5ELDA

Cholera toxin classical b-pentamer in complex with a lewis-y
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
103
structure length
103
Chain Sequence
TPQNITDLCAEYHNTQIHTLNDKIFSYTESLAGKREMAIITFKNGATFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAISMAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cholera enterotoxin B subunit
publication title High-Resolution Crystal Structures Elucidate the Molecular Basis of Cholera Blood Group Dependence.
pubmed doi rcsb
source organism Vibrio cholerae o1
molecule tags Toxin
total genus 28
structure length 103
sequence length 103
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2015-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01376 Enterotoxin_b Heat-labile enterotoxin beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 5eldA00
1DYQA 4O1NA 1JCKB 1F77A 2R61A 4BWGB 1LT5D 3EA6A 1BCPF 1I4RA 2O2LD 2RDHA 4RH6A 4UDUC 1PRTD 1JWSD 5D3DA 1LO5D 1PTOC 1JWUD 1SBBB 3SEBA 1D5XC 2AQ1B 1CQVA 3EFXD 4DXGA 1LTRD 1LTBD 1I4GA 1LTGD 1SE3A 4RGOS 4RGNA 1EWCA 1PYWD 5ELDA 1KTKA 1JR0D 1SE4A 1M4VA 3OWEB 4L63B 1PZKD 1ESFA 1RDPD 3MC0B 1STEA 2XRQD 1S5BD 1V1PA 1HTLD 1S5ED 1ENFA 2AQ2B 1BCPC 1I4HA 3W2DA 1RCVD 1FGBD 1PTOD 1SJED 2WV6D 1AW7A 1PRTB 5TSSA 1B1ZA 3KLSX 1LTSD 4C56C 1RD9D 1CHQD 3TSSA 2AQ3B 3BVMA 1FNWA 3DWQA 3R8BA 1QILA 1EFID 2J4XA 1GOZA 1V1PB 4RGMA 1S5FD 1XXGA 1PRTF 3O13A 5ELCA 1UNSA 4ZYSA 2QEJC 2G9HD 1LT4D 1I4PA 3BZDB 3V05A 2XNAC 4RHRA 1V1OA 1MD2D 4Z9CB 1D6EC 3CHBD 5ELEA 4RCOA 1BCPD 1TS5A 1HXYD 2IJ0A 1D5ZC 1TS3A 5FKAC 1PZJD 3DWAA 5ELBA 1FNVA 1I4QA 1EEID 1KLGD 1SXTA 1D5MC 3BYTB 3BYYB 1LTID 1PTOB 2NTSA 1LTAD 5FK9C 1HQRD 1KLUD 2RDGA 1S5DD 5I4DA 3GP7A 1ET9A 1T5XD 4TSSA 1EU3A 3BVZA 4RGTA 1BXTA 4RHSA 2NTTA 1SJHD 3URYA 1JQYD 1TY2A 1FNUA 1LT6D 2SEBD 2ICIA 4RFBA 4K6LA 1PRTC 1PTOF 2XN9C 5ELFA 1JWMD 2XRSD 1ET6A 1LT3D 1TS2A 4OHJA 1FD7D 5D3IB 2QILA 1TY0A 2CHBD 1CHPD 1EEFD 3R2IA 1RF2D 2Z8LA 3MFGA 4DXFA 1LTTD 1AN8A 1UUPA 1XTCD 1G8ZD 1DJRD 3DWPA 1EU4A 1LLRD 1BCPB 1HA5A 1PZID 2IPKD 4L6TB 1CT1D 1SEBD 1L0XB 3BVGA 3R2TA 1S5CD 1PTOH 2TSSA 1SE2A 1TS4A 1CK1A 1L0YB 1B44D 1I4XA
chains in the Genus database with same CATH superfamily
2UUBQ 3PO2G 4BBRG 4NXMQ 1HZBA 2KVMA 5C4XH 2EE1A 3MAQA 4KY5A 4C3HB 4YHHQ 1GD7A 1OXTA 2E75C 2F0KA 2BDOA 1XX8A 3VYRA 4DV3L 3HOUG 3D6CA 2BA0A 4PZ6A 3J81L 3Q22A 3FPUB 5IGDA 3PO3B 3E0EA 2A19A 4DR1Q 5JPMC 2FMMA 5FO9B 4GNXC 3MC0B 2IX1A 1ENAA 4OONA 5A35A 1UWVA 3J7AF 4OX9L 1GHKA 3HOZB 4DUYQ 1UE7A 2E2IH 4KKSA 1G91A 2L11A 1M8AA 3NBIA 1N36L 1TWFH 3Q23A 2CH4A 3HOWH 3S17H 3CW2C 3TSSA 3W5OA 3F1ZA 5FLMH 3NWSA 3KF6B 2HIVA 2NVYB 1GXDC 1Q1BA 4FDBA 4IFDI 1HZCA 1IBKQ 1STNA 2I5MX 3NUCA 1Y1VH 4DR7Q 3T4AC 4X66Q 1CTMA 1KQSA 3RD4A 1B3AA 1TWAH 1E7ZA 1FYCA 5CBEE 3TRZA 2V1CC 3T1YL 5E4XA 1HZ9A 1D5MC 1TVXA 2NTSA 2ZTEA 4E6IA 3GTGH 4A3MH 2JA8H 1T5XD 4DUZL 1U4PA 1HNWL 2MFIA 3M4YA 1JWMD 1VF7A 4A3CG 3NE5B 1JOOA 1L1OC 4LF4L 1JE4A 2D0OA 3FKIB 5IE8A 2XSCA 5KIXA 1EU4A 5GQOA 2WIIB 2OQ0A 1XTDA 1YHBA 3HS0C 2JEBI 3L9AX 4OWTB 2ENBA 1SYCA 1BQQT 3VR4A 1VQJA 4UAIA 4C3HG 4BBSH 5K36H 4O1NA 1O7LA 1F77A 1ICFB 2ZTDA 1JB7A 2F0FA 4CBVA 1NCVA 1LO5D 3ZYYX 3NBHA 4J15A 3D31A 4QIWB 1GUSA 1PHJA 1KXLA 1QUQA 1KDCA 3CCVA 4DXGA 4A3LG 4A3FH 2L0CA 3PIPA 3KOJA 4A3KH 3I4LA 5G3LD 3A54A 4POFA 1VQ7A 2K5HA 1G6ZA 1HR0L 1KTKA 1JR0D 4B3RQ 2FMCA 4CJ1B 1PZKD 3GTJH 3CMEA 2JJQA 3TBIB 1IKMA 4ZQ3A 4HIOA 1OXVA 2RBMA 1N8RC 3C3LA 1HUNA 2OCEA 1FGBD 3U9SA 2EYHA 1X65A 4X65Q 1VQNA 1O78A 4OL7A 3HOVB 4R9WA 4PZ8A 3M4PA 3X3MA 1X54A 4QGUA 4IPCA 4JI1Q 4C1NK 1FNWA 1S5FD 1XXGA 3D3RA 3K58A 4DV4Q 4DV0L 2RKSA 3C46A 1ILPA 4DV7Q 1A3UA 3AYHB 1X9NA 5CV8A 4DV5Q 2SNSA 2WACA 1U9RA 2XTIA 5I6WA 2IJ0A 2JE6I 4PMBA 3MHBA 5ELBA 1YHAA 4DR6L 1B70B 2B2VC 4GOPB 4DR2Q 2F0IA 4FF3A 1SROA 1HNZQ 3PUZA 3A56A 2O5JC 3KF8A 1D2BA 5DM73 4J6HA 4ULLA 1D1KA 1GUGA 3FKIG 3IFTA 3OWFA 4B3SL 1Y1WG 2QDBA 1TY2A 2OWOA 1H9SA 1PRTC 4HSVA 2Z4IA 2F0LA 4K8JA 2V4DA 3AQQA 2AWOA 2DNEA 3J80i 1NSNS 1NY4A 1SLJA 4P75A 4X3TA 1SNMA 4DK1A 3KLRA 2BE5D 2MO0A 1QZGA 3NELA 1W6KA 4IJLA 2MGSA 2CW0D 5KYLA 1PTOH 3RN5A 2VB2X 2B63B 3I73A 1GUWA 4HTHA 4KN4C 3PUVA 1PH8A 1DYQA 1VQLA 2PQAA 3QOJA 1XMQL 3NENA 3NHHA 1B7YB 2ZJQA 3B6YA 1STHA 4IUPA 3OSOA 1TWFB 4DFAA 2NVTH 1SBBB 3CC4A 3HOWB 4A93B 1O7YA 4PV1C 2A5HA 4AIMA 4OWXB 4R4OA 1Q46A 3GDEA 3KF8B 3DXJC 5EBDA 2F0QA 4NPSA 2KA7A 1SE3A 1E0BA 2DJGC 5C0XJ 2Z0SA 2WB1B 1X6OA 2NVQB 2KUMA 4BY7H 4JI5Q 1EY8A 1RDPD 3H0GB 3K57A 3P7JA 1HTLD 2Q8IB 3BDCA 2B2TC 4ZAIA 1I4HA 4G4KA 4F8MA 3Q8DA 1O7IA 1A62A 1D1IA 4A3EH 1EY6A 4XTCS 1VQ5A 1JJGA 2LXJA 2EVBA 3TP7A 3KBGA 4MNOA 5EKIA 4WJWA 1HH2P 4CDEC 4XIGS 2JA8B 1SNOA 3S1QH 1OXXK 1V1QA 1CHQD 1HZAA 1F2MA 2FINB 2PQAB 4DV1Q 3LNNA 4RGMA 4JI2L 2VY3A 2R7ZH 2UU9L 5IWAQ 1MBYA 2LKVA 3QR8A 1SN8A 5IGFA 3T13A 4UPAA 1DOLA 1SDFA 5IYDG 3AEVA 4HJ8A 3CPWA 2KEEA 5H1SE 4JI0Q 3K7AH 4AQYL 4A3IB 5M3FB 2H5XA 2KJXA 4UP8A 5FK9C 2PMZB 2PZUA 4LF7L 4BBRH 4JBMA 4DAYB 2BH2A 1PFNA 1FNUA 5GADC 4X62L 3HOYH 1VQMA 2DY8A 5ELFA 4OO1I 2JYOA 5IGBA 2EJMA 2F3VA 1CHPD 1SR3A 1NMGA 2QF7A 2ZXOA 1K8GA 1FVIA 1EYAA 3PIP3 3QIAA 3QG1A 3PIOA 5C6AA 4A3FB 4A3JB 1Y8OB 1YEZA 4RKBA 4HJ9A 4FXKC 1IW7D 1BCPB 2IPKD 4IOCA 3VR3A 1WI5A 1B8AA 2MP1A 1MHWC 5I9OA 2TSSA 5JPNC 1YJWA 5IGCA 2F0UA 3S1NH 1QNKA 2XWJB 3HOWG 1IYJB 2Q8RE 4Q0FA 2A74C 4EVOA 3UI2A 2RDHA 1KNEA 2Z9HA 3D4WA 4UDUC 4ALPA 4GLAC 4OGQC 5EPJA 2KBNA 2RCFA 5F2DA 3UE1A 3L7ZC 1HFGA 3K5LA 2WB1G 1Y1VG 4K5VA 1YBYA 3JAMc 4TKOB 1SYBA 4HJAA 4DA2A 3K5MA 1HJPA 2F0SA 4DV6L 1CKOA 4UHVA 1KDAA 3OW2A 3ULJA 1PH4A 4XYQA 1CKNA 1ONLA 4ZCKA 3QWNA 4KK7A 2HHHL 4IOAA 2B2UA 1B2TA 4IO9A 4GLXA 4GS3A 2MPMA 1WFQA 1STEA 2JA8G 1EIGA 4JI8Q 3R3OA 2KHSA 4K5XA 4DR5Q 4JI4Q 2AQ2B 1X3FA 2EQSA 5C4ZA 3KLSA 1Z7TA 5KNBA 2EDGA 1O80A 3E0JA 5E7NA 2LY7A 2C9OA 4NP5A 1Z9FA 3GV6A 2X6GA 4R8NA 3S14B 1DGSA 1VQ8A 4A3BH 4QL5A 4A3DH 2HDLA 5CBAE 1R9TB 2IHFA 3HKSA 4L5QA 3S1MB 3FHWA 4JCVE 1B9NA 3ITPA 4Z9CB 2EYPA 5JAVA 3CHBD 5IYBH 2I5HA 2LMCB 5ELEA 4DV2L 4BBSG 4RCOA 5K36G 1S40A 2E5LQ 2VQEL 4G7OC 3A7AB 5CGKA 1FNVA 4A3GB 1PTOB 1CKNB 3KBXA 4C3HH 3EROA 1UE6A 1AP0A 4HR7B 1C7YA 4K0KQ 1F2LA 2EY5A 3BVZA 4A3FG 1YNJC 4A3KG 1IHZA 3I3CA 3PO3H 3MXUA 2PMZE 4K6LA 3M7NA 1L0WA 2Z1CA 1A3TA 1CSQA 3CU7A 3SK5A 2F0OA 2HUGA 1LTTD 4HSPA 2AUKA 4DV3Q 1YI2A 1AZPA 2F4VL 5A2QL 2F03A 1AH9A 3HOZH 2K04A 3EN2A 4QY7A 3KDFA 4BY7B 4LK1C 1VQPA 1B53A 4FYDA 1K3BC 3IKJA 1C0AA 4XT1B 1BBWA 4EQNA 2NVYH 4OX9Q 4JG2A 5KGUA 1BCPF 3K59A 4FF1A 4GN4B 1N36Q 4QUCA 1KRSA 3PUXA 3HP3A 1F9RA 1NMFA 5EAYA 4KJOA 1XYIA 3S1QB 2OQKA 3K8AA 1VCIA 4DK6C 2JQOA 4C3JB 2L9HA 1MKHA 3D0FA 3OWEB 1JICA 2D62A 3U4VA 2HQEA 4GKKQ 2XRQD 1XPUA 4FO2A 2BA1A 4TVAB 1GVPA 3T1YQ 2KHJA 1DCZA 3MZ5A 4N9PA 5KEEA 3TZUA 4DAPA 3AFPA 3BZKA 4H7BA 2D9UA 3KDFB 1IBML 4DUZQ 5DAUA 1Q7YC 4LUZA 2D5DA 4RG1A 2NZ1D 5ELOA 4OXPA 1QILA 1HNWQ 1GOZA 3MTSA 3AMUA 1JOQA 4APVA 2VQFL 1Z6HA 2NWGA 4RHRA 1NAPA 4JI3L 3STBC 4C3IB 4O2DA 3S24A 3UDFA 1SAPA 1I94L 1NTGA 2F0VA 3M4OB 2PQEA 4LF8L 1SXTA 1EEID 3BYYB 3VA5A 1B50A 4LNQA 3F2BA 2K7VA 3I4OA 5IT9E 1HR0W 3DM1A 2I46A 5JOBA 1BNZA 4TQUS 3CCUA 4FXGC 1PTOF 1Q8IA 3K7UC 3L3OC 1LT3D 4Y7NH 4OHJA 1YIJA 2N3SA 4BY7G 1VS0A 1EEFD 1I6VC 2XVSA 2EYOA 4A76A 3NQTA 4LF5L 1J9OA 4DNRB 3C2PA 1I6HB 2FHTA 2EZVA 1HR0Q 1Q3LA 3BU2A 3BVGA 2HT1A 3HOVH 4A3EG 4KV6A 4IUNA 4H44C 3CF5A 3RNUA 1YZ6A 2IL8A 4L5TA 3V96A 1SMXA 1K28A 3EA6A 1EQVA 2EYLA 1A8VA 2L15A 4PMCA 1TIID 1PRTD 4M8AA 4S3SA 3DMUA 3A5ZB 4PZ7A 2F0JA 3PSIA 1LACA 3GD7A 2PW7A 1EQTA 4A75A 3I4NB 1VMCA 5CV9A 2F0HA 1ILQA 3T51B 3L2PA 5D65A 1N34L 2KOLA 2UXDQ 1S72A 2HIXA 4P71A 4DV0Q 1K8OA 4KD3A 1PFSA 2F0DA 5IODA 3D4RA 1N33L 1X3QA 5AJ3L 2N49A 5CYUA 1GO3E 1M4VA 4AYBG 5COYA 1H9RA 4L63B 4KHVA 4F87A 3KF6A 1Y14B 4U68A 3E9HA 4JI7L 3PV0A 5L37A 3J7ZC 1BBUA 4DR6Q 4QQBX 3HOYG 1OO9B 1IKLA 5E4WC 2LXKA 1AE2A 4CKEA 1OXSC 2HQLA 3HKZG 3VA7A 3T16A 3AU7A 2K5DA 4FNFA 3S2DB 4B3SQ 1V8QA 4EX5A 1N9WA 1V1PB 2RQXA 4LW1A 3RUZA 4KD4A 2F3IA 3U50C 3CCLA 2B63H 5BN4A 2WP8J 3NXWA 4HMIA 1RJTA 2YTXA 1EQRA 3TDQA 5GAEC 1KLGD 3BYTB 5CV6A 5J3BA 1I5FA 1HQMC 2QEXA 4A93H 3K81C 1KLUD 4LUOA 1WTHA 2QCPX 2H1EA 1XMQQ 1BXTA 1PXUA 2CWAA 3BZCA 4Q5VA 4CKBA 3CCEA 4K5WA 4B3TL 2NVQH 1BO0A 1WTRA 1KAWA 2MHVA 1CZWA 2CHBD 4ZRZA 3H0GH 5C44B 1RF2D 1SYDA 5I6YA 1U4LA 2RF4A 5C5MA 1XJVA 1PH6A 2K75A 3DHQA 2PNRC 3LX0A 4H0LC 3T1HQ 2B8FA 1K83H 3C1FA 1OXUA 3LGJA 1SNCA 3U9OA 4R1JA 3I4NG 4I7ZC 4KKUA 4RH6A 2UUCL 4HJ5A 4B3ML 4N8X1 4LUVA 4A3BG 4X6AH 2XIWA 2K5NA 1GHJA 4A3DG 4JV5L 1VDZA 2QA4A 3FEWX 1Q81C 3GTPB 3M4QA 1B9MA 2BH8A 1L1OB 1Q12A 5IYBG 3QO2A 1I4GA 4JI2Q 4K6DA 4RGNA 2J0TD 3RLNA 4FVMA 1PH2A 4A3IH 5M3FH 3CD6A 4ME5A 1XMOL 2N88A 4NDXA 2JN4A 1E1TA 1O7ZA 4KKTA 5FJ8G 1IBLL 2K5VA 3T56B 3ICEA 1VQBA 4AQYQ 1SJED 1WCMB 3PO3G 2PYKA 3FVQA 2N78A 1PYBA 4A3JH 4JBJA 3VYTA 4HIKA 1W2BA 3R8BA 5LMNL 5M5YB 5FO7B 4DPGA 4X62Q 3OMGA 3HOZG 3A74A 5JVH3 4GOPA 4YWLA 1U4RA 2B39A 4AH6A 4ZYSA 2CQOA 3SDZA 4Y7NB 3TP8A 1EUJA 1VQCA 1XNRL 4LAAA 3CMAA 3GTMB 4KHZA 2A69D 2E74C 1EFWA 3CQZB 2A1AA 5IGEA 2RA4A 3H3VC 4JC0A 5JJKA 4RAUC 5EKKA 3I4MB 2K4KA 1EU3A 3J81i 1H9KA 1FL0A 2L12A 2VS1A 3LWEA 4PQXA 1TWHB 2B8GA 2CWPA 1YHQA 1LT6D 4DN4M 4MZ9A 3FMCA 1VQ6A 1WD1A 5D3IB 2I0QA 2L5TA 4P74A 2IY5B 3H3VI 3M9BA 2E2HH 3DWPA 3CRLC 3UDIA 1LLRD 4FF2A 4CDDC 2CQAA 3CAMA 2HHHQ 1YITA 1QVGA 4XQQA 3D6WA 4WFN3 2NBFA 1VQ9A 3J80E 1PH7A 3S14H 2PZTA 1MSHA 1YNJD 3OTOL 4JI6L 3K0XA 2ZT9C 4MTNA 1QJOA 1DXMA 1UEAB 1R9TH 1GUOA 2PI2E 4UY8C 1VQHA 4EGVA 2UUBL 3S2HB 1VQFA 3J81j 4GOPC 3S1MH 1PH9A 2RCNA 3SGIA 2B29A 2YU9B 2LS01 1ZKOA 4LFCL 4Y52H 2RVLA 5BR8L 4A3GH 1X3PA 2YYZA 1WCMG 1E1OA 3MA2B 3QJYA 4DV2Q 1TR5A 3RMHA 2VQEQ 1G6PA 2OEOA 2YTYA 1PDQA 2D0PA 2KECA 2O4XA 2R92B 1KNAA 5J1ZA 3HZXA 2JA7B 3G48A 2NN6H 2ASBA 2IHEA 1KDBA 1EFID 3DEOA 3EQLC 4YCWA 2E76C 2K6AA 5ELCA 3PF5A 2QEJC 2G9HD 5E3FA 3TN2A 3HOVG 1X56A 3A55A 2O5IC 2XNAC 5EPKA 3CCMA 4DAYA 2F4VQ 3J7YW 1TS5A 1HXYD 2L4NA 1MI2A 2UXCQ 2HDMA 3DWAA 1LTID 2K28A 3SXHA 1K83B 5IOCA 4J1MA 3VDYA 4OWWB 4XQJA 3HGBA 1F2YA 4C3JH 1NR2A 5IP9H 2LSSA 1RHPA 4R8IA 2Q2IA 2WKDA 1NE3A 2VUMB 1C4QA 4GKJL 2ZXPA 2F0MA 2Z8LA 5FLXE 4DXFA 3G7LA 1AN8A 3A8KE 2OXPA 2EXDA 1MGSA 1I3QH 2Y0SE 2RHQB 3G6JB 4LF6L 1GJXA 5IYCH 4OIJA 4X3SA 1TU2B 1STYA 3D8GA 5LHY1 2F4IA 2KCCA 1KHIA 3VYSA 2K52A 1WVLA 4EQOA 3MXNA 2BCOA 2R61A 2O2LD 2YV5A 1VF5C 1HTPA 1KC8C 1JC7A 1K0RA 3VYUA 1HNXL 2WAQE 1IBMQ 4C3IH 1PH1A 1D5XC 2B63G 2AQ1B 1ASYA 3TZDA 2PNHA 1KABA 2E2JB 3M4OH 4NXNL 2ES2A 3NEMA 4ZUJA 2VQFQ 1EWCA 2PW5A 4XXEA 3F2UA 2F0GA 1XNQQ 4JI3Q 1QOHA 4A93G 1ESFA 1I94Q 2MO1A 5J22A 1S5BD 2JA7G 1S5ED 2E2DC 4OELB 2SNMA 3OPOA 1BCPC 5C3WA 4LF8Q 3S15H 2EY2A 2F3WA 5TSSA 1D7QA 2RSOA 1TWCB 5ISRA 3K5NA 3KLSX 5FOBB 3H0GG 3K80C 2ZJRA 3SK4A 2AQ3B 1I6HH 3PQIA 2KCMA 1KD1C 2CCZA 2J4XA 3MXNB 5J39A 5D14A 3O13A 4G57A 2ATWA 1I4PA 1EY0A 4DV4L 1V9PA 5LMUL 1YJ9A 1UE5A 2RDFA 1NJIC 1PYSB 2E2HB 4HN7A 1QE6A 1XPRA 4IUUA 1EY9A 3J7AV 1WTOA 3NPPA 1PFBA 2MUYA 4DU9A 3KK7A 3I4NH 3X3NA 1HQRD 2MNAA 2VUMG 1S5DD 1ET9A 4DR2L 4RGTA 5JJLA 5FO8B 4V0BA 2G5DA 4X3UA 1A15A 5JEAH 3RR5A 2SEBD 4B9WA 2XN9C 2VB3X 5M3FG 4A3IG 4BXXH 4R4IA 4MTKA 5C3EB 4IZ8A 3SVMA 5CMDA 3GQBA 1N33Q 1PZID 1CT1D 1VMPA 3AFQA 5FJ8H 4YCUA 3CP0A 3S2DH 1B44D 3E6ZX 4O42A 4A3JG 4JI7Q 4BWGB 3CKIB 1EZ8A 1QWYA 3H15A 3D4DA 4P72A 2F52A 1PTOC 4K14A 5EPLA 1JWUD 1BR9A 1CFMA 1YNNC 2B2UC 1Q8KA 3TEHB 2Q2TA 4ZUIA 2A6HC 1K3RA 2JK8A 4NB3A 4TRDA 4NW2A 2B2WA 3DUZA 3K5OA 1GUTA 1A6XA 3FPPA 1PYWD 1WTPA 2FXQA 1JJCB 2EY6A 1BBXC 3ERQA 1VQAA 1Q1EA 1C9OA 2KENA 5KNCA 4JI5L 3G4SA 4LFBL 1T9HA 4XQNA 4A4IA 1UE1A 1DOKA 4GN3B 1BVSA 1TKWB 1IL8A 1AW7A 4JK1C 4RWSC 5NUCA 3IAYA 4KN7C 5C44H 1X3GA 1E3PA 2JP1A 1EY4A 1H9JA 2R7DA 1DZ1A 4B3TQ 4DR3L 3TQYA 2NN6I 4DAMA 3E3XA 2GVAA 2I07B 3J80c 5IWAL 3NSWA 2JA6B 1NUCA 2BOSA 1N32L 3QB3A 2FJ2A 1B3QA 1I3QB 3HFZB 5EBCA 5G3LF 3KJOA 2NZHA 5IP7G 1U0LA 2K1BA 1LTAD 3GTPH 1JMCA 2B2YA 3GTLH 2K5WA 3KYHC 2L55A 5JEAJ 2BDNA 2EXZA 1SE8A 4R4QA 1AZQA 4YWMA 2NTTA 5KYIA 2K5QA 1V43A 2CH4W 4I65A 3IFDA 5ELNA 4LMQD 1STBA 2B2WC 4A3GG 4LF4Q 4P2CB 3E9IA 3H91A 1G51A 1WTVA 1HUMA 5DLQE 2Z6KA 3PMFA 1XTCD 2F0WA 3I2ZA 3KFUA 1PFMA 3PO2B 1WCMH 1XMOQ 1EY5A 3TREA 3R2TA 3MXGA 3U58A 4PG3A 1A63A 1IBLQ 1HHVA 1CUKA 1L0YB 2ZJPA 4H13C 5M5YH 2NN6G 1JOKA 4JBWA 4IUVA 3GTQH 3HOUB 3S15B 4EQ5A 1LM0A 4H02A 1QCBD 3M85A 4BY1H 4DKAC 3GTMH 5DM63 2EYMA 1SRUA 3UDGA 4M1UB 1CQVA 5LMNQ 1DM0B 3CQZH 4X64L 4P73A 3KLWA 1LTGD 2UXBL 1U5KA 2CVRA 1F9SA 2R93H 1VQEA 5A2QE 3I4MH 2A68C 2RSNA 1V1PA 4HCEA 3A8IE 1TWHH 1CA6A 1K0SA 4C3JG 1SFOH 5IP9G 3P1HA 5GAHC 4K8IA 1J5EL 4QB4A 1FJGL 3NTHA 3I90A 1RD9D 3NWTA 1EYCA 1EIFA 1F9QA 1OTCA 4KJNA 4BA1I 2N8NA 1WJJA 1VQOA 1UNSA 2K03A 1H95A 4IALA 3BZDB 1BKBA 1ZXTA 5IYCG 1WTXA 4MHEA 3LWUA 2UUAL 3W1GA 5E1FA 5EGTA 5HY6A 3S2HH 3H6MA 2JA5B 4KLKA 1PH5A 4KHPL 3MEHA 2EPBA 2RDGA 4OEMB 2YU9H 2A8VA 4C3IG 1HFNA 1TQOA 1X32A 2L1BA 4YY3L 3OTOQ 5I4DA 1WOCA 1GM5A 3U4ZA 1WTWA 1SYFA 1A3VA 2EYFA 2PI2A 3G71A 2JXMB 3R93A 4N9TA 3V2TA 2AMCB 1TY0A 4YWKA 5C4HA 3R2IA 4IQZA 3BJUA 2Z6BA 4GNXB 1Q86C 5I2XA 4NMZA 1R4PB 2TMPA 4LFCQ 4UP9A 1ZYRC 5BR8Q 2IX0A 1IYVA 1NBWA 3RZDB 1L0XB 4AYBE 2NVXB 1ASZA 2R92H 1L1OA 3CXCA 2D2CC 2VZAA 2K05A 2JA7H 1Y8PB 3HOXH 3HEJA 2M00A 1XPOA 1VQKA 3EVQA 1WYDA 3SHLA 3ONAB 2QW7A 1JCKB 4FF4A 2A6EC 4O0AA 2GN5A 1ENCA 2NUCA 1SSOA 1EOVA 3HKZE 1BOSA 2OTJA 1BDOA 1DOMA 1UAPA 4CDCC 4OIKA 2LFNA 5M5XB 4LF9L 5EKLA 4HJ7A 4RGOS 5AFWA 3BS1A 3K0YA 3JAME 3OYYA 5BN3A 4JYAL 3EJIA 3J80L 5CORA 4GKKL 3W2DA 3I91A 3L0OA 2WV6D 5JEAG 1K9MC 4RA8A 2VUMH 2EJGC 4BXXG 2DGYA 3GTLB 1M1KC 3JAMi 4ILWA 2UU9Q 1CZGA 3GO5A 4WJ3M 3MWYW 1K8MA 4OO1H 1DD2A 1J6QA 4GKJQ 3PGZA 2JA5G 3V05A 1T5EA 1AFPA 3GTOB 1MD2D 3GTKB 1D6EC 1NR4A 5KNDA 4GZYC 1WD0A 1BCPD 4LF6Q 1Y1WB 3HG9A 1EIYB 3CRKC 4MN3A 1MIUA 1I50B 4L5RC 3S16H 4X3KA 4LF7Q 2KEDA 1X55A 3OHXC 4KY7A 4CJ0B 4R4TA 1F9PA 3AB9A 2E2JH 4CGYB 4RHSA 5JVG3 3BG3A 4JBKA 5HGTA 3GTQB 4IFDG 4B9XA 3URYA 4ZK9B 3PUWA 2ICIA 4RFBA 4KTAA 1TXYA 1M90C 5C5LA 1HNXQ 3W1BA 2B2VA 2K32A 4BY1B 5DEHA 3BDLA 1CM9A 1E24A 1HCZA 4C2MB 1G2TA 5CV5A 4YCVA 4NXNQ 2EOTA 3J81E 1WTQA 4HIDA 2M9VA 4RMFA 4LFAL 2R7FA 4DR4L 1TWCH 4IPGA 1GUNA 1SE2A 2H4OA 3IL8A 2R93B 5C44G 1TS4A 5LL6X 1CK1A 4KMUC 2N55A 1CA5A 1RODA 5C0XH 3A0JA 2PPBC 4F88A 2X69A 1EYGA 2R6GA 3M3YB 1SFOB 3DM3A 5CV4A 3MEFA 1EL0A 1SNDA 2Y0SB 2ZM6L 2JEAI 3CCQA 3DLLA 3VR2A 4DV6Q 3WDNA 5C4JB 3S1RB 3OIPA 1IYUA 5FLXL 3K6OA 4DK0A 5ELDA 2UXDL 4K2LA 4MIUA 3H09A 2A73B 5LMUQ 2HCCA 2ZTCA 2WAQB 1RTOA 1BUVT 1XWEA 3NBHB 1H9MA 4HAEA 1QUQB 5IP7H 3PCOB 1VQ4A 1PTOD 2HCIA 4NXML 1PRTB 1TWGB 1B1ZA 2VXWA 1QZHA 1YNND 5CV7A 2IX3A 5C3EH 3MFYA 1C8CA 2MQHA 4YHHL 4K0KL 2A6HD 1JE5A 5GAGC 3WWVA 1Q82C 2B2TA 4RKLA 1SNQA 1JORA 3F8TA 5IT9c 3TMEA 5C4XB 4G7ZC 4L5SA 4DR1L 5KRUA 2I5LX 5GROA 3KJPA 3TS0A 1EOTA 1DONA 1TS3A 2XWBB 1SMYC 3CPFA 1EIHA 1NNXA 5LL6S 1RTNA 3FDTA 4GN5A 4DUYL 4PNYA 1KAAA 3E5SA 5M5WH 4BY1G 3CC2A 3HOXB 3RZOH 2F0EA 1QG7A 1B4OA 1E2ZA 4ZKBB 4TSSA 1JB3A 3I8ZA 2NB0A 2QKIC 2ID0A 2E2IB 1P8LA 1JT8A 2XRSD 1TS2A 1PLFA 1IBKL 1FD7D 4XT3B 4UP7A 1VQIA 2R93G 1SYGA 4DR7L 3W3AA 3S17B 2EIFA 4X66L 3I4MG 3M7GA 2AUJD 2ICEC 1HA5A 2EJFC 5JJIA 1SEBD 3EIVA 4POGA 4QIWE 1Y1VB 2Y0SG 3FP9A 1H9SB 1CSPA 5M3MH 2ALYB 4LFBQ 1QVCA 3T1HL 1TWAB 2Q2UA 4CJ2C 3RLFA 1EZ6A 3ND9A 1JJ2A 5D3DA 3STBD 1QNUA 3ND8A 3GTGB 1MJCA 4A3MB 2JA6H 2WAQG 4K2KA 2JA9A 3BDOA 5CR3A 4DR3Q 1PMRA 1UEBA 2HD3A 3G6EA 1SE4A 2VNUD 3I56A 1N32Q 4DNTB 3GV3A 1EWHA 2P5ZX 1ENFA 1SYEA 3OMCA 3CCRA 1SNPA 4ME3A 1KIXA 4J8QA 1HA6A 2KHIA 3OIQA 3N52A 3S16B 1MJEA 3IRBA 2Q2HA 4FP5D 3A7LA 3RLOA 5C4XG 3H94A 4R4CA 4CHTB 3WOEA 4BBSB 3PO2H 1RIPA 4WJ4A 4KY6A 1Y69U 1PRTF 1A2UA 2NZOA 1W3SA 4RCNA 3OOCA 3TP6A 3NTKA 4IN3A 2R92G 3NK9A 1BF4A 4B3RL 2A68D 1V1OA 3HOXG 1D8LA 4WORA 3HOUH 4A3KB 2Q8TA 1LUZA 1QVFA 3NP8A 2JSOA 2MJ8A 3FRPB 5DNFA 4X65L 4BS9A 3GTJB 3GP7A 3MVVA 4JI1L 1LABA 5EQ0A 5FLMG 5K5PA 1JQYD 1W6JA 4ID6A 4HEDA 3SK8A 1ET6A 4LF5Q 3Q0AA 2C5CA 4DV7L 4X64Q 2GVBA 2XGTA 1ZEQX 2J7ZA 4DV5L 2UXBQ 2F0NA 1X3EA 5IIFA 3C1EA 3ULPA 4HCSA 1S5CD 1CKMA 3UE0A 2CKZB 4JW0A 3HRZC 3QOLA 1HNZL 4A3MG 4DAVA 5T1GA 1II3A 1ML0D 1PA6A 1LT5D 2K14A 4YIJA 1HPCA 1Y8NB 2WB1E 4IUQA 5C0XI 2A69C 4OO1G 2F1MA 4HIMA 1J5EQ 1FJGQ 1HRJA 2DNCA 1N34Q 4GLVB 4IUTA 5HURA 3CCSA 3I72A 3P75A 3EFXD 1ZYRD 1LV9A 3UDXA 5AJ3Q 2CFMA 3EBEA 2AWNA 1EQQA 2RHSB 5M9OA 4QF4A 1PVOA 2JA5H 4A3CH 2EY1A 3NTIA 3SK6A 1P16A 2PO4A 2WFWA 2IWHA 1E2WA 2UUAQ 1KRTA 5IT9L 4IJHA 1F2ZA 5EJWA 1PV4A 2SOBA 2GA4B 3S9WA 1RL2A 1FR3A 2A6ED 2EYJA 1RCVD 1ICWA 3I70A 4KHPQ 3TS2A 3I55A 1STAA 3F2DA 1YNXA 1YJNA 5M5WB 4YY3Q 4XDXA 3RZOB 4C56C 3J81c 4PMWA 4IFDH 4C1NI 3BVMA 3DWQA 3P20A 5I2YA 2ZXRA 3F2CA 3TP5A 3RZDH 2NVXH 1G2SA 4ABNA 2PCFB 1R4QB 2NVTB 2DN8A 2SDFA 4JPBW 3JC66 4KI0A 5T1IA 4N8FA 4A3LH 1IZ6A 2AKWB 5C0XG 1AE3A 3SE0A 5FKAC 3PF4A 1LYLA 1I4QA 4JVZA 2BE5C 4LJZC 1YVCA 4CKCA 1K73C 2UXCL 2CW0C 1EWIA 5M3MB 3CCJA 4G7HC 5M5XH 4QJFA 3J7A5 1KL9A 3VR6A 4LWCA 2PZWA 1MSGA 5I9PA 2WINB 4DV1L 2X6LA 4A3EB 2QILA 1VQDA 1Z47A 4LF9Q 3Q24A 3Q6SA 4DGZA 1G8ZD 1DJRD 1S3OA 3RN2A 4BA2I 1ESRA 4IURA 3VR5A 3KUPA 3ULLA 2R7ZB 2YTVA 4IPDA 3A5UA 4JI0L 2Z4HA 1S4ZA 1K8AC 2R3ZA 5C3EG 2UUCQ 4B3MQ 5IGGA 4JYAQ 1I4XA 2IW3A 2QDLA 3ER0A 1I4RA 4JV5Q 5BN5A 1GKHA 1JWSD 3K7AB 3GTOH 4QCLA 3SEBA 4AYBB 1J8IA 2DUDA 4ZKCB 2DJFC 4XYOA 3GTKH 2DY7A 4V190 1A2TA 1LTRD 4HMJA 1STGA 3FKIH 1LTBD 4JOIA 4BBRB 1Y1WH 1I50H 5LMNW 3PUYA 2F0PA 1CI3M 2AHOB 4B08A 3HOYB 1E2VA 2IT1A 1XNQL 3HKZB 3PIO3 4CDFC 3WOFA 1VQGA 5HGQA 1E22A 4QUFA 4F7XA 2K33A 3DEPA 4IFDJ 4C2MH 4L8JA 1IL2A 2OF1A 1LTSD 3S1NB 1L2FA 4DK3C 1LTLA 2VW9A 3A8JE 3T53B 1EYDA 2QGQA 4QMGA 1XNRQ 2KCTA 1LT4D 2C35B 3H3VH 4NKLA 5M3MG 2B2YC 3M3YH 4LFAQ 4DF7A 3NQIA 3MXPA 1AEXA 1Q90A 1D5ZC 4JI8L 4DR4Q 1TT2A 1IW7C 4DR5L 1PZJD 4JI4L 3JAML 1CQFA 5FLXc 4U673 4GNXA 2OT2A 1A0IA 4EQPA 3N6RA 3ZJYC 2M2LA 5C4JH 4IPHA 2WKCA 3S1RH 2JA6G 2Z6KC 1RKNA 2OTLA 4ZLTF 1QB5D 4WRDA 1SJHD 4JOIC 2ZM6Q 2R7ZG 2FFKB 4DNIA 1G291 3CC7A 3I7FA 3MFGA 2B3GA 2KQ3A 1EY7A 1UUPA 5CC4A 4FXDA 2E8GA 1SMYD 1FGUA 1PH3A 2E5LL 4A3BB 1TWGH 2F0TA 1U4MA 4L6TB 3SR1A 5C3XA 5IY0A 1IXRA 4A3DB 3ERSX 2K50A 2G9DA 1C48A 2KCNA 4ODGA 4JI6Q 5JJZA 4I7AA 3OW7A 5IYDH 2VL6A 2NYZD 2K01A
chains in the Genus database with same CATH topology
2KVMA 3MAQA 2EE1A 4KY5A 4C3HB 1OXTA 2E75C 2F0KA 2BDOA 1XX8A 3VYRA 3D6CA 2BA0A 3J81L 3Q22A 3FPUB 5IGDA 3PO3B 5JPMC 2FMMA 5FO9B 3MC0B 2IX1A 1ENAA 5A35A 3J7AF 1GHKA 3HOZB 4KKSA 1G91A 2L11A 1M8AA 3NBIA 3Q23A 3TSSA 3NWSA 2NVYB 1GXDC 1Q1BA 4IFDI 1STNA 3NUCA 3T4AC 1CTMA 3RD4A 1B3AA 1FYCA 5CBEE 5E4XA 1D5MC 1TVXA 2NTSA 4E6IA 1T5XD 1U4PA 3M4YA 1JWMD 1VF7A 3NE5B 1JOOA 1JE4A 3FKIB 2XSCA 5KIXA 1EU4A 2WIIB 3L9AX 3HS0C 2JEBI 2ENBA 1SYCA 1BQQT 3VR4A 4UAIA 4C3HG 5K36H 4O1NA 1O7LA 1F77A 2F0FA 4CBVA 1NCVA 1LO5D 3ZYYX 3NBHA 3D31A 4QIWB 1GUSA 1KDCA 4DXGA 2L0CA 3I4LA 5G3LD 3A54A 1G6ZA 1KTKA 1JR0D 2FMCA 4CJ1B 1PZKD 3TBIB 1IKMA 4ZQ3A 1OXVA 2RBMA 3C3LA 1HUNA 1FGBD 3U9SA 2EYHA 1O78A 4OL7A 3HOVB 4R9WA 3X3MA 4C1NK 1FNWA 1S5FD 1XXGA 3D3RA 3K58A 2RKSA 3C46A 1ILPA 1A3UA 5CV8A 2SNSA 2WACA 1U9RA 5I6WA 2IJ0A 2JE6I 4PMBA 3MHBA 5ELBA 2B2VC 2F0IA 4FF3A 3PUZA 3A56A 2O5JC 3KF8A 1D2BA 5DM73 4J6HA 4ULLA 1D1KA 1GUGA 3IFTA 3OWFA 2QDBA 1TY2A 1H9SA 1PRTC 4HSVA 2Z4IA 2F0LA 4K8JA 2V4DA 2AWOA 2DNEA 1NSNS 4X3TA 1SNMA 4DK1A 3KLRA 2BE5D 1W6KA 2MGSA 2CW0D 5KYLA 1PTOH 2VB2X 2B63B 3I73A 1GUWA 4HTHA 4KN4C 3PUVA 1DYQA 3QOJA 3NHHA 1STHA 4IUPA 3OSOA 1TWFB 4DFAA 1SBBB 3HOWB 4A93B 1O7YA 4PV1C 2A5HA 3DXJC 5EBDA 2F0QA 2KA7A 1SE3A 1E0BA 5C0XJ 2WB1B 2NVQB 2KUMA 1EY8A 1RDPD 3H0GB 3K57A 3P7JA 1HTLD 2Q8IB 3BDCA 2B2TC 4ZAIA 1I4HA 4G4KA 4F8MA 1D1IA 1EY6A 4XTCS 2EVBA 3TP7A 3KBGA 5EKIA 4WJWA 2JA8B 4XIGS 1SNOA 1OXXK 1CHQD 1F2MA 2FINB 3LNNA 4RGMA 1MBYA 2LKVA 5IGFA 3T13A 1DOLA 1SDFA 2KEEA 4A3IB 5M3FB 2KJXA 5FK9C 2PMZB 2PZUA 1PFNA 1FNUA 2DY8A 5ELFA 4OO1I 2JYOA 5IGBA 2EJMA 2F3VA 1CHPD 2QF7A 2ZXOA 1EYAA 3PIP3 3QIAA 3QG1A 5C6AA 4A3FB 4A3JB 1Y8OB 4RKBA 4FXKC 1IW7D 1BCPB 2IPKD 3VR3A 2MP1A 5I9OA 2TSSA 5JPNC 5IGCA 2F0UA 1QNKA 2XWJB 2Q8RE 4Q0FA 2A74C 4EVOA 3UI2A 2RDHA 1KNEA 3D4WA 4UDUC 4OGQC 5EPJA 5F2DA 3L7ZC 1HFGA 3K5LA 4K5VA 4TKOB 1SYBA 4DA2A 3K5MA 2F0SA 1KDAA 4XYQA 1ONLA 3QWNA 4KK7A 2B2UA 1B2TA 2MPMA 1STEA 1EIGA 3R3OA 2KHSA 4K5XA 2AQ2B 5C4ZA 3KLSA 1Z7TA 5KNBA 2EDGA 1O80A 3E0JA 2LY7A 2C9OA 4NP5A 3GV6A 2X6GA 4R8NA 3S14B 2HDLA 5CBAE 1R9TB 3S1MB 1B9NA 3ITPA 4Z9CB 2EYPA 5JAVA 3CHBD 2LMCB 5ELEA 5K36G 4RCOA 4G7OC 3A7AB 5CGKA 1FNVA 4A3GB 1PTOB 3KBXA 3EROA 1AP0A 4HR7B 1F2LA 2EY5A 3BVZA 1YNJC 1IHZA 3I3CA 3MXUA 4K6LA 3M7NA 2Z1CA 1A3TA 3CU7A 3SK5A 4HSPA 2F0OA 2HUGA 1LTTD 2AUKA 1AZPA 5A2QL 2F03A 2K04A 4BY7B 4LK1C 1B53A 4FYDA 3IKJA 4XT1B 4EQNA 5KGUA 1BCPF 3K59A 4FF1A 4QUCA 3PUXA 3HP3A 1F9RA 1XYIA 4KJOA 3S1QB 1VCIA 4C3JB 2L9HA 3OWEB 1JICA 2D62A 2HQEA 2XRQD 4FO2A 2BA1A 4N9PA 1DCZA 3MZ5A 5KEEA 3TZUA 4DAPA 4H7BA 2D9UA 5DAUA 2D5DA 2NZ1D 1QILA 1GOZA 3MTSA 3AMUA 1JOQA 1Z6HA 2NWGA 4RHRA 1NAPA 4C3IB 1SAPA 2F0VA 3M4OB 2PQEA 1SXTA 1EEID 3BYYB 3VA5A 1B50A 2K7VA 5IT9E 3DM1A 2I46A 5JOBA 1BNZA 4TQUS 4FXGC 1PTOF 1Q8IA 3L3OC 1LT3D 4OHJA 1EEFD 1I6VC 2XVSA 2EYOA 3NQTA 1J9OA 4DNRB 3C2PA 1I6HB 2FHTA 2EZVA 1Q3LA 3BVGA 4KV6A 4IUNA 4H44C 2IL8A 3V96A 3EA6A 1EQVA 2EYLA 4PMCA 1TIID 1PRTD 4M8AA 4S3SA 3DMUA 2F0JA 1LACA 3GD7A 2PW7A 1EQTA 3I4NB 1VMCA 5CV9A 2F0HA 1ILQA 3T51B 5D65A 2KOLA 1K8OA 4KD3A 2F0DA 5IODA 3D4RA 1X3QA 5CYUA 1M4VA 5COYA 1H9RA 4L63B 4KHVA 4F87A 4U68A 3PV0A 1OO9B 1IKLA 5E4WC 4CKEA 1OXSC 3VA7A 3T16A 3AU7A 2K5DA 4FNFA 3S2DB 1V8QA 1V1PB 2RQXA 3RUZA 4KD4A 5BN4A 2WP8J 3NXWA 4HMIA 1RJTA 3TDQA 1KLGD 3BYTB 5CV6A 1HQMC 1KLUD 2QCPX 2H1EA 1BXTA 1PXUA 4Q5VA 4CKBA 4K5WA 1BO0A 1WTRA 2MHVA 1CZWA 2CHBD 4ZRZA 5C44B 1RF2D 1SYDA 5I6YA 1U4LA 5C5MA 3DHQA 2PNRC 3LX0A 4H0LC 2B8FA 3C1FA 3U9OA 1OXUA 1SNCA 4I7ZC 4KKUA 4RH6A 2XIWA 1GHJA 1VDZA 3FEWX 3GTPB 1B9MA 1Q12A 3QO2A 1I4GA 4K6DA 4RGNA 2J0TD 4FVMA 4ME5A 2N88A 4NDXA 1O7ZA 4KKTA 3T56B 1SJED 1WCMB 2PYKA 3FVQA 3VYTA 3R8BA 5M5YB 5FO7B 3OMGA 5JVH3 1U4RA 2B39A 4ZYSA 3SDZA 4Y7NB 3TP8A 4LAAA 3GTMB 4KHZA 2A69D 2E74C 3CQZB 5IGEA 2RA4A 3H3VC 4RAUC 5EKKA 3I4MB 1EU3A 1H9KA 3LWEA 2L12A 4PQXA 1TWHB 2B8GA 1LT6D 4DN4M 3FMCA 1WD1A 5D3IB 2L5TA 3DWPA 3CRLC 1LLRD 4FF2A 2CQAA 4XQQA 3D6WA 4WFN3 2NBFA 3J80E 2PZTA 1MSHA 1YNJD 2ZT9C 1QJOA 1DXMA 1UEAB 1GUOA 4EGVA 3S2HB 2YU9B 2LS01 1ZKOA 2RVLA 1X3PA 2YYZA 3MA2B 3QJYA 1TR5A 3RMHA 2OEOA 1PDQA 2KECA 2O4XA 2R92B 1KNAA 2JA7B 3HZXA 2NN6H 1KDBA 1EFID 3DEOA 3EQLC 2E76C 2K6AA 5ELCA 2QEJC 2G9HD 5E3FA 3TN2A 3A55A 2O5IC 2XNAC 5EPKA 4DAYA 3J7YW 1TS5A 1HXYD 2L4NA 1MI2A 2HDMA 3DWAA 1LTID 2K28A 3SXHA 1K83B 5IOCA 4J1MA 4XQJA 3HGBA 1F2YA 1NR2A 1RHPA 4R8IA 2WKDA 2VUMB 1C4QA 2ZXPA 2F0MA 2Z8LA 5FLXE 4DXFA 3G7LA 1AN8A 3A8KE 2OXPA 1MGSA 3G6JB 1GJXA 4OIJA 4X3SA 1TU2B 1STYA 3D8GA 5LHY1 2F4IA 2KCCA 3VYSA 1WVLA 4EQOA 3MXNA 2BCOA 2R61A 2O2LD 1VF5C 1HTPA 1JC7A 3VYUA 1D5XC 2AQ1B 3TZDA 1KABA 2E2JB 4ZUJA 1EWCA 2PW5A 4XXEA 3F2UA 2F0GA 1QOHA 1ESFA 5J22A 1S5BD 1S5ED 2E2DC 2SNMA 3OPOA 1BCPC 5C3WA 2EY2A 2F3WA 5TSSA 2RSOA 1TWCB 5ISRA 3K5NA 3KLSX 5FOBB 3SK4A 2AQ3B 2J4XA 5J39A 5D14A 3O13A 4G57A 1I4PA 1EY0A 2RDFA 2E2HB 4HN7A 1QE6A 4IUUA 1EY9A 3J7AV 1WTOA 3NPPA 1PFBA 2MUYA 4DU9A 3KK7A 3X3NA 1HQRD 1S5DD 1ET9A 4RGTA 5FO8B 4V0BA 4X3UA 1A15A 5JEAH 2SEBD 4B9WA 2XN9C 2VB3X 5C3EB 4IZ8A 3SVMA 5CMDA 3GQBA 1PZID 1CT1D 1VMPA 1B44D 3E6ZX 4O42A 4BWGB 3CKIB 1EZ8A 1QWYA 3D4DA 1PTOC 4K14A 5EPLA 1JWUD 1BR9A 1CFMA 1YNNC 2B2UC 4ZUIA 2A6HC 4TRDA 4NW2A 2B2WA 3DUZA 3K5OA 1GUTA 1A6XA 3FPPA 1PYWD 1WTPA 2EY6A 1BBXC 3ERQA 1Q1EA 5KNCA 4XQNA 1DOKA 1TKWB 1IL8A 1AW7A 4JK1C 4RWSC 5NUCA 3IAYA 4KN7C 2JP1A 1EY4A 1H9JA 1DZ1A 2NN6I 2I07B 3NSWA 2JA6B 1NUCA 2BOSA 3QB3A 2FJ2A 1I3QB 5G3LF 5EBCA 2K1BA 1LTAD 2B2YA 2K5WA 2L55A 5JEAJ 2BDNA 2EXZA 1AZQA 2NTTA 5KYIA 2K5QA 1V43A 4I65A 3IFDA 4LMQD 1STBA 2B2WC 4P2CB 3H91A 1WTVA 1HUMA 3PMFA 1XTCD 2F0WA 1PFMA 3PO2B 1EY5A 3R2TA 3MXGA 1HHVA 1L0YB 4H13C 2NN6G 1JOKA 4JBWA 4IUVA 3HOUB 3S15B 3M85A 1QCBD 5DM63 2EYMA 4M1UB 1CQVA 1DM0B 1LTGD 2CVRA 1F9SA 5A2QE 2A68C 2RSNA 1V1PA 4HCEA 3A8IE 1CA6A 4C3JG 3P1HA 4K8IA 4QB4A 3NTHA 3I90A 1RD9D 3NWTA 1EYCA 1F9QA 4KJNA 4BA1I 1UNSA 2K03A 4IALA 3BZDB 1ZXTA 1WTXA 4MHEA 3LWUA 5E1FA 5EGTA 3H6MA 2JA5B 3MEHA 2EPBA 2RDGA 1HFNA 4C3IG 1TQOA 1X32A 2L1BA 5I4DA 1WTWA 1SYFA 1A3VA 2EYFA 2JXMB 3R93A 4N9TA 3V2TA 1TY0A 5C4HA 3R2IA 4IQZA 5I2XA 4NMZA 1R4PB 2TMPA 1ZYRC 2IX0A 1IYVA 3RZDB 1L0XB 2NVXB 2D2CC 2K05A 1Y8PB 3HEJA 2M00A 3EVQA 3SHLA 3ONAB 1JCKB 4FF4A 2A6EC 1ENCA 2NUCA 1SSOA 1BOSA 1BDOA 1DOMA 1UAPA 4OIKA 2LFNA 5M5XB 5EKLA 4RGOS 5AFWA 3BS1A 3K0YA 3JAME 5BN3A 3EJIA 3J80L 5CORA 3W2DA 3I91A 2WV6D 5JEAG 4RA8A 2EJGC 3GTLB 4ILWA 1CZGA 3GO5A 3MWYW 1K8MA 4OO1H 1DD2A 3V05A 1T5EA 1AFPA 3GTOB 1MD2D 3GTKB 1D6EC 1NR4A 5KNDA 4GZYC 1WD0A 1BCPD 1Y1WB 3HG9A 3CRKC 4MN3A 1I50B 4X3KA 2KEDA 3OHXC 4KY7A 4CJ0B 1F9PA 3AB9A 4CGYB 4RHSA 5JVG3 3BG3A 5HGTA 3GTQB 4IFDG 4B9XA 3URYA 4ZK9B 3PUWA 2ICIA 4RFBA 4KTAA 5C5LA 2B2VA 2K32A 4BY1B 5DEHA 3BDLA 1CM9A 1HCZA 4C2MB 1G2TA 5CV5A 2EOTA 3J81E 1WTQA 2M9VA 1GUNA 1SE2A 2H4OA 3IL8A 2R93B 1TS4A 5LL6X 1CK1A 4KMUC 2N55A 1CA5A 1RODA 5C0XH 2PPBC 4F88A 2X69A 2R6GA 3M3YB 1SFOB 5CV4A 1EL0A 1SNDA 2Y0SB 2JEAI 3VR2A 3WDNA 5C4JB 3S1RB 3OIPA 1IYUA 5FLXL 3K6OA 4DK0A 5ELDA 4K2LA 4MIUA 3H09A 2A73B 2HCCA 2WAQB 1RTOA 1BUVT 1XWEA 1H9MA 4HAEA 1PTOD 2HCIA 1PRTB 1TWGB 1B1ZA 2VXWA 1YNND 5CV7A 2IX3A 3MFYA 1C8CA 2A6HD 2B2TA 4RKLA 1SNQA 1JORA 3TMEA 5C4XB 4G7ZC 5KRUA 1EOTA 1DONA 1TS3A 2XWBB 1SMYC 1EIHA 5LL6S 1RTNA 3FDTA 4PNYA 1KAAA 3E5SA 3HOXB 2F0EA 1QG7A 1B4OA 1E2ZA 4ZKBB 4TSSA 1JB3A 3I8ZA 2NB0A 2QKIC 2ID0A 2E2IB 2XRSD 1TS2A 1PLFA 1FD7D 4XT3B 1SYGA 3W3AA 3S17B 3M7GA 2AUJD 2ICEC 1HA5A 2EJFC 1SEBD 1Y1VB 1H9SB 1TWAB 4CJ2C 3RLFA 1EZ6A 3ND9A 5D3DA 1QNUA 3ND8A 3GTGB 4A3MB 4K2KA 3BDOA 5CR3A 1PMRA 1SE4A 2VNUD 4DNTB 3GV3A 1EWHA 1ENFA 1SYEA 3OMCA 1SNPA 4J8QA 1HA6A 3OIQA 3N52A 3S16B 4FP5D 3A7LA 3H94A 4CHTB 4BBSB 3WOEA 4KY6A 1Y69U 1PRTF 1A2UA 4RCNA 3OOCA 3TP6A 3NTKA 4IN3A 3NK9A 1BF4A 2A68D 1V1OA 4WORA 4A3KB 2Q8TA 3NP8A 2JSOA 2MJ8A 3FRPB 5DNFA 4BS9A 3GTJB 3GP7A 3MVVA 1LABA 5EQ0A 5K5PA 1JQYD 1W6JA 4ID6A 4HEDA 3SK8A 1ET6A 3Q0AA 2C5CA 1ZEQX 2J7ZA 2F0NA 5IIFA 3C1EA 4HCSA 1S5CD 3HRZC 3QOLA 4DAVA 5T1GA 1II3A 1ML0D 1LT5D 4YIJA 1HPCA 1Y8NB 4IUQA 5C0XI 2A69C 4OO1G 2F1MA 1HRJA 2DNCA 4IUTA 5HURA 3I72A 3EFXD 3P75A 1ZYRD 1LV9A 2AWNA 5M9OA 4QF4A 2EY1A 3NTIA 3SK6A 2PO4A 2IWHA 1E2WA 5IT9L 1F2ZA 5EJWA 2SOBA 2GA4B 3S9WA 1FR3A 2A6ED 2EYJA 1RCVD 1ICWA 3I70A 1STAA 5M5WB 4XDXA 3RZOB 4C56C 4PMWA 4IFDH 4C1NI 3BVMA 3DWQA 3P20A 5I2YA 2ZXRA 3TP5A 1G2SA 4ABNA 2PCFB 1R4QB 2NVTB 2DN8A 2SDFA 5T1IA 4KI0A 5C0XG 3SE0A 5FKAC 1I4QA 2BE5C 4LJZC 4CKCA 2CW0C 5M3MB 4G7HC 3VR6A 2PZWA 1MSGA 5I9PA 2WINB 2X6LA 4A3EB 2QILA 1Z47A 3Q24A 3Q6SA 4DGZA 1G8ZD 1DJRD 4BA2I 1ESRA 4IURA 3VR5A 3KUPA 2R7ZB 2Z4HA 1S4ZA 2R3ZA 5IGGA 1I4XA 2IW3A 1I4RA 5BN5A 1JWSD 3K7AB 4QCLA 3SEBA 4AYBB 1J8IA 4ZKCB 4XYOA 2DY7A 4V190 1A2TA 1LTRD 4HMJA 1STGA 1LTBD 4BBRB 3PUYA 2F0PA 1CI3M 4B08A 3HOYB 1E2VA 2IT1A 3HKZB 3PIO3 3WOFA 4QUFA 4F7XA 2K33A 3DEPA 4IFDJ 4L8JA 2OF1A 1LTSD 3S1NB 3A8JE 3T53B 1EYDA 4QMGA 1LT4D 4NKLA 2B2YC 4DF7A 3NQIA 3MXPA 1AEXA 1Q90A 1D5ZC 1TT2A 1IW7C 1PZJD 3JAML 1CQFA 4U673 2OT2A 4EQPA 3N6RA 2M2LA 2WKCA 1RKNA 4ZLTF 1QB5D 4WRDA 1SJHD 2FFKB 1G291 3MFGA 2KQ3A 1EY7A 1UUPA 5CC4A 4FXDA 1SMYD 4A3BB 2F0TA 4L6TB 1U4MA 3SR1A 5C3XA 4A3DB 2G9DA 1C48A 2KCNA 4ODGA 5JJZA 3OW7A 5J1ZA 2NYZD 2K01A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DYQ A;  4O1N A;  1JCK B;  1F77 A;  2R61 A;  4BWG B;  1LT5 D;  3EA6 A;  1BCP F;  1I4R A;  2O2L D;  2RDH A;  4RH6 A;  4UDU C;  1PRT D;  1JWS D;  5D3D A;  1LO5 D;  1PTO C;  1JWU D;  1SBB B;  3SEB A;  1D5X C;  2AQ1 B;  1CQV A;  3EFX D;  4DXG A;  1LTR D;  1LTB D;  1I4G A;  1LTG D;  1SE3 A;  4RGO S;  4RGN A;  1EWC A;  1PYW D;  5ELD A;  1KTK A;  1JR0 D;  1SE4 A;  1M4V A;  3OWE B;  4L63 B;  1PZK D;  1ESF A;  1RDP D;  3MC0 B;  1STE A;  2XRQ D;  1S5B D;  1V1P A;  1HTL D;  1S5E D;  1ENF A;  2AQ2 B;  1BCP C;  1I4H A;  3W2D A;  1RCV D;  1FGB D;  1PTO D;  1SJE D;  2WV6 D;  1AW7 A;  1PRT B;  5TSS A;  1B1Z A;  3KLS X;  1LTS D;  4C56 C;  1RD9 D;  1CHQ D;  3TSS A;  2AQ3 B;  3BVM A;  1FNW A;  3DWQ A;  3R8B A;  1QIL A;  1EFI D;  2J4X A;  1GOZ A;  1V1P B;  4RGM A;  1S5F D;  1XXG A;  1PRT F;  3O13 A;  5ELC A;  1UNS A;  4ZYS A;  2QEJ C;  2G9H D;  1LT4 D;  1I4P A;  3BZD B;  3V05 A;  2XNA C;  4RHR A;  1V1O A;  1MD2 D;  4Z9C B;  1D6E C;  3CHB D;  5ELE A;  4RCO A;  1BCP D;  1TS5 A;  1HXY D;  2IJ0 A;  1D5Z C;  1TS3 A;  5FKA C;  1PZJ D;  3DWA A;  5ELB A;  1FNV A;  1I4Q A;  1EEI D;  1KLG D;  1SXT A;  1D5M C;  3BYT B;  3BYY B;  1LTI D;  1PTO B;  2NTS A;  1LTA D;  5FK9 C;  1HQR D;  1KLU D;  2RDG A;  1S5D D;  5I4D A;  3GP7 A;  1ET9 A;  1T5X D;  4TSS A;  1EU3 A;  3BVZ A;  4RGT A;  1BXT A;  4RHS A;  2NTT A;  1SJH D;  3URY A;  1JQY D;  1TY2 A;  1FNU A;  1LT6 D;  2SEB D;  2ICI A;  4RFB A;  4K6L A;  1PRT C;  1PTO F;  2XN9 C;  5ELF A;  1JWM D;  2XRS D;  1ET6 A;  1LT3 D;  1TS2 A;  4OHJ A;  1FD7 D;  5D3I B;  2QIL A;  1TY0 A;  2CHB D;  1CHP D;  1EEF D;  3R2I A;  1RF2 D;  2Z8L A;  3MFG A;  4DXF A;  1LTT D;  1AN8 A;  1UUP A;  1XTC D;  1G8Z D;  1DJR D;  3DWP A;  1EU4 A;  1LLR D;  1BCP B;  1HA5 A;  1PZI D;  2IPK D;  4L6T B;  1CT1 D;  1SEB D;  1L0X B;  3BVG A;  3R2T A;  1S5C D;  1PTO H;  2TSS A;  1SE2 A;  1TS4 A;  1CK1 A;  1L0Y B;  1B44 D;  1I4X A; 
#chains in the Genus database with same CATH topology
 2UUB Q;  3PO2 G;  4BBR G;  4NXM Q;  1HZB A;  2KVM A;  5C4X H;  2EE1 A;  3MAQ A;  4KY5 A;  4C3H B;  4YHH Q;  1GD7 A;  1OXT A;  2E75 C;  2F0K A;  2BDO A;  1XX8 A;  3VYR A;  4DV3 L;  3HOU G;  3D6C A;  2BA0 A;  4PZ6 A;  3J81 L;  3Q22 A;  3FPU B;  5IGD A;  3PO3 B;  3E0E A;  2A19 A;  4DR1 Q;  5JPM C;  2FMM A;  5FO9 B;  4GNX C;  3MC0 B;  2IX1 A;  1ENA A;  4OON A;  5A35 A;  1UWV A;  3J7A F;  4OX9 L;  1GHK A;  3HOZ B;  4DUY Q;  1UE7 A;  2E2I H;  4KKS A;  1G91 A;  2L11 A;  1M8A A;  3NBI A;  1N36 L;  1TWF H;  3Q23 A;  2CH4 A;  3HOW H;  3S17 H;  3CW2 C;  3TSS A;  3W5O A;  3F1Z A;  5FLM H;  3NWS A;  3KF6 B;  2HIV A;  2NVY B;  1GXD C;  1Q1B A;  4FDB A;  4IFD I;  1HZC A;  1IBK Q;  1STN A;  2I5M X;  3NUC A;  1Y1V H;  4DR7 Q;  3T4A C;  4X66 Q;  1CTM A;  1KQS A;  3RD4 A;  1B3A A;  1TWA H;  1E7Z A;  1FYC A;  5CBE E;  3TRZ A;  2V1C C;  3T1Y L;  5E4X A;  1HZ9 A;  1D5M C;  1TVX A;  2NTS A;  2ZTE A;  4E6I A;  3GTG H;  4A3M H;  2JA8 H;  1T5X D;  4DUZ L;  1U4P A;  1HNW L;  2MFI A;  3M4Y A;  1JWM D;  1VF7 A;  4A3C G;  3NE5 B;  1JOO A;  1L1O C;  4LF4 L;  1JE4 A;  2D0O A;  3FKI B;  5IE8 A;  2XSC A;  5KIX A;  1EU4 A;  5GQO A;  2WII B;  2OQ0 A;  1XTD A;  1YHB A;  3HS0 C;  2JEB I;  3L9A X;  4OWT B;  2ENB A;  1SYC A;  1BQQ T;  3VR4 A;  1VQJ A;  4UAI A;  4C3H G;  4BBS H;  5K36 H;  4O1N A;  1O7L A;  1F77 A;  1ICF B;  2ZTD A;  1JB7 A;  2F0F A;  4CBV A;  1NCV A;  1LO5 D;  3ZYY X;  3NBH A;  4J15 A;  3D31 A;  4QIW B;  1GUS A;  1PHJ A;  1KXL A;  1QUQ A;  1KDC A;  3CCV A;  4DXG A;  4A3L G;  4A3F H;  2L0C A;  3PIP A;  3KOJ A;  4A3K H;  3I4L A;  5G3L D;  3A54 A;  4POF A;  1VQ7 A;  2K5H A;  1G6Z A;  1HR0 L;  1KTK A;  1JR0 D;  4B3R Q;  2FMC A;  4CJ1 B;  1PZK D;  3GTJ H;  3CME A;  2JJQ A;  3TBI B;  1IKM A;  4ZQ3 A;  4HIO A;  1OXV A;  2RBM A;  1N8R C;  3C3L A;  1HUN A;  2OCE A;  1FGB D;  3U9S A;  2EYH A;  1X65 A;  4X65 Q;  1VQN A;  1O78 A;  4OL7 A;  3HOV B;  4R9W A;  4PZ8 A;  3M4P A;  3X3M A;  1X54 A;  4QGU A;  4IPC A;  4JI1 Q;  4C1N K;  1FNW A;  1S5F D;  1XXG A;  3D3R A;  3K58 A;  4DV4 Q;  4DV0 L;  2RKS A;  3C46 A;  1ILP A;  4DV7 Q;  1A3U A;  3AYH B;  1X9N A;  5CV8 A;  4DV5 Q;  2SNS A;  2WAC A;  1U9R A;  2XTI A;  5I6W A;  2IJ0 A;  2JE6 I;  4PMB A;  3MHB A;  5ELB A;  1YHA A;  4DR6 L;  1B70 B;  2B2V C;  4GOP B;  4DR2 Q;  2F0I A;  4FF3 A;  1SRO A;  1HNZ Q;  3PUZ A;  3A56 A;  2O5J C;  3KF8 A;  1D2B A;  5DM7 3;  4J6H A;  4ULL A;  1D1K A;  1GUG A;  3FKI G;  3IFT A;  3OWF A;  4B3S L;  1Y1W G;  2QDB A;  1TY2 A;  2OWO A;  1H9S A;  1PRT C;  4HSV A;  2Z4I A;  2F0L A;  4K8J A;  2V4D A;  3AQQ A;  2AWO A;  2DNE A;  3J80 i;  1NSN S;  1NY4 A;  1SLJ A;  4P75 A;  4X3T A;  1SNM A;  4DK1 A;  3KLR A;  2BE5 D;  2MO0 A;  1QZG A;  3NEL A;  1W6K A;  4IJL A;  2MGS A;  2CW0 D;  5KYL A;  1PTO H;  3RN5 A;  2VB2 X;  2B63 B;  3I73 A;  1GUW A;  4HTH A;  4KN4 C;  3PUV A;  1PH8 A;  1DYQ A;  1VQL A;  2PQA A;  3QOJ A;  1XMQ L;  3NEN A;  3NHH A;  1B7Y B;  2ZJQ A;  3B6Y A;  1STH A;  4IUP A;  3OSO A;  1TWF B;  4DFA A;  2NVT H;  1SBB B;  3CC4 A;  3HOW B;  4A93 B;  1O7Y A;  4PV1 C;  2A5H A;  4AIM A;  4OWX B;  4R4O A;  1Q46 A;  3GDE A;  3KF8 B;  3DXJ C;  5EBD A;  2F0Q A;  4NPS A;  2KA7 A;  1SE3 A;  1E0B A;  2DJG C;  5C0X J;  2Z0S A;  2WB1 B;  1X6O A;  2NVQ B;  2KUM A;  4BY7 H;  4JI5 Q;  1EY8 A;  1RDP D;  3H0G B;  3K57 A;  3P7J A;  1HTL D;  2Q8I B;  3BDC A;  2B2T C;  4ZAI A;  1I4H A;  4G4K A;  4F8M A;  3Q8D A;  1O7I A;  1A62 A;  1D1I A;  4A3E H;  1EY6 A;  4XTC S;  1VQ5 A;  1JJG A;  2LXJ A;  2EVB A;  3TP7 A;  3KBG A;  4MNO A;  5EKI A;  4WJW A;  1HH2 P;  4CDE C;  4XIG S;  2JA8 B;  1SNO A;  3S1Q H;  1OXX K;  1V1Q A;  1CHQ D;  1HZA A;  1F2M A;  2FIN B;  2PQA B;  4DV1 Q;  3LNN A;  4RGM A;  4JI2 L;  2VY3 A;  2R7Z H;  2UU9 L;  5IWA Q;  1MBY A;  2LKV A;  3QR8 A;  1SN8 A;  5IGF A;  3T13 A;  4UPA A;  1DOL A;  1SDF A;  5IYD G;  3AEV A;  4HJ8 A;  3CPW A;  2KEE A;  5H1S E;  4JI0 Q;  3K7A H;  4AQY L;  4A3I B;  5M3F B;  2H5X A;  2KJX A;  4UP8 A;  5FK9 C;  2PMZ B;  2PZU A;  4LF7 L;  4BBR H;  4JBM A;  4DAY B;  2BH2 A;  1PFN A;  1FNU A;  5GAD C;  4X62 L;  3HOY H;  1VQM A;  2DY8 A;  5ELF A;  4OO1 I;  2JYO A;  5IGB A;  2EJM A;  2F3V A;  1CHP D;  1SR3 A;  1NMG A;  2QF7 A;  2ZXO A;  1K8G A;  1FVI A;  1EYA A;  3PIP 3;  3QIA A;  3QG1 A;  3PIO A;  5C6A A;  4A3F B;  4A3J B;  1Y8O B;  1YEZ A;  4RKB A;  4HJ9 A;  4FXK C;  1IW7 D;  1BCP B;  2IPK D;  4IOC A;  3VR3 A;  1WI5 A;  1B8A A;  2MP1 A;  1MHW C;  5I9O A;  2TSS A;  5JPN C;  1YJW A;  5IGC A;  2F0U A;  3S1N H;  1QNK A;  2XWJ B;  3HOW G;  1IYJ B;  2Q8R E;  4Q0F A;  2A74 C;  4EVO A;  3UI2 A;  2RDH A;  1KNE A;  2Z9H A;  3D4W A;  4UDU C;  4ALP A;  4GLA C;  4OGQ C;  5EPJ A;  2KBN A;  2RCF A;  5F2D A;  3UE1 A;  3L7Z C;  1HFG A;  3K5L A;  2WB1 G;  1Y1V G;  4K5V A;  1YBY A;  3JAM c;  4TKO B;  1SYB A;  4HJA A;  4DA2 A;  3K5M A;  1HJP A;  2F0S A;  4DV6 L;  1CKO A;  4UHV A;  1KDA A;  3OW2 A;  3ULJ A;  1PH4 A;  4XYQ A;  1CKN A;  1ONL A;  4ZCK A;  3QWN A;  4KK7 A;  2HHH L;  4IOA A;  2B2U A;  1B2T A;  4IO9 A;  4GLX A;  4GS3 A;  2MPM A;  1WFQ A;  1STE A;  2JA8 G;  1EIG A;  4JI8 Q;  3R3O A;  2KHS A;  4K5X A;  4DR5 Q;  4JI4 Q;  2AQ2 B;  1X3F A;  2EQS A;  5C4Z A;  3KLS A;  1Z7T A;  5KNB A;  2EDG A;  1O80 A;  3E0J A;  5E7N A;  2LY7 A;  2C9O A;  4NP5 A;  1Z9F A;  3GV6 A;  2X6G A;  4R8N A;  3S14 B;  1DGS A;  1VQ8 A;  4A3B H;  4QL5 A;  4A3D H;  2HDL A;  5CBA E;  1R9T B;  2IHF A;  3HKS A;  4L5Q A;  3S1M B;  3FHW A;  4JCV E;  1B9N A;  3ITP A;  4Z9C B;  2EYP A;  5JAV A;  3CHB D;  5IYB H;  2I5H A;  2LMC B;  5ELE A;  4DV2 L;  4BBS G;  4RCO A;  5K36 G;  1S40 A;  2E5L Q;  2VQE L;  4G7O C;  3A7A B;  5CGK A;  1FNV A;  4A3G B;  1PTO B;  1CKN B;  3KBX A;  4C3H H;  3ERO A;  1UE6 A;  1AP0 A;  4HR7 B;  1C7Y A;  4K0K Q;  1F2L A;  2EY5 A;  3BVZ A;  4A3F G;  1YNJ C;  4A3K G;  1IHZ A;  3I3C A;  3PO3 H;  3MXU A;  2PMZ E;  4K6L A;  3M7N A;  1L0W A;  2Z1C A;  1A3T A;  1CSQ A;  3CU7 A;  3SK5 A;  2F0O A;  2HUG A;  1LTT D;  4HSP A;  2AUK A;  4DV3 Q;  1YI2 A;  1AZP A;  2F4V L;  5A2Q L;  2F03 A;  1AH9 A;  3HOZ H;  2K04 A;  3EN2 A;  4QY7 A;  3KDF A;  4BY7 B;  4LK1 C;  1VQP A;  1B53 A;  4FYD A;  1K3B C;  3IKJ A;  1C0A A;  4XT1 B;  1BBW A;  4EQN A;  2NVY H;  4OX9 Q;  4JG2 A;  5KGU A;  1BCP F;  3K59 A;  4FF1 A;  4GN4 B;  1N36 Q;  4QUC A;  1KRS A;  3PUX A;  3HP3 A;  1F9R A;  1NMF A;  5EAY A;  4KJO A;  1XYI A;  3S1Q B;  2OQK A;  3K8A A;  1VCI A;  4DK6 C;  2JQO A;  4C3J B;  2L9H A;  1MKH A;  3D0F A;  3OWE B;  1JIC A;  2D62 A;  3U4V A;  2HQE A;  4GKK Q;  2XRQ D;  1XPU A;  4FO2 A;  2BA1 A;  4TVA B;  1GVP A;  3T1Y Q;  2KHJ A;  1DCZ A;  3MZ5 A;  4N9P A;  5KEE A;  3TZU A;  4DAP A;  3AFP A;  3BZK A;  4H7B A;  2D9U A;  3KDF B;  1IBM L;  4DUZ Q;  5DAU A;  1Q7Y C;  4LUZ A;  2D5D A;  4RG1 A;  2NZ1 D;  5ELO A;  4OXP A;  1QIL A;  1HNW Q;  1GOZ A;  3MTS A;  3AMU A;  1JOQ A;  4APV A;  2VQF L;  1Z6H A;  2NWG A;  4RHR A;  1NAP A;  4JI3 L;  3STB C;  4C3I B;  4O2D A;  3S24 A;  3UDF A;  1SAP A;  1I94 L;  1NTG A;  2F0V A;  3M4O B;  2PQE A;  4LF8 L;  1SXT A;  1EEI D;  3BYY B;  3VA5 A;  1B50 A;  4LNQ A;  3F2B A;  2K7V A;  3I4O A;  5IT9 E;  1HR0 W;  3DM1 A;  2I46 A;  5JOB A;  1BNZ A;  4TQU S;  3CCU A;  4FXG C;  1PTO F;  1Q8I A;  3K7U C;  3L3O C;  1LT3 D;  4Y7N H;  4OHJ A;  1YIJ A;  2N3S A;  4BY7 G;  1VS0 A;  1EEF D;  1I6V C;  2XVS A;  2EYO A;  4A76 A;  3NQT A;  4LF5 L;  1J9O A;  4DNR B;  3C2P A;  1I6H B;  2FHT A;  2EZV A;  1HR0 Q;  1Q3L A;  3BU2 A;  3BVG A;  2HT1 A;  3HOV H;  4A3E G;  4KV6 A;  4IUN A;  4H44 C;  3CF5 A;  3RNU A;  1YZ6 A;  2IL8 A;  4L5T A;  3V96 A;  1SMX A;  1K28 A;  3EA6 A;  1EQV A;  2EYL A;  1A8V A;  2L15 A;  4PMC A;  1TII D;  1PRT D;  4M8A A;  4S3S A;  3DMU A;  3A5Z B;  4PZ7 A;  2F0J A;  3PSI A;  1LAC A;  3GD7 A;  2PW7 A;  1EQT A;  4A75 A;  3I4N B;  1VMC A;  5CV9 A;  2F0H A;  1ILQ A;  3T51 B;  3L2P A;  5D65 A;  1N34 L;  2KOL A;  2UXD Q;  1S72 A;  2HIX A;  4P71 A;  4DV0 Q;  1K8O A;  4KD3 A;  1PFS A;  2F0D A;  5IOD A;  3D4R A;  1N33 L;  1X3Q A;  5AJ3 L;  2N49 A;  5CYU A;  1GO3 E;  1M4V A;  4AYB G;  5COY A;  1H9R A;  4L63 B;  4KHV A;  4F87 A;  3KF6 A;  1Y14 B;  4U68 A;  3E9H A;  4JI7 L;  3PV0 A;  5L37 A;  3J7Z C;  1BBU A;  4DR6 Q;  4QQB X;  3HOY G;  1OO9 B;  1IKL A;  5E4W C;  2LXK A;  1AE2 A;  4CKE A;  1OXS C;  2HQL A;  3HKZ G;  3VA7 A;  3T16 A;  3AU7 A;  2K5D A;  4FNF A;  3S2D B;  4B3S Q;  1V8Q A;  4EX5 A;  1N9W A;  1V1P B;  2RQX A;  4LW1 A;  3RUZ A;  4KD4 A;  2F3I A;  3U50 C;  3CCL A;  2B63 H;  5BN4 A;  2WP8 J;  3NXW A;  4HMI A;  1RJT A;  2YTX A;  1EQR A;  3TDQ A;  5GAE C;  1KLG D;  3BYT B;  5CV6 A;  5J3B A;  1I5F A;  1HQM C;  2QEX A;  4A93 H;  3K81 C;  1KLU D;  4LUO A;  1WTH A;  2QCP X;  2H1E A;  1XMQ Q;  1BXT A;  1PXU A;  2CWA A;  3BZC A;  4Q5V A;  4CKB A;  3CCE A;  4K5W A;  4B3T L;  2NVQ H;  1BO0 A;  1WTR A;  1KAW A;  2MHV A;  1CZW A;  2CHB D;  4ZRZ A;  3H0G H;  5C44 B;  1RF2 D;  1SYD A;  5I6Y A;  1U4L A;  2RF4 A;  5C5M A;  1XJV A;  1PH6 A;  2K75 A;  3DHQ A;  2PNR C;  3LX0 A;  4H0L C;  3T1H Q;  2B8F A;  1K83 H;  3C1F A;  1OXU A;  3LGJ A;  1SNC A;  3U9O A;  4R1J A;  3I4N G;  4I7Z C;  4KKU A;  4RH6 A;  2UUC L;  4HJ5 A;  4B3M L;  4N8X 1;  4LUV A;  4A3B G;  4X6A H;  2XIW A;  2K5N A;  1GHJ A;  4A3D G;  4JV5 L;  1VDZ A;  2QA4 A;  3FEW X;  1Q81 C;  3GTP B;  3M4Q A;  1B9M A;  2BH8 A;  1L1O B;  1Q12 A;  5IYB G;  3QO2 A;  1I4G A;  4JI2 Q;  4K6D A;  4RGN A;  2J0T D;  3RLN A;  4FVM A;  1PH2 A;  4A3I H;  5M3F H;  3CD6 A;  4ME5 A;  1XMO L;  2N88 A;  4NDX A;  2JN4 A;  1E1T A;  1O7Z A;  4KKT A;  5FJ8 G;  1IBL L;  2K5V A;  3T56 B;  3ICE A;  1VQB A;  4AQY Q;  1SJE D;  1WCM B;  3PO3 G;  2PYK A;  3FVQ A;  2N78 A;  1PYB A;  4A3J H;  4JBJ A;  3VYT A;  4HIK A;  1W2B A;  3R8B A;  5LMN L;  5M5Y B;  5FO7 B;  4DPG A;  4X62 Q;  3OMG A;  3HOZ G;  3A74 A;  5JVH 3;  4GOP A;  4YWL A;  1U4R A;  2B39 A;  4AH6 A;  4ZYS A;  2CQO A;  3SDZ A;  4Y7N B;  3TP8 A;  1EUJ A;  1VQC A;  1XNR L;  4LAA A;  3CMA A;  3GTM B;  4KHZ A;  2A69 D;  2E74 C;  1EFW A;  3CQZ B;  2A1A A;  5IGE A;  2RA4 A;  3H3V C;  4JC0 A;  5JJK A;  4RAU C;  5EKK A;  3I4M B;  2K4K A;  1EU3 A;  3J81 i;  1H9K A;  1FL0 A;  2L12 A;  2VS1 A;  3LWE A;  4PQX A;  1TWH B;  2B8G A;  2CWP A;  1YHQ A;  1LT6 D;  4DN4 M;  4MZ9 A;  3FMC A;  1VQ6 A;  1WD1 A;  5D3I B;  2I0Q A;  2L5T A;  4P74 A;  2IY5 B;  3H3V I;  3M9B A;  2E2H H;  3DWP A;  3CRL C;  3UDI A;  1LLR D;  4FF2 A;  4CDD C;  2CQA A;  3CAM A;  2HHH Q;  1YIT A;  1QVG A;  4XQQ A;  3D6W A;  4WFN 3;  2NBF A;  1VQ9 A;  3J80 E;  1PH7 A;  3S14 H;  2PZT A;  1MSH A;  1YNJ D;  3OTO L;  4JI6 L;  3K0X A;  2ZT9 C;  4MTN A;  1QJO A;  1DXM A;  1UEA B;  1R9T H;  1GUO A;  2PI2 E;  4UY8 C;  1VQH A;  4EGV A;  2UUB L;  3S2H B;  1VQF A;  3J81 j;  4GOP C;  3S1M H;  1PH9 A;  2RCN A;  3SGI A;  2B29 A;  2YU9 B;  2LS0 1;  1ZKO A;  4LFC L;  4Y52 H;  2RVL A;  5BR8 L;  4A3G H;  1X3P A;  2YYZ A;  1WCM G;  1E1O A;  3MA2 B;  3QJY A;  4DV2 Q;  1TR5 A;  3RMH A;  2VQE Q;  1G6P A;  2OEO A;  2YTY A;  1PDQ A;  2D0P A;  2KEC A;  2O4X A;  2R92 B;  1KNA A;  5J1Z A;  3HZX A;  2JA7 B;  3G48 A;  2NN6 H;  2ASB A;  2IHE A;  1KDB A;  1EFI D;  3DEO A;  3EQL C;  4YCW A;  2E76 C;  2K6A A;  5ELC A;  3PF5 A;  2QEJ C;  2G9H D;  5E3F A;  3TN2 A;  3HOV G;  1X56 A;  3A55 A;  2O5I C;  2XNA C;  5EPK A;  3CCM A;  4DAY A;  2F4V Q;  3J7Y W;  1TS5 A;  1HXY D;  2L4N A;  1MI2 A;  2UXC Q;  2HDM A;  3DWA A;  1LTI D;  2K28 A;  3SXH A;  1K83 B;  5IOC A;  4J1M A;  3VDY A;  4OWW B;  4XQJ A;  3HGB A;  1F2Y A;  4C3J H;  1NR2 A;  5IP9 H;  2LSS A;  1RHP A;  4R8I A;  2Q2I A;  2WKD A;  1NE3 A;  2VUM B;  1C4Q A;  4GKJ L;  2ZXP A;  2F0M A;  2Z8L A;  5FLX E;  4DXF A;  3G7L A;  1AN8 A;  3A8K E;  2OXP A;  2EXD A;  1MGS A;  1I3Q H;  2Y0S E;  2RHQ B;  3G6J B;  4LF6 L;  1GJX A;  5IYC H;  4OIJ A;  4X3S A;  1TU2 B;  1STY A;  3D8G A;  5LHY 1;  2F4I A;  2KCC A;  1KHI A;  3VYS A;  2K52 A;  1WVL A;  4EQO A;  3MXN A;  2BCO A;  2R61 A;  2O2L D;  2YV5 A;  1VF5 C;  1HTP A;  1KC8 C;  1JC7 A;  1K0R A;  3VYU A;  1HNX L;  2WAQ E;  1IBM Q;  4C3I H;  1PH1 A;  1D5X C;  2B63 G;  2AQ1 B;  1ASY A;  3TZD A;  2PNH A;  1KAB A;  2E2J B;  3M4O H;  4NXN L;  2ES2 A;  3NEM A;  4ZUJ A;  2VQF Q;  1EWC A;  2PW5 A;  4XXE A;  3F2U A;  2F0G A;  1XNQ Q;  4JI3 Q;  1QOH A;  4A93 G;  1ESF A;  1I94 Q;  2MO1 A;  5J22 A;  1S5B D;  2JA7 G;  1S5E D;  2E2D C;  4OEL B;  2SNM A;  3OPO A;  1BCP C;  5C3W A;  4LF8 Q;  3S15 H;  2EY2 A;  2F3W A;  5TSS A;  1D7Q A;  2RSO A;  1TWC B;  5ISR A;  3K5N A;  3KLS X;  5FOB B;  3H0G G;  3K80 C;  2ZJR A;  3SK4 A;  2AQ3 B;  1I6H H;  3PQI A;  2KCM A;  1KD1 C;  2CCZ A;  2J4X A;  3MXN B;  5J39 A;  5D14 A;  3O13 A;  4G57 A;  2ATW A;  1I4P A;  1EY0 A;  4DV4 L;  1V9P A;  5LMU L;  1YJ9 A;  1UE5 A;  2RDF A;  1NJI C;  1PYS B;  2E2H B;  4HN7 A;  1QE6 A;  1XPR A;  4IUU A;  1EY9 A;  3J7A V;  1WTO A;  3NPP A;  1PFB A;  2MUY A;  4DU9 A;  3KK7 A;  3I4N H;  3X3N A;  1HQR D;  2MNA A;  2VUM G;  1S5D D;  1ET9 A;  4DR2 L;  4RGT A;  5JJL A;  5FO8 B;  4V0B A;  2G5D A;  4X3U A;  1A15 A;  5JEA H;  3RR5 A;  2SEB D;  4B9W A;  2XN9 C;  2VB3 X;  5M3F G;  4A3I G;  4BXX H;  4R4I A;  4MTK A;  5C3E B;  4IZ8 A;  3SVM A;  5CMD A;  3GQB A;  1N33 Q;  1PZI D;  1CT1 D;  1VMP A;  3AFQ A;  5FJ8 H;  4YCU A;  3CP0 A;  3S2D H;  1B44 D;  3E6Z X;  4O42 A;  4A3J G;  4JI7 Q;  4BWG B;  3CKI B;  1EZ8 A;  1QWY A;  3H15 A;  3D4D A;  4P72 A;  2F52 A;  1PTO C;  4K14 A;  5EPL A;  1JWU D;  1BR9 A;  1CFM A;  1YNN C;  2B2U C;  1Q8K A;  3TEH B;  2Q2T A;  4ZUI A;  2A6H C;  1K3R A;  2JK8 A;  4NB3 A;  4TRD A;  4NW2 A;  2B2W A;  3DUZ A;  3K5O A;  1GUT A;  1A6X A;  3FPP A;  1PYW D;  1WTP A;  2FXQ A;  1JJC B;  2EY6 A;  1BBX C;  3ERQ A;  1VQA A;  1Q1E A;  1C9O A;  2KEN A;  5KNC A;  4JI5 L;  3G4S A;  4LFB L;  1T9H A;  4XQN A;  4A4I A;  1UE1 A;  1DOK A;  4GN3 B;  1BVS A;  1TKW B;  1IL8 A;  1AW7 A;  4JK1 C;  4RWS C;  5NUC A;  3IAY A;  4KN7 C;  5C44 H;  1X3G A;  1E3P A;  2JP1 A;  1EY4 A;  1H9J A;  2R7D A;  1DZ1 A;  4B3T Q;  4DR3 L;  3TQY A;  2NN6 I;  4DAM A;  3E3X A;  2GVA A;  2I07 B;  3J80 c;  5IWA L;  3NSW A;  2JA6 B;  1NUC A;  2BOS A;  1N32 L;  3QB3 A;  2FJ2 A;  1B3Q A;  1I3Q B;  3HFZ B;  5EBC A;  5G3L F;  3KJO A;  2NZH A;  5IP7 G;  1U0L A;  2K1B A;  1LTA D;  3GTP H;  1JMC A;  2B2Y A;  3GTL H;  2K5W A;  3KYH C;  2L55 A;  5JEA J;  2BDN A;  2EXZ A;  1SE8 A;  4R4Q A;  1AZQ A;  4YWM A;  2NTT A;  5KYI A;  2K5Q A;  1V43 A;  2CH4 W;  4I65 A;  3IFD A;  5ELN A;  4LMQ D;  1STB A;  2B2W C;  4A3G G;  4LF4 Q;  4P2C B;  3E9I A;  3H91 A;  1G51 A;  1WTV A;  1HUM A;  5DLQ E;  2Z6K A;  3PMF A;  1XTC D;  2F0W A;  3I2Z A;  3KFU A;  1PFM A;  3PO2 B;  1WCM H;  1XMO Q;  1EY5 A;  3TRE A;  3R2T A;  3MXG A;  3U58 A;  4PG3 A;  1A63 A;  1IBL Q;  1HHV A;  1CUK A;  1L0Y B;  2ZJP A;  4H13 C;  5M5Y H;  2NN6 G;  1JOK A;  4JBW A;  4IUV A;  3GTQ H;  3HOU B;  3S15 B;  4EQ5 A;  1LM0 A;  4H02 A;  1QCB D;  3M85 A;  4BY1 H;  4DKA C;  3GTM H;  5DM6 3;  2EYM A;  1SRU A;  3UDG A;  4M1U B;  1CQV A;  5LMN Q;  1DM0 B;  3CQZ H;  4X64 L;  4P73 A;  3KLW A;  1LTG D;  2UXB L;  1U5K A;  2CVR A;  1F9S A;  2R93 H;  1VQE A;  5A2Q E;  3I4M H;  2A68 C;  2RSN A;  1V1P A;  4HCE A;  3A8I E;  1TWH H;  1CA6 A;  1K0S A;  4C3J G;  1SFO H;  5IP9 G;  3P1H A;  5GAH C;  4K8I A;  1J5E L;  4QB4 A;  1FJG L;  3NTH A;  3I90 A;  1RD9 D;  3NWT A;  1EYC A;  1EIF A;  1F9Q A;  1OTC A;  4KJN A;  4BA1 I;  2N8N A;  1WJJ A;  1VQO A;  1UNS A;  2K03 A;  1H95 A;  4IAL A;  3BZD B;  1BKB A;  1ZXT A;  5IYC G;  1WTX A;  4MHE A;  3LWU A;  2UUA L;  3W1G A;  5E1F A;  5EGT A;  5HY6 A;  3S2H H;  3H6M A;  2JA5 B;  4KLK A;  1PH5 A;  4KHP L;  3MEH A;  2EPB A;  2RDG A;  4OEM B;  2YU9 H;  2A8V A;  4C3I G;  1HFN A;  1TQO A;  1X32 A;  2L1B A;  4YY3 L;  3OTO Q;  5I4D A;  1WOC A;  1GM5 A;  3U4Z A;  1WTW A;  1SYF A;  1A3V A;  2EYF A;  2PI2 A;  3G71 A;  2JXM B;  3R93 A;  4N9T A;  3V2T A;  2AMC B;  1TY0 A;  4YWK A;  5C4H A;  3R2I A;  4IQZ A;  3BJU A;  2Z6B A;  4GNX B;  1Q86 C;  5I2X A;  4NMZ A;  1R4P B;  2TMP A;  4LFC Q;  4UP9 A;  1ZYR C;  5BR8 Q;  2IX0 A;  1IYV A;  1NBW A;  3RZD B;  1L0X B;  4AYB E;  2NVX B;  1ASZ A;  2R92 H;  1L1O A;  3CXC A;  2D2C C;  2VZA A;  2K05 A;  2JA7 H;  1Y8P B;  3HOX H;  3HEJ A;  2M00 A;  1XPO A;  1VQK A;  3EVQ A;  1WYD A;  3SHL A;  3ONA B;  2QW7 A;  1JCK B;  4FF4 A;  2A6E C;  4O0A A;  2GN5 A;  1ENC A;  2NUC A;  1SSO A;  1EOV A;  3HKZ E;  1BOS A;  2OTJ A;  1BDO A;  1DOM A;  1UAP A;  4CDC C;  4OIK A;  2LFN A;  5M5X B;  4LF9 L;  5EKL A;  4HJ7 A;  4RGO S;  5AFW A;  3BS1 A;  3K0Y A;  3JAM E;  3OYY A;  5BN3 A;  4JYA L;  3EJI A;  3J80 L;  5COR A;  4GKK L;  3W2D A;  3I91 A;  3L0O A;  2WV6 D;  5JEA G;  1K9M C;  4RA8 A;  2VUM H;  2EJG C;  4BXX G;  2DGY A;  3GTL B;  1M1K C;  3JAM i;  4ILW A;  2UU9 Q;  1CZG A;  3GO5 A;  4WJ3 M;  3MWY W;  1K8M A;  4OO1 H;  1DD2 A;  1J6Q A;  4GKJ Q;  3PGZ A;  2JA5 G;  3V05 A;  1T5E A;  1AFP A;  3GTO B;  1MD2 D;  3GTK B;  1D6E C;  1NR4 A;  5KND A;  4GZY C;  1WD0 A;  1BCP D;  4LF6 Q;  1Y1W B;  3HG9 A;  1EIY B;  3CRK C;  4MN3 A;  1MIU A;  1I50 B;  4L5R C;  3S16 H;  4X3K A;  4LF7 Q;  2KED A;  1X55 A;  3OHX C;  4KY7 A;  4CJ0 B;  4R4T A;  1F9P A;  3AB9 A;  2E2J H;  4CGY B;  4RHS A;  5JVG 3;  3BG3 A;  4JBK A;  5HGT A;  3GTQ B;  4IFD G;  4B9X A;  3URY A;  4ZK9 B;  3PUW A;  2ICI A;  4RFB A;  4KTA A;  1TXY A;  1M90 C;  5C5L A;  1HNX Q;  3W1B A;  2B2V A;  2K32 A;  4BY1 B;  5DEH A;  3BDL A;  1CM9 A;  1E24 A;  1HCZ A;  4C2M B;  1G2T A;  5CV5 A;  4YCV A;  4NXN Q;  2EOT A;  3J81 E;  1WTQ A;  4HID A;  2M9V A;  4RMF A;  4LFA L;  2R7F A;  4DR4 L;  1TWC H;  4IPG A;  1GUN A;  1SE2 A;  2H4O A;  3IL8 A;  2R93 B;  5C44 G;  1TS4 A;  5LL6 X;  1CK1 A;  4KMU C;  2N55 A;  1CA5 A;  1ROD A;  5C0X H;  3A0J A;  2PPB C;  4F88 A;  2X69 A;  1EYG A;  2R6G A;  3M3Y B;  1SFO B;  3DM3 A;  5CV4 A;  3MEF A;  1EL0 A;  1SND A;  2Y0S B;  2ZM6 L;  2JEA I;  3CCQ A;  3DLL A;  3VR2 A;  4DV6 Q;  3WDN A;  5C4J B;  3S1R B;  3OIP A;  1IYU A;  5FLX L;  3K6O A;  4DK0 A;  5ELD A;  2UXD L;  4K2L A;  4MIU A;  3H09 A;  2A73 B;  5LMU Q;  2HCC A;  2ZTC A;  2WAQ B;  1RTO A;  1BUV T;  1XWE A;  3NBH B;  1H9M A;  4HAE A;  1QUQ B;  5IP7 H;  3PCO B;  1VQ4 A;  1PTO D;  2HCI A;  4NXM L;  1PRT B;  1TWG B;  1B1Z A;  2VXW A;  1QZH A;  1YNN D;  5CV7 A;  2IX3 A;  5C3E H;  3MFY A;  1C8C A;  2MQH A;  4YHH L;  4K0K L;  2A6H D;  1JE5 A;  5GAG C;  3WWV A;  1Q82 C;  2B2T A;  4RKL A;  1SNQ A;  1JOR A;  3F8T A;  5IT9 c;  3TME A;  5C4X B;  4G7Z C;  4L5S A;  4DR1 L;  5KRU A;  2I5L X;  5GRO A;  3KJP A;  3TS0 A;  1EOT A;  1DON A;  1TS3 A;  2XWB B;  1SMY C;  3CPF A;  1EIH A;  1NNX A;  5LL6 S;  1RTN A;  3FDT A;  4GN5 A;  4DUY L;  4PNY A;  1KAA A;  3E5S A;  5M5W H;  4BY1 G;  3CC2 A;  3HOX B;  3RZO H;  2F0E A;  1QG7 A;  1B4O A;  1E2Z A;  4ZKB B;  4TSS A;  1JB3 A;  3I8Z A;  2NB0 A;  2QKI C;  2ID0 A;  2E2I B;  1P8L A;  1JT8 A;  2XRS D;  1TS2 A;  1PLF A;  1IBK L;  1FD7 D;  4XT3 B;  4UP7 A;  1VQI A;  2R93 G;  1SYG A;  4DR7 L;  3W3A A;  3S17 B;  2EIF A;  4X66 L;  3I4M G;  3M7G A;  2AUJ D;  2ICE C;  1HA5 A;  2EJF C;  5JJI A;  1SEB D;  3EIV A;  4POG A;  4QIW E;  1Y1V B;  2Y0S G;  3FP9 A;  1H9S B;  1CSP A;  5M3M H;  2ALY B;  4LFB Q;  1QVC A;  3T1H L;  1TWA B;  2Q2U A;  4CJ2 C;  3RLF A;  1EZ6 A;  3ND9 A;  1JJ2 A;  5D3D A;  3STB D;  1QNU A;  3ND8 A;  3GTG B;  1MJC A;  4A3M B;  2JA6 H;  2WAQ G;  4K2K A;  2JA9 A;  3BDO A;  5CR3 A;  4DR3 Q;  1PMR A;  1UEB A;  2HD3 A;  3G6E A;  1SE4 A;  2VNU D;  3I56 A;  1N32 Q;  4DNT B;  3GV3 A;  1EWH A;  2P5Z X;  1ENF A;  1SYE A;  3OMC A;  3CCR A;  1SNP A;  4ME3 A;  1KIX A;  4J8Q A;  1HA6 A;  2KHI A;  3OIQ A;  3N52 A;  3S16 B;  1MJE A;  3IRB A;  2Q2H A;  4FP5 D;  3A7L A;  3RLO A;  5C4X G;  3H94 A;  4R4C A;  4CHT B;  3WOE A;  4BBS B;  3PO2 H;  1RIP A;  4WJ4 A;  4KY6 A;  1Y69 U;  1PRT F;  1A2U A;  2NZO A;  1W3S A;  4RCN A;  3OOC A;  3TP6 A;  3NTK A;  4IN3 A;  2R92 G;  3NK9 A;  1BF4 A;  4B3R L;  2A68 D;  1V1O A;  3HOX G;  1D8L A;  4WOR A;  3HOU H;  4A3K B;  2Q8T A;  1LUZ A;  1QVF A;  3NP8 A;  2JSO A;  2MJ8 A;  3FRP B;  5DNF A;  4X65 L;  4BS9 A;  3GTJ B;  3GP7 A;  3MVV A;  4JI1 L;  1LAB A;  5EQ0 A;  5FLM G;  5K5P A;  1JQY D;  1W6J A;  4ID6 A;  4HED A;  3SK8 A;  1ET6 A;  4LF5 Q;  3Q0A A;  2C5C A;  4DV7 L;  4X64 Q;  2GVB A;  2XGT A;  1ZEQ X;  2J7Z A;  4DV5 L;  2UXB Q;  2F0N A;  1X3E A;  5IIF A;  3C1E A;  3ULP A;  4HCS A;  1S5C D;  1CKM A;  3UE0 A;  2CKZ B;  4JW0 A;  3HRZ C;  3QOL A;  1HNZ L;  4A3M G;  4DAV A;  5T1G A;  1II3 A;  1ML0 D;  1PA6 A;  1LT5 D;  2K14 A;  4YIJ A;  1HPC A;  1Y8N B;  2WB1 E;  4IUQ A;  5C0X I;  2A69 C;  4OO1 G;  2F1M A;  4HIM A;  1J5E Q;  1FJG Q;  1HRJ A;  2DNC A;  1N34 Q;  4GLV B;  4IUT A;  5HUR A;  3CCS A;  3I72 A;  3P75 A;  3EFX D;  1ZYR D;  1LV9 A;  3UDX A;  5AJ3 Q;  2CFM A;  3EBE A;  2AWN A;  1EQQ A;  2RHS B;  5M9O A;  4QF4 A;  1PVO A;  2JA5 H;  4A3C H;  2EY1 A;  3NTI A;  3SK6 A;  1P16 A;  2PO4 A;  2WFW A;  2IWH A;  1E2W A;  2UUA Q;  1KRT A;  5IT9 L;  4IJH A;  1F2Z A;  5EJW A;  1PV4 A;  2SOB A;  2GA4 B;  3S9W A;  1RL2 A;  1FR3 A;  2A6E D;  2EYJ A;  1RCV D;  1ICW A;  3I70 A;  4KHP Q;  3TS2 A;  3I55 A;  1STA A;  3F2D A;  1YNX A;  1YJN A;  5M5W B;  4YY3 Q;  4XDX A;  3RZO B;  4C56 C;  3J81 c;  4PMW A;  4IFD H;  4C1N I;  3BVM A;  3DWQ A;  3P20 A;  5I2Y A;  2ZXR A;  3F2C A;  3TP5 A;  3RZD H;  2NVX H;  1G2S A;  4ABN A;  2PCF B;  1R4Q B;  2NVT B;  2DN8 A;  2SDF A;  4JPB W;  3JC6 6;  4KI0 A;  5T1I A;  4N8F A;  4A3L H;  1IZ6 A;  2AKW B;  5C0X G;  1AE3 A;  3SE0 A;  5FKA C;  3PF4 A;  1LYL A;  1I4Q A;  4JVZ A;  2BE5 C;  4LJZ C;  1YVC A;  4CKC A;  1K73 C;  2UXC L;  2CW0 C;  1EWI A;  5M3M B;  3CCJ A;  4G7H C;  5M5X H;  4QJF A;  3J7A 5;  1KL9 A;  3VR6 A;  4LWC A;  2PZW A;  1MSG A;  5I9P A;  2WIN B;  4DV1 L;  2X6L A;  4A3E B;  2QIL A;  1VQD A;  1Z47 A;  4LF9 Q;  3Q24 A;  3Q6S A;  4DGZ A;  1G8Z D;  1DJR D;  1S3O A;  3RN2 A;  4BA2 I;  1ESR A;  4IUR A;  3VR5 A;  3KUP A;  3ULL A;  2R7Z B;  2YTV A;  4IPD A;  3A5U A;  4JI0 L;  2Z4H A;  1S4Z A;  1K8A C;  2R3Z A;  5C3E G;  2UUC Q;  4B3M Q;  5IGG A;  4JYA Q;  1I4X A;  2IW3 A;  2QDL A;  3ER0 A;  1I4R A;  4JV5 Q;  5BN5 A;  1GKH A;  1JWS D;  3K7A B;  3GTO H;  4QCL A;  3SEB A;  4AYB B;  1J8I A;  2DUD A;  4ZKC B;  2DJF C;  4XYO A;  3GTK H;  2DY7 A;  4V19 0;  1A2T A;  1LTR D;  4HMJ A;  1STG A;  3FKI H;  1LTB D;  4JOI A;  4BBR B;  1Y1W H;  1I50 H;  5LMN W;  3PUY A;  2F0P A;  1CI3 M;  2AHO B;  4B08 A;  3HOY B;  1E2V A;  2IT1 A;  1XNQ L;  3HKZ B;  3PIO 3;  4CDF C;  3WOF A;  1VQG A;  5HGQ A;  1E22 A;  4QUF A;  4F7X A;  2K33 A;  3DEP A;  4IFD J;  4C2M H;  4L8J A;  1IL2 A;  2OF1 A;  1LTS D;  3S1N B;  1L2F A;  4DK3 C;  1LTL A;  2VW9 A;  3A8J E;  3T53 B;  1EYD A;  2QGQ A;  4QMG A;  1XNR Q;  2KCT A;  1LT4 D;  2C35 B;  3H3V H;  4NKL A;  5M3M G;  2B2Y C;  3M3Y H;  4LFA Q;  4DF7 A;  3NQI A;  3MXP A;  1AEX A;  1Q90 A;  1D5Z C;  4JI8 L;  4DR4 Q;  1TT2 A;  1IW7 C;  4DR5 L;  1PZJ D;  4JI4 L;  3JAM L;  1CQF A;  5FLX c;  4U67 3;  4GNX A;  2OT2 A;  1A0I A;  4EQP A;  3N6R A;  3ZJY C;  2M2L A;  5C4J H;  4IPH A;  2WKC A;  3S1R H;  2JA6 G;  2Z6K C;  1RKN A;  2OTL A;  4ZLT F;  1QB5 D;  4WRD A;  1SJH D;  4JOI C;  2ZM6 Q;  2R7Z G;  2FFK B;  4DNI A;  1G29 1;  3CC7 A;  3I7F A;  3MFG A;  2B3G A;  2KQ3 A;  1EY7 A;  1UUP A;  5CC4 A;  4FXD A;  2E8G A;  1SMY D;  1FGU A;  1PH3 A;  2E5L L;  4A3B B;  1TWG H;  2F0T A;  1U4M A;  4L6T B;  3SR1 A;  5C3X A;  5IY0 A;  1IXR A;  4A3D B;  3ERS X;  2K50 A;  2G9D A;  1C48 A;  2KCN A;  4ODG A;  4JI6 Q;  5JJZ A;  4I7A A;  3OW7 A;  5IYD H;  2VL6 A;  2NYZ D;  2K01 A; 
#chains in the Genus database with same CATH homology
 2KVM A;  3MAQ A;  2EE1 A;  4KY5 A;  4C3H B;  1OXT A;  2E75 C;  2F0K A;  2BDO A;  1XX8 A;  3VYR A;  3D6C A;  2BA0 A;  3J81 L;  3Q22 A;  3FPU B;  5IGD A;  3PO3 B;  5JPM C;  2FMM A;  5FO9 B;  3MC0 B;  2IX1 A;  1ENA A;  5A35 A;  3J7A F;  1GHK A;  3HOZ B;  4KKS A;  1G91 A;  2L11 A;  1M8A A;  3NBI A;  3Q23 A;  3TSS A;  3NWS A;  2NVY B;  1GXD C;  1Q1B A;  4IFD I;  1STN A;  3NUC A;  3T4A C;  1CTM A;  3RD4 A;  1B3A A;  1FYC A;  5CBE E;  5E4X A;  1D5M C;  1TVX A;  2NTS A;  4E6I A;  1T5X D;  1U4P A;  3M4Y A;  1JWM D;  1VF7 A;  3NE5 B;  1JOO A;  1JE4 A;  3FKI B;  2XSC A;  5KIX A;  1EU4 A;  2WII B;  3L9A X;  3HS0 C;  2JEB I;  2ENB A;  1SYC A;  1BQQ T;  3VR4 A;  4UAI A;  4C3H G;  5K36 H;  4O1N A;  1O7L A;  1F77 A;  2F0F A;  4CBV A;  1NCV A;  1LO5 D;  3ZYY X;  3NBH A;  3D31 A;  4QIW B;  1GUS A;  1KDC A;  4DXG A;  2L0C A;  3I4L A;  5G3L D;  3A54 A;  1G6Z A;  1KTK A;  1JR0 D;  2FMC A;  4CJ1 B;  1PZK D;  3TBI B;  1IKM A;  4ZQ3 A;  1OXV A;  2RBM A;  3C3L A;  1HUN A;  1FGB D;  3U9S A;  2EYH A;  1O78 A;  4OL7 A;  3HOV B;  4R9W A;  3X3M A;  4C1N K;  1FNW A;  1S5F D;  1XXG A;  3D3R A;  3K58 A;  2RKS A;  3C46 A;  1ILP A;  1A3U A;  5CV8 A;  2SNS A;  2WAC A;  1U9R A;  5I6W A;  2IJ0 A;  2JE6 I;  4PMB A;  3MHB A;  5ELB A;  2B2V C;  2F0I A;  4FF3 A;  3PUZ A;  3A56 A;  2O5J C;  3KF8 A;  1D2B A;  5DM7 3;  4J6H A;  4ULL A;  1D1K A;  1GUG A;  3IFT A;  3OWF A;  2QDB A;  1TY2 A;  1H9S A;  1PRT C;  4HSV A;  2Z4I A;  2F0L A;  4K8J A;  2V4D A;  2AWO A;  2DNE A;  1NSN S;  4X3T A;  1SNM A;  4DK1 A;  3KLR A;  2BE5 D;  1W6K A;  2MGS A;  2CW0 D;  5KYL A;  1PTO H;  2VB2 X;  2B63 B;  3I73 A;  1GUW A;  4HTH A;  4KN4 C;  3PUV A;  1DYQ A;  3QOJ A;  3NHH A;  1STH A;  4IUP A;  3OSO A;  1TWF B;  4DFA A;  1SBB B;  3HOW B;  4A93 B;  1O7Y A;  4PV1 C;  2A5H A;  3DXJ C;  5EBD A;  2F0Q A;  2KA7 A;  1SE3 A;  1E0B A;  5C0X J;  2WB1 B;  2NVQ B;  2KUM A;  1EY8 A;  1RDP D;  3H0G B;  3K57 A;  3P7J A;  1HTL D;  2Q8I B;  3BDC A;  2B2T C;  4ZAI A;  1I4H A;  4G4K A;  4F8M A;  1D1I A;  1EY6 A;  4XTC S;  2EVB A;  3TP7 A;  3KBG A;  5EKI A;  4WJW A;  2JA8 B;  4XIG S;  1SNO A;  1OXX K;  1CHQ D;  1F2M A;  2FIN B;  3LNN A;  4RGM A;  1MBY A;  2LKV A;  5IGF A;  3T13 A;  1DOL A;  1SDF A;  2KEE A;  4A3I B;  5M3F B;  2KJX A;  5FK9 C;  2PMZ B;  2PZU A;  1PFN A;  1FNU A;  2DY8 A;  5ELF A;  4OO1 I;  2JYO A;  5IGB A;  2EJM A;  2F3V A;  1CHP D;  2QF7 A;  2ZXO A;  1EYA A;  3PIP 3;  3QIA A;  3QG1 A;  5C6A A;  4A3F B;  4A3J B;  1Y8O B;  4RKB A;  4FXK C;  1IW7 D;  1BCP B;  2IPK D;  3VR3 A;  2MP1 A;  5I9O A;  2TSS A;  5JPN C;  5IGC A;  2F0U A;  1QNK A;  2XWJ B;  2Q8R E;  4Q0F A;  2A74 C;  4EVO A;  3UI2 A;  2RDH A;  1KNE A;  3D4W A;  4UDU C;  4OGQ C;  5EPJ A;  5F2D A;  3L7Z C;  1HFG A;  3K5L A;  4K5V A;  4TKO B;  1SYB A;  4DA2 A;  3K5M A;  2F0S A;  1KDA A;  4XYQ A;  1ONL A;  3QWN A;  4KK7 A;  2B2U A;  1B2T A;  2MPM A;  1STE A;  1EIG A;  3R3O A;  2KHS A;  4K5X A;  2AQ2 B;  5C4Z A;  3KLS A;  1Z7T A;  5KNB A;  2EDG A;  1O80 A;  3E0J A;  2LY7 A;  2C9O A;  4NP5 A;  3GV6 A;  2X6G A;  4R8N A;  3S14 B;  2HDL A;  5CBA E;  1R9T B;  3S1M B;  1B9N A;  3ITP A;  4Z9C B;  2EYP A;  5JAV A;  3CHB D;  2LMC B;  5ELE A;  5K36 G;  4RCO A;  4G7O C;  3A7A B;  5CGK A;  1FNV A;  4A3G B;  1PTO B;  3KBX A;  3ERO A;  1AP0 A;  4HR7 B;  1F2L A;  2EY5 A;  3BVZ A;  1YNJ C;  1IHZ A;  3I3C A;  3MXU A;  4K6L A;  3M7N A;  2Z1C A;  1A3T A;  3CU7 A;  3SK5 A;  4HSP A;  2F0O A;  2HUG A;  1LTT D;  2AUK A;  1AZP A;  5A2Q L;  2F03 A;  2K04 A;  4BY7 B;  4LK1 C;  1B53 A;  4FYD A;  3IKJ A;  4XT1 B;  4EQN A;  5KGU A;  1BCP F;  3K59 A;  4FF1 A;  4QUC A;  3PUX A;  3HP3 A;  1F9R A;  1XYI A;  4KJO A;  3S1Q B;  1VCI A;  4C3J B;  2L9H A;  3OWE B;  1JIC A;  2D62 A;  2HQE A;  2XRQ D;  4FO2 A;  2BA1 A;  4N9P A;  1DCZ A;  3MZ5 A;  5KEE A;  3TZU A;  4DAP A;  4H7B A;  2D9U A;  5DAU A;  2D5D A;  2NZ1 D;  1QIL A;  1GOZ A;  3MTS A;  3AMU A;  1JOQ A;  1Z6H A;  2NWG A;  4RHR A;  1NAP A;  4C3I B;  1SAP A;  2F0V A;  3M4O B;  2PQE A;  1SXT A;  1EEI D;  3BYY B;  3VA5 A;  1B50 A;  2K7V A;  5IT9 E;  3DM1 A;  2I46 A;  5JOB A;  1BNZ A;  4TQU S;  4FXG C;  1PTO F;  1Q8I A;  3L3O C;  1LT3 D;  4OHJ A;  1EEF D;  1I6V C;  2XVS A;  2EYO A;  3NQT A;  1J9O A;  4DNR B;  3C2P A;  1I6H B;  2FHT A;  2EZV A;  1Q3L A;  3BVG A;  4KV6 A;  4IUN A;  4H44 C;  2IL8 A;  3V96 A;  3EA6 A;  1EQV A;  2EYL A;  4PMC A;  1TII D;  1PRT D;  4M8A A;  4S3S A;  3DMU A;  2F0J A;  1LAC A;  3GD7 A;  2PW7 A;  1EQT A;  3I4N B;  1VMC A;  5CV9 A;  2F0H A;  1ILQ A;  3T51 B;  5D65 A;  2KOL A;  1K8O A;  4KD3 A;  2F0D A;  5IOD A;  3D4R A;  1X3Q A;  5CYU A;  1M4V A;  5COY A;  1H9R A;  4L63 B;  4KHV A;  4F87 A;  4U68 A;  3PV0 A;  1OO9 B;  1IKL A;  5E4W C;  4CKE A;  1OXS C;  3VA7 A;  3T16 A;  3AU7 A;  2K5D A;  4FNF A;  3S2D B;  1V8Q A;  1V1P B;  2RQX A;  3RUZ A;  4KD4 A;  5BN4 A;  2WP8 J;  3NXW A;  4HMI A;  1RJT A;  3TDQ A;  1KLG D;  3BYT B;  5CV6 A;  1HQM C;  1KLU D;  2QCP X;  2H1E A;  1BXT A;  1PXU A;  4Q5V A;  4CKB A;  4K5W A;  1BO0 A;  1WTR A;  2MHV A;  1CZW A;  2CHB D;  4ZRZ A;  5C44 B;  1RF2 D;  1SYD A;  5I6Y A;  1U4L A;  5C5M A;  3DHQ A;  2PNR C;  3LX0 A;  4H0L C;  2B8F A;  3C1F A;  3U9O A;  1OXU A;  1SNC A;  4I7Z C;  4KKU A;  4RH6 A;  2XIW A;  1GHJ A;  1VDZ A;  3FEW X;  3GTP B;  1B9M A;  1Q12 A;  3QO2 A;  1I4G A;  4K6D A;  4RGN A;  2J0T D;  4FVM A;  4ME5 A;  2N88 A;  4NDX A;  1O7Z A;  4KKT A;  3T56 B;  1SJE D;  1WCM B;  2PYK A;  3FVQ A;  3VYT A;  3R8B A;  5M5Y B;  5FO7 B;  3OMG A;  5JVH 3;  1U4R A;  2B39 A;  4ZYS A;  3SDZ A;  4Y7N B;  3TP8 A;  4LAA A;  3GTM B;  4KHZ A;  2A69 D;  2E74 C;  3CQZ B;  5IGE A;  2RA4 A;  3H3V C;  4RAU C;  5EKK A;  3I4M B;  1EU3 A;  1H9K A;  3LWE A;  2L12 A;  4PQX A;  1TWH B;  2B8G A;  1LT6 D;  4DN4 M;  3FMC A;  1WD1 A;  5D3I B;  2L5T A;  3DWP A;  3CRL C;  1LLR D;  4FF2 A;  2CQA A;  4XQQ A;  3D6W A;  4WFN 3;  2NBF A;  3J80 E;  2PZT A;  1MSH A;  1YNJ D;  2ZT9 C;  1QJO A;  1DXM A;  1UEA B;  1GUO A;  4EGV A;  3S2H B;  2YU9 B;  2LS0 1;  1ZKO A;  2RVL A;  1X3P A;  2YYZ A;  3MA2 B;  3QJY A;  1TR5 A;  3RMH A;  2OEO A;  1PDQ A;  2KEC A;  2O4X A;  2R92 B;  1KNA A;  2JA7 B;  3HZX A;  2NN6 H;  1KDB A;  1EFI D;  3DEO A;  3EQL C;  2E76 C;  2K6A A;  5ELC A;  2QEJ C;  2G9H D;  5E3F A;  3TN2 A;  3A55 A;  2O5I C;  2XNA C;  5EPK A;  4DAY A;  3J7Y W;  1TS5 A;  1HXY D;  2L4N A;  1MI2 A;  2HDM A;  3DWA A;  1LTI D;  2K28 A;  3SXH A;  1K83 B;  5IOC A;  4J1M A;  4XQJ A;  3HGB A;  1F2Y A;  1NR2 A;  1RHP A;  4R8I A;  2WKD A;  2VUM B;  1C4Q A;  2ZXP A;  2F0M A;  2Z8L A;  5FLX E;  4DXF A;  3G7L A;  1AN8 A;  3A8K E;  2OXP A;  1MGS A;  3G6J B;  1GJX A;  4OIJ A;  4X3S A;  1TU2 B;  1STY A;  3D8G A;  5LHY 1;  2F4I A;  2KCC A;  3VYS A;  1WVL A;  4EQO A;  3MXN A;  2BCO A;  2R61 A;  2O2L D;  1VF5 C;  1HTP A;  1JC7 A;  3VYU A;  1D5X C;  2AQ1 B;  3TZD A;  1KAB A;  2E2J B;  4ZUJ A;  1EWC A;  2PW5 A;  4XXE A;  3F2U A;  2F0G A;  1QOH A;  1ESF A;  5J22 A;  1S5B D;  1S5E D;  2E2D C;  2SNM A;  3OPO A;  1BCP C;  5C3W A;  2EY2 A;  2F3W A;  5TSS A;  2RSO A;  1TWC B;  5ISR A;  3K5N A;  3KLS X;  5FOB B;  3SK4 A;  2AQ3 B;  2J4X A;  5J39 A;  5D14 A;  3O13 A;  4G57 A;  1I4P A;  1EY0 A;  2RDF A;  2E2H B;  4HN7 A;  1QE6 A;  4IUU A;  1EY9 A;  3J7A V;  1WTO A;  3NPP A;  1PFB A;  2MUY A;  4DU9 A;  3KK7 A;  3X3N A;  1HQR D;  1S5D D;  1ET9 A;  4RGT A;  5FO8 B;  4V0B A;  4X3U A;  1A15 A;  5JEA H;  2SEB D;  4B9W A;  2XN9 C;  2VB3 X;  5C3E B;  4IZ8 A;  3SVM A;  5CMD A;  3GQB A;  1PZI D;  1CT1 D;  1VMP A;  1B44 D;  3E6Z X;  4O42 A;  4BWG B;  3CKI B;  1EZ8 A;  1QWY A;  3D4D A;  1PTO C;  4K14 A;  5EPL A;  1JWU D;  1BR9 A;  1CFM A;  1YNN C;  2B2U C;  4ZUI A;  2A6H C;  4TRD A;  4NW2 A;  2B2W A;  3DUZ A;  3K5O A;  1GUT A;  1A6X A;  3FPP A;  1PYW D;  1WTP A;  2EY6 A;  1BBX C;  3ERQ A;  1Q1E A;  5KNC A;  4XQN A;  1DOK A;  1TKW B;  1IL8 A;  1AW7 A;  4JK1 C;  4RWS C;  5NUC A;  3IAY A;  4KN7 C;  2JP1 A;  1EY4 A;  1H9J A;  1DZ1 A;  2NN6 I;  2I07 B;  3NSW A;  2JA6 B;  1NUC A;  2BOS A;  3QB3 A;  2FJ2 A;  1I3Q B;  5G3L F;  5EBC A;  2K1B A;  1LTA D;  2B2Y A;  2K5W A;  2L55 A;  5JEA J;  2BDN A;  2EXZ A;  1AZQ A;  2NTT A;  5KYI A;  2K5Q A;  1V43 A;  4I65 A;  3IFD A;  4LMQ D;  1STB A;  2B2W C;  4P2C B;  3H91 A;  1WTV A;  1HUM A;  3PMF A;  1XTC D;  2F0W A;  1PFM A;  3PO2 B;  1EY5 A;  3R2T A;  3MXG A;  1HHV A;  1L0Y B;  4H13 C;  2NN6 G;  1JOK A;  4JBW A;  4IUV A;  3HOU B;  3S15 B;  3M85 A;  1QCB D;  5DM6 3;  2EYM A;  4M1U B;  1CQV A;  1DM0 B;  1LTG D;  2CVR A;  1F9S A;  5A2Q E;  2A68 C;  2RSN A;  1V1P A;  4HCE A;  3A8I E;  1CA6 A;  4C3J G;  3P1H A;  4K8I A;  4QB4 A;  3NTH A;  3I90 A;  1RD9 D;  3NWT A;  1EYC A;  1F9Q A;  4KJN A;  4BA1 I;  1UNS A;  2K03 A;  4IAL A;  3BZD B;  1ZXT A;  1WTX A;  4MHE A;  3LWU A;  5E1F A;  5EGT A;  3H6M A;  2JA5 B;  3MEH A;  2EPB A;  2RDG A;  1HFN A;  4C3I G;  1TQO A;  1X32 A;  2L1B A;  5I4D A;  1WTW A;  1SYF A;  1A3V A;  2EYF A;  2JXM B;  3R93 A;  4N9T A;  3V2T A;  1TY0 A;  5C4H A;  3R2I A;  4IQZ A;  5I2X A;  4NMZ A;  1R4P B;  2TMP A;  1ZYR C;  2IX0 A;  1IYV A;  3RZD B;  1L0X B;  2NVX B;  2D2C C;  2K05 A;  1Y8P B;  3HEJ A;  2M00 A;  3EVQ A;  3SHL A;  3ONA B;  1JCK B;  4FF4 A;  2A6E C;  1ENC A;  2NUC A;  1SSO A;  1BOS A;  1BDO A;  1DOM A;  1UAP A;  4OIK A;  2LFN A;  5M5X B;  5EKL A;  4RGO S;  5AFW A;  3BS1 A;  3K0Y A;  3JAM E;  5BN3 A;  3EJI A;  3J80 L;  5COR A;  3W2D A;  3I91 A;  2WV6 D;  5JEA G;  4RA8 A;  2EJG C;  3GTL B;  4ILW A;  1CZG A;  3GO5 A;  3MWY W;  1K8M A;  4OO1 H;  1DD2 A;  3V05 A;  1T5E A;  1AFP A;  3GTO B;  1MD2 D;  3GTK B;  1D6E C;  1NR4 A;  5KND A;  4GZY C;  1WD0 A;  1BCP D;  1Y1W B;  3HG9 A;  3CRK C;  4MN3 A;  1I50 B;  4X3K A;  2KED A;  3OHX C;  4KY7 A;  4CJ0 B;  1F9P A;  3AB9 A;  4CGY B;  4RHS A;  5JVG 3;  3BG3 A;  5HGT A;  3GTQ B;  4IFD G;  4B9X A;  3URY A;  4ZK9 B;  3PUW A;  2ICI A;  4RFB A;  4KTA A;  5C5L A;  2B2V A;  2K32 A;  4BY1 B;  5DEH A;  3BDL A;  1CM9 A;  1HCZ A;  4C2M B;  1G2T A;  5CV5 A;  2EOT A;  3J81 E;  1WTQ A;  2M9V A;  1GUN A;  1SE2 A;  2H4O A;  3IL8 A;  2R93 B;  1TS4 A;  5LL6 X;  1CK1 A;  4KMU C;  2N55 A;  1CA5 A;  1ROD A;  5C0X H;  2PPB C;  4F88 A;  2X69 A;  2R6G A;  3M3Y B;  1SFO B;  5CV4 A;  1EL0 A;  1SND A;  2Y0S B;  2JEA I;  3VR2 A;  3WDN A;  5C4J B;  3S1R B;  3OIP A;  1IYU A;  5FLX L;  3K6O A;  4DK0 A;  5ELD A;  4K2L A;  4MIU A;  3H09 A;  2A73 B;  2HCC A;  2WAQ B;  1RTO A;  1BUV T;  1XWE A;  1H9M A;  4HAE A;  1PTO D;  2HCI A;  1PRT B;  1TWG B;  1B1Z A;  2VXW A;  1YNN D;  5CV7 A;  2IX3 A;  3MFY A;  1C8C A;  2A6H D;  2B2T A;  4RKL A;  1SNQ A;  1JOR A;  3TME A;  5C4X B;  4G7Z C;  5KRU A;  1EOT A;  1DON A;  1TS3 A;  2XWB B;  1SMY C;  1EIH A;  5LL6 S;  1RTN A;  3FDT A;  4PNY A;  1KAA A;  3E5S A;  3HOX B;  2F0E A;  1QG7 A;  1B4O A;  1E2Z A;  4ZKB B;  4TSS A;  1JB3 A;  3I8Z A;  2NB0 A;  2QKI C;  2ID0 A;  2E2I B;  2XRS D;  1TS2 A;  1PLF A;  1FD7 D;  4XT3 B;  1SYG A;  3W3A A;  3S17 B;  3M7G A;  2AUJ D;  2ICE C;  1HA5 A;  2EJF C;  1SEB D;  1Y1V B;  1H9S B;  1TWA B;  4CJ2 C;  3RLF A;  1EZ6 A;  3ND9 A;  5D3D A;  1QNU A;  3ND8 A;  3GTG B;  4A3M B;  4K2K A;  3BDO A;  5CR3 A;  1PMR A;  1SE4 A;  2VNU D;  4DNT B;  3GV3 A;  1EWH A;  1ENF A;  1SYE A;  3OMC A;  1SNP A;  4J8Q A;  1HA6 A;  3OIQ A;  3N52 A;  3S16 B;  4FP5 D;  3A7L A;  3H94 A;  4CHT B;  4BBS B;  3WOE A;  4KY6 A;  1Y69 U;  1PRT F;  1A2U A;  4RCN A;  3OOC A;  3TP6 A;  3NTK A;  4IN3 A;  3NK9 A;  1BF4 A;  2A68 D;  1V1O A;  4WOR A;  4A3K B;  2Q8T A;  3NP8 A;  2JSO A;  2MJ8 A;  3FRP B;  5DNF A;  4BS9 A;  3GTJ B;  3GP7 A;  3MVV A;  1LAB A;  5EQ0 A;  5K5P A;  1JQY D;  1W6J A;  4ID6 A;  4HED A;  3SK8 A;  1ET6 A;  3Q0A A;  2C5C A;  1ZEQ X;  2J7Z A;  2F0N A;  5IIF A;  3C1E A;  4HCS A;  1S5C D;  3HRZ C;  3QOL A;  4DAV A;  5T1G A;  1II3 A;  1ML0 D;  1LT5 D;  4YIJ A;  1HPC A;  1Y8N B;  4IUQ A;  5C0X I;  2A69 C;  4OO1 G;  2F1M A;  1HRJ A;  2DNC A;  4IUT A;  5HUR A;  3I72 A;  3EFX D;  3P75 A;  1ZYR D;  1LV9 A;  2AWN A;  5M9O A;  4QF4 A;  2EY1 A;  3NTI A;  3SK6 A;  2PO4 A;  2IWH A;  1E2W A;  5IT9 L;  1F2Z A;  5EJW A;  2SOB A;  2GA4 B;  3S9W A;  1FR3 A;  2A6E D;  2EYJ A;  1RCV D;  1ICW A;  3I70 A;  1STA A;  5M5W B;  4XDX A;  3RZO B;  4C56 C;  4PMW A;  4IFD H;  4C1N I;  3BVM A;  3DWQ A;  3P20 A;  5I2Y A;  2ZXR A;  3TP5 A;  1G2S A;  4ABN A;  2PCF B;  1R4Q B;  2NVT B;  2DN8 A;  2SDF A;  5T1I A;  4KI0 A;  5C0X G;  3SE0 A;  5FKA C;  1I4Q A;  2BE5 C;  4LJZ C;  4CKC A;  2CW0 C;  5M3M B;  4G7H C;  3VR6 A;  2PZW A;  1MSG A;  5I9P A;  2WIN B;  2X6L A;  4A3E B;  2QIL A;  1Z47 A;  3Q24 A;  3Q6S A;  4DGZ A;  1G8Z D;  1DJR D;  4BA2 I;  1ESR A;  4IUR A;  3VR5 A;  3KUP A;  2R7Z B;  2Z4H A;  1S4Z A;  2R3Z A;  5IGG A;  1I4X A;  2IW3 A;  1I4R A;  5BN5 A;  1JWS D;  3K7A B;  4QCL A;  3SEB A;  4AYB B;  1J8I A;  4ZKC B;  4XYO A;  2DY7 A;  4V19 0;  1A2T A;  1LTR D;  4HMJ A;  1STG A;  1LTB D;  4BBR B;  3PUY A;  2F0P A;  1CI3 M;  4B08 A;  3HOY B;  1E2V A;  2IT1 A;  3HKZ B;  3PIO 3;  3WOF A;  4QUF A;  4F7X A;  2K33 A;  3DEP A;  4IFD J;  4L8J A;  2OF1 A;  1LTS D;  3S1N B;  3A8J E;  3T53 B;  1EYD A;  4QMG A;  1LT4 D;  4NKL A;  2B2Y C;  4DF7 A;  3NQI A;  3MXP A;  1AEX A;  1Q90 A;  1D5Z C;  1TT2 A;  1IW7 C;  1PZJ D;  3JAM L;  1CQF A;  4U67 3;  2OT2 A;  4EQP A;  3N6R A;  2M2L A;  2WKC A;  1RKN A;  4ZLT F;  1QB5 D;  4WRD A;  1SJH D;  2FFK B;  1G29 1;  3MFG A;  2KQ3 A;  1EY7 A;  1UUP A;  5CC4 A;  4FXD A;  1SMY D;  4A3B B;  2F0T A;  4L6T B;  1U4M A;  3SR1 A;  5C3X A;  4A3D B;  2G9D A;  1C48 A;  2KCN A;  4ODG A;  5JJZ A;  3OW7 A;  5J1Z A;  2NYZ D;  2K01 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...