1JOKA

Averaged structure for staphylococcal nuclease-h124l in ternary complex with ca2+ and thymidine-3',5'-bisphosphate
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
149
structure length
149
Chain Sequence
b'ATSTKKLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQLLRKSEAQAKKEKLNIWSEDNADSGQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords staphylococcal nuclease
publication title Solution structures of staphylococcal nuclease from multidimensional, multinuclear NMR: nuclease-H124L and its ternary complex with Ca2+ and thymidine-3',5'-bisphosphate.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 23
structure length 149
sequence length 149
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2001-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1jokA00
2F0EA 2F0WA 5F2DA 2EYFA 1STBA 2OEOA 2F3VA 4J1MA 4RKLA 2EXZA 1TQOA 2EYJA 4KJOA 2EYPA 1EYCA 3SXHA 2EY5A 4HMIA 5M9OA 4I65A 5C4ZA 2PW7A 5C3XA 1EY8A 5CV4A 5CV5A 4EQNA 1EZ6A 4IALA 4QMGA 3NXWA 3QB3A 3SK6A 4IZ8A 3OMCA 1NSNS 2M00A 4F7XA 3ITPA 4IUNA 3D4WA 4K5XA 3QOJA 3LX0A 4B9XA 1SNPA 1KAAA 4TRDA 2F0KA 4ODGA 3NUCA 3DHQA 3EROA 2ENBA 2EYHA 4KHVA 4RKBA 5IOCA 5KGUA 4EQOA 2F0UA 3D6CA 3MEHA 5ISRA 4ZUJA 5IODA 1JORA 4G57A 1F2MA 4K6DA 5C3WA 5C6AA 2EY6A 3R3OA 4K8JA 1SNCA 4K5VA 3P1HA 4KY7A 3TP5A 5C4HA 4NDXA 3D8GA 5IGBA 1JOOA 1AEXA 3ERQA 4NMZA 4R8NA 5E3FA 1F2YA 4K2LA 3V2TA 3P75A 3T16A 5CGKA 1STGA 2KHSA 2QDBA 3NHHA 4N9PA 4PMBA 4QB4A 5KIXA 4NKLA 3SK4A 4F8MA 5KRUA 2PZTA 2LKVA 3H6MA 1A2UA 2SNSA 3MHBA 4HTHA 4PNYA 1A3TA 3E5SA 1KDAA 4WRDA 1SYCA 2F0FA 2F0DA 3TMEA 4DU9A 5K5PA 5EGTA 1F2ZA 1EY4A 2F0NA 5C5LA 5NUCA 1TR5A 1U9RA 2F0OA 5J1ZA 3TP6A 3SK5A 3SK8A 2WACA 3EJIA 5DEHA 1KDBA 1IHZA 1STYA 1NUCA 3EVQA 2PYKA 3PMFA 4J6HA 4KJNA 4OL7A 2PZWA 5CV9A 3S9WA 4WORA 1SNOA 1A3VA 3DMUA 4DFAA 3HEJA 5CC4A 5IGCA 3C1FA 4K2KA 1SYDA 2F0JA 2RDFA 5J39A 4EQPA 1EYDA 5EKKA 5KYLA 5KYIA 3C1EA 2F0VA 2OF1A 4KV6A 4KY5A 3SR1A 5IGEA 1EQVA 4K8IA 5IIFA 1SNMA 3VA5A 1EZ8A 5I9PA 4MIUA 4H7BA 5CV7A 1TT2A 5EKLA 1EY9A 4PMCA 3OMGA 3TP8A 2EYOA 4EVOA 2PW5A 1ENAA 1KABA 4ID6A 5IGDA 2PZUA 2F0PA 1RKNA 2F0SA 4K5WA 3T13A 5CV8A 5I6YA 5I9OA 1SNQA 4QF4A 3HZXA 3QOLA 5HURA 1A3UA 1EY7A 1EY0A 2F0MA 3MZ5A 4B9WA 2EY1A 5DAUA 4YIJA 5KEEA 4K14A 5E1FA 3NK9A 4ZQ3A 2NUCA 1II3A 2F0IA 4N9TA 2HQEA 2SOBA 1SYBA 2F3WA 2RKSA 3NQTA 2EYLA 3OSOA 4DF7A 4KTAA 4S3SA 5HGTA 4KD4A 1JOQA 3U9OA 1STHA 1SYFA 2F0QA 2OXPA 2O4XA 2EY2A 2KQ3A 2PQEA 1STNA 1SYEA 2F0LA 3BDLA 3D4DA 5CR3A 1ENCA 1A2TA 1EY5A 5CV6A 3MVVA 2EYMA 1JOKA 4KD3A 4ZUIA 5C5MA 5JOBA 5I6WA 3RUZA 5IGGA 3TP7A 3NP8A 2F0TA 1SNDA 2SNMA 2RBMA 3MXPA 4DGZA 4ME5A 5JAVA 5IGFA 5J22A 3OWFA 4HMJA 3BDCA 4E6IA 2F0HA 1EYAA 1SYGA 4KY6A 2F0GA 3SHLA 4LAAA 4NP5A 1KDCA 1STAA 1EY6A
chains in the Genus database with same CATH superfamily
2F0EA 1AN8A 3M85A 4RKLA 2EXZA 2N49A 3HFZB 3S2DH 1QOHA 4O42A 1VQ4A 2BH8A 5M5XH 3SGIA 5C4ZA 1WOCA 1SFOB 1DOLA 1BCPD 3CCEA 4A3LH 1PZJD 3BVGA 2RF4A 2XRSD 4B08A 1EYGA 4P74A 2XWJB 5GADC 4R9WA 1XXGA 1SJED 2ENBA 3I4OA 1XTCD 3FKIG 5I2XA 3RMHA 4G57A 4TKOB 4A3EH 2JA6B 3F2CA 4GS3A 1VQGA 3J80L 2LXJA 4BBRG 2K33A 2CH4A 2QKIC 4JV5Q 1E1TA 4RWSC 2MHVA 3SK4A 5IWAL 4DR6Q 5FLXL 1F2ZA 5M3MB 1V1PA 1HNXL 3HOZB 3SK5A 2KCCA 4A3MB 3I56A 3W2DA 2Z4IA 5C3EB 2L55A 1LM0A 2JA6G 4AIMA 4K2KA 1V1QA 1X3GA 3FRPB 1BUVT 1TWAH 1T5EA 3C1EA 2F0VA 4DR5L 4JYAL 1WTPA 5HGQA 1CA5A 4JI6Q 1EY9A 2R61A 3OOCA 1K8GA 1CKOA 5M3MG 3PO2B 3NE5B 4ID6A 1NCVA 3HOZG 3CAMA 1A63A 4V0BA 2HIXA 2KCNA 4A3MG 3S2DB 2RDGA 3MZ5A 5M5XB 2NUCA 5A2QE 3SVMA 2BA0A 4QIWB 3P20A 1GHKA 1EU3A 2OXPA 2H5XA 4LF8L 2PQEA 2OTJA 3M7GA 4PG3A 1OO9B 4R4QA 1OTCA 3I73A 2RVLA 1AP0A 4A3EB 3PO2G 4RH6A 1N33L 1JJGA 1YITA 3MXPA 1PVOA 1E0BA 1BBXC 1TS3A 1ZYRD 2R3ZA 2R93H 1XPOA 1IKLA 4OO1I 4A3LG 2C9OA 2OEOA 1RTNA 3F2UA 4IPDA 3J7AV 2B8FA 2MJ8A 2IX3A 2JYOA 1VQLA 4IJLA 2F52A 3SXHA 3I90A 3E0EA 2C35B 4A3EG 1B50A 3OMCA 1VQOA 1ZKOA 2DN8A 3D4WA 4JBMA 1VQJA 3FPPA 2L0CA 1BBWA 1TWAB 2C5CA 5AJ3Q 3H3VI 4CDCC 4P2CB 4APVA 4LUZA 2K01A 1W3SA 3MXNA 5JVH3 1J5EL 2NZ1D 2ES2A 2L12A 1IXRA 3TP5A 4POFA 5IYCH 4A76A 3U4VA 3T56B 2IY5B 1O7IA 2SDFA 1FR3A 3EN2A 3IKJA 4OWWB 4QB4A 3L7ZC 1X55A 1Y8OB 5KRUA 1HHVA 1SE4A 4X65Q 3KK7A 1SYCA 4JI5L 5JJLA 4DU9A 5K36H 1GUSA 3J81c 1WI5A 2MNAA 5DLQE 5NUCA 2MO0A 3VYSA 3EIVA 5JVG3 3PO3H 3CHBD 1WD1A 2PQAA 2B39A 2E5LQ 3PIO3 1ICFB 2D0OA 4GLAC 1B3QA 3D0FA 1H9RA 3I91A 3VA5A 2R93B 1TT2A 1QVGA 4R1JA 2J0TD 4RAUC 2QF7A 1UE7A 2AUJD 1R9TH 4X64Q 1KHIA 3OTOQ 4GKJQ 1G8ZD 3S1RH 1BVSA 3CC2A 4QF4A 4CDEC 4L5SA 3QR8A 3T4AC 3C46A 1HTLD 2MGSA 1IBLL 2EJGC 1IYJB 1F9PA 4JK1C 4QQBX 2EOTA 1STHA 5BN3A 1HZAA 1O80A 3M7NA 1N32L 3G7LA 3KF6A 3G6JB 2UUBL 2R93G 3HG9A 4GN3B 1QCBD 2Q8IB 4DUZQ 1LTGD 3S14H 3NP8A 2EIFA 1Y8PB 2KCMA 2F3IA 3O13A 1HZCA 3TS2A 4A3JH 1C8CA 2R6GA 2F0GA 1LTBD 2NN6I 3KLRA 3VA7A 4HCSA 3SDZA 4EX5A 5JJZA 3J81L 1S5FD 1I4QA 5M9OA 2KEDA 2PW7A 5C3XA 4QMGA 1PHJA 2OTLA 3QB3A 3PO3B 2UXDQ 4F7XA 1LACA 1A8VA 1HQRD 5ELCA 1W6JA 4TRDA 5IYCG 5D65A 1MJEA 5IE8A 4IUUA 3L9AX 4DR6L 3J7A5 4K8JA 1R9TB 5K36G 2VY3A 4G7OC 2HT1A 1K3RA 1PYWD 3S1RB 5I2YA 3KF8B 4JI3L 3FVQA 3NEMA 3IAYA 3K5MA 4CJ0B 1LTAD 3PO3G 5KNBA 1V43A 4IUQA 2F0NA 2N3SA 2HCCA 1U9RA 1L0WA 5LL6S 4B3RQ 3EJIA 4LFCQ 5DEHA 1SXTA 4DK3C 1OXSC 4JI6L 1JWSD 2X6GA 2B2VA 4IFDH 3HEJA 3HGBA 4MZ9A 1WCMH 2F0JA 1S5BD 2B29A 1EFWA 3S14B 1U4MA 3H0GH 5ELBA 5KYIA 4NXMQ 4KV6A 1VQEA 1TS2A 1JWUD 4K8IA 2EZVA 1EEID 5I9PA 4CKCA 2UU9Q 4A3JB 3S16H 3FEWX 1EQTA 2PW5A 4JCVE 2PZUA 3T13A 1UEBA 3ICEA 1JE4A 3AB9A 4PQXA 2A6HD 1Z9FA 1K83H 1Y8NB 3NENA 2I07B 2LXKA 4DN4M 1JB7A 3OSOA 4YCUA 1A0IA 1D1KA 2A6HC 3K7UC 1YNXA 3E9HA 4RHSA 3BDLA 1NE3A 4A3JG 1VMCA 3GTQH 1H9JA 1TY2A 5IY0A 1S5CD 1PFMA 3EFXD 3CCRA 1MSHA 4FF1A 1K28A 1YHBA 2WB1E 2WFWA 2HHHQ 3HOUH 4X3TA 2EYFA 3F2BA 1PTOH 4BY1H 3CPFA 4KJOA 2NVXH 3Q24A 4IFDJ 3S1NH 1EY8A 1HCZA 1X3QA 4DAYA 1DM0B 1WCMB 3ITPA 1CK1A 1LTTD 1HTPA 3VR2A 3A0JA 4JI8L 2F0KA 2WIIB 3H0GB 2RSNA 3X3MA 2EPBA 1J9OA 1X32A 3MEHA 5ISRA 2CWAA 5IODA 2KENA 4X65L 3S16B 1KXLA 1EQQA 1F2MA 4DR4L 3HOYG 1KNEA 1F2YA 2KCTA 5JPMC 1GUOA 4PMBA 2ALYB 2R92G 1EWIA 4BY7H 1EIFA 1JCKB 3S1QH 1YZ6A 2WP8J 4IFDG 1K83B 3DXJC 1WCMG 2IT1A 3H3VH 1EOVA 3H0GG 4DR2L 5ELEA 1HNZQ 1IBML 2CFMA 3RLNA 4R8IA 2QILA 1QUQB 3I7FA 4JOIC 1YNND 2K4KA 3GTQB 4X64L 5J39A 5GAHC 2PMZE 2O5JC 1CQVA 5KYLA 4R4OA 2OF1A 3RR5A 3H09A 1N9WA 3GTLH 1YNNC 1E2ZA 3U4ZA 3TN2A 2A8VA 4LFBQ 5IT9E 1WVLA 1E2VA 1KAWA 1D5ZC 3HOUB 1YHQA 1CKNB 1RKNA 5BN4A 1RDPD 3AFQA 3F2DA 3Q6SA 4FF3A 1PTOB 4BY1B 1Q86C 5ELOA 2NVXB 3S1NB 3STBC 3NK9A 2QEXA 3I2ZA 3G71A 4U68A 4DUZL 1SBBB 1VMPA 4JI0Q 1DCZA 1GKHA 1KLGD 2KUMA 1CM9A 1UUPA 2F0QA 3N52A 3TQYA 1ENCA 1L1OC 5IYBH 3HOXH 2HD3A 3CKIB 3HOUG 1CI3M 4DUYL 1PH9A 4KN4C 2ZTDA 1A62A 3R2IA 5COYA 5ELDA 1B9NA 1XMQQ 4BY1G 1AW7A 4E6IA 4UP8A 2OQ0A 4BY7B 1QWYA 4LF7Q 4PV1C 3S1QB 2JEAI 3K0XA 1TQOA 3A55A 1MKHA 1D7QA 3KJPA 4HMIA 4I65A 3DWQA 1ILPA 4NXNQ 2WAQE 4DNIA 2IHFA 2FINB 5IT9c 4N8X1 2UXBL 3MFGA 3VR3A 4ZK9B 1M90C 3KFUA 4HSPA 5FJ8H 3Q8DA 1DGSA 4RG1A 1MD2D 1PZID 5GAEC 3RLOA 2EYHA 3GTLB 2EE1A 5C3WA 4K6DA 5C6AA 3P1HA 5IGFA 1X54A 3OWEB 2DNCA 1GOZA 1PRTB 2JN4A 3T1YL 1I6HH 4B3RL 4LFCL 1WTWA 4PZ7A 2AMCB 4ZKCB 2J7ZA 1TR5A 4I7ZC 4U673 4DV0L 4X66Q 3W5OA 5FK9C 2UU9L 5CV9A 3RZOH 4MNOA 3RD4A 3HOXB 2K7VA 1H9SB 1N36L 4G4KA 1HRJA 2K5HA 4DAVA 5C0XH 3NQIA 5IIFA 1UE1A 1G2SA 2ASBA 5ELNA 4LF5Q 3E0JA 4L63B 3PIP3 1L0XB 4BS9A 1XX8A 4RCOA 4LF9L 1CUKA 3I3CA 1SNQA 1PDQA 1Q1EA 3F1ZA 5DNFA 1N34Q 3H15A 2XWBB 1KTKA 1DOKA 2IX0A 5KEEA 4IUPA 3HOXG 3BS1A 3J7AF 1QVFA 1JJCB 5JJKA 4AYBB 3CRLC 4S3SA 5HGTA 4CKBA 1G291 1SYEA 2F0LA 2A19A 1HXYD 2FJ2A 4IURA 1LABA 2UXCQ 2HHHL 2ICIA 3K59A 2OT2A 5EPLA 4A3BH 4ME5A 1RJTA 3HS0C 5EQ0A 1PH3A 5LMNW 1I6HB 1H9KA 3RLFA 1C7YA 4LAAA 1EIYB 2KOLA 4AYBG 5FOBB 4LJZC 2ZJPA 3GV3A 5FJ8G 2NTSA 2B63H 1H9MA 2B8GA 2PCFB 2JEBI 3S17H 4ABNA 4DV7L 2VS1A 4IALA 4BXXH 3RZOB 2WINB 3UE0A 5C0XJ 1C4QA 1NMGA 3C2PA 1NSNS 1A6XA 3PUWA 2JA5H 3NUCA 2AHOB 5TSSA 2OCEA 4RMFA 3TBIB 1WYDA 4F87A 4OXPA 2FMMA 4A3FG 1QVCA 4XT3B 5C4HA 1JJ2A 4NMZA 4ZYSA 1Q7YC 1DOMA 5KIXA 1HNZL 2AUKA 3A7AB 1A2UA 2ZTCA 3AYHB 2K5NA 5EGTA 2DY7A 4XQQA 4FO2A 3D4RA 3TP6A 1U4LA 3V96A 2ZM6Q 5C0XG 1J8IA 1BQQT 2E74C 4LFBL 5BR8Q 1F2LA 1KLUD 2XNAC 4A3BB 1KNAA 3RNUA 1BDOA 4A3DH 1Y1VH 1EZ8A 2NTTA 1Q8KA 3TP8A 5J3BA 2RCFA 3PF5A 4GOPB 3R2TA 3M4YA 4JI0L 4JVZA 5G3LF 1VQ7A 4AQYQ 1ESFA 3HZXA 1VCIA 2EJFC 3QG1A 2F0MA 2B63B 1IBKQ 1U4RA 3S17B 2K1BA 2K6AA 3M3YH 1JOQA 4A3BG 1YI2A 3IFDA 5FO7B 3AFPA 1JORA 2EY2A 3TDQA 5CR3A 5IGBA 2JA5B 3D6WA 1G6PA 1FYCA 3S2HH 2EYMA 1EOTA 1Z7TA 2MUYA 4ZUIA 2VNUD 2IWHA 3MEFA 1MI2A 3HKZE 3PUZA 1DZ1A 2SNMA 3K5OA 4G7HC 4IO9A 1DONA 5CBAE 2QA4A 3S24A 1AZQA 5C3EG 2AWNA 4NXNL 4JBJA 4BXXG 4ZKBB 2SEBD 1UEAB 4JPBW 3W1BA 2VB2X 2JA5G 1FNVA 3ONAB 4DV5Q 4OIJA 2UUAQ 4L8JA 1SR3A 2K50A 1EZ6A 1FVIA 2QW7A 3KDFB 2VUMH 1PH5A 2MPMA 3LX0A 1GUGA 4KMUC 1RF2D 3DHQA 1Z6HA 4A3DB 1Y1VB 2F0UA 4FXKC 4GZYC 1SNCA 4KY7A 1ENFA 2PI2E 2VQEL 3MXUA 3A5UA 4DV3L 1STEA 1K9MC 1ILQA 1QILA 2GVBA 4JOIA 4LUVA 1B7YB 4HTHA 4JW0A 4HIKA 1Q90A 1EY4A 1TXYA 1AH9A 1P16A 1PH8A 1O7LA 2A6ED 5KNCA 3M3YB 1V9PA 1GJXA 4A3DG 1IHZA 1Y1VG 4KKTA 3S2HB 2YTXA 2XGTA 5CC4A 4LF5L 2A6EC 4DFAA 4GOPC 5FO8B 1EYDA 4XYOA 2IX1A 2JA9A 1K3BC 1R4QB 4DPGA 1PFSA 1N34L 4A3IH 1JMCA 1JR0D 1HR0L 1TIID 1UWVA 1X3EA 1XJVA 2X69A 1C48A 4QIWE 5IGDA 4DNRB 1PTOF 3PUYA 1XPUA 1EU4A 1L1OA 4FYDA 1UAPA 2QEJC 1TWCH 2F03A 5HURA 3NTIA 5LMUQ 1I4XA 5DAUA 1VQNA 1FJGQ 1II3A 3U9SA 4LUOA 4X6AH 1NMFA 2UXCL 1G2TA 5LMNQ 1GHJA 1WTRA 2VUMB 1HPCA 3UDIA 4GKKQ 1G6ZA 2KQ3A 3JAMi 3D4DA 1RD9D 4B3TQ 1ONLA 4H02A 3JAME 2ZT9C 3U50C 3BVMA 2JXMB 1RCVD 3WWVA 3J7ZC 4LFAQ 1K73C 4JI1L 2LSSA 4XQNA 1M1KC 4OX9L 2D0PA 1EY6A 3OW2A 1ZEQX 1JE5A 4I7AA 2VUMG 1K0SA 1NAPA 1DD2A 2GN5A 1NR2A 2HIVA 2JA7H 4OIKA 2IL8A 1JWMD 5ELFA 1V8QA 2MP1A 5CORA 2L11A 1QUQA 1PH6A 3QOJA 1T9HA 1KAAA 5C44H 3BYYB 5LL6X 5A2QL 4A3CH 2M9VA 4Q0FA 1NBWA 4YWKA 5IP7H 4A3IB 4GN5A 3EQLC 3H91A 1PRTF 1X65A 3R3OA 2Y0SB 3NPPA 1AEXA 3URYA 1TWHH 3B6YA 4C2MH 4XDXA 4JG2A 5FLMH 3ULJA 1TWCB 1VQAA 4DR3Q 4J15A 4ALPA 1KQSA 2CHBD 3CCJA 4XQJA 3JAMc 4FF2A 1HZBA 2Z4HA 5C5LA 2MO1A 3CPWA 1P8LA 2EXDA 2R7FA 3TZDA 1PFNA 3CQZH 1KD1C 3R93A 2Q2TA 1V1PB 2ZXPA 4JV5L 2DY8A 4K0KQ 1H95A 4A3IG 1EFID 1D8LA 4DR1Q 3NBHA 2Y0SG 2BOSA 3J81j 1MBYA 4AQYL 4P71A 1S72A 4HJ7A 2F4VQ 2NVTH 2D2CC 1W2BA 3TEHB 1IBKL 3OMGA 1D5MC 1I6VC 3GTJH 1YJNA 2E75C 2KECA 3X3NA 4QY7A 5DM63 4DAMA 2JA7B 2K5DA 2HQEA 1SYBA 3NQTA 1IKMA 1VQDA 4PZ6A 3NWSA 4KN7C 1TWFH 1STNA 3K0YA 5C44B 2B2UC 2CKZB 2WB1B 3M4OH 1FNUA 3DM3A 5C5MA 2D62A 1E3PA 1V1OA 2BH2A 2PO4A 4K6LA 4KKUA 3DLLA 5JAVA 4EQ5A 2E8GA 1TWHB 3OWFA 4C2MB 3CRKC 4CJ2C 2JA7G 4P75A 4TQUS 4DV5L 2UUAL 1HA5A 2MQHA 5KGUA 4XIGS 4N9TA 5D3IB 3CMEA 1VF5C 1OXXK 4PZ8A 5C4JH 3JAML 1HJPA 1L2FA 4NB3A 3VDYA 1EYCA 3K8AA 2NB0A 4UP7A 4A3CG 3CQZB 4H0LC 2LFNA 1D2BA 5CV4A 4POGA 5IP7G 1SE2A 4A93H 5KNDA 2VXWA 2EQSA 2M00A 1SE8A 3BVZA 3C3LA 1C9OA 3BDOA 2CVRA 1RODA 2WV6D 2L4NA 3NELA 1NY4A 2N88A 1XMOQ 2NVTB 3BU2A 4DR7Q 3GTJB 3MFYA 3A7LA 3MXNB 2N55A 2G5DA 2AWOA 4NDXA 4JI4Q 2NWGA 2BCOA 3CC4A 4OEMB 4F88A 1F9RA 2K52A 3NHHA 1GUWA 3W3AA 4IPHA 5AJ3L 1YHAA 2VL6A 3MHBA 4UY8C 1S3OA 1Q3LA 2HUGA 4A3KH 3FMCA 2PMZB 4DNTB 4HIMA 4C1NI 5LHY1 2PPBC 1MGSA 2KBNA 4H13C 1TWFB 2WACA 1S40A 4OO1H 1STYA 2JSOA 1SAPA 4XYQA 1A3VA 2YTYA 3M4OB 2K05A 3S1MH 3C1FA 4EQPA 2A68C 1ICWA 5AFWA 2RA4A 2K5QA 3DWAA 2PQAB 1KRSA 4JI2Q 4DK1A 1RIPA 1TS5A 1M8AA 2XVSA 4PMCA 1JC7A 3HRZC 4FXDA 2F0PA 2DJFC 4B3SQ 2E5LL 5C4JB 3S15H 2ID0A 1KL9A 2TMPA 1A3UA 1EY7A 1VF7A 3A56A 2EY1A 5DM73 3TSSA 2YTVA 5E1FA 3Q0AA 4B3TL 4RGOS 5G3LD 2Z8LA 5GROA 5M3FH 4A93B 3D31A 1WTVA 3OTOL 4GKJL 2O4XA 4DV4Q 4LFAL 5CV6A 4KKSA 2I5MX 1GO3E 2ZJRA 5I6WA 3M4QA 4FXGC 1SNDA 3STBD 4IN3A 4HJ8A 1WTQA 4HMJA 4RFBA 1PLFA 2WAQB 4LK1C 1AE2A 2YYZA 5EKIA 4A93G 2PNHA 4YCWA 3CCMA 2F3VA 4A3KB 1UE5A 1B70B 2A74C 2B2TC 2EYJA 2F1MA 2DUDA 1VQ6A 2EY5A 1CTMA 4A3GH 1X3PA 4MHEA 4YCVA 1PYSB 3S1MB 4DV6Q 1HA6A 2BDOA 1BXTA 4BA1I 1JICA 3OYYA 4GNXB 4DKAC 5IWAQ 4KHVA 2NYZD 2LMCB 3KYHC 4HJ9A 4DXGA 1HNXQ 2NVQH 3I8ZA 4A3KG 3D8GA 1CKMA 1QNKA 2G9DA 4P72A 1QG7A 4K2LA 2UXDL 1AE3A 3V2TA 2QDBA 5T1IA 4GOPA 1D6EC 3S15B 1U4PA 1K8OA 4OO1G 2PZTA 2LKVA 5GAGC 1VQBA 2CQAA 4OWXB 1IYVA 1O7YA 1X6OA 5M3FB 1XNRQ 1PH7A 3SK8A 3EVQA 3UI2A 4EVOA 3DEPA 2PZWA 2NN6H 1UNSA 1SNOA 4BY7G 1IL2A 1M4VA 3OW7A 1W6KA 4KY5A 2RHSB 4FF4A 1B4OA 4PMWA 5EKLA 4RGMA 4IPCA 4O0AA 2E2JH 5M3FG 1Q81C 4XTCS 3FDTA 5I6YA 5I9OA 4LF8Q 1MSGA 4NXML 1MIUA 3MTSA 3RN5A 4Y7NH 2A69C 4A3GB 1VQIA 1PTOD 1C0AA 4P73A 1D1IA 3PF4A 1HUNA 4IUTA 1PTOC 3KDFA 2JA8H 3OIPA 1EIHA 4R4IA 5D14A 1NR4A 4FVMA 1CHQD 5JOBA 4ZLTF 1WJJA 3RUZA 1SSOA 1TY0A 2NVQB 2D9UA 1EUJA 5FLXE 1NTGA 1VQCA 1SLJA 3G4SA 4MN3A 5I4DA 5IYBG 2Z6BA 1LT4D 4MTKA 5F2DA 3GQBA 1STBA 3MAQA 4KI0A 5IT9L 4GNXC 1BCPB 1J5EQ 2RCNA 4EQNA 1XMOL 2EJMA 5HY6A 3UDFA 3SK6A 4BBRH 3H3VC 4JI4L 2V4DA 4DAYB 1O78A 1MJCA 2QGQA 1HNWQ 2L1BA 4HR7B 4DV2Q 3D6CA 4LMQD 2Q2HA 2E2JB 3ERQA 3JC66 3P75A 5CGKA 1NNXA 3D3RA 3PUXA 1D5XC 1PRTD 3AEVA 3M9BA 3I70A 4Y7NB 2NN6G 5K5PA 2F0FA 3CW2C 2EDGA 1PRTC 1BR9A 3BJUA 3I4LA 4JI2L 5FLXc 2JA8B 1HFGA 2K75A 4J6HA 4KJNA 2PYKA 2B2WC 5CBEE 3DMUA 1PH1A 2Z0SA 2A73B 1PFBA 2RDFA 5EJWA 4B3SL 2JK8A 2N8NA 1LTID 4JC0A 1E2WA 1X56A 3CP0A 1VQ8A 2UUCQ 1TWGH 2JE6I 2YV5A 2ZTEA 1EEFD 5L37A 3ZJYC 3FP9A 2B3GA 2KJXA 1B3AA 1Y14B 2IPKD 3IL8A 3BZKA 3CCLA 1I50H 2B2UA 5EBDA 5BN5A 1S4ZA 2UUBQ 3QWNA 4RA8A 4ILWA 1WD0A 4DV4L 4B9WA 1EY0A 1PV4A 3MWYW 3WDNA 3VR6A 4DXFA 2IJ0A 1I4HA 3HKZB 2F3WA 2EYLA 1JT8A 1SMYD 1B44D 4IPGA 4BBRB 1IZ6A 3G6EA 3NTKA 3ND9A 1PMRA 4RGNA 1EY5A 3NWTA 2G9HD 1B53A 1TU2B 3MVVA 1SMYC 4HIDA 4KD3A 4L5QA 1EWHA 2ZXOA 4CGYB 3TP7A 1LTLA 2F0TA 3KOJA 4BWGB 2RBMA 4YWLA 1BCPC 1LT3D 4X62Q 1BO0A 4L6TB 1EYAA 4X3UA 1DYQA 3HKZG 2ZJQA 1VQ5A 1QJOA 5FO9B 2K32A 1XWEA 4B3MQ 1J6QA 4BBSH 3K80C 4IFDI 4DV6L 2OWOA 1EWCA 5M5WH 1XMQL 3F8TA 5E4XA 3VYRA 5EPJA 4L5RC 4LF7L 4IZ8A 3K5LA 3CC7A 1I94Q 2O2LD 4ODGA 1I4PA 4JI3Q 4UP9A 5IOCA 4RKBA 2B63G 1TWGB 5EBCA 3KF8A 1XYIA 3QJYA 1XNRL 1I50B 3BG3A 2NBFA 3HKSA 3NSWA 3K5NA 3GDEA 4NKLA 3T53B 1IW7D 4F8MA 3N6RA 3LNNA 3IRBA 1E24A 5IP9H 1KDAA 3DUZA 3SE0A 2F0DA 1IW7C 3LGJA 3RN2A 1SDFA 3UDGA 3WOEA 1Z47A 3PMFA 3TZUA 4OL7A 4WORA 1LO5D 5IGCA 3OIQA 4R4TA 1K8MA 3J81i 5GQOA 1SNMA 4X66L 3J81E 3CCVA 1FGUA 2HDLA 1YJWA 2AQ2B 4IJHA 1SJHD 5JJIA 2VQFQ 1KABA 2F0SA 3CCQA 4BBSB 2I5HA 3GTGH 2RQXA 2KEEA 3R8BA 1OXVA 5E4WC 2YU9H 3GP7A 5M5WB 4TVAB 1EQRA 1ZYRC 1FGBD 2SOBA 4KLKA 1R4PB 4A75A 4LF4Q 1WTHA 2J4XA 3U58A 1SYFA 3CD6A 2XN9C 2Z6KC 1A2TA 2RDHA 5CMDA 2NVYH 2B2TA 5IGGA 2I46A 4BBSG 3WOFA 4DGZA 1PXUA 2BDNA 4C3JH 1LT6D 4WJ3M 2M2LA 1E7ZA 1SYGA 1DJRD 3L2PA 4HAEA 3SEBA 2E2IH 1T5XD 2KVMA 1MHWC 1ASYA 3V05A 3A8IE 4JI8Q 2L9HA 1B8AA 3GTMH 2QDLA 3GTOH 1QZGA 4YHHQ 2WKDA 1SN8A 3K6OA 1QE6A 1HNWL 1SROA 1A15A 4DV2L 4DV1Q 4DR4Q 5A35A 4M8AA 3TRZA 4HN7A 1PH4A 1BKBA 4IUNA 2I0QA 1E1OA 1I3QH 2FXQA 2BA1A 3GTKH 3T51B 2X6LA 3I4MH 3A74A 3TS0A 4C1NK 5IP9G 3PGZA 1CZWA 4XT1B 1BOSA 4DR2Q 1IBMQ 4N9PA 2KHSA 3GTGB 1GVPA 3MA2B 3CMAA 3ULPA 3T1HQ 2YU9B 1AFPA 2F4IA 2SNSA 3A8KE 2IHEA 1LYLA 3E5SA 4WRDA 3BZDB 3TMEA 3K7AH 1WTXA 1SEBD 2F0OA 4OONA 1RHPA 2UUCL 4IOAA 4JI7Q 1VQ9A 4LF6Q 2NVYB 4UPAA 1Q46A 2JJQA 3PQIA 2Z9HA 1QB5D 1Q1BA 1EL0A 3L0OA 4C3JB 2ZM6L 1CKNA 1VQPA 2EYOA 3Q22A 2E2IB 1S5ED 2B2YC 4DK6C 4LNQA 5BR8L 2K28A 1Y1WH 3GTMB 3TREA 3DM1A 1FNWA 1WTOA 3GTOB 4GN4B 4FP5D 1HQMC 3PIOA 3UDXA 1B2TA 2F0IA 4DUYQ 3PUVA 4Q5VA 4X62L 1I3QB 2NZOA 4C3JG 3GTKB 1JB3A 4Z9CB 2AQ3B 1S5DD 2ATWA 3I4MB 4QUFA 3ZYYX 1X9NA 4GNXA 4B3ML 4XXEA 4J8QA 4DAPA 3AQQA 2KHJA 1DXMA 2F0HA 2UXBQ 1KDCA 3QO2A 4UDUC 2N78A 1BCPF 3K7AB 5JPNC 1I94L 2E2HH 2EYPA 1ESRA 1ET9A 1XNQQ 3UE1A 5C0XI 1F77A 3I4MG 5CV5A 2H4OA 3HOYH 2OQKA 1F9SA 2Y0SE 4IUVA 4K5XA 3T1YQ 1SNPA 2R92H 1VDZA 1LLRD 4O1NA 1OXUA 1HFNA 4CKEA 1G51A 1LUZA 4LWCA 3BZCA 4YY3Q 1JQYD 3GV6A 1QNUA 2E2DC 2XRQD 4DV0Q 1YNJD 5EPKA 1STGA 2B2WA 1Y1WB 5EAYA 5C44G 2I5LX 4PNYA 2WB1G 1VQKA 1A3TA 4GLVB 1N36Q 2CCZA 1U5KA 1YNJC 1I4GA 3HOWH 4V190 1O7ZA 2HQLA 3BYTB 3A5ZB 1L0YB 1H9SA 1KDBA 1NUCA 2A1AA 5FLMG 2WKCA 1LV9A 4LF9Q 1HUMA 2VQFL 2E76C 3PCOB 4HCEA 4G7ZC 1B1ZA 3FHWA 4IOCA 1PYBA 3KBXA 1Y1WG 3GTPH 1WFQA 4IQZA 1FL0A 5IGEA 2K04A 3K58A 4MIUA 5CV7A 3E6ZX 4OWTB 4C3IH 1KC8C 1GM5A 4BA2I 3KLWA 1HR0W 2KA7A 1CA6A 1PA6A 4LF4L 2EVBA 4OHJA 2E2HB 2TSSA 1L1OB 2A68D 4YIJA 1K8AC 4N8FA 1I4RA 4HSVA 3IFTA 2RKSA 4KHPQ 1U0LA 3HOYB 1VQMA 3HOVH 4ZCKA 3ULLA 2DJGC 2R92B 1Q8IA 4HJAA 5LMUL 2RSOA 2DNEA 4R4CA 4WJWA 4CBVA 1FJGL 1GXDC 1XPRA 1BBUA 5LMNL 4HJ5A 1Y69U 4OGQC 1Q82C 4YWMA 4GKKL 4DV7Q 4YHHL 3I4NH 2RHQB 3GO5A 3SHLA 4AH6A 1NJIC 5CYUA 4NP5A 4DV1L 1BNZA 1X3FA 4DA2A 3HOWB 2CQOA 1CFMA 3KUPA 2VW9A 1F9QA 3M4PA 1YVCA 3GD7A 3KF6B 4ME3A 4QUCA 4B9XA 3KLSA 4A4IA 3GTPB 2FMCA 2XSCA 2Z1CA 1CQFA 4EQOA 3T1HL 1LT5D 4ZUJA 1ML0D 3H94A 2EY6A 2XTIA 2ICEC 4C3IB 3HOWG 1ASZA 2CWPA 5E3FA 1N8RC 3CF5A 1CSPA 2IW3A 3NTHA 2Q8TA 1E22A 3QIAA 3CCUA 4JI7L 4LF6L 1SMXA 4CDDC 1YBYA 3MC0B 1LTRD 2CW0D 3W1GA 3HOVB 1ZXTA 5J1ZA 3RZDH 2WAQG 5JEAH 3S9WA 3AMUA 1SE3A 2CW0C 2Q8RE 4QL5A 1CZGA 2AQ1B 4DR3L 4HEDA 4C3IG 1CHPD 3DEOA 5C4XH 2P5ZX 2L5TA 3CXCA 1G91A 3NBHB 4LW1A 1VS0A 1CT1D 4RGTA 5IYDH 3I4NB 4K0KL 4UHVA 1KRTA 4EGVA 1TVXA 4DR1L 5CV8A 4DR5Q 2Z6KA 2VB3X 3HOVG 4JYAQ 5M5YH 2QCPX 3FPUB 3CCSA 1YIJA 4Y52H 2F4VL 3G48A 4DK0A 4C3HH 1OXTA 3L3OC 3LWEA 3U9OA 1HH2P 4OELB 4RCNA 5E7NA 2PI2A 2FFKB 3SR1A 2GVAA 1PH2A 1KIXA 2O5IC 3ERSX 3I4NG 4WFN3 3J7YW 4QCLA 1GD7A 3KLSX 4WJ4A 4ZRZA 4M1UB 2A69D 4ULLA 2D5DA 2L15A 2MFIA 4QGUA 1EIGA 4X3KA 3BDCA 5D3DA 2GA4B 3Q23A 1VQHA 1XNQL 1XTDA 2HCIA 1GUTA 1N33Q 2F0WA 1BF4A 3EBEA 2R7ZH 4RHRA 1Q12A 4J1MA 2JQOA 5H1SE 5JEAJ 3A8JE 4CDFC 2NZHA 5T1GA 3J80i 1TS4A 3OPOA 4A3FH 2ZXRA 3J80E 3RZDB 1RTOA 2VQEQ 4NPSA 3NXWA 4UAIA 1I5FA 4YY3L 1SRUA 2H1EA 4DV3Q 2HDMA 3CU7A 2R7DA 4ZAIA 5C4XB 3K81C 3EROA 3PSIA 1K0RA 4A3GG 2A5HA 4L5TA 4FNFA 4K5VA 1AZPA 1JOOA 2KHIA 1RL2A 2AKWB 4R8NA 5FKAC 3T16A 2FHTA 3VR5A 4CJ1B 4O2DA 5M5YB 4H44C 3FKIH 3H6MA 5JEAG 2K14A 3KJOA 1YJ9A 4DR7L 1LTSD 4C3HB 4HIOA 5C4XG 4GLXA 4JBKA 1IYUA 1CSQA 2BE5D 1SFOH 1HR0Q 1TKWB 4FDBA 5IYDG 2B2YA 2V1CC 4JI5Q 2Q2IA 4QJFA 3AU7A 1SYDA 2BE5C 5EKKA 1HZ9A 2K5WA 3LWUA 1B9MA 3VYUA 3ER0A 1EQVA 4H7BA 3HP3A 2K5VA 2JA6H 3ND8A 2LS01 1ENAA 3J80c 4K5WA 4C3HG 3PV0A 2B2VC 4KK7A 2K03A 1VQFA 4KHPL 2R7ZB 1GUNA 1IL8A 3P7JA 3EA6A 3E3XA 3QOLA 1UE6A 3A54A 4MTNA 3VR4A 4K14A 4X3SA 4A3FB 4ZQ3A 3KBGA 3NBIA 5M3MH 3VYTA 3HOZH 4DF7A 1PZKD 4KTAA 3I72A 1FD7D 3I55A 4JI1Q 2JP1A 4KD4A 4NW2A 4KHZA 4A3MH 2Q2UA 1YEZA 5C3EH 4OX9Q 2LY7A 3PIPA 1IBLQ 4C56C 2VZAA 1JOKA 3OHXC 1ET6A 3DWPA 2XIWA 4AYBE 2R7ZG 4TSSA 3K57A 4CHTB 3MXGA 1N32Q 4JBWA 3E9IA 5J22A 1QZHA 2JA8G 2PNRC 4KY6A 2CH4W 3FKIB 1STAA 3PO2H 2DGYA
chains in the Genus database with same CATH topology
2F0EA 1AN8A 3M85A 4RKLA 2EXZA 1QOHA 4O42A 5C4ZA 1SFOB 1DOLA 1BCPD 1PZJD 3BVGA 2XRSD 4B08A 2XWJB 4R9WA 1XXGA 1SJED 2ENBA 1XTCD 5I2XA 3RMHA 4G57A 4TKOB 2JA6B 3J80L 2K33A 2QKIC 4RWSC 2MHVA 3SK4A 5FLXL 1F2ZA 5M3MB 1V1PA 3HOZB 3SK5A 2KCCA 4A3MB 3W2DA 2Z4IA 5C3EB 2L55A 4K2KA 3FRPB 1BUVT 1T5EA 3C1EA 2F0VA 1WTPA 1CA5A 1EY9A 2R61A 3OOCA 3PO2B 3NE5B 4ID6A 1NCVA 4V0BA 2KCNA 3S2DB 2RDGA 3MZ5A 5M5XB 2NUCA 5A2QE 3SVMA 2BA0A 4QIWB 3P20A 1GHKA 1EU3A 2OXPA 2PQEA 3M7GA 1OO9B 3I73A 2RVLA 1AP0A 4A3EB 4RH6A 3MXPA 1E0BA 1BBXC 1TS3A 1ZYRD 2R3ZA 1IKLA 4OO1I 2C9OA 2OEOA 1RTNA 3F2UA 3J7AV 2B8FA 2MJ8A 2IX3A 2JYOA 3SXHA 3I90A 1B50A 3OMCA 1ZKOA 2DN8A 3D4WA 3FPPA 2L0CA 1TWAB 2C5CA 4P2CB 2K01A 3MXNA 5JVH3 2NZ1D 2L12A 3TP5A 3T56B 2SDFA 1FR3A 3IKJA 4QB4A 3L7ZC 1Y8OB 5KRUA 1HHVA 1SE4A 3KK7A 1SYCA 4DU9A 5K36H 1GUSA 5NUCA 3VYSA 5JVG3 3CHBD 1WD1A 2B39A 3PIO3 1H9RA 3I91A 3VA5A 2R93B 1TT2A 2J0TD 4RAUC 2QF7A 2AUJD 1G8ZD 4QF4A 3T4AC 3C46A 1HTLD 2MGSA 2EJGC 1F9PA 4JK1C 2EOTA 1STHA 5BN3A 3M7NA 1O80A 3G7LA 3G6JB 3HG9A 1QCBD 2Q8IB 1LTGD 3NP8A 1Y8PB 3O13A 1C8CA 2R6GA 2F0GA 1LTBD 2NN6I 3KLRA 3VA7A 4HCSA 3SDZA 5JJZA 3J81L 1S5FD 1I4QA 5M9OA 2KEDA 2PW7A 5C3XA 4QMGA 3QB3A 3PO3B 4F7XA 1LACA 1HQRD 5ELCA 1W6JA 4TRDA 5D65A 4IUUA 3L9AX 4K8JA 1R9TB 5K36G 4G7OC 1PYWD 3S1RB 5I2YA 3FVQA 3IAYA 3K5MA 4CJ0B 1LTAD 5KNBA 1V43A 4IUQA 2F0NA 2HCCA 1U9RA 5LL6S 3EJIA 5DEHA 1SXTA 1OXSC 1JWSD 2X6GA 2B2VA 4IFDH 3HEJA 3HGBA 2F0JA 1S5BD 3S14B 1U4MA 5ELBA 5KYIA 4KV6A 1TS2A 1JWUD 4K8IA 2EZVA 1EEID 5I9PA 4CKCA 4A3JB 3FEWX 1EQTA 2PW5A 2PZUA 3T13A 1JE4A 3AB9A 4PQXA 2A6HD 1Y8NB 2I07B 4DN4M 3OSOA 1D1KA 2A6HC 4RHSA 3BDLA 1VMCA 1H9JA 1TY2A 1S5CD 1PFMA 3EFXD 1MSHA 4FF1A 4X3TA 2EYFA 1PTOH 4KJOA 3Q24A 4IFDJ 1EY8A 1HCZA 1X3QA 4DAYA 1DM0B 1WCMB 3ITPA 1CK1A 1LTTD 1HTPA 3VR2A 2F0KA 2WIIB 3H0GB 2RSNA 3X3MA 2EPBA 1J9OA 1X32A 3MEHA 5ISRA 5IODA 3S16B 1F2MA 1KNEA 1F2YA 5JPMC 1GUOA 4PMBA 1JCKB 2WP8J 4IFDG 1K83B 3DXJC 2IT1A 5ELEA 4R8IA 2QILA 1YNND 3GTQB 5J39A 2O5JC 1CQVA 5KYLA 2OF1A 3H09A 1YNNC 1E2ZA 3TN2A 5IT9E 1WVLA 1E2VA 1D5ZC 3HOUB 5BN4A 1RKNA 1RDPD 3Q6SA 4FF3A 1PTOB 4BY1B 2NVXB 3S1NB 3NK9A 4U68A 1SBBB 1VMPA 1DCZA 1KLGD 2KUMA 1CM9A 1UUPA 2F0QA 3N52A 1ENCA 3CKIB 1CI3M 4KN4C 3R2IA 5COYA 5ELDA 1B9NA 1AW7A 4E6IA 4BY7B 1QWYA 4PV1C 3S1QB 2JEAI 1TQOA 3A55A 4HMIA 4I65A 3DWQA 1ILPA 2FINB 3MFGA 3VR3A 4ZK9B 4HSPA 1MD2D 1PZID 2EYHA 3GTLB 2EE1A 5C3WA 4K6DA 5C6AA 3P1HA 5IGFA 3OWEB 2DNCA 1GOZA 1PRTB 1WTWA 4ZKCB 2J7ZA 1TR5A 4I7ZC 4U673 5FK9C 5CV9A 3HOXB 3RD4A 2K7VA 1H9SB 4G4KA 1HRJA 4DAVA 5C0XH 3NQIA 5IIFA 1G2SA 3E0JA 4L63B 3PIP3 1L0XB 4BS9A 1XX8A 4RCOA 3I3CA 1SNQA 1PDQA 1Q1EA 5DNFA 2XWBB 1KTKA 1DOKA 2IX0A 5KEEA 4IUPA 3BS1A 3J7AF 4AYBB 3CRLC 4S3SA 5HGTA 4CKBA 1G291 1SYEA 2F0LA 1HXYD 2FJ2A 4IURA 1LABA 2ICIA 3K59A 2OT2A 5EPLA 4ME5A 1RJTA 3HS0C 5EQ0A 1I6HB 1H9KA 3RLFA 4LAAA 2KOLA 5FOBB 4LJZC 3GV3A 2NTSA 1H9MA 2B8GA 2PCFB 2JEBI 4ABNA 4IALA 3RZOB 2WINB 5C0XJ 1C4QA 3C2PA 1NSNS 1A6XA 3PUWA 3NUCA 5TSSA 3TBIB 4F87A 2FMMA 4XT3B 5C4HA 4NMZA 4ZYSA 1DOMA 5KIXA 2AUKA 3A7AB 1A2UA 5EGTA 2DY7A 4XQQA 4FO2A 3D4RA 3TP6A 1U4LA 3V96A 5C0XG 1J8IA 1BQQT 2E74C 1F2LA 1KLUD 2XNAC 4A3BB 1KNAA 1BDOA 1EZ8A 2NTTA 3TP8A 3R2TA 3M4YA 5G3LF 1ESFA 3HZXA 1VCIA 2EJFC 3QG1A 2F0MA 2B63B 1U4RA 3S17B 2K1BA 2K6AA 1JOQA 3IFDA 5FO7B 1JORA 2EY2A 3TDQA 5CR3A 5IGBA 2JA5B 3D6WA 1FYCA 2EYMA 1EOTA 1Z7TA 2MUYA 4ZUIA 2VNUD 2IWHA 1MI2A 3PUZA 1DZ1A 2SNMA 3K5OA 4G7HC 1DONA 5CBAE 1AZQA 2AWNA 4ZKBB 2SEBD 1UEAB 2VB2X 1FNVA 3ONAB 4OIJA 4L8JA 1EZ6A 2MPMA 3LX0A 1GUGA 4KMUC 1RF2D 3DHQA 1Z6HA 4A3DB 1Y1VB 2F0UA 4FXKC 4GZYC 1SNCA 4KY7A 1ENFA 3MXUA 1STEA 1ILQA 1QILA 4HTHA 1Q90A 1EY4A 1O7LA 2A6ED 5KNCA 3M3YB 1GJXA 1IHZA 4KKTA 3S2HB 5CC4A 2A6EC 4DFAA 5FO8B 1EYDA 4XYOA 2IX1A 1R4QB 1JR0D 1TIID 2X69A 1C48A 5IGDA 4DNRB 1PTOF 3PUYA 1EU4A 4FYDA 1UAPA 2QEJC 2F03A 5HURA 3NTIA 1I4XA 5DAUA 1II3A 3U9SA 1G2TA 1GHJA 1WTRA 2VUMB 1HPCA 1G6ZA 2KQ3A 3D4DA 1RD9D 1ONLA 3JAME 2ZT9C 3BVMA 2JXMB 1RCVD 4XQNA 1EY6A 1ZEQX 1NAPA 1DD2A 1NR2A 4OIKA 2IL8A 1JWMD 5ELFA 1V8QA 2MP1A 5CORA 2L11A 3QOJA 1KAAA 3BYYB 5LL6X 5A2QL 2M9VA 4Q0FA 4A3IB 3EQLC 3H91A 1PRTF 3R3OA 2Y0SB 3NPPA 1AEXA 3URYA 4XDXA 1TWCB 2CHBD 4XQJA 4FF2A 2Z4HA 5C5LA 3TZDA 1PFNA 3R93A 1V1PB 2ZXPA 2DY8A 1EFID 3NBHA 2BOSA 1MBYA 2D2CC 3OMGA 1D5MC 1I6VC 2E75C 2KECA 3X3NA 5DM63 2JA7B 2K5DA 2HQEA 1SYBA 3NQTA 1IKMA 3NWSA 4KN7C 1STNA 3K0YA 5C44B 2B2UC 2WB1B 1FNUA 5C5MA 2D62A 1V1OA 2PO4A 4K6LA 4KKUA 5JAVA 1TWHB 3OWFA 4C2MB 3CRKC 4CJ2C 4TQUS 1HA5A 5KGUA 4XIGS 5D3IB 4N9TA 1VF5C 1OXXK 3JAML 1EYCA 2NB0A 3CQZB 4H0LC 2LFNA 1D2BA 5CV4A 1SE2A 5KNDA 2VXWA 2M00A 3BVZA 3C3LA 3BDOA 2CVRA 1RODA 2WV6D 2L4NA 2N88A 2NVTB 3GTJB 3MFYA 3A7LA 2N55A 2AWOA 4NDXA 2NWGA 2BCOA 4F88A 1F9RA 3NHHA 1GUWA 3W3AA 3MHBA 1Q3LA 2HUGA 3FMCA 2PMZB 4DNTB 4C1NI 5LHY1 2PPBC 1MGSA 4H13C 1TWFB 2WACA 4OO1H 1STYA 2JSOA 1SAPA 4XYQA 1A3VA 3M4OB 2K05A 3C1FA 4EQPA 2A68C 1ICWA 5AFWA 2RA4A 2K5QA 3DWAA 4DK1A 1TS5A 1M8AA 2XVSA 4PMCA 1JC7A 3HRZC 4FXDA 2F0PA 5C4JB 2ID0A 2TMPA 1A3UA 1EY7A 1VF7A 3A56A 2EY1A 5DM73 3TSSA 5E1FA 3Q0AA 4RGOS 5G3LD 2Z8LA 4A93B 3D31A 1WTVA 2O4XA 5CV6A 4KKSA 5I6WA 4FXGC 1SNDA 4IN3A 1WTQA 4HMJA 4RFBA 1PLFA 2WAQB 4LK1C 2YYZA 5EKIA 2F3VA 4A3KB 2A74C 2B2TC 2EYJA 2F1MA 2EY5A 1CTMA 1X3PA 4MHEA 3S1MB 1HA6A 2BDOA 1BXTA 4BA1I 1JICA 4KHVA 2NYZD 2LMCB 4DXGA 3I8ZA 3D8GA 1QNKA 2G9DA 1QG7A 4K2LA 3V2TA 2QDBA 5T1IA 1D6EC 3S15B 1U4PA 1K8OA 4OO1G 2PZTA 2LKVA 2CQAA 1IYVA 1O7YA 5M3FB 3SK8A 3EVQA 3UI2A 4EVOA 3DEPA 2PZWA 2NN6H 1UNSA 1SNOA 1M4VA 3OW7A 1W6KA 4KY5A 4FF4A 1B4OA 4PMWA 5EKLA 4RGMA 4XTCS 3FDTA 5I6YA 5I9OA 1MSGA 3MTSA 2A69C 4A3GB 1PTOD 1D1IA 1HUNA 4IUTA 1PTOC 3OIPA 1EIHA 5D14A 1NR4A 4FVMA 1CHQD 5JOBA 4ZLTF 3RUZA 1SSOA 1TY0A 2NVQB 2D9UA 5FLXE 4MN3A 5I4DA 1LT4D 5F2DA 3GQBA 1STBA 3MAQA 4KI0A 5IT9L 1BCPB 4EQNA 2EJMA 3SK6A 3H3VC 2V4DA 1O78A 2L1BA 4HR7B 3D6CA 4LMQD 2E2JB 3ERQA 3P75A 5CGKA 3D3RA 3PUXA 1D5XC 1PRTD 3I70A 4Y7NB 2NN6G 5K5PA 2F0FA 2EDGA 1PRTC 1BR9A 3I4LA 2JA8B 1HFGA 4J6HA 4KJNA 2PYKA 2B2WC 5CBEE 3DMUA 2A73B 1PFBA 2RDFA 5EJWA 1LTID 1E2WA 2JE6I 1EEFD 2KJXA 1B3AA 2IPKD 3IL8A 2B2UA 5EBDA 5BN5A 1S4ZA 3QWNA 4RA8A 4ILWA 1WD0A 4B9WA 1EY0A 3MWYW 3WDNA 3VR6A 4DXFA 2IJ0A 1I4HA 3HKZB 2F3WA 2EYLA 1SMYD 1B44D 4BBRB 3NTKA 3ND9A 1PMRA 4RGNA 1EY5A 3NWTA 2G9HD 1B53A 1TU2B 3MVVA 1SMYC 4KD3A 1EWHA 2ZXOA 4CGYB 3TP7A 2F0TA 4BWGB 2RBMA 1BCPC 1LT3D 1BO0A 4L6TB 1EYAA 4X3UA 1DYQA 1QJOA 5FO9B 2K32A 1XWEA 4IFDI 1EWCA 5E4XA 3VYRA 5EPJA 4IZ8A 3K5LA 2O2LD 4ODGA 1I4PA 5IOCA 4RKBA 1TWGB 5EBCA 3KF8A 1XYIA 3QJYA 1I50B 3BG3A 2NBFA 3NSWA 3K5NA 4NKLA 3T53B 1IW7D 4F8MA 3N6RA 3LNNA 1KDAA 3DUZA 3SE0A 2F0DA 1IW7C 1SDFA 3WOEA 1Z47A 3PMFA 3TZUA 4OL7A 4WORA 1LO5D 5IGCA 3OIQA 1K8MA 1SNMA 3J81E 2HDLA 2AQ2B 1SJHD 1KABA 2F0SA 4BBSB 2RQXA 2KEEA 3R8BA 1OXVA 5E4WC 3GP7A 5M5WB 1ZYRC 1FGBD 2SOBA 1R4PB 2J4XA 1SYFA 2XN9C 1A2TA 2RDHA 5CMDA 2B2TA 5IGGA 2I46A 3WOFA 4DGZA 1PXUA 2BDNA 1LT6D 2M2LA 1SYGA 1DJRD 4HAEA 3SEBA 1T5XD 2KVMA 3V05A 3A8IE 2L9HA 2WKDA 3K6OA 1QE6A 1A15A 5A35A 4M8AA 4HN7A 4IUNA 2BA1A 3T51B 2X6LA 4C1NK 1CZWA 4XT1B 1BOSA 4N9PA 2KHSA 3GTGB 3MA2B 2YU9B 1AFPA 2F4IA 2SNSA 3A8KE 3E5SA 4WRDA 3BZDB 3TMEA 1WTXA 1SEBD 2F0OA 1RHPA 2NVYB 1QB5D 1Q1BA 1EL0A 4C3JB 2EYOA 3Q22A 2E2IB 1S5ED 2B2YC 2K28A 3GTMB 3DM1A 1FNWA 1WTOA 3GTOB 4FP5D 1HQMC 1B2TA 2F0IA 3PUVA 4Q5VA 1I3QB 4C3JG 3GTKB 1JB3A 4Z9CB 2AQ3B 1S5DD 3I4MB 4QUFA 3ZYYX 4XXEA 4J8QA 4DAPA 1DXMA 2F0HA 1KDCA 3QO2A 4UDUC 1BCPF 3K7AB 5JPNC 2EYPA 1ESRA 1ET9A 5C0XI 1F77A 5CV5A 2H4OA 1F9SA 4IUVA 4K5XA 1SNPA 1VDZA 1LLRD 4O1NA 1OXUA 1HFNA 4CKEA 1JQYD 3GV6A 1QNUA 2E2DC 2XRQD 1YNJD 5EPKA 1STGA 2B2WA 1Y1WB 4PNYA 1A3TA 1YNJC 1I4GA 4V190 1O7ZA 3BYTB 1L0YB 1H9SA 1KDBA 1NUCA 2WKCA 1LV9A 1HUMA 2E76C 4HCEA 4G7ZC 1B1ZA 3KBXA 4IQZA 5IGEA 2K04A 3K58A 4MIUA 5CV7A 3E6ZX 4BA2I 2KA7A 1CA6A 2EVBA 4OHJA 2E2HB 2TSSA 2A68D 4YIJA 1I4RA 4HSVA 3IFTA 2RKSA 3HOYB 2R92B 1Q8IA 2RSOA 2DNEA 4CBVA 4WJWA 1GXDC 1Y69U 4OGQC 3GO5A 3SHLA 5CYUA 4NP5A 1BNZA 4DA2A 3HOWB 1CFMA 3KUPA 1F9QA 3GD7A 4QUCA 4B9XA 3KLSA 3GTPB 2FMCA 2XSCA 2Z1CA 1CQFA 4EQOA 1LT5D 4ZUJA 1ML0D 3H94A 2EY6A 2ICEC 4C3IB 5E3FA 2IW3A 3NTHA 2Q8TA 3QIAA 3MC0B 1LTRD 2CW0D 3HOVB 1ZXTA 5J1ZA 5JEAH 3S9WA 3AMUA 1SE3A 2CW0C 2Q8RE 1CZGA 2AQ1B 4HEDA 4C3IG 1CHPD 3DEOA 2L5TA 1G91A 1CT1D 4RGTA 3I4NB 4EGVA 1TVXA 5CV8A 2VB3X 2QCPX 3FPUB 4DK0A 1OXTA 3L3OC 3LWEA 3U9OA 4RCNA 2FFKB 3SR1A 2O5IC 4WFN3 3J7YW 4QCLA 3KLSX 4ZRZA 4M1UB 2A69D 4ULLA 2D5DA 1EIGA 4X3KA 3BDCA 5D3DA 2GA4B 3Q23A 2HCIA 1GUTA 2F0WA 1BF4A 4RHRA 1Q12A 4J1MA 5JEAJ 3A8JE 5T1GA 1TS4A 3OPOA 2ZXRA 3J80E 3RZDB 1RTOA 4UAIA 3NXWA 2H1EA 2HDMA 3CU7A 4ZAIA 5C4XB 3EROA 2A5HA 4FNFA 4K5VA 1AZPA 1JOOA 4R8NA 5FKAC 3T16A 2FHTA 3VR5A 4CJ1B 5M5YB 4H44C 3H6MA 5JEAG 1LTSD 4C3HB 1IYUA 2BE5D 1TKWB 2B2YA 3AU7A 1SYDA 2BE5C 5EKKA 2K5WA 3LWUA 1B9MA 3VYUA 1EQVA 4H7BA 3HP3A 3ND8A 2LS01 1ENAA 4K5WA 4C3HG 3PV0A 2B2VC 4KK7A 2K03A 2R7ZB 1GUNA 1IL8A 3P7JA 3EA6A 3QOLA 3A54A 3VR4A 4K14A 4X3SA 4A3FB 4ZQ3A 3KBGA 3NBIA 3VYTA 4DF7A 1PZKD 4KTAA 3I72A 1FD7D 2JP1A 4KD4A 4NW2A 4KHZA 2LY7A 4C56C 1JOKA 3OHXC 1ET6A 3DWPA 2XIWA 4TSSA 3K57A 4CHTB 3MXGA 4JBWA 5J22A 2PNRC 4KY6A 3FKIB 1STAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F0E A;  2F0W A;  5F2D A;  2EYF A;  1STB A;  2OEO A;  2F3V A;  4J1M A;  4RKL A;  2EXZ A;  1TQO A;  2EYJ A;  4KJO A;  2EYP A;  1EYC A;  3SXH A;  2EY5 A;  4HMI A;  5M9O A;  4I65 A;  5C4Z A;  2PW7 A;  5C3X A;  1EY8 A;  5CV4 A;  5CV5 A;  4EQN A;  1EZ6 A;  4IAL A;  4QMG A;  3NXW A;  3QB3 A;  3SK6 A;  4IZ8 A;  3OMC A;  1NSN S;  2M00 A;  4F7X A;  3ITP A;  4IUN A;  3D4W A;  4K5X A;  3QOJ A;  3LX0 A;  4B9X A;  1SNP A;  1KAA A;  4TRD A;  2F0K A;  4ODG A;  3NUC A;  3DHQ A;  3ERO A;  2ENB A;  2EYH A;  4KHV A;  4RKB A;  5IOC A;  5KGU A;  4EQO A;  2F0U A;  3D6C A;  3MEH A;  5ISR A;  4ZUJ A;  5IOD A;  1JOR A;  4G57 A;  1F2M A;  4K6D A;  5C3W A;  5C6A A;  2EY6 A;  3R3O A;  4K8J A;  1SNC A;  4K5V A;  3P1H A;  4KY7 A;  3TP5 A;  5C4H A;  4NDX A;  3D8G A;  5IGB A;  1JOO A;  1AEX A;  3ERQ A;  4NMZ A;  4R8N A;  5E3F A;  1F2Y A;  4K2L A;  3V2T A;  3P75 A;  3T16 A;  5CGK A;  1STG A;  2KHS A;  2QDB A;  3NHH A;  4N9P A;  4PMB A;  4QB4 A;  5KIX A;  4NKL A;  3SK4 A;  4F8M A;  5KRU A;  2PZT A;  2LKV A;  3H6M A;  1A2U A;  2SNS A;  3MHB A;  4HTH A;  4PNY A;  1A3T A;  3E5S A;  1KDA A;  4WRD A;  1SYC A;  2F0F A;  2F0D A;  3TME A;  4DU9 A;  5K5P A;  5EGT A;  1F2Z A;  1EY4 A;  2F0N A;  5C5L A;  5NUC A;  1TR5 A;  1U9R A;  2F0O A;  5J1Z A;  3TP6 A;  3SK5 A;  3SK8 A;  2WAC A;  3EJI A;  5DEH A;  1KDB A;  1IHZ A;  1STY A;  1NUC A;  3EVQ A;  2PYK A;  3PMF A;  4J6H A;  4KJN A;  4OL7 A;  2PZW A;  5CV9 A;  3S9W A;  4WOR A;  1SNO A;  1A3V A;  3DMU A;  4DFA A;  3HEJ A;  5CC4 A;  5IGC A;  3C1F A;  4K2K A;  1SYD A;  2F0J A;  2RDF A;  5J39 A;  4EQP A;  1EYD A;  5EKK A;  5KYL A;  5KYI A;  3C1E A;  2F0V A;  2OF1 A;  4KV6 A;  4KY5 A;  3SR1 A;  5IGE A;  1EQV A;  4K8I A;  5IIF A;  1SNM A;  3VA5 A;  1EZ8 A;  5I9P A;  4MIU A;  4H7B A;  5CV7 A;  1TT2 A;  5EKL A;  1EY9 A;  4PMC A;  3OMG A;  3TP8 A;  2EYO A;  4EVO A;  2PW5 A;  1ENA A;  1KAB A;  4ID6 A;  5IGD A;  2PZU A;  2F0P A;  1RKN A;  2F0S A;  4K5W A;  3T13 A;  5CV8 A;  5I6Y A;  5I9O A;  1SNQ A;  4QF4 A;  3HZX A;  3QOL A;  5HUR A;  1A3U A;  1EY7 A;  1EY0 A;  2F0M A;  3MZ5 A;  4B9W A;  2EY1 A;  5DAU A;  4YIJ A;  5KEE A;  4K14 A;  5E1F A;  3NK9 A;  4ZQ3 A;  2NUC A;  1II3 A;  2F0I A;  4N9T A;  2HQE A;  2SOB A;  1SYB A;  2F3W A;  2RKS A;  3NQT A;  2EYL A;  3OSO A;  4DF7 A;  4KTA A;  4S3S A;  5HGT A;  4KD4 A;  1JOQ A;  3U9O A;  1STH A;  1SYF A;  2F0Q A;  2OXP A;  2O4X A;  2EY2 A;  2KQ3 A;  2PQE A;  1STN A;  1SYE A;  2F0L A;  3BDL A;  3D4D A;  5CR3 A;  1ENC A;  1A2T A;  1EY5 A;  5CV6 A;  3MVV A;  2EYM A;  1JOK A;  4KD3 A;  4ZUI A;  5C5M A;  5JOB A;  5I6W A;  3RUZ A;  5IGG A;  3TP7 A;  3NP8 A;  2F0T A;  1SND A;  2SNM A;  2RBM A;  3MXP A;  4DGZ A;  4ME5 A;  5JAV A;  5IGF A;  5J22 A;  3OWF A;  4HMJ A;  3BDC A;  4E6I A;  2F0H A;  1EYA A;  1SYG A;  4KY6 A;  2F0G A;  3SHL A;  4LAA A;  4NP5 A;  1KDC A;  1STA A;  1EY6 A; 
#chains in the Genus database with same CATH topology
 2F0E A;  1AN8 A;  3M85 A;  4RKL A;  2EXZ A;  2N49 A;  3HFZ B;  3S2D H;  1QOH A;  4O42 A;  1VQ4 A;  2BH8 A;  5M5X H;  3SGI A;  5C4Z A;  1WOC A;  1SFO B;  1DOL A;  1BCP D;  3CCE A;  4A3L H;  1PZJ D;  3BVG A;  2RF4 A;  2XRS D;  4B08 A;  1EYG A;  4P74 A;  2XWJ B;  5GAD C;  4R9W A;  1XXG A;  1SJE D;  2ENB A;  3I4O A;  1XTC D;  3FKI G;  5I2X A;  3RMH A;  4G57 A;  4TKO B;  4A3E H;  2JA6 B;  3F2C A;  4GS3 A;  1VQG A;  3J80 L;  2LXJ A;  4BBR G;  2K33 A;  2CH4 A;  2QKI C;  4JV5 Q;  1E1T A;  4RWS C;  2MHV A;  3SK4 A;  5IWA L;  4DR6 Q;  5FLX L;  1F2Z A;  5M3M B;  1V1P A;  1HNX L;  3HOZ B;  3SK5 A;  2KCC A;  4A3M B;  3I56 A;  3W2D A;  2Z4I A;  5C3E B;  2L55 A;  1LM0 A;  2JA6 G;  4AIM A;  4K2K A;  1V1Q A;  1X3G A;  3FRP B;  1BUV T;  1TWA H;  1T5E A;  3C1E A;  2F0V A;  4DR5 L;  4JYA L;  1WTP A;  5HGQ A;  1CA5 A;  4JI6 Q;  1EY9 A;  2R61 A;  3OOC A;  1K8G A;  1CKO A;  5M3M G;  3PO2 B;  3NE5 B;  4ID6 A;  1NCV A;  3HOZ G;  3CAM A;  1A63 A;  4V0B A;  2HIX A;  2KCN A;  4A3M G;  3S2D B;  2RDG A;  3MZ5 A;  5M5X B;  2NUC A;  5A2Q E;  3SVM A;  2BA0 A;  4QIW B;  3P20 A;  1GHK A;  1EU3 A;  2OXP A;  2H5X A;  4LF8 L;  2PQE A;  2OTJ A;  3M7G A;  4PG3 A;  1OO9 B;  4R4Q A;  1OTC A;  3I73 A;  2RVL A;  1AP0 A;  4A3E B;  3PO2 G;  4RH6 A;  1N33 L;  1JJG A;  1YIT A;  3MXP A;  1PVO A;  1E0B A;  1BBX C;  1TS3 A;  1ZYR D;  2R3Z A;  2R93 H;  1XPO A;  1IKL A;  4OO1 I;  4A3L G;  2C9O A;  2OEO A;  1RTN A;  3F2U A;  4IPD A;  3J7A V;  2B8F A;  2MJ8 A;  2IX3 A;  2JYO A;  1VQL A;  4IJL A;  2F52 A;  3SXH A;  3I90 A;  3E0E A;  2C35 B;  4A3E G;  1B50 A;  3OMC A;  1VQO A;  1ZKO A;  2DN8 A;  3D4W A;  4JBM A;  1VQJ A;  3FPP A;  2L0C A;  1BBW A;  1TWA B;  2C5C A;  5AJ3 Q;  3H3V I;  4CDC C;  4P2C B;  4APV A;  4LUZ A;  2K01 A;  1W3S A;  3MXN A;  5JVH 3;  1J5E L;  2NZ1 D;  2ES2 A;  2L12 A;  1IXR A;  3TP5 A;  4POF A;  5IYC H;  4A76 A;  3U4V A;  3T56 B;  2IY5 B;  1O7I A;  2SDF A;  1FR3 A;  3EN2 A;  3IKJ A;  4OWW B;  4QB4 A;  3L7Z C;  1X55 A;  1Y8O B;  5KRU A;  1HHV A;  1SE4 A;  4X65 Q;  3KK7 A;  1SYC A;  4JI5 L;  5JJL A;  4DU9 A;  5K36 H;  1GUS A;  3J81 c;  1WI5 A;  2MNA A;  5DLQ E;  5NUC A;  2MO0 A;  3VYS A;  3EIV A;  5JVG 3;  3PO3 H;  3CHB D;  1WD1 A;  2PQA A;  2B39 A;  2E5L Q;  3PIO 3;  1ICF B;  2D0O A;  4GLA C;  1B3Q A;  3D0F A;  1H9R A;  3I91 A;  3VA5 A;  2R93 B;  1TT2 A;  1QVG A;  4R1J A;  2J0T D;  4RAU C;  2QF7 A;  1UE7 A;  2AUJ D;  1R9T H;  4X64 Q;  1KHI A;  3OTO Q;  4GKJ Q;  1G8Z D;  3S1R H;  1BVS A;  3CC2 A;  4QF4 A;  4CDE C;  4L5S A;  3QR8 A;  3T4A C;  3C46 A;  1HTL D;  2MGS A;  1IBL L;  2EJG C;  1IYJ B;  1F9P A;  4JK1 C;  4QQB X;  2EOT A;  1STH A;  5BN3 A;  1HZA A;  1O80 A;  3M7N A;  1N32 L;  3G7L A;  3KF6 A;  3G6J B;  2UUB L;  2R93 G;  3HG9 A;  4GN3 B;  1QCB D;  2Q8I B;  4DUZ Q;  1LTG D;  3S14 H;  3NP8 A;  2EIF A;  1Y8P B;  2KCM A;  2F3I A;  3O13 A;  1HZC A;  3TS2 A;  4A3J H;  1C8C A;  2R6G A;  2F0G A;  1LTB D;  2NN6 I;  3KLR A;  3VA7 A;  4HCS A;  3SDZ A;  4EX5 A;  5JJZ A;  3J81 L;  1S5F D;  1I4Q A;  5M9O A;  2KED A;  2PW7 A;  5C3X A;  4QMG A;  1PHJ A;  2OTL A;  3QB3 A;  3PO3 B;  2UXD Q;  4F7X A;  1LAC A;  1A8V A;  1HQR D;  5ELC A;  1W6J A;  4TRD A;  5IYC G;  5D65 A;  1MJE A;  5IE8 A;  4IUU A;  3L9A X;  4DR6 L;  3J7A 5;  4K8J A;  1R9T B;  5K36 G;  2VY3 A;  4G7O C;  2HT1 A;  1K3R A;  1PYW D;  3S1R B;  5I2Y A;  3KF8 B;  4JI3 L;  3FVQ A;  3NEM A;  3IAY A;  3K5M A;  4CJ0 B;  1LTA D;  3PO3 G;  5KNB A;  1V43 A;  4IUQ A;  2F0N A;  2N3S A;  2HCC A;  1U9R A;  1L0W A;  5LL6 S;  4B3R Q;  3EJI A;  4LFC Q;  5DEH A;  1SXT A;  4DK3 C;  1OXS C;  4JI6 L;  1JWS D;  2X6G A;  2B2V A;  4IFD H;  3HEJ A;  3HGB A;  4MZ9 A;  1WCM H;  2F0J A;  1S5B D;  2B29 A;  1EFW A;  3S14 B;  1U4M A;  3H0G H;  5ELB A;  5KYI A;  4NXM Q;  4KV6 A;  1VQE A;  1TS2 A;  1JWU D;  4K8I A;  2EZV A;  1EEI D;  5I9P A;  4CKC A;  2UU9 Q;  4A3J B;  3S16 H;  3FEW X;  1EQT A;  2PW5 A;  4JCV E;  2PZU A;  3T13 A;  1UEB A;  3ICE A;  1JE4 A;  3AB9 A;  4PQX A;  2A6H D;  1Z9F A;  1K83 H;  1Y8N B;  3NEN A;  2I07 B;  2LXK A;  4DN4 M;  1JB7 A;  3OSO A;  4YCU A;  1A0I A;  1D1K A;  2A6H C;  3K7U C;  1YNX A;  3E9H A;  4RHS A;  3BDL A;  1NE3 A;  4A3J G;  1VMC A;  3GTQ H;  1H9J A;  1TY2 A;  5IY0 A;  1S5C D;  1PFM A;  3EFX D;  3CCR A;  1MSH A;  4FF1 A;  1K28 A;  1YHB A;  2WB1 E;  2WFW A;  2HHH Q;  3HOU H;  4X3T A;  2EYF A;  3F2B A;  1PTO H;  4BY1 H;  3CPF A;  4KJO A;  2NVX H;  3Q24 A;  4IFD J;  3S1N H;  1EY8 A;  1HCZ A;  1X3Q A;  4DAY A;  1DM0 B;  1WCM B;  3ITP A;  1CK1 A;  1LTT D;  1HTP A;  3VR2 A;  3A0J A;  4JI8 L;  2F0K A;  2WII B;  3H0G B;  2RSN A;  3X3M A;  2EPB A;  1J9O A;  1X32 A;  3MEH A;  5ISR A;  2CWA A;  5IOD A;  2KEN A;  4X65 L;  3S16 B;  1KXL A;  1EQQ A;  1F2M A;  4DR4 L;  3HOY G;  1KNE A;  1F2Y A;  2KCT A;  5JPM C;  1GUO A;  4PMB A;  2ALY B;  2R92 G;  1EWI A;  4BY7 H;  1EIF A;  1JCK B;  3S1Q H;  1YZ6 A;  2WP8 J;  4IFD G;  1K83 B;  3DXJ C;  1WCM G;  2IT1 A;  3H3V H;  1EOV A;  3H0G G;  4DR2 L;  5ELE A;  1HNZ Q;  1IBM L;  2CFM A;  3RLN A;  4R8I A;  2QIL A;  1QUQ B;  3I7F A;  4JOI C;  1YNN D;  2K4K A;  3GTQ B;  4X64 L;  5J39 A;  5GAH C;  2PMZ E;  2O5J C;  1CQV A;  5KYL A;  4R4O A;  2OF1 A;  3RR5 A;  3H09 A;  1N9W A;  3GTL H;  1YNN C;  1E2Z A;  3U4Z A;  3TN2 A;  2A8V A;  4LFB Q;  5IT9 E;  1WVL A;  1E2V A;  1KAW A;  1D5Z C;  3HOU B;  1YHQ A;  1CKN B;  1RKN A;  5BN4 A;  1RDP D;  3AFQ A;  3F2D A;  3Q6S A;  4FF3 A;  1PTO B;  4BY1 B;  1Q86 C;  5ELO A;  2NVX B;  3S1N B;  3STB C;  3NK9 A;  2QEX A;  3I2Z A;  3G71 A;  4U68 A;  4DUZ L;  1SBB B;  1VMP A;  4JI0 Q;  1DCZ A;  1GKH A;  1KLG D;  2KUM A;  1CM9 A;  1UUP A;  2F0Q A;  3N52 A;  3TQY A;  1ENC A;  1L1O C;  5IYB H;  3HOX H;  2HD3 A;  3CKI B;  3HOU G;  1CI3 M;  4DUY L;  1PH9 A;  4KN4 C;  2ZTD A;  1A62 A;  3R2I A;  5COY A;  5ELD A;  1B9N A;  1XMQ Q;  4BY1 G;  1AW7 A;  4E6I A;  4UP8 A;  2OQ0 A;  4BY7 B;  1QWY A;  4LF7 Q;  4PV1 C;  3S1Q B;  2JEA I;  3K0X A;  1TQO A;  3A55 A;  1MKH A;  1D7Q A;  3KJP A;  4HMI A;  4I65 A;  3DWQ A;  1ILP A;  4NXN Q;  2WAQ E;  4DNI A;  2IHF A;  2FIN B;  5IT9 c;  4N8X 1;  2UXB L;  3MFG A;  3VR3 A;  4ZK9 B;  1M90 C;  3KFU A;  4HSP A;  5FJ8 H;  3Q8D A;  1DGS A;  4RG1 A;  1MD2 D;  1PZI D;  5GAE C;  3RLO A;  2EYH A;  3GTL B;  2EE1 A;  5C3W A;  4K6D A;  5C6A A;  3P1H A;  5IGF A;  1X54 A;  3OWE B;  2DNC A;  1GOZ A;  1PRT B;  2JN4 A;  3T1Y L;  1I6H H;  4B3R L;  4LFC L;  1WTW A;  4PZ7 A;  2AMC B;  4ZKC B;  2J7Z A;  1TR5 A;  4I7Z C;  4U67 3;  4DV0 L;  4X66 Q;  3W5O A;  5FK9 C;  2UU9 L;  5CV9 A;  3RZO H;  4MNO A;  3RD4 A;  3HOX B;  2K7V A;  1H9S B;  1N36 L;  4G4K A;  1HRJ A;  2K5H A;  4DAV A;  5C0X H;  3NQI A;  5IIF A;  1UE1 A;  1G2S A;  2ASB A;  5ELN A;  4LF5 Q;  3E0J A;  4L63 B;  3PIP 3;  1L0X B;  4BS9 A;  1XX8 A;  4RCO A;  4LF9 L;  1CUK A;  3I3C A;  1SNQ A;  1PDQ A;  1Q1E A;  3F1Z A;  5DNF A;  1N34 Q;  3H15 A;  2XWB B;  1KTK A;  1DOK A;  2IX0 A;  5KEE A;  4IUP A;  3HOX G;  3BS1 A;  3J7A F;  1QVF A;  1JJC B;  5JJK A;  4AYB B;  3CRL C;  4S3S A;  5HGT A;  4CKB A;  1G29 1;  1SYE A;  2F0L A;  2A19 A;  1HXY D;  2FJ2 A;  4IUR A;  1LAB A;  2UXC Q;  2HHH L;  2ICI A;  3K59 A;  2OT2 A;  5EPL A;  4A3B H;  4ME5 A;  1RJT A;  3HS0 C;  5EQ0 A;  1PH3 A;  5LMN W;  1I6H B;  1H9K A;  3RLF A;  1C7Y A;  4LAA A;  1EIY B;  2KOL A;  4AYB G;  5FOB B;  4LJZ C;  2ZJP A;  3GV3 A;  5FJ8 G;  2NTS A;  2B63 H;  1H9M A;  2B8G A;  2PCF B;  2JEB I;  3S17 H;  4ABN A;  4DV7 L;  2VS1 A;  4IAL A;  4BXX H;  3RZO B;  2WIN B;  3UE0 A;  5C0X J;  1C4Q A;  1NMG A;  3C2P A;  1NSN S;  1A6X A;  3PUW A;  2JA5 H;  3NUC A;  2AHO B;  5TSS A;  2OCE A;  4RMF A;  3TBI B;  1WYD A;  4F87 A;  4OXP A;  2FMM A;  4A3F G;  1QVC A;  4XT3 B;  5C4H A;  1JJ2 A;  4NMZ A;  4ZYS A;  1Q7Y C;  1DOM A;  5KIX A;  1HNZ L;  2AUK A;  3A7A B;  1A2U A;  2ZTC A;  3AYH B;  2K5N A;  5EGT A;  2DY7 A;  4XQQ A;  4FO2 A;  3D4R A;  3TP6 A;  1U4L A;  3V96 A;  2ZM6 Q;  5C0X G;  1J8I A;  1BQQ T;  2E74 C;  4LFB L;  5BR8 Q;  1F2L A;  1KLU D;  2XNA C;  4A3B B;  1KNA A;  3RNU A;  1BDO A;  4A3D H;  1Y1V H;  1EZ8 A;  2NTT A;  1Q8K A;  3TP8 A;  5J3B A;  2RCF A;  3PF5 A;  4GOP B;  3R2T A;  3M4Y A;  4JI0 L;  4JVZ A;  5G3L F;  1VQ7 A;  4AQY Q;  1ESF A;  3HZX A;  1VCI A;  2EJF C;  3QG1 A;  2F0M A;  2B63 B;  1IBK Q;  1U4R A;  3S17 B;  2K1B A;  2K6A A;  3M3Y H;  1JOQ A;  4A3B G;  1YI2 A;  3IFD A;  5FO7 B;  3AFP A;  1JOR A;  2EY2 A;  3TDQ A;  5CR3 A;  5IGB A;  2JA5 B;  3D6W A;  1G6P A;  1FYC A;  3S2H H;  2EYM A;  1EOT A;  1Z7T A;  2MUY A;  4ZUI A;  2VNU D;  2IWH A;  3MEF A;  1MI2 A;  3HKZ E;  3PUZ A;  1DZ1 A;  2SNM A;  3K5O A;  4G7H C;  4IO9 A;  1DON A;  5CBA E;  2QA4 A;  3S24 A;  1AZQ A;  5C3E G;  2AWN A;  4NXN L;  4JBJ A;  4BXX G;  4ZKB B;  2SEB D;  1UEA B;  4JPB W;  3W1B A;  2VB2 X;  2JA5 G;  1FNV A;  3ONA B;  4DV5 Q;  4OIJ A;  2UUA Q;  4L8J A;  1SR3 A;  2K50 A;  1EZ6 A;  1FVI A;  2QW7 A;  3KDF B;  2VUM H;  1PH5 A;  2MPM A;  3LX0 A;  1GUG A;  4KMU C;  1RF2 D;  3DHQ A;  1Z6H A;  4A3D B;  1Y1V B;  2F0U A;  4FXK C;  4GZY C;  1SNC A;  4KY7 A;  1ENF A;  2PI2 E;  2VQE L;  3MXU A;  3A5U A;  4DV3 L;  1STE A;  1K9M C;  1ILQ A;  1QIL A;  2GVB A;  4JOI A;  4LUV A;  1B7Y B;  4HTH A;  4JW0 A;  4HIK A;  1Q90 A;  1EY4 A;  1TXY A;  1AH9 A;  1P16 A;  1PH8 A;  1O7L A;  2A6E D;  5KNC A;  3M3Y B;  1V9P A;  1GJX A;  4A3D G;  1IHZ A;  1Y1V G;  4KKT A;  3S2H B;  2YTX A;  2XGT A;  5CC4 A;  4LF5 L;  2A6E C;  4DFA A;  4GOP C;  5FO8 B;  1EYD A;  4XYO A;  2IX1 A;  2JA9 A;  1K3B C;  1R4Q B;  4DPG A;  1PFS A;  1N34 L;  4A3I H;  1JMC A;  1JR0 D;  1HR0 L;  1TII D;  1UWV A;  1X3E A;  1XJV A;  2X69 A;  1C48 A;  4QIW E;  5IGD A;  4DNR B;  1PTO F;  3PUY A;  1XPU A;  1EU4 A;  1L1O A;  4FYD A;  1UAP A;  2QEJ C;  1TWC H;  2F03 A;  5HUR A;  3NTI A;  5LMU Q;  1I4X A;  5DAU A;  1VQN A;  1FJG Q;  1II3 A;  3U9S A;  4LUO A;  4X6A H;  1NMF A;  2UXC L;  1G2T A;  5LMN Q;  1GHJ A;  1WTR A;  2VUM B;  1HPC A;  3UDI A;  4GKK Q;  1G6Z A;  2KQ3 A;  3JAM i;  3D4D A;  1RD9 D;  4B3T Q;  1ONL A;  4H02 A;  3JAM E;  2ZT9 C;  3U50 C;  3BVM A;  2JXM B;  1RCV D;  3WWV A;  3J7Z C;  4LFA Q;  1K73 C;  4JI1 L;  2LSS A;  4XQN A;  1M1K C;  4OX9 L;  2D0P A;  1EY6 A;  3OW2 A;  1ZEQ X;  1JE5 A;  4I7A A;  2VUM G;  1K0S A;  1NAP A;  1DD2 A;  2GN5 A;  1NR2 A;  2HIV A;  2JA7 H;  4OIK A;  2IL8 A;  1JWM D;  5ELF A;  1V8Q A;  2MP1 A;  5COR A;  2L11 A;  1QUQ A;  1PH6 A;  3QOJ A;  1T9H A;  1KAA A;  5C44 H;  3BYY B;  5LL6 X;  5A2Q L;  4A3C H;  2M9V A;  4Q0F A;  1NBW A;  4YWK A;  5IP7 H;  4A3I B;  4GN5 A;  3EQL C;  3H91 A;  1PRT F;  1X65 A;  3R3O A;  2Y0S B;  3NPP A;  1AEX A;  3URY A;  1TWH H;  3B6Y A;  4C2M H;  4XDX A;  4JG2 A;  5FLM H;  3ULJ A;  1TWC B;  1VQA A;  4DR3 Q;  4J15 A;  4ALP A;  1KQS A;  2CHB D;  3CCJ A;  4XQJ A;  3JAM c;  4FF2 A;  1HZB A;  2Z4H A;  5C5L A;  2MO1 A;  3CPW A;  1P8L A;  2EXD A;  2R7F A;  3TZD A;  1PFN A;  3CQZ H;  1KD1 C;  3R93 A;  2Q2T A;  1V1P B;  2ZXP A;  4JV5 L;  2DY8 A;  4K0K Q;  1H95 A;  4A3I G;  1EFI D;  1D8L A;  4DR1 Q;  3NBH A;  2Y0S G;  2BOS A;  3J81 j;  1MBY A;  4AQY L;  4P71 A;  1S72 A;  4HJ7 A;  2F4V Q;  2NVT H;  2D2C C;  1W2B A;  3TEH B;  1IBK L;  3OMG A;  1D5M C;  1I6V C;  3GTJ H;  1YJN A;  2E75 C;  2KEC A;  3X3N A;  4QY7 A;  5DM6 3;  4DAM A;  2JA7 B;  2K5D A;  2HQE A;  1SYB A;  3NQT A;  1IKM A;  1VQD A;  4PZ6 A;  3NWS A;  4KN7 C;  1TWF H;  1STN A;  3K0Y A;  5C44 B;  2B2U C;  2CKZ B;  2WB1 B;  3M4O H;  1FNU A;  3DM3 A;  5C5M A;  2D62 A;  1E3P A;  1V1O A;  2BH2 A;  2PO4 A;  4K6L A;  4KKU A;  3DLL A;  5JAV A;  4EQ5 A;  2E8G A;  1TWH B;  3OWF A;  4C2M B;  3CRK C;  4CJ2 C;  2JA7 G;  4P75 A;  4TQU S;  4DV5 L;  2UUA L;  1HA5 A;  2MQH A;  5KGU A;  4XIG S;  4N9T A;  5D3I B;  3CME A;  1VF5 C;  1OXX K;  4PZ8 A;  5C4J H;  3JAM L;  1HJP A;  1L2F A;  4NB3 A;  3VDY A;  1EYC A;  3K8A A;  2NB0 A;  4UP7 A;  4A3C G;  3CQZ B;  4H0L C;  2LFN A;  1D2B A;  5CV4 A;  4POG A;  5IP7 G;  1SE2 A;  4A93 H;  5KND A;  2VXW A;  2EQS A;  2M00 A;  1SE8 A;  3BVZ A;  3C3L A;  1C9O A;  3BDO A;  2CVR A;  1ROD A;  2WV6 D;  2L4N A;  3NEL A;  1NY4 A;  2N88 A;  1XMO Q;  2NVT B;  3BU2 A;  4DR7 Q;  3GTJ B;  3MFY A;  3A7L A;  3MXN B;  2N55 A;  2G5D A;  2AWO A;  4NDX A;  4JI4 Q;  2NWG A;  2BCO A;  3CC4 A;  4OEM B;  4F88 A;  1F9R A;  2K52 A;  3NHH A;  1GUW A;  3W3A A;  4IPH A;  5AJ3 L;  1YHA A;  2VL6 A;  3MHB A;  4UY8 C;  1S3O A;  1Q3L A;  2HUG A;  4A3K H;  3FMC A;  2PMZ B;  4DNT B;  4HIM A;  4C1N I;  5LHY 1;  2PPB C;  1MGS A;  2KBN A;  4H13 C;  1TWF B;  2WAC A;  1S40 A;  4OO1 H;  1STY A;  2JSO A;  1SAP A;  4XYQ A;  1A3V A;  2YTY A;  3M4O B;  2K05 A;  3S1M H;  3C1F A;  4EQP A;  2A68 C;  1ICW A;  5AFW A;  2RA4 A;  2K5Q A;  3DWA A;  2PQA B;  1KRS A;  4JI2 Q;  4DK1 A;  1RIP A;  1TS5 A;  1M8A A;  2XVS A;  4PMC A;  1JC7 A;  3HRZ C;  4FXD A;  2F0P A;  2DJF C;  4B3S Q;  2E5L L;  5C4J B;  3S15 H;  2ID0 A;  1KL9 A;  2TMP A;  1A3U A;  1EY7 A;  1VF7 A;  3A56 A;  2EY1 A;  5DM7 3;  3TSS A;  2YTV A;  5E1F A;  3Q0A A;  4B3T L;  4RGO S;  5G3L D;  2Z8L A;  5GRO A;  5M3F H;  4A93 B;  3D31 A;  1WTV A;  3OTO L;  4GKJ L;  2O4X A;  4DV4 Q;  4LFA L;  5CV6 A;  4KKS A;  2I5M X;  1GO3 E;  2ZJR A;  5I6W A;  3M4Q A;  4FXG C;  1SND A;  3STB D;  4IN3 A;  4HJ8 A;  1WTQ A;  4HMJ A;  4RFB A;  1PLF A;  2WAQ B;  4LK1 C;  1AE2 A;  2YYZ A;  5EKI A;  4A93 G;  2PNH A;  4YCW A;  3CCM A;  2F3V A;  4A3K B;  1UE5 A;  1B70 B;  2A74 C;  2B2T C;  2EYJ A;  2F1M A;  2DUD A;  1VQ6 A;  2EY5 A;  1CTM A;  4A3G H;  1X3P A;  4MHE A;  4YCV A;  1PYS B;  3S1M B;  4DV6 Q;  1HA6 A;  2BDO A;  1BXT A;  4BA1 I;  1JIC A;  3OYY A;  4GNX B;  4DKA C;  5IWA Q;  4KHV A;  2NYZ D;  2LMC B;  3KYH C;  4HJ9 A;  4DXG A;  1HNX Q;  2NVQ H;  3I8Z A;  4A3K G;  3D8G A;  1CKM A;  1QNK A;  2G9D A;  4P72 A;  1QG7 A;  4K2L A;  2UXD L;  1AE3 A;  3V2T A;  2QDB A;  5T1I A;  4GOP A;  1D6E C;  3S15 B;  1U4P A;  1K8O A;  4OO1 G;  2PZT A;  2LKV A;  5GAG C;  1VQB A;  2CQA A;  4OWX B;  1IYV A;  1O7Y A;  1X6O A;  5M3F B;  1XNR Q;  1PH7 A;  3SK8 A;  3EVQ A;  3UI2 A;  4EVO A;  3DEP A;  2PZW A;  2NN6 H;  1UNS A;  1SNO A;  4BY7 G;  1IL2 A;  1M4V A;  3OW7 A;  1W6K A;  4KY5 A;  2RHS B;  4FF4 A;  1B4O A;  4PMW A;  5EKL A;  4RGM A;  4IPC A;  4O0A A;  2E2J H;  5M3F G;  1Q81 C;  4XTC S;  3FDT A;  5I6Y A;  5I9O A;  4LF8 Q;  1MSG A;  4NXM L;  1MIU A;  3MTS A;  3RN5 A;  4Y7N H;  2A69 C;  4A3G B;  1VQI A;  1PTO D;  1C0A A;  4P73 A;  1D1I A;  3PF4 A;  1HUN A;  4IUT A;  1PTO C;  3KDF A;  2JA8 H;  3OIP A;  1EIH A;  4R4I A;  5D14 A;  1NR4 A;  4FVM A;  1CHQ D;  5JOB A;  4ZLT F;  1WJJ A;  3RUZ A;  1SSO A;  1TY0 A;  2NVQ B;  2D9U A;  1EUJ A;  5FLX E;  1NTG A;  1VQC A;  1SLJ A;  3G4S A;  4MN3 A;  5I4D A;  5IYB G;  2Z6B A;  1LT4 D;  4MTK A;  5F2D A;  3GQB A;  1STB A;  3MAQ A;  4KI0 A;  5IT9 L;  4GNX C;  1BCP B;  1J5E Q;  2RCN A;  4EQN A;  1XMO L;  2EJM A;  5HY6 A;  3UDF A;  3SK6 A;  4BBR H;  3H3V C;  4JI4 L;  2V4D A;  4DAY B;  1O78 A;  1MJC A;  2QGQ A;  1HNW Q;  2L1B A;  4HR7 B;  4DV2 Q;  3D6C A;  4LMQ D;  2Q2H A;  2E2J B;  3ERQ A;  3JC6 6;  3P75 A;  5CGK A;  1NNX A;  3D3R A;  3PUX A;  1D5X C;  1PRT D;  3AEV A;  3M9B A;  3I70 A;  4Y7N B;  2NN6 G;  5K5P A;  2F0F A;  3CW2 C;  2EDG A;  1PRT C;  1BR9 A;  3BJU A;  3I4L A;  4JI2 L;  5FLX c;  2JA8 B;  1HFG A;  2K75 A;  4J6H A;  4KJN A;  2PYK A;  2B2W C;  5CBE E;  3DMU A;  1PH1 A;  2Z0S A;  2A73 B;  1PFB A;  2RDF A;  5EJW A;  4B3S L;  2JK8 A;  2N8N A;  1LTI D;  4JC0 A;  1E2W A;  1X56 A;  3CP0 A;  1VQ8 A;  2UUC Q;  1TWG H;  2JE6 I;  2YV5 A;  2ZTE A;  1EEF D;  5L37 A;  3ZJY C;  3FP9 A;  2B3G A;  2KJX A;  1B3A A;  1Y14 B;  2IPK D;  3IL8 A;  3BZK A;  3CCL A;  1I50 H;  2B2U A;  5EBD A;  5BN5 A;  1S4Z A;  2UUB Q;  3QWN A;  4RA8 A;  4ILW A;  1WD0 A;  4DV4 L;  4B9W A;  1EY0 A;  1PV4 A;  3MWY W;  3WDN A;  3VR6 A;  4DXF A;  2IJ0 A;  1I4H A;  3HKZ B;  2F3W A;  2EYL A;  1JT8 A;  1SMY D;  1B44 D;  4IPG A;  4BBR B;  1IZ6 A;  3G6E A;  3NTK A;  3ND9 A;  1PMR A;  4RGN A;  1EY5 A;  3NWT A;  2G9H D;  1B53 A;  1TU2 B;  3MVV A;  1SMY C;  4HID A;  4KD3 A;  4L5Q A;  1EWH A;  2ZXO A;  4CGY B;  3TP7 A;  1LTL A;  2F0T A;  3KOJ A;  4BWG B;  2RBM A;  4YWL A;  1BCP C;  1LT3 D;  4X62 Q;  1BO0 A;  4L6T B;  1EYA A;  4X3U A;  1DYQ A;  3HKZ G;  2ZJQ A;  1VQ5 A;  1QJO A;  5FO9 B;  2K32 A;  1XWE A;  4B3M Q;  1J6Q A;  4BBS H;  3K80 C;  4IFD I;  4DV6 L;  2OWO A;  1EWC A;  5M5W H;  1XMQ L;  3F8T A;  5E4X A;  3VYR A;  5EPJ A;  4L5R C;  4LF7 L;  4IZ8 A;  3K5L A;  3CC7 A;  1I94 Q;  2O2L D;  4ODG A;  1I4P A;  4JI3 Q;  4UP9 A;  5IOC A;  4RKB A;  2B63 G;  1TWG B;  5EBC A;  3KF8 A;  1XYI A;  3QJY A;  1XNR L;  1I50 B;  3BG3 A;  2NBF A;  3HKS A;  3NSW A;  3K5N A;  3GDE A;  4NKL A;  3T53 B;  1IW7 D;  4F8M A;  3N6R A;  3LNN A;  3IRB A;  1E24 A;  5IP9 H;  1KDA A;  3DUZ A;  3SE0 A;  2F0D A;  1IW7 C;  3LGJ A;  3RN2 A;  1SDF A;  3UDG A;  3WOE A;  1Z47 A;  3PMF A;  3TZU A;  4OL7 A;  4WOR A;  1LO5 D;  5IGC A;  3OIQ A;  4R4T A;  1K8M A;  3J81 i;  5GQO A;  1SNM A;  4X66 L;  3J81 E;  3CCV A;  1FGU A;  2HDL A;  1YJW A;  2AQ2 B;  4IJH A;  1SJH D;  5JJI A;  2VQF Q;  1KAB A;  2F0S A;  3CCQ A;  4BBS B;  2I5H A;  3GTG H;  2RQX A;  2KEE A;  3R8B A;  1OXV A;  5E4W C;  2YU9 H;  3GP7 A;  5M5W B;  4TVA B;  1EQR A;  1ZYR C;  1FGB D;  2SOB A;  4KLK A;  1R4P B;  4A75 A;  4LF4 Q;  1WTH A;  2J4X A;  3U58 A;  1SYF A;  3CD6 A;  2XN9 C;  2Z6K C;  1A2T A;  2RDH A;  5CMD A;  2NVY H;  2B2T A;  5IGG A;  2I46 A;  4BBS G;  3WOF A;  4DGZ A;  1PXU A;  2BDN A;  4C3J H;  1LT6 D;  4WJ3 M;  2M2L A;  1E7Z A;  1SYG A;  1DJR D;  3L2P A;  4HAE A;  3SEB A;  2E2I H;  1T5X D;  2KVM A;  1MHW C;  1ASY A;  3V05 A;  3A8I E;  4JI8 Q;  2L9H A;  1B8A A;  3GTM H;  2QDL A;  3GTO H;  1QZG A;  4YHH Q;  2WKD A;  1SN8 A;  3K6O A;  1QE6 A;  1HNW L;  1SRO A;  1A15 A;  4DV2 L;  4DV1 Q;  4DR4 Q;  5A35 A;  4M8A A;  3TRZ A;  4HN7 A;  1PH4 A;  1BKB A;  4IUN A;  2I0Q A;  1E1O A;  1I3Q H;  2FXQ A;  2BA1 A;  3GTK H;  3T51 B;  2X6L A;  3I4M H;  3A74 A;  3TS0 A;  4C1N K;  5IP9 G;  3PGZ A;  1CZW A;  4XT1 B;  1BOS A;  4DR2 Q;  1IBM Q;  4N9P A;  2KHS A;  3GTG B;  1GVP A;  3MA2 B;  3CMA A;  3ULP A;  3T1H Q;  2YU9 B;  1AFP A;  2F4I A;  2SNS A;  3A8K E;  2IHE A;  1LYL A;  3E5S A;  4WRD A;  3BZD B;  3TME A;  3K7A H;  1WTX A;  1SEB D;  2F0O A;  4OON A;  1RHP A;  2UUC L;  4IOA A;  4JI7 Q;  1VQ9 A;  4LF6 Q;  2NVY B;  4UPA A;  1Q46 A;  2JJQ A;  3PQI A;  2Z9H A;  1QB5 D;  1Q1B A;  1EL0 A;  3L0O A;  4C3J B;  2ZM6 L;  1CKN A;  1VQP A;  2EYO A;  3Q22 A;  2E2I B;  1S5E D;  2B2Y C;  4DK6 C;  4LNQ A;  5BR8 L;  2K28 A;  1Y1W H;  3GTM B;  3TRE A;  3DM1 A;  1FNW A;  1WTO A;  3GTO B;  4GN4 B;  4FP5 D;  1HQM C;  3PIO A;  3UDX A;  1B2T A;  2F0I A;  4DUY Q;  3PUV A;  4Q5V A;  4X62 L;  1I3Q B;  2NZO A;  4C3J G;  3GTK B;  1JB3 A;  4Z9C B;  2AQ3 B;  1S5D D;  2ATW A;  3I4M B;  4QUF A;  3ZYY X;  1X9N A;  4GNX A;  4B3M L;  4XXE A;  4J8Q A;  4DAP A;  3AQQ A;  2KHJ A;  1DXM A;  2F0H A;  2UXB Q;  1KDC A;  3QO2 A;  4UDU C;  2N78 A;  1BCP F;  3K7A B;  5JPN C;  1I94 L;  2E2H H;  2EYP A;  1ESR A;  1ET9 A;  1XNQ Q;  3UE1 A;  5C0X I;  1F77 A;  3I4M G;  5CV5 A;  2H4O A;  3HOY H;  2OQK A;  1F9S A;  2Y0S E;  4IUV A;  4K5X A;  3T1Y Q;  1SNP A;  2R92 H;  1VDZ A;  1LLR D;  4O1N A;  1OXU A;  1HFN A;  4CKE A;  1G51 A;  1LUZ A;  4LWC A;  3BZC A;  4YY3 Q;  1JQY D;  3GV6 A;  1QNU A;  2E2D C;  2XRQ D;  4DV0 Q;  1YNJ D;  5EPK A;  1STG A;  2B2W A;  1Y1W B;  5EAY A;  5C44 G;  2I5L X;  4PNY A;  2WB1 G;  1VQK A;  1A3T A;  4GLV B;  1N36 Q;  2CCZ A;  1U5K A;  1YNJ C;  1I4G A;  3HOW H;  4V19 0;  1O7Z A;  2HQL A;  3BYT B;  3A5Z B;  1L0Y B;  1H9S A;  1KDB A;  1NUC A;  2A1A A;  5FLM G;  2WKC A;  1LV9 A;  4LF9 Q;  1HUM A;  2VQF L;  2E76 C;  3PCO B;  4HCE A;  4G7Z C;  1B1Z A;  3FHW A;  4IOC A;  1PYB A;  3KBX A;  1Y1W G;  3GTP H;  1WFQ A;  4IQZ A;  1FL0 A;  5IGE A;  2K04 A;  3K58 A;  4MIU A;  5CV7 A;  3E6Z X;  4OWT B;  4C3I H;  1KC8 C;  1GM5 A;  4BA2 I;  3KLW A;  1HR0 W;  2KA7 A;  1CA6 A;  1PA6 A;  4LF4 L;  2EVB A;  4OHJ A;  2E2H B;  2TSS A;  1L1O B;  2A68 D;  4YIJ A;  1K8A C;  4N8F A;  1I4R A;  4HSV A;  3IFT A;  2RKS A;  4KHP Q;  1U0L A;  3HOY B;  1VQM A;  3HOV H;  4ZCK A;  3ULL A;  2DJG C;  2R92 B;  1Q8I A;  4HJA A;  5LMU L;  2RSO A;  2DNE A;  4R4C A;  4WJW A;  4CBV A;  1FJG L;  1GXD C;  1XPR A;  1BBU A;  5LMN L;  4HJ5 A;  1Y69 U;  4OGQ C;  1Q82 C;  4YWM A;  4GKK L;  4DV7 Q;  4YHH L;  3I4N H;  2RHQ B;  3GO5 A;  3SHL A;  4AH6 A;  1NJI C;  5CYU A;  4NP5 A;  4DV1 L;  1BNZ A;  1X3F A;  4DA2 A;  3HOW B;  2CQO A;  1CFM A;  3KUP A;  2VW9 A;  1F9Q A;  3M4P A;  1YVC A;  3GD7 A;  3KF6 B;  4ME3 A;  4QUC A;  4B9X A;  3KLS A;  4A4I A;  3GTP B;  2FMC A;  2XSC A;  2Z1C A;  1CQF A;  4EQO A;  3T1H L;  1LT5 D;  4ZUJ A;  1ML0 D;  3H94 A;  2EY6 A;  2XTI A;  2ICE C;  4C3I B;  3HOW G;  1ASZ A;  2CWP A;  5E3F A;  1N8R C;  3CF5 A;  1CSP A;  2IW3 A;  3NTH A;  2Q8T A;  1E22 A;  3QIA A;  3CCU A;  4JI7 L;  4LF6 L;  1SMX A;  4CDD C;  1YBY A;  3MC0 B;  1LTR D;  2CW0 D;  3W1G A;  3HOV B;  1ZXT A;  5J1Z A;  3RZD H;  2WAQ G;  5JEA H;  3S9W A;  3AMU A;  1SE3 A;  2CW0 C;  2Q8R E;  4QL5 A;  1CZG A;  2AQ1 B;  4DR3 L;  4HED A;  4C3I G;  1CHP D;  3DEO A;  5C4X H;  2P5Z X;  2L5T A;  3CXC A;  1G91 A;  3NBH B;  4LW1 A;  1VS0 A;  1CT1 D;  4RGT A;  5IYD H;  3I4N B;  4K0K L;  4UHV A;  1KRT A;  4EGV A;  1TVX A;  4DR1 L;  5CV8 A;  4DR5 Q;  2Z6K A;  2VB3 X;  3HOV G;  4JYA Q;  5M5Y H;  2QCP X;  3FPU B;  3CCS A;  1YIJ A;  4Y52 H;  2F4V L;  3G48 A;  4DK0 A;  4C3H H;  1OXT A;  3L3O C;  3LWE A;  3U9O A;  1HH2 P;  4OEL B;  4RCN A;  5E7N A;  2PI2 A;  2FFK B;  3SR1 A;  2GVA A;  1PH2 A;  1KIX A;  2O5I C;  3ERS X;  3I4N G;  4WFN 3;  3J7Y W;  4QCL A;  1GD7 A;  3KLS X;  4WJ4 A;  4ZRZ A;  4M1U B;  2A69 D;  4ULL A;  2D5D A;  2L15 A;  2MFI A;  4QGU A;  1EIG A;  4X3K A;  3BDC A;  5D3D A;  2GA4 B;  3Q23 A;  1VQH A;  1XNQ L;  1XTD A;  2HCI A;  1GUT A;  1N33 Q;  2F0W A;  1BF4 A;  3EBE A;  2R7Z H;  4RHR A;  1Q12 A;  4J1M A;  2JQO A;  5H1S E;  5JEA J;  3A8J E;  4CDF C;  2NZH A;  5T1G A;  3J80 i;  1TS4 A;  3OPO A;  4A3F H;  2ZXR A;  3J80 E;  3RZD B;  1RTO A;  2VQE Q;  4NPS A;  3NXW A;  4UAI A;  1I5F A;  4YY3 L;  1SRU A;  2H1E A;  4DV3 Q;  2HDM A;  3CU7 A;  2R7D A;  4ZAI A;  5C4X B;  3K81 C;  3ERO A;  3PSI A;  1K0R A;  4A3G G;  2A5H A;  4L5T A;  4FNF A;  4K5V A;  1AZP A;  1JOO A;  2KHI A;  1RL2 A;  2AKW B;  4R8N A;  5FKA C;  3T16 A;  2FHT A;  3VR5 A;  4CJ1 B;  4O2D A;  5M5Y B;  4H44 C;  3FKI H;  3H6M A;  5JEA G;  2K14 A;  3KJO A;  1YJ9 A;  4DR7 L;  1LTS D;  4C3H B;  4HIO A;  5C4X G;  4GLX A;  4JBK A;  1IYU A;  1CSQ A;  2BE5 D;  1SFO H;  1HR0 Q;  1TKW B;  4FDB A;  5IYD G;  2B2Y A;  2V1C C;  4JI5 Q;  2Q2I A;  4QJF A;  3AU7 A;  1SYD A;  2BE5 C;  5EKK A;  1HZ9 A;  2K5W A;  3LWU A;  1B9M A;  3VYU A;  3ER0 A;  1EQV A;  4H7B A;  3HP3 A;  2K5V A;  2JA6 H;  3ND8 A;  2LS0 1;  1ENA A;  3J80 c;  4K5W A;  4C3H G;  3PV0 A;  2B2V C;  4KK7 A;  2K03 A;  1VQF A;  4KHP L;  2R7Z B;  1GUN A;  1IL8 A;  3P7J A;  3EA6 A;  3E3X A;  3QOL A;  1UE6 A;  3A54 A;  4MTN A;  3VR4 A;  4K14 A;  4X3S A;  4A3F B;  4ZQ3 A;  3KBG A;  3NBI A;  5M3M H;  3VYT A;  3HOZ H;  4DF7 A;  1PZK D;  4KTA A;  3I72 A;  1FD7 D;  3I55 A;  4JI1 Q;  2JP1 A;  4KD4 A;  4NW2 A;  4KHZ A;  4A3M H;  2Q2U A;  1YEZ A;  5C3E H;  4OX9 Q;  2LY7 A;  3PIP A;  1IBL Q;  4C56 C;  2VZA A;  1JOK A;  3OHX C;  1ET6 A;  3DWP A;  2XIW A;  4AYB E;  2R7Z G;  4TSS A;  3K57 A;  4CHT B;  3MXG A;  1N32 Q;  4JBW A;  3E9I A;  5J22 A;  1QZH A;  2JA8 G;  2PNR C;  4KY6 A;  2CH4 W;  3FKI B;  1STA A;  3PO2 H;  2DGY A; 
#chains in the Genus database with same CATH homology
 2F0E A;  1AN8 A;  3M85 A;  4RKL A;  2EXZ A;  1QOH A;  4O42 A;  5C4Z A;  1SFO B;  1DOL A;  1BCP D;  1PZJ D;  3BVG A;  2XRS D;  4B08 A;  2XWJ B;  4R9W A;  1XXG A;  1SJE D;  2ENB A;  1XTC D;  5I2X A;  3RMH A;  4G57 A;  4TKO B;  2JA6 B;  3J80 L;  2K33 A;  2QKI C;  4RWS C;  2MHV A;  3SK4 A;  5FLX L;  1F2Z A;  5M3M B;  1V1P A;  3HOZ B;  3SK5 A;  2KCC A;  4A3M B;  3W2D A;  2Z4I A;  5C3E B;  2L55 A;  4K2K A;  3FRP B;  1BUV T;  1T5E A;  3C1E A;  2F0V A;  1WTP A;  1CA5 A;  1EY9 A;  2R61 A;  3OOC A;  3PO2 B;  3NE5 B;  4ID6 A;  1NCV A;  4V0B A;  2KCN A;  3S2D B;  2RDG A;  3MZ5 A;  5M5X B;  2NUC A;  5A2Q E;  3SVM A;  2BA0 A;  4QIW B;  3P20 A;  1GHK A;  1EU3 A;  2OXP A;  2PQE A;  3M7G A;  1OO9 B;  3I73 A;  2RVL A;  1AP0 A;  4A3E B;  4RH6 A;  3MXP A;  1E0B A;  1BBX C;  1TS3 A;  1ZYR D;  2R3Z A;  1IKL A;  4OO1 I;  2C9O A;  2OEO A;  1RTN A;  3F2U A;  3J7A V;  2B8F A;  2MJ8 A;  2IX3 A;  2JYO A;  3SXH A;  3I90 A;  1B50 A;  3OMC A;  1ZKO A;  2DN8 A;  3D4W A;  3FPP A;  2L0C A;  1TWA B;  2C5C A;  4P2C B;  2K01 A;  3MXN A;  5JVH 3;  2NZ1 D;  2L12 A;  3TP5 A;  3T56 B;  2SDF A;  1FR3 A;  3IKJ A;  4QB4 A;  3L7Z C;  1Y8O B;  5KRU A;  1HHV A;  1SE4 A;  3KK7 A;  1SYC A;  4DU9 A;  5K36 H;  1GUS A;  5NUC A;  3VYS A;  5JVG 3;  3CHB D;  1WD1 A;  2B39 A;  3PIO 3;  1H9R A;  3I91 A;  3VA5 A;  2R93 B;  1TT2 A;  2J0T D;  4RAU C;  2QF7 A;  2AUJ D;  1G8Z D;  4QF4 A;  3T4A C;  3C46 A;  1HTL D;  2MGS A;  2EJG C;  1F9P A;  4JK1 C;  2EOT A;  1STH A;  5BN3 A;  3M7N A;  1O80 A;  3G7L A;  3G6J B;  3HG9 A;  1QCB D;  2Q8I B;  1LTG D;  3NP8 A;  1Y8P B;  3O13 A;  1C8C A;  2R6G A;  2F0G A;  1LTB D;  2NN6 I;  3KLR A;  3VA7 A;  4HCS A;  3SDZ A;  5JJZ A;  3J81 L;  1S5F D;  1I4Q A;  5M9O A;  2KED A;  2PW7 A;  5C3X A;  4QMG A;  3QB3 A;  3PO3 B;  4F7X A;  1LAC A;  1HQR D;  5ELC A;  1W6J A;  4TRD A;  5D65 A;  4IUU A;  3L9A X;  4K8J A;  1R9T B;  5K36 G;  4G7O C;  1PYW D;  3S1R B;  5I2Y A;  3FVQ A;  3IAY A;  3K5M A;  4CJ0 B;  1LTA D;  5KNB A;  1V43 A;  4IUQ A;  2F0N A;  2HCC A;  1U9R A;  5LL6 S;  3EJI A;  5DEH A;  1SXT A;  1OXS C;  1JWS D;  2X6G A;  2B2V A;  4IFD H;  3HEJ A;  3HGB A;  2F0J A;  1S5B D;  3S14 B;  1U4M A;  5ELB A;  5KYI A;  4KV6 A;  1TS2 A;  1JWU D;  4K8I A;  2EZV A;  1EEI D;  5I9P A;  4CKC A;  4A3J B;  3FEW X;  1EQT A;  2PW5 A;  2PZU A;  3T13 A;  1JE4 A;  3AB9 A;  4PQX A;  2A6H D;  1Y8N B;  2I07 B;  4DN4 M;  3OSO A;  1D1K A;  2A6H C;  4RHS A;  3BDL A;  1VMC A;  1H9J A;  1TY2 A;  1S5C D;  1PFM A;  3EFX D;  1MSH A;  4FF1 A;  4X3T A;  2EYF A;  1PTO H;  4KJO A;  3Q24 A;  4IFD J;  1EY8 A;  1HCZ A;  1X3Q A;  4DAY A;  1DM0 B;  1WCM B;  3ITP A;  1CK1 A;  1LTT D;  1HTP A;  3VR2 A;  2F0K A;  2WII B;  3H0G B;  2RSN A;  3X3M A;  2EPB A;  1J9O A;  1X32 A;  3MEH A;  5ISR A;  5IOD A;  3S16 B;  1F2M A;  1KNE A;  1F2Y A;  5JPM C;  1GUO A;  4PMB A;  1JCK B;  2WP8 J;  4IFD G;  1K83 B;  3DXJ C;  2IT1 A;  5ELE A;  4R8I A;  2QIL A;  1YNN D;  3GTQ B;  5J39 A;  2O5J C;  1CQV A;  5KYL A;  2OF1 A;  3H09 A;  1YNN C;  1E2Z A;  3TN2 A;  5IT9 E;  1WVL A;  1E2V A;  1D5Z C;  3HOU B;  5BN4 A;  1RKN A;  1RDP D;  3Q6S A;  4FF3 A;  1PTO B;  4BY1 B;  2NVX B;  3S1N B;  3NK9 A;  4U68 A;  1SBB B;  1VMP A;  1DCZ A;  1KLG D;  2KUM A;  1CM9 A;  1UUP A;  2F0Q A;  3N52 A;  1ENC A;  3CKI B;  1CI3 M;  4KN4 C;  3R2I A;  5COY A;  5ELD A;  1B9N A;  1AW7 A;  4E6I A;  4BY7 B;  1QWY A;  4PV1 C;  3S1Q B;  2JEA I;  1TQO A;  3A55 A;  4HMI A;  4I65 A;  3DWQ A;  1ILP A;  2FIN B;  3MFG A;  3VR3 A;  4ZK9 B;  4HSP A;  1MD2 D;  1PZI D;  2EYH A;  3GTL B;  2EE1 A;  5C3W A;  4K6D A;  5C6A A;  3P1H A;  5IGF A;  3OWE B;  2DNC A;  1GOZ A;  1PRT B;  1WTW A;  4ZKC B;  2J7Z A;  1TR5 A;  4I7Z C;  4U67 3;  5FK9 C;  5CV9 A;  3HOX B;  3RD4 A;  2K7V A;  1H9S B;  4G4K A;  1HRJ A;  4DAV A;  5C0X H;  3NQI A;  5IIF A;  1G2S A;  3E0J A;  4L63 B;  3PIP 3;  1L0X B;  4BS9 A;  1XX8 A;  4RCO A;  3I3C A;  1SNQ A;  1PDQ A;  1Q1E A;  5DNF A;  2XWB B;  1KTK A;  1DOK A;  2IX0 A;  5KEE A;  4IUP A;  3BS1 A;  3J7A F;  4AYB B;  3CRL C;  4S3S A;  5HGT A;  4CKB A;  1G29 1;  1SYE A;  2F0L A;  1HXY D;  2FJ2 A;  4IUR A;  1LAB A;  2ICI A;  3K59 A;  2OT2 A;  5EPL A;  4ME5 A;  1RJT A;  3HS0 C;  5EQ0 A;  1I6H B;  1H9K A;  3RLF A;  4LAA A;  2KOL A;  5FOB B;  4LJZ C;  3GV3 A;  2NTS A;  1H9M A;  2B8G A;  2PCF B;  2JEB I;  4ABN A;  4IAL A;  3RZO B;  2WIN B;  5C0X J;  1C4Q A;  3C2P A;  1NSN S;  1A6X A;  3PUW A;  3NUC A;  5TSS A;  3TBI B;  4F87 A;  2FMM A;  4XT3 B;  5C4H A;  4NMZ A;  4ZYS A;  1DOM A;  5KIX A;  2AUK A;  3A7A B;  1A2U A;  5EGT A;  2DY7 A;  4XQQ A;  4FO2 A;  3D4R A;  3TP6 A;  1U4L A;  3V96 A;  5C0X G;  1J8I A;  1BQQ T;  2E74 C;  1F2L A;  1KLU D;  2XNA C;  4A3B B;  1KNA A;  1BDO A;  1EZ8 A;  2NTT A;  3TP8 A;  3R2T A;  3M4Y A;  5G3L F;  1ESF A;  3HZX A;  1VCI A;  2EJF C;  3QG1 A;  2F0M A;  2B63 B;  1U4R A;  3S17 B;  2K1B A;  2K6A A;  1JOQ A;  3IFD A;  5FO7 B;  1JOR A;  2EY2 A;  3TDQ A;  5CR3 A;  5IGB A;  2JA5 B;  3D6W A;  1FYC A;  2EYM A;  1EOT A;  1Z7T A;  2MUY A;  4ZUI A;  2VNU D;  2IWH A;  1MI2 A;  3PUZ A;  1DZ1 A;  2SNM A;  3K5O A;  4G7H C;  1DON A;  5CBA E;  1AZQ A;  2AWN A;  4ZKB B;  2SEB D;  1UEA B;  2VB2 X;  1FNV A;  3ONA B;  4OIJ A;  4L8J A;  1EZ6 A;  2MPM A;  3LX0 A;  1GUG A;  4KMU C;  1RF2 D;  3DHQ A;  1Z6H A;  4A3D B;  1Y1V B;  2F0U A;  4FXK C;  4GZY C;  1SNC A;  4KY7 A;  1ENF A;  3MXU A;  1STE A;  1ILQ A;  1QIL A;  4HTH A;  1Q90 A;  1EY4 A;  1O7L A;  2A6E D;  5KNC A;  3M3Y B;  1GJX A;  1IHZ A;  4KKT A;  3S2H B;  5CC4 A;  2A6E C;  4DFA A;  5FO8 B;  1EYD A;  4XYO A;  2IX1 A;  1R4Q B;  1JR0 D;  1TII D;  2X69 A;  1C48 A;  5IGD A;  4DNR B;  1PTO F;  3PUY A;  1EU4 A;  4FYD A;  1UAP A;  2QEJ C;  2F03 A;  5HUR A;  3NTI A;  1I4X A;  5DAU A;  1II3 A;  3U9S A;  1G2T A;  1GHJ A;  1WTR A;  2VUM B;  1HPC A;  1G6Z A;  2KQ3 A;  3D4D A;  1RD9 D;  1ONL A;  3JAM E;  2ZT9 C;  3BVM A;  2JXM B;  1RCV D;  4XQN A;  1EY6 A;  1ZEQ X;  1NAP A;  1DD2 A;  1NR2 A;  4OIK A;  2IL8 A;  1JWM D;  5ELF A;  1V8Q A;  2MP1 A;  5COR A;  2L11 A;  3QOJ A;  1KAA A;  3BYY B;  5LL6 X;  5A2Q L;  2M9V A;  4Q0F A;  4A3I B;  3EQL C;  3H91 A;  1PRT F;  3R3O A;  2Y0S B;  3NPP A;  1AEX A;  3URY A;  4XDX A;  1TWC B;  2CHB D;  4XQJ A;  4FF2 A;  2Z4H A;  5C5L A;  3TZD A;  1PFN A;  3R93 A;  1V1P B;  2ZXP A;  2DY8 A;  1EFI D;  3NBH A;  2BOS A;  1MBY A;  2D2C C;  3OMG A;  1D5M C;  1I6V C;  2E75 C;  2KEC A;  3X3N A;  5DM6 3;  2JA7 B;  2K5D A;  2HQE A;  1SYB A;  3NQT A;  1IKM A;  3NWS A;  4KN7 C;  1STN A;  3K0Y A;  5C44 B;  2B2U C;  2WB1 B;  1FNU A;  5C5M A;  2D62 A;  1V1O A;  2PO4 A;  4K6L A;  4KKU A;  5JAV A;  1TWH B;  3OWF A;  4C2M B;  3CRK C;  4CJ2 C;  4TQU S;  1HA5 A;  5KGU A;  4XIG S;  5D3I B;  4N9T A;  1VF5 C;  1OXX K;  3JAM L;  1EYC A;  2NB0 A;  3CQZ B;  4H0L C;  2LFN A;  1D2B A;  5CV4 A;  1SE2 A;  5KND A;  2VXW A;  2M00 A;  3BVZ A;  3C3L A;  3BDO A;  2CVR A;  1ROD A;  2WV6 D;  2L4N A;  2N88 A;  2NVT B;  3GTJ B;  3MFY A;  3A7L A;  2N55 A;  2AWO A;  4NDX A;  2NWG A;  2BCO A;  4F88 A;  1F9R A;  3NHH A;  1GUW A;  3W3A A;  3MHB A;  1Q3L A;  2HUG A;  3FMC A;  2PMZ B;  4DNT B;  4C1N I;  5LHY 1;  2PPB C;  1MGS A;  4H13 C;  1TWF B;  2WAC A;  4OO1 H;  1STY A;  2JSO A;  1SAP A;  4XYQ A;  1A3V A;  3M4O B;  2K05 A;  3C1F A;  4EQP A;  2A68 C;  1ICW A;  5AFW A;  2RA4 A;  2K5Q A;  3DWA A;  4DK1 A;  1TS5 A;  1M8A A;  2XVS A;  4PMC A;  1JC7 A;  3HRZ C;  4FXD A;  2F0P A;  5C4J B;  2ID0 A;  2TMP A;  1A3U A;  1EY7 A;  1VF7 A;  3A56 A;  2EY1 A;  5DM7 3;  3TSS A;  5E1F A;  3Q0A A;  4RGO S;  5G3L D;  2Z8L A;  4A93 B;  3D31 A;  1WTV A;  2O4X A;  5CV6 A;  4KKS A;  5I6W A;  4FXG C;  1SND A;  4IN3 A;  1WTQ A;  4HMJ A;  4RFB A;  1PLF A;  2WAQ B;  4LK1 C;  2YYZ A;  5EKI A;  2F3V A;  4A3K B;  2A74 C;  2B2T C;  2EYJ A;  2F1M A;  2EY5 A;  1CTM A;  1X3P A;  4MHE A;  3S1M B;  1HA6 A;  2BDO A;  1BXT A;  4BA1 I;  1JIC A;  4KHV A;  2NYZ D;  2LMC B;  4DXG A;  3I8Z A;  3D8G A;  1QNK A;  2G9D A;  1QG7 A;  4K2L A;  3V2T A;  2QDB A;  5T1I A;  1D6E C;  3S15 B;  1U4P A;  1K8O A;  4OO1 G;  2PZT A;  2LKV A;  2CQA A;  1IYV A;  1O7Y A;  5M3F B;  3SK8 A;  3EVQ A;  3UI2 A;  4EVO A;  3DEP A;  2PZW A;  2NN6 H;  1UNS A;  1SNO A;  1M4V A;  3OW7 A;  1W6K A;  4KY5 A;  4FF4 A;  1B4O A;  4PMW A;  5EKL A;  4RGM A;  4XTC S;  3FDT A;  5I6Y A;  5I9O A;  1MSG A;  3MTS A;  2A69 C;  4A3G B;  1PTO D;  1D1I A;  1HUN A;  4IUT A;  1PTO C;  3OIP A;  1EIH A;  5D14 A;  1NR4 A;  4FVM A;  1CHQ D;  5JOB A;  4ZLT F;  3RUZ A;  1SSO A;  1TY0 A;  2NVQ B;  2D9U A;  5FLX E;  4MN3 A;  5I4D A;  1LT4 D;  5F2D A;  3GQB A;  1STB A;  3MAQ A;  4KI0 A;  5IT9 L;  1BCP B;  4EQN A;  2EJM A;  3SK6 A;  3H3V C;  2V4D A;  1O78 A;  2L1B A;  4HR7 B;  3D6C A;  4LMQ D;  2E2J B;  3ERQ A;  3P75 A;  5CGK A;  3D3R A;  3PUX A;  1D5X C;  1PRT D;  3I70 A;  4Y7N B;  2NN6 G;  5K5P A;  2F0F A;  2EDG A;  1PRT C;  1BR9 A;  3I4L A;  2JA8 B;  1HFG A;  4J6H A;  4KJN A;  2PYK A;  2B2W C;  5CBE E;  3DMU A;  2A73 B;  1PFB A;  2RDF A;  5EJW A;  1LTI D;  1E2W A;  2JE6 I;  1EEF D;  2KJX A;  1B3A A;  2IPK D;  3IL8 A;  2B2U A;  5EBD A;  5BN5 A;  1S4Z A;  3QWN A;  4RA8 A;  4ILW A;  1WD0 A;  4B9W A;  1EY0 A;  3MWY W;  3WDN A;  3VR6 A;  4DXF A;  2IJ0 A;  1I4H A;  3HKZ B;  2F3W A;  2EYL A;  1SMY D;  1B44 D;  4BBR B;  3NTK A;  3ND9 A;  1PMR A;  4RGN A;  1EY5 A;  3NWT A;  2G9H D;  1B53 A;  1TU2 B;  3MVV A;  1SMY C;  4KD3 A;  1EWH A;  2ZXO A;  4CGY B;  3TP7 A;  2F0T A;  4BWG B;  2RBM A;  1BCP C;  1LT3 D;  1BO0 A;  4L6T B;  1EYA A;  4X3U A;  1DYQ A;  1QJO A;  5FO9 B;  2K32 A;  1XWE A;  4IFD I;  1EWC A;  5E4X A;  3VYR A;  5EPJ A;  4IZ8 A;  3K5L A;  2O2L D;  4ODG A;  1I4P A;  5IOC A;  4RKB A;  1TWG B;  5EBC A;  3KF8 A;  1XYI A;  3QJY A;  1I50 B;  3BG3 A;  2NBF A;  3NSW A;  3K5N A;  4NKL A;  3T53 B;  1IW7 D;  4F8M A;  3N6R A;  3LNN A;  1KDA A;  3DUZ A;  3SE0 A;  2F0D A;  1IW7 C;  1SDF A;  3WOE A;  1Z47 A;  3PMF A;  3TZU A;  4OL7 A;  4WOR A;  1LO5 D;  5IGC A;  3OIQ A;  1K8M A;  1SNM A;  3J81 E;  2HDL A;  2AQ2 B;  1SJH D;  1KAB A;  2F0S A;  4BBS B;  2RQX A;  2KEE A;  3R8B A;  1OXV A;  5E4W C;  3GP7 A;  5M5W B;  1ZYR C;  1FGB D;  2SOB A;  1R4P B;  2J4X A;  1SYF A;  2XN9 C;  1A2T A;  2RDH A;  5CMD A;  2B2T A;  5IGG A;  2I46 A;  3WOF A;  4DGZ A;  1PXU A;  2BDN A;  1LT6 D;  2M2L A;  1SYG A;  1DJR D;  4HAE A;  3SEB A;  1T5X D;  2KVM A;  3V05 A;  3A8I E;  2L9H A;  2WKD A;  3K6O A;  1QE6 A;  1A15 A;  5A35 A;  4M8A A;  4HN7 A;  4IUN A;  2BA1 A;  3T51 B;  2X6L A;  4C1N K;  1CZW A;  4XT1 B;  1BOS A;  4N9P A;  2KHS A;  3GTG B;  3MA2 B;  2YU9 B;  1AFP A;  2F4I A;  2SNS A;  3A8K E;  3E5S A;  4WRD A;  3BZD B;  3TME A;  1WTX A;  1SEB D;  2F0O A;  1RHP A;  2NVY B;  1QB5 D;  1Q1B A;  1EL0 A;  4C3J B;  2EYO A;  3Q22 A;  2E2I B;  1S5E D;  2B2Y C;  2K28 A;  3GTM B;  3DM1 A;  1FNW A;  1WTO A;  3GTO B;  4FP5 D;  1HQM C;  1B2T A;  2F0I A;  3PUV A;  4Q5V A;  1I3Q B;  4C3J G;  3GTK B;  1JB3 A;  4Z9C B;  2AQ3 B;  1S5D D;  3I4M B;  4QUF A;  3ZYY X;  4XXE A;  4J8Q A;  4DAP A;  1DXM A;  2F0H A;  1KDC A;  3QO2 A;  4UDU C;  1BCP F;  3K7A B;  5JPN C;  2EYP A;  1ESR A;  1ET9 A;  5C0X I;  1F77 A;  5CV5 A;  2H4O A;  1F9S A;  4IUV A;  4K5X A;  1SNP A;  1VDZ A;  1LLR D;  4O1N A;  1OXU A;  1HFN A;  4CKE A;  1JQY D;  3GV6 A;  1QNU A;  2E2D C;  2XRQ D;  1YNJ D;  5EPK A;  1STG A;  2B2W A;  1Y1W B;  4PNY A;  1A3T A;  1YNJ C;  1I4G A;  4V19 0;  1O7Z A;  3BYT B;  1L0Y B;  1H9S A;  1KDB A;  1NUC A;  2WKC A;  1LV9 A;  1HUM A;  2E76 C;  4HCE A;  4G7Z C;  1B1Z A;  3KBX A;  4IQZ A;  5IGE A;  2K04 A;  3K58 A;  4MIU A;  5CV7 A;  3E6Z X;  4BA2 I;  2KA7 A;  1CA6 A;  2EVB A;  4OHJ A;  2E2H B;  2TSS A;  2A68 D;  4YIJ A;  1I4R A;  4HSV A;  3IFT A;  2RKS A;  3HOY B;  2R92 B;  1Q8I A;  2RSO A;  2DNE A;  4CBV A;  4WJW A;  1GXD C;  1Y69 U;  4OGQ C;  3GO5 A;  3SHL A;  5CYU A;  4NP5 A;  1BNZ A;  4DA2 A;  3HOW B;  1CFM A;  3KUP A;  1F9Q A;  3GD7 A;  4QUC A;  4B9X A;  3KLS A;  3GTP B;  2FMC A;  2XSC A;  2Z1C A;  1CQF A;  4EQO A;  1LT5 D;  4ZUJ A;  1ML0 D;  3H94 A;  2EY6 A;  2ICE C;  4C3I B;  5E3F A;  2IW3 A;  3NTH A;  2Q8T A;  3QIA A;  3MC0 B;  1LTR D;  2CW0 D;  3HOV B;  1ZXT A;  5J1Z A;  5JEA H;  3S9W A;  3AMU A;  1SE3 A;  2CW0 C;  2Q8R E;  1CZG A;  2AQ1 B;  4HED A;  4C3I G;  1CHP D;  3DEO A;  2L5T A;  1G91 A;  1CT1 D;  4RGT A;  3I4N B;  4EGV A;  1TVX A;  5CV8 A;  2VB3 X;  2QCP X;  3FPU B;  4DK0 A;  1OXT A;  3L3O C;  3LWE A;  3U9O A;  4RCN A;  2FFK B;  3SR1 A;  2O5I C;  4WFN 3;  3J7Y W;  4QCL A;  3KLS X;  4ZRZ A;  4M1U B;  2A69 D;  4ULL A;  2D5D A;  1EIG A;  4X3K A;  3BDC A;  5D3D A;  2GA4 B;  3Q23 A;  2HCI A;  1GUT A;  2F0W A;  1BF4 A;  4RHR A;  1Q12 A;  4J1M A;  5JEA J;  3A8J E;  5T1G A;  1TS4 A;  3OPO A;  2ZXR A;  3J80 E;  3RZD B;  1RTO A;  4UAI A;  3NXW A;  2H1E A;  2HDM A;  3CU7 A;  4ZAI A;  5C4X B;  3ERO A;  2A5H A;  4FNF A;  4K5V A;  1AZP A;  1JOO A;  4R8N A;  5FKA C;  3T16 A;  2FHT A;  3VR5 A;  4CJ1 B;  5M5Y B;  4H44 C;  3H6M A;  5JEA G;  1LTS D;  4C3H B;  1IYU A;  2BE5 D;  1TKW B;  2B2Y A;  3AU7 A;  1SYD A;  2BE5 C;  5EKK A;  2K5W A;  3LWU A;  1B9M A;  3VYU A;  1EQV A;  4H7B A;  3HP3 A;  3ND8 A;  2LS0 1;  1ENA A;  4K5W A;  4C3H G;  3PV0 A;  2B2V C;  4KK7 A;  2K03 A;  2R7Z B;  1GUN A;  1IL8 A;  3P7J A;  3EA6 A;  3QOL A;  3A54 A;  3VR4 A;  4K14 A;  4X3S A;  4A3F B;  4ZQ3 A;  3KBG A;  3NBI A;  3VYT A;  4DF7 A;  1PZK D;  4KTA A;  3I72 A;  1FD7 D;  2JP1 A;  4KD4 A;  4NW2 A;  4KHZ A;  2LY7 A;  4C56 C;  1JOK A;  3OHX C;  1ET6 A;  3DWP A;  2XIW A;  4TSS A;  3K57 A;  4CHT B;  3MXG A;  4JBW A;  5J22 A;  2PNR C;  4KY6 A;  3FKI B;  1STA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...