1JOKA

Averaged structure for staphylococcal nuclease-h124l in ternary complex with ca2+ and thymidine-3',5'-bisphosphate
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
149
structure length
149
Chain Sequence
ATSTKKLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQLLRKSEAQAKKEKLNIWSEDNADSGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords staphylococcal nuclease
publication title Solution structures of staphylococcal nuclease from multidimensional, multinuclear NMR: nuclease-H124L and its ternary complex with Ca2+ and thymidine-3',5'-bisphosphate.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 23
structure length 149
sequence length 149
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2001-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1jokA00
2PYKA 5JAVA 3OWFA 5K5PA 1A3VA 1SNMA 5CV4A 1EY4A 4ID6A 5CV5A 1TQOA 4RKBA 5C3XA 5HGTA 1EY7A 3E5SA 4KJNA 4PNYA 2LKVA 5IGGA 3QB3A 2F0HA 3RUZA 3MHBA 2NUCA 1SYEA 3QOLA 4KD4A 5CR3A 4N9PA 3SK5A 2EXZA 4K2KA 3TP5A 3T16A 5IGFA 2F0QA 1SNQA 5CV7A 5I6WA 4IALA 5C5LA 2PZWA 3NHHA 3TMEA 1EY5A 3NUCA 3SHLA 4I65A 1TR5A 2PZUA 1STNA 2F0JA 1KABA 1JOKA 3NQTA 3OMCA 1JOQA 4RKLA 1STBA 1EYDA 1EY9A 2OXPA 1NSNS 1F2ZA 2EY5A 4PMCA 5CV6A 5I6YA 5NUCA 4KTAA 4NMZA 5KIXA 4KY7A 3H6MA 3C1FA 4J6HA 2EY6A 4J1MA 2F0EA 4DF7A 5M9OA 2F3VA 5E3FA 1U9RA 4EQPA 3C1EA 4PMBA 4IZ8A 4K8IA 1A2TA 3LX0A 1STAA 2PZTA 5EKLA 5KRUA 1F2MA 4HTHA 1ENCA 5CGKA 4DFAA 4MIUA 1STHA 4S3SA 2KHSA 5EKKA 2EY2A 2EYLA 3DMUA 5IODA 4EQOA 5KEEA 2F0IA 2F3WA 3NK9A 3P1HA 2PW7A 4HMJA 1EY0A 2EYJA 2SNSA 2SOBA 5CV8A 1EYCA 5KYIA 1STGA 1ENAA 5ISRA 4TRDA 5C6AA 2F0SA 5DEHA 4QF4A 3SXHA 1KDAA 1EYAA 2OEOA 1KAAA 1EY6A 1KDCA 1TT2A 4DU9A 5IIFA 4QMGA 3OMGA 4NP5A 3MEHA 1JOOA 1STYA 2EYHA 4EVOA 4HMIA 5IGDA 3HEJA 2QDBA 5EGTA 3PMFA 1RKNA 2F0TA 4ZUJA 2O4XA 1A3TA 1EZ8A 1SNCA 4NDXA 5E1FA 1SNOA 2HQEA 3DHQA 5J22A 5CV9A 5I9PA 2EY1A 4F7XA 5J1ZA 4LAAA 1JORA 5C5MA 4ZUIA 2KQ3A 4ZQ3A 4OL7A 3T13A 2F0GA 3ITPA 5IOCA 3VA5A 3R3OA 4K5WA 2EYFA 2F0MA 3D4WA 3NXWA 5CC4A 4KHVA 3TP8A 2F0NA 1A3UA 1F2YA 3P75A 1A2UA 2F0KA 4N9TA 4E6IA 4K8JA 5KGUA 1NUCA 3OSOA 3ERQA 4NKLA 1EZ6A 1SYDA 2F0WA 1AEXA 1SNDA 5IGCA 5HURA 2F0PA 3SK4A 4KY6A 5J39A 4IUNA 2RKSA 2M00A 3BDCA 1SYCA 2F0FA 1KDBA 1SYFA 3QOJA 4DGZA 3SR1A 3U9OA 4KV6A 3MXPA 5C3WA 4K6DA 1SYBA 4F8MA 3D4DA 5I9OA 4YIJA 5DAUA 3SK6A 2OF1A 2EYPA 3BDLA 3MZ5A 4G57A 4KY5A 3NP8A 4H7BA 4EQNA 2SNMA 4B9XA 4KD3A 3D6CA 2F0OA 1II3A 4K2LA 4R8NA 2ENBA 2F0LA 2EYOA 3EVQA 2WACA 4ME5A 4WORA 4K5XA 5C4ZA 3EROA 5KYLA 3SK8A 1EY8A 3V2TA 4B9WA 3TP7A 4K5VA 1SYGA 2F0VA 2RDFA 2RBMA 5JOBA 3S9WA 3HZXA 4ODGA 1IHZA 2PW5A 4K14A 5F2DA 4WRDA 2EYMA 3MVVA 2F0UA 2PQEA 4KJOA 1SNPA 5C4HA 3EJIA 5IGEA 3D8GA 2F0DA 4QB4A 5IGBA 3TP6A 1EQVA
chains in the Genus database with same CATH superfamily
3D31A 1BO0A 3T1YQ 2MGSA 1K8MA 1YJNA 2UXCQ 3CKIB 4DR1L 4PNYA 1RTNA 5FO9B 1CQFA 3MHBA 3NPPA 1SAPA 2N3SA 2HDLA 1YHQA 1UE7A 3NTIA 1R4PB 1X56A 2JA7G 3FVQA 2KHIA 4R4TA 1B50A 3J81c 3CCLA 5EAYA 3CPFA 2NZOA 3SVMA 1PV4A 1QOHA 2CWAA 2D9UA 4RHRA 3KJOA 2ZM6L 2CW0C 1HQRD 2K1BA 3IRBA 3JAME 4DR1Q 1CZGA 3GP7A 2FMCA 2F3VA 3R2IA 1Q8IA 1KRSA 4QGUA 4K8IA 4QIWB 1VQ9A 1VQPA 5T1IA 1QILA 3TZUA 2EYLA 4AIMA 2KENA 4EQOA 3HOVH 4IOAA 3H0GH 1OXVA 2ZM6Q 4KMUC 3MEHA 3DXJC 4A3DH 4A3FG 4B3SL 1L1OA 1Q90A 1X55A 1BCPB 5FLXc 4LF8L 1PHJA 4R4QA 4L5RC 1KTKA 5D3DA 3M85A 4HJAA 2KQ3A 1NAPA 1MHWC 3DM1A 4A93H 3NXWA 3D4WA 3J81E 2Z6BA 3IKJA 1RF2D 1S5FD 4FVMA 3T51B 1ENFA 3DWQA 2KBNA 2MO1A 4LF6L 1SNDA 2OQ0A 4B3SQ 5AFWA 2NVTB 1M1KC 1YZ6A 4BXXG 3HOUG 4LF8Q 4RGTA 1X3EA 4JI4Q 4IURA 2ID0A 1SYBA 1K8GA 1OTCA 3AU7A 3D0FA 4L63B 1E2VA 3F1ZA 4RAUC 1PRTB 1IYVA 1QE6A 1VQ8A 3S15B 1H9RA 4QJFA 2ZTEA 2DY7A 4XQNA 2UUCL 4CJ0B 4LF6Q 2F0VA 2RBMA 2NBFA 2IHEA 1QZHA 3STBD 4RMFA 5ELEA 3KJPA 4HIDA 1SN8A 1S5DD 2IHFA 3EJIA 5FLXE 2D62A 4UP9A 5CBEE 1HFNA 1A3VA 5CV4A 2UUBL 1HR0L 4IPCA 4KJNA 1UEBA 2A19A 3CCUA 5IYBG 2FJ2A 3Q24A 1DOMA 1PFBA 4DK1A 2A8VA 3FKIH 3HOYH 1CI3M 1NBWA 5CR3A 4WJWA 4ZK9B 2F0QA 1EWHA 2I5HA 5CV7A 4GNXB 1D5ZC 4LUOA 1V43A 4Y7NH 3I8ZA 2UUBQ 1SE2A 2QCPX 1NSNS 1HR0Q 1VQ4A 3SEBA 4TQUS 5M5XH 1JB3A 1G91A 3H09A 4ZCKA 5E7NA 1YNJD 3WWVA 4DV6L 4XQJA 1E1TA 1HJPA 2OTLA 4RA8A 3E6ZX 4DFAA 3E0EA 1STHA 1YHBA 4CBVA 5GADC 4HMJA 1IBLL 1QJOA 3I4LA 5CV8A 3HOVB 1ENAA 1G2TA 2PI2A 5C6AA 2K5HA 4A3BG 2VB2X 1PDQA 4L5SA 2OEOA 4IO9A 1TWAB 1EIYB 1LTLA 4LJZC 3R8BA 2B3GA 3CW2C 4DV6Q 5IT9L 1SNCA 4A4IA 1BCPF 5E1FA 1KD1C 5J22A 5I9PA 3E9IA 1Z9FA 2KEEA 1IBLQ 3G48A 3GTJH 1V8QA 2EJMA 3BZKA 1KXLA 1ZKOA 2F0MA 3K5MA 1TIID 3HKZG 4DR3L 4E6IA 1BBXC 5H1SE 1ESRA 1NCVA 1CUKA 1GJXA 2WP8J 4KY6A 2RKSA 2R92G 3I3CA 1B3AA 4AYBE 1HRJA 3VYRA 2R93G 1PTOD 3AMUA 1CKNA 1Y69U 2YTXA 2BE5D 2AWOA 3I91A 1QNKA 4DR3Q 4Z9CB 1BCPC 1LTTD 2B63G 1XMOL 1N32L 5IP9G 1E1OA 1X6OA 1RTOA 2BH8A 1RD9D 3G6JB 4K14A 2QEXA 3HOUH 5C4JB 4KHZA 4KJOA 1VQLA 1WTRA 3JAMi 2AUKA 2XWJB 3ND9A 1WCMB 2RSNA 3PIP3 1F9SA 1NY4A 4DAYB 5K5PA 4BBRG 4G7OC 2IPKD 1E0BA 3VDYA 1DYQA 1XYIA 4R1JA 3URYA 3C2PA 2ZTDA 2RF4A 1OXXK 1XMOQ 3BJUA 1N32Q 2KCCA 3FKIB 2LXJA 3A54A 4B3TL 3E9HA 4IFDH 3PUYA 3HRZC 4I65A 4Y7NB 1EY9A 4L5TA 4X3SA 2L0CA 3K59A 3HFZB 4A3EH 1KNEA 3ERSX 4QIWE 5NUCA 4X66L 3CXCA 1A8VA 2NVQH 3HOXG 4CJ2C 1SJED 2L55A 2JA6H 3OIPA 5FJ8G 4A3KG 1F2MA 4LMQD 1GKHA 3L2PA 4B3TQ 2FMMA 2F3WA 2SNSA 2IW3A 3UE1A 1XPRA 2JA7B 4TRDA 4A3IG 1GO3E 5JVH3 1Y1VH 1HTLD 1WTPA 2A6HC 3PQIA 5G3LD 4X66Q 5KNBA 3OMGA 1JOOA 3Q6SA 1I4HA 3TSSA 1J8IA 1Q12A 3M4YA 4ZUJA 4OWTB 1EU3A 4GNXC 5C3EG 2B2TC 2WB1G 3BDOA 1B4OA 5C5MA 2RVLA 1L1OB 4ABNA 5FOBB 5ELOA 4K5WA 3GTLH 4C2MH 1HNWL 1CQVA 3P75A 4DUYL 1A62A 3P7JA 4X62L 5LL6S 2UXBL 2ZJQA 5J39A 4DPGA 2UUAQ 4A3FB 1I6HH 3RZOH 2NTSA 1KDBA 3KYHC 3ND8A 4OO1H 4YIJA 2HQLA 1M4VA 1C7YA 4G57A 3NP8A 5HY6A 1U4PA 1ET9A 3MTSA 1EWCA 4R4CA 1HNXL 3G7LA 1XPUA 2MUYA 3MEFA 3K0YA 4DUYQ 2XRSD 1EY8A 3V2TA 3NTHA 2NVYB 1Y1WG 1JB7A 2XVSA 4X62Q 4IFDI 2Z8LA 2VNUD 4ZKCB 2UXBQ 2Q8RE 1VQHA 2R92H 1JE5A 5A2QL 2PQEA 1VQ6A 2R6GA 1HZAA 1X3QA 1EQQA 1FYCA 4YHHL 2CFMA 1SMXA 4DN4M 1HNXQ 3GTKB 1G6ZA 1TS2A 2LKVA 3EA6A 1S40A 2F0HA 3UDFA 1HUMA 5E4WC 5KNDA 3KFUA 1IW7D 1P8LA 4A3LG 3NEMA 4FXKC 4RG1A 1FJGQ 3S17H 4KKSA 3KDFA 4BA2I 1STNA 1QVGA 4YHHQ 3OMCA 4ALPA 3IFTA 1QVFA 3KF8B 5EPKA 3C1FA 4XYQA 5E3FA 5GAHC 2E2HH 1STAA 5KRUA 4JI2L 2SEBD 2NVXH 2B29A 3F2CA 5IODA 2VL6A 1B70B 2E74C 2WAQE 2E5LL 1Q7YC 1TWFH 3ONAB 3S14B 1U0LA 4H02A 3NBHA 3KF6A 3NWSA 1QNUA 2AQ3B 4A3JH 3F8TA 4OO1I 3ULJA 4TVAB 1TVXA 5E4XA 2HIXA 4JI2Q 3WDNA 5CV9A 1Y8PB 1ET6A 3S1RH 5D65A 1SR3A 5IP7G 3S2DH 4APVA 3CF5A 1QVCA 2F52A 5IOCA 3AEVA 3TS2A 3FP9A 4A3BB 4NKLA 1YEZA 4P71A 3PO3G 1C4QA 4OWWB 4FF3A 1X54A 2KHJA 3J7YW 3MXGA 2F0FA 3VR2A 1K3BC 3BZCA 4F8MA 4B3MQ 1RHPA 2R7FA 1I6HB 2F3IA 1BR9A 2HHHL 3I73A 1IZ6A 4C3HH 3J80c 3DUZA 1CKNB 3SE0A 3CCJA 5ELBA 1HXYD 1CM9A 1P16A 4YY3L 3S2HB 3HKZB 5JOBA 3OOCA 2K01A 4PZ6A 5DM73 2JEBI 5LL6X 1PFSA 5F2DA 1YNJC 2EYMA 3MVVA 1ILPA 2F0UA 1G8ZD 2A69D 5CMDA 2C5CA 5M5WH 2R93B 5DLQE 2HHHQ 2WIIB 2N78A 3HOZG 3HOWG 1K3RA 4LFAL 3S16B 1TQOA 1N34L 3K7AB 2Q2HA 1PLFA 2EDGA 1FNVA 2XN9C 2RHSB 5LMUL 4WJ4A 4YY3Q 2B39A 1B8AA 2B63B 2JA8H 1EWIA 2NN6G 1U4LA 1FNUA 3HG9A 3IFDA 3SHLA 1G51A 4LF9L 1C9OA 1B53A 1KABA 2K4KA 1YIJA 1C0AA 3Q0AA 3AQQA 4LFAQ 1WTVA 4HSVA 1K73C 1N34Q 3QR8A 4IUVA 2LMCB 4LW1A 4BBRB 5LMUQ 2CQAA 4BBSG 4FYDA 3LX0A 3VR5A 2E2HB 1HA5A 2CWPA 4PQXA 2Z4HA 2I5LX 5EKKA 2GVBA 2F4VL 3NK9A 3RNUA 4LF9Q 1LTID 3GTGB 1M8AA 1LYLA 4JI8L 3SXHA 2EJFC 1V1PA 1IL2A 4UPAA 2K33A 1WYDA 4C1NK 1JMCA 4L6TB 1XWEA 5D14A 1STYA 4DV1L 3DWAA 1A6XA 2QDBA 2NYZD 2O4XA 4HIMA 1T9HA 2TSSA 1KHIA 1WJJA 4GZYC 3HOXB 2AUJD 1HCZA 1JORA 2F4VQ 4A3KB 3S1RB 1K9MC 1ZXTA 2VUMG 5K36H 2BA1A 2EYFA 2I46A 1NMFA 1PA6A 1O78A 4A3IB 3QWNA 3Q22A 5JEAJ 1PMRA 4DV1Q 1VF7A 1SFOB 2JYOA 5EBDA 5IWAL 1F9PA 5G3LF 3QOJA 5C3EB 3MXPA 2RDGA 1TS5A 4OIJA 2WB1B 3GTQB 2MQHA 1JE4A 1TWHB 1EFWA 4NXML 2K32A 3CRLC 2EJGC 5GAGC 3GO5A 3I4NG 2B8FA 3GQBA 3SK8A 3S1NB 3NBIA 5HGQA 5C0XH 1ASYA 4QL5A 2F03A 1I50B 1WTQA 5IWAQ 3TEHB 4DR7L 3DWPA 2NB0A 1MJCA 3OWFA 1WCMG 2JE6I 1EQRA 4YWLA 4NXMQ 3L0OA 2A68D 5C3XA 1OXTA 1EY7A 3BVGA 3RLOA 1JJ2A 1WVLA 3S15H 2EXDA 1D5XC 1YJ9A 2E76C 1Y1WB 1CT1D 3MXUA 4RCNA 4JW0A 4DR7Q 1B7YB 4DR4L 3TMEA 1MKHA 2PZUA 4DAPA 3I55A 4O2DA 2EY5A 2O2LD 3NENA 4J8QA 1AFPA 1STEA 3KDFB 3TQYA 1HH2P 1I4GA 1YNND 4CKEA 4IJHA 4DF7A 3BYYB 2F0EA 1VQCA 4IPDA 3S1MB 2C9OA 4PMBA 4GLXA 3K81C 1A15A 3F2BA 4ZYSA 5KNCA 2EY2A 4GLAC 1BBWA 1WTHA 3UDIA 1EQTA 4ZLTF 4H44C 5JJKA 5ISRA 2IX0A 4OGQC 2F0SA 1CSQA 4UHVA 2HT1A 3CQZH 1K0SA 4RFBA 5T1GA 1EY6A 3MFGA 1OXSC 1I5FA 4EVOA 4OHJA 1RKNA 4NW2A 3Q23A 1XPOA 3NBHB 3KF6B 3M9BA 4NPSA 1GOZA 4NDXA 3ICEA 4LFBL 2HQEA 3WOFA 3GD7A 2L11A 3R93A 1ICWA 3TRZA 2K5WA 2B2WC 1G6PA 3A0JA 3T13A 3ULLA 5C0XI 4DK6C 2C35B 1IL8A 1A2UA 1RCVD 1TWAH 2OT2A 5IYDG 3EIVA 3SK4A 4J15A 5FK9C 4LFBQ 2M00A 4C1NI 1IW7C 3JAML 5C3WA 2JSOA 2F1MA 2JP1A 4XYOA 4DAMA 1TY2A 4IQZA 3KLWA 2A73B 3HKZE 2YV5A 1QZGA 1B3QA 4R4IA 3NSWA 1Q86C 3EROA 4K5VA 4L5QA 5ELNA 4RGNA 5EBCA 3PO3B 4DV2L 2K5QA 3RLFA 1O7IA 5IGEA 1SEBD 1Z47A 1EQVA 5ELCA 1VQDA 1UEAB 5JAVA 1Q81C 1OO9B 2A6ED 4PZ7A 2D0PA 4RKBA 3HP3A 1NMGA 3TZDA 4P2CB 1BKBA 5IGGA 1K83B 4U68A 1RL2A 1SYEA 3SK5A 3GTOB 5TSSA 5IGFA 3W1BA 3J81L 4DV2Q 1VDZA 5I6WA 1BVSA 5JPNC 4DR2L 5C4JH 2VW9A 4X65L 1TR5A 5DM63 1T5XD 2EPBA 3OIQA 3I56A 1WCMH 1EYDA 4C3JG 3NWTA 1PYWD 1UNSA 2LSSA 3HOWB 3HOZB 4KY7A 2EY6A 1U9RA 2VQEL 4LF5L 1E22A 1XTCD 3K58A 1ENCA 2UUCQ 1LTAD 5A35A 2ICEC 3CRKC 1GUNA 2EYJA 4DR2Q 3SGIA 1EYCA 5KYIA 4X65Q 2O5IC 2GN5A 1CZWA 1CKMA 2ALYB 1HHVA 1ICFB 1TT2A 4DU9A 3PUZA 3CQZB 4Q5VA 1CHPD 2KCMA 3EBEA 2B8GA 5IE8A 1V1PB 5FLXL 1QWYA 2VQEQ 4LF5Q 2DGYA 2DNCA 4RH6A 3CAMA 5FO7B 2MNAA 3M4OB 3F2DA 5J1ZA 3GTMH 4LAAA 4BBSB 2CVRA 4JI6L 2RHQB 2X6GA 4OL7A 4GN3B 2F0GA 3NTKA 4JI7L 2XRQD 2JA7H 3DM3A 4KHVA 4RGOS 5M5YB 2H4OA 1OXUA 2KA7A 4RWSC 5GROA 1SYDA 3CCQA 4JI0L 1Y14B 3S1QB 1E2WA 2B2VA 4FO2A 4RGMA 4O1NA 5IGBA 1HZBA 1FD7D 2VB3X 4M8AA 1ZYRD 3CCMA 3U58A 4JI6Q 1LLRD 1WTOA 1R4QB 2AQ1B 4MZ9A 2VUMB 1ONLA 2WACA 3J7A5 4GKKL 3J7AV 2RDFA 2CH4A 4BWGB 4JI0Q 3H3VH 2JA9A 1RODA 4LK1C 3O13A 4A3FH 2F0DA 4QB4A 1HR0W 4YCWA 3VYTA 1VCIA 1V1OA 3I2ZA 4OX9L 4GKKQ 5JJZA 1GHJA 2HCCA 2KJXA 4PMWA 3I4NB 1B1ZA 2NVYH 2E8GA 1UE5A 4HJ5A 1HA6A 2G9DA 3VA7A 5BN3A 1I6VC 2K05A 3EFXD 2IX3A 1VQNA 1I3QB 2HUGA 4BXXH 3G4SA 1XJVA 1STBA 4POFA 2BCOA 4OX9Q 3PIOA 2EE1A 2Z4IA 4LWCA 5M9OA 2V1CC 3GTKH 2DUDA 1VF5C 2R3ZA 4X3UA 2P5ZX 5EKLA 3NELA 1TS4A 2AKWB 2K5VA 2Y0SG 4S3SA 5EPJA 4HCEA 2EVBA 1Z7TA 1STGA 1GUWA 4FDBA 2JEAI 1EIFA 2B2WA 4M1UB 3A74A 1KDCA 3C46A 2YTVA 1S5CD 2A1AA 4JG2A 3RLNA 1K0RA 2BA0A 2F0TA 5AJ3L 1PH7A 1KC8C 1SNOA 5IYBH 2AQ2B 1X9NA 3GTMB 1LTSD 2LY7A 5BR8L 3VA5A 3J81i 3C3LA 3H3VI 3S14H 1NR2A 1SBBB 1S5BD 5KGUA 2UU9L 3M4PA 1AEXA 2RQXA 3BYTB 5AJ3Q 2J4XA 4DV5L 2UXDL 3J7AF 3RN5A 3ZYYX 3F2UA 4DGZA 4DUZL 4NXNL 2EQSA 4HSPA 1VS0A 2EYPA 4LNQA 5BR8Q 5BN5A 1JJGA 3D4RA 5ELFA 1LABA 3L3OC 2A5HA 2EYOA 4ME5A 5C4ZA 3I70A 2MHVA 4B9WA 4A3BH 2UU9Q 5GAEC 3PO2G 4LUVA 4ULLA 1UAPA 1EIGA 3UE0A 4DV5Q 1JC7A 2DN8A 4A3CG 4WRDA 2WINB 3RD4A 2EOTA 1F77A 1K8OA 1WFQA 3BVMA 4DUZQ 4NXNQ 1XX8A 2Z0SA 1IYUA 3G6EA 1SNMA 3MAQA 4XTCS 3FPPA 1VQJA 3KOJA 5IYCG 1AP0A 3Q8DA 3VR6A 4KD4A 1HNWQ 5J3BA 3S2HH 2IY5B 2OQKA 4K2KA 4CDEC 3OYYA 4JBWA 4JK1C 4QUFA 1HTPA 1PZID 3KBGA 2KECA 3CPWA 5FLMG 3K5OA 2OXPA 4PMCA 5CV6A 1Y8NB 2R93H 4DV4L 4BS9A 1G291 3M7NA 3S16H 3K7AH 1ILQA 1Q1EA 5LHY1 4AYBG 1VQOA 2K04A 1PTOB 2ICIA 3R2TA 1CTMA 2B63H 4ZAIA 4QCLA 2DJFC 5IP9H 1H95A 2E2JH 3I90A 1RJTA 4FP5D 1C48A 3H15A 4DV4Q 3M7GA 4QMGA 2EYHA 5C44G 4C3JB 4JCVE 3PMFA 1GUSA 2KEDA 4BBRH 3TDQA 4A3GG 1DCZA 3DHQA 3MC0B 1MD2D 1VQMA 1GVPA 2YTYA 1D5MC 3VR3A 1H9SA 1TWGB 2OCEA 2MPMA 2QKIC 3GTGH 1I4XA 3RZDB 5M3FG 2A6EC 3J7ZC 2HCIA 3ERQA 2G9HD 4DAVA 2BOSA 4O0AA 3V05A 2NZHA 4DV0L 1H9KA 1VQKA 4XT3B 1DZ1A 2XNAC 3BDCA 1EFID 4HEDA 3HOXH 1R9TB 4WFN3 3T4AC 4ZRZA 5FJ8H 4A3KH 3K7UC 1PH3A 2N88A 2JA5G 3STBC 4KD3A 2E5LQ 1J6QA 2WV6D 1ESFA 2L1BA 4JI1L 4L8JA 4A3IH 2KCTA 1X65A 5JEAG 2X69A 3AYHB 4IPGA 1RDPD 3HKSA 4DV0Q 1V9PA 4ODGA 1SFOH 4POGA 2RDHA 3VYSA 2Q2IA 3A5ZB 5C3EH 3I4MG 3V96A 1TU2B 4DKAC 4EGVA 3GTQH 1JWSD 1TWHH 3PCOB 4CKBA 4F87A 3E5SA 1XTDA 2QGQA 3S1NH 1IYJB 1DM0B 3K5LA 3TP5A 2RA4A 1JT8A 3T16A 1YI2A 1I50H 1T5EA 4IN3A 5C5LA 1EY5A 1UUPA 2HD3A 3NUCA 3TS0A 1HPCA 1X3GA 5C4XG 3DEOA 3FPUB 3FMCA 3H6MA 4J6HA 1HZCA 3C1EA 3BS1A 1PTOF 3AFPA 2GA4B 1Y1WH 5KEEA 2MO0A 2F0IA 3P1HA 2LXKA 2SOBA 2Z6KC 1LT4D 4BY1G 4JI3L 3MXNA 2H1EA 1ML0D 3U9SA 2E2JB 1ZYRC 5FLMH 1TXYA 2KCNA 2VZAA 4DK0A 4GN4B 4ZKBB 4BA1I 3HEJA 4QQBX 5EKIA 4IPHA 4HJ7A 3S1MH 4KHPL 4KKUA 1Q8KA 1W6JA 2D2CC 3J80E 1B9MA 4F88A 1IKMA 1D2BA 2PPBC 2EIFA 3OTOL 1LT6D 2Y0SB 3E3XA 4A3LH 5LMNL 3LNNA 4JI3Q 1KNAA 1L2FA 2E75C 3M4QA 2SDFA 1F2YA 2F0KA 1NUCA 1PTOC 4N8FA 3KBXA 1VQBA 5HURA 2K5DA 4KHPQ 4A3GH 2BE5C 1QCBD 1I4RA 3E0JA 4Y52H 3OTOQ 3M3YH 4NB3A 4IOCA 1C8CA 3D4DA 2L15A 4JOIA 5LMNQ 3EQLC 1KAWA 4H7BA 2MP1A 4A75A 1QG7A 1SLJA 2PQAA 3FEWX 5M3FH 3EVQA 1EIHA 4JI8Q 1G2SA 5M3MB 3I4OA 4JYAL 3H0GG 1H9JA 5ELDA 2WAQG 1IHZA 1F9RA 1LTGD 3RR5A 2JQOA 4DV7L 4GOPC 4X3TA 1SNPA 5C4HA 1BCPD 3NE5B 4P73A 3TP6A 1I94L 2FXQA 4A3DG 1A0IA 2FHTA 4ID6A 2ZT9C 4CGYB 5IP7H 5HGTA 5DNFA 4KN4C 1RIPA 5JEAH 3QOLA 2K14A 4JYAQ 1X3PA 4YWKA 2XSCA 4JPBW 4N8X1 4DV7Q 2B2VC 3PO2B 4A93G 3PO3H 4JBJA 1I94Q 1ASZA 5D3IB 3HGBA 4DNIA 3D6WA 2JN4A 3A55A 3BZDB 4OONA 1PRTD 5FO8B 5EQ0A 1EU4A 1CHQD 1K83H 2PZTA 1KIXA 1HFGA 3GTOH 2J0TD 1B44D 2G5DA 1D6EC 1KAAA 5IIFA 1J5EL 2D5DA 2JXMB 3HOWH 3HOZH 5I2XA 2XGTA 3FDTA 1A3TA 1N33L 2K6AA 1V1QA 3JAMc 4G7ZC 4XDXA 4UY8C 4AYBB 1CA6A 2CCZA 2K7VA 2R61A 4LFCL 4BY1H 3G71A 4B08A 2EZVA 4DR4Q 1L0XB 3HOYG 4GS3A 1J5EQ 2NN6H 1AE2A 2PI2E 1H9SB 2IT1A 4K8JA 1SMYD 2F0WA 1S72A 3MA2B 1DJRD 5IY0A 5C44B 4CHTB 1N33Q 1U4MA 3TN2A 3M4OH 1SYCA 2PO4A 4A3GB 4KV6A 1SE8A 2TMPA 4K6DA 3LGJA 4BBSH 4FNFA 4HN7A 5I9OA 3KUPA 4FF4A 4LFCQ 3M3YB 1PH2A 3PV0A 1D1IA 3A56A 3ER0A 2K03A 1II3A 2WKDA 4YCVA 3UI2A 5KYLA 1X32A 5M5YH 3CCSA 5M3FB 3QG1A 1GUOA 2PNHA 4HR7B 2FFKB 4MNOA 3OPOA 3S1QH 5JPMC 5EJWA 4JBKA 2QA4A 1BQQT 4DXFA 5CYUA 1JJCB 5JJLA 4DXGA 1O7ZA 1O7LA 4HAEA 5GQOA 2ZJPA 4BY7G 2JA5B 3MFYA 1VQGA 4G4KA 5EPLA 2VUMH 3EN2A 2NUCA 2NZ1D 1MI2A 2WFWA 1N36L 4OIKA 2B2UA 1KRTA 1YBYA 2ES2A 2JK8A 4CJ1B 3TREA 2K50A 4CDCC 1SROA 1S3OA 1CA5A 3GTPB 4XIGS 2Z6KA 4FF2A 4LUZA 3I4MB 3TBIB 4UDUC 5BN4A 3J81j 4NMZA 1GUGA 2MFIA 4J1MA 3J80i 4JI4L 4JVZA 4YCUA 1N36Q 3I4NH 2N55A 4HTHA 1MBYA 2CHBD 2KHSA 4ME3A 2NN6I 2PNRC 4DNRB 4DR5L 4R4OA 1VQIA 1I3QH 2NWGA 1WOCA 1Z6HA 1VMCA 4A3MB 4DA2A 5C4XB 1LTRD 1SRUA 3MXNB 4HJ9A 1EOTA 1X3FA 2R7ZG 4I7ZC 1J9OA 2Y0SE 2GVAA 2B2YA 5IT9c 3RMHA 4DR5Q 1U4RA 1L0WA 4OWXB 3PIO3 2RSOA 3R3OA 3T53B 2CH4W 4BY1B 3A8JE 4QY7A 3A8IE 1EOVA 1A3UA 1K28A 4JV5L 2KVMA 4XT1B 4IFDG 2VXWA 4UP8A 2F0PA 1FGBD 2IJ0A 3SR1A 1E7ZA 1FR3A 2ZXPA 4A3EG 4GOPA 3H91A 2F4IA 3I7FA 3D6CA 2JA6G 3RN2A 3P20A 2K28A 2ENBA 1CFMA 1LV9A 4XQQA 1NR4A 1E24A 2XIWA 4JV5Q 2A69C 1EEID 4RCOA 2PQAB 3PUWA 3KF8A 3L7ZC 3OW2A 2PW5A 1YITA 3PF5A 1Y1VG 1LTBD 2WB1E 2JJQA 5IT9E 3K0XA 1D7QA 1GXDC 2NTTA 3UDXA 4UAIA 1QB5D 1HQMC 3LWEA 1GD7A 1YVCA 1PH4A 3RUZA 4JI7Q 1GM5A 2WKCA 2PCFB 2EXZA 2VQFL 4GLVB 1MSGA 3H0GB 5IYDH 2WAQB 4TSSA 5L37A 2HIVA 1PFMA 1JOQA 3X3NA 1GUTA 4YWMA 3D3RA 1BUVT 5I6YA 4A3DB 3U4VA 4P75A 4BY7H 1Q46A 4OO1G 4IZ8A 1SE4A 2VQFQ 3DMUA 4HIKA 2PW7A 1LO5D 1YHAA 1KQSA 4A93B 5DEHA 2CQOA 4QUCA 1MGSA 2PMZB 4XXEA 1FGUA 1AZPA 4GN5A 4NP5A 2L4NA 4DNTB 2ZJRA 4I7AA 2QDLA 1PTOH 5JJIA 2EY1A 4KN7C 1PRTF 4ZUIA 1LUZA 4ZQ3A 1Q82C 1S4ZA 3LWUA 1YNXA 3N52A 3X3MA 2FINB 5FKAC 1F2LA 3OWEB 4FXDA 1W6KA 4LF4L 4P72A 3ZJYC 1VQ7A 3KLRA 4C3JH 2R7ZH 4CKCA 1HUNA 3K6OA 3VR4A 3NQIA 4IFDJ 1F9QA 1UWVA 4IUUA 3KLSA 3CMAA 2OF1A 3MZ5A 1WD0A 1QUQA 3A7LA 4B9XA 1TWGH 4K2LA 1DD2A 1EYGA 3U50C 3QIAA 4K5XA 2BDOA 1PH1A 4LF4Q 3RZDH 1BDOA 3HOYB 1A63A 3PUVA 1BF4A 3AFQA 1CSPA 4R8IA 1DGSA 1PYSB 2BH2A 5M3MG 3N6RA 1PRTC 1VQEA 3S9WA 3HZXA 2A68C 4V190 1N9WA 2RCFA 4G7HC 2F0OA 1SXTA 1R9TH 1DONA 2PYKA 3PGZA 4A3JG 5M5XB 4IUPA 4C3IG 4OELB 4KKTA 1YJWA 2KUMA 4B3RL 4JBMA 1FVIA 1SNQA 2I5MX 4X6AH 1XMQL 1YNNC 5JVG3 1MSHA 1NJIC 2UXDQ 4OEMB 4IJLA 1IXRA 4JOIC 4MHEA 2ZTCA 1JWMD 2H5XA 5KIXA 1IKLA 2UUAL 2M9VA 2N8NA 4FXGC 4GKJL 4BY7B 2Q8TA 1SMYC 1HNZL 4B3RQ 4MIUA 2ASBA 4ILWA 4C3HG 3GTJB 4PV1C 1XMQQ 1H9MA 1Q1BA 3K5NA 2K52A 3H94A 4Q0FA 2K5NA 4QF4A 3QJYA 4PZ8A 1CKOA 1KDAA 2CKZB 1EYAA 4U673 3CCRA 5A2QE 2YU9H 5IGDA 1TY0A 5EGTA 2I0QA 4GKJQ 3B6YA 4JC0A 1HNZQ 1SSOA 2DJGC 3CC4A 3CD6A 3A8KE 1JICA 1SJHD 1LACA 1UE6A 1PVOA 4RHSA 2HDMA 2IL8A 2CW0D 3KK7A 3IL8A 3HS0C 3PIPA 3W2DA 3L9AX 4MN3A 1PZJD 2X6LA 5I4DA 1B2TA 4X64L 1FJGL 1O7YA 2JA8G 1WTXA 3HOUB 1BNZA 3PSIA 4HJ8A 3CMEA 2R7ZB 3CHBD 1IBML 1Q3LA 4CDFC 2ZXOA 4KLKA 3FHWA 3I72A 1DOKA 1TWCH 4GOPB 4WORA 5CBAE 2E2IH 3TP7A 1JCKB 1SYGA 4X64Q 2AHOB 4O42A 1W3SA 4HIOA 1LM0A 1IBMQ 1JWUD 1MIUA 1CK1A 3D8GA 1VQFA 2Z9HA 3KLSX 1Y8OB 4A3EB 1HZ9A 1D1KA 1EY4A 5CV5A 2QW7A 2NVQB 1LT3D 4WJ3M 2JA6B 1UE1A 2IWHA 3A5UA 2YYZA 3SDZA 5M3MH 3ULPA 3MWYW 4CDDC 1VMPA 3OHXC 4LF7L 5K36G 2OTJA 1XXGA 2PZWA 2QEJC 3NHHA 1BXTA 2ZXRA 1Y1VB 2L9HA 2F0JA 1JOKA 2LS01 3W5OA 4C56C 4RKLA 1AH9A 2O5JC 1PH5A 4HCSA 4V0BA 4C3IH 2N49A 1D8LA 3AB9A 3UDGA 4IUTA 4B3ML 1PH8A 4X3KA 4JI1Q 2E2DC 4LF7Q 1XNQL 2PMZE 3PO2H 4K0KL 4MTNA 4KI0A 3U4ZA 2Q2TA 4C2MB 1I4QA 3GTLB 4A3CH 5C0XG 1LT5D 3CP0A 1BOSA 4DV3L 1XNRL 2A74C 1WI5A 1KLGD 4A3MG 3W3AA 2YU9B 2ATWA 3CU7A 1EZ8A 3RZOB 5IYCH 1FL0A 1PXUA 1E3PA 3A7AB 3BVZA 4F7XA 1IBKL 2B2UC 1XNQQ 1DXMA 4K0KQ 2I07B 2J7ZA 2M2LA 2R7DA 3PF4A 1KLUD 3QO2A 5CC4A 4DV3Q 2F0NA 1XNRQ 1ZEQX 3T1HL 1L1OC 4MTKA 3OSOA 5IGCA 1EZ6A 4TKOB 2R92B 4JI5L 4IUNA 3GV3A 1IBKQ 1SYFA 3U9OA 2Z1CA 3H3VC 3BG3A 4KY5A 2SNMA 1E2ZA 1WTWA 1B9NA 1TWCB 4R8NA 2L5TA 4DK3C 3T1HQ 1QUQB 1MJEA 1U5KA 3IAYA 1AN8A 1NE3A 1S5ED 2E2IB 4JI5Q 5COYA 3S17B 1PZKD 5C44H 2KOLA 2B2YC 4H13C 2RCNA 3K8AA 3S24A 4UP7A 4AH6A 1NTGA 4DR6L 1N8RC 2OWOA 3J80L 1EL0A 3QB3A 4GNXA 4K6LA 1AW7A 2B2TA 2NVXB 1JQYD 4N9PA 3T56B 4OXPA 2VS1A 1K8AC 1PH9A 3HOVG 4IALA 4FF1A 1TWFB 3PUXA 2IX1A 2MJ8A 1VQ5A 3NQTA 1PFNA 4DR6Q 1PH6A 1F2ZA 4KTAA 2VY3A 4A3JB 1NNXA 1O80A 3DLLA 4C3IB 2JA5H 4EX5A 1KL9A 4EQPA 2K75A 1A2TA 2L12A 4AQYL 1DOLA 1SE3A 4H0LC 3S2DB 5CGKA 3CC7A 1EY0A 4KK7A 2XWBB 3K57A 3GTPH 3K80C 1AZQA 1GHKA 5C0XJ 3I4MH 1EEFD 4HMIA 2AMCB 3BU2A 3OW7A 1WD1A 2BDNA 4PG3A 2QILA 4A76A 4AQYQ 3JC66 5LMNW 3VYUA 1EUJA 1W2BA 4C3HB 4R9WA 1I4PA 3ITPA 3WOEA 3TP8A 3CC2A 4N9TA 4A3MH 2NVTH 5C4XH 3CCVA 1M90C 1PYBA 2Q8IB 1FNWA 1TKWB 2AWNA 3FRPB 2DY8A 1TS3A 5M5WB 3W1GA 3GDEA 2DNEA 2A6HD 5DAUA 3SK6A 3BDLA 4EQNA 3T1YL 3DEPA 4IUQA 2LFNA 2UXCL 4EQ5A 1VQAA 2F0LA 3GV6A 5I2YA 3FKIG 2V4DA 1L0YB 5CORA 2XTIA 1BBUA 2QF7A 2Q2UA 3CCEA 2JA8B 2D0OA 4DAYA 1JR0D 1SDFA 4P74A 1AE3A
chains in the Genus database with same CATH topology
3D31A 1BO0A 2MGSA 1K8MA 3CKIB 4PNYA 1RTNA 5FO9B 1CQFA 3MHBA 3NPPA 1SAPA 2HDLA 3NTIA 1R4PB 3FVQA 1B50A 3SVMA 1QOHA 2D9UA 4RHRA 2CW0C 1HQRD 2K1BA 3JAME 1CZGA 3GP7A 2FMCA 2F3VA 3R2IA 1Q8IA 4K8IA 4QIWB 5T1IA 1QILA 3TZUA 2EYLA 4EQOA 1OXVA 4KMUC 3MEHA 3DXJC 1Q90A 1BCPB 1KTKA 5D3DA 3M85A 2KQ3A 1NAPA 3DM1A 3NXWA 3D4WA 3J81E 3IKJA 1RF2D 1S5FD 4FVMA 3T51B 1ENFA 3DWQA 1SNDA 2NVTB 5AFWA 4RGTA 4IURA 2ID0A 1SYBA 3AU7A 4L63B 1E2VA 4RAUC 1PRTB 1IYVA 1QE6A 3S15B 1H9RA 2DY7A 4XQNA 4CJ0B 2F0VA 2RBMA 2NBFA 5ELEA 1S5DD 3EJIA 5FLXE 2D62A 5CBEE 1HFNA 1A3VA 5CV4A 4KJNA 3Q24A 2FJ2A 1DOMA 1PFBA 4DK1A 1CI3M 5CR3A 4WJWA 4ZK9B 2F0QA 1EWHA 5CV7A 1D5ZC 1V43A 3I8ZA 1SE2A 2QCPX 1NSNS 3SEBA 4TQUS 1JB3A 1G91A 3H09A 1YNJD 4XQJA 4RA8A 3E6ZX 4DFAA 1STHA 4CBVA 4HMJA 1QJOA 3I4LA 5CV8A 3HOVB 1ENAA 1G2TA 5C6AA 2VB2X 1PDQA 2OEOA 1TWAB 4LJZC 3R8BA 5IT9L 1SNCA 1BCPF 5E1FA 5J22A 5I9PA 2KEEA 1V8QA 2EJMA 1ZKOA 2F0MA 3K5MA 1TIID 4E6IA 1BBXC 1ESRA 1NCVA 1GJXA 2WP8J 4KY6A 2RKSA 3I3CA 1B3AA 1HRJA 3VYRA 1PTOD 3AMUA 1Y69U 2BE5D 2AWOA 3I91A 1QNKA 4Z9CB 1BCPC 1LTTD 1RTOA 4K14A 1RD9D 3G6JB 5C4JB 4KHZA 4KJOA 1WTRA 2AUKA 2XWJB 3ND9A 1WCMB 2RSNA 3PIP3 1F9SA 5K5PA 4G7OC 2IPKD 1E0BA 1DYQA 1XYIA 3URYA 3C2PA 1OXXK 2KCCA 3FKIB 3A54A 4IFDH 3PUYA 3HRZC 4I65A 4Y7NB 1EY9A 4X3SA 2L0CA 3K59A 1KNEA 5NUCA 4CJ2C 1SJED 2L55A 3OIPA 1F2MA 4LMQD 2FMMA 2F3WA 2SNSA 2IW3A 2JA7B 4TRDA 5JVH3 1HTLD 1WTPA 2A6HC 5G3LD 5KNBA 3OMGA 1JOOA 3Q6SA 1I4HA 3TSSA 1J8IA 1Q12A 3M4YA 4ZUJA 1EU3A 2B2TC 3BDOA 1B4OA 5C5MA 2RVLA 4ABNA 5FOBB 4K5WA 1CQVA 3P75A 3P7JA 5LL6S 5J39A 4A3FB 2NTSA 1KDBA 3ND8A 4OO1H 4YIJA 1M4VA 4G57A 3NP8A 1U4PA 1ET9A 3MTSA 1EWCA 3G7LA 2MUYA 3K0YA 2XRSD 1EY8A 3V2TA 3NTHA 2NVYB 2XVSA 4IFDI 2Z8LA 2VNUD 4ZKCB 2Q8RE 5A2QL 2PQEA 2R6GA 1X3QA 1FYCA 4DN4M 3GTKB 1G6ZA 1TS2A 2LKVA 3EA6A 2F0HA 1HUMA 5E4WC 5KNDA 1IW7D 4FXKC 4KKSA 4BA2I 1STNA 3OMCA 3IFTA 5EPKA 3C1FA 4XYQA 5E3FA 1STAA 5KRUA 2SEBD 5IODA 2E74C 3ONAB 3S14B 3NBHA 3NWSA 1QNUA 2AQ3B 4OO1I 5E4XA 1TVXA 3WDNA 5CV9A 1Y8PB 1ET6A 5D65A 5IOCA 4A3BB 4NKLA 1C4QA 4FF3A 3J7YW 3MXGA 2F0FA 3VR2A 4F8MA 1I6HB 1RHPA 1BR9A 3I73A 3DUZA 3SE0A 5ELBA 1HXYD 1CM9A 3S2HB 3HKZB 5JOBA 3OOCA 2K01A 5DM73 2JEBI 5LL6X 5F2DA 1YNJC 2EYMA 3MVVA 1ILPA 2F0UA 1G8ZD 2A69D 5CMDA 2C5CA 2R93B 2WIIB 3S16B 1TQOA 3K7AB 1PLFA 2EDGA 1FNVA 2XN9C 2B39A 2B63B 2NN6G 1U4LA 1FNUA 3HG9A 3IFDA 3SHLA 1B53A 1KABA 3Q0AA 1WTVA 4HSVA 4IUVA 2LMCB 4BBRB 2CQAA 4FYDA 3LX0A 3VR5A 2E2HB 1HA5A 4PQXA 2Z4HA 5EKKA 3NK9A 1LTID 3GTGB 1M8AA 3SXHA 2EJFC 1V1PA 2K33A 4C1NK 4L6TB 1XWEA 5D14A 1STYA 3DWAA 1A6XA 2QDBA 2NYZD 2O4XA 2TSSA 4GZYC 3HOXB 2AUJD 1HCZA 1JORA 4A3KB 3S1RB 1ZXTA 5K36H 2BA1A 2EYFA 2I46A 1O78A 4A3IB 3QWNA 3Q22A 5JEAJ 1PMRA 1VF7A 1SFOB 2JYOA 5EBDA 1F9PA 5G3LF 3QOJA 5C3EB 3MXPA 2RDGA 1TS5A 4OIJA 2WB1B 3GTQB 1JE4A 1TWHB 2K32A 3CRLC 2EJGC 3GO5A 2B8FA 3GQBA 3SK8A 3S1NB 3NBIA 5C0XH 2F03A 1I50B 1WTQA 3DWPA 2NB0A 3OWFA 2JE6I 2A68D 5C3XA 1OXTA 1EY7A 3BVGA 1WVLA 1D5XC 2E76C 1Y1WB 1CT1D 3MXUA 4RCNA 3TMEA 2PZUA 4DAPA 2EY5A 2O2LD 4J8QA 1AFPA 1STEA 1I4GA 1YNND 4CKEA 4DF7A 3BYYB 2F0EA 3S1MB 2C9OA 4PMBA 1A15A 4ZYSA 5KNCA 2EY2A 1EQTA 4ZLTF 4H44C 5ISRA 2IX0A 4OGQC 2F0SA 4RFBA 5T1GA 1EY6A 3MFGA 1OXSC 4EVOA 4OHJA 1RKNA 4NW2A 3Q23A 1GOZA 4NDXA 2HQEA 3WOFA 3GD7A 2L11A 3R93A 1ICWA 2K5WA 2B2WC 3T13A 5C0XI 1IL8A 1A2UA 1RCVD 2OT2A 3SK4A 5FK9C 2M00A 4C1NI 1IW7C 3JAML 5C3WA 2JSOA 2F1MA 2JP1A 4XYOA 1TY2A 4IQZA 2A73B 3NSWA 3EROA 4K5VA 4RGNA 5EBCA 3PO3B 2K5QA 3RLFA 5IGEA 1SEBD 1Z47A 1EQVA 5ELCA 1UEAB 5JAVA 1OO9B 2A6ED 4RKBA 3HP3A 3TZDA 4P2CB 5IGGA 1K83B 4U68A 1SYEA 3SK5A 3GTOB 5TSSA 5IGFA 3J81L 1VDZA 5I6WA 5JPNC 5DM63 1TR5A 1T5XD 2EPBA 3OIQA 1EYDA 4C3JG 3NWTA 1PYWD 1UNSA 3HOWB 3HOZB 4KY7A 2EY6A 1U9RA 1XTCD 3K58A 1ENCA 1LTAD 5A35A 2ICEC 3CRKC 1GUNA 2EYJA 1EYCA 5KYIA 2O5IC 1CZWA 1HHVA 1TT2A 4DU9A 3PUZA 3CQZB 4Q5VA 1CHPD 2B8GA 1V1PB 5FLXL 1QWYA 4RH6A 2DNCA 5FO7B 3M4OB 5J1ZA 4BBSB 4LAAA 2CVRA 2X6GA 4OL7A 2F0GA 3NTKA 2XRQD 4KHVA 4RGOS 5M5YB 2H4OA 1OXUA 2KA7A 4RWSC 1SYDA 3S1QB 1E2WA 2B2VA 4FO2A 4RGMA 4O1NA 5IGBA 1FD7D 2VB3X 4M8AA 1ZYRD 1LLRD 1WTOA 1R4QB 2AQ1B 2VUMB 1ONLA 2WACA 3J7AV 2RDFA 4BWGB 1RODA 4LK1C 3O13A 2F0DA 4QB4A 3VYTA 1VCIA 1V1OA 5JJZA 1GHJA 2HCCA 2KJXA 4PMWA 3I4NB 1B1ZA 1HA6A 2G9DA 3VA7A 5BN3A 1I6VC 2K05A 3EFXD 2IX3A 1I3QB 2HUGA 1STBA 2BCOA 2EE1A 2Z4IA 5M9OA 1VF5C 2R3ZA 4X3UA 5EKLA 1TS4A 4S3SA 5EPJA 4HCEA 2EVBA 1Z7TA 1STGA 1GUWA 2JEAI 2B2WA 4M1UB 1KDCA 1S5CD 2BA0A 2F0TA 1SNOA 2AQ2B 3GTMB 1LTSD 2LY7A 3VA5A 3C3LA 1NR2A 1SBBB 1S5BD 5KGUA 1AEXA 2RQXA 3BYTB 2J4XA 3J7AF 3ZYYX 3F2UA 4DGZA 4HSPA 2EYPA 5BN5A 3D4RA 5ELFA 1LABA 4ME5A 5C4ZA 2A5HA 2EYOA 3L3OC 3I70A 2MHVA 4B9WA 4ULLA 1UAPA 1EIGA 1JC7A 2DN8A 4WRDA 2WINB 3RD4A 2EOTA 1F77A 1K8OA 3BVMA 1XX8A 1IYUA 1SNMA 3MAQA 4XTCS 3FPPA 1AP0A 3VR6A 4KD4A 4K2KA 4JBWA 4JK1C 4QUFA 1HTPA 1PZID 3KBGA 2KECA 3K5OA 2OXPA 4PMCA 5CV6A 1Y8NB 4BS9A 1G291 3M7NA 1ILQA 1Q1EA 5LHY1 2K04A 1PTOB 2ICIA 3R2TA 1CTMA 4QCLA 4ZAIA 3I90A 1RJTA 4FP5D 1C48A 3M7GA 4QMGA 2EYHA 4C3JB 3PMFA 1GUSA 2KEDA 3TDQA 1DCZA 3DHQA 3MC0B 1MD2D 1D5MC 3VR3A 1H9SA 1TWGB 2MPMA 2QKIC 1I4XA 3RZDB 2A6EC 2HCIA 3ERQA 2G9HD 4DAVA 2BOSA 3V05A 1H9KA 4XT3B 1DZ1A 2XNAC 3BDCA 1EFID 4HEDA 1R9TB 4WFN3 3T4AC 4ZRZA 2N88A 4KD3A 2WV6D 1ESFA 2L1BA 4L8JA 5JEAG 2X69A 1RDPD 4ODGA 2RDHA 3VYSA 3V96A 1TU2B 4EGVA 1JWSD 4CKBA 4F87A 3E5SA 1DM0B 3K5LA 3TP5A 2RA4A 3T16A 1T5EA 4IN3A 5C5LA 1EY5A 1UUPA 3NUCA 1HPCA 3DEOA 3FPUB 3FMCA 3H6MA 4J6HA 3C1EA 3BS1A 1PTOF 2GA4B 5KEEA 2F0IA 3P1HA 2SOBA 1LT4D 2H1EA 1ML0D 3MXNA 3U9SA 2E2JB 1ZYRC 2KCNA 4DK0A 4ZKBB 4BA1I 3HEJA 5EKIA 4KKUA 1W6JA 2D2CC 3J80E 1B9MA 4F88A 1IKMA 1D2BA 2PPBC 1LT6D 2Y0SB 3LNNA 1KNAA 2E75C 2SDFA 1F2YA 2F0KA 1NUCA 1PTOC 3KBXA 5HURA 2K5DA 2BE5C 1QCBD 1I4RA 3E0JA 1C8CA 3D4DA 3EQLC 4H7BA 2MP1A 1QG7A 3FEWX 3EVQA 1EIHA 1G2SA 5M3MB 1H9JA 5ELDA 1IHZA 1F9RA 1LTGD 4X3TA 1SNPA 5C4HA 1BCPD 3NE5B 3TP6A 2FHTA 4ID6A 2ZT9C 4CGYB 5HGTA 5DNFA 4KN4C 5JEAH 3QOLA 1X3PA 2XSCA 3PO2B 2B2VC 5D3IB 3HGBA 3D6WA 3A55A 3BZDB 1PRTD 5FO8B 5EQ0A 1EU4A 1CHQD 2PZTA 1HFGA 2J0TD 1B44D 1D6EC 1KAAA 5IIFA 2D5DA 2JXMB 5I2XA 3FDTA 1A3TA 2K6AA 4G7ZC 4XDXA 4AYBB 1CA6A 2K7VA 2R61A 4B08A 2EZVA 1L0XB 2NN6H 1H9SB 2IT1A 4K8JA 1SMYD 2F0WA 3MA2B 1DJRD 5C44B 4CHTB 1U4MA 3TN2A 1SYCA 2PO4A 4A3GB 4KV6A 2TMPA 4K6DA 4FNFA 4HN7A 5I9OA 3KUPA 4FF4A 3M3YB 3PV0A 1D1IA 3A56A 2K03A 1II3A 2WKDA 3UI2A 5KYLA 1X32A 5M3FB 3QG1A 1GUOA 4HR7B 2FFKB 3OPOA 5JPMC 5EJWA 1BQQT 4DXFA 5CYUA 4DXGA 1O7ZA 1O7LA 4HAEA 2JA5B 3MFYA 4G4KA 5EPLA 2NUCA 2NZ1D 1MI2A 4OIKA 2B2UA 4CJ1B 1CA5A 3GTPB 4XIGS 4FF2A 3I4MB 3TBIB 4UDUC 5BN4A 4NMZA 1GUGA 4J1MA 2N55A 4HTHA 1MBYA 2CHBD 2KHSA 2NN6I 2PNRC 4DNRB 2NWGA 1Z6HA 1VMCA 4A3MB 4DA2A 5C4XB 1LTRD 1EOTA 4I7ZC 1J9OA 2B2YA 3RMHA 1U4RA 3PIO3 2RSOA 3R3OA 3T53B 4BY1B 3A8JE 3A8IE 1A3UA 2KVMA 4XT1B 4IFDG 2VXWA 2F0PA 1FGBD 2IJ0A 3SR1A 1FR3A 2ZXPA 3H91A 2F4IA 3D6CA 3P20A 2ENBA 1CFMA 1LV9A 2K28A 4XQQA 1NR4A 2XIWA 2A69C 1EEID 4RCOA 3PUWA 3KF8A 3L7ZC 2PW5A 1LTBD 5IT9E 1GXDC 2NTTA 4UAIA 1QB5D 1HQMC 3LWEA 3RUZA 2WKCA 2PCFB 2EXZA 1MSGA 3H0GB 2WAQB 4TSSA 1PFMA 1JOQA 3X3NA 1GUTA 3D3RA 1BUVT 5I6YA 4A3DB 4OO1G 4IZ8A 1SE4A 3DMUA 2PW7A 1LO5D 4A93B 5DEHA 4QUCA 1MGSA 2PMZB 4XXEA 1AZPA 4NP5A 2L4NA 4DNTB 1PTOH 2EY1A 4KN7C 1PRTF 4ZUIA 4ZQ3A 1S4ZA 3LWUA 3N52A 3X3MA 2FINB 5FKAC 1F2LA 3OWEB 4FXDA 1W6KA 3KLRA 4CKCA 1HUNA 3K6OA 3VR4A 3NQIA 4IFDJ 1F9QA 4IUUA 3KLSA 2OF1A 3MZ5A 1WD0A 3A7LA 4B9XA 4K2LA 1DD2A 3QIAA 4K5XA 2BDOA 1BDOA 3HOYB 3PUVA 1BF4A 4R8IA 3N6RA 1PRTC 3S9WA 3HZXA 2A68C 4V190 4G7HC 2F0OA 1SXTA 1DONA 2PYKA 5M5XB 4IUPA 4C3IG 4KKTA 2KUMA 1SNQA 1YNNC 5JVG3 1MSHA 4MHEA 1JWMD 5KIXA 1IKLA 2M9VA 4FXGC 4BY7B 2Q8TA 1SMYC 4MIUA 4ILWA 4C3HG 3GTJB 4PV1C 1H9MA 1Q1BA 3K5NA 3H94A 4Q0FA 4QF4A 3QJYA 1KDAA 1EYAA 4U673 5A2QE 5IGDA 1TY0A 5EGTA 1SSOA 3A8KE 1SJHD 1JICA 1LACA 4RHSA 2HDMA 2IL8A 2CW0D 3KK7A 3IL8A 3HS0C 3W2DA 3L9AX 4MN3A 1PZJD 2X6LA 5I4DA 1B2TA 1O7YA 1WTXA 3HOUB 1BNZA 2R7ZB 3CHBD 1Q3LA 2ZXOA 3I72A 1DOKA 4WORA 5CBAE 3TP7A 1JCKB 1SYGA 4O42A 1JWUD 1CK1A 3D8GA 3KLSX 1Y8OB 4A3EB 1D1KA 1EY4A 5CV5A 2NVQB 1LT3D 2JA6B 2IWHA 2YYZA 3SDZA 3MWYW 1VMPA 3OHXC 5K36G 1XXGA 2PZWA 2QEJC 3NHHA 1BXTA 2ZXRA 1Y1VB 2L9HA 2F0JA 1JOKA 2LS01 4C56C 4RKLA 2O5JC 4HCSA 4V0BA 3AB9A 4IUTA 4X3KA 2E2DC 4KI0A 3GTLB 4C2MB 1I4QA 5C0XG 1LT5D 1BOSA 2A74C 1KLGD 3W3AA 2YU9B 3CU7A 1EZ8A 3RZOB 1PXUA 3A7AB 3BVZA 4F7XA 2B2UC 1DXMA 2I07B 2J7ZA 2M2LA 1KLUD 3QO2A 5CC4A 2F0NA 1ZEQX 3OSOA 5IGCA 1EZ6A 4TKOB 2R92B 4IUNA 3GV3A 1SYFA 3U9OA 2Z1CA 3H3VC 3BG3A 4KY5A 2SNMA 1E2ZA 1WTWA 1B9NA 1TWCB 4R8NA 2L5TA 3IAYA 1AN8A 1S5ED 2E2IB 5COYA 3S17B 1PZKD 2KOLA 2B2YC 4H13C 3J80L 1EL0A 3QB3A 4K6LA 1AW7A 2B2TA 2NVXB 1JQYD 4N9PA 3T56B 4IALA 4FF1A 1TWFB 3PUXA 2IX1A 2MJ8A 3NQTA 1PFNA 1F2ZA 4KTAA 4A3JB 1O80A 4C3IB 4EQPA 1A2TA 2L12A 1DOLA 1SE3A 4H0LC 3S2DB 5CGKA 1EY0A 4KK7A 2XWBB 3K57A 1AZQA 1GHKA 5C0XJ 1EEFD 4HMIA 3OW7A 1WD1A 2BDNA 2QILA 3VYUA 4C3HB 4R9WA 1I4PA 3ITPA 3WOEA 3TP8A 4N9TA 2Q8IB 1FNWA 1TKWB 2AWNA 3FRPB 2DY8A 1TS3A 5M5WB 2DNEA 2A6HD 5DAUA 3SK6A 3BDLA 4EQNA 3DEPA 4IUQA 2LFNA 2F0LA 3GV6A 5I2YA 2V4DA 1L0YB 5CORA 2QF7A 2JA8B 4DAYA 1JR0D 1SDFA 3C46A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PYK A;  5JAV A;  3OWF A;  5K5P A;  1A3V A;  1SNM A;  5CV4 A;  1EY4 A;  4ID6 A;  5CV5 A;  1TQO A;  4RKB A;  5C3X A;  5HGT A;  1EY7 A;  3E5S A;  4KJN A;  4PNY A;  2LKV A;  5IGG A;  3QB3 A;  2F0H A;  3RUZ A;  3MHB A;  2NUC A;  1SYE A;  3QOL A;  4KD4 A;  5CR3 A;  4N9P A;  3SK5 A;  2EXZ A;  4K2K A;  3TP5 A;  3T16 A;  5IGF A;  2F0Q A;  1SNQ A;  5CV7 A;  5I6W A;  4IAL A;  5C5L A;  2PZW A;  3NHH A;  3TME A;  1EY5 A;  3NUC A;  3SHL A;  4I65 A;  1TR5 A;  2PZU A;  1STN A;  2F0J A;  1KAB A;  1JOK A;  3NQT A;  3OMC A;  1JOQ A;  4RKL A;  1STB A;  1EYD A;  1EY9 A;  2OXP A;  1NSN S;  1F2Z A;  2EY5 A;  4PMC A;  5CV6 A;  5I6Y A;  5NUC A;  4KTA A;  4NMZ A;  5KIX A;  4KY7 A;  3H6M A;  3C1F A;  4J6H A;  2EY6 A;  4J1M A;  2F0E A;  4DF7 A;  5M9O A;  2F3V A;  5E3F A;  1U9R A;  4EQP A;  3C1E A;  4PMB A;  4IZ8 A;  4K8I A;  1A2T A;  3LX0 A;  1STA A;  2PZT A;  5EKL A;  5KRU A;  1F2M A;  4HTH A;  1ENC A;  5CGK A;  4DFA A;  4MIU A;  1STH A;  4S3S A;  2KHS A;  5EKK A;  2EY2 A;  2EYL A;  3DMU A;  5IOD A;  4EQO A;  5KEE A;  2F0I A;  2F3W A;  3NK9 A;  3P1H A;  2PW7 A;  4HMJ A;  1EY0 A;  2EYJ A;  2SNS A;  2SOB A;  5CV8 A;  1EYC A;  5KYI A;  1STG A;  1ENA A;  5ISR A;  4TRD A;  5C6A A;  2F0S A;  5DEH A;  4QF4 A;  3SXH A;  1KDA A;  1EYA A;  2OEO A;  1KAA A;  1EY6 A;  1KDC A;  1TT2 A;  4DU9 A;  5IIF A;  4QMG A;  3OMG A;  4NP5 A;  3MEH A;  1JOO A;  1STY A;  2EYH A;  4EVO A;  4HMI A;  5IGD A;  3HEJ A;  2QDB A;  5EGT A;  3PMF A;  1RKN A;  2F0T A;  4ZUJ A;  2O4X A;  1A3T A;  1EZ8 A;  1SNC A;  4NDX A;  5E1F A;  1SNO A;  2HQE A;  3DHQ A;  5J22 A;  5CV9 A;  5I9P A;  2EY1 A;  4F7X A;  5J1Z A;  4LAA A;  1JOR A;  5C5M A;  4ZUI A;  2KQ3 A;  4ZQ3 A;  4OL7 A;  3T13 A;  2F0G A;  3ITP A;  5IOC A;  3VA5 A;  3R3O A;  4K5W A;  2EYF A;  2F0M A;  3D4W A;  3NXW A;  5CC4 A;  4KHV A;  3TP8 A;  2F0N A;  1A3U A;  1F2Y A;  3P75 A;  1A2U A;  2F0K A;  4N9T A;  4E6I A;  4K8J A;  5KGU A;  1NUC A;  3OSO A;  3ERQ A;  4NKL A;  1EZ6 A;  1SYD A;  2F0W A;  1AEX A;  1SND A;  5IGC A;  5HUR A;  2F0P A;  3SK4 A;  4KY6 A;  5J39 A;  4IUN A;  2RKS A;  2M00 A;  3BDC A;  1SYC A;  2F0F A;  1KDB A;  1SYF A;  3QOJ A;  4DGZ A;  3SR1 A;  3U9O A;  4KV6 A;  3MXP A;  5C3W A;  4K6D A;  1SYB A;  4F8M A;  3D4D A;  5I9O A;  4YIJ A;  5DAU A;  3SK6 A;  2OF1 A;  2EYP A;  3BDL A;  3MZ5 A;  4G57 A;  4KY5 A;  3NP8 A;  4H7B A;  4EQN A;  2SNM A;  4B9X A;  4KD3 A;  3D6C A;  2F0O A;  1II3 A;  4K2L A;  4R8N A;  2ENB A;  2F0L A;  2EYO A;  3EVQ A;  2WAC A;  4ME5 A;  4WOR A;  4K5X A;  5C4Z A;  3ERO A;  5KYL A;  3SK8 A;  1EY8 A;  3V2T A;  4B9W A;  3TP7 A;  4K5V A;  1SYG A;  2F0V A;  2RDF A;  2RBM A;  5JOB A;  3S9W A;  3HZX A;  4ODG A;  1IHZ A;  2PW5 A;  4K14 A;  5F2D A;  4WRD A;  2EYM A;  3MVV A;  2F0U A;  2PQE A;  4KJO A;  1SNP A;  5C4H A;  3EJI A;  5IGE A;  3D8G A;  2F0D A;  4QB4 A;  5IGB A;  3TP6 A;  1EQV A; 
#chains in the Genus database with same CATH topology
 3D31 A;  1BO0 A;  3T1Y Q;  2MGS A;  1K8M A;  1YJN A;  2UXC Q;  3CKI B;  4DR1 L;  4PNY A;  1RTN A;  5FO9 B;  1CQF A;  3MHB A;  3NPP A;  1SAP A;  2N3S A;  2HDL A;  1YHQ A;  1UE7 A;  3NTI A;  1R4P B;  1X56 A;  2JA7 G;  3FVQ A;  2KHI A;  4R4T A;  1B50 A;  3J81 c;  3CCL A;  5EAY A;  3CPF A;  2NZO A;  3SVM A;  1PV4 A;  1QOH A;  2CWA A;  2D9U A;  4RHR A;  3KJO A;  2ZM6 L;  2CW0 C;  1HQR D;  2K1B A;  3IRB A;  3JAM E;  4DR1 Q;  1CZG A;  3GP7 A;  2FMC A;  2F3V A;  3R2I A;  1Q8I A;  1KRS A;  4QGU A;  4K8I A;  4QIW B;  1VQ9 A;  1VQP A;  5T1I A;  1QIL A;  3TZU A;  2EYL A;  4AIM A;  2KEN A;  4EQO A;  3HOV H;  4IOA A;  3H0G H;  1OXV A;  2ZM6 Q;  4KMU C;  3MEH A;  3DXJ C;  4A3D H;  4A3F G;  4B3S L;  1L1O A;  1Q90 A;  1X55 A;  1BCP B;  5FLX c;  4LF8 L;  1PHJ A;  4R4Q A;  4L5R C;  1KTK A;  5D3D A;  3M85 A;  4HJA A;  2KQ3 A;  1NAP A;  1MHW C;  3DM1 A;  4A93 H;  3NXW A;  3D4W A;  3J81 E;  2Z6B A;  3IKJ A;  1RF2 D;  1S5F D;  4FVM A;  3T51 B;  1ENF A;  3DWQ A;  2KBN A;  2MO1 A;  4LF6 L;  1SND A;  2OQ0 A;  4B3S Q;  5AFW A;  2NVT B;  1M1K C;  1YZ6 A;  4BXX G;  3HOU G;  4LF8 Q;  4RGT A;  1X3E A;  4JI4 Q;  4IUR A;  2ID0 A;  1SYB A;  1K8G A;  1OTC A;  3AU7 A;  3D0F A;  4L63 B;  1E2V A;  3F1Z A;  4RAU C;  1PRT B;  1IYV A;  1QE6 A;  1VQ8 A;  3S15 B;  1H9R A;  4QJF A;  2ZTE A;  2DY7 A;  4XQN A;  2UUC L;  4CJ0 B;  4LF6 Q;  2F0V A;  2RBM A;  2NBF A;  2IHE A;  1QZH A;  3STB D;  4RMF A;  5ELE A;  3KJP A;  4HID A;  1SN8 A;  1S5D D;  2IHF A;  3EJI A;  5FLX E;  2D62 A;  4UP9 A;  5CBE E;  1HFN A;  1A3V A;  5CV4 A;  2UUB L;  1HR0 L;  4IPC A;  4KJN A;  1UEB A;  2A19 A;  3CCU A;  5IYB G;  2FJ2 A;  3Q24 A;  1DOM A;  1PFB A;  4DK1 A;  2A8V A;  3FKI H;  3HOY H;  1CI3 M;  1NBW A;  5CR3 A;  4WJW A;  4ZK9 B;  2F0Q A;  1EWH A;  2I5H A;  5CV7 A;  4GNX B;  1D5Z C;  4LUO A;  1V43 A;  4Y7N H;  3I8Z A;  2UUB Q;  1SE2 A;  2QCP X;  1NSN S;  1HR0 Q;  1VQ4 A;  3SEB A;  4TQU S;  5M5X H;  1JB3 A;  1G91 A;  3H09 A;  4ZCK A;  5E7N A;  1YNJ D;  3WWV A;  4DV6 L;  4XQJ A;  1E1T A;  1HJP A;  2OTL A;  4RA8 A;  3E6Z X;  4DFA A;  3E0E A;  1STH A;  1YHB A;  4CBV A;  5GAD C;  4HMJ A;  1IBL L;  1QJO A;  3I4L A;  5CV8 A;  3HOV B;  1ENA A;  1G2T A;  2PI2 A;  5C6A A;  2K5H A;  4A3B G;  2VB2 X;  1PDQ A;  4L5S A;  2OEO A;  4IO9 A;  1TWA B;  1EIY B;  1LTL A;  4LJZ C;  3R8B A;  2B3G A;  3CW2 C;  4DV6 Q;  5IT9 L;  1SNC A;  4A4I A;  1BCP F;  5E1F A;  1KD1 C;  5J22 A;  5I9P A;  3E9I A;  1Z9F A;  2KEE A;  1IBL Q;  3G48 A;  3GTJ H;  1V8Q A;  2EJM A;  3BZK A;  1KXL A;  1ZKO A;  2F0M A;  3K5M A;  1TII D;  3HKZ G;  4DR3 L;  4E6I A;  1BBX C;  5H1S E;  1ESR A;  1NCV A;  1CUK A;  1GJX A;  2WP8 J;  4KY6 A;  2RKS A;  2R92 G;  3I3C A;  1B3A A;  4AYB E;  1HRJ A;  3VYR A;  2R93 G;  1PTO D;  3AMU A;  1CKN A;  1Y69 U;  2YTX A;  2BE5 D;  2AWO A;  3I91 A;  1QNK A;  4DR3 Q;  4Z9C B;  1BCP C;  1LTT D;  2B63 G;  1XMO L;  1N32 L;  5IP9 G;  1E1O A;  1X6O A;  1RTO A;  2BH8 A;  1RD9 D;  3G6J B;  4K14 A;  2QEX A;  3HOU H;  5C4J B;  4KHZ A;  4KJO A;  1VQL A;  1WTR A;  3JAM i;  2AUK A;  2XWJ B;  3ND9 A;  1WCM B;  2RSN A;  3PIP 3;  1F9S A;  1NY4 A;  4DAY B;  5K5P A;  4BBR G;  4G7O C;  2IPK D;  1E0B A;  3VDY A;  1DYQ A;  1XYI A;  4R1J A;  3URY A;  3C2P A;  2ZTD A;  2RF4 A;  1OXX K;  1XMO Q;  3BJU A;  1N32 Q;  2KCC A;  3FKI B;  2LXJ A;  3A54 A;  4B3T L;  3E9H A;  4IFD H;  3PUY A;  3HRZ C;  4I65 A;  4Y7N B;  1EY9 A;  4L5T A;  4X3S A;  2L0C A;  3K59 A;  3HFZ B;  4A3E H;  1KNE A;  3ERS X;  4QIW E;  5NUC A;  4X66 L;  3CXC A;  1A8V A;  2NVQ H;  3HOX G;  4CJ2 C;  1SJE D;  2L55 A;  2JA6 H;  3OIP A;  5FJ8 G;  4A3K G;  1F2M A;  4LMQ D;  1GKH A;  3L2P A;  4B3T Q;  2FMM A;  2F3W A;  2SNS A;  2IW3 A;  3UE1 A;  1XPR A;  2JA7 B;  4TRD A;  4A3I G;  1GO3 E;  5JVH 3;  1Y1V H;  1HTL D;  1WTP A;  2A6H C;  3PQI A;  5G3L D;  4X66 Q;  5KNB A;  3OMG A;  1JOO A;  3Q6S A;  1I4H A;  3TSS A;  1J8I A;  1Q12 A;  3M4Y A;  4ZUJ A;  4OWT B;  1EU3 A;  4GNX C;  5C3E G;  2B2T C;  2WB1 G;  3BDO A;  1B4O A;  5C5M A;  2RVL A;  1L1O B;  4ABN A;  5FOB B;  5ELO A;  4K5W A;  3GTL H;  4C2M H;  1HNW L;  1CQV A;  3P75 A;  4DUY L;  1A62 A;  3P7J A;  4X62 L;  5LL6 S;  2UXB L;  2ZJQ A;  5J39 A;  4DPG A;  2UUA Q;  4A3F B;  1I6H H;  3RZO H;  2NTS A;  1KDB A;  3KYH C;  3ND8 A;  4OO1 H;  4YIJ A;  2HQL A;  1M4V A;  1C7Y A;  4G57 A;  3NP8 A;  5HY6 A;  1U4P A;  1ET9 A;  3MTS A;  1EWC A;  4R4C A;  1HNX L;  3G7L A;  1XPU A;  2MUY A;  3MEF A;  3K0Y A;  4DUY Q;  2XRS D;  1EY8 A;  3V2T A;  3NTH A;  2NVY B;  1Y1W G;  1JB7 A;  2XVS A;  4X62 Q;  4IFD I;  2Z8L A;  2VNU D;  4ZKC B;  2UXB Q;  2Q8R E;  1VQH A;  2R92 H;  1JE5 A;  5A2Q L;  2PQE A;  1VQ6 A;  2R6G A;  1HZA A;  1X3Q A;  1EQQ A;  1FYC A;  4YHH L;  2CFM A;  1SMX A;  4DN4 M;  1HNX Q;  3GTK B;  1G6Z A;  1TS2 A;  2LKV A;  3EA6 A;  1S40 A;  2F0H A;  3UDF A;  1HUM A;  5E4W C;  5KND A;  3KFU A;  1IW7 D;  1P8L A;  4A3L G;  3NEM A;  4FXK C;  4RG1 A;  1FJG Q;  3S17 H;  4KKS A;  3KDF A;  4BA2 I;  1STN A;  1QVG A;  4YHH Q;  3OMC A;  4ALP A;  3IFT A;  1QVF A;  3KF8 B;  5EPK A;  3C1F A;  4XYQ A;  5E3F A;  5GAH C;  2E2H H;  1STA A;  5KRU A;  4JI2 L;  2SEB D;  2NVX H;  2B29 A;  3F2C A;  5IOD A;  2VL6 A;  1B70 B;  2E74 C;  2WAQ E;  2E5L L;  1Q7Y C;  1TWF H;  3ONA B;  3S14 B;  1U0L A;  4H02 A;  3NBH A;  3KF6 A;  3NWS A;  1QNU A;  2AQ3 B;  4A3J H;  3F8T A;  4OO1 I;  3ULJ A;  4TVA B;  1TVX A;  5E4X A;  2HIX A;  4JI2 Q;  3WDN A;  5CV9 A;  1Y8P B;  1ET6 A;  3S1R H;  5D65 A;  1SR3 A;  5IP7 G;  3S2D H;  4APV A;  3CF5 A;  1QVC A;  2F52 A;  5IOC A;  3AEV A;  3TS2 A;  3FP9 A;  4A3B B;  4NKL A;  1YEZ A;  4P71 A;  3PO3 G;  1C4Q A;  4OWW B;  4FF3 A;  1X54 A;  2KHJ A;  3J7Y W;  3MXG A;  2F0F A;  3VR2 A;  1K3B C;  3BZC A;  4F8M A;  4B3M Q;  1RHP A;  2R7F A;  1I6H B;  2F3I A;  1BR9 A;  2HHH L;  3I73 A;  1IZ6 A;  4C3H H;  3J80 c;  3DUZ A;  1CKN B;  3SE0 A;  3CCJ A;  5ELB A;  1HXY D;  1CM9 A;  1P16 A;  4YY3 L;  3S2H B;  3HKZ B;  5JOB A;  3OOC A;  2K01 A;  4PZ6 A;  5DM7 3;  2JEB I;  5LL6 X;  1PFS A;  5F2D A;  1YNJ C;  2EYM A;  3MVV A;  1ILP A;  2F0U A;  1G8Z D;  2A69 D;  5CMD A;  2C5C A;  5M5W H;  2R93 B;  5DLQ E;  2HHH Q;  2WII B;  2N78 A;  3HOZ G;  3HOW G;  1K3R A;  4LFA L;  3S16 B;  1TQO A;  1N34 L;  3K7A B;  2Q2H A;  1PLF A;  2EDG A;  1FNV A;  2XN9 C;  2RHS B;  5LMU L;  4WJ4 A;  4YY3 Q;  2B39 A;  1B8A A;  2B63 B;  2JA8 H;  1EWI A;  2NN6 G;  1U4L A;  1FNU A;  3HG9 A;  3IFD A;  3SHL A;  1G51 A;  4LF9 L;  1C9O A;  1B53 A;  1KAB A;  2K4K A;  1YIJ A;  1C0A A;  3Q0A A;  3AQQ A;  4LFA Q;  1WTV A;  4HSV A;  1K73 C;  1N34 Q;  3QR8 A;  4IUV A;  2LMC B;  4LW1 A;  4BBR B;  5LMU Q;  2CQA A;  4BBS G;  4FYD A;  3LX0 A;  3VR5 A;  2E2H B;  1HA5 A;  2CWP A;  4PQX A;  2Z4H A;  2I5L X;  5EKK A;  2GVB A;  2F4V L;  3NK9 A;  3RNU A;  4LF9 Q;  1LTI D;  3GTG B;  1M8A A;  1LYL A;  4JI8 L;  3SXH A;  2EJF C;  1V1P A;  1IL2 A;  4UPA A;  2K33 A;  1WYD A;  4C1N K;  1JMC A;  4L6T B;  1XWE A;  5D14 A;  1STY A;  4DV1 L;  3DWA A;  1A6X A;  2QDB A;  2NYZ D;  2O4X A;  4HIM A;  1T9H A;  2TSS A;  1KHI A;  1WJJ A;  4GZY C;  3HOX B;  2AUJ D;  1HCZ A;  1JOR A;  2F4V Q;  4A3K B;  3S1R B;  1K9M C;  1ZXT A;  2VUM G;  5K36 H;  2BA1 A;  2EYF A;  2I46 A;  1NMF A;  1PA6 A;  1O78 A;  4A3I B;  3QWN A;  3Q22 A;  5JEA J;  1PMR A;  4DV1 Q;  1VF7 A;  1SFO B;  2JYO A;  5EBD A;  5IWA L;  1F9P A;  5G3L F;  3QOJ A;  5C3E B;  3MXP A;  2RDG A;  1TS5 A;  4OIJ A;  2WB1 B;  3GTQ B;  2MQH A;  1JE4 A;  1TWH B;  1EFW A;  4NXM L;  2K32 A;  3CRL C;  2EJG C;  5GAG C;  3GO5 A;  3I4N G;  2B8F A;  3GQB A;  3SK8 A;  3S1N B;  3NBI A;  5HGQ A;  5C0X H;  1ASY A;  4QL5 A;  2F03 A;  1I50 B;  1WTQ A;  5IWA Q;  3TEH B;  4DR7 L;  3DWP A;  2NB0 A;  1MJC A;  3OWF A;  1WCM G;  2JE6 I;  1EQR A;  4YWL A;  4NXM Q;  3L0O A;  2A68 D;  5C3X A;  1OXT A;  1EY7 A;  3BVG A;  3RLO A;  1JJ2 A;  1WVL A;  3S15 H;  2EXD A;  1D5X C;  1YJ9 A;  2E76 C;  1Y1W B;  1CT1 D;  3MXU A;  4RCN A;  4JW0 A;  4DR7 Q;  1B7Y B;  4DR4 L;  3TME A;  1MKH A;  2PZU A;  4DAP A;  3I55 A;  4O2D A;  2EY5 A;  2O2L D;  3NEN A;  4J8Q A;  1AFP A;  1STE A;  3KDF B;  3TQY A;  1HH2 P;  1I4G A;  1YNN D;  4CKE A;  4IJH A;  4DF7 A;  3BYY B;  2F0E A;  1VQC A;  4IPD A;  3S1M B;  2C9O A;  4PMB A;  4GLX A;  3K81 C;  1A15 A;  3F2B A;  4ZYS A;  5KNC A;  2EY2 A;  4GLA C;  1BBW A;  1WTH A;  3UDI A;  1EQT A;  4ZLT F;  4H44 C;  5JJK A;  5ISR A;  2IX0 A;  4OGQ C;  2F0S A;  1CSQ A;  4UHV A;  2HT1 A;  3CQZ H;  1K0S A;  4RFB A;  5T1G A;  1EY6 A;  3MFG A;  1OXS C;  1I5F A;  4EVO A;  4OHJ A;  1RKN A;  4NW2 A;  3Q23 A;  1XPO A;  3NBH B;  3KF6 B;  3M9B A;  4NPS A;  1GOZ A;  4NDX A;  3ICE A;  4LFB L;  2HQE A;  3WOF A;  3GD7 A;  2L11 A;  3R93 A;  1ICW A;  3TRZ A;  2K5W A;  2B2W C;  1G6P A;  3A0J A;  3T13 A;  3ULL A;  5C0X I;  4DK6 C;  2C35 B;  1IL8 A;  1A2U A;  1RCV D;  1TWA H;  2OT2 A;  5IYD G;  3EIV A;  3SK4 A;  4J15 A;  5FK9 C;  4LFB Q;  2M00 A;  4C1N I;  1IW7 C;  3JAM L;  5C3W A;  2JSO A;  2F1M A;  2JP1 A;  4XYO A;  4DAM A;  1TY2 A;  4IQZ A;  3KLW A;  2A73 B;  3HKZ E;  2YV5 A;  1QZG A;  1B3Q A;  4R4I A;  3NSW A;  1Q86 C;  3ERO A;  4K5V A;  4L5Q A;  5ELN A;  4RGN A;  5EBC A;  3PO3 B;  4DV2 L;  2K5Q A;  3RLF A;  1O7I A;  5IGE A;  1SEB D;  1Z47 A;  1EQV A;  5ELC A;  1VQD A;  1UEA B;  5JAV A;  1Q81 C;  1OO9 B;  2A6E D;  4PZ7 A;  2D0P A;  4RKB A;  3HP3 A;  1NMG A;  3TZD A;  4P2C B;  1BKB A;  5IGG A;  1K83 B;  4U68 A;  1RL2 A;  1SYE A;  3SK5 A;  3GTO B;  5TSS A;  5IGF A;  3W1B A;  3J81 L;  4DV2 Q;  1VDZ A;  5I6W A;  1BVS A;  5JPN C;  4DR2 L;  5C4J H;  2VW9 A;  4X65 L;  1TR5 A;  5DM6 3;  1T5X D;  2EPB A;  3OIQ A;  3I56 A;  1WCM H;  1EYD A;  4C3J G;  3NWT A;  1PYW D;  1UNS A;  2LSS A;  3HOW B;  3HOZ B;  4KY7 A;  2EY6 A;  1U9R A;  2VQE L;  4LF5 L;  1E22 A;  1XTC D;  3K58 A;  1ENC A;  2UUC Q;  1LTA D;  5A35 A;  2ICE C;  3CRK C;  1GUN A;  2EYJ A;  4DR2 Q;  3SGI A;  1EYC A;  5KYI A;  4X65 Q;  2O5I C;  2GN5 A;  1CZW A;  1CKM A;  2ALY B;  1HHV A;  1ICF B;  1TT2 A;  4DU9 A;  3PUZ A;  3CQZ B;  4Q5V A;  1CHP D;  2KCM A;  3EBE A;  2B8G A;  5IE8 A;  1V1P B;  5FLX L;  1QWY A;  2VQE Q;  4LF5 Q;  2DGY A;  2DNC A;  4RH6 A;  3CAM A;  5FO7 B;  2MNA A;  3M4O B;  3F2D A;  5J1Z A;  3GTM H;  4LAA A;  4BBS B;  2CVR A;  4JI6 L;  2RHQ B;  2X6G A;  4OL7 A;  4GN3 B;  2F0G A;  3NTK A;  4JI7 L;  2XRQ D;  2JA7 H;  3DM3 A;  4KHV A;  4RGO S;  5M5Y B;  2H4O A;  1OXU A;  2KA7 A;  4RWS C;  5GRO A;  1SYD A;  3CCQ A;  4JI0 L;  1Y14 B;  3S1Q B;  1E2W A;  2B2V A;  4FO2 A;  4RGM A;  4O1N A;  5IGB A;  1HZB A;  1FD7 D;  2VB3 X;  4M8A A;  1ZYR D;  3CCM A;  3U58 A;  4JI6 Q;  1LLR D;  1WTO A;  1R4Q B;  2AQ1 B;  4MZ9 A;  2VUM B;  1ONL A;  2WAC A;  3J7A 5;  4GKK L;  3J7A V;  2RDF A;  2CH4 A;  4BWG B;  4JI0 Q;  3H3V H;  2JA9 A;  1ROD A;  4LK1 C;  3O13 A;  4A3F H;  2F0D A;  4QB4 A;  1HR0 W;  4YCW A;  3VYT A;  1VCI A;  1V1O A;  3I2Z A;  4OX9 L;  4GKK Q;  5JJZ A;  1GHJ A;  2HCC A;  2KJX A;  4PMW A;  3I4N B;  1B1Z A;  2NVY H;  2E8G A;  1UE5 A;  4HJ5 A;  1HA6 A;  2G9D A;  3VA7 A;  5BN3 A;  1I6V C;  2K05 A;  3EFX D;  2IX3 A;  1VQN A;  1I3Q B;  2HUG A;  4BXX H;  3G4S A;  1XJV A;  1STB A;  4POF A;  2BCO A;  4OX9 Q;  3PIO A;  2EE1 A;  2Z4I A;  4LWC A;  5M9O A;  2V1C C;  3GTK H;  2DUD A;  1VF5 C;  2R3Z A;  4X3U A;  2P5Z X;  5EKL A;  3NEL A;  1TS4 A;  2AKW B;  2K5V A;  2Y0S G;  4S3S A;  5EPJ A;  4HCE A;  2EVB A;  1Z7T A;  1STG A;  1GUW A;  4FDB A;  2JEA I;  1EIF A;  2B2W A;  4M1U B;  3A74 A;  1KDC A;  3C46 A;  2YTV A;  1S5C D;  2A1A A;  4JG2 A;  3RLN A;  1K0R A;  2BA0 A;  2F0T A;  5AJ3 L;  1PH7 A;  1KC8 C;  1SNO A;  5IYB H;  2AQ2 B;  1X9N A;  3GTM B;  1LTS D;  2LY7 A;  5BR8 L;  3VA5 A;  3J81 i;  3C3L A;  3H3V I;  3S14 H;  1NR2 A;  1SBB B;  1S5B D;  5KGU A;  2UU9 L;  3M4P A;  1AEX A;  2RQX A;  3BYT B;  5AJ3 Q;  2J4X A;  4DV5 L;  2UXD L;  3J7A F;  3RN5 A;  3ZYY X;  3F2U A;  4DGZ A;  4DUZ L;  4NXN L;  2EQS A;  4HSP A;  1VS0 A;  2EYP A;  4LNQ A;  5BR8 Q;  5BN5 A;  1JJG A;  3D4R A;  5ELF A;  1LAB A;  3L3O C;  2A5H A;  2EYO A;  4ME5 A;  5C4Z A;  3I70 A;  2MHV A;  4B9W A;  4A3B H;  2UU9 Q;  5GAE C;  3PO2 G;  4LUV A;  4ULL A;  1UAP A;  1EIG A;  3UE0 A;  4DV5 Q;  1JC7 A;  2DN8 A;  4A3C G;  4WRD A;  2WIN B;  3RD4 A;  2EOT A;  1F77 A;  1K8O A;  1WFQ A;  3BVM A;  4DUZ Q;  4NXN Q;  1XX8 A;  2Z0S A;  1IYU A;  3G6E A;  1SNM A;  3MAQ A;  4XTC S;  3FPP A;  1VQJ A;  3KOJ A;  5IYC G;  1AP0 A;  3Q8D A;  3VR6 A;  4KD4 A;  1HNW Q;  5J3B A;  3S2H H;  2IY5 B;  2OQK A;  4K2K A;  4CDE C;  3OYY A;  4JBW A;  4JK1 C;  4QUF A;  1HTP A;  1PZI D;  3KBG A;  2KEC A;  3CPW A;  5FLM G;  3K5O A;  2OXP A;  4PMC A;  5CV6 A;  1Y8N B;  2R93 H;  4DV4 L;  4BS9 A;  1G29 1;  3M7N A;  3S16 H;  3K7A H;  1ILQ A;  1Q1E A;  5LHY 1;  4AYB G;  1VQO A;  2K04 A;  1PTO B;  2ICI A;  3R2T A;  1CTM A;  2B63 H;  4ZAI A;  4QCL A;  2DJF C;  5IP9 H;  1H95 A;  2E2J H;  3I90 A;  1RJT A;  4FP5 D;  1C48 A;  3H15 A;  4DV4 Q;  3M7G A;  4QMG A;  2EYH A;  5C44 G;  4C3J B;  4JCV E;  3PMF A;  1GUS A;  2KED A;  4BBR H;  3TDQ A;  4A3G G;  1DCZ A;  3DHQ A;  3MC0 B;  1MD2 D;  1VQM A;  1GVP A;  2YTY A;  1D5M C;  3VR3 A;  1H9S A;  1TWG B;  2OCE A;  2MPM A;  2QKI C;  3GTG H;  1I4X A;  3RZD B;  5M3F G;  2A6E C;  3J7Z C;  2HCI A;  3ERQ A;  2G9H D;  4DAV A;  2BOS A;  4O0A A;  3V05 A;  2NZH A;  4DV0 L;  1H9K A;  1VQK A;  4XT3 B;  1DZ1 A;  2XNA C;  3BDC A;  1EFI D;  4HED A;  3HOX H;  1R9T B;  4WFN 3;  3T4A C;  4ZRZ A;  5FJ8 H;  4A3K H;  3K7U C;  1PH3 A;  2N88 A;  2JA5 G;  3STB C;  4KD3 A;  2E5L Q;  1J6Q A;  2WV6 D;  1ESF A;  2L1B A;  4JI1 L;  4L8J A;  4A3I H;  2KCT A;  1X65 A;  5JEA G;  2X69 A;  3AYH B;  4IPG A;  1RDP D;  3HKS A;  4DV0 Q;  1V9P A;  4ODG A;  1SFO H;  4POG A;  2RDH A;  3VYS A;  2Q2I A;  3A5Z B;  5C3E H;  3I4M G;  3V96 A;  1TU2 B;  4DKA C;  4EGV A;  3GTQ H;  1JWS D;  1TWH H;  3PCO B;  4CKB A;  4F87 A;  3E5S A;  1XTD A;  2QGQ A;  3S1N H;  1IYJ B;  1DM0 B;  3K5L A;  3TP5 A;  2RA4 A;  1JT8 A;  3T16 A;  1YI2 A;  1I50 H;  1T5E A;  4IN3 A;  5C5L A;  1EY5 A;  1UUP A;  2HD3 A;  3NUC A;  3TS0 A;  1HPC A;  1X3G A;  5C4X G;  3DEO A;  3FPU B;  3FMC A;  3H6M A;  4J6H A;  1HZC A;  3C1E A;  3BS1 A;  1PTO F;  3AFP A;  2GA4 B;  1Y1W H;  5KEE A;  2MO0 A;  2F0I A;  3P1H A;  2LXK A;  2SOB A;  2Z6K C;  1LT4 D;  4BY1 G;  4JI3 L;  3MXN A;  2H1E A;  1ML0 D;  3U9S A;  2E2J B;  1ZYR C;  5FLM H;  1TXY A;  2KCN A;  2VZA A;  4DK0 A;  4GN4 B;  4ZKB B;  4BA1 I;  3HEJ A;  4QQB X;  5EKI A;  4IPH A;  4HJ7 A;  3S1M H;  4KHP L;  4KKU A;  1Q8K A;  1W6J A;  2D2C C;  3J80 E;  1B9M A;  4F88 A;  1IKM A;  1D2B A;  2PPB C;  2EIF A;  3OTO L;  1LT6 D;  2Y0S B;  3E3X A;  4A3L H;  5LMN L;  3LNN A;  4JI3 Q;  1KNA A;  1L2F A;  2E75 C;  3M4Q A;  2SDF A;  1F2Y A;  2F0K A;  1NUC A;  1PTO C;  4N8F A;  3KBX A;  1VQB A;  5HUR A;  2K5D A;  4KHP Q;  4A3G H;  2BE5 C;  1QCB D;  1I4R A;  3E0J A;  4Y52 H;  3OTO Q;  3M3Y H;  4NB3 A;  4IOC A;  1C8C A;  3D4D A;  2L15 A;  4JOI A;  5LMN Q;  3EQL C;  1KAW A;  4H7B A;  2MP1 A;  4A75 A;  1QG7 A;  1SLJ A;  2PQA A;  3FEW X;  5M3F H;  3EVQ A;  1EIH A;  4JI8 Q;  1G2S A;  5M3M B;  3I4O A;  4JYA L;  3H0G G;  1H9J A;  5ELD A;  2WAQ G;  1IHZ A;  1F9R A;  1LTG D;  3RR5 A;  2JQO A;  4DV7 L;  4GOP C;  4X3T A;  1SNP A;  5C4H A;  1BCP D;  3NE5 B;  4P73 A;  3TP6 A;  1I94 L;  2FXQ A;  4A3D G;  1A0I A;  2FHT A;  4ID6 A;  2ZT9 C;  4CGY B;  5IP7 H;  5HGT A;  5DNF A;  4KN4 C;  1RIP A;  5JEA H;  3QOL A;  2K14 A;  4JYA Q;  1X3P A;  4YWK A;  2XSC A;  4JPB W;  4N8X 1;  4DV7 Q;  2B2V C;  3PO2 B;  4A93 G;  3PO3 H;  4JBJ A;  1I94 Q;  1ASZ A;  5D3I B;  3HGB A;  4DNI A;  3D6W A;  2JN4 A;  3A55 A;  3BZD B;  4OON A;  1PRT D;  5FO8 B;  5EQ0 A;  1EU4 A;  1CHQ D;  1K83 H;  2PZT A;  1KIX A;  1HFG A;  3GTO H;  2J0T D;  1B44 D;  2G5D A;  1D6E C;  1KAA A;  5IIF A;  1J5E L;  2D5D A;  2JXM B;  3HOW H;  3HOZ H;  5I2X A;  2XGT A;  3FDT A;  1A3T A;  1N33 L;  2K6A A;  1V1Q A;  3JAM c;  4G7Z C;  4XDX A;  4UY8 C;  4AYB B;  1CA6 A;  2CCZ A;  2K7V A;  2R61 A;  4LFC L;  4BY1 H;  3G71 A;  4B08 A;  2EZV A;  4DR4 Q;  1L0X B;  3HOY G;  4GS3 A;  1J5E Q;  2NN6 H;  1AE2 A;  2PI2 E;  1H9S B;  2IT1 A;  4K8J A;  1SMY D;  2F0W A;  1S72 A;  3MA2 B;  1DJR D;  5IY0 A;  5C44 B;  4CHT B;  1N33 Q;  1U4M A;  3TN2 A;  3M4O H;  1SYC A;  2PO4 A;  4A3G B;  4KV6 A;  1SE8 A;  2TMP A;  4K6D A;  3LGJ A;  4BBS H;  4FNF A;  4HN7 A;  5I9O A;  3KUP A;  4FF4 A;  4LFC Q;  3M3Y B;  1PH2 A;  3PV0 A;  1D1I A;  3A56 A;  3ER0 A;  2K03 A;  1II3 A;  2WKD A;  4YCV A;  3UI2 A;  5KYL A;  1X32 A;  5M5Y H;  3CCS A;  5M3F B;  3QG1 A;  1GUO A;  2PNH A;  4HR7 B;  2FFK B;  4MNO A;  3OPO A;  3S1Q H;  5JPM C;  5EJW A;  4JBK A;  2QA4 A;  1BQQ T;  4DXF A;  5CYU A;  1JJC B;  5JJL A;  4DXG A;  1O7Z A;  1O7L A;  4HAE A;  5GQO A;  2ZJP A;  4BY7 G;  2JA5 B;  3MFY A;  1VQG A;  4G4K A;  5EPL A;  2VUM H;  3EN2 A;  2NUC A;  2NZ1 D;  1MI2 A;  2WFW A;  1N36 L;  4OIK A;  2B2U A;  1KRT A;  1YBY A;  2ES2 A;  2JK8 A;  4CJ1 B;  3TRE A;  2K50 A;  4CDC C;  1SRO A;  1S3O A;  1CA5 A;  3GTP B;  4XIG S;  2Z6K A;  4FF2 A;  4LUZ A;  3I4M B;  3TBI B;  4UDU C;  5BN4 A;  3J81 j;  4NMZ A;  1GUG A;  2MFI A;  4J1M A;  3J80 i;  4JI4 L;  4JVZ A;  4YCU A;  1N36 Q;  3I4N H;  2N55 A;  4HTH A;  1MBY A;  2CHB D;  2KHS A;  4ME3 A;  2NN6 I;  2PNR C;  4DNR B;  4DR5 L;  4R4O A;  1VQI A;  1I3Q H;  2NWG A;  1WOC A;  1Z6H A;  1VMC A;  4A3M B;  4DA2 A;  5C4X B;  1LTR D;  1SRU A;  3MXN B;  4HJ9 A;  1EOT A;  1X3F A;  2R7Z G;  4I7Z C;  1J9O A;  2Y0S E;  2GVA A;  2B2Y A;  5IT9 c;  3RMH A;  4DR5 Q;  1U4R A;  1L0W A;  4OWX B;  3PIO 3;  2RSO A;  3R3O A;  3T53 B;  2CH4 W;  4BY1 B;  3A8J E;  4QY7 A;  3A8I E;  1EOV A;  1A3U A;  1K28 A;  4JV5 L;  2KVM A;  4XT1 B;  4IFD G;  2VXW A;  4UP8 A;  2F0P A;  1FGB D;  2IJ0 A;  3SR1 A;  1E7Z A;  1FR3 A;  2ZXP A;  4A3E G;  4GOP A;  3H91 A;  2F4I A;  3I7F A;  3D6C A;  2JA6 G;  3RN2 A;  3P20 A;  2K28 A;  2ENB A;  1CFM A;  1LV9 A;  4XQQ A;  1NR4 A;  1E24 A;  2XIW A;  4JV5 Q;  2A69 C;  1EEI D;  4RCO A;  2PQA B;  3PUW A;  3KF8 A;  3L7Z C;  3OW2 A;  2PW5 A;  1YIT A;  3PF5 A;  1Y1V G;  1LTB D;  2WB1 E;  2JJQ A;  5IT9 E;  3K0X A;  1D7Q A;  1GXD C;  2NTT A;  3UDX A;  4UAI A;  1QB5 D;  1HQM C;  3LWE A;  1GD7 A;  1YVC A;  1PH4 A;  3RUZ A;  4JI7 Q;  1GM5 A;  2WKC A;  2PCF B;  2EXZ A;  2VQF L;  4GLV B;  1MSG A;  3H0G B;  5IYD H;  2WAQ B;  4TSS A;  5L37 A;  2HIV A;  1PFM A;  1JOQ A;  3X3N A;  1GUT A;  4YWM A;  3D3R A;  1BUV T;  5I6Y A;  4A3D B;  3U4V A;  4P75 A;  4BY7 H;  1Q46 A;  4OO1 G;  4IZ8 A;  1SE4 A;  2VQF Q;  3DMU A;  4HIK A;  2PW7 A;  1LO5 D;  1YHA A;  1KQS A;  4A93 B;  5DEH A;  2CQO A;  4QUC A;  1MGS A;  2PMZ B;  4XXE A;  1FGU A;  1AZP A;  4GN5 A;  4NP5 A;  2L4N A;  4DNT B;  2ZJR A;  4I7A A;  2QDL A;  1PTO H;  5JJI A;  2EY1 A;  4KN7 C;  1PRT F;  4ZUI A;  1LUZ A;  4ZQ3 A;  1Q82 C;  1S4Z A;  3LWU A;  1YNX A;  3N52 A;  3X3M A;  2FIN B;  5FKA C;  1F2L A;  3OWE B;  4FXD A;  1W6K A;  4LF4 L;  4P72 A;  3ZJY C;  1VQ7 A;  3KLR A;  4C3J H;  2R7Z H;  4CKC A;  1HUN A;  3K6O A;  3VR4 A;  3NQI A;  4IFD J;  1F9Q A;  1UWV A;  4IUU A;  3KLS A;  3CMA A;  2OF1 A;  3MZ5 A;  1WD0 A;  1QUQ A;  3A7L A;  4B9X A;  1TWG H;  4K2L A;  1DD2 A;  1EYG A;  3U50 C;  3QIA A;  4K5X A;  2BDO A;  1PH1 A;  4LF4 Q;  3RZD H;  1BDO A;  3HOY B;  1A63 A;  3PUV A;  1BF4 A;  3AFQ A;  1CSP A;  4R8I A;  1DGS A;  1PYS B;  2BH2 A;  5M3M G;  3N6R A;  1PRT C;  1VQE A;  3S9W A;  3HZX A;  2A68 C;  4V19 0;  1N9W A;  2RCF A;  4G7H C;  2F0O A;  1SXT A;  1R9T H;  1DON A;  2PYK A;  3PGZ A;  4A3J G;  5M5X B;  4IUP A;  4C3I G;  4OEL B;  4KKT A;  1YJW A;  2KUM A;  4B3R L;  4JBM A;  1FVI A;  1SNQ A;  2I5M X;  4X6A H;  1XMQ L;  1YNN C;  5JVG 3;  1MSH A;  1NJI C;  2UXD Q;  4OEM B;  4IJL A;  1IXR A;  4JOI C;  4MHE A;  2ZTC A;  1JWM D;  2H5X A;  5KIX A;  1IKL A;  2UUA L;  2M9V A;  2N8N A;  4FXG C;  4GKJ L;  4BY7 B;  2Q8T A;  1SMY C;  1HNZ L;  4B3R Q;  4MIU A;  2ASB A;  4ILW A;  4C3H G;  3GTJ B;  4PV1 C;  1XMQ Q;  1H9M A;  1Q1B A;  3K5N A;  2K52 A;  3H94 A;  4Q0F A;  2K5N A;  4QF4 A;  3QJY A;  4PZ8 A;  1CKO A;  1KDA A;  2CKZ B;  1EYA A;  4U67 3;  3CCR A;  5A2Q E;  2YU9 H;  5IGD A;  1TY0 A;  5EGT A;  2I0Q A;  4GKJ Q;  3B6Y A;  4JC0 A;  1HNZ Q;  1SSO A;  2DJG C;  3CC4 A;  3CD6 A;  3A8K E;  1JIC A;  1SJH D;  1LAC A;  1UE6 A;  1PVO A;  4RHS A;  2HDM A;  2IL8 A;  2CW0 D;  3KK7 A;  3IL8 A;  3HS0 C;  3PIP A;  3W2D A;  3L9A X;  4MN3 A;  1PZJ D;  2X6L A;  5I4D A;  1B2T A;  4X64 L;  1FJG L;  1O7Y A;  2JA8 G;  1WTX A;  3HOU B;  1BNZ A;  3PSI A;  4HJ8 A;  3CME A;  2R7Z B;  3CHB D;  1IBM L;  1Q3L A;  4CDF C;  2ZXO A;  4KLK A;  3FHW A;  3I72 A;  1DOK A;  1TWC H;  4GOP B;  4WOR A;  5CBA E;  2E2I H;  3TP7 A;  1JCK B;  1SYG A;  4X64 Q;  2AHO B;  4O42 A;  1W3S A;  4HIO A;  1LM0 A;  1IBM Q;  1JWU D;  1MIU A;  1CK1 A;  3D8G A;  1VQF A;  2Z9H A;  3KLS X;  1Y8O B;  4A3E B;  1HZ9 A;  1D1K A;  1EY4 A;  5CV5 A;  2QW7 A;  2NVQ B;  1LT3 D;  4WJ3 M;  2JA6 B;  1UE1 A;  2IWH A;  3A5U A;  2YYZ A;  3SDZ A;  5M3M H;  3ULP A;  3MWY W;  4CDD C;  1VMP A;  3OHX C;  4LF7 L;  5K36 G;  2OTJ A;  1XXG A;  2PZW A;  2QEJ C;  3NHH A;  1BXT A;  2ZXR A;  1Y1V B;  2L9H A;  2F0J A;  1JOK A;  2LS0 1;  3W5O A;  4C56 C;  4RKL A;  1AH9 A;  2O5J C;  1PH5 A;  4HCS A;  4V0B A;  4C3I H;  2N49 A;  1D8L A;  3AB9 A;  3UDG A;  4IUT A;  4B3M L;  1PH8 A;  4X3K A;  4JI1 Q;  2E2D C;  4LF7 Q;  1XNQ L;  2PMZ E;  3PO2 H;  4K0K L;  4MTN A;  4KI0 A;  3U4Z A;  2Q2T A;  4C2M B;  1I4Q A;  3GTL B;  4A3C H;  5C0X G;  1LT5 D;  3CP0 A;  1BOS A;  4DV3 L;  1XNR L;  2A74 C;  1WI5 A;  1KLG D;  4A3M G;  3W3A A;  2YU9 B;  2ATW A;  3CU7 A;  1EZ8 A;  3RZO B;  5IYC H;  1FL0 A;  1PXU A;  1E3P A;  3A7A B;  3BVZ A;  4F7X A;  1IBK L;  2B2U C;  1XNQ Q;  1DXM A;  4K0K Q;  2I07 B;  2J7Z A;  2M2L A;  2R7D A;  3PF4 A;  1KLU D;  3QO2 A;  5CC4 A;  4DV3 Q;  2F0N A;  1XNR Q;  1ZEQ X;  3T1H L;  1L1O C;  4MTK A;  3OSO A;  5IGC A;  1EZ6 A;  4TKO B;  2R92 B;  4JI5 L;  4IUN A;  3GV3 A;  1IBK Q;  1SYF A;  3U9O A;  2Z1C A;  3H3V C;  3BG3 A;  4KY5 A;  2SNM A;  1E2Z A;  1WTW A;  1B9N A;  1TWC B;  4R8N A;  2L5T A;  4DK3 C;  3T1H Q;  1QUQ B;  1MJE A;  1U5K A;  3IAY A;  1AN8 A;  1NE3 A;  1S5E D;  2E2I B;  4JI5 Q;  5COY A;  3S17 B;  1PZK D;  5C44 H;  2KOL A;  2B2Y C;  4H13 C;  2RCN A;  3K8A A;  3S24 A;  4UP7 A;  4AH6 A;  1NTG A;  4DR6 L;  1N8R C;  2OWO A;  3J80 L;  1EL0 A;  3QB3 A;  4GNX A;  4K6L A;  1AW7 A;  2B2T A;  2NVX B;  1JQY D;  4N9P A;  3T56 B;  4OXP A;  2VS1 A;  1K8A C;  1PH9 A;  3HOV G;  4IAL A;  4FF1 A;  1TWF B;  3PUX A;  2IX1 A;  2MJ8 A;  1VQ5 A;  3NQT A;  1PFN A;  4DR6 Q;  1PH6 A;  1F2Z A;  4KTA A;  2VY3 A;  4A3J B;  1NNX A;  1O80 A;  3DLL A;  4C3I B;  2JA5 H;  4EX5 A;  1KL9 A;  4EQP A;  2K75 A;  1A2T A;  2L12 A;  4AQY L;  1DOL A;  1SE3 A;  4H0L C;  3S2D B;  5CGK A;  3CC7 A;  1EY0 A;  4KK7 A;  2XWB B;  3K57 A;  3GTP H;  3K80 C;  1AZQ A;  1GHK A;  5C0X J;  3I4M H;  1EEF D;  4HMI A;  2AMC B;  3BU2 A;  3OW7 A;  1WD1 A;  2BDN A;  4PG3 A;  2QIL A;  4A76 A;  4AQY Q;  3JC6 6;  5LMN W;  3VYU A;  1EUJ A;  1W2B A;  4C3H B;  4R9W A;  1I4P A;  3ITP A;  3WOE A;  3TP8 A;  3CC2 A;  4N9T A;  4A3M H;  2NVT H;  5C4X H;  3CCV A;  1M90 C;  1PYB A;  2Q8I B;  1FNW A;  1TKW B;  2AWN A;  3FRP B;  2DY8 A;  1TS3 A;  5M5W B;  3W1G A;  3GDE A;  2DNE A;  2A6H D;  5DAU A;  3SK6 A;  3BDL A;  4EQN A;  3T1Y L;  3DEP A;  4IUQ A;  2LFN A;  2UXC L;  4EQ5 A;  1VQA A;  2F0L A;  3GV6 A;  5I2Y A;  3FKI G;  2V4D A;  1L0Y B;  5COR A;  2XTI A;  1BBU A;  2QF7 A;  2Q2U A;  3CCE A;  2JA8 B;  2D0O A;  4DAY A;  1JR0 D;  1SDF A;  4P74 A;  1AE3 A; 
#chains in the Genus database with same CATH homology
 3D31 A;  1BO0 A;  2MGS A;  1K8M A;  3CKI B;  4PNY A;  1RTN A;  5FO9 B;  1CQF A;  3MHB A;  3NPP A;  1SAP A;  2HDL A;  3NTI A;  1R4P B;  3FVQ A;  1B50 A;  3SVM A;  1QOH A;  2D9U A;  4RHR A;  2CW0 C;  1HQR D;  2K1B A;  3JAM E;  1CZG A;  3GP7 A;  2FMC A;  2F3V A;  3R2I A;  1Q8I A;  4K8I A;  4QIW B;  5T1I A;  1QIL A;  3TZU A;  2EYL A;  4EQO A;  1OXV A;  4KMU C;  3MEH A;  3DXJ C;  1Q90 A;  1BCP B;  1KTK A;  5D3D A;  3M85 A;  2KQ3 A;  1NAP A;  3DM1 A;  3NXW A;  3D4W A;  3J81 E;  3IKJ A;  1RF2 D;  1S5F D;  4FVM A;  3T51 B;  1ENF A;  3DWQ A;  1SND A;  2NVT B;  5AFW A;  4RGT A;  4IUR A;  2ID0 A;  1SYB A;  3AU7 A;  4L63 B;  1E2V A;  4RAU C;  1PRT B;  1IYV A;  1QE6 A;  3S15 B;  1H9R A;  2DY7 A;  4XQN A;  4CJ0 B;  2F0V A;  2RBM A;  2NBF A;  5ELE A;  1S5D D;  3EJI A;  5FLX E;  2D62 A;  5CBE E;  1HFN A;  1A3V A;  5CV4 A;  4KJN A;  3Q24 A;  2FJ2 A;  1DOM A;  1PFB A;  4DK1 A;  1CI3 M;  5CR3 A;  4WJW A;  4ZK9 B;  2F0Q A;  1EWH A;  5CV7 A;  1D5Z C;  1V43 A;  3I8Z A;  1SE2 A;  2QCP X;  1NSN S;  3SEB A;  4TQU S;  1JB3 A;  1G91 A;  3H09 A;  1YNJ D;  4XQJ A;  4RA8 A;  3E6Z X;  4DFA A;  1STH A;  4CBV A;  4HMJ A;  1QJO A;  3I4L A;  5CV8 A;  3HOV B;  1ENA A;  1G2T A;  5C6A A;  2VB2 X;  1PDQ A;  2OEO A;  1TWA B;  4LJZ C;  3R8B A;  5IT9 L;  1SNC A;  1BCP F;  5E1F A;  5J22 A;  5I9P A;  2KEE A;  1V8Q A;  2EJM A;  1ZKO A;  2F0M A;  3K5M A;  1TII D;  4E6I A;  1BBX C;  1ESR A;  1NCV A;  1GJX A;  2WP8 J;  4KY6 A;  2RKS A;  3I3C A;  1B3A A;  1HRJ A;  3VYR A;  1PTO D;  3AMU A;  1Y69 U;  2BE5 D;  2AWO A;  3I91 A;  1QNK A;  4Z9C B;  1BCP C;  1LTT D;  1RTO A;  4K14 A;  1RD9 D;  3G6J B;  5C4J B;  4KHZ A;  4KJO A;  1WTR A;  2AUK A;  2XWJ B;  3ND9 A;  1WCM B;  2RSN A;  3PIP 3;  1F9S A;  5K5P A;  4G7O C;  2IPK D;  1E0B A;  1DYQ A;  1XYI A;  3URY A;  3C2P A;  1OXX K;  2KCC A;  3FKI B;  3A54 A;  4IFD H;  3PUY A;  3HRZ C;  4I65 A;  4Y7N B;  1EY9 A;  4X3S A;  2L0C A;  3K59 A;  1KNE A;  5NUC A;  4CJ2 C;  1SJE D;  2L55 A;  3OIP A;  1F2M A;  4LMQ D;  2FMM A;  2F3W A;  2SNS A;  2IW3 A;  2JA7 B;  4TRD A;  5JVH 3;  1HTL D;  1WTP A;  2A6H C;  5G3L D;  5KNB A;  3OMG A;  1JOO A;  3Q6S A;  1I4H A;  3TSS A;  1J8I A;  1Q12 A;  3M4Y A;  4ZUJ A;  1EU3 A;  2B2T C;  3BDO A;  1B4O A;  5C5M A;  2RVL A;  4ABN A;  5FOB B;  4K5W A;  1CQV A;  3P75 A;  3P7J A;  5LL6 S;  5J39 A;  4A3F B;  2NTS A;  1KDB A;  3ND8 A;  4OO1 H;  4YIJ A;  1M4V A;  4G57 A;  3NP8 A;  1U4P A;  1ET9 A;  3MTS A;  1EWC A;  3G7L A;  2MUY A;  3K0Y A;  2XRS D;  1EY8 A;  3V2T A;  3NTH A;  2NVY B;  2XVS A;  4IFD I;  2Z8L A;  2VNU D;  4ZKC B;  2Q8R E;  5A2Q L;  2PQE A;  2R6G A;  1X3Q A;  1FYC A;  4DN4 M;  3GTK B;  1G6Z A;  1TS2 A;  2LKV A;  3EA6 A;  2F0H A;  1HUM A;  5E4W C;  5KND A;  1IW7 D;  4FXK C;  4KKS A;  4BA2 I;  1STN A;  3OMC A;  3IFT A;  5EPK A;  3C1F A;  4XYQ A;  5E3F A;  1STA A;  5KRU A;  2SEB D;  5IOD A;  2E74 C;  3ONA B;  3S14 B;  3NBH A;  3NWS A;  1QNU A;  2AQ3 B;  4OO1 I;  5E4X A;  1TVX A;  3WDN A;  5CV9 A;  1Y8P B;  1ET6 A;  5D65 A;  5IOC A;  4A3B B;  4NKL A;  1C4Q A;  4FF3 A;  3J7Y W;  3MXG A;  2F0F A;  3VR2 A;  4F8M A;  1I6H B;  1RHP A;  1BR9 A;  3I73 A;  3DUZ A;  3SE0 A;  5ELB A;  1HXY D;  1CM9 A;  3S2H B;  3HKZ B;  5JOB A;  3OOC A;  2K01 A;  5DM7 3;  2JEB I;  5LL6 X;  5F2D A;  1YNJ C;  2EYM A;  3MVV A;  1ILP A;  2F0U A;  1G8Z D;  2A69 D;  5CMD A;  2C5C A;  2R93 B;  2WII B;  3S16 B;  1TQO A;  3K7A B;  1PLF A;  2EDG A;  1FNV A;  2XN9 C;  2B39 A;  2B63 B;  2NN6 G;  1U4L A;  1FNU A;  3HG9 A;  3IFD A;  3SHL A;  1B53 A;  1KAB A;  3Q0A A;  1WTV A;  4HSV A;  4IUV A;  2LMC B;  4BBR B;  2CQA A;  4FYD A;  3LX0 A;  3VR5 A;  2E2H B;  1HA5 A;  4PQX A;  2Z4H A;  5EKK A;  3NK9 A;  1LTI D;  3GTG B;  1M8A A;  3SXH A;  2EJF C;  1V1P A;  2K33 A;  4C1N K;  4L6T B;  1XWE A;  5D14 A;  1STY A;  3DWA A;  1A6X A;  2QDB A;  2NYZ D;  2O4X A;  2TSS A;  4GZY C;  3HOX B;  2AUJ D;  1HCZ A;  1JOR A;  4A3K B;  3S1R B;  1ZXT A;  5K36 H;  2BA1 A;  2EYF A;  2I46 A;  1O78 A;  4A3I B;  3QWN A;  3Q22 A;  5JEA J;  1PMR A;  1VF7 A;  1SFO B;  2JYO A;  5EBD A;  1F9P A;  5G3L F;  3QOJ A;  5C3E B;  3MXP A;  2RDG A;  1TS5 A;  4OIJ A;  2WB1 B;  3GTQ B;  1JE4 A;  1TWH B;  2K32 A;  3CRL C;  2EJG C;  3GO5 A;  2B8F A;  3GQB A;  3SK8 A;  3S1N B;  3NBI A;  5C0X H;  2F03 A;  1I50 B;  1WTQ A;  3DWP A;  2NB0 A;  3OWF A;  2JE6 I;  2A68 D;  5C3X A;  1OXT A;  1EY7 A;  3BVG A;  1WVL A;  1D5X C;  2E76 C;  1Y1W B;  1CT1 D;  3MXU A;  4RCN A;  3TME A;  2PZU A;  4DAP A;  2EY5 A;  2O2L D;  4J8Q A;  1AFP A;  1STE A;  1I4G A;  1YNN D;  4CKE A;  4DF7 A;  3BYY B;  2F0E A;  3S1M B;  2C9O A;  4PMB A;  1A15 A;  4ZYS A;  5KNC A;  2EY2 A;  1EQT A;  4ZLT F;  4H44 C;  5ISR A;  2IX0 A;  4OGQ C;  2F0S A;  4RFB A;  5T1G A;  1EY6 A;  3MFG A;  1OXS C;  4EVO A;  4OHJ A;  1RKN A;  4NW2 A;  3Q23 A;  1GOZ A;  4NDX A;  2HQE A;  3WOF A;  3GD7 A;  2L11 A;  3R93 A;  1ICW A;  2K5W A;  2B2W C;  3T13 A;  5C0X I;  1IL8 A;  1A2U A;  1RCV D;  2OT2 A;  3SK4 A;  5FK9 C;  2M00 A;  4C1N I;  1IW7 C;  3JAM L;  5C3W A;  2JSO A;  2F1M A;  2JP1 A;  4XYO A;  1TY2 A;  4IQZ A;  2A73 B;  3NSW A;  3ERO A;  4K5V A;  4RGN A;  5EBC A;  3PO3 B;  2K5Q A;  3RLF A;  5IGE A;  1SEB D;  1Z47 A;  1EQV A;  5ELC A;  1UEA B;  5JAV A;  1OO9 B;  2A6E D;  4RKB A;  3HP3 A;  3TZD A;  4P2C B;  5IGG A;  1K83 B;  4U68 A;  1SYE A;  3SK5 A;  3GTO B;  5TSS A;  5IGF A;  3J81 L;  1VDZ A;  5I6W A;  5JPN C;  5DM6 3;  1TR5 A;  1T5X D;  2EPB A;  3OIQ A;  1EYD A;  4C3J G;  3NWT A;  1PYW D;  1UNS A;  3HOW B;  3HOZ B;  4KY7 A;  2EY6 A;  1U9R A;  1XTC D;  3K58 A;  1ENC A;  1LTA D;  5A35 A;  2ICE C;  3CRK C;  1GUN A;  2EYJ A;  1EYC A;  5KYI A;  2O5I C;  1CZW A;  1HHV A;  1TT2 A;  4DU9 A;  3PUZ A;  3CQZ B;  4Q5V A;  1CHP D;  2B8G A;  1V1P B;  5FLX L;  1QWY A;  4RH6 A;  2DNC A;  5FO7 B;  3M4O B;  5J1Z A;  4BBS B;  4LAA A;  2CVR A;  2X6G A;  4OL7 A;  2F0G A;  3NTK A;  2XRQ D;  4KHV A;  4RGO S;  5M5Y B;  2H4O A;  1OXU A;  2KA7 A;  4RWS C;  1SYD A;  3S1Q B;  1E2W A;  2B2V A;  4FO2 A;  4RGM A;  4O1N A;  5IGB A;  1FD7 D;  2VB3 X;  4M8A A;  1ZYR D;  1LLR D;  1WTO A;  1R4Q B;  2AQ1 B;  2VUM B;  1ONL A;  2WAC A;  3J7A V;  2RDF A;  4BWG B;  1ROD A;  4LK1 C;  3O13 A;  2F0D A;  4QB4 A;  3VYT A;  1VCI A;  1V1O A;  5JJZ A;  1GHJ A;  2HCC A;  2KJX A;  4PMW A;  3I4N B;  1B1Z A;  1HA6 A;  2G9D A;  3VA7 A;  5BN3 A;  1I6V C;  2K05 A;  3EFX D;  2IX3 A;  1I3Q B;  2HUG A;  1STB A;  2BCO A;  2EE1 A;  2Z4I A;  5M9O A;  1VF5 C;  2R3Z A;  4X3U A;  5EKL A;  1TS4 A;  4S3S A;  5EPJ A;  4HCE A;  2EVB A;  1Z7T A;  1STG A;  1GUW A;  2JEA I;  2B2W A;  4M1U B;  1KDC A;  1S5C D;  2BA0 A;  2F0T A;  1SNO A;  2AQ2 B;  3GTM B;  1LTS D;  2LY7 A;  3VA5 A;  3C3L A;  1NR2 A;  1SBB B;  1S5B D;  5KGU A;  1AEX A;  2RQX A;  3BYT B;  2J4X A;  3J7A F;  3ZYY X;  3F2U A;  4DGZ A;  4HSP A;  2EYP A;  5BN5 A;  3D4R A;  5ELF A;  1LAB A;  4ME5 A;  5C4Z A;  2A5H A;  2EYO A;  3L3O C;  3I70 A;  2MHV A;  4B9W A;  4ULL A;  1UAP A;  1EIG A;  1JC7 A;  2DN8 A;  4WRD A;  2WIN B;  3RD4 A;  2EOT A;  1F77 A;  1K8O A;  3BVM A;  1XX8 A;  1IYU A;  1SNM A;  3MAQ A;  4XTC S;  3FPP A;  1AP0 A;  3VR6 A;  4KD4 A;  4K2K A;  4JBW A;  4JK1 C;  4QUF A;  1HTP A;  1PZI D;  3KBG A;  2KEC A;  3K5O A;  2OXP A;  4PMC A;  5CV6 A;  1Y8N B;  4BS9 A;  1G29 1;  3M7N A;  1ILQ A;  1Q1E A;  5LHY 1;  2K04 A;  1PTO B;  2ICI A;  3R2T A;  1CTM A;  4QCL A;  4ZAI A;  3I90 A;  1RJT A;  4FP5 D;  1C48 A;  3M7G A;  4QMG A;  2EYH A;  4C3J B;  3PMF A;  1GUS A;  2KED A;  3TDQ A;  1DCZ A;  3DHQ A;  3MC0 B;  1MD2 D;  1D5M C;  3VR3 A;  1H9S A;  1TWG B;  2MPM A;  2QKI C;  1I4X A;  3RZD B;  2A6E C;  2HCI A;  3ERQ A;  2G9H D;  4DAV A;  2BOS A;  3V05 A;  1H9K A;  4XT3 B;  1DZ1 A;  2XNA C;  3BDC A;  1EFI D;  4HED A;  1R9T B;  4WFN 3;  3T4A C;  4ZRZ A;  2N88 A;  4KD3 A;  2WV6 D;  1ESF A;  2L1B A;  4L8J A;  5JEA G;  2X69 A;  1RDP D;  4ODG A;  2RDH A;  3VYS A;  3V96 A;  1TU2 B;  4EGV A;  1JWS D;  4CKB A;  4F87 A;  3E5S A;  1DM0 B;  3K5L A;  3TP5 A;  2RA4 A;  3T16 A;  1T5E A;  4IN3 A;  5C5L A;  1EY5 A;  1UUP A;  3NUC A;  1HPC A;  3DEO A;  3FPU B;  3FMC A;  3H6M A;  4J6H A;  3C1E A;  3BS1 A;  1PTO F;  2GA4 B;  5KEE A;  2F0I A;  3P1H A;  2SOB A;  1LT4 D;  2H1E A;  1ML0 D;  3MXN A;  3U9S A;  2E2J B;  1ZYR C;  2KCN A;  4DK0 A;  4ZKB B;  4BA1 I;  3HEJ A;  5EKI A;  4KKU A;  1W6J A;  2D2C C;  3J80 E;  1B9M A;  4F88 A;  1IKM A;  1D2B A;  2PPB C;  1LT6 D;  2Y0S B;  3LNN A;  1KNA A;  2E75 C;  2SDF A;  1F2Y A;  2F0K A;  1NUC A;  1PTO C;  3KBX A;  5HUR A;  2K5D A;  2BE5 C;  1QCB D;  1I4R A;  3E0J A;  1C8C A;  3D4D A;  3EQL C;  4H7B A;  2MP1 A;  1QG7 A;  3FEW X;  3EVQ A;  1EIH A;  1G2S A;  5M3M B;  1H9J A;  5ELD A;  1IHZ A;  1F9R A;  1LTG D;  4X3T A;  1SNP A;  5C4H A;  1BCP D;  3NE5 B;  3TP6 A;  2FHT A;  4ID6 A;  2ZT9 C;  4CGY B;  5HGT A;  5DNF A;  4KN4 C;  5JEA H;  3QOL A;  1X3P A;  2XSC A;  3PO2 B;  2B2V C;  5D3I B;  3HGB A;  3D6W A;  3A55 A;  3BZD B;  1PRT D;  5FO8 B;  5EQ0 A;  1EU4 A;  1CHQ D;  2PZT A;  1HFG A;  2J0T D;  1B44 D;  1D6E C;  1KAA A;  5IIF A;  2D5D A;  2JXM B;  5I2X A;  3FDT A;  1A3T A;  2K6A A;  4G7Z C;  4XDX A;  4AYB B;  1CA6 A;  2K7V A;  2R61 A;  4B08 A;  2EZV A;  1L0X B;  2NN6 H;  1H9S B;  2IT1 A;  4K8J A;  1SMY D;  2F0W A;  3MA2 B;  1DJR D;  5C44 B;  4CHT B;  1U4M A;  3TN2 A;  1SYC A;  2PO4 A;  4A3G B;  4KV6 A;  2TMP A;  4K6D A;  4FNF A;  4HN7 A;  5I9O A;  3KUP A;  4FF4 A;  3M3Y B;  3PV0 A;  1D1I A;  3A56 A;  2K03 A;  1II3 A;  2WKD A;  3UI2 A;  5KYL A;  1X32 A;  5M3F B;  3QG1 A;  1GUO A;  4HR7 B;  2FFK B;  3OPO A;  5JPM C;  5EJW A;  1BQQ T;  4DXF A;  5CYU A;  4DXG A;  1O7Z A;  1O7L A;  4HAE A;  2JA5 B;  3MFY A;  4G4K A;  5EPL A;  2NUC A;  2NZ1 D;  1MI2 A;  4OIK A;  2B2U A;  4CJ1 B;  1CA5 A;  3GTP B;  4XIG S;  4FF2 A;  3I4M B;  3TBI B;  4UDU C;  5BN4 A;  4NMZ A;  1GUG A;  4J1M A;  2N55 A;  4HTH A;  1MBY A;  2CHB D;  2KHS A;  2NN6 I;  2PNR C;  4DNR B;  2NWG A;  1Z6H A;  1VMC A;  4A3M B;  4DA2 A;  5C4X B;  1LTR D;  1EOT A;  4I7Z C;  1J9O A;  2B2Y A;  3RMH A;  1U4R A;  3PIO 3;  2RSO A;  3R3O A;  3T53 B;  4BY1 B;  3A8J E;  3A8I E;  1A3U A;  2KVM A;  4XT1 B;  4IFD G;  2VXW A;  2F0P A;  1FGB D;  2IJ0 A;  3SR1 A;  1FR3 A;  2ZXP A;  3H91 A;  2F4I A;  3D6C A;  3P20 A;  2ENB A;  1CFM A;  1LV9 A;  2K28 A;  4XQQ A;  1NR4 A;  2XIW A;  2A69 C;  1EEI D;  4RCO A;  3PUW A;  3KF8 A;  3L7Z C;  2PW5 A;  1LTB D;  5IT9 E;  1GXD C;  2NTT A;  4UAI A;  1QB5 D;  1HQM C;  3LWE A;  3RUZ A;  2WKC A;  2PCF B;  2EXZ A;  1MSG A;  3H0G B;  2WAQ B;  4TSS A;  1PFM A;  1JOQ A;  3X3N A;  1GUT A;  3D3R A;  1BUV T;  5I6Y A;  4A3D B;  4OO1 G;  4IZ8 A;  1SE4 A;  3DMU A;  2PW7 A;  1LO5 D;  4A93 B;  5DEH A;  4QUC A;  1MGS A;  2PMZ B;  4XXE A;  1AZP A;  4NP5 A;  2L4N A;  4DNT B;  1PTO H;  2EY1 A;  4KN7 C;  1PRT F;  4ZUI A;  4ZQ3 A;  1S4Z A;  3LWU A;  3N52 A;  3X3M A;  2FIN B;  5FKA C;  1F2L A;  3OWE B;  4FXD A;  1W6K A;  3KLR A;  4CKC A;  1HUN A;  3K6O A;  3VR4 A;  3NQI A;  4IFD J;  1F9Q A;  4IUU A;  3KLS A;  2OF1 A;  3MZ5 A;  1WD0 A;  3A7L A;  4B9X A;  4K2L A;  1DD2 A;  3QIA A;  4K5X A;  2BDO A;  1BDO A;  3HOY B;  3PUV A;  1BF4 A;  4R8I A;  3N6R A;  1PRT C;  3S9W A;  3HZX A;  2A68 C;  4V19 0;  4G7H C;  2F0O A;  1SXT A;  1DON A;  2PYK A;  5M5X B;  4IUP A;  4C3I G;  4KKT A;  2KUM A;  1SNQ A;  1YNN C;  5JVG 3;  1MSH A;  4MHE A;  1JWM D;  5KIX A;  1IKL A;  2M9V A;  4FXG C;  4BY7 B;  2Q8T A;  1SMY C;  4MIU A;  4ILW A;  4C3H G;  3GTJ B;  4PV1 C;  1H9M A;  1Q1B A;  3K5N A;  3H94 A;  4Q0F A;  4QF4 A;  3QJY A;  1KDA A;  1EYA A;  4U67 3;  5A2Q E;  5IGD A;  1TY0 A;  5EGT A;  1SSO A;  3A8K E;  1SJH D;  1JIC A;  1LAC A;  4RHS A;  2HDM A;  2IL8 A;  2CW0 D;  3KK7 A;  3IL8 A;  3HS0 C;  3W2D A;  3L9A X;  4MN3 A;  1PZJ D;  2X6L A;  5I4D A;  1B2T A;  1O7Y A;  1WTX A;  3HOU B;  1BNZ A;  2R7Z B;  3CHB D;  1Q3L A;  2ZXO A;  3I72 A;  1DOK A;  4WOR A;  5CBA E;  3TP7 A;  1JCK B;  1SYG A;  4O42 A;  1JWU D;  1CK1 A;  3D8G A;  3KLS X;  1Y8O B;  4A3E B;  1D1K A;  1EY4 A;  5CV5 A;  2NVQ B;  1LT3 D;  2JA6 B;  2IWH A;  2YYZ A;  3SDZ A;  3MWY W;  1VMP A;  3OHX C;  5K36 G;  1XXG A;  2PZW A;  2QEJ C;  3NHH A;  1BXT A;  2ZXR A;  1Y1V B;  2L9H A;  2F0J A;  1JOK A;  2LS0 1;  4C56 C;  4RKL A;  2O5J C;  4HCS A;  4V0B A;  3AB9 A;  4IUT A;  4X3K A;  2E2D C;  4KI0 A;  3GTL B;  4C2M B;  1I4Q A;  5C0X G;  1LT5 D;  1BOS A;  2A74 C;  1KLG D;  3W3A A;  2YU9 B;  3CU7 A;  1EZ8 A;  3RZO B;  1PXU A;  3A7A B;  3BVZ A;  4F7X A;  2B2U C;  1DXM A;  2I07 B;  2J7Z A;  2M2L A;  1KLU D;  3QO2 A;  5CC4 A;  2F0N A;  1ZEQ X;  3OSO A;  5IGC A;  1EZ6 A;  4TKO B;  2R92 B;  4IUN A;  3GV3 A;  1SYF A;  3U9O A;  2Z1C A;  3H3V C;  3BG3 A;  4KY5 A;  2SNM A;  1E2Z A;  1WTW A;  1B9N A;  1TWC B;  4R8N A;  2L5T A;  3IAY A;  1AN8 A;  1S5E D;  2E2I B;  5COY A;  3S17 B;  1PZK D;  2KOL A;  2B2Y C;  4H13 C;  3J80 L;  1EL0 A;  3QB3 A;  4K6L A;  1AW7 A;  2B2T A;  2NVX B;  1JQY D;  4N9P A;  3T56 B;  4IAL A;  4FF1 A;  1TWF B;  3PUX A;  2IX1 A;  2MJ8 A;  3NQT A;  1PFN A;  1F2Z A;  4KTA A;  4A3J B;  1O80 A;  4C3I B;  4EQP A;  1A2T A;  2L12 A;  1DOL A;  1SE3 A;  4H0L C;  3S2D B;  5CGK A;  1EY0 A;  4KK7 A;  2XWB B;  3K57 A;  1AZQ A;  1GHK A;  5C0X J;  1EEF D;  4HMI A;  3OW7 A;  1WD1 A;  2BDN A;  2QIL A;  3VYU A;  4C3H B;  4R9W A;  1I4P A;  3ITP A;  3WOE A;  3TP8 A;  4N9T A;  2Q8I B;  1FNW A;  1TKW B;  2AWN A;  3FRP B;  2DY8 A;  1TS3 A;  5M5W B;  2DNE A;  2A6H D;  5DAU A;  3SK6 A;  3BDL A;  4EQN A;  3DEP A;  4IUQ A;  2LFN A;  2F0L A;  3GV6 A;  5I2Y A;  2V4D A;  1L0Y B;  5COR A;  2QF7 A;  2JA8 B;  4DAY A;  1JR0 D;  1SDF A;  3C46 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...