3LWEA

The crystal structure of mpp8
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
61
structure length
61
Chain Sequence
GEDVFEVEKILDMKTEGGKVLYKVRWKGYTSDDDTWEPEIHLEDCKEVLLEFRKKIAENKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell cycle
molecule keywords M-phase phosphoprotein 8
publication title Structural basis for specific binding of human MPP8 chromodomain to histone H3 methylated at lysine 9.
pubmed doi rcsb
source organism Homo sapiens
total genus 14
structure length 61
sequence length 61
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3lweA00
1RHPA 1B50A 4IUPA 1NAPA 2B2UA 1X32A 4MN3A 4O42A 4OIJA 5EQ0A 2HCIA 1HA6A 1CM9A 1WTWA 1C8CA 1DONA 1IKLA 2EOTA 1EL0A 3TN2A 1ESRA 2XIWA 5CORA 1CA5A 4UAIA 1PFMA 2NYZD 2B2TC 3IFDA 4IUUA 5JJZA 1CA6A 2SDFA 1TVXA 1PDQA 4U68A 1BO0A 2DY8A 4DN4M 1G2SA 1F9PA 4QUFA 1RODA 1JICA 2X6LA 1EIHA 2X6GA 3F2UA 2VXWA 4RAUC 5T1GA 2J7ZA 2JYOA 1MSHA 3UI2A 3I8ZA 1AZQA 1HUNA 1VMPA 1GUWA 2M2LA 3FPUB 1DOLA 2L12A 1LV9A 2RA4A 1NR4A 1PLFA 1ZXTA 1JE4A 4IUQA 3Q6SA 1MSGA 2B2VA 2X69A 4ZKCB 3GV6A 3SVMA 2NWGA 2MP1A 2K03A 1WTQA 5DNFA 1HFGA 1IL8A 2HDLA 2RSNA 3DM1A 3KUPA 1B4OA 4LMQD 2Q8TA 2MJ8A 1ILQA 1F9SA 1HFNA 2JP1A 2KOLA 4QUCA 4MHEA 2B2UC 2RSOA 1ILPA 2KECA 1O7YA 1RTOA 4XDXA 1QG7A 2MPMA 2KEDA 3G7LA 4ZLTF 1G91A 3IL8A 5D14A 2B2YA 5T1IA 2HCCA 3TZDA 1HRJA 4X3KA 3GV3A 5E4WC 4R9WA 1XYIA 1SAPA 5EJWA 1DOMA 2MGSA 2EE1A 1BBXC 1X3PA 3DEPA 1F9QA 1B2TA 1U4RA 3H91A 4IUTA 2B2WA 4X3SA 2L11A 1BNZA 2IL8A 2L4NA 4R8IA 5EPKA 3D6WA 1WTRA 1WTOA 1AP0A 2K05A 5AFWA 2FINB 4CJ1B 4ZAIA 1F9RA 1J8IA 1X3QA 1G6ZA 1NR2A 4ZKBB 1MI2A 2NZ1D 3ONAB 5CBAE 1BF4A 1AZPA 2K04A 1KNAA 1QE6A 1O7ZA 2K28A 2L9HA 4HAEA 2B2VC 3R93A 1XX8A 1ML0D 1RJTA 4HSVA 5CMDA 4ZK9B 1M8AA 2K01A 1U4LA 2N55A 3KBXA 1ICWA 3P7JA 4RA8A 2BDNA 1WTXA 1KNEA 2D9UA 2HDMA 2N88A 1S4ZA 2B2TA 2EPBA 3I3CA 3MWYW 5EKIA 1WTPA 1J9OA 2FJ2A 4RWSC 1HHVA 1F2LA 1U4MA 1EIGA 4CJ0B 5EPJA 1U4PA 1WTVA 1DOKA 2DY7A 5D65A 5E4XA 1DZ1A 4IUVA 1NCVA 2B2YC 2FFKB 4X3UA 4NW2A 1O80A 1PFBA 2H1EA 2HUGA 3LWEA 1WD0A 1RTNA 5EPLA 2KEEA 3I90A 1E0BA 3MTSA 4CJ2C 1HUMA 4X3TA 1PFNA 1WVLA 2KVMA 3FDTA 5COYA 4HCSA 2B2WC 1EOTA 2FMMA 1IKMA 2L1BA 4XT1B 1A15A 1MGSA 2K1BA 3QO2A 4OIKA 1WD1A 3HP3A 1B53A 1EQTA 1QNKA 4HEDA 2RVLA 3N52A 1G2TA 2Q8RE 2CVRA 1VMCA 2KUMA 1SDFA 2R3ZA 4XT3B 1B3AA 4IURA 1Q3LA 1SSOA 3I91A 2FHTA 5CBEE 3DEOA
chains in the Genus database with same CATH superfamily
3HOZG 1XXGA 2B2UA 3J7AF 1GUTA 1BDOA 2EYLA 3NP8A 4AYBG 1OTCA 3TSSA 2P5ZX 4GLAC 2XVSA 3I4OA 2SEBD 4N8X1 1JOKA 4NPSA 1Y1VG 2UXDQ 2IX3A 1JOOA 4IUUA 4J8QA 5JJKA 2EDGA 2MO1A 1S5DD 3CW2C 2SNMA 5IT9E 1JICA 5IYDH 1PH5A 1HUNA 1FNWA 1LTLA 3BDOA 2F4VQ 1Y8PB 4DK0A 2M2LA 2F52A 2CWAA 5I9PA 2RA4A 1NR4A 1I6HH 2JA7G 3GV6A 3P75A 1VQ7A 1VQIA 2RHQB 5CV5A 3SE0A 3DM1A 5IYBG 4LMQD 1VQHA 2Q8TA 1VQLA 1BVSA 1O7IA 2F0HA 4MTNA 1W6JA 2Z6KA 1TWAH 4IJHA 1HR0L 4KHPL 4DV5Q 4JI1L 4G7HC 1XTCD 3KK7A 1MHWC 4KN7C 1JJGA 4XTCS 1BBXC 2OXPA 2OEOA 3MXNA 1U0LA 1EQQA 4HMIA 1LABA 4WORA 1WI5A 3AU7A 4B3SL 1B70B 4TKOB 3W5OA 1KD1C 3LWUA 3HFZB 3OIPA 1QVCA 2B2VC 2K5DA 5NUCA 3H15A 4IALA 4HSPA 2EY1A 4A3KH 1Q82C 1SE8A 1DD2A 1LACA 4JVZA 2MHVA 2R6GA 5IGDA 1MD2D 4XYOA 2QF7A 1CKMA 3AQQA 3HOWB 4A3CH 3I4NH 2F3IA 5C44G 2PNHA 1STAA 3VA5A 5D65A 5E4XA 1BCPF 5ELBA 4CKCA 1J6QA 5BR8L 3JAME 2HHHL 1NNXA 1STBA 4X3TA 3KLSX 5CC4A 2VQEQ 2A6HC 2VQFQ 2OCEA 1EOTA 1PTOH 3HKZB 3A0JA 1E22A 1H9SA 5CV8A 1B53A 1Q81C 2CH4A 4JI7L 3KF8A 2ID0A 3OSOA 4K0KL 5FO7B 1IBKQ 5LMNL 1SDFA 1G291 3OOCA 1YEZA 3DEOA 1RHPA 3EJIA 5EQ0A 4UPAA 1E1TA 4KY7A 2K7VA 2PYKA 4A3GB 1HA6A 2RDFA 5I4DA 3SR1A 1ZYRC 1PH6A 3W2DA 2R93H 1GUSA 3M4PA 4X66L 3EROA 1CA6A 2A74C 4JI6Q 4QUFA 4XIGS 3KFUA 2J7ZA 4Y52H 1WCMH 5I2XA 4RKBA 1XNRL 1A62A 2CH4W 2JN4A 5C3EH 4A93B 2NWGA 3H0GG 2I5LX 5DNFA 5ELDA 3R3OA 4C1NK 3GTGB 1W2BA 4LF6L 1A6XA 4QIWB 2EJFC 1EYGA 4UY8C 4JOIC 4KHPQ 4F8MA 1LT3D 1O7YA 3MEHA 4JI1Q 1Y69U 4EVOA 2MPMA 1LTTD 1TWHH 2K5WA 4LK1C 5ELNA 1EY5A 1IL2A 3UE0A 1T5EA 2G5DA 3HOUH 1F9QA 3HOZB 2ZTCA 2NTSA 4X3SA 5J3BA 5GADC 3T1HL 4AYBB 4YWKA 2F1MA 1LTRD 4GNXA 1S72A 4B3SQ 3NTHA 5AFWA 1TS3A 2HQEA 3FHWA 4DK1A 1Y1VB 4CJ1B 4ZRZA 1K8GA 4BBSG 4O1NA 1HQRD 2BH8A 4J1MA 4WRDA 5CMDA 1D1KA 4ZK9B 1STYA 1WTHA 3NENA 4CDDC 4PMWA 2ICIA 4CDCC 2A68D 1YHQA 4Z9CB 1YBYA 4CGYB 2JA7B 4IOCA 2BA1A 4A3MH 1DZ1A 4JG2A 5BR8Q 2HHHQ 2HUGA 1E2WA 1GUGA 5EPLA 5M5YB 3C3LA 4LFBL 3OYYA 2FMMA 4G57A 1I5FA 1MGSA 4OIKA 2N78A 4JI7Q 3P20A 4HEDA 5LMNQ 1AE2A 1TY0A 2ENBA 2TSSA 4LAAA 2R3ZA 1PRTC 2F3VA 4L5RC 2BH2A 2L0CA 1WTWA 4RGTA 3NPPA 1FGUA 5TSSA 4C3HG 3HEJA 1BUVT 1NMGA 4X66Q 1PFMA 2NYZD 1V8QA 3MZ5A 1Y8NB 5KEEA 4OO1G 5CV7A 2VY3A 2Q8IB 3OW2A 4CBVA 3N6RA 1N34L 3CRKC 1XNRQ 3FPUB 2CWPA 2YTYA 3H6MA 1E3PA 2X69A 4A3IG 1N8RC 4RKLA 1EY9A 3T51B 1SYDA 2GN5A 2PW7A 1YJWA 4WJ3M 4LF7L 3BVGA 1F9SA 4YHHL 3S17B 3KBGA 5C4JH 4HIKA 2PQEA 1DYQA 1QG7A 1YHBA 3TZDA 1AH9A 1YNJC 1ET6A 1SAPA 1CHPD 5L37A 3I4LA 2QW7A 2EXDA 3W3AA 3T1HQ 4A3JH 4G4KA 1I6VC 5I2YA 1SLJA 1SNDA 3CCVA 2L5TA 1CKOA 1PZID 1AN8A 4Y7NH 2K04A 4QMGA 4X64L 2L9HA 2A73B 2ZM6L 4K6DA 4OO1I 1PYSB 2UUCL 4ZYSA 4QGUA 3T13A 5M5WB 2N3SA 3MHBA 2F0SA 4H7BA 3MEFA 3OW7A 2VW9A 2OT2A 3ERSX 3H0GB 1LUZA 1MJCA 2VUMG 1PFBA 3OTOL 1WD0A 3VYRA 4A3GH 1D7QA 4GN5A 4LFBQ 2Z8LA 1QUQB 3FDTA 3RZOB 1STGA 2L1BA 1OXXK 2KHIA 1E2ZA 1BR9A 3J7YW 3E0EA 2M9VA 5FOBB 3WOEA 2CVRA 2K6AA 3J80E 3TREA 5J22A 3A56A 3G6JB 2QGQA 5M3FG 3H3VH 1B9NA 3TN2A 3CP0A 3A55A 4KHVA 3I2ZA 3M3YH 3S1NB 3DMUA 2JXMB 4BBSB 2YTXA 4TSSA 3GTGH 3K58A 4WJWA 1PDQA 1K73C 1BO0A 1JWUD 2M00A 2F0KA 2BE5C 2JA8G 1HZCA 2JYOA 2MUYA 1TR5A 1VQJA 3T16A 1ZKOA 5C6AA 1OXUA 1Q46A 1CK1A 4RCNA 3EIVA 1ICFB 1BQQT 1YJNA 5IGCA 2CFMA 4FNFA 4LF7Q 3KOJA 4YHHQ 4KY6A 1II3A 2MJ8A 1TWCH 1TWFH 2KOLA 3PV0A 4LFAL 2HT1A 2RCNA 4YY3L 4DAYB 2XN9C 3H09A 5JEAH 2K52A 2EYPA 3G7LA 1E24A 3TQYA 4BA1I 2EZVA 1KLUD 3PQIA 1H9JA 2AWOA 1IZ6A 3RMHA 2L4NA 3HRZC 4EX5A 4C3HB 3CKIB 4LF5L 2F0MA 2FINB 2JE6I 2R7FA 4HJ7A 4X64Q 3ONAB 4NXML 5CBAE 4X6AH 1PH9A 2ZM6Q 3M9BA 3P1HA 1JWSD 1TKWB 2K28A 2Z4IA 4HAEA 5EKKA 2CQOA 4CKBA 2NVYB 4HJ5A 1YITA 2B8FA 2UUCQ 4P75A 3R8BA 3I56A 1M4VA 4OX9L 3J81i 3HOXG 2EQSA 1JT8A 3KDFA 5CV9A 3DWPA 1KNEA 4L5SA 1I50B 3I3CA 3I7FA 5EKIA 1CTMA 4GOPA 5EPJA 4A3IB 3OTOQ 2B2YC 2GVAA 4DF7A 1N33L 1GJXA 5K36H 3MXUA 4JW0A 1Y1WH 5E3FA 3BVZA 2RBMA 4DAMA 2N49A 4XT1B 2KJXA 4FF1A 5J1ZA 1D6EC 1EZ8A 4I7AA 5DEHA 3A8KE 4DUZL 4O0AA 3I73A 2OTLA 5FJ8G 1NMFA 3AFQA 4BBRG 1KDBA 1UAPA 2RF4A 2PMZE 2JA5G 4DR1Q 5M5XH 4C3JB 2IY5B 2EOTA 1L1OA 1Q8IA 4DV1L 3L2PA 1Q1EA 1TXYA 3GTOH 4UAIA 1FNVA 4KJNA 2R7ZG 2R92G 4PV1C 1F9PA 3D6CA 3IKJA 2QA4A 1JE5A 4KHZA 4FP5D 1DOLA 2EYJA 1B9MA 1RF2D 1CSQA 4JCVE 2VUMB 4ABNA 4EQPA 1I4HA 1HCZA 2HDLA 3A8IE 4AYBE 3OPOA 1HQMC 2R7DA 4NKLA 4LFAQ 5DLQE 1D2BA 2RCFA 3A5ZB 4OL7A 2AQ1B 4RGNA 1K0RA 4KV6A 2WP8J 3NUCA 2EYMA 4K2LA 1E1OA 2DUDA 3CXCA 2A6EC 5F2DA 5M3FB 3H91A 3BZCA 3TP5A 3K80C 2IL8A 4R8IA 1K3RA 5EPKA 4LF5Q 5BN5A 2F0DA 1V1PA 3BDCA 3E0JA 3GTMB 4NXMQ 2E2IB 1VQGA 1HXYD 4R4QA 2JA8B 1GVPA 5K5PA 1I3QB 1A8VA 4POGA 1OXSC 3ZJYC 1U4LA 4BXXG 1ET9A 4A3EG 1UNSA 2VZAA 4JOIA 1U4MA 1EEID 2K33A 4OWTB 1DOKA 3K5LA 1N33Q 2Z9HA 4APVA 1FJGL 2BCOA 2EXZA 2H1EA 4DK6C 1E0BA 4X65L 4IFDG 1WVLA 2KVMA 3PO2G 4JBMA 4FF4A 3RLFA 4RGMA 4BY1G 1H95A 3CCSA 2PPBC 1QNKA 4DUZQ 1ZEQX 3N52A 1G2TA 5GAHC 3Q23A 1TS4A 4LF8L 4KLKA 1HH2P 4UP8A 3HS0C 3KF6B 3L3OC 2YU9B 1HJPA 3T1YL 3QOLA 4DV1Q 1KHIA 3E6ZX 2WIIB 3OIQA 1XJVA 2WFWA 1AFPA 1R4PB 1QJOA 1EIFA 4C3IG 4B9XA 1WOCA 4G7OC 1B44D 1RODA 3D3RA 3J7AV 3GTKB 4KD3A 3URYA 3HOXB 3HOYG 1AZQA 4OWWB 2LMCB 1DGSA 3SHLA 4LUVA 4PZ8A 3V2TA 1EY0A 1JJCB 4IUQA 2EJGC 4HIMA 1BBUA 2LFNA 3L0OA 3G4SA 3CMEA 1BCPC 3C2PA 2WB1G 4JBKA 1HFGA 1K83H 2PW5A 1ILQA 4OXPA 3GTQB 4IN3A 5M3MG 2KCTA 4A3DG 3MFGA 1RTOA 4IFDI 1QVFA 5D3DA 5EKLA 3DM3A 1SYEA 2KEDA 3EQLC 1QCBD 2D0PA 1HA5A 2NVYH 2JSOA 5GQOA 4R9WA 1SE4A 2UUBL 2JA6H 2EE1A 3IFTA 3A5UA 1XTDA 4BBRB 1SFOH 1HZBA 4IUTA 4A75A 4UP7A 2JA5B 1UE6A 3CQZH 5FLXL 3D4RA 5KIXA 1IYVA 2EVBA 4A3IH 2F0LA 1F9RA 1TWGH 5IYCG 4IOAA 3TBIB 2R7ZB 2R92B 1EWCA 3RNUA 4K5WA 3BYYB 1FL0A 3KLWA 1JC7A 1PH1A 4RA8A 1D5MC 1ICWA 3RUZA 4RHSA 5D3IB 2D9UA 4O2DA 2I0QA 4P72A 4DV4Q 4UDUC 3D8GA 3W1GA 1PTOD 5FLMG 1EQVA 1FJGQ 4A3FG 2F0FA 4TVAB 1YNXA 3QG1A 4X3UA 4J15A 1QWYA 2CW0D 3PIO3 3PIOA 4C3JH 4X65Q 3ER0A 4LF4Q 4HIDA 3C1FA 3FKIG 3ND8A 1JJ2A 1PRTB 1EOVA 1IKMA 5C3WA 4HCSA 4IUNA 2PZWA 1OXVA 2EY6A 2KCNA 1QOHA 1MJEA 4LF8Q 3ULJA 2Q8RE 3PO3G 1C9OA 1OXTA 1GKHA 1TT2A 2QEXA 5C4XB 3GTJB 5A35A 2CW0C 1VQMA 3T1YQ 1B50A 2R61A 4JPBW 4MN3A 2WINB 3NSWA 1W3SA 4OIJA 4BWGB 2Z6BA 2IWHA 1VQEA 2XWBB 1N32L 2LXKA 3VYSA 2AMCB 2OQ0A 3S14B 5EGTA 3SK6A 1C0AA 2F0TA 4QY7A 4L5QA 1VQKA 2X6GA 5T1GA 3U9SA 5KRUA 1MSHA 2HQLA 2PO4A 1I4XA 2YTVA 5KNDA 1MKHA 1VQFA 2QILA 3FRPB 3J7ZC 5ELFA 1SNMA 4GLXA 3WOFA 3FMCA 3DWAA 1X55A 3CCUA 5JJIA 3KUPA 5EBDA 3U9OA 1EWHA 3S9WA 3BVMA 2E2IH 1LO5D 4BY1B 3MVVA 2UUBQ 2PI2E 1RIPA 2E5LL 1VQAA 1I3QH 5IP9H 1DOMA 2K75A 1EY8A 4FVMA 2PMZB 3K6OA 3FEWX 1D8LA 2NVXB 5FLXc 1KXLA 4I7ZC 1EUJA 2F03A 4IPGA 2Q2UA 4A3BG 1G6ZA 3UDIA 4C3IB 1LTBD 4JI0L 3R93A 1HR0Q 4JI4L 1UWVA 1CHQD 1HPCA 4FDBA 5JVH3 3HOYB 3GQBA 1YNND 4M1UB 1Z7TA 1PTOF 1K8AC 3GTPB 2B2TA 1HHVA 1X3EA 3UDGA 2F0GA 1Y14B 1WTVA 1IYUA 1ENCA 1HNZL 4RG1A 1RD9D 3QB3A 3V96A 1NSNS 2KEEA 1A3TA 1HUMA 3BJUA 1X65A 1XWEA 1YNNC 3AEVA 4JI2L 2B2WC 3GTLB 4LUZA 4FXGC 5C4ZA 1NE3A 4DV3L 3STBD 1UE1A 2I5HA 2I5MX 1LTID 4RCOA 3U50C 2C9OA 1Q3LA 2YYZA 4LFCL 1Q8KA 1F2MA 1S3OA 3HOVH 1VQOA 3ND9A 2HIVA 4MZ9A 3K59A 2Z0SA 3S1RB 1C8CA 4BY7H 1N32Q 2H5XA 3M4OB 3PMFA 2NVTB 2UXCL 1VQCA 5G3LD 5JJZA 4NMZA 1DCZA 1TVXA 2A68C 1SRUA 5I9OA 1PYWD 2B63G 4K0KQ 2LSSA 4L5TA 2DNEA 1LTGD 2F4IA 1EFID 1EU3A 1SEBD 1JE4A 5FJ8H 1ZXTA 2GVBA 1N9WA 4A3FB 1V1QA 4MIUA 5LMUL 1LT5D 1PH7A 1VQ8A 1JB3A 3OMCA 1JR0D 2E2JB 1ASZA 4OWXB 3FKIB 2MQHA 2OWOA 3VYUA 4PZ6A 2B2UC 1YJ9A 2KECA 2RDGA 2E2DC 3D31A 5D14A 2E5LQ 1K0SA 2ZXRA 3PO3B 3U4ZA 4ZQ3A 2NZOA 4WJ4A 2WAQG 2FXQA 2MGSA 1CZWA 2O4XA 3NWTA 1U4RA 4HTHA 3PUZA 1CQVA 3V05A 5C44B 3ICEA 3BG3A 3MAQA 1PH2A 5C5LA 2WACA 4GNXB 1SXTA 4LF6Q 1B1ZA 3VR3A 4ZKBB 4JI0Q 1MI2A 1BF4A 4JI4Q 2NN6H 2IPKD 4DNIA 5IYDG 3T53B 1XX8A 4LWCA 4GZYC 1DM0B 2KBNA 1WTXA 5CYUA 3DHQA 1PV4A 2KCCA 2NVQB 5IGGA 2ZT9C 1HZ9A 2FJ2A 2Z6KC 1Y8OB 5C4XH 4A3LH 1YHAA 3HOWH 1HNZQ 5A2QE 1E7ZA 3S15B 4HJAA 1L0XB 1HTPA 1GXDC 3I90A 4JI2Q 1K3BC 3CAMA 5C0XH 3MFYA 4DV3Q 3PF5A 1F2YA 4RH6A 3E3XA 5AJ3L 3UDXA 4JK1C 4LFCQ 1G6PA 1YVCA 4XT3B 3Q0AA 2K5VA 1O7LA 4PG3A 3CCQA 1VDZA 5IGFA 1CM9A 4ZUJA 2E8GA 5G3LF 4A76A 4A3BB 4DAPA 3H3VC 2E2HB 1CA5A 2UXCQ 2E76C 4HN7A 2PQAA 1KRSA 3K8AA 4DAYA 2MNAA 2RHSB 1HNWL 1T5XD 3AB9A 3BU2A 4K2KA 4A3KG 4LUOA 3OMGA 4BY1H 1IYJB 1IHZA 3F2BA 4UP9A 5M9OA 2PCFB 1V43A 1UE7A 3SEBA 2AKWB 1PRTF 3I4NG 2VB3X 1TY2A 3SK8A 4DR4L 3S1MB 5FLXE 5LMUQ 2NB0A 3RN5A 1D5ZC 2NVXH 4GN3B 2MP1A 1U9RA 2K03A 3NELA 1KRTA 1IL8A 1SNQA 4A93H 1C4QA 3RZDB 1D5XC 1EYAA 1VCIA 5IE8A 1X6OA 3CF5A 5C3XA 1N34Q 2CCZA 3DWQA 3PGZA 5IP7H 2K4KA 2BOSA 1FR3A 3GTPH 3K5NA 1GOZA 1CFMA 4GKKL 2R93G 3HOZH 3NHHA 4Q0FA 4DV0L 3S16B 2EY5A 3DXJC 1CI3M 3K7AB 2NZ1D 4DR3L 4IFDJ 2Y0SE 1Y1VH 4FF2A 2B63B 3JAMi 4DR2L 1KDCA 4RGOS 3Q24A 1ML0D 4HSVA 1WCMG 2V4DA 3P7JA 4NB3A 2DNCA 1BOSA 4E6IA 2EPBA 1M1KC 3NQIA 4JI8L 1X54A 4RWSC 5C3EG 1WJJA 3TEHB 1GUNA 1KTKA 4RHRA 3NTIA 4ULLA 2PZUA 2JA7H 2J4XA 1SN8A 1A3UA 2JJQA 4HR7B 5IYBH 3JAML 3EA6A 2EIFA 4C2MB 4JI3L 5M5YH 5AJ3Q 3FP9A 4B3RL 2ZJPA 4K6LA 1X3GA 4GNXC 3HOUG 3NBIA 2O5IC 1SSOA 3I91A 3M4YA 2ZXOA 2F3WA 4IPCA 3S2HB 2BA0A 3LNNA 4EQNA 4IPHA 4JV5L 1VQ5A 5CORA 1G8ZD 4XYQA 1HNWQ 5BN4A 2RDHA 5KYLA 1TU2B 3J81L 3M85A 3E5SA 4JI5L 2VXWA 1BCPB 4IZ8A 1I6HB 1I4QA 3RN2A 3Q8DA 1GHKA 1PLFA 4A3MG 2IJ0A 3CRLC 2E74C 2B2VA 4ZKCB 1PMRA 5FK9C 2V1CC 2NTTA 5ELCA 3SVMA 4QQBX 5C44H 1EYCA 2K5QA 1TWAB 1P16A 4POFA 1GO3E 3Q22A 4K5XA 3U58A 2JP1A 3QIAA 3T4AC 1KABA 5LL6S 5EBCA 1F2ZA 2K5HA 4IJLA 3S17H 2CQAA 1UE5A 4ILWA 3HGBA 2NBFA 3WDNA 1V9PA 2D5DA 4TQUS 3C46A 1XNQL 4GKKQ 4HJ8A 1BNZA 3PUVA 3KLRA 2E75C 2I07B 3S24A 4ME3A 4DV0Q 2B39A 3K0XA 2K05A 3BZDB 2WB1E 2IHEA 4DPGA 2F0VA 2Y0SG 3BS1A 1SE2A 4DR2Q 4YY3Q 1KNAA 2PNRC 2N8NA 3JC66 5IWAL 4OGQC 1IBLL 4PZ7A 4UHVA 3CMAA 3KBXA 4JI8Q 1C7YA 2HDMA 1IBML 1JWMD 4P71A 1WTPA 2EYFA 1F2LA 2ZTEA 3NTKA 3HG9A 2A69D 5M5WH 4KKSA 4NW2A 1O80A 5I6YA 3JAMc 1RTNA 3H0GH 3F8TA 4JI3Q 2JA9A 4B3RQ 4AIMA 4CDFC 1XPUA 4OX9Q 1WD1A 3QO2A 1YIJA 2KA7A 3RZOH 1XPRA 5HGTA 4A3JG 2KUMA 1VQ9A 1UUPA 3K57A 2DJFC 4DUYL 3RLOA 4R1JA 2VS1A 1K28A 1L2FA 4JV5Q 2R93B 3ZYYX 4GN4B 3VR2A 3ERQA 3BZKA 4U673 3IFDA 1R9TB 3RZDH 3S1NH 5HY6A 3HKZG 3PUXA 3J81c 3S2DB 1EZ6A 4JI5Q 2Q2HA 1SMYD 4BBSH 4L6TB 1WCMB 3F2UA 4PQXA 1A63A 3PCOB 1ONLA 3TP7A 4DXFA 5C3EB 3QJYA 4EQ5A 2IT1A 4A3GG 4ME5A 3QWNA 4AH6A 3BDLA 1VQ4A 2UXBL 2OF1A 1F77A 3T56B 1TWHB 2AQ3B 4JBWA 4QUCA 3K7AH 3NE5B 3K7UC 4KK7A 3TS2A 5T1IA 2HCCA 3HOUB 3I4MG 2D62A 2EY2A 5I6WA 3A74A 1KC8C 1S40A 3NBHB 4F87A 2EYHA 4L8JA 1S5ED 1WTOA 2F0EA 5KNBA 1NR2A 1LTAD 4C3HH 4FXDA 2RQXA 5CGKA 4ID6A 1S5BD 1QE6A 5IWAQ 2OTJA 1IBLQ 4KKTA 3WWVA 4OO1H 4DR5L 5FO9B 1PHJA 3OWFA 1CSPA 4B3TL 2EJMA 3K0YA 2MFIA 4A3MB 1SROA 3K5OA 1LT6D 1I50H 3J80i 3PIP3 3PIPA 3F1ZA 2FFKB 4RMFA 1PXUA 3S2HH 3KJOA 2ZJQA 5JEAG 5KYIA 4M8AA 1CKNB 4JI6L 2XWJB 3A54A 1SJED 2RVLA 3CPFA 3CD6A 1LM0A 1DJRD 1V1OA 2IW3A 4BS9A 4DNRB 4DUYQ 1VF5C 1PH4A 1FNUA 1ESFA 4OELB 1B3AA 3J80L 3K5MA 4PMCA 5CV6A 3H3VI 4IUPA 1UEAB 1R4QB 3D0FA 3X3NA 1IKLA 1CUKA 2XIWA 1N36L 2Y0SB 1KLGD 5HURA 4GOPC 3F2DA 2KHSA 2SDFA 2VNUD 1G2SA 4KI0A 4CKEA 3G48A 3UDFA 4C56C 5CR3A 4B08A 2HIXA 5LMNW 1PTOC 1D1IA 1GUWA 3VR6A 3M4QA 1SNCA 5BN3A 4GLVB 2IX1A 3TS0A 4NXNL 3TP8A 3GD7A 5K36G 2UXBQ 5ELEA 4DV2L 1WTQA 3W1BA 2HD3A 1Y1WG 4HMJA 3BYTB 5C4JB 2VUMH 1HFNA 1L0WA 1I94L 2LXJA 1P8LA 1HNXL 4H13C 3RLNA 2Z1CA 2K5NA 4XDXA 4YWMA 1LTSD 4ZLTF 3IL8A 1L1OC 2A6HD 4A3JB 4A3EB 3QOJA 5EJWA 3O13A 4DR6L 2K50A 1B2TA 1CQFA 4X62L 1Q12A 2L11A 1KL9A 3A7AB 5M3FH 2NUCA 3TRZA 4ZUIA 4WFN3 1PFSA 5JAVA 4Y7NB 1A3VA 4ZAIA 1J8IA 3X3MA 2B8GA 3R2IA 1DXMA 4EGVA 3CC7A 4DFAA 4XQJA 3GTMH 1O7ZA 2IX0A 3PO2B 1ZYRD 4DR5Q 1SYCA 2YV5A 2K32A 2ZJRA 2C35B 4B3TQ 4ZCKA 2JA8H 1SMXA 1Q90A 3I55A 1PH8A 3MWYW 1J9OA 4R8NA 5JVG3 2WAQE 4B3ML 3VDYA 1U4PA 2F0QA 3MXNB 3ULLA 4IUVA 4H44C 1NCVA 2ASBA 4S3SA 3GDEA 2WKDA 1IXRA 2XNAC 4P2CB 1ENAA 1UEBA 3MTSA 2A19A 2Q2IA 3J81E 4RFBA 1R9TH 4XQQA 3I4MB 3S2DH 4GKJL 2B29A 4Q5VA 1A0IA 3J80c 2KCMA 1K8MA 1XMOL 3PF4A 2TMPA 2FHTA 3CU7A 4O42A 1NAPA 1X9NA 3RD4A 3M3YB 1VF7A 1N36Q 1EL0A 2WB1B 2YU9H 1FYCA 4YCUA 1K9MC 5M3MB 4A3DB 4U68A 3MC0B 1Q1BA 1STHA 1S5CD 1H9SB 3CCEA 1PH3A 3KF8B 3GTKH 3HOXH 1O78A 4DR7L 4NXNQ 1QILA 4DV2Q 1TWCB 3H94A 1X3FA 3TMEA 1TWFB 1I94Q 1B4OA 1HNXQ 1I4RA 1STNA 3STBC 3EVQA 1BBWA 1ENFA 4KD4A 3MXPA 3GTQH 4KTAA 5FKAC 4CDEC 3PUWA 2FMCA 4DA2A 1HRJA 2B2YA 2F0UA 1GD7A 3GV3A 4X3KA 3SXHA 3S1QB 4DR6Q 5E4WC 1XYIA 3L7ZC 4HIOA 4X62Q 4V190 4HCEA 3A8JE 2IHFA 1EU4A 2F0IA 2XRSD 3NQTA 1SR3A 3PUYA 4BBRH 2QCPX 1PRTD 3E9HA 1XPOA 2L55A 2JA5H 1AP0A 1BXTA 2JEAI 1A2UA 1AE3A 2R7ZH 1EY6A 4L63B 3CC2A 2R92H 3K81C 1RJTA 4KMUC 1ILPA 1XMQL 1S4ZA 4B3MQ 4JYAL 1NJIC 1PZJD 3LX0A 1YI2A 2F0OA 2DY7A 2BDOA 2EYOA 1WYDA 2A8VA 1TS2A 3LGJA 1FGBD 3HKSA 1Y1WB 1EFWA 4DV7L 4P74A 1CZGA 1EY7A 1QUQA 1RCVD 2WV6D 3D4WA 4GKJQ 3MXGA 2K1BA 1JOQA 2AQ2B 3DUZA 2JA6G 4IQZA 2A1AA 1YZ6A 1XMOQ 1SJHD 1VMCA 4MNOA 2O5JC 2KHJA 4KKUA 2VB2X 4PNYA 4IURA 5M5XB 4K8IA 2UUAL 3UE1A 1YNJD 4OHJA 3CCRA 1X32A 5H1SE 3GTOB 3GTJH 3IAYA 2HCIA 1VQBA 2H4OA 3VYTA 1ASYA 3NEMA 1KAWA 4F7XA 4YIJA 3PSIA 2QDBA 1NBWA 1HTLD 1SNPA 1VQPA 2AUJD 2F0JA 4DAVA 2LY7A 5FO8B 4ODGA 3S14H 2X6LA 3NK9A 2UU9L 1CT1D 3EFXD 5GAEC 4DR7Q 3M7NA 3GO5A 4BXXH 5EAYA 3SK5A 4A3EH 2LS01 5IIFA 1VQNA 1MSGA 1EYDA 4NP5A 1OO9B 4K8JA 3KYHC 4C3JG 1KAAA 4CHTB 1EQRA 4NDXA 4IO9A 4MHEA 2C5CA 2RSOA 4IFDH 2SNSA 4OEMB 4KN4C 3M7GA 3PO2H 1KDAA 3OWEB 3OHXC 1GHJA 5IT9L 2QKIC 5JPNC 4MTKA 1T9HA 4A3CG 1KIXA 3DEPA 2PZTA 2SOBA 1W6KA 4TRDA 2XTIA 4YCVA 4AQYL 3QR8A 1SNOA 3VA7A 1GUOA 1QZGA 1JORA 1C48A 1PVOA 1X3QA 5KNCA 1SBBB 5ELOA 2PI2A 4QL5A 2ATWA 4C3IH 5E7NA 4FF3A 1I4GA 1Q7YC 2B3GA 4K14A 2A5HA 1XMQQ 2K01A 2N55A 1Q86C 2BDNA 3I4MH 4JYAQ 4YCWA 3HOYH 2BE5D 1HZAA 3VR5A 3CCJA 4LW1A 1AEXA 3D4DA 4DR1L 2O2LD 5CV4A 1EWIA 4DV7Q 3LWEA 1TS5A 5C0XJ 4CJ2C 1B7YB 1H9RA 4K5VA 1QNUA 1J5EL 4N9TA 5M3MH 1SYFA 4A3DH 1A15A 5IP9G 1EQTA 3J7A5 3GTLH 2GA4B 2UUAQ 2WKCA 4B9WA 2JQOA 3U4VA 1Z47A 4I65A 3AYHB 1JCKB 1TQOA 1PZKD 2J0TD 3C1EA 5IGEA 2Q2TA 4HJ9A 2B2TC 3S1RH 1TIID 2PQAB 3TZUA 4F88A 5IYCH 4DN4M 1FVIA 3I72A 3M4OH 2UU9Q 2NVTH 4DK3C 3EN2A 1EIHA 3UI2A 4OONA 2WAQB 4ALPA 2AUKA 3S1QH 4C1NI 1E2VA 2QDLA 1G51A 1K83B 2MO0A 2XRQD 2ZTDA 1MBYA 5IY0A 5FLMH 5KGUA 4A3FH 1B8AA 4GS3A 3SDZA 1IW7D 1PYBA 1H9KA 4JBJA 2E2JH 3FKIH 1JMCA 5C5MA 4DGZA 3KLSA 4QB4A 2JA6B 3HKZE 5IT9c 1SFOB 4DU9A 4AQYQ 1X3PA 3SGIA 2OQKA 3HOVG 3PO3H 4DR4Q 3CQZB 1QZHA 1B3QA 3ULPA 5DM63 4BY7G 2DGYA 1TWGB 1IW7C 1Z9FA 1WTRA 1M90C 4JC0A 2ES2A 1A2TA 1NY4A 3E9IA 4XQNA 1SYGA 2LKVA 2NZHA 5DAUA 5JEAJ 4FYDA 4LF9L 2KQ3A 2QEJC 5IGBA 1RDPD 2G9HD 2JK8A 2F0NA 4YWLA 1M8AA 3I70A 1JB7A 2AHOB 1RKNA 4CJ0B 4P73A 2NVQH 2CHBD 3GP7A 3EBEA 1EY4A 4V0BA 4BA2I 1FD7D 5GROA 4LNQA 4DV6L 1J5EQ 4DR3Q 4H0LC 3NWSA 3S15H 5COYA 4QIWE 5IOCA 2JEBI 1VQ6A 4A3KB 5JOBA 3CC4A 1Z6HA 1PA6A 1GM5A 5JPMC 4R4CA 2I46A 2XSCA 2ALYB 3AFPA 3KDFB 3I4NB 5HGQA 1LT4D 4GOPB 3KF6A 5CBEE 5J39A 3DLLA 5LHY1 1NUCA 2A6ED 3MA2B 4J6HA 1DONA 3B6YA 1ESRA 5JJLA 2NN6G 4A3BH 1PTOB 4QCLA 2E2HH 2UXDL 1BKBA 2DY8A 3HZXA 4A4IA 4G7ZC 4IPDA 4RAUC 2A69C 4DNTB 1JQYD 3I8ZA 1STEA 1VMPA 3NBHA 3L9AX 5C4XG 2L12A 4N9PA 2F4VL 3HOWG 1LV9A 4A3LG 5LL6X 1LLRD 3Q6SA 1SYBA 3AMUA 1NTGA 2DN8A 3S1MH 3TP6A 2RSNA 1L1OB 3VR4A 4EQOA 5C0XG 4PMBA 1L0YB 2VL6A 4FXKC 3ITPA 3R2TA 4XXEA 1G91A 3J81j 5C4HA 2DJGC 2Z4HA 3CCMA 4R4TA 4DV5L 5E1FA 4N8FA 4DXGA 1U5KA 4R4IA 4DV4L 2F0PA 2B2WA 1SE3A 3RR5A 3F2CA 2G9DA 4FO2A 4H02A 3D6WA 1MIUA 1EIYB 3G71A 1QB5D 1AW7A 1SMYC 1S5FD 4LF4L 1VQDA 1CKNA 4LF9Q 5IODA 1AZPA 3S16H 3KJPA 2NN6I 1WFQA 5ISRA 4KY5A 2L15A 3G6EA 1H9MA 3IRBA 2B63H 3CPWA 2N88A 1XNQQ 4LJZC 2KENA 2XGTA 1EIGA 4DKAC 4KJOA 3FPPA 3NXWA 4A93G 2ZXPA 4DV6Q 1EEFD 2K14A 5A2QL 1V1PB 1K8OA 1BCPD 1PFNA 4QJFA 5C0XI 1KQSA 1X56A 1I4PA 2ICEC 3SK4A 2VQEL 1LYLA 2VQFL 1HR0W 3CCLA 1VS0A 2F0WA 2CKZB 5GAGC 4QF4A 5IP7G 4C2MH 3CHBD 3FVQA 2AWNA 4R4OA 1IBMQ 2D0OA 5DM73 1RL2A 3HOVB 1IBKL 3HP3A 2RKSA 3TDQA 4BY7B 1QVGA 3A7LA 2D2CC
chains in the Genus database with same CATH topology
1XXGA 2B2UA 3J7AF 1GUTA 1BDOA 2EYLA 3NP8A 3TSSA 2XVSA 2SEBD 1JOKA 2IX3A 1JOOA 4IUUA 4J8QA 2EDGA 1S5DD 2SNMA 5IT9E 1JICA 1HUNA 1FNWA 3BDOA 1Y8PB 4DK0A 2M2LA 5I9PA 2RA4A 1NR4A 3GV6A 3P75A 5CV5A 3SE0A 3DM1A 4LMQD 2Q8TA 2F0HA 1W6JA 4G7HC 1XTCD 3KK7A 4KN7C 4XTCS 1BBXC 2OXPA 2OEOA 3MXNA 4HMIA 1LABA 4WORA 3AU7A 4TKOB 3LWUA 3OIPA 2B2VC 2K5DA 5NUCA 4IALA 4HSPA 2EY1A 1DD2A 1LACA 2MHVA 2R6GA 5IGDA 1MD2D 4XYOA 2QF7A 3HOWB 3VA5A 1STAA 5D65A 5E4XA 1BCPF 5ELBA 4CKCA 3JAME 1STBA 4X3TA 3KLSX 5CC4A 2A6HC 1EOTA 1PTOH 3HKZB 1H9SA 5CV8A 1B53A 3KF8A 2ID0A 3OSOA 5FO7B 1SDFA 1G291 3OOCA 3DEOA 1RHPA 3EJIA 5EQ0A 4KY7A 2K7VA 2PYKA 4A3GB 1HA6A 2RDFA 5I4DA 3SR1A 1ZYRC 3W2DA 1GUSA 3EROA 1CA6A 2A74C 4QUFA 4XIGS 2J7ZA 5I2XA 4RKBA 4A93B 2NWGA 5DNFA 5ELDA 3R3OA 4C1NK 3GTGB 1A6XA 4QIWB 2EJFC 4F8MA 1LT3D 1O7YA 3MEHA 1Y69U 4EVOA 2MPMA 1LTTD 2K5WA 4LK1C 1EY5A 1T5EA 1F9QA 3HOZB 2NTSA 4X3SA 4AYBB 2F1MA 1LTRD 3NTHA 5AFWA 1TS3A 2HQEA 4DK1A 4CJ1B 1Y1VB 4ZRZA 4O1NA 1HQRD 4J1MA 4WRDA 5CMDA 1D1KA 4ZK9B 1STYA 4PMWA 2ICIA 2A68D 4Z9CB 4CGYB 2JA7B 2BA1A 1DZ1A 2HUGA 1E2WA 1GUGA 5EPLA 5M5YB 3C3LA 2FMMA 4G57A 1MGSA 4OIKA 3P20A 4HEDA 1TY0A 2ENBA 2TSSA 4LAAA 2R3ZA 1PRTC 2F3VA 2L0CA 1WTWA 4RGTA 3NPPA 5TSSA 4C3HG 3HEJA 1BUVT 1PFMA 2NYZD 1V8QA 3MZ5A 1Y8NB 5KEEA 4OO1G 5CV7A 2Q8IB 4CBVA 3N6RA 3CRKC 3FPUB 3H6MA 2X69A 4RKLA 1EY9A 3T51B 1SYDA 2PW7A 3BVGA 1F9SA 3S17B 3KBGA 2PQEA 1DYQA 1QG7A 3TZDA 1YNJC 1ET6A 1SAPA 1CHPD 3I4LA 3W3AA 4G4KA 1I6VC 5I2YA 1SNDA 2L5TA 1PZID 1AN8A 2K04A 4QMGA 2L9HA 2A73B 4K6DA 4OO1I 4ZYSA 3T13A 5M5WB 3MHBA 2F0SA 4H7BA 3OW7A 2OT2A 3H0GB 1PFBA 1WD0A 3VYRA 2Z8LA 3FDTA 3RZOB 1STGA 2L1BA 1OXXK 1E2ZA 1BR9A 3J7YW 2M9VA 5FOBB 3WOEA 2CVRA 2K6AA 3J80E 5J22A 3A56A 3G6JB 1B9NA 3TN2A 3A55A 4KHVA 3S1NB 3DMUA 2JXMB 4BBSB 4TSSA 3K58A 4WJWA 1PDQA 1BO0A 1JWUD 2M00A 2F0KA 2BE5C 2JYOA 2MUYA 1TR5A 3T16A 1ZKOA 5C6AA 1OXUA 1CK1A 4RCNA 1BQQT 5IGCA 4FNFA 4KY6A 1II3A 2MJ8A 2KOLA 3PV0A 2XN9C 3H09A 5JEAH 2EYPA 3G7LA 4BA1I 2EZVA 1KLUD 1H9JA 2AWOA 3RMHA 2L4NA 3HRZC 4C3HB 3CKIB 2F0MA 2FINB 2JE6I 3ONAB 5CBAE 4CKBA 3P1HA 1JWSD 1TKWB 2K28A 2Z4IA 4HAEA 5EKKA 2NVYB 2B8FA 3R8BA 1M4VA 5CV9A 3DWPA 1KNEA 1I50B 3I3CA 5EKIA 1CTMA 5EPJA 4A3IB 2B2YC 4DF7A 1GJXA 5K36H 3MXUA 5E3FA 3BVZA 2RBMA 4XT1B 2KJXA 4FF1A 5J1ZA 1D6EC 1EZ8A 5DEHA 3A8KE 3I73A 1KDBA 1UAPA 4C3JB 2EOTA 1Q8IA 1Q1EA 4UAIA 1FNVA 4KJNA 4PV1C 1F9PA 3D6CA 3IKJA 4KHZA 4FP5D 1DOLA 2EYJA 1B9MA 1RF2D 2VUMB 4ABNA 4EQPA 1I4HA 1HCZA 2HDLA 3A8IE 3OPOA 1HQMC 4NKLA 1D2BA 4OL7A 2AQ1B 4RGNA 4KV6A 2WP8J 3NUCA 2EYMA 4K2LA 2A6EC 5F2DA 5M3FB 3H91A 3TP5A 2IL8A 4R8IA 5EPKA 5BN5A 2F0DA 1V1PA 3BDCA 3E0JA 3GTMB 2E2IB 1HXYD 2JA8B 5K5PA 1I3QB 1OXSC 1U4LA 1ET9A 1UNSA 1U4MA 1EEID 2K33A 1DOKA 3K5LA 2BCOA 2EXZA 2H1EA 1E0BA 4IFDG 1WVLA 2KVMA 4FF4A 3RLFA 4RGMA 2PPBC 1QNKA 1ZEQX 3N52A 1G2TA 3Q23A 1TS4A 3HS0C 3L3OC 2YU9B 3QOLA 3E6ZX 2WIIB 3OIQA 1AFPA 1R4PB 1QJOA 4C3IG 4B9XA 4G7OC 1B44D 1RODA 3D3RA 3J7AV 3GTKB 4KD3A 3URYA 3HOXB 1AZQA 2LMCB 3SHLA 3V2TA 1EY0A 4IUQA 2EJGC 2LFNA 1BCPC 3C2PA 1HFGA 2PW5A 1ILQA 3GTQB 4IN3A 3MFGA 1RTOA 4IFDI 5D3DA 5EKLA 1SYEA 2KEDA 3EQLC 1QCBD 1HA5A 2JSOA 4R9WA 1SE4A 2EE1A 3IFTA 4BBRB 4IUTA 2JA5B 5FLXL 3D4RA 5KIXA 1IYVA 2EVBA 2F0LA 1F9RA 3TBIB 2R7ZB 2R92B 1EWCA 4K5WA 3BYYB 1JC7A 4RA8A 1D5MC 1ICWA 3RUZA 4RHSA 5D3IB 2D9UA 4UDUC 3D8GA 1PTOD 1EQVA 2F0FA 3QG1A 4X3UA 1QWYA 2CW0D 3PIO3 3C1FA 3ND8A 1PRTB 1IKMA 5C3WA 4HCSA 4IUNA 2PZWA 1OXVA 2EY6A 2KCNA 1QOHA 2Q8RE 1OXTA 1TT2A 5C4XB 3GTJB 5A35A 2CW0C 1B50A 2R61A 4MN3A 2WINB 3NSWA 4OIJA 4BWGB 2IWHA 2XWBB 3VYSA 3S14B 5EGTA 3SK6A 2F0TA 2X6GA 5T1GA 3U9SA 5KRUA 1MSHA 2PO4A 1I4XA 5KNDA 2QILA 3FRPB 5ELFA 1SNMA 3WOFA 3FMCA 3DWAA 3KUPA 5EBDA 3U9OA 1EWHA 3S9WA 3BVMA 1LO5D 4BY1B 3MVVA 1DOMA 1EY8A 4FVMA 2PMZB 3K6OA 3FEWX 2NVXB 4I7ZC 2F03A 1G6ZA 4C3IB 1LTBD 3R93A 1CHQD 1HPCA 5JVH3 3HOYB 3GQBA 1YNND 4M1UB 1Z7TA 1PTOF 3GTPB 2B2TA 1HHVA 2F0GA 1WTVA 1IYUA 1ENCA 1RD9D 3QB3A 3V96A 1NSNS 2KEEA 1A3TA 1HUMA 1XWEA 1YNNC 2B2WC 3GTLB 4FXGC 5C4ZA 1LTID 4RCOA 2C9OA 1Q3LA 2YYZA 1F2MA 3ND9A 3K59A 3S1RB 1C8CA 3M4OB 3PMFA 2NVTB 5G3LD 5JJZA 4NMZA 1DCZA 1TVXA 2A68C 5I9OA 1PYWD 2DNEA 1LTGD 1EFID 1SEBD 1EU3A 2F4IA 1JE4A 1ZXTA 4A3FB 4MIUA 1LT5D 1JB3A 3OMCA 1JR0D 2E2JB 3FKIB 3VYUA 2B2UC 2KECA 2RDGA 2E2DC 3D31A 5D14A 2ZXRA 3PO3B 4ZQ3A 2MGSA 1CZWA 2O4XA 3NWTA 1U4RA 4HTHA 3PUZA 1CQVA 3V05A 5C44B 3BG3A 3MAQA 5C5LA 2WACA 1SXTA 1B1ZA 3VR3A 4ZKBB 1MI2A 1BF4A 2NN6H 2IPKD 3T53B 1XX8A 4GZYC 1DM0B 1WTXA 5CYUA 3DHQA 2KCCA 2NVQB 5IGGA 2ZT9C 2FJ2A 1Y8OB 5A2QE 3S15B 1L0XB 1HTPA 1GXDC 3I90A 5C0XH 3MFYA 1F2YA 4RH6A 4JK1C 4XT3B 3Q0AA 1O7LA 1VDZA 5IGFA 1CM9A 4ZUJA 5G3LF 4A3BB 4DAPA 3H3VC 2E2HB 1CA5A 2E76C 4HN7A 4DAYA 1T5XD 3AB9A 4K2KA 3OMGA 1IHZA 5M9OA 2PCFB 1V43A 3SEBA 1PRTF 2VB3X 1TY2A 3SK8A 3S1MB 5FLXE 2NB0A 1D5ZC 2MP1A 1U9RA 2K03A 1IL8A 1SNQA 1C4QA 3RZDB 1D5XC 1EYAA 1VCIA 5C3XA 3DWQA 2BOSA 1FR3A 3K5NA 1GOZA 1CFMA 3NHHA 4Q0FA 3S16B 2EY5A 3DXJC 1CI3M 3K7AB 2NZ1D 4IFDJ 4FF2A 2B63B 1KDCA 4RGOS 3Q24A 1ML0D 4HSVA 2V4DA 3P7JA 2DNCA 1BOSA 4E6IA 2EPBA 3NQIA 4RWSC 1GUNA 1KTKA 4RHRA 3NTIA 4ULLA 2PZUA 2J4XA 1A3UA 4HR7B 3JAML 3EA6A 4C2MB 4K6LA 3NBIA 2O5IC 1SSOA 3I91A 3M4YA 2ZXOA 2F3WA 3S2HB 2BA0A 3LNNA 4EQNA 5CORA 1G8ZD 4XYQA 5BN4A 2RDHA 5KYLA 1TU2B 3J81L 3M85A 3E5SA 2VXWA 1BCPB 4IZ8A 1I6HB 1I4QA 1GHKA 1PLFA 2IJ0A 3CRLC 2E74C 2B2VA 4ZKCB 1PMRA 5FK9C 2NTTA 5ELCA 3SVMA 1EYCA 2K5QA 1TWAB 3Q22A 4K5XA 2JP1A 3QIAA 3T4AC 1KABA 5LL6S 5EBCA 1F2ZA 2CQAA 4ILWA 3HGBA 2NBFA 3WDNA 4TQUS 2D5DA 3C46A 1BNZA 3PUVA 3KLRA 2E75C 2I07B 2B39A 2K05A 3BZDB 2F0VA 3BS1A 1SE2A 1KNAA 2PNRC 4OGQC 3KBXA 2HDMA 1JWMD 1WTPA 2EYFA 1F2LA 3NTKA 3HG9A 2A69D 4KKSA 4NW2A 1O80A 5I6YA 1RTNA 1WD1A 3QO2A 2KA7A 5HGTA 2KUMA 1UUPA 3K57A 2R93B 3ZYYX 3VR2A 3ERQA 4U673 3IFDA 1R9TB 3PUXA 3S2DB 1EZ6A 1SMYD 4L6TB 1WCMB 3F2UA 4PQXA 1ONLA 3TP7A 4DXFA 5C3EB 3QJYA 2IT1A 4ME5A 3QWNA 3BDLA 2OF1A 1F77A 3T56B 1TWHB 2AQ3B 4JBWA 4QUCA 3NE5B 4KK7A 5T1IA 2HCCA 3HOUB 2D62A 2EY2A 5I6WA 4F87A 2EYHA 4L8JA 1S5ED 1WTOA 2F0EA 5KNBA 1NR2A 1LTAD 4FXDA 2RQXA 5CGKA 4ID6A 1S5BD 1QE6A 4KKTA 4OO1H 5FO9B 3OWFA 2EJMA 3K0YA 4A3MB 3K5OA 1LT6D 3PIP3 2FFKB 1PXUA 5JEAG 5KYIA 4M8AA 2XWJB 3A54A 1SJED 2RVLA 1DJRD 1V1OA 2IW3A 4BS9A 4DNRB 1VF5C 1FNUA 1ESFA 3J80L 1B3AA 3K5MA 4PMCA 5CV6A 4IUPA 1UEAB 1R4QB 3X3NA 1IKLA 2XIWA 2Y0SB 1KLGD 5HURA 2KHSA 2SDFA 2VNUD 1G2SA 4KI0A 4CKEA 4C56C 5CR3A 4B08A 1PTOC 1D1IA 1GUWA 3VR6A 1SNCA 5BN3A 2IX1A 3TP8A 3GD7A 5K36G 5ELEA 1WTQA 4HMJA 3BYTB 5C4JB 1HFNA 4H13C 2Z1CA 4XDXA 1LTSD 4ZLTF 3IL8A 2A6HD 4A3JB 4A3EB 3QOJA 5EJWA 3O13A 1B2TA 1CQFA 1Q12A 2L11A 3A7AB 2NUCA 4ZUIA 4WFN3 4Y7NB 5JAVA 1A3VA 4ZAIA 1J8IA 3X3MA 2B8GA 3R2IA 1DXMA 4EGVA 4DFAA 4XQJA 3PO2B 1O7ZA 2IX0A 1ZYRD 1SYCA 2K32A 1Q90A 3MWYW 1J9OA 4R8NA 5JVG3 1U4PA 2F0QA 4IUVA 4H44C 1NCVA 4S3SA 2WKDA 2XNAC 4P2CB 1ENAA 3MTSA 3J81E 4RFBA 4XQQA 3I4MB 4Q5VA 1K8MA 2TMPA 2FHTA 3CU7A 4O42A 1NAPA 3RD4A 3M3YB 1VF7A 1EL0A 2WB1B 1FYCA 5M3MB 4A3DB 4U68A 3MC0B 1Q1BA 1STHA 1S5CD 1H9SB 1O78A 1QILA 1TWCB 3H94A 3TMEA 1TWFB 1B4OA 1I4RA 1STNA 3EVQA 1ENFA 4KD4A 3MXPA 4KTAA 5FKAC 3PUWA 2FMCA 4DA2A 1HRJA 2B2YA 2F0UA 4X3KA 3GV3A 3SXHA 3S1QB 5E4WC 1XYIA 3L7ZC 4V190 4HCEA 3A8JE 1EU4A 2F0IA 2XRSD 3NQTA 3PUYA 2QCPX 1PRTD 2L55A 1AP0A 1BXTA 2JEAI 1A2UA 1EY6A 4L63B 1RJTA 4KMUC 1ILPA 1S4ZA 1PZJD 3LX0A 2F0OA 2DY7A 2BDOA 2EYOA 1TS2A 1FGBD 1Y1WB 1CZGA 1EY7A 1RCVD 2WV6D 3D4WA 3MXGA 2K1BA 1JOQA 2AQ2B 3DUZA 4IQZA 1SJHD 1VMCA 2O5JC 4KKUA 5M5XB 2VB2X 4PNYA 4IURA 4K8IA 1YNJD 4OHJA 1X32A 3GTOB 3IAYA 2HCIA 2H4OA 3VYTA 4F7XA 4YIJA 2QDBA 1HTLD 1SNPA 2AUJD 2F0JA 4DAVA 2LY7A 5FO8B 4ODGA 2X6LA 3NK9A 1CT1D 3EFXD 3M7NA 3GO5A 3SK5A 2LS01 5IIFA 1MSGA 1EYDA 4NP5A 1OO9B 4K8JA 4C3JG 1KAAA 4CHTB 4NDXA 4MHEA 2C5CA 2RSOA 4IFDH 2SNSA 4KN4C 3M7GA 1KDAA 3OWEB 3OHXC 1GHJA 5IT9L 2QKIC 5JPNC 3DEPA 2PZTA 2SOBA 1W6KA 4TRDA 1SNOA 3VA7A 1GUOA 1JORA 1C48A 1X3QA 5KNCA 1SBBB 4FF3A 1I4GA 4K14A 2A5HA 2K01A 2N55A 2BDNA 2BE5D 3VR5A 1AEXA 3D4DA 2O2LD 5CV4A 3LWEA 1TS5A 5C0XJ 4CJ2C 1H9RA 4K5VA 1QNUA 4N9TA 1SYFA 1A15A 1EQTA 2GA4B 2WKCA 4B9WA 1Z47A 4I65A 1JCKB 1TQOA 1PZKD 2J0TD 3C1EA 5IGEA 2B2TC 1TIID 3TZUA 4F88A 4DN4M 3I72A 1EIHA 3UI2A 2WAQB 2AUKA 4C1NI 1E2VA 1K83B 2XRQD 1MBYA 5KGUA 3SDZA 1IW7D 1H9KA 5C5MA 4DGZA 3KLSA 4QB4A 2JA6B 1SFOB 4DU9A 1X3PA 3CQZB 5DM63 1TWGB 1IW7C 1WTRA 1A2TA 4XQNA 1SYGA 2LKVA 5DAUA 5JEAJ 4FYDA 2KQ3A 2QEJC 5IGBA 1RDPD 2G9HD 2F0NA 1M8AA 3I70A 1RKNA 4CJ0B 2CHBD 3GP7A 1EY4A 4V0BA 4BA2I 1FD7D 4H0LC 3NWSA 5COYA 5IOCA 2JEBI 4A3KB 5JOBA 1Z6HA 5JPMC 2I46A 2XSCA 3I4NB 1LT4D 5CBEE 5J39A 5LHY1 1NUCA 2A6ED 3MA2B 4J6HA 1DONA 1ESRA 2NN6G 1PTOB 4QCLA 2DY8A 3HZXA 4G7ZC 4RAUC 2A69C 4DNTB 1JQYD 3I8ZA 1STEA 1VMPA 3NBHA 3L9AX 2L12A 4N9PA 1LV9A 5LL6X 1LLRD 3Q6SA 1SYBA 3AMUA 2DN8A 3TP6A 2RSNA 3VR4A 4EQOA 5C0XG 4PMBA 1L0YB 4FXKC 3ITPA 3R2TA 4XXEA 1G91A 5C4HA 2Z4HA 5E1FA 4DXGA 2F0PA 2B2WA 1SE3A 2G9DA 4FO2A 3D6WA 1QB5D 1AW7A 1SMYC 1S5FD 5IODA 1AZPA 2NN6I 5ISRA 4KY5A 1H9MA 2N88A 4LJZC 1EIGA 4KJOA 3FPPA 3NXWA 2ZXPA 1EEFD 5A2QL 1V1PB 1K8OA 1BCPD 1PFNA 5C0XI 1I4PA 2ICEC 3SK4A 2F0WA 4QF4A 3CHBD 3FVQA 2AWNA 5DM73 3HOVB 3HP3A 2RKSA 3TDQA 4BY7B 3A7LA 2D2CC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RHP A;  1B50 A;  4IUP A;  1NAP A;  2B2U A;  1X32 A;  4MN3 A;  4O42 A;  4OIJ A;  5EQ0 A;  2HCI A;  1HA6 A;  1CM9 A;  1WTW A;  1C8C A;  1DON A;  1IKL A;  2EOT A;  1EL0 A;  3TN2 A;  1ESR A;  2XIW A;  5COR A;  1CA5 A;  4UAI A;  1PFM A;  2NYZ D;  2B2T C;  3IFD A;  4IUU A;  5JJZ A;  1CA6 A;  2SDF A;  1TVX A;  1PDQ A;  4U68 A;  1BO0 A;  2DY8 A;  4DN4 M;  1G2S A;  1F9P A;  4QUF A;  1ROD A;  1JIC A;  2X6L A;  1EIH A;  2X6G A;  3F2U A;  2VXW A;  4RAU C;  5T1G A;  2J7Z A;  2JYO A;  1MSH A;  3UI2 A;  3I8Z A;  1AZQ A;  1HUN A;  1VMP A;  1GUW A;  2M2L A;  3FPU B;  1DOL A;  2L12 A;  1LV9 A;  2RA4 A;  1NR4 A;  1PLF A;  1ZXT A;  1JE4 A;  4IUQ A;  3Q6S A;  1MSG A;  2B2V A;  2X69 A;  4ZKC B;  3GV6 A;  3SVM A;  2NWG A;  2MP1 A;  2K03 A;  1WTQ A;  5DNF A;  1HFG A;  1IL8 A;  2HDL A;  2RSN A;  3DM1 A;  3KUP A;  1B4O A;  4LMQ D;  2Q8T A;  2MJ8 A;  1ILQ A;  1F9S A;  1HFN A;  2JP1 A;  2KOL A;  4QUC A;  4MHE A;  2B2U C;  2RSO A;  1ILP A;  2KEC A;  1O7Y A;  1RTO A;  4XDX A;  1QG7 A;  2MPM A;  2KED A;  3G7L A;  4ZLT F;  1G91 A;  3IL8 A;  5D14 A;  2B2Y A;  5T1I A;  2HCC A;  3TZD A;  1HRJ A;  4X3K A;  3GV3 A;  5E4W C;  4R9W A;  1XYI A;  1SAP A;  5EJW A;  1DOM A;  2MGS A;  2EE1 A;  1BBX C;  1X3P A;  3DEP A;  1F9Q A;  1B2T A;  1U4R A;  3H91 A;  4IUT A;  2B2W A;  4X3S A;  2L11 A;  1BNZ A;  2IL8 A;  2L4N A;  4R8I A;  5EPK A;  3D6W A;  1WTR A;  1WTO A;  1AP0 A;  2K05 A;  5AFW A;  2FIN B;  4CJ1 B;  4ZAI A;  1F9R A;  1J8I A;  1X3Q A;  1G6Z A;  1NR2 A;  4ZKB B;  1MI2 A;  2NZ1 D;  3ONA B;  5CBA E;  1BF4 A;  1AZP A;  2K04 A;  1KNA A;  1QE6 A;  1O7Z A;  2K28 A;  2L9H A;  4HAE A;  2B2V C;  3R93 A;  1XX8 A;  1ML0 D;  1RJT A;  4HSV A;  5CMD A;  4ZK9 B;  1M8A A;  2K01 A;  1U4L A;  2N55 A;  3KBX A;  1ICW A;  3P7J A;  4RA8 A;  2BDN A;  1WTX A;  1KNE A;  2D9U A;  2HDM A;  2N88 A;  1S4Z A;  2B2T A;  2EPB A;  3I3C A;  3MWY W;  5EKI A;  1WTP A;  1J9O A;  2FJ2 A;  4RWS C;  1HHV A;  1F2L A;  1U4M A;  1EIG A;  4CJ0 B;  5EPJ A;  1U4P A;  1WTV A;  1DOK A;  2DY7 A;  5D65 A;  5E4X A;  1DZ1 A;  4IUV A;  1NCV A;  2B2Y C;  2FFK B;  4X3U A;  4NW2 A;  1O80 A;  1PFB A;  2H1E A;  2HUG A;  3LWE A;  1WD0 A;  1RTN A;  5EPL A;  2KEE A;  3I90 A;  1E0B A;  3MTS A;  4CJ2 C;  1HUM A;  4X3T A;  1PFN A;  1WVL A;  2KVM A;  3FDT A;  5COY A;  4HCS A;  2B2W C;  1EOT A;  2FMM A;  1IKM A;  2L1B A;  4XT1 B;  1A15 A;  1MGS A;  2K1B A;  3QO2 A;  4OIK A;  1WD1 A;  3HP3 A;  1B53 A;  1EQT A;  1QNK A;  4HED A;  2RVL A;  3N52 A;  1G2T A;  2Q8R E;  2CVR A;  1VMC A;  2KUM A;  1SDF A;  2R3Z A;  4XT3 B;  1B3A A;  4IUR A;  1Q3L A;  1SSO A;  3I91 A;  2FHT A;  5CBE E;  3DEO A; 
#chains in the Genus database with same CATH topology
 3HOZ G;  1XXG A;  2B2U A;  3J7A F;  1GUT A;  1BDO A;  2EYL A;  3NP8 A;  4AYB G;  1OTC A;  3TSS A;  2P5Z X;  4GLA C;  2XVS A;  3I4O A;  2SEB D;  4N8X 1;  1JOK A;  4NPS A;  1Y1V G;  2UXD Q;  2IX3 A;  1JOO A;  4IUU A;  4J8Q A;  5JJK A;  2EDG A;  2MO1 A;  1S5D D;  3CW2 C;  2SNM A;  5IT9 E;  1JIC A;  5IYD H;  1PH5 A;  1HUN A;  1FNW A;  1LTL A;  3BDO A;  2F4V Q;  1Y8P B;  4DK0 A;  2M2L A;  2F52 A;  2CWA A;  5I9P A;  2RA4 A;  1NR4 A;  1I6H H;  2JA7 G;  3GV6 A;  3P75 A;  1VQ7 A;  1VQI A;  2RHQ B;  5CV5 A;  3SE0 A;  3DM1 A;  5IYB G;  4LMQ D;  1VQH A;  2Q8T A;  1VQL A;  1BVS A;  1O7I A;  2F0H A;  4MTN A;  1W6J A;  2Z6K A;  1TWA H;  4IJH A;  1HR0 L;  4KHP L;  4DV5 Q;  4JI1 L;  4G7H C;  1XTC D;  3KK7 A;  1MHW C;  4KN7 C;  1JJG A;  4XTC S;  1BBX C;  2OXP A;  2OEO A;  3MXN A;  1U0L A;  1EQQ A;  4HMI A;  1LAB A;  4WOR A;  1WI5 A;  3AU7 A;  4B3S L;  1B70 B;  4TKO B;  3W5O A;  1KD1 C;  3LWU A;  3HFZ B;  3OIP A;  1QVC A;  2B2V C;  2K5D A;  5NUC A;  3H15 A;  4IAL A;  4HSP A;  2EY1 A;  4A3K H;  1Q82 C;  1SE8 A;  1DD2 A;  1LAC A;  4JVZ A;  2MHV A;  2R6G A;  5IGD A;  1MD2 D;  4XYO A;  2QF7 A;  1CKM A;  3AQQ A;  3HOW B;  4A3C H;  3I4N H;  2F3I A;  5C44 G;  2PNH A;  1STA A;  3VA5 A;  5D65 A;  5E4X A;  1BCP F;  5ELB A;  4CKC A;  1J6Q A;  5BR8 L;  3JAM E;  2HHH L;  1NNX A;  1STB A;  4X3T A;  3KLS X;  5CC4 A;  2VQE Q;  2A6H C;  2VQF Q;  2OCE A;  1EOT A;  1PTO H;  3HKZ B;  3A0J A;  1E22 A;  1H9S A;  5CV8 A;  1B53 A;  1Q81 C;  2CH4 A;  4JI7 L;  3KF8 A;  2ID0 A;  3OSO A;  4K0K L;  5FO7 B;  1IBK Q;  5LMN L;  1SDF A;  1G29 1;  3OOC A;  1YEZ A;  3DEO A;  1RHP A;  3EJI A;  5EQ0 A;  4UPA A;  1E1T A;  4KY7 A;  2K7V A;  2PYK A;  4A3G B;  1HA6 A;  2RDF A;  5I4D A;  3SR1 A;  1ZYR C;  1PH6 A;  3W2D A;  2R93 H;  1GUS A;  3M4P A;  4X66 L;  3ERO A;  1CA6 A;  2A74 C;  4JI6 Q;  4QUF A;  4XIG S;  3KFU A;  2J7Z A;  4Y52 H;  1WCM H;  5I2X A;  4RKB A;  1XNR L;  1A62 A;  2CH4 W;  2JN4 A;  5C3E H;  4A93 B;  2NWG A;  3H0G G;  2I5L X;  5DNF A;  5ELD A;  3R3O A;  4C1N K;  3GTG B;  1W2B A;  4LF6 L;  1A6X A;  4QIW B;  2EJF C;  1EYG A;  4UY8 C;  4JOI C;  4KHP Q;  4F8M A;  1LT3 D;  1O7Y A;  3MEH A;  4JI1 Q;  1Y69 U;  4EVO A;  2MPM A;  1LTT D;  1TWH H;  2K5W A;  4LK1 C;  5ELN A;  1EY5 A;  1IL2 A;  3UE0 A;  1T5E A;  2G5D A;  3HOU H;  1F9Q A;  3HOZ B;  2ZTC A;  2NTS A;  4X3S A;  5J3B A;  5GAD C;  3T1H L;  4AYB B;  4YWK A;  2F1M A;  1LTR D;  4GNX A;  1S72 A;  4B3S Q;  3NTH A;  5AFW A;  1TS3 A;  2HQE A;  3FHW A;  4DK1 A;  1Y1V B;  4CJ1 B;  4ZRZ A;  1K8G A;  4BBS G;  4O1N A;  1HQR D;  2BH8 A;  4J1M A;  4WRD A;  5CMD A;  1D1K A;  4ZK9 B;  1STY A;  1WTH A;  3NEN A;  4CDD C;  4PMW A;  2ICI A;  4CDC C;  2A68 D;  1YHQ A;  4Z9C B;  1YBY A;  4CGY B;  2JA7 B;  4IOC A;  2BA1 A;  4A3M H;  1DZ1 A;  4JG2 A;  5BR8 Q;  2HHH Q;  2HUG A;  1E2W A;  1GUG A;  5EPL A;  5M5Y B;  3C3L A;  4LFB L;  3OYY A;  2FMM A;  4G57 A;  1I5F A;  1MGS A;  4OIK A;  2N78 A;  4JI7 Q;  3P20 A;  4HED A;  5LMN Q;  1AE2 A;  1TY0 A;  2ENB A;  2TSS A;  4LAA A;  2R3Z A;  1PRT C;  2F3V A;  4L5R C;  2BH2 A;  2L0C A;  1WTW A;  4RGT A;  3NPP A;  1FGU A;  5TSS A;  4C3H G;  3HEJ A;  1BUV T;  1NMG A;  4X66 Q;  1PFM A;  2NYZ D;  1V8Q A;  3MZ5 A;  1Y8N B;  5KEE A;  4OO1 G;  5CV7 A;  2VY3 A;  2Q8I B;  3OW2 A;  4CBV A;  3N6R A;  1N34 L;  3CRK C;  1XNR Q;  3FPU B;  2CWP A;  2YTY A;  3H6M A;  1E3P A;  2X69 A;  4A3I G;  1N8R C;  4RKL A;  1EY9 A;  3T51 B;  1SYD A;  2GN5 A;  2PW7 A;  1YJW A;  4WJ3 M;  4LF7 L;  3BVG A;  1F9S A;  4YHH L;  3S17 B;  3KBG A;  5C4J H;  4HIK A;  2PQE A;  1DYQ A;  1QG7 A;  1YHB A;  3TZD A;  1AH9 A;  1YNJ C;  1ET6 A;  1SAP A;  1CHP D;  5L37 A;  3I4L A;  2QW7 A;  2EXD A;  3W3A A;  3T1H Q;  4A3J H;  4G4K A;  1I6V C;  5I2Y A;  1SLJ A;  1SND A;  3CCV A;  2L5T A;  1CKO A;  1PZI D;  1AN8 A;  4Y7N H;  2K04 A;  4QMG A;  4X64 L;  2L9H A;  2A73 B;  2ZM6 L;  4K6D A;  4OO1 I;  1PYS B;  2UUC L;  4ZYS A;  4QGU A;  3T13 A;  5M5W B;  2N3S A;  3MHB A;  2F0S A;  4H7B A;  3MEF A;  3OW7 A;  2VW9 A;  2OT2 A;  3ERS X;  3H0G B;  1LUZ A;  1MJC A;  2VUM G;  1PFB A;  3OTO L;  1WD0 A;  3VYR A;  4A3G H;  1D7Q A;  4GN5 A;  4LFB Q;  2Z8L A;  1QUQ B;  3FDT A;  3RZO B;  1STG A;  2L1B A;  1OXX K;  2KHI A;  1E2Z A;  1BR9 A;  3J7Y W;  3E0E A;  2M9V A;  5FOB B;  3WOE A;  2CVR A;  2K6A A;  3J80 E;  3TRE A;  5J22 A;  3A56 A;  3G6J B;  2QGQ A;  5M3F G;  3H3V H;  1B9N A;  3TN2 A;  3CP0 A;  3A55 A;  4KHV A;  3I2Z A;  3M3Y H;  3S1N B;  3DMU A;  2JXM B;  4BBS B;  2YTX A;  4TSS A;  3GTG H;  3K58 A;  4WJW A;  1PDQ A;  1K73 C;  1BO0 A;  1JWU D;  2M00 A;  2F0K A;  2BE5 C;  2JA8 G;  1HZC A;  2JYO A;  2MUY A;  1TR5 A;  1VQJ A;  3T16 A;  1ZKO A;  5C6A A;  1OXU A;  1Q46 A;  1CK1 A;  4RCN A;  3EIV A;  1ICF B;  1BQQ T;  1YJN A;  5IGC A;  2CFM A;  4FNF A;  4LF7 Q;  3KOJ A;  4YHH Q;  4KY6 A;  1II3 A;  2MJ8 A;  1TWC H;  1TWF H;  2KOL A;  3PV0 A;  4LFA L;  2HT1 A;  2RCN A;  4YY3 L;  4DAY B;  2XN9 C;  3H09 A;  5JEA H;  2K52 A;  2EYP A;  3G7L A;  1E24 A;  3TQY A;  4BA1 I;  2EZV A;  1KLU D;  3PQI A;  1H9J A;  2AWO A;  1IZ6 A;  3RMH A;  2L4N A;  3HRZ C;  4EX5 A;  4C3H B;  3CKI B;  4LF5 L;  2F0M A;  2FIN B;  2JE6 I;  2R7F A;  4HJ7 A;  4X64 Q;  3ONA B;  4NXM L;  5CBA E;  4X6A H;  1PH9 A;  2ZM6 Q;  3M9B A;  3P1H A;  1JWS D;  1TKW B;  2K28 A;  2Z4I A;  4HAE A;  5EKK A;  2CQO A;  4CKB A;  2NVY B;  4HJ5 A;  1YIT A;  2B8F A;  2UUC Q;  4P75 A;  3R8B A;  3I56 A;  1M4V A;  4OX9 L;  3J81 i;  3HOX G;  2EQS A;  1JT8 A;  3KDF A;  5CV9 A;  3DWP A;  1KNE A;  4L5S A;  1I50 B;  3I3C A;  3I7F A;  5EKI A;  1CTM A;  4GOP A;  5EPJ A;  4A3I B;  3OTO Q;  2B2Y C;  2GVA A;  4DF7 A;  1N33 L;  1GJX A;  5K36 H;  3MXU A;  4JW0 A;  1Y1W H;  5E3F A;  3BVZ A;  2RBM A;  4DAM A;  2N49 A;  4XT1 B;  2KJX A;  4FF1 A;  5J1Z A;  1D6E C;  1EZ8 A;  4I7A A;  5DEH A;  3A8K E;  4DUZ L;  4O0A A;  3I73 A;  2OTL A;  5FJ8 G;  1NMF A;  3AFQ A;  4BBR G;  1KDB A;  1UAP A;  2RF4 A;  2PMZ E;  2JA5 G;  4DR1 Q;  5M5X H;  4C3J B;  2IY5 B;  2EOT A;  1L1O A;  1Q8I A;  4DV1 L;  3L2P A;  1Q1E A;  1TXY A;  3GTO H;  4UAI A;  1FNV A;  4KJN A;  2R7Z G;  2R92 G;  4PV1 C;  1F9P A;  3D6C A;  3IKJ A;  2QA4 A;  1JE5 A;  4KHZ A;  4FP5 D;  1DOL A;  2EYJ A;  1B9M A;  1RF2 D;  1CSQ A;  4JCV E;  2VUM B;  4ABN A;  4EQP A;  1I4H A;  1HCZ A;  2HDL A;  3A8I E;  4AYB E;  3OPO A;  1HQM C;  2R7D A;  4NKL A;  4LFA Q;  5DLQ E;  1D2B A;  2RCF A;  3A5Z B;  4OL7 A;  2AQ1 B;  4RGN A;  1K0R A;  4KV6 A;  2WP8 J;  3NUC A;  2EYM A;  4K2L A;  1E1O A;  2DUD A;  3CXC A;  2A6E C;  5F2D A;  5M3F B;  3H91 A;  3BZC A;  3TP5 A;  3K80 C;  2IL8 A;  4R8I A;  1K3R A;  5EPK A;  4LF5 Q;  5BN5 A;  2F0D A;  1V1P A;  3BDC A;  3E0J A;  3GTM B;  4NXM Q;  2E2I B;  1VQG A;  1HXY D;  4R4Q A;  2JA8 B;  1GVP A;  5K5P A;  1I3Q B;  1A8V A;  4POG A;  1OXS C;  3ZJY C;  1U4L A;  4BXX G;  1ET9 A;  4A3E G;  1UNS A;  2VZA A;  4JOI A;  1U4M A;  1EEI D;  2K33 A;  4OWT B;  1DOK A;  3K5L A;  1N33 Q;  2Z9H A;  4APV A;  1FJG L;  2BCO A;  2EXZ A;  2H1E A;  4DK6 C;  1E0B A;  4X65 L;  4IFD G;  1WVL A;  2KVM A;  3PO2 G;  4JBM A;  4FF4 A;  3RLF A;  4RGM A;  4BY1 G;  1H95 A;  3CCS A;  2PPB C;  1QNK A;  4DUZ Q;  1ZEQ X;  3N52 A;  1G2T A;  5GAH C;  3Q23 A;  1TS4 A;  4LF8 L;  4KLK A;  1HH2 P;  4UP8 A;  3HS0 C;  3KF6 B;  3L3O C;  2YU9 B;  1HJP A;  3T1Y L;  3QOL A;  4DV1 Q;  1KHI A;  3E6Z X;  2WII B;  3OIQ A;  1XJV A;  2WFW A;  1AFP A;  1R4P B;  1QJO A;  1EIF A;  4C3I G;  4B9X A;  1WOC A;  4G7O C;  1B44 D;  1ROD A;  3D3R A;  3J7A V;  3GTK B;  4KD3 A;  3URY A;  3HOX B;  3HOY G;  1AZQ A;  4OWW B;  2LMC B;  1DGS A;  3SHL A;  4LUV A;  4PZ8 A;  3V2T A;  1EY0 A;  1JJC B;  4IUQ A;  2EJG C;  4HIM A;  1BBU A;  2LFN A;  3L0O A;  3G4S A;  3CME A;  1BCP C;  3C2P A;  2WB1 G;  4JBK A;  1HFG A;  1K83 H;  2PW5 A;  1ILQ A;  4OXP A;  3GTQ B;  4IN3 A;  5M3M G;  2KCT A;  4A3D G;  3MFG A;  1RTO A;  4IFD I;  1QVF A;  5D3D A;  5EKL A;  3DM3 A;  1SYE A;  2KED A;  3EQL C;  1QCB D;  2D0P A;  1HA5 A;  2NVY H;  2JSO A;  5GQO A;  4R9W A;  1SE4 A;  2UUB L;  2JA6 H;  2EE1 A;  3IFT A;  3A5U A;  1XTD A;  4BBR B;  1SFO H;  1HZB A;  4IUT A;  4A75 A;  4UP7 A;  2JA5 B;  1UE6 A;  3CQZ H;  5FLX L;  3D4R A;  5KIX A;  1IYV A;  2EVB A;  4A3I H;  2F0L A;  1F9R A;  1TWG H;  5IYC G;  4IOA A;  3TBI B;  2R7Z B;  2R92 B;  1EWC A;  3RNU A;  4K5W A;  3BYY B;  1FL0 A;  3KLW A;  1JC7 A;  1PH1 A;  4RA8 A;  1D5M C;  1ICW A;  3RUZ A;  4RHS A;  5D3I B;  2D9U A;  4O2D A;  2I0Q A;  4P72 A;  4DV4 Q;  4UDU C;  3D8G A;  3W1G A;  1PTO D;  5FLM G;  1EQV A;  1FJG Q;  4A3F G;  2F0F A;  4TVA B;  1YNX A;  3QG1 A;  4X3U A;  4J15 A;  1QWY A;  2CW0 D;  3PIO 3;  3PIO A;  4C3J H;  4X65 Q;  3ER0 A;  4LF4 Q;  4HID A;  3C1F A;  3FKI G;  3ND8 A;  1JJ2 A;  1PRT B;  1EOV A;  1IKM A;  5C3W A;  4HCS A;  4IUN A;  2PZW A;  1OXV A;  2EY6 A;  2KCN A;  1QOH A;  1MJE A;  4LF8 Q;  3ULJ A;  2Q8R E;  3PO3 G;  1C9O A;  1OXT A;  1GKH A;  1TT2 A;  2QEX A;  5C4X B;  3GTJ B;  5A35 A;  2CW0 C;  1VQM A;  3T1Y Q;  1B50 A;  2R61 A;  4JPB W;  4MN3 A;  2WIN B;  3NSW A;  1W3S A;  4OIJ A;  4BWG B;  2Z6B A;  2IWH A;  1VQE A;  2XWB B;  1N32 L;  2LXK A;  3VYS A;  2AMC B;  2OQ0 A;  3S14 B;  5EGT A;  3SK6 A;  1C0A A;  2F0T A;  4QY7 A;  4L5Q A;  1VQK A;  2X6G A;  5T1G A;  3U9S A;  5KRU A;  1MSH A;  2HQL A;  2PO4 A;  1I4X A;  2YTV A;  5KND A;  1MKH A;  1VQF A;  2QIL A;  3FRP B;  3J7Z C;  5ELF A;  1SNM A;  4GLX A;  3WOF A;  3FMC A;  3DWA A;  1X55 A;  3CCU A;  5JJI A;  3KUP A;  5EBD A;  3U9O A;  1EWH A;  3S9W A;  3BVM A;  2E2I H;  1LO5 D;  4BY1 B;  3MVV A;  2UUB Q;  2PI2 E;  1RIP A;  2E5L L;  1VQA A;  1I3Q H;  5IP9 H;  1DOM A;  2K75 A;  1EY8 A;  4FVM A;  2PMZ B;  3K6O A;  3FEW X;  1D8L A;  2NVX B;  5FLX c;  1KXL A;  4I7Z C;  1EUJ A;  2F03 A;  4IPG A;  2Q2U A;  4A3B G;  1G6Z A;  3UDI A;  4C3I B;  1LTB D;  4JI0 L;  3R93 A;  1HR0 Q;  4JI4 L;  1UWV A;  1CHQ D;  1HPC A;  4FDB A;  5JVH 3;  3HOY B;  3GQB A;  1YNN D;  4M1U B;  1Z7T A;  1PTO F;  1K8A C;  3GTP B;  2B2T A;  1HHV A;  1X3E A;  3UDG A;  2F0G A;  1Y14 B;  1WTV A;  1IYU A;  1ENC A;  1HNZ L;  4RG1 A;  1RD9 D;  3QB3 A;  3V96 A;  1NSN S;  2KEE A;  1A3T A;  1HUM A;  3BJU A;  1X65 A;  1XWE A;  1YNN C;  3AEV A;  4JI2 L;  2B2W C;  3GTL B;  4LUZ A;  4FXG C;  5C4Z A;  1NE3 A;  4DV3 L;  3STB D;  1UE1 A;  2I5H A;  2I5M X;  1LTI D;  4RCO A;  3U50 C;  2C9O A;  1Q3L A;  2YYZ A;  4LFC L;  1Q8K A;  1F2M A;  1S3O A;  3HOV H;  1VQO A;  3ND9 A;  2HIV A;  4MZ9 A;  3K59 A;  2Z0S A;  3S1R B;  1C8C A;  4BY7 H;  1N32 Q;  2H5X A;  3M4O B;  3PMF A;  2NVT B;  2UXC L;  1VQC A;  5G3L D;  5JJZ A;  4NMZ A;  1DCZ A;  1TVX A;  2A68 C;  1SRU A;  5I9O A;  1PYW D;  2B63 G;  4K0K Q;  2LSS A;  4L5T A;  2DNE A;  1LTG D;  2F4I A;  1EFI D;  1EU3 A;  1SEB D;  1JE4 A;  5FJ8 H;  1ZXT A;  2GVB A;  1N9W A;  4A3F B;  1V1Q A;  4MIU A;  5LMU L;  1LT5 D;  1PH7 A;  1VQ8 A;  1JB3 A;  3OMC A;  1JR0 D;  2E2J B;  1ASZ A;  4OWX B;  3FKI B;  2MQH A;  2OWO A;  3VYU A;  4PZ6 A;  2B2U C;  1YJ9 A;  2KEC A;  2RDG A;  2E2D C;  3D31 A;  5D14 A;  2E5L Q;  1K0S A;  2ZXR A;  3PO3 B;  3U4Z A;  4ZQ3 A;  2NZO A;  4WJ4 A;  2WAQ G;  2FXQ A;  2MGS A;  1CZW A;  2O4X A;  3NWT A;  1U4R A;  4HTH A;  3PUZ A;  1CQV A;  3V05 A;  5C44 B;  3ICE A;  3BG3 A;  3MAQ A;  1PH2 A;  5C5L A;  2WAC A;  4GNX B;  1SXT A;  4LF6 Q;  1B1Z A;  3VR3 A;  4ZKB B;  4JI0 Q;  1MI2 A;  1BF4 A;  4JI4 Q;  2NN6 H;  2IPK D;  4DNI A;  5IYD G;  3T53 B;  1XX8 A;  4LWC A;  4GZY C;  1DM0 B;  2KBN A;  1WTX A;  5CYU A;  3DHQ A;  1PV4 A;  2KCC A;  2NVQ B;  5IGG A;  2ZT9 C;  1HZ9 A;  2FJ2 A;  2Z6K C;  1Y8O B;  5C4X H;  4A3L H;  1YHA A;  3HOW H;  1HNZ Q;  5A2Q E;  1E7Z A;  3S15 B;  4HJA A;  1L0X B;  1HTP A;  1GXD C;  3I90 A;  4JI2 Q;  1K3B C;  3CAM A;  5C0X H;  3MFY A;  4DV3 Q;  3PF5 A;  1F2Y A;  4RH6 A;  3E3X A;  5AJ3 L;  3UDX A;  4JK1 C;  4LFC Q;  1G6P A;  1YVC A;  4XT3 B;  3Q0A A;  2K5V A;  1O7L A;  4PG3 A;  3CCQ A;  1VDZ A;  5IGF A;  1CM9 A;  4ZUJ A;  2E8G A;  5G3L F;  4A76 A;  4A3B B;  4DAP A;  3H3V C;  2E2H B;  1CA5 A;  2UXC Q;  2E76 C;  4HN7 A;  2PQA A;  1KRS A;  3K8A A;  4DAY A;  2MNA A;  2RHS B;  1HNW L;  1T5X D;  3AB9 A;  3BU2 A;  4K2K A;  4A3K G;  4LUO A;  3OMG A;  4BY1 H;  1IYJ B;  1IHZ A;  3F2B A;  4UP9 A;  5M9O A;  2PCF B;  1V43 A;  1UE7 A;  3SEB A;  2AKW B;  1PRT F;  3I4N G;  2VB3 X;  1TY2 A;  3SK8 A;  4DR4 L;  3S1M B;  5FLX E;  5LMU Q;  2NB0 A;  3RN5 A;  1D5Z C;  2NVX H;  4GN3 B;  2MP1 A;  1U9R A;  2K03 A;  3NEL A;  1KRT A;  1IL8 A;  1SNQ A;  4A93 H;  1C4Q A;  3RZD B;  1D5X C;  1EYA A;  1VCI A;  5IE8 A;  1X6O A;  3CF5 A;  5C3X A;  1N34 Q;  2CCZ A;  3DWQ A;  3PGZ A;  5IP7 H;  2K4K A;  2BOS A;  1FR3 A;  3GTP H;  3K5N A;  1GOZ A;  1CFM A;  4GKK L;  2R93 G;  3HOZ H;  3NHH A;  4Q0F A;  4DV0 L;  3S16 B;  2EY5 A;  3DXJ C;  1CI3 M;  3K7A B;  2NZ1 D;  4DR3 L;  4IFD J;  2Y0S E;  1Y1V H;  4FF2 A;  2B63 B;  3JAM i;  4DR2 L;  1KDC A;  4RGO S;  3Q24 A;  1ML0 D;  4HSV A;  1WCM G;  2V4D A;  3P7J A;  4NB3 A;  2DNC A;  1BOS A;  4E6I A;  2EPB A;  1M1K C;  3NQI A;  4JI8 L;  1X54 A;  4RWS C;  5C3E G;  1WJJ A;  3TEH B;  1GUN A;  1KTK A;  4RHR A;  3NTI A;  4ULL A;  2PZU A;  2JA7 H;  2J4X A;  1SN8 A;  1A3U A;  2JJQ A;  4HR7 B;  5IYB H;  3JAM L;  3EA6 A;  2EIF A;  4C2M B;  4JI3 L;  5M5Y H;  5AJ3 Q;  3FP9 A;  4B3R L;  2ZJP A;  4K6L A;  1X3G A;  4GNX C;  3HOU G;  3NBI A;  2O5I C;  1SSO A;  3I91 A;  3M4Y A;  2ZXO A;  2F3W A;  4IPC A;  3S2H B;  2BA0 A;  3LNN A;  4EQN A;  4IPH A;  4JV5 L;  1VQ5 A;  5COR A;  1G8Z D;  4XYQ A;  1HNW Q;  5BN4 A;  2RDH A;  5KYL A;  1TU2 B;  3J81 L;  3M85 A;  3E5S A;  4JI5 L;  2VXW A;  1BCP B;  4IZ8 A;  1I6H B;  1I4Q A;  3RN2 A;  3Q8D A;  1GHK A;  1PLF A;  4A3M G;  2IJ0 A;  3CRL C;  2E74 C;  2B2V A;  4ZKC B;  1PMR A;  5FK9 C;  2V1C C;  2NTT A;  5ELC A;  3SVM A;  4QQB X;  5C44 H;  1EYC A;  2K5Q A;  1TWA B;  1P16 A;  4POF A;  1GO3 E;  3Q22 A;  4K5X A;  3U58 A;  2JP1 A;  3QIA A;  3T4A C;  1KAB A;  5LL6 S;  5EBC A;  1F2Z A;  2K5H A;  4IJL A;  3S17 H;  2CQA A;  1UE5 A;  4ILW A;  3HGB A;  2NBF A;  3WDN A;  1V9P A;  2D5D A;  4TQU S;  3C46 A;  1XNQ L;  4GKK Q;  4HJ8 A;  1BNZ A;  3PUV A;  3KLR A;  2E75 C;  2I07 B;  3S24 A;  4ME3 A;  4DV0 Q;  2B39 A;  3K0X A;  2K05 A;  3BZD B;  2WB1 E;  2IHE A;  4DPG A;  2F0V A;  2Y0S G;  3BS1 A;  1SE2 A;  4DR2 Q;  4YY3 Q;  1KNA A;  2PNR C;  2N8N A;  3JC6 6;  5IWA L;  4OGQ C;  1IBL L;  4PZ7 A;  4UHV A;  3CMA A;  3KBX A;  4JI8 Q;  1C7Y A;  2HDM A;  1IBM L;  1JWM D;  4P71 A;  1WTP A;  2EYF A;  1F2L A;  2ZTE A;  3NTK A;  3HG9 A;  2A69 D;  5M5W H;  4KKS A;  4NW2 A;  1O80 A;  5I6Y A;  3JAM c;  1RTN A;  3H0G H;  3F8T A;  4JI3 Q;  2JA9 A;  4B3R Q;  4AIM A;  4CDF C;  1XPU A;  4OX9 Q;  1WD1 A;  3QO2 A;  1YIJ A;  2KA7 A;  3RZO H;  1XPR A;  5HGT A;  4A3J G;  2KUM A;  1VQ9 A;  1UUP A;  3K57 A;  2DJF C;  4DUY L;  3RLO A;  4R1J A;  2VS1 A;  1K28 A;  1L2F A;  4JV5 Q;  2R93 B;  3ZYY X;  4GN4 B;  3VR2 A;  3ERQ A;  3BZK A;  4U67 3;  3IFD A;  1R9T B;  3RZD H;  3S1N H;  5HY6 A;  3HKZ G;  3PUX A;  3J81 c;  3S2D B;  1EZ6 A;  4JI5 Q;  2Q2H A;  1SMY D;  4BBS H;  4L6T B;  1WCM B;  3F2U A;  4PQX A;  1A63 A;  3PCO B;  1ONL A;  3TP7 A;  4DXF A;  5C3E B;  3QJY A;  4EQ5 A;  2IT1 A;  4A3G G;  4ME5 A;  3QWN A;  4AH6 A;  3BDL A;  1VQ4 A;  2UXB L;  2OF1 A;  1F77 A;  3T56 B;  1TWH B;  2AQ3 B;  4JBW A;  4QUC A;  3K7A H;  3NE5 B;  3K7U C;  4KK7 A;  3TS2 A;  5T1I A;  2HCC A;  3HOU B;  3I4M G;  2D62 A;  2EY2 A;  5I6W A;  3A74 A;  1KC8 C;  1S40 A;  3NBH B;  4F87 A;  2EYH A;  4L8J A;  1S5E D;  1WTO A;  2F0E A;  5KNB A;  1NR2 A;  1LTA D;  4C3H H;  4FXD A;  2RQX A;  5CGK A;  4ID6 A;  1S5B D;  1QE6 A;  5IWA Q;  2OTJ A;  1IBL Q;  4KKT A;  3WWV A;  4OO1 H;  4DR5 L;  5FO9 B;  1PHJ A;  3OWF A;  1CSP A;  4B3T L;  2EJM A;  3K0Y A;  2MFI A;  4A3M B;  1SRO A;  3K5O A;  1LT6 D;  1I50 H;  3J80 i;  3PIP 3;  3PIP A;  3F1Z A;  2FFK B;  4RMF A;  1PXU A;  3S2H H;  3KJO A;  2ZJQ A;  5JEA G;  5KYI A;  4M8A A;  1CKN B;  4JI6 L;  2XWJ B;  3A54 A;  1SJE D;  2RVL A;  3CPF A;  3CD6 A;  1LM0 A;  1DJR D;  1V1O A;  2IW3 A;  4BS9 A;  4DNR B;  4DUY Q;  1VF5 C;  1PH4 A;  1FNU A;  1ESF A;  4OEL B;  1B3A A;  3J80 L;  3K5M A;  4PMC A;  5CV6 A;  3H3V I;  4IUP A;  1UEA B;  1R4Q B;  3D0F A;  3X3N A;  1IKL A;  1CUK A;  2XIW A;  1N36 L;  2Y0S B;  1KLG D;  5HUR A;  4GOP C;  3F2D A;  2KHS A;  2SDF A;  2VNU D;  1G2S A;  4KI0 A;  4CKE A;  3G48 A;  3UDF A;  4C56 C;  5CR3 A;  4B08 A;  2HIX A;  5LMN W;  1PTO C;  1D1I A;  1GUW A;  3VR6 A;  3M4Q A;  1SNC A;  5BN3 A;  4GLV B;  2IX1 A;  3TS0 A;  4NXN L;  3TP8 A;  3GD7 A;  5K36 G;  2UXB Q;  5ELE A;  4DV2 L;  1WTQ A;  3W1B A;  2HD3 A;  1Y1W G;  4HMJ A;  3BYT B;  5C4J B;  2VUM H;  1HFN A;  1L0W A;  1I94 L;  2LXJ A;  1P8L A;  1HNX L;  4H13 C;  3RLN A;  2Z1C A;  2K5N A;  4XDX A;  4YWM A;  1LTS D;  4ZLT F;  3IL8 A;  1L1O C;  2A6H D;  4A3J B;  4A3E B;  3QOJ A;  5EJW A;  3O13 A;  4DR6 L;  2K50 A;  1B2T A;  1CQF A;  4X62 L;  1Q12 A;  2L11 A;  1KL9 A;  3A7A B;  5M3F H;  2NUC A;  3TRZ A;  4ZUI A;  4WFN 3;  1PFS A;  5JAV A;  4Y7N B;  1A3V A;  4ZAI A;  1J8I A;  3X3M A;  2B8G A;  3R2I A;  1DXM A;  4EGV A;  3CC7 A;  4DFA A;  4XQJ A;  3GTM H;  1O7Z A;  2IX0 A;  3PO2 B;  1ZYR D;  4DR5 Q;  1SYC A;  2YV5 A;  2K32 A;  2ZJR A;  2C35 B;  4B3T Q;  4ZCK A;  2JA8 H;  1SMX A;  1Q90 A;  3I55 A;  1PH8 A;  3MWY W;  1J9O A;  4R8N A;  5JVG 3;  2WAQ E;  4B3M L;  3VDY A;  1U4P A;  2F0Q A;  3MXN B;  3ULL A;  4IUV A;  4H44 C;  1NCV A;  2ASB A;  4S3S A;  3GDE A;  2WKD A;  1IXR A;  2XNA C;  4P2C B;  1ENA A;  1UEB A;  3MTS A;  2A19 A;  2Q2I A;  3J81 E;  4RFB A;  1R9T H;  4XQQ A;  3I4M B;  3S2D H;  4GKJ L;  2B29 A;  4Q5V A;  1A0I A;  3J80 c;  2KCM A;  1K8M A;  1XMO L;  3PF4 A;  2TMP A;  2FHT A;  3CU7 A;  4O42 A;  1NAP A;  1X9N A;  3RD4 A;  3M3Y B;  1VF7 A;  1N36 Q;  1EL0 A;  2WB1 B;  2YU9 H;  1FYC A;  4YCU A;  1K9M C;  5M3M B;  4A3D B;  4U68 A;  3MC0 B;  1Q1B A;  1STH A;  1S5C D;  1H9S B;  3CCE A;  1PH3 A;  3KF8 B;  3GTK H;  3HOX H;  1O78 A;  4DR7 L;  4NXN Q;  1QIL A;  4DV2 Q;  1TWC B;  3H94 A;  1X3F A;  3TME A;  1TWF B;  1I94 Q;  1B4O A;  1HNX Q;  1I4R A;  1STN A;  3STB C;  3EVQ A;  1BBW A;  1ENF A;  4KD4 A;  3MXP A;  3GTQ H;  4KTA A;  5FKA C;  4CDE C;  3PUW A;  2FMC A;  4DA2 A;  1HRJ A;  2B2Y A;  2F0U A;  1GD7 A;  3GV3 A;  4X3K A;  3SXH A;  3S1Q B;  4DR6 Q;  5E4W C;  1XYI A;  3L7Z C;  4HIO A;  4X62 Q;  4V19 0;  4HCE A;  3A8J E;  2IHF A;  1EU4 A;  2F0I A;  2XRS D;  3NQT A;  1SR3 A;  3PUY A;  4BBR H;  2QCP X;  1PRT D;  3E9H A;  1XPO A;  2L55 A;  2JA5 H;  1AP0 A;  1BXT A;  2JEA I;  1A2U A;  1AE3 A;  2R7Z H;  1EY6 A;  4L63 B;  3CC2 A;  2R92 H;  3K81 C;  1RJT A;  4KMU C;  1ILP A;  1XMQ L;  1S4Z A;  4B3M Q;  4JYA L;  1NJI C;  1PZJ D;  3LX0 A;  1YI2 A;  2F0O A;  2DY7 A;  2BDO A;  2EYO A;  1WYD A;  2A8V A;  1TS2 A;  3LGJ A;  1FGB D;  3HKS A;  1Y1W B;  1EFW A;  4DV7 L;  4P74 A;  1CZG A;  1EY7 A;  1QUQ A;  1RCV D;  2WV6 D;  3D4W A;  4GKJ Q;  3MXG A;  2K1B A;  1JOQ A;  2AQ2 B;  3DUZ A;  2JA6 G;  4IQZ A;  2A1A A;  1YZ6 A;  1XMO Q;  1SJH D;  1VMC A;  4MNO A;  2O5J C;  2KHJ A;  4KKU A;  2VB2 X;  4PNY A;  4IUR A;  5M5X B;  4K8I A;  2UUA L;  3UE1 A;  1YNJ D;  4OHJ A;  3CCR A;  1X32 A;  5H1S E;  3GTO B;  3GTJ H;  3IAY A;  2HCI A;  1VQB A;  2H4O A;  3VYT A;  1ASY A;  3NEM A;  1KAW A;  4F7X A;  4YIJ A;  3PSI A;  2QDB A;  1NBW A;  1HTL D;  1SNP A;  1VQP A;  2AUJ D;  2F0J A;  4DAV A;  2LY7 A;  5FO8 B;  4ODG A;  3S14 H;  2X6L A;  3NK9 A;  2UU9 L;  1CT1 D;  3EFX D;  5GAE C;  4DR7 Q;  3M7N A;  3GO5 A;  4BXX H;  5EAY A;  3SK5 A;  4A3E H;  2LS0 1;  5IIF A;  1VQN A;  1MSG A;  1EYD A;  4NP5 A;  1OO9 B;  4K8J A;  3KYH C;  4C3J G;  1KAA A;  4CHT B;  1EQR A;  4NDX A;  4IO9 A;  4MHE A;  2C5C A;  2RSO A;  4IFD H;  2SNS A;  4OEM B;  4KN4 C;  3M7G A;  3PO2 H;  1KDA A;  3OWE B;  3OHX C;  1GHJ A;  5IT9 L;  2QKI C;  5JPN C;  4MTK A;  1T9H A;  4A3C G;  1KIX A;  3DEP A;  2PZT A;  2SOB A;  1W6K A;  4TRD A;  2XTI A;  4YCV A;  4AQY L;  3QR8 A;  1SNO A;  3VA7 A;  1GUO A;  1QZG A;  1JOR A;  1C48 A;  1PVO A;  1X3Q A;  5KNC A;  1SBB B;  5ELO A;  2PI2 A;  4QL5 A;  2ATW A;  4C3I H;  5E7N A;  4FF3 A;  1I4G A;  1Q7Y C;  2B3G A;  4K14 A;  2A5H A;  1XMQ Q;  2K01 A;  2N55 A;  1Q86 C;  2BDN A;  3I4M H;  4JYA Q;  4YCW A;  3HOY H;  2BE5 D;  1HZA A;  3VR5 A;  3CCJ A;  4LW1 A;  1AEX A;  3D4D A;  4DR1 L;  2O2L D;  5CV4 A;  1EWI A;  4DV7 Q;  3LWE A;  1TS5 A;  5C0X J;  4CJ2 C;  1B7Y B;  1H9R A;  4K5V A;  1QNU A;  1J5E L;  4N9T A;  5M3M H;  1SYF A;  4A3D H;  1A15 A;  5IP9 G;  1EQT A;  3J7A 5;  3GTL H;  2GA4 B;  2UUA Q;  2WKC A;  4B9W A;  2JQO A;  3U4V A;  1Z47 A;  4I65 A;  3AYH B;  1JCK B;  1TQO A;  1PZK D;  2J0T D;  3C1E A;  5IGE A;  2Q2T A;  4HJ9 A;  2B2T C;  3S1R H;  1TII D;  2PQA B;  3TZU A;  4F88 A;  5IYC H;  4DN4 M;  1FVI A;  3I72 A;  3M4O H;  2UU9 Q;  2NVT H;  4DK3 C;  3EN2 A;  1EIH A;  3UI2 A;  4OON A;  2WAQ B;  4ALP A;  2AUK A;  3S1Q H;  4C1N I;  1E2V A;  2QDL A;  1G51 A;  1K83 B;  2MO0 A;  2XRQ D;  2ZTD A;  1MBY A;  5IY0 A;  5FLM H;  5KGU A;  4A3F H;  1B8A A;  4GS3 A;  3SDZ A;  1IW7 D;  1PYB A;  1H9K A;  4JBJ A;  2E2J H;  3FKI H;  1JMC A;  5C5M A;  4DGZ A;  3KLS A;  4QB4 A;  2JA6 B;  3HKZ E;  5IT9 c;  1SFO B;  4DU9 A;  4AQY Q;  1X3P A;  3SGI A;  2OQK A;  3HOV G;  3PO3 H;  4DR4 Q;  3CQZ B;  1QZH A;  1B3Q A;  3ULP A;  5DM6 3;  4BY7 G;  2DGY A;  1TWG B;  1IW7 C;  1Z9F A;  1WTR A;  1M90 C;  4JC0 A;  2ES2 A;  1A2T A;  1NY4 A;  3E9I A;  4XQN A;  1SYG A;  2LKV A;  2NZH A;  5DAU A;  5JEA J;  4FYD A;  4LF9 L;  2KQ3 A;  2QEJ C;  5IGB A;  1RDP D;  2G9H D;  2JK8 A;  2F0N A;  4YWL A;  1M8A A;  3I70 A;  1JB7 A;  2AHO B;  1RKN A;  4CJ0 B;  4P73 A;  2NVQ H;  2CHB D;  3GP7 A;  3EBE A;  1EY4 A;  4V0B A;  4BA2 I;  1FD7 D;  5GRO A;  4LNQ A;  4DV6 L;  1J5E Q;  4DR3 Q;  4H0L C;  3NWS A;  3S15 H;  5COY A;  4QIW E;  5IOC A;  2JEB I;  1VQ6 A;  4A3K B;  5JOB A;  3CC4 A;  1Z6H A;  1PA6 A;  1GM5 A;  5JPM C;  4R4C A;  2I46 A;  2XSC A;  2ALY B;  3AFP A;  3KDF B;  3I4N B;  5HGQ A;  1LT4 D;  4GOP B;  3KF6 A;  5CBE E;  5J39 A;  3DLL A;  5LHY 1;  1NUC A;  2A6E D;  3MA2 B;  4J6H A;  1DON A;  3B6Y A;  1ESR A;  5JJL A;  2NN6 G;  4A3B H;  1PTO B;  4QCL A;  2E2H H;  2UXD L;  1BKB A;  2DY8 A;  3HZX A;  4A4I A;  4G7Z C;  4IPD A;  4RAU C;  2A69 C;  4DNT B;  1JQY D;  3I8Z A;  1STE A;  1VMP A;  3NBH A;  3L9A X;  5C4X G;  2L12 A;  4N9P A;  2F4V L;  3HOW G;  1LV9 A;  4A3L G;  5LL6 X;  1LLR D;  3Q6S A;  1SYB A;  3AMU A;  1NTG A;  2DN8 A;  3S1M H;  3TP6 A;  2RSN A;  1L1O B;  3VR4 A;  4EQO A;  5C0X G;  4PMB A;  1L0Y B;  2VL6 A;  4FXK C;  3ITP A;  3R2T A;  4XXE A;  1G91 A;  3J81 j;  5C4H A;  2DJG C;  2Z4H A;  3CCM A;  4R4T A;  4DV5 L;  5E1F A;  4N8F A;  4DXG A;  1U5K A;  4R4I A;  4DV4 L;  2F0P A;  2B2W A;  1SE3 A;  3RR5 A;  3F2C A;  2G9D A;  4FO2 A;  4H02 A;  3D6W A;  1MIU A;  1EIY B;  3G71 A;  1QB5 D;  1AW7 A;  1SMY C;  1S5F D;  4LF4 L;  1VQD A;  1CKN A;  4LF9 Q;  5IOD A;  1AZP A;  3S16 H;  3KJP A;  2NN6 I;  1WFQ A;  5ISR A;  4KY5 A;  2L15 A;  3G6E A;  1H9M A;  3IRB A;  2B63 H;  3CPW A;  2N88 A;  1XNQ Q;  4LJZ C;  2KEN A;  2XGT A;  1EIG A;  4DKA C;  4KJO A;  3FPP A;  3NXW A;  4A93 G;  2ZXP A;  4DV6 Q;  1EEF D;  2K14 A;  5A2Q L;  1V1P B;  1K8O A;  1BCP D;  1PFN A;  4QJF A;  5C0X I;  1KQS A;  1X56 A;  1I4P A;  2ICE C;  3SK4 A;  2VQE L;  1LYL A;  2VQF L;  1HR0 W;  3CCL A;  1VS0 A;  2F0W A;  2CKZ B;  5GAG C;  4QF4 A;  5IP7 G;  4C2M H;  3CHB D;  3FVQ A;  2AWN A;  4R4O A;  1IBM Q;  2D0O A;  5DM7 3;  1RL2 A;  3HOV B;  1IBK L;  3HP3 A;  2RKS A;  3TDQ A;  4BY7 B;  1QVG A;  3A7L A;  2D2C C; 
#chains in the Genus database with same CATH homology
 1XXG A;  2B2U A;  3J7A F;  1GUT A;  1BDO A;  2EYL A;  3NP8 A;  3TSS A;  2XVS A;  2SEB D;  1JOK A;  2IX3 A;  1JOO A;  4IUU A;  4J8Q A;  2EDG A;  1S5D D;  2SNM A;  5IT9 E;  1JIC A;  1HUN A;  1FNW A;  3BDO A;  1Y8P B;  4DK0 A;  2M2L A;  5I9P A;  2RA4 A;  1NR4 A;  3GV6 A;  3P75 A;  5CV5 A;  3SE0 A;  3DM1 A;  4LMQ D;  2Q8T A;  2F0H A;  1W6J A;  4G7H C;  1XTC D;  3KK7 A;  4KN7 C;  4XTC S;  1BBX C;  2OXP A;  2OEO A;  3MXN A;  4HMI A;  1LAB A;  4WOR A;  3AU7 A;  4TKO B;  3LWU A;  3OIP A;  2B2V C;  2K5D A;  5NUC A;  4IAL A;  4HSP A;  2EY1 A;  1DD2 A;  1LAC A;  2MHV A;  2R6G A;  5IGD A;  1MD2 D;  4XYO A;  2QF7 A;  3HOW B;  3VA5 A;  1STA A;  5D65 A;  5E4X A;  1BCP F;  5ELB A;  4CKC A;  3JAM E;  1STB A;  4X3T A;  3KLS X;  5CC4 A;  2A6H C;  1EOT A;  1PTO H;  3HKZ B;  1H9S A;  5CV8 A;  1B53 A;  3KF8 A;  2ID0 A;  3OSO A;  5FO7 B;  1SDF A;  1G29 1;  3OOC A;  3DEO A;  1RHP A;  3EJI A;  5EQ0 A;  4KY7 A;  2K7V A;  2PYK A;  4A3G B;  1HA6 A;  2RDF A;  5I4D A;  3SR1 A;  1ZYR C;  3W2D A;  1GUS A;  3ERO A;  1CA6 A;  2A74 C;  4QUF A;  4XIG S;  2J7Z A;  5I2X A;  4RKB A;  4A93 B;  2NWG A;  5DNF A;  5ELD A;  3R3O A;  4C1N K;  3GTG B;  1A6X A;  4QIW B;  2EJF C;  4F8M A;  1LT3 D;  1O7Y A;  3MEH A;  1Y69 U;  4EVO A;  2MPM A;  1LTT D;  2K5W A;  4LK1 C;  1EY5 A;  1T5E A;  1F9Q A;  3HOZ B;  2NTS A;  4X3S A;  4AYB B;  2F1M A;  1LTR D;  3NTH A;  5AFW A;  1TS3 A;  2HQE A;  4DK1 A;  4CJ1 B;  1Y1V B;  4ZRZ A;  4O1N A;  1HQR D;  4J1M A;  4WRD A;  5CMD A;  1D1K A;  4ZK9 B;  1STY A;  4PMW A;  2ICI A;  2A68 D;  4Z9C B;  4CGY B;  2JA7 B;  2BA1 A;  1DZ1 A;  2HUG A;  1E2W A;  1GUG A;  5EPL A;  5M5Y B;  3C3L A;  2FMM A;  4G57 A;  1MGS A;  4OIK A;  3P20 A;  4HED A;  1TY0 A;  2ENB A;  2TSS A;  4LAA A;  2R3Z A;  1PRT C;  2F3V A;  2L0C A;  1WTW A;  4RGT A;  3NPP A;  5TSS A;  4C3H G;  3HEJ A;  1BUV T;  1PFM A;  2NYZ D;  1V8Q A;  3MZ5 A;  1Y8N B;  5KEE A;  4OO1 G;  5CV7 A;  2Q8I B;  4CBV A;  3N6R A;  3CRK C;  3FPU B;  3H6M A;  2X69 A;  4RKL A;  1EY9 A;  3T51 B;  1SYD A;  2PW7 A;  3BVG A;  1F9S A;  3S17 B;  3KBG A;  2PQE A;  1DYQ A;  1QG7 A;  3TZD A;  1YNJ C;  1ET6 A;  1SAP A;  1CHP D;  3I4L A;  3W3A A;  4G4K A;  1I6V C;  5I2Y A;  1SND A;  2L5T A;  1PZI D;  1AN8 A;  2K04 A;  4QMG A;  2L9H A;  2A73 B;  4K6D A;  4OO1 I;  4ZYS A;  3T13 A;  5M5W B;  3MHB A;  2F0S A;  4H7B A;  3OW7 A;  2OT2 A;  3H0G B;  1PFB A;  1WD0 A;  3VYR A;  2Z8L A;  3FDT A;  3RZO B;  1STG A;  2L1B A;  1OXX K;  1E2Z A;  1BR9 A;  3J7Y W;  2M9V A;  5FOB B;  3WOE A;  2CVR A;  2K6A A;  3J80 E;  5J22 A;  3A56 A;  3G6J B;  1B9N A;  3TN2 A;  3A55 A;  4KHV A;  3S1N B;  3DMU A;  2JXM B;  4BBS B;  4TSS A;  3K58 A;  4WJW A;  1PDQ A;  1BO0 A;  1JWU D;  2M00 A;  2F0K A;  2BE5 C;  2JYO A;  2MUY A;  1TR5 A;  3T16 A;  1ZKO A;  5C6A A;  1OXU A;  1CK1 A;  4RCN A;  1BQQ T;  5IGC A;  4FNF A;  4KY6 A;  1II3 A;  2MJ8 A;  2KOL A;  3PV0 A;  2XN9 C;  3H09 A;  5JEA H;  2EYP A;  3G7L A;  4BA1 I;  2EZV A;  1KLU D;  1H9J A;  2AWO A;  3RMH A;  2L4N A;  3HRZ C;  4C3H B;  3CKI B;  2F0M A;  2FIN B;  2JE6 I;  3ONA B;  5CBA E;  4CKB A;  3P1H A;  1JWS D;  1TKW B;  2K28 A;  2Z4I A;  4HAE A;  5EKK A;  2NVY B;  2B8F A;  3R8B A;  1M4V A;  5CV9 A;  3DWP A;  1KNE A;  1I50 B;  3I3C A;  5EKI A;  1CTM A;  5EPJ A;  4A3I B;  2B2Y C;  4DF7 A;  1GJX A;  5K36 H;  3MXU A;  5E3F A;  3BVZ A;  2RBM A;  4XT1 B;  2KJX A;  4FF1 A;  5J1Z A;  1D6E C;  1EZ8 A;  5DEH A;  3A8K E;  3I73 A;  1KDB A;  1UAP A;  4C3J B;  2EOT A;  1Q8I A;  1Q1E A;  4UAI A;  1FNV A;  4KJN A;  4PV1 C;  1F9P A;  3D6C A;  3IKJ A;  4KHZ A;  4FP5 D;  1DOL A;  2EYJ A;  1B9M A;  1RF2 D;  2VUM B;  4ABN A;  4EQP A;  1I4H A;  1HCZ A;  2HDL A;  3A8I E;  3OPO A;  1HQM C;  4NKL A;  1D2B A;  4OL7 A;  2AQ1 B;  4RGN A;  4KV6 A;  2WP8 J;  3NUC A;  2EYM A;  4K2L A;  2A6E C;  5F2D A;  5M3F B;  3H91 A;  3TP5 A;  2IL8 A;  4R8I A;  5EPK A;  5BN5 A;  2F0D A;  1V1P A;  3BDC A;  3E0J A;  3GTM B;  2E2I B;  1HXY D;  2JA8 B;  5K5P A;  1I3Q B;  1OXS C;  1U4L A;  1ET9 A;  1UNS A;  1U4M A;  1EEI D;  2K33 A;  1DOK A;  3K5L A;  2BCO A;  2EXZ A;  2H1E A;  1E0B A;  4IFD G;  1WVL A;  2KVM A;  4FF4 A;  3RLF A;  4RGM A;  2PPB C;  1QNK A;  1ZEQ X;  3N52 A;  1G2T A;  3Q23 A;  1TS4 A;  3HS0 C;  3L3O C;  2YU9 B;  3QOL A;  3E6Z X;  2WII B;  3OIQ A;  1AFP A;  1R4P B;  1QJO A;  4C3I G;  4B9X A;  4G7O C;  1B44 D;  1ROD A;  3D3R A;  3J7A V;  3GTK B;  4KD3 A;  3URY A;  3HOX B;  1AZQ A;  2LMC B;  3SHL A;  3V2T A;  1EY0 A;  4IUQ A;  2EJG C;  2LFN A;  1BCP C;  3C2P A;  1HFG A;  2PW5 A;  1ILQ A;  3GTQ B;  4IN3 A;  3MFG A;  1RTO A;  4IFD I;  5D3D A;  5EKL A;  1SYE A;  2KED A;  3EQL C;  1QCB D;  1HA5 A;  2JSO A;  4R9W A;  1SE4 A;  2EE1 A;  3IFT A;  4BBR B;  4IUT A;  2JA5 B;  5FLX L;  3D4R A;  5KIX A;  1IYV A;  2EVB A;  2F0L A;  1F9R A;  3TBI B;  2R7Z B;  2R92 B;  1EWC A;  4K5W A;  3BYY B;  1JC7 A;  4RA8 A;  1D5M C;  1ICW A;  3RUZ A;  4RHS A;  5D3I B;  2D9U A;  4UDU C;  3D8G A;  1PTO D;  1EQV A;  2F0F A;  3QG1 A;  4X3U A;  1QWY A;  2CW0 D;  3PIO 3;  3C1F A;  3ND8 A;  1PRT B;  1IKM A;  5C3W A;  4HCS A;  4IUN A;  2PZW A;  1OXV A;  2EY6 A;  2KCN A;  1QOH A;  2Q8R E;  1OXT A;  1TT2 A;  5C4X B;  3GTJ B;  5A35 A;  2CW0 C;  1B50 A;  2R61 A;  4MN3 A;  2WIN B;  3NSW A;  4OIJ A;  4BWG B;  2IWH A;  2XWB B;  3VYS A;  3S14 B;  5EGT A;  3SK6 A;  2F0T A;  2X6G A;  5T1G A;  3U9S A;  5KRU A;  1MSH A;  2PO4 A;  1I4X A;  5KND A;  2QIL A;  3FRP B;  5ELF A;  1SNM A;  3WOF A;  3FMC A;  3DWA A;  3KUP A;  5EBD A;  3U9O A;  1EWH A;  3S9W A;  3BVM A;  1LO5 D;  4BY1 B;  3MVV A;  1DOM A;  1EY8 A;  4FVM A;  2PMZ B;  3K6O A;  3FEW X;  2NVX B;  4I7Z C;  2F03 A;  1G6Z A;  4C3I B;  1LTB D;  3R93 A;  1CHQ D;  1HPC A;  5JVH 3;  3HOY B;  3GQB A;  1YNN D;  4M1U B;  1Z7T A;  1PTO F;  3GTP B;  2B2T A;  1HHV A;  2F0G A;  1WTV A;  1IYU A;  1ENC A;  1RD9 D;  3QB3 A;  3V96 A;  1NSN S;  2KEE A;  1A3T A;  1HUM A;  1XWE A;  1YNN C;  2B2W C;  3GTL B;  4FXG C;  5C4Z A;  1LTI D;  4RCO A;  2C9O A;  1Q3L A;  2YYZ A;  1F2M A;  3ND9 A;  3K59 A;  3S1R B;  1C8C A;  3M4O B;  3PMF A;  2NVT B;  5G3L D;  5JJZ A;  4NMZ A;  1DCZ A;  1TVX A;  2A68 C;  5I9O A;  1PYW D;  2DNE A;  1LTG D;  1EFI D;  1SEB D;  1EU3 A;  2F4I A;  1JE4 A;  1ZXT A;  4A3F B;  4MIU A;  1LT5 D;  1JB3 A;  3OMC A;  1JR0 D;  2E2J B;  3FKI B;  3VYU A;  2B2U C;  2KEC A;  2RDG A;  2E2D C;  3D31 A;  5D14 A;  2ZXR A;  3PO3 B;  4ZQ3 A;  2MGS A;  1CZW A;  2O4X A;  3NWT A;  1U4R A;  4HTH A;  3PUZ A;  1CQV A;  3V05 A;  5C44 B;  3BG3 A;  3MAQ A;  5C5L A;  2WAC A;  1SXT A;  1B1Z A;  3VR3 A;  4ZKB B;  1MI2 A;  1BF4 A;  2NN6 H;  2IPK D;  3T53 B;  1XX8 A;  4GZY C;  1DM0 B;  1WTX A;  5CYU A;  3DHQ A;  2KCC A;  2NVQ B;  5IGG A;  2ZT9 C;  2FJ2 A;  1Y8O B;  5A2Q E;  3S15 B;  1L0X B;  1HTP A;  1GXD C;  3I90 A;  5C0X H;  3MFY A;  1F2Y A;  4RH6 A;  4JK1 C;  4XT3 B;  3Q0A A;  1O7L A;  1VDZ A;  5IGF A;  1CM9 A;  4ZUJ A;  5G3L F;  4A3B B;  4DAP A;  3H3V C;  2E2H B;  1CA5 A;  2E76 C;  4HN7 A;  4DAY A;  1T5X D;  3AB9 A;  4K2K A;  3OMG A;  1IHZ A;  5M9O A;  2PCF B;  1V43 A;  3SEB A;  1PRT F;  2VB3 X;  1TY2 A;  3SK8 A;  3S1M B;  5FLX E;  2NB0 A;  1D5Z C;  2MP1 A;  1U9R A;  2K03 A;  1IL8 A;  1SNQ A;  1C4Q A;  3RZD B;  1D5X C;  1EYA A;  1VCI A;  5C3X A;  3DWQ A;  2BOS A;  1FR3 A;  3K5N A;  1GOZ A;  1CFM A;  3NHH A;  4Q0F A;  3S16 B;  2EY5 A;  3DXJ C;  1CI3 M;  3K7A B;  2NZ1 D;  4IFD J;  4FF2 A;  2B63 B;  1KDC A;  4RGO S;  3Q24 A;  1ML0 D;  4HSV A;  2V4D A;  3P7J A;  2DNC A;  1BOS A;  4E6I A;  2EPB A;  3NQI A;  4RWS C;  1GUN A;  1KTK A;  4RHR A;  3NTI A;  4ULL A;  2PZU A;  2J4X A;  1A3U A;  4HR7 B;  3JAM L;  3EA6 A;  4C2M B;  4K6L A;  3NBI A;  2O5I C;  1SSO A;  3I91 A;  3M4Y A;  2ZXO A;  2F3W A;  3S2H B;  2BA0 A;  3LNN A;  4EQN A;  5COR A;  1G8Z D;  4XYQ A;  5BN4 A;  2RDH A;  5KYL A;  1TU2 B;  3J81 L;  3M85 A;  3E5S A;  2VXW A;  1BCP B;  4IZ8 A;  1I6H B;  1I4Q A;  1GHK A;  1PLF A;  2IJ0 A;  3CRL C;  2E74 C;  2B2V A;  4ZKC B;  1PMR A;  5FK9 C;  2NTT A;  5ELC A;  3SVM A;  1EYC A;  2K5Q A;  1TWA B;  3Q22 A;  4K5X A;  2JP1 A;  3QIA A;  3T4A C;  1KAB A;  5LL6 S;  5EBC A;  1F2Z A;  2CQA A;  4ILW A;  3HGB A;  2NBF A;  3WDN A;  4TQU S;  2D5D A;  3C46 A;  1BNZ A;  3PUV A;  3KLR A;  2E75 C;  2I07 B;  2B39 A;  2K05 A;  3BZD B;  2F0V A;  3BS1 A;  1SE2 A;  1KNA A;  2PNR C;  4OGQ C;  3KBX A;  2HDM A;  1JWM D;  1WTP A;  2EYF A;  1F2L A;  3NTK A;  3HG9 A;  2A69 D;  4KKS A;  4NW2 A;  1O80 A;  5I6Y A;  1RTN A;  1WD1 A;  3QO2 A;  2KA7 A;  5HGT A;  2KUM A;  1UUP A;  3K57 A;  2R93 B;  3ZYY X;  3VR2 A;  3ERQ A;  4U67 3;  3IFD A;  1R9T B;  3PUX A;  3S2D B;  1EZ6 A;  1SMY D;  4L6T B;  1WCM B;  3F2U A;  4PQX A;  1ONL A;  3TP7 A;  4DXF A;  5C3E B;  3QJY A;  2IT1 A;  4ME5 A;  3QWN A;  3BDL A;  2OF1 A;  1F77 A;  3T56 B;  1TWH B;  2AQ3 B;  4JBW A;  4QUC A;  3NE5 B;  4KK7 A;  5T1I A;  2HCC A;  3HOU B;  2D62 A;  2EY2 A;  5I6W A;  4F87 A;  2EYH A;  4L8J A;  1S5E D;  1WTO A;  2F0E A;  5KNB A;  1NR2 A;  1LTA D;  4FXD A;  2RQX A;  5CGK A;  4ID6 A;  1S5B D;  1QE6 A;  4KKT A;  4OO1 H;  5FO9 B;  3OWF A;  2EJM A;  3K0Y A;  4A3M B;  3K5O A;  1LT6 D;  3PIP 3;  2FFK B;  1PXU A;  5JEA G;  5KYI A;  4M8A A;  2XWJ B;  3A54 A;  1SJE D;  2RVL A;  1DJR D;  1V1O A;  2IW3 A;  4BS9 A;  4DNR B;  1VF5 C;  1FNU A;  1ESF A;  3J80 L;  1B3A A;  3K5M A;  4PMC A;  5CV6 A;  4IUP A;  1UEA B;  1R4Q B;  3X3N A;  1IKL A;  2XIW A;  2Y0S B;  1KLG D;  5HUR A;  2KHS A;  2SDF A;  2VNU D;  1G2S A;  4KI0 A;  4CKE A;  4C56 C;  5CR3 A;  4B08 A;  1PTO C;  1D1I A;  1GUW A;  3VR6 A;  1SNC A;  5BN3 A;  2IX1 A;  3TP8 A;  3GD7 A;  5K36 G;  5ELE A;  1WTQ A;  4HMJ A;  3BYT B;  5C4J B;  1HFN A;  4H13 C;  2Z1C A;  4XDX A;  1LTS D;  4ZLT F;  3IL8 A;  2A6H D;  4A3J B;  4A3E B;  3QOJ A;  5EJW A;  3O13 A;  1B2T A;  1CQF A;  1Q12 A;  2L11 A;  3A7A B;  2NUC A;  4ZUI A;  4WFN 3;  4Y7N B;  5JAV A;  1A3V A;  4ZAI A;  1J8I A;  3X3M A;  2B8G A;  3R2I A;  1DXM A;  4EGV A;  4DFA A;  4XQJ A;  3PO2 B;  1O7Z A;  2IX0 A;  1ZYR D;  1SYC A;  2K32 A;  1Q90 A;  3MWY W;  1J9O A;  4R8N A;  5JVG 3;  1U4P A;  2F0Q A;  4IUV A;  4H44 C;  1NCV A;  4S3S A;  2WKD A;  2XNA C;  4P2C B;  1ENA A;  3MTS A;  3J81 E;  4RFB A;  4XQQ A;  3I4M B;  4Q5V A;  1K8M A;  2TMP A;  2FHT A;  3CU7 A;  4O42 A;  1NAP A;  3RD4 A;  3M3Y B;  1VF7 A;  1EL0 A;  2WB1 B;  1FYC A;  5M3M B;  4A3D B;  4U68 A;  3MC0 B;  1Q1B A;  1STH A;  1S5C D;  1H9S B;  1O78 A;  1QIL A;  1TWC B;  3H94 A;  3TME A;  1TWF B;  1B4O A;  1I4R A;  1STN A;  3EVQ A;  1ENF A;  4KD4 A;  3MXP A;  4KTA A;  5FKA C;  3PUW A;  2FMC A;  4DA2 A;  1HRJ A;  2B2Y A;  2F0U A;  4X3K A;  3GV3 A;  3SXH A;  3S1Q B;  5E4W C;  1XYI A;  3L7Z C;  4V19 0;  4HCE A;  3A8J E;  1EU4 A;  2F0I A;  2XRS D;  3NQT A;  3PUY A;  2QCP X;  1PRT D;  2L55 A;  1AP0 A;  1BXT A;  2JEA I;  1A2U A;  1EY6 A;  4L63 B;  1RJT A;  4KMU C;  1ILP A;  1S4Z A;  1PZJ D;  3LX0 A;  2F0O A;  2DY7 A;  2BDO A;  2EYO A;  1TS2 A;  1FGB D;  1Y1W B;  1CZG A;  1EY7 A;  1RCV D;  2WV6 D;  3D4W A;  3MXG A;  2K1B A;  1JOQ A;  2AQ2 B;  3DUZ A;  4IQZ A;  1SJH D;  1VMC A;  2O5J C;  4KKU A;  5M5X B;  2VB2 X;  4PNY A;  4IUR A;  4K8I A;  1YNJ D;  4OHJ A;  1X32 A;  3GTO B;  3IAY A;  2HCI A;  2H4O A;  3VYT A;  4F7X A;  4YIJ A;  2QDB A;  1HTL D;  1SNP A;  2AUJ D;  2F0J A;  4DAV A;  2LY7 A;  5FO8 B;  4ODG A;  2X6L A;  3NK9 A;  1CT1 D;  3EFX D;  3M7N A;  3GO5 A;  3SK5 A;  2LS0 1;  5IIF A;  1MSG A;  1EYD A;  4NP5 A;  1OO9 B;  4K8J A;  4C3J G;  1KAA A;  4CHT B;  4NDX A;  4MHE A;  2C5C A;  2RSO A;  4IFD H;  2SNS A;  4KN4 C;  3M7G A;  1KDA A;  3OWE B;  3OHX C;  1GHJ A;  5IT9 L;  2QKI C;  5JPN C;  3DEP A;  2PZT A;  2SOB A;  1W6K A;  4TRD A;  1SNO A;  3VA7 A;  1GUO A;  1JOR A;  1C48 A;  1X3Q A;  5KNC A;  1SBB B;  4FF3 A;  1I4G A;  4K14 A;  2A5H A;  2K01 A;  2N55 A;  2BDN A;  2BE5 D;  3VR5 A;  1AEX A;  3D4D A;  2O2L D;  5CV4 A;  3LWE A;  1TS5 A;  5C0X J;  4CJ2 C;  1H9R A;  4K5V A;  1QNU A;  4N9T A;  1SYF A;  1A15 A;  1EQT A;  2GA4 B;  2WKC A;  4B9W A;  1Z47 A;  4I65 A;  1JCK B;  1TQO A;  1PZK D;  2J0T D;  3C1E A;  5IGE A;  2B2T C;  1TII D;  3TZU A;  4F88 A;  4DN4 M;  3I72 A;  1EIH A;  3UI2 A;  2WAQ B;  2AUK A;  4C1N I;  1E2V A;  1K83 B;  2XRQ D;  1MBY A;  5KGU A;  3SDZ A;  1IW7 D;  1H9K A;  5C5M A;  4DGZ A;  3KLS A;  4QB4 A;  2JA6 B;  1SFO B;  4DU9 A;  1X3P A;  3CQZ B;  5DM6 3;  1TWG B;  1IW7 C;  1WTR A;  1A2T A;  4XQN A;  1SYG A;  2LKV A;  5DAU A;  5JEA J;  4FYD A;  2KQ3 A;  2QEJ C;  5IGB A;  1RDP D;  2G9H D;  2F0N A;  1M8A A;  3I70 A;  1RKN A;  4CJ0 B;  2CHB D;  3GP7 A;  1EY4 A;  4V0B A;  4BA2 I;  1FD7 D;  4H0L C;  3NWS A;  5COY A;  5IOC A;  2JEB I;  4A3K B;  5JOB A;  1Z6H A;  5JPM C;  2I46 A;  2XSC A;  3I4N B;  1LT4 D;  5CBE E;  5J39 A;  5LHY 1;  1NUC A;  2A6E D;  3MA2 B;  4J6H A;  1DON A;  1ESR A;  2NN6 G;  1PTO B;  4QCL A;  2DY8 A;  3HZX A;  4G7Z C;  4RAU C;  2A69 C;  4DNT B;  1JQY D;  3I8Z A;  1STE A;  1VMP A;  3NBH A;  3L9A X;  2L12 A;  4N9P A;  1LV9 A;  5LL6 X;  1LLR D;  3Q6S A;  1SYB A;  3AMU A;  2DN8 A;  3TP6 A;  2RSN A;  3VR4 A;  4EQO A;  5C0X G;  4PMB A;  1L0Y B;  4FXK C;  3ITP A;  3R2T A;  4XXE A;  1G91 A;  5C4H A;  2Z4H A;  5E1F A;  4DXG A;  2F0P A;  2B2W A;  1SE3 A;  2G9D A;  4FO2 A;  3D6W A;  1QB5 D;  1AW7 A;  1SMY C;  1S5F D;  5IOD A;  1AZP A;  2NN6 I;  5ISR A;  4KY5 A;  1H9M A;  2N88 A;  4LJZ C;  1EIG A;  4KJO A;  3FPP A;  3NXW A;  2ZXP A;  1EEF D;  5A2Q L;  1V1P B;  1K8O A;  1BCP D;  1PFN A;  5C0X I;  1I4P A;  2ICE C;  3SK4 A;  2F0W A;  4QF4 A;  3CHB D;  3FVQ A;  2AWN A;  5DM7 3;  3HOV B;  3HP3 A;  2RKS A;  3TDQ A;  4BY7 B;  3A7L A;  2D2C C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...