2CWPA

Crystal structure of metrs related protein from pyrococcus horikoshii
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
109
structure length
109
Chain Sequence
MELYDVDEFWKFQMKVGLVKKAEKIKRTKKLIKLIVDFGNEERTIVTGIADQIPPEELEGKKFIFVVNLKPKKFSGVESQGMLILAETEDGKVYLIPVPEEVPVGARVW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MetRS related protein
publication title Crystal structure of MetRS related protein from Pyrococcus horikoshii
rcsb
source organism Pyrococcus horikoshii
molecule tags Ligase
total genus 22
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2005-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01588 tRNA_bind Putative tRNA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2cwpA00
2UXDL 1VQBA 4YY3L 2UUCQ 1SN8A 3OTOL 2KHIA 1C9OA 5C0XI 4A3DH 3CCQA 1AH9A 2A1AA 1VQCA 1HZBA 1SFOH 3CPFA 1Q81C 3FHWA 1HR0L 4DR4Q 4B3MQ 2YV5A 5GADC 1KXLA 1K8AC 4QIWE 3U58A 2I5HA 2A19A 4LFCQ 1HNZL 3J80i 4AH6A 2CCZA 3BZKA 2KHJA 2N78A 2NN6I 4DUZQ 5C44H 1GM5A 4ALPA 2LXJA 3G48A 3HOWG 4EQ5A 1YVCA 3AEVA 1WJJA 2GVBA 2CKZB 1J6QA 1OXSC 3K7UC 3BJUA 2VQEL 4JYAL 1NMFA 4O2DA 1KQSA 2ZJPA 3KF6B 2CWAA 3E0EA 4R4TA 3UE1A 3J80c 1YJ9A 4NXNL 4R4QA 4GKJQ 3TQYA 4OO1I 4IFDI 4XTCS 3ICEA 5C0XG 2EXDA 5BR8L 2NZHA 1K8GA 2UUBQ 4A3DG 1VQ7A 4LF8L 4IPGA 4IO9A 1OXUA 4A3MG 3I4NG 1O7IA 1R9TH 2MFIA 2ASBA 5AJ3L 2NVXH 1HNWQ 3RNUA 2Q2UA 4QGUA 4JOIC 4ME3A 2R92G 1S3OA 2VY3A 3FKIG 1VQKA 3GTMH 3I4MH 1N36L 3I2ZA 3MEFA 2K4KA 2UXDQ 4DR6L 1L1OC 1WCMH 3I55A 3S1QH 1B7YB 3HKZG 3KOJA 4P71A 1I94L 3IRBA 1E24A 3M4QA 4YCVA 5C44G 4OWXB 4JG2A 1ASZA 4BXXH 2V1CC 4DUYQ 4HIDA 2AHOB 1JJGA 4DV6Q 1VQAA 3GTLH 4NXMQ 2Z6KA 5C4XG 3NEMA 4IFDG 3A74A 3E9IA 1YI2A 4IJLA 5J3BA 2B63H 3JAMi 1OXVA 4DPGA 5IP7G 1M90C 2UU9Q 5JJLA 3GO5A 3CCJA 4JYAQ 3RN2A 3G71A 4A3FH 1V9PA 3NBHB 1VQHA 1XTDA 3CXCA 3UDFA 2UXBL 3B6YA 3CW2C 1JE5A 1V1QA 2OCEA 3U50C 1XPRA 3S16H 4H02A 4FDBA 4MTNA 1EUJA 5BR8Q 2HQLA 2HIVA 3JAMc 4QJFA 3TREA 5M5XH 1Y1VH 2OWOA 1QVFA 3PUYA 3KYHC 4A93H 4X6AH 1I6HH 4APVA 2E5LL 4OONA 4LF5Q 5AJ3Q 1EIFA 4DR1L 1X3EA 3I4OA 2K5VA 4AQYL 3CPWA 1VQMA 1Q82C 2RCNA 2GN5A 4GOPC 4KHPL 2WP8J 5JEAJ 2JEAI 3GDEA 4DV1L 1NJIC 3MXNB 4DR6Q 4B3SQ 3T1HL 1CUKA 2UUCL 4AYBG 3K0XA 1KHIA 1PH2A 2E2IH 2B63G 3S15H 3EN2A 4JI8Q 1XNQL 3J81i 1IBLQ 2PQAA 4MNOA 1CKOA 1KAWA 1PH7A 4P75A 4X65L 4B3ML 2MO1A 4LF7Q 4DR4L 3CQZH 2CFMA 2KCMA 2WFWA 3L7ZC 1TWFH 1VQPA 3RLFA 2IY5B 2JA7G 1XPOA 3KFUA 1NMGA 1KIXA 1A62A 2K14A 3J81c 4DUZL 4Y7NH 1D7QA 3CAMA 3CP0A 1YJWA 2R7ZG 4JBJA 2ZM6Q 5M5YH 3RN5A 2H5XA 4YWLA 4JI5Q 1QUQB 3PO2H 4J15A 1SROA 4HJ5A 2UUAQ 3GTOH 4KHZA 3ULJA 3PCOB 1KC8C 3F2BA 2E2HH 4GLXA 4LUZA 4A3LH 3HKSA 3CCRA 2IHFA 1LYLA 2UUBL 3T1YQ 3W5OA 2E2JH 2K52A 1UE7A 5GQOA 3CCMA 3S14H 4JCVE 1EFWA 1HNWL 1E3PA 1NTGA 3M9BA 4JI1Q 5LMNL 2VW9A 4LF6Q 1ASYA 4DR2Q 3K81C 2EIFA 2BH8A 4GNXB 3PUWA 1XJVA 2Z0SA 1XNQQ 2IT1A 1YJNA 1SE8A 1X3FA 5IE8A 4K0KQ 2KCTA 2I5MX 4A3MH 3I4NH 4C2MH 4YHHL 4X65Q 1U0LA 1NY4A 5K36G 1YNXA 5IY0A 4DUYL 3PO2G 2R92H 3FKIH 1QVGA 2VS1A 3J7A5 1X56A 4DV6L 5M3FG 4AIMA 2D0OA 4NXML 1RL2A 4A3LG 4GN3B 3RZOH 4BBSG 3PGZA 3PIPA 3A5UA 2UU9L 1JB7A 1J5EL 3HOXH 3SGIA 1UE1A 4Y52H 1NE3A 1Q8KA 1X54A 2K5HA 3F1ZA 1LTLA 2N3SA 2YTXA 3J81j 4JI0L 1B8AA 3F8TA 1VQOA 2A8VA 5C4XH 4BA2I 4OXPA 1YHBA 4GLAC 5EAYA 2LXKA 1FGUA 1K83H 1AE2A 3NELA 3BZCA 5C4JH 3GTJH 2ZJRA 4PZ6A 1Y1WH 1VQ9A 3RLOA 2CQOA 4IPCA 2BH2A 1A8VA 4DAYB 4DV7L 5IP7H 1FJGL 3M4OH 1QZGA 2F3IA 4POFA 2JA5G 1VQNA 4DV2Q 4GOPA 1Q86C 3S1MH 3AFQA 1AE3A 2I5LX 4LF5L 2ZJQA 2R93G 5LMNQ 1VQIA 3PO3H 4HJAA 2PMZE 3I7FA 5C0XJ 1PH9A 2JK8A 4GN4B 4HJ8A 1HZCA 3PF5A 3NENA 1UEBA 2Q2IA 1X9NA 4B3SL 2B3GA 2YYZA 1T9HA 4OWTB 1N34Q 3H0GH 4JI8L 2WB1E 4PZ8A 1N9WA 1Z9FA 4YHHQ 1IBLL 3STBD 3HOUG 3HOXG 1B70B 3F2DA 2E8GA 3D0FA 3PSIA 1IL2A 2RHSB 2KBNA 4L5SA 4LF7L 1XPUA 2VZAA 1Y14B 4GNXC 2JE6I 4HIKA 1P8LA 2OQKA 4WJ3M 3ULPA 1CKNA 3I4MG 2Y0SE 1WYDA 1VQGA 2AWOA 1SLJA 2KENA 4A4IA 1Y1WG 4A3JH 5IYBG 2K50A 1HZ9A 1IYJB 2ALYB 3PUZA 5GAEC 3I56A 1J5EQ 1PYSB 5FLXc 1C7YA 2ZM6L 2PNHA 3KDFA 2EQSA 2PI2E 3EBEA 4LW1A 4JI0Q 3PO3G 3CMAA 3HOZG 4PZ7A 4JI5L 4IFDJ 1SRUA 3GTQH 1P16A 2LSSA 3FP9A 1HH2P 4P73A 1PA6A 2UUAL 3UDGA 1HNXL 2JA7H 1M1KC 2R6GA 3TRZA 1IBKL 4B3TL 4DV7Q 1FJGQ 4DNIA 3H0GG 2WAQE 3T1YL 4P72A 2R7ZH 3K80C 5M5WH 5GAHC 3M7NA 1JJCB 1GO3E 4GS3A 1I3QH 4X62Q 2NZOA 2XTIA 2BA0A 4L5RC 1Q7YC 4JI3L 2JJQA 4JI1L 1PFSA 1YZ6A 3UE0A 4DK6C 2B29A 4LF6L 3PF4A 4DR2L 1X6OA 2OTLA 4JI7Q 2F52A 2QA4A 1OTCA 2K5NA 4A3JG 2D0PA 2F4VL 2I0QA 2Q2TA 3M4PA 4DR7Q 3L0OA 3A5ZB 1PHJA 1BBWA 1HJPA 3KF8B 4JBMA 3S17H 2JEBI 1E22A 1GD7A 2JA9A 1U5KA 3CCSA 1W2BA 4LUVA 2VQFQ 2RHQB 5LMNW 5HY6A 4XIGS 4DV0Q 1VQ4A 4A76A 4A75A 1XNRQ 4C3IH 2YTYA 1G6PA 4DV5Q 4EX5A 4A3KH 2PQAB 1K0RA 3F2CA 4GN5A 3RLNA 4A3BH 3UDIA 2OTJA 2VL6A 2CWPA 1H95A 1X65A 4LWCA 3W1BA 1HNXQ 1VCIA 5M3FH 1IBKQ 4QL5A 3CMEA 4B3TQ 4YCWA 5JJIA 4DV3L 4JI2L 5IP9G 4BBSH 1A0IA 1G291 5E7NA 1KD1C 4A3CH 1VQLA 3L2PA 4JOIA 1JT8A 4DV2L 1PH1A 1TWAH 4GKKQ 1Z47A 2Z6KC 4P74A 2JA6H 4L5QA 1L1OA 4JI3Q 5M3MG 1XMOL 1UE6A 2D62A 1SR3A 5IYCG 5C3EH 3CC2A 2MQHA 3S2HH 1VQJA 4DR5Q 4JI6L 2Q2HA 4A3GH 2F4VQ 2JA5H 1CKMA 1L0WA 3RR5A 1N34L 1FL0A 4A3KG 1VQ5A 1JMCA 1K73C 1KRSA 3HKZE 1TWGH 3M85A 4A3BG 4X66L 4LFBQ 2R93H 2ES2A 1G51A 2HT1A 4UP8A 3G4SA 1PH6A 1SMXA 1L2FA 1IXRA 1VQFA 4A3EG 2VUMH 1PVOA 3PUXA 4NPSA 3S1RH 2IX1A 3H3VH 4LFAL 3H3VI 1N32Q 2QEXA 3HOUH 2XGTA 4A3CG 1MJCA 4HIOA 2AMCB 2R7DA 4X64Q 2QGQA 4JI4Q 4A3IG 2JA6G 1KL9A 1VQEA 1UWVA 4HJ9A 1A63A 4JBWA 4JC0A 3S24A 3ULLA 3U4VA 2UXCQ 1WFQA 5C3EG 1I50H 4DV3Q 4JI2Q 5IYDH 4IOAA 1CSPA 3KF6A 5IYBH 4A3GG 4BY1G 4WJ4A 1PH5A 2MO0A 4UY8C 1MJEA 4KLKA 4X62L 1XMOQ 3HOZH 2K75A 2VUMG 1PH3A 4DR3Q 4PMWA 3AYHB 4TQUS 1NBWA 5DLQE 3TEHB 1EOVA 4JI6Q 2JA8G 1IBMQ 3ER0A 1XMQQ 4JI7L 4R1JA 2ZTDA 3M3YH 1YBYA 1E1TA 2MNAA 4GOPB 1EQQA 4LF4L 3K8AA 4B3RQ 4X66Q 1YITA 5IWAQ 4AYBE 4DR7L 5ELNA 1EWIA 1N33L 2PI2A 4KI0A 1EIYB 4OWWB 2VQFL 3E9HA 3CC7A 1PYBA 5GROA 4BBRH 2N49A 4L5TA 4DV0L 4IOCA 4LFAQ 1X55A 3HOYH 5JJKA 5IYDG 4TVAB 1VQ8A 1HZAA 1XNRL 1VS0A 2NVYH 2AWNA 4YY3Q 4DV5L 3ERSX 2L15A 3OTOQ 1YIJA 1S72A 1E7ZA 3S1NH 5GAGC 3BU2A 4IJHA 4LF9L 2AKWB 2NN6G 1Q46A 4BY7H 3H15A 1HR0Q 1MIUA 4QQBX 2DGYA 3GTPH 1QVCA 3GD7A 3CCVA 1EQRA 4HJ7A 3ZJYC 3PUVA 1CKNB 3CD6A 2HHHL 1TXYA 4DAMA 1HNZQ 1FVIA 1TWHH 4RMFA 3CCLA 4OO1G 2IHEA 1RIPA 3KDFB 3PIOA 3KJOA 4GKKL 2N8NA 4DKAC 1PH8A 5LMUL 5HGQA 1W3SA 1X3GA 4POGA 4C3JH 2VQEQ 1VQDA 4MZ9A 4BBRG 4UPAA 2ZTCA 4DR5L 3HOYG 5IP9H 3CCEA 4NXNQ 4LUOA 4IPHA 4LF4Q 3UDXA 4HIMA 1E1OA 1WCMG 5JEAG 1D8LA 3Q8DA 1K9MC 4LNQA 1BVSA 4JV5L 2ZTEA 1BKBA 4LF8Q 4OX9L 1QZHA 1N33Q 4RG1A 4BY7G 4LFBL 3CC4A 5M3MH 1VQ6A 1Q12A 2OQ0A 3AFPA 4QY7A 4BA1I 4PG3A 5IYCH 1WI5A 5ELOA 3GTGH 3HFZB 4DV4L 4BXXG 3CF5A 3K7AH 3HOVH 1LUZA 3A0JA 1N36Q 1GVPA 1N32L 3S2DH 2WB1G 4LF9Q 3D31A 2NVTH 1I94Q 4X64L 2NVQH 2BA1A 4JI4L 3JC66 1KRTA 1IZ6A 3OYYA 1LM0A 5FJ8H 3VDYA 3TS0A 4A3EH 3KJPA 1V43A 4UP7A 2VNUD 4O0AA 1S40A 1OXXK 2UXCL 3W1GA 2HHHQ 1BBUA 1OXTA 4A3FG 1CSQA 1QUQA 2RF4A 2Y0SG 4C3HH 5FLMH 2R7FA 3EIVA 3OW2A 4JBKA 4LFCL 2YU9H 1N8RC 3T1HQ 2C35B 1PH4A 3LGJA 3U4ZA 3RZDH 1UE5A 1C0AA 3GTKH 1EYGA 3KLWA 3PV0A 4A3IH 1TWCH 1YEZA 1Y1VG 1YHAA 4R4IA 5LMUQ 2FXQA 1GKHA 4NB3A 4YCUA 4A93G 3TS2A 1I5FA 4R4OA 3DLLA 3STBC 1HR0W 4DR3L 5IT9c 2JQOA 3HOVG 4DK3C 2UXBQ 4R4CA 1IBML 2HIXA 4GLVB 3WWVA 1PV4A 4BY1H 1XMQL 2ID0A 2WAQG 4JV5Q 4YWMA 3G6EA 1Q1BA 3CCUA 4GNXA 4OX9Q 1DGSA 3AQQA 4B3RL 4GKJL 5IWAL 4K0KL 1L1OB 2YTVA 2E5LQ 4IPDA 5H1SE 5FJ8G 1WOCA 1K3RA 2ATWA 3HOWH 4DR1Q 4UP9A 2DUDA 4DV4Q 2JA8H 4AQYQ 4KHPQ 1JJ2A 3DM3A 1YHQA 5FLMG 1MKHA 2IX0A 4YWKA 4DV1Q 2GVAA 1Q1EA 3J7ZC
chains in the Genus database with same CATH superfamily
1STGA 2KHIA 4A3DH 4HCEA 2QKIC 1VQCA 1SFOH 3CPFA 1HR0L 2ENBA 3FVQA 1BCPB 5EKLA 4BBRB 3Q0AA 2F0MA 2DY7A 2NVXB 3CKIB 4AH6A 2CCZA 3KLSX 1KDCA 2N78A 4KY7A 2NN6H 4DUZQ 4DAYA 1WCMB 1GM5A 1DCZA 2A69D 3HOWG 4EQ5A 1DZ1A 1YVCA 2F0QA 1WJJA 2GVBA 5E4WC 1J6QA 2VQEL 3BJUA 3GTPB 4O2DA 3K0YA 2ZJPA 5IT9E 3UE1A 5CR3A 1YJ9A 2AUJD 4NKLA 1VMPA 4JW0A 4K5VA 3NHHA 4OO1H 1K8GA 2NZHA 4A3MG 2MFIA 2ASBA 5CV7A 1JWUD 2DNEA 5AJ3L 1F9PA 4I7ZC 4IALA 4FF3A 4ME3A 2F0FA 3TP6A 1VQKA 1PRTC 3GTMH 2HQEA 1N36L 1L1OC 3HKZG 3FDTA 4YCVA 2I07B 4OWXB 4NDXA 3NPPA 4HIDA 3LWEA 1VQAA 3VYRA 3DXJC 3HOVB 5IGEA 4LJZC 3A74A 2N88A 5C5LA 3E9IA 2WAQB 1OXVA 5IP7G 1F77A 3GO5A 3CCJA 4JYAQ 2FMCA 1V9PA 1VQHA 3VA5A 2UXBL 3VYUA 2HDMA 3CW2C 4H02A 4MTNA 3SK4A 1KC8C 2HIVA 2YU9B 1SBBB 1Y1VH 3AB9A 5J1ZA 1NUCA 1I6HH 1MSHA 1RTOA 1UNSA 1EIFA 2EDGA 4CKBA 3A8JE 3RD4A 2RCNA 4CJ2C 2JEAI 1EU4A 4DV1L 4DR6Q 3T53B 5A2QL 4B3SQ 3GTOB 3S15H 2ZXRA 3J81i 3DMUA 5D14A 2XRQD 3EROA 4X65L 3K57A 2CFMA 1B9MA 4KV6A 3S14B 3RLFA 2JA7G 1HPCA 2KOLA 3KFUA 5EBCA 3VR5A 2BE5D 1WTRA 4DUZL 4CJ0B 3CAMA 3CP0A 4ABNA 2RVLA 3GP7A 3OMGA 2H5XA 1RF2D 1SROA 3F2BA 2R92B 1PRTF 5I9OA 4FO2A 4ZLTF 3OMCA 1LTGD 1HA5A 3JAME 2F3WA 3A7AB 3H94A 1NTGA 1RKNA 4N9TA 4LF6Q 1CZWA 2XIWA 1XNQQ 4JK1C 2KCTA 5C4JB 1O78A 4A3MH 4YHHL 2PO4A 3T13A 1DD2A 4E6IA 5I6WA 1FNVA 5M3FG 5L37A 4A3LG 1NCVA 3FPPA 2K01A 1ICWA 3QJYA 3C2PA 1R4PB 1STEA 1NE3A 1JOQA 1Q8KA 1F9QA 1GUGA 1X54A 3F1ZA 5COYA 1LTLA 2N3SA 4JI0L 2OT2A 1KNAA 3F8TA 4OXPA 1YHBA 1IL8A 4WORA 3GTJH 1AE2A 1VQ9A 2KCCA 3I4MH 3RLOA 4IPCA 4DAYB 5IP7H 3M4OH 4L6TB 1QZGA 2F3IA 4B9XA 2B63B 3FMCA 2R93G 1LTSD 4MTKA 1SMYC 3I7FA 4ILWA 5DM73 4HJ8A 2GA4B 4K8JA 1X9NA 4B3SL 4OWTB 4HTHA 2WB1E 3HOUG 1Z9FA 1B70B 3PSIA 1IL2A 2RHSB 1XPUA 3TN2A 1Y14B 2JE6I 1P8LA 4WJ3M 2Y0SE 2AWOA 2AUKA 3MZ5A 2K50A 3NTHA 3SK5A 1IYJB 1J5EQ 5IGFA 3BYTB 5HURA 5FLXc 2CHBD 1EQVA 3EBEA 4LW1A 3PO3G 3HOZG 1SRUA 2LSSA 2DJGC 2SEBD 5T1IA 1PA6A 2JA7H 3UDGA 1A3VA 1A15A 4B3TL 4DV7Q 1JR0D 3A8IE 1FJGQ 1XWEA 1GO3E 4Y7NB 1I3QH 2XTIA 2BA0A 3EJIA 2JJQA 1PFSA 1YZ6A 3PO2B 3BZDB 1SE4A 4LF6L 3OIQA 2QILA 1LABA 2D0PA 2I0QA 2F4VL 1HJPA 4BBSB 4IUVA 3V96A 4H44C 1U5KA 1AP0A 2RHQB 4HEDA 4XIGS 3TP5A 1XNRQ 5C5MA 1Q3LA 4DV5Q 4EX5A 5JAVA 1K0RA 2JA5B 2VL6A 4C2MB 3E0JA 1H95A 4LWCA 3W1BA 1HNXQ 1B3AA 5M3FH 1CHPD 3A8KE 1QWYA 5IP9G 1A0IA 2EYJA 1KD1C 4JOIA 1TWAH 4P74A 2Z6KC 4L5QA 1I4XA 4JI3Q 4FP5D 2B2UA 5IYCG 1QB5D 5C3EH 5FLXL 1C4QA 4JI6L 1FD7D 2Q2HA 4XT1B 1BCPD 4A3GH 1K83B 1L0WA 1Y1WB 3HKZE 1TWGH 3M85A 1O7ZA 4XYQA 2R93H 1HUNA 2ES2A 1G51A 2L12A 4UP8A 3J7YW 1VQFA 2VXWA 3ND9A 3PUXA 4NPSA 2IX1A 3OW7A 3DEPA 4C3HG 1B53A 3HOUH 4A3CG 5ISRA 1DOKA 1MJCA 5BN4A 1WTHA 2WACA 3DHQA 3H0GB 4A3IG 2F0TA 4CDEC 2K32A 2Q8IB 1WFQA 2M00A 4DV3Q 3KF6A 4BY1G 2RBMA 4QUFA 1ESRA 2K5WA 3VA7A 4A3JB 2NVYB 1ET9A 3LX0A 3HOZH 1QOHA 2K75A 1PZJD 1RTNA 4EVOA 4PMWA 3AYHB 1EOVA 2NTSA 2G5DA 1ILQA 3ER0A 1SJHD 2IWHA 2ZTDA 3L3OC 2QDLA 1E1TA 1EQQA 4LF4L 1DM0B 5ELNA 3NTKA 1TIID 1N33L 5E3FA 3AMUA 1EIYB 4BBRH 4IOCA 2K7VA 4TVAB 2SDFA 1XNRL 1IW7D 2RA4A 1Y69U 3TSSA 1LTAD 4DV5L 1B44D 2L15A 3BU2A 1HUMA 4N8FA 1YNJC 1G91A 4Q0FA 3GTPH 1A6XA 3GD7A 5G3LF 3CCVA 3PUVA 2HHHL 1TXYA 2WKDA 2XNAC 3DEOA 4C3IB 2IHEA 1RIPA 4H0LC 3DWQA 4A3KB 3VYSA 4A3BB 3NK9A 1VMCA 2A6HD 2NUCA 4POGA 2E76C 3E5SA 4A3EB 1D1KA 2NB0A 5IP9H 1ILPA 4IPHA 3UDXA 4HIMA 1K9MC 4LNQA 2XWBB 1BVSA 4X3UA 4CDDC 4LF8Q 1QZHA 1VQ6A 1Q12A 2PYKA 3GTKB 3AFPA 3W2DA 1E0BA 1JORA 1IKLA 3KBXA 4PG3A 5IYCH 3HFZB 3CF5A 3HOVH 3I73A 1SJED 1VF5C 2DNCA 4LF9Q 3D31A 3LNNA 2F0DA 3IFTA 2EZVA 1B2TA 4DFAA 1IZ6A 3OYYA 1LM0A 3TS0A 3KJPA 4UP7A 2VNUD 1I4RA 1I4GA 3K5MA 4A3FG 1CSQA 5ELFA 3RUZA 4C3HH 5FLMH 1XYIA 2YU9H 3MA2B 1PH4A 1A3UA 3U4ZA 1EYGA 1Y8OB 4A3IH 1YHAA 5LMUQ 4YCUA 1IHZA 1QNUA 1XXGA 4A93G 3NQTA 3MEHA 5IT9c 2L0CA 1CA6A 3BVMA 4BY1H 4JV5Q 1Q1BA 1QE6A 4GNXA 4GKJL 4DK1A 4J8QA 3BDOA 2YTVA 2E5LQ 4IPDA 1KAAA 1SYBA 2EOTA 4DR1Q 3HZXA 4UP9A 4DV4Q 4KHPQ 1JJ2A 3I90A 3QOJA 4FF4A 1Q1EA 4WFN3 1DYQA 3MWYW 3VR3A 1VQBA 2UUCQ 1II3A 3NSWA 1EEFD 2WIIB 5C0XI 4Q5VA 5CGKA 3CCQA 4G7HC 1PZKD 5CMDA 1Q81C 3CHBD 1KXLA 2K04A 3OIPA 1WTQA 2F0EA 2OEOA 1R9TB 1SNDA 2I5HA 4LFCQ 3J80i 2B8GA 3BZKA 2KHJA 4ZK9B 5C3XA 1K0SA 1EY5A 3G48A 1I4HA 1CTMA 1PDQA 1LTTD 2CKZB 2PMZB 1OXSC 3K7UC 4CKEA 4DF7A 1NMFA 5D3IB 1KQSA 3KF6B 2CWAA 3E0EA 1EIHA 3TQYA 4B08A 4YIJA 1AZQA 4IFDI 4XTCS 2EXDA 2UUBQ 4A3DG 4GZYC 2NZ1D 4RHRA 4LF8L 4IPGA 4WRDA 4IO9A 4X3KA 3I4NG 1GUTA 2F0IA 2A73B 2EJFC 1HNWQ 3RNUA 2Q2UA 1S3OA 4ZAIA 2K33A 3I2ZA 2L1BA 4IZ8A 3I55A 3S1QH 4P71A 3M4QA 2VB3X 1LV9A 5M5XB 1ASZA 4DUYQ 3J7AV 3BVGA 4DV6Q 5KNCA 4O1NA 3K7AB 1YNNC 1YI2A 4IJLA 2B63H 2IX3A 2EY2A 2JSOA 5JJLA 5IGGA 3RN2A 5I9PA 4A3FH 3IFDA 3MXGA 3M7GA 4KJNA 3CXCA 3UDFA 4XQNA 1TS2A 1JE5A 4OIKA 2OCEA 1SNOA 4NMZA 2G9DA 5CV8A 5LL6S 3S16H 3JAMc 3TREA 2OWOA 4K8IA 2K6AA 4MN3A 3PUYA 2J0TD 1GUOA 3KYHC 4A93H 5J39A 2E5LL 1TWCB 4OONA 5AJ3Q 4DR1L 1X3EA 5KNDA 1VQMA 3GQBA 4KHPL 2GN5A 2WP8J 1CFMA 1D1IA 1PFMA 3FPUB 1GUSA 5EPKA 2UUCL 4AYBG 2E2HB 3EN2A 4JI8Q 5IGDA 1IBLQ 1PH7A 1U4RA 1KAWA 2O2LD 4QMGA 2MO1A 4RA8A 2E2JB 2KCMA 3L7ZC 1TWFH 4RFBA 2IY5B 1JC7A 4R8IA 1A62A 2RDGA 2MP1A 4Y7NH 4JBJA 5T1GA 5K36H 5KRUA 3PO2H 2QEJC 2B2VA 3L9AX 3WDNA 5I2YA 5FKAC 3PCOB 2B2WC 3FKIB 1STAA 3HKSA 2UUBL 2XN9C 1BDOA 5CBAE 1O7YA 5C44B 3RZOB 3A56A 1HNWL 1HXYD 2VW9A 4OL7A 2A6ED 1ENFA 3WOEA 1ASYA 4DR2Q 1UUPA 1F9SA 4GNXB 1BNZA 2ICIA 1CQVA 1XJVA 2Z0SA 5C4XB 2EY1A 1SE8A 2KCNA 5IE8A 4F7XA 2I5MX 3I4NH 4QB4A 4C2MH 4F8MA 4X65Q 1SE3A 1NY4A 1JOOA 4IQZA 1YNXA 5IY0A 4DUYL 2VS1A 4DV6L 1EQTA 1LTID 2HCCA 4G4KA 3K5LA 1E2ZA 5FO8B 5KGUA 4J6HA 2L9HA 4B9WA 3A5UA 3J81E 1WVLA 1PTOC 2K5HA 3NP8A 1PYWD 3QIAA 2B2TA 4K14A 4JVZA 2A8VA 4BA2I 5EAYA 2LXKA 1K83H 1VF7A 1Y1WH 1EY6A 3GTLH 3K6OA 3CRLC 2F0UA 1Q86C 4ULLA 4ZUIA 2ZJQA 5KNBA 2HCIA 1HRJA 2Z1CA 3T51B 5ELCA 1UEBA 3GTQB 2N55A 2B3GA 2MPMA 2YYZA 1EFID 4HMJA 1MSGA 3NWTA 3H0GH 4JI8L 4YHHQ 1IBLL 3STBD 3F2DA 2EVBA 4KKSA 3D0FA 2SNSA 3D3RA 2R7ZB 1K8MA 4RGOS 3QR8A 2F3VA 1T5XD 1CKNA 3I4MG 4A4IA 2IPKD 1SLJA 1RJTA 3HS0C 4A3JH 4X3SA 3BS1A 3I56A 1B3QA 3FRPB 3K58A 2E2IB 1PYSB 1EY8A 1D5XC 2EQSA 2PI2E 4JI0Q 3CMAA 4P73A 2R6GA 3A54A 1IBKL 2F03A 2K28A 3RMHA 4DNIA 4IUPA 2Z4IA 1JJCB 1EWCA 1SSOA 2NZOA 3KBGA 3IKJA 3Q6SA 1LT3D 2RKSA 4L5RC 3T56B 5IGBA 3UE0A 4L8JA 4DR2L 2FHTA 4HMIA 2F52A 2QA4A 5C4ZA 3I8ZA 1WTWA 4DR7Q 3A5ZB 1BBWA 2JEBI 3K5OA 2JA9A 1PTOF 1BUVT 2A69C 5HY6A 1VQ4A 1S5CD 3SXHA 4C3IH 2YTYA 3K59A 4A3KH 4A3BH 4DK0A 3T16A 2MHVA 1X65A 5EKIA 1R4QB 1VCIA 4C3JG 4QL5A 2X6GA 3CMEA 4B3TQ 1JOKA 4FYDA 2AQ3B 4JI2L 1CQFA 3KLRA 5E7NA 1VQLA 3L2PA 1ZKOA 1E2WA 2RDHA 2Z9HA 1SXTA 2D2CC 4GKKQ 2SNMA 1L1OA 3HOXB 5M3MG 1O80A 1XMOL 4LAAA 1UE6A 3MXUA 3MTSA 4RCOA 3SVMA 2HDLA 1H9SA 3S2HH 2E75C 2F4VQ 3EFXD 1I50B 3RR5A 1JMCA 1K73C 4HSPA 4X66L 2L11A 3S1MB 1STBA 2CW0D 1RHPA 1SMXA 1L2FA 5EQ0A 4DGZA 4UHVA 3SK8A 2QEXA 3C1FA 5ELEA 4HIOA 2DY8A 4XXEA 3I91A 2K05A 1KL9A 2QCPX 1SYEA 4JC0A 3ULLA 3NBIA 1ZEQX 5C3EG 2D5DA 4PV1C 3Q22A 5IYDH 1EOTA 1ENAA 1SYDA 4IOAA 1DONA 4A3GG 2BOSA 4DXGA 3EA6A 1I6VC 1PH3A 1FGBD 4MIUA 1S4ZA 5DLQE 4JI6Q 1MD2D 4K6LA 3A55A 5JVG3 3KLSA 2MNAA 4K0KQ 1A63A 2KJXA 4B3RQ 4DR7L 5IWAQ 4AYBE 1FNUA 5E4XA 2BE5C 5M5WB 4QUCA 5LHY1 1Z6HA 1PYBA 1GJXA 2N49A 3HOYH 2XSCA 1V8QA 1VQ8A 1VS0A 3OTOQ 5JEAH 5C3WA 5GAGC 4IJHA 1JICA 1WD0A 1EY9A 5EBDA 1MIUA 1G2SA 2E2DC 2LS01 3WOFA 5CC4A 1CKNB 2LY7A 3KK7A 3NBHA 4DAMA 1HNZQ 3GTGB 1TWHH 1WTOA 3PIOA 3S2DB 2V4DA 4GKKL 2N8NA 1PH8A 3MFGA 1TQOA 1X3GA 4RHSA 4ZKBB 4C3JH 4DN4M 5FK9C 4BBRG 3SHLA 2JXMB 4ZQ3A 2F0LA 3R2TA 1DXMA 4LF4Q 3MXNA 1WCMG 1N33Q 3ONAB 4RG1A 3CC4A 5M3MH 2OQ0A 2JA6B 1F2YA 4X3TA 2K03A 3K7AH 1LUZA 1LTBD 5KEEA 3DWAA 2L4NA 1CZGA 2RQXA 4DAPA 2C5CA 2J4XA 1AFPA 1B50A 4TSSA 3DWPA 1S40A 2EY5A 3W1GA 3OHXC 2HHHQ 2VUMB 1QUQA 2JA8B 2RCFA 3R8BA 1NSNS 2C35B 2FFKB 3LGJA 3RZDH 1C0AA 4ZRZA 1TWCH 4R4IA 1HA6A 2FXQA 1GKHA 3SK6A 1I5FA 4R4OA 2ICEC 1U4PA 2FINB 1SFOB 5LL6X 3HOVG 4R4CA 4GLVB 2ID0A 2WAQG 3AU7A 1ENCA 1PRTB 3CCUA 4B3RL 4K0KL 5IWAL 1L1OB 1WOCA 2ATWA 2DUDA 4AQYQ 1H9SB 3DM3A 5FLMG 2GVAA 2L5TA 3T1HQ 4PNYA 2UXDL 3V05A 1SN8A 5IGCA 1S5FD 5IIFA 5C0XH 5I4DA 3OTOL 3M3YB 5EPJA 1HZBA 1FR3A 1CM9A 4C1NI 1UAPA 4ZYSA 2X6LA 4G7ZC 1EYDA 5GADC 1K8AC 4QIWE 1ICFB 3PIO3 1HNZL 3LWUA 5M9OA 4KD3A 3GTMB 2EJGC 1PLFA 2Z6BA 5C44H 4ALPA 2LXJA 3R2IA 3AEVA 4BY7B 3IL8A 1SYFA 3P7JA 4PQXA 4R4TA 4R4QA 1CA5A 4GKJQ 4IFDH 4HSVA 1JQYD 5A35A 2WB1B 4TKOB 5BR8L 3X3NA 3D8GA 5EKKA 1WTPA 4KD4A 2NVXH 3ITPA 4QGUA 1SAPA 2R92G 2VY3A 1EY7A 2Y0SB 1K28A 1WCMH 1B7YB 3KOJA 1E24A 3C46A 1SYGA 1Y1VB 2DN8A 4ODGA 1I6HB 4RGMA 2KA7A 1JJGA 1BBXC 2Z6KA 3NEMA 2C9OA 3DUZA 2MUYA 3U9SA 4DPGA 1M90C 3ND8A 1BCPC 2NVQB 2CQAA 4IURA 4UDUC 3NBHB 2I46A 1XTDA 4WJWA 3B6YA 3UI2A 3J80E 4FDBA 4O42A 4QJFA 5AFWA 1QVFA 1KLUD 5KYLA 4RGTA 4APVA 1PFBA 3KF8A 3I4OA 2EPBA 2K5VA 4AQYL 3CPWA 4GOPC 3GDEA 1GHKA 2Z8LA 2JN4A 3MXNB 4DNRB 3T1HL 3P75A 1UEAB 3K0XA 1KHIA 2E2IH 2B63G 1Y8NB 3KUPA 2IJ0A 1F2ZA 2ZXPA 4KN4C 2A74C 2EJMA 1CKOA 4ZUJA 4LF7Q 3VYTA 2J7ZA 3HOWB 1ZYRC 3H09A 1SNQA 1V1PA 1VQPA 2F0KA 3N6RA 4FXGC 1XPOA 1NMGA 3J81c 5CBEE 3RN5A 4OEMB 4A3MB 3PQIA 2F0OA 1TS4A 1QUQB 4YWLA 5FOBB 4HJ5A 3GTOH 3BDLA 4KHZA 4LUZA 1QG7A 2IHFA 2KVMA 3T1YQ 3HKZB 3QWNA 2K52A 1UE7A 2Q8RE 3CCMA 3S14H 4JCVE 1EFWA 1E3PA 5LMNL 2NWGA 3K81C 2EIFA 3PUWA 4FNFA 2ZXOA 3GV3A 4M1UB 5ELDA 2IT1A 3GTJB 3HEJA 4K6DA 3M4OB 5K36G 3PO2G 2R92H 1QVGA 3J7A5 1EIGA 2A6HC 1RL2A 5JVH3 2F1MA 2LMCB 1B1ZA 5E1FA 4BBSG 3PGZA 3PIPA 1JB7A 4Y52H 3HOXH 1UE1A 4V190 2X69A 3J81j 1B8AA 4IUNA 4HAEA 2ZJRA 5C4JH 4EQPA 2CQOA 1A8VA 2VB2X 4BS9A 4FVMA 2JA5G 1VQNA 4GOPA 3S1MH 2EYPA 2KEEA 1LO5D 4IN3A 5J22A 2PCFB 3J81L 2F0GA 2BDNA 3NENA 2Q2IA 2JA7B 5IT9L 2PZWA 5JPNC 1A2TA 2CH4W 4LF7L 1EY4A 4L5SA 2A68D 1S5DD 2VZAA 1I3QB 1JCKB 3OPOA 1STYA 3ULPA 3OOCA 1Y1WG 1VQGA 1LT5D 5IYBG 1EY0A 2ALYB 3PUZA 5GAEC 3O13A 3KDFA 1SEBD 2PPBC 2EYMA 4RGNA 1MI2A 1P16A 3FP9A 1HH2P 3CQZB 1M1KC 3NE5B 1RD9D 1CK1A 1SNMA 3H0GG 2WAQE 3T1YL 3K80C 5M5WH 5GAHC 2R3ZA 1Q7YC 5M5YB 4DK6C 3K5NA 3MHBA 5JJZA 2OTLA 5M3FB 4JI7Q 1OTCA 2K5NA 4A3JG 3G6JB 2Q2TA 3M4PA 3L0OA 1PHJA 4JBMA 1PFNA 3KF8B 2CVRA 1GD7A 1L0XB 2FMMA 1HHVA 3CCSA 1W2BA 1TWAB 4LUVA 1XTCD 5I6YA 2VQFQ 1A3TA 5LMNW 4DV0Q 2TMPA 3PIP3 4A75A 1G6PA 2KQ3A 3NUCA 3TMEA 1BXTA 3F2CA 3SE0A 1QCBD 4GN5A 2OTJA 1D6EC 2CWPA 1PRTD 1TWGB 4CKCA 1AEXA 1V1PB 2R93B 1IBKQ 5JJIA 4C1NK 4BBSH 4QF4A 4DXFA 1JT8A 1PH1A 3HGBA 3HOUB 1Z47A 2JA6H 1W6KA 2D62A 1A2UA 3CC2A 3QO2A 4C3IG 2OF1A 2JA5H 1CKMA 1FL0A 4A3KG 1VQ5A 3Q24A 1D2BA 4A3BG 4LFBQ 2H4OA 2HT1A 1RCVD 3JAML 3G4SA 2VUMH 1IXRA 4A3EG 3PO3B 3HOZB 1X3QA 3D4DA 4LFAL 3H3VI 4HN7A 2IW3A 3NWSA 2AMCB 4X64Q 4OIJA 4MHEA 1VQEA 2F0WA 4OELB 1UWVA 2BDOA 3R93A 4JBWA 1CI3M 4KTAA 2UXCQ 5BN5A 4K2LA 4JI2Q 5IYBH 2EXZA 1M8AA 3VR2A 1PXUA 1NR4A 1T5EA 1KLGD 1XMOQ 4DR3Q 1LT6D 1E2VA 4F88A 4HCSA 1XMQQ 4JI7L 1LACA 3M3YH 1YBYA 4GOPB 3K8AA 4X66Q 1YITA 4UAIA 2PZUA 1DJRD 3H91A 2F0NA 4I65A 2D9UA 2PI2A 2QW7A 4KI0A 2VQFL 3E9HA 1HTLD 5JJKA 4DV0L 4KK7A 3C3LA 5IYDG 1SNPA 1ET6A 1W6JA 1HZAA 2G9HD 2NVYH 4YY3Q 1YIJA 1E7ZA 5EJWA 3MXPA 2AQ1B 3I4LA 1Q46A 2R61A 4KKTA 2B2WA 3H15A 4BY7H 4H13C 3S17B 3NTIA 5JPMC 2DGYA 1EU3A 1QVCA 1EQRA 4HJ7A 4EQOA 3TDQA 2A6EC 1X3PA 4S3SA 3CCLA 2PZTA 3D6CA 3R3OA 4RKLA 3KDFB 5CV4A 3KJOA 2KECA 1BR9A 5HGQA 1W3SA 4ME5A 3A7LA 4UPAA 3HOYG 4DU9A 4NXNQ 4LUOA 4C3HB 1E1OA 2EYOA 5JEAG 1D8LA 2ZTEA 4OX9L 4LFBL 4P2CB 4A3IB 2WV6D 4BXXG 4EQNA 1DOMA 1L0YB 4G7OC 2K1BA 3TZDA 2ZT9C 1PMRA 4FF1A 1I94Q 4BY1B 4X64L 4RH6A 2BA1A 2NVQH 1SMYD 3JC66 1KRTA 5FJ8H 3VDYA 4A3EH 1V43A 4O0AA 1OXXK 1QNKA 2UXCL 1OXTA 2E74C 1GUWA 2R7FA 3BG3A 4U68A 3OW2A 3S1RB 3IAYA 4JBKA 1RODA 4F87A 4CBVA 1UE5A 3GTKH 2NYZD 3KLWA 3PV0A 1AN8A 1YEZA 3STBC 1HR0W 4DR3L 1HCZA 1O7LA 5NUCA 2JQOA 4KKUA 1EYCA 1PV4A 1XMQL 5IOCA 1DGSA 3AQQA 1S5BD 3HOWH 1K3RA 2O4XA 2F0SA 2QDBA 1GHJA 1KTKA 1Q8IA 1M4VA 3J7ZC 2F4IA 5CV6A 4YY3L 1C9OA 2A1AA 1BQQT 2DJFC 1IYVA 3FHWA 3N52A 4DR4Q 2KHSA 4B3MQ 2YV5A 1AZPA 1FNWA 3C1EA 3U58A 4KJOA 1J9OA 2A19A 3BYYB 1HQMC 1JE4A 1KDAA 2NN6I 4L63B 2TSSA 3W3AA 3S1NB 3S1QB 4IUUA 3TBIB 2PW5A 4JYAL 1U4MA 1D5MC 2HUGA 3J80c 3MVVA 3NXWA 4NXNL 3E3XA 4OO1I 3ICEA 2XVSA 5C0XG 4J1MA 1VQ7A 4JPBW 1LT4D 1OXUA 1O7IA 3VR6A 1R9TH 3P20A 4XYOA 3SEBA 4JOIC 3FKIG 5FO7B 4A3FB 1H9MA 2K4KA 3MEFA 2UXDQ 1QILA 1TKWB 4DR6L 5EGTA 2WINB 5G3LD 1I94L 3IRBA 3S16B 2B2UC 5C44G 2XRSD 4JG2A 4BXXH 4A93B 2V1CC 1BO0A 5CORA 2AHOB 4NXMQ 5C4XG 1V1OA 4G57A 4N9PA 4IFDG 5J3BA 3JAMi 2NVTB 5CV9A 2UU9Q 2B39A 1JWMD 5A2QE 1CHQD 3G71A 4CDFC 1K3BC 4LK1C 2HD3A 2CW0C 1V1QA 1JWSD 3U50C 1XPRA 1TWFB 5BR8Q 1EUJA 2HQLA 5M5XH 4K5XA 3I70A 4X6AH 3J7AF 1MHWC 1C8CA 4LF5Q 4FF2A 5EPLA 5KIXA 2RSOA 1Q82C 1KDBA 5JEAJ 1NNXA 1QJOA 4OGQC 3FEWX 5JOBA 4XT3B 1NJIC 3MC0B 5DEHA 1CUKA 1F2MA 1PH2A 3QOLA 1XNQL 1HQRD 4KN7C 3URYA 2PQAA 1C48A 4MNOA 4DNTB 4M8AA 3J80L 4P75A 2WKCA 4B3ML 4DR4L 3CQZH 4CJ1B 2SOBA 5CYUA 2WFWA 1G8ZD 1PTOB 1Z7TA 1KIXA 2K14A 3BDCA 1D7QA 1YJWA 4A3DB 2B2YC 2R7ZG 2ZM6Q 2PNRC 3F2UA 1ML0D 5M5YH 4LMQD 3I4NB 4JI5Q 4J15A 2UUAQ 4C56C 3ULJA 2E2HH 4GLXA 4A3LH 3CCRA 1G6ZA 3ERQA 1LYLA 1YNJD 1MBYA 4V0BA 5C4HA 1NR2A 3W5OA 2E2JH 5GQOA 2JP1A 1F9RA 2RSNA 1KABA 4PMBA 1H9RA 2M9VA 3M9BA 4JI1Q 5BN3A 2MJ8A 4EGVA 2BH8A 2JYOA 1YJNA 1X3FA 1EL0A 3GTLB 1U0LA 4R8NA 3OWFA 3FKIH 4RAUC 1SYCA 1J8IA 1X56A 5HGTA 4NXML 4AIMA 2D0OA 4I7AA 1ONLA 4H7BA 2KEDA 4GN3B 3RZOH 2UU9L 1J5EL 3SGIA 4XQJA 1U9RA 2B8FA 4IUTA 2YTXA 3GV6A 3S9WA 1STHA 1VQOA 5C4XH 1ESFA 5ELBA 1G2TA 4GLAC 4ZCKA 1FGUA 3NELA 3BZCA 1Q90A 4PZ6A 2BH2A 4DV7L 1FJGL 4AYBB 4POFA 2FJ2A 4DV2Q 1HTPA 3AFQA 1AE3A 2I5LX 4LF5L 2NBFA 1ZYRD 2P5ZX 2F0JA 1VQIA 5LMNQ 3PO3H 4HJAA 2PMZE 1SNCA 5C0XJ 1PH9A 2JK8A 4GN4B 2K5DA 1HZCA 3PF5A 1SE2A 2BCOA 1T9HA 1STNA 1N34Q 2EE1A 1SDFA 4PZ8A 1N9WA 3HOXG 2E8GA 3CU7A 1AW7A 2KBNA 2AQ2B 1HFGA 3PMFA 4GNXC 2MGSA 4HIKA 1EZ6A 2OQKA 3M4YA 2B2YA 1WYDA 2KENA 1HZ9A 3OSOA 1F2LA 3S15B 1C7YA 2ZM6L 2PNHA 3D4RA 4PZ7A 4JI5L 4IFDJ 2EYHA 3GTQH 2UUAL 5DM63 1HNXL 3TRZA 1GUNA 3I3CA 1TR5A 2PQEA 4P72A 2R7ZH 3M7NA 1VDZA 4GS3A 4X62Q 1D5ZC 4NW2A 4JI3L 4JI1L 1LTRD 2O5IC 2B29A 3PF4A 1BF4A 1X6OA 3MAQA 1DOLA 3EQLC 3BVZA 3TP8A 3S17H 1E22A 1EWHA 4KMUC 1JB3A 4TRDA 4A76A 1TY2A 4IUQA 1OO9B 3S2HB 2PQAB 3RLNA 3HP3A 1TS3A 3UDIA 1WTVA 5FLXE 1WTXA 4Z9CB 2Q8TA 2A5HA 3VR4A 3CRKC 4YCWA 2LFNA 3U9OA 4DV3L 5C6AA 1G291 4A3CH 1IW7C 2PW7A 4DV2L 1K8OA 1YNND 1SR3A 1XX8A 2MQHA 4FXDA 1VQJA 4KY6A 4DR5Q 4K5WA 4PMCA 5DAUA 5K5PA 1N34L 3I4MB 1GOZA 4N8X1 1KRSA 4RCNA 1BCPF 4QCLA 1PZID 4NP5A 5TSSA 4CDCC 2O5JC 3V2TA 1PH6A 1PVOA 3HRZC 4QIWB 3S1RH 3SR1A 2RDFA 3H3VH 1N32Q 4FXKC 1WD1A 2XGTA 1I4QA 4HR7B 2R7DA 2M2LA 1H9JA 2QGQA 3TZUA 4JI4Q 2JA6G 5KYIA 4HJ9A 3S24A 3I72A 3U4VA 3SDZA 3P1HA 3OWEB 1TS5A 1I50H 3E6ZX 3G7LA 1CSPA 5CV5A 1KNEA 3HOYB 4WJ4A 1PH5A 4K2KA 2MO0A 4UY8C 1IKMA 1MJEA 4KLKA 4X62L 2VUMG 4TQUS 1NBWA 3TEHB 2JA8G 2CH4A 1IBMQ 3H3VC 1Y8PB 4R1JA 1AH9A 2EY6A 1GXDC 2B2VC 1EWIA 1TWHB 1S5ED 2F0VA 1TY0A 2QF7A 1U4LA 4OWWB 3CC7A 3D6WA 5GROA 4L5TA 1LLRD 4LFAQ 1X55A 4C3JB 1EYAA 2AWNA 1S72A 3ERSX 1I4PA 3S1NH 4LF9L 3EVQA 2L55A 1B9NA 2AKWB 2NN6G 3HG9A 4KY5A 1RDPD 5F2DA 1HR0Q 1H9KA 5DNFA 4QQBX 5M3MB 3ZJYC 1BOSA 3CD6A 2F0HA 1IYUA 1TVXA 1FVIA 2F0PA 2IL8A 2XWJB 4RMFA 4CHTB 4OO1G 2NTTA 1TT2A 4DKAC 5LMUL 1EEID 4RWSC 2H1EA 3X3MA 2VQEQ 1CT1D 1VQDA 1X32A 2LKVA 4MZ9A 5D3DA 4OHJA 2ZTCA 4BWGB 4DR5L 3CCEA 1PTOD 2B2TC 3Q8DA 4R9WA 4JV5L 2K5QA 1B4OA 1BKBA 3RZDB 4BY7G 4QY7A 1NAPA 4BA1I 3GTGH 1WI5A 5ELOA 4DV4L 1TU2B 3A0JA 1N36Q 1GVPA 5C3EB 1N32L 3S2DH 2WB1G 2NVTH 4KHVA 4A3GB 3QG1A 4JI4L 2OXPA 2KUMA 1BBUA 2RF4A 2Y0SG 3EIVA 4DAVA 4LFCL 1N8RC 5IODA 4DA2A 4ZKCB 5I2XA 1Y1VG 4NB3A 3MFYA 3TS2A 1ZXTA 3DLLA 4XDXA 4DK3C 2UXBQ 2A68C 2EYLA 2HIXA 5D65A 3WWVA 1IBML 3D4WA 4ID6A 3NQIA 2EYFA 3H6MA 4YWMA 3G6EA 1EZ8A 4CGYB 4OX9Q 1FYCA 3ZYYX 3TP7A 3DM1A 5FO9B 1MGSA 4U673 5H1SE 5FJ8G 4XQQA 1PTOH 4RKBA 2JA8H 3T4AC 3Q23A 1YHQA 2Z4HA 1MKHA 2IX0A 3QB3A 4YWKA 4DV1Q 1HFNA
chains in the Genus database with same CATH topology
2UXDL 1VQBA 4YY3L 2UUCQ 1SN8A 3OTOL 2KHIA 1C9OA 5C0XI 4A3DH 3CCQA 1AH9A 2A1AA 1VQCA 1HZBA 1SFOH 3CPFA 1Q81C 3FHWA 1HR0L 4DR4Q 4B3MQ 2YV5A 5GADC 1KXLA 1K8AC 4QIWE 3U58A 2I5HA 2A19A 4LFCQ 1HNZL 3J80i 4AH6A 2CCZA 3BZKA 2KHJA 2N78A 2NN6I 4DUZQ 5C44H 1GM5A 4ALPA 2LXJA 3G48A 3HOWG 4EQ5A 1YVCA 3AEVA 1WJJA 2GVBA 2CKZB 1J6QA 1OXSC 3K7UC 3BJUA 2VQEL 4JYAL 1NMFA 4O2DA 1KQSA 2ZJPA 3KF6B 2CWAA 3E0EA 4R4TA 3UE1A 3J80c 1YJ9A 4NXNL 4R4QA 4GKJQ 3TQYA 4OO1I 4IFDI 4XTCS 3ICEA 5C0XG 2EXDA 5BR8L 2NZHA 1K8GA 2UUBQ 4A3DG 1VQ7A 4LF8L 4IPGA 4IO9A 1OXUA 4A3MG 3I4NG 1O7IA 1R9TH 2MFIA 2ASBA 5AJ3L 2NVXH 1HNWQ 3RNUA 2Q2UA 4QGUA 4JOIC 4ME3A 2R92G 1S3OA 2VY3A 3FKIG 1VQKA 3GTMH 3I4MH 1N36L 3I2ZA 3MEFA 2K4KA 2UXDQ 4DR6L 1L1OC 1WCMH 3I55A 3S1QH 1B7YB 3HKZG 3KOJA 4P71A 1I94L 3IRBA 1E24A 3M4QA 4YCVA 5C44G 4OWXB 4JG2A 1ASZA 4BXXH 2V1CC 4DUYQ 4HIDA 2AHOB 1JJGA 4DV6Q 1VQAA 3GTLH 4NXMQ 2Z6KA 5C4XG 3NEMA 4IFDG 3A74A 3E9IA 1YI2A 4IJLA 5J3BA 2B63H 3JAMi 1OXVA 4DPGA 5IP7G 1M90C 2UU9Q 5JJLA 3GO5A 3CCJA 4JYAQ 3RN2A 3G71A 4A3FH 1V9PA 3NBHB 1VQHA 1XTDA 3CXCA 3UDFA 2UXBL 3B6YA 3CW2C 1JE5A 1V1QA 2OCEA 3U50C 1XPRA 3S16H 4H02A 4FDBA 4MTNA 1EUJA 5BR8Q 2HQLA 2HIVA 3JAMc 4QJFA 3TREA 5M5XH 1Y1VH 2OWOA 1QVFA 3PUYA 3KYHC 4A93H 4X6AH 1I6HH 4APVA 2E5LL 4OONA 4LF5Q 5AJ3Q 1EIFA 4DR1L 1X3EA 3I4OA 2K5VA 4AQYL 3CPWA 1VQMA 1Q82C 2RCNA 2GN5A 4GOPC 4KHPL 2WP8J 5JEAJ 2JEAI 3GDEA 4DV1L 1NJIC 3MXNB 4DR6Q 4B3SQ 3T1HL 1CUKA 2UUCL 4AYBG 3K0XA 1KHIA 1PH2A 2E2IH 2B63G 3S15H 3EN2A 4JI8Q 1XNQL 3J81i 1IBLQ 2PQAA 4MNOA 1CKOA 1KAWA 1PH7A 4P75A 4X65L 4B3ML 2MO1A 4LF7Q 4DR4L 3CQZH 2CFMA 2KCMA 2WFWA 3L7ZC 1TWFH 1VQPA 3RLFA 2IY5B 2JA7G 1XPOA 3KFUA 1NMGA 1KIXA 1A62A 2K14A 3J81c 4DUZL 4Y7NH 1D7QA 3CAMA 3CP0A 1YJWA 2R7ZG 4JBJA 2ZM6Q 5M5YH 3RN5A 2H5XA 4YWLA 4JI5Q 1QUQB 3PO2H 4J15A 1SROA 4HJ5A 2UUAQ 3GTOH 4KHZA 3ULJA 3PCOB 1KC8C 3F2BA 2E2HH 4GLXA 4LUZA 4A3LH 3HKSA 3CCRA 2IHFA 1LYLA 2UUBL 3T1YQ 3W5OA 2E2JH 2K52A 1UE7A 5GQOA 3CCMA 3S14H 4JCVE 1EFWA 1HNWL 1E3PA 1NTGA 3M9BA 4JI1Q 5LMNL 2VW9A 4LF6Q 1ASYA 4DR2Q 3K81C 2EIFA 2BH8A 4GNXB 3PUWA 1XJVA 2Z0SA 1XNQQ 2IT1A 1YJNA 1SE8A 1X3FA 5IE8A 4K0KQ 2KCTA 2I5MX 4A3MH 3I4NH 4C2MH 4YHHL 4X65Q 1U0LA 1NY4A 5K36G 1YNXA 5IY0A 4DUYL 3PO2G 2R92H 3FKIH 1QVGA 2VS1A 3J7A5 1X56A 4DV6L 5M3FG 4AIMA 2D0OA 4NXML 1RL2A 4A3LG 4GN3B 3RZOH 4BBSG 3PGZA 3PIPA 3A5UA 2UU9L 1JB7A 1J5EL 3HOXH 3SGIA 1UE1A 4Y52H 1NE3A 1Q8KA 1X54A 2K5HA 3F1ZA 1LTLA 2N3SA 2YTXA 3J81j 4JI0L 1B8AA 3F8TA 1VQOA 2A8VA 5C4XH 4BA2I 4OXPA 1YHBA 4GLAC 5EAYA 2LXKA 1FGUA 1K83H 1AE2A 3NELA 3BZCA 5C4JH 3GTJH 2ZJRA 4PZ6A 1Y1WH 1VQ9A 3RLOA 2CQOA 4IPCA 2BH2A 1A8VA 4DAYB 4DV7L 5IP7H 1FJGL 3M4OH 1QZGA 2F3IA 4POFA 2JA5G 1VQNA 4DV2Q 4GOPA 1Q86C 3S1MH 3AFQA 1AE3A 2I5LX 4LF5L 2ZJQA 2R93G 5LMNQ 1VQIA 3PO3H 4HJAA 2PMZE 3I7FA 5C0XJ 1PH9A 2JK8A 4GN4B 4HJ8A 1HZCA 3PF5A 3NENA 1UEBA 2Q2IA 1X9NA 4B3SL 2B3GA 2YYZA 1T9HA 4OWTB 1N34Q 3H0GH 4JI8L 2WB1E 4PZ8A 1N9WA 1Z9FA 4YHHQ 1IBLL 3STBD 3HOUG 3HOXG 1B70B 3F2DA 2E8GA 3D0FA 3PSIA 1IL2A 2RHSB 2KBNA 4L5SA 4LF7L 1XPUA 2VZAA 1Y14B 4GNXC 2JE6I 4HIKA 1P8LA 2OQKA 4WJ3M 3ULPA 1CKNA 3I4MG 2Y0SE 1WYDA 1VQGA 2AWOA 1SLJA 2KENA 4A4IA 1Y1WG 4A3JH 5IYBG 2K50A 1HZ9A 1IYJB 2ALYB 3PUZA 5GAEC 3I56A 1J5EQ 1PYSB 5FLXc 1C7YA 2ZM6L 2PNHA 3KDFA 2EQSA 2PI2E 3EBEA 4LW1A 4JI0Q 3PO3G 3CMAA 3HOZG 4PZ7A 4JI5L 4IFDJ 1SRUA 3GTQH 1P16A 2LSSA 3FP9A 1HH2P 4P73A 1PA6A 2UUAL 3UDGA 1HNXL 2JA7H 1M1KC 2R6GA 3TRZA 1IBKL 4B3TL 4DV7Q 1FJGQ 4DNIA 3H0GG 2WAQE 3T1YL 4P72A 2R7ZH 3K80C 5M5WH 5GAHC 3M7NA 1JJCB 1GO3E 4GS3A 1I3QH 4X62Q 2NZOA 2XTIA 2BA0A 4L5RC 1Q7YC 4JI3L 2JJQA 4JI1L 1PFSA 1YZ6A 3UE0A 4DK6C 2B29A 4LF6L 3PF4A 4DR2L 1X6OA 2OTLA 4JI7Q 2F52A 2QA4A 1OTCA 2K5NA 4A3JG 2D0PA 2F4VL 2I0QA 2Q2TA 3M4PA 4DR7Q 3L0OA 3A5ZB 1PHJA 1BBWA 1HJPA 3KF8B 4JBMA 3S17H 2JEBI 1E22A 1GD7A 2JA9A 1U5KA 3CCSA 1W2BA 4LUVA 2VQFQ 2RHQB 5LMNW 5HY6A 4XIGS 4DV0Q 1VQ4A 4A76A 4A75A 1XNRQ 4C3IH 2YTYA 1G6PA 4DV5Q 4EX5A 4A3KH 2PQAB 1K0RA 3F2CA 4GN5A 3RLNA 4A3BH 3UDIA 2OTJA 2VL6A 2CWPA 1H95A 1X65A 4LWCA 3W1BA 1HNXQ 1VCIA 5M3FH 1IBKQ 4QL5A 3CMEA 4B3TQ 4YCWA 5JJIA 4DV3L 4JI2L 5IP9G 4BBSH 1A0IA 1G291 5E7NA 1KD1C 4A3CH 1VQLA 3L2PA 4JOIA 1JT8A 4DV2L 1PH1A 1TWAH 4GKKQ 1Z47A 2Z6KC 4P74A 2JA6H 4L5QA 1L1OA 4JI3Q 5M3MG 1XMOL 1UE6A 2D62A 1SR3A 5IYCG 5C3EH 3CC2A 2MQHA 3S2HH 1VQJA 4DR5Q 4JI6L 2Q2HA 4A3GH 2F4VQ 2JA5H 1CKMA 1L0WA 3RR5A 1N34L 1FL0A 4A3KG 1VQ5A 1JMCA 1K73C 1KRSA 3HKZE 1TWGH 3M85A 4A3BG 4X66L 4LFBQ 2R93H 2ES2A 1G51A 2HT1A 4UP8A 3G4SA 1PH6A 1SMXA 1L2FA 1IXRA 1VQFA 4A3EG 2VUMH 1PVOA 3PUXA 4NPSA 3S1RH 2IX1A 3H3VH 4LFAL 3H3VI 1N32Q 2QEXA 3HOUH 2XGTA 4A3CG 1MJCA 4HIOA 2AMCB 2R7DA 4X64Q 2QGQA 4JI4Q 4A3IG 2JA6G 1KL9A 1VQEA 1UWVA 4HJ9A 1A63A 4JBWA 4JC0A 3S24A 3ULLA 3U4VA 2UXCQ 1WFQA 5C3EG 1I50H 4DV3Q 4JI2Q 5IYDH 4IOAA 1CSPA 3KF6A 5IYBH 4A3GG 4BY1G 4WJ4A 1PH5A 2MO0A 4UY8C 1MJEA 4KLKA 4X62L 1XMOQ 3HOZH 2K75A 2VUMG 1PH3A 4DR3Q 4PMWA 3AYHB 4TQUS 1NBWA 5DLQE 3TEHB 1EOVA 4JI6Q 2JA8G 1IBMQ 3ER0A 1XMQQ 4JI7L 4R1JA 2ZTDA 3M3YH 1YBYA 1E1TA 2MNAA 4GOPB 1EQQA 4LF4L 3K8AA 4B3RQ 4X66Q 1YITA 5IWAQ 4AYBE 4DR7L 5ELNA 1EWIA 1N33L 2PI2A 4KI0A 1EIYB 4OWWB 2VQFL 3E9HA 3CC7A 1PYBA 5GROA 4BBRH 2N49A 4L5TA 4DV0L 4IOCA 4LFAQ 1X55A 3HOYH 5JJKA 5IYDG 4TVAB 1VQ8A 1HZAA 1XNRL 1VS0A 2NVYH 2AWNA 4YY3Q 4DV5L 3ERSX 2L15A 3OTOQ 1YIJA 1S72A 1E7ZA 3S1NH 5GAGC 3BU2A 4IJHA 4LF9L 2AKWB 2NN6G 1Q46A 4BY7H 3H15A 1HR0Q 1MIUA 4QQBX 2DGYA 3GTPH 1QVCA 3GD7A 3CCVA 1EQRA 4HJ7A 3ZJYC 3PUVA 1CKNB 3CD6A 2HHHL 1TXYA 4DAMA 1HNZQ 1FVIA 1TWHH 4RMFA 3CCLA 4OO1G 2IHEA 1RIPA 3KDFB 3PIOA 3KJOA 4GKKL 2N8NA 4DKAC 1PH8A 5LMUL 5HGQA 1W3SA 1X3GA 4POGA 4C3JH 2VQEQ 1VQDA 4MZ9A 4BBRG 4UPAA 2ZTCA 4DR5L 3HOYG 5IP9H 3CCEA 4NXNQ 4LUOA 4IPHA 4LF4Q 3UDXA 4HIMA 1E1OA 1WCMG 5JEAG 1D8LA 3Q8DA 1K9MC 4LNQA 1BVSA 4JV5L 2ZTEA 1BKBA 4LF8Q 4OX9L 1QZHA 1N33Q 4RG1A 4BY7G 4LFBL 3CC4A 5M3MH 1VQ6A 1Q12A 2OQ0A 3AFPA 4QY7A 4BA1I 4PG3A 5IYCH 1WI5A 5ELOA 3GTGH 3HFZB 4DV4L 4BXXG 3CF5A 3K7AH 3HOVH 1LUZA 3A0JA 1N36Q 1GVPA 1N32L 3S2DH 2WB1G 4LF9Q 3D31A 2NVTH 1I94Q 4X64L 2NVQH 2BA1A 4JI4L 3JC66 1KRTA 1IZ6A 3OYYA 1LM0A 5FJ8H 3VDYA 3TS0A 4A3EH 3KJPA 1V43A 4UP7A 2VNUD 4O0AA 1S40A 1OXXK 2UXCL 3W1GA 2HHHQ 1BBUA 1OXTA 4A3FG 1CSQA 1QUQA 2RF4A 2Y0SG 4C3HH 5FLMH 2R7FA 3EIVA 3OW2A 4JBKA 4LFCL 2YU9H 1N8RC 3T1HQ 2C35B 1PH4A 3LGJA 3U4ZA 3RZDH 1UE5A 1C0AA 3GTKH 1EYGA 3KLWA 3PV0A 4A3IH 1TWCH 1YEZA 1Y1VG 1YHAA 4R4IA 5LMUQ 2FXQA 1GKHA 4NB3A 4YCUA 4A93G 3TS2A 1I5FA 4R4OA 3DLLA 3STBC 1HR0W 4DR3L 5IT9c 2JQOA 3HOVG 4DK3C 2UXBQ 4R4CA 1IBML 2HIXA 4GLVB 3WWVA 1PV4A 4BY1H 1XMQL 2ID0A 2WAQG 4JV5Q 4YWMA 3G6EA 1Q1BA 3CCUA 4GNXA 4OX9Q 1DGSA 3AQQA 4B3RL 4GKJL 5IWAL 4K0KL 1L1OB 2YTVA 2E5LQ 4IPDA 5H1SE 5FJ8G 1WOCA 1K3RA 2ATWA 3HOWH 4DR1Q 4UP9A 2DUDA 4DV4Q 2JA8H 4AQYQ 4KHPQ 1JJ2A 3DM3A 1YHQA 5FLMG 1MKHA 2IX0A 4YWKA 4DV1Q 2GVAA 1Q1EA 3J7ZC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UXD L;  1VQB A;  4YY3 L;  2UUC Q;  1SN8 A;  3OTO L;  2KHI A;  1C9O A;  5C0X I;  4A3D H;  3CCQ A;  1AH9 A;  2A1A A;  1VQC A;  1HZB A;  1SFO H;  3CPF A;  1Q81 C;  3FHW A;  1HR0 L;  4DR4 Q;  4B3M Q;  2YV5 A;  5GAD C;  1KXL A;  1K8A C;  4QIW E;  3U58 A;  2I5H A;  2A19 A;  4LFC Q;  1HNZ L;  3J80 i;  4AH6 A;  2CCZ A;  3BZK A;  2KHJ A;  2N78 A;  2NN6 I;  4DUZ Q;  5C44 H;  1GM5 A;  4ALP A;  2LXJ A;  3G48 A;  3HOW G;  4EQ5 A;  1YVC A;  3AEV A;  1WJJ A;  2GVB A;  2CKZ B;  1J6Q A;  1OXS C;  3K7U C;  3BJU A;  2VQE L;  4JYA L;  1NMF A;  4O2D A;  1KQS A;  2ZJP A;  3KF6 B;  2CWA A;  3E0E A;  4R4T A;  3UE1 A;  3J80 c;  1YJ9 A;  4NXN L;  4R4Q A;  4GKJ Q;  3TQY A;  4OO1 I;  4IFD I;  4XTC S;  3ICE A;  5C0X G;  2EXD A;  5BR8 L;  2NZH A;  1K8G A;  2UUB Q;  4A3D G;  1VQ7 A;  4LF8 L;  4IPG A;  4IO9 A;  1OXU A;  4A3M G;  3I4N G;  1O7I A;  1R9T H;  2MFI A;  2ASB A;  5AJ3 L;  2NVX H;  1HNW Q;  3RNU A;  2Q2U A;  4QGU A;  4JOI C;  4ME3 A;  2R92 G;  1S3O A;  2VY3 A;  3FKI G;  1VQK A;  3GTM H;  3I4M H;  1N36 L;  3I2Z A;  3MEF A;  2K4K A;  2UXD Q;  4DR6 L;  1L1O C;  1WCM H;  3I55 A;  3S1Q H;  1B7Y B;  3HKZ G;  3KOJ A;  4P71 A;  1I94 L;  3IRB A;  1E24 A;  3M4Q A;  4YCV A;  5C44 G;  4OWX B;  4JG2 A;  1ASZ A;  4BXX H;  2V1C C;  4DUY Q;  4HID A;  2AHO B;  1JJG A;  4DV6 Q;  1VQA A;  3GTL H;  4NXM Q;  2Z6K A;  5C4X G;  3NEM A;  4IFD G;  3A74 A;  3E9I A;  1YI2 A;  4IJL A;  5J3B A;  2B63 H;  3JAM i;  1OXV A;  4DPG A;  5IP7 G;  1M90 C;  2UU9 Q;  5JJL A;  3GO5 A;  3CCJ A;  4JYA Q;  3RN2 A;  3G71 A;  4A3F H;  1V9P A;  3NBH B;  1VQH A;  1XTD A;  3CXC A;  3UDF A;  2UXB L;  3B6Y A;  3CW2 C;  1JE5 A;  1V1Q A;  2OCE A;  3U50 C;  1XPR A;  3S16 H;  4H02 A;  4FDB A;  4MTN A;  1EUJ A;  5BR8 Q;  2HQL A;  2HIV A;  3JAM c;  4QJF A;  3TRE A;  5M5X H;  1Y1V H;  2OWO A;  1QVF A;  3PUY A;  3KYH C;  4A93 H;  4X6A H;  1I6H H;  4APV A;  2E5L L;  4OON A;  4LF5 Q;  5AJ3 Q;  1EIF A;  4DR1 L;  1X3E A;  3I4O A;  2K5V A;  4AQY L;  3CPW A;  1VQM A;  1Q82 C;  2RCN A;  2GN5 A;  4GOP C;  4KHP L;  2WP8 J;  5JEA J;  2JEA I;  3GDE A;  4DV1 L;  1NJI C;  3MXN B;  4DR6 Q;  4B3S Q;  3T1H L;  1CUK A;  2UUC L;  4AYB G;  3K0X A;  1KHI A;  1PH2 A;  2E2I H;  2B63 G;  3S15 H;  3EN2 A;  4JI8 Q;  1XNQ L;  3J81 i;  1IBL Q;  2PQA A;  4MNO A;  1CKO A;  1KAW A;  1PH7 A;  4P75 A;  4X65 L;  4B3M L;  2MO1 A;  4LF7 Q;  4DR4 L;  3CQZ H;  2CFM A;  2KCM A;  2WFW A;  3L7Z C;  1TWF H;  1VQP A;  3RLF A;  2IY5 B;  2JA7 G;  1XPO A;  3KFU A;  1NMG A;  1KIX A;  1A62 A;  2K14 A;  3J81 c;  4DUZ L;  4Y7N H;  1D7Q A;  3CAM A;  3CP0 A;  1YJW A;  2R7Z G;  4JBJ A;  2ZM6 Q;  5M5Y H;  3RN5 A;  2H5X A;  4YWL A;  4JI5 Q;  1QUQ B;  3PO2 H;  4J15 A;  1SRO A;  4HJ5 A;  2UUA Q;  3GTO H;  4KHZ A;  3ULJ A;  3PCO B;  1KC8 C;  3F2B A;  2E2H H;  4GLX A;  4LUZ A;  4A3L H;  3HKS A;  3CCR A;  2IHF A;  1LYL A;  2UUB L;  3T1Y Q;  3W5O A;  2E2J H;  2K52 A;  1UE7 A;  5GQO A;  3CCM A;  3S14 H;  4JCV E;  1EFW A;  1HNW L;  1E3P A;  1NTG A;  3M9B A;  4JI1 Q;  5LMN L;  2VW9 A;  4LF6 Q;  1ASY A;  4DR2 Q;  3K81 C;  2EIF A;  2BH8 A;  4GNX B;  3PUW A;  1XJV A;  2Z0S A;  1XNQ Q;  2IT1 A;  1YJN A;  1SE8 A;  1X3F A;  5IE8 A;  4K0K Q;  2KCT A;  2I5M X;  4A3M H;  3I4N H;  4C2M H;  4YHH L;  4X65 Q;  1U0L A;  1NY4 A;  5K36 G;  1YNX A;  5IY0 A;  4DUY L;  3PO2 G;  2R92 H;  3FKI H;  1QVG A;  2VS1 A;  3J7A 5;  1X56 A;  4DV6 L;  5M3F G;  4AIM A;  2D0O A;  4NXM L;  1RL2 A;  4A3L G;  4GN3 B;  3RZO H;  4BBS G;  3PGZ A;  3PIP A;  3A5U A;  2UU9 L;  1JB7 A;  1J5E L;  3HOX H;  3SGI A;  1UE1 A;  4Y52 H;  1NE3 A;  1Q8K A;  1X54 A;  2K5H A;  3F1Z A;  1LTL A;  2N3S A;  2YTX A;  3J81 j;  4JI0 L;  1B8A A;  3F8T A;  1VQO A;  2A8V A;  5C4X H;  4BA2 I;  4OXP A;  1YHB A;  4GLA C;  5EAY A;  2LXK A;  1FGU A;  1K83 H;  1AE2 A;  3NEL A;  3BZC A;  5C4J H;  3GTJ H;  2ZJR A;  4PZ6 A;  1Y1W H;  1VQ9 A;  3RLO A;  2CQO A;  4IPC A;  2BH2 A;  1A8V A;  4DAY B;  4DV7 L;  5IP7 H;  1FJG L;  3M4O H;  1QZG A;  2F3I A;  4POF A;  2JA5 G;  1VQN A;  4DV2 Q;  4GOP A;  1Q86 C;  3S1M H;  3AFQ A;  1AE3 A;  2I5L X;  4LF5 L;  2ZJQ A;  2R93 G;  5LMN Q;  1VQI A;  3PO3 H;  4HJA A;  2PMZ E;  3I7F A;  5C0X J;  1PH9 A;  2JK8 A;  4GN4 B;  4HJ8 A;  1HZC A;  3PF5 A;  3NEN A;  1UEB A;  2Q2I A;  1X9N A;  4B3S L;  2B3G A;  2YYZ A;  1T9H A;  4OWT B;  1N34 Q;  3H0G H;  4JI8 L;  2WB1 E;  4PZ8 A;  1N9W A;  1Z9F A;  4YHH Q;  1IBL L;  3STB D;  3HOU G;  3HOX G;  1B70 B;  3F2D A;  2E8G A;  3D0F A;  3PSI A;  1IL2 A;  2RHS B;  2KBN A;  4L5S A;  4LF7 L;  1XPU A;  2VZA A;  1Y14 B;  4GNX C;  2JE6 I;  4HIK A;  1P8L A;  2OQK A;  4WJ3 M;  3ULP A;  1CKN A;  3I4M G;  2Y0S E;  1WYD A;  1VQG A;  2AWO A;  1SLJ A;  2KEN A;  4A4I A;  1Y1W G;  4A3J H;  5IYB G;  2K50 A;  1HZ9 A;  1IYJ B;  2ALY B;  3PUZ A;  5GAE C;  3I56 A;  1J5E Q;  1PYS B;  5FLX c;  1C7Y A;  2ZM6 L;  2PNH A;  3KDF A;  2EQS A;  2PI2 E;  3EBE A;  4LW1 A;  4JI0 Q;  3PO3 G;  3CMA A;  3HOZ G;  4PZ7 A;  4JI5 L;  4IFD J;  1SRU A;  3GTQ H;  1P16 A;  2LSS A;  3FP9 A;  1HH2 P;  4P73 A;  1PA6 A;  2UUA L;  3UDG A;  1HNX L;  2JA7 H;  1M1K C;  2R6G A;  3TRZ A;  1IBK L;  4B3T L;  4DV7 Q;  1FJG Q;  4DNI A;  3H0G G;  2WAQ E;  3T1Y L;  4P72 A;  2R7Z H;  3K80 C;  5M5W H;  5GAH C;  3M7N A;  1JJC B;  1GO3 E;  4GS3 A;  1I3Q H;  4X62 Q;  2NZO A;  2XTI A;  2BA0 A;  4L5R C;  1Q7Y C;  4JI3 L;  2JJQ A;  4JI1 L;  1PFS A;  1YZ6 A;  3UE0 A;  4DK6 C;  2B29 A;  4LF6 L;  3PF4 A;  4DR2 L;  1X6O A;  2OTL A;  4JI7 Q;  2F52 A;  2QA4 A;  1OTC A;  2K5N A;  4A3J G;  2D0P A;  2F4V L;  2I0Q A;  2Q2T A;  3M4P A;  4DR7 Q;  3L0O A;  3A5Z B;  1PHJ A;  1BBW A;  1HJP A;  3KF8 B;  4JBM A;  3S17 H;  2JEB I;  1E22 A;  1GD7 A;  2JA9 A;  1U5K A;  3CCS A;  1W2B A;  4LUV A;  2VQF Q;  2RHQ B;  5LMN W;  5HY6 A;  4XIG S;  4DV0 Q;  1VQ4 A;  4A76 A;  4A75 A;  1XNR Q;  4C3I H;  2YTY A;  1G6P A;  4DV5 Q;  4EX5 A;  4A3K H;  2PQA B;  1K0R A;  3F2C A;  4GN5 A;  3RLN A;  4A3B H;  3UDI A;  2OTJ A;  2VL6 A;  2CWP A;  1H95 A;  1X65 A;  4LWC A;  3W1B A;  1HNX Q;  1VCI A;  5M3F H;  1IBK Q;  4QL5 A;  3CME A;  4B3T Q;  4YCW A;  5JJI A;  4DV3 L;  4JI2 L;  5IP9 G;  4BBS H;  1A0I A;  1G29 1;  5E7N A;  1KD1 C;  4A3C H;  1VQL A;  3L2P A;  4JOI A;  1JT8 A;  4DV2 L;  1PH1 A;  1TWA H;  4GKK Q;  1Z47 A;  2Z6K C;  4P74 A;  2JA6 H;  4L5Q A;  1L1O A;  4JI3 Q;  5M3M G;  1XMO L;  1UE6 A;  2D62 A;  1SR3 A;  5IYC G;  5C3E H;  3CC2 A;  2MQH A;  3S2H H;  1VQJ A;  4DR5 Q;  4JI6 L;  2Q2H A;  4A3G H;  2F4V Q;  2JA5 H;  1CKM A;  1L0W A;  3RR5 A;  1N34 L;  1FL0 A;  4A3K G;  1VQ5 A;  1JMC A;  1K73 C;  1KRS A;  3HKZ E;  1TWG H;  3M85 A;  4A3B G;  4X66 L;  4LFB Q;  2R93 H;  2ES2 A;  1G51 A;  2HT1 A;  4UP8 A;  3G4S A;  1PH6 A;  1SMX A;  1L2F A;  1IXR A;  1VQF A;  4A3E G;  2VUM H;  1PVO A;  3PUX A;  4NPS A;  3S1R H;  2IX1 A;  3H3V H;  4LFA L;  3H3V I;  1N32 Q;  2QEX A;  3HOU H;  2XGT A;  4A3C G;  1MJC A;  4HIO A;  2AMC B;  2R7D A;  4X64 Q;  2QGQ A;  4JI4 Q;  4A3I G;  2JA6 G;  1KL9 A;  1VQE A;  1UWV A;  4HJ9 A;  1A63 A;  4JBW A;  4JC0 A;  3S24 A;  3ULL A;  3U4V A;  2UXC Q;  1WFQ A;  5C3E G;  1I50 H;  4DV3 Q;  4JI2 Q;  5IYD H;  4IOA A;  1CSP A;  3KF6 A;  5IYB H;  4A3G G;  4BY1 G;  4WJ4 A;  1PH5 A;  2MO0 A;  4UY8 C;  1MJE A;  4KLK A;  4X62 L;  1XMO Q;  3HOZ H;  2K75 A;  2VUM G;  1PH3 A;  4DR3 Q;  4PMW A;  3AYH B;  4TQU S;  1NBW A;  5DLQ E;  3TEH B;  1EOV A;  4JI6 Q;  2JA8 G;  1IBM Q;  3ER0 A;  1XMQ Q;  4JI7 L;  4R1J A;  2ZTD A;  3M3Y H;  1YBY A;  1E1T A;  2MNA A;  4GOP B;  1EQQ A;  4LF4 L;  3K8A A;  4B3R Q;  4X66 Q;  1YIT A;  5IWA Q;  4AYB E;  4DR7 L;  5ELN A;  1EWI A;  1N33 L;  2PI2 A;  4KI0 A;  1EIY B;  4OWW B;  2VQF L;  3E9H A;  3CC7 A;  1PYB A;  5GRO A;  4BBR H;  2N49 A;  4L5T A;  4DV0 L;  4IOC A;  4LFA Q;  1X55 A;  3HOY H;  5JJK A;  5IYD G;  4TVA B;  1VQ8 A;  1HZA A;  1XNR L;  1VS0 A;  2NVY H;  2AWN A;  4YY3 Q;  4DV5 L;  3ERS X;  2L15 A;  3OTO Q;  1YIJ A;  1S72 A;  1E7Z A;  3S1N H;  5GAG C;  3BU2 A;  4IJH A;  4LF9 L;  2AKW B;  2NN6 G;  1Q46 A;  4BY7 H;  3H15 A;  1HR0 Q;  1MIU A;  4QQB X;  2DGY A;  3GTP H;  1QVC A;  3GD7 A;  3CCV A;  1EQR A;  4HJ7 A;  3ZJY C;  3PUV A;  1CKN B;  3CD6 A;  2HHH L;  1TXY A;  4DAM A;  1HNZ Q;  1FVI A;  1TWH H;  4RMF A;  3CCL A;  4OO1 G;  2IHE A;  1RIP A;  3KDF B;  3PIO A;  3KJO A;  4GKK L;  2N8N A;  4DKA C;  1PH8 A;  5LMU L;  5HGQ A;  1W3S A;  1X3G A;  4POG A;  4C3J H;  2VQE Q;  1VQD A;  4MZ9 A;  4BBR G;  4UPA A;  2ZTC A;  4DR5 L;  3HOY G;  5IP9 H;  3CCE A;  4NXN Q;  4LUO A;  4IPH A;  4LF4 Q;  3UDX A;  4HIM A;  1E1O A;  1WCM G;  5JEA G;  1D8L A;  3Q8D A;  1K9M C;  4LNQ A;  1BVS A;  4JV5 L;  2ZTE A;  1BKB A;  4LF8 Q;  4OX9 L;  1QZH A;  1N33 Q;  4RG1 A;  4BY7 G;  4LFB L;  3CC4 A;  5M3M H;  1VQ6 A;  1Q12 A;  2OQ0 A;  3AFP A;  4QY7 A;  4BA1 I;  4PG3 A;  5IYC H;  1WI5 A;  5ELO A;  3GTG H;  3HFZ B;  4DV4 L;  4BXX G;  3CF5 A;  3K7A H;  3HOV H;  1LUZ A;  3A0J A;  1N36 Q;  1GVP A;  1N32 L;  3S2D H;  2WB1 G;  4LF9 Q;  3D31 A;  2NVT H;  1I94 Q;  4X64 L;  2NVQ H;  2BA1 A;  4JI4 L;  3JC6 6;  1KRT A;  1IZ6 A;  3OYY A;  1LM0 A;  5FJ8 H;  3VDY A;  3TS0 A;  4A3E H;  3KJP A;  1V43 A;  4UP7 A;  2VNU D;  4O0A A;  1S40 A;  1OXX K;  2UXC L;  3W1G A;  2HHH Q;  1BBU A;  1OXT A;  4A3F G;  1CSQ A;  1QUQ A;  2RF4 A;  2Y0S G;  4C3H H;  5FLM H;  2R7F A;  3EIV A;  3OW2 A;  4JBK A;  4LFC L;  2YU9 H;  1N8R C;  3T1H Q;  2C35 B;  1PH4 A;  3LGJ A;  3U4Z A;  3RZD H;  1UE5 A;  1C0A A;  3GTK H;  1EYG A;  3KLW A;  3PV0 A;  4A3I H;  1TWC H;  1YEZ A;  1Y1V G;  1YHA A;  4R4I A;  5LMU Q;  2FXQ A;  1GKH A;  4NB3 A;  4YCU A;  4A93 G;  3TS2 A;  1I5F A;  4R4O A;  3DLL A;  3STB C;  1HR0 W;  4DR3 L;  5IT9 c;  2JQO A;  3HOV G;  4DK3 C;  2UXB Q;  4R4C A;  1IBM L;  2HIX A;  4GLV B;  3WWV A;  1PV4 A;  4BY1 H;  1XMQ L;  2ID0 A;  2WAQ G;  4JV5 Q;  4YWM A;  3G6E A;  1Q1B A;  3CCU A;  4GNX A;  4OX9 Q;  1DGS A;  3AQQ A;  4B3R L;  4GKJ L;  5IWA L;  4K0K L;  1L1O B;  2YTV A;  2E5L Q;  4IPD A;  5H1S E;  5FJ8 G;  1WOC A;  1K3R A;  2ATW A;  3HOW H;  4DR1 Q;  4UP9 A;  2DUD A;  4DV4 Q;  2JA8 H;  4AQY Q;  4KHP Q;  1JJ2 A;  3DM3 A;  1YHQ A;  5FLM G;  1MKH A;  2IX0 A;  4YWK A;  4DV1 Q;  2GVA A;  1Q1E A;  3J7Z C; 
#chains in the Genus database with same CATH topology
 1STG A;  2KHI A;  4A3D H;  4HCE A;  2QKI C;  1VQC A;  1SFO H;  3CPF A;  1HR0 L;  2ENB A;  3FVQ A;  1BCP B;  5EKL A;  4BBR B;  3Q0A A;  2F0M A;  2DY7 A;  2NVX B;  3CKI B;  4AH6 A;  2CCZ A;  3KLS X;  1KDC A;  2N78 A;  4KY7 A;  2NN6 H;  4DUZ Q;  4DAY A;  1WCM B;  1GM5 A;  1DCZ A;  2A69 D;  3HOW G;  4EQ5 A;  1DZ1 A;  1YVC A;  2F0Q A;  1WJJ A;  2GVB A;  5E4W C;  1J6Q A;  2VQE L;  3BJU A;  3GTP B;  4O2D A;  3K0Y A;  2ZJP A;  5IT9 E;  3UE1 A;  5CR3 A;  1YJ9 A;  2AUJ D;  4NKL A;  1VMP A;  4JW0 A;  4K5V A;  3NHH A;  4OO1 H;  1K8G A;  2NZH A;  4A3M G;  2MFI A;  2ASB A;  5CV7 A;  1JWU D;  2DNE A;  5AJ3 L;  1F9P A;  4I7Z C;  4IAL A;  4FF3 A;  4ME3 A;  2F0F A;  3TP6 A;  1VQK A;  1PRT C;  3GTM H;  2HQE A;  1N36 L;  1L1O C;  3HKZ G;  3FDT A;  4YCV A;  2I07 B;  4OWX B;  4NDX A;  3NPP A;  4HID A;  3LWE A;  1VQA A;  3VYR A;  3DXJ C;  3HOV B;  5IGE A;  4LJZ C;  3A74 A;  2N88 A;  5C5L A;  3E9I A;  2WAQ B;  1OXV A;  5IP7 G;  1F77 A;  3GO5 A;  3CCJ A;  4JYA Q;  2FMC A;  1V9P A;  1VQH A;  3VA5 A;  2UXB L;  3VYU A;  2HDM A;  3CW2 C;  4H02 A;  4MTN A;  3SK4 A;  1KC8 C;  2HIV A;  2YU9 B;  1SBB B;  1Y1V H;  3AB9 A;  5J1Z A;  1NUC A;  1I6H H;  1MSH A;  1RTO A;  1UNS A;  1EIF A;  2EDG A;  4CKB A;  3A8J E;  3RD4 A;  2RCN A;  4CJ2 C;  2JEA I;  1EU4 A;  4DV1 L;  4DR6 Q;  3T53 B;  5A2Q L;  4B3S Q;  3GTO B;  3S15 H;  2ZXR A;  3J81 i;  3DMU A;  5D14 A;  2XRQ D;  3ERO A;  4X65 L;  3K57 A;  2CFM A;  1B9M A;  4KV6 A;  3S14 B;  3RLF A;  2JA7 G;  1HPC A;  2KOL A;  3KFU A;  5EBC A;  3VR5 A;  2BE5 D;  1WTR A;  4DUZ L;  4CJ0 B;  3CAM A;  3CP0 A;  4ABN A;  2RVL A;  3GP7 A;  3OMG A;  2H5X A;  1RF2 D;  1SRO A;  3F2B A;  2R92 B;  1PRT F;  5I9O A;  4FO2 A;  4ZLT F;  3OMC A;  1LTG D;  1HA5 A;  3JAM E;  2F3W A;  3A7A B;  3H94 A;  1NTG A;  1RKN A;  4N9T A;  4LF6 Q;  1CZW A;  2XIW A;  1XNQ Q;  4JK1 C;  2KCT A;  5C4J B;  1O78 A;  4A3M H;  4YHH L;  2PO4 A;  3T13 A;  1DD2 A;  4E6I A;  5I6W A;  1FNV A;  5M3F G;  5L37 A;  4A3L G;  1NCV A;  3FPP A;  2K01 A;  1ICW A;  3QJY A;  3C2P A;  1R4P B;  1STE A;  1NE3 A;  1JOQ A;  1Q8K A;  1F9Q A;  1GUG A;  1X54 A;  3F1Z A;  5COY A;  1LTL A;  2N3S A;  4JI0 L;  2OT2 A;  1KNA A;  3F8T A;  4OXP A;  1YHB A;  1IL8 A;  4WOR A;  3GTJ H;  1AE2 A;  1VQ9 A;  2KCC A;  3I4M H;  3RLO A;  4IPC A;  4DAY B;  5IP7 H;  3M4O H;  4L6T B;  1QZG A;  2F3I A;  4B9X A;  2B63 B;  3FMC A;  2R93 G;  1LTS D;  4MTK A;  1SMY C;  3I7F A;  4ILW A;  5DM7 3;  4HJ8 A;  2GA4 B;  4K8J A;  1X9N A;  4B3S L;  4OWT B;  4HTH A;  2WB1 E;  3HOU G;  1Z9F A;  1B70 B;  3PSI A;  1IL2 A;  2RHS B;  1XPU A;  3TN2 A;  1Y14 B;  2JE6 I;  1P8L A;  4WJ3 M;  2Y0S E;  2AWO A;  2AUK A;  3MZ5 A;  2K50 A;  3NTH A;  3SK5 A;  1IYJ B;  1J5E Q;  5IGF A;  3BYT B;  5HUR A;  5FLX c;  2CHB D;  1EQV A;  3EBE A;  4LW1 A;  3PO3 G;  3HOZ G;  1SRU A;  2LSS A;  2DJG C;  2SEB D;  5T1I A;  1PA6 A;  2JA7 H;  3UDG A;  1A3V A;  1A15 A;  4B3T L;  4DV7 Q;  1JR0 D;  3A8I E;  1FJG Q;  1XWE A;  1GO3 E;  4Y7N B;  1I3Q H;  2XTI A;  2BA0 A;  3EJI A;  2JJQ A;  1PFS A;  1YZ6 A;  3PO2 B;  3BZD B;  1SE4 A;  4LF6 L;  3OIQ A;  2QIL A;  1LAB A;  2D0P A;  2I0Q A;  2F4V L;  1HJP A;  4BBS B;  4IUV A;  3V96 A;  4H44 C;  1U5K A;  1AP0 A;  2RHQ B;  4HED A;  4XIG S;  3TP5 A;  1XNR Q;  5C5M A;  1Q3L A;  4DV5 Q;  4EX5 A;  5JAV A;  1K0R A;  2JA5 B;  2VL6 A;  4C2M B;  3E0J A;  1H95 A;  4LWC A;  3W1B A;  1HNX Q;  1B3A A;  5M3F H;  1CHP D;  3A8K E;  1QWY A;  5IP9 G;  1A0I A;  2EYJ A;  1KD1 C;  4JOI A;  1TWA H;  4P74 A;  2Z6K C;  4L5Q A;  1I4X A;  4JI3 Q;  4FP5 D;  2B2U A;  5IYC G;  1QB5 D;  5C3E H;  5FLX L;  1C4Q A;  4JI6 L;  1FD7 D;  2Q2H A;  4XT1 B;  1BCP D;  4A3G H;  1K83 B;  1L0W A;  1Y1W B;  3HKZ E;  1TWG H;  3M85 A;  1O7Z A;  4XYQ A;  2R93 H;  1HUN A;  2ES2 A;  1G51 A;  2L12 A;  4UP8 A;  3J7Y W;  1VQF A;  2VXW A;  3ND9 A;  3PUX A;  4NPS A;  2IX1 A;  3OW7 A;  3DEP A;  4C3H G;  1B53 A;  3HOU H;  4A3C G;  5ISR A;  1DOK A;  1MJC A;  5BN4 A;  1WTH A;  2WAC A;  3DHQ A;  3H0G B;  4A3I G;  2F0T A;  4CDE C;  2K32 A;  2Q8I B;  1WFQ A;  2M00 A;  4DV3 Q;  3KF6 A;  4BY1 G;  2RBM A;  4QUF A;  1ESR A;  2K5W A;  3VA7 A;  4A3J B;  2NVY B;  1ET9 A;  3LX0 A;  3HOZ H;  1QOH A;  2K75 A;  1PZJ D;  1RTN A;  4EVO A;  4PMW A;  3AYH B;  1EOV A;  2NTS A;  2G5D A;  1ILQ A;  3ER0 A;  1SJH D;  2IWH A;  2ZTD A;  3L3O C;  2QDL A;  1E1T A;  1EQQ A;  4LF4 L;  1DM0 B;  5ELN A;  3NTK A;  1TII D;  1N33 L;  5E3F A;  3AMU A;  1EIY B;  4BBR H;  4IOC A;  2K7V A;  4TVA B;  2SDF A;  1XNR L;  1IW7 D;  2RA4 A;  1Y69 U;  3TSS A;  1LTA D;  4DV5 L;  1B44 D;  2L15 A;  3BU2 A;  1HUM A;  4N8F A;  1YNJ C;  1G91 A;  4Q0F A;  3GTP H;  1A6X A;  3GD7 A;  5G3L F;  3CCV A;  3PUV A;  2HHH L;  1TXY A;  2WKD A;  2XNA C;  3DEO A;  4C3I B;  2IHE A;  1RIP A;  4H0L C;  3DWQ A;  4A3K B;  3VYS A;  4A3B B;  3NK9 A;  1VMC A;  2A6H D;  2NUC A;  4POG A;  2E76 C;  3E5S A;  4A3E B;  1D1K A;  2NB0 A;  5IP9 H;  1ILP A;  4IPH A;  3UDX A;  4HIM A;  1K9M C;  4LNQ A;  2XWB B;  1BVS A;  4X3U A;  4CDD C;  4LF8 Q;  1QZH A;  1VQ6 A;  1Q12 A;  2PYK A;  3GTK B;  3AFP A;  3W2D A;  1E0B A;  1JOR A;  1IKL A;  3KBX A;  4PG3 A;  5IYC H;  3HFZ B;  3CF5 A;  3HOV H;  3I73 A;  1SJE D;  1VF5 C;  2DNC A;  4LF9 Q;  3D31 A;  3LNN A;  2F0D A;  3IFT A;  2EZV A;  1B2T A;  4DFA A;  1IZ6 A;  3OYY A;  1LM0 A;  3TS0 A;  3KJP A;  4UP7 A;  2VNU D;  1I4R A;  1I4G A;  3K5M A;  4A3F G;  1CSQ A;  5ELF A;  3RUZ A;  4C3H H;  5FLM H;  1XYI A;  2YU9 H;  3MA2 B;  1PH4 A;  1A3U A;  3U4Z A;  1EYG A;  1Y8O B;  4A3I H;  1YHA A;  5LMU Q;  4YCU A;  1IHZ A;  1QNU A;  1XXG A;  4A93 G;  3NQT A;  3MEH A;  5IT9 c;  2L0C A;  1CA6 A;  3BVM A;  4BY1 H;  4JV5 Q;  1Q1B A;  1QE6 A;  4GNX A;  4GKJ L;  4DK1 A;  4J8Q A;  3BDO A;  2YTV A;  2E5L Q;  4IPD A;  1KAA A;  1SYB A;  2EOT A;  4DR1 Q;  3HZX A;  4UP9 A;  4DV4 Q;  4KHP Q;  1JJ2 A;  3I90 A;  3QOJ A;  4FF4 A;  1Q1E A;  4WFN 3;  1DYQ A;  3MWY W;  3VR3 A;  1VQB A;  2UUC Q;  1II3 A;  3NSW A;  1EEF D;  2WII B;  5C0X I;  4Q5V A;  5CGK A;  3CCQ A;  4G7H C;  1PZK D;  5CMD A;  1Q81 C;  3CHB D;  1KXL A;  2K04 A;  3OIP A;  1WTQ A;  2F0E A;  2OEO A;  1R9T B;  1SND A;  2I5H A;  4LFC Q;  3J80 i;  2B8G A;  3BZK A;  2KHJ A;  4ZK9 B;  5C3X A;  1K0S A;  1EY5 A;  3G48 A;  1I4H A;  1CTM A;  1PDQ A;  1LTT D;  2CKZ B;  2PMZ B;  1OXS C;  3K7U C;  4CKE A;  4DF7 A;  1NMF A;  5D3I B;  1KQS A;  3KF6 B;  2CWA A;  3E0E A;  1EIH A;  3TQY A;  4B08 A;  4YIJ A;  1AZQ A;  4IFD I;  4XTC S;  2EXD A;  2UUB Q;  4A3D G;  4GZY C;  2NZ1 D;  4RHR A;  4LF8 L;  4IPG A;  4WRD A;  4IO9 A;  4X3K A;  3I4N G;  1GUT A;  2F0I A;  2A73 B;  2EJF C;  1HNW Q;  3RNU A;  2Q2U A;  1S3O A;  4ZAI A;  2K33 A;  3I2Z A;  2L1B A;  4IZ8 A;  3I55 A;  3S1Q H;  4P71 A;  3M4Q A;  2VB3 X;  1LV9 A;  5M5X B;  1ASZ A;  4DUY Q;  3J7A V;  3BVG A;  4DV6 Q;  5KNC A;  4O1N A;  3K7A B;  1YNN C;  1YI2 A;  4IJL A;  2B63 H;  2IX3 A;  2EY2 A;  2JSO A;  5JJL A;  5IGG A;  3RN2 A;  5I9P A;  4A3F H;  3IFD A;  3MXG A;  3M7G A;  4KJN A;  3CXC A;  3UDF A;  4XQN A;  1TS2 A;  1JE5 A;  4OIK A;  2OCE A;  1SNO A;  4NMZ A;  2G9D A;  5CV8 A;  5LL6 S;  3S16 H;  3JAM c;  3TRE A;  2OWO A;  4K8I A;  2K6A A;  4MN3 A;  3PUY A;  2J0T D;  1GUO A;  3KYH C;  4A93 H;  5J39 A;  2E5L L;  1TWC B;  4OON A;  5AJ3 Q;  4DR1 L;  1X3E A;  5KND A;  1VQM A;  3GQB A;  4KHP L;  2GN5 A;  2WP8 J;  1CFM A;  1D1I A;  1PFM A;  3FPU B;  1GUS A;  5EPK A;  2UUC L;  4AYB G;  2E2H B;  3EN2 A;  4JI8 Q;  5IGD A;  1IBL Q;  1PH7 A;  1U4R A;  1KAW A;  2O2L D;  4QMG A;  2MO1 A;  4RA8 A;  2E2J B;  2KCM A;  3L7Z C;  1TWF H;  4RFB A;  2IY5 B;  1JC7 A;  4R8I A;  1A62 A;  2RDG A;  2MP1 A;  4Y7N H;  4JBJ A;  5T1G A;  5K36 H;  5KRU A;  3PO2 H;  2QEJ C;  2B2V A;  3L9A X;  3WDN A;  5I2Y A;  5FKA C;  3PCO B;  2B2W C;  3FKI B;  1STA A;  3HKS A;  2UUB L;  2XN9 C;  1BDO A;  5CBA E;  1O7Y A;  5C44 B;  3RZO B;  3A56 A;  1HNW L;  1HXY D;  2VW9 A;  4OL7 A;  2A6E D;  1ENF A;  3WOE A;  1ASY A;  4DR2 Q;  1UUP A;  1F9S A;  4GNX B;  1BNZ A;  2ICI A;  1CQV A;  1XJV A;  2Z0S A;  5C4X B;  2EY1 A;  1SE8 A;  2KCN A;  5IE8 A;  4F7X A;  2I5M X;  3I4N H;  4QB4 A;  4C2M H;  4F8M A;  4X65 Q;  1SE3 A;  1NY4 A;  1JOO A;  4IQZ A;  1YNX A;  5IY0 A;  4DUY L;  2VS1 A;  4DV6 L;  1EQT A;  1LTI D;  2HCC A;  4G4K A;  3K5L A;  1E2Z A;  5FO8 B;  5KGU A;  4J6H A;  2L9H A;  4B9W A;  3A5U A;  3J81 E;  1WVL A;  1PTO C;  2K5H A;  3NP8 A;  1PYW D;  3QIA A;  2B2T A;  4K14 A;  4JVZ A;  2A8V A;  4BA2 I;  5EAY A;  2LXK A;  1K83 H;  1VF7 A;  1Y1W H;  1EY6 A;  3GTL H;  3K6O A;  3CRL C;  2F0U A;  1Q86 C;  4ULL A;  4ZUI A;  2ZJQ A;  5KNB A;  2HCI A;  1HRJ A;  2Z1C A;  3T51 B;  5ELC A;  1UEB A;  3GTQ B;  2N55 A;  2B3G A;  2MPM A;  2YYZ A;  1EFI D;  4HMJ A;  1MSG A;  3NWT A;  3H0G H;  4JI8 L;  4YHH Q;  1IBL L;  3STB D;  3F2D A;  2EVB A;  4KKS A;  3D0F A;  2SNS A;  3D3R A;  2R7Z B;  1K8M A;  4RGO S;  3QR8 A;  2F3V A;  1T5X D;  1CKN A;  3I4M G;  4A4I A;  2IPK D;  1SLJ A;  1RJT A;  3HS0 C;  4A3J H;  4X3S A;  3BS1 A;  3I56 A;  1B3Q A;  3FRP B;  3K58 A;  2E2I B;  1PYS B;  1EY8 A;  1D5X C;  2EQS A;  2PI2 E;  4JI0 Q;  3CMA A;  4P73 A;  2R6G A;  3A54 A;  1IBK L;  2F03 A;  2K28 A;  3RMH A;  4DNI A;  4IUP A;  2Z4I A;  1JJC B;  1EWC A;  1SSO A;  2NZO A;  3KBG A;  3IKJ A;  3Q6S A;  1LT3 D;  2RKS A;  4L5R C;  3T56 B;  5IGB A;  3UE0 A;  4L8J A;  4DR2 L;  2FHT A;  4HMI A;  2F52 A;  2QA4 A;  5C4Z A;  3I8Z A;  1WTW A;  4DR7 Q;  3A5Z B;  1BBW A;  2JEB I;  3K5O A;  2JA9 A;  1PTO F;  1BUV T;  2A69 C;  5HY6 A;  1VQ4 A;  1S5C D;  3SXH A;  4C3I H;  2YTY A;  3K59 A;  4A3K H;  4A3B H;  4DK0 A;  3T16 A;  2MHV A;  1X65 A;  5EKI A;  1R4Q B;  1VCI A;  4C3J G;  4QL5 A;  2X6G A;  3CME A;  4B3T Q;  1JOK A;  4FYD A;  2AQ3 B;  4JI2 L;  1CQF A;  3KLR A;  5E7N A;  1VQL A;  3L2P A;  1ZKO A;  1E2W A;  2RDH A;  2Z9H A;  1SXT A;  2D2C C;  4GKK Q;  2SNM A;  1L1O A;  3HOX B;  5M3M G;  1O80 A;  1XMO L;  4LAA A;  1UE6 A;  3MXU A;  3MTS A;  4RCO A;  3SVM A;  2HDL A;  1H9S A;  3S2H H;  2E75 C;  2F4V Q;  3EFX D;  1I50 B;  3RR5 A;  1JMC A;  1K73 C;  4HSP A;  4X66 L;  2L11 A;  3S1M B;  1STB A;  2CW0 D;  1RHP A;  1SMX A;  1L2F A;  5EQ0 A;  4DGZ A;  4UHV A;  3SK8 A;  2QEX A;  3C1F A;  5ELE A;  4HIO A;  2DY8 A;  4XXE A;  3I91 A;  2K05 A;  1KL9 A;  2QCP X;  1SYE A;  4JC0 A;  3ULL A;  3NBI A;  1ZEQ X;  5C3E G;  2D5D A;  4PV1 C;  3Q22 A;  5IYD H;  1EOT A;  1ENA A;  1SYD A;  4IOA A;  1DON A;  4A3G G;  2BOS A;  4DXG A;  3EA6 A;  1I6V C;  1PH3 A;  1FGB D;  4MIU A;  1S4Z A;  5DLQ E;  4JI6 Q;  1MD2 D;  4K6L A;  3A55 A;  5JVG 3;  3KLS A;  2MNA A;  4K0K Q;  1A63 A;  2KJX A;  4B3R Q;  4DR7 L;  5IWA Q;  4AYB E;  1FNU A;  5E4X A;  2BE5 C;  5M5W B;  4QUC A;  5LHY 1;  1Z6H A;  1PYB A;  1GJX A;  2N49 A;  3HOY H;  2XSC A;  1V8Q A;  1VQ8 A;  1VS0 A;  3OTO Q;  5JEA H;  5C3W A;  5GAG C;  4IJH A;  1JIC A;  1WD0 A;  1EY9 A;  5EBD A;  1MIU A;  1G2S A;  2E2D C;  2LS0 1;  3WOF A;  5CC4 A;  1CKN B;  2LY7 A;  3KK7 A;  3NBH A;  4DAM A;  1HNZ Q;  3GTG B;  1TWH H;  1WTO A;  3PIO A;  3S2D B;  2V4D A;  4GKK L;  2N8N A;  1PH8 A;  3MFG A;  1TQO A;  1X3G A;  4RHS A;  4ZKB B;  4C3J H;  4DN4 M;  5FK9 C;  4BBR G;  3SHL A;  2JXM B;  4ZQ3 A;  2F0L A;  3R2T A;  1DXM A;  4LF4 Q;  3MXN A;  1WCM G;  1N33 Q;  3ONA B;  4RG1 A;  3CC4 A;  5M3M H;  2OQ0 A;  2JA6 B;  1F2Y A;  4X3T A;  2K03 A;  3K7A H;  1LUZ A;  1LTB D;  5KEE A;  3DWA A;  2L4N A;  1CZG A;  2RQX A;  4DAP A;  2C5C A;  2J4X A;  1AFP A;  1B50 A;  4TSS A;  3DWP A;  1S40 A;  2EY5 A;  3W1G A;  3OHX C;  2HHH Q;  2VUM B;  1QUQ A;  2JA8 B;  2RCF A;  3R8B A;  1NSN S;  2C35 B;  2FFK B;  3LGJ A;  3RZD H;  1C0A A;  4ZRZ A;  1TWC H;  4R4I A;  1HA6 A;  2FXQ A;  1GKH A;  3SK6 A;  1I5F A;  4R4O A;  2ICE C;  1U4P A;  2FIN B;  1SFO B;  5LL6 X;  3HOV G;  4R4C A;  4GLV B;  2ID0 A;  2WAQ G;  3AU7 A;  1ENC A;  1PRT B;  3CCU A;  4B3R L;  4K0K L;  5IWA L;  1L1O B;  1WOC A;  2ATW A;  2DUD A;  4AQY Q;  1H9S B;  3DM3 A;  5FLM G;  2GVA A;  2L5T A;  3T1H Q;  4PNY A;  2UXD L;  3V05 A;  1SN8 A;  5IGC A;  1S5F D;  5IIF A;  5C0X H;  5I4D A;  3OTO L;  3M3Y B;  5EPJ A;  1HZB A;  1FR3 A;  1CM9 A;  4C1N I;  1UAP A;  4ZYS A;  2X6L A;  4G7Z C;  1EYD A;  5GAD C;  1K8A C;  4QIW E;  1ICF B;  3PIO 3;  1HNZ L;  3LWU A;  5M9O A;  4KD3 A;  3GTM B;  2EJG C;  1PLF A;  2Z6B A;  5C44 H;  4ALP A;  2LXJ A;  3R2I A;  3AEV A;  4BY7 B;  3IL8 A;  1SYF A;  3P7J A;  4PQX A;  4R4T A;  4R4Q A;  1CA5 A;  4GKJ Q;  4IFD H;  4HSV A;  1JQY D;  5A35 A;  2WB1 B;  4TKO B;  5BR8 L;  3X3N A;  3D8G A;  5EKK A;  1WTP A;  4KD4 A;  2NVX H;  3ITP A;  4QGU A;  1SAP A;  2R92 G;  2VY3 A;  1EY7 A;  2Y0S B;  1K28 A;  1WCM H;  1B7Y B;  3KOJ A;  1E24 A;  3C46 A;  1SYG A;  1Y1V B;  2DN8 A;  4ODG A;  1I6H B;  4RGM A;  2KA7 A;  1JJG A;  1BBX C;  2Z6K A;  3NEM A;  2C9O A;  3DUZ A;  2MUY A;  3U9S A;  4DPG A;  1M90 C;  3ND8 A;  1BCP C;  2NVQ B;  2CQA A;  4IUR A;  4UDU C;  3NBH B;  2I46 A;  1XTD A;  4WJW A;  3B6Y A;  3UI2 A;  3J80 E;  4FDB A;  4O42 A;  4QJF A;  5AFW A;  1QVF A;  1KLU D;  5KYL A;  4RGT A;  4APV A;  1PFB A;  3KF8 A;  3I4O A;  2EPB A;  2K5V A;  4AQY L;  3CPW A;  4GOP C;  3GDE A;  1GHK A;  2Z8L A;  2JN4 A;  3MXN B;  4DNR B;  3T1H L;  3P75 A;  1UEA B;  3K0X A;  1KHI A;  2E2I H;  2B63 G;  1Y8N B;  3KUP A;  2IJ0 A;  1F2Z A;  2ZXP A;  4KN4 C;  2A74 C;  2EJM A;  1CKO A;  4ZUJ A;  4LF7 Q;  3VYT A;  2J7Z A;  3HOW B;  1ZYR C;  3H09 A;  1SNQ A;  1V1P A;  1VQP A;  2F0K A;  3N6R A;  4FXG C;  1XPO A;  1NMG A;  3J81 c;  5CBE E;  3RN5 A;  4OEM B;  4A3M B;  3PQI A;  2F0O A;  1TS4 A;  1QUQ B;  4YWL A;  5FOB B;  4HJ5 A;  3GTO H;  3BDL A;  4KHZ A;  4LUZ A;  1QG7 A;  2IHF A;  2KVM A;  3T1Y Q;  3HKZ B;  3QWN A;  2K52 A;  1UE7 A;  2Q8R E;  3CCM A;  3S14 H;  4JCV E;  1EFW A;  1E3P A;  5LMN L;  2NWG A;  3K81 C;  2EIF A;  3PUW A;  4FNF A;  2ZXO A;  3GV3 A;  4M1U B;  5ELD A;  2IT1 A;  3GTJ B;  3HEJ A;  4K6D A;  3M4O B;  5K36 G;  3PO2 G;  2R92 H;  1QVG A;  3J7A 5;  1EIG A;  2A6H C;  1RL2 A;  5JVH 3;  2F1M A;  2LMC B;  1B1Z A;  5E1F A;  4BBS G;  3PGZ A;  3PIP A;  1JB7 A;  4Y52 H;  3HOX H;  1UE1 A;  4V19 0;  2X69 A;  3J81 j;  1B8A A;  4IUN A;  4HAE A;  2ZJR A;  5C4J H;  4EQP A;  2CQO A;  1A8V A;  2VB2 X;  4BS9 A;  4FVM A;  2JA5 G;  1VQN A;  4GOP A;  3S1M H;  2EYP A;  2KEE A;  1LO5 D;  4IN3 A;  5J22 A;  2PCF B;  3J81 L;  2F0G A;  2BDN A;  3NEN A;  2Q2I A;  2JA7 B;  5IT9 L;  2PZW A;  5JPN C;  1A2T A;  2CH4 W;  4LF7 L;  1EY4 A;  4L5S A;  2A68 D;  1S5D D;  2VZA A;  1I3Q B;  1JCK B;  3OPO A;  1STY A;  3ULP A;  3OOC A;  1Y1W G;  1VQG A;  1LT5 D;  5IYB G;  1EY0 A;  2ALY B;  3PUZ A;  5GAE C;  3O13 A;  3KDF A;  1SEB D;  2PPB C;  2EYM A;  4RGN A;  1MI2 A;  1P16 A;  3FP9 A;  1HH2 P;  3CQZ B;  1M1K C;  3NE5 B;  1RD9 D;  1CK1 A;  1SNM A;  3H0G G;  2WAQ E;  3T1Y L;  3K80 C;  5M5W H;  5GAH C;  2R3Z A;  1Q7Y C;  5M5Y B;  4DK6 C;  3K5N A;  3MHB A;  5JJZ A;  2OTL A;  5M3F B;  4JI7 Q;  1OTC A;  2K5N A;  4A3J G;  3G6J B;  2Q2T A;  3M4P A;  3L0O A;  1PHJ A;  4JBM A;  1PFN A;  3KF8 B;  2CVR A;  1GD7 A;  1L0X B;  2FMM A;  1HHV A;  3CCS A;  1W2B A;  1TWA B;  4LUV A;  1XTC D;  5I6Y A;  2VQF Q;  1A3T A;  5LMN W;  4DV0 Q;  2TMP A;  3PIP 3;  4A75 A;  1G6P A;  2KQ3 A;  3NUC A;  3TME A;  1BXT A;  3F2C A;  3SE0 A;  1QCB D;  4GN5 A;  2OTJ A;  1D6E C;  2CWP A;  1PRT D;  1TWG B;  4CKC A;  1AEX A;  1V1P B;  2R93 B;  1IBK Q;  5JJI A;  4C1N K;  4BBS H;  4QF4 A;  4DXF A;  1JT8 A;  1PH1 A;  3HGB A;  3HOU B;  1Z47 A;  2JA6 H;  1W6K A;  2D62 A;  1A2U A;  3CC2 A;  3QO2 A;  4C3I G;  2OF1 A;  2JA5 H;  1CKM A;  1FL0 A;  4A3K G;  1VQ5 A;  3Q24 A;  1D2B A;  4A3B G;  4LFB Q;  2H4O A;  2HT1 A;  1RCV D;  3JAM L;  3G4S A;  2VUM H;  1IXR A;  4A3E G;  3PO3 B;  3HOZ B;  1X3Q A;  3D4D A;  4LFA L;  3H3V I;  4HN7 A;  2IW3 A;  3NWS A;  2AMC B;  4X64 Q;  4OIJ A;  4MHE A;  1VQE A;  2F0W A;  4OEL B;  1UWV A;  2BDO A;  3R93 A;  4JBW A;  1CI3 M;  4KTA A;  2UXC Q;  5BN5 A;  4K2L A;  4JI2 Q;  5IYB H;  2EXZ A;  1M8A A;  3VR2 A;  1PXU A;  1NR4 A;  1T5E A;  1KLG D;  1XMO Q;  4DR3 Q;  1LT6 D;  1E2V A;  4F88 A;  4HCS A;  1XMQ Q;  4JI7 L;  1LAC A;  3M3Y H;  1YBY A;  4GOP B;  3K8A A;  4X66 Q;  1YIT A;  4UAI A;  2PZU A;  1DJR D;  3H91 A;  2F0N A;  4I65 A;  2D9U A;  2PI2 A;  2QW7 A;  4KI0 A;  2VQF L;  3E9H A;  1HTL D;  5JJK A;  4DV0 L;  4KK7 A;  3C3L A;  5IYD G;  1SNP A;  1ET6 A;  1W6J A;  1HZA A;  2G9H D;  2NVY H;  4YY3 Q;  1YIJ A;  1E7Z A;  5EJW A;  3MXP A;  2AQ1 B;  3I4L A;  1Q46 A;  2R61 A;  4KKT A;  2B2W A;  3H15 A;  4BY7 H;  4H13 C;  3S17 B;  3NTI A;  5JPM C;  2DGY A;  1EU3 A;  1QVC A;  1EQR A;  4HJ7 A;  4EQO A;  3TDQ A;  2A6E C;  1X3P A;  4S3S A;  3CCL A;  2PZT A;  3D6C A;  3R3O A;  4RKL A;  3KDF B;  5CV4 A;  3KJO A;  2KEC A;  1BR9 A;  5HGQ A;  1W3S A;  4ME5 A;  3A7L A;  4UPA A;  3HOY G;  4DU9 A;  4NXN Q;  4LUO A;  4C3H B;  1E1O A;  2EYO A;  5JEA G;  1D8L A;  2ZTE A;  4OX9 L;  4LFB L;  4P2C B;  4A3I B;  2WV6 D;  4BXX G;  4EQN A;  1DOM A;  1L0Y B;  4G7O C;  2K1B A;  3TZD A;  2ZT9 C;  1PMR A;  4FF1 A;  1I94 Q;  4BY1 B;  4X64 L;  4RH6 A;  2BA1 A;  2NVQ H;  1SMY D;  3JC6 6;  1KRT A;  5FJ8 H;  3VDY A;  4A3E H;  1V43 A;  4O0A A;  1OXX K;  1QNK A;  2UXC L;  1OXT A;  2E74 C;  1GUW A;  2R7F A;  3BG3 A;  4U68 A;  3OW2 A;  3S1R B;  3IAY A;  4JBK A;  1ROD A;  4F87 A;  4CBV A;  1UE5 A;  3GTK H;  2NYZ D;  3KLW A;  3PV0 A;  1AN8 A;  1YEZ A;  3STB C;  1HR0 W;  4DR3 L;  1HCZ A;  1O7L A;  5NUC A;  2JQO A;  4KKU A;  1EYC A;  1PV4 A;  1XMQ L;  5IOC A;  1DGS A;  3AQQ A;  1S5B D;  3HOW H;  1K3R A;  2O4X A;  2F0S A;  2QDB A;  1GHJ A;  1KTK A;  1Q8I A;  1M4V A;  3J7Z C;  2F4I A;  5CV6 A;  4YY3 L;  1C9O A;  2A1A A;  1BQQ T;  2DJF C;  1IYV A;  3FHW A;  3N52 A;  4DR4 Q;  2KHS A;  4B3M Q;  2YV5 A;  1AZP A;  1FNW A;  3C1E A;  3U58 A;  4KJO A;  1J9O A;  2A19 A;  3BYY B;  1HQM C;  1JE4 A;  1KDA A;  2NN6 I;  4L63 B;  2TSS A;  3W3A A;  3S1N B;  3S1Q B;  4IUU A;  3TBI B;  2PW5 A;  4JYA L;  1U4M A;  1D5M C;  2HUG A;  3J80 c;  3MVV A;  3NXW A;  4NXN L;  3E3X A;  4OO1 I;  3ICE A;  2XVS A;  5C0X G;  4J1M A;  1VQ7 A;  4JPB W;  1LT4 D;  1OXU A;  1O7I A;  3VR6 A;  1R9T H;  3P20 A;  4XYO A;  3SEB A;  4JOI C;  3FKI G;  5FO7 B;  4A3F B;  1H9M A;  2K4K A;  3MEF A;  2UXD Q;  1QIL A;  1TKW B;  4DR6 L;  5EGT A;  2WIN B;  5G3L D;  1I94 L;  3IRB A;  3S16 B;  2B2U C;  5C44 G;  2XRS D;  4JG2 A;  4BXX H;  4A93 B;  2V1C C;  1BO0 A;  5COR A;  2AHO B;  4NXM Q;  5C4X G;  1V1O A;  4G57 A;  4N9P A;  4IFD G;  5J3B A;  3JAM i;  2NVT B;  5CV9 A;  2UU9 Q;  2B39 A;  1JWM D;  5A2Q E;  1CHQ D;  3G71 A;  4CDF C;  1K3B C;  4LK1 C;  2HD3 A;  2CW0 C;  1V1Q A;  1JWS D;  3U50 C;  1XPR A;  1TWF B;  5BR8 Q;  1EUJ A;  2HQL A;  5M5X H;  4K5X A;  3I70 A;  4X6A H;  3J7A F;  1MHW C;  1C8C A;  4LF5 Q;  4FF2 A;  5EPL A;  5KIX A;  2RSO A;  1Q82 C;  1KDB A;  5JEA J;  1NNX A;  1QJO A;  4OGQ C;  3FEW X;  5JOB A;  4XT3 B;  1NJI C;  3MC0 B;  5DEH A;  1CUK A;  1F2M A;  1PH2 A;  3QOL A;  1XNQ L;  1HQR D;  4KN7 C;  3URY A;  2PQA A;  1C48 A;  4MNO A;  4DNT B;  4M8A A;  3J80 L;  4P75 A;  2WKC A;  4B3M L;  4DR4 L;  3CQZ H;  4CJ1 B;  2SOB A;  5CYU A;  2WFW A;  1G8Z D;  1PTO B;  1Z7T A;  1KIX A;  2K14 A;  3BDC A;  1D7Q A;  1YJW A;  4A3D B;  2B2Y C;  2R7Z G;  2ZM6 Q;  2PNR C;  3F2U A;  1ML0 D;  5M5Y H;  4LMQ D;  3I4N B;  4JI5 Q;  4J15 A;  2UUA Q;  4C56 C;  3ULJ A;  2E2H H;  4GLX A;  4A3L H;  3CCR A;  1G6Z A;  3ERQ A;  1LYL A;  1YNJ D;  1MBY A;  4V0B A;  5C4H A;  1NR2 A;  3W5O A;  2E2J H;  5GQO A;  2JP1 A;  1F9R A;  2RSN A;  1KAB A;  4PMB A;  1H9R A;  2M9V A;  3M9B A;  4JI1 Q;  5BN3 A;  2MJ8 A;  4EGV A;  2BH8 A;  2JYO A;  1YJN A;  1X3F A;  1EL0 A;  3GTL B;  1U0L A;  4R8N A;  3OWF A;  3FKI H;  4RAU C;  1SYC A;  1J8I A;  1X56 A;  5HGT A;  4NXM L;  4AIM A;  2D0O A;  4I7A A;  1ONL A;  4H7B A;  2KED A;  4GN3 B;  3RZO H;  2UU9 L;  1J5E L;  3SGI A;  4XQJ A;  1U9R A;  2B8F A;  4IUT A;  2YTX A;  3GV6 A;  3S9W A;  1STH A;  1VQO A;  5C4X H;  1ESF A;  5ELB A;  1G2T A;  4GLA C;  4ZCK A;  1FGU A;  3NEL A;  3BZC A;  1Q90 A;  4PZ6 A;  2BH2 A;  4DV7 L;  1FJG L;  4AYB B;  4POF A;  2FJ2 A;  4DV2 Q;  1HTP A;  3AFQ A;  1AE3 A;  2I5L X;  4LF5 L;  2NBF A;  1ZYR D;  2P5Z X;  2F0J A;  1VQI A;  5LMN Q;  3PO3 H;  4HJA A;  2PMZ E;  1SNC A;  5C0X J;  1PH9 A;  2JK8 A;  4GN4 B;  2K5D A;  1HZC A;  3PF5 A;  1SE2 A;  2BCO A;  1T9H A;  1STN A;  1N34 Q;  2EE1 A;  1SDF A;  4PZ8 A;  1N9W A;  3HOX G;  2E8G A;  3CU7 A;  1AW7 A;  2KBN A;  2AQ2 B;  1HFG A;  3PMF A;  4GNX C;  2MGS A;  4HIK A;  1EZ6 A;  2OQK A;  3M4Y A;  2B2Y A;  1WYD A;  2KEN A;  1HZ9 A;  3OSO A;  1F2L A;  3S15 B;  1C7Y A;  2ZM6 L;  2PNH A;  3D4R A;  4PZ7 A;  4JI5 L;  4IFD J;  2EYH A;  3GTQ H;  2UUA L;  5DM6 3;  1HNX L;  3TRZ A;  1GUN A;  3I3C A;  1TR5 A;  2PQE A;  4P72 A;  2R7Z H;  3M7N A;  1VDZ A;  4GS3 A;  4X62 Q;  1D5Z C;  4NW2 A;  4JI3 L;  4JI1 L;  1LTR D;  2O5I C;  2B29 A;  3PF4 A;  1BF4 A;  1X6O A;  3MAQ A;  1DOL A;  3EQL C;  3BVZ A;  3TP8 A;  3S17 H;  1E22 A;  1EWH A;  4KMU C;  1JB3 A;  4TRD A;  4A76 A;  1TY2 A;  4IUQ A;  1OO9 B;  3S2H B;  2PQA B;  3RLN A;  3HP3 A;  1TS3 A;  3UDI A;  1WTV A;  5FLX E;  1WTX A;  4Z9C B;  2Q8T A;  2A5H A;  3VR4 A;  3CRK C;  4YCW A;  2LFN A;  3U9O A;  4DV3 L;  5C6A A;  1G29 1;  4A3C H;  1IW7 C;  2PW7 A;  4DV2 L;  1K8O A;  1YNN D;  1SR3 A;  1XX8 A;  2MQH A;  4FXD A;  1VQJ A;  4KY6 A;  4DR5 Q;  4K5W A;  4PMC A;  5DAU A;  5K5P A;  1N34 L;  3I4M B;  1GOZ A;  4N8X 1;  1KRS A;  4RCN A;  1BCP F;  4QCL A;  1PZI D;  4NP5 A;  5TSS A;  4CDC C;  2O5J C;  3V2T A;  1PH6 A;  1PVO A;  3HRZ C;  4QIW B;  3S1R H;  3SR1 A;  2RDF A;  3H3V H;  1N32 Q;  4FXK C;  1WD1 A;  2XGT A;  1I4Q A;  4HR7 B;  2R7D A;  2M2L A;  1H9J A;  2QGQ A;  3TZU A;  4JI4 Q;  2JA6 G;  5KYI A;  4HJ9 A;  3S24 A;  3I72 A;  3U4V A;  3SDZ A;  3P1H A;  3OWE B;  1TS5 A;  1I50 H;  3E6Z X;  3G7L A;  1CSP A;  5CV5 A;  1KNE A;  3HOY B;  4WJ4 A;  1PH5 A;  4K2K A;  2MO0 A;  4UY8 C;  1IKM A;  1MJE A;  4KLK A;  4X62 L;  2VUM G;  4TQU S;  1NBW A;  3TEH B;  2JA8 G;  2CH4 A;  1IBM Q;  3H3V C;  1Y8P B;  4R1J A;  1AH9 A;  2EY6 A;  1GXD C;  2B2V C;  1EWI A;  1TWH B;  1S5E D;  2F0V A;  1TY0 A;  2QF7 A;  1U4L A;  4OWW B;  3CC7 A;  3D6W A;  5GRO A;  4L5T A;  1LLR D;  4LFA Q;  1X55 A;  4C3J B;  1EYA A;  2AWN A;  1S72 A;  3ERS X;  1I4P A;  3S1N H;  4LF9 L;  3EVQ A;  2L55 A;  1B9N A;  2AKW B;  2NN6 G;  3HG9 A;  4KY5 A;  1RDP D;  5F2D A;  1HR0 Q;  1H9K A;  5DNF A;  4QQB X;  5M3M B;  3ZJY C;  1BOS A;  3CD6 A;  2F0H A;  1IYU A;  1TVX A;  1FVI A;  2F0P A;  2IL8 A;  2XWJ B;  4RMF A;  4CHT B;  4OO1 G;  2NTT A;  1TT2 A;  4DKA C;  5LMU L;  1EEI D;  4RWS C;  2H1E A;  3X3M A;  2VQE Q;  1CT1 D;  1VQD A;  1X32 A;  2LKV A;  4MZ9 A;  5D3D A;  4OHJ A;  2ZTC A;  4BWG B;  4DR5 L;  3CCE A;  1PTO D;  2B2T C;  3Q8D A;  4R9W A;  4JV5 L;  2K5Q A;  1B4O A;  1BKB A;  3RZD B;  4BY7 G;  4QY7 A;  1NAP A;  4BA1 I;  3GTG H;  1WI5 A;  5ELO A;  4DV4 L;  1TU2 B;  3A0J A;  1N36 Q;  1GVP A;  5C3E B;  1N32 L;  3S2D H;  2WB1 G;  2NVT H;  4KHV A;  4A3G B;  3QG1 A;  4JI4 L;  2OXP A;  2KUM A;  1BBU A;  2RF4 A;  2Y0S G;  3EIV A;  4DAV A;  4LFC L;  1N8R C;  5IOD A;  4DA2 A;  4ZKC B;  5I2X A;  1Y1V G;  4NB3 A;  3MFY A;  3TS2 A;  1ZXT A;  3DLL A;  4XDX A;  4DK3 C;  2UXB Q;  2A68 C;  2EYL A;  2HIX A;  5D65 A;  3WWV A;  1IBM L;  3D4W A;  4ID6 A;  3NQI A;  2EYF A;  3H6M A;  4YWM A;  3G6E A;  1EZ8 A;  4CGY B;  4OX9 Q;  1FYC A;  3ZYY X;  3TP7 A;  3DM1 A;  5FO9 B;  1MGS A;  4U67 3;  5H1S E;  5FJ8 G;  4XQQ A;  1PTO H;  4RKB A;  2JA8 H;  3T4A C;  3Q23 A;  1YHQ A;  2Z4H A;  1MKH A;  2IX0 A;  3QB3 A;  4YWK A;  4DV1 Q;  1HFN A; 
#chains in the Genus database with same CATH homology
 2UXD L;  1VQB A;  4YY3 L;  2UUC Q;  1SN8 A;  3OTO L;  2KHI A;  1C9O A;  5C0X I;  4A3D H;  3CCQ A;  1AH9 A;  2A1A A;  1VQC A;  1HZB A;  1SFO H;  3CPF A;  1Q81 C;  3FHW A;  1HR0 L;  4DR4 Q;  4B3M Q;  2YV5 A;  5GAD C;  1KXL A;  1K8A C;  4QIW E;  3U58 A;  2I5H A;  2A19 A;  4LFC Q;  1HNZ L;  3J80 i;  4AH6 A;  2CCZ A;  3BZK A;  2KHJ A;  2N78 A;  2NN6 I;  4DUZ Q;  5C44 H;  1GM5 A;  4ALP A;  2LXJ A;  3G48 A;  3HOW G;  4EQ5 A;  1YVC A;  3AEV A;  1WJJ A;  2GVB A;  2CKZ B;  1J6Q A;  1OXS C;  3K7U C;  3BJU A;  2VQE L;  4JYA L;  1NMF A;  4O2D A;  1KQS A;  2ZJP A;  3KF6 B;  2CWA A;  3E0E A;  4R4T A;  3UE1 A;  3J80 c;  1YJ9 A;  4NXN L;  4R4Q A;  4GKJ Q;  3TQY A;  4OO1 I;  4IFD I;  4XTC S;  3ICE A;  5C0X G;  2EXD A;  5BR8 L;  2NZH A;  1K8G A;  2UUB Q;  4A3D G;  1VQ7 A;  4LF8 L;  4IPG A;  4IO9 A;  1OXU A;  4A3M G;  3I4N G;  1O7I A;  1R9T H;  2MFI A;  2ASB A;  5AJ3 L;  2NVX H;  1HNW Q;  3RNU A;  2Q2U A;  4QGU A;  4JOI C;  4ME3 A;  2R92 G;  1S3O A;  2VY3 A;  3FKI G;  1VQK A;  3GTM H;  3I4M H;  1N36 L;  3I2Z A;  3MEF A;  2K4K A;  2UXD Q;  4DR6 L;  1L1O C;  1WCM H;  3I55 A;  3S1Q H;  1B7Y B;  3HKZ G;  3KOJ A;  4P71 A;  1I94 L;  3IRB A;  1E24 A;  3M4Q A;  4YCV A;  5C44 G;  4OWX B;  4JG2 A;  1ASZ A;  4BXX H;  2V1C C;  4DUY Q;  4HID A;  2AHO B;  1JJG A;  4DV6 Q;  1VQA A;  3GTL H;  4NXM Q;  2Z6K A;  5C4X G;  3NEM A;  4IFD G;  3A74 A;  3E9I A;  1YI2 A;  4IJL A;  5J3B A;  2B63 H;  3JAM i;  1OXV A;  4DPG A;  5IP7 G;  1M90 C;  2UU9 Q;  5JJL A;  3GO5 A;  3CCJ A;  4JYA Q;  3RN2 A;  3G71 A;  4A3F H;  1V9P A;  3NBH B;  1VQH A;  1XTD A;  3CXC A;  3UDF A;  2UXB L;  3B6Y A;  3CW2 C;  1JE5 A;  1V1Q A;  2OCE A;  3U50 C;  1XPR A;  3S16 H;  4H02 A;  4FDB A;  4MTN A;  1EUJ A;  5BR8 Q;  2HQL A;  2HIV A;  3JAM c;  4QJF A;  3TRE A;  5M5X H;  1Y1V H;  2OWO A;  1QVF A;  3PUY A;  3KYH C;  4A93 H;  4X6A H;  1I6H H;  4APV A;  2E5L L;  4OON A;  4LF5 Q;  5AJ3 Q;  1EIF A;  4DR1 L;  1X3E A;  3I4O A;  2K5V A;  4AQY L;  3CPW A;  1VQM A;  1Q82 C;  2RCN A;  2GN5 A;  4GOP C;  4KHP L;  2WP8 J;  5JEA J;  2JEA I;  3GDE A;  4DV1 L;  1NJI C;  3MXN B;  4DR6 Q;  4B3S Q;  3T1H L;  1CUK A;  2UUC L;  4AYB G;  3K0X A;  1KHI A;  1PH2 A;  2E2I H;  2B63 G;  3S15 H;  3EN2 A;  4JI8 Q;  1XNQ L;  3J81 i;  1IBL Q;  2PQA A;  4MNO A;  1CKO A;  1KAW A;  1PH7 A;  4P75 A;  4X65 L;  4B3M L;  2MO1 A;  4LF7 Q;  4DR4 L;  3CQZ H;  2CFM A;  2KCM A;  2WFW A;  3L7Z C;  1TWF H;  1VQP A;  3RLF A;  2IY5 B;  2JA7 G;  1XPO A;  3KFU A;  1NMG A;  1KIX A;  1A62 A;  2K14 A;  3J81 c;  4DUZ L;  4Y7N H;  1D7Q A;  3CAM A;  3CP0 A;  1YJW A;  2R7Z G;  4JBJ A;  2ZM6 Q;  5M5Y H;  3RN5 A;  2H5X A;  4YWL A;  4JI5 Q;  1QUQ B;  3PO2 H;  4J15 A;  1SRO A;  4HJ5 A;  2UUA Q;  3GTO H;  4KHZ A;  3ULJ A;  3PCO B;  1KC8 C;  3F2B A;  2E2H H;  4GLX A;  4LUZ A;  4A3L H;  3HKS A;  3CCR A;  2IHF A;  1LYL A;  2UUB L;  3T1Y Q;  3W5O A;  2E2J H;  2K52 A;  1UE7 A;  5GQO A;  3CCM A;  3S14 H;  4JCV E;  1EFW A;  1HNW L;  1E3P A;  1NTG A;  3M9B A;  4JI1 Q;  5LMN L;  2VW9 A;  4LF6 Q;  1ASY A;  4DR2 Q;  3K81 C;  2EIF A;  2BH8 A;  4GNX B;  3PUW A;  1XJV A;  2Z0S A;  1XNQ Q;  2IT1 A;  1YJN A;  1SE8 A;  1X3F A;  5IE8 A;  4K0K Q;  2KCT A;  2I5M X;  4A3M H;  3I4N H;  4C2M H;  4YHH L;  4X65 Q;  1U0L A;  1NY4 A;  5K36 G;  1YNX A;  5IY0 A;  4DUY L;  3PO2 G;  2R92 H;  3FKI H;  1QVG A;  2VS1 A;  3J7A 5;  1X56 A;  4DV6 L;  5M3F G;  4AIM A;  2D0O A;  4NXM L;  1RL2 A;  4A3L G;  4GN3 B;  3RZO H;  4BBS G;  3PGZ A;  3PIP A;  3A5U A;  2UU9 L;  1JB7 A;  1J5E L;  3HOX H;  3SGI A;  1UE1 A;  4Y52 H;  1NE3 A;  1Q8K A;  1X54 A;  2K5H A;  3F1Z A;  1LTL A;  2N3S A;  2YTX A;  3J81 j;  4JI0 L;  1B8A A;  3F8T A;  1VQO A;  2A8V A;  5C4X H;  4BA2 I;  4OXP A;  1YHB A;  4GLA C;  5EAY A;  2LXK A;  1FGU A;  1K83 H;  1AE2 A;  3NEL A;  3BZC A;  5C4J H;  3GTJ H;  2ZJR A;  4PZ6 A;  1Y1W H;  1VQ9 A;  3RLO A;  2CQO A;  4IPC A;  2BH2 A;  1A8V A;  4DAY B;  4DV7 L;  5IP7 H;  1FJG L;  3M4O H;  1QZG A;  2F3I A;  4POF A;  2JA5 G;  1VQN A;  4DV2 Q;  4GOP A;  1Q86 C;  3S1M H;  3AFQ A;  1AE3 A;  2I5L X;  4LF5 L;  2ZJQ A;  2R93 G;  5LMN Q;  1VQI A;  3PO3 H;  4HJA A;  2PMZ E;  3I7F A;  5C0X J;  1PH9 A;  2JK8 A;  4GN4 B;  4HJ8 A;  1HZC A;  3PF5 A;  3NEN A;  1UEB A;  2Q2I A;  1X9N A;  4B3S L;  2B3G A;  2YYZ A;  1T9H A;  4OWT B;  1N34 Q;  3H0G H;  4JI8 L;  2WB1 E;  4PZ8 A;  1N9W A;  1Z9F A;  4YHH Q;  1IBL L;  3STB D;  3HOU G;  3HOX G;  1B70 B;  3F2D A;  2E8G A;  3D0F A;  3PSI A;  1IL2 A;  2RHS B;  2KBN A;  4L5S A;  4LF7 L;  1XPU A;  2VZA A;  1Y14 B;  4GNX C;  2JE6 I;  4HIK A;  1P8L A;  2OQK A;  4WJ3 M;  3ULP A;  1CKN A;  3I4M G;  2Y0S E;  1WYD A;  1VQG A;  2AWO A;  1SLJ A;  2KEN A;  4A4I A;  1Y1W G;  4A3J H;  5IYB G;  2K50 A;  1HZ9 A;  1IYJ B;  2ALY B;  3PUZ A;  5GAE C;  3I56 A;  1J5E Q;  1PYS B;  5FLX c;  1C7Y A;  2ZM6 L;  2PNH A;  3KDF A;  2EQS A;  2PI2 E;  3EBE A;  4LW1 A;  4JI0 Q;  3PO3 G;  3CMA A;  3HOZ G;  4PZ7 A;  4JI5 L;  4IFD J;  1SRU A;  3GTQ H;  1P16 A;  2LSS A;  3FP9 A;  1HH2 P;  4P73 A;  1PA6 A;  2UUA L;  3UDG A;  1HNX L;  2JA7 H;  1M1K C;  2R6G A;  3TRZ A;  1IBK L;  4B3T L;  4DV7 Q;  1FJG Q;  4DNI A;  3H0G G;  2WAQ E;  3T1Y L;  4P72 A;  2R7Z H;  3K80 C;  5M5W H;  5GAH C;  3M7N A;  1JJC B;  1GO3 E;  4GS3 A;  1I3Q H;  4X62 Q;  2NZO A;  2XTI A;  2BA0 A;  4L5R C;  1Q7Y C;  4JI3 L;  2JJQ A;  4JI1 L;  1PFS A;  1YZ6 A;  3UE0 A;  4DK6 C;  2B29 A;  4LF6 L;  3PF4 A;  4DR2 L;  1X6O A;  2OTL A;  4JI7 Q;  2F52 A;  2QA4 A;  1OTC A;  2K5N A;  4A3J G;  2D0P A;  2F4V L;  2I0Q A;  2Q2T A;  3M4P A;  4DR7 Q;  3L0O A;  3A5Z B;  1PHJ A;  1BBW A;  1HJP A;  3KF8 B;  4JBM A;  3S17 H;  2JEB I;  1E22 A;  1GD7 A;  2JA9 A;  1U5K A;  3CCS A;  1W2B A;  4LUV A;  2VQF Q;  2RHQ B;  5LMN W;  5HY6 A;  4XIG S;  4DV0 Q;  1VQ4 A;  4A76 A;  4A75 A;  1XNR Q;  4C3I H;  2YTY A;  1G6P A;  4DV5 Q;  4EX5 A;  4A3K H;  2PQA B;  1K0R A;  3F2C A;  4GN5 A;  3RLN A;  4A3B H;  3UDI A;  2OTJ A;  2VL6 A;  2CWP A;  1H95 A;  1X65 A;  4LWC A;  3W1B A;  1HNX Q;  1VCI A;  5M3F H;  1IBK Q;  4QL5 A;  3CME A;  4B3T Q;  4YCW A;  5JJI A;  4DV3 L;  4JI2 L;  5IP9 G;  4BBS H;  1A0I A;  1G29 1;  5E7N A;  1KD1 C;  4A3C H;  1VQL A;  3L2P A;  4JOI A;  1JT8 A;  4DV2 L;  1PH1 A;  1TWA H;  4GKK Q;  1Z47 A;  2Z6K C;  4P74 A;  2JA6 H;  4L5Q A;  1L1O A;  4JI3 Q;  5M3M G;  1XMO L;  1UE6 A;  2D62 A;  1SR3 A;  5IYC G;  5C3E H;  3CC2 A;  2MQH A;  3S2H H;  1VQJ A;  4DR5 Q;  4JI6 L;  2Q2H A;  4A3G H;  2F4V Q;  2JA5 H;  1CKM A;  1L0W A;  3RR5 A;  1N34 L;  1FL0 A;  4A3K G;  1VQ5 A;  1JMC A;  1K73 C;  1KRS A;  3HKZ E;  1TWG H;  3M85 A;  4A3B G;  4X66 L;  4LFB Q;  2R93 H;  2ES2 A;  1G51 A;  2HT1 A;  4UP8 A;  3G4S A;  1PH6 A;  1SMX A;  1L2F A;  1IXR A;  1VQF A;  4A3E G;  2VUM H;  1PVO A;  3PUX A;  4NPS A;  3S1R H;  2IX1 A;  3H3V H;  4LFA L;  3H3V I;  1N32 Q;  2QEX A;  3HOU H;  2XGT A;  4A3C G;  1MJC A;  4HIO A;  2AMC B;  2R7D A;  4X64 Q;  2QGQ A;  4JI4 Q;  4A3I G;  2JA6 G;  1KL9 A;  1VQE A;  1UWV A;  4HJ9 A;  1A63 A;  4JBW A;  4JC0 A;  3S24 A;  3ULL A;  3U4V A;  2UXC Q;  1WFQ A;  5C3E G;  1I50 H;  4DV3 Q;  4JI2 Q;  5IYD H;  4IOA A;  1CSP A;  3KF6 A;  5IYB H;  4A3G G;  4BY1 G;  4WJ4 A;  1PH5 A;  2MO0 A;  4UY8 C;  1MJE A;  4KLK A;  4X62 L;  1XMO Q;  3HOZ H;  2K75 A;  2VUM G;  1PH3 A;  4DR3 Q;  4PMW A;  3AYH B;  4TQU S;  1NBW A;  5DLQ E;  3TEH B;  1EOV A;  4JI6 Q;  2JA8 G;  1IBM Q;  3ER0 A;  1XMQ Q;  4JI7 L;  4R1J A;  2ZTD A;  3M3Y H;  1YBY A;  1E1T A;  2MNA A;  4GOP B;  1EQQ A;  4LF4 L;  3K8A A;  4B3R Q;  4X66 Q;  1YIT A;  5IWA Q;  4AYB E;  4DR7 L;  5ELN A;  1EWI A;  1N33 L;  2PI2 A;  4KI0 A;  1EIY B;  4OWW B;  2VQF L;  3E9H A;  3CC7 A;  1PYB A;  5GRO A;  4BBR H;  2N49 A;  4L5T A;  4DV0 L;  4IOC A;  4LFA Q;  1X55 A;  3HOY H;  5JJK A;  5IYD G;  4TVA B;  1VQ8 A;  1HZA A;  1XNR L;  1VS0 A;  2NVY H;  2AWN A;  4YY3 Q;  4DV5 L;  3ERS X;  2L15 A;  3OTO Q;  1YIJ A;  1S72 A;  1E7Z A;  3S1N H;  5GAG C;  3BU2 A;  4IJH A;  4LF9 L;  2AKW B;  2NN6 G;  1Q46 A;  4BY7 H;  3H15 A;  1HR0 Q;  1MIU A;  4QQB X;  2DGY A;  3GTP H;  1QVC A;  3GD7 A;  3CCV A;  1EQR A;  4HJ7 A;  3ZJY C;  3PUV A;  1CKN B;  3CD6 A;  2HHH L;  1TXY A;  4DAM A;  1HNZ Q;  1FVI A;  1TWH H;  4RMF A;  3CCL A;  4OO1 G;  2IHE A;  1RIP A;  3KDF B;  3PIO A;  3KJO A;  4GKK L;  2N8N A;  4DKA C;  1PH8 A;  5LMU L;  5HGQ A;  1W3S A;  1X3G A;  4POG A;  4C3J H;  2VQE Q;  1VQD A;  4MZ9 A;  4BBR G;  4UPA A;  2ZTC A;  4DR5 L;  3HOY G;  5IP9 H;  3CCE A;  4NXN Q;  4LUO A;  4IPH A;  4LF4 Q;  3UDX A;  4HIM A;  1E1O A;  1WCM G;  5JEA G;  1D8L A;  3Q8D A;  1K9M C;  4LNQ A;  1BVS A;  4JV5 L;  2ZTE A;  1BKB A;  4LF8 Q;  4OX9 L;  1QZH A;  1N33 Q;  4RG1 A;  4BY7 G;  4LFB L;  3CC4 A;  5M3M H;  1VQ6 A;  1Q12 A;  2OQ0 A;  3AFP A;  4QY7 A;  4BA1 I;  4PG3 A;  5IYC H;  1WI5 A;  5ELO A;  3GTG H;  3HFZ B;  4DV4 L;  4BXX G;  3CF5 A;  3K7A H;  3HOV H;  1LUZ A;  3A0J A;  1N36 Q;  1GVP A;  1N32 L;  3S2D H;  2WB1 G;  4LF9 Q;  3D31 A;  2NVT H;  1I94 Q;  4X64 L;  2NVQ H;  2BA1 A;  4JI4 L;  3JC6 6;  1KRT A;  1IZ6 A;  3OYY A;  1LM0 A;  5FJ8 H;  3VDY A;  3TS0 A;  4A3E H;  3KJP A;  1V43 A;  4UP7 A;  2VNU D;  4O0A A;  1S40 A;  1OXX K;  2UXC L;  3W1G A;  2HHH Q;  1BBU A;  1OXT A;  4A3F G;  1CSQ A;  1QUQ A;  2RF4 A;  2Y0S G;  4C3H H;  5FLM H;  2R7F A;  3EIV A;  3OW2 A;  4JBK A;  4LFC L;  2YU9 H;  1N8R C;  3T1H Q;  2C35 B;  1PH4 A;  3LGJ A;  3U4Z A;  3RZD H;  1UE5 A;  1C0A A;  3GTK H;  1EYG A;  3KLW A;  3PV0 A;  4A3I H;  1TWC H;  1YEZ A;  1Y1V G;  1YHA A;  4R4I A;  5LMU Q;  2FXQ A;  1GKH A;  4NB3 A;  4YCU A;  4A93 G;  3TS2 A;  1I5F A;  4R4O A;  3DLL A;  3STB C;  1HR0 W;  4DR3 L;  5IT9 c;  2JQO A;  3HOV G;  4DK3 C;  2UXB Q;  4R4C A;  1IBM L;  2HIX A;  4GLV B;  3WWV A;  1PV4 A;  4BY1 H;  1XMQ L;  2ID0 A;  2WAQ G;  4JV5 Q;  4YWM A;  3G6E A;  1Q1B A;  3CCU A;  4GNX A;  4OX9 Q;  1DGS A;  3AQQ A;  4B3R L;  4GKJ L;  5IWA L;  4K0K L;  1L1O B;  2YTV A;  2E5L Q;  4IPD A;  5H1S E;  5FJ8 G;  1WOC A;  1K3R A;  2ATW A;  3HOW H;  4DR1 Q;  4UP9 A;  2DUD A;  4DV4 Q;  2JA8 H;  4AQY Q;  4KHP Q;  1JJ2 A;  3DM3 A;  1YHQ A;  5FLM G;  1MKH A;  2IX0 A;  4YWK A;  4DV1 Q;  2GVA A;  1Q1E A;  3J7Z C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...