5ELDA

Cholera toxin classical b-pentamer in complex with a lewis-y
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
103
structure length
103
Chain Sequence
TPQNITDLCAEYHNTQIHTLNDKIFSYTESLAGKREMAIITFKNGATFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAISMAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords Cholera enterotoxin B subunit
publication title High-Resolution Crystal Structures Elucidate the Molecular Basis of Cholera Blood Group Dependence.
pubmed doi rcsb
source organism Vibrio cholerae o1
total genus 28
structure length 103
sequence length 103
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2015-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01376 Enterotoxin_b Heat-labile enterotoxin beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5eldA00
3EA6A 1PYWD 1I4QA 1SBBB 3BYTB 2G9HD 1UNSA 1CQVA 1LT4D 1V1PA 1JWMD 1ESFA 1S5ED 3CHBD 2WV6D 3V05A 1ENFA 1RF2D 1L0XB 1LO5D 1JWUD 1TY2A 1JR0D 1F77A 4DXGA 1JQYD 1XXGA 1PZJD 1LTAD 2AQ1B 5ELEA 1JWSD 3BZDB 4Z9CB 1DYQA 1S5FD 1BCPB 2RDHA 5TSSA 1KLGD 1PRTB 1PTOB 4RFBA 4RGNA 1JCKB 1EFID 1LLRD 1CT1D 3DWPA 2AQ2B 2XN9C 1MD2D 2O2LD 1TS5A 1AW7A 4UDUC 1SE3A 1BCPD 1LTID 1LT5D 1PRTD 1M4VA 1PTOD 1TS2A 1XTCD 2XRSD 5FK9C 4L63B 1EWCA 3KLSX 1SE2A 1D5MC 1HA5A 3BVGA 1V1OA 4TSSA 4O1NA 3R2IA 1STEA 1I4PA 2R61A 3DWAA 1LTSD 1EU4A 4RGOS 3OWEB 1EU3A 1FNVA 1SE4A 1PZID 4K6LA 3W2DA 3BYYB 4C56C 4RGMA 1B44D 1PRTC 3R8BA 3URYA 3BVMA 4OHJA 1D6EC 1RCVD 1G8ZD 1TY0A 3MFGA 5I4DA 2NTSA 1FGBD 2SEBD 2AQ3B 1I4GA 1V1PB 1LT3D 1TS4A 1RDPD 3SEBA 1FNUA 2Z8LA 5ELFA 1I4RA 1PRTF 1I4HA 2QILA 5ELCA 1CHQD 2XRQD 4RHSA 1BXTA 1SEBD 1AN8A 1SJHD 4L6TB 3GP7A 1HQRD 1PZKD 2ICIA 1L0YB 3EFXD 4BWGB 1S5BD 2RDGA 2J4XA 1KTKA 1DJRD 5D3DA 4ZYSA 1BCPC 1EEID 3O13A 1CK1A 3TSSA 1PTOC 1CHPD 1RD9D 1TS3A 3DWQA 5FKAC 1FD7D 1T5XD 1EEFD 4DXFA 1LT6D 1D5XC 4RCOA 1B1ZA 1ET9A 1FNWA 1LTGD 1QILA 3BVZA 2QEJC 2NTTA 3MC0B 4RH6A 1BCPF 5ELBA 1PTOF 1KLUD 1HXYD 1S5CD 3R2TA 4RGTA 2CHBD 4RHRA 1HTLD 1D5ZC 1SJED 5D3IB 1S5DD 1GOZA 1ET6A 1LTRD 2IJ0A 2IPKD 2TSSA 1PTOH 1I4XA 1UUPA 5ELDA 1LTBD 1SXTA 2XNAC 1LTTD
chains in the Genus database with same CATH superfamily
3JAME 1MKHA 4A3JB 3CC2A 3ZJYC 1L1OB 1UNSA 1C4QA 3A8KE 4UAIA 2G9DA 1V1PA 2RCNA 5BN3A 4LF9L 4CJ0B 1U9RA 3UI2A 4JI4Q 4LF6Q 3M85A 3H0GH 3VYRA 3NUCA 3I4NH 3J81L 2B2YA 2CH4W 2KCTA 3HGBA 3TP6A 4A3KG 4RWSC 4AQYQ 2WAQE 4DV1L 2NVQH 2VS1A 4S3SA 3DLLA 4MZ9A 3GTMH 1S72A 2JA7G 1F9PA 1F2YA 3QR8A 1YIJA 3BJUA 2JA6G 1TT2A 4DV0Q 1TIID 4L5SA 1CKOA 1OXUA 3L7ZC 4HSPA 2DNCA 4X3SA 1JORA 1S40A 1E2ZA 2F0PA 5CV5A 4Y7NB 3CMAA 1A63A 3VYSA 4CKEA 4DR5L 4LJZC 3Q0AA 3DMUA 3KJOA 4K6LA 1K73C 5KNBA 4WJ3M 1O7YA 4BY1H 4C3HG 3Q23A 1PA6A 3NBIA 1RCVD 2WB1G 3K5NA 4HJAA 2NTSA 4NXNL 2NVXB 5M3FH 1PFMA 2JA5B 1GUGA 3QIAA 1YHQA 1FNUA 1JT8A 2MHVA 1I4RA 3G6EA 3FMCA 4JI8Q 4A93H 4G7OC 2QF7A 3NENA 3I8ZA 4DK1A 3NHHA 2R92B 2D5DA 4K14A 2A69C 4HCEA 3K6OA 4YHHL 1Z47A 4DV6L 2B2UA 4LF9Q 3KOJA 3IFDA 2OQ0A 2YYZA 4DNRB 1O7ZA 4RCNA 4F87A 3Q6SA 5GADC 1E2WA 2K5DA 4L8JA 4YWLA 1U4LA 2OTLA 1B1ZA 1Z6HA 4DV1Q 1YHAA 2EYJA 1PH4A 2IX1A 2QEJC 1K28A 3PO2G 4K5XA 5JJLA 1RODA 2PCFB 1HXYD 4AYBE 1MJCA 3PO3H 5IYDG 1QWYA 2A6HD 1ASYA 2MP1A 2B8GA 1JOQA 2A73B 2EJGC 4TRDA 1R4PB 1I4XA 2L0CA 4JVZA 1Y8NB 5CR3A 3CCRA 1CQVA 1TKWB 5IOCA 1VQDA 2AMCB 2PMZE 3MHBA 2NZ1D 4IZ8A 4BY7H 1X3GA 3BDLA 4JK1C 4DR5Q 2XWJB 2AUKA 1JWUD 1F77A 3PSIA 4UP9A 1PFNA 1LTAD 4KHPL 1STYA 1QE6A 4WORA 1DYQA 2N8NA 4NXNQ 2KECA 4RGNA 3K5LA 3NQIA 4QIWE 2SDFA 1CT1D 4IN3A 3UDXA 3TS0A 1BF4A 5CBAE 1U4RA 1TS2A 3GQBA 3NBHA 3GTOB 3QOLA 4K2LA 2Q2TA 1D7QA 2OEOA 4YHHQ 3CCQA 1WTPA 4LF5L 1WD0A 1DOLA 1MSGA 5I6WA 2F0VA 1SE4A 1X56A 2K4KA 5CV7A 5KIXA 1Q46A 5C5MA 1XMOQ 4RGMA 1B44D 1PRTC 3AYHB 4LF7L 1EWHA 4ALPA 2MJ8A 4POGA 3H15A 3MVVA 1X55A 4A3MG 4N8FA 5C44H 1OXTA 3E0EA 3VA7A 2F0EA 1RDPD 1I4HA 2R93G 2XWBB 2ZTEA 4EQOA 4HJ8A 4MTNA 4B3SL 3EN2A 1N36L 2HQEA 2RCFA 1HQRD 3UDIA 3CPFA 1PH5A 1F2ZA 1D1IA 1AFPA 5C4XB 1PMRA 3CRLC 1QVGA 2JA8G 3KDFA 2PQAA 2QCPX 3F1ZA 3TSSA 4HIOA 1J5EL 1WCMG 2B3GA 2K04A 2NN6G 2IHEA 1XNRL 1VQEA 4G57A 4C3JH 2HD3A 4KHPQ 1EZ6A 2NVTB 5EQ0A 1R9TH 2ICEC 3M9BA 1X32A 3A8JE 2B2WA 1G2SA 4KY5A 2M2LA 3KUPA 3S14H 2A74C 1IL2A 1VQNA 2PZUA 2OT2A 3T13A 4DGZA 3IFTA 5J1ZA 3NTIA 2Z4IA 1VQ9A 2R6GA 3S24A 1PH8A 4P72A 4LF5Q 5LMUL 1Z9FA 1ENFA 3M4PA 3T1YL 4R4OA 2EPBA 2B39A 3AFQA 3S1QH 2F0TA 3WOFA 4LF7Q 5FJ8H 3FKIH 3H3VH 3VR5A 3CKIB 4EQ5A 4KY6A 1QUQA 1CSQA 1VQIA 3RNUA 1STGA 4YCVA 4FP5D 4OELB 2GN5A 5LL6X 3S2DB 3OW7A 3HOZG 1EYAA 1BCPD 4GN4B 4B3SQ 1EIGA 1QOHA 2F52A 3SK6A 1BKBA 1N36Q 2ZTCA 3MEHA 3GTLH 4GNXC 1IBML 2P5ZX 1GHJA 3TZDA 3CCEA 4HR7B 1XJVA 2CWPA 5M5XH 2RSNA 4NW2A 4P71A 3HOXH 1FNVA 1XNRQ 1Q1EA 1PYBA 4OO1H 4XXEA 1A15A 2NYZD 4RKLA 4APVA 4FXGC 1EQTA 2F0JA 1STHA 2X69A 2UUBL 4L5QA 3PIPA 1FL0A 1FGBD 4A3EB 1EQVA 4QGUA 1YNND 4OWXB 1G2TA 5C3EG 1U5KA 5T1IA 1BR9A 2FMCA 1SMXA 4A3BG 5LL6S 1B3AA 2PZTA 5JVG3 5ELNA 3Q8DA 1EWIA 3HOVB 2FFKB 1Q12A 1DD2A 3P7JA 1BCPC 4B9XA 5LMUQ 4DAPA 1TS3A 3NE5B 3SXHA 3DM1A 3T1YQ 1VDZA 4LFBL 2B2UC 5IGBA 1GVPA 4A3DB 1X9NA 4OIJA 2DGYA 5EPJA 3I4MB 2EY6A 4DPGA 3KJPA 2H4OA 1LABA 4ZK9B 3PUVA 4OEMB 1ESRA 1F9SA 1HTLD 1TU2B 1SJED 3RUZA 1KHIA 4A3GB 3NK9A 1FJGL 2MQHA 2ZJPA 1MGSA 3S1MB 4YIJA 1IBMQ 1NY4A 1UEAB 1M1KC 3C2PA 4CDFC 3F8TA 2AHOB 3DXJC 4BBSG 3S15B 4A3IB 4DV5L 1JC7A 4DR2L 1RF2D 1R4QB 1A0IA 1XXGA 2F0KA 3KF8B 1E0BA 2UUBQ 3M7NA 1RL2A 4YCUA 5I9PA 4IUPA 1G6ZA 1IKMA 4PMWA 1GUOA 3T56B 3IL8A 3E5SA 4P2CB 2EZVA 4F7XA 3VA5A 2R7ZH 3E0JA 1K8OA 5IYCG 5FLMH 2HQLA 2L15A 2XSCA 3S1NH 1EU4A 1HZAA 2F0MA 3HOWH 1JE5A 4LFBQ 2ZT9C 3OSOA 3I55A 1PH3A 4C56C 1JOKA 1XPRA 3RZOB 1SMYD 4TKOB 1K3BC 1NAPA 1TWGH 1UEBA 1O80A 1K0RA 5I2XA 4DR4L 5I4DA 2SEBD 4DAMA 4NP5A 5C4ZA 1FJGQ 2CQOA 3MTSA 1Y1VB 1N34L 3M4OB 4DR6L 4OWWB 1V8QA 1KQSA 1CM9A 3LNNA 4K2KA 4JI0L 2F4VL 1BOSA 1SRUA 5I2YA 4Q0FA 2DUDA 4DV5Q 2UU9L 1KAWA 1EY8A 5D14A 2KHIA 1KXLA 4DR2Q 1CHPD 1A6XA 2NB0A 4X3KA 4A3KB 3CD6A 1ET9A 3KF6B 2VB3X 2K32A 3GTOH 2EYPA 1EYDA 2BH2A 3JC66 3TDQA 3CP0A 4JG2A 3KF8A 3ERQA 1EIFA 1LTRD 4A3LH 4IUVA 1PV4A 2JK8A 2B2WC 2VY3A 2H5XA 4IPCA 4JC0A 2JA6B 5F2DA 1SBBB 1NUCA 4XQQA 2HT1A 1SN8A 2OQKA 2F0IA 5GAGC 5JPMC 1B70B 2CWAA 3HZXA 4LMQD 2E8GA 3D3RA 3J81E 2UXCL 1VS0A 2NVYB 1H9KA 4XT3B 4IFDI 4XQNA 4EVOA 4QL5A 1AE3A 4C3HB 5KNDA 1LTLA 3S2HH 4JPBW 3U58A 2RHSB 2NZOA 4DR4Q 2D2CC 2WB1B 3I4LA 5TSSA 5C0XI 1WVLA 1IHZA 4EGVA 3I72A 3RLOA 5FOBB 5I6YA 5G3LF 3AEVA 2B63G 1PTOD 1N34Q 2VZAA 4DAYB 1NR2A 4BXXG 4UY8C 2JQOA 4DR6Q 4DUZL 2NVTH 1XPOA 1G291 2RVLA 1E3PA 3S16H 4JI0Q 1D5MC 3CU7A 2F4VQ 4XQJA 5KGUA 3IRBA 4KHVA 4K0KL 1VQHA 2UU9Q 1JJ2A 4RGOS 3AU7A 4NDXA 3P1HA 2RBMA 4JI5L 2I5MX 3BYYB 3VYUA 2K50A 1KABA 2YV5A 1Z7TA 3PO2B 1WTQA 5A2QL 1D2BA 1V1PB 4NPSA 2KCNA 4MNOA 3S1RB 1N9WA 1AN8A 1EY4A 3S9WA 2EY2A 3H0GG 2F1MA 2BCOA 4K6DA 2J4XA 3TBIB 2UXCQ 3S2DH 4BS9A 1PTOC 1I50B 4V0BA 3Q24A 4KV6A 4GNXB 5H1SE 1VQ5A 3HOYH 2LY7A 3FRPB 2QA4A 3A7AB 1EOTA 4C1NK 1TWCB 4KJNA 1C9OA 4CDDC 4DUYL 4FYDA 1STBA 1MBYA 1YJ9A 4HN7A 3C3LA 2OWOA 3WOEA 2LXJA 3T4AC 4DUZQ 1Y1WH 2IX0A 2Q2HA 3I56A 4A3EH 5GAHC 4K0KQ 4BY1G 4A3FH 5IT9L 4MN3A 3A5UA 1L0XB 3AQQA 5E1FA 4JI5Q 4H7BA 1W6JA 4ZAIA 4IPDA 5M3FG 1JQYD 4HEDA 2A6EC 4QJFA 2X6LA 4ULLA 1WJJA 3W5OA 1V1QA 1BCPB 1K83B 4LWCA 3R3OA 4JI2L 4A3MB 4K8JA 4A93G 1F9RA 3NPPA 3IAYA 2MO0A 1ASZA 1IBLL 1J9OA 2R93B 5FLXc 1EIHA 1LT5D 1VQ4A 4A3DH 2QDLA 3U4ZA 4H02A 1HA5A 3BVGA 3J7AF 2EXZA 4KN4C 4O1NA 3K59A 1STEA 1EZ8A 2JEBI 1M90C 4JV5L 1I3QB 2WACA 1WCMB 2E75C 3PO3G 1SNDA 3CCLA 3QOJA 1NTGA 3SVMA 3A8IE 2A69D 4X3TA 3MFGA 1PXUA 3BDOA 4DUYQ 4E6IA 4GNXA 3GTQH 4A3IH 1NCVA 2EVBA 1PLFA 5LMNW 3SEBA 4ZKCB 2ZXRA 1TWFB 4QUCA 4ME3A 3D4DA 3MXPA 4BWGB 3J80E 2UXBL 4X66L 5BR8L 1SFOH 1X3FA 3IKJA 3V96A 1YHBA 3D8GA 3BZCA 1FD7D 1T5XD 4DXFA 4R9WA 1YZ6A 3GTGB 3STBD 1EOVA 1ICFB 3K7AH 3TEHB 3TP8A 5M3MH 3K5MA 5JJIA 3NBHB 1X3EA 2F0DA 3ONAB 4KKUA 1EQRA 4TVAB 4JI2Q 4C3IH 3BZKA 1PH7A 1S5CD 4ABNA 1DXMA 1QNKA 5JOBA 5E3FA 1IBLQ 3G4SA 3HOZB 2ES2A 2CKZB 5ELDA 1FGUA 3KLSA 1KD1C 1PYWD 2VQFL 3GTPB 4H0LC 5I9OA 3WWVA 3DEPA 4JBJA 1UAPA 2CQAA 3H6MA 4JV5Q 2RF4A 2N49A 1TQOA 4KMUC 4IUTA 3P75A 1Y1VH 3G6JB 1JR0D 3M4OH 4GN5A 1PZJD 2K7VA 4ODGA 1SSOA 2QGQA 1AZPA 3M3YB 1KLGD 3FP9A 2XGTA 1PH2A 1IW7C 1TWAH 3KDFB 2PQAB 4ID6A 1BBUA 3W1GA 3PUYA 3STBC 1NBWA 3RZDB 4R8NA 1PRTD 1XTCD 2HHHL 4LFCL 4O42A 1A8VA 1QG7A 3SDZA 3UE0A 1HA6A 1H9JA 1EYGA 1V43A 3R93A 2UXBQ 1EYCA 4C3JG 5BR8Q 4X66Q 1ILPA 2D0PA 2XVSA 5LMNL 3HG9A 1A3VA 2H1EA 3MWYW 3ITPA 5ELOA 1WTXA 1YVCA 2L12A 4LF8L 1TVXA 2HCCA 4HIDA 2JA6H 2KOLA 2K05A 3K0YA 3PF4A 3URYA 3GD7A 4BA2I 4QF4A 5E7NA 4AYBG 1B9MA 1X54A 4HAEA 2LXKA 2QILA 4IJLA 5EKIA 3S17B 3CQZH 4DV6Q 5D65A 2QKIC 5GQOA 4L5TA 2VQFQ 5HURA 1QUQB 3D0FA 1JOOA 4BBSB 1KTKA 3VR6A 5FJ8G 3FKIG 1DONA 2K75A 3P20A 4KLKA 2LFNA 1GHKA 3JAML 1SNQA 1TWHH 3MZ5A 3RLNA 2I5HA 4FVMA 3EROA 1L0WA 4DKAC 1D1KA 1GXDC 3JAMc 2NUCA 2ZXPA 3DUZA 3PV0A 3KFUA 1U4MA 2AWNA 5IE8A 4FF4A 4FF2A 2HHHQ 4LFCQ 5CV9A 4CBVA 3J7A5 1SNOA 4ZUJA 3HOXG 1BBXC 1KDBA 1NE3A 1JJGA 5GAEC 4OO1G 3FHWA 1EY7A 5LMNQ 1W3SA 3GTJH 1W2BA 3S1RH 3A55A 1YJWA 1QB5D 1QCBD 2TMPA 4LF8Q 4L5RC 2N3SA 3DM3A 5JPNC 3E9IA 1OXVA 1PTOB 3KBXA 3W1BA 4DV2L 4J15A 1JCKB 4HJ9A 1WTWA 2KQ3A 3DWPA 1RKNA 4IUUA 2KUMA 5E4WC 1BNZA 4X62L 3E3XA 2YU9H 4C1NI 4C2MB 4IFDJ 1A2TA 1VQJA 3AB9A 2F3VA 1YNJC 4A76A 4DR3L 3T1HL 1NMGA 2CCZA 1QVFA 3R2IA 2PW7A 5C0XJ 2JA9A 4RMFA 1QZGA 1Q7YC 5EGTA 5DM73 4DFAA 4JBWA 3GDEA 1S3OA 4XYOA 5M5WB 5K36H 4RKBA 1PRTF 4DK6C 4ZQ3A 1HR0L 4KKSA 3GTKH 1HRJA 3BU2A 1SJHD 2IWHA 2F0OA 3L3OC 1I6HB 2ICIA 1K83H 1J5EQ 2EY1A 4CDCC 3JAMi 2B2VA 2ENBA 2E74C 4IQZA 2KHJA 1EEFD 4HCSA 2RHQB 1F2LA 4A3JH 2EXDA 4CGYB 4PNYA 2MPMA 2NTTA 4DV2Q 1Q81C 2BDNA 3L2PA 5KRUA 5IP9H 1A2UA 1KL9A 1Y8OB 3VR3A 2R7ZG 3RD4A 4GZYC 3BS1A 2B63B 3H3VC 2YTXA 4X62Q 5FLMG 1VQ6A 2EOTA 3J7ZC 1S4ZA 2XNAC 1C48A 2K1BA 3HOWG 3CF5A 4IFDH 1W6KA 4DR3Q 1IKLA 3HOUG 1CI3M 3OHXC 2QEXA 5C0XH 3M7GA 4LFAL 1UE5A 3T53B 5CV8A 2IHFA 4Y7NH 3QO2A 4BBRB 4PV1C 1CFMA 1IBKL 3ND8A 2VNUD 2RDHA 3BG3A 4AIMA 1GUWA 3TN2A 3V2TA 3SK4A 2YTVA 1NSNS 3E6ZX 2BA1A 2MNAA 2B29A 3K7UC 4LW1A 2A68C 1TR5A 4MHEA 1WD1A 4KY7A 3GTGH 1SE3A 2DY7A 4R1JA 2ALYB 2V1CC 1HR0Q 2XRSD 4B3RL 2PPBC 2NVXH 2JA5H 3RR5A 3A54A 1L1OC 2Q8TA 1BQQT 2L5TA 4JBKA 5JEAJ 4R4IA 1CZGA 2NVQB 2K14A 2IX3A 2EYMA 2F0HA 1KNEA 1VQKA 3GTMB 4GLVB 4JOIC 2R92H 2PO4A 5C5LA 4CDEC 5A2QE 4OHJA 4A3LG 4R4CA 2JP1A 1QZHA 3HEJA 1Q82C 4IPGA 1EQQA 3E9HA 4J6HA 4B08A 1TS4A 2Z8LA 4A3CH 1PVOA 3PCOB 1VMCA 4I7AA 1LUZA 2RA4A 1PZKD 1AZQA 5K5PA 2EYHA 1ZKOA 3OMCA 2B8FA 4BY1B 3O13A 1D8LA 4DU9A 4U673 2BDOA 2PW5A 2KEDA 2C35B 1WFQA 5M5YB 2VQEL 5M3FB 2A5HA 4LNQA 3NWSA 1IBKQ 1LYLA 1VQ7A 1BCPF 3I91A 2Y0SG 1KLUD 2K5HA 4A93B 3HKZG 3ULJA 1PH1A 4X6AH 3FEWX 5IYBH 1HQMC 1SR3A 2E2IB 4B3RQ 3CCVA 1B53A 2RQXA 3NQTA 1AH9A 4F8MA 1I4QA 4OXPA 4X64L 1Q90A 1JB3A 3EIVA 4B3TL 3OTOL 3OPOA 5IT9E 2UUCL 1WTRA 5JEAH 2FINB 3PO3B 5EJWA 2PNHA 2PQEA 3LWUA 4LF4L 1N32L 1IYVA 2IY5B 2JA7B 1OTCA 1EY0A 3H94A 5IP7H 1FYCA 2CW0D 1PRTB 4BBSH 1LM0A 1UE7A 4RFBA 4UPAA 5BN5A 4UP8A 3VYTA 4IOAA 1Q3LA 4IURA 1Q1BA 2PI2A 2V4DA 1MSHA 2F0WA 2NN6I 4MTKA 4L63B 1LACA 4P75A 1EY5A 2IL8A 1K8MA 2ATWA 3HOYG 3HFZB 2N88A 2WFWA 3NTHA 4QY7A 1LTSD 3I4OA 2E76C 4DV4L 4RA8A 1RHPA 2WKDA 2VQEQ 5C4XH 1HH2P 2D0OA 3CCJA 4IOCA 4PQXA 2IT1A 2RSOA 5LHY1 3K81C 3KYHC 4GLAC 1Y1WG 2LKVA 1XTDA 5NUCA 2Z6KC 1DOKA 5ELCA 1XNQL 2DJGC 2K5NA 2XRQD 4A3EG 2Z4HA 4A3FG 2CW0C 1QVCA 4R8IA 2WINB 4X64Q 1U4PA 4FF1A 3F2UA 1HFNA 4B3TQ 3OTOQ 2UXDL 2UUCQ 3TS2A 2F3WA 5CV6A 4WJ4A 2VUMG 1CK1A 2X6GA 2B2VC 2CH4A 1LV9A 3CAMA 4LF4Q 1N32Q 1D5XC 2RKSA 4RCOA 5CORA 3T51B 2EYLA 4JI1L 4C2MH 1VQBA 2AKWB 1QILA 3RLFA 3MC0B 4LK1C 1E24A 4DR7L 3CC4A 3ULPA 2C5CA 1D5ZC 2ZJQA 1HZCA 4U68A 5KEEA 1CQFA 3I4NG 2A6ED 3I3CA 2EJFC 1G6PA 5CV4A 1C0AA 1LTBD 2KEEA 1N8RC 2FMMA 1HUNA 1KAAA 1ZYRC 5E4XA 2L4NA 3OMGA 5M5WH 2ZTDA 4C3JB 3HRZC 1BBWA 5JVH3 2WKCA 4CJ1B 4X3UA 1STNA 2L55A 2PZWA 4LUZA 4DNTB 1B50A 4DF7A 1BO0A 2L1BA 1JWSD 3W3AA 4K5WA 3S14B 4AYBB 1B7YB 2F4IA 1NJIC 4AQYL 1H9RA 3TP5A 2O5JC 1DM0B 2XN9C 1XNQQ 2EIFA 4WJWA 1VQAA 3I70A 4N8X1 4GN3B 3D6WA 1QJOA 3FPPA 1CUKA 1VF5C 2UXDQ 5COYA 5M3MG 3S1QB 3FKIB 3OWEB 1X3PA 1PH9A 3HOVH 4C3IG 5FLXL 2Q2IA 2B63H 3MFYA 2AWOA 4JI1Q 4PMCA 1GUNA 1M8AA 4DR7Q 1IL8A 2BOSA 2A19A 1NR4A 3G71A 2EJMA 4QIWB 1KC8C 3I4MH 1STAA 1CHQD 4RAUC 1YITA 5JJKA 2BE5C 4BBRH 2JA8B 2J7ZA 4EQNA 5M5XB 4A3GH 1ML0D 3HOXB 1Y1VG 2ZXOA 1XX8A 1KNAA 2I07B 3S1MH 1DCZA 1ZXTA 5DEHA 2K5QA 4J8QA 4ZYSA 2EYFA 1EEID 2PNRC 3VR4A 2ZJRA 2O5IC 3TRZA 3PMFA 3OYYA 5J39A 1LT6D 3S15H 1E1OA 1HJPA 5HGQA 1O78A 2KENA 1EIYB 4QMGA 2WB1E 4DA2A 1PTOF 1Q8KA 4EQPA 2NBFA 1SYFA 5IIFA 2CHBD 3PQIA 3J7YW 4WFN3 5D3IB 4OGQC 3UDGA 4BY7G 3J81c 2OTJA 1WOCA 1WYDA 3TZUA 4J1MA 5HGTA 1RTOA 3I90A 2VW9A 3BYTB 4PG3A 1IW7D 2G9HD 2Z1CA 3A74A 3KBGA 5T1GA 2WAQG 1LO5D 1X65A 1TY2A 4HSVA 4PZ6A 4KK7A 5C4JB 3K80C 3BZDB 5J22A 1S5FD 3C46A 3M4YA 4LUOA 1KDAA 3SHLA 1CA5A 1B3QA 2E2DC 1N33L 2FXQA 3RZOH 3ICEA 1C7YA 1UE1A 3PUZA 5HY6A 5M5YH 2UUAL 1OXXK 2NZHA 5FK9C 1O7IA 2HDLA 2JYOA 1MHWC 2JEAI 1ILQA 1PH6A 1H9SB 1ICWA 3SGIA 1IYJB 1F9QA 4POFA 1JMCA 2OF1A 1SNMA 3MXUA 5C44G 1HCZA 2LMCB 3M4QA 4KJOA 2SNSA 4NKLA 4JYAL 2DNEA 1PZID 2E2IH 1JICA 1IZ6A 2F0GA 3J7AV 1K3RA 4O2DA 3R8BA 1IXRA 1G8ZD 1TY0A 2E2JB 1KDCA 5C3EB 4LUVA 2VL6A 1L1OA 1XMOL 1K0SA 4A3KH 4A3BB 5ELFA 3U50C 3MXGA 2R7ZB 1H9MA 2JE6I 4YWMA 2KHSA 3PUXA 2K6AA 3NWTA 1UWVA 4RHSA 3F2BA 2JA7H 1SEBD 2SOBA 3CMEA 4A75A 3S1NB 2F0UA 4JOIA 2MFIA 3FDTA 3OW2A 3HOWB 1ENCA 2EY5A 4DNIA 2Z9HA 2Q8IB 5D3DA 3EQLC 4DK3C 3HOUB 1TWGB 1VQ8A 4ME5A 1RD9D 3ULLA 3J81i 2I46A 5EAYA 1CKNB 2ID0A 1I6VC 1I94L 3K5OA 2Z6BA 4KTAA 2NVYH 4DN4M 3C1EA 3QB3A 4DV3L 3LX0A 3K0XA 1Q86C 4PMBA 1N33Q 4FF3A 2B2TA 3C1FA 1CA6A 2E2HB 4C3HH 3EBEA 1VQMA 4N9PA 1GOZA 5EKKA 3RMHA 2O4XA 5A35A 2UUAQ 3X3MA 2ZM6L 3ND9A 1FR3A 1JB7A 4IUQA 5IGCA 4OIKA 4QB4A 1Y8PB 2KVMA 2MO1A 3A56A 1WTHA 1HR0W 2A8VA 2Q2UA 4GOPC 3HKSA 5GROA 3VDYA 2A6HC 5EBCA 1MJEA 2A1AA 5C3WA 4NMZA 4JYAQ 1H9SA 5K36G 5DAUA 1Y69U 2AQ1B 1C8CA 1YNJD 1B4OA 2EE1A 3L0OA 3NELA 1PHJA 5C3XA 1E7ZA 5IGGA 5JJZA 1SDFA 3NP8A 2FJ2A 2RDFA 3T16A 4XDXA 4ZCKA 2DN8A 2O2LD 1HNZL 3PO2H 2CVRA 1LTID 4OWTB 3TMEA 3CRKC 5IYDH 2R7FA 1EY6A 1RJTA 2EQSA 5EPKA 1EWCA 3KLSX 2R3ZA 3PGZA 1L2FA 1V1OA 4A3JG 2KCMA 5FO9B 3S2HB 1X3QA 5KYLA 2G5DA 2GVBA 3SE0A 1YJNA 1I94Q 4JI3L 1VQLA 3H91A 5IP9G 3J80L 4JI7L 1VQGA 3BVMA 1I50H 4DV3Q 2Y0SB 4FNFA 5FO7B 4UP7A 5IGFA 3HKZB 3DEOA 1CKNA 2BH8A 3J80c 3UE1A 4IALA 3F2DA 1DZ1A 3B6YA 3S16B 4IFDG 2ZM6Q 1TWCH 2LS01 1AE2A 1SAPA 4MIUA 5C0XG 1SYCA 3EFXD 1GO3E 1YI2A 2F3IA 3HP3A 4ZKBB 1CTMA 2F0QA 5FO8B 1Y14B 4CKBA 2Z6KA 2BA0A 3OOCA 2F0SA 2HCIA 3BVZA 4O0AA 2SNMA 4HMJA 4RGTA 4BA1I 2JA5G 3SR1A 2B2YC 1DGSA 1PYSB 5C6AA 1HNZQ 1S5DD 3EVQA 1VMPA 3D6CA 4ZRZA 5CMDA 4KKTA 4A3MH 3PIO3 2F0NA 3TREA 3CW2C 1KIXA 2JSOA 3EA6A 3FVQA 2R93H 2HDMA 4XTCS 2R92G 1XMQL 1AP0A 2A68D 5AJ3L 3ER0A 3HOYB 1ESFA 2GVAA 1CSPA 1U0LA 3VR2A 1YNXA 1GKHA 3G7LA 4DXGA 4JI3Q 2JA8H 4JI7Q 1JE4A 2HIVA 2L11A 4A3CG 1I3QH 5EKLA 4Z9CB 4RG1A 1WCMH 2NN6H 4ILWA 4IPHA 3KK7A 5CBEE 4N9TA 4OL7A 1G91A 1PFSA 2I5LX 4M1UB 1Y1WB 4KHZA 1LLRD 2K01A 1BUVT 4YWKA 1AW7A 4UDUC 4B3ML 5CC4A 2K03A 2VB2X 3MXNB 3T1HQ 4A3FB 3KLWA 3D31A 1K8AC 4DAVA 3NTKA 3CCUA 1Q8IA 2XTIA 4TSSA 3K58A 1TWFH 1OXSC 1MIUA 1PDQA 3J80i 1SROA 1E22A 2VUMB 2F03A 3DWAA 1K9MC 1EU3A 4JBMA 1XWEA 4OX9L 3LWEA 1IYUA 1PFBA 2AUJD 4R4QA 5IYBG 1D6EC 1VQPA 3CXCA 5IWAL 2N78A 1T9HA 2AQ3B 1B9NA 1I4GA 2KA7A 1F2MA 2JXMB 3DHQA 3AFPA 4HIMA 3H0GB 3SK8A 3I4NB 5C4JH 4NB3A 1BXTA 2K5WA 2XIWA 1SYEA 5JEAG 4K8IA 5J3BA 2K28A 3HOZH 5JAVA 5G3LD 1S5BD 3A0JA 2RDGA 1A62A 2WP8J 1WTOA 1XMQQ 5AJ3Q 1HTPA 4FO2A 1DJRD 1KRTA 5IP7G 3DWQA 3N6RA 3AMUA 1J8IA 5FKAC 1YNNC 3GTPH 4YY3L 3A7LA 3GTQB 1JJCB 2D9UA 3PUWA 2N55A 4IJHA 2F0LA 1UE6A 1P16A 3I2ZA 4H13C 1E1TA 5CYUA 3U4VA 2DY8A 3R2TA 3PF5A 3Q22A 1MI2A 1HZBA 2Y0SE 4HTHA 1A3UA 1ONLA 1VF7A 2F0FA 2IJ0A 1II3A 4B3MQ 2IPKD 3HKZE 3M3YH 3G48A 2B2TC 3QWNA 1RIPA 4HMIA 1SXTA 5KYIA 4TQUS 1LTTD 1SFOB 5ISRA 3CPWA 4K5VA 2E2JH 4KD4A 3U9SA 5C3EH 5KNCA 4HJ7A 4PZ7A 4GKJL 3RZDH 5C4XG 1HUMA 3OIQA 4LFAQ 1G51A 3K7AB 4PZ8A 4CHTB 1LT4D 5M3MB 3MAQA 4A3BH 1DOMA 1SE8A 3MXNA 3TQYA 3CHBD 2WV6D 1BVSA 3V05A 4C3IB 1NNXA 4OX9Q 5EPLA 4ZUIA 5ELEA 2FHTA 5IODA 3UDFA 3LGJA 5IWAQ 4M8AA 3HOUH 3CCMA 1B2TA 2K52A 4XT1B 4UHVA 2AQ2B 3H3VI 3RN5A 3BDCA 4LAAA 1M4VA 1SNPA 1FVIA 1GM5A 4P74A 1SE2A 2EDGA 3S17H 4GS3A 2KCCA 4F88A 1ENAA 1SLJA 2E2HH 4NXML 2QW7A 2CFMA 2R61A 1EY9A 5FLXE 1CZWA 4YY3Q 4B9WA 4ZLTF 3W2DA 3F2CA 4DV7L 1TWAB 1ZEQX 4Q5VA 4X65L 3GV6A 4GOPB 2E5LL 2KJXA 1XYIA 3A5ZB 1VQCA 4HIKA 4OO1I 1LT3D 4DR1L 1P8LA 4BY7B 5C4HA 1GUSA 5DM63 4AH6A 1A3TA 4JI6L 1YEZA 2DJFC 3OWFA 1GD7A 1HPCA 2PYKA 3D4WA 1SMYC 3CC7A 4GKJQ 2JN4A 1B8AA 2EYOA 2D62A 5DNFA 4FXKC 3QJYA 2WAQB 2WIIB 1VCIA 4IO9A 1EL0A 5EBDA 2Z0SA 5IYCH 2KBNA 1O7LA 1HNXL 4G4KA 1FNWA 3K8AA 3SK5A 1LTGD 4RH6A 1ZYRD 1HZ9A 2J0TD 4FXDA 1HNWL 3CQZB 4CJ2C 4KN7C 4Y52H 2VXWA 1YBYA 3GO5A 4P73A 4I65A 5BN4A 3MEFA 2TSSA 1PTOH 1VQFA 1X6OA 1NMFA 1SYBA 4WRDA 1RTNA 3HOVG 3L9AX 2K33A 1TWHB 2NWGA 5C44B 2K5VA 4KD3A 4NXMQ 1JWMD 1S5ED 5CGKA 2Q8RE 3WDNA 3CCSA 4FDBA 4XIGS 5DLQE 4GLXA 3TP7A 4DV7Q 3J81j 4A3DG 3U9OA 2MUYA 4R4TA 4X65Q 2I0QA 3I4MG 1VQOA 2PI2E 2L9HA 1WTVA 2E5LQ 1CKMA 3X3NA 3D4RA 4XYQA 4BBRG 4QCLA 2HIXA 1EFID 4A3GG 5L37A 4DR1Q 4I7ZC 4GOPA 1MD2D 3NXWA 1OO9B 1TS5A 2R7DA 4EX5A 1KRSA 2JJQA 3ZYYX 4JI6Q 4JW0A 3KF6A 4GKKL 4G7ZC 3GTJB 3KLRA 5IGDA 5IGEA 4DV4Q 4H44C 2C9OA 1R9TB 3NSWA 1BDOA 1GUTA 4A3IG 4QQBX 1I4PA 1QNUA 4JI4L 1I6HH 4LF6L 2BE5D 2OCEA 1TXYA 1HNXQ 3OIPA 1HFGA 2IW3A 4IUNA 1HNWQ 3NEMA 4QUFA 3I7FA 1H95A 2YU9B 1AEXA 4V190 3HS0C 3EJIA 1V9PA 2YTYA 1SYDA 4JCVE 1T5EA 4A4IA 4DV0L 3RN2A 3MA2B 2HUGA 4L6TB 3H09A 3GP7A 2PMZB 1L0YB 1J6QA 2M9VA 3N52A 2ASBA 2LSSA 3K57A 3GV3A 3PIP3 1XPUA 2GA4B 2MGSA 3I73A 5IY0A 4BXXH 3FPUB 4YCWA 3ERSX 3QG1A 1EUJA 2QDBA 5M9OA 3PIOA 1HHVA 4DAYA 5AFWA 1E2VA 1EFWA 5ELBA 3GTLB 3GTKB 1WI5A 4OONA 4HJ5A 4RHRA 2VUMH 5IT9c 2M00A 4KI0A 2OXPA 1I5FA 4CKCA 1SYGA 1ET6A 4G7HC 4JI8L 1SNCA 1UUPA 4GKKQ 4DK0A 1K8GA 1GJXA
chains in the Genus database with same CATH topology
3JAME 4A3JB 1UNSA 1C4QA 3A8KE 4UAIA 2G9DA 1V1PA 5BN3A 4CJ0B 1U9RA 3UI2A 3M85A 3VYRA 3NUCA 3J81L 2B2YA 3TP6A 3HGBA 4RWSC 4S3SA 1F9PA 1F2YA 1TT2A 1TIID 1JORA 1OXUA 3L7ZC 4HSPA 4X3SA 2DNCA 1E2ZA 2F0PA 5CV5A 4Y7NB 3VYSA 4CKEA 4LJZC 3Q0AA 3DMUA 4K6LA 5KNBA 1O7YA 4C3HG 3Q23A 3NBIA 1RCVD 3K5NA 2NTSA 2NVXB 1PFMA 2JA5B 1GUGA 3QIAA 1FNUA 2MHVA 1I4RA 3FMCA 4G7OC 2QF7A 3I8ZA 4DK1A 3NHHA 2R92B 2D5DA 4K14A 2A69C 4HCEA 3K6OA 1Z47A 2B2UA 3IFDA 2YYZA 4DNRB 1O7ZA 4RCNA 4F87A 3Q6SA 1E2WA 2K5DA 4L8JA 1U4LA 1B1ZA 1Z6HA 2EYJA 2IX1A 2QEJC 4K5XA 1RODA 2PCFB 1HXYD 1QWYA 2A6HD 2MP1A 2B8GA 1JOQA 2A73B 2EJGC 4TRDA 1R4PB 1I4XA 2L0CA 1Y8NB 5CR3A 1CQVA 1TKWB 5IOCA 3MHBA 2NZ1D 4IZ8A 3BDLA 4JK1C 2XWJB 2AUKA 1JWUD 1F77A 1PFNA 1LTAD 1STYA 1QE6A 4WORA 1DYQA 2KECA 4RGNA 3K5LA 3NQIA 2SDFA 1CT1D 4IN3A 1BF4A 5CBAE 1U4RA 1TS2A 3GQBA 3NBHA 3GTOB 3QOLA 4K2LA 2OEOA 1WTPA 1WD0A 1DOLA 1MSGA 5I6WA 2F0VA 1SE4A 5CV7A 5KIXA 5C5MA 4RGMA 1B44D 1PRTC 1EWHA 2MJ8A 3MVVA 1OXTA 3VA7A 2F0EA 1RDPD 1I4HA 2XWBB 4EQOA 2HQEA 1HQRD 1F2ZA 1D1IA 1AFPA 5C4XB 1PMRA 3CRLC 2QCPX 3TSSA 2K04A 2NN6G 4G57A 1EZ6A 2NVTB 5EQ0A 2ICEC 1X32A 3A8JE 2B2WA 1G2SA 4KY5A 2M2LA 3KUPA 2A74C 2PZUA 2OT2A 3T13A 4DGZA 3IFTA 5J1ZA 3NTIA 2Z4IA 2R6GA 1ENFA 2EPBA 2B39A 2F0TA 3WOFA 3VR5A 3CKIB 4KY6A 1STGA 4FP5D 5LL6X 3S2DB 3OW7A 1EYAA 1BCPD 1EIGA 1QOHA 3SK6A 3MEHA 1GHJA 3TZDA 4HR7B 2RSNA 4NW2A 1FNVA 1Q1EA 4OO1H 4XXEA 1A15A 2NYZD 4RKLA 4FXGC 1EQTA 2F0JA 1STHA 2X69A 1FGBD 4A3EB 1EQVA 1YNND 1G2TA 5T1IA 1BR9A 2FMCA 5LL6S 1B3AA 2PZTA 5JVG3 3HOVB 2FFKB 1Q12A 1DD2A 3P7JA 1BCPC 4B9XA 4DAPA 1TS3A 3NE5B 3SXHA 3DM1A 1VDZA 2B2UC 5IGBA 4A3DB 4OIJA 5EPJA 3I4MB 2EY6A 2H4OA 1LABA 4ZK9B 3PUVA 1ESRA 1F9SA 1HTLD 1TU2B 1SJED 3RUZA 4A3GB 3NK9A 1MGSA 3S1MB 4YIJA 1UEAB 3C2PA 3DXJC 3S15B 4A3IB 1JC7A 1RF2D 1R4QB 1XXGA 2F0KA 1E0BA 3M7NA 5I9PA 4IUPA 1G6ZA 1IKMA 4PMWA 1GUOA 3T56B 3IL8A 3E5SA 4P2CB 2EZVA 4F7XA 3VA5A 3E0JA 1K8OA 2XSCA 1EU4A 2F0MA 2ZT9C 3OSOA 4C56C 1JOKA 3RZOB 1SMYD 4TKOB 1NAPA 1O80A 5I2XA 5I4DA 2SEBD 4NP5A 5C4ZA 3MTSA 1Y1VB 3M4OB 1V8QA 1CM9A 3LNNA 4K2KA 1BOSA 5I2YA 4Q0FA 1EY8A 5D14A 1CHPD 1A6XA 2NB0A 4X3KA 4A3KB 1ET9A 2VB3X 2K32A 2EYPA 1EYDA 3TDQA 3KF8A 3ERQA 1LTRD 4IUVA 2JA6B 2B2WC 5F2DA 1SBBB 1NUCA 4XQQA 2F0IA 5JPMC 3HZXA 4LMQD 3D3RA 3J81E 2NVYB 1H9KA 4XT3B 4IFDI 4XQNA 4EVOA 4C3HB 5KNDA 2D2CC 2WB1B 3I4LA 5TSSA 5C0XI 1WVLA 1IHZA 4EGVA 3I72A 5I6YA 5FOBB 5G3LF 1PTOD 1NR2A 1G291 2RVLA 1D5MC 3CU7A 4XQJA 5KGUA 4KHVA 4RGOS 3AU7A 4NDXA 3P1HA 2RBMA 3VYUA 3BYYB 1KABA 1Z7TA 3PO2B 1WTQA 5A2QL 1D2BA 1V1PB 2KCNA 3S1RB 1AN8A 1EY4A 3S9WA 2EY2A 2F1MA 2BCOA 4K6DA 2J4XA 3TBIB 4BS9A 1PTOC 1I50B 4V0BA 3Q24A 4KV6A 2LY7A 3FRPB 3A7AB 1EOTA 4C1NK 1TWCB 4KJNA 4FYDA 1STBA 1MBYA 4HN7A 3C3LA 3WOEA 3T4AC 2IX0A 5IT9L 4MN3A 1L0XB 5E1FA 4H7BA 1W6JA 4ZAIA 1JQYD 4HEDA 2A6EC 2X6LA 4ULLA 1BCPB 1K83B 3R3OA 4A3MB 4K8JA 1F9RA 3NPPA 3IAYA 1J9OA 2R93B 1EIHA 1LT5D 1HA5A 3BVGA 3J7AF 2EXZA 4KN4C 4O1NA 3K59A 1STEA 1EZ8A 2JEBI 1I3QB 2WACA 1WCMB 2E75C 1SNDA 3QOJA 3SVMA 3A8IE 2A69D 4X3TA 3MFGA 1PXUA 3BDOA 4E6IA 1NCVA 2EVBA 1PLFA 3SEBA 4ZKCB 2ZXRA 1TWFB 4QUCA 3D4DA 3MXPA 4BWGB 3J80E 3IKJA 3V96A 3D8GA 1FD7D 1T5XD 4DXFA 4R9WA 3GTGB 3TP8A 3K5MA 2F0DA 3ONAB 4KKUA 1S5CD 4ABNA 1DXMA 1QNKA 5JOBA 5E3FA 3HOZB 5ELDA 3KLSA 1PYWD 3GTPB 4H0LC 5I9OA 3DEPA 1UAPA 2CQAA 3H6MA 1TQOA 4KMUC 4IUTA 3P75A 3G6JB 1JR0D 1PZJD 2K7VA 4ODGA 1SSOA 1AZPA 3M3YB 1KLGD 1IW7C 4ID6A 3PUYA 3RZDB 4R8NA 1PRTD 1XTCD 4O42A 1QG7A 3SDZA 1HA6A 1H9JA 1V43A 3R93A 1EYCA 4C3JG 1ILPA 2XVSA 3HG9A 1A3VA 2H1EA 3MWYW 3ITPA 1WTXA 2L12A 1TVXA 2HCCA 2KOLA 2K05A 3K0YA 3URYA 3GD7A 4BA2I 4QF4A 1B9MA 4HAEA 2QILA 5EKIA 3S17B 5D65A 2QKIC 5HURA 1JOOA 4BBSB 3VR6A 1KTKA 1DONA 3P20A 2LFNA 1GHKA 3JAML 1SNQA 3MZ5A 4FVMA 3EROA 1D1KA 1GXDC 2NUCA 2ZXPA 3DUZA 3PV0A 1U4MA 2AWNA 4FF4A 4FF2A 5CV9A 4CBVA 1SNOA 4ZUJA 1BBXC 1KDBA 4OO1G 1EY7A 3A55A 1QB5D 1QCBD 2TMPA 5JPNC 1OXVA 1PTOB 3KBXA 1JCKB 1WTWA 2KQ3A 3DWPA 1RKNA 4IUUA 2KUMA 5E4WC 1BNZA 4C1NI 4C2MB 4IFDJ 1A2TA 3AB9A 2F3VA 1YNJC 3R2IA 2PW7A 5C0XJ 5EGTA 5DM73 4DFAA 4JBWA 4XYOA 5M5WB 5K36H 4RKBA 1PRTF 4ZQ3A 4KKSA 1HRJA 1SJHD 2IWHA 2F0OA 3L3OC 1I6HB 2ICIA 2EY1A 2B2VA 2ENBA 2E74C 4IQZA 1EEFD 4HCSA 1F2LA 4CGYB 4PNYA 2MPMA 2NTTA 2BDNA 5KRUA 1A2UA 1Y8OB 3VR3A 3RD4A 4GZYC 3BS1A 2B63B 3H3VC 2EOTA 1S4ZA 2XNAC 1C48A 2K1BA 4IFDH 1W6KA 1IKLA 1CI3M 3OHXC 5C0XH 3M7GA 3T53B 5CV8A 3QO2A 4BBRB 4PV1C 1CFMA 3ND8A 2VNUD 2RDHA 3BG3A 1GUWA 3TN2A 3V2TA 3SK4A 1NSNS 3E6ZX 2BA1A 2A68C 1TR5A 4MHEA 1WD1A 4KY7A 1SE3A 2DY7A 2XRSD 2PPBC 3A54A 2Q8TA 1BQQT 2L5TA 5JEAJ 1CZGA 2NVQB 2IX3A 2EYMA 2F0HA 1KNEA 3GTMB 2PO4A 5C5LA 5A2QE 4OHJA 2JP1A 3HEJA 4J6HA 4B08A 1TS4A 2Z8LA 1VMCA 2RA4A 1PZKD 1AZQA 5K5PA 2EYHA 1ZKOA 3OMCA 2B8FA 4BY1B 3O13A 4DU9A 4U673 2BDOA 2PW5A 2KEDA 5M5YB 5M3FB 2A5HA 3NWSA 1BCPF 3I91A 1KLUD 4A93B 3FEWX 1HQMC 2E2IB 1B53A 2RQXA 3NQTA 4F8MA 1I4QA 1Q90A 1JB3A 3OPOA 5IT9E 1WTRA 5JEAH 2FINB 3PO3B 5EJWA 2PQEA 3LWUA 1IYVA 2JA7B 1EY0A 3H94A 1FYCA 2CW0D 1PRTB 4RFBA 5BN5A 3VYTA 1Q3LA 4IURA 1Q1BA 2V4DA 1MSHA 2F0WA 2NN6I 4L63B 1LACA 1EY5A 2IL8A 1K8MA 2N88A 3NTHA 1LTSD 2E76C 4RA8A 1RHPA 2WKDA 4PQXA 2IT1A 2RSOA 5LHY1 2LKVA 5NUCA 1DOKA 5ELCA 2XRQD 2Z4HA 2CW0C 4R8IA 2WINB 1U4PA 4FF1A 3F2UA 1HFNA 2F3WA 5CV6A 1CK1A 2X6GA 2B2VC 1LV9A 1D5XC 2RKSA 4RCOA 5CORA 3T51B 2EYLA 1QILA 3RLFA 3MC0B 4LK1C 2C5CA 1D5ZC 4U68A 5KEEA 1CQFA 2A6ED 3I3CA 2EJFC 5CV4A 1LTBD 2KEEA 2FMMA 1HUNA 1KAAA 1ZYRC 5E4XA 2L4NA 3OMGA 4C3JB 3HRZC 5JVH3 2WKCA 4CJ1B 4X3UA 1STNA 2L55A 2PZWA 4DNTB 1B50A 4DF7A 1BO0A 2L1BA 1JWSD 3W3AA 4K5WA 3S14B 4AYBB 2F4IA 1H9RA 3TP5A 2O5JC 1DM0B 2XN9C 4WJWA 3I70A 3D6WA 1QJOA 3FPPA 1VF5C 5COYA 3S1QB 3FKIB 3OWEB 1X3PA 4C3IG 5FLXL 3MFYA 2AWOA 4PMCA 1GUNA 1M8AA 1IL8A 2BOSA 1NR4A 2EJMA 4QIWB 1STAA 1CHQD 4RAUC 2BE5C 2JA8B 2J7ZA 4EQNA 5M5XB 1ML0D 3HOXB 2ZXOA 1XX8A 1KNAA 2I07B 1DCZA 1ZXTA 4ZYSA 2K5QA 4J8QA 5DEHA 2EYFA 1EEID 2PNRC 3VR4A 2O5IC 3PMFA 5J39A 1LT6D 1O78A 4QMGA 4DA2A 1PTOF 4EQPA 2NBFA 1SYFA 5IIFA 2CHBD 3J7YW 4WFN3 5D3IB 4OGQC 3TZUA 4J1MA 5HGTA 1RTOA 3I90A 3BYTB 1IW7D 2G9HD 2Z1CA 3KBGA 5T1GA 1LO5D 1TY2A 4HSVA 4KK7A 5C4JB 3BZDB 5J22A 1S5FD 3C46A 3M4YA 1KDAA 3SHLA 1CA5A 2E2DC 3PUZA 1OXXK 5FK9C 2HDLA 2JYOA 2JEAI 1ILQA 1H9SB 1ICWA 1F9QA 2OF1A 1SNMA 3MXUA 1HCZA 2LMCB 4KJOA 2SNSA 4NKLA 2DNEA 1PZID 1JICA 2F0GA 3J7AV 3R8BA 1G8ZD 1TY0A 2E2JB 1KDCA 5C3EB 4A3BB 5ELFA 3MXGA 2R7ZB 1H9MA 2JE6I 2KHSA 3PUXA 2K6AA 3NWTA 4RHSA 1SEBD 2SOBA 3S1NB 2F0UA 3FDTA 3HOWB 1ENCA 2EY5A 2Q8IB 5D3DA 3EQLC 3HOUB 1TWGB 4ME5A 1RD9D 2I46A 2ID0A 1I6VC 3K5OA 4KTAA 4DN4M 3C1EA 3QB3A 3LX0A 4PMBA 4FF3A 2B2TA 3C1FA 1CA6A 2E2HB 4N9PA 1GOZA 5EKKA 3RMHA 2O4XA 5A35A 3X3MA 3ND9A 1FR3A 4IUQA 5IGCA 4OIKA 4QB4A 1Y8PB 2KVMA 3A56A 2A6HC 5EBCA 5C3WA 4NMZA 1H9SA 5K36G 5DAUA 1Y69U 2AQ1B 1C8CA 1YNJD 1B4OA 2EE1A 5C3XA 5JJZA 5IGGA 1SDFA 3NP8A 2FJ2A 2RDFA 3T16A 4XDXA 2DN8A 2O2LD 2CVRA 1LTID 3TMEA 3CRKC 1EY6A 1RJTA 5EPKA 1EWCA 3KLSX 2R3ZA 1V1OA 5FO9B 3S2HB 1X3QA 5KYLA 3SE0A 3H91A 3J80L 3BVMA 2Y0SB 4FNFA 5FO7B 5IGFA 3HKZB 3DEOA 4IALA 1DZ1A 3S16B 4IFDG 2LS01 1SAPA 4MIUA 5C0XG 1SYCA 3EFXD 3HP3A 4ZKBB 1CTMA 2F0QA 5FO8B 4CKBA 2BA0A 3OOCA 2F0SA 2HCIA 3BVZA 2SNMA 4HMJA 4RGTA 4BA1I 3SR1A 2B2YC 5C6AA 1S5DD 3EVQA 1VMPA 3D6CA 4ZRZA 5CMDA 4KKTA 3PIO3 2F0NA 2JSOA 3EA6A 3FVQA 2HDMA 4XTCS 1AP0A 2A68D 3HOYB 1ESFA 3VR2A 3G7LA 4DXGA 1JE4A 2L11A 5EKLA 4Z9CB 2NN6H 4ILWA 3KK7A 5CBEE 4N9TA 4OL7A 1G91A 1Y1WB 4M1UB 4KHZA 1LLRD 2K01A 1BUVT 1AW7A 4UDUC 5CC4A 2K03A 2VB2X 4A3FB 3D31A 4DAVA 3NTKA 1Q8IA 4TSSA 3K58A 1OXSC 1PDQA 2VUMB 2F03A 3DWAA 1EU3A 1XWEA 3LWEA 1IYUA 1PFBA 2AUJD 1D6EC 2AQ3B 1B9NA 1I4GA 2KA7A 1F2MA 2JXMB 3DHQA 3H0GB 3SK8A 3I4NB 1BXTA 2K5WA 2XIWA 1SYEA 5JEAG 4K8IA 2K28A 5JAVA 5G3LD 1S5BD 2RDGA 2WP8J 1WTOA 1HTPA 4FO2A 1DJRD 3DWQA 3N6RA 3AMUA 1J8IA 5FKAC 1YNNC 3A7LA 3GTQB 2D9UA 3PUWA 2N55A 2F0LA 4H13C 5CYUA 2DY8A 3R2TA 3Q22A 1MI2A 4HTHA 1A3UA 1ONLA 1VF7A 2F0FA 2IJ0A 1II3A 2IPKD 2B2TC 3QWNA 4HMIA 1SXTA 5KYIA 4TQUS 1LTTD 1SFOB 5ISRA 4K5VA 4KD4A 3U9SA 5KNCA 1HUMA 3OIQA 5M3MB 3K7AB 4CHTB 1LT4D 3MAQA 1DOMA 3MXNA 3CHBD 2WV6D 3V05A 4C3IB 5EPLA 4ZUIA 5ELEA 2FHTA 5IODA 4M8AA 1B2TA 4XT1B 2AQ2B 3BDCA 4LAAA 1M4VA 1SNPA 1SE2A 2EDGA 4F88A 2KCCA 1ENAA 2R61A 1EY9A 5FLXE 1CZWA 4B9WA 4ZLTF 3W2DA 1TWAB 1ZEQX 4Q5VA 3GV6A 2KJXA 1XYIA 4OO1I 1LT3D 4BY7B 5C4HA 1GUSA 5DM63 1A3TA 3OWFA 1HPCA 2PYKA 3D4WA 1SMYC 2EYOA 2D62A 5DNFA 4FXKC 3QJYA 2WAQB 2WIIB 1VCIA 1EL0A 5EBDA 1O7LA 4G4KA 1FNWA 3SK5A 1LTGD 4RH6A 1ZYRD 2J0TD 4FXDA 3CQZB 4CJ2C 4KN7C 2VXWA 3GO5A 4I65A 5BN4A 2TSSA 1PTOH 1SYBA 4WRDA 1RTNA 3L9AX 2K33A 1TWHB 2NWGA 5C44B 4KD3A 1JWMD 1S5ED 5CGKA 2Q8RE 3WDNA 4XIGS 3TP7A 3U9OA 2MUYA 1WTVA 2L9HA 3X3NA 3D4RA 4XYQA 4QCLA 1EFID 4I7ZC 1MD2D 3NXWA 1OO9B 1TS5A 3ZYYX 4G7ZC 3GTJB 3KLRA 5IGDA 5IGEA 4H44C 2C9OA 1R9TB 3NSWA 1BDOA 1GUTA 1I4PA 1QNUA 2BE5D 3OIPA 1HFGA 2IW3A 4IUNA 4QUFA 2YU9B 1AEXA 4V190 3HS0C 3EJIA 1SYDA 1T5EA 3MA2B 2HUGA 4L6TB 3H09A 3GP7A 2PMZB 1L0YB 2M9VA 3N52A 3K57A 3GV3A 3PIP3 2GA4B 2MGSA 3I73A 3FPUB 3QG1A 5M9OA 2QDBA 1HHVA 4DAYA 5AFWA 1E2VA 5ELBA 3GTLB 3GTKB 4RHRA 2M00A 4KI0A 2OXPA 4CKCA 1SYGA 1ET6A 4G7HC 1SNCA 1UUPA 4DK0A 1GJXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EA6 A;  1PYW D;  1I4Q A;  1SBB B;  3BYT B;  2G9H D;  1UNS A;  1CQV A;  1LT4 D;  1V1P A;  1JWM D;  1ESF A;  1S5E D;  3CHB D;  2WV6 D;  3V05 A;  1ENF A;  1RF2 D;  1L0X B;  1LO5 D;  1JWU D;  1TY2 A;  1JR0 D;  1F77 A;  4DXG A;  1JQY D;  1XXG A;  1PZJ D;  1LTA D;  2AQ1 B;  5ELE A;  1JWS D;  3BZD B;  4Z9C B;  1DYQ A;  1S5F D;  1BCP B;  2RDH A;  5TSS A;  1KLG D;  1PRT B;  1PTO B;  4RFB A;  4RGN A;  1JCK B;  1EFI D;  1LLR D;  1CT1 D;  3DWP A;  2AQ2 B;  2XN9 C;  1MD2 D;  2O2L D;  1TS5 A;  1AW7 A;  4UDU C;  1SE3 A;  1BCP D;  1LTI D;  1LT5 D;  1PRT D;  1M4V A;  1PTO D;  1TS2 A;  1XTC D;  2XRS D;  5FK9 C;  4L63 B;  1EWC A;  3KLS X;  1SE2 A;  1D5M C;  1HA5 A;  3BVG A;  1V1O A;  4TSS A;  4O1N A;  3R2I A;  1STE A;  1I4P A;  2R61 A;  3DWA A;  1LTS D;  1EU4 A;  4RGO S;  3OWE B;  1EU3 A;  1FNV A;  1SE4 A;  1PZI D;  4K6L A;  3W2D A;  3BYY B;  4C56 C;  4RGM A;  1B44 D;  1PRT C;  3R8B A;  3URY A;  3BVM A;  4OHJ A;  1D6E C;  1RCV D;  1G8Z D;  1TY0 A;  3MFG A;  5I4D A;  2NTS A;  1FGB D;  2SEB D;  2AQ3 B;  1I4G A;  1V1P B;  1LT3 D;  1TS4 A;  1RDP D;  3SEB A;  1FNU A;  2Z8L A;  5ELF A;  1I4R A;  1PRT F;  1I4H A;  2QIL A;  5ELC A;  1CHQ D;  2XRQ D;  4RHS A;  1BXT A;  1SEB D;  1AN8 A;  1SJH D;  4L6T B;  3GP7 A;  1HQR D;  1PZK D;  2ICI A;  1L0Y B;  3EFX D;  4BWG B;  1S5B D;  2RDG A;  2J4X A;  1KTK A;  1DJR D;  5D3D A;  4ZYS A;  1BCP C;  1EEI D;  3O13 A;  1CK1 A;  3TSS A;  1PTO C;  1CHP D;  1RD9 D;  1TS3 A;  3DWQ A;  5FKA C;  1FD7 D;  1T5X D;  1EEF D;  4DXF A;  1LT6 D;  1D5X C;  4RCO A;  1B1Z A;  1ET9 A;  1FNW A;  1LTG D;  1QIL A;  3BVZ A;  2QEJ C;  2NTT A;  3MC0 B;  4RH6 A;  1BCP F;  5ELB A;  1PTO F;  1KLU D;  1HXY D;  1S5C D;  3R2T A;  4RGT A;  2CHB D;  4RHR A;  1HTL D;  1D5Z C;  1SJE D;  5D3I B;  1S5D D;  1GOZ A;  1ET6 A;  1LTR D;  2IJ0 A;  2IPK D;  2TSS A;  1PTO H;  1I4X A;  1UUP A;  5ELD A;  1LTB D;  1SXT A;  2XNA C;  1LTT D; 
#chains in the Genus database with same CATH topology
 3JAM E;  1MKH A;  4A3J B;  3CC2 A;  3ZJY C;  1L1O B;  1UNS A;  1C4Q A;  3A8K E;  4UAI A;  2G9D A;  1V1P A;  2RCN A;  5BN3 A;  4LF9 L;  4CJ0 B;  1U9R A;  3UI2 A;  4JI4 Q;  4LF6 Q;  3M85 A;  3H0G H;  3VYR A;  3NUC A;  3I4N H;  3J81 L;  2B2Y A;  2CH4 W;  2KCT A;  3HGB A;  3TP6 A;  4A3K G;  4RWS C;  4AQY Q;  2WAQ E;  4DV1 L;  2NVQ H;  2VS1 A;  4S3S A;  3DLL A;  4MZ9 A;  3GTM H;  1S72 A;  2JA7 G;  1F9P A;  1F2Y A;  3QR8 A;  1YIJ A;  3BJU A;  2JA6 G;  1TT2 A;  4DV0 Q;  1TII D;  4L5S A;  1CKO A;  1OXU A;  3L7Z C;  4HSP A;  2DNC A;  4X3S A;  1JOR A;  1S40 A;  1E2Z A;  2F0P A;  5CV5 A;  4Y7N B;  3CMA A;  1A63 A;  3VYS A;  4CKE A;  4DR5 L;  4LJZ C;  3Q0A A;  3DMU A;  3KJO A;  4K6L A;  1K73 C;  5KNB A;  4WJ3 M;  1O7Y A;  4BY1 H;  4C3H G;  3Q23 A;  1PA6 A;  3NBI A;  1RCV D;  2WB1 G;  3K5N A;  4HJA A;  2NTS A;  4NXN L;  2NVX B;  5M3F H;  1PFM A;  2JA5 B;  1GUG A;  3QIA A;  1YHQ A;  1FNU A;  1JT8 A;  2MHV A;  1I4R A;  3G6E A;  3FMC A;  4JI8 Q;  4A93 H;  4G7O C;  2QF7 A;  3NEN A;  3I8Z A;  4DK1 A;  3NHH A;  2R92 B;  2D5D A;  4K14 A;  2A69 C;  4HCE A;  3K6O A;  4YHH L;  1Z47 A;  4DV6 L;  2B2U A;  4LF9 Q;  3KOJ A;  3IFD A;  2OQ0 A;  2YYZ A;  4DNR B;  1O7Z A;  4RCN A;  4F87 A;  3Q6S A;  5GAD C;  1E2W A;  2K5D A;  4L8J A;  4YWL A;  1U4L A;  2OTL A;  1B1Z A;  1Z6H A;  4DV1 Q;  1YHA A;  2EYJ A;  1PH4 A;  2IX1 A;  2QEJ C;  1K28 A;  3PO2 G;  4K5X A;  5JJL A;  1ROD A;  2PCF B;  1HXY D;  4AYB E;  1MJC A;  3PO3 H;  5IYD G;  1QWY A;  2A6H D;  1ASY A;  2MP1 A;  2B8G A;  1JOQ A;  2A73 B;  2EJG C;  4TRD A;  1R4P B;  1I4X A;  2L0C A;  4JVZ A;  1Y8N B;  5CR3 A;  3CCR A;  1CQV A;  1TKW B;  5IOC A;  1VQD A;  2AMC B;  2PMZ E;  3MHB A;  2NZ1 D;  4IZ8 A;  4BY7 H;  1X3G A;  3BDL A;  4JK1 C;  4DR5 Q;  2XWJ B;  2AUK A;  1JWU D;  1F77 A;  3PSI A;  4UP9 A;  1PFN A;  1LTA D;  4KHP L;  1STY A;  1QE6 A;  4WOR A;  1DYQ A;  2N8N A;  4NXN Q;  2KEC A;  4RGN A;  3K5L A;  3NQI A;  4QIW E;  2SDF A;  1CT1 D;  4IN3 A;  3UDX A;  3TS0 A;  1BF4 A;  5CBA E;  1U4R A;  1TS2 A;  3GQB A;  3NBH A;  3GTO B;  3QOL A;  4K2L A;  2Q2T A;  1D7Q A;  2OEO A;  4YHH Q;  3CCQ A;  1WTP A;  4LF5 L;  1WD0 A;  1DOL A;  1MSG A;  5I6W A;  2F0V A;  1SE4 A;  1X56 A;  2K4K A;  5CV7 A;  5KIX A;  1Q46 A;  5C5M A;  1XMO Q;  4RGM A;  1B44 D;  1PRT C;  3AYH B;  4LF7 L;  1EWH A;  4ALP A;  2MJ8 A;  4POG A;  3H15 A;  3MVV A;  1X55 A;  4A3M G;  4N8F A;  5C44 H;  1OXT A;  3E0E A;  3VA7 A;  2F0E A;  1RDP D;  1I4H A;  2R93 G;  2XWB B;  2ZTE A;  4EQO A;  4HJ8 A;  4MTN A;  4B3S L;  3EN2 A;  1N36 L;  2HQE A;  2RCF A;  1HQR D;  3UDI A;  3CPF A;  1PH5 A;  1F2Z A;  1D1I A;  1AFP A;  5C4X B;  1PMR A;  3CRL C;  1QVG A;  2JA8 G;  3KDF A;  2PQA A;  2QCP X;  3F1Z A;  3TSS A;  4HIO A;  1J5E L;  1WCM G;  2B3G A;  2K04 A;  2NN6 G;  2IHE A;  1XNR L;  1VQE A;  4G57 A;  4C3J H;  2HD3 A;  4KHP Q;  1EZ6 A;  2NVT B;  5EQ0 A;  1R9T H;  2ICE C;  3M9B A;  1X32 A;  3A8J E;  2B2W A;  1G2S A;  4KY5 A;  2M2L A;  3KUP A;  3S14 H;  2A74 C;  1IL2 A;  1VQN A;  2PZU A;  2OT2 A;  3T13 A;  4DGZ A;  3IFT A;  5J1Z A;  3NTI A;  2Z4I A;  1VQ9 A;  2R6G A;  3S24 A;  1PH8 A;  4P72 A;  4LF5 Q;  5LMU L;  1Z9F A;  1ENF A;  3M4P A;  3T1Y L;  4R4O A;  2EPB A;  2B39 A;  3AFQ A;  3S1Q H;  2F0T A;  3WOF A;  4LF7 Q;  5FJ8 H;  3FKI H;  3H3V H;  3VR5 A;  3CKI B;  4EQ5 A;  4KY6 A;  1QUQ A;  1CSQ A;  1VQI A;  3RNU A;  1STG A;  4YCV A;  4FP5 D;  4OEL B;  2GN5 A;  5LL6 X;  3S2D B;  3OW7 A;  3HOZ G;  1EYA A;  1BCP D;  4GN4 B;  4B3S Q;  1EIG A;  1QOH A;  2F52 A;  3SK6 A;  1BKB A;  1N36 Q;  2ZTC A;  3MEH A;  3GTL H;  4GNX C;  1IBM L;  2P5Z X;  1GHJ A;  3TZD A;  3CCE A;  4HR7 B;  1XJV A;  2CWP A;  5M5X H;  2RSN A;  4NW2 A;  4P71 A;  3HOX H;  1FNV A;  1XNR Q;  1Q1E A;  1PYB A;  4OO1 H;  4XXE A;  1A15 A;  2NYZ D;  4RKL A;  4APV A;  4FXG C;  1EQT A;  2F0J A;  1STH A;  2X69 A;  2UUB L;  4L5Q A;  3PIP A;  1FL0 A;  1FGB D;  4A3E B;  1EQV A;  4QGU A;  1YNN D;  4OWX B;  1G2T A;  5C3E G;  1U5K A;  5T1I A;  1BR9 A;  2FMC A;  1SMX A;  4A3B G;  5LL6 S;  1B3A A;  2PZT A;  5JVG 3;  5ELN A;  3Q8D A;  1EWI A;  3HOV B;  2FFK B;  1Q12 A;  1DD2 A;  3P7J A;  1BCP C;  4B9X A;  5LMU Q;  4DAP A;  1TS3 A;  3NE5 B;  3SXH A;  3DM1 A;  3T1Y Q;  1VDZ A;  4LFB L;  2B2U C;  5IGB A;  1GVP A;  4A3D B;  1X9N A;  4OIJ A;  2DGY A;  5EPJ A;  3I4M B;  2EY6 A;  4DPG A;  3KJP A;  2H4O A;  1LAB A;  4ZK9 B;  3PUV A;  4OEM B;  1ESR A;  1F9S A;  1HTL D;  1TU2 B;  1SJE D;  3RUZ A;  1KHI A;  4A3G B;  3NK9 A;  1FJG L;  2MQH A;  2ZJP A;  1MGS A;  3S1M B;  4YIJ A;  1IBM Q;  1NY4 A;  1UEA B;  1M1K C;  3C2P A;  4CDF C;  3F8T A;  2AHO B;  3DXJ C;  4BBS G;  3S15 B;  4A3I B;  4DV5 L;  1JC7 A;  4DR2 L;  1RF2 D;  1R4Q B;  1A0I A;  1XXG A;  2F0K A;  3KF8 B;  1E0B A;  2UUB Q;  3M7N A;  1RL2 A;  4YCU A;  5I9P A;  4IUP A;  1G6Z A;  1IKM A;  4PMW A;  1GUO A;  3T56 B;  3IL8 A;  3E5S A;  4P2C B;  2EZV A;  4F7X A;  3VA5 A;  2R7Z H;  3E0J A;  1K8O A;  5IYC G;  5FLM H;  2HQL A;  2L15 A;  2XSC A;  3S1N H;  1EU4 A;  1HZA A;  2F0M A;  3HOW H;  1JE5 A;  4LFB Q;  2ZT9 C;  3OSO A;  3I55 A;  1PH3 A;  4C56 C;  1JOK A;  1XPR A;  3RZO B;  1SMY D;  4TKO B;  1K3B C;  1NAP A;  1TWG H;  1UEB A;  1O80 A;  1K0R A;  5I2X A;  4DR4 L;  5I4D A;  2SEB D;  4DAM A;  4NP5 A;  5C4Z A;  1FJG Q;  2CQO A;  3MTS A;  1Y1V B;  1N34 L;  3M4O B;  4DR6 L;  4OWW B;  1V8Q A;  1KQS A;  1CM9 A;  3LNN A;  4K2K A;  4JI0 L;  2F4V L;  1BOS A;  1SRU A;  5I2Y A;  4Q0F A;  2DUD A;  4DV5 Q;  2UU9 L;  1KAW A;  1EY8 A;  5D14 A;  2KHI A;  1KXL A;  4DR2 Q;  1CHP D;  1A6X A;  2NB0 A;  4X3K A;  4A3K B;  3CD6 A;  1ET9 A;  3KF6 B;  2VB3 X;  2K32 A;  3GTO H;  2EYP A;  1EYD A;  2BH2 A;  3JC6 6;  3TDQ A;  3CP0 A;  4JG2 A;  3KF8 A;  3ERQ A;  1EIF A;  1LTR D;  4A3L H;  4IUV A;  1PV4 A;  2JK8 A;  2B2W C;  2VY3 A;  2H5X A;  4IPC A;  4JC0 A;  2JA6 B;  5F2D A;  1SBB B;  1NUC A;  4XQQ A;  2HT1 A;  1SN8 A;  2OQK A;  2F0I A;  5GAG C;  5JPM C;  1B70 B;  2CWA A;  3HZX A;  4LMQ D;  2E8G A;  3D3R A;  3J81 E;  2UXC L;  1VS0 A;  2NVY B;  1H9K A;  4XT3 B;  4IFD I;  4XQN A;  4EVO A;  4QL5 A;  1AE3 A;  4C3H B;  5KND A;  1LTL A;  3S2H H;  4JPB W;  3U58 A;  2RHS B;  2NZO A;  4DR4 Q;  2D2C C;  2WB1 B;  3I4L A;  5TSS A;  5C0X I;  1WVL A;  1IHZ A;  4EGV A;  3I72 A;  3RLO A;  5FOB B;  5I6Y A;  5G3L F;  3AEV A;  2B63 G;  1PTO D;  1N34 Q;  2VZA A;  4DAY B;  1NR2 A;  4BXX G;  4UY8 C;  2JQO A;  4DR6 Q;  4DUZ L;  2NVT H;  1XPO A;  1G29 1;  2RVL A;  1E3P A;  3S16 H;  4JI0 Q;  1D5M C;  3CU7 A;  2F4V Q;  4XQJ A;  5KGU A;  3IRB A;  4KHV A;  4K0K L;  1VQH A;  2UU9 Q;  1JJ2 A;  4RGO S;  3AU7 A;  4NDX A;  3P1H A;  2RBM A;  4JI5 L;  2I5M X;  3BYY B;  3VYU A;  2K50 A;  1KAB A;  2YV5 A;  1Z7T A;  3PO2 B;  1WTQ A;  5A2Q L;  1D2B A;  1V1P B;  4NPS A;  2KCN A;  4MNO A;  3S1R B;  1N9W A;  1AN8 A;  1EY4 A;  3S9W A;  2EY2 A;  3H0G G;  2F1M A;  2BCO A;  4K6D A;  2J4X A;  3TBI B;  2UXC Q;  3S2D H;  4BS9 A;  1PTO C;  1I50 B;  4V0B A;  3Q24 A;  4KV6 A;  4GNX B;  5H1S E;  1VQ5 A;  3HOY H;  2LY7 A;  3FRP B;  2QA4 A;  3A7A B;  1EOT A;  4C1N K;  1TWC B;  4KJN A;  1C9O A;  4CDD C;  4DUY L;  4FYD A;  1STB A;  1MBY A;  1YJ9 A;  4HN7 A;  3C3L A;  2OWO A;  3WOE A;  2LXJ A;  3T4A C;  4DUZ Q;  1Y1W H;  2IX0 A;  2Q2H A;  3I56 A;  4A3E H;  5GAH C;  4K0K Q;  4BY1 G;  4A3F H;  5IT9 L;  4MN3 A;  3A5U A;  1L0X B;  3AQQ A;  5E1F A;  4JI5 Q;  4H7B A;  1W6J A;  4ZAI A;  4IPD A;  5M3F G;  1JQY D;  4HED A;  2A6E C;  4QJF A;  2X6L A;  4ULL A;  1WJJ A;  3W5O A;  1V1Q A;  1BCP B;  1K83 B;  4LWC A;  3R3O A;  4JI2 L;  4A3M B;  4K8J A;  4A93 G;  1F9R A;  3NPP A;  3IAY A;  2MO0 A;  1ASZ A;  1IBL L;  1J9O A;  2R93 B;  5FLX c;  1EIH A;  1LT5 D;  1VQ4 A;  4A3D H;  2QDL A;  3U4Z A;  4H02 A;  1HA5 A;  3BVG A;  3J7A F;  2EXZ A;  4KN4 C;  4O1N A;  3K59 A;  1STE A;  1EZ8 A;  2JEB I;  1M90 C;  4JV5 L;  1I3Q B;  2WAC A;  1WCM B;  2E75 C;  3PO3 G;  1SND A;  3CCL A;  3QOJ A;  1NTG A;  3SVM A;  3A8I E;  2A69 D;  4X3T A;  3MFG A;  1PXU A;  3BDO A;  4DUY Q;  4E6I A;  4GNX A;  3GTQ H;  4A3I H;  1NCV A;  2EVB A;  1PLF A;  5LMN W;  3SEB A;  4ZKC B;  2ZXR A;  1TWF B;  4QUC A;  4ME3 A;  3D4D A;  3MXP A;  4BWG B;  3J80 E;  2UXB L;  4X66 L;  5BR8 L;  1SFO H;  1X3F A;  3IKJ A;  3V96 A;  1YHB A;  3D8G A;  3BZC A;  1FD7 D;  1T5X D;  4DXF A;  4R9W A;  1YZ6 A;  3GTG B;  3STB D;  1EOV A;  1ICF B;  3K7A H;  3TEH B;  3TP8 A;  5M3M H;  3K5M A;  5JJI A;  3NBH B;  1X3E A;  2F0D A;  3ONA B;  4KKU A;  1EQR A;  4TVA B;  4JI2 Q;  4C3I H;  3BZK A;  1PH7 A;  1S5C D;  4ABN A;  1DXM A;  1QNK A;  5JOB A;  5E3F A;  1IBL Q;  3G4S A;  3HOZ B;  2ES2 A;  2CKZ B;  5ELD A;  1FGU A;  3KLS A;  1KD1 C;  1PYW D;  2VQF L;  3GTP B;  4H0L C;  5I9O A;  3WWV A;  3DEP A;  4JBJ A;  1UAP A;  2CQA A;  3H6M A;  4JV5 Q;  2RF4 A;  2N49 A;  1TQO A;  4KMU C;  4IUT A;  3P75 A;  1Y1V H;  3G6J B;  1JR0 D;  3M4O H;  4GN5 A;  1PZJ D;  2K7V A;  4ODG A;  1SSO A;  2QGQ A;  1AZP A;  3M3Y B;  1KLG D;  3FP9 A;  2XGT A;  1PH2 A;  1IW7 C;  1TWA H;  3KDF B;  2PQA B;  4ID6 A;  1BBU A;  3W1G A;  3PUY A;  3STB C;  1NBW A;  3RZD B;  4R8N A;  1PRT D;  1XTC D;  2HHH L;  4LFC L;  4O42 A;  1A8V A;  1QG7 A;  3SDZ A;  3UE0 A;  1HA6 A;  1H9J A;  1EYG A;  1V43 A;  3R93 A;  2UXB Q;  1EYC A;  4C3J G;  5BR8 Q;  4X66 Q;  1ILP A;  2D0P A;  2XVS A;  5LMN L;  3HG9 A;  1A3V A;  2H1E A;  3MWY W;  3ITP A;  5ELO A;  1WTX A;  1YVC A;  2L12 A;  4LF8 L;  1TVX A;  2HCC A;  4HID A;  2JA6 H;  2KOL A;  2K05 A;  3K0Y A;  3PF4 A;  3URY A;  3GD7 A;  4BA2 I;  4QF4 A;  5E7N A;  4AYB G;  1B9M A;  1X54 A;  4HAE A;  2LXK A;  2QIL A;  4IJL A;  5EKI A;  3S17 B;  3CQZ H;  4DV6 Q;  5D65 A;  2QKI C;  5GQO A;  4L5T A;  2VQF Q;  5HUR A;  1QUQ B;  3D0F A;  1JOO A;  4BBS B;  1KTK A;  3VR6 A;  5FJ8 G;  3FKI G;  1DON A;  2K75 A;  3P20 A;  4KLK A;  2LFN A;  1GHK A;  3JAM L;  1SNQ A;  1TWH H;  3MZ5 A;  3RLN A;  2I5H A;  4FVM A;  3ERO A;  1L0W A;  4DKA C;  1D1K A;  1GXD C;  3JAM c;  2NUC A;  2ZXP A;  3DUZ A;  3PV0 A;  3KFU A;  1U4M A;  2AWN A;  5IE8 A;  4FF4 A;  4FF2 A;  2HHH Q;  4LFC Q;  5CV9 A;  4CBV A;  3J7A 5;  1SNO A;  4ZUJ A;  3HOX G;  1BBX C;  1KDB A;  1NE3 A;  1JJG A;  5GAE C;  4OO1 G;  3FHW A;  1EY7 A;  5LMN Q;  1W3S A;  3GTJ H;  1W2B A;  3S1R H;  3A55 A;  1YJW A;  1QB5 D;  1QCB D;  2TMP A;  4LF8 Q;  4L5R C;  2N3S A;  3DM3 A;  5JPN C;  3E9I A;  1OXV A;  1PTO B;  3KBX A;  3W1B A;  4DV2 L;  4J15 A;  1JCK B;  4HJ9 A;  1WTW A;  2KQ3 A;  3DWP A;  1RKN A;  4IUU A;  2KUM A;  5E4W C;  1BNZ A;  4X62 L;  3E3X A;  2YU9 H;  4C1N I;  4C2M B;  4IFD J;  1A2T A;  1VQJ A;  3AB9 A;  2F3V A;  1YNJ C;  4A76 A;  4DR3 L;  3T1H L;  1NMG A;  2CCZ A;  1QVF A;  3R2I A;  2PW7 A;  5C0X J;  2JA9 A;  4RMF A;  1QZG A;  1Q7Y C;  5EGT A;  5DM7 3;  4DFA A;  4JBW A;  3GDE A;  1S3O A;  4XYO A;  5M5W B;  5K36 H;  4RKB A;  1PRT F;  4DK6 C;  4ZQ3 A;  1HR0 L;  4KKS A;  3GTK H;  1HRJ A;  3BU2 A;  1SJH D;  2IWH A;  2F0O A;  3L3O C;  1I6H B;  2ICI A;  1K83 H;  1J5E Q;  2EY1 A;  4CDC C;  3JAM i;  2B2V A;  2ENB A;  2E74 C;  4IQZ A;  2KHJ A;  1EEF D;  4HCS A;  2RHQ B;  1F2L A;  4A3J H;  2EXD A;  4CGY B;  4PNY A;  2MPM A;  2NTT A;  4DV2 Q;  1Q81 C;  2BDN A;  3L2P A;  5KRU A;  5IP9 H;  1A2U A;  1KL9 A;  1Y8O B;  3VR3 A;  2R7Z G;  3RD4 A;  4GZY C;  3BS1 A;  2B63 B;  3H3V C;  2YTX A;  4X62 Q;  5FLM G;  1VQ6 A;  2EOT A;  3J7Z C;  1S4Z A;  2XNA C;  1C48 A;  2K1B A;  3HOW G;  3CF5 A;  4IFD H;  1W6K A;  4DR3 Q;  1IKL A;  3HOU G;  1CI3 M;  3OHX C;  2QEX A;  5C0X H;  3M7G A;  4LFA L;  1UE5 A;  3T53 B;  5CV8 A;  2IHF A;  4Y7N H;  3QO2 A;  4BBR B;  4PV1 C;  1CFM A;  1IBK L;  3ND8 A;  2VNU D;  2RDH A;  3BG3 A;  4AIM A;  1GUW A;  3TN2 A;  3V2T A;  3SK4 A;  2YTV A;  1NSN S;  3E6Z X;  2BA1 A;  2MNA A;  2B29 A;  3K7U C;  4LW1 A;  2A68 C;  1TR5 A;  4MHE A;  1WD1 A;  4KY7 A;  3GTG H;  1SE3 A;  2DY7 A;  4R1J A;  2ALY B;  2V1C C;  1HR0 Q;  2XRS D;  4B3R L;  2PPB C;  2NVX H;  2JA5 H;  3RR5 A;  3A54 A;  1L1O C;  2Q8T A;  1BQQ T;  2L5T A;  4JBK A;  5JEA J;  4R4I A;  1CZG A;  2NVQ B;  2K14 A;  2IX3 A;  2EYM A;  2F0H A;  1KNE A;  1VQK A;  3GTM B;  4GLV B;  4JOI C;  2R92 H;  2PO4 A;  5C5L A;  4CDE C;  5A2Q E;  4OHJ A;  4A3L G;  4R4C A;  2JP1 A;  1QZH A;  3HEJ A;  1Q82 C;  4IPG A;  1EQQ A;  3E9H A;  4J6H A;  4B08 A;  1TS4 A;  2Z8L A;  4A3C H;  1PVO A;  3PCO B;  1VMC A;  4I7A A;  1LUZ A;  2RA4 A;  1PZK D;  1AZQ A;  5K5P A;  2EYH A;  1ZKO A;  3OMC A;  2B8F A;  4BY1 B;  3O13 A;  1D8L A;  4DU9 A;  4U67 3;  2BDO A;  2PW5 A;  2KED A;  2C35 B;  1WFQ A;  5M5Y B;  2VQE L;  5M3F B;  2A5H A;  4LNQ A;  3NWS A;  1IBK Q;  1LYL A;  1VQ7 A;  1BCP F;  3I91 A;  2Y0S G;  1KLU D;  2K5H A;  4A93 B;  3HKZ G;  3ULJ A;  1PH1 A;  4X6A H;  3FEW X;  5IYB H;  1HQM C;  1SR3 A;  2E2I B;  4B3R Q;  3CCV A;  1B53 A;  2RQX A;  3NQT A;  1AH9 A;  4F8M A;  1I4Q A;  4OXP A;  4X64 L;  1Q90 A;  1JB3 A;  3EIV A;  4B3T L;  3OTO L;  3OPO A;  5IT9 E;  2UUC L;  1WTR A;  5JEA H;  2FIN B;  3PO3 B;  5EJW A;  2PNH A;  2PQE A;  3LWU A;  4LF4 L;  1N32 L;  1IYV A;  2IY5 B;  2JA7 B;  1OTC A;  1EY0 A;  3H94 A;  5IP7 H;  1FYC A;  2CW0 D;  1PRT B;  4BBS H;  1LM0 A;  1UE7 A;  4RFB A;  4UPA A;  5BN5 A;  4UP8 A;  3VYT A;  4IOA A;  1Q3L A;  4IUR A;  1Q1B A;  2PI2 A;  2V4D A;  1MSH A;  2F0W A;  2NN6 I;  4MTK A;  4L63 B;  1LAC A;  4P75 A;  1EY5 A;  2IL8 A;  1K8M A;  2ATW A;  3HOY G;  3HFZ B;  2N88 A;  2WFW A;  3NTH A;  4QY7 A;  1LTS D;  3I4O A;  2E76 C;  4DV4 L;  4RA8 A;  1RHP A;  2WKD A;  2VQE Q;  5C4X H;  1HH2 P;  2D0O A;  3CCJ A;  4IOC A;  4PQX A;  2IT1 A;  2RSO A;  5LHY 1;  3K81 C;  3KYH C;  4GLA C;  1Y1W G;  2LKV A;  1XTD A;  5NUC A;  2Z6K C;  1DOK A;  5ELC A;  1XNQ L;  2DJG C;  2K5N A;  2XRQ D;  4A3E G;  2Z4H A;  4A3F G;  2CW0 C;  1QVC A;  4R8I A;  2WIN B;  4X64 Q;  1U4P A;  4FF1 A;  3F2U A;  1HFN A;  4B3T Q;  3OTO Q;  2UXD L;  2UUC Q;  3TS2 A;  2F3W A;  5CV6 A;  4WJ4 A;  2VUM G;  1CK1 A;  2X6G A;  2B2V C;  2CH4 A;  1LV9 A;  3CAM A;  4LF4 Q;  1N32 Q;  1D5X C;  2RKS A;  4RCO A;  5COR A;  3T51 B;  2EYL A;  4JI1 L;  4C2M H;  1VQB A;  2AKW B;  1QIL A;  3RLF A;  3MC0 B;  4LK1 C;  1E24 A;  4DR7 L;  3CC4 A;  3ULP A;  2C5C A;  1D5Z C;  2ZJQ A;  1HZC A;  4U68 A;  5KEE A;  1CQF A;  3I4N G;  2A6E D;  3I3C A;  2EJF C;  1G6P A;  5CV4 A;  1C0A A;  1LTB D;  2KEE A;  1N8R C;  2FMM A;  1HUN A;  1KAA A;  1ZYR C;  5E4X A;  2L4N A;  3OMG A;  5M5W H;  2ZTD A;  4C3J B;  3HRZ C;  1BBW A;  5JVH 3;  2WKC A;  4CJ1 B;  4X3U A;  1STN A;  2L55 A;  2PZW A;  4LUZ A;  4DNT B;  1B50 A;  4DF7 A;  1BO0 A;  2L1B A;  1JWS D;  3W3A A;  4K5W A;  3S14 B;  4AYB B;  1B7Y B;  2F4I A;  1NJI C;  4AQY L;  1H9R A;  3TP5 A;  2O5J C;  1DM0 B;  2XN9 C;  1XNQ Q;  2EIF A;  4WJW A;  1VQA A;  3I70 A;  4N8X 1;  4GN3 B;  3D6W A;  1QJO A;  3FPP A;  1CUK A;  1VF5 C;  2UXD Q;  5COY A;  5M3M G;  3S1Q B;  3FKI B;  3OWE B;  1X3P A;  1PH9 A;  3HOV H;  4C3I G;  5FLX L;  2Q2I A;  2B63 H;  3MFY A;  2AWO A;  4JI1 Q;  4PMC A;  1GUN A;  1M8A A;  4DR7 Q;  1IL8 A;  2BOS A;  2A19 A;  1NR4 A;  3G71 A;  2EJM A;  4QIW B;  1KC8 C;  3I4M H;  1STA A;  1CHQ D;  4RAU C;  1YIT A;  5JJK A;  2BE5 C;  4BBR H;  2JA8 B;  2J7Z A;  4EQN A;  5M5X B;  4A3G H;  1ML0 D;  3HOX B;  1Y1V G;  2ZXO A;  1XX8 A;  1KNA A;  2I07 B;  3S1M H;  1DCZ A;  1ZXT A;  5DEH A;  2K5Q A;  4J8Q A;  4ZYS A;  2EYF A;  1EEI D;  2PNR C;  3VR4 A;  2ZJR A;  2O5I C;  3TRZ A;  3PMF A;  3OYY A;  5J39 A;  1LT6 D;  3S15 H;  1E1O A;  1HJP A;  5HGQ A;  1O78 A;  2KEN A;  1EIY B;  4QMG A;  2WB1 E;  4DA2 A;  1PTO F;  1Q8K A;  4EQP A;  2NBF A;  1SYF A;  5IIF A;  2CHB D;  3PQI A;  3J7Y W;  4WFN 3;  5D3I B;  4OGQ C;  3UDG A;  4BY7 G;  3J81 c;  2OTJ A;  1WOC A;  1WYD A;  3TZU A;  4J1M A;  5HGT A;  1RTO A;  3I90 A;  2VW9 A;  3BYT B;  4PG3 A;  1IW7 D;  2G9H D;  2Z1C A;  3A74 A;  3KBG A;  5T1G A;  2WAQ G;  1LO5 D;  1X65 A;  1TY2 A;  4HSV A;  4PZ6 A;  4KK7 A;  5C4J B;  3K80 C;  3BZD B;  5J22 A;  1S5F D;  3C46 A;  3M4Y A;  4LUO A;  1KDA A;  3SHL A;  1CA5 A;  1B3Q A;  2E2D C;  1N33 L;  2FXQ A;  3RZO H;  3ICE A;  1C7Y A;  1UE1 A;  3PUZ A;  5HY6 A;  5M5Y H;  2UUA L;  1OXX K;  2NZH A;  5FK9 C;  1O7I A;  2HDL A;  2JYO A;  1MHW C;  2JEA I;  1ILQ A;  1PH6 A;  1H9S B;  1ICW A;  3SGI A;  1IYJ B;  1F9Q A;  4POF A;  1JMC A;  2OF1 A;  1SNM A;  3MXU A;  5C44 G;  1HCZ A;  2LMC B;  3M4Q A;  4KJO A;  2SNS A;  4NKL A;  4JYA L;  2DNE A;  1PZI D;  2E2I H;  1JIC A;  1IZ6 A;  2F0G A;  3J7A V;  1K3R A;  4O2D A;  3R8B A;  1IXR A;  1G8Z D;  1TY0 A;  2E2J B;  1KDC A;  5C3E B;  4LUV A;  2VL6 A;  1L1O A;  1XMO L;  1K0S A;  4A3K H;  4A3B B;  5ELF A;  3U50 C;  3MXG A;  2R7Z B;  1H9M A;  2JE6 I;  4YWM A;  2KHS A;  3PUX A;  2K6A A;  3NWT A;  1UWV A;  4RHS A;  3F2B A;  2JA7 H;  1SEB D;  2SOB A;  3CME A;  4A75 A;  3S1N B;  2F0U A;  4JOI A;  2MFI A;  3FDT A;  3OW2 A;  3HOW B;  1ENC A;  2EY5 A;  4DNI A;  2Z9H A;  2Q8I B;  5D3D A;  3EQL C;  4DK3 C;  3HOU B;  1TWG B;  1VQ8 A;  4ME5 A;  1RD9 D;  3ULL A;  3J81 i;  2I46 A;  5EAY A;  1CKN B;  2ID0 A;  1I6V C;  1I94 L;  3K5O A;  2Z6B A;  4KTA A;  2NVY H;  4DN4 M;  3C1E A;  3QB3 A;  4DV3 L;  3LX0 A;  3K0X A;  1Q86 C;  4PMB A;  1N33 Q;  4FF3 A;  2B2T A;  3C1F A;  1CA6 A;  2E2H B;  4C3H H;  3EBE A;  1VQM A;  4N9P A;  1GOZ A;  5EKK A;  3RMH A;  2O4X A;  5A35 A;  2UUA Q;  3X3M A;  2ZM6 L;  3ND9 A;  1FR3 A;  1JB7 A;  4IUQ A;  5IGC A;  4OIK A;  4QB4 A;  1Y8P B;  2KVM A;  2MO1 A;  3A56 A;  1WTH A;  1HR0 W;  2A8V A;  2Q2U A;  4GOP C;  3HKS A;  5GRO A;  3VDY A;  2A6H C;  5EBC A;  1MJE A;  2A1A A;  5C3W A;  4NMZ A;  4JYA Q;  1H9S A;  5K36 G;  5DAU A;  1Y69 U;  2AQ1 B;  1C8C A;  1YNJ D;  1B4O A;  2EE1 A;  3L0O A;  3NEL A;  1PHJ A;  5C3X A;  1E7Z A;  5IGG A;  5JJZ A;  1SDF A;  3NP8 A;  2FJ2 A;  2RDF A;  3T16 A;  4XDX A;  4ZCK A;  2DN8 A;  2O2L D;  1HNZ L;  3PO2 H;  2CVR A;  1LTI D;  4OWT B;  3TME A;  3CRK C;  5IYD H;  2R7F A;  1EY6 A;  1RJT A;  2EQS A;  5EPK A;  1EWC A;  3KLS X;  2R3Z A;  3PGZ A;  1L2F A;  1V1O A;  4A3J G;  2KCM A;  5FO9 B;  3S2H B;  1X3Q A;  5KYL A;  2G5D A;  2GVB A;  3SE0 A;  1YJN A;  1I94 Q;  4JI3 L;  1VQL A;  3H91 A;  5IP9 G;  3J80 L;  4JI7 L;  1VQG A;  3BVM A;  1I50 H;  4DV3 Q;  2Y0S B;  4FNF A;  5FO7 B;  4UP7 A;  5IGF A;  3HKZ B;  3DEO A;  1CKN A;  2BH8 A;  3J80 c;  3UE1 A;  4IAL A;  3F2D A;  1DZ1 A;  3B6Y A;  3S16 B;  4IFD G;  2ZM6 Q;  1TWC H;  2LS0 1;  1AE2 A;  1SAP A;  4MIU A;  5C0X G;  1SYC A;  3EFX D;  1GO3 E;  1YI2 A;  2F3I A;  3HP3 A;  4ZKB B;  1CTM A;  2F0Q A;  5FO8 B;  1Y14 B;  4CKB A;  2Z6K A;  2BA0 A;  3OOC A;  2F0S A;  2HCI A;  3BVZ A;  4O0A A;  2SNM A;  4HMJ A;  4RGT A;  4BA1 I;  2JA5 G;  3SR1 A;  2B2Y C;  1DGS A;  1PYS B;  5C6A A;  1HNZ Q;  1S5D D;  3EVQ A;  1VMP A;  3D6C A;  4ZRZ A;  5CMD A;  4KKT A;  4A3M H;  3PIO 3;  2F0N A;  3TRE A;  3CW2 C;  1KIX A;  2JSO A;  3EA6 A;  3FVQ A;  2R93 H;  2HDM A;  4XTC S;  2R92 G;  1XMQ L;  1AP0 A;  2A68 D;  5AJ3 L;  3ER0 A;  3HOY B;  1ESF A;  2GVA A;  1CSP A;  1U0L A;  3VR2 A;  1YNX A;  1GKH A;  3G7L A;  4DXG A;  4JI3 Q;  2JA8 H;  4JI7 Q;  1JE4 A;  2HIV A;  2L11 A;  4A3C G;  1I3Q H;  5EKL A;  4Z9C B;  4RG1 A;  1WCM H;  2NN6 H;  4ILW A;  4IPH A;  3KK7 A;  5CBE E;  4N9T A;  4OL7 A;  1G91 A;  1PFS A;  2I5L X;  4M1U B;  1Y1W B;  4KHZ A;  1LLR D;  2K01 A;  1BUV T;  4YWK A;  1AW7 A;  4UDU C;  4B3M L;  5CC4 A;  2K03 A;  2VB2 X;  3MXN B;  3T1H Q;  4A3F B;  3KLW A;  3D31 A;  1K8A C;  4DAV A;  3NTK A;  3CCU A;  1Q8I A;  2XTI A;  4TSS A;  3K58 A;  1TWF H;  1OXS C;  1MIU A;  1PDQ A;  3J80 i;  1SRO A;  1E22 A;  2VUM B;  2F03 A;  3DWA A;  1K9M C;  1EU3 A;  4JBM A;  1XWE A;  4OX9 L;  3LWE A;  1IYU A;  1PFB A;  2AUJ D;  4R4Q A;  5IYB G;  1D6E C;  1VQP A;  3CXC A;  5IWA L;  2N78 A;  1T9H A;  2AQ3 B;  1B9N A;  1I4G A;  2KA7 A;  1F2M A;  2JXM B;  3DHQ A;  3AFP A;  4HIM A;  3H0G B;  3SK8 A;  3I4N B;  5C4J H;  4NB3 A;  1BXT A;  2K5W A;  2XIW A;  1SYE A;  5JEA G;  4K8I A;  5J3B A;  2K28 A;  3HOZ H;  5JAV A;  5G3L D;  1S5B D;  3A0J A;  2RDG A;  1A62 A;  2WP8 J;  1WTO A;  1XMQ Q;  5AJ3 Q;  1HTP A;  4FO2 A;  1DJR D;  1KRT A;  5IP7 G;  3DWQ A;  3N6R A;  3AMU A;  1J8I A;  5FKA C;  1YNN C;  3GTP H;  4YY3 L;  3A7L A;  3GTQ B;  1JJC B;  2D9U A;  3PUW A;  2N55 A;  4IJH A;  2F0L A;  1UE6 A;  1P16 A;  3I2Z A;  4H13 C;  1E1T A;  5CYU A;  3U4V A;  2DY8 A;  3R2T A;  3PF5 A;  3Q22 A;  1MI2 A;  1HZB A;  2Y0S E;  4HTH A;  1A3U A;  1ONL A;  1VF7 A;  2F0F A;  2IJ0 A;  1II3 A;  4B3M Q;  2IPK D;  3HKZ E;  3M3Y H;  3G48 A;  2B2T C;  3QWN A;  1RIP A;  4HMI A;  1SXT A;  5KYI A;  4TQU S;  1LTT D;  1SFO B;  5ISR A;  3CPW A;  4K5V A;  2E2J H;  4KD4 A;  3U9S A;  5C3E H;  5KNC A;  4HJ7 A;  4PZ7 A;  4GKJ L;  3RZD H;  5C4X G;  1HUM A;  3OIQ A;  4LFA Q;  1G51 A;  3K7A B;  4PZ8 A;  4CHT B;  1LT4 D;  5M3M B;  3MAQ A;  4A3B H;  1DOM A;  1SE8 A;  3MXN A;  3TQY A;  3CHB D;  2WV6 D;  1BVS A;  3V05 A;  4C3I B;  1NNX A;  4OX9 Q;  5EPL A;  4ZUI A;  5ELE A;  2FHT A;  5IOD A;  3UDF A;  3LGJ A;  5IWA Q;  4M8A A;  3HOU H;  3CCM A;  1B2T A;  2K52 A;  4XT1 B;  4UHV A;  2AQ2 B;  3H3V I;  3RN5 A;  3BDC A;  4LAA A;  1M4V A;  1SNP A;  1FVI A;  1GM5 A;  4P74 A;  1SE2 A;  2EDG A;  3S17 H;  4GS3 A;  2KCC A;  4F88 A;  1ENA A;  1SLJ A;  2E2H H;  4NXM L;  2QW7 A;  2CFM A;  2R61 A;  1EY9 A;  5FLX E;  1CZW A;  4YY3 Q;  4B9W A;  4ZLT F;  3W2D A;  3F2C A;  4DV7 L;  1TWA B;  1ZEQ X;  4Q5V A;  4X65 L;  3GV6 A;  4GOP B;  2E5L L;  2KJX A;  1XYI A;  3A5Z B;  1VQC A;  4HIK A;  4OO1 I;  1LT3 D;  4DR1 L;  1P8L A;  4BY7 B;  5C4H A;  1GUS A;  5DM6 3;  4AH6 A;  1A3T A;  4JI6 L;  1YEZ A;  2DJF C;  3OWF A;  1GD7 A;  1HPC A;  2PYK A;  3D4W A;  1SMY C;  3CC7 A;  4GKJ Q;  2JN4 A;  1B8A A;  2EYO A;  2D62 A;  5DNF A;  4FXK C;  3QJY A;  2WAQ B;  2WII B;  1VCI A;  4IO9 A;  1EL0 A;  5EBD A;  2Z0S A;  5IYC H;  2KBN A;  1O7L A;  1HNX L;  4G4K A;  1FNW A;  3K8A A;  3SK5 A;  1LTG D;  4RH6 A;  1ZYR D;  1HZ9 A;  2J0T D;  4FXD A;  1HNW L;  3CQZ B;  4CJ2 C;  4KN7 C;  4Y52 H;  2VXW A;  1YBY A;  3GO5 A;  4P73 A;  4I65 A;  5BN4 A;  3MEF A;  2TSS A;  1PTO H;  1VQF A;  1X6O A;  1NMF A;  1SYB A;  4WRD A;  1RTN A;  3HOV G;  3L9A X;  2K33 A;  1TWH B;  2NWG A;  5C44 B;  2K5V A;  4KD3 A;  4NXM Q;  1JWM D;  1S5E D;  5CGK A;  2Q8R E;  3WDN A;  3CCS A;  4FDB A;  4XIG S;  5DLQ E;  4GLX A;  3TP7 A;  4DV7 Q;  3J81 j;  4A3D G;  3U9O A;  2MUY A;  4R4T A;  4X65 Q;  2I0Q A;  3I4M G;  1VQO A;  2PI2 E;  2L9H A;  1WTV A;  2E5L Q;  1CKM A;  3X3N A;  3D4R A;  4XYQ A;  4BBR G;  4QCL A;  2HIX A;  1EFI D;  4A3G G;  5L37 A;  4DR1 Q;  4I7Z C;  4GOP A;  1MD2 D;  3NXW A;  1OO9 B;  1TS5 A;  2R7D A;  4EX5 A;  1KRS A;  2JJQ A;  3ZYY X;  4JI6 Q;  4JW0 A;  3KF6 A;  4GKK L;  4G7Z C;  3GTJ B;  3KLR A;  5IGD A;  5IGE A;  4DV4 Q;  4H44 C;  2C9O A;  1R9T B;  3NSW A;  1BDO A;  1GUT A;  4A3I G;  4QQB X;  1I4P A;  1QNU A;  4JI4 L;  1I6H H;  4LF6 L;  2BE5 D;  2OCE A;  1TXY A;  1HNX Q;  3OIP A;  1HFG A;  2IW3 A;  4IUN A;  1HNW Q;  3NEM A;  4QUF A;  3I7F A;  1H95 A;  2YU9 B;  1AEX A;  4V19 0;  3HS0 C;  3EJI A;  1V9P A;  2YTY A;  1SYD A;  4JCV E;  1T5E A;  4A4I A;  4DV0 L;  3RN2 A;  3MA2 B;  2HUG A;  4L6T B;  3H09 A;  3GP7 A;  2PMZ B;  1L0Y B;  1J6Q A;  2M9V A;  3N52 A;  2ASB A;  2LSS A;  3K57 A;  3GV3 A;  3PIP 3;  1XPU A;  2GA4 B;  2MGS A;  3I73 A;  5IY0 A;  4BXX H;  3FPU B;  4YCW A;  3ERS X;  3QG1 A;  1EUJ A;  2QDB A;  5M9O A;  3PIO A;  1HHV A;  4DAY A;  5AFW A;  1E2V A;  1EFW A;  5ELB A;  3GTL B;  3GTK B;  1WI5 A;  4OON A;  4HJ5 A;  4RHR A;  2VUM H;  5IT9 c;  2M00 A;  4KI0 A;  2OXP A;  1I5F A;  4CKC A;  1SYG A;  1ET6 A;  4G7H C;  4JI8 L;  1SNC A;  1UUP A;  4GKK Q;  4DK0 A;  1K8G A;  1GJX A; 
#chains in the Genus database with same CATH homology
 3JAM E;  4A3J B;  1UNS A;  1C4Q A;  3A8K E;  4UAI A;  2G9D A;  1V1P A;  5BN3 A;  4CJ0 B;  1U9R A;  3UI2 A;  3M85 A;  3VYR A;  3NUC A;  3J81 L;  2B2Y A;  3TP6 A;  3HGB A;  4RWS C;  4S3S A;  1F9P A;  1F2Y A;  1TT2 A;  1TII D;  1JOR A;  1OXU A;  3L7Z C;  4HSP A;  4X3S A;  2DNC A;  1E2Z A;  2F0P A;  5CV5 A;  4Y7N B;  3VYS A;  4CKE A;  4LJZ C;  3Q0A A;  3DMU A;  4K6L A;  5KNB A;  1O7Y A;  4C3H G;  3Q23 A;  3NBI A;  1RCV D;  3K5N A;  2NTS A;  2NVX B;  1PFM A;  2JA5 B;  1GUG A;  3QIA A;  1FNU A;  2MHV A;  1I4R A;  3FMC A;  4G7O C;  2QF7 A;  3I8Z A;  4DK1 A;  3NHH A;  2R92 B;  2D5D A;  4K14 A;  2A69 C;  4HCE A;  3K6O A;  1Z47 A;  2B2U A;  3IFD A;  2YYZ A;  4DNR B;  1O7Z A;  4RCN A;  4F87 A;  3Q6S A;  1E2W A;  2K5D A;  4L8J A;  1U4L A;  1B1Z A;  1Z6H A;  2EYJ A;  2IX1 A;  2QEJ C;  4K5X A;  1ROD A;  2PCF B;  1HXY D;  1QWY A;  2A6H D;  2MP1 A;  2B8G A;  1JOQ A;  2A73 B;  2EJG C;  4TRD A;  1R4P B;  1I4X A;  2L0C A;  1Y8N B;  5CR3 A;  1CQV A;  1TKW B;  5IOC A;  3MHB A;  2NZ1 D;  4IZ8 A;  3BDL A;  4JK1 C;  2XWJ B;  2AUK A;  1JWU D;  1F77 A;  1PFN A;  1LTA D;  1STY A;  1QE6 A;  4WOR A;  1DYQ A;  2KEC A;  4RGN A;  3K5L A;  3NQI A;  2SDF A;  1CT1 D;  4IN3 A;  1BF4 A;  5CBA E;  1U4R A;  1TS2 A;  3GQB A;  3NBH A;  3GTO B;  3QOL A;  4K2L A;  2OEO A;  1WTP A;  1WD0 A;  1DOL A;  1MSG A;  5I6W A;  2F0V A;  1SE4 A;  5CV7 A;  5KIX A;  5C5M A;  4RGM A;  1B44 D;  1PRT C;  1EWH A;  2MJ8 A;  3MVV A;  1OXT A;  3VA7 A;  2F0E A;  1RDP D;  1I4H A;  2XWB B;  4EQO A;  2HQE A;  1HQR D;  1F2Z A;  1D1I A;  1AFP A;  5C4X B;  1PMR A;  3CRL C;  2QCP X;  3TSS A;  2K04 A;  2NN6 G;  4G57 A;  1EZ6 A;  2NVT B;  5EQ0 A;  2ICE C;  1X32 A;  3A8J E;  2B2W A;  1G2S A;  4KY5 A;  2M2L A;  3KUP A;  2A74 C;  2PZU A;  2OT2 A;  3T13 A;  4DGZ A;  3IFT A;  5J1Z A;  3NTI A;  2Z4I A;  2R6G A;  1ENF A;  2EPB A;  2B39 A;  2F0T A;  3WOF A;  3VR5 A;  3CKI B;  4KY6 A;  1STG A;  4FP5 D;  5LL6 X;  3S2D B;  3OW7 A;  1EYA A;  1BCP D;  1EIG A;  1QOH A;  3SK6 A;  3MEH A;  1GHJ A;  3TZD A;  4HR7 B;  2RSN A;  4NW2 A;  1FNV A;  1Q1E A;  4OO1 H;  4XXE A;  1A15 A;  2NYZ D;  4RKL A;  4FXG C;  1EQT A;  2F0J A;  1STH A;  2X69 A;  1FGB D;  4A3E B;  1EQV A;  1YNN D;  1G2T A;  5T1I A;  1BR9 A;  2FMC A;  5LL6 S;  1B3A A;  2PZT A;  5JVG 3;  3HOV B;  2FFK B;  1Q12 A;  1DD2 A;  3P7J A;  1BCP C;  4B9X A;  4DAP A;  1TS3 A;  3NE5 B;  3SXH A;  3DM1 A;  1VDZ A;  2B2U C;  5IGB A;  4A3D B;  4OIJ A;  5EPJ A;  3I4M B;  2EY6 A;  2H4O A;  1LAB A;  4ZK9 B;  3PUV A;  1ESR A;  1F9S A;  1HTL D;  1TU2 B;  1SJE D;  3RUZ A;  4A3G B;  3NK9 A;  1MGS A;  3S1M B;  4YIJ A;  1UEA B;  3C2P A;  3DXJ C;  3S15 B;  4A3I B;  1JC7 A;  1RF2 D;  1R4Q B;  1XXG A;  2F0K A;  1E0B A;  3M7N A;  5I9P A;  4IUP A;  1G6Z A;  1IKM A;  4PMW A;  1GUO A;  3T56 B;  3IL8 A;  3E5S A;  4P2C B;  2EZV A;  4F7X A;  3VA5 A;  3E0J A;  1K8O A;  2XSC A;  1EU4 A;  2F0M A;  2ZT9 C;  3OSO A;  4C56 C;  1JOK A;  3RZO B;  1SMY D;  4TKO B;  1NAP A;  1O80 A;  5I2X A;  5I4D A;  2SEB D;  4NP5 A;  5C4Z A;  3MTS A;  1Y1V B;  3M4O B;  1V8Q A;  1CM9 A;  3LNN A;  4K2K A;  1BOS A;  5I2Y A;  4Q0F A;  1EY8 A;  5D14 A;  1CHP D;  1A6X A;  2NB0 A;  4X3K A;  4A3K B;  1ET9 A;  2VB3 X;  2K32 A;  2EYP A;  1EYD A;  3TDQ A;  3KF8 A;  3ERQ A;  1LTR D;  4IUV A;  2JA6 B;  2B2W C;  5F2D A;  1SBB B;  1NUC A;  4XQQ A;  2F0I A;  5JPM C;  3HZX A;  4LMQ D;  3D3R A;  3J81 E;  2NVY B;  1H9K A;  4XT3 B;  4IFD I;  4XQN A;  4EVO A;  4C3H B;  5KND A;  2D2C C;  2WB1 B;  3I4L A;  5TSS A;  5C0X I;  1WVL A;  1IHZ A;  4EGV A;  3I72 A;  5I6Y A;  5FOB B;  5G3L F;  1PTO D;  1NR2 A;  1G29 1;  2RVL A;  1D5M C;  3CU7 A;  4XQJ A;  5KGU A;  4KHV A;  4RGO S;  3AU7 A;  4NDX A;  3P1H A;  2RBM A;  3VYU A;  3BYY B;  1KAB A;  1Z7T A;  3PO2 B;  1WTQ A;  5A2Q L;  1D2B A;  1V1P B;  2KCN A;  3S1R B;  1AN8 A;  1EY4 A;  3S9W A;  2EY2 A;  2F1M A;  2BCO A;  4K6D A;  2J4X A;  3TBI B;  4BS9 A;  1PTO C;  1I50 B;  4V0B A;  3Q24 A;  4KV6 A;  2LY7 A;  3FRP B;  3A7A B;  1EOT A;  4C1N K;  1TWC B;  4KJN A;  4FYD A;  1STB A;  1MBY A;  4HN7 A;  3C3L A;  3WOE A;  3T4A C;  2IX0 A;  5IT9 L;  4MN3 A;  1L0X B;  5E1F A;  4H7B A;  1W6J A;  4ZAI A;  1JQY D;  4HED A;  2A6E C;  2X6L A;  4ULL A;  1BCP B;  1K83 B;  3R3O A;  4A3M B;  4K8J A;  1F9R A;  3NPP A;  3IAY A;  1J9O A;  2R93 B;  1EIH A;  1LT5 D;  1HA5 A;  3BVG A;  3J7A F;  2EXZ A;  4KN4 C;  4O1N A;  3K59 A;  1STE A;  1EZ8 A;  2JEB I;  1I3Q B;  2WAC A;  1WCM B;  2E75 C;  1SND A;  3QOJ A;  3SVM A;  3A8I E;  2A69 D;  4X3T A;  3MFG A;  1PXU A;  3BDO A;  4E6I A;  1NCV A;  2EVB A;  1PLF A;  3SEB A;  4ZKC B;  2ZXR A;  1TWF B;  4QUC A;  3D4D A;  3MXP A;  4BWG B;  3J80 E;  3IKJ A;  3V96 A;  3D8G A;  1FD7 D;  1T5X D;  4DXF A;  4R9W A;  3GTG B;  3TP8 A;  3K5M A;  2F0D A;  3ONA B;  4KKU A;  1S5C D;  4ABN A;  1DXM A;  1QNK A;  5JOB A;  5E3F A;  3HOZ B;  5ELD A;  3KLS A;  1PYW D;  3GTP B;  4H0L C;  5I9O A;  3DEP A;  1UAP A;  2CQA A;  3H6M A;  1TQO A;  4KMU C;  4IUT A;  3P75 A;  3G6J B;  1JR0 D;  1PZJ D;  2K7V A;  4ODG A;  1SSO A;  1AZP A;  3M3Y B;  1KLG D;  1IW7 C;  4ID6 A;  3PUY A;  3RZD B;  4R8N A;  1PRT D;  1XTC D;  4O42 A;  1QG7 A;  3SDZ A;  1HA6 A;  1H9J A;  1V43 A;  3R93 A;  1EYC A;  4C3J G;  1ILP A;  2XVS A;  3HG9 A;  1A3V A;  2H1E A;  3MWY W;  3ITP A;  1WTX A;  2L12 A;  1TVX A;  2HCC A;  2KOL A;  2K05 A;  3K0Y A;  3URY A;  3GD7 A;  4BA2 I;  4QF4 A;  1B9M A;  4HAE A;  2QIL A;  5EKI A;  3S17 B;  5D65 A;  2QKI C;  5HUR A;  1JOO A;  4BBS B;  3VR6 A;  1KTK A;  1DON A;  3P20 A;  2LFN A;  1GHK A;  3JAM L;  1SNQ A;  3MZ5 A;  4FVM A;  3ERO A;  1D1K A;  1GXD C;  2NUC A;  2ZXP A;  3DUZ A;  3PV0 A;  1U4M A;  2AWN A;  4FF4 A;  4FF2 A;  5CV9 A;  4CBV A;  1SNO A;  4ZUJ A;  1BBX C;  1KDB A;  4OO1 G;  1EY7 A;  3A55 A;  1QB5 D;  1QCB D;  2TMP A;  5JPN C;  1OXV A;  1PTO B;  3KBX A;  1JCK B;  1WTW A;  2KQ3 A;  3DWP A;  1RKN A;  4IUU A;  2KUM A;  5E4W C;  1BNZ A;  4C1N I;  4C2M B;  4IFD J;  1A2T A;  3AB9 A;  2F3V A;  1YNJ C;  3R2I A;  2PW7 A;  5C0X J;  5EGT A;  5DM7 3;  4DFA A;  4JBW A;  4XYO A;  5M5W B;  5K36 H;  4RKB A;  1PRT F;  4ZQ3 A;  4KKS A;  1HRJ A;  1SJH D;  2IWH A;  2F0O A;  3L3O C;  1I6H B;  2ICI A;  2EY1 A;  2B2V A;  2ENB A;  2E74 C;  4IQZ A;  1EEF D;  4HCS A;  1F2L A;  4CGY B;  4PNY A;  2MPM A;  2NTT A;  2BDN A;  5KRU A;  1A2U A;  1Y8O B;  3VR3 A;  3RD4 A;  4GZY C;  3BS1 A;  2B63 B;  3H3V C;  2EOT A;  1S4Z A;  2XNA C;  1C48 A;  2K1B A;  4IFD H;  1W6K A;  1IKL A;  1CI3 M;  3OHX C;  5C0X H;  3M7G A;  3T53 B;  5CV8 A;  3QO2 A;  4BBR B;  4PV1 C;  1CFM A;  3ND8 A;  2VNU D;  2RDH A;  3BG3 A;  1GUW A;  3TN2 A;  3V2T A;  3SK4 A;  1NSN S;  3E6Z X;  2BA1 A;  2A68 C;  1TR5 A;  4MHE A;  1WD1 A;  4KY7 A;  1SE3 A;  2DY7 A;  2XRS D;  2PPB C;  3A54 A;  2Q8T A;  1BQQ T;  2L5T A;  5JEA J;  1CZG A;  2NVQ B;  2IX3 A;  2EYM A;  2F0H A;  1KNE A;  3GTM B;  2PO4 A;  5C5L A;  5A2Q E;  4OHJ A;  2JP1 A;  3HEJ A;  4J6H A;  4B08 A;  1TS4 A;  2Z8L A;  1VMC A;  2RA4 A;  1PZK D;  1AZQ A;  5K5P A;  2EYH A;  1ZKO A;  3OMC A;  2B8F A;  4BY1 B;  3O13 A;  4DU9 A;  4U67 3;  2BDO A;  2PW5 A;  2KED A;  5M5Y B;  5M3F B;  2A5H A;  3NWS A;  1BCP F;  3I91 A;  1KLU D;  4A93 B;  3FEW X;  1HQM C;  2E2I B;  1B53 A;  2RQX A;  3NQT A;  4F8M A;  1I4Q A;  1Q90 A;  1JB3 A;  3OPO A;  5IT9 E;  1WTR A;  5JEA H;  2FIN B;  3PO3 B;  5EJW A;  2PQE A;  3LWU A;  1IYV A;  2JA7 B;  1EY0 A;  3H94 A;  1FYC A;  2CW0 D;  1PRT B;  4RFB A;  5BN5 A;  3VYT A;  1Q3L A;  4IUR A;  1Q1B A;  2V4D A;  1MSH A;  2F0W A;  2NN6 I;  4L63 B;  1LAC A;  1EY5 A;  2IL8 A;  1K8M A;  2N88 A;  3NTH A;  1LTS D;  2E76 C;  4RA8 A;  1RHP A;  2WKD A;  4PQX A;  2IT1 A;  2RSO A;  5LHY 1;  2LKV A;  5NUC A;  1DOK A;  5ELC A;  2XRQ D;  2Z4H A;  2CW0 C;  4R8I A;  2WIN B;  1U4P A;  4FF1 A;  3F2U A;  1HFN A;  2F3W A;  5CV6 A;  1CK1 A;  2X6G A;  2B2V C;  1LV9 A;  1D5X C;  2RKS A;  4RCO A;  5COR A;  3T51 B;  2EYL A;  1QIL A;  3RLF A;  3MC0 B;  4LK1 C;  2C5C A;  1D5Z C;  4U68 A;  5KEE A;  1CQF A;  2A6E D;  3I3C A;  2EJF C;  5CV4 A;  1LTB D;  2KEE A;  2FMM A;  1HUN A;  1KAA A;  1ZYR C;  5E4X A;  2L4N A;  3OMG A;  4C3J B;  3HRZ C;  5JVH 3;  2WKC A;  4CJ1 B;  4X3U A;  1STN A;  2L55 A;  2PZW A;  4DNT B;  1B50 A;  4DF7 A;  1BO0 A;  2L1B A;  1JWS D;  3W3A A;  4K5W A;  3S14 B;  4AYB B;  2F4I A;  1H9R A;  3TP5 A;  2O5J C;  1DM0 B;  2XN9 C;  4WJW A;  3I70 A;  3D6W A;  1QJO A;  3FPP A;  1VF5 C;  5COY A;  3S1Q B;  3FKI B;  3OWE B;  1X3P A;  4C3I G;  5FLX L;  3MFY A;  2AWO A;  4PMC A;  1GUN A;  1M8A A;  1IL8 A;  2BOS A;  1NR4 A;  2EJM A;  4QIW B;  1STA A;  1CHQ D;  4RAU C;  2BE5 C;  2JA8 B;  2J7Z A;  4EQN A;  5M5X B;  1ML0 D;  3HOX B;  2ZXO A;  1XX8 A;  1KNA A;  2I07 B;  1DCZ A;  1ZXT A;  4ZYS A;  2K5Q A;  4J8Q A;  5DEH A;  2EYF A;  1EEI D;  2PNR C;  3VR4 A;  2O5I C;  3PMF A;  5J39 A;  1LT6 D;  1O78 A;  4QMG A;  4DA2 A;  1PTO F;  4EQP A;  2NBF A;  1SYF A;  5IIF A;  2CHB D;  3J7Y W;  4WFN 3;  5D3I B;  4OGQ C;  3TZU A;  4J1M A;  5HGT A;  1RTO A;  3I90 A;  3BYT B;  1IW7 D;  2G9H D;  2Z1C A;  3KBG A;  5T1G A;  1LO5 D;  1TY2 A;  4HSV A;  4KK7 A;  5C4J B;  3BZD B;  5J22 A;  1S5F D;  3C46 A;  3M4Y A;  1KDA A;  3SHL A;  1CA5 A;  2E2D C;  3PUZ A;  1OXX K;  5FK9 C;  2HDL A;  2JYO A;  2JEA I;  1ILQ A;  1H9S B;  1ICW A;  1F9Q A;  2OF1 A;  1SNM A;  3MXU A;  1HCZ A;  2LMC B;  4KJO A;  2SNS A;  4NKL A;  2DNE A;  1PZI D;  1JIC A;  2F0G A;  3J7A V;  3R8B A;  1G8Z D;  1TY0 A;  2E2J B;  1KDC A;  5C3E B;  4A3B B;  5ELF A;  3MXG A;  2R7Z B;  1H9M A;  2JE6 I;  2KHS A;  3PUX A;  2K6A A;  3NWT A;  4RHS A;  1SEB D;  2SOB A;  3S1N B;  2F0U A;  3FDT A;  3HOW B;  1ENC A;  2EY5 A;  2Q8I B;  5D3D A;  3EQL C;  3HOU B;  1TWG B;  4ME5 A;  1RD9 D;  2I46 A;  2ID0 A;  1I6V C;  3K5O A;  4KTA A;  4DN4 M;  3C1E A;  3QB3 A;  3LX0 A;  4PMB A;  4FF3 A;  2B2T A;  3C1F A;  1CA6 A;  2E2H B;  4N9P A;  1GOZ A;  5EKK A;  3RMH A;  2O4X A;  5A35 A;  3X3M A;  3ND9 A;  1FR3 A;  4IUQ A;  5IGC A;  4OIK A;  4QB4 A;  1Y8P B;  2KVM A;  3A56 A;  2A6H C;  5EBC A;  5C3W A;  4NMZ A;  1H9S A;  5K36 G;  5DAU A;  1Y69 U;  2AQ1 B;  1C8C A;  1YNJ D;  1B4O A;  2EE1 A;  5C3X A;  5JJZ A;  5IGG A;  1SDF A;  3NP8 A;  2FJ2 A;  2RDF A;  3T16 A;  4XDX A;  2DN8 A;  2O2L D;  2CVR A;  1LTI D;  3TME A;  3CRK C;  1EY6 A;  1RJT A;  5EPK A;  1EWC A;  3KLS X;  2R3Z A;  1V1O A;  5FO9 B;  3S2H B;  1X3Q A;  5KYL A;  3SE0 A;  3H91 A;  3J80 L;  3BVM A;  2Y0S B;  4FNF A;  5FO7 B;  5IGF A;  3HKZ B;  3DEO A;  4IAL A;  1DZ1 A;  3S16 B;  4IFD G;  2LS0 1;  1SAP A;  4MIU A;  5C0X G;  1SYC A;  3EFX D;  3HP3 A;  4ZKB B;  1CTM A;  2F0Q A;  5FO8 B;  4CKB A;  2BA0 A;  3OOC A;  2F0S A;  2HCI A;  3BVZ A;  2SNM A;  4HMJ A;  4RGT A;  4BA1 I;  3SR1 A;  2B2Y C;  5C6A A;  1S5D D;  3EVQ A;  1VMP A;  3D6C A;  4ZRZ A;  5CMD A;  4KKT A;  3PIO 3;  2F0N A;  2JSO A;  3EA6 A;  3FVQ A;  2HDM A;  4XTC S;  1AP0 A;  2A68 D;  3HOY B;  1ESF A;  3VR2 A;  3G7L A;  4DXG A;  1JE4 A;  2L11 A;  5EKL A;  4Z9C B;  2NN6 H;  4ILW A;  3KK7 A;  5CBE E;  4N9T A;  4OL7 A;  1G91 A;  1Y1W B;  4M1U B;  4KHZ A;  1LLR D;  2K01 A;  1BUV T;  1AW7 A;  4UDU C;  5CC4 A;  2K03 A;  2VB2 X;  4A3F B;  3D31 A;  4DAV A;  3NTK A;  1Q8I A;  4TSS A;  3K58 A;  1OXS C;  1PDQ A;  2VUM B;  2F03 A;  3DWA A;  1EU3 A;  1XWE A;  3LWE A;  1IYU A;  1PFB A;  2AUJ D;  1D6E C;  2AQ3 B;  1B9N A;  1I4G A;  2KA7 A;  1F2M A;  2JXM B;  3DHQ A;  3H0G B;  3SK8 A;  3I4N B;  1BXT A;  2K5W A;  2XIW A;  1SYE A;  5JEA G;  4K8I A;  2K28 A;  5JAV A;  5G3L D;  1S5B D;  2RDG A;  2WP8 J;  1WTO A;  1HTP A;  4FO2 A;  1DJR D;  3DWQ A;  3N6R A;  3AMU A;  1J8I A;  5FKA C;  1YNN C;  3A7L A;  3GTQ B;  2D9U A;  3PUW A;  2N55 A;  2F0L A;  4H13 C;  5CYU A;  2DY8 A;  3R2T A;  3Q22 A;  1MI2 A;  4HTH A;  1A3U A;  1ONL A;  1VF7 A;  2F0F A;  2IJ0 A;  1II3 A;  2IPK D;  2B2T C;  3QWN A;  4HMI A;  1SXT A;  5KYI A;  4TQU S;  1LTT D;  1SFO B;  5ISR A;  4K5V A;  4KD4 A;  3U9S A;  5KNC A;  1HUM A;  3OIQ A;  5M3M B;  3K7A B;  4CHT B;  1LT4 D;  3MAQ A;  1DOM A;  3MXN A;  3CHB D;  2WV6 D;  3V05 A;  4C3I B;  5EPL A;  4ZUI A;  5ELE A;  2FHT A;  5IOD A;  4M8A A;  1B2T A;  4XT1 B;  2AQ2 B;  3BDC A;  4LAA A;  1M4V A;  1SNP A;  1SE2 A;  2EDG A;  4F88 A;  2KCC A;  1ENA A;  2R61 A;  1EY9 A;  5FLX E;  1CZW A;  4B9W A;  4ZLT F;  3W2D A;  1TWA B;  1ZEQ X;  4Q5V A;  3GV6 A;  2KJX A;  1XYI A;  4OO1 I;  1LT3 D;  4BY7 B;  5C4H A;  1GUS A;  5DM6 3;  1A3T A;  3OWF A;  1HPC A;  2PYK A;  3D4W A;  1SMY C;  2EYO A;  2D62 A;  5DNF A;  4FXK C;  3QJY A;  2WAQ B;  2WII B;  1VCI A;  1EL0 A;  5EBD A;  1O7L A;  4G4K A;  1FNW A;  3SK5 A;  1LTG D;  4RH6 A;  1ZYR D;  2J0T D;  4FXD A;  3CQZ B;  4CJ2 C;  4KN7 C;  2VXW A;  3GO5 A;  4I65 A;  5BN4 A;  2TSS A;  1PTO H;  1SYB A;  4WRD A;  1RTN A;  3L9A X;  2K33 A;  1TWH B;  2NWG A;  5C44 B;  4KD3 A;  1JWM D;  1S5E D;  5CGK A;  2Q8R E;  3WDN A;  4XIG S;  3TP7 A;  3U9O A;  2MUY A;  1WTV A;  2L9H A;  3X3N A;  3D4R A;  4XYQ A;  4QCL A;  1EFI D;  4I7Z C;  1MD2 D;  3NXW A;  1OO9 B;  1TS5 A;  3ZYY X;  4G7Z C;  3GTJ B;  3KLR A;  5IGD A;  5IGE A;  4H44 C;  2C9O A;  1R9T B;  3NSW A;  1BDO A;  1GUT A;  1I4P A;  1QNU A;  2BE5 D;  3OIP A;  1HFG A;  2IW3 A;  4IUN A;  4QUF A;  2YU9 B;  1AEX A;  4V19 0;  3HS0 C;  3EJI A;  1SYD A;  1T5E A;  3MA2 B;  2HUG A;  4L6T B;  3H09 A;  3GP7 A;  2PMZ B;  1L0Y B;  2M9V A;  3N52 A;  3K57 A;  3GV3 A;  3PIP 3;  2GA4 B;  2MGS A;  3I73 A;  3FPU B;  3QG1 A;  5M9O A;  2QDB A;  1HHV A;  4DAY A;  5AFW A;  1E2V A;  5ELB A;  3GTL B;  3GTK B;  4RHR A;  2M00 A;  4KI0 A;  2OXP A;  4CKC A;  1SYG A;  1ET6 A;  4G7H C;  1SNC A;  1UUP A;  4DK0 A;  1GJX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...