3LWEA

The crystal structure of mpp8
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
61
structure length
61
Chain Sequence
b'GEDVFEVEKILDMKTEGGKVLYKVRWKGYTSDDDTWEPEIHLEDCKEVLLEFRKKIAENKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords M-phase phosphoprotein 8
publication title Structural basis for specific binding of human MPP8 chromodomain to histone H3 methylated at lysine 9.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 14
structure length 61
sequence length 61
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3lweA00
1B53A 1EL0A 1F9PA 2FHTA 4U68A 1MGSA 1F9RA 2FJ2A 5D14A 1EOTA 2B2UA 2H1EA 2B2TC 1J8IA 1IKLA 4IUQA 5COYA 5EPLA 4R8IA 2FINB 1XYIA 4O42A 1G2SA 2HCIA 1WTWA 1MSGA 1E0BA 1EQTA 2K01A 1AP0A 4HSVA 1B3AA 1KNAA 1RTOA 3TZDA 3KBXA 2KEEA 1RODA 4QUCA 3R93A 4IUVA 3ONAB 4XT1B 2K1BA 1XX8A 1AZQA 5E4WC 2HDMA 1F2LA 5CORA 1DOLA 3SVMA 3MWYW 1G91A 3UI2A 2X6GA 1U4MA 1VMPA 1TVXA 2JYOA 1PDQA 2FFKB 2K03A 3IFDA 5CBEE 3DM1A 2MGSA 1NAPA 4RAUC 1GUWA 2IL8A 2J7ZA 2L11A 1ZXTA 4HAEA 1IKMA 1WD0A 2HUGA 3F2UA 1NR2A 4R9WA 1SSOA 3HP3A 5AFWA 2B2VA 3GV6A 1BBXC 1WTRA 1X32A 1VMCA 3G7LA 4LMQD 4DN4M 1EIGA 2B2TA 1O80A 2EPBA 2B2YA 4ZKBB 3KUPA 1X3PA 1DOMA 2X69A 1NR4A 1X3QA 1JE4A 2JP1A 1CA6A 4X3KA 1G6ZA 1SAPA 1RTNA 1PFBA 2K28A 2VXWA 1ILPA 1ILQA 3LWEA 3MTSA 4CJ2C 2Q8RE 1ML0D 1PFMA 1U4RA 2KOLA 2K05A 2CVRA 1HA6A 1HFNA 4CJ0B 3QO2A 4XT3B 4ZLTF 1HHVA 3GV3A 2MJ8A 2HDLA 2B2UC 1M8AA 1LV9A 2B2WA 1CA5A 1HRJA 1U4PA 2DY7A 1ICWA 4CJ1B 1QNKA 2KEDA 4IUPA 2SDFA 1Q3LA 2L9HA 4OIKA 5CBAE 5CMDA 4NW2A 1B50A 1DONA 2KECA 1EIHA 1RHPA 2RVLA 5E4XA 2RSOA 2BDNA 5EPKA 1BF4A 5T1GA 1PFNA 2XIWA 4IUUA 2L4NA 2N88A 3N52A 1JICA 5JJZA 1NCVA 1O7ZA 4X3UA 2RSNA 1F9SA 2DY8A 3I3CA 1CM9A 1F9QA 3I90A 1WTPA 1HUMA 1PLFA 1A15A 2KVMA 4IUTA 4X3TA 1MI2A 2D9UA 2L12A 2L1BA 2EE1A 4MHEA 4X3SA 1WTXA 1HFGA 2EOTA 1DZ1A 2KUMA 2FMMA 4RA8A 1WD1A 1WTOA 1B2TA 2NZ1D 1QE6A 4XDXA 4OIJA 2B2VC 4MN3A 2Q8TA 3TN2A 5D65A 3FPUB 5T1IA 1DOKA 1AZPA 2B2YC 2X6LA 1BNZA 2NYZD 1O7YA 1SDFA 2NWGA 3Q6SA 4HEDA 5EQ0A 1KNEA 2MPMA 1MSHA 1IL8A 1WVLA 2RA4A 3I8ZA 5EKIA 3DEOA 5EPJA 1U4LA 4ZKCB 1WTVA 4HCSA 4IURA 3DEPA 1J9OA 1ESRA 2M2LA 4QUFA 1RJTA 3I91A 2N55A 2K04A 3P7JA 2R3ZA 4UAIA 5EJWA 1S4ZA 3FDTA 4ZAIA 1G2TA 2HCCA 1HUNA 3D6WA 2B2WC 3IL8A 4RWSC 1C8CA 1BO0A 1QG7A 1B4OA 1WTQA 3H91A 5DNFA 2MP1A 4ZK9B
chains in the Genus database with same CATH superfamily
4M1UB 2R7DA 4KKUA 4JOIC 4HIKA 1XMOL 3VYSA 4R4CA 1JMCA 1I4QA 5KIXA 4RCOA 3UE1A 1PH9A 3OW7A 4DAYA 1VQJA 1NMFA 1L0WA 1E0BA 1KD1C 2F0QA 4HSVA 1GKHA 1KNAA 4GZYC 4XQJA 2KQ3A 4OHJA 4KMUC 2YV5A 2KCMA 3GTQB 3TS2A 1X54A 3RNUA 3VYUA 1KABA 4LNQA 1TVXA 1UUPA 3QOLA 4HR7B 2Z4HA 4DR5Q 3L9AX 3QWNA 4A3JH 2J7ZA 2L11A 4P74A 1QUQA 1OO9B 5IGCA 4RH6A 4BXXG 2Y0SG 5EBCA 1HR0Q 1LT3D 2NVTB 2KJXA 4DV4L 3HOYH 4C3HB 1SNMA 4LFCL 1XNQL 2N49A 4ZKBB 1I3QB 5EKLA 2X69A 1M1KC 4N9TA 3KLSA 2UUCL 2K28A 4L63B 1TKWB 1VQ8A 2UU9Q 3WWVA 1I4PA 1FGUA 1HHVA 1PXUA 2CWAA 4HMJA 1STNA 2ATWA 3H6MA 1KRSA 3ND8A 3I72A 2KECA 3VA5A 1C7YA 1TWGH 4JI6L 4A93B 4DUYL 3TP8A 1PRTD 1XXGA 5C4XB 4DV2L 2K7VA 4DAMA 4A3IB 2KVMA 5IY0A 3J80i 4X3TA 2D9UA 1N32L 5A35A 3HOZH 5KYLA 3CXCA 2RHQB 4PV1C 1V1PB 2A69D 4ZQ3A 3U50C 3EQLC 4P71A 1WCMG 2ZTCA 1GD7A 3I70A 1B1ZA 1NSNS 1STGA 2VB2X 3FPUB 4UPAA 5KYIA 4WFN3 4NP5A 3E3XA 1BBUA 2A73B 1QVGA 2NWGA 3D4DA 5KGUA 1IBKL 3S1RB 3KJPA 1WVLA 1EFWA 4DNIA 4AQYQ 1Y1WG 2QA4A 4ZKCB 4HCSA 4IURA 3GTQH 3M3YB 3CC2A 1XTDA 1YHAA 1I4XA 2KBNA 5FLXE 4RWSC 1NTGA 4PMBA 2JA8G 3H91A 3X3MA 2MP1A 5K5PA 4X65L 2A6EC 3GQBA 3KK7A 2NVTH 1EU3A 1MGSA 1RKNA 4C3HH 2H1EA 3PO3G 1FNVA 1GUNA 1I3QH 5JOBA 1KHIA 1SYGA 3O13A 2UXBQ 2HCIA 5FLXL 1MSGA 4GN4B 3MFYA 2I5MX 3H0GH 3HGBA 3K7UC 3R93A 4LF9Q 2E2HB 1XX8A 3OMGA 4BY1G 1IYUA 1OXVA 1VQCA 1EEID 1ZEQX 4F87A 2EJMA 2OCEA 4G7HC 1H9JA 2F0HA 4JBKA 4YWLA 1WTRA 1EYAA 1VMCA 4KHVA 5C4XH 3WDNA 4K8IA 3RLFA 5AJ3Q 4B3SQ 5JPMC 1X3PA 1DOMA 4A3IH 1XJVA 1HQRD 1SJHD 4EQOA 1EYGA 4A3MG 2VZAA 3RN2A 3AU7A 1XPUA 1LLRD 5LMUL 4DR6Q 1EYCA 3NPPA 1Q12A 1JT8A 4GLVB 2LSSA 4RG1A 5E3FA 1JC7A 3UDXA 2B2WA 1TWHB 4F88A 2EJFC 4B3TL 3NBHA 4K2KA 1H95A 1IW7C 3PV0A 2VW9A 1PHJA 5M3FG 1STEA 5EPKA 4ALPA 3E5SA 3M3YH 2ZXOA 1SE8A 4YWKA 1D5MC 2B63G 4LUVA 1SYDA 2MO0A 1S5FD 3I7FA 4JI0Q 4ME3A 1A3VA 4IUTA 4K6LA 3RD4A 1TQOA 5JEAH 1XWEA 4IPCA 3R2IA 4H0LC 3GTPH 1A3UA 3JAME 3OTOL 2EIFA 1NUCA 4GNXB 4GOPC 1Y14B 4IO9A 1BCPD 4QL5A 4A3DG 1K8AC 1W2BA 3P1HA 3I8ZA 4K0KQ 3QJYA 5IWAQ 4UHVA 3JAML 5C4HA 5C3EG 2VQFQ 2JA5G 1JOKA 4AIMA 2F0WA 1FD7D 4GKJQ 1TY0A 5JAVA 3PQIA 2RQXA 4GKKQ 4IJHA 1F9PA 1AEXA 3BZDB 4U68A 3HOWB 2B2UA 4X66L 4J8QA 1ZYRD 2XRSD 4C2MB 4DR7L 4IUNA 3HKZB 3S1MB 1EQTA 1UE6A 3SXHA 3S1QB 3FVQA 1ZKOA 1Y1VB 1VDZA 1RODA 1N34Q 1SNQA 1VQ7A 5LHY1 3U9SA 1PTOH 2A19A 3BU2A 3K5MA 1PH7A 1CKOA 1HCZA 3OMCA 5IIFA 1TWHH 4CGYB 2K03A 2PMZB 1PH5A 1R4QB 1XMOQ 1C0AA 5JEAJ 3R2TA 5F2DA 1D5ZC 3KLRA 5J1ZA 2CWPA 3I73A 1QOHA 2I5LX 3UDIA 1CI3M 1CTMA 4DN4M 3BS1A 3M9BA 4CHTB 5LMNL 1EQRA 1X3QA 1E2ZA 3J81i 1STBA 1PFBA 2VXWA 3HOXG 3CQZB 5KNDA 4K8JA 1R4PB 1PZID 3AFQA 1L2FA 1I94L 1CSQA 1WYDA 3GV3A 4JI3Q 3H3VI 5I2XA 5IOCA 1EY8A 4NKLA 1Z7TA 4CJ1B 4PZ7A 2NZHA 4DV4Q 2AQ2B 3T4AC 4LFCQ 4JOIA 1TS3A 2EYJA 1VS0A 2RSOA 4NMZA 1NCVA 1SBBB 2RSNA 3SK6A 2DY8A 1RIPA 5IGBA 3GTJB 2SNMA 4QCLA 2FXQA 4OEMB 2EYLA 3N6RA 1NJIC 2EVBA 3HOWH 1QILA 5FO7B 4HJ5A 1LT4D 3S1NB 2VY3A 3BZKA 3S1MH 3R8BA 4BA1I 4JI6Q 3S1QH 1Y1VH 1R9TB 4APVA 1HNZL 4DV2Q 4RKBA 2I0QA 3D4WA 3J7ZC 1WTVA 3KFUA 2R93B 3I91A 2HHHL 2HIVA 5EJWA 2EY1A 1JCKB 2SEBD 2MO1A 4A3KG 1A2UA 2K14A 2R92B 3VYTA 1F2ZA 4P72A 3ER0A 4ZK9B 5IE8A 1HNXQ 2NVQB 5D3DA 2F0TA 2PZTA 4A3EH 1SYEA 3CHBD 3MEHA 1SNOA 3A56A 2D62A 4EX5A 3CQZH 1E2WA 3LNNA 5BN5A 2K6AA 4BBRG 1CKMA 1Q7YC 4RHSA 1BQQT 3ZYYX 1WD0A 3A7LA 2ZJPA 1S3OA 1PRTC 5C4JB 3FRPB 3SGIA 5J22A 5IGFA 3ULLA 2EPBA 5ELDA 4H44C 3GTJH 1KDAA 3PIPA 1T9HA 4A3BG 2CCZA 4RMFA 2A69C 4RHRA 4PZ6A 4N8X1 3AEVA 2KOLA 1HA6A 1U4RA 2R61A 1G8ZD 3QO2A 2F4VL 3FEWX 2PQAA 1EYDA 3KF8B 2E8GA 3HKSA 3ULPA 1YJNA 1R9TH 2K5VA 1B8AA 2NUCA 4C3IG 4YHHL 4WJ3M 3ICEA 2UXCL 5K36H 1G51A 3S14B 4A3FG 2R93H 4OXPA 2HQEA 2L4NA 3KLSX 3CCEA 5JJZA 1ESFA 4OELB 1F9SA 3RZOB 1NMGA 1HUMA 1MI2A 2UUAQ 4B9WA 1X3EA 2NVQH 1WFQA 3J7YW 3CP0A 2AUJD 1UE5A 3S2HB 1CFMA 2GA4B 1JOQA 1EIYB 4QB4A 5ISRA 5EAYA 4EGVA 1DCZA 3DEOA 1TT2A 2WAQE 3IFTA 3D6CA 5IYCH 2A8VA 1EOVA 4YWMA 1RJTA 2K04A 4B3RL 1XNRQ 3NEMA 3CCJA 2QW7A 4LFAL 3CW2C 4YIJA 1VQKA 2CKZB 3OIQA 5C4JH 3HRZC 4NXML 3PUYA 1MBYA 1TY2A 3I4NB 4N9PA 1UEBA 2LXKA 1C4QA 3M4PA 1VF7A 2XVSA 1BKBA 2KEEA 4K5XA 4PMCA 4OO1G 1STYA 2K5WA 1CHQD 1SN8A 1SNPA 1UE7A 1LABA 3D31A 3STBD 1NE3A 3FKIG 1I4HA 1X65A 4FXKC 4BBSB 2HUGA 1SSOA 5IP9G 2WAQG 4DR7Q 2P5ZX 4LF6Q 4LFBL 1D6EC 4G57A 3S2DB 1LTBD 4DV0L 1EIGA 2B2TA 2PCFB 4Y52H 3RZOH 3G6JB 3P20A 4OX9L 1GHKA 5HURA 1ASZA 5I6YA 4PG3A 2BDOA 4IPGA 1O7IA 2QKIC 1VQ9A 3HOXH 1QB5D 1YHBA 3W1BA 3T1HL 4KY7A 2MJ8A 2ES2A 4DGZA 3PF4A 5JJKA 3KF6B 3QOJA 1B50A 4HIMA 1RHPA 3JC66 2RVLA 3CKIB 2B29A 5I9OA 1PVOA 4EQ5A 3EA6A 1LT5D 2IX0A 2CQOA 1WTPA 2LFNA 2F0PA 2XWBB 4CDDC 5C6AA 1YVCA 3C46A 1G6PA 1ZYRC 1WTOA 1QE6A 5JVG3 4DV3L 2B8FA 4JI2Q 1HNWQ 4I65A 3LX0A 1T5EA 2R7FA 3FMCA 3TZUA 4G7ZC 2VQEQ 3I4NH 1B9NA 1VQNA 4A3JB 5IT9E 4ABNA 1KNEA 1GO3E 4LF7L 1FGBD 2I46A 5EPJA 1VQPA 3KDFA 4IFDG 2XWJB 4CDCC 4OWWB 3PO2H 3OPOA 4C56C 2G5DA 5IT9L 3M85A 1VQ6A 2ALYB 4JI7Q 1VF5C 4WRDA 1WTQA 1A62A 4BBSH 5DNFA 4HIOA 2R7ZB 1J6QA 2XTIA 1KAWA 2FJ2A 1LT6D 1GM5A 5COYA 5BN3A 1HNZQ 3CD6A 3NSWA 1S5DD 2F0UA 5IYBH 1PZKD 2Y0SE 1QZHA 2HHHQ 5FJ8H 3SK5A 1PV4A 4DKAC 5HGTA 2OXPA 5CORA 4A3GG 4LF4L 1A0IA 2EQSA 2X6GA 3TBIB 3RR5A 2ASBA 5LL6X 4DR4L 1K28A 3WOFA 1GUOA 2R6GA 3BDLA 3HOZB 4P75A 2WFWA 2WINB 3GTGB 2JA7B 1BVSA 5KNCA 5AFWA 3CMEA 3CPWA 1X32A 5KNBA 3AQQA 4DV5L 4Z9CB 2NVYH 3A5ZB 1L0XB 4IN3A 3U9OA 5IYDH 2FMCA 1A6XA 1KL9A 1L1OA 1N8RC 2ZTDA 4A3BH 1EY7A 2EXDA 1TS2A 4WJWA 3F2CA 1F2MA 1S40A 4O0AA 2BA0A 3G71A 4GN5A 4KI0A 1IBLQ 1JQYD 4QF4A 3I56A 3MXNA 4X64Q 4DV1L 3T16A 1KC8C 4A3LH 1CKNB 1LTID 5FO9B 2ZJRA 2QGQA 4GN3B 3G48A 1PZJD 1PFNA 1SR3A 1EZ6A 1PYSB 4BY7G 3I90A 1A8VA 4LF5L 3MZ5A 2JEBI 3B6YA 3H0GB 1PH4A 3L3OC 2R7ZH 4DUZQ 1YZ6A 4ILWA 2FMMA 5C3XA 3BYYB 3EBEA 2QEXA 3WOEA 1VQ4A 1D5XC 4YHHQ 5T1IA 3MAQA 4UDUC 1PTOF 4RGNA 1C9OA 3UDGA 3CAMA 4KK7A 1Y69U 4FVMA 4F8MA 2ENBA 2AWNA 2YYZA 2VL6A 3CU7A 5C44G 3OW2A 1A2TA 3P75A 1ET6A 3D4RA 4DR2L 3GTGH 2JA7H 2IT1A 1SEBD 2SNSA 1SNDA 4LK1C 4OGQC 1EOTA 1QCBD 1QWYA 3K5LA 2QDBA 1VQDA 2F3VA 1K8OA 1D7QA 3S24A 2E5LQ 4B3RQ 3EIVA 4WORA 1N36Q 2K50A 4FF4A 3NE5B 1CUKA 2VUMG 1N9WA 2EZVA 2D5DA 3GTPB 4JVZA 5IP9H 1O78A 4DXFA 2C35B 3EFXD 1EY5A 2G9DA 2JA6B 3HOUG 3OIPA 2Z6KA 1YNND 3J80E 3LGJA 3E0EA 1HZ9A 2M9VA 2KHIA 4O1NA 5ELFA 4L6TB 1V9PA 4CJ0B 1GHJA 5IGDA 4HCEA 1CA5A 4TQUS 1SJED 1KDCA 4Y7NH 1CQFA 1STHA 5CV6A 3J80L 4EQNA 3NTKA 1LTGD 1IBMQ 3CCQA 5IP7H 2BDNA 1BF4A 3DWPA 1RL2A 4GOPB 1ET9A 3D8GA 3OWFA 2K5QA 4GLXA 1PTOB 1B2TA 2NZ1D 3VR4A 4KV6A 3JAMi 4FF1A 4JBWA 2RDFA 4KN7C 4KHPQ 1D8LA 1MIUA 4HEDA 3W1GA 3A8JE 5EQ0A 4YY3L 4JYAL 2CW0D 4R1JA 2Y0SB 1J9OA 2VS1A 2M2LA 3J81j 1EWCA 1VQIA 4UY8C 3MC0B 3STBC 4Q0FA 3GTKB 2HT1A 4DV3Q 4L5TA 4MZ9A 1I4RA 3E9HA 1WOCA 1H9SA 1X9NA 1EWHA 5D14A 3OSOA 2B2TC 1IKLA 1IYJB 4IUQA 2JA6H 4AYBE 1AP0A 4NXNL 3TZDA 2O5IC 1CK1A 4K5VA 2QEJC 4B3ML 4KY6A 3SVMA 3K0YA 3M4OB 3I4OA 3CCSA 5CR3A 1GUSA 4C3JH 4DV6L 3DM1A 4IQZA 4POFA 1TWCB 5C0XH 4R9WA 2KCCA 4KJOA 2ZTEA 1E3PA 3BVGA 3S17B 1WCMB 1JWSD 1CT1D 3W3AA 3PIP3 3PUVA 1RTNA 4LF4Q 1CQVA 1ILPA 4DR1L 3FHWA 3DM3A 1Y1WB 4P2CB 1LTRD 3BJUA 4XT3B 1AFPA 3SDZA 4AYBG 2OTLA 2DY7A 1PH1A 4JI8L 5GAEC 2Z8LA 2JEAI 2WB1E 1JOOA 4DV5Q 4NW2A 2EYPA 4HTHA 1DONA 4LW1A 2JA8B 3NWSA 4MTKA 5DM73 4BXXH 4EVOA 4KKSA 4L5SA 1TR5A 4A3EB 2E2DC 3PO3B 1SLJA 3GTKH 5GQOA 4DAYB 2L1BA 2F3WA 1FR3A 4HSPA 3EJIA 4DV1Q 1DZ1A 3ND9A 4KLKA 4XQNA 2IPKD 2PPBC 5JJLA 1AZPA 4BY1B 3BZCA 1KDBA 3SR1A 4XTCS 5I2YA 1BXTA 3BVMA 2XSCA 4DR3L 1XNQQ 2IHFA 1X56A 1VCIA 1MHWC 5LL6S 1QUQB 4FO2A 2UUCQ 3M4OH 4LF5Q 2KENA 1I6VC 1Q1BA 2H4OA 1PYBA 5FLMG 3NUCA 1X3GA 2HCCA 3D6WA 4YCVA 3NP8A 4XXEA 2WB1G 4J1MA 1TWCH 2AHOB 1T5XD 4A3MB 1HR0W 1B53A 2WV6D 4DK0A 5E1FA 4FDBA 5JPNC 3S17H 1WCMH 2B3GA 2J0TD 3A74A 3F8TA 4R8IA 4DUYQ 2F0FA 2I07B 1FVIA 4P73A 1WTWA 1SE2A 3AMUA 2K75A 3MXGA 3J81E 1L1OC 1B44D 1S5BD 2A68D 4NDXA 2UUBL 5FLXc 2A6HD 4QIWE 1Y1WH 5M3FB 3T13A 3E0JA 1PRTB 2A1AA 2ID0A 1N32Q 3C1EA 3UI2A 2F0OA 4DR2Q 3VDYA 2MFIA 2Z6BA 1AE3A 4IALA 3J81L 3HS0C 2NN6G 4RGMA 1EY4A 2JA8H 3BYTB 3NELA 2F0VA 1H9KA 1BBXC 1SNCA 3EN2A 2AWOA 3OOCA 3UE0A 1IBKQ 4ZYSA 4V190 3QB3A 3PO3H 1O80A 1BUVT 3GTLB 2JA9A 4ZRZA 2EYFA 1JWUD 1KIXA 4C1NK 1W6KA 1E1TA 1Y8OB 2L0CA 1LTSD 1ILQA 4A3DB 3MTSA 4A4IA 1XMQL 2IX3A 2ZM6L 4HMIA 2JQOA 1VQLA 1DYQA 4BY1H 1X3FA 5C3WA 2JA5B 4X65Q 1M8AA 3G4SA 1HTLD 4KHZA 2DJGC 3I4MG 1Q3LA 2L55A 2L9HA 3KYHC 4F7XA 5CBAE 3Q24A 1Q86C 2XRQD 4J6HA 1M90C 3W2DA 3MXPA 1EIFA 3NXWA 3HOVG 3N52A 1JICA 4LJZC 3VR2A 1PLFA 1A15A 1VQAA 3NENA 4A3MH 5G3LF 2YTVA 2DNEA 3L7ZC 1HFGA 3R3OA 5C5MA 4RCNA 1SMXA 4RA8A 2F0MA 4DR5L 2Z0SA 3TN2A 1S5CD 1GUTA 2GVBA 4DU9A 4B08A 3PUXA 2JJQA 2X6LA 4PZ8A 3OHXC 4JC0A 1I4GA 1BNZA 1OTCA 1YJWA 4A3CG 1FNWA 4TSSA 3PIO3 2NBFA 3CCUA 3ITPA 4JBMA 1B9MA 5M3FH 2RF4A 2ZXRA 1NNXA 4QUFA 2KA7A 1EU4A 2B63H 1CZGA 2BOSA 4OONA 1G2TA 2UU9L 3JAMc 1VQGA 5EKKA 5LMUQ 1B4OA 3I2ZA 2BE5D 3HOXB 1YEZA 4B3TQ 3FPPA 3K81C 3HOYG 3GTLH 5DAUA 2A6ED 5IGEA 1YNNC 3CMAA 3S9WA 4JYAQ 2Z6KC 3RLOA 1SE3A 4HJ7A 4A3DH 3NBHB 4XT1B 2K1BA 4KD4A 2EYOA 1TS5A 2IWHA 4R8NA 5C3EH 2JA5H 5M3MG 1F2YA 2FFKB 5H1SE 3DHQA 1HJPA 3OTOQ 2IL8A 3NQTA 2V4DA 3TMEA 2ICEC 1Q1EA 1WTHA 4LMQD 3RLNA 1EWIA 1DXMA 1HZBA 2NTSA 2OWOA 3CPFA 4N8FA 3QIAA 1YBYA 2OQKA 1SAPA 4B3MQ 3K8AA 2EXZA 4OL7A 3HOZG 4QY7A 5J3BA 3LWEA 3L2PA 2AKWB 1K8GA 5ELNA 1GXDC 1V8QA 4DV6Q 2YU9B 2C5CA 2CVRA 2CH4W 1ICFB 2F0GA 4A76A 2XNAC 1YIJA 4OWXB 2NB0A 3PO2B 3BVZA 3H09A 1ICWA 1K83B 2YTXA 3GO5A 4RFBA 4CDEC 4X62L 4X66Q 2CW0C 1ENFA 2CH4A 2RBMA 1IW7D 1B3QA 1KXLA 3GTMB 2JK8A 1SYFA 5CV8A 1CHPD 4LF9L 3L0OA 2EE1A 4HJAA 4DF7A 4DAPA 1QVFA 2KUMA 3C1FA 1EY9A 4C3HG 4JI8Q 1IYVA 1K0SA 4H02A 1SROA 1BCPC 4LUOA 4QJFA 2BH2A 1D2BA 4BBRB 3G6EA 5LMNQ 1TIID 4B3SL 1HA5A 1MJEA 4XQQA 1KLGD 2XGTA 2NVYB 1PTOD 4RGOS 1JJ2A 2TSSA 1YNXA 2DN8A 1Q8KA 1I94Q 4A3BB 3VYRA 4A93G 3C3LA 2F52A 2N78A 3K58A 3CF5A 5C4XG 4YCUA 1S72A 4DR3Q 1PH8A 4JI1L 4A3IG 3J7A5 4LAAA 1M4VA 3H3VC 1Y8PB 3CCMA 3AYHB 2VNUD 5C0XI 1B3AA 4CBVA 1LM0A 4C3IB 5EBDA 4JPBW 2RCNA 5E4WC 2YU9H 1F2LA 1PH2A 4A3FB 4GNXA 1DOLA 1QNUA 4WJ4A 1G91A 5ELOA 4A3KH 1K83H 4TKOB 2N8NA 2F0EA 5C5LA 2HD3A 3F2UA 3Q23A 2RHSB 4IPHA 4ZCKA 5CYUA 4R4QA 3GTMH 2OT2A 3G7LA 3U4ZA 2LKVA 4GS3A 1NR4A 2UUBQ 4K0KL 1JE4A 4BA2I 4K6DA 4L5RC 2O4XA 5FK9C 3PUWA 2VQFL 4HIDA 3NBIA 1FNUA 2D2CC 4JI5L 5JEAG 1X55A 4CJ2C 1YITA 3CC7A 4BBRH 2ZJQA 2RDHA 3I55A 3MVVA 4E6IA 1E22A 1I6HB 4JV5L 3U4VA 2KCTA 1H9RA 4IUUA 2JSOA 3DWQA 1KLUD 2EJGC 3IKJA 1VQBA 2QILA 2RKSA 4X3SA 1J5EL 3S16H 2B39A 2BA1A 4R4IA 3KOJA 3TP6A 1JWMD 3MFGA 4JCVE 2RDGA 1Q81C 3J7AF 2NVXB 2B2YC 4ODGA 2A68C 1IXRA 4CDFC 2A6HC 3FKIB 4C3IH 2MPMA 1OXSC 1IL8A 4A3CH 3DMUA 3KBGA 4FNFA 4A3FH 2WAQB 3DEPA 4QGUA 1EFID 1NBWA 4B9XA 1CZWA 3ERQA 1S4ZA 3FDTA 2PO4A 4ZAIA 4AH6A 5BN4A 1SMYD 2F4VQ 2K52A 1LYLA 4JI3L 1EL0A 2F3IA 1MJCA 3GTOB 2UXCQ 3HKZE 4CKCA 2LS01 4Y7NB 1Z6HA 4KY5A 2PQAB 1H9MA 2MHVA 1RTOA 3VR3A 2L5TA 1VQEA 4KD3A 5CGKA 2RCFA 2K5DA 3SK4A 2HDMA 1EY0A 5CV9A 4A75A 2C9OA 3K6OA 2F0DA 1U4MA 2AQ1B 2JYOA 2PMZE 1S5ED 5M3MH 4RAUC 1I6HH 1ZXTA 1IKMA 3M7NA 1RF2D 5M5WB 1YNJD 2PI2A 3ULJA 3GV6A 3CCVA 2K4KA 4KTAA 4NPSA 3RMHA 1DJRD 1D1IA 1E7ZA 3T51B 4R4OA 4H13C 5C4ZA 1LACA 4JW0A 4OO1H 4LFAQ 3HOWG 2WKDA 3H94A 2WP8J 2F0IA 3TEHB 4ZLTF 4V0BA 2PW7A 3HKZG 4JBJA 4MNOA 2NVXH 5TSSA 2PZWA 1HNXL 3CRLC 3NQIA 3IRBA 4IUPA 5JVH3 1Y1VG 4NXMQ 3FKIH 4POGA 1K73C 3T1YL 2E2IB 1P16A 5E4XA 4FF2A 3T56B 1UE1A 1FYCA 3PGZA 2JN4A 3I3CA 5ELCA 4YCWA 2BE5C 1LTAD 2LY7A 1WTXA 5I9PA 1Q82C 2GVAA 4RKLA 2O2LD 2ZT9C 3PUZA 1WD1A 1II3A 4OIJA 3M4QA 3GTOH 3NTIA 4X62Q 4A3EG 4A3GB 1W3SA 1SFOB 1DOKA 4IPDA 4C3JB 4LFBQ 2NYZD 2SOBA 4KKTA 2J4XA 4DV0Q 1K0RA 4DV7L 2E2JB 4EQPA 3IAYA 2PI2E 4OX9Q 5GAGC 3KF8A 1Q8IA 3A8IE 2N55A 2NZOA 1SXTA 1TXYA 2KHSA 3RZDB 2YTYA 3T1HQ 1OXUA 5M5WH 1KQSA 1UAPA 3RUZA 1BBWA 4A93H 5IT9c 1AN8A 1Y8NB 2Z4IA 5M9OA 4FXGC 1J8IA 1DD2A 2FINB 4O42A 1G2SA 3LWUA 2O5JC 3SEBA 3MA2B 4O2DA 5CV5A 3KBXA 2K32A 4IUVA 3AFPA 2Z9HA 3M4YA 5IODA 2BH8A 3NTHA 5A2QE 5KRUA 2EDGA 1VMPA 4J15A 5EGTA 2UUAL 4IFDH 1JJGA 5CC4A 4BY7B 5GAHC 3TQYA 4KJNA 4CKBA 1GUWA 5LMNW 4HAEA 3BG3A 1U5KA 2E2IH 3CCLA 4DXGA 3S1RH 1LTLA 5K36G 4JI1Q 2R93G 4MIUA 5A2QL 4LF7Q 1DM0B 2Q2TA 2R92G 2A74C 4LF8L 3K7AB 2OEOA 4X3KA 2F0SA 1BDOA 2I5HA 1XNRL 4UP7A 5KEEA 4ID6A 4A3GH 1SFOH 1AH9A 3KDFB 2HDLA 1LV9A 1PRTF 4L8JA 1U4PA 4I7AA 5C44B 2E2JH 1QNKA 2KEDA 1AE2A 1EIHA 1MD2D 1PTOC 2E2HH 4CKEA 2EYMA 1AW7A 3Q8DA 5IYCG 2N88A 5HY6A 2M00A 1FL0A 1BR9A 3RZDH 1RD9D 3FP9A 4JI5Q 2PYKA 1CM9A 3TS0A 3DXJC 4K5WA 3A8KE 3HZXA 4C1NI 1VQ5A 2ICIA 2UXDL 4DR4Q 3DWAA 1EUJA 2A5HA 2G9HD 3V05A 4IFDJ 2B2VC 4MN3A 5ELEA 1QZGA 4FYDA 3VA7A 4JV5Q 4DNTB 4K14A 5NUCA 5G3LD 1O7YA 4LF6L 1B70B 1DGSA 1MSHA 1RCVD 2PNHA 2VUMB 1HZCA 5E7NA 1U4LA 5GROA 5GADC 5BR8L 2WACA 2CFMA 3U58A 1XPOA 2JE6I 4GNXC 1J5EQ 1EEFD 1OXTA 4GLAC 5CV7A 3KF6A 4BY7H 3TRZA 1HUNA 4PMWA 5FO8B 3T53B 3HOUB 3A55A 1JB7A 4FXDA 1Z47A 5M5XB 5J39A 4HJ9A 2KCNA 5EKIA 1L1OB 2FHTA 1D1KA 3PCOB 1W6JA 3GDEA 2IHEA 4BWGB 4DPGA 1TS4A 1F77A 3K7AH 5C0XJ 4NB3A 1X6OA 3MXNB 3K80C 2NN6I 3BDCA 2BCOA 4QUCA 3D3RA 1E1OA 3K0XA 3ONAB 2F0JA 3NK9A 4XYOA 4H7BA 4R4TA 5C44H 5CBEE 1IL2A 2MGSA 2F4IA 4XYQA 5DM63 2MNAA 4JI2L 1HNWL 1V43A 3X3NA 1N33L 3HP3A 3ERSX 2VQEL 2OF1A 1Z9FA 2B2YA 3KUPA 3ZJYC 2F0LA 4JI4L 2Q2IA 2KHJA 1HQMC 5HGQA 1LO5D 2QF7A 3K59A 3NHHA 2Q8RE 1ML0D 4DA2A 1HFNA 3A5UA 2Q8IB 3TP7A 4Q5VA 2B63B 1PH6A 3HFZB 2XN9C 4JI7L 1FJGL 4C2MH 3I4NG 1WJJA 3A54A 2OQ0A 4OIKA 1SYCA 5CMDA 2VUMH 4FP5D 3URYA 1KAAA 3J80c 2XIWA 1K9MC 3EROA 2JXMB 1VQMA 2D0OA 1SMYC 3TDQA 3PO2G 1F9QA 1JJCB 3HOUH 5M5YB 1JE5A 1I50B 5M5XH 4BBSG 4IOCA 1C48A 1BCPF 5I6WA 2AQ3B 5L37A 5C3EB 4UP8A 4XDXA 3KLWA 3TP5A 4DK1A 3T1YQ 1TWAB 2IW3A 4KN4C 3Q6SA 2AMCB 5IYBG 2Q2UA 2EY2A 1ASYA 2K5NA 5FJ8G 5D3IB 3HG9A 1CKNA 3PF5A 2H5XA 2EYHA 4G7OC 3IL8A 2CQAA 1XPRA 1ENAA 1YNJC 1QG7A 3F2DA 1U0LA 4M8AA 1IBLL 4X64L 1F9RA 4I7ZC 4DV7Q 1K3RA 1G291 3V2TA 4DNRB 5EPLA 5IYDG 1HXYD 1HR0L 4AYBB 2PNRC 1QVCA 3EVQA 2WIIB 4U673 2HIXA 3C2PA 1AZQA 2QDLA 1RDPD 2V1CC 3V96A 3S1NH 4X6AH 1KTKA 4K2LA 4A3LG 1A3TA 1B7YB 1KRTA 4UP9A 5FOBB 4A3JG 4DUZL 1NAPA 4OO1I 2LMCB 4LUZA 1PMRA 3NWTA 4HN7A 1VQHA 4YY3Q 3KJOA 1YHQA 1HTPA 5M5YH 1V1PA 2R92H 3M7GA 1I50H 4ZUIA 3HEJA 2F03A 2R7ZG 2F0KA 2DGYA 1SYBA 1O7LA 1LTTD 1JR0D 1PFMA 4PNYA 2K05A 5ELBA 3TSSA 1UNSA 1HRJA 1TWAH 3DLLA 3H15A 4QQBX 2SDFA 5IGGA 4IZ8A 2WB1B 4QMGA 3QG1A 2QCPX 4OWTB 4LF8Q 4MTNA 2IX1A 4NXNQ 2N3SA 1H9SB 1O7ZA 4X3UA 4AQYL 2IY5B 1BCPB 3UDFA 2E5LL 1N36L 4MHEA 2JA7G 3SHLA 2EOTA 5CV4A 3CRKC 3F2BA 3SE0A 1PYWD 4A3KB 1XTCD 1YI2A 1YJ9A 1SRUA 3RN5A 1SDFA 2LXJA 2AUKA 2GN5A 4JK1C 2PQEA 4ZUJA 3TREA 1JB3A 2UXBL 2RA4A 1IZ6A 4LWCA 1Q90A 1CSPA 2EY6A 5DEHA 3MXUA 1A63A 1ESRA 1VQFA 2EY5A 4DR1Q 2DUDA 1K8MA 2UXDQ 2Q2HA 2K33A 3OYYA 3J7AV 2B2WC 1C8CA 3S15B 1BO0A 3CCRA 2HQLA 3AB9A 4IFDI 3S14H 3E6ZX 2TMPA 4GOPA 1XYIA 2OTJA 3D0FA 3H0GG 1IBML 2K01A 1GOZA 3PSIA 5BR8Q 1HH2P 2NTTA 5JJIA 1TU2B 5AJ3L 3I4MB 4BS9A 3VR6A 4DFAA 3A0JA 5FKAC 1K3BC 3W5OA 3QR8A 4QIWB 3MWYW 3HOVB 1PDQA 3S2HH 5FLMH 3IFDA 2F0NA 4DR6L 3S16B 4JG2A 1IHZA 1TWFB 1NR2A 1V1OA 1STAA 2CHBD 5IP7G 2B2VA 3J81c 4DK6C 1HZAA 4KHPL 5DLQE 4DK3C 3E9IA 2JP1A 1CA6A 3F1ZA 3K57A 1V1QA 1EQVA 1MKHA 3OWEB 4JI0L 1PH3A 2Z1CA 1LUZA 3CC4A 4L5QA 1U9RA 2K5HA 1GUGA 4TRDA 2DJFC 2E74C 2B2UC 1E2VA 3MEFA 2IJ0A 1N33Q 2PZUA 3VR5A 3Q22A 4ME5A 2NN6H 2D0PA 4FF3A 3GD7A 3PIOA 2E75C 2DNCA 2L15A 3GP7A 2ZXPA 3K5OA 5T1GA 4DAVA 4JI4Q 1E24A 1BOSA 1VQOA 3HOYB 2E76C 5IWAL 1PA6A 1UWVA 2B8GA 3S15H 3H3VH 1G6ZA 2L12A 2PW5A 4ULLA 2VB3X 1GVPA 1FJGQ 2MQHA 4GKJL 1JORA 1EY6A 1QJOA 4G4KA 3K5NA 1OXXK 2Q8TA 3S2DH 1I5FA 4IOAA 5D65A 4GKKL 3DUZA 2JA6G 2F1MA 4IJLA 1EZ8A 5I4DA 1Q46A 3MHBA 5M3MB 3PMFA 1EQQA 1ONLA 3I4MH 1GJXA 1P8LA 4XIGS 2WKCA 2MUYA 1TWGB 1SE4A 3Q0AA 1PFSA 3HOVH 4RGTA 1ENCA 3SK8A 1N34L 1XMQQ 1WI5A 3P7JA 2R3ZA 1L0YB 4UAIA 4C3JG 2ZM6Q 1UEAB 4S3SA 3A7AB 3I4LA 3BDOA 4TVAB 1HPCA 4PQXA 1TWFH 4HJ8A 1NY4A 5C0XG
chains in the Genus database with same CATH topology
4M1UB 4KKUA 3VYSA 1I4QA 5KIXA 4RCOA 3OW7A 4DAYA 1E0BA 2F0QA 4HSVA 1KNAA 4GZYC 4XQJA 2KQ3A 4OHJA 4KMUC 3GTQB 3VYUA 1KABA 1TVXA 1UUPA 3QOLA 4HR7B 2Z4HA 3L9AX 3QWNA 2J7ZA 2L11A 1OO9B 5IGCA 4RH6A 5EBCA 1LT3D 2NVTB 2KJXA 4C3HB 1SNMA 4ZKBB 1I3QB 5EKLA 2X69A 4N9TA 3KLSA 2K28A 4L63B 1TKWB 1I4PA 1HHVA 1PXUA 4HMJA 1STNA 3H6MA 3ND8A 3I72A 2KECA 3VA5A 4A93B 3TP8A 1PRTD 1XXGA 5C4XB 2K7VA 4A3IB 2KVMA 4X3TA 2D9UA 5A35A 5KYLA 4PV1C 1V1PB 2A69D 4ZQ3A 3EQLC 1STGA 3I70A 1B1ZA 1NSNS 3FPUB 2VB2X 5KYIA 4WFN3 4NP5A 2A73B 2NWGA 3D4DA 5KGUA 3S1RB 1WVLA 4ZKCB 4HCSA 4IURA 3M3YB 1I4XA 5FLXE 4RWSC 4PMBA 3H91A 3X3MA 2MP1A 5K5PA 2A6EC 3GQBA 3KK7A 1EU3A 1MGSA 1RKNA 2H1EA 1FNVA 1GUNA 5JOBA 1SYGA 3O13A 2HCIA 5FLXL 1MSGA 3MFYA 3HGBA 3R93A 2E2HB 1XX8A 3OMGA 1IYUA 1OXVA 1EEID 1ZEQX 4F87A 2EJMA 4G7HC 1H9JA 2F0HA 1WTRA 1EYAA 1VMCA 4KHVA 3WDNA 4K8IA 3RLFA 5JPMC 1X3PA 1DOMA 1HQRD 1SJHD 4EQOA 3AU7A 1LLRD 1EYCA 3NPPA 1Q12A 5E3FA 1JC7A 2B2WA 1TWHB 4F88A 2EJFC 3NBHA 4K2KA 1IW7C 3PV0A 1STEA 5EPKA 3E5SA 2ZXOA 1D5MC 1SYDA 1S5FD 1A3VA 4IUTA 4K6LA 3RD4A 1TQOA 5JEAH 1XWEA 3R2IA 4H0LC 1A3UA 3JAME 1NUCA 1BCPD 3P1HA 3I8ZA 3QJYA 3JAML 5C4HA 1JOKA 2F0WA 1FD7D 1TY0A 5JAVA 2RQXA 1F9PA 1AEXA 3BZDB 4U68A 3HOWB 2B2UA 4J8QA 1ZYRD 2XRSD 4C2MB 4IUNA 3HKZB 3S1MB 1EQTA 3SXHA 3S1QB 3FVQA 1ZKOA 1Y1VB 1VDZA 1RODA 1SNQA 5LHY1 3U9SA 1PTOH 3K5MA 1HCZA 3OMCA 5IIFA 4CGYB 2K03A 2PMZB 1R4QB 5JEAJ 3R2TA 5F2DA 1D5ZC 3KLRA 5J1ZA 3I73A 1QOHA 1CI3M 1CTMA 4DN4M 3BS1A 4CHTB 1X3QA 1E2ZA 1STBA 1PFBA 2VXWA 3CQZB 5KNDA 4K8JA 1R4PB 1PZID 3GV3A 5I2XA 5IOCA 1EY8A 4NKLA 1Z7TA 4CJ1B 2AQ2B 3T4AC 1TS3A 2EYJA 2RSOA 4NMZA 1NCVA 1SBBB 2RSNA 3SK6A 2DY8A 5IGBA 3GTJB 2SNMA 4QCLA 2EYLA 3N6RA 2EVBA 1QILA 5FO7B 3S1NB 1LT4D 3R8BA 4BA1I 1R9TB 4RKBA 3D4WA 1WTVA 2R93B 3I91A 5EJWA 2EY1A 1JCKB 2SEBD 1A2UA 2R92B 3VYTA 1F2ZA 4ZK9B 2NVQB 5D3DA 2F0TA 2PZTA 1SYEA 3CHBD 3MEHA 1SNOA 3A56A 2D62A 1E2WA 3LNNA 5BN5A 2K6AA 4RHSA 1BQQT 3ZYYX 1WD0A 3A7LA 1PRTC 5C4JB 3FRPB 5J22A 5IGFA 2EPBA 5ELDA 4H44C 1KDAA 2A69C 4RHRA 2KOLA 1HA6A 1U4RA 2R61A 1G8ZD 3QO2A 3FEWX 1EYDA 2NUCA 4C3IG 5K36H 3S14B 2HQEA 2L4NA 3KLSX 5JJZA 1ESFA 1F9SA 3RZOB 1HUMA 1MI2A 4B9WA 3J7YW 2AUJD 3S2HB 1CFMA 2GA4B 1JOQA 4QB4A 5ISRA 4EGVA 1DCZA 3DEOA 1TT2A 3IFTA 3D6CA 1RJTA 2K04A 4YIJA 3OIQA 3HRZC 3PUYA 1MBYA 1TY2A 3I4NB 4N9PA 1C4QA 1VF7A 2XVSA 4K5XA 2KEEA 4PMCA 4OO1G 1STYA 2K5WA 1CHQD 1SNPA 1LABA 3D31A 1I4HA 4FXKC 4BBSB 2HUGA 1SSOA 1D6EC 4G57A 3S2DB 1LTBD 1EIGA 2B2TA 2PCFB 3G6JB 3P20A 1GHKA 5HURA 5I6YA 2BDOA 2QKIC 1QB5D 4KY7A 2MJ8A 4DGZA 3QOJA 1B50A 1RHPA 2RVLA 3CKIB 5I9OA 3EA6A 1LT5D 2IX0A 1WTPA 2LFNA 2F0PA 2XWBB 5C6AA 3C46A 1ZYRC 1WTOA 1QE6A 5JVG3 2B8FA 4I65A 3LX0A 1T5EA 3FMCA 3TZUA 4G7ZC 1B9NA 4A3JB 5IT9E 4ABNA 1KNEA 1FGBD 2I46A 5EPJA 4IFDG 2XWJB 3OPOA 4C56C 3M85A 5IT9L 1VF5C 4WRDA 1WTQA 5DNFA 2R7ZB 2FJ2A 1LT6D 5COYA 5BN3A 3NSWA 1S5DD 2F0UA 1PZKD 3SK5A 5HGTA 2OXPA 5CORA 2X6GA 3TBIB 5LL6X 3WOFA 1GUOA 2R6GA 3BDLA 3HOZB 2WINB 3GTGB 2JA7B 5KNCA 5AFWA 1X32A 5KNBA 4Z9CB 4IN3A 1L0XB 3U9OA 2FMCA 1A6XA 1EY7A 1TS2A 4WJWA 1F2MA 2BA0A 4KI0A 1JQYD 4QF4A 3MXNA 3T16A 1LTID 5FO9B 1PZJD 1PFNA 1EZ6A 3I90A 3MZ5A 2JEBI 3H0GB 3L3OC 4ILWA 2FMMA 5C3XA 3BYYB 3WOEA 1D5XC 5T1IA 3MAQA 4UDUC 1PTOF 4RGNA 4KK7A 1Y69U 4FVMA 4F8MA 2ENBA 2AWNA 2YYZA 3CU7A 1A2TA 3P75A 1ET6A 3D4RA 2IT1A 1SEBD 2SNSA 1SNDA 4LK1C 4OGQC 1EOTA 1QCBD 1QWYA 3K5LA 2QDBA 2F3VA 1K8OA 4WORA 4FF4A 3NE5B 2EZVA 2D5DA 3GTPB 1O78A 4DXFA 3EFXD 1EY5A 2G9DA 2JA6B 3OIPA 1YNND 3J80E 2M9VA 4O1NA 5ELFA 4L6TB 4CJ0B 1GHJA 5IGDA 4HCEA 1CA5A 4TQUS 1SJED 1KDCA 1CQFA 1STHA 5CV6A 3J80L 4EQNA 3NTKA 1LTGD 2BDNA 1BF4A 3DWPA 1ET9A 3D8GA 3OWFA 2K5QA 1PTOB 1B2TA 2NZ1D 3VR4A 4KV6A 4FF1A 4JBWA 2RDFA 4KN7C 4HEDA 3A8JE 5EQ0A 2CW0D 2Y0SB 1J9OA 2M2LA 1EWCA 3MC0B 4Q0FA 3GTKB 1I4RA 1H9SA 1EWHA 5D14A 3OSOA 2B2TC 1IKLA 4IUQA 1AP0A 3TZDA 2O5IC 1CK1A 4K5VA 2QEJC 4KY6A 3SVMA 3K0YA 3M4OB 5CR3A 1GUSA 3DM1A 4IQZA 1TWCB 5C0XH 4R9WA 2KCCA 4KJOA 3BVGA 3S17B 1WCMB 1JWSD 1CT1D 3W3AA 3PIP3 3PUVA 1RTNA 1CQVA 1ILPA 1Y1WB 4P2CB 1LTRD 4XT3B 1AFPA 3SDZA 2DY7A 2Z8LA 2JEAI 1JOOA 4NW2A 2EYPA 4HTHA 1DONA 2JA8B 3NWSA 5DM73 4EVOA 4KKSA 1TR5A 4A3EB 2E2DC 3PO3B 2L1BA 2F3WA 1FR3A 4HSPA 3EJIA 1DZ1A 3ND9A 4XQNA 2IPKD 2PPBC 1AZPA 4BY1B 1KDBA 3SR1A 4XTCS 5I2YA 1BXTA 3BVMA 2XSCA 1VCIA 5LL6S 4FO2A 1I6VC 1Q1BA 2H4OA 3NUCA 2HCCA 3D6WA 4XXEA 3NP8A 4J1MA 1T5XD 4A3MB 1B53A 2WV6D 4DK0A 5E1FA 5JPNC 2J0TD 4R8IA 2F0FA 2I07B 1WTWA 3AMUA 1SE2A 3MXGA 3J81E 1B44D 1S5BD 2A68D 4NDXA 2A6HD 5M3FB 3T13A 3E0JA 1PRTB 2ID0A 3C1EA 3UI2A 2F0OA 4IALA 3J81L 3HS0C 2NN6G 4RGMA 1EY4A 3BYTB 2F0VA 1H9KA 1BBXC 1SNCA 2AWOA 3OOCA 4ZYSA 4V190 3QB3A 1O80A 1BUVT 3GTLB 4ZRZA 2EYFA 1JWUD 4C1NK 1W6KA 1Y8OB 2L0CA 1LTSD 1ILQA 4A3DB 3MTSA 2IX3A 4HMIA 1DYQA 5C3WA 2JA5B 1M8AA 1HTLD 4KHZA 1Q3LA 2L55A 2L9HA 4F7XA 5CBAE 3Q24A 2XRQD 4J6HA 3W2DA 3MXPA 3NXWA 3N52A 1JICA 4LJZC 3VR2A 1PLFA 1A15A 5G3LF 2DNEA 3L7ZC 1HFGA 3R3OA 5C5MA 4RCNA 4RA8A 2F0MA 3TN2A 1S5CD 1GUTA 4DU9A 4B08A 3PUXA 2X6LA 1BNZA 3OHXC 1I4GA 1FNWA 4TSSA 3PIO3 2NBFA 3ITPA 1B9MA 2ZXRA 4QUFA 2KA7A 1EU4A 1CZGA 2BOSA 1G2TA 5EKKA 1B4OA 2BE5D 3HOXB 3FPPA 5DAUA 2A6ED 5IGEA 1YNNC 3S9WA 1SE3A 4XT1B 2K1BA 4KD4A 2EYOA 1TS5A 2IWHA 4R8NA 1F2YA 2FFKB 3DHQA 2IL8A 3NQTA 2V4DA 3TMEA 2ICEC 1Q1EA 4LMQD 1DXMA 2NTSA 3QIAA 1SAPA 2EXZA 4OL7A 3LWEA 1GXDC 1V8QA 2YU9B 2C5CA 2CVRA 2F0GA 2XNAC 2NB0A 3PO2B 3BVZA 3H09A 1ICWA 1K83B 3GO5A 4RFBA 2CW0C 1ENFA 2RBMA 1IW7D 3GTMB 1SYFA 5CV8A 1CHPD 2EE1A 4DF7A 4DAPA 2KUMA 3C1FA 1EY9A 4C3HG 1IYVA 1BCPC 1D2BA 4BBRB 1TIID 1HA5A 4XQQA 1KLGD 2NVYB 1PTOD 4RGOS 2TSSA 2DN8A 4A3BB 3VYRA 3C3LA 3K58A 4LAAA 1M4VA 3H3VC 1Y8PB 2VNUD 5C0XI 1B3AA 4CBVA 4C3IB 5EBDA 5E4WC 1F2LA 4A3FB 1DOLA 1QNUA 1G91A 4TKOB 2F0EA 5C5LA 3F2UA 3Q23A 5CYUA 2OT2A 3G7LA 2LKVA 1NR4A 1JE4A 4BA2I 4K6DA 2O4XA 5FK9C 3PUWA 3NBIA 1FNUA 2D2CC 5JEAG 4CJ2C 2RDHA 3MVVA 4E6IA 1I6HB 1H9RA 4IUUA 2JSOA 3DWQA 1KLUD 2EJGC 3IKJA 2QILA 2RKSA 4X3SA 2B39A 2BA1A 3TP6A 1JWMD 3MFGA 2RDGA 3J7AF 2NVXB 2B2YC 4ODGA 2A68C 2A6HC 3FKIB 2MPMA 1OXSC 1IL8A 3DMUA 3KBGA 4FNFA 2WAQB 3DEPA 1EFID 4B9XA 1CZWA 3ERQA 1S4ZA 3FDTA 2PO4A 4ZAIA 5BN4A 1SMYD 1EL0A 3GTOB 4CKCA 2LS01 4Y7NB 1Z6HA 4KY5A 1H9MA 2MHVA 1RTOA 3VR3A 2L5TA 4KD3A 5CGKA 2K5DA 3SK4A 2HDMA 1EY0A 5CV9A 2C9OA 3K6OA 2F0DA 1U4MA 2AQ1B 2JYOA 1S5ED 4RAUC 1ZXTA 1IKMA 3M7NA 1RF2D 5M5WB 1YNJD 3GV6A 4KTAA 3RMHA 1DJRD 1D1IA 3T51B 4H13C 5C4ZA 1LACA 4OO1H 2WKDA 3H94A 2WP8J 2F0IA 4ZLTF 4V0BA 2PW7A 5TSSA 2PZWA 3CRLC 3NQIA 4IUPA 5JVH3 2E2IB 4FF2A 5E4XA 3T56B 1FYCA 3I3CA 5ELCA 2BE5C 1LTAD 2LY7A 1WTXA 5I9PA 4RKLA 2O2LD 2ZT9C 3PUZA 1WD1A 1II3A 4OIJA 3NTIA 4A3GB 1SFOB 1DOKA 4C3JB 2NYZD 2SOBA 4KKTA 2J4XA 2E2JB 4EQPA 3IAYA 3KF8A 1Q8IA 3A8IE 2N55A 1SXTA 2KHSA 3RZDB 1OXUA 1UAPA 3RUZA 1AN8A 1Y8NB 2Z4IA 5M9OA 4FXGC 1J8IA 1DD2A 2FINB 4O42A 1G2SA 3LWUA 2O5JC 3SEBA 3MA2B 5CV5A 3KBXA 2K32A 4IUVA 3M4YA 5IODA 3NTHA 5A2QE 5KRUA 2EDGA 1VMPA 4IFDH 5EGTA 5CC4A 4BY7B 4KJNA 4CKBA 1GUWA 4HAEA 3BG3A 4DXGA 5K36G 4MIUA 5A2QL 1DM0B 2A74C 3K7AB 2OEOA 4X3KA 2F0SA 1BDOA 5KEEA 4ID6A 2HDLA 1LV9A 1PRTF 4L8JA 1U4PA 5C44B 1QNKA 2KEDA 1EIHA 1MD2D 1PTOC 4CKEA 2EYMA 1AW7A 2N88A 2M00A 1BR9A 1RD9D 2PYKA 1CM9A 3DXJC 4K5WA 3A8KE 3HZXA 4C1NI 2ICIA 3DWAA 2A5HA 2G9HD 3V05A 4IFDJ 2B2VC 4MN3A 5ELEA 4FYDA 3VA7A 4DNTB 4K14A 5NUCA 5G3LD 1O7YA 1MSHA 1RCVD 2VUMB 1U4LA 2WACA 2JE6I 1EEFD 1OXTA 1HUNA 4PMWA 5FO8B 3T53B 3HOUB 3A55A 4FXDA 1Z47A 5M5XB 5J39A 2KCNA 5EKIA 2FHTA 1D1KA 1W6JA 4BWGB 1TS4A 1F77A 5C0XJ 2NN6I 3BDCA 2BCOA 4QUCA 3D3RA 3ONAB 2F0JA 3NK9A 4XYOA 4H7BA 5CBEE 2MGSA 2F4IA 4XYQA 5DM63 1V43A 3X3NA 3HP3A 2OF1A 2B2YA 3KUPA 2F0LA 1HQMC 1LO5D 2QF7A 3K59A 3NHHA 2Q8RE 1ML0D 4DA2A 1HFNA 2Q8IB 3TP7A 4Q5VA 2B63B 2XN9C 3A54A 4OIKA 1SYCA 5CMDA 4FP5D 3URYA 1KAAA 2XIWA 3EROA 2JXMB 1SMYC 3TDQA 1F9QA 5M5YB 1I50B 1C48A 1BCPF 5I6WA 2AQ3B 5C3EB 4XDXA 3TP5A 4DK1A 1TWAB 2IW3A 4KN4C 3Q6SA 2EY2A 5D3IB 3HG9A 2EYHA 4G7OC 3IL8A 2CQAA 1ENAA 1YNJC 1QG7A 4M8AA 1F9RA 4I7ZC 3V2TA 1G291 4DNRB 5EPLA 1HXYD 4AYBB 2PNRC 3EVQA 2WIIB 4U673 3C2PA 1AZQA 1RDPD 3V96A 1KTKA 4K2LA 1A3TA 5FOBB 1NAPA 4OO1I 2LMCB 1PMRA 3NWTA 4HN7A 1HTPA 1V1PA 3M7GA 4ZUIA 3HEJA 2F03A 2F0KA 1SYBA 1O7LA 1LTTD 1JR0D 1PFMA 4PNYA 2K05A 5ELBA 3TSSA 1UNSA 1HRJA 2SDFA 5IGGA 4IZ8A 2WB1B 4QMGA 3QG1A 2QCPX 2IX1A 1H9SB 1O7ZA 4X3UA 1BCPB 4MHEA 3SHLA 2EOTA 5CV4A 3CRKC 3SE0A 1PYWD 4A3KB 1XTCD 1SDFA 2AUKA 4JK1C 4ZUJA 2PQEA 1JB3A 2RA4A 1Q90A 2EY6A 5DEHA 3MXUA 1ESRA 2EY5A 1K8MA 2K33A 3J7AV 2B2WC 1C8CA 3S15B 1BO0A 3AB9A 4IFDI 3E6ZX 2TMPA 1XYIA 2K01A 1GOZA 2NTTA 1TU2B 3I4MB 4BS9A 3VR6A 4DFAA 5FKAC 4QIWB 3MWYW 3HOVB 1PDQA 3IFDA 2F0NA 3S16B 1IHZA 1TWFB 1NR2A 1V1OA 1STAA 2CHBD 2B2VA 2JP1A 1CA6A 3K57A 1EQVA 3OWEB 2Z1CA 1U9RA 1GUGA 4TRDA 2E74C 2B2UC 1E2VA 2IJ0A 2PZUA 3VR5A 3Q22A 4ME5A 2NN6H 4FF3A 3GD7A 2E75C 2DNCA 3GP7A 2ZXPA 3K5OA 5T1GA 4DAVA 1BOSA 3HOYB 2E76C 2B8GA 1G6ZA 2L12A 2PW5A 4ULLA 2VB3X 1JORA 1EY6A 1QJOA 4G4KA 3K5NA 1OXXK 2Q8TA 5D65A 3DUZA 2F1MA 1EZ8A 5I4DA 3MHBA 5M3MB 3PMFA 1ONLA 1GJXA 4XIGS 2WKCA 2MUYA 1TWGB 1SE4A 3Q0AA 4RGTA 1ENCA 3SK8A 3P7JA 2R3ZA 1L0YB 4UAIA 4C3JG 1UEAB 4S3SA 3A7AB 3I4LA 3BDOA 1HPCA 4PQXA 5CV7A 5C0XG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B53 A;  1EL0 A;  1F9P A;  2FHT A;  4U68 A;  1MGS A;  1F9R A;  2FJ2 A;  5D14 A;  1EOT A;  2B2U A;  2H1E A;  2B2T C;  1J8I A;  1IKL A;  4IUQ A;  5COY A;  5EPL A;  4R8I A;  2FIN B;  1XYI A;  4O42 A;  1G2S A;  2HCI A;  1WTW A;  1MSG A;  1E0B A;  1EQT A;  2K01 A;  1AP0 A;  4HSV A;  1B3A A;  1KNA A;  1RTO A;  3TZD A;  3KBX A;  2KEE A;  1ROD A;  4QUC A;  3R93 A;  4IUV A;  3ONA B;  4XT1 B;  2K1B A;  1XX8 A;  1AZQ A;  5E4W C;  2HDM A;  1F2L A;  5COR A;  1DOL A;  3SVM A;  3MWY W;  1G91 A;  3UI2 A;  2X6G A;  1U4M A;  1VMP A;  1TVX A;  2JYO A;  1PDQ A;  2FFK B;  2K03 A;  3IFD A;  5CBE E;  3DM1 A;  2MGS A;  1NAP A;  4RAU C;  1GUW A;  2IL8 A;  2J7Z A;  2L11 A;  1ZXT A;  4HAE A;  1IKM A;  1WD0 A;  2HUG A;  3F2U A;  1NR2 A;  4R9W A;  1SSO A;  3HP3 A;  5AFW A;  2B2V A;  3GV6 A;  1BBX C;  1WTR A;  1X32 A;  1VMC A;  3G7L A;  4LMQ D;  4DN4 M;  1EIG A;  2B2T A;  1O80 A;  2EPB A;  2B2Y A;  4ZKB B;  3KUP A;  1X3P A;  1DOM A;  2X69 A;  1NR4 A;  1X3Q A;  1JE4 A;  2JP1 A;  1CA6 A;  4X3K A;  1G6Z A;  1SAP A;  1RTN A;  1PFB A;  2K28 A;  2VXW A;  1ILP A;  1ILQ A;  3LWE A;  3MTS A;  4CJ2 C;  2Q8R E;  1ML0 D;  1PFM A;  1U4R A;  2KOL A;  2K05 A;  2CVR A;  1HA6 A;  1HFN A;  4CJ0 B;  3QO2 A;  4XT3 B;  4ZLT F;  1HHV A;  3GV3 A;  2MJ8 A;  2HDL A;  2B2U C;  1M8A A;  1LV9 A;  2B2W A;  1CA5 A;  1HRJ A;  1U4P A;  2DY7 A;  1ICW A;  4CJ1 B;  1QNK A;  2KED A;  4IUP A;  2SDF A;  1Q3L A;  2L9H A;  4OIK A;  5CBA E;  5CMD A;  4NW2 A;  1B50 A;  1DON A;  2KEC A;  1EIH A;  1RHP A;  2RVL A;  5E4X A;  2RSO A;  2BDN A;  5EPK A;  1BF4 A;  5T1G A;  1PFN A;  2XIW A;  4IUU A;  2L4N A;  2N88 A;  3N52 A;  1JIC A;  5JJZ A;  1NCV A;  1O7Z A;  4X3U A;  2RSN A;  1F9S A;  2DY8 A;  3I3C A;  1CM9 A;  1F9Q A;  3I90 A;  1WTP A;  1HUM A;  1PLF A;  1A15 A;  2KVM A;  4IUT A;  4X3T A;  1MI2 A;  2D9U A;  2L12 A;  2L1B A;  2EE1 A;  4MHE A;  4X3S A;  1WTX A;  1HFG A;  2EOT A;  1DZ1 A;  2KUM A;  2FMM A;  4RA8 A;  1WD1 A;  1WTO A;  1B2T A;  2NZ1 D;  1QE6 A;  4XDX A;  4OIJ A;  2B2V C;  4MN3 A;  2Q8T A;  3TN2 A;  5D65 A;  3FPU B;  5T1I A;  1DOK A;  1AZP A;  2B2Y C;  2X6L A;  1BNZ A;  2NYZ D;  1O7Y A;  1SDF A;  2NWG A;  3Q6S A;  4HED A;  5EQ0 A;  1KNE A;  2MPM A;  1MSH A;  1IL8 A;  1WVL A;  2RA4 A;  3I8Z A;  5EKI A;  3DEO A;  5EPJ A;  1U4L A;  4ZKC B;  1WTV A;  4HCS A;  4IUR A;  3DEP A;  1J9O A;  1ESR A;  2M2L A;  4QUF A;  1RJT A;  3I91 A;  2N55 A;  2K04 A;  3P7J A;  2R3Z A;  4UAI A;  5EJW A;  1S4Z A;  3FDT A;  4ZAI A;  1G2T A;  2HCC A;  1HUN A;  3D6W A;  2B2W C;  3IL8 A;  4RWS C;  1C8C A;  1BO0 A;  1QG7 A;  1B4O A;  1WTQ A;  3H91 A;  5DNF A;  2MP1 A;  4ZK9 B; 
#chains in the Genus database with same CATH topology
 4M1U B;  2R7D A;  4KKU A;  4JOI C;  4HIK A;  1XMO L;  3VYS A;  4R4C A;  1JMC A;  1I4Q A;  5KIX A;  4RCO A;  3UE1 A;  1PH9 A;  3OW7 A;  4DAY A;  1VQJ A;  1NMF A;  1L0W A;  1E0B A;  1KD1 C;  2F0Q A;  4HSV A;  1GKH A;  1KNA A;  4GZY C;  4XQJ A;  2KQ3 A;  4OHJ A;  4KMU C;  2YV5 A;  2KCM A;  3GTQ B;  3TS2 A;  1X54 A;  3RNU A;  3VYU A;  1KAB A;  4LNQ A;  1TVX A;  1UUP A;  3QOL A;  4HR7 B;  2Z4H A;  4DR5 Q;  3L9A X;  3QWN A;  4A3J H;  2J7Z A;  2L11 A;  4P74 A;  1QUQ A;  1OO9 B;  5IGC A;  4RH6 A;  4BXX G;  2Y0S G;  5EBC A;  1HR0 Q;  1LT3 D;  2NVT B;  2KJX A;  4DV4 L;  3HOY H;  4C3H B;  1SNM A;  4LFC L;  1XNQ L;  2N49 A;  4ZKB B;  1I3Q B;  5EKL A;  2X69 A;  1M1K C;  4N9T A;  3KLS A;  2UUC L;  2K28 A;  4L63 B;  1TKW B;  1VQ8 A;  2UU9 Q;  3WWV A;  1I4P A;  1FGU A;  1HHV A;  1PXU A;  2CWA A;  4HMJ A;  1STN A;  2ATW A;  3H6M A;  1KRS A;  3ND8 A;  3I72 A;  2KEC A;  3VA5 A;  1C7Y A;  1TWG H;  4JI6 L;  4A93 B;  4DUY L;  3TP8 A;  1PRT D;  1XXG A;  5C4X B;  4DV2 L;  2K7V A;  4DAM A;  4A3I B;  2KVM A;  5IY0 A;  3J80 i;  4X3T A;  2D9U A;  1N32 L;  5A35 A;  3HOZ H;  5KYL A;  3CXC A;  2RHQ B;  4PV1 C;  1V1P B;  2A69 D;  4ZQ3 A;  3U50 C;  3EQL C;  4P71 A;  1WCM G;  2ZTC A;  1GD7 A;  3I70 A;  1B1Z A;  1NSN S;  1STG A;  2VB2 X;  3FPU B;  4UPA A;  5KYI A;  4WFN 3;  4NP5 A;  3E3X A;  1BBU A;  2A73 B;  1QVG A;  2NWG A;  3D4D A;  5KGU A;  1IBK L;  3S1R B;  3KJP A;  1WVL A;  1EFW A;  4DNI A;  4AQY Q;  1Y1W G;  2QA4 A;  4ZKC B;  4HCS A;  4IUR A;  3GTQ H;  3M3Y B;  3CC2 A;  1XTD A;  1YHA A;  1I4X A;  2KBN A;  5FLX E;  4RWS C;  1NTG A;  4PMB A;  2JA8 G;  3H91 A;  3X3M A;  2MP1 A;  5K5P A;  4X65 L;  2A6E C;  3GQB A;  3KK7 A;  2NVT H;  1EU3 A;  1MGS A;  1RKN A;  4C3H H;  2H1E A;  3PO3 G;  1FNV A;  1GUN A;  1I3Q H;  5JOB A;  1KHI A;  1SYG A;  3O13 A;  2UXB Q;  2HCI A;  5FLX L;  1MSG A;  4GN4 B;  3MFY A;  2I5M X;  3H0G H;  3HGB A;  3K7U C;  3R93 A;  4LF9 Q;  2E2H B;  1XX8 A;  3OMG A;  4BY1 G;  1IYU A;  1OXV A;  1VQC A;  1EEI D;  1ZEQ X;  4F87 A;  2EJM A;  2OCE A;  4G7H C;  1H9J A;  2F0H A;  4JBK A;  4YWL A;  1WTR A;  1EYA A;  1VMC A;  4KHV A;  5C4X H;  3WDN A;  4K8I A;  3RLF A;  5AJ3 Q;  4B3S Q;  5JPM C;  1X3P A;  1DOM A;  4A3I H;  1XJV A;  1HQR D;  1SJH D;  4EQO A;  1EYG A;  4A3M G;  2VZA A;  3RN2 A;  3AU7 A;  1XPU A;  1LLR D;  5LMU L;  4DR6 Q;  1EYC A;  3NPP A;  1Q12 A;  1JT8 A;  4GLV B;  2LSS A;  4RG1 A;  5E3F A;  1JC7 A;  3UDX A;  2B2W A;  1TWH B;  4F88 A;  2EJF C;  4B3T L;  3NBH A;  4K2K A;  1H95 A;  1IW7 C;  3PV0 A;  2VW9 A;  1PHJ A;  5M3F G;  1STE A;  5EPK A;  4ALP A;  3E5S A;  3M3Y H;  2ZXO A;  1SE8 A;  4YWK A;  1D5M C;  2B63 G;  4LUV A;  1SYD A;  2MO0 A;  1S5F D;  3I7F A;  4JI0 Q;  4ME3 A;  1A3V A;  4IUT A;  4K6L A;  3RD4 A;  1TQO A;  5JEA H;  1XWE A;  4IPC A;  3R2I A;  4H0L C;  3GTP H;  1A3U A;  3JAM E;  3OTO L;  2EIF A;  1NUC A;  4GNX B;  4GOP C;  1Y14 B;  4IO9 A;  1BCP D;  4QL5 A;  4A3D G;  1K8A C;  1W2B A;  3P1H A;  3I8Z A;  4K0K Q;  3QJY A;  5IWA Q;  4UHV A;  3JAM L;  5C4H A;  5C3E G;  2VQF Q;  2JA5 G;  1JOK A;  4AIM A;  2F0W A;  1FD7 D;  4GKJ Q;  1TY0 A;  5JAV A;  3PQI A;  2RQX A;  4GKK Q;  4IJH A;  1F9P A;  1AEX A;  3BZD B;  4U68 A;  3HOW B;  2B2U A;  4X66 L;  4J8Q A;  1ZYR D;  2XRS D;  4C2M B;  4DR7 L;  4IUN A;  3HKZ B;  3S1M B;  1EQT A;  1UE6 A;  3SXH A;  3S1Q B;  3FVQ A;  1ZKO A;  1Y1V B;  1VDZ A;  1ROD A;  1N34 Q;  1SNQ A;  1VQ7 A;  5LHY 1;  3U9S A;  1PTO H;  2A19 A;  3BU2 A;  3K5M A;  1PH7 A;  1CKO A;  1HCZ A;  3OMC A;  5IIF A;  1TWH H;  4CGY B;  2K03 A;  2PMZ B;  1PH5 A;  1R4Q B;  1XMO Q;  1C0A A;  5JEA J;  3R2T A;  5F2D A;  1D5Z C;  3KLR A;  5J1Z A;  2CWP A;  3I73 A;  1QOH A;  2I5L X;  3UDI A;  1CI3 M;  1CTM A;  4DN4 M;  3BS1 A;  3M9B A;  4CHT B;  5LMN L;  1EQR A;  1X3Q A;  1E2Z A;  3J81 i;  1STB A;  1PFB A;  2VXW A;  3HOX G;  3CQZ B;  5KND A;  4K8J A;  1R4P B;  1PZI D;  3AFQ A;  1L2F A;  1I94 L;  1CSQ A;  1WYD A;  3GV3 A;  4JI3 Q;  3H3V I;  5I2X A;  5IOC A;  1EY8 A;  4NKL A;  1Z7T A;  4CJ1 B;  4PZ7 A;  2NZH A;  4DV4 Q;  2AQ2 B;  3T4A C;  4LFC Q;  4JOI A;  1TS3 A;  2EYJ A;  1VS0 A;  2RSO A;  4NMZ A;  1NCV A;  1SBB B;  2RSN A;  3SK6 A;  2DY8 A;  1RIP A;  5IGB A;  3GTJ B;  2SNM A;  4QCL A;  2FXQ A;  4OEM B;  2EYL A;  3N6R A;  1NJI C;  2EVB A;  3HOW H;  1QIL A;  5FO7 B;  4HJ5 A;  1LT4 D;  3S1N B;  2VY3 A;  3BZK A;  3S1M H;  3R8B A;  4BA1 I;  4JI6 Q;  3S1Q H;  1Y1V H;  1R9T B;  4APV A;  1HNZ L;  4DV2 Q;  4RKB A;  2I0Q A;  3D4W A;  3J7Z C;  1WTV A;  3KFU A;  2R93 B;  3I91 A;  2HHH L;  2HIV A;  5EJW A;  2EY1 A;  1JCK B;  2SEB D;  2MO1 A;  4A3K G;  1A2U A;  2K14 A;  2R92 B;  3VYT A;  1F2Z A;  4P72 A;  3ER0 A;  4ZK9 B;  5IE8 A;  1HNX Q;  2NVQ B;  5D3D A;  2F0T A;  2PZT A;  4A3E H;  1SYE A;  3CHB D;  3MEH A;  1SNO A;  3A56 A;  2D62 A;  4EX5 A;  3CQZ H;  1E2W A;  3LNN A;  5BN5 A;  2K6A A;  4BBR G;  1CKM A;  1Q7Y C;  4RHS A;  1BQQ T;  3ZYY X;  1WD0 A;  3A7L A;  2ZJP A;  1S3O A;  1PRT C;  5C4J B;  3FRP B;  3SGI A;  5J22 A;  5IGF A;  3ULL A;  2EPB A;  5ELD A;  4H44 C;  3GTJ H;  1KDA A;  3PIP A;  1T9H A;  4A3B G;  2CCZ A;  4RMF A;  2A69 C;  4RHR A;  4PZ6 A;  4N8X 1;  3AEV A;  2KOL A;  1HA6 A;  1U4R A;  2R61 A;  1G8Z D;  3QO2 A;  2F4V L;  3FEW X;  2PQA A;  1EYD A;  3KF8 B;  2E8G A;  3HKS A;  3ULP A;  1YJN A;  1R9T H;  2K5V A;  1B8A A;  2NUC A;  4C3I G;  4YHH L;  4WJ3 M;  3ICE A;  2UXC L;  5K36 H;  1G51 A;  3S14 B;  4A3F G;  2R93 H;  4OXP A;  2HQE A;  2L4N A;  3KLS X;  3CCE A;  5JJZ A;  1ESF A;  4OEL B;  1F9S A;  3RZO B;  1NMG A;  1HUM A;  1MI2 A;  2UUA Q;  4B9W A;  1X3E A;  2NVQ H;  1WFQ A;  3J7Y W;  3CP0 A;  2AUJ D;  1UE5 A;  3S2H B;  1CFM A;  2GA4 B;  1JOQ A;  1EIY B;  4QB4 A;  5ISR A;  5EAY A;  4EGV A;  1DCZ A;  3DEO A;  1TT2 A;  2WAQ E;  3IFT A;  3D6C A;  5IYC H;  2A8V A;  1EOV A;  4YWM A;  1RJT A;  2K04 A;  4B3R L;  1XNR Q;  3NEM A;  3CCJ A;  2QW7 A;  4LFA L;  3CW2 C;  4YIJ A;  1VQK A;  2CKZ B;  3OIQ A;  5C4J H;  3HRZ C;  4NXM L;  3PUY A;  1MBY A;  1TY2 A;  3I4N B;  4N9P A;  1UEB A;  2LXK A;  1C4Q A;  3M4P A;  1VF7 A;  2XVS A;  1BKB A;  2KEE A;  4K5X A;  4PMC A;  4OO1 G;  1STY A;  2K5W A;  1CHQ D;  1SN8 A;  1SNP A;  1UE7 A;  1LAB A;  3D31 A;  3STB D;  1NE3 A;  3FKI G;  1I4H A;  1X65 A;  4FXK C;  4BBS B;  2HUG A;  1SSO A;  5IP9 G;  2WAQ G;  4DR7 Q;  2P5Z X;  4LF6 Q;  4LFB L;  1D6E C;  4G57 A;  3S2D B;  1LTB D;  4DV0 L;  1EIG A;  2B2T A;  2PCF B;  4Y52 H;  3RZO H;  3G6J B;  3P20 A;  4OX9 L;  1GHK A;  5HUR A;  1ASZ A;  5I6Y A;  4PG3 A;  2BDO A;  4IPG A;  1O7I A;  2QKI C;  1VQ9 A;  3HOX H;  1QB5 D;  1YHB A;  3W1B A;  3T1H L;  4KY7 A;  2MJ8 A;  2ES2 A;  4DGZ A;  3PF4 A;  5JJK A;  3KF6 B;  3QOJ A;  1B50 A;  4HIM A;  1RHP A;  3JC6 6;  2RVL A;  3CKI B;  2B29 A;  5I9O A;  1PVO A;  4EQ5 A;  3EA6 A;  1LT5 D;  2IX0 A;  2CQO A;  1WTP A;  2LFN A;  2F0P A;  2XWB B;  4CDD C;  5C6A A;  1YVC A;  3C46 A;  1G6P A;  1ZYR C;  1WTO A;  1QE6 A;  5JVG 3;  4DV3 L;  2B8F A;  4JI2 Q;  1HNW Q;  4I65 A;  3LX0 A;  1T5E A;  2R7F A;  3FMC A;  3TZU A;  4G7Z C;  2VQE Q;  3I4N H;  1B9N A;  1VQN A;  4A3J B;  5IT9 E;  4ABN A;  1KNE A;  1GO3 E;  4LF7 L;  1FGB D;  2I46 A;  5EPJ A;  1VQP A;  3KDF A;  4IFD G;  2XWJ B;  4CDC C;  4OWW B;  3PO2 H;  3OPO A;  4C56 C;  2G5D A;  5IT9 L;  3M85 A;  1VQ6 A;  2ALY B;  4JI7 Q;  1VF5 C;  4WRD A;  1WTQ A;  1A62 A;  4BBS H;  5DNF A;  4HIO A;  2R7Z B;  1J6Q A;  2XTI A;  1KAW A;  2FJ2 A;  1LT6 D;  1GM5 A;  5COY A;  5BN3 A;  1HNZ Q;  3CD6 A;  3NSW A;  1S5D D;  2F0U A;  5IYB H;  1PZK D;  2Y0S E;  1QZH A;  2HHH Q;  5FJ8 H;  3SK5 A;  1PV4 A;  4DKA C;  5HGT A;  2OXP A;  5COR A;  4A3G G;  4LF4 L;  1A0I A;  2EQS A;  2X6G A;  3TBI B;  3RR5 A;  2ASB A;  5LL6 X;  4DR4 L;  1K28 A;  3WOF A;  1GUO A;  2R6G A;  3BDL A;  3HOZ B;  4P75 A;  2WFW A;  2WIN B;  3GTG B;  2JA7 B;  1BVS A;  5KNC A;  5AFW A;  3CME A;  3CPW A;  1X32 A;  5KNB A;  3AQQ A;  4DV5 L;  4Z9C B;  2NVY H;  3A5Z B;  1L0X B;  4IN3 A;  3U9O A;  5IYD H;  2FMC A;  1A6X A;  1KL9 A;  1L1O A;  1N8R C;  2ZTD A;  4A3B H;  1EY7 A;  2EXD A;  1TS2 A;  4WJW A;  3F2C A;  1F2M A;  1S40 A;  4O0A A;  2BA0 A;  3G71 A;  4GN5 A;  4KI0 A;  1IBL Q;  1JQY D;  4QF4 A;  3I56 A;  3MXN A;  4X64 Q;  4DV1 L;  3T16 A;  1KC8 C;  4A3L H;  1CKN B;  1LTI D;  5FO9 B;  2ZJR A;  2QGQ A;  4GN3 B;  3G48 A;  1PZJ D;  1PFN A;  1SR3 A;  1EZ6 A;  1PYS B;  4BY7 G;  3I90 A;  1A8V A;  4LF5 L;  3MZ5 A;  2JEB I;  3B6Y A;  3H0G B;  1PH4 A;  3L3O C;  2R7Z H;  4DUZ Q;  1YZ6 A;  4ILW A;  2FMM A;  5C3X A;  3BYY B;  3EBE A;  2QEX A;  3WOE A;  1VQ4 A;  1D5X C;  4YHH Q;  5T1I A;  3MAQ A;  4UDU C;  1PTO F;  4RGN A;  1C9O A;  3UDG A;  3CAM A;  4KK7 A;  1Y69 U;  4FVM A;  4F8M A;  2ENB A;  2AWN A;  2YYZ A;  2VL6 A;  3CU7 A;  5C44 G;  3OW2 A;  1A2T A;  3P75 A;  1ET6 A;  3D4R A;  4DR2 L;  3GTG H;  2JA7 H;  2IT1 A;  1SEB D;  2SNS A;  1SND A;  4LK1 C;  4OGQ C;  1EOT A;  1QCB D;  1QWY A;  3K5L A;  2QDB A;  1VQD A;  2F3V A;  1K8O A;  1D7Q A;  3S24 A;  2E5L Q;  4B3R Q;  3EIV A;  4WOR A;  1N36 Q;  2K50 A;  4FF4 A;  3NE5 B;  1CUK A;  2VUM G;  1N9W A;  2EZV A;  2D5D A;  3GTP B;  4JVZ A;  5IP9 H;  1O78 A;  4DXF A;  2C35 B;  3EFX D;  1EY5 A;  2G9D A;  2JA6 B;  3HOU G;  3OIP A;  2Z6K A;  1YNN D;  3J80 E;  3LGJ A;  3E0E A;  1HZ9 A;  2M9V A;  2KHI A;  4O1N A;  5ELF A;  4L6T B;  1V9P A;  4CJ0 B;  1GHJ A;  5IGD A;  4HCE A;  1CA5 A;  4TQU S;  1SJE D;  1KDC A;  4Y7N H;  1CQF A;  1STH A;  5CV6 A;  3J80 L;  4EQN A;  3NTK A;  1LTG D;  1IBM Q;  3CCQ A;  5IP7 H;  2BDN A;  1BF4 A;  3DWP A;  1RL2 A;  4GOP B;  1ET9 A;  3D8G A;  3OWF A;  2K5Q A;  4GLX A;  1PTO B;  1B2T A;  2NZ1 D;  3VR4 A;  4KV6 A;  3JAM i;  4FF1 A;  4JBW A;  2RDF A;  4KN7 C;  4KHP Q;  1D8L A;  1MIU A;  4HED A;  3W1G A;  3A8J E;  5EQ0 A;  4YY3 L;  4JYA L;  2CW0 D;  4R1J A;  2Y0S B;  1J9O A;  2VS1 A;  2M2L A;  3J81 j;  1EWC A;  1VQI A;  4UY8 C;  3MC0 B;  3STB C;  4Q0F A;  3GTK B;  2HT1 A;  4DV3 Q;  4L5T A;  4MZ9 A;  1I4R A;  3E9H A;  1WOC A;  1H9S A;  1X9N A;  1EWH A;  5D14 A;  3OSO A;  2B2T C;  1IKL A;  1IYJ B;  4IUQ A;  2JA6 H;  4AYB E;  1AP0 A;  4NXN L;  3TZD A;  2O5I C;  1CK1 A;  4K5V A;  2QEJ C;  4B3M L;  4KY6 A;  3SVM A;  3K0Y A;  3M4O B;  3I4O A;  3CCS A;  5CR3 A;  1GUS A;  4C3J H;  4DV6 L;  3DM1 A;  4IQZ A;  4POF A;  1TWC B;  5C0X H;  4R9W A;  2KCC A;  4KJO A;  2ZTE A;  1E3P A;  3BVG A;  3S17 B;  1WCM B;  1JWS D;  1CT1 D;  3W3A A;  3PIP 3;  3PUV A;  1RTN A;  4LF4 Q;  1CQV A;  1ILP A;  4DR1 L;  3FHW A;  3DM3 A;  1Y1W B;  4P2C B;  1LTR D;  3BJU A;  4XT3 B;  1AFP A;  3SDZ A;  4AYB G;  2OTL A;  2DY7 A;  1PH1 A;  4JI8 L;  5GAE C;  2Z8L A;  2JEA I;  2WB1 E;  1JOO A;  4DV5 Q;  4NW2 A;  2EYP A;  4HTH A;  1DON A;  4LW1 A;  2JA8 B;  3NWS A;  4MTK A;  5DM7 3;  4BXX H;  4EVO A;  4KKS A;  4L5S A;  1TR5 A;  4A3E B;  2E2D C;  3PO3 B;  1SLJ A;  3GTK H;  5GQO A;  4DAY B;  2L1B A;  2F3W A;  1FR3 A;  4HSP A;  3EJI A;  4DV1 Q;  1DZ1 A;  3ND9 A;  4KLK A;  4XQN A;  2IPK D;  2PPB C;  5JJL A;  1AZP A;  4BY1 B;  3BZC A;  1KDB A;  3SR1 A;  4XTC S;  5I2Y A;  1BXT A;  3BVM A;  2XSC A;  4DR3 L;  1XNQ Q;  2IHF A;  1X56 A;  1VCI A;  1MHW C;  5LL6 S;  1QUQ B;  4FO2 A;  2UUC Q;  3M4O H;  4LF5 Q;  2KEN A;  1I6V C;  1Q1B A;  2H4O A;  1PYB A;  5FLM G;  3NUC A;  1X3G A;  2HCC A;  3D6W A;  4YCV A;  3NP8 A;  4XXE A;  2WB1 G;  4J1M A;  1TWC H;  2AHO B;  1T5X D;  4A3M B;  1HR0 W;  1B53 A;  2WV6 D;  4DK0 A;  5E1F A;  4FDB A;  5JPN C;  3S17 H;  1WCM H;  2B3G A;  2J0T D;  3A74 A;  3F8T A;  4R8I A;  4DUY Q;  2F0F A;  2I07 B;  1FVI A;  4P73 A;  1WTW A;  1SE2 A;  3AMU A;  2K75 A;  3MXG A;  3J81 E;  1L1O C;  1B44 D;  1S5B D;  2A68 D;  4NDX A;  2UUB L;  5FLX c;  2A6H D;  4QIW E;  1Y1W H;  5M3F B;  3T13 A;  3E0J A;  1PRT B;  2A1A A;  2ID0 A;  1N32 Q;  3C1E A;  3UI2 A;  2F0O A;  4DR2 Q;  3VDY A;  2MFI A;  2Z6B A;  1AE3 A;  4IAL A;  3J81 L;  3HS0 C;  2NN6 G;  4RGM A;  1EY4 A;  2JA8 H;  3BYT B;  3NEL A;  2F0V A;  1H9K A;  1BBX C;  1SNC A;  3EN2 A;  2AWO A;  3OOC A;  3UE0 A;  1IBK Q;  4ZYS A;  4V19 0;  3QB3 A;  3PO3 H;  1O80 A;  1BUV T;  3GTL B;  2JA9 A;  4ZRZ A;  2EYF A;  1JWU D;  1KIX A;  4C1N K;  1W6K A;  1E1T A;  1Y8O B;  2L0C A;  1LTS D;  1ILQ A;  4A3D B;  3MTS A;  4A4I A;  1XMQ L;  2IX3 A;  2ZM6 L;  4HMI A;  2JQO A;  1VQL A;  1DYQ A;  4BY1 H;  1X3F A;  5C3W A;  2JA5 B;  4X65 Q;  1M8A A;  3G4S A;  1HTL D;  4KHZ A;  2DJG C;  3I4M G;  1Q3L A;  2L55 A;  2L9H A;  3KYH C;  4F7X A;  5CBA E;  3Q24 A;  1Q86 C;  2XRQ D;  4J6H A;  1M90 C;  3W2D A;  3MXP A;  1EIF A;  3NXW A;  3HOV G;  3N52 A;  1JIC A;  4LJZ C;  3VR2 A;  1PLF A;  1A15 A;  1VQA A;  3NEN A;  4A3M H;  5G3L F;  2YTV A;  2DNE A;  3L7Z C;  1HFG A;  3R3O A;  5C5M A;  4RCN A;  1SMX A;  4RA8 A;  2F0M A;  4DR5 L;  2Z0S A;  3TN2 A;  1S5C D;  1GUT A;  2GVB A;  4DU9 A;  4B08 A;  3PUX A;  2JJQ A;  2X6L A;  4PZ8 A;  3OHX C;  4JC0 A;  1I4G A;  1BNZ A;  1OTC A;  1YJW A;  4A3C G;  1FNW A;  4TSS A;  3PIO 3;  2NBF A;  3CCU A;  3ITP A;  4JBM A;  1B9M A;  5M3F H;  2RF4 A;  2ZXR A;  1NNX A;  4QUF A;  2KA7 A;  1EU4 A;  2B63 H;  1CZG A;  2BOS A;  4OON A;  1G2T A;  2UU9 L;  3JAM c;  1VQG A;  5EKK A;  5LMU Q;  1B4O A;  3I2Z A;  2BE5 D;  3HOX B;  1YEZ A;  4B3T Q;  3FPP A;  3K81 C;  3HOY G;  3GTL H;  5DAU A;  2A6E D;  5IGE A;  1YNN C;  3CMA A;  3S9W A;  4JYA Q;  2Z6K C;  3RLO A;  1SE3 A;  4HJ7 A;  4A3D H;  3NBH B;  4XT1 B;  2K1B A;  4KD4 A;  2EYO A;  1TS5 A;  2IWH A;  4R8N A;  5C3E H;  2JA5 H;  5M3M G;  1F2Y A;  2FFK B;  5H1S E;  3DHQ A;  1HJP A;  3OTO Q;  2IL8 A;  3NQT A;  2V4D A;  3TME A;  2ICE C;  1Q1E A;  1WTH A;  4LMQ D;  3RLN A;  1EWI A;  1DXM A;  1HZB A;  2NTS A;  2OWO A;  3CPF A;  4N8F A;  3QIA A;  1YBY A;  2OQK A;  1SAP A;  4B3M Q;  3K8A A;  2EXZ A;  4OL7 A;  3HOZ G;  4QY7 A;  5J3B A;  3LWE A;  3L2P A;  2AKW B;  1K8G A;  5ELN A;  1GXD C;  1V8Q A;  4DV6 Q;  2YU9 B;  2C5C A;  2CVR A;  2CH4 W;  1ICF B;  2F0G A;  4A76 A;  2XNA C;  1YIJ A;  4OWX B;  2NB0 A;  3PO2 B;  3BVZ A;  3H09 A;  1ICW A;  1K83 B;  2YTX A;  3GO5 A;  4RFB A;  4CDE C;  4X62 L;  4X66 Q;  2CW0 C;  1ENF A;  2CH4 A;  2RBM A;  1IW7 D;  1B3Q A;  1KXL A;  3GTM B;  2JK8 A;  1SYF A;  5CV8 A;  1CHP D;  4LF9 L;  3L0O A;  2EE1 A;  4HJA A;  4DF7 A;  4DAP A;  1QVF A;  2KUM A;  3C1F A;  1EY9 A;  4C3H G;  4JI8 Q;  1IYV A;  1K0S A;  4H02 A;  1SRO A;  1BCP C;  4LUO A;  4QJF A;  2BH2 A;  1D2B A;  4BBR B;  3G6E A;  5LMN Q;  1TII D;  4B3S L;  1HA5 A;  1MJE A;  4XQQ A;  1KLG D;  2XGT A;  2NVY B;  1PTO D;  4RGO S;  1JJ2 A;  2TSS A;  1YNX A;  2DN8 A;  1Q8K A;  1I94 Q;  4A3B B;  3VYR A;  4A93 G;  3C3L A;  2F52 A;  2N78 A;  3K58 A;  3CF5 A;  5C4X G;  4YCU A;  1S72 A;  4DR3 Q;  1PH8 A;  4JI1 L;  4A3I G;  3J7A 5;  4LAA A;  1M4V A;  3H3V C;  1Y8P B;  3CCM A;  3AYH B;  2VNU D;  5C0X I;  1B3A A;  4CBV A;  1LM0 A;  4C3I B;  5EBD A;  4JPB W;  2RCN A;  5E4W C;  2YU9 H;  1F2L A;  1PH2 A;  4A3F B;  4GNX A;  1DOL A;  1QNU A;  4WJ4 A;  1G91 A;  5ELO A;  4A3K H;  1K83 H;  4TKO B;  2N8N A;  2F0E A;  5C5L A;  2HD3 A;  3F2U A;  3Q23 A;  2RHS B;  4IPH A;  4ZCK A;  5CYU A;  4R4Q A;  3GTM H;  2OT2 A;  3G7L A;  3U4Z A;  2LKV A;  4GS3 A;  1NR4 A;  2UUB Q;  4K0K L;  1JE4 A;  4BA2 I;  4K6D A;  4L5R C;  2O4X A;  5FK9 C;  3PUW A;  2VQF L;  4HID A;  3NBI A;  1FNU A;  2D2C C;  4JI5 L;  5JEA G;  1X55 A;  4CJ2 C;  1YIT A;  3CC7 A;  4BBR H;  2ZJQ A;  2RDH A;  3I55 A;  3MVV A;  4E6I A;  1E22 A;  1I6H B;  4JV5 L;  3U4V A;  2KCT A;  1H9R A;  4IUU A;  2JSO A;  3DWQ A;  1KLU D;  2EJG C;  3IKJ A;  1VQB A;  2QIL A;  2RKS A;  4X3S A;  1J5E L;  3S16 H;  2B39 A;  2BA1 A;  4R4I A;  3KOJ A;  3TP6 A;  1JWM D;  3MFG A;  4JCV E;  2RDG A;  1Q81 C;  3J7A F;  2NVX B;  2B2Y C;  4ODG A;  2A68 C;  1IXR A;  4CDF C;  2A6H C;  3FKI B;  4C3I H;  2MPM A;  1OXS C;  1IL8 A;  4A3C H;  3DMU A;  3KBG A;  4FNF A;  4A3F H;  2WAQ B;  3DEP A;  4QGU A;  1EFI D;  1NBW A;  4B9X A;  1CZW A;  3ERQ A;  1S4Z A;  3FDT A;  2PO4 A;  4ZAI A;  4AH6 A;  5BN4 A;  1SMY D;  2F4V Q;  2K52 A;  1LYL A;  4JI3 L;  1EL0 A;  2F3I A;  1MJC A;  3GTO B;  2UXC Q;  3HKZ E;  4CKC A;  2LS0 1;  4Y7N B;  1Z6H A;  4KY5 A;  2PQA B;  1H9M A;  2MHV A;  1RTO A;  3VR3 A;  2L5T A;  1VQE A;  4KD3 A;  5CGK A;  2RCF A;  2K5D A;  3SK4 A;  2HDM A;  1EY0 A;  5CV9 A;  4A75 A;  2C9O A;  3K6O A;  2F0D A;  1U4M A;  2AQ1 B;  2JYO A;  2PMZ E;  1S5E D;  5M3M H;  4RAU C;  1I6H H;  1ZXT A;  1IKM A;  3M7N A;  1RF2 D;  5M5W B;  1YNJ D;  2PI2 A;  3ULJ A;  3GV6 A;  3CCV A;  2K4K A;  4KTA A;  4NPS A;  3RMH A;  1DJR D;  1D1I A;  1E7Z A;  3T51 B;  4R4O A;  4H13 C;  5C4Z A;  1LAC A;  4JW0 A;  4OO1 H;  4LFA Q;  3HOW G;  2WKD A;  3H94 A;  2WP8 J;  2F0I A;  3TEH B;  4ZLT F;  4V0B A;  2PW7 A;  3HKZ G;  4JBJ A;  4MNO A;  2NVX H;  5TSS A;  2PZW A;  1HNX L;  3CRL C;  3NQI A;  3IRB A;  4IUP A;  5JVH 3;  1Y1V G;  4NXM Q;  3FKI H;  4POG A;  1K73 C;  3T1Y L;  2E2I B;  1P16 A;  5E4X A;  4FF2 A;  3T56 B;  1UE1 A;  1FYC A;  3PGZ A;  2JN4 A;  3I3C A;  5ELC A;  4YCW A;  2BE5 C;  1LTA D;  2LY7 A;  1WTX A;  5I9P A;  1Q82 C;  2GVA A;  4RKL A;  2O2L D;  2ZT9 C;  3PUZ A;  1WD1 A;  1II3 A;  4OIJ A;  3M4Q A;  3GTO H;  3NTI A;  4X62 Q;  4A3E G;  4A3G B;  1W3S A;  1SFO B;  1DOK A;  4IPD A;  4C3J B;  4LFB Q;  2NYZ D;  2SOB A;  4KKT A;  2J4X A;  4DV0 Q;  1K0R A;  4DV7 L;  2E2J B;  4EQP A;  3IAY A;  2PI2 E;  4OX9 Q;  5GAG C;  3KF8 A;  1Q8I A;  3A8I E;  2N55 A;  2NZO A;  1SXT A;  1TXY A;  2KHS A;  3RZD B;  2YTY A;  3T1H Q;  1OXU A;  5M5W H;  1KQS A;  1UAP A;  3RUZ A;  1BBW A;  4A93 H;  5IT9 c;  1AN8 A;  1Y8N B;  2Z4I A;  5M9O A;  4FXG C;  1J8I A;  1DD2 A;  2FIN B;  4O42 A;  1G2S A;  3LWU A;  2O5J C;  3SEB A;  3MA2 B;  4O2D A;  5CV5 A;  3KBX A;  2K32 A;  4IUV A;  3AFP A;  2Z9H A;  3M4Y A;  5IOD A;  2BH8 A;  3NTH A;  5A2Q E;  5KRU A;  2EDG A;  1VMP A;  4J15 A;  5EGT A;  2UUA L;  4IFD H;  1JJG A;  5CC4 A;  4BY7 B;  5GAH C;  3TQY A;  4KJN A;  4CKB A;  1GUW A;  5LMN W;  4HAE A;  3BG3 A;  1U5K A;  2E2I H;  3CCL A;  4DXG A;  3S1R H;  1LTL A;  5K36 G;  4JI1 Q;  2R93 G;  4MIU A;  5A2Q L;  4LF7 Q;  1DM0 B;  2Q2T A;  2R92 G;  2A74 C;  4LF8 L;  3K7A B;  2OEO A;  4X3K A;  2F0S A;  1BDO A;  2I5H A;  1XNR L;  4UP7 A;  5KEE A;  4ID6 A;  4A3G H;  1SFO H;  1AH9 A;  3KDF B;  2HDL A;  1LV9 A;  1PRT F;  4L8J A;  1U4P A;  4I7A A;  5C44 B;  2E2J H;  1QNK A;  2KED A;  1AE2 A;  1EIH A;  1MD2 D;  1PTO C;  2E2H H;  4CKE A;  2EYM A;  1AW7 A;  3Q8D A;  5IYC G;  2N88 A;  5HY6 A;  2M00 A;  1FL0 A;  1BR9 A;  3RZD H;  1RD9 D;  3FP9 A;  4JI5 Q;  2PYK A;  1CM9 A;  3TS0 A;  3DXJ C;  4K5W A;  3A8K E;  3HZX A;  4C1N I;  1VQ5 A;  2ICI A;  2UXD L;  4DR4 Q;  3DWA A;  1EUJ A;  2A5H A;  2G9H D;  3V05 A;  4IFD J;  2B2V C;  4MN3 A;  5ELE A;  1QZG A;  4FYD A;  3VA7 A;  4JV5 Q;  4DNT B;  4K14 A;  5NUC A;  5G3L D;  1O7Y A;  4LF6 L;  1B70 B;  1DGS A;  1MSH A;  1RCV D;  2PNH A;  2VUM B;  1HZC A;  5E7N A;  1U4L A;  5GRO A;  5GAD C;  5BR8 L;  2WAC A;  2CFM A;  3U58 A;  1XPO A;  2JE6 I;  4GNX C;  1J5E Q;  1EEF D;  1OXT A;  4GLA C;  5CV7 A;  3KF6 A;  4BY7 H;  3TRZ A;  1HUN A;  4PMW A;  5FO8 B;  3T53 B;  3HOU B;  3A55 A;  1JB7 A;  4FXD A;  1Z47 A;  5M5X B;  5J39 A;  4HJ9 A;  2KCN A;  5EKI A;  1L1O B;  2FHT A;  1D1K A;  3PCO B;  1W6J A;  3GDE A;  2IHE A;  4BWG B;  4DPG A;  1TS4 A;  1F77 A;  3K7A H;  5C0X J;  4NB3 A;  1X6O A;  3MXN B;  3K80 C;  2NN6 I;  3BDC A;  2BCO A;  4QUC A;  3D3R A;  1E1O A;  3K0X A;  3ONA B;  2F0J A;  3NK9 A;  4XYO A;  4H7B A;  4R4T A;  5C44 H;  5CBE E;  1IL2 A;  2MGS A;  2F4I A;  4XYQ A;  5DM6 3;  2MNA A;  4JI2 L;  1HNW L;  1V43 A;  3X3N A;  1N33 L;  3HP3 A;  3ERS X;  2VQE L;  2OF1 A;  1Z9F A;  2B2Y A;  3KUP A;  3ZJY C;  2F0L A;  4JI4 L;  2Q2I A;  2KHJ A;  1HQM C;  5HGQ A;  1LO5 D;  2QF7 A;  3K59 A;  3NHH A;  2Q8R E;  1ML0 D;  4DA2 A;  1HFN A;  3A5U A;  2Q8I B;  3TP7 A;  4Q5V A;  2B63 B;  1PH6 A;  3HFZ B;  2XN9 C;  4JI7 L;  1FJG L;  4C2M H;  3I4N G;  1WJJ A;  3A54 A;  2OQ0 A;  4OIK A;  1SYC A;  5CMD A;  2VUM H;  4FP5 D;  3URY A;  1KAA A;  3J80 c;  2XIW A;  1K9M C;  3ERO A;  2JXM B;  1VQM A;  2D0O A;  1SMY C;  3TDQ A;  3PO2 G;  1F9Q A;  1JJC B;  3HOU H;  5M5Y B;  1JE5 A;  1I50 B;  5M5X H;  4BBS G;  4IOC A;  1C48 A;  1BCP F;  5I6W A;  2AQ3 B;  5L37 A;  5C3E B;  4UP8 A;  4XDX A;  3KLW A;  3TP5 A;  4DK1 A;  3T1Y Q;  1TWA B;  2IW3 A;  4KN4 C;  3Q6S A;  2AMC B;  5IYB G;  2Q2U A;  2EY2 A;  1ASY A;  2K5N A;  5FJ8 G;  5D3I B;  3HG9 A;  1CKN A;  3PF5 A;  2H5X A;  2EYH A;  4G7O C;  3IL8 A;  2CQA A;  1XPR A;  1ENA A;  1YNJ C;  1QG7 A;  3F2D A;  1U0L A;  4M8A A;  1IBL L;  4X64 L;  1F9R A;  4I7Z C;  4DV7 Q;  1K3R A;  1G29 1;  3V2T A;  4DNR B;  5EPL A;  5IYD G;  1HXY D;  1HR0 L;  4AYB B;  2PNR C;  1QVC A;  3EVQ A;  2WII B;  4U67 3;  2HIX A;  3C2P A;  1AZQ A;  2QDL A;  1RDP D;  2V1C C;  3V96 A;  3S1N H;  4X6A H;  1KTK A;  4K2L A;  4A3L G;  1A3T A;  1B7Y B;  1KRT A;  4UP9 A;  5FOB B;  4A3J G;  4DUZ L;  1NAP A;  4OO1 I;  2LMC B;  4LUZ A;  1PMR A;  3NWT A;  4HN7 A;  1VQH A;  4YY3 Q;  3KJO A;  1YHQ A;  1HTP A;  5M5Y H;  1V1P A;  2R92 H;  3M7G A;  1I50 H;  4ZUI A;  3HEJ A;  2F03 A;  2R7Z G;  2F0K A;  2DGY A;  1SYB A;  1O7L A;  1LTT D;  1JR0 D;  1PFM A;  4PNY A;  2K05 A;  5ELB A;  3TSS A;  1UNS A;  1HRJ A;  1TWA H;  3DLL A;  3H15 A;  4QQB X;  2SDF A;  5IGG A;  4IZ8 A;  2WB1 B;  4QMG A;  3QG1 A;  2QCP X;  4OWT B;  4LF8 Q;  4MTN A;  2IX1 A;  4NXN Q;  2N3S A;  1H9S B;  1O7Z A;  4X3U A;  4AQY L;  2IY5 B;  1BCP B;  3UDF A;  2E5L L;  1N36 L;  4MHE A;  2JA7 G;  3SHL A;  2EOT A;  5CV4 A;  3CRK C;  3F2B A;  3SE0 A;  1PYW D;  4A3K B;  1XTC D;  1YI2 A;  1YJ9 A;  1SRU A;  3RN5 A;  1SDF A;  2LXJ A;  2AUK A;  2GN5 A;  4JK1 C;  2PQE A;  4ZUJ A;  3TRE A;  1JB3 A;  2UXB L;  2RA4 A;  1IZ6 A;  4LWC A;  1Q90 A;  1CSP A;  2EY6 A;  5DEH A;  3MXU A;  1A63 A;  1ESR A;  1VQF A;  2EY5 A;  4DR1 Q;  2DUD A;  1K8M A;  2UXD Q;  2Q2H A;  2K33 A;  3OYY A;  3J7A V;  2B2W C;  1C8C A;  3S15 B;  1BO0 A;  3CCR A;  2HQL A;  3AB9 A;  4IFD I;  3S14 H;  3E6Z X;  2TMP A;  4GOP A;  1XYI A;  2OTJ A;  3D0F A;  3H0G G;  1IBM L;  2K01 A;  1GOZ A;  3PSI A;  5BR8 Q;  1HH2 P;  2NTT A;  5JJI A;  1TU2 B;  5AJ3 L;  3I4M B;  4BS9 A;  3VR6 A;  4DFA A;  3A0J A;  5FKA C;  1K3B C;  3W5O A;  3QR8 A;  4QIW B;  3MWY W;  3HOV B;  1PDQ A;  3S2H H;  5FLM H;  3IFD A;  2F0N A;  4DR6 L;  3S16 B;  4JG2 A;  1IHZ A;  1TWF B;  1NR2 A;  1V1O A;  1STA A;  2CHB D;  5IP7 G;  2B2V A;  3J81 c;  4DK6 C;  1HZA A;  4KHP L;  5DLQ E;  4DK3 C;  3E9I A;  2JP1 A;  1CA6 A;  3F1Z A;  3K57 A;  1V1Q A;  1EQV A;  1MKH A;  3OWE B;  4JI0 L;  1PH3 A;  2Z1C A;  1LUZ A;  3CC4 A;  4L5Q A;  1U9R A;  2K5H A;  1GUG A;  4TRD A;  2DJF C;  2E74 C;  2B2U C;  1E2V A;  3MEF A;  2IJ0 A;  1N33 Q;  2PZU A;  3VR5 A;  3Q22 A;  4ME5 A;  2NN6 H;  2D0P A;  4FF3 A;  3GD7 A;  3PIO A;  2E75 C;  2DNC A;  2L15 A;  3GP7 A;  2ZXP A;  3K5O A;  5T1G A;  4DAV A;  4JI4 Q;  1E24 A;  1BOS A;  1VQO A;  3HOY B;  2E76 C;  5IWA L;  1PA6 A;  1UWV A;  2B8G A;  3S15 H;  3H3V H;  1G6Z A;  2L12 A;  2PW5 A;  4ULL A;  2VB3 X;  1GVP A;  1FJG Q;  2MQH A;  4GKJ L;  1JOR A;  1EY6 A;  1QJO A;  4G4K A;  3K5N A;  1OXX K;  2Q8T A;  3S2D H;  1I5F A;  4IOA A;  5D65 A;  4GKK L;  3DUZ A;  2JA6 G;  2F1M A;  4IJL A;  1EZ8 A;  5I4D A;  1Q46 A;  3MHB A;  5M3M B;  3PMF A;  1EQQ A;  1ONL A;  3I4M H;  1GJX A;  1P8L A;  4XIG S;  2WKC A;  2MUY A;  1TWG B;  1SE4 A;  3Q0A A;  1PFS A;  3HOV H;  4RGT A;  1ENC A;  3SK8 A;  1N34 L;  1XMQ Q;  1WI5 A;  3P7J A;  2R3Z A;  1L0Y B;  4UAI A;  4C3J G;  2ZM6 Q;  1UEA B;  4S3S A;  3A7A B;  3I4L A;  3BDO A;  4TVA B;  1HPC A;  4PQX A;  1TWF H;  4HJ8 A;  1NY4 A;  5C0X G; 
#chains in the Genus database with same CATH homology
 4M1U B;  4KKU A;  3VYS A;  1I4Q A;  5KIX A;  4RCO A;  3OW7 A;  4DAY A;  1E0B A;  2F0Q A;  4HSV A;  1KNA A;  4GZY C;  4XQJ A;  2KQ3 A;  4OHJ A;  4KMU C;  3GTQ B;  3VYU A;  1KAB A;  1TVX A;  1UUP A;  3QOL A;  4HR7 B;  2Z4H A;  3L9A X;  3QWN A;  2J7Z A;  2L11 A;  1OO9 B;  5IGC A;  4RH6 A;  5EBC A;  1LT3 D;  2NVT B;  2KJX A;  4C3H B;  1SNM A;  4ZKB B;  1I3Q B;  5EKL A;  2X69 A;  4N9T A;  3KLS A;  2K28 A;  4L63 B;  1TKW B;  1I4P A;  1HHV A;  1PXU A;  4HMJ A;  1STN A;  3H6M A;  3ND8 A;  3I72 A;  2KEC A;  3VA5 A;  4A93 B;  3TP8 A;  1PRT D;  1XXG A;  5C4X B;  2K7V A;  4A3I B;  2KVM A;  4X3T A;  2D9U A;  5A35 A;  5KYL A;  4PV1 C;  1V1P B;  2A69 D;  4ZQ3 A;  3EQL C;  1STG A;  3I70 A;  1B1Z A;  1NSN S;  3FPU B;  2VB2 X;  5KYI A;  4WFN 3;  4NP5 A;  2A73 B;  2NWG A;  3D4D A;  5KGU A;  3S1R B;  1WVL A;  4ZKC B;  4HCS A;  4IUR A;  3M3Y B;  1I4X A;  5FLX E;  4RWS C;  4PMB A;  3H91 A;  3X3M A;  2MP1 A;  5K5P A;  2A6E C;  3GQB A;  3KK7 A;  1EU3 A;  1MGS A;  1RKN A;  2H1E A;  1FNV A;  1GUN A;  5JOB A;  1SYG A;  3O13 A;  2HCI A;  5FLX L;  1MSG A;  3MFY A;  3HGB A;  3R93 A;  2E2H B;  1XX8 A;  3OMG A;  1IYU A;  1OXV A;  1EEI D;  1ZEQ X;  4F87 A;  2EJM A;  4G7H C;  1H9J A;  2F0H A;  1WTR A;  1EYA A;  1VMC A;  4KHV A;  3WDN A;  4K8I A;  3RLF A;  5JPM C;  1X3P A;  1DOM A;  1HQR D;  1SJH D;  4EQO A;  3AU7 A;  1LLR D;  1EYC A;  3NPP A;  1Q12 A;  5E3F A;  1JC7 A;  2B2W A;  1TWH B;  4F88 A;  2EJF C;  3NBH A;  4K2K A;  1IW7 C;  3PV0 A;  1STE A;  5EPK A;  3E5S A;  2ZXO A;  1D5M C;  1SYD A;  1S5F D;  1A3V A;  4IUT A;  4K6L A;  3RD4 A;  1TQO A;  5JEA H;  1XWE A;  3R2I A;  4H0L C;  1A3U A;  3JAM E;  1NUC A;  1BCP D;  3P1H A;  3I8Z A;  3QJY A;  3JAM L;  5C4H A;  1JOK A;  2F0W A;  1FD7 D;  1TY0 A;  5JAV A;  2RQX A;  1F9P A;  1AEX A;  3BZD B;  4U68 A;  3HOW B;  2B2U A;  4J8Q A;  1ZYR D;  2XRS D;  4C2M B;  4IUN A;  3HKZ B;  3S1M B;  1EQT A;  3SXH A;  3S1Q B;  3FVQ A;  1ZKO A;  1Y1V B;  1VDZ A;  1ROD A;  1SNQ A;  5LHY 1;  3U9S A;  1PTO H;  3K5M A;  1HCZ A;  3OMC A;  5IIF A;  4CGY B;  2K03 A;  2PMZ B;  1R4Q B;  5JEA J;  3R2T A;  5F2D A;  1D5Z C;  3KLR A;  5J1Z A;  3I73 A;  1QOH A;  1CI3 M;  1CTM A;  4DN4 M;  3BS1 A;  4CHT B;  1X3Q A;  1E2Z A;  1STB A;  1PFB A;  2VXW A;  3CQZ B;  5KND A;  4K8J A;  1R4P B;  1PZI D;  3GV3 A;  5I2X A;  5IOC A;  1EY8 A;  4NKL A;  1Z7T A;  4CJ1 B;  2AQ2 B;  3T4A C;  1TS3 A;  2EYJ A;  2RSO A;  4NMZ A;  1NCV A;  1SBB B;  2RSN A;  3SK6 A;  2DY8 A;  5IGB A;  3GTJ B;  2SNM A;  4QCL A;  2EYL A;  3N6R A;  2EVB A;  1QIL A;  5FO7 B;  3S1N B;  1LT4 D;  3R8B A;  4BA1 I;  1R9T B;  4RKB A;  3D4W A;  1WTV A;  2R93 B;  3I91 A;  5EJW A;  2EY1 A;  1JCK B;  2SEB D;  1A2U A;  2R92 B;  3VYT A;  1F2Z A;  4ZK9 B;  2NVQ B;  5D3D A;  2F0T A;  2PZT A;  1SYE A;  3CHB D;  3MEH A;  1SNO A;  3A56 A;  2D62 A;  1E2W A;  3LNN A;  5BN5 A;  2K6A A;  4RHS A;  1BQQ T;  3ZYY X;  1WD0 A;  3A7L A;  1PRT C;  5C4J B;  3FRP B;  5J22 A;  5IGF A;  2EPB A;  5ELD A;  4H44 C;  1KDA A;  2A69 C;  4RHR A;  2KOL A;  1HA6 A;  1U4R A;  2R61 A;  1G8Z D;  3QO2 A;  3FEW X;  1EYD A;  2NUC A;  4C3I G;  5K36 H;  3S14 B;  2HQE A;  2L4N A;  3KLS X;  5JJZ A;  1ESF A;  1F9S A;  3RZO B;  1HUM A;  1MI2 A;  4B9W A;  3J7Y W;  2AUJ D;  3S2H B;  1CFM A;  2GA4 B;  1JOQ A;  4QB4 A;  5ISR A;  4EGV A;  1DCZ A;  3DEO A;  1TT2 A;  3IFT A;  3D6C A;  1RJT A;  2K04 A;  4YIJ A;  3OIQ A;  3HRZ C;  3PUY A;  1MBY A;  1TY2 A;  3I4N B;  4N9P A;  1C4Q A;  1VF7 A;  2XVS A;  4K5X A;  2KEE A;  4PMC A;  4OO1 G;  1STY A;  2K5W A;  1CHQ D;  1SNP A;  1LAB A;  3D31 A;  1I4H A;  4FXK C;  4BBS B;  2HUG A;  1SSO A;  1D6E C;  4G57 A;  3S2D B;  1LTB D;  1EIG A;  2B2T A;  2PCF B;  3G6J B;  3P20 A;  1GHK A;  5HUR A;  5I6Y A;  2BDO A;  2QKI C;  1QB5 D;  4KY7 A;  2MJ8 A;  4DGZ A;  3QOJ A;  1B50 A;  1RHP A;  2RVL A;  3CKI B;  5I9O A;  3EA6 A;  1LT5 D;  2IX0 A;  1WTP A;  2LFN A;  2F0P A;  2XWB B;  5C6A A;  3C46 A;  1ZYR C;  1WTO A;  1QE6 A;  5JVG 3;  2B8F A;  4I65 A;  3LX0 A;  1T5E A;  3FMC A;  3TZU A;  4G7Z C;  1B9N A;  4A3J B;  5IT9 E;  4ABN A;  1KNE A;  1FGB D;  2I46 A;  5EPJ A;  4IFD G;  2XWJ B;  3OPO A;  4C56 C;  3M85 A;  5IT9 L;  1VF5 C;  4WRD A;  1WTQ A;  5DNF A;  2R7Z B;  2FJ2 A;  1LT6 D;  5COY A;  5BN3 A;  3NSW A;  1S5D D;  2F0U A;  1PZK D;  3SK5 A;  5HGT A;  2OXP A;  5COR A;  2X6G A;  3TBI B;  5LL6 X;  3WOF A;  1GUO A;  2R6G A;  3BDL A;  3HOZ B;  2WIN B;  3GTG B;  2JA7 B;  5KNC A;  5AFW A;  1X32 A;  5KNB A;  4Z9C B;  4IN3 A;  1L0X B;  3U9O A;  2FMC A;  1A6X A;  1EY7 A;  1TS2 A;  4WJW A;  1F2M A;  2BA0 A;  4KI0 A;  1JQY D;  4QF4 A;  3MXN A;  3T16 A;  1LTI D;  5FO9 B;  1PZJ D;  1PFN A;  1EZ6 A;  3I90 A;  3MZ5 A;  2JEB I;  3H0G B;  3L3O C;  4ILW A;  2FMM A;  5C3X A;  3BYY B;  3WOE A;  1D5X C;  5T1I A;  3MAQ A;  4UDU C;  1PTO F;  4RGN A;  4KK7 A;  1Y69 U;  4FVM A;  4F8M A;  2ENB A;  2AWN A;  2YYZ A;  3CU7 A;  1A2T A;  3P75 A;  1ET6 A;  3D4R A;  2IT1 A;  1SEB D;  2SNS A;  1SND A;  4LK1 C;  4OGQ C;  1EOT A;  1QCB D;  1QWY A;  3K5L A;  2QDB A;  2F3V A;  1K8O A;  4WOR A;  4FF4 A;  3NE5 B;  2EZV A;  2D5D A;  3GTP B;  1O78 A;  4DXF A;  3EFX D;  1EY5 A;  2G9D A;  2JA6 B;  3OIP A;  1YNN D;  3J80 E;  2M9V A;  4O1N A;  5ELF A;  4L6T B;  4CJ0 B;  1GHJ A;  5IGD A;  4HCE A;  1CA5 A;  4TQU S;  1SJE D;  1KDC A;  1CQF A;  1STH A;  5CV6 A;  3J80 L;  4EQN A;  3NTK A;  1LTG D;  2BDN A;  1BF4 A;  3DWP A;  1ET9 A;  3D8G A;  3OWF A;  2K5Q A;  1PTO B;  1B2T A;  2NZ1 D;  3VR4 A;  4KV6 A;  4FF1 A;  4JBW A;  2RDF A;  4KN7 C;  4HED A;  3A8J E;  5EQ0 A;  2CW0 D;  2Y0S B;  1J9O A;  2M2L A;  1EWC A;  3MC0 B;  4Q0F A;  3GTK B;  1I4R A;  1H9S A;  1EWH A;  5D14 A;  3OSO A;  2B2T C;  1IKL A;  4IUQ A;  1AP0 A;  3TZD A;  2O5I C;  1CK1 A;  4K5V A;  2QEJ C;  4KY6 A;  3SVM A;  3K0Y A;  3M4O B;  5CR3 A;  1GUS A;  3DM1 A;  4IQZ A;  1TWC B;  5C0X H;  4R9W A;  2KCC A;  4KJO A;  3BVG A;  3S17 B;  1WCM B;  1JWS D;  1CT1 D;  3W3A A;  3PIP 3;  3PUV A;  1RTN A;  1CQV A;  1ILP A;  1Y1W B;  4P2C B;  1LTR D;  4XT3 B;  1AFP A;  3SDZ A;  2DY7 A;  2Z8L A;  2JEA I;  1JOO A;  4NW2 A;  2EYP A;  4HTH A;  1DON A;  2JA8 B;  3NWS A;  5DM7 3;  4EVO A;  4KKS A;  1TR5 A;  4A3E B;  2E2D C;  3PO3 B;  2L1B A;  2F3W A;  1FR3 A;  4HSP A;  3EJI A;  1DZ1 A;  3ND9 A;  4XQN A;  2IPK D;  2PPB C;  1AZP A;  4BY1 B;  1KDB A;  3SR1 A;  4XTC S;  5I2Y A;  1BXT A;  3BVM A;  2XSC A;  1VCI A;  5LL6 S;  4FO2 A;  1I6V C;  1Q1B A;  2H4O A;  3NUC A;  2HCC A;  3D6W A;  4XXE A;  3NP8 A;  4J1M A;  1T5X D;  4A3M B;  1B53 A;  2WV6 D;  4DK0 A;  5E1F A;  5JPN C;  2J0T D;  4R8I A;  2F0F A;  2I07 B;  1WTW A;  3AMU A;  1SE2 A;  3MXG A;  3J81 E;  1B44 D;  1S5B D;  2A68 D;  4NDX A;  2A6H D;  5M3F B;  3T13 A;  3E0J A;  1PRT B;  2ID0 A;  3C1E A;  3UI2 A;  2F0O A;  4IAL A;  3J81 L;  3HS0 C;  2NN6 G;  4RGM A;  1EY4 A;  3BYT B;  2F0V A;  1H9K A;  1BBX C;  1SNC A;  2AWO A;  3OOC A;  4ZYS A;  4V19 0;  3QB3 A;  1O80 A;  1BUV T;  3GTL B;  4ZRZ A;  2EYF A;  1JWU D;  4C1N K;  1W6K A;  1Y8O B;  2L0C A;  1LTS D;  1ILQ A;  4A3D B;  3MTS A;  2IX3 A;  4HMI A;  1DYQ A;  5C3W A;  2JA5 B;  1M8A A;  1HTL D;  4KHZ A;  1Q3L A;  2L55 A;  2L9H A;  4F7X A;  5CBA E;  3Q24 A;  2XRQ D;  4J6H A;  3W2D A;  3MXP A;  3NXW A;  3N52 A;  1JIC A;  4LJZ C;  3VR2 A;  1PLF A;  1A15 A;  5G3L F;  2DNE A;  3L7Z C;  1HFG A;  3R3O A;  5C5M A;  4RCN A;  4RA8 A;  2F0M A;  3TN2 A;  1S5C D;  1GUT A;  4DU9 A;  4B08 A;  3PUX A;  2X6L A;  1BNZ A;  3OHX C;  1I4G A;  1FNW A;  4TSS A;  3PIO 3;  2NBF A;  3ITP A;  1B9M A;  2ZXR A;  4QUF A;  2KA7 A;  1EU4 A;  1CZG A;  2BOS A;  1G2T A;  5EKK A;  1B4O A;  2BE5 D;  3HOX B;  3FPP A;  5DAU A;  2A6E D;  5IGE A;  1YNN C;  3S9W A;  1SE3 A;  4XT1 B;  2K1B A;  4KD4 A;  2EYO A;  1TS5 A;  2IWH A;  4R8N A;  1F2Y A;  2FFK B;  3DHQ A;  2IL8 A;  3NQT A;  2V4D A;  3TME A;  2ICE C;  1Q1E A;  4LMQ D;  1DXM A;  2NTS A;  3QIA A;  1SAP A;  2EXZ A;  4OL7 A;  3LWE A;  1GXD C;  1V8Q A;  2YU9 B;  2C5C A;  2CVR A;  2F0G A;  2XNA C;  2NB0 A;  3PO2 B;  3BVZ A;  3H09 A;  1ICW A;  1K83 B;  3GO5 A;  4RFB A;  2CW0 C;  1ENF A;  2RBM A;  1IW7 D;  3GTM B;  1SYF A;  5CV8 A;  1CHP D;  2EE1 A;  4DF7 A;  4DAP A;  2KUM A;  3C1F A;  1EY9 A;  4C3H G;  1IYV A;  1BCP C;  1D2B A;  4BBR B;  1TII D;  1HA5 A;  4XQQ A;  1KLG D;  2NVY B;  1PTO D;  4RGO S;  2TSS A;  2DN8 A;  4A3B B;  3VYR A;  3C3L A;  3K58 A;  4LAA A;  1M4V A;  3H3V C;  1Y8P B;  2VNU D;  5C0X I;  1B3A A;  4CBV A;  4C3I B;  5EBD A;  5E4W C;  1F2L A;  4A3F B;  1DOL A;  1QNU A;  1G91 A;  4TKO B;  2F0E A;  5C5L A;  3F2U A;  3Q23 A;  5CYU A;  2OT2 A;  3G7L A;  2LKV A;  1NR4 A;  1JE4 A;  4BA2 I;  4K6D A;  2O4X A;  5FK9 C;  3PUW A;  3NBI A;  1FNU A;  2D2C C;  5JEA G;  4CJ2 C;  2RDH A;  3MVV A;  4E6I A;  1I6H B;  1H9R A;  4IUU A;  2JSO A;  3DWQ A;  1KLU D;  2EJG C;  3IKJ A;  2QIL A;  2RKS A;  4X3S A;  2B39 A;  2BA1 A;  3TP6 A;  1JWM D;  3MFG A;  2RDG A;  3J7A F;  2NVX B;  2B2Y C;  4ODG A;  2A68 C;  2A6H C;  3FKI B;  2MPM A;  1OXS C;  1IL8 A;  3DMU A;  3KBG A;  4FNF A;  2WAQ B;  3DEP A;  1EFI D;  4B9X A;  1CZW A;  3ERQ A;  1S4Z A;  3FDT A;  2PO4 A;  4ZAI A;  5BN4 A;  1SMY D;  1EL0 A;  3GTO B;  4CKC A;  2LS0 1;  4Y7N B;  1Z6H A;  4KY5 A;  1H9M A;  2MHV A;  1RTO A;  3VR3 A;  2L5T A;  4KD3 A;  5CGK A;  2K5D A;  3SK4 A;  2HDM A;  1EY0 A;  5CV9 A;  2C9O A;  3K6O A;  2F0D A;  1U4M A;  2AQ1 B;  2JYO A;  1S5E D;  4RAU C;  1ZXT A;  1IKM A;  3M7N A;  1RF2 D;  5M5W B;  1YNJ D;  3GV6 A;  4KTA A;  3RMH A;  1DJR D;  1D1I A;  3T51 B;  4H13 C;  5C4Z A;  1LAC A;  4OO1 H;  2WKD A;  3H94 A;  2WP8 J;  2F0I A;  4ZLT F;  4V0B A;  2PW7 A;  5TSS A;  2PZW A;  3CRL C;  3NQI A;  4IUP A;  5JVH 3;  2E2I B;  4FF2 A;  5E4X A;  3T56 B;  1FYC A;  3I3C A;  5ELC A;  2BE5 C;  1LTA D;  2LY7 A;  1WTX A;  5I9P A;  4RKL A;  2O2L D;  2ZT9 C;  3PUZ A;  1WD1 A;  1II3 A;  4OIJ A;  3NTI A;  4A3G B;  1SFO B;  1DOK A;  4C3J B;  2NYZ D;  2SOB A;  4KKT A;  2J4X A;  2E2J B;  4EQP A;  3IAY A;  3KF8 A;  1Q8I A;  3A8I E;  2N55 A;  1SXT A;  2KHS A;  3RZD B;  1OXU A;  1UAP A;  3RUZ A;  1AN8 A;  1Y8N B;  2Z4I A;  5M9O A;  4FXG C;  1J8I A;  1DD2 A;  2FIN B;  4O42 A;  1G2S A;  3LWU A;  2O5J C;  3SEB A;  3MA2 B;  5CV5 A;  3KBX A;  2K32 A;  4IUV A;  3M4Y A;  5IOD A;  3NTH A;  5A2Q E;  5KRU A;  2EDG A;  1VMP A;  4IFD H;  5EGT A;  5CC4 A;  4BY7 B;  4KJN A;  4CKB A;  1GUW A;  4HAE A;  3BG3 A;  4DXG A;  5K36 G;  4MIU A;  5A2Q L;  1DM0 B;  2A74 C;  3K7A B;  2OEO A;  4X3K A;  2F0S A;  1BDO A;  5KEE A;  4ID6 A;  2HDL A;  1LV9 A;  1PRT F;  4L8J A;  1U4P A;  5C44 B;  1QNK A;  2KED A;  1EIH A;  1MD2 D;  1PTO C;  4CKE A;  2EYM A;  1AW7 A;  2N88 A;  2M00 A;  1BR9 A;  1RD9 D;  2PYK A;  1CM9 A;  3DXJ C;  4K5W A;  3A8K E;  3HZX A;  4C1N I;  2ICI A;  3DWA A;  2A5H A;  2G9H D;  3V05 A;  4IFD J;  2B2V C;  4MN3 A;  5ELE A;  4FYD A;  3VA7 A;  4DNT B;  4K14 A;  5NUC A;  5G3L D;  1O7Y A;  1MSH A;  1RCV D;  2VUM B;  1U4L A;  2WAC A;  2JE6 I;  1EEF D;  1OXT A;  1HUN A;  4PMW A;  5FO8 B;  3T53 B;  3HOU B;  3A55 A;  4FXD A;  1Z47 A;  5M5X B;  5J39 A;  2KCN A;  5EKI A;  2FHT A;  1D1K A;  1W6J A;  4BWG B;  1TS4 A;  1F77 A;  5C0X J;  2NN6 I;  3BDC A;  2BCO A;  4QUC A;  3D3R A;  3ONA B;  2F0J A;  3NK9 A;  4XYO A;  4H7B A;  5CBE E;  2MGS A;  2F4I A;  4XYQ A;  5DM6 3;  1V43 A;  3X3N A;  3HP3 A;  2OF1 A;  2B2Y A;  3KUP A;  2F0L A;  1HQM C;  1LO5 D;  2QF7 A;  3K59 A;  3NHH A;  2Q8R E;  1ML0 D;  4DA2 A;  1HFN A;  2Q8I B;  3TP7 A;  4Q5V A;  2B63 B;  2XN9 C;  3A54 A;  4OIK A;  1SYC A;  5CMD A;  4FP5 D;  3URY A;  1KAA A;  2XIW A;  3ERO A;  2JXM B;  1SMY C;  3TDQ A;  1F9Q A;  5M5Y B;  1I50 B;  1C48 A;  1BCP F;  5I6W A;  2AQ3 B;  5C3E B;  4XDX A;  3TP5 A;  4DK1 A;  1TWA B;  2IW3 A;  4KN4 C;  3Q6S A;  2EY2 A;  5D3I B;  3HG9 A;  2EYH A;  4G7O C;  3IL8 A;  2CQA A;  1ENA A;  1YNJ C;  1QG7 A;  4M8A A;  1F9R A;  4I7Z C;  3V2T A;  1G29 1;  4DNR B;  5EPL A;  1HXY D;  4AYB B;  2PNR C;  3EVQ A;  2WII B;  4U67 3;  3C2P A;  1AZQ A;  1RDP D;  3V96 A;  1KTK A;  4K2L A;  1A3T A;  5FOB B;  1NAP A;  4OO1 I;  2LMC B;  1PMR A;  3NWT A;  4HN7 A;  1HTP A;  1V1P A;  3M7G A;  4ZUI A;  3HEJ A;  2F03 A;  2F0K A;  1SYB A;  1O7L A;  1LTT D;  1JR0 D;  1PFM A;  4PNY A;  2K05 A;  5ELB A;  3TSS A;  1UNS A;  1HRJ A;  2SDF A;  5IGG A;  4IZ8 A;  2WB1 B;  4QMG A;  3QG1 A;  2QCP X;  2IX1 A;  1H9S B;  1O7Z A;  4X3U A;  1BCP B;  4MHE A;  3SHL A;  2EOT A;  5CV4 A;  3CRK C;  3SE0 A;  1PYW D;  4A3K B;  1XTC D;  1SDF A;  2AUK A;  4JK1 C;  4ZUJ A;  2PQE A;  1JB3 A;  2RA4 A;  1Q90 A;  2EY6 A;  5DEH A;  3MXU A;  1ESR A;  2EY5 A;  1K8M A;  2K33 A;  3J7A V;  2B2W C;  1C8C A;  3S15 B;  1BO0 A;  3AB9 A;  4IFD I;  3E6Z X;  2TMP A;  1XYI A;  2K01 A;  1GOZ A;  2NTT A;  1TU2 B;  3I4M B;  4BS9 A;  3VR6 A;  4DFA A;  5FKA C;  4QIW B;  3MWY W;  3HOV B;  1PDQ A;  3IFD A;  2F0N A;  3S16 B;  1IHZ A;  1TWF B;  1NR2 A;  1V1O A;  1STA A;  2CHB D;  2B2V A;  2JP1 A;  1CA6 A;  3K57 A;  1EQV A;  3OWE B;  2Z1C A;  1U9R A;  1GUG A;  4TRD A;  2E74 C;  2B2U C;  1E2V A;  2IJ0 A;  2PZU A;  3VR5 A;  3Q22 A;  4ME5 A;  2NN6 H;  4FF3 A;  3GD7 A;  2E75 C;  2DNC A;  3GP7 A;  2ZXP A;  3K5O A;  5T1G A;  4DAV A;  1BOS A;  3HOY B;  2E76 C;  2B8G A;  1G6Z A;  2L12 A;  2PW5 A;  4ULL A;  2VB3 X;  1JOR A;  1EY6 A;  1QJO A;  4G4K A;  3K5N A;  1OXX K;  2Q8T A;  5D65 A;  3DUZ A;  2F1M A;  1EZ8 A;  5I4D A;  3MHB A;  5M3M B;  3PMF A;  1ONL A;  1GJX A;  4XIG S;  2WKC A;  2MUY A;  1TWG B;  1SE4 A;  3Q0A A;  4RGT A;  1ENC A;  3SK8 A;  3P7J A;  2R3Z A;  1L0Y B;  4UAI A;  4C3J G;  1UEA B;  4S3S A;  3A7A B;  3I4L A;  3BDO A;  1HPC A;  4PQX A;  5CV7 A;  5C0X G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...