3HG9A

Crystal structure of putative pilm protein from pseudomonas aeruginosa 2192
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
119
structure length
119
Chain Sequence
LAEVDTLARSLLLYRSRLAEYAHANPGFSGSPADSALGLPAWFRKPVRLQGYIAAGTSYAFIASPPAGLAAAVDTGTESDLVGVRRNGQLVTRRLGATAIALPAPIPEGAVVAVKEGHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title CRYSTAL STRUCTURE OF putative pilM protein from Pseudomonas aeruginosa 2192
rcsb
source organism Pseudomonas aeruginosa
molecule tags Structural genomics, unknown function
molecule keywords PilM
total genus 16
structure length 119
sequence length 119
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-05-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1170 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3hg9A01
2.40.50.380 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3hg9A02
3HG9A
chains in the Genus database with same CATH superfamily
2VQEQ 3HOYH 4CBVA 4IPAA 4XL9A 2I46A 1CF7B 3M1CA 2JN6A 3LA3A 3CQZJ 4ZDOA 2CQKA 1MJBA 3L2WA 3MXPA 5D65A 4HG2A 3RZOJ 2F4VL 1U5TC 3ECOA 2DPDA 1EY4A 2LD5A 5C4XH 2B0LA 3CCLA 1J5YA 4HV6A 1QUQB 4YHHQ 2D62A 2NVQH 4LIVA 2FMYA 2MNAA 2Y48A 2GXAA 2KJXA 4KT5C 4LF6L 4XLAA 3L2UA 3PO3J 5E20A 4DR3L 2WB1B 2K5CA 3AKZA 1XTAA 2KQRA 3MXUA 2EFOA 4L5RC 1V1PB 4BY1G 1QVFA 1U0LA 5HLHA 3GTQB 1VQPI 1P7JA 1YRNB 4DAMA 1QOHA 2OWOA 2OQRA 1XGNA 4KN7X 3Q22A 4IRHA 4PJJA 2SNSA 4JYAL 2YTXA 2RQPA 4NC7A 4HJ5A 2AS5F 4WF2A 3F8NA 5DCMB 1W3SA 4A4IA 4ID6A 2K33A 1T2KA 2YU9J 3DCFA 4IX7A 2A5WA 2R7ZB 1WPKA 2KCTA 1TWFB 4B47A 1WJFA 2Z6KC 3J7ZI 3AMUA 4DR2L 2KT0A 5KVRA 2DI3A 2V1CC 2LKVA 1V5GA 2R92B 3AQQA 3M4OB 4IRIA 3A8JE 1RL2A 3OS1A 3HXLA 1KLGD 3CCVI 2IXSA 1MIJA 1N77A 4AYBE 4NMZA 5M3MJ 1SC7A 2OTJI 2E5LL 5M5YH 2K7LA 4R8HA 1I3QH 4OIOF 4R9WA 1W0UA 3R6SA 4HOBA 4XORA 3EYYA 4UV9A 1JHHA 1V1QA 3HOZB 1MSGA 5BPIA 1YNJD 2EE1A 4HCEA 4XLFA 4LF8L 3S17H 1G51A 4TV7A 4KICA 4AUXA 1WTPA 3KJOA 2I10A 1OPCA 5KNLA 2WP8J 3SFIA 1VQKA 3S2HB 5D8LB 5C44G 4E6KG 2DYSH 1BI2A 2VE8A 4GOPA 2N78A 1EQQA 4OO1I 4HW0A 1XNQL 2X6YA 3TOBA 2P5ZX 3HOZH 4YWKA 5EKKA 4NXNL 4RB1A 3KE2A 3I4OA 1KRTA 3FXRA 5J4YA 1X58A 2FBHA 3N4MA 4CDCC 4CCMA 1S40A 5C5MA 4K0KL 4CYDA 3FEWX 3G3ZA 4CDGA 1IF1A 1I3QJ 5ICGA 1NH3A 2H1KA 1S5CD 1OLTA 4BBSB 1PFSA 2ZMEC 5IYBJ 4KJZA 3CUQB 1FYKA 3HOUH 5M3FJ 1I1SA 1IKMA 3W5OA 1ET9A 2HDMA 3TMOA 4G57A 3ZP5A 1FBSA 2KIQA 1S5ED 2R6GA 4CXFA 5DUIA 2IL8A 4C2UA 3VODA 3T4AC 3RD4A 1Y1VH 3RMHA 1D5MC 1TC3C 2I0QA 5JJZA 2ALYB 1CZWA 3G71I 5M3FH 3M3YH 2FSWA 1VQOA 3D6WA 5M5WB 2VT2A 2XGTA 4E7IA 4Y52J 4ZTJA 1SVOA 3TEDA 1Z3XA 1XMQL 3JRIA 4RH6A 5LRSA 1ZR4A 1WTVA 5F04A 2L5TA 4M6VA 3KFWX 3G2BA 1CSQA 3PO3H 4CGZA 4NDXA 2RDFA 4JI1Q 1E1TA 1BIAA 1TLHB 4FVMA 4B08A 3O3KA 5G3LF 3JW4A 1DCZA 5CQEA 3DLLF 1AWCA 4YFXF 2F0OA 2WB1E 1RRJA 1Z7LA 3GTOB 3Q0UA 3AFQA 4XN0A 2V4JC 4C3HH 2W85A 3ITPA 2F4IA 1FWZA 3KP4A 1R00A 1C8CA 1A2UA 2QCPX 1R9TB 1HNZQ 1K6OA 1RC9A 4LFAQ 2SNMA 4HSTA 3CDIA 4CCJA 3OIPA 3F2UA 2KUMA 1CHPD 3CP0A 4BQQA 3DF8A 1K83H 4HJ7A 5HOOA 3BP8A 4C2TA 1PYBA 1MBHA 2JK3A 3GLLA 4HJ8A 1FP2A 1STNA 5EPLA 3K4JA 1KU3A 5F1JA 3BQYA 4N4OB 3WTXC 4HZFA 3FMRA 3GTLB 4LF9Q 2YSRA 4GN3B 1NHAA 1XPOA 3KK7A 1SFXA 1IXCA 4B3ML 3FXMA 2DMTA 4X3SA 1SAUA 3QPHA 5ELOA 3WOFA 4L5EA 3JTGA 3H3VI 1PHJA 3RKWA 4YIIA 1PP7U 4LFBQ 5K5QA 2AUKA 1OXTA 3NRVA 3RTRA 4BE0A 2K27A 1JE8A 3D1NI 4DNTB 3ULPA 4EJVA 4G8XA 3H0DA 4G6DA 2NNNA 4ESJA 1E1OA 1STHA 2HR3A 3ZYYX 5E17F 1ZREA 4AC0A 4AVZA 2V1UA 3AU7A 2X4HA 1V4RA 5LMNL 2R7WA 4XBFA 1WJCA 2ZJQF 1YW8A 4DV4L 3S2DJ 3RDIA 2P5LC 4A3KB 3GX4X 4JI6Q 3R0JA 3HRTA 5F1RA 1VQNA 4GN5A 3S3NA 2RQQA 1XSXA 1R1UA 3JCUC 2F0MA 2KVMA 2NZ1D 4G94A 1F1ZA 4C2MH 2MO0A 3EYIA 1S4ZA 2QEXI 3LSMA 3PUBA 1ETKA 5FO7B 1CF7A 1QJOA 1JWSD 1H9SB 3TS2A 1GXDC 3E6DA 1Q46A 2OD5A 3ASOH 4CCNA 4U7BA 5AFWA 1EL0A 2E60A 4IVNA 3AL0B 1TY0A 1QO0D 3LWFA 3DKYA 3OR1C 3SK8A 2V9VA 5EJCA 2ZBKA 3IRBA 4DUZL 3HFZB 4NC8A 3H9QA 3CLQA 1OXSC 4UUSB 1MGSA 2DOFA 1T39A 3UKGA 1NR4A 4LOCA 3MXNB 4DR4L 2KCNA 3C1DA 2H8WA 2PJRA 1CGPA 3L00A 2DFHA 4RMNA 4KA4A 4M9SA 3B02A 3HGYA 1MHWC 4EVIA 2JA8B 2NBFA 4DR2Q 4BE1A 3I9V2 1Q8IA 3A8KE 4YELA 3EROA 2EFQA 3PUYA 2XTIA 1D1CA 2RSNA 1N33L 2CCZA 4GRIA 1XMXA 1XMAA 3FXKA 3A1YA 3I4NJ 3BR5A 1EIGA 1P16A 2H27A 4YG2F 2KQ3A 5GPCA 4LB5A 1IHZA 5DM7F 4KNYA 5A2QK 5I2XA 1JT8A 5IIFA 5EYRA 4IJAA 2O03A 2E75C 3KX2A 3FWEA 1QPIA 3Q6SA 3I58A 5L3GA 3ZN1A 3K4BA 4BQNA 4NC6A 2OPTA 3CCEI 1WI5A 1GO3E 2RF4A 1QUQA 3TO7A 3GTGJ 3FXLA 4PNYA 3QIAA 1DPRA 2ZXJA 3KP2A 3H0GJ 1ILPA 1IG7A 4C3JB 2CFXA 4LFCQ 2HOSA 2E1NA 3GD7A 3ULJA 2GVBA 4U87A 1WH7A 1HXYD 5CC4A 4AIKA 2ZJ2A 4OX9Q 5IT9E 5EEGA 3HHGA 3A0BC 1WD0A 1TXYA 2AQEA 1QNUA 1OJLA 3O6BB 1CA5A 3AAFA 3F8TA 4ZDPA 4DV1L 1A15A 3K69A 1YW7A 3J80i 2M0MA 4UP7A 2HNHA 1GVPA 3WE2A 1K61A 4OAZA 1GHJA 2WB1G 2B63B 3PGZA 2YU9B 4JI4Q 1GUSA 4XSXF 1S5DD 2W00A 3AB9A 1MBYA 3OYYA 3NE5B 4BY7H 2HQ5A 5M5WH 3GTMJ 3MA2B 1RZ4A 5F64A 4PGHA 1IBKL 1ZYRF 2VL8A 1OTCA 4J01A 2MH9A 1S8NA 2J7ZA 4HNVA 4RGNA 3T8RA 3BVGA 3OYDA 3LSPA 2VQFL 1GOZA 2JVGA 2VI6A 3RKQA 1JORA 2KDOA 3GTLJ 3A01A 2L9HA 3D0SA 2R7QA 2JA8G 2F0FA 4ME3A 1AA7A 4P96A 1UE5A 1FTTA 1G8ZD 3EUAA 3BG7A 1P6RA 1B3AA 3GTPB 4XN3A 2EYJA 3WDNA 5TGTA 5CQGA 2RA4A 1OFCX 2FU4A 4K6DA 5JOBA 4DR1Q 3A0JA 2QENA 5LGUA 2R93H 3F2DA 3O8GA 4I09A 3K2AA 4Q5SF 4NPSA 2HIVA 2LFNA 1RTNA 1ZXTA 5LEKA 3ABUA 1B9MA 2N88A 3HOXJ 5EG0B 5C3EB 3G71A 4UP9A 5FK9C 1Z05A 1HNZL 2HGCA 5CBEE 3MXNA 1WTRA 3LA7A 2CUZA 4C3HB 1QNTA 5C0XH 3OTOQ 1FIPA 1W4MA 3I55I 2R7ZG 3K80C 3M7GA 2E35A 3E3XA 1FD7D 4LF6Q 1B9NA 1WWXA 4OIKA 4B3SL 1F9RA 2XAUA 3I4MJ 1D1AA 2GXGA 4K2EA 3K70C 4AU7A 1O3RA 2XUBA 1IAWA 1K0RA 3HG9A 5C0XJ 4DW6A 2WV0A 3PF4A 5DYMA 4IHXA 2UUBQ 4K5WA 1FEXA 3RJPA 1GUNA 1L0XB 3NEMA 4V2GA 3JREA 3DEPA 1LKXA 4JI0Q 5C4HA 1LTRD 4ASNA 3A01B 1SSOA 3EPZA 2LKSA 2JA7J 1HSJA 1ZGJA 2XWJB 2QBYA 1AOYA 2VBZA 1O3SA 3K4LA 5F0HA 1DZ1A 2B2VC 4A75A 1MJEA 3K81C 1JJ8C 5F0CA 1I1GA 3B6YA 2PQEA 4FP5D 2JA5J 3CMYA 3SZTA 1A8VA 2HTJA 4R8NA 1D1IA 2AUJD 2P7CB 5D5VB 1DU0A 3U9SA 3S2DB 1XGSA 3MFKA 4CJ1B 3GV3A 5FKKA 4EQOA 3TEHB 1SR3A 4R8IA 1M1KC 2Q8KA 3BJ6A 4JI5Q 1ZGAA 3COAC 4OIPF 2RNGA 1KDAA 3JRAA 2DNCA 1IKLA 4A3EJ 4YEJA 4XRMA 2AHQA 5J3LA 2M4KA 3HOYJ 4TVAB 4DV7Q 4HDVA 1K78A 2F0KA 2EWNA 4IUNA 1UG0A 5CR3A 3I70A 3G6JB 1KLUD 3I4NG 4D0PA 4POGA 3FKIB 4PJMA 4C1NK 1HA6A 4BJ5C 3KLOA 1YLFA 1L2FA 2ASBA 1MDMA 4QB4A 4K8JA 3DBLB 4PG3A 3IC7A 3OYJA 1VFCA 4U88A 4KD4A 4P75A 3MVVA 2QZ8A 1UAPA 1HFGA 2LH9A 3BT9A 2K52A 2DTZA 4GXOA 1FOXA 3MEFA 3J7AV 3GW2A 1USTA 4V2FA 1PZKD 1FJLA 4I7AA 5CVVA 1IDZA 4IUUA 3HOYB 5JJKA 3BWGA 5M3MG 4LGWA 4NXML 3W2DA 1I4GA 3R4KA 4DQ2A 2NVTJ 3K57A 4Y52H 2LSOA 3I71A 4U7DA 3PQIA 1OYWA 1YNJC 2Z2SB 3E3VA 5CV4A 1PFBA 2A61A 3S15H 4A76A 5JI6A 1DXMA 1EY0A 5FLXZ 4BHBA 1YOVB 2BW3A 2XDVA 1XDUA 1SMYF 4PJ0C 2NVQB 1LTTD 3L9AX 3SEZA 4BU2A 4II2A 1TW2A 1PDQA 4FT8A 4XNFA 1HA5A 1UFMA 3CW2C 4Z9CB 2VQEL 1ETYA 3B73A 2HZDA 3QAHA 4E7JA 3FM5A 4JG2A 1JR0D 4EGZA 1X3WB 2FQ3A 3RYPA 1TQMA 5IT9c 3J80c 3JSOA 3HOUJ 1YO5C 4I7HA 5IYDJ 4F93B 3DTKA 3I4MB 3F6OA 3LSGA 2Q2EB 1YBYA 1VQFA 3K8AA 5CVIA 2HVQA 4EEFG 2IPKD 3W2VA 1E3OC 2EYPA 1LUJB 3K7AB 1FX7A 3HZXA 4LUZA 1JB7A 4GLXA 1W7PD 1SVLA 2NWGA 1SEUA 5B1BH 1SEBD 2MPMA 3H6MA 1WZ2A 3ABMH 3RNUA 1PTOD 1BC7C 2RDGA 1S7OA 1V1OA 4OX9L 1VQCA 2R7FA 3FHWA 2DTRA 1NTCA 1VF5C 5LFAA 2IRFG 2P7VB 2VXWA 3HUGB 2TSSA 1LDDA 2COMA 4KY7A 4CH7A 4BQAA 1IO2A 4A0YA 1IXSB 5C44J 1NNXA 2XWBB 1LTLA 1U5KA 1HKQA 5KNBA 3BYTB 1XMOQ 3U9GA 3S1RB 2JP1A 2GOMA 3E1SA 3K1PA 1NMGA 5DDGA 1N32L 1WJDA 1JOOA 2AXLA 3VR6A 4GN4B 4A3FB 1ZRDA 4RDUA 4L9JA 5LL6X 4K5XA 1Z0XA 3BOQA 2VJ4A 1KU9A 2IGMA 5ICCA 1ZR2A 1X1PA 1Z6RA 1X3GA 5H2FC 3G1LA 1IUYA 3MC0B 4O42A 4B1RA 2R92G 4B4CA 2MC4A 2CFMA 2GA2A 2WAEA 4HSVA 1QHGA 2HHHQ 1TWHJ 3S1NH 4KN4C 1SXTA 1T0FA 1TWAH 4FTHA 2DA5A 2K5VA 4QCLA 2JEAI 4RGXA 3BY6A 3G4SI 3E6BA 2ZSHB 1JC7A 2IA2A 3MVPA 4A2UA 2ISZA 4ZYSA 2M8EA 2EZLA 3L7ZC 4M3BA 3J7AF 4HV5A 2M4GA 2LY1A 1DP7P 2A6HF 3L09A 3LSKA 4N9HA 2K5DA 1PZID 4WXHA 1P9QC 1VQ4I 2MHVA 1SFOH 2JRMA 3T1BA 2FOWA 3CD6A 3PIOF 2K14A 5HS7A 4NHJA 3W1GA 1T08B 1QGPA 1TVXA 2ICWG 4U68A 2KISA 1KA8A 1IN8A 1LE8B 3BDDA 3PO2G 1UELB 4RLQA 1MMAA 4DAYA 1DOMA 3GQBA 2A3SA 4DYRA 4PSXA 1NTGA 1F2ZA 1XMKA 3Q3SA 4HQEA 2FRHA 1W7PB 4DV7L 2ZC2A 5HY6A 2ZCWA 5FFXA 4A3DH 2GXBA 2ZXPA 3PV0A 3DWAA 2UUCQ 1G6ZA 1B1ZA 3PO3B 4Z6YA 4DV2Q 4UVBA 3F22A 2R5YA 2XAJA 2E8GA 1L0WA 3M9AA 5M3MH 2FFKB 1PH6A 1B44D 2Z5UA 4HX4A 3WTUC 2VB6A 5H6RA 2K3FA 1VQ6I 2OEOA 1NUCA 2XSCA 5IPAA 3MFYA 4QY7A 3IRQA 2EY5A 2X9DA 2WKDA 4PMCA 2I07B 2RVCA 2VN2A 1TQPA 2K02A 4C3HG 2OXPA 4XIGS 4HIOA 1NSNS 3ZPLA 2XAQA 1K7AA 3ABTA 1KONA 5FLMG 2OQGA 1T56A 3TKYA 1XMQQ 1XCBA 2LNBA 2ECCA 3GTLH 3MZYA 5IWAL 4MIMA 1KXLA 2XB5A 3KYCB 2N8GA 3HSFA 2OT2A 1ERDA 3PFYA 4HNUA 2B63G 1STYA 2K32A 2R7UA 4XQQA 1V5FA 4LK1F 1MNMC 3CCRI 1F36A 1PTOH 1DQUA 1YHQA 5LL6S 3AYHB 3ND8A 1I50H 2NB0A 2PI0A 5AIQA 1PVEA 2CMPA 3C18A 1HTLD 1IW7F 3TS0A 3F72A 3RN5A 1N36L 2K03A 1F4KA 2DMQA 4KFCA 1FNNA 4MNUA 4ENMA 1YJWI 4B3RQ 2RAEA 2DT7B 3CC7I 3NAUA 3ZR8X 1TQIA 1Q86C 3BPXA 1F9NA 3LA2A 1F77A 2EJRA 1D5YA 1ACIA 4DFAA 4KLKA 3QOLA 2Y2ZA 2JUGA 3NELA 1OCPA 5IT9K 1Q81C 2Y69H 4APVA 2Q2UA 1RNLA 1VQ6A 5GADC 4IALA 5FLXE 3E6MA 1L1OC 3TP8A 4CCOA 1UEBA 1PRTF 1T0FC 3ECHA 2VKHA 4W97A 2FQ4A 4HYEA 1UB9A 2UXCL 3R3OA 1VQ5A 3I4NH 4YFKF 3C2PA 1SMTA 3CMAA 2VUMB 3GVAA 1XXGA 4N9IA 1MMDA 1UHWA 1QU3A 2TCTA 1H9SA 1JUMA 3OYAA 2R7RA 2BY2A 3EJIA 3GTKB 2BZTA 1VQ8I 2MGSA 2XSDC 4IJHA 1TIID 4A0XA 3DXJC 1U5TA 5J8FA 2DT6A 4OIJA 1Q82C 1HW5A 1NG6A 5DD4A 2NVUB 3UDFA 2X6GA 2PG4A 1SNCA 3F2CA 2LF7A 2A5YB 4PZ6A 3V05A 4E7HA 4KK7A 5BOXA 1TWAJ 1TS4A 4L5JA 4DUYQ 2HTSA 4V0BA 2HDCA 4ZTFA 3AG4H 5GAGJ 3DHQA 1Z21A 5GAGC 2HDWA 2KIUA 2MD0A 1YI2A 2B9SA 3LQQA 2JT1A 2OTLI 5HNFA 4WFN3 5ELCA 3W2AA 1JXSA 5JPMC 3IKJA 1TWGB 4AYBN 1EF4A 3R2IA 5M5XH 3PUXA 1OYYA 2MYSA 2DGYA 4WK8F 5CORA 1LLRD 3I0TA 1K73C 4XKVA 3S15J 1A04A 4H0EA 3IFDA 2QF7A 4P72A 1QA6A 2P5KA 5EPKA 1P4XA 3CC4I 3M8FA 5J47A 3TW7A 5BMZA 1OXXK 3OOCA 3KEQA 2DY7A 5JEAH 3WU2C 3QYBA 2JYOA 2XIWA 2CUJA 4IHWA 1EY5A 1KAWA 4GOPC 1B70B 2VXDA 1MMNA 3VWBA 1Q90A 3MD2A 1BM9A 1BO0A 3NSWA 3U2RA 1TS3A 2LSSA 2A6HD 1K79A 4BACA 3OSGA 2M30A 3UDGA 4BS9A 3VSLA 1EA3A 4FXDA 5IP9G 1SRUA 3TBIA 2MFIA 1IV8A 3HRMA 3MZ8A 4AH6A 3H5RA 2NN6G 3WGHA 2PMZN 3S16B 1BI0A 1UMQA 2G7UA 1ON2A 4B48A 5FLMH 2JWTA 3PUWA 3WTTC 1EWIA 2K3PA 4RHRA 4DV2L 4P2CB 3MKWB 3CO7C 3I7FA 3JAMZ 2EY6A 4UVAA 4A3GG 1YE9A 4M72A 2EILH 4GS3A 3WE3A 3QYEA 2Q2IA 5M5WJ 1OXUA 2RBMA 1M4VA 1G3WA 4A3FH 1XX5A 1ICFB 2D45A 1I6HB 4XXEA 4FE7A 4A3CG 2EJFC 4FF1A 1JT6A 2UUAL 3AG1H 5EKIA 3I90A 4JI7L 4MEXF 2YTYA 4CCLA 2OV7A 1VQMI 3PQKA 5C44H 1JKOC 4JYAQ 3FMQA 4P9FA 2B8FA 3DEWA 4IHYA 4NDLA 4CGYB 3I91A 3C7JA 3K7UC 3SK5A 3J81Z 4X65L 1VQAA 2AQ3B 2W84A 4S05A 2AQ2B 3GTQJ 1G6NA 4A3IJ 1MBKA 3CC7A 2DOEA 2EZKA 2CQXA 5ILVA 2NVXH 1PTOF 3T0YA 4ALPA 5T1IA 3TO6A 4MTNA 4JP0A 3GF2A 1IRGA 4IN3A 3QR8A 2HQRA 4ULLA 2IA0A 1PH5A 2H1LA 4B3RL 4M3FA 1SNQA 2JXMB 3H15A 1FBQA 2O3FA 3M7NA 3LNQA 2VASA 4UXNA 5C4ZA 3WWVA 5CMDA 3BR3A 3SGIA 2MH2A 2EV6A 4H7BA 1O7ZA 2R7SA 5DCFA 2M34A 1FLIA 5TSSA 1JTYA 1MMGA 1FSEA 1HNWL 1A31A 5HLIA 1D5VA 3O13A 3I4MG 1EJ9A 2G9DA 2QDLA 2JRTA 2KHMA 4D7NA 1CSPA 4QIWB 1BDOA 2IJLA 5FKAC 1I6HJ 1CKOA 2ZM6Q 3T56B 1H9MA 3J81E 5LRRA 4DZJA 1E24A 1MI2A 4JOIC 1BCPC 3CUQA 1FNUA 4KYWA 2ZTEA 1UUPA 3NTHA 5H1SE 2XVCA 2K9SA 2OQ0A 2BVMA 3MMYB 4BKXA 4QL5A 2AQFA 4HX7A 1M1EB 2PLYA 5DD8A 1IN6A 4MQ9F 5DM6F 2D5VA 1JICA 4I99C 3TDZC 5IGGA 4WJ3M 1XN7A 5E1ZB 5F0FA 3W1BA 4F55A 4KHPL 1DU6A 3V96A 2QGUA 2DA3A 1IC8A 5EDNA 5IY5H 1H8AC 4X3TA 3I3CA 1WTWA 3VR2A 3M4QA 1DP3A 4FO2A 5EPJA 2L9VA 3ASNH 3J81L 2O8KA 2CG4A 4RA2A 3LGJA 1SLJA 1Z77A 3HM5A 1D0XA 3H3UA 1Y14B 1ESRA 4HIMA 5JEAG 3H35A 4XQFA 4F7ZA 3U9OA 4GNXC 1ML0D 3K4NA 4XM3A 3S9WA 1JE4A 3CCEA 4C3JJ 4EATA 1WTOA 2UXCQ 1R49A 2M7BA 1VQ4A 1ENHA 1Y1VG 3M4OJ 3KEOA 4KY6A 1K4SA 3L0OA 2DDAA 2DA2A 3S15B 2VQHA 3JAML 5J4VA 1EH6A 1Q8KA 3MN2A 5LEJA 2DLLA 3F3XA 4O2DA 4ZYAA 3VSKA 4A3EH 4QLCU 2V1XA 2WFWA 4XSZF 5GQOA 1WGXA 1V54H 1IL8A 1K6YA 2I5UA 2A68C 4C2MB 4NB5A 4DR7Q 2AKWB 3VOEA 1BBUA 4JX4A 4G6TB 2CW0C 5EGOB 5IYBH 1CM9A 1WOCA 4RB0A 1QRYA 2VNUD 3V7SA 2CU7A 1F2YA 2DO7A 4KIBA 4A3IB 4AYBG 4ZYEA 1IXRC 5LGNA 2A69F 3P7NA 1A6XA 3J81K 1BR2A 1I3AA 3UE1A 1BW5A 5LGTA 1YX5A 4BWGB 1N75A 1HC8A 3K2ZA 1LVAA 2JA8H 2CH4A 1X4OA 5HGTA 3QPSA 4PSWA 2EINH 4A3DG 4XYOA 1ZN2A 3NENA 2Y0SG 4CO8A 3N52A 4DV4Q 3VYRA 5G3LD 4A3BG 3ZRGA 3BTLA 1SMYC 2IHEA 4DXFA 4F92B 3I53A 2XB0X 1OISA 1ICWA 4RKBA 2ID3A 5DCMA 2A05A 5I2YA 1Y1WJ 3J81j 5BN5A 1X54A 1BN5A 3KF6A 2KDZA 1Y0UA 1HSTA 4OONA 4J00A 2HOEA 5FKLA 1SFOJ 1SE3A 5J22A 4CA0A 4H13C 3F8MA 3LOCA 3VA7A 1X1AA 5IYCJ 3ZQHA 4JVZA 5ELBA 3FIWA 2E34A 2Y31A 4EQQA 2KOLA 2KCCA 2F0HA 1KDCA 2CRGA 2Z33A 4CHTB 1X3ZB 3VB2A 1AE3A 3E0JB 4OU0A 3U4VA 1U9OA 3U58A 3EUHC 3E0JA 2M8GX 2F0PA 2GOXB 3KDFB 1PVOA 4Q4ZF 1MNDA 1I6XA 3SDGA 2D2WA 3KLSX 1I27A 2XAHA 5GPAA 2FMMA 4I01A 4UY8C 3KP7A 2ECBA 4MO7A 3GTJH 1JB3A 1DGSA 3DEOA 1XGMA 2L15A 5JLWA 1P8LA 5KAIC 3TQYA 4KHZA 4Y13A 4IPDA 2ZJPA 2UXNA 2HWVA 1Q7YC 3FBNB 1JTXA 5ELNA 4Y7NB 3OIOA 1PYVA 5D3IB 1C7YA 2FXQA 2OU2A 3VR4A 1N33Q 3CF2A 2Z1CA 4BBRG 3Q9VA 2PCFB 4KISA 4OIQF 1O4XA 2KEDA 2MSYA 1ZYRD 1MBEA 4ILWA 2FD5A 2K9MA 4F88A 4LG3A 4Q5VA 1FJGQ 3KYHC 3BS1A 2M00A 4IHSA 3BG5A 1MSFC 1DOLA 2VB2X 1R5GA 4RAYA 3SK4A 5C4JB 5C44B 2W57A 4GGGA 4IHTA 1LACA 2OF7A 4O1NA 2GN5A 4II3A 1KQ8A 3PJRA 3ZMDA 2E1MC 3LWUA 3FHNA 1HNWQ 3JAMK 3V42A 1Z6TA 5E3NA 2KBNA 1TWCB 1BI1A 1OCOH 2PQ8A 2H4OA 3VA5A 3VYSA 1PMRA 4PV1C 3GWZA 2PQAB 1FNVA 1X1BA 2K86A 1U2WA 3DP7A 4C3JG 4LLNA 2MBFA 4LFUA 4OO1H 3S1MJ 2B2YC 1YS6A 1YG2A 3CDHA 5GAEJ 4HR7B 1PDNC 2H6CA 2BBYA 2VBYA 4B09A 2PI2A 5D4RA 4GKJQ 4DUYL 5GROA 1VQ8A 3IWZA 5TISC 4J8QA 3LMMA 1PXUA 1TT5B 2K4BA 1Q1BA 2A1AA 1RI7A 3KEYA 3JRDA 3A5ZB 1TWHH 2CKZB 2WAQN 1EOTA 1U4LA 2W7NA 2UXBL 4XR6A 2K5WA 4OAYA 2JA7G 3S1MB 3CQZB 2UUBL 2OZ6A 3TW6A 4M71A 4RMFA 1WHUA 2NN6H 4ZYDA 3W6KB 3QB3A 4GKKL 1HNXQ 4KY5A 3J81c 2CH4W 2PNRC 1II3A 3KJPA 2RQXA 2KJCA 3H3VC 2OC6A 1VNDA 2YR2A 3BVZA 2MG4A 1QVCA 1U3EM 1RETA 3MKLA 1GLNA 3NBHB 3DKXA 4BHPA 4MNOA 2BOSA 2H1EA 4L5TA 5EAYA 2Z6BA 4ENNA 5HDKA 2PX9A 2FA5A 1TWGJ 4XT3B 4HTHA 1I50B 4KV6A 2ETHA 3O8HA 3S2DH 3LSTA 1KC8C 5KEEA 2HYJA 4BA2I 1X6OA 4CSWA 2OTJA 3BJAA 2QQ8A 3JSPA 1UE1A 3X3NA 1IW7D 5ILUA 1N25A 2ICEC 3RPUA 4E4HA 1IJWC 1EFWA 1FPQA 2KL4A 3JRHA 4WRDA 5IWAQ 4JK1C 2ZXIA 2QLZA 3PIPA 3I56A 1TS2A 4G4KA 1AE2A 2ENBA 3RCOA 1OCTC 4R4CA 5CPRB 1FR3A 2Y0SA 1PFNA 5IYBG 4A3JJ 2Y9ZA 1J9OA 2LYCA 2DW4A 1S5LC 3MTSA 4QWQA 3M07A 4L0ZB 4FETA 1HPCA 1A35A 1EYDA 5GP9A 2BDNA 2VODA 1G291 3JAME 4XKWA 1JMCA 2JJQA 1PV4A 1VCIA 5DTDA 2PBIA 4A5MA 3H36A 4B3TQ 4H0LC 1U5TB 1Q3LA 1O78A 2BE5D 4ITVA 2K9NA 4I7ZC 5KHDA 2FOKA 5ILSA 3CPWA 4DK3C 4NXMQ 3DU6A 1L0YB 3OSFA 2VKDA 2CUEA 4CYCA 4XLEA 3HHHA 1JOKA 3HOXG 4M3GA 1B6AA 4R1HA 2IVMA 4MTKA 1GKHA 3LNNA 2L7KA 3BZ6A 4C3IH 3C1EA 3I72A 1D8JA 3MCZA 5JHUA 1T5XD 3HOUG 5J6XA 1PJRA 2A5HA 4RAGA 1KYZA 2CQQA 3ABKH 3HOXH 2WKCA 5LHIA 5M5YB 4N8X1 1HXDA 4A3LG 3P1HA 5IT9L 2KFDA 3WGGA 4YCWA 2Z4HA 1Z47A 1X3QA 2K9LA 2Y0SN 5BR8Q 1EU4A 1ZELA 1FTZA 4DR5L 4A3MG 5DEHA 3U1KA 3OS0A 2F0JA 4C3JH 2KPMA 3MEHA 3PUZA 3ZMZA 5BN4A 3C3WA 3LAPA 2FXAA 1NR2A 2YUSA 2WADA 1I4RA 2Z6KA 5EBDA 3ULLA 2RVLA 4M9ZA 3OWEB 1O7IA 1RKTA 4KD3A 2B63H 2X6XA 1YNND 4LLLA 1Z1DA 2X69A 3PSFA 1HZCA 1RODA 2F5DA 2QDBA 1ODDA 2RREA 2V79A 1QB5D 3JAMc 1K8MA 2B7EA 2FNPA 4CDEC 2ISYA 1PLFA 1KHIA 5HVQC 5KNDA 2EFPA 5DUKA 2JUCA 5K1YA 2P81A 1IL2A 5TRDA 1MJ9A 2F0VA 2EOTA 2KMUA 3C2HA 5AJ3L 3HKZB 3S32A 4GKJL 1ZKOA 3HEJA 2XPVA 1A3TA 4EM1A 4MN3A 2O6GE 5FJ8H 1X4PA 1K8GA 3WTZA 2B2WA 1F9SA 1I4XA 2FEZA 4A3EG 1MKMA 1X3PA 3HRSA 4CKCA 3PUVA 2L2OA 3HOYG 2GVAA 2Q2EA 2V6CA 2QQAA 4B9XA 2G9HD 5FRMA 2C9OA 4EQ5A 5EGTA 5CJ9A 5CVJA 1SFOB 3BTIA 1J59A 2F0SA 2BV6A 4XLPF 3JAMi 1HZAA 4E70A 5A2QZ 2DYRH 1ZQ3P 3HIFA 5EGOA 2QBYB 2ZJPF 3T1HL 2CWEA 1Y1WH 2EDGA 4M9XA 3HKSA 3RI4A 2IEKA 1XMOL 5M3MB 4Y3OA 2XRLA 3SHFA 5ICFA 1DONA 2Q0OA 4HQMA 1WTHA 2LOOA 4IZZA 2Z0SA 2F0DA 3BQZA 5EEHA 2UUAQ 5FJ8G 4DKAC 4LFAL 2BY3A 3UDIA 3IKVA 2R7VA 1EOVA 2B8GA 5JEAJ 4JI6L 1C9OA 3BG3A 2LTPA 4X1EA 4OHJA 2BY0A 4A93B 4RGSA 3HTUA 3DM3A 2IPQX 1FMWA 1Y8PB 1L1OB 1VQBA 1HR0W 4JI2Q 2AQ1B 3OL4A 1OCZH 2DN0A 1LTID 1U4RA 3AG3H 1E3PA 4GYIA 2WV6D 1GV2A 1GXPA 1HR0L 2HU9A 2ZXRA 1DGRM 5CKTA 2I5LX 3K9TA 3OYGA 2HKXA 5FLMJ 3HOZJ 4LNQA 1HNXL 5FKNA 4BY1B 2L54A 4ON0A 4X66L 4M3EA 2NTTA 3I5UA 4ME5A 4IOCA 4F87A 1BCPF 1LTGD 3LSJA 1MJCA 3H9JA 4KJOA 1MSEC 1NCVA 4I2OA 5LD2C 4JI4L 1QBJA 3HDDA 4C1NI 1A2TA 2F5CA 3BR0A 4KMUX 3QRFF 2YS9A 2YU3A 5C4JJ 2JTVA 2E5NA 1WI3A 4U673 1H9GA 4X6AH 3K4KA 3U50C 4L9VA 2PNHA 2GA4B 3NK9A 4BBRB 4QMGA 3NXWA 3FHZA 2OTLA 2W82A 1ET6A 3LQRA 1H89C 1QZEA 1S6LA 4BYYA 2ZM6L 1MH4A 3ZMUA 3RLFA 3K0XA 2MC3A 4KKSA 4BY1J 5KYIA 2LR8A 3VYTA 2EB7A 3CTAA 3FXOA 1JJ6C 1J7KA 2ZNYA 4YCVA 1EQTA 4GNXA 4X6AJ 2ZFUA 1KGSA 2WA0A 1EIFA 2P5VA 4QPQA 4UV8A 3QWLA 2Z16A 2HCCA 1YNXA 2QA4I 1DOKA 4KN7C 2A69D 4A3FG 1FYLA 2GZWA 3IKTA 4IEJA 3EUKL 5BR8L 2LREA 1YYVA 2PMZB 3H1CA 1NY4A 4IURA 2L9SA 3GP7A 2F5EA 2F5VA 1K3BC 4LD5A 5GTHC 2O5RA 2B2UA 1X65A 2O8XA 1B4AA 2IS2A 5IGEA 5C4XB 3HBLA 1SNOA 5EJWA 4B3TL 5K5PA 2C5CA 4IO9F 4KKTA 3HRZC 1V3FA 1I4PA 4AYBA 1IBLQ 3ZN0A 3OPOA 3AG2H 1SVMA 4ZH4F 2R7OA 3OIQA 5B66C 3E0EA 4ANJA 5IYDH 1OKRA 1D8LA 4G7OC 1Z9CA 1ZRFA 1BXTA 2EV0A 2RCFA 3ZXSA 1QZZA 3OV8A 2Y0SE 1U0JA 3UR3C 2UWMA 4MEYF 2IT1A 4HLYA 3J7AY 4K2LA 1LFUP 1JKRC 1ZG1A 4RM2A 1WJ5A 4DV3L 1YJNA 4A3DJ 1XPRA 3G1MA 2E36A 5FD6A 2BHZA 2KENA 2MD5A 1TWFH 3S2HJ 2Z1DA 2L4AA 3DWQA 2EZIA 1DM0B 2XAFA 3FXQA 2CV1A 3D5LA 5FLXL 2X1EA 2IWHA 2ZKZA 2EVBA 2CJJA 4OINF 1P92A 2DMNA 3BG9A 1X55A 3MQ0A 3CCMA 3BCBA 2XGXA 3ERMA 3DM1A 1CKMA 1I4HA 2Q2HA 2BCOA 3CCMI 2M9VA 2K7VA 4WCGA 1XPXA 4UUTA 3E6CC 3UI2A 5M3FG 5FD5A 4DAPA 4AIJA 4FHTA 2VPRA 1RIPA 4BBRJ 4C3HJ 2UXDQ 4IKFA 4N4NB 4B3AA 4IPHA 4J1MA 1MBGA 5C3EG 2N3SA 3OYLA 1RPWA 2JA8J 1YX3A 3KOJA 2QSGX 2HDLA 4C56C 5L3CA 3IH2A 4XRSG 3A7AB 1R22A 2UU9Q 4QTRA 3D4RA 5JVH3 1L0OC 1LTAD 4N9TA 3HOWH 3BJOA 1VMCA 5K5RA 1ZH5A 2JPBA 3S14B 4BY7J 4MLOA 4A3KG 4G12A 2QVOA 4F91B 2W24A 1JUPA 4LF9L 3CMEI 1MJAA 3B6CA 4G7ZF 2OQKA 3KZYA 3NP8A 4RM3A 3GTKJ 2CW0F 4B9WA 4QIWE 1JOQA 2F3WA 2LXKA 2O4XA 1LT6D 5IT9Z 4RWSC 1VQMA 4DV0Q 4BL0B 5F6FA 5FLXK 1N9WA 2JA2A 1IZ6A 4P1WA 4N9PA 1YRNA 5IY0A 2E71A 2XIGA 2HIXA 2Q1ZB 1EYAA 4RGOS 4I6ZA 5IYCH 4X3UA 3P7JA 4YCUA 2Y0MA 4EQNA 2YYZA 1A3VA 1KQ0A 3B6AA 5L3DA 3EN2A 1JJ2A 1HBXG 3H92A 2JEBI 2PZTA 1AH9A 1V55H 4V19K 4O6JA 3ML6A 1TWCH 1RHPA 1HDDC 4OO1G 4QQBX 4XTCS 3BLYA 1VQKI 1X3EA 3E5UA 1QZHA 1Y1VB 3S93A 1KU2A 2XV4S 1YNNC 3H3VH 4EV0A 4TRDA 5EZHA 5JJLA 2DA4A 3SE0A 2JE6I 3GFIA 3HOTA 3GTPJ 4MHEA 1R9TH 1PH1A 2PN6A 3I4PA 1I50J 5A2QE 1SN8A 1B3QA 2DFFA 4XLNF 1STEA 2W4SA 4PZJA 2QUFA 2EXDA 2DDBA 3OYCA 2PI2E 3JRGA 5CBAE 3FF5A 2XNAC 3SDZA 1VF9A 1ETQA 1B72B 1BCPB 3DPLC 4XICA 5BQTA 1LEAA 2JA5H 2F0EA 4B44A 2K01A 3PO2H 2EA2A 2BXYA 1TZLA 3Q9SA 1G3SA 3CCSI 3I8ZA 1TWCJ 5DAUA 3KUPA 2EFWA 3VYRB 1ZEQX 3M3YB 1WTQA 2A74C 4JI7Q 3FMCA 1X3FA 3CF5A 2IS1A 4RGMA 3GCMA 4FF4A 3M4PA 3KBXA 5A2QL 1VQGA 1WJBA 4RAUC 4K14A 1G8XA 1Y69U 3K59A 3BDCA 3HS0C 3S8PA 3K4CA 4A3JH 1WCMB 2R7TA 1EZ8A 4DIQA 1UAAA 1SANA 1TTYA 3KYLA 5E4WC 4NW2A 3FKJA 1V9PA 3S1MH 1U4MA 2F3IA 2JA7B 3BR6A 5DEQA 1OR7C 2E1CA 1EY7A 2RCNA 2C6YA 2MW8A 4DV6L 3K0LA 2I5MX 1W2BA 3DBRB 3BCAA 2MUYA 2JSOA 3V4GA 2P8TA 3EIVA 3GTGB 1OCRH 3F6VA 3HOVH 3FKIH 3CP2A 4BEHA 4E7ZA 1D5ZC 3V7CA 2O5IC 1G2HA 5JAVA 2DJFC 1FT9A 2UXXA 4DV3Q 3CP8A 3TDQA 3ELKA 3QPTA 2STTA 1VQNI 1SMXA 3CCJI 4IPGA 3QOJA 1XD7A 1D0YA 5JJIA 3F8FA 1J5EQ 5HS9A 2ZTCA 2ZMEA 1SE4A 4A69C 5CV8A 3RN2A 1R23A 2NVXJ 2XKPA 5DLQE 4HNTA 3FMSA 4JV5L 1VI0A 3QO2A 1HKSA 1YTYA 1S3OA 4GOPB 3J7YJ 2DFEA 4A3GJ 2ID6A 4Z2YA 2A6HC 2LC2A 1Y1VJ 3DKWA 4NQWB 2BVLA 4M1UB 1U6GA 3BVMA 2Z8LA 3CDLA 2PMZA 2ZO4A 1V43A 4C3IJ 1SJED 3CC2A 3HPHA 3DEEA 3F0CA 3I4NB 3FKIJ 1EY9A 5ELEA 4DV1Q 4D5CA 4A3IH 3S1NJ 2ZNZA 2NVYJ 5ED4A 2Y75A 4F3QA 3KZIC 1EIYB 4Q47A 1K9MC 1K0SA 1K8AC 3A54A 1IYVA 2WAQA 1UNSA 2VQLA 1PZJD 2QKMB 1GV5A 5HDNA 4R1JA 4DV5L 2VKVA 4WWCA 1J0RA 1J9IA 2QM3A 1BBXC 3QJYA 2QKLB 5FGMA 2QEXA 1KL9A 1QHHD 2HVSA 4LF5L 1NK3P 1KRSA 2F4VQ 2L0KA 1O7YA 4HJ9A 1ZGWA 3IL8A 2JA6G 2BW3B 2D1VA 1CTMA 1WSUA 4UUSA 3PO2J 1TL8A 1IBML 3T1HQ 1C48A 1SNPA 2R7ZH 5D3DA 4D1QA 3S17B 5FLXc 3CCJA 3VFZA 2ME0A 2E1OA 3OWTA 2XF5A 3CMAI 3CCUA 1HQRD 4H44C 5L3EA 5C4XJ 1WJEA 2ZFWA 2L7ZA 4A3GB 3OMGA 2WY8Q 2NN6I 4EJWA 4J19A 3QYFA 1GXQA 3NWSA 4N8FA 2SEBD 3E5SA 1TR5A 1WI9A 4IHVA 1IN4A 2VUMH 4MFEA 1SJHD 4PUSA 1SD5A 4EMSA 4WXDA 1WVRA 3E9HA 2HPMA 2H8RA 2FINB 1LYLA 3DUZA 3CF5F 4AVPA 3CMEA 3QWNA 1U8RA 2E76C 4RB3C 1DUXC 2LKXA 2EZHA 2IAIA 1HTPA 1FOKA 4JK1X 3LFUA 5K7ZA 4JOIA 4Y7NJ 1JKPC 1B8IA 1PH4A 3U21A 5H20A 1B7YB 5J3BA 4LMQD 1HHVA 3P75A 1HR0Q 4HBLA 3N05A 4WX9A 3K1MA 4MGRA 3MKZA 2E7XA 2Z4IA 4DV0L 2F0WA 2ICIA 1YW9A 2JSPA 5E8GA 1BCPD 4AD9A 1VQ9I 5DNFA 4HDUA 2L4MA 3GTOJ 1VDZA 2E5ZA 2FMLA 4Y7NH 4IUVA 3P5JA 4ZLTF 2KP6A 3HZJA 3S1NB 3PCOB 4DYCA 2EH3A 1GJXA 3E9IA 2PQAA 5FJ8J 4K8IA 2B2WC 2H6BA 3J80L 2VOPA 5D5UB 1I6HH 4HSPA 1VQ7I 2VQCA 3VDXA 1UJ8A 3GTJB 1M90C 5B3SH 3T51B 2WINB 4EJTA 3PNTA 1ONVA 2BYVE 4A3CH 3L1PA 3HOWJ 2EYMA 1UEAB 2JQ7A 2GQQA 1D2BA 2IW5A 3SHLA 3ERED 5BN3A 4LB6B 3UDXA 2IX0A 2CS3A 2F0TA 3QG1A 4QJFA 2L12A 1JWUD 4A3BH 2TMPA 4OWXB 3DXJF 1W5SA 4Y15A 4JI3Q 3F9KA 4WORA 1Y1WB 4DR3Q 4EGYA 4BXXH 1PRTB 4ABZA 2K6AA 2YU9H 1KIXA 4P74A 3HGGA 3HC7A 3CMMA 3LAJA 4U0WA 4G7ZC 4RG1A 1SBBB 1QCBD 1YZ6A 5T1GA 4B8XA 3OTOL 1IXRA 3HKZG 1QQIA 4R79A 2O5JC 3HL2A 3HOVG 1O7LA 2HYFA 2HQAA 1Y6IA 1EY8A 3SXYA 2FJ1A 2A68D 3S1QB 3GV6A 5CV5A 2P6TA 4E7SA 4QF4A 2K04A 5LMUQ 1B53A 1BOAA 3IUOA 2C35B 4HPQA 1IBMQ 4NQWA 5IGDA 2YTVA 5J39A 1D0ZA 1DPUA 1I6VC 4FE4A 1Z7TA 4A3FJ 3LX0A 5D8KB 1ENCA 1OQYA 4RAZA 4PQXA 1XCVA 2CHBD 1B4OA 2ATWA 1Y8RB 3TO9A 4M6XA 5F2DA 4EQPA 5F08A 1ETXA 2KZGA 5M3FB 4FF3A 4FYDA 3CKIB 1VQJA 4BXXJ 2CO5A 2K50A 2F52A 1DJRD 3CAMA 1AKHB 3KETA 5DV5A 1USSA 1AKHA 1RR7A 3DLAA 4UUVA 1EZ6A 2L9NA 4H4KC 1G2TA 2K40A 5IYCG 3W3AA 2JK8A 1YITI 1FZPB 4QPOA 3OY9A 1FVIA 4O0AA 4RCNA 5FLVA 2VUMG 1KDBA 4HJAA 3BZDB 4A3DB 3F23A 3S1RJ 1FMVA 3V2TA 5E3LA 3WG9A 4IFDI 2CYYA 1X2NA 3GUDA 3GZNB 1K8OA 3TP5A 4J6HA 4FX4A 3TZDA 3IAYA 2XVSA 3C3LA 1QILA 2WC2A 2LKPA 4IF4A 2VBWA 4DZPA 3LSRA 1I4QA 1SAPA 5BS6A 1ZAOA 3G1OA 1CQTA 3H9GA 4R4IA 1D6EC 1PYWD 4FASD 5D6FA 3I54A 3M3YJ 1ULYA 4BBSJ 1Q12A 3TQNA 4QIWN 2JSCA 4UB6C 3LSHA 1ZLJA 2VT3A 4KT6A 1R71A 1PH8A 3ULQB 4GFBA 3L2VA 2JJ7A 4IUPA 2RGVA 2MLGA 4A3CJ 5KAFC 1EEID 2B29A 3J80K 2GLOA 2PEXA 1Q1EA 1XGOA 2ZTDA 1FJGL 4WJ4A 2R4GA 1R4PB 2NVTB 2NAZA 3G6EI 4LAAA 1SYGA 1ON1A 3GFJA 2IX1A 5CLSA 1GT0C 3JTHA 3R60A 3SZPA 1IYJB 3S24A 2B3GA 5NUCA 1LFPA 2QGQA 1UE7A 2WAQB 4BEHB 4GLAC 5IP9J 3I3LA 2HCIA 3D31A 2HHHL 4ZKCB 1TY2A 5CYVA 5LHY1 3PUFA 3EETA 4PMBA 1Z7UA 5D14A 3FISA 2LG4A 1HOMA 1U9NA 2ZJRA 3E97A 1FP1D 2R61A 1LUZA 1CI3M 5IP7G 1SFKA 3BR1A 2DK5A 4EM0B 2EQSA 4CYCB 2DU9A 1F9QA 1OO9B 1Z3YA 3D0FA 4IOCF 4P55A 5JLXA 1SYCA 5E1XA 1H95A 2KIMA 2RHQB 2QCOA 2X1DA 1E2WA 1XTCD 2K4KA 2B2YA 2XSJC 2MQHA 1R4NB 1Y8OB 2VW9A 2B2TA 2NYZD 1PUFB 3J7YW 2KRHA 5LMUL 1NMFA 2EJGC 3CXCA 1PUFA 2E74C 3RKYA 3S2HH 4NNJA 4HX8A 4E6IA 4FX0A 1IRXA 2LY7A 2GIZA 2DA1A 1HLVA 2OAZA 1PA6A 4IFDG 1VQLA 3IHUA 1TT2A 3KYDB 3STBD 5LMNW 4LW1A 3D6CA 1UHMA 1IRZA 3SK6A 3D8GA 5KRUA 1ZHFA 1BOSA 4JYKA 2L55A 4HSRA 2WWYA 3TOAA 1ZKGA 1OMIA 1M8AA 4PZ7A 2QYOA 3SEQA 1CZGA 3N6RA 1W36C 1IDYA 1YVCA 3GTJJ 1RUNA 2QWWA 4UB8C 2O61A 3K7AH 2EYLA 4KDPA 3ZQIA 2VPLA 2RSOA 3VR5A 3DTIA 1ITYA 3CPFA 1GHCA 2RC4A 3STBC 2EYOA 2E2HH 2CH0A 3V8KA 2DMPA 3JRCA 1DD2A 4BQOA 4XRSA 3EFXD 1NK2P 2AWOA 4ODGA 1ENFA 2HDDA 1SNDA 1DDNA 2JZYA 3NUCA 2WTEA 3H0GB 2E2HB 4LF7Q 2DPUA 1J75A 2NVXB 4IJLA 3RR5A 2XC7A 1XJVA 1KQ9A 3H0GH 1T8IA 2K5HA 3S3MA 3OW2A 1L1OA 5EKLA 3H3VK 2DFIA 1W36D 4AWXB 4DR5Q 2R7DA 2DN8A 3KP3A 2CW0D 4JV5Q 3PIOA 1R4QB 4JI3L 3D5RC 2BY1A 1MBJA 1XNQQ 2J5PA 3RQ4A 1I3QB 2VXZA 2VLAA 4X0GA 2CGPA 3FP9A 4BXXG 2HS5A 1LV9A 4HN7A 2EJMA 2H5XA 4A3JG 2DA6A 3KCCA 4ZK9B 4P9UA 5E8IA 4BY7B 4HAMA 1FGUA 4OMZA 1H9KA 3PO2B 1B2TA 2LXJA 5I6YA 2M3AA 5C3WA 3CCYA 2O2LD 3QPLA 4DR4Q 3WODF 2ZXHA 3HEFA 1SE2A 4CICA 2VJJA 5ICEA 2FBKA 2IGKA 1EFID 4OWTB 3BPVA 4G7HF 3FK6A 1QE6A 4AQYQ 1SMYD 2M7AA 3HPGA 3T13A 5AJ3Q 2CW7A 4HIKA 5K7FA 2WAQG 5EF6A 2WB1A 1MIUA 1JGGA 4OWWB 3CJQB 4A93H 1RIOH 2K05A 1CQVA 4ZKBB 5I6WA 4DK6C 1RESA 3BDLA 4HLXA 3JR9A 1VQ7A 2E2IJ 2QW7A 2OZUA 1BJAA 2J0TD 4BBSG 2WIIB 4CZZA 4YIRX 1OR7A 3T1YL 2KIFA 4K2KA 3GYHX 1LEBA 3Q0AA 3BDOA 4CCKA 1YHQI 4IRGA 2L4NA 3ISPA 2BE5C 5EZGA 1JGSA 5IE8A 3SR1A 1HZBA 4A6DA 4LWCA 2X1CA 1MDMB 1JQYD 3RIRA 3R8BA 2L5QA 4EX5A 2DJNA 3MEXA 2Q8TA 2XF7A 3T16A 3CQZH 3S16J 2HOTA 4A3MJ 5EQ0A 1F43A 2RDPA 1PH3A 1IW7C 2D5DA 4BXUA 3PF5A 5ELFA 4NBQA 1TWHB 3CC2I 4DK1A 2XASA 1RF2D 4AIMA 2A6EC 1G2SA 3Q24A 4IPCA 3PM1A 1V8QA 4X66Q 2EK5A 2VC1A 4IXAA 4ZJZA 3F2BA 4EGVA 3VEPA 3QU3A 4X64Q 1A36A 2ELJA 1Y8QB 1BA5A 4RGTA 3NBHA 5B1AH 2V4DA 1HQMC 5JVGF 5E1FA 1E22A 4P73A 2CQNA 1I5FA 4I98B 4IQJA 5HLGA 4ZUJA 3CCLI 3K5OA 1TQOA 1STZA 5HDGA 3BG6A 1RD9D 1LABA 3EA6A 3GTKH 3PIPF 3M85A 3VYUB 1GUOA 3WOEA 4BJTA 2QA4A 5DM63 1EWCA 2VJIA 3NTKA 1PRTD 4DU9A 1T6SA 2R7ZJ 1ZRCA 2EIJH 2L02A 4MFDA 2B39A 3ND9A 2VC0A 2BGCA 3M1EA 3FKIG 1B50A 5GTIC 4DNRB 3GZ6A 1E2VA 2FBIA 2E7WA 4DF7A 3ONQA 3KP5A 3OS2A 2P4WA 3L2CA 4IFDJ 3VR3A 1LTBD 4L8JA 2UZKA 1QZYA 1PH2A 3T8TA 1J6QA 1IV6A 3HRUA 1F2MA 5E3FA 4RAFA 1FYMA 1X9NA 1LVKA 2CW8A 1WFQA 4RLFA 4A3KH 5E79C 1UCRA 1S7EA 1GVJA 3IH3A 4JBWA 1IBLL 3PSIA 1HF0A 3H91A 3WGIA 2BE5F 1AU7A 2L01A 2IP2A 1LFBA 4ZZDA 1TU2B 4YY3L 3C2GA 1H88C 5J1ZA 4BUPA 4LLGF 1SYEA 3TRZA 4X62Q 3L2QA 4NKLA 3F8BA 1X19A 3ZOBA 3IL2A 3X2QH 1YI2I 5C4XG 2FF4A 1JI8A 2A19A 5ISRA 5FKOA 2NZHA 1W7PA 5IGFA 4JC0A 3KZZA 2ZT9C 2L11A 4KKUA 4KIFA 1E7ZA 2KLOA 2V6EA 4IZ8A 1YJ9I 3ESWB 1FGBD 1B8AA 1K28A 3MZHA 1Q1VA 4NP5A 1MW7A 3T1YQ 2CWPA 2OCCH 1U4PA 2OF1A 1GD7A 5KNCA 4ABNA 4RS8A 4DJAA 4C30A 2X0LA 4G7OF 3GXOA 2EIKH 3DBHB 2D2CC 3HOSA 1WCMJ 1JKQC 1E17A 1F9PA 2BOLA 2MLKA 1SAXA 4JX5A 2NTSA 1APLC 3OHXC 2AWNA 2HI3A 2DOAA 3TMEA 5E3OA 4FISA 2GBYA 2RHSB 5HS8A 2K1BA 1EQVA 3EVQA 4IOAF 4LITA 3JRBA 3G7LA 2OA4A 2DQLA 4W1UA 2FJ2A 4CJ2C 3K5NA 1EYCA 2BHYA 4BBSH 2PMHA 2ES2A 1S72A 1HW2A 3ZQ7A 4JX6A 4RKLA 4XLHA 4FQGA 1TWAB 3W6JB 1YFHA 1WH5A 2R5ZA 3L3OC 4JQFA 3I55A 3HOWG 5E1WA 2RKSA 2KRCA 5EBCA 3RZOB 2V1NA 4LFCL 1LPQA 1JT0A 2F0NA 2XRSD 3CUOA 3FBIB 4M3DA 6PAXA 2UXBQ 3OYIA 2R93G 2UXDL 3NEUA 2IS6A 3REOA 2X6LA 4KI0A 4XT1B 2LF8A 1S3JA 3I59A 4GKKQ 4JI8Q 2LMDA 4G6QA 2AO9A 2H94A 3OYMA 2Z3YA 2KJBA 1A6IA 3WU1B 5M5YJ 1E3HA 2DK8A 2HXOA 1IZ1A 4RA8A 1YJWA 3ONAB 2PZWA 4DXGA 4JBAA 1FC3A 3VPRA 3S2WA 2JMWA 2R7XA 4KITB 2MO1A 1YIJA 3FDYA 4DPGA 2WAQE 3PFIA 1IRFA 3Q23A 4MQVA 2F0GA 3DEUA 2RN7A 5LHGA 1NAPA 3RQIA 1E2ZA 2F3VA 2RKHA 1VQOI 3ZMTA 4EVOA 2GAUA 3WU0A 4XRFA 4LJZF 4D9JA 2K4JA 3K5MA 5K5OA 1KNAA 4GO1A 1PH9A 1YITA 3GTOH 1K4TA 2D0PA 3QP6A 4GNXB 4YY3Q 1XDSA 2N49A 1C0AA 3KPHA 3W6VA 3DV8A 3K1NA 2E2JH 3OYHA 1GM5A 1PTOC 2A69C 1V5EA 2XF6A 2RNJA 4Y33A 4U0VA 1N78A 2IGOA 1VTNC 1NJIC 3L2RA 1MD2D 2P0WA 1FY7A 5FOBB 1HKTA 1BKBA 1W6KA 1G4DA 4HAEA 2DODA 2MGQA 3D3RA 1XC5A 5J1UA 4E7KA 3KLWA 1WVLA 4KN4X 4XQNA 1EH7A 2M87A 2XAGA 1ILQA 1BR1A 3V8LA 3ZJYC 5IODA 3OOPA 1TP4A 4ESFA 2LS01 1S9HA 2LY9A 2X6WA 2WACA 3KIOA 3SYTA 1EYGA 2R0QC 2SOBA 1QVTA 2KCMA 4BY1H 1Z67A 5JFRA 5ELDA 1WTXA 3OYKA 1I5ZA 2NS7A 2CQOA 4BDYA 5K36H 2L7MP 1L3LA 1G6PA 1E0BA 1IBKQ 3A7LA 2G9WA 3OR2C 2X48A 4M73A 5E7NA 3ZGKA 1P4WA 4JI0L 1SNMA 1U78A 2EY1A 2F0IA 2UUZA 4I65A 4YHHL 2YX7A 4L0YB 2LFBA 3U1DA 4BY7G 3VYTB 2O9LA 1CHQD 2Z9OA 3LWEA 2X85A 4LG0B 1V1PA 1PP8F 1YHAA 2XHKA 2YPRA 2NZOA 4ZDLA 1XNRL 1LM0A 1C0WA 1N36Q 1FIAA 1LT5D 2DQRA 2A6EF 3ZCOA 2EPBA 2G5DA 2OCEA 4DYQA 2N55A 2JA6B 5M9OA 1MNEA 2KECA 4IUQA 1EU3A 4KTAA 1ASYA 3P9CA 2JA6H 2NUCA 3UNGC 4ETSA 2JN4A 3NWTA 5FO5A 1MGTA 1H0MA 4XOTA 1MKHA 1GUWA 5COYA 3RYRA 4I0AA 3TP0A 2NVTH 3M9BA 5EEAA 1Z9FA 1S5FD 2M9HA 2ME6A 3T53B 4HCSA 1S29A 3ZQCA 1ZG3A 3BU2A 4RBOA 1STGA 2XPUA 3CZ6A 5IGBA 1X1CA 4BAYA 3DPUA 2BXZA 3RUZA 4KUMA 3R0AA 3CRLC 2L1BA 1WKMA 2QSHX 4DV6Q 2MJ8A 5J1RA 3CRKC 3A0HC 2PFBA 1WD1A 1BVSA 2DNEA 4GZYC 1CK1A 2LLKA 1P2FA 1BW6A 3OSOA 2QSFX 2QEJC 2VONA 2E5LQ 2CSOA 2UUCL 2OUMA 1LJ9A 1IN5A 4NXNQ 2ZJQA 2RV8A 1S72I 2XN9C 3FVQA 4L6TB 3MAQA 3FDTA 3RZDJ 1T98A 2E1MB 4UHTA 1HW1A 1ZYRC 3GTQH 3X3MA 4HEDA 3BYYB 1SFUA 3DTEA 5CVRA 2A68F 2VY3A 1R4MB 1XWEA 2ZSIB 4L5SA 4S04A 2CVRA 1D3YA 1WYDA 4HF1A 4EJOA 3LL7A 3TSSA 3OW7A 4CJ0B 4TSSA 1RTOA 4YIJA 2VQFQ 4XKBA 2D0OA 2VJ5A 2F48A 2E19A 1CKNA 2PPBC 3TGNA 2M45A 2KRFA 5C0XG 3HGBA 1FOYA 3WTSC 2O7OA 1RCVD 3L2PA 2NS8A 2QKIC 4K0KQ 3IWFA 3EBEA 2PMUA 2JQOA 1ENAA 4L5QA 3HOZG 3I4LA 1ONLA 3AFHA 3HKZN 3K6OA 2K85A 3K7AJ 3A03A 5IOCA 2VQGA 5HURA 1K83J 3K70D 3HSEA 1PYSB 2DJIA 4D7MA 3QQAA 1HCZA 3DWPA 1BBWA 3ZMVA 4BE2A 2DUDA 1O57A 4A93J 2HQLA 1F5TA 2ACJA 5K36G 2R92H 4FXGC 3PNVA 2L3DA 1J2XA 3CJRB 2PJPA 4FXKC 3DWLE 3FZVA 5H6QA 2K75A 3MAJA 1GHKA 5C3XA 2XROA 3A5UA 2EIMH 3K10A 1UE6A 5D6EA 3AL0C 2TDXA 2IT0A 1X2MA 1QNKA 3OL3A 3DLLA 1I39A 1FOWA 3CCQA 3HOWB 4X64L 3RKXA 2V7FA 2HD3A 2QILA 4LK1C 3FXUA 1BIBA 1ZTRA 4L18B 3IP4B 1HRJA 3H3ZA 2EPFA 4R4QA 3DMUA 1BOBA 1UHSA 3R2TA 2Z9HA 3GTPH 2V1DA 1PUEE 3S16H 1VS0A 4UAIA 3Q5FA 1SD4A 5AONA 4DGZA 1RKNA 2M2EA 2EV5A 4PGGA 1QWYA 4FNFA 3IV5A 3GFMA 4ENKA 2VKEA 4PZ8A 2GM4A 4KHVA 2J5OA 1A5JA 4PJNA 4ZZLA 4B3MQ 1QVGA 4A3BB 4FF2A 5KGUA 2HYGD 4ZUIA 3GMEA 4N0BA 2KHSA 1LT3D 2F03A 2F0LA 2H09A 2E2IH 1X1DA 1LDJA 4LFBL 2NXNB 1Y8NB 3J81i 5C5LA 5J40A 4JI5L 1SROA 5AIPA 1C4QA 3F21A 3M8EA 2M5WA 4CHUA 5B5EC 1D1KA 1JJCB 3BC8A 1XS9A 4A3JB 3NHHA 1S7AA 1XSDA 3CJTB 5LMNQ 2TRTA 4DUZQ 1SFEA 2CV2A 4UDUC 5I9PA 3S14J 2LVSA 2KZVA 1AZPA 1HUNA 3WG7H 4RHSA 1H9TA 3BZKA 3BTJA 1BBYA 1HA8A 4DR6Q 1D1BA 3CCQI 2VOOA 1CQFA 4YIFA 1VQEA 3SZGA 4DOZA 1JWMD 1SD7A 4YRVA 2M0CA 4L9TA 1EH8A 3MKYB 4A3LH 3K6GA 1AW7A 1SDFA 3A74A 2GA1A 3HOVB 2N8NA 1MD0A 3K0YA 1FYCA 1J8IA 2I8DA 3IAS2 3J7ZC 1B1BA 4NUBA 3NPPA 4YWLA 4D5FA 1JHFA 2M1BA 1VZ0A 4UHVA 2HUGA 1YIOA 3QODA 2M2LA 4XIDA 3CC4A 4M6YA 2A8VA 1W6JA 1Q1HA 2V9PA 1XB4A 3A4CA 3TP6A 4WXCA 2E2HJ 1BQQT 4HMJA 1KZHA 3BZCA 5C3EJ 1OXVA 3M4YA 2ESHA 3Q0WA 1Z6HA 1WRJA 2VS1A 1AZQA 2HPIA 3F8CA 2WB1N 3GO5A 1JUSA 4OELB 4DGWB 1TT0A 4MTEA 5TJJA 3OMYA 1RJTA 1E0EA 3QU6A 3FM3A 3OWFA 2ESNA 5FFZA 3HUGA 3ZMSA 4UVCA 4UNOA 1IGNA 1IN7A 5M5XJ 2F4OB 1PFMA 3SEBA 2NVYB 4JBMA 3SDBA 2CFOA 3C46A 2K9QA 4L63B 3HB9A 3JRFA 4BDZA 2X6OA 5IOYA 4ZC3A 2ZB9A 2LDUA 2BA0A 4LG0A 1LDKB 3RLOA 1N34Q 2WBMA 4IL6C 4MTDA 5A35A 2JA9A 3QP5A 2NVYH 4BJ6C 2FX0A 3CESA 1RKWA 4AIDA 4X62L 3OOUA 1CKNB 2CV0A 3SXHA 1TW3A 2XGDA 5K7HA 2EXZA 4AIHA 2WV1A 3HSRA 3A8IE 4OOIA 4KHPQ 2KHIA 2LK2A 3P9KA 1Y39A 2VBXA 3JC66 3S3OA 4HF2A 2DY8A 3OYFA 5FO9B 1KAAA 4Q0FA 2L7FP 5E4XA 3M4OH 2BDOA 3MZ5A 2YX4A 3ERSX 3RZDB 2HQNA 4A6EA 3CJNA 1J09A 2FHTA 3SQNA 4B3XA 4JW0A 3G48A 2ADUA 1EV7A 1O7FA 1U8BA 1RDPD 4A3EB 2V26A 5CVUA 4XQJA 1DGWY 2L0CA 1CFMA 2ZJRF 1FBUA 1A6QA 1I94L 4E7LA 2W48A 1TNTA 3W3CA 1SE8A 4A3KJ 2A73B 4JBJA 3HYIA 2F2EA 3OYNA 1EWHA 4EJUA 1T38A 2XRQD 5BNGA 5LBQA 5EG0A 3I2ZA 4R4TA 2WY7Q 3VYSB 1X56A 4HEA2 4ENJA 3I4MH 4XK4A 2COBA 1GVDA 3ROUA 2DA7A 1ETOA 2SDFA 3I56I 2DCEA 1AHDP 2PYKA 4RB2C 3NQTA 4A3MH 1EKEA 3RPUD 1AFPA 2F0QA 4POFA 3D4WA 1MZBA 1XYIA 2LBFB 3EUHA 2UV1A 1KU7A 4DR6L 4XLCA 4DR7L 3BR2A 1K78B 4XKCA 2G0EA 1IYUA 3D5SC 2DMUA 2XKOA 2LY2A 5IP7H 2PW5A 4JI2L 1LNWA 1R58A 1S5BD 1WCMG 2NRAC 3E5XA 5IOZA 4U0YA 3CCVA 1R36A 4HMIA 5D5WB 2FNAA 4QUCA 2BH2A 3WHBA 3PQJA 1VQPA 3WTVC 1VQ9A 1UZCA 4LF4Q 5C0XI 4DR1L 1YJNI 4CDDC 4KJNA 1A3UA 2DBBA 2MA3A 3TL4X 2KKOA 3T5XA 1BI3A 2EA4A 4CKEA 3C2BA 1RR8C 1EIHA 3ERQA 2EFNA 4XYQA 1U9RA 2IA1A 1TKWB 3S1QJ 1MBFA 3HJEA 4RGRA 2XGCA 2KA7A 1YHBA 1FSHA 1E2XA 3H5AA 2W25A 5C6AA 3RZOH 4ZAIA 2HFHA 5GAHC 5M5XB 2HT1A 4B3SQ 3CD6I 2PJRB 4A12A 4AM3A 3S1RH 2F5FA 1REPC 4MHGA 5DS9A 4A3BJ 3R61A 4C9YA 2VL6A 4M74A 2KEEA 3OMCA 1KNEA 3SVMA 1OYIA 1D5XC 1KD1C 1AP0A 3KF6B 3BROA 1CUKA 2E2IB 4R4OA 1Y1WG 5C4JH 2NNYA 1YS7A 2NS0A 2Y0SB 2CQ7A 3F1ZA 1G3TA 2I5HA 1UG2A 2XPWA 1G3YA 4DA2A 3KP6A 1N8RC 3CLOA 2E2JJ 4IQZA 2GIVA 4L9NA 4OMYA 1LO5D 1BC8C 4DNCA 2K5QA 5HODA 3K5LA 3DFGA 1K83B 2EYHA 2PW7A 3EQLC 3KLSA 2CQAA 4V190 4H02A 2OBPA 2HQEA 1QPMA 1STBA 1TWFJ 2ID0A 4ZQ3A 2EBIA 4BXFA 1R6RA 1MMSA 3NTIA 4X65Q 4PJLA 5IT3A 2E2JB 3TN2A 1BUVT 3WTYC 1G91A 9ANTA 4YFNF 3MXGA 3H5NA 1VMPA 2JA6J 4JBKA 2ZMEB 1SD6A 2DXIA 4LF7L 3NQOA 4CKBA 3I73A 4PDKA 1ORKA 2NOJB 1X32A 1GUTA 1T33A 5L3FA 4LIUA 1D7QA 4RGUA 3VDYA 4UP8A 4XMYA 4IQ4A 2R93B 2IHFA 4OGQC 2Q8RE 2LBFA 1QZGA 1LTSD 2EZVA 2VZAA 3KLNA 2G7HA 5IYDG 3ZQFA 1EQRA 5JVG3 1R1VA 4RCOA 3URYA 3E5QA 4C2MJ 1XNRQ 2D9UA 1TS5A 2B2TC 4JPBW 4OEMB 3FRPB 5KIXA 1VQIA 1SYBA 2EIFA 1X3UA 1I94Q 4HA8A 1PH7A 2OJED 3PIO3 1FNWA 1AEXA 4PK4A 2E2DC 2AXTC 1K3RA 2PZUA 3A56A 1W5CC 4GCVA 3BJUA 5L3BA 1CT1D 4DN4M 3TP7A 5GAEC 3IFTA 4LF4L 5J8CA 2GWRA 1R1TA 4X3KA 1B72A 2X51A 3DU5A 2BH8A 4XOPA 4TKOB 1D8KA 3GTMH 5E18F 1LE8A 2A6ED 4YWMA 3G6EA 2JA5G 1HUMA 1QG7A 5LLQA 2ZXWH 3FXJA 4QGUA 1ASZA 3PNYA 4S0HB 2R3ZA 3CO6C 2V9KA 3H09A 4K6LA 1YQAA 1RUOA 2HZTA 1WQ2A 3DPTA 4ZCKA 5CV7A 4F7XA 2FUG2 2R3SA 4S3SA 3FK7A 2JPCA 1VQHA 3GTMB 1VQDA 3AEVA 2HKOA 3L9FA 3C1FA 4LJZC 4C3IB 1NBWA 1QVUA 3RZDH 1JE5A 4DK0A 1PTOB 4MZ9A 1KQSA 3PMFA 1KABA 2P6SA 4A5NA 1GUGA 3TDUC 2BEOA 4FDBA 1BL0A 3V7RA 1R9TJ 1SYDA 4A3IG 2QQBA 2CWAA 3CCSA 5JVTA 5GAHJ 1TNSA 3IH4A 2A6TA 3CHBD 1ZG5A 1A62A 2VB3X 1MH3A 3G73A 3KF8B 3EDPA 1XSVA 5BPDA 4JI1L 5I9OA 3ZQGA 2HOAA 3GZ5A 3FX3A 3E6ZX 5IP6A 3QOPA 1SYFA 4OWRB 1O3QA 2F0UA 4CUGA 1UWVA 2B2UC 1N32Q 3ZQQA 2PMZE 4FCYA 3LFKA 2IGNA 2UU9L 3H94A 1A63A 4BA1I 3HOXB 1NG7A 4DAYB 2XGEA 2Q2TA 4A3MB 3ICEA 5CGKA 2FMCA 3V8JA 1HDPA 1XPUA 3P20A 1R5ID 1ZK8A 2EY2A 4RFBA 5DM73 1BF4A 5CYUA 3HKZE 3R93A 2R5ZB 3I64A 1YEZA 3MWMA 5HNHA 5HLTA 1MSHA 3TZUA 4G7HC 5HGQA 3K4MA 5L37A 4DBQA 2AHOB 3KFUA 3I59B 5IGCA 4BH9A 2AMCB 1ETWA 3A55A 3J80Z 1BNZA 2Q8IB 2IJ0A 3ABLH 1P7IA 4AYBB 4OIRF 3KLRA 1XX8A 2F6CA 2B63J 3ER0A 4XONA 1T5EA 4A93G 5ERIA 2LMCB 4PCQA 2Y30A 3TBIB 1LT4D 3IAM2 2MP1A 2QQ9A 4DAVA 4Q48A 4BHCA 2VUMJ 4QSHA 4O3MA 2HEOA 1HCRA 3PL8A 2IS4A 1TWGH 1GUUA 3LSIA 4A3GH 2ELHA 5FRNA 3PO3G 4IOAA 2CUFA 3KDFA 3CCUI 3H0GG 4TQUS 3HOVJ 5JHFA 5JR3A 1ZARA 3ZQLA 2D1HA 1XG1A 1POGA 4QUFA 2HXIA 4J15A 5GADJ 3MHBA 4P71A 5KCMA 2F1MA 4CDFC 3VYUA 1F2LA 3WHCA 3O2PE 3EQLF 4A0ZA 5IP9H 1WJAA 1DYQA 1W0TA 3MWYW 2STWA 1EY6A 2R5YB 1KTKA 3SFZA 3S14H 1Z91A 2DAOA 2R93J 2VIXA 3U4ZA 4LUOA 1R7JA 3FPUB 3S1QH 1R5HA 4GYGA 3E7LA 3OYEA 1T95A 4I02A 1H9RA 3PIP3 1YIJI 4PFPA 3J80E 4GDFA 4O5VA 2NOGA 4EM2A 2R92J 5I4DA 1KYWA 1VQLI 4KMUC 4A3LJ 1N34L 1FL0A 3RPQA 4WJWA 3WTWC 1A0IA 3CU7A 2JA5B 2K5NA 1JCKB 3MFGA 2PO4A 2FE3A 5LHHA 3HOUB 2EYFA 2MABA 3RSNA 2ELKA 1G59A 1EEFD 2KHJA 3KF8A 4IFDH 1ESFA 1HH2P 3HP3A 2LRDA 1W1WE 1H9JA 2NVQJ 3TP3A 1OCCH 1STAA 2A07F 5CV9A 3GEZA 3GDEA 5KK1A 2DT5A 4Y4RA 3P9IA 5FKMA 4K5VA 1XTDA 3NARA 4UPAA 4DBRA 2VE9A 5CV6A 1O80A 3NBIA 5D5XB 4LMYA 3FPPA 5F27A 1WCMH 2L9RA 4BGDA 4NB3A 1JJGA 4HF0A 4ZYHA 2JA7H 4ZYGA 2Y9YA 3IRRA 2IBDA 3HKZA 1AN8A 4LF5Q 1LB2A 3D4DA 3N97A 3KBGA 5FB2A 4G9YA 4PMWA 1BJZA 1J5EL 2XRNA 1PRTC 4F52A 3G4SA 4DNIA 3J7AO 1BR4A 4C3IG 3DQVC 4ESBA 5C3EH 3S17J 1HZ9A 3W2WA 2EQRA 4LUVA 3GTGH 3BTCA 2O0YA 4GLVB 3RLNA 2HVRA 4OL7A 1YJ9A 5FROA 3GBGA 1VQ5I 1ZLKA 1BR9A 1NE3A 1T9HA 5KYLA 3M8JA 3CUQC 3A2KA 1EUJA 4KIGA 2J4XA 1Y0NA 1B8IB 4PFOA 2LP0A 1ETVA 4LF8Q 4M8AA 2IY5B 1HFNA 4KMFA 2NYXA 1CA6A 2IX3A 2B2VA 1GDTA 4I0BA 4OXPA 3GLXA 4BNCA 4UY8I 4DV5Q 5IP7J 1O3TA 3GFLA 3Q0VA 2IW3A 5E3MA 3Q8DA 3TREA 4I76A 4HIDA 1B59A 3L7WA 5J1YA 4ZRZA 4LK0F 1LQ1A 4CZCA 4JOMA 3UE0A 4IO9A 3OYBA 1P4AA 4Y17A 4MIUA 1TBXA 2ZXOA 5D4SA 1W5TA 2F4MB 4B43A 2Z99A 4HRIA 2DJGC 4L5IA 4F8MA 4JCVE 4AQYL 2BA1A 1HJPA 1WJJA 3K58A 1Y56A 4IUTA 4JI8L 5FO8B 3AFPA 4XDXA 1IUFA 3CCRA 3A02A 2RDHA 2MFZA 3HTSB 3QOEA 2JVHA 2YV5A 5JPNC 2WAFA 3J7A5 2K28A 2W1OA 1VF7A 3SJMA 3NQIA 4BBRH 1HQCA 4P5OA 1WFXA
chains in the Genus database with same CATH topology
3QYBA 2JYOA 1Y1VB 3S93A 2XIWA 2CUJA 4CBVA 1ILQA 1EY5A 4XL9A 1BR1A 1YNNC 2I46A 3M1CA 2VXDA 4TRDA 1MMNA 3VWBA 5IODA 1Q90A 4ZDOA 3MD2A 3SE0A 2JE6I 2LS01 1S9HA 1BO0A 2X6WA 3HOTA 2WACA 3NSWA 1TS3A 4MHEA 3L2WA 3SYTA 2A6HD 4BACA 2SOBA 4BS9A 5ELDA 3VSLA 3MXPA 1WTXA 3OYKA 1EA3A 5A2QE 5D65A 4FXDA 4HG2A 4BDYA 1STEA 5K36H 3TBIA 2W4SA 1EY4A 1E0BA 3H5RA 3OYCA 2NN6G 5CBAE 3S16B 2XNAC 3A7LA 3SDZA 2D62A 3OR2C 4LIVA 1BCPB 3DPLC 3ZGKA 4B48A 2KJXA 1SNMA 3PUWA 4XLAA 2F0EA 2EY1A 3L2UA 4B44A 2K01A 2F0IA 2K3PA 4RHRA 2WB1B 2UUZA 2K5CA 4P2CB 3AKZA 4I65A 1TZLA 3MKWB 2KQRA 3MXUA 3VYTB 3I8ZA 2EY6A 1V1PB 1CHQD 1YE9A 3LWEA 2X85A 1V1PA 5DAUA 3QYEA 4ZDLA 3KUPA 3GTQB 3VYRB 1ZEQX 1LT5D 3M3YB 1QOHA 1OXUA 3ZCOA 2EPBA 1WTQA 2RBMA 2A74C 1M4VA 2N55A 2JA6B 3FMCA 5M9OA 2IS1A 4RGMA 1MNEA 4FF4A 2KECA 3KBXA 1I6HB 5A2QL 4IUQA 4XXEA 3Q22A 1EU3A 4KTAA 4PJJA 2SNSA 1WJBA 4RAUC 4NC7A 2NUCA 4K14A 1G8XA 2EJFC 3UNGC 1Y69U 3K59A 4FF1A 3NWTA 4XOTA 1GUWA 3BDCA 3HS0C 3S8PA 5COYA 3K4CA 5EKIA 1WCMB 3I90A 4ID6A 2R7TA 1EZ8A 2K33A 4DIQA 1UAAA 4CCLA 2OV7A 3KYLA 5E4WC 4IX7A 1S5FD 2A5WA 2R7ZB 4NW2A 3FKJA 1TWFB 4B47A 1WJFA 1U4MA 3AMUA 2B8FA 3T53B 4HCSA 2JA7B 4CGYB 3I91A 1OR7C 1EY7A 3SK5A 2LKVA 1V5GA 2R92B 1STGA 3BCAA 3M4OB 2AQ3B 2JSOA 2MUYA 3A8JE 3OS1A 3HXLA 3CZ6A 2AQ2B 1X1CA 5IGBA 1KLGD 3DPUA 3GTGB 2IXSA 3RUZA 1N77A 4NMZA 3CRLC 2L1BA 3CP2A 1PTOF 4BEHA 4E7ZA 1D5ZC 2MJ8A 2O5IC 5T1IA 4R9WA 3CRKC 5JAVA 1WD1A 4XORA 3CP8A 2DNEA 4IN3A 3TDQA 4GZYC 1CK1A 4ULLA 3OSOA 3HOZB 1MSGA 2QEJC 3QOJA 1YNJD 1SNQA 2EE1A 4HCEA 4XLFA 2JXMB 2OUMA 1D0YA 1WTPA 3M7NA 5KNLA 2WP8J 2VASA 5C4ZA 5CMDA 1SE4A 5CV8A 3S2HB 2XN9C 3FVQA 4L6TB 3MAQA 3FDTA 4H7BA 4E6KG 2E1MB 4HNTA 1O7ZA 1ZYRC 2R7SA 3QO2A 4OO1I 3X3MA 4HEDA 3BYYB 2X6YA 3DTEA 5TSSA 1MMGA 5EKKA 1XWEA 2ZSIB 2A6HC 2CVRA 2LC2A 3O13A 3LL7A 3TSSA 3OW7A 4CJ0B 4NQWB 2G9DA 4CCMA 2KHMA 2BVLA 4TSSA 4M1UB 1RTOA 4QIWB 5C5MA 3BVMA 4YIJA 4XKBA 1BDOA 2Z8LA 2VJ5A 5FKAC 3FEWX 2PMZA 1V43A 2PPBC 3T56B 1H9MA 3J81E 1SJED 5C0XG 3HGBA 1RCVD 3DEEA 3HPHA 1MI2A 1S5CD 1OLTA 1BCPC 4BBSB 1FNUA 3I4NB 1EY9A 2QKIC 5ELEA 4KJZA 1UUPA 3NTHA 4F3QA 1IKMA 1ET9A 2BVMA 2HDMA 3MMYB 1ENAA 3TMOA 4G57A 3I4LA 1ONLA 2AQFA 3AFHA 3K6OA 1JICA 5IOCA 3A54A 2VQGA 5HURA 1S5ED 1IYVA 2WAQA 1UNSA 2R6GA 2VQLA 3K70D 1PZJD 2QKMB 2IL8A 5IGGA 2DJIA 4C2UA 3T4AC 3RD4A 1HCZA 4F55A 3RMHA 3DWPA 1D5MC 3V96A 4BE2A 5JJZA 4X3TA 1BBXC 5K36G 3I3CA 1CZWA 3QJYA 1WTWA 3VR2A 2QKLB 4FXGC 3PNVA 1QHHD 3CJRB 1DP3A 2HVSA 4FO2A 3D6WA 5EPJA 5M5WB 4FXKC 3DWLE 3J81L 4E7IA 1O7YA 4ZTJA 1GHKA 1Z3XA 5C3XA 3IL8A 2BW3B 4RH6A 3K10A 1CTMA 1WTVA 1D0XA 3AL0C 2L5TA 1ESRA 3G2BA 5JEAG 3H35A 4XQFA 3U9OA 4NDXA 2RDFA 1C48A 1SNPA 1ML0D 5D3DA 4D1QA 4FVMA 4B08A 3S17B 3K4NA 5G3LF 4XM3A 3S9WA 1DCZA 5CQEA 1JE4A 1QNKA 2F0OA 3OL3A 3OWTA 2XF5A 1Z7LA 4EATA 3HOWB 1HQRD 3GTOB 4H44C 1WJEA 1WTOA 2V7FA 4XN0A 4A3GB 3OMGA 2V4JC 2QILA 4LK1C 3ITPA 2F4IA 2WY8Q 2M7BA 2NN6I 1C8CA 3IP4B 1A2UA 2QCPX 1HRJA 4KY6A 1R9TB 3QYFA 3NWSA 3S15B 2SEBD 3DMUA 1BOBA 2VQHA 2SNMA 3JAML 3R2TA 4HSTA 3E5SA 1TR5A 4ZYAA 3OIPA 1SJHD 3VSKA 4CCJA 3F2UA 2KUMA 1CHPD 4PUSA 4UAIA 4BQQA 2HPMA 2FINB 3DUZA 5HOOA 4C2TA 4DGZA 3QWNA 1RKNA 2E76C 1IL8A 1QWYA 1K6YA 4FNFA 1STNA 2A68C 1HTPA 4C2MB 5EPLA 3K4JA 4KHVA 4N4OB 4PJNA 4G6TB 4A3BB 3LFUA 2CW0C 1CM9A 4FF2A 5KGUA 2VNUD 3U21A 1F2YA 3GTLB 4LMQD 1HHVA 4ZUIA 3P75A 2KHSA 1LT3D 4A3IB 2F0LA 2F03A 3KK7A 3N05A 1X1DA 1Y8NB 3MKZA 4X3SA 1SAUA 1A6XA 1BR2A 2Z4IA 3WOFA 5C5LA 2F0WA 2ICIA 1C4QA 2JSPA 1BCPD 5DNFA 1VDZA 2E5ZA 1D1KA 3BC8A 1YX5A 4BWGB 4IUVA 1N75A 2AUKA 4ZLTF 2KP6A 1OXTA 4A3JB 3NHHA 3S1NB 3RTRA 4BE0A 1X4OA 4DNTB 5HGTA 1GJXA 2CV2A 4K8IA 2B2WC 4PSWA 4UDUC 3H0DA 5I9PA 4XYOA 2KZVA 3J80L 1AZPA 1HUNA 3N52A 4HSPA 1STHA 3VYRA 2VQCA 3VDXA 4RHSA 5G3LD 3GTJB 3ZYYX 3ZRGA 3T51B 2WINB 4AVZA 3AU7A 1SMYC 1HA8A 1D1BA 1CQFA 2R7WA 3PNTA 4DXFA 3SZGA 1WJCA 4DOZA 1JWMD 4F92B 4YRVA 3MKYB 1ICWA 3K6GA 1AW7A 1SDFA 3HOVB 4RKBA 2EYMA 3K0YA 1FYCA 4A3KB 1J8IA 1UEAB 2I8DA 3IAS2 5I2YA 1D2BA 3SHLA 4NUBA 5BN5A 3NPPA 3S3NA 2RQQA 1VZ0A 5BN3A 2HUGA 3QODA 2M2LA 2F0MA 2KVMA 2NZ1D 2IX0A 2CS3A 2F0TA 4J00A 3QG1A 1W6JA 1S4ZA 2L12A 3LSMA 1SE3A 3A4CA 3PUBA 1JWUD 5J22A 3TP6A 4CA0A 4H13C 5FO7B 2TMPA 3VA7A 1X1AA 1BQQT 1QJOA 1JWSD 4HMJA 1H9SB 1GXDC 5ELBA 3F9KA 4WORA 4CCNA 4U7BA 5AFWA 1Y1WB 1EL0A 1OXVA 2E60A 3AL0B 1PRTB 2KOLA 1TY0A 2K6AA 2KCCA 3M4YA 2F0HA 1KDCA 1Z6HA 1AZQA 3DKYA 3OR1C 2HPIA 3SK8A 4CHTB 3GO5A 3HC7A 4DGWB 1TT0A 3CMMA 3E0JB 3OMYA 1RJTA 4G7ZC 1E0EA 1SBBB 3EUHC 3OWFA 3E0JA 4NC8A 2F0PA 3H9QA 2GOXB 1QCBD 1MNDA 1OXSC 1PFMA 5T1GA 1MGSA 3SEBA 3KLSX 2NVYB 3SDBA 4R79A 2CFOA 2O5JC 1NR4A 3C46A 3HL2A 4L63B 1O7LA 2FMMA 4BDZA 2KCNA 2HQAA 4ZC3A 1Y6IA 1EY8A 2PJRA 2A68D 1JB3A 4RMNA 2BA0A 1LDKB 3DEOA 3S1QB 3GV6A 5CV5A 4E7SA 4QF4A 2K04A 2WBMA 1B53A 2JA8B 2NBFA 5A35A 4BE1A 3I9V2 1Q8IA 3A8KE 3IUOA 4YELA 4HPQA 4KHZA 5IGDA 3EROA 5J39A 3PUYA 2RSNA 1D1CA 4BJ6C 3CESA 1D0ZA 3FBNB 1I6VC 4GRIA 1Z7TA 3LX0A 3A1YA 3OOUA 1ENCA 2CV0A 4PQXA 3SXHA 2CHBD 1B4OA 4Y7NB 1EIGA 5F2DA 1PYVA 2KQ3A 4EQPA 2EXZA 5D3IB 5M3FB 3VR4A 1IHZA 4FF3A 4FYDA 3CKIB 3A8IE 3CF2A 2Z1CA 5I2XA 5IIFA 2PCFB 4KISA 1DJRD 2E75C 3S3OA 3KX2A 2DY8A 2KEDA 1ZYRD 3OYFA 5FO9B 3Q6SA 1KAAA 4Q0FA 4ILWA 4BQNA 3K4BA 2K9MA 4F88A 3DLAA 4LG3A 4Q5VA 5E4XA 1EZ6A 2L9NA 4H4KC 1G2TA 3BS1A 2M00A 2BDOA 3W3AA