3HG9A

Crystal structure of putative pilm protein from pseudomonas aeruginosa 2192
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
119
structure length
119
Chain Sequence
LAEVDTLARSLLLYRSRLAEYAHANPGFSGSPADSALGLPAWFRKPVRLQGYIAAGTSYAFIASPPAGLAAAVDTGTESDLVGVRRNGQLVTRRLGATAIALPAPIPEGAVVAVKEGHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title CRYSTAL STRUCTURE OF putative pilM protein from Pseudomonas aeruginosa 2192
rcsb
source organism Pseudomonas aeruginosa
molecule tags Structural genomics, unknown function
molecule keywords PilM
total genus 16
structure length 119
sequence length 119
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-05-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1170 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3hg9A01
2.40.50.380 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3hg9A02
3HG9A
chains in the Genus database with same CATH superfamily
1R23A 1ZG3A 2W7NA 4IUVA 2XGEA 1Y8QB 4R8NA 2D45A 2FU4A 5EPJA 4CICA 2X1CA 4ESJA 2FOWA 1LTAD 5A2QK 1BQQT 1B4AA 1ZEQX 4DR2L 2F03A 3DHQA 4P72A 3BJOA 1PYVA 1WTVA 1IW7C 2GA2A 4YFKF 4DA2A 1PJRA 2E2JB 1V8QA 5IOCA 1VQ4A 4HLYA 1JKRC 3AG2H 3FWEA 1PDNC 2R7SA 2XTIA 1F77A 1W0UA 5HLIA 1F1ZA 4JI3Q 1KU9A 5AONA 1XNQL 2JA7B 3MC0B 2X6XA 3HOWJ 1D5YA 1FPQA 5EKLA 1MMSA 3H92A 4XLFA 1O7ZA 5BR8L 1X6OA 5CYVA 2LY9A 2TDXA 5C3EJ 5K1YA 3PUFA 1OCZH 4BS9A 2YU9H 4OONA 1LUZA 3HSFA 1LJ9A 3HRSA 3AYHB 1JE8A 1SFOH 1RUNA 1M90C 5J8CA 2RAEA 4HIKA 2R5ZA 1VQBA 4ZYDA 2C35B 4F92B 1Q81C 2W4SA 5C4XJ 4V190 3HOZJ 4BXXJ 2BXZA 3S1MB 1EIGA 5ICCA 3X2QH 2RF4A 5LRSA 4G6QA 3J7A5 1XPXA 4QWQA 1B70B 4KY7A 3TEDA 5JPNC 3QO2A 4H0LC 4G12A 4LWCA 3UKGA 1VQKI 2VW9A 3F23A 5F27A 5T1GA 4GXOA 3SHFA 4OWWB 1MSFC 4DYCA 1X65A 2QEJC 4F88A 2P5LC 3HUGA 1DGRM 2LK2A 2B2TC 1QCBD 2GN5A 1HA8A 1H9SB 4IVNA 3T5XA 4IUQA 3RR5A 2E1NA 2EXDA 1M4VA 4EM0B 2CCZA 3S16H 2GA4B 3GTJJ 3S1QH 2HPIA 1ZQ3P 2Z9OA 1GHKA 4PFOA 3W3AA 2VKDA 2ID3A 4CDGA 1X9NA 2XKOA 3NQIA 4YCVA 3M4YA 4IFDG 4QPOA 4V19K 5E20A 1SMYD 3OMCA 5A2QL 5EZHA 1ERDA 2HKXA 2KZGA 2WY8Q 4P71A 5DD8A 4QSHA 4Y7NH 5EKKA 1UMQA 4D1QA 1K8MA 3EUHA 2JA8G 4WX9A 4N4OB 4XQNA 1R7JA 5GAEC 3H91A 2EYMA 2E2IB 3MAJA 1MBKA 1K3RA 3FVQA 4J8QA 3CF5A 2VKHA 3H0GJ 4QQBX 4IXAA 3CCLA 4ID6A 4XQQA 3CP8A 5B1BH 4HQMA 1EQVA 4NNJA 1WCMG 2WTEA 4R79A 1S29A 3TP0A 2LBFA 3C3LA 1BR2A 1EH6A 3PUBA 2C9OA 3I2ZA 1SC7A 3K5LA 3F2UA 3ZMVA 3GXOA 3BR6A 3WU2C 1S8NA 2XAHA 3KP3A 1ESFA 2B2WA 1IHZA 2F6CA 4KKSA 2QZ8A 1B72B 1GUWA 1VQ5A 1L1OB 3U4ZA 2CVRA 2K03A 1GOZA 4A3MG 4EJTA 3BCBA 1ZRCA 1Z47A 1N33Q 1U8RA 1HC8A 2R7XA 2BE5F 1E1TA 5IOZA 5CYUA 1ENFA 1JJCB 3QWNA 3WODF 4Y4RA 3S3MA 5FLMH 2R5ZB 1BBUA 3T53B 1I50J 1Y0NA 1TS4A 1KNAA 4I99C 4HF0A 3VWBA 2EV5A 3CUOA 1SNPA 5EZGA 4OWXB 1BI3A 3OWFA 1OJLA 3WTSC 3QYFA 4CCMA 1QVGA 2ATWA 2M8EA 3IKVA 2VPLA 4A76A 1UHWA 2RKSA 1H9GA 3UI2A 1DYQA 3QPLA 3HHHA 2VE8A 3TZUA 2WIIB 2Y0SA 5BPDA 1W5TA 2N8NA 4R4QA 1OXUA 3I4NB 2YSRA 4HNUA 3K1NA 3NTKA 5IY0A 1ENHA 3EDPA 2I5LX 1BM9A 1H9MA 4X62Q 1EY5A 4L5QA 3A1YA 5D8LB 2HKOA 2Q8KA 3J7ZC 1OCCH 4JI7L 3VR4A 1UE5A 2V1UA 1TWFJ 1BI2A 3E3VA 3F21A 3VSKA 1A5JA 5C5MA 3CO6C 3F0CA 1VF7A 1X54A 3W2VA 4JVZA 2CWEA 1Z91A 3SGIA 3OYIA 3GTMJ 3OYDA 2DA4A 4Q47A 1DU0A 4X64Q 3CCUA 2FJ2A 3TL4X 1ETWA 2R3SA 1MJCA 1J6QA 3TQNA 4IPDA 4ALPA 3IFTA 1ICFB 1J8IA 3WTTC 3S9WA 2A73B 2GIVA 5IYBJ 5C3WA 2NVQB 1FT9A 4Q0FA 4QPQA 4OEMB 2R93J 1QNTA 4B1RA 2MA3A 2JA5B 2DFHA 3CMAA 3F8BA 3A0JA 4N4NB 2R7WA 2BBYA 4PJ0C 5E17F 3ZYYX 1JT0A 3HDDA 3T1BA 4OAYA 3DEOA 4J15A 2VNUD 4A3FJ 2M1BA 4Y52J 2LMCB 2FJ1A 1TP4A 3FMRA 3F6VA 2HT1A 2A6TA 3GX4X 1VQAA 1S5DD 1LLRD 4HV6A 3EJIA 1XG1A 3LA2A 2IRFG 1YFHA 2W84A 4RB2C 2P4WA 4GFBA 5IP7H 1KDAA 4K0KQ 4CCNA 2CO5A 3OSFA 2MGQA 4A3DB 2O2LD 1SYGA 3I72A 3BQZA 1DGWY 4LNQA 4ENKA 4PQXA 1MKMA 4JI6Q 3S1NB 4WXDA 5JEAH 3Q24A 1TWHB 4K6DA 5D14A 2L5TA 3OYLA 3QOEA 1N78A 3LSHA 3H35A 2GVBA 2QQBA 2CQNA 2XNAC 1SDFA 1S7EA 4DK1A 1K6YA 2UUZA 1U9NA 4DR1Q 2DBBA 2K5HA 2KLOA 1NE3A 3LOCA 3ICEA 2EILH 3A01B 4FQGA 2NVUB 1AA7A 4S04A 2EZVA 3URYA 2QCPX 4P2CB 1Q1HA 2E60A 4GLAC 4YWMA 4FTHA 2AXTC 2IA2A 3K9TA 3I71A 2NVYB 5LGUA 1DP7P 2OUMA 1ILQA 2XN9C 1EYAA 4HJAA 1UG0A 3C7JA 3FXOA 2XRSD 4A3EB 2V9VA 2R7TA 2F0EA 1EU4A 2QVOA 4GN5A 3H0DA 2VI6A 3JSPA 4QIWE 2X1EA 1HKTA 2R7FA 4YIIA 3KLWA 1SE4A 2E36A 3K70D 5DD4A 3GQBA 1I27A 1R5GA 2G9WA 3RPQA 5F2DA 4IPGA 1PH4A 1CQFA 1FX7A 1Z7UA 2DA1A 3CQZJ 2D5DA 2DQRA 2L02A 2KMUA 4O5VA 1BR9A 1VQNA 1BCPD 1GUNA 3ABMH 3TGNA 3AMUA 5J1UA 2L7MP 5ELFA 4HX8A 3BTCA 3HKZA 2O7OA 1V1PA 3PMFA 2QILA 2ESNA 1BF4A 2ICIA 4C3HJ 5I2YA 3SR1A 4EJWA 5CQEA 2VUMG 2KCNA 3GTPH 4HIMA 5GP9A 1G2TA 1B9NA 3L2QA 1V54H 3CC7I 5CV5A 1A04A 3DXJC 1F9RA 3AFHA 4O2DA 5IY5H 2DXIA 3Q3SA 4I0AA 3EUKL 4AYBG 3HXLA 4EV0A 3Q5FA 1JE4A 3KF6A 3BVMA 2K9SA 2BHYA 4GRIA 3K0LA 1TT0A 5CV6A 1STAA 1MIUA 5DLQE 4AQYQ 3S17H 2DMPA 1Q82C 4HN7A 2ISZA 4A3FH 2F0QA 3SEBA 5J22A 2BZTA 2L55A 4P9FA 2B2UC 1EYGA 5KRUA 2SNMA 3P1HA 5CV9A 3EUHC 2K86A 1HDPA 4LK1C 2HHHL 2QA4I 3W2WA 4BL0B 4ESFA 2F3WA 1J5EL 3ECHA 3PF4A 1WJCA 1AN8A 4W97A 3CHBD 1SVLA 1W7PA 1QPIA 2CH4A 1TT2A 1V1QA 4F91B 3L2UA 3CDIA 5K7FA 3JRIA 2IT1A 4ZTFA 4KTAA 1NK2P 2V4DA 1E17A 3KP5A 5GADC 3EIVA 2D2WA 2FHTA 3I4MG 2ID6A 1PH2A 1T38A 2F0DA 2F3VA 4KHZA 5KNLA 2R7ZJ 3HG9A 3TP6A 3OS1A 2MSYA 1O7LA 4CJ1B 2ZXOA 3I54A 1FJLA 3E6MA 1HOMA 3Q0AA 1FLIA 4ZLTF 1ZH5A 4FETA 1WSUA 3ERQA 2RSNA 2JQOA 2K5NA 4MZ9A 1BXTA 2M34A 4O3MA 4WJWA 1V1PB 1MMAA 3HKZB 3CC4I 5HNHA 5AIQA 1K0SA 4M3DA 1R4PB 4GKKL 1YQAA 3ULQB 1WFXA 1PLFA 2FX0A 1TC3C 4IRIA 3R60A 2WAFA 2B2YC 2ZFWA 4YG2F 1PTOC 4RMFA 3PL8A 4ON0A 3S1RH 4K2EA 4C3HG 4QLCU 4QTRA 3GTQH 1Q3LA 2R7RA 4FT8A 4L63B 2LKPA 3RKYA 2V9KA 5ELBA 3NWTA 3H5NA 2RKHA 2OXPA 4NC6A 1VQFA 3MWMA 3KLSX 4O1NA 2DNCA 2WV0A 1HFNA 3DM3A 1QVFA 1NG7A 2HPMA 5NUCA 1I6XA 4RH6A 1WH7A 5HDNA 2VL6A 3W6JB 4MTKA 1SMXA 2K5VA 1R36A 1ONLA 3HOZH 3WG7H 1K7AA 2Q1ZB 4BUPA 1IUFA 3ZQIA 4CGYB 3C46A 4DNTB 4XN0A 4WJ4A 2MNAA 3F1ZA 4M74A 4BE1A 1ON1A 1IV6A 4G57A 4RGXA 4UV9A 1Y1WJ 1OCTC 2WB1N 3I56I 3SK8A 1D0YA 3KX2A 4UY8C 3REOA 3NSWA 3FXMA 4RGSA 4LUZA 5BPIA 1TWFH 2WAQB 2MG4A 4DQ2A 5BNGA 1OYYA 2MLGA 3SHLA 2Z2SB 2WV6D 4PJMA 1TIID 5K5OA 5C4JB 4Q48A 2E76C 1RESA 5T1IA 2KPMA 1HQRD 1I94Q 2F0FA 2Z1CA 4X66Q 1XMQL 1T0FA 5EEAA 4KFCA 1TW3A 3NK9A 1GV2A 2R5YA 3QQAA 1D1AA 5C6AA 4IOCF 4C1NI 3DTEA 2E19A 1FNNA 3AG1H 1FSHA 2DUDA 1EWHA 4KN4X 4C30A 3SXYA 2EE1A 4LK1F 4I01A 3GTJH 2B2VC 1T56A 2UXDQ 3I4MB 1GXDC 3KP2A 3GV3A 2QGQA 3LSPA 5TGTA 4X6AH 1JMCA 2XIGA 3NWSA 2OWOA 4UUSA 3OS0A 2XHKA 4A3FG 1BL0A 1KXLA 4OHJA 1J09A 1UAPA 3GMEA 1HZAA 2EY1A 1K6OA 1CZWA 2PZWA 5K7HA 4A2UA 3KLSA 3HZXA 2Q0OA 1KGSA 1R22A 4Y52H 2XSJC 1O7IA 2DMNA 2DGYA 1ICWA 2XWJB 4GNXB 4PG3A 4L9TA 5KNBA 4OX9L 3RD4A 4A3GH 2XRQD 5D5UB 4JYAL 3HZJA 1B8AA 3W1BA 1HQMC 2FD5A 4MGRA 3BZDB 5LMUQ 2K4BA 3LWUA 1JUSA 3C2HA 4V2FA 4RAUC 2MUYA 4DYRA 1OO9B 1P4WA 1DZ1A 2CQKA 3GTKJ 4KHVA 1Y1WB 2ICEC 4GN3B 2L9VA 5HNFA 1LDJA 4AD9A 1WTQA 1PP8F 2CW8A 4NC7A 3IRRA 3MFYA 2DTRA 4ZKBB 4CHTB 1OKRA 2B0LA 4E7SA 1WTRA 1JWUD 1Q1EA 2PN6A 1DU6A 1UEAB 1A35A 1TY0A 1PRTF 1Q8IA 3W6KB 2OEOA 3RKQA 1F9SA 2NS7A 1FMVA 2L7FP 1TBXA 4LLNA 2E34A 1S9HA 1ZR2A 4IF4A 4KHPQ 1JKQC 1I5ZA 3GF2A 2EYFA 4XKVA 1EQQA 2DLLA 1F9PA 3FIWA 5I6YA 2MBFA 4AQYL 4DV7L 1STYA 2LTPA 2JTVA 1EIHA 2HTSA 2F4IA 4DK0A 2JK3A 2GM4A 4HTHA 4NBQA 2WADA 1UNSA 5CV7A 4A3JH 2V79A 1VDZA 4RGOS 4C2MB 3BR3A 5H6RA 1V43A 2HDLA 3TRZA 5C0XH 3CXCA 1CSQA 2HHHQ 3CJTB 3A55A 2M7AA 3K80C 3WTVC 1UE1A 4MNOA 2CH0A 1TKWB 5I6WA 1F9QA 1HJPA 4BDZA 2CQOA 2CYYA 3TZDA 2KQRA 2WBMA 2F5EA 4HSPA 2JVHA 3M7GA 3CLQA 5FJ8G 3MMYB 1XTAA 3CDLA 4NXML 1X1AA 4DK3C 2NZ1D 3S15B 1ZHFA 4KDPA 4ZUIA 5K5RA 1D1IA 3V2TA 1GV5A 1CA6A 2UU9Q 2RHSB 3QR8A 4KKTA 2WWYA 2ZXHA 3SFZA 2YU9J 4XXEA 3HTUA 1LFUP 2W24A 3DU6A 1JGGA 2NN6I 3FXUA 3NPPA 1ZKOA 3WTUC 5K7ZA 1DJRD 1QHHD 3IL8A 2WA0A 4QF4A 3ITPA 4OIQF 1H89C 1MSEC 4GKJQ 4JBKA 1LTID 1IDYA 4U87A 4DUZL 4RAFA 5ERIA 1V1OA 4BE2A 3U4VA 1CM9A 4G7OF 2ZJPA 1IL2A 1IKLA 2Q8RE 1D8JA 3M85A 4M72A 4BY7B 3HOVH 2HXOA 3I90A 1T5EA 2MQHA 1Y1VB 2MC4A 1G91A 1K8OA 3LAPA 2I07B 3NELA 3Q9SA 2BVMA 1CI3M 2F1MA 1K4SA 1ETVA 2K9MA 1YJWI 4A0XA 1TS5A 1XMKA 1LTRD 2KEDA 5D65A 2MJ8A 5G3LD 1XDUA 1T33A 4FF4A 3WU0A 2DT6A 4A93G 3CJNA 2VJJA 2X6LA 1SYFA 1YRNA 5B5EC 9ANTA 2WKDA 3BR5A 1IBLQ 3HOUB 2VBZA 3RYPA 3NAUA 3W5OA 1ZGJA 4XYOA 4NXMQ 2YR2A 5EPKA 4CO8A 1N25A 5JOBA 4LF6Q 2WAQA 1S3JA 2HQRA 3J7AV 2E5ZA 4IN3A 1Y69U 1Y39A 5C3EG 1W6JA 2X48A 5I4DA 2EY2A 2JRMA 3M9AA 4XR6A 1ZG5A 3ZQHA 3I4MJ 3EUAA 4TSSA 4BAYA 3EQLF 4M71A 2L0CA 3K7AB 1Z9FA 3FZVA 1HZ9A 5CPRB 5C3EB 2ZXIA 2MH9A 2PJPA 1HNXL 1OCRH 2DOEA 1WJBA 2CV2A 4YY3L 1F2ZA 2KQ3A 3H6MA 2SDFA 1DPRA 2VL8A 3OTOQ 3G71I 3ASNH 4PZ7A 2RC4A 4A93J 4P55A 3FMQA 3I4LA 1BJZA 1RODA 1TS2A 5BN4A 1QUQA 3V8LA 1L1OC 2UXCL 1DONA 1QZEA 1ITYA 3GWZA 4B3RQ 2FF4A 4QGUA 3OW2A 2VUMJ 1A15A 1QZHA 5JI6A 4HJ8A 1MH3A 3J7YW 1S5FD 1IZ6A 2GAUA 1AP0A 1XNQQ 3GZNB 2PI0A 1TW2A 3DLLF 1EZ8A 4G7ZC 3M3YJ 4EGYA 3P75A 2NVQJ 3KBGA 1A0IA 3C1DA 3PSFA 2DA5A 2A19A 3F8TA 1GXQA 3GO5A 1K83B 1VQIA 5IODA 1X3GA 2ME0A 4QJFA 4JOIC 1CQTA 4HSVA 1SVOA 4A3MB 2BOSA 3OYYA 1ETYA 3SK5A 4FF3A 4A3EJ 3VYUB 2GBYA 2WY7Q 1MKHA 1LPQA 4GYGA 3FISA 2HEOA 1LNWA 2DYRH 1IBML 1BA5A 2Y31A 1IV8A 2D1VA 3LSTA 4A3GJ 4EGVA 5IGGA 1D8KA 2GXGA 1U5TA 2W48A 1MBYA 1ZN2A 1VQGA 3ELKA 3K0XA 2WC2A 2HDMA 1IJWC 1ML0D 1Y0UA 2VASA 2NNNA 4PV1C 3D6CA 3AG3H 2V1NA 2EBIA 4OX9Q 5IP9J 1TU2B 1AFPA 2XGDA 1I5FA 1D0XA 2F4OB 4A3KG 1ZGAA 2JA6G 2VQGA 2JA5G 3S1MH 3WU1B 5DNFA 1ZELA 2BGCA 1ZYRC 2DFFA 3S3OA 2Z1DA 3MFKA 2F3IA 4KN4C 1U0JA 4RM2A 5M3FJ 2A74C 2DA7A 1BO0A 3TO9A 3E5SA 2BHZA 1MBHA 5B1AH 3CC2I 4A3LH 2FQ3A 5ICFA 1WTXA 4JV5L 4DR4Q 2EZHA 4M3EA 1YW8A 2CV1A 4A3IJ 2HYJA 3B02A 1B53A 2F5DA 2QBYB 3DKYA 5EDNA 5EGOB 1IRXA 4DU9A 1PA6A 2D2CC 3W6VA 2GZWA 4Z2YA 1SJHD 2ALYB 2K05A 4RFBA 1WJ5A 3CPWA 2ZXWH 1QOHA 1B7YB 1UJ8A 2L7KA 3DKXA 3S1RB 1APLC 3LMMA 1IXRC 1A3VA 3OL3A 2KCTA 3HKSA 3CESA 4IZZA 1WJJA 4KMFA 1W2BA 1G51A 1A6XA 4RA2A 3C2GA 2IGMA 2JVGA 4GNXA 5ICGA 4A0ZA 2FBKA 2F4VQ 2EZLA 2ACJA 3L1PA 2K50A 1DOMA 3J7AY 3QAHA 3OSOA 4ILWA 2EK5A 3ASOH 2A69F 3TBIB 2OJED 3GTLB 1LT6D 2A6HD 1T39A 1V5FA 3F8CA 5CVJA 1D5VA 4BJTA 1N33L 4AUXA 2VXDA 3M4OB 2MD0A 1EY4A 5HY6A 3IAS2 4M3GA 3UE0A 1LT5D 1Y56A 4CKCA 5DTDA 4C2MH 2KJCA 3CDHA 3OYJA 3TP8A 5LMNQ 3KZZA 3CP0A 4JI2Q 2HIVA 5FLXc 1FIPA 1VQ6I 2DDAA 2E74C 1TQPA 4DUZQ 1MDMA 1TWCH 1CGPA 1TQMA 2NNYA 3PQKA 1XPRA 5C44H 1OLTA 3ND9A 4BXUA 1UHMA 2Q2UA 3CCVA 2VXZA 1WJFA 2VBXA 3DPUA 3MAQA 3CMMA 3G2BA 2X0LA 4HG2A 3WTZA 3SXHA 4OINF 3ZJYC 5L3EA 1XX5A 1SE8A 4HPQA 4MO7A 1FOWA 4HAEA 4BACA 2HZTA 1ZR4A 1VMPA 2LFNA 1XMQQ 3BR0A 2Z4IA 1HW5A 2LSSA 4BEHB 1JICA 1IBLL 2HFHA 2V7FA 2VIXA 2IPQX 3SFIA 4WWCA 1RHPA 3A0BC 4ZC3A 4CA0A 5ILUA 1SFEA 5FD5A 2DY8A 1EIYB 1PH9A 2KJBA 5FKLA 4YFNF 2VQEL 1B8IB 1E2XA 3OW7A 1KU3A 4ABZA 3VR2A 1U6GA 2Z8LA 4IPAA 3SYTA 1GJXA 1IN8A 5M5WH 2EXZA 4JBJA 3E6CC 2DJIA 3QOJA 4CZZA 3RQ4A 3GTKB 4DAYB 3FXJA 2LBFB 3O3KA 1EL0A 4PFPA 3CQZB 4DF7A 2NVTJ 3CCSA 2KZVA 1E2WA 1LE8A 5H20A 2IPKD 1OTCA 3DLAA 2DJGC 3IKTA 4LW1A 2TRTA 2XF7A 2MFZA 3FRPB 3DM1A 3QPTA 3SK4A 5CMDA 3HOVB 2CW0C 2YUSA 3P20A 2X1DA 3S16J 3BR2A 1YLFA 3L9FA 1STNA 2EYHA 1PFNA 3A03A 3PUXA 3AEVA 2PO4A 4FNFA 1WCMJ 3EETA 2AQEA 5L3BA 3NE5B 2Y9ZA 2E2JJ 3BVGA 3D31A 3HFZB 1FMWA 1HLVA 3KZIC 1R9TJ 3PCOB 1YNJD 4DV0Q 2VT3A 2BY0A 1O4XA 4JG2A 5D3DA 4O42A 4OIPF 2X6GA 1M1EB 1RETA 1WD0A 3LSJA 2KOLA 3NARA 5IGEA 3VB2A 5F6FA 1Z77A 5C3XA 2UUAQ 3WHBA 1KA8A 5FK9C 1AH9A 5M9OA 2LNBA 2W57A 3MXUA 2JA8H 1VNDA 1WTHA 2IA1A 5FLMJ 4DV4Q 4A3DG 4BJ6C 5HGQA 2R92J 4B3SL 3VR3A 4KD4A 3LGJA 2A6EC 3E9IA 2Y0SN 5ELCA 3CAMA 5LL6X 1TLHB 1EH8A 5FO9B 4LK0F 1SD4A 3I55I 5E1FA 4LUOA 3HOUG 3S93A 3CP2A 2WAEA 4ZRZA 4DV6L 2VY3A 4LF8Q 3CCJI 3B73A 1KYZA 5LLQA 3PUVA 2KIQA 2EV6A 4P9UA 2BVLA 1QNKA 2E1OA 3JCUC 1UG2A 2E5LL 1JUMA 3BOQA 1D1CA 3CCSI 2A6EF 1KAWA 3RLFA 2KKOA 2QM3A 3RN5A 5EAYA 5F64A 4S0HB 2HVRA 3DUZA 4A3CH 5B3SH 2RQPA 1H95A 4HNVA 4EJOA 4M6VA 2XAUA 4DV3Q 4ZUJA 2CRGA 2IHFA 2MO0A 4E7IA 4IFDH 1EU3A 3HOYG 1RCVD 4ESBA 3BQYA 1PH1A 4AIDA 4RHSA 1ORKA 3RPUA 2F0LA 3U1KA 3G4SI 3AU7A 2I46A 1G291 1LKXA 2K33A 2XIWA 3K1PA 1FJGQ 5JEAG 1PRTD 2KDZA 1YW7A 2A68F 2BH8A 2OT2A 1R5ID 2JUGA 2ZXPA 1BKBA 1U9RA 3BTLA 2CH4W 1K83J 3QG1A 2BEOA 3CC4A 4OO1G 3TO6A 4FCYA 2NXNB 1P4XA 4FF1A 1RJTA 1B50A 1XGMA 4KUMA 4G7HC 4XONA 4RB3C 1PTOB 2NVTH 4XTCS 2TMPA 3K6OA 5L3FA 3CRKC 3DWPA 2RVCA 1U0LA 1WCMB 2OZUA 1FYLA 3KEYA 3P7NA 2PJRA 1C4QA 2JEBI 5M5XJ 2AUKA 4TRDA 4AYBE 3QP6A 1ZRFA 1N32L 2O8KA 3AKZA 5E79C 3FKIG 1Z05A 5M3FH 1LE8B 2VS1A 3G1MA 2L4AA 5HLTA 2DTZA 4BQAA 3MXPA 1SE3A 3R0AA 3TP5A 3H3VK 2M8GX 1MJBA 3S32A 4L9VA 1W3SA 3U9OA 3D1NI 3JAML 3QYEA 1EH7A 1K79A 1JOQA 3J81K 3RKWA 1HA5A 3WE2A 3CCUI 3NBHA 3JAMZ 3MN2A 4X3TA 4JBWA 1XPUA 1YOVB 1ETKA 5LD2C 1PTOD 1TWGJ 4E7LA 3G1OA 3GVAA 5KYIA 5HVQC 3HJEA 2LR8A 3G1LA 1SN8A 1KABA 4RA8A 3EYYA 1YVCA 2CS3A 3HKZN 3PO3J 3TS0A 2LKVA 4ZYHA 1LDKB 3K7UC 3S17J 1V9PA 2K27A 2A68C 1ODDA 4KJNA 5IIFA 3HRUA 4JP0A 1ZLJA 3DF8A 2STTA 4X0GA 2AQ1B 3RZOH 5IYDJ 4K14A 5A35A 3IP4B 3J80L 4KIGA 3WWVA 4BBSG 3TDUC 2MP1A 2IXSA 2GOMA 5E4XA 3H0GB 1PTOF 1UWVA 2XAGA 3GLLA 1PH8A 1X3ZB 1JQYD 1QJOA 4ABNA 1EEID 2PBIA 3E6BA 5HLHA 4CDFC 3JRGA 1A36A 2DOAA 3I59A 3AG4H 2ETHA 3VDXA 1MDMB 3Q9VA 2A6HC 1Y8PB 2M0CA 1PRTC 4N9PA 2R61A 1X4OA 5IT9E 1WFQA 1I4XA 3OMYA 4ANJA 5ELNA 4I76A 3ABUA 1VQPI 2DAOA 2DN8A 3KEOA 1XD7A 3L7ZC 4WF2A 1W6KA 3FHWA 3QYBA 1YJ9I 1J9OA 1V5EA 5BN5A 5IT3A 1CFMA 4M6XA 4GLXA 3CUQA 2K4KA 1QE6A 5M5YB 3IHUA 4B8XA 4RHRA 1A2TA 1I3AA 3L2PA 4ME5A 2DO7A 1O80A 2XPWA 2FXQA 1IDZA 3Q6SA 3ZMTA 3GTQB 1PH3A 1WI3A 3A5UA 3M8FA 2JRTA 4FDBA 3FMCA 3H5AA 3VYSA 4NQWA 2JZYA 3TO7A 3RI4A 3RNUA 2UXNA 1A8VA 4HF1A 4WFN3 4FXDA 1O3TA 4PCQA 3GTGB 1QGPA 1R71A 4DBQA 2EA2A 4PSXA 4RDUA 2LFBA 4IHWA 2JJQA 1SRUA 3K5MA 3H3VC 5FRMA 3HKZE 2FRHA 4L5TA 4XMYA 1YHQI 3PO2B 1HNWQ 4R9WA 3DPLC 3R8BA 5ELDA 1N77A 3I53A 4A3BJ 4Q5SF 5C44B 1BVSA 4DBRA 4L5JA 3OYFA 1JHHA 1SXTA 1KU7A 5L37A 5DS9A 1EQTA 3GYHX 1JTYA 2O61A 3MTSA 3PNYA 2DJFC 2LF7A 2F0WA 5LL6S 4C3IB 4IHYA 2L11A 3CCRA 5TISC 2P8TA 5K5QA 1MNDA 2EIJH 3OOPA 5A2QE 1CF7A 2EJGC 3IH4A 3HRZC 3CCEA 5C4XB 2DYSH 2OQKA 1LT4D 1TQOA 4N8X1 2JA7H 3E0JA 4IJAA 2AMCB 1B3QA 5HURA 2G9DA 4UP7A 1WQ2A 4EQNA 2NS8A 1VQKA 4C2UA 3RMHA 2UZKA 3ABLH 4LF7L 1USTA 2CFXA 4AYBB 4LITA 2IGKA 1NTGA 2B63J 2JN4A 1O3QA 3MCZA 4JI3L 1H9TA 5M5WJ 4A3FB 4N9HA 5TRDA 3OOCA 3J80K 3G7LA 1I6HH 1ZRDA 3K2ZA 1RC9A 4E7KA 1TWHJ 2LXKA 4R8IA 2VJ5A 2ZXJA 2FMYA 2HS5A 3D0SA 3VYUA 2NN6G 2K9LA 2K40A 4K8IA 4XDXA 2DQLA 1LTGD 5LBQA 2JA8J 4BY1G 4LFBL 2VUMH 2SOBA 3IFDA 2QSHX 4PUSA 3OIPA 1PZID 2QBYA 3TW6A 4UUTA 2E75C 3HOXJ 1D6EC 3K57A 1CHQD 3G3ZA 1IN6A 4CSWA 3VEPA 1VQMI 2E35A 1AE3A 4KNYA 1I6HB 4PK4A 5GAGJ 1GVJA 1U4RA 1YI2A 4QIWN 1VQ8A 1IXSB 1IKMA 1DUXC 1YS6A 2Y30A 2H8RA 4DUYL 5B66C 5IT9Z 4U0WA 2RSOA 1AE2A 1TNSA 4OIRF 3MD2A 3NEMA 1SNOA 2Y75A 3HKZG 4NXNL 2EY5A 1VQOA 1QBJA 2DNEA 3BPVA 1T8IA 3MXGA 1PZJD 2HVQA 1HW2A 3LFUA 4CH7A 3A4CA 1WKMA 5HOOA 2FFKB 4KIBA 3STBC 3T4AC 1PMRA 4ZZLA 3AL0C 3HUGB 4NDLA 3P5JA 1P9QC 4IJHA 2ZSIB 5L3DA 4FO2A 1E2VA 3CMEI 2A8VA 4JI6L 2IX1A 2DA3A 3VA7A 3K7AJ 1NCVA 2EYOA 4G6DA 4HIOA 2COMA 4BU2A 3R6SA 4LOCA 3AL0B 2ZJRF 4R4OA 5DEQA 1GHCA 4EATA 4E7ZA 3M3YB 2A69D 4XSXF 1T9HA 5J3BA 1QA6A 1G3SA 2X51A 2JPCA 3GTKH 3ROUA 5BQTA 5FLXZ 1NR4A 1FNWA 4L5RC 4KN7C 5M5YJ 2YU3A 5D4SA 3JAME 3KF8B 2Q2IA 2EDGA 1FBQA 3HOVJ 1RD9D 3HOWG 1QQIA 3N4MA 3HOUJ 3RLOA 3T8TA 1T5XD 4DR6L 3CCQI 4POFA 1SAXA 3E6DA 5EG0A 3OWEB 4RLQA 3CCEI 4MHEA 3V7CA 2VB3X 2AKWB 2R92G 1X55A 4J01A 4K5VA 3LA7A 4IOCA 2FSWA 1AKHB 3TN2A 3CU7A 5AJ3Q 2A5HA 1UAAA 3OMGA 3HGGA 3BZCA 3JRHA 5CBAE 1PYSB 3O6BB 3S1QB 2R0QC 2FEZA 1WYDA 3GFMA 4B3TL 1BDOA 5C44J 1OYIA 2AO9A 1S7AA 2EYJA 3CUQB 3SDBA 3J80E 4DGZA 2JA7G 2BCOA 2RVLA 1VQ9A 1ZG1A 1I3QH 5J4VA 1J5YA 3KLNA 3DU5A 4C2MJ 1G59A 1K78B 3UR3C 3BYTB 2A6HF 1Q90A 2YU9B 4OMYA 2F0NA 4OMZA 4HCEA 1HR0W 5IYBH 3ULLA 4Z9CB 1AU7A 3ZPLA 4HEDA 1I50B 2GXAA 4MNUA 1SNQA 1IZ1A 5F0FA 2XROA 2Q2HA 4LAAA 1VF9A 4HMIA 3S15J 5C4HA 3ZOBA 2K4JA 2I5HA 3GD7A 3SQNA 2LREA 2W85A 4UP8A 4HQEA 3QU3A 1A6IA 5JVH3 5IE8A 5CJ9A 2FMMA 4BBRJ 2NN6H 2ZC2A 2ZNYA 4NMZA 1HSJA 3NHHA 1HKQA 3PFIA 3OY9A 3QJYA 2NTSA 2RNJA 1ZREA 5DAUA 2ZTCA 1UCRA 1WD1A 3DBRB 1I6VC 1TVXA 3AFPA 3LSGA 1SFKA 1FC3A 4C3JJ 3HPGA 4DIQA 3JAMc 1I94L 3STBD 4TKOB 4IHVA 4MN3A 1EFWA 1MBJA 1JTXA 3X3NA 1XSDA 3E6ZX 2GA1A 2JPBA 3I9V2 5KK1A 2RQXA 1DXMA 4QMGA 3HBLA 1TWGH 1P8LA 1S3OA 3RYRA 2Q8IB 3KP7A 3ZMUA 3CJRB 4II3A 3BG7A 1IYUA 3D6WA 2YX4A 3K70C 1EY6A 1HNWL 4ZH4F 1YITI 2ZM6Q 1DDNA 4CUGA 2UXDL 4KMUC 2CQAA 4E7JA 3HOZB 1C8CA 3I3LA 3MZYA 3NP8A 1F36A 1I1GA 4LIUA 2KVMA 4HNTA 4QY7A 1U4MA 2MHVA 4A3JB 3C3WA 1CKNB 2HQEA 1YNJC 5F0HA 4DR3L 3A74A 4XN3A 1WCMH 4I0BA 4DOZA 4A5NA 3GUDA 4V2GA 1QRYA 4AIHA 2ZJ2A 3MHBA 3J81i 4NQWB 2JSCA 5DCFA 5E3OA 2F0VA 2X85A 4DV7Q 2BDNA 2P6TA 4POGA 2P6SA 4F93B 3T8RA 4QB4A 1BOBA 2OZ6A 1X1BA 4KY5A 2OQGA 2HDDA 1QVUA 3IH2A 3VSLA 1CUKA 2IHEA 4L18B 2H6CA 4PZ6A 1PP7U 3QB3A 2RDPA 4OWRB 2UXXA 4IRHA 1VQPA 1Q86C 5EBCA 3DEEA 5IGBA 3ZCOA 2V6CA 1PH7A 5TSSA 1SNCA 3DQVC 4XRFA 3O13A 4H44C 4S3SA 5GAHJ 1Y8RB 4GOPC 2XC7A 2CFOA 3ZN0A 3TMEA 1PFBA 4UXNA 4C3IJ 2MC3A 1TWFB 1IN7A 2UXCQ 1IL8A 1DM0B 4I7AA 1M1KC 4GOPA 3GDEA 4DNCA 3TP7A 4AIMA 3KP6A 1KRSA 4DNIA 3MEXA 2P7CB 3RN2A 4BBSJ 4ULLA 3V8JA 2Z99A 4UHTA 1GHJA 2JMWA 4IZ8A 1JORA 2MABA 1MGTA 3W2AA 5M3FB 1B2TA 2ENBA 1LO5D 2GVAA 4ENMA 3J7AF 2DPUA 2RNGA 1HSTA 4A3MJ 4GN4B 1QNUA 2QQ9A 4YHHL 1FNVA 2LDUA 2LRDA 1B6AA 3K4BA 1QVTA 4YWKA 5A2QZ 3C18A 4I09A 2PMHA 4F3QA 5ISRA 2KIUA 5M3FG 4WK8F 2D62A 5AFWA 2F0GA 5EJWA 1LFPA 2PZUA 1HDDC 2WKCA 2PLYA 1TQIA 5J6XA 5J40A 2JA5J 4FYDA 4B3MQ 4ZTJA 1ZYRD 4HCSA 1G2HA 3I3CA 1A62A 3K69A 2NYXA 2PCFB 1SD6A 2HVSA 3SVMA 1NR2A 5CORA 3CMYA 5EGTA 1Y1VJ 2UUCL 1X58A 2EJMA 1D5MC 2F5CA 2M87A 3IAYA 3L2WA 3H1CA 4RB0A 5C0XJ 1IYVA 4DV0L 3BDOA 3WTYC 2UUBQ 3H94A 4A3JJ 2F5FA 4BH9A 2JJ7A 2ADUA 3KDFB 1JWMD 1C48A 2WP8J 2E2JH 3ABKH 2OTLI 4CDEC 5IGDA 1BOAA 3PO3H 4A3LG 3VR5A 2OBPA 3N05A 2PQAB 4KYWA 3FHZA 2M0MA 4I6ZA 4LG3A 3IV5A 4E70A 1MIJA 2Y0SB 3I73A 2VONA 3J80Z 1D2BA 4IHSA 2FNPA 2F4VL 2BW3A 2DI3A 3DWQA 4XRSG 2XASA 3ZMSA 1BIBA 1G4DA 4DV6Q 4LF8L 5JLWA 2GLOA 3CC7A 3OIOA 3ZQGA 2HYFA 3D3RA 4A3BB 2WV1A 1PFSA 2HD3A 2X69A 4ME3A 3A2KA 4XQJA 1YITA 3V8KA 5JEAJ 3PF5A 1QHGA 2CUFA 4PGGA 4Y7NJ 3H36A 1I4RA 3EN2A 3HP3A 1J59A 2JE6I 2A07F 3HOYJ 1V55H 4CDCC 3KOJA 4RGRA 2VBYA 1XTDA 3I4MH 2DJNA 1V5GA 4QUFA 3F2CA 2O4XA 1MBEA 4XLAA 2E2DC 5CVVA 1PUFB 1GT0C 1GUUA 2N8GA 5E3MA 4UAIA 3CPFA 1SEUA 2G9HD 2ME6A 5EQ0A 3HIFA 4EVIA 4C2TA 2K32A 2HU9A 1Z1DA 1BIAA 4CYCB 3KETA 2KHSA 1Z0XA 5I2XA 1W5CC 2P5KA 4YEJA 4A3CG 1YX3A 4MHGA 2ECBA 5E1ZB 1LACA 2KEEA 5AIPA 3CCJA 3H15A 3K4KA 4CZCA 3HB9A 2AQ2B 4PJLA 3DEPA 3GTGJ 4AIJA 4CKEA 2QSFX 1DQUA 1S40A 2W00A 2HDCA 2CWPA 2E71A 4HV5A 3KYHC 2RQQA 4IO9A 3HRMA 2BY2A 1LABA 5C4XH 3CCVI 3S3NA 1NBWA 4C3HB 5JAVA 3T1YQ 3SDGA 3DFGA 4XRMA 2F0SA 4C3HH 1SMTA 1FGUA 2YV5A 1SVMA 4DR1L 5IGCA 3S1RJ 2QWWA 4A6EA 1S7OA 4F55A 4KKUA 3OYMA 3FXRA 2V26A 3OYHA 1SMYF 1X2MA 5E1WA 3EQLC 1STEA 4I65A 4JBAA 5FLXK 2E2IJ 1MD0A 1KTKA 3BDDA 3HOSA 2Z3YA 2LG4A 3L00A 5C0XI 3HOXG 1PUEE 2FINB 2KJXA 2HDWA 4KLKA 1XYIA 2ELKA 3V4GA 1FYCA 4U0VA 4II2A 1VQ4I 1VQLA 4LIVA 1R1UA 2M30A 4FE4A 3BTIA 2J0TD 3IAM2 1R00A 2ZO4A 4AVZA 2Z33A 2FMLA 4ZYGA 4LJZC 1BNZA 2AWNA 1VCIA 4NB3A 1YW9A 2IW5A 4UVBA 3OYKA 1ESRA 1CTMA 2B63H 1W7PB 2V1CC 3OYCA 1I4QA 2BDOA 2IAIA 4JI0L 2XAFA 3KCCA 3PGZA 3LX0A 3RPUD 1N75A 2P7VB 2DMUA 2KISA 4XKWA 2JA7J 1Y8NB 3U9GA 4L0YB 4PJNA 1QPMA 2OAZA 1X3FA 4OXPA 1S5BD 4LLGF 3R2IA 1XMXA 2EFWA 5FO5A 3ZN1A 5D4RA 3L2VA 1HNZQ 3GFJA 2NVXJ 4YCWA 3ZGKA 3N52A 4B3AA 1J75A 2FUG2 2BA0A 4I7ZC 5IP7J 1BOSA 4G4KA 1HKSA 3ESWB 4PZ8A 5CBEE 4BBSH 4MTNA 3R61A 2EFQA 2KRCA 4BJ5C 1PRTB 2HUGA 4F52A 4D5CA 1IRZA 4BEHA 4B3TQ 1S72A 2CQXA 4L9JA 4DAPA 1XTCD 3MVVA 4FF2A 5FKNA 1EFID 1Y8OB 5DUIA 2UWMA 4DR5L 5H1SE 3J7YJ 4MEYF 1E3OC 3S8PA 2IJLA 3A8IE 2DOFA 1B72A 3J81c 1USSA 3L0OA 2RCNA 1JJGA 1XGOA 3CQZH 2A1AA 3TOBA 1HHVA 2ZJRA 1JWSD 4DR7Q 2A61A 4A3EH 4W1UA 2NAZA 3SEQA 1LUJB 5C5LA 1XSXA 2Y0MA 5EKIA 2MLKA 1GM5A 3BG3A 3K4JA 2QENA 1WI9A 3TDQA 4LF4L 5KNCA 3GLXA 4CJ2C 2KA7A 2JEAI 5J1ZA 4YWLA 3PNVA 2FBIA 3L2CA 1HTLD 3I8ZA 2IJ0A 3F9KA 5AJ3L 1JOKA 5GAEJ 3PIOA 2E2HH 3RTRA 5CQGA 1RKNA 2QEXI 1C0WA 4P96A 1MMGA 2J7ZA 1ILPA 1WVRA 2EYPA 1U5TB 1D8LA 3BT9A 3A8KE 3RUZA 3U21A 3WOEA 1H9JA 3GTQJ 2JA5H 3MZHA 5CV4A 4N9IA 4MEXF 1I1SA 1FEXA 4JYKA 4RCOA 2QDBA 2ISYA 3NTHA 1STGA 3MKLA 1T2KA 3HEFA 2OQ0A 3L9AX 3K1MA 1ET6A 4X65Q 2BYVE 3ZP5A 2X9DA 1XCBA 2J5OA 1MHWC 5JVTA 3R0JA 2LVSA 4KISA 1AZQA 4ZYAA 3WDNA 2DCEA 4M9XA 4UVAA 4AVPA 1PYBA 1VQHA 1TY2A 2LS01 3SDZA 1VF5C 3F8FA 3CCRI 1LTSD 2LOOA 2FNAA 3IWFA 2EQRA 3MQ0A 1HNZL 2HOEA 1S6LA 1FY7A 1TR5A 5HODA 2N49A 2WINB 1X32A 1YNNC 2L3DA 2L9NA 1X1PA 1OXSC 3GZ6A 1N32Q 1K61A 3ISPA 3HSRA 2MW8A 2R7VA 5IYCH 1NMFA 1TWHH 1MMDA 2EB7A 3BG9A 3L09A 1VZ0A 4YIRX 2ZFUA 5KCMA 1XMAA 3NTIA 2J4XA 2HYGD 2H27A 3GW2A 2HWVA 1U3EM 2CQQA 2R7UA 3V42A 4HAMA 4RCNA 1W1WE 2X6YA 4DAVA 5HS7A 2ELJA 1Y1WG 3SE0A 5JJKA 4LFAQ 3GTOB 3ZXSA 3GTMH 4G6TB 1V3FA 2F52A 4DZJA 5FO8B 2RN7A 2PG4A 2NRAC 2UU9L 1Q8KA 1H0MA 1D1KA 3E97A 3HSEA 1FOYA 1FL0A 2P5VA 1T08B 1QB5D 4KD3A 4K5XA 4HF2A 2N55A 4DV5Q 1UUPA 1T6SA 2DN0A 2BH2A 4IL6C 2W82A 3ERMA 3O8GA 4JI5Q 2TCTA 3K5OA 1QZYA 4L5IA 5IP9H 4UHVA 5FFZA 3BG6A 4LF5L 1HUMA 2F0KA 3ERED 2M00A 4ZYEA 1U78A 2XWBB 3EPZA 3T1YL 4DK6C 4XK4A 2EZKA 2PQ8A 1P92A 2B2UA 1KLGD 1JHFA 3SK6A 4BYYA 4B44A 3HOUH 1QVCA 3COAC 3GZ5A 2XVCA 3RSNA 1FSEA 1G3TA 4OIOF 5JJIA 1ZLKA 1STHA 1W0TA 2XAQA 4B9WA 2K7VA 5DM73 3JRFA 1F4KA 4L6TB 4RM3A 2DW4A 1K28A 2B7EA 5E3NA 1TXYA 3DEWA 3A7LA 1XSVA 4CYCA 1UFMA 5HGTA 3HOZG 3HOWB 4XM3A 1KLUD 4J1MA 4YIJA 3M7NA 2CUJA 5HDGA 4GNXC 4IURA 4FE7A 3KPHA 2JA2A 4X3UA 4RS8A 4GDFA 3CZ6A 4A3MH 1OXVA 1FNUA 4R4TA 2JWTA 2OF7A 2IEKA 4B3RL 2JT1A 5DEHA 1EY8A 1QWYA 2E2IH 4XNFA 4N9TA 1SFXA 3PIOF 3ZMDA 5LRRA 5F04A 2L1BA 2D0OA 1TT5B 1UB9A 4BGDA 2LY2A 4IKFA 3AQQA 2VC1A 4C3IH 4B9XA 1RI7A 2K7LA 3DKWA 1EZ6A 1BI1A 1R9TH 3RCOA 1LB2A 4PMBA 4C3JG 3DBHB 3V7SA 2GXBA 3I55A 2UUBL 3J7ZI 4DNRB 3S14J 3ML6A 2AXLA 4YFXF 3S2DH 3D0FA 4E6IA 4NW2A 1P7JA 5HS8A 4B47A 2JSOA 3HOXH 4BBRG 2VB6A 3S1MJ 4LFAL 1HXDA 3FKIH 2E2HB 4L0ZB 4K6LA 2K5CA 5GAGC 1QO0D 1EOTA 1VQ6A 1YIJA 4U7BA 5FLXL 4TVAB 4XLNF 1B3AA 2XRNA 1QU3A 2FQ4A 5D5XB 5KGUA 3W3CA 1VI0A 5FKAC 3FHNA 4JI1Q 3LL7A 1X3PA 4G7HF 4LG0B 3Q0UA 3SZGA 5IYCG 4IQZA 4MQ9F 5E3FA 4ZDPA 3S2HH 1R5HA 3Q23A 1L2FA 1MJ9A 2JA6B 2ZJQA 3WOFA 1C7YA 1R9TB 4AU7A 3I64A 4EMSA 4MQVA 2UV1A 5BMZA 4ZK9B 2PJRB 5IYCJ 3OIQA 5FROA 4H4KC 1JI8A 2EA4A 1U4PA 2XRLA 4JX6A 2IT0A 1PHJA 1PH5A 4KJOA 4M3FA 1BBYA 1RUOA 3ONQA 1VQCA 1X3EA 2A69C 3TP3A 2K3FA 4PSWA 3GTMB 2NS0A 1BCPC 3ECOA 5IT9L 3UNGC 4XIGS 1J5EQ 3C2PA 2LSOA 4X65L 1G8ZD 1RR8C 1LTLA 4GS3A 5F08A 4GGGA 2CW0D 1YYVA 3HOWH 3BWGA 3PO2J 1KYWA 2XGXA 1CT1D 3MKWB 2VUMB 3RZOB 4XT3B 1STZA 3ZQLA 3D4RA 1LEBA 3HC7A 4BQNA 4RAGA 2SNSA 3FKIB 3N6RA 1W5SA 2IL8A 1LQ1A 3S2DJ 1TWCJ 2RDFA 1OYWA 4HA8A 4H13C 3L7WA 1K8GA 3QU6A 1H9SA 2WB1B 4AH6A 3FBNB 3M8EA 1HR0Q 2AQFA 3QPHA 3CCMA 1PYWD 1Z67A 3KDFA 4OL7A 3OYGA 2H1KA 3SZPA 1IN5A 3C1FA 4MIMA 1H9KA 1F5TA 2QYOA 1YHQA 1E1OA 1VTNC 3IRQA 1MD2D 5IT9c 3RZDB 1MSHA 3M8JA 4DW6A 3B6AA 2RCFA 5FJ8H 1CKMA 2LKXA 4YY3Q 1X1CA 4M73A 2H94A 5LGTA 4FXGC 3I7FA 4IEJA 3I0TA 2OPTA 4AYBN 3I4NJ 3S15H 1XNRQ 5CLSA 3KYDB 3PQJA 3PM1A 1ON2A 3QWLA 4ENJA 4IFDI 2L4NA 3VYRA 2OTLA 2EIMH 2ESHA 4LF7Q 2CMPA 2XSDC 1Q1BA 2PNHA 1EKEA 4BBRB 4K0KL 1VQ7I 4ODGA 2JA6H 4EQPA 1WWXA 3T16A 2OV7A 3H3UA 1XC5A 1E22A 4Y17A 3KFUA 4O6JA 4FASD 4PGHA 1W4MA 4A5MA 4WRDA 5GPAA 4A6DA 4DR6Q 2NUCA 4IX7A 5DUKA 2E5NA 1HNXQ 1MJAA 4LB5A 4A3KB 1G6ZA 1OQYA 2F48A 4A3LJ 3OYBA 1CHPD 1M8AA 4LFCL 1U9OA 3DWAA 1BR1A 4BY7J 4E7HA 5JLXA 4A3IG 1CZGA 2HOAA 1EUJA 3GFLA 1B9MA 4DUYQ 1YIOA 5BN3A 3M07A 1KRTA 3OR1C 3FEWX 4RG1A 1DD2A 4BY1J 2XPVA 4Y7NB 1S72I 3K10A 3P9CA 2K02A 3CF2A 1O3RA 2CJJA 2EFOA 2KDOA 3KFWX 1Y1VG 3PO2H 5K5PA 2EJFC 4XOPA 2EJRA 1SEBD 4V0BA 3UDGA 3GTGH 5J47A 1VQ7A 1IW7F 4A3KJ 1L0XB 1S5LC 1AHDP 4J6HA 1X3QA 1S4ZA 3BDCA 4RKBA 4HMJA 1ET9A 3BPXA 3LWFA 5I9PA 3RDIA 4LMQD 1WTPA 5EF6A 4NPSA 4Y15A 3FPUB 5FGMA 3RQIA 1RIPA 3GTOJ 2HOTA 2O8XA 3CTAA 3DXJF 5IPAA 5KAIC 2HQAA 1R6RA 4TQUS 5ICEA 5KAFC 1P2FA 1J9IA 1JKPC 3WTWC 4BY1H 3RIRA 4CCOA 4DV1L 1GUTA 3FXLA 3IUOA 3DBLB 3K4NA 1HQCA 1R49A 1WOCA 2LD5A 4IQJA 3MXNB 1B1BA 1PFMA 3TQYA 1W36C 2WACA 3GTJB 1C0AA 2GIZA 1NMGA 1SFOB 4DR4L 4I2OA 3KIOA 3MVPA 1G8XA 1K0RA 4GLVB 3BS1A 1KL9A 2XGCA 1X3WB 5J8FA 4NP5A 4HJ5A 5JHUA 3K6GA 5FLVA 2YYZA 3D5LA 1EV7A 3JRBA 2TSSA 3I70A 1A63A 4BY7G 4DR7L 3F72A 2KHMA 4HZFA 3CF5F 1KHIA 1B44D 4D7MA 2R4GA 1VQOI 4JI7Q 5H6QA 2QGUA 2EIFA 5E4WC 1MBGA 1J7KA 2HQ5A 5E3LA 1YIJI 3DEUA 4IHXA 3J81Z 2QKMB 1AEXA 3GTPJ 3HRTA 2E1MC 3EBEA 4BBSB 1SAUA 5KNDA 4IFDJ 1YJNA 1PVOA 4UB8C 2VLAA 1MW7A 1JJ8C 2DA2A 2WFWA 1YZ6A 3PQIA 1P6RA 2V1DA 1XXGA 1VQEA 2DK5A 4XICA 4GKJL 1IRGA 4IQ4A 2NB0A 4A3IB 3WG9A 3E0JB 5LGNA 3GCMA 4MTDA 3O8HA 2R7ZG 2VE9A 4WXCA 1LYLA 3UDIA 3QOPA 1OPCA 4LF6L 1BR4A 2NVXB 2PW5A 3R2TA 3GTPB 1KZHA 2KUMA 1SBBB 2PMUA 3PSIA 3T51B 2PQEA 3JTHA 5IT9K 2PYKA 2KIFA 3K4CA 2RDGA 3DTKA 2Q2EB 4JOIA 5CC4A 2VPRA 5I9OA 2DFEA 2M45A 5C4XG 4IPHA 3FXQA 4L5EA 6PAXA 2RA4A 1EWIA 5IWAL 3OWTA 1FYMA 5LMNL 4ZJZA 1IGNA 5DCMA 4Y13A 5D5WB 3QPSA 4EJVA 2F0IA 4IALA 5ED4A 4OO1H 4EJUA 4JI8Q 1U2WA 4RB1A 2A6ED 1A6QA 4YCUA 4BHBA 5ILSA 3CRLC 2HQNA 1BUVT 5FKOA 3JC66 1RRJA 1EOVA 5LMNW 4XORA 1NNXA 2LH9A 2R93H 1WGXA 3FX3A 3A8JE 2COBA 4IUTA 1EQRA 1PH6A 3ZQQA 2VQEQ 4UVCA 5GPCA 2Q2TA 1JC7A 1VQLI 5IP7G 2ASBA 4DV1Q 1YI2I 2NTTA 3HTSB 1XPOA 1BCPF 5C4JJ 1WJAA 1GUOA 2XSCA 3PO2G 1UZCA 4GKKQ 4LFBQ 1YJWA 2CV0A 5FFXA 4G94A 3IWZA 2Z6KC 5CGKA 3D5SC 5KVRA 1U4LA 2VQHA 2VB2X 4JI8L 3FK7A 1SSOA 2VODA 4BXFA 5JVGF 4DR5Q 3CCMI 3HS0C 3S2WA 4A3GG 2NVXH 5C4ZA 4KICA 4A0YA 2EPFA 1J0RA 1Q46A 2WB1E 3ABTA 1SANA 2CKZB 2QQ8A 3V7RA 3G6EI 1EF4A 1HCZA 1FBSA 2IBDA 4DXGA 2DT5A 4M1UB 2V6EA 3F8NA 4JOMA 3TEHB 2GWRA 4BHPA 4BQQA 1B8IA 3H9JA 5JHFA 4HRIA 4DFAA 2IGNA 4EM1A 1SNMA 1LT3D 3G48A 4R8HA 4LFCQ 1I3QJ 4D9JA 4H0EA 2EZIA 3JW4A 3HM5A 1SFOJ 1Z9CA 1DCZA 5E18F 1PXUA 2CQ7A 1YNXA 1ZARA 3I5UA 1ONVA 4HJ9A 5FLXE 2STWA 1IBMQ 5GADJ 2NVQH 1FP1D 4UUSB 1C9OA 2VKVA 2K3PA 3S17B 4PMWA 1KAAA 1MSGA 5CV8A 4HBLA 2DFIA 2XPUA 4DPGA 3JRAA 1BBXC 1KU2A 2X4HA 2YX7A 4RAYA 2HCIA 2LMDA 3OOUA 4HW0A 4CBVA 3G71A 4PZJA 1LTTD 3OR2C 1FVIA 4D5FA 4YHHQ 4DYQA 2E7WA 1VQ5I 4HDVA 3VA5A 3OV8A 1RDPD 2H1EA 3L3OC 3LA3A 1PUFA 2M9VA 2G7HA 2Y69H 1LM0A 1K78A 3JSOA 5IGFA 3PIPF 4M6YA 1KD1C 4OELB 1Q1VA 2QUFA 1GXPA 4B09A 2EQSA 5GTHC 3J7AO 3NBHB 2Q2EA 1EY0A 1QZZA 3ZQ7A 4GZYC 1VQ8I 1HUNA 1I3QB 3PIPA 3EYIA 4B08A 1VQMA 3PO3B 5F1RA 2F0OA 1K73C 2B39A 3IC7A 5D6EA 4UNOA 3R93A 3TOAA 1X3UA 3DTIA 3F3XA 4XRSA 5KYLA 1K83H 2D1HA 1IXRA 3S1QJ 1ETQA 1EJ9A 2KHIA 3JREA 3LQRA 2M3AA 1L0WA 1CSPA 1WTWA 1E0BA 3PUYA 1ETOA 5M3MH 1RNLA 4XL9A 1NK3P 2EY6A 1NHAA 2VXWA 3TMOA 3BJUA 4U68A 4JPBW 3CCQA 5J3LA 2VOPA 5HLGA 1OR7A 1MNMC 5KHDA 3JAMK 1HA6A 3F8MA 3CMEA 3KLRA 4X64L 3WTXC 4XLPF 3VODA 2FA5A 5LEJA 5EG0B 3KJPA 2VQLA 4I98B 1YTYA 2L2OA 1G6PA 2JA8B 3L2RA 3IKJA 4XKCA 2P81A 5BR8Q 1ENAA 1A2UA 1XJVA 3LFKA 2RV8A 3U1DA 1JR0D 3ZMZA 1F9NA 1WJEA 2NYZD 3CC2A 4HEA2 2HIXA 1MI2A 3ZR8X 2B3GA 5BOXA 2VJ4A 1XCVA 5FJ8J 5LEKA 1GVPA 2B9SA 1Q7YC 3I4OA 1HPCA 1TL8A 3G73A 3ULJA 4DAYA 3TW7A 4UP9A 4AWXB 4R4IA 1FTTA 4EM2A 4ZKCB 2KRFA 5CVUA 3Q22A 2D9UA 2CU7A 4RKLA 2MYSA 4AYBA 4JI5L 2EWNA 5EBDA 3DLLA 4B3XA 3PJRA 2WB1A 2R7QA 4IPCA 2LY1A 3S24A 3MKZA 3LQQA 1JJ6C 1MMNA 4JCVE 1FWZA 2KFDA 3EA6A 2F0HA 5FD6A 5D6FA 3OHXC 1X56A 5FRNA 2ZBKA 5H2FC 2B2VA 2Z5UA 3RZOJ 3MFGA 3JAMi 2JXMB 2HOSA 3S2HB 1G3WA 3PUZA 1JGSA 2ZXRA 2DODA 4Y33A 1I50H 3KJOA 2R92H 2AQ3B 2XVSA 4EQ5A 2QEXA 2XV4S 3VYSB 1MH4A 1W36D 2DU9A 2PQAA 2E2HJ 1WHUA 4KITB 4FX0A 4A3BH 2L0KA 2PEXA 3WGGA 2JN6A 4JQFA 2I5MX 3FKJA 1OCPA 5CR3A 5J4YA 4RGTA 1XS9A 1VQ9I 4H7BA 4A3IH 2QQAA 2XGTA 3DV8A 2EV0A 2NZOA 4QCLA 4A75A 3D8GA 2AS5F 2CW7A 3B6YA 4LFUA 2KL4A 3K59A 1EIFA 3N97A 1B59A 2UXBQ 3EROA 4CKBA 4DJAA 4OOIA 2QKIC 2H1LA 4QUCA 4F87A 3VR6A 1I6HJ 3J80i 4G8XA 4X1EA 1ZK8A 1IG7A 3BROA 2B29A 1TNTA 2K04A 2B63B 1FOXA 1ULYA 4Y3OA 3CCLI 2MPMA 5BS6A 1ENCA 4BA2I 1D7QA 4XYQA 1KIXA 3GTOH 3ZQFA 4QIWB 1U5KA 2IW3A 2R7DA 1REPC 3T1HQ 3ER0A 1O7YA 2DDBA 1XMOQ 2OA4A 3QRFF 4WORA 3BG5A 2F0PA 4G7OC 3MEFA 1YS7A 5EEGA 2I8DA 1HZBA 5L3GA 4GYIA 2MFIA 1OXTA 2B8FA 4BA1I 2K9QA 1WJDA 3KUPA 1Q12A 4A3KH 2PMZA 1ZYRF 1GUSA 1NSNS 2ZJPF 4JYAQ 3H3ZA 2NWGA 2L5QA 3J81L 3E5QA 3NENA 1U8BA 4QL5A 3GTLH 1P7IA 4DV5L 3NRVA 2K5QA 4GOPB 1K4TA 2CSOA 1NTCA 4LGWA 1YO5C 2J5PA 1EY9A 2Y0SE 2IWHA 2C5CA 2Q8TA 4C3JB 1HBXG 4ZCKA 3CUQC 2RGVA 2CG4A 4D7NA 3GEZA 3QOLA 4KT6A 1UE7A 3H5RA 1XGSA 4MFEA 3K0YA 2E5LQ 1GUGA 1SD5A 4ASNA 4JI4Q 2XB0X 2N88A 3EFXD 2H5XA 1JT6A 4GO1A 1YHAA 2D5VA 1Z7LA 1D3YA 4XLEA 1QZGA 3F22A 1AWCA 2OC6A 3I58A 1SE2A 4EX5A 1EA3A 1TWGB 4L5SA 3HGBA 1RKWA 1CKOA 2DMTA 3HL2A 4KJZA 3KEQA 1H8AC 4CXFA 2K5WA 4KA4A 5GAHC 4OO1I 4CCKA 2ZJQF 5EPLA 3R4KA 5GQOA 1EWCA 4G7ZF 1B4OA 3I59B 1Z21A 3K7AH 3X3MA 2VKEA 5E8IA 2GOXB 5EYRA 4A3EG 1ZXTA 1MJEA 3K2AA 1KQ0A 2HR3A 2IS1A 4P74A 5D3IB 3PIO3 1BBWA 2ZTEA 4JI4L 2K01A 1TS3A 2ES2A 4PNYA 2MGSA 1LTBD 2O5IC 1K3BC 2OCEA 2C6YA 3BP8A 1PZKD 1BW6A 4LF9Q 1FBUA 2IA0A 2L9SA 1E3HA 2KP6A 3AFQA 4DR3Q 3RJPA 2FBHA 5FB2A 3MWYW 3H0GH 4HSRA 4UY8I 2IP2A 4IUNA 2V4JC 2O5RA 4BE0A 3OSGA 3TBIA 4JK1C 1G2SA 4EQOA 4IUPA 1SMYC 2IS4A 1BJAA 1IC8A 3W1GA 1VQNI 4TV7A 1LV9A 3VYTB 3GTLJ 2JUCA 1O3SA 4XLHA 2WB1G 2EH3A 4BDYA 1DPUA 1SR3A 4UPAA 3ND8A 1AKHA 1ZGWA 2Z4HA 5IWAQ 1JB7A 5F0CA 1WTOA 4KN7X 4OGQC 5JPMC 1IO2A 1E3PA 1RPWA 1OMIA 4RBOA 3ZQCA 2YPRA 2IS6A 3MXNA 3HPHA 3JRDA 4K2KA 2M4GA 3QODA 4XLCA 4BY1B 4P73A 1OXXK 4OAZA 1B1ZA 1I4GA 5DCMB 3M1CA 3QIAA 4HR7B 2YS9A 1SYBA 3G6EA 1T98A 3KE2A 3FMSA 1R1TA 5M3MJ 3EVQA 3JRCA 4A3CJ 2W25A 1JT8A 3PV0A 4ITVA 2OU2A 4ZZDA 2Y2ZA 1R4NB 4GCVA 1HXYD 2LXJA 1QILA 4IO9F 4LUVA 2PI2E 2XF5A 2HCCA 1N9WA 2DT7B 5IYBG 4XQFA 5FKKA 1GDTA 3UDXA 3OYNA 2K1BA 4Q4ZF 3QP5A 4LLLA 4HDUA 3I91A 3LAJA 5M5XB 2L4MA 3WHCA 2OTJI 4CJ0B 5D8KB 4BKXA 3S2DB 2KCMA 4JC0A 1TWAB 2ZB9A 4JW0A 1FYKA 4K5WA 1JUPA 2LKSA 4JI2L 4S05A 1NUCA 2K14A 3JR9A 1I4HA 4FX4A 2Z16A 2XDVA 1X1DA 3M3YH 2HI3A 5C3EH 5LHGA 2K6AA 2YTYA 4FXKC 1LVAA 2XF6A 3WGHA 4C3JH 5IP6A 4OU0A 1CQVA 1FZPB 4M8AA 3CD6I 2ZMEB 4AIKA 2LF8A 5EEHA 3S1NJ 2A5YB 2CUZA 3WE3A 2WAQG 3CKIB 4BBRH 3S14H 3A56A 1JCKB 1CK1A 3E0EA 2PMZN 2DA6A 1AW7A 2E7XA 3O2PE 3S14B 1T0FC 2QCOA 4HOBA 5TJJA 4M9ZA 1EY7A 2PW7A 3H09A 4A69C 1MGSA 2PMZB 1NJIC 1BCPB 5LMUL 4NHJA 3U9SA 3FP9A 2M7BA 3HYIA 5FKMA 1BC7C 4JI0Q 4DV3L 2DK8A 4EEFG 1RKTA 2B63G 3CCYA 1II3A 2HQLA 2G5DA 2DPDA 1LFBA 1GD7A 2EYLA 3RZDH 3BR1A 2Y9YA 1EYCA 4C1NK 1N36L 2W1OA 1WRJA 4LF5Q 4L9NA 2H8WA 2KRHA 3D5RC 2H4OA 1Y1WH 1BW5A 1GKHA 2NZHA 4A3JG 2MH2A 2JSPA 1FGBD 5JFRA 3GV6A 3HOXB 1UE6A 3OYEA 1GLNA 4R1HA 1GVDA 1L1OA 1K8AC 2R92B 3OL4A 2IX0A 2KENA 1O7FA 3DWLE 4KK7A 1UELB 1YEZA 1O57A 1R58A 4DV2Q 3E5UA 4O0AA 2PFBA 2JQ7A 1F2YA 1P4AA 1LDDA 1L0OC 2L01A 3BU2A 2OQRA 1LEAA 5M3MB 2G7UA 3OPOA 4IOAF 1X4PA 2CGPA 3P9KA 5LHHA 3NBIA 3LNQA 3IRBA 2BY1A 5CVRA 3BJ6A 2LC2A 1G3YA 4P5OA 3BDLA 5DYMA 3BY6A 4D0PA 3MA2B 3K4LA 4A12A 5E7NA 2D0PA 3FBIB 3LSRA 1YNND 1SYEA 3ULPA 1N34L 1RZ4A 2YTVA 2B2YA 1D0ZA 5M5YH 1RF2D 3M1EA 2PNRC 4B4CA 2A3SA 2ZNZA 1HFGA 4ZDOA 3NQTA 1AZPA 2PZTA 4BWGB 2MD5A 3F2BA 4DV4L 2EINH 2KHJA 1CF7B 2CW0F 4R1JA 1OFCX 1SD7A 2O0YA 4CCJA 1KDBA 3H9GA 1DOLA 3A02A 3WGIA 5J1YA 1YHBA 3I4NG 1LVKA 3FM3A 3JTGA 3FM5A 1HZCA 2N3SA 1HRJA 4KMUX 3GFIA 5HS9A 1DGSA 2F0UA 1PTOH 2NVTB 2VQFQ 1FTZA 1F2MA 4DXFA 1YBYA 2EFPA 4HSTA 4UV8A 1POGA 3BLYA 1Y1VH 4K8JA 1YJNI 1VMCA 3BYYB 2VN2A 3J80c 2R7ZH 2QW7A 4XBFA 1Z3YA 4X62L 3LWEA 3HOYB 2GQQA 3TS2A 2B2WC 2EFNA 4UUVA 2QSGX 2K85A 2WAQE 2FMCA 2L15A 2NVYH 4BXXG 3V96A 4CCLA 1VS0A 2OD5A 3V05A 3G6JB 1IXCA 4DR2Q 2ZKZA 4C56C 1JE5A 3A5ZB 4C9YA 4J00A 1RL2A 2XAJA 4KT5C 2QLZA 4Z6YA 4FVMA 3IH3A 5KIXA 2VQFL 2K5DA 1JJ2A 4EQQA 1IUYA 2RREA 1H88C 1SJED 1YX5A 2BE5D 4BNCA 3MZ5A 2R5YB 3IL2A 2EVBA 3PO3G 1E0EA 1D1BA 2F0TA 4MFDA 4ZAIA 2AHQA 1NY4A 1PV4A 3ZRGA 5DDGA 5GROA 3NUCA 3T13A 4A4IA 1KC8C 2AUJD 1L0YB 3P9IA 3BCAA 2KCCA 5LFAA 5E1XA 5CVIA 1G6NA 4BHCA 2O6GE 1Z7TA 3K4MA 1MBFA 4H02A 1FOKA 2NVYJ 4YRVA 1Y6IA 1IAWA 2K9NA 2F5VA 3U50C 5J1RA 1SAPA 4DV2L 2HZDA 3GBGA 2L9RA 1IW7D 5IYDH 1HR0L 3VFZA 4PJJA 4FP5D 5FO7B 1SLJA 4NUBA 4IOAA 1FIAA 3M4OJ 1J2XA 5ELOA 1WH5A 2V9PA 1FR3A 3VYRB 1IBKL 1KDCA 2UUCQ 1IYJB 2L7ZA 3K5NA 2QF7A 2H6BA 5DM63 2BXYA 2O9LA 3W2DA 3J81E 3K81C 3NQOA 4WJ3M 1WPKA 1JKOC 5F1JA 1T95A 4XKBA 4DGWB 3TDZC 4KY6A 4NXNQ 1KQ8A 2ECCA 4P1WA 1CKNA 2DMQA 2UXBL 5C4JH 1XNRL 4X6AJ 2ZM6L 3OS2A 4Q5VA 4FISA 1UEBA 3FF5A 5HDKA 1EEFD 3H0GG 1XX8A 1JXSA 5JJLA 4ZDLA 2P0WA 3VOEA 3NEUA 4PDKA 5C44G 4ENNA 2E1MB 2I5UA 4B48A 2M4KA 2M9HA 4R4CA 3A0HC 3KP4A 5LHY1 1NH3A 1UHSA 1DOKA 5ILVA 2B8GA 1X19A 1U5TC 3LSKA 3F2DA 2E8GA 4YIFA 3CJQB 1ZKGA 3FDYA 2A05A 4X3KA 3KBXA 4DZPA 2YTXA 1R4MB 4LMYA 1N8RC 4EVOA 1L3LA 1W7PD 3A7AB 3KLOA 4XOTA 1BI0A 1MNEA 4XSZF 1E2ZA 1TZLA 1SNDA 5EGOA 3UE1A 1IBKQ 3HOVG 1DP3A 3T1HL 5ELEA 4LJZF 3FXKA 1Z3XA 1WVLA 4RGMA 1XGNA 1BC8C 5KEEA 2BV6A 4RMNA 3A54A 2ICWG 2A68D 4U673 2A5WA 2DY7A 2ZCWA 4NB5A 4MTEA 4XT1B 2FOKA 2WAQN 1R1VA 2CHBD 1RTOA 2XKPA 3E7LA 1QUQB 4HJ7A 4A3DJ 4HX7A 5FLMG 2O3FA 3HHGA 1SROA 2KIMA 2L9HA 1IRFA 4U7DA 2V1XA 2M2EA 2RHQB 1GO3E 2JA9A 4IUUA 1E24A 4B3SQ 2PI2A 3FK6A 1OISA 4BXXH 4YELA 2FE3A 4LG0A 4M3BA 3H9QA 2R6GA 2VJIA 3FPPA 5GTIC 3RLNA 2KT0A 4F7ZA 3KF6B 4ZQ3A 5M5WB 1YRNB 1KQ9A 1Y14B 3S1NH 3E3XA 3C1EA 1KONA 1X2NA 4RGNA 4KI0A 2R93B 3E1SA 3OTOL 1SFUA 3MKYB 5JVG3 2ZSHB 2ELHA 3MEHA 3J81j 4XIDA 4F7XA 3UDFA 3Q0VA 4ETSA 1RR7A 3CW2C 4X66L 4A93B 2M2LA 1RIOH 2NOJB 4KHPL 3R3OA 2AHOB 1A31A 3TREA 1XDSA 3S16B 3Q8DA 1XN7A 1PDQA 4A93H 2X6WA 2F0JA 4E4HA 2JK8A 4FHTA 1ZTRA 2FXAA 3KF8A 3H3VI 1XWEA 2VT2A 5EJCA 1V4RA 2KBNA 3F6OA 1SYDA 4WCGA 2LY7A 4CDDC 3PIP3 5E8GA 2PPBC 2HTJA 5J39A 2PX9A 3K58A 2RDHA 5JJZA 2Z6BA 3D4WA 5D5VB 2ZTDA 5K36H 1VQDA 2O03A 1YE9A 4OIJA 2ZT9C 3BVZA 2ID0A 4K2LA 1ACIA 5C0XG 4G9YA 1OR7C 1HTPA 1TWAJ 2R3ZA 2QA4A 3MZ8A 3DP7A 1FJGL 1SYCA 3H3VH 2RBMA 3I56A 2M5WA 5LHIA 2I10A 1FD7D 4KIFA 4HYEA 3BJAA 2F0MA 4HX4A 3CO7C 4F8MA 2QKLB 1P16A 2NOGA 2CFMA 3RKXA 2VC0A 2F2EA 3HOYH 4AM3A 1F43A 1ETXA 2R7ZB 2K28A 4BY7H 1S5CD 4HLXA 4CYDA 2H09A 2E1CA 1XMOL 3ERSX 3SZTA 3LNNA 3KYCB 2I0QA 4C3IG 3VPRA 2N78A 2K52A 2Y48A 4I7HA 1HCRA 1IF1A 2ZMEC 1ASYA 2ZMEA 2OF1A 4A3BG 2BW3B 4RLFA 1CA5A 5G3LF 3HGYA 4P75A 1KQSA 3NXWA 3Q0WA 1PVEA 3BTJA 1VFCA 1FP2A 4EGZA 2MO1A 3TKYA 2Z0SA 3PNTA 3HOTA 4LB6B 3TSSA 2R93G 3K8AA 2CUEA 3BC8A 3G4SA 3OYAA 3E5XA 1Z6RA 4DN4M 1D5XC 3I4PA 1Z6HA 3AAFA 2B2TA 4LF4Q 2PMZE 3D4DA 2G0EA 1WI5A 2HGCA 1O78A 2LYCA 1D5ZC 1YJ9A 4JBMA 1I39A 2CWAA 2XUBA 3RZDJ 3VYTA 2VOOA 1Z6TA 2VZAA 3M4PA 2BY3A 4IRGA 4A3DH 4J19A 3C2BA 4ZYSA 4WXHA 2IVMA 2VQCA 2HNHA 1VQJA 2L54A 2SEBD 3A01A 1TWCB 2BE5C 3PFYA 3P7JA 1IN4A 3DMUA 1JOOA 1S5ED 2JP1A 5L3CA 2F4MB 1N36Q 1MZBA 4OWTB 4E6KG 3B6CA 4JX5A 4U0YA 4X3SA 4RAZA 2EPBA 4LD5A 3T56B 1R4QB 4DAMA 3M9BA 5JR3A 2IS2A 5COYA 4NKLA 4PMCA 2Z9HA 3VDYA 3LSMA 5DV5A 4CGZA 4I02A 2L12A 1STBA 5M3MG 3T0YA 3CD6A 2KECA 1XB4A 2OTJA 2IY5B 4B43A 1K9MC 2UUAL 3DPTA 4KV6A 4MLOA 3E9HA 3KK7A 3ONAB 4U88A 1ASZA 1HW1A 5CKTA 3KYLA 3PUWA 3BZ6A 4LF9L 1NG6A 4JX4A 3CLOA 4M9SA 1I4PA 4L8JA 2EOTA 4IJLA 4APVA 5IP9G 2BOLA 2AWOA 1HF0A 3HEJA 3M4QA 2O5JC 4JV5Q 2K75A 4RGUA 2NBFA 4HIDA 5IYDG 3FDTA 1OCOH 3DCFA 3LSIA 3SEZA 2IX3A 3U58A 4RWSC 2LP0A 2P5ZX 2HXIA 3GP7A 3BZKA 3KZYA 1WZ2A 2Z6KA 3SJMA 1A3UA 1N34Q 4OIKA 2JA6J 1E7ZA 4IHTA 2JYOA 4BQOA 4MIUA 4B3ML 2BA1A 2VBWA 3S2HJ 5K36G 4N0BA 2R7OA 5M5XH 1RTNA 3I4NH 4A3GB 1HH2P 2XB5A 1JB3A 2Y0SG 1F2LA 4UDUC 1EYDA 1H9RA 2LLKA 2QDLA 2X6OA 1NAPA 4JI1L 1BN5A 1QG7A 4DKAC 3CMAI 2EIKH 4UB6C 1AOYA 4CHUA 1KNEA 4NC8A 1TTYA 4NDXA 3FKIJ 4JK1X 1TWAH 5FOBB 4N8FA 1ZAOA 3M4OH 5IOYA 2OCCH 4AC0A 5DM6F 3AB9A 5DM7F 3U2RA 2IGOA 1A3TA 1YG2A
chains in the Genus database with same CATH topology
3S1RB 3LMMA 1JR0D 2W7NA 4IUVA 1A3VA 3OL3A 1WJEA 2RQQA 2NYZD 4R8NA 3CESA 4IZZA 1LABA 5EPJA 2X1CA 4HEA2 1LTAD 3S3NA 4C3HB 1A6XA 1BQQT 1MI2A 5JAVA 3ZR8X 3C2GA 2IGMA 2JVGA 1ZEQX 2F0SA 2VJ4A 2F03A 1DOMA 3DHQA 3J7AY 5IGCA 3OSOA 4ILWA 1PYVA 1WTVA 1IW7C 4DA2A 1PJRA 2E2JB 4F55A 4KKUA 1V8QA 5IOCA 3OYMA 1HPCA 2V26A 3OYHA 3TBIB 3GTLB 1LT6D 4DAYA 2R7SA 2A6HD 1F77A 3EQLC 1STEA 4I65A 4ZKCB 1V5FA 2JA7B 3MC0B 3Q22A 2D9UA 4BJTA 2X6XA 2VXDA 5EKLA 3M4OB 4RKLA 2MYSA 2MD0A 4AYBA 1KTKA 1EY4A 5EBDA 4XLFA 3HOSA 3IAS2 1O7ZA 2LG4A 4B3XA 3PJRA 2WB1A 2R7QA 5C0XI 1LT5D 1Y56A 2FINB 2LY1A 2KJXA 4CKCA 2HDWA 3MKZA 1MMNA 3OYJA 3TP8A 4BS9A 3EA6A 2F0HA 1XYIA 3OHXC 1FYCA 2E74C 4II2A 5FRNA 4LIVA 2B2VA 2J0TD 3MFGA 3IAM2 4AVZA 2JXMB 3S2HB 1OLTA 4LJZC 1BNZA 3ND9A 2AWNA 3PUZA 1VCIA 2VXZA 1WJFA 4F92B 2W4SA 2ZXRA 3DPUA 4Y33A 3MAQA 4V190 3CMMA 3OYKA 1ESRA 1CTMA 3G2BA 4HG2A 3OYCA 2AQ3B 1I4QA 3SXHA 2XVSA 3S1MB 1EIGA 2BDOA 3VYSB 4HPQA 1W36D 4KY7A 4HAEA 4BACA 1VMPA 5JPNC 4KITB 3LX0A 2LFNA 3RPUD 1N75A 3QO2A 2Z4IA 4JQFA 4H0LC 3FKJA 4XKWA 4BEHB 1JICA 5CR3A 1Y8NB 4PJNA 4RGTA 1S5BD 2V7FA 3R2IA 5T1GA 2VIXA 4H7BA 3L2VA 1RHPA 2QEJC 4F88A 4QCLA 3ZGKA 4ZC3A 4CA0A 3D8GA 2CW7A 3N52A 1DGRM 2KL4A 3K59A 2B2TC 1QCBD 2FUG2 2DY8A 2BA0A 3EROA 4CKBA 4I7ZC 4DJAA 2QKIC 4QUCA 4F87A 1HA8A 1H9SB 3VR6A 4IUQA 1BOSA 3OW7A 1M4VA 3VR2A 4G4KA 2Z8LA 2GA4B 3SYTA 1GJXA 2HPIA 2EXZA 2K04A 2B63B 1GHKA 5CBEE 4PFOA 4Y3OA 3W3AA 2VKDA 2MPMA 3NQIA 1ENCA 3M4YA 2DJIA 4IFDG 4QPOA 2KRCA 4BA2I 4BJ5C 1PRTB 2HUGA 3QOJA 4F52A 1SMYD 3RQ4A 3OMCA 4XYQA 5A2QL 4BEHA 3GTKB 2LBFB 1ERDA 4QIWB 2IW3A 2WY8Q 4DAPA 1XTCD 1EL0A 4PFPA 3CQZB 4DF7A 5EKKA 3MVVA 4FF2A 4D1QA 1O7YA 1K8MA 4WORA 1EFID 2KZVA 1Y8OB 1E2WA 4N4OB 4XQNA 3H91A 2EYMA 2F0PA 2UWMA 4G7OC 2E2IB 2IPKD 3FVQA 3DLAA 4J8QA 2I8DA 2VKHA 3S8PA 1OXTA 2B8FA 4BA1I 1WJDA 3KUPA 2XF7A 2MFZA 3FRPB 1Q12A 3A8IE 2PMZA 3DM1A 3SK4A 4ID6A 5CMDA 3HOVB 1GUSA 4XQQA 1NSNS 2CW0C 3CP8A 1EQVA 3P20A 2X1DA 2L5QA 4NNJA 2NWGA 1STNA 2EYHA 1PFNA 4R79A 3PUXA 3J81L 2PO4A 2LBFA 4FNFA 2AQEA 1HHVA 1JWSD 3C3LA 1BR2A 3NE5B 3PUBA 2C9OA 2K5QA 3BVGA 3D31A 3SEQA 5C5LA 3K5LA 3F2UA 1EY9A 1FMWA 2IWHA 2C5CA 5EKIA 3BG3A 3K4JA 2Q8TA 1YNJD 3TDQA 1ESFA 4C3JB 5KNCA 2B2WA 4CJ2C 1IHZA 2F6CA 2KA7A 4KKSA 2JEAI 5D3DA 5J1ZA 3PNVA 1HTLD 4O42A 1GUWA 3I8ZA 3QOLA 4KT6A 2IJ0A 3F9KA 2CVRA 2K03A 2X6GA 1GOZA 3H5RA 1JOKA 1WD0A 3BCBA 1Z47A 3K0YA 2KOLA 3RTRA 5CQGA 1GUGA 1RKNA 2R7XA 2N88A 5CYUA 5IGEA 3EFXD 1ENFA 3QWNA 5C3XA 4Y4RA 3S3MA 1Z7LA 5FK9C 1MMGA 4XLEA 2J7ZA 5M9OA 3T53B 1ILPA 1TS4A 2OC6A 3MXUA 1SE2A 2EYPA 1EA3A 1KNAA 1TWGB 4BJ6C 3A8KE 3HGBA 3VWBA 3VR3A 1SNPA 3RUZA 4KD4A 3HL2A 3U21A 3WOEA 2A6EC 4KJZA 5ELCA 3OWFA 5LL6X 2K5WA 1H9JA 3QYFA 5FO9B 4CCMA 5E1FA 4OO1I 4CCKA 5CV4A 2VPLA 5EPLA 2RKSA 3S93A 3CP2A 1EWCA 4RCOA 3UI2A 2QDBA 2WAEA 1B4OA 4ZRZA 1Z21A 1DYQA 3NTHA 1STGA 3X3MA 3TZUA 3PUVA 2WIIB 2GOXB 2Y0SA 1ZXTA 2BVLA 1OXUA 3I4NB 3L9AX 4HNUA 3NTKA 1ET6A 1QNKA 2IS1A 5D3IB 3PIO3 2K01A 1TS3A 1D1CA 4PNYA 2MGSA 1LTBD 4KISA 3RLFA 2O5IC 1AZQA 1H9MA 1EY5A 4ZYAA 3A1YA 1PZKD 3WDNA 2DCEA 2L9SA 2KP6A 2HVRA 3DUZA 1TY2A 2LS01 3VR4A 3SDZA 1VF5C 1LTSD 2LOOA 3MWYW 2XAUA 3VSKA 5C5MA 4HSRA 1VF7A 4IUNA 4ZUJA 2V4JC 3W2VA 2O5RA 1TR5A 4BE0A 2WINB 3TBIA 4E7IA 4JK1C 1G2SA 1X32A 1YNNC 4EQOA 4IUPA 4IFDH 1EU3A 1SMYC 1RCVD 2IS4A 2L9NA 4RHSA 1OXSC 3OYIA 2F0LA 1LV9A 3OYDA 3AU7A 2I46A 1G291 1LKXA 3VYTB 2K33A 2XIWA 2FJ2A 2R7VA 4XLHA 5JEAG 4BDYA 3TL4X 1PRTD 1MMDA 3ND8A 1VZ0A 2Z4HA 2ZFUA 2OT2A 5KCMA 3NTIA 2J4XA 1WTOA 2JUGA 4OGQC 2R7UA 5JPMC 3V42A 2ZXPA 1U9RA 3IFTA 4RCNA 1J8IA 3S9WA 2A73B 2X6YA 4DAVA 2IS6A 2ELJA 3QG1A 3MXNA 4OO1G 3HPHA 5C3WA 2NVQB 3SE0A 4Q0FA 4K2KA 4QPQA 2M4GA 4FF1A 3QODA 4XLCA 1RJTA 1B50A 4BY1B 2JA5B 3GTOB 3ZXSA 1OXXK 4G6TB 4G7HC 4XONA 1PTOB 4XTCS 5FO8B 2TMPA 3DWPA 4OAZA 3CRKC 3K6OA 4N4NB 2R7WA 1WCMB 3ZYYX 1B1ZA 1I4GA 4OAYA 3DEOA 2VNUD 1D1KA 3M1CA 3QIAA 4HR7B 1SYBA 3KEYA 2PJRA 2LMCB 1C4QA 2JEBI 1QB5D 2AUKA 4KD3A 4TRDA 2A6TA 4K5XA 1S5DD 3EVQA 1LLRD 3AKZA 3EJIA 3PV0A 4ITVA 1HXYD 2N55A 1UUPA 5HLTA 1KDAA 1QILA 2W82A 3MXPA 4CCNA 2XF5A 1SE3A 4A3DB 2O2LD 2HCCA 3TP5A 2DT7B 1SYGA 3I72A 3K5OA 3S32A 1DGWY 4XQFA 3U9OA 3OYNA 2K1BA 4PQXA 3I91A 3JAML 3QYEA 3S1NB 3BG6A 5M5XB 1JOQA 4CJ0B 1HUMA 2F0KA 5JEAH 3Q24A 1TWHB 1HA5A 4K6DA 5D14A 2L5TA 3OYLA 3S2DB 3QOEA 1N78A 3LSHA 3H35A 1TWAB 3NBHA 2M00A 2XWBB 3EPZA 4X3TA 4JBWA 4K5WA 2XNAC 1SDFA 2B2UA 1KLGD 1K6YA 4DK1A 2UUZA 1NUCA 5LD2C 1PTOD 2KLOA 3SK6A 4E7LA 1I4HA 2Z16A 2XDVA 1X1DA 4B44A 5KYIA 5HVQC 1AA7A 2K6AA 2EZVA 3RSNA 1KABA 4FXKC 3URYA 2QCPX 4RA8A 4P2CB 2XF6A 2E60A 1STHA 2CS3A 2LKVA 1LDKB 2NVYB 2OUMA 1ILQA 2A68C 4B9WA 2XN9C 4KJNA 1EYAA 5IIFA 1CQVA 4M8AA 2K7VA 5DM73 4L6TB 4RM3A 1UG0A 2XRSD 4A3EB 4X0GA 2AQ1B 3A7LA 4K14A 2CUZA 5HGTA 2R7TA 2F0EA 3HOWB 5A35A 4XM3A 1EU4A 1KLUD 4J1MA 4YIJA 3CKIB 3IP4B 3M7NA 2CUJA 3J80L 3A56A 1JCKB 4IURA 2JA2A 1CK1A 3H0DA 4X3UA 2MP1A 2IXSA 2GOMA 5E4XA 1AW7A 3H0GB 3CZ6A 1PTOF 2X1EA 1OXVA 1FNUA 1JQYD 1QJOA 4ABNA 3S14B 1T0FC 1SE4A 3K70D 1EEID 3GQBA 5DEHA 1EY7A 5F2DA 2PW7A 1EY8A 1QWYA 3H09A 1MGSA 1CQFA 4XNFA 2PMZB 2DOAA 1BCPB 2D5DA 3U9SA 4N9TA 3VDXA 2M7BA 2A6HC 1Y8PB 2KMUA 1PRTC 4N9PA 2R61A 1X4OA 5IT9E 1BR9A 1I4XA 2L1BA 3OMYA 1BCPD 1GUNA 4ANJA 3AMUA 1II3A 5ELFA 2DN8A 4BGDA 2LY2A 4IKFA 3HKZA 1V1PA 2EYLA 3PMFA 1EYCA