3LWEA

The crystal structure of mpp8
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
61
structure length
61
Chain Sequence
GEDVFEVEKILDMKTEGGKVLYKVRWKGYTSDDDTWEPEIHLEDCKEVLLEFRKKIAENKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords M-phase phosphoprotein 8
publication title Structural basis for specific binding of human MPP8 chromodomain to histone H3 methylated at lysine 9.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 14
structure length 61
sequence length 61
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3lweA00
1IKLA 1GUWA 4X3KA 2DY7A 1F9RA 1RJTA 2B2UA 3ONAB 2NWGA 5CMDA 1HFGA 4IURA 1HRJA 1PFMA 2N88A 4ZK9B 1XYIA 2VXWA 3QO2A 1ML0D 4LMQD 1KNAA 2K03A 1XX8A 3KBXA 4IUPA 2FFKB 2KOLA 1B2TA 1MSHA 5CORA 4ZLTF 3HP3A 1NCVA 2B2WC 4MHEA 5AFWA 1BF4A 2XIWA 4XT3B 2H1EA 2CVRA 1O80A 1HFNA 2K28A 2HDMA 1IL8A 2MGSA 5E4WC 1WTQA 2MP1A 4IUVA 2R3ZA 4RAUC 1EQTA 2HCIA 4IUTA 5D14A 4R8IA 1CA6A 1BNZA 1WTPA 1PLFA 1PFNA 4HSVA 2K1BA 5CBAE 4OIJA 4X3UA 4R9WA 2EPBA 3TN2A 1X3QA 1WVLA 3UI2A 4IUUA 2B2YC 2B2UC 2N55A 2M2LA 1BO0A 1RTOA 2HCCA 1QG7A 5T1GA 1B4OA 2D9UA 1IKMA 2HUGA 1WTOA 1CA5A 1HUMA 1ESRA 3P7JA 2K01A 3DEOA 1AZPA 2MPMA 1AP0A 1RTNA 1HHVA 2B2TA 4O42A 1A15A 1U4MA 2KUMA 2FHTA 2NZ1D 1J8IA 1LV9A 5CBEE 4CJ0B 1HA6A 2L1BA 2B2VC 2L12A 2X6LA 4X3SA 4OIKA 1PFBA 1F9SA 1CM9A 2JP1A 4HAEA 1VMCA 1QE6A 1NAPA 1KNEA 2HDLA 1DOKA 1MGSA 2KVMA 2KEEA 4CJ1B 3G7LA 4DN4M 3MTSA 1TVXA 5EPKA 1G6ZA 4HCSA 2L4NA 2FMMA 2RSOA 3KUPA 5EJWA 5E4XA 3R93A 1S4ZA 3FDTA 1EIHA 2Q8RE 3N52A 3DM1A 4HEDA 2RA4A 1JE4A 1ICWA 5D65A 1U4PA 1J9OA 4NW2A 5EPLA 4ZAIA 1SDFA 4CJ2C 1DOMA 1O7ZA 1EIGA 2BDNA 1B50A 2B2TC 2KEDA 3FPUB 5EPJA 2RSNA 3TZDA 1ILPA 2L11A 1X32A 2L9HA 1JICA 1VMPA 1F9QA 2JYOA 3I90A 1Q3LA 1DOLA 3I8ZA 2FINB 4X3TA 1WTRA 2K05A 1DZ1A 2EOTA 2KECA 2MJ8A 1WD0A 4QUFA 1ILQA 2K04A 1MSGA 4QUCA 1RHPA 2J7ZA 4U68A 4RA8A 2X6GA 2NYZD 5EQ0A 1BBXC 4RWSC 1WD1A 2SDFA 2RVLA 3GV3A 2Q8TA 1ZXTA 1SAPA 2B2YA 1M8AA 1QNKA 5EKIA 1WTVA 1F2LA 3SVMA 1O7YA 3GV6A 3IL8A 1B3AA 1B53A 1G91A 5COYA 1WTWA 1NR4A 4ZKCB 1EL0A 1G2SA 1NR2A 1MI2A 1RODA 2IL8A 1U4RA 4ZKBB 1AZQA 2B2VA 5JJZA 1HUNA 2B2WA 3MWYW 4XDXA 3I91A 1E0BA 1U4LA 1PDQA 3D6WA 1DONA 3DEPA 3IFDA 1G2TA 1SSOA 5DNFA 4MN3A 4UAIA 1F9PA 2DY8A 4XT1B 3H91A 1C8CA 1EOTA 5T1IA 3LWEA 2FJ2A 3F2UA 1X3PA 2EE1A 2X69A 1WTXA 3Q6SA 4IUQA 3I3CA
chains in the Genus database with same CATH superfamily
3FRPB 4X3KA 1ENAA 1LUZA 4BBSB 4YHHL 2NBFA 2NVXB 2N88A 5M5WB 2F0TA 4X6AH 3KBXA 1Y1VG 1BCPC 3A74A 2FFKB 3SK5A 4DK6C 3OIPA 1PHJA 2E5LQ 4RMFA 4MHEA 2DNEA 2K5VA 1WFQA 1EZ6A 3WWVA 3TP8A 4JI2L 4A3BH 1RIPA 1JT8A 2JEAI 1PLFA 3CC4A 1K8AC 4LF9L 1X3QA 3DLLA 1AE3A 1QUQA 2RF4A 1Y1WB 4KY7A 3R2IA 1VQNA 2B39A 1AP0A 4GNXA 1D5ZC 1U4MA 2WAQG 2MUYA 1CQVA 3TMEA 1F9SA 1SJHD 4R4OA 2ZTEA 1L1OC 3CMEA 3HOXB 1A63A 2GN5A 1W6KA 3W5OA 3J81E 3OWEB 4CDFC 1G6ZA 1C0AA 1TKWB 5JJIA 3CCJA 2F0NA 3STBD 5FO9B 3PMFA 3P20A 5F2DA 3DWQA 5E7NA 3JAMc 4OWTB 1I94Q 2E5LL 1OO9B 5C3EH 1AFPA 1K73C 1PH3A 3S2HB 4A76A 1S5ED 1JQYD 1SE3A 3I90A 4P73A 4ZCKA 1V1OA 2VUMG 4C56C 4FO2A 4RA8A 5EQ0A 5C4JH 4PZ8A 1Y8PB 5IT9L 2V4DA 1F2LA 4JVZA 2ZJPA 1H9SB 1SE8A 2RDFA 4BBRB 2R7DA 1EIYB 3STBC 4OEMB 3M3YH 3I91A 3X3MA 1VQBA 4K6DA 4C3JB 5ISRA 1SLJA 2V1CC 5C0XH 4QIWB 2EY6A 2D5DA 1WTXA 1KAAA 3J80E 1BVSA 1F9RA 3TP5A 2AQ1B 4I7AA 5BR8Q 3ND8A 3F8TA 4LMQD 4JC0A 3NBHA 3PF4A 1YIJA 3PO2G 2DNCA 3E0JA 1AW7A 1HNXQ 2PZUA 2JA8B 1KTKA 1UE6A 3NENA 3J81i 2Y0SE 2IW3A 1IL8A 2MGSA 3OSOA 4N8X1 1JJ2A 4HCEA 1EQTA 4B3MQ 3VYSA 1PFNA 4NPSA 3HOZG 2A69D 3KF8A 1RDPD 3NQIA 4OO1H 3ZYYX 1WVLA 3KF6B 5CGKA 2M2LA 4XYOA 1QG7A 5JVH3 2OCEA 2D9UA 2KCNA 5ELDA 5LMUQ 4DF7A 2LXJA 3HOVH 2MPMA 3DM3A 4KHZA 2QDBA 4DV4Q 1CKOA 1CKNB 2X6LA 4DA2A 1IW7D 3KYHC 3QIAA 1VQLA 4IALA 1TT2A 3M4YA 4EGVA 2KEEA 5JEAG 3S16H 2L4NA 5KRUA 4YY3L 3KUPA 5BR8L 3HRZC 4X64Q 4DV0Q 2KCTA 5C44G 1ENFA 1WYDA 1L0WA 3CCLA 2CWPA 1HNXL 5IYCH 4DV1L 3MFYA 1TWHB 1ASZA 1J9OA 4OL7A 3D3RA 5KGUA 1SXTA 4A3MH 1VQFA 4B3ML 1I6HH 1HR0Q 3PUYA 2L55A 4X3TA 2K04A 2R6GA 2YV5A 3J80i 3RNUA 3SK4A 3CF5A 2WKCA 1IW7C 2HD3A 3NWSA 4QB4A 4S3SA 2Q8TA 1HTPA 4DK0A 4BY1H 1M8AA 1QNKA 3TREA 3RLOA 3MEHA 4DV4L 1CQFA 3PCOB 2SNMA 2ASBA 3I4MH 4X62Q 2XNAC 4B08A 2B3GA 4C3HG 1Q7YC 5ELFA 2PNHA 2F03A 3CRLC 3FKIG 1C8CA 4X64L 1AN8A 3MXGA 5C4ZA 4DV0L 1KD1C 4H0LC 1CZWA 3MVVA 3VYRA 3I4OA 1GKHA 4IUQA 3U9OA 3RZOH 1V9PA 3KFUA 2WB1E 3I72A 2NZOA 4B3TQ 4GKJQ 2JXMB 1HR0L 4BBRG 1VF5C 1DD2A 3SK6A 2F0OA 2K14A 2NZHA 3LWUA 1DM0B 4X66Q 1VQ7A 3JAML 4BY7H 3AMUA 2RCNA 2XIWA 1L1OA 1ET9A 2OF1A 2Z8LA 1PFSA 4R8IA 1HA5A 1CHPD 3BDCA 3S17H 2JEBI 1YZ6A 5IGFA 2TSSA 1JR0D 3E3XA 3CKIB 1GHKA 4X62L 3BVZA 3IFTA 2F0GA 2ES2A 2F52A 1V8QA 2XTIA 1XXGA 1LACA 1HHVA 4OXPA 2JA8G 2C9OA 1HNWQ 3NTHA 1I50H 2OXPA 3I7FA 1XJVA 2UUBQ 3AFQA 4QIWE 3CQZH 3A56A 1VQEA 1LTGD 4R4QA 4B3TL 5EPKA 4GKJL 3J7AV 3I4NH 4FP5D 1G8ZD 1E1TA 2EYJA 1FNUA 3W3AA 2EY5A 2EY1A 4X66L 4QY7A 5D65A 1STNA 4JI1Q 1SDFA 3FMCA 1A3UA 3ULPA 3O13A 1I3QB 5CV8A 5J39A 3GDEA 3KLSA 4HIKA 5EBCA 2E2DC 2FINB 2NN6H 1MIUA 3CC2A 5GQOA 2DUDA 2N8NA 2Z1CA 3ULLA 3DXJC 5FO8B 4IJHA 4CKEA 2PI2E 2ID0A 1AH9A 2E2JB 1PTOH 5IGEA 3D0FA 3S1MH 1HNWL 3S16B 3M7GA 1GO3E 1MHWC 4G7OC 5AJ3L 2UUBL 2BE5C 2Q8IB 1TY2A 1BUVT 3EBEA 4IZ8A 3SGIA 3OIQA 4DAYB 4MN3A 1K9MC 3TP6A 2IX0A 3DHQA 4L5TA 1T9HA 1I6HB 1YITA 2X69A 1D1KA 2CH4A 4JI1L 2NWGA 3T4AC 4DAVA 2I46A 2KQ3A 1YHAA 2WV6D 4IUNA 1XMQL 5EKKA 3ER0A 3JC66 1XX8A 1LTID 1X3EA 2K4KA 1NCVA 2EXDA 2F0EA 5JOBA 4PQXA 2OQ0A 1LTRD 2PYKA 1S3OA 3W2DA 2K28A 1DXMA 2QILA 3S1RH 4IUTA 4UHVA 5DM63 1EWCA 2RKSA 4A93H 5FLXL 1D2BA 1DCZA 1UUPA 1IHZA 4NB3A 2A68C 2UUAQ 4UP8A 2RDGA 1I4HA 1O78A 3GTQB 4DXGA 1K0SA 2QGQA 3AQQA 1JB3A 3PUWA 3RZOB 3LGJA 3R8BA 1KDBA 4KJNA 2JA6B 1Z6HA 3R3OA 4GOPC 1KIXA 1OXSC 3HOYB 2D0OA 3PQIA 3OOCA 5CR3A 4DR1Q 2WP8J 2Q2TA 2UUCQ 3HOUG 1S5BD 3RLFA 4A3EB 4B3RQ 3H0GG 1UWVA 3QOJA 2VQFQ 5GAGC 4P75A 1PRTB 1U4PA 4NW2A 3RZDH 3U4ZA 3K7AH 1EY4A 4QF4A 1B7YB 4LUOA 4LFCL 5CV9A 1JICA 1VMPA 1D5MC 3TP7A 3V2TA 3WOEA 1DZ1A 5ELEA 2KECA 3GTMB 2Z4HA 2UUAL 3GTLB 1GHJA 1DGSA 1VQ5A 1JWUD 1GUNA 1ZXTA 3TS0A 1MD2D 5EKIA 1S5FD 5KYIA 4GN3B 2NTTA 1PYSB 3PO2H 1G91A 4ZKCB 1LYLA 4KI0A 5KEEA 5ELNA 5C4HA 4UP9A 4DR1L 2HIVA 2HT1A 3NUCA 1SSOA 4GNXB 2UUCL 3K5OA 2F0DA 1BOSA 4JI5Q 1Y69U 4BBSH 4B3RL 5M5WH 3I70A 2VQFL 2I5MX 3H94A 2GVBA 3A5UA 1IKLA 4OELB 4HJ9A 2XN9C 3M4PA 2F0VA 4OX9Q 2K5HA 5ELCA 2QEXA 5IP9G 5M5YB 1HRJA 3KDFB 1I5FA 4ZK9B 5JPNC 3CC7A 3RN5A 1XYIA 2M9VA 4DR5Q 1VQ8A 1BCPF 1XWEA 4DUYQ 1N34Q 1MSHA 3OW7A 1STBA 4FDBA 1Y1VB 1M90C 5FLXE 5JEAH 2LY7A 1Y1WH 3MXNB 1FR3A 2ALYB 4XTCS 2UU9Q 1VQCA 4A3GB 1BO0A 3ND9A 1AE2A 3M85A 3D8GA 4N9PA 1YI2A 3I56A 4U673 2CCZA 3DEOA 3CCVA 2K7VA 1R4PB 4DR6Q 2WAQB 2JP1A 4GLAC 4LFAQ 1OXXK 4LFBQ 3MXPA 1TIID 1VMCA 1N32Q 3HGBA 1NAPA 5IYDG 4OX9L 3NXWA 3G48A 2FMMA 3R93A 1K3BC 5D3DA 4DR5L 4DUYL 3L3OC 3S2HH 3QB3A 5EBDA 4C3HH 1ICWA 5EPLA 2UXCQ 3FKIH 3HOWB 2BDNA 3GTGB 3A5ZB 2ZXOA 5I2YA 1KLUD 4GN4B 1V1QA 3C46A 2JA6G 2LSSA 3A7LA 3NBHB 3K8AA 2AWNA 1Q8KA 2K05A 3HFZB 1TWGB 3H15A 2G9HD 2VUMB 2X6GA 2NYZD 2UU9L 1XTCD 2YTXA 2BDOA 3D4RA 3PO3B 1HQMC 3PIP3 2D0PA 4A3EG 1FNVA 4BBRH 4A3DG 3PF5A 4JI7Q 4HMIA 4JYAQ 1TWFB 1A8VA 1PH6A 1PYBA 1NR4A 1R9TB 1TY0A 1G2SA 1ET6A 4DR2Q 4DR6L 3RMHA 4LFAL 4ZYSA 1G6PA 2HIXA 2Z0SA 2ICEC 1N32L 2H4OA 2DJFC 1G2TA 2MHVA 4LJZC 3TEHB 3P75A 1NJIC 4XQQA 2B63B 4Y52H 5T1IA 4FXKC 4ME5A 4X65Q 3H3VH 2EXZA 4KN7C 1TS4A 2EYOA 2UXCL 3D6CA 4RCOA 1L0YB 4KJOA 3HKZB 2JA8H 4KKTA 1ZYRD 2F3VA 4O0AA 1A6XA 4PG3A 2K03A 2O5JC 1LTTD 2L15A 3HP3A 2OQKA 4H02A 5LL6S 4FXGC 1O7IA 3PO2B 4C2MB 3CMAA 1EFID 1J5EQ 2BA0A 3BVMA 1FVIA 4RAUC 1NUCA 5GROA 4JI7L 1BNZA 4RHSA 4PV1C 4R1JA 3BG3A 1PH4A 2PNRC 2F1MA 4DR2L 3HOZB 2B2UC 2KENA 2GVAA 3BVGA 1X65A 5E1FA 4B9XA 1PH7A 1Q90A 2KA7A 2EDGA 1XPRA 3OMGA 2K75A 5CBEE 3C1FA 2F0PA 1BCPB 1SYGA 2IHEA 4X65L 1ZYRC 3AYHB 2LS01 1TVXA 1GOZA 3TSSA 1FJGQ 2QF7A 1TWHH 5GADC 4A3GG 2OTJA 1HH2P 1QCBD 3PUXA 2H5XA 3PIOA 4JCVE 3BU2A 1T5XD 5C5MA 1IZ6A 2J4XA 4HIMA 4JOIA 5C44B 4IN3A 4MTKA 2B2TC 3V96A 1J5EL 2XGTA 3OW2A 1X32A 3AEVA 4TSSA 1K8OA 2MNAA 4A75A 1SYDA 2EOTA 1MSGA 4U68A 3UE1A 1WD1A 3KOJA 2RVLA 1L1OB 4OONA 2RQXA 3BYYB 2PW5A 3C1EA 3MC0B 2A1AA 4NXNQ 3A8IE 3D4DA 4FF3A 3HOWG 1E1OA 1WTWA 1X56A 2NVYB 1KABA 3FVQA 4WFN3 4A3JB 3D4WA 1AZQA 1D1IA 2WAQE 4K14A 2G5DA 1LTLA 5DLQE 5FOBB 5DAUA 4C3HB 3NSWA 4KK7A 3FPPA 4J15A 3FKIB 1FJGL 1HNZQ 4FXDA 1LT6D 3EROA 1HZAA 2F4IA 3PO3G 1OTCA 1VQAA 4R8NA 5HGQA 4ID6A 1E22A 2DY7A 3S24A 1EY7A 1PFMA 3GTOB 4IFDI 3OYYA 2VXWA 1SE2A 3TS2A 2ZTDA 4KD3A 3BYTB 3QOLA 3ULJA 1A3TA 3FP9A 2CQOA 4CDCC 2B63G 4DNTB 2HCIA 4R4CA 4HSVA 4NXNL 4APVA 1I94L 2EPBA 3PGZA 3HKZG 1RTOA 1SNDA 1Y8OB 2ZM6Q 1TXYA 1IKMA 1JOOA 3CCRA 3BDLA 1Z9FA 1HA6A 2NZ1D 1HNZL 2FXQA 1SMYD 3A8KE 1QWYA 1KLGD 5C3XA 1CK1A 1QE6A 3GO5A 1KNEA 2E76C 4ZUIA 3TBIB 2A8VA 3VA5A 2K32A 4I65A 2A73B 5EJWA 3GD7A 1EEFD 3HKZE 1I3QH 4G7HC 5I6WA 1Z47A 1EZ8A 2EJFC 1PA6A 2QW7A 4J1MA 1HTLD 3LX0A 3RN2A 4XQJA 4R4IA 1A62A 4HIDA 4L5RC 3ZJYC 3E9HA 2N3SA 4K5XA 2R92B 3CPFA 2E2JH 5FJ8G 4A3IB 1N36Q 1BBXC 2ZM6L 1SJED 1SMYC 1EU4A 2K5WA 5IP9H 4YIJA 5IP7G 5FLMG 2YTYA 4TQUS 3K5NA 2HQLA 3KLSX 1BBWA 1K0RA 1NR2A 1EL0A 2IL8A 3EQLC 1U4RA 3NBIA 1V1PA 5E3FA 2A69C 2BA1A 4ULLA 2LXKA 3EVQA 4NDXA 2QA4A 2R93G 2A6ED 4UY8C 1IYUA 3CCSA 5IT9E 2ZXPA 2RDHA 1O7LA 2XVSA 1BXTA 3Q0AA 3CU7A 1CUKA 4A3KB 4OWWB 1ZEQX 5BN3A 5LMUL 4JV5Q 2B2UA 3ONAB 2VW9A 4RKBA 2CW0D 1EFWA 1R4QB 3KK7A 3QO2A 4A3JG 4N8FA 4ALPA 2PMZB 3S1NB 1EQRA 1KQSA 2BH2A 4WJ3M 2D62A 3VR2A 1GUGA 2O5IC 2VQEQ 1N36L 4DV7Q 2MP1A 2KCMA 3GTQH 2IX3A 3MHBA 4R9WA 2PO4A 4LF5Q 4BXXG 4DGZA 4IOCA 3H6MA 4C1NI 2PZWA 5KNCA 3F1ZA 2JA6H 2K01A 1AZPA 2B2TA 5KIXA 3HOYH 1QNUA 3K6OA 1C9OA 2M00A 4YCUA 4NXMQ 4DUZQ 4HJ5A 3V05A 2RHSB 4ZUJA 1W2BA 4KY5A 2HDLA 3H09A 4JV5L 4A3EH 1MGSA 4CJ1B 3AFPA 1EY6A 2LKVA 2IPKD 4HCSA 2F0JA 2E2HB 5C0XI 1S4ZA 2AKWB 1EIHA 1SBBB 3HOUB 3N52A 5JPMC 4HEDA 1K3RA 4DR4Q 1L2FA 3H0GB 1F2ZA 1DOMA 3PV0A 1IL2A 1VQPA 4DV7L 2R61A 1G291 1ILPA 3GTMH 1E3PA 3GTLH 1SNOA 1DOLA 1UE1A 1WTRA 4JBKA 1P16A 1VQ6A 4LF5L 2F3WA 5GAEC 2DGYA 4ILWA 2C35B 2F0KA 1WTHA 1L0XB 3W1BA 1PH2A 2KJXA 2KCCA 5C4XG 1LLRD 1YHBA 2MFIA 2QDLA 1B3AA 4OO1I 4NXML 2A5HA 3G4SA 3DUZA 2B2VA 2LMCB 4DXFA 1EIFA 4DNIA 5IIFA 3CD6A 4XIGS 1TWAB 2R92G 4XT1B 2EJMA 4G7ZC 4A3IG 3OPOA 1G51A 5M5YH 3Q6SA 1H9SA 3P1HA 4DR4L 3GTPB 1JORA 1HR0W 2K33A 2LFNA 1JMCA 1HFGA 5I9PA 1JWMD 1Y1VH 1DJRD 2EVBA 3L0OA 2BCOA 3IRBA 4TKOB 1JOKA 4KHPQ 3MFGA 1X6OA 2K52A 4EQPA 2K50A 5DM73 3NE5B 4IUVA 4A3GH 2R3ZA 1VDZA 3I2ZA 3WOFA 1XNQQ 4A3KG 1WTPA 2F0QA 3A55A 4IO9A 4A3BG 1PZJD 2C5CA 4IUUA 1B44D 1KC8C 2N55A 1WI5A 4JW0A 1X9NA 4LNQA 5KNDA 1C7YA 2IWHA 3JAME 1ESRA 3T13A 3P7JA 4L63B 2L0CA 2JN4A 3KLRA 4CDEC 5M5XB 1KRSA 2ZTCA 5BN4A 1GM5A 3NK9A 1V43A 1QZHA 2VZAA 3VR6A 3E6ZX 3MTSA 1TR5A 5E4XA 1VQDA 4IPGA 3HEJA 3HOWH 3GTGH 3I4LA 3NP8A 4MIUA 4H7BA 1CKNA 1QILA 5CV6A 2WIIB 2PMZE 1SMXA 4HJAA 1EIGA 3HS0C 1TWGH 4JBWA 3EIVA 4DNRB 2FMCA 5C3EG 4DR3Q 2VUMH 4LK1C 1PRTD 1GD7A 1XNQL 2Z9HA 4P71A 2MJ8A 3PO3H 4IFDJ 4V190 1Z7TA 2AQ2B 2JQOA 2VY3A 4QUFA 3T1YQ 2JA7B 1T5EA 2I5LX 3J81c 1STAA 1TWFH 1I6VC 5EKLA 4GOPB 1R9TH 1Q1BA 2JSOA 4JG2A 4A3DB 1RD9D 4G4KA 4CGYB 2NB0A 1E2ZA 2Z6BA 5A2QL 3CCMA 1Q86C 1QVFA 3QWNA 3U4VA 4IPCA 3PIPA 2B63H 4XDXA 3PSIA 5M3MB 1I4GA 3IFDA 4BS9A 4UAIA 3H91A 2A6HD 2VB3X 3T1HQ 3LWEA 2WKDA 2OEOA 3SR1A 4P72A 4IQZA 1YNXA 1FNWA 4DAMA 3JAMi 3L2PA 4Y7NB 1SFOH 1C4QA 2ZXRA 2WINB 1YHQA 4LF7Q 3MEFA 4DR3L 4JOIC 5HURA 4YCVA 4C2MH 2Z6KA 1KNAA 1QUQB 4CBVA 3DMUA 5CORA 3T1YL 1E7ZA 1YJNA 2EY2A 4O2DA 4LUVA 5AFWA 2CVRA 1O80A 4L5QA 2HDMA 5E4WC 4K5WA 3HOZH 1PTOD 2I0QA 4POGA 4F87A 2NN6I 1NY4A 2PW7A 5IWAQ 1NMGA 3J80c 4KY6A 4DU9A 1SRUA 4LAAA 3S2DB 1YBYA 2A6HC 1B4OA 4UDUC 2KHJA 2HUGA 4LF6Q 1HUMA 2J0TD 4O42A 2KUMA 1MBYA 4DFAA 1J8IA 1LV9A 1NMFA 1CTMA 3T1HL 5NUCA 5FJ8H 4A3CG 4XYQA 4PNYA 2DN8A 4DV5Q 3EJIA 2QKIC 3FHWA 4LUZA 5FLMH 4DN4M 4LF7L 1QVCA 4HTHA 5C44H 1HZCA 4ZRZA 1EWHA 1KDCA 3DM1A 2K5NA 1Q82C 1PTOC 1GUTA 1JE4A 1PH1A 2WFWA 4ZAIA 2I5HA 3CRKC 5M9OA 2P5ZX 1MJCA 4KTAA 2OTLA 2R93H 4JI5L 3I8ZA 4A3MG 3Q8DA 1ILQA 3B6YA 1IBMQ 3BJUA 1SYFA 2F4VQ 1KL9A 3M4QA 4JI3Q 2SDFA 5A2QE 2YYZA 4KKSA 5JJKA 4LF6L 2NVYH 3NEMA 4A3JH 3SVMA 2NVQH 1N34L 2CQAA 5I4DA 1H95A 4I7ZC 3BDOA 3FEWX 4K8IA 4C3IB 2D2CC 4DV5L 3I4MG 2MO0A 1U5KA 4DKAC 2EZVA 2JA9A 3N6RA 3HKSA 2JA7G 1Q1EA 4P2CB 3S14H 3S15B 1EOTA 3GQBA 4BXXH 4DK3C 1ENCA 5IYBG 3GTOH 3J7AF 2PQAA 4KHVA 3I3CA 4HR7B 5CMDA 2BH8A 1A2UA 3GTJB 1N9WA 3S1QB 4EVOA 4GLVB 2VL6A 3KF8B 4AQYQ 1SEBD 4DAYA 1I4RA 3L9AX 1CSQA 5C0XJ 2KOLA 2ENBA 1UEAB 4ZLTF 4LFBL 2B2WC 5M3MG 1D7QA 1IBML 5J22A 2H1EA 5D3IB 4BY7G 3VA7A 3ITPA 5D14A 3EN2A 1HZ9A 4JI8Q 4PZ6A 1VF7A 2CWAA 1VQ9A 1EYAA 3K81C 1K83B 1EQVA 1U9RA 1A0IA 2YU9B 3M4OB 1SFOB 1K28A 1B70B 1S5DD 3ERSX 2UXDQ 1UAPA 3U9SA 2CFMA 1V1PB 1AEXA 4ODGA 1PH5A 4A4IA 1PV4A 3GTKB 2SEBD 2UXBQ 3G7LA 1LM0A 5KNBA 2RSOA 1M4VA 1WCMB 1CFMA 3NQTA 1KAWA 3MXUA 4RGTA 3FDTA 4JI2Q 1SYCA 4AQYL 4C1NK 2RA4A 5IGGA 4CJ2C 3NWTA 3QG1A 2F0LA 1O7ZA 1FL0A 3W1GA 2R92H 2WACA 4JI8L 1B9NA 1RKNA 2F3IA 3CCQA 4A3IH 3MAQA 1B9MA 2J7ZA 3K59A 4RWSC 5M3FB 3E9IA 4LF8Q 5G3LD 3NTKA 1X3FA 1VCIA 2JJQA 1WTVA 4LF4Q 1BDOA 1ESFA 3GV6A 3OTOQ 4FYDA 1EYGA 2UXDL 1Q81C 1CSPA 3J80L 1JOQA 2UXBL 3G6EA 1E0BA 1KHIA 2RCFA 1A2TA 3DEPA 3OMCA 4GS3A 4A3KH 1TQOA 1W3SA 4EQOA 4MNOA 4WORA 2R93B 2XWJB 1IXRA 2EE1A 4YCWA 2JE6I 4ABNA 3S1NH 1STGA 5IE8A 4CHTB 5CYUA 1XPUA 2AMCB 4C3IG 2PQEA 1J6QA 3TZUA 2NVQB 4PMCA 3KLWA 1FD7D 2EYMA 3L7ZC 2NUCA 1HFNA 1WTQA 3E0EA 4J6HA 4LF8L 4OGQC 4DV6Q 4FF4A 1GJXA 1EEID 4LF4L 3KDFA 3S9WA 2EQSA 5CBAE 3OTOL 1SNQA 4X3UA 3C3LA 3TN2A 5A35A 4JYAL 4A3FB 4A93G 1GUOA 1TWCB 2EIFA 3TDQA 3S14B 2WB1B 3NTIA 1WTOA 2F0SA 4JK1C 1SYEA 3KJPA 3AB9A 1A15A 4RGMA 1XPOA 1RCVD 2L1BA 2B2VC 2L12A 4X3SA 3MXNA 1LTAD 4B3SQ 1BKBA 2BOSA 2E2HH 2DJGC 3MZ5A 1N33Q 3R2TA 2QCPX 1DOKA 3HOUH 3CPWA 2O4XA 1S5CD 2A74C 2JK8A 3H0GH 3J81j 4HJ7A 3K80C 2R7ZB 2IX1A 1SNCA 1E24A 3H3VI 1H9MA 2F0IA 2XSCA 1CZGA 2IJ0A 1HCZA 5CC4A 1VQHA 3FPUB 4RKLA 5EPJA 3TZDA 4F7XA 4DV6L 1EY5A 1STHA 1FGBD 1JJGA 4WRDA 2Y0SG 4RHRA 1D6EC 4QUCA 2ATWA 4RGOS 2ZT9C 4AYBB 1STYA 1VQOA 1MKHA 1WCMG 3M9BA 3H3VC 1JJCB 4RGNA 2B2YA 4NKLA 3WDNA 1S40A 1QJOA 2E74C 1QOHA 3IKJA 4YY3Q 5C4XB 4JBMA 2AWOA 1QZGA 4K6LA 4B3SL 5CV7A 1KRTA 4WJ4A 3F2DA 1TWAH 1ASYA 1HPCA 5I9OA 2Q2HA 3UDIA 4EQ5A 4DV1Q 2B2WA 1N33L 2OT2A 4K2LA 1PH9A 3SEBA 2F0MA 3GTPH 1TU2B 2NVTB 3CHBD 5M3FG 3OWFA 2K5QA 5J1ZA 4BBSG 3T51B 1GUWA 2JA5B 2QEJC 1YNND 1D8LA 1H9KA 1ML0D 2RBMA 5IODA 4Q0FA 3MA2B 2XRQD 4A3CH 1PMRA 3K7UC 3D31A 1Q8IA 4BA1I 4HJ8A 4A3LG 3PIO3 5ELOA 1BF4A 3CCEA 2K6AA 3RR5A 1WOCA 3UDXA 3SXHA 2F0HA 4M8AA 4OIJA 1GVPA 5FK9C 1I4PA 1PYWD 1Y8NB 1Y1WG 4A3BB 2HHHQ 2EYLA 2HCCA 1VS0A 2VNUD 5M5XH 1NSNS 4FF2A 4GZYC 4R4TA 4POFA 3M7NA 5FLXc 3C2PA 1F77A 1D5XC 1YNNC 3HOXG 3VDYA 5IYDH 4HAEA 4QMGA 3J7ZC 4L8JA 3F2BA 1SR3A 4JI0Q 1LO5D 2KBNA 1HJPA 3PUZA 3CXCA 4A3FG 5K36G 2AQ3B 4E6IA 4QL5A 1ZKOA 5CV4A 1HQRD 2WB1G 2A6EC 1YJWA 1IBLQ 1FGUA 4Q5VA 4F8MA 1K8MA 1F2YA 1B50A 2Z6KC 2JA7H 1H9JA 1M1KC 1YNJD 2MQHA 4OWXB 1KDAA 3CAMA 1II3A 1Q3LA 5C3EB 1JWSD 2CW0C 5IYBH 3VYTA 4EQNA 2AHOB 4NP5A 2B29A 3TRZA 2HHHL 4PMBA 5LMNQ 3Q23A 4A3DH 2O2LD 2R7ZG 5C4JB 5C5LA 3IL8A 2F0WA 4FVMA 2N78A 5M3MH 4IFDG 2IHFA 1LTBD 4ZKBB 2VQEL 1MJEA 3I73A 5JJZA 1HUNA 4BWGB 4C3JG 1GUSA 3D6WA 4JI0L 4QCLA 1YVCA 2XRSD 5FKAC 2ZJRA 2IY5B 4JI4Q 4Y7NH 4AYBG 3M3YB 1XNRQ 2HQEA 2L5TA 1PRTF 1EYDA 1YNJC 3UE0A 1IBLL 4L5SA 1SNMA 3A7AB 4K8JA 5JAVA 1RJTA 2B8FA 4IURA 4QQBX 3EA6A 3K0XA 2CH4W 5HY6A 4DUZL 4OHJA 3GP7A 5LL6X 1A3VA 4RCNA 1XMOQ 3SK8A 5AJ3Q 5LMNL 1EY9A 1E2VA 4AYBE 4O1NA 4H44C 4NMZA 4QJFA 5IGDA 3S2DH 2BE5D 3G6JB 4FNFA 2K1BA 4KD4A 2SOBA 2JA5G 1ICFB 3UI2A 1B3QA 1Q12A 5JEAJ 4L6TB 3NHHA 4FF1A 3K57A 1QVGA 2ICIA 4CJ0B 1XMQQ 4JI4L 4GLXA 1XNRL 1CM9A 1EWIA 3HOVB 2EJGC 2G9DA 2OWOA 5CV5A 2KVMA 1LT4D 3T53B 1QB5D 1NBWA 3K0YA 3F2CA 1H9RA 1LT3D 1SE4A 4GN5A 2AUJD 1B1ZA 1PTOF 1Q46A 1BBUA 2VB2X 2PQAB 4JI6Q 1XMOL 2A19A 4EX5A 1X3GA 3VR5A 3KBGA 2RSNA 1U0LA 4PZ7A 2JYOA 1F9QA 1JE5A 1WJJA 2YTVA 2A68D 3J7A5 4K0KQ 1PZID 3TQYA 3CCUA 4A3MB 1OXVA 2EYFA 5IGCA 3KF6A 4JBJA 2PI2A 4YWMA 5C3WA 4IJLA 1EOVA 1SAPA 1EYCA 2K5DA 3PUVA 4J8QA 4KHPL 4C3IH 1CHQD 1B53A 3Q24A 5EAYA 4BY1B 5LMNW 3DWPA 2Q2IA 3S15H 4DV3Q 2GA4B 3MWYW 3NPPA 4XXEA 1PDQA 3E5SA 3I4MB 5DNFA 5KYLA 1EY8A 4LFCQ 3URYA 1N8RC 3GTJH 3S1QH 5IY0A 4JI6L 3HZXA 3ERQA 1IYJB 1UE5A 3BZKA 1VQMA 3Q22A 1JC7A 3QR8A 3CP0A 4IUPA 4K0KL 1SROA 4LW1A 4YWLA 1CT1D 1PXUA 5JJLA 3K5MA 1NE3A 4DAPA 5H1SE 1SYBA 2Q2UA 1EU3A 1RF2D 1W6JA 4XQNA 4BY7B 3BZCA 2B8GA 3SHLA 5C0XG 1PRTC 1K83H 1JB7A 5I6YA 2YU9H 3M4OH 1VQKA 1TS2A 3CW2C 3HG9A 3S17B 4DV3L 1I4QA 4RG1A 5FO7B 1YEZA 1SNPA 1RTNA 5EGTA 1LT5D 4MTNA 3GTKH 3A0JA 4YWKA 1PFBA 4HSPA 4DV2Q 2MO1A 1PH8A 5K5PA 2E2IH 1WCMH 4ZQ3A 3RLNA 3VR3A 4ME3A 1I50B 4CKBA 1X54A 3CQZB 5C6AA 5LHY1 3UDGA 4QGUA 3RUZA 2EYPA 5TSSA 4OO1G 3T16A 3I4NB 2F0FA 1JCKB 1VQGA 4CDDC 4GNXC 4IOAA 2L11A 2L9HA 2R7FA 4GKKQ 3HOVG 1BR9A 5M3FH 1S72A 1RHPA 1STEA 2KHSA 3SE0A 5IP7H 2NVXH 3QJYA 4H13C 5J3BA 1PZKD 3GV3A 4IPHA 4DPGA 5HGTA 1GXDC 2N49A 1O7YA 4KV6A 3T56B 4A3LH 4CKCA 4DV2L 4TVAB 1RODA 5GAHC 1B8AA 1NTGA 1PTOB 5IGBA 5IYCG 3KJOA 2VS1A 3BS1A 3S1MB 5DEHA 1ONLA 2XWBB 5IWAL 1F9PA 1E2WA 4F88A 1DYQA 1EY0A 1NNXA 1X3PA 1VQ4A 1UEBA 2CHBD 4BA2I 4BY1G 1UNSA 4GKKL 1PVOA 3LNNA 3G71A 1TS5A 3HOXH 5G3LF 1B2TA 1XTDA 4TRDA 2Z4IA 1FYCA 1EQQA 4RH6A 5L37A 1IYVA 3K5LA 2F0UA 2PPBC 4HN7A 4XT3B 4HMJA 4KMUC 5IT9c 2PCFB 4A3FH 4UPAA 4LWCA 5K36H 1TWCH 5IOCA 1EUJA 1CA6A 1CKMA 4KKUA 3K58A 4DR7Q 4KLKA 1VQIA 2B2YC 3S1RB 4N9TA 1Y14B 1YJ9A 4A93B 4RFBA 4DK1A 3J7YW 5T1GA 3IAYA 3NELA 1CA5A 3BZDB 2E8GA 5ELBA 1LABA 3A54A 2FHTA 4B9WA 5BN5A 5I2XA 4V0BA 2NTSA 2SNSA 4OIKA 1UE7A 2I07B 4KN4C 3HOYG 4UP7A 1VQJA 2F4VL 4JI3L 4K5VA 2R7ZH 1IBKQ 2EYHA 4P74A 4IFDH 2Q8RE 2CKZB 3J81L 4JPBW 4IPDA 2TMPA 3SDZA 1X55A 4M1UB 4C3JH 2E75C 4YHHQ 2KEDA 4MZ9A 2KHIA 3VR4A 3U58A 3U50C 3RZDB 2IT1A 1RL2A 3K7AB 1WD0A 4DR7L 4Z9CB 2Y0SB 1BQQT 3RD4A 3UDFA 4K2KA 5C4XH 2AUKA 1BCPD 2E2IB 3OHXC 4PMWA 3DWAA 3I4NG 1HXYD 4LF9Q 5COYA 3X3NA 5JVG3 1MI2A 1KXLA 1HZBA 4AH6A 1SN8A 1I4XA 4AIMA 1LTSD 4HIOA 1OXUA 3ICEA 1TS3A 3I55A 2NVTH 1U4LA 2RHQB 1DONA 4GOPA 1IBKL 2DY8A 4G57A 3VYUA 2JA5H 1K8GA 2FJ2A 2NN6G 2PZTA 3A8JE 4WJWA 2ZJQA 1F2MA 3EFXD 1C48A 3F2UA 3AU7A 1OXTA 1P8LA 1CI3M
chains in the Genus database with same CATH topology
3FRPB 4X3KA 1ENAA 4BBSB 2NVXB 2NBFA 2N88A 5M5WB 2F0TA 3KBXA 1BCPC 2FFKB 3SK5A 3OIPA 4MHEA 2DNEA 1EZ6A 3TP8A 2JEAI 1PLFA 1X3QA 1Y1WB 4KY7A 3R2IA 2B39A 1AP0A 1D5ZC 1U4MA 2MUYA 1CQVA 3TMEA 1F9SA 1SJHD 3HOXB 1W6KA 3J81E 3OWEB 1G6ZA 1TKWB 2F0NA 5FO9B 3PMFA 3P20A 5F2DA 3DWQA 1OO9B 1AFPA 3S2HB 1S5ED 1JQYD 1SE3A 3I90A 1V1OA 4C56C 4FO2A 4RA8A 5EQ0A 1Y8PB 5IT9L 2V4DA 1F2LA 1H9SB 2RDFA 4BBRB 3I91A 3X3MA 4C3JB 5ISRA 5C0XH 4QIWB 2EY6A 2D5DA 1WTXA 1KAAA 3J80E 1F9RA 3TP5A 2AQ1B 3ND8A 4LMQD 3NBHA 2DNCA 3E0JA 1AW7A 2JA8B 2PZUA 1KTKA 2IW3A 1IL8A 2MGSA 3OSOA 4HCEA 1EQTA 3VYSA 1PFNA 2A69D 3KF8A 1RDPD 3NQIA 4OO1H 3ZYYX 1WVLA 5CGKA 2M2LA 4XYOA 1QG7A 5JVH3 2D9UA 2KCNA 5ELDA 4DF7A 2MPMA 4KHZA 2QDBA 2X6LA 4DA2A 1IW7D 3QIAA 4IALA 1TT2A 3M4YA 4EGVA 2KEEA 5JEAG 2L4NA 5KRUA 3KUPA 3HRZC 1ENFA 3MFYA 1TWHB 1J9OA 4OL7A 3D3RA 5KGUA 1SXTA 3PUYA 2L55A 4X3TA 2K04A 2R6GA 3SK4A 2WKCA 1IW7C 4S3SA 3NWSA 4QB4A 2Q8TA 4DK0A 1HTPA 1M8AA 1QNKA 3MEHA 1CQFA 2SNMA 2XNAC 4B08A 4C3HG 5ELFA 2F03A 3CRLC 3AU7A 1C8CA 1AN8A 3MXGA 5C4ZA 4H0LC 1CZWA 3MVVA 3VYRA 4IUQA 3U9OA 3I72A 2JXMB 1VF5C 1DD2A 3SK6A 2F0OA 3LWUA 1DM0B 3JAML 3AMUA 2XIWA 1ET9A 2OF1A 2Z8LA 4R8IA 1HA5A 1CHPD 3BDCA 2JEBI 5IGFA 2TSSA 1JR0D 1GHKA 3CKIB 3BVZA 3IFTA 2F0GA 1V8QA 1XXGA 1LACA 1HHVA 2C9OA 3NTHA 2OXPA 3A56A 1LTGD 5EPKA 3J7AV 4FP5D 1G8ZD 2EYJA 1FNUA 3W3AA 2EY5A 2EY1A 5D65A 1STNA 1SDFA 3FMCA 1A3UA 3O13A 1I3QB 5CV8A 5J39A 3KLSA 5EBCA 2E2DC 2FINB 2NN6H 2Z1CA 3DXJC 5FO8B 4CKEA 2ID0A 2E2JB 1PTOH 5IGEA 3S16B 3M7GA 4G7OC 2BE5C 2Q8IB 1TY2A 1BUVT 4IZ8A 3OIQA 4MN3A 3TP6A 2IX0A 3DHQA 1I6HB 2X69A 1D1KA 2NWGA 3T4AC 4DAVA 2I46A 2KQ3A 2WV6D 4IUNA 5EKKA 1XX8A 1LTID 1NCVA 2F0EA 5JOBA 4PQXA 1LTRD 2PYKA 3W2DA 2K28A 1DXMA 2QILA 4IUTA 5DM63 1EWCA 2RKSA 5FLXL 1D2BA 1DCZA 1UUPA 1IHZA 2A68C 2RDGA 1I4HA 1O78A 3GTQB 4DXGA 1JB3A 3PUWA 3RZOB 3R8BA 1KDBA 4KJNA 2JA6B 1Z6HA 3R3OA 1OXSC 3HOYB 3OOCA 5CR3A 2WP8J 1S5BD 3RLFA 4A3EB 3QOJA 1PRTB 1U4PA 4NW2A 1EY4A 4QF4A 5CV9A 1JICA 1VMPA 1D5MC 3TP7A 3V2TA 3WOEA 1DZ1A 5ELEA 2KECA 3GTMB 2Z4HA 3GTLB 1GHJA 1JWUD 1GUNA 1ZXTA 1MD2D 5EKIA 1S5FD 5KYIA 2NTTA 1G91A 4ZKCB 4KI0A 5KEEA 5C4HA 3NUCA 1SSOA 3K5OA 2F0DA 1BOSA 1Y69U 3I70A 3H94A 1IKLA 2XN9C 2F0VA 5ELCA 5M5YB 1HRJA 4ZK9B 5JPNC 1XYIA 2M9VA 1BCPF 1XWEA 1MSHA 3OW7A 1STBA 1Y1VB 5FLXE 5JEAH 2LY7A 1FR3A 4A3GB 4XTCS 1BO0A 3ND9A 3M85A 3D8GA 4N9PA 4U673 3DEOA 2K7VA 1R4PB 2WAQB 2JP1A 1OXXK 3MXPA 1TIID 1VMCA 3HGBA 1NAPA 3NXWA 2FMMA 3R93A 5D3DA 3L3OC 3QB3A 5EBDA 1ICWA 5EPLA 3HOWB 2BDNA 3GTGB 2ZXOA 5I2YA 1KLUD 3C46A 3A7LA 2AWNA 2K05A 1TWGB 2G9HD 2VUMB 2X6GA 2NYZD 1XTCD 2BDOA 3D4RA 3PO3B 1HQMC 3PIP3 1FNVA 4HMIA 1TWFB 1NR4A 1R9TB 1TY0A 1G2SA 1ET6A 3RMHA 4ZYSA 2ICEC 2H4OA 1G2TA 2MHVA 4LJZC 3P75A 4XQQA 2B63B 5T1IA 4FXKC 4ME5A 2EXZA 4KN7C 1TS4A 2EYOA 3D6CA 4RCOA 1L0YB 4KJOA 3HKZB 4KKTA 1ZYRD 2F3VA 1A6XA 2K03A 2O5JC 1LTTD 3HP3A 5LL6S 4FXGC 3PO2B 4C2MB 1EFID 2BA0A 3BVMA 4RAUC 1NUCA 1BNZA 4RHSA 4PV1C 3BG3A 2PNRC 2F1MA 3HOZB 2B2UC 3BVGA 5E1FA 4B9XA 1Q90A 2KA7A 2EDGA 3OMGA 5CBEE 3C1FA 2F0PA 1BCPB 1SYGA 1ZYRC 2LS01 1TVXA 1GOZA 3TSSA 2QF7A 1QCBD 3PUXA 1T5XD 5C5MA 2J4XA 5C44B 4IN3A 2B2TC 3V96A 1X32A 4TSSA 1K8OA 1SYDA 2EOTA 1MSGA 4U68A 1WD1A 2RVLA 2RQXA 3BYYB 2PW5A 3C1EA 3MC0B 3A8IE 3D4DA 4FF3A 1WTWA 2NVYB 1KABA 3FVQA 4WFN3 4A3JB 3D4WA 1AZQA 1D1IA 4K14A 5FOBB 5DAUA 4C3HB 3NSWA 4KK7A 3FPPA 3FKIB 4FXDA 1LT6D 3EROA 2F4IA 4R8NA 4ID6A 2DY7A 1EY7A 1PFMA 3GTOB 4IFDI 2VXWA 1SE2A 4KD3A 3BYTB 3QOLA 1A3TA 4DNTB 2HCIA 4HSVA 2EPBA 1RTOA 1SNDA 1Y8OB 1IKMA 1JOOA 3BDLA 1HA6A 2NZ1D 1SMYD 3A8KE 1QWYA 1KLGD 5C3XA 1CK1A 1QE6A 3GO5A 1KNEA 2E76C 4ZUIA 3TBIB 3VA5A 2K32A 4I65A 5EJWA 2A73B 3GD7A 1EEFD 4G7HC 5I6WA 1Z47A 1EZ8A 2EJFC 4J1MA 1HTLD 3LX0A 4XQJA 4K5XA 2R92B 4A3IB 1BBXC 1SJED 1SMYC 1EU4A 2K5WA 4YIJA 4TQUS 3K5NA 3KLSX 1EL0A 1NR2A 2IL8A 3EQLC 1U4RA 3NBIA 1V1PA 5E3FA 2A69C 2BA1A 4ULLA 3EVQA 4NDXA 2A6ED 1IYUA 5IT9E 2ZXPA 2RDHA 1O7LA 2XVSA 1BXTA 3Q0AA 3CU7A 4A3KB 1ZEQX 5BN3A 2B2UA 3ONAB 4RKBA 2CW0D 1R4QB 3KK7A 3QO2A 2PMZB 3S1NB 2D62A 3VR2A 1GUGA 2O5IC 2MP1A 2IX3A 3MHBA 4R9WA 2PO4A 4DGZA 3H6MA 4C1NI 2PZWA 5KNCA 2K01A 1AZPA 2B2TA 5KIXA 1QNUA 3K6OA 2M00A 3V05A 4ZUJA 2HDLA 3H09A 1MGSA 4CJ1B 1EY6A 2LKVA 2IPKD 4HCSA 2F0JA 2E2HB 5C0XI 1S4ZA 1EIHA 1SBBB 3HOUB 3N52A 5JPMC 4HEDA 3H0GB 1F2ZA 1DOMA 3PV0A 2R61A 1G291 1ILPA 1SNOA 1DOLA 1WTRA 2F3WA 4ILWA 2F0KA 1L0XB 2KJXA 2KCCA 1LLRD 1B3AA 4OO1I 2A5HA 3DUZA 2B2VA 2LMCB 4DXFA 5IIFA 4XIGS 1TWAB 4XT1B 2EJMA 4G7ZC 3OPOA 3Q6SA 1H9SA 3P1HA 3GTPB 1JORA 2K33A 2LFNA 1HFGA 5I9PA 1JWMD 1DJRD 2EVBA 2BCOA 4TKOB 1JOKA 3MFGA 4EQPA 5DM73 3NE5B 4IUVA 2R3ZA 1VDZA 3WOFA 1WTPA 2F0QA 3A55A 1PZJD 2C5CA 4IUUA 1B44D 2N55A 5KNDA 2IWHA 3JAME 1ESRA 3T13A 3P7JA 4L63B 2L0CA 3KLRA 5M5XB 5BN4A 3NK9A 1V43A 3VR6A 3E6ZX 3MTSA 1TR5A 5E4XA 3HEJA 3I4LA 3NP8A 4MIUA 4H7BA 1QILA 5CV6A 2WIIB 1EIGA 3HS0C 4JBWA 4DNRB 2FMCA 4LK1C 1PRTD 2MJ8A 4IFDJ 4V190 1Z7TA 2AQ2B 4QUFA 2JA7B 1T5EA 1STAA 1I6VC 5EKLA 1Q1BA 2JSOA 4A3DB 1RD9D 4G4KA 4CGYB 2NB0A 1E2ZA 5A2QL 3QWNA 4XDXA 5M3MB 1I4GA 3IFDA 4BS9A 4UAIA 3H91A 2A6HD 2VB3X 3LWEA 2WKDA 2OEOA 3SR1A 4IQZA 1FNWA 4Y7NB 1C4QA 2ZXRA 2WINB 5HURA 1KNAA 4CBVA 3DMUA 5CORA 2EY2A 5AFWA 2CVRA 1O80A 2HDMA 5E4WC 4K5WA 1PTOD 4F87A 2NN6I 2PW7A 4KY6A 4DU9A 4LAAA 3S2DB 2A6HC 1B4OA 4UDUC 2HUGA 1HUMA 2J0TD 4O42A 2KUMA 1MBYA 4DFAA 1J8IA 1LV9A 1CTMA 5NUCA 4XYQA 4PNYA 2DN8A 1OXTA 3EJIA 2QKIC 4DN4M 4HTHA 4ZRZA 1EWHA 1KDCA 3DM1A 1PTOC 1GUTA 1JE4A 4ZAIA 3CRKC 5M9OA 4KTAA 3I8ZA 1ILQA 1SYFA 2SDFA 5A2QE 2YYZA 4KKSA 3SVMA 2CQAA 5I4DA 4I7ZC 3BDOA 3FEWX 4K8IA 4C3IB 2D2CC 2EZVA 3N6RA 1Q1EA 4P2CB 3S15B 1EOTA 3GQBA 1ENCA 3J7AF 4KHVA 3I3CA 4HR7B 5CMDA 1A2UA 3GTJB 3S1QB 4EVOA 1SEBD 4DAYA 1I4RA 3L9AX 5C0XJ 2KOLA 2ENBA 1UEAB 4ZLTF 2B2WC 5J22A 2H1EA 5D3IB 3VA7A 3ITPA 5D14A 1VF7A 1EYAA 1K83B 1EQVA 1U9RA 2YU9B 3M4OB 1SFOB 1S5DD 1UAPA 3U9SA 1V1PB 1AEXA 4ODGA 3GTKB 2SEBD 3G7LA 5KNBA 2RSOA 1M4VA 1WCMB 1CFMA 3NQTA 3MXUA 4RGTA 3FDTA 1SYCA 4C1NK 2RA4A 5IGGA 4CJ2C 3NWTA 3QG1A 2F0LA 1O7ZA 2WACA 1B9NA 1RKNA 3MAQA 1B9MA 2J7ZA 3K59A 4RWSC 5M3FB 5G3LD 3NTKA 1VCIA 1WTVA 1BDOA 1ESFA 3GV6A 4FYDA 3J80L 1JOQA 1E0BA 1A2TA 3DEPA 3OMCA 1TQOA 4EQOA 4WORA 2R93B 2XWJB 2EE1A 2JE6I 4ABNA 1STGA 4CHTB 5CYUA 4C3IG 2PQEA 3TZUA 2NVQB 4PMCA 1FD7D 2EYMA 3L7ZC 2NUCA 1HFNA 1WTQA 4J6HA 1GJXA 4OGQC 4FF4A 1EEID 3S9WA 5CBAE 3C3LA 1SNQA 4X3UA 3TN2A 5A35A 4A3FB 1GUOA 1TWCB 3TDQA 3S14B 2WB1B 3NTIA 1WTOA 2F0SA 4JK1C 1SYEA 3AB9A 1A15A 4RGMA 1RCVD 2L1BA 2B2VC 2L12A 4X3SA 3MXNA 1LTAD 2BOSA 3MZ5A 3R2TA 2QCPX 1DOKA 2O4XA 1S5CD 2A74C 2R7ZB 2IX1A 1SNCA 1H9MA 2F0IA 2XSCA 1CZGA 2IJ0A 1HCZA 5CC4A 3FPUB 5EPJA 4RKLA 3TZDA 4F7XA 1EY5A 1STHA 1FGBD 4WRDA 4RHRA 1D6EC 4QUCA 4RGOS 2ZT9C 4AYBB 1STYA 3H3VC 4RGNA 2B2YA 4NKLA 3WDNA 1QJOA 2E74C 1QOHA 3IKJA 5C4XB 2AWOA 4K6LA 5CV7A 1HPCA 5I9OA 2B2WA 2OT2A 4K2LA 3SEBA 2F0MA 1TU2B 2NVTB 3CHBD 3OWFA 2K5QA 5J1ZA 3T51B 1GUWA 2JA5B 2QEJC 1YNND 1H9KA 1ML0D 2RBMA 5IODA 4Q0FA 3MA2B 2XRQD 1PMRA 3D31A 1Q8IA 4BA1I 3PIO3 1BF4A 2K6AA 3SXHA 2F0HA 4M8AA 4OIJA 5FK9C 1I4PA 1PYWD 1Y8NB 4A3BB 2EYLA 2HCCA 2VNUD 1NSNS 4FF2A 4GZYC 3M7NA 3C2PA 1F77A 1D5XC 1YNNC 4HAEA 4QMGA 4L8JA 1LO5D 3PUZA 5K36G 2AQ3B 4E6IA 1ZKOA 5CV4A 1HQRD 2A6EC 4Q5VA 4F8MA 1K8MA 1F2YA 1B50A 1H9JA 1YNJD 1KDAA 1II3A 1Q3LA 5C3EB 1JWSD 2CW0C 3VYTA 4EQNA 4NP5A 4PMBA 3Q23A 2O2LD 5C4JB 5C5LA 3IL8A 2F0WA 4FVMA 4IFDG 1LTBD 4ZKBB 3I73A 5JJZA 1HUNA 4BWGB 4C3JG 1GUSA 3D6WA 4QCLA 2XRSD 5FKAC 3M3YB 2HQEA 2L5TA 1PRTF 1EYDA 1YNJC 1SNMA 3A7AB 4K8JA 5JAVA 1RJTA 2B8FA 4IURA 3EA6A 4OHJA 3GP7A 5LL6X 1A3VA 4RCNA 3SK8A 1EY9A 1E2VA 4O1NA 4H44C 4NMZA 5IGDA 2BE5D 3G6JB 4FNFA 2K1BA 4KD4A 2SOBA 3UI2A 1Q12A 5JEAJ 4L6TB 3NHHA 4FF1A 3K57A 2ICIA 4CJ0B 1CM9A 3HOVB 2EJGC 2G9DA 5CV5A 2KVMA 1LT4D 3T53B 1QB5D 3K0YA 1H9RA 1LT3D 1SE4A 2AUJD 1B1ZA 1PTOF 2VB2X 3VR5A 3KBGA 2RSNA 2JYOA 1F9QA 2A68D 1PZID 4A3MB 1OXVA 2EYFA 5IGCA 5C3WA 1SAPA 1EYCA 2K5DA 3PUVA 4J8QA 1CHQD 1B53A 3Q24A 4BY1B 3DWPA 2GA4B 3MWYW 3NPPA 4XXEA 1PDQA 3E5SA 3I4MB 5DNFA 5KYLA 1EY8A 3URYA 3HZXA 3ERQA 3Q22A 1JC7A 4IUPA 1CT1D 1PXUA 3K5MA 4DAPA 1SYBA 1EU3A 1RF2D 1W6JA 4XQNA 4BY7B 2B8GA 3SHLA 5C0XG 1PRTC 5I6YA 1TS2A 3HG9A 3S17B 1I4QA 5FO7B 1SNPA 1RTNA 5EGTA 1LT5D 1PFBA 4HSPA 5K5PA 4ZQ3A 3VR3A 1I50B 4CKBA 3CQZB 5C6AA 5LHY1 3RUZA 2EYPA 5TSSA 4OO1G 3T16A 3I4NB 2F0FA 1JCKB 2L11A 2L9HA 1BR9A 1RHPA 1STEA 2KHSA 3SE0A 3QJYA 4H13C 1PZKD 3GV3A 5HGTA 1GXDC 1O7YA 4KV6A 3T56B 4CKCA 1RODA 1PTOB 5IGBA 3BS1A 3S1MB 5DEHA 1ONLA 2XWBB 1F9PA 1E2WA 4F88A 1DYQA 1EY0A 1X3PA 2CHBD 4BA2I 1UNSA 3LNNA 1TS5A 5G3LF 1B2TA 4TRDA 2Z4IA 1FYCA 4RH6A 1IYVA 3K5LA 2F0UA 2PPBC 4HN7A 4XT3B 4HMJA 4KMUC 2PCFB 5K36H 5IOCA 1CA6A 3K58A 4KKUA 3S1RB 2B2YC 4N9TA 4A93B 4RFBA 4DK1A 3J7YW 5T1GA 3IAYA 1CA5A 3BZDB 5ELBA 1LABA 5BN5A 5I2XA 2FHTA 3A54A 4B9WA 4V0BA 2NTSA 2SNSA 4OIKA 2I07B 4KN4C 4K5VA 2EYHA 4IFDH 2Q8RE 3J81L 3SDZA 2TMPA 4M1UB 2E75C 2KEDA 3VR4A 3RZDB 2IT1A 3K7AB 1WD0A 4Z9CB 2Y0SB 1BQQT 3RD4A 4K2KA 2AUKA 1BCPD 2E2IB 3OHXC 4PMWA 3DWAA 1HXYD 5COYA 3X3NA 5JVG3 1MI2A 1I4XA 1LTSD 1OXUA 1TS3A 1U4LA 1DONA 2DY8A 4G57A 3VYUA 2FJ2A 2NN6G 2PZTA 3A8JE 4WJWA 1F2MA 3EFXD 1C48A 3F2UA 4K6DA 4KY5A 1CI3M
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IKL A;  1GUW A;  4X3K A;  2DY7 A;  1F9R A;  1RJT A;  2B2U A;  3ONA B;  2NWG A;  5CMD A;  1HFG A;  4IUR A;  1HRJ A;  1PFM A;  2N88 A;  4ZK9 B;  1XYI A;  2VXW A;  3QO2 A;  1ML0 D;  4LMQ D;  1KNA A;  2K03 A;  1XX8 A;  3KBX A;  4IUP A;  2FFK B;  2KOL A;  1B2T A;  1MSH A;  5COR A;  4ZLT F;  3HP3 A;  1NCV A;  2B2W C;  4MHE A;  5AFW A;  1BF4 A;  2XIW A;  4XT3 B;  2H1E A;  2CVR A;  1O80 A;  1HFN A;  2K28 A;  2HDM A;  1IL8 A;  2MGS A;  5E4W C;  1WTQ A;  2MP1 A;  4IUV A;  2R3Z A;  4RAU C;  1EQT A;  2HCI A;  4IUT A;  5D14 A;  4R8I A;  1CA6 A;  1BNZ A;  1WTP A;  1PLF A;  1PFN A;  4HSV A;  2K1B A;  5CBA E;  4OIJ A;  4X3U A;  4R9W A;  2EPB A;  3TN2 A;  1X3Q A;  1WVL A;  3UI2 A;  4IUU A;  2B2Y C;  2B2U C;  2N55 A;  2M2L A;  1BO0 A;  1RTO A;  2HCC A;  1QG7 A;  5T1G A;  1B4O A;  2D9U A;  1IKM A;  2HUG A;  1WTO A;  1CA5 A;  1HUM A;  1ESR A;  3P7J A;  2K01 A;  3DEO A;  1AZP A;  2MPM A;  1AP0 A;  1RTN A;  1HHV A;  2B2T A;  4O42 A;  1A15 A;  1U4M A;  2KUM A;  2FHT A;  2NZ1 D;  1J8I A;  1LV9 A;  5CBE E;  4CJ0 B;  1HA6 A;  2L1B A;  2B2V C;  2L12 A;  2X6L A;  4X3S A;  4OIK A;  1PFB A;  1F9S A;  1CM9 A;  2JP1 A;  4HAE A;  1VMC A;  1QE6 A;  1NAP A;  1KNE A;  2HDL A;  1DOK A;  1MGS A;  2KVM A;  2KEE A;  4CJ1 B;  3G7L A;  4DN4 M;  3MTS A;  1TVX A;  5EPK A;  1G6Z A;  4HCS A;  2L4N A;  2FMM A;  2RSO A;  3KUP A;  5EJW A;  5E4X A;  3R93 A;  1S4Z A;  3FDT A;  1EIH A;  2Q8R E;  3N52 A;  3DM1 A;  4HED A;  2RA4 A;  1JE4 A;  1ICW A;  5D65 A;  1U4P A;  1J9O A;  4NW2 A;  5EPL A;  4ZAI A;  1SDF A;  4CJ2 C;  1DOM A;  1O7Z A;  1EIG A;  2BDN A;  1B50 A;  2B2T C;  2KED A;  3FPU B;  5EPJ A;  2RSN A;  3TZD A;  1ILP A;  2L11 A;  1X32 A;  2L9H A;  1JIC A;  1VMP A;  1F9Q A;  2JYO A;  3I90 A;  1Q3L A;  1DOL A;  3I8Z A;  2FIN B;  4X3T A;  1WTR A;  2K05 A;  1DZ1 A;  2EOT A;  2KEC A;  2MJ8 A;  1WD0 A;  4QUF A;  1ILQ A;  2K04 A;  1MSG A;  4QUC A;  1RHP A;  2J7Z A;  4U68 A;  4RA8 A;  2X6G A;  2NYZ D;  5EQ0 A;  1BBX C;  4RWS C;  1WD1 A;  2SDF A;  2RVL A;  3GV3 A;  2Q8T A;  1ZXT A;  1SAP A;  2B2Y A;  1M8A A;  1QNK A;  5EKI A;  1WTV A;  1F2L A;  3SVM A;  1O7Y A;  3GV6 A;  3IL8 A;  1B3A A;  1B53 A;  1G91 A;  5COY A;  1WTW A;  1NR4 A;  4ZKC B;  1EL0 A;  1G2S A;  1NR2 A;  1MI2 A;  1ROD A;  2IL8 A;  1U4R A;  4ZKB B;  1AZQ A;  2B2V A;  5JJZ A;  1HUN A;  2B2W A;  3MWY W;  4XDX A;  3I91 A;  1E0B A;  1U4L A;  1PDQ A;  3D6W A;  1DON A;  3DEP A;  3IFD A;  1G2T A;  1SSO A;  5DNF A;  4MN3 A;  4UAI A;  1F9P A;  2DY8 A;  4XT1 B;  3H91 A;  1C8C A;  1EOT A;  5T1I A;  3LWE A;  2FJ2 A;  3F2U A;  1X3P A;  2EE1 A;  2X69 A;  1WTX A;  3Q6S A;  4IUQ A;  3I3C A; 
#chains in the Genus database with same CATH topology
 3FRP B;  4X3K A;  1ENA A;  1LUZ A;  4BBS B;  4YHH L;  2NBF A;  2NVX B;  2N88 A;  5M5W B;  2F0T A;  4X6A H;  3KBX A;  1Y1V G;  1BCP C;  3A74 A;  2FFK B;  3SK5 A;  4DK6 C;  3OIP A;  1PHJ A;  2E5L Q;  4RMF A;  4MHE A;  2DNE A;  2K5V A;  1WFQ A;  1EZ6 A;  3WWV A;  3TP8 A;  4JI2 L;  4A3B H;  1RIP A;  1JT8 A;  2JEA I;  1PLF A;  3CC4 A;  1K8A C;  4LF9 L;  1X3Q A;  3DLL A;  1AE3 A;  1QUQ A;  2RF4 A;  1Y1W B;  4KY7 A;  3R2I A;  1VQN A;  2B39 A;  1AP0 A;  4GNX A;  1D5Z C;  1U4M A;  2WAQ G;  2MUY A;  1CQV A;  3TME A;  1F9S A;  1SJH D;  4R4O A;  2ZTE A;  1L1O C;  3CME A;  3HOX B;  1A63 A;  2GN5 A;  1W6K A;  3W5O A;  3J81 E;  3OWE B;  4CDF C;  1G6Z A;  1C0A A;  1TKW B;  5JJI A;  3CCJ A;  2F0N A;  3STB D;  5FO9 B;  3PMF A;  3P20 A;  5F2D A;  3DWQ A;  5E7N A;  3JAM c;  4OWT B;  1I94 Q;  2E5L L;  1OO9 B;  5C3E H;  1AFP A;  1K73 C;  1PH3 A;  3S2H B;  4A76 A;  1S5E D;  1JQY D;  1SE3 A;  3I90 A;  4P73 A;  4ZCK A;  1V1O A;  2VUM G;  4C56 C;  4FO2 A;  4RA8 A;  5EQ0 A;  5C4J H;  4PZ8 A;  1Y8P B;  5IT9 L;  2V4D A;  1F2L A;  4JVZ A;  2ZJP A;  1H9S B;  1SE8 A;  2RDF A;  4BBR B;  2R7D A;  1EIY B;  3STB C;  4OEM B;  3M3Y H;  3I91 A;  3X3M A;  1VQB A;  4K6D A;  4C3J B;  5ISR A;  1SLJ A;  2V1C C;  5C0X H;  4QIW B;  2EY6 A;  2D5D A;  1WTX A;  1KAA A;  3J80 E;  1BVS A;  1F9R A;  3TP5 A;  2AQ1 B;  4I7A A;  5BR8 Q;  3ND8 A;  3F8T A;  4LMQ D;  4JC0 A;  3NBH A;  3PF4 A;  1YIJ A;  3PO2 G;  2DNC A;  3E0J A;  1AW7 A;  1HNX Q;  2PZU A;  2JA8 B;  1KTK A;  1UE6 A;  3NEN A;  3J81 i;  2Y0S E;  2IW3 A;  1IL8 A;  2MGS A;  3OSO A;  4N8X 1;  1JJ2 A;  4HCE A;  1EQT A;  4B3M Q;  3VYS A;  1PFN A;  4NPS A;  3HOZ G;  2A69 D;  3KF8 A;  1RDP D;  3NQI A;  4OO1 H;  3ZYY X;  1WVL A;  3KF6 B;  5CGK A;  2M2L A;  4XYO A;  1QG7 A;  5JVH 3;  2OCE A;  2D9U A;  2KCN A;  5ELD A;  5LMU Q;  4DF7 A;  2LXJ A;  3HOV H;  2MPM A;  3DM3 A;  4KHZ A;  2QDB A;  4DV4 Q;  1CKO A;  1CKN B;  2X6L A;  4DA2 A;  1IW7 D;  3KYH C;  3QIA A;  1VQL A;  4IAL A;  1TT2 A;  3M4Y A;  4EGV A;  2KEE A;  5JEA G;  3S16 H;  2L4N A;  5KRU A;  4YY3 L;  3KUP A;  5BR8 L;  3HRZ C;  4X64 Q;  4DV0 Q;  2KCT A;  5C44 G;  1ENF A;  1WYD A;  1L0W A;  3CCL A;  2CWP A;  1HNX L;  5IYC H;  4DV1 L;  3MFY A;  1TWH B;  1ASZ A;  1J9O A;  4OL7 A;  3D3R A;  5KGU A;  1SXT A;  4A3M H;  1VQF A;  4B3M L;  1I6H H;  1HR0 Q;  3PUY A;  2L55 A;  4X3T A;  2K04 A;  2R6G A;  2YV5 A;  3J80 i;  3RNU A;  3SK4 A;  3CF5 A;  2WKC A;  1IW7 C;  2HD3 A;  3NWS A;  4QB4 A;  4S3S A;  2Q8T A;  1HTP A;  4DK0 A;  4BY1 H;  1M8A A;  1QNK A;  3TRE A;  3RLO A;  3MEH A;  4DV4 L;  1CQF A;  3PCO B;  2SNM A;  2ASB A;  3I4M H;  4X62 Q;  2XNA C;  4B08 A;  2B3G A;  4C3H G;  1Q7Y C;  5ELF A;  2PNH A;  2F03 A;  3CRL C;  3FKI G;  1C8C A;  4X64 L;  1AN8 A;  3MXG A;  5C4Z A;  4DV0 L;  1KD1 C;  4H0L C;  1CZW A;  3MVV A;  3VYR A;  3I4O A;  1GKH A;  4IUQ A;  3U9O A;  3RZO H;  1V9P A;  3KFU A;  2WB1 E;  3I72 A;  2NZO A;  4B3T Q;  4GKJ Q;  2JXM B;  1HR0 L;  4BBR G;  1VF5 C;  1DD2 A;  3SK6 A;  2F0O A;  2K14 A;  2NZH A;  3LWU A;  1DM0 B;  4X66 Q;  1VQ7 A;  3JAM L;  4BY7 H;  3AMU A;  2RCN A;  2XIW A;  1L1O A;  1ET9 A;  2OF1 A;  2Z8L A;  1PFS A;  4R8I A;  1HA5 A;  1CHP D;  3BDC A;  3S17 H;  2JEB I;  1YZ6 A;  5IGF A;  2TSS A;  1JR0 D;  3E3X A;  3CKI B;  1GHK A;  4X62 L;  3BVZ A;  3IFT A;  2F0G A;  2ES2 A;  2F52 A;  1V8Q A;  2XTI A;  1XXG A;  1LAC A;  1HHV A;  4OXP A;  2JA8 G;  2C9O A;  1HNW Q;  3NTH A;  1I50 H;  2OXP A;  3I7F A;  1XJV A;  2UUB Q;  3AFQ A;  4QIW E;  3CQZ H;  3A56 A;  1VQE A;  1LTG D;  4R4Q A;  4B3T L;  5EPK A;  4GKJ L;  3J7A V;  3I4N H;  4FP5 D;  1G8Z D;  1E1T A;  2EYJ A;  1FNU A;  3W3A A;  2EY5 A;  2EY1 A;  4X66 L;  4QY7 A;  5D65 A;  1STN A;  4JI1 Q;  1SDF A;  3FMC A;  1A3U A;  3ULP A;  3O13 A;  1I3Q B;  5CV8 A;  5J39 A;  3GDE A;  3KLS A;  4HIK A;  5EBC A;  2E2D C;  2FIN B;  2NN6 H;  1MIU A;  3CC2 A;  5GQO A;  2DUD A;  2N8N A;  2Z1C A;  3ULL A;  3DXJ C;  5FO8 B;  4IJH A;  4CKE A;  2PI2 E;  2ID0 A;  1AH9 A;  2E2J B;  1PTO H;  5IGE A;  3D0F A;  3S1M H;  1HNW L;  3S16 B;  3M7G A;  1GO3 E;  1MHW C;  4G7O C;  5AJ3 L;  2UUB L;  2BE5 C;  2Q8I B;  1TY2 A;  1BUV T;  3EBE A;  4IZ8 A;  3SGI A;  3OIQ A;  4DAY B;  4MN3 A;  1K9M C;  3TP6 A;  2IX0 A;  3DHQ A;  4L5T A;  1T9H A;  1I6H B;  1YIT A;  2X69 A;  1D1K A;  2CH4 A;  4JI1 L;  2NWG A;  3T4A C;  4DAV A;  2I46 A;  2KQ3 A;  1YHA A;  2WV6 D;  4IUN A;  1XMQ L;  5EKK A;  3ER0 A;  3JC6 6;  1XX8 A;  1LTI D;  1X3E A;  2K4K A;  1NCV A;  2EXD A;  2F0E A;  5JOB A;  4PQX A;  2OQ0 A;  1LTR D;  2PYK A;  1S3O A;  3W2D A;  2K28 A;  1DXM A;  2QIL A;  3S1R H;  4IUT A;  4UHV A;  5DM6 3;  1EWC A;  2RKS A;  4A93 H;  5FLX L;  1D2B A;  1DCZ A;  1UUP A;  1IHZ A;  4NB3 A;  2A68 C;  2UUA Q;  4UP8 A;  2RDG A;  1I4H A;  1O78 A;  3GTQ B;  4DXG A;  1K0S A;  2QGQ A;  3AQQ A;  1JB3 A;  3PUW A;  3RZO B;  3LGJ A;  3R8B A;  1KDB A;  4KJN A;  2JA6 B;  1Z6H A;  3R3O A;  4GOP C;  1KIX A;  1OXS C;  3HOY B;  2D0O A;  3PQI A;  3OOC A;  5CR3 A;  4DR1 Q;  2WP8 J;  2Q2T A;  2UUC Q;  3HOU G;  1S5B D;  3RLF A;  4A3E B;  4B3R Q;  3H0G G;  1UWV A;  3QOJ A;  2VQF Q;  5GAG C;  4P75 A;  1PRT B;  1U4P A;  4NW2 A;  3RZD H;  3U4Z A;  3K7A H;  1EY4 A;  4QF4 A;  1B7Y B;  4LUO A;  4LFC L;  5CV9 A;  1JIC A;  1VMP A;  1D5M C;  3TP7 A;  3V2T A;  3WOE A;  1DZ1 A;  5ELE A;  2KEC A;  3GTM B;  2Z4H A;  2UUA L;  3GTL B;  1GHJ A;  1DGS A;  1VQ5 A;  1JWU D;  1GUN A;  1ZXT A;  3TS0 A;  1MD2 D;  5EKI A;  1S5F D;  5KYI A;  4GN3 B;  2NTT A;  1PYS B;  3PO2 H;  1G91 A;  4ZKC B;  1LYL A;  4KI0 A;  5KEE A;  5ELN A;  5C4H A;  4UP9 A;  4DR1 L;  2HIV A;  2HT1 A;  3NUC A;  1SSO A;  4GNX B;  2UUC L;  3K5O A;  2F0D A;  1BOS A;  4JI5 Q;  1Y69 U;  4BBS H;  4B3R L;  5M5W H;  3I70 A;  2VQF L;  2I5M X;  3H94 A;  2GVB A;  3A5U A;  1IKL A;  4OEL B;  4HJ9 A;  2XN9 C;  3M4P A;  2F0V A;  4OX9 Q;  2K5H A;  5ELC A;  2QEX A;  5IP9 G;  5M5Y B;  1HRJ A;  3KDF B;  1I5F A;  4ZK9 B;  5JPN C;  3CC7 A;  3RN5 A;  1XYI A;  2M9V A;  4DR5 Q;  1VQ8 A;  1BCP F;  1XWE A;  4DUY Q;  1N34 Q;  1MSH A;  3OW7 A;  1STB A;  4FDB A;  1Y1V B;  1M90 C;  5FLX E;  5JEA H;  2LY7 A;  1Y1W H;  3MXN B;  1FR3 A;  2ALY B;  4XTC S;  2UU9 Q;  1VQC A;  4A3G B;  1BO0 A;  3ND9 A;  1AE2 A;  3M85 A;  3D8G A;  4N9P A;  1YI2 A;  3I56 A;  4U67 3;  2CCZ A;  3DEO A;  3CCV A;  2K7V A;  1R4P B;  4DR6 Q;  2WAQ B;  2JP1 A;  4GLA C;  4LFA Q;  1OXX K;  4LFB Q;  3MXP A;  1TII D;  1VMC A;  1N32 Q;  3HGB A;  1NAP A;  5IYD G;  4OX9 L;  3NXW A;  3G48 A;  2FMM A;  3R93 A;  1K3B C;  5D3D A;  4DR5 L;  4DUY L;  3L3O C;  3S2H H;  3QB3 A;  5EBD A;  4C3H H;  1ICW A;  5EPL A;  2UXC Q;  3FKI H;  3HOW B;  2BDN A;  3GTG B;  3A5Z B;  2ZXO A;  5I2Y A;  1KLU D;  4GN4 B;  1V1Q A;  3C46 A;  2JA6 G;  2LSS A;  3A7L A;  3NBH B;  3K8A A;  2AWN A;  1Q8K A;  2K05 A;  3HFZ B;  1TWG B;  3H15 A;  2G9H D;  2VUM B;  2X6G A;  2NYZ D;  2UU9 L;  1XTC D;  2YTX A;  2BDO A;  3D4R A;  3PO3 B;  1HQM C;  3PIP 3;  2D0P A;  4A3E G;  1FNV A;  4BBR H;  4A3D G;  3PF5 A;  4JI7 Q;  4HMI A;  4JYA Q;  1TWF B;  1A8V A;  1PH6 A;  1PYB A;  1NR4 A;  1R9T B;  1TY0 A;  1G2S A;  1ET6 A;  4DR2 Q;  4DR6 L;  3RMH A;  4LFA L;  4ZYS A;  1G6P A;  2HIX A;  2Z0S A;  2ICE C;  1N32 L;  2H4O A;  2DJF C;  1G2T A;  2MHV A;  4LJZ C;  3TEH B;  3P75 A;  1NJI C;  4XQQ A;  2B63 B;  4Y52 H;  5T1I A;  4FXK C;  4ME5 A;  4X65 Q;  3H3V H;  2EXZ A;  4KN7 C;  1TS4 A;  2EYO A;  2UXC L;  3D6C A;  4RCO A;  1L0Y B;  4KJO A;  3HKZ B;  2JA8 H;  4KKT A;  1ZYR D;  2F3V A;  4O0A A;  1A6X A;  4PG3 A;  2K03 A;  2O5J C;  1LTT D;  2L15 A;  3HP3 A;  2OQK A;  4H02 A;  5LL6 S;  4FXG C;  1O7I A;  3PO2 B;  4C2M B;  3CMA A;  1EFI D;  1J5E Q;  2BA0 A;  3BVM A;  1FVI A;  4RAU C;  1NUC A;  5GRO A;  4JI7 L;  1BNZ A;  4RHS A;  4PV1 C;  4R1J A;  3BG3 A;  1PH4 A;  2PNR C;  2F1M A;  4DR2 L;  3HOZ B;  2B2U C;  2KEN A;  2GVA A;  3BVG A;  1X65 A;  5E1F A;  4B9X A;  1PH7 A;  1Q90 A;  2KA7 A;  2EDG A;  1XPR A;  3OMG A;  2K75 A;  5CBE E;  3C1F A;  2F0P A;  1BCP B;  1SYG A;  2IHE A;  4X65 L;  1ZYR C;  3AYH B;  2LS0 1;  1TVX A;  1GOZ A;  3TSS A;  1FJG Q;  2QF7 A;  1TWH H;  5GAD C;  4A3G G;  2OTJ A;  1HH2 P;  1QCB D;  3PUX A;  2H5X A;  3PIO A;  4JCV E;  3BU2 A;  1T5X D;  5C5M A;  1IZ6 A;  2J4X A;  4HIM A;  4JOI A;  5C44 B;  4IN3 A;  4MTK A;  2B2T C;  3V96 A;  1J5E L;  2XGT A;  3OW2 A;  1X32 A;  3AEV A;  4TSS A;  1K8O A;  2MNA A;  4A75 A;  1SYD A;  2EOT A;  1MSG A;  4U68 A;  3UE1 A;  1WD1 A;  3KOJ A;  2RVL A;  1L1O B;  4OON A;  2RQX A;  3BYY B;  2PW5 A;  3C1E A;  3MC0 B;  2A1A A;  4NXN Q;  3A8I E;  3D4D A;  4FF3 A;  3HOW G;  1E1O A;  1WTW A;  1X56 A;  2NVY B;  1KAB A;  3FVQ A;  4WFN 3;  4A3J B;  3D4W A;  1AZQ A;  1D1I A;  2WAQ E;  4K14 A;  2G5D A;  1LTL A;  5DLQ E;  5FOB B;  5DAU A;  4C3H B;  3NSW A;  4KK7 A;  3FPP A;  4J15 A;  3FKI B;  1FJG L;  1HNZ Q;  4FXD A;  1LT6 D;  3ERO A;  1HZA A;  2F4I A;  3PO3 G;  1OTC A;  1VQA A;  4R8N A;  5HGQ A;  4ID6 A;  1E22 A;  2DY7 A;  3S24 A;  1EY7 A;  1PFM A;  3GTO B;  4IFD I;  3OYY A;  2VXW A;  1SE2 A;  3TS2 A;  2ZTD A;  4KD3 A;  3BYT B;  3QOL A;  3ULJ A;  1A3T A;  3FP9 A;  2CQO A;  4CDC C;  2B63 G;  4DNT B;  2HCI A;  4R4C A;  4HSV A;  4NXN L;  4APV A;  1I94 L;  2EPB A;  3PGZ A;  3HKZ G;  1RTO A;  1SND A;  1Y8O B;  2ZM6 Q;  1TXY A;  1IKM A;  1JOO A;  3CCR A;  3BDL A;  1Z9F A;  1HA6 A;  2NZ1 D;  1HNZ L;  2FXQ A;  1SMY D;  3A8K E;  1QWY A;  1KLG D;  5C3X A;  1CK1 A;  1QE6 A;  3GO5 A;  1KNE A;  2E76 C;  4ZUI A;  3TBI B;  2A8V A;  3VA5 A;  2K32 A;  4I65 A;  2A73 B;  5EJW A;  3GD7 A;  1EEF D;  3HKZ E;  1I3Q H;  4G7H C;  5I6W A;  1Z47 A;  1EZ8 A;  2EJF C;  1PA6 A;  2QW7 A;  4J1M A;  1HTL D;  3LX0 A;  3RN2 A;  4XQJ A;  4R4I A;  1A62 A;  4HID A;  4L5R C;  3ZJY C;  3E9H A;  2N3S A;  4K5X A;  2R92 B;  3CPF A;  2E2J H;  5FJ8 G;  4A3I B;  1N36 Q;  1BBX C;  2ZM6 L;  1SJE D;  1SMY C;  1EU4 A;  2K5W A;  5IP9 H;  4YIJ A;  5IP7 G;  5FLM G;  2YTY A;  4TQU S;  3K5N A;  2HQL A;  3KLS X;  1BBW A;  1K0R A;  1NR2 A;  1EL0 A;  2IL8 A;  3EQL C;  1U4R A;  3NBI A;  1V1P A;  5E3F A;  2A69 C;  2BA1 A;  4ULL A;  2LXK A;  3EVQ A;  4NDX A;  2QA4 A;  2R93 G;  2A6E D;  4UY8 C;  1IYU A;  3CCS A;  5IT9 E;  2ZXP A;  2RDH A;  1O7L A;  2XVS A;  1BXT A;  3Q0A A;  3CU7 A;  1CUK A;  4A3K B;  4OWW B;  1ZEQ X;  5BN3 A;  5LMU L;  4JV5 Q;  2B2U A;  3ONA B;  2VW9 A;  4RKB A;  2CW0 D;  1EFW A;  1R4Q B;  3KK7 A;  3QO2 A;  4A3J G;  4N8F A;  4ALP A;  2PMZ B;  3S1N B;  1EQR A;  1KQS A;  2BH2 A;  4WJ3 M;  2D62 A;  3VR2 A;  1GUG A;  2O5I C;  2VQE Q;  1N36 L;  4DV7 Q;  2MP1 A;  2KCM A;  3GTQ H;  2IX3 A;  3MHB A;  4R9W A;  2PO4 A;  4LF5 Q;  4BXX G;  4DGZ A;  4IOC A;  3H6M A;  4C1N I;  2PZW A;  5KNC A;  3F1Z A;  2JA6 H;  2K01 A;  1AZP A;  2B2T A;  5KIX A;  3HOY H;  1QNU A;  3K6O A;  1C9O A;  2M00 A;  4YCU A;  4NXM Q;  4DUZ Q;  4HJ5 A;  3V05 A;  2RHS B;  4ZUJ A;  1W2B A;  4KY5 A;  2HDL A;  3H09 A;  4JV5 L;  4A3E H;  1MGS A;  4CJ1 B;  3AFP A;  1EY6 A;  2LKV A;  2IPK D;  4HCS A;  2F0J A;  2E2H B;  5C0X I;  1S4Z A;  2AKW B;  1EIH A;  1SBB B;  3HOU B;  3N52 A;  5JPM C;  4HED A;  1K3R A;  4DR4 Q;  1L2F A;  3H0G B;  1F2Z A;  1DOM A;  3PV0 A;  1IL2 A;  1VQP A;  4DV7 L;  2R61 A;  1G29 1;  1ILP A;  3GTM H;  1E3P A;  3GTL H;  1SNO A;  1DOL A;  1UE1 A;  1WTR A;  4JBK A;  1P16 A;  1VQ6 A;  4LF5 L;  2F3W A;  5GAE C;  2DGY A;  4ILW A;  2C35 B;  2F0K A;  1WTH A;  1L0X B;  3W1B A;  1PH2 A;  2KJX A;  2KCC A;  5C4X G;  1LLR D;  1YHB A;  2MFI A;  2QDL A;  1B3A A;  4OO1 I;  4NXM L;  2A5H A;  3G4S A;  3DUZ A;  2B2V A;  2LMC B;  4DXF A;  1EIF A;  4DNI A;  5IIF A;  3CD6 A;  4XIG S;  1TWA B;  2R92 G;  4XT1 B;  2EJM A;  4G7Z C;  4A3I G;  3OPO A;  1G51 A;  5M5Y H;  3Q6S A;  1H9S A;  3P1H A;  4DR4 L;  3GTP B;  1JOR A;  1HR0 W;  2K33 A;  2LFN A;  1JMC A;  1HFG A;  5I9P A;  1JWM D;  1Y1V H;  1DJR D;  2EVB A;  3L0O A;  2BCO A;  3IRB A;  4TKO B;  1JOK A;  4KHP Q;  3MFG A;  1X6O A;  2K52 A;  4EQP A;  2K50 A;  5DM7 3;  3NE5 B;  4IUV A;  4A3G H;  2R3Z A;  1VDZ A;  3I2Z A;  3WOF A;  1XNQ Q;  4A3K G;  1WTP A;  2F0Q A;  3A55 A;  4IO9 A;  4A3B G;  1PZJ D;  2C5C A;  4IUU A;  1B44 D;  1KC8 C;  2N55 A;  1WI5 A;  4JW0 A;  1X9N A;  4LNQ A;  5KND A;  1C7Y A;  2IWH A;  3JAM E;  1ESR A;  3T13 A;  3P7J A;  4L63 B;  2L0C A;  2JN4 A;  3KLR A;  4CDE C;  5M5X B;  1KRS A;  2ZTC A;  5BN4 A;  1GM5 A;  3NK9 A;  1V43 A;  1QZH A;  2VZA A;  3VR6 A;  3E6Z X;  3MTS A;  1TR5 A;  5E4X A;  1VQD A;  4IPG A;  3HEJ A;  3HOW H;  3GTG H;  3I4L A;  3NP8 A;  4MIU A;  4H7B A;  1CKN A;  1QIL A;  5CV6 A;  2WII B;  2PMZ E;  1SMX A;  4HJA A;  1EIG A;  3HS0 C;  1TWG H;  4JBW A;  3EIV A;  4DNR B;  2FMC A;  5C3E G;  4DR3 Q;  2VUM H;  4LK1 C;  1PRT D;  1GD7 A;  1XNQ L;  2Z9H A;  4P71 A;  2MJ8 A;  3PO3 H;  4IFD J;  4V19 0;  1Z7T A;  2AQ2 B;  2JQO A;  2VY3 A;  4QUF A;  3T1Y Q;  2JA7 B;  1T5E A;  2I5L X;  3J81 c;  1STA A;  1TWF H;  1I6V C;  5EKL A;  4GOP B;  1R9T H;  1Q1B A;  2JSO A;  4JG2 A;  4A3D B;  1RD9 D;  4G4K A;  4CGY B;  2NB0 A;  1E2Z A;  2Z6B A;  5A2Q L;  3CCM A;  1Q86 C;  1QVF A;  3QWN A;  3U4V A;  4IPC A;  3PIP A;  2B63 H;  4XDX A;  3PSI A;  5M3M B;  1I4G A;  3IFD A;  4BS9 A;  4UAI A;  3H91 A;  2A6H D;  2VB3 X;  3T1H Q;  3LWE A;  2WKD A;  2OEO A;  3SR1 A;  4P72 A;  4IQZ A;  1YNX A;  1FNW A;  4DAM A;  3JAM i;  3L2P A;  4Y7N B;  1SFO H;  1C4Q A;  2ZXR A;  2WIN B;  1YHQ A;  4LF7 Q;  3MEF A;  4DR3 L;  4JOI C;  5HUR A;  4YCV A;  4C2M H;  2Z6K A;  1KNA A;  1QUQ B;  4CBV A;  3DMU A;  5COR A;  3T1Y L;  1E7Z A;  1YJN A;  2EY2 A;  4O2D A;  4LUV A;  5AFW A;  2CVR A;  1O80 A;  4L5Q A;  2HDM A;  5E4W C;  4K5W A;  3HOZ H;  1PTO D;  2I0Q A;  4POG A;  4F87 A;  2NN6 I;  1NY4 A;  2PW7 A;  5IWA Q;  1NMG A;  3J80 c;  4KY6 A;  4DU9 A;  1SRU A;  4LAA A;  3S2D B;  1YBY A;  2A6H C;  1B4O A;  4UDU C;  2KHJ A;  2HUG A;  4LF6 Q;  1HUM A;  2J0T D;  4O42 A;  2KUM A;  1MBY A;  4DFA A;  1J8I A;  1LV9 A;  1NMF A;  1CTM A;  3T1H L;  5NUC A;  5FJ8 H;  4A3C G;  4XYQ A;  4PNY A;  2DN8 A;  4DV5 Q;  3EJI A;  2QKI C;  3FHW A;  4LUZ A;  5FLM H;  4DN4 M;  4LF7 L;  1QVC A;  4HTH A;  5C44 H;  1HZC A;  4ZRZ A;  1EWH A;  1KDC A;  3DM1 A;  2K5N A;  1Q82 C;  1PTO C;  1GUT A;  1JE4 A;  1PH1 A;  2WFW A;  4ZAI A;  2I5H A;  3CRK C;  5M9O A;  2P5Z X;  1MJC A;  4KTA A;  2OTL A;  2R93 H;  4JI5 L;  3I8Z A;  4A3M G;  3Q8D A;  1ILQ A;  3B6Y A;  1IBM Q;  3BJU A;  1SYF A;  2F4V Q;  1KL9 A;  3M4Q A;  4JI3 Q;  2SDF A;  5A2Q E;  2YYZ A;  4KKS A;  5JJK A;  4LF6 L;  2NVY H;  3NEM A;  4A3J H;  3SVM A;  2NVQ H;  1N34 L;  2CQA A;  5I4D A;  1H95 A;  4I7Z C;  3BDO A;  3FEW X;  4K8I A;  4C3I B;  2D2C C;  4DV5 L;  3I4M G;  2MO0 A;  1U5K A;  4DKA C;  2EZV A;  2JA9 A;  3N6R A;  3HKS A;  2JA7 G;  1Q1E A;  4P2C B;  3S14 H;  3S15 B;  1EOT A;  3GQB A;  4BXX H;  4DK3 C;  1ENC A;  5IYB G;  3GTO H;  3J7A F;  2PQA A;  4KHV A;  3I3C A;  4HR7 B;  5CMD A;  2BH8 A;  1A2U A;  3GTJ B;  1N9W A;  3S1Q B;  4EVO A;  4GLV B;  2VL6 A;  3KF8 B;  4AQY Q;  1SEB D;  4DAY A;  1I4R A;  3L9A X;  1CSQ A;  5C0X J;  2KOL A;  2ENB A;  1UEA B;  4ZLT F;  4LFB L;  2B2W C;  5M3M G;  1D7Q A;  1IBM L;  5J22 A;  2H1E A;  5D3I B;  4BY7 G;  3VA7 A;  3ITP A;  5D14 A;  3EN2 A;  1HZ9 A;  4JI8 Q;  4PZ6 A;  1VF7 A;  2CWA A;  1VQ9 A;  1EYA A;  3K81 C;  1K83 B;  1EQV A;  1U9R A;  1A0I A;  2YU9 B;  3M4O B;  1SFO B;  1K28 A;  1B70 B;  1S5D D;  3ERS X;  2UXD Q;  1UAP A;  3U9S A;  2CFM A;  1V1P B;  1AEX A;  4ODG A;  1PH5 A;  4A4I A;  1PV4 A;  3GTK B;  2SEB D;  2UXB Q;  3G7L A;  1LM0 A;  5KNB A;  2RSO A;  1M4V A;  1WCM B;  1CFM A;  3NQT A;  1KAW A;  3MXU A;  4RGT A;  3FDT A;  4JI2 Q;  1SYC A;  4AQY L;  4C1N K;  2RA4 A;  5IGG A;  4CJ2 C;  3NWT A;  3QG1 A;  2F0L A;  1O7Z A;  1FL0 A;  3W1G A;  2R92 H;  2WAC A;  4JI8 L;  1B9N A;  1RKN A;  2F3I A;  3CCQ A;  4A3I H;  3MAQ A;  1B9M A;  2J7Z A;  3K59 A;  4RWS C;  5M3F B;  3E9I A;  4LF8 Q;  5G3L D;  3NTK A;  1X3F A;  1VCI A;  2JJQ A;  1WTV A;  4LF4 Q;  1BDO A;  1ESF A;  3GV6 A;  3OTO Q;  4FYD A;  1EYG A;  2UXD L;  1Q81 C;  1CSP A;  3J80 L;  1JOQ A;  2UXB L;  3G6E A;  1E0B A;  1KHI A;  2RCF A;  1A2T A;  3DEP A;  3OMC A;  4GS3 A;  4A3K H;  1TQO A;  1W3S A;  4EQO A;  4MNO A;  4WOR A;  2R93 B;  2XWJ B;  1IXR A;  2EE1 A;  4YCW A;  2JE6 I;  4ABN A;  3S1N H;  1STG A;  5IE8 A;  4CHT B;  5CYU A;  1XPU A;  2AMC B;  4C3I G;  2PQE A;  1J6Q A;  3TZU A;  2NVQ B;  4PMC A;  3KLW A;  1FD7 D;  2EYM A;  3L7Z C;  2NUC A;  1HFN A;  1WTQ A;  3E0E A;  4J6H A;  4LF8 L;  4OGQ C;  4DV6 Q;  4FF4 A;  1GJX A;  1EEI D;  4LF4 L;  3KDF A;  3S9W A;  2EQS A;  5CBA E;  3OTO L;  1SNQ A;  4X3U A;  3C3L A;  3TN2 A;  5A35 A;  4JYA L;  4A3F B;  4A93 G;  1GUO A;  1TWC B;  2EIF A;  3TDQ A;  3S14 B;  2WB1 B;  3NTI A;  1WTO A;  2F0S A;  4JK1 C;  1SYE A;  3KJP A;  3AB9 A;  1A15 A;  4RGM A;  1XPO A;  1RCV D;  2L1B A;  2B2V C;  2L12 A;  4X3S A;  3MXN A;  1LTA D;  4B3S Q;  1BKB A;  2BOS A;  2E2H H;  2DJG C;  3MZ5 A;  1N33 Q;  3R2T A;  2QCP X;  1DOK A;  3HOU H;  3CPW A;  2O4X A;  1S5C D;  2A74 C;  2JK8 A;  3H0G H;  3J81 j;  4HJ7 A;  3K80 C;  2R7Z B;  2IX1 A;  1SNC A;  1E24 A;  3H3V I;  1H9M A;  2F0I A;  2XSC A;  1CZG A;  2IJ0 A;  1HCZ A;  5CC4 A;  1VQH A;  3FPU B;  4RKL A;  5EPJ A;  3TZD A;  4F7X A;  4DV6 L;  1EY5 A;  1STH A;  1FGB D;  1JJG A;  4WRD A;  2Y0S G;  4RHR A;  1D6E C;  4QUC A;  2ATW A;  4RGO S;  2ZT9 C;  4AYB B;  1STY A;  1VQO A;  1MKH A;  1WCM G;  3M9B A;  3H3V C;  1JJC B;  4RGN A;  2B2Y A;  4NKL A;  3WDN A;  1S40 A;  1QJO A;  2E74 C;  1QOH A;  3IKJ A;  4YY3 Q;  5C4X B;  4JBM A;  2AWO A;  1QZG A;  4K6L A;  4B3S L;  5CV7 A;  1KRT A;  4WJ4 A;  3F2D A;  1TWA H;  1ASY A;  1HPC A;  5I9O A;  2Q2H A;  3UDI A;  4EQ5 A;  4DV1 Q;  2B2W A;  1N33 L;  2OT2 A;  4K2L A;  1PH9 A;  3SEB A;  2F0M A;  3GTP H;  1TU2 B;  2NVT B;  3CHB D;  5M3F G;  3OWF A;  2K5Q A;  5J1Z A;  4BBS G;  3T51 B;  1GUW A;  2JA5 B;  2QEJ C;  1YNN D;  1D8L A;  1H9K A;  1ML0 D;  2RBM A;  5IOD A;  4Q0F A;  3MA2 B;  2XRQ D;  4A3C H;  1PMR A;  3K7U C;  3D31 A;  1Q8I A;  4BA1 I;  4HJ8 A;  4A3L G;  3PIO 3;  5ELO A;  1BF4 A;  3CCE A;  2K6A A;  3RR5 A;  1WOC A;  3UDX A;  3SXH A;  2F0H A;  4M8A A;  4OIJ A;  1GVP A;  5FK9 C;  1I4P A;  1PYW D;  1Y8N B;  1Y1W G;  4A3B B;  2HHH Q;  2EYL A;  2HCC A;  1VS0 A;  2VNU D;  5M5X H;  1NSN S;  4FF2 A;  4GZY C;  4R4T A;  4POF A;  3M7N A;  5FLX c;  3C2P A;  1F77 A;  1D5X C;  1YNN C;  3HOX G;  3VDY A;  5IYD H;  4HAE A;  4QMG A;  3J7Z C;  4L8J A;  3F2B A;  1SR3 A;  4JI0 Q;  1LO5 D;  2KBN A;  1HJP A;  3PUZ A;  3CXC A;  4A3F G;  5K36 G;  2AQ3 B;  4E6I A;  4QL5 A;  1ZKO A;  5CV4 A;  1HQR D;  2WB1 G;  2A6E C;  1YJW A;  1IBL Q;  1FGU A;  4Q5V A;  4F8M A;  1K8M A;  1F2Y A;  1B50 A;  2Z6K C;  2JA7 H;  1H9J A;  1M1K C;  1YNJ D;  2MQH A;  4OWX B;  1KDA A;  3CAM A;  1II3 A;  1Q3L A;  5C3E B;  1JWS D;  2CW0 C;  5IYB H;  3VYT A;  4EQN A;  2AHO B;  4NP5 A;  2B29 A;  3TRZ A;  2HHH L;  4PMB A;  5LMN Q;  3Q23 A;  4A3D H;  2O2L D;  2R7Z G;  5C4J B;  5C5L A;  3IL8 A;  2F0W A;  4FVM A;  2N78 A;  5M3M H;  4IFD G;  2IHF A;  1LTB D;  4ZKB B;  2VQE L;  1MJE A;  3I73 A;  5JJZ A;  1HUN A;  4BWG B;  4C3J G;  1GUS A;  3D6W A;  4JI0 L;  4QCL A;  1YVC A;  2XRS D;  5FKA C;  2ZJR A;  2IY5 B;  4JI4 Q;  4Y7N H;  4AYB G;  3M3Y B;  1XNR Q;  2HQE A;  2L5T A;  1PRT F;  1EYD A;  1YNJ C;  3UE0 A;  1IBL L;  4L5S A;  1SNM A;  3A7A B;  4K8J A;  5JAV A;  1RJT A;  2B8F A;  4IUR A;  4QQB X;  3EA6 A;  3K0X A;  2CH4 W;  5HY6 A;  4DUZ L;  4OHJ A;  3GP7 A;  5LL6 X;  1A3V A;  4RCN A;  1XMO Q;  3SK8 A;  5AJ3 Q;  5LMN L;  1EY9 A;  1E2V A;  4AYB E;  4O1N A;  4H44 C;  4NMZ A;  4QJF A;  5IGD A;  3S2D H;  2BE5 D;  3G6J B;  4FNF A;  2K1B A;  4KD4 A;  2SOB A;  2JA5 G;  1ICF B;  3UI2 A;  1B3Q A;  1Q12 A;  5JEA J;  4L6T B;  3NHH A;  4FF1 A;  3K57 A;  1QVG A;  2ICI A;  4CJ0 B;  1XMQ Q;  4JI4 L;  4GLX A;  1XNR L;  1CM9 A;  1EWI A;  3HOV B;  2EJG C;  2G9D A;  2OWO A;  5CV5 A;  2KVM A;  1LT4 D;  3T53 B;  1QB5 D;  1NBW A;  3K0Y A;  3F2C A;  1H9R A;  1LT3 D;  1SE4 A;  4GN5 A;  2AUJ D;  1B1Z A;  1PTO F;  1Q46 A;  1BBU A;  2VB2 X;  2PQA B;  4JI6 Q;  1XMO L;  2A19 A;  4EX5 A;  1X3G A;  3VR5 A;  3KBG A;  2RSN A;  1U0L A;  4PZ7 A;  2JYO A;  1F9Q A;  1JE5 A;  1WJJ A;  2YTV A;  2A68 D;  3J7A 5;  4K0K Q;  1PZI D;  3TQY A;  3CCU A;  4A3M B;  1OXV A;  2EYF A;  5IGC A;  3KF6 A;  4JBJ A;  2PI2 A;  4YWM A;  5C3W A;  4IJL A;  1EOV A;  1SAP A;  1EYC A;  2K5D A;  3PUV A;  4J8Q A;  4KHP L;  4C3I H;  1CHQ D;  1B53 A;  3Q24 A;  5EAY A;  4BY1 B;  5LMN W;  3DWP A;  2Q2I A;  3S15 H;  4DV3 Q;  2GA4 B;  3MWY W;  3NPP A;  4XXE A;  1PDQ A;  3E5S A;  3I4M B;  5DNF A;  5KYL A;  1EY8 A;  4LFC Q;  3URY A;  1N8R C;  3GTJ H;  3S1Q H;  5IY0 A;  4JI6 L;  3HZX A;  3ERQ A;  1IYJ B;  1UE5 A;  3BZK A;  1VQM A;  3Q22 A;  1JC7 A;  3QR8 A;  3CP0 A;  4IUP A;  4K0K L;  1SRO A;  4LW1 A;  4YWL A;  1CT1 D;  1PXU A;  5JJL A;  3K5M A;  1NE3 A;  4DAP A;  5H1S E;  1SYB A;  2Q2U A;  1EU3 A;  1RF2 D;  1W6J A;  4XQN A;  4BY7 B;  3BZC A;  2B8G A;  3SHL A;  5C0X G;  1PRT C;  1K83 H;  1JB7 A;  5I6Y A;  2YU9 H;  3M4O H;  1VQK A;  1TS2 A;  3CW2 C;  3HG9 A;  3S17 B;  4DV3 L;  1I4Q A;  4RG1 A;  5FO7 B;  1YEZ A;  1SNP A;  1RTN A;  5EGT A;  1LT5 D;  4MTN A;  3GTK H;  3A0J A;  4YWK A;  1PFB A;  4HSP A;  4DV2 Q;  2MO1 A;  1PH8 A;  5K5P A;  2E2I H;  1WCM H;  4ZQ3 A;  3RLN A;  3VR3 A;  4ME3 A;  1I50 B;  4CKB A;  1X54 A;  3CQZ B;  5C6A A;  5LHY 1;  3UDG A;  4QGU A;  3RUZ A;  2EYP A;  5TSS A;  4OO1 G;  3T16 A;  3I4N B;  2F0F A;  1JCK B;  1VQG A;  4CDD C;  4GNX C;  4IOA A;  2L11 A;  2L9H A;  2R7F A;  4GKK Q;  3HOV G;  1BR9 A;  5M3F H;  1S72 A;  1RHP A;  1STE A;  2KHS A;  3SE0 A;  5IP7 H;  2NVX H;  3QJY A;  4H13 C;  5J3B A;  1PZK D;  3GV3 A;  4IPH A;  4DPG A;  5HGT A;  1GXD C;  2N49 A;  1O7Y A;  4KV6 A;  3T56 B;  4A3L H;  4CKC A;  4DV2 L;  4TVA B;  1ROD A;  5GAH C;  1B8A A;  1NTG A;  1PTO B;  5IGB A;  5IYC G;  3KJO A;  2VS1 A;  3BS1 A;  3S1M B;  5DEH A;  1ONL A;  2XWB B;  5IWA L;  1F9P A;  1E2W A;  4F88 A;  1DYQ A;  1EY0 A;  1NNX A;  1X3P A;  1VQ4 A;  1UEB A;  2CHB D;  4BA2 I;  4BY1 G;  1UNS A;  4GKK L;  1PVO A;  3LNN A;  3G71 A;  1TS5 A;  3HOX H;  5G3L F;  1B2T A;  1XTD A;  4TRD A;  2Z4I A;  1FYC A;  1EQQ A;  4RH6 A;  5L37 A;  1IYV A;  3K5L A;  2F0U A;  2PPB C;  4HN7 A;  4XT3 B;  4HMJ A;  4KMU C;  5IT9 c;  2PCF B;  4A3F H;  4UPA A;  4LWC A;  5K36 H;  1TWC H;  5IOC A;  1EUJ A;  1CA6 A;  1CKM A;  4KKU A;  3K58 A;  4DR7 Q;  4KLK A;  1VQI A;  2B2Y C;  3S1R B;  4N9T A;  1Y14 B;  1YJ9 A;  4A93 B;  4RFB A;  4DK1 A;  3J7Y W;  5T1G A;  3IAY A;  3NEL A;  1CA5 A;  3BZD B;  2E8G A;  5ELB A;  1LAB A;  3A54 A;  2FHT A;  4B9W A;  5BN5 A;  5I2X A;  4V0B A;  2NTS A;  2SNS A;  4OIK A;  1UE7 A;  2I07 B;  4KN4 C;  3HOY G;  4UP7 A;  1VQJ A;  2F4V L;  4JI3 L;  4K5V A;  2R7Z H;  1IBK Q;  2EYH A;  4P74 A;  4IFD H;  2Q8R E;  2CKZ B;  3J81 L;  4JPB W;  4IPD A;  2TMP A;  3SDZ A;  1X55 A;  4M1U B;  4C3J H;  2E75 C;  4YHH Q;  2KED A;  4MZ9 A;  2KHI A;  3VR4 A;  3U58 A;  3U50 C;  3RZD B;  2IT1 A;  1RL2 A;  3K7A B;  1WD0 A;  4DR7 L;  4Z9C B;  2Y0S B;  1BQQ T;  3RD4 A;  3UDF A;  4K2K A;  5C4X H;  2AUK A;  1BCP D;  2E2I B;  3OHX C;  4PMW A;  3DWA A;  3I4N G;  1HXY D;  4LF9 Q;  5COY A;  3X3N A;  5JVG 3;  1MI2 A;  1KXL A;  1HZB A;  4AH6 A;  1SN8 A;  1I4X A;  4AIM A;  1LTS D;  4HIO A;  1OXU A;  3ICE A;  1TS3 A;  3I55 A;  2NVT H;  1U4L A;  2RHQ B;  1DON A;  4GOP A;  1IBK L;  2DY8 A;  4G57 A;  3VYU A;  2JA5 H;  1K8G A;  2FJ2 A;  2NN6 G;  2PZT A;  3A8J E;  4WJW A;  2ZJQ A;  1F2M A;  3EFX D;  1C48 A;  3F2U A;  3AU7 A;  1OXT A;  1P8L A;  1CI3 M; 
#chains in the Genus database with same CATH homology
 3FRP B;  4X3K A;  1ENA A;  4BBS B;  2NVX B;  2NBF A;  2N88 A;  5M5W B;  2F0T A;  3KBX A;  1BCP C;  2FFK B;  3SK5 A;  3OIP A;  4MHE A;  2DNE A;  1EZ6 A;  3TP8 A;  2JEA I;  1PLF A;  1X3Q A;  1Y1W B;  4KY7 A;  3R2I A;  2B39 A;  1AP0 A;  1D5Z C;  1U4M A;  2MUY A;  1CQV A;  3TME A;  1F9S A;  1SJH D;  3HOX B;  1W6K A;  3J81 E;  3OWE B;  1G6Z A;  1TKW B;  2F0N A;  5FO9 B;  3PMF A;  3P20 A;  5F2D A;  3DWQ A;  1OO9 B;  1AFP A;  3S2H B;  1S5E D;  1JQY D;  1SE3 A;  3I90 A;  1V1O A;  4C56 C;  4FO2 A;  4RA8 A;  5EQ0 A;  1Y8P B;  5IT9 L;  2V4D A;  1F2L A;  1H9S B;  2RDF A;  4BBR B;  3I91 A;  3X3M A;  4C3J B;  5ISR A;  5C0X H;  4QIW B;  2EY6 A;  2D5D A;  1WTX A;  1KAA A;  3J80 E;  1F9R A;  3TP5 A;  2AQ1 B;  3ND8 A;  4LMQ D;  3NBH A;  2DNC A;  3E0J A;  1AW7 A;  2JA8 B;  2PZU A;  1KTK A;  2IW3 A;  1IL8 A;  2MGS A;  3OSO A;  4HCE A;  1EQT A;  3VYS A;  1PFN A;  2A69 D;  3KF8 A;  1RDP D;  3NQI A;  4OO1 H;  3ZYY X;  1WVL A;  5CGK A;  2M2L A;  4XYO A;  1QG7 A;  5JVH 3;  2D9U A;  2KCN A;  5ELD A;  4DF7 A;  2MPM A;  4KHZ A;  2QDB A;  2X6L A;  4DA2 A;  1IW7 D;  3QIA A;  4IAL A;  1TT2 A;  3M4Y A;  4EGV A;  2KEE A;  5JEA G;  2L4N A;  5KRU A;  3KUP A;  3HRZ C;  1ENF A;  3MFY A;  1TWH B;  1J9O A;  4OL7 A;  3D3R A;  5KGU A;  1SXT A;  3PUY A;  2L55 A;  4X3T A;  2K04 A;  2R6G A;  3SK4 A;  2WKC A;  1IW7 C;  4S3S A;  3NWS A;  4QB4 A;  2Q8T A;  4DK0 A;  1HTP A;  1M8A A;  1QNK A;  3MEH A;  1CQF A;  2SNM A;  2XNA C;  4B08 A;  4C3H G;  5ELF A;  2F03 A;  3CRL C;  3AU7 A;  1C8C A;  1AN8 A;  3MXG A;  5C4Z A;  4H0L C;  1CZW A;  3MVV A;  3VYR A;  4IUQ A;  3U9O A;  3I72 A;  2JXM B;  1VF5 C;  1DD2 A;  3SK6 A;  2F0O A;  3LWU A;  1DM0 B;  3JAM L;  3AMU A;  2XIW A;  1ET9 A;  2OF1 A;  2Z8L A;  4R8I A;  1HA5 A;  1CHP D;  3BDC A;  2JEB I;  5IGF A;  2TSS A;  1JR0 D;  1GHK A;  3CKI B;  3BVZ A;  3IFT A;  2F0G A;  1V8Q A;  1XXG A;  1LAC A;  1HHV A;  2C9O A;  3NTH A;  2OXP A;  3A56 A;  1LTG D;  5EPK A;  3J7A V;  4FP5 D;  1G8Z D;  2EYJ A;  1FNU A;  3W3A A;  2EY5 A;  2EY1 A;  5D65 A;  1STN A;  1SDF A;  3FMC A;  1A3U A;  3O13 A;  1I3Q B;  5CV8 A;  5J39 A;  3KLS A;  5EBC A;  2E2D C;  2FIN B;  2NN6 H;  2Z1C A;  3DXJ C;  5FO8 B;  4CKE A;  2ID0 A;  2E2J B;  1PTO H;  5IGE A;  3S16 B;  3M7G A;  4G7O C;  2BE5 C;  2Q8I B;  1TY2 A;  1BUV T;  4IZ8 A;  3OIQ A;  4MN3 A;  3TP6 A;  2IX0 A;  3DHQ A;  1I6H B;  2X69 A;  1D1K A;  2NWG A;  3T4A C;  4DAV A;  2I46 A;  2KQ3 A;  2WV6 D;  4IUN A;  5EKK A;  1XX8 A;  1LTI D;  1NCV A;  2F0E A;  5JOB A;  4PQX A;  1LTR D;  2PYK A;  3W2D A;  2K28 A;  1DXM A;  2QIL A;  4IUT A;  5DM6 3;  1EWC A;  2RKS A;  5FLX L;  1D2B A;  1DCZ A;  1UUP A;  1IHZ A;  2A68 C;  2RDG A;  1I4H A;  1O78 A;  3GTQ B;  4DXG A;  1JB3 A;  3PUW A;  3RZO B;  3R8B A;  1KDB A;  4KJN A;  2JA6 B;  1Z6H A;  3R3O A;  1OXS C;  3HOY B;  3OOC A;  5CR3 A;  2WP8 J;  1S5B D;  3RLF A;  4A3E B;  3QOJ A;  1PRT B;  1U4P A;  4NW2 A;  1EY4 A;  4QF4 A;  5CV9 A;  1JIC A;  1VMP A;  1D5M C;  3TP7 A;  3V2T A;  3WOE A;  1DZ1 A;  5ELE A;  2KEC A;  3GTM B;  2Z4H A;  3GTL B;  1GHJ A;  1JWU D;  1GUN A;  1ZXT A;  1MD2 D;  5EKI A;  1S5F D;  5KYI A;  2NTT A;  1G91 A;  4ZKC B;  4KI0 A;  5KEE A;  5C4H A;  3NUC A;  1SSO A;  3K5O A;  2F0D A;  1BOS A;  1Y69 U;  3I70 A;  3H94 A;  1IKL A;  2XN9 C;  2F0V A;  5ELC A;  5M5Y B;  1HRJ A;  4ZK9 B;  5JPN C;  1XYI A;  2M9V A;  1BCP F;  1XWE A;  1MSH A;  3OW7 A;  1STB A;  1Y1V B;  5FLX E;  5JEA H;  2LY7 A;  1FR3 A;  4A3G B;  4XTC S;  1BO0 A;  3ND9 A;  3M85 A;  3D8G A;  4N9P A;  4U67 3;  3DEO A;  2K7V A;  1R4P B;  2WAQ B;  2JP1 A;  1OXX K;  3MXP A;  1TII D;  1VMC A;  3HGB A;  1NAP A;  3NXW A;  2FMM A;  3R93 A;  5D3D A;  3L3O C;  3QB3 A;  5EBD A;  1ICW A;  5EPL A;  3HOW B;  2BDN A;  3GTG B;  2ZXO A;  5I2Y A;  1KLU D;  3C46 A;  3A7L A;  2AWN A;  2K05 A;  1TWG B;  2G9H D;  2VUM B;  2X6G A;  2NYZ D;  1XTC D;  2BDO A;  3D4R A;  3PO3 B;  1HQM C;  3PIP 3;  1FNV A;  4HMI A;  1TWF B;  1NR4 A;  1R9T B;  1TY0 A;  1G2S A;  1ET6 A;  3RMH A;  4ZYS A;  2ICE C;  2H4O A;  1G2T A;  2MHV A;  4LJZ C;  3P75 A;  4XQQ A;  2B63 B;  5T1I A;  4FXK C;  4ME5 A;  2EXZ A;  4KN7 C;  1TS4 A;  2EYO A;  3D6C A;  4RCO A;  1L0Y B;  4KJO A;  3HKZ B;  4KKT A;  1ZYR D;  2F3V A;  1A6X A;  2K03 A;  2O5J C;  1LTT D;  3HP3 A;  5LL6 S;  4FXG C;  3PO2 B;  4C2M B;  1EFI D;  2BA0 A;  3BVM A;  4RAU C;  1NUC A;  1BNZ A;  4RHS A;  4PV1 C;  3BG3 A;  2PNR C;  2F1M A;  3HOZ B;  2B2U C;  3BVG A;  5E1F A;  4B9X A;  1Q90 A;  2KA7 A;  2EDG A;  3OMG A;  5CBE E;  3C1F A;  2F0P A;  1BCP B;  1SYG A;  1ZYR C;  2LS0 1;  1TVX A;  1GOZ A;  3TSS A;  2QF7 A;  1QCB D;  3PUX A;  1T5X D;  5C5M A;  2J4X A;  5C44 B;  4IN3 A;  2B2T C;  3V96 A;  1X32 A;  4TSS A;  1K8O A;  1SYD A;  2EOT A;  1MSG A;  4U68 A;  1WD1 A;  2RVL A;  2RQX A;  3BYY B;  2PW5 A;  3C1E A;  3MC0 B;  3A8I E;  3D4D A;  4FF3 A;  1WTW A;  2NVY B;  1KAB A;  3FVQ A;  4WFN 3;  4A3J B;  3D4W A;  1AZQ A;  1D1I A;  4K14 A;  5FOB B;  5DAU A;  4C3H B;  3NSW A;  4KK7 A;  3FPP A;  3FKI B;  4FXD A;  1LT6 D;  3ERO A;  2F4I A;  4R8N A;  4ID6 A;  2DY7 A;  1EY7 A;  1PFM A;  3GTO B;  4IFD I;  2VXW A;  1SE2 A;  4KD3 A;  3BYT B;  3QOL A;  1A3T A;  4DNT B;  2HCI A;  4HSV A;  2EPB A;  1RTO A;  1SND A;  1Y8O B;  1IKM A;  1JOO A;  3BDL A;  1HA6 A;  2NZ1 D;  1SMY D;  3A8K E;  1QWY A;  1KLG D;  5C3X A;  1CK1 A;  1QE6 A;  3GO5 A;  1KNE A;  2E76 C;  4ZUI A;  3TBI B;  3VA5 A;  2K32 A;  4I65 A;  5EJW A;  2A73 B;  3GD7 A;  1EEF D;  4G7H C;  5I6W A;  1Z47 A;  1EZ8 A;  2EJF C;  4J1M A;  1HTL D;  3LX0 A;  4XQJ A;  4K5X A;  2R92 B;  4A3I B;  1BBX C;  1SJE D;  1SMY C;  1EU4 A;  2K5W A;  4YIJ A;  4TQU S;  3K5N A;  3KLS X;  1EL0 A;  1NR2 A;  2IL8 A;  3EQL C;  1U4R A;  3NBI A;  1V1P A;  5E3F A;  2A69 C;  2BA1 A;  4ULL A;  3EVQ A;  4NDX A;  2A6E D;  1IYU A;  5IT9 E;  2ZXP A;  2RDH A;  1O7L A;  2XVS A;  1BXT A;  3Q0A A;  3CU7 A;  4A3K B;  1ZEQ X;  5BN3 A;  2B2U A;  3ONA B;  4RKB A;  2CW0 D;  1R4Q B;  3KK7 A;  3QO2 A;  2PMZ B;  3S1N B;  2D62 A;  3VR2 A;  1GUG A;  2O5I C;  2MP1 A;  2IX3 A;  3MHB A;  4R9W A;  2PO4 A;  4DGZ A;  3H6M A;  4C1N I;  2PZW A;  5KNC A;  2K01 A;  1AZP A;  2B2T A;  5KIX A;  1QNU A;  3K6O A;  2M00 A;  3V05 A;  4ZUJ A;  2HDL A;  3H09 A;  1MGS A;  4CJ1 B;  1EY6 A;  2LKV A;  2IPK D;  4HCS A;  2F0J A;  2E2H B;  5C0X I;  1S4Z A;  1EIH A;  1SBB B;  3HOU B;  3N52 A;  5JPM C;  4HED A;  3H0G B;  1F2Z A;  1DOM A;  3PV0 A;  2R61 A;  1G29 1;  1ILP A;  1SNO A;  1DOL A;  1WTR A;  2F3W A;  4ILW A;  2F0K A;  1L0X B;  2KJX A;  2KCC A;  1LLR D;  1B3A A;  4OO1 I;  2A5H A;  3DUZ A;  2B2V A;  2LMC B;  4DXF A;  5IIF A;  4XIG S;  1TWA B;  4XT1 B;  2EJM A;  4G7Z C;  3OPO A;  3Q6S A;  1H9S A;  3P1H A;  3GTP B;  1JOR A;  2K33 A;  2LFN A;  1HFG A;  5I9P A;  1JWM D;  1DJR D;  2EVB A;  2BCO A;  4TKO B;  1JOK A;  3MFG A;  4EQP A;  5DM7 3;  3NE5 B;  4IUV A;  2R3Z A;  1VDZ A;  3WOF A;  1WTP A;  2F0Q A;  3A55 A;  1PZJ D;  2C5C A;  4IUU A;  1B44 D;  2N55 A;  5KND A;  2IWH A;  3JAM E;  1ESR A;  3T13 A;  3P7J A;  4L63 B;  2L0C A;  3KLR A;  5M5X B;  5BN4 A;  3NK9 A;  1V43 A;  3VR6 A;  3E6Z X;  3MTS A;  1TR5 A;  5E4X A;  3HEJ A;  3I4L A;  3NP8 A;  4MIU A;  4H7B A;  1QIL A;  5CV6 A;  2WII B;  1EIG A;  3HS0 C;  4JBW A;  4DNR B;  2FMC A;  4LK1 C;  1PRT D;  2MJ8 A;  4IFD J;  4V19 0;  1Z7T A;  2AQ2 B;  4QUF A;  2JA7 B;  1T5E A;  1STA A;  1I6V C;  5EKL A;  1Q1B A;  2JSO A;  4A3D B;  1RD9 D;  4G4K A;  4CGY B;  2NB0 A;  1E2Z A;  5A2Q L;  3QWN A;  4XDX A;  5M3M B;  1I4G A;  3IFD A;  4BS9 A;  4UAI A;  3H91 A;  2A6H D;  2VB3 X;  3LWE A;  2WKD A;  2OEO A;  3SR1 A;  4IQZ A;  1FNW A;  4Y7N B;  1C4Q A;  2ZXR A;  2WIN B;  5HUR A;  1KNA A;  4CBV A;  3DMU A;  5COR A;  2EY2 A;  5AFW A;  2CVR A;  1O80 A;  2HDM A;  5E4W C;  4K5W A;  1PTO D;  4F87 A;  2NN6 I;  2PW7 A;  4KY6 A;  4DU9 A;  4LAA A;  3S2D B;  2A6H C;  1B4O A;  4UDU C;  2HUG A;  1HUM A;  2J0T D;  4O42 A;  2KUM A;  1MBY A;  4DFA A;  1J8I A;  1LV9 A;  1CTM A;  5NUC A;  4XYQ A;  4PNY A;  2DN8 A;  1OXT A;  3EJI A;  2QKI C;  4DN4 M;  4HTH A;  4ZRZ A;  1EWH A;  1KDC A;  3DM1 A;  1PTO C;  1GUT A;  1JE4 A;  4ZAI A;  3CRK C;  5M9O A;  4KTA A;  3I8Z A;  1ILQ A;  1SYF A;  2SDF A;  5A2Q E;  2YYZ A;  4KKS A;  3SVM A;  2CQA A;  5I4D A;  4I7Z C;  3BDO A;  3FEW X;  4K8I A;  4C3I B;  2D2C C;  2EZV A;  3N6R A;  1Q1E A;  4P2C B;  3S15 B;  1EOT A;  3GQB A;  1ENC A;  3J7A F;  4KHV A;  3I3C A;  4HR7 B;  5CMD A;  1A2U A;  3GTJ B;  3S1Q B;  4EVO A;  1SEB D;  4DAY A;  1I4R A;  3L9A X;  5C0X J;  2KOL A;  2ENB A;  1UEA B;  4ZLT F;  2B2W C;  5J22 A;  2H1E A;  5D3I B;  3VA7 A;  3ITP A;  5D14 A;  1VF7 A;  1EYA A;  1K83 B;  1EQV A;  1U9R A;  2YU9 B;  3M4O B;  1SFO B;  1S5D D;  1UAP A;  3U9S A;  1V1P B;  1AEX A;  4ODG A;  3GTK B;  2SEB D;  3G7L A;  5KNB A;  2RSO A;  1M4V A;  1WCM B;  1CFM A;  3NQT A;  3MXU A;  4RGT A;  3FDT A;  1SYC A;  4C1N K;  2RA4 A;  5IGG A;  4CJ2 C;  3NWT A;  3QG1 A;  2F0L A;  1O7Z A;  2WAC A;  1B9N A;  1RKN A;  3MAQ A;  1B9M A;  2J7Z A;  3K59 A;  4RWS C;  5M3F B;  5G3L D;  3NTK A;  1VCI A;  1WTV A;  1BDO A;  1ESF A;  3GV6 A;  4FYD A;  3J80 L;  1JOQ A;  1E0B A;  1A2T A;  3DEP A;  3OMC A;  1TQO A;  4EQO A;  4WOR A;  2R93 B;  2XWJ B;  2EE1 A;  2JE6 I;  4ABN A;  1STG A;  4CHT B;  5CYU A;  4C3I G;  2PQE A;  3TZU A;  2NVQ B;  4PMC A;  1FD7 D;  2EYM A;  3L7Z C;  2NUC A;  1HFN A;  1WTQ A;  4J6H A;  1GJX A;  4OGQ C;  4FF4 A;  1EEI D;  3S9W A;  5CBA E;  3C3L A;  1SNQ A;  4X3U A;  3TN2 A;  5A35 A;  4A3F B;  1GUO A;  1TWC B;  3TDQ A;  3S14 B;  2WB1 B;  3NTI A;  1WTO A;  2F0S A;  4JK1 C;  1SYE A;  3AB9 A;  1A15 A;  4RGM A;  1RCV D;  2L1B A;  2B2V C;  2L12 A;  4X3S A;  3MXN A;  1LTA D;  2BOS A;  3MZ5 A;  3R2T A;  2QCP X;  1DOK A;  2O4X A;  1S5C D;  2A74 C;  2R7Z B;  2IX1 A;  1SNC A;  1H9M A;  2F0I A;  2XSC A;  1CZG A;  2IJ0 A;  1HCZ A;  5CC4 A;  3FPU B;  5EPJ A;  4RKL A;  3TZD A;  4F7X A;  1EY5 A;  1STH A;  1FGB D;  4WRD A;  4RHR A;  1D6E C;  4QUC A;  4RGO S;  2ZT9 C;  4AYB B;  1STY A;  3H3V C;  4RGN A;  2B2Y A;  4NKL A;  3WDN A;  1QJO A;  2E74 C;  1QOH A;  3IKJ A;  5C4X B;  2AWO A;  4K6L A;  5CV7 A;  1HPC A;  5I9O A;  2B2W A;  2OT2 A;  4K2L A;  3SEB A;  2F0M A;  1TU2 B;  2NVT B;  3CHB D;  3OWF A;  2K5Q A;  5J1Z A;  3T51 B;  1GUW A;  2JA5 B;  2QEJ C;  1YNN D;  1H9K A;  1ML0 D;  2RBM A;  5IOD A;  4Q0F A;  3MA2 B;  2XRQ D;  1PMR A;  3D31 A;  1Q8I A;  4BA1 I;  3PIO 3;  1BF4 A;  2K6A A;  3SXH A;  2F0H A;  4M8A A;  4OIJ A;  5FK9 C;  1I4P A;  1PYW D;  1Y8N B;  4A3B B;  2EYL A;  2HCC A;  2VNU D;  1NSN S;  4FF2 A;  4GZY C;  3M7N A;  3C2P A;  1F77 A;  1D5X C;  1YNN C;  4HAE A;  4QMG A;  4L8J A;  1LO5 D;  3PUZ A;  5K36 G;  2AQ3 B;  4E6I A;  1ZKO A;  5CV4 A;  1HQR D;  2A6E C;  4Q5V A;  4F8M A;  1K8M A;  1F2Y A;  1B50 A;  1H9J A;  1YNJ D;  1KDA A;  1II3 A;  1Q3L A;  5C3E B;  1JWS D;  2CW0 C;  3VYT A;  4EQN A;  4NP5 A;  4PMB A;  3Q23 A;  2O2L D;  5C4J B;  5C5L A;  3IL8 A;  2F0W A;  4FVM A;  4IFD G;  1LTB D;  4ZKB B;  3I73 A;  5JJZ A;  1HUN A;  4BWG B;  4C3J G;  1GUS A;  3D6W A;  4QCL A;  2XRS D;  5FKA C;  3M3Y B;  2HQE A;  2L5T A;  1PRT F;  1EYD A;  1YNJ C;  1SNM A;  3A7A B;  4K8J A;  5JAV A;  1RJT A;  2B8F A;  4IUR A;  3EA6 A;  4OHJ A;  3GP7 A;  5LL6 X;  1A3V A;  4RCN A;  3SK8 A;  1EY9 A;  1E2V A;  4O1N A;  4H44 C;  4NMZ A;  5IGD A;  2BE5 D;  3G6J B;  4FNF A;  2K1B A;  4KD4 A;  2SOB A;  3UI2 A;  1Q12 A;  5JEA J;  4L6T B;  3NHH A;  4FF1 A;  3K57 A;  2ICI A;  4CJ0 B;  1CM9 A;  3HOV B;  2EJG C;  2G9D A;  5CV5 A;  2KVM A;  1LT4 D;  3T53 B;  1QB5 D;  3K0Y A;  1H9R A;  1LT3 D;  1SE4 A;  2AUJ D;  1B1Z A;  1PTO F;  2VB2 X;  3VR5 A;  3KBG A;  2RSN A;  2JYO A;  1F9Q A;  2A68 D;  1PZI D;  4A3M B;  1OXV A;  2EYF A;  5IGC A;  5C3W A;  1SAP A;  1EYC A;  2K5D A;  3PUV A;  4J8Q A;  1CHQ D;  1B53 A;  3Q24 A;  4BY1 B;  3DWP A;  2GA4 B;  3MWY W;  3NPP A;  4XXE A;  1PDQ A;  3E5S A;  3I4M B;  5DNF A;  5KYL A;  1EY8 A;  3URY A;  3HZX A;  3ERQ A;  3Q22 A;  1JC7 A;  4IUP A;  1CT1 D;  1PXU A;  3K5M A;  4DAP A;  1SYB A;  1EU3 A;  1RF2 D;  1W6J A;  4XQN A;  4BY7 B;  2B8G A;  3SHL A;  5C0X G;  1PRT C;  5I6Y A;  1TS2 A;  3HG9 A;  3S17 B;  1I4Q A;  5FO7 B;  1SNP A;  1RTN A;  5EGT A;  1LT5 D;  1PFB A;  4HSP A;  5K5P A;  4ZQ3 A;  3VR3 A;  1I50 B;  4CKB A;  3CQZ B;  5C6A A;  5LHY 1;  3RUZ A;  2EYP A;  5TSS A;  4OO1 G;  3T16 A;  3I4N B;  2F0F A;  1JCK B;  2L11 A;  2L9H A;  1BR9 A;  1RHP A;  1STE A;  2KHS A;  3SE0 A;  3QJY A;  4H13 C;  1PZK D;  3GV3 A;  5HGT A;  1GXD C;  1O7Y A;  4KV6 A;  3T56 B;  4CKC A;  1ROD A;  1PTO B;  5IGB A;  3BS1 A;  3S1M B;  5DEH A;  1ONL A;  2XWB B;  1F9P A;  1E2W A;  4F88 A;  1DYQ A;  1EY0 A;  1X3P A;  2CHB D;  4BA2 I;  1UNS A;  3LNN A;  1TS5 A;  5G3L F;  1B2T A;  4TRD A;  2Z4I A;  1FYC A;  4RH6 A;  1IYV A;  3K5L A;  2F0U A;  2PPB C;  4HN7 A;  4XT3 B;  4HMJ A;  4KMU C;  2PCF B;  5K36 H;  5IOC A;  1CA6 A;  3K58 A;  4KKU A;  3S1R B;  2B2Y C;  4N9T A;  4A93 B;  4RFB A;  4DK1 A;  3J7Y W;  5T1G A;  3IAY A;  1CA5 A;  3BZD B;  5ELB A;  1LAB A;  5BN5 A;  5I2X A;  2FHT A;  3A54 A;  4B9W A;  4V0B A;  2NTS A;  2SNS A;  4OIK A;  2I07 B;  4KN4 C;  4K5V A;  2EYH A;  4IFD H;  2Q8R E;  3J81 L;  3SDZ A;  2TMP A;  4M1U B;  2E75 C;  2KED A;  3VR4 A;  3RZD B;  2IT1 A;  3K7A B;  1WD0 A;  4Z9C B;  2Y0S B;  1BQQ T;  3RD4 A;  4K2K A;  2AUK A;  1BCP D;  2E2I B;  3OHX C;  4PMW A;  3DWA A;  1HXY D;  5COY A;  3X3N A;  5JVG 3;  1MI2 A;  1I4X A;  1LTS D;  1OXU A;  1TS3 A;  1U4L A;  1DON A;  2DY8 A;  4G57 A;  3VYU A;  2FJ2 A;  2NN6 G;  2PZT A;  3A8J E;  4WJW A;  1F2M A;  3EFX D;  1C48 A;  3F2U A;  4K6D A;  4KY5 A;  1CI3 M; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...