3OTOL

Crystal structure of the 30s ribosomal subunit from a ksga mutant of thermus thermophilus (hb8)
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
124
structure length
124
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title Modification of 16S ribosomal RNA by the KsgA methyltransferase restructures the 30S subunit to optimize ribosome function.
pubmed doi rcsb
total genus 13
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2010-09-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3otoL00
2OQ0A 3AFPA 1X9NA 4P72A 4GKKL 1A8VA 5GROA 2ES2A 1HZBA 2ZM6L 1SROA 2H5XA 2OTLA 4JBJA 2HT1A 4HIOA 3NENA 4JI6Q 3J7A5 1EFWA 4DV3L 4DV5L 1Q1EA 4R4TA 1I94Q 3M4PA 4AH6A 3HOXG 2WB1E 1LYLA 4A3MH 4B3ML 1MIUA 1S3OA 2E8GA 3H15A 5IYBG 3STBD 3GTPH 4LUVA 1KC8C 2I5HA 4JI2Q 3WWVA 5FJ8G 2A19A 3FHWA 4JI3L 1K9MC 5IY0A 5H1SE 1VQDA 4X66L 4HIKA 1K73C 2K5VA 4DV7Q 1SR3A 2VQEQ 4BXXG 2Q2UA 2PI2E 4GOPA 2JA7G 3W5OA 2HIVA 5IYCH 2NVTH 1I6HH 2VQFL 1SRUA 1HNWQ 4X64L 2AWOA 4YCUA 4DUZQ 1Q81C 4O0AA 2JA5H 4JI0L 1HR0L 5JJLA 2KCMA 1J6QA 4A93H 3HOZG 1PH3A 2D62A 3CW2C 3EIVA 3CPFA 1YHAA 1Y1WG 3H0GH 1AE2A 1X3EA 3S16H 2JQOA 1VQ4A 1Z9FA 2QEXA 4IPDA 4IPHA 4X62Q 2JA9A 3HOZH 2E5LL 1JJGA 4B3RQ 1CSQA 1U0LA 3RLOA 4QGUA 1L0WA 2ZJQA 1A63A 4A3IH 4GNXC 1YJNA 2Q2TA 4LF8L 3GD7A 1EUJA 3J81c 1H95A 3HOWG 5C0XI 4L5SA 3PUVA 3PO3G 2OWOA 3PO2H 3HFZB 1IBLQ 3OTOQ 1PH9A 2UUCQ 5GAEC 3CCQA 4YWLA 3PUZA 4ME3A 4PZ8A 3CAMA 4KLKA 4A3EG 2JA8G 2WB1G 4KHPQ 4QQBX 5C4XH 5HY6A 1PH8A 2IHEA 1N32Q 1SFOH 1QVFA 4XTCS 2YU9H 2R93H 4IJLA 5M3MH 4LUOA 1P16A 4H02A 5LMUL 4HJ7A 1GM5A 2Z6KA 3U50C 1OXTA 2YTXA 2N3SA 3HOVG 3KDFB 2KHJA 3KLWA 3ULPA 1UE7A 3CQZH 3CCMA 1XPRA 1CKOA 4HJ8A 3CCUA 3ER0A 4C3JH 1XPOA 1XNQQ 4A3LG 1L1OB 4IJHA 1I94L 2E2IH 1L1OC 2JEAI 4FDBA 3RR5A 1LM0A 2PNHA 4J15A 1G291 1PH6A 1PH7A 3L0OA 3ZJYC 1I5FA 2IT1A 3NEMA 2PI2A 4YY3Q 3U4VA 1J5EL 4JI2L 4C3HH 4B3SL 2NVXH 4IPCA 1GKHA 1XMOQ 1PYBA 5C4JH 3TRZA 1LUZA 3K8AA 4GOPC 4A3FH 4UPAA 4JI3Q 5FLMG 2CFMA 3I2ZA 2GN5A 3I55A 1A62A 4UP8A 1HNWL 5K36G 5IP9G 3W1GA 1YITA 4GN3B 2KHIA 4NXMQ 3F1ZA 2VUMG 4OO1I 4DPGA 4IO9A 2Q2HA 2RHSB 2VQFQ 4PZ7A 1KAWA 4X64Q 1Y1VH 2PQAB 3ULLA 1K0RA 3S1MH 4JI0Q 4IOCA 1IBMQ 3UE0A 1QUQB 4L5TA 3TS0A 3I4OA 1TWAH 1VQ7A 5LMNW 3KFUA 2JA6H 3HOYG 3ICEA 4P73A 2VW9A 3S14H 2I5LX 2K75A 3HKSA 1XPUA 2UXBL 2Y0SE 3AEVA 1R9TH 4DR2Q 2MO0A 1VCIA 4R4IA 4A3DH 1EIFA 3CCEA 4KI0A 4LF4Q 1KHIA 3CCLA 1UWVA 4IFDI 1OXUA 1E1OA 4JOIC 4HIDA 1U5KA 2UUCL 1B8AA 4YCVA 1OXXK 3AYHB 4IOAA 5IP7H 4DNIA 2IY5B 3JAMi 2I0QA 3F2DA 2VS1A 3PUYA 1Q12A 1N32L 4PZ6A 3K7AH 1EYGA 3GTQH 4RG1A 1JT8A 4A3CH 4APVA 3M7NA 1EQQA 1QZGA 2KBNA 4LW1A 3CCJA 5LMUQ 3PUWA 1VQ6A 4BBSH 4JG2A 1IZ6A 1X6OA 4OWTB 3CMAA 1XNQL 2JE6I 5DLQE 1IXRA 4A3MG 3E0EA 2K5NA 1BBUA 3KF6B 3CPWA 1OTCA 4LFBQ 4AYBE 2E2JH 1X54A 3A5ZB 4JBKA 1VQPA 1QVCA 3S1RH 3CCSA 2YTYA 5IT9c 4YY3L 4B3TL 1L1OA 4A3BH 1HZCA 1EOVA 4L5RC 1XMOL 3CMEA 3M85A 1I3QH 1J5EQ 4MNOA 1HNZL 5M5XH 4B3SQ 4DR6Q 5IYCG 4A3GH 2OTJA 4BBRH 4NXNL 2Y0SG 4KHZA 4O2DA 1XMQL 1FVIA 1IYJB 1VQAA 2IX0A 2LXKA 3A74A 3BZCA 4A3JH 2JA5G 1VQ5A 4A93G 1VQJA 4NXML 1Z47A 2C35B 2ID0A 2KENA 5ELNA 2OCEA 3H0GG 1FGUA 2XGTA 5C3EH 3I56A 2UUBL 4TVAB 3W1BA 3I4NH 3K81C 2CWAA 1VQIA 1T9HA 5GAGC 1IBML 3VDYA 1EIYB 4DKAC 2V1CC 4YHHL 1SLJA 2F4VL 2YV5A 3S2DH 2UXCL 1QVGA 4P74A 1D8LA 4DV6L 1JJCB 1HZAA 4A3IG 3BZKA 2R92H 4R4CA 2PQAA 5IWAL 3G71A 4DR2L 4OWXB 3PV0A 4DR3Q 2N8NA 3DLLA 5C0XG 4LF4L 1QUQA 4XIGS 1PH5A 3PO2G 2N78A 5C44G 2UXBQ 1VQ8A 2PMZE 3TQYA 1JMCA 4UY8C 4R4OA 3FKIH 2RCNA 3MXNB 1VQCA 3FP9A 2UXDQ 4HJ9A 1CSPA 3S1NH 5C4XG 4JI7Q 4UP9A 3G6EA 4A75A 2I5MX 3PSIA 4AYBG 5C44H 3KJPA 1E3PA 2R93G 4MZ9A 4RMFA 5M3MG 4DV0Q 4JOIA 3RNUA 1BKBA 1K8AC 4DR7L 3UE1A 2WAQG 5HGQA 1N9WA 3U4ZA 1A0IA 1VQBA 1NJIC 4LF6L 3G4SA 1PA6A 1YIJA 2MNAA 1CKNA 4JCVE 3ULJA 5FLXc 3HKZE 3RLNA 4TQUS 3RN5A 1OXVA 2DGYA 4GN5A 3T1HL 4LFBL 4AIMA 1VQNA 4BA1I 1WCMH 4C2MH 2F3IA 5ELOA 1IL2A 4LF9L 3M3YH 4POFA 5IYDH 1G51A 2MFIA 1O7IA 4A3KH 4POGA 4MTNA 3S17H 1KRSA 3J81i 4A3FG 3UDIA 4JI8L 1E22A 3S15H 3KF6A 3KF8B 4B3TQ 3NBHB 4DR6L 3EN2A 2N49A 1ASZA 4DUYQ 1BBWA 1HNZQ 4LUZA 2ZTDA 1VQOA 4DR4L 4EQ5A 4OO1G 4BA2I 3GTLH 4NXNQ 1Y1VG 2BH8A 3CC7A 1XMQQ 1Q86C 2ATWA 1HNXQ 5JEAG 1V1QA 3F2CA 3EBEA 1MJEA 2UU9L 4LNQA 1P8LA 1S40A 2JA6G 2HHHQ 1C9OA 1SMXA 2RF4A 5M3FH 2QGQA 2YTVA 2UUBQ 1JB7A 5JJKA 1E24A 2JEBI 2VL6A 5AJ3L 5LMNL 4P75A 4DV2L 1VQFA 4A3DG 2K14A 1L2FA 3T1YL 1Q82C 4YHHQ 2F4VQ 3GTMH 3F2BA 3U58A 2UXCQ 1VQKA 4DR3L 1KQSA 4DV6Q 1UEBA 3E9HA 4QY7A 5IWAQ 2B63H 4IFDG 4JV5Q 4BY7H 4K0KL 1W3SA 3HKZG 3J80c 4QIWE 1V43A 4AQYL 2UXDL 3TS2A 1BVSA 2R6GA 5IP7G 1GD7A 4JI7L 1PFSA 4JI5L 2EIFA 4X6AH 1JJ2A 1HH2P 1AH9A 2CWPA 4NB3A 1GO3E 4A3CG 1PH4A 3HOUH 4DV0L 2HQLA 3UDXA 1CKMA 5E7NA 3BU2A 1X3FA 2R7ZH 1NMFA 3J7ZC 2K4KA 4DR7Q 5C0XJ 1VQMA 4BBSG 3J81j 4LFCL 1RL2A 2BA1A 2UUAL 1UE5A 4LF6Q 1WFQA 5J3BA 5BR8Q 3CC2A 3D31A 3GTGH 3GO5A 3CC4A 3AFQA 4BY1H 4X65Q 1W2BA 4A3BG 1KD1C 3T1HQ 3KDFA 5GADC 2R7DA 1IBKQ 2Z0SA 1AE3A 1VS0A 4ALPA 4LF9Q 1JE5A 1X56A 4YCWA 1I50H 4LFAL 4A3GG 2VNUD 4BBRG 2BA0A 2FXQA 1B70B 2WAQE 1K83H 4HJAA 2R7FA 4A3JG 4JI8Q 4DUYL 3I4MH 1XNRL 1TWHH 1WJJA 4DK6C 1C0AA 1B7YB 1K8GA 4DV1L 2BH2A 2NZHA 4GKJL 2ZTEA 3CCRA 4DR1Q 4P71A 5EAYA 5C3EG 2ASBA 3GTJH 1HNXL 4DR4Q 3I4NG 1NE3A 3TREA 4Y7NH 2GVAA 4WJ3M 2HHHL 3LGJA 2WFWA 1G6PA 2F52A 3KYHC 2UU9Q 1YNXA 2R92G 3DM3A 4DR5L 3K80C 2A1AA 3RN2A 4LF7Q 1V9PA 2MQHA 1YVCA 5AJ3Q 5LMNQ 4DV2Q 3RZDH 4HIMA 1TXYA 3T1YQ 1UE1A 3FKIG 3STBC 4JV5L 3RZOH 3HOXH 2D0PA 1FJGQ 5JEAJ 2D0OA 2IX1A 4K0KQ 5IYBH 4DAYB 4R4QA 2RHQB 1N36L 4IPGA 4JC0A 1XTDA 2VZAA 4PG3A 5FJ8H 4JI4Q 2VY3A 1YHBA 4AQYQ 2WP8J 3H3VI 3AQQA 3H3VH 2ZJPA 4JI5Q 3PGZA 4JYAQ 1VQGA 1LTLA 1VQLA 1Q1BA 2AKWB 1KL9A 2HIXA 1S72A 1NBWA 2CCZA 2JA7H 4BXXH 1RIPA 4QJFA 1HR0W 3CCVA 3GTKH 1SE8A 4IFDJ 1MKHA 4A4IA 3A0JA 3UDGA 1YZ6A 1EQRA 1X55A 4LWCA 5IE8A 5BR8L 3KOJA 3M9BA 1OXSC 2QA4A 4DV4Q 1PV4A 2CQOA 1N34L 1Y1WH 2NVYH 1WCMG 2LSSA 4OXPA 2UUAQ 4LFCQ 4LF5L 4OX9Q 1TWCH 1X65A 4JI1Q 4QL5A 4YWKA 5IYDG 4GNXB 4X65L 1DGSA 4A3KG 3K7UC 1KIXA 1HJPA 3Q8DA 1NY4A 4JBMA 1GVPA 1MJCA 1Q8KA 2B3GA 2AMCB 2Q2IA 3B6YA 3ERSX 3F8TA 3RLFA 3PF5A 1IBKL 2IHFA 3NELA 2K50A 3K0XA 3M4QA 1YJ9A 3HOWH 3PF4A 1VQ9A 4LFAQ 1PVOA 1KRTA 5M5YH 3CD6A 1D7QA 3PO3H 1N33L 2LXJA 1K3RA 4L5QA 3G48A 2E2HH 1XNRQ 2DUDA 1E7ZA 1E1TA 1YBYA 4DR1L 3OW2A 1QZHA 4A3EH 2JA8H 1EWIA 5JJIA 4DV1Q 3M4OH 2CKZB 4C3IH 2AHOB 4GKJQ 4GLAC 4EX5A 5M3FG 3GDEA 1PH1A 4JI6L 2YYZA 3PUXA 5GQOA 1M1KC 4GKKQ 2ZM6Q 1VQEA 3I7FA 3GTOH 2MO1A 4PMWA 3HOVH 4DV3Q 2JJQA 1WYDA 2XTIA 4DV5Q 4LF7L 2JK8A 4NPSA 1NTGA 2EXDA 2EQSA 1N8RC 3D0FA 3E9IA 4DR5Q 2B63G 4A3LH 1KXLA 4BY7G 2GVBA 2ZJRA 3S1QH 3CP0A 4B3MQ 3TEHB 1NMGA 3OYYA 5M5WH 1VQHA 1FJGL 3PCOB 4GOPB 1YEZA 1TWFH 1PYSB 2ALYB 3PIPA 4A76A 4DV7L 4R1JA 4UP7A 2K52A 2VQEL 4JI4L 3HOUG 1TWGH 4HJ5A 4YWMA 4X66Q 3SGIA 5GAHC 3CF5A 1X3GA 1N36Q 2K5HA 3JAMc 4DUZL 1UE6A 2R7ZG 4GS3A 4JYAL 1YI2A 2ZTCA 5FLMH 2OQKA 2KCTA 1PHJA 3JC66 2NVQH 1WOCA 4OONA 4Y52H 3L7ZC 5IP9H 1HR0Q 2L15A 3IRBA 4GLXA 2VUMH 3KJOA 3S2HH 1PH2A 2NN6G 4X62L 2AWNA 4DV4L 4DK3C 3MEFA 4B3RL 4OX9L 4BY1G 1C7YA 4GLVB 4JI1L 2E5LQ 2NN6I 1N34Q 1XJVA 2B29A 4LF5Q 4OWWB 1HZ9A 3HOYH 4LF8Q 1IBLL 3OTOL 1Q46A 4DAMA 1FL0A 3CXCA 1Q7YC 1M90C 3J80i 1YHQA 2A8VA 4GNXA 1WI5A 3I4MG 4WJ4A 4KHPL 2NZOA 3A5UA 1Y14B 1CKNB 4JBWA 3PIOA 2Z6KC 3S24A 3L2PA 1CUKA 3UDFA 1N33Q 1SN8A 4GN4B 3BJUA 1ASYA 1YJWA
chains in the Genus database with same CATH superfamily
4V0BA 1D2BA 2A5HA 4P72A 2OTLA 2PPBC 1LO5D 3URYA 1SBBB 3U9OA 5IOCA 4R4TA 3SK4A 4E6IA 1I94Q 3S1QB 3MVVA 2WACA 2I5HA 4JI2Q 4JI3L 4K2LA 2F03A 1AW7A 1YNNC 4X66L 4F88A 2CVRA 2K5VA 1SR3A 2PI2E 4GOPA 1I6HH 3TZUA 1PZKD 4O0AA 2JA5H 4JI0L 1J6QA 1RJTA 1PH3A 3CPFA 1AE2A 2JXMB 3VYTA 1K28A 1EIGA 1Z9FA 2B8GA 3EVQA 4IPDA 4IPHA 5I9PA 2JA9A 3J7AV 3GTGB 4BY1B 4N9PA 4B3RQ 2N55A 3RLOA 1QJOA 5CBAE 1EUJA 1F2YA 1Q8IA 1CHQD 4K6LA 1SYDA 2EYLA 3NWTA 5C0XH 1EY8A 3OTOQ 2XIWA 1PFBA 4KLKA 5IIFA 4DXFA 4KJNA 3GTJB 1SAPA 5M3MH 1EY9A 2Z6KA 3DMUA 4O42A 1XPRA 4C3JH 2L9HA 4A3MB 1G291 1PH7A 4LAAA 1I5FA 4YY3Q 2MUYA 1PYBA 5HURA 3TRZA 4DU9A 1LUZA 4UPAA 4JI3Q 3I2ZA 4UP8A 4GN3B 3N52A 5DNFA 4ZAIA 1Y1VH 2SOBA 1K0RA 3HOZB 4JI0Q 4OGQC 4IUNA 3IFTA 1RTOA 2JA6H 2I5LX 2NZ1D 2K75A 1BCPB 1LTID 1BCPC 1R9TH 3CCEA 4EVOA 2HQEA 3CCLA 3TMEA 5ELCA 4JOIC 1MI2A 4IFDH 3J80E 2PCFB 2A69D 3T51B 1LV9A 1OXXK 3AYHB 1CTMA 4IOAA 3FPPA 3K5LA 2F0NA 2YU9B 1ENCA 2E2HB 1T5XD 3ND8A 3VA7A 1N32L 3K7AH 3SDZA 1B50A 3M7NA 5T1GA 1BOSA 3R2IA 3K6OA 1VQ6A 1XNQL 4OWTB 4Q5VA 1EY6A 1CZGA 1IXRA 4RH6A 2PZWA 2A68C 2K5NA 4X3TA 3CPWA 4AYBE 4QMGA 3A5ZB 3C46A 4R8NA 5IT9c 5C4ZA 1TQOA 4B3TL 4A3BH 1HZCA 2F0FA 3CMEA 1HNZL 3A7AB 1EU3A 2AQ3B 4DR6Q 3MAQA 1DJRD 1FVIA 1VQAA 2IX0A 2EJMA 1I4XA 3FRPB 2PMZB 1QG7A 2C35B 2OCEA 1STAA 4TVAB 2AQ2B 1DM0B 2V1CC 4CKCA 4XQNA 4P74A 1ZXTA 4DGZA 1HZAA 3BZKA 2R92H 5IWAL 3PV0A 1JQYD 3O13A 2OF1A 3TZDA 5FO7B 1QUQA 3AB9A 4XIGS 2N78A 3FDTA 5C44G 3TQYA 4IUUA 4UY8C 3MXNB 1VQCA 2UXDQ 4HJ9A 1CSPA 5KGUA 2EJGC 4AYBG 1E3PA 3OIQA 2FINB 1BKBA 4CHTB 3LX0A 3U4ZA 1A0IA 1NJIC 1BCPF 1YIJA 1HTLD 2F0PA 4TQUS 3D4RA 4LFBL 4AIMA 3CU7A 4BA1I 1TS3A 4C3HG 2F3IA 4LF9L 4KN4C 4POFA 5M5XB 4A3KH 4A3GB 3UDIA 4JI8L 4B3TQ 1HNZQ 3L9AX 2B2TA 1JWSD 4DR4L 3LWEA 5C3EB 2XNAC 4MTKA 4EGVA 3GTLH 2F0TA 1D5MC 1Q86C 2ATWA 4RWSC 5JEAG 2CHBD 3F2CA 1WTWA 1MJEA 1S40A 3MC0B 3R2TA 1C9OA 2SNSA 2YTVA 2HUGA 1KTKA 5KYIA 2JEBI 5LMNL 4P75A 2L0CA 1Q82C 1HUMA 5IWAQ 3PO2B 1A15A 1F2LA 1X32A 2BDNA 5IP7G 1MHWC 3QG1A 2EIFA 4X6AH 4YIJA 5C4XB 4NB3A 1EWHA 5CV6A 3UDXA 3JAME 2R93B 1V1OA 3BU2A 1X3FA 4DK0A 2R7ZH 3D4DA 2WAQB 3R93A 5C0XJ 1VQMA 4BBSG 1XWEA 3J81j 4LFCL 3X3NA 2E2DC 3P75A 4FF3A 1WFQA 5J3BA 4HSPA 3CC2A 3GO5A 4KK7A 1U9RA 4X65Q 1W2BA 3T4AC 4P2CB 1IW7D 1G2TA 1H9KA 1VS0A 1ZYRC 4LF9Q 1JE5A 1X56A 4YCWA 1I50H 5JJLA 2BA0A 2FMMA 4B9WA 4HJAA 3C1FA 4A3JG 4JI8Q 4DUYL 3I4MH 1TWHH 1QILA 3MXGA 2JSOA 1SNPA 4IN3A 3QO2A 1EY4A 1HNXL 4DR4Q 3I4NG 3HG9A 1QWYA 4Y7NH 3AU7A 2EDGA 4WJ3M 4KN7C 1G6PA 2RQXA 1YNXA 5C5MA 3NTIA 5KIXA 1Z6HA 4BY7B 5LMNQ 3RZDH 1TXYA 3SXHA 1H9RA 1UE1A 3QJYA 1HQMC 2QILA 1HQRD 3SHLA 4IPGA 2VZAA 4IQZA 2EE1A 3C2PA 1YHBA 1HA6A 4DF7A 2X6LA 3H3VH 2ZJPA 2QKIC 1LTLA 4DNRB 5C5LA 2AKWB 2HIXA 1MSGA 1PZJD 5F2DA 4QJFA 1HR0W 3CCVA 1IYUA 2EY6A 3MXPA 3HRZC 4CKEA 1LTRD 4IFDJ 1O7YA 1YZ6A 2QA4A 4LFCQ 5CR3A 1WCMG 2K5DA 2LSSA 4H44C 4QL5A 4GNXB 1DGSA 1GVPA 3ERSX 2Q2IA 3PF5A 1XX8A 2EYMA 1IBKL 1LTSD 2IHFA 4RGMA 1YJ9A 2F0EA 3PF4A 1VQ9A 1L0XB 5I9OA 3MTSA 3F2UA 4HTHA 2A6EC 2F0QA 1SJED 3G48A 5CV4A 1E7ZA 1GHKA 5CYUA 1QZHA 2RKSA 4KTAA 2Z4IA 5JJIA 1SNCA 1DONA 2J0TD 4PQXA 4IURA 4H13C 1Q3LA 1ZEQX 5GQOA 3ND9A 1EIHA 1MD2D 3I7FA 5LL6S 3GTOH 4DV5Q 2JJQA 3MFGA 4LF7L 4MIUA 3T56B 3HOXB 1KLGD 2WINB 2ZJRA 4B3MQ 1TT2A 2R61A 2F0OA 2EY2A 2WKCA 3A54A 4GOPB 1TWFH 3PIPA 4A76A 2K52A 2VQEL 3HOUG 1ENFA 1TWGH 1SDFA 4CDFC 5GAHC 1X3GA 1PTOB 2K5HA 2JA7B 5FKAC 1PTOC 1SNMA 1RDPD 1YI2A 3OPOA 1WOCA 4ZLTF 4NP5A 1LT6D 3S2HH 4OX9L 4BY1G 3M4YA 4JI1L 2DY7A 2ZXRA 4G7ZC 2Q8RE 1LT3D 3HOWB 1IBLL 1GUOA 3D6WA 1FL0A 3J80i 3DWPA 1PMRA 3K59A 1Y14B 1CKNB 2JA8B 2Z6KC 3S24A 1EU4A 3UDFA 3D3RA 3BJUA 1NCVA 2OQ0A 2Q8IB 1XYIA 3HOVB 4GKKL 4ZRZA 1KAAA 5M3FB 2OEOA 1PFMA 4JBJA 5J1ZA 4DV3L 3T16A 1DOKA 2FMCA 3M4PA 5IGFA 1NSNS 2WB1E 1LYLA 5T1IA 2B63B 1S3OA 1HA5A 2E8GA 3WWVA 2A19A 1YNJD 3FHWA 5IY0A 2CH4W 1R4PB 5H1SE 3MWYW 3DXJC 3W3AA 4O1NA 4HIKA 1K73C 1DZ1A 2VQEQ 2QEJC 3W5OA 1HNWQ 2EZVA 1LTGD 2VQFL 1SRUA 4L6TB 2EYPA 2KCMA 5KNCA 3HOZG 4GZYC 3S16H 3S9WA 4ODGA 1BUVT 1JJGA 1CSQA 1WTHA 1L0WA 3TSSA 2ZJQA 1A63A 1QB5D 1YJNA 1PTOF 3J81c 2KJXA 1K83B 1JOKA 3PUVA 3HFZB 2D9UA 2F3WA 3BYYB 1IBLQ 4RA8A 5GAEC 4TRDA 5TSSA 4QQBX 4A3EG 2WB1G 2TSSA 1PH8A 1JC7A 1SFOH 1QVFA 3MA2B 4LUOA 2VB3X 3L3OC 1GM5A 1PRTF 2F0DA 2YTXA 1FR3A 3VR4A 1UE7A 1JCKB 3CCUA 1XPOA 1I94L 2JEAI 4ZCKA 5D14A 1LM0A 2PNHA 1VF7A 4IUQA 3L0OA 1ONLA 1EY5A 4KJOA 3ZJYC 1KDAA 3NEMA 2PI2A 3U4VA 4OHJA 4JI2L 4C3HH 4B3SL 4IPCA 1XMOQ 5DM73 3K8AA 1I6HB 3J7YW 1I4PA 2EPBA 2Y0SB 2EXZA 4KY5A 2JA5B 4DN4M 5I2YA 5IP9G 2G9HD 3W1GA 3CHBD 3E3XA 4NXMQ 1HUNA 4OO1I 4XYQA 4DPGA 1S5CD 2VQFQ 1KAWA 3NPPA 3ULLA 5JEAH 2KEEA 1IBMQ 1QUQB 3TS0A 1VQ7A 1TWAH 3HOYG 3TP8A 3IFDA 5CGKA 2UXBL 3AEVA 4BWGB 2MO0A 4DR2Q 4R4IA 1DD2A 1EIFA 3BVGA 3EJIA 4KI0A 3OHXC 2K32A 1MSHA 4HIDA 5M5YB 3RD4A 1B8AA 4B9XA 4OIJA 5IP7H 1LTTD 5M3MB 3JAMi 3F2DA 1Q12A 4PZ6A 2F0KA 3GTQH 1TS4A 4APVA 4IUPA 1ENAA 1EQQA 1KNAA 1RHPA 3PUWA 4BBSH 1IZ6A 3CMAA 1H9MA 3G6JB 3SK6A 2E2JH 3I90A 4JBKA 3OOCA 5M5WB 1HXYD 3J7AF 1QVCA 3D4WA 3S1RH 2YTYA 4KV6A 4YY3L 2A6HC 1I4QA 2B2TC 1RTNA 4B3SQ 2VXWA 5IYCG 2JYOA 2HT1A 2Z8LA 3BZCA 5BN3A 4A3JH 4A93G 1VQJA 5C3WA 1O7ZA 1Z47A 2KENA 3H0GG 2VUMB 1FGUA 2XGTA 2F4IA 3I56A 2UUBL 2JA6B 3I4NH 3K81C 1CZWA 3VR6A 2CWAA 1VQIA 1T9HA 1EIYB 3VDYA 4YHHL 3P1HA 2F4VL 1G2SA 1R9TB 4BS9A 2I46A 3KLSX 1QVGA 3S2DH 2UXCL 3QOJA 4A3IG 4R4CA 1RF2D 1E2WA 5G3LF 4DR3Q 1CA5A 3DLLA 3PO2G 1PH5A 1IKMA 2UXBQ 3KLSA 2KOLA 3HKZB 1SYEA 1JMCA 1O78A 2IW3A 2RCNA 3FP9A 2MPMA 5C4XG 4JI7Q 3G6EA 3K7AB 4A75A 4RHRA 2K03A 2Z9HA 2XRQD 5A2QE 2R93G 3I91A 4RMFA 5IGDA 4DR7L 1PLFA 4OELB 2WAQG 1N9WA 4UHVA 3GP7A 4LF6L 3G4SA 1CKNA 3SVMA 4JCVE 4WJWA 3RLNA 4PMCA 1EEFD 1STNA 1K0SA 1B3QA 4PV1C 2Q8TA 3RN5A 2DGYA 4GN5A 3T1HL 5E1FA 4M1UB 5DM63 3TDQA 4A3BB 2L55A 1WCMH 2PW5A 3GTPB 3M3YH 1O7IA 1QOHA 3J81E 4MTNA 1U4RA 3BZDB 4KY6A 4C1NK 1VMCA 4A3FG 1I6VC 3KF8B 3LNNA 4DR6L 2N49A 2DY8A 3DWQA 1BBWA 2NVTB 2ZTDA 1VQOA 4K14A 3BS1A 4BA2I 1SYGA 1XXGA 3CC7A 4S3SA 4QIWB 1V1QA 4OEMB 2KA7A 4QUCA 2HHHQ 4H7BA 2RF4A 5NUCA 2R92B 3IAYA 2UUBQ 4KKTA 4Q0FA 1VQFA 3DHQA 2K14A 2B2YA 4JW0A 1HFGA 4YHHQ 2F4VQ 2RDHA 2UXCQ 5CC4A 1VQKA 4HCEA 3D6CA 3OWFA 4EQNA 2UXDL 4AQYL 2B2WA 3NTHA 1GD7A 4ZKCB 3VYUA 1HH2P 3W2DA 5FK9C 3H09A 3HOUH 4QF4A 4JVZA 4H0LC 2HQLA 4ZQ3A 3KBGA 4QCLA 1W6KA 2K4KA 1BF4A 4DR7Q 4CGYB 3D8GA 3TP7A 1HPCA 1FD7D 4LF6Q 5EKKA 1PDQA 3WDNA 1A3TA 3RUZA 1E0BA 2B39A 1I4GA 3MZ5A 4RCOA 3GTGH 3AFQA 4BY1H 5DEHA 1KD1C 3T1HQ 2R7DA 2A69C 5I2XA 1SEBD 2R7FA 4J8QA 1WVLA 1SE2A 3GTLB 2IX3A 2EVBA 1WD0A 1C0AA 1K8GA 2BH2A 2NZHA 3CCRA 4P71A 2ASBA 3GTJH 2KCCA 3EQLC 3NBHA 1NE3A 3BG3A 5IGGA 2GVAA 5FLXL 3LGJA 3PIO3 2F0HA 2K7VA 3DM3A 1X3QA 1LLRD 2MJ8A 4A3DB 4KMUC 4IUTA 4ZUJA 3STBC 1R4QB 2D0PA 1FJGQ 1IYVA 5JEAJ 2D0OA 2IX1A 5CBEE 4DAYB 4R4QA 2F0VA 1XTDA 4PG3A 4AQYQ 1JORA 2R7ZB 3PGZA 1LTBD 1VQGA 2HDLA 1VQLA 1Q1BA 1CK1A 3CKIB 1S5ED 2B2UC 1MKHA 2DNEA 2F0JA 2KECA 1EYAA 4X3KA 4DV4Q 3KOJA 5JAVA 2K28A 1N34L 4KKUA 1UEAB 4ID6A 3IKJA 1X65A 5DAUA 5IYDG 4X65L 1B9MA 1HJPA 3Q8DA 1Q8KA 3RLFA 3F8TA 4FF4A 2BE5C 2K50A 1TWHB 3K0XA 3Q0AA 3P7JA 2OXPA 4FP5D 4BBRB 1F9SA 2NVXB 1D7QA 2RDGA 2SDFA 1JE4A 4OIKA 4L5QA 2E2HH 2DUDA 1E1TA 1YBYA 3BDOA 4Y7NB 4A3EH 1EWIA 1G6ZA 1EY7A 2AHOB 3NQIA 5M3FG 3VR3A 5EPLA 2ZM6Q 1VQEA 1B3AA 3K5OA 3RZDB 5M9OA 1UAPA 2EQSA 1N8RC 3D0FA 4M8AA 2B63G 2EYFA 1KXLA 1SNDA 3Q23A 3DEOA 4G4KA 3CP0A 3TEHB 1EEID 1NMGA 1VQHA 3FKIB 1J9OA 1YEZA 2ALYB 2XN9C 3R3OA 4K8JA 5I6YA 4R1JA 3SGIA 3CF5A 1Z7TA 2K5WA 1UE6A 4XXEA 1SYBA 3JC66 2NVQH 1NNXA 3L7ZC 5IP9H 1HR0Q 2L15A 1PH2A 1QNKA 4L8JA 1CA6A 3MEFA 3DWAA 2E5LQ 1OO9B 4C2MB 1N34Q 1HTPA 2F1MA 2QCPX 4OWWB 3HOYH 3S17B 1Y8NB 4Z9CB 2QDLA 4LF8Q 5JVG3 1M90C 1ZYRD 3NUCA 2NZOA 1AEXA 3A5UA 1D6EC 2P5ZX 4JBWA 3WOEA 3QB3A 3L2PA 4DXGA 1CUKA 1CQVA 4GN4B 1DOMA 3KF8A 3GTOB 3AFPA 1A8VA 5GROA 4G7OC 1HZBA 3NENA 1CQFA 2BOSA 1JICA 2KUMA 4DV5L 1Q1EA 4F87A 2O5JC 2C5CA 3HGBA 1IW7C 1TIID 1EQTA 4AH6A 4B3ML 1MIUA 3H15A 5IYBG 4NW2A 2F0IA 4LUVA 1KC8C 4RCNA 5IT9E 5FO9B 1RODA 3IL8A 1UUPA 3TP5A 3SR1A 4BXXG 2Q2UA 5IYCH 2HIVA 1LT4D 2NUCA 3S2HB 4YCUA 1RD9D 1STHA 3DUZA 4A93H 2D62A 3CW2C 1YHAA 3H0GH 4XQJA 2AQ1B 1MGSA 2JN4A 1VQ4A 5LL6X 2SEBD 1AZQA 4CJ2C 4HEDA 1AZPA 2AUKA 4UAIA 1AP0A 4HN7A 4A3IH 4GNXC 1D1IA 3GD7A 1K8OA 5C0XI 4L5SA 3PO3G 2OWOA 3PO2H 5KYLA 3J80L 2UUCQ 1D5XC 4ME3A 4PZ8A 3CAMA 1I4RA 1NR4A 3C1EA 2WV6D 5C4XH 1ML0D 1QCBD 5C4HA 4RFBA 4XTCS 2R93H 4I7ZC 1P16A 4H02A 2K05A 3KDFB 3KLWA 3ULPA 5IGCA 3CQZH 3MHBA 3WOFA 4K8IA 3ER0A 4A3LG 4JPBW 2ICIA 2E2IH 3U9SA 3RR5A 4J15A 1PH6A 1SYFA 5IGEA 1GKHA 1FNVA 5C4JH 2DNCA 4GOPC 4A3FH 5FLMG 2GN5A 1HNWL 1LACA 5K36G 1YITA 1TR5A 2VUMG 3F1ZA 5C3XA 4IO9A 1GOZA 2RHSB 3A56A 1KDBA 5ELFA 3S16B 4DAYA 5ISRA 1BBXC 4CBVA 3S1MH 4ULLA 4IOCA 1Y1WB 4L5TA 1TY0A 5LMNW 3KFUA 5ELEA 4P73A 2VW9A 3S14H 3HKSA 1XPUA 1PRTD 1U4MA 1VCIA 3PQIA 4LF4Q 1KHIA 2H1EA 1Y8OB 3ONAB 1UWVA 4IFDI 1OXUA 1SYCA 1KDCA 1WTRA 1U5KA 4AYBB 4YCVA 3K5NA 1IHZA 4DNIA 3PUYA 3TP6A 1EYGA 4RG1A 3V96A 4C3IB 1EOTA 5CMDA 2JP1A 2KBNA 4IUVA 4K5XA 2JE6I 5DLQE 5EGTA 1B44D 4K5WA 4CDEC 3E0EA 4A3MG 1BBUA 1OTCA 3I3CA 5FO8B 4FXGC 4C3HB 2H4OA 2V4DA 1VQPA 3CCSA 1STYA 3FPUB 1L1OA 5CV5A 1I4HA 1EOVA 1XMOL 4V190 1I3QH 4MNOA 2OTJA 1ICWA 3GQBA 4NXNL 4O2DA 1XMQL 1IYJB 2LXKA 3A74A 2L12A 4NXML 5A35A 1JR0D 1JWUD 2ID0A 2G9DA 5ELNA 2D5DA 3CRLC 1FGBD 1TWAB 3W1BA 2LS01 5EJWA 3MXUA 4IZ8A 1PFNA 5GAGC 1IBML 3EROA 2PQAA 4DR2L 2J4XA 1YNJC 1KLUD 1V1PB 1K8MA 4XT1B 4PNYA 5IGBA 2B2VA 2PMZE 3DEPA 3VYRA 3I4LA 1MBYA 3S1NH 1VMPA 4UP9A 1TS2A 2I5MX 5C44H 1DXMA 2ZXPA 2PZTA 1PTOH 4DV0Q 3GV3A 3NSWA 3JAML 3RNUA 1K8AC 3UE1A 2CW0D 1WTQA 4RGOS 5HGQA 4NKLA 1B1ZA 1VQBA 3I70A 3NWSA 5D3IB 2MNAA 1JB3A 4ZUIA 2E2JB 3I8ZA 4FF2A 1OXVA 3S1RB 4XQQA 3E5SA 5ELOA 3QR8A 1IL2A 5IYDH 1G51A 4POGA 3S15H 3KF6A 4K6DA 1CM9A 3NBHB 3EN2A 4HCSA 1HCZA 3ERQA 2G5DA 3NHHA 1EYDA 2DN8A 5G3LD 5JOBA 1V8QA 5JJZA 2L1BA 4OO1G 4RKLA 4NXNQ 1STEA 2BH8A 2XVSA 1XMQQ 1EZ8A 3I4NB 1GUNA 1ET9A 3EBEA 1T5EA 2UU9L 3S2DB 4LNQA 4U673 1SMXA 5M3FH 2QGQA 4FF1A 5JJKA 1E24A 1F9RA 2VL6A 5AJ3L 4DV2L 4A3DG 3T1YL 4XDXA 3GTMH 3F2BA 4DR3L 2EY1A 4QB4A 4QY7A 2B63H 4JV5Q 1W3SA 4NMZA 3J80c 1BVSA 2R6GA 2IWHA 4JI7L 1PFSA 4JI5L 5CORA 1JJ2A 1AH9A 4A3CG 1EWCA 2DJGC 1CKMA 3BDLA 3K57A 1KNEA 3OMCA 5EBCA 3KUPA 1C48A 1VDZA 1RL2A 2PW7A 1S5FD 2UUAL 2KCNA 4C3JB 3SK5A 2O2LD 5BR8Q 1EFID 4ME5A 1SMYC 3M3YB 2CH4A 5K5PA 2R3ZA 1HFNA 1WTVA 4DK1A 3A55A 3KDFA 1LTAD 1AE3A 1S4ZA 4A3GG 2WKDA 4BBRG 2FXQA 1B70B 2WAQE 1K83H 4CDCC 1WJJA 2PQEA 1B7YB 1YNND 4GKJL 1IL8A 4KKSA 5C3EG 5EAYA 4DR1Q 3DM1A 3SK8A 1Y1VB 2RBMA 5EKLA 3TREA 4G57A 2HHHL 2WFWA 2F52A 2UU9Q 2LFNA 1DCZA 3K80C 1BNZA 2A1AA 3I72A 3RN2A 4KHVA 2MQHA 4RAUC 2NWGA 1YVCA 5AJ3Q 4DV2Q 4R9WA 3T1YQ 3FKIG 4WORA 4J6HA 3RZOH 2XWBB 5IYBH 5I4DA 3HOUB 2RHQB 3TBIB 4C56C 2DJFC 4JI4Q 2VY3A 2WP8J 3H3VI 1F2MA 1EZ6A 3AQQA 4JI5Q 4MN3A 1PYWD 4JYAQ 3KLRA 1Q90A 1NBWA 1Y69U 4BXXH 3VR2A 1RIPA 3GTKH 1F2ZA 2RSNA 1VF5C 3A0JA 1II3A 3UDGA 1EQRA 1H9JA 1OXSC 3CC4A 2CQOA 2NVYH 4C1NI 2UUAQ 3E6ZX 1TWCH 2MHVA 4YWKA 1ESRA 1NAPA 2F3VA 4JBMA 4X3UA 2B3GA 3B6YA 3HEJA 3NELA 3M4QA 1FNWA 1KABA 2XSCA 5M5YH 3CD6A 1PVOA 3PO3H 1N33L 2K33A 2LXJA 1A3UA 1K3RA 2K1BA 4HMIA 3OW2A 5CV8A 3M4OH 2RVLA 1SE4A 4GKJQ 4GLAC 4EX5A 3GDEA 2ICEC 4JI6L 2E75C 3PUXA 1M1KC 2E74C 4F7XA 3VA5A 2MP1A 2NTSA 1WYDA 4TKOB 2M00A 2JK8A 4NPSA 1NTGA 2EXDA 3E9IA 4A3LH 4BY7G 1NUCA 3S1QH 1CFMA 3OYYA 5M5WH 1FJGL 3PCOB 1BCPD 1PYSB 2EYOA 4DV7L 4HJ5A 4F8MA 4X66Q 2F0UA 3LWUA 1S5DD 3JAMc 3QOLA 4DUZL 3G7LA 4HAEA 2OQKA 1CT1D 1V1PA 2KCTA 4FXKC 4ZKBB 5JPMC 5FLMH 1AFPA 4OONA 5K36H 5FOBB 1F77A 2VUMH 2QDBA 1W6JA 2IL8A 2NN6G 2Z1CA 4X62L 4DV4L 1WD1A 4DK3C 1QNUA 3QWNA 4GLVB 1PXUA 1O80A 2NN6I 4CKBA 1HZ9A 2A68D 4A3KB 5BN4A 2XRSD 3K5MA 3Q6SA 1GUTA 2EOTA 1Q46A 3CXCA 1Q7YC 2L5TA 5IODA 4KHPL 2RCFA 1ESFA 2ENBA 3PIOA 2PZUA 2WB1B 1O7LA 4A3EB 3V05A 1HRJA 5CV9A 1UNSA 5COYA 1N33Q 4XT3B 1B53A 4HMJA 1ASYA 1EYCA 5KNBA 3TN2A 3VYSA 1X9NA 2ES2A 2ZM6L 1SROA 2H5XA 1J8IA 3RMHA 3J7A5 4HIOA 4JI6Q 1EFWA 3FEWX 3N6RA 3SEBA 5C6AA 1TKWB 5HGTA 3HOXG 4A3MH 1EQVA 3STBD 3GTPH 1U4PA 1K9MC 5FJ8G 1VQDA 5E3FA 1FYCA 4DV7Q 2NVQB 1JOOA 1EY0A 2JA7G 1SE3A 2NVTH 3CRKC 4FO2A 1SJHD 4X64L 2AWOA 4DUZQ 4XYOA 1HR0L 4CJ1B 3BDCA 4CJ0B 3EIVA 1Y1WG 2XWJB 1X3EA 2JQOA 4FXDA 3HOYB 2QEXA 4X62Q 3HOZH 2E5LL 1U0LA 4QGUA 2FFKB 3BVMA 1GUWA 2NBFA 2Q2TA 4LF8L 1TS5A 1TVXA 1GUSA 1I50B 1M8AA 2GA4B 3HOWG 2BE5D 1H95A 5L37A 1D1KA 3I4MB 1PH9A 2CQAA 3CCQA 1XTCD 3PUZA 4YWLA 4KHPQ 2JA8G 1WTOA 5HY6A 4C3IG 2IHEA 1IKLA 1N32Q 2YU9H 4IJLA 5LMUL 4HJ7A 3U50C 1OXTA 2N3SA 3T13A 5LHY1 2KHJA 2X6GA 3HOVG 1A3VA 3CCMA 2L4NA 3AMUA 1CKOA 4HJ8A 1XNQQ 1L1OB 4IJHA 1L1OC 4FDBA 2BCOA 3Q22A 4OL7A 2IT1A 4K5VA 1J5EL 1E2ZA 1CI3M 4HR7B 1A6XA 1X3PA 1ICFB 2B8FA 4KY7A 3H3VC 2CFMA 2LMCB 3I55A 2AUJD 1A62A 4A93B 3SE0A 1JWMD 2KHIA 1LT5D 2Z4HA 3H0GB 3NQTA 4OO1H 2Q2HA 4PZ7A 4X64Q 2PQAB 4WRDA 5JPNC 2K04A 3ITPA 3UE0A 3I4OA 2O5IC 4DA2A 3ICEA 5EKIA 4A3IB 2B2VC 2KEDA 4ZYSA 1F9PA 2Y0SE 2SNMA 4A3DH 3OSOA 5KNDA 4KD4A 1DOLA 1H9SB 1E1OA 2F0LA 1EL0A 2UUCL 2LKVA 4EQOA 4N9TA 3MEHA 2IY5B 5A2QL 1GHJA 4EQPA 2VS1A 1JT8A 1SNOA 4U68A 4A3CH 3CQZB 2PYKA 1RKNA 1QZGA 2E2IB 4LW1A 3CCJA 2FJ2A 4DAVA 5LMUQ 1G8ZD 4JG2A 1X6OA 2Z6BA 3HS0C 3KF6B 4LFBQ 4X3SA 1X54A 4LMQD 5C4JB 1TWFB 3J81L 4A3FB 2K6AA 4L5RC 4N8X1 3M85A 1TWGB 1J5EQ 2ZT9C 5M5XH 3R8BA 2N88A 3Q24A 4A3GH 1ILQA 4BBRH 1Q81C 2Y0SG 4KHZA 2NVXH 2J7ZA 4RGTA 2JA5G 1VQ5A 5I6WA 3S1MB 1B2TA 4ILWA 5C3EH 1DYQA 3K0YA 3S14B 3MFYA 4DKAC 1SLJA 2YV5A 3NBIA 1WTPA 1D8LA 3T53B 4RHSA 1JJCB 3NK9A 5EPJA 4DV6L 3G71A 2F0GA 2NYZD 4OWXB 2TMPA 2IJ0A 2N8NA 3KBXA 1GJXA 4LF4L 5C0XG 2F0MA 4PMBA 2E76C 1VQ8A 1M4VA 2F0WA 4R4OA 3NXWA 1CHPD 3FKIH 2BDOA 3PSIA 3KJPA 2PNRC 5KEEA 3EA6A 4MZ9A 5M3MG 3A8IE 4JOIA 2A6ED 1PA6A 4C3JG 3A8KE 2HDMA 3GV6A 3ULJA 5FLXc 3HKZE 3I73A 1BO0A 4WFN3 2K5QA 1PZID 1VQNA 1S5BD 3OMGA 3NTKA 4C2MH 1I3QB 2MFIA 3A8JE 3S17H 1B4OA 1KRSA 3J81i 1E22A 4DNTB 1A2TA 3A7LA 2EJFC 1ASZA 4DUYQ 1C4QA 4B08A 4LUZA 4EQ5A 2IPKD 3ZYYX 1Y1VG 1PTOD 1HNXQ 5EBDA 4UDUC 3OIPA 1P8LA 2JA6G 1A2UA 4I65A 2NTTA 3FVQA 1JB7A 2PO4A 2EYJA 1L2FA 3U58A 1STBA 3C3LA 1KQSA 3NP8A 4DV6Q 1B9NA 1UEBA 3E9HA 3S1NB 4IFDG 4K0KL 4BY7H 3HKZG 5C44B 4QIWE 1V43A 3TS2A 3H6MA 3BYTB 1SXTA 1JOQA 2CWPA 1HHVA 1GO3E 1PH4A 1SFOB 4DV0L 3VR5A 3UI2A 3MXNA 4FYDA 5E7NA 2A73B 1NMFA 3J7ZC 1BXTA 3PIP3 1U4LA 4RGNA 5ELDA 2QF7A 2NB0A 2BA1A 1UE5A 2B2UA 2EYHA 1PRTB 1PRTC 2LY7A 4NDXA 2NN6H 5D65A 3D31A 1TY2A 4A3BG 3S15B 2QW7A 3BVZA 2HCCA 5GADC 1IBKQ 1SSOA 2Z0SA 4ZK9B 4ALPA 2M2LA 2C9OA 4LFAL 1SNQA 2VNUD 2ZXOA 2L11A 1XNRL 4DK6C 1LABA 4DV1L 3M7GA 1STGA 2ZTEA 2F0SA 2MGSA 2KHSA 5J39A 1ZKOA 4J1MA 5D3DA 4HSVA 4MHEA 2B2YC 3GTMB 3KYHC 2R92G 4DR5L 1GUGA 1GXDC 4LF7Q 1V9PA 4DFAA 4HIMA 2B2WC 4JV5L 2X69A 1FNUA 4KD3A 3HOXH 3K58A 2O4XA 4JK1C 1WTXA 2OT2A 1N36L 2A74C 4K0KQ 1E2VA 4JC0A 5FJ8H 3QIAA 1BR9A 3FMCA 3H91A 2RA4A 4I7AA 3GTQB 1NR2A 5ELBA 1S72A 1KL9A 1H9SA 2CCZA 4K2KA 1RCVD 2JA7H 2VB2X 2I07B 5E4XA 1SE8A 3NE5B 4A4IA 4BBSB 5JVH3 1X55A 4LWCA 5IE8A 5BR8L 3M9BA 5CV7A 1PV4A 2I0QA 1Y1WH 4OXPA 4OX9Q 4L63B 4LF5L 3KK7A 4FVMA 4JI1Q 1BDOA 1F9QA 4LJZC 4A3KG 1AN8A 3OWEB 1QE6A 3K7UC 1KIXA 1NY4A 1ET6A 1MJCA 2AMCB 1L0YB 4FNFA 1K3BC 1TU2B 2RSOA 3OW7A 3HOWH 4LFAQ 1KRTA 4A3JB 2CW0C 4R8IA 1XNRQ 4DR1L 2JA8H 4DV1Q 2CKZB 2EY5A 3E0JA 4C3IH 5KRUA 1PH1A 2YYZA 4GKKQ 3V2TA 5FLXE 1C8CA 2MO1A 4PMWA 3HOVH 3H94A 4TSSA 2XTIA 4DV3Q 3RZOB 5BN5A 4DR5Q 5J22A 2FHTA 2KQ3A 2GVBA 1D5ZC 3HZXA 2M9VA 5IT9L 1ILPA 4UP7A 4JI4L 4YWMA 4N8FA 4RKBA 1N36Q 2WIIB 2R7ZG 3GTKB 4JYAL 4GS3A 5E4WC 2ZTCA 5EPKA 2KVMA 1PHJA 4Y52H 4DAPA 1BQQT 3IRBA 4LK1C 4GLXA 2NVYB 3KJOA 3PMFA 1TWCB 2AWNA 4QUFA 4B3RL 4G7HC 3EFXD 4CDDC 2K01A 1C7YA 1SMYD 1WCMB 2HD3A 1XJVA 2B29A 4LF5Q 5AFWA 4ABNA 1G91A 2RDFA 3OTOL 4DAMA 3PO3B 2A8VA 3I4MG 2HCIA 1YHQA 4WJ4A 4GNXA 1WI5A 2A6HD 3X3MA 1Y8PB 4IALA 3M4OB 2D2CC 1SN8A 3HP3A 3P20A 5EQ0A 1YJWA
chains in the Genus database with same CATH topology
2OQ0A 3AFPA 1X9NA 4P72A 4GKKL 1A8VA 5GROA 2ES2A 1HZBA 2ZM6L 1SROA 2H5XA 2OTLA 4JBJA 2HT1A 4HIOA 3NENA 4JI6Q 3J7A5 1EFWA 4DV3L 4DV5L 1Q1EA 4R4TA 1I94Q 3M4PA 4AH6A 3HOXG 2WB1E 1LYLA 4A3MH 4B3ML 1MIUA 1S3OA 2E8GA 3H15A 5IYBG 3STBD 3GTPH 4LUVA 1KC8C 2I5HA 4JI2Q 3WWVA 5FJ8G 2A19A 3FHWA 4JI3L 1K9MC 5IY0A 5H1SE 1VQDA 4X66L 4HIKA 1K73C 2K5VA 4DV7Q 1SR3A 2VQEQ 4BXXG 2Q2UA 2PI2E 4GOPA 2JA7G 3W5OA 2HIVA 5IYCH 2NVTH 1I6HH 2VQFL 1SRUA 1HNWQ 4X64L 2AWOA 4YCUA 4DUZQ 1Q81C 4O0AA 2JA5H 4JI0L 1HR0L 5JJLA 2KCMA 1J6QA 4A93H 3HOZG 1PH3A 2D62A 3CW2C 3EIVA 3CPFA 1YHAA 1Y1WG 3H0GH 1AE2A 1X3EA 3S16H 2JQOA 1VQ4A 1Z9FA 2QEXA 4IPDA 4IPHA 4X62Q 2JA9A 3HOZH 2E5LL 1JJGA 4B3RQ 1CSQA 1U0LA 3RLOA 4QGUA 1L0WA 2ZJQA 1A63A 4A3IH 4GNXC 1YJNA 2Q2TA 4LF8L 3GD7A 1EUJA 3J81c 1H95A 3HOWG 5C0XI 4L5SA 3PUVA 3PO3G 2OWOA 3PO2H 3HFZB 1IBLQ 3OTOQ 1PH9A 2UUCQ 5GAEC 3CCQA 4YWLA 3PUZA 4ME3A 4PZ8A 3CAMA 4KLKA 4A3EG 2JA8G 2WB1G 4KHPQ 4QQBX 5C4XH 5HY6A 1PH8A 2IHEA 1N32Q 1SFOH 1QVFA 4XTCS 2YU9H 2R93H 4IJLA 5M3MH 4LUOA 1P16A 4H02A 5LMUL 4HJ7A 1GM5A 2Z6KA 3U50C 1OXTA 2YTXA 2N3SA 3HOVG 3KDFB 2KHJA 3KLWA 3ULPA 1UE7A 3CQZH 3CCMA 1XPRA 1CKOA 4HJ8A 3CCUA 3ER0A 4C3JH 1XPOA 1XNQQ 4A3LG 1L1OB 4IJHA 1I94L 2E2IH 1L1OC 2JEAI 4FDBA 3RR5A 1LM0A 2PNHA 4J15A 1G291 1PH6A 1PH7A 3L0OA 3ZJYC 1I5FA 2IT1A 3NEMA 2PI2A 4YY3Q 3U4VA 1J5EL 4JI2L 4C3HH 4B3SL 2NVXH 4IPCA 1GKHA 1XMOQ 1PYBA 5C4JH 3TRZA 1LUZA 3K8AA 4GOPC 4A3FH 4UPAA 4JI3Q 5FLMG 2CFMA 3I2ZA 2GN5A 3I55A 1A62A 4UP8A 1HNWL 5K36G 5IP9G 3W1GA 1YITA 4GN3B 2KHIA 4NXMQ 3F1ZA 2VUMG 4OO1I 4DPGA 4IO9A 2Q2HA 2RHSB 2VQFQ 4PZ7A 1KAWA 4X64Q 1Y1VH 2PQAB 3ULLA 1K0RA 3S1MH 4JI0Q 4IOCA 1IBMQ 3UE0A 1QUQB 4L5TA 3TS0A 3I4OA 1TWAH 1VQ7A 5LMNW 3KFUA 2JA6H 3HOYG 3ICEA 4P73A 2VW9A 3S14H 2I5LX 2K75A 3HKSA 1XPUA 2UXBL 2Y0SE 3AEVA 1R9TH 4DR2Q 2MO0A 1VCIA 4R4IA 4A3DH 1EIFA 3CCEA 4KI0A 4LF4Q 1KHIA 3CCLA 1UWVA 4IFDI 1OXUA 1E1OA 4JOIC 4HIDA 1U5KA 2UUCL 1B8AA 4YCVA 1OXXK 3AYHB 4IOAA 5IP7H 4DNIA 2IY5B 3JAMi 2I0QA 3F2DA 2VS1A 3PUYA 1Q12A 1N32L 4PZ6A 3K7AH 1EYGA 3GTQH 4RG1A 1JT8A 4A3CH 4APVA 3M7NA 1EQQA 1QZGA 2KBNA 4LW1A 3CCJA 5LMUQ 3PUWA 1VQ6A 4BBSH 4JG2A 1IZ6A 1X6OA 4OWTB 3CMAA 1XNQL 2JE6I 5DLQE 1IXRA 4A3MG 3E0EA 2K5NA 1BBUA 3KF6B 3CPWA 1OTCA 4LFBQ 4AYBE 2E2JH 1X54A 3A5ZB 4JBKA 1VQPA 1QVCA 3S1RH 3CCSA 2YTYA 5IT9c 4YY3L 4B3TL 1L1OA 4A3BH 1HZCA 1EOVA 4L5RC 1XMOL 3CMEA 3M85A 1I3QH 1J5EQ 4MNOA 1HNZL 5M5XH 4B3SQ 4DR6Q 5IYCG 4A3GH 2OTJA 4BBRH 4NXNL 2Y0SG 4KHZA 4O2DA 1XMQL 1FVIA 1IYJB 1VQAA 2IX0A 2LXKA 3A74A 3BZCA 4A3JH 2JA5G 1VQ5A 4A93G 1VQJA 4NXML 1Z47A 2C35B 2ID0A 2KENA 5ELNA 2OCEA 3H0GG 1FGUA 2XGTA 5C3EH 3I56A 2UUBL 4TVAB 3W1BA 3I4NH 3K81C 2CWAA 1VQIA 1T9HA 5GAGC 1IBML 3VDYA 1EIYB 4DKAC 2V1CC 4YHHL 1SLJA 2F4VL 2YV5A 3S2DH 2UXCL 1QVGA 4P74A 1D8LA 4DV6L 1JJCB 1HZAA 4A3IG 3BZKA 2R92H 4R4CA 2PQAA 5IWAL 3G71A 4DR2L 4OWXB 3PV0A 4DR3Q 2N8NA 3DLLA 5C0XG 4LF4L 1QUQA 4XIGS 1PH5A 3PO2G 2N78A 5C44G 2UXBQ 1VQ8A 2PMZE 3TQYA 1JMCA 4UY8C 4R4OA 3FKIH 2RCNA 3MXNB 1VQCA 3FP9A 2UXDQ 4HJ9A 1CSPA 3S1NH 5C4XG 4JI7Q 4UP9A 3G6EA 4A75A 2I5MX 3PSIA 4AYBG 5C44H 3KJPA 1E3PA 2R93G 4MZ9A 4RMFA 5M3MG 4DV0Q 4JOIA 3RNUA 1BKBA 1K8AC 4DR7L 3UE1A 2WAQG 5HGQA 1N9WA 3U4ZA 1A0IA 1VQBA 1NJIC 4LF6L 3G4SA 1PA6A 1YIJA 2MNAA 1CKNA 4JCVE 3ULJA 5FLXc 3HKZE 3RLNA 4TQUS 3RN5A 1OXVA 2DGYA 4GN5A 3T1HL 4LFBL 4AIMA 1VQNA 4BA1I 1WCMH 4C2MH 2F3IA 5ELOA 1IL2A 4LF9L 3M3YH 4POFA 5IYDH 1G51A 2MFIA 1O7IA 4A3KH 4POGA 4MTNA 3S17H 1KRSA 3J81i 4A3FG 3UDIA 4JI8L 1E22A 3S15H 3KF6A 3KF8B 4B3TQ 3NBHB 4DR6L 3EN2A 2N49A 1ASZA 4DUYQ 1BBWA 1HNZQ 4LUZA 2ZTDA 1VQOA 4DR4L 4EQ5A 4OO1G 4BA2I 3GTLH 4NXNQ 1Y1VG 2BH8A 3CC7A 1XMQQ 1Q86C 2ATWA 1HNXQ 5JEAG 1V1QA 3F2CA 3EBEA 1MJEA 2UU9L 4LNQA 1P8LA 1S40A 2JA6G 2HHHQ 1C9OA 1SMXA 2RF4A 5M3FH 2QGQA 2YTVA 2UUBQ 1JB7A 5JJKA 1E24A 2JEBI 2VL6A 5AJ3L 5LMNL 4P75A 4DV2L 1VQFA 4A3DG 2K14A 1L2FA 3T1YL 1Q82C 4YHHQ 2F4VQ 3GTMH 3F2BA 3U58A 2UXCQ 1VQKA 4DR3L 1KQSA 4DV6Q 1UEBA 3E9HA 4QY7A 5IWAQ 2B63H 4IFDG 4JV5Q 4BY7H 4K0KL 1W3SA 3HKZG 3J80c 4QIWE 1V43A 4AQYL 2UXDL 3TS2A 1BVSA 2R6GA 5IP7G 1GD7A 4JI7L 1PFSA 4JI5L 2EIFA 4X6AH 1JJ2A 1HH2P 1AH9A 2CWPA 4NB3A 1GO3E 4A3CG 1PH4A 3HOUH 4DV0L 2HQLA 3UDXA 1CKMA 5E7NA 3BU2A 1X3FA 2R7ZH 1NMFA 3J7ZC 2K4KA 4DR7Q 5C0XJ 1VQMA 4BBSG 3J81j 4LFCL 1RL2A 2BA1A 2UUAL 1UE5A 4LF6Q 1WFQA 5J3BA 5BR8Q 3CC2A 3D31A 3GTGH 3GO5A 3CC4A 3AFQA 4BY1H 4X65Q 1W2BA 4A3BG 1KD1C 3T1HQ 3KDFA 5GADC 2R7DA 1IBKQ 2Z0SA 1AE3A 1VS0A 4ALPA 4LF9Q 1JE5A 1X56A 4YCWA 1I50H 4LFAL 4A3GG 2VNUD 4BBRG 2BA0A 2FXQA 1B70B 2WAQE 1K83H 4HJAA 2R7FA 4A3JG 4JI8Q 4DUYL 3I4MH 1XNRL 1TWHH 1WJJA 4DK6C 1C0AA 1B7YB 1K8GA 4DV1L 2BH2A 2NZHA 4GKJL 2ZTEA 3CCRA 4DR1Q 4P71A 5EAYA 5C3EG 2ASBA 3GTJH 1HNXL 4DR4Q 3I4NG 1NE3A 3TREA 4Y7NH 2GVAA 4WJ3M 2HHHL 3LGJA 2WFWA 1G6PA 2F52A 3KYHC 2UU9Q 1YNXA 2R92G 3DM3A 4DR5L 3K80C 2A1AA 3RN2A 4LF7Q 1V9PA 2MQHA 1YVCA 5AJ3Q 5LMNQ 4DV2Q 3RZDH 4HIMA 1TXYA 3T1YQ 1UE1A 3FKIG 3STBC 4JV5L 3RZOH 3HOXH 2D0PA 1FJGQ 5JEAJ 2D0OA 2IX1A 4K0KQ 5IYBH 4DAYB 4R4QA 2RHQB 1N36L 4IPGA 4JC0A 1XTDA 2VZAA 4PG3A 5FJ8H 4JI4Q 2VY3A 1YHBA 4AQYQ 2WP8J 3H3VI 3AQQA 3H3VH 2ZJPA 4JI5Q 3PGZA 4JYAQ 1VQGA 1LTLA 1VQLA 1Q1BA 2AKWB 1KL9A 2HIXA 1S72A 1NBWA 2CCZA 2JA7H 4BXXH 1RIPA 4QJFA 1HR0W 3CCVA 3GTKH 1SE8A 4IFDJ 1MKHA 4A4IA 3A0JA 3UDGA 1YZ6A 1EQRA 1X55A 4LWCA 5IE8A 5BR8L 3KOJA 3M9BA 1OXSC 2QA4A 4DV4Q 1PV4A 2CQOA 1N34L 1Y1WH 2NVYH 1WCMG 2LSSA 4OXPA 2UUAQ 4LFCQ 4LF5L 4OX9Q 1TWCH 1X65A 4JI1Q 4QL5A 4YWKA 5IYDG 4GNXB 4X65L 1DGSA 4A3KG 3K7UC 1KIXA 1HJPA 3Q8DA 1NY4A 4JBMA 1GVPA 1MJCA 1Q8KA 2B3GA 2AMCB 2Q2IA 3B6YA 3ERSX 3F8TA 3RLFA 3PF5A 1IBKL 2IHFA 3NELA 2K50A 3K0XA 3M4QA 1YJ9A 3HOWH 3PF4A 1VQ9A 4LFAQ 1PVOA 1KRTA 5M5YH 3CD6A 1D7QA 3PO3H 1N33L 2LXJA 1K3RA 4L5QA 3G48A 2E2HH 1XNRQ 2DUDA 1E7ZA 1E1TA 1YBYA 4DR1L 3OW2A 1QZHA 4A3EH 2JA8H 1EWIA 5JJIA 4DV1Q 3M4OH 2CKZB 4C3IH 2AHOB 4GKJQ 4GLAC 4EX5A 5M3FG 3GDEA 1PH1A 4JI6L 2YYZA 3PUXA 5GQOA 1M1KC 4GKKQ 2ZM6Q 1VQEA 3I7FA 3GTOH 2MO1A 4PMWA 3HOVH 4DV3Q 2JJQA 1WYDA 2XTIA 4DV5Q 4LF7L 2JK8A 4NPSA 1NTGA 2EXDA 2EQSA 1N8RC 3D0FA 3E9IA 4DR5Q 2B63G 4A3LH 1KXLA 4BY7G 2GVBA 2ZJRA 3S1QH 3CP0A 4B3MQ 3TEHB 1NMGA 3OYYA 5M5WH 1VQHA 1FJGL 3PCOB 4GOPB 1YEZA 1TWFH 1PYSB 2ALYB 3PIPA 4A76A 4DV7L 4R1JA 4UP7A 2K52A 2VQEL 4JI4L 3HOUG 1TWGH 4HJ5A 4YWMA 4X66Q 3SGIA 5GAHC 3CF5A 1X3GA 1N36Q 2K5HA 3JAMc 4DUZL 1UE6A 2R7ZG 4GS3A 4JYAL 1YI2A 2ZTCA 5FLMH 2OQKA 2KCTA 1PHJA 3JC66 2NVQH 1WOCA 4OONA 4Y52H 3L7ZC 5IP9H 1HR0Q 2L15A 3IRBA 4GLXA 2VUMH 3KJOA 3S2HH 1PH2A 2NN6G 4X62L 2AWNA 4DV4L 4DK3C 3MEFA 4B3RL 4OX9L 4BY1G 1C7YA 4GLVB 4JI1L 2E5LQ 2NN6I 1N34Q 1XJVA 2B29A 4LF5Q 4OWWB 1HZ9A 3HOYH 4LF8Q 1IBLL 3OTOL 1Q46A 4DAMA 1FL0A 3CXCA 1Q7YC 1M90C 3J80i 1YHQA 2A8VA 4GNXA 1WI5A 3I4MG 4WJ4A 4KHPL 2NZOA 3A5UA 1Y14B 1CKNB 4JBWA 3PIOA 2Z6KC 3S24A 3L2PA 1CUKA 3UDFA 1N33Q 1SN8A 4GN4B 3BJUA 1ASYA 1YJWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OQ0 A;  3AFP A;  1X9N A;  4P72 A;  4GKK L;  1A8V A;  5GRO A;  2ES2 A;  1HZB A;  2ZM6 L;  1SRO A;  2H5X A;  2OTL A;  4JBJ A;  2HT1 A;  4HIO A;  3NEN A;  4JI6 Q;  3J7A 5;  1EFW A;  4DV3 L;  4DV5 L;  1Q1E A;  4R4T A;  1I94 Q;  3M4P A;  4AH6 A;  3HOX G;  2WB1 E;  1LYL A;  4A3M H;  4B3M L;  1MIU A;  1S3O A;  2E8G A;  3H15 A;  5IYB G;  3STB D;  3GTP H;  4LUV A;  1KC8 C;  2I5H A;  4JI2 Q;  3WWV A;  5FJ8 G;  2A19 A;  3FHW A;  4JI3 L;  1K9M C;  5IY0 A;  5H1S E;  1VQD A;  4X66 L;  4HIK A;  1K73 C;  2K5V A;  4DV7 Q;  1SR3 A;  2VQE Q;  4BXX G;  2Q2U A;  2PI2 E;  4GOP A;  2JA7 G;  3W5O A;  2HIV A;  5IYC H;  2NVT H;  1I6H H;  2VQF L;  1SRU A;  1HNW Q;  4X64 L;  2AWO A;  4YCU A;  4DUZ Q;  1Q81 C;  4O0A A;  2JA5 H;  4JI0 L;  1HR0 L;  5JJL A;  2KCM A;  1J6Q A;  4A93 H;  3HOZ G;  1PH3 A;  2D62 A;  3CW2 C;  3EIV A;  3CPF A;  1YHA A;  1Y1W G;  3H0G H;  1AE2 A;  1X3E A;  3S16 H;  2JQO A;  1VQ4 A;  1Z9F A;  2QEX A;  4IPD A;  4IPH A;  4X62 Q;  2JA9 A;  3HOZ H;  2E5L L;  1JJG A;  4B3R Q;  1CSQ A;  1U0L A;  3RLO A;  4QGU A;  1L0W A;  2ZJQ A;  1A63 A;  4A3I H;  4GNX C;  1YJN A;  2Q2T A;  4LF8 L;  3GD7 A;  1EUJ A;  3J81 c;  1H95 A;  3HOW G;  5C0X I;  4L5S A;  3PUV A;  3PO3 G;  2OWO A;  3PO2 H;  3HFZ B;  1IBL Q;  3OTO Q;  1PH9 A;  2UUC Q;  5GAE C;  3CCQ A;  4YWL A;  3PUZ A;  4ME3 A;  4PZ8 A;  3CAM A;  4KLK A;  4A3E G;  2JA8 G;  2WB1 G;  4KHP Q;  4QQB X;  5C4X H;  5HY6 A;  1PH8 A;  2IHE A;  1N32 Q;  1SFO H;  1QVF A;  4XTC S;  2YU9 H;  2R93 H;  4IJL A;  5M3M H;  4LUO A;  1P16 A;  4H02 A;  5LMU L;  4HJ7 A;  1GM5 A;  2Z6K A;  3U50 C;  1OXT A;  2YTX A;  2N3S A;  3HOV G;  3KDF B;  2KHJ A;  3KLW A;  3ULP A;  1UE7 A;  3CQZ H;  3CCM A;  1XPR A;  1CKO A;  4HJ8 A;  3CCU A;  3ER0 A;  4C3J H;  1XPO A;  1XNQ Q;  4A3L G;  1L1O B;  4IJH A;  1I94 L;  2E2I H;  1L1O C;  2JEA I;  4FDB A;  3RR5 A;  1LM0 A;  2PNH A;  4J15 A;  1G29 1;  1PH6 A;  1PH7 A;  3L0O A;  3ZJY C;  1I5F A;  2IT1 A;  3NEM A;  2PI2 A;  4YY3 Q;  3U4V A;  1J5E L;  4JI2 L;  4C3H H;  4B3S L;  2NVX H;  4IPC A;  1GKH A;  1XMO Q;  1PYB A;  5C4J H;  3TRZ A;  1LUZ A;  3K8A A;  4GOP C;  4A3F H;  4UPA A;  4JI3 Q;  5FLM G;  2CFM A;  3I2Z A;  2GN5 A;  3I55 A;  1A62 A;  4UP8 A;  1HNW L;  5K36 G;  5IP9 G;  3W1G A;  1YIT A;  4GN3 B;  2KHI A;  4NXM Q;  3F1Z A;  2VUM G;  4OO1 I;  4DPG A;  4IO9 A;  2Q2H A;  2RHS B;  2VQF Q;  4PZ7 A;  1KAW A;  4X64 Q;  1Y1V H;  2PQA B;  3ULL A;  1K0R A;  3S1M H;  4JI0 Q;  4IOC A;  1IBM Q;  3UE0 A;  1QUQ B;  4L5T A;  3TS0 A;  3I4O A;  1TWA H;  1VQ7 A;  5LMN W;  3KFU A;  2JA6 H;  3HOY G;  3ICE A;  4P73 A;  2VW9 A;  3S14 H;  2I5L X;  2K75 A;  3HKS A;  1XPU A;  2UXB L;  2Y0S E;  3AEV A;  1R9T H;  4DR2 Q;  2MO0 A;  1VCI A;  4R4I A;  4A3D H;  1EIF A;  3CCE A;  4KI0 A;  4LF4 Q;  1KHI A;  3CCL A;  1UWV A;  4IFD I;  1OXU A;  1E1O A;  4JOI C;  4HID A;  1U5K A;  2UUC L;  1B8A A;  4YCV A;  1OXX K;  3AYH B;  4IOA A;  5IP7 H;  4DNI A;  2IY5 B;  3JAM i;  2I0Q A;  3F2D A;  2VS1 A;  3PUY A;  1Q12 A;  1N32 L;  4PZ6 A;  3K7A H;  1EYG A;  3GTQ H;  4RG1 A;  1JT8 A;  4A3C H;  4APV A;  3M7N A;  1EQQ A;  1QZG A;  2KBN A;  4LW1 A;  3CCJ A;  5LMU Q;  3PUW A;  1VQ6 A;  4BBS H;  4JG2 A;  1IZ6 A;  1X6O A;  4OWT B;  3CMA A;  1XNQ L;  2JE6 I;  5DLQ E;  1IXR A;  4A3M G;  3E0E A;  2K5N A;  1BBU A;  3KF6 B;  3CPW A;  1OTC A;  4LFB Q;  4AYB E;  2E2J H;  1X54 A;  3A5Z B;  4JBK A;  1VQP A;  1QVC A;  3S1R H;  3CCS A;  2YTY A;  5IT9 c;  4YY3 L;  4B3T L;  1L1O A;  4A3B H;  1HZC A;  1EOV A;  4L5R C;  1XMO L;  3CME A;  3M85 A;  1I3Q H;  1J5E Q;  4MNO A;  1HNZ L;  5M5X H;  4B3S Q;  4DR6 Q;  5IYC G;  4A3G H;  2OTJ A;  4BBR H;  4NXN L;  2Y0S G;  4KHZ A;  4O2D A;  1XMQ L;  1FVI A;  1IYJ B;  1VQA A;  2IX0 A;  2LXK A;  3A74 A;  3BZC A;  4A3J H;  2JA5 G;  1VQ5 A;  4A93 G;  1VQJ A;  4NXM L;  1Z47 A;  2C35 B;  2ID0 A;  2KEN A;  5ELN A;  2OCE A;  3H0G G;  1FGU A;  2XGT A;  5C3E H;  3I56 A;  2UUB L;  4TVA B;  3W1B A;  3I4N H;  3K81 C;  2CWA A;  1VQI A;  1T9H A;  5GAG C;  1IBM L;  3VDY A;  1EIY B;  4DKA C;  2V1C C;  4YHH L;  1SLJ A;  2F4V L;  2YV5 A;  3S2D H;  2UXC L;  1QVG A;  4P74 A;  1D8L A;  4DV6 L;  1JJC B;  1HZA A;  4A3I G;  3BZK A;  2R92 H;  4R4C A;  2PQA A;  5IWA L;  3G71 A;  4DR2 L;  4OWX B;  3PV0 A;  4DR3 Q;  2N8N A;  3DLL A;  5C0X G;  4LF4 L;  1QUQ A;  4XIG S;  1PH5 A;  3PO2 G;  2N78 A;  5C44 G;  2UXB Q;  1VQ8 A;  2PMZ E;  3TQY A;  1JMC A;  4UY8 C;  4R4O A;  3FKI H;  2RCN A;  3MXN B;  1VQC A;  3FP9 A;  2UXD Q;  4HJ9 A;  1CSP A;  3S1N H;  5C4X G;  4JI7 Q;  4UP9 A;  3G6E A;  4A75 A;  2I5M X;  3PSI A;  4AYB G;  5C44 H;  3KJP A;  1E3P A;  2R93 G;  4MZ9 A;  4RMF A;  5M3M G;  4DV0 Q;  4JOI A;  3RNU A;  1BKB A;  1K8A C;  4DR7 L;  3UE1 A;  2WAQ G;  5HGQ A;  1N9W A;  3U4Z A;  1A0I A;  1VQB A;  1NJI C;  4LF6 L;  3G4S A;  1PA6 A;  1YIJ A;  2MNA A;  1CKN A;  4JCV E;  3ULJ A;  5FLX c;  3HKZ E;  3RLN A;  4TQU S;  3RN5 A;  1OXV A;  2DGY A;  4GN5 A;  3T1H L;  4LFB L;  4AIM A;  1VQN A;  4BA1 I;  1WCM H;  4C2M H;  2F3I A;  5ELO A;  1IL2 A;  4LF9 L;  3M3Y H;  4POF A;  5IYD H;  1G51 A;  2MFI A;  1O7I A;  4A3K H;  4POG A;  4MTN A;  3S17 H;  1KRS A;  3J81 i;  4A3F G;  3UDI A;  4JI8 L;  1E22 A;  3S15 H;  3KF6 A;  3KF8 B;  4B3T Q;  3NBH B;  4DR6 L;  3EN2 A;  2N49 A;  1ASZ A;  4DUY Q;  1BBW A;  1HNZ Q;  4LUZ A;  2ZTD A;  1VQO A;  4DR4 L;  4EQ5 A;  4OO1 G;  4BA2 I;  3GTL H;  4NXN Q;  1Y1V G;  2BH8 A;  3CC7 A;  1XMQ Q;  1Q86 C;  2ATW A;  1HNX Q;  5JEA G;  1V1Q A;  3F2C A;  3EBE A;  1MJE A;  2UU9 L;  4LNQ A;  1P8L A;  1S40 A;  2JA6 G;  2HHH Q;  1C9O A;  1SMX A;  2RF4 A;  5M3F H;  2QGQ A;  2YTV A;  2UUB Q;  1JB7 A;  5JJK A;  1E24 A;  2JEB I;  2VL6 A;  5AJ3 L;  5LMN L;  4P75 A;  4DV2 L;  1VQF A;  4A3D G;  2K14 A;  1L2F A;  3T1Y L;  1Q82 C;  4YHH Q;  2F4V Q;  3GTM H;  3F2B A;  3U58 A;  2UXC Q;  1VQK A;  4DR3 L;  1KQS A;  4DV6 Q;  1UEB A;  3E9H A;  4QY7 A;  5IWA Q;  2B63 H;  4IFD G;  4JV5 Q;  4BY7 H;  4K0K L;  1W3S A;  3HKZ G;  3J80 c;  4QIW E;  1V43 A;  4AQY L;  2UXD L;  3TS2 A;  1BVS A;  2R6G A;  5IP7 G;  1GD7 A;  4JI7 L;  1PFS A;  4JI5 L;  2EIF A;  4X6A H;  1JJ2 A;  1HH2 P;  1AH9 A;  2CWP A;  4NB3 A;  1GO3 E;  4A3C G;  1PH4 A;  3HOU H;  4DV0 L;  2HQL A;  3UDX A;  1CKM A;  5E7N A;  3BU2 A;  1X3F A;  2R7Z H;  1NMF A;  3J7Z C;  2K4K A;  4DR7 Q;  5C0X J;  1VQM A;  4BBS G;  3J81 j;  4LFC L;  1RL2 A;  2BA1 A;  2UUA L;  1UE5 A;  4LF6 Q;  1WFQ A;  5J3B A;  5BR8 Q;  3CC2 A;  3D31 A;  3GTG H;  3GO5 A;  3CC4 A;  3AFQ A;  4BY1 H;  4X65 Q;  1W2B A;  4A3B G;  1KD1 C;  3T1H Q;  3KDF A;  5GAD C;  2R7D A;  1IBK Q;  2Z0S A;  1AE3 A;  1VS0 A;  4ALP A;  4LF9 Q;  1JE5 A;  1X56 A;  4YCW A;  1I50 H;  4LFA L;  4A3G G;  2VNU D;  4BBR G;  2BA0 A;  2FXQ A;  1B70 B;  2WAQ E;  1K83 H;  4HJA A;  2R7F A;  4A3J G;  4JI8 Q;  4DUY L;  3I4M H;  1XNR L;  1TWH H;  1WJJ A;  4DK6 C;  1C0A A;  1B7Y B;  1K8G A;  4DV1 L;  2BH2 A;  2NZH A;  4GKJ L;  2ZTE A;  3CCR A;  4DR1 Q;  4P71 A;  5EAY A;  5C3E G;  2ASB A;  3GTJ H;  1HNX L;  4DR4 Q;  3I4N G;  1NE3 A;  3TRE A;  4Y7N H;  2GVA A;  4WJ3 M;  2HHH L;  3LGJ A;  2WFW A;  1G6P A;  2F52 A;  3KYH C;  2UU9 Q;  1YNX A;  2R92 G;  3DM3 A;  4DR5 L;  3K80 C;  2A1A A;  3RN2 A;  4LF7 Q;  1V9P A;  2MQH A;  1YVC A;  5AJ3 Q;  5LMN Q;  4DV2 Q;  3RZD H;  4HIM A;  1TXY A;  3T1Y Q;  1UE1 A;  3FKI G;  3STB C;  4JV5 L;  3RZO H;  3HOX H;  2D0P A;  1FJG Q;  5JEA J;  2D0O A;  2IX1 A;  4K0K Q;  5IYB H;  4DAY B;  4R4Q A;  2RHQ B;  1N36 L;  4IPG A;  4JC0 A;  1XTD A;  2VZA A;  4PG3 A;  5FJ8 H;  4JI4 Q;  2VY3 A;  1YHB A;  4AQY Q;  2WP8 J;  3H3V I;  3AQQ A;  3H3V H;  2ZJP A;  4JI5 Q;  3PGZ A;  4JYA Q;  1VQG A;  1LTL A;  1VQL A;  1Q1B A;  2AKW B;  1KL9 A;  2HIX A;  1S72 A;  1NBW A;  2CCZ A;  2JA7 H;  4BXX H;  1RIP A;  4QJF A;  1HR0 W;  3CCV A;  3GTK H;  1SE8 A;  4IFD J;  1MKH A;  4A4I A;  3A0J A;  3UDG A;  1YZ6 A;  1EQR A;  1X55 A;  4LWC A;  5IE8 A;  5BR8 L;  3KOJ A;  3M9B A;  1OXS C;  2QA4 A;  4DV4 Q;  1PV4 A;  2CQO A;  1N34 L;  1Y1W H;  2NVY H;  1WCM G;  2LSS A;  4OXP A;  2UUA Q;  4LFC Q;  4LF5 L;  4OX9 Q;  1TWC H;  1X65 A;  4JI1 Q;  4QL5 A;  4YWK A;  5IYD G;  4GNX B;  4X65 L;  1DGS A;  4A3K G;  3K7U C;  1KIX A;  1HJP A;  3Q8D A;  1NY4 A;  4JBM A;  1GVP A;  1MJC A;  1Q8K A;  2B3G A;  2AMC B;  2Q2I A;  3B6Y A;  3ERS X;  3F8T A;  3RLF A;  3PF5 A;  1IBK L;  2IHF A;  3NEL A;  2K50 A;  3K0X A;  3M4Q A;  1YJ9 A;  3HOW H;  3PF4 A;  1VQ9 A;  4LFA Q;  1PVO A;  1KRT A;  5M5Y H;  3CD6 A;  1D7Q A;  3PO3 H;  1N33 L;  2LXJ A;  1K3R A;  4L5Q A;  3G48 A;  2E2H H;  1XNR Q;  2DUD A;  1E7Z A;  1E1T A;  1YBY A;  4DR1 L;  3OW2 A;  1QZH A;  4A3E H;  2JA8 H;  1EWI A;  5JJI A;  4DV1 Q;  3M4O H;  2CKZ B;  4C3I H;  2AHO B;  4GKJ Q;  4GLA C;  4EX5 A;  5M3F G;  3GDE A;  1PH1 A;  4JI6 L;  2YYZ A;  3PUX A;  5GQO A;  1M1K C;  4GKK Q;  2ZM6 Q;  1VQE A;  3I7F A;  3GTO H;  2MO1 A;  4PMW A;  3HOV H;  4DV3 Q;  2JJQ A;  1WYD A;  2XTI A;  4DV5 Q;  4LF7 L;  2JK8 A;  4NPS A;  1NTG A;  2EXD A;  2EQS A;  1N8R C;  3D0F A;  3E9I A;  4DR5 Q;  2B63 G;  4A3L H;  1KXL A;  4BY7 G;  2GVB A;  2ZJR A;  3S1Q H;  3CP0 A;  4B3M Q;  3TEH B;  1NMG A;  3OYY A;  5M5W H;  1VQH A;  1FJG L;  3PCO B;  4GOP B;  1YEZ A;  1TWF H;  1PYS B;  2ALY B;  3PIP A;  4A76 A;  4DV7 L;  4R1J A;  4UP7 A;  2K52 A;  2VQE L;  4JI4 L;  3HOU G;  1TWG H;  4HJ5 A;  4YWM A;  4X66 Q;  3SGI A;  5GAH C;  3CF5 A;  1X3G A;  1N36 Q;  2K5H A;  3JAM c;  4DUZ L;  1UE6 A;  2R7Z G;  4GS3 A;  4JYA L;  1YI2 A;  2ZTC A;  5FLM H;  2OQK A;  2KCT A;  1PHJ A;  3JC6 6;  2NVQ H;  1WOC A;  4OON A;  4Y52 H;  3L7Z C;  5IP9 H;  1HR0 Q;  2L15 A;  3IRB A;  4GLX A;  2VUM H;  3KJO A;  3S2H H;  1PH2 A;  2NN6 G;  4X62 L;  2AWN A;  4DV4 L;  4DK3 C;  3MEF A;  4B3R L;  4OX9 L;  4BY1 G;  1C7Y A;  4GLV B;  4JI1 L;  2E5L Q;  2NN6 I;  1N34 Q;  1XJV A;  2B29 A;  4LF5 Q;  4OWW B;  1HZ9 A;  3HOY H;  4LF8 Q;  1IBL L;  3OTO L;  1Q46 A;  4DAM A;  1FL0 A;  3CXC A;  1Q7Y C;  1M90 C;  3J80 i;  1YHQ A;  2A8V A;  4GNX A;  1WI5 A;  3I4M G;  4WJ4 A;  4KHP L;  2NZO A;  3A5U A;  1Y14 B;  1CKN B;  4JBW A;  3PIO A;  2Z6K C;  3S24 A;  3L2P A;  1CUK A;  3UDF A;  1N33 Q;  1SN8 A;  4GN4 B;  3BJU A;  1ASY A;  1YJW A; 
#chains in the Genus database with same CATH topology
 4V0B A;  1D2B A;  2A5H A;  4P72 A;  2OTL A;  2PPB C;  1LO5 D;  3URY A;  1SBB B;  3U9O A;  5IOC A;  4R4T A;  3SK4 A;  4E6I A;  1I94 Q;  3S1Q B;  3MVV A;  2WAC A;  2I5H A;  4JI2 Q;  4JI3 L;  4K2L A;  2F03 A;  1AW7 A;  1YNN C;  4X66 L;  4F88 A;  2CVR A;  2K5V A;  1SR3 A;  2PI2 E;  4GOP A;  1I6H H;  3TZU A;  1PZK D;  4O0A A;  2JA5 H;  4JI0 L;  1J6Q A;  1RJT A;  1PH3 A;  3CPF A;  1AE2 A;  2JXM B;  3VYT A;  1K28 A;  1EIG A;  1Z9F A;  2B8G A;  3EVQ A;  4IPD A;  4IPH A;  5I9P A;  2JA9 A;  3J7A V;  3GTG B;  4BY1 B;  4N9P A;  4B3R Q;  2N55 A;  3RLO A;  1QJO A;  5CBA E;  1EUJ A;  1F2Y A;  1Q8I A;  1CHQ D;  4K6L A;  1SYD A;  2EYL A;  3NWT A;  5C0X H;  1EY8 A;  3OTO Q;  2XIW A;  1PFB A;  4KLK A;  5IIF A;  4DXF A;  4KJN A;  3GTJ B;  1SAP A;  5M3M H;  1EY9 A;  2Z6K A;  3DMU A;  4O42 A;  1XPR A;  4C3J H;  2L9H A;  4A3M B;  1G29 1;  1PH7 A;  4LAA A;  1I5F A;  4YY3 Q;  2MUY A;  1PYB A;  5HUR A;  3TRZ A;  4DU9 A;  1LUZ A;  4UPA A;  4JI3 Q;  3I2Z A;  4UP8 A;  4GN3 B;  3N52 A;  5DNF A;  4ZAI A;  1Y1V H;  2SOB A;  1K0R A;  3HOZ B;  4JI0 Q;  4OGQ C;  4IUN A;  3IFT A;  1RTO A;  2JA6 H;  2I5L X;  2NZ1 D;  2K75 A;  1BCP B;  1LTI D;  1BCP C;  1R9T H;  3CCE A;  4EVO A;  2HQE A;  3CCL A;  3TME A;  5ELC A;  4JOI C;  1MI2 A;  4IFD H;  3J80 E;  2PCF B;  2A69 D;  3T51 B;  1LV9 A;  1OXX K;  3AYH B;  1CTM A;  4IOA A;  3FPP A;  3K5L A;  2F0N A;  2YU9 B;  1ENC A;  2E2H B;  1T5X D;  3ND8 A;  3VA7 A;  1N32 L;  3K7A H;  3SDZ A;  1B50 A;  3M7N A;  5T1G A;  1BOS A;  3R2I A;  3K6O A;  1VQ6 A;  1XNQ L;  4OWT B;  4Q5V A;  1EY6 A;  1CZG A;  1IXR A;  4RH6 A;  2PZW A;  2A68 C;  2K5N A;  4X3T A;  3CPW A;  4AYB E;  4QMG A;  3A5Z B;  3C46 A;  4R8N A;  5IT9 c;  5C4Z A;  1TQO A;  4B3T L;  4A3B H;  1HZC A;  2F0F A;  3CME A;  1HNZ L;  3A7A B;  1EU3 A;  2AQ3 B;  4DR6 Q;  3MAQ A;  1DJR D;  1FVI A;  1VQA A;  2IX0 A;  2EJM A;  1I4X A;  3FRP B;  2PMZ B;  1QG7 A;  2C35 B;  2OCE A;  1STA A;  4TVA B;  2AQ2 B;  1DM0 B;  2V1C C;  4CKC A;  4XQN A;  4P74 A;  1ZXT A;  4DGZ A;  1HZA A;  3BZK A;  2R92 H;  5IWA L;  3PV0 A;  1JQY D;  3O13 A;  2OF1 A;  3TZD A;  5FO7 B;  1QUQ A;  3AB9 A;  4XIG S;  2N78 A;  3FDT A;  5C44 G;  3TQY A;  4IUU A;  4UY8 C;  3MXN B;  1VQC A;  2UXD Q;  4HJ9 A;  1CSP A;  5KGU A;  2EJG C;  4AYB G;  1E3P A;  3OIQ A;  2FIN B;  1BKB A;  4CHT B;  3LX0 A;  3U4Z A;  1A0I A;  1NJI C;  1BCP F;  1YIJ A;  1HTL D;  2F0P A;  4TQU S;  3D4R A;  4LFB L;  4AIM A;  3CU7 A;  4BA1 I;  1TS3 A;  4C3H G;  2F3I A;  4LF9 L;  4KN4 C;  4POF A;  5M5X B;  4A3K H;  4A3G B;  3UDI A;  4JI8 L;  4B3T Q;  1HNZ Q;  3L9A X;  2B2T A;  1JWS D;  4DR4 L;  3LWE A;  5C3E B;  2XNA C;  4MTK A;  4EGV A;  3GTL H;  2F0T A;  1D5M C;  1Q86 C;  2ATW A;  4RWS C;  5JEA G;  2CHB D;  3F2C A;  1WTW A;  1MJE A;  1S40 A;  3MC0 B;  3R2T A;  1C9O A;  2SNS A;  2YTV A;  2HUG A;  1KTK A;  5KYI A;  2JEB I;  5LMN L;  4P75 A;  2L0C A;  1Q82 C;  1HUM A;  5IWA Q;  3PO2 B;  1A15 A;  1F2L A;  1X32 A;  2BDN A;  5IP7 G;  1MHW C;  3QG1 A;  2EIF A;  4X6A H;  4YIJ A;  5C4X B;  4NB3 A;  1EWH A;  5CV6 A;  3UDX A;  3JAM E;  2R93 B;  1V1O A;  3BU2 A;  1X3F A;  4DK0 A;  2R7Z H;  3D4D A;  2WAQ B;  3R93 A;  5C0X J;  1VQM A;  4BBS G;  1XWE A;  3J81 j;  4LFC L;  3X3N A;  2E2D C;  3P75 A;  4FF3 A;  1WFQ A;  5J3B A;  4HSP A;  3CC2 A;  3GO5 A;  4KK7 A;  1U9R A;  4X65 Q;  1W2B A;  3T4A C;  4P2C B;  1IW7 D;  1G2T A;  1H9K A;  1VS0 A;  1ZYR C;  4LF9 Q;  1JE5 A;  1X56 A;  4YCW A;  1I50 H;  5JJL A;  2BA0 A;  2FMM A;  4B9W A;  4HJA A;  3C1F A;  4A3J G;  4JI8 Q;  4DUY L;  3I4M H;  1TWH H;  1QIL A;  3MXG A;  2JSO A;  1SNP A;  4IN3 A;  3QO2 A;  1EY4 A;  1HNX L;  4DR4 Q;  3I4N G;  3HG9 A;  1QWY A;  4Y7N H;  3AU7 A;  2EDG A;  4WJ3 M;  4KN7 C;  1G6P A;  2RQX A;  1YNX A;  5C5M A;  3NTI A;  5KIX A;  1Z6H A;  4BY7 B;  5LMN Q;  3RZD H;  1TXY A;  3SXH A;  1H9R A;  1UE1 A;  3QJY A;  1HQM C;  2QIL A;  1HQR D;  3SHL A;  4IPG A;  2VZA A;  4IQZ A;  2EE1 A;  3C2P A;  1YHB A;  1HA6 A;  4DF7 A;  2X6L A;  3H3V H;  2ZJP A;  2QKI C;  1LTL A;  4DNR B;  5C5L A;  2AKW B;  2HIX A;  1MSG A;  1PZJ D;  5F2D A;  4QJF A;  1HR0 W;  3CCV A;  1IYU A;  2EY6 A;  3MXP A;  3HRZ C;  4CKE A;  1LTR D;  4IFD J;  1O7Y A;  1YZ6 A;  2QA4 A;  4LFC Q;  5CR3 A;  1WCM G;  2K5D A;  2LSS A;  4H44 C;  4QL5 A;  4GNX B;  1DGS A;  1GVP A;  3ERS X;  2Q2I A;  3PF5 A;  1XX8 A;  2EYM A;  1IBK L;  1LTS D;  2IHF A;  4RGM A;  1YJ9 A;  2F0E A;  3PF4 A;  1VQ9 A;  1L0X B;  5I9O A;  3MTS A;  3F2U A;  4HTH A;  2A6E C;  2F0Q A;  1SJE D;  3G48 A;  5CV4 A;  1E7Z A;  1GHK A;  5CYU A;  1QZH A;  2RKS A;  4KTA A;  2Z4I A;  5JJI A;  1SNC A;  1DON A;  2J0T D;  4PQX A;  4IUR A;  4H13 C;  1Q3L A;  1ZEQ X;  5GQO A;  3ND9 A;  1EIH A;  1MD2 D;  3I7F A;  5LL6 S;  3GTO H;  4DV5 Q;  2JJQ A;  3MFG A;  4LF7 L;  4MIU A;  3T56 B;  3HOX B;  1KLG D;  2WIN B;  2ZJR A;  4B3M Q;  1TT2 A;  2R61 A;  2F0O A;  2EY2 A;  2WKC A;  3A54 A;  4GOP B;  1TWF H;  3PIP A;  4A76 A;  2K52 A;  2VQE L;  3HOU G;  1ENF A;  1TWG H;  1SDF A;  4CDF C;  5GAH C;  1X3G A;  1PTO B;  2K5H A;  2JA7 B;  5FKA C;  1PTO C;  1SNM A;  1RDP D;  1YI2 A;  3OPO A;  1WOC A;  4ZLT F;  4NP5 A;  1LT6 D;  3S2H H;  4OX9 L;  4BY1 G;  3M4Y A;  4JI1 L;  2DY7 A;  2ZXR A;  4G7Z C;  2Q8R E;  1LT3 D;  3HOW B;  1IBL L;  1GUO A;  3D6W A;  1FL0 A;  3J80 i;  3DWP A;  1PMR A;  3K59 A;  1Y14 B;  1CKN B;  2JA8 B;  2Z6K C;  3S24 A;  1EU4 A;  3UDF A;  3D3R A;  3BJU A;  1NCV A;  2OQ0 A;  2Q8I B;  1XYI A;  3HOV B;  4GKK L;  4ZRZ A;  1KAA A;  5M3F B;  2OEO A;  1PFM A;  4JBJ A;  5J1Z A;  4DV3 L;  3T16 A;  1DOK A;  2FMC A;  3M4P A;  5IGF A;  1NSN S;  2WB1 E;  1LYL A;  5T1I A;  2B63 B;  1S3O A;  1HA5 A;  2E8G A;  3WWV A;  2A19 A;  1YNJ D;  3FHW A;  5IY0 A;  2CH4 W;  1R4P B;  5H1S E;  3MWY W;  3DXJ C;  3W3A A;  4O1N A;  4HIK A;  1K73 C;  1DZ1 A;  2VQE Q;  2QEJ C;  3W5O A;  1HNW Q;  2EZV A;  1LTG D;  2VQF L;  1SRU A;  4L6T B;  2EYP A;  2KCM A;  5KNC A;  3HOZ G;  4GZY C;  3S16 H;  3S9W A;  4ODG A;  1BUV T;  1JJG A;  1CSQ A;  1WTH A;  1L0W A;  3TSS A;  2ZJQ A;  1A63 A;  1QB5 D;  1YJN A;  1PTO F;  3J81 c;  2KJX A;  1K83 B;  1JOK A;  3PUV A;  3HFZ B;  2D9U A;  2F3W A;  3BYY B;  1IBL Q;  4RA8 A;  5GAE C;  4TRD A;  5TSS A;  4QQB X;  4A3E G;  2WB1 G;  2TSS A;  1PH8 A;  1JC7 A;  1SFO H;  1QVF A;  3MA2 B;  4LUO A;  2VB3 X;  3L3O C;  1GM5 A;  1PRT F;  2F0D A;  2YTX A;  1FR3 A;  3VR4 A;  1UE7 A;  1JCK B;  3CCU A;  1XPO A;  1I94 L;  2JEA I;  4ZCK A;  5D14 A;  1LM0 A;  2PNH A;  1VF7 A;  4IUQ A;  3L0O A;  1ONL A;  1EY5 A;  4KJO A;  3ZJY C;  1KDA A;  3NEM A;  2PI2 A;  3U4V A;  4OHJ A;  4JI2 L;  4C3H H;  4B3S L;  4IPC A;  1XMO Q;  5DM7 3;  3K8A A;  1I6H B;  3J7Y W;  1I4P A;  2EPB A;  2Y0S B;  2EXZ A;  4KY5 A;  2JA5 B;  4DN4 M;  5I2Y A;  5IP9 G;  2G9H D;  3W1G A;  3CHB D;  3E3X A;  4NXM Q;  1HUN A;  4OO1 I;  4XYQ A;  4DPG A;  1S5C D;  2VQF Q;  1KAW A;  3NPP A;  3ULL A;  5JEA H;  2KEE A;  1IBM Q;  1QUQ B;  3TS0 A;  1VQ7 A;  1TWA H;  3HOY G;  3TP8 A;  3IFD A;  5CGK A;  2UXB L;  3AEV A;  4BWG B;  2MO0 A;  4DR2 Q;  4R4I A;  1DD2 A;  1EIF A;  3BVG A;  3EJI A;  4KI0 A;  3OHX C;  2K32 A;  1MSH A;  4HID A;  5M5Y B;  3RD4 A;  1B8A A;  4B9X A;  4OIJ A;  5IP7 H;  1LTT D;  5M3M B;  3JAM i;  3F2D A;  1Q12 A;  4PZ6 A;  2F0K A;  3GTQ H;  1TS4 A;  4APV A;  4IUP A;  1ENA A;  1EQQ A;  1KNA A;  1RHP A;  3PUW A;  4BBS H;  1IZ6 A;  3CMA A;  1H9M A;  3G6J B;  3SK6 A;  2E2J H;  3I90 A;  4JBK A;  3OOC A;  5M5W B;  1HXY D;  3J7A F;  1QVC A;  3D4W A;  3S1R H;  2YTY A;  4KV6 A;  4YY3 L;  2A6H C;  1I4Q A;  2B2T C;  1RTN A;  4B3S Q;  2VXW A;  5IYC G;  2JYO A;  2HT1 A;  2Z8L A;  3BZC A;  5BN3 A;  4A3J H;  4A93 G;  1VQJ A;  5C3W A;  1O7Z A;  1Z47 A;  2KEN A;  3H0G G;  2VUM B;  1FGU A;  2XGT A;  2F4I A;  3I56 A;  2UUB L;  2JA6 B;  3I4N H;  3K81 C;  1CZW A;  3VR6 A;  2CWA A;  1VQI A;  1T9H A;  1EIY B;  3VDY A;  4YHH L;  3P1H A;  2F4V L;  1G2S A;  1R9T B;  4BS9 A;  2I46 A;  3KLS X;  1QVG A;  3S2D H;  2UXC L;  3QOJ A;  4A3I G;  4R4C A;  1RF2 D;  1E2W A;  5G3L F;  4DR3 Q;  1CA5 A;  3DLL A;  3PO2 G;  1PH5 A;  1IKM A;  2UXB Q;  3KLS A;  2KOL A;  3HKZ B;  1SYE A;  1JMC A;  1O78 A;  2IW3 A;  2RCN A;  3FP9 A;  2MPM A;  5C4X G;  4JI7 Q;  3G6E A;  3K7A B;  4A75 A;  4RHR A;  2K03 A;  2Z9H A;  2XRQ D;  5A2Q E;  2R93 G;  3I91 A;  4RMF A;  5IGD A;  4DR7 L;  1PLF A;  4OEL B;  2WAQ G;  1N9W A;  4UHV A;  3GP7 A;  4LF6 L;  3G4S A;  1CKN A;  3SVM A;  4JCV E;  4WJW A;  3RLN A;  4PMC A;  1EEF D;  1STN A;  1K0S A;  1B3Q A;  4PV1 C;  2Q8T A;  3RN5 A;  2DGY A;  4GN5 A;  3T1H L;  5E1F A;  4M1U B;  5DM6 3;  3TDQ A;  4A3B B;  2L55 A;  1WCM H;  2PW5 A;  3GTP B;  3M3Y H;  1O7I A;  1QOH A;  3J81 E;  4MTN A;  1U4R A;  3BZD B;  4KY6 A;  4C1N K;  1VMC A;  4A3F G;  1I6V C;  3KF8 B;  3LNN A;  4DR6 L;  2N49 A;  2DY8 A;  3DWQ A;  1BBW A;  2NVT B;  2ZTD A;  1VQO A;  4K14 A;  3BS1 A;  4BA2 I;  1SYG A;  1XXG A;  3CC7 A;  4S3S A;  4QIW B;  1V1Q A;  4OEM B;  2KA7 A;  4QUC A;  2HHH Q;  4H7B A;  2RF4 A;  5NUC A;  2R92 B;  3IAY A;  2UUB Q;  4KKT A;  4Q0F A;  1VQF A;  3DHQ A;  2K14 A;  2B2Y A;  4JW0 A;  1HFG A;  4YHH Q;  2F4V Q;  2RDH A;  2UXC Q;  5CC4 A;  1VQK A;  4HCE A;  3D6C A;  3OWF A;  4EQN A;  2UXD L;  4AQY L;  2B2W A;  3NTH A;  1GD7 A;  4ZKC B;  3VYU A;  1HH2 P;  3W2D A;  5FK9 C;  3H09 A;  3HOU H;  4QF4 A;  4JVZ A;  4H0L C;  2HQL A;  4ZQ3 A;  3KBG A;  4QCL A;  1W6K A;  2K4K A;  1BF4 A;  4DR7 Q;  4CGY B;  3D8G A;  3TP7 A;  1HPC A;  1FD7 D;  4LF6 Q;  5EKK A;  1PDQ A;  3WDN A;  1A3T A;  3RUZ A;  1E0B A;  2B39 A;  1I4G A;  3MZ5 A;  4RCO A;  3GTG H;  3AFQ A;  4BY1 H;  5DEH A;  1KD1 C;  3T1H Q;  2R7D A;  2A69 C;  5I2X A;  1SEB D;  2R7F A;  4J8Q A;  1WVL A;  1SE2 A;  3GTL B;  2IX3 A;  2EVB A;  1WD0 A;  1C0A A;  1K8G A;  2BH2 A;  2NZH A;  3CCR A;  4P71 A;  2ASB A;  3GTJ H;  2KCC A;  3EQL C;  3NBH A;  1NE3 A;  3BG3 A;  5IGG A;  2GVA A;  5FLX L;  3LGJ A;  3PIO 3;  2F0H A;  2K7V A;  3DM3 A;  1X3Q A;  1LLR D;  2MJ8 A;  4A3D B;  4KMU C;  4IUT A;  4ZUJ A;  3STB C;  1R4Q B;  2D0P A;  1FJG Q;  1IYV A;  5JEA J;  2D0O A;  2IX1 A;  5CBE E;  4DAY B;  4R4Q A;  2F0V A;  1XTD A;  4PG3 A;  4AQY Q;  1JOR A;  2R7Z B;  3PGZ A;  1LTB D;  1VQG A;  2HDL A;  1VQL A;  1Q1B A;  1CK1 A;  3CKI B;  1S5E D;  2B2U C;  1MKH A;  2DNE A;  2F0J A;  2KEC A;  1EYA A;  4X3K A;  4DV4 Q;  3KOJ A;  5JAV A;  2K28 A;  1N34 L;  4KKU A;  1UEA B;  4ID6 A;  3IKJ A;  1X65 A;  5DAU A;  5IYD G;  4X65 L;  1B9M A;  1HJP A;  3Q8D A;  1Q8K A;  3RLF A;  3F8T A;  4FF4 A;  2BE5 C;  2K50 A;  1TWH B;  3K0X A;  3Q0A A;  3P7J A;  2OXP A;  4FP5 D;  4BBR B;  1F9S A;  2NVX B;  1D7Q A;  2RDG A;  2SDF A;  1JE4 A;  4OIK A;  4L5Q A;  2E2H H;  2DUD A;  1E1T A;  1YBY A;  3BDO A;  4Y7N B;  4A3E H;  1EWI A;  1G6Z A;  1EY7 A;  2AHO B;  3NQI A;  5M3F G;  3VR3 A;  5EPL A;  2ZM6 Q;  1VQE A;  1B3A A;  3K5O A;  3RZD B;  5M9O A;  1UAP A;  2EQS A;  1N8R C;  3D0F A;  4M8A A;  2B63 G;  2EYF A;  1KXL A;  1SND A;  3Q23 A;  3DEO A;  4G4K A;  3CP0 A;  3TEH B;  1EEI D;  1NMG A;  1VQH A;  3FKI B;  1J9O A;  1YEZ A;  2ALY B;  2XN9 C;  3R3O A;  4K8J A;  5I6Y A;  4R1J A;  3SGI A;  3CF5 A;  1Z7T A;  2K5W A;  1UE6 A;  4XXE A;  1SYB A;  3JC6 6;  2NVQ H;  1NNX A;  3L7Z C;  5IP9 H;  1HR0 Q;  2L15 A;  1PH2 A;  1QNK A;  4L8J A;  1CA6 A;  3MEF A;  3DWA A;  2E5L Q;  1OO9 B;  4C2M B;  1N34 Q;  1HTP A;  2F1M A;  2QCP X;  4OWW B;  3HOY H;  3S17 B;  1Y8N B;  4Z9C B;  2QDL A;  4LF8 Q;  5JVG 3;  1M90 C;  1ZYR D;  3NUC A;  2NZO A;  1AEX A;  3A5U A;  1D6E C;  2P5Z X;  4JBW A;  3WOE A;  3QB3 A;  3L2P A;  4DXG A;  1CUK A;  1CQV A;  4GN4 B;  1DOM A;  3KF8 A;  3GTO B;  3AFP A;  1A8V A;  5GRO A;  4G7O C;  1HZB A;  3NEN A;  1CQF A;  2BOS A;  1JIC A;  2KUM A;  4DV5 L;  1Q1E A;  4F87 A;  2O5J C;  2C5C A;  3HGB A;  1IW7 C;  1TII D;  1EQT A;  4AH6 A;  4B3M L;  1MIU A;  3H15 A;  5IYB G;  4NW2 A;  2F0I A;  4LUV A;  1KC8 C;  4RCN A;  5IT9 E;  5FO9 B;  1ROD A;  3IL8 A;  1UUP A;  3TP5 A;  3SR1 A;  4BXX G;  2Q2U A;  5IYC H;  2HIV A;  1LT4 D;  2NUC A;  3S2H B;  4YCU A;  1RD9 D;  1STH A;  3DUZ A;  4A93 H;  2D62 A;  3CW2 C;  1YHA A;  3H0G H;  4XQJ A;  2AQ1 B;  1MGS A;  2JN4 A;  1VQ4 A;  5LL6 X;  2SEB D;  1AZQ A;  4CJ2 C;  4HED A;  1AZP A;  2AUK A;  4UAI A;  1AP0 A;  4HN7 A;  4A3I H;  4GNX C;  1D1I A;  3GD7 A;  1K8O A;  5C0X I;  4L5S A;  3PO3 G;  2OWO A;  3PO2 H;  5KYL A;  3J80 L;  2UUC Q;  1D5X C;  4ME3 A;  4PZ8 A;  3CAM A;  1I4R A;  1NR4 A;  3C1E A;  2WV6 D;  5C4X H;  1ML0 D;  1QCB D;  5C4H A;  4RFB A;  4XTC S;  2R93 H;  4I7Z C;  1P16 A;  4H02 A;  2K05 A;  3KDF B;  3KLW A;  3ULP A;  5IGC A;  3CQZ H;  3MHB A;  3WOF A;  4K8I A;  3ER0 A;  4A3L G;  4JPB W;  2ICI A;  2E2I H;  3U9S A;  3RR5 A;  4J15 A;  1PH6 A;  1SYF A;  5IGE A;  1GKH A;  1FNV A;  5C4J H;  2DNC A;  4GOP C;  4A3F H;  5FLM G;  2GN5 A;  1HNW L;  1LAC A;  5K36 G;  1YIT A;  1TR5 A;  2VUM G;  3F1Z A;  5C3X A;  4IO9 A;  1GOZ A;  2RHS B;  3A56 A;  1KDB A;  5ELF A;  3S16 B;  4DAY A;  5ISR A;  1BBX C;  4CBV A;  3S1M H;  4ULL A;  4IOC A;  1Y1W B;  4L5T A;  1TY0 A;  5LMN W;  3KFU A;  5ELE A;  4P73 A;  2VW9 A;  3S14 H;  3HKS A;  1XPU A;  1PRT D;  1U4M A;  1VCI A;  3PQI A;  4LF4 Q;  1KHI A;  2H1E A;  1Y8O B;  3ONA B;  1UWV A;  4IFD I;  1OXU A;  1SYC A;  1KDC A;  1WTR A;  1U5K A;  4AYB B;  4YCV A;  3K5N A;  1IHZ A;  4DNI A;  3PUY A;  3TP6 A;  1EYG A;  4RG1 A;  3V96 A;  4C3I B;  1EOT A;  5CMD A;  2JP1 A;  2KBN A;  4IUV A;  4K5X A;  2JE6 I;  5DLQ E;  5EGT A;  1B44 D;  4K5W A;  4CDE C;  3E0E A;  4A3M G;  1BBU A;  1OTC A;  3I3C A;  5FO8 B;  4FXG C;  4C3H B;  2H4O A;  2V4D A;  1VQP A;  3CCS A;  1STY A;  3FPU B;  1L1O A;  5CV5 A;  1I4H A;  1EOV A;  1XMO L;  4V19 0;  1I3Q H;  4MNO A;  2OTJ A;  1ICW A;  3GQB A;  4NXN L;  4O2D A;  1XMQ L;  1IYJ B;  2LXK A;  3A74 A;  2L12 A;  4NXM L;  5A35 A;  1JR0 D;  1JWU D;  2ID0 A;  2G9D A;  5ELN A;  2D5D A;  3CRL C;  1FGB D;  1TWA B;  3W1B A;  2LS0 1;  5EJW A;  3MXU A;  4IZ8 A;  1PFN A;  5GAG C;  1IBM L;  3ERO A;  2PQA A;  4DR2 L;  2J4X A;  1YNJ C;  1KLU D;  1V1P B;  1K8M A;  4XT1 B;  4PNY A;  5IGB A;  2B2V A;  2PMZ E;  3DEP A;  3VYR A;  3I4L A;  1MBY A;  3S1N H;  1VMP A;  4UP9 A;  1TS2 A;  2I5M X;  5C44 H;  1DXM A;  2ZXP A;  2PZT A;  1PTO H;  4DV0 Q;  3GV3 A;  3NSW A;  3JAM L;  3RNU A;  1K8A C;  3UE1 A;  2CW0 D;  1WTQ A;  4RGO S;  5HGQ A;  4NKL A;  1B1Z A;  1VQB A;  3I70 A;  3NWS A;  5D3I B;  2MNA A;  1JB3 A;  4ZUI A;  2E2J B;  3I8Z A;  4FF2 A;  1OXV A;  3S1R B;  4XQQ A;  3E5S A;  5ELO A;  3QR8 A;  1IL2 A;  5IYD H;  1G51 A;  4POG A;  3S15 H;  3KF6 A;  4K6D A;  1CM9 A;  3NBH B;  3EN2 A;  4HCS A;  1HCZ A;  3ERQ A;  2G5D A;  3NHH A;  1EYD A;  2DN8 A;  5G3L D;  5JOB A;  1V8Q A;  5JJZ A;  2L1B A;  4OO1 G;  4RKL A;  4NXN Q;  1STE A;  2BH8 A;  2XVS A;  1XMQ Q;  1EZ8 A;  3I4N B;  1GUN A;  1ET9 A;  3EBE A;  1T5E A;  2UU9 L;  3S2D B;  4LNQ A;  4U67 3;  1SMX A;  5M3F H;  2QGQ A;  4FF1 A;  5JJK A;  1E24 A;  1F9R A;  2VL6 A;  5AJ3 L;  4DV2 L;  4A3D G;  3T1Y L;  4XDX A;  3GTM H;  3F2B A;  4DR3 L;  2EY1 A;  4QB4 A;  4QY7 A;  2B63 H;  4JV5 Q;  1W3S A;  4NMZ A;  3J80 c;  1BVS A;  2R6G A;  2IWH A;  4JI7 L;  1PFS A;  4JI5 L;  5COR A;  1JJ2 A;  1AH9 A;  4A3C G;  1EWC A;  2DJG C;  1CKM A;  3BDL A;  3K57 A;  1KNE A;  3OMC A;  5EBC A;  3KUP A;  1C48 A;  1VDZ A;  1RL2 A;  2PW7 A;  1S5F D;  2UUA L;  2KCN A;  4C3J B;  3SK5 A;  2O2L D;  5BR8 Q;  1EFI D;  4ME5 A;  1SMY C;  3M3Y B;  2CH4 A;  5K5P A;  2R3Z A;  1HFN A;  1WTV A;  4DK1 A;  3A55 A;  3KDF A;  1LTA D;  1AE3 A;  1S4Z A;  4A3G G;  2WKD A;  4BBR G;  2FXQ A;  1B70 B;  2WAQ E;  1K83 H;  4CDC C;  1WJJ A;  2PQE A;  1B7Y B;  1YNN D;  4GKJ L;  1IL8 A;  4KKS A;  5C3E G;  5EAY A;  4DR1 Q;  3DM1 A;  3SK8 A;  1Y1V B;  2RBM A;  5EKL A;  3TRE A;  4G57 A;  2HHH L;  2WFW A;  2F52 A;  2UU9 Q;  2LFN A;  1DCZ A;  3K80 C;  1BNZ A;  2A1A A;  3I72 A;  3RN2 A;  4KHV A;  2MQH A;  4RAU C;  2NWG A;  1YVC A;  5AJ3 Q;  4DV2 Q;  4R9W A;  3T1Y Q;  3FKI G;  4WOR A;  4J6H A;  3RZO H;  2XWB B;  5IYB H;  5I4D A;  3HOU B;  2RHQ B;  3TBI B;  4C56 C;  2DJF C;  4JI4 Q;  2VY3 A;  2WP8 J;  3H3V I;  1F2M A;  1EZ6 A;  3AQQ A;  4JI5 Q;  4MN3 A;  1PYW D;  4JYA Q;  3KLR A;  1Q90 A;  1NBW A;  1Y69 U;  4BXX H;  3VR2 A;  1RIP A;  3GTK H;  1F2Z A;  2RSN A;  1VF5 C;  3A0J A;  1II3 A;  3UDG A;  1EQR A;  1H9J A;  1OXS C;  3CC4 A;  2CQO A;  2NVY H;  4C1N I;  2UUA Q;  3E6Z X;  1TWC H;  2MHV A;  4YWK A;  1ESR A;  1NAP A;  2F3V A;  4JBM A;  4X3U A;  2B3G A;  3B6Y A;  3HEJ A;  3NEL A;  3M4Q A;  1FNW A;  1KAB A;  2XSC A;  5M5Y H;  3CD6 A;  1PVO A;  3PO3 H;  1N33 L;  2K33 A;  2LXJ A;  1A3U A;  1K3R A;  2K1B A;  4HMI A;  3OW2 A;  5CV8 A;  3M4O H;  2RVL A;  1SE4 A;  4GKJ Q;  4GLA C;  4EX5 A;  3GDE A;  2ICE C;  4JI6 L;  2E75 C;  3PUX A;  1M1K C;  2E74 C;  4F7X A;  3VA5 A;  2MP1 A;  2NTS A;  1WYD A;  4TKO B;  2M00 A;  2JK8 A;  4NPS A;  1NTG A;  2EXD A;  3E9I A;  4A3L H;  4BY7 G;  1NUC A;  3S1Q H;  1CFM A;  3OYY A;  5M5W H;  1FJG L;  3PCO B;  1BCP D;  1PYS B;  2EYO A;  4DV7 L;  4HJ5 A;  4F8M A;  4X66 Q;  2F0U A;  3LWU A;  1S5D D;  3JAM c;  3QOL A;  4DUZ L;  3G7L A;  4HAE A;  2OQK A;  1CT1 D;  1V1P A;  2KCT A;  4FXK C;  4ZKB B;  5JPM C;  5FLM H;  1AFP A;  4OON A;  5K36 H;  5FOB B;  1F77 A;  2VUM H;  2QDB A;  1W6J A;  2IL8 A;  2NN6 G;  2Z1C A;  4X62 L;  4DV4 L;  1WD1 A;  4DK3 C;  1QNU A;  3QWN A;  4GLV B;  1PXU A;  1O80 A;  2NN6 I;  4CKB A;  1HZ9 A;  2A68 D;  4A3K B;  5BN4 A;  2XRS D;  3K5M A;  3Q6S A;  1GUT A;  2EOT A;  1Q46 A;  3CXC A;  1Q7Y C;  2L5T A;  5IOD A;  4KHP L;  2RCF A;  1ESF A;  2ENB A;  3PIO A;  2PZU A;  2WB1 B;  1O7L A;  4A3E B;  3V05 A;  1HRJ A;  5CV9 A;  1UNS A;  5COY A;  1N33 Q;  4XT3 B;  1B53 A;  4HMJ A;  1ASY A;  1EYC A;  5KNB A;  3TN2 A;  3VYS A;  1X9N A;  2ES2 A;  2ZM6 L;  1SRO A;  2H5X A;  1J8I A;  3RMH A;  3J7A 5;  4HIO A;  4JI6 Q;  1EFW A;  3FEW X;  3N6R A;  3SEB A;  5C6A A;  1TKW B;  5HGT A;  3HOX G;  4A3M H;  1EQV A;  3STB D;  3GTP H;  1U4P A;  1K9M C;  5FJ8 G;  1VQD A;  5E3F A;  1FYC A;  4DV7 Q;  2NVQ B;  1JOO A;  1EY0 A;  2JA7 G;  1SE3 A;  2NVT H;  3CRK C;  4FO2 A;  1SJH D;  4X64 L;  2AWO A;  4DUZ Q;  4XYO A;  1HR0 L;  4CJ1 B;  3BDC A;  4CJ0 B;  3EIV A;  1Y1W G;  2XWJ B;  1X3E A;  2JQO A;  4FXD A;  3HOY B;  2QEX A;  4X62 Q;  3HOZ H;  2E5L L;  1U0L A;  4QGU A;  2FFK B;  3BVM A;  1GUW A;  2NBF A;  2Q2T A;  4LF8 L;  1TS5 A;  1TVX A;  1GUS A;  1I50 B;  1M8A A;  2GA4 B;  3HOW G;  2BE5 D;  1H95 A;  5L37 A;  1D1K A;  3I4M B;  1PH9 A;  2CQA A;  3CCQ A;  1XTC D;  3PUZ A;  4YWL A;  4KHP Q;  2JA8 G;  1WTO A;  5HY6 A;  4C3I G;  2IHE A;  1IKL A;  1N32 Q;  2YU9 H;  4IJL A;  5LMU L;  4HJ7 A;  3U50 C;  1OXT A;  2N3S A;  3T13 A;  5LHY 1;  2KHJ A;  2X6G A;  3HOV G;  1A3V A;  3CCM A;  2L4N A;  3AMU A;  1CKO A;  4HJ8 A;  1XNQ Q;  1L1O B;  4IJH A;  1L1O C;  4FDB A;  2BCO A;  3Q22 A;  4OL7 A;  2IT1 A;  4K5V A;  1J5E L;  1E2Z A;  1CI3 M;  4HR7 B;  1A6X A;  1X3P A;  1ICF B;  2B8F A;  4KY7 A;  3H3V C;  2CFM A;  2LMC B;  3I55 A;  2AUJ D;  1A62 A;  4A93 B;  3SE0 A;  1JWM D;  2KHI A;  1LT5 D;  2Z4H A;  3H0G B;  3NQT A;  4OO1 H;  2Q2H A;  4PZ7 A;  4X64 Q;  2PQA B;  4WRD A;  5JPN C;  2K04 A;  3ITP A;  3UE0 A;  3I4O A;  2O5I C;  4DA2 A;  3ICE A;  5EKI A;  4A3I B;  2B2V C;  2KED A;  4ZYS A;  1F9P A;  2Y0S E;  2SNM A;  4A3D H;  3OSO A;  5KND A;  4KD4 A;  1DOL A;  1H9S B;  1E1O A;  2F0L A;  1EL0 A;  2UUC L;  2LKV A;  4EQO A;  4N9T A;  3MEH A;  2IY5 B;  5A2Q L;  1GHJ A;  4EQP A;  2VS1 A;  1JT8 A;  1SNO A;  4U68 A;  4A3C H;  3CQZ B;  2PYK A;  1RKN A;  1QZG A;  2E2I B;  4LW1 A;  3CCJ A;  2FJ2 A;  4DAV A;  5LMU Q;  1G8Z D;  4JG2 A;  1X6O A;  2Z6B A;  3HS0 C;  3KF6 B;  4LFB Q;  4X3S A;  1X54 A;  4LMQ D;  5C4J B;  1TWF B;  3J81 L;  4A3F B;  2K6A A;  4L5R C;  4N8X 1;  3M85 A;  1TWG B;  1J5E Q;  2ZT9 C;  5M5X H;  3R8B A;  2N88 A;  3Q24 A;  4A3G H;  1ILQ A;  4BBR H;  1Q81 C;  2Y0S G;  4KHZ A;  2NVX H;  2J7Z A;  4RGT A;  2JA5 G;  1VQ5 A;  5I6W A;  3S1M B;  1B2T A;  4ILW A;  5C3E H;  1DYQ A;  3K0Y A;  3S14 B;  3MFY A;  4DKA C;  1SLJ A;  2YV5 A;  3NBI A;  1WTP A;  1D8L A;  3T53 B;  4RHS A;  1JJC B;  3NK9 A;  5EPJ A;  4DV6 L;  3G71 A;  2F0G A;  2NYZ D;  4OWX B;  2TMP A;  2IJ0 A;  2N8N A;  3KBX A;  1GJX A;  4LF4 L;  5C0X G;  2F0M A;  4PMB A;  2E76 C;  1VQ8 A;  1M4V A;  2F0W A;  4R4O A;  3NXW A;  1CHP D;  3FKI H;  2BDO A;  3PSI A;  3KJP A;  2PNR C;  5KEE A;  3EA6 A;  4MZ9 A;  5M3M G;  3A8I E;  4JOI A;  2A6E D;  1PA6 A;  4C3J G;  3A8K E;  2HDM A;  3GV6 A;  3ULJ A;  5FLX c;  3HKZ E;  3I73 A;  1BO0 A;  4WFN 3;  2K5Q A;  1PZI D;  1VQN A;  1S5B D;  3OMG A;  3NTK A;  4C2M H;  1I3Q B;  2MFI A;  3A8J E;  3S17 H;  1B4O A;  1KRS A;  3J81 i;  1E22 A;  4DNT B;  1A2T A;  3A7L A;  2EJF C;  1ASZ A;  4DUY Q;  1C4Q A;  4B08 A;  4LUZ A;  4EQ5 A;  2IPK D;  3ZYY X;  1Y1V G;  1PTO D;  1HNX Q;  5EBD A;  4UDU C;  3OIP A;  1P8L A;  2JA6 G;  1A2U A;  4I65 A;  2NTT A;  3FVQ A;  1JB7 A;  2PO4 A;  2EYJ A;  1L2F A;  3U58 A;  1STB A;  3C3L A;  1KQS A;  3NP8 A;  4DV6 Q;  1B9N A;  1UEB A;  3E9H A;  3S1N B;  4IFD G;  4K0K L;  4BY7 H;  3HKZ G;  5C44 B;  4QIW E;  1V43 A;  3TS2 A;  3H6M A;  3BYT B;  1SXT A;  1JOQ A;  2CWP A;  1HHV A;  1GO3 E;  1PH4 A;  1SFO B;  4DV0 L;  3VR5 A;  3UI2 A;  3MXN A;  4FYD A;  5E7N A;  2A73 B;  1NMF A;  3J7Z C;  1BXT A;  3PIP 3;  1U4L A;  4RGN A;  5ELD A;  2QF7 A;  2NB0 A;  2BA1 A;  1UE5 A;  2B2U A;  2EYH A;  1PRT B;  1PRT C;  2LY7 A;  4NDX A;  2NN6 H;  5D65 A;  3D31 A;  1TY2 A;  4A3B G;  3S15 B;  2QW7 A;  3BVZ A;  2HCC A;  5GAD C;  1IBK Q;  1SSO A;  2Z0S A;  4ZK9 B;  4ALP A;  2M2L A;  2C9O A;  4LFA L;  1SNQ A;  2VNU D;  2ZXO A;  2L11 A;  1XNR L;  4DK6 C;  1LAB A;  4DV1 L;  3M7G A;  1STG A;  2ZTE A;  2F0S A;  2MGS A;  2KHS A;  5J39 A;  1ZKO A;  4J1M A;  5D3D A;  4HSV A;  4MHE A;  2B2Y C;  3GTM B;  3KYH C;  2R92 G;  4DR5 L;  1GUG A;  1GXD C;  4LF7 Q;  1V9P A;  4DFA A;  4HIM A;  2B2W C;  4JV5 L;  2X69 A;  1FNU A;  4KD3 A;  3HOX H;  3K58 A;  2O4X A;  4JK1 C;  1WTX A;  2OT2 A;  1N36 L;  2A74 C;  4K0K Q;  1E2V A;  4JC0 A;  5FJ8 H;  3QIA A;  1BR9 A;  3FMC A;  3H91 A;  2RA4 A;  4I7A A;  3GTQ B;  1NR2 A;  5ELB A;  1S72 A;  1KL9 A;  1H9S A;  2CCZ A;  4K2K A;  1RCV D;  2JA7 H;  2VB2 X;  2I07 B;  5E4X A;  1SE8 A;  3NE5 B;  4A4I A;  4BBS B;  5JVH 3;  1X55 A;  4LWC A;  5IE8 A;  5BR8 L;  3M9B A;  5CV7 A;  1PV4 A;  2I0Q A;  1Y1W H;  4OXP A;  4OX9 Q;  4L63 B;  4LF5 L;  3KK7 A;  4FVM A;  4JI1 Q;  1BDO A;  1F9Q A;  4LJZ C;  4A3K G;  1AN8 A;  3OWE B;  1QE6 A;  3K7U C;  1KIX A;  1NY4 A;  1ET6 A;  1MJC A;  2AMC B;  1L0Y B;  4FNF A;  1K3B C;  1TU2 B;  2RSO A;  3OW7 A;  3HOW H;  4LFA Q;  1KRT A;  4A3J B;  2CW0 C;  4R8I A;  1XNR Q;  4DR1 L;  2JA8 H;  4DV1 Q;  2CKZ B;  2EY5 A;  3E0J A;  4C3I H;  5KRU A;  1PH1 A;  2YYZ A;  4GKK Q;  3V2T A;  5FLX E;  1C8C A;  2MO1 A;  4PMW A;  3HOV H;  3H94 A;  4TSS A;  2XTI A;  4DV3 Q;  3RZO B;  5BN5 A;  4DR5 Q;  5J22 A;  2FHT A;  2KQ3 A;  2GVB A;  1D5Z C;  3HZX A;  2M9V A;  5IT9 L;  1ILP A;  4UP7 A;  4JI4 L;  4YWM A;  4N8F A;  4RKB A;  1N36 Q;  2WII B;  2R7Z G;  3GTK B;  4JYA L;  4GS3 A;  5E4W C;  2ZTC A;  5EPK A;  2KVM A;  1PHJ A;  4Y52 H;  4DAP A;  1BQQ T;  3IRB A;  4LK1 C;  4GLX A;  2NVY B;  3KJO A;  3PMF A;  1TWC B;  2AWN A;  4QUF A;  4B3R L;  4G7H C;  3EFX D;  4CDD C;  2K01 A;  1C7Y A;  1SMY D;  1WCM B;  2HD3 A;  1XJV A;  2B29 A;  4LF5 Q;  5AFW A;  4ABN A;  1G91 A;  2RDF A;  3OTO L;  4DAM A;  3PO3 B;  2A8V A;  3I4M G;  2HCI A;  1YHQ A;  4WJ4 A;  4GNX A;  1WI5 A;  2A6H D;  3X3M A;  1Y8P B;  4IAL A;  3M4O B;  2D2C C;  1SN8 A;  3HP3 A;  3P20 A;  5EQ0 A;  1YJW A; 
#chains in the Genus database with same CATH homology
 2OQ0 A;  3AFP A;  1X9N A;  4P72 A;  4GKK L;  1A8V A;  5GRO A;  2ES2 A;  1HZB A;  2ZM6 L;  1SRO A;  2H5X A;  2OTL A;  4JBJ A;  2HT1 A;  4HIO A;  3NEN A;  4JI6 Q;  3J7A 5;  1EFW A;  4DV3 L;  4DV5 L;  1Q1E A;  4R4T A;  1I94 Q;  3M4P A;  4AH6 A;  3HOX G;  2WB1 E;  1LYL A;  4A3M H;  4B3M L;  1MIU A;  1S3O A;  2E8G A;  3H15 A;  5IYB G;  3STB D;  3GTP H;  4LUV A;  1KC8 C;  2I5H A;  4JI2 Q;  3WWV A;  5FJ8 G;  2A19 A;  3FHW A;  4JI3 L;  1K9M C;  5IY0 A;  5H1S E;  1VQD A;  4X66 L;  4HIK A;  1K73 C;  2K5V A;  4DV7 Q;  1SR3 A;  2VQE Q;  4BXX G;  2Q2U A;  2PI2 E;  4GOP A;  2JA7 G;  3W5O A;  2HIV A;  5IYC H;  2NVT H;  1I6H H;  2VQF L;  1SRU A;  1HNW Q;  4X64 L;  2AWO A;  4YCU A;  4DUZ Q;  1Q81 C;  4O0A A;  2JA5 H;  4JI0 L;  1HR0 L;  5JJL A;  2KCM A;  1J6Q A;  4A93 H;  3HOZ G;  1PH3 A;  2D62 A;  3CW2 C;  3EIV A;  3CPF A;  1YHA A;  1Y1W G;  3H0G H;  1AE2 A;  1X3E A;  3S16 H;  2JQO A;  1VQ4 A;  1Z9F A;  2QEX A;  4IPD A;  4IPH A;  4X62 Q;  2JA9 A;  3HOZ H;  2E5L L;  1JJG A;  4B3R Q;  1CSQ A;  1U0L A;  3RLO A;  4QGU A;  1L0W A;  2ZJQ A;  1A63 A;  4A3I H;  4GNX C;  1YJN A;  2Q2T A;  4LF8 L;  3GD7 A;  1EUJ A;  3J81 c;  1H95 A;  3HOW G;  5C0X I;  4L5S A;  3PUV A;  3PO3 G;  2OWO A;  3PO2 H;  3HFZ B;  1IBL Q;  3OTO Q;  1PH9 A;  2UUC Q;  5GAE C;  3CCQ A;  4YWL A;  3PUZ A;  4ME3 A;  4PZ8 A;  3CAM A;  4KLK A;  4A3E G;  2JA8 G;  2WB1 G;  4KHP Q;  4QQB X;  5C4X H;  5HY6 A;  1PH8 A;  2IHE A;  1N32 Q;  1SFO H;  1QVF A;  4XTC S;  2YU9 H;  2R93 H;  4IJL A;  5M3M H;  4LUO A;  1P16 A;  4H02 A;  5LMU L;  4HJ7 A;  1GM5 A;  2Z6K A;  3U50 C;  1OXT A;  2YTX A;  2N3S A;  3HOV G;  3KDF B;  2KHJ A;  3KLW A;  3ULP A;  1UE7 A;  3CQZ H;  3CCM A;  1XPR A;  1CKO A;  4HJ8 A;  3CCU A;  3ER0 A;  4C3J H;  1XPO A;  1XNQ Q;  4A3L G;  1L1O B;  4IJH A;  1I94 L;  2E2I H;  1L1O C;  2JEA I;  4FDB A;  3RR5 A;  1LM0 A;  2PNH A;  4J15 A;  1G29 1;  1PH6 A;  1PH7 A;  3L0O A;  3ZJY C;  1I5F A;  2IT1 A;  3NEM A;  2PI2 A;  4YY3 Q;  3U4V A;  1J5E L;  4JI2 L;  4C3H H;  4B3S L;  2NVX H;  4IPC A;  1GKH A;  1XMO Q;  1PYB A;  5C4J H;  3TRZ A;  1LUZ A;  3K8A A;  4GOP C;  4A3F H;  4UPA A;  4JI3 Q;  5FLM G;  2CFM A;  3I2Z A;  2GN5 A;  3I55 A;  1A62 A;  4UP8 A;  1HNW L;  5K36 G;  5IP9 G;  3W1G A;  1YIT A;  4GN3 B;  2KHI A;  4NXM Q;  3F1Z A;  2VUM G;  4OO1 I;  4DPG A;  4IO9 A;  2Q2H A;  2RHS B;  2VQF Q;  4PZ7 A;  1KAW A;  4X64 Q;  1Y1V H;  2PQA B;  3ULL A;  1K0R A;  3S1M H;  4JI0 Q;  4IOC A;  1IBM Q;  3UE0 A;  1QUQ B;  4L5T A;  3TS0 A;  3I4O A;  1TWA H;  1VQ7 A;  5LMN W;  3KFU A;  2JA6 H;  3HOY G;  3ICE A;  4P73 A;  2VW9 A;  3S14 H;  2I5L X;  2K75 A;  3HKS A;  1XPU A;  2UXB L;  2Y0S E;  3AEV A;  1R9T H;  4DR2 Q;  2MO0 A;  1VCI A;  4R4I A;  4A3D H;  1EIF A;  3CCE A;  4KI0 A;  4LF4 Q;  1KHI A;  3CCL A;  1UWV A;  4IFD I;  1OXU A;  1E1O A;  4JOI C;  4HID A;  1U5K A;  2UUC L;  1B8A A;  4YCV A;  1OXX K;  3AYH B;  4IOA A;  5IP7 H;  4DNI A;  2IY5 B;  3JAM i;  2I0Q A;  3F2D A;  2VS1 A;  3PUY A;  1Q12 A;  1N32 L;  4PZ6 A;  3K7A H;  1EYG A;  3GTQ H;  4RG1 A;  1JT8 A;  4A3C H;  4APV A;  3M7N A;  1EQQ A;  1QZG A;  2KBN A;  4LW1 A;  3CCJ A;  5LMU Q;  3PUW A;  1VQ6 A;  4BBS H;  4JG2 A;  1IZ6 A;  1X6O A;  4OWT B;  3CMA A;  1XNQ L;  2JE6 I;  5DLQ E;  1IXR A;  4A3M G;  3E0E A;  2K5N A;  1BBU A;  3KF6 B;  3CPW A;  1OTC A;  4LFB Q;  4AYB E;  2E2J H;  1X54 A;  3A5Z B;  4JBK A;  1VQP A;  1QVC A;  3S1R H;  3CCS A;  2YTY A;  5IT9 c;  4YY3 L;  4B3T L;  1L1O A;  4A3B H;  1HZC A;  1EOV A;  4L5R C;  1XMO L;  3CME A;  3M85 A;  1I3Q H;  1J5E Q;  4MNO A;  1HNZ L;  5M5X H;  4B3S Q;  4DR6 Q;  5IYC G;  4A3G H;  2OTJ A;  4BBR H;  4NXN L;  2Y0S G;  4KHZ A;  4O2D A;  1XMQ L;  1FVI A;  1IYJ B;  1VQA A;  2IX0 A;  2LXK A;  3A74 A;  3BZC A;  4A3J H;  2JA5 G;  1VQ5 A;  4A93 G;  1VQJ A;  4NXM L;  1Z47 A;  2C35 B;  2ID0 A;  2KEN A;  5ELN A;  2OCE A;  3H0G G;  1FGU A;  2XGT A;  5C3E H;  3I56 A;  2UUB L;  4TVA B;  3W1B A;  3I4N H;  3K81 C;  2CWA A;  1VQI A;  1T9H A;  5GAG C;  1IBM L;  3VDY A;  1EIY B;  4DKA C;  2V1C C;  4YHH L;  1SLJ A;  2F4V L;  2YV5 A;  3S2D H;  2UXC L;  1QVG A;  4P74 A;  1D8L A;  4DV6 L;  1JJC B;  1HZA A;  4A3I G;  3BZK A;  2R92 H;  4R4C A;  2PQA A;  5IWA L;  3G71 A;  4DR2 L;  4OWX B;  3PV0 A;  4DR3 Q;  2N8N A;  3DLL A;  5C0X G;  4LF4 L;  1QUQ A;  4XIG S;  1PH5 A;  3PO2 G;  2N78 A;  5C44 G;  2UXB Q;  1VQ8 A;  2PMZ E;  3TQY A;  1JMC A;  4UY8 C;  4R4O A;  3FKI H;  2RCN A;  3MXN B;  1VQC A;  3FP9 A;  2UXD Q;  4HJ9 A;  1CSP A;  3S1N H;  5C4X G;  4JI7 Q;  4UP9 A;  3G6E A;  4A75 A;  2I5M X;  3PSI A;  4AYB G;  5C44 H;  3KJP A;  1E3P A;  2R93 G;  4MZ9 A;  4RMF A;  5M3M G;  4DV0 Q;  4JOI A;  3RNU A;  1BKB A;  1K8A C;  4DR7 L;  3UE1 A;  2WAQ G;  5HGQ A;  1N9W A;  3U4Z A;  1A0I A;  1VQB A;  1NJI C;  4LF6 L;  3G4S A;  1PA6 A;  1YIJ A;  2MNA A;  1CKN A;  4JCV E;  3ULJ A;  5FLX c;  3HKZ E;  3RLN A;  4TQU S;  3RN5 A;  1OXV A;  2DGY A;  4GN5 A;  3T1H L;  4LFB L;  4AIM A;  1VQN A;  4BA1 I;  1WCM H;  4C2M H;  2F3I A;  5ELO A;  1IL2 A;  4LF9 L;  3M3Y H;  4POF A;  5IYD H;  1G51 A;  2MFI A;  1O7I A;  4A3K H;  4POG A;  4MTN A;  3S17 H;  1KRS A;  3J81 i;  4A3F G;  3UDI A;  4JI8 L;  1E22 A;  3S15 H;  3KF6 A;  3KF8 B;  4B3T Q;  3NBH B;  4DR6 L;  3EN2 A;  2N49 A;  1ASZ A;  4DUY Q;  1BBW A;  1HNZ Q;  4LUZ A;  2ZTD A;  1VQO A;  4DR4 L;  4EQ5 A;  4OO1 G;  4BA2 I;  3GTL H;  4NXN Q;  1Y1V G;  2BH8 A;  3CC7 A;  1XMQ Q;  1Q86 C;  2ATW A;  1HNX Q;  5JEA G;  1V1Q A;  3F2C A;  3EBE A;  1MJE A;  2UU9 L;  4LNQ A;  1P8L A;  1S40 A;  2JA6 G;  2HHH Q;  1C9O A;  1SMX A;  2RF4 A;  5M3F H;  2QGQ A;  2YTV A;  2UUB Q;  1JB7 A;  5JJK A;  1E24 A;  2JEB I;  2VL6 A;  5AJ3 L;  5LMN L;  4P75 A;  4DV2 L;  1VQF A;  4A3D G;  2K14 A;  1L2F A;  3T1Y L;  1Q82 C;  4YHH Q;  2F4V Q;  3GTM H;  3F2B A;  3U58 A;  2UXC Q;  1VQK A;  4DR3 L;  1KQS A;  4DV6 Q;  1UEB A;  3E9H A;  4QY7 A;  5IWA Q;  2B63 H;  4IFD G;  4JV5 Q;  4BY7 H;  4K0K L;  1W3S A;  3HKZ G;  3J80 c;  4QIW E;  1V43 A;  4AQY L;  2UXD L;  3TS2 A;  1BVS A;  2R6G A;  5IP7 G;  1GD7 A;  4JI7 L;  1PFS A;  4JI5 L;  2EIF A;  4X6A H;  1JJ2 A;  1HH2 P;  1AH9 A;  2CWP A;  4NB3 A;  1GO3 E;  4A3C G;  1PH4 A;  3HOU H;  4DV0 L;  2HQL A;  3UDX A;  1CKM A;  5E7N A;  3BU2 A;  1X3F A;  2R7Z H;  1NMF A;  3J7Z C;  2K4K A;  4DR7 Q;  5C0X J;  1VQM A;  4BBS G;  3J81 j;  4LFC L;  1RL2 A;  2BA1 A;  2UUA L;  1UE5 A;  4LF6 Q;  1WFQ A;  5J3B A;  5BR8 Q;  3CC2 A;  3D31 A;  3GTG H;  3GO5 A;  3CC4 A;  3AFQ A;  4BY1 H;  4X65 Q;  1W2B A;  4A3B G;  1KD1 C;  3T1H Q;  3KDF A;  5GAD C;  2R7D A;  1IBK Q;  2Z0S A;  1AE3 A;  1VS0 A;  4ALP A;  4LF9 Q;  1JE5 A;  1X56 A;  4YCW A;  1I50 H;  4LFA L;  4A3G G;  2VNU D;  4BBR G;  2BA0 A;  2FXQ A;  1B70 B;  2WAQ E;  1K83 H;  4HJA A;  2R7F A;  4A3J G;  4JI8 Q;  4DUY L;  3I4M H;  1XNR L;  1TWH H;  1WJJ A;  4DK6 C;  1C0A A;  1B7Y B;  1K8G A;  4DV1 L;  2BH2 A;  2NZH A;  4GKJ L;  2ZTE A;  3CCR A;  4DR1 Q;  4P71 A;  5EAY A;  5C3E G;  2ASB A;  3GTJ H;  1HNX L;  4DR4 Q;  3I4N G;  1NE3 A;  3TRE A;  4Y7N H;  2GVA A;  4WJ3 M;  2HHH L;  3LGJ A;  2WFW A;  1G6P A;  2F52 A;  3KYH C;  2UU9 Q;  1YNX A;  2R92 G;  3DM3 A;  4DR5 L;  3K80 C;  2A1A A;  3RN2 A;  4LF7 Q;  1V9P A;  2MQH A;  1YVC A;  5AJ3 Q;  5LMN Q;  4DV2 Q;  3RZD H;  4HIM A;  1TXY A;  3T1Y Q;  1UE1 A;  3FKI G;  3STB C;  4JV5 L;  3RZO H;  3HOX H;  2D0P A;  1FJG Q;  5JEA J;  2D0O A;  2IX1 A;  4K0K Q;  5IYB H;  4DAY B;  4R4Q A;  2RHQ B;  1N36 L;  4IPG A;  4JC0 A;  1XTD A;  2VZA A;  4PG3 A;  5FJ8 H;  4JI4 Q;  2VY3 A;  1YHB A;  4AQY Q;  2WP8 J;  3H3V I;  3AQQ A;  3H3V H;  2ZJP A;  4JI5 Q;  3PGZ A;  4JYA Q;  1VQG A;  1LTL A;  1VQL A;  1Q1B A;  2AKW B;  1KL9 A;  2HIX A;  1S72 A;  1NBW A;  2CCZ A;  2JA7 H;  4BXX H;  1RIP A;  4QJF A;  1HR0 W;  3CCV A;  3GTK H;  1SE8 A;  4IFD J;  1MKH A;  4A4I A;  3A0J A;  3UDG A;  1YZ6 A;  1EQR A;  1X55 A;  4LWC A;  5IE8 A;  5BR8 L;  3KOJ A;  3M9B A;  1OXS C;  2QA4 A;  4DV4 Q;  1PV4 A;  2CQO A;  1N34 L;  1Y1W H;  2NVY H;  1WCM G;  2LSS A;  4OXP A;  2UUA Q;  4LFC Q;  4LF5 L;  4OX9 Q;  1TWC H;  1X65 A;  4JI1 Q;  4QL5 A;  4YWK A;  5IYD G;  4GNX B;  4X65 L;  1DGS A;  4A3K G;  3K7U C;  1KIX A;  1HJP A;  3Q8D A;  1NY4 A;  4JBM A;  1GVP A;  1MJC A;  1Q8K A;  2B3G A;  2AMC B;  2Q2I A;  3B6Y A;  3ERS X;  3F8T A;  3RLF A;  3PF5 A;  1IBK L;  2IHF A;  3NEL A;  2K50 A;  3K0X A;  3M4Q A;  1YJ9 A;  3HOW H;  3PF4 A;  1VQ9 A;  4LFA Q;  1PVO A;  1KRT A;  5M5Y H;  3CD6 A;  1D7Q A;  3PO3 H;  1N33 L;  2LXJ A;  1K3R A;  4L5Q A;  3G48 A;  2E2H H;  1XNR Q;  2DUD A;  1E7Z A;  1E1T A;  1YBY A;  4DR1 L;  3OW2 A;  1QZH A;  4A3E H;  2JA8 H;  1EWI A;  5JJI A;  4DV1 Q;  3M4O H;  2CKZ B;  4C3I H;  2AHO B;  4GKJ Q;  4GLA C;  4EX5 A;  5M3F G;  3GDE A;  1PH1 A;  4JI6 L;  2YYZ A;  3PUX A;  5GQO A;  1M1K C;  4GKK Q;  2ZM6 Q;  1VQE A;  3I7F A;  3GTO H;  2MO1 A;  4PMW A;  3HOV H;  4DV3 Q;  2JJQ A;  1WYD A;  2XTI A;  4DV5 Q;  4LF7 L;  2JK8 A;  4NPS A;  1NTG A;  2EXD A;  2EQS A;  1N8R C;  3D0F A;  3E9I A;  4DR5 Q;  2B63 G;  4A3L H;  1KXL A;  4BY7 G;  2GVB A;  2ZJR A;  3S1Q H;  3CP0 A;  4B3M Q;  3TEH B;  1NMG A;  3OYY A;  5M5W H;  1VQH A;  1FJG L;  3PCO B;  4GOP B;  1YEZ A;  1TWF H;  1PYS B;  2ALY B;  3PIP A;  4A76 A;  4DV7 L;  4R1J A;  4UP7 A;  2K52 A;  2VQE L;  4JI4 L;  3HOU G;  1TWG H;  4HJ5 A;  4YWM A;  4X66 Q;  3SGI A;  5GAH C;  3CF5 A;  1X3G A;  1N36 Q;  2K5H A;  3JAM c;  4DUZ L;  1UE6 A;  2R7Z G;  4GS3 A;  4JYA L;  1YI2 A;  2ZTC A;  5FLM H;  2OQK A;  2KCT A;  1PHJ A;  3JC6 6;  2NVQ H;  1WOC A;  4OON A;  4Y52 H;  3L7Z C;  5IP9 H;  1HR0 Q;  2L15 A;  3IRB A;  4GLX A;  2VUM H;  3KJO A;  3S2H H;  1PH2 A;  2NN6 G;  4X62 L;  2AWN A;  4DV4 L;  4DK3 C;  3MEF A;  4B3R L;  4OX9 L;  4BY1 G;  1C7Y A;  4GLV B;  4JI1 L;  2E5L Q;  2NN6 I;  1N34 Q;  1XJV A;  2B29 A;  4LF5 Q;  4OWW B;  1HZ9 A;  3HOY H;  4LF8 Q;  1IBL L;  3OTO L;  1Q46 A;  4DAM A;  1FL0 A;  3CXC A;  1Q7Y C;  1M90 C;  3J80 i;  1YHQ A;  2A8V A;  4GNX A;  1WI5 A;  3I4M G;  4WJ4 A;  4KHP L;  2NZO A;  3A5U A;  1Y14 B;  1CKN B;  4JBW A;  3PIO A;  2Z6K C;  3S24 A;  3L2P A;  1CUK A;  3UDF A;  1N33 Q;  1SN8 A;  4GN4 B;  3BJU A;  1ASY A;  1YJW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...