1JOKA

Averaged structure for staphylococcal nuclease-h124l in ternary complex with ca2+ and thymidine-3',5'-bisphosphate
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
149
structure length
149
Chain Sequence
ATSTKKLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQLLRKSEAQAKKEKLNIWSEDNADSGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structures of staphylococcal nuclease from multidimensional, multinuclear NMR: nuclease-H124L and its ternary complex with Ca2+ and thymidine-3',5'-bisphosphate.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords staphylococcal nuclease
total genus 23
structure length 149
sequence length 149
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2001-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1jokA00
4KY5A 1U9RA 5CR3A 2LKVA 4KY7A 3T13A 1AEXA 4EQNA 3R3OA 4KD3A 4R8NA 4KTAA 1SNOA 1IHZA 2M00A 4KJOA 3SR1A 5I6WA 4KJNA 5CV8A 2PZTA 5IGEA 1STGA 4RKLA 1STYA 1EY7A 2F0SA 2F0IA 2F0KA 4NKLA 5K5PA 2SNSA 3E5SA 2EYMA 2EYFA 1SNCA 2PZUA 2OF1A 1KABA 4KY6A 4QF4A 3RUZA 2F0EA 2PQEA 2EYOA 4ZUJA 3TMEA 1A3TA 5IIFA 5IGBA 1JOQA 4EQOA 1A3UA 1EYCA 1TQOA 2OXPA 1ENAA 3MZ5A 2F0DA 4IALA 2F0HA 4ZQ3A 5JOBA 3OMGA 5IGDA 1KDCA 2HQEA 4ODGA 3SK8A 4K2KA 3BDCA 5J22A 2KHSA 4PMCA 4F8MA 5C5LA 2OEOA 4J1MA 5EGTA 2EY6A 4HTHA 2WACA 1F2YA 4K8IA 2F3VA 4OL7A 3V2TA 5IOCA 3ERQA 4LAAA 3EJIA 4PNYA 5DAUA 4DFAA 1SNDA 3HEJA 2PYKA 3BDLA 4ME5A 3OSOA 3S9WA 4N9PA 5C3XA 3P1HA 5C6AA 1KDBA 2EY2A 3NXWA 3NHHA 2F0QA 5M9OA 5C5MA 1EY4A 2ENBA 4MIUA 1SNPA 1SNQA 5EKKA 4DU9A 1EY9A 1EY6A 1EYAA 3D4WA 5F2DA 1EY5A 3QOJA 4YIJA 1SYDA 3P75A 3SK5A 4K6DA 3D8GA 5CV5A 2SOBA 4N9TA 1EY0A 1SYFA 4K5VA 4KHVA 3T16A 5JAVA 4HMJA 4I65A 4DF7A 2QDBA 3SHLA 5NUCA 5J39A 1JOOA 1SYBA 1EYDA 3OMCA 4ID6A 5CV4A 1STNA 5DEHA 4IUNA 3MEHA 3EVQA 1EY8A 3ITPA 5KYIA 3D4DA 5KIXA 2EYPA 4KV6A 5E1FA 5IGFA 4DGZA 3QOLA 3DMUA 2O4XA 5I9PA 2F0VA 4H7BA 4EVOA 1SNMA 4NMZA 5IODA 2F0GA 4PMBA 1STAA 2F0TA 2F0LA 5C4ZA 2EY1A 2F0NA 1NSNS 1F2ZA 4G57A 1STBA 5CV9A 3MHBA 3C1FA 3PMFA 5CC4A 2F0UA 3NUCA 5HURA 2EYJA 3OWFA 4QB4A 2F0FA 5E3FA 5CGKA 2SNMA 3NP8A 5KEEA 2RKSA 2F0PA 1F2MA 4NP5A 1KAAA 1KDAA 5C4HA 1A3VA 2PW5A 5CV7A 4ZUIA 3LX0A 3TP6A 5HGTA 4QMGA 2KQ3A 4K5WA 3TP7A 3MVVA 4KD4A 4B9XA 2EY5A 3VA5A 1ENCA 4TRDA 1SYEA 1NUCA 4K2LA 4K14A 3SK6A 2RBMA 2F0JA 3C1EA 3HZXA 2EXZA 2F3WA 3D6CA 2PW7A 3QB3A 4IZ8A 4S3SA 2EYLA 3SK4A 2F0MA 3TP5A 3TP8A 4WORA 2PZWA 3NQTA 1II3A 4K5XA 5I9OA 4RKBA 5IGGA 5ISRA 3MXPA 1JOKA 4NDXA 2RDFA 5EKLA 5KRUA 1SYCA 1JORA 1A2TA 5J1ZA 1A2UA 1SYGA 5CV6A 1STHA 4F7XA 5I6YA 3H6MA 5KYLA 4E6IA 1EZ8A 3DHQA 5C3WA 1TT2A 3EROA 2F0WA 4EQPA 5IGCA 1TR5A 2EYHA 4WRDA 3NK9A 5KGUA 1EZ6A 1RKNA 4J6HA 4K8JA 4B9WA 1EQVA 2F0OA 2NUCA 3U9OA 4HMIA 3SXHA
chains in the Genus database with same CATH superfamily
3PUWA 3T13A 3UDIA 2LKVA 1FD7D 1LABA 3G6EA 4DV4Q 4J8QA 2JA7G 1JWSD 3HOVB 1HNXL 4CJ0B 1JB7A 1ICFB 3S17B 3GTMB 3KF6B 4IUUA 2C9OA 2K52A 4A3GH 2PO4A 1PTOC 2NN6H 2JA5H 3WOEA 4JOIC 1I94L 4NXMQ 3TMEA 2JYOA 2PNHA 3C2PA 1VF7A 1KHIA 4LF7L 1TQOA 3KUPA 3W5OA 1GO3E 2O5IC 3MXGA 1HA6A 4IALA 3OMGA 3GTQB 1AZPA 1C48A 3CCJA 3CCEA 4GNXB 3HFZB 2OEOA 5I2YA 4LF7Q 3RR5A 1TS2A 5D65A 1MSHA 4A3BH 3P1HA 1IBLL 3NXWA 1D2BA 3NHHA 2CVRA 5C5MA 4HR7B 3BZKA 4TVAB 4RG1A 1F9RA 4DU9A 2A1AA 4K5VA 4HMJA 4DF7A 4HAEA 2AKWB 1VQLA 4ME3A 3FPUB 4DV1L 4JBJA 4KV6A 1QVGA 2B2UC 3FMCA 1WOCA 4KHPL 3PIPA 2Y0SE 1TS5A 1RCVD 4DK3C 4NMZA 2Q2UA 4P74A 1B8AA 5J3BA 1QOHA 5CORA 2NVXB 1ZYRC 3A5ZB 5HURA 1ENFA 4A3JB 1K83H 2EJFC 1LO5D 2MGSA 4DXGA 5CGKA 5KEEA 3E6ZX 1SJHD 1QNKA 1TWFB 4NP5A 2PCFB 2VB2X 4ALPA 1HZAA 2H5XA 2NVTH 3PO2B 2KJXA 1JJGA 4PMWA 1A0IA 1YNJC 3E9IA 5KNBA 4K2LA 4JI7L 1LTID 5LMUQ 4JI3L 3TP8A 4WORA 4HCEA 4TKOB 4A3CH 1JOKA 4C3HH 4YY3L 2UUCQ 1JORA 3I4NG 2GN5A 4KN4C 4F7XA 3HKZB 3MAQA 3DHQA 4XQJA 1ICWA 5IGCA 1KNAA 1TR5A 2EYHA 3NK9A 1N34Q 1EZ6A 1PH4A 3DEOA 1K73C 3SGIA 4XXEA 4KY7A 4ABNA 5IYDH 1PZJD 3EN2A 1N36L 1SNOA 1O7YA 5L37A 2WV6D 4M8AA 3U4VA 4DV5Q 4DR6Q 3PIO3 3U58A 3KYHC 1W2BA 3K7AB 1D1KA 4KK7A 3A54A 1GUSA 1Z7TA 3RUZA 2PQEA 4OHJA 4PV1C 3S16B 1IYVA 2AQ1B 3OTOQ 5M5XB 1Q81C 3K8AA 2D2CC 1KLGD 1TWCH 4UP9A 1YJNA 1Z47A 4ODGA 4DNTB 2UXCQ 4K2KA 1GUWA 5J22A 2EIFA 2NTTA 2EY6A 3J7YW 1IYUA 2MO1A 3GTKH 3M7NA 3TS2A 4N9PA 4A3EH 1DOKA 2B2WC 2XRSD 1TU2B 3QOJA 4N8X1 3K59A 3HOWB 3S14H 5LMUL 4LF8L 4KHVA 1S3OA 4C3JH 1WTWA 1DXMA 3HOXB 3NE5B 4HSPA 5DEHA 4MTNA 2UUCL 3CMEA 3AYHB 3D4DA 1I4RA 3H3VC 3QO2A 3LNNA 1E22A 2DGYA 1B7YB 2F0GA 4PMBA 4QGUA 1EIFA 3I4NB 2OCEA 3C1FA 3BVMA 3CC4A 3HKZG 4IFDI 2AQ3B 1HTLD 2IHFA 4C2MB 5ELBA 1N32Q 1KAAA 1EFWA 2JSOA 2KHIA 3VR5A 2KQ3A 5FLMH 4DR5Q 1BBWA 2NZOA 1DOMA 3MTSA 3VYUA 1SN8A 3KLRA 4R4OA 4X65L 3HKSA 1OTCA 3MEFA 1GHJA 1IW7D 3RLOA 3CCMA 4NDXA 2RDFA 2KHJA 2B2TA 1A2UA 3NPPA 2UXCL 2HHHL 4A3DG 4KMUC 3T1YL 1VQ8A 2BCOA 5C3WA 1TT2A 3EROA 4M1UB 1LLRD 1IKMA 1RKNA 3FKIG 3E3XA 5LMNW 1X9NA 3AB9A 5D14A 3PIP3 2J7ZA 1C8CA 1B3AA 4A3FG 1BQQT 4HIDA 1VQ5A 1N32L 3GDEA 2CH4W 2MHVA 5EKIA 1QZHA 2UU9Q 1TWHH 4DA2A 2K50A 2KOLA 2Z6BA 3S1RH 3SK8A 3GTLB 4OO1H 1OXSC 3HOXG 4QUFA 3DLLA 2KHSA 4ZYSA 1SEBD 2A68C 4HTHA 5C44H 1F2YA 2F3VA 5BN4A 2SEBD 1X55A 1RD9D 5ELFA 1SBBB 3HOUH 3WOFA 1S4ZA 4AYBB 1EY4A 1SNQA 1NMGA 1EY6A 5F2DA 4EGVA 1XMOQ 5M3MH 3H0GB 1PFBA 1BO0A 1L1OB 1JE5A 3GV6A 2IX1A 3H3VH 5CBAE 4FP5D 1W6KA 4JYAL 3J80L 1J8IA 4A3IG 2YYZA 3FVQA 4C3IH 1X3QA 3GTOH 3UI2A 5IYCG 3DMUA 5IT9c 4XDXA 5I9PA 2F4VQ 1HNWL 2VUMH 2QDLA 3MHBA 4A3DB 4YWLA 3NUCA 4XYQA 2WIIB 2F0PA 3LGJA 1F2MA 3I7FA 2B63H 2UXDL 3NTKA 2YU9H 3GTJH 1PDQA 4LF8Q 3S15B 1PRTF 1P16A 5HGTA 5EPJA 1TKWB 2NTSA 4LFCQ 1F9PA 4K14A 4R4TA 2PW7A 3JAML 2F0MA 3ICEA 2PZWA 3M4PA 3JC66 4U68A 1WI5A 4QY7A 1KIXA 2K33A 4YY3Q 1YZ6A 1H9JA 1CKNB 2FMMA 1SE3A 4A3JG 2E76C 1CSQA 2NZHA 4RWSC 3CHBD 4RCNA 1LTTD 1IL2A 1EQVA 3BVZA 2PQAB 1WTOA 3PO2G 1O7IA 5CR3A 2E2IB 3A56A 2HIVA 2K5HA 4GLAC 4JI8L 4LJZC 3S1QB 1PTOB 2PZTA 3PV0A 2F0SA 2FXQA 1EQTA 4AYBG 4B3RQ 1UNSA 5LMNQ 4EQOA 1EYCA 1VQ9A 2R7ZG 3HG9A 3OYYA 5FOBB 1H9SA 2AHOB 4KHPQ 1EFID 1LV9A 3UDFA 2K5VA 3PO3B 1KRTA 3U9SA 3NEMA 4IUPA 1V1PB 1S5FD 1XPRA 1RL2A 1VS0A 4JW0A 2WACA 5ELCA 4XT1B 1VDZA 3ZYYX 4DR3Q 2FMCA 2PYKA 2AMCB 4APVA 4G7HC 1JB3A 1PV4A 3K57A 1WTPA 4K6DA 5JVH3 1SDFA 2Q8TA 1EIYB 3Q6SA 2Z9HA 1YJ9A 1WTRA 2N3SA 1K0SA 4HJAA 3S17H 1ET9A 3J81i 1MBYA 2K5DA 4XIGS 4GKJQ 4QL5A 4IPDA 1SNMA 2ZM6L 5EJWA 2ZXPA 3L0OA 1Y69U 3NBHB 4FXGC 4LF4Q 1CA6A 2LY7A 4BY1H 2EYJA 3OIPA 1FNWA 1Z6HA 5I4DA 2B2VC 2KENA 3K6OA 1H9SB 3VR4A 2CCZA 1E7ZA 1U4RA 3GTPB 3I4MH 4LF4L 3I8ZA 1CQVA 2RQXA 4IPGA 1ILPA 1V1PA 4IZ8A 4KLKA 1GKHA 1VQJA 3X3MA 5A2QE 2XWBB 2I0QA 5EKLA 5KRUA 3VDYA 5GQOA 4FF4A 1QUQA 3BG3A 5IWAQ 3H6MA 3Q24A 2JA8H 4BA1I 3NWTA 2IY5B 1NNXA 3C46A 3DM1A 3L9AX 2E2DC 3S1MH 3GTGB 1YNNC 3SVMA 4JI8Q 1AEXA 4AH6A 4GLXA 1A8VA 1ESRA 1PTOF 2M00A 5DNFA 5M5WH 2JA6H 1IYJB 1DCZA 5K5PA 1MSGA 3OIQA 1D7QA 1GHKA 1HQMC 2KUMA 3S1NH 1N8RC 1EOVA 1XWEA 4KY6A 1AW7A 1TWAB 1JJ2A 3OHXC 5E4XA 4LMQD 2IX0A 2R61A 4IO9A 3KF8A 3J81c 2E2HH 1FYCA 2BA0A 4QIWB 4GKJL 1TVXA 3ZJYC 1HUMA 4OX9Q 5JPMC 3IKJA 3DM3A 5K36G 4A3FB 1RDPD 5IOCA 2MFIA 4WJ3M 4Y7NB 2CW0D 3EJIA 5IP7G 1SNDA 4JK1C 1BCPF 4DR1Q 3I3CA 1EUJA 2DN8A 4WFN3 5M9OA 4CDFC 4DUZL 4A4IA 4JI5Q 3D4WA 4H0LC 1D6EC 1EY5A 4A3MH 4LW1A 1MKHA 1SYFA 2R92H 5JEAJ 4LUVA 1EU3A 5CV4A 1VMPA 1I6HH 1B44D 1Q46A 3Q23A 5E1FA 1ZXTA 1EIGA 5IGFA 4PZ8A 1JR0D 4H44C 2E8GA 4JV5L 2JP1A 4IURA 1EL0A 3T53B 1WCMH 1Q7YC 4G57A 2BDOA 5M5XH 2F4IA 4O42A 4LFBQ 2KCTA 1MJCA 3H0GG 1A3VA 3TN2A 3M4YA 4KN7C 3MVVA 3HOZG 2VQEQ 3RZOB 3A8IE 1S5CD 4A3IB 1Q86C 3EQLC 1D5ZC 3SK4A 3KOJA 1AE3A 2EYLA 4OEMB 1IKLA 1Q90A 4MN3A 2ZM6Q 1LTLA 2DJGC 2GVBA 1HNZL 4DNRB 3PUXA 2QCPX 3HOWH 3S14B 1DGSA 4C3JB 4JV5Q 2F0WA 1S5ED 3NELA 4YHHQ 3SEBA 2NUCA 2IWHA 1YHQA 1S72A 2NVQB 2Y0SB 4DKAC 4A3CG 1AN8A 2D5DA 4JI3Q 3FDTA 3I4NH 1HPCA 1I94Q 4NXML 2EYMA 2RSNA 1KLUD 4ZK9B 3P20A 1FGBD 1WTXA 2EYOA 1HJPA 3F2UA 1YBYA 4C2MH 3PF5A 5FLXE 1Y1VH 1D5XC 1NR4A 3MZ5A 3EA6A 2UUBL 3BVGA 1G6PA 4O0AA 3G4SA 1HZBA 2AUKA 4JC0A 5C3EH 1XNQL 3TS0A 1TWGH 4LFBL 3I2ZA 1U4MA 2MJ8A 2VQFQ 1DJRD 2L1BA 1VQHA 3UDXA 1IBLQ 3K0XA 1YVCA 2D0OA 2R7DA 2A6HD 1LT3D 2CHBD 4HEDA 5JVG3 3I90A 3L2PA 2PNRC 4IPCA 2R7ZB 3KDFA 3U50C 3PGZA 1SAPA 3J80E 1CSPA 3PO3G 5AJ3L 4BS9A 4RCOA 5NUCA 1SYBA 4BBRH 4OWWB 1RHPA 2L9HA 3KBXA 3H91A 2B8FA 4BY7H 1A6XA 3S2HH 4DK1A 1PFMA 2F0NA 3SE0A 2HD3A 3W3AA 5CV9A 4JYAQ 1YNJD 4OXPA 2A6HC 4LFAL 4LF9L 2JXMB 4DR4L 1EU4A 2P5ZX 2AUJD 5E3FA 4C3JG 1N34L 3I72A 1G91A 1K3RA 1MIUA 3NBIA 2RF4A 1XPOA 4QMGA 4K5WA 1R9TB 3F2BA 4PZ6A 2Y0SG 4TRDA 1SYEA 1GJXA 2KCNA 3S24A 4RHSA 2NN6G 4GLVB 2K03A 1CKOA 1JMCA 2JA5G 1UEAB 1FVIA 1NR2A 2J0TD 1BR9A 4A76A 1W3SA 5COYA 4ZAIA 4IJLA 1Y14B 4A75A 4CHTB 4ZKCB 1X3EA 1SYGA 2X6GA 5M3MB 2BDNA 1I50B 3K5OA 4OELB 4WJ4A 3BDOA 4DN4M 1SE2A 3VYTA 1GUNA 2EOTA 1RTNA 4C3IB 4L6TB 2E2JB 5M5YB 4KTAA 1B1ZA 3KJPA 4K6LA 3W1BA 4ZRZA 5I6WA 4KJNA 1YI2A 1IW7C 4KI0A 2KA7A 2Z6KA 5LL6S 2EZVA 1IZ6A 2EYFA 3KFUA 3GTQH 4DAVA 2F0EA 5IGBA 1JOQA 2TSSA 1A3TA 5IIFA 2OT2A 2WINB 4CKEA 4HIOA 1U4PA 1YHBA 4C56C 2VB3X 1HR0L 3BJUA 1FNUA 1JJCB 2RHQB 1JCKB 4I7ZC 1VQCA 3UE1A 1CQFA 4DV2L 3PUVA 3M85A 2EPBA 4K8IA 1PTOD 1D1IA 3ERQA 4LAAA 1EQQA 3K7UC 4DUYQ 4DAPA 1YNND 1X3FA 5EKKA 3I70A 3F8TA 4OWXB 1SXTA 2B29A 2WAQE 1BBXC 1NJIC 4UP7A 5C4XB 3J81j 1JQYD 1D8LA 4I65A 4CDCC 4GKKL 3D31A 2BOSA 1EYGA 1HXYD 1VCIA 1CHPD 2JA5B 2A68D 1WJJA 2WB1G 3KK7A 5IODA 2IL8A 2C5CA 1TWFH 1NSNS 2JJQA 5E4WC 4CDEC 2WP8J 1XTCD 1PHJA 5M3MG 3K81C 3STBD 1Y1WB 1IXRA 2F0FA 2E75C 3TBIB 1KQSA 5BN3A 2CW0C 4QUCA 4OONA 1KNEA 3IFDA 5GAHC 2KCMA 1VQ7A 5CV7A 4CBVA 1QE6A 4C3IG 3QIAA 4EQ5A 2RHSB 2BE5D 1PFSA 1G291 1W6JA 2F0JA 3C1EA 3D6CA 4B3RL 5DM63 2UXBQ 4DV3L 1AZQA 4OGQC 1CT1D 2XVSA 3J81E 3IAYA 2N49A 1HNZQ 1A2TA 1TY0A 1PVOA 4DV6Q 1DD2A 1CKMA 1F9QA 4B08A 2NBFA 3IRBA 1HH2P 3U9OA 5D3DA 2VS1A 3I4OA 4GNXA 1L2FA 3A7AB 2B8GA 3HOZB 1U9RA 3MWYW 3WDNA 2I07B 3R3OA 2Q2HA 4JCVE 4A93H 1X56A 3HOYH 4IUTA 5ELOA 1UUPA 2MNAA 3S16H 3A74A 3CC7A 5EQ0A 2F0KA 4JI4Q 3HOVH 2L55A 3O13A 1LT5D 1TWCB 4A3JH 4HJ9A 3H15A 1SFOB 4BBSH 5KNCA 2MO0A 2OXPA 2NVTB 1AFPA 1KC8C 3M4QA 4JI4L 3GTKB 5M3FH 1PH5A 2H1EA 4CKBA 2ZJQA 4PMCA 4OO1I 3OTOL 4A3EB 3V2TA 4PNYA 3RLFA 4JBMA 2A19A 4DR7Q 3KLSA 2EY2A 1F2LA 1B9MA 2RSOA 2LMCB 1DYQA 4P2CB 4DK0A 3K5NA 4A3BB 4HIMA 1UE5A 5CV5A 4JI1L 2SOBA 5FKAC 3GTGH 5GAEC 1HR0Q 4UDUC 3NSWA 3M3YB 5C4JB 3GP7A 4QJFA 3CQZB 3CCLA 1LACA 3MC0B 5KIXA 5FJ8G 3F2CA 2XNAC 1QILA 2EQSA 4ZCKA 1TWAH 2LXJA 3EFXD 3MFYA 1F2ZA 1STBA 2GA4B 4NPSA 1QWYA 1JT8A 1SMYD 4JI7Q 1S5BD 2VZAA 2NVXH 1K3BC 2MUYA 3QR8A 3TP6A 3PF4A 4Y7NH 3SK6A 4BXXG 4ZKBB 1B50A 5JJZA 3A8JE 3FHWA 1VQIA 5IP9G 4QCLA 1C0AA 2HT1A 5KYLA 3E0EA 2R92B 5IT9E 3HOXH 4K0KQ 4B9WA 4A3KG 1V43A 5BR8Q 2R3ZA 4HSVA 2ATWA 4EQNA 4LFAQ 4X6AH 1NY4A 3M7GA 1XXGA 2ZJRA 1X3GA 2QGQA 3CCVA 1S5DD 3F1ZA 1EY7A 1SLJA 1HZ9A 3S1RB 2IT1A 4QF4A 3GTLH 1FJGL 2RVLA 1SR3A 3LWUA 1N36Q 5IWAL 2CQAA 5C0XJ 2DY8A 2BA1A 3K7AH 4A3BG 3GO5A 1SMXA 2DY7A 1EEFD 1OO9B 2F0HA 3A7LA 3CCQA 4A3IH 4FF1A 5FO7B 5C0XH 1SROA 4FXKC 2F52A 4DAYA 1I3QB 1SRUA 4KKSA 1X65A 1VQ6A 1UWVA 4R9WA 3PUZA 3QJYA 4MIUA 4RGNA 5FLMG 3GV3A 1EIHA 1EY9A 5HGQA 4YCVA 3P75A 5I2XA 4KHZA 4X65Q 1OXUA 1NE3A 1LT6D 4DAMA 4X62L 2YTXA 4KKTA 1ET6A 5J39A 5IGDA 4LF5Q 1PFNA 2K1BA 4DUZQ 1J6QA 4A3DH 4QQBX 4DV3Q 4DR3L 2N88A 1S40A 3T56B 2IX3A 2O5JC 4DR5L 3FKIH 3URYA 1I4QA 2R93H 2X69A 3TDQA 1XX8A 3DWQA 1M90C 2SNMA 3NP8A 4QIWE 1D5MC 5C4XG 1KXLA 5C4HA 1R4PB 4ZUIA 2TMPA 4A3KB 1QB5D 1XJVA 1Q1BA 3D6WA 3GD7A 3CF5A 1B3QA 1I5FA 2E74C 1WVLA 2NN6I 1ENCA 4R4CA 3H3VI 3J80i 2RBMA 1ESFA 1YNXA 2E5LL 4F87A 2CKZB 3FRPB 3OW7A 4JVZA 1HHVA 4X62Q 5I9OA 2L0CA 2ICEC 2WB1B 2JEBI 5IYDG 1CFMA 4H02A 3J7AF 5CV6A 5T1GA 2C35B 4N8FA 2B2WA 2LXKA 2QEXA 1Y1WG 3KLSX 4CJ1B 4X3UA 3ULLA 4E6IA 2E2IH 2N8NA 1G8ZD 5JJIA 4LF6L 3T4AC 5A2QL 3GTMH 2FJ2A 5FLXL 3M4OB 1LTAD 4OX9L 3RMHA 4IFDH 4KY5A 1K28A 3GTOB 4Q5VA 4LUZA 5EPLA 1T5EA 2UXDQ 2OWOA 2Z8LA 4A3LG 2MP1A 1U5KA 2ASBA 3F2DA 3CCRA 1B53A 4BWGB 1PH9A 1N9WA 1HNXQ 3J7ZC 4L5RC 2JE6I 4B3TQ 2DNEA 5JEAH 1E2VA 2EJGC 1YITA 1KAWA 5C0XI 4DV6L 2LFNA 1MJEA 2BH2A 1CUKA 1CZWA 5C5LA 4L63B 2O2LD 4XTCS 3CRLC 4GZYC 2NVYB 3K5LA 5DAUA 3W1GA 1PYWD 4HIKA 1B4OA 2RDGA 3S9WA 5C3XA 3D4RA 5C44B 4UHVA 2B2TC 4DV0Q 1WTHA 4B3SQ 1V8QA 1OXXK 4C1NK 4CDDC 2K04A 1PRTD 3HOUB 4IOCA 1E24A 1Q8IA 1ONLA 2Q8RE 3DXJC 1E2WA 3S2DH 4ID6A 3S1QH 1WFQA 4G7ZC 1VQPA 5EPKA 4TSSA 1GD7A 4PQXA 4A3EG 3MXNB 1ASZA 2OTJA 1UAPA 1LYLA 1HNWQ 4X66L 1Q8KA 4H7BA 1K83B 4X64Q 2KEDA 1STAA 1L0YB 2UUAL 3BYYB 3CD6A 4A3GB 1OXTA 2F0UA 5GAGC 2Q2TA 1LTBD 5EAYA 1C9OA 2EVBA 3Q8DA 4YHHL 2JA9A 2HQLA 1RIPA 4B3SL 1PH1A 1CZGA 3ONAB 1GUGA 3DWPA 3K5MA 3QB3A 4S3SA 1SJED 2A73B 1T5XD 4JI0L 3NQTA 1XMQL 4RKBA 4FNFA 3CU7A 4P75A 1HA5A 5D3IB 3QWNA 2K01A 2X6LA 2KCCA 4DV5L 4JI0Q 4J6HA 1EQRA 4K0KL 4TQUS 1IBMQ 1BNZA 3MA2B 1LTRD 3CC2A 1E2ZA 1IHZA 2VQFL 1G2SA 5IGEA 2SNSA 4UY8C 1FJGQ 4OIKA 4J15A 2K14A 4JG2A 2E2HB 3CAMA 4ZUJA 1PZKD 3RZDH 1AE2A 5CYUA 1AH9A 3NTIA 4POFA 2R92G 3GTPH 3P7JA 5E7NA 4A3FH 1CA5A 4GOPA 1KDCA 1N33L 2K5WA 4V0BA 1LTGD 5T1IA 2A8VA 2D0PA 1FNVA 1HQRD 4OL7A 4DFAA 1CM9A 2QKIC 1V1OA 2YTVA 2G9HD 3OSOA 1PLFA 4FDBA 2A69C 1QNUA 4A3GG 2A74C 4XQNA 5IYCH 5FO8B 4P73A 1EYAA 4LWCA 2XTIA 2A6EC 5JPNC 4A93B 3T51B 1PRTB 3TZUA 1UE6A 2ICIA 3A5UA 3PUYA 4MNOA 1ML0D 1N33Q 2F0TA 3N6RA 2VQEL 4C1NI 4JBWA 2R7FA 2L15A 3RZOH 2RKSA 1CKNA 2KVMA 3RD4A 2PW5A 1O80A 2B2YC 4V190 1RJTA 3KLWA 3ULJA 2Z4HA 2PQAA 1DONA 1EWCA 1J5EL 2CQOA 4CGYB 2PI2A 1EWHA 1K9MC 3PO2H 2WB1E 3E0JA 1GUTA 4YCWA 2H4OA 4IJHA 4UAIA 2LSSA 1B9NA 1WYDA 3KF8B 1VQBA 3AFPA 1DOLA 5EBDA 3CQZH 2KEEA 1VQMA 4KD3A 3JAMi 3T1YQ 1CTMA 1A15A 3UDGA 1HFGA 2E5LQ 1STGA 4UPAA 1XMQQ 5IYBH 3CCSA 2I5LX 1ASYA 1LT4D 1LUZA 1VQDA 1QZGA 1UEBA 4DPGA 3A0JA 3HOYG 1I6VC 3QG1A 2EDGA 4BY7G 2PMZE 4RGOS 3AU7A 4JBKA 3J81L 4Z9CB 4XYOA 4EX5A 4X64L 3JAME 2UUBQ 1X3PA 3BDLA 2D62A 4ME5A 3H0GH 1KDBA 2K05A 4GN3B 4LF5L 2K6AA 2ZTDA 1SNPA 3AMUA 2N78A 1B70B 1X54A 2K32A 4AQYQ 2XN9C 5A35A 5FLXc 1L0WA 4L5TA 1A63A 2UU9L 4WJWA 1GXDC 4DV7L 4DK6C 3E9HA 1JOOA 1E1OA 1RTOA 4A3MB 3N52A 3EVQA 1QVFA 5KYIA 4DV1Q 2B3GA 1JWUD 2FFKB 3MXNA 3I56A 1B2TA 3VR6A 3NTHA 5C44G 4GN4B 3RN5A 1WTVA 2YU9B 4JOIA 4UP8A 3S15H 1X6OA 3OWFA 3V96A 1WD0A 3HOUG 2EXDA 1VQNA 2L5TA 2G9DA 2XIWA 1T9HA 2ZXOA 3G6JB 1BF4A 3TP7A 2JA8G 1L1OA 2HCCA 1Q1EA 4KKUA 4NB3A 1JICA 2EXZA 2F3WA 3TP5A 4DR2L 4O2DA 2JA7H 1BDOA 3CW2C 1II3A 1Y1VG 1I50H 1O7LA 1SYCA 3K0YA 3ULPA 1IL8A 3BU2A 3ERSX 4NXNL 1STHA 2PMZB 1XNQQ 2JN4A 2Z1CA 3M9BA 4WRDA 5KGUA 2VY3A 4K8JA 2F0OA 2K5NA 3NQIA 4JPBW 2FINB 5JJKA 2PI2E 4B3MQ 2V1CC 2VW9A 1M4VA 4BY7B 1YIJA 4R8NA 2OTLA 2XWJB 5IT9L 3OOCA 4KJOA 4JI6Q 4B3TL 3FEWX 5BN5A 1MI2A 3VR3A 4OWTB 1HCZA 2F0IA 5FO9B 4NKLA 1A62A 4MTKA 3H09A 3CCUA 3HRZC 1HFNA 4B3ML 3CKIB 4IUVA 1YHAA 3HKZE 1L0XB 2I5MX 1TIID 1A3UA 2QF7A 3KDFB 3C3LA 2WFWA 5IP7H 2Z4IA 4Q0FA 4A3KH 1ENAA 1GVPA 4RGMA 1WD1A 4NXNQ 3BDCA 4GOPB 3GTJB 3I55A 4J1MA 2WAQG 5G3LF 4LF6Q 5KNDA 2GVAA 4LUOA 2VXWA 1VQEA 1RF2D 1MHWC 1BXTA 1TY2A 2HIXA 1Z9FA 5LL6X 3DWAA 5DM73 3MXUA 4IUQA 4ILWA 2MQHA 3SK5A 1WCMG 2RCNA 4IPHA 3TREA 4FF2A 3M4OH 1EY0A 4BA2I 3T16A 5M5YH 2E2JH 1KL9A 1OXVA 2I5HA 4FVMA 3SHLA 3OMCA 2ZTCA 4DV0L 1STNA 4ZLTF 4AIMA 2YTYA 3ITPA 2EYPA 4DGZA 2IHEA 5EBCA 1YEZA 2AWOA 1GOZA 2F0VA 4BBRB 2XRQD 2DJFC 1VF5C 4EVOA 1WTQA 4GKKQ 1QVCA 1M1KC 1DM0B 2R6GA 4C3HG 3K80C 2L12A 3S2HB 1ZKOA 2CWPA 3Q22A 3TZDA 4AQYL 4FXDA 3JAMc 4GOPC 1JE4A 4A93G 2QILA 1E1TA 4B9XA 4DXFA 1BOSA 2AQ2B 3NWSA 4PG3A 4JI2L 2M2LA 1K8OA 3RLNA 3J7A5 2DNCA 2FHTA 1ZYRD 1PZID 4LNQA 1H9KA 1VQ4A 2HHHQ 2RA4A 1BCPC 2R93G 3S1MB 3NBHA 5JJLA 1VQOA 1CHQD 5M5WB 1PRTC 1PYSB 4HMIA 4MZ9A 1VQGA 1VQAA 4IN3A 3VYRA 3CP0A 2ES2A 2WAQB 3AQQA 3VR2A 3SR1A 1PXUA 2BH8A 1Y8OB 4P71A 5CV8A 1SFOH 4BBSB 4RKLA 1BCPB 3I4MG 1BVSA 1Y1WH 1SNCA 1UE1A 2OQKA 2PZUA 1NCVA 3TRZA 5M3FB 2YV5A 4JI2Q 2IPKD 1Q82C 1PMRA 1QUQB 2JQOA 5FK9C 4HJ7A 4BY1B 1KD1C 2B2VA 3W2DA 2B39A 2F1MA 2B2YA 4IQZA 2F3IA 4GN5A 3NENA 1XYIA 1L1OC 3D0FA 2ZXRA 2NYZD 5LMNL 1Y8NB 4CJ2C 2OQ0A 3PO3H 3DEPA 1BUVT 3HEJA 2F0QA 2HUGA 1O7ZA 4C3HB 3WWVA 2JA6G 1I4XA 5ELEA 4YIJA 1EWIA 1I6HB 2A6ED 5C3EG 3T1HL 4N9TA 4FO2A 4YCUA 2ZJPA 4DR7L 3CRKC 4CKCA 2EJMA 1BCPD 3TSSA 3X3NA 4F88A 2WKCA 3HOYB 4BXXH 1LTSD 5DLQE 3MEHA 5AJ3Q 5ELDA 2A69D 3RN2A 4JI5L 1NAPA 2KBNA 1K0RA 2WKDA 3IL8A 3ND9A 5IP9H 3T1HQ 5GADC 1FR3A 3J80c 2XGTA 4U673 2V4DA 2EY1A 4RHRA 3HGBA 3RZDB 3PMFA 3ER0A 3HS0C 3S1NB 3VA7A 4QB4A 5AFWA 2XSCA 3I4LA 4YWKA 3UE0A 2NZ1D 1FGUA 1XMOL 1STEA 3CPWA 4OIJA 3LX0A 4DV7Q 4L8JA 1HTPA 4KD4A 2UUAQ 4A3MG 3A55A 4G7OC 4HN7A 1G51A 4FF3A 3HOVG 1NUCA 3BZCA 4LFCL 5I6YA 4RMFA 3I73A 2M9VA 1V9PA 1P8LA 5IGGA 2PPBC 3I4MB 3MXPA 3VYSA 2F4VL 1E3PA 5J1ZA 5BR8L 1H95A 4PZ7A 5M3FG 3TQYA 2K7VA 5LHY1 3FP9A 1I4HA 3HP3A 3PSIA 1G6ZA 4ULLA 3M3YH 1DZ1A 4DV4L 4XQQA 1SSOA 2JA8B 2QA4A 1VQFA 2VNUD 4OO1G 1KRSA 4R4QA 3KF6A 1KTKA 3Q0AA 1Y1VB 4LK1C 3HOZH 3E5SA 3BS1A 2JEAI 2L11A 2OF1A 4RA8A 1IBML 1XPUA 2CFMA 4HCSA 4P72A 4H13C 2JA6B 1BKBA 2HDMA 5C3EB 4X3KA 2DUDA 3U4ZA 2F0DA 3KJOA 4ZQ3A 1F77A 2HQEA 5FJ8H 4F8MA 2K75A 2ZTEA 5EGTA 4RH6A 1XNRQ 1SE4A 4GS3A 4JI6L 2KECA 1BBUA 4XT3B 3PIOA 3EIVA 1G2TA 3R8BA 5C6AA 1HZCA 3I91A 5G3LD 1MGSA 2ENBA 4R1JA 2AWNA 4LF9Q 2VUMG 3FPPA 4DR4Q 1J9OA 4DR6L 1H9RA 1SYDA 5CMDA 3D8GA 4DR2Q 2ALYB 2HCIA 3RNUA 2A5HA 2QDBA 2B63G 3IFTA 1U4LA 4IUNA 1EY8A 1CK1A 3KBGA 2N55A 3CPFA 3BZDB 1VMCA 3OWEB 5K36H 1Y8PB 5C4JH 4DUYL 2Z6KC 1FL0A 2F0LA 5TSSA 5C4ZA 2I46A 3EBEA 1LM0A 3A8KE 1XNRL 2RDHA 2NB0A 3L3OC 2Q8IB 2J4XA 1TWHB 1U0LA 2EE1A 3AEVA 1WCMB 4IFDJ 4Y52H 4R4IA 4IFDG 1KDAA 4MHEA 1YJWA 2VL6A 3R2TA 1SMYC 1QG7A 1V1QA 1RODA 1K8GA 1I3QH 2SDFA 1X32A 5HY6A 2Q2IA 3HZXA 4A3LH 2CWAA 2CH4A 1JC7A 2ZT9C 4BBRG 3G48A 1EOTA 1HUNA 5ELNA 5H1SE 1C7YA 1NTGA 1EZ8A 5C0XG 3L7ZC 4EQPA 4POGA 1HR0W 4NW2A 4HJ5A 2R7ZH 2K5QA 4DV2Q 3SXHA 4DAYB 1MD2D 3SDZA 1F9SA 2IJ0A 2B2UA 3TEHB 1I4GA 4IOAA 1STYA 2NWGA 3R2IA 2NVQH 3D3RA 2R93B 2JK8A 1GM5A 1KABA 1Q12A 2LS01 4RGTA 4X3TA 2K4KA 2VUMB 1QJOA 4JI1Q 3HOWG 3AFQA 1O78A 1JWMD 1I4PA 5JOBA 5IY0A 2QW7A 2D9UA 2NVYH 5CBEE 2B63B 5GROA 3MFGA 1PH2A 2JA7B 5IE8A 1PYBA 4R8IA 5IYBG 4BBSG 2RCFA 3CMAA 2QEJC 5C4XH 4L5QA 3PQIA 1PH3A 2MPMA 1TWGB 1ILQA 4DR1L 4BY1G 1R4QB 3PCOB 1NMFA 1PA6A 5JAVA 4GNXC 3OW2A 3V05A 1PH8A 1Q3LA 1EYDA 2IW3A 3G7LA 4HJ8A 1NBWA 1HRJA 1J5EQ 3QOLA 2O4XA 1IBKQ 4AYBE 1PH6A 3BYTB 1M8AA 3H94A 1AP0A 1PTOH 4L5SA 1VQKA 4DNIA 1TS4A 2BE5C 5CC4A 1QCBD 1TXYA 4X3SA 3GQBA 4YWMA 1K8MA 3DUZA 1GUOA 1XTDA 4RAUC 3B6YA 2F03A 1PH7A 3FKIB 3J7AV 4RFBA 1H9MA 2L4NA 3STBC 1SE8A 3CXCA 2EY5A 3VA5A 4O1NA 1K8AC 1CI3M 3R93A 5ISRA 4K5XA 1UE7A 1R9TH 2G5DA 2K28A 5JEAG 1TS3A 4G4KA 1EEID 2Z0SA 3OPOA 3LWEA 4I7AA 1ZEQX 1IBKL 4X66Q 2UXBL 2ID0A 3K58A 1E0BA 3S2DB 1C4QA 3ND8A 4FYDA 3G71A 2HDLA
chains in the Genus database with same CATH topology
3PUWA 3T13A 2LKVA 1FD7D 1LABA 4J8QA 1JWSD 3HOVB 4CJ0B 3S17B 3GTMB 4IUUA 2C9OA 2PO4A 1PTOC 2NN6H 3WOEA 3TMEA 2JYOA 3C2PA 1VF7A 1TQOA 3KUPA 2O5IC 3MXGA 1HA6A 4IALA 3OMGA 3GTQB 1AZPA 1C48A 2OEOA 5I2YA 1TS2A 5D65A 1MSHA 3P1HA 3NXWA 1D2BA 3NHHA 2CVRA 5C5MA 4HR7B 4DU9A 1F9RA 4K5VA 4HMJA 4DF7A 4HAEA 3FPUB 4KV6A 2B2UC 3FMCA 1TS5A 1RCVD 4NMZA 1QOHA 5CORA 2NVXB 1ZYRC 5HURA 1ENFA 4A3JB 2EJFC 2MGSA 1LO5D 4DXGA 5KEEA 5CGKA 3E6ZX 1SJHD 1QNKA 1TWFB 4NP5A 2PCFB 2VB2X 3PO2B 2KJXA 4PMWA 1YNJC 5KNBA 4K2LA 1LTID 3TP8A 4WORA 4HCEA 4TKOB 1JOKA 1JORA 4KN4C 4F7XA 3HKZB 3MAQA 3DHQA 4XQJA 1ICWA 5IGCA 1KNAA 1TR5A 2EYHA 3NK9A 1EZ6A 3DEOA 4XXEA 4KY7A 4ABNA 1PZJD 1SNOA 1O7YA 2WV6D 4M8AA 3PIO3 3K7AB 1D1KA 4KK7A 3A54A 1GUSA 1Z7TA 3RUZA 2PQEA 4OHJA 4PV1C 3S16B 1IYVA 2AQ1B 5M5XB 2D2CC 1KLGD 1Z47A 4ODGA 4DNTB 4K2KA 1GUWA 5J22A 2NTTA 2EY6A 3J7YW 1IYUA 3M7NA 4N9PA 1DOKA 2B2WC 2XRSD 1TU2B 3QOJA 3K59A 3HOWB 4KHVA 1WTWA 1DXMA 3HOXB 3NE5B 4HSPA 5DEHA 3D4DA 1I4RA 3H3VC 3QO2A 3LNNA 2F0GA 4PMBA 3I4NB 3C1FA 3BVMA 4IFDI 2AQ3B 1HTLD 4C2MB 5ELBA 1KAAA 2JSOA 3VR5A 2KQ3A 1DOMA 3MTSA 3VYUA 3KLRA 1GHJA 1IW7D 4NDXA 2RDFA 2B2TA 1A2UA 3NPPA 4KMUC 2BCOA 5C3WA 1TT2A 3EROA 4M1UB 1LLRD 1IKMA 1RKNA 3AB9A 5D14A 3PIP3 2J7ZA 1C8CA 1B3AA 1BQQT 2MHVA 5EKIA 4DA2A 2KOLA 3SK8A 3GTLB 4OO1H 1OXSC 4QUFA 2KHSA 4ZYSA 1SEBD 2A68C 4HTHA 1F2YA 2F3VA 5BN4A 2SEBD 1RD9D 5ELFA 1SBBB 3WOFA 1S4ZA 4AYBB 1EY4A 1SNQA 1EY6A 5F2DA 4EGVA 3H0GB 1PFBA 1BO0A 3GV6A 2IX1A 5CBAE 4FP5D 1W6KA 3J80L 1J8IA 2YYZA 3FVQA 1X3QA 3UI2A 3DMUA 4XDXA 5I9PA 3MHBA 4A3DB 3NUCA 4XYQA 2WIIB 2F0PA 1F2MA 3NTKA 1PDQA 3S15B 1PRTF 5HGTA 5EPJA 1TKWB 2NTSA 1F9PA 4K14A 2PW7A 3JAML 2F0MA 2PZWA 4U68A 2K33A 1H9JA 2FMMA 1SE3A 2E76C 4RWSC 3CHBD 4RCNA 1LTTD 1EQVA 3BVZA 1WTOA 5CR3A 2E2IB 3A56A 3S1QB 4LJZC 1PTOB 2PZTA 3PV0A 2F0SA 1EQTA 1UNSA 4EQOA 1EYCA 3HG9A 5FOBB 1H9SA 1EFID 1LV9A 3PO3B 3U9SA 4IUPA 1V1PB 1S5FD 5ELCA 2WACA 4XT1B 1VDZA 3ZYYX 2FMCA 2PYKA 4G7HC 1JB3A 3K57A 1WTPA 4K6DA 5JVH3 1SDFA 2Q8TA 3Q6SA 1WTRA 1ET9A 1MBYA 2K5DA 4XIGS 1SNMA 5EJWA 2ZXPA 1Y69U 4FXGC 1CA6A 2LY7A 2EYJA 3OIPA 1FNWA 1Z6HA 5I4DA 2B2VC 3K6OA 1H9SB 3VR4A 3GTPB 1U4RA 3I8ZA 1CQVA 2RQXA 1ILPA 1V1PA 4IZ8A 3X3MA 5A2QE 2XWBB 5EKLA 5KRUA 4FF4A 3BG3A 3Q24A 3H6MA 4BA1I 3NWTA 3C46A 3DM1A 3L9AX 2E2DC 3GTGB 1YNNC 3SVMA 1AEXA 1ESRA 1PTOF 2M00A 5DNFA 1DCZA 5K5PA 1MSGA 3OIQA 1GHKA 1HQMC 2KUMA 1XWEA 4KY6A 1AW7A 1TWAB 3OHXC 5E4XA 4LMQD 2IX0A 2R61A 3KF8A 1FYCA 2BA0A 4QIWB 1TVXA 1HUMA 5JPMC 3IKJA 5K36G 4A3FB 1RDPD 5IOCA 4Y7NB 2CW0D 3EJIA 1SNDA 4JK1C 1BCPF 3I3CA 4WFN3 2DN8A 5M9OA 3D4WA 4H0LC 1D6EC 1EY5A 1SYFA 5JEAJ 1EU3A 5CV4A 1VMPA 1B44D 3Q23A 5E1FA 1ZXTA 1EIGA 5IGFA 1JR0D 4H44C 2JP1A 4IURA 1EL0A 3T53B 4G57A 2BDOA 2F4IA 4O42A 1A3VA 3TN2A 3M4YA 4KN7C 3MVVA 3RZOB 3A8IE 1S5CD 4A3IB 3EQLC 1D5ZC 3SK4A 2EYLA 1IKLA 1Q90A 4MN3A 4DNRB 3PUXA 2QCPX 3S14B 4C3JB 2F0WA 1S5ED 3SEBA 2NUCA 2IWHA 2NVQB 2Y0SB 1AN8A 2D5DA 3FDTA 1HPCA 2EYMA 2RSNA 1KLUD 4ZK9B 3P20A 1FGBD 1WTXA 2EYOA 3F2UA 5FLXE 1D5XC 1NR4A 3MZ5A 3EA6A 3BVGA 2AUKA 1U4MA 2MJ8A 1DJRD 2L1BA 2A6HD 1LT3D 2CHBD 4HEDA 5JVG3 3I90A 2PNRC 2R7ZB 1SAPA 3J80E 4BS9A 4RCOA 5NUCA 1SYBA 1RHPA 2L9HA 3KBXA 3H91A 2B8FA 1A6XA 4DK1A 1PFMA 2F0NA 3SE0A 3W3AA 5CV9A 1YNJD 2A6HC 2JXMB 1EU4A 5E3FA 2AUJD 4C3JG 3I72A 1G91A 3NBIA 4QMGA 4K5WA 1R9TB 4TRDA 1SYEA 1GJXA 2KCNA 4RHSA 2NN6G 2K03A 1UEAB 1NR2A 2J0TD 1BR9A 5COYA 4ZAIA 4CHTB 4ZKCB 1SYGA 2X6GA 5M3MB 2BDNA 1I50B 3K5OA 3BDOA 4DN4M 1SE2A 3VYTA 1GUNA 2EOTA 1RTNA 4C3IB 4L6TB 2E2JB 5M5YB 4KTAA 1B1ZA 4K6LA 4ZRZA 5I6WA 4KJNA 1IW7C 4KI0A 2KA7A 5LL6S 2EZVA 2EYFA 4DAVA 2F0EA 5IGBA 1JOQA 2TSSA 1A3TA 5IIFA 2OT2A 2WINB 4CKEA 1U4PA 4C56C 2VB3X 1FNUA 1JCKB 4I7ZC 1CQFA 3PUVA 3M85A 2EPBA 4K8IA 1PTOD 1D1IA 3ERQA 4LAAA 4DAPA 1YNND 5EKKA 3I70A 1SXTA 1BBXC 5C4XB 1JQYD 4I65A 3D31A 2BOSA 1HXYD 1VCIA 1CHPD 2JA5B 2A68D 3KK7A 5IODA 2IL8A 2C5CA 1NSNS 5E4WC 2WP8J 1XTCD 1Y1WB 2F0FA 2E75C 3TBIB 5BN3A 2CW0C 4QUCA 3IFDA 1KNEA 5CV7A 4CBVA 1QE6A 4C3IG 3QIAA 2BE5D 2F0JA 1G291 1W6JA 3C1EA 3D6CA 5DM63 1AZQA 4OGQC 1CT1D 2XVSA 3J81E 3IAYA 1A2TA 1TY0A 1DD2A 1F9QA 4B08A 2NBFA 3U9OA 5D3DA 3A7AB 2B8GA 3HOZB 1U9RA 3MWYW 3WDNA 2I07B 3R3OA 4IUTA 1UUPA 5EQ0A 2F0KA 2L55A 3O13A 1LT5D 1TWCB 1SFOB 5KNCA 2OXPA 2NVTB 1AFPA 3GTKB 2H1EA 4CKBA 4PMCA 4OO1I 4A3EB 3V2TA 4PNYA 3RLFA 3KLSA 2EY2A 1F2LA 1B9MA 2RSOA 2LMCB 1DYQA 4P2CB 4DK0A 3K5NA 4A3BB 5CV5A 2SOBA 5FKAC 4UDUC 3NSWA 3M3YB 5C4JB 3GP7A 3CQZB 1LACA 3MC0B 5KIXA 2XNAC 1QILA 3EFXD 3MFYA 1F2ZA 1STBA 2GA4B 1QWYA 1SMYD 1S5BD 2MUYA 3TP6A 3SK6A 4ZKBB 1B50A 5JJZA 3A8JE 4QCLA 5KYLA 2R92B 5IT9E 4B9WA 1V43A 2R3ZA 4HSVA 4EQNA 3M7GA 1XXGA 1S5DD 1EY7A 3S1RB 2IT1A 4QF4A 2RVLA 3LWUA 2CQAA 5C0XJ 2DY8A 2BA1A 3GO5A 2DY7A 1EEFD 1OO9B 2F0HA 3A7LA 4FF1A 5FO7B 5C0XH 4FXKC 4DAYA 1I3QB 4KKSA 4R9WA 3PUZA 3QJYA 4MIUA 4RGNA 1EIHA 3GV3A 1EY9A 3P75A 5I2XA 4KHZA 1OXUA 1LT6D 4KKTA 1ET6A 5J39A 5IGDA 1PFNA 2K1BA 2N88A 3T56B 2IX3A 2O5JC 3URYA 1I4QA 2X69A 3TDQA 1XX8A 3DWQA 2SNMA 3NP8A 1D5MC 5C4HA 1R4PB 4ZUIA 2TMPA 4A3KB 1QB5D 1Q1BA 3D6WA 3GD7A 1WVLA 2E74C 2NN6I 1ENCA 2RBMA 1ESFA 4F87A 3OW7A 3FRPB 1HHVA 5I9OA 2L0CA 2ICEC 2WB1B 2JEBI 1CFMA 3J7AF 5CV6A 5T1GA 2B2WA 3KLSX 4CJ1B 4X3UA 4E6IA 1G8ZD 3T4AC 5A2QL 2FJ2A 5FLXL 3M4OB 1LTAD 3RMHA 4IFDH 4KY5A 3GTOB 4Q5VA 5EPLA 1T5EA 2Z8LA 2MP1A 1B53A 4BWGB 2JE6I 2DNEA 5JEAH 1E2VA 2EJGC 5C0XI 2LFNA 1CZWA 5C5LA 4L63B 2O2LD 4XTCS 3CRLC 4GZYC 2NVYB 3K5LA 5DAUA 1PYWD 1B4OA 2RDGA 3S9WA 5C3XA 3D4RA 5C44B 2B2TC 1V8QA 1OXXK 4C1NK 2K04A 1PRTD 3HOUB 1Q8IA 1ONLA 2Q8RE 3DXJC 1E2WA 4ID6A 4G7ZC 5EPKA 4TSSA 4PQXA 1UAPA 4H7BA 1K83B 2KEDA 1STAA 1L0YB 3BYYB 4A3GB 1OXTA 2F0UA 1LTBD 2EVBA 1CZGA 3ONAB 1GUGA 3DWPA 3K5MA 3QB3A 4S3SA 1SJED 2A73B 1T5XD 3NQTA 4RKBA 4FNFA 3CU7A 1HA5A 5D3IB 3QWNA 2K01A 2X6LA 2KCCA 4J6HA 4TQUS 1BNZA 3MA2B 1LTRD 1E2ZA 1IHZA 1G2SA 5IGEA 2SNSA 4OIKA 2E2HB 4ZUJA 1PZKD 5CYUA 3NTIA 3P7JA 1CA5A 1KDCA 2K5WA 4V0BA 1LTGD 5T1IA 1FNVA 1HQRD 4OL7A 4DFAA 1CM9A 2QKIC 1V1OA 2G9HD 3OSOA 1PLFA 2A69C 1QNUA 2A74C 4XQNA 5FO8B 1EYAA 2A6EC 5JPNC 4A93B 3T51B 1PRTB 3TZUA 2ICIA 3PUYA 1ML0D 2F0TA 3N6RA 4C1NI 4JBWA 2RKSA 2KVMA 3RD4A 2PW5A 1O80A 2B2YC 4V190 1RJTA 2Z4HA 1DONA 1EWCA 4CGYB 1EWHA 3E0JA 1GUTA 2H4OA 4UAIA 1B9NA 1DOLA 5EBDA 2KEEA 4KD3A 1CTMA 1A15A 1HFGA 1STGA 1LT4D 1I6VC 3QG1A 2EDGA 4RGOS 3AU7A 3J81L 4Z9CB 4XYOA 3JAME 1X3PA 3BDLA 2D62A 4ME5A 1KDBA 2K05A 2K6AA 1SNPA 3AMUA 2K32A 2XN9C 5A35A 4WJWA 1GXDC 1JOOA 1RTOA 4A3MB 3N52A 3EVQA 5KYIA 1JWUD 2FFKB 3MXNA 1B2TA 3VR6A 3NTHA 1WTVA 2YU9B 3OWFA 3V96A 1WD0A 2L5TA 2G9DA 2XIWA 2ZXOA 3G6JB 1BF4A 3TP7A 2HCCA 1Q1EA 4KKUA 1JICA 2EXZA 2F3WA 3TP5A 1BDOA 1II3A 1O7LA 1SYCA 3K0YA 1IL8A 1STHA 2PMZB 2Z1CA 4WRDA 5KGUA 4K8JA 2F0OA 3NQIA 2FINB 1M4VA 4BY7B 4R8NA 2XWJB 5IT9L 3OOCA 4KJOA 3FEWX 5BN5A 1MI2A 3VR3A 1HCZA 2F0IA 5FO9B 4NKLA 3H09A 3HRZC 1HFNA 3CKIB 4IUVA 1L0XB 1TIID 1A3UA 2QF7A 3C3LA 2Z4IA 4Q0FA 1ENAA 4RGMA 1WD1A 3BDCA 3GTJB 4J1MA 5G3LF 5KNDA 2VXWA 1RF2D 1BXTA 1TY2A 5LL6X 3DWAA 5DM73 3MXUA 4IUQA 4ILWA 3SK5A 4FF2A 4BA2I 1EY0A 3T16A 1OXVA 4FVMA 3SHLA 3OMCA 1STNA 4ZLTF 3ITPA 2EYPA 4DGZA 5EBCA 2AWOA 1GOZA 2F0VA 4BBRB 2XRQD 4EVOA 1VF5C 1WTQA 1DM0B 2R6GA 4C3HG 2L12A 3S2HB 1ZKOA 3Q22A 3TZDA 4FXDA 1JE4A 2QILA 4B9XA 4DXFA 1BOSA 2AQ2B 3NWSA 2M2LA 1K8OA 2DNCA 2FHTA 1ZYRD 1PZID 1H9KA 2RA4A 1BCPC 3S1MB 3NBHA 1CHQD 5M5WB 1PRTC 4HMIA 4IN3A 3VYRA 2WAQB 3VR2A 3SR1A 1PXUA 1Y8OB 5CV8A 4BBSB 4RKLA 1BCPB 1SNCA 2PZUA 1NCVA 5M3FB 2IPKD 1PMRA 5FK9C 4BY1B 2B2VA 3W2DA 2B39A 2F1MA 2B2YA 4IQZA 1XYIA 2ZXRA 2NYZD 1Y8NB 4CJ2C 3DEPA 1BUVT 3HEJA 2F0QA 2HUGA 1O7ZA 4C3HB 1I4XA 5ELEA 4YIJA 1I6HB 2A6ED 4N9TA 4FO2A 4CKCA 3CRKC 2EJMA 3TSSA 1BCPD 3X3NA 4F88A 2WKCA 3HOYB 1LTSD 3MEHA 5ELDA 2A69D 1NAPA 2WKDA 3ND9A 3IL8A 1FR3A 4U673 2V4DA 2EY1A 4RHRA 3HGBA 3RZDB 3PMFA 3HS0C 3S1NB 3VA7A 4QB4A 5AFWA 2XSCA 3I4LA 2NZ1D 1STEA 4OIJA 3LX0A 4L8JA 1HTPA 4KD4A 4G7OC 3A55A 4HN7A 4FF3A 1NUCA 5I6YA 3I73A 2M9VA 5IGGA 2PPBC 3I4MB 3MXPA 3VYSA 5J1ZA 2K7VA 5LHY1 1I4HA 3HP3A 1G6ZA 4ULLA 1DZ1A 4XQQA 1SSOA 2JA8B 2VNUD 4OO1G 1KTKA 3Q0AA 1Y1VB 4LK1C 3E5SA 3BS1A 2JEAI 2L11A 2OF1A 4RA8A 4HCSA 4H13C 2JA6B 2HDMA 5C3EB 4X3KA 2F0DA 4ZQ3A 1F77A 2HQEA 4F8MA 5EGTA 4RH6A 1SE4A 2KECA 4XT3B 1G2TA 3R8BA 5C6AA 3I91A 5G3LD 1MGSA 2ENBA 2AWNA 3FPPA 1J9OA 1H9RA 1SYDA 5CMDA 3D8GA 2HCIA 2A5HA 2QDBA 3IFTA 1U4LA 4IUNA 1EY8A 1CK1A 3KBGA 2N55A 3BZDB 1VMCA 3OWEB 5K36H 1Y8PB 5TSSA 2F0LA 5C4ZA 2I46A 3A8KE 2RDHA 2NB0A 3L3OC 2Q8IB 2J4XA 1TWHB 2EE1A 1WCMB 4IFDJ 4IFDG 1KDAA 4MHEA 3R2TA 1SMYC 1QG7A 1RODA 2SDFA 1X32A 3HZXA 1JC7A 2ZT9C 1EOTA 1HUNA 1EZ8A 5C0XG 3L7ZC 4EQPA 4NW2A 2K5QA 3SXHA 1MD2D 3SDZA 1F9SA 2IJ0A 2B2UA 1I4GA 1STYA 2NWGA 3R2IA 3D3RA 2R93B 1KABA 1Q12A 2LS01 4RGTA 4X3TA 2VUMB 1QJOA 1O78A 1JWMD 1I4PA 5JOBA 2D9UA 5CBEE 2B63B 3MFGA 2JA7B 4R8IA 2QEJC 2MPMA 1TWGB 1ILQA 1R4QB 5JAVA 3V05A 1Q3LA 1EYDA 2IW3A 3G7LA 1HRJA 3QOLA 2O4XA 3BYTB 1M8AA 3H94A 1AP0A 1PTOH 1TS4A 2BE5C 5CC4A 1QCBD 4X3SA 3GQBA 1K8MA 3DUZA 1GUOA 4RAUC 2F03A 3FKIB 3J7AV 4RFBA 1H9MA 2L4NA 2EY5A 3VA5A 4O1NA 1CI3M 3R93A 5ISRA 4K5XA 2K28A 5JEAG 1TS3A 4G4KA 1EEID 3OPOA 3LWEA 1ZEQX 2ID0A 3K58A 1E0BA 3S2DB 1C4QA 3ND8A 4FYDA 2HDLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KY5 A;  1U9R A;  5CR3 A;  2LKV A;  4KY7 A;  3T13 A;  1AEX A;  4EQN A;  3R3O A;  4KD3 A;  4R8N A;  4KTA A;  1SNO A;  1IHZ A;  2M00 A;  4KJO A;  3SR1 A;  5I6W A;  4KJN A;  5CV8 A;  2PZT A;  5IGE A;  1STG A;  4RKL A;  1STY A;  1EY7 A;  2F0S A;  2F0I A;  2F0K A;  4NKL A;  5K5P A;  2SNS A;  3E5S A;  2EYM A;  2EYF A;  1SNC A;  2PZU A;  2OF1 A;  1KAB A;  4KY6 A;  4QF4 A;  3RUZ A;  2F0E A;  2PQE A;  2EYO A;  4ZUJ A;  3TME A;  1A3T A;  5IIF A;  5IGB A;  1JOQ A;  4EQO A;  1A3U A;  1EYC A;  1TQO A;  2OXP A;  1ENA A;  3MZ5 A;  2F0D A;  4IAL A;  2F0H A;  4ZQ3 A;  5JOB A;  3OMG A;  5IGD A;  1KDC A;  2HQE A;  4ODG A;  3SK8 A;  4K2K A;  3BDC A;  5J22 A;  2KHS A;  4PMC A;  4F8M A;  5C5L A;  2OEO A;  4J1M A;  5EGT A;  2EY6 A;  4HTH A;  2WAC A;  1F2Y A;  4K8I A;  2F3V A;  4OL7 A;  3V2T A;  5IOC A;  3ERQ A;  4LAA A;  3EJI A;  4PNY A;  5DAU A;  4DFA A;  1SND A;  3HEJ A;  2PYK A;  3BDL A;  4ME5 A;  3OSO A;  3S9W A;  4N9P A;  5C3X A;  3P1H A;  5C6A A;  1KDB A;  2EY2 A;  3NXW A;  3NHH A;  2F0Q A;  5M9O A;  5C5M A;  1EY4 A;  2ENB A;  4MIU A;  1SNP A;  1SNQ A;  5EKK A;  4DU9 A;  1EY9 A;  1EY6 A;  1EYA A;  3D4W A;  5F2D A;  1EY5 A;  3QOJ A;  4YIJ A;  1SYD A;  3P75 A;  3SK5 A;  4K6D A;  3D8G A;  5CV5 A;  2SOB A;  4N9T A;  1EY0 A;  1SYF A;  4K5V A;  4KHV A;  3T16 A;  5JAV A;  4HMJ A;  4I65 A;  4DF7 A;  2QDB A;  3SHL A;  5NUC A;  5J39 A;  1JOO A;  1SYB A;  1EYD A;  3OMC A;  4ID6 A;  5CV4 A;  1STN A;  5DEH A;  4IUN A;  3MEH A;  3EVQ A;  1EY8 A;  3ITP A;  5KYI A;  3D4D A;  5KIX A;  2EYP A;  4KV6 A;  5E1F A;  5IGF A;  4DGZ A;  3QOL A;  3DMU A;  2O4X A;  5I9P A;  2F0V A;  4H7B A;  4EVO A;  1SNM A;  4NMZ A;  5IOD A;  2F0G A;  4PMB A;  1STA A;  2F0T A;  2F0L A;  5C4Z A;  2EY1 A;  2F0N A;  1NSN S;  1F2Z A;  4G57 A;  1STB A;  5CV9 A;  3MHB A;  3C1F A;  3PMF A;  5CC4 A;  2F0U A;  3NUC A;  5HUR A;  2EYJ A;  3OWF A;  4QB4 A;  2F0F A;  5E3F A;  5CGK A;  2SNM A;  3NP8 A;  5KEE A;  2RKS A;  2F0P A;  1F2M A;  4NP5 A;  1KAA A;  1KDA A;  5C4H A;  1A3V A;  2PW5 A;  5CV7 A;  4ZUI A;  3LX0 A;  3TP6 A;  5HGT A;  4QMG A;  2KQ3 A;  4K5W A;  3TP7 A;  3MVV A;  4KD4 A;  4B9X A;  2EY5 A;  3VA5 A;  1ENC A;  4TRD A;  1SYE A;  1NUC A;  4K2L A;  4K14 A;  3SK6 A;  2RBM A;  2F0J A;  3C1E A;  3HZX A;  2EXZ A;  2F3W A;  3D6C A;  2PW7 A;  3QB3 A;  4IZ8 A;  4S3S A;  2EYL A;  3SK4 A;  2F0M A;  3TP5 A;  3TP8 A;  4WOR A;  2PZW A;  3NQT A;  1II3 A;  4K5X A;  5I9O A;  4RKB A;  5IGG A;  5ISR A;  3MXP A;  1JOK A;  4NDX A;  2RDF A;  5EKL A;  5KRU A;  1SYC A;  1JOR A;  1A2T A;  5J1Z A;  1A2U A;  1SYG A;  5CV6 A;  1STH A;  4F7X A;  5I6Y A;  3H6M A;  5KYL A;  4E6I A;  1EZ8 A;  3DHQ A;  5C3W A;  1TT2 A;  3ERO A;  2F0W A;  4EQP A;  5IGC A;  1TR5 A;  2EYH A;  4WRD A;  3NK9 A;  5KGU A;  1EZ6 A;  1RKN A;  4J6H A;  4K8J A;  4B9W A;  1EQV A;  2F0O A;  2NUC A;  3U9O A;  4HMI A;  3SXH A; 
#chains in the Genus database with same CATH topology
 3PUW A;  3T13 A;  3UDI A;  2LKV A;  1FD7 D;  1LAB A;  3G6E A;  4DV4 Q;  4J8Q A;  2JA7 G;  1JWS D;  3HOV B;  1HNX L;  4CJ0 B;  1JB7 A;  1ICF B;  3S17 B;  3GTM B;  3KF6 B;  4IUU A;  2C9O A;  2K52 A;  4A3G H;  2PO4 A;  1PTO C;  2NN6 H;  2JA5 H;  3WOE A;  4JOI C;  1I94 L;  4NXM Q;  3TME A;  2JYO A;  2PNH A;  3C2P A;  1VF7 A;  1KHI A;  4LF7 L;  1TQO A;  3KUP A;  3W5O A;  1GO3 E;  2O5I C;  3MXG A;  1HA6 A;  4IAL A;  3OMG A;  3GTQ B;  1AZP A;  1C48 A;  3CCJ A;  3CCE A;  4GNX B;  3HFZ B;  2OEO A;  5I2Y A;  4LF7 Q;  3RR5 A;  1TS2 A;  5D65 A;  1MSH A;  4A3B H;  3P1H A;  1IBL L;  3NXW A;  1D2B A;  3NHH A;  2CVR A;  5C5M A;  4HR7 B;  3BZK A;  4TVA B;  4RG1 A;  1F9R A;  4DU9 A;  2A1A A;  4K5V A;  4HMJ A;  4DF7 A;  4HAE A;  2AKW B;  1VQL A;  4ME3 A;  3FPU B;  4DV1 L;  4JBJ A;  4KV6 A;  1QVG A;  2B2U C;  3FMC A;  1WOC A;  4KHP L;  3PIP A;  2Y0S E;  1TS5 A;  1RCV D;  4DK3 C;  4NMZ A;  2Q2U A;  4P74 A;  1B8A A;  5J3B A;  1QOH A;  5COR A;  2NVX B;  1ZYR C;  3A5Z B;  5HUR A;  1ENF A;  4A3J B;  1K83 H;  2EJF C;  1LO5 D;  2MGS A;  4DXG A;  5CGK A;  5KEE A;  3E6Z X;  1SJH D;  1QNK A;  1TWF B;  4NP5 A;  2PCF B;  2VB2 X;  4ALP A;  1HZA A;  2H5X A;  2NVT H;  3PO2 B;  2KJX A;  1JJG A;  4PMW A;  1A0I A;  1YNJ C;  3E9I A;  5KNB A;  4K2L A;  4JI7 L;  1LTI D;  5LMU Q;  4JI3 L;  3TP8 A;  4WOR A;  4HCE A;  4TKO B;  4A3C H;  1JOK A;  4C3H H;  4YY3 L;  2UUC Q;  1JOR A;  3I4N G;  2GN5 A;  4KN4 C;  4F7X A;  3HKZ B;  3MAQ A;  3DHQ A;  4XQJ A;  1ICW A;  5IGC A;  1KNA A;  1TR5 A;  2EYH A;  3NK9 A;  1N34 Q;  1EZ6 A;  1PH4 A;  3DEO A;  1K73 C;  3SGI A;  4XXE A;  4KY7 A;  4ABN A;  5IYD H;  1PZJ D;  3EN2 A;  1N36 L;  1SNO A;  1O7Y A;  5L37 A;  2WV6 D;  4M8A A;  3U4V A;  4DV5 Q;  4DR6 Q;  3PIO 3;  3U58 A;  3KYH C;  1W2B A;  3K7A B;  1D1K A;  4KK7 A;  3A54 A;  1GUS A;  1Z7T A;  3RUZ A;  2PQE A;  4OHJ A;  4PV1 C;  3S16 B;  1IYV A;  2AQ1 B;  3OTO Q;  5M5X B;  1Q81 C;  3K8A A;  2D2C C;  1KLG D;  1TWC H;  4UP9 A;  1YJN A;  1Z47 A;  4ODG A;  4DNT B;  2UXC Q;  4K2K A;  1GUW A;  5J22 A;  2EIF A;  2NTT A;  2EY6 A;  3J7Y W;  1IYU A;  2MO1 A;  3GTK H;  3M7N A;  3TS2 A;  4N9P A;  4A3E H;  1DOK A;  2B2W C;  2XRS D;  1TU2 B;  3QOJ A;  4N8X 1;  3K59 A;  3HOW B;  3S14 H;  5LMU L;  4LF8 L;  4KHV A;  1S3O A;  4C3J H;  1WTW A;  1DXM A;  3HOX B;  3NE5 B;  4HSP A;  5DEH A;  4MTN A;  2UUC L;  3CME A;  3AYH B;  3D4D A;  1I4R A;  3H3V C;  3QO2 A;  3LNN A;  1E22 A;  2DGY A;  1B7Y B;  2F0G A;  4PMB A;  4QGU A;  1EIF A;  3I4N B;  2OCE A;  3C1F A;  3BVM A;  3CC4 A;  3HKZ G;  4IFD I;  2AQ3 B;  1HTL D;  2IHF A;  4C2M B;  5ELB A;  1N32 Q;  1KAA A;  1EFW A;  2JSO A;  2KHI A;  3VR5 A;  2KQ3 A;  5FLM H;  4DR5 Q;  1BBW A;  2NZO A;  1DOM A;  3MTS A;  3VYU A;  1SN8 A;  3KLR A;  4R4O A;  4X65 L;  3HKS A;  1OTC A;  3MEF A;  1GHJ A;  1IW7 D;  3RLO A;  3CCM A;  4NDX A;  2RDF A;  2KHJ A;  2B2T A;  1A2U A;  3NPP A;  2UXC L;  2HHH L;  4A3D G;  4KMU C;  3T1Y L;  1VQ8 A;  2BCO A;  5C3W A;  1TT2 A;  3ERO A;  4M1U B;  1LLR D;  1IKM A;  1RKN A;  3FKI G;  3E3X A;  5LMN W;  1X9N A;  3AB9 A;  5D14 A;  3PIP 3;  2J7Z A;  1C8C A;  1B3A A;  4A3F G;  1BQQ T;  4HID A;  1VQ5 A;  1N32 L;  3GDE A;  2CH4 W;  2MHV A;  5EKI A;  1QZH A;  2UU9 Q;  1TWH H;  4DA2 A;  2K50 A;  2KOL A;  2Z6B A;  3S1R H;  3SK8 A;  3GTL B;  4OO1 H;  1OXS C;  3HOX G;  4QUF A;  3DLL A;  2KHS A;  4ZYS A;  1SEB D;  2A68 C;  4HTH A;  5C44 H;  1F2Y A;  2F3V A;  5BN4 A;  2SEB D;  1X55 A;  1RD9 D;  5ELF A;  1SBB B;  3HOU H;  3WOF A;  1S4Z A;  4AYB B;  1EY4 A;  1SNQ A;  1NMG A;  1EY6 A;  5F2D A;  4EGV A;  1XMO Q;  5M3M H;  3H0G B;  1PFB A;  1BO0 A;  1L1O B;  1JE5 A;  3GV6 A;  2IX1 A;  3H3V H;  5CBA E;  4FP5 D;  1W6K A;  4JYA L;  3J80 L;  1J8I A;  4A3I G;  2YYZ A;  3FVQ A;  4C3I H;  1X3Q A;  3GTO H;  3UI2 A;  5IYC G;  3DMU A;  5IT9 c;  4XDX A;  5I9P A;  2F4V Q;  1HNW L;  2VUM H;  2QDL A;  3MHB A;  4A3D B;  4YWL A;  3NUC A;  4XYQ A;  2WII B;  2F0P A;  3LGJ A;  1F2M A;  3I7F A;  2B63 H;  2UXD L;  3NTK A;  2YU9 H;  3GTJ H;  1PDQ A;  4LF8 Q;  3S15 B;  1PRT F;  1P16 A;  5HGT A;  5EPJ A;  1TKW B;  2NTS A;  4LFC Q;  1F9P A;  4K14 A;  4R4T A;  2PW7 A;  3JAM L;  2F0M A;  3ICE A;  2PZW A;  3M4P A;  3JC6 6;  4U68 A;  1WI5 A;  4QY7 A;  1KIX A;  2K33 A;  4YY3 Q;  1YZ6 A;  1H9J A;  1CKN B;  2FMM A;  1SE3 A;  4A3J G;  2E76 C;  1CSQ A;  2NZH A;  4RWS C;  3CHB D;  4RCN A;  1LTT D;  1IL2 A;  1EQV A;  3BVZ A;  2PQA B;  1WTO A;  3PO2 G;  1O7I A;  5CR3 A;  2E2I B;  3A56 A;  2HIV A;  2K5H A;  4GLA C;  4JI8 L;  4LJZ C;  3S1Q B;  1PTO B;  2PZT A;  3PV0 A;  2F0S A;  2FXQ A;  1EQT A;  4AYB G;  4B3R Q;  1UNS A;  5LMN Q;  4EQO A;  1EYC A;  1VQ9 A;  2R7Z G;  3HG9 A;  3OYY A;  5FOB B;  1H9S A;  2AHO B;  4KHP Q;  1EFI D;  1LV9 A;  3UDF A;  2K5V A;  3PO3 B;  1KRT A;  3U9S A;  3NEM A;  4IUP A;  1V1P B;  1S5F D;  1XPR A;  1RL2 A;  1VS0 A;  4JW0 A;  2WAC A;  5ELC A;  4XT1 B;  1VDZ A;  3ZYY X;  4DR3 Q;  2FMC A;  2PYK A;  2AMC B;  4APV A;  4G7H C;  1JB3 A;  1PV4 A;  3K57 A;  1WTP A;  4K6D A;  5JVH 3;  1SDF A;  2Q8T A;  1EIY B;  3Q6S A;  2Z9H A;  1YJ9 A;  1WTR A;  2N3S A;  1K0S A;  4HJA A;  3S17 H;  1ET9 A;  3J81 i;  1MBY A;  2K5D A;  4XIG S;  4GKJ Q;  4QL5 A;  4IPD A;  1SNM A;  2ZM6 L;  5EJW A;  2ZXP A;  3L0O A;  1Y69 U;  3NBH B;  4FXG C;  4LF4 Q;  1CA6 A;  2LY7 A;  4BY1 H;  2EYJ A;  3OIP A;  1FNW A;  1Z6H A;  5I4D A;  2B2V C;  2KEN A;  3K6O A;  1H9S B;  3VR4 A;  2CCZ A;  1E7Z A;  1U4R A;  3GTP B;  3I4M H;  4LF4 L;  3I8Z A;  1CQV A;  2RQX A;  4IPG A;  1ILP A;  1V1P A;  4IZ8 A;  4KLK A;  1GKH A;  1VQJ A;  3X3M A;  5A2Q E;  2XWB B;  2I0Q A;  5EKL A;  5KRU A;  3VDY A;  5GQO A;  4FF4 A;  1QUQ A;  3BG3 A;  5IWA Q;  3H6M A;  3Q24 A;  2JA8 H;  4BA1 I;  3NWT A;  2IY5 B;  1NNX A;  3C46 A;  3DM1 A;  3L9A X;  2E2D C;  3S1M H;  3GTG B;  1YNN C;  3SVM A;  4JI8 Q;  1AEX A;  4AH6 A;  4GLX A;  1A8V A;  1ESR A;  1PTO F;  2M00 A;  5DNF A;  5M5W H;  2JA6 H;  1IYJ B;  1DCZ A;  5K5P A;  1MSG A;  3OIQ A;  1D7Q A;  1GHK A;  1HQM C;  2KUM A;  3S1N H;  1N8R C;  1EOV A;  1XWE A;  4KY6 A;  1AW7 A;  1TWA B;  1JJ2 A;  3OHX C;  5E4X A;  4LMQ D;  2IX0 A;  2R61 A;  4IO9 A;  3KF8 A;  3J81 c;  2E2H H;  1FYC A;  2BA0 A;  4QIW B;  4GKJ L;  1TVX A;  3ZJY C;  1HUM A;  4OX9 Q;  5JPM C;  3IKJ A;  3DM3 A;  5K36 G;  4A3F B;  1RDP D;  5IOC A;  2MFI A;  4WJ3 M;  4Y7N B;  2CW0 D;  3EJI A;  5IP7 G;  1SND A;  4JK1 C;  1BCP F;  4DR1 Q;  3I3C A;  1EUJ A;  2DN8 A;  4WFN 3;  5M9O A;  4CDF C;  4DUZ L;  4A4I A;  4JI5 Q;  3D4W A;  4H0L C;  1D6E C;  1EY5 A;  4A3M H;  4LW1 A;  1MKH A;  1SYF A;  2R92 H;  5JEA J;  4LUV A;  1EU3 A;  5CV4 A;  1VMP A;  1I6H H;  1B44 D;  1Q46 A;  3Q23 A;  5E1F A;  1ZXT A;  1EIG A;  5IGF A;  4PZ8 A;  1JR0 D;  4H44 C;  2E8G A;  4JV5 L;  2JP1 A;  4IUR A;  1EL0 A;  3T53 B;  1WCM H;  1Q7Y C;  4G57 A;  2BDO A;  5M5X H;  2F4I A;  4O42 A;  4LFB Q;  2KCT A;  1MJC A;  3H0G G;  1A3V A;  3TN2 A;  3M4Y A;  4KN7 C;  3MVV A;  3HOZ G;  2VQE Q;  3RZO B;  3A8I E;  1S5C D;  4A3I B;  1Q86 C;  3EQL C;  1D5Z C;  3SK4 A;  3KOJ A;  1AE3 A;  2EYL A;  4OEM B;  1IKL A;  1Q90 A;  4MN3 A;  2ZM6 Q;  1LTL A;  2DJG C;  2GVB A;  1HNZ L;  4DNR B;  3PUX A;  2QCP X;  3HOW H;  3S14 B;  1DGS A;  4C3J B;  4JV5 Q;  2F0W A;  1S5E D;  3NEL A;  4YHH Q;  3SEB A;  2NUC A;  2IWH A;  1YHQ A;  1S72 A;  2NVQ B;  2Y0S B;  4DKA C;  4A3C G;  1AN8 A;  2D5D A;  4JI3 Q;  3FDT A;  3I4N H;  1HPC A;  1I94 Q;  4NXM L;  2EYM A;  2RSN A;  1KLU D;  4ZK9 B;  3P20 A;  1FGB D;  1WTX A;  2EYO A;  1HJP A;  3F2U A;  1YBY A;  4C2M H;  3PF5 A;  5FLX E;  1Y1V H;  1D5X C;  1NR4 A;  3MZ5 A;  3EA6 A;  2UUB L;  3BVG A;  1G6P A;  4O0A A;  3G4S A;  1HZB A;  2AUK A;  4JC0 A;  5C3E H;  1XNQ L;  3TS0 A;  1TWG H;  4LFB L;  3I2Z A;  1U4M A;  2MJ8 A;  2VQF Q;  1DJR D;  2L1B A;  1VQH A;  3UDX A;  1IBL Q;  3K0X A;  1YVC A;  2D0O A;  2R7D A;  2A6H D;  1LT3 D;  2CHB D;  4HED A;  5JVG 3;  3I90 A;  3L2P A;  2PNR C;  4IPC A;  2R7Z B;  3KDF A;  3U50 C;  3PGZ A;  1SAP A;  3J80 E;  1CSP A;  3PO3 G;  5AJ3 L;  4BS9 A;  4RCO A;  5NUC A;  1SYB A;  4BBR H;  4OWW B;  1RHP A;  2L9H A;  3KBX A;  3H91 A;  2B8F A;  4BY7 H;  1A6X A;  3S2H H;  4DK1 A;  1PFM A;  2F0N A;  3SE0 A;  2HD3 A;  3W3A A;  5CV9 A;  4JYA Q;  1YNJ D;  4OXP A;  2A6H C;  4LFA L;  4LF9 L;  2JXM B;  4DR4 L;  1EU4 A;  2P5Z X;  2AUJ D;  5E3F A;  4C3J G;  1N34 L;  3I72 A;  1G91 A;  1K3R A;  1MIU A;  3NBI A;  2RF4 A;  1XPO A;  4QMG A;  4K5W A;  1R9T B;  3F2B A;  4PZ6 A;  2Y0S G;  4TRD A;  1SYE A;  1GJX A;  2KCN A;  3S24 A;  4RHS A;  2NN6 G;  4GLV B;  2K03 A;  1CKO A;  1JMC A;  2JA5 G;  1UEA B;  1FVI A;  1NR2 A;  2J0T D;  1BR9 A;  4A76 A;  1W3S A;  5COY A;  4ZAI A;  4IJL A;  1Y14 B;  4A75 A;  4CHT B;  4ZKC B;  1X3E A;  1SYG A;  2X6G A;  5M3M B;  2BDN A;  1I50 B;  3K5O A;  4OEL B;  4WJ4 A;  3BDO A;  4DN4 M;  1SE2 A;  3VYT A;  1GUN A;  2EOT A;  1RTN A;  4C3I B;  4L6T B;  2E2J B;  5M5Y B;  4KTA A;  1B1Z A;  3KJP A;  4K6L A;  3W1B A;  4ZRZ A;  5I6W A;  4KJN A;  1YI2 A;  1IW7 C;  4KI0 A;  2KA7 A;  2Z6K A;  5LL6 S;  2EZV A;  1IZ6 A;  2EYF A;  3KFU A;  3GTQ H;  4DAV A;  2F0E A;  5IGB A;  1JOQ A;  2TSS A;  1A3T A;  5IIF A;  2OT2 A;  2WIN B;  4CKE A;  4HIO A;  1U4P A;  1YHB A;  4C56 C;  2VB3 X;  1HR0 L;  3BJU A;  1FNU A;  1JJC B;  2RHQ B;  1JCK B;  4I7Z C;  1VQC A;  3UE1 A;  1CQF A;  4DV2 L;  3PUV A;  3M85 A;  2EPB A;  4K8I A;  1PTO D;  1D1I A;  3ERQ A;  4LAA A;  1EQQ A;  3K7U C;  4DUY Q;  4DAP A;  1YNN D;  1X3F A;  5EKK A;  3I70 A;  3F8T A;  4OWX B;  1SXT A;  2B29 A;  2WAQ E;  1BBX C;  1NJI C;  4UP7 A;  5C4X B;  3J81 j;  1JQY D;  1D8L A;  4I65 A;  4CDC C;  4GKK L;  3D31 A;  2BOS A;  1EYG A;  1HXY D;  1VCI A;  1CHP D;  2JA5 B;  2A68 D;  1WJJ A;  2WB1 G;  3KK7 A;  5IOD A;  2IL8 A;  2C5C A;  1TWF H;  1NSN S;  2JJQ A;  5E4W C;  4CDE C;  2WP8 J;  1XTC D;  1PHJ A;  5M3M G;  3K81 C;  3STB D;  1Y1W B;  1IXR A;  2F0F A;  2E75 C;  3TBI B;  1KQS A;  5BN3 A;  2CW0 C;  4QUC A;  4OON A;  1KNE A;  3IFD A;  5GAH C;  2KCM A;  1VQ7 A;  5CV7 A;  4CBV A;  1QE6 A;  4C3I G;  3QIA A;  4EQ5 A;  2RHS B;  2BE5 D;  1PFS A;  1G29 1;  1W6J A;  2F0J A;  3C1E A;  3D6C A;  4B3R L;  5DM6 3;  2UXB Q;  4DV3 L;  1AZQ A;  4OGQ C;  1CT1 D;  2XVS A;  3J81 E;  3IAY A;  2N49 A;  1HNZ Q;  1A2T A;  1TY0 A;  1PVO A;  4DV6 Q;  1DD2 A;  1CKM A;  1F9Q A;  4B08 A;  2NBF A;  3IRB A;  1HH2 P;  3U9O A;  5D3D A;  2VS1 A;  3I4O A;  4GNX A;  1L2F A;  3A7A B;  2B8G A;  3HOZ B;  1U9R A;  3MWY W;  3WDN A;  2I07 B;  3R3O A;  2Q2H A;  4JCV E;  4A93 H;  1X56 A;  3HOY H;  4IUT A;  5ELO A;  1UUP A;  2MNA A;  3S16 H;  3A74 A;  3CC7 A;  5EQ0 A;  2F0K A;  4JI4 Q;  3HOV H;  2L55 A;  3O13 A;  1LT5 D;  1TWC B;  4A3J H;  4HJ9 A;  3H15 A;  1SFO B;  4BBS H;  5KNC A;  2MO0 A;  2OXP A;  2NVT B;  1AFP A;  1KC8 C;  3M4Q A;  4JI4 L;  3GTK B;  5M3F H;  1PH5 A;  2H1E A;  4CKB A;  2ZJQ A;  4PMC A;  4OO1 I;  3OTO L;  4A3E B;  3V2T A;  4PNY A;  3RLF A;  4JBM A;  2A19 A;  4DR7 Q;  3KLS A;  2EY2 A;  1F2L A;  1B9M A;  2RSO A;  2LMC B;  1DYQ A;  4P2C B;  4DK0 A;  3K5N A;  4A3B B;  4HIM A;  1UE5 A;  5CV5 A;  4JI1 L;  2SOB A;  5FKA C;  3GTG H;  5GAE C;  1HR0 Q;  4UDU C;  3NSW A;  3M3Y B;  5C4J B;  3GP7 A;  4QJF A;  3CQZ B;  3CCL A;  1LAC A;  3MC0 B;  5KIX A;  5FJ8 G;  3F2C A;  2XNA C;  1QIL A;  2EQS A;  4ZCK A;  1TWA H;  2LXJ A;  3EFX D;  3MFY A;  1F2Z A;  1STB A;  2GA4 B;  4NPS A;  1QWY A;  1JT8 A;  1SMY D;  4JI7 Q;  1S5B D;  2VZA A;  2NVX H;  1K3B C;  2MUY A;  3QR8 A;  3TP6 A;  3PF4 A;  4Y7N H;  3SK6 A;  4BXX G;  4ZKB B;  1B50 A;  5JJZ A;  3A8J E;  3FHW A;  1VQI A;  5IP9 G;  4QCL A;  1C0A A;  2HT1 A;  5KYL A;  3E0E A;  2R92 B;  5IT9 E;  3HOX H;  4K0K Q;  4B9W A;  4A3K G;  1V43 A;  5BR8 Q;  2R3Z A;  4HSV A;  2ATW A;  4EQN A;  4LFA Q;  4X6A H;  1NY4 A;  3M7G A;  1XXG A;  2ZJR A;  1X3G A;  2QGQ A;  3CCV A;  1S5D D;  3F1Z A;  1EY7 A;  1SLJ A;  1HZ9 A;  3S1R B;  2IT1 A;  4QF4 A;  3GTL H;  1FJG L;  2RVL A;  1SR3 A;  3LWU A;  1N36 Q;  5IWA L;  2CQA A;  5C0X J;  2DY8 A;  2BA1 A;  3K7A H;  4A3B G;  3GO5 A;  1SMX A;  2DY7 A;  1EEF D;  1OO9 B;  2F0H A;  3A7L A;  3CCQ A;  4A3I H;  4FF1 A;  5FO7 B;  5C0X H;  1SRO A;  4FXK C;  2F52 A;  4DAY A;  1I3Q B;  1SRU A;  4KKS A;  1X65 A;  1VQ6 A;  1UWV A;  4R9W A;  3PUZ A;  3QJY A;  4MIU A;  4RGN A;  5FLM G;  3GV3 A;  1EIH A;  1EY9 A;  5HGQ A;  4YCV A;  3P75 A;  5I2X A;  4KHZ A;  4X65 Q;  1OXU A;  1NE3 A;  1LT6 D;  4DAM A;  4X62 L;  2YTX A;  4KKT A;  1ET6 A;  5J39 A;  5IGD A;  4LF5 Q;  1PFN A;  2K1B A;  4DUZ Q;  1J6Q A;  4A3D H;  4QQB X;  4DV3 Q;  4DR3 L;  2N88 A;  1S40 A;  3T56 B;  2IX3 A;  2O5J C;  4DR5 L;  3FKI H;  3URY A;  1I4Q A;  2R93 H;  2X69 A;  3TDQ A;  1XX8 A;  3DWQ A;  1M90 C;  2SNM A;  3NP8 A;  4QIW E;  1D5M C;  5C4X G;  1KXL A;  5C4H A;  1R4P B;  4ZUI A;  2TMP A;  4A3K B;  1QB5 D;  1XJV A;  1Q1B A;  3D6W A;  3GD7 A;  3CF5 A;  1B3Q A;  1I5F A;  2E74 C;  1WVL A;  2NN6 I;  1ENC A;  4R4C A;  3H3V I;  3J80 i;  2RBM A;  1ESF A;  1YNX A;  2E5L L;  4F87 A;  2CKZ B;  3FRP B;  3OW7 A;  4JVZ A;  1HHV A;  4X62 Q;  5I9O A;  2L0C A;  2ICE C;  2WB1 B;  2JEB I;  5IYD G;  1CFM A;  4H02 A;  3J7A F;  5CV6 A;  5T1G A;  2C35 B;  4N8F A;  2B2W A;  2LXK A;  2QEX A;  1Y1W G;  3KLS X;  4CJ1 B;  4X3U A;  3ULL A;  4E6I A;  2E2I H;  2N8N A;  1G8Z D;  5JJI A;  4LF6 L;  3T4A C;  5A2Q L;  3GTM H;  2FJ2 A;  5FLX L;  3M4O B;  1LTA D;  4OX9 L;  3RMH A;  4IFD H;  4KY5 A;  1K28 A;  3GTO B;  4Q5V A;  4LUZ A;  5EPL A;  1T5E A;  2UXD Q;  2OWO A;  2Z8L A;  4A3L G;  2MP1 A;  1U5K A;  2ASB A;  3F2D A;  3CCR A;  1B53 A;  4BWG B;  1PH9 A;  1N9W A;  1HNX Q;  3J7Z C;  4L5R C;  2JE6 I;  4B3T Q;  2DNE A;  5JEA H;  1E2V A;  2EJG C;  1YIT A;  1KAW A;  5C0X I;  4DV6 L;  2LFN A;  1MJE A;  2BH2 A;  1CUK A;  1CZW A;  5C5L A;  4L63 B;  2O2L D;  4XTC S;  3CRL C;  4GZY C;  2NVY B;  3K5L A;  5DAU A;  3W1G A;  1PYW D;  4HIK A;  1B4O A;  2RDG A;  3S9W A;  5C3X A;  3D4R A;  5C44 B;  4UHV A;  2B2T C;  4DV0 Q;  1WTH A;  4B3S Q;  1V8Q A;  1OXX K;  4C1N K;  4CDD C;  2K04 A;  1PRT D;  3HOU B;  4IOC A;  1E24 A;  1Q8I A;  1ONL A;  2Q8R E;  3DXJ C;  1E2W A;  3S2D H;  4ID6 A;  3S1Q H;  1WFQ A;  4G7Z C;  1VQP A;  5EPK A;  4TSS A;  1GD7 A;  4PQX A;  4A3E G;  3MXN B;  1ASZ A;  2OTJ A;  1UAP A;  1LYL A;  1HNW Q;  4X66 L;  1Q8K A;  4H7B A;  1K83 B;  4X64 Q;  2KED A;  1STA A;  1L0Y B;  2UUA L;  3BYY B;  3CD6 A;  4A3G B;  1OXT A;  2F0U A;  5GAG C;  2Q2T A;  1LTB D;  5EAY A;  1C9O A;  2EVB A;  3Q8D A;  4YHH L;  2JA9 A;  2HQL A;  1RIP A;  4B3S L;  1PH1 A;  1CZG A;  3ONA B;  1GUG A;  3DWP A;  3K5M A;  3QB3 A;  4S3S A;  1SJE D;  2A73 B;  1T5X D;  4JI0 L;  3NQT A;  1XMQ L;  4RKB A;  4FNF A;  3CU7 A;  4P75 A;  1HA5 A;  5D3I B;  3QWN A;  2K01 A;  2X6L A;  2KCC A;  4DV5 L;  4JI0 Q;  4J6H A;  1EQR A;  4K0K L;  4TQU S;  1IBM Q;  1BNZ A;  3MA2 B;  1LTR D;  3CC2 A;  1E2Z A;  1IHZ A;  2VQF L;  1G2S A;  5IGE A;  2SNS A;  4UY8 C;  1FJG Q;  4OIK A;  4J15 A;  2K14 A;  4JG2 A;  2E2H B;  3CAM A;  4ZUJ A;  1PZK D;  3RZD H;  1AE2 A;  5CYU A;  1AH9 A;  3NTI A;  4POF A;  2R92 G;  3GTP H;  3P7J A;  5E7N A;  4A3F H;  1CA5 A;  4GOP A;  1KDC A;  1N33 L;  2K5W A;  4V0B A;  1LTG D;  5T1I A;  2A8V A;  2D0P A;  1FNV A;  1HQR D;  4OL7 A;  4DFA A;  1CM9 A;  2QKI C;  1V1O A;  2YTV A;  2G9H D;  3OSO A;  1PLF A;  4FDB A;  2A69 C;  1QNU A;  4A3G G;  2A74 C;  4XQN A;  5IYC H;  5FO8 B;  4P73 A;  1EYA A;  4LWC A;  2XTI A;  2A6E C;  5JPN C;  4A93 B;  3T51 B;  1PRT B;  3TZU A;  1UE6 A;  2ICI A;  3A5U A;  3PUY A;  4MNO A;  1ML0 D;  1N33 Q;  2F0T A;  3N6R A;  2VQE L;  4C1N I;  4JBW A;  2R7F A;  2L15 A;  3RZO H;  2RKS A;  1CKN A;  2KVM A;  3RD4 A;  2PW5 A;  1O80 A;  2B2Y C;  4V19 0;  1RJT A;  3KLW A;  3ULJ A;  2Z4H A;  2PQA A;  1DON A;  1EWC A;  1J5E L;  2CQO A;  4CGY B;  2PI2 A;  1EWH A;  1K9M C;  3PO2 H;  2WB1 E;  3E0J A;  1GUT A;  4YCW A;  2H4O A;  4IJH A;  4UAI A;  2LSS A;  1B9N A;  1WYD A;  3KF8 B;  1VQB A;  3AFP A;  1DOL A;  5EBD A;  3CQZ H;  2KEE A;  1VQM A;  4KD3 A;  3JAM i;  3T1Y Q;  1CTM A;  1A15 A;  3UDG A;  1HFG A;  2E5L Q;  1STG A;  4UPA A;  1XMQ Q;  5IYB H;  3CCS A;  2I5L X;  1ASY A;  1LT4 D;  1LUZ A;  1VQD A;  1QZG A;  1UEB A;  4DPG A;  3A0J A;  3HOY G;  1I6V C;  3QG1 A;  2EDG A;  4BY7 G;  2PMZ E;  4RGO S;  3AU7 A;  4JBK A;  3J81 L;  4Z9C B;  4XYO A;  4EX5 A;  4X64 L;  3JAM E;  2UUB Q;  1X3P A;  3BDL A;  2D62 A;  4ME5 A;  3H0G H;  1KDB A;  2K05 A;  4GN3 B;  4LF5 L;  2K6A A;  2ZTD A;  1SNP A;  3AMU A;  2N78 A;  1B70 B;  1X54 A;  2K32 A;  4AQY Q;  2XN9 C;  5A35 A;  5FLX c;  1L0W A;  4L5T A;  1A63 A;  2UU9 L;  4WJW A;  1GXD C;  4DV7 L;  4DK6 C;  3E9H A;  1JOO A;  1E1O A;  1RTO A;  4A3M B;  3N52 A;  3EVQ A;  1QVF A;  5KYI A;  4DV1 Q;  2B3G A;  1JWU D;  2FFK B;  3MXN A;  3I56 A;  1B2T A;  3VR6 A;  3NTH A;  5C44 G;  4GN4 B;  3RN5 A;  1WTV A;  2YU9 B;  4JOI A;  4UP8 A;  3S15 H;  1X6O A;  3OWF A;  3V96 A;  1WD0 A;  3HOU G;  2EXD A;  1VQN A;  2L5T A;  2G9D A;  2XIW A;  1T9H A;  2ZXO A;  3G6J B;  1BF4 A;  3TP7 A;  2JA8 G;  1L1O A;  2HCC A;  1Q1E A;  4KKU A;  4NB3 A;  1JIC A;  2EXZ A;  2F3W A;  3TP5 A;  4DR2 L;  4O2D A;  2JA7 H;  1BDO A;  3CW2 C;  1II3 A;  1Y1V G;  1I50 H;  1O7L A;  1SYC A;  3K0Y A;  3ULP A;  1IL8 A;  3BU2 A;  3ERS X;  4NXN L;  1STH A;  2PMZ B;  1XNQ Q;  2JN4 A;  2Z1C A;  3M9B A;  4WRD A;  5KGU A;  2VY3 A;  4K8J A;  2F0O A;  2K5N A;  3NQI A;  4JPB W;  2FIN B;  5JJK A;  2PI2 E;  4B3M Q;  2V1C C;  2VW9 A;  1M4V A;  4BY7 B;  1YIJ A;  4R8N A;  2OTL A;  2XWJ B;  5IT9 L;  3OOC A;  4KJO A;  4JI6 Q;  4B3T L;  3FEW X;  5BN5 A;  1MI2 A;  3VR3 A;  4OWT B;  1HCZ A;  2F0I A;  5FO9 B;  4NKL A;  1A62 A;  4MTK A;  3H09 A;  3CCU A;  3HRZ C;  1HFN A;  4B3M L;  3CKI B;  4IUV A;  1YHA A;  3HKZ E;  1L0X B;  2I5M X;  1TII D;  1A3U A;  2QF7 A;  3KDF B;  3C3L A;  2WFW A;  5IP7 H;  2Z4I A;  4Q0F A;  4A3K H;  1ENA A;  1GVP A;  4RGM A;  1WD1 A;  4NXN Q;  3BDC A;  4GOP B;  3GTJ B;  3I55 A;  4J1M A;  2WAQ G;  5G3L F;  4LF6 Q;  5KND A;  2GVA A;  4LUO A;  2VXW A;  1VQE A;  1RF2 D;  1MHW C;  1BXT A;  1TY2 A;  2HIX A;  1Z9F A;  5LL6 X;  3DWA A;  5DM7 3;  3MXU A;  4IUQ A;  4ILW A;  2MQH A;  3SK5 A;  1WCM G;  2RCN A;  4IPH A;  3TRE A;  4FF2 A;  3M4O H;  1EY0 A;  4BA2 I;  3T16 A;  5M5Y H;  2E2J H;  1KL9 A;  1OXV A;  2I5H A;  4FVM A;  3SHL A;  3OMC A;  2ZTC A;  4DV0 L;  1STN A;  4ZLT F;  4AIM A;  2YTY A;  3ITP A;  2EYP A;  4DGZ A;  2IHE A;  5EBC A;  1YEZ A;  2AWO A;  1GOZ A;  2F0V A;  4BBR B;  2XRQ D;  2DJF C;  1VF5 C;  4EVO A;  1WTQ A;  4GKK Q;  1QVC A;  1M1K C;  1DM0 B;  2R6G A;  4C3H G;  3K80 C;  2L12 A;  3S2H B;  1ZKO A;  2CWP A;  3Q22 A;  3TZD A;  4AQY L;  4FXD A;  3JAM c;  4GOP C;  1JE4 A;  4A93 G;  2QIL A;  1E1T A;  4B9X A;  4DXF A;  1BOS A;  2AQ2 B;  3NWS A;  4PG3 A;  4JI2 L;  2M2L A;  1K8O A;  3RLN A;  3J7A 5;  2DNC A;  2FHT A;  1ZYR D;  1PZI D;  4LNQ A;  1H9K A;  1VQ4 A;  2HHH Q;  2RA4 A;  1BCP C;  2R93 G;  3S1M B;  3NBH A;  5JJL A;  1VQO A;  1CHQ D;  5M5W B;  1PRT C;  1PYS B;  4HMI A;  4MZ9 A;  1VQG A;  1VQA A;  4IN3 A;  3VYR A;  3CP0 A;  2ES2 A;  2WAQ B;  3AQQ A;  3VR2 A;  3SR1 A;  1PXU A;  2BH8 A;  1Y8O B;  4P71 A;  5CV8 A;  1SFO H;  4BBS B;  4RKL A;  1BCP B;  3I4M G;  1BVS A;  1Y1W H;  1SNC A;  1UE1 A;  2OQK A;  2PZU A;  1NCV A;  3TRZ A;  5M3F B;  2YV5 A;  4JI2 Q;  2IPK D;  1Q82 C;  1PMR A;  1QUQ B;  2JQO A;  5FK9 C;  4HJ7 A;  4BY1 B;  1KD1 C;  2B2V A;  3W2D A;  2B39 A;  2F1M A;  2B2Y A;  4IQZ A;  2F3I A;  4GN5 A;  3NEN A;  1XYI A;  1L1O C;  3D0F A;  2ZXR A;  2NYZ D;  5LMN L;  1Y8N B;  4CJ2 C;  2OQ0 A;  3PO3 H;  3DEP A;  1BUV T;  3HEJ A;  2F0Q A;  2HUG A;  1O7Z A;  4C3H B;  3WWV A;  2JA6 G;  1I4X A;  5ELE A;  4YIJ A;  1EWI A;  1I6H B;  2A6E D;  5C3E G;  3T1H L;  4N9T A;  4FO2 A;  4YCU A;  2ZJP A;  4DR7 L;  3CRK C;  4CKC A;  2EJM A;  1BCP D;  3TSS A;  3X3N A;  4F88 A;  2WKC A;  3HOY B;  4BXX H;  1LTS D;  5DLQ E;  3MEH A;  5AJ3 Q;  5ELD A;  2A69 D;  3RN2 A;  4JI5 L;  1NAP A;  2KBN A;  1K0R A;  2WKD A;  3IL8 A;  3ND9 A;  5IP9 H;  3T1H Q;  5GAD C;  1FR3 A;  3J80 c;  2XGT A;  4U67 3;  2V4D A;  2EY1 A;  4RHR A;  3HGB A;  3RZD B;  3PMF A;  3ER0 A;  3HS0 C;  3S1N B;  3VA7 A;  4QB4 A;  5AFW A;  2XSC A;  3I4L A;  4YWK A;  3UE0 A;  2NZ1 D;  1FGU A;  1XMO L;  1STE A;  3CPW A;  4OIJ A;  3LX0 A;  4DV7 Q;  4L8J A;  1HTP A;  4KD4 A;  2UUA Q;  4A3M G;  3A55 A;  4G7O C;  4HN7 A;  1G51 A;  4FF3 A;  3HOV G;  1NUC A;  3BZC A;  4LFC L;  5I6Y A;  4RMF A;  3I73 A;  2M9V A;  1V9P A;  1P8L A;  5IGG A;  2PPB C;  3I4M B;  3MXP A;  3VYS A;  2F4V L;  1E3P A;  5J1Z A;  5BR8 L;  1H95 A;  4PZ7 A;  5M3F G;  3TQY A;  2K7V A;  5LHY 1;  3FP9 A;  1I4H A;  3HP3 A;  3PSI A;  1G6Z A;  4ULL A;  3M3Y H;  1DZ1 A;  4DV4 L;  4XQQ A;  1SSO A;  2JA8 B;  2QA4 A;  1VQF A;  2VNU D;  4OO1 G;  1KRS A;  4R4Q A;  3KF6 A;  1KTK A;  3Q0A A;  1Y1V B;  4LK1 C;  3HOZ H;  3E5S A;  3BS1 A;  2JEA I;  2L11 A;  2OF1 A;  4RA8 A;  1IBM L;  1XPU A;  2CFM A;  4HCS A;  4P72 A;  4H13 C;  2JA6 B;  1BKB A;  2HDM A;  5C3E B;  4X3K A;  2DUD A;  3U4Z A;  2F0D A;  3KJO A;  4ZQ3 A;  1F77 A;  2HQE A;  5FJ8 H;  4F8M A;  2K75 A;  2ZTE A;  5EGT A;  4RH6 A;  1XNR Q;  1SE4 A;  4GS3 A;  4JI6 L;  2KEC A;  1BBU A;  4XT3 B;  3PIO A;  3EIV A;  1G2T A;  3R8B A;  5C6A A;  1HZC A;  3I91 A;  5G3L D;  1MGS A;  2ENB A;  4R1J A;  2AWN A;  4LF9 Q;  2VUM G;  3FPP A;  4DR4 Q;  1J9O A;  4DR6 L;  1H9R A;  1SYD A;  5CMD A;  3D8G A;  4DR2 Q;  2ALY B;  2HCI A;  3RNU A;  2A5H A;  2QDB A;  2B63 G;  3IFT A;  1U4L A;  4IUN A;  1EY8 A;  1CK1 A;  3KBG A;  2N55 A;  3CPF A;  3BZD B;  1VMC A;  3OWE B;  5K36 H;  1Y8P B;  5C4J H;  4DUY L;  2Z6K C;  1FL0 A;  2F0L A;  5TSS A;  5C4Z A;  2I46 A;  3EBE A;  1LM0 A;  3A8K E;  1XNR L;  2RDH A;  2NB0 A;  3L3O C;  2Q8I B;  2J4X A;  1TWH B;  1U0L A;  2EE1 A;  3AEV A;  1WCM B;  4IFD J;  4Y52 H;  4R4I A;  4IFD G;  1KDA A;  4MHE A;  1YJW A;  2VL6 A;  3R2T A;  1SMY C;  1QG7 A;  1V1Q A;  1ROD A;  1K8G A;  1I3Q H;  2SDF A;  1X32 A;  5HY6 A;  2Q2I A;  3HZX A;  4A3L H;  2CWA A;  2CH4 A;  1JC7 A;  2ZT9 C;  4BBR G;  3G48 A;  1EOT A;  1HUN A;  5ELN A;  5H1S E;  1C7Y A;  1NTG A;  1EZ8 A;  5C0X G;  3L7Z C;  4EQP A;  4POG A;  1HR0 W;  4NW2 A;  4HJ5 A;  2R7Z H;  2K5Q A;  4DV2 Q;  3SXH A;  4DAY B;  1MD2 D;  3SDZ A;  1F9S A;  2IJ0 A;  2B2U A;  3TEH B;  1I4G A;  4IOA A;  1STY A;  2NWG A;  3R2I A;  2NVQ H;  3D3R A;  2R93 B;  2JK8 A;  1GM5 A;  1KAB A;  1Q12 A;  2LS0 1;  4RGT A;  4X3T A;  2K4K A;  2VUM B;  1QJO A;  4JI1 Q;  3HOW G;  3AFQ A;  1O78 A;  1JWM D;  1I4P A;  5JOB A;  5IY0 A;  2QW7 A;  2D9U A;  2NVY H;  5CBE E;  2B63 B;  5GRO A;  3MFG A;  1PH2 A;  2JA7 B;  5IE8 A;  1PYB A;  4R8I A;  5IYB G;  4BBS G;  2RCF A;  3CMA A;  2QEJ C;  5C4X H;  4L5Q A;  3PQI A;  1PH3 A;  2MPM A;  1TWG B;  1ILQ A;  4DR1 L;  4BY1 G;  1R4Q B;  3PCO B;  1NMF A;  1PA6 A;  5JAV A;  4GNX C;  3OW2 A;  3V05 A;  1PH8 A;  1Q3L A;  1EYD A;  2IW3 A;  3G7L A;  4HJ8 A;  1NBW A;  1HRJ A;  1J5E Q;  3QOL A;  2O4X A;  1IBK Q;  4AYB E;  1PH6 A;  3BYT B;  1M8A A;  3H94 A;  1AP0 A;  1PTO H;  4L5S A;  1VQK A;  4DNI A;  1TS4 A;  2BE5 C;  5CC4 A;  1QCB D;  1TXY A;  4X3S A;  3GQB A;  4YWM A;  1K8M A;  3DUZ A;  1GUO A;  1XTD A;  4RAU C;  3B6Y A;  2F03 A;  1PH7 A;  3FKI B;  3J7A V;  4RFB A;  1H9M A;  2L4N A;  3STB C;  1SE8 A;  3CXC A;  2EY5 A;  3VA5 A;  4O1N A;  1K8A C;  1CI3 M;  3R93 A;  5ISR A;  4K5X A;  1UE7 A;  1R9T H;  2G5D A;  2K28 A;  5JEA G;  1TS3 A;  4G4K A;  1EEI D;  2Z0S A;  3OPO A;  3LWE A;  4I7A A;  1ZEQ X;  1IBK L;  4X66 Q;  2UXB L;  2ID0 A;  3K58 A;  1E0B A;  3S2D B;  1C4Q A;  3ND8 A;  4FYD A;  3G71 A;  2HDL A; 
#chains in the Genus database with same CATH homology
 3PUW A;  3T13 A;  2LKV A;  1FD7 D;  1LAB A;  4J8Q A;  1JWS D;  3HOV B;  4CJ0 B;  3S17 B;  3GTM B;  4IUU A;  2C9O A;  2PO4 A;  1PTO C;  2NN6 H;  3WOE A;  3TME A;  2JYO A;  3C2P A;  1VF7 A;  1TQO A;  3KUP A;  2O5I C;  3MXG A;  1HA6 A;  4IAL A;  3OMG A;  3GTQ B;  1AZP A;  1C48 A;  2OEO A;  5I2Y A;  1TS2 A;  5D65 A;  1MSH A;  3P1H A;  3NXW A;  1D2B A;  3NHH A;  2CVR A;  5C5M A;  4HR7 B;  4DU9 A;  1F9R A;  4K5V A;  4HMJ A;  4DF7 A;  4HAE A;  3FPU B;  4KV6 A;  2B2U C;  3FMC A;  1TS5 A;  1RCV D;  4NMZ A;  1QOH A;  5COR A;  2NVX B;  1ZYR C;  5HUR A;  1ENF A;  4A3J B;  2EJF C;  2MGS A;  1LO5 D;  4DXG A;  5KEE A;  5CGK A;  3E6Z X;  1SJH D;  1QNK A;  1TWF B;  4NP5 A;  2PCF B;  2VB2 X;  3PO2 B;  2KJX A;  4PMW A;  1YNJ C;  5KNB A;  4K2L A;  1LTI D;  3TP8 A;  4WOR A;  4HCE A;  4TKO B;  1JOK A;  1JOR A;  4KN4 C;  4F7X A;  3HKZ B;  3MAQ A;  3DHQ A;  4XQJ A;  1ICW A;  5IGC A;  1KNA A;  1TR5 A;  2EYH A;  3NK9 A;  1EZ6 A;  3DEO A;  4XXE A;  4KY7 A;  4ABN A;  1PZJ D;  1SNO A;  1O7Y A;  2WV6 D;  4M8A A;  3PIO 3;  3K7A B;  1D1K A;  4KK7 A;  3A54 A;  1GUS A;  1Z7T A;  3RUZ A;  2PQE A;  4OHJ A;  4PV1 C;  3S16 B;  1IYV A;  2AQ1 B;  5M5X B;  2D2C C;  1KLG D;  1Z47 A;  4ODG A;  4DNT B;  4K2K A;  1GUW A;  5J22 A;  2NTT A;  2EY6 A;  3J7Y W;  1IYU A;  3M7N A;  4N9P A;  1DOK A;  2B2W C;  2XRS D;  1TU2 B;  3QOJ A;  3K59 A;  3HOW B;  4KHV A;  1WTW A;  1DXM A;  3HOX B;  3NE5 B;  4HSP A;  5DEH A;  3D4D A;  1I4R A;  3H3V C;  3QO2 A;  3LNN A;  2F0G A;  4PMB A;  3I4N B;  3C1F A;  3BVM A;  4IFD I;  2AQ3 B;  1HTL D;  4C2M B;  5ELB A;  1KAA A;  2JSO A;  3VR5 A;  2KQ3 A;  1DOM A;  3MTS A;  3VYU A;  3KLR A;  1GHJ A;  1IW7 D;  4NDX A;  2RDF A;  2B2T A;  1A2U A;  3NPP A;  4KMU C;  2BCO A;  5C3W A;  1TT2 A;  3ERO A;  4M1U B;  1LLR D;  1IKM A;  1RKN A;  3AB9 A;  5D14 A;  3PIP 3;  2J7Z A;  1C8C A;  1B3A A;  1BQQ T;  2MHV A;  5EKI A;  4DA2 A;  2KOL A;  3SK8 A;  3GTL B;  4OO1 H;  1OXS C;  4QUF A;  2KHS A;  4ZYS A;  1SEB D;  2A68 C;  4HTH A;  1F2Y A;  2F3V A;  5BN4 A;  2SEB D;  1RD9 D;  5ELF A;  1SBB B;  3WOF A;  1S4Z A;  4AYB B;  1EY4 A;  1SNQ A;  1EY6 A;  5F2D A;  4EGV A;  3H0G B;  1PFB A;  1BO0 A;  3GV6 A;  2IX1 A;  5CBA E;  4FP5 D;  1W6K A;  3J80 L;  1J8I A;  2YYZ A;  3FVQ A;  1X3Q A;  3UI2 A;  3DMU A;  4XDX A;  5I9P A;  3MHB A;  4A3D B;  3NUC A;  4XYQ A;  2WII B;  2F0P A;  1F2M A;  3NTK A;  1PDQ A;  3S15 B;  1PRT F;  5HGT A;  5EPJ A;  1TKW B;  2NTS A;  1F9P A;  4K14 A;  2PW7 A;  3JAM L;  2F0M A;  2PZW A;  4U68 A;  2K33 A;  1H9J A;  2FMM A;  1SE3 A;  2E76 C;  4RWS C;  3CHB D;  4RCN A;  1LTT D;  1EQV A;  3BVZ A;  1WTO A;  5CR3 A;  2E2I B;  3A56 A;  3S1Q B;  4LJZ C;  1PTO B;  2PZT A;  3PV0 A;  2F0S A;  1EQT A;  1UNS A;  4EQO A;  1EYC A;  3HG9 A;  5FOB B;  1H9S A;  1EFI D;  1LV9 A;  3PO3 B;  3U9S A;  4IUP A;  1V1P B;  1S5F D;  5ELC A;  2WAC A;  4XT1 B;  1VDZ A;  3ZYY X;  2FMC A;  2PYK A;  4G7H C;  1JB3 A;  3K57 A;  1WTP A;  4K6D A;  5JVH 3;  1SDF A;  2Q8T A;  3Q6S A;  1WTR A;  1ET9 A;  1MBY A;  2K5D A;  4XIG S;  1SNM A;  5EJW A;  2ZXP A;  1Y69 U;  4FXG C;  1CA6 A;  2LY7 A;  2EYJ A;  3OIP A;  1FNW A;  1Z6H A;  5I4D A;  2B2V C;  3K6O A;  1H9S B;  3VR4 A;  3GTP B;  1U4R A;  3I8Z A;  1CQV A;  2RQX A;  1ILP A;  1V1P A;  4IZ8 A;  3X3M A;  5A2Q E;  2XWB B;  5EKL A;  5KRU A;  4FF4 A;  3BG3 A;  3Q24 A;  3H6M A;  4BA1 I;  3NWT A;  3C46 A;  3DM1 A;  3L9A X;  2E2D C;  3GTG B;  1YNN C;  3SVM A;  1AEX A;  1ESR A;  1PTO F;  2M00 A;  5DNF A;  1DCZ A;  5K5P A;  1MSG A;  3OIQ A;  1GHK A;  1HQM C;  2KUM A;  1XWE A;  4KY6 A;  1AW7 A;  1TWA B;  3OHX C;  5E4X A;  4LMQ D;  2IX0 A;  2R61 A;  3KF8 A;  1FYC A;  2BA0 A;  4QIW B;  1TVX A;  1HUM A;  5JPM C;  3IKJ A;  5K36 G;  4A3F B;  1RDP D;  5IOC A;  4Y7N B;  2CW0 D;  3EJI A;  1SND A;  4JK1 C;  1BCP F;  3I3C A;  4WFN 3;  2DN8 A;  5M9O A;  3D4W A;  4H0L C;  1D6E C;  1EY5 A;  1SYF A;  5JEA J;  1EU3 A;  5CV4 A;  1VMP A;  1B44 D;  3Q23 A;  5E1F A;  1ZXT A;  1EIG A;  5IGF A;  1JR0 D;  4H44 C;  2JP1 A;  4IUR A;  1EL0 A;  3T53 B;  4G57 A;  2BDO A;  2F4I A;  4O42 A;  1A3V A;  3TN2 A;  3M4Y A;  4KN7 C;  3MVV A;  3RZO B;  3A8I E;  1S5C D;  4A3I B;  3EQL C;  1D5Z C;  3SK4 A;  2EYL A;  1IKL A;  1Q90 A;  4MN3 A;  4DNR B;  3PUX A;  2QCP X;  3S14 B;  4C3J B;  2F0W A;  1S5E D;  3SEB A;  2NUC A;  2IWH A;  2NVQ B;  2Y0S B;  1AN8 A;  2D5D A;  3FDT A;  1HPC A;  2EYM A;  2RSN A;  1KLU D;  4ZK9 B;  3P20 A;  1FGB D;  1WTX A;  2EYO A;  3F2U A;  5FLX E;  1D5X C;  1NR4 A;  3MZ5 A;  3EA6 A;  3BVG A;  2AUK A;  1U4M A;  2MJ8 A;  1DJR D;  2L1B A;  2A6H D;  1LT3 D;  2CHB D;  4HED A;  5JVG 3;  3I90 A;  2PNR C;  2R7Z B;  1SAP A;  3J80 E;  4BS9 A;  4RCO A;  5NUC A;  1SYB A;  1RHP A;  2L9H A;  3KBX A;  3H91 A;  2B8F A;  1A6X A;  4DK1 A;  1PFM A;  2F0N A;  3SE0 A;  3W3A A;  5CV9 A;  1YNJ D;  2A6H C;  2JXM B;  1EU4 A;  5E3F A;  2AUJ D;  4C3J G;  3I72 A;  1G91 A;  3NBI A;  4QMG A;  4K5W A;  1R9T B;  4TRD A;  1SYE A;  1GJX A;  2KCN A;  4RHS A;  2NN6 G;  2K03 A;  1UEA B;  1NR2 A;  2J0T D;  1BR9 A;  5COY A;  4ZAI A;  4CHT B;  4ZKC B;  1SYG A;  2X6G A;  5M3M B;  2BDN A;  1I50 B;  3K5O A;  3BDO A;  4DN4 M;  1SE2 A;  3VYT A;  1GUN A;  2EOT A;  1RTN A;  4C3I B;  4L6T B;  2E2J B;  5M5Y B;  4KTA A;  1B1Z A;  4K6L A;  4ZRZ A;  5I6W A;  4KJN A;  1IW7 C;  4KI0 A;  2KA7 A;  5LL6 S;  2EZV A;  2EYF A;  4DAV A;  2F0E A;  5IGB A;  1JOQ A;  2TSS A;  1A3T A;  5IIF A;  2OT2 A;  2WIN B;  4CKE A;  1U4P A;  4C56 C;  2VB3 X;  1FNU A;  1JCK B;  4I7Z C;  1CQF A;  3PUV A;  3M85 A;  2EPB A;  4K8I A;  1PTO D;  1D1I A;  3ERQ A;  4LAA A;  4DAP A;  1YNN D;  5EKK A;  3I70 A;  1SXT A;  1BBX C;  5C4X B;  1JQY D;  4I65 A;  3D31 A;  2BOS A;  1HXY D;  1VCI A;  1CHP D;  2JA5 B;  2A68 D;  3KK7 A;  5IOD A;  2IL8 A;  2C5C A;  1NSN S;  5E4W C;  2WP8 J;  1XTC D;  1Y1W B;  2F0F A;  2E75 C;  3TBI B;  5BN3 A;  2CW0 C;  4QUC A;  3IFD A;  1KNE A;  5CV7 A;  4CBV A;  1QE6 A;  4C3I G;  3QIA A;  2BE5 D;  2F0J A;  1G29 1;  1W6J A;  3C1E A;  3D6C A;  5DM6 3;  1AZQ A;  4OGQ C;  1CT1 D;  2XVS A;  3J81 E;  3IAY A;  1A2T A;  1TY0 A;  1DD2 A;  1F9Q A;  4B08 A;  2NBF A;  3U9O A;  5D3D A;  3A7A B;  2B8G A;  3HOZ B;  1U9R A;  3MWY W;  3WDN A;  2I07 B;  3R3O A;  4IUT A;  1UUP A;  5EQ0 A;  2F0K A;  2L55 A;  3O13 A;  1LT5 D;  1TWC B;  1SFO B;  5KNC A;  2OXP A;  2NVT B;  1AFP A;  3GTK B;  2H1E A;  4CKB A;  4PMC A;  4OO1 I;  4A3E B;  3V2T A;  4PNY A;  3RLF A;  3KLS A;  2EY2 A;  1F2L A;  1B9M A;  2RSO A;  2LMC B;  1DYQ A;  4P2C B;  4DK0 A;  3K5N A;  4A3B B;  5CV5 A;  2SOB A;  5FKA C;  4UDU C;  3NSW A;  3M3Y B;  5C4J B;  3GP7 A;  3CQZ B;  1LAC A;  3MC0 B;  5KIX A;  2XNA C;  1QIL A;  3EFX D;  3MFY A;  1F2Z A;  1STB A;  2GA4 B;  1QWY A;  1SMY D;  1S5B D;  2MUY A;  3TP6 A;  3SK6 A;  4ZKB B;  1B50 A;  5JJZ A;  3A8J E;  4QCL A;  5KYL A;  2R92 B;  5IT9 E;  4B9W A;  1V43 A;  2R3Z A;  4HSV A;  4EQN A;  3M7G A;  1XXG A;  1S5D D;  1EY7 A;  3S1R B;  2IT1 A;  4QF4 A;  2RVL A;  3LWU A;  2CQA A;  5C0X J;  2DY8 A;  2BA1 A;  3GO5 A;  2DY7 A;  1EEF D;  1OO9 B;  2F0H A;  3A7L A;  4FF1 A;  5FO7 B;  5C0X H;  4FXK C;  4DAY A;  1I3Q B;  4KKS A;  4R9W A;  3PUZ A;  3QJY A;  4MIU A;  4RGN A;  1EIH A;  3GV3 A;  1EY9 A;  3P75 A;  5I2X A;  4KHZ A;  1OXU A;  1LT6 D;  4KKT A;  1ET6 A;  5J39 A;  5IGD A;  1PFN A;  2K1B A;  2N88 A;  3T56 B;  2IX3 A;  2O5J C;  3URY A;  1I4Q A;  2X69 A;  3TDQ A;  1XX8 A;  3DWQ A;  2SNM A;  3NP8 A;  1D5M C;  5C4H A;  1R4P B;  4ZUI A;  2TMP A;  4A3K B;  1QB5 D;  1Q1B A;  3D6W A;  3GD7 A;  1WVL A;  2E74 C;  2NN6 I;  1ENC A;  2RBM A;  1ESF A;  4F87 A;  3OW7 A;  3FRP B;  1HHV A;  5I9O A;  2L0C A;  2ICE C;  2WB1 B;  2JEB I;  1CFM A;  3J7A F;  5CV6 A;  5T1G A;  2B2W A;  3KLS X;  4CJ1 B;  4X3U A;  4E6I A;  1G8Z D;  3T4A C;  5A2Q L;  2FJ2 A;  5FLX L;  3M4O B;  1LTA D;  3RMH A;  4IFD H;  4KY5 A;  3GTO B;  4Q5V A;  5EPL A;  1T5E A;  2Z8L A;  2MP1 A;  1B53 A;  4BWG B;  2JE6 I;  2DNE A;  5JEA H;  1E2V A;  2EJG C;  5C0X I;  2LFN A;  1CZW A;  5C5L A;  4L63 B;  2O2L D;  4XTC S;  3CRL C;  4GZY C;  2NVY B;  3K5L A;  5DAU A;  1PYW D;  1B4O A;  2RDG A;  3S9W A;  5C3X A;  3D4R A;  5C44 B;  2B2T C;  1V8Q A;  1OXX K;  4C1N K;  2K04 A;  1PRT D;  3HOU B;  1Q8I A;  1ONL A;  2Q8R E;  3DXJ C;  1E2W A;  4ID6 A;  4G7Z C;  5EPK A;  4TSS A;  4PQX A;  1UAP A;  4H7B A;  1K83 B;  2KED A;  1STA A;  1L0Y B;  3BYY B;  4A3G B;  1OXT A;  2F0U A;  1LTB D;  2EVB A;  1CZG A;  3ONA B;  1GUG A;  3DWP A;  3K5M A;  3QB3 A;  4S3S A;  1SJE D;  2A73 B;  1T5X D;  3NQT A;  4RKB A;  4FNF A;  3CU7 A;  1HA5 A;  5D3I B;  3QWN A;  2K01 A;  2X6L A;  2KCC A;  4J6H A;  4TQU S;  1BNZ A;  3MA2 B;  1LTR D;  1E2Z A;  1IHZ A;  1G2S A;  5IGE A;  2SNS A;  4OIK A;  2E2H B;  4ZUJ A;  1PZK D;  5CYU A;  3NTI A;  3P7J A;  1CA5 A;  1KDC A;  2K5W A;  4V0B A;  1LTG D;  5T1I A;  1FNV A;  1HQR D;  4OL7 A;  4DFA A;  1CM9 A;  2QKI C;  1V1O A;  2G9H D;  3OSO A;  1PLF A;  2A69 C;  1QNU A;  2A74 C;  4XQN A;  5FO8 B;  1EYA A;  2A6E C;  5JPN C;  4A93 B;  3T51 B;  1PRT B;  3TZU A;  2ICI A;  3PUY A;  1ML0 D;  2F0T A;  3N6R A;  4C1N I;  4JBW A;  2RKS A;  2KVM A;  3RD4 A;  2PW5 A;  1O80 A;  2B2Y C;  4V19 0;  1RJT A;  2Z4H A;  1DON A;  1EWC A;  4CGY B;  1EWH A;  3E0J A;  1GUT A;  2H4O A;  4UAI A;  1B9N A;  1DOL A;  5EBD A;  2KEE A;  4KD3 A;  1CTM A;  1A15 A;  1HFG A;  1STG A;  1LT4 D;  1I6V C;  3QG1 A;  2EDG A;  4RGO S;  3AU7 A;  3J81 L;  4Z9C B;  4XYO A;  3JAM E;  1X3P A;  3BDL A;  2D62 A;  4ME5 A;  1KDB A;  2K05 A;  2K6A A;  1SNP A;  3AMU A;  2K32 A;  2XN9 C;  5A35 A;  4WJW A;  1GXD C;  1JOO A;  1RTO A;  4A3M B;  3N52 A;  3EVQ A;  5KYI A;  1JWU D;  2FFK B;  3MXN A;  1B2T A;  3VR6 A;  3NTH A;  1WTV A;  2YU9 B;  3OWF A;  3V96 A;  1WD0 A;  2L5T A;  2G9D A;  2XIW A;  2ZXO A;  3G6J B;  1BF4 A;  3TP7 A;  2HCC A;  1Q1E A;  4KKU A;  1JIC A;  2EXZ A;  2F3W A;  3TP5 A;  1BDO A;  1II3 A;  1O7L A;  1SYC A;  3K0Y A;  1IL8 A;  1STH A;  2PMZ B;  2Z1C A;  4WRD A;  5KGU A;  4K8J A;  2F0O A;  3NQI A;  2FIN B;  1M4V A;  4BY7 B;  4R8N A;  2XWJ B;  5IT9 L;  3OOC A;  4KJO A;  3FEW X;  5BN5 A;  1MI2 A;  3VR3 A;  1HCZ A;  2F0I A;  5FO9 B;  4NKL A;  3H09 A;  3HRZ C;  1HFN A;  3CKI B;  4IUV A;  1L0X B;  1TII D;  1A3U A;  2QF7 A;  3C3L A;  2Z4I A;  4Q0F A;  1ENA A;  4RGM A;  1WD1 A;  3BDC A;  3GTJ B;  4J1M A;  5G3L F;  5KND A;  2VXW A;  1RF2 D;  1BXT A;  1TY2 A;  5LL6 X;  3DWA A;  5DM7 3;  3MXU A;  4IUQ A;  4ILW A;  3SK5 A;  4FF2 A;  4BA2 I;  1EY0 A;  3T16 A;  1OXV A;  4FVM A;  3SHL A;  3OMC A;  1STN A;  4ZLT F;  3ITP A;  2EYP A;  4DGZ A;  5EBC A;  2AWO A;  1GOZ A;  2F0V A;  4BBR B;  2XRQ D;  4EVO A;  1VF5 C;  1WTQ A;  1DM0 B;  2R6G A;  4C3H G;  2L12 A;  3S2H B;  1ZKO A;  3Q22 A;  3TZD A;  4FXD A;  1JE4 A;  2QIL A;  4B9X A;  4DXF A;  1BOS A;  2AQ2 B;  3NWS A;  2M2L A;  1K8O A;  2DNC A;  2FHT A;  1ZYR D;  1PZI D;  1H9K A;  2RA4 A;  1BCP C;  3S1M B;  3NBH A;  1CHQ D;  5M5W B;  1PRT C;  4HMI A;  4IN3 A;  3VYR A;  2WAQ B;  3VR2 A;  3SR1 A;  1PXU A;  1Y8O B;  5CV8 A;  4BBS B;  4RKL A;  1BCP B;  1SNC A;  2PZU A;  1NCV A;  5M3F B;  2IPK D;  1PMR A;  5FK9 C;  4BY1 B;  2B2V A;  3W2D A;  2B39 A;  2F1M A;  2B2Y A;  4IQZ A;  1XYI A;  2ZXR A;  2NYZ D;  1Y8N B;  4CJ2 C;  3DEP A;  1BUV T;  3HEJ A;  2F0Q A;  2HUG A;  1O7Z A;  4C3H B;  1I4X A;  5ELE A;  4YIJ A;  1I6H B;  2A6E D;  4N9T A;  4FO2 A;  4CKC A;  3CRK C;  2EJM A;  3TSS A;  1BCP D;  3X3N A;  4F88 A;  2WKC A;  3HOY B;  1LTS D;  3MEH A;  5ELD A;  2A69 D;  1NAP A;  2WKD A;  3ND9 A;  3IL8 A;  1FR3 A;  4U67 3;  2V4D A;  2EY1 A;  4RHR A;  3HGB A;  3RZD B;  3PMF A;  3HS0 C;  3S1N B;  3VA7 A;  4QB4 A;  5AFW A;  2XSC A;  3I4L A;  2NZ1 D;  1STE A;  4OIJ A;  3LX0 A;  4L8J A;  1HTP A;  4KD4 A;  4G7O C;  3A55 A;  4HN7 A;  4FF3 A;  1NUC A;  5I6Y A;  3I73 A;  2M9V A;  5IGG A;  2PPB C;  3I4M B;  3MXP A;  3VYS A;  5J1Z A;  2K7V A;  5LHY 1;  1I4H A;  3HP3 A;  1G6Z A;  4ULL A;  1DZ1 A;  4XQQ A;  1SSO A;  2JA8 B;  2VNU D;  4OO1 G;  1KTK A;  3Q0A A;  1Y1V B;  4LK1 C;  3E5S A;  3BS1 A;  2JEA I;  2L11 A;  2OF1 A;  4RA8 A;  4HCS A;  4H13 C;  2JA6 B;  2HDM A;  5C3E B;  4X3K A;  2F0D A;  4ZQ3 A;  1F77 A;  2HQE A;  4F8M A;  5EGT A;  4RH6 A;  1SE4 A;  2KEC A;  4XT3 B;  1G2T A;  3R8B A;  5C6A A;  3I91 A;  5G3L D;  1MGS A;  2ENB A;  2AWN A;  3FPP A;  1J9O A;  1H9R A;  1SYD A;  5CMD A;  3D8G A;  2HCI A;  2A5H A;  2QDB A;  3IFT A;  1U4L A;  4IUN A;  1EY8 A;  1CK1 A;  3KBG A;  2N55 A;  3BZD B;  1VMC A;  3OWE B;  5K36 H;  1Y8P B;  5TSS A;  2F0L A;  5C4Z A;  2I46 A;  3A8K E;  2RDH A;  2NB0 A;  3L3O C;  2Q8I B;  2J4X A;  1TWH B;  2EE1 A;  1WCM B;  4IFD J;  4IFD G;  1KDA A;  4MHE A;  3R2T A;  1SMY C;  1QG7 A;  1ROD A;  2SDF A;  1X32 A;  3HZX A;  1JC7 A;  2ZT9 C;  1EOT A;  1HUN A;  1EZ8 A;  5C0X G;  3L7Z C;  4EQP A;  4NW2 A;  2K5Q A;  3SXH A;  1MD2 D;  3SDZ A;  1F9S A;  2IJ0 A;  2B2U A;  1I4G A;  1STY A;  2NWG A;  3R2I A;  3D3R A;  2R93 B;  1KAB A;  1Q12 A;  2LS0 1;  4RGT A;  4X3T A;  2VUM B;  1QJO A;  1O78 A;  1JWM D;  1I4P A;  5JOB A;  2D9U A;  5CBE E;  2B63 B;  3MFG A;  2JA7 B;  4R8I A;  2QEJ C;  2MPM A;  1TWG B;  1ILQ A;  1R4Q B;  5JAV A;  3V05 A;  1Q3L A;  1EYD A;  2IW3 A;  3G7L A;  1HRJ A;  3QOL A;  2O4X A;  3BYT B;  1M8A A;  3H94 A;  1AP0 A;  1PTO H;  1TS4 A;  2BE5 C;  5CC4 A;  1QCB D;  4X3S A;  3GQB A;  1K8M A;  3DUZ A;  1GUO A;  4RAU C;  2F03 A;  3FKI B;  3J7A V;  4RFB A;  1H9M A;  2L4N A;  2EY5 A;  3VA5 A;  4O1N A;  1CI3 M;  3R93 A;  5ISR A;  4K5X A;  2K28 A;  5JEA G;  1TS3 A;  4G4K A;  1EEI D;  3OPO A;  3LWE A;  1ZEQ X;  2ID0 A;  3K58 A;  1E0B A;  3S2D B;  1C4Q A;  3ND8 A;  4FYD A;  2HDL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...