2CWPA

Crystal structure of metrs related protein from pyrococcus horikoshii
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
109
structure length
109
Chain Sequence
b'MELYDVDEFWKFQMKVGLVKKAEKIKRTKKLIKLIVDFGNEERTIVTGIADQIPPEELEGKKFIFVVNLKPKKFSGVESQGMLILAETEDGKVYLIPVPEEVPVGARVW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MetRS related protein
publication title Crystal structure of MetRS related protein from Pyrococcus horikoshii
rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
total genus 22
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2005-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01588 tRNA_bind Putative tRNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2cwpA00
4A3GH 1VQBA 4O2DA 1WI5A 1IBLL 1XMQL 4WJ3M 2F4VL 3W1BA 4HIKA 1QVFA 2JJQA 1OXSC 5DLQE 1NMFA 2JQOA 3ZJYC 4LFCQ 4DV1Q 1Z9FA 3OW2A 1YI2A 4R4CA 1E3PA 3MXNB 4DAYB 3S15H 1X3GA 3GTJH 2WAQG 1IBML 1H95A 2UUAQ 5FJ8H 3K81C 1VQFA 1K8AC 5LMNW 3D31A 4HIOA 4LFAQ 3TS0A 4YCUA 1JE5A 1T9HA 3STBD 1N33Q 1CKNA 4IFDJ 1AH9A 2V1CC 2PI2A 5GAEC 4K0KL 2VUMH 4A3LH 1WFQA 5JJLA 3KOJA 4B3SL 2R92H 1B8AA 2CCZA 4A93G 1SN8A 5C3EH 2HHHL 3PCOB 4WJ4A 3BZKA 3GDEA 3BJUA 4XTCS 1S40A 3HOVG 3HOXH 3CF5A 4A3MG 1IBLQ 4A3DG 3K7AH 2F4VQ 1PVOA 1N36L 2NVTH 2JE6I 2VY3A 3NENA 2NN6I 3M4QA 4GN3B 2EQSA 1E7ZA 3CQZH 2UUBL 2NVQH 2VQFQ 4A3EH 1LYLA 4A3FG 1VQ7A 2B3GA 4BY1H 1IBKL 3CXCA 4HJ9A 2I5MX 3A0JA 3CMAA 1C0AA 3EBEA 1VQ6A 4L5RC 2JK8A 2MQHA 1K0RA 4PMWA 1JMCA 1KXLA 3S1QH 1IYJB 1Y1VG 3RR5A 2AWNA 1VQMA 2JA6H 3JC66 1VQPA 4AQYQ 4X64L 2Q2TA 3F8TA 2EIFA 4ALPA 2MO0A 1U5KA 4GLXA 1VQ5A 5C4JH 4OO1G 4HIMA 3Q8DA 3I4NH 1YZ6A 4BY7G 3M9BA 2K52A 5IE8A 4C2MH 4DV4Q 1X3FA 1PH4A 1I3QH 3AQQA 1TWFH 1UE7A 2JEBI 3H15A 4QGUA 3UDIA 2UUBQ 5M3FG 4LFBL 1YJ9A 4P73A 4JG2A 3CC7A 2LXKA 2VL6A 5J3BA 1CKNB 1VQKA 2ZJPA 1AE2A 1S72A 2KCMA 1NE3A 2UU9L 3TS2A 2E2HH 4OO1I 5JJIA 4GN5A 4NB3A 5IYDG 2Q2HA 3I55A 4B3ML 1XTDA 4NXML 3GTGH 4LF7Q 4JI8Q 4HJAA 1I50H 3SGIA 3J7A5 2GVBA 1HNZL 2JA5H 4X64Q 2Q2UA 3S17H 4BXXG 4GOPA 4A3KG 2UUCL 5M3MG 4LNQA 2BA0A 1D8LA 4DV3L 1GKHA 1PH3A 4DUZL 3CC4A 1YHAA 4GNXA 2VZAA 4DPGA 4LF9Q 2OWOA 4DR5L 4JI5Q 4JOIC 1KAWA 3KLWA 4KI0A 3M7NA 4OX9Q 2R6GA 1XJVA 2VQEL 1A8VA 3IRBA 3K0XA 3NEMA 2UXBQ 3CPWA 1N9WA 4GLAC 3AYHB 1GVPA 1U0LA 4LUVA 1SRUA 1B70B 1LUZA 5FLXc 3M4PA 5IYCG 1OXTA 4GN4B 4TVAB 1Q81C 3FKIG 4P74A 2N49A 4PG3A 4DR6Q 1G291 1HR0L 1I94Q 4A93H 2VS1A 4DKAC 1HNZQ 4X65L 3RLNA 3CCVA 1PH7A 3HOVH 2DGYA 2LXJA 3TEHB 4A3MH 1XPRA 1VQ9A 3M4OH 4A3DH 1VQGA 3EN2A 1YEZA 4DAMA 4B3TL 2B29A 1WYDA 4IJLA 1J6QA 2H5XA 4DUZQ 1VQOA 4DUYQ 3HOWG 4A3FH 3I4MG 2WP8J 4LFCL 4LW1A 2CWAA 1VQCA 3PV0A 4QJFA 4DV1L 1PFSA 3CC2A 5JJKA 1EOVA 1L0WA 3I2ZA 4A3CG 1EFWA 1Q12A 2GVAA 4IO9A 2AHOB 5IP7G 1E1TA 4AH6A 1BBWA 3KJOA 2UUAL 2BA1A 4JI0Q 1M1KC 4LFAL 1Y1VH 2IHEA 2JA8G 5IWAQ 1S3OA 1XNQQ 1N33L 1HZ9A 4UY8C 1QZGA 2EXDA 1N32Q 4UP8A 3UE1A 2D0OA 2MNAA 3CCUA 4GNXB 3KF6A 4YWKA 5C0XJ 5M5WH 4A76A 3GTMH 2OCEA 3M3YH 4KHZA 2E5LQ 4BY7H 1EIYB 4B3TQ 1RIPA 2YU9H 2WB1E 4BBRG 3MEFA 5M3FH 2HIVA 5C4XG 2VQFL 4AIMA 5JEAJ 3HOUG 1Z47A 4L5QA 3L2PA 1KRSA 3PO3G 5IYDH 2KENA 4LF5Q 2ATWA 3I56A 3ER0A 1A63A 5M5YH 1V43A 2CQOA 4RG1A 5GROA 2R7FA 2NN6G 2XTIA 4DR2Q 3DM3A 4QL5A 4BXXH 1Y14B 3D0FA 4HJ7A 2ASBA 3F1ZA 4DV6Q 1KHIA 1GD7A 4A3KH 2NVXH 5M3MH 4JI7L 4AQYL 4PZ6A 4JBKA 1KL9A 2PQAB 1SMXA 4QQBX 4JBMA 2I0QA 1UWVA 3KDFA 3ULJA 3W1GA 3JAMc 1HR0W 1TWGH 3CCEA 1V1QA 3GD7A 2K5VA 4DV4L 1K8GA 1HZCA 1B7YB 1VQDA 1Q46A 2PMZE 4R1JA 2HQLA 3PIOA 1DGSA 4QIWE 5GAHC 3A5ZB 2Y0SG 3F2CA 4YY3L 3J81c 5IYCH 1W3SA 1J5EQ 4A4IA 3FKIH 1X65A 3UDGA 4MZ9A 3CCMA 4JBJA 3STBC 1PHJA 4A3BG 4IOCA 1Q7YC 3ICEA 1E22A 4GKJQ 1WOCA 1VCIA 1Q1BA 1X9NA 4LF7L 4JI8L 1V9PA 4C3HH 4JI3Q 4JI7Q 3W5OA 3FP9A 4ME3A 1HH2P 2BH8A 1CKOA 4DV0Q 1P16A 2BH2A 2WB1G 5E7NA 1PH1A 4DK6C 3HOWH 3I4OA 1SROA 3I4MH 3AEVA 2IHFA 2GN5A 2FXQA 1JB7A 1XMOQ 1EQQA 4LF8Q 1VQ8A 4DR4Q 1G6PA 4KLKA 3S24A 4LF9L 2IT1A 2YTVA 3H0GG 4L5TA 4JI5L 4DV7Q 4KHPQ 3PUWA 4OX9L 5IP7H 3TRZA 4YY3Q 2CFMA 4UP9A 4JC0A 4OXPA 5GADC 3RN2A 2ZTEA 4MNOA 4R4IA 4YCVA 1YJWA 1YHQA 4JV5Q 1C7YA 2JA8H 1QUQA 1QZHA 1PYBA 1TWAH 4JCVE 4AYBE 2ZTCA 3S2HH 2E2JH 3S14H 4DR6L 3M85A 3RLFA 3RLOA 2AWOA 1TXYA 3ULPA 3CW2C 4A3CH 1I94L 3KDFB 2HT1A 1BBUA 2JA5G 4R4OA 2YTXA 2YYZA 3J81j 3K8AA 1A62A 4JYAQ 4BBRH 4DR1Q 1LTLA 3KYHC 1AE3A 4QY7A 4OWTB 5C4XH 4DR3Q 3NELA 3HKSA 4DUYL 4UPAA 4JI6Q 2Z6KA 3HOUH 1K83H 3PO3H 3L7ZC 5IT9c 1NBWA 4BA2I 1M90C 2CWPA 2K50A 2C35B 2VNUD 4DR7Q 1EIFA 1X6OA 4LF6Q 3S2DH 3AFQA 4JI0L 2K14A 1VQ4A 1O7IA 2N3SA 5IWAL 5IYBG 3UE0A 3CP0A 1HZAA 2RHQB 1XNQL 4A3JG 3CCQA 4PZ8A 4P72A 1HNXQ 2ZM6Q 3RZDH 1N32L 3J7ZC 2DUDA 4X66Q 1PYSB 3TQYA 3A74A 2E5LL 5HGQA 4GOPC 2MO1A 3ERSX 3HFZB 2I5HA 4NXNQ 1SE8A 1EYGA 1NY4A 3A5UA 1NTGA 5C0XI 1XNRQ 2OQKA 3J80c 4GNXC 4DV2Q 2WAQE 4A75A 4X62Q 4GS3A 4A3BH 4IFDG 1PH9A 4AYBG 1Q86C 1P8LA 5GQOA 5LMUL 3S16H 4LF5L 2F3IA 3U50C 3K80C 4R4QA 1UEBA 1SR3A 3EIVA 4JI4L 5K36G 4GOPB 4DR2L 2R93G 1FGUA 1YBYA 2K5HA 2B63G 3HKZE 5IP9G 4JI1L 4DV6L 4HJ8A 1VQHA 1WCMG 4JBWA 1KQSA 2I5LX 1N8RC 2A1AA 4IPGA 3T1YL 1CUKA 2PI2E 4JI2Q 1VQAA 5LMNQ 4IFDI 3U4VA 2YV5A 3PO2G 3OYYA 1G51A 3H0GH 3CD6A 1NMGA 2HIXA 1XPOA 4DV5Q 2NVYH 3S1NH 1FL0A 2K75A 3PF5A 2R7ZG 4IJHA 4IPCA 4C3JH 5AJ3Q 1J5EL 4BBSG 1KD1C 1JJ2A 5LMUQ 1HNWL 1MJEA 1OXUA 3H3VI 1VS0A 2KCTA 3CCSA 4HJ5A 4B3RL 2YTYA 4JI4Q 3AFPA 1QVGA 4GKJL 3F2DA 4P75A 3GTLH 1GO3E 4JI1Q 4XIGS 1HJPA 4JI3L 1BKBA 3E0EA 3T1HQ 1OXXK 3JAMi 4Y7NH 3GTKH 4DV0L 3GTQH 3G71A 3T1YQ 1A0IA 2NZOA 3RNUA 2UXCQ 1D7QA 3FHWA 3S1RH 1K9MC 3F2BA 2RHSB 1XMOL 4LF8L 5FLMG 3J81i 2ZJQA 1N34Q 4DR4L 4KHPL 4DV7L 3OTOQ 1XPUA 3CPFA 3E9IA 1VQJA 1MJCA 2D0PA 4JV5L 4GKKL 4H02A 1HNWQ 1JJCB 4OONA 1IZ6A 5IYBH 1VQLA 4B3RQ 1YVCA 4A3JH 5BR8Q 3KF6B 2ES2A 1IL2A 3E9HA 1CKMA 3HKZG 4YCWA 2Q2IA 3WWVA 2F52A 4DK3C 2JA9A 1E1OA 3B6YA 2PNHA 1BVSA 1XMQQ 1NJIC 4JYAL 4DR1L 2N8NA 3K7UC 3PGZA 2NZHA 1SLJA 1E24A 4GLVB 2E8GA 2JA7G 4DR3L 1L1OA 4LWCA 5EAYA 3PF4A 3HOZG 5ELNA 1HZBA 4A3IG 1IBMQ 4JI6L 3HOYG 4Y52H 4YHHL 1LM0A 1YJNA 2OTJA 3I7FA 4LUZA 2ID0A 1PH2A 4GKKQ 3BU2A 4L5SA 2UXDL 4DR7L 2E2IH 4EX5A 1L2FA 4LF6L 2R93H 1YITA 2K4KA 2B63H 3KFUA 5IP9H 4K0KQ 1OXVA 4OWXB 3RN5A 4B3SQ 1WCMH 4C3IH 4RMFA 2HHHQ 1X54A 1JT8A 3H3VH 5C44G 4IPDA 1Y1WG 1CSQA 1HNXL 3GTPH 4X6AH 2ZM6L 3G48A 2K5NA 2Z0SA 4X66L 1X3EA 4HIDA 3PUXA 4JOIA 3PO2H 4LF4L 2KHJA 3G6EA 2UXBL 1N36Q 1Q82C 1I6HH 4A3GG 2WFWA 4LUOA 1VQNA 4NXNL 3GO5A 3UDFA 1PH5A 2ALYB 1MKHA 3CCLA 1YHBA 3PUVA 4FDBA 1XNRL 1GM5A 2R7ZH 2QGQA 4YHHQ 2N78A 4BA1I 1L1OC 1IBKQ 1FJGL 4BBSH 1X55A 3VDYA 5IY0A 1KRTA 4DV2L 4X62L 1KIXA 1Q1EA 4IPHA 2UXDQ 2QA4A 4P71A 5FJ8G 4POFA 4EQ5A 5H1SE 3L0OA 5C0XG 1WJJA 5GAGC 1CSPA 2IX0A 3CCRA 2VW9A 5HY6A 3U4ZA 3S1MH 3CAMA 4O0AA 2VUMG 3RZOH 3PIPA 3CCJA 2R92G 4A3LG 2MFIA 2A19A 1EQRA 1L1OB 2AMCB 3UDXA 5C3EG 2JEAI 4IOAA 4LF4Q 1PH6A 1YNXA 3HOXG 2ZJRA 2IX1A 1EUJA 2QEXA 4JI2L 5FLMH 1I5FA 5LMNL 4POGA 3U58A 2KHIA 3J80i 4YWLA 5JEAG 4OWWB 4LFBQ 2KBNA 1TWCH 1QUQB 4PZ7A 4DV5L 1VQIA 1PV4A 1FJGQ 2OTLA 4A3EG 2UU9Q 1EWIA 2Z6KC 3PUZA 2OQ0A 1OTCA 2D62A 4BY1G 4DNIA 5AJ3L 1FVIA 3KF8B 4B3MQ 4NXMQ 4UP7A 1X56A 2R7DA 3G4SA 1UE6A 1PA6A 1PH8A 5ELOA 3DLLA 3KJPA 2JA6G 2UUCQ 1IXRA 4TQUS 3NBHB 2RF4A 4DV3Q 3T1HL 1SFOH 4R4TA 2RCNA 2JA7H 2AKWB 2CKZB 3GTOH 3I4NG 2UXCL 4DR5Q 2PQAA 2LSSA 4J15A 4A3IH 1KC8C 1Q8KA 3ULLA 1K73C 3HOZH 3HOYH 1C9OA 3PUYA 2VQEQ 1VQEA 1K3RA 1ASYA 2A8VA 4NPSA 1N34L 1ASZA 2Y0SE 4YWMA 1QVCA 4MTNA 3OTOL 1JJGA 1TWHH 3LGJA 1R9TH 1RL2A 1YIJA 1HR0Q 4APVA 3BZCA 2ZTDA 3PSIA 2L15A 3TREA 4X65Q 5BR8L 3CMEA 5C44H 1Y1WH 1UE1A 1W2BA 2IY5B 1MIUA 1UE5A 5M5XH 2XGTA
chains in the Genus database with same CATH superfamily
2KJXA 4WJ3M 2F4VL 1DD2A 5JVG3 2E2IB 1YI2A 2FINB 1RKNA 3Q6SA 2WAQG 5IGDA 2IJ0A 1DONA 5FJ8H 4IUQA 1EY9A 1T9HA 1YNJC 3D6WA 3C46A 1N33Q 4IFDJ 1I6HB 2PI2A 4A3LH 1XX8A 3DWPA 1MI2A 1PZID 2HHHL 1LTBD 4ME5A 4I7AA 3EVQA 3HOUB 4A3MG 4A3DG 1F2ZA 1WTOA 1BXTA 1F9SA 5JEAH 2E76C 1PVOA 1F77A 3T56B 2NN6I 1M8AA 2EQSA 1E7ZA 2UUBL 1LYLA 2K05A 3CXCA 2JXMB 2XVSA 4CJ1B 2I5MX 1C0AA 2MQHA 4PMWA 2BE5D 5IGCA 1SJED 1Y1VG 3I90A 2JA6H 1VQPA 2Q2TA 3F8TA 4GLXA 1U5KA 1U4MA 2WKCA 1HHVA 4RH6A 1BUVT 3I4NH 3WOEA 2XWBB 3M9BA 4C2MH 4DV4Q 3QR8A 1B3AA 4A3BB 1TWFH 5EKLA 2Z9HA 3UDIA 5M3FG 4P73A 4JG2A 2F0FA 5J3BA 1CKNB 1VQKA 2ZJPA 2EXZA 1EY7A 2KCMA 4M8AA 1HQRD 2Q2HA 2EYJA 1JWSD 3GTGH 1KDAA 3I73A 4JI8Q 5DEHA 2GVBA 2PW5A 1HNZL 4X64Q 2Q2UA 3J7A5 3S17H 1JORA 5C4HA 1PLFA 1PTOB 3O13A 1EFID 2UUCL 2PPBC 4B08A 1D8LA 1ET9A 1GKHA 5EPLA 4DUZL 1PH3A 4GNXA 4DPGA 1HA6A 2K03A 2R6GA 2VB3X 3IRBA 1KLGD 1NSNS 2A6HC 1B70B 5LL6S 4GN4B 5M5XB 4MTKA 3R2IA 5L37A 2VS1A 4G7OC 3RLNA 3NHHA 2DGYA 3TEHB 1XPRA 3M4OH 4X3KA 4C3HG 1KDCA 3LX0A 1NR2A 4DUYQ 4C56C 4DV1L 2CWAA 3PV0A 1MGSA 1PFSA 5CC4A 1EOVA 3I2ZA 4F7XA 2NB0A 5CV5A 5T1GA 1LABA 1BBWA 5D3DA 4KMUC 4M1UB 5I2XA 2F0MA 3HGBA 2JA8G 1BNZA 4ZAIA 1S3OA 5I9PA 1RHPA 1QB5D 2Z8LA 1HZ9A 1DJRD 2EXDA 1Q90A 4OO1H 3CRKC 2MNAA 3GTMH 3M3YH 4KHZA 5FO7B 3AMUA 3A8KE 1BCPF 1AW7A 2X6LA 5EBCA 2YU9H 4BBRG 2E74C 4ZRZA 3A55A 2F4IA 1D6EC 1PXUA 4XT1B 3S1QB 2R93B 5JEAJ 3HOUG 1WCMB 1EOTA 4ZYSA 2LMCB 2ATWA 2F1MA 1GUNA 2EYPA 4L8JA 3QIAA 4RG1A 1KNEA 2B2UA 2NN6G 2R7FA 2XTIA 3DM3A 3FPPA 4DXGA 3BVMA 4HJ7A 5JPMC 3KUPA 2BCOA 2NVXH 1QNKA 4AQYL 3K5MA 4ABNA 4JBKA 2PQAB 1SE3A 3RD4A 1JICA 3CCEA 1TY0A 2K5VA 3OWFA 1VQDA 4R1JA 1ZXTA 3PIOA 3D4DA 4KTAA 3F2CA 2IWHA 3NTKA 1W3SA 4A4IA 3FKIH 1X65A 4RCNA 4MZ9A 1EQTA 2ICEC 4A3BG 2JP1A 4GKJQ 1WOCA 1X9NA 4LF7L 1HQMC 4JI3Q 5CV7A 4JI7Q 1JQYD 3J7YW 1CK1A 2F3VA 4K8JA 2BH8A 5IIFA 3I4OA 3I4MH 2FXQA 4IUUA 4LF8Q 1VQ8A 3SE0A 4PV1C 4LF9L 2DNCA 1SNCA 1ESRA 4UP9A 3OIQA 4H44C 4YCVA 3HOVB 1LLRD 2ZTCA 4OELB 2CHBD 3WOFA 1SFOB 3T4AC 4R4OA 2YTXA 5E1FA 3NWSA 1EL0A 1LTLA 2AQ1B 1TIID 5KRUA 4FXKC 3U9SA 1K83H 3PO3H 3L7ZC 1NNXA 1X3QA 4QUFA 4BY7B 2A68D 4LF6Q 1R4PB 4JI0L 3NSWA 3A8IE 2FMMA 5IYBG 1HZAA 3DEPA 4IUVA 4P72A 4DA2A 1ML0D 1HNXQ 2ZM6Q 3RZDH 1N32L 2L4NA 3A74A 1EZ6A 4GOPC 2MO1A 2HCIA 3ERSX 3J80c 3TP5A 4A3KB 1WVLA 4IFDG 1PH9A 2F3IA 1ILPA 1UEBA 1SR3A 3EIVA 5EKKA 4JI4L 4DR2L 2R93G 2K5HA 2JSOA 4HJ8A 1VQHA 1WCMG 4KK7A 1SDFA 1KQSA 1N8RC 1U9RA 5I6YA 2PI2E 5LMNQ 4HCEA 4O1NA 3OYYA 1G51A 3H0GH 4CKBA 2KUMA 1XPOA 3J7AV 3S1NH 3PF5A 2R7ZG 1SSOA 4IJHA 1DCZA 4C3JH 5AJ3Q 4G7ZC 1J5EL 4BBSG 5D14A 1JJ2A 1HNWL 1NCVA 1MJEA 1OXUA 3H3VI 4RKLA 1VS0A 3BYTB 5CV6A 3G6JB 4B3RL 2YTYA 5EPJA 1DYQA 4JPBW 3FMCA 4P75A 3V05A 4JI1Q 1TWFB 1A2TA 1BKBA 3T1HQ 1STGA 4RWSC 3GTKH 3GTQH 4ID6A 2NZOA 4IURA 3S1RH 2DNEA 2RHSB 2QCPX 5CR3A 5EBDA 5FLMG 3S14B 3K59A 1GJXA 1KAAA 3OTOQ 2EVBA 3RUZA 4GKKL 1CFMA 2DN8A 4N8FA 1YVCA 4MN3A 3E9HA 4YCWA 5C4XB 2Q2IA 4KHVA 2PNHA 5JOBA 4H13C 4DR1L 3PGZA 3LNNA 1EU3A 1L1OA 5EAYA 3TSSA 5ELNA 1HZBA 5CBAE 1Q8IA 4Y52H 4YHHL 1PTOD 1G2TA 2OTJA 3I7FA 5D65A 1PH2A 2UXDL 3V2TA 2NBFA 2E2IH 3M4OB 4EX5A 2Z6BA 3DMUA 4B3SQ 4K14A 3WDNA 4C3IH 1JT8A 1O7YA 3QG1A 1A15A 1Y1WG 4Q5VA 1QNUA 2Z0SA 3VR5A 1I6VC 1X3EA 4X66L 1HXYD 2KHJA 2R61A 3G6EA 4LF4L 1Q82C 1I6HH 2WFWA 1VQNA 1PH5A 1BCPC 2ALYB 1SMYC 1YHBA 1XNRL 2A6EC 2QGQA 4BA1I 3OIPA 2V4DA 2RKSA 4ZQ3A 3DHQA 5FJ8G 3GTMB 1EY8A 4RGOS 1CT1D 4XQNA 1CSPA 2IX0A 1KTKA 5DM63 4A3LG 1HA5A 3UDXA 4IOAA 3M4YA 1SAPA 2ZJRA 1VDZA 3GV6A 3PQIA 3U58A 3J80i 5JEAG 2NYZD 2KBNA 2EY5A 4CGYB 1F9RA 1SEBD 4DV5L 1FJGQ 4K6LA 2OTLA 2OQ0A 1GOZA 4DNIA 2RDGA 4JW0A 5FLXE 4HSPA 4FF3A 4R8NA 2R7DA 4CHTB 1BO0A 2JA6G 1IXRA 1ZYRD 2RF4A 1GHJA 4U68A 2G9DA 4R4TA 3SK5A 2CKZB 3I4NG 2NWGA 4J15A 2LSSA 4A3IH 1KC8C 1Q8KA 1K73C 1C9OA 2HDMA 1VQEA 1PTOH 4A3JB 2A8VA 1ASZA 2L0CA 1VF5C 2VB2X 1CZWA 2PZWA 4DNRB 3G7LA 4APVA 2ZTDA 4CKCA 3TREA 5BR8L 3CMEA 3I4MB 3E0JA 3QOLA 1HFGA 1UE5A 5M5XH 1VMPA 2H4OA 1EYDA 4HIKA 1OXSC 1PMRA 5DLQE 3K5OA 1LTRD 4LFCQ 4R4CA 1E3PA 2F3WA 4DAYB 5AFWA 2DJGC 1IBML 1H95A 4EVOA 3K81C 1G8ZD 4LFAQ 1G91A 2B2YA 3PO2B 1AH9A 1CKNA 4X3SA 1G2SA 4K0KL 3KOJA 4DXFA 2R92H 2IW3A 1AP0A 1STHA 1SN8A 3GDEA 1S40A 3BJUA 2K5WA 1A6XA 2NTTA 5BN5A 3HRZC 3QWNA 1K83B 3PO3B 5IGEA 2NVTH 2JE6I 4RGMA 3SDZA 4GN3B 3C2PA 2QILA 4A3EH 3R3OA 2A74C 4BY1H 1IBKL 2Z4HA 3CMAA 3J81E 1DXMA 1LO5D 1K0RA 2F0JA 1EIGA 3V96A 1KXLA 3S1QH 1IYJB 2P5ZX 4XT3B 4X64L 4OHJA 2EIFA 3D4RA 1RF2D 4OO1G 4HIMA 1UUPA 3Q8DA 1EEFD 4U673 1F2MA 5IE8A 4KKSA 1UE7A 2JEBI 4LFBL 2RSOA 1CZGA 1PFMA 1PRTB 4LK1C 3CC7A 2K7VA 2CW0C 3NP8A 1NE3A 5JJIA 2WB1B 4GN5A 1XTDA 3VR6A 4NDXA 3SGIA 1STBA 3HOYB 3H0GB 1EWHA 4MHEA 3OHXC 3S1NB 4DV3L 3HG9A 1TWHB 4DR5L 1A3TA 4JOIC 1KAWA 1XJVA 1A8VA 3EQLC 2UXBQ 1W6JA 3CPWA 5C44B 2L9HA 4GLAC 2O5JC 1IKLA 1SRUA 2EY2A 3FKIG 4PG3A 4DR6Q 1G291 4KY6A 1CTMA 5E3FA 3S1RB 4QIWB 3J7AF 4X65L 3CCVA 1PH7A 3HOVH 1ICFB 1LTID 3NUCA 1QG7A 1YEZA 1B9NA 2J7ZA 1WYDA 4IJLA 1J6QA 5EQ0A 4K2KA 3I4MG 5LHY1 1VQCA 2LFNA 4HEDA 1U4RA 2GVAA 4G57A 1E1TA 2UUAL 3K57A 1G6ZA 2K04A 5I4DA 3HOXB 3DWQA 5IWAQ 4DU9A 4ZKBB 3MZ5A 4N9PA 3BVGA 2D0OA 3VA7A 3CCUA 4A76A 4BY7H 3K5NA 3H3VC 2E5LQ 1E0BA 4PQXA 1CI3M 3MHBA 4B3TQ 3MXGA 2WB1E 3K0YA 4AYBB 1FR3A 3MEFA 1VMCA 1SYFA 3BS1A 2F0IA 4CDFC 2QKIC 1I4QA 4P2CB 2VQFL 3PO3G 1KRSA 2KQ3A 5CV4A 4C3IB 5IYDH 2KENA 3ER0A 5C4JB 1YNJD 2CQOA 5GROA 4KD4A 4ZLTF 4QL5A 2Q8RE 3KLRA 1Y14B 1I4RA 4DAVA 2ASBA 3F1ZA 3F2UA 4DV6Q 4A3KH 1GD7A 4JI7L 3L3OC 3EJIA 1K8OA 4PZ6A 3BVZA 1KL9A 3GP7A 1SMXA 2OF1A 4QQBX 4RHRA 4JBMA 2I0QA 1UWVA 3ULJA 1FYCA 2B2TA 3A54A 1V1QA 3KBGA 2X6GA 1Q46A 4ULLA 4QIWE 3VA5A 1I50B 1NR4A 1EEID 3HP3A 2BDOA 4ILWA 2EJMA 4CDDC 2IX3A 1TQOA 1AZQA 2PW7A 2WIIB 3QOJA 4RKBA 4KJOA 1LTTD 3HS0C 1CKOA 4DV0Q 2WB1G 5E7NA 2A5HA 1KNAA 2LS01 1SROA 2F0QA 1B2TA 1XMOQ 3W3AA 4DR4Q 4KLKA 4KHPQ 2L1BA 4JI5L 1EYAA 1U4LA 2EDGA 3H0GG 4C1NK 4DV7Q 4OX9L 5IP7H 3TRZA 1Z6HA 4YY3Q 4A93B 1VQ5A 4MNOA 1YHQA 5ISRA 4C3JG 2EZVA 4JCVE 4AYBE 1K0SA 3S14H 2Q8IB 1EY0A 1EY6A 3KBXA 3RLOA 3RLFA 3ULPA 5M9OA 2K01A 3CW2C 3NE5B 2CVRA 1I94L 3TMEA 4A3IB 1BBUA 2M2LA 1A62A 3TZDA 4JYAQ 4IUPA 1SNOA 4HMJA 4QY7A 4OWTB 5C4XH 4QF4A 4JI6Q 2WINB 3OW7A 3H6MA 2Z6KA 5A2QE 2PYKA 4OIJA 4RCOA 3Q0AA 5IT9c 3I8ZA 2K50A 2ICIA 2C35B 1RDPD 4DR7Q 3S2DH 3N52A 3AFQA 1WTVA 2F0UA 2N3SA 2K33A 1XNQL 2I46A 1QJOA 1SYGA 5JJZA 4F8MA 3J7ZC 1PYSB 3VYRA 3TQYA 1Y8NB 5KEEA 5FK9C 2CQAA 5M5YB 1SE8A 1EYGA 3A5UA 2OQKA 3X3NA 3ND8A 4A75A 4GS3A 4FP5D 5M3MB 4K8IA 2R92B 5J22A 4AYBG 2WV6D 4KV6A 4N9TA 4LF5L 1MD2D 1V1PB 3I4LA 1Y8OB 5FLXL 1TWGB 2MUYA 3C1FA 2NVTB 4JI1L 3OWEB 3P7JA 2B8GA 4C3IG 4A3EB 2A1AA 4IPGA 1CUKA 1AFPA 4BY1B 4IFDI 2RDHA 3Q22A 3W2DA 3CD6A 1JOKA 1FNUA 1LTAD 1PYWD 1KD1C 1JOOA 3CCSA 4HJ5A 3LWUA 1D1IA 1RJTA 4IALA 5IGGA 1QVGA 2HDLA 2F0WA 4XIGS 2K1BA 1JWMD 1D7QA 2L55A 2UXCQ 1K9MC 1B50A 3F2BA 1S4ZA 4DK0A 1N34Q 4ZUJA 3SK6A 1WTXA 3CPFA 3E9IA 1SE2A 4JK1C 5NUCA 1MJCA 2D0PA 4XYQA 4JV5L 4H02A 1JC7A 1BBXC 1JJCB 1SXTA 1GUGA 4A3JH 3MEHA 3WWVA 1PRTD 2F0SA 3B6YA 4WFN3 3N6RA 3VYUA 4PNYA 2EJFC 5FO9B 2SOBA 3K7UC 2C5CA 2NZHA 1E24A 4GLVB 2Z4IA 2E8GA 2PNRC 4DR3L 4LWCA 4A3IG 4XDXA 3SEBA 2F0KA 5KNDA 5CMDA 4IZ8A 1RD9D 2ID0A 5K36H 1L2FA 1EWCA 3J81L 1O78A 2K4KA 5CYUA 3KFUA 4FF4A 5ELDA 4RMFA 2HHHQ 1SE4A 2Y0SB 1Y8PB 4K5VA 4X6AH 1CSQA 3IFDA 2K5NA 3PUXA 3PO2H 3TBIB 2HD3A 4HSVA 2EY6A 4LUOA 3PIO3 4NXNL 3S16B 3GO5A 1MKHA 3DXJC 3PUVA 1D1KA 1L1OC 1FJGL 1X55A 3VDYA 5IY0A 4DV2L 4KN4C 4X62L 1Q1EA 4IPHA 2QA4A 1IL8A 3QB3A 4JVZA 3GQBA 4UHVA 2F0PA 1WJJA 2VW9A 4J1MA 4XYOA 3CCJA 4FXDA 2R92G 2MFIA 2A19A 2AMCB 5C4ZA 2JEAI 2PZTA 1PH6A 2AQ2B 2IX1A 1EUJA 4JI2L 4POGA 1I5FA 2KHIA 4YWLA 1O7ZA 3NXWA 2D2CC 2RCFA 1ENCA 1CHPD 4PZ7A 2MP1A 4J8QA 4A3EG 3GTLB 2F0VA 2A68C 4BY1G 2KEEA 4DAYA 4WORA 1W6KA 2EYLA 1WTWA 4NMZA 3R2TA 1A3VA 3MTSA 3I72A 1X56A 3G4SA 4S3SA 1UE6A 1PH8A 5ELOA 3VR2A 3KJPA 2UUCQ 4KY7A 4TQUS 1AEXA 2I07B 1SNQA 2J4XA 1F2LA 3ULLA 2ZXOA 2F03A 3HOYH 3IL8A 2G5DA 1C4QA 1ICWA 3T13A 4NPSA 2L11A 1PZJD 2Y0SE 4MTNA 1TS5A 3L9AX 1JJGA 1TWHH 1IHZA 2R3ZA 3LGJA 2F0EA 1MIUA 3BZCA 4IUNA 2L15A 5HURA 5C44H 1KLUD 5COYA 4O42A 1K3BC 4O2DA 1XMQL 1QVFA 1C48A 2HUGA 1NMFA 2JQOA 1KDBA 4DV1Q 1Z9FA 4QMGA 2B63B 2A69D 1X3GA 3GTJH 4HCSA 1TY2A 5I9OA 1VQFA 1HPCA 1K8AC 3TS0A 4YCUA 1JE5A 5C0XH 3STBD 2V1CC 5GAEC 2VUMH 1WFQA 5FO8B 1B8AA 5C3EH 3PCOB 1WTRA 4K2LA 3HOVG 3HOXH 4XQJA 1IBLQ 1CQFA 3K7AH 1A3UA 4LMQD 1N36L 3NENA 3S2DB 2NTSA 1BQQT 1EY5A 2GA4B 1J9OA 3BDOA 2B3GA 2EYFA 1QE6A 1GUTA 1YNND 1B9MA 3RZOB 3EBEA 2EY1A 4L5RC 1JMCA 1Y69U 3RR5A 2AWNA 1VQMA 2NZ1D 3JC66 4TRDA 3C3LA 1MBYA 4AQYQ 2L5TA 2MO0A 4BS9A 5C4JH 2EYMA 2RVLA 1Q3LA 1YZ6A 4BY7G 2K52A 4TSSA 1X3FA 1PH4A 4OGQC 1I3QH 4RAUC 3H15A 4QGUA 3HKZB 1PTOC 3K5LA 2KCCA 2VL6A 4BWGB 1DM0B 2UU9L 3TS2A 4FYDA 4OO1I 1FNWA 3A8JE 5IYDG 4B3ML 4DN4M 4NXML 3MXUA 4LF7Q 2JA7B 3GTOB 1I50H 3HOZB 1I4XA 4GOPA 4A3KG 4LNQA 3I3CA 5I2YA 2K5QA 4LF9Q 3HEJA 3KLWA 3M7NA 2RDFA 2JN4A 4XQQA 2K5DA 1PZKD 2VQEL 1TS3A 3K0XA 5A2QL 5C3WA 1U0LA 4LUVA 1LUZA 1OXTA 3H91A 5T1IA 1Q81C 1XXGA 2WKDA 4A3GB 3BYYB 2M00A 1HR0L 2PMZB 4A93H 4HTHA 1NUCA 1VQ9A 1VQGA 4KKUA 3EN2A 2FHTA 4Z9CB 5JPNC 4B3TL 2H5XA 1VQOA 3DM1A 4A3FH 5CGKA 2WP8J 4LW1A 2B2WC 1UAPA 2EJGC 1II3A 1I4HA 2X69A 4IO9A 5IP7G 3J80E 3KJOA 4JI0Q 1FD7D 1M1KC 1EU4A 4G4KA 3D8GA 2AQ3B 1N33L 4UY8C 1QZGA 2MJ8A 1ZYRC 4UP8A 3UE1A 5KNCA 1N32Q 3CQZB 3KF6A 2KVMA 4I65A 4YWKA 5C0XJ 3QO2A 2NVQB 1I4GA 2RQXA 5CBEE 2N88A 2HIVA 3NPPA 4EQPA 5C4XG 4XXEA 1Z47A 4L5QA 1L0YB 2F0GA 2KCNA 1A63A 2AUJD 5M5YH 1CHQD 1V43A 1HCZA 5I6WA 5KYIA 4DR2Q 4BXXH 1EYCA 3C1EA 2B2VC 1KHIA 1RTNA 5M3MH 1QCBD 3P20A 4GZYC 1DOMA 1HR0W 3JAMc 2F0TA 1TWGH 3GD7A 4DV4L 1K8GA 4CJ0B 1CA5A 1B7YB 2PMZE 1LTSD 1DGSA 4DK1A 3CRLC 4FF1A 2L12A 4YY3L 3H09A 5IYCH 1J5EQ 4KY5A 2OT2A 3SK4A 3UDGA 3CCMA 1PHJA 4IOCA 1Q7YC 3ICEA 1E22A 4F87A 5F2DA 4JI8L 3W5OA 2WAQB 3FP9A 4ME3A 1QILA 1PH1A 3HOWH 3AEVA 2GN5A 3MA2B 1JB7A 2Z1CA 1G6PA 2YTVA 1OO9B 3PUWA 4LAAA 1H9MA 4JC0A 4R4IA 1YJWA 1R4QB 1C7YA 4A3DB 1PYBA 1TWAH 3OPOA 3FDTA 2C9OA 1D5XC 3M85A 1B53A 2AWOA 1O80A 4A3CH 3FVQA 3KDFB 2SNSA 2YYZA 1V1PA 1Z7TA 1V8QA 1AZPA 4DR1Q 2PO4A 1AE3A 5CORA 2HCCA 3NELA 5KIXA 3HKSA 1Y1VB 4UPAA 4DUYL 4F88A 1IW7D 4BA2I 3T51B 1A2UA 3TDQA 3LWEA 2XNAC 1EIFA 2SEBD 1ONLA 1VQ4A 3OMCA 3K58A 1T5XD 3CP0A 3NQIA 4A3JG 3CCQA 5KYLA 4X66Q 3GTJB 5HGQA 3HFZB 5G3LD 1XNRQ 1NTGA 3M7GA 5C0XI 4GNXC 2WAQE 3CU7A 4FO2A 2VUMB 2H1EA 2ZXRA 1PRTF 1P8LA 3S16H 5C3EB 5ELCA 4V190 1UEAB 3K80C 5K36G 1H9KA 4GOPB 3K7AB 1FGUA 1YBYA 1XYIA 4ZKCB 4KD3A 4JBWA 2CH4A 3CKIB 3PO2G 2HIXA 4DV5Q 2NVYH 1D5ZC 2K75A 3A7LA 1LT6D 3H94A 5LMUQ 2IL8A 3EFXD 2KCTA 3AFPA 3A56A 4FNFA 5E4XA 1IKMA 4GKJL 3GTLH 2F0LA 3TZUA 1I3QB 3MXPA 4JI3L 3E0EA 4NKLA 3JAMi 3G71A 3QJYA 3T1YQ 1LTGD 2RSNA 3RNUA 1TT2A 2F0DA 3FHWA 1KABA 1STNA 2JA8B 3S2HB 2B8FA 4LF8L 2XRQD 2E2JB 2AUKA 4V0BA 4DGZA 1XPUA 1EIHA 3NTHA 1SJHD 4BBRB 1IZ6A 5BR8Q 3KF6B 3MFYA 4IQZA 2ES2A 2CH4W 1CKMA 4QUCA 2JA9A 2B2UC 1HUMA 1E1OA 5FOBB 4KN7C 1NJIC 1E2VA 3T53B 2N8NA 1GXDC 5IOCA 1F9QA 3JAME 1BDOA 3KLSX 1IBMQ 1CA6A 3HOYG 4X3UA 4LUZA 5JAVA 3BU2A 4L5SA 2XN9C 4LF6L 1LT5D 2BE5C 3HZXA 2B63H 4K0KQ 5IP9H 1E2ZA 5EGTA 1D5MC 1X54A 3NK9A 3ITPA 4A3FB 5C44G 4IPDA 3H3VH 1HNXL 3BDCA 1D2BA 2ZM6L 3ONAB 3IAYA 4JOIA 5KGUA 3VR4A 1RTOA 1ESFA 2DJFC 3UDFA 3CCLA 4FDBA 1GM5A 4L6TB 2N78A 1IBKQ 2G9HD 4TKOB 2A6HD 5DNFA 1SYDA 1S5ED 4P71A 4EQ5A 5H1SE 2K32A 4UAIA 5C0XG 5TSSA 5GAGC 4J6HA 1SBBB 5HY6A 3U4ZA 3S1MH 3CAMA 1GUSA 3Q24A 1BCPB 4O0AA 2VUMG 3PIPA 3RZOH 3EROA 1CM9A 2OEOA 5JVH3 5C3EG 4ODGA 2SDFA 1YNXA 3SHLA 3HOXG 1V1OA 2J0TD 4RFBA 5LMNL 1QWYA 4LFBQ 2B39A 1TVXA 1ENFA 2PZUA 1PV4A 4CBVA 1EWIA 3PUZA 2K28A 2D62A 5AJ3L 1FVIA 3KF8B 4DF7A 3OMGA 3VR3A 4Y7NB 3DUZA 4UP7A 3U9OA 1BF4A 1S5CD 1S5FD 5FKAC 3DLLA 2EYHA 1JB3A 3NBHB 4DV3Q 4HAEA 3T1HL 1HTLD 1ILQA 2RCNA 2JA7H 2AKWB 3GTOH 1PTOF 5DM73 4DR5Q 3HOZH 2DY8A 3PUYA 4KKTA 4L63B 3OTOL 1H9RA 1LT4D 1K28A 1JE4A 1X32A 2KOLA 1TU2B 3J80L 1TR5A 1YIJA 1F2YA 2QDLA 3PIP3 2ENBA 4X65Q 3SK8A 3HOWB 2M9VA 3P1HA 2XGTA 3K6OA 2XRSD 3PMFA 4A3GH 1VQBA 1WI5A 2EPBA 1IBLL 3W1BA 1H9SB 2JJQA 2QF7A 3ZJYC 3UI2A 1TWAB 1JOQA 3OW2A 3MXNB 3S15H 1SYBA 5CV8A 2UUAQ 1M4VA 5LMNW 3D31A 4HIOA 3GTPB 1K8MA 3D6CA 4DAPA 2QEJC 4K5XA 4NW2A 5JJLA 5ELBA 4B3SL 2CCZA 3MAQA 4A93G 4WJ4A 3BZKA 2R7ZB 4XTCS 3T16A 4BBSB 2A73B 4FVMA 3CF5A 2KA7A 2MHVA 2F4VQ 2VY3A 5C5LA 4YIJA 3TP7A 3M4QA 3CQZH 2NVQH 1F9PA 2VQFQ 1VQ7A 3A7AB 4A3FG 1DOKA 2SNMA 4WJWA 4HJ9A 3A0JA 4Q0FA 1VQ6A 3IFTA 2JK8A 2LKVA 1PRTC 3ZYYX 4ALPA 1XTCD 1TWCB 5BN4A 3AQQA 4EQNA 2UUBQ 1YJ9A 3Q23A 2LXKA 1AE2A 1S72A 1C8CA 1S5BD 2E2HH 1RCVD 4NB3A 3I55A 3MC0B 4MIUA 3E3XA 4HJAA 4BXXG 2JA5H 3SR1A 3TP6A 4R9WA 5M3MG 2NVYB 2BA0A 5C6AA 1SYCA 5K5PA 3CC4A 1MSHA 1YHAA 2VZAA 5HGTA 2OWOA 4RHSA 4JI5Q 1R9TB 4KI0A 4OX9Q 1DZ1A 1J8IA 3NEMA 5EPKA 1N9WA 1Y1WB 1GVPA 3AYHB 5FLXc 3M4PA 1GUOA 5IYCG 1RODA 4TVAB 1ZKOA 5IT9E 4P74A 2N49A 1I94Q 4DKAC 1HNZQ 2KECA 4RA8A 2LXJA 4A3MH 4A3DH 1HRJA 4DAMA 2B29A 4DUZQ 3HOWG 4HMIA 4LFCL 4QJFA 5JJKA 3CC2A 1L0WA 1EFWA 1Q12A 2AHOB 4AH6A 2BA1A 4LFAL 1Y1VH 2IHEA 5J1ZA 1HUNA 5CV9A 2VXWA 1XNQQ 1EY4A 4LJZC 2EYOA 2Q8TA 4GNXB 4A3CG 5M5WH 2OCEA 2MGSA 4RGNA 1EIYB 1RIPA 1B1ZA 3TP8A 1B4OA 5A35A 5M3FH 2DY7A 5EJWA 1STYA 4AIMA 2JA6B 4NP5A 3L2PA 2O5IC 4LF5Q 3I56A 2BDNA 3I4NB 4DFAA 1I4PA 4C2MB 3D0FA 4R8IA 5BN3A 4K5WA 2D5DA 1FNVA 3MFGA 3KDFA 3W1GA 5ELFA 3FEWX 3OSOA 1HZCA 2A69C 2HQLA 5IGFA 5GAHC 3GTGB 3A5ZB 2BOSA 2Y0SG 4ZCKA 4QB4A 3R93A 3J81c 3S17B 1SNDA 4CDCC 3S1MB 1X3PA 2F0OA 4JBJA 3STBC 1WTHA 1VCIA 1Q1BA 1ZEQX 1V9PA 3AU7A 5G3LF 2B2YC 4C3HH 1HH2P 1T5EA 2WACA 3R8BA 1P16A 2XIWA 2BH2A 4DK6C 5DAUA 2IHFA 3AB9A 1EQQA 2RA4A 4HR7B 3S24A 2IT1A 4L5TA 3TN2A 3JAML 1BCPD 2HQEA 1SMYD 4CJ2C 2A6ED 1YNNC 2CFMA 5GADC 3RN2A 4OXPA 2UXBL 2ZTEA 4RGTA 4JV5Q 4B9WA 3MWYW 2JA8H 1QUQA 1QZHA 4I7ZC 3E6ZX 3SVMA 3S2HH 4WRDA 2E2JH 4DR6L 4B9XA 1TXYA 1BR9A 2HT1A 3J81j 3K8AA 4BBRH 1NAPA 1PDQA 3KYHC 1QOHA 3BDLA 4DR3Q 1FGBD 1BOSA 4EGVA 1S5DD 1PFNA 3HOUH 1NBWA 2EE1A 1M90C 2CWPA 2VNUD 2NN6H 1X6OA 2MPMA 3M3YB 2NUCA 1U4PA 2YU9B 2K14A 1O7IA 5IWAL 3P75A 3UE0A 2RHQB 4PZ8A 1STEA 2DUDA 1DOLA 1LV9A 2KEDA 3S15B 1B44D 2E5LL 3MVVA 2N55A 4CDEC 1TS2A 4NXNQ 2I5HA 1NY4A 5KNBA 1WTPA 2OXPA 4DV2Q 4X62Q 1JR0D 1LACA 4A3BH 2NVXB 4DNTB 1Q86C 5GQOA 5LMUL 5EKIA 1STAA 3U50C 4R4QA 1GUWA 2B63G 3X3MA 3HKZE 5IP9G 4DV6L 4OIKA 2I5LX 4OL7A 2ZXPA 3T1YL 4JI2Q 1HFNA 3FKIB 1VQAA 3KK7A 3U4VA 1TKWB 2YV5A 1NMGA 2RBMA 3FPUB 2E75C 4G7HC 3VYSA 1FL0A 3SXHA 4IPCA 5IGBA 2D9UA 3E5SA 1JCKB 4JI4Q 3ERQA 4EQOA 1PFBA 3F2DA 1GO3E 4PMBA 3NQTA 1HJPA 2FMCA 2E2DC 1OXXK 4Y7NH 2LY7A 4DV0L 2XWJB 1A0IA 4OEMB 3I70A 1XMOL 2E2HB 3J81i 3CHBD 4IUTA 2ZJQA 4DR4L 4QCLA 4KHPL 5C5MA 2QW7A 4K6DA 4DV7L 1ENAA 4E6IA 1VQJA 1UNSA 2JA5B 1HNWQ 1EQVA 4OONA 5IODA 5IYBH 1VQLA 4B3RQ 4PMCA 3EA6A 2JYOA 3OOCA 1IL2A 3HKZG 2F52A 4DK3C 3NBIA 4FXGC 2QDBA 5D3IB 1BVSA 1XMQQ 4JYAL 2TSSA 2F0HA 3RMHA 1SLJA 4ZK9B 4H0LC 2JA7G 1H9JA 3PF4A 3HOZG 1IYVA 4JI6L 2B2TC 5C3XA 1O7LA 4IFDH 1LM0A 4N8X1 1YJNA 2CW0D 2F0NA 1LT3D 4GKKQ 3RZDB 2IPKD 4A3MB 4DR7L 1MHWC 2R93H 1YITA 1OXVA 4OWXB 3RN5A 1WD1A 1WCMH 3KF8A 1SYEA 4ZUIA 3I91A 3GTPH 1TS4A 4C1NI 3G48A 5J39A 4HIDA 4UDUC 1N36Q 3BZDB 3DWAA 2O2LD 4A3GG 1MSGA 3NBHA 4X3TA 4H7BA 5ELEA 2R7ZH 4YHHQ 4BBSH 1KRTA 1ET6A 4HN7A 2O4XA 1KIXA 4CKEA 2UXDQ 4POFA 3GV3A 2K6AA 5M5WB 1SNPA 3D4WA 3NTIA 3L0OA 3IKJA 1WD0A 3CCRA 5M3FB 1XWEA 4FF2A 3NWTA 1EQRA 1L1OB 2FJ2A 4LF4Q 2PCFB 4C3JB 3VYTA 3URYA 2B2WA 2QEXA 5FLMH 1JWUD 4OWWB 1CQVA 1IW7C 3ND9A 1TWCH 1H9SA 1QUQB 1WTQA 1VQIA 2UU9Q 2PQEA 1SNMA 2Z6KC 1OTCA 3MXNA 4B3MQ 3GTKB 4NXMQ 3GTQB 5IT9L 1PA6A 5E4WC 3FRPB 3KLSA 1SFOH 3S9WA 3BG3A 1AN8A 2UXCL 2PQAA 3DEOA 1EZ8A 2TMPA 1HTPA 2VQEQ 2FFKB 1K3RA 4KJNA 1ASYA 1N34L 3D3RA 1QVCA 1B3QA 4YWMA 2ZT9C 1GHKA 4C3HB 1IYUA 4IN3A 1E2WA 2EOTA 2B2VA 1RL2A 1R9TH 2XSCA 1HR0Q 1L0XB 5LL6X 3PSIA 2KHSA 1Y1WH 1UE1A 1W2BA 2IY5B 1VF7A 2JA5G
chains in the Genus database with same CATH topology
4A3GH 1VQBA 4O2DA 1WI5A 1IBLL 1XMQL 4WJ3M 2F4VL 3W1BA 4HIKA 1QVFA 2JJQA 1OXSC 5DLQE 1NMFA 2JQOA 3ZJYC 4LFCQ 4DV1Q 1Z9FA 3OW2A 1YI2A 4R4CA 1E3PA 3MXNB 4DAYB 3S15H 1X3GA 3GTJH 2WAQG 1IBML 1H95A 2UUAQ 5FJ8H 3K81C 1VQFA 1K8AC 5LMNW 3D31A 4HIOA 4LFAQ 3TS0A 4YCUA 1JE5A 1T9HA 3STBD 1N33Q 1CKNA 4IFDJ 1AH9A 2V1CC 2PI2A 5GAEC 4K0KL 2VUMH 4A3LH 1WFQA 5JJLA 3KOJA 4B3SL 2R92H 1B8AA 2CCZA 4A93G 1SN8A 5C3EH 2HHHL 3PCOB 4WJ4A 3BZKA 3GDEA 3BJUA 4XTCS 1S40A 3HOVG 3HOXH 3CF5A 4A3MG 1IBLQ 4A3DG 3K7AH 2F4VQ 1PVOA 1N36L 2NVTH 2JE6I 2VY3A 3NENA 2NN6I 3M4QA 4GN3B 2EQSA 1E7ZA 3CQZH 2UUBL 2NVQH 2VQFQ 4A3EH 1LYLA 4A3FG 1VQ7A 2B3GA 4BY1H 1IBKL 3CXCA 4HJ9A 2I5MX 3A0JA 3CMAA 1C0AA 3EBEA 1VQ6A 4L5RC 2JK8A 2MQHA 1K0RA 4PMWA 1JMCA 1KXLA 3S1QH 1IYJB 1Y1VG 3RR5A 2AWNA 1VQMA 2JA6H 3JC66 1VQPA 4AQYQ 4X64L 2Q2TA 3F8TA 2EIFA 4ALPA 2MO0A 1U5KA 4GLXA 1VQ5A 5C4JH 4OO1G 4HIMA 3Q8DA 3I4NH 1YZ6A 4BY7G 3M9BA 2K52A 5IE8A 4C2MH 4DV4Q 1X3FA 1PH4A 1I3QH 3AQQA 1TWFH 1UE7A 2JEBI 3H15A 4QGUA 3UDIA 2UUBQ 5M3FG 4LFBL 1YJ9A 4P73A 4JG2A 3CC7A 2LXKA 2VL6A 5J3BA 1CKNB 1VQKA 2ZJPA 1AE2A 1S72A 2KCMA 1NE3A 2UU9L 3TS2A 2E2HH 4OO1I 5JJIA 4GN5A 4NB3A 5IYDG 2Q2HA 3I55A 4B3ML 1XTDA 4NXML 3GTGH 4LF7Q 4JI8Q 4HJAA 1I50H 3SGIA 3J7A5 2GVBA 1HNZL 2JA5H 4X64Q 2Q2UA 3S17H 4BXXG 4GOPA 4A3KG 2UUCL 5M3MG 4LNQA 2BA0A 1D8LA 4DV3L 1GKHA 1PH3A 4DUZL 3CC4A 1YHAA 4GNXA 2VZAA 4DPGA 4LF9Q 2OWOA 4DR5L 4JI5Q 4JOIC 1KAWA 3KLWA 4KI0A 3M7NA 4OX9Q 2R6GA 1XJVA 2VQEL 1A8VA 3IRBA 3K0XA 3NEMA 2UXBQ 3CPWA 1N9WA 4GLAC 3AYHB 1GVPA 1U0LA 4LUVA 1SRUA 1B70B 1LUZA 5FLXc 3M4PA 5IYCG 1OXTA 4GN4B 4TVAB 1Q81C 3FKIG 4P74A 2N49A 4PG3A 4DR6Q 1G291 1HR0L 1I94Q 4A93H 2VS1A 4DKAC 1HNZQ 4X65L 3RLNA 3CCVA 1PH7A 3HOVH 2DGYA 2LXJA 3TEHB 4A3MH 1XPRA 1VQ9A 3M4OH 4A3DH 1VQGA 3EN2A 1YEZA 4DAMA 4B3TL 2B29A 1WYDA 4IJLA 1J6QA 2H5XA 4DUZQ 1VQOA 4DUYQ 3HOWG 4A3FH 3I4MG 2WP8J 4LFCL 4LW1A 2CWAA 1VQCA 3PV0A 4QJFA 4DV1L 1PFSA 3CC2A 5JJKA 1EOVA 1L0WA 3I2ZA 4A3CG 1EFWA 1Q12A 2GVAA 4IO9A 2AHOB 5IP7G 1E1TA 4AH6A 1BBWA 3KJOA 2UUAL 2BA1A 4JI0Q 1M1KC 4LFAL 1Y1VH 2IHEA 2JA8G 5IWAQ 1S3OA 1XNQQ 1N33L 1HZ9A 4UY8C 1QZGA 2EXDA 1N32Q 4UP8A 3UE1A 2D0OA 2MNAA 3CCUA 4GNXB 3KF6A 4YWKA 5C0XJ 5M5WH 4A76A 3GTMH 2OCEA 3M3YH 4KHZA 2E5LQ 4BY7H 1EIYB 4B3TQ 1RIPA 2YU9H 2WB1E 4BBRG 3MEFA 5M3FH 2HIVA 5C4XG 2VQFL 4AIMA 5JEAJ 3HOUG 1Z47A 4L5QA 3L2PA 1KRSA 3PO3G 5IYDH 2KENA 4LF5Q 2ATWA 3I56A 3ER0A 1A63A 5M5YH 1V43A 2CQOA 4RG1A 5GROA 2R7FA 2NN6G 2XTIA 4DR2Q 3DM3A 4QL5A 4BXXH 1Y14B 3D0FA 4HJ7A 2ASBA 3F1ZA 4DV6Q 1KHIA 1GD7A 4A3KH 2NVXH 5M3MH 4JI7L 4AQYL 4PZ6A 4JBKA 1KL9A 2PQAB 1SMXA 4QQBX 4JBMA 2I0QA 1UWVA 3KDFA 3ULJA 3W1GA 3JAMc 1HR0W 1TWGH 3CCEA 1V1QA 3GD7A 2K5VA 4DV4L 1K8GA 1HZCA 1B7YB 1VQDA 1Q46A 2PMZE 4R1JA 2HQLA 3PIOA 1DGSA 4QIWE 5GAHC 3A5ZB 2Y0SG 3F2CA 4YY3L 3J81c 5IYCH 1W3SA 1J5EQ 4A4IA 3FKIH 1X65A 3UDGA 4MZ9A 3CCMA 4JBJA 3STBC 1PHJA 4A3BG 4IOCA 1Q7YC 3ICEA 1E22A 4GKJQ 1WOCA 1VCIA 1Q1BA 1X9NA 4LF7L 4JI8L 1V9PA 4C3HH 4JI3Q 4JI7Q 3W5OA 3FP9A 4ME3A 1HH2P 2BH8A 1CKOA 4DV0Q 1P16A 2BH2A 2WB1G 5E7NA 1PH1A 4DK6C 3HOWH 3I4OA 1SROA 3I4MH 3AEVA 2IHFA 2GN5A 2FXQA 1JB7A 1XMOQ 1EQQA 4LF8Q 1VQ8A 4DR4Q 1G6PA 4KLKA 3S24A 4LF9L 2IT1A 2YTVA 3H0GG 4L5TA 4JI5L 4DV7Q 4KHPQ 3PUWA 4OX9L 5IP7H 3TRZA 4YY3Q 2CFMA 4UP9A 4JC0A 4OXPA 5GADC 3RN2A 2ZTEA 4MNOA 4R4IA 4YCVA 1YJWA 1YHQA 4JV5Q 1C7YA 2JA8H 1QUQA 1QZHA 1PYBA 1TWAH 4JCVE 4AYBE 2ZTCA 3S2HH 2E2JH 3S14H 4DR6L 3M85A 3RLFA 3RLOA 2AWOA 1TXYA 3ULPA 3CW2C 4A3CH 1I94L 3KDFB 2HT1A 1BBUA 2JA5G 4R4OA 2YTXA 2YYZA 3J81j 3K8AA 1A62A 4JYAQ 4BBRH 4DR1Q 1LTLA 3KYHC 1AE3A 4QY7A 4OWTB 5C4XH 4DR3Q 3NELA 3HKSA 4DUYL 4UPAA 4JI6Q 2Z6KA 3HOUH 1K83H 3PO3H 3L7ZC 5IT9c 1NBWA 4BA2I 1M90C 2CWPA 2K50A 2C35B 2VNUD 4DR7Q 1EIFA 1X6OA 4LF6Q 3S2DH 3AFQA 4JI0L 2K14A 1VQ4A 1O7IA 2N3SA 5IWAL 5IYBG 3UE0A 3CP0A 1HZAA 2RHQB 1XNQL 4A3JG 3CCQA 4PZ8A 4P72A 1HNXQ 2ZM6Q 3RZDH 1N32L 3J7ZC 2DUDA 4X66Q 1PYSB 3TQYA 3A74A 2E5LL 5HGQA 4GOPC 2MO1A 3ERSX 3HFZB 2I5HA 4NXNQ 1SE8A 1EYGA 1NY4A 3A5UA 1NTGA 5C0XI 1XNRQ 2OQKA 3J80c 4GNXC 4DV2Q 2WAQE 4A75A 4X62Q 4GS3A 4A3BH 4IFDG 1PH9A 4AYBG 1Q86C 1P8LA 5GQOA 5LMUL 3S16H 4LF5L 2F3IA 3U50C 3K80C 4R4QA 1UEBA 1SR3A 3EIVA 4JI4L 5K36G 4GOPB 4DR2L 2R93G 1FGUA 1YBYA 2K5HA 2B63G 3HKZE 5IP9G 4JI1L 4DV6L 4HJ8A 1VQHA 1WCMG 4JBWA 1KQSA 2I5LX 1N8RC 2A1AA 4IPGA 3T1YL 1CUKA 2PI2E 4JI2Q 1VQAA 5LMNQ 4IFDI 3U4VA 2YV5A 3PO2G 3OYYA 1G51A 3H0GH 3CD6A 1NMGA 2HIXA 1XPOA 4DV5Q 2NVYH 3S1NH 1FL0A 2K75A 3PF5A 2R7ZG 4IJHA 4IPCA 4C3JH 5AJ3Q 1J5EL 4BBSG 1KD1C 1JJ2A 5LMUQ 1HNWL 1MJEA 1OXUA 3H3VI 1VS0A 2KCTA 3CCSA 4HJ5A 4B3RL 2YTYA 4JI4Q 3AFPA 1QVGA 4GKJL 3F2DA 4P75A 3GTLH 1GO3E 4JI1Q 4XIGS 1HJPA 4JI3L 1BKBA 3E0EA 3T1HQ 1OXXK 3JAMi 4Y7NH 3GTKH 4DV0L 3GTQH 3G71A 3T1YQ 1A0IA 2NZOA 3RNUA 2UXCQ 1D7QA 3FHWA 3S1RH 1K9MC 3F2BA 2RHSB 1XMOL 4LF8L 5FLMG 3J81i 2ZJQA 1N34Q 4DR4L 4KHPL 4DV7L 3OTOQ 1XPUA 3CPFA 3E9IA 1VQJA 1MJCA 2D0PA 4JV5L 4GKKL 4H02A 1HNWQ 1JJCB 4OONA 1IZ6A 5IYBH 1VQLA 4B3RQ 1YVCA 4A3JH 5BR8Q 3KF6B 2ES2A 1IL2A 3E9HA 1CKMA 3HKZG 4YCWA 2Q2IA 3WWVA 2F52A 4DK3C 2JA9A 1E1OA 3B6YA 2PNHA 1BVSA 1XMQQ 1NJIC 4JYAL 4DR1L 2N8NA 3K7UC 3PGZA 2NZHA 1SLJA 1E24A 4GLVB 2E8GA 2JA7G 4DR3L 1L1OA 4LWCA 5EAYA 3PF4A 3HOZG 5ELNA 1HZBA 4A3IG 1IBMQ 4JI6L 3HOYG 4Y52H 4YHHL 1LM0A 1YJNA 2OTJA 3I7FA 4LUZA 2ID0A 1PH2A 4GKKQ 3BU2A 4L5SA 2UXDL 4DR7L 2E2IH 4EX5A 1L2FA 4LF6L 2R93H 1YITA 2K4KA 2B63H 3KFUA 5IP9H 4K0KQ 1OXVA 4OWXB 3RN5A 4B3SQ 1WCMH 4C3IH 4RMFA 2HHHQ 1X54A 1JT8A 3H3VH 5C44G 4IPDA 1Y1WG 1CSQA 1HNXL 3GTPH 4X6AH 2ZM6L 3G48A 2K5NA 2Z0SA 4X66L 1X3EA 4HIDA 3PUXA 4JOIA 3PO2H 4LF4L 2KHJA 3G6EA 2UXBL 1N36Q 1Q82C 1I6HH 4A3GG 2WFWA 4LUOA 1VQNA 4NXNL 3GO5A 3UDFA 1PH5A 2ALYB 1MKHA 3CCLA 1YHBA 3PUVA 4FDBA 1XNRL 1GM5A 2R7ZH 2QGQA 4YHHQ 2N78A 4BA1I 1L1OC 1IBKQ 1FJGL 4BBSH 1X55A 3VDYA 5IY0A 1KRTA 4DV2L 4X62L 1KIXA 1Q1EA 4IPHA 2UXDQ 2QA4A 4P71A 5FJ8G 4POFA 4EQ5A 5H1SE 3L0OA 5C0XG 1WJJA 5GAGC 1CSPA 2IX0A 3CCRA 2VW9A 5HY6A 3U4ZA 3S1MH 3CAMA 4O0AA 2VUMG 3RZOH 3PIPA 3CCJA 2R92G 4A3LG 2MFIA 2A19A 1EQRA 1L1OB 2AMCB 3UDXA 5C3EG 2JEAI 4IOAA 4LF4Q 1PH6A 1YNXA 3HOXG 2ZJRA 2IX1A 1EUJA 2QEXA 4JI2L 5FLMH 1I5FA 5LMNL 4POGA 3U58A 2KHIA 3J80i 4YWLA 5JEAG 4OWWB 4LFBQ 2KBNA 1TWCH 1QUQB 4PZ7A 4DV5L 1VQIA 1PV4A 1FJGQ 2OTLA 4A3EG 2UU9Q 1EWIA 2Z6KC 3PUZA 2OQ0A 1OTCA 2D62A 4BY1G 4DNIA 5AJ3L 1FVIA 3KF8B 4B3MQ 4NXMQ 4UP7A 1X56A 2R7DA 3G4SA 1UE6A 1PA6A 1PH8A 5ELOA 3DLLA 3KJPA 2JA6G 2UUCQ 1IXRA 4TQUS 3NBHB 2RF4A 4DV3Q 3T1HL 1SFOH 4R4TA 2RCNA 2JA7H 2AKWB 2CKZB 3GTOH 3I4NG 2UXCL 4DR5Q 2PQAA 2LSSA 4J15A 4A3IH 1KC8C 1Q8KA 3ULLA 1K73C 3HOZH 3HOYH 1C9OA 3PUYA 2VQEQ 1VQEA 1K3RA 1ASYA 2A8VA 4NPSA 1N34L 1ASZA 2Y0SE 4YWMA 1QVCA 4MTNA 3OTOL 1JJGA 1TWHH 3LGJA 1R9TH 1RL2A 1YIJA 1HR0Q 4APVA 3BZCA 2ZTDA 3PSIA 2L15A 3TREA 4X65Q 5BR8L 3CMEA 5C44H 1Y1WH 1UE1A 1W2BA 2IY5B 1MIUA 1UE5A 5M5XH 2XGTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3G H;  1VQB A;  4O2D A;  1WI5 A;  1IBL L;  1XMQ L;  4WJ3 M;  2F4V L;  3W1B A;  4HIK A;  1QVF A;  2JJQ A;  1OXS C;  5DLQ E;  1NMF A;  2JQO A;  3ZJY C;  4LFC Q;  4DV1 Q;  1Z9F A;  3OW2 A;  1YI2 A;  4R4C A;  1E3P A;  3MXN B;  4DAY B;  3S15 H;  1X3G A;  3GTJ H;  2WAQ G;  1IBM L;  1H95 A;  2UUA Q;  5FJ8 H;  3K81 C;  1VQF A;  1K8A C;  5LMN W;  3D31 A;  4HIO A;  4LFA Q;  3TS0 A;  4YCU A;  1JE5 A;  1T9H A;  3STB D;  1N33 Q;  1CKN A;  4IFD J;  1AH9 A;  2V1C C;  2PI2 A;  5GAE C;  4K0K L;  2VUM H;  4A3L H;  1WFQ A;  5JJL A;  3KOJ A;  4B3S L;  2R92 H;  1B8A A;  2CCZ A;  4A93 G;  1SN8 A;  5C3E H;  2HHH L;  3PCO B;  4WJ4 A;  3BZK A;  3GDE A;  3BJU A;  4XTC S;  1S40 A;  3HOV G;  3HOX H;  3CF5 A;  4A3M G;  1IBL Q;  4A3D G;  3K7A H;  2F4V Q;  1PVO A;  1N36 L;  2NVT H;  2JE6 I;  2VY3 A;  3NEN A;  2NN6 I;  3M4Q A;  4GN3 B;  2EQS A;  1E7Z A;  3CQZ H;  2UUB L;  2NVQ H;  2VQF Q;  4A3E H;  1LYL A;  4A3F G;  1VQ7 A;  2B3G A;  4BY1 H;  1IBK L;  3CXC A;  4HJ9 A;  2I5M X;  3A0J A;  3CMA A;  1C0A A;  3EBE A;  1VQ6 A;  4L5R C;  2JK8 A;  2MQH A;  1K0R A;  4PMW A;  1JMC A;  1KXL A;  3S1Q H;  1IYJ B;  1Y1V G;  3RR5 A;  2AWN A;  1VQM A;  2JA6 H;  3JC6 6;  1VQP A;  4AQY Q;  4X64 L;  2Q2T A;  3F8T A;  2EIF A;  4ALP A;  2MO0 A;  1U5K A;  4GLX A;  1VQ5 A;  5C4J H;  4OO1 G;  4HIM A;  3Q8D A;  3I4N H;  1YZ6 A;  4BY7 G;  3M9B A;  2K52 A;  5IE8 A;  4C2M H;  4DV4 Q;  1X3F A;  1PH4 A;  1I3Q H;  3AQQ A;  1TWF H;  1UE7 A;  2JEB I;  3H15 A;  4QGU A;  3UDI A;  2UUB Q;  5M3F G;  4LFB L;  1YJ9 A;  4P73 A;  4JG2 A;  3CC7 A;  2LXK A;  2VL6 A;  5J3B A;  1CKN B;  1VQK A;  2ZJP A;  1AE2 A;  1S72 A;  2KCM A;  1NE3 A;  2UU9 L;  3TS2 A;  2E2H H;  4OO1 I;  5JJI A;  4GN5 A;  4NB3 A;  5IYD G;  2Q2H A;  3I55 A;  4B3M L;  1XTD A;  4NXM L;  3GTG H;  4LF7 Q;  4JI8 Q;  4HJA A;  1I50 H;  3SGI A;  3J7A 5;  2GVB A;  1HNZ L;  2JA5 H;  4X64 Q;  2Q2U A;  3S17 H;  4BXX G;  4GOP A;  4A3K G;  2UUC L;  5M3M G;  4LNQ A;  2BA0 A;  1D8L A;  4DV3 L;  1GKH A;  1PH3 A;  4DUZ L;  3CC4 A;  1YHA A;  4GNX A;  2VZA A;  4DPG A;  4LF9 Q;  2OWO A;  4DR5 L;  4JI5 Q;  4JOI C;  1KAW A;  3KLW A;  4KI0 A;  3M7N A;  4OX9 Q;  2R6G A;  1XJV A;  2VQE L;  1A8V A;  3IRB A;  3K0X A;  3NEM A;  2UXB Q;  3CPW A;  1N9W A;  4GLA C;  3AYH B;  1GVP A;  1U0L A;  4LUV A;  1SRU A;  1B70 B;  1LUZ A;  5FLX c;  3M4P A;  5IYC G;  1OXT A;  4GN4 B;  4TVA B;  1Q81 C;  3FKI G;  4P74 A;  2N49 A;  4PG3 A;  4DR6 Q;  1G29 1;  1HR0 L;  1I94 Q;  4A93 H;  2VS1 A;  4DKA C;  1HNZ Q;  4X65 L;  3RLN A;  3CCV A;  1PH7 A;  3HOV H;  2DGY A;  2LXJ A;  3TEH B;  4A3M H;  1XPR A;  1VQ9 A;  3M4O H;  4A3D H;  1VQG A;  3EN2 A;  1YEZ A;  4DAM A;  4B3T L;  2B29 A;  1WYD A;  4IJL A;  1J6Q A;  2H5X A;  4DUZ Q;  1VQO A;  4DUY Q;  3HOW G;  4A3F H;  3I4M G;  2WP8 J;  4LFC L;  4LW1 A;  2CWA A;  1VQC A;  3PV0 A;  4QJF A;  4DV1 L;  1PFS A;  3CC2 A;  5JJK A;  1EOV A;  1L0W A;  3I2Z A;  4A3C G;  1EFW A;  1Q12 A;  2GVA A;  4IO9 A;  2AHO B;  5IP7 G;  1E1T A;  4AH6 A;  1BBW A;  3KJO A;  2UUA L;  2BA1 A;  4JI0 Q;  1M1K C;  4LFA L;  1Y1V H;  2IHE A;  2JA8 G;  5IWA Q;  1S3O A;  1XNQ Q;  1N33 L;  1HZ9 A;  4UY8 C;  1QZG A;  2EXD A;  1N32 Q;  4UP8 A;  3UE1 A;  2D0O A;  2MNA A;  3CCU A;  4GNX B;  3KF6 A;  4YWK A;  5C0X J;  5M5W H;  4A76 A;  3GTM H;  2OCE A;  3M3Y H;  4KHZ A;  2E5L Q;  4BY7 H;  1EIY B;  4B3T Q;  1RIP A;  2YU9 H;  2WB1 E;  4BBR G;  3MEF A;  5M3F H;  2HIV A;  5C4X G;  2VQF L;  4AIM A;  5JEA J;  3HOU G;  1Z47 A;  4L5Q A;  3L2P A;  1KRS A;  3PO3 G;  5IYD H;  2KEN A;  4LF5 Q;  2ATW A;  3I56 A;  3ER0 A;  1A63 A;  5M5Y H;  1V43 A;  2CQO A;  4RG1 A;  5GRO A;  2R7F A;  2NN6 G;  2XTI A;  4DR2 Q;  3DM3 A;  4QL5 A;  4BXX H;  1Y14 B;  3D0F A;  4HJ7 A;  2ASB A;  3F1Z A;  4DV6 Q;  1KHI A;  1GD7 A;  4A3K H;  2NVX H;  5M3M H;  4JI7 L;  4AQY L;  4PZ6 A;  4JBK A;  1KL9 A;  2PQA B;  1SMX A;  4QQB X;  4JBM A;  2I0Q A;  1UWV A;  3KDF A;  3ULJ A;  3W1G A;  3JAM c;  1HR0 W;  1TWG H;  3CCE A;  1V1Q A;  3GD7 A;  2K5V A;  4DV4 L;  1K8G A;  1HZC A;  1B7Y B;  1VQD A;  1Q46 A;  2PMZ E;  4R1J A;  2HQL A;  3PIO A;  1DGS A;  4QIW E;  5GAH C;  3A5Z B;  2Y0S G;  3F2C A;  4YY3 L;  3J81 c;  5IYC H;  1W3S A;  1J5E Q;  4A4I A;  3FKI H;  1X65 A;  3UDG A;  4MZ9 A;  3CCM A;  4JBJ A;  3STB C;  1PHJ A;  4A3B G;  4IOC A;  1Q7Y C;  3ICE A;  1E22 A;  4GKJ Q;  1WOC A;  1VCI A;  1Q1B A;  1X9N A;  4LF7 L;  4JI8 L;  1V9P A;  4C3H H;  4JI3 Q;  4JI7 Q;  3W5O A;  3FP9 A;  4ME3 A;  1HH2 P;  2BH8 A;  1CKO A;  4DV0 Q;  1P16 A;  2BH2 A;  2WB1 G;  5E7N A;  1PH1 A;  4DK6 C;  3HOW H;  3I4O A;  1SRO A;  3I4M H;  3AEV A;  2IHF A;  2GN5 A;  2FXQ A;  1JB7 A;  1XMO Q;  1EQQ A;  4LF8 Q;  1VQ8 A;  4DR4 Q;  1G6P A;  4KLK A;  3S24 A;  4LF9 L;  2IT1 A;  2YTV A;  3H0G G;  4L5T A;  4JI5 L;  4DV7 Q;  4KHP Q;  3PUW A;  4OX9 L;  5IP7 H;  3TRZ A;  4YY3 Q;  2CFM A;  4UP9 A;  4JC0 A;  4OXP A;  5GAD C;  3RN2 A;  2ZTE A;  4MNO A;  4R4I A;  4YCV A;  1YJW A;  1YHQ A;  4JV5 Q;  1C7Y A;  2JA8 H;  1QUQ A;  1QZH A;  1PYB A;  1TWA H;  4JCV E;  4AYB E;  2ZTC A;  3S2H H;  2E2J H;  3S14 H;  4DR6 L;  3M85 A;  3RLF A;  3RLO A;  2AWO A;  1TXY A;  3ULP A;  3CW2 C;  4A3C H;  1I94 L;  3KDF B;  2HT1 A;  1BBU A;  2JA5 G;  4R4O A;  2YTX A;  2YYZ A;  3J81 j;  3K8A A;  1A62 A;  4JYA Q;  4BBR H;  4DR1 Q;  1LTL A;  3KYH C;  1AE3 A;  4QY7 A;  4OWT B;  5C4X H;  4DR3 Q;  3NEL A;  3HKS A;  4DUY L;  4UPA A;  4JI6 Q;  2Z6K A;  3HOU H;  1K83 H;  3PO3 H;  3L7Z C;  5IT9 c;  1NBW A;  4BA2 I;  1M90 C;  2CWP A;  2K50 A;  2C35 B;  2VNU D;  4DR7 Q;  1EIF A;  1X6O A;  4LF6 Q;  3S2D H;  3AFQ A;  4JI0 L;  2K14 A;  1VQ4 A;  1O7I A;  2N3S A;  5IWA L;  5IYB G;  3UE0 A;  3CP0 A;  1HZA A;  2RHQ B;  1XNQ L;  4A3J G;  3CCQ A;  4PZ8 A;  4P72 A;  1HNX Q;  2ZM6 Q;  3RZD H;  1N32 L;  3J7Z C;  2DUD A;  4X66 Q;  1PYS B;  3TQY A;  3A74 A;  2E5L L;  5HGQ A;  4GOP C;  2MO1 A;  3ERS X;  3HFZ B;  2I5H A;  4NXN Q;  1SE8 A;  1EYG A;  1NY4 A;  3A5U A;  1NTG A;  5C0X I;  1XNR Q;  2OQK A;  3J80 c;  4GNX C;  4DV2 Q;  2WAQ E;  4A75 A;  4X62 Q;  4GS3 A;  4A3B H;  4IFD G;  1PH9 A;  4AYB G;  1Q86 C;  1P8L A;  5GQO A;  5LMU L;  3S16 H;  4LF5 L;  2F3I A;  3U50 C;  3K80 C;  4R4Q A;  1UEB A;  1SR3 A;  3EIV A;  4JI4 L;  5K36 G;  4GOP B;  4DR2 L;  2R93 G;  1FGU A;  1YBY A;  2K5H A;  2B63 G;  3HKZ E;  5IP9 G;  4JI1 L;  4DV6 L;  4HJ8 A;  1VQH A;  1WCM G;  4JBW A;  1KQS A;  2I5L X;  1N8R C;  2A1A A;  4IPG A;  3T1Y L;  1CUK A;  2PI2 E;  4JI2 Q;  1VQA A;  5LMN Q;  4IFD I;  3U4V A;  2YV5 A;  3PO2 G;  3OYY A;  1G51 A;  3H0G H;  3CD6 A;  1NMG A;  2HIX A;  1XPO A;  4DV5 Q;  2NVY H;  3S1N H;  1FL0 A;  2K75 A;  3PF5 A;  2R7Z G;  4IJH A;  4IPC A;  4C3J H;  5AJ3 Q;  1J5E L;  4BBS G;  1KD1 C;  1JJ2 A;  5LMU Q;  1HNW L;  1MJE A;  1OXU A;  3H3V I;  1VS0 A;  2KCT A;  3CCS A;  4HJ5 A;  4B3R L;  2YTY A;  4JI4 Q;  3AFP A;  1QVG A;  4GKJ L;  3F2D A;  4P75 A;  3GTL H;  1GO3 E;  4JI1 Q;  4XIG S;  1HJP A;  4JI3 L;  1BKB A;  3E0E A;  3T1H Q;  1OXX K;  3JAM i;  4Y7N H;  3GTK H;  4DV0 L;  3GTQ H;  3G71 A;  3T1Y Q;  1A0I A;  2NZO A;  3RNU A;  2UXC Q;  1D7Q A;  3FHW A;  3S1R H;  1K9M C;  3F2B A;  2RHS B;  1XMO L;  4LF8 L;  5FLM G;  3J81 i;  2ZJQ A;  1N34 Q;  4DR4 L;  4KHP L;  4DV7 L;  3OTO Q;  1XPU A;  3CPF A;  3E9I A;  1VQJ A;  1MJC A;  2D0P A;  4JV5 L;  4GKK L;  4H02 A;  1HNW Q;  1JJC B;  4OON A;  1IZ6 A;  5IYB H;  1VQL A;  4B3R Q;  1YVC A;  4A3J H;  5BR8 Q;  3KF6 B;  2ES2 A;  1IL2 A;  3E9H A;  1CKM A;  3HKZ G;  4YCW A;  2Q2I A;  3WWV A;  2F52 A;  4DK3 C;  2JA9 A;  1E1O A;  3B6Y A;  2PNH A;  1BVS A;  1XMQ Q;  1NJI C;  4JYA L;  4DR1 L;  2N8N A;  3K7U C;  3PGZ A;  2NZH A;  1SLJ A;  1E24 A;  4GLV B;  2E8G A;  2JA7 G;  4DR3 L;  1L1O A;  4LWC A;  5EAY A;  3PF4 A;  3HOZ G;  5ELN A;  1HZB A;  4A3I G;  1IBM Q;  4JI6 L;  3HOY G;  4Y52 H;  4YHH L;  1LM0 A;  1YJN A;  2OTJ A;  3I7F A;  4LUZ A;  2ID0 A;  1PH2 A;  4GKK Q;  3BU2 A;  4L5S A;  2UXD L;  4DR7 L;  2E2I H;  4EX5 A;  1L2F A;  4LF6 L;  2R93 H;  1YIT A;  2K4K A;  2B63 H;  3KFU A;  5IP9 H;  4K0K Q;  1OXV A;  4OWX B;  3RN5 A;  4B3S Q;  1WCM H;  4C3I H;  4RMF A;  2HHH Q;  1X54 A;  1JT8 A;  3H3V H;  5C44 G;  4IPD A;  1Y1W G;  1CSQ A;  1HNX L;  3GTP H;  4X6A H;  2ZM6 L;  3G48 A;  2K5N A;  2Z0S A;  4X66 L;  1X3E A;  4HID A;  3PUX A;  4JOI A;  3PO2 H;  4LF4 L;  2KHJ A;  3G6E A;  2UXB L;  1N36 Q;  1Q82 C;  1I6H H;  4A3G G;  2WFW A;  4LUO A;  1VQN A;  4NXN L;  3GO5 A;  3UDF A;  1PH5 A;  2ALY B;  1MKH A;  3CCL A;  1YHB A;  3PUV A;  4FDB A;  1XNR L;  1GM5 A;  2R7Z H;  2QGQ A;  4YHH Q;  2N78 A;  4BA1 I;  1L1O C;  1IBK Q;  1FJG L;  4BBS H;  1X55 A;  3VDY A;  5IY0 A;  1KRT A;  4DV2 L;  4X62 L;  1KIX A;  1Q1E A;  4IPH A;  2UXD Q;  2QA4 A;  4P71 A;  5FJ8 G;  4POF A;  4EQ5 A;  5H1S E;  3L0O A;  5C0X G;  1WJJ A;  5GAG C;  1CSP A;  2IX0 A;  3CCR A;  2VW9 A;  5HY6 A;  3U4Z A;  3S1M H;  3CAM A;  4O0A A;  2VUM G;  3RZO H;  3PIP A;  3CCJ A;  2R92 G;  4A3L G;  2MFI A;  2A19 A;  1EQR A;  1L1O B;  2AMC B;  3UDX A;  5C3E G;  2JEA I;  4IOA A;  4LF4 Q;  1PH6 A;  1YNX A;  3HOX G;  2ZJR A;  2IX1 A;  1EUJ A;  2QEX A;  4JI2 L;  5FLM H;  1I5F A;  5LMN L;  4POG A;  3U58 A;  2KHI A;  3J80 i;  4YWL A;  5JEA G;  4OWW B;  4LFB Q;  2KBN A;  1TWC H;  1QUQ B;  4PZ7 A;  4DV5 L;  1VQI A;  1PV4 A;  1FJG Q;  2OTL A;  4A3E G;  2UU9 Q;  1EWI A;  2Z6K C;  3PUZ A;  2OQ0 A;  1OTC A;  2D62 A;  4BY1 G;  4DNI A;  5AJ3 L;  1FVI A;  3KF8 B;  4B3M Q;  4NXM Q;  4UP7 A;  1X56 A;  2R7D A;  3G4S A;  1UE6 A;  1PA6 A;  1PH8 A;  5ELO A;  3DLL A;  3KJP A;  2JA6 G;  2UUC Q;  1IXR A;  4TQU S;  3NBH B;  2RF4 A;  4DV3 Q;  3T1H L;  1SFO H;  4R4T A;  2RCN A;  2JA7 H;  2AKW B;  2CKZ B;  3GTO H;  3I4N G;  2UXC L;  4DR5 Q;  2PQA A;  2LSS A;  4J15 A;  4A3I H;  1KC8 C;  1Q8K A;  3ULL A;  1K73 C;  3HOZ H;  3HOY H;  1C9O A;  3PUY A;  2VQE Q;  1VQE A;  1K3R A;  1ASY A;  2A8V A;  4NPS A;  1N34 L;  1ASZ A;  2Y0S E;  4YWM A;  1QVC A;  4MTN A;  3OTO L;  1JJG A;  1TWH H;  3LGJ A;  1R9T H;  1RL2 A;  1YIJ A;  1HR0 Q;  4APV A;  3BZC A;  2ZTD A;  3PSI A;  2L15 A;  3TRE A;  4X65 Q;  5BR8 L;  3CME A;  5C44 H;  1Y1W H;  1UE1 A;  1W2B A;  2IY5 B;  1MIU A;  1UE5 A;  5M5X H;  2XGT A; 
#chains in the Genus database with same CATH topology
 2KJX A;  4WJ3 M;  2F4V L;  1DD2 A;  5JVG 3;  2E2I B;  1YI2 A;  2FIN B;  1RKN A;  3Q6S A;  2WAQ G;  5IGD A;  2IJ0 A;  1DON A;  5FJ8 H;  4IUQ A;  1EY9 A;  1T9H A;  1YNJ C;  3D6W A;  3C46 A;  1N33 Q;  4IFD J;  1I6H B;  2PI2 A;  4A3L H;  1XX8 A;  3DWP A;  1MI2 A;  1PZI D;  2HHH L;  1LTB D;  4ME5 A;  4I7A A;  3EVQ A;  3HOU B;  4A3M G;  4A3D G;  1F2Z A;  1WTO A;  1BXT A;  1F9S A;  5JEA H;  2E76 C;  1PVO A;  1F77 A;  3T56 B;  2NN6 I;  1M8A A;  2EQS A;  1E7Z A;  2UUB L;  1LYL A;  2K05 A;  3CXC A;  2JXM B;  2XVS A;  4CJ1 B;  2I5M X;  1C0A A;  2MQH A;  4PMW A;  2BE5 D;  5IGC A;  1SJE D;  1Y1V G;  3I90 A;  2JA6 H;  1VQP A;  2Q2T A;  3F8T A;  4GLX A;  1U5K A;  1U4M A;  2WKC A;  1HHV A;  4RH6 A;  1BUV T;  3I4N H;  3WOE A;  2XWB B;  3M9B A;  4C2M H;  4DV4 Q;  3QR8 A;  1B3A A;  4A3B B;  1TWF H;  5EKL A;  2Z9H A;  3UDI A;  5M3F G;  4P73 A;  4JG2 A;  2F0F A;  5J3B A;  1CKN B;  1VQK A;  2ZJP A;  2EXZ A;  1EY7 A;  2KCM A;  4M8A A;  1HQR D;  2Q2H A;  2EYJ A;  1JWS D;  3GTG H;  1KDA A;  3I73 A;  4JI8 Q;  5DEH A;  2GVB A;  2PW5 A;  1HNZ L;  4X64 Q;  2Q2U A;  3J7A 5;  3S17 H;  1JOR A;  5C4H A;  1PLF A;  1PTO B;  3O13 A;  1EFI D;  2UUC L;  2PPB C;  4B08 A;  1D8L A;  1ET9 A;  1GKH A;  5EPL A;  4DUZ L;  1PH3 A;  4GNX A;  4DPG A;  1HA6 A;  2K03 A;  2R6G A;  2VB3 X;  3IRB A;  1KLG D;  1NSN S;  2A6H C;  1B70 B;  5LL6 S;  4GN4 B;  5M5X B;  4MTK A;  3R2I A;  5L37 A;  2VS1 A;  4G7O C;  3RLN A;  3NHH A;  2DGY A;  3TEH B;  1XPR A;  3M4O H;  4X3K A;  4C3H G;  1KDC A;  3LX0 A;  1NR2 A;  4DUY Q;  4C56 C;  4DV1 L;  2CWA A;  3PV0 A;  1MGS A;  1PFS A;  5CC4 A;  1EOV A;  3I2Z A;  4F7X A;  2NB0 A;  5CV5 A;  5T1G A;  1LAB A;  1BBW A;  5D3D A;  4KMU C;  4M1U B;  5I2X A;  2F0M A;  3HGB A;  2JA8 G;  1BNZ A;  4ZAI A;  1S3O A;  5I9P A;  1RHP A;  1QB5 D;  2Z8L A;  1HZ9 A;  1DJR D;  2EXD A;  1Q90 A;  4OO1 H;  3CRK C;  2MNA A;  3GTM H;  3M3Y H;  4KHZ A;  5FO7 B;  3AMU A;  3A8K E;  1BCP F;  1AW7 A;  2X6L A;  5EBC A;  2YU9 H;  4BBR G;  2E74 C;  4ZRZ A;  3A55 A;  2F4I A;  1D6E C;  1PXU A;  4XT1 B;  3S1Q B;  2R93 B;  5JEA J;  3HOU G;  1WCM B;  1EOT A;  4ZYS A;  2LMC B;  2ATW A;  2F1M A;  1GUN A;  2EYP A;  4L8J A;  3QIA A;  4RG1 A;  1KNE A;  2B2U A;  2NN6 G;  2R7F A;  2XTI A;  3DM3 A;  3FPP A;  4DXG A;  3BVM A;  4HJ7 A;  5JPM C;  3KUP A;  2BCO A;  2NVX H;  1QNK A;  4AQY L;  3K5M A;  4ABN A;  4JBK A;  2PQA B;  1SE3 A;  3RD4 A;  1JIC A;  3CCE A;  1TY0 A;  2K5V A;  3OWF A;  1VQD A;  4R1J A;  1ZXT A;  3PIO A;  3D4D A;  4KTA A;  3F2C A;  2IWH A;  3NTK A;  1W3S A;  4A4I A;  3FKI H;  1X65 A;  4RCN A;  4MZ9 A;  1EQT A;  2ICE C;  4A3B G;  2JP1 A;  4GKJ Q;  1WOC A;  1X9N A;  4LF7 L;  1HQM C;  4JI3 Q;  5CV7 A;  4JI7 Q;  1JQY D;  3J7Y W;  1CK1 A;  2F3V A;  4K8J A;  2BH8 A;  5IIF A;  3I4O A;  3I4M H;  2FXQ A;  4IUU A;  4LF8 Q;  1VQ8 A;  3SE0 A;  4PV1 C;  4LF9 L;  2DNC A;  1SNC A;  1ESR A;  4UP9 A;  3OIQ A;  4H44 C;  4YCV A;  3HOV B;  1LLR D;  2ZTC A;  4OEL B;  2CHB D;  3WOF A;  1SFO B;  3T4A C;  4R4O A;  2YTX A;  5E1F A;  3NWS A;  1EL0 A;  1LTL A;  2AQ1 B;  1TII D;  5KRU A;  4FXK C;  3U9S A;  1K83 H;  3PO3 H;  3L7Z C;  1NNX A;  1X3Q A;  4QUF A;  4BY7 B;  2A68 D;  4LF6 Q;  1R4P B;  4JI0 L;  3NSW A;  3A8I E;  2FMM A;  5IYB G;  1HZA A;  3DEP A;  4IUV A;  4P72 A;  4DA2 A;  1ML0 D;  1HNX Q;  2ZM6 Q;  3RZD H;  1N32 L;  2L4N A;  3A74 A;  1EZ6 A;  4GOP C;  2MO1 A;  2HCI A;  3ERS X;  3J80 c;  3TP5 A;  4A3K B;  1WVL A;  4IFD G;  1PH9 A;  2F3I A;  1ILP A;  1UEB A;  1SR3 A;  3EIV A;  5EKK A;  4JI4 L;  4DR2 L;  2R93 G;  2K5H A;  2JSO A;  4HJ8 A;  1VQH A;  1WCM G;  4KK7 A;  1SDF A;  1KQS A;  1N8R C;  1U9R A;  5I6Y A;  2PI2 E;  5LMN Q;  4HCE A;  4O1N A;  3OYY A;  1G51 A;  3H0G H;  4CKB A;  2KUM A;  1XPO A;  3J7A V;  3S1N H;  3PF5 A;  2R7Z G;  1SSO A;  4IJH A;  1DCZ A;  4C3J H;  5AJ3 Q;  4G7Z C;  1J5E L;  4BBS G;  5D14 A;  1JJ2 A;  1HNW L;  1NCV A;  1MJE A;  1OXU A;  3H3V I;  4RKL A;  1VS0 A;  3BYT B;  5CV6 A;  3G6J B;  4B3R L;  2YTY A;  5EPJ A;  1DYQ A;  4JPB W;  3FMC A;  4P75 A;  3V05 A;  4JI1 Q;  1TWF B;  1A2T A;  1BKB A;  3T1H Q;  1STG A;  4RWS C;  3GTK H;  3GTQ H;  4ID6 A;  2NZO A;  4IUR A;  3S1R H;  2DNE A;  2RHS B;  2QCP X;  5CR3 A;  5EBD A;  5FLM G;  3S14 B;  3K59 A;  1GJX A;  1KAA A;  3OTO Q;  2EVB A;  3RUZ A;  4GKK L;  1CFM A;  2DN8 A;  4N8F A;  1YVC A;  4MN3 A;  3E9H A;  4YCW A;  5C4X B;  2Q2I A;  4KHV A;  2PNH A;  5JOB A;  4H13 C;  4DR1 L;  3PGZ A;  3LNN A;  1EU3 A;  1L1O A;  5EAY A;  3TSS A;  5ELN A;  1HZB A;  5CBA E;  1Q8I A;  4Y52 H;  4YHH L;  1PTO D;  1G2T A;  2OTJ A;  3I7F A;  5D65 A;  1PH2 A;  2UXD L;  3V2T A;  2NBF A;  2E2I H;  3M4O B;  4EX5 A;  2Z6B A;  3DMU A;  4B3S Q;  4K14 A;  3WDN A;  4C3I H;  1JT8 A;  1O7Y A;  3QG1 A;  1A15 A;  1Y1W G;  4Q5V A;  1QNU A;  2Z0S A;  3VR5 A;  1I6V C;  1X3E A;  4X66 L;  1HXY D;  2KHJ A;  2R61 A;  3G6E A;  4LF4 L;  1Q82 C;  1I6H H;  2WFW A;  1VQN A;  1PH5 A;  1BCP C;  2ALY B;  1SMY C;  1YHB A;  1XNR L;  2A6E C;  2QGQ A;  4BA1 I;  3OIP A;  2V4D A;  2RKS A;  4ZQ3 A;  3DHQ A;  5FJ8 G;  3GTM B;  1EY8 A;  4RGO S;  1CT1 D;  4XQN A;  1CSP A;  2IX0 A;  1KTK A;  5DM6 3;  4A3L G;  1HA5 A;  3UDX A;  4IOA A;  3M4Y A;  1SAP A;  2ZJR A;  1VDZ A;  3GV6 A;  3PQI A;  3U58 A;  3J80 i;  5JEA G;  2NYZ D;  2KBN A;  2EY5 A;  4CGY B;  1F9R A;  1SEB D;  4DV5 L;  1FJG Q;  4K6L A;  2OTL A;  2OQ0 A;  1GOZ A;  4DNI A;  2RDG A;  4JW0 A;  5FLX E;  4HSP A;  4FF3 A;  4R8N A;  2R7D A;  4CHT B;  1BO0 A;  2JA6 G;  1IXR A;  1ZYR D;  2RF4 A;  1GHJ A;  4U68 A;  2G9D A;  4R4T A;  3SK5 A;  2CKZ B;  3I4N G;  2NWG A;  4J15 A;  2LSS A;  4A3I H;  1KC8 C;  1Q8K A;  1K73 C;  1C9O A;  2HDM A;  1VQE A;  1PTO H;  4A3J B;  2A8V A;  1ASZ A;  2L0C A;  1VF5 C;  2VB2 X;  1CZW A;  2PZW A;  4DNR B;  3G7L A;  4APV A;  2ZTD A;  4CKC A;  3TRE A;  5BR8 L;  3CME A;  3I4M B;  3E0J A;  3QOL A;  1HFG A;  1UE5 A;  5M5X H;  1VMP A;  2H4O A;  1EYD A;  4HIK A;  1OXS C;  1PMR A;  5DLQ E;  3K5O A;  1LTR D;  4LFC Q;  4R4C A;  1E3P A;  2F3W A;  4DAY B;  5AFW A;  2DJG C;  1IBM L;  1H95 A;  4EVO A;  3K81 C;  1G8Z D;  4LFA Q;  1G91 A;  2B2Y A;  3PO2 B;  1AH9 A;  1CKN A;  4X3S A;  1G2S A;  4K0K L;  3KOJ A;  4DXF A;  2R92 H;  2IW3 A;  1AP0 A;  1STH A;  1SN8 A;  3GDE A;  1S40 A;  3BJU A;  2K5W A;  1A6X A;  2NTT A;  5BN5 A;  3HRZ C;  3QWN A;  1K83 B;  3PO3 B;  5IGE A;  2NVT H;  2JE6 I;  4RGM A;  3SDZ A;  4GN3 B;  3C2P A;  2QIL A;  4A3E H;  3R3O A;  2A74 C;  4BY1 H;  1IBK L;  2Z4H A;  3CMA A;  3J81 E;  1DXM A;  1LO5 D;  1K0R A;  2F0J A;  1EIG A;  3V96 A;  1KXL A;  3S1Q H;  1IYJ B;  2P5Z X;  4XT3 B;  4X64 L;  4OHJ A;  2EIF A;  3D4R A;  1RF2 D;  4OO1 G;  4HIM A;  1UUP A;  3Q8D A;  1EEF D;  4U67 3;  1F2M A;  5IE8 A;  4KKS A;  1UE7 A;  2JEB I;  4LFB L;  2RSO A;  1CZG A;  1PFM A;  1PRT B;  4LK1 C;  3CC7 A;  2K7V A;  2CW0 C;  3NP8 A;  1NE3 A;  5JJI A;  2WB1 B;  4GN5 A;  1XTD A;  3VR6 A;  4NDX A;  3SGI A;  1STB A;  3HOY B;  3H0G B;  1EWH A;  4MHE A;  3OHX C;  3S1N B;  4DV3 L;  3HG9 A;  1TWH B;  4DR5 L;  1A3T A;  4JOI C;  1KAW A;  1XJV A;  1A8V A;  3EQL C;  2UXB Q;  1W6J A;  3CPW A;  5C44 B;  2L9H A;  4GLA C;  2O5J C;  1IKL A;  1SRU A;  2EY2 A;  3FKI G;  4PG3 A;  4DR6 Q;  1G29 1;  4KY6 A;  1CTM A;  5E3F A;  3S1R B;  4QIW B;  3J7A F;  4X65 L;  3CCV A;  1PH7 A;  3HOV H;  1ICF B;  1LTI D;  3NUC A;  1QG7 A;  1YEZ A;  1B9N A;  2J7Z A;  1WYD A;  4IJL A;  1J6Q A;  5EQ0 A;  4K2K A;  3I4M G;  5LHY 1;  1VQC A;  2LFN A;  4HED A;  1U4R A;  2GVA A;  4G57 A;  1E1T A;  2UUA L;  3K57 A;  1G6Z A;  2K04 A;  5I4D A;  3HOX B;  3DWQ A;  5IWA Q;  4DU9 A;  4ZKB B;  3MZ5 A;  4N9P A;  3BVG A;  2D0O A;  3VA7 A;  3CCU A;  4A76 A;  4BY7 H;  3K5N A;  3H3V C;  2E5L Q;  1E0B A;  4PQX A;  1CI3 M;  3MHB A;  4B3T Q;  3MXG A;  2WB1 E;  3K0Y A;  4AYB B;  1FR3 A;  3MEF A;  1VMC A;  1SYF A;  3BS1 A;  2F0I A;  4CDF C;  2QKI C;  1I4Q A;  4P2C B;  2VQF L;  3PO3 G;  1KRS A;  2KQ3 A;  5CV4 A;  4C3I B;  5IYD H;  2KEN A;  3ER0 A;  5C4J B;  1YNJ D;  2CQO A;  5GRO A;  4KD4 A;  4ZLT F;  4QL5 A;  2Q8R E;  3KLR A;  1Y14 B;  1I4R A;  4DAV A;  2ASB A;  3F1Z A;  3F2U A;  4DV6 Q;  4A3K H;  1GD7 A;  4JI7 L;  3L3O C;  3EJI A;  1K8O A;  4PZ6 A;  3BVZ A;  1KL9 A;  3GP7 A;  1SMX A;  2OF1 A;  4QQB X;  4RHR A;  4JBM A;  2I0Q A;  1UWV A;  3ULJ A;  1FYC A;  2B2T A;  3A54 A;  1V1Q A;  3KBG A;  2X6G A;  1Q46 A;  4ULL A;  4QIW E;  3VA5 A;  1I50 B;  1NR4 A;  1EEI D;  3HP3 A;  2BDO A;  4ILW A;  2EJM A;  4CDD C;  2IX3 A;  1TQO A;  1AZQ A;  2PW7 A;  2WII B;  3QOJ A;  4RKB A;  4KJO A;  1LTT D;  3HS0 C;  1CKO A;  4DV0 Q;  2WB1 G;  5E7N A;  2A5H A;  1KNA A;  2LS0 1;  1SRO A;  2F0Q A;  1B2T A;  1XMO Q;  3W3A A;  4DR4 Q;  4KLK A;  4KHP Q;  2L1B A;  4JI5 L;  1EYA A;  1U4L A;  2EDG A;  3H0G G;  4C1N K;  4DV7 Q;  4OX9 L;  5IP7 H;  3TRZ A;  1Z6H A;  4YY3 Q;  4A93 B;  1VQ5 A;  4MNO A;  1YHQ A;  5ISR A;  4C3J G;  2EZV A;  4JCV E;  4AYB E;  1K0S A;  3S14 H;  2Q8I B;  1EY0 A;  1EY6 A;  3KBX A;  3RLO A;  3RLF A;  3ULP A;  5M9O A;  2K01 A;  3CW2 C;  3NE5 B;  2CVR A;  1I94 L;  3TME A;  4A3I B;  1BBU A;  2M2L A;  1A62 A;  3TZD A;  4JYA Q;  4IUP A;  1SNO A;  4HMJ A;  4QY7 A;  4OWT B;  5C4X H;  4QF4 A;  4JI6 Q;  2WIN B;  3OW7 A;  3H6M A;  2Z6K A;  5A2Q E;  2PYK A;  4OIJ A;  4RCO A;  3Q0A A;  5IT9 c;  3I8Z A;  2K50 A;  2ICI A;  2C35 B;  1RDP D;  4DR7 Q;  3S2D H;  3N52 A;  3AFQ A;  1WTV A;  2F0U A;  2N3S A;  2K33 A;  1XNQ L;  2I46 A;  1QJO A;  1SYG A;  5JJZ A;  4F8M A;  3J7Z C;  1PYS B;  3VYR A;  3TQY A;  1Y8N B;  5KEE A;  5FK9 C;  2CQA A;  5M5Y B;  1SE8 A;  1EYG A;  3A5U A;  2OQK A;  3X3N A;  3ND8 A;  4A75 A;  4GS3 A;  4FP5 D;  5M3M B;  4K8I A;  2R92 B;  5J22 A;  4AYB G;  2WV6 D;  4KV6 A;  4N9T A;  4LF5 L;  1MD2 D;  1V1P B;  3I4L A;  1Y8O B;  5FLX L;  1TWG B;  2MUY A;  3C1F A;  2NVT B;  4JI1 L;  3OWE B;  3P7J A;  2B8G A;  4C3I G;  4A3E B;  2A1A A;  4IPG A;  1CUK A;  1AFP A;  4BY1 B;  4IFD I;  2RDH A;  3Q22 A;  3W2D A;  3CD6 A;  1JOK A;  1FNU A;  1LTA D;  1PYW D;  1KD1 C;  1JOO A;  3CCS A;  4HJ5 A;  3LWU A;  1D1I A;  1RJT A;  4IAL A;  5IGG A;  1QVG A;  2HDL A;  2F0W A;  4XIG S;  2K1B A;  1JWM D;  1D7Q A;  2L55 A;  2UXC Q;  1K9M C;  1B50 A;  3F2B A;  1S4Z A;  4DK0 A;  1N34 Q;  4ZUJ A;  3SK6 A;  1WTX A;  3CPF A;  3E9I A;  1SE2 A;  4JK1 C;  5NUC A;  1MJC A;  2D0P A;  4XYQ A;  4JV5 L;  4H02 A;  1JC7 A;  1BBX C;  1JJC B;  1SXT A;  1GUG A;  4A3J H;  3MEH A;  3WWV A;  1PRT D;  2F0S A;  3B6Y A;  4WFN 3;  3N6R A;  3VYU A;  4PNY A;  2EJF C;  5FO9 B;  2SOB A;  3K7U C;  2C5C A;  2NZH A;  1E24 A;  4GLV B;  2Z4I A;  2E8G A;  2PNR C;  4DR3 L;  4LWC A;  4A3I G;  4XDX A;  3SEB A;  2F0K A;  5KND A;  5CMD A;  4IZ8 A;  1RD9 D;  2ID0 A;  5K36 H;  1L2F A;  1EWC A;  3J81 L;  1O78 A;  2K4K A;  5CYU A;  3KFU A;  4FF4 A;  5ELD A;  4RMF A;  2HHH Q;  1SE4 A;  2Y0S B;  1Y8P B;  4K5V A;  4X6A H;  1CSQ A;  3IFD A;  2K5N A;  3PUX A;  3PO2 H;  3TBI B;  2HD3 A;  4HSV A;  2EY6 A;  4LUO A;  3PIO 3;  4NXN L;  3S16 B;  3GO5 A;  1MKH A;  3DXJ C;  3PUV A;  1D1K A;  1L1O C;  1FJG L;  1X55 A;  3VDY A;  5IY0 A;  4DV2 L;  4KN4 C;  4X62 L;  1Q1E A;  4IPH A;  2QA4 A;  1IL8 A;  3QB3 A;  4JVZ A;  3GQB A;  4UHV A;  2F0P A;  1WJJ A;  2VW9 A;  4J1M A;  4XYO A;  3CCJ A;  4FXD A;  2R92 G;  2MFI A;  2A19 A;  2AMC B;  5C4Z A;  2JEA I;  2PZT A;  1PH6 A;  2AQ2 B;  2IX1 A;  1EUJ A;  4JI2 L;  4POG A;  1I5F A;  2KHI A;  4YWL A;  1O7Z A;  3NXW A;  2D2C C;  2RCF A;  1ENC A;  1CHP D;  4PZ7 A;  2MP1 A;  4J8Q A;  4A3E G;  3GTL B;  2F0V A;  2A68 C;  4BY1 G;  2KEE A;  4DAY A;  4WOR A;  1W6K A;  2EYL A;  1WTW A;  4NMZ A;  3R2T A;  1A3V A;  3MTS A;  3I72 A;  1X56 A;  3G4S A;  4S3S A;  1UE6 A;  1PH8 A;  5ELO A;  3VR2 A;  3KJP A;  2UUC Q;  4KY7 A;  4TQU S;  1AEX A;  2I07 B;  1SNQ A;  2J4X A;  1F2L A;  3ULL A;  2ZXO A;  2F03 A;  3HOY H;  3IL8 A;  2G5D A;  1C4Q A;  1ICW A;  3T13 A;  4NPS A;  2L11 A;  1PZJ D;  2Y0S E;  4MTN A;  1TS5 A;  3L9A X;  1JJG A;  1TWH H;  1IHZ A;  2R3Z A;  3LGJ A;  2F0E A;  1MIU A;  3BZC A;  4IUN A;  2L15 A;  5HUR A;  5C44 H;  1KLU D;  5COY A;  4O42 A;  1K3B C;  4O2D A;  1XMQ L;  1QVF A;  1C48 A;  2HUG A;  1NMF A;  2JQO A;  1KDB A;  4DV1 Q;  1Z9F A;  4QMG A;  2B63 B;  2A69 D;  1X3G A;  3GTJ H;  4HCS A;  1TY2 A;  5I9O A;  1VQF A;  1HPC A;  1K8A C;  3TS0 A;  4YCU A;  1JE5 A;  5C0X H;  3STB D;  2V1C C;  5GAE C;  2VUM H;  1WFQ A;  5FO8 B;  1B8A A;  5C3E H;  3PCO B;  1WTR A;  4K2L A;  3HOV G;  3HOX H;  4XQJ A;  1IBL Q;  1CQF A;  3K7A H;  1A3U A;  4LMQ D;  1N36 L;  3NEN A;  3S2D B;  2NTS A;  1BQQ T;  1EY5 A;  2GA4 B;  1J9O A;  3BDO A;  2B3G A;  2EYF A;  1QE6 A;  1GUT A;  1YNN D;  1B9M A;  3RZO B;  3EBE A;  2EY1 A;  4L5R C;  1JMC A;  1Y69 U;  3RR5 A;  2AWN A;  1VQM A;  2NZ1 D;  3JC6 6;  4TRD A;  3C3L A;  1MBY A;  4AQY Q;  2L5T A;  2MO0 A;  4BS9 A;  5C4J H;  2EYM A;  2RVL A;  1Q3L A;  1YZ6 A;  4BY7 G;  2K52 A;  4TSS A;  1X3F A;  1PH4 A;  4OGQ C;  1I3Q H;  4RAU C;  3H15 A;  4QGU A;  3HKZ B;  1PTO C;  3K5L A;  2KCC A;  2VL6 A;  4BWG B;  1DM0 B;  2UU9 L;  3TS2 A;  4FYD A;  4OO1 I;  1FNW A;  3A8J E;  5IYD G;  4B3M L;  4DN4 M;  4NXM L;  3MXU A;  4LF7 Q;  2JA7 B;  3GTO B;  1I50 H;  3HOZ B;  1I4X A;  4GOP A;  4A3K G;  4LNQ A;  3I3C A;  5I2Y A;  2K5Q A;  4LF9 Q;  3HEJ A;  3KLW A;  3M7N A;  2RDF A;  2JN4 A;  4XQQ A;  2K5D A;  1PZK D;  2VQE L;  1TS3 A;  3K0X A;  5A2Q L;  5C3W A;  1U0L A;  4LUV A;  1LUZ A;  1OXT A;  3H91 A;  5T1I A;  1Q81 C;  1XXG A;  2WKD A;  4A3G B;  3BYY B;  2M00 A;  1HR0 L;  2PMZ B;  4A93 H;  4HTH A;  1NUC A;  1VQ9 A;  1VQG A;  4KKU A;  3EN2 A;  2FHT A;  4Z9C B;  5JPN C;  4B3T L;  2H5X A;  1VQO A;  3DM1 A;  4A3F H;  5CGK A;  2WP8 J;  4LW1 A;  2B2W C;  1UAP A;  2EJG C;  1II3 A;  1I4H A;  2X69 A;  4IO9 A;  5IP7 G;  3J80 E;  3KJO A;  4JI0 Q;  1FD7 D;  1M1K C;  1EU4 A;  4G4K A;  3D8G A;  2AQ3 B;  1N33 L;  4UY8 C;  1QZG A;  2MJ8 A;  1ZYR C;  4UP8 A;  3UE1 A;  5KNC A;  1N32 Q;  3CQZ B;  3KF6 A;  2KVM A;  4I65 A;  4YWK A;  5C0X J;  3QO2 A;  2NVQ B;  1I4G A;  2RQX A;  5CBE E;  2N88 A;  2HIV A;  3NPP A;  4EQP A;  5C4X G;  4XXE A;  1Z47 A;  4L5Q A;  1L0Y B;  2F0G A;  2KCN A;  1A63 A;  2AUJ D;  5M5Y H;  1CHQ D;  1V43 A;  1HCZ A;  5I6W A;  5KYI A;  4DR2 Q;  4BXX H;  1EYC A;  3C1E A;  2B2V C;  1KHI A;  1RTN A;  5M3M H;  1QCB D;  3P20 A;  4GZY C;  1DOM A;  1HR0 W;  3JAM c;  2F0T A;  1TWG H;  3GD7 A;  4DV4 L;  1K8G A;  4CJ0 B;  1CA5 A;  1B7Y B;  2PMZ E;  1LTS D;  1DGS A;  4DK1 A;  3CRL C;  4FF1 A;  2L12 A;  4YY3 L;  3H09 A;  5IYC H;  1J5E Q;  4KY5 A;  2OT2 A;  3SK4 A;  3UDG A;  3CCM A;  1PHJ A;  4IOC A;  1Q7Y C;  3ICE A;  1E22 A;  4F87 A;  5F2D A;  4JI8 L;  3W5O A;  2WAQ B;  3FP9 A;  4ME3 A;  1QIL A;  1PH1 A;  3HOW H;  3AEV A;  2GN5 A;  3MA2 B;  1JB7 A;  2Z1C A;  1G6P A;  2YTV A;  1OO9 B;  3PUW A;  4LAA A;  1H9M A;  4JC0 A;  4R4I A;  1YJW A;  1R4Q B;  1C7Y A;  4A3D B;  1PYB A;  1TWA H;  3OPO A;  3FDT A;  2C9O A;  1D5X C;  3M85 A;  1B53 A;  2AWO A;  1O80 A;  4A3C H;  3FVQ A;  3KDF B;  2SNS A;  2YYZ A;  1V1P A;  1Z7T A;  1V8Q A;  1AZP A;  4DR1 Q;  2PO4 A;  1AE3 A;  5COR A;  2HCC A;  3NEL A;  5KIX A;  3HKS A;  1Y1V B;  4UPA A;  4DUY L;  4F88 A;  1IW7 D;  4BA2 I;  3T51 B;  1A2U A;  3TDQ A;  3LWE A;  2XNA C;  1EIF A;  2SEB D;  1ONL A;  1VQ4 A;  3OMC A;  3K58 A;  1T5X D;  3CP0 A;  3NQI A;  4A3J G;  3CCQ A;  5KYL A;  4X66 Q;  3GTJ B;  5HGQ A;  3HFZ B;  5G3L D;  1XNR Q;  1NTG A;  3M7G A;  5C0X I;  4GNX C;  2WAQ E;  3CU7 A;  4FO2 A;  2VUM B;  2H1E A;  2ZXR A;  1PRT F;  1P8L A;  3S16 H;  5C3E B;  5ELC A;  4V19 0;  1UEA B;  3K80 C;  5K36 G;  1H9K A;  4GOP B;  3K7A B;  1FGU A;  1YBY A;  1XYI A;  4ZKC B;  4KD3 A;  4JBW A;  2CH4 A;  3CKI B;  3PO2 G;  2HIX A;  4DV5 Q;  2NVY H;  1D5Z C;  2K75 A;  3A7L A;  1LT6 D;  3H94 A;  5LMU Q;  2IL8 A;  3EFX D;  2KCT A;  3AFP A;  3A56 A;  4FNF A;  5E4X A;  1IKM A;  4GKJ L;  3GTL H;  2F0L A;  3TZU A;  1I3Q B;  3MXP A;  4JI3 L;  3E0E A;  4NKL A;  3JAM i;  3G71 A;  3QJY A;  3T1Y Q;  1LTG D;  2RSN A;  3RNU A;  1TT2 A;  2F0D A;  3FHW A;  1KAB A;  1STN A;  2JA8 B;  3S2H B;  2B8F A;  4LF8 L;  2XRQ D;  2E2J B;  2AUK A;  4V0B A;  4DGZ A;  1XPU A;  1EIH A;  3NTH A;  1SJH D;  4BBR B;  1IZ6 A;  5BR8 Q;  3KF6 B;  3MFY A;  4IQZ A;  2ES2 A;  2CH4 W;  1CKM A;  4QUC A;  2JA9 A;  2B2U C;  1HUM A;  1E1O A;  5FOB B;  4KN7 C;  1NJI C;  1E2V A;  3T53 B;  2N8N A;  1GXD C;  5IOC A;  1F9Q A;  3JAM E;  1BDO A;  3KLS X;  1IBM Q;  1CA6 A;  3HOY G;  4X3U A;  4LUZ A;  5JAV A;  3BU2 A;  4L5S A;  2XN9 C;  4LF6 L;  1LT5 D;  2BE5 C;  3HZX A;  2B63 H;  4K0K Q;  5IP9 H;  1E2Z A;  5EGT A;  1D5M C;  1X54 A;  3NK9 A;  3ITP A;  4A3F B;  5C44 G;  4IPD A;  3H3V H;  1HNX L;  3BDC A;  1D2B A;  2ZM6 L;  3ONA B;  3IAY A;  4JOI A;  5KGU A;  3VR4 A;  1RTO A;  1ESF A;  2DJF C;  3UDF A;  3CCL A;  4FDB A;  1GM5 A;  4L6T B;  2N78 A;  1IBK Q;  2G9H D;  4TKO B;  2A6H D;  5DNF A;  1SYD A;  1S5E D;  4P71 A;  4EQ5 A;  5H1S E;  2K32 A;  4UAI A;  5C0X G;  5TSS A;  5GAG C;  4J6H A;  1SBB B;  5HY6 A;  3U4Z A;  3S1M H;  3CAM A;  1GUS A;  3Q24 A;  1BCP B;  4O0A A;  2VUM G;  3PIP A;  3RZO H;  3ERO A;  1CM9 A;  2OEO A;  5JVH 3;  5C3E G;  4ODG A;  2SDF A;  1YNX A;  3SHL A;  3HOX G;  1V1O A;  2J0T D;  4RFB A;  5LMN L;  1QWY A;  4LFB Q;  2B39 A;  1TVX A;  1ENF A;  2PZU A;  1PV4 A;  4CBV A;  1EWI A;  3PUZ A;  2K28 A;  2D62 A;  5AJ3 L;  1FVI A;  3KF8 B;  4DF7 A;  3OMG A;  3VR3 A;  4Y7N B;  3DUZ A;  4UP7 A;  3U9O A;  1BF4 A;  1S5C D;  1S5F D;  5FKA C;  3DLL A;  2EYH A;  1JB3 A;  3NBH B;  4DV3 Q;  4HAE A;  3T1H L;  1HTL D;  1ILQ A;  2RCN A;  2JA7 H;  2AKW B;  3GTO H;  1PTO F;  5DM7 3;  4DR5 Q;  3HOZ H;  2DY8 A;  3PUY A;  4KKT A;  4L63 B;  3OTO L;  1H9R A;  1LT4 D;  1K28 A;  1JE4 A;  1X32 A;  2KOL A;  1TU2 B;  3J80 L;  1TR5 A;  1YIJ A;  1F2Y A;  2QDL A;  3PIP 3;  2ENB A;  4X65 Q;  3SK8 A;  3HOW B;  2M9V A;  3P1H A;  2XGT A;  3K6O A;  2XRS D;  3PMF A;  4A3G H;  1VQB A;  1WI5 A;  2EPB A;  1IBL L;  3W1B A;  1H9S B;  2JJQ A;  2QF7 A;  3ZJY C;  3UI2 A;  1TWA B;  1JOQ A;  3OW2 A;  3MXN B;  3S15 H;  1SYB A;  5CV8 A;  2UUA Q;  1M4V A;  5LMN W;  3D31 A;  4HIO A;  3GTP B;  1K8M A;  3D6C A;  4DAP A;  2QEJ C;  4K5X A;  4NW2 A;  5JJL A;  5ELB A;  4B3S L;  2CCZ A;  3MAQ A;  4A93 G;  4WJ4 A;  3BZK A;  2R7Z B;  4XTC S;  3T16 A;  4BBS B;  2A73 B;  4FVM A;  3CF5 A;  2KA7 A;  2MHV A;  2F4V Q;  2VY3 A;  5C5L A;  4YIJ A;  3TP7 A;  3M4Q A;  3CQZ H;  2NVQ H;  1F9P A;  2VQF Q;  1VQ7 A;  3A7A B;  4A3F G;  1DOK A;  2SNM A;  4WJW A;  4HJ9 A;  3A0J A;  4Q0F A;  1VQ6 A;  3IFT A;  2JK8 A;  2LKV A;  1PRT C;  3ZYY X;  4ALP A;  1XTC D;  1TWC B;  5BN4 A;  3AQQ A;  4EQN A;  2UUB Q;  1YJ9 A;  3Q23 A;  2LXK A;  1AE2 A;  1S72 A;  1C8C A;  1S5B D;  2E2H H;  1RCV D;  4NB3 A;  3I55 A;  3MC0 B;  4MIU A;  3E3X A;  4HJA A;  4BXX G;  2JA5 H;  3SR1 A;  3TP6 A;  4R9W A;  5M3M G;  2NVY B;  2BA0 A;  5C6A A;  1SYC A;  5K5P A;  3CC4 A;  1MSH A;  1YHA A;  2VZA A;  5HGT A;  2OWO A;  4RHS A;  4JI5 Q;  1R9T B;  4KI0 A;  4OX9 Q;  1DZ1 A;  1J8I A;  3NEM A;  5EPK A;  1N9W A;  1Y1W B;  1GVP A;  3AYH B;  5FLX c;  3M4P A;  1GUO A;  5IYC G;  1ROD A;  4TVA B;  1ZKO A;  5IT9 E;  4P74 A;  2N49 A;  1I94 Q;  4DKA C;  1HNZ Q;  2KEC A;  4RA8 A;  2LXJ A;  4A3M H;  4A3D H;  1HRJ A;  4DAM A;  2B29 A;  4DUZ Q;  3HOW G;  4HMI A;  4LFC L;  4QJF A;  5JJK A;  3CC2 A;  1L0W A;  1EFW A;  1Q12 A;  2AHO B;  4AH6 A;  2BA1 A;  4LFA L;  1Y1V H;  2IHE A;  5J1Z A;  1HUN A;  5CV9 A;  2VXW A;  1XNQ Q;  1EY4 A;  4LJZ C;  2EYO A;  2Q8T A;  4GNX B;  4A3C G;  5M5W H;  2OCE A;  2MGS A;  4RGN A;  1EIY B;  1RIP A;  1B1Z A;  3TP8 A;  1B4O A;  5A35 A;  5M3F H;  2DY7 A;  5EJW A;  1STY A;  4AIM A;  2JA6 B;  4NP5 A;  3L2P A;  2O5I C;  4LF5 Q;  3I56 A;  2BDN A;  3I4N B;  4DFA A;  1I4P A;  4C2M B;  3D0F A;  4R8I A;  5BN3 A;  4K5W A;  2D5D A;  1FNV A;  3MFG A;  3KDF A;  3W1G A;  5ELF A;  3FEW X;  3OSO A;  1HZC A;  2A69 C;  2HQL A;  5IGF A;  5GAH C;  3GTG B;  3A5Z B;  2BOS A;  2Y0S G;  4ZCK A;  4QB4 A;  3R93 A;  3J81 c;  3S17 B;  1SND A;  4CDC C;  3S1M B;  1X3P A;  2F0O A;  4JBJ A;  3STB C;  1WTH A;  1VCI A;  1Q1B A;  1ZEQ X;  1V9P A;  3AU7 A;  5G3L F;  2B2Y C;  4C3H H;  1HH2 P;  1T5E A;  2WAC A;  3R8B A;  1P16 A;  2XIW A;  2BH2 A;  4DK6 C;  5DAU A;  2IHF A;  3AB9 A;  1EQQ A;  2RA4 A;  4HR7 B;  3S24 A;  2IT1 A;  4L5T A;  3TN2 A;  3JAM L;  1BCP D;  2HQE A;  1SMY D;  4CJ2 C;  2A6E D;  1YNN C;  2CFM A;  5GAD C;  3RN2 A;  4OXP A;  2UXB L;  2ZTE A;  4RGT A;  4JV5 Q;  4B9W A;  3MWY W;  2JA8 H;  1QUQ A;  1QZH A;  4I7Z C;  3E6Z X;  3SVM A;  3S2H H;  4WRD A;  2E2J H;  4DR6 L;  4B9X A;  1TXY A;  1BR9 A;  2HT1 A;  3J81 j;  3K8A A;  4BBR H;  1NAP A;  1PDQ A;  3KYH C;  1QOH A;  3BDL A;  4DR3 Q;  1FGB D;  1BOS A;  4EGV A;  1S5D D;  1PFN A;  3HOU H;  1NBW A;  2EE1 A;  1M90 C;  2CWP A;  2VNU D;  2NN6 H;  1X6O A;  2MPM A;  3M3Y B;  2NUC A;  1U4P A;  2YU9 B;  2K14 A;  1O7I A;  5IWA L;  3P75 A;  3UE0 A;  2RHQ B;  4PZ8 A;  1STE A;  2DUD A;  1DOL A;  1LV9 A;  2KED A;  3S15 B;  1B44 D;  2E5L L;  3MVV A;  2N55 A;  4CDE C;  1TS2 A;  4NXN Q;  2I5H A;  1NY4 A;  5KNB A;  1WTP A;  2OXP A;  4DV2 Q;  4X62 Q;  1JR0 D;  1LAC A;  4A3B H;  2NVX B;  4DNT B;  1Q86 C;  5GQO A;  5LMU L;  5EKI A;  1STA A;  3U50 C;  4R4Q A;  1GUW A;  2B63 G;  3X3M A;  3HKZ E;  5IP9 G;  4DV6 L;  4OIK A;  2I5L X;  4OL7 A;  2ZXP A;  3T1Y L;  4JI2 Q;  1HFN A;  3FKI B;  1VQA A;  3KK7 A;  3U4V A;  1TKW B;  2YV5 A;  1NMG A;  2RBM A;  3FPU B;  2E75 C;  4G7H C;  3VYS A;  1FL0 A;  3SXH A;  4IPC A;  5IGB A;  2D9U A;  3E5S A;  1JCK B;  4JI4 Q;  3ERQ A;  4EQO A;  1PFB A;  3F2D A;  1GO3 E;  4PMB A;  3NQT A;  1HJP A;  2FMC A;  2E2D C;  1OXX K;  4Y7N H;  2LY7 A;  4DV0 L;  2XWJ B;  1A0I A;  4OEM B;  3I70 A;  1XMO L;  2E2H B;  3J81 i;  3CHB D;  4IUT A;  2ZJQ A;  4DR4 L;  4QCL A;  4KHP L;  5C5M A;  2QW7 A;  4K6D A;  4DV7 L;  1ENA A;  4E6I A;  1VQJ A;  1UNS A;  2JA5 B;  1HNW Q;  1EQV A;  4OON A;  5IOD A;  5IYB H;  1VQL A;  4B3R Q;  4PMC A;  3EA6 A;  2JYO A;  3OOC A;  1IL2 A;  3HKZ G;  2F52 A;  4DK3 C;  3NBI A;  4FXG C;  2QDB A;  5D3I B;  1BVS A;  1XMQ Q;  4JYA L;  2TSS A;  2F0H A;  3RMH A;  1SLJ A;  4ZK9 B;  4H0L C;  2JA7 G;  1H9J A;  3PF4 A;  3HOZ G;  1IYV A;  4JI6 L;  2B2T C;  5C3X A;  1O7L A;  4IFD H;  1LM0 A;  4N8X 1;  1YJN A;  2CW0 D;  2F0N A;  1LT3 D;  4GKK Q;  3RZD B;  2IPK D;  4A3M B;  4DR7 L;  1MHW C;  2R93 H;  1YIT A;  1OXV A;  4OWX B;  3RN5 A;  1WD1 A;  1WCM H;  3KF8 A;  1SYE A;  4ZUI A;  3I91 A;  3GTP H;  1TS4 A;  4C1N I;  3G48 A;  5J39 A;  4HID A;  4UDU C;  1N36 Q;  3BZD B;  3DWA A;  2O2L D;  4A3G G;  1MSG A;  3NBH A;  4X3T A;  4H7B A;  5ELE A;  2R7Z H;  4YHH Q;  4BBS H;  1KRT A;  1ET6 A;  4HN7 A;  2O4X A;  1KIX A;  4CKE A;  2UXD Q;  4POF A;  3GV3 A;  2K6A A;  5M5W B;  1SNP A;  3D4W A;  3NTI A;  3L0O A;  3IKJ A;  1WD0 A;  3CCR A;  5M3F B;  1XWE A;  4FF2 A;  3NWT A;  1EQR A;  1L1O B;  2FJ2 A;  4LF4 Q;  2PCF B;  4C3J B;  3VYT A;  3URY A;  2B2W A;  2QEX A;  5FLM H;  1JWU D;  4OWW B;  1CQV A;  1IW7 C;  3ND9 A;  1TWC H;  1H9S A;  1QUQ B;  1WTQ A;  1VQI A;  2UU9 Q;  2PQE A;  1SNM A;  2Z6K C;  1OTC A;  3MXN A;  4B3M Q;  3GTK B;  4NXM Q;  3GTQ B;  5IT9 L;  1PA6 A;  5E4W C;  3FRP B;  3KLS A;  1SFO H;  3S9W A;  3BG3 A;  1AN8 A;  2UXC L;  2PQA A;  3DEO A;  1EZ8 A;  2TMP A;  1HTP A;  2VQE Q;  2FFK B;  1K3R A;  4KJN A;  1ASY A;  1N34 L;  3D3R A;  1QVC A;  1B3Q A;  4YWM A;  2ZT9 C;  1GHK A;  4C3H B;  1IYU A;  4IN3 A;  1E2W A;  2EOT A;  2B2V A;  1RL2 A;  1R9T H;  2XSC A;  1HR0 Q;  1L0X B;  5LL6 X;  3PSI A;  2KHS A;  1Y1W H;  1UE1 A;  1W2B A;  2IY5 B;  1VF7 A;  2JA5 G; 
#chains in the Genus database with same CATH homology
 4A3G H;  1VQB A;  4O2D A;  1WI5 A;  1IBL L;  1XMQ L;  4WJ3 M;  2F4V L;  3W1B A;  4HIK A;  1QVF A;  2JJQ A;  1OXS C;  5DLQ E;  1NMF A;  2JQO A;  3ZJY C;  4LFC Q;  4DV1 Q;  1Z9F A;  3OW2 A;  1YI2 A;  4R4C A;  1E3P A;  3MXN B;  4DAY B;  3S15 H;  1X3G A;  3GTJ H;  2WAQ G;  1IBM L;  1H95 A;  2UUA Q;  5FJ8 H;  3K81 C;  1VQF A;  1K8A C;  5LMN W;  3D31 A;  4HIO A;  4LFA Q;  3TS0 A;  4YCU A;  1JE5 A;  1T9H A;  3STB D;  1N33 Q;  1CKN A;  4IFD J;  1AH9 A;  2V1C C;  2PI2 A;  5GAE C;  4K0K L;  2VUM H;  4A3L H;  1WFQ A;  5JJL A;  3KOJ A;  4B3S L;  2R92 H;  1B8A A;  2CCZ A;  4A93 G;  1SN8 A;  5C3E H;  2HHH L;  3PCO B;  4WJ4 A;  3BZK A;  3GDE A;  3BJU A;  4XTC S;  1S40 A;  3HOV G;  3HOX H;  3CF5 A;  4A3M G;  1IBL Q;  4A3D G;  3K7A H;  2F4V Q;  1PVO A;  1N36 L;  2NVT H;  2JE6 I;  2VY3 A;  3NEN A;  2NN6 I;  3M4Q A;  4GN3 B;  2EQS A;  1E7Z A;  3CQZ H;  2UUB L;  2NVQ H;  2VQF Q;  4A3E H;  1LYL A;  4A3F G;  1VQ7 A;  2B3G A;  4BY1 H;  1IBK L;  3CXC A;  4HJ9 A;  2I5M X;  3A0J A;  3CMA A;  1C0A A;  3EBE A;  1VQ6 A;  4L5R C;  2JK8 A;  2MQH A;  1K0R A;  4PMW A;  1JMC A;  1KXL A;  3S1Q H;  1IYJ B;  1Y1V G;  3RR5 A;  2AWN A;  1VQM A;  2JA6 H;  3JC6 6;  1VQP A;  4AQY Q;  4X64 L;  2Q2T A;  3F8T A;  2EIF A;  4ALP A;  2MO0 A;  1U5K A;  4GLX A;  1VQ5 A;  5C4J H;  4OO1 G;  4HIM A;  3Q8D A;  3I4N H;  1YZ6 A;  4BY7 G;  3M9B A;  2K52 A;  5IE8 A;  4C2M H;  4DV4 Q;  1X3F A;  1PH4 A;  1I3Q H;  3AQQ A;  1TWF H;  1UE7 A;  2JEB I;  3H15 A;  4QGU A;  3UDI A;  2UUB Q;  5M3F G;  4LFB L;  1YJ9 A;  4P73 A;  4JG2 A;  3CC7 A;  2LXK A;  2VL6 A;  5J3B A;  1CKN B;  1VQK A;  2ZJP A;  1AE2 A;  1S72 A;  2KCM A;  1NE3 A;  2UU9 L;  3TS2 A;  2E2H H;  4OO1 I;  5JJI A;  4GN5 A;  4NB3 A;  5IYD G;  2Q2H A;  3I55 A;  4B3M L;  1XTD A;  4NXM L;  3GTG H;  4LF7 Q;  4JI8 Q;  4HJA A;  1I50 H;  3SGI A;  3J7A 5;  2GVB A;  1HNZ L;  2JA5 H;  4X64 Q;  2Q2U A;  3S17 H;  4BXX G;  4GOP A;  4A3K G;  2UUC L;  5M3M G;  4LNQ A;  2BA0 A;  1D8L A;  4DV3 L;  1GKH A;  1PH3 A;  4DUZ L;  3CC4 A;  1YHA A;  4GNX A;  2VZA A;  4DPG A;  4LF9 Q;  2OWO A;  4DR5 L;  4JI5 Q;  4JOI C;  1KAW A;  3KLW A;  4KI0 A;  3M7N A;  4OX9 Q;  2R6G A;  1XJV A;  2VQE L;  1A8V A;  3IRB A;  3K0X A;  3NEM A;  2UXB Q;  3CPW A;  1N9W A;  4GLA C;  3AYH B;  1GVP A;  1U0L A;  4LUV A;  1SRU A;  1B70 B;  1LUZ A;  5FLX c;  3M4P A;  5IYC G;  1OXT A;  4GN4 B;  4TVA B;  1Q81 C;  3FKI G;  4P74 A;  2N49 A;  4PG3 A;  4DR6 Q;  1G29 1;  1HR0 L;  1I94 Q;  4A93 H;  2VS1 A;  4DKA C;  1HNZ Q;  4X65 L;  3RLN A;  3CCV A;  1PH7 A;  3HOV H;  2DGY A;  2LXJ A;  3TEH B;  4A3M H;  1XPR A;  1VQ9 A;  3M4O H;  4A3D H;  1VQG A;  3EN2 A;  1YEZ A;  4DAM A;  4B3T L;  2B29 A;  1WYD A;  4IJL A;  1J6Q A;  2H5X A;  4DUZ Q;  1VQO A;  4DUY Q;  3HOW G;  4A3F H;  3I4M G;  2WP8 J;  4LFC L;  4LW1 A;  2CWA A;  1VQC A;  3PV0 A;  4QJF A;  4DV1 L;  1PFS A;  3CC2 A;  5JJK A;  1EOV A;  1L0W A;  3I2Z A;  4A3C G;  1EFW A;  1Q12 A;  2GVA A;  4IO9 A;  2AHO B;  5IP7 G;  1E1T A;  4AH6 A;  1BBW A;  3KJO A;  2UUA L;  2BA1 A;  4JI0 Q;  1M1K C;  4LFA L;  1Y1V H;  2IHE A;  2JA8 G;  5IWA Q;  1S3O A;  1XNQ Q;  1N33 L;  1HZ9 A;  4UY8 C;  1QZG A;  2EXD A;  1N32 Q;  4UP8 A;  3UE1 A;  2D0O A;  2MNA A;  3CCU A;  4GNX B;  3KF6 A;  4YWK A;  5C0X J;  5M5W H;  4A76 A;  3GTM H;  2OCE A;  3M3Y H;  4KHZ A;  2E5L Q;  4BY7 H;  1EIY B;  4B3T Q;  1RIP A;  2YU9 H;  2WB1 E;  4BBR G;  3MEF A;  5M3F H;  2HIV A;  5C4X G;  2VQF L;  4AIM A;  5JEA J;  3HOU G;  1Z47 A;  4L5Q A;  3L2P A;  1KRS A;  3PO3 G;  5IYD H;  2KEN A;  4LF5 Q;  2ATW A;  3I56 A;  3ER0 A;  1A63 A;  5M5Y H;  1V43 A;  2CQO A;  4RG1 A;  5GRO A;  2R7F A;  2NN6 G;  2XTI A;  4DR2 Q;  3DM3 A;  4QL5 A;  4BXX H;  1Y14 B;  3D0F A;  4HJ7 A;  2ASB A;  3F1Z A;  4DV6 Q;  1KHI A;  1GD7 A;  4A3K H;  2NVX H;  5M3M H;  4JI7 L;  4AQY L;  4PZ6 A;  4JBK A;  1KL9 A;  2PQA B;  1SMX A;  4QQB X;  4JBM A;  2I0Q A;  1UWV A;  3KDF A;  3ULJ A;  3W1G A;  3JAM c;  1HR0 W;  1TWG H;  3CCE A;  1V1Q A;  3GD7 A;  2K5V A;  4DV4 L;  1K8G A;  1HZC A;  1B7Y B;  1VQD A;  1Q46 A;  2PMZ E;  4R1J A;  2HQL A;  3PIO A;  1DGS A;  4QIW E;  5GAH C;  3A5Z B;  2Y0S G;  3F2C A;  4YY3 L;  3J81 c;  5IYC H;  1W3S A;  1J5E Q;  4A4I A;  3FKI H;  1X65 A;  3UDG A;  4MZ9 A;  3CCM A;  4JBJ A;  3STB C;  1PHJ A;  4A3B G;  4IOC A;  1Q7Y C;  3ICE A;  1E22 A;  4GKJ Q;  1WOC A;  1VCI A;  1Q1B A;  1X9N A;  4LF7 L;  4JI8 L;  1V9P A;  4C3H H;  4JI3 Q;  4JI7 Q;  3W5O A;  3FP9 A;  4ME3 A;  1HH2 P;  2BH8 A;  1CKO A;  4DV0 Q;  1P16 A;  2BH2 A;  2WB1 G;  5E7N A;  1PH1 A;  4DK6 C;  3HOW H;  3I4O A;  1SRO A;  3I4M H;  3AEV A;  2IHF A;  2GN5 A;  2FXQ A;  1JB7 A;  1XMO Q;  1EQQ A;  4LF8 Q;  1VQ8 A;  4DR4 Q;  1G6P A;  4KLK A;  3S24 A;  4LF9 L;  2IT1 A;  2YTV A;  3H0G G;  4L5T A;  4JI5 L;  4DV7 Q;  4KHP Q;  3PUW A;  4OX9 L;  5IP7 H;  3TRZ A;  4YY3 Q;  2CFM A;  4UP9 A;  4JC0 A;  4OXP A;  5GAD C;  3RN2 A;  2ZTE A;  4MNO A;  4R4I A;  4YCV A;  1YJW A;  1YHQ A;  4JV5 Q;  1C7Y A;  2JA8 H;  1QUQ A;  1QZH A;  1PYB A;  1TWA H;  4JCV E;  4AYB E;  2ZTC A;  3S2H H;  2E2J H;  3S14 H;  4DR6 L;  3M85 A;  3RLF A;  3RLO A;  2AWO A;  1TXY A;  3ULP A;  3CW2 C;  4A3C H;  1I94 L;  3KDF B;  2HT1 A;  1BBU A;  2JA5 G;  4R4O A;  2YTX A;  2YYZ A;  3J81 j;  3K8A A;  1A62 A;  4JYA Q;  4BBR H;  4DR1 Q;  1LTL A;  3KYH C;  1AE3 A;  4QY7 A;  4OWT B;  5C4X H;  4DR3 Q;  3NEL A;  3HKS A;  4DUY L;  4UPA A;  4JI6 Q;  2Z6K A;  3HOU H;  1K83 H;  3PO3 H;  3L7Z C;  5IT9 c;  1NBW A;  4BA2 I;  1M90 C;  2CWP A;  2K50 A;  2C35 B;  2VNU D;  4DR7 Q;  1EIF A;  1X6O A;  4LF6 Q;  3S2D H;  3AFQ A;  4JI0 L;  2K14 A;  1VQ4 A;  1O7I A;  2N3S A;  5IWA L;  5IYB G;  3UE0 A;  3CP0 A;  1HZA A;  2RHQ B;  1XNQ L;  4A3J G;  3CCQ A;  4PZ8 A;  4P72 A;  1HNX Q;  2ZM6 Q;  3RZD H;  1N32 L;  3J7Z C;  2DUD A;  4X66 Q;  1PYS B;  3TQY A;  3A74 A;  2E5L L;  5HGQ A;  4GOP C;  2MO1 A;  3ERS X;  3HFZ B;  2I5H A;  4NXN Q;  1SE8 A;  1EYG A;  1NY4 A;  3A5U A;  1NTG A;  5C0X I;  1XNR Q;  2OQK A;  3J80 c;  4GNX C;  4DV2 Q;  2WAQ E;  4A75 A;  4X62 Q;  4GS3 A;  4A3B H;  4IFD G;  1PH9 A;  4AYB G;  1Q86 C;  1P8L A;  5GQO A;  5LMU L;  3S16 H;  4LF5 L;  2F3I A;  3U50 C;  3K80 C;  4R4Q A;  1UEB A;  1SR3 A;  3EIV A;  4JI4 L;  5K36 G;  4GOP B;  4DR2 L;  2R93 G;  1FGU A;  1YBY A;  2K5H A;  2B63 G;  3HKZ E;  5IP9 G;  4JI1 L;  4DV6 L;  4HJ8 A;  1VQH A;  1WCM G;  4JBW A;  1KQS A;  2I5L X;  1N8R C;  2A1A A;  4IPG A;  3T1Y L;  1CUK A;  2PI2 E;  4JI2 Q;  1VQA A;  5LMN Q;  4IFD I;  3U4V A;  2YV5 A;  3PO2 G;  3OYY A;  1G51 A;  3H0G H;  3CD6 A;  1NMG A;  2HIX A;  1XPO A;  4DV5 Q;  2NVY H;  3S1N H;  1FL0 A;  2K75 A;  3PF5 A;  2R7Z G;  4IJH A;  4IPC A;  4C3J H;  5AJ3 Q;  1J5E L;  4BBS G;  1KD1 C;  1JJ2 A;  5LMU Q;  1HNW L;  1MJE A;  1OXU A;  3H3V I;  1VS0 A;  2KCT A;  3CCS A;  4HJ5 A;  4B3R L;  2YTY A;  4JI4 Q;  3AFP A;  1QVG A;  4GKJ L;  3F2D A;  4P75 A;  3GTL H;  1GO3 E;  4JI1 Q;  4XIG S;  1HJP A;  4JI3 L;  1BKB A;  3E0E A;  3T1H Q;  1OXX K;  3JAM i;  4Y7N H;  3GTK H;  4DV0 L;  3GTQ H;  3G71 A;  3T1Y Q;  1A0I A;  2NZO A;  3RNU A;  2UXC Q;  1D7Q A;  3FHW A;  3S1R H;  1K9M C;  3F2B A;  2RHS B;  1XMO L;  4LF8 L;  5FLM G;  3J81 i;  2ZJQ A;  1N34 Q;  4DR4 L;  4KHP L;  4DV7 L;  3OTO Q;  1XPU A;  3CPF A;  3E9I A;  1VQJ A;  1MJC A;  2D0P A;  4JV5 L;  4GKK L;  4H02 A;  1HNW Q;  1JJC B;  4OON A;  1IZ6 A;  5IYB H;  1VQL A;  4B3R Q;  1YVC A;  4A3J H;  5BR8 Q;  3KF6 B;  2ES2 A;  1IL2 A;  3E9H A;  1CKM A;  3HKZ G;  4YCW A;  2Q2I A;  3WWV A;  2F52 A;  4DK3 C;  2JA9 A;  1E1O A;  3B6Y A;  2PNH A;  1BVS A;  1XMQ Q;  1NJI C;  4JYA L;  4DR1 L;  2N8N A;  3K7U C;  3PGZ A;  2NZH A;  1SLJ A;  1E24 A;  4GLV B;  2E8G A;  2JA7 G;  4DR3 L;  1L1O A;  4LWC A;  5EAY A;  3PF4 A;  3HOZ G;  5ELN A;  1HZB A;  4A3I G;  1IBM Q;  4JI6 L;  3HOY G;  4Y52 H;  4YHH L;  1LM0 A;  1YJN A;  2OTJ A;  3I7F A;  4LUZ A;  2ID0 A;  1PH2 A;  4GKK Q;  3BU2 A;  4L5S A;  2UXD L;  4DR7 L;  2E2I H;  4EX5 A;  1L2F A;  4LF6 L;  2R93 H;  1YIT A;  2K4K A;  2B63 H;  3KFU A;  5IP9 H;  4K0K Q;  1OXV A;  4OWX B;  3RN5 A;  4B3S Q;  1WCM H;  4C3I H;  4RMF A;  2HHH Q;  1X54 A;  1JT8 A;  3H3V H;  5C44 G;  4IPD A;  1Y1W G;  1CSQ A;  1HNX L;  3GTP H;  4X6A H;  2ZM6 L;  3G48 A;  2K5N A;  2Z0S A;  4X66 L;  1X3E A;  4HID A;  3PUX A;  4JOI A;  3PO2 H;  4LF4 L;  2KHJ A;  3G6E A;  2UXB L;  1N36 Q;  1Q82 C;  1I6H H;  4A3G G;  2WFW A;  4LUO A;  1VQN A;  4NXN L;  3GO5 A;  3UDF A;  1PH5 A;  2ALY B;  1MKH A;  3CCL A;  1YHB A;  3PUV A;  4FDB A;  1XNR L;  1GM5 A;  2R7Z H;  2QGQ A;  4YHH Q;  2N78 A;  4BA1 I;  1L1O C;  1IBK Q;  1FJG L;  4BBS H;  1X55 A;  3VDY A;  5IY0 A;  1KRT A;  4DV2 L;  4X62 L;  1KIX A;  1Q1E A;  4IPH A;  2UXD Q;  2QA4 A;  4P71 A;  5FJ8 G;  4POF A;  4EQ5 A;  5H1S E;  3L0O A;  5C0X G;  1WJJ A;  5GAG C;  1CSP A;  2IX0 A;  3CCR A;  2VW9 A;  5HY6 A;  3U4Z A;  3S1M H;  3CAM A;  4O0A A;  2VUM G;  3RZO H;  3PIP A;  3CCJ A;  2R92 G;  4A3L G;  2MFI A;  2A19 A;  1EQR A;  1L1O B;  2AMC B;  3UDX A;  5C3E G;  2JEA I;  4IOA A;  4LF4 Q;  1PH6 A;  1YNX A;  3HOX G;  2ZJR A;  2IX1 A;  1EUJ A;  2QEX A;  4JI2 L;  5FLM H;  1I5F A;  5LMN L;  4POG A;  3U58 A;  2KHI A;  3J80 i;  4YWL A;  5JEA G;  4OWW B;  4LFB Q;  2KBN A;  1TWC H;  1QUQ B;  4PZ7 A;  4DV5 L;  1VQI A;  1PV4 A;  1FJG Q;  2OTL A;  4A3E G;  2UU9 Q;  1EWI A;  2Z6K C;  3PUZ A;  2OQ0 A;  1OTC A;  2D62 A;  4BY1 G;  4DNI A;  5AJ3 L;  1FVI A;  3KF8 B;  4B3M Q;  4NXM Q;  4UP7 A;  1X56 A;  2R7D A;  3G4S A;  1UE6 A;  1PA6 A;  1PH8 A;  5ELO A;  3DLL A;  3KJP A;  2JA6 G;  2UUC Q;  1IXR A;  4TQU S;  3NBH B;  2RF4 A;  4DV3 Q;  3T1H L;  1SFO H;  4R4T A;  2RCN A;  2JA7 H;  2AKW B;  2CKZ B;  3GTO H;  3I4N G;  2UXC L;  4DR5 Q;  2PQA A;  2LSS A;  4J15 A;  4A3I H;  1KC8 C;  1Q8K A;  3ULL A;  1K73 C;  3HOZ H;  3HOY H;  1C9O A;  3PUY A;  2VQE Q;  1VQE A;  1K3R A;  1ASY A;  2A8V A;  4NPS A;  1N34 L;  1ASZ A;  2Y0S E;  4YWM A;  1QVC A;  4MTN A;  3OTO L;  1JJG A;  1TWH H;  3LGJ A;  1R9T H;  1RL2 A;  1YIJ A;  1HR0 Q;  4APV A;  3BZC A;  2ZTD A;  3PSI A;  2L15 A;  3TRE A;  4X65 Q;  5BR8 L;  3CME A;  5C44 H;  1Y1W H;  1UE1 A;  1W2B A;  2IY5 B;  1MIU A;  1UE5 A;  5M5X H;  2XGT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...