2CWPA

Crystal structure of metrs related protein from pyrococcus horikoshii
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
109
structure length
109
Chain Sequence
MELYDVDEFWKFQMKVGLVKKAEKIKRTKKLIKLIVDFGNEERTIVTGIADQIPPEELEGKKFIFVVNLKPKKFSGVESQGMLILAETEDGKVYLIPVPEEVPVGARVW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords MetRS related protein
publication title Crystal structure of MetRS related protein from Pyrococcus horikoshii
rcsb
source organism Pyrococcus horikoshii
total genus 22
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2005-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01588 tRNA_bind Putative tRNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2cwpA00
1TWFH 3LGJA 3TRZA 1N32Q 3CXCA 4WJ4A 1K9MC 3AYHB 4GNXC 2N49A 4OWWB 1E3PA 4NXNQ 3BZKA 1IZ6A 3K8AA 3TEHB 1TWGH 4YCVA 2YU9H 4LF7Q 1KD1C 4UP8A 4BBSH 2MO0A 4X64Q 2R7ZH 1RL2A 4IJLA 5IYCH 1H95A 4Y7NH 4ALPA 1PYSB 2HQLA 4QGUA 4JV5L 3J80i 3RLFA 5IYDG 4OXPA 3GDEA 1QUQB 2EQSA 1UE7A 2CFMA 1QUQA 4JI2Q 1HZAA 3A0JA 4YCWA 3G4SA 1PH7A 3RNUA 3S16H 4K0KL 3HOVH 4NPSA 1HR0L 3U58A 1TWHH 3T1HQ 3KDFB 4GKKQ 3J7A5 4JI0Q 2NN6G 3KDFA 4WJ3M 3PIPA 2UUCL 1N34Q 3UDFA 5C3EH 2NZHA 2LSSA 1N33L 3I4MG 1YHQA 4HJ7A 3OTOL 1SMXA 4UP9A 2QA4A 1A8VA 4LF4L 3GTOH 2UXBQ 4A3GH 1UEBA 1KXLA 2LXJA 1XNRQ 3RZOH 4B3ML 2KHJA 4GLXA 1YHAA 3BJUA 3FHWA 2ID0A 1OXSC 4HJ8A 4GOPC 1VQIA 5IP7H 3CW2C 3CC7A 4JOIA 2UXCQ 3A74A 1NMGA 1ASYA 1KIXA 1L1OB 1N34L 1MKHA 2Y0SE 1G51A 1L1OA 1N36L 5GAGC 3S1MH 3PV0A 3KF6B 2MO1A 5HGQA 3A5UA 1XMOL 3KF6A 2JEAI 3TS0A 1EUJA 3PSIA 4MTNA 1SFOH 4BXXG 1WCMH 1JJGA 3F2CA 3GTGH 5AJ3Q 2UU9L 1VQJA 4JYAQ 5LMNW 1PH4A 4POGA 2NZOA 4BBRG 2VQEL 4PZ8A 1MIUA 2WB1E 3L7ZC 4QY7A 3HOZH 1X6OA 2OQ0A 5LMUQ 4YWLA 4TVAB 3S1NH 1EIFA 2MFIA 2BA0A 3J81i 3UE1A 4PZ6A 1HNZQ 1V43A 1VQDA 1WJJA 1Y14B 2VZAA 3E9IA 3PUZA 1X3FA 3OYYA 2MNAA 4A76A 4AQYL 4A3IG 2NVQH 2ZM6Q 3S15H 1YZ6A 4DPGA 2V1CC 2UUAL 4HIMA 1N8RC 5DLQE 3CCUA 5JJLA 1XPOA 4A93H 1NBWA 3ERSX 4X65L 5GAHC 2VQFL 4DR4L 5C4JH 4KHZA 2N78A 1WFQA 4QIWE 5IT9c 1I94L 4A3FG 3RZDH 3CCLA 4KHPL 5IWAQ 4DUYL 2LXKA 1VQ6A 4A3EH 1Q1BA 2ZTCA 1J6QA 1KRTA 4A3JG 3EBEA 3I7FA 3H0GH 2JA6G 1G291 4DV5L 5FJ8H 1E7ZA 1JE5A 4LF6Q 1YVCA 2BH2A 2D0OA 4DV0Q 1PYBA 5J3BA 2ZM6L 1Q1EA 3PIOA 1S40A 4C3HH 2JA5H 4IPGA 4GLAC 4AIMA 5JJIA 4IO9A 5GAEC 2Y0SG 2QGQA 4P73A 2B63H 4BY7G 3I4OA 3M4PA 3K80C 5C4XG 4HJ5A 1QVGA 4R4TA 3CP0A 2JA9A 1HZCA 4J15A 3UDXA 4JI7Q 4JI5Q 4OO1I 3TQYA 1EOVA 1NTGA 4YWKA 4JI1L 3STBC 3S1QH 4DV3Q 4X6AH 2NN6I 1KHIA 2K5HA 4LFCQ 3HOYH 1TWAH 3AEVA 4DR6Q 4DR3L 1X55A 1VQ5A 3CCJA 3GTMH 2GN5A 4JI4L 3H3VI 3W1GA 1K83H 4APVA 3CPWA 1PH5A 4C3JH 1JT8A 1VQNA 4JOIC 1HNXL 1IBLL 1PH6A 3GTLH 4YHHL 3KFUA 3D0FA 1FVIA 3RN2A 5JJKA 1BVSA 5IYBH 4HJ9A 1L1OC 4DV1L 3I4NH 3L2PA 3CC4A 2RHSB 1Q86C 1FGUA 3G71A 1SE8A 1XNQL 2N8NA 4H02A 4JV5Q 4DR6L 3BU2A 1JJ2A 2YTXA 1B8AA 2YYZA 5ELNA 2IHFA 4A3KH 1E1OA 2Z6KA 1NY4A 4QJFA 4POFA 1HH2P 1X3EA 4YY3L 1E24A 1VQGA 5IP9G 1PH9A 3DM3A 1BBUA 4K0KQ 3PUYA 2IHEA 2UXDQ 3CPFA 1YJWA 1GVPA 1YNXA 1Q12A 1U5KA 2HIXA 4X62L 1DGSA 1HR0Q 4BY1H 3HOWG 4DUZL 1YBYA 1J5EL 4DAYB 1HJPA 3PUXA 3HOUH 2UUCQ 3F2BA 2D62A 1Y1WH 3G6EA 1Q8KA 2I5LX 4B3TL 1YEZA 1N33Q 4AYBG 3OTOQ 3ULLA 4LF4Q 4YCUA 4P74A 1PH1A 2R7FA 4LUVA 5GROA 4B3MQ 1AE2A 4A3LG 1X65A 2E2IH 1FL0A 1EQQA 5IY0A 1VQ4A 4A3DH 2VUMG 1CKOA 1Y1VG 1T9HA 3UDIA 5M5YH 1EIYB 2JA7H 4DK3C 2UXDL 1KRSA 2A19A 4OO1G 3PF5A 1VQKA 3HOXH 3D31A 5HY6A 5GQOA 2E2JH 5M3FG 4P72A 3FKIG 2PNHA 1N36Q 1VQBA 2E8GA 1AH9A 3PUWA 4JBJA 5FLMH 2KENA 2R93G 5E7NA 3HKZG 2MQHA 1XMOQ 1HZBA 4BA1I 4IPHA 3B6YA 3ULPA 2UU9Q 3JAMc 4A3BG 2OTJA 3F8TA 2VQEQ 4PMWA 3T1YL 1CKNB 4DV6L 1WYDA 3TS2A 1CKNA 2AWNA 2PQAA 2Q2TA 1GKHA 5C0XI 4HIKA 1JMCA 4B3SL 4AQYQ 4X66L 5GADC 4A3CG 2KCTA 5ELOA 1OXXK 1A0IA 2I5MX 3S24A 1VQMA 2K14A 5JEAG 2UUAQ 5IYDH 5JEAJ 2JEBI 3NEMA 2OCEA 4X65Q 3EN2A 2VQFQ 3CC2A 4DR4Q 4DV2L 4JI6L 3ER0A 1OXUA 4A4IA 4EQ5A 1XPRA 2DGYA 1KAWA 1SR3A 1I94Q 2VL6A 4KHPQ 4DV4Q 1VQOA 4DUYQ 2Q2UA 2NVTH 3ULJA 4UPAA 3RLNA 4DV5Q 1X56A 2EXDA 4PG3A 3Q8DA 3I4MH 1GO3E 2JQOA 1Q81C 4LFBL 4L5TA 5M3MG 4JI3L 2JA8G 2Z6KC 4LF8L 3CCQA 3PO2G 4LUOA 1SROA 3H3VH 1Z47A 2CCZA 2WFWA 1NE3A 1XMQL 3GTQH 1XPUA 3PO3G 4A3BH 1PHJA 2CWAA 2AKWB 2HHHL 1X3GA 1VQAA 4NXML 3CCEA 2R7DA 1N9WA 4DV4L 4DR7L 1PFSA 2CQOA 3FP9A 3PGZA 4KI0A 2CKZB 4JI1Q 1MJEA 2VY3A 2H5XA 2RCNA 5K36G 1FJGL 1S3OA 1VQHA 1R9TH 1VS0A 3I55A 3CF5A 4XTCS 1VQ7A 2UUBQ 1C0AA 4JG2A 2ZTEA 4DR2L 1C9OA 4DR3Q 2I5HA 4PZ7A 4BXXH 3J7ZC 4UP7A 1YITA 2JE6I 4JI4Q 1VCIA 2HT1A 4BBRH 2CWPA 1Q82C 4OX9L 1IBLQ 4YHHQ 1P16A 4DR1L 4LNQA 3MXNB 5BR8L 3STBD 1UWVA 1EWIA 5C0XG 1VQ8A 1L0WA 4DV1Q 4A3IH 5C0XJ 3S2DH 2K75A 1VQLA 2WB1G 1JJCB 1WOCA 4OONA 3GTKH 2JJQA 1KL9A 2RF4A 4IPCA 4DK6C 3MEFA 2QEXA 2ZJRA 3CCVA 4JCVE 3A5ZB 4R4CA 1XNQQ 2KCMA 1KC8C 2DUDA 1AE3A 2R6GA 3I2ZA 5C44G 2VNUD 3RLOA 1B70B 2Q2HA 4YY3Q 4JI8L 4A3FH 1HR0W 4A3MG 1UE6A 1HNWL 2FXQA 2AWOA 2JA6H 4A3JH 4X62Q 2C35B 4LF9L 4B3RQ 4DUZQ 1J5EQ 5LMNL 3S14H 4B3TQ 3KLWA 4MNOA 4YWMA 2B3GA 4BBSG 1L2FA 1O7IA 1CSQA 2N3SA 3K0XA 2E5LL 2I0QA 1PH2A 2R7ZG 5C4XH 1I50H 5IYCG 4BY7H 4AH6A 4DV7L 2F52A 1EFWA 1LYLA 4DR5L 4TQUS 4GN4B 4OWXB 2A8VA 3EIVA 1HZ9A 2YV5A 3U50C 3KYHC 3J81c 4B3RL 3RR5A 3PCOB 1YHBA 2K5NA 4HJAA 1LUZA 1P8LA 3K7AH 3UDGA 1YIJA 1K73C 1V1QA 2R92G 3HOVG 1IYJB 3NENA 1GM5A 3GTPH 4R4QA 4GKJL 5C3EG 1PA6A 1KQSA 1S72A 1XTDA 4L5RC 4MZ9A 4A3GG 4A75A 4QL5A 3CMAA 4DV6Q 4FDBA 3T1YQ 2WP8J 1IBKL 3GO5A 2E2HH 2OWOA 3K7UC 3F2DA 3CQZH 4B3SQ 3RN5A 4X66Q 5IP7G 2BA1A 5H1SE 2PI2A 4LFAL 5IE8A 4JBWA 4C2MH 1PH8A 1G6PA 1IBML 4LF5L 3DLLA 4DV2Q 4JI6Q 2XGTA 5IP9H 3W5OA 1K0RA 1MJCA 3G48A 3HFZB 3JC66 1PV4A 3F1ZA 4LUZA 1N32L 3HOWH 2YTVA 1CUKA 2PQAB 1K8AC 1WCMG 4NXNL 4GN3B 3VDYA 4LF7L 2R92H 3HOZG 1BBWA 4LFBQ 5FLXc 1WI5A 2HIVA 3AQQA 2UUBL 4X64L 3K81C 2KBNA 4JI3Q 3S17H 3NELA 4LF8Q 1UE1A 4A3LH 1A62A 3KF8B 1XMQQ 2Q2IA 1Q7YC 1U0LA 4IFDI 2K50A 2IT1A 2ZTDA 2VUMH 2HHHQ 1JB7A 1Y1VH 4NXMQ 2F3IA 4QQBX 4C3IH 1NMFA 1GD7A 4JI2L 2OQKA 3ZJYC 3I56A 1SRUA 4LWCA 4IPDA 4UY8C 4DR7Q 3PF4A 4JBMA 1Z9FA 4IOCA 3U4VA 3U4ZA 3OW2A 4GN5A 3CCMA 1I6HH 3AFPA 5M3FH 1FJGQ 3FKIH 3M3YH 2IX1A 3T1HL 5EAYA 4GKKL 2B29A 4JI0L 4A3EG 4DR2Q 2R93H 3SGIA 3M85A 2EIFA 2L15A 3H0GG 4XIGS 1E22A 1M1KC 2WAQE 5FJ8G 2GVAA 3KJPA 3NBHB 2YTYA 2GVBA 4EX5A 4L5QA 4LW1A 1QZGA 4HIDA 2UXBL 2ASBA 2JA5G 4OX9Q 2IY5B 1XNRL 4IJHA 3E0EA 4DR1Q 4R4OA 5BR8Q 2ZJPA 5FLMG 2B63G 4RMFA 1TXYA 2VW9A 4A3CH 2ALYB 4GNXB 2PI2E 2ATWA 2AHOB 4GNXA 1HNXQ 1VQCA 3KJOA 2KHIA 3GTJH 1W3SA 3WWVA 3J80c 1OTCA 2UXCL 5M5XH 3M4OH 1E1TA 2ZJQA 3HOYG 4GS3A 2Z0SA 2K4KA 3H15A 3S1RH 4JI8Q 1C7YA 1NJIC 1RIPA 1HNWQ 2OTLA 4ME3A 4GLVB 1M90C 5AJ3L 4LF9Q 4JYAL 2JK8A 4HIOA 2K5VA 1YI2A 2PMZE 5LMNQ 5M3MH 1X9NA 5LMUL 2JA8H 4O0AA 1YJ9A 1EYGA 1CKMA 3ICEA 1QVCA 3L0OA 3PO2H 2F4VL 1PVOA 1HNZL 3CCRA 2E5LQ 5IYBG 4BA2I 1I5FA 3I4NG 3CAMA 3PO3H 4IFDG 3BZCA 4IFDJ 4JBKA 4DV7Q 2BH8A 1B7YB 1QZHA 2ES2A 4DR5Q 2NVXH 1X54A 3CCSA 4DKAC 2WAQG 4R1JA 3HKSA 4A3KG 1IXRA 4DNIA 4NB3A 4O2DA 4A93G 4P75A 1K3RA 3JAMi 2VS1A 2K52A 4JC0A 3E9HA 1V9PA 2RHQB 3M9BA 4P71A 1I3QH 3W1BA 1K8GA 5IWAL 1D8LA 4AYBE 4GOPB 1A63A 3CD6A 3IRBA 4RG1A 4BY1G 4GOPA 3PUVA 2IX0A 4LF6L 1SLJA 1VQEA 1OXVA 3HOUG 3KOJA 4DV0L 1Y1WG 2AMCB 1ASZA 4GKJQ 3M7NA 3S2HH 3CMEA 1IL2A 1QVFA 2F4VQ 1UE5A 1IBKQ 1PH3A 1LM0A 4KLKA 1W2BA 1EQRA 4A3DG 1TWCH 4L5SA 1CSPA 1VQFA 2XTIA 1BKBA 3M4QA 3UE0A 1XJVA 2JA7G 1LTLA 4JI7L 4LFAQ 4JI5L 1VQPA 4Y52H 1D7QA 3HKZE 1OXTA 4OWTB 5C44H 4DV3L 4R4IA 4LFCL 3HOXG 1IBMQ 4LF5Q 1YJNA 4IOAA 2A1AA 3AFQA 1VQ9A 5M5WH 3J81j 1SN8A 3TREA 4A3MH 2D0PA 3GD7A 2NVYH 4DAMA 1Q46A
chains in the Genus database with same CATH superfamily
3TRZA 1K9MC 3QIAA 1E3PA 4NXNQ 5CV5A 4YCVA 1KD1C 2MO0A 5C44B 1X32A 4QGUA 1F9QA 3QWNA 4OXPA 4RH6A 1LACA 1QUQB 2EQSA 2B2TC 2NVYB 4DXGA 1E0BA 4JI2Q 1HZAA 1STYA 2KECA 3A0JA 4YCWA 1EY5A 3J80L 1B9MA 2GA4B 1HR0L 1M4VA 2YU9B 3D4WA 3KLSA 3MFYA 3OWFA 2NN6G 4GZYC 2C5CA 2R61A 1QNKA 5C3EH 2NZHA 2LSSA 1XWEA 4IUPA 4DNRB 1N33L 4HJ7A 1SMXA 4UP9A 2QA4A 1A8VA 1H9MA 3OWEB 4RCOA 3GTOH 2UXBQ 4A3GH 1TU2B 1XNRQ 2F0FA 4GLXA 2B2VA 3S16B 4HJ8A 5I2YA 3CW2C 1AP0A 5K5PA 2Q8IB 4WFN3 5NUCA 3BS1A 1ASYA 5ELEA 5IGGA 1N34L 2Z4IA 1MKHA 4F7XA 1G51A 1L1OA 1BBXC 1ESRA 5HGQA 3RZOB 1XMOL 2JEAI 4BXXG 3TS0A 1EUJA 3BYTB 1Z6HA 5IGBA 4HMJA 2XN9C 2NYZD 2OQ0A 5LMUQ 2AQ1B 3N52A 4TVAB 1EIFA 1I4PA 2BA0A 2F0DA 4PZ6A 1WJJA 3E9IA 4A76A 4C56C 4RAUC 3S15H 2LY7A 1C48A 1KDAA 5DLQE 3CCUA 1WTOA 1XPOA 4A93H 5GAHC 4KHZA 1D2BA 5IT9c 1EYCA 3SVMA 3QR8A 3RZDH 5IWAQ 2NZ1D 1KRTA 3Q6SA 2CVRA 1G291 2NVQB 1E7ZA 3I90A 3ZYYX 2ZM6L 1T5XD 2OEOA 3DMUA 3DXJC 2CH4A 4GLAC 5GAEC 2QGQA 5C4JB 4BY7G 3I4OA 3X3MA 5DNFA 4ID6A 5EPJA 4I7AA 4J15A 1HZCA 1F2YA 4RGNA 4JI5Q 4OO1I 3OMCA 2F0IA 3H0GB 4YWKA 4DA2A 1PRTB 2P5ZX 4B9WA 2JA5B 1X55A 2QKIC 2B2VC 3CCJA 3GTMH 3IFTA 4APVA 3I8ZA 3VYRA 3QO2A 1PH5A 4C3JH 2K33A 1IBLL 1PH6A 3A56A 2NB0A 1LT5D 5JJKA 3G6JB 1SYFA 5JVH3 1L1OC 4DV1L 3L2PA 4ZLTF 1MI2A 3HOYB 1XNQL 2KVMA 4H02A 4CKCA 4WJWA 1JJ2A 4RGOS 2IHFA 2Z6KA 1NY4A 4QJFA 4POFA 4CJ1B 1GOZA 3PUYA 2IHEA 1HR0Q 1YNXA 2HIXA 3VYSA 1PFBA 3HOWG 4DAYB 1HJPA 1QWYA 3I4NB 3HOUH 2D62A 1I4QA 3G6EA 1B2TA 1Q8KA 4B3TL 1N33Q 2WV6D 1CK1A 5GROA 1HHVA 1SE2A 1FL0A 5EKKA 1EQQA 5IY0A 4FYDA 1EIHA 1T9HA 5M5YH 2RDFA 2EYOA 1D6EC 4DK3C 3MTSA 3J7AV 1O78A 5J1ZA 4JW0A 1GHJA 3PF5A 3VYTA 3P7JA 4KY5A 1CQFA 5HY6A 4P72A 2F0SA 2PNHA 3MXUA 3PUWA 2R93G 2KENA 1XMOQ 2E2IB 4A3BG 2SDFA 3C46A 3KLRA 4PMWA 3T1YL 3FEWX 3TZDA 3TS2A 3VA5A 1ZXTA 1FGBD 3CQZB 1JR0D 1GKHA 4B3SL 3HOXB 1IYUA 4K8IA 4X66L 5GADC 5ELOA 5IYDH 2JEBI 1KDBA 4EQ5A 1O7ZA 1XPRA 1KAWA 1GHKA 4H7BA 2B2UA 4UPAA 3I4MH 2JQOA 4LFBL 5JOBA 2JA8G 2Z6KC 5D3IB 2MGSA 2DY8A 2CCZA 1XMQL 3BVMA 2Z8LA 3DWQA 2AQ3B 2CWAA 5KEEA 1X3GA 4XYQA 2M2LA 5G3LD 1II3A 3OOCA 5J39A 3K58A 1FYCA 3PGZA 4KI0A 5T1IA 2ZXOA 1MJEA 1W6KA 3TDQA 1R9TH 1IHZA 1EU3A 3Q0AA 1YITA 2JE6I 5CBAE 4A3BB 5KNDA 2FMMA 4CBVA 1D5XC 4BBRH 2CWPA 3NTHA 1IBLQ 3MXNB 5DEHA 4ZUIA 4KD3A 5BR8L 5C0XG 4DV1Q 3IL8A 1XX8A 1VQLA 2WB1G 1WOCA 1LTID 3GTKH 2UUBL 4PMBA 1XNQQ 1HTLD 1TS4A 2RVLA 1KC8C 1VF5C 4QMGA 1RF2D 3RLOA 4BS9A 2D9UA 1B70B 1SE4A 4A3FH 4DGZA 2PW5A 2F0HA 4LF9L 3HS0C 1IW7C 3D3RA 5DAUA 4A3IB 2JA8B 1ILPA 1PFMA 1EQTA 3TZUA 2M9VA 4B3TQ 4Q5VA 1D5ZC 4K6LA 1L2FA 3R2IA 2I0QA 4F87A 1PH2A 2WKCA 4DV7L 2F52A 5IODA 4DR5L 2B2UC 4GN4B 1JOOA 5I4DA 4OGQC 1HZ9A 2Z6BA 1MSHA 2JA6B 4A3JB 4IUVA 5CV4A 3SHLA 4ZCKA 4DK1A 1RHPA 1P8LA 2R92G 2O5IC 1IYJB 1KAAA 1PZKD 5C3EG 1FNUA 2K04A 4MZ9A 4A3GG 3T1YQ 5FOBB 4FDBA 4KY7A 4C3IG 3BG3A 3NBIA 1PDQA 2WB1B 1ET6A 4B3SQ 3RN5A 4X66Q 1JOKA 2BA1A 5C6AA 3GV6A 4OEMB 1PH8A 1IBML 4LF5L 5M5WB 4H44C 1PFNA 3HFZB 2A6EC 1HRJA 4BWGB 2PQAB 2E2HB 4J6HA 4LF7L 3GP7A 1BNZA 2KEEA 4LFBQ 5FLXc 1WI5A 2HIVA 4DXFA 4X64L 4FXDA 2NUCA 2BDNA 1CFMA 1YNNC 4MN3A 4C2MB 1A62A 1BCPD 3KF8B 1XMQQ 2Q2IA 2G9DA 2ZTDA 5BN3A 2VUMH 4XQJA 4QF4A 4UY8C 4A93G 3ZJYC 2TMPA 1SRUA 2FINB 3ERQA 1BXTA 2F0TA 4IOCA 3U4ZA 4GN5A 3CCMA 4KV6A 2R92B 5M3FH 1JICA 2IX1A 2ENBA 2CH4W 3BVZA 5EAYA 4GKKL 2B29A 1PZID 5IOCA 1H9SB 4XIGS 1E22A 2WAQE 2GVAA 5F2DA 3GTOB 1Y1VB 4LW1A 4EX5A 2LS01 1S5FD 4C3IB 4ILWA 5BR8Q 2DNEA 2ZJPA 2JP1A 1STAA 2NWGA 4IUUA 4GNXA 1VQCA 1OTCA 3Q22A 5M5XH 2ZJQA 2V4DA 2K4KA 3H15A 3PIP3 1WTVA 1Y8OB 2FJ2A 4XDXA 2IW3A 3O13A 1CHQD 3V96A 3K5NA 2RKSA 4GLVB 5AJ3L 4LF9Q 1DZ1A 4HIOA 2K5VA 4C3JG 3SE0A 5M3MH 2E76C 3ICEA 2PZTA 2F4VL 4WRDA 1X3PA 5E4WC 4IFDJ 1H9KA 5A2QE 4DV7Q 3EA6A 4C1NI 1BF4A 4DR5Q 2K28A 3S1RB 1K0SA 2EY6A 3W3AA 1VF7A 4R1JA 3HKSA 1I4HA 3P75A 1IXRA 1O7LA 4CGYB 1MBYA 1S4ZA 2K52A 3W1BA 5K36H 3RZDB 4KKTA 1HQMC 2F0LA 3CD6A 3PO2B 4GOPA 5E4XA 5KYIA 1RTNA 1TVXA 3NSWA 1VQEA 3JAML 3HOUG 3PO3B 1JWSD 4DV0L 1EZ8A 4CDCC 3M7NA 3S2HH 1IL2A 5KYLA 2NVXB 4K5WA 1UE5A 5I6YA 1ZYRD 3TSSA 4FF3A 1QG7A 2ICIA 1VQFA 3UE0A 2XRQD 4JI7L 1SJED 4IFDH 4R4IA 4LFCL 1IBMQ 4LF5Q 4IOAA 5C3WA 4A3MH 3PSIA 3GD7A 4DU9A 1B3AA 1Q46A 2F0WA 1A3VA 5FK9C 1LTTD 1QB5D 5DM73 2MHVA 2N49A 4GNXC 1NUCA 4C3JB 1R4PB 3X3NA 1TWCB 3BZKA 4HTHA 4LF7Q 3TEHB 1TWGH 2EPBA 4X64Q 2EYPA 1DOKA 1NAPA 4DAYA 2QW7A 1RL2A 4EVOA 1H95A 4Y7NH 3I72A 1PYSB 2Z4HA 4RHRA 1PTOB 3J80i 3RLFA 5IYDG 3M7GA 1TWFB 5A35A 4R8IA 2PPBC 4QIWB 3G4SA 3RNUA 3HOVH 4M1UB 4NPSA 1TWHH 4GKKQ 3J7A5 4EQPA 1G2TA 3KDFA 1B50A 2R7ZB 4LAAA 4N9TA 2N55A 2R3ZA 3I4MG 1W6JA 3SK5A 1JOQA 3I70A 4LF4L 2LXJA 4GOPC 2LKVA 5IP7H 3NWSA 3A7AB 4JOIA 1MD2D 3A74A 1KIXA 1V1PB 1J9OA 4DAPA 3U9SA 2Y0SE 4F88A 5GAGC 1JWUD 3S1MH 3MZ5A 2K7VA 3A5UA 3KF6A 1BCPC 1SFOH 1HQRD 5AJ3Q 1VQJA 2XWJB 1PH4A 4R8NA 4BBRG 2VQEL 1MIUA 3HOZH 1UUPA 1QOHA 4QY7A 3J80E 1S5BD 3RD4A 2HDMA 2MFIA 2F4VQ 1Y14B 2VZAA 4M8AA 3OYYA 1NSNS 2PNRC 1WD0A 3FMCA 1WTPA 1CTMA 1LABA 3OHXC 3ERSX 1JC7A 1FR3A 2XVSA 1WCMB 3GTGB 4QIWE 1G2SA 4ZQ3A 4A3FG 4J1MA 4KHPL 5EQ0A 4DUYL 2LXKA 3S1NB 1Q1BA 2ZTCA 3EBEA 4DV5L 1I4RA 2BH2A 1YVCA 2D0OA 4DV0Q 5J3BA 3RUZA 4AIMA 2B63H 1SSOA 3M4PA 1A3TA 3K80C 2HCIA 4TRDA 4R4TA 4EQNA 4JI7Q 4A3EB 5ELDA 3TQYA 1EOVA 3STBC 3LWUA 5L37A 1BO0A 4X6AH 4LFCQ 1TWAH 1CZWA 4DR6Q 4C3HB 4DR3L 1NR2A 3H3VI 5G3LF 3W1GA 3K5OA 3GTLH 4JOIC 5C5LA 3DWPA 1FVIA 3RN2A 5IYBH 4HJ9A 3S1QB 3EFXD 4RKLA 1Q86C 2ZXRA 3G71A 3E6ZX 4RFBA 1E1OA 2DJGC 2CW0D 1HH2P 2G5DA 1K83B 3EJIA 4I65A 1BBUA 1YJWA 1GVPA 5D14A 1Q12A 4BY1H 1SNPA 4DUZL 1YBYA 2B8FA 4V190 3NK9A 3WOFA 5CMDA 1ICWA 3E3XA 3ULLA 4LF4Q 1KTKA 4P74A 2R7FA 5ELBA 4A3KB 4ZAIA 1ENAA 2VUMG 1CKOA 1EIYB 2JA7H 2J4XA 3SK4A 4I7ZC 1Y1WB 3D31A 2EJFC 1HA5A 5M3FG 2RA4A 2DNCA 2O2LD 4CJ2C 4G4KA 3TMEA 1STBA 5IT9L 1WD1A 1HZBA 1KNAA 4IPHA 4A3DB 2BOSA 3SEBA 3F8TA 1HUMA 2VQEQ 1CKNB 2HDLA 2ICEC 5EKLA 2EY1A 2BE5C 2Q8RE 2PQAA 4HEDA 4U68A 2F0PA 5C0XI 1JMCA 2E2JB 2KCTA 4S3SA 1O80A 1SXTA 3NE5B 5JEAJ 3NTIA 1HFNA 1SE3A 2OCEA 1F9SA 3EN2A 3MA2B 3CC2A 4DV2L 4XQNA 1I6VC 1RDPD 4JI6L 4N8X1 1GUGA 1SJHD 4HAEA 4KHPQ 4DV4Q 4DUYQ 1G6ZA 3ULJA 4DV5Q 1X56A 4KK7A 4PG3A 3Q8DA 1AZPA 1Q81C 3OMGA 5M3MG 2L9HA 2XNAC 2EYLA 2JN4A 5I9PA 3IFDA 4LF8L 4LUOA 3GTQH 3VYUA 1QCBD 1PHJA 2HHHL 1EY4A 3ND8A 1BUVT 4NXML 3CCEA 3K59A 4RKBA 2QEJC 2R7DA 1BOSA 1N9WA 4K14A 4MTKA 4UDUC 1XTCD 3LNNA 1STEA 2CKZB 4K5XA 2H5XA 5K36G 4HSVA 1VQHA 2EY2A 2PCFB 1QJOA 5T1GA 1U4MA 4DR2L 1BCPF 1C9OA 4DR3Q 3EVQA 5ISRA 4ME5A 3J7YW 1EY9A 2OXPA 1Q82C 4OX9L 3R3OA 4DR1L 1P16A 1UWVA 1HUNA 1EWIA 2CHBD 2I07B 2EYJA 3S2DH 3A55A 1JJCB 1K8OA 1HNXL 1KL9A 1WTWA 2QEXA 2ZJRA 2VB3X 2KCNA 2DUDA 2Q2HA 3MHBA 4A3MG 4LJZC 1HNWL 2FXQA 2BDOA 1LT6D 4B3RQ 4DUZQ 2BCOA 2O4XA 4CDFC 1GUWA 2F4IA 2DJFC 1R4QB 1TIID 2E5LL 1CSQA 3K0XA 4XT3B 5C4XH 1I50H 2PQEA 4TQUS 2PW7A 4OWXB 5KIXA 5JVG3 2YV5A 1JB3A 1DD2A 3KYHC 1UEAB 3R8BA 1YHBA 3DUZA 3CU7A 3EQLC 5KNCA 3HOVG 1LUZA 3OIPA 3K7AH 3UDGA 1YIJA 1Z7TA 4X3UA 3S14B 3NENA 1AFPA 5FO8B 3GTPH 4BY7B 3CRLC 1S72A 2WACA 1XTDA 2EVBA 1SMYC 4KN7C 4A75A 3CMAA 4CKBA 1IBKL 2CW0C 4ZRZA 3K7UC 5CV9A 1GUTA 3F2DA 4IURA 5IP7G 2PI2A 1SEBD 5IE8A 4JBWA 4DV2Q 4JI6Q 5IP9H 3W5OA 1MJCA 5HGTA 3JC66 3F1ZA 1CUKA 3GQBA 4GN3B 4C1NK 1KABA 3D6CA 3HOZG 1GUOA 1MSGA 2K03A 4HCSA 3S17H 4LF8Q 2AUJD 1EYDA 3MXGA 4A3LH 1U0LA 2VXWA 1SDFA 3R93A 2HHHQ 1XXGA 4NXMQ 4QQBX 3VR6A 1O7YA 3HOWB 4IPDA 4RGTA 1LO5D 1Z9FA 3U4VA 3OW2A 3AFPA 1TWHB 3FKIH 2IJ0A 1SNMA 3T1HL 5C4ZA 1AZQA 1STNA 1E2VA 2SNMA 3OSOA 4JI0L 1TS3A 4DR2Q 3QJYA 1A6XA 3T51B 1M1KC 5CGKA 2GVBA 3NBHA 4L5QA 4OX9Q 2ZXPA 4DR1Q 1G8ZD 1EIGA 3T56B 2B63G 1CT1D 1HA6A 1RJTA 1SNQA 4A3CH 1I6HB 1SNCA 3M3YB 4UHVA 1HNXQ 1HFGA 1ET9A 1F2ZA 2R93B 5HURA 3GTJH 5KNBA 2EY5A 1M8AA 3VA7A 1RKNA 5JAVA 1HNWQ 2OTLA 4ME3A 1QE6A 1M90C 4FVMA 5E1FA 2K5WA 1EYGA 1QVCA 1PVOA 2E5LQ 5IYBG 3CAMA 1SYBA 2BH8A 4FP5D 2XSCA 4DKAC 4B08A 2WAQG 3D4DA 2DY7A 4NB3A 5CC4A 3JAMi 2VS1A 4JC0A 1DOMA 2RHQB 3M9BA 1SYEA 1AN8A 4BY1G 2IX0A 5EJWA 2F0UA 3KOJA 2AMCB 1ASZA 1B3QA 3CMEA 4N8FA 1HPCA 1HTPA 1Y8PB 1IBKQ 1LM0A 4KLKA 5FLXL 4KKUA 1I3QB 2JA7G 3M4QA 1V1OA 1S5DD 2IX3A 1VQPA 5EBCA 1D7QA 2M00A 5C44H 3HZXA 2E2DC 3J81j 1SN8A 3TREA 2NVYH 1PZJD 4OWWB 4MHEA 3K8AA 1EYAA 2MJ8A 2YU9H 5IGDA 1A15A 2F0EA 5J22A 1MGSA 2VB2X 2JSOA 4UP8A 3L9AX 2DN8A 1SBBB 3JAME 4ALPA 2HQLA 4Q0FA 4DAVA 1UE7A 3DEPA 3TBIB 1QUQA 1RCVD 3ONAB 2NTTA 4FXGC 1PRTD 3MVVA 1PH7A 3S16H 3U58A 3T1HQ 1NNXA 3TP7A 4JI0Q 2UUCL 5KRUA 2X69A 1WTRA 3OTOL 1KLGD 1UEBA 1KXLA 3RZOH 4B3ML 2KHJA 2X6GA 1YHAA 2KQ3A 3BJUA 2ID0A 1OXSC 3D8GA 1VQIA 3BZDB 3CC7A 1VMPA 1RTOA 1SNDA 1NMGA 2WIIB 1L1OB 5C3EB 1LV9A 1S5CD 2OT2A 4A3GB 4TSSA 4MTNA 1Q3LA 3URYA 3F2CA 4KY6A 2UU9L 4OL7A 4POGA 2A73B 2K5DA 2NZOA 2WB1E 4L63B 1X6OA 4YWLA 1VQDA 5FO7B 2NVQH 3A54A 4V0BA 3VR3A 2NBFA 4KTAA 2F3WA 2WKDA 3NWTA 4YIJA 3L3OC 3AU7A 1F2MA 3J81L 2VQFL 4DR4L 4NW2A 5C4JH 4KJNA 4ZK9B 2N78A 3Q24A 1I94L 1VQ6A 1J6QA 3I7FA 3H0GH 3ITPA 5EGTA 5FJ8H 2PO4A 3S15B 3PIOA 2JA5H 4IPGA 3C3LA 4PV1C 4A93B 1F9RA 4IO9A 4WJ3M 2Y0SG 4P73A 5C4XG 1EQVA 1CQVA 3K0YA 1QVGA 2EYHA 3P20A 4OELB 3UDXA 4JI1L 1JCKB 3WOEA 2NN6I 3HOYH 1FNWA 5CV8A 4LK1C 4CHTB 3AEVA 1VQ5A 3TP6A 2B39A 1IKLA 3V05A 3CPWA 1JT8A 3D0FA 4DFAA 1BVSA 3MC0B 3I4NH 1ZEQX 4L6TB 1FGUA 3NXWA 4DR6L 2EOTA 1B8AA 2YYZA 2L5TA 5ELNA 3GTMB 3TP8A 1X3EA 4DNTB 4ZKBB 1C4QA 1VQGA 5IP9G 3DM3A 2UXDQ 1U5KA 4QB4A 1WTHA 3PUXA 2UUCQ 5IGFA 2PYKA 3D4RA 1YEZA 4AYBG 3OTOQ 4YCUA 1I50B 3A8IE 4A3LG 2MP1A 4B3MQ 1AE2A 3MAQA 1I4GA 2HCCA 2I46A 2E2IH 1VQ4A 2EJMA 3UDIA 2A19A 4HR7B 2KEDA 1VQKA 1Q8IA 1TS5A 3HOUB 3HOXH 5GQOA 3FKIG 4ZYSA 2AQ2B 1VQBA 2E8GA 5FLMH 3NHHA 4HSPA 4QCLA 3HKZG 1EWHA 5FO9B 3B6YA 1TT2A 2UU9Q 3JAMc 1A3UA 5M5YB 1V8QA 2G9HD 1WYDA 2O5JC 1U4PA 2Q2TA 1PRTC 1CZGA 2Z1CA 2JYOA 4A3CG 4LMQD 1OXXK 1VQMA 5D65A 3NEMA 4DR4Q 2VQFQ 3ER0A 4A4IA 1GXDC 2DGYA 2H4OA 1SR3A 1I94Q 2VL6A 1VQOA 1WVLA 2NVTH 1D1KA 4H0LC 2L0CA 4U673 4K5VA 1GO3E 4AYBB 4JI3L 1JORA 3H3VH 2RDHA 3DHQA 2WFWA 5IT9E 1FNVA 2L11A 2JXMB 4A3BH 4O1NA 1VQAA 2J7ZA 4DV4L 4DR7L 1H9RA 1PFSA 2CQOA 3WDNA 4JI1Q 3I4MB 1FJGL 1CM9A 1VS0A 3I55A 3CF5A 4XTCS 1ML0D 3DEOA 3NQTA 1C0AA 3BVGA 2ZTEA 4JG2A 5ELFA 2KJXA 3J7ZC 4XT1B 3U9OA 4PQXA 4EQOA 2HT1A 3BYYB 3J7AF 3KK7A 1EZ6A 4RHSA 1EY0A 3MXNA 3MXPA 1L0WA 4A3IH 5C0XJ 2K75A 3P1HA 3OPOA 1R9TB 2JJQA 4IPCA 2RF4A 4DK6C 2F0QA 3GTJB 3CCVA 3DM1A 3BDCA 5IGCA 1AE3A 3I2ZA 5C44G 2VNUD 5LHY1 4RCNA 1D5MC 4XXEA 3CRKC 4BBRB 5I6WA 4ULLA 3QOJA 1EEID 2JA6H 4A3JH 2C35B 2K01A 4R9WA 3SK6A 2QDLA 4RGMA 3GTKB 4MNOA 1O7IA 1JWMD 2K6AA 2N3SA 1CHPD 3VR5A 4AH6A 1EFWA 1EY7A 1LYLA 3HGBA 5DM63 3EROA 4A3FB 1DM0B 4L8JA 5C0XH 4OIKA 1ZYRC 3U50C 4B3RL 3RR5A 4DF7A 4HJAA 3S9WA 1K73C 2ZT9C 5CV6A 3DWAA 4GKJL 1KQSA 1PA6A 2IL8A 3BDOA 4X3KA 2E75C 4QL5A 3PIO3 3GO5A 2E2HH 2OWOA 4WORA 4K8JA 3H3VC 3KBGA 1LT4D 4FF2A 1L0XB 4C2MH 4NMZA 4RWSC 3DLLA 4PNYA 1PV4A 1K0RA 3FPUB 4LUZA 2XRSD 5BN4A 1N32L 2YTVA 2PMZB 3VDYA 2R92H 2NTSA 1DYQA 5I9OA 1YNJD 2A6HD 4JI3Q 3K81C 2KBNA 3KLSX 1UE1A 4FXKC 3AB9A 3KF8A 1JB7A 1Y1VH 2F3IA 4C3IH 4KJOA 1NMFA 4OO1H 1EL0A 1GD7A 3I56A 4DR7Q 4JBMA 4OIJA 3KUPA 2N88A 1FJGQ 2PZUA 1I4XA 4JPBW 3M85A 2L15A 3H0GG 2B8GA 5FJ8G 1H9SA 3KJPA 2YTYA 1VDZA 2VUMB 1QZGA 4HIDA 2FFKB 2ASBA 2JA5G 1PRTF 3E0EA 2K05A 4RMFA 2D2CC 1TXYA 1PTOD 2ALYB 4GNXB 5M3FB 2ATWA 2HUGA 5JEAH 2KHIA 1G91A 2UXCL 3WWVA 3J80c 3M4OH 4CDEC 4F8MA 3HOYG 4MIUA 3T4AC 4K2LA 5AFWA 3S1RH 1C7YA 4KMUC 1NJIC 1RIPA 2RSNA 2A5HA 1GUNA 1E2WA 4X3TA 5CV7A 3C1FA 4JYAL 4X3SA 1VMCA 4FF4A 2PMZE 2KOLA 2QCPX 4IUNA 2RCFA 3PO2H 1WTXA 1HNZL 3CCRA 3I4NG 4IFDG 5M5XB 3PO3H 1PXUA 3HEJA 3BZCA 4JBKA 1B44D 1ENFA 4HN7A 1B7YB 1QZHA 3V2TA 2NVXH 3HRZC 3CCSA 5EPLA 1EY8A 1IW7D 4DNIA 4JVZA 4P75A 3C1EA 1TQOA 2RSOA 3E9HA 1V9PA 1X3QA 3H94A 1HXYD 2X6LA 1JE4A 5M3MB 4GOPB 3IRBA 4RG1A 4LF6L 1DJRD 1OXVA 1A2TA 5M9OA 4GKJQ 1U4LA 1QVFA 2EYFA 1B4OA 5C3XA 2L4NA 5IIFA 1PH3A 1BCPB 3FRPB 1CA5A 2IPKD 1TWCH 3OW7A 3TP5A 1BKBA 1XJVA 3E0JA 2XWBB 4IQZA 4XYOA 2EYMA 1K3BC 4DV3L 1JJGA 3HOXG 3TN2A 5CBEE 1YJNA 1PTOH 3AFQA 3S2HB 3UDFA 5FLMG 4DAMA 5CYUA 1TWFH 1LTGD 3LGJA 1N32Q 3CXCA 4WJ4A 1LLRD 3AYHB 3NP8A 4FF1A 1STGA 1IZ6A 1U4RA 4BBSH 1XYIA 2TSSA 2R7ZH 4IJLA 5IYCH 1LTBD 5LL6X 1BR9A 2KCCA 4JV5L 4CDDC 4A3MB 3GDEA 2A6ED 4KD4A 2CFMA 4N9PA 1HCZA 5FLXE 4FNFA 4IN3A 3K5MA 4K0KL 1TWGB 2A74C 3KDFB 4Z9CB 1YNND 2B2YA 3MEHA 3PIPA 1LTRD 1N34Q 3Q23A 4Y7NB 1YHQA 3PQIA 4PMCA 1WTQA 2QDBA 5D3DA 2F0KA 3BDLA 3FHWA 3HOVB 2RQXA 3I73A 2LMCB 3SK8A 3SR1A 4IUQA 2Z9HA 1SYDA 2UXCQ 2L55A 2SOBA 1IYVA 1YNJC 1N36L 1V1PA 2A6HC 3PV0A 3KF6B 2MO1A 5ELCA 1WCMH 3GTGH 1J8IA 4JYAQ 5LMNW 4PZ8A 3L7ZC 1BDOA 1TKWB 2F0NA 3S1NH 3QOLA 3J81i 3UE1A 1HNZQ 1V43A 3PUZA 1X3FA 2MNAA 4AQYL 2A69D 4A3IG 2ZM6Q 1YZ6A 4DPGA 1QILA 2V1CC 2UUAL 3S1MB 1L0YB 4HIMA 1N8RC 5C5MA 3CKIB 5JJLA 1NBWA 1BQQT 4X65L 1SFOB 2E74C 1ONLA 2EJGC 5KGUA 1WFQA 3HOZB 1U9RA 1S5ED 3CCLA 2NVTB 1SNOA 4A3EH 2JA6G 4A3JG 1EOTA 1RODA 1TS2A 4LF6Q 1JE5A 2SEBD 1PTOC 3H09A 1PYBA 2EDGA 1Q1EA 1S40A 4C3HH 4ODGA 5JJIA 1MHWC 3NQIA 1NR4A 4HJ5A 2B2YC 1F77A 3CP0A 2JA9A 3UI2A 1KDCA 4K2KA 1NTGA 2F0GA 3S1QH 4DV3Q 5BN5A 1KHIA 2K5HA 4P2CB 3K6OA 1CA6A 3ND9A 3CHBD 2GN5A 3J81E 2KUMA 4JI4L 4EGVA 2B63B 1K83H 4B9XA 1AW7A 1VQNA 3IAYA 4YHHL 3KFUA 5CR3A 4NDXA 2H1EA 3LWEA 1IL8A 1K28A 1KLUD 4KN4C 5JJZA 2LFNA 1E2ZA 3CC4A 2RHSB 5TSSA 1TWAB 1DCZA 1SE8A 2N8NA 4JV5Q 3BU2A 3G7LA 3A8KE 2K5QA 2YTXA 4A3KH 3H6MA 4QUFA 4YY3L 1E24A 1PH9A 3GTLB 2A68D 4OHJA 4K0KQ 3CPFA 3OIQA 2FMCA 4X62L 1DGSA 3I91A 3I3CA 1J5EL 3F2BA 1Y1WH 2I5LX 2D5DA 1F9PA 2L12A 2WAQB 1PH1A 4LUVA 1X65A 1ENCA 1CI3M 4A3DH 1Y1VG 4E6IA 2UXDL 3NPPA 1KRSA 4NP5A 4OO1G 3T16A 4BY1B 1ESFA 2F1MA 3GV3A 3HG9A 1D1IA 2E2JH 1N36Q 3F2UA 1AH9A 4JBJA 5E7NA 1PMRA 1NCVA 2MQHA 1UNSA 2QILA 4BA1I 3ULPA 2OTJA 2JA7B 2B2WA 3NTKA 4DV6L 3A8JE 2PZWA 3MWYW 1CKNA 2AWNA 1TY2A 4HIKA 4AQYQ 1JQYD 1B9NA 3S24A 1A0IA 2I5MX 2K14A 5JEAG 2UUAQ 5E3FA 1EFID 4X65Q 2KHSA 1OXUA 2Q2UA 1EEFD 2NN6H 3C2PA 3RLNA 2EXDA 3K5LA 4L5TA 1B1ZA 3CCQA 3PO2G 1SROA 1Z47A 2HD3A 1NE3A 1XPUA 3PO3G 5LL6S 4IUTA 2AKWB 4QUCA 2MPMA 3A7LA 1DONA 3FP9A 2VY3A 2RCNA 1S3OA 2UUBQ 1VQ7A 4JK1C 1GUSA 1PLFA 2I5HA 4PZ7A 4BXXH 3GTQB 4UP7A 1UAPA 2A69C 3I4LA 4RA8A 4JI4Q 1VCIA 1SYGA 4YHHQ 4LNQA 3STBD 3SXHA 1VQ8A 2SNSA 1KNEA 4OONA 3HP3A 3MEFA 3KBXA 3A5ZB 4JCVE 4R4CA 1FD7D 3M4OB 2KCMA 2R6GA 2B2WC 3SDZA 4YY3Q 4JI8L 3VR4A 1HR0W 1UE6A 2AWOA 1Y69U 2F0JA 4X62Q 1PTOF 4XQQA 1J5EQ 3S2DB 4IZ8A 5LMNL 4CKEA 3S14H 3KLWA 3RMHA 4YWMA 2B3GA 4BBSG 2R7ZG 4BY7H 3H91A 3D6WA 5IYCG 3VR2A 1ICFB 2A8VA 1LT3D 3EIVA 1T5EA 2XIWA 5EKIA 3J81c 3M4YA 2OF1A 3PCOB 3N6RA 2K5NA 4DK0A 1V1QA 4K6DA 5I2XA 2RBMA 1GM5A 3AMUA 3FPPA 2Y0SB 1B53A 4R4QA 4KHVA 5C4XB 2HQEA 4L5RC 1H9JA 4DV6Q 2WP8J 3IKJA 5EBDA 4CJ0B 3CQZH 2A68C 4FO2A 2FHTA 3K7AB 4KKSA 5IGEA 5H1SE 4LFAL 4DN4M 1C8CA 2L1BA 4NKLA 3GTPB 3FVQA 3NUCA 1G6PA 5JPMC 2WINB 1EY6A 1EU4A 2KA7A 2XGTA 1Y8NB 3G48A 2BE5D 2F0VA 3E5SA 2F0OA 3HOWH 1K8AC 4G7OC 1WCMG 4NXNL 2C9OA 3T13A 1BBWA 4BBSB 3AQQA 4H13C 1SAPA 3NELA 3FDTA 1PYWD 3QG1A 3MFGA 1Q7YC 4IFDI 2K50A 2IT1A 4TKOB 3PMFA 5JPNC 4JI2L 2OQKA 4G57A 4LWCA 2K32A 1SYCA 3PF4A 2AUKA 1I6HH 3M3YH 1IKMA 2R93H 3S17B 4A3EG 3SGIA 2EIFA 2IWHA 5A2QL 3NBHB 3LX0A 2UXBL 4C3HG 1F2LA 2EE1A 1XNRL 2IY5B 4IJHA 4R4OA 4ZKCB 5COYA 2VW9A 2J0TD 2PI2E 1LTSD 3FKIB 2AHOB 1TR5A 3T53B 3KJOA 2EZVA 1W3SA 2MUYA 2EXZA 1A2UA 3HKZB 3QB3A 4ABNA 1E1TA 1GJXA 4GS3A 2K1BA 2Z0SA 4O42A 2F03A 4JI8Q 4J8QA 1DOLA 1ILQA 5FKAC 2B2TA 2JK8A 3R2TA 1YI2A 5LMNQ 1X9NA 2JA8H 5LMUL 4O0AA 1YJ9A 1CKMA 4G7ZC 2Q8TA 3L0OA 4BA2I 1I5FA 1TY0A 5C4HA 2ES2A 1LTAD 3W2DA 1X54A 1DXMA 4A3KG 4O2DA 1QNUA 1K3RA 1K8GA 4P71A 1I3QH 2QF7A 2F3VA 1AEXA 1D8LA 1RD9D 2CQAA 5CORA 4AYBE 5IWAL 1A63A 2F0MA 3PUVA 1SLJA 1Y1WG 4HCEA 1Q90A 1OO9B 4G7HC 1STHA 4IALA 1ZKOA 1EWCA 2RDGA 1W2BA 1EQRA 4A3DG 1K8MA 4L5SA 1CSPA 4ZUJA 2XTIA 1LTLA 4LFAQ 4UAIA 4JI5L 4Y52H 4HMIA 3HKZE 1OXTA 4OWTB 2A1AA 5EPKA 1VQ9A 5M5WH 3K57A 1SMYD 2D0PA
chains in the Genus database with same CATH topology
1TWFH 3LGJA 3TRZA 1N32Q 3CXCA 4WJ4A 1K9MC 3AYHB 4GNXC 2N49A 4OWWB 1E3PA 4NXNQ 3BZKA 1IZ6A 3K8AA 3TEHB 1TWGH 4YCVA 2YU9H 4LF7Q 1KD1C 4UP8A 4BBSH 2MO0A 4X64Q 2R7ZH 1RL2A 4IJLA 5IYCH 1H95A 4Y7NH 4ALPA 1PYSB 2HQLA 4QGUA 4JV5L 3J80i 3RLFA 5IYDG 4OXPA 3GDEA 1QUQB 2EQSA 1UE7A 2CFMA 1QUQA 4JI2Q 1HZAA 3A0JA 4YCWA 3G4SA 1PH7A 3RNUA 3S16H 4K0KL 3HOVH 4NPSA 1HR0L 3U58A 1TWHH 3T1HQ 3KDFB 4GKKQ 3J7A5 4JI0Q 2NN6G 3KDFA 4WJ3M 3PIPA 2UUCL 1N34Q 3UDFA 5C3EH 2NZHA 2LSSA 1N33L 3I4MG 1YHQA 4HJ7A 3OTOL 1SMXA 4UP9A 2QA4A 1A8VA 4LF4L 3GTOH 2UXBQ 4A3GH 1UEBA 1KXLA 2LXJA 1XNRQ 3RZOH 4B3ML 2KHJA 4GLXA 1YHAA 3BJUA 3FHWA 2ID0A 1OXSC 4HJ8A 4GOPC 1VQIA 5IP7H 3CW2C 3CC7A 4JOIA 2UXCQ 3A74A 1NMGA 1ASYA 1KIXA 1L1OB 1N34L 1MKHA 2Y0SE 1G51A 1L1OA 1N36L 5GAGC 3S1MH 3PV0A 3KF6B 2MO1A 5HGQA 3A5UA 1XMOL 3KF6A 2JEAI 3TS0A 1EUJA 3PSIA 4MTNA 1SFOH 4BXXG 1WCMH 1JJGA 3F2CA 3GTGH 5AJ3Q 2UU9L 1VQJA 4JYAQ 5LMNW 1PH4A 4POGA 2NZOA 4BBRG 2VQEL 4PZ8A 1MIUA 2WB1E 3L7ZC 4QY7A 3HOZH 1X6OA 2OQ0A 5LMUQ 4YWLA 4TVAB 3S1NH 1EIFA 2MFIA 2BA0A 3J81i 3UE1A 4PZ6A 1HNZQ 1V43A 1VQDA 1WJJA 1Y14B 2VZAA 3E9IA 3PUZA 1X3FA 3OYYA 2MNAA 4A76A 4AQYL 4A3IG 2NVQH 2ZM6Q 3S15H 1YZ6A 4DPGA 2V1CC 2UUAL 4HIMA 1N8RC 5DLQE 3CCUA 5JJLA 1XPOA 4A93H 1NBWA 3ERSX 4X65L 5GAHC 2VQFL 4DR4L 5C4JH 4KHZA 2N78A 1WFQA 4QIWE 5IT9c 1I94L 4A3FG 3RZDH 3CCLA 4KHPL 5IWAQ 4DUYL 2LXKA 1VQ6A 4A3EH 1Q1BA 2ZTCA 1J6QA 1KRTA 4A3JG 3EBEA 3I7FA 3H0GH 2JA6G 1G291 4DV5L 5FJ8H 1E7ZA 1JE5A 4LF6Q 1YVCA 2BH2A 2D0OA 4DV0Q 1PYBA 5J3BA 2ZM6L 1Q1EA 3PIOA 1S40A 4C3HH 2JA5H 4IPGA 4GLAC 4AIMA 5JJIA 4IO9A 5GAEC 2Y0SG 2QGQA 4P73A 2B63H 4BY7G 3I4OA 3M4PA 3K80C 5C4XG 4HJ5A 1QVGA 4R4TA 3CP0A 2JA9A 1HZCA 4J15A 3UDXA 4JI7Q 4JI5Q 4OO1I 3TQYA 1EOVA 1NTGA 4YWKA 4JI1L 3STBC 3S1QH 4DV3Q 4X6AH 2NN6I 1KHIA 2K5HA 4LFCQ 3HOYH 1TWAH 3AEVA 4DR6Q 4DR3L 1X55A 1VQ5A 3CCJA 3GTMH 2GN5A 4JI4L 3H3VI 3W1GA 1K83H 4APVA 3CPWA 1PH5A 4C3JH 1JT8A 1VQNA 4JOIC 1HNXL 1IBLL 1PH6A 3GTLH 4YHHL 3KFUA 3D0FA 1FVIA 3RN2A 5JJKA 1BVSA 5IYBH 4HJ9A 1L1OC 4DV1L 3I4NH 3L2PA 3CC4A 2RHSB 1Q86C 1FGUA 3G71A 1SE8A 1XNQL 2N8NA 4H02A 4JV5Q 4DR6L 3BU2A 1JJ2A 2YTXA 1B8AA 2YYZA 5ELNA 2IHFA 4A3KH 1E1OA 2Z6KA 1NY4A 4QJFA 4POFA 1HH2P 1X3EA 4YY3L 1E24A 1VQGA 5IP9G 1PH9A 3DM3A 1BBUA 4K0KQ 3PUYA 2IHEA 2UXDQ 3CPFA 1YJWA 1GVPA 1YNXA 1Q12A 1U5KA 2HIXA 4X62L 1DGSA 1HR0Q 4BY1H 3HOWG 4DUZL 1YBYA 1J5EL 4DAYB 1HJPA 3PUXA 3HOUH 2UUCQ 3F2BA 2D62A 1Y1WH 3G6EA 1Q8KA 2I5LX 4B3TL 1YEZA 1N33Q 4AYBG 3OTOQ 3ULLA 4LF4Q 4YCUA 4P74A 1PH1A 2R7FA 4LUVA 5GROA 4B3MQ 1AE2A 4A3LG 1X65A 2E2IH 1FL0A 1EQQA 5IY0A 1VQ4A 4A3DH 2VUMG 1CKOA 1Y1VG 1T9HA 3UDIA 5M5YH 1EIYB 2JA7H 4DK3C 2UXDL 1KRSA 2A19A 4OO1G 3PF5A 1VQKA 3HOXH 3D31A 5HY6A 5GQOA 2E2JH 5M3FG 4P72A 3FKIG 2PNHA 1N36Q 1VQBA 2E8GA 1AH9A 3PUWA 4JBJA 5FLMH 2KENA 2R93G 5E7NA 3HKZG 2MQHA 1XMOQ 1HZBA 4BA1I 4IPHA 3B6YA 3ULPA 2UU9Q 3JAMc 4A3BG 2OTJA 3F8TA 2VQEQ 4PMWA 3T1YL 1CKNB 4DV6L 1WYDA 3TS2A 1CKNA 2AWNA 2PQAA 2Q2TA 1GKHA 5C0XI 4HIKA 1JMCA 4B3SL 4AQYQ 4X66L 5GADC 4A3CG 2KCTA 5ELOA 1OXXK 1A0IA 2I5MX 3S24A 1VQMA 2K14A 5JEAG 2UUAQ 5IYDH 5JEAJ 2JEBI 3NEMA 2OCEA 4X65Q 3EN2A 2VQFQ 3CC2A 4DR4Q 4DV2L 4JI6L 3ER0A 1OXUA 4A4IA 4EQ5A 1XPRA 2DGYA 1KAWA 1SR3A 1I94Q 2VL6A 4KHPQ 4DV4Q 1VQOA 4DUYQ 2Q2UA 2NVTH 3ULJA 4UPAA 3RLNA 4DV5Q 1X56A 2EXDA 4PG3A 3Q8DA 3I4MH 1GO3E 2JQOA 1Q81C 4LFBL 4L5TA 5M3MG 4JI3L 2JA8G 2Z6KC 4LF8L 3CCQA 3PO2G 4LUOA 1SROA 3H3VH 1Z47A 2CCZA 2WFWA 1NE3A 1XMQL 3GTQH 1XPUA 3PO3G 4A3BH 1PHJA 2CWAA 2AKWB 2HHHL 1X3GA 1VQAA 4NXML 3CCEA 2R7DA 1N9WA 4DV4L 4DR7L 1PFSA 2CQOA 3FP9A 3PGZA 4KI0A 2CKZB 4JI1Q 1MJEA 2VY3A 2H5XA 2RCNA 5K36G 1FJGL 1S3OA 1VQHA 1R9TH 1VS0A 3I55A 3CF5A 4XTCS 1VQ7A 2UUBQ 1C0AA 4JG2A 2ZTEA 4DR2L 1C9OA 4DR3Q 2I5HA 4PZ7A 4BXXH 3J7ZC 4UP7A 1YITA 2JE6I 4JI4Q 1VCIA 2HT1A 4BBRH 2CWPA 1Q82C 4OX9L 1IBLQ 4YHHQ 1P16A 4DR1L 4LNQA 3MXNB 5BR8L 3STBD 1UWVA 1EWIA 5C0XG 1VQ8A 1L0WA 4DV1Q 4A3IH 5C0XJ 3S2DH 2K75A 1VQLA 2WB1G 1JJCB 1WOCA 4OONA 3GTKH 2JJQA 1KL9A 2RF4A 4IPCA 4DK6C 3MEFA 2QEXA 2ZJRA 3CCVA 4JCVE 3A5ZB 4R4CA 1XNQQ 2KCMA 1KC8C 2DUDA 1AE3A 2R6GA 3I2ZA 5C44G 2VNUD 3RLOA 1B70B 2Q2HA 4YY3Q 4JI8L 4A3FH 1HR0W 4A3MG 1UE6A 1HNWL 2FXQA 2AWOA 2JA6H 4A3JH 4X62Q 2C35B 4LF9L 4B3RQ 4DUZQ 1J5EQ 5LMNL 3S14H 4B3TQ 3KLWA 4MNOA 4YWMA 2B3GA 4BBSG 1L2FA 1O7IA 1CSQA 2N3SA 3K0XA 2E5LL 2I0QA 1PH2A 2R7ZG 5C4XH 1I50H 5IYCG 4BY7H 4AH6A 4DV7L 2F52A 1EFWA 1LYLA 4DR5L 4TQUS 4GN4B 4OWXB 2A8VA 3EIVA 1HZ9A 2YV5A 3U50C 3KYHC 3J81c 4B3RL 3RR5A 3PCOB 1YHBA 2K5NA 4HJAA 1LUZA 1P8LA 3K7AH 3UDGA 1YIJA 1K73C 1V1QA 2R92G 3HOVG 1IYJB 3NENA 1GM5A 3GTPH 4R4QA 4GKJL 5C3EG 1PA6A 1KQSA 1S72A 1XTDA 4L5RC 4MZ9A 4A3GG 4A75A 4QL5A 3CMAA 4DV6Q 4FDBA 3T1YQ 2WP8J 1IBKL 3GO5A 2E2HH 2OWOA 3K7UC 3F2DA 3CQZH 4B3SQ 3RN5A 4X66Q 5IP7G 2BA1A 5H1SE 2PI2A 4LFAL 5IE8A 4JBWA 4C2MH 1PH8A 1G6PA 1IBML 4LF5L 3DLLA 4DV2Q 4JI6Q 2XGTA 5IP9H 3W5OA 1K0RA 1MJCA 3G48A 3HFZB 3JC66 1PV4A 3F1ZA 4LUZA 1N32L 3HOWH 2YTVA 1CUKA 2PQAB 1K8AC 1WCMG 4NXNL 4GN3B 3VDYA 4LF7L 2R92H 3HOZG 1BBWA 4LFBQ 5FLXc 1WI5A 2HIVA 3AQQA 2UUBL 4X64L 3K81C 2KBNA 4JI3Q 3S17H 3NELA 4LF8Q 1UE1A 4A3LH 1A62A 3KF8B 1XMQQ 2Q2IA 1Q7YC 1U0LA 4IFDI 2K50A 2IT1A 2ZTDA 2VUMH 2HHHQ 1JB7A 1Y1VH 4NXMQ 2F3IA 4QQBX 4C3IH 1NMFA 1GD7A 4JI2L 2OQKA 3ZJYC 3I56A 1SRUA 4LWCA 4IPDA 4UY8C 4DR7Q 3PF4A 4JBMA 1Z9FA 4IOCA 3U4VA 3U4ZA 3OW2A 4GN5A 3CCMA 1I6HH 3AFPA 5M3FH 1FJGQ 3FKIH 3M3YH 2IX1A 3T1HL 5EAYA 4GKKL 2B29A 4JI0L 4A3EG 4DR2Q 2R93H 3SGIA 3M85A 2EIFA 2L15A 3H0GG 4XIGS 1E22A 1M1KC 2WAQE 5FJ8G 2GVAA 3KJPA 3NBHB 2YTYA 2GVBA 4EX5A 4L5QA 4LW1A 1QZGA 4HIDA 2UXBL 2ASBA 2JA5G 4OX9Q 2IY5B 1XNRL 4IJHA 3E0EA 4DR1Q 4R4OA 5BR8Q 2ZJPA 5FLMG 2B63G 4RMFA 1TXYA 2VW9A 4A3CH 2ALYB 4GNXB 2PI2E 2ATWA 2AHOB 4GNXA 1HNXQ 1VQCA 3KJOA 2KHIA 3GTJH 1W3SA 3WWVA 3J80c 1OTCA 2UXCL 5M5XH 3M4OH 1E1TA 2ZJQA 3HOYG 4GS3A 2Z0SA 2K4KA 3H15A 3S1RH 4JI8Q 1C7YA 1NJIC 1RIPA 1HNWQ 2OTLA 4ME3A 4GLVB 1M90C 5AJ3L 4LF9Q 4JYAL 2JK8A 4HIOA 2K5VA 1YI2A 2PMZE 5LMNQ 5M3MH 1X9NA 5LMUL 2JA8H 4O0AA 1YJ9A 1EYGA 1CKMA 3ICEA 1QVCA 3L0OA 3PO2H 2F4VL 1PVOA 1HNZL 3CCRA 2E5LQ 5IYBG 4BA2I 1I5FA 3I4NG 3CAMA 3PO3H 4IFDG 3BZCA 4IFDJ 4JBKA 4DV7Q 2BH8A 1B7YB 1QZHA 2ES2A 4DR5Q 2NVXH 1X54A 3CCSA 4DKAC 2WAQG 4R1JA 3HKSA 4A3KG 1IXRA 4DNIA 4NB3A 4O2DA 4A93G 4P75A 1K3RA 3JAMi 2VS1A 2K52A 4JC0A 3E9HA 1V9PA 2RHQB 3M9BA 4P71A 1I3QH 3W1BA 1K8GA 5IWAL 1D8LA 4AYBE 4GOPB 1A63A 3CD6A 3IRBA 4RG1A 4BY1G 4GOPA 3PUVA 2IX0A 4LF6L 1SLJA 1VQEA 1OXVA 3HOUG 3KOJA 4DV0L 1Y1WG 2AMCB 1ASZA 4GKJQ 3M7NA 3S2HH 3CMEA 1IL2A 1QVFA 2F4VQ 1UE5A 1IBKQ 1PH3A 1LM0A 4KLKA 1W2BA 1EQRA 4A3DG 1TWCH 4L5SA 1CSPA 1VQFA 2XTIA 1BKBA 3M4QA 3UE0A 1XJVA 2JA7G 1LTLA 4JI7L 4LFAQ 4JI5L 1VQPA 4Y52H 1D7QA 3HKZE 1OXTA 4OWTB 5C44H 4DV3L 4R4IA 4LFCL 3HOXG 1IBMQ 4LF5Q 1YJNA 4IOAA 2A1AA 3AFQA 1VQ9A 5M5WH 3J81j 1SN8A 3TREA 4A3MH 2D0PA 3GD7A 2NVYH 4DAMA 1Q46A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TWF H;  3LGJ A;  3TRZ A;  1N32 Q;  3CXC A;  4WJ4 A;  1K9M C;  3AYH B;  4GNX C;  2N49 A;  4OWW B;  1E3P A;  4NXN Q;  3BZK A;  1IZ6 A;  3K8A A;  3TEH B;  1TWG H;  4YCV A;  2YU9 H;  4LF7 Q;  1KD1 C;  4UP8 A;  4BBS H;  2MO0 A;  4X64 Q;  2R7Z H;  1RL2 A;  4IJL A;  5IYC H;  1H95 A;  4Y7N H;  4ALP A;  1PYS B;  2HQL A;  4QGU A;  4JV5 L;  3J80 i;  3RLF A;  5IYD G;  4OXP A;  3GDE A;  1QUQ B;  2EQS A;  1UE7 A;  2CFM A;  1QUQ A;  4JI2 Q;  1HZA A;  3A0J A;  4YCW A;  3G4S A;  1PH7 A;  3RNU A;  3S16 H;  4K0K L;  3HOV H;  4NPS A;  1HR0 L;  3U58 A;  1TWH H;  3T1H Q;  3KDF B;  4GKK Q;  3J7A 5;  4JI0 Q;  2NN6 G;  3KDF A;  4WJ3 M;  3PIP A;  2UUC L;  1N34 Q;  3UDF A;  5C3E H;  2NZH A;  2LSS A;  1N33 L;  3I4M G;  1YHQ A;  4HJ7 A;  3OTO L;  1SMX A;  4UP9 A;  2QA4 A;  1A8V A;  4LF4 L;  3GTO H;  2UXB Q;  4A3G H;  1UEB A;  1KXL A;  2LXJ A;  1XNR Q;  3RZO H;  4B3M L;  2KHJ A;  4GLX A;  1YHA A;  3BJU A;  3FHW A;  2ID0 A;  1OXS C;  4HJ8 A;  4GOP C;  1VQI A;  5IP7 H;  3CW2 C;  3CC7 A;  4JOI A;  2UXC Q;  3A74 A;  1NMG A;  1ASY A;  1KIX A;  1L1O B;  1N34 L;  1MKH A;  2Y0S E;  1G51 A;  1L1O A;  1N36 L;  5GAG C;  3S1M H;  3PV0 A;  3KF6 B;  2MO1 A;  5HGQ A;  3A5U A;  1XMO L;  3KF6 A;  2JEA I;  3TS0 A;  1EUJ A;  3PSI A;  4MTN A;  1SFO H;  4BXX G;  1WCM H;  1JJG A;  3F2C A;  3GTG H;  5AJ3 Q;  2UU9 L;  1VQJ A;  4JYA Q;  5LMN W;  1PH4 A;  4POG A;  2NZO A;  4BBR G;  2VQE L;  4PZ8 A;  1MIU A;  2WB1 E;  3L7Z C;  4QY7 A;  3HOZ H;  1X6O A;  2OQ0 A;  5LMU Q;  4YWL A;  4TVA B;  3S1N H;  1EIF A;  2MFI A;  2BA0 A;  3J81 i;  3UE1 A;  4PZ6 A;  1HNZ Q;  1V43 A;  1VQD A;  1WJJ A;  1Y14 B;  2VZA A;  3E9I A;  3PUZ A;  1X3F A;  3OYY A;  2MNA A;  4A76 A;  4AQY L;  4A3I G;  2NVQ H;  2ZM6 Q;  3S15 H;  1YZ6 A;  4DPG A;  2V1C C;  2UUA L;  4HIM A;  1N8R C;  5DLQ E;  3CCU A;  5JJL A;  1XPO A;  4A93 H;  1NBW A;  3ERS X;  4X65 L;  5GAH C;  2VQF L;  4DR4 L;  5C4J H;  4KHZ A;  2N78 A;  1WFQ A;  4QIW E;  5IT9 c;  1I94 L;  4A3F G;  3RZD H;  3CCL A;  4KHP L;  5IWA Q;  4DUY L;  2LXK A;  1VQ6 A;  4A3E H;  1Q1B A;  2ZTC A;  1J6Q A;  1KRT A;  4A3J G;  3EBE A;  3I7F A;  3H0G H;  2JA6 G;  1G29 1;  4DV5 L;  5FJ8 H;  1E7Z A;  1JE5 A;  4LF6 Q;  1YVC A;  2BH2 A;  2D0O A;  4DV0 Q;  1PYB A;  5J3B A;  2ZM6 L;  1Q1E A;  3PIO A;  1S40 A;  4C3H H;  2JA5 H;  4IPG A;  4GLA C;  4AIM A;  5JJI A;  4IO9 A;  5GAE C;  2Y0S G;  2QGQ A;  4P73 A;  2B63 H;  4BY7 G;  3I4O A;  3M4P A;  3K80 C;  5C4X G;  4HJ5 A;  1QVG A;  4R4T A;  3CP0 A;  2JA9 A;  1HZC A;  4J15 A;  3UDX A;  4JI7 Q;  4JI5 Q;  4OO1 I;  3TQY A;  1EOV A;  1NTG A;  4YWK A;  4JI1 L;  3STB C;  3S1Q H;  4DV3 Q;  4X6A H;  2NN6 I;  1KHI A;  2K5H A;  4LFC Q;  3HOY H;  1TWA H;  3AEV A;  4DR6 Q;  4DR3 L;  1X55 A;  1VQ5 A;  3CCJ A;  3GTM H;  2GN5 A;  4JI4 L;  3H3V I;  3W1G A;  1K83 H;  4APV A;  3CPW A;  1PH5 A;  4C3J H;  1JT8 A;  1VQN A;  4JOI C;  1HNX L;  1IBL L;  1PH6 A;  3GTL H;  4YHH L;  3KFU A;  3D0F A;  1FVI A;  3RN2 A;  5JJK A;  1BVS A;  5IYB H;  4HJ9 A;  1L1O C;  4DV1 L;  3I4N H;  3L2P A;  3CC4 A;  2RHS B;  1Q86 C;  1FGU A;  3G71 A;  1SE8 A;  1XNQ L;  2N8N A;  4H02 A;  4JV5 Q;  4DR6 L;  3BU2 A;  1JJ2 A;  2YTX A;  1B8A A;  2YYZ A;  5ELN A;  2IHF A;  4A3K H;  1E1O A;  2Z6K A;  1NY4 A;  4QJF A;  4POF A;  1HH2 P;  1X3E A;  4YY3 L;  1E24 A;  1VQG A;  5IP9 G;  1PH9 A;  3DM3 A;  1BBU A;  4K0K Q;  3PUY A;  2IHE A;  2UXD Q;  3CPF A;  1YJW A;  1GVP A;  1YNX A;  1Q12 A;  1U5K A;  2HIX A;  4X62 L;  1DGS A;  1HR0 Q;  4BY1 H;  3HOW G;  4DUZ L;  1YBY A;  1J5E L;  4DAY B;  1HJP A;  3PUX A;  3HOU H;  2UUC Q;  3F2B A;  2D62 A;  1Y1W H;  3G6E A;  1Q8K A;  2I5L X;  4B3T L;  1YEZ A;  1N33 Q;  4AYB G;  3OTO Q;  3ULL A;  4LF4 Q;  4YCU A;  4P74 A;  1PH1 A;  2R7F A;  4LUV A;  5GRO A;  4B3M Q;  1AE2 A;  4A3L G;  1X65 A;  2E2I H;  1FL0 A;  1EQQ A;  5IY0 A;  1VQ4 A;  4A3D H;  2VUM G;  1CKO A;  1Y1V G;  1T9H A;  3UDI A;  5M5Y H;  1EIY B;  2JA7 H;  4DK3 C;  2UXD L;  1KRS A;  2A19 A;  4OO1 G;  3PF5 A;  1VQK A;  3HOX H;  3D31 A;  5HY6 A;  5GQO A;  2E2J H;  5M3F G;  4P72 A;  3FKI G;  2PNH A;  1N36 Q;  1VQB A;  2E8G A;  1AH9 A;  3PUW A;  4JBJ A;  5FLM H;  2KEN A;  2R93 G;  5E7N A;  3HKZ G;  2MQH A;  1XMO Q;  1HZB A;  4BA1 I;  4IPH A;  3B6Y A;  3ULP A;  2UU9 Q;  3JAM c;  4A3B G;  2OTJ A;  3F8T A;  2VQE Q;  4PMW A;  3T1Y L;  1CKN B;  4DV6 L;  1WYD A;  3TS2 A;  1CKN A;  2AWN A;  2PQA A;  2Q2T A;  1GKH A;  5C0X I;  4HIK A;  1JMC A;  4B3S L;  4AQY Q;  4X66 L;  5GAD C;  4A3C G;  2KCT A;  5ELO A;  1OXX K;  1A0I A;  2I5M X;  3S24 A;  1VQM A;  2K14 A;  5JEA G;  2UUA Q;  5IYD H;  5JEA J;  2JEB I;  3NEM A;  2OCE A;  4X65 Q;  3EN2 A;  2VQF Q;  3CC2 A;  4DR4 Q;  4DV2 L;  4JI6 L;  3ER0 A;  1OXU A;  4A4I A;  4EQ5 A;  1XPR A;  2DGY A;  1KAW A;  1SR3 A;  1I94 Q;  2VL6 A;  4KHP Q;  4DV4 Q;  1VQO A;  4DUY Q;  2Q2U A;  2NVT H;  3ULJ A;  4UPA A;  3RLN A;  4DV5 Q;  1X56 A;  2EXD A;  4PG3 A;  3Q8D A;  3I4M H;  1GO3 E;  2JQO A;  1Q81 C;  4LFB L;  4L5T A;  5M3M G;  4JI3 L;  2JA8 G;  2Z6K C;  4LF8 L;  3CCQ A;  3PO2 G;  4LUO A;  1SRO A;  3H3V H;  1Z47 A;  2CCZ A;  2WFW A;  1NE3 A;  1XMQ L;  3GTQ H;  1XPU A;  3PO3 G;  4A3B H;  1PHJ A;  2CWA A;  2AKW B;  2HHH L;  1X3G A;  1VQA A;  4NXM L;  3CCE A;  2R7D A;  1N9W A;  4DV4 L;  4DR7 L;  1PFS A;  2CQO A;  3FP9 A;  3PGZ A;  4KI0 A;  2CKZ B;  4JI1 Q;  1MJE A;  2VY3 A;  2H5X A;  2RCN A;  5K36 G;  1FJG L;  1S3O A;  1VQH A;  1R9T H;  1VS0 A;  3I55 A;  3CF5 A;  4XTC S;  1VQ7 A;  2UUB Q;  1C0A A;  4JG2 A;  2ZTE A;  4DR2 L;  1C9O A;  4DR3 Q;  2I5H A;  4PZ7 A;  4BXX H;  3J7Z C;  4UP7 A;  1YIT A;  2JE6 I;  4JI4 Q;  1VCI A;  2HT1 A;  4BBR H;  2CWP A;  1Q82 C;  4OX9 L;  1IBL Q;  4YHH Q;  1P16 A;  4DR1 L;  4LNQ A;  3MXN B;  5BR8 L;  3STB D;  1UWV A;  1EWI A;  5C0X G;  1VQ8 A;  1L0W A;  4DV1 Q;  4A3I H;  5C0X J;  3S2D H;  2K75 A;  1VQL A;  2WB1 G;  1JJC B;  1WOC A;  4OON A;  3GTK H;  2JJQ A;  1KL9 A;  2RF4 A;  4IPC A;  4DK6 C;  3MEF A;  2QEX A;  2ZJR A;  3CCV A;  4JCV E;  3A5Z B;  4R4C A;  1XNQ Q;  2KCM A;  1KC8 C;  2DUD A;  1AE3 A;  2R6G A;  3I2Z A;  5C44 G;  2VNU D;  3RLO A;  1B70 B;  2Q2H A;  4YY3 Q;  4JI8 L;  4A3F H;  1HR0 W;  4A3M G;  1UE6 A;  1HNW L;  2FXQ A;  2AWO A;  2JA6 H;  4A3J H;  4X62 Q;  2C35 B;  4LF9 L;  4B3R Q;  4DUZ Q;  1J5E Q;  5LMN L;  3S14 H;  4B3T Q;  3KLW A;  4MNO A;  4YWM A;  2B3G A;  4BBS G;  1L2F A;  1O7I A;  1CSQ A;  2N3S A;  3K0X A;  2E5L L;  2I0Q A;  1PH2 A;  2R7Z G;  5C4X H;  1I50 H;  5IYC G;  4BY7 H;  4AH6 A;  4DV7 L;  2F52 A;  1EFW A;  1LYL A;  4DR5 L;  4TQU S;  4GN4 B;  4OWX B;  2A8V A;  3EIV A;  1HZ9 A;  2YV5 A;  3U50 C;  3KYH C;  3J81 c;  4B3R L;  3RR5 A;  3PCO B;  1YHB A;  2K5N A;  4HJA A;  1LUZ A;  1P8L A;  3K7A H;  3UDG A;  1YIJ A;  1K73 C;  1V1Q A;  2R92 G;  3HOV G;  1IYJ B;  3NEN A;  1GM5 A;  3GTP H;  4R4Q A;  4GKJ L;  5C3E G;  1PA6 A;  1KQS A;  1S72 A;  1XTD A;  4L5R C;  4MZ9 A;  4A3G G;  4A75 A;  4QL5 A;  3CMA A;  4DV6 Q;  4FDB A;  3T1Y Q;  2WP8 J;  1IBK L;  3GO5 A;  2E2H H;  2OWO A;  3K7U C;  3F2D A;  3CQZ H;  4B3S Q;  3RN5 A;  4X66 Q;  5IP7 G;  2BA1 A;  5H1S E;  2PI2 A;  4LFA L;  5IE8 A;  4JBW A;  4C2M H;  1PH8 A;  1G6P A;  1IBM L;  4LF5 L;  3DLL A;  4DV2 Q;  4JI6 Q;  2XGT A;  5IP9 H;  3W5O A;  1K0R A;  1MJC A;  3G48 A;  3HFZ B;  3JC6 6;  1PV4 A;  3F1Z A;  4LUZ A;  1N32 L;  3HOW H;  2YTV A;  1CUK A;  2PQA B;  1K8A C;  1WCM G;  4NXN L;  4GN3 B;  3VDY A;  4LF7 L;  2R92 H;  3HOZ G;  1BBW A;  4LFB Q;  5FLX c;  1WI5 A;  2HIV A;  3AQQ A;  2UUB L;  4X64 L;  3K81 C;  2KBN A;  4JI3 Q;  3S17 H;  3NEL A;  4LF8 Q;  1UE1 A;  4A3L H;  1A62 A;  3KF8 B;  1XMQ Q;  2Q2I A;  1Q7Y C;  1U0L A;  4IFD I;  2K50 A;  2IT1 A;  2ZTD A;  2VUM H;  2HHH Q;  1JB7 A;  1Y1V H;  4NXM Q;  2F3I A;  4QQB X;  4C3I H;  1NMF A;  1GD7 A;  4JI2 L;  2OQK A;  3ZJY C;  3I56 A;  1SRU A;  4LWC A;  4IPD A;  4UY8 C;  4DR7 Q;  3PF4 A;  4JBM A;  1Z9F A;  4IOC A;  3U4V A;  3U4Z A;  3OW2 A;  4GN5 A;  3CCM A;  1I6H H;  3AFP A;  5M3F H;  1FJG Q;  3FKI H;  3M3Y H;  2IX1 A;  3T1H L;  5EAY A;  4GKK L;  2B29 A;  4JI0 L;  4A3E G;  4DR2 Q;  2R93 H;  3SGI A;  3M85 A;  2EIF A;  2L15 A;  3H0G G;  4XIG S;  1E22 A;  1M1K C;  2WAQ E;  5FJ8 G;  2GVA A;  3KJP A;  3NBH B;  2YTY A;  2GVB A;  4EX5 A;  4L5Q A;  4LW1 A;  1QZG A;  4HID A;  2UXB L;  2ASB A;  2JA5 G;  4OX9 Q;  2IY5 B;  1XNR L;  4IJH A;  3E0E A;  4DR1 Q;  4R4O A;  5BR8 Q;  2ZJP A;  5FLM G;  2B63 G;  4RMF A;  1TXY A;  2VW9 A;  4A3C H;  2ALY B;  4GNX B;  2PI2 E;  2ATW A;  2AHO B;  4GNX A;  1HNX Q;  1VQC A;  3KJO A;  2KHI A;  3GTJ H;  1W3S A;  3WWV A;  3J80 c;  1OTC A;  2UXC L;  5M5X H;  3M4O H;  1E1T A;  2ZJQ A;  3HOY G;  4GS3 A;  2Z0S A;  2K4K A;  3H15 A;  3S1R H;  4JI8 Q;  1C7Y A;  1NJI C;  1RIP A;  1HNW Q;  2OTL A;  4ME3 A;  4GLV B;  1M90 C;  5AJ3 L;  4LF9 Q;  4JYA L;  2JK8 A;  4HIO A;  2K5V A;  1YI2 A;  2PMZ E;  5LMN Q;  5M3M H;  1X9N A;  5LMU L;  2JA8 H;  4O0A A;  1YJ9 A;  1EYG A;  1CKM A;  3ICE A;  1QVC A;  3L0O A;  3PO2 H;  2F4V L;  1PVO A;  1HNZ L;  3CCR A;  2E5L Q;  5IYB G;  4BA2 I;  1I5F A;  3I4N G;  3CAM A;  3PO3 H;  4IFD G;  3BZC A;  4IFD J;  4JBK A;  4DV7 Q;  2BH8 A;  1B7Y B;  1QZH A;  2ES2 A;  4DR5 Q;  2NVX H;  1X54 A;  3CCS A;  4DKA C;  2WAQ G;  4R1J A;  3HKS A;  4A3K G;  1IXR A;  4DNI A;  4NB3 A;  4O2D A;  4A93 G;  4P75 A;  1K3R A;  3JAM i;  2VS1 A;  2K52 A;  4JC0 A;  3E9H A;  1V9P A;  2RHQ B;  3M9B A;  4P71 A;  1I3Q H;  3W1B A;  1K8G A;  5IWA L;  1D8L A;  4AYB E;  4GOP B;  1A63 A;  3CD6 A;  3IRB A;  4RG1 A;  4BY1 G;  4GOP A;  3PUV A;  2IX0 A;  4LF6 L;  1SLJ A;  1VQE A;  1OXV A;  3HOU G;  3KOJ A;  4DV0 L;  1Y1W G;  2AMC B;  1ASZ A;  4GKJ Q;  3M7N A;  3S2H H;  3CME A;  1IL2 A;  1QVF A;  2F4V Q;  1UE5 A;  1IBK Q;  1PH3 A;  1LM0 A;  4KLK A;  1W2B A;  1EQR A;  4A3D G;  1TWC H;  4L5S A;  1CSP A;  1VQF A;  2XTI A;  1BKB A;  3M4Q A;  3UE0 A;  1XJV A;  2JA7 G;  1LTL A;  4JI7 L;  4LFA Q;  4JI5 L;  1VQP A;  4Y52 H;  1D7Q A;  3HKZ E;  1OXT A;  4OWT B;  5C44 H;  4DV3 L;  4R4I A;  4LFC L;  3HOX G;  1IBM Q;  4LF5 Q;  1YJN A;  4IOA A;  2A1A A;  3AFQ A;  1VQ9 A;  5M5W H;  3J81 j;  1SN8 A;  3TRE A;  4A3M H;  2D0P A;  3GD7 A;  2NVY H;  4DAM A;  1Q46 A; 
#chains in the Genus database with same CATH topology
 3TRZ A;  1K9M C;  3QIA A;  1E3P A;  4NXN Q;  5CV5 A;  4YCV A;  1KD1 C;  2MO0 A;  5C44 B;  1X32 A;  4QGU A;  1F9Q A;  3QWN A;  4OXP A;  4RH6 A;  1LAC A;  1QUQ B;  2EQS A;  2B2T C;  2NVY B;  4DXG A;  1E0B A;  4JI2 Q;  1HZA A;  1STY A;  2KEC A;  3A0J A;  4YCW A;  1EY5 A;  3J80 L;  1B9M A;  2GA4 B;  1HR0 L;  1M4V A;  2YU9 B;  3D4W A;  3KLS A;  3MFY A;  3OWF A;  2NN6 G;  4GZY C;  2C5C A;  2R61 A;  1QNK A;  5C3E H;  2NZH A;  2LSS A;  1XWE A;  4IUP A;  4DNR B;  1N33 L;  4HJ7 A;  1SMX A;  4UP9 A;  2QA4 A;  1A8V A;  1H9M A;  3OWE B;  4RCO A;  3GTO H;  2UXB Q;  4A3G H;  1TU2 B;  1XNR Q;  2F0F A;  4GLX A;  2B2V A;  3S16 B;  4HJ8 A;  5I2Y A;  3CW2 C;  1AP0 A;  5K5P A;  2Q8I B;  4WFN 3;  5NUC A;  3BS1 A;  1ASY A;  5ELE A;  5IGG A;  1N34 L;  2Z4I A;  1MKH A;  4F7X A;  1G51 A;  1L1O A;  1BBX C;  1ESR A;  5HGQ A;  3RZO B;  1XMO L;  2JEA I;  4BXX G;  3TS0 A;  1EUJ A;  3BYT B;  1Z6H A;  5IGB A;  4HMJ A;  2XN9 C;  2NYZ D;  2OQ0 A;  5LMU Q;  2AQ1 B;  3N52 A;  4TVA B;  1EIF A;  1I4P A;  2BA0 A;  2F0D A;  4PZ6 A;  1WJJ A;  3E9I A;  4A76 A;  4C56 C;  4RAU C;  3S15 H;  2LY7 A;  1C48 A;  1KDA A;  5DLQ E;  3CCU A;  1WTO A;  1XPO A;  4A93 H;  5GAH C;  4KHZ A;  1D2B A;  5IT9 c;  1EYC A;  3SVM A;  3QR8 A;  3RZD H;  5IWA Q;  2NZ1 D;  1KRT A;  3Q6S A;  2CVR A;  1G29 1;  2NVQ B;  1E7Z A;  3I90 A;  3ZYY X;  2ZM6 L;  1T5X D;  2OEO A;  3DMU A;  3DXJ C;  2CH4 A;  4GLA C;  5GAE C;  2QGQ A;  5C4J B;  4BY7 G;  3I4O A;  3X3M A;  5DNF A;  4ID6 A;  5EPJ A;  4I7A A;  4J15 A;  1HZC A;  1F2Y A;  4RGN A;  4JI5 Q;  4OO1 I;  3OMC A;  2F0I A;  3H0G B;  4YWK A;  4DA2 A;  1PRT B;  2P5Z X;  4B9W A;  2JA5 B;  1X55 A;  2QKI C;  2B2V C;  3CCJ A;  3GTM H;  3IFT A;  4APV A;  3I8Z A;  3VYR A;  3QO2 A;  1PH5 A;  4C3J H;  2K33 A;  1IBL L;  1PH6 A;  3A56 A;  2NB0 A;  1LT5 D;  5JJK A;  3G6J B;  1SYF A;  5JVH 3;  1L1O C;  4DV1 L;  3L2P A;  4ZLT F;  1MI2 A;  3HOY B;  1XNQ L;  2KVM A;  4H02 A;  4CKC A;  4WJW A;  1JJ2 A;  4RGO S;  2IHF A;  2Z6K A;  1NY4 A;  4QJF A;  4POF A;  4CJ1 B;  1GOZ A;  3PUY A;  2IHE A;  1HR0 Q;  1YNX A;  2HIX A;  3VYS A;  1PFB A;  3HOW G;  4DAY B;  1HJP A;  1QWY A;  3I4N B;  3HOU H;  2D62 A;  1I4Q A;  3G6E A;  1B2T A;  1Q8K A;  4B3T L;  1N33 Q;  2WV6 D;  1CK1 A;  5GRO A;  1HHV A;  1SE2 A;  1FL0 A;  5EKK A;  1EQQ A;  5IY0 A;  4FYD A;  1EIH A;  1T9H A;  5M5Y H;  2RDF A;  2EYO A;  1D6E C;  4DK3 C;  3MTS A;  3J7A V;  1O78 A;  5J1Z A;  4JW0 A;  1GHJ A;  3PF5 A;  3VYT A;  3P7J A;  4KY5 A;  1CQF A;  5HY6 A;  4P72 A;  2F0S A;  2PNH A;  3MXU A;  3PUW A;  2R93 G;  2KEN A;  1XMO Q;  2E2I B;  4A3B G;  2SDF A;  3C46 A;  3KLR A;  4PMW A;  3T1Y L;  3FEW X;  3TZD A;  3TS2 A;  3VA5 A;  1ZXT A;  1FGB D;  3CQZ B;  1JR0 D;  1GKH A;  4B3S L;  3HOX B;  1IYU A;  4K8I A;  4X66 L;  5GAD C;  5ELO A;  5IYD H;  2JEB I;  1KDB A;  4EQ5 A;  1O7Z A;  1XPR A;  1KAW A;  1GHK A;  4H7B A;  2B2U A;  4UPA A;  3I4M H;  2JQO A;  4LFB L;  5JOB A;  2JA8 G;  2Z6K C;  5D3I B;  2MGS A;  2DY8 A;  2CCZ A;  1XMQ L;  3BVM A;  2Z8L A;  3DWQ A;  2AQ3 B;  2CWA A;  5KEE A;  1X3G A;  4XYQ A;  2M2L A;  5G3L D;  1II3 A;  3OOC A;  5J39 A;  3K58 A;  1FYC A;  3PGZ A;  4KI0 A;  5T1I A;  2ZXO A;  1MJE A;  1W6K A;  3TDQ A;  1R9T H;  1IHZ A;  1EU3 A;  3Q0A A;  1YIT A;  2JE6 I;  5CBA E;  4A3B B;  5KND A;  2FMM A;  4CBV A;  1D5X C;  4BBR H;  2CWP A;  3NTH A;  1IBL Q;  3MXN B;  5DEH A;  4ZUI A;  4KD3 A;  5BR8 L;  5C0X G;  4DV1 Q;  3IL8 A;  1XX8 A;  1VQL A;  2WB1 G;  1WOC A;  1LTI D;  3GTK H;  2UUB L;  4PMB A;  1XNQ Q;  1HTL D;  1TS4 A;  2RVL A;  1KC8 C;  1VF5 C;  4QMG A;  1RF2 D;  3RLO A;  4BS9 A;  2D9U A;  1B70 B;  1SE4 A;  4A3F H;  4DGZ A;  2PW5 A;  2F0H A;  4LF9 L;  3HS0 C;  1IW7 C;  3D3R A;  5DAU A;  4A3I B;  2JA8 B;  1ILP A;  1PFM A;  1EQT A;  3TZU A;  2M9V A;  4B3T Q;  4Q5V A;  1D5Z C;  4K6L A;  1L2F A;  3R2I A;  2I0Q A;  4F87 A;  1PH2 A;  2WKC A;  4DV7 L;  2F52 A;  5IOD A;  4DR5 L;  2B2U C;  4GN4 B;  1JOO A;  5I4D A;  4OGQ C;  1HZ9 A;  2Z6B A;  1MSH A;  2JA6 B;  4A3J B;  4IUV A;  5CV4 A;  3SHL A;  4ZCK A;  4DK1 A;  1RHP A;  1P8L A;  2R92 G;  2O5I C;  1IYJ B;  1KAA A;  1PZK D;  5C3E G;  1FNU A;  2K04 A;  4MZ9 A;  4A3G G;  3T1Y Q;  5FOB B;  4FDB A;  4KY7 A;  4C3I G;  3BG3 A;  3NBI A;  1PDQ A;  2WB1 B;  1ET6 A;  4B3S Q;  3RN5 A;  4X66 Q;  1JOK A;  2BA1 A;  5C6A A;  3GV6 A;  4OEM B;  1PH8 A;  1IBM L;  4LF5 L;  5M5W B;  4H44 C;  1PFN A;  3HFZ B;  2A6E C;  1HRJ A;  4BWG B;  2PQA B;  2E2H B;  4J6H A;  4LF7 L;  3GP7 A;  1BNZ A;  2KEE A;  4LFB Q;  5FLX c;  1WI5 A;  2HIV A;  4DXF A;  4X64 L;  4FXD A;  2NUC A;  2BDN A;  1CFM A;  1YNN C;  4MN3 A;  4C2M B;  1A62 A;  1BCP D;  3KF8 B;  1XMQ Q;  2Q2I A;  2G9D A;  2ZTD A;  5BN3 A;  2VUM H;  4XQJ A;  4QF4 A;  4UY8 C;  4A93 G;  3ZJY C;  2TMP A;  1SRU A;  2FIN B;  3ERQ A;  1BXT A;  2F0T A;  4IOC A;  3U4Z A;  4GN5 A;  3CCM A;  4KV6 A;  2R92 B;  5M3F H;  1JIC A;  2IX1 A;  2ENB A;  2CH4 W;  3BVZ A;  5EAY A;  4GKK L;  2B29 A;  1PZI D;  5IOC A;  1H9S B;  4XIG S;  1E22 A;  2WAQ E;  2GVA A;  5F2D A;  3GTO B;  1Y1V B;  4LW1 A;  4EX5 A;  2LS0 1;  1S5F D;  4C3I B;  4ILW A;  5BR8 Q;  2DNE A;  2ZJP A;  2JP1 A;  1STA A;  2NWG A;  4IUU A;  4GNX A;  1VQC A;  1OTC A;  3Q22 A;  5M5X H;  2ZJQ A;  2V4D A;  2K4K A;  3H15 A;  3PIP 3;  1WTV A;  1Y8O B;  2FJ2 A;  4XDX A;  2IW3 A;  3O13 A;  1CHQ D;  3V96 A;  3K5N A;  2RKS A;  4GLV B;  5AJ3 L;  4LF9 Q;  1DZ1 A;  4HIO A;  2K5V A;  4C3J G;  3SE0 A;  5M3M H;  2E76 C;  3ICE A;  2PZT A;  2F4V L;  4WRD A;  1X3P A;  5E4W C;  4IFD J;  1H9K A;  5A2Q E;  4DV7 Q;  3EA6 A;  4C1N I;  1BF4 A;  4DR5 Q;  2K28 A;  3S1R B;  1K0S A;  2EY6 A;  3W3A A;  1VF7 A;  4R1J A;  3HKS A;  1I4H A;  3P75 A;  1IXR A;  1O7L A;  4CGY B;  1MBY A;  1S4Z A;  2K52 A;  3W1B A;  5K36 H;  3RZD B;  4KKT A;  1HQM C;  2F0L A;  3CD6 A;  3PO2 B;  4GOP A;  5E4X A;  5KYI A;  1RTN A;  1TVX A;  3NSW A;  1VQE A;  3JAM L;  3HOU G;  3PO3 B;  1JWS D;  4DV0 L;  1EZ8 A;  4CDC C;  3M7N A;  3S2H H;  1IL2 A;  5KYL A;  2NVX B;  4K5W A;  1UE5 A;  5I6Y A;  1ZYR D;  3TSS A;  4FF3 A;  1QG7 A;  2ICI A;  1VQF A;  3UE0 A;  2XRQ D;  4JI7 L;  1SJE D;  4IFD H;  4R4I A;  4LFC L;  1IBM Q;  4LF5 Q;  4IOA A;  5C3W A;  4A3M H;  3PSI A;  3GD7 A;  4DU9 A;  1B3A A;  1Q46 A;  2F0W A;  1A3V A;  5FK9 C;  1LTT D;  1QB5 D;  5DM7 3;  2MHV A;  2N49 A;  4GNX C;  1NUC A;  4C3J B;  1R4P B;  3X3N A;  1TWC B;  3BZK A;  4HTH A;  4LF7 Q;  3TEH B;  1TWG H;  2EPB A;  4X64 Q;  2EYP A;  1DOK A;  1NAP A;  4DAY A;  2QW7 A;  1RL2 A;  4EVO A;  1H95 A;  4Y7N H;  3I72 A;  1PYS B;  2Z4H A;  4RHR A;  1PTO B;  3J80 i;  3RLF A;  5IYD G;  3M7G A;  1TWF B;  5A35 A;  4R8I A;  2PPB C;  4QIW B;  3G4S A;  3RNU A;  3HOV H;  4M1U B;  4NPS A;  1TWH H;  4GKK Q;  3J7A 5;  4EQP A;  1G2T A;  3KDF A;  1B50 A;  2R7Z B;  4LAA A;  4N9T A;  2N55 A;  2R3Z A;  3I4M G;  1W6J A;  3SK5 A;  1JOQ A;  3I70 A;  4LF4 L;  2LXJ A;  4GOP C;  2LKV A;  5IP7 H;  3NWS A;  3A7A B;  4JOI A;  1MD2 D;  3A74 A;  1KIX A;  1V1P B;  1J9O A;  4DAP A;  3U9S A;  2Y0S E;  4F88 A;  5GAG C;  1JWU D;  3S1M H;  3MZ5 A;  2K7V A;  3A5U A;  3KF6 A;  1BCP C;  1SFO H;  1HQR D;  5AJ3 Q;  1VQJ A;  2XWJ B;  1PH4 A;  4R8N A;  4BBR G;  2VQE L;  1MIU A;  3HOZ H;  1UUP A;  1QOH A;  4QY7 A;  3J80 E;  1S5B D;  3RD4 A;  2HDM A;  2MFI A;  2F4V Q;  1Y14 B;  2VZA A;  4M8A A;  3OYY A;  1NSN S;  2PNR C;  1WD0 A;  3FMC A;  1WTP A;  1CTM A;  1LAB A;  3OHX C;  3ERS X;  1JC7 A;  1FR3 A;  2XVS A;  1WCM B;  3GTG B;  4QIW E;  1G2S A;  4ZQ3 A;  4A3F G;  4J1M A;  4KHP L;  5EQ0 A;  4DUY L;  2LXK A;  3S1N B;  1Q1B A;  2ZTC A;  3EBE A;  4DV5 L;  1I4R A;  2BH2 A;  1YVC A;  2D0O A;  4DV0 Q;  5J3B A;  3RUZ A;  4AIM A;  2B63 H;  1SSO A;  3M4P A;  1A3T A;  3K80 C;  2HCI A;  4TRD A;  4R4T A;  4EQN A;  4JI7 Q;  4A3E B;  5ELD A;  3TQY A;  1EOV A;  3STB C;  3LWU A;  5L37 A;  1BO0 A;  4X6A H;  4LFC Q;  1TWA H;  1CZW A;  4DR6 Q;  4C3H B;  4DR3 L;  1NR2 A;  3H3V I;  5G3L F;  3W1G A;  3K5O A;  3GTL H;  4JOI C;  5C5L A;  3DWP A;  1FVI A;  3RN2 A;  5IYB H;  4HJ9 A;  3S1Q B;  3EFX D;  4RKL A;  1Q86 C;  2ZXR A;  3G71 A;  3E6Z X;  4RFB A;  1E1O A;  2DJG C;  2CW0 D;  1HH2 P;  2G5D A;  1K83 B;  3EJI A;  4I65 A;  1BBU A;  1YJW A;  1GVP A;  5D14 A;  1Q12 A;  4BY1 H;  1SNP A;  4DUZ L;  1YBY A;  2B8F A;  4V19 0;  3NK9 A;  3WOF A;  5CMD A;  1ICW A;  3E3X A;  3ULL A;  4LF4 Q;  1KTK A;  4P74 A;  2R7F A;  5ELB A;  4A3K B;  4ZAI A;  1ENA A;  2VUM G;  1CKO A;  1EIY B;  2JA7 H;  2J4X A;  3SK4 A;  4I7Z C;  1Y1W B;  3D31 A;  2EJF C;  1HA5 A;  5M3F G;  2RA4 A;  2DNC A;  2O2L D;  4CJ2 C;  4G4K A;  3TME A;  1STB A;  5IT9 L;  1WD1 A;  1HZB A;  1KNA A;  4IPH A;  4A3D B;  2BOS A;  3SEB A;  3F8T A;  1HUM A;  2VQE Q;  1CKN B;  2HDL A;  2ICE C;  5EKL A;  2EY1 A;  2BE5 C;  2Q8R E;  2PQA A;  4HED A;  4U68 A;  2F0P A;  5C0X I;  1JMC A;  2E2J B;  2KCT A;  4S3S A;  1O80 A;  1SXT A;  3NE5 B;  5JEA J;  3NTI A;  1HFN A;  1SE3 A;  2OCE A;  1F9S A;  3EN2 A;  3MA2 B;  3CC2 A;  4DV2 L;  4XQN A;  1I6V C;  1RDP D;  4JI6 L;  4N8X 1;  1GUG A;  1SJH D;  4HAE A;  4KHP Q;  4DV4 Q;  4DUY Q;  1G6Z A;  3ULJ A;  4DV5 Q;  1X56 A;  4KK7 A;  4PG3 A;  3Q8D A;  1AZP A;  1Q81 C;  3OMG A;  5M3M G;  2L9H A;  2XNA C;  2EYL A;  2JN4 A;  5I9P A;  3IFD A;  4LF8 L;  4LUO A;  3GTQ H;  3VYU A;  1QCB D;  1PHJ A;  2HHH L;  1EY4 A;  3ND8 A;  1BUV T;  4NXM L;  3CCE A;  3K59 A;  4RKB A;  2QEJ C;  2R7D A;  1BOS A;  1N9W A;  4K14 A;  4MTK A;  4UDU C;  1XTC D;  3LNN A;  1STE A;  2CKZ B;  4K5X A;  2H5X A;  5K36 G;  4HSV A;  1VQH A;  2EY2 A;  2PCF B;  1QJO A;  5T1G A;  1U4M A;  4DR2 L;  1BCP F;  1C9O A;  4DR3 Q;  3EVQ A;  5ISR A;  4ME5 A;  3J7Y W;  1EY9 A;  2OXP A;  1Q82 C;  4OX9 L;  3R3O A;  4DR1 L;  1P16 A;  1UWV A;  1HUN A;  1EWI A;  2CHB D;  2I07 B;  2EYJ A;  3S2D H;  3A55 A;  1JJC B;  1K8O A;  1HNX L;  1KL9 A;  1WTW A;  2QEX A;  2ZJR A;  2VB3 X;  2KCN A;  2DUD A;  2Q2H A;  3MHB A;  4A3M G;  4LJZ C;  1HNW L;  2FXQ A;  2BDO A;  1LT6 D;  4B3R Q;  4DUZ Q;  2BCO A;  2O4X A;  4CDF C;  1GUW A;  2F4I A;  2DJF C;  1R4Q B;  1TII D;  2E5L L;  1CSQ A;  3K0X A;  4XT3 B;  5C4X H;  1I50 H;  2PQE A;  4TQU S;  2PW7 A;  4OWX B;  5KIX A;  5JVG 3;  2YV5 A;  1JB3 A;  1DD2 A;  3KYH C;  1UEA B;  3R8B A;  1YHB A;  3DUZ A;  3CU7 A;  3EQL C;  5KNC A;  3HOV G;  1LUZ A;  3OIP A;  3K7A H;  3UDG A;  1YIJ A;  1Z7T A;  4X3U A;  3S14 B;  3NEN A;  1AFP A;  5FO8 B;  3GTP H;  4BY7 B;  3CRL C;  1S72 A;  2WAC A;  1XTD A;  2EVB A;  1SMY C;  4KN7 C;  4A75 A;  3CMA A;  4CKB A;  1IBK L;  2CW0 C;  4ZRZ A;  3K7U C;  5CV9 A;  1GUT A;  3F2D A;  4IUR A;  5IP7 G;  2PI2 A;  1SEB D;  5IE8 A;  4JBW A;  4DV2 Q;  4JI6 Q;  5IP9 H;  3W5O A;  1MJC A;  5HGT A;  3JC6 6;  3F1Z A;  1CUK A;  3GQB A;  4GN3 B;  4C1N K;  1KAB A;  3D6C A;  3HOZ G;  1GUO A;  1MSG A;  2K03 A;  4HCS A;  3S17 H;  4LF8 Q;  2AUJ D;  1EYD A;  3MXG A;  4A3L H;  1U0L A;  2VXW A;  1SDF A;  3R93 A;  2HHH Q;  1XXG A;  4NXM Q;  4QQB X;  3VR6 A;  1O7Y A;  3HOW B;  4IPD A;  4RGT A;  1LO5 D;  1Z9F A;  3U4V A;  3OW2 A;  3AFP A;  1TWH B;  3FKI H;  2IJ0 A;  1SNM A;  3T1H L;  5C4Z A;  1AZQ A;  1STN A;  1E2V A;  2SNM A;  3OSO A;  4JI0 L;  1TS3 A;  4DR2 Q;  3QJY A;  1A6X A;  3T51 B;  1M1K C;  5CGK A;  2GVB A;  3NBH A;  4L5Q A;  4OX9 Q;  2ZXP A;  4DR1 Q;  1G8Z D;  1EIG A;  3T56 B;  2B63 G;  1CT1 D;  1HA6 A;  1RJT A;  1SNQ A;  4A3C H;  1I6H B;  1SNC A;  3M3Y B;  4UHV A;  1HNX Q;  1HFG A;  1ET9 A;  1F2Z A;  2R93 B;  5HUR A;  3GTJ H;  5KNB A;  2EY5 A;  1M8A A;  3VA7 A;  1RKN A;  5JAV A;  1HNW Q;  2OTL A;  4ME3 A;  1QE6 A;  1M90 C;  4FVM A;  5E1F A;  2K5W A;  1EYG A;  1QVC A;  1PVO A;  2E5L Q;  5IYB G;  3CAM A;  1SYB A;  2BH8 A;  4FP5 D;  2XSC A;  4DKA C;  4B08 A;  2WAQ G;  3D4D A;  2DY7 A;  4NB3 A;  5CC4 A;  3JAM i;  2VS1 A;  4JC0 A;  1DOM A;  2RHQ B;  3M9B A;  1SYE A;  1AN8 A;  4BY1 G;  2IX0 A;  5EJW A;  2F0U A;  3KOJ A;  2AMC B;  1ASZ A;  1B3Q A;  3CME A;  4N8F A;  1HPC A;  1HTP A;  1Y8P B;  1IBK Q;  1LM0 A;  4KLK A;  5FLX L;  4KKU A;  1I3Q B;  2JA7 G;  3M4Q A;  1V1O A;  1S5D D;  2IX3 A;  1VQP A;  5EBC A;  1D7Q A;  2M00 A;  5C44 H;  3HZX A;  2E2D C;  3J81 j;  1SN8 A;  3TRE A;  2NVY H;  1PZJ D;  4OWW B;  4MHE A;  3K8A A;  1EYA A;  2MJ8 A;  2YU9 H;  5IGD A;  1A15 A;  2F0E A;  5J22 A;  1MGS A;  2VB2 X;  2JSO A;  4UP8 A;  3L9A X;  2DN8 A;  1SBB B;  3JAM E;  4ALP A;  2HQL A;  4Q0F A;  4DAV A;  1UE7 A;  3DEP A;  3TBI B;  1QUQ A;  1RCV D;  3ONA B;  2NTT A;  4FXG C;  1PRT D;  3MVV A;  1PH7 A;  3S16 H;  3U58 A;  3T1H Q;  1NNX A;  3TP7 A;  4JI0 Q;  2UUC L;  5KRU A;  2X69 A;  1WTR A;  3OTO L;  1KLG D;  1UEB A;  1KXL A;  3RZO H;  4B3M L;  2KHJ A;  2X6G A;  1YHA A;  2KQ3 A;  3BJU A;  2ID0 A;  1OXS C;  3D8G A;  1VQI A;  3BZD B;  3CC7 A;  1VMP A;  1RTO A;  1SND A;  1NMG A;  2WII B;  1L1O B;  5C3E B;  1LV9 A;  1S5C D;  2OT2 A;  4A3G B;  4TSS A;  4MTN A;  1Q3L A;  3URY A;  3F2C A;  4KY6 A;  2UU9 L;  4OL7 A;  4POG A;  2A73 B;  2K5D A;  2NZO A;  2WB1 E;  4L63 B;  1X6O A;  4YWL A;  1VQD A;  5FO7 B;  2NVQ H;  3A54 A;  4V0B A;  3VR3 A;  2NBF A;  4KTA A;  2F3W A;  2WKD A;  3NWT A;  4YIJ A;  3L3O C;  3AU7 A;  1F2M A;  3J81 L;  2VQF L;  4DR4 L;  4NW2 A;  5C4J H;  4KJN A;  4ZK9 B;  2N78 A;  3Q24 A;  1I94 L;  1VQ6 A;  1J6Q A;  3I7F A;  3H0G H;  3ITP A;  5EGT A;  5FJ8 H;  2PO4 A;  3S15 B;  3PIO A;  2JA5 H;  4IPG A;  3C3L A;  4PV1 C;  4A93 B;  1F9R A;  4IO9 A;  4WJ3 M;  2Y0S G;  4P73 A;  5C4X G;  1EQV A;  1CQV A;  3K0Y A;  1QVG A;  2EYH A;  3P20 A;  4OEL B;  3UDX A;  4JI1 L;  1JCK B;  3WOE A;  2NN6 I;  3HOY H;  1FNW A;  5CV8 A;  4LK1 C;  4CHT B;  3AEV A;  1VQ5 A;  3TP6 A;  2B39 A;  1IKL A;  3V05 A;  3CPW A;  1JT8 A;  3D0F A;  4DFA A;  1BVS A;  3MC0 B;  3I4N H;  1ZEQ X;  4L6T B;  1FGU A;  3NXW A;  4DR6 L;  2EOT A;  1B8A A;  2YYZ A;  2L5T A;  5ELN A;  3GTM B;  3TP8 A;  1X3E A;  4DNT B;  4ZKB B;  1C4Q A;  1VQG A;  5IP9 G;  3DM3 A;  2UXD Q;  1U5K A;  4QB4 A;  1WTH A;  3PUX A;  2UUC Q;  5IGF A;  2PYK A;  3D4R A;  1YEZ A;  4AYB G;  3OTO Q;  4YCU A;  1I50 B;  3A8I E;  4A3L G;  2MP1 A;  4B3M Q;  1AE2 A;  3MAQ A;  1I4G A;  2HCC A;  2I46 A;  2E2I H;  1VQ4 A;  2EJM A;  3UDI A;  2A19 A;  4HR7 B;  2KED A;  1VQK A;  1Q8I A;  1TS5 A;  3HOU B;  3HOX H;  5GQO A;  3FKI G;  4ZYS A;  2AQ2 B;  1VQB A;  2E8G A;  5FLM H;  3NHH A;  4HSP A;  4QCL A;  3HKZ G;  1EWH A;  5FO9 B;  3B6Y A;  1TT2 A;  2UU9 Q;  3JAM c;  1A3U A;  5M5Y B;  1V8Q A;  2G9H D;  1WYD A;  2O5J C;  1U4P A;  2Q2T A;  1PRT C;  1CZG A;  2Z1C A;  2JYO A;  4A3C G;  4LMQ D;  1OXX K;  1VQM A;  5D65 A;  3NEM A;  4DR4 Q;  2VQF Q;  3ER0 A;  4A4I A;  1GXD C;  2DGY A;  2H4O A;  1SR3 A;  1I94 Q;  2VL6 A;  1VQO A;  1WVL A;  2NVT H;  1D1K A;  4H0L C;  2L0C A;  4U67 3;  4K5V A;  1GO3 E;  4AYB B;  4JI3 L;  1JOR A;  3H3V H;  2RDH A;  3DHQ A;  2WFW A;  5IT9 E;  1FNV A;  2L11 A;  2JXM B;  4A3B H;  4O1N A;  1VQA A;  2J7Z A;  4DV4 L;  4DR7 L;  1H9R A;  1PFS A;  2CQO A;  3WDN A;  4JI1 Q;  3I4M B;  1FJG L;  1CM9 A;  1VS0 A;  3I55 A;  3CF5 A;  4XTC S;  1ML0 D;  3DEO A;  3NQT A;  1C0A A;  3BVG A;  2ZTE A;  4JG2 A;  5ELF A;  2KJX A;  3J7Z C;  4XT1 B;  3U9O A;  4PQX A;  4EQO A;  2HT1 A;  3BYY B;  3J7A F;  3KK7 A;  1EZ6 A;  4RHS A;  1EY0 A;  3MXN A;  3MXP A;  1L0W A;  4A3I H;  5C0X J;  2K75 A;  3P1H A;  3OPO A;  1R9T B;  2JJQ A;  4IPC A;  2RF4 A;  4DK6 C;  2F0Q A;  3GTJ B;  3CCV A;  3DM1 A;  3BDC A;  5IGC A;  1AE3 A;  3I2Z A;  5C44 G;  2VNU D;  5LHY 1;  4RCN A;  1D5M C;  4XXE A;  3CRK C;  4BBR B;  5I6W A;  4ULL A;  3QOJ A;  1EEI D;  2JA6 H;  4A3J H;  2C35 B;  2K01 A;  4R9W A;  3SK6 A;  2QDL A;  4RGM A;  3GTK B;  4MNO A;  1O7I A;  1JWM D;  2K6A A;  2N3S A;  1CHP D;  3VR5 A;  4AH6 A;  1EFW A;  1EY7 A;  1LYL A;  3HGB A;  5DM6 3;  3ERO A;  4A3F B;  1DM0 B;  4L8J A;  5C0X H;  4OIK A;  1ZYR C;  3U50 C;  4B3R L;  3RR5 A;  4DF7 A;  4HJA A;  3S9W A;  1K73 C;  2ZT9 C;  5CV6 A;  3DWA A;  4GKJ L;  1KQS A;  1PA6 A;  2IL8 A;  3BDO A;  4X3K A;  2E75 C;  4QL5 A;  3PIO 3;  3GO5 A;  2E2H H;  2OWO A;  4WOR A;  4K8J A;  3H3V C;  3KBG A;  1LT4 D;  4FF2 A;  1L0X B;  4C2M H;  4NMZ A;  4RWS C;  3DLL A;  4PNY A;  1PV4 A;  1K0R A;  3FPU B;  4LUZ A;  2XRS D;  5BN4 A;  1N32 L;  2YTV A;  2PMZ B;  3VDY A;  2R92 H;  2NTS A;  1DYQ A;  5I9O A;  1YNJ D;  2A6H D;  4JI3 Q;  3K81 C;  2KBN A;  3KLS X;  1UE1 A;  4FXK C;  3AB9 A;  3KF8 A;  1JB7 A;  1Y1V H;  2F3I A;  4C3I H;  4KJO A;  1NMF A;  4OO1 H;  1EL0 A;  1GD7 A;  3I56 A;  4DR7 Q;  4JBM A;  4OIJ A;  3KUP A;  2N88 A;  1FJG Q;  2PZU A;  1I4X A;  4JPB W;  3M85 A;  2L15 A;  3H0G G;  2B8G A;  5FJ8 G;  1H9S A;  3KJP A;  2YTY A;  1VDZ A;  2VUM B;  1QZG A;  4HID A;  2FFK B;  2ASB A;  2JA5 G;  1PRT F;  3E0E A;  2K05 A;  4RMF A;  2D2C C;  1TXY A;  1PTO D;  2ALY B;  4GNX B;  5M3F B;  2ATW A;  2HUG A;  5JEA H;  2KHI A;  1G91 A;  2UXC L;  3WWV A;  3J80 c;  3M4O H;  4CDE C;  4F8M A;  3HOY G;  4MIU A;  3T4A C;  4K2L A;  5AFW A;  3S1R H;  1C7Y A;  4KMU C;  1NJI C;  1RIP A;  2RSN A;  2A5H A;  1GUN A;  1E2W A;  4X3T A;  5CV7 A;  3C1F A;  4JYA L;  4X3S A;  1VMC A;  4FF4 A;  2PMZ E;  2KOL A;  2QCP X;  4IUN A;  2RCF A;  3PO2 H;  1WTX A;  1HNZ L;  3CCR A;  3I4N G;  4IFD G;  5M5X B;  3PO3 H;  1PXU A;  3HEJ A;  3BZC A;  4JBK A;  1B44 D;  1ENF A;  4HN7 A;  1B7Y B;  1QZH A;  3V2T A;  2NVX H;  3HRZ C;  3CCS A;  5EPL A;  1EY8 A;  1IW7 D;  4DNI A;  4JVZ A;  4P75 A;  3C1E A;  1TQO A;  2RSO A;  3E9H A;  1V9P A;  1X3Q A;  3H94 A;  1HXY D;  2X6L A;  1JE4 A;  5M3M B;  4GOP B;  3IRB A;  4RG1 A;  4LF6 L;  1DJR D;  1OXV A;  1A2T A;  5M9O A;  4GKJ Q;  1U4L A;  1QVF A;  2EYF A;  1B4O A;  5C3X A;  2L4N A;  5IIF A;  1PH3 A;  1BCP B;  3FRP B;  1CA5 A;  2IPK D;  1TWC H;  3OW7 A;  3TP5 A;  1BKB A;  1XJV A;  3E0J A;  2XWB B;  4IQZ A;  4XYO A;  2EYM A;  1K3B C;  4DV3 L;  1JJG A;  3HOX G;  3TN2 A;  5CBE E;  1YJN A;  1PTO H;  3AFQ A;  3S2H B;  3UDF A;  5FLM G;  4DAM A;  5CYU A;  1TWF H;  1LTG D;  3LGJ A;  1N32 Q;  3CXC A;  4WJ4 A;  1LLR D;  3AYH B;  3NP8 A;  4FF1 A;  1STG A;  1IZ6 A;  1U4R A;  4BBS H;  1XYI A;  2TSS A;  2R7Z H;  4IJL A;  5IYC H;  1LTB D;  5LL6 X;  1BR9 A;  2KCC A;  4JV5 L;  4CDD C;  4A3M B;  3GDE A;  2A6E D;  4KD4 A;  2CFM A;  4N9P A;  1HCZ A;  5FLX E;  4FNF A;  4IN3 A;  3K5M A;  4K0K L;  1TWG B;  2A74 C;  3KDF B;  4Z9C B;  1YNN D;  2B2Y A;  3MEH A;  3PIP A;  1LTR D;  1N34 Q;  3Q23 A;  4Y7N B;  1YHQ A;  3PQI A;  4PMC A;  1WTQ A;  2QDB A;  5D3D A;  2F0K A;  3BDL A;  3FHW A;  3HOV B;  2RQX A;  3I73 A;  2LMC B;  3SK8 A;  3SR1 A;  4IUQ A;  2Z9H A;  1SYD A;  2UXC Q;  2L55 A;  2SOB A;  1IYV A;  1YNJ C;  1N36 L;  1V1P A;  2A6H C;  3PV0 A;  3KF6 B;  2MO1 A;  5ELC A;  1WCM H;  3GTG H;  1J8I A;  4JYA Q;  5LMN W;  4PZ8 A;  3L7Z C;  1BDO A;  1TKW B;  2F0N A;  3S1N H;  3QOL A;  3J81 i;  3UE1 A;  1HNZ Q;  1V43 A;  3PUZ A;  1X3F A;  2MNA A;  4AQY L;  2A69 D;  4A3I G;  2ZM6 Q;  1YZ6 A;  4DPG A;  1QIL A;  2V1C C;  2UUA L;  3S1M B;  1L0Y B;  4HIM A;  1N8R C;  5C5M A;  3CKI B;  5JJL A;  1NBW A;  1BQQ T;  4X65 L;  1SFO B;  2E74 C;  1ONL A;  2EJG C;  5KGU A;  1WFQ A;  3HOZ B;  1U9R A;  1S5E D;  3CCL A;  2NVT B;  1SNO A;  4A3E H;  2JA6 G;  4A3J G;  1EOT A;  1ROD A;  1TS2 A;  4LF6 Q;  1JE5 A;  2SEB D;  1PTO C;  3H09 A;  1PYB A;  2EDG A;  1Q1E A;  1S40 A;  4C3H H;  4ODG A;  5JJI A;  1MHW C;  3NQI A;  1NR4 A;  4HJ5 A;  2B2Y C;  1F77 A;  3CP0 A;  2JA9 A;  3UI2 A;  1KDC A;  4K2K A;  1NTG A;  2F0G A;  3S1Q H;  4DV3 Q;  5BN5 A;  1KHI A;  2K5H A;  4P2C B;  3K6O A;  1CA6 A;  3ND9 A;  3CHB D;  2GN5 A;  3J81 E;  2KUM A;  4JI4 L;  4EGV A;  2B63 B;  1K83 H;  4B9X A;  1AW7 A;  1VQN A;  3IAY A;  4YHH L;  3KFU A;  5CR3 A;  4NDX A;  2H1E A;  3LWE A;  1IL8 A;  1K28 A;  1KLU D;  4KN4 C;  5JJZ A;  2LFN A;  1E2Z A;  3CC4 A;  2RHS B;  5TSS A;  1TWA B;  1DCZ A;  1SE8 A;  2N8N A;  4JV5 Q;  3BU2 A;  3G7L A;  3A8K E;  2K5Q A;  2YTX A;  4A3K H;  3H6M A;  4QUF A;  4YY3 L;  1E24 A;  1PH9 A;  3GTL B;  2A68 D;  4OHJ A;  4K0K Q;  3CPF A;  3OIQ A;  2FMC A;  4X62 L;  1DGS A;  3I91 A;  3I3C A;  1J5E L;  3F2B A;  1Y1W H;  2I5L X;  2D5D A;  1F9P A;  2L12 A;  2WAQ B;  1PH1 A;  4LUV A;  1X65 A;  1ENC A;  1CI3 M;  4A3D H;  1Y1V G;  4E6I A;  2UXD L;  3NPP A;  1KRS A;  4NP5 A;  4OO1 G;  3T16 A;  4BY1 B;  1ESF A;  2F1M A;  3GV3 A;  3HG9 A;  1D1I A;  2E2J H;  1N36 Q;  3F2U A;  1AH9 A;  4JBJ A;  5E7N A;  1PMR A;  1NCV A;  2MQH A;  1UNS A;  2QIL A;  4BA1 I;  3ULP A;  2OTJ A;  2JA7 B;  2B2W A;  3NTK A;  4DV6 L;  3A8J E;  2PZW A;  3MWY W;  1CKN A;  2AWN A;  1TY2 A;  4HIK A;  4AQY Q;  1JQY D;  1B9N A;  3S24 A;  1A0I A;  2I5M X;  2K14 A;  5JEA G;  2UUA Q;  5E3F A;  1EFI D;  4X65 Q;  2KHS A;  1OXU A;  2Q2U A;  1EEF D;  2NN6 H;  3C2P A;  3RLN A;  2EXD A;  3K5L A;  4L5T A;  1B1Z A;  3CCQ A;  3PO2 G;  1SRO A;  1Z47 A;  2HD3 A;  1NE3 A;  1XPU A;  3PO3 G;  5LL6 S;  4IUT A;  2AKW B;  4QUC A;  2MPM A;  3A7L A;  1DON A;  3FP9 A;  2VY3 A;  2RCN A;  1S3O A;  2UUB Q;  1VQ7 A;  4JK1 C;  1GUS A;  1PLF A;  2I5H A;  4PZ7 A;  4BXX H;  3GTQ B;  4UP7 A;  1UAP A;  2A69 C;  3I4L A;  4RA8 A;  4JI4 Q;  1VCI A;  1SYG A;  4YHH Q;  4LNQ A;  3STB D;  3SXH A;  1VQ8 A;  2SNS A;  1KNE A;  4OON A;  3HP3 A;  3MEF A;  3KBX A;  3A5Z B;  4JCV E;  4R4C A;  1FD7 D;  3M4O B;  2KCM A;  2R6G A;  2B2W C;  3SDZ A;  4YY3 Q;  4JI8 L;  3VR4 A;  1HR0 W;  1UE6 A;  2AWO A;  1Y69 U;  2F0J A;  4X62 Q;  1PTO F;  4XQQ A;  1J5E Q;  3S2D B;  4IZ8 A;  5LMN L;  4CKE A;  3S14 H;  3KLW A;  3RMH A;  4YWM A;  2B3G A;  4BBS G;  2R7Z G;  4BY7 H;  3H91 A;  3D6W A;  5IYC G;  3VR2 A;  1ICF B;  2A8V A;  1LT3 D;  3EIV A;  1T5E A;  2XIW A;  5EKI A;  3J81 c;  3M4Y A;  2OF1 A;  3PCO B;  3N6R A;  2K5N A;  4DK0 A;  1V1Q A;  4K6D A;  5I2X A;  2RBM A;  1GM5 A;  3AMU A;  3FPP A;  2Y0S B;  1B53 A;  4R4Q A;  4KHV A;  5C4X B;  2HQE A;  4L5R C;  1H9J A;  4DV6 Q;  2WP8 J;  3IKJ A;  5EBD A;  4CJ0 B;  3CQZ H;  2A68 C;  4FO2 A;  2FHT A;  3K7A B;  4KKS A;  5IGE A;  5H1S E;  4LFA L;  4DN4 M;  1C8C A;  2L1B A;  4NKL A;  3GTP B;  3FVQ A;  3NUC A;  1G6P A;  5JPM C;  2WIN B;  1EY6 A;  1EU4 A;  2KA7 A;  2XGT A;  1Y8N B;  3G48 A;  2BE5 D;  2F0V A;  3E5S A;  2F0O A;  3HOW H;  1K8A C;  4G7O C;  1WCM G;  4NXN L;  2C9O A;  3T13 A;  1BBW A;  4BBS B;  3AQQ A;  4H13 C;  1SAP A;  3NEL A;  3FDT A;  1PYW D;  3QG1 A;  3MFG A;  1Q7Y C;  4IFD I;  2K50 A;  2IT1 A;  4TKO B;  3PMF A;  5JPN C;  4JI2 L;  2OQK A;  4G57 A;  4LWC A;  2K32 A;  1SYC A;  3PF4 A;  2AUK A;  1I6H H;  3M3Y H;  1IKM A;  2R93 H;  3S17 B;  4A3E G;  3SGI A;  2EIF A;  2IWH A;  5A2Q L;  3NBH B;  3LX0 A;  2UXB L;  4C3H G;  1F2L A;  2EE1 A;  1XNR L;  2IY5 B;  4IJH A;  4R4O A;  4ZKC B;  5COY A;  2VW9 A;  2J0T D;  2PI2 E;  1LTS D;  3FKI B;  2AHO B;  1TR5 A;  3T53 B;  3KJO A;  2EZV A;  1W3S A;  2MUY A;  2EXZ A;  1A2U A;  3HKZ B;  3QB3 A;  4ABN A;  1E1T A;  1GJX A;  4GS3 A;  2K1B A;  2Z0S A;  4O42 A;  2F03 A;  4JI8 Q;  4J8Q A;  1DOL A;  1ILQ A;  5FKA C;  2B2T A;  2JK8 A;  3R2T A;  1YI2 A;  5LMN Q;  1X9N A;  2JA8 H;  5LMU L;  4O0A A;  1YJ9 A;  1CKM A;  4G7Z C;  2Q8T A;  3L0O A;  4BA2 I;  1I5F A;  1TY0 A;  5C4H A;  2ES2 A;  1LTA D;  3W2D A;  1X54 A;  1DXM A;  4A3K G;  4O2D A;  1QNU A;  1K3R A;  1K8G A;  4P71 A;  1I3Q H;  2QF7 A;  2F3V A;  1AEX A;  1D8L A;  1RD9 D;  2CQA A;  5COR A;  4AYB E;  5IWA L;  1A63 A;  2F0M A;  3PUV A;  1SLJ A;  1Y1W G;  4HCE A;  1Q90 A;  1OO9 B;  4G7H C;  1STH A;  4IAL A;  1ZKO A;  1EWC A;  2RDG A;  1W2B A;  1EQR A;  4A3D G;  1K8M A;  4L5S A;  1CSP A;  4ZUJ A;  2XTI A;  1LTL A;  4LFA Q;  4UAI A;  4JI5 L;  4Y52 H;  4HMI A;  3HKZ E;  1OXT A;  4OWT B;  2A1A A;  5EPK A;  1VQ9 A;  5M5W H;  3K57 A;  1SMY D;  2D0P A; 
#chains in the Genus database with same CATH homology
 1TWF H;  3LGJ A;  3TRZ A;  1N32 Q;  3CXC A;  4WJ4 A;  1K9M C;  3AYH B;  4GNX C;  2N49 A;  4OWW B;  1E3P A;  4NXN Q;  3BZK A;  1IZ6 A;  3K8A A;  3TEH B;  1TWG H;  4YCV A;  2YU9 H;  4LF7 Q;  1KD1 C;  4UP8 A;  4BBS H;  2MO0 A;  4X64 Q;  2R7Z H;  1RL2 A;  4IJL A;  5IYC H;  1H95 A;  4Y7N H;  4ALP A;  1PYS B;  2HQL A;  4QGU A;  4JV5 L;  3J80 i;  3RLF A;  5IYD G;  4OXP A;  3GDE A;  1QUQ B;  2EQS A;  1UE7 A;  2CFM A;  1QUQ A;  4JI2 Q;  1HZA A;  3A0J A;  4YCW A;  3G4S A;  1PH7 A;  3RNU A;  3S16 H;  4K0K L;  3HOV H;  4NPS A;  1HR0 L;  3U58 A;  1TWH H;  3T1H Q;  3KDF B;  4GKK Q;  3J7A 5;  4JI0 Q;  2NN6 G;  3KDF A;  4WJ3 M;  3PIP A;  2UUC L;  1N34 Q;  3UDF A;  5C3E H;  2NZH A;  2LSS A;  1N33 L;  3I4M G;  1YHQ A;  4HJ7 A;  3OTO L;  1SMX A;  4UP9 A;  2QA4 A;  1A8V A;  4LF4 L;  3GTO H;  2UXB Q;  4A3G H;  1UEB A;  1KXL A;  2LXJ A;  1XNR Q;  3RZO H;  4B3M L;  2KHJ A;  4GLX A;  1YHA A;  3BJU A;  3FHW A;  2ID0 A;  1OXS C;  4HJ8 A;  4GOP C;  1VQI A;  5IP7 H;  3CW2 C;  3CC7 A;  4JOI A;  2UXC Q;  3A74 A;  1NMG A;  1ASY A;  1KIX A;  1L1O B;  1N34 L;  1MKH A;  2Y0S E;  1G51 A;  1L1O A;  1N36 L;  5GAG C;  3S1M H;  3PV0 A;  3KF6 B;  2MO1 A;  5HGQ A;  3A5U A;  1XMO L;  3KF6 A;  2JEA I;  3TS0 A;  1EUJ A;  3PSI A;  4MTN A;  1SFO H;  4BXX G;  1WCM H;  1JJG A;  3F2C A;  3GTG H;  5AJ3 Q;  2UU9 L;  1VQJ A;  4JYA Q;  5LMN W;  1PH4 A;  4POG A;  2NZO A;  4BBR G;  2VQE L;  4PZ8 A;  1MIU A;  2WB1 E;  3L7Z C;  4QY7 A;  3HOZ H;  1X6O A;  2OQ0 A;  5LMU Q;  4YWL A;  4TVA B;  3S1N H;  1EIF A;  2MFI A;  2BA0 A;  3J81 i;  3UE1 A;  4PZ6 A;  1HNZ Q;  1V43 A;  1VQD A;  1WJJ A;  1Y14 B;  2VZA A;  3E9I A;  3PUZ A;  1X3F A;  3OYY A;  2MNA A;  4A76 A;  4AQY L;  4A3I G;  2NVQ H;  2ZM6 Q;  3S15 H;  1YZ6 A;  4DPG A;  2V1C C;  2UUA L;  4HIM A;  1N8R C;  5DLQ E;  3CCU A;  5JJL A;  1XPO A;  4A93 H;  1NBW A;  3ERS X;  4X65 L;  5GAH C;  2VQF L;  4DR4 L;  5C4J H;  4KHZ A;  2N78 A;  1WFQ A;  4QIW E;  5IT9 c;  1I94 L;  4A3F G;  3RZD H;  3CCL A;  4KHP L;  5IWA Q;  4DUY L;  2LXK A;  1VQ6 A;  4A3E H;  1Q1B A;  2ZTC A;  1J6Q A;  1KRT A;  4A3J G;  3EBE A;  3I7F A;  3H0G H;  2JA6 G;  1G29 1;  4DV5 L;  5FJ8 H;  1E7Z A;  1JE5 A;  4LF6 Q;  1YVC A;  2BH2 A;  2D0O A;  4DV0 Q;  1PYB A;  5J3B A;  2ZM6 L;  1Q1E A;  3PIO A;  1S40 A;  4C3H H;  2JA5 H;  4IPG A;  4GLA C;  4AIM A;  5JJI A;  4IO9 A;  5GAE C;  2Y0S G;  2QGQ A;  4P73 A;  2B63 H;  4BY7 G;  3I4O A;  3M4P A;  3K80 C;  5C4X G;  4HJ5 A;  1QVG A;  4R4T A;  3CP0 A;  2JA9 A;  1HZC A;  4J15 A;  3UDX A;  4JI7 Q;  4JI5 Q;  4OO1 I;  3TQY A;  1EOV A;  1NTG A;  4YWK A;  4JI1 L;  3STB C;  3S1Q H;  4DV3 Q;  4X6A H;  2NN6 I;  1KHI A;  2K5H A;  4LFC Q;  3HOY H;  1TWA H;  3AEV A;  4DR6 Q;  4DR3 L;  1X55 A;  1VQ5 A;  3CCJ A;  3GTM H;  2GN5 A;  4JI4 L;  3H3V I;  3W1G A;  1K83 H;  4APV A;  3CPW A;  1PH5 A;  4C3J H;  1JT8 A;  1VQN A;  4JOI C;  1HNX L;  1IBL L;  1PH6 A;  3GTL H;  4YHH L;  3KFU A;  3D0F A;  1FVI A;  3RN2 A;  5JJK A;  1BVS A;  5IYB H;  4HJ9 A;  1L1O C;  4DV1 L;  3I4N H;  3L2P A;  3CC4 A;  2RHS B;  1Q86 C;  1FGU A;  3G71 A;  1SE8 A;  1XNQ L;  2N8N A;  4H02 A;  4JV5 Q;  4DR6 L;  3BU2 A;  1JJ2 A;  2YTX A;  1B8A A;  2YYZ A;  5ELN A;  2IHF A;  4A3K H;  1E1O A;  2Z6K A;  1NY4 A;  4QJF A;  4POF A;  1HH2 P;  1X3E A;  4YY3 L;  1E24 A;  1VQG A;  5IP9 G;  1PH9 A;  3DM3 A;  1BBU A;  4K0K Q;  3PUY A;  2IHE A;  2UXD Q;  3CPF A;  1YJW A;  1GVP A;  1YNX A;  1Q12 A;  1U5K A;  2HIX A;  4X62 L;  1DGS A;  1HR0 Q;  4BY1 H;  3HOW G;  4DUZ L;  1YBY A;  1J5E L;  4DAY B;  1HJP A;  3PUX A;  3HOU H;  2UUC Q;  3F2B A;  2D62 A;  1Y1W H;  3G6E A;  1Q8K A;  2I5L X;  4B3T L;  1YEZ A;  1N33 Q;  4AYB G;  3OTO Q;  3ULL A;  4LF4 Q;  4YCU A;  4P74 A;  1PH1 A;  2R7F A;  4LUV A;  5GRO A;  4B3M Q;  1AE2 A;  4A3L G;  1X65 A;  2E2I H;  1FL0 A;  1EQQ A;  5IY0 A;  1VQ4 A;  4A3D H;  2VUM G;  1CKO A;  1Y1V G;  1T9H A;  3UDI A;  5M5Y H;  1EIY B;  2JA7 H;  4DK3 C;  2UXD L;  1KRS A;  2A19 A;  4OO1 G;  3PF5 A;  1VQK A;  3HOX H;  3D31 A;  5HY6 A;  5GQO A;  2E2J H;  5M3F G;  4P72 A;  3FKI G;  2PNH A;  1N36 Q;  1VQB A;  2E8G A;  1AH9 A;  3PUW A;  4JBJ A;  5FLM H;  2KEN A;  2R93 G;  5E7N A;  3HKZ G;  2MQH A;  1XMO Q;  1HZB A;  4BA1 I;  4IPH A;  3B6Y A;  3ULP A;  2UU9 Q;  3JAM c;  4A3B G;  2OTJ A;  3F8T A;  2VQE Q;  4PMW A;  3T1Y L;  1CKN B;  4DV6 L;  1WYD A;  3TS2 A;  1CKN A;  2AWN A;  2PQA A;  2Q2T A;  1GKH A;  5C0X I;  4HIK A;  1JMC A;  4B3S L;  4AQY Q;  4X66 L;  5GAD C;  4A3C G;  2KCT A;  5ELO A;  1OXX K;  1A0I A;  2I5M X;  3S24 A;  1VQM A;  2K14 A;  5JEA G;  2UUA Q;  5IYD H;  5JEA J;  2JEB I;  3NEM A;  2OCE A;  4X65 Q;  3EN2 A;  2VQF Q;  3CC2 A;  4DR4 Q;  4DV2 L;  4JI6 L;  3ER0 A;  1OXU A;  4A4I A;  4EQ5 A;  1XPR A;  2DGY A;  1KAW A;  1SR3 A;  1I94 Q;  2VL6 A;  4KHP Q;  4DV4 Q;  1VQO A;  4DUY Q;  2Q2U A;  2NVT H;  3ULJ A;  4UPA A;  3RLN A;  4DV5 Q;  1X56 A;  2EXD A;  4PG3 A;  3Q8D A;  3I4M H;  1GO3 E;  2JQO A;  1Q81 C;  4LFB L;  4L5T A;  5M3M G;  4JI3 L;  2JA8 G;  2Z6K C;  4LF8 L;  3CCQ A;  3PO2 G;  4LUO A;  1SRO A;  3H3V H;  1Z47 A;  2CCZ A;  2WFW A;  1NE3 A;  1XMQ L;  3GTQ H;  1XPU A;  3PO3 G;  4A3B H;  1PHJ A;  2CWA A;  2AKW B;  2HHH L;  1X3G A;  1VQA A;  4NXM L;  3CCE A;  2R7D A;  1N9W A;  4DV4 L;  4DR7 L;  1PFS A;  2CQO A;  3FP9 A;  3PGZ A;  4KI0 A;  2CKZ B;  4JI1 Q;  1MJE A;  2VY3 A;  2H5X A;  2RCN A;  5K36 G;  1FJG L;  1S3O A;  1VQH A;  1R9T H;  1VS0 A;  3I55 A;  3CF5 A;  4XTC S;  1VQ7 A;  2UUB Q;  1C0A A;  4JG2 A;  2ZTE A;  4DR2 L;  1C9O A;  4DR3 Q;  2I5H A;  4PZ7 A;  4BXX H;  3J7Z C;  4UP7 A;  1YIT A;  2JE6 I;  4JI4 Q;  1VCI A;  2HT1 A;  4BBR H;  2CWP A;  1Q82 C;  4OX9 L;  1IBL Q;  4YHH Q;  1P16 A;  4DR1 L;  4LNQ A;  3MXN B;  5BR8 L;  3STB D;  1UWV A;  1EWI A;  5C0X G;  1VQ8 A;  1L0W A;  4DV1 Q;  4A3I H;  5C0X J;  3S2D H;  2K75 A;  1VQL A;  2WB1 G;  1JJC B;  1WOC A;  4OON A;  3GTK H;  2JJQ A;  1KL9 A;  2RF4 A;  4IPC A;  4DK6 C;  3MEF A;  2QEX A;  2ZJR A;  3CCV A;  4JCV E;  3A5Z B;  4R4C A;  1XNQ Q;  2KCM A;  1KC8 C;  2DUD A;  1AE3 A;  2R6G A;  3I2Z A;  5C44 G;  2VNU D;  3RLO A;  1B70 B;  2Q2H A;  4YY3 Q;  4JI8 L;  4A3F H;  1HR0 W;  4A3M G;  1UE6 A;  1HNW L;  2FXQ A;  2AWO A;  2JA6 H;  4A3J H;  4X62 Q;  2C35 B;  4LF9 L;  4B3R Q;  4DUZ Q;  1J5E Q;  5LMN L;  3S14 H;  4B3T Q;  3KLW A;  4MNO A;  4YWM A;  2B3G A;  4BBS G;  1L2F A;  1O7I A;  1CSQ A;  2N3S A;  3K0X A;  2E5L L;  2I0Q A;  1PH2 A;  2R7Z G;  5C4X H;  1I50 H;  5IYC G;  4BY7 H;  4AH6 A;  4DV7 L;  2F52 A;  1EFW A;  1LYL A;  4DR5 L;  4TQU S;  4GN4 B;  4OWX B;  2A8V A;  3EIV A;  1HZ9 A;  2YV5 A;  3U50 C;  3KYH C;  3J81 c;  4B3R L;  3RR5 A;  3PCO B;  1YHB A;  2K5N A;  4HJA A;  1LUZ A;  1P8L A;  3K7A H;  3UDG A;  1YIJ A;  1K73 C;  1V1Q A;  2R92 G;  3HOV G;  1IYJ B;  3NEN A;  1GM5 A;  3GTP H;  4R4Q A;  4GKJ L;  5C3E G;  1PA6 A;  1KQS A;  1S72 A;  1XTD A;  4L5R C;  4MZ9 A;  4A3G G;  4A75 A;  4QL5 A;  3CMA A;  4DV6 Q;  4FDB A;  3T1Y Q;  2WP8 J;  1IBK L;  3GO5 A;  2E2H H;  2OWO A;  3K7U C;  3F2D A;  3CQZ H;  4B3S Q;  3RN5 A;  4X66 Q;  5IP7 G;  2BA1 A;  5H1S E;  2PI2 A;  4LFA L;  5IE8 A;  4JBW A;  4C2M H;  1PH8 A;  1G6P A;  1IBM L;  4LF5 L;  3DLL A;  4DV2 Q;  4JI6 Q;  2XGT A;  5IP9 H;  3W5O A;  1K0R A;  1MJC A;  3G48 A;  3HFZ B;  3JC6 6;  1PV4 A;  3F1Z A;  4LUZ A;  1N32 L;  3HOW H;  2YTV A;  1CUK A;  2PQA B;  1K8A C;  1WCM G;  4NXN L;  4GN3 B;  3VDY A;  4LF7 L;  2R92 H;  3HOZ G;  1BBW A;  4LFB Q;  5FLX c;  1WI5 A;  2HIV A;  3AQQ A;  2UUB L;  4X64 L;  3K81 C;  2KBN A;  4JI3 Q;  3S17 H;  3NEL A;  4LF8 Q;  1UE1 A;  4A3L H;  1A62 A;  3KF8 B;  1XMQ Q;  2Q2I A;  1Q7Y C;  1U0L A;  4IFD I;  2K50 A;  2IT1 A;  2ZTD A;  2VUM H;  2HHH Q;  1JB7 A;  1Y1V H;  4NXM Q;  2F3I A;  4QQB X;  4C3I H;  1NMF A;  1GD7 A;  4JI2 L;  2OQK A;  3ZJY C;  3I56 A;  1SRU A;  4LWC A;  4IPD A;  4UY8 C;  4DR7 Q;  3PF4 A;  4JBM A;  1Z9F A;  4IOC A;  3U4V A;  3U4Z A;  3OW2 A;  4GN5 A;  3CCM A;  1I6H H;  3AFP A;  5M3F H;  1FJG Q;  3FKI H;  3M3Y H;  2IX1 A;  3T1H L;  5EAY A;  4GKK L;  2B29 A;  4JI0 L;  4A3E G;  4DR2 Q;  2R93 H;  3SGI A;  3M85 A;  2EIF A;  2L15 A;  3H0G G;  4XIG S;  1E22 A;  1M1K C;  2WAQ E;  5FJ8 G;  2GVA A;  3KJP A;  3NBH B;  2YTY A;  2GVB A;  4EX5 A;  4L5Q A;  4LW1 A;  1QZG A;  4HID A;  2UXB L;  2ASB A;  2JA5 G;  4OX9 Q;  2IY5 B;  1XNR L;  4IJH A;  3E0E A;  4DR1 Q;  4R4O A;  5BR8 Q;  2ZJP A;  5FLM G;  2B63 G;  4RMF A;  1TXY A;  2VW9 A;  4A3C H;  2ALY B;  4GNX B;  2PI2 E;  2ATW A;  2AHO B;  4GNX A;  1HNX Q;  1VQC A;  3KJO A;  2KHI A;  3GTJ H;  1W3S A;  3WWV A;  3J80 c;  1OTC A;  2UXC L;  5M5X H;  3M4O H;  1E1T A;  2ZJQ A;  3HOY G;  4GS3 A;  2Z0S A;  2K4K A;  3H15 A;  3S1R H;  4JI8 Q;  1C7Y A;  1NJI C;  1RIP A;  1HNW Q;  2OTL A;  4ME3 A;  4GLV B;  1M90 C;  5AJ3 L;  4LF9 Q;  4JYA L;  2JK8 A;  4HIO A;  2K5V A;  1YI2 A;  2PMZ E;  5LMN Q;  5M3M H;  1X9N A;  5LMU L;  2JA8 H;  4O0A A;  1YJ9 A;  1EYG A;  1CKM A;  3ICE A;  1QVC A;  3L0O A;  3PO2 H;  2F4V L;  1PVO A;  1HNZ L;  3CCR A;  2E5L Q;  5IYB G;  4BA2 I;  1I5F A;  3I4N G;  3CAM A;  3PO3 H;  4IFD G;  3BZC A;  4IFD J;  4JBK A;  4DV7 Q;  2BH8 A;  1B7Y B;  1QZH A;  2ES2 A;  4DR5 Q;  2NVX H;  1X54 A;  3CCS A;  4DKA C;  2WAQ G;  4R1J A;  3HKS A;  4A3K G;  1IXR A;  4DNI A;  4NB3 A;  4O2D A;  4A93 G;  4P75 A;  1K3R A;  3JAM i;  2VS1 A;  2K52 A;  4JC0 A;  3E9H A;  1V9P A;  2RHQ B;  3M9B A;  4P71 A;  1I3Q H;  3W1B A;  1K8G A;  5IWA L;  1D8L A;  4AYB E;  4GOP B;  1A63 A;  3CD6 A;  3IRB A;  4RG1 A;  4BY1 G;  4GOP A;  3PUV A;  2IX0 A;  4LF6 L;  1SLJ A;  1VQE A;  1OXV A;  3HOU G;  3KOJ A;  4DV0 L;  1Y1W G;  2AMC B;  1ASZ A;  4GKJ Q;  3M7N A;  3S2H H;  3CME A;  1IL2 A;  1QVF A;  2F4V Q;  1UE5 A;  1IBK Q;  1PH3 A;  1LM0 A;  4KLK A;  1W2B A;  1EQR A;  4A3D G;  1TWC H;  4L5S A;  1CSP A;  1VQF A;  2XTI A;  1BKB A;  3M4Q A;  3UE0 A;  1XJV A;  2JA7 G;  1LTL A;  4JI7 L;  4LFA Q;  4JI5 L;  1VQP A;  4Y52 H;  1D7Q A;  3HKZ E;  1OXT A;  4OWT B;  5C44 H;  4DV3 L;  4R4I A;  4LFC L;  3HOX G;  1IBM Q;  4LF5 Q;  1YJN A;  4IOA A;  2A1A A;  3AFQ A;  1VQ9 A;  5M5W H;  3J81 j;  1SN8 A;  3TRE A;  4A3M H;  2D0P A;  3GD7 A;  2NVY H;  4DAM A;  1Q46 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...