3HG9A

Crystal structure of putative pilm protein from pseudomonas aeruginosa 2192
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
119
structure length
119
Chain Sequence
b'LAEVDTLARSLLLYRSRLAEYAHANPGFSGSPADSALGLPAWFRKPVRLQGYIAAGTSYAFIASPPAGLAAAVDTGTESDLVGVRRNGQLVTRRLGATAIALPAPIPEGAVVAVKEGHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PilM
publication title CRYSTAL STRUCTURE OF putative pilM protein from Pseudomonas aeruginosa 2192
rcsb
source organism Pseudomonas aeruginosa
molecule tags Structural genomics, unknown function
total genus 16
structure length 119
sequence length 119
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-05-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1170 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3hg9A01
2.40.50.380 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3hg9A02
3HG9A
chains in the Genus database with same CATH superfamily
3GTJH 3K81C 3PF4A 1CHPD 3PO3J 4YFNF 1OXTA 1Y8QB 2JTVA 2KKOA 5GADC 3GTLB 2ID3A 4DV6L 1BBWA 3JRDA 3NELA 1SRUA 2EZHA 3PO3G 3A8KE 3I3CA 4KY7A 3G4SI 1YX3A 4JI8Q 4BE0A 1PYSB 5GAEJ 1YJNA 4AVPA 3G6EI 4RM3A 3WTUC 3X3NA 1BCPC 3RPUD 1GT0C 1WVLA 2GOMA 1HDPA 1EUJA 1OPCA 4Q0FA 4M72A 5E4WC 3NHHA 1AFPA 2XWBB 5IGFA 3FKIB 3B6CA 3EUHA 1S3JA 1CQFA 1YI2A 1XDUA 3A7LA 2PI2A 3K5LA 3CU7A 2DYRH 1CZGA 4N9HA 1MDMB 1B72B 5KYIA 5F27A 5IP9J 5A2QE 2MD0A 4CDDC 1ENCA 2EILH 1GXPA 3CCUI 3BROA 2SOBA 2W00A 3JAMZ 1ESFA 5IT9Z 1N34L 4G94A 3D0FA 4KKTA 1PRTF 2JN6A 3ERMA 3D31A 5LMUQ 5IP9G 3KP5A 1FYCA 1MBHA 2D1VA 4HIKA 2VKVA 3H94A 3W2DA 5IWAQ 1JKOC 3VA5A 1AZPA 2PLYA 3CUQB 2KEDA 2NS0A 5ICCA 3I4MB 5GROA 1YNJD 1ICWA 2DK5A 2WAQA 4TVAB 1UFMA 2GAUA 4NQWB 1U0JA 2DXIA 4NXMQ 3NENA 1KL9A 1VQOI 3CCLI 2ZB9A 1NCVA 2DFEA 4LD5A 2DFFA 3W1BA 3AG4H 4G6QA 2XGTA 2KZVA 4BDYA 2QCPX 2R7ZB 1QA6A 1EFID 4L5JA 3CAMA 3HOVB 3ZMTA 1RR8C 4HMIA 1GHKA 4B4CA 3QU6A 4M8AA 2ZFWA 5CORA 3J7YW 3H3VI 4FISA 4UP7A 2UXCQ 3ZPLA 3MVPA 2RSNA 5C0XJ 2FMYA 3PUBA 1X2MA 4A3MB 5E3OA 4C3IB 2HCIA 4A3BH 4O1NA 3RQIA 2A19A 1WZ2A 4FX4A 1RZ4A 4BJTA 3ZMVA 5C0XG 3QPLA 2HNHA 3VR5A 3AB9A 3T8RA 3W6JB 1JOOA 3SK5A 2TSSA 5FKAC 3HUGB 2ELKA 3MEXA 1OCZH 2G9WA 1SYFA 3RZOJ 1YJ9I 4G7HC 4AIHA 3VODA 4A93H 4DA2A 4KDPA 2QYOA 1E7ZA 4KN7X 1F1ZA 1EV7A 5EBCA 3K1NA 2DUDA 1MW7A 1HUNA 2HD3A 1WTPA 1LT5D 4GDFA 1Y1WB 1YFHA 2LYCA 1CTMA 2A74C 4FYDA 2V6EA 1FMVA 4A3EH 4OGQC 1PTOC 4XL9A 3JAMK 2ZXRA 5IT9K 3HOZH 3ASOH 2JQ7A 1SD4A 1JMCA 3JCUC 4NBQA 1YW7A 2F52A 1SAPA 3FXMA 3KEYA 1RC9A 3QWLA 3URYA 4LJZC 3CCRI 1IDZA 5KNLA 1LLRD 4A3KH 2K32A 1O7FA 5B1AH 3EJIA 4B3TQ 3K6GA 1ZR4A 4QF4A 4M6YA 4DR6L 5DEQA 3HOTA 3MTSA 4IN3A 4APVA 2K52A 4HAEA 1X3FA 3DBRB 1HHVA 1STYA 3VR2A 2RDHA 5EF6A 1IG7A 3K4KA 3M85A 4EM0B 2CVRA 4JQFA 2DOFA 1RUOA 4JV5Q 2E74C 1ZXTA 3S24A 2EFWA 2YX4A 2R3ZA 4KHVA 2JUGA 5C4XH 1J5EQ 1X54A 5IYCH 2LBFA 1A6IA 4IURA 3PNYA 2R93H 5JLWA 3SHLA 2X85A 1T95A 4G57A 3ECHA 4KK7A 3T1HL 4C2MH 2VUMG 1JC7A 3MXPA 1FNVA 4A5MA 1Q86C 1NK2P 4AIKA 3J80i 4UNOA 2DO7A 4HZFA 4XIGS 4B8XA 4CA0A 3WDNA 3QPHA 4LFCL 4K2EA 3BDCA 1ZREA 3EYYA 4RWSC 5M3MB 3OYJA 3MHBA 4KJNA 3DLLF 1BC8C 3H3ZA 3PUWA 1LE8B 2NZ1D 2JUCA 1EY9A 3QRFF 3KFWX 3MFYA 3MVVA 2LKVA 3HOUH 1HSJA 4RLFA 4DR1L 2BGCA 2R6GA 4PZ6A 1PH6A 2MG4A 3BG5A 3HEJA 5COYA 1K83J 1F2YA 1I3QJ 3VYTB 3BJUA 4LFAL 5KGUA 3ROUA 3HSFA 2JA5H 2IW3A 1X56A 4XQNA 1KYWA 2ZKZA 2QSGX 1HC8A 2FHTA 2E36A 2I5UA 1VDZA 4HA8A 1YNND 4QMGA 3PIPA 5JPMC 1I6XA 1FJLA 5CBEE 1YX5A 3BT9A 1QZYA 3IAS2 5TJJA 4K0KQ 2KRCA 4CJ0B 1WJBA 4LG0B 2Y31A 1ZEQX 1SMYF 2FFKB 4IHSA 1MDMA 3PO2J 1JT8A 4BBSB 1B72A 1ZRCA 3KK7A 1IUFA 2JA6B 3R61A 4LK1F 1SJED 3TO6A 1RUNA 4ZYSA 3S1NB 1H95A 1XXGA 5CMDA 1LTSD 3CMEI 3NTIA 2ZMEB 1B50A 5JLXA 1W7PD 2L3DA 3MMYB 1X3WB 4X0GA 1KDBA 3CUQA 1ETKA 4JI1Q 1WTQA 4A3IJ 4I99C 5LHIA 4J6HA 1Q12A 3HBLA 2BOLA 2MUYA 2LG4A 4FP5D 4NQWA 1ENFA 4A3IG 3LFKA 1Y8OB 2E19A 1LTID 1CF7A 1T33A 2L55A 2X4HA 2OZ6A 2F0WA 1HXDA 2Z1DA 2VODA 5HURA 3NPPA 3I4NB 2KRHA 1WCMH 5B3SH 1S5LC 2L12A 3CCQI 5LRSA 3CXCA 4UUTA 3RPUA 4G7HF 1P92A 3PUZA 3CP8A 4HW0A 4X1EA 2PEXA 1FJGQ 4S05A 2B2TA 2B3GA 1OQYA 4PGGA 3HUGA 2WAQE 3VSKA 1AWCA 1WJCA 4CKBA 3L2PA 4A3CH 1A3VA 1ZK8A 3S3MA 2XPUA 3M4OJ 1I4QA 1PTOF 2UXDL 1BC7C 4P73A 4RH6A 3Q0UA 2XC7A 1YLFA 3IRQA 1G6NA 1IBLL 4HAMA 3A54A 3BU2A 2PX9A 3L1PA 1QBJA 4QUFA 3E1SA 4FNFA 3ZYYX 2LRDA 1HQCA 3WU0A 4IX7A 4WX9A 2QCOA 4OXPA 3F6OA 3C1DA 3FPPA 4GS3A 1WRJA 1AW7A 1VQLI 1J5YA 5GAGJ 1MD0A 4ANJA 2CMPA 5EJCA 3CC4A 5C4JH 1FGBD 3BG9A 4XBFA 2QDLA 3GTJB 2EV6A 2MLGA 3H92A 5FJ8J 4MIUA 1Q7YC 2IS6A 2FOWA 4GKJL 5DCMA 5F0CA 1VQIA 5CVRA 3SZPA 1W1WE 1KTKA 4BXUA 3F8NA 4L5TA 3RN2A 5FJ8G 2E2HH 4OAYA 1HRJA 3VR6A 2NVQJ 4DR4L 1S7EA 3BPXA 4I6ZA 2F6CA 4R4IA 4DNIA 2M7BA 1RETA 2KFDA 4JI7L 1Q3LA 2E5LQ 5GP9A 4JI3Q 2W82A 2HZDA 1SFEA 3IWFA 9ANTA 1VQGA 1USTA 2QA4A 3U9OA 3PIPF 2I5LX 4JI0L 2H09A 2F4OB 2LC2A 3UE0A 4PZJA 2K5HA 5FLMH 1C48A 3JAME 1Z6HA 5IT9E 3BYYB 4XM3A 4CYCA 1S5FD 4IHVA 3CMMA 4Y52J 3DWQA 2NAZA 3H0GG 4PSXA 4E6IA 2DJFC 3EVQA 1VQPI 1LE8A 1JKPC 1I94Q 5KAFC 3ONAB 3W1GA 1SNDA 5J39A 5JEAH 3I4OA 4AYBB 2YYZA 2XF6A 5IT3A 4PMCA 1KRSA 3VYTA 2VXDA 1YEZA 1JKRC 3OL4A 2F0UA 3QOLA 1XPOA 2FXAA 3HTUA 4K8JA 1TS2A 3B02A 2L1BA 2LKSA 4C3JB 5J3BA 4X3UA 1BNZA 4OWWB 3NWTA 4XLPF 2RBMA 2GOXB 3M1EA 2EBIA 3MEFA 2NVTB 1WI9A 2PYKA 1JTYA 3MKYB 1SBBB 1U9NA 4DR2L 4MQ9F 4LG0A 1BBXC 1PH8A 1U4LA 1YI2I 3EQLC 3EETA 5EPLA 3LNQA 2Q8IB 1W3SA 1MKHA 4RAYA 3LAPA 1F43A 1ETOA 1FNNA 4RKLA 2UXBL 4QUCA 1TU2B 3QR8A 4DUYL 4BXXH 2CW0F 2ZMEA 1I50B 5CV6A 3AG3H 2LF7A 2OTLI 5C44G 1SFXA 1VCIA 5ILVA 1ZRDA 2EFOA 2UUCL 2KIMA 1NE3A 4WK8F 4Q5VA 3K57A 2CO5A 4JBJA 1I27A 1SN8A 5FO8B 2K5QA 2BBYA 4DV3Q 1DONA 1F9QA 4A93B 3F2DA 2NOGA 2NS7A 1UUPA 4DK3C 1YNNC 4YY3L 1EOVA 2AKWB 1XCBA 2F48A 5H1SE 1SD5A 3F72A 4F7XA 1J09A 5E8GA 4PG3A 4X65Q 4BBRJ 5LMNL 1KC8C 3H9JA 5DM7F 2LY1A 1AKHB 3BC8A 3RMHA 1D1IA 5IYDH 3AL0B 3LWEA 3S16B 3SK6A 3Q23A 3SEZA 1WTOA 1FZPB 4KKSA 1NTCA 1PFSA 4PV1C 5IP6A 2UV1A 1O7YA 1TT0A 2OQ0A 1JQYD 1HA6A 1CI3M 1QGPA 3BR2A 1FY7A 4R9WA 3HM5A 1FWZA 3KUPA 3H3UA 1UE7A 4PGHA 2VB2X 1UZCA 3OSOA 1RHPA 2DODA 1LVKA 2XASA 4NDXA 4P2CB 4B3RL 2M9HA 1Z67A 1E3PA 3BVMA 2O5IC 3GTGB 3AG2H 5C4XB 3ZP5A 2MFIA 1KHIA 1ZKGA 2R93B 3DKYA 4A4IA 1YW8A 5CVVA 4LLLA 5ICGA 4C2MB 5LGNA 2HVQA 1TLHB 1IN6A 2FINB 2EVBA 2OQGA 5FFZA 2OZUA 5L3FA 2Z8LA 3D5SC 3RLFA 1J75A 5I2YA 3S15J 2D1HA 2FRHA 5I6YA 2XWJB 1N32Q 1UMQA 4FE4A 2OWOA 4KI0A 1OR7C 2X9DA 1V5GA 3CCVA 5KK1A 3I90A 3DU6A 4NB3A 2IY5B 2YTVA 4HDVA 2VBWA 1L2FA 2X51A 1CA5A 1FMWA 5FKMA 3GZ5A 3HOUB 2VONA 4CKCA 4QLCU 3NBHB 2ID6A 4CDGA 1SDFA 1MNMC 2MYSA 4XYOA 2XB0X 1HNZQ 4Y15A 5HVQC 2HPMA 2JA5B 1ASYA 3U58A 4B44A 4OINF 1STBA 4KMUC 5I9PA 1ZH5A 4XKBA 2VXWA 2CSOA 2QDBA 1CZWA 5K5PA 3LAJA 4KYWA 2AQ3B 2NUCA 3LSRA 4K14A 1DZ1A 3CC2I 1F77A 1V43A 3OR2C 2CQXA 4KT6A 2ZXWH 4JI6Q 4KUMA 1LTRD 1XGOA 5L3BA 4DFAA 2LS01 3VYSA 3ZMSA 5C5LA 1XPUA 3FXJA 1ZRFA 3KFUA 3M3YJ 4IPGA 5HLIA 3M4YA 1B7YB 2HYFA 2YU9H 2KP6A 1IBMQ 2NOJB 1T08B 2NN6I 3KYHC 3M4PA 1DD2A 4AYBA 2LFBA 2AQ2B 1HUMA 4DR5Q 4ZJZA 1RNLA 2TRTA 5FB2A 1OISA 1Y1VH 1BKBA 2EZKA 2PMZN 3BR3A 4V190 2Y9ZA 2FBHA 4QY7A 3LSKA 2DA3A 5AJ3Q 1LVAA 1APLC 2XNAC 2KZGA 2XHKA 4ZYHA 1EIHA 3V8KA 2OEOA 4TSSA 4M6VA 1IF1A 1O4XA 3UI2A 3BTCA 2CUJA 1X19A 1ETVA 4XSXF 5E3NA 1A36A 1XB4A 3FXQA 3PO3H 1TNTA 1CQTA 2A6HD 3H3VH 1XYIA 1MNEA 4U87A 5F04A 1STGA 3W2AA 3I0TA 3K10A 5FD5A 3K4BA 3SEBA 3PMFA 4CJ1B 1WCMB 2ISZA 1LTLA 1UE5A 3WE2A 1LEAA 3F8MA 4HEA2 4PCQA 5M5WJ 3ZCOA 1XMOL 2X1CA 5FRNA 4ZDLA 2A6ED 2XUBA 2DI3A 3LMMA 3S1RH 5GQOA 4BE2A 2PZWA 3J81c 3ZMZA 1RPWA 1Y8NB 4CCNA 5JPNC 2H4OA 3Q22A 1U5TC 4Y3OA 2VI6A 1F9PA 4X66Q 3FXRA 5DYMA 1A6XA 2RHSB 1DOKA 1PFNA 2P6SA 2JK3A 1QHGA 4FF1A 2MA3A 4EMSA 2J5PA 1ZQ3P 2IX0A 2VPRA 5IP9H 3CJNA 2VQGA 4QSHA 2TMPA 3VA7A 2B2YA 2E2JJ 3GTOJ 1IXCA 1ONVA 1DDNA 4K5VA 1AKHA 5KVRA 3FK7A 4UY8I 1G2SA 4KY5A 1ZG5A 2KVMA 4KLKA 1BVSA 3OMGA 1TWGJ 3FKJA 1DGRM 1MZBA 4DR7L 4BAYA 1K8OA 4BXFA 2JMWA 1VQ8A 4YWKA 1SFKA 1C0WA 2BXYA 2XGEA 2N8NA 1HH2P 2K05A 1X3QA 3FBIB 2RKSA 3PSIA 2OF7A 1PYBA 2HFHA 4UHTA 4IALA 1UHWA 4YG2F 2VBYA 1VQ4A 3ERQA 4XRSG 2VQLA 1MI2A 1FBSA 2Q2HA 2COBA 3QIAA 1SXTA 2BE5D 2IA1A 5M9OA 5IY5H 5K5RA 1QVTA 3MZ5A 5C0XH 4PJ0C 3J80L 1FOYA 3PQKA 2ZTDA 4F7ZA 1SC7A 2HXOA 5LHY1 1RODA 2Y48A 2Z3YA 2WIIB 5HS9A 4B1RA 1XTCD 1L1OC 4LF5Q 3FXLA 3I56I 3DKXA 4OWTB 3K2AA 2Q2IA 2LREA 3RZOH 3K4JA 2WAEA 4E7SA 3CC4I 3W3AA 2MQHA 1FC3A 3F3XA 2F0OA 4XQJA 1LT4D 1S29A 4HR7B 2L11A 3NBHA 3IC7A 1IKLA 2WBMA 3OYNA 3ABMH 3DWAA 1WJJA 1K8MA 5D6FA 4UP9A 5EZGA 3Q9VA 3E3XA 1O7IA 5E20A 4BE1A 4E70A 3BDOA 5EBDA 4GFBA 4LK0F 1G6PA 2FSWA 4BYYA 5CYVA 1JHFA 1T0FA 2IS1A 4I7HA 4KJOA 2Y0MA 1JT6A 4D7MA 2UUZA 1RI7A 2QA4I 2IX3A 2QLZA 4ZKBB 3IH3A 1AEXA 4EQOA 3D5RC 4DOZA 1VQNI 2ISYA 3FMCA 5EYRA 4IPDA 2DY8A 4P75A 1XGMA 1EH6A 1D8KA 1WFQA 1HR0Q 2HDCA 2JP1A 4NW2A 3HKZB 4EVOA 2CWAA 2KIUA 3J81Z 1QZHA 2DA6A 4P9FA 3QOPA 4XIDA 4IF4A 2VT3A 3F8BA 3KLNA 3ASNH 2ADUA 1Z7TA 1X4PA 1S8NA 4HF2A 4C3HJ 1SE3A 3OR1C 1V5FA 3A8IE 3ZMDA 1BUVT 2PNHA 5C6AA 1G6ZA 1K8GA 3CD6A 1OKRA 5DM6F 4DV5Q 3MQ0A 1STZA 3WGIA 4DV7L 1K61A 1JE8A 3HRMA 3KJOA 3E0EA 2ZJ2A 4Y33A 1JJ8C 5HNHA 1JE4A 2OD5A 2CRGA 1IDYA 3HPGA 4GGGA 2F0LA 4RGNA 4QIWE 4IHTA 2H6CA 3F1ZA 2GZWA 4YCUA 1K83H 4CJ2C 2JK8A 2I07B 4LMQD 2HTSA 2DJNA 2RCFA 3STBD 2IX1A 1B8IB 5EPJA 4J1MA 3KF8B 1MGSA 3P75A 1UG0A 3EDPA 1SNQA 2P81A 4KIBA 2NVYH 2LKPA 4J00A 4G4KA 4R79A 3VEPA 4BH9A 1G3SA 2E75C 4A0YA 1AE2A 3GDEA 1DP3A 1P4AA 1IXSB 4AIJA 1T2KA 2K28A 4PZ8A 3P9IA 1O3QA 2J5OA 3OWFA 3K7AJ 4BL0B 3GWZA 4ZZDA 2A6HC 5C3EJ 1AOYA 4V0BA 4YCVA 2JPCA 4RKBA 1SD7A 1U4MA 3OS2A 3J81K 3I91A 4A3IH 2XROA 1ILQA 1RDPD 2H5XA 3K4NA 1BDOA 2XIGA 4MN3A 5M3FJ 1X4OA 1TWAJ 3KYDB 1R49A 1Q90A 2UUBL 4J8QA 1EYAA 2A6EC 1B3AA 1QG7A 2CQNA 1W0UA 5E1WA 4AD9A 3SGIA 1BOAA 4HPQA 5M3FG 2GA1A 4IXAA 2MHVA 3I3LA 1JICA 5ELCA 1X1BA 1O7LA 3K7UC 2V1UA 4OIRF 1KLUD 1WD0A 2XGCA 3FXUA 5ICFA 3VFZA 3M8JA 1R9TJ 1JTXA 2E2IJ 1SE8A 4C1NI 4JK1C 1X3UA 4PUSA 4FX0A 1VF5C 3A0BC 5CR3A 1TP4A 1B59A 3L2RA 4P55A 4RB1A 1GOZA 2K02A 1GV5A 4JYAL 4YFKF 1BN5A 1LTAD 4X6AH 3CP0A 3R3OA 4ALPA 5ISRA 3KIOA 2WACA 3CCVI 4G12A 3M4OH 1DYQA 1Z1DA 2YU9B 1D6EC 3FZVA 3CO6C 4NDLA 5CJ9A 2HI3A 2F0KA 4O42A 1E3HA 3SXHA 5FO7B 5GTHC 1DPUA 1Y1VB 3DEWA 4G7OC 1IXRC 3JSPA 3VSLA 3HGGA 4NPSA 2Z4IA 3ND9A 1FPQA 2BE5C 1LUZA 4A3BG 2JN4A 3JRAA 1SNPA 3LNNA 1SROA 2UZKA 1TIID 4D5FA 1SNOA 4N8X1 2RQPA 3MWYW 4NXNQ 1QQIA 1YHQA 1N34Q 1TS4A 5J47A 4XNFA 3PO3B 5I4DA 1QPMA 5FJ8H 3ZN0A 3TREA 4KD3A 3IKVA 4KIGA 1PUFA 4JBAA 4ZYDA 5JAVA 4AIDA 2F0DA 1FYLA 1EYDA 2ZXOA 3HKZA 4GLVB 1RIPA 3ZQGA 5D8KB 2NVQH 2L9NA 1CA6A 4FO2A 1H9MA 4ZCKA 3CCYA 1GVDA 3GF2A 2XSJC 3IAM2 4GLXA 2VJJA 4Y13A 3S1RB 1R6RA 1E24A 3H0GH 3HPHA 5C4ZA 4FF2A 1UHSA 4YFXF 2Y0SE 3VR3A 2TCTA 3Q24A 2JA8J 2RF4A 4R8HA 1WFXA 3R60A 4A3FJ 2BH8A 4Y52H 2GBYA 4KMUX 1WVRA 2H94A 4DV2L 3PIO3 4J15A 2VIXA 2JYOA 1EWCA 1DOLA 3FPUB 3T51B 1WYDA 4B3XA 3IFDA 4B09A 1OYWA 1MJAA 5KIXA 3RYRA 1AE3A 1RTNA 2LNBA 2CH4A 1W36D 1SNCA 4CCKA 1XX5A 5IYCG 1SMTA 5F6FA 1OO9B 2V6CA 1KYZA 4A3JJ 1V4RA 2PQAB 3CQZB 5E3LA 1A31A 4WFN3 1B8IA 4DXFA 3FMQA 3ZN1A 1PZKD 3KF8A 2V79A 2EZIA 1ETQA 3IHUA 4EJOA 4A3JG 3CUOA 1KLGD 1FYMA 2OTJI 1GUNA 1NUCA 2N3SA 4A76A 1QWYA 3R8BA 1UELB 1TKWB 2B39A 1VQ5A 2M0MA 3WE3A 3T13A 1ZN2A 2EPFA 3TS2A 2STWA 2HXIA 2KUMA 5C44H 1U6GA 4K5WA 4DR3Q 1NY4A 3FHNA 5FO5A 2DTZA 4L9NA 2KJXA 2A6EF 1OCPA 5CPRB 2BH2A 3K5NA 4MHEA 3BJOA 2XPVA 3HHGA 2R5ZB 3S1QJ 4DR6Q 1P2FA 3RLOA 1LB2A 4DNTB 2OXPA 5IP7G 2OQRA 4RGUA 3RZOB 4XYQA 1I6VC 3A02A 3QYEA 2DFIA 1MJ9A 2F0MA 1KGSA 1AZQA 1HTPA 4JVZA 1VQ8I 1FSEA 2B2UA 2HQRA 2D9UA 3VYUB 4I7ZC 4IUNA 3HB9A 2V9VA 2FQ4A 1ZAOA 3IL8A 2FU4A 4CBVA 3S17B 1CKOA 2DMUA 3ULLA 3CO7C 3QPSA 2EYJA 2B8GA 3T1HQ 4LF7Q 3G6EA 2ELJA 4X64Q 4RGSA 3WGHA 1U9OA 1VQ4I 2EZVA 2ES2A 1V1PB 2EV0A 3GLLA 4PZ7A 1FIAA 5D6EA 3KETA 3QWNA 4BJ6C 4LFCQ 1T56A 3ERED 1OCTC 2Z6KA 5DUIA 1XMQL 1MIJA 4HRIA 1YTYA 1XGNA 1LUJB 4KT5C 3FKIJ 4JI2L 3FHZA 1U78A 3TW6A 4DR1Q 4JCVE 4PJMA 5D14A 3J81E 2CFMA 4OOIA 2EY6A 3CDIA 3A55A 1QB5D 4LFAQ 1BI3A 4DU9A 3BWGA 5J22A 1VQFA 4FETA 2I10A 3QOEA 5JVTA 1F5TA 2VUMB 2OAZA 4HX4A 4P72A 1Z05A 1SVMA 1NBWA 4D9JA 1VQ9A 2EA4A 1X65A 3I4MJ 2KEEA 3GTQB 1XC5A 4YIIA 4JI8L 4II3A 4DK1A 4UUSA 2X6OA 5HLGA 2F3IA 3S15H 4CCJA 2K03A 2V1CC 2BDOA 3H3VK 4OWRB 3NEMA 2XAFA 1OCOH 2R7ZJ 5E3FA 4KA4A 4OIOF 3R2IA 4MHGA 3HOXG 3HOVJ 3DEEA 2ZTEA 1TTYA 3HRSA 4LIUA 2XN9C 3K1MA 2RHQB 2O03A 5E18F 2VC1A 3M9BA 2UU9L 3HIFA 1K0SA 2CW7A 2XV4S 1SAUA 3SZTA 3MFKA 1PYVA 2A73B 4A3MJ 4A3GJ 3PF5A 2DPDA 1P9QC 1K7AA 5LMUL 1HSTA 2NNYA 4XQFA 2JVHA 2YR2A 1SR3A 1BR4A 1GXDC 3OS0A 4I02A 1J59A 1E2XA 5IWAL 4A3GG 2K7LA 1YJ9A 5L37A 2ZFUA 4WXCA 3M9AA 4BA1I 4ZAIA 3HOWJ 4RGXA 1EY7A 2NVYB 3NUCA 4JYKA 1IW7D 4CDFC 3TW7A 1IGNA 2XIWA 3ITPA 2ZJQA 3HRZC 4FT8A 5CVIA 2RAEA 3R6SA 3HOWG 1PH2A 1UEAB 3M3YH 3DXJC 4IFDJ 1J2XA 3F8CA 3S3NA 3U4VA 1W6JA 4R4OA 1Y1WJ 3A01B 4HYEA 4ZC3A 4L9TA 3HOYB 1HR0W 2R92B 1A0IA 1VZ0A 1ETXA 3CCRA 1GLNA 4HJ5A 3CCEI 3NEUA 3L9FA 1YRNB 4PMBA 3BP8A 3C7JA 2JQOA 2PQAA 3ABTA 2A8VA 1TWHH 1TNSA 3KLWA 2NYZD 2HDWA 2BA1A 2K04A 1C9OA 3I71A 4U68A 3GO5A 2EV5A 1NG7A 4L18B 5ELEA 3FEWX 4JBMA 1D5VA 1A15A 2B9SA 1IBLQ 1QZZA 1EOTA 2A69D 2JRTA 2HT1A 4C2UA 2W57A 2RQXA 2PO4A 4OIQF 1PLFA 2MSYA 3CCMI 3SEQA 4ZYAA 1O78A 5GAHJ 3WTYC 1KQ0A 1Z6RA 4LLNA 4CICA 2IT0A 4BNCA 4GN4B 1JB7A 4ULLA 4E7IA 2G7UA 1XCVA 1G4DA 1G8XA 4KKUA 1XNRQ 3F6VA 3I54A 2JEAI 5M5WH 1ICFB 3KPHA 4G9YA 2KQ3A 2R5ZA 2X1EA 1N78A 3IFTA 2MGSA 3CESA 2PMUA 3BJAA 2FNPA 4OHJA 2IXSA 5IGBA 3S93A 4RS8A 4GCVA 4BACA 2CJJA 3WTTC 3DPLC 5M3MJ 1TWFJ 1LV9A 1HKQA 3O2PE 4BQOA 3DBLB 1DP7P 1SFOJ 3S2HH 1TR5A 2HPIA 3R4KA 3HSEA 1SMYD 3TS0A 4E7KA 3U50C 2Q8RE 3HEFA 4BGDA 2R3SA 4DR4Q 4CZZA 1HJPA 1A2TA 3VYUA 1ET9A 2P0WA 4K5XA 2E2JH 3JAMi 5E7NA 1GUUA 1JI8A 2RA4A 2ELHA 3LA2A 2W25A 4GO1A 3GTOH 1B53A 3SDZA 1ESRA 2A5HA 4L5EA 3GW2A 3KLSA 1EQRA 4JI0Q 1V1PA 3A74A 1CT1D 1J5EL 3BG6A 4RGTA 3FX3A 2EJRA 2QKMB 2JT1A 1A35A 2LDUA 1TWGH 3DU5A 4PFPA 1V55H 1K4SA 3Q8DA 3KZZA 4J01A 2MH9A 2F0FA 1XPXA 3OOCA 5IOCA 1RR7A 3H6MA 4BBSJ 3Q6SA 3E7LA 1Z0XA 2B2VC 2IS2A 2LY9A 2M8EA 3CDHA 4IQ4A 2ATWA 1Z91A 3UDFA 2XRQD 2GXBA 3S1NJ 4HV6A 2HYJA 4GLAC 4DGZA 4IJLA 4XKCA 2IS4A 1X3PA 2EFNA 2IPQX 1JJ6C 4UV9A 3CLOA 2QWWA 2CQAA 1FVIA 4B3AA 4BHBA 4OIKA 4CUGA 2VN2A 1PRTC 4DR2Q 3H0GB 2CW8A 1B70B 1IZ1A 2F5CA 3W2VA 1RCVD 2QF7A 1HA5A 4HNTA 2VJ4A 2DCEA 4GN5A 1X55A 5CQGA 1TT5B 3WOEA 3SYTA 1YQAA 2DOEA 1SEBD 1BW6A 4N4OB 3HKSA 2EK5A 2ZJQF 4RGMA 4ZH4F 3DPUA 4EV0A 2UXBQ 4N9PA 1Q1BA 2AHQA 1DJRD 3HC7A 2M2EA 1YHQI 4GYIA 1VQKI 2Y69H 2PNRC 3OMYA 1JGSA 1MIUA 4YELA 4JK1X 2E60A 1ZLKA 2W4SA 1ON2A 3F8TA 2QQBA 3I4NJ 2IT1A 5FKNA 4HX8A 4Z9CB 4R4CA 3SJMA 5HNFA 3TP0A 3BZDB 3BJ6A 3I4PA 2XSDC 2WV1A 2M1BA 5H20A 4JP0A 3S14B 3I4NG 3EFXD 2GXAA 2CV2A 4S04A 1VS0A 2EH3A 2HQLA 4EM1A 3UKGA 1FP2A 1D8JA 2N49A 2FMMA 4F92B 3CMAI 2FF4A 4FXDA 1WH5A 5LMNQ 4D7NA 1Y56A 2K1BA 1WTRA 2O7OA 1YHBA 1RKWA 4IPCA 3W3CA 1MMAA 3LSPA 5IGDA 3RJPA 3NQTA 3SFIA 3ERSX 5C44B 1MJCA 4HV5A 4RGRA 2NXNB 3GQBA 4MTDA 1TXYA 4XKVA 4B3MQ 3A01A 5J4VA 2P5LC 4M6XA 1D1KA 5L3DA 2L9SA 5K7ZA 2RNJA 4A3DJ 2YV5A 3EUAA 1PDQA 4JBWA 2V9KA 2XGXA 4HBLA 3JR9A 3KZIC 1YRNA 3RTRA 4EGYA 4CCMA 4B3RQ 4A3DG 3IKJA 1RKTA 1FJGL 4MTKA 4I7AA 2WB1E 3RNUA 2LOOA 4H44C 2ZM6L 1XDSA 5C5MA 5FKLA 4ENMA 3UDXA 4XR6A 3QP5A 2K50A 4B9XA 1OCRH 3E9IA 4RFBA 1TC3C 5B5EC 1IW7C 3ML6A 2COMA 4QIWN 2ZJRA 3WG9A 2ZSIB 1VTNC 1HA8A 4A69C 4ON0A 1QNUA 3OYCA 2NZHA 4DZPA 3GLXA 2Z16A 2X6YA 1F9NA 2UXNA 1XMAA 2EE1A 1FLIA 3NSWA 3EA6A 2AWNA 3KP4A 3J7AF 1V3FA 1MKMA 1ACIA 2E1OA 2BY1A 3JSOA 1EA3A 5AONA 4BEHB 1XS9A 2Y9YA 5FKOA 1FD7D 4U0YA 4WXDA 5E1ZB 1VQCA 1HZCA 2ICWG 4POFA 3EYIA 3E6BA 1BR9A 2KECA 4A3LJ 4ILWA 2F1MA 2M4KA 2QUFA 5A2QL 4O0AA 3G48A 3EUHC 3LWUA 3RSNA 2JZYA 1QVFA 3V7RA 4NHJA 4BQNA 2D2CC 1IN8A 2O61A 4A3LG 2DJIA 3H9QA 5IGEA 3O13A 2CW0D 2A69C 2ETHA 4I2OA 3K7AH 2VKDA 2EA2A 1V9PA 3OIQA 1X1DA 3FK6A 4C3JJ 5C3EH 3S15B 1EH7A 4M74A 4TQUS 4HF1A 2NVTJ 1IZ6A 5F2DA 1TWCJ 3FRPB 1TVXA 2YUSA 3TQYA 4H0EA 4RAGA 3PUFA 4Y4RA 5M3FH 3N6RA 2AUKA 2VQFL 4LAAA 3TOBA 3TMOA 2L7KA 1TWAH 2XB5A 4EM2A 1GV2A 3OWTA 2JA2A 1EJ9A 4BQAA 4UVAA 3AFQA 3BCAA 1H88C 5DEHA 4V19K 3E0JB 1CKNB 1VQHA 1ASZA 4JOIA 3RKQA 2XAHA 2KIQA 3ELKA 3PFYA 1B4OA 1S5DD 1I94L 4DXGA 2BA0A 2OTLA 1KQ8A 2KIFA 1BIAA 1SMYC 2DMPA 2VE8A 1I50J 4W97A 4RAFA 1IKMA 4LK1C 2E2IH 1NSNS 1O3RA 2H1KA 3SE0A 1JOQA 3TQNA 2BZTA 3QODA 2E1MB 5DS9A 1VQ9I 4R8NA 1ET6A 3QB3A 3TZUA 4QB4A 4IEJA 1XJVA 1O3TA 3HZXA 2K4KA 2KHSA 1CF7B 2O5RA 3LSHA 2G9HD 2XSCA 1BBYA 5EDNA 2ENBA 2AXTC 2IEKA 2BV6A 3M3YB 3NAUA 2M5WA 1BM9A 5C4HA 1STNA 2Z6BA 4HIDA 2RVLA 1BR1A 4TKOB 1XMOQ 2DMTA 4KV6A 4ABZA 2QGUA 1A2UA 5HDKA 2B63J 3TN2A 1T5XD 5CKTA 1PYWD 2K14A 3S16J 3NARA 1PP8F 5KRUA 5AIQA 3WODF 3DWLE 1PH5A 4MFEA 1K4TA 4ID6A 1QNTA 4IUTA 2DDAA 4C2TA 3I59B 1TWHB 5EGOB 2B63G 2WY7Q 2MC3A 3HP3A 5F1RA 3J7AV 3C3WA 4R1HA 2L7FP 1S9HA 4BHPA 4AH6A 5EPKA 3H35A 2YX7A 3DEUA 3K58A 3RZDB 2AQFA 3GTGJ 1WWXA 3KP6A 2LKXA 5HS8A 5LEJA 4UPAA 1OYYA 4AU7A 2PMZB 5CLSA 2EY5A 4C2MJ 1YNXA 3DCFA 2E8GA 3C2HA 4DR7Q 2IVMA 1R1TA 4C30A 2DY7A 2A6TA 2RN7A 2M34A 4L6TB 2O5JC 3BZCA 5ILSA 3IAYA 4EATA 3JC66 2F0SA 2Y0SN 3QG1A 5FD6A 4L5RC 4L0ZB 3AFPA 2X6XA 5LHGA 4XRFA 3SK8A 4M9ZA 4TRDA 3E5QA 2OCEA 1IW7F 3S2HB 4H4KC 1QHHD 2JA8H 3I8ZA 5DCMB 2EXZA 3WOFA 4UB8C 2Q8TA 4A3FH 1FSHA 3RKYA 2KT0A 5CV9A 3X2QH 2E2JB 1U4PA 2RGVA 4QGUA 1KQ9A 3GTOB 1WTVA 5FO9B 1JXSA 3SQNA 2JA5J 1E1TA 2EIKH 4BY1J 3Q0WA 2V9PA 4GKKL 4KN4C 5DTDA 3PL8A 3CC2A 2EYMA 2RSOA 2CCZA 1Z7UA 5C0XI 4DW6A 3H5NA 1TWGB 4A3JH 1ZHFA 4Y17A 4BY1G 3RUZA 3O8GA 5DUKA 1Y14B 2SDFA 3ZQFA 4GNXB 4BEHA 1MBGA 1D1BA 1I4RA 2NTSA 4RCOA 3VDXA 2Y0SG 3JTHA 4CYCB 1SE2A 1X1PA 3PM1A 2GWRA 1FOKA 3OPOA 3LOCA 3CLQA 5DDGA 5CV4A 2I5HA 5BQTA 1F9SA 2A69F 1SJHD 3PUVA 3M07A 1PTOH 2I0QA 3CC7I 4HNUA 2CQ7A 1VQ6A 4BY7J 2C6YA 2VZAA 2A68D 2DJGC 1XTDA 3LWFA 4HN7A 4HOBA 3BTJA 4N9TA 2XAJA 4S3SA 3ND8A 2Q2TA 1CSQA 3V7CA 4A6EA 4LFBL 4BY7G 3O6BB 5IP7H 3SR1A 1B44D 5K5QA 4LLGF 2FQ3A 1QJOA 1EFWA 5JVH3 2HYGD 3OY9A 1E2ZA 3QAHA 2XRNA 3ULQB 5C3WA 2A3SA 3CUQC 3TL4X 4XXEA 5L3GA 3BR0A 4P1WA 1U9RA 2L2OA 3P9KA 4JI6L 2EJGC 3FDTA 4AQYL 3E5XA 3HL2A 3E0JA 1CKNA 1S7AA 1M1EB 1PXUA 1KU7A 2K5CA 1EU4A 4LF6L 6PAXA 3P1HA 3K2ZA 3PO2G 2PQEA 5M5XH 1W5CC 2MO0A 5EZHA 2WP8J 1IBML 2KCCA 5M5YH 2L7ZA 4D0PA 5GPCA 2BY0A 1XMKA 1QILA 2N55A 1SMXA 1HCRA 4UY8C 3BDLA 4IO9A 1D8LA 4DR5L 1SNMA 2IWHA 3OTOL 1BI1A 2KDZA 1R4MB 2PN6A 1D0ZA 1VQJA 3J7AY 5CVUA 1JR0D 2CW0C 4DV7Q 1G91A 3NE5B 1FL0A 2F0GA 2X6LA 2GN5A 3PGZA 4D1QA 3UNGC 2LD5A 1X2NA 1D1CA 2NB0A 3H1CA 2M8GX 2PI2E 2B2TC 1USSA 4IL6C 1QUQB 1TT2A 4IZZA 5JOBA 1Q1HA 3DPTA 2GVAA 2QEJC 2WWYA 2JJQA 2IJ0A 3KYLA 3DTIA 2DA2A 5FLXL 2P5KA 1KD1C 3S2WA 1P4WA 3D4DA 3G71I 2QQAA 1ZR2A 2X0LA 2HKOA 1G59A 3PIP3 4C56C 2WV0A 3AG1H 3QYFA 1HW2A 1YJWA 4GYGA 4I65A 1BBUA 4LF8L 3E6DA 3GXOA 1WOCA 1R71A 2B2WA 3I59A 1HQMC 5EGOA 1E3OC 5CV8A 5TRDA 1GO3E 4HCSA 3HOXH 1FP1D 2BXZA 4XDXA 1YNJC 1YBYA 1A5JA 2R5YB 4QWQA 2R7ZH 1RIOH 3OYIA 2HTJA 4KHPQ 2HU9A 3HOVH 4LF9Q 1RRJA 3Q9SA 2D2WA 2DGYA 2DNEA 1MBKA 2PMZA 3LFUA 2EDGA 2F5DA 2VXZA 3BVZA 1IYVA 1X3GA 4A3GH 2V1XA 2R7SA 3GCMA 1G51A 1YS7A 3ESWB 2M9VA 1ENAA 3GX4X 4RMNA 4JI5L 3K4CA 2VJ5A 5GAHC 3I56A 1F36A 1MMGA 3H9GA 4WXHA 2W85A 1GUGA 4HSVA 2WKCA 2ZCWA 4N8FA 4HJ9A 3S2DH 3DLAA 3HOWH 1Z9FA 3HYIA 1BF4A 3JAML 2F0EA 2DFHA 3BCBA 3DV8A 4OL7A 1VFCA 4EJWA 3OHXC 1NJIC 3GTMH 1MNDA 3K70D 1B1BA 4P9UA 3BZKA 4U0VA 4CO8A 4IFDH 5EKIA 3SVMA 4Y7NH 3K7AB 3REOA 2DA1A 2O0YA 2YU3A 2CQOA 4HJAA 4EJTA 2ACJA 3S32A 2ZSHB 5ELBA 3QPTA 3VPRA 1MHWC 1VQNA 1P4XA 2ECBA 1Y8PB 4IPAA 5IODA 5E3MA 5IGGA 2WV6D 3MXUA 1KNEA 4GNXA 1Z3XA 1TWAB 5K7FA 4HIOA 3VYSB 3HRUA 4J19A 4OU0A 4XRSA 5K5OA 1SYDA 5E4XA 4HEDA 1H9SB 1HFNA 4Z6YA 3FVQA 5DM73 2QGQA 2FEZA 3ICEA 1QO0D 4DYCA 2GIZA 4RLQA 1R4NB 3LQRA 3MAJA 1FNWA 2E2IB 2RREA 4IVNA 2HGCA 4FCYA 1D5XC 4IO9F 2ESNA 1BW5A 2Z33A 1EKEA 1L0OC 3DKWA 4M3BA 2V1NA 1JUSA 2O9LA 4E7HA 4YRVA 1GUTA 4CYDA 3BR1A 2ZMEC 2K85A 3L09A 3E97A 5FLXc 1HNWL 3HTSB 2PJPA 1H9GA 4PMWA 1TWFH 4KTAA 1VQEA 1Q81C 3PCOB 4B08A 1SFOH 5J1RA 2VASA 3G73A 1BCPB 4XKWA 3T1BA 2M7AA 5D5XB 2MJ8A 2ZJPA 3OV8A 2VOOA 4GOPA 4LF4L 3I4LA 4XMYA 1YHAA 3OYLA 3KP2A 4A3BB 2PCFB 4HIMA 4DK0A 4F8MA 3WTSC 1KABA 3NTKA 1NH3A 1IRXA 3AU7A 5HS7A 2LH9A 3G1OA 1N9WA 3QYBA 3V2TA 3S1MH 2RDGA 3UR3C 3CJTB 4DBQA 3L0OA 4HQMA 4MGRA 3TDZC 3TO9A 3MKWB 1OFCX 1V54H 3IH2A 4DV2Q 1ZKOA 2K40A 2VQEL 4KICA 4BU2A 2ZT9C 1HOMA 4R4TA 5B66C 2Y2ZA 1IBKL 1TW2A 2OPTA 1W5SA 4DV5L 1ZG1A 4M9XA 1K6YA 1A3TA 1QUQA 3I5UA 5J8FA 1HQRD 3EIVA 1WGXA 3ZOBA 4JX4A 4EQPA 4A3EB 3AKZA 3DEPA 3S1NH 5LFAA 3C3LA 4G7ZF 3HOZB 3JAMc 4BBRG 2CH0A 3A4CA 2CV1A 4A3KB 2H1EA 3FP9A 4R4QA 2Z0SA 1H9RA 3GTKH 1I4PA 1HXYD 1Q82C 5I2XA 1KU3A 1C4QA 3OMCA 2CQKA 1I6HJ 1EH8A 2N88A 3BS1A 1QVUA 4K8IA 4C1NK 2DNCA 2R5YA 3PUYA 3L2QA 2HDDA 2P6TA 3EUKL 1ULYA 4XTCS 3ISPA 2MBFA 1IV8A 4DV4L 4KNYA 1MBYA 2R7XA 3RR5A 1MMSA 2IHEA 3I4NH 4G6TB 3V05A 4EX5A 2A61A 2O3FA 2H6BA 1UWVA 4XLFA 2E76C 3RKXA 4A3JB 4F91B 2TDXA 3N97A 4JC0A 4JI4L 4I98B 3A7AB 5CYUA 4YIFA 1KNAA 3IWZA 4IJAA 4QPQA 1SAXA 2AHOB 1P16A 2EY1A 3TOAA 1WTHA 2LK2A 3MXNB 1XX8A 2L7MP 1PVOA 1W6KA 3R0JA 3LA3A 2IGNA 1PVEA 2XTIA 1R58A 2K33A 1M4VA 3P5JA 2I8DA 2C9OA 3ULJA 1XWEA 1P8LA 5ERIA 2V4JC 3NRVA 2HOEA 5I6WA 5FLXZ 4R1JA 1Y1VJ 1WD1A 3A8JE 2F03A 1UE1A 5JVG3 4IKFA 1XMQQ 1HKSA 1HF0A 3F21A 4IUUA 3E3VA 3V8JA 5D5VB 4WJWA 3KEQA 4A3DH 3HRTA 5DAUA 1Q1EA 1YYVA 1UE6A 4BS9A 1JWSD 2CKZB 3JRBA 3J7ZI 4DNRB 2H1LA 1QNKA 3L9AX 2JE6I 1Y0UA 2PJRB 1S5ED 4UAIA 3GTPJ 1EY4A 2WB1N 1HTLD 4HSRA 5F0FA 1H9JA 1H9SA 2FXQA 2EIJH 2VL8A 2ZJPF 4DQ2A 1TZLA 1LM0A 3KP3A 5M5XB 2NBFA 2VY3A 2KISA 2K5WA 4HJ7A 5M5YB 2F0JA 1VQ6I 1MSFC 2F3VA 1OXUA 2UUAL 1E22A 3K70C 4HTHA 1FTZA 4M1UB 1NHAA 3K1PA 1R23A 1CHQD 2IP2A 3S1RJ 1TS5A 4JPBW 4L8JA 1N36L 4MQVA 5LGTA 1S4ZA 3T5XA 1JB3A 3I73A 3P9CA 4YIJA 1N33Q 3KF6A 3MZHA 4ZDPA 4LGWA 1QRYA 4CKEA 2UU9Q 2WB1G 3DLLA 4F93B 4N0BA 2R7TA 4NXNL 4A3LH 4KN4X 1R1UA 2A68F 1LQ1A 4A5NA 2Z99A 1PH1A 1P7JA 1WJEA 4Z2YA 4ZYEA 4DF7A 3C2GA 3KDFA 2F5EA 5BR8L 2F4VL 4PK4A 1DU6A 2B2YC 2VB6A 1HNXL 4MLOA 1BXTA 3T0YA 1IJWC 3CQZJ 4AUXA 4UB6C 4C3JH 1PH9A 3LSTA 1D5YA 3MFGA 3WTXC 4E7JA 5ED4A 5FLXK 2AWOA 2OTJA 1U0LA 3AL0C 3HOXB 2YSRA 2NVTH 1TWCH 3E5SA 1BA5A 4BWGB 3KP7A 1XGSA 1PV4A 1I1SA 1CUKA 3LSJA 2Q0OA 1VF9A 2ESHA 3V8LA 4U7DA 2G7HA 2D62A 2P7CB 5LBQA 4KJZA 3MN2A 2PW7A 2HS5A 5LD2C 2ID0A 3K8AA 1TQPA 1MGTA 4UV8A 2R7UA 2P5ZX 1SE4A 4A3GB 1PZID 4RMFA 1F2MA 1VQDA 2PBIA 5LGUA 1I50H 2IGKA 3WWVA 1T98A 1A04A 3J7AO 1XNQL 3GEZA 1UHMA 5C4JB 4N4NB 3HXLA 1NNXA 4P74A 5EQ0A 3BQZA 2M30A 3FDYA 1OXSC 3S2DB 1FBQA 1D2BA 2Y75A 1YJWI 3HOWB 2JSPA 1WJ5A 3OIPA 1E0EA 3E9HA 3GTMB 4KD4A 3BDDA 2EYOA 2XRSD 3I70A 4MEXF 4XORA 4ZYGA 3WU2C 2E2HB 4JOMA 5EEGA 3S17J 5KAIC 3DTEA 4Y7NB 2QEXA 1W0TA 1HKTA 2HDMA 1FYKA 2JRMA 3TRZA 5ELNA 2D5DA 1VQ7I 4RHSA 5D5UB 3GZ6A 2B63H 3S16H 2XAUA 3MEHA 1Q46A 4ME3A 3CCJA 4DR3L 2FJ2A 3DTKA 1J7KA 2EZLA 2E34A 3GFIA 2HIXA 3I7FA 5DM63 5EKKA 4DYQA 2XAGA 4UHVA 5F0HA 3U9GA 2K3FA 4OMZA 4A0XA 2DW4A 3MXNA 3DMUA 5HY6A 2M0CA 2W1OA 1NTGA 4HCEA 2QQ9A 4WRDA 5FOBB 3TO7A 3E5UA 4MNOA 1T0FC 4A6DA 3M8EA 3H36A 2HHHL 2DA4A 3GVAA 1PFBA 3SZGA 2OBPA 3GTGH 2VUMJ 4RAZA 5IOYA 1B9NA 4YHHL 5E1FA 3OYEA 2BHYA 1FOWA 4RM2A 1JWUD 2JVGA 4A0ZA 4LW1A 1MBFA 1EIFA 4LF7L 1VMPA 4JX5A 1JGGA 1DU0A 3H91A 3RKWA 5HGTA 4X64L 2E1CA 3GTQJ 4RHRA 4A75A 3PUXA 3DP7A 2K5DA 1PMRA 1U2WA 3L2WA 3GFJA 2OC6A 4HDUA 1GVJA 2E71A 3FF5A 5KHDA 3U4ZA 5K1YA 1A6QA 3HJEA 5BN5A 2AXLA 1TWFB 1Y8RB 3CPWA 3DQVC 2PJRA 4Q47A 4H02A 1SFOB 2EYHA 2DK8A 4IPHA 3FIWA 1EF4A 3RD4A 3ZR8X 1PUFB 4L9JA 4AVZA 1BCPF 1A8VA 1IRGA 1EY6A 4WORA 3OYGA 3V42A 1EU3A 4H0LC 2DBBA 3BTLA 4FHTA 4DAVA 2LY7A 3OW7A 5A35A 4BY1H 5BN4A 2OA4A 2RDFA 3H5AA 1NK3P 3A0JA 5ICEA 3J7A5 1EY0A 4DUZL 4AWXB 3SXYA 4PFOA 2CS3A 3S1MB 3I64A 3JTGA 3BR6A 1BO0A 2L0CA 2HCCA 5HOOA 1S7OA 2EIFA 2NVYJ 3BPVA 1E2VA 2FA5A 2PZUA 4C3HG 1EYGA 2L9RA 3MXGA 3IRBA 5IPAA 2O2LD 1IHZA 4OIPF 1BIBA 4DV0Q 5L3EA 1WJFA 1LFBA 2G0EA 3V96A 3KLOA 3AEVA 4ZUJA 1SYEA 5IE8A 4IOAA 5IY0A 3JRHA 1S6LA 3TEDA 5J6XA 4BY7H 1EY5A 3ZQ7A 3Q0VA 3CCEA 3LA7A 1I3QH 4X62Q 3HOYJ 4DPGA 3C18A 3FBNB 5LL6X 1PUEE 2R92J 4AYBE 1LNWA 2FBIA 2Z2SB 1H8AC 2EJFC 5J40A 4XONA 1G291 1ON1A 2CWPA 1DGSA 1HZ9A 1I4XA 3GMEA 4OONA 3HOYG 3LSGA 3OYKA 1XSVA 3D0SA 1T8IA 3GTKB 2R92G 1OTCA 1JJ2A 4OX9L 3W6VA 3SDGA 1MSEC 1S72A 4R8IA 3J80c 3CCMA 4OO1G 1EIYB 2LXJA 5D65A 3PO2H 5J1YA 5JJLA 1DUXC 1UCRA 4DIQA 2VJIA 3JRCA 1LDJA 1ENHA 2XF7A 1R22A 3W5OA 2C35B 2DTRA 2OUMA 1Q1VA 4RB0A 2X6WA 4B3SL 3ZQLA 1DXMA 1CKMA 2KCNA 1IAWA 1WPKA 1H0MA 5BNGA 5CVJA 2JA7J 4M3EA 5G3LD 2F3WA 2QZ8A 2EY2A 4XLCA 3V4GA 3JRFA 4AM3A 5C3EG 1K78B 4X6AJ 2ZM6Q 4BJ5C 4IHWA 4HJ8A 2JA7G 3DF8A 5I9OA 1XTAA 4ZRZA 2DAOA 3V7SA 2VLAA 5FLXE 1HLVA 3CRLC 1EYCA 5F08A 3GZNB 4I0BA 3ZQHA 2R7WA 1GHCA 1N25A 1NG6A 3TDQA 4LJZF 1W7PB 4XLAA 2F5FA 1IN4A 3BR5A 2K7VA 4EQ5A 4ZTJA 3D6CA 1D3YA 4A3DB 1YE9A 3ZXSA 4UDUC 3PQIA 1X32A 4XLEA 3C1FA 4XT3B 4NUBA 2K4BA 4EJVA 2HUGA 1XNRL 4QPOA 4ENKA 3O3KA 2WAQN 1C0AA 1J6QA 2PW5A 2K5VA 1SEUA 3O8HA 4HSTA 1RD9D 4DV6Q 5D4RA 3MCZA 3T1YL 4OO1I 3HGBA 3UDIA 1HBXG 3OS1A 3F23A 3C1EA 4HLYA 4M73A 4DV1L 1AHDP 1R4QB 2WKDA 4P5OA 1VF7A 3K9TA 1UNSA 1PH7A 1DQUA 1FIPA 4KHZA 1IL2A 1STAA 3IUOA 3L2VA 1PH3A 4UUSB 3N05A 1LACA 3H0GJ 1HZBA 2VQFQ 3UE1A 3SHFA 2IJLA 4BUPA 4D5CA 3ZMUA 3C2BA 2D45A 1EZ6A 4DZJA 1K28A 2V1DA 2WAQG 1B2TA 1H9KA 4YCWA 1VQKA 3MD2A 4IOCA 2KA7A 5K7HA 3T4AC 4QIWB 4RA2A 2MD5A 4FE7A 1T6SA 4C9YA 4IOAF 5D8LB 1UAPA 2BY3A 2KOLA 4DN4M 3AAFA 3OYFA 2W48A 1BI2A 3KLRA 1CQVA 2KDOA 4RCNA 1PZJD 1O80A 3D6WA 1Z3YA 1B8AA 2VKEA 4LG3A 1F2ZA 3EBEA 4LFUA 1NR4A 3J80Z 4RA8A 1LFPA 2ZXPA 1VI0A 3S14J 3OYYA 1YJNI 4EGZA 2L9HA 4LNQA 4XQQA 1TWCB 3CMAA 1P7IA 4II2A 2KLOA 3R93A 1I5FA 1J9OA 2AMCB 1LPQA 2E35A 2OT2A 1B6AA 2IRFG 2CU7A 4PJLA 3ABKH 1XG1A 1L0XB 1WHUA 2GVBA 2JA8G 1PDNC 2X69A 5C44J 1A3UA 4A3FG 1DGWY 1MD2D 2X48A 4ZUIA 4DKAC 2A07F 3PV0A 2KHMA 4AIMA 2L15A 1Z7LA 2QW7A 1CK1A 1D1AA 3GYHX 2X1DA 5AIPA 1E1OA 2WADA 3JW4A 2Z5UA 3AMUA 3C46A 5HLTA 2EIMH 2J4XA 4IHYA 1FX7A 1IN5A 1QOHA 4S0HB 3KBXA 4XN0A 4FXGC 2ZC2A 5EKLA 3NK9A 3KE2A 1V5EA 3G1MA 2F2EA 2MP1A 3TKYA 3IH4A 2XGDA 2RC4A 3T16A 3K5OA 2HWVA 4CH7A 4AC0A 2OCCH 4HMJA 2VQCA 1X6OA 3RLNA 3BY6A 2RNGA 3L3OC 2LSOA 1VMCA 1HW1A 3OW2A 2R7RA 1U5TB 2B63B 2NVXJ 2B2UC 4M3FA 1K79A 1X3ZB 2NYXA 2KBNA 2HDLA 2UWMA 3WHCA 2E5NA 5IYBJ 4B3ML 3LX0A 4ME5A 1OXXK 2L02A 3CKIB 3D3RA 2MPMA 3HS0C 1GXQA 2EYFA 3KZYA 2QILA 2J7ZA 3CPFA 4JG2A 3K4LA 4ZK9B 5IYBG 5L3CA 1K78A 3STBC 2A5WA 2K9NA 3J80K 2AO9A 5D4SA 3MKZA 2Z6KC 2IAIA 2K4JA 2ICEC 3F2UA 3GTLJ 1KDCA 1H9TA 3J81L 3QOJA 1LYLA 3DEOA 3CJQB 4OWXB 1R7JA 3KCCA 4GKKQ 4BBRH 2NN6G 3L2UA 1X58A 1W7PA 2R7DA 5HLHA 1WI3A 2QEXI 3VYRB 3LSIA 1AH9A 3DM1A 2L4NA 5JHFA 4MEYF 1DCZA 5ELFA 3Q5FA 2KJCA 1OCCH 3CCJI 3TBIB 4N9IA 1XD7A 4ODGA 1REPC 3A56A 4IOCF 3SFZA 1I6HH 2STTA 3FKIG 1STEA 3C2PA 2VQHA 2F0QA 1LO5D 1SSOA 3HZJA 1GKHA 2Q8KA 1G3WA 5J1ZA 1YIJA 2O8KA 4LFBQ 1ODDA 1MBJA 3OSGA 1JWMD 1JUMA 4BY1B 2DA5A 3H3VC 1OR7A 2ZBKA 1I5ZA 1L1OB 2F0IA 2LTPA 3P20A 2NWGA 4ESJA 2Y0SB 2Z9HA 1KU2A 2P7VB 1EZ8A 5DCFA 1ERDA 1B9MA 4JX6A 1IUYA 2VW9A 1R4PB 5GAEC 4AQYQ 2Y30A 3I4MG 4UVCA 5CC4A 1KZHA 3NQOA 4LF6Q 1AP0A 4FDBA 5FRMA 1IV6A 3K0YA 2Q1ZB 2V7FA 4BY7B 4NC8A 3U9SA 5FK9C 3X3MA 2R7ZG 1K83B 1I3QB 1LTBD 3WHBA 3QQAA 3K5MA 3HOVG 4ENNA 5BOXA 1SVOA 4C3IJ 4WWCA 3OTOQ 4EQNA 5TGTA 2ZNZA 3W6KB 2FE3A 1TQOA 4FVMA 4RDUA 3RN5A 3OYHA 1ZARA 3EQLF 1TWHJ 3GUDA 1VQBA 4A3MG 4BKXA 4C3IG 4X3TA 5CV5A 4MNUA 2HOTA 1ZYRD 2LY2A 3WTVC 2ZXHA 2DU9A 1GUWA 4L9VA 5JJIA 3U1DA 3CP2A 2RV8A 3A03A 1IO2A 1TY2A 4NXML 3PO2B 2O8XA 4NMZA 3GTPH 4O2DA 3RZDJ 2DPUA 3CF2A 2HQEA 4YWLA 2MABA 3CZ6A 1R1VA 1I4GA 1S5BD 4Q5SF 5HDNA 3CHBD 3VB2A 4A2UA 2K01A 4JW0A 3BOQA 4H7BA 3K0XA 3KYCB 2HEOA 4LF8Q 1GHJA 3HKZE 4IFDG 2UXCL 1QZEA 3G1LA 5BMZA 4DJAA 5K36G 4A3IB 5JVGF 1U4RA 1O3SA 1Y1WG 4NKLA 3FISA 4I76A 4IZ8A 4UUVA 1JORA 3FWEA 3CF5A 2F0PA 1MSGA 3H0DA 4I09A 4GXOA 2ME6A 1EWIA 2WAFA 2PQ8A 2QSFX 2UXDQ 3F22A 3S2HJ 2O6GE 3BQYA 4MTNA 2KQRA 1YVCA 2BCOA 2BY2A 4LB5A 1S72I 2E7WA 2B7EA 1Q8IA 2ZNYA 1HW5A 2MNAA 4MIMA 4OMYA 1W4MA 4I01A 5FKKA 4ETSA 4KFCA 1Z77A 2QSHX 1K6OA 3M8FA 3TP8A 4RBOA 1G8ZD 1U5TA 4JI5Q 2WINB 1STHA 5JFRA 3G6JB 3GV3A 4XRMA 3IKTA 4F87A 4CSWA 3CQZH 1QCBD 4DAYB 1OJLA 1GM5A 1W36C 1D0XA 1H89C 3M4QA 4GKJQ 2EXDA 4FASD 4HX7A 2CG4A 2FOKA 1PFMA 2CWEA 5FROA 3RI4A 3CC7A 2CFXA 4EGVA 2GM4A 1V1OA 4M3GA 2NRAC 3S3OA 3M4OB 4HNVA 1R36A 4YIRX 4B3TL 1IN7A 3OSFA 1I1GA 3FM3A 2QBYB 4JI7Q 3OYDA 4NC7A 5M3MG 2KCMA 1WI5A 2R4GA 1O57A 2ZXIA 2DT6A 2P5VA 3PNTA 1MBEA 1I3AA 4JV5L 1Y6IA 2LXKA 4IFDI 1V1QA 4NB5A 2RQQA 3KOJA 1SYBA 3VYRA 4RAUC 2R7OA 2IBDA 4W1UA 5E8IA 5KNDA 5NUCA 5G3LF 2BDNA 2A05A 2KHJA 1Z47A 4FF3A 1F9RA 1F2LA 4WJ3M 1NMFA 3TBIA 2SNMA 3GP7A 2MFZA 2VE9A 1JJGA 2OJED 2XF5A 3D8GA 1CSPA 3D5LA 1JE5A 1SVLA 1GJXA 3IP4B 3S8PA 2JA6J 1BL0A 1JJCB 2J0TD 4UP8A 1ZELA 2M4GA 3S17H 3N4MA 5TISC 2NVQB 4BBSG 3J80E 3QP6A 4F55A 2KL4A 2JA6G 4ZDOA 4KY6A 3R0AA 3E6CC 5BN3A 1J8IA 1L1OA 4ZKCB 2Y0SA 1HNWQ 4XICA 2NZOA 3RPQA 2IGMA 1NMGA 1D7QA 4V2FA 3CMYA 2CYYA 1MSHA 4X3SA 2L54A 4U0WA 1ZTRA 1GDTA 3I72A 2K86A 1V8QA 3Q0AA 2OU2A 3FHWA 1LDDA 3MZYA 4K0KL 3WU1B 4PJNA 4LF4Q 2AQ1B 5F1JA 4DUYQ 1LKXA 4IRGA 2P8TA 4ABNA 4GZYC 3G71A 2K9QA 1EEID 1B4AA 2E7XA 1B3QA 2VUMH 5EJWA 3WTWC 4HQEA 4P96A 1T9HA 2OQKA 2UUCQ 2QVOA 1WSUA 3FXOA 3S9WA 1LFUP 1L0YB 3A2KA 3GTQH 2HOSA 3MC0B 3CF5F 1LABA 4DBRA 4YY3Q 5ILUA 2VQEQ 4JI1L 2CHBD 1IBKQ 3K80C 5JI6A 2O4XA 2VT2A 3F0CA 5CGKA 1BI0A 2IHFA 3EN2A 4K6LA 4O5VA 3QJYA 2K9LA 2EYLA 2RKHA 2PG4A 2IA0A 4ZZLA 4EJUA 4RGOS 1QU3A 5FFXA 1VQMA 1U5KA 2M00A 5ELOA 2N8GA 2PMHA 1HZAA 2ECCA 2CQQA 4BDZA 4XSZF 4CZCA 4IRHA 5H6RA 1XMXA 4DAPA 2QM3A 1N77A 1QVCA 1KRTA 3K0LA 3SK4A 1KDAA 1QE6A 5ELDA 4C3HH 5BS6A 1K3RA 2N78A 4ZQ3A 3GTJJ 2XVCA 3E6ZX 3TEHB 2VPLA 2EINH 4ESBA 4DK6C 4CDCC 1YITA 1C7YA 1IC8A 1EIGA 3BZ6A 1ZYRC 4DV4Q 4XOPA 2A5YB 5LEKA 2GQQA 3K4MA 2JJ7A 5KNBA 5F64A 2M2LA 2WY8Q 4BBRB 1U8BA 2HIVA 3ONQA 4GRIA 4KHPL 4LF9L 1ETYA 1XSXA 2R7VA 2FD5A 4JI4Q 1FT9A 4AYBN 3HOYH 4CCLA 2KJBA 2R92H 1YZ6A 5DD8A 1X9NA 3P7JA 1E17A 2GA4B 3ER0A 4DAYA 4OO1H 3CTAA 1TQIA 2PPBC 2F0VA 1I6HB 3VWBA 3MZ8A 2HQNA 2F4MB 4E6KG 5KEEA 1YS6A 5GAGC 2B8FA 1OMIA 2M3AA 3CCSA 2LSSA 5D3IB 2BVMA 1SYGA 1KU9A 1ZLJA 2L0KA 3OYBA 2JSOA 3AFHA 2E2DC 4DYRA 5DNFA 4RB3C 2QBYA 2PZTA 2BYVE 5HODA 3PNVA 4ZLTF 1K73C 2IW5A 3VR4A 3BTIA 5CBAE 1AA7A 5EAYA 3BYTB 4JOIC 5LL6S 2XKOA 2SEBD 1K9MC 3KBGA 4AYBG 2ZTCA 5C3XA 2R61A 5JR3A 1YIOA 2E5LL 5GADJ 3D4WA 2XRLA 2L5QA 2XDVA 1UJ8A 4JI3L 3RCOA 1XSDA 4DAMA 2JA7H 4OELB 4QCLA 1YG2A 4XOTA 1G3YA 2RDPA 2EQRA 1YOVB 4I0AA 1Z21A 4C3JG 2F0TA 2XAQA 3ECOA 2AS5F 1N8RC 3AQQA 3Q3SA 3DBHB 4IQJA 5H6QA 4EQQA 4ESFA 2AQEA 3NXWA 2UUAQ 1Y0NA 3PIOA 2ME0A 3LL7A 4A3BJ 3CDLA 1M8AA 2CV0A 4POGA 2DQRA 1N36Q 1YIJI 2YTYA 3LGJA 5IGCA 4L5IA 1R5ID 5KNCA 4CHTB 1R9TH 3NBIA 1D5ZC 2XPWA 4MO7A 1JOKA 1LTGD 3GBGA 1PH4A 1MMDA 4E7LA 4ASNA 2HVSA 3H15A 3N52A 4QJFA 3IRRA 3BLYA 2H27A 3QO2A 1WKMA 5JJZA 1GD7A 1HCZA 3M7GA 4A93J 1G3TA 1MJEA 3GTPB 2P4WA 3HFZB 4JBKA 1WTXA 5CQEA 1RTOA 2RVCA 4BA2I 1IXRA 1SYCA 4LUZA 3ULPA 4E7ZA 4A93G 1DM0B 1ITYA 4F52A 1Q8KA 3K59A 5BR8Q 2F4VQ 4A3EJ 4RB2C 1SANA 1SD6A 3DWPA 1HNXQ 3G7LA 4L0YB 1Y39A 5JJKA 3HOZJ 2W7NA 4L5QA 2DN0A 4IHXA 4A3EG 2BVLA 4A3KJ 4KITB 2JEBI 2WB1B 2V26A 1GUOA 2L9VA 1PJRA 3HOZG 3JREA 3HGYA 2ASBA 4HF0A 2K3PA 4K2KA 5EEHA 2VBZA 4WJ4A 4EEFG 4A3KG 4PSWA 3OYMA 1B1ZA 1S3OA 1EQTA 3H5RA 4LOCA 4DV3L 4V2GA 5E1XA 3LSMA 3BVGA 1E2WA 3CRKC 1OXVA 3HG9A 5C4XJ 5IYCJ 1LTTD 4KMFA 1X1AA 3TP6A 2R93J 1M90C 2ZJRF 1FEXA 3ZQIA 2OV7A 1IRFA 5KYLA 2QENA 4X65L 3I55A 1XNQQ 2HQ5A 3TDUC 5C4XG 4XK4A 5M5WB 1P6RA 1L3LA 4NC6A 3SDBA 3WTZA 2R93G 2LF8A 1BJAA 2EYPA 5LLQA 4QQBX 1RKNA 3PQJA 1CFMA 1ZYRF 1NAPA 1QPIA 3S14H 3ZRGA 1EL0A 3PSFA 1EWHA 3R2TA 3FMRA 2VS1A 4LIVA 4MZ9A 3J7ZC 4IQZA 1W5TA 3D1NI 2A6HF 3WG7H 1R5GA 3HOUJ 3LQQA 2VL6A 2FNAA 1ONLA 4EVIA 4LITA 2XVSA 3TZDA 2BHZA 1ZGJA 3HOUG 4PJJA 3GD7A 1XPRA 5IP7J 2KMUA 2VNUD 1W2BA 2SNSA 2Q2UA 1T38A 3PFIA 2JA5G 4H13C 2CUEA 1O7ZA 1TQMA 2EOTA 3NQIA 4X3KA 1BOBA 4XLHA 1IL8A 3BG3A 1N32L 2FJ1A 2HHHQ 2IPKD 1CGPA 2M45A 1F4KA 3M7NA 5H2FC 1FNUA 1ZGWA 2OF1A 5DLQE 4YHHQ 5GTIC 4E4HA 1FOXA 3G4SA 2HOAA 5B1BH 1DPRA 3OOPA 3PIOF 1PRTD 3OOUA 1PP7U 5M5XJ 1TL8A 3F9KA 2HVRA 2F0HA 4WF2A 5BPDA 5M5YJ 2G5DA 3EPZA 1CM9A 2NVXH 2FX0A 1HNZL 3U2RA 3K6OA 2K9SA 1QVGA 4B43A 4M9SA 1EQVA 1HDDC 3TP3A 2Q2EB 5IYBH 4BQQA 1HFGA 4LUOA 3L7ZC 4WCGA 1KONA 2VKHA 1HPCA 2CFOA 2MGQA 3S1QH 4LUVA 3CCUA 1GUSA 1VQAA 4F3QA 4CGZA 1MH4A 4L5SA 2DYSH 4OEMB 2DLLA 4G7OF 3DFGA 5IOZA 1BQQT 1MMNA 3I53A 2NN6H 2E1MC 2KRFA 3GTLH 3TMEA 3VDYA 1SFUA 4FTHA 2PI0A 1QZGA 2BE5F 4GOPB 2H8WA 1WCMJ 4KISA 3OWEB 2VBXA 2CUZA 4DUZQ 4KN7C 5J3LA 2E1NA 3DHQA 1D5MC 1MH3A 2HZTA 1KQSA 3KLSX 2NVUB 1LT6D 2W84A 2BW3B 3D4RA 4M3DA 3L7WA 1UAAA 5T1GA 2BEOA 4XT1B 1WCMG 2HQAA 5EG0B 1VQOA 3CCLA 3ABLH 5IIFA 2B0LA 3H09A 4PDKA 3HOXJ 5LHHA 1T5EA 2WC2A 3FKIH 1RF2D 4A3CJ 5AJ3L 2JWTA 3HHHA 2K75A 2ZXJA 1AU7A 2B2WC 3NTHA 1KAWA 2VOPA 1N33L 3FXKA 1VNDA 1D0YA 2F4IA 4A3CG 3WGGA 4A12A 3F8FA 4OIJA 1PRTB 5A2QZ 4LB6B 2Z4HA 2DT5A 4IUVA 2G9DA 1S40A 1UG2A 1ORKA 3T8TA 2QQ8A 1I39A 3CW2C 3L2CA 4O3MA 4OX9Q 4C3HB 4XLNF 4KIFA 3I4MH 5C4JJ 2F5VA 2DT7B 2WB1A 3S2DJ 2L4MA 1TW3A 4G7ZC 4FXKC 3HDDA 1L0WA 3MKLA 2FMCA 4HSPA 1YW9A 2MC4A 4CGYB 4ZTFA 4YWMA 3GTMJ 2FMLA 3A1YA 3MWMA 3I2ZA 2K9MA 1Z6TA 3CD6I 2GA2A 2YPRA 4X66L 4NP5A 2JSCA 2E2HJ 3ZQQA 4DNCA 1VQ7A 1OLTA 4Y7NJ 2ZO4A 1LDKB 3ABUA 1SLJA 4B3SQ 1WJAA 5BPIA 1FTTA 2EB7A 3U21A 5DD4A 1NR2A 1RESA 1N75A 3OL3A 4A3MH 1ILPA 5KCMA 4C3IH 2FUG2 3RDIA 1VQMI 1BR2A 2MO1A 1PA6A 4B48A 3W2WA 1K8AC 4ITVA 2QKLB 2UUBQ 5FLMJ 5TSSA 2WTEA 4UVBA 1FBUA 1X1CA 3ZGKA 5HDGA 2C5CA 5DV5A 3MA2B 1A63A 5FLMG 1ETWA 4IRIA 2FBKA 5IT9L 4FQGA 1RJTA 2KENA 1EY8A 3F2BA 3MAQA 1BOSA 5JEAJ 1BCPD 2K6AA 3RZDH 4GNXC 2DOAA 1YITI 2JA9A 2LP0A 3P7NA 3T53B 3COAC 5GPAA 5K36H 5LMNW 3GFMA 1Y1WH 5JEAG 3HKZN 2D0PA 4F88A 5C3EB 4K6DA 3E6MA 3A5ZB 4IUQA 4PQXA 4IJHA 5A2QK 4QL5A 5AFWA 1G2TA 2EFQA 2A1AA 3ZQCA 2JA7B 2L4AA 2VB3X 2ICIA 1II3A 4JYAQ 3T1YQ 1TBXA 5M3FB 5EGTA 1J0RA 2LMCB 4RG1A 5E17F 1C8CA 4M71A 1YO5C 4DV1Q 4IUPA 3TSSA 2D0OA 3OIOA 2H8RA 4LF5L 3A5UA 1WQ2A 1ZG3A 5EEAA 2ALYB 3BG7A 3J81j 4CCOA 4K2LA 2DN8A 2QKIC 4BXXJ 3GV6A 3CCSI 2AUJD 1X3EA 2GLOA 2M87A 1K3BC 2NTTA 3GFLA 1R9TB 3HKZG 1IRZA 1JT0A 2DQLA 3VOEA 1R00A 2YS9A 4BXXG 3S1MJ 1WJDA 1ML0D 1KIXA 4GOPC 2R7FA 1BJZA 2Q2EA 4G6DA 3B6AA 4XN3A 4B9WA 2JPBA 3PJRA 4LWCA 3KF6B 1EEFD 2JXMB 3U1KA 5M3MH 3IV5A 2Z1CA 2WFWA 5FLVA 3CMEA 5E79C 3JRIA 3RQ4A 2GXGA 1I4HA 2LVSA 5IYDJ 2PFBA 3F2CA 4PNYA 3RIRA 4Q48A 1HR0L 2E5ZA 4HG2A 3KDFB 2LFNA 3DUZA 2NNNA 4HLXA 1ZGAA 2IGOA 2BW3A 5IYDG 2WAQB 2A68C 5EG0A 5LRRA 2KPMA 1FGUA 4CHUA 2MW8A 3I58A 3T56B 3GTKJ 2R0QC 5J1UA 3HOSA 4UXNA 2B2VA 5CV7A 3KX2A 1JHHA 3B73A 4L63B 2MLKA 3CJRB 3IL2A 3K69A 4U7BA 2KHIA 1R5HA 2VC0A 1IYUA 2UXXA 2YTXA 1T39A 1POGA 3QU3A 4BBSH 2GIVA 2L01A 1PTOD 4YEJA 1KAAA 1IYJB 4DGWB 4U673 2DMNA 2JA6H 2I46A 3CCQA 2I5MX 5D3DA 4DV0L 3UDGA 3L00A 5D5WB 1LJ9A 4TV7A 1EQQA 2LMDA 1JUPA 1TY0A 1UB9A 4NNJA 2HKXA 3JRGA 4BHCA 3KEOA 3B6YA 4CDEC 5IT9c 1S5CD 4X62L 1JKQC 2CGPA 2KCTA 4OAZA 1Z9CA 4MTEA 2D5VA 4ENJA 3DXJF 2WA0A 4P71A 2Z9OA 1A62A 2JA8B 3NWSA 2X6GA 1U8RA 1TS3A 2W24A 2K5NA 4A3FB 1G2HA 2DA7A 4GN3B 2IL8A 1M1KC 1XN7A 4QTRA 4O6JA 3NP8A 1LEBA 4LMYA 2RCNA 2DMQA 1MJBA 5T1IA 3KJPA 3AYHB 4MFDA 1FR3A 1VQLA 1PHJA 2HR3A 3A0HC 1LT3D 1E0BA 4CXFA 1U3EM 1K0RA 4U88A 2EFPA 3EROA 3I55I 2EWNA 2EPBA 5JHUA 5J8CA 1KXLA 2CUFA 2DDBA 2BOSA 3FMSA 1UEBA 3TP7A 1J9IA 2CH4W 3RYPA 5HGQA 3I9V2 2XKPA 1WH7A 1PTOB 1Y69U 5FGMA 4FF4A 2YU9J 3G2BA 1KA8A 2LBFB 2MH2A 1VQ5I 3FM5A 2NVXB 3TGNA 3TP5A 2R7QA 2L5TA 3G3ZA 1JCKB 3M1CA 3J81i 2PMZE 4G8XA 4JI2Q 1GVPA 2B29A 2F0NA 2NS8A 5J4YA 2IA2A 1DOMA 3ZJYC 2V4DA 3S1QB 2LLKA 2LR8A 1Y1VG 1AN8A 3J7YJ 3HSRA 4Q4ZF 4B47A 1WTWA 3OYAA 1RL2A 2EJMA 3DM3A 1VQPA 2EQSA 1OYIA 2K27A
chains in the Genus database with same CATH topology
1RDPD 1CHPD 2V7FA 3K4NA 4BY7B 1BDOA 1G59A 3PIP3 1OXTA 4MN3A 4NC8A 3U9SA 4C56C 1X4OA 5FK9C 3X3MA 1K83B 3GTLB 3QYFA 1I3QB 1LTBD 4I65A 3K5MA 1Q90A 4J8QA 1EYAA 2A6EC 2B2WA 1B3AA 1HQMC 4EQNA 1QG7A 5TGTA 3A8KE 1TQOA 3I3CA 4FVMA 4KY7A 4HPQA 5CV8A 3OYHA 4HCSA 2MHVA 1YX3A 3I3LA 4BE0A 1JICA 5ELCA 1X1BA 4XDXA 1YNJC 4C3IG 4X3TA 1O7LA 5CV5A 4RM3A 1ZYRD 3X3NA 2LY2A 3RPUD 1BCPC 2ZXHA 1KLUD 1WD0A 1WVLA 1GUWA 2GOMA 3OYIA 3CP2A 2HU9A 4Q0FA 3M8JA 5E4WC 1TY2A 3PO2B 4C1NI 3NHHA 4NMZA 2XWBB 5IGFA 1AFPA 3FKIB 2DNEA 1CQFA 4JK1C 2PMZA 3A7LA 3LFUA 4PUSA 3K5LA 2EDGA 3CU7A 3CF2A 1CZGA 2HQEA 2VXZA 1VF5C 3BVZA 1IYVA 2MABA 5KYIA 3CZ6A 2R7SA 5A2QE 1I4GA 5CR3A 1S5BD 3L2RA 2MD0A 1ENCA 3CHBD 2M9VA 1ENAA 1GOZA 2K01A 2SOBA 2W00A 4H7BA 1ESFA 4RMNA 3K4CA 2VJ5A 4KKTA 1LTAD 1GHJA 1PRTF 4IFDG 1MMGA 3R3OA 3D31A 3H9GA 5ISRA 2WACA 1GUGA 4DJAA 5K36G 4HSVA 2WKCA 4A3IB 1U4RA 1DYQA 1FYCA 3H94A 4NKLA 3W2DA 1D6EC 2YU9B 3DLAA 4IZ8A 3VA5A 1BF4A 3JAML 1JORA 1AZPA 2KEDA 2F0EA 2F0PA 2F0KA 1MSGA 3BCBA 4O42A 3H0DA 3I4MB 4OL7A 1YNJD 2WAFA 1ICWA 3OHXC 3SXHA 5FO7B 2WAQA 1MNDA 3K70D 1Y1VB 4G7OC 3VSLA 4NQWB 4IFDH 2KQRA 1U0JA 5EKIA 3SVMA 2DXIA 2Z4IA 2BCOA 3ND9A 3K7AB 1Q8IA 2BE5C 1NCVA 1SNPA 2KZVA 4BDYA 2QCPX 2R7ZB 3LNNA 1EFID 1TIID 3HOVB 3S32A 1SNOA 3MWYW 2ZSHB 5ELBA 3TP8A 1G8ZD 4HMIA 1GHKA 1TS4A 2WINB 4XNFA 4M8AA 3PO3B 5I4DA 1STHA 1Y8PB 5CORA 3J7YW 4KD3A 5IODA 3G6JB 5IGGA 2WV6D 3MXUA 2RSNA 1KNEA 5C0XJ 1Z3XA 3PUBA 1TWAB 3GV3A 4A3MB 3VYSB 4C3IB 5JAVA 4F87A 4CSWA 2HCIA 1SYDA 1QCBD 2F0DA 5E4XA 4HEDA 1H9SB 4O1NA 1EYDA 1W36C 2ZXOA 3HKZA 1D0XA 1HFNA 4BJTA 4FASD 3FVQA 5C0XG 2HNHA 5DM73 3VR5A 3AB9A 2L9NA 1CA6A 4FO2A 1H9MA 1JOOA 1PFMA 5FROA 3SK5A 2XSJC 3IAM2 4EGVA 2TSSA 1V1OA 2VJJA 3HUGB 5FKAC 3S3OA 3M4OB 3S1RB 1R6RA 1SYFA 4RLQA 4G7HC 1FNWA 2E2IB 2RREA 3OYDA 4NC7A 3HPHA 4DA2A 2R4GA 5C4ZA 1D5XC 4FF2A 2ZXIA 2DT6A 3VR3A 3Q24A 3PNTA 5EBCA 2V1NA 1Y6IA 4IFDI 1WFXA 4E7HA 4YRVA 2RQQA 1GUTA 1MW7A 1HUNA 1SYBA 3VYRA 1WTPA 1LT5D 4RAUC 1Y1WB 2R7OA 2LYCA 1CTMA 2A74C 4FYDA 2V6EA 1FMVA 5KNDA 3PIO3 2VIXA 5NUCA 5G3LF 4OGQC 2JYOA 4PMWA 1EWCA 1PTOC 2BDNA 1DOLA 4XL9A 2ZXRA 3FPUB 4KTAA 3T51B 1Z47A 4FF3A 4B3XA 1F9RA 1F2LA 3IFDA 4B08A 2VASA 5KIXA 1BCPB 1RTNA 3TBIA 1W36D 1SAPA 4XKWA 2SNMA 3GP7A 2MFZA 3KEYA 3URYA 4LJZC 2M7AA 2XF5A 1SNCA 3D8GA 5KNLA 2MJ8A 4CCKA 1LLRD 3D5LA 2K32A 1OO9B 1GJXA 3I4LA 4XMYA 3EJIA 3OYLA 3IP4B 3S8PA 4A3BB 3CQZB 3K6GA 2PCFB 4QF4A 4WFN3 3HOTA 2J0TD 4DXFA 3MTSA 4IN3A 1PZKD 4DK0A 1ZELA 4HAEA 3KF8A 4F8MA 2M4GA 2NVQB 1KABA 1HHVA 3J80E 1STYA 3NTKA 3VR2A 2RDHA 1IRXA 3AU7A 4F55A 3M85A 3K4KA 2LH9A 2KL4A 4ZDOA 2CVRA 4JQFA 3QYBA 3V2TA 2E74C 4KY6A 1ZXTA 1KLGD 2RDGA 3UR3C 2R3ZA 4KHVA 5BN3A 2JUGA 1J8IA 4DBQA 1GUNA 1NUCA 4ZKCB 2LBFA 1QWYA 4IURA 3R8BA 1UELB 2Y0SA 1TKWB 2B39A 3PNYA 2M0MA 3T13A 3MKWB 3SHLA 2X85A 2IGMA 1T95A 1ZKOA 4G57A 4KK7A 4BU2A 2ZT9C 1MSHA 4X3SA 2KUMA 1JC7A 4K5WA 3MXPA 1FNVA 3I72A 3FHNA 1K6YA 1A3TA 1V8QA 3Q0AA 1HQRD 2KJXA 4XIGS 4CA0A 4EQPA 5CPRB 3WDNA 4A3EB 3AKZA 3K5NA 3DEPA 4MHEA 4PJNA 3BDCA 2AQ1B 5LFAA 3C3LA 4RWSC 5M3MB 1LKXA 3OYJA 3MHBA 4ABNA 4GZYC 4KJNA 3HOZB 4DNTB 2OXPA 1EEID 3PUWA 2NZ1D 1EY9A 2CH0A 5EJWA 3RZOB 3MFYA 3MVVA 4XYQA 3A4CA 1I6VC 2LKVA 2CV1A 3QYEA 4RLFA 4A3KB 2H1EA 2R6GA 3S9WA 2F0MA 1AZQA 1HTPA 2B2UA 3HEJA 5COYA 1F2YA 1H9RA 1L0YB 3VYTB 2D9UA 3A2KA 1I4PA 3VYUB 1HXYD 4I7ZC 4IUNA 5KGUA 3IL8A 5I2XA 3MC0B 4CBVA 2IW3A 1C4QA 3S17B 1LABA 3OMCA 4XQNA 2EYJA 2B8GA 4DBRA 2N88A 2FHTA 3BS1A 2CHBD 1VDZA 2ELJA 4K8IA 1YNND 4C1NK 2DNCA 3PUYA 2EZVA 3L2QA 1V1PB 4QMGA 3EUKL 2O4XA 5CGKA 5JPMC 4XTCS 5CBEE 4K6LA 1YX5A 3QJYA 3IAS2 3QWNA 2K9LA 1MBYA 2KRCA 4BJ6C 1WJBA 2EYLA 4CJ0B 2R7XA 1ZEQX 2FFKB 4G6TB 4HRIA 3V05A 4BBSB 4RGOS 1QU3A 4XLFA 2E76C 3KK7A 4A3JB 2JA6B 4F91B 2M00A 1SJED 3A7AB 5CYUA 4BDZA 4ZYSA 4CZCA 4PJMA 5D14A 3J81E 3S1NB 1KNAA 1XXGA 5CMDA 1LTSD 4QPQA 3NTIA 4DAPA 2EY6A 1N77A 1B50A 2EY1A 3A55A 1QB5D 3SK4A 3MMYB 1KDAA 4DU9A 1QE6A 5J22A 4FETA 4X0GA 5ELDA 1XX8A 3QOEA 1W6KA 2VUMB 1KDBA 2IGNA 4ZQ3A 1WTQA 2K33A 4J6HA 1Q12A 1M4VA 3E6ZX 2VPLA 4D9JA 2I8DA 2BOLA 2C9OA 2MUYA 1XWEA 2LG4A 4FP5D 1ENFA 1EIGA 2V4JC 3GTQB 2KEEA 5I6WA 4II3A 1ZYRC 4DK1A 4XOPA 1Y8OB 3K4MA 1WD1A 5KNBA 1LTID 2M2LA 2WY8Q 3A8JE 4CCJA 4BBRB 2F03A 2K03A 5JVG3 4IKFA 2L55A 4IUUA 3ONQA 4GRIA 2BDOA 4WJWA 4OWRB 2F0WA 5DAUA 1Q1EA 2Z1DA 2R7VA 4BS9A 1JWSD 4CCLA 5E3FA 4DNRB 3R2IA 5HURA 3NPPA 1QNKA 3DEEA 3I4NB 3L9AX 2JE6I 2PJRB 2KRHA 2L12A 1S5ED 4LIUA 4UAIA 2XN9C 1EY4A 3P7JA 1HTLD 4HSRA 2CW7A 2GA4B 1H9JA 1SAUA 1H9SA 4DAYA 4OO1H 2A73B 1PYVA 3PUZA 3CP8A 2VL8A 1P9QC 2PPBC 2F0VA 1I6HB 3VWBA 2B2TA 1TZLA 4XQFA 4E6KG 2JVHA 5KEEA 1BR4A 1GXDC 3OS0A 5M5XB 2B8FA 2NBFA 3VSKA 2M3AA 2K5WA 5D3IB 5M5YB 2BVMA 1SYGA 1WJCA 3OYBA 2JSOA 3AFHA 2F0JA 2E2DC 4CKBA 5DNFA 2F3VA 1A3VA 1OXUA 4HTHA 2ZFUA 3K70C 3S3MA 2PZTA 4BA1I 3PNVA 4M1UB 4ZLTF 1I4QA 4ZAIA 1CHQD 1PTOF 2NVYB 1EY7A 1TS5A 3NUCA 4RH6A 2XC7A 4L8JA 3VR4A 1IW7D 5CBAE 1AA7A 3BYTB 1S4ZA 2XIWA 3ITPA 5LL6S 2SEBD 3HRZC 3A54A 3KBGA 1JB3A 5C3XA 3I73A 2R61A 4QUFA 4YIJA 3E1SA 4FNFA 3D4WA 3ZYYX 1UEAB 4IFDJ 3DXJC 2L5QA 2LRDA 2XDVA 3S3NA 3RCOA 4IX7A 4ZDPA 4CKEA 4QCLA 1W6JA 4XOTA 4F93B 2R7TA 3FPPA 1Z21A 1AW7A 4C3JG 2F0TA 4ZC3A 3HOYB 4ANJA 2CMPA 2R92B 1VZ0A 1FGBD 1GLNA 1WJEA 3GTJB 4PMBA 4DF7A 3C2GA 4MIUA 4IQJA 2IS6A 4PK4A 2AQEA 2B2YC