3HG9A

Crystal structure of putative pilm protein from pseudomonas aeruginosa 2192
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
119
structure length
119
Chain Sequence
LAEVDTLARSLLLYRSRLAEYAHANPGFSGSPADSALGLPAWFRKPVRLQGYIAAGTSYAFIASPPAGLAAAVDTGTESDLVGVRRNGQLVTRRLGATAIALPAPIPEGAVVAVKEGHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title CRYSTAL STRUCTURE OF putative pilM protein from Pseudomonas aeruginosa 2192
rcsb
source organism Pseudomonas aeruginosa
molecule tags Structural genomics, unknown function
molecule keywords PilM
total genus 16
structure length 119
sequence length 119
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-05-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1170 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3hg9A01
2.40.50.380 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3hg9A02
3HG9A
chains in the Genus database with same CATH superfamily
5GPAA 2F0TA 5KCMA 4GNXB 3CTAA 5L3CA 3ZQIA 1H9GA 2ID6A 3ULPA 1VQBA 1JC7A 3DLLF 3NXWA 3CD6I 1FBSA 5B3SH 1HNXQ 5L3GA 2ZNYA 1TXYA 2I46A 4I2OA 5IWAL 4HQEA 4CUGA 2MLGA 1EY8A 1OTCA 3A1YA 2NN6G 2KQRA 4RH6A 2A73B 4LFAL 1TZLA 1U8BA 2Q2HA 1XX8A 1EH8A 3C2GA 2IA1A 5J8CA 3U1DA 1B50A 2HDCA 4DV7Q 2R7TA 5FKAC 1H8AC 1NR4A 1SEUA 4XLFA 5M3MG 3A01A 2F0OA 5FROA 5JFRA 5FLMJ 3WGIA 3CCJI 1QUQA 3U9OA 2K5VA 4K8IA 4S0HB 2B63J 3PUVA 1X54A 2NZHA 1RZ4A 2Z8LA 1EF4A 2F6CA 1BXTA 3OWEB 1N75A 2CW8A 2K85A 2UXNA 1A6IA 4UHTA 3V8LA 2C6YA 3T4AC 1DP3A 1ICWA 3FHWA 4XKBA 4XTCS 1MGTA 2KEDA 3MA2B 4CCMA 1YW9A 4HJ7A 1V5EA 1JJ6C 1Y1WG 1VQFA 1I6HB 3NHHA 1KLUD 1LVKA 3QPLA 5L3FA 5DS9A 3TZDA 3ECHA 4PSXA 1PH3A 4UHVA 5HURA 4LG0A 1YNND 1GO3E 1EH6A 3OL4A 5F0HA 4OIOF 3GTJJ 3A2KA 3PO2H 4QIWN 3FVQA 4QF4A 5IT9E 4A3BG 3TS2A 2O9LA 2I5UA 3WODF 5IOCA 4V0BA 3H0DA 2HDLA 4DR7Q 2LTPA 1HC8A 2PPBC 1ZK8A 2HQ5A 1X3PA 2O5JC 1HJPA 3B02A 3A03A 4XIDA 3WOEA 4O3MA 4A3BH 3L2PA 1X1AA 2EE1A 4A3FG 2DODA 2X1CA 3HOXG 3WU1B 3GTMH 2LLKA 4QB4A 3KJPA 4DV2L 2EY5A 3MKLA 2GM4A 2LOOA 3IFTA 2DFIA 2AMCB 3SVMA 2W24A 3MEXA 3EYIA 5IY0A 2QQAA 3V2TA 2UXDQ 3ZMZA 2STWA 1R9TH 5E17F 1UE5A 4KTAA 1O7LA 1STAA 3AG2H 4A3CH 4JOMA 3MXGA 1PTOH 3H92A 1QB5D 2FNPA 4DFAA 2A6HD 3T16A 1LT5D 3KYDB 5E3OA 1Y0UA 4JI1Q 1VF5C 2WINB 4B8XA 1W7PD 5GROA 2V1UA 4HIOA 3CC2I 3HTSB 4DXFA 5BN3A 2RREA 2PI2A 5D14A 1VMPA 5B66C 4EVIA 2KECA 4UB8C 3FDTA 3U21A 3CQZJ 4C3JH 1PYWD 3HTUA 4HIDA 3F2CA 2F52A 1JE5A 4XLHA 1BDOA 2RKHA 2NVQH 4CO8A 4H7BA 1SC7A 2NVXB 1ERDA 3L2QA 5BNGA 3PL8A 2VQFL 3A5UA 1SYGA 1FGBD 3HOWB 2ZCWA 3PUYA 1SNDA 2VIXA 1R4MB 4XKCA 4LITA 1PLFA 4X65L 1Z3YA 1L0YB 3NELA 4XYOA 2IEKA 1U0JA 4ESFA 3V42A 1HZ9A 1EY0A 3HM5A 2UUCL 3I4LA 5HS9A 3HOYB 4GKJQ 1HTLD 1G2SA 4EQ5A 2MPMA 3KFUA 1X55A 3DLAA 2HYFA 2EV5A 1SYBA 1L0WA 4OAYA 1LACA 1YE9A 3ZR8X 4HSPA 4YFNF 5FLXK 3J7AY 4YEJA 4HEDA 5C3EJ 4CHTB 4BQOA 1ZN2A 2CYYA 4U0WA 1L3LA 1HW2A 1IV6A 3P1HA 3Q23A 1ZGWA 1Y6IA 1O3SA 1WFQA 1FZPB 2OAZA 3HRMA 1STGA 1XSDA 2K6AA 2CCZA 2KL4A 1FMVA 4YIIA 4A3MB 1AP0A 2GA4B 3IL2A 1JQYD 2WIIB 5CLSA 1F1ZA 2XGEA 3RCOA 2VJ5A 4P72A 4C9YA 3R0JA 3BG6A 2XAGA 5F2DA 5J1ZA 5CV4A 2P4WA 1OXUA 3S24A 3BTIA 4UXNA 3KP7A 3JAMK 1CZGA 1VQLI 1QCBD 2QSFX 3G1OA 4Y52J 2JT1A 2P6TA 2L4NA 4XQQA 4A3MJ 4HCSA 1LEBA 2WKCA 5M3FB 2A69F 1MDMB 4QIWB 2XIWA 1VQDA 4N0BA 3H0GH 3WTTC 4I0BA 2V9VA 4ZCKA 5DD8A 1ZREA 1PDNC 5DEHA 3P9KA 4DAPA 3SHFA 3HPHA 4K5WA 2IHFA 1DQUA 3A55A 2CUEA 4X3TA 3RR5A 4B3RL 4N9PA 1U9OA 1H9JA 2NNYA 1PFBA 4UY8I 1QZEA 4UPAA 2OZUA 1KL9A 2IGOA 3P9IA 1I94L 1FR3A 3SQNA 3KF6B 1HSJA 2B29A 1JUMA 1SVMA 3KF8A 3WTSC 2IL8A 2DJNA 4DV6L 4ZYAA 3VFZA 3A7LA 1TQIA 2L55A 2UUZA 2BV6A 2CVRA 2IT0A 3LGJA 3DBRB 1O7YA 1D8LA 3QOEA 3R60A 3IRBA 3G71A 2HYGD 1O3QA 2JJ7A 2KIMA 2P5KA 4DR6Q 2EY6A 2KQ3A 3OS1A 3NPPA 4KNYA 2G5DA 2LMCB 3WWVA 2K3PA 2JQ7A 1Q82C 4JYKA 4JI5Q 1FJGL 4I99C 3OMCA 1LUZA 3ML6A 3L09A 1CKNB 2O5IC 1CGPA 3FMRA 4WXHA 2QSGX 4L5JA 3M4QA 3TP8A 4MN3A 2AQ1B 1B53A 3H94A 3T1HL 4DR4L 1FGUA 1J9OA 3L2CA 5KIXA 5IYDJ 1RJTA 1N32L 2IW5A 1PH4A 3C3LA 1R5HA 3GFJA 1QILA 4ZKCB 5CYVA 4AYBA 1EV7A 1KNEA 4J01A 4XSXF 3D8GA 3G7LA 2XVCA 3H09A 1XNRQ 4KKSA 4DR4Q 3IC7A 1JUPA 1UE1A 3SK6A 2F0VA 3F8TA 5NUCA 4LF9L 4OMYA 4IHXA 1ICFB 1S4ZA 1P7IA 1CF7A 1P7JA 4I7HA 2M8EA 5DM73 1DOKA 2K5CA 1B2TA 1TWHJ 1Q86C 1JJCB 1S9HA 2COMA 4L5EA 4AD9A 3IAM2 4HNTA 5J3LA 2P0WA 4PJJA 5D5XB 3DKWA 2K4JA 2EZLA 5FLXL 2COBA 1IN4A 1YX5A 2RNGA 5J3BA 2JWTA 2X6LA 5ICGA 5TISC 3SZPA 4BACA 2NVYB 3KFWX 2EZVA 4HBLA 1TTYA 2FXAA 1OYIA 3BZ6A 1OCOH 2DMPA 2CQ7A 2Z1DA 1N33L 4IHVA 4FO2A 2A19A 1A04A 3SK4A 4DGWB 5D5VB 1VF9A 3H5AA 4RA8A 1AHDP 1S7EA 1ZRDA 4KT5C 5E1ZB 4GKKQ 3PIP3 3CPWA 1Y1WH 2R7ZH 2LY2A 3NENA 4I76A 1BIAA 3CCRA 2TRTA 3MHBA 2FNAA 1XSXA 3S2DB 3JRGA 2CQOA 1HNZL 4JX6A 2P7CB 2RV8A 1HQCA 2BE5F 3NTIA 4NXNQ 2DBBA 1ENAA 4KK7A 1V1QA 3CMEA 3GLXA 5JHUA 3RKWA 4KY6A 3LWFA 2UUBL 2K52A 2Y9ZA 2E2DC 3P9CA 4ZDLA 4IOAA 5K5OA 1SNQA 2MSYA 4BHPA 1GUTA 1EQQA 2XGTA 2IP2A 4HZFA 1SDFA 3PIOF 2MQHA 3ZXSA 5ILVA 4BY1J 4XQNA 1HNZQ 1GD7A 3EUHA 3NK9A 5E18F 4WXCA 4Q5VA 3GWZA 3ECOA 2UXCL 5GQOA 3H0GG 4HNVA 2FF4A 4NPSA 2QVOA 4KMFA 1Q8IA 2EILH 4EQOA 2RSNA 4C3HG 1ZRFA 3BR1A 3H91A 2WY7Q 4QLCU 3OMYA 1J75A 1PRTB 2DT6A 2HWVA 3RLOA 1EWCA 2Z1CA 3OYJA 3GO5A 1MJAA 5ICEA 1NSNS 4NNJA 2W48A 1I27A 2HU9A 2SNSA 4CDEC 2ZXWH 1MSEC 3WU0A 1S5ED 1F4KA 3JSPA 2UV1A 4DZPA 4HG2A 2X6OA 4DGZA 1UJ8A 2V1DA 3IRRA 1YJ9A 1HZBA 3FBNB 2IX1A 2VB3X 1USTA 1TWCJ 1B1ZA 2OQGA 4ULLA 3FXJA 1LTID 4EGVA 2K50A 4BHCA 4PZ6A 1Q7YC 3IAYA 1ZKOA 1ZR4A 1VQKI 2R7WA 3JAMi 1GV2A 4OAZA 2RCNA 3CCLA 4MIUA 4A3KH 1KHIA 4CGZA 2FEZA 3CLQA 3CPFA 2QENA 2IVMA 3LQQA 3RJPA 2JEAI 1Y1WB 3IUOA 1PHJA 4NXMQ 3KEQA 1EWIA 1TT5B 4M9SA 2ELJA 5JLWA 5ELCA 3GP7A 5EPJA 1FX7A 3UI2A 3GD7A 1PMRA 2QSHX 2YU3A 3S2HB 3PNTA 3HS0C 1PRTF 3DWLE 4XIGS 4RKBA 3RPUD 1SFKA 3OOPA 1KAWA 2LYCA 3DPLC 3CF5F 4BXUA 3OL3A 2A6HC 3FKIH 4IQZA 4KDPA 4EJOA 4MO7A 4C3IB 2IS1A 2EWNA 1FMWA 4RGXA 1FNNA 2XPUA 3HB9A 1NHAA 1HFGA 1YO5C 1SFUA 2E2JH 2CS3A 1L1OA 4KYWA 1Z1DA 3HOWJ 1XDUA 3EETA 4BKXA 2MJ8A 3S2DH 1FT9A 4L5TA 2ICEC 1W6KA 4S04A 2K01A 3T56B 2DDBA 1EKEA 4EGZA 3MXNB 3KX2A 1K3BC 1KDCA 3F6VA 1ODDA 4DV5L 2K9NA 2H1EA 1HFNA 3K8AA 1QQIA 1TWGH 4LFBL 1BI1A 1ITYA 1UCRA 5CORA 2EFPA 4ENJA 5KNLA 1VTNC 2EFWA 3GTLJ 5EYRA 3U4ZA 3HRSA 1FSHA 1H9TA 1ZQ3P 4RG1A 1PXUA 1TNSA 4HMJA 2HEOA 1W0UA 3BZCA 3TDUC 1B72B 4KN7X 2RDFA 4XORA 1R5ID 4A3IG 4A3DG 4M3FA 2KHMA 2HZTA 5M3MH 2AQ3B 5TRDA 3MKWB 4YCUA 1KRTA 1QVTA 4V2GA 1A15A 4Y3OA 2KISA 2BE5C 3D6CA 4UV9A 3HJEA 2VN2A 3FKIG 4LB5A 3E0EA 3FDYA 5IP7J 3ZYYX 4XLPF 2RA4A 3PFIA 4EM0B 3L9FA 1SE8A 3DPUA 4CDFC 4RGSA 2CQNA 1I6XA 4X1EA 1MBEA 2X1EA 2N55A 4QMGA 1RC9A 2OTLI 1DXMA 4DNCA 3QWLA 2HQEA 1EY9A 3TSSA 5KAIC 1T33A 3RZDH 5L3BA 4YRVA 3SZGA 3CCRI 1X9NA 3I70A 2HFHA 2QEXI 3BQZA 1YBYA 4XQJA 4OX9L 1LE8A 3CCVA 2QCOA 2I0QA 3PO2G 3NP8A 5BR8Q 5J4YA 3GTMB 1OJLA 2EXZA 3E6DA 1NY4A 1I6HJ 5D8LB 4OELB 1MSHA 2GXBA 2K33A 1BF4A 4AVPA 2X9DA 1K0RA 1A36A 3N97A 4L5IA 4C3HH 4DAYB 3IWZA 3CUQC 4B43A 5E1FA 2RNJA 3TO7A 4B44A 1IC8A 5FRMA 3FXKA 2HYJA 1LLRD 5FRNA 1FC3A 2Q8IB 3GTMJ 4PUSA 1R22A 3ND9A 5FLXc 3R2TA 1VQMI 3K7AB 3VYUA 2OTLA 2R93G 1WSUA 1EZ6A 4IUQA 3NRVA 4E4HA 1VQPI 4DK1A 2K02A 2ZJRA 2FJ1A 1X1DA 1LFPA 2DA6A 4PZJA 3FMSA 4CDDC 4O42A 3GTJB 4XQFA 4B9WA 3SE0A 1SFOH 1D6EC 1GXDC 5IP7G 1TWGB 3CCSA 4G7OF 2X48A 3HEFA 5K7ZA 2AWOA 3WGGA 3Q5FA 1XNQQ 1Y1VG 5IYBH 3BZKA 3F8CA 5GADJ 2GOMA 5DDGA 2OU2A 1GVPA 5KAFC 2EFOA 4A3DJ 1WCMJ 3LFKA 1BOSA 5EQ0A 3DU5A 4KMUX 3WE3A 2KDOA 2RKSA 5J47A 1MD2D 5EDNA 5FJ8H 1N77A 2O3FA 3REOA 4RB0A 5ERIA 1Z7TA 2DA7A 4CJ2C 2EJRA 1IJWC 5GPCA 2A61A 2LG4A 3B6YA 5DYMA 1VQOI 4L6TB 3BJOA 1STBA 1RKNA 4GYIA 3OPOA 4YWKA 2UU9Q 2Q8TA 4A3CJ 1JCKB 3I4NB 4BDYA 2BA1A 3FISA 2B2TC 3NQTA 3ICEA 1TY0A 4XM3A 1SMYC 4HCEA 4HSRA 2WWYA 1OXVA 2AKWB 3F6OA 3JTHA 2IPQX 3FPUB 2X69A 3UR3C 2F0WA 4A0YA 5EBDA 4ESBA 5GP9A 4HSVA 1UAAA 3HOVH 2Q2EB 2HTSA 4MEYF 4U0VA 3VA7A 1VQLA 3HZJA 2DY7A 1B4OA 4HIMA 2D2CC 1OO9B 3W2AA 1FIPA 3T1BA 3I91A 2M8GX 1R36A 2L12A 4LUVA 2ZKZA 2XKPA 1J0RA 1JWUD 3CUOA 2ZSIB 2GVAA 3MKZA 1AKHB 3LWUA 3PV0A 5D8KB 1TS3A 1RRJA 3I4MJ 3BTJA 4CYCA 2H27A 4UUSA 5JEAH 1WVRA 5D5WB 2CQQA 2YTYA 2MYSA 3P7NA 3KEOA 4RGRA 2RVCA 2EZIA 5IE8A 1NH3A 2PNRC 3F21A 4G9YA 4V2FA 4AIJA 3K59A 5I9OA 5LMNL 2KIFA 2PMZE 2J0TD 1YI2I 3IHUA 2QDBA 5IT9c 2O6GE 1ASYA 1STYA 4RGMA 3BG5A 4RMFA 1I94Q 2Q0OA 1VQGA 1FSEA 2F5VA 1EYDA 5I4DA 2RN7A 2XSDC 3EYYA 3CO6C 1HRJA 1EEID 2JA5B 4C30A 1KDAA 3OW2A 1MMSA 3HHGA 3CDHA 1TU2B 1IBMQ 5EF6A 2NVQJ 3CUQB 5CVVA 3KZIC 2A68F 4BBRG 3K9TA 1SEBD 3SEQA 4K6LA 5HVQC 2KDZA 1B9MA 2BVMA 2QBYA 2ZXHA 2Q2EA 4DR6L 1LT3D 1S3JA 1RD9D 2GA2A 4K5XA 2VT2A 1QHHD 3M8JA 1NR2A 2EDGA 4ZRZA 4QIWE 3NQIA 5ICCA 4JP0A 2LD5A 5JPNC 2FOKA 4OWRB 3K4BA 5HNFA 1FYCA 1RHPA 2MO0A 2RHSB 3CUQA 1IBKQ 4JI4Q 2DFFA 4X3UA 5D3IB 5IYBG 3BY6A 2HOTA 1Y1VH 2QGQA 4C3IH 3D0SA 4HLXA 1SYFA 5DM63 3J7ZC 5F0FA 5D65A 4O5VA 3HDDA 1HSTA 3L7ZC 3HFZB 5HLTA 3IH4A 2L7FP 4B08A 2QZ8A 3E3XA 1Y1VJ 3KLSX 4PSWA 2D0OA 4J6HA 3MFGA 4AIMA 2IRFG 3NBHA 3HC7A 3J7AO 1AOYA 1X65A 2H6BA 4XRSG 4DV1L 2M30A 3G6EA 1FP2A 1VCIA 5BN5A 4P1WA 4BY7B 2PZUA 4BXXG 4AIKA 1VQEA 4LLLA 1S3OA 3BLYA 1I6HH 1X1BA 4DUZQ 3CP2A 1XJVA 1S5BD 4MGRA 1HUNA 2DN0A 2PJRB 1REPC 2O4XA 4MEXF 2A07F 4FCYA 3PCOB 2JXMB 1ZARA 5HGTA 2R5ZB 2A5YB 2DTRA 4IFDJ 3WG7H 2NUCA 2E5ZA 4A3FJ 3LA7A 1TLHB 4M74A 4HAEA 4KIBA 2B2TA 1J59A 1DD2A 4OO1H 4JBKA 5EEHA 3VYRA 1SVOA 4DAYA 3NAUA 1QO0D 1D1KA 3FXQA 5LRSA 4XSZF 3RZOJ 4PMBA 3CCMA 4A3KG 3S15J 3GCMA 4WCGA 1SROA 3M1CA 5KK1A 4A3BJ 2A68C 2K9QA 1ML0D 1MBYA 3M7GA 4ABZA 2Z4HA 1R23A 4R8IA 4KIFA 1QNTA 2JVGA 1GXPA 4CKEA 2WAQA 2KENA 1T5EA 2A68D 2PYKA 2HUGA 2M1BA 3PO2J 5I6WA 2LXKA 5FD5A 1JKOC 3BYTB 4LFCL 2ICWG 5M5WH 3HBLA 1FTZA 4DYCA 2HIVA 4P9FA 4AYBE 3FZVA 2VODA 2H8WA 4CCJA 2YX7A 2B63G 3G4SA 1YNXA 1VQ4A 1PTOF 4LFUA 2JVHA 1XPRA 3I4NH 2EZHA 4OOIA 2NYXA 1E1OA 3H9GA 2PMZB 4A2UA 4MHEA 4Z9CB 2CGPA 2F1MA 3VYSA 5IYDG 1D0YA 1PZID 2ZJRF 4MLOA 5FLMH 1VS0A 3MQ0A 2JA6H 1E3OC 1B72A 2K28A 5EPLA 3GZNB 1E2XA 4QL5A 2HDWA 1TS2A 2VPRA 2DQRA 1TWAJ 4EGYA 4LF4Q 5LL6X 1U6GA 2GQQA 4A3IJ 4JOIA 4A4IA 2Z9OA 3QPTA 4BA1I 3FRPB 1QOHA 1HCZA 3I53A 4QSHA 1K8GA 3S1QJ 1SVLA 4RAYA 5FK9C 2JRTA 3KDFB 1W4MA 2J4XA 1SAPA 4J00A 4HF2A 4RS8A 4UV8A 3J81Z 1MD0A 4AYBN 3VR2A 1SE3A 1ENHA 4JBJA 4BQQA 4CZCA 1EIYB 3ZQFA 1V1PA 2LY7A 3DTEA 2YTVA 1QPMA 1UUPA 2DNCA 1K0SA 5DM6F 1GVDA 4WX9A 5IYBJ 2I10A 2WAQG 3JCUC 4P75A 1R1UA 1RKTA 1KNAA 4IQ4A 2CMPA 3E6MA 4KA4A 3T1YL 1LTLA 2AXTC 1V8QA 5IYCG 1QZHA 3LNQA 2XPVA 3SDBA 1G3WA 4IKFA 1DU0A 5FJ8J 2EIJH 3D4RA 3MC0B 2CW7A 2EA2A 4IURA 3DBHB 4KISA 5C4JJ 1EIHA 2KCCA 4DNIA 3STBD 2DXIA 3K10A 3I54A 2K5WA 2PW7A 3OYCA 4IVNA 3E9HA 4HX4A 1MW7A 2RF4A 3A56A 1BL0A 2CU7A 4E7KA 1TWHB 5F1RA 1X2MA 1VF7A 2ZJ2A 1MMGA 2JUGA 1PVEA 5F64A 2DJFC 1EH7A 2L0CA 3ZGKA 1N36L 3CCEI 2VNUD 2JPCA 5FLXZ 3FBIB 3G1LA 3HGBA 1WJDA 2V9PA 1XS9A 4JOIC 2JZYA 2G9WA 1LYLA 2A6TA 1XD7A 3HL2A 1WTQA 3CC4I 1RL2A 1F9RA 5CMDA 5M3MB 5HDGA 1YEZA 2Q2IA 3K1MA 3GBGA 1FY7A 2K7VA 4LFBQ 5D4SA 3MZ8A 3J81L 1I5FA 4B3SL 2A6EF 1QZYA 4A5MA 3EQLF 2YTXA 1WJ5A 3ASNH 5AJ3Q 1JICA 4Y4RA 4L9VA 5M5XJ 3CCEA 3OS2A 3WTYC 4ZKBB 1WGXA 2WB1N 5I6YA 2D5VA 2IS6A 4JI3Q 3EFXD 3MD2A 1P92A 1V4RA 2F0KA 4IHWA 3DEPA 4MTNA 4BAYA 1OCRH 4AU7A 1X3FA 3LNNA 4CJ0B 5EGOB 3T1YQ 1RDPD 3C7JA 2ZTDA 3H0GJ 2VJIA 5JI6A 5KNDA 3OTOL 3KYCB 2KLOA 5FO8B 1O7FA 1YQAA 2HQRA 2L9VA 2Y0SN 3VPRA 4M6VA 1SMYD 2PJRA 4DV3L 1S8NA 4JV5Q 4NKLA 1Z21A 1STHA 2VB2X 2VQFQ 4C2MJ 2EA4A 1KRSA 4F3QA 2L0KA 2F48A 2BW3A 2XB5A 5C4XG 3BC8A 2ESHA 1EOTA 4DV2Q 3T53B 3CP0A 3AFQA 2B2WA 4P55A 4EJWA 3EUAA 3K4LA 1ZLKA 3GYHX 1CM9A 1M4VA 5M9OA 4IZZA 3OIOA 2EFNA 3CKIB 1ZXTA 1TW3A 2MGQA 4P9UA 5HDKA 5T1IA 3PMFA 3DXJF 3KK7A 3RD4A 4F8MA 4KY7A 3OYMA 4IHSA 4PZ7A 2IJLA 5LLQA 3PF4A 2L7ZA 3WHBA 1JKQC 1V1OA 3TKYA 2Z2SB 2A6ED 2VQGA 1TKWB 1CA6A 1WJAA 2WFWA 4LD5A 3Q0WA 1IKMA 4Q47A 3CZ6A 1HNWL 1RIPA 3VYRB 3TP0A 4X62L 3TP5A 3KLRA 3T8TA 3S14J 2NTSA 3BCAA 4M3BA 3R6SA 4DV7L 3ZN0A 2HVRA 5B5EC 3F1ZA 4IRIA 3D5LA 2IX3A 3TW6A 3I0TA 1DPUA 3M7NA 5HLHA 4JI8L 3GTOJ 1HOMA 2ASBA 2F0NA 2R7FA 4P74A 3Q0VA 2BXZA 2OA4A 2YX4A 2V6CA 2CRGA 2KZGA 4HF0A 5AFWA 3FX3A 2ZXRA 4IX7A 1B7YB 3ULLA 1Y1WJ 2XROA 1CF7B 2OZ6A 3S2HJ 3IKVA 3CW2C 2YU9H 2VZAA 2L02A 4BBRH 4L5SA 1LT4D 1TWAH 3TREA 1LTGD 1J6QA 4XN3A 2GXGA 4A3GG 2IAIA 1NK2P 1FWZA 3J81E 1UEAB 4DJAA 4BY7J 4HIKA 4Z2YA 1GKHA 2PG4A 2HHHL 1I4XA 2Y0SB 1MBJA 4NC7A 4F93B 1L0XB 3EJIA 1OXXK 3FK7A 2MC4A 1OR7C 4HA8A 1OYWA 3V7SA 4I7ZC 4ZH4F 1E24A 2W85A 3AAFA 1HQRD 3CC7I 1POGA 2B0LA 2FOWA 1U5TA 3CCMI 3HOSA 3J7AV 1Z67A 2FA5A 4XN0A 3DMUA 3PNVA 4OWTB 1YHQI 1IW7D 4LUOA 4YCWA 3ZMDA 1DCZA 1Y8RB 1Z91A 2K9LA 2L54A 1IUYA 3BROA 1HHVA 3OSFA 4A0XA 2XGCA 4RWSC 4B4CA 3CP8A 1N8RC 2X6WA 4BJ6C 4BY7H 5CV6A 2ZB9A 1ZGAA 3QAHA 4JI8Q 2MG4A 3GW2A 4DUYL 1MIUA 2V4JC 1MJBA 1BR9A 1UWVA 2G7UA 2DPUA 1H9MA 5F04A 2NS0A 1YHBA 4XLEA 1R5GA 3OR1C 3I7FA 1PH2A 2FBKA 3GTLB 1N34L 1FYKA 2L9NA 5HOOA 1B44D 3CD6A 2G9DA 4IPAA 2Y69H 2DT5A 1S72I 4QUFA 4LJZF 1TWFB 4QWQA 1F9SA 5DTDA 1ETXA 2R7OA 3W6KB 2KCTA 3STBC 5FD6A 1RUNA 2R7VA 2HPIA 2OQKA 4WFN3 3Q24A 1BR1A 1R7JA 1Y14B 1RETA 2KHJA 2XTIA 2RDGA 1WD1A 1U0LA 4A3DB 3PO3J 3CDIA 4RM3A 4A6DA 4MTEA 2XAJA 3SZTA 3GFLA 1WJCA 2FUG2 3KJOA 5J39A 3WE2A 1XMQQ 3BTCA 1G2TA 2TDXA 2UUCQ 2LKPA 2Y9YA 5HODA 1K7AA 1PP8F 2JEBI 2XF6A 3KE2A 2YS9A 2B2YA 2YR2A 5K5PA 1TWFJ 1Z05A 1LO5D 4L9JA 4JI6L 4RCNA 4KJOA 1CQTA 4HF1A 5HS7A 4OEMB 1QVUA 4FVMA 4FETA 3PF5A 5C5LA 2Z5UA 4LUZA 4IPCA 2VJJA 3RPUA 1OXTA 3CC4A 5IIFA 1BI3A 1GT0C 1SD5A 1VDZA 4DZJA 2ACJA 1VQ6A 2A3SA 2FU4A 4PMCA 1BCPC 1DOMA 2CFOA 4P5OA 2ZTCA 1BJAA 5E3LA 4HRIA 2WC2A 4FP5D 1SJHD 5ICFA 4C2UA 2RGVA 2C35B 5I2YA 5IODA 2XUBA 3C3WA 1E17A 3RSNA 3H3VH 1FEXA 2EZKA 2EOTA 3SGIA 3JREA 4II3A 4EM2A 3M4PA 1IF1A 1K83B 3ZPLA 1Z9CA 3UDGA 2JA7J 2FMMA 3CJTB 1BO0A 3I71A 4ME5A 4GN3B 2KA7A 1U4LA 4L0ZB 2ZJPA 1S40A 2N49A 1KAAA 1FOYA 4LB6B 3T5XA 3S16J 1X3QA 2KHIA 1C0AA 2CH4W 1FTTA 2MBFA 2PW5A 2O8XA 4M71A 1ETWA 3CJQB 1WCMB 4OIQF 1WYDA 4LGWA 2Y30A 1K6YA 3HOVB 3PUFA 4WF2A 5E3MA 3GF2A 4EMSA 4BY1G 1KU2A 2WV6D 1K28A 3QODA 1PH5A 2X85A 5EKKA 4BXXH 3CQZB 3O6BB 1W1WE 4Y7NH 3MWYW 1BBUA 2FQ3A 5EZHA 4IJLA 2LBFA 1SSOA 2DGYA 5IP6A 3I64A 1GUSA 4QPQA 2DNEA 4IJAA 1O3TA 3OYDA 4ZTJA 1Z0XA 1PA6A 2M9VA 5T1GA 2DU9A 3DEEA 1PZJD 2PQ8A 2IXSA 5K5RA 2DFHA 1RR7A 4CH7A 1RPWA 4C2MH 1O7ZA 4EQNA 4HLYA 2F0IA 2F5FA 2YU9J 1S6LA 3M4OH 2B8FA 3CF5A 2H94A 4EJTA 1XN7A 3UE1A 3HOUG 2F4VQ 3BJ6A 4NUBA 1SBBB 4I7AA 2X4HA 3CMYA 3FPPA 3PQKA 4HTHA 1K83H 1KQSA 3UKGA 4BA2I 2NZ1D 3RN5A 2HI3A 2MC3A 3VYTA 4LIVA 1I4QA 4RLQA 1UE6A 4ID6A 3KBXA 3HP3A 5DM7F 2IY5B 1FPQA 4JCVE 3CO7C 2CFXA 4ILWA 4A3FH 4GLAC 5H6QA 3HOYH 1QE6A 1OISA 2QKIC 4BEHA 2BH2A 4H4KC 5IYCH 2BZTA 4R8NA 4H44C 2KRCA 4YIRX 3TO6A 1A2UA 3K4CA 3D5SC 2V1NA 4ZK9B 5M3FG 1L2FA 1P6RA 3DFGA 2IHEA 1AWCA 5HY6A 5C0XG 5IGBA 3RLFA 4C1NI 1XTAA 3GTGH 1Q1BA 2EBIA 2ZXIA 2NVQB 3DM3A 2HOSA 2DFEA 1EUJA 3L0OA 2Y75A 2E1MB 5FLMG 4FASD 1WTVA 2UUAL 4IFDI 4DK3C 3GTPH 1OCPA 2K9MA 1HDDC 1PTOC 3CCVI 4NHJA 4N9TA 3PSIA 2DLLA 5J4VA 3PIPF 3PO3H 4G94A 4LF5Q 4JI0L 3HOTA 1MIJA 3RDIA 4HNUA 4R1HA 4W1UA 2MFIA 4CA0A 2WY8Q 1HKTA 2JA6B 4OXPA 3MVPA 4GKKL 1MH4A 4UP7A 1BKBA 2L1BA 2CHBD 1EFID 3RKQA 1DP7P 2B7EA 2CV1A 3KLNA 4ZDPA 4B3XA 2VUMG 3U50C 3NEUA 3V7RA 1YNJC 2PI0A 2DDAA 2DT7B 1JKRC 2Q8RE 3ZQQA 2PFBA 3W6VA 5IGDA 1PZKD 1XPOA 2JTVA 3HOXH 2G9HD 2PQAA 4OIRF 3DHQA 2R7UA 2E71A 2M4KA 4M73A 2PJPA 2EPBA 4L5RC 3BDOA 2R93H 2LY1A 2AWNA 2L9SA 3TBIA 1PP7U 3G4SI 2B3GA 2PLYA 3PUWA 1X3UA 1N36Q 1M8AA 1U8RA 4XR6A 2AXLA 2ZFWA 3BS1A 4ZJZA 5CBEE 4A12A 3G48A 1HUMA 1YZ6A 1SFXA 1NNXA 4DR2L 2RVLA 2F0UA 2K86A 4M3DA 4R4TA 2Q1ZB 1SAUA 3ZRGA 2RQPA 3IL8A 2ID0A 2CFMA 2AHOB 2PQAB 3A01B 1HLVA 4PG3A 2R3ZA 3Q0AA 3DWAA 4FT8A 3QYBA 3QOPA 4L9TA 5A2QL 1XX5A 1FL0A 3GFMA 4XMYA 2E74C 1QPIA 4ZUIA 1TT0A 3RNUA 3KP2A 1BC7C 1HNXL 4LF8L 3KPHA 3S1RH 1Y8QB 1QNUA 2A69D 2QYOA 1B8IB 3GZ6A 3SFZA 4JYAQ 3D5RC 1S5FD 5J22A 2JJQA 1F9QA 1VQ7A 2JE6I 4R1JA 4BY7G 4K6DA 1UZCA 1YJ9I 3QP5A 1DONA 5M3FJ 4IHYA 1KU3A 3K4NA 2A1AA 2FXQA 4MZ9A 5KNCA 5HGQA 2NB0A 1WD0A 3FKIB 2BY0A 5EJWA 3OOCA 3O2PE 1ET9A 3QOLA 5K7HA 1YNNC 2X1DA 5H2FC 3ISPA 4AIDA 1MJCA 1IYVA 2HQLA 1B6AA 1A63A 2QW7A 2CH4A 2B8GA 1T0FA 3I4MH 2LNBA 3IV5A 4EEFG 3S1MH 4KHZA 4ZDOA 4A3BB 5EG0A 3A8IE 1PRTD 4JBWA 2F3VA 5FKNA 2KVMA 4NP5A 1TWCH 1EZ8A 1R4NB 4LK0F 2OXPA 2XC7A 3HUGA 4D9JA 4C3JB 2Y31A 1MNMC 5EPKA 1ULYA 1Q1EA 5E1WA 2BY3A 2HPMA 4U7DA 1JB3A 2F2EA 4HPQA 3PO2B 1T08B 1PJRA 3HRUA 2W7NA 1O4XA 1XCVA 5JEAG 4OO1I 5C44G 3BU2A 3C2HA 5K36H 5TGTA 3F8FA 1OCTC 4Y7NJ 3F72A 4A3JG 4EQPA 4QY7A 4N8FA 2FQ4A 4AYBB 1JT0A 1JT8A 2EYJA 4A5NA 4NW2A 1ZGJA 2B63B 2EJMA 1ZG5A 2QEJC 1MNEA 1MHWC 1FOXA 4E7LA 3NE5B 4UVCA 2WAEA 5IT3A 4I6ZA 1IYUA 2GBYA 3MZHA 1M1KC 4LJZC 3RTRA 1XTDA 1UHSA 2KRHA 3DKXA 5GAEJ 1VQOA 1SFOB 1D7QA 1E1TA 3SFIA 1UHMA 4C2MB 1JOKA 4GNXC 2UXXA 2VUMH 2CH0A 4LIUA 4KT6A 2DA1A 1T2KA 4JI1L 2E1OA 3OSOA 5DNFA 2RBMA 4JI7L 2E1MC 1ZH5A 1YVCA 1CSQA 4O6JA 1VQNA 4V190 3RYRA 2JA7H 3MEFA 1CHPD 2Z16A 2LFNA 4J15A 1PUEE 1KC8C 4LG3A 3K5OA 3I72A 2EIFA 1MSGA 5FKOA 4A3LH 3JR9A 4FDBA 3GDEA 4FQGA 3U9GA 3HUGB 4JI7Q 2G0EA 2ZMEC 4AVZA 1R1VA 1TT2A 1FYMA 3L9AX 4R8HA 1STEA 3LX0A 4A3JJ 4HN7A 4QQBX 3RUZA 1QWYA 1ETKA 2ZSHB 4CSWA 2XRNA 2FBHA 3BR0A 3JRDA 2ZM6Q 2L9HA 2Y48A 1RESA 3FM5A 3HSEA 1YW7A 1DM0B 3KCCA 1NTCA 4E6KG 4D7NA 1PTOD 1ENCA 2R6GA 2XF5A 4IFDH 2H1LA 2BHZA 4HX7A 5GADC 4FX0A 4UUTA 2HXOA 5FO7B 3O8GA 4RHSA 4HV6A 5HNHA 1DOLA 5FO5A 5CPRB 3PQIA 1TR5A 2ALYB 4H02A 3BR6A 2EY2A 2HVQA 5LBQA 4KV6A 1I3QB 1MBHA 1B59A 1K78B 1ENFA 4NDLA 4IPDA 4A3JB 1FP1D 2ZT9C 1Y56A 3A74A 2WA0A 2UXBL 2EINH 3F0CA 2A69C 4EM1A 3GTGB 3TMOA 3M9AA 4BHBA 1P9QC 4LK1C 4D1QA 3DXJC 1B70B 2F0HA 2MO1A 2VPLA 1ZTRA 2V4DA 2IA2A 1EWHA 3S15H 1TIID 5CGKA 3KIOA 2EYOA 1KYZA 3I73A 4ESJA 3AL0C 3I8ZA 5CVIA 4B48A 2ZJPF 1YHQA 1KLGD 3W2DA 3GTGJ 4RAGA 1W5TA 1DUXC 2R7ZJ 1I1SA 4BJTA 2E2IH 3RYPA 4MIMA 1KTKA 2WV0A 5M3MJ 3P5JA 4DUYQ 4BJ5C 1EJ9A 4Q5SF 4W97A 4WORA 1UG0A 2G7HA 1IKLA 2HVSA 4UAIA 2KMUA 3O3KA 4RDUA 3WTWC 4A3LG 3LSPA 3RMHA 3OYGA 5M5YH 5JJIA 3F2DA 5CR3A 3ABKH 1DU6A 1AEXA 2JN4A 2XRQD 3VR3A 2FMCA 1A0IA 2DTZA 2ID3A 2MFZA 1L1OC 1T0FC 2EV0A 2L9RA 4KJZA 3DWQA 4GKJL 1F36A 1YS7A 3E0JA 4DW6A 1LDJA 1RODA 2VKEA 4B3RQ 3C1EA 3QIAA 2V9KA 4ZTFA 1R00A 3W6JB 4YHHQ 3PFYA 3ROUA 3OW7A 3AB9A 2A6HF 1ONLA 1DGRM 3ZMTA 1WI9A 1IDZA 2DJIA 3BDCA 2EYPA 3C1FA 1FLIA 4JK1X 4B9XA 2RDHA 3OSGA 2IW3A 3CC2A 4DV6Q 1SNOA 1XMOL 3K5LA 1NUCA 2JA8G 1D1BA 2O0YA 3AFHA 4RAUC 1R49A 4DBRA 4B09A 1J5YA 1BOBA 3OOUA 1UHWA 4OGQC 4PK4A 1SYDA 3R2IA 3PIPA 3DEUA 3EROA 2Z6KC 2ETHA 1W5SA 5C44H 1O57A 1V1PB 3DBLB 3RI4A 3K70D 3J7YJ 3BDDA 2HGCA 2JRMA 1JI8A 5FFXA 2E5LQ 1VQKA 2JUCA 4GNXA 2GIVA 1B3AA 2OCEA 4DBQA 1N78A 3AL0B 2OF1A 1V3FA 3HEJA 4LMQD 3IAS2 2XV4S 1JTYA 1D5XC 2CW0C 4RGUA 1T38A 4A93H 3SK5A 2W25A 2A5WA 3ABMH 2LKXA 4DK6C 1Y8NB 1HA5A 3DF8A 4HJAA 5IP9H 2E1NA 2D9UA 3ZOBA 2WB1B 2EVBA 4HEA2 1XPUA 3KETA 3BR3A 2CQKA 5E3NA 1VZ0A 2EB7A 4PZ8A 1D3YA 1IG7A 2QILA 2KJBA 2B2WC 2F3WA 4CKCA 4A3EG 2M9HA 4GOPB 3K4KA 4I98B 2IBDA 1DGWY 2TSSA 3GFIA 2E35A 4KMUC 3F8BA 1IBLL 1D5YA 3TN2A 3EA6A 1RF2D 1USSA 3GLLA 4Y17A 2NVYJ 3BVGA 1LQ1A 3HHHA 2IS4A 2DPDA 3I55A 5G3LF 3H3VC 2VY3A 1R58A 1Y69U 2ZO4A 4DKAC 3HOWH 5EGOA 3UNGC 1YLFA 2L3DA 3IKJA 1LV9A 3AMUA 3OYIA 4JVZA 4B3AA 2HDDA 1D1AA 3JSOA 2V6EA 4I09A 1V5FA 4M6XA 1LDKB 4XLAA 1P16A 4WWCA 1KQ0A 1SYCA 2M0MA 5K36G 1IXRC 4N4NB 2RC4A 1QRYA 1MZBA 3HRTA 4F87A 1FJGQ 3M3YH 2R93B 1IBML 4LF4L 1VQPA 3C2BA 4L8JA 3S2DJ 1S5DD 1YS6A 1X3EA 1VQ9I 5C4ZA 1IN8A 5DV5A 5DUKA 3J80K 1FOWA 1Y1VB 4ZYSA 6PAXA 2MD5A 2VQHA 1P4WA 1KZHA 1Y8PB 4G4KA 2RHQB 4ZAIA 5IP9G 2EFQA 1H95A 5FOBB 3CRKC 3S1RB 5GAHJ 1TS5A 4FISA 1AN8A 1G91A 2FE3A 2W82A 3ULJA 2BOSA 2QA4I 4M1UB 5H20A 1LTRD 2PO4A 4DIQA 1IN7A 2KOLA 2XNAC 1EY4A 2VB6A 3FMQA 4ZYDA 3ZQGA 3E5QA 1E2VA 1B4AA 3VWBA 3G3ZA 1UELB 5LMNW 1XXGA 4A0ZA 4H13C 5LMUL 4BQAA 2Q8KA 3QO2A 3KLSA 2M34A 4KD4A 2R61A 3S16B 5FKLA 2JA7G 2Q2TA 2FINB 3H15A 2CUJA 1TWGJ 1AU7A 1IW7C 2JA8H 4NC8A 3K5NA 4A3EB 1EIFA 4DF7A 1IBLQ 2R92G 3HKZA 1HH2P 1HCRA 2P5ZX 3G6EI 3O8HA 2DAOA 3K5MA 3MXPA 2GXAA 3SYTA 2IPKD 2O8KA 1MMDA 1F77A 5E4WC 2JK8A 1YJWI 1BI2A 3B73A 2X6XA 1SXTA 2I5LX 1LDDA 4FF2A 4HW0A 4QTRA 5M5WJ 1D0ZA 3ZMUA 4KKTA 2KEEA 1W6JA 3ERSX 5LHY1 2M2LA 4KN7C 3VOEA 4NQWB 1A8VA 3PJRA 3HKZN 3F8NA 4BBRJ 5ILUA 3MTSA 4RM2A 2NS7A 4ENNA 5CVUA 3L2RA 2RAEA 1C4QA 1LTAD 2EJGC 4G57A 4A3EJ 4KJNA 4XRFA 4CBVA 2HS5A 3K58A 3URYA 2DMQA 4HYEA 5E79C 1BCPB 4TSSA 4IUPA 1PV4A 4BYYA 1WPKA 4IF4A 1D8JA 2ELHA 2D62A 1UG2A 4GRIA 1U5TC 4IQJA 4LAAA 2ENBA 3JW4A 2F4IA 1O3RA 1H9SA 1PH9A 4ZLTF 2L15A 4JI3L 5KYIA 1XDSA 5JAVA 1C7YA 4BBRB 3FHZA 3CQZH 2JA5H 3MAJA 3E0JB 4BE0A 3HOYJ 5C5MA 3PO3G 4FX4A 1CI3M 3V4GA 2MNAA 1A62A 1OLTA 1OXSC 4ZUJA 2XIGA 3OTOQ 1XGMA 4RGTA 4LFCQ 2R3SA 1B1BA 1Q3LA 2PEXA 1MKMA 2GN5A 1J7KA 5BQTA 3MN2A 3PIO3 3H3VK 2A6EC 3U58A 4GZYC 2ISYA 3FIWA 2F5DA 3Q9SA 1ZHFA 1KU9A 3R0AA 1SFEA 5AONA 4J1MA 4UNOA 3RKYA 1ZRCA 1W7PA 1I4GA 1JT6A 2HOAA 3RKXA 1FOKA 3A0HC 5C4JB 1IHZA 2JA6J 1CA5A 1J2XA 4AQYQ 3KEYA 1VFCA 3QG1A 2NXNB 4POGA 3K1PA 1V55H 4PMWA 4EATA 2KCMA 5K5QA 2R7QA 4A3CG 4QUCA 2CG4A 1KONA 5LHIA 3U9SA 2KPMA 2Z33A 1EU4A 3ERQA 1IRZA 2IGNA 1V5GA 2K4KA 2NVUB 2P8TA 4G6QA 4AIHA 3CCQI 4KIGA 2HXIA 2CWAA 1NBWA 3H1CA 2NOJB 4FE4A 3CCLI 3GTKB 3K7AH 3CJNA 4P2CB 3R4KA 4E6IA 1W36D 5I2XA 2NVTB 1SD6A 4G7HC 4AC0A 2DMTA 1ETQA 4DV5Q 3I90A 2XN9C 3KYHC 4XNFA 4FNFA 1HA8A 2QKMB 1NJIC 1VQ8I 1GHJA 2M7BA 4RA2A 4HDUA 1K8OA 2KIUA 4H0EA 4O0AA 2DOEA 5IPAA 4XBFA 2PN6A 3JAMZ 3AEVA 1I50B 2BDOA 2F0PA 2QCPX 4J8QA 3TP3A 2ZJQA 3VYSB 1PH8A 2XDVA 1E2ZA 2GVBA 1N25A 2NBFA 4MHGA 2EPFA 1FVIA 5G3LD 1K9MC 1PFMA 1LEAA 3V96A 2R93J 3KOJA 1YIJI 2OJED 2XKOA 4LWCA 4A3GJ 3CMEI 2JSCA 4NDXA 1W2BA 3OR2C 4G6DA 3TL4X 4IZ8A 3TOAA 3K2ZA 5C3EB 4RMNA 2EYHA 4KFCA 4DR7L 2KZVA 3RPQA 1SNMA 2MH2A 4OINF 2VBZA 5ELNA 2SDFA 1TWFH 4BBSG 1TL8A 1KU7A 1VQ5A 4XOPA 2EIMH 4KLKA 1EA3A 4GYGA 4OIPF 3HOUJ 2OBPA 4ITVA 1K4TA 5M3FH 4A3KJ 3IH3A 1IXRA 3EUHC 3OV8A 4ASNA 4II2A 2UXDL 2VQLA 1IDYA 1CHQD 5ELOA 4A3FB 3A0BC 1IL2A 1ZR2A 4FE7A 2MW8A 1BW5A 4JBAA 2I5HA 2XSCA 4G7OC 2QQ9A 5C3EH 3GEZA 4RAFA 3LSRA 1Z77A 2XRLA 3V7CA 1SMTA 2D1VA 3A54A 2BGCA 4IN3A 5LL6S 1IO2A 4MQ9F 1YJWA 2LS01 3S17J 4M9XA 1FNWA 1SR3A 3CHBD 3QPHA 3MZYA 1XGNA 4MQVA 1G3YA 2DQLA 1DYQA 2JMWA 2MH9A 4YELA 2K75A 5JR3A 3G2BA 3JRAA 2ZC2A 1XGSA 2D45A 2VL8A 4FTHA 2W57A 4E70A 4C1NK 2K5DA 1BBYA 2QEXA 2R7DA 3F23A 3FXUA 1JMCA 4CGYB 1UAPA 1C9OA 2GOXB 4DK0A 3NEMA 1RI7A 2E36A 2Y0SG 1E0EA 2JP1A 4KHVA 4OHJA 3QQAA 1MSFC 4KN4C 3S3MA 2MUYA 1IL8A 1LTBD 4OX9Q 4GN4B 3B6CA 4X65Q 1TNTA 3W3AA 2VBWA 3R8BA 2K27A 4OWWB 4IOAF 3S8PA 3BDLA 1WTOA 3I59B 1ILPA 2OPTA 2B2UC 4EJVA 1LTSD 4XLNF 5CV5A 5D4RA 1I39A 3AKZA 3G71I 2CWPA 2R5YA 1I4HA 2W84A 1KXLA 3BP8A 1C0WA 2E7XA 1MI2A 2FRHA 3WDNA 5FO9B 5EGTA 3J81j 4GDFA 4DA2A 4PGHA 1Q8KA 2R0QC 5BOXA 1QUQB 1P4AA 2PMZN 2LC2A 2BEOA 2BDNA 2KP6A 5IOZA 1P4XA 2HZDA 1U2WA 4JI2L 4APVA 3QB3A 1JGGA 1G291 2VBXA 3MFKA 3E97A 3ZN1A 4U87A 3Q22A 3TDZC 4G6TB 3BG3A 3I58A 3RZOH 1X6OA 2H1KA 2L7MP 2WB1E 1A2TA 1BN5A 2VOOA 4NMZA 4YWMA 3M1EA 2IX0A 2K04A 2J5OA 3M9BA 3L2VA 3K4JA 2GAUA 4WJWA 1ZYRF 1K83J 3BT9A 4DAVA 2R5ZA 1SNPA 2OQ0A 4DYQA 1ESFA 2Y0SA 4A3EH 1HNWQ 4PJNA 3L00A 2QBYB 3E5XA 4O1NA 4HJ9A 3FXRA 1HXYD 4EQQA 1E2WA 1OR7A 1OYYA 3DU6A 2ECCA 4K5VA 2DW4A 2A74C 4CYCB 1JWSD 3CCUA 1ON1A 2F0LA 2PMZA 1JOOA 4LF6Q 3T1HQ 5M5WB 3TQNA 2F0MA 3S2HH 1E7ZA 2EYLA 4DR5Q 1J8IA 1WQ2A 5GTHC 3QRFF 4WRDA 1N32Q 3LAPA 3E9IA 3I2ZA 2ZNZA 5E8GA 2ATWA 4ZQ3A 1BA5A 3ZCOA 5A2QE 4RLFA 3HZXA 1I5ZA 4CCNA 3V8JA 4UUVA 4FXDA 1T39A 4L9NA 4A76A 3BWGA 2NN6H 1XNRL 4IRHA 4I0AA 1X3ZB 3ERED 3VYUB 4UUSB 5M5YJ 3CMAA 2XASA 3CCUI 2H8RA 5JOBA 1G8XA 2CV2A 1CKMA 2HKOA 4GN5A 2HHHQ 3H3VI 4JI6Q 1NK3P 1YRNB 3I4NJ 3GTQB 4BWGB 5DAUA 1QVCA 1W3SA 2F0FA 1K4SA 4GGGA 2HQAA 1LKXA 2EYFA 4DXGA 2FMLA 5FLVA 3VR4A 2E5LL 1U4PA 3X2QH 1VQJA 3LMMA 4LMYA 3QU3A 4B3MQ 4P71A 1QJOA 3BR5A 2LH9A 3K69A 2ZMEB 1LVAA 5C4XB 1STNA 1W0TA 2M5WA 3HIFA 2DCEA 2L5QA 4IUNA 4ZZLA 3OS0A 3FKJA 1PYBA 3IWFA 1PYSB 1PFNA 1K6OA 1TWAB 4KY5A 1GVJA 2M00A 3T0YA 2JQOA 4DN4M 3KDFA 3KP6A 1SFOJ 5K7FA 4DV0Q 1STZA 1S5LC 3ER0A 4R4CA 2NVYH 2XWJB 4UB6C 1X58A 2LXJA 4G12A 5A35A 3K6GA 3S1QH 1MJEA 3VYTB 5FKMA 1CTMA 1CKOA 1C8CA 1XMKA 4Y13A 1YX3A 3R93A 4E7HA 3TEHB 2NVTH 5IY5H 4LF9Q 3JRIA 5H1SE 1D0XA 2E2HH 1HR0W 4NXNL 2DY8A 3P20A 2ZJQF 1BVSA 2UUBQ 4WK8F 3FK6A 3F22A 2NAZA 1J9IA 3JAML 1S7AA 3LSHA 2NNNA 1VQ6I 4A93B 1KQ8A 1CQVA 5KRUA 1WH5A 2O5RA 4DUZL 2K3FA 1GJXA 5KEEA 2IWHA 3NBIA 3C46A 3I9V2 3L2UA 4ALPA 5C6AA 4ABNA 4GLVB 1TC3C 2IS2A 1X2NA 3WTVC 2VE9A 4LLGF 4X64Q 1D1IA 3M4OB 1JUSA 2VKVA 1WOCA 3H3UA 1XMQL 5LHGA 2LY9A 3AG1H 3S3NA 1EYGA 3CMMA 3Q8DA 4FF3A 1KQ9A 1QGPA 3SEBA 2XVSA 4YY3L 1LUJB 2OQRA 1JJ8C 4IFDG 3EPZA 3VSKA 1FBUA 5DD4A 3WTXC 1PH1A 4F88A 5DUIA 1YTYA 3WHCA 3HOXB 1U5TB 1Z9FA 4BU2A 1EEFD 1MMNA 2WADA 4CCKA 2VJ4A 1CUKA 2OT2A 1FNVA 3EN2A 3BZDB 5IT9L 2XPWA 3M3YJ 2H6CA 1A6XA 1YRNA 1OQYA 4JI0Q 4A3GB 1JJGA 2VOPA 4OWXB 4J19A 3QWNA 3VR6A 4BXXJ 3OY9A 4TQUS 1XGOA 2RDPA 3HPGA 5TSSA 2XGXA 2LKVA 2PMHA 4RCOA 1WJBA 1UB9A 2HD3A 4RHRA 4G7ZF 3OYHA 1XG1A 5F27A 2GIZA 4U7BA 4XKVA 4A3MH 4JW0A 5IT9K 4GOPA 5C4XJ 1AZPA 4ETSA 3FP9A 1WHUA 2UXCQ 5JPMC 1BR2A 3NTKA 3HXLA 1KA8A 2DI3A 2OC6A 1NG7A 3OWFA 3NBHB 3GTJH 4GCVA 5C0XI 2CO5A 2A05A 1EY7A 2ZFUA 2WAQN 1ILQA 1WI3A 2JA2A 4JX4A 5JJKA 2E19A 3H0GB 3HOZG 3X3NA 1IW7F 4IXAA 1F9NA 2UUAQ 1NAPA 3HOWG 3LSJA 2W4SA 3FM3A 4C3HB 1S5CD 1SE2A 3K70C 3OWTA 4LFAQ 5LHHA 1GXQA 3SR1A 5IOYA 3CRLC 1WVLA 4F52A 3MEHA 4GFBA 2JA6G 2EH3A 1X3GA 2E60A 5F1JA 5CQGA 2FD5A 2IGMA 3ZMSA 1ZEQX 1J5EL 2N3SA 2VUMB 1MMAA 4C3IJ 3GTKH 1X3WB 2JA5J 2CW0D 5CJ9A 4Q0FA 4KHPL 1BBWA 4OIJA 4HAMA 1NE3A 4CCLA 4PV1C 3MXNA 1TWHH 3N6RA 2E1CA 5A2QZ 3O13A 2XHKA 2XF7A 4K2KA 2VKDA 2PMUA 1VQHA 5KVRA 5ED4A 2JSOA 2RQXA 3S93A 3K0YA 5GAGJ 2IA0A 2DOAA 2IGKA 2K14A 2SOBA 4DPGA 2HR3A 2PZWA 2I5MX 4RAZA 3A4CA 2OEOA 4A6EA 2F4VL 3EDPA 3ZQ7A 1GM5A 1MBFA 2ME6A 1PTOB 2RSOA 1WZ2A 4U68A 1T5XD 3QU6A 1I50J 4NC6A 1DJRD 4QPOA 1FD7D 4NB3A 4FHTA 1HPCA 1DPRA 2NS8A 3H9JA 5J8FA 3EUKL 3J7YW 2DOFA 3KZZA 2HTJA 3FXOA 1F9PA 2L4AA 1A3VA 4LF8Q 1TBXA 4S3SA 3MMYB 1J09A 4F91B 5E1XA 4A3JH 1LFBA 2LP0A 3OYLA 2DMUA 1TW2A 4TV7A 5AIPA 3QJYA 1EU3A 1MBGA 4JQFA 1R9TJ 3GTPJ 1II3A 4DV4L 5FJ8G 4WJ4A 2JA5G 1CFMA 4BGDA 1KIXA 1DGSA 4A3DH 3UE0A 1XC5A 4KKUA 1P8LA 1J5EQ 2HCCA 2OWOA 5IWAQ 1ASZA 3HG9A 5JJZA 1MGSA 2KUMA 4NQWA 3C18A 3HRZC 3LA3A 3P7JA 1RIOH 1SYEA 5HLIA 3PUZA 1JHFA 1TP4A 1I50H 4X3KA 4XRMA 4ON0A 4DV4Q 2EQSA 1FIAA 1L1OB 2EXDA 1QBJA 2MLKA 2XAQA 4R4QA 1PRTC 1WJFA 4JPBW 2F0EA 3AG3H 4DR3Q 3U1KA 3ULQB 5KNBA 1WCMG 1TS4A 5E4XA 3BPXA 1G4DA 2WTEA 3GUDA 1QNKA 4FF1A 1YW8A 2DK8A 1VQMA 3C1DA 1Q90A 4AUXA 3OYKA 3DUZA 2F0QA 3E6ZX 5J40A 1FJLA 5CC4A 4DR3L 1YJNI 4KUMA 2NWGA 3NARA 2VL6A 2F3IA 4M3EA 4ENKA 4U0YA 2ZM6L 5JHFA 4XXEA 4L0YB 4AM3A 2Q2UA 1EQTA 3LWEA 2J5PA 1AKHA 2V7FA 1D2BA 3GX4X 1YHAA 2E8GA 1SMYF 1UNSA 5B1AH 5TJJA 4DQ2A 2NVTJ 3K7UC 3MAQA 4LW1A 5AJ3L 3DTKA 1XPXA 5CYUA 1QZZA 4XT3B 1QVFA 2H09A 4M8AA 3Q3SA 5GTIC 1JJ2A 2WP8J 4D7MA 5J1YA 1T95A 4IO9F 3OYBA 3SK8A 1R4QB 3E6CC 3E7LA 2UWMA 5M5XB 2E5NA 1T8IA 4CZZA 1Z6RA 4IRGA 2P7VB 4CXFA 4N4OB 1HTPA 2DUDA 3TW7A 4JYAL 1IRXA 5M5YB 2HT1A 5KYLA 2I07B 4ME3A 3ONAB 4BBSJ 3H5RA 1WTPA 3W3CA 4GLXA 3A8KE 4XK4A 1Q1HA 4DV3Q 5ELEA 2M87A 4RGOS 2YU9B 2ZBKA 3HKZB 2ADUA 3KYLA 3I4OA 1X4PA 3HKZE 1G59A 1XCBA 1A35A 1I1GA 4PJMA 3KUPA 4A3KB 4IUTA 4BDZA 3EVQA 4DYRA 1I4RA 1LABA 1D5VA 4PNYA 1XYIA 2JK3A 3AFPA 5EAYA 5IT9Z 3GMEA 1P2FA 1Y8OB 4UVBA 1HR0L 4LK1F 5M5XH 1RKWA 4E7JA 3VB2A 3TRZA 2L2OA 4Q4ZF 4CJ1B 4N8X1 3PNYA 1RTOA 4XKWA 1F2MA 2KRFA 3RZOB 1F5TA 3TQYA 2PX9A 1R1TA 4ZYHA 4YWLA 1YFHA 4ZYGA 2JSPA 2FHTA 4YHHL 2VS1A 2UXBQ 1HR0Q 3PGZA 3S1MJ 1O7IA 5LGUA 1VQCA 4CICA 3D4DA 2K9SA 1JE4A 3MVVA 2ES2A 3J80Z 3F2UA 1CZWA 5ELBA 3DKYA 3SXHA 3GTKJ 3LFUA 5J1UA 1IRFA 4ZZDA 2WAQB 2XAUA 3FEWX 2SNMA 1K8AC 5D3DA 4GO1A 2KFDA 2D0PA 1QU3A 1S7OA 2QUFA 3ABUA 1UFMA 4D5FA 1MBKA 1F43A 1WJJA 4FF4A 4E7IA 4UY8C 3OIQA 1X1PA 1TQPA 2QF7A 4MTDA 1V43A 2E34A 4I01A 3K6OA 1ZKGA 3CDLA 1HQMC 2F03A 1OMIA 3HOUH 3BOQA 2R7SA 1JWMD 2K03A 5LD2C 1LM0A 5CVRA 1VQ4I 1WH7A 1Q12A 1RNLA 3EIVA 3ND8A 2BH8A 3TP6A 1UE7A 2Y2ZA 2DA4A 4K8JA 4F7XA 2R7XA 4JBMA 3KF8B 1Y39A 4D5CA 4DOZA 3RQ4A 3BG7A 1R9TB 5ILSA 4K2LA 3OMGA 5D6EA 4Y33A 2GLOA 4BE2A 2P5LC 3MKYB 1M90C 2QKLB 4ZC3A 2AO9A 4IL6C 1IRGA 3A0JA 3H6MA 3BCBA 3I4PA 3PQJA 3RLNA 3BYYB 1AH9A 2E2IB 3MXUA 2E2HB 4A75A 1ET6A 5KGUA 1HDPA 4XOTA 1AE3A 1HBXG 1CK1A 2DA5A 3KZYA 3DLLA 2PI2E 2WV1A 5L3EA 4RB2C 1HKSA 3S9WA 3GTOH 3M8FA 2WAFA 2R92H 2NN6I 4R9WA 3COAC 1ZELA 1A3TA 3JAME 3S2WA 3SDGA 3I56A 3I4MG 3J7A5 5I9PA 2ME0A 2E2IJ 4I65A 5C3WA 2Z0SA 1YNJD 3UDXA 4F7ZA 3J81K 1R6RA 1BQQT 4X66Q 4UVAA 3K0XA 3LSIA 4L18B 2LKSA 4KITB 5LFAA 3BPVA 1WTXA 1BUVT 3CCYA 1WCMH 1IUFA 5IYCJ 4BY1H 1Y0NA 4GOPC 4BQNA 2XWBB 3BTLA 4C2TA 2B9SA 1U4MA 2AUKA 5EBCA 2ZTEA 1H9RA 1VQIA 5FB2A 4JI5L 4DV0L 4HJ5A 4C3HJ 3M07A 5IGGA 4C3IG 1I3QH 4BEHB 3X3MA 1FYLA 2FBIA 2QGUA 3GVAA 5HDNA 3K1NA 1KABA 1I6VC 2OUMA 2F5CA 3ZQLA 2X6GA 1AE2A 3I59A 1WTWA 5E7NA 3J80L 2E76C 2HKXA 1H0MA 3QP6A 2AQFA 4BXFA 2EY1A 2BCOA 3S17B 1EIGA 4YFKF 5J6XA 5LMUQ 2WKDA 2M45A 1D5MC 2NZOA 2YUSA 2QWWA 4XLCA 2YV5A 2K5QA 4PFOA 4TKOB 3S1QB 2X51A 3KBGA 4X6AJ 2F0JA 5LEJA 1OFCX 2XAFA 2EYMA 1KYWA 1TY2A 2VBYA 5EJCA 2K5HA 2BBYA 4HJ8A 1S72A 3BJAA 1EYAA 5EZGA 1VQNI 3S1NJ 1JB7A 2V1CC 5LRRA 2Z99A 2EIKH 1Z7UA 2IT1A 1CKNA 2CUZA 1SRUA 3LSKA 1G6NA 3WU2C 4A3IB 5EKLA 2H5XA 2NVXH 2M2EA 4MNUA 1KDBA 3HGYA 1G6PA 3D3RA 2ZXPA 3BVMA 5CV7A 3VSLA 2VASA 3CMAI 4B3TL 2JN6A 1JGSA 4IPHA 4IO9A 3IRQA 3ASOH 2BOLA 3E3VA 3N05A 2TCTA 5C44J 3OIPA 4OMZA 1UEBA 2PQEA 1JHHA 3H3ZA 1SD7A 3FXMA 5EEAA 1SD4A 5GAHC 4A93J 4Z6YA 1TQMA 4M72A 1WTHA 1VNDA 4C56C 2RQQA 3ERMA 4RB1A 3MFYA 2LSOA 5E8IA 2HCIA 1Z3XA 3J81c 5JVTA 2TMPA 1IN6A 3D1NI 4F55A 1O80A 1PYVA 3S16H 2B39A 3D4WA 3OYAA 2OTJI 2K1BA 1PH6A 3KLWA 2ZXJA 3HSRA 2F4MB 3ELKA 3NWTA 3VODA 2M0CA 4S05A 1K73C 4IHTA 4BS9A 3G1MA 1SAXA 2ISZA 3LL7A 5KHDA 1JOQA 2CQAA 1X19A 4I02A 4GXOA 1MDMA 4OIKA 2BHYA 4OU0A 2MGSA 3K81C 3S3OA 1SLJA 3E6BA 5CVJA 3FKIJ 1GOZA 4LLNA 3R3OA 3W1GA 2B2VA 3V05A 2PBIA 2HNHA 4AQYL 1ZAOA 3TP7A 4AWXB 2B63H 1T98A 5FFZA 1ON2A 1BJZA 4EJUA 1WKMA 1EY5A 2LFBA 1QA6A 1N33Q 4XT1B 1SN8A 4Q48A 1G2HA 2V26A 1G3SA 2KJCA 1EY6A 3NUCA 2W00A 3A7AB 3FF5A 2K4BA 3HGGA 4KHPQ 3AQQA 1TVXA 5HS8A 1IYJB 3DQVC 4P96A 4MNOA 4K0KL 3LSTA 3S32A 2VQEQ 3PO3B 5DEQA 4TVAB 1EQRA 4GS3A 4V19K 4B3SQ 2DA3A 5JVG3 2VI6A 1A3UA 3I4NG 3U2RA 3GTPB 1HKQA 1I4PA 4IOCF 1OCCH 3ESWB 2Z9HA 3VDYA 3OHXC 4QGUA 3W2VA 1FNUA 1X56A 4JG2A 2VQEL 2Z6BA 2Z6KA 2R5YB 3N4MA 1ONVA 2RCFA 5C4XH 2SEBD 1E3HA 5H6RA 1YG2A 3ZP5A 5F6FA 3QYFA 2Z3YA 3CCQA 2R7ZG 2OD5A 3NWSA 2LR8A 1CT1D 2DK5A 1RTNA 1Q81C 1I3QJ 4IJHA 4XDXA 2VW9A 2A8VA 4JK1C 1A5JA 4PQXA 4E7ZA 3L2WA 2QM3A 3Q0UA 1ESRA 3F3XA 1T56A 3W2WA 4DR2Q 1XB4A 1G8ZD 4POFA 3E5SA 3IKTA 3VA5A 2YSRA 4OO1G 1B3QA 3WTZA 4OONA 1LT6D 3UDIA 3JRBA 2WB1G 3ZMVA 4K2EA 3DEOA 1AFPA 3DPTA 4A69C 4IPGA 2WACA 1W5CC 3CXCA 3G6JB 2F4OB 1ACIA 2YYZA 1B8IA 4N9HA 3HOZH 1BNZA 3IH2A 5IYDH 1RUOA 1MH3A 3BVZA 1EFWA 5E20A 2F0SA 5EKIA 2HDMA 3PIOA 4H0LC 4WJ3M 1E0BA 3AYHB 2N8NA 1EL0A 2ECBA 1D8KA 1U4RA 3CAMA 1D5ZC 3M4OJ 3ABTA 2GA1A 3IP4B 1ETYA 1U9NA 4BUPA 2EJFC 3S15B 2NVXJ 3HKZG 3DEWA 2MABA 2LF7A 1VQ7I 1BCPF 3SEZA 3EBEA 3TEDA 5C4HA 2E7WA 2ELKA 3S14B 2D5DA 1YOVB 3DCFA 1ZG1A 4EVOA 2LMDA 2J7ZA 3BR2A 4PJLA 4LG0B 3WGHA 1DDNA 5HLGA 4JV5L 3U4VA 5FGMA 2UZKA 4IEJA 1PH7A 4BBSB 2XAHA 3KP5A 3F2BA 1S29A 1U5KA 5C0XH 1K61A 2EQRA 2X6YA 3E1SA 4HV5A 2VLAA 4R79A 4FYDA 4E7SA 4YIFA 2F0GA 3HOZJ 5IGCA 3KP3A 2O7OA 2R7ZB 4FXKC 3DP7A 1NTGA 5BS6A 1A31A 5COYA 1LB2A 3GV3A 1VMCA 2K05A 5EG0B 1EYCA 3ITPA 3BJUA 4N9IA 2LSSA 3D0FA 3J80c 2KHSA 4KICA 3H36A 3S1RJ 1Z6HA 4BL0B 4CKBA 1L0OC 1NMGA 1QZGA 5D5UB 2OV7A 4U88A 1LNWA 4RFBA 5JVH3 4DNRB 1QVGA 3I56I 3D31A 5ISRA 4YG2F 1LFUP 5BPIA 1XWEA 3FHNA 2VXZA 1PUFB 3WG9A 5DLQE 3TMEA 3J80E 1ETVA 1GUOA 2K5NA 2N8GA 3J80i 1KD1C 1VQAA 5BMZA 3CLOA 2R92B 3GZ5A 3DTIA 3HOUB 4B1RA 2AS5F 3OYFA 2ZMEA 2JA7B 4EX5A 3S1MB 4CDGA 3QYEA 1YJNA 4X62Q 2AQ2B 2ZXOA 3TO9A 2B2YC 1N9WA 4FXGC 1HZAA 1LPQA 2CUFA 1R4PB 3L3OC 2R4GA 2FSWA 1OKRA 3JTGA 2B2UA 1EQVA 2CV0A 2V79A 3RQIA 5CV8A 2BW3B 2L01A 3K7AJ 2DMNA 1JTXA 4QCLA 2HQNA 4ANJA 2GZWA 3VR5A 2KIQA 2FFKB 2L7KA 3FWEA 1VQ8A 1XMAA 4X3SA 2E75C 2JYOA 2WBMA 4UP9A 5LMNQ 2KBNA 3L1PA 5CBAE 1AA7A 2VONA 4C3JJ 1T6SA 1VI0A 3EQLC 4M3GA 4MFDA 4LF6L 4LF7Q 4XICA 4JC0A 2QA4A 1U9RA 4XYQA 1H9KA 1XTCD 1G51A 1PDQA 3I3CA 4D0PA 3CCJA 2N78A 3B6AA 2PNHA 3LA2A 1HZCA 3LSMA 3SDZA 1SMXA 1SNCA 5J1RA 3Q9VA 1N34Q 3HYIA 2WB1A 4B47A 1BIBA 4YIJA 5F08A 5BR8L 4CDCC 3W1BA 1YIJA 3ZQHA 3JRHA 1I3AA 2VE8A 5CV9A 2NTTA 2HIXA 3I4MB 2V1XA 2AUJD 5IGFA 2F0DA 5LGTA 3TDQA 3GQBA 2BY1A 3S1NB 4LOCA 4MTKA 4DR1Q 2O61A 5BN4A 1SANA 5JLXA 3H9QA 2KT0A 3BQYA 1YIOA 1IBKL 4JI4L 2DA2A 2CW0F 4NBQA 3LOCA 4LNQA 3PM1A 5ELFA 3NTHA 1AW7A 1Z6TA 1IZ6A 1G6ZA 4P73A 3TOBA 2E2JJ 4TRDA 5ELDA 3I55I 1YYVA 2LK2A 2M7AA 3CF2A 4DR1L 1APLC 1G3TA 1Z47A 1Q1VA 2C5CA 2VXWA 2MHVA 3M4YA 4HMIA 3K4MA 2QQ8A 3K0LA 2JA8J 3MZ5A 2M4GA 3F9KA 1GV5A 1WFXA 2BY2A 2D1HA 2E2JB 2KCNA 3SJMA 1K78A 3F8MA 1IXSB 4DNTB 3FMCA 5A2QK 1LE8B 1K8MA 2VKHA 4R4OA 1XNQL 2O2LD 1W36C 3GTLH 2P81A 5E3FA 4Y52H 4DV1Q 5CQEA 4AH6A 2JPBA 3J7AF 4ENMA 1B9NA 2QLZA 5K1YA 1HF0A 3PUXA 1T9HA 2NOGA 4KI0A 2AQEA 3PSFA 4RKLA 1CSPA 2CWEA 1MNDA 4PCQA 4LF7L 2H4OA 2WAQE 2OF7A 1LJ9A 1ZG3A 1JR0D 2OCCH 3J7ZI 1Z7LA 3TS0A 2KKOA 3C2PA 2JA8B 3OYEA 5IGEA 2BE5D 1FBQA 4HR7B 1JKPC 3SXYA 4A3LJ 2EV6A 2BVLA 3GTQJ 1C48A 3SHLA 1YI2A 2UU9L 3HOYG 3T13A 2JA9A 2P5VA 1IGNA 1IN5A 1BI0A 1U3EM 2EK5A 5C3XA 2CKZB 3RZDB 1JXSA 1MJ9A 5C0XJ 3HKSA 3VDXA 1WWXA 2R7RA 3CJRB 1KGSA 2K40A 3E5UA 4X66L 5FKKA 2X0LA 3R61A 2GWRA 2NRAC 2K7LA 4X64L 2MA3A 3OYYA 5DCFA 1PUFA 1D1CA 2DJGC 4CCOA 3KP4A 3JRFA 4BH9A 1A6QA 5DCMB 1X4OA 3GTQH 3S17H 4YFXF 1K79A 4A3MG 4JI2Q 2OTJA 2LBFB 3PUBA 4K14A 3TZUA 2STTA 5IP7H 2HOEA 3M3YB 4PFPA 1ETOA 3G73A 4XRSA 1TWCB 1K3RA 1F2LA 1GHCA 2AHQA 1ORKA 2QQBA 4C3JG 3VEPA 1HW5A 5C3EG 3I3LA 2VT3A 1SE4A 3WTUC 3M85A 2MP1A 2LF8A 3RZDJ 2XSJC 5EEGA 3RIRA 2FX0A 1GDTA 1LTTD 3ABLH 2DYRH 3D6WA 1JE8A 5C44B 2A5HA 4DAMA 1WJEA 3KF6A 3JAMc 2LREA 1RR8C 1WI5A 4A3IH 3AG4H 2P6SA 4BNCA 2LRDA 5BPDA 1GUGA 3JC66 4A93G 1BW6A 5LEKA 1YITA 3T51B 4KN4X 1GUUA 2DYSH 3N52A 2R92J 2Z4IA 4DR5L 1XMOQ 2L4MA 4RBOA 2FMYA 1V54H 3IFDA 5JJLA 3GXOA 3Q6SA 5CKTA 1F2ZA 3ONQA 3KLOA 2VXDA 3CCSI 3UDFA 1GHKA 1H9SB 3DV8A 1XMXA 4DU9A 4O2DA 3H35A 1YITI 4PDKA 4OL7A 3FXLA 1BM9A 2K32A 5GAGC 1WTRA 2QDLA 3QPSA 1OPCA 1VQ5I 4B3TQ 1GUWA 1TQOA 4YY3Q 1AZQA 1MKHA 1BC8C 2NYZD 5B1BH 3HOVG 3LAJA 4NB5A 1HA6A 4BBSH 4HDVA 4RB3C 5GAEC 4BY1B 3TGNA 4M6YA 3BG9A 2IJ0A 2DN8A 1SJED 4AYBG 3S1NH 2I8DA 1B8AA 1OCZH 1H89C 1H88C 5IP9J 1QG7A 4HSTA 2ESNA 3NSWA 5L37A 4KD3A 3HOVJ 1RCVD 3LSGA 1JORA 1U78A 4QJFA 2ICIA 4B3ML 4IALA 3QR8A 3LQRA 3GTOB 9ANTA 2VC1A 4Y7NB 2W1OA 3M8EA 4G8XA 2L11A 2XGDA 2O03A 2PZTA 3HOXJ 1BCPD 1NCVA 4EV0A 1QHGA 1ZYRC 1WRJA 3K57A 5JVGF 3RN2A 3HSFA 2XB0X 4WXDA 1GLNA 1IXCA 5JEAJ 4XONA 4U673 3A5ZB 4L63B 3CU7A 3DWPA 3I5UA 1IZ1A 4G7HF 4IUUA 1EOVA 5LGNA 4XL9A 3HOZB 1Q46A 3JRCA 1X1CA 4HQMA 1V9PA 2YPRA 3ZJYC 1VQ9A 2BXYA 1F2YA 4UDUC 1R71A 5C4JH 1BOAA 4JX5A 4CHUA 4IOCA 3ZQCA 5F0CA 1O78A 3A02A 2N88A 3GV6A 1CQFA 2C9OA 5DCMA 3J81i 2LDUA 2M3AA 5D6FA 3H5NA 1PFSA 4PJ0C 4UP8A 1HW1A 2BYVE 3K80C 2VQCA 2MD0A 2E2HJ 1E3PA 4ZYEA 5AIQA 4G7ZC 2FJ2A 1PVOA 4A3GH 4K0KQ 4BE1A 4X6AH 1ZLJA 1ZYRD 4F92B 2Y0MA 3V8KA 1UMQA 4LF5L 1NMFA 3MCZA 3L7WA 3MWMA 5FLXE 2Y0SE 1IV8A 1BBXC 2CSOA 3W5OA 4IUVA 3K2AA 2F5EA 4YCVA 2XRSD 1BR4A 2BA0A 2PCFB 4RGNA 3DM1A 4Y15A 2VC0A 1DZ1A 2KJXA 4HX8A 4HOBA 4M9ZA 1XSVA 2D2WA 4PGGA 3CC7A 3NQOA 2B2VC 4MFEA 3QOJA 1HXDA 1IAWA 1W7PB 4CYDA 4NXML 3TBIB 5L3DA 3OYNA 1M1EB 1E22A 4L5QA 2L5TA 2CJJA 3P75A 4R4IA 1NG6A 2VUMJ 2LVSA 1X32A 3A8JE 1GUNA 3S14H 2DO7A 3CESA 4X0GA 3T8RA 3WOFA 3AU7A 2CQXA 4ODGA
chains in the Genus database with same CATH topology
1T5EA 4RGOS 2F0TA 2RDHA 2YU9B 2A68D 3HKZB 2PYKA 5KCMA 2HUGA 3KYLA 5I6WA 2IW3A 1X4PA 1G59A 1SNOA 3K5LA 4PJMA 3BYTB 1NUCA 3KUPA 4A3KB 4IUTA 1D1BA 4BDZA 3AFHA 4RAUC 1JC7A 3NXWA 3EVQA 1I4RA 4DBRA 1LABA 4CCJA 4PNYA 1XYIA 2I46A 1BOBA 1PTOF 3OOUA 2JVHA 4CUGA 4OGQC 1Y8OB 1EY8A 4PK4A 3A1YA 1SYDA 2NN6G 3R2IA 2KQRA 4RH6A 3H9GA 2A73B 1TZLA 2PMZB 3EROA 4E7JA 1XX8A 4MHEA 3C2GA 4Z9CB 2L2OA 1V1PB 4CJ1B 1B50A 2F1MA 3VYSA 3K70D 3PNYA 1RTOA 4XKWA 2R7TA 1F2MA 1JI8A 5FKAC 1D0YA 1NR4A 1PZID 3RZOB 4XLFA 4MLOA 1B3AA 4DBQA 1N78A 3AL0B 2OF1A 3HEJA 4LMQD 2F0OA 3IAS2 5FROA 1D5XC 2CW0C 2JSPA 2FHTA 3SK5A 5EPLA 2K28A 2A5WA 3U9OA 4K8IA 2HDWA 1TS2A 1Y8NB 3PUVA 1HA5A 2Z8LA 2F6CA 5LL6X 1BXTA 3OWEB 1N75A 2D9UA 2CW8A 3D4DA 1JE4A 3MVVA 3F2UA 4BA1I 2WB1B 2EVBA 4HEA2 1CZWA 1QOHA 3FRPB 5ELBA 3T4AC 1HCZA 3DKYA 1DP3A 1ICWA 1VZ0A 3SXHA 3LFUA 4XKBA 4XTCS 2KEDA 3MA2B 4CCMA 2WAQB 5FK9C 1V5EA 2XAUA 2QILA 2B2WC 2F3WA 4CKCA 2J4XA 3FEWX 2SNMA 1SAPA 1I6HB 3NHHA 3K4KA 1KLUD 1LVKA 5D3DA 4J00A 3TZDA 2TSSA 1DGWY 4PSXA 1QU3A 3VR2A 1SE3A 4KMUC 5HURA 1YNND 3OL4A 3TN2A 4BQQA 3EA6A 1RF2D 4CZCA 3A2KA 3FVQA 4QF4A 5IT9E 3BVGA 2IS4A 4FF4A 1V1PA 4E7IA 2LY7A 3OIQA 5G3LF 3DTEA 3H3VC 2QF7A 1Y69U 5IOCA 1V43A 4V0BA 3H0DA 1UUPA 2DNCA 2HDLA 3UNGC 3IKJA 1LV9A 3AMUA 3OYIA 2PPBC 1KNAA 1D1AA 1X3PA 4IQ4A 3K6OA 2CMPA 1HQMC 2V6EA 2O5JC 2F03A 1V5FA 2R7SA 1JWMD 3WOEA 2K03A 1LDKB 5LD2C 1V8QA 1X1AA 2EE1A 4XLAA 2X1CA 1SYCA 1Q12A 3ND8A 3SDBA 2M0MA 4QB4A 5K36G 4N4NB 2EY5A 4IKFA 2LOOA 3TP6A 3D4RA 3IFTA 3MC0B 2CW7A 4K8JA 4F7XA 2R7XA 4F87A 3SVMA 2R93B 4L8JA 1S5DD 3V2TA 5C4ZA 4IURA 4KISA 4KTAA 1EIHA 1O7LA 2KCCA 4DOZA 1STAA 3RQ4A 1Y1VB 4ZYSA 4JOMA 3MXGA 2DXIA 1PTOH 3K10A 2VQHA 3BG7A 2K5WA 2PW7A 1QB5D 1R9TB 3OYCA 4K2LA 4DFAA 2A6HD 3OMGA 1MW7A 1LT5D 3T16A 1Y8PB 4G4KA 3A56A 4ZAIA 4Y33A 4BE2A 4E7KA 1VF5C 3MKYB 1TWHB 2WINB 5FOBB 2QKLB 3CRKC 3S1RB 1VF7A 4ZC3A 1MMGA 1TS5A 3H6MA 3BCBA 1AN8A 2JUGA 4DXFA 5BN3A 1G91A 2W82A 2RREA 2BOSA 4M1UB 2L0CA 1LTRD 3BYYB 3ZGKA 5D14A 2PO4A 4DIQA 1VMPA 2E2IB 3MXUA 2E2HB 2KOLA 2XNAC 1EY4A 2VB6A 2KECA 2VNUD 3FDTA 3U21A 1ET6A 5KGUA 4XOTA 3FBIB 1PYWD 3HGBA 1E2VA 1CK1A 1WJDA 4XLHA 3VWBA 1BDOA 3S9WA 1UELB 2A6TA 2WAFA 1XXGA 4H7BA 2NN6I 4H13C 4R9WA 3HL2A 1WTQA 2NVXB 3QO2A 1ERDA 3L2QA 3KLSA 5CMDA 1F9RA 5M3MB 1ZELA 1A3TA 3JAME 4KD4A 2R61A 3S16B 5I9PA 3GBGA 2K7VA 2FINB 3PL8A 2CUJA 4I65A 5C3WA 1SYGA 1YNJD 1IW7C 1FGBD 3J81L 4NC8A 3HOWB 1R6RA 3PUYA 1BQQT 3K5NA 1SNDA 4A3EB 1WJ5A 1JICA 4DF7A 3LSIA 4Y4RA 4KITB 5LFAA 1WTXA 3HKZA 1BUVT 2VIXA 3OS2A 4ZKBB 3K5MA 3MXPA 4XKCA 4LITA 1PLFA 3SYTA 2IPKD 1MMDA 5I6YA 1Z3YA 1F77A 4BQNA 1L0YB 2XWBB 4C2TA 4XYOA 1U4MA 2AUKA 2IS6A 5E4WC 5EBCA 3EFXD 1U0JA 3MD2A 2F0KA 3DEPA 3V42A 1H9RA 1EY0A 2X6XA 1SXTA 4FF2A 4AU7A 5IGGA 1D0ZA 4C3IG 4KKTA 3I4LA 2KEEA 3LNNA 3HOYB 4CJ0B 4BEHB 1W6JA 1HTLD 1RDPD 1G2SA 3X3MA 2MPMA 5LHY1 3DLAA 2M2LA 1SYBA 1KABA 2VJIA 4KN7C 4OAYA 1LACA 1I6VC 4NQWB 1YE9A 3ZR8X 4HSPA 5KNDA 2OUMA 3PJRA 2KLOA 5FO8B 2X6GA 1WTWA 3J7AY 3J80L 2E76C 4YEJA 3MTSA 4HEDA 4RM2A 4CHTB 4BQOA 3L2RA 1C4QA 3P1HA 3Q23A 1Y6IA 2AQFA 4BXFA 1LTAD 1SMYD 2EJGC 4G57A 2EY1A 4KJNA 2PJRA 2BCOA 4CBVA 3S17B 1EIGA 1STGA 2K6AA 3K58A 2KL4A 3URYA 4NKLA 2WKDA 1FMVA 1Z21A 1BCPB 1D5MC 4TSSA 1STHA 4A3MB 1AP0A 2GA4B 2VB2X 1JQYD 2WIIB 4IUPA 4XLCA 3RCOA 4F3QA 2K5QA 2VJ5A 4PFOA 2BW3A 4C9YA 3BG6A 4TKOB 3S1QB 2X51A 5F2DA 3KBGA 2F0JA 2EYMA 5J1ZA 5CV4A 2D62A 1OXUA 4GRIA 3BC8A 1TY2A 4IQJA 4LAAA 1EOTA 2ENBA 3T53B 1CZGA 2F4IA 1H9SA 2B2WA 1QCBD 4ZLTF 3EUAA 2L4NA 1EYAA 4XQQA 3K4LA 5KYIA 5JAVA 4HCSA 1CM9A 4BBRB 1M4VA 5M9OA 2WKCA 2IT1A 4IZZA 4QIWB 5M3FB 2XIWA 2CUZA 3LSKA 3CKIB 1ZXTA 4A3IB 3E0JB 4BE0A 5T1IA 5EKLA 3PMFA 3KK7A 5C5MA 1CI3M 3RD4A 4F8MA 4KY7A 1KDBA 1OLTA 1OXSC 3OYMA 4ZUJA 3D3RA 2ZXPA 3BVMA 4RGTA 5CV7A 5DEHA 3VSLA 1Q3LA 2VASA 4DAPA 3HPHA 4K5WA 2BOLA 1V1OA 3N05A 1DQUA 3PIO3 3A55A 3OIPA 2A6EC 2Z2SB 4GZYC 4X3TA 2A6ED 2VQGA 1TKWB 1CA6A 1WJAA 2PQEA 4N9PA 1IKMA 4J1MA 3CZ6A 1H9JA 3VYRB 1I4GA 1PFBA 3TP5A 3KLRA 2NTSA 3BCAA 5C4JB 1IHZA 1CA5A 2IGOA 3KEYA 3QG1A 1FR3A 2HVRA 4PMWA 4EATA 3KF8A 2R7QA 2IX3A 3D5LA 2IL8A 4C56C 3M7NA 2RQQA 4QUCA 1KONA 4ZYAA 3U9SA 2KPMA 2F0NA 1EU4A 3ERQA 3MFYA 3A7LA 2IGNA 1V5GA 2L55A 2HCIA 2UUZA 1Z3XA 2CVRA 2TMPA 2NOJB 1O7YA 5AFWA 3GTKB 4F55A 3QOEA 2ZXRA 1O80A 1PYVA 4IX7A 4P2CB 2B39A 4E6IA 3D4WA 3OYAA 2K1BA 1W36D 5I2XA 2NVTB 4G7HC 1LT4D 2EY6A 2KQ3A 3OS1A 3NPPA 1LTGD 3I90A 2XN9C 3NWTA 2LMCB 4XN3A 2K3PA 4XNFA 4BS9A 4FNFA 3LL7A 5KHDA 1HA8A 3OMCA 1JOQA 3J81E 2CQAA 1UEAB 2QKMB 1X19A 4DJAA 2O5IC 1GHJA 4OIKA 2M7BA 1K8OA 2MGSA 3S3OA 3TP8A 4MN3A 2AQ1B 1B53A 1GOZA 3H94A 1I4XA 2Y0SB 1I50B 2BDOA 2F0PA 2QCPX 4J8QA 4NC7A 1J9OA 4F93B 3VYSB 1L0XB 3R3OA 2XDVA 3EJIA 2B2VA 1E2ZA 3V05A 5KIXA 2HNHA 1RJTA 1OXXK 3TP7A 2MC4A 2NBFA 3C3LA 1OR7C 1QILA 4ZKCB 1EY5A 5G3LD 4I7ZC 4AYBA 4XT1B 1PFMA 1KNEA 2V26A 1HQRD 4J01A 3V96A 3D8GA 3G7LA 3H09A 4KKSA 1EY6A 3SK6A 2F0VA 2W00A 3NUCA 3HOSA 3J7AV 5NUCA 3A7AB 1S4ZA 4XN0A 3DMUA 3PNVA 4NDXA 1TVXA 3OR2C 5DM73 3TL4X 1DOKA 2K5CA 4IZ8A 3DQVC 5C3EB 1B2TA 1IW7D 2EYHA 4RMNA 3S32A 1DCZA 1S9HA 3PO3B 2K9LA 2KZVA 1SNMA 3IAM2 1HHVA 2SDFA 5JVG3 4HNTA 2P0WA 4PJJA 4RWSC 3CP8A 1A3UA 2X6WA 5FLXL 4BJ6C 4XOPA 3GTPB 5CV6A 1EA3A 1I4PA 4ITVA 3OHXC 2V4JC 3W2VA 1YX5A 2RNGA 1BR9A 1FNUA 3EUHC 1H9MA 4II2A 2X6LA 2VQLA