3HG9A

Crystal structure of putative pilm protein from pseudomonas aeruginosa 2192
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
119
structure length
119
Chain Sequence
LAEVDTLARSLLLYRSRLAEYAHANPGFSGSPADSALGLPAWFRKPVRLQGYIAAGTSYAFIASPPAGLAAAVDTGTESDLVGVRRNGQLVTRRLGATAIALPAPIPEGAVVAVKEGHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title CRYSTAL STRUCTURE OF putative pilM protein from Pseudomonas aeruginosa 2192
rcsb
source organism Pseudomonas aeruginosa
molecule tags Structural genomics, unknown function
molecule keywords PilM
total genus 16
structure length 119
sequence length 119
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-05-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1170 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3hg9A01
2.40.50.380 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3hg9A02
3HG9A
chains in the Genus database with same CATH superfamily
4Q5SF 2ETHA 3G71I 1BR9A 1LT6D 3NHHA 4AD9A 5E1ZB 2RA4A 4JI2Q 2WAFA 2MQHA 4IRIA 1VQCA 5C44G 1OPCA 2SDFA 1X2MA 2KIUA 1K8OA 5LHHA 4Z9CB 2YTYA 3U1DA 4A5NA 4HX8A 3P7JA 4O1NA 2XGCA 4A3DJ 1LACA 3PGZA 2A73B 3NQIA 5FRNA 3A0HC 4XKWA 5D14A 3OL3A 1PFBA 5EPKA 2OQRA 1W5SA 1DU0A 1U2WA 1IZ1A 2KIQA 5D8KB 2PYKA 3EJIA 3FXRA 1STYA 1IN5A 2IHFA 2Z2SB 2OZ6A 1BXTA 4DR3L 1Y39A 3F72A 4V0BA 3NEUA 2BZTA 2WY7Q 2VASA 1EYDA 3RI4A 2NRAC 4F7XA 4GXOA 1GUGA 2CYYA 3KP7A 1V1PA 4L9JA 2K1BA 2B63B 3NTHA 4JI4L 5A2QL 1X9NA 5H6RA 3FXUA 5JHUA 4LAAA 3NENA 3F8CA 2WB1N 3FMSA 1I4GA 1F2YA 1Y1WJ 4FHTA 3WTXC 4PG3A 3O8HA 3HS0C 3HOZH 2HQLA 1MBGA 3G2BA 3FBNB 4II3A 3CAMA 4FISA 3EUKL 3T51B 3I59B 2HQAA 3Q5FA 2CFMA 4JCVE 2KHJA 3R2TA 2K28A 1D1BA 2YYZA 2LXKA 4UPAA 3IC7A 1J7KA 4CCLA 2IT1A 1T38A 1A36A 4IN3A 1R9TJ 2PMZA 5BN5A 4A6DA 4A3BB 1VQ8A 2OXPA 1PYBA 4U88A 4QPQA 4K14A 1R5GA 1R22A 1U8RA 1AKHA 2B2VA 5KCMA 3WDNA 2ZCWA 1I27A 2F0KA 1QVCA 1TWCH 2VUMG 1GXDC 3LA2A 2BVMA 3EUAA 2CUJA 2EFQA 3FM3A 4E7KA 3HP3A 5F6FA 4MQ9F 1K28A 5D3IB 1U5TC 3CC4I 2Z1CA 5DD4A 5HY6A 2W57A 3CD6A 1EIYB 1DCZA 5IYCJ 4LF7L 2EXZA 1E2ZA 1TT0A 3CDIA 3E0JA 2GOXB 1Q82C 1WJ5A 3DM3A 5DCMA 5CYUA 1SFKA 1TWFB 2QWWA 2VN2A 1Q1EA 4R4TA 3I90A 4NC8A 4DNRB 1VQMI 2MD5A 2NZOA 1V5GA 1XWEA 5KRUA 1A0IA 3L7ZC 4DOZA 4EJVA 4EM2A 3HOYG 2M7AA 1K0RA 4XQQA 3WE2A 1C48A 3GLLA 3HXLA 1MSHA 3OIOA 5C5LA 1Z7TA 1YJNI 2A3SA 2K5WA 1SFOH 1IF1A 1QUQA 1EH7A 1UFMA 2ZKZA 3ZQFA 3J81j 3IAYA 3CUOA 1G6ZA 1SMYD 1WD0A 1F4KA 2XIGA 5FO5A 2JA2A 4E70A 2ELJA 2W25A 4KN7C 1RETA 3GTMJ 4OIOF 4P74A 5C4JH 1TP4A 4X3SA 4BJ5C 2KKOA 2R6GA 3TBIB 3LFKA 1IYJB 3CCLI 2OCEA 1EYAA 3GDEA 4GKJQ 1A2TA 2K50A 2COMA 4QL5A 1NCVA 4I98B 2W7NA 5E3OA 2B7EA 1QHHD 4A3EJ 1G291 1ICFB 3PUXA 2Z0SA 5D65A 2F0DA 2NZ1D 2R0QC 3O6BB 1MI2A 5DAUA 2ICEC 1Q86C 1G3SA 1AWCA 1ASYA 1A31A 1UAAA 1MDMA 2MHVA 4UUTA 1WJEA 3S3NA 1XMQQ 4I7AA 2C6YA 2EJRA 2BHZA 4HLXA 3BOQA 3QAHA 4I01A 1BF4A 2NTSA 1X56A 1E22A 1U4PA 1GV5A 1V1PB 2BDOA 4A2UA 1FOWA 1JT8A 4BDYA 2JSOA 3D6CA 1S9HA 2A8VA 5BQTA 1UWVA 2LFNA 2AUJD 3IRQA 1DZ1A 2L3DA 5FLXZ 3OW7A 3HOWJ 1B72A 1A8VA 1V5EA 1VF9A 3EPZA 3IH4A 3OYBA 5EAYA 2KMUA 1NSNS 1R23A 1SSOA 2JA5J 1B6AA 3VYUB 5F0HA 4C3IH 1N9WA 2P5LC 1A6XA 5C0XG 4ZKBB 3P5JA 4XSZF 1XSDA 4PQXA 4CYCA 1F36A 1HQCA 4GGGA 4XQJA 5M3MB 2SNMA 4EGYA 3BT9A 2I5HA 3CMAA 2F4OB 4A3KB 4PJJA 4IQ4A 4BY7J 2WB1A 1X54A 4AM3A 3UI2A 4LOCA 3GZ6A 3N52A 3VOEA 1BCPC 2L9SA 4W97A 1ITYA 5F04A 3S1NJ 2AQ1B 3BVMA 4F3QA 5CVRA 5E18F 1GLNA 4IUTA 3U4ZA 4HDVA 3RR5A 3H3VC 1E2XA 1JXSA 2F4MB 1W2BA 4O5VA 2QW7A 3DWPA 4C1NK 2D1VA 1L1OC 1JUSA 2JA6G 2VLAA 4LGWA 4BQOA 3FHNA 3V96A 2DTRA 4C2MJ 2EYOA 1K8AC 4DFAA 2ESNA 5JLWA 4J1MA 2JEAI 2K01A 3L2PA 1WH5A 1WFQA 3FHWA 2M2EA 2Z1DA 1FNUA 1H9RA 4DJAA 4BH9A 1IBMQ 2XWJB 3TS2A 3LSRA 3I4NG 1WTRA 2FMMA 1EZ6A 3J7YJ 2AMCB 4ZJZA 1HFGA 2JA8J 3A5ZB 3HOUG 3P7NA 3S3MA 2R7OA 1YI2A 1OCTC 1K83H 1OCCH 3K5MA 1H0MA 3DEUA 2BH8A 1KU3A 3I5UA 3FDYA 2DMPA 3WTTC 1CHPD 4BJ6C 1BBWA 3R93A 5EPLA 1I50B 2Y48A 3D5SC 4OIKA 4BY1H 3K10A 3K5NA 4A3BH 4R1JA 3PCOB 2DOFA 4GKKL 2QCOA 3REOA 3S1NH 2QDLA 3DTIA 2E19A 2ZMEB 4QGUA 4LWCA 1JQYD 3MKZA 2A68D 1B3AA 4XLAA 2KCTA 4BQAA 2JA7H 2KDZA 1XYIA 3PUFA 4EM1A 2WINB 4DV0L 1PYVA 2R7QA 2D45A 2MLGA 3FWEA 3CCQA 2W84A 3DHQA 3JRDA 2KECA 3HRZC 2GVAA 1QNUA 5HLGA 3H0GH 1TU2B 4HJAA 4V190 1SD6A 4UVCA 1K8GA 4XONA 3J7AY 2AS5F 2XROA 2EYFA 2E5NA 4X3UA 4CGYB 2K33A 1T5EA 3FXLA 1MBJA 2NOGA 1P6RA 1S6LA 1S40A 1ETOA 3M1EA 4ZDLA 5A2QK 1X4PA 3EQLF 5GP9A 1JE8A 4KY5A 2X6XA 1VQKA 2QEXA 3V7RA 1LLRD 4DAMA 4MLOA 3QR8A 1J8IA 5EEHA 1RTOA 5LRRA 3KLSA 2D5DA 1SFOB 2AQ2B 1VQKI 4MEXF 3ASNH 5DM6F 1O3TA 3X2QH 1EL0A 1VQHA 2HYGD 4WWCA 1BR1A 3H92A 2VQEL 5E1FA 4IQJA 3V7CA 1JJ8C 1YJWA 1EA3A 1SDFA 1LJ9A 2GIVA 1BI3A 3S1QB 1DYQA 3HOXH 3LSIA 4JYKA 4OMYA 1CI3M 1YJ9I 2HDLA 1XN7A 1D6EC 1VDZA 3FM5A 1FYLA 4XQFA 3FXJA 2MABA 5LGUA 1ETVA 2K52A 5IT3A 2QA4A 4PGHA 2VQCA 4HF0A 2G9DA 1CKMA 5FLXL 1Y69U 3DBHB 1NG6A 4A3JH 1R5ID 3K80C 1E7ZA 1E3PA 4EATA 3MA2B 4MEYF 5HDNA 1EY4A 4L5RC 2OD5A 1XMOL 2LDUA 2HOEA 2ZXRA 5JAVA 2GWRA 3ZJYC 1Q8IA 4YFKF 1KQ8A 1K6OA 4HLYA 1KQSA 2CJJA 1UAPA 1D5YA 1DP3A 4FF4A 1SD7A 4U7DA 4QY7A 1XMXA 4KT5C 2FJ1A 3E0JB 1VQ4A 4KHPQ 1I5FA 4WJWA 2PPBC 1OXTA 1JJCB 4NXMQ 3Q8DA 1SYDA 1BJAA 2NVYB 2XWBB 1E2WA 1HHVA 3S16J 1G4DA 3EQLC 4PV1C 2ATWA 3G4SA 3T1HQ 3ITPA 1RTNA 3WWVA 4HA8A 3GWZA 4DR7Q 2BHYA 2VW9A 4P9UA 3OMGA 2Q2UA 1IRXA 2F5CA 1Z21A 2YTVA 1M1KC 4R8NA 4LLGF 1VQ5A 3F2DA 2DFFA 1WHUA 3M3YJ 1J9OA 2ZXHA 2PZTA 4J8QA 3FHZA 1JMCA 4ZYAA 3PIPF 3BR1A 3K4JA 1U9RA 4RG1A 4ALPA 4B48A 2BGCA 3MZHA 3MZYA 1N32Q 3I56I 2JZYA 3Q22A 3LMMA 4KMUX 2KBNA 5IYDJ 4BBSB 1LVAA 1X55A 3HRTA 4CICA 1D8LA 1LFPA 1KDCA 5IY5H 3HSEA 5KYLA 1MKHA 3LWUA 4RCOA 3LSPA 3TOBA 4JI8L 1OFCX 4UVBA 1RRJA 5J39A 1EYGA 2QUFA 2RQPA 3WHBA 3GVAA 4K6LA 3TZDA 1KQ9A 2YU9B 3NWTA 3NSWA 1TBXA 4E7LA 4CKEA 2JA6H 1FJGL 2NZHA 4OEMB 1SROA 3PF5A 2R4GA 3ISPA 1I1SA 4DAVA 5KYIA 5IP9G 4UUSA 2ZTEA 2M9HA 2H1EA 4LF8Q 4ESBA 1BBUA 2K5QA 3K0LA 4TSSA 2RCNA 3C2PA 2DT6A 4I76A 1M8AA 5E3LA 3RN2A 4JI0L 4ID6A 4A69C 4HV5A 3WTUC 3LWFA 2NVUB 4IOAF 2K9SA 4C3IJ 3OYKA 1LT3D 4MTNA 3D0SA 2CQXA 2B9SA 3DLLF 2BEOA 2Q1ZB 2OBPA 2ISZA 3F8NA 4RBOA 1D1IA 4FE7A 2RNJA 3UE1A 2VQGA 3GF2A 3DCFA 4MIMA 1YQAA 1YIJA 2PQAB 2LR8A 4JX4A 2FBHA 5K5QA 1CQTA 3OV8A 2G0EA 4HR7B 2VQHA 1XPXA 1CSQA 2FQ3A 2L12A 3QODA 3CMYA 1WTWA 4JK1C 1S5FD 2DOAA 4LW1A 5EZHA 4LFAL 1K78A 4ITVA 1HTLD 5IGBA 1D2BA 4XKCA 2IWHA 4DR4L 2RSNA 4K8IA 4KFCA 2R5ZB 1IL8A 3GV3A 5JI6A 3K58A 1SD5A 4GYIA 3H3ZA 2GZWA 2ELKA 1O7IA 4DV6L 1XNRQ 1WI9A 1H89C 1ZHFA 1P8LA 4HSVA 1OXXK 1DM0B 1J75A 3KLOA 4WJ4A 1JTXA 3UE0A 3PFIA 2WBMA 4BY7G 2EFWA 3R3OA 4L0ZB 1BW5A 3MWMA 2M2LA 4XQNA 3E0EA 3CKIB 2PBIA 3NBIA 1QVUA 5M3FH 1TNTA 1BL0A 4ZRZA 1ML0D 2CQ7A 1UNSA 2QSHX 1TWCJ 4BEHA 1OLTA 2VBWA 3BG6A 3MFGA 1S7OA 1JB7A 4V19K 1IYVA 2X1DA 1X1CA 4JX5A 4MTDA 2FMCA 4NC6A 4LJZF 1B8AA 2ZTCA 3CF2A 3STBC 1WTXA 1Z9FA 3RD4A 4KMUC 1H88C 2VJ5A 2L55A 2K7LA 4A3MH 4IOCA 2FMYA 4DV7Q 1Y14B 3BZCA 4DK6C 3I59A 4A3JB 3ER0A 1SFEA 2CQKA 2OF7A 3N05A 5JVGF 2DA2A 4UY8C 3IP4B 1O7FA 1GUTA 5M3MH 4CCKA 3GTPJ 1EIGA 4HJ7A 3QP6A 5F0FA 1B4AA 1JHFA 3S1RJ 4JVZA 1HH2P 1GVJA 1I3QJ 3KZYA 2EY1A 3C2BA 2DQRA 2NYXA 2A69D 2Y75A 1ETWA 1H95A 1IN4A 4G7OF 4DR3Q 2WY8Q 1VQNA 2PZWA 1JKPC 3VFZA 4RGRA 3S3OA 5K36G 2E7XA 4PCQA 1Q7YC 3P9KA 4EX5A 4DR4Q 2FSWA 3A7LA 2G9HD 4MQVA 2EK5A 3FXKA 2A6HF 2LC2A 2A5YB 1SBBB 5F1RA 2P81A 4HV6A 3QU3A 1N34L 3ERQA 4OO1H 1JE5A 1TS5A 2F2EA 4MO7A 1XNRL 2NXNB 3IH2A 3F2CA 3H9QA 2PNRC 3HJEA 3D4RA 4XYOA 1B7YB 4G94A 3K4MA 2Z6BA 3OYYA 2K86A 4A3GB 4FT8A 3PIOF 2CKZB 4LMYA 4A12A 2NN6I 4NUBA 5ILVA 3W6JB 3CCEI 1Y56A 5M5WH 4FX0A 5ICEA 4IPHA 2CFOA 4JOIA 1P92A 3KF8B 3BCBA 4D0PA 2DJNA 3ONQA 3KF6A 4DF7A 1PZKD 1WCMH 5CR3A 4YG2F 4G7HF 3HEFA 2AHOB 3HTUA 2B8GA 2EY5A 4Y52H 2JVHA 3OWEB 2JE6I 1FMWA 1J5EQ 3NP8A 1JWUD 1E24A 2VUMJ 1FNVA 2JA7B 4IALA 1ZREA 2R93J 2GAUA 1L2FA 1KABA 2PX9A 1Q1VA 1R1UA 4WORA 2WWYA 1Z1DA 1U8BA 4LLNA 2BW3B 2BYVE 4LD5A 2NN6H 2D2CC 3CCLA 4CJ2C 3PIP3 5C4XG 4K5XA 3D8GA 2XUBA 5BR8L 1A3TA 5J4VA 5A2QZ 2ZNYA 2Q8KA 3ZMDA 1NNXA 1PTOC 4IO9A 2PO4A 1HA6A 4RAUC 5J40A 4DGWB 3RTRA 1GUOA 2AO9A 2MH2A 1ESRA 2EFPA 4IUPA 1EFWA 1Q1BA 4YFNF 5FD5A 2JA9A 4PDKA 4CYDA 3IRRA 3HKZA 4FF3A 2Y0MA 3M4OH 2G5DA 2F0TA 3OS1A 1SE8A 2HTSA 4JI7Q 2WP8J 4BHPA 2LY9A 2C35B 2K85A 4QJFA 3S1RH 1B9NA 4ZYSA 2MJ8A 3G7LA 3HUGB 5GROA 1T0FA 3I0TA 3HOVG 3TO9A 1IXRA 4J00A 1X3UA 1IUYA 3OYNA 3LFUA 3NTKA 4GKJL 1TQIA 5J8FA 2CV1A 3U9OA 1OCRH 2A6ED 2WAQN 3T1BA 4DN4M 2CO5A 2FINB 4I2OA 3DMUA 2NAZA 1SNOA 3E3VA 4JI1L 2DDAA 4M3EA 1G2SA 2XAQA 4UB8C 4HSPA 1UUPA 3HYIA 2KLOA 1LKXA 2QKLB 3QYBA 1CT1D 3A55A 2QSGX 1NUCA 2PI0A 1OYYA 3L09A 5TJJA 2LFBA 3IAM2 4BBRG 3RYPA 3V2TA 4A3EH 3SDBA 1EU4A 1A62A 2ZXPA 3HHGA 1Y8NB 1EWIA 3FVQA 1T0FC 3OOUA 5DM73 2JA7G 2P5ZX 4DYCA 1O3SA 1HC8A 2LXJA 2RQXA 3IRBA 3LQRA 2M8EA 1WJBA 4RB3C 4OAZA 1MJ9A 3TP3A 4GN4B 4U0YA 5JVTA 2ENBA 3RUZA 2HPMA 2H94A 2QDBA 2G9WA 2O0YA 4RMFA 4JI2L 2LH9A 3RZOH 2JN6A 2PQ8A 1VQNI 4X64Q 1JGGA 1YYVA 5BS6A 1IGNA 4JI7L 1G59A 3U1KA 1RZ4A 3C7JA 1A04A 4N8FA 1HZ9A 4KDPA 3TMEA 3K7AJ 3KP6A 3OYFA 2F0MA 5LRSA 2KDOA 2K3PA 1MH3A 1PP8F 2VUMH 3DBLB 3KFWX 1PP7U 2K40A 1EU3A 1RKWA 1U78A 2L7FP 3B6YA 5DEQA 2RDFA 2V9KA 3AEVA 1QNTA 2M30A 3OR1C 2RBMA 3RYRA 5D5XB 2H1KA 1G6NA 3TKYA 3TQNA 3BDCA 3WODF 5GAHJ 5CV4A 4CUGA 3L2VA 3TP8A 2CCZA 2L9RA 2H4OA 1HW2A 3N97A 1GT0C 4ZLTF 3QYEA 1U5TB 2EYHA 3HOXJ 3P9IA 3HOZB 3FP9A 1YITA 3GTQJ 3BP8A 3N6RA 2OZUA 2VBXA 2XVSA 4H44C 4CCNA 3JAMi 2IGOA 3ECOA 1XCVA 3GBGA 3QWNA 5EKIA 2GXAA 5I6WA 2A61A 1V55H 2QEXI 4XT1B 1VQ4I 2KIMA 1S7EA 4TQUS 1FSEA 2NVXJ 2Z6KA 1FYCA 4CYCB 2RN7A 1LVKA 2KT0A 1AE3A 1OXSC 1U9NA 5CV7A 1L3LA 1C4QA 1F5TA 5K5OA 5GAEJ 3J7AF 3BPXA 2XSCA 1QG7A 1JKQC 4ODGA 5EKKA 2DMQA 5FKAC 1Z7LA 2SNSA 4E4HA 5FRMA 1RNLA 5FLVA 4L5IA 3S2DJ 3KYHC 2ZB9A 2PJPA 1E0BA 5ERIA 3KJPA 1KU2A 4GLVB 1G3WA 1YHAA 3A0JA 3K4LA 4YHHQ 5KK1A 3K4NA 2LKPA 2C9OA 3E5UA 3S17B 2F0FA 4DV0Q 1D3YA 3C2HA 5CV9A 1PRTB 1SC7A 2F0GA 1BIBA 4M71A 2QA4I 1A3VA 2GM4A 2PMZE 2WAQA 2XRSD 2JSCA 1UZCA 2XSDC 3TOAA 4HIDA 1Y1VB 2N3SA 2R92B 4P71A 3VYRA 2HCIA 1OCOH 5IT9c 4XR6A 3VR2A 2JA6J 5I9OA 1FGBD 4Q4ZF 4ZC3A 2L9HA 4RGNA 2EYMA 1XSXA 5J6XA 3WU0A 1VI0A 4ZYDA 5IP9J 2QM3A 5C3EJ 4H7BA 1DOKA 5HS9A 4APVA 3M4PA 1QOHA 2XAUA 2UV1A 2F6CA 4A3CG 1Z6TA 5AIPA 4U0VA 1HNZQ 3E3XA 1CZWA 5E20A 2JA5B 1N75A 2O61A 3H91A 1C0WA 5KNDA 3OMCA 5GADJ 5E3FA 5K5PA 2N8GA 4KIGA 1G8XA 2OC6A 4AIMA 1SYGA 5C44J 2FOKA 2NVQJ 3TW6A 4ZYEA 5LMUL 4G6TB 4HDUA 4JQFA 4AIHA 1LTRD 4A3LG 4RGOS 3Q0UA 3CPWA 3VYSB 1VCIA 4KMFA 1HCZA 4ZAIA 2XAFA 4N9PA 4A93B 2WAQB 5IP9H 1DGRM 2XF5A 4A3IJ 3QPTA 1POGA 5E1XA 2MA3A 4KD3A 2E2HJ 3H3UA 5IYDG 2AKWB 5DUIA 3L2CA 4HPQA 3I4MB 3HGBA 1GUWA 2ALYB 4S3SA 4PZ7A 5KNLA 1PH6A 4B44A 3PSFA 3ZGKA 1GD7A 1QBJA 3J7YW 2W4SA 4YHHL 1XX8A 1BCPB 1TWGH 1B59A 4IZ8A 3D6WA 1NBWA 5K36H 2HZDA 2EQRA 1HQMC 3CCMA 4RB0A 4A3DB 3I4NH 3KP2A 2Y0SB 4NXML 4QB4A 3KFUA 3J81c 4JI3L 1YFHA 4N4NB 4E7JA 4L5QA 4DV1Q 4YFXF 2A68C 3S32A 4DV3Q 3UDXA 3M8JA 1N36L 1VQPI 4KN4C 4XOTA 1X3WB 4LFBQ 1IN8A 4NPSA 3WOFA 3G6EA 5M5XJ 2HTJA 1KNAA 3Q0AA 1OQYA 1HPCA 2K4BA 2R7XA 1G3YA 3E5SA 1XMKA 4PMBA 2E2JJ 1PRTC 4EGVA 1PH9A 5FFXA 3DM1A 1UCRA 3AFQA 1FMVA 2MFIA 3MCZA 3GTOJ 4BHBA 2B63G 4PJLA 3MAJA 1WCMG 3QRFF 3WGGA 4QCLA 3GLXA 5FKOA 2H27A 1IKMA 2UZKA 3M9AA 1IW7C 5IYBH 2VT3A 4KICA 4PMWA 1NHAA 1FJGQ 1SJED 3C1EA 3GZ5A 4AUXA 3MTSA 4X6AJ 1E2VA 5HS7A 5BN4A 3H1CA 4CO8A 2GIZA 3HOUJ 5IGEA 3A0BC 5BNGA 1VQIA 3GFIA 2GLOA 2CG4A 1LV9A 3ASOH 1X3PA 4DU9A 3TN2A 4JI0Q 1X19A 3NTIA 4AIJA 1SYCA 2QILA 1B2TA 1MZBA 1O57A 2MFZA 2VPLA 1TT2A 1IDYA 2OT2A 4CKCA 2RC4A 3J80K 1HJPA 1KXLA 1SAPA 2L7ZA 3LSJA 4POGA 3FPUB 3H09A 4IQZA 1IUFA 3R61A 3LX0A 4KKUA 4HG2A 2A68F 3F22A 5KEEA 4A3IH 2MGQA 2R3ZA 4BA1I 2DJGC 2EIFA 4P96A 3MMYB 5JEAG 1QPIA 4IFDG 4DV4L 2DNEA 3BR6A 6PAXA 3AMUA 2EBIA 2W1OA 1GM5A 2CFXA 2R7ZJ 1J6QA 4GKKQ 1KC8C 3GXOA 3MZ8A 4A6EA 4A0YA 1WJCA 4LFBL 2V9VA 3DKYA 3VSLA 3IFDA 2EZKA 5H20A 1RUNA 3H3VK 2R92H 2A6EC 4HTHA 1JORA 3E9HA 1VQ5I 1VMCA 4B3TL 1V4RA 2O6GE 3G1LA 1QZZA 1T33A 2WAQE 1YW9A 4A3MG 1T6SA 1S5BD 1IW7F 5HLTA 5C4ZA 5E4XA 3E97A 2DBBA 1H9MA 2PMZB 3K1PA 2OWOA 3JRAA 1SMXA 5ILUA 4LF6L 1L0XB 2MPMA 3KP5A 5M3MG 3GTOH 5IOZA 3G6JB 2Z4HA 4ABZA 2MO1A 4HSRA 1V5FA 5FKMA 3DXJC 2ICWG 1QPMA 1BR2A 3DEEA 1QQIA 4BKXA 1YNND 2K5VA 1MMAA 4A3EB 1HNXL 1R7JA 2A5WA 5J1RA 3CCVI 5C4XB 1NY4A 2VQEQ 2ZJRA 4TV7A 3T5XA 1MJAA 3PFYA 2DT7B 2L2OA 1ASZA 1STAA 2YSRA 5LGNA 3KYCB 1LTBD 5ELCA 1C0AA 5FJ8J 1SNMA 1J0RA 1FP2A 3DEOA 2SOBA 2PQEA 1G2HA 4MHGA 2R61A 2B2VC 1JT0A 4NNJA 3OYEA 2LF7A 3MFYA 1IBLQ 3GTMH 3L2UA 1W6JA 2F0VA 1FBQA 3ABUA 3OS2A 1Z47A 1RPWA 1G2TA 4G7ZC 5E3NA 4DUYQ 3BTIA 1BBXC 3L9AX 4KY6A 1UE6A 4UUSB 1TWGB 4W1UA 3HEJA 2YU9J 4HQEA 2RVLA 2ZBKA 1OO9B 4GFBA 1T98A 3ZN0A 1SE4A 5FOBB 4LG0B 3C18A 3KEQA 3VA5A 2VIXA 2HPIA 1B8IA 5E79C 1XGSA 3CPFA 2A05A 4JI5Q 1IXCA 2R3SA 3DBRB 2D0OA 4NB3A 4WRDA 4HJ5A 3QOEA 4PGGA 3FF5A 4TVAB 2VJIA 4PSXA 5L3BA 3FIWA 1BC7C 1DJRD 4B9WA 1N25A 1WFXA 3CCRA 2FJ2A 2CH4A 5J22A 1SMYF 1GO3E 2EPBA 3GTLJ 2ME6A 5L3GA 2H1LA 3OYGA 3IFTA 1WVLA 4XLHA 3GTGB 2K9QA 5E8IA 3ZMUA 2HD3A 2XF6A 2Q2IA 1FPQA 3LAPA 1ENFA 3LNQA 1S5ED 3CCSA 4DR7L 2J5PA 4BY1G 2O5IC 3IWZA 1PH1A 2R5ZA 4L8JA 2GA4B 2OQGA 2B63H 2EPFA 4YIIA 1E1TA 2L4MA 3VSKA 2K5CA 3W6VA 3V8JA 1B4OA 1PH7A 3VDXA 3CQZB 2UXDL 1HZBA 2F0WA 1HNXQ 2IA0A 2UUBL 1AN8A 2X6OA 2NTTA 3O3KA 1CF7A 1H9KA 4IJHA 3Q0WA 5IT9K 5EF6A 4H0EA 4A3GH 1J5EL 3C2GA 4Q0FA 2AQFA 1QO0D 3MKWB 2YX4A 3T53B 3BTLA 3C3LA 4Y33A 3U9SA 1O7LA 3OOPA 4UB6C 3FBIB 2F1MA 5ELOA 4DUYL 2E60A 4JI6L 2E5ZA 3STBD 2IHEA 3U9GA 3F2UA 5M3FJ 2PMZN 3GFMA 4HX4A 5NUCA 3SQNA 1KIXA 4OINF 1JJ2A 2DCEA 5M5YH 2VE9A 4N8X1 4CJ0B 2DDBA 3DWLE 1ZKGA 3M9BA 3U50C 2P4WA 1W0UA 2B2UC 2O8XA 3FKIJ 1WTHA 2CW8A 1MIUA 1O80A 3HOWH 1ORKA 4IHTA 4M73A 2YX7A 4A3FG 4PJMA 1VQAA 1J5YA 1YX5A 3CC7I 3JTHA 1HUNA 4PJNA 1FVIA 4ON0A 3OYHA 2NVXH 4D9JA 2HDWA 2TRTA 3JRCA 2M9VA 1WQ2A 2IGKA 5IT9L 2EIKH 3GTJB 4BS9A 1YNJC 2EINH 5J47A 1STZA 4RS8A 2M8GX 1MGTA 4LB5A 5CV5A 2ZT9C 3KE2A 3VDYA 1LM0A 3GTQH 4LFAQ 1V1QA 4Q48A 4A93H 4DIQA 1VF7A 3WHCA 3CC2I 2K4KA 3MHBA 2EQSA 1OCZH 3KEOA 1MGSA 1H9SB 2LTPA 3L00A 4II2A 1UB9A 5FLXE 3I8ZA 2EDGA 2F0JA 4DNIA 4DV6Q 3J80i 1RODA 4R8IA 4XLEA 2YS9A 2ZNZA 3BDLA 5DS9A 2F5EA 1Y8RB 2V79A 5LLQA 3WTSC 3A8IE 4UHTA 2CWAA 1W0TA 3OYLA 1I4XA 5FO9B 1F9RA 2X1CA 1LTID 1Y8OB 2Y31A 1BVSA 1N77A 3S2HJ 1STGA 2WFWA 1GXPA 3RSNA 3J81E 4M3GA 4MN3A 1R9TH 2VQFQ 1F9SA 1W5TA 4OX9Q 1Y8QB 5D6FA 1YG2A 3MEHA 1Z9CA 1AW7A 3MC0B 1PH4A 1MW7A 1CA6A 2MH9A 2R92G 5CORA 5FO8B 2F0LA 4S04A 1EOVA 2XPWA 1ERDA 2F0HA 4RA2A 2VC1A 1AE2A 3CCJA 4JBMA 2FX0A 1MNDA 1YW7A 1FY7A 4DV7L 1FBUA 1XGMA 2Y9ZA 4CDCC 2K27A 3EYYA 5IGFA 4ESJA 1A63A 2Y0SG 1CUKA 1LEAA 4X64L 4OWTB 5DTDA 5K7ZA 2J7ZA 1H9SA 3AFHA 1U9OA 4X66Q 2WACA 1KRTA 1JR0D 3RPUD 4HMJA 3Q0VA 3MVPA 1HZCA 4C3HH 1IW7D 5D5WB 2FBKA 4FXDA 4DBQA 2TCTA 3K81C 1ZN2A 3F23A 2QQBA 1QZHA 2XPVA 2N78A 4PFPA 4A4IA 3SFZA 3WTYC 2IW3A 4DAYA 3HZXA 2LG4A 1WJFA 3J80Z 1O78A 3CP2A 4C3JH 2Z99A 2M7BA 2F4VQ 2M4KA 2A6TA 4KN4X 4L6TB 3R60A 1LFUP 4FXGC 1VFCA 1IAWA 5HLHA 1N8RC 4XORA 3ERMA 3BPVA 1ETXA 5CVJA 4XLNF 1I4RA 2PCFB 5LHIA 1D5MC 3H9JA 1ET6A 2QYOA 1JUMA 3JRGA 3G71A 3S14J 4BXXH 3EDPA 2FA5A 1K3BC 4B3RQ 4JX6A 4Q47A 5M3MJ 1YHBA 4M6YA 1T39A 4RDUA 4IHSA 4BACA 2L5QA 3M8FA 4BY7B 2DAOA 1S7AA 1W5CC 4LLLA 3MAQA 3W3CA 2HYFA 5IODA 3M85A 2NVQH 4WX9A 2KHSA 3WU2C 2E2IJ 4FVMA 4HBLA 5AJ3Q 3EFXD 3PO2H 1ENAA 1FGUA 1EZ8A 1IG7A 2PI2A 2V1DA 5H2FC 4EQPA 3I4OA 2VB3X 5IGCA 5IP7H 1XTDA 1EKEA 1BCPD 3HOWG 3M4OB 3GTKB 1X32A 5FB2A 1AA7A 3H0GG 2BOLA 3M8EA 3TEDA 1GKHA 1QRYA 4C3JG 3ZMVA 3HRSA 1X3FA 2JUGA 1RC9A 2XVCA 3BVZA 1SEUA 1JCKB 1VQ6A 2WV1A 5CVUA 3H15A 1XJVA 4XSXF 4B3XA 1VQ9A 5HNFA 1MBEA 4IUVA 5J8CA 4LF9Q 2E76C 1FSHA 5IP7G 4A76A 1HNZL 1JE4A 2QBYB 2L11A 2M4GA 2EOTA 4U68A 3H5NA 2OQKA 5F64A 3ZP5A 4DBRA 3F8MA 4FASD 2VJ4A 4PZ6A 2F0NA 4QTRA 3PNTA 2MD0A 3OIPA 2O03A 4XICA 1ESFA 5EGOB 2PMUA 4I09A 5C3XA 4RHRA 4IFDJ 3CDLA 2BXYA 4A3KJ 4EJWA 4JBJA 2ZJQA 3TQYA 4DR1Q 5CQGA 1X4OA 2R93H 3S1QH 3I72A 5KHDA 4Y7NJ 5IY0A 2IW5A 1ULYA 5IIFA 2B3GA 1RIPA 2XTIA 2Q2HA 2V4JC 2CWEA 4B09A 3KJOA 4EM0B 1T2KA 1R5HA 4ZUJA 2X6GA 4JI1Q 3SHFA 2CW7A 2RF4A 4K5VA 1YOVB 3I73A 3TP0A 3J81Z 4GCVA 1YI2I 3CP0A 1YTYA 4M72A 5A35A 1C7YA 3L2WA 4Y4RA 2UU9L 3GX4X 2DGYA 4RGXA 3S15B 1TXYA 5C3EG 1HOMA 1K73C 3Q24A 1EEID 3P20A 1F9QA 1B53A 3PM1A 1MBFA 5EZGA 2DJIA 3PO3B 1TIID 3HL2A 4A3CJ 4N4OB 1DGWY 1SYEA 2W82A 3RZOB 4BUPA 1ZYRC 4A3BJ 1UHMA 3BR0A 1ET9A 3B6CA 1N36Q 3BVGA 1L1OB 2DU9A 4A3MB 4KHZA 1UHWA 1BI0A 2JJQA 4XXEA 4U7BA 1YBYA 4RB2C 2R7UA 4JBAA 1BOSA 3H0DA 4YCWA 4LF9L 3J7A5 3BTJA 3W2VA 4B3ML 5ICGA 3RN5A 3NAUA 4IFDI 5CBEE 3ERSX 3SEBA 4RMNA 2MYSA 1MDMB 1N33Q 3WG9A 1LQ1A 1RI7A 3LWEA 1ZGAA 3V4GA 3RPQA 1OMIA 2RKHA 1WYDA 4K0KQ 5IGDA 2CSOA 4AU7A 1SNCA 2F3IA 2AWNA 4M3FA 4Q5VA 5CLSA 2EIMH 2X9DA 4UNOA 1DD2A 4R4OA 4GNXB 1F77A 3J7ZI 2N8NA 5C0XH 2VKVA 2H09A 2VB6A 1YJWI 3IL2A 3DV8A 1HW1A 1HNWQ 2WB1G 5M5YB 4XYQA 3SVMA 2OU2A 4UP9A 4FE4A 5E1WA 4K2EA 4UV8A 4RKLA 4M6XA 1PFSA 3OYDA 1YO5C 3KP4A 4B43A 1TQMA 3HC7A 1VQOI 1IZ6A 1B9MA 1BN5A 2X6LA 4CCOA 3CCRI 1Y0UA 5C4JJ 3I91A 4X3TA 1TQPA 1KD1C 2DYRH 3EETA 4KIFA 4HW0A 3S1QJ 1JB3A 1STBA 3CCEA 3CCVA 2AQEA 4BBSJ 1CKNA 1YNJD 2LK2A 3BCAA 1KA8A 2VBYA 4C3HJ 2M34A 5E4WC 5IYCH 3P75A 1R1TA 1IRFA 2XGTA 4KJNA 1AP0A 2LMDA 1D1AA 1TWHH 1IXSB 2ZJPA 4WCGA 3IKJA 1MHWC 2NS7A 3SZGA 2F03A 1R6RA 3GTPH 1NJIC 3WU1B 2NOJB 4R1HA 2CW0D 1TWAH 1RKNA 2Q2EA 3OYMA 3S16H 1WWXA 1N33L 1AOYA 1PVOA 4BBRH 4MTEA 1QGPA 3V8KA 1O7YA 1SVMA 4K0KL 2X51A 4LF6Q 1SRUA 3T4AC 4JC0A 2RSOA 2RAEA 4CSWA 1I39A 5F27A 1D5VA 1NMGA 2IJ0A 4QSHA 5GAGJ 2CHBD 2IGNA 4A3KG 2JRTA 2XB5A 5J1YA 3UKGA 4RH6A 4KHVA 1P7IA 1XD7A 3BJAA 4EV0A 2JP1A 2VE8A 2DPUA 2JK3A 2PJRA 2FRHA 1FYKA 1IN7A 5FJ8G 2O3FA 1EV7A 5AONA 1TWAJ 2J4XA 4GRIA 1YRNB 2BDNA 4IOCF 2VKHA 4DR6L 1BI2A 3FXMA 2LSOA 3CCSI 4R4IA 3PMFA 3GTLH 2JUCA 2EE1A 2ZSHB 2XASA 4IJLA 1TS3A 2ASBA 3VYTA 2FBIA 3TBIA 1IJWC 4CJ1B 5LFAA 5EBDA 1P4AA 5GAGC 3KK7A 1ONVA 4PMCA 4CDDC 3S1MJ 4YIFA 1P9QC 2ID3A 5C4XH 1K8MA 3RZDJ 2K04A 2OEOA 3RPUA 4G6QA 4Y7NH 1LTSD 4RKBA 3VODA 3G1MA 3DEWA 1F9PA 5FLXK 2IX0A 2D62A 1K83J 2DOEA 1MNMC 5D3DA 2MG4A 2YUSA 5E8GA 2CV2A 4I99C 3MN2A 3HOUB 5DNFA 1LO5D 1K79A 3EYIA 4N9HA 3GZNB 2LS01 4F55A 3HOXG 4JBKA 2K9MA 1EH8A 2YU3A 3F8TA 3CF5F 5BN3A 3OSGA 4A3GG 3BC8A 3RQIA 1UEAB 3TP7A 4X65Q 3DFGA 1Q81C 1BW6A 4M8AA 3HOYB 3HTSB 2KRHA 4HAEA 1SAXA 4JI3Q 3IAS2 4ENMA 1T5XD 3H94A 1FOYA 1I6XA 3PL8A 5I9PA 2WIIB 4XKBA 5IOCA 2FF4A 2ACJA 1VQ8I 2ID0A 4S05A 2KJCA 3VYUA 4ULLA 4I0AA 5B1BH 2IGMA 4DV3L 4XT3B 3A01B 4A3LJ 2A5HA 3M3YH 3VR4A 3VYTB 3KETA 1WVRA 1R4NB 5JPMC 1QVTA 2IP2A 5HNHA 2PW5A 5L3CA 4LIUA 2O5JC 1P4WA 4S0HB 2JXMB 1TWHJ 1D0ZA 1WPKA 2UUBQ 3CF5A 2B8FA 1AKHB 2XGEA 2G7HA 3CMMA 3BDOA 3IH3A 3W1GA 2A07F 3JAME 1YX3A 1BCPF 1EUJA 5D4SA 1LTTD 3PIO3 5JJLA 1STEA 3A54A 4DR6Q 2HOTA 2D5VA 2HQRA 3BQZA 3LL7A 3QO2A 3M4QA 3FKIH 3Q6SA 4Y15A 4ZZDA 3PSIA 1QZEA 1PJRA 3BQYA 2L7MP 2YV5A 2D0PA 4A3FH 4HF2A 4HN7A 3HKZB 5IT9E 3M4YA 2CVRA 5J3BA 2UXCQ 4RHSA 2VC0A 1GVPA 1IBKL 1PTOF 2Y9YA 3BYYB 1GHKA 3IL8A 2BVLA 2R7VA 1W4MA 2Z5UA 1MD0A 1KRSA 1LUZA 3GCMA 1QB5D 5EEGA 3GEZA 3FKJA 3T8RA 4F8MA 2F0EA 4DV2L 4XOPA 4KHPL 5M5XH 4BY1J 1R1VA 3HZJA 4DR2L 5KNBA 3GW2A 5AFWA 4BE0A 3I4MG 3K57A 2JA6B 2E1OA 4M3BA 3E1SA 4DYQA 3NBHB 1HDDC 1YS6A 1Y1WB 2Y69H 2KQ3A 4IHXA 1J2XA 3IV5A 3LSMA 1LE8B 3A7AB 2LRDA 3GFLA 1T08B 4FNFA 1YIOA 5CC4A 3CUQA 2UUAQ 5DD8A 2CH4W 1GOZA 2Z16A 3VR6A 5E17F 2Z4IA 4XLFA 1I1GA 1VQMA 3GFJA 1K3RA 3HKZG 2OCCH 3S16B 1LT5D 2LY1A 2D9UA 3S1RB 1X2NA 3S2DH 2FOWA 2O9LA 2R93B 3AG2H 2AHQA 2ZXWH 5CV6A 2JA5G 1ENCA 3I64A 2NVXB 2OTLI 5DLQE 4OAYA 1EQQA 5C44B 2JJ7A 4ASNA 4XN0A 4R8HA 5KAIC 2XRNA 3JRIA 1JT6A 3CDHA 4Y3OA 5T1IA 3K6OA 3AAFA 1XC5A 3LSTA 4XNFA 2PJRB 1LTLA 4HEDA 1I3AA 4XTCS 3UDIA 4DGZA 5F08A 4OIPF 1SEBD 1S29A 4GOPC 3HOVJ 1P16A 2M00A 2RNGA 1HXDA 1XCBA 4HEA2 4MFEA 3FKIG 1ONLA 4IHVA 2MO0A 3HG9A 3MQ0A 1GUSA 3I70A 1PA6A 4LF8L 2OJED 4G57A 4NMZA 4BXUA 4I02A 3AKZA 1X6OA 3K9TA 2P6SA 4E7SA 1PTOD 2QQAA 1PDNC 2L1BA 5GQOA 5ILSA 2W85A 5C6AA 2UXBL 3CQZJ 4HRIA 4DNTB 3I56A 1MBYA 3LAJA 3JAMc 1KLUD 4EJOA 1KU7A 2LP0A 4ZTJA 4ENNA 4D5CA 3V05A 4IPGA 3MZ5A 3CJTB 3MEFA 2EV5A 1I5ZA 1EY7A 4D1QA 5C3EB 2A1AA 1WCMJ 3KYLA 3ZXSA 3RLFA 4FYDA 4NB5A 5B3SH 3F21A 1MSGA 3K4BA 1GUNA 1M1EB 4H0LC 3I4MH 2L0KA 2NBFA 3OYJA 3JW4A 4ZYGA 2DA7A 2DQLA 2JA7J 4EQOA 3OMYA 3DF8A 4GOPA 1I6VC 1SNPA 2KENA 3GTGH 2F48A 1ZEQX 3K2AA 5IYBG 2DUDA 2WB1E 4KITB 3E6ZX 1YHQI 3CJRB 3TP6A 2A6EF 3ABTA 1Z05A 1MBKA 3F8FA 5EBCA 2XAJA 4IPAA 4ABNA 4A93J 3DLAA 3HPGA 1CQFA 3FX3A 3OL4A 3MD2A 5JJKA 3A8JE 1E0EA 2HXIA 1V3FA 2Y2ZA 3ELKA 4B47A 2HXOA 1PYSB 1HKQA 1B44D 2VL6A 2O5RA 4XM3A 4GNXA 1AZQA 2F5FA 4AQYQ 1R36A 1PTOB 2FXQA 2F4IA 3GTJJ 2CGPA 1KNEA 2RHQB 4C3IG 1JKRC 2GA1A 3DU5A 1VF5C 1IHZA 2ZMEA 3I3LA 1OJLA 4XBFA 1PH5A 3L2RA 2UXDQ 5H6QA 3PO3G 5JOBA 1R49A 3TO6A 4B8XA 2P7VB 3JRHA 1SFXA 2UXBQ 2CUEA 3SE0A 1OYIA 5D4RA 1LPQA 3T16A 5CKTA 2JQ7A 4BXFA 3KBXA 1EFID 5IWAQ 4CDGA 2NN6G 3TZUA 4HF1A 1FL0A 3K70D 5AJ3L 2QVOA 1P7JA 1J59A 3CUQB 3FXOA 3K7UC 1HR0Q 3E5XA 2TMPA 3KF6B 2EYLA 1D0YA 2AWOA 1II3A 4XKVA 3D5RC 1XPRA 2V1UA 4LF4L 2FE3A 3SFIA 1WTQA 2P6TA 5TISC 5M5WB 5EG0B 4L5TA 3FZVA 1UG2A 4K2KA 1MBHA 1USTA 3A8KE 4XRSA 1TC3C 3AL0C 2DI3A 4IUQA 5ISRA 1RDPD 4IF4A 2PZUA 4BDZA 5I6YA 1LDJA 3J80E 3B6AA 1W36C 4HQMA 1R4PB 5GPCA 4P73A 3PO2B 2NUCA 4PK4A 1ZGWA 4DK0A 1AFPA 3KX2A 1Z3YA 2IBDA 1F9NA 3SYTA 3CCJI 1SR3A 1TY0A 3SXHA 2N49A 2RDHA 3WE3A 1XPUA 1GDTA 5FROA 2WKCA 3ND9A 1PH2A 1S3JA 2PEXA 5JEAH 2HR3A 2XDVA 1VQ7I 5DEHA 3W2AA 3AB9A 1JOQA 1ICWA 5KVRA 4BYYA 2EA4A 3ZPLA 3S2DB 2VNUD 4F52A 3V8LA 4EGZA 1VQDA 2FMLA 1QVFA 2MSYA 3HB9A 4HNVA 3K2ZA 4AYBG 4UP7A 3MXGA 2Y30A 4POFA 2Z9HA 1NE3A 1GHJA 2QGUA 3ERED 1TWFJ 3A02A 5HVQC 1SD4A 3ESWB 3BJ6A 1Y6IA 5DM63 4TRDA 3F8BA 2B29A 3ZQLA 2E5LL 4AVZA 4FP5D 2DA5A 4L5JA 3QG1A 2XNAC 3CLOA 1YITI 4LK1F 2QKMB 2EJGC 4X3KA 4R4QA 1ZELA 1EY5A 3CLQA 2LKXA 3G48A 1ON2A 2LMCB 1OISA 3I4NJ 3ZMSA 4U87A 3PIPA 4YELA 2GN5A 2EXDA 3HOZJ 1BC8C 4JOMA 2HOAA 2HVRA 4LFCL 3OIQA 1MD2D 2WC2A 3BJOA 1Z91A 1MSFC 1Z6HA 5BR8Q 3DEPA 1LFBA 3KOJA 1XSVA 3AG3H 1VZ0A 2RDPA 4LJZC 4E7ZA 4OX9L 4OGQC 5FLMH 4B3SQ 3LSHA 1NTGA 4NXNL 1BJZA 4RGTA 5IE8A 4RCNA 2KP6A 1RESA 3L1PA 1FTZA 4IEJA 2DPDA 1QVGA 3M3YB 5ICFA 5I2XA 2VOOA 5ELNA 4IX7A 2IRFG 2F3WA 1PV4A 1YVCA 1FWZA 1IN6A 1CF7B 1YEZA 1WD1A 3TREA 3AYHB 2C5CA 2I10A 2L7KA 1TKWB 4JV5Q 2A69C 5J1ZA 3PUBA 4X66L 3I4MJ 3K4CA 3J81i 3DTKA 4X0GA 3SK4A 1C9OA 1VQEA 2BY1A 4KUMA 4A3FJ 4KI0A 4G7OC 2VODA 3H5AA 2QCPX 2B39A 2EZLA 3GTKJ 5GPAA 2O8KA 2K03A 4LK0F 3SHLA 2E1CA 4YWLA 3G1OA 4QUCA 5EJWA 4A3KH 1ZYRF 3GYHX 3I7FA 1HNWL 1LNWA 1EY0A 3HPHA 5A2QE 4LK1C 3I53A 3OPOA 1PZID 5E7NA 3AU7A 1IRGA 1Q12A 2IY5B 4FO2A 2VB2X 2O7OA 3PQKA 3VEPA 1TWGJ 5HDGA 4ETSA 3K6GA 4BY7H 2FUG2 1IV8A 2VUMB 2HCCA 3KDFA 1K4TA 1B8IB 4GS3A 5M5XB 3NQOA 4C9YA 3I9V2 4N9IA 4CA0A 1Q46A 2CRGA 1I6HJ 3T8TA 2XAGA 4RGMA 2E2JB 3MKLA 4B3RL 4RWSC 1B72B 1KL9A 4V2FA 3JAMZ 4B3SL 2Q8RE 4AYBA 4NXNQ 1CFMA 2MUYA 2HZTA 2UWMA 2VT2A 3GTKH 2KEEA 2KJXA 3C1FA 1HW5A 2BE5F 4A3IB 2STTA 4FETA 5CV8A 3H3VI 2Q8IB 2X4HA 4XRMA 1NH3A 2Z9OA 3EA6A 1TL8A 4C1NI 4E7HA 2DLLA 4H02A 1PRTD 2X48A 1HRJA 1A35A 3NK9A 5ELDA 3RKQA 1VQ9I 1SVOA 3AG4H 1XMQL 4UDUC 2L9NA 1JI8A 3E6MA 4LFUA 4HAMA 3ZYYX 2BA0A 2ESHA 1I50J 1SNDA 3FK6A 1BNZA 2KZVA 1ZG1A 2XC7A 2O2LD 1RHPA 1S5CD 2XSJC 5DDGA 2QF7A 4D5FA 1NK2P 4LNQA 1DGSA 2R7TA 1FLIA 3DXJF 4M6VA 4RAYA 1O3QA 3LOCA 3QPSA 2NNNA 2BBYA 2JPBA 1DXMA 3COAC 5EPJA 3OR2C 3VPRA 2EV0A 4Y17A 5IPAA 1SMTA 2V6EA 1FYMA 2IVMA 3FDTA 5KGUA 2K7VA 3GTJH 1RL2A 5B66C 3R4KA 1U6GA 1B70B 1L0WA 4A5MA 3S2HB 1J09A 4RAZA 3F0CA 2ELHA 2HHHL 3R0JA 1VS0A 1D5ZC 1ZXTA 3URYA 3S93A 2NVTB 2HYJA 3K1MA 3GTQB 1V1OA 3CP8A 2XN9C 4G7ZF 2LY7A 2EWNA 1U3EM 2JWTA 1ZG3A 3IWFA 3CRKC 4C2MB 1ZARA 3D5LA 4F87A 3KPHA 1NMFA 2HUGA 4MNOA 3RDIA 4V2GA 4IRHA 3CC2A 2ZSIB 2B2YA 2KQRA 4I6ZA 5AIQA 3BU2A 4RM3A 1Y1WG 4IOAA 1USSA 3ULLA 2XRLA 1EQVA 2JA8B 3PUYA 1I94Q 5JR3A 3CCUA 5GTHC 1FNWA 3HKZE 3RCOA 1EOTA 1MH4A 5IP7J 1BO0A 2UU9Q 2D2WA 4EQQA 2XB0X 3HIFA 3VA7A 1IBML 5JEAJ 3DKXA 1X3GA 2V1XA 1JKOC 3S17J 1IO2A 2ZXJA 3PF4A 2V6CA 3HOUH 2VZAA 4BNCA 3I55I 2VXWA 1S72A 2YPRA 2OA4A 4HZFA 1F2ZA 2PMHA 3BYTB 3BS1A 2XGXA 2KIFA 2NB0A 3HOTA 1T95A 3M7NA 2LF8A 3RQ4A 1XTAA 2VBZA 1BKBA 2L15A 1F2MA 2EFOA 4ZDPA 3HHHA 2NVYH 2ZO4A 1STHA 1EYCA 4A3DH 1ZR2A 1YNNC 3H35A 2R7FA 5EKLA 5IYCG 2OV7A 2R7ZB 3U2RA 3KIOA 1KGSA 1OXUA 3HKSA 3FK7A 5LHY1 3KEYA 3HOSA 2F0UA 5COYA 1APLC 4I7HA 3HGYA 3K70C 1QJOA 5LMUQ 3TRZA 1OR7C 3ULQB 5F0CA 1Q1HA 4XIDA 3ONAB 5G3LF 5KAFC 2LBFB 3TO7A 3WTZA 1TT5B 5H1SE 1UJ8A 1J9IA 5CGKA 3BDDA 1K61A 2UUCQ 4ZYHA 4BBSH 1FZPB 4OIRF 5EGTA 1A6QA 4C3JJ 3ZQHA 2KZGA 2OTLA 4UVAA 4P75A 4OU0A 4MIUA 5J3LA 1U5TA 1XDSA 4E6IA 3PUZA 1EQRA 5CPRB 3A03A 5ELEA 3OSOA 4M3DA 1Q8KA 2OAZA 1RR7A 4GLAC 1D0XA 2F52A 3L7WA 3K59A 5TRDA 4BJTA 2EB7A 3UDGA 5ICCA 4DV2Q 2JTVA 4ME3A 3SK5A 4UAIA 4C3HG 3TDUC 2EYPA 3RIRA 4QIWE 4DXGA 5C0XI 1D1CA 3E6CC 3CUQC 4AVPA 2L5TA 4K6DA 3HDDA 4HCEA 2DY8A 3OTOQ 5TSSA 4LF5L 1Z67A 2KPMA 1VTNC 1KZHA 2JVGA 4UUVA 3HOWB 3S17H 2ZTDA 3BZ6A 1ZR4A 1AHDP 2LSSA 3DPUA 3CRLC 3K5OA 5LGTA 3H0GB 3ZMTA 5K5RA 4UY8I 4DZJA 5FLMJ 3RZDB 2EILH 2YTXA 2V4DA 2AXLA 2FQ4A 3IHUA 3C46A 1XMOQ 3PO2G 5HS8A 2Y0SA 1HFNA 2G7UA 4HIOA 1D7QA 4A3LH 1WJAA 1I4PA 2LVSA 4O2DA 4UHVA 2GVBA 3ZR8X 1XGNA 2HKXA 1JJGA 2L01A 3S14B 1T9HA 2Z3YA 3TDZC 1ZRFA 4R9WA 3CHBD 4AC0A 3AG1H 4RFBA 2HEOA 1W7PB 3A5UA 1X65A 3F1ZA 2Q2EB 4XIGS 1CKNB 3QIAA 2ECBA 1VQGA 3Q3SA 4AWXB 5IYBJ 4KIBA 1BA5A 4DR5L 3T1HL 4A3BG 5LL6X 2XGDA 1JOKA 4AIKA 1CZGA 2BCOA 3GTLB 3ABKH 4IUNA 4QF4A 1SANA 2VJJA 5CJ9A 3PQIA 1QCBD 1DPUA 4GO1A 2R5YB 3S2HH 2X6WA 4CXFA 1QUQB 1FNNA 3H9GA 2JRMA 1QILA 2P5KA 1SAUA 1GV2A 1P2FA 4F92B 2CWPA 3OWFA 1NR2A 2EYJA 2OPTA 2IA1A 1S5LC 2I5LX 1FOKA 3T1YQ 3QOPA 4WFN3 2KCMA 2DT5A 4NQWB 5JLXA 2R7RA 2DFIA 4MNUA 3A01A 4LUZA 2DTZA 2DMNA 2CUFA 3SEZA 4X62Q 4NBQA 1WTPA 2MW8A 2QZ8A 1PXUA 3TW7A 4P2CB 5LHGA 2Z6KC 1UHSA 1YIJI 4C2UA 4KK7A 5EDNA 2JEBI 1LB2A 2P7CB 4IZZA 1A5JA 2JA8H 4BE1A 2DJFC 3NXWA 4QUFA 2LREA 2DXIA 1S3OA 4DK1A 2UXXA 2B63J 1FOXA 4XL9A 2HGCA 5KNCA 4CHUA 3SZTA 1HKTA 1F43A 1TNSA 3VR5A 1ETQA 4NP5A 1H9TA 2CQNA 4CZCA 2F0IA 2QSFX 2M0CA 2V1CC 3NE5B 4HX7A 5I4DA 1T56A 1PH8A 1CKOA 4KKTA 4F93B 1W3SA 1TS4A 3PO3H 1YJ9A 4LITA 4IVNA 4HNTA 1D5XC 4OWWB 4ANJA 1HTPA 1KAAA 3O13A 3LGJA 3SDZA 5HOOA 3ZQGA 2JSPA 4DW6A 3QYFA 2COBA 1NK3P 4MGRA 3CMAI 1A15A 1ILQA 3X3NA 2EZHA 3PIOA 3AL0B 2KISA 3K1NA 3L3OC 3FXQA 1ZKOA 4AQYL 2ZFUA 1M4VA 4DR5Q 3RLOA 2BOSA 4IURA 5DCMB 3WTVC 3CCUI 1IXRC 5D8LB 1MMNA 3OS0A 3CU7A 3W1BA 4P9FA 2KJBA 3K7AH 1SVLA 4JP0A 2K6AA 2Q8TA 2YU9H 1EJ9A 1QZYA 3R2IA 3DQVC 2A74C 1C8CA 3U58A 2FU4A 1U5KA 4ZZLA 4BQNA 3RZOJ 1G91A 2VPRA 3H3VH 1DONA 3VWBA 3WTWC 2K5HA 2IX1A 2RREA 3T1YL 1VQLA 2K3FA 2E7WA 2LKVA 4NKLA 2HWVA 1AZPA 2KOLA 3A74A 4G7HC 1RUOA 5C4XJ 3KF8A 4J15A 2XV4S 4A3DG 3CC7A 3S2WA 4X62L 1P4XA 1S72I 3TDQA 4F7ZA 2VXDA 1X1DA 3HOVB 5GAHC 1CM9A 4AYBB 2GBYA 3M7GA 1RD9D 3HM5A 2HVQA 5HURA 3FEWX 2HDMA 1EIHA 1NG7A 1QU3A 4A3JG 2H8WA 4Z6YA 2CU7A 4ENKA 4ZH4F 4GDFA 3HSFA 1JICA 4JI5L 3KLWA 2CH0A 4R79A 4CH7A 5DYMA 4MTKA 1Z6RA 3LA7A 2NVYJ 3EN2A 2AQ3B 1VQBA 5EGOA 2UXNA 4DR2Q 4LIVA 2BH2A 3A2KA 1GJXA 2K5DA 2JPCA 3R6SA 1YJNA 2K5NA 5C44H 2TDXA 2RQQA 4KNYA 3QU6A 3CCMI 3I4PA 1OXVA 2W48A 2EY2A 1ILPA 1CK1A 2UUAL 4PFOA 1KU9A 4B4CA 3HUGA 1E3HA 1RR8C 2GA2A 3ZQ7A 2ZJRF 3J7ZC 5CQEA 1EY9A 2JYOA 1HSTA 2E2HB 3C1DA 1VQJA 2IXSA 2DA1A 1V9PA 1YHQA 1TWAB 1LDDA 5T1GA 2R7WA 2E8GA 4LB6B 2R7DA 1ZLJA 5C4JB 4BBRB 3TEHB 4M9XA 2VKEA 1MKMA 3I4LA 1K0SA 4EMSA 3M4OJ 1W7PD 2HQNA 3E9IA 1UE5A 4MZ9A 1JJ6C 4ENJA 4A3GJ 3AFPA 4XDXA 5IP6A 4RGUA 1CTMA 3BJUA 2L4NA 4KLKA 3J80L 1B1ZA 3LNNA 4LFCQ 1LE8A 2KUMA 4UP8A 1KAWA 4EQ5A 2M0MA 2VY3A 2F0QA 1FEXA 2RVCA 3J7AO 3CO7C 4PZ8A 2E1NA 3RMHA 1WRJA 3I54A 5HGTA 2I8DA 2HDCA 2MP1A 1LT4D 2HS5A 2DMUA 1JHHA 1H8AC 4RLQA 3BG3A 2J5OA 5K7FA 1O3RA 5LL6S 4BE2A 3GTMB 4IKFA 4EJTA 3HOZG 1WOCA 5L3DA 3K0XA 1V8QA 1XTCD 2MC4A 2E74C 3CMEI 1LEBA 4XN3A 3CCYA 5JVG3 1EEFD 4G4KA 2STWA 3HOYJ 2WV0A 1I6HH 2RHSB 3KP3A 1T8IA 4QMGA 4D7MA 4YEJA 3CJQB 2B2TC 2RDGA 1EY6A 3D4DA 4HYEA 5L37A 1LTAD 1PFMA 4Y7NB 3NEMA 1DP7P 3O8GA 1W36D 3NUCA 2ICIA 3ULJA 4BXXJ 2R5YA 1NTCA 4K8JA 1RJTA 2VQLA 3GTGJ 5M5WJ 3HRMA 3PUWA 3T13A 2DN0A 5LD2C 4IXAA 3WG7H 2AUKA 2I5MX 4DV5L 2B0LA 1X1BA 1BIAA 3SK8A 3BR5A 2IPKD 2X0LA 4OO1I 2B2WC 3Q9SA 1U4RA 4BGDA 3PO2J 2E35A 3S15J 1PTOH 3HOYH 4E6KG 2LKSA 5J1UA 2YR2A 3IUOA 3D4WA 4A3EG 3LSKA 3JTGA 2LBFA 1KQ0A 1TZLA 5E3MA 4DAYB 2Q0OA 2W24A 1VMPA 3H5RA 3HRUA 1BOBA 3A56A 4M74A 3CQZH 3K7AB 1TW3A 4FCYA 4EQNA 2EY6A 1A6IA 1IDZA 3ROUA 2IS1A 3N4MA 4GOPB 1HKSA 1UG0A 1VQFA 3ZRGA 3V7SA 1GVDA 4A3IG 3GUDA 5ED4A 2DO7A 3M1CA 1UEBA 1R00A 2A69F 1ZYRD 5FKNA 3SK6A 4A0XA 3K0YA 4ZQ3A 5HDKA 3ML6A 3W2DA 5CVIA 4P1WA 4CGZA 3MWYW 2XPUA 3NQTA 1VQ6I 4BA2I 1FIPA 1I50H 5CMDA 4G12A 1KONA 4BY1B 2PFBA 3SJMA 1BQQT 2B2WA 2HQ5A 3FKIB 1TTYA 2JT1A 4RLFA 1G51A 2IT0A 1HR0L 2E2JH 1KTKA 4GN5A 5HGQA 5JJZA 3X3MA 2W00A 1ENHA 4YWMA 4L0YB 2CUZA 1VQPA 4A0ZA 4A93G 1TWHB 4BBSG 1R58A 2ZC2A 3KLRA 3G6EI 4HSTA 3ABLH 3D31A 2ME0A 2EFNA 2JK8A 3CESA 1ZAOA 4WXCA 4CHTB 3S9WA 5CBAE 3D3RA 1YLFA 2EV6A 1NAPA 4DKAC 1S4ZA 3RKYA 5M3FG 1KYZA 1EY8A 1VNDA 1X1PA 1IRZA 1BR4A 4NC7A 4E7IA 1HR0W 3K4KA 4IRGA 3GMEA 4ZTFA 2F4VL 4KTAA 4WXHA 3MEXA 2H6BA 1PYWD 1TWCB 1SXTA 1HUMA 2M1BA 3NPPA 4OWXB 1H9GA 4TKOB 3BROA 4PNYA 1PVEA 4BAYA 2BE5C 3ECHA 1EQTA 4IO9F 1YW8A 3D0FA 1BUVT 2HHHQ 5EQ0A 2K9NA 2HVSA 4YCUA 4GLXA 2HFHA 3FISA 2F0OA 4LG0A 3DLLA 1REPC 2K32A 1M90C 1CQVA 3C3WA 2VI6A 2JA5H 1BOAA 3JC66 4I0BA 2NS8A 3HOXB 1DPRA 1JOOA 1ETKA 1DUXC 1D8KA 2Q2TA 2E2IH 1U4MA 1XPOA 4O42A 2DK5A 5EEAA 1B50A 1ZK8A 2E5LQ 3NWSA 1WI5A 5FLXc 4DUZQ 4CDEC 2CV0A 4B08A 1U4LA 4DYRA 1UELB 4CCJA 1XB4A 5JVH3 3PV0A 3W6KB 4Z2YA 1R9TB 4JG2A 5CVVA 3L0OA 4BU2A 2SEBD 4YCVA 2IS2A 1IL2A 4DQ2A 4YIRX 1XG1A 1RCVD 4O3MA 1U0JA 4C2MH 5DCFA 1VQLI 2EA2A 1VQOA 2M87A 5M5YJ 4N0BA 3TS0A 5DUKA 2KL4A 3CMEA 1K7AA 2V26A 4AYBN 4J19A 1K9MC 1ETYA 2E1MC 2ECCA 1ZGJA 3FMQA 3CC4A 2DFEA 2VS1A 1I6HB 1QE6A 2R7ZG 1HBXG 4PJ0C 1EH6A 4GNXC 1WTVA 2ES2A 4C2TA 1AH9A 2M3AA 4QWQA 5EJCA 4YRVA 4AIDA 1Y1VG 2QQ9A 4B9XA 2B2UA 4R4CA 3KDFB 2ZJ2A 1OKRA 4RAGA 4C3HB 4L18B 2TSSA 3S1MB 1K6YA 3EUHC 3M07A 2XRQD 1PZJD 1EIFA 3UDFA 1BDOA 1MJCA 1Z77A 3E5QA 2M45A 1X3ZB 2ZJQF 4JYAL 4D7NA 3VYSA 1XNQQ 3E6DA 5FLMG 4JV5L 1E3OC 4XRSG 1U0LA 4DNCA 4F91B 4YIJA 3BWGA 1PUEE 4HOBA 3EVQA 3WGHA 2UUCL 1CHQD 1FTTA 5C4HA 2L9VA 2ZJPF 4IPCA 2XKOA 5C0XJ 4DR1L 1K4SA 1R4QB 4C3IB 3EUHA 4C30A 4OHJA 1KYWA 2EZIA 2GXGA 4Y13A 4LMQD 2GXBA 2IJLA 1TS2A 1FC3A 3F2BA 1F1ZA 1Q3LA 3LQQA 1KDAA 2BY0A 2N88A 4L63B 2KHMA 2BXZA 2A6HC 1HLVA 4DUZL 5LEKA 2OTJI 4P55A 4ME5A 2X69A 2WADA 3J7AV 2WKDA 4GYGA 2EVBA 4M9SA 3V42A 5FKLA 1AU7A 4RA8A 4IHYA 5HODA 2V9PA 2DYSH 3BR3A 1HQRD 3E6BA 3KZZA 4JI4Q 2E34A 1X1AA 5C5MA 2PN6A 3NARA 3OTOL 1PHJA 3QPLA 4A75A 2L4AA 3OSFA 3I2ZA 4IPDA 3G4SI 2EIJH 2F0SA 3F6OA 1WJJA 3CXCA 2JQOA 2DA3A 2X1EA 1EWHA 4ZCKA 3J80c 2GQQA 1O7ZA 3DPLC 1D1KA 5FFZA 1RF2D 4KJZA 1PMRA 2HQEA 4WF2A 1FP1D 4JPBW 1Y1WH 3ICEA 1TQOA 4ILWA 4B3MQ 1GXQA 1JWMD 3TSSA 3JCUC 1L1OA 1AEXA 1K83B 2I0QA 3VYRB 4DAPA 3F6VA 4N9TA 4L9VA 1LUJB 3T56B 4HJ8A 3RZDH 4JYAQ 2KRCA 5GAEC 1XNQL 2QEJC 2KEDA 2D1HA 3OWTA 3RLNA 3S1NB 1ON1A 2I5UA 2XF7A 3DPTA 9ANTA 3MXNA 2XIWA 4LUOA 1MSEC 2K75A 4DV1L 4MFDA 4BWGB 3ZCOA 1FR3A 5GTIC 3MKYB 1CGPA 4KD4A 3I71A 4YY3L 4CKBA 3KCCA 4LF7Q 3DKWA 2CS3A 4L9NA 4M9ZA 3OYIA 3GTPB 1ZLKA 3QOLA 4ZUIA 3UR3C 1IYUA 3HSRA 1I4HA 3QQAA 2FXAA 2WTEA 1WJDA 4JK1X 5B5EC 1VQ7A 2IPQX 3LSGA 3S8PA 1IC8A 1HA5A 2MNAA 5FK9C 4MHEA 2KA7A 4L9TA 1ODDA 2GOMA 1WH7A 3ND8A 3OOCA 4Y52J 1FD7D 1I4QA 3DUZA 3P9CA 3W5OA 3W3AA 4P5OA 2X85A 4UV9A 1PLFA 5G3LD 3PQJA 1D8JA 3MXNB 2FNAA 4LG3A 5ELBA 1K78B 5FD6A 2KRFA 3IKVA 2MC3A 3DWAA 1X3EA 1XXGA 3GQBA 4A3MJ 2K9LA 2FFKB 3EIVA 1MMGA 2DMTA 5JHFA 3PNVA 3D1NI 1I94L 3VB2A 2V1NA 3T0YA 1Y1VJ 1SN8A 1N78A 1G6PA 4FF2A 4OWRB 3CCQI 2EJFC 3KLNA 2H8RA 4QLCU 1IV6A 3OY9A 1HZAA 1G3TA 5LEJA 3ZQCA 1PUFB 4AH6A 4A3JJ 3JSPA 3UNGC 2VONA 4NQWA 2R7ZH 3KZIC 3IKTA 3ZN1A 2CMPA 1MIJA 3BY6A 2P8TA 1DOMA 5IYDH 4OO1G 3H0GJ 3S1MH 4KY7A 4DV4Q 1R71A 5EYRA 4U0WA 2FNPA 4FQGA 2DW4A 4YY3Q 2BY2A 2VOPA 1SFOJ 4YWKA 2HI3A 1UE7A 4O0AA 2VXZA 2WB1B 2B2TA 2BY3A 1R4MB 3VR3A 2HU9A 1G8ZD 2NNYA 3WOEA 1QNKA 2DA6A 4KA4A 1LYLA 3G3ZA 3AQQA 4B3TQ 4OXPA 1QWYA 2F5DA 1QZGA 1W6KA 2PI2E 2BV6A 2FHTA 2XHKA 4KYWA 1LDKB 4XLCA 1HDPA 2OQ0A 4OELB 4RM2A 1LABA 4JI8Q 2LD5A 3KUPA 4PZJA 2L0CA 3CJNA 5HLIA 3CO6C 3PNYA 1YE9A 1OR7A 2IS6A 3QWLA 4DXFA 2EH3A 4NDLA 3JAMK 2DNCA 5D5UB 4X1EA 2NYZD 1V54H 4DPGA 2R92J 4JBWA 3K5LA 5BOXA 3RKWA 4CZZA 3PUVA 2PLYA 4RGSA 1B3QA 4J6HA 2IEKA 1ZH5A 2ID6A 3DTEA 2Z33A 5DM7F 1I3QH 1FIAA 2Y0SN 4F88A 1PRTF 1E17A 4G8XA 1JTYA 3ULPA 2X6YA 3HOVH 3FMRA 4X65L 3NRVA 1L0YB 4KV6A 3ZOBA 2Z8LA 2PG4A 3JSOA 3CTAA 4DK3C 2BE5D 1JUPA 1TY2A 1H9JA 1IBLL 1SYBA 1ZRCA 1WZ2A 4A3CH 1PH3A 4H4KC 4LF5Q 4OL7A 2I46A 2O4XA 4QQBX 2JA8G 5TGTA 3S14H 4HIMA 1X3QA 2EJMA 1XX5A 1HF0A 3BZDB 4ZK9B 4FF1A 1HA8A 1BI1A 4EJUA 3SXYA 5DV5A 2HNHA 3EBEA 3OYCA 1FT9A 5IOYA 2OF1A 4CCMA 3SDGA 5KIXA 1UE1A 4BL0B 2V7FA 2CW0C 3DU6A 5F1JA 1YNXA 1ACIA 1FX7A 3GTOB 4B1RA 4IJAA 2DFHA 1Y1VH 4GZYC 3PJRA 4B3AA 2E2IB 3FPPA 5C3WA 4X6AH 2B2YC 5F2DA 2KFDA 1BBYA 2P0WA 1V43A 3H36A 4XK4A 4ZDOA 1YZ6A 2I07B 4L5SA 1OTCA 1Z0XA 4KN7X 4J01A 2HT1A 2NVTJ 3J81L 3WGIA 1S8NA 4QPOA 5FJ8H 2PNHA 5ELFA 3S24A 2ZXOA 4ZKCB 2LY2A 3ZQIA 1CA5A 2E2HH 2DN8A 4CDFC 3CW2C 5BPDA 3BTCA 1HSJA 5J4YA 2UUZA 1W1WE 1EWCA 3PO3J 3RKXA 1TR5A 5LMNQ 1WSUA 1YS7A 3SGIA 2UXCL 4NHJA 1YRNA 2H6CA 3QP5A 4HMIA 4AYBE 1IBKQ 1XDUA 1JC7A 2DODA 2WAEA 4DA2A 2EZVA 4IUUA 2IA2A 4PSWA 1RIOH 3K69A 5K7HA 5CYVA 4OIQF 1W7PA 3B73A 1ZRDA 1ZQ3P 1A2UA 4FTHA 2OTJA 2XAHA 2NVTH 4HCSA 1TW2A 4PUSA 1X58A 1IKLA 4HIKA 1WTOA 1Z7UA 4KISA 3A1YA 4G6DA 1KLGD 2QBYA 5M3FB 3HKZN 2CQAA 1FJLA 2LNBA 2WV6D 1SMYC 1B1BA 5EG0A 3MFKA 3TGNA 2F5VA 1KDBA 5BPIA 1SYFA 4IFDH 3SEQA 5L3EA 1Z3XA 4OIJA 1RKTA 4JI6Q 4H13C 3JR9A 4LUVA 1JGSA 2RKSA 4DV5Q 3I3CA 4HNUA 3HFZB 4I65A 1SLJA 5I2YA 2MGSA 3SR1A 3I4NB 1ZTRA 4HJ9A 4BXXG 2CQQA 2QENA 3O2PE 2CQOA 1PDQA 2FD5A 3TMOA 1DU6A 3P1HA 2E2DC 3NBHA 1HCRA 2A6HD 3R8BA 3HBLA 3ZQQA 3OHXC 1N34Q 5D6EA 1JWSD 2RV8A 2J0TD 3OW2A 1SE2A 3GD7A 2BA1A 5GADC 3GO5A 3GP7A 1GUUA 3I55A 2VL8A 2DY7A 4FX4A 1OYWA 2QQ8A 3B02A 4C3JB 3K8AA 1S5DD 4L5EA 2DK8A 4QIWB 3DP7A 4XMYA 3QB3A 5D5VB 3J81K 3L9FA 2E1MB 1PFNA 2A19A 4JOIC 5K1YA 5LMNL 2HKOA 4NDXA 4ESFA 2RCFA 4K5WA 2HDDA 3FRPB 2PW7A 4UXNA 4QIWN 1UMQA 3TP5A 5FKKA 3BG9A 1N32L 1GHCA 3R0AA 3MXPA 2R7SA 2AXTC 4BBRJ 2DA4A 4A3FB 5M9OA 2KVMA 3BR2A 2FEZA 2L54A 2H5XA 2KCNA 1PUFA 3NELA 4WJ3M 5FO7B 2RGVA 3MXUA 3F3XA 2IX3A 2K05A 3RNUA 1MJBA 4WXDA 4K2LA 2HIXA 3I58A 4DZPA 3G73A 1HXYD 2LLKA 2ZM6L 4IHWA 4KJOA 4XLPF 3Q9VA 1DQUA 1DOLA 1I3QB 1XGOA 3LA3A 1QA6A 4OOIA 2QKIC 3U4VA 1WGXA 2NVQB 2VQFL 4WK8F 4OMZA 1WCMB 3W2WA 2CW0F 4P72A 3HGGA 2P5VA 1SE3A 5JPNC 5JFRA 1TVXA 4FXKC 1Y8PB 2KHIA 3SZPA 2N55A 3JRFA 3QPHA 2K4JA 2R93G 2ZFWA 1WI3A 1A3UA 1WKMA 2NS0A 1XMAA 4CBVA 2HIVA 5FGMA 3JAML 4M1UB 3DWQA 2JMWA 2ZXIA 4BQQA 4KT6A 4EVIA 2IS4A 2WAQG 3F9KA 4EVOA 3CD6I 4OONA 3CZ6A 3U21A 2LYCA 1MMSA 2K14A 1MMDA 2MLKA 1L0OC 2E75C 1TWFH 1FBSA 3GV6A 2IL8A 3E7LA 4O6JA 1Q90A 5IGGA 3MVVA 4BEHB 2ZMEC 1NR4A 1SFUA 2QGQA 1DDNA 2LOOA 4GN3B 2NWGA 3BG7A 1EF4A 1MJEA 2XKPA 3RJPA 3BZKA 1O4XA 1SNQA 4U673 5LBQA 1MNEA 2MBFA 4BHCA 1ZG5A 4IL6C 2K02A 3TL4X 1STNA 2IAIA 4C56C 3ABMH 2OUMA 3L2QA 2HOSA 1BM9A 2E36A 1Y0NA 1LTGD 5IWAL 3BG5A 5BMZA 5JJIA 1CSPA 3H6MA 2L02A 3FMCA 2ISYA 4RAFA 4XRFA 2E71A 2F3VA 2VKDA 1E1OA 4JW0A 2KCCA 3KBGA 2ADUA 4EEFG 2F0PA 5IT9Z 4LF4Q 1XS9A 1QHGA 5B1AH 4G9YA 3JREA 2ZM6Q 3ZMZA 3Q23A 2BW3A 3QJYA 2PQAA 3A4CA 2JN4A 1SJHD 3KLSX 4FDBA 4NW2A 1TLHB 2Y0SE 3OYAA 3QOJA 4KKSA 5L3FA 5C3EH 1OCPA 1F2LA 4I7ZC 3S15H 2WA0A 3BLYA 1KHIA 4RB1A 3EROA 3JRBA 5LMNW 2M5WA 3KYDB 2QLZA
chains in the Genus database with same CATH topology
4F55A 3K4NA 2C9OA 2AQ3B 3S17B 2F0FA 2K9MA 3C2HA 1BR9A 1LT6D 3NHHA 5CV9A 1PRTB 2F0GA 2RA4A 5BN3A 2WAFA 1A3VA 4LIVA 3BC8A 1UEAB 3TP7A 4M8AA 3HOYB 2SDFA 2KRHA 2WAQA 4HAEA 3A2KA 1GJXA 1K8OA 2XRSD 2K5DA 4Z9CB 3P7JA 3IAS2 1T5XD 1Y1VB 3H94A 4O1NA 2R92B 2RQQA 1LACA 3VYRA 3PL8A 2HCIA 5I9PA 2WIIB 4XR6A 2A73B 4XKBA 5IOCA 3NQIA 3VR2A 5I9OA 5FRNA 1FGBD 4ZC3A 1OXVA 2ID0A 2L9HA 4XKWA 4RGNA 2EYMA 5D14A 3OL3A 3VYUA 4ULLA 2EY2A 1ILPA 2IGMA 1CK1A 1PFBA 5EPKA 4PFOA 4XT3B 2A5HA 3VR4A 3VYTB 2PYKA 3EJIA 4H7BA 1DOKA 5JPMC 1STYA 5CQEA 1EY9A 2JYOA 5HNHA 2PW5A 4LIUA 2O5JC 2Z2SB 1QOHA 1BXTA 2JXMB 2E2HB 2XAUA 2IXSA 2UV1A 1D0ZA 1TWAB 2F6CA 4V0BA 5T1GA 2WY7Q 2R7WA 2VASA 1EYDA 1CZWA 2B8FA 2JA5B 3CMMA 1N75A 3BDOA 5C4JB 4BBRB 3H91A 4F7XA 5KNDA 3OMCA 3JAME 1YX3A 3I4LA 5E3FA 5K5PA 1G8XA 2OC6A 1BCPF 1GUGA 1LTTD 3PIO3 4XDXA 1SYGA 1STEA 1V1PA 3A54A 1CTMA 2K1BA 2B63B 3NTHA 2L4NA 4G6TB 3J80L 3LL7A 4JQFA 1B1ZA 3LNNA 1LTRD 4RGOS 3QO2A 5A2QL 3VYSB 1VCIA 2KUMA 4LAAA 3Q6SA 1HCZA 2M0MA 3PSIA 4ZAIA 1I4GA 1PJRA 2F0QA 4N9PA 1F2YA 4A93B 2WAQB 1DGRM 2XF5A 3RMHA 4HN7A 3HS0C 5HGTA 2I8DA 2MP1A 4KD3A 3HKZB 1LT4D 5IT9E 3M4YA 3G2BA 2CVRA 3FBNB 4II3A 4RLQA 4RHSA 3BG3A 3EUKL 4HPQA 5LL6S 3I4MB 4BE2A 3HGBA 1GUWA 3GTMB 4IKFA 3T51B 1PTOF 3BYYB 2HQAA 1GHKA 4S3SA 5KNLA 1V8QA 1XTCD 2MC4A 4B44A 3PSFA 2E74C 3ZGKA 3IL8A 2K28A 3R2TA 2BVLA 2R7VA 1D1BA 4XN3A 3J7YW 2YYZA 2W4SA 1XX8A 1BCPB 5JVG3 1EEFD 4G4KA 4CCLA 2IT1A 4IZ8A 1QB5D 3FKJA 4IN3A 3D6WA 4F8MA 2F0EA 5K36H 4XOPA 2HZDA 2PMZA 1HQMC 4QMGA 5BN5A 4A3BB 4YEJA 3CJQB 2OXPA 2B2TC 2RDGA 4A3DB 5KNBA 1EY6A 5AFWA 2Y0SB 4QPQA 3D4DA 4K14A 1LTAD 4QB4A 4BE0A 1PFMA 4Y7NB 3K57A 2B2VA 5KCMA 3WDNA 2JA6B 1W36D 3NUCA 2F0KA 2ICIA 1GXDC 2BVMA 3E1SA 3EUAA 2CUJA 4N4NB 4K8JA 1Y1WB 2KQ3A 1RJTA 3LSMA 2VQLA 4E7JA 4E7KA 3HP3A 3A7AB 2LRDA 3PUWA 3T13A 5LD2C 5D3IB 2A68C 4FNFA 5CC4A 2AUKA 2Z1CA 3S32A 1GOZA 2Z16A 3VR6A 3M8JA 1DCZA 4KN4C 4XOTA 2Z4IA 2EXZA 1E2ZA 1X1BA 4XLFA 1TT0A 3SK8A 3E0JA 2GOXB 2IPKD 1WJ5A 3S16B 3WOFA 1LT5D 2LY1A 5CYUA 4OO1I 2B2WC 2D9UA 1SFKA 1U4RA 3S1RB 4BGDA 1TWFB 1KNAA 1PTOH 3Q0AA 4E6KG 1HPCA 1Q1EA 3I90A 2R93B 2R7XA 4NC8A 3E5SA 5CV6A 1ENCA 4DNRB 3IUOA 1V5GA 2NVXB 1XWEA 3D4WA 3LSKA 4PMBA 5KRUA 4OAYA 3L7ZC 4DOZA 5C44B 1PRTC 4EGVA 4XN0A 2M7AA 2LBFA 4XQQA 3DM1A 1C48A 1TZLA 3HXLA 1FMVA 4Y3OA 1VMPA 1MSHA 5T1IA 5C5LA 3K6OA 1Z7TA 2K5WA 3H5RA 4PJLA 4XNFA 2PJRB 1BOBA 3A56A 4HEDA 4XTCS 3K7AB 4QCLA 4EQNA 1IKMA 2EY6A 4DGZA 3IAYA 1SEBD 2IS1A 1G6ZA 1SMYD 1IW7C 2M00A 1WD0A 1UG0A 2RNGA 3ZRGA 4PMWA 2JA2A 2ELJA 4HEA2 4KN7C 3M1CA 1ONLA 1SJED 3C1EA 1ZYRD 3SK6A 3HG9A 1GUSA 3I70A 3K0YA 3MTSA 4BJ5C 4X3SA 4ZQ3A 1E2VA 2R6GA 3TBIB 3W2DA 5BN4A 4G57A 4P1WA 4NMZA 3AKZA 3MWYW 5IGEA 4E7SA 1PTOD 3NQTA 1EYAA 2L1BA 1A2TA 1LV9A 4BA2I 5C6AA 4HRIA 1X3PA 4DNTB 4DU9A 3TN2A 1NCVA 5CMDA 2W7NA 1KONA 1MBYA 1X19A 3NTIA 1QHHD 4BY1B 1G291 2B2WA 1BQQT 1SYCA 1KLUD 2QILA 3FKIB 3PUXA 5D65A 2F0DA 2NZ1D 1B2TA 4RLFA 4ZTJA 2MFZA 1MI2A 5DAUA 2ICEC 3V05A 2VPLA 3MZ5A 1UAAA 1TT2A 1KTKA 2OT2A 4CKCA 1EY7A 4D1QA 5JJZA 5C3EB 3X3MA 1SAPA 2MHVA 1WJEA 2W00A 3KYLA 3S3NA 3ZXSA 3FPUB 3RLFA 2CUZA 3H09A 4IQZA 4FYDA 1TWHB 1MSGA 3K4BA 1GUNA 3LX0A 4H0LC 4KKUA 4HG2A 3KLRA 1BF4A 2NTSA 2NBFA 4HSTA 5KEEA 3OYJA 2R3ZA 4BA1I 3D31A 1U4PA 1V1PB 2BDOA 3MMYB 5JEAG 4IFDG 4BDYA 4EQOA 2JSOA 3D6CA 1S9HA 3OMYA 2DNEA 3CESA 1I6VC 3AMUA 2LFNA 2AUJD 4CHTB 3S9WA 5CBAE 3D3RA 2W1OA 1NAPA 1SNPA 1S4ZA 1DZ1A 1EY8A 3OW7A 1WJCA 3DKYA 1V5EA 3VSLA 1ZEQX 3EPZA 3OYBA 3IFDA 4KITB 2KMUA 1NSNS 3E6ZX 1BR4A 1SSOA 4NC7A 4E7IA 3CJRB 3K4KA 4ZTFA 3VYUB 4KTAA 2A6EC 4HTHA 3TP6A 1JORA 1A6XA 1PYWD 1TWCB 1SXTA 5C0XG 4ZKBB 1HUMA 1VMCA 3NPPA 4PQXA 5EBCA 4TKOB 4XQJA 4ABNA 5M3MB 2SNMA 4PNYA 2BE5C 3DLAA 1EQTA 3HPGA 1CQFA 4A3KB 4PJJA 4IQ4A 3OL4A 3MD2A 2WB1A 3A8JE 1BUVT 1E0EA 5EQ0A 3UI2A 1S5BD 2HVSA 3N52A 1BCPC 4B47A 2L9SA 5HLTA 5C4ZA 5E4XA 2F0OA 1B44D 2O5RA 2K32A 1H9MA 4XM3A 2PMZB 1CQVA 2AQ1B 1AZQA 3BVMA 4F3QA 1PTOB 2F4IA 1GLNA 4IUTA 1L0XB 2MPMA 3HOXB 1KNEA 1JOOA 4C3IG 3G6JB 2Z4HA 3DU5A 1VF5C 3H3VC 1IHZA 4HSRA 1V5FA 3DXJC 3DWPA 1U4MA 4C1NK 1BR2A 3I3LA 3DEEA 1YNND 1MMAA 3L2RA 4O42A 4A3EB 1B50A 5JOBA 4BQOA 2VLAA 3FHNA 2A5WA 3NWSA 5C4XB 2CV0A 4B08A 3SE0A 1U4LA 3V96A 2EYOA 3T16A 1UELB 5CKTA 4CCJA 5JVH3 4DFAA 3PFYA 3PV0A 4BXFA 3KBXA 2DT7B 1EFID 1R9TB 2L2OA 4J1MA 2NN6G 3TZUA 2JEAI 2K01A 1STAA 3K70D 1LTBD 4BU2A 5ELCA 2SEBD 1SNMA 2Z1DA 2IS2A 1FNUA 3DEOA 1H9RA 4DJAA 1RCVD 2SOBA 1U0JA 2PQEA 2XWJB 2R61A 2B2VC 1WTRA 2TMPA 4NNJA 3OYEA 2EYLA 3MFYA 1D0YA 2FMMA 2AWOA 1EZ6A 1II3A 4XKVA 3D5RC 4ZJZA 1HFGA 3L2UA 1W6JA 2F0VA 2KL4A 3S3MA 2R7OA 1WTQA 2V26A 3OS2A 3K5MA 1Z47A 1G2TA 4G7ZC 5M5WB 2E1MC 4K2KA 1BBXC 3A8KE 3FDYA 3L9AX 1CHPD 3AL0C 4BJ6C 4KY6A 3R93A 5EPLA 1I50B 1TWGB 3HEJA 4IUQA 5ISRA 2RVLA 3D5SC 1RDPD 1OO9B 2PZUA 1I6HB 4OIKA 1QE6A 3K10A 3K5NA 4BDZA 5I6YA 3J80E 1SE4A 1W36C 5FOBB 1WTVA 1R4PB 3VA5A 2VIXA 2HPIA 3DTIA 4C2TA 3PO2B 2M3AA 2NUCA 4YRVA 4PK4A 1JQYD 4DK0A 1AFPA 4B9XA 3KX2A 4WRDA 3MKZA 2A68D 1B3AA 4XLAA 2B2UA 1Z3YA 3SYTA 1TY0A 1XYIA 3QOEA 3SXHA 2RDHA 2VJIA 4PSXA 2WINB 5FROA 4C3HB 1PYVA 2R7QA 2WKCA 2TSSA 3ND9A 3S1MB 1DJRD 4B9WA 1K6YA 3DHQA 3EUHC 2KECA 5JEAH 2XRQD 1WFXA 1PZJD 3HRZC 1BDOA 2FJ2A 2XDVA 5J22A 1QNUA 5DEHA 3W2AA 1TU2B 3AB9A 1ICWA 2EPBA 1JOQA 3VYSA 4V190 4XONA 3J7AY 2EYFA 3OYGA 2E5NA