1JOKA

Averaged structure for staphylococcal nuclease-h124l in ternary complex with ca2+ and thymidine-3',5'-bisphosphate
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
149
structure length
149
Chain Sequence
ATSTKKLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQLLRKSEAQAKKEKLNIWSEDNADSGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords staphylococcal nuclease
publication title Solution structures of staphylococcal nuclease from multidimensional, multinuclear NMR: nuclease-H124L and its ternary complex with Ca2+ and thymidine-3',5'-bisphosphate.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 23
structure length 149
sequence length 149
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2001-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1jokA00
5CV9A 2F0NA 2SOBA 4K8JA 1TQOA 4RKBA 3TP6A 5CGKA 2F0EA 3C1EA 1A3UA 2F3VA 3BDCA 2RDFA 1SNOA 2KQ3A 4K8IA 3MEHA 4EQNA 4KY7A 2F0JA 2F0DA 2ENBA 5CR3A 5M9OA 3OSOA 3C1FA 1KDBA 3TP8A 3EROA 2EYFA 3OMCA 5CC4A 3TP7A 4EVOA 3MVVA 2EYMA 2EYJA 1SNPA 2SNSA 4QMGA 5E1FA 3VA5A 5J39A 4J1MA 3D4DA 4ZUIA 5CV5A 2F0VA 3T16A 5KYLA 1JOKA 1EZ8A 5K5PA 1EY7A 2EYPA 4K5WA 2F0GA 1KDAA 2PZUA 5IODA 3MXPA 2F3WA 4PMBA 5I6YA 1SYCA 1STNA 5I6WA 5HURA 4F8MA 1EY4A 5IGEA 1KDCA 2QDBA 5F2DA 4QF4A 1SYEA 1TR5A 2WACA 1F2YA 5C6AA 4PMCA 3E5SA 4ME5A 4NP5A 1A3VA 2F0QA 4KV6A 1SNDA 4S3SA 4E6IA 1A2TA 3H6MA 1EYDA 5IIFA 3D6CA 2NUCA 1SYBA 3SK8A 1ENAA 3SK4A 2HQEA 5C4ZA 4DGZA 5EKLA 3SXHA 3RUZA 5J22A 2KHSA 4DFAA 4PNYA 1EYAA 4IZ8A 4WRDA 4KTAA 1EY8A 1STBA 2EYOA 3DMUA 3QOJA 4LAAA 2O4XA 3QB3A 5C5MA 2EXZA 4B9XA 5ISRA 3SK6A 1ENCA 5JOBA 4N9PA 3EJIA 3NHHA 5KGUA 1SNQA 5KIXA 1F2ZA 3HEJA 2PW5A 4QB4A 5KRUA 5IGBA 2LKVA 4KY6A 1JORA 4F7XA 4K14A 2EY6A 1II3A 3DHQA 3EVQA 3ITPA 4IALA 2F0PA 4NDXA 4WORA 5DEHA 3MHBA 3NXWA 2PQEA 4KJOA 1EY6A 4ODGA 4HTHA 5NUCA 2OXPA 2F0MA 5C5LA 1U9RA 1EY0A 3QOLA 5C3XA 1NUCA 4TRDA 4EQOA 4I65A 3D4WA 1A2UA 1EQVA 1F2MA 2M00A 4HMIA 5E3FA 5KYIA 3OMGA 3D8GA 4HMJA 1EY5A 5IGGA 2EYHA 3NQTA 1RKNA 2EY5A 2PYKA 5J1ZA 4OL7A 4K2LA 3TMEA 2EY2A 1JOQA 2F0HA 3BDLA 5I9PA 3NP8A 4KJNA 5JAVA 4NMZA 3ERQA 2EY1A 2SNMA 3LX0A 1A3TA 3OWFA 4ZQ3A 4ZUJA 1SYGA 4N9TA 4K6DA 4K5VA 4KY5A 1AEXA 4RKLA 2PZTA 3TP5A 2F0SA 1KAAA 5HGTA 2RKSA 1TT2A 5EKKA 5IGDA 5IGCA 2PW7A 4R8NA 3SR1A 2F0UA 5DAUA 3SHLA 1IHZA 3S9WA 5C4HA 2F0OA 3T13A 4MIUA 4YIJA 5KEEA 2OF1A 5IGFA 4K5XA 5EGTA 1SYDA 3MZ5A 3HZXA 4KD4A 4B9WA 1EYCA 5C3WA 1KABA 4KD3A 4H7BA 1STYA 3P75A 4IUNA 4J6HA 3PMFA 4EQPA 1EY9A 2F0LA 5CV7A 2OEOA 3U9OA 4K2KA 5I9OA 2F0TA 1SNCA 2F0WA 1SYFA 3SK5A 3NK9A 4DU9A 2PZWA 3R3OA 1STHA 5CV8A 4KHVA 5CV6A 5IOCA 1JOOA 1NSNS 1SNMA 1EZ6A 2F0KA 5CV4A 4ID6A 4DF7A 2RBMA 1STGA 2F0IA 3P1HA 4NKLA 4G57A 3V2TA 2F0FA 1STAA 2EYLA 3NUCA
chains in the Genus database with same CATH superfamily
1H9SB 3HOXB 4N8FA 1EFWA 1JQYD 4DR4L 4GN4B 5CR3A 1GUSA 1VQGA 1WI5A 1YZ6A 4OO1G 4DV5L 1TS5A 3BZCA 1PH8A 3MVVA 2B2TA 2G9DA 1F9QA 4B3SQ 2HHHL 4FDBA 2WAQB 1SJHD 2B2UA 4C3HB 4WJ3M 4A3FG 3BYYB 3MXPA 2LY7A 4A3BB 1HR0W 1VQDA 1S5BD 2JA6G 1CSPA 3GTJB 1V1PA 1SYEA 1HCZA 1WCMG 1AH9A 1UEBA 1T5EA 4KKSA 1N34Q 1GUWA 3ONAB 1ENAA 5K36H 2MHVA 3I4NB 3RUZA 2IL8A 4RAUC 4XYQA 2E74C 1PH1A 3A56A 1L0WA 5ISRA 3SK6A 3KF8B 4DR5L 5JOBA 4FO2A 3W1GA 1SNQA 2ID0A 3T1HQ 1YJNA 1JORA 5IYBG 1E2WA 4DKAC 4R8IA 4RH6A 3A55A 2C9OA 4LFCQ 2Z0SA 1C8CA 1FNUA 2BE5C 1B3QA 1LT5D 4FXKC 3L2PA 1BBUA 4V0BA 2QCPX 1UE1A 3EQLC 4J8QA 4P72A 1EQTA 1VQBA 1QB5D 3K81C 2R92G 4RCNA 1E24A 2B2WC 4AQYL 1ET9A 3Q8DA 5IGDA 3CCQA 4A3KH 1MJEA 3SEBA 4JI2Q 1BOSA 2B2YC 2D62A 1N8RC 2K5NA 2OF1A 2EIFA 3KLRA 4JI3Q 4P2CB 3GQBA 3QIAA 3MAQA 1CKOA 4XT3B 3FKIG 3I8ZA 1A15A 4HIMA 3ICEA 3H3VI 3WOEA 3R3OA 5CV6A 1G6ZA 5IP9G 1YI2A 3PIO3 1L2FA 1ZKOA 1I4RA 3DWAA 1S5CD 3FPUB 3PSIA 1ZYRC 3BDCA 4YCWA 2NVQH 1W6KA 3F2CA 1IBKL 1SLJA 3BZDB 3NTIA 4C2MH 4B3MQ 2XWJB 5CC4A 2MO0A 1IBML 4GS3A 5J39A 4DAPA 4GNXB 2O5IC 1XPOA 2HCCA 3I4LA 2Z8LA 3C2PA 3S2HH 3NWSA 3V96A 2DJGC 4C3JH 1VQ7A 1TS2A 5HURA 3QG1A 2RDGA 1AZQA 5CORA 4LFAQ 1YBYA 3KYHC 5IGEA 4DV0L 3HOUH 1KRSA 1QG7A 2JN4A 2PPBC 4GLAC 4KV6A 3U4VA 3K5OA 1SMYD 2LSSA 1R4QB 1HNXL 3HKZG 1Y1VB 5C4ZA 1KTKA 4GOPB 1MGSA 3S14H 1U5KA 4XYOA 3AFQA 3EBEA 2VXWA 5GROA 3J80L 1I50H 4KKUA 3CMAA 5KGUA 3A8JE 5LHY1 1X65A 5FO7B 4AYBB 1VQ4A 4JPBW 2R7ZG 2NZHA 3BVGA 5TSSA 3TZDA 2VUMH 3OYYA 5C5LA 1K83B 3PO2H 1TWFH 4V190 1PMRA 2A6ED 5C3EG 4MTNA 1S5ED 2CFMA 4DV7Q 4IJHA 1K8OA 2HD3A 3BDLA 3VA7A 3PUZA 4LF8Q 2NVQB 1E0BA 2EE1A 2WINB 3UDFA 3VR4A 3K57A 3OWFA 3KF6A 4DXFA 1VMCA 5D3IB 2HDLA 4C2MB 1HQMC 4A3MH 2R93H 4FNFA 2K75A 1HFGA 2BCOA 3J81L 3F2BA 2B2TC 2CHBD 1DCZA 1KIXA 3T13A 4ZKCB 2R7DA 4C3JB 2RVLA 4A3LH 3N6RA 1Y8PB 1QJOA 2B2UC 4POFA 1EIGA 2NN6H 3VDYA 4C56C 4IPGA 1L0YB 2A8VA 1FR3A 4HAEA 3SK5A 2PCFB 1TWCH 3ULJA 1C9OA 2F0KA 3H91A 2L1BA 2NBFA 2N3SA 4DF7A 1STGA 4G7OC 4JI0L 4B3TL 3RZOB 2X6LA 4HSVA 2EYLA 2RSOA 5CV9A 4DV3Q 1M90C 1I50B 2JYOA 2KQ3A 5AJ3L 3CCRA 1WVLA 1B3AA 4DNTB 5FKAC 1SAPA 3QR8A 3GV3A 5I2XA 3EIVA 3EROA 1NTGA 3HOWB 3D4DA 1IXRA 2EYPA 1XMOQ 2HT1A 3S1MH 1SMXA 3S15H 3NPPA 4A3EB 3M4YA 2PQAB 4DAMA 1F77A 4N8X1 2MO1A 4NB3A 4ME5A 2UUBL 5M3MH 4DXGA 3Q22A 4E6IA 4DV2Q 4GN3B 2JA9A 2K01A 2H1EA 4X3TA 2XRSD 4FVMA 1PYBA 4DR1L 1QVCA 4R4TA 1RIPA 3Q23A 4A3MB 4LF9L 2KHSA 1PRTD 2AHOB 5JEAH 2OQKA 4DUYQ 1STBA 2EJGC 3EFXD 2E75C 3I4MH 1DD2A 2ZM6Q 4ME3A 4OELB 1GHJA 3ULLA 5ELBA 3J80i 1K0SA 2VZAA 4F7XA 3GP7A 4RFBA 3NWTA 3J7A5 2EY6A 3K59A 2QA4A 2C35B 3HFZB 3Q24A 5JEAJ 1TWCB 4A3IB 2PI2A 2K04A 4Z9CB 1HUMA 5C0XG 5IT9E 2UU9L 1I3QH 2K5DA 1AFPA 2Y0SG 3PUWA 2N8NA 4HMJA 2B63H 2A1AA 4BXXG 2EY2A 5EPJA 3DWPA 1I6HH 2ZJQA 2YU9B 3CCJA 1TWAH 1LV9A 1SE2A 4YHHL 4B3RQ 4BY7G 2IY5B 2A68D 2XTIA 4DR6Q 2F0UA 3SHLA 1SEBD 3OW7A 4PMWA 1Q1EA 3S15B 1SYDA 3J81i 2O5JC 4UP9A 3A5ZB 3PMFA 2NTSA 4LUZA 2Z9HA 1ICWA 5M3FH 3T53B 4OWWB 2F0IA 2EPBA 2PI2E 5BN3A 5HY6A 3IFDA 4ULLA 3DXJC 4RKBA 4DR7Q 4DAVA 1NMFA 1ASYA 3I4MB 2F3VA 2OQ0A 1WD0A 3PGZA 4BWGB 1XMQQ 3IFTA 3HRZC 2GVBA 1VQ6A 1P8LA 1H9MA 5E1FA 3BZKA 4LFCL 1HQRD 3GTKH 1QVFA 5KYLA 2KCCA 1TIID 5IODA 4A3GB 3JAME 4R4OA 1WTWA 2JA7G 1XTCD 3NE5B 1HZCA 1EY4A 3K8AA 2I5HA 4OIKA 1O7ZA 4NP5A 4ABNA 2E5LQ 5LMUQ 5IIFA 1QVGA 2EJFC 1I6HB 4QIWE 4Y7NH 4DR3Q 4PV1C 2B39A 5C5MA 1H9SA 3ZYYX 1ENCA 3KDFA 1KLGD 5DM73 4OO1H 3TQYA 4BY1B 2JA8B 5IGBA 4A3JG 5ELFA 4JI4L 3OHXC 2RQXA 4A3FH 3MWYW 4PZ6A 5EKIA 2NVXH 2IJ0A 5M3FB 2JA6H 2F52A 1AZPA 1E3PA 3GTLB 1U4LA 2CH4A 1WCMH 2QEJC 3HOYB 1I4PA 3DUZA 3VYSA 4NPSA 4IFDJ 4C3IG 4QUFA 4CDCC 5T1GA 1VS0A 4DNIA 5L37A 1Q81C 3U50C 3CCLA 1EWIA 3CC4A 4ZYSA 3OWEB 1LTTD 5HGTA 1I4QA 4R8NA 4OEMB 4P74A 1IHZA 1K0RA 1D8LA 5IYBH 4OWTB 2UXCQ 3S17H 4MIUA 1PYWD 3TREA 3L7ZC 1O80A 4OX9Q 3A5UA 4CJ1B 2FHTA 1F2LA 4H13C 1EY9A 3CCUA 4UP7A 3J80c 1PTOB 2VQFQ 3OTOQ 4KN7C 1U4RA 3TS0A 1FGUA 3NENA 2GA4B 2WAQE 2R92H 3LNNA 3STBD 1HXYD 1LLRD 5LMNQ 4KLKA 1LABA 2EYFA 4LF4Q 2HCIA 3I7FA 4XT1B 4EVOA 1E2ZA 2ZT9C 3AB9A 4XIGS 1JB7A 2PMZE 3TN2A 2NVXB 3EA6A 4LNQA 1E1OA 1JWMD 1EOVA 2AKWB 3FKIH 3DEOA 5T1IA 2QEXA 4DV7L 3S1QB 1CHQD 4R9WA 1A0IA 3CQZH 5IP9H 4PMCA 4QUCA 4A93G 2JEBI 3I2ZA 2LXKA 3RZDB 1R4PB 3I4OA 4KTAA 1FVIA 2EYOA 3SE0A 1B50A 4LAAA 2KCMA 3H94A 4GN5A 4BS9A 3I3CA 4UHVA 1TKWB 2Z1CA 3MXNA 1UE7A 3T1YQ 2R61A 1DOKA 2IT1A 1WTHA 1I4GA 1KRTA 3RN2A 4DV1L 2M2LA 1YJWA 4ODGA 1O7LA 2F0MA 1Y8OB 4IURA 2XN9C 3QOLA 1J9OA 2LFNA 2JP1A 2XIWA 3FDTA 4FF4A 2IHFA 4LWCA 1T9HA 4LW1A 1TXYA 2K50A 2J4XA 1I94Q 1JE5A 4YWKA 1RD9D 4TKOB 5JAVA 3W5OA 3S1NH 3CU7A 2F3IA 4BBRB 3KJOA 2HIXA 1QUQA 4YY3L 1VF7A 1QCBD 4P73A 2UXDQ 3SR1A 4I7ZC 5DAUA 1Q3LA 1Y14B 4X3KA 1XMOL 5IGFA 3M4QA 1IYJB 2R7ZH 4IUVA 3MZ5A 5C3WA 1R9TH 1L1OA 5E7NA 2A74C 2OEOA 1I4XA 2F0WA 4QQBX 5C3EH 4DU9A 4DV2L 5IYCG 4CHTB 1JOOA 1EZ6A 3RMHA 5C44G 3P1HA 1I4HA 1EYGA 1YNNC 3NUCA 3T56B 1Q12A 2F0NA 4X62Q 5CGKA 5FOBB 2ES2A 4IOAA 3PIOA 2F0EA 2JQOA 3C1EA 2RDFA 4F88A 4H02A 3C1FA 1SN8A 2HDMA 3TP7A 3GTOB 2AMCB 1LT4D 2RA4A 2K52A 4J1MA 3KFUA 2VNUD 1O7YA 1TWHH 1SE4A 4CJ0B 3KOJA 2F0GA 1KDAA 4CKBA 3MXGA 2NTTA 4WFN3 1VQ9A 2E2IH 1IW7D 1JMCA 1YEZA 1IBLL 2JA5B 3K7AB 1XPRA 2WACA 1D1KA 3A54A 3HKZB 1A3VA 2F0QA 5DNFA 2BH2A 3S1NB 2NVYB 4AYBE 3SK4A 2FINB 1DGSA 5BN5A 3FMCA 3R2IA 3SXHA 1ESFA 4HJ7A 3CCEA 1V9PA 3AEVA 2KHIA 3J7YW 1D7QA 1PZID 1EY8A 1SBBB 3DMUA 2SDFA 3QOJA 4X64Q 3F2UA 2BDOA 2EXZA 4GKJL 1CTMA 1JCKB 1P16A 5KIXA 1A8VA 3KBXA 3DEPA 5KRUA 2PW5A 2R7ZB 1OXUA 2OT2A 1HTPA 4M1UB 2I5MX 3FEWX 1F9SA 3UE1A 1CK1A 3NXWA 4X65L 5C3EB 1PFMA 3J7AF 1JT8A 1X3FA 5FK9C 1F2MA 3HOVG 1SJED 2F4IA 4L5SA 1BCPB 4K2LA 4GLXA 2KOLA 2IW3A 3L9AX 4G7ZC 3K80C 2VQEQ 2JEAI 1UE5A 1XMQL 3VR3A 4POGA 2Z6BA 4CDFC 3PO3G 1UNSA 2V4DA 5DM63 4DV4Q 2K33A 1VQIA 3B6YA 1HNZL 3A74A 1CI3M 3NBHA 3GTMB 2F4VL 2AWOA 1VQPA 5M5YB 2E2IB 4LF5Q 1KABA 1J6QA 3S16B 3TZUA 4JBMA 4KHPQ 4TVAB 3HOZB 4GZYC 2ZTDA 2K03A 1SSOA 3X3MA 5LMUL 1STHA 2KUMA 1WYDA 1TS4A 4BXXH 2FXQA 1I6VC 4IQZA 2A5HA 3D0FA 4A3DG 4JV5Q 5A2QE 5E4WC 1HH2P 3QWNA 3OIPA 1SFOH 1Q90A 2X6GA 1DYQA 4DV6Q 2QF7A 1KXLA 2G9HD 1CKMA 1PHJA 4R1JA 1G2TA 2EYMA 2K05A 5C4XG 4GKKL 2UXBQ 1X3QA 3T51B 3S1RH 3CW2C 3PUXA 1IYVA 2RCNA 1G51A 2UUAQ 2F3WA 4JI5Q 5I6WA 1GXDC 1CHPD 1BKBA 1LTRD 2CW0C 1KAWA 3CF5A 1V1QA 3E6ZX 4LK1C 4LF6Q 4M8AA 1SYBA 4MHEA 2D2CC 2K32A 4DGZA 5EKLA 3TSSA 2LMCB 2NVTH 2MP1A 4FP5D 1M1KC 2YTVA 2IX3A 2HIVA 2QW7A 4A76A 2BDNA 1HZBA 1BVSA 4N9PA 1KC8C 1B4OA 2P5ZX 4KHZA 4KI0A 4OX9L 4ZK9B 4JI7Q 4K14A 2NYZD 4IALA 1Q46A 1D1IA 4UY8C 2IX0A 4OO1I 1L1OC 1ASZA 4IOCA 3MC0B 4CBVA 1EY0A 2JA7H 2Y0SB 4IFDI 2CCZA 1GHKA 3D4WA 3ERSX 1HTLD 4O42A 5KYIA 1NJIC 1CUKA 1KNAA 1E1TA 1H95A 1MSGA 2K1BA 4FYDA 1H9KA 4OL7A 4X3UA 4A3KB 2NZ1D 1JICA 3CC7A 4KJNA 5I2YA 3HP3A 1A63A 5BR8L 3JAMc 1SYGA 3TP5A 2F0SA 3FPPA 3ND9A 2XGTA 1GKHA 3HOXG 3F1ZA 2YTXA 1EWHA 2ZTEA 4A3JH 1B1ZA 1HZ9A 4K5XA 1K9MC 5EGTA 2ASBA 1X54A 1A6XA 1S72A 3IL8A 3VYTA 1ZEQX 4ZKBB 1WTRA 1E7ZA 3CCVA 4XDXA 2WFWA 3I55A 4FF2A 1BUVT 1YHBA 4YWLA 4DUZQ 2WAQG 1TWGH 4C3IH 1STAA 3CMEA 4LF7Q 2NVTB 4A3BG 3Q6SA 4FF3A 2BA0A 3G7LA 3TP6A 1IW7C 1VQ8A 1PDQA 5M9OA 3HG9A 3S2HB 3DM1A 4R4IA 2F1MA 1C0AA 2A6HD 4JOIA 1MJCA 2EYJA 3HOUB 1GUOA 4P71A 5COYA 4XXEA 1WTXA 1PTOD 5FJ8G 5K5PA 2PZUA 2Z6KA 4PMBA 4JI1L 4HJ9A 3S14B 4F8MA 1OTCA 1CQVA 5F2DA 4QF4A 2VL6A 1I94L 5C6AA 1WTQA 3H0GH 2WB1B 3M3YH 1XYIA 1PV4A 4S3SA 4X66Q 2R6GA 1EUJA 1VQKA 4L6TB 2BOSA 1CKNB 4JI6Q 4K6LA 1RTNA 1MHWC 3VR2A 4PNYA 2UXDL 3L0OA 5ELOA 5M5WH 5JVG3 3M4PA 1PH6A 4Q0FA 2VUMB 4A3JB 3PO2B 3OIQA 1TWFB 2OWOA 2Q8RE 3BDOA 1NR2A 2XSCA 2CWPA 3PUVA 3CXCA 2YV5A 1N33Q 1GD7A 2PQEA 2V1CC 1KQSA 3CC2A 4HTHA 2OXPA 5EAYA 4EQOA 1V1PB 4IUPA 2E8GA 1A2UA 4XQQA 1H9RA 2R93B 4A93H 4L5QA 1STEA 1VQJA 1MIUA 2EY5A 1HRJA 4RG1A 2AWNA 2MGSA 2F0HA 3M7NA 1SRUA 4NMZA 4KK7A 3CAMA 2PO4A 1IL8A 2XRQD 2K28A 1FNVA 1XNRL 3H15A 1KAAA 2RKSA 1TT2A 2OTLA 2QDLA 4UAIA 1E2VA 4JW0A 5CBEE 1FYCA 2QILA 4RGTA 2MUYA 3HZXA 4K0KQ 1H9JA 4J15A 3CPWA 4IN3A 4O2DA 2OTJA 2YYZA 3H0GB 3I90A 1VQOA 4AIMA 1HA6A 4YCUA 3M4OH 4IJLA 1VMPA 2FJ2A 4DAYA 1JWSD 3KLWA 4ZRZA 4X64L 4K8JA 5M5WB 3A7AB 3NSWA 1O78A 1TU2B 4B3SL 1GO3E 4EQNA 4DPGA 3S1MB 3Q0AA 3MFGA 4O0AA 1Y1VG 3E9HA 1U0LA 2WKCA 2F0VA 4H0LC 1EZ8A 4JI8Q 5M3MB 2BH8A 1N34L 4DV5Q 1V1OA 2YTYA 1BF4A 1EQQA 3F2DA 4A93B 1GJXA 4AYBG 5IYCH 1B53A 1WTOA 2RSNA 5ELDA 1X55A 5C44H 2VQEL 1C48A 1MKHA 3D6CA 1PRTF 1U4PA 3T1HL 4XQJA 4RA8A 1SMYC 3K6OA 4IZ8A 3PQIA 2L0CA 3QB3A 1MI2A 1YHAA 2EDGA 1HZAA 2NZOA 1K8AC 4QB4A 1I3QB 3PIPA 3DHQA 1VCIA 2AUJD 4YWMA 2B63B 4NW2A 4KJOA 1N32Q 5NUCA 4DR5Q 1U9RA 5C3XA 1G91A 1PH2A 1HA5A 1EQVA 4PQXA 1JR0D 2RHQB 1UUPA 3OMGA 3M4OB 4C3JG 3N52A 5J1ZA 1TWAB 1BR9A 2IX1A 2KENA 2A6EC 2J7ZA 4JI2L 1GUNA 4DK6C 2EY1A 4HN7A 5FLMG 2MNAA 4DV6L 4LMQD 4ZQ3A 3A8IE 2EQSA 4CKEA 3UI2A 4JI3L 3PF5A 1CFMA 2XNAC 3PUYA 5CBAE 1CA5A 5GAGC 2A73B 4JG2A 2B2VA 4JOIC 1Q8KA 1WFQA 5A35A 2UXBL 3AYHB 3H3VC 3M85A 4BA2I 4L63B 1YNJD 5IT9L 2IPKD 2N49A 3BU2A 2Z6KC 2KBNA 4U68A 1BCPD 1EFID 1RTOA 1OXSC 3HOVH 3W3AA 4LF6L 3HOWG 4KHVA 2D5DA 3LGJA 2L55A 3GTGH 4B3ML 4G57A 1QZGA 5D14A 1G2SA 3MA2B 1S5FD 1NE3A 4A3EG 3KF6B 1DOLA 3GTKB 3PO3H 1D5MC 1SR3A 4KY7A 3CCMA 3OSOA 3RLFA 1Z6HA 3TP8A 1CZWA 1CSQA 1UEAB 3KF8A 3P20A 4LFAL 2UUCQ 1SNPA 4A3MG 2Q2IA 5CV5A 3GTPH 1IBKQ 2RF4A 1EY7A 4H44C 2DJFC 1LT3D 4Y7NB 4JCVE 2VY3A 1Y1WG 1VF5C 2A69D 4FXDA 4MN3A 2AQ1B 3H6MA 1ILPA 1EYDA 2EXDA 1EQRA 2ZXRA 4A3IG 2HQEA 3AU7A 2D9UA 4KN4C 4C1NI 3CCSA 1EU4A 5EPKA 4DV0Q 1QNUA 2Q2UA 2VW9A 3VYRA 4A3FB 4IUTA 3EJIA 2I0QA 1PRTC 1F2ZA 2KA7A 3JAML 2CWAA 2JA6B 1L0XB 5FLXE 5C4XH 4ZCKA 1WCMB 2BE5D 3MHBA 3G48A 1DZ1A 1PXUA 4LF8L 4HR7B 2KEEA 5E3FA 1PA6A 3UE0A 1WTPA 4OONA 3C3LA 5HGQA 4XQNA 3E0EA 5C4JH 2B8FA 3D6WA 3K0YA 3PIP3 3NP8A 2K5WA 3ULPA 3LX0A 2CQAA 1U4MA 3S17B 1QILA 4ZUJA 5KNCA 1LACA 4KY5A 3PCOB 1LTID 3CHBD 1WD1A 3DM3A 1PH7A 2K5HA 3R93A 4YCVA 3GTPB 1EU3A 3WOFA 1AW7A 3S9WA 1B2TA 2F0OA 2PNRC 2E2HH 4A75A 3RN5A 3I4MG 4GNXA 4U673 1XXGA 3SDZA 3GD7A 2A68C 1EYCA 2BA1A 1IKMA 4H7BA 5I4DA 2F0LA 3TEHB 3LWUA 4DV3L 2R92B 2Z4IA 1V8QA 1WJJA 4X66L 1AN8A 2NB0A 4UPAA 1PYSB 1ZYRD 1YITA 4JI6L 3PV0A 4A3GG 2OCEA 1RDPD 4GOPA 1TQOA 1PH9A 4UDUC 1ESRA 1JB3A 3OW2A 2Q2TA 3FVQA 4K8IA 3W1BA 4RCOA 4XTCS 4JI0Q 3FKIB 1Z47A 3K5MA 3OMCA 1DONA 2KCNA 5D65A 4QMGA 2SNSA 3CQZB 1AE3A 2ALYB 5J3BA 5AJ3Q 1VQEA 4JC0A 1RHPA 2NN6I 2B8GA 3NELA 1X32A 4BY1G 2JA8G 4RGOS 4OWXB 5C4JB 3T4AC 5KNDA 2O2LD 4DUYL 1GVPA 4IUUA 1DJRD 3CRKC 1SNDA 1D2BA 3URYA 1A2TA 1SDFA 2ZM6L 2NUCA 1LTGD 5JJLA 3IAYA 1LTSD 1BO0A 5J22A 3I73A 4HCEA 5JPNC 1ILQA 3HOYG 5DLQE 1KD1C 3BJUA 2B2VC 3KLSX 4KMUC 1G8ZD 4DR1Q 5GADC 2LKVA 1SE3A 4LF9Q 4K0KL 1GUTA 4DK3C 5DEHA 2DNCA 5JVH3 5FJ8H 1FGBD 3JAMi 2MQHA 5GQOA 1JJGA 4PZ7A 3M9BA 2M00A 1GUGA 1SXTA 4JBWA 4JYAQ 3LWEA 3D8GA 1NCVA 3BYTB 2PYKA 1B9NA 4B3RL 3G4SA 4DR6L 3R8BA 3GV6A 2IHEA 4K6DA 2R3ZA 2PZTA 1R9TB 4GLVB 3KDFB 4X6AH 2RCFA 4JI8L 1BNZA 1TVXA 4EGVA 2TMPA 2DUDA 4JBJA 5ELCA 4YHHQ 4IFDG 1UAPA 3U9OA 4DR7L 4IPHA 2PQAA 5LL6S 4TQUS 1N36Q 1VQMA 2NWGA 1LYLA 1W2BA 4PG3A 3HKSA 5FO9B 5LL6X 1S3OA 3ND8A 3OOCA 2I5LX 1MBYA 2AUKA 1TWHB 4BBSG 2PMZB 2D0PA 2F0JA 2A69C 1RODA 2WIIB 1BDOA 4C1NK 3J7AV 3STBC 1ZXTA 4JVZA 1PLFA 5JJIA 2DN8A 2WB1E 2ZXPA 5EQ0A 3VA5A 3J80E 3P7JA 5EJWA 1N32L 1MSHA 5C0XH 1C4QA 1SE8A 1J5EQ 2E5LL 5IP7G 1D5XC 1DOMA 3I91A 1SYCA 1STNA 2N78A 1HFNA 2QDBA 1LTAD 4OIJA 4QGUA 2KHJA 4O1NA 4DR3L 1B9MA 4LUOA 2FFKB 4HJAA 1XNQQ 4OHJA 1QNKA 4A4IA 5IT9c 5BN4A 3FHWA 5C0XJ 4BY7H 3GTQH 1NNXA 3W2DA 3X3NA 4WRDA 3TS2A 2O4XA 2CH4W 4B9XA 1PZKD 2F03A 3BVZA 3NHHA 1Y1VH 3JC66 5ELEA 3O13A 1CA6A 1IZ6A 4BBRG 4GNXC 4HSPA 4L8JA 4NDXA 2N88A 1BBXC 1XPUA 1NY4A 3J81E 5IYDG 4RHRA 4QCLA 1PH4A 2B29A 4F87A 3SGIA 4JI4Q 4JK1C 3CP0A 1K8MA 3G6EA 3NQTA 1BBWA 1RKNA 1K83H 1YJ9A 3V05A 4HJ8A 3MXUA 5I9PA 1UE6A 4GOPC 4A3CG 1AP0A 3UDGA 1HHVA 4APVA 3NBIA 2UXCL 1B44D 5KNBA 1AEXA 1X3GA 2TSSA 5EKKA 2UUCL 2PW7A 3WDNA 3E0JA 1FJGQ 3MXNB 4CDDC 3G6JB 2VQFL 3BS1A 1KL9A 2XWBB 4B9WA 5JJZA 1LTBD 3OTOL 1S40A 4TSSA 4IPCA 4IUNA 3P75A 4UP8A 4Q5VA 1SFOB 3K5NA 5CV4A 1SNMA 1K3RA 5LMNL 1QOHA 2RBMA 2VS1A 3GO5A 1HNWQ 1FL0A 4BY7B 3GTQB 4LF4L 4R4CA 1X3PA 2RHSB 5FLMH 2JA5G 1QUQB 5EBCA 5IE8A 4ALPA 3S1RB 1Y8NB 4CJ2C 3RZOH 4PZ8A 4WJWA 4QL5A 2ZJPA 3S2DH 2L5TA 1JOKA 4LFBQ 3RNUA 1L1OB 4K5WA 4HIKA 5I6YA 3E3XA 3S24A 4CKCA 1BXTA 4P75A 4C3HG 2KCTA 3QJYA 5A2QL 3HOWH 5IWAQ 3I56A 1D6EC 1VDZA 1W6JA 2ICEC 3MTSA 2LXJA 4IUQA 4DK0A 2EJMA 3F8TA 4X3SA 1XTDA 2WKDA 1DXMA 4OGQC 4A3EH 3T1YL 3AQQA 4HCSA 3I4NG 4MZ9A 2D0OA 4HJ5A 3I72A 2JA7B 3QO2A 1HR0Q 4KY6A 2JE6I 4WORA 3RLOA 4HIOA 2DY8A 5EBDA 3FRPB 4RWSC 1FD7D 1O7IA 3L3OC 2JK8A 1ENFA 1Y1WH 4I65A 2QKIC 1SROA 5IGGA 1IKLA 4L5RC 4CDEC 4DV1Q 1JOQA 4A3IH 3UDIA 1C7YA 3ERQA 3HOZG 3RR5A 1TS3A 5JPMC 1JE4A 1EEFD 1YHQA 1PFBA 4N9TA 4AH6A 1YIJA 4K5VA 1HUNA 2K7VA 1YNXA 1G6PA 2HQLA 5IGCA 3S2DB 3G71A 2WP8J 4EQ5A 4IO9A 2YU9H 4Y52H 1EEID 4YY3Q 1TWGB 1WOCA 2DNEA 3A0JA 4C3IB 4J6HA 1ET6A 3CPFA 2F0TA 4X62L 1SYFA 2L9HA 3NEMA 3NK9A 2VB2X 3D4RA 4NXMQ 5G3LD 1YVCA 5FLXc 4NKLA 3V2TA 1RL2A 5K36G 2J0TD 1QE6A 5EPLA 4NXNQ 1VQCA 3MEHA 2F0DA 3RD4A 1EOTA 2VB3X 5LMNW 1PTOF 3NBHB 4QJFA 1OO9B 3TBIB 1K73C 3M3YB 3EN2A 1Y1WB 1E22A 4JYAL 2L12A 2CQOA 4DR2Q 2DY7A 4G4KA 2N55A 1KDCA 3OPOA 1K8GA 2MFIA 1XJVA 1D5ZC 2Q2HA 1XX8A 1M4VA 1HPCA 3UDXA 4A3GH 2K5QA 1IBLQ 5D3DA 2K14A 1EYAA 1LO5D 3CRLC 4IPDA 3GDEA 4DK1A 3K58A 3I70A 1VQNA 1PFSA 4A3KG 4DR4Q 1AE2A 4LUVA 3HEJA 1K28A 3U9SA 2K6AA 1F9RA 2H5XA 2KVMA 2F0PA 4GKJQ 3J7ZC 2HHHQ 1GOZA 4BY1H 3U58A 2CKZB 2JA8H 3R2TA 3KBGA 1N36L 1CZGA 3CKIB 2EYHA 2H4OA 4X65Q 3NTKA 4DV4L 3TMEA 5M5XH 5GAHC 5G3LF 1LM0A 3VR6A 1PVOA 1Z9FA 1A3TA 1LUZA 2ZXOA 3GTLH 3HOYH 4RKLA 4LF5L 1PZJD 1NAPA 4KHPL 2Q8IB 3BG3A 2EVBA 1QWYA 5C4HA 1J5EL 2GN5A 3KK7A 1VQ5A 2JXMB 3H3VH 3IKJA 1X56A 4KD4A 1VQLA 1G291 4KD3A 4RGNA 2C5CA 2QGQA 3J81j 4JV5L 3D31A 5ELNA 2K4KA 1RJTA 1CQFA 4K2KA 3E9IA 1HNZQ 1EWCA 3HOUG 5CV8A 1XNQL 1YNND 2F4VQ 3H09A 4ZAIA 2G5DA 4EX5A 3MFYA 3CD6A 1FNWA 1PTOH 2HUGA 2WB1G 4CGYB 2I07B 1KDBA 2UUAL 4JI5L 1W3SA 4AQYQ 5IY0A 3SVMA 2MPMA 5AFWA 1PFNA 4ZUIA 2A6HC 5C44B 1HJPA 1NMGA 1Q1BA 1V43A 3D3RA 2PNHA 2VUMG 4I7AA 4B08A 3PO2G 4IFDH 3KUPA 3NQIA 1OXXK 1PTOC 1UWVA 4ZLTF 5C0XI 3FP9A 2ATWA 4GKKQ 1F2YA 5M5XB 3E5SA 4DN4M 2CVRA 2X69A 2DGYA 5JJKA 4JBKA 1ICFB 2AQ3B 3S1QH 1OXTA 4JI7L 4DFAA 4BBSH 3HKZE 1FJGL 1X6OA 2R93G 4HIDA 1Q86C 2R7FA 3RZDH 5CYUA 1KNEA 1S5DD 1II3A 3EVQA 1IBMQ 4A3LG 5IP7H 2AQ2B 2NN6G 2FMMA 2ZTCA 2IWHA 1NUCA 1B70B 4HMIA 4A3DH 1HNWL 1RF2D 4RHSA 1QZHA 2JSOA 1Q8IA 2I46A 2FMCA 3PF4A 1F9PA 2Q8TA 2KECA 3H0GG 1HNXQ 1JJ2A 2A19A 3K0XA 3KJPA 1B7YB 2M9VA 3WWVA 1PH3A 2E2DC 3DLLA 3KLSA 1JJCB 4LFBL 1Y69U 4BBRH 3HOVB 5KEEA 5BR8Q 1VQHA 1BCPF 4R4QA 4RGMA 1GM5A 4DUZL 1KHIA 2KJXA 3GTGB 5GAEC 1B8AA 5IYDH 4EQPA 5IWAL 5CV7A 4LF7L 1EIYB 1NR4A 1JWUD 2K5VA 1ONLA 1NSNS 1IL2A 3PO3B 1T5XD 5M3MG 5H1SE 2F0FA 2EZVA 4A3CH 4BBSB 4OXPA 2SOBA 3J81c 2L4NA 1A3UA 1X9NA 5JEAG 1SNOA 2GVAA 2XVSA 1LT6D 4QY7A 1VQFA 2ENBA 2B2WA 1HR0L 4DA2A 3AMUA 1XWEA 2RDHA 2KEDA 1DM0B 1PRTB 4FXGC 3ER0A 1OXVA 3AFPA 1Q82C 1JC7A 2L11A 1A62A 3K5LA 2B2YA 2E76C 3T16A 2L15A 2CW0D 4A3DB 4L5TA 3GTOH 1IYUA 4HEDA 2JJQA 3DWQA 1TR5A 3A8KE 1KLUD 2B63G 5CMDA 2E2JH 4DAYB 3SK8A 1TY0A 1CM9A 4JI1Q 3HS0C 4B3TQ 3K7UC 2JA5H 1N9WA 3K7AH 5C4XB 1N33L 3HOXH 3IRBA 4MTKA 1M8AA 2NVYH 3NTHA 1EIHA 3C46A 4ILWA 1S4ZA 1X3EA 3ITPA 4QIWB 2EOTA 1NBWA 4FF1A 2ZJRA 1EY6A 5E4XA 3TRZA 3RLNA 4MNOA 4TRDA 4C3HH 4BA1I 1CT1D 4NXML 2LS01 3MEFA 4A3BH 4DNRB 1EY5A 5M3FG 2Z4HA 1WTVA 1EIFA 3GTJH 1EL0A 1RCVD 3BVMA 3VYUA 2B3GA 2UUBQ 2Y0SE 1J8IA 4NXNL 2SNMA 4RMFA 2MJ8A 1TY2A 2E2HB 5FO8B 3A7LA 5FLXL 3I4NH 3U4ZA 4WJ4A 1LTLA 1Z7TA 1BQQT 2ICIA 1K3BC 1VQAA 4YIJA 4DR2L 3M7GA 1XNRQ 1STYA 1YNJC 1ML0D 5I9OA 4G7HC 4KKTA 1SNCA 3TDQA 2PZWA 1I5FA 1Q7YC 3GTMH 2WV6D 3ZJYC 5M5YH 2E2JB 5IOCA 4LJZC 1BCPC 2UU9Q 4ID6A 1PH5A 2SEBD 3VR5A 3S16H 3HGBA 1MD2D 1CKNA 3HOZH
chains in the Genus database with same CATH topology
1H9SB 3HOXB 1JQYD 5CR3A 1GUSA 4OO1G 1TS5A 3MVVA 2B2TA 2G9DA 1F9QA 2WAQB 1SJHD 2B2UA 4C3HB 3BYYB 3MXPA 2LY7A 4A3BB 1S5BD 3GTJB 1V1PA 1SYEA 1HCZA 1T5EA 4KKSA 1GUWA 3ONAB 1ENAA 5K36H 2MHVA 3I4NB 3RUZA 2IL8A 4RAUC 4XYQA 2E74C 3A56A 5ISRA 3SK6A 5JOBA 4FO2A 1SNQA 2ID0A 1JORA 1E2WA 4R8IA 4RH6A 3A55A 2C9OA 1C8CA 1FNUA 2BE5C 1LT5D 4FXKC 4V0BA 2QCPX 3EQLC 4J8QA 1EQTA 1QB5D 4RCNA 2B2WC 1ET9A 5IGDA 3SEBA 1BOSA 2B2YC 2D62A 2OF1A 3KLRA 4P2CB 3GQBA 3QIAA 3MAQA 4XT3B 3I8ZA 1A15A 3WOEA 3R3OA 5CV6A 1G6ZA 3PIO3 1ZKOA 1I4RA 3DWAA 1S5CD 3FPUB 1ZYRC 3BDCA 1W6KA 3BZDB 3NTIA 2XWJB 5CC4A 5J39A 4DAPA 2O5IC 2HCCA 3I4LA 2Z8LA 3C2PA 3NWSA 3V96A 1TS2A 5HURA 3QG1A 2RDGA 1AZQA 5CORA 5IGEA 1QG7A 2PPBC 4KV6A 3K5OA 1SMYD 1R4QB 1Y1VB 5C4ZA 1KTKA 1MGSA 4XYOA 2VXWA 3J80L 4KKUA 5KGUA 3A8JE 5LHY1 5FO7B 4AYBB 3BVGA 5TSSA 3TZDA 5C5LA 1K83B 4V190 1PMRA 2A6ED 1S5ED 1K8OA 3BDLA 3VA7A 3PUZA 2NVQB 1E0BA 2EE1A 2WINB 3VR4A 3K57A 3OWFA 4DXFA 1VMCA 5D3IB 2HDLA 4C2MB 1HQMC 4FNFA 1HFGA 2BCOA 3J81L 2B2TC 2CHBD 1DCZA 3T13A 4ZKCB 4C3JB 2RVLA 3N6RA 1Y8PB 1QJOA 2B2UC 1EIGA 2NN6H 4C56C 1L0YB 1FR3A 4HAEA 3SK5A 2PCFB 2F0KA 3H91A 2L1BA 2NBFA 4DF7A 1STGA 4G7OC 3RZOB 2X6LA 4HSVA 2EYLA 2RSOA 5CV9A 1I50B 2JYOA 2KQ3A 1WVLA 1B3AA 4DNTB 5FKAC 1SAPA 3GV3A 5I2XA 3EROA 3HOWB 3D4DA 2EYPA 3NPPA 4A3EB 3M4YA 1F77A 4ME5A 4DXGA 3Q22A 4E6IA 2K01A 2H1EA 4X3TA 2XRSD 4FVMA 3Q23A 4A3MB 2KHSA 1PRTD 5JEAH 1STBA 2EJGC 3EFXD 2E75C 1DD2A 1GHJA 5ELBA 4F7XA 3GP7A 4RFBA 3NWTA 2EY6A 3K59A 3Q24A 5JEAJ 1TWCB 4A3IB 2K04A 4Z9CB 1HUMA 5C0XG 5IT9E 2K5DA 1AFPA 4HMJA 3PUWA 2EY2A 5EPJA 3DWPA 2YU9B 1LV9A 1SE2A 2A68D 2F0UA 3SHLA 1SEBD 3OW7A 4PMWA 1Q1EA 3S15B 1SYDA 2O5JC 3PMFA 2NTSA 1ICWA 3T53B 2F0IA 2EPBA 5BN3A 3IFDA 4ULLA 3DXJC 4RKBA 4DAVA 3I4MB 2F3VA 1WD0A 4BWGB 3IFTA 3HRZC 1H9MA 5E1FA 1HQRD 5KYLA 2KCCA 1TIID 5IODA 4A3GB 3JAME 1WTWA 1XTCD 3NE5B 1EY4A 4OIKA 1O7ZA 4NP5A 4ABNA 5IIFA 2EJFC 1I6HB 4PV1C 2B39A 5C5MA 1H9SA 3ZYYX 1ENCA 5DM73 1KLGD 4OO1H 4BY1B 2JA8B 5IGBA 5ELFA 3OHXC 2RQXA 3MWYW 5EKIA 2IJ0A 5M3FB 1AZPA 3GTLB 1U4LA 3HOYB 2QEJC 1I4PA 3DUZA 3VYSA 4IFDJ 4C3IG 4QUFA 5T1GA 4ZYSA 3OWEB 1LTTD 5HGTA 1I4QA 4R8NA 1IHZA 4MIUA 1PYWD 3L7ZC 1O80A 4CJ1B 2FHTA 1F2LA 4H13C 1EY9A 1PTOB 4KN7C 1U4RA 2GA4B 3LNNA 1HXYD 1LLRD 1LABA 2EYFA 2HCIA 4XT1B 4EVOA 1E2ZA 2ZT9C 3AB9A 4XIGS 3TN2A 2NVXB 3EA6A 1JWMD 3DEOA 5T1IA 3S1QB 1CHQD 4R9WA 4PMCA 4QUCA 2JEBI 3RZDB 1R4PB 4KTAA 2EYOA 3SE0A 1B50A 4LAAA 3H94A 4BS9A 3I3CA 1TKWB 2Z1CA 3MXNA 2R61A 1DOKA 2IT1A 1I4GA 2M2LA 4ODGA 1O7LA 2F0MA 1Y8OB 4IURA 2XN9C 3QOLA 1J9OA 2LFNA 2JP1A 2XIWA 3FDTA 4FF4A 2J4XA 5JAVA 1RD9D 4TKOB 3CU7A 4BBRB 1VF7A 1QCBD 3SR1A 4I7ZC 5DAUA 1Q3LA 4X3KA 5IGFA 4IUVA 3MZ5A 5C3WA 2A74C 2OEOA 1I4XA 2F0WA 4DU9A 4CHTB 1JOOA 1EZ6A 3RMHA 3P1HA 1I4HA 1YNNC 3NUCA 3T56B 1Q12A 2F0NA 5CGKA 5FOBB 2F0EA 3C1EA 2RDFA 4F88A 3C1FA 2HDMA 3TP7A 3GTOB 1LT4D 2RA4A 4J1MA 2VNUD 1O7YA 1SE4A 4CJ0B 2F0GA 1KDAA 4CKBA 3MXGA 2NTTA 4WFN3 1IW7D 2JA5B 3K7AB 2WACA 1D1KA 3A54A 3HKZB 1A3VA 2F0QA 5DNFA 3S1NB 2NVYB 3SK4A 2FINB 5BN5A 3FMCA 3R2IA 3SXHA 1ESFA 3J7YW 1PZID 1EY8A 1SBBB 3DMUA 2SDFA 3QOJA 3F2UA 2BDOA 2EXZA 1CTMA 1JCKB 5KIXA 3KBXA 3DEPA 5KRUA 2PW5A 2R7ZB 1OXUA 2OT2A 1HTPA 4M1UB 3FEWX 1F9SA 1CK1A 3NXWA 5C3EB 1PFMA 3J7AF 5FK9C 1F2MA 1SJED 2F4IA 1BCPB 4K2LA 2KOLA 2IW3A 3L9AX 4G7ZC 2JEAI 3VR3A 1UNSA 2V4DA 5DM63 2K33A 1CI3M 3NBHA 3GTMB 2AWOA 5M5YB 2E2IB 1KABA 3S16B 3TZUA 3HOZB 4GZYC 2K03A 1SSOA 3X3MA 1STHA 2KUMA 1TS4A 4IQZA 1I6VC 2A5HA 5A2QE 5E4WC 3QWNA 3OIPA 1Q90A 2X6GA 1DYQA 2QF7A 2G9HD 1G2TA 2EYMA 2K05A 1X3QA 3T51B 3PUXA 1IYVA 2F3WA 5I6WA 1GXDC 1CHPD 1LTRD 2CW0C 3E6ZX 4LK1C 4M8AA 1SYBA 4MHEA 2D2CC 2K32A 4DGZA 5EKLA 3TSSA 2LMCB 2MP1A 4FP5D 2IX3A 2BDNA 4N9PA 1B4OA 4KHZA 4KI0A 4ZK9B 4K14A 2NYZD 4IALA 1D1IA 2IX0A 4OO1I 3MC0B 4CBVA 1EY0A 4IFDI 2Y0SB 1GHKA 3D4WA 1HTLD 4O42A 5KYIA 1KNAA 1MSGA 2K1BA 4FYDA 1H9KA 4OL7A 4X3UA 4A3KB 2NZ1D 1JICA 4KJNA 5I2YA 3HP3A 1SYGA 3TP5A 2F0SA 3FPPA 3ND9A 1EWHA 1B1ZA 4K5XA 5EGTA 1A6XA 3IL8A 3VYTA 1ZEQX 4ZKBB 1WTRA 4XDXA 4FF2A 1BUVT 1STAA 2NVTB 3Q6SA 4FF3A 2BA0A 3G7LA 3TP6A 1IW7C 1PDQA 5M9OA 3HG9A 3S2HB 3DM1A 2F1MA 2A6HD 2EYJA 3HOUB 1GUOA 4XXEA 5COYA 1WTXA 1PTOD 5K5PA 2PZUA 4PMBA 3S14B 4F8MA 1CQVA 5F2DA 4QF4A 5C6AA 1WTQA 2WB1B 1XYIA 4S3SA 2R6GA 4L6TB 2BOSA 4K6LA 1RTNA 3VR2A 4PNYA 5JVG3 4Q0FA 2VUMB 4A3JB 3PO2B 3OIQA 1TWFB 2Q8RE 3BDOA 1NR2A 2XSCA 3PUVA 2PQEA 4HTHA 2OXPA 4EQOA 1V1PB 4IUPA 1A2UA 4XQQA 1H9RA 2R93B 1STEA 2EY5A 1HRJA 2AWNA 2MGSA 2F0HA 3M7NA 4NMZA 4KK7A 2PO4A 1IL8A 2XRQD 2K28A 1FNVA 1KAAA 2RKSA 1TT2A 4UAIA 1E2VA 5CBEE 1FYCA 2QILA 4RGTA 2MUYA 3HZXA 1H9JA 4IN3A 2YYZA 3H0GB 3I90A 1HA6A 1VMPA 4DAYA 2FJ2A 1JWSD 4ZRZA 4K8JA 5M5WB 3A7AB 3NSWA 1O78A 1TU2B 4EQNA 3S1MB 3Q0AA 3MFGA 2WKCA 2F0VA 4H0LC 1EZ8A 5M3MB 1V1OA 1BF4A 4A93B 1GJXA 1B53A 1WTOA 2RSNA 5ELDA 1C48A 3D6CA 1PRTF 1U4PA 4XQJA 4RA8A 1SMYC 3K6OA 4IZ8A 2L0CA 3QB3A 1MI2A 2EDGA 4QB4A 1I3QB 3DHQA 1VCIA 2AUJD 2B63B 4NW2A 4KJOA 5NUCA 1U9RA 5C3XA 1G91A 1HA5A 1EQVA 4PQXA 1JR0D 1UUPA 3OMGA 3M4OB 4C3JG 3N52A 5J1ZA 1TWAB 1BR9A 2IX1A 2A6EC 2J7ZA 1GUNA 2EY1A 4HN7A 4LMQD 4ZQ3A 3A8IE 4CKEA 3UI2A 1CFMA 2XNAC 3PUYA 5CBAE 1CA5A 2A73B 2B2VA 5A35A 3H3VC 3M85A 4BA2I 4L63B 1YNJD 5IT9L 2IPKD 4U68A 1BCPD 1EFID 1RTOA 1OXSC 3W3AA 4KHVA 2D5DA 2L55A 4G57A 5D14A 1G2SA 3MA2B 1S5FD 1DOLA 3GTKB 1D5MC 4KY7A 3OSOA 3RLFA 1Z6HA 3TP8A 1CZWA 1UEAB 3KF8A 3P20A 1SNPA 5CV5A 1EY7A 4H44C 1LT3D 4Y7NB 1VF5C 2A69D 4FXDA 4MN3A 2AQ1B 3H6MA 1ILPA 1EYDA 2ZXRA 2HQEA 3AU7A 2D9UA 4KN4C 4C1NI 1EU4A 5EPKA 1QNUA 3VYRA 4A3FB 4IUTA 3EJIA 1PRTC 1F2ZA 2KA7A 3JAML 2JA6B 1L0XB 5FLXE 1WCMB 2BE5D 3MHBA 1DZ1A 1PXUA 4HR7B 2KEEA 5E3FA 1WTPA 3C3LA 4XQNA 2B8FA 3D6WA 3K0YA 3PIP3 3NP8A 2K5WA 3LX0A 2CQAA 1U4MA 3S17B 1QILA 4ZUJA 5KNCA 1LACA 4KY5A 1LTID 3CHBD 1WD1A 3R93A 3GTPB 1EU3A 3WOFA 1AW7A 3S9WA 1B2TA 2F0OA 2PNRC 4U673 3SDZA 1XXGA 3GD7A 2A68C 1EYCA 2BA1A 1IKMA 4H7BA 5I4DA 2F0LA 3LWUA 2R92B 2Z4IA 1V8QA 1AN8A 2NB0A 1ZYRD 3PV0A 1RDPD 1TQOA 4UDUC 1ESRA 1JB3A 3FVQA 4K8IA 4RCOA 4XTCS 3FKIB 1Z47A 3K5MA 3OMCA 1DONA 2KCNA 5D65A 4QMGA 2SNSA 3CQZB 1RHPA 2NN6I 2B8GA 1X32A 4RGOS 5C4JB 3T4AC 5KNDA 2O2LD 4IUUA 1DJRD 3CRKC 1SNDA 1D2BA 3URYA 1A2TA 1SDFA 2NUCA 1LTGD 3IAYA 1LTSD 1BO0A 5J22A 3I73A 4HCEA 5JPNC 1ILQA 2B2VC 3KLSX 4KMUC 1G8ZD 2LKVA 1SE3A 1GUTA 5DEHA 2DNCA 5JVH3 1FGBD 2M00A 1GUGA 1SXTA 4JBWA 3LWEA 3D8GA 1NCVA 3BYTB 2PYKA 1B9NA 3R8BA 3GV6A 4K6DA 2R3ZA 2PZTA 1R9TB 1BNZA 1TVXA 4EGVA 2TMPA 5ELCA 4IFDG 1UAPA 3U9OA 5LL6S 4TQUS 2NWGA 5FO9B 5LL6X 3ND8A 3OOCA 1MBYA 2AUKA 1TWHB 2PMZB 2F0JA 2A69C 1RODA 2WIIB 1BDOA 4C1NK 3J7AV 1ZXTA 1PLFA 2DN8A 2ZXPA 5EQ0A 3VA5A 3J80E 3P7JA 5EJWA 1MSHA 5C0XH 1C4QA 1D5XC 1DOMA 3I91A 1SYCA 1STNA 1HFNA 2QDBA 1LTAD 4OIJA 4O1NA 1B9MA 2FFKB 4OHJA 1QNKA 5C0XJ 5BN4A 3W2DA 3X3NA 4WRDA 2O4XA 4B9XA 1PZKD 2F03A 3BVZA 3NHHA 5ELEA 3O13A 1CA6A 4HSPA 4L8JA 4NDXA 2N88A 1BBXC 3J81E 4QCLA 4RHRA 4F87A 4JK1C 1K8MA 3NQTA 1RKNA 3V05A 3MXUA 5I9PA 1AP0A 1HHVA 3NBIA 1B44D 5KNBA 1AEXA 2TSSA 5EKKA 2PW7A 3WDNA 3E0JA 3G6JB 3BS1A 2XWBB 4B9WA 5JJZA 1LTBD 4TSSA 4IUNA 3P75A 4Q5VA 1SFOB 3K5NA 5CV4A 1SNMA 1QOHA 2RBMA 3GO5A 4BY7B 3GTQB 1X3PA 5EBCA 3S1RB 1Y8NB 4CJ2C 4WJWA 2L5TA 1JOKA 4K5WA 5I6YA 4CKCA 1BXTA 4C3HG 3QJYA 5A2QL 1D6EC 1VDZA 1W6JA 2ICEC 3MTSA 4IUQA 4DK0A 2EJMA 4X3SA 2WKDA 1DXMA 4OGQC 4HCSA 2JA7B 3I72A 3QO2A 4KY6A 2JE6I 4WORA 2DY8A 5EBDA 3FRPB 4RWSC 1FD7D 3L3OC 1ENFA 4I65A 2QKIC 5IGGA 1IKLA 1JOQA 3ERQA 1TS3A 5JPMC 1JE4A 1EEFD 1PFBA 4N9TA 4K5VA 1HUNA 2K7VA 5IGCA 3S2DB 2WP8J 1EEID 1TWGB 2DNEA 4C3IB 4J6HA 1ET6A 2F0TA 1SYFA 2L9HA 3NK9A 2VB2X 3D4RA 5G3LD 4NKLA 3V2TA 5K36G 2J0TD 1QE6A 5EPLA 3MEHA 2F0DA 3RD4A 1EOTA 2VB3X 1PTOF 1OO9B 3TBIB 3M3YB 1Y1WB 2L12A 2DY7A 4G4KA 2N55A 1KDCA 3OPOA 1D5ZC 1XX8A 1M4VA 1HPCA 2K5QA 5D3DA 1EYAA 1LO5D 3CRLC 4DK1A 3K58A 3I70A 3HEJA 3U9SA 2K6AA 1F9RA 2KVMA 2F0PA 1GOZA 3R2TA 3KBGA 1CZGA 3CKIB 2EYHA 2H4OA 3NTKA 3TMEA 5G3LF 3VR6A 1A3TA 2ZXOA 4RKLA 1PZJD 1NAPA 2Q8IB 3BG3A 2EVBA 1QWYA 5C4HA 3KK7A 2JXMB 3IKJA 4KD4A 1G291 4KD3A 4RGNA 2C5CA 3D31A 1RJTA 1CQFA 4K2KA 1EWCA 5CV8A 1YNND 3H09A 4ZAIA 3MFYA 1FNWA 1PTOH 2HUGA 4CGYB 2I07B 1KDBA 3SVMA 2MPMA 5AFWA 1PFNA 4ZUIA 2A6HC 5C44B 1V43A 1Q1BA 3D3RA 4B08A 4IFDH 3KUPA 3NQIA 1OXXK 1PTOC 4ZLTF 5C0XI 1F2YA 5M5XB 3E5SA 4DN4M 2CVRA 2X69A 2AQ3B 1OXTA 4DFAA 5CYUA 1KNEA 1S5DD 1II3A 3EVQA 2AQ2B 2NN6G 2FMMA 2IWHA 1NUCA 4HMIA 1RF2D 4RHSA 2JSOA 1Q8IA 2I46A 2FMCA 1F9PA 2Q8TA 2KECA 2M9VA 2E2DC 3KLSA 1Y69U 3HOVB 5KEEA 1BCPF 4RGMA 2KJXA 3GTGB 4EQPA 5CV7A 1NR4A 1JWUD 1ONLA 1NSNS 3PO3B 1T5XD 2F0FA 2EZVA 4BBSB 2SOBA 2L4NA 1A3UA 5JEAG 1SNOA 2XVSA 1LT6D 2ENBA 2B2WA 4DA2A 3AMUA 1XWEA 2RDHA 2KEDA 1DM0B 1PRTB 4FXGC 1OXVA 1JC7A 2L11A 3K5LA 2B2YA 2E76C 3T16A 2CW0D 4A3DB 1IYUA 4HEDA 3DWQA 1TR5A 3A8KE 1KLUD 5CMDA 3SK8A 1TY0A 1CM9A 3HS0C 5C4XB 1M8AA 3NTHA 1EIHA 3C46A 4ILWA 1S4ZA 3ITPA 4QIWB 2EOTA 4FF1A 1EY6A 5E4XA 4TRDA 4BA1I 1CT1D 2LS01 4DNRB 1EY5A 2Z4HA 1WTVA 1EL0A 1RCVD 3BVMA 3VYUA 1J8IA 2SNMA 2MJ8A 1TY2A 2E2HB 5FO8B 3A7LA 5FLXL 1Z7TA 1BQQT 2ICIA 4YIJA 3M7GA 1STYA 1YNJC 1ML0D 5I9OA 4G7HC 4KKTA 1SNCA 3TDQA 2PZWA 2WV6D 2E2JB 5IOCA 4LJZC 1BCPC 4ID6A 2SEBD 3VR5A 3HGBA 1MD2D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CV9 A;  2F0N A;  2SOB A;  4K8J A;  1TQO A;  4RKB A;  3TP6 A;  5CGK A;  2F0E A;  3C1E A;  1A3U A;  2F3V A;  3BDC A;  2RDF A;  1SNO A;  2KQ3 A;  4K8I A;  3MEH A;  4EQN A;  4KY7 A;  2F0J A;  2F0D A;  2ENB A;  5CR3 A;  5M9O A;  3OSO A;  3C1F A;  1KDB A;  3TP8 A;  3ERO A;  2EYF A;  3OMC A;  5CC4 A;  3TP7 A;  4EVO A;  3MVV A;  2EYM A;  2EYJ A;  1SNP A;  2SNS A;  4QMG A;  5E1F A;  3VA5 A;  5J39 A;  4J1M A;  3D4D A;  4ZUI A;  5CV5 A;  2F0V A;  3T16 A;  5KYL A;  1JOK A;  1EZ8 A;  5K5P A;  1EY7 A;  2EYP A;  4K5W A;  2F0G A;  1KDA A;  2PZU A;  5IOD A;  3MXP A;  2F3W A;  4PMB A;  5I6Y A;  1SYC A;  1STN A;  5I6W A;  5HUR A;  4F8M A;  1EY4 A;  5IGE A;  1KDC A;  2QDB A;  5F2D A;  4QF4 A;  1SYE A;  1TR5 A;  2WAC A;  1F2Y A;  5C6A A;  4PMC A;  3E5S A;  4ME5 A;  4NP5 A;  1A3V A;  2F0Q A;  4KV6 A;  1SND A;  4S3S A;  4E6I A;  1A2T A;  3H6M A;  1EYD A;  5IIF A;  3D6C A;  2NUC A;  1SYB A;  3SK8 A;  1ENA A;  3SK4 A;  2HQE A;  5C4Z A;  4DGZ A;  5EKL A;  3SXH A;  3RUZ A;  5J22 A;  2KHS A;  4DFA A;  4PNY A;  1EYA A;  4IZ8 A;  4WRD A;  4KTA A;  1EY8 A;  1STB A;  2EYO A;  3DMU A;  3QOJ A;  4LAA A;  2O4X A;  3QB3 A;  5C5M A;  2EXZ A;  4B9X A;  5ISR A;  3SK6 A;  1ENC A;  5JOB A;  4N9P A;  3EJI A;  3NHH A;  5KGU A;  1SNQ A;  5KIX A;  1F2Z A;  3HEJ A;  2PW5 A;  4QB4 A;  5KRU A;  5IGB A;  2LKV A;  4KY6 A;  1JOR A;  4F7X A;  4K14 A;  2EY6 A;  1II3 A;  3DHQ A;  3EVQ A;  3ITP A;  4IAL A;  2F0P A;  4NDX A;  4WOR A;  5DEH A;  3MHB A;  3NXW A;  2PQE A;  4KJO A;  1EY6 A;  4ODG A;  4HTH A;  5NUC A;  2OXP A;  2F0M A;  5C5L A;  1U9R A;  1EY0 A;  3QOL A;  5C3X A;  1NUC A;  4TRD A;  4EQO A;  4I65 A;  3D4W A;  1A2U A;  1EQV A;  1F2M A;  2M00 A;  4HMI A;  5E3F A;  5KYI A;  3OMG A;  3D8G A;  4HMJ A;  1EY5 A;  5IGG A;  2EYH A;  3NQT A;  1RKN A;  2EY5 A;  2PYK A;  5J1Z A;  4OL7 A;  4K2L A;  3TME A;  2EY2 A;  1JOQ A;  2F0H A;  3BDL A;  5I9P A;  3NP8 A;  4KJN A;  5JAV A;  4NMZ A;  3ERQ A;  2EY1 A;  2SNM A;  3LX0 A;  1A3T A;  3OWF A;  4ZQ3 A;  4ZUJ A;  1SYG A;  4N9T A;  4K6D A;  4K5V A;  4KY5 A;  1AEX A;  4RKL A;  2PZT A;  3TP5 A;  2F0S A;  1KAA A;  5HGT A;  2RKS A;  1TT2 A;  5EKK A;  5IGD A;  5IGC A;  2PW7 A;  4R8N A;  3SR1 A;  2F0U A;  5DAU A;  3SHL A;  1IHZ A;  3S9W A;  5C4H A;  2F0O A;  3T13 A;  4MIU A;  4YIJ A;  5KEE A;  2OF1 A;  5IGF A;  4K5X A;  5EGT A;  1SYD A;  3MZ5 A;  3HZX A;  4KD4 A;  4B9W A;  1EYC A;  5C3W A;  1KAB A;  4KD3 A;  4H7B A;  1STY A;  3P75 A;  4IUN A;  4J6H A;  3PMF A;  4EQP A;  1EY9 A;  2F0L A;  5CV7 A;  2OEO A;  3U9O A;  4K2K A;  5I9O A;  2F0T A;  1SNC A;  2F0W A;  1SYF A;  3SK5 A;  3NK9 A;  4DU9 A;  2PZW A;  3R3O A;  1STH A;  5CV8 A;  4KHV A;  5CV6 A;  5IOC A;  1JOO A;  1NSN S;  1SNM A;  1EZ6 A;  2F0K A;  5CV4 A;  4ID6 A;  4DF7 A;  2RBM A;  1STG A;  2F0I A;  3P1H A;  4NKL A;  4G57 A;  3V2T A;  2F0F A;  1STA A;  2EYL A;  3NUC A; 
#chains in the Genus database with same CATH topology
 1H9S B;  3HOX B;  4N8F A;  1EFW A;  1JQY D;  4DR4 L;  4GN4 B;  5CR3 A;  1GUS A;  1VQG A;  1WI5 A;  1YZ6 A;  4OO1 G;  4DV5 L;  1TS5 A;  3BZC A;  1PH8 A;  3MVV A;  2B2T A;  2G9D A;  1F9Q A;  4B3S Q;  2HHH L;  4FDB A;  2WAQ B;  1SJH D;  2B2U A;  4C3H B;  4WJ3 M;  4A3F G;  3BYY B;  3MXP A;  2LY7 A;  4A3B B;  1HR0 W;  1VQD A;  1S5B D;  2JA6 G;  1CSP A;  3GTJ B;  1V1P A;  1SYE A;  1HCZ A;  1WCM G;  1AH9 A;  1UEB A;  1T5E A;  4KKS A;  1N34 Q;  1GUW A;  3ONA B;  1ENA A;  5K36 H;  2MHV A;  3I4N B;  3RUZ A;  2IL8 A;  4RAU C;  4XYQ A;  2E74 C;  1PH1 A;  3A56 A;  1L0W A;  5ISR A;  3SK6 A;  3KF8 B;  4DR5 L;  5JOB A;  4FO2 A;  3W1G A;  1SNQ A;  2ID0 A;  3T1H Q;  1YJN A;  1JOR A;  5IYB G;  1E2W A;  4DKA C;  4R8I A;  4RH6 A;  3A55 A;  2C9O A;  4LFC Q;  2Z0S A;  1C8C A;  1FNU A;  2BE5 C;  1B3Q A;  1LT5 D;  4FXK C;  3L2P A;  1BBU A;  4V0B A;  2QCP X;  1UE1 A;  3EQL C;  4J8Q A;  4P72 A;  1EQT A;  1VQB A;  1QB5 D;  3K81 C;  2R92 G;  4RCN A;  1E24 A;  2B2W C;  4AQY L;  1ET9 A;  3Q8D A;  5IGD A;  3CCQ A;  4A3K H;  1MJE A;  3SEB A;  4JI2 Q;  1BOS A;  2B2Y C;  2D62 A;  1N8R C;  2K5N A;  2OF1 A;  2EIF A;  3KLR A;  4JI3 Q;  4P2C B;  3GQB A;  3QIA A;  3MAQ A;  1CKO A;  4XT3 B;  3FKI G;  3I8Z A;  1A15 A;  4HIM A;  3ICE A;  3H3V I;  3WOE A;  3R3O A;  5CV6 A;  1G6Z A;  5IP9 G;  1YI2 A;  3PIO 3;  1L2F A;  1ZKO A;  1I4R A;  3DWA A;  1S5C D;  3FPU B;  3PSI A;  1ZYR C;  3BDC A;  4YCW A;  2NVQ H;  1W6K A;  3F2C A;  1IBK L;  1SLJ A;  3BZD B;  3NTI A;  4C2M H;  4B3M Q;  2XWJ B;  5CC4 A;  2MO0 A;  1IBM L;  4GS3 A;  5J39 A;  4DAP A;  4GNX B;  2O5I C;  1XPO A;  2HCC A;  3I4L A;  2Z8L A;  3C2P A;  3S2H H;  3NWS A;  3V96 A;  2DJG C;  4C3J H;  1VQ7 A;  1TS2 A;  5HUR A;  3QG1 A;  2RDG A;  1AZQ A;  5COR A;  4LFA Q;  1YBY A;  3KYH C;  5IGE A;  4DV0 L;  3HOU H;  1KRS A;  1QG7 A;  2JN4 A;  2PPB C;  4GLA C;  4KV6 A;  3U4V A;  3K5O A;  1SMY D;  2LSS A;  1R4Q B;  1HNX L;  3HKZ G;  1Y1V B;  5C4Z A;  1KTK A;  4GOP B;  1MGS A;  3S14 H;  1U5K A;  4XYO A;  3AFQ A;  3EBE A;  2VXW A;  5GRO A;  3J80 L;  1I50 H;  4KKU A;  3CMA A;  5KGU A;  3A8J E;  5LHY 1;  1X65 A;  5FO7 B;  4AYB B;  1VQ4 A;  4JPB W;  2R7Z G;  2NZH A;  3BVG A;  5TSS A;  3TZD A;  2VUM H;  3OYY A;  5C5L A;  1K83 B;  3PO2 H;  1TWF H;  4V19 0;  1PMR A;  2A6E D;  5C3E G;  4MTN A;  1S5E D;  2CFM A;  4DV7 Q;  4IJH A;  1K8O A;  2HD3 A;  3BDL A;  3VA7 A;  3PUZ A;  4LF8 Q;  2NVQ B;  1E0B A;  2EE1 A;  2WIN B;  3UDF A;  3VR4 A;  3K57 A;  3OWF A;  3KF6 A;  4DXF A;  1VMC A;  5D3I B;  2HDL A;  4C2M B;  1HQM C;  4A3M H;  2R93 H;  4FNF A;  2K75 A;  1HFG A;  2BCO A;  3J81 L;  3F2B A;  2B2T C;  2CHB D;  1DCZ A;  1KIX A;  3T13 A;  4ZKC B;  2R7D A;  4C3J B;  2RVL A;  4A3L H;  3N6R A;  1Y8P B;  1QJO A;  2B2U C;  4POF A;  1EIG A;  2NN6 H;  3VDY A;  4C56 C;  4IPG A;  1L0Y B;  2A8V A;  1FR3 A;  4HAE A;  3SK5 A;  2PCF B;  1TWC H;  3ULJ A;  1C9O A;  2F0K A;  3H91 A;  2L1B A;  2NBF A;  2N3S A;  4DF7 A;  1STG A;  4G7O C;  4JI0 L;  4B3T L;  3RZO B;  2X6L A;  4HSV A;  2EYL A;  2RSO A;  5CV9 A;  4DV3 Q;  1M90 C;  1I50 B;  2JYO A;  2KQ3 A;  5AJ3 L;  3CCR A;  1WVL A;  1B3A A;  4DNT B;  5FKA C;  1SAP A;  3QR8 A;  3GV3 A;  5I2X A;  3EIV A;  3ERO A;  1NTG A;  3HOW B;  3D4D A;  1IXR A;  2EYP A;  1XMO Q;  2HT1 A;  3S1M H;  1SMX A;  3S15 H;  3NPP A;  4A3E B;  3M4Y A;  2PQA B;  4DAM A;  1F77 A;  4N8X 1;  2MO1 A;  4NB3 A;  4ME5 A;  2UUB L;  5M3M H;  4DXG A;  3Q22 A;  4E6I A;  4DV2 Q;  4GN3 B;  2JA9 A;  2K01 A;  2H1E A;  4X3T A;  2XRS D;  4FVM A;  1PYB A;  4DR1 L;  1QVC A;  4R4T A;  1RIP A;  3Q23 A;  4A3M B;  4LF9 L;  2KHS A;  1PRT D;  2AHO B;  5JEA H;  2OQK A;  4DUY Q;  1STB A;  2EJG C;  3EFX D;  2E75 C;  3I4M H;  1DD2 A;  2ZM6 Q;  4ME3 A;  4OEL B;  1GHJ A;  3ULL A;  5ELB A;  3J80 i;  1K0S A;  2VZA A;  4F7X A;  3GP7 A;  4RFB A;  3NWT A;  3J7A 5;  2EY6 A;  3K59 A;  2QA4 A;  2C35 B;  3HFZ B;  3Q24 A;  5JEA J;  1TWC B;  4A3I B;  2PI2 A;  2K04 A;  4Z9C B;  1HUM A;  5C0X G;  5IT9 E;  2UU9 L;  1I3Q H;  2K5D A;  1AFP A;  2Y0S G;  3PUW A;  2N8N A;  4HMJ A;  2B63 H;  2A1A A;  4BXX G;  2EY2 A;  5EPJ A;  3DWP A;  1I6H H;  2ZJQ A;  2YU9 B;  3CCJ A;  1TWA H;  1LV9 A;  1SE2 A;  4YHH L;  4B3R Q;  4BY7 G;  2IY5 B;  2A68 D;  2XTI A;  4DR6 Q;  2F0U A;  3SHL A;  1SEB D;  3OW7 A;  4PMW A;  1Q1E A;  3S15 B;  1SYD A;  3J81 i;  2O5J C;  4UP9 A;  3A5Z B;  3PMF A;  2NTS A;  4LUZ A;  2Z9H A;  1ICW A;  5M3F H;  3T53 B;  4OWW B;  2F0I A;  2EPB A;  2PI2 E;  5BN3 A;  5HY6 A;  3IFD A;  4ULL A;  3DXJ C;  4RKB A;  4DR7 Q;  4DAV A;  1NMF A;  1ASY A;  3I4M B;  2F3V A;  2OQ0 A;  1WD0 A;  3PGZ A;  4BWG B;  1XMQ Q;  3IFT A;  3HRZ C;  2GVB A;  1VQ6 A;  1P8L A;  1H9M A;  5E1F A;  3BZK A;  4LFC L;  1HQR D;  3GTK H;  1QVF A;  5KYL A;  2KCC A;  1TII D;  5IOD A;  4A3G B;  3JAM E;  4R4O A;  1WTW A;  2JA7 G;  1XTC D;  3NE5 B;  1HZC A;  1EY4 A;  3K8A A;  2I5H A;  4OIK A;  1O7Z A;  4NP5 A;  4ABN A;  2E5L Q;  5LMU Q;  5IIF A;  1QVG A;  2EJF C;  1I6H B;  4QIW E;  4Y7N H;  4DR3 Q;  4PV1 C;  2B39 A;  5C5M A;  1H9S A;  3ZYY X;  1ENC A;  3KDF A;  1KLG D;  5DM7 3;  4OO1 H;  3TQY A;  4BY1 B;  2JA8 B;  5IGB A;  4A3J G;  5ELF A;  4JI4 L;  3OHX C;  2RQX A;  4A3F H;  3MWY W;  4PZ6 A;  5EKI A;  2NVX H;  2IJ0 A;  5M3F B;  2JA6 H;  2F52 A;  1AZP A;  1E3P A;  3GTL B;  1U4L A;  2CH4 A;  1WCM H;  2QEJ C;  3HOY B;  1I4P A;  3DUZ A;  3VYS A;  4NPS A;  4IFD J;  4C3I G;  4QUF A;  4CDC C;  5T1G A;  1VS0 A;  4DNI A;  5L37 A;  1Q81 C;  3U50 C;  3CCL A;  1EWI A;  3CC4 A;  4ZYS A;  3OWE B;  1LTT D;  5HGT A;  1I4Q A;  4R8N A;  4OEM B;  4P74 A;  1IHZ A;  1K0R A;  1D8L A;  5IYB H;  4OWT B;  2UXC Q;  3S17 H;  4MIU A;  1PYW D;  3TRE A;  3L7Z C;  1O80 A;  4OX9 Q;  3A5U A;  4CJ1 B;  2FHT A;  1F2L A;  4H13 C;  1EY9 A;  3CCU A;  4UP7 A;  3J80 c;  1PTO B;  2VQF Q;  3OTO Q;  4KN7 C;  1U4R A;  3TS0 A;  1FGU A;  3NEN A;  2GA4 B;  2WAQ E;  2R92 H;  3LNN A;  3STB D;  1HXY D;  1LLR D;  5LMN Q;  4KLK A;  1LAB A;  2EYF A;  4LF4 Q;  2HCI A;  3I7F A;  4XT1 B;  4EVO A;  1E2Z A;  2ZT9 C;  3AB9 A;  4XIG S;  1JB7 A;  2PMZ E;  3TN2 A;  2NVX B;  3EA6 A;  4LNQ A;  1E1O A;  1JWM D;  1EOV A;  2AKW B;  3FKI H;  3DEO A;  5T1I A;  2QEX A;  4DV7 L;  3S1Q B;  1CHQ D;  4R9W A;  1A0I A;  3CQZ H;  5IP9 H;  4PMC A;  4QUC A;  4A93 G;  2JEB I;  3I2Z A;  2LXK A;  3RZD B;  1R4P B;  3I4O A;  4KTA A;  1FVI A;  2EYO A;  3SE0 A;  1B50 A;  4LAA A;  2KCM A;  3H94 A;  4GN5 A;  4BS9 A;  3I3C A;  4UHV A;  1TKW B;  2Z1C A;  3MXN A;  1UE7 A;  3T1Y Q;  2R61 A;  1DOK A;  2IT1 A;  1WTH A;  1I4G A;  1KRT A;  3RN2 A;  4DV1 L;  2M2L A;  1YJW A;  4ODG A;  1O7L A;  2F0M A;  1Y8O B;  4IUR A;  2XN9 C;  3QOL A;  1J9O A;  2LFN A;  2JP1 A;  2XIW A;  3FDT A;  4FF4 A;  2IHF A;  4LWC A;  1T9H A;  4LW1 A;  1TXY A;  2K50 A;  2J4X A;  1I94 Q;  1JE5 A;  4YWK A;  1RD9 D;  4TKO B;  5JAV A;  3W5O A;  3S1N H;  3CU7 A;  2F3I A;  4BBR B;  3KJO A;  2HIX A;  1QUQ A;  4YY3 L;  1VF7 A;  1QCB D;  4P73 A;  2UXD Q;  3SR1 A;  4I7Z C;  5DAU A;  1Q3L A;  1Y14 B;  4X3K A;  1XMO L;  5IGF A;  3M4Q A;  1IYJ B;  2R7Z H;  4IUV A;  3MZ5 A;  5C3W A;  1R9T H;  1L1O A;  5E7N A;  2A74 C;  2OEO A;  1I4X A;  2F0W A;  4QQB X;  5C3E H;  4DU9 A;  4DV2 L;  5IYC G;  4CHT B;  1JOO A;  1EZ6 A;  3RMH A;  5C44 G;  3P1H A;  1I4H A;  1EYG A;  1YNN C;  3NUC A;  3T56 B;  1Q12 A;  2F0N A;  4X62 Q;  5CGK A;  5FOB B;  2ES2 A;  4IOA A;  3PIO A;  2F0E A;  2JQO A;  3C1E A;  2RDF A;  4F88 A;  4H02 A;  3C1F A;  1SN8 A;  2HDM A;  3TP7 A;  3GTO B;  2AMC B;  1LT4 D;  2RA4 A;  2K52 A;  4J1M A;  3KFU A;  2VNU D;  1O7Y A;  1TWH H;  1SE4 A;  4CJ0 B;  3KOJ A;  2F0G A;  1KDA A;  4CKB A;  3MXG A;  2NTT A;  4WFN 3;  1VQ9 A;  2E2I H;  1IW7 D;  1JMC A;  1YEZ A;  1IBL L;  2JA5 B;  3K7A B;  1XPR A;  2WAC A;  1D1K A;  3A54 A;  3HKZ B;  1A3V A;  2F0Q A;  5DNF A;  2BH2 A;  3S1N B;  2NVY B;  4AYB E;  3SK4 A;  2FIN B;  1DGS A;  5BN5 A;  3FMC A;  3R2I A;  3SXH A;  1ESF A;  4HJ7 A;  3CCE A;  1V9P A;  3AEV A;  2KHI A;  3J7Y W;  1D7Q A;  1PZI D;  1EY8 A;  1SBB B;  3DMU A;  2SDF A;  3QOJ A;  4X64 Q;  3F2U A;  2BDO A;  2EXZ A;  4GKJ L;  1CTM A;  1JCK B;  1P16 A;  5KIX A;  1A8V A;  3KBX A;  3DEP A;  5KRU A;  2PW5 A;  2R7Z B;  1OXU A;  2OT2 A;  1HTP A;  4M1U B;  2I5M X;  3FEW X;  1F9S A;  3UE1 A;  1CK1 A;  3NXW A;  4X65 L;  5C3E B;  1PFM A;  3J7A F;  1JT8 A;  1X3F A;  5FK9 C;  1F2M A;  3HOV G;  1SJE D;  2F4I A;  4L5S A;  1BCP B;  4K2L A;  4GLX A;  2KOL A;  2IW3 A;  3L9A X;  4G7Z C;  3K80 C;  2VQE Q;  2JEA I;  1UE5 A;  1XMQ L;  3VR3 A;  4POG A;  2Z6B A;  4CDF C;  3PO3 G;  1UNS A;  2V4D A;  5DM6 3;  4DV4 Q;  2K33 A;  1VQI A;  3B6Y A;  1HNZ L;  3A74 A;  1CI3 M;  3NBH A;  3GTM B;  2F4V L;  2AWO A;  1VQP A;  5M5Y B;  2E2I B;  4LF5 Q;  1KAB A;  1J6Q A;  3S16 B;  3TZU A;  4JBM A;  4KHP Q;  4TVA B;  3HOZ B;  4GZY C;  2ZTD A;  2K03 A;  1SSO A;  3X3M A;  5LMU L;  1STH A;  2KUM A;  1WYD A;  1TS4 A;  4BXX H;  2FXQ A;  1I6V C;  4IQZ A;  2A5H A;  3D0F A;  4A3D G;  4JV5 Q;  5A2Q E;  5E4W C;  1HH2 P;  3QWN A;  3OIP A;  1SFO H;  1Q90 A;  2X6G A;  1DYQ A;  4DV6 Q;  2QF7 A;  1KXL A;  2G9H D;  1CKM A;  1PHJ A;  4R1J A;  1G2T A;  2EYM A;  2K05 A;  5C4X G;  4GKK L;  2UXB Q;  1X3Q A;  3T51 B;  3S1R H;  3CW2 C;  3PUX A;  1IYV A;  2RCN A;  1G51 A;  2UUA Q;  2F3W A;  4JI5 Q;  5I6W A;  1GXD C;  1CHP D;  1BKB A;  1LTR D;  2CW0 C;  1KAW A;  3CF5 A;  1V1Q A;  3E6Z X;  4LK1 C;  4LF6 Q;  4M8A A;  1SYB A;  4MHE A;  2D2C C;  2K32 A;  4DGZ A;  5EKL A;  3TSS A;  2LMC B;  2NVT H;  2MP1 A;  4FP5 D;  1M1K C;  2YTV A;  2IX3 A;  2HIV A;  2QW7 A;  4A76 A;  2BDN A;  1HZB A;  1BVS A;  4N9P A;  1KC8 C;  1B4O A;  2P5Z X;  4KHZ A;  4KI0 A;  4OX9 L;  4ZK9 B;  4JI7 Q;  4K14 A;  2NYZ D;  4IAL A;  1Q46 A;  1D1I A;  4UY8 C;  2IX0 A;  4OO1 I;  1L1O C;  1ASZ A;  4IOC A;  3MC0 B;  4CBV A;  1EY0 A;  2JA7 H;  2Y0S B;  4IFD I;  2CCZ A;  1GHK A;  3D4W A;  3ERS X;  1HTL D;  4O42 A;  5KYI A;  1NJI C;  1CUK A;  1KNA A;  1E1T A;  1H95 A;  1MSG A;  2K1B A;  4FYD A;  1H9K A;  4OL7 A;  4X3U A;  4A3K B;  2NZ1 D;  1JIC A;  3CC7 A;  4KJN A;  5I2Y A;  3HP3 A;  1A63 A;  5BR8 L;  3JAM c;  1SYG A;  3TP5 A;  2F0S A;  3FPP A;  3ND9 A;  2XGT A;  1GKH A;  3HOX G;  3F1Z A;  2YTX A;  1EWH A;  2ZTE A;  4A3J H;  1B1Z A;  1HZ9 A;  4K5X A;  1K9M C;  5EGT A;  2ASB A;  1X54 A;  1A6X A;  1S72 A;  3IL8 A;  3VYT A;  1ZEQ X;  4ZKB B;  1WTR A;  1E7Z A;  3CCV A;  4XDX A;  2WFW A;  3I55 A;  4FF2 A;  1BUV T;  1YHB A;  4YWL A;  4DUZ Q;  2WAQ G;  1TWG H;  4C3I H;  1STA A;  3CME A;  4LF7 Q;  2NVT B;  4A3B G;  3Q6S A;  4FF3 A;  2BA0 A;  3G7L A;  3TP6 A;  1IW7 C;  1VQ8 A;  1PDQ A;  5M9O A;  3HG9 A;  3S2H B;  3DM1 A;  4R4I A;  2F1M A;  1C0A A;  2A6H D;  4JOI A;  1MJC A;  2EYJ A;  3HOU B;  1GUO A;  4P71 A;  5COY A;  4XXE A;  1WTX A;  1PTO D;  5FJ8 G;  5K5P A;  2PZU A;  2Z6K A;  4PMB A;  4JI1 L;  4HJ9 A;  3S14 B;  4F8M A;  1OTC A;  1CQV A;  5F2D A;  4QF4 A;  2VL6 A;  1I94 L;  5C6A A;  1WTQ A;  3H0G H;  2WB1 B;  3M3Y H;  1XYI A;  1PV4 A;  4S3S A;  4X66 Q;  2R6G A;  1EUJ A;  1VQK A;  4L6T B;  2BOS A;  1CKN B;  4JI6 Q;  4K6L A;  1RTN A;  1MHW C;  3VR2 A;  4PNY A;  2UXD L;  3L0O A;  5ELO A;  5M5W H;  5JVG 3;  3M4P A;  1PH6 A;  4Q0F A;  2VUM B;  4A3J B;  3PO2 B;  3OIQ A;  1TWF B;  2OWO A;  2Q8R E;  3BDO A;  1NR2 A;  2XSC A;  2CWP A;  3PUV A;  3CXC A;  2YV5 A;  1N33 Q;  1GD7 A;  2PQE A;  2V1C C;  1KQS A;  3CC2 A;  4HTH A;  2OXP A;  5EAY A;  4EQO A;  1V1P B;  4IUP A;  2E8G A;  1A2U A;  4XQQ A;  1H9R A;  2R93 B;  4A93 H;  4L5Q A;  1STE A;  1VQJ A;  1MIU A;  2EY5 A;  1HRJ A;  4RG1 A;  2AWN A;  2MGS A;  2F0H A;  3M7N A;  1SRU A;  4NMZ A;  4KK7 A;  3CAM A;  2PO4 A;  1IL8 A;  2XRQ D;  2K28 A;  1FNV A;  1XNR L;  3H15 A;  1KAA A;  2RKS A;  1TT2 A;  2OTL A;  2QDL A;  4UAI A;  1E2V A;  4JW0 A;  5CBE E;  1FYC A;  2QIL A;  4RGT A;  2MUY A;  3HZX A;  4K0K Q;  1H9J A;  4J15 A;  3CPW A;  4IN3 A;  4O2D A;  2OTJ A;  2YYZ A;  3H0G B;  3I90 A;  1VQO A;  4AIM A;  1HA6 A;  4YCU A;  3M4O H;  4IJL A;  1VMP A;  2FJ2 A;  4DAY A;  1JWS D;  3KLW A;  4ZRZ A;  4X64 L;  4K8J A;  5M5W B;  3A7A B;  3NSW A;  1O78 A;  1TU2 B;  4B3S L;  1GO3 E;  4EQN A;  4DPG A;  3S1M B;  3Q0A A;  3MFG A;  4O0A A;  1Y1V G;  3E9H A;  1U0L A;  2WKC A;  2F0V A;  4H0L C;  1EZ8 A;  4JI8 Q;  5M3M B;  2BH8 A;  1N34 L;  4DV5 Q;  1V1O A;  2YTY A;  1BF4 A;  1EQQ A;  3F2D A;  4A93 B;  1GJX A;  4AYB G;  5IYC H;  1B53 A;  1WTO A;  2RSN A;  5ELD A;  1X55 A;  5C44 H;  2VQE L;  1C48 A;  1MKH A;  3D6C A;  1PRT F;  1U4P A;  3T1H L;  4XQJ A;  4RA8 A;  1SMY C;  3K6O A;  4IZ8 A;  3PQI A;  2L0C A;  3QB3 A;  1MI2 A;  1YHA A;  2EDG A;  1HZA A;  2NZO A;  1K8A C;  4QB4 A;  1I3Q B;  3PIP A;  3DHQ A;  1VCI A;  2AUJ D;  4YWM A;  2B63 B;  4NW2 A;  4KJO A;  1N32 Q;  5NUC A;  4DR5 Q;  1U9R A;  5C3X A;  1G91 A;  1PH2 A;  1HA5 A;  1EQV A;  4PQX A;  1JR0 D;  2RHQ B;  1UUP A;  3OMG A;  3M4O B;  4C3J G;  3N52 A;  5J1Z A;  1TWA B;  1BR9 A;  2IX1 A;  2KEN A;  2A6E C;  2J7Z A;  4JI2 L;  1GUN A;  4DK6 C;  2EY1 A;  4HN7 A;  5FLM G;  2MNA A;  4DV6 L;  4LMQ D;  4ZQ3 A;  3A8I E;  2EQS A;  4CKE A;  3UI2 A;  4JI3 L;  3PF5 A;  1CFM A;  2XNA C;  3PUY A;  5CBA E;  1CA5 A;  5GAG C;  2A73 B;  4JG2 A;  2B2V A;  4JOI C;  1Q8K A;  1WFQ A;  5A35 A;  2UXB L;  3AYH B;  3H3V C;  3M85 A;  4BA2 I;  4L63 B;  1YNJ D;  5IT9 L;  2IPK D;  2N49 A;  3BU2 A;  2Z6K C;  2KBN A;  4U68 A;  1BCP D;  1EFI D;  1RTO A;  1OXS C;  3HOV H;  3W3A A;  4LF6 L;  3HOW G;  4KHV A;  2D5D A;  3LGJ A;  2L55 A;  3GTG H;  4B3M L;  4G57 A;  1QZG A;  5D14 A;  1G2S A;  3MA2 B;  1S5F D;  1NE3 A;  4A3E G;  3KF6 B;  1DOL A;  3GTK B;  3PO3 H;  1D5M C;  1SR3 A;  4KY7 A;  3CCM A;  3OSO A;  3RLF A;  1Z6H A;  3TP8 A;  1CZW A;  1CSQ A;  1UEA B;  3KF8 A;  3P20 A;  4LFA L;  2UUC Q;  1SNP A;  4A3M G;  2Q2I A;  5CV5 A;  3GTP H;  1IBK Q;  2RF4 A;  1EY7 A;  4H44 C;  2DJF C;  1LT3 D;  4Y7N B;  4JCV E;  2VY3 A;  1Y1W G;  1VF5 C;  2A69 D;  4FXD A;  4MN3 A;  2AQ1 B;  3H6M A;  1ILP A;  1EYD A;  2EXD A;  1EQR A;  2ZXR A;  4A3I G;  2HQE A;  3AU7 A;  2D9U A;  4KN4 C;  4C1N I;  3CCS A;  1EU4 A;  5EPK A;  4DV0 Q;  1QNU A;  2Q2U A;  2VW9 A;  3VYR A;  4A3F B;  4IUT A;  3EJI A;  2I0Q A;  1PRT C;  1F2Z A;  2KA7 A;  3JAM L;  2CWA A;  2JA6 B;  1L0X B;  5FLX E;  5C4X H;  4ZCK A;  1WCM B;  2BE5 D;  3MHB A;  3G48 A;  1DZ1 A;  1PXU A;  4LF8 L;  4HR7 B;  2KEE A;  5E3F A;  1PA6 A;  3UE0 A;  1WTP A;  4OON A;  3C3L A;  5HGQ A;  4XQN A;  3E0E A;  5C4J H;  2B8F A;  3D6W A;  3K0Y A;  3PIP 3;  3NP8 A;  2K5W A;  3ULP A;  3LX0 A;  2CQA A;  1U4M A;  3S17 B;  1QIL A;  4ZUJ A;  5KNC A;  1LAC A;  4KY5 A;  3PCO B;  1LTI D;  3CHB D;  1WD1 A;  3DM3 A;  1PH7 A;  2K5H A;  3R93 A;  4YCV A;  3GTP B;  1EU3 A;  3WOF A;  1AW7 A;  3S9W A;  1B2T A;  2F0O A;  2PNR C;  2E2H H;  4A75 A;  3RN5 A;  3I4M G;  4GNX A;  4U67 3;  1XXG A;  3SDZ A;  3GD7 A;  2A68 C;  1EYC A;  2BA1 A;  1IKM A;  4H7B A;  5I4D A;  2F0L A;  3TEH B;  3LWU A;  4DV3 L;  2R92 B;  2Z4I A;  1V8Q A;  1WJJ A;  4X66 L;  1AN8 A;  2NB0 A;  4UPA A;  1PYS B;  1ZYR D;  1YIT A;  4JI6 L;  3PV0 A;  4A3G G;  2OCE A;  1RDP D;  4GOP A;  1TQO A;  1PH9 A;  4UDU C;  1ESR A;  1JB3 A;  3OW2 A;  2Q2T A;  3FVQ A;  4K8I A;  3W1B A;  4RCO A;  4XTC S;  4JI0 Q;  3FKI B;  1Z47 A;  3K5M A;  3OMC A;  1DON A;  2KCN A;  5D65 A;  4QMG A;  2SNS A;  3CQZ B;  1AE3 A;  2ALY B;  5J3B A;  5AJ3 Q;  1VQE A;  4JC0 A;  1RHP A;  2NN6 I;  2B8G A;  3NEL A;  1X32 A;  4BY1 G;  2JA8 G;  4RGO S;  4OWX B;  5C4J B;  3T4A C;  5KND A;  2O2L D;  4DUY L;  1GVP A;  4IUU A;  1DJR D;  3CRK C;  1SND A;  1D2B A;  3URY A;  1A2T A;  1SDF A;  2ZM6 L;  2NUC A;  1LTG D;  5JJL A;  3IAY A;  1LTS D;  1BO0 A;  5J22 A;  3I73 A;  4HCE A;  5JPN C;  1ILQ A;  3HOY G;  5DLQ E;  1KD1 C;  3BJU A;  2B2V C;  3KLS X;  4KMU C;  1G8Z D;  4DR1 Q;  5GAD C;  2LKV A;  1SE3 A;  4LF9 Q;  4K0K L;  1GUT A;  4DK3 C;  5DEH A;  2DNC A;  5JVH 3;  5FJ8 H;  1FGB D;  3JAM i;  2MQH A;  5GQO A;  1JJG A;  4PZ7 A;  3M9B A;  2M00 A;  1GUG A;  1SXT A;  4JBW A;  4JYA Q;  3LWE A;  3D8G A;  1NCV A;  3BYT B;  2PYK A;  1B9N A;  4B3R L;  3G4S A;  4DR6 L;  3R8B A;  3GV6 A;  2IHE A;  4K6D A;  2R3Z A;  2PZT A;  1R9T B;  4GLV B;  3KDF B;  4X6A H;  2RCF A;  4JI8 L;  1BNZ A;  1TVX A;  4EGV A;  2TMP A;  2DUD A;  4JBJ A;  5ELC A;  4YHH Q;  4IFD G;  1UAP A;  3U9O A;  4DR7 L;  4IPH A;  2PQA A;  5LL6 S;  4TQU S;  1N36 Q;  1VQM A;  2NWG A;  1LYL A;  1W2B A;  4PG3 A;  3HKS A;  5FO9 B;  5LL6 X;  1S3O A;  3ND8 A;  3OOC A;  2I5L X;  1MBY A;  2AUK A;  1TWH B;  4BBS G;  2PMZ B;  2D0P A;  2F0J A;  2A69 C;  1ROD A;  2WII B;  1BDO A;  4C1N K;  3J7A V;  3STB C;  1ZXT A;  4JVZ A;  1PLF A;  5JJI A;  2DN8 A;  2WB1 E;  2ZXP A;  5EQ0 A;  3VA5 A;  3J80 E;  3P7J A;  5EJW A;  1N32 L;  1MSH A;  5C0X H;  1C4Q A;  1SE8 A;  1J5E Q;  2E5L L;  5IP7 G;  1D5X C;  1DOM A;  3I91 A;  1SYC A;  1STN A;  2N78 A;  1HFN A;  2QDB A;  1LTA D;  4OIJ A;  4QGU A;  2KHJ A;  4O1N A;  4DR3 L;  1B9M A;  4LUO A;  2FFK B;  4HJA A;  1XNQ Q;  4OHJ A;  1QNK A;  4A4I A;  5IT9 c;  5BN4 A;  3FHW A;  5C0X J;  4BY7 H;  3GTQ H;  1NNX A;  3W2D A;  3X3N A;  4WRD A;  3TS2 A;  2O4X A;  2CH4 W;  4B9X A;  1PZK D;  2F03 A;  3BVZ A;  3NHH A;  1Y1V H;  3JC6 6;  5ELE A;  3O13 A;  1CA6 A;  1IZ6 A;  4BBR G;  4GNX C;  4HSP A;  4L8J A;  4NDX A;  2N88 A;  1BBX C;  1XPU A;  1NY4 A;  3J81 E;  5IYD G;  4RHR A;  4QCL A;  1PH4 A;  2B29 A;  4F87 A;  3SGI A;  4JI4 Q;  4JK1 C;  3CP0 A;  1K8M A;  3G6E A;  3NQT A;  1BBW A;  1RKN A;  1K83 H;  1YJ9 A;  3V05 A;  4HJ8 A;  3MXU A;  5I9P A;  1UE6 A;  4GOP C;  4A3C G;  1AP0 A;  3UDG A;  1HHV A;  4APV A;  3NBI A;  2UXC L;  1B44 D;  5KNB A;  1AEX A;  1X3G A;  2TSS A;  5EKK A;  2UUC L;  2PW7 A;  3WDN A;  3E0J A;  1FJG Q;  3MXN B;  4CDD C;  3G6J B;  2VQF L;  3BS1 A;  1KL9 A;  2XWB B;  4B9W A;  5JJZ A;  1LTB D;  3OTO L;  1S40 A;  4TSS A;  4IPC A;  4IUN A;  3P75 A;  4UP8 A;  4Q5V A;  1SFO B;  3K5N A;  5CV4 A;  1SNM A;  1K3R A;  5LMN L;  1QOH A;  2RBM A;  2VS1 A;  3GO5 A;  1HNW Q;  1FL0 A;  4BY7 B;  3GTQ B;  4LF4 L;  4R4C A;  1X3P A;  2RHS B;  5FLM H;  2JA5 G;  1QUQ B;  5EBC A;  5IE8 A;  4ALP A;  3S1R B;  1Y8N B;  4CJ2 C;  3RZO H;  4PZ8 A;  4WJW A;  4QL5 A;  2ZJP A;  3S2D H;  2L5T A;  1JOK A;  4LFB Q;  3RNU A;  1L1O B;  4K5W A;  4HIK A;  5I6Y A;  3E3X A;  3S24 A;  4CKC A;  1BXT A;  4P75 A;  4C3H G;  2KCT A;  3QJY A;  5A2Q L;  3HOW H;  5IWA Q;  3I56 A;  1D6E C;  1VDZ A;  1W6J A;  2ICE C;  3MTS A;  2LXJ A;  4IUQ A;  4DK0 A;  2EJM A;  3F8T A;  4X3S A;  1XTD A;  2WKD A;  1DXM A;  4OGQ C;  4A3E H;  3T1Y L;  3AQQ A;  4HCS A;  3I4N G;  4MZ9 A;  2D0O A;  4HJ5 A;  3I72 A;  2JA7 B;  3QO2 A;  1HR0 Q;  4KY6 A;  2JE6 I;  4WOR A;  3RLO A;  4HIO A;  2DY8 A;  5EBD A;  3FRP B;  4RWS C;  1FD7 D;  1O7I A;  3L3O C;  2JK8 A;  1ENF A;  1Y1W H;  4I65 A;  2QKI C;  1SRO A;  5IGG A;  1IKL A;  4L5R C;  4CDE C;  4DV1 Q;  1JOQ A;  4A3I H;  3UDI A;  1C7Y A;  3ERQ A;  3HOZ G;  3RR5 A;  1TS3 A;  5JPM C;  1JE4 A;  1EEF D;  1YHQ A;  1PFB A;  4N9T A;  4AH6 A;  1YIJ A;  4K5V A;  1HUN A;  2K7V A;  1YNX A;  1G6P A;  2HQL A;  5IGC A;  3S2D B;  3G71 A;  2WP8 J;  4EQ5 A;  4IO9 A;  2YU9 H;  4Y52 H;  1EEI D;  4YY3 Q;  1TWG B;  1WOC A;  2DNE A;  3A0J A;  4C3I B;  4J6H A;  1ET6 A;  3CPF A;  2F0T A;  4X62 L;  1SYF A;  2L9H A;  3NEM A;  3NK9 A;  2VB2 X;  3D4R A;  4NXM Q;  5G3L D;  1YVC A;  5FLX c;  4NKL A;  3V2T A;  1RL2 A;  5K36 G;  2J0T D;  1QE6 A;  5EPL A;  4NXN Q;  1VQC A;  3MEH A;  2F0D A;  3RD4 A;  1EOT A;  2VB3 X;  5LMN W;  1PTO F;  3NBH B;  4QJF A;  1OO9 B;  3TBI B;  1K73 C;  3M3Y B;  3EN2 A;  1Y1W B;  1E22 A;  4JYA L;  2L12 A;  2CQO A;  4DR2 Q;  2DY7 A;  4G4K A;  2N55 A;  1KDC A;  3OPO A;  1K8G A;  2MFI A;  1XJV A;  1D5Z C;  2Q2H A;  1XX8 A;  1M4V A;  1HPC A;  3UDX A;  4A3G H;  2K5Q A;  1IBL Q;  5D3D A;  2K14 A;  1EYA A;  1LO5 D;  3CRL C;  4IPD A;  3GDE A;  4DK1 A;  3K58 A;  3I70 A;  1VQN A;  1PFS A;  4A3K G;  4DR4 Q;  1AE2 A;  4LUV A;  3HEJ A;  1K28 A;  3U9S A;  2K6A A;  1F9R A;  2H5X A;  2KVM A;  2F0P A;  4GKJ Q;  3J7Z C;  2HHH Q;  1GOZ A;  4BY1 H;  3U58 A;  2CKZ B;  2JA8 H;  3R2T A;  3KBG A;  1N36 L;  1CZG A;  3CKI B;  2EYH A;  2H4O A;  4X65 Q;  3NTK A;  4DV4 L;  3TME A;  5M5X H;  5GAH C;  5G3L F;  1LM0 A;  3VR6 A;  1PVO A;  1Z9F A;  1A3T A;  1LUZ A;  2ZXO A;  3GTL H;  3HOY H;  4RKL A;  4LF5 L;  1PZJ D;  1NAP A;  4KHP L;  2Q8I B;  3BG3 A;  2EVB A;  1QWY A;  5C4H A;  1J5E L;  2GN5 A;  3KK7 A;  1VQ5 A;  2JXM B;  3H3V H;  3IKJ A;  1X56 A;  4KD4 A;  1VQL A;  1G29 1;  4KD3 A;  4RGN A;  2C5C A;  2QGQ A;  3J81 j;  4JV5 L;  3D31 A;  5ELN A;  2K4K A;  1RJT A;  1CQF A;  4K2K A;  3E9I A;  1HNZ Q;  1EWC A;  3HOU G;  5CV8 A;  1XNQ L;  1YNN D;  2F4V Q;  3H09 A;  4ZAI A;  2G5D A;  4EX5 A;  3MFY A;  3CD6 A;  1FNW A;  1PTO H;  2HUG A;  2WB1 G;  4CGY B;  2I07 B;  1KDB A;  2UUA L;  4JI5 L;  1W3S A;  4AQY Q;  5IY0 A;  3SVM A;  2MPM A;  5AFW A;  1PFN A;  4ZUI A;  2A6H C;  5C44 B;  1HJP A;  1NMG A;  1Q1B A;  1V43 A;  3D3R A;  2PNH A;  2VUM G;  4I7A A;  4B08 A;  3PO2 G;  4IFD H;  3KUP A;  3NQI A;  1OXX K;  1PTO C;  1UWV A;  4ZLT F;  5C0X I;  3FP9 A;  2ATW A;  4GKK Q;  1F2Y A;  5M5X B;  3E5S A;  4DN4 M;  2CVR A;  2X69 A;  2DGY A;  5JJK A;  4JBK A;  1ICF B;  2AQ3 B;  3S1Q H;  1OXT A;  4JI7 L;  4DFA A;  4BBS H;  3HKZ E;  1FJG L;  1X6O A;  2R93 G;  4HID A;  1Q86 C;  2R7F A;  3RZD H;  5CYU A;  1KNE A;  1S5D D;  1II3 A;  3EVQ A;  1IBM Q;  4A3L G;  5IP7 H;  2AQ2 B;  2NN6 G;  2FMM A;  2ZTC A;  2IWH A;  1NUC A;  1B70 B;  4HMI A;  4A3D H;  1HNW L;  1RF2 D;  4RHS A;  1QZH A;  2JSO A;  1Q8I A;  2I46 A;  2FMC A;  3PF4 A;  1F9P A;  2Q8T A;  2KEC A;  3H0G G;  1HNX Q;  1JJ2 A;  2A19 A;  3K0X A;  3KJP A;  1B7Y B;  2M9V A;  3WWV A;  1PH3 A;  2E2D C;  3DLL A;  3KLS A;  1JJC B;  4LFB L;  1Y69 U;  4BBR H;  3HOV B;  5KEE A;  5BR8 Q;  1VQH A;  1BCP F;  4R4Q A;  4RGM A;  1GM5 A;  4DUZ L;  1KHI A;  2KJX A;  3GTG B;  5GAE C;  1B8A A;  5IYD H;  4EQP A;  5IWA L;  5CV7 A;  4LF7 L;  1EIY B;  1NR4 A;  1JWU D;  2K5V A;  1ONL A;  1NSN S;  1IL2 A;  3PO3 B;  1T5X D;  5M3M G;  5H1S E;  2F0F A;  2EZV A;  4A3C H;  4BBS B;  4OXP A;  2SOB A;  3J81 c;  2L4N A;  1A3U A;  1X9N A;  5JEA G;  1SNO A;  2GVA A;  2XVS A;  1LT6 D;  4QY7 A;  1VQF A;  2ENB A;  2B2W A;  1HR0 L;  4DA2 A;  3AMU A;  1XWE A;  2RDH A;  2KED A;  1DM0 B;  1PRT B;  4FXG C;  3ER0 A;  1OXV A;  3AFP A;  1Q82 C;  1JC7 A;  2L11 A;  1A62 A;  3K5L A;  2B2Y A;  2E76 C;  3T16 A;  2L15 A;  2CW0 D;  4A3D B;  4L5T A;  3GTO H;  1IYU A;  4HED A;  2JJQ A;  3DWQ A;  1TR5 A;  3A8K E;  1KLU D;  2B63 G;  5CMD A;  2E2J H;  4DAY B;  3SK8 A;  1TY0 A;  1CM9 A;  4JI1 Q;  3HS0 C;  4B3T Q;  3K7U C;  2JA5 H;  1N9W A;  3K7A H;  5C4X B;  1N33 L;  3HOX H;  3IRB A;  4MTK A;  1M8A A;  2NVY H;  3NTH A;  1EIH A;  3C46 A;  4ILW A;  1S4Z A;  1X3E A;  3ITP A;  4QIW B;  2EOT A;  1NBW A;  4FF1 A;  2ZJR A;  1EY6 A;  5E4X A;  3TRZ A;  3RLN A;  4MNO A;  4TRD A;  4C3H H;  4BA1 I;  1CT1 D;  4NXM L;  2LS0 1;  3MEF A;  4A3B H;  4DNR B;  1EY5 A;  5M3F G;  2Z4H A;  1WTV A;  1EIF A;  3GTJ H;  1EL0 A;  1RCV D;  3BVM A;  3VYU A;  2B3G A;  2UUB Q;  2Y0S E;  1J8I A;  4NXN L;  2SNM A;  4RMF A;  2MJ8 A;  1TY2 A;  2E2H B;  5FO8 B;  3A7L A;  5FLX L;  3I4N H;  3U4Z A;  4WJ4 A;  1LTL A;  1Z7T A;  1BQQ T;  2ICI A;  1K3B C;  1VQA A;  4YIJ A;  4DR2 L;  3M7G A;  1XNR Q;  1STY A;  1YNJ C;  1ML0 D;  5I9O A;  4G7H C;  4KKT A;  1SNC A;  3TDQ A;  2PZW A;  1I5F A;  1Q7Y C;  3GTM H;  2WV6 D;  3ZJY C;  5M5Y H;  2E2J B;  5IOC A;  4LJZ C;  1BCP C;  2UU9 Q;  4ID6 A;  1PH5 A;  2SEB D;  3VR5 A;  3S16 H;  3HGB A;  1MD2 D;  1CKN A;  3HOZ H; 
#chains in the Genus database with same CATH homology
 1H9S B;  3HOX B;  1JQY D;  5CR3 A;  1GUS A;  4OO1 G;  1TS5 A;  3MVV A;  2B2T A;  2G9D A;  1F9Q A;  2WAQ B;  1SJH D;  2B2U A;  4C3H B;  3BYY B;  3MXP A;  2LY7 A;  4A3B B;  1S5B D;  3GTJ B;  1V1P A;  1SYE A;  1HCZ A;  1T5E A;  4KKS A;  1GUW A;  3ONA B;  1ENA A;  5K36 H;  2MHV A;  3I4N B;  3RUZ A;  2IL8 A;  4RAU C;  4XYQ A;  2E74 C;  3A56 A;  5ISR A;  3SK6 A;  5JOB A;  4FO2 A;  1SNQ A;  2ID0 A;  1JOR A;  1E2W A;  4R8I A;  4RH6 A;  3A55 A;  2C9O A;  1C8C A;  1FNU A;  2BE5 C;  1LT5 D;  4FXK C;  4V0B A;  2QCP X;  3EQL C;  4J8Q A;  1EQT A;  1QB5 D;  4RCN A;  2B2W C;  1ET9 A;  5IGD A;  3SEB A;  1BOS A;  2B2Y C;  2D62 A;  2OF1 A;  3KLR A;  4P2C B;  3GQB A;  3QIA A;  3MAQ A;  4XT3 B;  3I8Z A;  1A15 A;  3WOE A;  3R3O A;  5CV6 A;  1G6Z A;  3PIO 3;  1ZKO A;  1I4R A;  3DWA A;  1S5C D;  3FPU B;  1ZYR C;  3BDC A;  1W6K A;  3BZD B;  3NTI A;  2XWJ B;  5CC4 A;  5J39 A;  4DAP A;  2O5I C;  2HCC A;  3I4L A;  2Z8L A;  3C2P A;  3NWS A;  3V96 A;  1TS2 A;  5HUR A;  3QG1 A;  2RDG A;  1AZQ A;  5COR A;  5IGE A;  1QG7 A;  2PPB C;  4KV6 A;  3K5O A;  1SMY D;  1R4Q B;  1Y1V B;  5C4Z A;  1KTK A;  1MGS A;  4XYO A;  2VXW A;  3J80 L;  4KKU A;  5KGU A;  3A8J E;  5LHY 1;  5FO7 B;  4AYB B;  3BVG A;  5TSS A;  3TZD A;  5C5L A;  1K83 B;  4V19 0;  1PMR A;  2A6E D;  1S5E D;  1K8O A;  3BDL A;  3VA7 A;  3PUZ A;  2NVQ B;  1E0B A;  2EE1 A;  2WIN B;  3VR4 A;  3K57 A;  3OWF A;  4DXF A;  1VMC A;  5D3I B;  2HDL A;  4C2M B;  1HQM C;  4FNF A;  1HFG A;  2BCO A;  3J81 L;  2B2T C;  2CHB D;  1DCZ A;  3T13 A;  4ZKC B;  4C3J B;  2RVL A;  3N6R A;  1Y8P B;  1QJO A;  2B2U C;  1EIG A;  2NN6 H;  4C56 C;  1L0Y B;  1FR3 A;  4HAE A;  3SK5 A;  2PCF B;  2F0K A;  3H91 A;  2L1B A;  2NBF A;  4DF7 A;  1STG A;  4G7O C;  3RZO B;  2X6L A;  4HSV A;  2EYL A;  2RSO A;  5CV9 A;  1I50 B;  2JYO A;  2KQ3 A;  1WVL A;  1B3A A;  4DNT B;  5FKA C;  1SAP A;  3GV3 A;  5I2X A;  3ERO A;  3HOW B;  3D4D A;  2EYP A;  3NPP A;  4A3E B;  3M4Y A;  1F77 A;  4ME5 A;  4DXG A;  3Q22 A;  4E6I A;  2K01 A;  2H1E A;  4X3T A;  2XRS D;  4FVM A;  3Q23 A;  4A3M B;  2KHS A;  1PRT D;  5JEA H;  1STB A;  2EJG C;  3EFX D;  2E75 C;  1DD2 A;  1GHJ A;  5ELB A;  4F7X A;  3GP7 A;  4RFB A;  3NWT A;  2EY6 A;  3K59 A;  3Q24 A;  5JEA J;  1TWC B;  4A3I B;  2K04 A;  4Z9C B;  1HUM A;  5C0X G;  5IT9 E;  2K5D A;  1AFP A;  4HMJ A;  3PUW A;  2EY2 A;  5EPJ A;  3DWP A;  2YU9 B;  1LV9 A;  1SE2 A;  2A68 D;  2F0U A;  3SHL A;  1SEB D;  3OW7 A;  4PMW A;  1Q1E A;  3S15 B;  1SYD A;  2O5J C;  3PMF A;  2NTS A;  1ICW A;  3T53 B;  2F0I A;  2EPB A;  5BN3 A;  3IFD A;  4ULL A;  3DXJ C;  4RKB A;  4DAV A;  3I4M B;  2F3V A;  1WD0 A;  4BWG B;  3IFT A;  3HRZ C;  1H9M A;  5E1F A;  1HQR D;  5KYL A;  2KCC A;  1TII D;  5IOD A;  4A3G B;  3JAM E;  1WTW A;  1XTC D;  3NE5 B;  1EY4 A;  4OIK A;  1O7Z A;  4NP5 A;  4ABN A;  5IIF A;  2EJF C;  1I6H B;  4PV1 C;  2B39 A;  5C5M A;  1H9S A;  3ZYY X;  1ENC A;  5DM7 3;  1KLG D;  4OO1 H;  4BY1 B;  2JA8 B;  5IGB A;  5ELF A;  3OHX C;  2RQX A;  3MWY W;  5EKI A;  2IJ0 A;  5M3F B;  1AZP A;  3GTL B;  1U4L A;  3HOY B;  2QEJ C;  1I4P A;  3DUZ A;  3VYS A;  4IFD J;  4C3I G;  4QUF A;  5T1G A;  4ZYS A;  3OWE B;  1LTT D;  5HGT A;  1I4Q A;  4R8N A;  1IHZ A;  4MIU A;  1PYW D;  3L7Z C;  1O80 A;  4CJ1 B;  2FHT A;  1F2L A;  4H13 C;  1EY9 A;  1PTO B;  4KN7 C;  1U4R A;  2GA4 B;  3LNN A;  1HXY D;  1LLR D;  1LAB A;  2EYF A;  2HCI A;  4XT1 B;  4EVO A;  1E2Z A;  2ZT9 C;  3AB9 A;  4XIG S;  3TN2 A;  2NVX B;  3EA6 A;  1JWM D;  3DEO A;  5T1I A;  3S1Q B;  1CHQ D;  4R9W A;  4PMC A;  4QUC A;  2JEB I;  3RZD B;  1R4P B;  4KTA A;  2EYO A;  3SE0 A;  1B50 A;  4LAA A;  3H94 A;  4BS9 A;  3I3C A;  1TKW B;  2Z1C A;  3MXN A;  2R61 A;  1DOK A;  2IT1 A;  1I4G A;  2M2L A;  4ODG A;  1O7L A;  2F0M A;  1Y8O B;  4IUR A;  2XN9 C;  3QOL A;  1J9O A;  2LFN A;  2JP1 A;  2XIW A;  3FDT A;  4FF4 A;  2J4X A;  5JAV A;  1RD9 D;  4TKO B;  3CU7 A;  4BBR B;  1VF7 A;  1QCB D;  3SR1 A;  4I7Z C;  5DAU A;  1Q3L A;  4X3K A;  5IGF A;  4IUV A;  3MZ5 A;  5C3W A;  2A74 C;  2OEO A;  1I4X A;  2F0W A;  4DU9 A;  4CHT B;  1JOO A;  1EZ6 A;  3RMH A;  3P1H A;  1I4H A;  1YNN C;  3NUC A;  3T56 B;  1Q12 A;  2F0N A;  5CGK A;  5FOB B;  2F0E A;  3C1E A;  2RDF A;  4F88 A;  3C1F A;  2HDM A;  3TP7 A;  3GTO B;  1LT4 D;  2RA4 A;  4J1M A;  2VNU D;  1O7Y A;  1SE4 A;  4CJ0 B;  2F0G A;  1KDA A;  4CKB A;  3MXG A;  2NTT A;  4WFN 3;  1IW7 D;  2JA5 B;  3K7A B;  2WAC A;  1D1K A;  3A54 A;  3HKZ B;  1A3V A;  2F0Q A;  5DNF A;  3S1N B;  2NVY B;  3SK4 A;  2FIN B;  5BN5 A;  3FMC A;  3R2I A;  3SXH A;  1ESF A;  3J7Y W;  1PZI D;  1EY8 A;  1SBB B;  3DMU A;  2SDF A;  3QOJ A;  3F2U A;  2BDO A;  2EXZ A;  1CTM A;  1JCK B;  5KIX A;  3KBX A;  3DEP A;  5KRU A;  2PW5 A;  2R7Z B;  1OXU A;  2OT2 A;  1HTP A;  4M1U B;  3FEW X;  1F9S A;  1CK1 A;  3NXW A;  5C3E B;  1PFM A;  3J7A F;  5FK9 C;  1F2M A;  1SJE D;  2F4I A;  1BCP B;  4K2L A;  2KOL A;  2IW3 A;  3L9A X;  4G7Z C;  2JEA I;  3VR3 A;  1UNS A;  2V4D A;  5DM6 3;  2K33 A;  1CI3 M;  3NBH A;  3GTM B;  2AWO A;  5M5Y B;  2E2I B;  1KAB A;  3S16 B;  3TZU A;  3HOZ B;  4GZY C;  2K03 A;  1SSO A;  3X3M A;  1STH A;  2KUM A;  1TS4 A;  4IQZ A;  1I6V C;  2A5H A;  5A2Q E;  5E4W C;  3QWN A;  3OIP A;  1Q90 A;  2X6G A;  1DYQ A;  2QF7 A;  2G9H D;  1G2T A;  2EYM A;  2K05 A;  1X3Q A;  3T51 B;  3PUX A;  1IYV A;  2F3W A;  5I6W A;  1GXD C;  1CHP D;  1LTR D;  2CW0 C;  3E6Z X;  4LK1 C;  4M8A A;  1SYB A;  4MHE A;  2D2C C;  2K32 A;  4DGZ A;  5EKL A;  3TSS A;  2LMC B;  2MP1 A;  4FP5 D;  2IX3 A;  2BDN A;  4N9P A;  1B4O A;  4KHZ A;  4KI0 A;  4ZK9 B;  4K14 A;  2NYZ D;  4IAL A;  1D1I A;  2IX0 A;  4OO1 I;  3MC0 B;  4CBV A;  1EY0 A;  4IFD I;  2Y0S B;  1GHK A;  3D4W A;  1HTL D;  4O42 A;  5KYI A;  1KNA A;  1MSG A;  2K1B A;  4FYD A;  1H9K A;  4OL7 A;  4X3U A;  4A3K B;  2NZ1 D;  1JIC A;  4KJN A;  5I2Y A;  3HP3 A;  1SYG A;  3TP5 A;  2F0S A;  3FPP A;  3ND9 A;  1EWH A;  1B1Z A;  4K5X A;  5EGT A;  1A6X A;  3IL8 A;  3VYT A;  1ZEQ X;  4ZKB B;  1WTR A;  4XDX A;  4FF2 A;  1BUV T;  1STA A;  2NVT B;  3Q6S A;  4FF3 A;  2BA0 A;  3G7L A;  3TP6 A;  1IW7 C;  1PDQ A;  5M9O A;  3HG9 A;  3S2H B;  3DM1 A;  2F1M A;  2A6H D;  2EYJ A;  3HOU B;  1GUO A;  4XXE A;  5COY A;  1WTX A;  1PTO D;  5K5P A;  2PZU A;  4PMB A;  3S14 B;  4F8M A;  1CQV A;  5F2D A;  4QF4 A;  5C6A A;  1WTQ A;  2WB1 B;  1XYI A;  4S3S A;  2R6G A;  4L6T B;  2BOS A;  4K6L A;  1RTN A;  3VR2 A;  4PNY A;  5JVG 3;  4Q0F A;  2VUM B;  4A3J B;  3PO2 B;  3OIQ A;  1TWF B;  2Q8R E;  3BDO A;  1NR2 A;  2XSC A;  3PUV A;  2PQE A;  4HTH A;  2OXP A;  4EQO A;  1V1P B;  4IUP A;  1A2U A;  4XQQ A;  1H9R A;  2R93 B;  1STE A;  2EY5 A;  1HRJ A;  2AWN A;  2MGS A;  2F0H A;  3M7N A;  4NMZ A;  4KK7 A;  2PO4 A;  1IL8 A;  2XRQ D;  2K28 A;  1FNV A;  1KAA A;  2RKS A;  1TT2 A;  4UAI A;  1E2V A;  5CBE E;  1FYC A;  2QIL A;  4RGT A;  2MUY A;  3HZX A;  1H9J A;  4IN3 A;  2YYZ A;  3H0G B;  3I90 A;  1HA6 A;  1VMP A;  4DAY A;  2FJ2 A;  1JWS D;  4ZRZ A;  4K8J A;  5M5W B;  3A7A B;  3NSW A;  1O78 A;  1TU2 B;  4EQN A;  3S1M B;  3Q0A A;  3MFG A;  2WKC A;  2F0V A;  4H0L C;  1EZ8 A;  5M3M B;  1V1O A;  1BF4 A;  4A93 B;  1GJX A;  1B53 A;  1WTO A;  2RSN A;  5ELD A;  1C48 A;  3D6C A;  1PRT F;  1U4P A;  4XQJ A;  4RA8 A;  1SMY C;  3K6O A;  4IZ8 A;  2L0C A;  3QB3 A;  1MI2 A;  2EDG A;  4QB4 A;  1I3Q B;  3DHQ A;  1VCI A;  2AUJ D;  2B63 B;  4NW2 A;  4KJO A;  5NUC A;  1U9R A;  5C3X A;  1G91 A;  1HA5 A;  1EQV A;  4PQX A;  1JR0 D;  1UUP A;  3OMG A;  3M4O B;  4C3J G;  3N52 A;  5J1Z A;  1TWA B;  1BR9 A;  2IX1 A;  2A6E C;  2J7Z A;  1GUN A;  2EY1 A;  4HN7 A;  4LMQ D;  4ZQ3 A;  3A8I E;  4CKE A;  3UI2 A;  1CFM A;  2XNA C;  3PUY A;  5CBA E;  1CA5 A;  2A73 B;  2B2V A;  5A35 A;  3H3V C;  3M85 A;  4BA2 I;  4L63 B;  1YNJ D;  5IT9 L;  2IPK D;  4U68 A;  1BCP D;  1EFI D;  1RTO A;  1OXS C;  3W3A A;  4KHV A;  2D5D A;  2L55 A;  4G57 A;  5D14 A;  1G2S A;  3MA2 B;  1S5F D;  1DOL A;  3GTK B;  1D5M C;  4KY7 A;  3OSO A;  3RLF A;  1Z6H A;  3TP8 A;  1CZW A;  1UEA B;  3KF8 A;  3P20 A;  1SNP A;  5CV5 A;  1EY7 A;  4H44 C;  1LT3 D;  4Y7N B;  1VF5 C;  2A69 D;  4FXD A;  4MN3 A;  2AQ1 B;  3H6M A;  1ILP A;  1EYD A;  2ZXR A;  2HQE A;  3AU7 A;  2D9U A;  4KN4 C;  4C1N I;  1EU4 A;  5EPK A;  1QNU A;  3VYR A;  4A3F B;  4IUT A;  3EJI A;  1PRT C;  1F2Z A;  2KA7 A;  3JAM L;  2JA6 B;  1L0X B;  5FLX E;  1WCM B;  2BE5 D;  3MHB A;  1DZ1 A;  1PXU A;  4HR7 B;  2KEE A;  5E3F A;  1WTP A;  3C3L A;  4XQN A;  2B8F A;  3D6W A;  3K0Y A;  3PIP 3;  3NP8 A;  2K5W A;  3LX0 A;  2CQA A;  1U4M A;  3S17 B;  1QIL A;  4ZUJ A;  5KNC A;  1LAC A;  4KY5 A;  1LTI D;  3CHB D;  1WD1 A;  3R93 A;  3GTP B;  1EU3 A;  3WOF A;  1AW7 A;  3S9W A;  1B2T A;  2F0O A;  2PNR C;  4U67 3;  3SDZ A;  1XXG A;  3GD7 A;  2A68 C;  1EYC A;  2BA1 A;  1IKM A;  4H7B A;  5I4D A;  2F0L A;  3LWU A;  2R92 B;  2Z4I A;  1V8Q A;  1AN8 A;  2NB0 A;  1ZYR D;  3PV0 A;  1RDP D;  1TQO A;  4UDU C;  1ESR A;  1JB3 A;  3FVQ A;  4K8I A;  4RCO A;  4XTC S;  3FKI B;  1Z47 A;  3K5M A;  3OMC A;  1DON A;  2KCN A;  5D65 A;  4QMG A;  2SNS A;  3CQZ B;  1RHP A;  2NN6 I;  2B8G A;  1X32 A;  4RGO S;  5C4J B;  3T4A C;  5KND A;  2O2L D;  4IUU A;  1DJR D;  3CRK C;  1SND A;  1D2B A;  3URY A;  1A2T A;  1SDF A;  2NUC A;  1LTG D;  3IAY A;  1LTS D;  1BO0 A;  5J22 A;  3I73 A;  4HCE A;  5JPN C;  1ILQ A;  2B2V C;  3KLS X;  4KMU C;  1G8Z D;  2LKV A;  1SE3 A;  1GUT A;  5DEH A;  2DNC A;  5JVH 3;  1FGB D;  2M00 A;  1GUG A;  1SXT A;  4JBW A;  3LWE A;  3D8G A;  1NCV A;  3BYT B;  2PYK A;  1B9N A;  3R8B A;  3GV6 A;  4K6D A;  2R3Z A;  2PZT A;  1R9T B;  1BNZ A;  1TVX A;  4EGV A;  2TMP A;  5ELC A;  4IFD G;  1UAP A;  3U9O A;  5LL6 S;  4TQU S;  2NWG A;  5FO9 B;  5LL6 X;  3ND8 A;  3OOC A;  1MBY A;  2AUK A;  1TWH B;  2PMZ B;  2F0J A;  2A69 C;  1ROD A;  2WII B;  1BDO A;  4C1N K;  3J7A V;  1ZXT A;  1PLF A;  2DN8 A;  2ZXP A;  5EQ0 A;  3VA5 A;  3J80 E;  3P7J A;  5EJW A;  1MSH A;  5C0X H;  1C4Q A;  1D5X C;  1DOM A;  3I91 A;  1SYC A;  1STN A;  1HFN A;  2QDB A;  1LTA D;  4OIJ A;  4O1N A;  1B9M A;  2FFK B;  4OHJ A;  1QNK A;  5C0X J;  5BN4 A;  3W2D A;  3X3N A;  4WRD A;  2O4X A;  4B9X A;  1PZK D;  2F03 A;  3BVZ A;  3NHH A;  5ELE A;  3O13 A;  1CA6 A;  4HSP A;  4L8J A;  4NDX A;  2N88 A;  1BBX C;  3J81 E;  4QCL A;  4RHR A;  4F87 A;  4JK1 C;  1K8M A;  3NQT A;  1RKN A;  3V05 A;  3MXU A;  5I9P A;  1AP0 A;  1HHV A;  3NBI A;  1B44 D;  5KNB A;  1AEX A;  2TSS A;  5EKK A;  2PW7 A;  3WDN A;  3E0J A;  3G6J B;  3BS1 A;  2XWB B;  4B9W A;  5JJZ A;  1LTB D;  4TSS A;  4IUN A;  3P75 A;  4Q5V A;  1SFO B;  3K5N A;  5CV4 A;  1SNM A;  1QOH A;  2RBM A;  3GO5 A;  4BY7 B;  3GTQ B;  1X3P A;  5EBC A;  3S1R B;  1Y8N B;  4CJ2 C;  4WJW A;  2L5T A;  1JOK A;  4K5W A;  5I6Y A;  4CKC A;  1BXT A;  4C3H G;  3QJY A;  5A2Q L;  1D6E C;  1VDZ A;  1W6J A;  2ICE C;  3MTS A;  4IUQ A;  4DK0 A;  2EJM A;  4X3S A;  2WKD A;  1DXM A;  4OGQ C;  4HCS A;  2JA7 B;  3I72 A;  3QO2 A;  4KY6 A;  2JE6 I;  4WOR A;  2DY8 A;  5EBD A;  3FRP B;  4RWS C;  1FD7 D;  3L3O C;  1ENF A;  4I65 A;  2QKI C;  5IGG A;  1IKL A;  1JOQ A;  3ERQ A;  1TS3 A;  5JPM C;  1JE4 A;  1EEF D;  1PFB A;  4N9T A;  4K5V A;  1HUN A;  2K7V A;  5IGC A;  3S2D B;  2WP8 J;  1EEI D;  1TWG B;  2DNE A;  4C3I B;  4J6H A;  1ET6 A;  2F0T A;  1SYF A;  2L9H A;  3NK9 A;  2VB2 X;  3D4R A;  5G3L D;  4NKL A;  3V2T A;  5K36 G;  2J0T D;  1QE6 A;  5EPL A;  3MEH A;  2F0D A;  3RD4 A;  1EOT A;  2VB3 X;  1PTO F;  1OO9 B;  3TBI B;  3M3Y B;  1Y1W B;  2L12 A;  2DY7 A;  4G4K A;  2N55 A;  1KDC A;  3OPO A;  1D5Z C;  1XX8 A;  1M4V A;  1HPC A;  2K5Q A;  5D3D A;  1EYA A;  1LO5 D;  3CRL C;  4DK1 A;  3K58 A;  3I70 A;  3HEJ A;  3U9S A;  2K6A A;  1F9R A;  2KVM A;  2F0P A;  1GOZ A;  3R2T A;  3KBG A;  1CZG A;  3CKI B;  2EYH A;  2H4O A;  3NTK A;  3TME A;  5G3L F;  3VR6 A;  1A3T A;  2ZXO A;  4RKL A;  1PZJ D;  1NAP A;  2Q8I B;  3BG3 A;  2EVB A;  1QWY A;  5C4H A;  3KK7 A;  2JXM B;  3IKJ A;  4KD4 A;  1G29 1;  4KD3 A;  4RGN A;  2C5C A;  3D31 A;  1RJT A;  1CQF A;  4K2K A;  1EWC A;  5CV8 A;  1YNN D;  3H09 A;  4ZAI A;  3MFY A;  1FNW A;  1PTO H;  2HUG A;  4CGY B;  2I07 B;  1KDB A;  3SVM A;  2MPM A;  5AFW A;  1PFN A;  4ZUI A;  2A6H C;  5C44 B;  1V43 A;  1Q1B A;  3D3R A;  4B08 A;  4IFD H;  3KUP A;  3NQI A;  1OXX K;  1PTO C;  4ZLT F;  5C0X I;  1F2Y A;  5M5X B;  3E5S A;  4DN4 M;  2CVR A;  2X69 A;  2AQ3 B;  1OXT A;  4DFA A;  5CYU A;  1KNE A;  1S5D D;  1II3 A;  3EVQ A;  2AQ2 B;  2NN6 G;  2FMM A;  2IWH A;  1NUC A;  4HMI A;  1RF2 D;  4RHS A;  2JSO A;  1Q8I A;  2I46 A;  2FMC A;  1F9P A;  2Q8T A;  2KEC A;  2M9V A;  2E2D C;  3KLS A;  1Y69 U;  3HOV B;  5KEE A;  1BCP F;  4RGM A;  2KJX A;  3GTG B;  4EQP A;  5CV7 A;  1NR4 A;  1JWU D;  1ONL A;  1NSN S;  3PO3 B;  1T5X D;  2F0F A;  2EZV A;  4BBS B;  2SOB A;  2L4N A;  1A3U A;  5JEA G;  1SNO A;  2XVS A;  1LT6 D;  2ENB A;  2B2W A;  4DA2 A;  3AMU A;  1XWE A;  2RDH A;  2KED A;  1DM0 B;  1PRT B;  4FXG C;  1OXV A;  1JC7 A;  2L11 A;  3K5L A;  2B2Y A;  2E76 C;  3T16 A;  2CW0 D;  4A3D B;  1IYU A;  4HED A;  3DWQ A;  1TR5 A;  3A8K E;  1KLU D;  5CMD A;  3SK8 A;  1TY0 A;  1CM9 A;  3HS0 C;  5C4X B;  1M8A A;  3NTH A;  1EIH A;  3C46 A;  4ILW A;  1S4Z A;  3ITP A;  4QIW B;  2EOT A;  4FF1 A;  1EY6 A;  5E4X A;  4TRD A;  4BA1 I;  1CT1 D;  2LS0 1;  4DNR B;  1EY5 A;  2Z4H A;  1WTV A;  1EL0 A;  1RCV D;  3BVM A;  3VYU A;  1J8I A;  2SNM A;  2MJ8 A;  1TY2 A;  2E2H B;  5FO8 B;  3A7L A;  5FLX L;  1Z7T A;  1BQQ T;  2ICI A;  4YIJ A;  3M7G A;  1STY A;  1YNJ C;  1ML0 D;  5I9O A;  4G7H C;  4KKT A;  1SNC A;  3TDQ A;  2PZW A;  2WV6 D;  2E2J B;  5IOC A;  4LJZ C;  1BCP C;  4ID6 A;  2SEB D;  3VR5 A;  3HGB A;  1MD2 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...