3HG9A

Crystal structure of putative pilm protein from pseudomonas aeruginosa 2192
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
119
structure length
119
Chain Sequence
LAEVDTLARSLLLYRSRLAEYAHANPGFSGSPADSALGLPAWFRKPVRLQGYIAAGTSYAFIASPPAGLAAAVDTGTESDLVGVRRNGQLVTRRLGATAIALPAPIPEGAVVAVKEGHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PilM
publication title CRYSTAL STRUCTURE OF putative pilM protein from Pseudomonas aeruginosa 2192
rcsb
source organism Pseudomonas aeruginosa
molecule tags Structural genomics, unknown function
total genus 16
structure length 119
sequence length 119
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-05-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1170 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3hg9A01
2.40.50.380 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3hg9A02
3HG9A
chains in the Genus database with same CATH superfamily
2KPMA 1EYAA 2EIMH 4APVA 3OIPA 4NC8A 4KTAA 2EH3A 1EY9A 1SE4A 4F7XA 4XKBA 1BOSA 2LF7A 1R6RA 2V1CC 3ZQIA 1MGSA 1PH1A 1D0XA 4IO9A 2ZNYA 3T1YL 4DAVA 1J5EL 1FL0A 1KC8C 3K0LA 5HODA 2MSYA 5GAEC 3QP5A 1K3BC 2K75A 5ELCA 4KKUA 4LIVA 1Y8QB 4GN5A 5C5MA 1U9OA 1VQ6A 3FXRA 1W6KA 2ZTCA 2JUCA 3GTQJ 3BJUA 2IPQX 2CG4A 4DPGA 4LF8Q 4GKKQ 2K4KA 1LO5D 4BY7H 4RH6A 1X1DA 4O6JA 4BE0A 5M5XH 2HQLA 3DBHB 2I46A 1XDSA 5ED4A 2PMZN 1R49A 4JYKA 1L0OC 3VR4A 3NK9A 3CC7I 4HW0A 4YFNF 4M73A 1XMAA 3SZGA 4A3LJ 2LREA 3DTEA 2P5LC 4LF4Q 3BU2A 2HZTA 2FJ1A 4I0AA 3P7JA 4LG3A 4YIFA 1MGTA 1W5CC 4JI1Q 1R22A 4RA2A 4N4NB 1WTOA 3ZQ7A 5HNHA 4R1JA 3TP6A 1PTOC 3HKZN 5CC4A 4AM3A 1EV7A 2MD0A 3OW2A 2YS9A 3KLSA 1R9TH 2WAQA 3I4MG 1XGOA 1HHVA 2LDUA 3TMOA 2TCTA 4NQWB 3NRVA 3SYTA 2J7ZA 3IL8A 4OINF 3HSRA 3S14B 1JCKB 4H4KC 2NVXJ 1D5ZC 4Y17A 3OY9A 3DM1A 3TP5A 2A69D 1QZYA 4G6TB 2NVYJ 4AYBA 3WTTC 1I4XA 3IUOA 3H0GB 2OZUA 3S3NA 4BXXJ 2X69A 3S1MH 3FXUA 4KK7A 5IE8A 4BY1H 3RIRA 3GTMH 4IPAA 4BACA 3V7CA 1VQPA 1BUVT 3WU2C 1JTYA 1VQ4A 3ZQGA 2EYMA 3ELKA 5A35A 5KVRA 1TVXA 3G73A 4FVMA 5HGTA 3U50C 2HDMA 1PYBA 1JWMD 4JI4Q 4LMQD 1OKRA 3HOUB 5C3EB 2E2HB 2VASA 2FSWA 1Y1WH 4IHYA 5E18F 2Y9ZA 2PX9A 2KHIA 3MZ8A 2E8GA 5E4XA 1EWIA 1C48A 3HOWH 1X2NA 3G48A 3GTGJ 5GROA 1B8AA 3A0HC 3VR2A 3WU0A 5E3LA 3KF8B 3KYHC 2LKXA 2VUMB 4XTCS 1RZ4A 1S5LC 1MSEC 5J22A 3R3OA 5FO5A 5ELFA 2EV5A 4G9YA 3C7JA 4EQQA 3FKIH 2NVUB 1I6HJ 2PBIA 2RQQA 1HUMA 5F2DA 3F8NA 1FYMA 5HS8A 2LVSA 4M3BA 4ZTJA 3GV6A 3OYKA 1E2WA 4OWXB 2D62A 1CQTA 1HPCA 5B1BH 2W48A 4JBKA 3K4BA 1XPOA 2EIKH 1IV6A 3W2WA 3CC2A 3FHZA 2L7MP 3I5UA 2QKMB 3LX0A 3WTWC 5ILUA 3S17H 1PHJA 4EM1A 1OCOH 3BR2A 2DDAA 3A5ZB 1HNWL 1ZYRC 3LL7A 1NK2P 2P8TA 2YV5A 1R1TA 4CYCB 1X3ZB 1PTOD 2CMPA 1I5ZA 1TQMA 1XNQL 4I7ZC 3FMRA 2ZJQF 1LT3D 4NQWA 4LUZA 5IT9Z 5LGUA 3ABKH 1B72B 1E2VA 3OR2C 5A2QZ 1QVUA 3W5OA 3T1HL 3D0FA 2GA1A 4P72A 2LP0A 4DYRA 2DA5A 1ETYA 1F1ZA 4OOIA 2EA4A 1BI3A 2NZOA 4BL0B 1OO9B 2K03A 3TOAA 2O0YA 2PYKA 5C44H 2B39A 1XPRA 3HOYH 4C3IG 5FJ8H 4G7ZC 3GWZA 1QILA 4HF0A 5CYVA 1JWSD 2V7FA 5IYBJ 3GP7A 1XMOL 3OOPA 1V1PB 2FINB 1ASZA 4LK1C 3O13A 2E2DC 2HOSA 1DOKA 1JICA 2F4MB 3ERED 1CK1A 2H94A 1F4KA 4DR1L 4GOPB 1MBGA 3VR3A 3HPGA 3J81L 2OF1A 4A3JB 4IFDG 1BR1A 1TU2B 3J7YW 2HHHQ 4A3DG 1WI3A 5J1UA 4R79A 1O3SA 1P92A 1E17A 3ZQLA 1IBML 4LFBL 3F2CA 2EYJA 4EJOA 2BE5C 2OD5A 4EQOA 2N3SA 1NG6A 4BBSB 2L1BA 3KF8A 3TKYA 2VQHA 4YWKA 3KETA 3I58A 3ZRGA 1WJFA 3CMAI 1YI2I 2JEBI 1LUZA 1U8BA 2KP6A 3BZCA 5I2XA 1SVOA 1WD0A 1A36A 1PXUA 1STHA 5CGKA 4II2A 3S2HH 3FHWA 3CRLC 1O78A 3IWFA 4BHCA 2E5LQ 1Y39A 3S8PA 1VQFA 3V42A 4GXOA 1VQMI 1G2SA 1R58A 1K61A 3BG7A 1VQ5I 1ZGWA 2YUSA 3UE1A 3GZNB 3RKXA 1WFQA 2ZXIA 4UHVA 1ZARA 1A8VA 1W3SA 4RBOA 5J47A 1HCRA 2NUCA 4M1UB 2EJGC 1ZKOA 5JJLA 3F3XA 1DOLA 2R7WA 4IALA 2AQ2B 3DLLA 2JA5G 1DUXC 1S7OA 1S5FD 3CCYA 1ZYRD 4CYCA 5HOOA 1KAWA 2ID0A 3RSNA 3GFIA 4IO9F 3BTCA 3LQQA 3KP5A 1HA5A 4ZH4F 3GXOA 1YX5A 2K27A 4DFAA 1B72A 2K4BA 1SYGA 5GAHC 1DGSA 3OTOL 4AIKA 3FP9A 1GVPA 5CVRA 3IC7A 1IW7F 4IQJA 1IBKQ 1VTNC 2IL8A 1X58A 4F91B 2KA7A 2PQAB 2BZTA 4JI7Q 1YRNB 1R1VA 1U78A 3A01A 3ITPA 4RM2A 5DCFA 3JREA 2X6XA 2PMZE 3GTJJ 4NC6A 1V1PA 4Z9CB 3NBHB 3LWUA 4XBFA 2GVAA 4PDKA 2DUDA 4ID6A 4IN3A 2CQ7A 4L9VA 3HUGB 3T16A 3WTSC 3I4NG 4GOPA 4NXNL 1GXDC 2H5XA 3BDOA 2JRTA 3C18A 2I8DA 2TDXA 1CI3M 2B63H 3IP4B 5ICCA 2EJRA 2SEBD 1JUPA 1TWAJ 1MMSA 4KHPQ 4X6AH 1ORKA 3SK5A 3MN2A 4RFBA 4GLXA 3ULPA 2WACA 5EF6A 3TL4X 2LTPA 2HR3A 3P9IA 1KONA 1XTAA 3LA2A 3BG5A 4A6DA 2A05A 1XTDA 3HKZE 2Y75A 2BE5D 3K5LA 1YHAA 2K7VA 3DPTA 4A3BG 3BCAA 3BTIA 3TOBA 3J7A5 2IW5A 2LG4A 1YJ9A 1MH4A 2LRDA 4BQOA 2ZSIB 1HLVA 3D31A 4JW0A 1ZELA 1I3QH 2KCTA 1O4XA 1UZCA 3G2BA 1Z0XA 4B1RA 5J8CA 2M0MA 2OWOA 1PJRA 5KNDA 2DN0A 1DP3A 4J00A 1U3EM 2F3IA 4DUZQ 4QIWN 4WRDA 1UE6A 5GTHC 2C6YA 3KDFB 4DR6L 1IN8A 2M00A 5KYIA 3SDGA 1S5DD 2E2JJ 3PO2H 1ZAOA 1WCMG 5CBAE 1X1CA 2PNHA 2L12A 5JVGF 2OTJA 3WGIA 1KQ8A 2MFZA 4IUQA 3K5OA 5K5PA 2R0QC 5AONA 4HF1A 3ZMSA 2UUZA 4EJUA 1OPCA 2Q8RE 5C0XI 1PV4A 2NBFA 3HOTA 4A3KG 3F8MA 4XLEA 2KFDA 3CCVI 5IT9E 2NWGA 3K4NA 4KT5C 1IHZA 4MQ9F 2AXLA 5M5YB 4IQZA 2H1LA 1OR7C 1L0WA 4U0VA 4C3JB 2RAEA 4L9NA 2HOTA 1WVLA 4U68A 4RB1A 2PQAA 5LMUQ 1N34Q 5E3NA 2ZTDA 3CP0A 1YRNA 5K7ZA 2M87A 3GF2A 1VQ9I 3O8HA 1VMCA 1RDPD 1NSNS 3OSOA 1HXDA 1ETWA 2A69F 4TVAB 3LFUA 3NBHA 2EV6A 3H91A 1SYDA 4HX7A 4IZZA 2KVMA 4BBRH 3HUGA 1ZEQX 2Q2EB 5BS6A 2BEOA 1YITI 3RZDB 3M4OH 3IH2A 4CJ0B 4G8XA 4I99C 1TL8A 1LTGD 3HGGA 4RMFA 3KUPA 1IRXA 3GYHX 2HYFA 3FWEA 3FKJA 4M9SA 2LMCB 3A8IE 1AA7A 2E2IB 4J6HA 1Y8OB 1LTAD 3HDDA 1P4WA 4G6DA 4ZQ3A 1VQ5A 4RGOS 1A3VA 3DWPA 2X1DA 2K5WA 2BOLA 4I01A 1SN8A 2R93G 4BY7G 4UXNA 4BDYA 1X9NA 3ZP5A 4LAAA 3M07A 4RGSA 1QVFA 3M1CA 1RKTA 4GZYC 5IT9c 1YYVA 3LFKA 3BP8A 3KDFA 5M3MG 4P9UA 4A3IG 3KP4A 2WAQN 3R4KA 3CCQI 5CORA 3VA5A 2WTEA 1WJ5A 2R92B 1PH5A 4DNIA 4RKBA 1FYCA 4XRSA 1DU6A 5CBEE 5FOBB 3PQIA 1E24A 4U88A 4DGZA 1YNNC 4PZ6A 1NG7A 4D0PA 3MHBA 5F64A 4AYBN 4RAFA 3GTOB 1QPIA 3FMCA 2MP1A 1ZRDA 1SMTA 3A7AB 3OYEA 4F7ZA 1R00A 3TO7A 3VSLA 4L5RC 5CV6A 3EPZA 2LNBA 2RSNA 2IS6A 4I09A 5EGOB 1RETA 3KPHA 2K50A 1LE8B 3E0EA 1ACIA 3BTLA 1A5JA 1JORA 2VQEQ 4A3MG 5IYCH 4ENNA 2HVRA 1PTOF 3KZYA 1HBXG 2C35B 3PO3B 1SLJA 3S14H 2YTVA 2VJ5A 3V7SA 3OMYA 4A93G 3JAML 1XCBA 1Q1HA 3KLNA 3J80L 4PFPA 4PZ8A 2IEKA 3AB9A 3HGYA 4MNUA 1F9NA 4U87A 4OX9Q 2D45A 1R71A 3H0GH 3ZGKA 4OAZA 3TDUC 1XSDA 1QUQB 1HXYD 3E3VA 2XVSA 1S8NA 1LYLA 2VOOA 3HOZG 2Z6BA 4DNRB 2QEXI 4DV0Q 3BQZA 4IUUA 4HRIA 2Q2EA 3H3UA 1ZRFA 1P7JA 2B2WC 1E3OC 3ZQCA 3DLLF 2R7FA 1FBQA 2DJGC 3QPLA 3MTSA 3HOUH 3S9WA 4XYQA 2E2HH 4KMUC 1LDKB 1KA8A 5IYDH 1Y69U 4B3XA 2RNGA 4EATA 1Q8KA 2YU3A 3RLFA 5I2YA 1MIJA 2A6EC 1SXTA 1MBHA 2HCIA 1TIID 5KNBA 1S3JA 1YW8A 3X3MA 4XORA 4PJJA 2ZM6L 1G6PA 2XWBB 3G7LA 3C1FA 3I2ZA 1SJHD 4MTDA 5ERIA 3BJ6A 1C7YA 2FOWA 2VKHA 3L7WA 3G6EA 3RCOA 2VUMH 3CDIA 1JT8A 2M1BA 1MMGA 2KRHA 3LA7A 2DODA 3KEQA 2KT0A 2N88A 1W7PD 4G7HC 2E76C 1V1OA 3I4OA 3OW7A 3LSIA 1PMRA 1RIPA 1FOKA 5ICFA 3GFLA 5JEAG 1BM9A 1YNND 4JI8L 4DBRA 5BPDA 4HX8A 3DWQA 4Y52H 5CKTA 4FE7A 1TWGB 4FDBA 1Z05A 5L3DA 2F0MA 4HMJA 3AL0C 4PK4A 3S32A 4C2MH 4FF4A 3K7AJ 4ZRZA 3FPUB 4CJ2C 3G71I 2QEJC 3EFXD 3RDIA 4BJTA 5EGOA 3RZOJ 1SDFA 1LE8A 1VQ9A 1OYYA 4ZYGA 5L3EA 1ZYRF 4B48A 3CMEI 4IJLA 3CZ6A 2WB1E 3HZJA 3EUAA 2SNSA 4F88A 2BA0A 2VONA 1TWCB 1Y14B 4JV5Q 1SSOA 4N0BA 3M3YB 1TTYA 1FJGQ 3IKVA 5DEQA 3NWTA 4D5CA 3LMMA 4X62Q 1T56A 2XPWA 3TEHB 3Q0UA 1YITA 3BZDB 2ZFWA 5KNCA 3GZ5A 1XNRL 2CW0C 1N25A 1QUQA 4QIWE 4A3CG 1HKTA 4DW6A 3L3OC 5D5XB 2DXIA 2DMPA 3DEEA 3K8AA 3A4CA 2D2WA 4G7ZF 1JT6A 3S1NJ 3A8JE 1K28A 1NAPA 3S2DJ 1OCTC 4YIJA 2PQEA 2M4GA 1D3YA 4YHHQ 2IWHA 3MWYW 4LK1F 3KEYA 2BXYA 1R4QB 4A3JH 3STBC 4F3QA 3LAJA 4HG2A 1I50B 4HPQA 4XRFA 2ID6A 1WJBA 4ESBA 1VQEA 1VQDA 4KN7X 1CKNB 3Q0AA 2A6ED 2KJBA 2F0FA 4PJMA 2LD5A 4BBSH 1TC3C 1H9JA 3CCQA 4JI3L 3CQZJ 1TS4A 3AL0B 2W25A 3HOXB 2BE5F 3IKJA 2R7ZB 3WE3A 1MHWC 2QDBA 2ISYA 4QGUA 2Z33A 2E7WA 4H0EA 3RQ4A 1X54A 1QE6A 3K4MA 3HPHA 4LF5Q 4FYDA 3X3NA 4OO1G 3SZPA 2MGQA 2CU7A 1W2BA 4N9IA 2UWMA 1WJJA 1BC7C 2QQ9A 3VWBA 3F72A 5TISC 1C0WA 4KJNA 2CFXA 4RCNA 2RN7A 5C4XB 4D1QA 2RGVA 4GO1A 1STYA 1HNZL 4B3MQ 3AMUA 4P74A 2PNRC 2WB1G 2QQ8A 3BLYA 4H02A 2IX3A 3S3OA 1VQ8I 1Z3YA 3RPQA 4WORA 3PUFA 2C5CA 2PW7A 1ZKGA 4FTHA 1S3OA 2X48A 3OS2A 2CFOA 1HOMA 1Z6TA 2B2WA 3ZXSA 3MA2B 5EEHA 2R7XA 4YIRX 3H35A 2M9VA 1K0SA 2L9RA 2CQXA 3F8CA 3ROUA 1U8RA 4IFDJ 4A3FG 3QOJA 3PNVA 3ND8A 3HOSA 3SGIA 3MC0B 2JRMA 4IHWA 2R7TA 3BPXA 2KIMA 3BG3A 4KDPA 1R5ID 5FKNA 3FXMA 2JJ7A 4B3TL 1JGSA 1MSHA 4G94A 2VE9A 2JSCA 4MTEA 3L7ZC 1PVEA 2X1CA 5DDGA 4TKOB 2JK3A 3GDEA 4BA1I 4GFBA 2Z16A 4PNYA 2J5PA 3T1YQ 3K4CA 2WAQE 2CW0D 5E17F 2DLLA 1B9NA 2JA8G 1V55H 3GVAA 3BT9A 2FBIA 1DPUA 2DU9A 1IN7A 3JTGA 2DA1A 4DAPA 5DUKA 2XGEA 1WWXA 4B4CA 4NBQA 1S72I 1OISA 3M1EA 5AJ3L 2CQNA 1UHMA 1MNEA 2EIJH 4ZKCB 3CPFA 3STBD 3IKTA 1CKNA 2HPIA 1C8CA 1I1GA 2GXGA 4OL7A 5AIPA 3HS0C 3E5XA 3RKWA 5CR3A 4KMFA 3FM5A 3NHHA 1D8LA 4BA2I 1O80A 1N32Q 1B4OA 2PPBC 1W0TA 2CUFA 4EGZA 4DV5L 1Q81C 1X3FA 1O7FA 1Y8RB 2XAGA 5C4JJ 1VQKI 2J5OA 1WGXA 4DK3C 2Q1ZB 3J81Z 3K58A 2XRSD 4M74A 4DYCA 3S1RB 3VDYA 4HOBA 2G7HA 1Y1VG 2AQ3B 4RAUC 3FXQA 3CC4I 5C0XG 4IOCF 4RAZA 2NNYA 5DUIA 1WI9A 2CWPA 3CCLI 4FT8A 3JSOA 2VPRA 4EX5A 5B66C 1AZPA 2KDZA 1KDCA 2M45A 4LF9L 2UUBL 2CVRA 4QQBX 1DU0A 2F48A 2Z4IA 1V5GA 1GV2A 1HFNA 5F0FA 2H09A 1EY7A 4QMGA 1I4RA 4RM3A 2XKOA 1PYSB 3LSGA 3OOCA 3SJMA 3GTPJ 2B2UA 4WXDA 4L5IA 2FA5A 4HCEA 3IH4A 1H9TA 4HSPA 4QF4A 3VR5A 2ZJ2A 3L00A 3KLOA 1HZ9A 5KYLA 4IPDA 2ZXPA 3O6BB 5M5YH 1J7KA 1E3PA 5FLMH 1VQJA 5TJJA 2BHYA 4C3JH 1KQ0A 1JTXA 5BPIA 1X3EA 4X3KA 1QVTA 5CVUA 4ZYHA 1SE2A 1UG0A 1Z47A 1MNDA 3WOEA 1N33L 5LEJA 2JT1A 3SK4A 4M71A 5JVH3 2EPBA 3W1BA 3LNNA 1EQQA 5HS7A 2JA7B 2KHSA 2ZBKA 4BBRG 4LF6Q 3FXOA 2ZCWA 1ILPA 4L0ZB 2ZTEA 1WTVA 5FFXA 4ZTFA 4LB5A 2CV1A 2Q8IB 1NMFA 5FD5A 4KUMA 3QG1A 5EZGA 3F23A 2VODA 2DMUA 2Z5UA 1EEID 3RZDH 3OWTA 3QPSA 3S15B 2FXAA 5T1GA 4HF2A 4DV1Q 4Y7NJ 3SK8A 2UV1A 2JA6J 2DA6A 1HUNA 1TR5A 5HY6A 3V4GA 4A3GB 2OUMA 1MMNA 1F2ZA 2E2IH 3V8KA 4BWGB 3NQIA 4GCVA 5KEEA 4CSWA 4A3EJ 1BC8C 4DR3L 1IL8A 3N52A 4G57A 3AG4H 3LGJA 3U58A 4JP0A 2LY7A 1WH5A 2KRFA 3OYCA 3VFZA 5GAGC 3KFWX 2XGTA 1Q7YC 1HNWQ 5FRMA 2MW8A 5EPLA 2OQGA 1BR2A 2XSJC 5IP9H 5IGBA 4UB8C 1OYIA 2CWAA 1F9QA 4E7JA 3K5MA 3D4WA 2B2TA 5D14A 4O3MA 3BDDA 4X0GA 1VQ8A 2E36A 4S05A 4HJ9A 1XNQQ 4KNYA 1EY8A 2F0EA 2DJIA 3I70A 1MIUA 2QVOA 2R92H 3PQJA 1R5HA 1ZQ3P 1MBFA 2ME6A 3GLXA 2JPBA 3ZN0A 4KN4C 2G9HD 3NTIA 3C3WA 3AU7A 4EQPA 2FBHA 2DT6A 4U7BA 1HFGA 1MBKA 4ABNA 4A3LG 1B59A 3D0SA 3T1HQ 3ZCOA 2XKPA 3E1SA 4E7ZA 3K6OA 3HSEA 1E0EA 2E5NA 1S5BD 2DO7A 3GTOH 1U5TC 1M4VA 1BIBA 2UUAL 1B7YB 4WXCA 2LKVA 3IH3A 4A69C 4IHXA 2IRFG 1PRTC 2W24A 2Z2SB 2VQFQ 1BN5A 3P75A 5IGDA 1TZLA 4AWXB 4DV6L 3CW2C 2M2EA 4DV4L 1FWZA 2OF7A 3MEFA 2OQKA 1EOTA 4DR1Q 4AU7A 2O5JC 1XS9A 1JR0D 2NRAC 4CHTB 1H9RA 3T5XA 5K5OA 3PO3H 2F52A 1UE5A 3E9IA 1JWUD 4BYYA 1H95A 1ZG3A 5BMZA 4BS9A 3DPUA 4GRIA 2Y0SB 3HOVB 3J7YJ 3DWAA 4BY7J 4WJWA 3SHLA 1BI1A 2XIWA 5M5XJ 1W0UA 1ONLA 3ER0A 4PGHA 1S72A 4BXXG 4X66L 4CDCC 2K85A 3PIO3 1KD1C 3HEJA 4XLFA 2XAJA 3K1NA 1X1BA 3OL4A 4IUPA 1P4AA 1D2BA 1UNSA 2STWA 5IP7H 3BC8A 1C0AA 4IZ8A 2SNMA 4KIBA 4FNFA 5E1XA 3PF4A 1HH2P 4X3TA 3OWFA 2JA9A 3QU3A 4DF7A 4MQVA 4JI2Q 1SYCA 2D0PA 2F0TA 1VFCA 1ICFB 4RGXA 2CCZA 3O8GA 1MBJA 2MABA 2K5QA 4B9XA 2IHFA 2K01A 3CCUI 4XT1B 3DTIA 1A3TA 4N8X1 3CTAA 1U5TB 1DYQA 1R9TJ 3GLLA 2H8RA 2A6EF 3CC4A 1OFCX 3LA3A 4NXML 2XPUA 3TO6A 1SBBB 1A35A 3J81E 1PRTB 1IRGA 4BQAA 3L2CA 2K5NA 3CCLA 3OYGA 5K36H 2G7UA 3AEVA 1YFHA 2ACJA 1WJAA 2F4IA 4N8FA 4PMCA 5HDNA 6PAXA 1HSTA 4B3SL 3ECOA 3A7LA 2Q8TA 3GTLB 2AS5F 1SNDA 2XWJB 2VL6A 3S1MJ 4C3HB 2L5QA 1PLFA 3DP7A 4IPGA 3NENA 4BY1J 2K4JA 5EAYA 3GTMJ 4L6TB 1J75A 4EGVA 4G7HF 1EH8A 1WTRA 1EQRA 2LK2A 2Z1CA 5I9OA 2R3SA 1QBJA 4IEJA 3ZMTA 1WJCA 2RA4A 2I5UA 1MSFC 4LLGF 2M7AA 1TWGH 2L54A 5E1FA 2GXAA 2XGCA 3VODA 1G91A 2XROA 1Y1WJ 4PUSA 3BR0A 3M4QA 3RN2A 2GBYA 1PRTD 1G291 3HOWJ 4POGA 2RC4A 1RF2D 2J0TD 5M5WB 1G6ZA 3AG3H 4C56C 4NXNQ 1WTPA 1SD5A 2EYLA 4JI0L 3TO9A 3U4VA 4F87A 3ERSX 1TWCH 3W2VA 1O57A 2ZKZA 2R7OA 1B1ZA 2Z6KC 4DNCA 2EK5A 3AQQA 1XJVA 1FSEA 3M3YH 2RDGA 4UP8A 2Y0SA 3U1KA 2KQ3A 1RPWA 1CUKA 2Z0SA 3FX3A 1OCRH 1D5YA 3OV8A 2DJFC 2F0LA 1YIJI 2XIGA 3ZJYC 3NWSA 3TREA 3FKIJ 4XQJA 4PZJA 2VE8A 1XPUA 2HZDA 4GS3A 4F8MA 1EYDA 5FKKA 5IYBG 4MIMA 1XG1A 2CW0F 4OIPF 4Q4ZF 3J81c 4I7HA 3TQYA 4R8NA 1ZXTA 2HDWA 5EGTA 2FMMA 3AFPA 3W2DA 3S17J 3FVQA 4I0BA 2X0LA 3J80Z 2QSGX 2ZXOA 1I50H 4QPOA 2KIFA 1I4PA 3I4LA 3OWEB 4DN4M 3FDTA 1U5TA 2RVLA 1B44D 2XDVA 1RJTA 4LITA 2FF4A 1JKQC 3KZIC 3BVGA 2MA3A 4BJ6C 4D7MA 2I5LX 3V7RA 3HOXH 3K2AA 3P9CA 1E1TA 2FD5A 2R7ZH 1PH7A 3KP2A 2B29A 3I4MB 3IAYA 4G6QA 1VQIA 4RAYA 4OU0A 1D6EC 1ZREA 5C44J 3OL3A 3HHGA 4OIQF 3HOYJ 2F0WA 1FJLA 4DXFA 5FJ8J 3I59B 1FNUA 1A6XA 5F6FA 1KDBA 4K8JA 2Z9HA 2VB3X 5EKIA 3KCCA 4LFCL 5M3FJ 2EB7A 3H3VI 4MEYF 4NP5A 5C4XH 1EY6A 4R8HA 4V2FA 3V8JA 4RHSA 3WGHA 1AW7A 4LNQA 4YEJA 4A2UA 4D7NA 4XM3A 4BEHA 1UB9A 3CUOA 4K2LA 1B53A 1F9SA 4L5TA 3SHFA 4ON0A 1CHPD 3H3VC 2CQKA 2CQAA 1CQVA 1ZN2A 1OXSC 2E1MC 1GLNA 4HLYA 2Z8LA 1MJAA 4DGWB 1WJEA 2XAUA 1Z77A 1NK3P 1W1WE 4OMZA 2O8KA 3EETA 1XXGA 2I07B 2GAUA 4JBWA 3F2BA 2FHTA 4HNVA 1T0FC 2VBZA 4XNFA 4IFDI 3S2HJ 4H0LC 2F0HA 3SXYA 1MKMA 2WBMA 2R6GA 1SR3A 1LTRD 1VQ7I 2IPKD 1BBXC 3A54A 2MO1A 5L37A 4BJ5C 3UDIA 3WG9A 3P7NA 4V190 2BOSA 3E5SA 1T08B 1NMGA 3VYSB 3CCUA 2COMA 4GYGA 1Z91A 2EY2A 2HIVA 3J7ZI 4FHTA 3T0YA 1IKMA 3S2DB 1RR8C 4JYAL 2L01A 2QKIC 4OONA 2ES2A 1DOMA 3J7AO 1MKHA 5T1IA 2A6HC 2CUEA 2W7NA 2NVQB 1HKQA 2ID3A 2IP2A 3PV0A 2IGOA 2PMHA 2K9NA 4CCJA 4LF8L 4GKKL 1A04A 4UY8C 4XDXA 4X3SA 1VQNI 2L4NA 2M0CA 2QENA 4BXFA 3J7ZC 1K4SA 2VI6A 1I3AA 2EINH 1EIGA 4XICA 1EKEA 1LT5D 1BI2A 1U0LA 4HYEA 5GPCA 1SNQA 3NBIA 1STBA 3SFIA 4RAGA 3SZTA 4LFAL 1NHAA 4PMBA 4DBQA 2WC2A 3QJYA 4Q47A 1SFOB 3S1RH 5GPAA 2E35A 1T95A 2Z6KA 3I59A 1HKSA 3ABMH 3RMHA 1MJBA 1SVMA 4YY3L 4XIDA 1JE8A 1XGSA 4JI1L 2XF7A 3QPTA 2F0JA 2FFKB 4FE4A 4KI0A 5LL6S 4G7OC 1Q1EA 1H8AC 1CF7B 3MMYB 4NNJA 4C3IB 4CUGA 5F27A 2FE3A 2X6LA 4ZZDA 1PYWD 5TSSA 1TT5B 2X6WA 2NNNA 5E1WA 2MUYA 3CDHA 5HDKA 1TT0A 2HQRA 1TW3A 2FNAA 1D0YA 2B63J 2CGPA 1FNNA 1KU9A 4DK6C 1OTCA 3S1QB 1K83B 2D9UA 2F0VA 4X6AJ 1Z7UA 1FEXA 3M9BA 5FLMG 1A6QA 1G8ZD 1EFWA 2V26A 1SD4A 3MEHA 2ZJPA 1STZA 4A3DB 3I56I 5CMDA 2RDFA 4ITVA 2CRGA 1V8QA 2LSOA 1FC3A 4LLLA 2HXOA 4EM2A 1HSJA 3KLSX 3H3VK 3SVMA 3UKGA 3I3CA 1I3QJ 1B70B 1VMPA 1GVDA 1CZGA 2JEAI 4DR7L 1YJNI 1TWFH 2CWEA 2H6CA 3RI4A 4A76A 5HGQA 2K9LA 2P7CB 9ANTA 1VF7A 3MXGA 3VEPA 4E7KA 3E5UA 2JA7H 2ZM6Q 4CDGA 5FRNA 1JB3A 1JJ8C 2RQPA 2LXJA 3QIAA 4LF7L 3PO2J 3G1LA 3VYSA 5D5WB 1YZ6A 3WODF 3OYYA 4XKWA 1Z6RA 3JRDA 4JI5L 2D5VA 5COYA 2V9KA 4KY5A 3J80E 3K69A 2MC3A 1MW7A 1FGBD 3S15H 2V6CA 3S16H 2R5YB 3U2RA 2KIUA 5LHGA 1BJAA 5DD4A 4K0KQ 5IOYA 2P5ZX 4KHZA 2EZLA 3GBGA 2A6HD 1HRJA 2RKSA 4A3GH 1S5ED 2JA5B 1FP1D 1KXLA 3VYTB 1IXRC 1WRJA 1BXTA 5LRSA 4YWMA 2QQBA 2E1CA 5IP9G 1BDOA 4UP9A 1EQVA 1X55A 4HV6A 2RCNA 3CF2A 3K4JA 3CJTB 1UWVA 1II3A 4IUNA 2XGDA 4E6IA 3WTZA 4AIMA 1ZG1A 5C4ZA 2KUMA 1RESA 2EFQA 4O0AA 2VB2X 1BQQT 3LSTA 4MN3A 2HIXA 4M9XA 2K32A 4C2TA 2LS01 3MD2A 1T0FA 2IT0A 2B8GA 3CDLA 1JB7A 4LG0B 5F04A 3Q0WA 1CKOA 1CF7A 4ZKBB 1CM9A 4HJ7A 2A61A 1U5KA 4BBRJ 1HZBA 3WHCA 3DBRB 2AKWB 1WTQA 1X65A 3M4OJ 3ONAB 1XNRQ 2K5CA 3K57A 2KENA 4RCOA 1YEZA 5ELNA 2HKOA 1CA6A 3I4NB 3SEQA 4HSRA 1ITYA 4ASNA 4MLOA 4UVBA 2WFWA 2RNJA 3PF5A 2B3GA 3BS1A 2I5HA 4MFDA 2JVHA 1I4QA 2MPMA 1RTNA 1KAAA 1HW2A 3OSFA 4GKJQ 2Z1DA 2BHZA 3RPUD 3JC66 3JAMc 3JRBA 3J80c 3CCMI 2KHMA 2QCOA 2O8XA 2W57A 1VQLI 2UXBL 1PRTF 2L11A 4EEFG 2FX0A 3G6JB 1BF4A 1BW6A 5EPKA 4DU9A 4CJ1B 1KL9A 2O4XA 2HDLA 4A3BB 1YVCA 4XOPA 1LTTD 2K1BA 4JBAA 2BDOA 1IZ1A 1Q8IA 3HOVH 3KJOA 4Q48A 2HVSA 2EYFA 4JI3Q 1YS6A 3FXJA 3M7GA 2HVQA 2BY1A 4U673 1SVLA 2GA4B 1HQRD 2R61A 4AH6A 1Q3LA 3H1CA 3M4YA 1HJPA 2HHHL 3NQOA 2ZXWH 1QJOA 3JRAA 2HOAA 2KBNA 1VQNA 4RKLA 2F6CA 1FGUA 2VQGA 2R5YA 1ZK8A 3MFYA 3NELA 1WCMB 3I8ZA 3KLWA 1M8AA 3TMEA 4R4OA 1TW2A 1LVAA 3TP0A 1X3QA 4RG1A 3DBLB 2UU9Q 1BKBA 5J6XA 3L2UA 3VYTA 2G5DA 5E3MA 4ESJA 1HC8A 5DM63 3BR6A 4K2KA 5FO7B 3PCOB 3R61A 2KEDA 4I76A 2FXQA 4NHJA 4A5MA 4A3KB 4BHBA 4HAMA 2TMPA 5BR8L 5IYCJ 3J7AV 2Y0MA 1LFUP 3RPUA 3UDXA 5DM7F 3S14J 1IYJB 2JXMB 2EFOA 1POGA 1AU7A 3FK7A 3IRQA 2IHEA 4FF2A 1QB5D 4NMZA 5LLQA 3TSSA 1UAPA 5GAEJ 3GTLH 1QRYA 3H0GJ 4KV6A 2MH2A 1TXYA 4P96A 4LG0A 3EYYA 3FBIB 3W3AA 1ENCA 4Y4RA 4C3HH 4B3TQ 2L3DA 2TRTA 4KYWA 2Y0SN 2VKEA 2F0OA 3NXWA 4CCNA 1HNXQ 3GTKB 1VNDA 2FJ2A 4RA8A 3I56A 5EJWA 4B3RL 2PLYA 1BVSA 2EZIA 3HOUJ 1GXQA 1APLC 2E2HJ 1EIYB 3MKZA 3L2PA 2BBYA 2YX4A 1ZLKA 4LFUA 5IYDJ 4RGMA 1YJNA 4BE1A 2LLKA 1G6NA 3JRHA 1G2TA 5M5WH 4LK0F 1ESFA 2HYGD 1ETXA 1GV5A 3HB9A 5AJ3Q 1DCZA 2ME0A 5EQ0A 5DYMA 3PIPA 1H9MA 3URYA 1IXRA 1ETOA 4ZC3A 4E7SA 2ZMEC 5J4YA 2R93B 3IFTA 2VUMJ 1SAUA 1XWEA 4KD3A 4ZK9B 4BY7B 4DR5L 5JHFA 2K5HA 3TP3A 2DJNA 1S5CD 2OTLI 5DD8A 3GW2A 1LTLA 1K78B 3DUZA 2ZC2A 3KZZA 3QO2A 3D3RA 5M3MB 1BR9A 5CV9A 4KHPL 4A3IB 3SDBA 1JKRC 1E3HA 2M4KA 3IAS2 2A3SA 4II3A 2R7RA 4GOPC 2RREA 1Y8NB 2I0QA 1MJCA 1STGA 1YS7A 2MLGA 3LWFA 3IWZA 2NVTB 4Y52J 4EQNA 1LTID 2VBWA 3F8FA 4HEDA 2W82A 3CLOA 3SK6A 5F1JA 2E19A 4JK1C 4C2MJ 1RHPA 4L63B 1LFPA 1WYDA 2GVBA 2DK5A 1JJ2A 4M3EA 3OYFA 2H1EA 4LF9Q 3BZKA 1ET6A 3JTHA 5E20A 2UUBQ 4I7AA 4B47A 2LC2A 2LY2A 1B8IB 1EU4A 2MC4A 4DUZL 2DFHA 2UXNA 1Z9CA 5CV7A 3H36A 4JK1X 1T33A 5H6RA 2CV2A 2XUBA 1CA5A 1BR4A 1FD7D 1SNPA 4A3MB 3I4MH 3DHQA 2H6BA 1BBUA 3GD7A 4C9YA 3HIFA 4DA2A 2NZHA 1MJEA 5LL6X 1S29A 5ELEA 3I53A 1IG7A 4A93B 3GUDA 3GO5A 4NB5A 4OIJA 2AQEA 5JVTA 4QCLA 2M7BA 2ZMEB 4R8IA 2WY8Q 3E5QA 3IFDA 5E8GA 3CMMA 3A01B 3MXUA 3SXHA 1PH2A 3PM1A 1N33Q 5M3FH 4X64Q 3FRPB 5AFWA 4FF3A 1T8IA 5KCMA 3L1PA 1QNKA 3HOZB 3RR5A 3HRZC 1LT4D 1OCPA 1VQLA 1EYGA 3LWEA 4HR7B 5A2QK 4W97A 3I90A 1QHGA 3OYHA 4AUXA 2QUFA 4A3JJ 3W2AA 3A74A 2UXDQ 1I94L 2MGSA 2YTXA 2DTZA 2NN6G 2OBPA 4DZPA 1O3TA 3EJIA 2O5RA 4B09A 1BCPC 1R4PB 4OHJA 1FBSA 1G59A 4ZYEA 4BBSJ 1K9MC 2DY8A 2O03A 2QDLA 4BAYA 3M8JA 2WA0A 3PMFA 1C9OA 3CC7A 2VXZA 5J8FA 4BU2A 4N9PA 5L3GA 4HEA2 3L2QA 1K78A 1PUFB 3HG9A 2RKHA 2K86A 5ELBA 1U6GA 2CQOA 4WCGA 3LNQA 2MH9A 5IWAL 4M8AA 2EY6A 2GZWA 5J39A 3HHHA 4HDVA 3TQNA 3K70C 5IODA 1EH6A 2L9VA 4JBMA 3KX2A 2Q2UA 3B6CA 3F2DA 1RODA 5EDNA 2MBFA 2G0EA 1UEBA 1GUWA 1EZ6A 1PZID 2F0DA 1SMYC 1JOOA 3PGZA 3HZXA 4AIDA 4OO1I 4HNUA 1TY2A 4GDFA 1STNA 1OCZH 3H3ZA 4P75A 2ZSHB 1WSUA 2NVQH 2PI2A 3I55I 2VOPA 3V05A 4NKLA 4MFEA 1V5EA 1B8IA 2A6HF 1FT9A 3ZQHA 3TRZA 2BV6A 2L4MA 2P6TA 3LOCA 1G51A 1IUFA 2W4SA 2CQQA 4P9FA 4LUOA 1KIXA 2UUAQ 4R4CA 3BVZA 2YR2A 1SD6A 4QY7A 1SAXA 3H3VH 1UE7A 1XX5A 2EYOA 4JOIA 1QCBD 1BCPB 1WQ2A 3MVPA 3QR8A 4EJWA 4KIGA 1SFOH 3H9GA 4DV4Q 3OHXC 1GUUA 2XPVA 4X1EA 4MHGA 2GN5A 4RB3C 2ZMEA 4A0XA 3O3KA 3I3LA 3K9TA 3K0XA 4DOZA 3TS2A 5L3BA 4C3IH 4V0BA 4L9TA 1PA6A 5C3XA 1S7EA 5EZHA 3AYHB 2XF5A 2VT3A 4G7OF 2JUGA 1VI0A 3OSGA 2A73B 2VQEL 4X66Q 3CUQB 5D6EA 2MHVA 2QSFX 3S1QH 1K83H 1TS2A 3NEMA 2OCCH 5NUCA 3ZOBA 4BE2A 2H1KA 3JAMi 4ZZLA 4XXEA 2ICEC 2MJ8A 2HWVA 4CBVA 4F92B 2CW8A 1BCPD 2IX1A 4A3DH 5EEAA 2B8FA 5JFRA 4OX9L 3ZPLA 1TNSA 4ZDPA 3M8FA 3S24A 3L9AX 4IOAA 1RR7A 3PUBA 1YQAA 3RD4A 1LLRD 2K40A 3PNYA 3OYLA 4Z6YA 1VQOI 4JI6Q 1C4QA 4AVZA 4HNTA 1KYWA 4HX4A 4ZYAA 4DV0L 5JLWA 1AEXA 4MO7A 1G8XA 4WK8F 2YU9B 2HKXA 2PO4A 3NE5B 3ULLA 1PUFA 2EXDA 2LBFB 4CGYB 1X2MA 2XF6A 3WE2A 5GAHJ 4QUFA 1QGPA 4YFKF 3ZQQA 2JE6I 5EEGA 2EZKA 1TNTA 4CCMA 3LQRA 1TWHB 3Q0VA 2QYOA 4RB2C 3K70D 2Y0SE 3SQNA 3CO6C 3ZQFA 1G4DA 5F08A 3SDZA 1HTPA 4NPSA 1ESRA 3BZ6A 3DKWA 3K4LA 2JA6G 1QO0D 1SMYD 2WB1B 2M8EA 3DQVC 1I5FA 3H9JA 2JSPA 4A3EG 2JA5H 3R2TA 2O7OA 4M6YA 1TY0A 1OCCH 1ENAA 2NB0A 2DPUA 2HGCA 5M5YJ 5FLMJ 5JOBA 3PIPF 1HW1A 4C3JJ 4A3FB 3SFZA 3U9SA 2YSRA 2DFFA 1ERDA 4GLVB 4DQ2A 4FISA 3TN2A 3A2KA 1YTYA 2M34A 2UXXA 1TBXA 2IVMA 4XSZF 3ND9A 2PZTA 5GADC 1YNJC 4JI0Q 3H15A 3LSJA 5DAUA 3BVMA 3NTKA 5H6QA 5B3SH 4AQYL 1N78A 4W1UA 1R7JA 3MFKA 1IUYA 5KRUA 1CKMA 4FP5D 1F77A 3HKZG 5BQTA 1UHWA 1SNOA 3RZDJ 2JA8B 3D5SC 1OXXK 3EA6A 2MO0A 1P9QC 2J4XA 3F2UA 3CUQA 4BH9A 2DOAA 3RJPA 2Z99A 2NXNB 3CD6I 1LPQA 3GCMA 1F2YA 5LMNQ 1DD2A 3I4NH 2F0PA 2R7DA 1PFMA 1FJGL 1H89C 2E2IJ 2ASBA 4HV5A 3CMAA 1YI2A 3PFIA 3BR1A 3RYRA 3RQIA 2DA7A 4IL6C 4A12A 1B3AA 2K04A 1E22A 4ANJA 5FLXK 1CT1D 3ABLH 2STTA 2WV0A 1Q1BA 1U9RA 3PUXA 1L2FA 1HR0Q 1B9MA 1TQIA 1VQMA 2B9SA 2HEOA 4XLCA 3COAC 4CO8A 1QZGA 2I5MX 4A3BH 5IP9J 4IHTA 4P73A 3WDNA 3HJEA 3NTHA 3GEZA 4XQNA 2L0KA 2LBFA 2K02A 5JHUA 4YRVA 5FKAC 2QM3A 3NSWA 4HTHA 2SDFA 1XC5A 1XGMA 1X3PA 1OXTA 3CESA 2P5KA 1MMAA 2R92J 1OLTA 5CVVA 3TBIB 2DA4A 1V1QA 1YG2A 2NS7A 3PUVA 5D65A 1Y1VB 3CCSI 2KJCA 3MKLA 2W00A 3LSRA 2OA4A 5BNGA 3E9HA 3I0TA 2N8GA 2LR8A 3SR1A 3L2RA 1WCMH 2WB1A 1L1OC 3GTOJ 1BA5A 4N9HA 3MCZA 1N36L 3PSFA 4IX7A 2OQRA 4KY7A 3E6DA 5JR3A 5IGCA 1DM0B 1ICWA 2UXCQ 4LF5L 2RVCA 5HLGA 2HCCA 3F21A 1SANA 1GUTA 3B02A 4A3KH 1SYEA 2H27A 3C1DA 2IAIA 1JE4A 1SE8A 1ZHFA 3PO3J 2UUCQ 3BY6A 1LEAA 5LEKA 1QNUA 3WGGA 4B3ML 4M3DA 2F0QA 2PJPA 4B9WA 5K5RA 1AFPA 3QB3A 4O42A 1DZ1A 1AE2A 3MXPA 5JVG3 4UUSB 2IJLA 2GIZA 5ELDA 2KIQA 2R4GA 1YNJD 5D5VB 5HS9A 4G12A 1JJ6C 3FZVA 3OS1A 3VR6A 1HW5A 4BY1G 4HDUA 1IC8A 4IRGA 2IGKA 4MGRA 1GHCA 1NJIC 1AN8A 5EKKA 3GTKH 4BBRB 1IJWC 3CLQA 2UZKA 2V9PA 1A62A 5IP7J 1AZQA 2VJJA 2E60A 2Y31A 2WAFA 1Y1WG 1VQHA 2K33A 4CDDC 4CKCA 1VQOA 4DK0A 4V2GA 4BXUA 2IX0A 1G3WA 2HU9A 2JMWA 2RBMA 3EROA 1WJDA 5C3EH 3C46A 2HXIA 2AO9A 3HOWG 2O3FA 5EYRA 2DGYA 3ICEA 1JI8A 3NARA 3KOJA 2VXWA 1L1OB 3WU1B 2DFEA 4JYAQ 1Z3XA 1GD7A 1LTBD 2MLKA 4M3FA 1M1KC 2MD5A 2ISZA 1FMVA 2ATWA 2V1NA 1IF1A 4KMUX 2BGCA 2VC0A 3JRGA 5EBDA 5K7FA 2L9SA 2R93H 4XL9A 3GTQB 2IJ0A 2V1XA 5DEHA 2X9DA 3FKIG 3S93A 3K1MA 3TBIA 2F0UA 2F5EA 5CLSA 2GOMA 2K05A 4IHVA 1VZ0A 2TSSA 5M3MH 2DN8A 3QWLA 5LD2C 4A3IH 2K14A 2JK8A 3DXJC 1HTLD 1HDPA 1WTXA 5CQEA 4LFAQ 4EM0B 1W6JA 2B2VA 1CQFA 4AIJA 4GN4B 2IS2A 2NVTH 3CCVA 1N32L 1FY7A 1TWGJ 4YY3Q 2BCOA 1H9SB 1EIHA 4KD4A 2PEXA 2LY9A 1GUOA 1CGPA 2XNAC 3KYCB 2OZ6A 2E75C 1ASYA 2L02A 2AQ1B 3K10A 2NYZD 2R7QA 1X1PA 4IOAF 1F43A 1WZ2A 3EBEA 1A3UA 3HRTA 4UB6C 5C5LA 1R1UA 1TWCJ 3FIWA 3OS0A 4L5EA 4XSXF 3M3YJ 3HP3A 2P81A 4A3MH 4RGRA 1LDDA 5TRDA 1BI0A 1X3GA 1K6OA 2NVXB 4UUSA 3G4SI 2GM4A 5C44G 4IPHA 4PQXA 1ZR2A 4ZUIA 3HOYG 2LOOA 5FJ8G 3RYPA 3CD6A 2K52A 4A93H 5E1ZB 1K79A 1KQSA 5G3LF 1W5TA 4PFOA 3W6VA 3GQBA 2NVYB 2H8WA 4UVAA 5M3FG 4WWCA 4HQEA 5IT3A 2B2YC 5CV4A 3K2ZA 1JE5A 3A03A 2XGXA 2KEEA 1QVCA 3ULQB 2RDPA 4DR7Q 3HOZH 3QP6A 5D6FA 5FKLA 1BBYA 3DEPA 4DK1A 2B2UC 3NUCA 2MYSA 1I6XA 2HD3A 3U21A 2WWYA 4F52A 1FMWA 3UDGA 1WI5A 4LF7Q 4TSSA 2ECBA 1I50J 1QZZA 1BW5A 4JI5Q 2Z3YA 2GWRA 3K1PA 2MNAA 1L1OA 3MAJA 3DKXA 4Y13A 2EBIA 4DV7Q 1VCIA 4CCKA 4HJ5A 3GTGB 4LF6L 3HOXJ 1BCPF 2R7ZJ 2HQAA 3CCSA 3U4ZA 1R36A 1PTOB 1X4OA 3C2GA 3KBXA 3QU6A 3P1HA 1GM5A 3DWLE 4FXDA 1IBLQ 1F2MA 4JX4A 1D5VA 2ICIA 2E34A 5KNLA 2EVBA 4RGTA 4QPQA 4DV1L 1LB2A 4ALPA 2K28A 5LHY1 3KK7A 1LT6D 1F2LA 1YJ9I 4BHPA 2VNUD 3DKYA 3TDQA 1NTCA 1I6HB 2EJMA 4DUYL 1S6LA 5C4XJ 3VDXA 1Z67A 1SFUA 2HFHA 4Z2YA 3K59A 1O7YA 1H9SA 4IQ4A 4BDZA 3HM5A 4AC0A 2JWTA 3U9GA 4I65A 5JEAH 3Q23A 2RHSB 3NP8A 4K5WA 2F0NA 4HA8A 2F5DA 5JLXA 1DGWY 4C2MB 4FXKC 5IIFA 1YHQI 2HI3A 1JJCB 1SMYF 5I9PA 2FU4A 1V54H 3F8TA 3TGNA 4A75A 5F1RA 1RCVD 1JJGA 2MFIA 2A8VA 3A0JA 2D2CC 3PUZA 2CV0A 2OTJI 5D8KB 3B6YA 3I73A 3C2PA 5DS9A 4KHVA 4KKSA 3M4PA 4B8XA 1SNCA 2Q2TA 4IVNA 2B2TC 2R5ZB 4DV2Q 1ETKA 2FBKA 1STAA 3MWMA 5E3FA 2VW9A 2R3ZA 2QEXA 4J1MA 2LMDA 1MZBA 2FNPA 5L3FA 2X85A 2VJIA 2UXBQ 2BVLA 1Z7LA 1R23A 3H09A 1J5EQ 5DV5A 4FXGC 4YCUA 5LHHA 3QOEA 1GXPA 3FHNA 3CF5A 3BG9A 4A3CH 2X1EA 2BXZA 4L8JA 2VQFL 5K7HA 2RCFA 3VOEA 3IAM2 2W84A 5IY5H 4L5JA 4P71A 2NS0A 2BY0A 4QLCU 2M30A 2VBYA 2DFIA 1IN6A 4ETSA 2XVCA 5K1YA 1SEUA 4LMYA 1AP0A 4R1HA 4M6XA 2B63G 1K8GA 4M6VA 3N97A 3ONQA 4AYBE 4ZJZA 1UCRA 2RV8A 5CQGA 2EV0A 1EH7A 4IRIA 3DMUA 1Y56A 2L5TA 3G3ZA 2QBYB 1F9RA 2A19A 3MZHA 3TS0A 4KT6A 3BR3A 4RMNA 4Y15A 3H92A 1X19A 3B73A 3M7NA 2CYYA 1IV8A 3AG1H 3VYRB 4ODGA 4M9ZA 4PJLA 3FMSA 1JKPC 3TZDA 3DM3A 1RTOA 2YU9H 4I6ZA 2QQAA 5KAIC 3S1RJ 1HF0A 2EPFA 3E3XA 1MJ9A 3EUHC 2F4OB 5J1RA 3Q3SA 5BR8Q 3EIVA 1KU3A 3DCFA 1YO5C 4OO1H 3PO2G 4Q5VA 4H7BA 1TWHH 4OWRB 5E8IA 4JI2L 2GLOA 3HRSA 3PFYA 1DPRA 4F93B 2AWNA 1W4MA 5H1SE 3KBGA 3G71A 4XLNF 3WTUC 4MIUA 1DONA 2B2YA 1LTSD 1KLGD 4JVZA 2VIXA 1P6RA 3CMEA 2JPCA 1FOWA 4PSWA 3BCBA 2ELJA 5FGMA 3J81K 1RL2A 1XCVA 1ET9A 1CFMA 5D8LB 3G4SA 1AWCA 4HIDA 4CH7A 3D6WA 4B3RQ 4MTNA 1IN5A 3KEOA 3G1MA 3CCJI 2WAQG 4LB6B 4E6KG 1K0RA 2R5ZA 4A3FH 3OMCA 4FX4A 1IZ6A 1D7QA 3H94A 3UNGC 2IA2A 1YOVB 3RNUA 1IXCA 1D0ZA 4LD5A 4PJ0C 1RUOA 1RI7A 1GOZA 3IRRA 2JYOA 1TWFJ 2AWOA 1J09A 2PG4A 2QLZA 3CAMA 1L3LA 1HZAA 2ENBA 4AYBG 1E7ZA 5HLHA 3WG7H 1H9GA 4YFXF 2JA7J 1S7AA 3A55A 5TGTA 4UHTA 3HKSA 2N49A 3E97A 3KP6A 4M3GA 2Y69H 4HJAA 2N8NA 2DT7B 3GTJB 3BYYB 4DR5Q 2JA8H 3ISPA 1T5XD 4XKCA 3S15J 3T1BA 3S16J 2YTYA 3E0JB 4UDUC 2CO5A 5CV8A 3Q24A 1H9KA 4A3GJ 3ZMDA 3I64A 2KECA 2L4AA 2QBYA 2QCPX 1EYCA 1ZR4A 2VXDA 1TWAB 4TRDA 1T2KA 1QQIA 4XQQA 3FMQA 1TT2A 3T13A 3LSHA 5LMNW 3T53B 3HRMA 3UI2A 2P0WA 1T5EA 2WB1N 4DR2L 3MZ5A 1EY4A 4JBJA 5IGGA 3R0JA 2WAEA 1A0IA 3VYRA 2Q2HA 3DU5A 3CP2A 3VA7A 1M90C 4CHUA 3E6BA 4IF4A 3KF6B 4QB4A 1HR0W 1DDNA 4CCLA 3DFGA 1Q90A 3LSMA 1MNMC 1PYVA 3FK6A 3KP7A 2EA2A 3JR9A 3ABUA 2K3PA 3C3LA 1JT0A 5E4WC 4AVPA 4RLFA 1UMQA 5ISRA 4OIRF 1PDNC 1YHQA 3JCUC 2CUZA 4M72A 2F1MA 1Y1VH 3G6EI 3PUWA 2VJ4A 1DQUA 4IJAA 2E2JB 1QU3A 3OIOA 5C0XH 3MKWB 1O3QA 4FQGA 4F55A 2A5WA 2VC1A 2HYJA 3CKIB 2A68C 3EUKL 1YX3A 2IA1A 2XAQA 5KAFC 1F5TA 4KN4X 1ZTRA 2ZXHA 3OIQA 2F4VL 1Y8PB 1U2WA 2X4HA 1EQTA 4UPAA 2HDCA 1RUNA 1KZHA 2EILH 2VL8A 4UP7A 4KFCA 3K4KA 3FPPA 1XMOQ 5B1AH 1WTHA 3Q5FA 2KRCA 2SOBA 5IYCG 4K8IA 1EY5A 5A2QE 1O3RA 5HVQC 3K5NA 1OJLA 2DOFA 3NEUA 3ESWB 1I94Q 3BPVA 1KNAA 5I6YA 3HBLA 2EYPA 2JSOA 2PI2E 1KDAA 1I39A 5BN4A 2L7ZA 4H44C 2NS8A 2A1AA 2M8GX 4KITB 3HOVJ 1YBYA 3KIOA 1XD7A 1D1IA 3H0GG 4L18B 3V2TA 5GAGJ 1IBMQ 4LFBQ 5F0HA 5FLXZ 1BL0A 1LV9A 2EJFC 3S2WA 1G3YA 1OXVA 2GA2A 2IGMA 2DMQA 1I4HA 3EUHA 1XMQL 1EZ8A 2XAHA 4ZLTF 2ZFUA 3OYNA 3E0JA 4E70A 2XSDC 1V5FA 3ERQA 3HOUG 5C3EG 2BY3A 2AUJD 2QZ8A 5IWAQ 1SJED 2IGNA 2VZAA 1V3FA 1N77A 2XTIA 3H6MA 5IYDG 1HZCA 1V43A 1J2XA 4EJTA 3F22A 2WV1A 2RF4A 4K6DA 3CP8A 1OYWA 1VQKA 4L5SA 3J7AF 2PCFB 2VN2A 3U9OA 1D1CA 1NR4A 2L55A 2BY2A 3CU7A 4ZYSA 3H5RA 1FYLA 1RKNA 3KF6A 2EWNA 4UV9A 5C4HA 2Y30A 2VUMG 4DKAC 4GGGA 2M9HA 4OXPA 3C2HA 1Q12A 4TQUS 3NPPA 1UG2A 3GTQH 1FSHA 2P5VA 3FEWX 2VS1A 3GTLJ 1JOKA 3JSPA 4P55A 2EZVA 2DMNA 2LFNA 4LLNA 4C3HJ 2ELKA 2VQLA 3CF5F 3KP3A 4U7DA 3FDYA 4RWSC 1FOYA 2EY5A 4V19K 1GKHA 2DTRA 3OTOQ 1T38A 2GIVA 3RKQA 1TKWB 2M5WA 3DXJF 3Q9VA 3HGBA 3CCJA 4DR4L 2A68D 4A3LH 1EL0A 3UE0A 2PZWA 2EDGA 1JMCA 3OYIA 1P7IA 1I6VC 3A1YA 3EDPA 4HSTA 4BEHB 3VPRA 1UEAB 1JOQA 3CRKC 5M5WJ 2HQNA 2JN4A 2L7FP 3I4PA 4X65L 1QA6A 4CKEA 1LNWA 5HLTA 5GQOA 3WHBA 3QYFA 1YNXA 4FASD 2A5HA 5FKOA 1A6IA 1J8IA 3IHUA 5EPJA 3KJPA 1K7AA 2NVXH 1F9PA 3A0BC 1KGSA 4QL5A 2L9NA 2E7XA 5LFAA 1B4AA 1VF5C 1RNLA 1XN7A 4CA0A 2JP1A 1FLIA 2NVYH 2NOGA 2YX7A 3QWNA 4BGDA 5D4SA 2F5FA 4WX9A 4ENKA 1Q86C 4BXXH 2EYHA 4IOCA 5LGNA 3BROA 4KJZA 1UELB 1W7PB 2OEOA 3X2QH 2HOEA 5EJCA 3OOUA 3ASNH 1U4PA 3L09A 2P6SA 2Q2IA 1EUJA 3M85A 4ILWA 1O7ZA 2D0OA 2LSSA 1X4PA 4A3JG 2IY5B 2PMUA 1EIFA 4CCOA 3ERMA 1D1BA 1XMXA 4DR6Q 2G9DA 1MSGA 3PIOA 3A5UA 3FXKA 3MEXA 1PH8A 1ZGAA 2EOTA 5M9OA 1HA8A 3LAPA 5AIQA 1NUCA 4YWLA 4BBSG 4B44A 4NUBA 5HURA 4Q5SF 1MDMB 1B1BA 3ZMVA 1SNMA 2K7LA 4IURA 1JHFA 3GTGH 4J15A 4PG3A 4NDXA 3MKYB 3VYUB 4KKTA 1K3RA 1PH3A 4HCSA 1AHDP 5KIXA 4RB0A 3I4MJ 2BH8A 1PTOH 1CSQA 3F0CA 3BJOA 4J01A 1OR7A 3D6CA 3JAMK 4ULLA 2PFBA 4QWQA 3J80K 3M8EA 1FBUA 4C2UA 3DF8A 1GUSA 3JRCA 4XRMA 2EQRA 2VPLA 1SFXA 1ULYA 4OEMB 4K0KL 3FF5A 1DJRD 2MQHA 4P1WA 1I6HH 4D5FA 1AOYA 5B5EC 3D4RA 5FD6A 5IGFA 2AMCB 4LWCA 4JCVE 1VQBA 2EXZA 3SEBA 1QPMA 3R0AA 2JA2A 2COBA 3T8TA 4AQYQ 2DK8A 2V6EA 2FQ3A 4DV3L 4I98B 2XB5A 1VF9A 1TLHB 4YIIA 1KABA 3Q22A 3K7AB 4P5OA 2XB0X 2NTTA 1X1AA 2V79A 4LJZC 3RZOB 2ZB9A 4GN3B 1D5XC 2KISA 1W36C 1OXUA 1KTKA 1FR3A 4NC7A 4KA4A 3FXLA 2OC6A 3C2BA 1M1EB 2ICWG 4HIOA 3BG6A 3JW4A 5JJIA 3H5AA 2XN9C 5FLXE 2NN6I 1GDTA 3REOA 2HTSA 5CVJA 1TQOA 2K6AA 2HQ5A 1NE3A 3ECHA 2N78A 4A6EA 2LF8A 1PP7U 5IOZA 3PL8A 1T6SA 3U1DA 2LXKA 3CCRI 4RGNA 4GLAC 1W7PA 3PQKA 2HT1A 2A6TA 4OGQC 4PJNA 4GKJL 3RKYA 3KLRA 5IYBH 4WFN3 1LKXA 1KQ9A 5C6AA 4KN7C 4CICA 3S1NB 2DCEA 2ZJRA 2H4OA 1JC7A 2OT2A 3ULJA 1D1AA 5JI6A 3H9QA 3OPOA 4MHEA 2OJED 2NVQJ 1FTZA 1YE9A 2WY7Q 5IGEA 1MDMA 5J4VA 2KOLA 4POFA 2QF7A 2DQLA 4HBLA 3GMEA 2K5VA 2LFBA 3VYUA 4RS8A 3CQZB 1N36Q 4IRHA 4DIQA 4OIOF 2NTSA 2KCMA 3DEWA 3TP7A 4UUTA 4XLPF 2AXTC 3CXCA 1BO0A 1VQGA 3WWVA 2DNCA 4XLHA 2DA2A 1SFOJ 1AH9A 3OYAA 4R4IA 4LGWA 1J59A 3CHBD 3Q9SA 4B08A 3DV8A 2HQEA 5FLVA 2CH4A 3V96A 4LF4L 1GUGA 2UU9L 2PZUA 4IJHA 4U0WA 3E6CC 4C3IJ 1X56A 4XRSG 3D8GA 1IYUA 2F0GA 2OV7A 1D8JA 1K8AC 1STEA 1IYVA 5HLIA 5FLXc 4EVOA 3N05A 1JGGA 5J40A 4ABZA 3S1QJ 3BOQA 1K83J 4ENJA 4HN7A 2XRLA 2I10A 3GV3A 4A3DJ 1N9WA 2KL4A 2LKSA 3T4AC 1BNZA 2FUG2 4C3JG 1SC7A 1GVJA 1YIJA 1W36D 4QSHA 4CZZA 1D1KA 1P16A 2HNHA 2EFWA 1WTWA 1I27A 3IV5A 3QRFF 1HNXL 1NTGA 4K14A 1E0BA 2A5YB 1J5YA 3ASOH 4PSXA 3TZUA 1FX7A 2ZXJA 1U4MA 5J1YA 3ZYYX 1O7LA 2HS5A 1X3WB 4DNTB 5HDGA 4YELA 1EEFD 4JI4L 2QILA 1XYIA 3P9KA 1D5MC 2KKOA 4KICA 3R93A 5KGUA 3GTJH 2EFPA 1JXSA 1ODDA 1WOCA 1GHKA 4N9TA 2Q0OA 1E2XA 2CKZB 2EQSA 2DOEA 3RLNA 3WTVC 4PZ7A 4CYDA 3HL2A 2WADA 2P7VB 2V9VA 2JA5J 3LSPA 1H0MA 2L15A 4KY6A 4DAMA 1SYBA 1TWAH 1K8OA 3OYDA 1FTTA 2CSOA 2F5CA 4HZFA 1BOBA 1ZG5A 4UAIA 3HSFA 3N4MA 5JAVA 3QOPA 4JI8Q 3DTKA 4L9JA 1PFSA 4TV7A 3JRFA 2M3AA 1FOXA 1IXSB 3BR5A 5I6WA 4C1NI 2F3WA 4WJ4A 4XR6A 2WIIB 5E79C 5C4JB 4E7LA 4X3UA 2ZNZA 4S0HB 1ENFA 2EE1A 2R92G 4XMYA 2Z9OA 1WD1A 1EU3A 4OELB 3GX4X 5H2FC 3ZMUA 1XX8A 2D1HA 1G3TA 4ZCKA 1WH7A 3V8LA 2FMYA 2DI3A 3EQLC 1BIAA 2FMLA 2C9OA 3R60A 2V1DA 2E2JH 1H88C 4UV8A 2ZO4A 1O7IA 2QSHX 1PH9A 1K8MA 4O2DA 2KHJA 3NAUA 4JPBW 4PMWA 4YG2F 3PNTA 3I4NJ 3PIOF 1X3UA 1ETVA 1S9HA 2E1OA 2A68F 3MXNB 1N75A 3HYIA 2JTVA 4EQ5A 4RLQA 3S3MA 2VQCA 1QNTA 3GTPB 1ZLJA 1KRSA 4NB3A 3H5NA 4ZDOA 5EKLA 1LACA 2QKLB 4ME3A 2XSCA 3T56B 4HJ8A 1VQ7A 3PO3G 1U4RA 4JX6A 3CCRA 4A3BJ 3KYDB 1FP2A 3BDCA 3GFJA 4X64L 1TWFB 2FMCA 1SD7A 1DP7P 4FO2A 4HIMA 1T39A 1YHBA 1ILQA 1U9NA 1WVRA 1I1SA 1VQAA 1XTCD 2UXDL 2DA3A 1KLUD 4HQMA 3QYBA 2VKDA 5KHDA 3J81i 1KYZA 2LKPA 1USSA 5IP7G 1DGRM 2GQQA 1JUSA 3MQ0A 1UJ8A 1QG7A 2VB6A 4KIFA 5DNFA 3KE2A 3S16B 1WCMJ 2L7KA 1DXMA 5J1ZA 5J3BA 3ZMZA 2XHKA 1MI2A 4S3SA 2DYSH 2DW4A 4EVIA 4DUYQ 1SMXA 4L5QA 4Y7NB 2JA6B 1QZEA 5BOXA 1L0XB 4DXGA 4I2OA 1LEBA 5E7NA 1OMIA 2ECCA 1NH3A 4K6LA 2R7VA 4A3EB 4OMYA 1HNZQ 1GJXA 3HTSB 4R9WA 1CTMA 1XSXA 4A3KJ 2O2LD 1USTA 1MBYA 1P2FA 1MD2D 1UUPA 2E5LL 3DPLC 5K36G 1LABA 3MVVA 1FNWA 3K7UC 5CJ9A 2ZXRA 3CMYA 1U0JA 2PMZB 4PGGA 3DEOA 4PCQA 5GP9A 4IHSA 3IRBA 1EA3A 3BYTB 4NW2A 3DLAA 1AKHB 1MBEA 5EG0B 3HXLA 1Q82C 1PDQA 4ZDLA 2BA1A 1Z7TA 3TEDA 1A2TA 3EVQA 3KYLA 2LY1A 3EYIA 1QWYA 1Z6HA 4Q0FA 2E5ZA 3GTKJ 4YCVA 3J7AY 3E7LA 3W6KB 3A8KE 4XKVA 4GNXC 3OR1C 2LYCA 2ZJRF 5ILSA 2XV4S 3HKZB 3PUYA 1B3QA 1WFXA 2A07F 2EZHA 3MXNA 4JG2A 3ABTA 4WXHA 3C1EA 1HDDC 2OCEA 4C1NK 2K9MA 5C3EJ 4EV0A 2PW5A 3BQYA 2IS4A 5JPNC 1S4ZA 1LVKA 2R7UA 1IBKL 3MZYA 1CHQD 3R2IA 2VT2A 1IL2A 4QUCA 1NY4A 5JPMC 2DNEA 4XN3A 1IDYA 4JI7L 2IA0A 2RSOA 4JOIC 2F0IA 5D3IB 4DYQA 4J8QA 1YJWI 2R93J 1P4XA 1PFNA 1GUNA 4IXAA 1EWHA 1K4TA 2KCNA 4ZUJA 4WF2A 2VLAA 4B43A 3OMGA 4A4IA 5M5XB 1FIAA 2K9QA 5M3MJ 4A5NA 4A3IJ 3LSKA 1Y6IA 5FROA 2XRQD 3QODA 2EIFA 4JC0A 4E7HA 5IP6A 4DV5Q 4XONA 5D5UB 1RKWA 2AHOB 5IT9L 2NVTJ 4UVCA 2ESHA 4DJAA 2WINB 1WHUA 3D5RC 3FISA 4KLKA 1XDUA 1ONVA 2BW3B 2HTJA 3I72A 5A2QL 1YW7A 2KLOA 4JI6L 1G3SA 2O5IC 2Y2ZA 3D5LA 3W6JB 4HAEA 4GNXB 3Q8DA 4O5VA 4G4KA 2ZJPF 5CVIA 4CKBA 4IPCA 2AQFA 3HOXG 4CZCA 3CJRB 4O1NA 2R7ZG 2V1UA 2X6GA 3PJRA 2QW7A 1R9TB 3HRUA 2F0KA 5GTIC 3WTXC 1IKLA 2KCCA 2E71A 4A3MJ 2ZT9C 2PMZA 2Q8KA 3Q6SA 1TP4A 1PP8F 5E3OA 2Y9YA 2BVMA 4IUTA 1AKHA 5EG0A 3K81C 4A93J 2N55A 2WKCA 1KU2A 1QOHA 5IPAA 1JQYD 2E1NA 4BUPA 5C4XG 1VS0A 2BDNA 2L9HA 5DCMB 3AFHA 3SE0A 3S1MB 3TDZC 5CV5A 4FF1A 1B50A 4BY1B 4P2CB 5IY0A 2WKDA 3GTMB 2BH2A 3SEZA 1MD0A 3HOZJ 2DMTA 3F9KA 1K73C 5IT9K 3NQTA 3HKZA 2OQ0A 4EGYA 3CCMA 3MFGA 1HA6A 1SYFA 2CUJA 1Y1WB 1NR2A 5DM73 1R5GA 2O9LA 2PI0A 3K7AH 2XC7A 3WTYC 1QVGA 3RZOH 2NOJB 1QHHD 5LMUL 1N34L 2DAOA 3I71A 5FO9B 4R4QA 1P8LA 3HOWB 2FOKA 2KDOA 1EWCA 2F0SA 4LJZF 1BJZA 4XIGS 1X6OA 4QTRA 4XK4A 3HC7A 1XMKA 2JVGA 4DAYB 2WP8J 2QGUA 4DR3Q 4DR2Q 5J3LA 4ENMA 3RUZA 2IBDA 5LMNL 3L9FA 4IUVA 1RC9A 3BDLA 2OPTA 2O61A 2BYVE 3F6OA 1RRJA 3FKIB 5LBQA 1GHJA 2O6GE 1Q46A 4A0ZA 1IO2A 4K5VA 1EOVA 4MNOA 3CUQC 4J19A 3HTUA 4B3AA 4PV1C 4H13C 4D9JA 4OWWB 2JQ7A 4XN0A 3ZN1A 1HR0L 2BW3A 3S1NH 4UUVA 3JAMZ 5JEAJ 2PJRB 3W1GA 3S2DH 3S17B 3CCEI 1Z21A 2X6OA 1YIOA 4OIKA 4BKXA 4BNCA 4GNXA 3CO7C 1NCVA 1S40A 2L2OA 5IOCA 1PFBA 2G9WA 3L2WA 4QJFA 2HUGA 2OU2A 1PZJD 3OYJA 1UAAA 3IL2A 3QPHA 2WV6D 3J81j 3CQZH 3CJNA 3W3CA 3ML6A 2F4VQ 1T98A 4HMIA 1V9PA 1SFKA 3DEUA 3BTJA 1U4LA 2JZYA 1NBWA 1WPKA 4LOCA 3TP8A 1F36A 2RHQB 1R4MB 3GZ6A 2F03A 1FNVA 2FEZA 2K9SA 4NDLA 2V4DA 5G3LD 5FO8B 4CXFA 4JQFA 4DV6Q 1PH4A 4JOMA 2ETHA 5D4RA 1IRZA 5C44B 5DCMA 3HOYB 2KZVA 2QA4I 4A3CJ 5JJZA 2KMUA 1REPC 5LRRA 2R7SA 4LW1A 5M3FB 2CS3A 2UXCL 3FM3A 1J9OA 1TQPA 5ICGA 1YLFA 1T9HA 5I4DA 1XPXA 1R4NB 1Q1VA 1PUEE 2XRNA 4E7IA 1YJWA 3AG2H 4ZAIA 2FRHA 3CJQB 2UUCL 4UNOA 2F2EA 1XMQQ 3QOLA 2CW7A 5JJKA 3WOFA 2NN6H 1KNEA 5K5QA 3J80i 3F6VA 5HNFA 4IFDH 1MH3A 1IDZA 1L0YB 1PH6A 2OTLA 3L0OA 3HFZB 1ENHA 4K2EA 1I4GA 5FB2A 3JRIA 2AUKA 4WJ3M 3KFUA 1UFMA 4KJOA 4DAYA 1BOAA 4HLXA 3O2PE 2YU9J 1FYKA 2DT5A 4DZJA 4RHRA 1K6YA 2OAZA 3R8BA 4BQQA 2PN6A 1KU7A 4HIKA 2JA7G 3S2HB 3I7FA 4OWTB 4I02A 3OYMA 2KJXA 3B6AA 3R6SA 4MEXF 3RLOA 4A0YA 1W5SA 3CPWA 1TWHJ 4UY8I 1JHHA 2M2LA 5DTDA 4NXMQ 2LH9A 3BJAA 2RDHA 2GOXB 4E4HA 5LGTA 1VQ6I 1FVIA 4AIHA 1EFID 4CDFC 2ELHA 2PJRA 2DQRA 1LFBA 3QQAA 2RQXA 5CPRB 4B3SQ 4MTKA 2JQOA 2CFMA 4A3GG 1ON2A 1ML0D 1B2TA 2D1VA 2DY7A 1HQMC 1Y0NA 2JJQA 1SROA 3EN2A 2W85A 3QYEA 2AHQA 3VB2A 3I54A 5FLXL 3RN5A 2CH4W 2ADUA 4DR4Q 1MMDA 5ELOA 4XOTA 4AD9A 4ZYDA 4A3FJ 2Y48A 5H20A 1IW7C 3T8RA 3DU6A 4RDUA 2QWWA 4QIWB 5KK1A 4CDEC 2X51A 1Z9FA 4CGZA 1VQCA 2A74C 2E1MB 2NYXA 5C4JH 2DPDA 1RD9D 1SEBD 2QGQA 1PZKD 2F5VA 1LQ1A 3N6RA 4X65Q 1V4RA 1ETQA 5DLQE 2KQRA 4EJVA 1IRFA 1ZGJA 2B2VC 1KRTA 3D1NI 3T51B 1J6QA 1WKMA 1IAWA 2F3VA 4BQNA 4K5XA 2XAFA 1SFEA 2CHBD 1PVOA 4FETA 1Z1DA 2JA8J 2FQ4A 1ZH5A 5C3WA 3EQLF 1OQYA 2GXBA 1ZRCA 1UE1A 4EMSA 1LUJB 4OAYA 3A02A 2ALYB 2DDBA 1HCZA 1LJ9A 5ILVA 2MG4A 2B63B 4YCWA 1AE3A 2IT1A 4JV5L 3GTPH 5BN5A 4JX5A 1EY0A 2EY1A 1VQPI 4X62L 3PSIA 2CH0A 3I91A 1VQ4I 3F8BA 5D3DA 1VDZA 1A2UA 2OXPA 1X32A 4FCYA 3RTRA 2VKVA 2IW3A 1B6AA 3ZR8X 1TS3A 1GT0C 3E6ZX 2ZJQA 1SAPA 4IKFA 2Y0SG 3TW6A 3VSKA 1NNXA 5BN3A 3L2VA 1A63A 3P5JA 3HOVG 4R4TA 1JUMA 1I3QB 5DM6F 3TW7A 1CSPA 2CJJA 4Y33A 4HSVA 2B0LA 3GFMA 3H0DA 3CCEA 3D4DA 4LIUA 4ME5A 2PQ8A 4YHHL 2W1OA 2L0CA 1IN4A 1YW9A 1Y1VJ 4KISA 3MAQA 2XASA 4XLAA 2HPMA 3JAME 3PO2B 5CYUA 2IS1A 5GADJ 5C0XJ 3I55A 1A15A 1UHSA 4DV7L 3G1OA 4ESFA 3P20A 2NZ1D 1J9IA 3A56A 2E74C 1J0RA 1KHIA 1E2ZA 1HQCA 5EBCA 5LHIA 2YYZA 3FBNB 4Y7NH 2JA6H 2EFNA 2VY3A 4LFCQ 5FK9C 2KZGA 2V4JC 2B7EA 3K6GA 1G2HA 5ICEA 1XB4A 1CZWA 4U0YA 4Y3OA 4A3EH 1IBLL 3AAFA 3UDFA 1JKOC 1D8KA 1FZPB 1FPQA 3CC2I 1LM0A 4MZ9A 5L3CA 3I9V2 1IW7D 1LDJA 2QA4A 4DV3Q 4XYOA 2WAQB 2DBBA 1RIOH 3AKZA 4RGUA 3M9AA 4LUVA 3OYBA 3E6MA 2HDDA 2DYRH 1E1OA 1SE3A 1TS5A 4FX0A 1FIPA 5FFZA 1EF4A 2A69C 2YPRA 4C3HG 1A31A 4C30A 1XGNA 3QAHA 2VBXA 2ESNA 2P4WA 3F1ZA 4AYBB 4N4OB 2K3FA 2Z4HA 4S04A 2IXSA 4GYIA 1SRUA 1Y0UA 1ON1A 1GO3E 3K80C 2D5DA 3HEFA 2JN6A 3AFQA 2X6YA 1N8RC 1QZHA 1XSVA 4XT3B 2NAZA 4L0YB 2K5DA 1EJ9A 3BWGA 3M4OB 3PIP3 5FKMA 3K0YA 5F0CA 4XQFA 3UR3C 4DV2L 1BBWA 1IGNA
chains in the Genus database with same CATH topology
3LSGA 3OOCA 2KPMA 1MSGA 1EYAA 2B2UA 2ZSHB 2EOTA 4HCEA 3V05A 4NKLA 4HSPA 5M9OA 3OIPA 4NC8A 4KTAA 1HA8A 1EY9A 1SE4A 4F7XA 4QF4A 4XKBA 1BOSA 3VR5A 1NUCA 1R6RA 1V5EA 4B44A 4NUBA 5HURA 5KYLA 1MGSA 2ZXPA 1SNMA 1D0XA 2W4SA 4IURA 4DAVA 4NDXA 3BVZA 3MKYB 3VYUB 4KKTA 4HCSA 5KIXA 5ELCA 4KKUA 4X3KA 4LIVA 1PTOH 1SE2A 1UG0A 1Z47A 5C5MA 1MNDA 2EYOA 4J01A 1QCBD 1BCPB 1W6KA 3WOEA 3D6CA 4ULLA 3SK4A 3H9GA 4C2UA 3OHXC 1GUSA 5JVH3 2EPBA 2VPLA 1LO5D 4RH6A 1X1DA 4BE0A 3LNNA 2JA7B 2I46A 2KHSA 1DJRD 3I3LA 4P1WA 1ILPA 4DOZA 1WTVA 4ZTFA 3D4RA 2CV1A 3VR4A 3NK9A 4V0BA 2Q8IB 5IGFA 5C3XA 3QG1A 2XF5A 3SZGA 2EXZA 3SEBA 1EEID 2JUGA 2JA2A 3OWTA 2A73B 2LREA 3DTEA 3S15B 5T1GA 3SK8A 2UV1A 2MHVA 3P7JA 2V6EA 4LG3A 1HUNA 1TR5A 1TS2A 5NUCA 4BE2A 4A3GB 2OUMA 1MMNA 1F2ZA 1KABA 3Q22A 4BWGB 3NQIA 3K7AB 4P5OA 4N4NB 5KEEA 4XXEA 4CSWA 2NTTA 2ICEC 1X1AA 2MJ8A 1WTOA 4LJZC 4CBVA 1IL8A 5HNHA 4F92B 3RZOB 3TP6A 2CW8A 1BCPD 2IX1A 3N52A 1PTOC 4G57A 5CC4A 2B8FA 2MD0A 4ZDPA 1D5XC 3L9AX 2LY7A 1W36C 3PUBA 1OXUA 1KTKA 1FR3A 3RD4A 3KLSA 4NC7A 2WAQA 1LLRD 3OYCA 3PNYA 2OC6A 3OYLA 1HHVA 3TMOA 4NQWB 5FRMA 1C4QA 3SYTA 2J7ZA 3IL8A 5EPLA 4AVZA 1BR2A 2XSJC 4HNTA 5IGBA 4ZYAA 1AEXA 3S14B 1JCKB 4H4KC 1G8XA 3BG6A 1D5ZC 1F9QA 4E7JA 2YU9B 3H5AA 2XN9C 5FLXE 3D4WA 2B2TA 5D14A 2NN6I 3K5MA 2PO4A 3OY9A 3DM1A 3NE5B 3TP5A 2LBFB 4X0GA 4CGYB 2A69D 4G6TB 1TQOA 2K6AA 2XF6A 1EY8A 2F0EA 4QUFA 4AYBA 2DJIA 3I70A 1I4XA 3IUOA 3H0GB 3ZQQA 2JE6I 4CCMA 3PL8A 3S3NA 2X69A 1TWHB 4KN4C 4RGNA 4KK7A 2G9HD 3NTIA 3AU7A 3K70D 4EQPA 2A6TA 2DT6A 4PJNA 4OGQC 4U7BA 4BACA 1BUVT 1HFGA 3SDZA 4ABNA 1HTPA 3KLRA 1ESRA 4WFN3 1LKXA 5C6AA 4KN7C 3ZCOA 3E1SA 4E7ZA 3K6OA 3K4LA 2EYMA 3S1NB 5A35A 1TVXA 1E0EA 2DCEA 2H4OA 1SMYD 1JC7A 4FVMA 2E5NA 2OT2A 5HGTA 2HDMA 1S5BD 1JWMD 1D1AA 1M4VA 2WB1B 4LMQD 3H9QA 3OPOA 3DQVC 3HOUB 4MHEA 5C3EB 2LKVA 2E2HB 2VASA 3H9JA 1YE9A 2JSPA 2WY7Q 3R2TA 1PRTC 2Z2SB 5IGEA 2KOLA 3P75A 5IGDA 1TY0A 1TZLA 2QF7A 1ENAA 5E4XA 2NB0A 1C48A 5JOBA 1EOTA 3VYUA 4AU7A 2O5JC 3CQZB 1JR0D 4A3FB 4DIQA 2NTSA 3VR2A 4CHTB 3TP7A 3U9SA 1H9RA 1ERDA 1BO0A 3TN2A 3A2KA 1JWUD 2DNCA 4XLHA 4BS9A 2VUMB 3DPUA 4GRIA 2Y0SB 3ND9A 4XTCS 3OYAA 2PZTA 3HOVB 3DWAA 4WJWA 3SHLA 1YNJC 3CHBD 2XIWA 5J22A 1ONLA 3R3OA 5DAUA 5ELFA 4B08A 3BVMA 2HQEA 3NTKA 3V96A 1GUGA 3PIO3 2PZUA 3HEJA 4XLFA 1N78A 2RQQA 3D8GA 1IYUA 2F0GA 1HUMA 5F2DA 5KRUA 1X1BA 3OL4A 2OV7A 4FP5D 4IUPA 4ZTJA 1STEA 3GV6A 3OYKA 1IYVA 1E2WA 1D2BA 1F77A 2D62A 1UNSA 1SNOA 1HPCA 2JA8B 3D5SC 4EVOA 1OXXK 3K4BA 3EA6A 3BC8A 1P9QC 3W2WA 2J4XA 3F2UA 3N05A 4IZ8A 2DOAA 2QKMB 2SNMA 3LX0A 4FNFA 1F2YA 1DD2A 2F0PA 4X3TA 3OWFA 4DF7A 4HN7A 1PFMA 1SYCA 2F0TA 1ZYRC 3LL7A 2MABA 2K5QA 3GV3A 4B9XA 1B3AA 2K01A 2K04A 4XT1B 4ANJA 3DTIA 1CT1D 1A3TA 2KL4A 3T4AC 1BNZA 1Q1BA 2FUG2 1PTOD 1U9RA 2CMPA 4C3JG 3PUXA 1DYQA 1B9MA 1W36D 4I7ZC 1LT3D 4XLCA 1D1KA 2HNHA 1WTWA 1SBBB 3J81E 1PRTB 3OYGA 5K36H 3WDNA 3NTHA 4K14A 1E0BA 1E2VA 3OR2C 4XQNA 1WJAA 2LBFA 4PSXA 2F4IA 3TZUA 4YRVA 4PMCA 5FKAC 1U4MA 3NSWA 3ZYYX 4HTHA 1O7LA 2SDFA 3A7LA 1X3PA 1OXTA 2Q8TA 4DNTB 3GTLB 3CESA 4BL0B 1OO9B 1SNDA 2K03A 1MMAA 2PYKA 1OLTA 2B39A 2XWJB 4YELA 1EEFD 3TBIB 4C3IG 4C3HB 2QILA 2L5QA 1PLFA 4G7ZC 1XYIA 1QILA 3PUVA 1D5MC 5D65A 1Y1VB 4L6TB 3R93A 4EGVA 1JWSD 2W00A 5KGUA 1WTRA 2V7FA 3GP7A 1GHKA 4N9TA 1V1PB 2Z1CA 5I9OA 2FINB 4LK1C 3O13A 2E2DC 3SR1A 3L2RA 1DOKA 1WJCA 1JICA 2RA4A 2WB1A 1CK1A 2M7AA 5E1FA 3HL2A 2WADA 1G91A 3PSFA 3VR3A 4PUSA 3HPGA 4IX7A 3J81L 4KY6A 4KY7A 2OF1A 4A3JB 4IFDG 1SYBA 5IGCA 1DM0B 1ICWA 1BR1A 1TU2B 1K8OA 3J7YW 3OYDA 1PRTD 4R79A 1G291 1BOBA 4UAIA 2HCCA 5JAVA 1RF2D 2EYJA 2BE5C 2J0TD 5M5WB 4EQOA 1G6ZA 1GUTA 4C56C 1NG6A 1WTPA 2EYLA 4BBSB 1SYEA 3DTKA 2L1BA 4F87A 2M3AA 3KF8A 2VQHA 3W2VA 1JE4A 2R7OA 1B1ZA 5I6WA 3ZRGA 1WJFA 4C1NI 2JEBI 2F3WA 2RDGA 4XR6A 2KP6A 2Y0SA 1QNUA 2WIIB 5I2XA 2F0QA 1WD0A 2KQ3A 5C4JB 4E7LA 4B9WA 4X3UA 1AFPA 1PXUA 3QB3A 4O42A 1STHA 5CGKA 1DZ1A 4II2A 1ENFA 2EE1A 3MXPA 5JVG3 3CRLC 1O78A 5ELDA 2R4GA 1YNJD 2F0LA 3S8PA 4XMYA 1WD1A 3V42A 1EU3A 3NWSA 1G2SA 3BG7A 1XX8A 4XQJA 3OS1A 3VR6A 2HZDA 2IGKA 3EQLC 4F8MA 1EYDA 2ZXIA 1AN8A 2C9OA 5EKKA 4BBRB 2NUCA 4R8NA 1ZXTA 2HDWA 4M1UB 2EJGC 5EGTA 1K8MA 1ZKOA 2FMMA 1DOLA 1AZQA 2VJJA 2E60A 3W2DA 2R7WA 2WAFA 3FVQA 4IALA 2AQ2B 2K33A 4PMWA 4CKCA 3PNTA 4DK0A 1S9HA 2IX0A 2HU9A 2ZXOA 1N75A 1S5FD 4RLQA 3S3MA 1WJDA 2VQCA 2RBMA 3EROA 3C46A 3GTPB 1ZYRD 4QPOA 5HOOA 3H5NA 2ID0A 3RSNA 4ZDOA 1I4PA 3I4LA 3OWEB 1JI8A 3FDTA 4DN4M 2RVLA 2VXWA 5EKLA 1B44D 1LACA 2XDVA 1RJTA 4LITA 2QKLB 1Z3XA 1LTBD 2XSCA 1HA5A 3BVGA 3T56B 4BJ6C 1FMVA 1YX5A 2V1NA 1U4RA 4DFAA 1SYGA 5EBDA 2L9SA 3BDCA 3I4MB 3IAYA 4XL9A 4IQJA 1TWFB 2FMCA 2IL8A 4F91B 3GTQB 2IJ0A 2KA7A 5DEHA 4FO2A 1D6EC 3S93A 1ILQA 3OL3A 3TBIA 2F0UA 3ITPA 2F0WA 4DXFA 2GOMA 4RM2A 1FNUA 1A6XA 2K05A 1KDBA 4K8JA 1XTCD 1KLUD 1VZ0A 2TSSA 2VB3X 5EKIA 2DN8A 5LD2C 2X6XA 3QYBA 3DXJC 2VKDA 5KHDA 1HTLD 1WTXA 4NP5A 5CQEA 1EY6A 1V1PA 4Z9CB 1W6JA 1DGRM 1CQFA 2B2VA 1QG7A 3LWUA 4RHSA 1AW7A 2VB6A 2IS2A 5DNFA 4ID6A 4IN3A 3S16B 4YEJA 3HUGB 3T16A 2L7KA 1DXMA 5J1ZA 2BCOA 1H9SB 1GXDC 1EIHA 4XM3A 4BEHA 4KD4A 3BDOA 1MI2A 4S3SA 2I8DA 1CI3M 4Y7NB 3IP4B 4K2LA 1GUOA 1B53A 2SEBD 2JA6B 1F9SA 1L0XB 4DXGA 2XNAC 3SK5A 4RFBA 2E75C 1CHPD 4K6LA 2WACA 3TL4X 2AQ1B 3H3VC 3K10A 2R7VA 4A3EB 2NYZD 2R7QA 1KONA 1GJXA 2CQAA 1CQVA 4R9WA