2CWPA

Crystal structure of metrs related protein from pyrococcus horikoshii
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
109
structure length
109
Chain Sequence
MELYDVDEFWKFQMKVGLVKKAEKIKRTKKLIKLIVDFGNEERTIVTGIADQIPPEELEGKKFIFVVNLKPKKFSGVESQGMLILAETEDGKVYLIPVPEEVPVGARVW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of MetRS related protein from Pyrococcus horikoshii
rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
molecule keywords MetRS related protein
total genus 22
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2005-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01588 tRNA_bind Putative tRNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2cwpA00
3PGZA 3A5UA 1K8AC 3AFQA 4BXXG 3BZKA 1FVIA 1QVCA 4BY7G 2HIVA 4BY1H 1WJJA 3BZCA 4DNIA 2NZOA 3Q8DA 4JG2A 1TXYA 1PFSA 4MNOA 2WFWA 4GNXC 4A4IA 2Z6KA 4BBRH 1PYBA 2MQHA 2VW9A 1XPUA 1QVFA 1T9HA 3CPWA 2HT1A 1LTLA 4B3SQ 1PH7A 1CKNA 1I50H 2EIFA 3TS2A 1XNRL 4Y7NH 5IWAQ 1VQDA 1I5FA 4P74A 3UE1A 1VQ7A 4IPDA 1Q7YC 1K9MC 2JA6H 1N36Q 1MIUA 1S3OA 4B3RQ 1RIPA 3CCMA 4A3FG 4LF4Q 4JI0Q 3HKZE 4JI7Q 1C9OA 1MKHA 4HIDA 2YYZA 2C35B 1E7ZA 2MNAA 2ZJQA 1PH8A 2E2IH 4A3JG 3B6YA 4APVA 1UWVA 4B3MQ 3CD6A 3UE0A 1VQAA 5M3MH 1Q8KA 2IHEA 4A93G 1YIJA 3G48A 3RLNA 1WI5A 3K80C 2L15A 1KHIA 4GLAC 4P72A 5IYBH 1VQ5A 3S2HH 2OCEA 4A3EH 2JA5H 5H1SE 2JJQA 3STBC 1YI2A 4HJ9A 2GVBA 2IX1A 1G291 1E24A 1L1OA 3I4OA 4IJHA 1K83H 1KRTA 3CF5A 1KAWA 5LMUL 2WP8J 3U4VA 4A76A 2R7ZH 2JEBI 1Z9FA 2JK8A 4PZ6A 4A3IH 4H02A 4B3TQ 4JI0L 1X3FA 2MO0A 1QZHA 4JI4L 1L1OB 3EIVA 4MTNA 3GTLH 4B3ML 1PYSB 4A3IG 4A3CG 1P16A 2HIXA 4DV3Q 4LFBQ 1X55A 1IYJB 1U0LA 1Y14B 4LWCA 3HOVH 2R7DA 4JI1Q 1JMCA 3PUZA 3AQQA 3GTMH 3HOYH 3ERSX 3AYHB 2UXBL 1TWFH 4P71A 4JI6Q 1YJ9A 3E0EA 2FXQA 1VQ4A 2R92G 4GS3A 1N33L 1SN8A 1E3PA 2MO1A 3A0JA 4X6AH 2UXCQ 2HHHL 2PMZE 4HIMA 1NBWA 3J7ZC 1XMQQ 2E5LL 2K52A 3TRZA 3F8TA 3NEMA 1YVCA 2IT1A 4JI8Q 3H0GH 1D7QA 4GKJQ 3KYHC 2WB1E 4QY7A 4LUOA 4DV3L 1HZ9A 2I5MX 3EBEA 1SRUA 4DUYQ 3HOXH 2A19A 1OXVA 4IOAA 1YHAA 3CQZH 4JBKA 4LF5Q 3OYYA 2AMCB 1IBMQ 3RNUA 3U4ZA 4NPSA 4DPGA 1WCMG 4O0AA 3TREA 1J5EQ 4A3GH 3ULLA 1XNQQ 5GQOA 3S2DH 1FL0A 2HQLA 2D0PA 3J81i 5FJ8H 1SR3A 4HJ8A 2B63H 3SGIA 3ZJYC 4JV5Q 2VUMH 2DUDA 2AWOA 1OXTA 1IBLQ 3I2ZA 5M3MG 1OXSC 1I94L 3M7NA 3K8AA 3RLOA 4JI3Q 3JAMc 3T1YL 4LF9Q 2JEAI 5IYDH 3PIOA 3PV0A 4R4CA 1CSQA 3OTOQ 1BBWA 1N34Q 3W1GA 3UDGA 4GOPC 3J80i 3DM3A 4A3DG 1Q1BA 3LGJA 1OXUA 4Y52H 4X62L 1Q81C 3NBHB 3ULJA 3ULPA 4JC0A 2A8VA 1VQIA 1J5EL 1FJGL 2E8GA 1EUJA 1X54A 5IY0A 5IP7G 4X64L 4DR5L 1JE5A 1PH3A 1VQEA 5ELOA 5IYCG 4ALPA 3S15H 4BBRG 4UY8C 2VNUD 3AFPA 3S24A 1EWIA 5C4JH 1VQCA 1XJVA 1I94Q 2UUCL 5FLMH 3TS0A 5IYCH 5M3FG 4A3GG 3M4QA 4DR2Q 1HNZQ 3CP0A 3CC7A 1HJPA 1U5KA 4UP9A 3S1RH 3PF4A 3CC4A 1N34L 2R7FA 5C44G 1X3EA 5J3BA 3KF8B 1EIFA 1NTGA 2PI2A 4DV5L 1ASYA 4P75A 4A3LG 4K0KQ 1CSPA 4OO1I 1X6OA 2WAQG 4YWMA 4HIOA 1PH4A 1XTDA 2RHQB 3KFUA 1W2BA 3CAMA 1SROA 4TVAB 5IYDG 2LXJA 1PA6A 4X64Q 4DR5Q 4IFDG 4XTCS 5C0XG 1GKHA 3M85A 2Q2TA 3FKIG 2F4VL 1I3QH 2F52A 3DLLA 2N78A 3W5OA 4JI2L 1BKBA 4NXNL 3GD7A 2QGQA 4YWLA 3EN2A 4GN3B 1C0AA 1A63A 1Q1EA 1V1QA 1VQ6A 4LW1A 4O2DA 1CKNB 3GO5A 5LMUQ 1H95A 3J80c 1S72A 1EYGA 2H5XA 1VQKA 4L5SA 1A0IA 4DV6Q 3HKSA 4LF4L 4OXPA 4JI7L 4JBWA 3E9HA 4C3IH 3HOWG 1HZBA 1YJNA 2LSSA 4BA2I 4GN5A 4A3BH 4X66L 2I0QA 3JC66 3NENA 1PH9A 1N32Q 2F3IA 2Q2UA 2CCZA 2F4VQ 5HY6A 4OX9Q 3KF6A 1D8LA 4XIGS 1KIXA 1E22A 1TWCH 1VQMA 2YU9H 5GADC 4DV4L 2Q2HA 1MJCA 4P73A 2KBNA 5AJ3Q 2ZJPA 4JYAL 2NVYH 1YZ6A 4JI6L 2Y0SE 1VS0A 3G6EA 2K4KA 2ZTCA 4DAYB 4DV1Q 2D62A 3S17H 2UUBQ 2ZM6Q 4DV6L 4FDBA 2OWOA 1QUQB 5LMNQ 3PO2G 3PO3H 3H3VI 4IFDI 4A3KG 1WYDA 3H0GG 1HR0L 4PZ8A 2K5HA 3M9BA 1K73C 1N32L 2ZTEA 2VQEL 4A3FH 2K14A 1VQ9A 2PI2E 5C44H 1KXLA 4IPHA 2PQAA 5C4XH 2IX0A 1NMFA 1YNXA 4OONA 4RG1A 5GROA 2QA4A 4HIKA 4LFAL 1CKOA 2KHIA 4A3EG 4NXML 1P8LA 3CCJA 5JEAJ 1PH6A 2I5HA 3RR5A 4WJ4A 4LUVA 1L1OC 4DV0L 1M1KC 4JI3L 2UUBL 3T1YQ 1LUZA 4LF9L 4DUZL 4AYBG 2CKZB 4AQYQ 1N33Q 2ALYB 3F1ZA 3STBD 3UDFA 2UXCL 5JJIA 4GOPA 2JA7H 3S14H 5ELNA 3PF5A 3K7AH 2XGTA 4JI8L 2PNHA 4LF6Q 2VQFL 2EQSA 1VQOA 3RZDH 4DR6Q 5DLQE 1L0WA 4DUYL 1SMXA 1Q82C 1TWGH 3PUYA 2JQOA 1FJGQ 2ATWA 3S1MH 3S1QH 2OTJA 1VCIA 5K36G 2CQOA 3CPFA 4AYBE 3L0OA 2UXDL 2KENA 4RMFA 4LFCL 4YY3L 5FLMG 5JJKA 4DV0Q 1VQGA 2JA9A 5C3EH 1IBLL 4OWWB 3CCQA 1HNZL 1Y1WG 3H3VH 3KDFA 1N9WA 2NN6I 1X9NA 1JJGA 5GAHC 2YTVA 5EAYA 2Q2IA 4BY7H 3F2DA 4BY1G 4LF6L 1AE3A 1E1TA 4R4IA 2ID0A 4PZ7A 4DV5Q 1PH1A 1JJ2A 3ICEA 4DR6L 2K50A 2RCNA 4YHHQ 1XMOQ 4A3DH 1B7YB 1QUQA 2I5LX 3PSIA 4DV2Q 1UEBA 1VQJA 4L5RC 4ME3A 4DR7L 1NJIC 3U50C 3PIPA 4YCVA 3VDYA 3UDXA 3KJOA 4DK6C 4JOIA 5IP9G 1M90C 3L2PA 1BBUA 2UU9L 2VUMG 3BU2A 2B63G 1YHQA 4EQ5A 5IE8A 1CUKA 4JI5L 3KDFB 4OWXB 1WCMH 3PUXA 3G71A 2BA0A 5C4XG 2CWAA 3K7UC 1IL2A 5BR8L 5C0XI 4YCWA 3S1NH 4UP8A 4K0KL 2R6GA 1KRSA 4DV2L 1IBKQ 1B70B 3I7FA 1SLJA 3D0FA 1ASZA 4LNQA 1Q46A 1QVGA 3K0XA 1VQHA 3CMEA 5M5YH 3RN5A 2K75A 2NVTH 1G6PA 3PO3G 2CFMA 1RL2A 1J6QA 2ZTDA 4PG3A 3CXCA 3FP9A 2JA7G 2UUAQ 4JBMA 1W3SA 4KI0A 1V43A 3GTOH 3HOUH 4IPCA 1VQ8A 4NXNQ 4JYAQ 4GLVB 2RHSB 4QGUA 2BH8A 4LFBL 5JJLA 3PUVA 4A3MG 3J7A5 3H15A 1G51A 1NY4A 2K5NA 2KHJA 1HZCA 2OQ0A 4A3MH 1HNXQ 1GO3E 3WWVA 2KCMA 5LMNW 1UE5A 3CMAA 4R1JA 4NB3A 3HOXG 1XMQL 4POGA 5GAGC 1PV4A 2YTYA 4TQUS 2R93G 1HZAA 4GNXB 1V9PA 1OTCA 4GKJL 2E5LQ 1Y1VH 4DR1L 2PQAB 1C7YA 1YBYA 4L5TA 4OX9L 1LM0A 4JCVE 3J81c 4LFAQ 4GKKL 4R4OA 3TQYA 4BA1I 1XMOL 4DR3L 1SFOH 2R92H 3S16H 2Z6KC 2E2JH 4GNXA 1FGUA 3KOJA 4KHZA 1VQLA 2VL6A 4LF5L 2IHFA 1K0RA 4DV1L 3BJUA 3L7ZC 4GLXA 1NMGA 2K5VA 5IYBG 5C0XJ 3MXNB 4HJAA 3IRBA 2ZM6L 5IP9H 2GVAA 5LMNL 2N3SA 1HH2P 1GD7A 3CC2A 4B3SL 3M4OH 4A3BG 4DR4L 5IT9c 1HR0Q 4BBSG 2JE6I 4IO9A 3T1HL 1Q12A 2OQKA 2VY3A 5IWAL 1KQSA 4LF7Q 2YTXA 3CW2C 4X62Q 3J81j 2JA6G 3OTOL 2IY5B 1VQBA 3FHWA 2B3GA 3K81C 4DR3Q 1EQQA 1I6HH 1HNWL 3PCOB 3F2CA 1KL9A 3RLFA 1WFQA 1O7IA 4YY3Q 1HR0W 2JA8G 1JT8A 4J15A 1A62A 4QJFA 1Y1WH 4A75A 2LXKA 2N8NA 2OTLA 3G4SA 4DR2L 1SE8A 4KLKA 1VQPA 1R9TH 4HJ7A 3FKIH 5GAEC 2ZJRA 2N49A 2UUCQ 4R4QA 1XPRA 5IP7H 4YHHL 4QL5A 2VQFQ 2Z0SA 3D31A 4JBJA 4IOCA 3I4NG 4BXXH 1X65A 1XNRQ 1BVSA 3W1BA 3UDIA 4MZ9A 5HGQA 3I55A 4C3HH 4IJLA 4B3TL 1N36L 4B3RL 4GN4B 3ER0A 3I4NH 3GTKH 4JI4Q 4A3KH 2NN6G 1X3GA 3CCEA 2R93H 2UXDQ 4BBSH 3KLWA 2UU9Q 4LFCQ 3RN2A 3PO2H 4JI2Q 2NZHA 5M3FH 1AH9A 1Z47A 3I4MG 4OWTB 1XPOA 1K8GA 3GTJH 3HOWH 3HKZG 5C3EG 4UP7A 4X65Q 2AKWB 3KF6B 2ASBA 2GN5A 4WJ3M 1KC8C 4DAMA 1S40A 4LF8L 4YWKA 2JA8H 1IZ6A 4AH6A 4POFA 5E7NA 3HOUG 1GM5A 2D0OA 4HJ5A 3M3YH 1UE6A 3TEHB 1OXXK 2HHHQ 3GDEA 1MJEA 3NELA 4DR7Q 2Y0SG 3A74A 2KCTA 4YCUA 3JAMi 2UUAL 1UE7A 5M5WH 4UPAA 1YJWA 5JEAG 4X66Q 2VZAA 2BH2A 1WOCA 1PVOA 2A1AA 5AJ3L 1PH2A 2CWPA 3M4PA 3OW2A 1X56A 4X65L 3U58A 1YEZA 4OO1G 4DV7Q 1DGSA 5FJ8G 4DV4Q 4JI5Q 1IBML 1GVPA 4JI1L 4GOPB 3HOYG 4LF8Q 4KHPQ 1VQFA 5M5XH 2NVQH 1A8VA 4QIWE 5FLXc 1XNQL 1K3RA 4DKAC 4DK3C 2AWNA 1KD1C 1TWAH 5BR8Q 1PHJA 3HOVG 2UXBQ 4C2MH 2XTIA 1YITA 4AIMA 2DGYA 4A3CH 1UE1A 3PUWA 4C3JH 4PMWA 4DR1Q 2E2HH 3HOZH 3HFZB 2NVXH 1Q86C 4IFDJ 1Y1VG 1L2FA 1QZGA 4GKKQ 1EQRA 3HOZG 2B29A 2V1CC 1EIYB 2R7ZG 2VQEQ 2MFIA 1LYLA 2BA1A 4L5QA 3E9IA 2AHOB 3GTGH 1TWHH 4DV7L 1YHBA 2QEXA 1JB7A 1EFWA 3CCSA 2ES2A 3CCRA 2WB1G 2VS1A 4IPGA 2WAQE 1PH5A 2JA5G 3CCLA 3GTPH 1VQNA 4AQYL 1HNXL 4NXMQ 1EOVA 3KJPA 1B8AA 3MEFA 4DR4Q 4QQBX 2YV5A 4A93H 3GTQH 3I4MH 3CCVA 4KHPL 3T1HQ 4EX5A 3I56A 4JV5L 4DUZQ 1IBKL 2EXDA 1IXRA 2RF4A 1JJCB 4LF7L 4A3JH 3AEVA 3RZOH 4LUZA 3F2BA 4R4TA 1E1OA 1AE2A 1CKMA 4JOIC 3CCUA 4A3LH 1N8RC 1HNWQ 1NE3A 3A5ZB
chains in the Genus database with same CATH superfamily
3PGZA 1K8AC 2OXPA 1PTOB 3OPOA 4BY7G 3M7GA 1C8CA 3GP7A 4JG2A 1PFSA 5C3WA 4A4IA 1PYBA 1XPUA 4B9XA 3HEJA 1T9HA 1CKNA 4Y7NH 1VQ7A 1VQDA 4P74A 4IPDA 2KA7A 1MIUA 1S3OA 1IW7C 4HTHA 1NR4A 2QDBA 2CW0C 1F2ZA 2FFKB 1K8OA 1AW7A 3QOLA 4APVA 2GA4B 1Q8KA 5IGGA 3ONAB 4NMZA 2SEBD 3G48A 2F0JA 3VA7A 2PCFB 4QIWB 1KHIA 1I6VC 1II3A 1VQ5A 3NPPA 4A3EH 2FHTA 2O4XA 5H1SE 3STBC 1O78A 2G9DA 1E24A 1L1OA 5KRUA 3K6OA 4JI0L 5DAUA 3P7JA 2MO0A 2HUGA 3AB9A 1L1OB 3K5NA 4JI4L 3GTLH 1PYSB 1IW7D 2HIXA 4CDCC 2E2IB 4JI1Q 3PUZA 1CM9A 1Q90A 2ENBA 1BBXC 1YJ9A 3GTKB 2QKIC 2X6LA 1M8AA 3OSOA 1SN8A 3A0JA 3T53B 1N33L 4X6AH 1UEAB 3SEBA 2PMZE 3TRZA 2K52A 1F9SA 3I3CA 1DYQA 1D7QA 3KYHC 4DV3L 1J9OA 1HZ9A 4H13C 3E3XA 3L9AX 3I4NB 4RHRA 4CJ0B 1JOOA 4O0AA 3ULLA 3S2DH 3J81i 1K8MA 4HJ8A 5JAVA 1STGA 3ZJYC 3NQIA 2AWOA 1YNJC 3I2ZA 3RLOA 3JAMc 1CQVA 2JSOA 2JEAI 1B3AA 2RDHA 1T5EA 4ZKBB 3PIOA 2X69A 1VF7A 1EOTA 2F03A 1N34Q 3W1GA 3UDGA 3NP8A 3VYTA 1SYBA 4A3DG 1Q1BA 4IUPA 4JPBW 5CV9A 3K58A 2B2TA 3TP8A 1DCZA 2A8VA 1XYIA 1PH3A 1EUJA 1B53A 2XIWA 3NWSA 3KK7A 4ALPA 3S1RB 4UY8C 2VNUD 3AFPA 5C4JH 1EWIA 1XWEA 1ENCA 2HDMA 3BDOA 5M3FG 3SE0A 3S15B 4K5XA 1H9JA 2KVMA 2R7FA 3G7LA 5J3BA 1E0BA 4DV5L 1CK1A 2WAQG 1PH4A 2B2VA 3SK4A 3CAMA 5IYDG 2LXJA 3EVQA 4M8AA 3M85A 3EROA 1G2TA 3BS1A 3TZDA 1BKBA 4YWLA 4L63B 1A63A 4X3UA 4QUFA 1Q1EA 5CV8A 4LW1A 4O2DA 1CKNB 3J80c 3N6RA 2RDGA 4QUCA 2CHBD 1BR9A 1ILQA 2H5XA 5LHY1 1A0IA 2J0TD 3CQZB 3TSSA 4C3IH 2V4DA 2LSSA 4BA2I 4X66L 1TY2A 2TMPA 5D14A 2I0QA 3JC66 1LT4D 3BZDB 5IGBA 5HY6A 4XIGS 4DV4L 2Q2HA 2F0FA 2IX3A 2KBNA 2NVYH 3TZUA 3QB3A 3VR2A 5CBEE 2NYZD 2D62A 1A3TA 4K2KA 1G2SA 1PZKD 5TSSA 1PRTD 4FDBA 3T51B 4K5VA 1QUQB 3PO2G 2EY2A 3H0GG 4PZ8A 1S4ZA 2J7ZA 1MI2A 1JWMD 1K73C 1Y1WB 3K57A 1H9SB 5C44H 3H0GB 1KXLA 3OMGA 3S1MB 1B3QA 1NMFA 1YNXA 3FPPA 4RG1A 1QWYA 1E2WA 3J81L 3NE5B 4V190 5JEAJ 1PH6A 1ZKOA 2DNEA 1L1OC 4DV0L 2UUBL 4A93H 1ML0D 4AQYQ 2CKZB 2ALYB 3UDFA 3MFGA 1WTQA 5JEAH 4RGNA 5ELNA 2HCIA 3PF5A 4ABNA 3K7AH 4U68A 3FDTA 1BQQT 2VQFL 1VQOA 1FNWA 4DUYL 1WD1A 1SYDA 1LT5D 2ATWA 3S1MH 5K36G 3S1QH 2AQ1B 2CQOA 4FF1A 3CPFA 2K5DA 4RHSA 3M3YB 1IKLA 4UHVA 5E1FA 4YY3L 4LFCL 2UXDL 5JJKA 5ISRA 1DD2A 1UUPA 2JA9A 1IBLL 3CCQA 3KDFA 5EAYA 5NUCA 2Q2IA 3U9OA 1AZPA 4LF6L 1I4GA 2ID0A 4KMUC 4DV5Q 2MJ8A 1EZ6A 1WTOA 1B7YB 1QUQA 2O2LD 1UEBA 4L5RC 1B50A 1NJIC 2LKVA 3FEWX 3UDXA 3KJOA 4DA2A 4IUTA 2Z1CA 2F0QA 3OWFA 2B63G 1YHQA 5IE8A 5EKLA 4OWXB 2BDOA 1WCMH 1JWSD 2BA0A 5C4XG 3A7LA 4YCWA 3JAML 4K0KL 1X3PA 1HUMA 1B70B 1SLJA 1Q46A 1TT2A 1U9RA 1QVGA 3H94A 4KD4A 4QF4A 1AP0A 2NVTH 2CFMA 1RL2A 3GV6A 3CXCA 4DF7A 2UUAQ 4KI0A 1ICWA 2QEJC 4NXNQ 2F1MA 4XDXA 5E4WC 2RHSB 4QGUA 5JJLA 3P1HA 2K33A 2OQ0A 5FKAC 2CQAA 1EY9A 1GO3E 4POGA 4R1JA 3HOXG 1TQOA 2R93G 4ID6A 1TS2A 2R92B 5M5WB 3HG9A 3J81c 1A6XA 3TQYA 1XMOL 1SFOH 4KHZA 3KOJA 2VL6A 4DV1L 1A2TA 3NXWA 3R3OA 2RVLA 2RCFA 1KNAA 3IRBA 5IP9H 2GVAA 5LMNL 3CC2A 1SE2A 3GQBA 3T1HL 2OQKA 2VY3A 2AQ3B 4CKEA 5M3MB 4ULLA 1KDAA 5AFWA 4X62Q 2JA6G 2IY5B 1VMCA 4DR3Q 4BY1B 2A73B 3F2CA 4YY3Q 1WFQA 4IQZA 2WINB 5E4XA 2JA6B 4J15A 4QJFA 1Y1WH 4CJ2C 4KLKA 3K5OA 2F0NA 3FKIH 5I9OA 2ZJRA 3LX0A 4LAAA 1SNCA 3SXHA 3R93A 1HUNA 3I4NG 3PMFA 1U4LA 3MWYW 4C3HH 4IJLA 4B3TL 1EU3A 3OOCA 1IYUA 2MPMA 4M1UB 3CCEA 4ZUIA 3E5SA 5M3FH 1AH9A 2EVBA 4EVOA 1STEA 5C3EG 4UAIA 1PRTC 3FKIB 5IGEA 4DAMA 5EJWA 1K83B 3DM1A 2L5TA 1S5CD 2XN9C 3HOUG 4MTKA 2PPBC 1BOSA 4HJ5A 3CU7A 3GDEA 2Y0SG 2G5DA 3A74A 4YCUA 1LLRD 1ILPA 1SNDA 2UUAL 1UE7A 2F0UA 4X66Q 1WOCA 2NWGA 5KNCA 1HCZA 3H3VC 3E0JA 3OW2A 1X56A 2F0LA 2NZ1D 2RQXA 1DGSA 4DV4Q 1IBML 4LF8Q 5M5XH 2F0WA 5FLXc 4Y7NB 3HOVG 2K5WA 1YITA 4AIMA 1HHVA 3S14B 3HOZH 3EFXD 4FNFA 4RAUC 1EY7A 2H4OA 2HD3A 1GXDC 3NK9A 3HOZG 1EIYB 4XQNA 1L0XB 5J39A 4L5QA 3WOFA 2AHOB 5IGDA 1YHBA 4H44C 3ERQA 4K6DA 2A6HD 5LL6X 2QEXA 2ES2A 3CCRA 3HOXB 3GTOB 4IPGA 2WAQE 3CCLA 1VQNA 3NBHA 1B2TA 2Z9HA 5F2DA 3T1HQ 4EX5A 4JV5L 4CJ1B 1MHWC 2EYHA 3NTHA 4MHEA 3HOWB 4WFN3 2F0KA 1ET9A 3RZOH 1RODA 4R4TA 4A3GB 1EY4A 1HXYD 4OGQC 1NE3A 1NUCA 1LTRD 3BVMA 4JK1C 1EZ8A 3BZKA 3BYTB 5I2XA 2R3ZA 2NZOA 2NUCA 2E2JB 2VW9A 5EPLA 3TBIB 2B8FA 1TWGB 4PMBA 2F0MA 5CR3A 4G4KA 3I4MB 5IWAQ 1Y8OB 3UE1A 1K9MC 2K32A 2JA6H 2JA5B 4LF4Q 3D8GA 4O1NA 3HKZE 4JI7Q 1C9OA 3A55A 1MKHA 2KUMA 1E7ZA 2ZJQA 4A3JG 4HR7B 2NVQB 3VA5A 4B3MQ 5M3MH 1CA6A 2EJFC 3RLNA 1WI5A 1QE6A 2SNMA 3K80C 2RSOA 5KNBA 4DAVA 4GLAC 4P72A 3M4OB 3SVMA 1KABA 2JA5H 3QO2A 1GJXA 1RD9D 2JJQA 4HJ9A 2IX1A 2EYJA 1SSOA 1TWAB 4IJHA 1KRTA 3CF5A 5LMUL 1KAWA 3U4VA 2JEBI 1Z9FA 2JK8A 5DM73 3ND8A 1X3FA 1QZHA 4KV6A 5C4JB 4A3CG 4C3JG 1X55A 1IYJB 1Y14B 4LWCA 5FLXL 1GUNA 1DM0B 1TKWB 3AQQA 2ICEC 4YIJA 1PZJD 3ERSX 4IUNA 1LT6D 3E0EA 3NBIA 5I6YA 1E3PA 1EFID 2UXCQ 2E5LL 4HIMA 3P20A 1SDFA 4BBRB 1YVCA 2IT1A 4JI8Q 4L6TB 1KTKA 4LUOA 1A15A 3OWEB 1STNA 2A19A 2F0VA 2K1BA 1DZ1A 5I4DA 4LF5Q 4NPSA 2WIIB 3V96A 3TREA 1J5EQ 1KLGD 3DEOA 2HQLA 2B63H 1SR3A 3SGIA 2X6GA 3MFYA 4JV5Q 3QIAA 2VUMH 3M7NA 1I94L 4LF9Q 3HOZB 1KAAA 5IYDH 1B4OA 3HKZB 4R4CA 1CSQA 1H9KA 3DWQA 5BN3A 2B2WA 4G7HC 1OXUA 4RGMA 4X62L 3NUCA 1Q81C 5ELCA 3ULJA 3MXNA 2IW3A 3X3MA 4HAEA 1FJGL 2E8GA 3V05A 3A8KE 5IGFA 2F3WA 3HP3A 3TS0A 1C48A 4A3GG 3CP0A 2L9HA 1NR2A 1U5KA 4UP9A 2NN6H 1ENFA 5BN4A 3PF4A 3CC4A 1R4QB 1X3EA 3KF8B 2K28A 1NTGA 3K0YA 1Q3LA 2PI2A 4OO1I 4P75A 4FXKC 1CSPA 3PO3B 1STAA 5EKIA 3TP6A 3D6CA 1W2BA 1SROA 4ZYSA 4GZYC 5A2QE 3DWAA 4X64Q 4DR5Q 5D3DA 4IFDG 4XTCS 1GKHA 4TKOB 1RKNA 3H09A 3ITPA 3KUPA 3FKIG 4WRDA 2F4VL 2B2YA 1Y1VB 4F7XA 2N55A 2QGQA 2AUKA 2K03A 2F0OA 1V1QA 4F88A 5LMUQ 1H95A 1S72A 2BCOA 1PTOC 4L5SA 4DV6Q 5KYIA 4JBWA 3E9HA 3S1NB 1D5MC 1S5FD 1SAPA 1N32Q 1PH9A 2SNSA 4OX9Q 1KIXA 2YU9H 5LL6S 5DNFA 3WDNA 1MJCA 1WTXA 4P73A 3WOEA 4JYAL 1YZ6A 1VS0A 2K4KA 2ZTCA 4DAYB 2K5QA 2K01A 1WCMB 3PQIA 1S5ED 3DHQA 3H3VI 1Y8NB 3OIPA 5J1ZA 2VQEL 2K14A 4CDDC 1VQ9A 1D5ZC 1DXMA 3J7AF 1AEXA 4HIKA 1CKOA 2KHIA 4NXML 4XYQA 3CCJA 1H9MA 2I5HA 4WJ4A 2K7VA 4LUVA 3HOWG 1M1KC 4LF9L 1N33Q 4AYBG 4ZLTF 3Q23A 2ICIA 4A93B 1LACA 5CYUA 2PNHA 1GUTA 2EQSA 4IUUA 1K28A 4X3KA 1Q8IA 3MXUA 1Q82C 1TWGH 3PUYA 2JQOA 5IIFA 1FJGQ 3D6WA 5C44B 3TMEA 3OHXC 3L0OA 1HA5A 2KENA 4RMFA 1TVXA 1Z7TA 1EY0A 2JXMB 1Z6HA 4OWWB 1LTSD 2NN6I 5CORA 1X9NA 1JJGA 5GAHC 2M00A 4BY7H 4BY1G 3GTJB 1PH1A 2ZXOA 4DR6L 2RCNA 3T56B 1CT1D 2WB1B 2I5LX 3PSIA 3KLRA 4BWGB 4DV2Q 2VB3X 3S17B 1VF5C 4LMQD 3VDYA 4DK6C 2RDFA 4N9TA 5JVG3 3L2PA 2VUMG 3BU2A 2J4XA 3VYSA 2Z4IA 1CUKA 4JI5L 1A3UA 3CRLC 3KDFB 3G71A 4R8NA 3J80E 1IL2A 1IL8A 5C0XI 2K04A 4NDXA 4UP8A 1KRSA 2R7ZB 3K0XA 1VQHA 3KLSA 4LJZC 2K75A 1G6PA 3PO3G 1CZWA 4PG3A 1JQYD 3GTOH 1V43A 1G6ZA 4IPCA 4JYAQ 3S16B 5CBAE 2BH8A 4OIKA 3A8JE 1NY4A 2K5NA 2SDFA 1SEBD 4A3MH 3W3AA 1I4RA 1UE5A 3CMAA 3I91A 2CVRA 3NSWA 5A2QL 1OTCA 1CHQD 4GKJL 1WTRA 1Y69U 2E5LQ 5C4HA 3F2UA 2B2YC 3KLSX 1XXGA 5COYA 1IHZA 2CH4A 3S16H 2EPBA 2E2JH 4B9WA 2E76C 3IKJA 3VR6A 4LF5L 1HTPA 5C0XJ 2F0DA 3A7AB 4BBSB 4KKSA 1B9NA 3JAME 3C1EA 2AQ2B 2N3SA 4B3SL 1BCPB 3KBXA 4XQJA 4V0BA 2A69C 4BBSG 2JE6I 1DOMA 1I4QA 5EGTA 1HQMC 1KQSA 2XVSA 4LF7Q 1STHA 3TDQA 1SYFA 3R8BA 3K81C 1EY6A 1KL9A 2JA8G 3BYYB 4ZCKA 3VYUA 2N8NA 2OTLA 3G4SA 1JCKB 3TN2A 1R9TH 1SJED 4HJ7A 2N49A 1XPRA 5IP7H 2VQFQ 3DXJC 2EDGA 1AN8A 1SMYC 1X65A 3UDIA 4C3HG 2PMZB 3I55A 1CI3M 1N36L 4B3RL 3GTKH 4C3HB 1D5XC 2UXDQ 2MGSA 4BBSH 4LFCQ 3I70A 4RGOS 3I73A 2B39A 3M4YA 3X3NA 4L8JA 3R2TA 4OWTB 3GTJH 3HOWH 3HKZG 2HQEA 3KF6B 2ASBA 3QWNA 3NHHA 4KY6A 2JA8H 3DWPA 2PZWA 1IZ6A 1HPCA 4POFA 5EBCA 1UE6A 3GTGB 2HHHQ 1SYGA 5JVH3 5C3XA 3NELA 4ZRZA 5ELDA 3JAMi 2IJ0A 4TRDA 2IPKD 5M5WH 4UPAA 2QDLA 1ESRA 3BDLA 1PVOA 2A1AA 1PH2A 1EEID 2CWPA 3U58A 1CQFA 4X65L 1YEZA 4OO1G 1BO0A 1TY0A 1BXTA 3NWTA 3HOYG 2D9UA 4C1NK 1V1PA 4EQOA 1A8VA 1XNQL 1K3RA 4DKAC 4DK3C 4IUQA 4OO1H 2UXBQ 4RGTA 2DGYA 2DJFC 3C2PA 1UE1A 2F0PA 5C5LA 1L2FA 1QZGA 3OW7A 2EXZA 2XWBB 3S9WA 2JA8B 2B29A 1TR5A 2V1CC 2R7ZG 2VQEQ 2MFIA 3J81E 3OMCA 2A6EC 2P5ZX 3E9IA 3V2TA 4FF3A 1FGBD 1TWHH 4CBVA 5C6AA 4DV7L 3GTGH 1JB7A 1EFWA 1TU2B 3CCSA 2FJ2A 3HOUB 1ET6A 3GTPH 4NXMQ 3H6MA 3A56A 5A35A 2YV5A 2ZT9C 5ELEA 1EYAA 3DMUA 1IXRA 2QCPX 4LF7L 2LY7A 5CGKA 2A69D 1CKMA 4JOIC 3EQLC 3CCUA 4A3LH 2EY5A 4OEMB 3A5ZB 1XMOQ 3GTQB 2NVYB 2L12A 1IYVA 4BY1H 3BZCA 2L55A 1SBBB 3EJIA 2ZXPA 2WFWA 4MNOA 4ME5A 3Q6SA 2A6ED 4BBRH 1LTID 2MQHA 4B08A 1QVFA 1LTLA 1PH7A 3FVQA 1R4PB 3TS2A 3LWEA 1I5FA 4ZQ3A 2Q8TA 1Q7YC 1MBYA 1N36Q 1F77A 4B3RQ 1RIPA 3CCMA 1L0YB 4JI0Q 1WTVA 2MNAA 1PH8A 3DEPA 1EY5A 1UWVA 3Q22A 4QCLA 3NTIA 3UE0A 4A3DB 1VQAA 4A93G 1YIJA 1F9PA 2BE5D 1CTMA 1PFMA 3S2HH 4K6LA 3I4OA 1K83H 2WP8J 2DY7A 2PO4A 4A3IH 4B3TQ 3FPUB 1TS4A 3EIVA 3T16A 4HMJA 4A3IG 4A3MB 1KNEA 1P16A 4DV3Q 2CW0D 1ESFA 1U0LA 5EPJA 2B2UA 1BF4A 1JMCA 4NW2A 1LTGD 3GTMH 3HOYH 2UXBL 4PQXA 4P71A 1EYCA 1PFBA 2IL8A 1RTOA 1O7ZA 2MUYA 2KECA 1GHJA 1GUGA 2C5CA 1NBWA 1WTPA 2A5HA 1PRTB 4GKJQ 4QY7A 1X32A 3GTMB 3HOYB 3EBEA 1GUSA 1CA5A 3HOXH 4F87A 1OXVA 1YHAA 3CQZH 4C3IB 2R61A 3OYYA 2AMCB 1IBMQ 3U4ZA 1WCMG 4A3GH 3GV3A 5GQOA 1D2BA 1QCBD 2D0PA 2FMCA 5FJ8H 2EY1A 1OXTA 4P2CB 1OXSC 1SNQA 3R2IA 1CFMA 1CHPD 5T1GA 2XRQD 5C3EB 2RSNA 3BVZA 1S5DD 1BBWA 1QB5D 3J80i 3DM3A 3BDCA 3LGJA 4Y52H 3SR1A 1WTWA 3ULPA 1VQIA 4A3BH 5IY0A 3IAYA 2C9OA 1JE5A 1VQEA 5ELOA 5IYCG 3PIO3 3S15H 4DAPA 4BBRG 2L11A 3S24A 2UUCL 1YNNC 1XJVA 1K3BC 2LS01 5FLMH 5IYCH 2F4IA 2KCNA 1EIHA 1HNZQ 3CC7A 3S1RH 1RTNA 3KBGA 1N34L 5C44G 4G7OC 1EIFA 2L4NA 1ASYA 4A3LG 1X6OA 4HIOA 3KFUA 4FXGC 4TVAB 1PA6A 3QJYA 2Q2TA 2WAQB 4RKBA 1I3QH 2F52A 2XWJB 5CMDA 3DLLA 3W5OA 3I90A 3EN2A 5E3FA 3VR5A 1JORA 1VQ6A 3GO5A 4NKLA 1EYGA 4IZ8A 4DFAA 1VQKA 4LF4L 3HKSA 4OXPA 4JI7L 1HZBA 1YJNA 1STBA 1FYCA 4GN5A 4C3IG 2Q2UA 3G6JB 3KF6A 1AZQA 3SK8A 1D8LA 1TWCH 1VQMA 2ZJPA 4JVZA 2Y0SE 3G6EA 1QG7A 1BDOA 1QJOA 1HRJA 4I7AA 2KCCA 3S17H 1I4XA 1FNUA 2UUBQ 2ZM6Q 4KD3A 5IT9L 5KIXA 2OWOA 3PO3H 3J80L 4IFDI 2E74C 1WYDA 1HR0L 4OIJA 2K5HA 3MZ5A 1BNZA 2KEDA 2ZTEA 4ODGA 2WV6D 2PI2E 4C1NI 1BUVT 4IPHA 4EQNA 2PQAA 2IX0A 4OONA 5J22A 5GROA 2QA4A 4LFAL 2NVXB 4A3EG 1EIGA 3LWUA 1P8LA 2WACA 4OL7A 1PMRA 3RR5A 2Q8IB 4KHPQ 3F1ZA 2UXCL 3STBD 4ZK9B 4GOPA 2JA7H 1O7LA 1IKMA 3RZDB 2NB0A 4JI8L 4LF6Q 1RDPD 1QOHA 4PV1C 1LTAD 1ICFB 5FK9C 2QILA 1NNXA 4DN4M 1YNND 4AYBE 4ZKCB 1UAPA 4KJNA 5I9PA 5K5PA 1VQGA 4DV0Q 5C3EH 2PZTA 4KKTA 4R8IA 1HNZL 2YTVA 2JA7B 2PYKA 3O13A 3NTKA 2EYMA 4R4IA 4PZ7A 2NTSA 5C4ZA 2K50A 4YHHQ 4A3BB 1I50B 4A3DH 1PTOF 1WD0A 4DXFA 4ME3A 4DR7L 3PIPA 4G57A 4JOIA 5IP9G 4G7ZC 4I65A 1M90C 2Y0SB 1BBUA 2E75C 2UU9L 1RCVD 1GUWA 2N88A 3FRPB 4EQ5A 2L0CA 4IALA 3PUXA 5G3LF 4K14A 3S2DB 5BR8L 3S1NH 1JC7A 3E6ZX 4RKLA 3K5LA 4LNQA 1ASZA 2B2TC 1PTOH 3CMEA 1J6QA 4A3EB 2PQEA 3HOUH 2PNRC 4GLVB 4CDEC 4DK0A 3PUVA 3J7A5 2A68D 4TSSA 3ZYYX 1HZCA 1JOQA 1HNXQ 3WWVA 2KCMA 5LMNW 1XMQL 4NB3A 5D3IB 3I4LA 1Y8PB 5GAGC 5FOBB 1PV4A 1U4RA 4GNXB 1V9PA 1SMYD 1SFOB 1MSHA 1YBYA 4L5TA 4OX9L 1LM0A 4JCVE 4LFAQ 4GKKL 1G91A 3MA2B 4DR3L 2R92H 1NAPA 5CC4A 2Z6KC 4GNXA 1FGUA 2OF1A 3DUZA 1VQLA 5IGCA 5CV4A 2IHFA 3BJUA 2K5VA 3MXNB 1KDCA 4HJAA 4F8MA 2OT2A 3M4OH 1GD7A 4A3BG 3A8IE 2FMMA 4RA8A 2YTXA 1HFGA 1VQBA 3FHWA 1EQQA 1I6HH 4RCNA 3RLFA 1O7IA 3ND9A 1JT8A 4KJOA 1V1OA 4A75A 2LXKA 3C1FA 4DR2L 1SE8A 1LTBD 2UUCQ 5HGTA 1S5BD 4YHHL 4QL5A 3D31A 4IOCA 4PMCA 4BY7B 5EBDA 1XNRQ 3TP5A 1I4PA 4MZ9A 5HGQA 3RMHA 3ER0A 3I4NH 4JI4Q 1KDBA 1X3GA 2R93H 4DAYA 2XNAC 2UU9Q 1EQTA 4JI2Q 3GTPB 1Z47A 1XPOA 4J1MA 1ZXTA 2F3VA 4WJ3M 1PZID 1R9TB 4LF8L 3I72A 2A74C 3H91A 4DNRB 2D5DA 1HQRD 3M3YH 3TEHB 5KNDA 1FR3A 4MIUA 1MJEA 2OEOA 2KCTA 2H1EA 4ZAIA 1LT3D 3NQTA 5M5XB 3VR4A 1O7YA 5AJ3L 3M4PA 5FJ8G 2CH4W 4JI5Q 1W6JA 1GVPA 3D3RA 4GOPB 1O80A 1VQFA 4QB4A 2NVQH 3CKIB 1AFPA 4LK1C 2LMCB 2PW5A 2XTIA 5EPKA 2E2HH 4E6IA 2NVXH 1SNPA 2F0HA 4KN4C 4IFDJ 2M9VA 3QOJA 4GKKQ 1RJTA 1FNVA 2EOTA 2TSSA 3LNNA 5G3LD 2ZXRA 1JWUD 5C0XH 2WB1G 2VS1A 3VYRA 4FYDA 3SK5A 4DK1A 1B8AA 3MEFA 3HZXA 2AUJD 4Q5VA 3CCVA 4KHPL 3I56A 2EXDA 5EQ0A 4J8QA 2F0EA 2Z8LA 3F2BA 4CHTB 1E1OA 1N8RC 2F0SA 3A5UA 2PW7A 3AFQA 4HEDA 4BXXG 5EKKA 1FVIA 1QVCA 1I3QB 2HIVA 1MSGA 4U673 1WJJA 3MTSA 4EQPA 4DNIA 4KHVA 3Q8DA 5CV6A 1TXYA 4GNXC 4H7BA 2Z6KA 2NTTA 2O5JC 3CPWA 2HT1A 4B3SQ 3T13A 1I50H 1SYCA 2EIFA 2F0GA 1LTTD 1XNRL 2MHVA 5CV5A 1PFNA 3MEHA 1TWFB 1DONA 1XTCD 5I6WA 4A3FG 2E2DC 1W6KA 4HIDA 4K8JA 2YYZA 5KGUA 2C35B 3J7YW 2E2IH 3B6YA 1V1PB 2A68C 3CD6A 4CGYB 1PYWD 4HCEA 2IHEA 3AMUA 2O5IC 2L15A 5IYBH 2OCEA 5I2YA 1YI2A 2GVBA 1KLUD 1G291 5K36H 1IBKL 4A76A 3D4WA 2R7ZH 1JR0D 1ONLA 4O42A 4PZ6A 4H02A 4PNYA 3K5MA 2SOBA 3S1QB 1B44D 4MTNA 1D1KA 4B3ML 2HCCA 4LFBQ 4A3KB 3Q24A 3HOVH 3MVVA 2R7DA 2A6HC 4AYBB 2Q8RE 5L37A 3AYHB 2KEEA 1TWFH 2R93B 4JI6Q 1BCPF 2FXQA 2JYOA 1VQ4A 2R92G 4CKCA 4GS3A 2MO1A 5D65A 2HHHL 1XMQQ 3J7ZC 4UDUC 3F8TA 3I8ZA 3NEMA 2B2UC 5ELFA 1MD2D 3H0GH 2WB1E 4CDFC 5M5YB 2I5MX 1SRUA 4JW0A 4DUYQ 2F0IA 4IOAA 3HOVB 4JBKA 3URYA 5KEEA 3BG3A 1EL0A 3RNUA 4DPGA 1SNMA 1XNQQ 1G8ZD 1FL0A 1HTLD 2DUDA 1IBLQ 5M3MG 4A3IB 3K8AA 4JI3Q 3T1YL 2E2HB 1J8IA 2G9HD 4Q0FA 3U9SA 3PV0A 3OTOQ 3K7AB 4GOPC 1QNKA 4HMIA 3QR8A 1HFNA 4XYOA 2EE1A 1SE4A 3NBHB 2XRSD 4JC0A 1SXTA 2EYPA 1J5EL 1X54A 5IP7G 4X64L 4DR5L 3SHLA 2WKCA 3IFDA 4FVMA 3OIQA 5FO9B 1PTOD 1VQCA 1I94Q 4N9PA 1OO9B 3M4QA 4DR2Q 1HJPA 3MAQA 1DJRD 1SE3A 1T5XD 4K0KQ 4X3TA 3P75A 3CRKC 1QNUA 4YWMA 1XTDA 2RHQB 5C0XG 4FXDA 1GOZA 1JICA 3J7AV 2N78A 4JI2L 4NXNL 3GD7A 2WKDA 4GN3B 1C0AA 1YNJD 5FO8B 3D4RA 2EYFA 2MP1A 1JE4A 1U4PA 3T4AC 3IFTA 2B63B 3NENA 4A3FB 2F3IA 1EY8A 2CCZA 2F4VQ 2NVTB 1E22A 1C4QA 5GADC 1V8QA 5AJ3Q 4FP5D 4JI6L 1TWCB 2XSCA 2KQ3A 4DV1Q 1XX8A 2EJGC 4IN3A 2KHSA 3L3OC 4DV6L 4I7ZC 5LMNQ 5C5MA 5JPMC 4A3KG 2NBFA 3M9BA 1N32L 1TIID 4OHJA 2M2LA 4A3FH 2I46A 4KY5A 2EZVA 5C4XH 1GHKA 4HSPA 2QW7A 4MN3A 3MXGA 4IURA 5BN5A 1ZYRC 3HGBA 4XT3B 2RA4A 4X3SA 4JI3L 3T1YQ 1LUZA 4DUZL 4N8X1 5JJIA 1MGSA 3S14H 2QF7A 4KY7A 2XGTA 4RCOA 4KK7A 1D6EC 3RZDH 2VXWA 4DR6Q 3TP7A 5DLQE 4OELB 2Z6BA 3MC0B 1L0WA 1SMXA 1I4HA 4DGZA 5C4XB 2OTJA 1VCIA 1UNSA 3PO2B 5FLMG 1H9RA 4XQQA 2K05A 5CV7A 4RFBA 3H3VH 1Y1WG 3K59A 1CZGA 1N9WA 1F2MA 3F2DA 1E2ZA 1AE3A 1E1TA 1JJ2A 2EY6A 3ICEA 1TS5A 3RZOB 4A3JB 3VR3A 1B1ZA 1VQJA 4ZUJA 3U50C 2VUMB 1B9MA 4YCVA 3D4DA 3N52A 1HA6A 4K8IA 3IL8A 1TWHB 5ELBA 1GUOA 4N8FA 2BOSA 1NSNS 3HS0C 3MXPA 5IT9E 2CWAA 2BDNA 2DY8A 1EWHA 1RHPA 2JP1A 3K7UC 4FF2A 1K0SA 2R6GA 4FO2A 4DV2L 1IBKQ 3MHBA 3I7FA 3D0FA 1DOLA 4C3JB 1PLFA 1D1IA 2FINB 1WVLA 1I6HB 5M5YH 4C2MB 5IODA 5JJZA 3RN5A 2ZTDA 4BS9A 3FP9A 2JA7G 4JBMA 1W3SA 1VQ8A 5DM63 3UI2A 5M9OA 4LFBL 3RD4A 4A3MG 3H15A 1G51A 5FLXE 2KHJA 3BVGA 1A2UA 1NCVA 1F2YA 1F2LA 2I07B 3A54A 2YTYA 4TQUS 1HZAA 4KKUA 1Y1VH 4DR1L 2PQAB 1C7YA 2L1BA 3GTLB 1M4VA 4R4OA 1WTHA 4BA1I 2HDLA 1VDZA 4RH6A 1F9RA 2DNCA 2BE5C 1K0RA 3L7ZC 4GLXA 1NMGA 4K5WA 5IYBG 2ZM6L 1ZYRD 3S2HB 1HH2P 2KJXA 4KTAA 5DEHA 1EWCA 4DR4L 1PDQA 1SJHD 5IT9c 1HR0Q 4DNTB 4IO9A 2B8GA 1DOKA 1Q12A 1U4MA 5IWAL 3C3LA 2LFNA 3CW2C 3J81j 3OTOL 5IOCA 2B3GA 4WORA 3FMCA 1HNWL 3PCOB 4IUVA 1HR0W 3C46A 1A62A 1BCPC 1ENAA 1LV9A 1VQPA 5FO7B 2RBMA 5GAEC 1QILA 1H9SA 4HCSA 4R4QA 4IFDH 1A3VA 2Z0SA 4JBJA 2JN4A 4BXXH 4FF4A 1BVSA 4ILWA 3W1BA 4WJWA 4Z9CB 1TS3A 4GN4B 5T1IA 2DN8A 4A3KH 2NN6G 2PZUA 1LABA 1LO5D 1SYEA 2Z4HA 3KLWA 3PO2H 3RN2A 2NZHA 3KF8A 3QG1A 4KN7C 3I4MG 3Q0AA 1K8GA 3CHBD 4UP7A 4X65Q 2EYLA 2AKWB 3SK6A 2GN5A 1EYDA 4EGVA 1KC8C 2RKSA 1S40A 4YWKA 4AH6A 1PRTF 2B2VC 1JOKA 5E7NA 1GM5A 4HSVA 2D0OA 1EQVA 4DR7Q 3HRZC 2KOLA 1VMPA 5JEAG 1YJWA 2VZAA 1PXUA 2BH2A 3EA6A 4XXEA 4S3SA 4NP5A 4DU9A 4DV7Q 4JI1L 1SNOA 3W2DA 4QIWE 1KD1C 1EU4A 2AWNA 1TWAH 5BR8Q 1PHJA 1FD7D 2VB2X 4C2MH 4C56C 1JB3A 4HN7A 4A3CH 5KYLA 1F9QA 2D2CC 2DJGC 3PUWA 4C3JH 4J6HA 2F0TA 4PMWA 3SDZA 3HFZB 4DR1Q 1Q86C 2EJMA 1Y1VG 5HURA 1EQRA 2B2WC 3PIP3 2IWHA 4RWSC 1LYLA 5JOBA 2BA1A 3RUZA 5JPNC 2YU9B 1RF2D 1STYA 1BCPD 4CKBA 2JA5G 1PH5A 4DXGA 5M3FB 4AQYL 1HNXL 1EOVA 2EYOA 3AU7A 3KJPA 1X3QA 1ZEQX 4DR4Q 4QQBX 4R9WA 3GTQH 3I4MH 4DUZQ 4QMGA 1EEFD 1JJCB 2RF4A 4H0LC 4A3JH 3AEVA 4XT1B 2K6AA 4LUZA 1AE2A 4K2LA 1HNWQ 1OXXK 1E2VA
chains in the Genus database with same CATH topology
3PGZA 3A5UA 1K8AC 3AFQA 4BXXG 3BZKA 1FVIA 1QVCA 4BY7G 2HIVA 4BY1H 1WJJA 3BZCA 4DNIA 2NZOA 3Q8DA 4JG2A 1TXYA 1PFSA 4MNOA 2WFWA 4GNXC 4A4IA 2Z6KA 4BBRH 1PYBA 2MQHA 2VW9A 1XPUA 1QVFA 1T9HA 3CPWA 2HT1A 1LTLA 4B3SQ 1PH7A 1CKNA 1I50H 2EIFA 3TS2A 1XNRL 4Y7NH 5IWAQ 1VQDA 1I5FA 4P74A 3UE1A 1VQ7A 4IPDA 1Q7YC 1K9MC 2JA6H 1N36Q 1MIUA 1S3OA 4B3RQ 1RIPA 3CCMA 4A3FG 4LF4Q 4JI0Q 3HKZE 4JI7Q 1C9OA 1MKHA 4HIDA 2YYZA 2C35B 1E7ZA 2MNAA 2ZJQA 1PH8A 2E2IH 4A3JG 3B6YA 4APVA 1UWVA 4B3MQ 3CD6A 3UE0A 1VQAA 5M3MH 1Q8KA 2IHEA 4A93G 1YIJA 3G48A 3RLNA 1WI5A 3K80C 2L15A 1KHIA 4GLAC 4P72A 5IYBH 1VQ5A 3S2HH 2OCEA 4A3EH 2JA5H 5H1SE 2JJQA 3STBC 1YI2A 4HJ9A 2GVBA 2IX1A 1G291 1E24A 1L1OA 3I4OA 4IJHA 1K83H 1KRTA 3CF5A 1KAWA 5LMUL 2WP8J 3U4VA 4A76A 2R7ZH 2JEBI 1Z9FA 2JK8A 4PZ6A 4A3IH 4H02A 4B3TQ 4JI0L 1X3FA 2MO0A 1QZHA 4JI4L 1L1OB 3EIVA 4MTNA 3GTLH 4B3ML 1PYSB 4A3IG 4A3CG 1P16A 2HIXA 4DV3Q 4LFBQ 1X55A 1IYJB 1U0LA 1Y14B 4LWCA 3HOVH 2R7DA 4JI1Q 1JMCA 3PUZA 3AQQA 3GTMH 3HOYH 3ERSX 3AYHB 2UXBL 1TWFH 4P71A 4JI6Q 1YJ9A 3E0EA 2FXQA 1VQ4A 2R92G 4GS3A 1N33L 1SN8A 1E3PA 2MO1A 3A0JA 4X6AH 2UXCQ 2HHHL 2PMZE 4HIMA 1NBWA 3J7ZC 1XMQQ 2E5LL 2K52A 3TRZA 3F8TA 3NEMA 1YVCA 2IT1A 4JI8Q 3H0GH 1D7QA 4GKJQ 3KYHC 2WB1E 4QY7A 4LUOA 4DV3L 1HZ9A 2I5MX 3EBEA 1SRUA 4DUYQ 3HOXH 2A19A 1OXVA 4IOAA 1YHAA 3CQZH 4JBKA 4LF5Q 3OYYA 2AMCB 1IBMQ 3RNUA 3U4ZA 4NPSA 4DPGA 1WCMG 4O0AA 3TREA 1J5EQ 4A3GH 3ULLA 1XNQQ 5GQOA 3S2DH 1FL0A 2HQLA 2D0PA 3J81i 5FJ8H 1SR3A 4HJ8A 2B63H 3SGIA 3ZJYC 4JV5Q 2VUMH 2DUDA 2AWOA 1OXTA 1IBLQ 3I2ZA 5M3MG 1OXSC 1I94L 3M7NA 3K8AA 3RLOA 4JI3Q 3JAMc 3T1YL 4LF9Q 2JEAI 5IYDH 3PIOA 3PV0A 4R4CA 1CSQA 3OTOQ 1BBWA 1N34Q 3W1GA 3UDGA 4GOPC 3J80i 3DM3A 4A3DG 1Q1BA 3LGJA 1OXUA 4Y52H 4X62L 1Q81C 3NBHB 3ULJA 3ULPA 4JC0A 2A8VA 1VQIA 1J5EL 1FJGL 2E8GA 1EUJA 1X54A 5IY0A 5IP7G 4X64L 4DR5L 1JE5A 1PH3A 1VQEA 5ELOA 5IYCG 4ALPA 3S15H 4BBRG 4UY8C 2VNUD 3AFPA 3S24A 1EWIA 5C4JH 1VQCA 1XJVA 1I94Q 2UUCL 5FLMH 3TS0A 5IYCH 5M3FG 4A3GG 3M4QA 4DR2Q 1HNZQ 3CP0A 3CC7A 1HJPA 1U5KA 4UP9A 3S1RH 3PF4A 3CC4A 1N34L 2R7FA 5C44G 1X3EA 5J3BA 3KF8B 1EIFA 1NTGA 2PI2A 4DV5L 1ASYA 4P75A 4A3LG 4K0KQ 1CSPA 4OO1I 1X6OA 2WAQG 4YWMA 4HIOA 1PH4A 1XTDA 2RHQB 3KFUA 1W2BA 3CAMA 1SROA 4TVAB 5IYDG 2LXJA 1PA6A 4X64Q 4DR5Q 4IFDG 4XTCS 5C0XG 1GKHA 3M85A 2Q2TA 3FKIG 2F4VL 1I3QH 2F52A 3DLLA 2N78A 3W5OA 4JI2L 1BKBA 4NXNL 3GD7A 2QGQA 4YWLA 3EN2A 4GN3B 1C0AA 1A63A 1Q1EA 1V1QA 1VQ6A 4LW1A 4O2DA 1CKNB 3GO5A 5LMUQ 1H95A 3J80c 1S72A 1EYGA 2H5XA 1VQKA 4L5SA 1A0IA 4DV6Q 3HKSA 4LF4L 4OXPA 4JI7L 4JBWA 3E9HA 4C3IH 3HOWG 1HZBA 1YJNA 2LSSA 4BA2I 4GN5A 4A3BH 4X66L 2I0QA 3JC66 3NENA 1PH9A 1N32Q 2F3IA 2Q2UA 2CCZA 2F4VQ 5HY6A 4OX9Q 3KF6A 1D8LA 4XIGS 1KIXA 1E22A 1TWCH 1VQMA 2YU9H 5GADC 4DV4L 2Q2HA 1MJCA 4P73A 2KBNA 5AJ3Q 2ZJPA 4JYAL 2NVYH 1YZ6A 4JI6L 2Y0SE 1VS0A 3G6EA 2K4KA 2ZTCA 4DAYB 4DV1Q 2D62A 3S17H 2UUBQ 2ZM6Q 4DV6L 4FDBA 2OWOA 1QUQB 5LMNQ 3PO2G 3PO3H 3H3VI 4IFDI 4A3KG 1WYDA 3H0GG 1HR0L 4PZ8A 2K5HA 3M9BA 1K73C 1N32L 2ZTEA 2VQEL 4A3FH 2K14A 1VQ9A 2PI2E 5C44H 1KXLA 4IPHA 2PQAA 5C4XH 2IX0A 1NMFA 1YNXA 4OONA 4RG1A 5GROA 2QA4A 4HIKA 4LFAL 1CKOA 2KHIA 4A3EG 4NXML 1P8LA 3CCJA 5JEAJ 1PH6A 2I5HA 3RR5A 4WJ4A 4LUVA 1L1OC 4DV0L 1M1KC 4JI3L 2UUBL 3T1YQ 1LUZA 4LF9L 4DUZL 4AYBG 2CKZB 4AQYQ 1N33Q 2ALYB 3F1ZA 3STBD 3UDFA 2UXCL 5JJIA 4GOPA 2JA7H 3S14H 5ELNA 3PF5A 3K7AH 2XGTA 4JI8L 2PNHA 4LF6Q 2VQFL 2EQSA 1VQOA 3RZDH 4DR6Q 5DLQE 1L0WA 4DUYL 1SMXA 1Q82C 1TWGH 3PUYA 2JQOA 1FJGQ 2ATWA 3S1MH 3S1QH 2OTJA 1VCIA 5K36G 2CQOA 3CPFA 4AYBE 3L0OA 2UXDL 2KENA 4RMFA 4LFCL 4YY3L 5FLMG 5JJKA 4DV0Q 1VQGA 2JA9A 5C3EH 1IBLL 4OWWB 3CCQA 1HNZL 1Y1WG 3H3VH 3KDFA 1N9WA 2NN6I 1X9NA 1JJGA 5GAHC 2YTVA 5EAYA 2Q2IA 4BY7H 3F2DA 4BY1G 4LF6L 1AE3A 1E1TA 4R4IA 2ID0A 4PZ7A 4DV5Q 1PH1A 1JJ2A 3ICEA 4DR6L 2K50A 2RCNA 4YHHQ 1XMOQ 4A3DH 1B7YB 1QUQA 2I5LX 3PSIA 4DV2Q 1UEBA 1VQJA 4L5RC 4ME3A 4DR7L 1NJIC 3U50C 3PIPA 4YCVA 3VDYA 3UDXA 3KJOA 4DK6C 4JOIA 5IP9G 1M90C 3L2PA 1BBUA 2UU9L 2VUMG 3BU2A 2B63G 1YHQA 4EQ5A 5IE8A 1CUKA 4JI5L 3KDFB 4OWXB 1WCMH 3PUXA 3G71A 2BA0A 5C4XG 2CWAA 3K7UC 1IL2A 5BR8L 5C0XI 4YCWA 3S1NH 4UP8A 4K0KL 2R6GA 1KRSA 4DV2L 1IBKQ 1B70B 3I7FA 1SLJA 3D0FA 1ASZA 4LNQA 1Q46A 1QVGA 3K0XA 1VQHA 3CMEA 5M5YH 3RN5A 2K75A 2NVTH 1G6PA 3PO3G 2CFMA 1RL2A 1J6QA 2ZTDA 4PG3A 3CXCA 3FP9A 2JA7G 2UUAQ 4JBMA 1W3SA 4KI0A 1V43A 3GTOH 3HOUH 4IPCA 1VQ8A 4NXNQ 4JYAQ 4GLVB 2RHSB 4QGUA 2BH8A 4LFBL 5JJLA 3PUVA 4A3MG 3J7A5 3H15A 1G51A 1NY4A 2K5NA 2KHJA 1HZCA 2OQ0A 4A3MH 1HNXQ 1GO3E 3WWVA 2KCMA 5LMNW 1UE5A 3CMAA 4R1JA 4NB3A 3HOXG 1XMQL 4POGA 5GAGC 1PV4A 2YTYA 4TQUS 2R93G 1HZAA 4GNXB 1V9PA 1OTCA 4GKJL 2E5LQ 1Y1VH 4DR1L 2PQAB 1C7YA 1YBYA 4L5TA 4OX9L 1LM0A 4JCVE 3J81c 4LFAQ 4GKKL 4R4OA 3TQYA 4BA1I 1XMOL 4DR3L 1SFOH 2R92H 3S16H 2Z6KC 2E2JH 4GNXA 1FGUA 3KOJA 4KHZA 1VQLA 2VL6A 4LF5L 2IHFA 1K0RA 4DV1L 3BJUA 3L7ZC 4GLXA 1NMGA 2K5VA 5IYBG 5C0XJ 3MXNB 4HJAA 3IRBA 2ZM6L 5IP9H 2GVAA 5LMNL 2N3SA 1HH2P 1GD7A 3CC2A 4B3SL 3M4OH 4A3BG 4DR4L 5IT9c 1HR0Q 4BBSG 2JE6I 4IO9A 3T1HL 1Q12A 2OQKA 2VY3A 5IWAL 1KQSA 4LF7Q 2YTXA 3CW2C 4X62Q 3J81j 2JA6G 3OTOL 2IY5B 1VQBA 3FHWA 2B3GA 3K81C 4DR3Q 1EQQA 1I6HH 1HNWL 3PCOB 3F2CA 1KL9A 3RLFA 1WFQA 1O7IA 4YY3Q 1HR0W 2JA8G 1JT8A 4J15A 1A62A 4QJFA 1Y1WH 4A75A 2LXKA 2N8NA 2OTLA 3G4SA 4DR2L 1SE8A 4KLKA 1VQPA 1R9TH 4HJ7A 3FKIH 5GAEC 2ZJRA 2N49A 2UUCQ 4R4QA 1XPRA 5IP7H 4YHHL 4QL5A 2VQFQ 2Z0SA 3D31A 4JBJA 4IOCA 3I4NG 4BXXH 1X65A 1XNRQ 1BVSA 3W1BA 3UDIA 4MZ9A 5HGQA 3I55A 4C3HH 4IJLA 4B3TL 1N36L 4B3RL 4GN4B 3ER0A 3I4NH 3GTKH 4JI4Q 4A3KH 2NN6G 1X3GA 3CCEA 2R93H 2UXDQ 4BBSH 3KLWA 2UU9Q 4LFCQ 3RN2A 3PO2H 4JI2Q 2NZHA 5M3FH 1AH9A 1Z47A 3I4MG 4OWTB 1XPOA 1K8GA 3GTJH 3HOWH 3HKZG 5C3EG 4UP7A 4X65Q 2AKWB 3KF6B 2ASBA 2GN5A 4WJ3M 1KC8C 4DAMA 1S40A 4LF8L 4YWKA 2JA8H 1IZ6A 4AH6A 4POFA 5E7NA 3HOUG 1GM5A 2D0OA 4HJ5A 3M3YH 1UE6A 3TEHB 1OXXK 2HHHQ 3GDEA 1MJEA 3NELA 4DR7Q 2Y0SG 3A74A 2KCTA 4YCUA 3JAMi 2UUAL 1UE7A 5M5WH 4UPAA 1YJWA 5JEAG 4X66Q 2VZAA 2BH2A 1WOCA 1PVOA 2A1AA 5AJ3L 1PH2A 2CWPA 3M4PA 3OW2A 1X56A 4X65L 3U58A 1YEZA 4OO1G 4DV7Q 1DGSA 5FJ8G 4DV4Q 4JI5Q 1IBML 1GVPA 4JI1L 4GOPB 3HOYG 4LF8Q 4KHPQ 1VQFA 5M5XH 2NVQH 1A8VA 4QIWE 5FLXc 1XNQL 1K3RA 4DKAC 4DK3C 2AWNA 1KD1C 1TWAH 5BR8Q 1PHJA 3HOVG 2UXBQ 4C2MH 2XTIA 1YITA 4AIMA 2DGYA 4A3CH 1UE1A 3PUWA 4C3JH 4PMWA 4DR1Q 2E2HH 3HOZH 3HFZB 2NVXH 1Q86C 4IFDJ 1Y1VG 1L2FA 1QZGA 4GKKQ 1EQRA 3HOZG 2B29A 2V1CC 1EIYB 2R7ZG 2VQEQ 2MFIA 1LYLA 2BA1A 4L5QA 3E9IA 2AHOB 3GTGH 1TWHH 4DV7L 1YHBA 2QEXA 1JB7A 1EFWA 3CCSA 2ES2A 3CCRA 2WB1G 2VS1A 4IPGA 2WAQE 1PH5A 2JA5G 3CCLA 3GTPH 1VQNA 4AQYL 1HNXL 4NXMQ 1EOVA 3KJPA 1B8AA 3MEFA 4DR4Q 4QQBX 2YV5A 4A93H 3GTQH 3I4MH 3CCVA 4KHPL 3T1HQ 4EX5A 3I56A 4JV5L 4DUZQ 1IBKL 2EXDA 1IXRA 2RF4A 1JJCB 4LF7L 4A3JH 3AEVA 3RZOH 4LUZA 3F2BA 4R4TA 1E1OA 1AE2A 1CKMA 4JOIC 3CCUA 4A3LH 1N8RC 1HNWQ 1NE3A 3A5ZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PGZ A;  3A5U A;  1K8A C;  3AFQ A;  4BXX G;  3BZK A;  1FVI A;  1QVC A;  4BY7 G;  2HIV A;  4BY1 H;  1WJJ A;  3BZC A;  4DNI A;  2NZO A;  3Q8D A;  4JG2 A;  1TXY A;  1PFS A;  4MNO A;  2WFW A;  4GNX C;  4A4I A;  2Z6K A;  4BBR H;  1PYB A;  2MQH A;  2VW9 A;  1XPU A;  1QVF A;  1T9H A;  3CPW A;  2HT1 A;  1LTL A;  4B3S Q;  1PH7 A;  1CKN A;  1I50 H;  2EIF A;  3TS2 A;  1XNR L;  4Y7N H;  5IWA Q;  1VQD A;  1I5F A;  4P74 A;  3UE1 A;  1VQ7 A;  4IPD A;  1Q7Y C;  1K9M C;  2JA6 H;  1N36 Q;  1MIU A;  1S3O A;  4B3R Q;  1RIP A;  3CCM A;  4A3F G;  4LF4 Q;  4JI0 Q;  3HKZ E;  4JI7 Q;  1C9O A;  1MKH A;  4HID A;  2YYZ A;  2C35 B;  1E7Z A;  2MNA A;  2ZJQ A;  1PH8 A;  2E2I H;  4A3J G;  3B6Y A;  4APV A;  1UWV A;  4B3M Q;  3CD6 A;  3UE0 A;  1VQA A;  5M3M H;  1Q8K A;  2IHE A;  4A93 G;  1YIJ A;  3G48 A;  3RLN A;  1WI5 A;  3K80 C;  2L15 A;  1KHI A;  4GLA C;  4P72 A;  5IYB H;  1VQ5 A;  3S2H H;  2OCE A;  4A3E H;  2JA5 H;  5H1S E;  2JJQ A;  3STB C;  1YI2 A;  4HJ9 A;  2GVB A;  2IX1 A;  1G29 1;  1E24 A;  1L1O A;  3I4O A;  4IJH A;  1K83 H;  1KRT A;  3CF5 A;  1KAW A;  5LMU L;  2WP8 J;  3U4V A;  4A76 A;  2R7Z H;  2JEB I;  1Z9F A;  2JK8 A;  4PZ6 A;  4A3I H;  4H02 A;  4B3T Q;  4JI0 L;  1X3F A;  2MO0 A;  1QZH A;  4JI4 L;  1L1O B;  3EIV A;  4MTN A;  3GTL H;  4B3M L;  1PYS B;  4A3I G;  4A3C G;  1P16 A;  2HIX A;  4DV3 Q;  4LFB Q;  1X55 A;  1IYJ B;  1U0L A;  1Y14 B;  4LWC A;  3HOV H;  2R7D A;  4JI1 Q;  1JMC A;  3PUZ A;  3AQQ A;  3GTM H;  3HOY H;  3ERS X;  3AYH B;  2UXB L;  1TWF H;  4P71 A;  4JI6 Q;  1YJ9 A;  3E0E A;  2FXQ A;  1VQ4 A;  2R92 G;  4GS3 A;  1N33 L;  1SN8 A;  1E3P A;  2MO1 A;  3A0J A;  4X6A H;  2UXC Q;  2HHH L;  2PMZ E;  4HIM A;  1NBW A;  3J7Z C;  1XMQ Q;  2E5L L;  2K52 A;  3TRZ A;  3F8T A;  3NEM A;  1YVC A;  2IT1 A;  4JI8 Q;  3H0G H;  1D7Q A;  4GKJ Q;  3KYH C;  2WB1 E;  4QY7 A;  4LUO A;  4DV3 L;  1HZ9 A;  2I5M X;  3EBE A;  1SRU A;  4DUY Q;  3HOX H;  2A19 A;  1OXV A;  4IOA A;  1YHA A;  3CQZ H;  4JBK A;  4LF5 Q;  3OYY A;  2AMC B;  1IBM Q;  3RNU A;  3U4Z A;  4NPS A;  4DPG A;  1WCM G;  4O0A A;  3TRE A;  1J5E Q;  4A3G H;  3ULL A;  1XNQ Q;  5GQO A;  3S2D H;  1FL0 A;  2HQL A;  2D0P A;  3J81 i;  5FJ8 H;  1SR3 A;  4HJ8 A;  2B63 H;  3SGI A;  3ZJY C;  4JV5 Q;  2VUM H;  2DUD A;  2AWO A;  1OXT A;  1IBL Q;  3I2Z A;  5M3M G;  1OXS C;  1I94 L;  3M7N A;  3K8A A;  3RLO A;  4JI3 Q;  3JAM c;  3T1Y L;  4LF9 Q;  2JEA I;  5IYD H;  3PIO A;  3PV0 A;  4R4C A;  1CSQ A;  3OTO Q;  1BBW A;  1N34 Q;  3W1G A;  3UDG A;  4GOP C;  3J80 i;  3DM3 A;  4A3D G;  1Q1B A;  3LGJ A;  1OXU A;  4Y52 H;  4X62 L;  1Q81 C;  3NBH B;  3ULJ A;  3ULP A;  4JC0 A;  2A8V A;  1VQI A;  1J5E L;  1FJG L;  2E8G A;  1EUJ A;  1X54 A;  5IY0 A;  5IP7 G;  4X64 L;  4DR5 L;  1JE5 A;  1PH3 A;  1VQE A;  5ELO A;  5IYC G;  4ALP A;  3S15 H;  4BBR G;  4UY8 C;  2VNU D;  3AFP A;  3S24 A;  1EWI A;  5C4J H;  1VQC A;  1XJV A;  1I94 Q;  2UUC L;  5FLM H;  3TS0 A;  5IYC H;  5M3F G;  4A3G G;  3M4Q A;  4DR2 Q;  1HNZ Q;  3CP0 A;  3CC7 A;  1HJP A;  1U5K A;  4UP9 A;  3S1R H;  3PF4 A;  3CC4 A;  1N34 L;  2R7F A;  5C44 G;  1X3E A;  5J3B A;  3KF8 B;  1EIF A;  1NTG A;  2PI2 A;  4DV5 L;  1ASY A;  4P75 A;  4A3L G;  4K0K Q;  1CSP A;  4OO1 I;  1X6O A;  2WAQ G;  4YWM A;  4HIO A;  1PH4 A;  1XTD A;  2RHQ B;  3KFU A;  1W2B A;  3CAM A;  1SRO A;  4TVA B;  5IYD G;  2LXJ A;  1PA6 A;  4X64 Q;  4DR5 Q;  4IFD G;  4XTC S;  5C0X G;  1GKH A;  3M85 A;  2Q2T A;  3FKI G;  2F4V L;  1I3Q H;  2F52 A;  3DLL A;  2N78 A;  3W5O A;  4JI2 L;  1BKB A;  4NXN L;  3GD7 A;  2QGQ A;  4YWL A;  3EN2 A;  4GN3 B;  1C0A A;  1A63 A;  1Q1E A;  1V1Q A;  1VQ6 A;  4LW1 A;  4O2D A;  1CKN B;  3GO5 A;  5LMU Q;  1H95 A;  3J80 c;  1S72 A;  1EYG A;  2H5X A;  1VQK A;  4L5S A;  1A0I A;  4DV6 Q;  3HKS A;  4LF4 L;  4OXP A;  4JI7 L;  4JBW A;  3E9H A;  4C3I H;  3HOW G;  1HZB A;  1YJN A;  2LSS A;  4BA2 I;  4GN5 A;  4A3B H;  4X66 L;  2I0Q A;  3JC6 6;  3NEN A;  1PH9 A;  1N32 Q;  2F3I A;  2Q2U A;  2CCZ A;  2F4V Q;  5HY6 A;  4OX9 Q;  3KF6 A;  1D8L A;  4XIG S;  1KIX A;  1E22 A;  1TWC H;  1VQM A;  2YU9 H;  5GAD C;  4DV4 L;  2Q2H A;  1MJC A;  4P73 A;  2KBN A;  5AJ3 Q;  2ZJP A;  4JYA L;  2NVY H;  1YZ6 A;  4JI6 L;  2Y0S E;  1VS0 A;  3G6E A;  2K4K A;  2ZTC A;  4DAY B;  4DV1 Q;  2D62 A;  3S17 H;  2UUB Q;  2ZM6 Q;  4DV6 L;  4FDB A;  2OWO A;  1QUQ B;  5LMN Q;  3PO2 G;  3PO3 H;  3H3V I;  4IFD I;  4A3K G;  1WYD A;  3H0G G;  1HR0 L;  4PZ8 A;  2K5H A;  3M9B A;  1K73 C;  1N32 L;  2ZTE A;  2VQE L;  4A3F H;  2K14 A;  1VQ9 A;  2PI2 E;  5C44 H;  1KXL A;  4IPH A;  2PQA A;  5C4X H;  2IX0 A;  1NMF A;  1YNX A;  4OON A;  4RG1 A;  5GRO A;  2QA4 A;  4HIK A;  4LFA L;  1CKO A;  2KHI A;  4A3E G;  4NXM L;  1P8L A;  3CCJ A;  5JEA J;  1PH6 A;  2I5H A;  3RR5 A;  4WJ4 A;  4LUV A;  1L1O C;  4DV0 L;  1M1K C;  4JI3 L;  2UUB L;  3T1Y Q;  1LUZ A;  4LF9 L;  4DUZ L;  4AYB G;  2CKZ B;  4AQY Q;  1N33 Q;  2ALY B;  3F1Z A;  3STB D;  3UDF A;  2UXC L;  5JJI A;  4GOP A;  2JA7 H;  3S14 H;  5ELN A;  3PF5 A;  3K7A H;  2XGT A;  4JI8 L;  2PNH A;  4LF6 Q;  2VQF L;  2EQS A;  1VQO A;  3RZD H;  4DR6 Q;  5DLQ E;  1L0W A;  4DUY L;  1SMX A;  1Q82 C;  1TWG H;  3PUY A;  2JQO A;  1FJG Q;  2ATW A;  3S1M H;  3S1Q H;  2OTJ A;  1VCI A;  5K36 G;  2CQO A;  3CPF A;  4AYB E;  3L0O A;  2UXD L;  2KEN A;  4RMF A;  4LFC L;  4YY3 L;  5FLM G;  5JJK A;  4DV0 Q;  1VQG A;  2JA9 A;  5C3E H;  1IBL L;  4OWW B;  3CCQ A;  1HNZ L;  1Y1W G;  3H3V H;  3KDF A;  1N9W A;  2NN6 I;  1X9N A;  1JJG A;  5GAH C;  2YTV A;  5EAY A;  2Q2I A;  4BY7 H;  3F2D A;  4BY1 G;  4LF6 L;  1AE3 A;  1E1T A;  4R4I A;  2ID0 A;  4PZ7 A;  4DV5 Q;  1PH1 A;  1JJ2 A;  3ICE A;  4DR6 L;  2K50 A;  2RCN A;  4YHH Q;  1XMO Q;  4A3D H;  1B7Y B;  1QUQ A;  2I5L X;  3PSI A;  4DV2 Q;  1UEB A;  1VQJ A;  4L5R C;  4ME3 A;  4DR7 L;  1NJI C;  3U50 C;  3PIP A;  4YCV A;  3VDY A;  3UDX A;  3KJO A;  4DK6 C;  4JOI A;  5IP9 G;  1M90 C;  3L2P A;  1BBU A;  2UU9 L;  2VUM G;  3BU2 A;  2B63 G;  1YHQ A;  4EQ5 A;  5IE8 A;  1CUK A;  4JI5 L;  3KDF B;  4OWX B;  1WCM H;  3PUX A;  3G71 A;  2BA0 A;  5C4X G;  2CWA A;  3K7U C;  1IL2 A;  5BR8 L;  5C0X I;  4YCW A;  3S1N H;  4UP8 A;  4K0K L;  2R6G A;  1KRS A;  4DV2 L;  1IBK Q;  1B70 B;  3I7F A;  1SLJ A;  3D0F A;  1ASZ A;  4LNQ A;  1Q46 A;  1QVG A;  3K0X A;  1VQH A;  3CME A;  5M5Y H;  3RN5 A;  2K75 A;  2NVT H;  1G6P A;  3PO3 G;  2CFM A;  1RL2 A;  1J6Q A;  2ZTD A;  4PG3 A;  3CXC A;  3FP9 A;  2JA7 G;  2UUA Q;  4JBM A;  1W3S A;  4KI0 A;  1V43 A;  3GTO H;  3HOU H;  4IPC A;  1VQ8 A;  4NXN Q;  4JYA Q;  4GLV B;  2RHS B;  4QGU A;  2BH8 A;  4LFB L;  5JJL A;  3PUV A;  4A3M G;  3J7A 5;  3H15 A;  1G51 A;  1NY4 A;  2K5N A;  2KHJ A;  1HZC A;  2OQ0 A;  4A3M H;  1HNX Q;  1GO3 E;  3WWV A;  2KCM A;  5LMN W;  1UE5 A;  3CMA A;  4R1J A;  4NB3 A;  3HOX G;  1XMQ L;  4POG A;  5GAG C;  1PV4 A;  2YTY A;  4TQU S;  2R93 G;  1HZA A;  4GNX B;  1V9P A;  1OTC A;  4GKJ L;  2E5L Q;  1Y1V H;  4DR1 L;  2PQA B;  1C7Y A;  1YBY A;  4L5T A;  4OX9 L;  1LM0 A;  4JCV E;  3J81 c;  4LFA Q;  4GKK L;  4R4O A;  3TQY A;  4BA1 I;  1XMO L;  4DR3 L;  1SFO H;  2R92 H;  3S16 H;  2Z6K C;  2E2J H;  4GNX A;  1FGU A;  3KOJ A;  4KHZ A;  1VQL A;  2VL6 A;  4LF5 L;  2IHF A;  1K0R A;  4DV1 L;  3BJU A;  3L7Z C;  4GLX A;  1NMG A;  2K5V A;  5IYB G;  5C0X J;  3MXN B;  4HJA A;  3IRB A;  2ZM6 L;  5IP9 H;  2GVA A;  5LMN L;  2N3S A;  1HH2 P;  1GD7 A;  3CC2 A;  4B3S L;  3M4O H;  4A3B G;  4DR4 L;  5IT9 c;  1HR0 Q;  4BBS G;  2JE6 I;  4IO9 A;  3T1H L;  1Q12 A;  2OQK A;  2VY3 A;  5IWA L;  1KQS A;  4LF7 Q;  2YTX A;  3CW2 C;  4X62 Q;  3J81 j;  2JA6 G;  3OTO L;  2IY5 B;  1VQB A;  3FHW A;  2B3G A;  3K81 C;  4DR3 Q;  1EQQ A;  1I6H H;  1HNW L;  3PCO B;  3F2C A;  1KL9 A;  3RLF A;  1WFQ A;  1O7I A;  4YY3 Q;  1HR0 W;  2JA8 G;  1JT8 A;  4J15 A;  1A62 A;  4QJF A;  1Y1W H;  4A75 A;  2LXK A;  2N8N A;  2OTL A;  3G4S A;  4DR2 L;  1SE8 A;  4KLK A;  1VQP A;  1R9T H;  4HJ7 A;  3FKI H;  5GAE C;  2ZJR A;  2N49 A;  2UUC Q;  4R4Q A;  1XPR A;  5IP7 H;  4YHH L;  4QL5 A;  2VQF Q;  2Z0S A;  3D31 A;  4JBJ A;  4IOC A;  3I4N G;  4BXX H;  1X65 A;  1XNR Q;  1BVS A;  3W1B A;  3UDI A;  4MZ9 A;  5HGQ A;  3I55 A;  4C3H H;  4IJL A;  4B3T L;  1N36 L;  4B3R L;  4GN4 B;  3ER0 A;  3I4N H;  3GTK H;  4JI4 Q;  4A3K H;  2NN6 G;  1X3G A;  3CCE A;  2R93 H;  2UXD Q;  4BBS H;  3KLW A;  2UU9 Q;  4LFC Q;  3RN2 A;  3PO2 H;  4JI2 Q;  2NZH A;  5M3F H;  1AH9 A;  1Z47 A;  3I4M G;  4OWT B;  1XPO A;  1K8G A;  3GTJ H;  3HOW H;  3HKZ G;  5C3E G;  4UP7 A;  4X65 Q;  2AKW B;  3KF6 B;  2ASB A;  2GN5 A;  4WJ3 M;  1KC8 C;  4DAM A;  1S40 A;  4LF8 L;  4YWK A;  2JA8 H;  1IZ6 A;  4AH6 A;  4POF A;  5E7N A;  3HOU G;  1GM5 A;  2D0O A;  4HJ5 A;  3M3Y H;  1UE6 A;  3TEH B;  1OXX K;  2HHH Q;  3GDE A;  1MJE A;  3NEL A;  4DR7 Q;  2Y0S G;  3A74 A;  2KCT A;  4YCU A;  3JAM i;  2UUA L;  1UE7 A;  5M5W H;  4UPA A;  1YJW A;  5JEA G;  4X66 Q;  2VZA A;  2BH2 A;  1WOC A;  1PVO A;  2A1A A;  5AJ3 L;  1PH2 A;  2CWP A;  3M4P A;  3OW2 A;  1X56 A;  4X65 L;  3U58 A;  1YEZ A;  4OO1 G;  4DV7 Q;  1DGS A;  5FJ8 G;  4DV4 Q;  4JI5 Q;  1IBM L;  1GVP A;  4JI1 L;  4GOP B;  3HOY G;  4LF8 Q;  4KHP Q;  1VQF A;  5M5X H;  2NVQ H;  1A8V A;  4QIW E;  5FLX c;  1XNQ L;  1K3R A;  4DKA C;  4DK3 C;  2AWN A;  1KD1 C;  1TWA H;  5BR8 Q;  1PHJ A;  3HOV G;  2UXB Q;  4C2M H;  2XTI A;  1YIT A;  4AIM A;  2DGY A;  4A3C H;  1UE1 A;  3PUW A;  4C3J H;  4PMW A;  4DR1 Q;  2E2H H;  3HOZ H;  3HFZ B;  2NVX H;  1Q86 C;  4IFD J;  1Y1V G;  1L2F A;  1QZG A;  4GKK Q;  1EQR A;  3HOZ G;  2B29 A;  2V1C C;  1EIY B;  2R7Z G;  2VQE Q;  2MFI A;  1LYL A;  2BA1 A;  4L5Q A;  3E9I A;  2AHO B;  3GTG H;  1TWH H;  4DV7 L;  1YHB A;  2QEX A;  1JB7 A;  1EFW A;  3CCS A;  2ES2 A;  3CCR A;  2WB1 G;  2VS1 A;  4IPG A;  2WAQ E;  1PH5 A;  2JA5 G;  3CCL A;  3GTP H;  1VQN A;  4AQY L;  1HNX L;  4NXM Q;  1EOV A;  3KJP A;  1B8A A;  3MEF A;  4DR4 Q;  4QQB X;  2YV5 A;  4A93 H;  3GTQ H;  3I4M H;  3CCV A;  4KHP L;  3T1H Q;  4EX5 A;  3I56 A;  4JV5 L;  4DUZ Q;  1IBK L;  2EXD A;  1IXR A;  2RF4 A;  1JJC B;  4LF7 L;  4A3J H;  3AEV A;  3RZO H;  4LUZ A;  3F2B A;  4R4T A;  1E1O A;  1AE2 A;  1CKM A;  4JOI C;  3CCU A;  4A3L H;  1N8R C;  1HNW Q;  1NE3 A;  3A5Z B; 
#chains in the Genus database with same CATH topology
 3PGZ A;  1K8A C;  2OXP A;  1PTO B;  3OPO A;  4BY7 G;  3M7G A;  1C8C A;  3GP7 A;  4JG2 A;  1PFS A;  5C3W A;  4A4I A;  1PYB A;  1XPU A;  4B9X A;  3HEJ A;  1T9H A;  1CKN A;  4Y7N H;  1VQ7 A;  1VQD A;  4P74 A;  4IPD A;  2KA7 A;  1MIU A;  1S3O A;  1IW7 C;  4HTH A;  1NR4 A;  2QDB A;  2CW0 C;  1F2Z A;  2FFK B;  1K8O A;  1AW7 A;  3QOL A;  4APV A;  2GA4 B;  1Q8K A;  5IGG A;  3ONA B;  4NMZ A;  2SEB D;  3G48 A;  2F0J A;  3VA7 A;  2PCF B;  4QIW B;  1KHI A;  1I6V C;  1II3 A;  1VQ5 A;  3NPP A;  4A3E H;  2FHT A;  2O4X A;  5H1S E;  3STB C;  1O78 A;  2G9D A;  1E24 A;  1L1O A;  5KRU A;  3K6O A;  4JI0 L;  5DAU A;  3P7J A;  2MO0 A;  2HUG A;  3AB9 A;  1L1O B;  3K5N A;  4JI4 L;  3GTL H;  1PYS B;  1IW7 D;  2HIX A;  4CDC C;  2E2I B;  4JI1 Q;  3PUZ A;  1CM9 A;  1Q90 A;  2ENB A;  1BBX C;  1YJ9 A;  3GTK B;  2QKI C;  2X6L A;  1M8A A;  3OSO A;  1SN8 A;  3A0J A;  3T53 B;  1N33 L;  4X6A H;  1UEA B;  3SEB A;  2PMZ E;  3TRZ A;  2K52 A;  1F9S A;  3I3C A;  1DYQ A;  1D7Q A;  3KYH C;  4DV3 L;  1J9O A;  1HZ9 A;  4H13 C;  3E3X A;  3L9A X;  3I4N B;  4RHR A;  4CJ0 B;  1JOO A;  4O0A A;  3ULL A;  3S2D H;  3J81 i;  1K8M A;  4HJ8 A;  5JAV A;  1STG A;  3ZJY C;  3NQI A;  2AWO A;  1YNJ C;  3I2Z A;  3RLO A;  3JAM c;  1CQV A;  2JSO A;  2JEA I;  1B3A A;  2RDH A;  1T5E A;  4ZKB B;  3PIO A;  2X69 A;  1VF7 A;  1EOT A;  2F03 A;  1N34 Q;  3W1G A;  3UDG A;  3NP8 A;  3VYT A;  1SYB A;  4A3D G;  1Q1B A;  4IUP A;  4JPB W;  5CV9 A;  3K58 A;  2B2T A;  3TP8 A;  1DCZ A;  2A8V A;  1XYI A;  1PH3 A;  1EUJ A;  1B53 A;  2XIW A;  3NWS A;  3KK7 A;  4ALP A;  3S1R B;  4UY8 C;  2VNU D;  3AFP A;  5C4J H;  1EWI A;  1XWE A;  1ENC A;  2HDM A;  3BDO A;  5M3F G;  3SE0 A;  3S15 B;  4K5X A;  1H9J A;  2KVM A;  2R7F A;  3G7L A;  5J3B A;  1E0B A;  4DV5 L;  1CK1 A;  2WAQ G;  1PH4 A;  2B2V A;  3SK4 A;  3CAM A;  5IYD G;  2LXJ A;  3EVQ A;  4M8A A;  3M85 A;  3ERO A;  1G2T A;  3BS1 A;  3TZD A;  1BKB A;  4YWL A;  4L63 B;  1A63 A;  4X3U A;  4QUF A;  1Q1E A;  5CV8 A;  4LW1 A;  4O2D A;  1CKN B;  3J80 c;  3N6R A;  2RDG A;  4QUC A;  2CHB D;  1BR9 A;  1ILQ A;  2H5X A;  5LHY 1;  1A0I A;  2J0T D;  3CQZ B;  3TSS A;  4C3I H;  2V4D A;  2LSS A;  4BA2 I;  4X66 L;  1TY2 A;  2TMP A;  5D14 A;  2I0Q A;  3JC6 6;  1LT4 D;  3BZD B;  5IGB A;  5HY6 A;  4XIG S;  4DV4 L;  2Q2H A;  2F0F A;  2IX3 A;  2KBN A;  2NVY H;  3TZU A;  3QB3 A;  3VR2 A;  5CBE E;  2NYZ D;  2D62 A;  1A3T A;  4K2K A;  1G2S A;  1PZK D;  5TSS A;  1PRT D;  4FDB A;  3T51 B;  4K5V A;  1QUQ B;  3PO2 G;  2EY2 A;  3H0G G;  4PZ8 A;  1S4Z A;  2J7Z A;  1MI2 A;  1JWM D;  1K73 C;  1Y1W B;  3K57 A;  1H9S B;  5C44 H;  3H0G B;  1KXL A;  3OMG A;  3S1M B;  1B3Q A;  1NMF A;  1YNX A;  3FPP A;  4RG1 A;  1QWY A;  1E2W A;  3J81 L;  3NE5 B;  4V19 0;  5JEA J;  1PH6 A;  1ZKO A;  2DNE A;  1L1O C;  4DV0 L;  2UUB L;  4A93 H;  1ML0 D;  4AQY Q;  2CKZ B;  2ALY B;  3UDF A;  3MFG A;  1WTQ A;  5JEA H;  4RGN A;  5ELN A;  2HCI A;  3PF5 A;  4ABN A;  3K7A H;  4U68 A;  3FDT A;  1BQQ T;  2VQF L;  1VQO A;  1FNW A;  4DUY L;  1WD1 A;  1SYD A;  1LT5 D;  2ATW A;  3S1M H;  5K36 G;  3S1Q H;  2AQ1 B;  2CQO A;  4FF1 A;  3CPF A;  2K5D A;  4RHS A;  3M3Y B;  1IKL A;  4UHV A;  5E1F A;  4YY3 L;  4LFC L;  2UXD L;  5JJK A;  5ISR A;  1DD2 A;  1UUP A;  2JA9 A;  1IBL L;  3CCQ A;  3KDF A;  5EAY A;  5NUC A;  2Q2I A;  3U9O A;  1AZP A;  4LF6 L;  1I4G A;  2ID0 A;  4KMU C;  4DV5 Q;  2MJ8 A;  1EZ6 A;  1WTO A;  1B7Y B;  1QUQ A;  2O2L D;  1UEB A;  4L5R C;  1B50 A;  1NJI C;  2LKV A;  3FEW X;  3UDX A;  3KJO A;  4DA2 A;  4IUT A;  2Z1C A;  2F0Q A;  3OWF A;  2B63 G;  1YHQ A;  5IE8 A;  5EKL A;  4OWX B;  2BDO A;  1WCM H;  1JWS D;  2BA0 A;  5C4X G;  3A7L A;  4YCW A;  3JAM L;  4K0K L;  1X3P A;  1HUM A;  1B70 B;  1SLJ A;  1Q46 A;  1TT2 A;  1U9R A;  1QVG A;  3H94 A;  4KD4 A;  4QF4 A;  1AP0 A;  2NVT H;  2CFM A;  1RL2 A;  3GV6 A;  3CXC A;  4DF7 A;  2UUA Q;  4KI0 A;  1ICW A;  2QEJ C;  4NXN Q;  2F1M A;  4XDX A;  5E4W C;  2RHS B;  4QGU A;  5JJL A;  3P1H A;  2K33 A;  2OQ0 A;  5FKA C;  2CQA A;  1EY9 A;  1GO3 E;  4POG A;  4R1J A;  3HOX G;  1TQO A;  2R93 G;  4ID6 A;  1TS2 A;  2R92 B;  5M5W B;  3HG9 A;  3J81 c;  1A6X A;  3TQY A;  1XMO L;  1SFO H;  4KHZ A;  3KOJ A;  2VL6 A;  4DV1 L;  1A2T A;  3NXW A;  3R3O A;  2RVL A;  2RCF A;  1KNA A;  3IRB A;  5IP9 H;  2GVA A;  5LMN L;  3CC2 A;  1SE2 A;  3GQB A;  3T1H L;  2OQK A;  2VY3 A;  2AQ3 B;  4CKE A;  5M3M B;  4ULL A;  1KDA A;  5AFW A;  4X62 Q;  2JA6 G;  2IY5 B;  1VMC A;  4DR3 Q;  4BY1 B;  2A73 B;  3F2C A;  4YY3 Q;  1WFQ A;  4IQZ A;  2WIN B;  5E4X A;  2JA6 B;  4J15 A;  4QJF A;  1Y1W H;  4CJ2 C;  4KLK A;  3K5O A;  2F0N A;  3FKI H;  5I9O A;  2ZJR A;  3LX0 A;  4LAA A;  1SNC A;  3SXH A;  3R93 A;  1HUN A;  3I4N G;  3PMF A;  1U4L A;  3MWY W;  4C3H H;  4IJL A;  4B3T L;  1EU3 A;  3OOC A;  1IYU A;  2MPM A;  4M1U B;  3CCE A;  4ZUI A;  3E5S A;  5M3F H;  1AH9 A;  2EVB A;  4EVO A;  1STE A;  5C3E G;  4UAI A;  1PRT C;  3FKI B;  5IGE A;  4DAM A;  5EJW A;  1K83 B;  3DM1 A;  2L5T A;  1S5C D;  2XN9 C;  3HOU G;  4MTK A;  2PPB C;  1BOS A;  4HJ5 A;  3CU7 A;  3GDE A;  2Y0S G;  2G5D A;  3A74 A;  4YCU A;  1LLR D;  1ILP A;  1SND A;  2UUA L;  1UE7 A;  2F0U A;  4X66 Q;  1WOC A;  2NWG A;  5KNC A;  1HCZ A;  3H3V C;  3E0J A;  3OW2 A;  1X56 A;  2F0L A;  2NZ1 D;  2RQX A;  1DGS A;  4DV4 Q;  1IBM L;  4LF8 Q;  5M5X H;  2F0W A;  5FLX c;  4Y7N B;  3HOV G;  2K5W A;  1YIT A;  4AIM A;  1HHV A;  3S14 B;  3HOZ H;  3EFX D;  4FNF A;  4RAU C;  1EY7 A;  2H4O A;  2HD3 A;  1GXD C;  3NK9 A;  3HOZ G;  1EIY B;  4XQN A;  1L0X B;  5J39 A;  4L5Q A;  3WOF A;  2AHO B;  5IGD A;  1YHB A;  4H44 C;  3ERQ A;  4K6D A;  2A6H D;  5LL6 X;  2QEX A;  2ES2 A;  3CCR A;  3HOX B;  3GTO B;  4IPG A;  2WAQ E;  3CCL A;  1VQN A;  3NBH A;  1B2T A;  2Z9H A;  5F2D A;  3T1H Q;  4EX5 A;  4JV5 L;  4CJ1 B;  1MHW C;  2EYH A;  3NTH A;  4MHE A;  3HOW B;  4WFN 3;  2F0K A;  1ET9 A;  3RZO H;  1ROD A;  4R4T A;  4A3G B;  1EY4 A;  1HXY D;  4OGQ C;  1NE3 A;  1NUC A;  1LTR D;  3BVM A;  4JK1 C;  1EZ8 A;  3BZK A;  3BYT B;  5I2X A;  2R3Z A;  2NZO A;  2NUC A;  2E2J B;  2VW9 A;  5EPL A;  3TBI B;  2B8F A;  1TWG B;  4PMB A;  2F0M A;  5CR3 A;  4G4K A;  3I4M B;  5IWA Q;  1Y8O B;  3UE1 A;  1K9M C;  2K32 A;  2JA6 H;  2JA5 B;  4LF4 Q;  3D8G A;  4O1N A;  3HKZ E;  4JI7 Q;  1C9O A;  3A55 A;  1MKH A;  2KUM A;  1E7Z A;  2ZJQ A;  4A3J G;  4HR7 B;  2NVQ B;  3VA5 A;  4B3M Q;  5M3M H;  1CA6 A;  2EJF C;  3RLN A;  1WI5 A;  1QE6 A;  2SNM A;  3K80 C;  2RSO A;  5KNB A;  4DAV A;  4GLA C;  4P72 A;  3M4O B;  3SVM A;  1KAB A;  2JA5 H;  3QO2 A;  1GJX A;  1RD9 D;  2JJQ A;  4HJ9 A;  2IX1 A;  2EYJ A;  1SSO A;  1TWA B;  4IJH A;  1KRT A;  3CF5 A;  5LMU L;  1KAW A;  3U4V A;  2JEB I;  1Z9F A;  2JK8 A;  5DM7 3;  3ND8 A;  1X3F A;  1QZH A;  4KV6 A;  5C4J B;  4A3C G;  4C3J G;  1X55 A;  1IYJ B;  1Y14 B;  4LWC A;  5FLX L;  1GUN A;  1DM0 B;  1TKW B;  3AQQ A;  2ICE C;  4YIJ A;  1PZJ D;  3ERS X;  4IUN A;  1LT6 D;  3E0E A;  3NBI A;  5I6Y A;  1E3P A;  1EFI D;  2UXC Q;  2E5L L;  4HIM A;  3P20 A;  1SDF A;  4BBR B;  1YVC A;  2IT1 A;  4JI8 Q;  4L6T B;  1KTK A;  4LUO A;  1A15 A;  3OWE B;  1STN A;  2A19 A;  2F0V A;  2K1B A;  1DZ1 A;  5I4D A;  4LF5 Q;  4NPS A;  2WII B;  3V96 A;  3TRE A;  1J5E Q;  1KLG D;  3DEO A;  2HQL A;  2B63 H;  1SR3 A;  3SGI A;  2X6G A;  3MFY A;  4JV5 Q;  3QIA A;  2VUM H;  3M7N A;  1I94 L;  4LF9 Q;  3HOZ B;  1KAA A;  5IYD H;  1B4O A;  3HKZ B;  4R4C A;  1CSQ A;  1H9K A;  3DWQ A;  5BN3 A;  2B2W A;  4G7H C;  1OXU A;  4RGM A;  4X62 L;  3NUC A;  1Q81 C;  5ELC A;  3ULJ A;  3MXN A;  2IW3 A;  3X3M A;  4HAE A;  1FJG L;  2E8G A;  3V05 A;  3A8K E;  5IGF A;  2F3W A;  3HP3 A;  3TS0 A;  1C48 A;  4A3G G;  3CP0 A;  2L9H A;  1NR2 A;  1U5K A;  4UP9 A;  2NN6 H;  1ENF A;  5BN4 A;  3PF4 A;  3CC4 A;  1R4Q B;  1X3E A;  3KF8 B;  2K28 A;  1NTG A;  3K0Y A;  1Q3L A;  2PI2 A;  4OO1 I;  4P75 A;  4FXK C;  1CSP A;  3PO3 B;  1STA A;  5EKI A;  3TP6 A;  3D6C A;  1W2B A;  1SRO A;  4ZYS A;  4GZY C;  5A2Q E;  3DWA A;  4X64 Q;  4DR5 Q;  5D3D A;  4IFD G;  4XTC S;  1GKH A;  4TKO B;  1RKN A;  3H09 A;  3ITP A;  3KUP A;  3FKI G;  4WRD A;  2F4V L;  2B2Y A;  1Y1V B;  4F7X A;  2N55 A;  2QGQ A;  2AUK A;  2K03 A;  2F0O A;  1V1Q A;  4F88 A;  5LMU Q;  1H95 A;  1S72 A;  2BCO A;  1PTO C;  4L5S A;  4DV6 Q;  5KYI A;  4JBW A;  3E9H A;  3S1N B;  1D5M C;  1S5F D;  1SAP A;  1N32 Q;  1PH9 A;  2SNS A;  4OX9 Q;  1KIX A;  2YU9 H;  5LL6 S;  5DNF A;  3WDN A;  1MJC A;  1WTX A;  4P73 A;  3WOE A;  4JYA L;  1YZ6 A;  1VS0 A;  2K4K A;  2ZTC A;  4DAY B;  2K5Q A;  2K01 A;  1WCM B;  3PQI A;  1S5E D;  3DHQ A;  3H3V I;  1Y8N B;  3OIP A;  5J1Z A;  2VQE L;  2K14 A;  4CDD C;  1VQ9 A;  1D5Z C;  1DXM A;  3J7A F;  1AEX A;  4HIK A;  1CKO A;  2KHI A;  4NXM L;  4XYQ A;  3CCJ A;  1H9M A;  2I5H A;  4WJ4 A;  2K7V A;  4LUV A;  3HOW G;  1M1K C;  4LF9 L;  1N33 Q;  4AYB G;  4ZLT F;  3Q23 A;  2ICI A;  4A93 B;  1LAC A;  5CYU A;  2PNH A;  1GUT A;  2EQS A;  4IUU A;  1K28 A;  4X3K A;  1Q8I A;  3MXU A;  1Q82 C;  1TWG H;  3PUY A;  2JQO A;  5IIF A;  1FJG Q;  3D6W A;  5C44 B;  3TME A;  3OHX C;  3L0O A;  1HA5 A;  2KEN A;  4RMF A;  1TVX A;  1Z7T A;  1EY0 A;  2JXM B;  1Z6H A;  4OWW B;  1LTS D;  2NN6 I;  5COR A;  1X9N A;  1JJG A;  5GAH C;  2M00 A;  4BY7 H;  4BY1 G;  3GTJ B;  1PH1 A;  2ZXO A;  4DR6 L;  2RCN A;  3T56 B;  1CT1 D;  2WB1 B;  2I5L X;  3PSI A;  3KLR A;  4BWG B;  4DV2 Q;  2VB3 X;  3S17 B;  1VF5 C;  4LMQ D;  3VDY A;  4DK6 C;  2RDF A;  4N9T A;  5JVG 3;  3L2P A;  2VUM G;  3BU2 A;  2J4X A;  3VYS A;  2Z4I A;  1CUK A;  4JI5 L;  1A3U A;  3CRL C;  3KDF B;  3G71 A;  4R8N A;  3J80 E;  1IL2 A;  1IL8 A;  5C0X I;  2K04 A;  4NDX A;  4UP8 A;  1KRS A;  2R7Z B;  3K0X A;  1VQH A;  3KLS A;  4LJZ C;  2K75 A;  1G6P A;  3PO3 G;  1CZW A;  4PG3 A;  1JQY D;  3GTO H;  1V43 A;  1G6Z A;  4IPC A;  4JYA Q;  3S16 B;  5CBA E;  2BH8 A;  4OIK A;  3A8J E;  1NY4 A;  2K5N A;  2SDF A;  1SEB D;  4A3M H;  3W3A A;  1I4R A;  1UE5 A;  3CMA A;  3I91 A;  2CVR A;  3NSW A;  5A2Q L;  1OTC A;  1CHQ D;  4GKJ L;  1WTR A;  1Y69 U;  2E5L Q;  5C4H A;  3F2U A;  2B2Y C;  3KLS X;  1XXG A;  5COY A;  1IHZ A;  2CH4 A;  3S16 H;  2EPB A;  2E2J H;  4B9W A;  2E76 C;  3IKJ A;  3VR6 A;  4LF5 L;  1HTP A;  5C0X J;  2F0D A;  3A7A B;  4BBS B;  4KKS A;  1B9N A;  3JAM E;  3C1E A;  2AQ2 B;  2N3S A;  4B3S L;  1BCP B;  3KBX A;  4XQJ A;  4V0B A;  2A69 C;  4BBS G;  2JE6 I;  1DOM A;  1I4Q A;  5EGT A;  1HQM C;  1KQS A;  2XVS A;  4LF7 Q;  1STH A;  3TDQ A;  1SYF A;  3R8B A;  3K81 C;  1EY6 A;  1KL9 A;  2JA8 G;  3BYY B;  4ZCK A;  3VYU A;  2N8N A;  2OTL A;  3G4S A;  1JCK B;  3TN2 A;  1R9T H;  1SJE D;  4HJ7 A;  2N49 A;  1XPR A;  5IP7 H;  2VQF Q;  3DXJ C;  2EDG A;  1AN8 A;  1SMY C;  1X65 A;  3UDI A;  4C3H G;  2PMZ B;  3I55 A;  1CI3 M;  1N36 L;  4B3R L;  3GTK H;  4C3H B;  1D5X C;  2UXD Q;  2MGS A;  4BBS H;  4LFC Q;  3I70 A;  4RGO S;  3I73 A;  2B39 A;  3M4Y A;  3X3N A;  4L8J A;  3R2T A;  4OWT B;  3GTJ H;  3HOW H;  3HKZ G;  2HQE A;  3KF6 B;  2ASB A;  3QWN A;  3NHH A;  4KY6 A;  2JA8 H;  3DWP A;  2PZW A;  1IZ6 A;  1HPC A;  4POF A;  5EBC A;  1UE6 A;  3GTG B;  2HHH Q;  1SYG A;  5JVH 3;  5C3X A;  3NEL A;  4ZRZ A;  5ELD A;  3JAM i;  2IJ0 A;  4TRD A;  2IPK D;  5M5W H;  4UPA A;  2QDL A;  1ESR A;  3BDL A;  1PVO A;  2A1A A;  1PH2 A;  1EEI D;  2CWP A;  3U58 A;  1CQF A;  4X65 L;  1YEZ A;  4OO1 G;  1BO0 A;  1TY0 A;  1BXT A;  3NWT A;  3HOY G;  2D9U A;  4C1N K;  1V1P A;  4EQO A;  1A8V A;  1XNQ L;  1K3R A;  4DKA C;  4DK3 C;  4IUQ A;  4OO1 H;  2UXB Q;  4RGT A;  2DGY A;  2DJF C;  3C2P A;  1UE1 A;  2F0P A;  5C5L A;  1L2F A;  1QZG A;  3OW7 A;  2EXZ A;  2XWB B;  3S9W A;  2JA8 B;  2B29 A;  1TR5 A;  2V1C C;  2R7Z G;  2VQE Q;  2MFI A;  3J81 E;  3OMC A;  2A6E C;  2P5Z X;  3E9I A;  3V2T A;  4FF3 A;  1FGB D;  1TWH H;  4CBV A;  5C6A A;  4DV7 L;  3GTG H;  1JB7 A;  1EFW A;  1TU2 B;  3CCS A;  2FJ2 A;  3HOU B;  1ET6 A;  3GTP H;  4NXM Q;  3H6M A;  3A56 A;  5A35 A;  2YV5 A;  2ZT9 C;  5ELE A;  1EYA A;  3DMU A;  1IXR A;  2QCP X;  4LF7 L;  2LY7 A;  5CGK A;  2A69 D;  1CKM A;  4JOI C;  3EQL C;  3CCU A;  4A3L H;  2EY5 A;  4OEM B;  3A5Z B;  1XMO Q;  3GTQ B;  2NVY B;  2L12 A;  1IYV A;  4BY1 H;  3BZC A;  2L55 A;  1SBB B;  3EJI A;  2ZXP A;  2WFW A;  4MNO A;  4ME5 A;  3Q6S A;  2A6E D;  4BBR H;  1LTI D;  2MQH A;  4B08 A;  1QVF A;  1LTL A;  1PH7 A;  3FVQ A;  1R4P B;  3TS2 A;  3LWE A;  1I5F A;  4ZQ3 A;  2Q8T A;  1Q7Y C;  1MBY A;  1N36 Q;  1F77 A;  4B3R Q;  1RIP A;  3CCM A;  1L0Y B;  4JI0 Q;  1WTV A;  2MNA A;  1PH8 A;  3DEP A;  1EY5 A;  1UWV A;  3Q22 A;  4QCL A;  3NTI A;  3UE0 A;  4A3D B;  1VQA A;  4A93 G;  1YIJ A;  1F9P A;  2BE5 D;  1CTM A;  1PFM A;  3S2H H;  4K6L A;  3I4O A;  1K83 H;  2WP8 J;  2DY7 A;  2PO4 A;  4A3I H;  4B3T Q;  3FPU B;  1TS4 A;  3EIV A;  3T16 A;  4HMJ A;  4A3I G;  4A3M B;  1KNE A;  1P16 A;  4DV3 Q;  2CW0 D;  1ESF A;  1U0L A;  5EPJ A;  2B2U A;  1BF4 A;  1JMC A;  4NW2 A;  1LTG D;  3GTM H;  3HOY H;  2UXB L;  4PQX A;  4P71 A;  1EYC A;  1PFB A;  2IL8 A;  1RTO A;  1O7Z A;  2MUY A;  2KEC A;  1GHJ A;  1GUG A;  2C5C A;  1NBW A;  1WTP A;  2A5H A;  1PRT B;  4GKJ Q;  4QY7 A;  1X32 A;  3GTM B;  3HOY B;  3EBE A;  1GUS A;  1CA5 A;  3HOX H;  4F87 A;  1OXV A;  1YHA A;  3CQZ H;  4C3I B;  2R61 A;  3OYY A;  2AMC B;  1IBM Q;  3U4Z A;  1WCM G;  4A3G H;  3GV3 A;  5GQO A;  1D2B A;  1QCB D;  2D0P A;  2FMC A;  5FJ8 H;  2EY1 A;  1OXT A;  4P2C B;  1OXS C;  1SNQ A;  3R2I A;  1CFM A;  1CHP D;  5T1G A;  2XRQ D;  5C3E B;  2RSN A;  3BVZ A;  1S5D D;  1BBW A;  1QB5 D;  3J80 i;  3DM3 A;  3BDC A;  3LGJ A;  4Y52 H;  3SR1 A;  1WTW A;  3ULP A;  1VQI A;  4A3B H;  5IY0 A;  3IAY A;  2C9O A;  1JE5 A;  1VQE A;  5ELO A;  5IYC G;  3PIO 3;  3S15 H;  4DAP A;  4BBR G;  2L11 A;  3S24 A;  2UUC L;  1YNN C;  1XJV A;  1K3B C;  2LS0 1;  5FLM H;  5IYC H;  2F4I A;  2KCN A;  1EIH A;  1HNZ Q;  3CC7 A;  3S1R H;  1RTN A;  3KBG A;  1N34 L;  5C44 G;  4G7O C;  1EIF A;  2L4N A;  1ASY A;  4A3L G;  1X6O A;  4HIO A;  3KFU A;  4FXG C;  4TVA B;  1PA6 A;  3QJY A;  2Q2T A;  2WAQ B;  4RKB A;  1I3Q H;  2F52 A;  2XWJ B;  5CMD A;  3DLL A;  3W5O A;  3I90 A;  3EN2 A;  5E3F A;  3VR5 A;  1JOR A;  1VQ6 A;  3GO5 A;  4NKL A;  1EYG A;  4IZ8 A;  4DFA A;  1VQK A;  4LF4 L;  3HKS A;  4OXP A;  4JI7 L;  1HZB A;  1YJN A;  1STB A;  1FYC A;  4GN5 A;  4C3I G;  2Q2U A;  3G6J B;  3KF6 A;  1AZQ A;  3SK8 A;  1D8L A;  1TWC H;  1VQM A;  2ZJP A;  4JVZ A;  2Y0S E;  3G6E A;  1QG7 A;  1BDO A;  1QJO A;  1HRJ A;  4I7A A;  2KCC A;  3S17 H;  1I4X A;  1FNU A;  2UUB Q;  2ZM6 Q;  4KD3 A;  5IT9 L;  5KIX A;  2OWO A;  3PO3 H;  3J80 L;  4IFD I;  2E74 C;  1WYD A;  1HR0 L;  4OIJ A;  2K5H A;  3MZ5 A;  1BNZ A;  2KED A;  2ZTE A;  4ODG A;  2WV6 D;  2PI2 E;  4C1N I;  1BUV T;  4IPH A;  4EQN A;  2PQA A;  2IX0 A;  4OON A;  5J22 A;  5GRO A;  2QA4 A;  4LFA L;  2NVX B;  4A3E G;  1EIG A;  3LWU A;  1P8L A;  2WAC A;  4OL7 A;  1PMR A;  3RR5 A;  2Q8I B;  4KHP Q;  3F1Z A;  2UXC L;  3STB D;  4ZK9 B;  4GOP A;  2JA7 H;  1O7L A;  1IKM A;  3RZD B;  2NB0 A;  4JI8 L;  4LF6 Q;  1RDP D;  1QOH A;  4PV1 C;  1LTA D;  1ICF B;  5FK9 C;  2QIL A;  1NNX A;  4DN4 M;  1YNN D;  4AYB E;  4ZKC B;  1UAP A;  4KJN A;  5I9P A;  5K5P A;  1VQG A;  4DV0 Q;  5C3E H;  2PZT A;  4KKT A;  4R8I A;  1HNZ L;  2YTV A;  2JA7 B;  2PYK A;  3O13 A;  3NTK A;  2EYM A;  4R4I A;  4PZ7 A;  2NTS A;  5C4Z A;  2K50 A;  4YHH Q;  4A3B B;  1I50 B;  4A3D H;  1PTO F;  1WD0 A;  4DXF A;  4ME3 A;  4DR7 L;  3PIP A;  4G57 A;  4JOI A;  5IP9 G;  4G7Z C;  4I65 A;  1M90 C;  2Y0S B;  1BBU A;  2E75 C;  2UU9 L;  1RCV D;  1GUW A;  2N88 A;  3FRP B;  4EQ5 A;  2L0C A;  4IAL A;  3PUX A;  5G3L F;  4K14 A;  3S2D B;  5BR8 L;  3S1N H;  1JC7 A;  3E6Z X;  4RKL A;  3K5L A;  4LNQ A;  1ASZ A;  2B2T C;  1PTO H;  3CME A;  1J6Q A;  4A3E B;  2PQE A;  3HOU H;  2PNR C;  4GLV B;  4CDE C;  4DK0 A;  3PUV A;  3J7A 5;  2A68 D;  4TSS A;  3ZYY X;  1HZC A;  1JOQ A;  1HNX Q;  3WWV A;  2KCM A;  5LMN W;  1XMQ L;  4NB3 A;  5D3I B;  3I4L A;  1Y8P B;  5GAG C;  5FOB B;  1PV4 A;  1U4R A;  4GNX B;  1V9P A;  1SMY D;  1SFO B;  1MSH A;  1YBY A;  4L5T A;  4OX9 L;  1LM0 A;  4JCV E;  4LFA Q;  4GKK L;  1G91 A;  3MA2 B;  4DR3 L;  2R92 H;  1NAP A;  5CC4 A;  2Z6K C;  4GNX A;  1FGU A;  2OF1 A;  3DUZ A;  1VQL A;  5IGC A;  5CV4 A;  2IHF A;  3BJU A;  2K5V A;  3MXN B;  1KDC A;  4HJA A;  4F8M A;  2OT2 A;  3M4O H;  1GD7 A;  4A3B G;  3A8I E;  2FMM A;  4RA8 A;  2YTX A;  1HFG A;  1VQB A;  3FHW A;  1EQQ A;  1I6H H;  4RCN A;  3RLF A;  1O7I A;  3ND9 A;  1JT8 A;  4KJO A;  1V1O A;  4A75 A;  2LXK A;  3C1F A;  4DR2 L;  1SE8 A;  1LTB D;  2UUC Q;  5HGT A;  1S5B D;  4YHH L;  4QL5 A;  3D31 A;  4IOC A;  4PMC A;  4BY7 B;  5EBD A;  1XNR Q;  3TP5 A;  1I4P A;  4MZ9 A;  5HGQ A;  3RMH A;  3ER0 A;  3I4N H;  4JI4 Q;  1KDB A;  1X3G A;  2R93 H;  4DAY A;  2XNA C;  2UU9 Q;  1EQT A;  4JI2 Q;  3GTP B;  1Z47 A;  1XPO A;  4J1M A;  1ZXT A;  2F3V A;  4WJ3 M;  1PZI D;  1R9T B;  4LF8 L;  3I72 A;  2A74 C;  3H91 A;  4DNR B;  2D5D A;  1HQR D;  3M3Y H;  3TEH B;  5KND A;  1FR3 A;  4MIU A;  1MJE A;  2OEO A;  2KCT A;  2H1E A;  4ZAI A;  1LT3 D;  3NQT A;  5M5X B;  3VR4 A;  1O7Y A;  5AJ3 L;  3M4P A;  5FJ8 G;  2CH4 W;  4JI5 Q;  1W6J A;  1GVP A;  3D3R A;  4GOP B;  1O80 A;  1VQF A;  4QB4 A;  2NVQ H;  3CKI B;  1AFP A;  4LK1 C;  2LMC B;  2PW5 A;  2XTI A;  5EPK A;  2E2H H;  4E6I A;  2NVX H;  1SNP A;  2F0H A;  4KN4 C;  4IFD J;  2M9V A;  3QOJ A;  4GKK Q;  1RJT A;  1FNV A;  2EOT A;  2TSS A;  3LNN A;  5G3L D;  2ZXR A;  1JWU D;  5C0X H;  2WB1 G;  2VS1 A;  3VYR A;  4FYD A;  3SK5 A;  4DK1 A;  1B8A A;  3MEF A;  3HZX A;  2AUJ D;  4Q5V A;  3CCV A;  4KHP L;  3I56 A;  2EXD A;  5EQ0 A;  4J8Q A;  2F0E A;  2Z8L A;  3F2B A;  4CHT B;  1E1O A;  1N8R C;  2F0S A;  3A5U A;  2PW7 A;  3AFQ A;  4HED A;  4BXX G;  5EKK A;  1FVI A;  1QVC A;  1I3Q B;  2HIV A;  1MSG A;  4U67 3;  1WJJ A;  3MTS A;  4EQP A;  4DNI A;  4KHV A;  3Q8D A;  5CV6 A;  1TXY A;  4GNX C;  4H7B A;  2Z6K A;  2NTT A;  2O5J C;  3CPW A;  2HT1 A;  4B3S Q;  3T13 A;  1I50 H;  1SYC A;  2EIF A;  2F0G A;  1LTT D;  1XNR L;  2MHV A;  5CV5 A;  1PFN A;  3MEH A;  1TWF B;  1DON A;  1XTC D;  5I6W A;  4A3F G;  2E2D C;  1W6K A;  4HID A;  4K8J A;  2YYZ A;  5KGU A;  2C35 B;  3J7Y W;  2E2I H;  3B6Y A;  1V1P B;  2A68 C;  3CD6 A;  4CGY B;  1PYW D;  4HCE A;  2IHE A;  3AMU A;  2O5I C;  2L15 A;  5IYB H;  2OCE A;  5I2Y A;  1YI2 A;  2GVB A;  1KLU D;  1G29 1;  5K36 H;  1IBK L;  4A76 A;  3D4W A;  2R7Z H;  1JR0 D;  1ONL A;  4O42 A;  4PZ6 A;  4H02 A;  4PNY A;  3K5M A;  2SOB A;  3S1Q B;  1B44 D;  4MTN A;  1D1K A;  4B3M L;  2HCC A;  4LFB Q;  4A3K B;  3Q24 A;  3HOV H;  3MVV A;  2R7D A;  2A6H C;  4AYB B;  2Q8R E;  5L37 A;  3AYH B;  2KEE A;  1TWF H;  2R93 B;  4JI6 Q;  1BCP F;  2FXQ A;  2JYO A;  1VQ4 A;  2R92 G;  4CKC A;  4GS3 A;  2MO1 A;  5D65 A;  2HHH L;  1XMQ Q;  3J7Z C;  4UDU C;  3F8T A;  3I8Z A;  3NEM A;  2B2U C;  5ELF A;  1MD2 D;  3H0G H;  2WB1 E;  4CDF C;  5M5Y B;  2I5M X;  1SRU A;  4JW0 A;  4DUY Q;  2F0I A;  4IOA A;  3HOV B;  4JBK A;  3URY A;  5KEE A;  3BG3 A;  1EL0 A;  3RNU A;  4DPG A;  1SNM A;  1XNQ Q;  1G8Z D;  1FL0 A;  1HTL D;  2DUD A;  1IBL Q;  5M3M G;  4A3I B;  3K8A A;  4JI3 Q;  3T1Y L;  2E2H B;  1J8I A;  2G9H D;  4Q0F A;  3U9S A;  3PV0 A;  3OTO Q;  3K7A B;  4GOP C;  1QNK A;  4HMI A;  3QR8 A;  1HFN A;  4XYO A;  2EE1 A;  1SE4 A;  3NBH B;  2XRS D;  4JC0 A;  1SXT A;  2EYP A;  1J5E L;  1X54 A;  5IP7 G;  4X64 L;  4DR5 L;  3SHL A;  2WKC A;  3IFD A;  4FVM A;  3OIQ A;  5FO9 B;  1PTO D;  1VQC A;  1I94 Q;  4N9P A;  1OO9 B;  3M4Q A;  4DR2 Q;  1HJP A;  3MAQ A;  1DJR D;  1SE3 A;  1T5X D;  4K0K Q;  4X3T A;  3P75 A;  3CRK C;  1QNU A;  4YWM A;  1XTD A;  2RHQ B;  5C0X G;  4FXD A;  1GOZ A;  1JIC A;  3J7A V;  2N78 A;  4JI2 L;  4NXN L;  3GD7 A;  2WKD A;  4GN3 B;  1C0A A;  1YNJ D;  5FO8 B;  3D4R A;  2EYF A;  2MP1 A;  1JE4 A;  1U4P A;  3T4A C;  3IFT A;  2B63 B;  3NEN A;  4A3F B;  2F3I A;  1EY8 A;  2CCZ A;  2F4V Q;  2NVT B;  1E22 A;  1C4Q A;  5GAD C;  1V8Q A;  5AJ3 Q;  4FP5 D;  4JI6 L;  1TWC B;  2XSC A;  2KQ3 A;  4DV1 Q;  1XX8 A;  2EJG C;  4IN3 A;  2KHS A;  3L3O C;  4DV6 L;  4I7Z C;  5LMN Q;  5C5M A;  5JPM C;  4A3K G;  2NBF A;  3M9B A;  1N32 L;  1TII D;  4OHJ A;  2M2L A;  4A3F H;  2I46 A;  4KY5 A;  2EZV A;  5C4X H;  1GHK A;  4HSP A;  2QW7 A;  4MN3 A;  3MXG A;  4IUR A;  5BN5 A;  1ZYR C;  3HGB A;  4XT3 B;  2RA4 A;  4X3S A;  4JI3 L;  3T1Y Q;  1LUZ A;  4DUZ L;  4N8X 1;  5JJI A;  1MGS A;  3S14 H;  2QF7 A;  4KY7 A;  2XGT A;  4RCO A;  4KK7 A;  1D6E C;  3RZD H;  2VXW A;  4DR6 Q;  3TP7 A;  5DLQ E;  4OEL B;  2Z6B A;  3MC0 B;  1L0W A;  1SMX A;  1I4H A;  4DGZ A;  5C4X B;  2OTJ A;  1VCI A;  1UNS A;  3PO2 B;  5FLM G;  1H9R A;  4XQQ A;  2K05 A;  5CV7 A;  4RFB A;  3H3V H;  1Y1W G;  3K59 A;  1CZG A;  1N9W A;  1F2M A;  3F2D A;  1E2Z A;  1AE3 A;  1E1T A;  1JJ2 A;  2EY6 A;  3ICE A;  1TS5 A;  3RZO B;  4A3J B;  3VR3 A;  1B1Z A;  1VQJ A;  4ZUJ A;  3U50 C;  2VUM B;  1B9M A;  4YCV A;  3D4D A;  3N52 A;  1HA6 A;  4K8I A;  3IL8 A;  1TWH B;  5ELB A;  1GUO A;  4N8F A;  2BOS A;  1NSN S;  3HS0 C;  3MXP A;  5IT9 E;  2CWA A;  2BDN A;  2DY8 A;  1EWH A;  1RHP A;  2JP1 A;  3K7U C;  4FF2 A;  1K0S A;  2R6G A;  4FO2 A;  4DV2 L;  1IBK Q;  3MHB A;  3I7F A;  3D0F A;  1DOL A;  4C3J B;  1PLF A;  1D1I A;  2FIN B;  1WVL A;  1I6H B;  5M5Y H;  4C2M B;  5IOD A;  5JJZ A;  3RN5 A;  2ZTD A;  4BS9 A;  3FP9 A;  2JA7 G;  4JBM A;  1W3S A;  1VQ8 A;  5DM6 3;  3UI2 A;  5M9O A;  4LFB L;  3RD4 A;  4A3M G;  3H15 A;  1G51 A;  5FLX E;  2KHJ A;  3BVG A;  1A2U A;  1NCV A;  1F2Y A;  1F2L A;  2I07 B;  3A54 A;  2YTY A;  4TQU S;  1HZA A;  4KKU A;  1Y1V H;  4DR1 L;  2PQA B;  1C7Y A;  2L1B A;  3GTL B;  1M4V A;  4R4O A;  1WTH A;  4BA1 I;  2HDL A;  1VDZ A;  4RH6 A;  1F9R A;  2DNC A;  2BE5 C;  1K0R A;  3L7Z C;  4GLX A;  1NMG A;  4K5W A;  5IYB G;  2ZM6 L;  1ZYR D;  3S2H B;  1HH2 P;  2KJX A;  4KTA A;  5DEH A;  1EWC A;  4DR4 L;  1PDQ A;  1SJH D;  5IT9 c;  1HR0 Q;  4DNT B;  4IO9 A;  2B8G A;  1DOK A;  1Q12 A;  1U4M A;  5IWA L;  3C3L A;  2LFN A;  3CW2 C;  3J81 j;  3OTO L;  5IOC A;  2B3G A;  4WOR A;  3FMC A;  1HNW L;  3PCO B;  4IUV A;  1HR0 W;  3C46 A;  1A62 A;  1BCP C;  1ENA A;  1LV9 A;  1VQP A;  5FO7 B;  2RBM A;  5GAE C;  1QIL A;  1H9S A;  4HCS A;  4R4Q A;  4IFD H;  1A3V A;  2Z0S A;  4JBJ A;  2JN4 A;  4BXX H;  4FF4 A;  1BVS A;  4ILW A;  3W1B A;  4WJW A;  4Z9C B;  1TS3 A;  4GN4 B;  5T1I A;  2DN8 A;  4A3K H;  2NN6 G;  2PZU A;  1LAB A;  1LO5 D;  1SYE A;  2Z4H A;  3KLW A;  3PO2 H;  3RN2 A;  2NZH A;  3KF8 A;  3QG1 A;  4KN7 C;  3I4M G;  3Q0A A;  1K8G A;  3CHB D;  4UP7 A;  4X65 Q;  2EYL A;  2AKW B;  3SK6 A;  2GN5 A;  1EYD A;  4EGV A;  1KC8 C;  2RKS A;  1S40 A;  4YWK A;  4AH6 A;  1PRT F;  2B2V C;  1JOK A;  5E7N A;  1GM5 A;  4HSV A;  2D0O A;  1EQV A;  4DR7 Q;  3HRZ C;  2KOL A;  1VMP A;  5JEA G;  1YJW A;  2VZA A;  1PXU A;  2BH2 A;  3EA6 A;  4XXE A;  4S3S A;  4NP5 A;  4DU9 A;  4DV7 Q;  4JI1 L;  1SNO A;  3W2D A;  4QIW E;  1KD1 C;  1EU4 A;  2AWN A;  1TWA H;  5BR8 Q;  1PHJ A;  1FD7 D;  2VB2 X;  4C2M H;  4C56 C;  1JB3 A;  4HN7 A;  4A3C H;  5KYL A;  1F9Q A;  2D2C C;  2DJG C;  3PUW A;  4C3J H;  4J6H A;  2F0T A;  4PMW A;  3SDZ A;  3HFZ B;  4DR1 Q;  1Q86 C;  2EJM A;  1Y1V G;  5HUR A;  1EQR A;  2B2W C;  3PIP 3;  2IWH A;  4RWS C;  1LYL A;  5JOB A;  2BA1 A;  3RUZ A;  5JPN C;  2YU9 B;  1RF2 D;  1STY A;  1BCP D;  4CKB A;  2JA5 G;  1PH5 A;  4DXG A;  5M3F B;  4AQY L;  1HNX L;  1EOV A;  2EYO A;  3AU7 A;  3KJP A;  1X3Q A;  1ZEQ X;  4DR4 Q;  4QQB X;  4R9W A;  3GTQ H;  3I4M H;  4DUZ Q;  4QMG A;  1EEF D;  1JJC B;  2RF4 A;  4H0L C;  4A3J H;  3AEV A;  4XT1 B;  2K6A A;  4LUZ A;  1AE2 A;  4K2L A;  1HNW Q;  1OXX K;  1E2V A; 
#chains in the Genus database with same CATH homology
 3PGZ A;  3A5U A;  1K8A C;  3AFQ A;  4BXX G;  3BZK A;  1FVI A;  1QVC A;  4BY7 G;  2HIV A;  4BY1 H;  1WJJ A;  3BZC A;  4DNI A;  2NZO A;  3Q8D A;  4JG2 A;  1TXY A;  1PFS A;  4MNO A;  2WFW A;  4GNX C;  4A4I A;  2Z6K A;  4BBR H;  1PYB A;  2MQH A;  2VW9 A;  1XPU A;  1QVF A;  1T9H A;  3CPW A;  2HT1 A;  1LTL A;  4B3S Q;  1PH7 A;  1CKN A;  1I50 H;  2EIF A;  3TS2 A;  1XNR L;  4Y7N H;  5IWA Q;  1VQD A;  1I5F A;  4P74 A;  3UE1 A;  1VQ7 A;  4IPD A;  1Q7Y C;  1K9M C;  2JA6 H;  1N36 Q;  1MIU A;  1S3O A;  4B3R Q;  1RIP A;  3CCM A;  4A3F G;  4LF4 Q;  4JI0 Q;  3HKZ E;  4JI7 Q;  1C9O A;  1MKH A;  4HID A;  2YYZ A;  2C35 B;  1E7Z A;  2MNA A;  2ZJQ A;  1PH8 A;  2E2I H;  4A3J G;  3B6Y A;  4APV A;  1UWV A;  4B3M Q;  3CD6 A;  3UE0 A;  1VQA A;  5M3M H;  1Q8K A;  2IHE A;  4A93 G;  1YIJ A;  3G48 A;  3RLN A;  1WI5 A;  3K80 C;  2L15 A;  1KHI A;  4GLA C;  4P72 A;  5IYB H;  1VQ5 A;  3S2H H;  2OCE A;  4A3E H;  2JA5 H;  5H1S E;  2JJQ A;  3STB C;  1YI2 A;  4HJ9 A;  2GVB A;  2IX1 A;  1G29 1;  1E24 A;  1L1O A;  3I4O A;  4IJH A;  1K83 H;  1KRT A;  3CF5 A;  1KAW A;  5LMU L;  2WP8 J;  3U4V A;  4A76 A;  2R7Z H;  2JEB I;  1Z9F A;  2JK8 A;  4PZ6 A;  4A3I H;  4H02 A;  4B3T Q;  4JI0 L;  1X3F A;  2MO0 A;  1QZH A;  4JI4 L;  1L1O B;  3EIV A;  4MTN A;  3GTL H;  4B3M L;  1PYS B;  4A3I G;  4A3C G;  1P16 A;  2HIX A;  4DV3 Q;  4LFB Q;  1X55 A;  1IYJ B;  1U0L A;  1Y14 B;  4LWC A;  3HOV H;  2R7D A;  4JI1 Q;  1JMC A;  3PUZ A;  3AQQ A;  3GTM H;  3HOY H;  3ERS X;  3AYH B;  2UXB L;  1TWF H;  4P71 A;  4JI6 Q;  1YJ9 A;  3E0E A;  2FXQ A;  1VQ4 A;  2R92 G;  4GS3 A;  1N33 L;  1SN8 A;  1E3P A;  2MO1 A;  3A0J A;  4X6A H;  2UXC Q;  2HHH L;  2PMZ E;  4HIM A;  1NBW A;  3J7Z C;  1XMQ Q;  2E5L L;  2K52 A;  3TRZ A;  3F8T A;  3NEM A;  1YVC A;  2IT1 A;  4JI8 Q;  3H0G H;  1D7Q A;  4GKJ Q;  3KYH C;  2WB1 E;  4QY7 A;  4LUO A;  4DV3 L;  1HZ9 A;  2I5M X;  3EBE A;  1SRU A;  4DUY Q;  3HOX H;  2A19 A;  1OXV A;  4IOA A;  1YHA A;  3CQZ H;  4JBK A;  4LF5 Q;  3OYY A;  2AMC B;  1IBM Q;  3RNU A;  3U4Z A;  4NPS A;  4DPG A;  1WCM G;  4O0A A;  3TRE A;  1J5E Q;  4A3G H;  3ULL A;  1XNQ Q;  5GQO A;  3S2D H;  1FL0 A;  2HQL A;  2D0P A;  3J81 i;  5FJ8 H;  1SR3 A;  4HJ8 A;  2B63 H;  3SGI A;  3ZJY C;  4JV5 Q;  2VUM H;  2DUD A;  2AWO A;  1OXT A;  1IBL Q;  3I2Z A;  5M3M G;  1OXS C;  1I94 L;  3M7N A;  3K8A A;  3RLO A;  4JI3 Q;  3JAM c;  3T1Y L;  4LF9 Q;  2JEA I;  5IYD H;  3PIO A;  3PV0 A;  4R4C A;  1CSQ A;  3OTO Q;  1BBW A;  1N34 Q;  3W1G A;  3UDG A;  4GOP C;  3J80 i;  3DM3 A;  4A3D G;  1Q1B A;  3LGJ A;  1OXU A;  4Y52 H;  4X62 L;  1Q81 C;  3NBH B;  3ULJ A;  3ULP A;  4JC0 A;  2A8V A;  1VQI A;  1J5E L;  1FJG L;  2E8G A;  1EUJ A;  1X54 A;  5IY0 A;  5IP7 G;  4X64 L;  4DR5 L;  1JE5 A;  1PH3 A;  1VQE A;  5ELO A;  5IYC G;  4ALP A;  3S15 H;  4BBR G;  4UY8 C;  2VNU D;  3AFP A;  3S24 A;  1EWI A;  5C4J H;  1VQC A;  1XJV A;  1I94 Q;  2UUC L;  5FLM H;  3TS0 A;  5IYC H;  5M3F G;  4A3G G;  3M4Q A;  4DR2 Q;  1HNZ Q;  3CP0 A;  3CC7 A;  1HJP A;  1U5K A;  4UP9 A;  3S1R H;  3PF4 A;  3CC4 A;  1N34 L;  2R7F A;  5C44 G;  1X3E A;  5J3B A;  3KF8 B;  1EIF A;  1NTG A;  2PI2 A;  4DV5 L;  1ASY A;  4P75 A;  4A3L G;  4K0K Q;  1CSP A;  4OO1 I;  1X6O A;  2WAQ G;  4YWM A;  4HIO A;  1PH4 A;  1XTD A;  2RHQ B;  3KFU A;  1W2B A;  3CAM A;  1SRO A;  4TVA B;  5IYD G;  2LXJ A;  1PA6 A;  4X64 Q;  4DR5 Q;  4IFD G;  4XTC S;  5C0X G;  1GKH A;  3M85 A;  2Q2T A;  3FKI G;  2F4V L;  1I3Q H;  2F52 A;  3DLL A;  2N78 A;  3W5O A;  4JI2 L;  1BKB A;  4NXN L;  3GD7 A;  2QGQ A;  4YWL A;  3EN2 A;  4GN3 B;  1C0A A;  1A63 A;  1Q1E A;  1V1Q A;  1VQ6 A;  4LW1 A;  4O2D A;  1CKN B;  3GO5 A;  5LMU Q;  1H95 A;  3J80 c;  1S72 A;  1EYG A;  2H5X A;  1VQK A;  4L5S A;  1A0I A;  4DV6 Q;  3HKS A;  4LF4 L;  4OXP A;  4JI7 L;  4JBW A;  3E9H A;  4C3I H;  3HOW G;  1HZB A;  1YJN A;  2LSS A;  4BA2 I;  4GN5 A;  4A3B H;  4X66 L;  2I0Q A;  3JC6 6;  3NEN A;  1PH9 A;  1N32 Q;  2F3I A;  2Q2U A;  2CCZ A;  2F4V Q;  5HY6 A;  4OX9 Q;  3KF6 A;  1D8L A;  4XIG S;  1KIX A;  1E22 A;  1TWC H;  1VQM A;  2YU9 H;  5GAD C;  4DV4 L;  2Q2H A;  1MJC A;  4P73 A;  2KBN A;  5AJ3 Q;  2ZJP A;  4JYA L;  2NVY H;  1YZ6 A;  4JI6 L;  2Y0S E;  1VS0 A;  3G6E A;  2K4K A;  2ZTC A;  4DAY B;  4DV1 Q;  2D62 A;  3S17 H;  2UUB Q;  2ZM6 Q;  4DV6 L;  4FDB A;  2OWO A;  1QUQ B;  5LMN Q;  3PO2 G;  3PO3 H;  3H3V I;  4IFD I;  4A3K G;  1WYD A;  3H0G G;  1HR0 L;  4PZ8 A;  2K5H A;  3M9B A;  1K73 C;  1N32 L;  2ZTE A;  2VQE L;  4A3F H;  2K14 A;  1VQ9 A;  2PI2 E;  5C44 H;  1KXL A;  4IPH A;  2PQA A;  5C4X H;  2IX0 A;  1NMF A;  1YNX A;  4OON A;  4RG1 A;  5GRO A;  2QA4 A;  4HIK A;  4LFA L;  1CKO A;  2KHI A;  4A3E G;  4NXM L;  1P8L A;  3CCJ A;  5JEA J;  1PH6 A;  2I5H A;  3RR5 A;  4WJ4 A;  4LUV A;  1L1O C;  4DV0 L;  1M1K C;  4JI3 L;  2UUB L;  3T1Y Q;  1LUZ A;  4LF9 L;  4DUZ L;  4AYB G;  2CKZ B;  4AQY Q;  1N33 Q;  2ALY B;  3F1Z A;  3STB D;  3UDF A;  2UXC L;  5JJI A;  4GOP A;  2JA7 H;  3S14 H;  5ELN A;  3PF5 A;  3K7A H;  2XGT A;  4JI8 L;  2PNH A;  4LF6 Q;  2VQF L;  2EQS A;  1VQO A;  3RZD H;  4DR6 Q;  5DLQ E;  1L0W A;  4DUY L;  1SMX A;  1Q82 C;  1TWG H;  3PUY A;  2JQO A;  1FJG Q;  2ATW A;  3S1M H;  3S1Q H;  2OTJ A;  1VCI A;  5K36 G;  2CQO A;  3CPF A;  4AYB E;  3L0O A;  2UXD L;  2KEN A;  4RMF A;  4LFC L;  4YY3 L;  5FLM G;  5JJK A;  4DV0 Q;  1VQG A;  2JA9 A;  5C3E H;  1IBL L;  4OWW B;  3CCQ A;  1HNZ L;  1Y1W G;  3H3V H;  3KDF A;  1N9W A;  2NN6 I;  1X9N A;  1JJG A;  5GAH C;  2YTV A;  5EAY A;  2Q2I A;  4BY7 H;  3F2D A;  4BY1 G;  4LF6 L;  1AE3 A;  1E1T A;  4R4I A;  2ID0 A;  4PZ7 A;  4DV5 Q;  1PH1 A;  1JJ2 A;  3ICE A;  4DR6 L;  2K50 A;  2RCN A;  4YHH Q;  1XMO Q;  4A3D H;  1B7Y B;  1QUQ A;  2I5L X;  3PSI A;  4DV2 Q;  1UEB A;  1VQJ A;  4L5R C;  4ME3 A;  4DR7 L;  1NJI C;  3U50 C;  3PIP A;  4YCV A;  3VDY A;  3UDX A;  3KJO A;  4DK6 C;  4JOI A;  5IP9 G;  1M90 C;  3L2P A;  1BBU A;  2UU9 L;  2VUM G;  3BU2 A;  2B63 G;  1YHQ A;  4EQ5 A;  5IE8 A;  1CUK A;  4JI5 L;  3KDF B;  4OWX B;  1WCM H;  3PUX A;  3G71 A;  2BA0 A;  5C4X G;  2CWA A;  3K7U C;  1IL2 A;  5BR8 L;  5C0X I;  4YCW A;  3S1N H;  4UP8 A;  4K0K L;  2R6G A;  1KRS A;  4DV2 L;  1IBK Q;  1B70 B;  3I7F A;  1SLJ A;  3D0F A;  1ASZ A;  4LNQ A;  1Q46 A;  1QVG A;  3K0X A;  1VQH A;  3CME A;  5M5Y H;  3RN5 A;  2K75 A;  2NVT H;  1G6P A;  3PO3 G;  2CFM A;  1RL2 A;  1J6Q A;  2ZTD A;  4PG3 A;  3CXC A;  3FP9 A;  2JA7 G;  2UUA Q;  4JBM A;  1W3S A;  4KI0 A;  1V43 A;  3GTO H;  3HOU H;  4IPC A;  1VQ8 A;  4NXN Q;  4JYA Q;  4GLV B;  2RHS B;  4QGU A;  2BH8 A;  4LFB L;  5JJL A;  3PUV A;  4A3M G;  3J7A 5;  3H15 A;  1G51 A;  1NY4 A;  2K5N A;  2KHJ A;  1HZC A;  2OQ0 A;  4A3M H;  1HNX Q;  1GO3 E;  3WWV A;  2KCM A;  5LMN W;  1UE5 A;  3CMA A;  4R1J A;  4NB3 A;  3HOX G;  1XMQ L;  4POG A;  5GAG C;  1PV4 A;  2YTY A;  4TQU S;  2R93 G;  1HZA A;  4GNX B;  1V9P A;  1OTC A;  4GKJ L;  2E5L Q;  1Y1V H;  4DR1 L;  2PQA B;  1C7Y A;  1YBY A;  4L5T A;  4OX9 L;  1LM0 A;  4JCV E;  3J81 c;  4LFA Q;  4GKK L;  4R4O A;  3TQY A;  4BA1 I;  1XMO L;  4DR3 L;  1SFO H;  2R92 H;  3S16 H;  2Z6K C;  2E2J H;  4GNX A;  1FGU A;  3KOJ A;  4KHZ A;  1VQL A;  2VL6 A;  4LF5 L;  2IHF A;  1K0R A;  4DV1 L;  3BJU A;  3L7Z C;  4GLX A;  1NMG A;  2K5V A;  5IYB G;  5C0X J;  3MXN B;  4HJA A;  3IRB A;  2ZM6 L;  5IP9 H;  2GVA A;  5LMN L;  2N3S A;  1HH2 P;  1GD7 A;  3CC2 A;  4B3S L;  3M4O H;  4A3B G;  4DR4 L;  5IT9 c;  1HR0 Q;  4BBS G;  2JE6 I;  4IO9 A;  3T1H L;  1Q12 A;  2OQK A;  2VY3 A;  5IWA L;  1KQS A;  4LF7 Q;  2YTX A;  3CW2 C;  4X62 Q;  3J81 j;  2JA6 G;  3OTO L;  2IY5 B;  1VQB A;  3FHW A;  2B3G A;  3K81 C;  4DR3 Q;  1EQQ A;  1I6H H;  1HNW L;  3PCO B;  3F2C A;  1KL9 A;  3RLF A;  1WFQ A;  1O7I A;  4YY3 Q;  1HR0 W;  2JA8 G;  1JT8 A;  4J15 A;  1A62 A;  4QJF A;  1Y1W H;  4A75 A;  2LXK A;  2N8N A;  2OTL A;  3G4S A;  4DR2 L;  1SE8 A;  4KLK A;  1VQP A;  1R9T H;  4HJ7 A;  3FKI H;  5GAE C;  2ZJR A;  2N49 A;  2UUC Q;  4R4Q A;  1XPR A;  5IP7 H;  4YHH L;  4QL5 A;  2VQF Q;  2Z0S A;  3D31 A;  4JBJ A;  4IOC A;  3I4N G;  4BXX H;  1X65 A;  1XNR Q;  1BVS A;  3W1B A;  3UDI A;  4MZ9 A;  5HGQ A;  3I55 A;  4C3H H;  4IJL A;  4B3T L;  1N36 L;  4B3R L;  4GN4 B;  3ER0 A;  3I4N H;  3GTK H;  4JI4 Q;  4A3K H;  2NN6 G;  1X3G A;  3CCE A;  2R93 H;  2UXD Q;  4BBS H;  3KLW A;  2UU9 Q;  4LFC Q;  3RN2 A;  3PO2 H;  4JI2 Q;  2NZH A;  5M3F H;  1AH9 A;  1Z47 A;  3I4M G;  4OWT B;  1XPO A;  1K8G A;  3GTJ H;  3HOW H;  3HKZ G;  5C3E G;  4UP7 A;  4X65 Q;  2AKW B;  3KF6 B;  2ASB A;  2GN5 A;  4WJ3 M;  1KC8 C;  4DAM A;  1S40 A;  4LF8 L;  4YWK A;  2JA8 H;  1IZ6 A;  4AH6 A;  4POF A;  5E7N A;  3HOU G;  1GM5 A;  2D0O A;  4HJ5 A;  3M3Y H;  1UE6 A;  3TEH B;  1OXX K;  2HHH Q;  3GDE A;  1MJE A;  3NEL A;  4DR7 Q;  2Y0S G;  3A74 A;  2KCT A;  4YCU A;  3JAM i;  2UUA L;  1UE7 A;  5M5W H;  4UPA A;  1YJW A;  5JEA G;  4X66 Q;  2VZA A;  2BH2 A;  1WOC A;  1PVO A;  2A1A A;  5AJ3 L;  1PH2 A;  2CWP A;  3M4P A;  3OW2 A;  1X56 A;  4X65 L;  3U58 A;  1YEZ A;  4OO1 G;  4DV7 Q;  1DGS A;  5FJ8 G;  4DV4 Q;  4JI5 Q;  1IBM L;  1GVP A;  4JI1 L;  4GOP B;  3HOY G;  4LF8 Q;  4KHP Q;  1VQF A;  5M5X H;  2NVQ H;  1A8V A;  4QIW E;  5FLX c;  1XNQ L;  1K3R A;  4DKA C;  4DK3 C;  2AWN A;  1KD1 C;  1TWA H;  5BR8 Q;  1PHJ A;  3HOV G;  2UXB Q;  4C2M H;  2XTI A;  1YIT A;  4AIM A;  2DGY A;  4A3C H;  1UE1 A;  3PUW A;  4C3J H;  4PMW A;  4DR1 Q;  2E2H H;  3HOZ H;  3HFZ B;  2NVX H;  1Q86 C;  4IFD J;  1Y1V G;  1L2F A;  1QZG A;  4GKK Q;  1EQR A;  3HOZ G;  2B29 A;  2V1C C;  1EIY B;  2R7Z G;  2VQE Q;  2MFI A;  1LYL A;  2BA1 A;  4L5Q A;  3E9I A;  2AHO B;  3GTG H;  1TWH H;  4DV7 L;  1YHB A;  2QEX A;  1JB7 A;  1EFW A;  3CCS A;  2ES2 A;  3CCR A;  2WB1 G;  2VS1 A;  4IPG A;  2WAQ E;  1PH5 A;  2JA5 G;  3CCL A;  3GTP H;  1VQN A;  4AQY L;  1HNX L;  4NXM Q;  1EOV A;  3KJP A;  1B8A A;  3MEF A;  4DR4 Q;  4QQB X;  2YV5 A;  4A93 H;  3GTQ H;  3I4M H;  3CCV A;  4KHP L;  3T1H Q;  4EX5 A;  3I56 A;  4JV5 L;  4DUZ Q;  1IBK L;  2EXD A;  1IXR A;  2RF4 A;  1JJC B;  4LF7 L;  4A3J H;  3AEV A;  3RZO H;  4LUZ A;  3F2B A;  4R4T A;  1E1O A;  1AE2 A;  1CKM A;  4JOI C;  3CCU A;  4A3L H;  1N8R C;  1HNW Q;  1NE3 A;  3A5Z B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...