3HG9A

Crystal structure of putative pilm protein from pseudomonas aeruginosa 2192
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
119
structure length
119
Chain Sequence
LAEVDTLARSLLLYRSRLAEYAHANPGFSGSPADSALGLPAWFRKPVRLQGYIAAGTSYAFIASPPAGLAAAVDTGTESDLVGVRRNGQLVTRRLGATAIALPAPIPEGAVVAVKEGHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords PilM
publication title CRYSTAL STRUCTURE OF putative pilM protein from Pseudomonas aeruginosa 2192
rcsb
source organism Pseudomonas aeruginosa
total genus 16
structure length 119
sequence length 119
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-05-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1170 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3hg9A01
2.40.50.380 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3hg9A02
3HG9A
chains in the Genus database with same CATH superfamily
1GUNA 1IW7F 1MSHA 1E3PA 4MIUA 3Q0VA 5BN4A 4IALA 4M71A 2DJFC 1O3SA 4OWRB 1F2ZA 1D0ZA 2P5KA 1JQYD 3OYDA 2KA7A 3H36A 5J1RA 4XRSG 4NUBA 3ULPA 3CF5F 3H5RA 2XAQA 1QBJA 3CCSI 5BR8L 3S1QH 1SFOJ 4MIMA 4NXNL 2YX7A 3SK6A 4M9XA 3NQTA 2J5OA 3DEPA 4LG3A 2MLGA 2IGOA 2NOGA 2LXJA 2PZTA 1XGMA 5M5YH 3KF8A 4PFPA 4M72A 1JJ2A 3HKZN 2XAFA 5J1UA 3PO2B 4CUGA 2Y48A 2RVLA 1KYWA 3HZJA 5DAUA 2N8GA 1S7EA 3CDHA 3DP7A 4GKKL 2R61A 1DD2A 2E2IB 3OYHA 1LFUP 4RM3A 3CC7A 1II3A 3ZQ7A 1N32Q 3ND9A 4ZK9B 4Q47A 3F6OA 1DU0A 3K2ZA 3M1EA 1LQ1A 4DXGA 1D5YA 2VNUD 1BJAA 3RPUD 3DTIA 3OIOA 4U87A 4PMWA 4IO9F 4ABZA 1CUKA 3DPTA 1AH9A 1O3RA 3RR5A 4FF3A 3D0SA 3A5UA 2R93H 4II2A 2PMZE 3UI2A 1G6ZA 5FO9B 4A3DG 1R5ID 2M3AA 3E3XA 2X6GA 5C5LA 3HOWG 3BCAA 3WGHA 2FRHA 5ELNA 3T13A 4L0ZB 5ILUA 2Z99A 2XC7A 4PDKA 1BM9A 4A5NA 3CCRA 2VKEA 1TT2A 2ZXWH 2VJ4A 5E1FA 4BDYA 4HAEA 1MDMB 1FD7D 3FMRA 1R4NB 1LYLA 4X66Q 2CQXA 4KKTA 1SEUA 4XLEA 2Y0SA 3G6EA 2HWVA 3SDGA 4JW0A 1YIJA 4I02A 3U50C 1X54A 1SYCA 3QAHA 3TEDA 1Q86C 3OSOA 3J80K 2OPTA 5F1RA 2BOSA 1ASYA 4GOPA 3F72A 3S2DJ 2CQNA 2XGTA 3BR3A 4GN4B 1OKRA 3VYTB 1H9RA 3ZJYC 2Z6BA 4XKCA 2KHJA 2QUFA 2EY6A 2BVLA 3OYJA 4Y4RA 1ZH5A 1Z91A 4I01A 3S3MA 2O0YA 4HCSA 2L0CA 2HOAA 1K0SA 2A69D 3HB9A 5F27A 2R92G 3KP6A 3ND8A 2WY8Q 5JR3A 1S3JA 1QVTA 4CBVA 3PNTA 4S05A 2H09A 5EG0B 1EL0A 3HRTA 4A3EH 3TN2A 1B2TA 3T1HL 2VBYA 1IBLQ 1DCZA 1PTOH 3RTRA 4DZJA 2JVHA 3P9KA 1R71A 2HCIA 5K36G 1TTYA 3OS0A 3BYTB 1QPIA 2ICIA 4UHTA 1LTTD 1XGSA 1HXDA 3FIWA 1AHDP 4ULLA 3K5OA 2Y0SN 1H8AC 2HIVA 1JE4A 1O78A 2A6TA 2B2UA 5IT9Z 1HOMA 5TGTA 3ULLA 3A02A 3OWTA 3JAMc 3RZDH 4V190 4HF2A 1SLJA 4A3LH 1HNXQ 4UVAA 3I73A 3QPTA 1QG7A 1UE1A 3ULJA 4JI2Q 2X48A 2EYMA 3JTHA 2HYGD 4A3EJ 1TQOA 2CMPA 4B3AA 2HDMA 2AQEA 1R49A 2KL4A 2F5DA 2QEXA 5E3NA 3ICEA 1A2TA 3T8RA 4JP0A 4HJ7A 5H20A 3H9GA 1KU3A 2OV7A 3BT9A 1CF7B 1PXUA 2LSOA 2JUGA 4BXUA 4HEA2 3G1LA 2M8GX 4EQPA 2HEOA 3CP8A 2A61A 5FFXA 2K28A 1FJGL 3DKXA 1HRJA 5IYCG 1BKBA 2ID3A 3RDIA 2V9PA 1LFBA 3RZDJ 4A3LJ 2IRFG 4IOAF 2R7DA 2GQQA 3ABLH 3D31A 2BGCA 2L01A 1TL8A 3F6VA 5LBQA 1A15A 5E3MA 1V8QA 3BJ6A 1F2YA 3V2TA 4JI1L 4L9JA 1EYGA 3D8GA 2DA4A 4XRSA 1E0BA 3CUOA 4IN3A 2MQHA 2FOWA 4GLVB 5FJ8J 2BY0A 2DN0A 1FYCA 3F1ZA 4LIVA 5FKOA 2YTVA 4E6IA 3ZQHA 4S0HB 1HR0W 4EJOA 1YOVB 4A69C 5IYDH 3CHBD 4KIGA 3PSIA 4OHJA 2H8RA 4JV5L 1V1PA 4I7AA 1DQUA 4R8IA 2DLLA 1FOKA 2HD3A 1I1SA 4RGXA 4K8JA 3UDFA 4HDUA 3I8ZA 5JLXA 2LY2A 2E1MB 1ZEQX 1LDKB 4UV9A 4DQ2A 2UXCL 3GFLA 1QOHA 1V1OA 1YS7A 4RLFA 2LR8A 1O4XA 4A0YA 1N9WA 4A3MJ 3GZNB 4XLPF 3EIVA 2E7XA 3IL8A 2EPFA 1I94Q 4AIKA 4X6AJ 4DYCA 4F55A 3COAC 4R8NA 3I70A 2ELHA 3FP9A 4AYBG 2OWOA 2B2TC 5J1YA 1T6SA 5IYDJ 1WGXA 2K5WA 4BNCA 3BQZA 2V26A 1B50A 3K57A 1BI3A 1GHJA 1FNVA 4G7OC 2NN6G 1X65A 3CC4I 3ZMDA 3H92A 2JQ7A 2HVSA 3J7A5 2Z1DA 3MZHA 5JHUA 1HQRD 5D5WB 3D5LA 3F3XA 1QILA 1X3FA 4L5JA 3JAMi 1PYVA 1Z3XA 1U4RA 1XC5A 2KISA 4KMUX 1WVRA 3S1MB 1PH6A 3D6CA 3LSTA 5HDNA 4LFAL 4OOIA 3HJEA 3QPSA 2MGQA 3CC7I 4DAYB 1K8OA 3T56B 3AMUA 1Z1DA 3OYLA 5EQ0A 4ZAIA 2JT1A 3W1BA 1FYKA 3CDLA 2K5NA 5FLXZ 2PQAB 1U2WA 4FCYA 4DR3L 1O7LA 2HYFA 1RUOA 3SGIA 4LITA 3IP4B 3MZ8A 4MTDA 3GTMB 4OIPF 4U0VA 4L5TA 2OZUA 2RHQB 1VQ8I 4MFDA 2JYOA 3H3VI 1W36C 2Y30A 5ICFA 2QCPX 1XTAA 1I6XA 3A4CA 1EQRA 2HKXA 3EETA 1I6VC 4FT8A 2K1BA 3LOCA 5A2QK 3OYEA 3BVGA 4DU9A 3BR2A 2UUAQ 1ZARA 2ELJA 1IXRA 4HIDA 5DM6F 2D1VA 2F0EA 2F4OB 4DK0A 2UXXA 2DYSH 1EU3A 4E4HA 2SNSA 3ZQIA 4K6LA 3TP7A 1S3OA 1EQTA 2PMZA 2DK8A 4FQGA 3I55A 3G6EI 3FVQA 1W7PA 3HOZG 1YIJI 2RF4A 1YITA 2K5CA 1B70B 4YFXF 5E18F 3SEZA 1SAPA 3H5AA 1LUZA 2JA5J 1X2NA 1S8NA 1X1DA 1HCRA 4CO8A 5M5WB 1J5EQ 4DV2L 1WD1A 3PO3H 1ZYRC 4DR2L 1E2VA 4KD3A 2XAGA 2ZFWA 3LMMA 3TEHB 4ODGA 4FX4A 3MXNA 1NNXA 3CD6I 2L4AA 2SEBD 1QO0D 2NBFA 5HLHA 5C3EB 1IC8A 3U58A 3NUCA 2HOSA 1STHA 5M3FH 1Z9FA 3HGYA 2CWAA 4L5IA 5LEKA 3ZGKA 2K02A 4E70A 3OHXC 1WJCA 2A19A 4FISA 4QUFA 2JEBI 1ZKOA 4R1JA 2GXGA 1LNWA 4JI5Q 3SEQA 1NCVA 2WB1E 2CQQA 4H13C 3DWPA 3KYDB 4RGMA 5C44G 1Q90A 1JE5A 5A2QL 2YV5A 3M3YB 1K61A 4AIHA 5E4WC 4HIKA 1LFPA 2PMZN 4BY7B 1N25A 1TR5A 3H0DA 3GTOH 1FTTA 1I50H 3TDZC 4MTNA 2DW4A 1OYYA 3I4NB 1KLUD 2R7RA 4B8XA 3CJRB 5EGOB 5LL6S 1VQ9I 2HXOA 3VODA 1FBQA 2VXDA 3GUDA 3H9JA 1XB4A 5GAGJ 1RUNA 2QEXI 4KTAA 4GFBA 2KQ3A 3R3OA 1Y8QB 2WKCA 4DV1L 1SMYC 2HDLA 4MQ9F 3KEQA 2DOFA 3K70C 3KF6A 3FPUB 3DTEA 1IXCA 3QJYA 4NDXA 4A3KG 5EPLA 3GTLJ 4KJOA 3P20A 4JI3Q 3V4GA 4JOIC 3VYUB 5CR3A 2K5DA 1EF4A 2RSOA 2L5QA 4IUUA 2QYOA 4NC8A 3OYIA 4I7HA 2D0OA 1JJCB 4RHRA 3HPGA 3K0LA 3G71I 4J19A 5T1IA 2VC0A 2KLOA 3K1PA 2FE3A 5LGNA 1IUYA 5J8FA 2UXBQ 1F43A 4LFUA 2WB1G 5J4YA 4XLNF 3ABMH 1SFEA 4IVNA 4DUYL 2F3IA 2VASA 2XPUA 4R9WA 1E2WA 5E7NA 2QEJC 1AFPA 3S15B 2ZXHA 2CUJA 3SHFA 2KCMA 3IAYA 1WSUA 2JA7H 1I3QH 3RJPA 3NEMA 4RGTA 3WGGA 3K80C 3FBNB 3HOVJ 1XXGA 3G73A 2E19A 3Q8DA 1Q46A 2XGCA 5HS7A 2BEOA 4A3JH 1HA8A 5K7HA 1R1UA 2P4WA 3TQNA 4ESBA 4C3JG 1MBKA 5E3FA 1ZHFA 2XB5A 1CA5A 1FMVA 4FE4A 2ZJPF 1DP3A 1FC3A 3VFZA 1BIBA 3OR2C 4ZUIA 4B3SL 2F0UA 4YWKA 4ZQ3A 3A54A 2JA7J 4HJ9A 4BY1H 2PCFB 5L3DA 3WTYC 3SDBA 2E2JB 3E6BA 3K4NA 3I2ZA 1D5ZC 3RD4A 5DYMA 4PV1C 1X3QA 1D3YA 3BY6A 4AYBN 2OTLA 4HRIA 3S16J 2L9NA 1D6EC 1GUTA 1ICFB 1K3BC 3KZZA 2WINB 2W7NA 1N77A 2OC6A 5GTIC 1CHQD 5FFZA 4LF8L 4G7OF 3GVAA 3RLNA 3OYBA 4KY6A 5IGDA 1AE3A 1VS0A 4D7MA 2LP0A 4GKJL 2OAZA 1PYBA 3KBGA 2E71A 3RIRA 2H4OA 4BY1J 1E3HA 3G1OA 3L2RA 1U5TB 1MBHA 2EXDA 3H3VH 4QCLA 3EQLC 4C3IH 1PFBA 3DU6A 1RR7A 2NVXH 2R5YA 5C3WA 1NAPA 2E2HJ 1JUPA 5CV5A 3E5QA 5CV6A 1OR7A 1XS9A 1UMQA 4B47A 3BR0A 1A63A 2R6GA 3HGBA 3J81K 4WWCA 2STTA 2HTSA 1TWCJ 1E3OC 5F6FA 3ZQQA 1O80A 4OEMB 4PJNA 4YWMA 3CUQA 4DNCA 1SYFA 2VY3A 3I4OA 3B73A 4IQ4A 3S1RB 1XCVA 2MHVA 2PBIA 3L3OC 1VQKA 5E17F 3K5LA 5GP9A 3I55I 5FROA 2EYJA 1JOOA 2IHEA 2JJ7A 4FF1A 1YITI 1FJLA 2GAUA 3WU2C 2MUYA 2EYPA 3BC8A 1K0RA 5JEAH 1FBUA 1LDDA 4CDGA 2I5LX 2AQFA 1I6HH 4JI6Q 3M4OB 4KHPL 1PRTC 2M87A 2YSRA 3W2VA 3K6GA 3T4AC 4YEJA 4A3IB 2W1OA 1RI7A 3K4MA 1CM9A 1V4RA 4QB4A 4WCGA 5D3IB 5IYBH 3CLQA 1C7YA 3W2DA 1LACA 2JXMB 2XPWA 2E5LQ 3A03A 1R4MB 3M9BA 3Q9VA 1VTNC 1CKNA 4ILWA 1ZYRF 2NNNA 2R7VA 1N78A 2IXSA 2VOOA 3J81L 1ZAOA 3GEZA 3CCYA 4ME3A 4IZ8A 3JRFA 2JA8G 1GXPA 4JBKA 1I6HJ 1IKMA 5CQEA 1X58A 4GLAC 2HQ5A 1LE8A 4DR1L 2J4XA 4LF7L 1TWGB 1HCZA 1EY5A 5G3LD 3OTOQ 2MABA 4RB0A 4TV7A 3IWZA 1RHPA 2Z5UA 4P71A 3ZYYX 4MTKA 1R5GA 3M4YA 2WB1A 3G4SI 3K4LA 2FEZA 3PO2H 2CO5A 4NNJA 1PUEE 1CKMA 4K5XA 3HOUG 4LF4L 4O6JA 3PL8A 3PIP3 2WIIB 3S14H 2R7ZH 2HYJA 4M73A 2JTVA 4I09A 4BBRG 4E7LA 4HNUA 3FRPB 1RKTA 2CU7A 3CQZJ 4RB3C 2FD5A 4P74A 1SMTA 3Q6SA 3TKYA 4UNOA 5GAHC 2LRDA 2H5XA 1YW9A 2IPQX 1OCRH 1VMPA 2ZMEB 1A0IA 4XYOA 1WWXA 1TWAJ 2DQLA 1W1WE 3FKIG 2NVQH 5K5OA 2ZXPA 1SMYF 1ET6A 1HZCA 1TC3C 1QVGA 1MH4A 1UG2A 3F21A 1VQNI 3CDIA 1DU6A 3FM5A 1WCMB 3S14J 1TQIA 1ETQA 1YHBA 4XRMA 5F1JA 2TSSA 3BZDB 1SNOA 2A6HC 1GUWA 4G6DA 5M5XJ 5BPDA 4KV6A 2P5ZX 2QLZA 4A3GG 2FQ4A 1KXLA 2ZKZA 1JT0A 2Z6KA 3TS0A 1O7FA 2G7UA 4GYIA 5LHY1 1UG0A 2HVQA 4G8XA 2ESHA 3KZIC 5HNFA 1ULYA 1QUQA 5GAGC 2WB1N 2QW7A 4HLXA 5ELFA 3HOXB 3W6JB 2KRFA 4AIDA 2G9DA 1CQFA 1G8XA 1JHHA 2IAIA 2JA6G 1LDJA 3K8AA 1EUJA 1YNNC 3JRIA 1PYWD 1Q1HA 3LQRA 3MC0B 2QSFX 1OXSC 4S04A 2V79A 1LKXA 1NSNS 3OPOA 1FYMA 4RGUA 1AZQA 3F0CA 1RODA 2EZKA 2F5FA 1JR0D 3K0YA 3FXOA 1UNSA 3JAME 4XQQA 3KCCA 3Q9SA 1T39A 1FOYA 1DUXC 4A3DH 2EFQA 2RNGA 3MFGA 1HSJA 5FO7B 2GVAA 4AVPA 2D5VA 3ERED 3TBIA 2M9HA 3RNUA 2DNEA 3WG9A 1HTPA 3HRZC 1GHKA 3LQQA 2AUKA 1WH5A 3HZXA 2IS6A 1QQIA 4Y17A 2ZTCA 3RN2A 1UAPA 2JRMA 2OTLI 5FKAC 2DNCA 1K4TA 2L1BA 3FF5A 1USTA 2LVSA 2XAHA 1AA7A 2XV4S 2AUJD 2EQSA 5BOXA 4HX4A 2M00A 4UVBA 5KHDA 3TOBA 2Z16A 2HI3A 2NVTJ 4A3DJ 3R8BA 2EB7A 3VR5A 3JRCA 1U0JA 2CCZA 3HOWJ 1G3TA 4ZTFA 2XF7A 2WFWA 4A76A 3GTGB 4C3HB 5ELCA 1A6QA 2FBIA 3K70D 1LLRD 3WG7H 3I56I 1BC7C 3GTKB 1VQMI 4IPGA 4ENNA 4A0ZA 4XMYA 1T33A 3K7AJ 2XASA 5TISC 4DOZA 1TW2A 5M3MG 4LF6Q 4KD4A 4A3CH 1IN6A 2M4KA 2VUMG 3OMCA 2IA0A 2LTPA 1IBML 1X55A 2WV6D 1EY6A 4IEJA 2R92H 2EY1A 1SNDA 5D6EA 1W0UA 1IXSB 3BTJA 1W5SA 3EQLF 2LBFB 2MD0A 2K4KA 4JYAL 2K04A 3NBHB 3M7NA 4DV1Q 3GTQH 2BY2A 2L15A 2ZXJA 1VQKI 2LY7A 3J80Z 3PIPF 2X6LA 3T1YL 5K36H 3HOYB 4DNRB 4U0WA 1YYVA 4CGZA 5HDGA 2FU4A 4X3TA 3MAJA 1GO3E 1BI0A 2BE5D 1T98A 3BR1A 1MDMA 4DJAA 2HCCA 2A07F 2ZXOA 4OIRF 1B72A 1R22A 2IS1A 1T0FA 1H9JA 3L2PA 2B9SA 1N33Q 4S3SA 4R1HA 2X1CA 1YBYA 2W4SA 4D5FA 5LGTA 2M2EA 4J8QA 4CKCA 3IRQA 1L1OC 4EEFG 4HMIA 1FMWA 3N97A 1A35A 3H1CA 3B6AA 1SFOB 3HM5A 2X6YA 1XPOA 5CVRA 1TT0A 2HHHL 1O7ZA 3GTQJ 1E1OA 3VB2A 5CKTA 5KAFC 1TY2A 1M8AA 2DPUA 4B3MQ 1QRYA 4YIIA 1CI3M 2FF4A 3R0AA 3PSFA 4PZJA 2CUFA 2PN6A 3HDDA 2L02A 1B9MA 4OAZA 3UDGA 1MJEA 1J0RA 5JJKA 1IL2A 3D1NI 5BQTA 1MMDA 4LK1C 3K6OA 1PRTF 2BDOA 3H3VC 2E5ZA 5CBAE 3KP3A 3E5XA 1S5FD 2RDFA 1QVCA 4CKBA 1Y8RB 4B43A 3D0FA 3IAS2 2OJED 3QPHA 1JB3A 4FYDA 2COMA 5IYCJ 4B3RL 1FVIA 3VR4A 1Y1VG 4M6YA 5FLMH 3N52A 4F88A 3QP6A 4XN0A 5GAEC 4IURA 1U5KA 2K14A 2FINB 3WTTC 2YU3A 4JX6A 5IP7G 5ED4A 1AU7A 2KCTA 5C4ZA 3T1BA 1IRXA 1OXXK 2LKVA 1FNUA 1UE7A 1MSGA 1EOVA 1EEFD 1Z9CA 2BA1A 4IHXA 1WJBA 3BVZA 3WU0A 5E8IA 2MJ8A 2MNAA 3I72A 4CGYB 2M7BA 1K9MC 2NTTA 5TJJA 3BTIA 1CF7A 2WAEA 1STGA 2WKDA 1EYCA 2R93B 3NTHA 1Q81C 2BZTA 2DFHA 1TQMA 2YU9H 3GTMH 3MKWB 3AFHA 1BR1A 4X64L 3M8EA 4RGNA 1V5GA 3M1CA 4HQEA 3S2DB 3C18A 1X19A 1LEAA 5F08A 4YWLA 4O0AA 4ZCKA 4E7HA 3VA7A 3C1DA 2O6GE 1ETXA 1PHJA 4APVA 1FZPB 2V4JC 1DZ1A 2SOBA 1GD7A 2DMNA 4KKUA 4HBLA 1Z6HA 3J81c 1TWHJ 2C6YA 1Y8NB 2O5IC 2A05A 1YW7A 5E3LA 2IBDA 4CCKA 4CICA 2YU9J 4ZYSA 1PH9A 3GF2A 4DV4L 2A6HF 5KNDA 3WTXC 3RZOH 5E4XA 4UXNA 1MI2A 4C56C 1I4QA 2VXWA 3J7AO 3KIOA 3MCZA 1U9RA 3A8JE 5H1SE 2DDAA 2QGUA 1QGPA 4HSRA 1U6GA 2MO1A 1CA6A 4M6XA 4RHSA 2L9RA 2TCTA 3K7UC 4ZYAA 4KN7X 2R7TA 2X4HA 4CYDA 2M5WA 5EJWA 2JPBA 4ZZLA 3ABKH 3DMUA 2AO9A 2F4MB 4QQBX 3A55A 1XN7A 4V19K 1KQ8A 1Z21A 4XXEA 5C0XG 3MTSA 4U7DA 4EJTA 4A3EB 5DD8A 1SNQA 3JSPA 3E0JA 3RZOJ 4XT3B 4DXFA 1HSTA 2VBZA 2QDLA 1OCTC 1ODDA 4HW0A 1MBYA 2CHBD 1X3WB 4OO1G 3TDQA 5DV5A 1O57A 5LHIA 2CYYA 3ABTA 3HOZH 3KP4A 2P7CB 2LC2A 3AAFA 4IKFA 3F8BA 3NK9A 1B3AA 4JBMA 4ANJA 1K3RA 1YE9A 4DGZA 3CF5A 4HZFA 4NBQA 3V7CA 2WAQE 4ZDLA 2QCOA 3M3YH 3RZDB 4BUPA 1X3GA 4BY7H 1TWFH 1Y56A 2ZJRA 2ZBKA 3I4NH 1Q8IA 2LYCA 1X3PA 3VR6A 1HZ9A 2ZSIB 3L2QA 2QKLB 1WTRA 3SR1A 1FL0A 2DYRH 1S6LA 3MKYB 1TS3A 4A93G 3HOZJ 4H0LC 4PZ6A 2L3DA 2I07B 2P81A 4DR4L 4X0GA 4R4CA 1KGSA 5KYIA 2LG4A 1LTAD 5KNBA 3GDEA 4K6DA 1EY4A 3MHBA 1GT0C 2EFPA 1DYQA 4BQAA 4AU7A 1SEBD 1XX8A 4NC7A 1EIFA 3AFQA 1SD4A 4YIRX 4IHTA 2A6HD 1TWFJ 2FXAA 3Q22A 3J81i 4E7SA 4OXPA 4IO9A 2PW5A 4MO7A 3DM3A 4A3MB 2UUBQ 1KAAA 2DFFA 1EH7A 5ICCA 1MJCA 2HQAA 1H9GA 1EFID 1IN7A 3IKVA 1YNND 5ELBA 3A0JA 1QWYA 4K2KA 1EWHA 1JWUD 4Q0FA 4DK6C 1WI3A 2D45A 1RR8C 3LSGA 1HNWQ 4RA8A 2UUZA 2UWMA 2Y31A 4UUTA 2WAQG 1Q8KA 2B2YA 1SD6A 5C44J 3RLFA 1VQLA 3T51B 5FO8B 3I4MG 4ID6A 4EGYA 3S17H 4N8FA 2DCEA 4A3KH 2D5DA 2Z4IA 2F5VA 3H09A 1B44D 4L5QA 3FEWX 4XL9A 4BA1I 4C1NK 4YFKF 3U4VA 1DOLA 2EPBA 1I4GA 2R7FA 4A3BG 1I4RA 3P75A 1VQ4I 1H95A 1GV5A 4L18B 2NVYJ 1VCIA 1KABA 2XF6A 4BDZA 3ABUA 4NXMQ 1RL2A 3A7LA 1JOKA 3SFIA 3HHHA 4XICA 4M1UB 2QWWA 5CV4A 3DEEA 2QQ9A 4D5CA 3S17J 1R36A 4XOPA 3PGZA 4A3KJ 2B0LA 3BTCA 2BH8A 1ZLKA 1E17A 1G59A 1JJ6C 2CFOA 3H0GG 1N32L 5KYLA 4LK1F 4B3XA 1DOMA 4IPCA 5LMNW 2GOMA 3C1EA 1K78B 5JJZA 1JTYA 1JT8A 2MP1A 3K4JA 2AKWB 1TIID 1SFXA 1QJOA 3I59B 2SDFA 2OU2A 4P55A 4UDUC 1K8GA 2LDUA 2K9LA 5C6AA 3QU3A 2BW3B 1G51A 3HC7A 2L4NA 2O2LD 1PZJD 4NDLA 1P4XA 1AKHB 2VONA 3D4RA 2MD5A 3FXUA 5KNCA 1W6JA 3PUWA 1U8RA 2UV1A 5TRDA 2PJRB 1DONA 1KTKA 1TQPA 1NK3P 2JA5B 3E5SA 3O8GA 4WJ3M 1LT5D 5IIFA 4FVMA 2Q1ZB 4X66L 4Y15A 3LSHA 1D5VA 3OR1C 1P8LA 5LGUA 2E1MC 2I5MX 4B9WA 1IBMQ 1LUJB 5JVGF 3PJRA 2PYKA 3GX4X 1SYGA 4C3JJ 3ER0A 3UDIA 4WXDA 1RIOH 3S1RH 2DT6A 4KN4X 2I46A 1XMKA 4BBSG 2A73B 4QIWB 4OMZA 1HKSA 1HW1A 1UUPA 2K33A 1A36A 4ITVA 3WWVA 4JYAQ 2DU9A 3Q23A 3D3RA 1EZ8A 2WBMA 1I4XA 2L5TA 3K9TA 4XLCA 4G7HC 4HSTA 1Y69U 3REOA 3NENA 2B2WC 4CYCA 3A0HC 1MSFC 3TP3A 3E1SA 1V9PA 1NR4A 2R7XA 2L9HA 2LMCB 3L9FA 2NS7A 2PPBC 1E0EA 3S24A 3CCEA 4OX9Q 4PZ8A 4GN3B 1KIXA 2F6CA 2HQNA 2MA3A 1IBLL 2KHIA 1LVAA 1IKLA 2H1EA 4WXCA 4RKLA 1IN4A 1XYIA 3OOUA 1GUUA 3TL4X 4K0KL 3HKSA 4B09A 3OMGA 1TW3A 1D8KA 2FMMA 1V54H 5FKKA 2XSDC 4GNXA 3SZGA 4Q48A 3F2CA 1SC7A 2E1NA 2HUGA 4CSWA 2LFNA 1JICA 3K81C 2A69C 2Q2EB 2VW9A 3JAMK 2H27A 3LSJA 2F03A 3GTLB 1XTCD 1HNXL 4LAAA 5K1YA 3CCLA 4JI2L 1WI9A 3GTOB 1RZ4A 1I50B 4IHVA 3WTZA 2JE6I 3TZUA 1T95A 2Q2TA 2TRTA 2DUDA 2P8TA 1CQVA 5EZGA 4B44A 4BL0B 3H3ZA 3IH4A 2XROA 2LKXA 3I3LA 2R0QC 3WOEA 2OQKA 2KDZA 2KIFA 2Z9OA 2H1LA 1GDTA 3PV0A 3DPUA 5IP9G 1ET9A 2E2IJ 1UCRA 4NB5A 3HUGB 1L0XB 3PIOF 3MAQA 1U9OA 1UEBA 4EGZA 1T2KA 4C9YA 1XMOQ 3VWBA 4IPAA 2WAQA 4WJWA 3HKZB 5A2QE 3T5XA 4HLYA 1M90C 2K5VA 2P0WA 2O7OA 3LL7A 1NUCA 3K5MA 1LJ9A 1R9TH 2IS2A 1TNSA 3N05A 2CQKA 2N88A 2JA8H 3BG7A 1DPRA 1K8MA 3T8TA 1WJDA 2I10A 1P4WA 4RGOS 1VQ5A 3F2BA 1J75A 3OWFA 1XJVA 3HOVB 2PMHA 3G3ZA 2HVRA 1E2XA 3W6VA 1HKQA 3GV3A 2DODA 1LEBA 4HF0A 1B8AA 2K7LA 2UXDQ 4DR7Q 2HXIA 2M8EA 4L5SA 1K6YA 1FWZA 3CCUA 1R9TJ 1DM0B 5CGKA 2JA8J 2JA7B 1I3QB 4OINF 3ZMTA 1VQLI 3AU7A 4BBRH 2K4JA 1QZYA 1EH6A 2VB6A 1I94L 1XPUA 4RKBA 2UUCQ 3HOXH 3DWLE 1GVPA 2NNYA 1P16A 2FA5A 5CC4A 3CMYA 2ADUA 4RFBA 3S16B 1ETVA 3V42A 4AD9A 4CJ0B 4HIOA 1G91A 4RGSA 1JI8A 3TP6A 1OR7C 3KF8B 1T56A 5IY0A 2WAQN 2CSOA 5BN3A 4PSXA 5J3LA 2QA4I 3GQBA 4KUMA 1VF5C 2EIFA 5F2DA 3HOUJ 3ZMZA 1DGSA 2ECBA 1HW2A 1VQCA 3Q0AA 4AH6A 1ZLJA 1PZID 1ETYA 1P4AA 4BY1B 1IF1A 4XT1B 4TKOB 3ASNH 1DGWY 1L1OB 1EY8A 5EJCA 3VDYA 1KNEA 4A3GH 4P96A 1YJ9A 3HRUA 1BI2A 1P6RA 4MHGA 2LOOA 2E2HB 1A3VA 5FK9C 1X6OA 2NZHA 3DBLB 3KP5A 2KRHA 4PG3A 3FKIJ 3FHZA 4IHSA 4IJAA 4RAGA 3KLRA 1Y1WG 3C7JA 3UE1A 4LMYA 4ESFA 2KBNA 1TWCB 1QHGA 2JA6H 3S1NJ 3IV5A 3LWFA 1V43A 3TZDA 5FOBB 2F0TA 2VLAA 1YX3A 2YUSA 1FOWA 5C4XG 5F04A 2WAFA 4KITB 3T0YA 3ZQCA 2CW0C 3LA2A 2G9HD 2O03A 1TNTA 3GTGH 5I6YA 4A3GJ 4C3HH 1MKMA 1MBEA 4XSXF 1B1ZA 2GOXB 4POFA 3GTKH 3KPHA 3I71A 1IYUA 2UXNA 1X3EA 3L0OA 2JA6J 4L9VA 4LF9Q 4ZJZA 4JBAA 2RQQA 5ERIA 5T1GA 2Y0SB 4WK8F 2AQ2B 5GTHC 1KNAA 4QMGA 4KKSA 2DXIA 4ZLTF 4C2TA 1LTLA 4DK3C 4P1WA 1RESA 3B6CA 1G3SA 2OQRA 4E7ZA 1GXDC 3FHNA 2P6TA 5C0XI 4GOPB 3CCVI 4CJ1B 5CYUA 3JRGA 2MH2A 4IOCF 3CC2A 3RKWA 2W85A 2OBPA 4HAMA 1J5EL 4C30A 4E7KA 4XRFA 4HJ8A 1JWSD 1OJLA 4POGA 3K10A 4MTEA 4CDDC 1FBSA 3DLLA 3EVQA 3WTUC 2O5RA 2W84A 2IJLA 3KK7A 5FO5A 1RF2D 1STAA 2M4GA 2JK8A 4IUVA 2YTYA 1I6HB 4IPHA 5M3MH 4CCNA 4P2CB 1EQVA 3MEFA 1ZKGA 3KEOA 1WI5A 2F0QA 1T38A 1ITYA 4IJLA 2ISYA 3FDYA 2X9DA 3WHBA 1SFOH 3CCEI 1KDCA 1ZXTA 5JLWA 2K5HA 4JI5L 4YRVA 2F0WA 1HFNA 3S2HJ 1HUMA 4FP5D 1POGA 1D1AA 2VQLA 5KVRA 4G7HF 3W2WA 4UAIA 1I27A 1BI1A 2E36A 1JJGA 4BE0A 3PUFA 4AIJA 2YTXA 4LD5A 5AJ3Q 3X2QH 4W1UA 5CBEE 5M3MJ 2F0PA 1F2MA 3GTPJ 2KIMA 1HNZL 2VE9A 5EKLA 3PCOB 5IOCA 1U5TC 1W7PD 2VUMJ 2EDGA 3CQZB 5JHFA 3HSEA 1LT4D 1S4ZA 3OYYA 4HCEA 3GD7A 3ZMVA 2ZJPA 4AVZA 4RAFA 4HIMA 2BOLA 5JJLA 2MG4A 2F0KA 3E7LA 1KQ9A 3ASOH 3MKLA 4J1MA 1TWAB 2IA2A 2FQ3A 1FPQA 1VMCA 2OA4A 1BBXC 2W57A 5A35A 3J7AF 2TMPA 2A69F 4JI3L 3S14B 3SK5A 2R7ZB 2KMUA 2B2TA 3J81E 3LSMA 3AEVA 5M5XB 2RDGA 1QZHA 3FM3A 3L1PA 4RAYA 1FGUA 3A56A 3A2KA 1Y8PB 3L2CA 4JYKA 2UXBL 3CU7A 3SJMA 4JPBW 2NVQB 1NHAA 2N49A 2JK3A 1ZRCA 3QRFF 5TSSA 1IDZA 3DWAA 4XOTA 3KJPA 1VQ5I 1ICWA 4DK1A 2RHSB 2EIKH 3I54A 4QPQA 1V1PB 1VQOA 1LTBD 1WD0A 3S2DH 3KX2A 1JMCA 4MLOA 3N4MA 2AHOB 3MEXA 4H4KC 2Q0OA 4ZKCB 3RI4A 1RETA 5IP7H 1BF4A 2NZOA 4N9HA 3RN5A 1UJ8A 2I5HA 4WFN3 5FRMA 3MXUA 1FLIA 1FGBD 1LABA 3E6DA 2GA2A 1TZLA 2IHFA 2KOLA 1X4OA 4A3FG 1S7OA 5IT9L 5HLGA 4LOCA 1J5YA 4DV3L 1Y39A 4UV8A 2Z9HA 1Y1VJ 2NZ1D 4DUZQ 2DMPA 3ERSX 5ICEA 1OYWA 3L2UA 1AWCA 3DHQA 1VQ7I 4X1EA 2ZC2A 4L5RC 3OYFA 5IT3A 1S5LC 3HBLA 3MFYA 2NVTB 2IX0A 4A3DB 2ESNA 2A1AA 3S9WA 5IP7J 5HS8A 2OTJA 1Z3YA 1OISA 3HOWB 3EROA 5C3EJ 2DFEA 2FJ2A 2BY1A 5DEQA 3RPQA 2GVBA 4O1NA 2EJFC 5HNHA 2RREA 5C4JH 3WHCA 1IO2A 1CFMA 3K7AB 1LV9A 2N78A 2G9WA 4K14A 1YJ9I 2FMLA 1RC9A 2MC3A 1STEA 5J47A 3FXQA 1AZPA 4QF4A 2ES2A 1C0AA 5B3SH 4LG0A 3OYGA 2LF8A 4DYRA 1UE6A 3CCMA 1FSEA 4EQOA 1T0FC 4K0KQ 3CRLC 4PJJA 1BJZA 3F9KA 1RTNA 2PW7A 2V9KA 1SFUA 2ZMEC 4H02A 3CJNA 3CJQB 5ISRA 2CG4A 2XUBA 3VYRA 5H2FC 1X2MA 1TVXA 1F1ZA 5C4JJ 2K86A 1U8BA 1HC8A 2WC2A 2QQAA 5H6RA 3JTGA 4KLKA 1J7KA 2XKPA 2HS5A 1B7YB 2F0DA 3K59A 3NWSA 5JPMC 2R92B 3EBEA 5LD2C 4RMFA 1JJ8C 2Y9YA 1W5TA 2QSHX 3GBGA 2KJBA 4ZRZA 2PG4A 3K1NA 5C0XH 2PMZB 2CW0F 5FJ8H 3DV8A 1FTZA 2KKOA 5I4DA 3GTQB 2O5JC 4QWQA 3C2HA 3W3AA 1J2XA 2F4VQ 4EJWA 1T5EA 2PLYA 3BOQA 3BG5A 4M3BA 1SAUA 3SEBA 4BEHA 1Z47A 5JVTA 1EY9A 4AC0A 3CC2I 1R23A 2FBKA 2VJ5A 4DV5Q 3C2GA 4BU2A 1LT3D 2L2OA 3FXRA 4FO2A 4PNYA 1HKTA 2GXBA 4LB6B 1S5DD 3MQ0A 4JI6L 1ZRFA 3QOLA 4A3MH 1YJWA 5C0XJ 4CXFA 2HR3A 1UWVA 1HBXG 3VSKA 4KIBA 4X6AH 4TVAB 3L09A 4JOIA 1NH3A 2E5LL 1USSA 2IX3A 2DOEA 3S15J 2C35B 4DR6Q 3U21A 4O2DA 4A93H 4DYQA 5DDGA 2XSCA 1BCPD 2MFIA 2DBBA 3HEJA 2ZNZA 1WVLA 1EFWA 4GGGA 2O3FA 3V05A 3QR8A 5FLXL 4CCMA 3D4DA 2NYZD 2F0VA 1H9SB 5IE8A 1KLGD 4ESJA 5M9OA 3OTOL 3QYEA 2BHZA 5BS6A 5GROA 1STZA 4N4OB 1BBYA 3QIAA 1YVCA 4LMQD 1VQ6A 2IA1A 1FSHA 4BAYA 2A5YB 3QOPA 4JC0A 2NVUB 1PA6A 4Q5SF 3OL3A 1WTOA 3BZ6A 1GKHA 4A93J 3L2WA 2VN2A 3RYRA 1JUMA 2XRQD 2DMQA 3QWNA 3F22A 2R7QA 2LKSA 3TMEA 2DA5A 1HZBA 2LSSA 4HPQA 2E2JJ 4BHCA 1PV4A 3CXCA 2D0PA 4YHHQ 4JI0Q 4D0PA 3PO3G 2CW0D 5J40A 3DKWA 1VQPA 3BR5A 2PEXA 4BACA 2J0TD 1KU9A 1AOYA 1Q82C 1B9NA 4X65Q 3C3LA 4BJTA 1FOXA 3KDFB 4KT6A 5DS9A 5M3FG 1BR9A 1FP1D 3QQAA 3JRDA 2JPCA 3IH3A 1PUFB 1IV6A 1IN5A 1CZWA 1TWHB 2IJ0A 4AYBB 3DTKA 5JVH3 1M4VA 2MYSA 2BV6A 5DTDA 4M9SA 2RBMA 1IUFA 2CW7A 1X56A 3TSSA 2HKOA 1BBUA 2YU9B 3F8FA 2EV0A 3AG2H 2EXZA 2EYHA 3KBXA 1WTWA 2ICWG 3I4MJ 2B2VC 4X62L 3O8HA 1H9KA 4FX0A 3KYLA 3JRAA 1QB5D 4OGQC 3M8FA 2DPDA 1U4PA 2JA5H 2RN7A 3H0GH 1BC8C 3PUBA 4PQXA 2EJMA 4IUQA 5GADJ 4ZYEA 4HQMA 2A8VA 3PFYA 3OS1A 3NTKA 4MNOA 3VDXA 3CCRI 1VF9A 1ZTRA 4A3BJ 1JWMD 1JTXA 2HQLA 1NTCA 5K7ZA 2M9VA 2MLKA 1IAWA 2COBA 2FFKB 2ID6A 1OMIA 1ZG5A 3CW2C 4HX8A 2EIMH 3MXGA 1B8IA 2K85A 1WTXA 3QU6A 5EBCA 1A5JA 2KJXA 1P7JA 1SE2A 2IGKA 1JKQC 2FUG2 1ASZA 1TS2A 3ZQFA 1A6XA 4OAYA 3RZOB 3ZQGA 3TO7A 4II3A 4M74A 4I76A 4PJLA 1RKNA 1JXSA 2ME6A 3H0GJ 1UHMA 1EWCA 3PUXA 1OXUA 1ZQ3P 1TKWB 3I0TA 4IXAA 1R58A 3QWLA 2X69A 2L11A 2D2WA 3CCSA 3M4OJ 4LFBL 2E8GA 2F0IA 3K4BA 5E79C 1L0OC 5DD4A 1UELB 2XAJA 2OTJI 2QQBA 1XNRQ 3NPPA 5IGBA 3STBC 4I6ZA 4FNFA 2B29A 1FNNA 2BXYA 4I0BA 1XDUA 5DUIA 2Z3YA 3GTJH 4NHJA 1MMAA 2CV2A 1Z0XA 1YW8A 2VQEQ 1G2TA 3A8KE 1Y8OB 2KEEA 3BLYA 1LT6D 4QLCU 1G3YA 4GXOA 4EM2A 1IDYA 3HOZB 2CV0A 3CCMI 1B53A 1ONLA 4D7NA 1W3SA 3I3CA 4JI8Q 4G7ZC 4RH6A 5GPCA 1GXQA 3E5UA 2VKHA 1DDNA 1K78A 2J7ZA 5EPJA 5I9OA 5EPKA 5F0HA 1D1CA 3GTLH 4LF6L 1PP8F 4A3JG 1HR0L 3H91A 1TWFB 3VPRA 1HNZQ 1SBBB 3J81j 1BCPB 3Q0WA 2V4DA 1DOKA 1MJAA 5HVQC 1TU2B 4Z9CB 3GTJJ 5IGFA 1JORA 2EFNA 3WGIA 5IGCA 2WACA 3CUQB 4Y7NJ 2A6ED 4BS9A 1D8JA 1HW5A 3KLWA 2ZM6Q 5C4HA 4XKBA 4L6TB 2CS3A 4BBSJ 1UAAA 1V5FA 3HOSA 2HNHA 3RLOA 1SRUA 2CW8A 5CPRB 1FEXA 3P5JA 2YR2A 2PO4A 2DT5A 5IT9c 3F2UA 2O4XA 1LPQA 3AQQA 4G6QA 5C44B 3BDCA 1MGSA 1SJED 3O6BB 2DTRA 2AS5F 3WDNA 1MH3A 3JRHA 1MJBA 2ZJ2A 1PDNC 1N33L 2QVOA 4DV6Q 2XGDA 5JPNC 2V1DA 1MNDA 1SNPA 3HOVH 2YX4A 1WPKA 2RA4A 3BR6A 2KENA 5HS9A 3P7NA 2LK2A 3LSKA 4IQJA 4B3ML 1L0WA 3OYKA 1TLHB 5D6FA 2XIGA 2NVYB 3R2TA 5IP9H 3MXPA 1IJWC 1CKNB 2OQGA 3GZ5A 4YG2F 1PH5A 3EYYA 1X1CA 2BE5C 3S17B 4A3KB 4FETA 5LEJA 2EH3A 3UR3C 5CORA 3JAMZ 3Q3SA 3M8JA 2F0FA 1LE8B 4P75A 1OCOH 3BG3A 5EF6A 2A5WA 3CKIB 4BKXA 5FKLA 1ERDA 3S16H 3PM1A 3NAUA 3KYCB 1P92A 1XWEA 2KEDA 1NJIC 5IP9J 3C2BA 4QTRA 1VQ6I 2WB1B 3ONAB 5IGEA 4HN7A 5K5RA 2K5QA 4DV3Q 3M4QA 3TOAA 3GV6A 4YCWA 3MZYA 2FNPA 3CCJA 4XYQA 1IZ6A 2JSPA 2O61A 2KUMA 2EYLA 4DGWB 5IODA 1GLNA 1VQPI 1V55H 3PQIA 5KIXA 3KE2A 2Q8TA 3AKZA 2DA3A 5IGGA 2E2HH 2DA2A 5B1AH 1YRNA 3KLSX 3OL4A 5IYBG 2EFOA 1XPXA 4PK4A 1S5BD 2VPLA 1HFGA 1TWCH 4UB8C 3OMYA 1XSVA 3AG4H 2X6XA 4EV0A 1B6AA 5HLTA 4JCVE 2XAUA 2B63G 1AE2A 4RLQA 4C3JB 2X1DA 5C3XA 3EJIA 1I39A 3TMOA 1YEZA 2A5HA 5JFRA 4BA2I 1NMGA 2RKHA 3R0JA 3F8NA 3BG6A 2EY5A 5LFAA 1KRSA 1CSQA 3LA3A 4J00A 1XGNA 2L4MA 3FXJA 3H3UA 5B66C 5G3LF 3HSFA 3QPLA 3ZN0A 3AL0B 5IOYA 4UB6C 4IQZA 2IVMA 2FMCA 5FLVA 1OLTA 1QUQB 2L9SA 2G7HA 1VNDA 4RCOA 5FLXc 5LHHA 3LSRA 4DAVA 2JA9A 3K0XA 3PO2G 2Y0MA 2WWYA 1MW7A 2L12A 1NTGA 2JEAI 1VDZA 1JKOC 4ZYHA 4LJZC 4KHZA 1CQTA 1Y0NA 4HF1A 4CDCC 1XMQQ 1G2SA 4DPGA 1EEID 4KY5A 5GQOA 2RNJA 3ZMSA 3QB3A 1G8ZD 1J9OA 3PNVA 1CSPA 4ZDOA 2W82A 4Z2YA 2QBYA 3TBIB 1FYLA 5LRRA 3DUZA 2XGEA 3R2IA 3E0EA 2EOTA 3V7SA 4IX7A 1Y1WJ 4EJUA 1XX5A 4H44C 3TGNA 3CC4A 1NG7A 1IRGA 2N55A 5ICGA 2ZJRF 4R4QA 4PZ7A 4ASNA 4GCVA 4JBWA 5C4XJ 4G94A 3PUZA 3J7AY 2IY5B 2DOAA 2X6WA 1EIGA 2NTSA 5D65A 1YNJD 1G6PA 3HOTA 5GADC 4HJAA 2K52A 2VS1A 1EV7A 1JGSA 1CK1A 4EATA 1L1OA 4TSSA 4FTHA 3CAMA 4CHUA 4CH7A 3SE0A 1VI0A 1EA3A 1QU3A 3S1QJ 1RD9D 5DCFA 1F77A 4F7ZA 1OXTA 3CQZH 5EEGA 5M5YJ 5IP6A 4A5MA 1I4PA 1Y0UA 1BVSA 1D1IA 3MA2B 3BROA 5D4RA 2E5NA 5I2XA 3C2PA 3TP8A 1M1KC 1H89C 5FD6A 1GUOA 2J5PA 2R5ZA 4MEXF 1G6NA 2RC4A 1IRFA 3CESA 1TWAH 1D5XC 3GMEA 3H5NA 4XLAA 1SSOA 2O8KA 2NRAC 1VQ8A 4G7ZF 3TQYA 3OYMA 4I65A 5IPAA 4Q5VA 1VQGA 4B1RA 4UUSB 2VC1A 1WQ2A 3BU2A 2E60A 2IP2A 5J1ZA 1V5EA 2HTJA 1PH1A 5M5XH 2BHYA 2KIUA 1WTVA 1R9TB 1B72B 4IRHA 3HEFA 1PLFA 3BQYA 2JA8B 2UUBL 1IGNA 1I5ZA 1IW7D 1UEAB 4CKEA 1QHHD 3K4KA 2NS0A 5J39A 2A68C 1CT1D 1RRJA 2R93J 2Z33A 4IZZA 4KMFA 1LTSD 4F91B 4XIGS 2ZTDA 1R00A 3IAM2 4L8JA 3GLLA 1HNWL 4LWCA 4NQWA 4HNVA 3FX3A 4MN3A 4MZ9A 2E35A 4PUSA 3NHHA 3DXJC 1ETOA 4HDVA 3KUPA 1ESRA 2ZJQF 1MBJA 1SMXA 1HJPA 3IWFA 4DZPA 3HOUB 1EOTA 4JI7Q 4X62Q 3WTWC 2NN6I 2XTIA 1UFMA 3CD6A 3IH2A 4A3CG 3HG9A 3OYNA 2KIQA 2ZB9A 2Q8IB 2GN5A 4BBRB 1X3UA 4IJHA 3VYSA 3DM1A 2LXKA 1E2ZA 3DQVC 2L55A 1KYZA 1EWIA 3VR2A 3BTLA 1YJNA 1K79A 3GXOA 2QILA 3KJOA 4LIUA 1Z7TA 1GVJA 1YLFA 5ELOA 3STBD 1BIAA 4L5EA 2BA0A 4HSPA 3G48A 4BXFA 3J7AV 2WADA 4NXML 5EDNA 3FKIB 3NE5B 2KHMA 3S1NB 5BN5A 3S93A 2BE5F 2CVRA 5E3OA 4KT5C 2IX1A 2Y2ZA 2EIJH 2PNRC 2HPIA 3TP5A 4DV0Q 3BCBA 1RJTA 2NVTH 1JHFA 4L9TA 1NMFA 4JG2A 3D5RC 3J7YW 3HOWH 3LGJA 3CCJI 1ZG3A 4A3GB 3ML6A 2SNMA 2MPMA 3CMMA 2CWPA 3E97A 4IUPA 5LL6X 1MNEA 1R1VA 4LFBQ 2EK5A 4ZUJA 1VQ9A 3L00A 2K50A 3K7AH 5DM63 1KQSA 1GM5A 3A01B 3C3WA 2V1CC 3HYIA 4ME5A 1KDAA 3J80L 4BE2A 1BR2A 3DEWA 1E7ZA 3GP7A 3O13A 5I9PA 2L54A 3LSPA 2JA6B 3OW7A 4B3TL 4Y13A 5EKKA 2OUMA 4KFCA 4IFDG 2E2DC 3L7WA 4A3FH 4AYBE 2UU9Q 4PMBA 4UP8A 5ELDA 2CKZB 4XLHA 2RGVA 3WE2A 1O3TA 1AN8A 2VQCA 2VB3X 3ELKA 5DLQE 5HDKA 3AB9A 4GDFA 3C46A 2XHKA 3IKJA 4JX5A 2Y75A 2VKVA 2W00A 4A2UA 2K3PA 3G71A 1BOBA 2EFWA 4UY8I 4KMUC 3MVPA 1F4KA 5D4SA 2Z0SA 3BDLA 1YQAA 3J7ZI 4ZKBB 1SXTA 4ZZDA 2N8NA 2GZWA 1HR0Q 1EH8A 2MFZA 2GIVA 4BQOA 1ENAA 2P5VA 4DW6A 3ITPA 1Q1EA 3BZCA 4D9JA 1WFQA 3PIOA 1T9HA 4A3FJ 3O2PE 3M85A 2ASBA 4RDUA 3LA7A 3L9AX 3DFGA 1HLVA 3I5UA 1K4SA 2KECA 1S72A 3EYIA 4TRDA 2F5EA 5DCMB 5FLMG 4OWXB 2VXZA 3K5NA 4ENMA 3SDZA 1D0XA 3MN2A 1C9OA 5J4VA 4R79A 2XVCA 5L3GA 3NWTA 4P72A 1ML0D 4XORA 3S2HB 4K2EA 5EBDA 1JT6A 1NR2A 2Z2SB 2HPMA 1GUSA 4WRDA 2K7VA 3IL2A 2EZLA 5L3EA 2P5LC 5HGQA 1BOAA 4KNYA 3F2DA 3ZXSA 3S3NA 1TS5A 1K83H 1F36A 3M4PA 4OX9L 3ISPA 5M3MB 1PH3A 3GTPB 2GIZA 3PUVA 3L2VA 2VUMB 1SD5A 3FDTA 2NB0A 2XRNA 3DEOA 3E0JB 1J8IA 2JVGA 4LJZF 1MBFA 1WFXA 2W24A 3ESWB 3H94A 3OYAA 2R7UA 3VYTA 1K6OA 4ENJA 1WJEA 4XKVA 2Q8RE 5IYCH 2RQXA 1SE3A 2EZVA 1IL8A 1ENCA 1C8CA 1OQYA 4F52A 1EJ9A 1K83J 1HUNA 2FX0A 2I0QA 2P6SA 3QYFA 5KAIC 4JBJA 4L9NA 3U9OA 1SFKA 3ULQB 2DFIA 4KY7A 1SR3A 4CDEC 1NY4A 5EG0A 1QVUA 4UVCA 5IWAQ 4FXDA 5KGUA 1FY7A 1BN5A 4QPOA 3LX0A 1H88C 3FZVA 1XMOL 1P2FA 3NRVA 2ZXRA 2JZYA 3HS0C 1JUSA 5C3EG 3RKQA 1XNQQ 3ECOA 3H3VK 4GOPC 2DJNA 3I58A 2BYVE 2NXNB 2HZTA 1MNMC 2WA0A 1IRZA 3H15A 2R7WA 5DNFA 5K5PA 1ILPA 1I4HA 1TWHH 1QZGA 1SYDA 4LUVA 2OT2A 1QZEA 4KJNA 3AG1H 4AWXB 3CCQA 2UXDL 2DAOA 1C4QA 4DR7L 1KC8C 1N34Q 2NN6H 2AQ1B 4DIQA 2L0KA 1G2HA 1VQJA 4DA2A 2RSNA 2Q2IA 4OONA 3OYCA 2DA1A 1L0YB 1Y1VB 2BY3A 2QF7A 4BY7G 1IN8A 3FPPA 3WTVC 2OD5A 1OPCA 5CYVA 3I4NG 5GPAA 2UUCL 2A68F 1KONA 3HPHA 5DUKA 1BUVT 1OFCX 5CJ9A 2ZSHB 2B2UC 3FMQA 1HDDC 3WTSC 5GAHJ 4IOCA 1YJNI 4I99C 3CMEA 3DXJF 5LHGA 3BPVA 3S3OA 4RMNA 4LFCL 2M2LA 2VQFQ 4DV7Q 4OMYA 4W97A 2AQ3B 3BG9A 3RPUA 3E3VA 2LKPA 3H6MA 2L7KA 1MZBA 3PO3J 2H8WA 2BVMA 4JK1C 1LTID 4U673 3SXHA 3ZMUA 2DY7A 1SE4A 1H9SA 4EM0B 1ORKA 2VPRA 5M3FJ 4LGWA 1PH7A 5F0FA 2CUEA 1SE8A 5C4JB 1X1PA 1LTGD 4R4TA 2K9QA 2AHQA 3BJAA 5BR8Q 3G4SA 1D1KA 4NXNQ 2VIXA 2PZWA 4O42A 1WJFA 5F0CA 3FXMA 4RBOA 2A74C 5IT9E 2LMDA 2B2WA 3I90A 2QKMB 1R7JA 3PQKA 2F2EA 3FK7A 1JCKB 1VF7A 4A75A 4HYEA 2KRCA 1O3QA 4GKKQ 3E6ZX 4JI4L 2MC4A 3KOJA 1WYDA 1JKRC 2KT0A 2K40A 2DMTA 2ZCWA 3GTOJ 1I50J 2DMUA 2F0GA 3NXWA 2GA4B 3KDFA 4DAYA 2E1OA 3FXKA 5HGTA 4N8X1 1MGTA 3FBIB 3IKTA 2ZTEA 4BQQA 1F2LA 1PYSB 1MIJA 2M0CA 3KFWX 1PJRA 4HX7A 4LF9L 4F8MA 1XG1A 1PMRA 1HH2P 1VQBA 1PUFA 1VQNA 1Z6RA 3DLLF 5A2QZ 2PQAA 2JRTA 5HY6A 5CV9A 3IFDA 4AYBA 2VJIA 2A68D 3CO6C 3LFUA 2B8FA 1OTCA 4GYGA 3ZN1A 4XR6A 2QKIC 4JK1X 1XCBA 4HOBA 3G1MA 1S72I 2CUZA 4RB2C 4EQNA 3LWEA 4PGGA 1XSXA 4C2MH 2F5CA 2ALYB 4QGUA 5CVVA 1PTOC 2X6OA 4WF2A 2DA7A 5C44H 2FHTA 4OIKA 2PJPA 1I3AA 4CYCB 1W4MA 3F8TA 3MWYW 1X1BA 1SVMA 3G2BA 2JSCA 1N8RC 1ZELA 4ETSA 4AQYL 3NARA 3SQNA 4ZYDA 4XK4A 1U9NA 1G291 2ZFUA 3TW7A 1F9NA 3I4LA 4K8IA 5CMDA 1R5HA 2EVBA 2KHSA 1SN8A 3OSFA 3EUHA 3IFTA 4U68A 2EJRA 2DJGC 2VL6A 3I4PA 4FF2A 3ROUA 3KZYA 3HXLA 4MFEA 2NVYH 3J80c 4C2MJ 1ENHA 4A93B 3HRSA 1F9QA 1JKPC 1I3QJ 1YG2A 4GNXB 3OOCA 2CQAA 2MH9A 1IZ1A 4C1NI 5AJ3L 1ZK8A 3CRKC 4CZZA 1C0WA 1GV2A 4A3JJ 1SNCA 2BCOA 2KPMA 2MSYA 2L7ZA 4P9FA 5JAVA 1OCPA 2Z4HA 4OIJA 4N9IA 4RA2A 2E1CA 4M3EA 1P9QC 1A3TA 4XN3A 4A6EA 1Q12A 2AXLA 1IV8A 4HV5A 3V8LA 3SVMA 4UHVA 3MKZA 2NS8A 3T1HQ 1V3FA 4EX5A 1D0YA 3V8KA 3HTSB 1IXRC 2E34A 3NEUA 1YI2A 3CP2A 3RUZA 3I56A 2JWTA 1VQMA 4LK0F 3AYHB 5I2YA 2IW5A 3ONQA 1X32A 2WAQB 5FLXE 2KZGA 3DU5A 3I4MB 4GS3A 4MHEA 1XMXA 1APLC 2CWEA 1ZG1A 3PQJA 5CLSA 2LD5A 3CMAA 4IPDA 5D5VB 3ZR8X 4A3IG 3TW6A 2XWJB 1DGRM 3JR9A 1U0LA 2VE8A 4JVZA 3KP7A 1XMAA 5EGOA 3OOPA 2ID0A 4WORA 2DA6A 2UZKA 4A3BB 2XRSD 1GVDA 2XDVA 1CGPA 3OWEB 4C3IJ 4B3TQ 2JP1A 2F4IA 1WJJA 4GLXA 4C3JH 4R4IA 3OV8A 4ZTJA 2X51A 2NVXJ 2Q2UA 1BO0A 5FKMA 1YZ6A 1FJGQ 3GFIA 2FSWA 4H7BA 4F93B 2F1MA 5HURA 3CCQI 1UZCA 1ENFA 1TY0A 2IL8A 4UP7A 1KZHA 3VYUA 5J22A 3OSGA 2QGQA 2EE1A 3QP5A 1NK2P 3H0GB 4XNFA 2DI3A 1ESFA 5L3CA 3LAPA 1U4LA 4DNIA 3ZCOA 3FHWA 4JI1Q 5GAEJ 1HPCA 2JUCA 1BA5A 1C48A 4YFNF 1F5TA 4OIOF 1Q1VA 3D5SC 3KLNA 3J80i 3RMHA 2XB0X 3P9IA 3JW4A 4MQVA 4BH9A 2QENA 4G4KA 1A04A 3V96A 1WOCA 5EZHA 3E9IA 4DUZL 4IOAA 3CMEI 4JV5Q 2B63H 2B8GA 1ZGJA 2CRGA 3EDPA 3DKYA 4DF7A 1DJRD 5JEAJ 2K9NA 2AWOA 4IFDI 1ZGWA 3NQOA 2FJ1A 3KLOA 3E6CC 1K7AA 5EAYA 3KETA 2UXCQ 1SANA 1IG7A 3RKYA 5EEHA 2GA1A 1ZN2A 1QA6A 1G4DA 4QUCA 3HGGA 4HNTA 1EIYB 5IYBJ 4RM2A 4PGHA 2V1UA 2OEOA 2CGPA 4ENKA 1WCMG 2IGNA 3GTJB 4MEYF 2F3WA 2JQOA 2B63J 4HMJA 1OYIA 2F3VA 3MMYB 4HTHA 4Y7NB 1NG6A 1U78A 3RKXA 2E2IH 4BBSB 3T53B 3R61A 4CCJA 2LY9A 1OO9B 1LVKA 4OWWB 3HHGA 1VFCA 4ZH4F 1SJHD 3SYTA 3I91A 4O3MA 4M3DA 2BDNA 4IRGA 3HOXG 4A6DA 2H94A 1W36D 3LNNA 4LFAQ 1RTOA 2L7MP 4X3KA 1FR3A 5LLQA 1A8VA 1QZZA 2M30A 1IBKL 3MFKA 3UE0A 5J3BA 3PO2J 3J81Z 2V7FA 1E24A 2CFMA 2NUCA 2OF1A 3HTUA 5LRSA 1MBGA 2XVSA 3S32A 4DR3Q 2R7ZJ 1Y6IA 4ZYGA 1U5TA 4ZDPA 4B08A 2ZO4A 2F4VL 1STBA 1IYJB 4F7XA 4G57A 4RCNA 1P7IA 2V9VA 4N9TA 1OXVA 2CH4A 4DV5L 1HQCA 1QNTA 4JX4A 1VQAA 5J8CA 6PAXA 1ZYRD 2ATWA 4C2UA 4I98B 2ZT9C 2NVQJ 4OU0A 2K01A 3M9AA 2CQOA 3HL2A 3NQIA 1UB9A 1VQIA 4IUTA 4KDPA 1OCCH 2EWNA 3GFMA 2ENBA 4XQNA 1Z7LA 2K75A 1S5CD 5E20A 4J01A 5LMNL 2DK5A 4DR6L 1FX7A 1A3UA 4HR7B 1R6RA 4C3HG 2OQ0A 2RVCA 4YY3L 1ZR2A 4J6HA 2WTEA 4CCLA 1PTOF 2DDBA 3SFZA 2TDXA 5K5QA 4KA4A 5KCMA 3HOUH 1S9HA 1A31A 1AP0A 5IY5H 2K9MA 1QPMA 1EY7A 3BJOA 2MGSA 5ILVA 3R4KA 4DV2Q 1E1TA 2ME0A 1T8IA 2X85A 2VJJA 4DR2Q 2K3FA 3U1KA 1QNKA 1PVEA 4O5VA 1G3WA 4UY8C 1ONVA 2K27A 2W25A 4IRIA 3J7ZC 2P7VB 5BMZA 1FNWA 3IUOA 4HSVA 2IGMA 2VB2X 3LWUA 2EBIA 3FKIH 1O7IA 1MD2D 1BCPC 1ZREA 1K28A 3I9V2 3S1NH 4LFCQ 2Q8KA 3HOYG 4YHHL 2OCCH 4JI0L 3HRMA 3QOJA 1SMYD 4FXKC 2IS4A 4NP5A 1MMNA 4LNQA 3MZ5A 4BXXG 3AFPA 4DKAC 3CUQC 1W6KA 2XRLA 1KRTA 1YI2I 4OIQF 3CTAA 5JOBA 4X65L 1WJ5A 2R7OA 4RS8A 1SVLA 3EA6A 1YHQA 3D4WA 1E22A 4X3SA 2VQGA 1QE6A 3TP0A 4LB5A 3CMAI 2I8DA 3SZPA 4HEDA 4NMZA 2GBYA 3TDUC 4K5WA 4ZC3A 1N36L 5B5EC 1QCBD 1XTDA 3ERQA 2HOTA 4ALPA 3F23A 3BDOA 4EGVA 1DPUA 4KICA 1WZ2A 1K73C 2RKSA 4UUSA 3GCMA 5FKNA 1CTMA 1KD1C 4UP9A 4XLFA 2V1XA 3A0BC 4JI4Q 2Z8LA 4A3CJ 2RAEA 4NKLA 4Q4ZF 3RQIA 3FKJA 4RAZA 1SYEA 3A5ZB 1PTOD 2R92J 2G0EA 2RQPA 4ON0A 2PZUA 4X3UA 4ABNA 2WV1A 1LB2A 2EV6A 1B59A 2ZMEA 3QO2A 4HG2A 1XPRA 1H9TA 2IT1A 3G7LA 1PP7U 2HQRA 3BVMA 3PFIA 2FNAA 1KU7A 1Y1WB 2DQRA 5CQGA 4OELB 4QL5A 3SHLA 3ZOBA 5H6QA 4DUYQ 1WKMA 1UE5A 5CVUA 4IFDH 5C4XB 4EQQA 3FMSA 1DXMA 2LLKA 3R6SA 1JE8A 1KAWA 5LMUL 2XN9C 3S2HH 1MJ9A 2ECCA 3HSRA 3R93A 3W2AA 5KEEA 2N3SA 2H6CA 1JB7A 4OO1I 3CF2A 1LTRD 4KISA 1PH4A 1VQ4A 1XNRL 1HTLD 3EPZA 2EJGC 2PI2E 1J09A 4CHTB 1NE3A 4AQYQ 3S1QB 3KEYA 1PFMA 2EILH 3PF4A 1SDFA 3GTPH 2KQRA 2WY7Q 2VUMH 4N4NB 1EIHA 1BL0A 5M5YB 1J9IA 2R93G 2VQEL 3LSIA 4IFDJ 1U3EM 1PH8A 4XTCS 4LG0B 1WH7A 1Q3LA 4Y3OA 2KP6A 2HU9A 2VKDA 3P7JA 2KCNA 3RSNA 4IL6C 5L3BA 4JI8L 1K8AC 4B3SQ 2F0SA 3VYRB 4KI0A 4P73A 3A74A 5CV8A 3G6JB 3S1MH 4YELA 2IPKD 1F9PA 1WTHA 4NB3A 3GLXA 1Q1BA 1D1BA 4LF5L 3S8PA 2ETHA 3CP0A 1VQFA 4KN7C 3MVVA 3IC7A 3A01A 3NSWA 3CCLI 3PMFA 1WTPA 2IEKA 5EEAA 3MWMA 4LF8Q 1VQHA 2Z6KC 1KQ0A 3AL0C 1DP7P 2KCCA 2ZM6L 3BJUA 1R4PB 5FLMJ 4U7BA 2RCNA 5D14A 4GKJQ 1JOQA 2HDWA 4M3GA 2C5CA 3S1MJ 4M6VA 5IT9K 2LY1A 2F0HA 2XPVA 2EYFA 3JSOA 3SXYA 2IWHA 4DR5L 4RB1A 4I2OA 1PVOA 2I5UA 2MBFA 4BEHB 2VI6A 1X4PA 1WRJA 2QQ8A 1YX5A 3BP8A 1BNZA 3OY9A 4DV6L 1B3QA 4A3EG 1A62A 3T16A 5AIQA 5EYRA 4KK7A 4AIMA 3NP8A 2A6EC 4BJ5C 4K2LA 4QY7A 1PRTD 2Z1CA 1XDSA 1SROA 1SNMA 2VT2A 1BXTA 2KZVA 2LBFA 3GTMJ 4BHPA 5DCMA 1D8LA 3CPFA 4H0EA 2OXPA 3NBHA 4LLLA 1KDBA 1XSDA 3U2RA 4CCOA 1CZGA 5M5WH 5KRUA 1Y1VH 3ZRGA 1Y14B 4A3LG 2O8XA 2VOPA 4UPAA 3I64A 3S2WA 4CZCA 4Z6YA 3D6WA 3LFKA 4F87A 3CCUI 2FXQA 1QVFA 3KFUA 2AMCB 4BGDA 1CHPD 5C3EH 1ZGAA 1KA8A 4F3QA 4KHPQ 2B2VA 2STWA 3CPWA 3B02A 3UKGA 5FJ8G 1SD7A 2JA2A 4E7IA 3DBHB 4BE1A 1AW7A 1PTOB 5NUCA 1FT9A 2R7SA 4DN4M 1RIPA 3W6KB 5I6WA 2ZNYA 5M5WJ 1X3ZB 4EM1A 4NPSA 1JGGA 2R3ZA 1TBXA 2W48A 1D7QA 1BR4A 4YIJA 2VZAA 1XD7A 1A6IA 4A0XA 3OIQA 4MGRA 1SAXA 3CZ6A 3U4ZA 4A3MG 2PQ8A 4GRIA 1B1BA 4DR1Q 4LF7Q 1N75A 1VZ0A 5JVG3 4QJFA 1PH2A 3OIPA 1YHQI 4NC6A 3WODF 3TREA 5IYDG 1BCPF 2V1NA 4XQJA 3C1FA 4P5OA 1S5ED 5FD5A 3MEHA 4YCUA 5B1BH 5DM73 1BDOA 3RCOA 3EUAA 4A3FB 3EFXD 5JJIA 1NBWA 2DY8A 3QG1A 5D5XB 2M0MA 2HGCA 3W5OA 4BHBA 2ZXIA 1MIUA 1L3LA 5COYA 4LF4Q 5BNGA 3F8MA 3M3YJ 1QNUA 3FWEA 2D1HA 2NAZA 4BY7J 1M1EB 4IF4A 5ILSA 5K7FA 4V0BA 3JC66 1MSEC 3RQ4A 2BH2A 3E9HA 3V7RA 3I4NJ 2M1BA 4XONA 1PDQA 2V6CA 5FLXK 1TXYA 2D62A 1HA5A 2ISZA 2LF7A 2LFBA 1AEXA 3V8JA 1STYA 1R1TA 3Q5FA 1REPC 1D5MC 3J80E 5CV7A 1IBKQ 4L0YB 4NW2A 2CV1A 2IW3A 5J6XA 1ETKA 3OS2A 4D1QA 1B8IB 3GW2A 2FMYA 4GN5A 4FDBA 1VQDA 1W7PB 3IRBA 3HIFA 5E1XA 3JREA 5BPIA 1XMQL 2GXAA 1OCZH 4QIWE 1B4OA 1EU4A 2OZ6A 3S15H 1BOSA 5D8KB 1RKWA 4OO1H 2HFHA 1F9SA 4MNUA 1H9MA 2RCFA 3PUYA 2LREA 3R60A 4FE7A 5HODA 1MMGA 3TRZA 5DEHA 3BYYB 3MXNB 3TO6A 5C5MA 1K83B 3A1YA 4HV6A 2Y9ZA 1MMSA 3LNQA 4KHVA 1RNLA 1HF0A 3ZP5A 2VBWA 4HJ5A 2QA4A 1UHWA 1HXYD 2GWRA 3RYPA 5E8GA 1X9NA 2X0LA 2ZJQA 3DPLC 5D3DA 1WHUA 2JSOA 2XIWA 1YFHA 1YIOA 2CH0A 1PFSA 3LAJA 5LMNQ 2Q2HA 3PIO3 4KN4C 2O9LA 4YY3Q 5FRNA 1HQMC 1Z77A 1PRTB 2JA5G 3M7GA 2BBYA 1X1AA 2E2JH 3GFJA 3KLSA 5CVJA 4BJ6C 3OW2A 3DF8A 2PI2A 3M07A 4DNTB 1BW5A 4GZYC 2NWGA 2DJIA 1J6QA 3IRRA 1Z7UA 2LH9A 3FMCA 4DAMA 2KVMA 3ZQLA 4DBRA 4IHYA 1IHZA 5AFWA 2ACJA 2MO0A 3VA5A 1W5CC 1TS4A 4GO1A 2XSJC 2FOKA 1YNJC 4CA0A 1YTYA 2XF5A 1J59A 5E1WA 3CJTB 2A3SA 1I5FA 3U1DA 1ZR4A 4XDXA 2OCEA 3NTIA 2EV5A 3KF6B 3GWZA 2CQ7A 1HA6A 5EGTA 2VBXA 2CFXA 1EY0A 2V6EA 3HFZB 3U9GA 3MD2A 4OWTB 5ELEA 3I4MH 2Y69H 3HKZE 2JMWA 4M9ZA 3K4CA 3A7AB 2WV0A 2H6BA 4RGRA 2GM4A 1LO5D 1YS6A 3VEPA 4TQUS 2KFDA 2NOJB 1T08B 3DEUA 1EKEA 4A3BH 4JQFA 3SK8A 2DN8A 1XGOA 3CCVA 4HA8A 2XWBB 3CLOA 1N36Q 3NELA 3O3KA 5DM7F 2K03A 3DBRB 3DLAA 4A12A 2R4GA 2DTZA 3BPXA 1FP2A 4EVIA 3VOEA 4JI7L 5HLIA 2FBHA 4N9PA 1BW6A 3T1YQ 3WE3A 2DO7A 2QSGX 4G9YA 1T5XD 3PO3B 1VQOI 4CDFC 1HZAA 4AUXA 3UDXA 2F0NA 1L2FA 2F52A 2B39A 3JCUC 2EYOA 1IW7C 2AXTC 4DBQA 2HDDA 1GJXA 2A6EF 5AONA 2MW8A 1MHWC 2RDPA 2EINH 1Z6TA 3M4OH 1ILQA 4P9UA 3S1RJ 5L3FA 5M3FB 4A3IH 3P9CA 3GYHX 3GZ6A 2HIXA 3F8CA 4B4CA 4EMSA 4G12A 3I7FA 3SK4A 2HT1A 3EUKL 1ON1A 2HQEA 3PIPA 2PQEA 3BWGA 4E7JA 2HZDA 2HHHQ 4Y52H 4F92B 3DWQA 1TP4A 3HKZG 4XSZF 4DV0L 3EN2A 2B3GA 1ETWA 4K5VA 2JN4A 5LMUQ 2LNBA 3ZPLA 2G5DA 1ZRDA 3W3CA 3N6RA 2K05A 2YS9A 5FB2A 3U9SA 4FXGC 2K4BA 1MKHA 2LS01 4A3IJ 2E74C 3HP3A 1O7YA 3HOVG 1TWGH 3IHUA 4XM3A 4J15A 4PFOA 2F0LA 5D8LB 1YRNB 3W1GA 4PCQA 4PJMA 4OL7A 3FK6A 2PX9A 4Y52J 5KK1A 2VQHA 5HOOA 1MD0A 2EA2A 2C9OA 1LM0A 2UU9L 1WTQA 3PF5A 3TO9A 2QZ8A 2F0MA 2GLOA 4M8AA 4Y7NH 3L7ZC 4I7ZC 4R8HA 3CO7C 5D5UB 4XKWA 2YYZA 4RWSC 2K6AA 4BBSH 4B3RQ 2JA7G 2R3SA 2E7WA 3H9QA 3EUHC 3X3MA 2R5YB 1BQQT 3K69A 4YIFA 1TWGJ 3NBIA 4XIDA 1V1QA 1EYDA 4WJ4A 4LF5Q 3I59A 4QSHA 2PNHA 1EYAA 2B2YC 4LW1A 1RPWA 3URYA 2F48A 2M45A 1FIAA 1S7AA 4XBFA 1EQQA 2BW3A 2Y0SE 2F0JA 1EZ6A 5FGMA 4RAUC 5E1ZB 1WCMH 4JOMA 2M7AA 3X3NA 4WX9A 4BY1G 4EJVA 1AKHA 1S29A 1Z67A 3JAML 1W2BA 1BBWA 2AWNA 4N0BA 4PMCA 4PJ0C 4V2GA 4X64Q 4L63B 4C2MB 3DCFA 2PJRA 2RV8A 9ANTA 4DR5Q 3P1HA 1YHAA 2QBYB 4KYWA 3FISA 4BYYA 2VODA 1SVOA 5KNLA 4LLGF 1YO5C 4A3JB 2JJQA 2F0OA 4FASD 2H1KA 3TS2A 3JRBA 2RDHA 4KIFA 4LUZA 3WOFA 4I0AA 1GHCA 1WCMJ 1YJWI 1FIPA 1ACIA 2HOEA 1IYVA 4R4OA 1Z05A 3H35A 1VQ7A 1B4AA 4C3IG 2PFBA 3FXLA 3PNYA 2EZHA 4V2FA 1KHIA 4DV4Q 4XQFA 3BDDA 1PFNA 2PMUA 4FF4A 2D9UA 1VQEA 2EZIA 4BBRJ 2HDCA 3UNGC 1PZKD 1ON2A 4BQNA 2CJJA 3HOXJ 4B48A 2BXZA 4LUOA 3VR3A 4DFAA 3I53A 2OF7A 3Q0UA 2Y0SG 1CKOA 3GO5A 1RCVD 4IHWA 2DGYA 2L9VA 1F9RA 5JI6A 5IWAL 4YCVA 4E6KG 3E6MA 1KL9A 2EY2A 3ECHA 5EKIA 4B9XA 1A2UA 2R5ZB 3Q24A 3BZKA 2L7FP 2IT0A 4BWGB 4WXHA 2XNAC 4UUVA 2JN6A 4DAPA 4PSWA 4C3IB 2EA4A 3A8IE 1I1GA 2NVXB 3K2AA 4IUNA 1STNA 2Q2EA 5JEAG 4LLNA 3KYHC 3QOEA 3B6YA 1XNQL 2KJCA 1KU2A 2YPRA 1HDPA 2XKOA 2UUAL 4KJZA 1UHSA 1GUGA 4Y33A 3K58A 2QDBA 2ICEC 4QIWN 3J7YJ 1YNXA 2VL8A 1JC7A 1TT5B 5L37A 4AM3A 4FHTA 2WP8J 3SZTA 4M3FA 2QM3A 3VSLA 1SYBA 2D2CC 3QODA 2CH4W 5IOZA 2ELKA 3GTGJ 3HUGA 4C3HJ 1N34L 1W0TA 4NQWB 4DR4Q 1R4QB 1D2BA 2X1EA 5AIPA 3GTKJ 1WJAA 2B7EA 3HOYH 3HKZA 3BS1A 4BXXH 1Q7YC 2DT7B 2VT3A 2NYXA 4CJ2C 4EVOA 3VYSB 4A4IA 2K32A 4GNXC 1GOZA 4EQ5A 2EQRA 2KDOA 2K9SA 3WU1B 1RDPD 3AG3H 4U0YA 1U4MA 4G6TB 3QYBA 1S40A 5F64A 2M34A 3ERMA 4RG1A 3KP2A 2E76C 2PI0A 2VQFL 4DV7L 1Y1WH 2XGXA 3HOYJ 2E75C 2R7ZG 1H0MA 5CVIA 5C4XH 2B63B 3K1MA 4U88A 4BXXJ 1HHVA
chains in the Genus database with same CATH topology
4FYDA 1U4LA 1CZWA 1GUNA 1MSHA 4MIUA 3ZCOA 5BN4A 1TWHB 4IALA 3VR4A 2IJ0A 4AYBB 3DTKA 1HPCA 5JVH3 4OWRB 3N52A 1F2ZA 1D0ZA 1C48A 4F88A 1JQYD 3OYDA 1M4VA 2MYSA 2KA7A 4XN0A 2RBMA 4IURA 4NUBA 2CW7A 3D5SC 3RMHA 3TSSA 2FINB 3H5RA 2YU9B 5C4ZA 2EXZA 3KBXA 2EYHA 1WTWA 2B2VC 3SK6A 1IRXA 1OXXK 3NQTA 2LKVA 4G4KA 1FNUA 3DEPA 4LG3A 1H9KA 3KYLA 3V96A 2IGOA 2PZTA 1QB5D 3KF8A 1MSGA 4OGQC 1EEFD 2BA1A 4PFPA 1WJBA 1U4PA 2B8GA 3BVZA 3PUBA 3PO2B 4CUGA 3DKYA 2MJ8A 4PQXA 2EJMA 4DF7A 4IUQA 2RVLA 1DJRD 5JEAJ 5DAUA 3I72A 3PFYA 4CGYB 2AWOA 3OS1A 4IFDI 3NTKA 2M7BA 3VDXA 2NTTA 2R61A 2WAEA 1JWMD 1STGA 1DD2A 2M9VA 2E2IB 3OYHA 2WKDA 4RM3A 2FFKB 1EYCA 2R93B 3NTHA 1II3A 3MXGA 3ND9A 4QUCA 1WTXA 4ZK9B 4HNTA 5EBCA 3MKWB 2KJXA 1SE2A 3AFHA 1BR1A 4RM2A 2IGKA 4RGNA 1V5GA 2FUG2 3M1CA 1TS2A 3S2DB 2OEOA 1A6XA 4DXGA 4OAYA 3RZOB 1X19A 2VNUD 4II3A 2IGNA 3RPUD 3GTJB 3DTIA 4U87A 2F3WA 4PJLA 1RKNA 4PMWA 4HMJA 4E7HA 1EWCA 2F3VA 3MMYB 3VA7A 3DPTA 4HTHA 4Y7NB 3PUXA 1NG6A 1OXUA 2V4JC 1TKWB 1DZ1A 2SOBA 4KKUA 2X69A 2L11A 1Z6HA 4FF3A 1Y8NB 4BBSB 3T53B 4CCJA 2F0IA 3K4BA 1OO9B 1LVKA 2O5IC 4II2A 1UELB 1SJHD 3UI2A 1G6ZA 3SYTA 3I91A 5FO9B 3NPPA 5IGBA 4FNFA 2M3AA 2BDNA 4CCKA 2X6GA 5C5LA 1W36D 4ZYSA 3LNNA 3BCAA 1RTOA 3T13A 5KNDA 5E4XA 4X3KA 2XC7A 1FR3A 1MI2A 1TT2A 1MMAA 2CV2A 4C56C 2VJ4A 1G2TA 1I4QA 2VXWA 3A8KE 5E1FA 1Y8OB 4BDYA 2KEEA 1U9RA 4HAEA 3A8JE 3BLYA 1LT6D 2V7FA 1FD7D 4HSRA 2NUCA 1CA6A 4RHSA 4KKTA 2OF1A 3HOZB 2XVSA 2CV0A 4XLEA 3S32A 4ZYAA 2Y0SA 1B53A 2R7TA 1ONLA 3I3CA 4G7ZC 4RH6A 5EJWA 1Y6IA 2VKHA 3DMUA 4ZDPA 4B08A 2J7ZA 5EPJA 3A55A 5I9OA 5EPKA 1STBA 1D1CA 1SYCA 1Z21A 4XXEA 3OSOA 5C0XG 3MTSA 4F7XA 2BOSA 4G57A 3H91A 1TWFB 4RCNA 4A3EB 1SBBB 1SNQA 1BCPB 3E0JA 1OXVA 4N9TA 2V4DA 1DOKA 4XT3B 4DXFA 3VYTB 5HVQC 1H9RA 1TU2B 4Z9CB 4XKCA 5IGFA 1JORA 2EY6A 2BVLA 3OYJA 1ZYRD 4Y4RA 4C2UA 1MBYA 2CHBD 4OO1G 3S3MA 5IGCA 2WACA 3TDQA 2A6ED 2ZT9C 4BS9A 4HCSA 2K01A 2L0CA 3HL2A 3NQIA 2LC2A 4IUTA 5C4HA 2A69D 4XKBA 4L6TB 4IKFA 2CS3A 3NK9A 1B3AA 4ANJA 1UAAA 1YE9A 2ENBA 4XQNA 1V5FA 3HOSA 4DGZA 1Z7LA 3ND8A 2HNHA 2CW8A 2WY8Q 5CPRB 1S5CD 4J01A 4ZDLA 2PO4A 4CBVA 3RZDB 4BUPA 3PNTA 3F2UA 1Y56A 1A3UA 4HR7B 2O4XA 1EL0A 1R6RA 4C3HG 3TN2A 1B2TA 4J6HA 5C44B 4CCLA 3BDCA 1MGSA 1PTOF 1Q8IA 1DCZA 2LYCA 1PTOH 1SJED 1X3PA 3VR6A 3RTRA 2ZSIB 3L2QA 3WDNA 2QKLB 5KCMA 1WTRA 3SR1A 2JVHA 1S9HA 1AP0A 2HCIA 2K9MA 5K36G 1EY7A 3MKYB 2MGSA 3OS0A 1TS3A 3BYTB 2ICIA 5JPNC 2X85A 2VJJA 1LTTD 1MNDA 4H0LC 2I07B 1SNPA 4ULLA 3K5OA 1QNKA 4X0GA 2RA4A 1JE4A 1O78A 2A6TA 2B2UA 5KYIA 2LG4A 1LTAD 5KNBA 4K6DA 1EY4A 5TGTA 3MHBA 1DYQA 3OWTA 3LSKA 4AU7A 1SEBD 4V190 1XX8A 4IQJA 4NC7A 3OYKA 3IUOA 1FNWA 4HSVA 3I73A 1QG7A 2IGMA 2A6HD 2VB2X 2NVYB 2EYMA 3R2TA 3Q22A 3MXPA 1TQOA 3LWUA 4E7SA 2CMPA 2HDMA 2AQEA 2KL4A 1MD2D 1X1CA 1A2TA 1BCPC 2BE5C 3I9V2 3S17B 3H9GA 4A3KB 4FETA 2PW5A 2OV7A 4A3MB 3QOJA 1KAAA 1SMYD 4FXKC 2IS4A 1PXUA 4NP5A 1MMNA 2JUGA 3MZ5A 4HEA2 2HQAA 1W6KA 4EQPA 3CP8A 3UR3C 1EFID 5CORA 5JOBA 2K28A 1YNND 3M8JA 3DKXA 2F0FA 5ELBA 1HRJA 1QWYA 4K2KA 1WJ5A 3BG3A 2A5WA 1EWHA 1JWUD 3CKIB 4Q0FA 2R7OA 1ERDA 3LSGA 3EA6A 4RA8A 3D4WA 2UUZA 2UWMA 4X3SA 2VQGA 1XWEA 2KEDA 3D31A 1QE6A 2B2YA 3RLFA 3T51B 5FO8B 2WB1B 2I8DA 4HEDA 4ID6A 3ONAB 4NMZA 1A15A 5IGEA 4K5WA 4HN7A 1V8QA 1F2YA 3V2TA 2DCEA 4ZC3A 2D5DA 2K5QA 3D8GA 2Z4IA 2F5VA 3GV6A 3H09A 1B44D 3FEWX 1E0BA 4XL9A 1QCBD 3ERQA 4BA1I 4C1NK 3BDOA 4IN3A 4EGVA 1FYCA 4XYQA 1DOLA 2JSPA 4LIVA 2EPBA 1I4GA 2KUMA 4E6IA 2EYLA 4DGWB 2RKSA 5IODA 1I4RA 3P75A 1GLNA 1CTMA 3CHBD 4XLFA 5KIXA 2Q8TA 3PSIA 3AKZA 4OHJA 2Z8LA 1V1PA 5IGGA 1DQUA 4R8IA 4NKLA 3KLSX 3FKJA 1VCIA 3OL4A 1KABA 2XF6A 4BDZA 4K8JA 1SYEA 1PTOD 3A7LA 1JOKA 3I8ZA 2LY2A 2E1MB 4PK4A 2PZUA 4M1UB 1ZEQX 1S5BD 1LDKB 4X3UA 5CV4A 4ABNA 2VPLA 3DEEA 1HFGA 1QOHA 1V1OA 3OMYA 4XOPA 4RLFA 3QO2A 2X6XA 4HG2A 5HLTA 1G59A 2XAUA 4RLQA 2IT1A 4C3JB 2CFOA 2X1DA 3G7LA 5KYLA 4B3XA 3IL8A 1DOMA 3BVMA 5C3XA 3EJIA 2GOMA 3TMOA 3C1EA 4F55A 2A5HA 4BA2I 5JJZA 1Y1WB 5CQGA 4R8NA 3I70A 3SHLA 3BG6A 2MP1A 3K4JA 2B2TC 1TIID 2EY5A 1QJOA 2K5WA 2V26A 5LFAA 1B50A 3K57A 4IFDH 4J00A 2SDFA 5C4XB 5G3LF 1GHJA 1DXMA 1FNVA 3AL0B 4G7OC 2NN6G 2XN9C 4UDUC 4IQZA 2FMCA 2HVSA 1OLTA 3R93A 2K9LA 3W2AA 5C6AA 2Z1DA 5KEEA 1HQRD 2L9SA 2BW3B 4RCOA 3D5LA 3HC7A 4OO1I 2L4NA 1QILA 3CF2A 1LTRD 4KISA 1PYVA 1Z3XA 1U4RA 2O2LD 4DAVA 1HTLD 3EPZA 2EJGC 3S1MB 1PZJD 1J09A 3D6CA 4CHTB 3D4RA 3S1QB 3KEYA 1PFMA 1MW7A 5KNCA 1W6JA 3PUWA 1SDFA 2L12A 1K8OA 2KQRA 2WY7Q 3T56B 3AMUA 4N4NB 1EIHA 3OYLA 5M5YB 2UV1A 1VDZA 2JEAI 5EQ0A 2PJRB 4LJZC 1DONA 1KTKA 4KHZA 4ZAIA 3LSIA 2JA5B 1G2SA 3E5SA 4IFDJ 1LT5D 1EEID 4XTCS 4KY5A 1Q3LA 4Y3OA 5IIFA 4FVMA 2Q1ZB 2KP6A 2HU9A 2VKDA 3P7JA 3QB3A 3LSHA 2KCNA 3OR1C 1G8ZD 3RSNA 1J9OA 3PNVA 4ZDOA 2E1MC 2W82A 4B9WA 3TBIB 2F0SA 3VYRB 4KI0A 1O7LA 3PJRA 5CV8A 3G6JB 3DUZA 3R2IA 2PYKA 4YELA 1SYGA 4LITA 2EOTA 2IPKD 1F9PA 3IP4B 3GTMB 2DT6A 1Q1BA 1D1BA 3S8PA 4IX7A 2I46A 2A73B 4H44C 4QIWB 1NG7A 2JYOA 1UUPA 2K33A 2N55A 4KN7C 1W36C 3MVVA 4ITVA 3Q23A 2QCPX 3A4CA 4JBWA 3NSWA 1I6VC 3PMFA 3D3RA 1EZ8A 2K1BA 2WBMA 1I4XA 3J7AY 3PUZA 2DOAA 2X6WA 1EIGA 3OYEA 3BVGA 4DU9A 1WTPA 2L5TA 2NTSA 4XLCA 5D65A 4G7HC 2ELJA 4HSTA 1YNJD 1Y69U 3AL0C 2KCCA 3HOTA 2B2WC 3E1SA 1R4PB 2F0EA 1NR4A 4DK0A 2R7XA 1CK1A 1EU3A 2L9HA 4E4HA 4U7BA 4EATA 2SNSA 2LMCB 5D14A 4K6LA 3TP7A 1JOQA