5ELDA

Cholera toxin classical b-pentamer in complex with a lewis-y
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
103
structure length
103
Chain Sequence
TPQNITDLCAEYHNTQIHTLNDKIFSYTESLAGKREMAIITFKNGATFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAISMAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High-Resolution Crystal Structures Elucidate the Molecular Basis of Cholera Blood Group Dependence.
pubmed doi rcsb
source organism Vibrio cholerae o1
molecule tags Toxin
molecule keywords Cholera enterotoxin B subunit
total genus 28
structure length 103
sequence length 103
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2015-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01376 Enterotoxin_b Heat-labile enterotoxin beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5eldA00
1LO5D 1HXYD 1CK1A 1I4HA 1AW7A 1T5XD 2O2LD 2ICIA 2AQ2B 2XNAC 1DYQA 2XRQD 1S5ED 1TS3A 4DXGA 2SEBD 1DJRD 2IPKD 1D6EC 1TS4A 1PZKD 1QILA 1V1OA 4RCOA 2G9HD 1KTKA 1EFID 1FNWA 1SXTA 1S5CD 3R2IA 4Z9CB 3URYA 1PTOB 3BZDB 1SE2A 1JWUD 1KLUD 1PRTF 3BVMA 3V05A 1FD7D 1TS2A 1D5ZC 3OWEB 1LT4D 1BCPF 1JWMD 1PZID 2XN9C 1LTTD 2NTTA 3DWPA 5ELCA 4RGNA 3EA6A 3BYYB 3EFXD 3GP7A 1V1PB 1SEBD 4RGMA 1PTOF 1SJHD 1JR0D 1HQRD 1XXGA 1ENFA 1L0XB 3R8BA 2XRSD 4L6TB 1F77A 1PRTB 1XTCD 1LTGD 1ESFA 1STEA 2QEJC 1TS5A 1LTID 2NTSA 4RGOS 1LLRD 1EU4A 1PYWD 1SE3A 4RGTA 4DXFA 1BCPC 1BXTA 1D5MC 1LTRD 1FNUA 4RH6A 2Z8LA 5ELDA 3MC0B 2AQ3B 2TSSA 1S5FD 1PTOD 3O13A 1I4QA 1I4PA 5FK9C 5ELBA 3BYTB 1I4RA 1UUPA 1B1ZA 3CHBD 1RCVD 3SEBA 1FGBD 1SE4A 1SBBB 1ET9A 1ET6A 5FKAC 4RHRA 5I4DA 3W2DA 2AQ1B 2QILA 4RFBA 4L63B 5ELFA 4ZYSA 5TSSA 1JCKB 1PTOC 1B44D 3DWAA 3DWQA 1AN8A 1CHPD 1CHQD 3MFGA 1RDPD 2J4XA 3BVGA 1L0YB 1EU3A 1HTLD 2RDHA 1EWCA 2R61A 5ELEA 1KLGD 1PRTD 1PTOH 1TY2A 1LT3D 1I4XA 3R2TA 1CQVA 1LTBD 2CHBD 3BVZA 1RF2D 1PZJD 1LT6D 4O1NA 1BCPD 1V1PA 1S5DD 1JWSD 1JQYD 1PRTC 1M4VA 1LT5D 4C56C 1MD2D 1BCPB 1D5XC 1LTAD 1CT1D 1FNVA 4UDUC 4BWGB 5D3DA 1EEFD 1GOZA 3KLSX 1SJED 4TSSA 1UNSA 1EEID 4OHJA 2IJ0A 1RD9D 1LTSD 1S5BD 2WV6D 3TSSA 2RDGA 5D3IB 1G8ZD 1HA5A 1I4GA 4RHSA 4K6LA 1TY0A
chains in the Genus database with same CATH superfamily
4WFN3 4JOIA 5JPNC 1Q46A 5CGKA 1TS3A 3CCLA 2JA6B 3W1BA 3CCJA 3M85A 1K8MA 4KI0A 1QZHA 2KHSA 2EPBA 4O2DA 1SXTA 3LWUA 4BBRB 4B9WA 1QUQB 5GQOA 2X6GA 2PNHA 3I4LA 1WFQA 2B2YC 4MN3A 4NP5A 4DGZA 2B39A 3DWPA 1VF5C 3GP7A 4S3SA 4A3JG 1L0XB 1SLJA 3Q8DA 1VQDA 1R4PB 4RG1A 3FPPA 4FYDA 2KENA 1UEBA 1KAWA 2HQEA 4U68A 5KIXA 1F2LA 4DK0A 3CW2C 1CSPA 4B3RL 4RGTA 1VQIA 2RSOA 4LFCQ 1EIFA 4QJFA 3ZYYX 3SK6A 2R7ZH 5JVH3 1XMOQ 1IHZA 4BY1G 1I4QA 4X6AH 1Q90A 2K5QA 5K5PA 2K52A 4YCUA 2B2VA 1I4RA 3EBEA 5FJ8H 3CMAA 3FHWA 3OYYA 5I2XA 3H94A 3AFQA 1WD1A 2YTYA 4L5RC 1GUTA 4DR3L 4ME5A 3QIAA 4LF4Q 2E2HB 2RHQB 3E3XA 2KVMA 3CRKC 1OXUA 2F03A 2N55A 1BBXC 1N33L 4J1MA 4DR7L 1HTLD 2B2WC 5C4JH 3KJOA 1XJVA 3MHBA 1F9QA 1RF2D 4RKBA 1IL2A 3KK7A 3A5UA 3FP9A 1N33Q 3S1RB 4IFDH 2B2TA 5M3MG 1HR0L 4A3GH 1NR4A 4DK1A 5D3DA 2WAQG 2ZJPA 1E1TA 4QCLA 4FF4A 4EQNA 1OXSC 3I4MG 2M2LA 4BS9A 1HZCA 2O4XA 3K81C 3TDQA 1HA5A 4OONA 3PMFA 2XGTA 1HR0W 4IOCA 3QB3A 3G71A 4GN3B 2UUCQ 2XRQD 5C4JB 3T13A 3JAML 5BN3A 4YIJA 4LF6Q 2NVYB 2G9HD 2F4VQ 2BE5C 4NPSA 1FNWA 2NVQB 5KYIA 5FLMH 1JOOA 2H4OA 3OTOQ 2UUBQ 3SGIA 3PIO3 1JOQA 1PRTF 3TZDA 3KBXA 4LF7L 4CJ2C 2JEAI 1ICFB 4BY1H 1V1PB 2EYMA 2FXQA 1JR0D 3SK8A 1HZ9A 1I6VC 2QEXA 1Y1VG 2IWHA 1XX8A 5CORA 4DR3Q 4BBRH 1D7QA 2Q2IA 1WTVA 3HOWB 4XQJA 2M9VA 5CV9A 4I65A 4AQYQ 2Z6KA 3J81i 4KY6A 1BBWA 1KABA 2JA6H 2L4NA 3ULLA 3HOXG 4IUNA 1Y14B 1KL9A 1VQHA 1MBYA 2WB1E 3VYRA 3SK4A 4NKLA 4N8FA 1SE4A 1KC8C 3VR2A 2RHSB 5E4WC 4A3GG 4ID6A 4DV0L 2F0WA 3DWAA 2A69D 1NTGA 4RA8A 3BVGA 4A3BG 5T1GA 1S72A 5LL6S 2NWGA 2WFWA 5C6AA 3RZOH 3A7LA 1BO0A 1B2TA 5HGQA 1WVLA 2PI2A 4CJ1B 4A3KG 5EPLA 5CBEE 2B63G 1Z6HA 1LTBD 4B3TQ 3NK9A 1MJEA 4CKEA 2MHVA 2EIFA 5FLXc 4P72A 3AEVA 2A6HD 2E2JB 1X54A 4JI5L 1YI2A 1S3OA 4B3SL 3HKZG 1YJWA 3RZOB 4Y7NH 4UDUC 5E3FA 3PCOB 2BOSA 1K83H 3PGZA 2Q8TA 2R93H 3PV0A 5JJLA 2HUGA 4JBJA 1SNPA 3SVMA 2A5HA 1EYCA 4B3SQ 4JI5Q 2NN6I 2PW7A 4FDBA 3J80L 4DV3L 5HURA 2JYOA 3GTMB 4LFBQ 2E2JH 3VYTA 2DN8A 1YVCA 2EY5A 2E2IH 4UP9A 2F0KA 1STGA 2IPKD 2RKSA 2HHHQ 1QNKA 1O7IA 4ODGA 4DR2Q 2VQEL 2K01A 5C3EG 2EJMA 2QDBA 1TQOA 3ND8A 2I5MX 4C2MH 2F4IA 3A56A 2LMCB 1D5ZC 3I8ZA 1K9MC 1IYJB 1LACA 2N3SA 3TS0A 1C9OA 1YNND 3I4NG 2XRSD 3RD4A 4L8JA 4KHZA 3S1QH 3WDNA 1R9TH 3E0JA 2KJXA 1E2ZA 2B2UA 4N9TA 3HRZC 4A3FB 1J5EQ 3T16A 3H6MA 3H15A 1AH9A 2QDLA 3O13A 4GOPB 1VQ8A 2NVQH 4HIMA 4EVOA 1EZ6A 2EXZA 3BYTB 1UUPA 4AIMA 2XVSA 1FGBD 3STBD 1K8OA 1X9NA 1SE8A 4RAUC 1HR0Q 5CYUA 3W3AA 2Z6BA 1NMFA 5TSSA 1JCKB 5C44G 5A35A 3BZKA 2LKVA 3MEHA 2HT1A 1YHAA 4FNFA 1L0YB 1PYSB 3HOVB 5M5XB 1QNUA 2D0PA 2VUMG 2PZUA 4A3DG 4A3GB 5JJIA 2WINB 3QWNA 1Y1VB 1CA6A 4V190 3CMEA 4QL5A 5IOCA 3K5OA 2F4VL 2GVBA 5IGEA 3OW2A 1DXMA 2QCPX 1PH1A 2HHHL 4UY8C 5IP7H 5JJKA 4DUZL 4R4IA 3HOXB 3F2CA 3GTMH 3A8JE 2MUYA 1GUOA 3G4SA 3OTOL 1A6XA 1BVSA 5CV6A 2SNMA 2OTJA 1TU2B 4HCSA 1E7ZA 2Z6KC 3N52A 4UP7A 3NELA 4TQUS 2CW0D 2I5LX 3U50C 1TY0A 3DXJC 1STBA 3F2DA 1R9TB 1MKHA 5CR3A 1ZYRD 3X3NA 4LW1A 4LUOA 2ZTDA 2Y0SE 4A3CH 3F8TA 3UE0A 5C3XA 3K59A 1BF4A 1IKLA 4QGUA 3J81E 1KIXA 3R2IA 1RIPA 1SNMA 2F0TA 3MWYW 1V43A 5EKIA 2QGQA 1N34L 4R9WA 3BVMA 1A3TA 3GTKB 4BBSB 3PO3B 3HKZE 2XN9C 2NTTA 4X3KA 5AJ3Q 3GTOH 2EJGC 5DLQE 4ABNA 1A63A 2B29A 1SAPA 4HSVA 1PTOF 2K5HA 4LF9L 4XQQA 4NDXA 4CDEC 1XPOA 1GKHA 1STEA 3EN2A 5I9PA 4O0AA 1WTOA 1C0AA 4ULLA 4GOPA 4QQBX 2L11A 3BJUA 4JI0Q 4RKLA 3I4NB 5IYCH 4A3DH 2CH4A 2NYZD 3IL8A 3RMHA 4BXXG 3M4QA 2IHEA 3DM1A 1QE6A 2I46A 2XWJB 2PQAB 3DHQA 1SMYD 3Q23A 4G7OC 5CV4A 3K80C 3RLNA 2O5IC 1ML0D 4Y7NB 2Q2TA 1EQVA 1UE7A 3DMUA 1SBBB 1VQ5A 1YJ9A 1RJTA 4QY7A 3W2DA 4JG2A 1SYEA 2OF1A 3I91A 2J7ZA 3GD7A 4K6DA 1EY7A 2OTLA 4IPGA 4WJ4A 1B44D 3F2BA 1EYDA 3STBC 4LUVA 2CFMA 3G48A 5A2QL 2N49A 1VQKA 1B9NA 4ZAIA 2A6ED 1TY2A 4OO1I 3HOWH 4OWXB 4K8IA 1LT6D 2HQLA 4H02A 1PRTC 1SNQA 2R92B 5KRUA 4BY1B 1Q7YC 3AFPA 4C56C 1S40A 4MHEA 3OHXC 5JEAG 4BWGB 1FNVA 1WYDA 4KJNA 3SDZA 4FO2A 3PIPA 1DZ1A 2PMZB 4DA2A 3KLSX 4IUUA 1NCVA 4BY7G 3TSSA 5C4HA 2WB1B 2NZ1D 4HEDA 1UAPA 4XT3B 2HCIA 5IY0A 2XNAC 3K0XA 4C3IG 3S1RH 1DYQA 1W3SA 1U4LA 1OTCA 4DR6L 1EWIA 1Q8KA 3VR5A 1EWHA 2QA4A 4LMQD 1KTKA 4IQZA 5IT9L 1STYA 3HOZB 5COYA 1X32A 2B2YA 1VQAA 4DNTB 2KCNA 3CP0A 1H95A 1OXTA 4FXDA 2FFKB 2CCZA 2JSOA 5EKKA 4JW0A 3KF8A 3X3MA 4HN7A 2R6GA 1J9OA 1XTCD 2XSCA 3NSWA 3PUZA 1A3UA 2CKZB 1TS5A 4JOIC 4IUPA 3M7GA 4ILWA 2JE6I 2Q8IB 3FKIB 4DV5Q 4K0KQ 5J39A 2Y0SG 1L0WA 1HHVA 4DV4L 4A3JB 3S1NB 2SDFA 4LF5Q 1CFMA 2FMMA 4JI2L 3RLFA 2E2HH 1X3FA 4KHPQ 1HFGA 1LTLA 5IGFA 4Q5VA 1F2MA 4KTAA 4B3RQ 1FJGL 4R4OA 1VQMA 5JEAH 1L1OC 2QILA 3GDEA 4RFBA 3K57A 2PYKA 4JI4Q 5EKLA 2AKWB 3RLOA 2NVTH 5G3LD 2OT2A 3OPOA 4IUQA 3DWQA 5T1IA 2KHJA 1UWVA 1FL0A 4OX9L 2BCOA 3NTKA 2WAQE 4RMFA 2K5VA 1ENAA 1I3QB 4EGVA 1KRTA 4ZUIA 1BR9A 4DK3C 1EIGA 1S5DD 1E22A 1N32Q 5C4XH 2PQEA 1HNZL 2F0HA 3QJYA 1RODA 3ND9A 1LT5D 1BNZA 2EYHA 1BCPB 3K5MA 1D5XC 3TP7A 2JQOA 4AYBB 3GTJH 2M00A 2G5DA 3I2ZA 1TWCH 1TVXA 1O78A 2V1CC 3HOZG 5EAYA 3CCUA 4FF2A 1S5BD 3VR4A 1JT8A 3NWSA 1E2VA 4HJAA 3BS1A 2K7VA 2MO0A 3CCRA 1CK1A 4DV1L 4C1NI 3VR6A 1C4QA 4IFDG 1VQCA 1HTPA 1D6EC 5EQ0A 4YWMA 4X3SA 2R7FA 1V1OA 2K5NA 4DAMA 2PO4A 3KBGA 2ZTCA 3KF6A 1S5CD 3TP6A 1QWYA 1DOMA 3NEMA 3A5ZB 4EQOA 2F1MA 3I4MH 4A3EH 4DUYQ 3KDFA 2C5CA 2JEBI 2IW3A 3FRPB 3OWEB 4Y52H 3H0GH 4DR5Q 1BCPF 2Z0SA 4CBVA 4K8JA 1SEBD 2K03A 2E2DC 3PF5A 1SJHD 1F9PA 5BN4A 4C3IB 2NVYH 2F0MA 4JBWA 2UUBL 4DAPA 3NHHA 1B53A 2C9OA 2WB1G 1QVGA 3HS0C 4A4IA 1SYDA 3JAMi 4DUYL 4DNRB 1PFSA 1QUQA 3D6CA 1X3EA 2VQEQ 1E3PA 4X64L 1HNXQ 2ZM6L 4RCNA 1YBYA 3J81j 1YITA 4RWSC 4YY3Q 2NBFA 1PTOD 1WCMB 2OQ0A 1RTOA 4LNQA 4WORA 3D3RA 3ZJYC 2ASBA 4KN7C 5FO7B 2F0QA 2K05A 4KJOA 3TP5A 4A3KH 3KFUA 2K50A 4X65L 4QF4A 2Q2UA 1V9PA 3KLSA 2SNSA 4HIDA 3T1HL 3MZ5A 1I6HH 2JA6G 4N8X1 1PTOC 1KRSA 4LF8L 1K0RA 2KQ3A 1CHQD 3MFGA 2FINB 2NUCA 3HOXH 1J5EL 4LK1C 2VW9A 1BOSA 4KKSA 1U9RA 2AWOA 1STHA 2RF4A 3BVZA 3GQBA 3A8KE 1Z9FA 4DV4Q 4DV1Q 5BN5A 3N6RA 5M5YH 4NW2A 3U9SA 2DJFC 1J8IA 2JP1A 4GLVB 5KNCA 5AFWA 4C3JB 1WTXA 1EEFD 5EGTA 3SK5A 3T51B 4A3MB 3C1FA 5I6YA 4PNYA 2F0SA 1UEAB 5IYDG 4DR1Q 3WOEA 4B3MQ 3NQIA 3C1EA 1KDAA 4KY5A 3SE0A 1G2TA 3I90A 4GZYC 4KMUC 3K5NA 2O2LD 3A55A 4FXKC 1KNAA 1ZYRC 1TS4A 1PH8A 1MHWC 2MP1A 4OEMB 1ICWA 5M5WH 3CCVA 2I0QA 4B9XA 2AWNA 1SYCA 4Z9CB 1O7YA 1XWEA 3HOUG 3BZDB 5IYBG 2JK8A 4GLXA 3E9HA 3V05A 2CW0C 1FD7D 4KHPL 1Q82C 1HA6A 5ELCA 1LUZA 3OMGA 2A19A 1L1OA 4J6HA 1VQOA 1N36L 1JOKA 3NTHA 4XYQA 2KOLA 1CI3M 1JB7A 2MFIA 3A0JA 1WTQA 2Z1CA 4PZ6A 2FJ2A 5IT9c 1BQQT 2VXWA 2WACA 1U4PA 4DR7Q 1C7YA 1DD2A 4DK6C 4GKKL 1MIUA 5CBAE 4POFA 4DNIA 5C44H 2UUCL 3MXGA 5FO9B 4WJ3M 3V2TA 4C3HB 1U4RA 3EVQA 4APVA 1TWFH 1B1ZA 3CHBD 4DAYA 1B70B 2YU9H 2RCFA 2VZAA 4JYAQ 2NN6G 5J3BA 3VDYA 5IP9H 4JI3Q 2L15A 4XYOA 1Y1WG 3CCSA 3VA5A 2CWPA 1NR2A 1VQPA 3GTQB 2BDNA 3J7AF 4OL7A 2BE5D 3OW7A 1A0IA 1SNOA 4DV5L 4K0KL 1ILQA 3S14B 1SYFA 3R2TA 5IYDH 3PQIA 3G7LA 1X3GA 4KY7A 5ELNA 4A3MG 1IBKQ 1JMCA 2UXCQ 2EDGA 1WTPA 3GTKH 1WCMG 2HIXA 2UU9L 4X62L 1M8AA 2K28A 3HOUH 4CJ0B 4A3LG 2PNRC 4A3CG 3CQZH 1VQGA 3ULPA 1LTAD 2E75C 3A74A 3EROA 1EQQA 3GTLB 1C8CA 3FPUB 3JC66 5C3EB 3HEJA 2VB3X 4BA1I 1H9JA 1TR5A 3UDGA 3P75A 4K14A 2A68C 2LS01 3H91A 1SFOH 1EFWA 1I4GA 3FKIH 1JJ2A 4QUFA 1DM0B 2EYFA 1P8LA 1K8GA 1X6OA 1ESRA 2AQ2B 1X3PA 1N34Q 2E5LL 4ME3A 1Y1WB 4QMGA 1IYUA 4NXNL 1IBML 4MTKA 4CHTB 2F0FA 3HG9A 3M4PA 1PFMA 4KK7A 1YJNA 3M3YH 2JA7G 4MZ9A 3KDFB 2EZVA 1H9MA 2F0UA 1SSOA 2JXMB 3D8GA 4GOPC 3FMCA 1XPUA 1PZID 2B3GA 2NZOA 3W5OA 4EX5A 3DM3A 4CGYB 1V1QA 4DV2L 3R8BA 3NXWA 1TKWB 4L6TB 4HR7B 1A3VA 5M5XH 2OEOA 2QEJC 4JI1Q 4EQPA 1P16A 5C0XH 3PF4A 4ZK9B 1MJCA 2C35B 1EOTA 2O5JC 4Q0FA 3GTGB 3AU7A 3S15B 4UAIA 1C48A 2OWOA 4PQXA 4JI0L 1N9WA 3H0GG 1B3QA 1DOKA 1EY6A 1AEXA 4A76A 3MXPA 3KOJA 2JN4A 1NJIC 1B50A 1I5FA 3C46A 4NXMQ 3FVQA 4PG3A 1VQNA 4BA2I 1D1IA 3CC2A 4X64Q 1AE3A 1NY4A 4PMBA 1KNEA 2R61A 5E1FA 2ZXRA 1HCZA 4BY7H 3U9OA 4XIGS 3HOYB 3U58A 4YY3L 2F0JA 3DLLA 3KJPA 1ZKOA 1IBMQ 2MNAA 4NXNQ 2Q8RE 2I5HA 1UE5A 2R3ZA 5K36H 1QOHA 2K33A 5FLXE 1HZBA 1CT1D 4YCVA 1IYVA 2WP8J 4A3IH 3BG3A 3U4ZA 3OIQA 2J0TD 3HOWG 2WV6D 3P7JA 2JA9A 5IWAL 1G8ZD 3HZXA 4XDXA 1MSHA 3MAQA 5IGCA 1HXYD 1RL2A 1SFOB 4LWCA 1T5XD 3KF8B 1YEZA 1OXXK 1YZ6A 1JE4A 4LF9Q 4PMWA 2FHTA 2R93B 5JAVA 3NPPA 5C0XG 1KDBA 2IX0A 1XTDA 4GNXA 5KGUA 1NUCA 2XTIA 3PUYA 1PH5A 4DF7A 2NVXH 1YNXA 1K3BC 3IFDA 4DV7Q 1U5KA 2L12A 5M3MB 1JWMD 2IX1A 2NVTB 4NB3A 3D0FA 2BDOA 1TWGB 2Y0SB 4DV7L 1YNJD 1ASYA 3EJIA 1HRJA 1IBLQ 1LTID 5FLMG 3LX0A 2JA5H 4U673 3QO2A 4KV6A 3J80E 1F9SA 3JAMc 1H9KA 1W6KA 1BXTA 3B6YA 5IIFA 4FF1A 4DR2L 1JJGA 2VUMH 1TT2A 3K6OA 2L5TA 1QJOA 1Y8NB 3TP8A 2F0NA 4K5WA 4JBMA 1EZ8A 3TBIB 1NMGA 1E24A 1IKMA 1A2UA 3J81L 5FKAC 3JAME 1NNXA 3MEFA 3K8AA 2B8GA 3D6WA 4JI6Q 1Y1VH 3NWTA 3D4DA 1I50H 3A54A 4PZ7A 4C1NK 2KCCA 2DUDA 4XQNA 2F3IA 2WKCA 4KD4A 2XIWA 4F8MA 1EUJA 4JI6L 4HAEA 3HOZH 1D8LA 4UPAA 1CSQA 1J6QA 1Q1BA 3J7A5 2YTXA 2N8NA 1GJXA 1JORA 3S15H 5LHY1 2K1BA 1FVIA 1NSNS 2KA7A 1VQ6A 4A3BH 4WJWA 1HFNA 2F0OA 5JEAJ 2ZXPA 4TSSA 3OWFA 4LF6L 4O42A 2PMZE 4G57A 4OHJA 4IN3A 2KUMA 2D0OA 4DV2Q 3K7AB 4UP8A 4QIWE 2HD3A 3SR1A 5JPMC 1IW7D 2L1BA 3GTGH 4DN4M 2E74C 3Q6SA 2NB0A 4A3MH 4DR5L 1QILA 4C3JH 3H09A 1EOVA 4RCOA 4YCWA 2UUAQ 1E0BA 1WJJA 3NBIA 2JA8G 1GUWA 5M3FG 4IJLA 1CTMA 4DV6L 1CKOA 3Q22A 4JI2Q 5L37A 3S17H 1D2BA 3MXUA 1HZAA 3ITPA 4LFAQ 3TZUA 2K4KA 1A2TA 2F0GA 1QVFA 3G6JB 4PV1C 4DAYB 1L1OB 1AZPA 4DAVA 4WRDA 4OWTB 5IWAQ 2EYLA 1Q86C 2D2CC 2PPBC 1EU4A 1SE3A 2LY7A 2BA1A 2GN5A 1JC7A 1BCPC 1O80A 2K75A 5HY6A 1SRUA 5ELDA 2A69C 1RKNA 1B3AA 4JC0A 2LXKA 4P71A 1F2YA 4CDFC 1AFPA 4NMZA 3T53B 5IGDA 5H1SE 2KHIA 1YIJA 1Z47A 2K6AA 3UE1A 4FVMA 5M3MH 5IGGA 1LYLA 2EYOA 4K2KA 2A1AA 5ELFA 5C5MA 2R7ZB 2EXDA 1PH4A 3NQTA 5KNBA 3GTOB 1CHPD 4IUVA 2B2TC 1VQBA 3KLWA 3FDTA 2IT1A 3J7YW 4HMIA 3HOYH 5ELEA 1X56A 3ER0A 4TKOB 1CQVA 1B4OA 4A93H 1CM9A 1WD0A 3UDFA 1CKNA 2RCNA 3I3CA 4G7ZC 1A15A 1VCIA 1XMOL 5I6WA 3GTQH 3Q24A 4A3EB 1JWSD 2RSNA 4C3HH 5KNDA 3DEOA 1VDZA 3UI2A 3S9WA 2B2WA 5CV8A 1ONLA 3BDOA 3CC7A 4OO1G 5M3FH 1XNRQ 2F52A 4JCVE 2RQXA 4CKCA 3A8IE 1GOZA 5D65A 2YU9B 3KF6B 1CKMA 5LMNL 1BBUA 1LV9A 1TIID 3TS2A 1XPRA 4ZKCB 2AUKA 4DXGA 2SEBD 4ZKBB 1DJRD 1TWCB 3E0EA 1SMYC 5DAUA 4PMCA 4E6IA 5DM63 2ES2A 2GA4B 4H0LC 4J8QA 4DFAA 3D31A 4A93B 1PTOB 2PI2E 4HMJA 3PUXA 4H7BA 5BR8Q 4JI7L 2JA7B 2D62A 1Q12A 1XMQQ 1QB5D 1SNCA 2F0DA 3TEHB 1LTTD 2EY1A 4RGNA 3H3VI 1GXDC 4A3FG 4GS3A 1WTRA 4OWWB 3J80i 3S2HB 1G6ZA 5C0XJ 5C4ZA 4HCEA 3NENA 4M8AA 2AUJD 5BR8L 4A75A 2UXDL 1LLRD 3K5LA 1K8AC 3RZDB 2P5ZX 5J22A 2H5XA 3S17B 5IP9G 1QVCA 1EYAA 3BU2A 3AQQA 4QUCA 2AMCB 1Y1WH 4RH6A 2Z8LA 4JI3L 1GHJA 2MO1A 2AQ3B 1BDOA 5FK9C 5AJ3L 5ELBA 3T56B 1PFBA 1Y69U 2ZJRA 5FO8B 4KLKA 2OXPA 3SEBA 4DU9A 5LL6X 2B63B 1X65A 4DR4Q 2SOBA 4LJZC 2AHOB 4CDCC 4A3JH 3M4OB 2A74C 1MGSA 1PXUA 4OO1H 4KKUA 4JI1L 1EQRA 4L63B 4X3TA 3RR5A 2OQKA 4AH6A 4C3HG 4L5SA 2MJ8A 4V0BA 3NBHA 2K32A 1WTHA 4CDDC 1O7LA 1Q3LA 2RDHA 2Z4IA 1EWCA 2TMPA 2R7ZG 5LMNQ 1VQ4A 1B9MA 1PTOH 3VYSA 2Z4HA 4DR1L 4B3ML 2VY3A 5JJZA 2K04A 1PZJD 2A8VA 1BCPD 3J7ZC 3S16H 5C3EH 3AYHB 3I73A 5GROA 4A3EG 2OCEA 1GM5A 2PZTA 4DV6Q 2F0VA 3HOUB 5EPJA 1H9SA 2CWAA 1DOLA 4A3KB 1IBLL 1LTSD 1M1KC 4FXGC 4JI7Q 3HOVG 4DUZQ 3IRBA 3NE5B 1I4HA 1AW7A 4R4CA 1N36Q 5C44B 4GKJQ 3ERQA 2ICEC 3MTSA 3KUPA 4ALPA 3GTJB 2WIIB 2KCMA 2F0LA 3I4MB 3BDCA 4GKKQ 4ZQ3A 1HNWL 3K7UC 4LAAA 1IW7C 3E6ZX 3OOCA 1SE2A 2E76C 1HUNA 4OELB 4IUTA 4P2CB 2ALYB 1PDQA 5NUCA 1GUSA 4TRDA 5GADC 3EFXD 1I50B 1ENFA 1OXVA 3T1HQ 2MPMA 1HNWQ 1KQSA 4JYAL 1PVOA 1LABA 1NE3A 4GLAC 4IPDA 3CC4A 2UXBL 1Q8IA 1D5MC 1G291 2LFNA 2QF7A 3MC0B 4P74A 4X66L 2F0IA 4B3TL 1Q81C 3DUZA 3PIOA 1T5EA 3MVVA 4MTNA 1DONA 3PUVA 5IP7G 1RCVD 1OO9B 5LMNW 3S1MH 1ET9A 4OIKA 2MGSA 1UE1A 1SROA 1VQEA 4FF3A 1EY9A 1AN8A 1LM0A 2KECA 1VF7A 4YHHL 4R4QA 2J4XA 1CA5A 4N9PA 3K0YA 1EU3A 2RBMA 4JBKA 1F2ZA 1KLGD 2HDMA 3P20A 3RN2A 3V96A 1CKNB 1X55A 4M1UB 2DNEA 2XWBB 2K5WA 4YHHQ 1U0LA 1G6PA 3ONAB 1EY8A 2DGYA 1FGUA 4XT1B 1FR3A 4IALA 4B08A 1RTNA 3CXCA 1JB3A 5EBDA 4IURA 3WOFA 1SJED 5CV5A 4R8NA 1UNSA 4F7XA 2IJ0A 1HH2P 5C3WA 1ENCA 2RDGA 4DKAC 1AP0A 3RZDH 2FMCA 4A3BB 1LO5D 2QW7A 3R3OA 1PH7A 3OSOA 5E4XA 1N32L 2JJQA 3S1NH 3GTPH 3TRZA 1WI5A 3G6EA 3LNNA 3ERSX 1ZXTA 1M90C 3RUZA 1MI2A 2HCCA 1KLUD 1E2WA 4DR6Q 1DGSA 1TS2A 3VYUA 4L5QA 4BXXH 4X66Q 2R93G 3C3LA 3BYYB 2YTVA 3QG1A 1EY5A 1VQ7A 1HPCA 1T9HA 2NN6H 1STAA 1XYIA 4DV3Q 2YV5A 5GAEC 3S2DH 4LFBL 3AB9A 1E1OA 3J81c 3T1YL 1EQTA 1I94Q 4GNXB 1PYWD 1PH3A 3MXNA 2PQAA 3L0OA 3BDLA 4IOAA 1VMCA 4NXML 1L2FA 2EYJA 4R1JA 1LTRD 1FNUA 2R92H 2MQHA 3TN2A 1STNA 4I7AA 4LF7Q 1EY4A 1K3RA 1IBKL 5D14A 1Q1EA 1Z7TA 3PO2H 3M3YB 1H9RA 2BH2A 5CMDA 1VQLA 2K14A 5M3FB 4TVAB 3L9AX 1KDCA 1GUGA 4OXPA 3CU7A 4JK1C 4A3FH 3H0GB 2JA5G 1ASZA 3I4NH 5JVG3 4LF5L 1SN8A 4GN4B 4IPCA 1AZQA 1X3QA 2LXJA 3R93A 5IE8A 1HNZQ 3C2PA 3AMUA 3J7AV 3FKIG 3HGBA 2ZJQA 3GTLH 1TWHH 1YHBA 2NVXB 2JA5B 1Y8PB 2F0EA 4PZ8A 5GAHC 2ID0A 3PUWA 2WAQB 3I72A 2CVRA 4BBSH 2KCTA 2ZT9C 3LWEA 5EPKA 2VB2X 1U4MA 3I7FA 3H3VH 1XMQL 3S14H 1EYGA 2L55A 1VMPA 2F3WA 3W1GA 3CKIB 1TWAH 2ZXOA 4J15A 1EEID 1YHQA 4G7HC 1EIHA 3CCQA 3S1MB 5C4XB 4JV5L 2JA8H 1JE5A 2ATWA 1Y8OB 5LMUQ 2VUMB 5CC4A 4K6LA 1PH9A 2IX3A 4OGQC 1B7YB 2ICIA 2DJGC 1S5ED 3GV6A 3TQYA 1QG7A 4ZCKA 1PLFA 4K5VA 1TWAB 2UXCL 3L3OC 2VNUD 1I94L 2CQOA 4JV5Q 4F88A 4DR4L 3H3VC 1JWUD 1SMXA 1O7ZA 3PO2G 3HFZB 1LT4D 2A68D 2R92G 1VS0A 3VR3A 2PZWA 2X6LA 3HOVH 3QOLA 4GN5A 1WOCA 1W6JA 3SHLA 3U4VA 2N78A 5A2QE 5F2DA 3T4AC 3NP8A 4BY7B 4RGOS 5FOBB 3K7AH 2QKIC 4P73A 4QB4A 4DPGA 1V8QA 5E7NA 2DNCA 2PW5A 4OX9Q 2A6EC 4IFDI 3CCEA 1W2BA 2EYPA 1I4PA 4BBSG 4A3IB 4AQYL 5IODA 4BBRG 4A93G 1GD7A 4RHRA 5I4DA 5K36G 2LSSA 2AQ1B 3CAMA 3TMEA 2IY5B 1BUVT 5KEEA 3S16B 1CQFA 3D4WA 1GUNA 3E9IA 2EY6A 3S2DB 5IYCG 2DY8A 3T1YQ 5LMUL 3UDIA 2Z9HA 4R8IA 3MFYA 5DEHA 1XNRL 2CHBD 4O1NA 1XNQQ 3GO5A 1V1PA 4C2MB 2I07B 4GNXC 2BH8A 2YYZA 3CPFA 3WWVA 3PO3G 1MD2D 1CZGA 2EVBA 4HSPA 2PCFB 3TREA 2UUAL 3HOYG 4IFDJ 4ZUJA 1HQMC 1K73C 3GTPB 2Q2HA 3M7NA 3M4OH 1RD9D 2B63H 3F1ZA 4XXEA 4LFAL 4KD3A 1G2SA 1NBWA 1S4ZA 4A3LH 3HP3A 4X62Q 4KHVA 1PV4A 1PZKD 2B8FA 4LFCL 1WTWA 1TWGH 5DM73 4HJ5A 1WCMH 3PSIA 3S1QB 3I4OA 2HIVA 1DCZA 1KXLA 5DNFA 4K5XA 1EL0A 5EJWA 1B8AA 1IZ6A 2ZTEA 1SDFA 4P75A 1ZEQX 2WKDA 2L9HA 3S2HH 3CQZB 2EOTA 4JI8L 4IJHA 1G51A 4ZLTF 4RGMA 2EJFC 1HQRD 1XXGA 1KD1C 1HUMA 4H44C 4KN4C 3CPWA 1NAPA 2RVLA 3CD6A 4LF4L 1SYBA 2JA7H 1ESFA 1ILPA 3IKJA 2KBNA 1GO3E 4C3IH 4X65Q 2NTSA 3CCMA 4A3DB 3L7ZC 2D9UA 4DXFA 4LF8Q 3CF5A 3NUCA 1BKBA 1CUKA 4L5TA 1YNJC 4YWLA 4R4TA 3I55A 1JJCB 1II3A 2L0CA 3HKSA 2VQFL 1GHKA 1QZGA 3E5SA 1A8VA 3BZCA 5EBCA 1K83B 3PO3H 1G91A 1TWFB 3NTIA 4OIJA 1MSGA 2B2UC 4ZYSA 1KAAA 1K28A 3CRLC 1PMRA 2GVAA 4KKTA 4YWKA 1TWHB 1TXYA 2DY7A 3D4RA 3A7AB 2EY2A 1LT3D 3DEPA 5M5WB 2NZHA 3IAYA 2KEEA 4F87A 4C3JG 3HKZB 5GAGC 1KHIA 5G3LF 3M4YA 1SNDA 3LGJA 4HIOA 3PO2B 5IYBH 3SXHA 4HTHA 1EIYB 2IL8A 3EQLC 1AE2A 2F0PA 2B2VC 4XTCS 4POGA 3IFTA 5ISRA 4JI8Q 4RHSA 3MA2B 2BA0A 3ICEA 1CZWA 4AYBE 2R7DA 5M5YB 1VQJA 3FEWX 4IZ8A 3P1HA 4FP5D 1PA6A 1UE6A 2E8GA 3KYHC 1HNXL 1HJPA 3UDXA 1VQ9A 1N8RC 1EFID 2K5DA 5JOBA 1GVPA 5C4XG 1I3QH 3URYA 2G9DA 2RA4A 1PH2A 2KEDA 5C5LA 2F3VA 4AYBG 4A3IG 2VL6A 2VQFQ 3QOJA 1H9SB 4HJ9A 1IXRA 3EA6A 2A6HC 5M9OA 3RNUA 2UXBQ 1F9RA 3OIPA 1VQFA 3EIVA 1F77A 1PRTB 3KLRA 5KYLA 1PYBA 4K2LA 3GV3A 1LTGD 2EE1A 2H1EA 4HJ8A 3M9BA 3OMCA 5HGTA 2EQSA 1R4QB 5CV7A 1SYGA 2D5DA 1SR3A 1RHPA 2VS1A 4X3UA 4LUZA 5FLXL 2CQAA 3K58A 3S24A 3I70A 5ELOA 4CKBA 4HIKA 2TSSA 1S5FD 5I9OA 1XNQL 4JVZA 3NBHB 1I6HB 4QIWB 3F2UA 1PFNA 2ENBA 1QCBD 1IL8A 1YNNC 1ET6A 5IGBA 4UHVA 4IO9A 1JICA 4H13C 5IT9E 2UU9Q 3RN5A 3L2PA 1RDPD 2RDFA 4MNOA 5C0XI 1A62A 1PHJA 2E2IB 4MIUA 5FJ8G 4EQ5A 2IHFA 2A73B 2UXDQ 1PRTD 4HJ7A 2ZM6Q 1I4XA 1PH6A 1K0SA 3PIP3 1FJGQ 4GKJL 4ZRZA 3ULJA 3J80c 1JQYD 3VA7A 2V4DA 1M4VA 2E5LQ 4IPHA 4G4KA 1EY0A 1FYCA 4JI4L 2N88A 2JA8B 2CH4W 4I7ZC 3Q0AA 4DV0Q 2HDLA 5I2YA 3MXNB 3I56A 2X69A 4JPBW 5J1ZA 5D3IB 1D1KA 3QR8A
chains in the Genus database with same CATH topology
4WFN3 5JPNC 5CGKA 1TS3A 2JA6B 3M85A 1K8MA 4KI0A 2KHSA 2EPBA 1SXTA 3LWUA 4BBRB 4B9WA 2X6GA 3I4LA 2B2YC 4MN3A 4NP5A 4DGZA 2B39A 3DWPA 1VF5C 3GP7A 4S3SA 1L0XB 1R4PB 3FPPA 4FYDA 2HQEA 4U68A 5KIXA 1F2LA 4DK0A 4RGTA 2RSOA 3ZYYX 3SK6A 5JVH3 1IHZA 1I4QA 1Q90A 2K5QA 5K5PA 2B2VA 1I4RA 5I2XA 3H94A 1WD1A 1GUTA 4ME5A 3QIAA 2E2HB 2KVMA 3CRKC 1OXUA 2F03A 2N55A 1BBXC 4J1MA 1HTLD 2B2WC 3MHBA 1F9QA 1RF2D 4RKBA 3KK7A 3S1RB 4IFDH 2B2TA 1NR4A 4DK1A 5D3DA 4QCLA 4FF4A 4EQNA 1OXSC 2M2LA 4BS9A 2O4XA 3TDQA 1HA5A 3PMFA 3QB3A 2XRQD 5C4JB 3T13A 3JAML 5BN3A 4YIJA 2NVYB 2G9HD 2BE5C 1FNWA 2NVQB 5KYIA 1JOOA 2H4OA 3PIO3 1JOQA 1PRTF 3TZDA 3KBXA 4CJ2C 2JEAI 1V1PB 2EYMA 1JR0D 3SK8A 1I6VC 2IWHA 1XX8A 5CORA 1WTVA 3HOWB 4XQJA 2M9VA 5CV9A 4I65A 4KY6A 1KABA 2L4NA 4IUNA 1MBYA 3VYRA 3SK4A 4NKLA 1SE4A 3VR2A 5E4WC 4ID6A 2F0WA 3DWAA 2A69D 4RA8A 3BVGA 5T1GA 5LL6S 2NWGA 5C6AA 3A7LA 1BO0A 1B2TA 1WVLA 4CJ1B 5EPLA 5CBEE 1Z6HA 1LTBD 3NK9A 4CKEA 2MHVA 2A6HD 2E2JB 3RZOB 4UDUC 5E3FA 2BOSA 2Q8TA 3PV0A 2HUGA 1SNPA 3SVMA 2A5HA 1EYCA 2NN6I 2PW7A 3J80L 5HURA 2JYOA 3GTMB 3VYTA 2DN8A 2EY5A 2F0KA 1STGA 2IPKD 2RKSA 1QNKA 4ODGA 2K01A 2EJMA 2QDBA 1TQOA 3ND8A 2F4IA 3A56A 2LMCB 1D5ZC 3I8ZA 1LACA 1YNND 2XRSD 3RD4A 4L8JA 4KHZA 3WDNA 3E0JA 2KJXA 1E2ZA 2B2UA 4N9TA 3HRZC 4A3FB 3T16A 3H6MA 3O13A 4EVOA 1EZ6A 2EXZA 3BYTB 1UUPA 2XVSA 1FGBD 1K8OA 4RAUC 5CYUA 3W3AA 5TSSA 1JCKB 5A35A 3MEHA 2LKVA 4FNFA 1L0YB 3HOVB 5M5XB 1QNUA 2PZUA 4A3GB 2WINB 3QWNA 1Y1VB 1CA6A 4V190 5IOCA 3K5OA 5IGEA 1DXMA 2QCPX 3HOXB 3A8JE 2MUYA 1GUOA 1A6XA 5CV6A 2SNMA 1TU2B 4HCSA 3N52A 4TQUS 2CW0D 1TY0A 3DXJC 1STBA 1R9TB 5CR3A 1ZYRD 3X3NA 5C3XA 3K59A 1BF4A 1IKLA 3J81E 3R2IA 1SNMA 2F0TA 3MWYW 5EKIA 1V43A 4R9WA 3BVMA 1A3TA 3GTKB 4BBSB 3PO3B 2XN9C 2NTTA 4X3KA 2EJGC 4ABNA 1SAPA 4HSVA 1PTOF 4XQQA 4NDXA 1STEA 5I9PA 1WTOA 4ULLA 2L11A 4RKLA 3I4NB 2NYZD 3IL8A 3RMHA 3DM1A 1QE6A 2I46A 2XWJB 3DHQA 1SMYD 3Q23A 4G7OC 5CV4A 2O5IC 1ML0D 4Y7NB 1EQVA 3DMUA 1SBBB 1RJTA 3W2DA 1SYEA 2OF1A 3I91A 2J7ZA 3GD7A 4K6DA 1EY7A 1B44D 1EYDA 5A2QL 1B9NA 4ZAIA 2A6ED 1TY2A 4OO1I 4K8IA 1LT6D 1PRTC 1SNQA 2R92B 5KRUA 4BY1B 4C56C 4MHEA 3OHXC 5JEAG 4BWGB 1FNVA 4KJNA 3SDZA 4FO2A 1DZ1A 2PMZB 4DA2A 3KLSX 4IUUA 1NCVA 3TSSA 5C4HA 2WB1B 2NZ1D 4HEDA 1UAPA 4XT3B 2HCIA 2XNAC 4C3IG 1DYQA 1U4LA 3VR5A 1EWHA 4LMQD 1KTKA 4IQZA 5IT9L 1STYA 3HOZB 5COYA 1X32A 2B2YA 4DNTB 2KCNA 1OXTA 4FXDA 2FFKB 2JSOA 5EKKA 3KF8A 3X3MA 4HN7A 2R6GA 1J9OA 1XTCD 2XSCA 3NSWA 3PUZA 1A3UA 1TS5A 4IUPA 3M7GA 4ILWA 2JE6I 2Q8IB 3FKIB 5J39A 1HHVA 4A3JB 3S1NB 2SDFA 1CFMA 2FMMA 3RLFA 1HFGA 5IGFA 4Q5VA 1F2MA 4KTAA 5JEAH 2QILA 4RFBA 3K57A 2PYKA 5EKLA 5G3LD 2OT2A 3OPOA 4IUQA 3DWQA 5T1IA 2BCOA 3NTKA 1ENAA 1I3QB 4EGVA 4ZUIA 1BR9A 1EIGA 1S5DD 2PQEA 2F0HA 3QJYA 1RODA 3ND9A 1LT5D 1BNZA 2EYHA 1BCPB 3K5MA 1D5XC 3TP7A 4AYBB 2M00A 1TVXA 1O78A 4FF2A 1S5BD 3VR4A 3NWSA 1E2VA 3BS1A 2K7VA 1CK1A 4C1NI 3VR6A 1C4QA 4IFDG 1HTPA 1D6EC 5EQ0A 4X3SA 1V1OA 2PO4A 3KBGA 1S5CD 3TP6A 1QWYA 1DOMA 4EQOA 2F1MA 2C5CA 2JEBI 2IW3A 3FRPB 3OWEB 1BCPF 4CBVA 4K8JA 1SEBD 2K03A 2E2DC 1SJHD 1F9PA 5BN4A 4C3IB 2F0MA 4JBWA 4DAPA 3NHHA 1B53A 2C9OA 3HS0C 1SYDA 4DNRB 3D6CA 4RCNA 4RWSC 2NBFA 1PTOD 1WCMB 1RTOA 4WORA 3D3RA 4KN7C 5FO7B 2F0QA 2K05A 4KJOA 3TP5A 4QF4A 3KLSA 2SNSA 3MZ5A 1PTOC 2KQ3A 1CHQD 3MFGA 2FINB 2NUCA 4LK1C 1BOSA 4KKSA 1U9RA 2AWOA 1STHA 3BVZA 3GQBA 3A8KE 5BN5A 3N6RA 4NW2A 3U9SA 1J8IA 2JP1A 5KNCA 5AFWA 4C3JB 1WTXA 1EEFD 5EGTA 3T51B 3SK5A 4A3MB 3C1FA 5I6YA 4PNYA 2F0SA 1UEAB 3WOEA 3NQIA 3C1EA 1KDAA 4KY5A 3SE0A 1G2TA 3I90A 4GZYC 4KMUC 3K5NA 2O2LD 3A55A 4FXKC 1KNAA 1ZYRC 1TS4A 2MP1A 1ICWA 4B9XA 4Z9CB 2AWNA 1SYCA 1O7YA 1XWEA 3BZDB 3V05A 2CW0C 1FD7D 1HA6A 5ELCA 3OMGA 4J6HA 1JOKA 3NTHA 4XYQA 2KOLA 1CI3M 1WTQA 2Z1CA 2FJ2A 1BQQT 2VXWA 2WACA 1U4PA 1DD2A 5CBAE 3MXGA 5FO9B 3V2TA 4C3HB 1U4RA 3EVQA 1B1ZA 3CHBD 4DAYA 2NN6G 4XYOA 3VA5A 1NR2A 3GTQB 2BDNA 3J7AF 4OL7A 2BE5D 3OW7A 1SNOA 1ILQA 3S14B 1SYFA 3R2TA 3G7LA 4KY7A 2EDGA 1WTPA 1M8AA 2K28A 4CJ0B 2PNRC 1LTAD 2E75C 3EROA 3GTLB 1C8CA 3FPUB 5C3EB 3HEJA 2VB3X 4BA1I 1H9JA 1TR5A 3P75A 4K14A 2A68C 2LS01 3H91A 1I4GA 4QUFA 1DM0B 2EYFA 1ESRA 2AQ2B 1X3PA 1Y1WB 4QMGA 1IYUA 4CHTB 2F0FA 3HG9A 1PFMA 4KK7A 2EZVA 1H9MA 2F0UA 1SSOA 2JXMB 3D8GA 3FMCA 1PZID 4CGYB 3R8BA 3NXWA 1TKWB 4L6TB 4HR7B 1A3VA 2OEOA 2QEJC 4EQPA 5C0XH 4ZK9B 1EOTA 2O5JC 4Q0FA 3GTGB 3AU7A 3S15B 4UAIA 1C48A 4PQXA 1DOKA 1EY6A 1AEXA 3MXPA 1B50A 3C46A 3FVQA 4BA2I 1D1IA 4PMBA 1KNEA 2R61A 5E1FA 2ZXRA 1HCZA 3U9OA 4XIGS 3HOYB 2F0JA 1ZKOA 2Q8RE 2R3ZA 5K36H 1QOHA 2K33A 5FLXE 1CT1D 1IYVA 2WP8J 3BG3A 3OIQA 2J0TD 2WV6D 3P7JA 1G8ZD 3HZXA 4XDXA 1MSHA 3MAQA 5IGCA 1HXYD 1SFOB 1T5XD 1OXXK 1JE4A 4PMWA 2FHTA 2R93B 5JAVA 3NPPA 5C0XG 1KDBA 2IX0A 5KGUA 1NUCA 3PUYA 4DF7A 3IFDA 2L12A 5M3MB 1JWMD 2IX1A 2NVTB 2BDOA 1TWGB 2Y0SB 1YNJD 3EJIA 1HRJA 1LTID 3LX0A 4U673 3QO2A 4KV6A 3J80E 1F9SA 1H9KA 1W6KA 1BXTA 5IIFA 4FF1A 1TT2A 3K6OA 2L5TA 1QJOA 1Y8NB 3TP8A 2F0NA 4K5WA 1EZ8A 3TBIB 1IKMA 1A2UA 3J81L 5FKAC 3JAME 2B8GA 3D6WA 3NWTA 3D4DA 3A54A 4C1NK 2KCCA 4XQNA 2WKCA 4KD4A 2XIWA 4F8MA 4HAEA 1Q1BA 1GJXA 1JORA 5LHY1 2K1BA 1NSNS 2KA7A 4WJWA 1HFNA 2F0OA 5JEAJ 2ZXPA 4TSSA 3OWFA 4O42A 4G57A 4OHJA 4IN3A 2KUMA 3K7AB 3SR1A 5JPMC 1IW7D 2L1BA 4DN4M 2E74C 3Q6SA 2NB0A 1QILA 3H09A 4RCOA 1E0BA 3NBIA 1GUWA 1CTMA 3Q22A 1D2BA 3MXUA 3ITPA 3TZUA 1A2TA 2F0GA 3G6JB 4PV1C 1AZPA 4DAVA 4WRDA 2EYLA 2D2CC 2PPBC 1EU4A 1SE3A 2LY7A 2BA1A 1JC7A 1BCPC 1O80A 5ELDA 2A69C 1RKNA 1B3AA 1F2YA 1AFPA 4NMZA 3T53B 5IGDA 1Z47A 2K6AA 4FVMA 5IGGA 2EYOA 4K2KA 5C5MA 5ELFA 2R7ZB 3NQTA 5KNBA 3GTOB 1CHPD 4IUVA 2B2TC 3FDTA 2IT1A 3J7YW 4HMIA 5ELEA 4TKOB 1CQVA 1B4OA 1CM9A 1WD0A 3I3CA 4G7ZC 1A15A 1VCIA 5I6WA 3Q24A 4A3EB 1JWSD 2RSNA 5KNDA 3DEOA 1VDZA 3UI2A 3S9WA 2B2WA 5CV8A 1ONLA 3BDOA 4OO1G 2RQXA 4CKCA 3A8IE 1GOZA 5D65A 2YU9B 1LV9A 1TIID 4ZKCB 2AUKA 4DXGA 2SEBD 4ZKBB 1DJRD 1TWCB 1SMYC 5DAUA 4PMCA 4E6IA 5DM63 2GA4B 4H0LC 4J8QA 4DFAA 3D31A 4A93B 1PTOB 4HMJA 3PUXA 4H7BA 2JA7B 2D62A 1Q12A 1QB5D 1SNCA 2F0DA 1LTTD 2EY1A 4RGNA 1GXDC 1WTRA 3S2HB 1G6ZA 5C0XJ 5C4ZA 4HCEA 4M8AA 2AUJD 1LLRD 3K5LA 3RZDB 5J22A 3S17B 1EYAA 4QUCA 4RH6A 2Z8LA 1GHJA 2AQ3B 1BDOA 5FK9C 5ELBA 3T56B 1PFBA 1Y69U 5FO8B 2OXPA 3SEBA 4DU9A 5LL6X 2B63B 2SOBA 4LJZC 3M4OB 2A74C 1MGSA 1PXUA 4OO1H 4KKUA 4L63B 4X3TA 4C3HG 2MJ8A 4V0BA 3NBHA 2K32A 1O7LA 1Q3LA 2RDHA 2Z4IA 1EWCA 2TMPA 1B9MA 3VYSA 1PTOH 2Z4HA 5JJZA 2K04A 1PZJD 1BCPD 3I73A 2PZTA 2F0VA 3HOUB 5EPJA 1H9SA 1DOLA 4A3KB 1LTSD 4FXGC 3NE5B 1I4HA 1AW7A 5C44B 3ERQA 2ICEC 3MTSA 3KUPA 3GTJB 2WIIB 2F0LA 3I4MB 3BDCA 4ZQ3A 4LAAA 1IW7C 3E6ZX 3OOCA 1SE2A 2E76C 1HUNA 4IUTA 4P2CB 1PDQA 5NUCA 1GUSA 4TRDA 3EFXD 1I50B 1ENFA 1OXVA 2MPMA 1LABA 1Q8IA 1D5MC 1G291 2LFNA 2QF7A 3MC0B 2F0IA 3DUZA 1T5EA 3MVVA 1DONA 3PUVA 1RCVD 1OO9B 1ET9A 4OIKA 2MGSA 4FF3A 1EY9A 1AN8A 2KECA 1VF7A 2J4XA 1CA5A 4N9PA 3K0YA 1EU3A 2RBMA 1F2ZA 1KLGD 2HDMA 3P20A 3V96A 4M1UB 2DNEA 2XWBB 2K5WA 3ONAB 1EY8A 4XT1B 1FR3A 4IALA 4B08A 1RTNA 1JB3A 5EBDA 4IURA 3WOFA 1SJED 5CV5A 4R8NA 1UNSA 4F7XA 2IJ0A 5C3WA 1ENCA 2RDGA 1AP0A 2FMCA 4A3BB 1LO5D 3R3OA 3OSOA 5E4XA 3LNNA 1ZXTA 3RUZA 1MI2A 2HCCA 1KLUD 1E2WA 1TS2A 3VYUA 3C3LA 3BYYB 3QG1A 1EY5A 1HPCA 2NN6H 1STAA 1XYIA 3AB9A 1EQTA 1PYWD 3MXNA 3BDLA 1VMCA 2EYJA 1LTRD 1FNUA 3TN2A 1STNA 1EY4A 5D14A 1Q1EA 1Z7TA 3M3YB 1H9RA 5CMDA 5M3FB 3L9AX 1KDCA 1GUGA 3CU7A 4JK1C 3H0GB 5JVG3 1AZQA 1X3QA 3R93A 3C2PA 3AMUA 3J7AV 3HGBA 2NVXB 2JA5B 1Y8PB 2F0EA 2ID0A 3PUWA 2WAQB 3I72A 2CVRA 2ZT9C 3LWEA 5EPKA 2VB2X 1U4MA 2L55A 1VMPA 2F3WA 3CKIB 2ZXOA 1EEID 4G7HC 1EIHA 5C4XB 3S1MB 1Y8OB 2VUMB 5CC4A 4K6LA 2IX3A 4OGQC 2ICIA 1S5ED 3GV6A 1QG7A 1PLFA 4K5VA 1TWAB 3L3OC 2VNUD 4F88A 3H3VC 1JWUD 1O7ZA 1LT4D 2A68D 3VR3A 2PZWA 2X6LA 3QOLA 1W6JA 3SHLA 5A2QE 5F2DA 3T4AC 3NP8A 4BY7B 4RGOS 5FOBB 2QKIC 4QB4A 1V8QA 2DNCA 2PW5A 2A6EC 4IFDI 2EYPA 1I4PA 4A3IB 5IODA 4RHRA 5I4DA 5K36G 2AQ1B 3TMEA 1BUVT 5KEEA 3S16B 1CQFA 3D4WA 1GUNA 2EY6A 3S2DB 2DY8A 4R8IA 3MFYA 5DEHA 2CHBD 4O1NA 3GO5A 1V1PA 4C2MB 2I07B 2YYZA 1MD2D 1CZGA 2EVBA 4HSPA 2PCFB 4IFDJ 4ZUJA 1HQMC 3M7NA 3GTPB 1RD9D 4XXEA 4KD3A 1G2SA 1S4ZA 3HP3A 4KHVA 1PZKD 2B8FA 1WTWA 5DM73 3S1QB 1DCZA 5DNFA 4K5XA 1EL0A 5EJWA 1SDFA 1ZEQX 2WKDA 2L9HA 3CQZB 2EOTA 4ZLTF 4RGMA 2EJFC 1HQRD 1XXGA 1HUMA 4H44C 4KN4C 1NAPA 2RVLA 1ILPA 1SYBA 1ESFA 3IKJA 2NTSA 4A3DB 3L7ZC 2D9UA 4DXFA 3NUCA 1YNJC 1II3A 2L0CA 1GHKA 3E5SA 5EBCA 1K83B 1G91A 1TWFB 3NTIA 4OIJA 1MSGA 2B2UC 4ZYSA 1KAAA 3CRLC 1PMRA 4KKTA 1TWHB 2DY7A 3D4RA 3A7AB 2EY2A 1LT3D 3DEPA 5M5WB 3IAYA 2KEEA 4F87A 4C3JG 3HKZB 5G3LF 3M4YA 1SNDA 3PO2B 3SXHA 4HTHA 2IL8A 3EQLC 2F0PA 2B2VC 4XTCS 3IFTA 5ISRA 4RHSA 3MA2B 2BA0A 1CZWA 5M5YB 3FEWX 4IZ8A 3P1HA 4FP5D 1EFID 2K5DA 5JOBA 3URYA 2G9DA 2RA4A 2KEDA 5C5LA 2F3VA 3QOJA 1H9SB 3EA6A 2A6HC 5M9OA 1F9RA 3OIPA 3KLRA 5KYLA 1F77A 1PRTB 4K2LA 3GV3A 1LTGD 2EE1A 2H1EA 3OMCA 5HGTA 1R4QB 5CV7A 1SYGA 2D5DA 1RHPA 4X3UA 5FLXL 2CQAA 3K58A 3I70A 4CKBA 2TSSA 1S5FD 5I9OA 1I6HB 4QIWB 3F2UA 1PFNA 2ENBA 1QCBD 1IL8A 1YNNC 1ET6A 5IGBA 1JICA 4H13C 5IT9E 1RDPD 2RDFA 5C0XI 2E2IB 4MIUA 2A73B 1PRTD 1I4XA 3PIP3 4ZRZA 1JQYD 3VA7A 2V4DA 1M4VA 4G4KA 1EY0A 1FYCA 2N88A 2JA8B 4I7ZC 3Q0AA 2HDLA 5I2YA 2X69A 5J1ZA 5D3IB 1D1KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LO5 D;  1HXY D;  1CK1 A;  1I4H A;  1AW7 A;  1T5X D;  2O2L D;  2ICI A;  2AQ2 B;  2XNA C;  1DYQ A;  2XRQ D;  1S5E D;  1TS3 A;  4DXG A;  2SEB D;  1DJR D;  2IPK D;  1D6E C;  1TS4 A;  1PZK D;  1QIL A;  1V1O A;  4RCO A;  2G9H D;  1KTK A;  1EFI D;  1FNW A;  1SXT A;  1S5C D;  3R2I A;  4Z9C B;  3URY A;  1PTO B;  3BZD B;  1SE2 A;  1JWU D;  1KLU D;  1PRT F;  3BVM A;  3V05 A;  1FD7 D;  1TS2 A;  1D5Z C;  3OWE B;  1LT4 D;  1BCP F;  1JWM D;  1PZI D;  2XN9 C;  1LTT D;  2NTT A;  3DWP A;  5ELC A;  4RGN A;  3EA6 A;  3BYY B;  3EFX D;  3GP7 A;  1V1P B;  1SEB D;  4RGM A;  1PTO F;  1SJH D;  1JR0 D;  1HQR D;  1XXG A;  1ENF A;  1L0X B;  3R8B A;  2XRS D;  4L6T B;  1F77 A;  1PRT B;  1XTC D;  1LTG D;  1ESF A;  1STE A;  2QEJ C;  1TS5 A;  1LTI D;  2NTS A;  4RGO S;  1LLR D;  1EU4 A;  1PYW D;  1SE3 A;  4RGT A;  4DXF A;  1BCP C;  1BXT A;  1D5M C;  1LTR D;  1FNU A;  4RH6 A;  2Z8L A;  5ELD A;  3MC0 B;  2AQ3 B;  2TSS A;  1S5F D;  1PTO D;  3O13 A;  1I4Q A;  1I4P A;  5FK9 C;  5ELB A;  3BYT B;  1I4R A;  1UUP A;  1B1Z A;  3CHB D;  1RCV D;  3SEB A;  1FGB D;  1SE4 A;  1SBB B;  1ET9 A;  1ET6 A;  5FKA C;  4RHR A;  5I4D A;  3W2D A;  2AQ1 B;  2QIL A;  4RFB A;  4L63 B;  5ELF A;  4ZYS A;  5TSS A;  1JCK B;  1PTO C;  1B44 D;  3DWA A;  3DWQ A;  1AN8 A;  1CHP D;  1CHQ D;  3MFG A;  1RDP D;  2J4X A;  3BVG A;  1L0Y B;  1EU3 A;  1HTL D;  2RDH A;  1EWC A;  2R61 A;  5ELE A;  1KLG D;  1PRT D;  1PTO H;  1TY2 A;  1LT3 D;  1I4X A;  3R2T A;  1CQV A;  1LTB D;  2CHB D;  3BVZ A;  1RF2 D;  1PZJ D;  1LT6 D;  4O1N A;  1BCP D;  1V1P A;  1S5D D;  1JWS D;  1JQY D;  1PRT C;  1M4V A;  1LT5 D;  4C56 C;  1MD2 D;  1BCP B;  1D5X C;  1LTA D;  1CT1 D;  1FNV A;  4UDU C;  4BWG B;  5D3D A;  1EEF D;  1GOZ A;  3KLS X;  1SJE D;  4TSS A;  1UNS A;  1EEI D;  4OHJ A;  2IJ0 A;  1RD9 D;  1LTS D;  1S5B D;  2WV6 D;  3TSS A;  2RDG A;  5D3I B;  1G8Z D;  1HA5 A;  1I4G A;  4RHS A;  4K6L A;  1TY0 A; 
#chains in the Genus database with same CATH topology
 4WFN 3;  4JOI A;  5JPN C;  1Q46 A;  5CGK A;  1TS3 A;  3CCL A;  2JA6 B;  3W1B A;  3CCJ A;  3M85 A;  1K8M A;  4KI0 A;  1QZH A;  2KHS A;  2EPB A;  4O2D A;  1SXT A;  3LWU A;  4BBR B;  4B9W A;  1QUQ B;  5GQO A;  2X6G A;  2PNH A;  3I4L A;  1WFQ A;  2B2Y C;  4MN3 A;  4NP5 A;  4DGZ A;  2B39 A;  3DWP A;  1VF5 C;  3GP7 A;  4S3S A;  4A3J G;  1L0X B;  1SLJ A;  3Q8D A;  1VQD A;  1R4P B;  4RG1 A;  3FPP A;  4FYD A;  2KEN A;  1UEB A;  1KAW A;  2HQE A;  4U68 A;  5KIX A;  1F2L A;  4DK0 A;  3CW2 C;  1CSP A;  4B3R L;  4RGT A;  1VQI A;  2RSO A;  4LFC Q;  1EIF A;  4QJF A;  3ZYY X;  3SK6 A;  2R7Z H;  5JVH 3;  1XMO Q;  1IHZ A;  4BY1 G;  1I4Q A;  4X6A H;  1Q90 A;  2K5Q A;  5K5P A;  2K52 A;  4YCU A;  2B2V A;  1I4R A;  3EBE A;  5FJ8 H;  3CMA A;  3FHW A;  3OYY A;  5I2X A;  3H94 A;  3AFQ A;  1WD1 A;  2YTY A;  4L5R C;  1GUT A;  4DR3 L;  4ME5 A;  3QIA A;  4LF4 Q;  2E2H B;  2RHQ B;  3E3X A;  2KVM A;  3CRK C;  1OXU A;  2F03 A;  2N55 A;  1BBX C;  1N33 L;  4J1M A;  4DR7 L;  1HTL D;  2B2W C;  5C4J H;  3KJO A;  1XJV A;  3MHB A;  1F9Q A;  1RF2 D;  4RKB A;  1IL2 A;  3KK7 A;  3A5U A;  3FP9 A;  1N33 Q;  3S1R B;  4IFD H;  2B2T A;  5M3M G;  1HR0 L;  4A3G H;  1NR4 A;  4DK1 A;  5D3D A;  2WAQ G;  2ZJP A;  1E1T A;  4QCL A;  4FF4 A;  4EQN A;  1OXS C;  3I4M G;  2M2L A;  4BS9 A;  1HZC A;  2O4X A;  3K81 C;  3TDQ A;  1HA5 A;  4OON A;  3PMF A;  2XGT A;  1HR0 W;  4IOC A;  3QB3 A;  3G71 A;  4GN3 B;  2UUC Q;  2XRQ D;  5C4J B;  3T13 A;  3JAM L;  5BN3 A;  4YIJ A;  4LF6 Q;  2NVY B;  2G9H D;  2F4V Q;  2BE5 C;  4NPS A;  1FNW A;  2NVQ B;  5KYI A;  5FLM H;  1JOO A;  2H4O A;  3OTO Q;  2UUB Q;  3SGI A;  3PIO 3;  1JOQ A;  1PRT F;  3TZD A;  3KBX A;  4LF7 L;  4CJ2 C;  2JEA I;  1ICF B;  4BY1 H;  1V1P B;  2EYM A;  2FXQ A;  1JR0 D;  3SK8 A;  1HZ9 A;  1I6V C;  2QEX A;  1Y1V G;  2IWH A;  1XX8 A;  5COR A;  4DR3 Q;  4BBR H;  1D7Q A;  2Q2I A;  1WTV A;  3HOW B;  4XQJ A;  2M9V A;  5CV9 A;  4I65 A;  4AQY Q;  2Z6K A;  3J81 i;  4KY6 A;  1BBW A;  1KAB A;  2JA6 H;  2L4N A;  3ULL A;  3HOX G;  4IUN A;  1Y14 B;  1KL9 A;  1VQH A;  1MBY A;  2WB1 E;  3VYR A;  3SK4 A;  4NKL A;  4N8F A;  1SE4 A;  1KC8 C;  3VR2 A;  2RHS B;  5E4W C;  4A3G G;  4ID6 A;  4DV0 L;  2F0W A;  3DWA A;  2A69 D;  1NTG A;  4RA8 A;  3BVG A;  4A3B G;  5T1G A;  1S72 A;  5LL6 S;  2NWG A;  2WFW A;  5C6A A;  3RZO H;  3A7L A;  1BO0 A;  1B2T A;  5HGQ A;  1WVL A;  2PI2 A;  4CJ1 B;  4A3K G;  5EPL A;  5CBE E;  2B63 G;  1Z6H A;  1LTB D;  4B3T Q;  3NK9 A;  1MJE A;  4CKE A;  2MHV A;  2EIF A;  5FLX c;  4P72 A;  3AEV A;  2A6H D;  2E2J B;  1X54 A;  4JI5 L;  1YI2 A;  1S3O A;  4B3S L;  3HKZ G;  1YJW A;  3RZO B;  4Y7N H;  4UDU C;  5E3F A;  3PCO B;  2BOS A;  1K83 H;  3PGZ A;  2Q8T A;  2R93 H;  3PV0 A;  5JJL A;  2HUG A;  4JBJ A;  1SNP A;  3SVM A;  2A5H A;  1EYC A;  4B3S Q;  4JI5 Q;  2NN6 I;  2PW7 A;  4FDB A;  3J80 L;  4DV3 L;  5HUR A;  2JYO A;  3GTM B;  4LFB Q;  2E2J H;  3VYT A;  2DN8 A;  1YVC A;  2EY5 A;  2E2I H;  4UP9 A;  2F0K A;  1STG A;  2IPK D;  2RKS A;  2HHH Q;  1QNK A;  1O7I A;  4ODG A;  4DR2 Q;  2VQE L;  2K01 A;  5C3E G;  2EJM A;  2QDB A;  1TQO A;  3ND8 A;  2I5M X;  4C2M H;  2F4I A;  3A56 A;  2LMC B;  1D5Z C;  3I8Z A;  1K9M C;  1IYJ B;  1LAC A;  2N3S A;  3TS0 A;  1C9O A;  1YNN D;  3I4N G;  2XRS D;  3RD4 A;  4L8J A;  4KHZ A;  3S1Q H;  3WDN A;  1R9T H;  3E0J A;  2KJX A;  1E2Z A;  2B2U A;  4N9T A;  3HRZ C;  4A3F B;  1J5E Q;  3T16 A;  3H6M A;  3H15 A;  1AH9 A;  2QDL A;  3O13 A;  4GOP B;  1VQ8 A;  2NVQ H;  4HIM A;  4EVO A;  1EZ6 A;  2EXZ A;  3BYT B;  1UUP A;  4AIM A;  2XVS A;  1FGB D;  3STB D;  1K8O A;  1X9N A;  1SE8 A;  4RAU C;  1HR0 Q;  5CYU A;  3W3A A;  2Z6B A;  1NMF A;  5TSS A;  1JCK B;  5C44 G;  5A35 A;  3BZK A;  2LKV A;  3MEH A;  2HT1 A;  1YHA A;  4FNF A;  1L0Y B;  1PYS B;  3HOV B;  5M5X B;  1QNU A;  2D0P A;  2VUM G;  2PZU A;  4A3D G;  4A3G B;  5JJI A;  2WIN B;  3QWN A;  1Y1V B;  1CA6 A;  4V19 0;  3CME A;  4QL5 A;  5IOC A;  3K5O A;  2F4V L;  2GVB A;  5IGE A;  3OW2 A;  1DXM A;  2QCP X;  1PH1 A;  2HHH L;  4UY8 C;  5IP7 H;  5JJK A;  4DUZ L;  4R4I A;  3HOX B;  3F2C A;  3GTM H;  3A8J E;  2MUY A;  1GUO A;  3G4S A;  3OTO L;  1A6X A;  1BVS A;  5CV6 A;  2SNM A;  2OTJ A;  1TU2 B;  4HCS A;  1E7Z A;  2Z6K C;  3N52 A;  4UP7 A;  3NEL A;  4TQU S;  2CW0 D;  2I5L X;  3U50 C;  1TY0 A;  3DXJ C;  1STB A;  3F2D A;  1R9T B;  1MKH A;  5CR3 A;  1ZYR D;  3X3N A;  4LW1 A;  4LUO A;  2ZTD A;  2Y0S E;  4A3C H;  3F8T A;  3UE0 A;  5C3X A;  3K59 A;  1BF4 A;  1IKL A;  4QGU A;  3J81 E;  1KIX A;  3R2I A;  1RIP A;  1SNM A;  2F0T A;  3MWY W;  1V43 A;  5EKI A;  2QGQ A;  1N34 L;  4R9W A;  3BVM A;  1A3T A;  3GTK B;  4BBS B;  3PO3 B;  3HKZ E;  2XN9 C;  2NTT A;  4X3K A;  5AJ3 Q;  3GTO H;  2EJG C;  5DLQ E;  4ABN A;  1A63 A;  2B29 A;  1SAP A;  4HSV A;  1PTO F;  2K5H A;  4LF9 L;  4XQQ A;  4NDX A;  4CDE C;  1XPO A;  1GKH A;  1STE A;  3EN2 A;  5I9P A;  4O0A A;  1WTO A;  1C0A A;  4ULL A;  4GOP A;  4QQB X;  2L11 A;  3BJU A;  4JI0 Q;  4RKL A;  3I4N B;  5IYC H;  4A3D H;  2CH4 A;  2NYZ D;  3IL8 A;  3RMH A;  4BXX G;  3M4Q A;  2IHE A;  3DM1 A;  1QE6 A;  2I46 A;  2XWJ B;  2PQA B;  3DHQ A;  1SMY D;  3Q23 A;  4G7O C;  5CV4 A;  3K80 C;  3RLN A;  2O5I C;  1ML0 D;  4Y7N B;  2Q2T A;  1EQV A;  1UE7 A;  3DMU A;  1SBB B;  1VQ5 A;  1YJ9 A;  1RJT A;  4QY7 A;  3W2D A;  4JG2 A;  1SYE A;  2OF1 A;  3I91 A;  2J7Z A;  3GD7 A;  4K6D A;  1EY7 A;  2OTL A;  4IPG A;  4WJ4 A;  1B44 D;  3F2B A;  1EYD A;  3STB C;  4LUV A;  2CFM A;  3G48 A;  5A2Q L;  2N49 A;  1VQK A;  1B9N A;  4ZAI A;  2A6E D;  1TY2 A;  4OO1 I;  3HOW H;  4OWX B;  4K8I A;  1LT6 D;  2HQL A;  4H02 A;  1PRT C;  1SNQ A;  2R92 B;  5KRU A;  4BY1 B;  1Q7Y C;  3AFP A;  4C56 C;  1S40 A;  4MHE A;  3OHX C;  5JEA G;  4BWG B;  1FNV A;  1WYD A;  4KJN A;  3SDZ A;  4FO2 A;  3PIP A;  1DZ1 A;  2PMZ B;  4DA2 A;  3KLS X;  4IUU A;  1NCV A;  4BY7 G;  3TSS A;  5C4H A;  2WB1 B;  2NZ1 D;  4HED A;  1UAP A;  4XT3 B;  2HCI A;  5IY0 A;  2XNA C;  3K0X A;  4C3I G;  3S1R H;  1DYQ A;  1W3S A;  1U4L A;  1OTC A;  4DR6 L;  1EWI A;  1Q8K A;  3VR5 A;  1EWH A;  2QA4 A;  4LMQ D;  1KTK A;  4IQZ A;  5IT9 L;  1STY A;  3HOZ B;  5COY A;  1X32 A;  2B2Y A;  1VQA A;  4DNT B;  2KCN A;  3CP0 A;  1H95 A;  1OXT A;  4FXD A;  2FFK B;  2CCZ A;  2JSO A;  5EKK A;  4JW0 A;  3KF8 A;  3X3M A;  4HN7 A;  2R6G A;  1J9O A;  1XTC D;  2XSC A;  3NSW A;  3PUZ A;  1A3U A;  2CKZ B;  1TS5 A;  4JOI C;  4IUP A;  3M7G A;  4ILW A;  2JE6 I;  2Q8I B;  3FKI B;  4DV5 Q;  4K0K Q;  5J39 A;  2Y0S G;  1L0W A;  1HHV A;  4DV4 L;  4A3J B;  3S1N B;  2SDF A;  4LF5 Q;  1CFM A;  2FMM A;  4JI2 L;  3RLF A;  2E2H H;  1X3F A;  4KHP Q;  1HFG A;  1LTL A;  5IGF A;  4Q5V A;  1F2M A;  4KTA A;  4B3R Q;  1FJG L;  4R4O A;  1VQM A;  5JEA H;  1L1O C;  2QIL A;  3GDE A;  4RFB A;  3K57 A;  2PYK A;  4JI4 Q;  5EKL A;  2AKW B;  3RLO A;  2NVT H;  5G3L D;  2OT2 A;  3OPO A;  4IUQ A;  3DWQ A;  5T1I A;  2KHJ A;  1UWV A;  1FL0 A;  4OX9 L;  2BCO A;  3NTK A;  2WAQ E;  4RMF A;  2K5V A;  1ENA A;  1I3Q B;  4EGV A;  1KRT A;  4ZUI A;  1BR9 A;  4DK3 C;  1EIG A;  1S5D D;  1E22 A;  1N32 Q;  5C4X H;  2PQE A;  1HNZ L;  2F0H A;  3QJY A;  1ROD A;  3ND9 A;  1LT5 D;  1BNZ A;  2EYH A;  1BCP B;  3K5M A;  1D5X C;  3TP7 A;  2JQO A;  4AYB B;  3GTJ H;  2M00 A;  2G5D A;  3I2Z A;  1TWC H;  1TVX A;  1O78 A;  2V1C C;  3HOZ G;  5EAY A;  3CCU A;  4FF2 A;  1S5B D;  3VR4 A;  1JT8 A;  3NWS A;  1E2V A;  4HJA A;  3BS1 A;  2K7V A;  2MO0 A;  3CCR A;  1CK1 A;  4DV1 L;  4C1N I;  3VR6 A;  1C4Q A;  4IFD G;  1VQC A;  1HTP A;  1D6E C;  5EQ0 A;  4YWM A;  4X3S A;  2R7F A;  1V1O A;  2K5N A;  4DAM A;  2PO4 A;  3KBG A;  2ZTC A;  3KF6 A;  1S5C D;  3TP6 A;  1QWY A;  1DOM A;  3NEM A;  3A5Z B;  4EQO A;  2F1M A;  3I4M H;  4A3E H;  4DUY Q;  3KDF A;  2C5C A;  2JEB I;  2IW3 A;  3FRP B;  3OWE B;  4Y52 H;  3H0G H;  4DR5 Q;  1BCP F;  2Z0S A;  4CBV A;  4K8J A;  1SEB D;  2K03 A;  2E2D C;  3PF5 A;  1SJH D;  1F9P A;  5BN4 A;  4C3I B;  2NVY H;  2F0M A;  4JBW A;  2UUB L;  4DAP A;  3NHH A;  1B53 A;  2C9O A;  2WB1 G;  1QVG A;  3HS0 C;  4A4I A;  1SYD A;  3JAM i;  4DUY L;  4DNR B;  1PFS A;  1QUQ A;  3D6C A;  1X3E A;  2VQE Q;  1E3P A;  4X64 L;  1HNX Q;  2ZM6 L;  4RCN A;  1YBY A;  3J81 j;  1YIT A;  4RWS C;  4YY3 Q;  2NBF A;  1PTO D;  1WCM B;  2OQ0 A;  1RTO A;  4LNQ A;  4WOR A;  3D3R A;  3ZJY C;  2ASB A;  4KN7 C;  5FO7 B;  2F0Q A;  2K05 A;  4KJO A;  3TP5 A;  4A3K H;  3KFU A;  2K50 A;  4X65 L;  4QF4 A;  2Q2U A;  1V9P A;  3KLS A;  2SNS A;  4HID A;  3T1H L;  3MZ5 A;  1I6H H;  2JA6 G;  4N8X 1;  1PTO C;  1KRS A;  4LF8 L;  1K0R A;  2KQ3 A;  1CHQ D;  3MFG A;  2FIN B;  2NUC A;  3HOX H;  1J5E L;  4LK1 C;  2VW9 A;  1BOS A;  4KKS A;  1U9R A;  2AWO A;  1STH A;  2RF4 A;  3BVZ A;  3GQB A;  3A8K E;  1Z9F A;  4DV4 Q;  4DV1 Q;  5BN5 A;  3N6R A;  5M5Y H;  4NW2 A;  3U9S A;  2DJF C;  1J8I A;  2JP1 A;  4GLV B;  5KNC A;  5AFW A;  4C3J B;  1WTX A;  1EEF D;  5EGT A;  3SK5 A;  3T51 B;  4A3M B;  3C1F A;  5I6Y A;  4PNY A;  2F0S A;  1UEA B;  5IYD G;  4DR1 Q;  3WOE A;  4B3M Q;  3NQI A;  3C1E A;  1KDA A;  4KY5 A;  3SE0 A;  1G2T A;  3I90 A;  4GZY C;  4KMU C;  3K5N A;  2O2L D;  3A55 A;  4FXK C;  1KNA A;  1ZYR C;  1TS4 A;  1PH8 A;  1MHW C;  2MP1 A;  4OEM B;  1ICW A;  5M5W H;  3CCV A;  2I0Q A;  4B9X A;  2AWN A;  1SYC A;  4Z9C B;  1O7Y A;  1XWE A;  3HOU G;  3BZD B;  5IYB G;  2JK8 A;  4GLX A;  3E9H A;  3V05 A;  2CW0 C;  1FD7 D;  4KHP L;  1Q82 C;  1HA6 A;  5ELC A;  1LUZ A;  3OMG A;  2A19 A;  1L1O A;  4J6H A;  1VQO A;  1N36 L;  1JOK A;  3NTH A;  4XYQ A;  2KOL A;  1CI3 M;  1JB7 A;  2MFI A;  3A0J A;  1WTQ A;  2Z1C A;  4PZ6 A;  2FJ2 A;  5IT9 c;  1BQQ T;  2VXW A;  2WAC A;  1U4P A;  4DR7 Q;  1C7Y A;  1DD2 A;  4DK6 C;  4GKK L;  1MIU A;  5CBA E;  4POF A;  4DNI A;  5C44 H;  2UUC L;  3MXG A;  5FO9 B;  4WJ3 M;  3V2T A;  4C3H B;  1U4R A;  3EVQ A;  4APV A;  1TWF H;  1B1Z A;  3CHB D;  4DAY A;  1B70 B;  2YU9 H;  2RCF A;  2VZA A;  4JYA Q;  2NN6 G;  5J3B A;  3VDY A;  5IP9 H;  4JI3 Q;  2L15 A;  4XYO A;  1Y1W G;  3CCS A;  3VA5 A;  2CWP A;  1NR2 A;  1VQP A;  3GTQ B;  2BDN A;  3J7A F;  4OL7 A;  2BE5 D;  3OW7 A;  1A0I A;  1SNO A;  4DV5 L;  4K0K L;  1ILQ A;  3S14 B;  1SYF A;  3R2T A;  5IYD H;  3PQI A;  3G7L A;  1X3G A;  4KY7 A;  5ELN A;  4A3M G;  1IBK Q;  1JMC A;  2UXC Q;  2EDG A;  1WTP A;  3GTK H;  1WCM G;  2HIX A;  2UU9 L;  4X62 L;  1M8A A;  2K28 A;  3HOU H;  4CJ0 B;  4A3L G;  2PNR C;  4A3C G;  3CQZ H;  1VQG A;  3ULP A;  1LTA D;  2E75 C;  3A74 A;  3ERO A;  1EQQ A;  3GTL B;  1C8C A;  3FPU B;  3JC6 6;  5C3E B;  3HEJ A;  2VB3 X;  4BA1 I;  1H9J A;  1TR5 A;  3UDG A;  3P75 A;  4K14 A;  2A68 C;  2LS0 1;  3H91 A;  1SFO H;  1EFW A;  1I4G A;  3FKI H;  1JJ2 A;  4QUF A;  1DM0 B;  2EYF A;  1P8L A;  1K8G A;  1X6O A;  1ESR A;  2AQ2 B;  1X3P A;  1N34 Q;  2E5L L;  4ME3 A;  1Y1W B;  4QMG A;  1IYU A;  4NXN L;  1IBM L;  4MTK A;  4CHT B;  2F0F A;  3HG9 A;  3M4P A;  1PFM A;  4KK7 A;  1YJN A;  3M3Y H;  2JA7 G;  4MZ9 A;  3KDF B;  2EZV A;  1H9M A;  2F0U A;  1SSO A;  2JXM B;  3D8G A;  4GOP C;  3FMC A;  1XPU A;  1PZI D;  2B3G A;  2NZO A;  3W5O A;  4EX5 A;  3DM3 A;  4CGY B;  1V1Q A;  4DV2 L;  3R8B A;  3NXW A;  1TKW B;  4L6T B;  4HR7 B;  1A3V A;  5M5X H;  2OEO A;  2QEJ C;  4JI1 Q;  4EQP A;  1P16 A;  5C0X H;  3PF4 A;  4ZK9 B;  1MJC A;  2C35 B;  1EOT A;  2O5J C;  4Q0F A;  3GTG B;  3AU7 A;  3S15 B;  4UAI A;  1C48 A;  2OWO A;  4PQX A;  4JI0 L;  1N9W A;  3H0G G;  1B3Q A;  1DOK A;  1EY6 A;  1AEX A;  4A76 A;  3MXP A;  3KOJ A;  2JN4 A;  1NJI C;  1B50 A;  1I5F A;  3C46 A;  4NXM Q;  3FVQ A;  4PG3 A;  1VQN A;  4BA2 I;  1D1I A;  3CC2 A;  4X64 Q;  1AE3 A;  1NY4 A;  4PMB A;  1KNE A;  2R61 A;  5E1F A;  2ZXR A;  1HCZ A;  4BY7 H;  3U9O A;  4XIG S;  3HOY B;  3U58 A;  4YY3 L;  2F0J A;  3DLL A;  3KJP A;  1ZKO A;  1IBM Q;  2MNA A;  4NXN Q;  2Q8R E;  2I5H A;  1UE5 A;  2R3Z A;  5K36 H;  1QOH A;  2K33 A;  5FLX E;  1HZB A;  1CT1 D;  4YCV A;  1IYV A;  2WP8 J;  4A3I H;  3BG3 A;  3U4Z A;  3OIQ A;  2J0T D;  3HOW G;  2WV6 D;  3P7J A;  2JA9 A;  5IWA L;  1G8Z D;  3HZX A;  4XDX A;  1MSH A;  3MAQ A;  5IGC A;  1HXY D;  1RL2 A;  1SFO B;  4LWC A;  1T5X D;  3KF8 B;  1YEZ A;  1OXX K;  1YZ6 A;  1JE4 A;  4LF9 Q;  4PMW A;  2FHT A;  2R93 B;  5JAV A;  3NPP A;  5C0X G;  1KDB A;  2IX0 A;  1XTD A;  4GNX A;  5KGU A;  1NUC A;  2XTI A;  3PUY A;  1PH5 A;  4DF7 A;  2NVX H;  1YNX A;  1K3B C;  3IFD A;  4DV7 Q;  1U5K A;  2L12 A;  5M3M B;  1JWM D;  2IX1 A;  2NVT B;  4NB3 A;  3D0F A;  2BDO A;  1TWG B;  2Y0S B;  4DV7 L;  1YNJ D;  1ASY A;  3EJI A;  1HRJ A;  1IBL Q;  1LTI D;  5FLM G;  3LX0 A;  2JA5 H;  4U67 3;  3QO2 A;  4KV6 A;  3J80 E;  1F9S A;  3JAM c;  1H9K A;  1W6K A;  1BXT A;  3B6Y A;  5IIF A;  4FF1 A;  4DR2 L;  1JJG A;  2VUM H;  1TT2 A;  3K6O A;  2L5T A;  1QJO A;  1Y8N B;  3TP8 A;  2F0N A;  4K5W A;  4JBM A;  1EZ8 A;  3TBI B;  1NMG A;  1E24 A;  1IKM A;  1A2U A;  3J81 L;  5FKA C;  3JAM E;  1NNX A;  3MEF A;  3K8A A;  2B8G A;  3D6W A;  4JI6 Q;  1Y1V H;  3NWT A;  3D4D A;  1I50 H;  3A54 A;  4PZ7 A;  4C1N K;  2KCC A;  2DUD A;  4XQN A;  2F3I A;  2WKC A;  4KD4 A;  2XIW A;  4F8M A;  1EUJ A;  4JI6 L;  4HAE A;  3HOZ H;  1D8L A;  4UPA A;  1CSQ A;  1J6Q A;  1Q1B A;  3J7A 5;  2YTX A;  2N8N A;  1GJX A;  1JOR A;  3S15 H;  5LHY 1;  2K1B A;  1FVI A;  1NSN S;  2KA7 A;  1VQ6 A;  4A3B H;  4WJW A;  1HFN A;  2F0O A;  5JEA J;  2ZXP A;  4TSS A;  3OWF A;  4LF6 L;  4O42 A;  2PMZ E;  4G57 A;  4OHJ A;  4IN3 A;  2KUM A;  2D0O A;  4DV2 Q;  3K7A B;  4UP8 A;  4QIW E;  2HD3 A;  3SR1 A;  5JPM C;  1IW7 D;  2L1B A;  3GTG H;  4DN4 M;  2E74 C;  3Q6S A;  2NB0 A;  4A3M H;  4DR5 L;  1QIL A;  4C3J H;  3H09 A;  1EOV A;  4RCO A;  4YCW A;  2UUA Q;  1E0B A;  1WJJ A;  3NBI A;  2JA8 G;  1GUW A;  5M3F G;  4IJL A;  1CTM A;  4DV6 L;  1CKO A;  3Q22 A;  4JI2 Q;  5L37 A;  3S17 H;  1D2B A;  3MXU A;  1HZA A;  3ITP A;  4LFA Q;  3TZU A;  2K4K A;  1A2T A;  2F0G A;  1QVF A;  3G6J B;  4PV1 C;  4DAY B;  1L1O B;  1AZP A;  4DAV A;  4WRD A;  4OWT B;  5IWA Q;  2EYL A;  1Q86 C;  2D2C C;  2PPB C;  1EU4 A;  1SE3 A;  2LY7 A;  2BA1 A;  2GN5 A;  1JC7 A;  1BCP C;  1O80 A;  2K75 A;  5HY6 A;  1SRU A;  5ELD A;  2A69 C;  1RKN A;  1B3A A;  4JC0 A;  2LXK A;  4P71 A;  1F2Y A;  4CDF C;  1AFP A;  4NMZ A;  3T53 B;  5IGD A;  5H1S E;  2KHI A;  1YIJ A;  1Z47 A;  2K6A A;  3UE1 A;  4FVM A;  5M3M H;  5IGG A;  1LYL A;  2EYO A;  4K2K A;  2A1A A;  5ELF A;  5C5M A;  2R7Z B;  2EXD A;  1PH4 A;  3NQT A;  5KNB A;  3GTO B;  1CHP D;  4IUV A;  2B2T C;  1VQB A;  3KLW A;  3FDT A;  2IT1 A;  3J7Y W;  4HMI A;  3HOY H;  5ELE A;  1X56 A;  3ER0 A;  4TKO B;  1CQV A;  1B4O A;  4A93 H;  1CM9 A;  1WD0 A;  3UDF A;  1CKN A;  2RCN A;  3I3C A;  4G7Z C;  1A15 A;  1VCI A;  1XMO L;  5I6W A;  3GTQ H;  3Q24 A;  4A3E B;  1JWS D;  2RSN A;  4C3H H;  5KND A;  3DEO A;  1VDZ A;  3UI2 A;  3S9W A;  2B2W A;  5CV8 A;  1ONL A;  3BDO A;  3CC7 A;  4OO1 G;  5M3F H;  1XNR Q;  2F52 A;  4JCV E;  2RQX A;  4CKC A;  3A8I E;  1GOZ A;  5D65 A;  2YU9 B;  3KF6 B;  1CKM A;  5LMN L;  1BBU A;  1LV9 A;  1TII D;  3TS2 A;  1XPR A;  4ZKC B;  2AUK A;  4DXG A;  2SEB D;  4ZKB B;  1DJR D;  1TWC B;  3E0E A;  1SMY C;  5DAU A;  4PMC A;  4E6I A;  5DM6 3;  2ES2 A;  2GA4 B;  4H0L C;  4J8Q A;  4DFA A;  3D31 A;  4A93 B;  1PTO B;  2PI2 E;  4HMJ A;  3PUX A;  4H7B A;  5BR8 Q;  4JI7 L;  2JA7 B;  2D62 A;  1Q12 A;  1XMQ Q;  1QB5 D;  1SNC A;  2F0D A;  3TEH B;  1LTT D;  2EY1 A;  4RGN A;  3H3V I;  1GXD C;  4A3F G;  4GS3 A;  1WTR A;  4OWW B;  3J80 i;  3S2H B;  1G6Z A;  5C0X J;  5C4Z A;  4HCE A;  3NEN A;  4M8A A;  2AUJ D;  5BR8 L;  4A75 A;  2UXD L;  1LLR D;  3K5L A;  1K8A C;  3RZD B;  2P5Z X;  5J22 A;  2H5X A;  3S17 B;  5IP9 G;  1QVC A;  1EYA A;  3BU2 A;  3AQQ A;  4QUC A;  2AMC B;  1Y1W H;  4RH6 A;  2Z8L A;  4JI3 L;  1GHJ A;  2MO1 A;  2AQ3 B;  1BDO A;  5FK9 C;  5AJ3 L;  5ELB A;  3T56 B;  1PFB A;  1Y69 U;  2ZJR A;  5FO8 B;  4KLK A;  2OXP A;  3SEB A;  4DU9 A;  5LL6 X;  2B63 B;  1X65 A;  4DR4 Q;  2SOB A;  4LJZ C;  2AHO B;  4CDC C;  4A3J H;  3M4O B;  2A74 C;  1MGS A;  1PXU A;  4OO1 H;  4KKU A;  4JI1 L;  1EQR A;  4L63 B;  4X3T A;  3RR5 A;  2OQK A;  4AH6 A;  4C3H G;  4L5S A;  2MJ8 A;  4V0B A;  3NBH A;  2K32 A;  1WTH A;  4CDD C;  1O7L A;  1Q3L A;  2RDH A;  2Z4I A;  1EWC A;  2TMP A;  2R7Z G;  5LMN Q;  1VQ4 A;  1B9M A;  1PTO H;  3VYS A;  2Z4H A;  4DR1 L;  4B3M L;  2VY3 A;  5JJZ A;  2K04 A;  1PZJ D;  2A8V A;  1BCP D;  3J7Z C;  3S16 H;  5C3E H;  3AYH B;  3I73 A;  5GRO A;  4A3E G;  2OCE A;  1GM5 A;  2PZT A;  4DV6 Q;  2F0V A;  3HOU B;  5EPJ A;  1H9S A;  2CWA A;  1DOL A;  4A3K B;  1IBL L;  1LTS D;  1M1K C;  4FXG C;  4JI7 Q;  3HOV G;  4DUZ Q;  3IRB A;  3NE5 B;  1I4H A;  1AW7 A;  4R4C A;  1N36 Q;  5C44 B;  4GKJ Q;  3ERQ A;  2ICE C;  3MTS A;  3KUP A;  4ALP A;  3GTJ B;  2WII B;  2KCM A;  2F0L A;  3I4M B;  3BDC A;  4GKK Q;  4ZQ3 A;  1HNW L;  3K7U C;  4LAA A;  1IW7 C;  3E6Z X;  3OOC A;  1SE2 A;  2E76 C;  1HUN A;  4OEL B;  4IUT A;  4P2C B;  2ALY B;  1PDQ A;  5NUC A;  1GUS A;  4TRD A;  5GAD C;  3EFX D;  1I50 B;  1ENF A;  1OXV A;  3T1H Q;  2MPM A;  1HNW Q;  1KQS A;  4JYA L;  1PVO A;  1LAB A;  1NE3 A;  4GLA C;  4IPD A;  3CC4 A;  2UXB L;  1Q8I A;  1D5M C;  1G29 1;  2LFN A;  2QF7 A;  3MC0 B;  4P74 A;  4X66 L;  2F0I A;  4B3T L;  1Q81 C;  3DUZ A;  3PIO A;  1T5E A;  3MVV A;  4MTN A;  1DON A;  3PUV A;  5IP7 G;  1RCV D;  1OO9 B;  5LMN W;  3S1M H;  1ET9 A;  4OIK A;  2MGS A;  1UE1 A;  1SRO A;  1VQE A;  4FF3 A;  1EY9 A;  1AN8 A;  1LM0 A;  2KEC A;  1VF7 A;  4YHH L;  4R4Q A;  2J4X A;  1CA5 A;  4N9P A;  3K0Y A;  1EU3 A;  2RBM A;  4JBK A;  1F2Z A;  1KLG D;  2HDM A;  3P20 A;  3RN2 A;  3V96 A;  1CKN B;  1X55 A;  4M1U B;  2DNE A;  2XWB B;  2K5W A;  4YHH Q;  1U0L A;  1G6P A;  3ONA B;  1EY8 A;  2DGY A;  1FGU A;  4XT1 B;  1FR3 A;  4IAL A;  4B08 A;  1RTN A;  3CXC A;  1JB3 A;  5EBD A;  4IUR A;  3WOF A;  1SJE D;  5CV5 A;  4R8N A;  1UNS A;  4F7X A;  2IJ0 A;  1HH2 P;  5C3W A;  1ENC A;  2RDG A;  4DKA C;  1AP0 A;  3RZD H;  2FMC A;  4A3B B;  1LO5 D;  2QW7 A;  3R3O A;  1PH7 A;  3OSO A;  5E4X A;  1N32 L;  2JJQ A;  3S1N H;  3GTP H;  3TRZ A;  1WI5 A;  3G6E A;  3LNN A;  3ERS X;  1ZXT A;  1M90 C;  3RUZ A;  1MI2 A;  2HCC A;  1KLU D;  1E2W A;  4DR6 Q;  1DGS A;  1TS2 A;  3VYU A;  4L5Q A;  4BXX H;  4X66 Q;  2R93 G;  3C3L A;  3BYY B;  2YTV A;  3QG1 A;  1EY5 A;  1VQ7 A;  1HPC A;  1T9H A;  2NN6 H;  1STA A;  1XYI A;  4DV3 Q;  2YV5 A;  5GAE C;  3S2D H;  4LFB L;  3AB9 A;  1E1O A;  3J81 c;  3T1Y L;  1EQT A;  1I94 Q;  4GNX B;  1PYW D;  1PH3 A;  3MXN A;  2PQA A;  3L0O A;  3BDL A;  4IOA A;  1VMC A;  4NXM L;  1L2F A;  2EYJ A;  4R1J A;  1LTR D;  1FNU A;  2R92 H;  2MQH A;  3TN2 A;  1STN A;  4I7A A;  4LF7 Q;  1EY4 A;  1K3R A;  1IBK L;  5D14 A;  1Q1E A;  1Z7T A;  3PO2 H;  3M3Y B;  1H9R A;  2BH2 A;  5CMD A;  1VQL A;  2K14 A;  5M3F B;  4TVA B;  3L9A X;  1KDC A;  1GUG A;  4OXP A;  3CU7 A;  4JK1 C;  4A3F H;  3H0G B;  2JA5 G;  1ASZ A;  3I4N H;  5JVG 3;  4LF5 L;  1SN8 A;  4GN4 B;  4IPC A;  1AZQ A;  1X3Q A;  2LXJ A;  3R93 A;  5IE8 A;  1HNZ Q;  3C2P A;  3AMU A;  3J7A V;  3FKI G;  3HGB A;  2ZJQ A;  3GTL H;  1TWH H;  1YHB A;  2NVX B;  2JA5 B;  1Y8P B;  2F0E A;  4PZ8 A;  5GAH C;  2ID0 A;  3PUW A;  2WAQ B;  3I72 A;  2CVR A;  4BBS H;  2KCT A;  2ZT9 C;  3LWE A;  5EPK A;  2VB2 X;  1U4M A;  3I7F A;  3H3V H;  1XMQ L;  3S14 H;  1EYG A;  2L55 A;  1VMP A;  2F3W A;  3W1G A;  3CKI B;  1TWA H;  2ZXO A;  4J15 A;  1EEI D;  1YHQ A;  4G7H C;  1EIH A;  3CCQ A;  3S1M B;  5C4X B;  4JV5 L;  2JA8 H;  1JE5 A;  2ATW A;  1Y8O B;  5LMU Q;  2VUM B;  5CC4 A;  4K6L A;  1PH9 A;  2IX3 A;  4OGQ C;  1B7Y B;  2ICI A;  2DJG C;  1S5E D;  3GV6 A;  3TQY A;  1QG7 A;  4ZCK A;  1PLF A;  4K5V A;  1TWA B;  2UXC L;  3L3O C;  2VNU D;  1I94 L;  2CQO A;  4JV5 Q;  4F88 A;  4DR4 L;  3H3V C;  1JWU D;  1SMX A;  1O7Z A;  3PO2 G;  3HFZ B;  1LT4 D;  2A68 D;  2R92 G;  1VS0 A;  3VR3 A;  2PZW A;  2X6L A;  3HOV H;  3QOL A;  4GN5 A;  1WOC A;  1W6J A;  3SHL A;  3U4V A;  2N78 A;  5A2Q E;  5F2D A;  3T4A C;  3NP8 A;  4BY7 B;  4RGO S;  5FOB B;  3K7A H;  2QKI C;  4P73 A;  4QB4 A;  4DPG A;  1V8Q A;  5E7N A;  2DNC A;  2PW5 A;  4OX9 Q;  2A6E C;  4IFD I;  3CCE A;  1W2B A;  2EYP A;  1I4P A;  4BBS G;  4A3I B;  4AQY L;  5IOD A;  4BBR G;  4A93 G;  1GD7 A;  4RHR A;  5I4D A;  5K36 G;  2LSS A;  2AQ1 B;  3CAM A;  3TME A;  2IY5 B;  1BUV T;  5KEE A;  3S16 B;  1CQF A;  3D4W A;  1GUN A;  3E9I A;  2EY6 A;  3S2D B;  5IYC G;  2DY8 A;  3T1Y Q;  5LMU L;  3UDI A;  2Z9H A;  4R8I A;  3MFY A;  5DEH A;  1XNR L;  2CHB D;  4O1N A;  1XNQ Q;  3GO5 A;  1V1P A;  4C2M B;  2I07 B;  4GNX C;  2BH8 A;  2YYZ A;  3CPF A;  3WWV A;  3PO3 G;  1MD2 D;  1CZG A;  2EVB A;  4HSP A;  2PCF B;  3TRE A;  2UUA L;  3HOY G;  4IFD J;  4ZUJ A;  1HQM C;  1K73 C;  3GTP B;  2Q2H A;  3M7N A;  3M4O H;  1RD9 D;  2B63 H;  3F1Z A;  4XXE A;  4LFA L;  4KD3 A;  1G2S A;  1NBW A;  1S4Z A;  4A3L H;  3HP3 A;  4X62 Q;  4KHV A;  1PV4 A;  1PZK D;  2B8F A;  4LFC L;  1WTW A;  1TWG H;  5DM7 3;  4HJ5 A;  1WCM H;  3PSI A;  3S1Q B;  3I4O A;  2HIV A;  1DCZ A;  1KXL A;  5DNF A;  4K5X A;  1EL0 A;  5EJW A;  1B8A A;  1IZ6 A;  2ZTE A;  1SDF A;  4P75 A;  1ZEQ X;  2WKD A;  2L9H A;  3S2H H;  3CQZ B;  2EOT A;  4JI8 L;  4IJH A;  1G51 A;  4ZLT F;  4RGM A;  2EJF C;  1HQR D;  1XXG A;  1KD1 C;  1HUM A;  4H44 C;  4KN4 C;  3CPW A;  1NAP A;  2RVL A;  3CD6 A;  4LF4 L;  1SYB A;  2JA7 H;  1ESF A;  1ILP A;  3IKJ A;  2KBN A;  1GO3 E;  4C3I H;  4X65 Q;  2NTS A;  3CCM A;  4A3D B;  3L7Z C;  2D9U A;  4DXF A;  4LF8 Q;  3CF5 A;  3NUC A;  1BKB A;  1CUK A;  4L5T A;  1YNJ C;  4YWL A;  4R4T A;  3I55 A;  1JJC B;  1II3 A;  2L0C A;  3HKS A;  2VQF L;  1GHK A;  1QZG A;  3E5S A;  1A8V A;  3BZC A;  5EBC A;  1K83 B;  3PO3 H;  1G91 A;  1TWF B;  3NTI A;  4OIJ A;  1MSG A;  2B2U C;  4ZYS A;  1KAA A;  1K28 A;  3CRL C;  1PMR A;  2GVA A;  4KKT A;  4YWK A;  1TWH B;  1TXY A;  2DY7 A;  3D4R A;  3A7A B;  2EY2 A;  1LT3 D;  3DEP A;  5M5W B;  2NZH A;  3IAY A;  2KEE A;  4F87 A;  4C3J G;  3HKZ B;  5GAG C;  1KHI A;  5G3L F;  3M4Y A;  1SND A;  3LGJ A;  4HIO A;  3PO2 B;  5IYB H;  3SXH A;  4HTH A;  1EIY B;  2IL8 A;  3EQL C;  1AE2 A;  2F0P A;  2B2V C;  4XTC S;  4POG A;  3IFT A;  5ISR A;  4JI8 Q;  4RHS A;  3MA2 B;  2BA0 A;  3ICE A;  1CZW A;  4AYB E;  2R7D A;  5M5Y B;  1VQJ A;  3FEW X;  4IZ8 A;  3P1H A;  4FP5 D;  1PA6 A;  1UE6 A;  2E8G A;  3KYH C;  1HNX L;  1HJP A;  3UDX A;  1VQ9 A;  1N8R C;  1EFI D;  2K5D A;  5JOB A;  1GVP A;  5C4X G;  1I3Q H;  3URY A;  2G9D A;  2RA4 A;  1PH2 A;  2KED A;  5C5L A;  2F3V A;  4AYB G;  4A3I G;  2VL6 A;  2VQF Q;  3QOJ A;  1H9S B;  4HJ9 A;  1IXR A;  3EA6 A;  2A6H C;  5M9O A;  3RNU A;  2UXB Q;  1F9R A;  3OIP A;  1VQF A;  3EIV A;  1F77 A;  1PRT B;  3KLR A;  5KYL A;  1PYB A;  4K2L A;  3GV3 A;  1LTG D;  2EE1 A;  2H1E A;  4HJ8 A;  3M9B A;  3OMC A;  5HGT A;  2EQS A;  1R4Q B;  5CV7 A;  1SYG A;  2D5D A;  1SR3 A;  1RHP A;  2VS1 A;  4X3U A;  4LUZ A;  5FLX L;  2CQA A;  3K58 A;  3S24 A;  3I70 A;  5ELO A;  4CKB A;  4HIK A;  2TSS A;  1S5F D;  5I9O A;  1XNQ L;  4JVZ A;  3NBH B;  1I6H B;  4QIW B;  3F2U A;  1PFN A;  2ENB A;  1QCB D;  1IL8 A;  1YNN C;  1ET6 A;  5IGB A;  4UHV A;  4IO9 A;  1JIC A;  4H13 C;  5IT9 E;  2UU9 Q;  3RN5 A;  3L2P A;  1RDP D;  2RDF A;  4MNO A;  5C0X I;  1A62 A;  1PHJ A;  2E2I B;  4MIU A;  5FJ8 G;  4EQ5 A;  2IHF A;  2A73 B;  2UXD Q;  1PRT D;  4HJ7 A;  2ZM6 Q;  1I4X A;  1PH6 A;  1K0S A;  3PIP 3;  1FJG Q;  4GKJ L;  4ZRZ A;  3ULJ A;  3J80 c;  1JQY D;  3VA7 A;  2V4D A;  1M4V A;  2E5L Q;  4IPH A;  4G4K A;  1EY0 A;  1FYC A;  4JI4 L;  2N88 A;  2JA8 B;  2CH4 W;  4I7Z C;  3Q0A A;  4DV0 Q;  2HDL A;  5I2Y A;  3MXN B;  3I56 A;  2X69 A;  4JPB W;  5J1Z A;  5D3I B;  1D1K A;  3QR8 A; 
#chains in the Genus database with same CATH homology
 4WFN 3;  5JPN C;  5CGK A;  1TS3 A;  2JA6 B;  3M85 A;  1K8M A;  4KI0 A;  2KHS A;  2EPB A;  1SXT A;  3LWU A;  4BBR B;  4B9W A;  2X6G A;  3I4L A;  2B2Y C;  4MN3 A;  4NP5 A;  4DGZ A;  2B39 A;  3DWP A;  1VF5 C;  3GP7 A;  4S3S A;  1L0X B;  1R4P B;  3FPP A;  4FYD A;  2HQE A;  4U68 A;  5KIX A;  1F2L A;  4DK0 A;  4RGT A;  2RSO A;  3ZYY X;  3SK6 A;  5JVH 3;  1IHZ A;  1I4Q A;  1Q90 A;  2K5Q A;  5K5P A;  2B2V A;  1I4R A;  5I2X A;  3H94 A;  1WD1 A;  1GUT A;  4ME5 A;  3QIA A;  2E2H B;  2KVM A;  3CRK C;  1OXU A;  2F03 A;  2N55 A;  1BBX C;  4J1M A;  1HTL D;  2B2W C;  3MHB A;  1F9Q A;  1RF2 D;  4RKB A;  3KK7 A;  3S1R B;  4IFD H;  2B2T A;  1NR4 A;  4DK1 A;  5D3D A;  4QCL A;  4FF4 A;  4EQN A;  1OXS C;  2M2L A;  4BS9 A;  2O4X A;  3TDQ A;  1HA5 A;  3PMF A;  3QB3 A;  2XRQ D;  5C4J B;  3T13 A;  3JAM L;  5BN3 A;  4YIJ A;  2NVY B;  2G9H D;  2BE5 C;  1FNW A;  2NVQ B;  5KYI A;  1JOO A;  2H4O A;  3PIO 3;  1JOQ A;  1PRT F;  3TZD A;  3KBX A;  4CJ2 C;  2JEA I;  1V1P B;  2EYM A;  1JR0 D;  3SK8 A;  1I6V C;  2IWH A;  1XX8 A;  5COR A;  1WTV A;  3HOW B;  4XQJ A;  2M9V A;  5CV9 A;  4I65 A;  4KY6 A;  1KAB A;  2L4N A;  4IUN A;  1MBY A;  3VYR A;  3SK4 A;  4NKL A;  1SE4 A;  3VR2 A;  5E4W C;  4ID6 A;  2F0W A;  3DWA A;  2A69 D;  4RA8 A;  3BVG A;  5T1G A;  5LL6 S;  2NWG A;  5C6A A;  3A7L A;  1BO0 A;  1B2T A;  1WVL A;  4CJ1 B;  5EPL A;  5CBE E;  1Z6H A;  1LTB D;  3NK9 A;  4CKE A;  2MHV A;  2A6H D;  2E2J B;  3RZO B;  4UDU C;  5E3F A;  2BOS A;  2Q8T A;  3PV0 A;  2HUG A;  1SNP A;  3SVM A;  2A5H A;  1EYC A;  2NN6 I;  2PW7 A;  3J80 L;  5HUR A;  2JYO A;  3GTM B;  3VYT A;  2DN8 A;  2EY5 A;  2F0K A;  1STG A;  2IPK D;  2RKS A;  1QNK A;  4ODG A;  2K01 A;  2EJM A;  2QDB A;  1TQO A;  3ND8 A;  2F4I A;  3A56 A;  2LMC B;  1D5Z C;  3I8Z A;  1LAC A;  1YNN D;  2XRS D;  3RD4 A;  4L8J A;  4KHZ A;  3WDN A;  3E0J A;  2KJX A;  1E2Z A;  2B2U A;  4N9T A;  3HRZ C;  4A3F B;  3T16 A;  3H6M A;  3O13 A;  4EVO A;  1EZ6 A;  2EXZ A;  3BYT B;  1UUP A;  2XVS A;  1FGB D;  1K8O A;  4RAU C;  5CYU A;  3W3A A;  5TSS A;  1JCK B;  5A35 A;  3MEH A;  2LKV A;  4FNF A;  1L0Y B;  3HOV B;  5M5X B;  1QNU A;  2PZU A;  4A3G B;  2WIN B;  3QWN A;  1Y1V B;  1CA6 A;  4V19 0;  5IOC A;  3K5O A;  5IGE A;  1DXM A;  2QCP X;  3HOX B;  3A8J E;  2MUY A;  1GUO A;  1A6X A;  5CV6 A;  2SNM A;  1TU2 B;  4HCS A;  3N52 A;  4TQU S;  2CW0 D;  1TY0 A;  3DXJ C;  1STB A;  1R9T B;  5CR3 A;  1ZYR D;  3X3N A;  5C3X A;  3K59 A;  1BF4 A;  1IKL A;  3J81 E;  3R2I A;  1SNM A;  2F0T A;  3MWY W;  5EKI A;  1V43 A;  4R9W A;  3BVM A;  1A3T A;  3GTK B;  4BBS B;  3PO3 B;  2XN9 C;  2NTT A;  4X3K A;  2EJG C;  4ABN A;  1SAP A;  4HSV A;  1PTO F;  4XQQ A;  4NDX A;  1STE A;  5I9P A;  1WTO A;  4ULL A;  2L11 A;  4RKL A;  3I4N B;  2NYZ D;  3IL8 A;  3RMH A;  3DM1 A;  1QE6 A;  2I46 A;  2XWJ B;  3DHQ A;  1SMY D;  3Q23 A;  4G7O C;  5CV4 A;  2O5I C;  1ML0 D;  4Y7N B;  1EQV A;  3DMU A;  1SBB B;  1RJT A;  3W2D A;  1SYE A;  2OF1 A;  3I91 A;  2J7Z A;  3GD7 A;  4K6D A;  1EY7 A;  1B44 D;  1EYD A;  5A2Q L;  1B9N A;  4ZAI A;  2A6E D;  1TY2 A;  4OO1 I;  4K8I A;  1LT6 D;  1PRT C;  1SNQ A;  2R92 B;  5KRU A;  4BY1 B;  4C56 C;  4MHE A;  3OHX C;  5JEA G;  4BWG B;  1FNV A;  4KJN A;  3SDZ A;  4FO2 A;  1DZ1 A;  2PMZ B;  4DA2 A;  3KLS X;  4IUU A;  1NCV A;  3TSS A;  5C4H A;  2WB1 B;  2NZ1 D;  4HED A;  1UAP A;  4XT3 B;  2HCI A;  2XNA C;  4C3I G;  1DYQ A;  1U4L A;  3VR5 A;  1EWH A;  4LMQ D;  1KTK A;  4IQZ A;  5IT9 L;  1STY A;  3HOZ B;  5COY A;  1X32 A;  2B2Y A;  4DNT B;  2KCN A;  1OXT A;  4FXD A;  2FFK B;  2JSO A;  5EKK A;  3KF8 A;  3X3M A;  4HN7 A;  2R6G A;  1J9O A;  1XTC D;  2XSC A;  3NSW A;  3PUZ A;  1A3U A;  1TS5 A;  4IUP A;  3M7G A;  4ILW A;  2JE6 I;  2Q8I B;  3FKI B;  5J39 A;  1HHV A;  4A3J B;  3S1N B;  2SDF A;  1CFM A;  2FMM A;  3RLF A;  1HFG A;  5IGF A;  4Q5V A;  1F2M A;  4KTA A;  5JEA H;  2QIL A;  4RFB A;  3K57 A;  2PYK A;  5EKL A;  5G3L D;  2OT2 A;  3OPO A;  4IUQ A;  3DWQ A;  5T1I A;  2BCO A;  3NTK A;  1ENA A;  1I3Q B;  4EGV A;  4ZUI A;  1BR9 A;  1EIG A;  1S5D D;  2PQE A;  2F0H A;  3QJY A;  1ROD A;  3ND9 A;  1LT5 D;  1BNZ A;  2EYH A;  1BCP B;  3K5M A;  1D5X C;  3TP7 A;  4AYB B;  2M00 A;  1TVX A;  1O78 A;  4FF2 A;  1S5B D;  3VR4 A;  3NWS A;  1E2V A;  3BS1 A;  2K7V A;  1CK1 A;  4C1N I;  3VR6 A;  1C4Q A;  4IFD G;  1HTP A;  1D6E C;  5EQ0 A;  4X3S A;  1V1O A;  2PO4 A;  3KBG A;  1S5C D;  3TP6 A;  1QWY A;  1DOM A;  4EQO A;  2F1M A;  2C5C A;  2JEB I;  2IW3 A;  3FRP B;  3OWE B;  1BCP F;  4CBV A;  4K8J A;  1SEB D;  2K03 A;  2E2D C;  1SJH D;  1F9P A;  5BN4 A;  4C3I B;  2F0M A;  4JBW A;  4DAP A;  3NHH A;  1B53 A;  2C9O A;  3HS0 C;  1SYD A;  4DNR B;  3D6C A;  4RCN A;  4RWS C;  2NBF A;  1PTO D;  1WCM B;  1RTO A;  4WOR A;  3D3R A;  4KN7 C;  5FO7 B;  2F0Q A;  2K05 A;  4KJO A;  3TP5 A;  4QF4 A;  3KLS A;  2SNS A;  3MZ5 A;  1PTO C;  2KQ3 A;  1CHQ D;  3MFG A;  2FIN B;  2NUC A;  4LK1 C;  1BOS A;  4KKS A;  1U9R A;  2AWO A;  1STH A;  3BVZ A;  3GQB A;  3A8K E;  5BN5 A;  3N6R A;  4NW2 A;  3U9S A;  1J8I A;  2JP1 A;  5KNC A;  5AFW A;  4C3J B;  1WTX A;  1EEF D;  5EGT A;  3T51 B;  3SK5 A;  4A3M B;  3C1F A;  5I6Y A;  4PNY A;  2F0S A;  1UEA B;  3WOE A;  3NQI A;  3C1E A;  1KDA A;  4KY5 A;  3SE0 A;  1G2T A;  3I90 A;  4GZY C;  4KMU C;  3K5N A;  2O2L D;  3A55 A;  4FXK C;  1KNA A;  1ZYR C;  1TS4 A;  2MP1 A;  1ICW A;  4B9X A;  4Z9C B;  2AWN A;  1SYC A;  1O7Y A;  1XWE A;  3BZD B;  3V05 A;  2CW0 C;  1FD7 D;  1HA6 A;  5ELC A;  3OMG A;  4J6H A;  1JOK A;  3NTH A;  4XYQ A;  2KOL A;  1CI3 M;  1WTQ A;  2Z1C A;  2FJ2 A;  1BQQ T;  2VXW A;  2WAC A;  1U4P A;  1DD2 A;  5CBA E;  3MXG A;  5FO9 B;  3V2T A;  4C3H B;  1U4R A;  3EVQ A;  1B1Z A;  3CHB D;  4DAY A;  2NN6 G;  4XYO A;  3VA5 A;  1NR2 A;  3GTQ B;  2BDN A;  3J7A F;  4OL7 A;  2BE5 D;  3OW7 A;  1SNO A;  1ILQ A;  3S14 B;  1SYF A;  3R2T A;  3G7L A;  4KY7 A;  2EDG A;  1WTP A;  1M8A A;  2K28 A;  4CJ0 B;  2PNR C;  1LTA D;  2E75 C;  3ERO A;  3GTL B;  1C8C A;  3FPU B;  5C3E B;  3HEJ A;  2VB3 X;  4BA1 I;  1H9J A;  1TR5 A;  3P75 A;  4K14 A;  2A68 C;  2LS0 1;  3H91 A;  1I4G A;  4QUF A;  1DM0 B;  2EYF A;  1ESR A;  2AQ2 B;  1X3P A;  1Y1W B;  4QMG A;  1IYU A;  4CHT B;  2F0F A;  3HG9 A;  1PFM A;  4KK7 A;  2EZV A;  1H9M A;  2F0U A;  1SSO A;  2JXM B;  3D8G A;  3FMC A;  1PZI D;  4CGY B;  3R8B A;  3NXW A;  1TKW B;  4L6T B;  4HR7 B;  1A3V A;  2OEO A;  2QEJ C;  4EQP A;  5C0X H;  4ZK9 B;  1EOT A;  2O5J C;  4Q0F A;  3GTG B;  3AU7 A;  3S15 B;  4UAI A;  1C48 A;  4PQX A;  1DOK A;  1EY6 A;  1AEX A;  3MXP A;  1B50 A;  3C46 A;  3FVQ A;  4BA2 I;  1D1I A;  4PMB A;  1KNE A;  2R61 A;  5E1F A;  2ZXR A;  1HCZ A;  3U9O A;  4XIG S;  3HOY B;  2F0J A;  1ZKO A;  2Q8R E;  2R3Z A;  5K36 H;  1QOH A;  2K33 A;  5FLX E;  1CT1 D;  1IYV A;  2WP8 J;  3BG3 A;  3OIQ A;  2J0T D;  2WV6 D;  3P7J A;  1G8Z D;  3HZX A;  4XDX A;  1MSH A;  3MAQ A;  5IGC A;  1HXY D;  1SFO B;  1T5X D;  1OXX K;  1JE4 A;  4PMW A;  2FHT A;  2R93 B;  5JAV A;  3NPP A;  5C0X G;  1KDB A;  2IX0 A;  5KGU A;  1NUC A;  3PUY A;  4DF7 A;  3IFD A;  2L12 A;  5M3M B;  1JWM D;  2IX1 A;  2NVT B;  2BDO A;  1TWG B;  2Y0S B;  1YNJ D;  3EJI A;  1HRJ A;  1LTI D;  3LX0 A;  4U67 3;  3QO2 A;  4KV6 A;  3J80 E;  1F9S A;  1H9K A;  1W6K A;  1BXT A;  5IIF A;  4FF1 A;  1TT2 A;  3K6O A;  2L5T A;  1QJO A;  1Y8N B;  3TP8 A;  2F0N A;  4K5W A;  1EZ8 A;  3TBI B;  1IKM A;  1A2U A;  3J81 L;  5FKA C;  3JAM E;  2B8G A;  3D6W A;  3NWT A;  3D4D A;  3A54 A;  4C1N K;  2KCC A;  4XQN A;  2WKC A;  4KD4 A;  2XIW A;  4F8M A;  4HAE A;  1Q1B A;  1GJX A;  1JOR A;  5LHY 1;  2K1B A;  1NSN S;  2KA7 A;  4WJW A;  1HFN A;  2F0O A;  5JEA J;  2ZXP A;  4TSS A;  3OWF A;  4O42 A;  4G57 A;  4OHJ A;  4IN3 A;  2KUM A;  3K7A B;  3SR1 A;  5JPM C;  1IW7 D;  2L1B A;  4DN4 M;  2E74 C;  3Q6S A;  2NB0 A;  1QIL A;  3H09 A;  4RCO A;  1E0B A;  3NBI A;  1GUW A;  1CTM A;  3Q22 A;  1D2B A;  3MXU A;  3ITP A;  3TZU A;  1A2T A;  2F0G A;  3G6J B;  4PV1 C;  1AZP A;  4DAV A;  4WRD A;  2EYL A;  2D2C C;  2PPB C;  1EU4 A;  1SE3 A;  2LY7 A;  2BA1 A;  1JC7 A;  1BCP C;  1O80 A;  5ELD A;  2A69 C;  1RKN A;  1B3A A;  1F2Y A;  1AFP A;  4NMZ A;  3T53 B;  5IGD A;  1Z47 A;  2K6A A;  4FVM A;  5IGG A;  2EYO A;  4K2K A;  5C5M A;  5ELF A;  2R7Z B;  3NQT A;  5KNB A;  3GTO B;  1CHP D;  4IUV A;  2B2T C;  3FDT A;  2IT1 A;  3J7Y W;  4HMI A;  5ELE A;  4TKO B;  1CQV A;  1B4O A;  1CM9 A;  1WD0 A;  3I3C A;  4G7Z C;  1A15 A;  1VCI A;  5I6W A;  3Q24 A;  4A3E B;  1JWS D;  2RSN A;  5KND A;  3DEO A;  1VDZ A;  3UI2 A;  3S9W A;  2B2W A;  5CV8 A;  1ONL A;  3BDO A;  4OO1 G;  2RQX A;  4CKC A;  3A8I E;  1GOZ A;  5D65 A;  2YU9 B;  1LV9 A;  1TII D;  4ZKC B;  2AUK A;  4DXG A;  2SEB D;  4ZKB B;  1DJR D;  1TWC B;  1SMY C;  5DAU A;  4PMC A;  4E6I A;  5DM6 3;  2GA4 B;  4H0L C;  4J8Q A;  4DFA A;  3D31 A;  4A93 B;  1PTO B;  4HMJ A;  3PUX A;  4H7B A;  2JA7 B;  2D62 A;  1Q12 A;  1QB5 D;  1SNC A;  2F0D A;  1LTT D;  2EY1 A;  4RGN A;  1GXD C;  1WTR A;  3S2H B;  1G6Z A;  5C0X J;  5C4Z A;  4HCE A;  4M8A A;  2AUJ D;  1LLR D;  3K5L A;  3RZD B;  5J22 A;  3S17 B;  1EYA A;  4QUC A;  4RH6 A;  2Z8L A;  1GHJ A;  2AQ3 B;  1BDO A;  5FK9 C;  5ELB A;  3T56 B;  1PFB A;  1Y69 U;  5FO8 B;  2OXP A;  3SEB A;  4DU9 A;  5LL6 X;  2B63 B;  2SOB A;  4LJZ C;  3M4O B;  2A74 C;  1MGS A;  1PXU A;  4OO1 H;  4KKU A;  4L63 B;  4X3T A;  4C3H G;  2MJ8 A;  4V0B A;  3NBH A;  2K32 A;  1O7L A;  1Q3L A;  2RDH A;  2Z4I A;  1EWC A;  2TMP A;  1B9M A;  3VYS A;  1PTO H;  2Z4H A;  5JJZ A;  2K04 A;  1PZJ D;  1BCP D;  3I73 A;  2PZT A;  2F0V A;  3HOU B;  5EPJ A;  1H9S A;  1DOL A;  4A3K B;  1LTS D;  4FXG C;  3NE5 B;  1I4H A;  1AW7 A;  5C44 B;  3ERQ A;  2ICE C;  3MTS A;  3KUP A;  3GTJ B;  2WII B;  2F0L A;  3I4M B;  3BDC A;  4ZQ3 A;  4LAA A;  1IW7 C;  3E6Z X;  3OOC A;  1SE2 A;  2E76 C;  1HUN A;  4IUT A;  4P2C B;  1PDQ A;  5NUC A;  1GUS A;  4TRD A;  3EFX D;  1I50 B;  1ENF A;  1OXV A;  2MPM A;  1LAB A;  1Q8I A;  1D5M C;  1G29 1;  2LFN A;  2QF7 A;  3MC0 B;  2F0I A;  3DUZ A;  1T5E A;  3MVV A;  1DON A;  3PUV A;  1RCV D;  1OO9 B;  1ET9 A;  4OIK A;  2MGS A;  4FF3 A;  1EY9 A;  1AN8 A;  2KEC A;  1VF7 A;  2J4X A;  1CA5 A;  4N9P A;  3K0Y A;  1EU3 A;  2RBM A;  1F2Z A;  1KLG D;  2HDM A;  3P20 A;  3V96 A;  4M1U B;  2DNE A;  2XWB B;  2K5W A;  3ONA B;  1EY8 A;  4XT1 B;  1FR3 A;  4IAL A;  4B08 A;  1RTN A;  1JB3 A;  5EBD A;  4IUR A;  3WOF A;  1SJE D;  5CV5 A;  4R8N A;  1UNS A;  4F7X A;  2IJ0 A;  5C3W A;  1ENC A;  2RDG A;  1AP0 A;  2FMC A;  4A3B B;  1LO5 D;  3R3O A;  3OSO A;  5E4X A;  3LNN A;  1ZXT A;  3RUZ A;  1MI2 A;  2HCC A;  1KLU D;  1E2W A;  1TS2 A;  3VYU A;  3C3L A;  3BYY B;  3QG1 A;  1EY5 A;  1HPC A;  2NN6 H;  1STA A;  1XYI A;  3AB9 A;  1EQT A;  1PYW D;  3MXN A;  3BDL A;  1VMC A;  2EYJ A;  1LTR D;  1FNU A;  3TN2 A;  1STN A;  1EY4 A;  5D14 A;  1Q1E A;  1Z7T A;  3M3Y B;  1H9R A;  5CMD A;  5M3F B;  3L9A X;  1KDC A;  1GUG A;  3CU7 A;  4JK1 C;  3H0G B;  5JVG 3;  1AZQ A;  1X3Q A;  3R93 A;  3C2P A;  3AMU A;  3J7A V;  3HGB A;  2NVX B;  2JA5 B;  1Y8P B;  2F0E A;  2ID0 A;  3PUW A;  2WAQ B;  3I72 A;  2CVR A;  2ZT9 C;  3LWE A;  5EPK A;  2VB2 X;  1U4M A;  2L55 A;  1VMP A;  2F3W A;  3CKI B;  2ZXO A;  1EEI D;  4G7H C;  1EIH A;  5C4X B;  3S1M B;  1Y8O B;  2VUM B;  5CC4 A;  4K6L A;  2IX3 A;  4OGQ C;  2ICI A;  1S5E D;  3GV6 A;  1QG7 A;  1PLF A;  4K5V A;  1TWA B;  3L3O C;  2VNU D;  4F88 A;  3H3V C;  1JWU D;  1O7Z A;  1LT4 D;  2A68 D;  3VR3 A;  2PZW A;  2X6L A;  3QOL A;  1W6J A;  3SHL A;  5A2Q E;  5F2D A;  3T4A C;  3NP8 A;  4BY7 B;  4RGO S;  5FOB B;  2QKI C;  4QB4 A;  1V8Q A;  2DNC A;  2PW5 A;  2A6E C;  4IFD I;  2EYP A;  1I4P A;  4A3I B;  5IOD A;  4RHR A;  5I4D A;  5K36 G;  2AQ1 B;  3TME A;  1BUV T;  5KEE A;  3S16 B;  1CQF A;  3D4W A;  1GUN A;  2EY6 A;  3S2D B;  2DY8 A;  4R8I A;  3MFY A;  5DEH A;  2CHB D;  4O1N A;  3GO5 A;  1V1P A;  4C2M B;  2I07 B;  2YYZ A;  1MD2 D;  1CZG A;  2EVB A;  4HSP A;  2PCF B;  4IFD J;  4ZUJ A;  1HQM C;  3M7N A;  3GTP B;  1RD9 D;  4XXE A;  4KD3 A;  1G2S A;  1S4Z A;  3HP3 A;  4KHV A;  1PZK D;  2B8F A;  1WTW A;  5DM7 3;  3S1Q B;  1DCZ A;  5DNF A;  4K5X A;  1EL0 A;  5EJW A;  1SDF A;  1ZEQ X;  2WKD A;  2L9H A;  3CQZ B;  2EOT A;  4ZLT F;  4RGM A;  2EJF C;  1HQR D;  1XXG A;  1HUM A;  4H44 C;  4KN4 C;  1NAP A;  2RVL A;  1ILP A;  1SYB A;  1ESF A;  3IKJ A;  2NTS A;  4A3D B;  3L7Z C;  2D9U A;  4DXF A;  3NUC A;  1YNJ C;  1II3 A;  2L0C A;  1GHK A;  3E5S A;  5EBC A;  1K83 B;  1G91 A;  1TWF B;  3NTI A;  4OIJ A;  1MSG A;  2B2U C;  4ZYS A;  1KAA A;  3CRL C;  1PMR A;  4KKT A;  1TWH B;  2DY7 A;  3D4R A;  3A7A B;  2EY2 A;  1LT3 D;  3DEP A;  5M5W B;  3IAY A;  2KEE A;  4F87 A;  4C3J G;  3HKZ B;  5G3L F;  3M4Y A;  1SND A;  3PO2 B;  3SXH A;  4HTH A;  2IL8 A;  3EQL C;  2F0P A;  2B2V C;  4XTC S;  3IFT A;  5ISR A;  4RHS A;  3MA2 B;  2BA0 A;  1CZW A;  5M5Y B;  3FEW X;  4IZ8 A;  3P1H A;  4FP5 D;  1EFI D;  2K5D A;  5JOB A;  3URY A;  2G9D A;  2RA4 A;  2KED A;  5C5L A;  2F3V A;  3QOJ A;  1H9S B;  3EA6 A;  2A6H C;  5M9O A;  1F9R A;  3OIP A;  3KLR A;  5KYL A;  1F77 A;  1PRT B;  4K2L A;  3GV3 A;  1LTG D;  2EE1 A;  2H1E A;  3OMC A;  5HGT A;  1R4Q B;  5CV7 A;  1SYG A;  2D5D A;  1RHP A;  4X3U A;  5FLX L;  2CQA A;  3K58 A;  3I70 A;  4CKB A;  2TSS A;  1S5F D;  5I9O A;  1I6H B;  4QIW B;  3F2U A;  1PFN A;  2ENB A;  1QCB D;  1IL8 A;  1YNN C;  1ET6 A;  5IGB A;  1JIC A;  4H13 C;  5IT9 E;  1RDP D;  2RDF A;  5C0X I;  2E2I B;  4MIU A;  2A73 B;  1PRT D;  1I4X A;  3PIP 3;  4ZRZ A;  1JQY D;  3VA7 A;  2V4D A;  1M4V A;  4G4K A;  1EY0 A;  1FYC A;  2N88 A;  2JA8 B;  4I7Z C;  3Q0A A;  2HDL A;  5I2Y A;  2X69 A;  5J1Z A;  5D3I B;  1D1K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...