1JOKA

Averaged structure for staphylococcal nuclease-h124l in ternary complex with ca2+ and thymidine-3',5'-bisphosphate
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
149
structure length
149
Chain Sequence
ATSTKKLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQLLRKSEAQAKKEKLNIWSEDNADSGQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords staphylococcal nuclease
publication title Solution structures of staphylococcal nuclease from multidimensional, multinuclear NMR: nuclease-H124L and its ternary complex with Ca2+ and thymidine-3',5'-bisphosphate.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 23
structure length 149
sequence length 149
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2001-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1jokA00
3SK5A 4EQNA 3NHHA 2F0MA 3VA5A 3NQTA 2ENBA 5IOCA 4K8JA 3PMFA 3TP6A 3U9OA 1ENCA 1KDBA 5NUCA 4NKLA 2EYJA 5CC4A 1KAAA 5IIFA 1SNPA 1SNOA 2WACA 2F0IA 1STHA 2EXZA 1A3TA 3OMGA 4RKBA 4K14A 2OXPA 4PMBA 5CV8A 5EGTA 4B9XA 1SNMA 1SYFA 2F0TA 3DMUA 5DEHA 3RUZA 3EJIA 1EY9A 1KDCA 3MVVA 4N9PA 5I6WA 2EY6A 1SYEA 3D8GA 4KJNA 5CV4A 2F0NA 4J1MA 1SYGA 1ENAA 3NUCA 2F0VA 2EYPA 4YIJA 1A2UA 3SK6A 3QB3A 3T13A 3OWFA 4PNYA 3MHBA 1NSNS 3NP8A 4RKLA 3OSOA 4J6HA 2F3VA 4IZ8A 3DHQA 2SNSA 1IHZA 4I65A 5JOBA 5F2DA 5CV6A 4KD4A 2F0HA 3EVQA 3S9WA 1A3UA 1STBA 2F0OA 4DFAA 5J22A 5J39A 4K2LA 5IGEA 2F0GA 4ZUIA 4K5WA 5IGBA 4HMIA 4WORA 2EYFA 5KGUA 2F0SA 5HURA 2F0QA 1EYAA 5IODA 2OF1A 3EROA 5KYLA 1TQOA 2F0KA 5M9OA 5IGDA 2EYHA 2SOBA 4KV6A 1F2ZA 3QOJA 4TRDA 1JORA 3SHLA 2RKSA 5IGFA 3TP8A 4PMCA 4R8NA 4DF7A 2F0EA 1JOKA 1TT2A 3SK8A 3P1HA 3QOLA 1EQVA 1STNA 3NK9A 4LAAA 3C1EA 4F7XA 3MEHA 3D6CA 2F0PA 2PW5A 1NUCA 3NXWA 4QMGA 5I9OA 2PZWA 4ID6A 4G57A 3HZXA 4ZQ3A 1EY6A 4E6IA 5KIXA 5E1FA 2HQEA 2F0DA 2F0UA 5EKLA 3SR1A 5C5MA 2RBMA 3SXHA 4HTHA 4QF4A 1KDAA 4KJOA 5I6YA 1KABA 4DU9A 4IALA 5C3XA 4KTAA 4ODGA 4DGZA 4B9WA 4F8MA 3LX0A 5C4ZA 5J1ZA 1EY5A 1STAA 3D4WA 5DAUA 5KEEA 2F0WA 4NP5A 4QB4A 4WRDA 2KHSA 4K6DA 5IGGA 1EY0A 2OEOA 5IGCA 4KY7A 5CV7A 4IUNA 1U9RA 2PQEA 2EY2A 3P75A 4HMJA 3OMCA 4K5VA 1STYA 4KY6A 3D4DA 4K5XA 5ISRA 3MXPA 3ERQA 1EY7A 3TP5A 4K2KA 2PW7A 3HEJA 5CGKA 5JAVA 2EYOA 1II3A 4NMZA 2F0FA 4S3SA 2EYMA 5C5LA 5C3WA 5CV9A 4K8IA 2KQ3A 1A2TA 4N9TA 4ZUJA 1SNDA 1TR5A 2F0JA 4H7BA 3C1FA 1STGA 4NDXA 4EQPA 3TMEA 2PZUA 4EVOA 2PZTA 3V2TA 3BDLA 4EQOA 1F2MA 4KHVA 1SYCA 5CR3A 3TP7A 5HGTA 2PYKA 2LKVA 5EKKA 4ME5A 5KYIA 1AEXA 2EY1A 2EYLA 1F2YA 1JOQA 2M00A 2QDBA 3ITPA 1EZ8A 1RKNA 1JOOA 4KY5A 2O4XA 2NUCA 1SNQA 3R3OA 5CV5A 3BDCA 2F0LA 1SYDA 4MIUA 4OL7A 1A3VA 1EY8A 3SK4A 3E5SA 3MZ5A 5I9PA 1EY4A 2SNMA 1EZ6A 1EYDA 1EYCA 2RDFA 3T16A 1SNCA 4KD3A 5E3FA 2F3WA 3H6MA 5KRUA 5C6AA 1SYBA 5C4HA 5K5PA 2EY5A
chains in the Genus database with same CATH superfamily
4JV5L 1W3SA 4JOIC 4CDCC 2L4NA 4K8JA 3M4QA 5I2YA 3HRZC 3OMGA 4RHRA 1IKLA 4HJ8A 2ZTEA 1X3QA 2F0NA 3AFPA 3FMCA 1HR0W 4DV3Q 1LT4D 3JAMi 3KF8B 4OWTB 1HHVA 1BR9A 5M5YB 4R9WA 2JE6I 4ZLTF 1ZYRC 4LFBQ 4ME3A 1E2ZA 2VS1A 2OTLA 3PF5A 1JQYD 3BZKA 3J81i 2EYFA 4KKUA 3PSIA 2EPBA 2F0QA 1EYAA 4KN7C 1SROA 1E22A 3K5NA 2N78A 3U58A 5JJKA 4MTKA 5BN4A 5EBDA 4ZKCB 2HT1A 2VNUD 3DLLA 3S14H 1GHJA 3NK9A 2A5HA 4A3IH 1C4QA 4IQZA 1S5BD 3CCSA 2YTYA 4RHSA 4F87A 4U673 1WCMB 5G3LF 5M5WH 1MSHA 4YHHQ 4DK0A 3HG9A 4X3UA 2WKCA 1N33L 4KKTA 2B2UC 3Q24A 3MFGA 3CC7A 4P2CB 3SE0A 1RIPA 4WRDA 5FJ8H 4A3KH 2L55A 2B8FA 1JJCB 2C35B 2CH4A 4K5XA 3CP0A 1GM5A 4X65Q 2R92H 3NTKA 3ERSX 4BY7B 4DR1Q 1BUVT 5DM63 1SNDA 2WB1B 1OXVA 4P71A 2JEAI 1GHKA 2RHSB 3HOYB 5EKKA 1B9MA 1HZBA 3URYA 4JBKA 1VQKA 3ITPA 1D1IA 1JOOA 1UEBA 4LF9Q 1PYSB 4KK7A 4B3MQ 3E5SA 2HDMA 3T51B 3T16A 1TWFH 2PQAA 2FXQA 2EY5A 2HD3A 2XRQD 3VA5A 1OXUA 2A6HD 1F9RA 1XXGA 1I4RA 2EYJA 1VQAA 4B3TQ 3ZJYC 3HKSA 4PMBA 1QWYA 2KECA 1JR0D 1PH2A 1BOSA 2EY6A 3P7JA 1ENAA 4XYQA 1B3QA 3SK6A 3FPUB 2JA7B 3D0FA 4PNYA 2E76C 2HUGA 1DJRD 2C9OA 2JA6B 3AYHB 2UUBL 1FL0A 2KOLA 4L63B 1X3PA 3W1BA 4YWKA 4RFBA 2HIVA 4NPSA 1CQFA 3NBIA 4HIOA 4CKEA 3T1HL 1YJWA 1K3BC 4Y7NB 3Q0AA 3CKIB 1RHPA 1I94L 1X3FA 3EROA 4DR2L 1E0BA 1HFNA 2AQ3B 4TRDA 5T1IA 4YY3L 4JI5L 5JVH3 4R8NA 1VQFA 1JOKA 1TT2A 2UUCQ 4KHPL 3OW2A 2F0PA 3DM3A 3VR6A 4J15A 1PH4A 2Z1CA 1CI3M 4ZQ3A 1GUOA 3PF4A 4DV0L 3AQQA 1IBML 2HHHL 4OGQC 4AQYL 3M85A 2J4XA 4BA1I 2Q8TA 1SSOA 3TRZA 2WB1E 2EE1A 3ER0A 3C2PA 4LF6Q 2O5IC 2NZ1D 4P74A 3RZDH 1FD7D 2JXMB 1EU3A 4JI3L 1MD2D 2Z6BA 2K5HA 2PW7A 3K5LA 5IP7H 1I6VC 4A3EG 4LUOA 1EOVA 4JCVE 4CKCA 5C4XH 1TWGH 3I8ZA 1TR5A 4BWGB 2DNEA 3VA7A 2N88A 3KDFB 3V2TA 3HOVH 4J8QA 2KUMA 4BBSH 1I3QH 2B3GA 4DV5Q 3S2DB 2NUCA 4A3FB 1STEA 5C44H 1BCPD 3OW7A 1DOMA 1EY4A 1EYDA 4HCEA 2QW7A 1FVIA 2IX3A 1PH8A 1U4MA 1N32Q 2RQXA 1JE5A 2R3ZA 5M3FG 4LUZA 3SK5A 4WJ4A 4JI2Q 3H0GG 1H9SB 4OWXB 5IIFA 2IT1A 4XQNA 3CCEA 4C3IH 3CHBD 3GQBA 3LGJA 5FO9B 1TWCB 3UE1A 1M4VA 2FMCA 5IP9H 4KJNA 4OXPA 3ULLA 1HCZA 1SYGA 2F0VA 3BG3A 1F9SA 1HJPA 5E7NA 3RR5A 3NWSA 1N34Q 3NTHA 1XNQQ 5HY6A 4MHEA 1B44D 3S9WA 3K7AH 5C4JH 2BH8A 1D2BA 5JEAG 1Y1VH 3A8KE 1BCPB 4GOPB 1YHBA 2QGQA 3G6EA 3G48A 1TQOA 3HOZG 2PQAB 4H0LC 5CBEE 1XNRQ 5L37A 3SHLA 3TP8A 4I7ZC 4DAMA 2F0EA 4RGNA 1V1OA 2JK8A 4YHHL 4NXMQ 1QILA 4V190 4HEDA 1A15A 1VQDA 3Q8DA 5T1GA 1SDFA 4A3JH 3MXUA 2ATWA 1EIYB 1X54A 2WAQE 3D31A 3HGBA 1N36Q 2HQEA 2B2TA 3IFDA 4TVAB 1N9WA 5FLXL 3HP3A 1LLRD 3DEPA 3KLSA 5FOBB 4NXNL 1L1OA 1CFMA 2VL6A 4X65L 1LTGD 1T5EA 1NR4A 4GKJL 2MNAA 1B9NA 3GTGH 5LMNL 3S14B 1TY0A 5CV7A 3FKIG 4A3BG 2AWOA 4FVMA 2KHJA 4JI1Q 4A3IB 1LTRD 2KEDA 1IYJB 2AMCB 2A74C 1BQQT 4V0BA 2TMPA 1AW7A 5M5WB 1II3A 3U9SA 4FF1A 1JJ2A 4JI0Q 3M3YH 3I4NH 2PCFB 2H4OA 3KYHC 4P75A 4A3DH 1OO9B 4A3KB 3AU7A 5KYIA 2IJ0A 3S1MH 1VDZA 3TBIB 1ASYA 2HCCA 2R92B 2E8GA 4GN4B 3CCJA 5IYDH 4A3LH 1EZ6A 4OO1H 2RF4A 4B3TL 1RTNA 1PH6A 5GAHC 3L2PA 3R93A 2R93H 3U9OA 2AUKA 2J7ZA 1RODA 1TS4A 1OTCA 4H44C 2DN8A 4PZ6A 1HNZL 1S72A 2OCEA 1SNMA 3SEBA 3WOFA 2K5WA 2KCCA 2B39A 2L11A 2CCZA 2PNRC 2XRSD 1WVLA 1WTVA 1MJCA 1A2UA 3T13A 4GLAC 1VMPA 4DV1L 1E7ZA 1TWFB 3HOWG 4OWWB 4DR3Q 1NNXA 1KNEA 1VQBA 2QF7A 3LWUA 2OWOA 4RGMA 1Z9FA 1L0YB 2PNHA 3PCOB 4GNXA 1QG7A 3OOCA 4IOCA 1PYBA 2C5CA 2XIWA 1TWAH 4A3MH 4L5QA 1B1ZA 2SOBA 4JV5Q 1A6XA 4HSVA 4O0AA 3S1NH 4CHTB 1G6ZA 2ID0A 1BVSA 1PZKD 2B2TC 4MZ9A 4A3GH 1ICFB 4GS3A 4ID6A 5GQOA 1P16A 1VQNA 4R1JA 1F77A 2F0UA 2JN4A 3UDXA 4QF4A 5I6YA 1GUWA 3MXNA 1I6HB 3T1YL 2R7DA 2L9HA 3KK7A 5LL6X 5AJ3L 1WTRA 3M4OB 3GTMH 5KNCA 4NP5A 1HQMC 2V4DA 3BJUA 1DOKA 1F9PA 4X62L 3CU7A 4IFDG 4JYAL 4POGA 3OMCA 4OIKA 2L1BA 5ISRA 1U5KA 3M7NA 3CMAA 1CZWA 4B08A 5JAVA 1FYCA 3F2DA 2X6LA 4BXXH 1TXYA 1XX8A 1SR3A 2ZJQA 4XXEA 4DV5L 5IT9c 2QDLA 4A93G 3K5OA 4EQPA 1E3PA 1GJXA 2K04A 1QB5D 3HOXH 2UXBL 3RZDB 5EQ0A 3HOYH 1N33Q 4MIUA 4BA2I 1VQIA 3G4SA 1S4ZA 4IUUA 5C4XB 1TWGB 3K5MA 1XYIA 2ENBA 3HOVB 4U68A 4FF3A 3N52A 1PH7A 4BBSB 1LT5D 1I3QB 1ILQA 3E9IA 1Q90A 2NN6I 5C44B 1HNWQ 4LJZC 3NUCA 4RG1A 1PH9A 3S16H 4CJ0B 4POFA 1HA6A 2KCTA 3PUWA 1AZQA 1WJJA 1Q12A 1K0RA 1LTBD 2F1MA 2Z0SA 5F2DA 3E0EA 1QCBD 1NMGA 3W1GA 3RMHA 2JA7G 2K5VA 3STBC 4K2LA 3CC2A 4C3IB 3H09A 1VF7A 3L0OA 4NB3A 5BN5A 2JA8G 4JG2A 2K5NA 4UPAA 2UXDL 4IURA 4JOIA 3EIVA 4XQQA 1LO5D 2IWHA 1EQVA 1STNA 5FLMG 5EAYA 1VQ7A 3MEHA 2K5DA 2DUDA 2R7FA 2RSNA 4QMGA 2EJGC 1VQ4A 3K7AB 5C4JB 3WDNA 2BE5C 2R6GA 2F4IA 2DY8A 1PZJD 4DK3C 1F9QA 2YTVA 1KDAA 2CWPA 4QCLA 4JI1L 2K32A 1MSGA 1EEFD 2UUBQ 4B9WA 4L8JA 1YNJD 1FNWA 3D4WA 2I07B 4KKSA 2MGSA 4P72A 1XPRA 2WP8J 5IGGA 1UE1A 5M3MH 4IUNA 1PH1A 3CQZH 2LFNA 3T1HQ 4JI0L 5A2QL 4DV7L 4A3JB 3CRLC 4Q0FA 2D0OA 3TP5A 1I94Q 4IJLA 3A55A 4DR2Q 1VQ6A 4YY3Q 4IPHA 4JI5Q 2G5DA 3AFQA 3NTIA 4KHPQ 2BA1A 1IW7D 2VUMH 2XSCA 4FDBA 1EQQA 2RCFA 5HGTA 1MGSA 1B4OA 4QJFA 2ZT9C 4O1NA 2B2UA 1B70B 4OL7A 3SK4A 3MXNB 1QVCA 4DR5L 1SNCA 4R8IA 1PFNA 3I4NB 3TREA 2K6AA 3VDYA 3NWTA 4JI3Q 4A3DB 2YV5A 2B63H 1VQPA 1G51A 2EVBA 4C3HG 5EGTA 2OXPA 4AYBG 2NN6G 2H5XA 4DR3L 3BZDB 2CHBD 1OXXK 3UI2A 1O7IA 4L5SA 4APVA 1K28A 3GO5A 4DUZL 1H9RA 4YIJA 1FGUA 3A0JA 2NZHA 4PG3A 1SE3A 1ZEQX 2LY7A 4QQBX 2HQLA 2MO1A 4J6HA 1SMYC 2SNSA 2A69C 2F0HA 5D3DA 1A3UA 2Q2IA 3I4LA 3MTSA 3VR2A 4DAYA 3CPWA 3HOUG 1MIUA 2R93B 1YNNC 1L0WA 1QUQA 2AQ1B 2F0KA 1G2TA 4KV6A 1O80A 2QEJC 1XMQL 1PTOF 1HH2P 1Z7TA 4A3CH 4Y52H 3BYYB 4G4KA 1SJHD 1BNZA 1SXTA 2PI2A 5ELFA 1HXYD 4HAEA 3RN2A 4DV2L 3FPPA 2F0DA 4X66L 1LUZA 3SR1A 1ZXTA 4M1UB 1TWAB 1KRSA 1CSQA 1S3OA 4A3MB 1KABA 1SBBB 5IYBH 3GD7A 4FXGC 3GTLH 4IPCA 3KF6A 4KI0A 3S1NB 2ZTDA 4KMUC 3P75A 3KLRA 1WTXA 4A3GB 1CTMA 2K50A 2CQOA 1YITA 1SRUA 4K6LA 3GTPH 2DJGC 3HEJA 1CA6A 3QR8A 4ZKBB 4DAPA 3M9BA 2B2YC 5JJZA 4JK1C 3C1FA 2BDOA 2WV6D 4JVZA 1ZKOA 3GTMB 3BDLA 3CMEA 2EIFA 3CCQA 2PYKA 2KA7A 2M00A 3X3MA 1V1PA 3NBHB 1PTOC 4A3KG 1Y1WG 2XGTA 4BY1B 4NXNQ 1PYWD 4GKJQ 1PFMA 2R92G 5LMNQ 2ZM6L 4DV6Q 1PH3A 3M4PA 2F0MA 1HNWL 2FINB 3FDTA 5IGDA 4R4IA 1R4QB 1O7YA 3HOXB 1A3TA 3ZYYX 2HCIA 3U4ZA 1I4XA 5CV8A 3CCVA 1SYFA 3BVMA 5DEHA 3DMUA 3NQIA 3CCRA 4GN5A 1YZ6A 2A19A 2KVMA 4QUCA 1LTLA 1U0LA 3IL8A 2YU9B 3HKZG 1I50H 3G7LA 1BDOA 4PV1C 3WWVA 3RLNA 3X3NA 5M9OA 1X3EA 2N55A 3CRKC 1NMFA 2FFKB 3S16B 1CT1D 4A76A 1QZGA 4QL5A 1DZ1A 2VQEL 1VQHA 4XYOA 5ELCA 3GTQH 5IT9E 1HNZQ 5I9OA 3N6RA 3VR3A 1K83B 5KIXA 5I4DA 5ELNA 5EKLA 1N8RC 1QNUA 4DV1Q 1D7QA 3ULPA 5C3XA 3PO3G 3DXJC 4KTAA 5KEEA 3PIOA 3EN2A 1EWIA 5EJWA 1C48A 1I6HH 1S5ED 1VS0A 3M4OH 4HMJA 2EZVA 1FR3A 3KOJA 4ABNA 4K2KA 5JEAJ 1K8MA 4L6TB 3B6YA 2EYMA 1B53A 2WINB 1BCPF 4HSPA 4EVOA 4EQOA 2XVSA 1VQEA 1QJOA 5M3MB 1G291 2LSSA 2RSOA 3CQZB 2EYLA 1NAPA 1JT8A 1DXMA 1SAPA 1KNAA 1W6JA 1KHIA 1VQOA 4C1NI 1SYDA 2KHIA 1HR0L 3T1YQ 2RDFA 2WAQB 5AJ3Q 1BBXC 4KD3A 2N49A 1KXLA 3U50C 3KF6B 1SYBA 4X62Q 4JYAQ 4IUVA 1CUKA 2VUMB 2O2LD 2VB3X 1YVCA 2NVYH 4JPBW 2OQKA 4PMWA 1W2BA 3R2IA 1G8ZD 2LXKA 5A35A 3H94A 1K9MC 4IO9A 1ILPA 3GV6A 3MVVA 2OQ0A 2K05A 5ELBA 1YI2A 4BBSG 1YHQA 4B3SL 2ZXPA 4A3EH 1V8QA 2BDNA 3I4MB 2DJFC 1XPOA 2F3VA 1Q7YC 2E74C 2UXBQ 4FNFA 1GUGA 3GV3A 1DYQA 3GTKH 4CDDC 1RTOA 1UE5A 4IPGA 5J39A 1QE6A 1V1PB 2FHTA 3FEWX 2F0GA 5IGEA 2B63B 5GAGC 4HIDA 2A8VA 1BCPC 1HQRD 1YHAA 2OF1A 1HZ9A 2MUYA 1UE6A 2D5DA 1A8VA 3T4AC 2EYHA 4N8X1 5K36H 4KLKA 3S17H 4YCWA 3J7YW 4TSSA 4LAAA 4PZ8A 3D6CA 1Y8OB 2EJMA 3CAMA 3TZUA 5M3FH 2VXWA 3H0GH 1DOLA 1GVPA 1YNXA 1PZID 1YBYA 1S5DD 4FXKC 3PIPA 1Y1VG 5C4ZA 1Q1EA 1Q8KA 3ONAB 4WFN3 1M8AA 4X64L 2Y0SG 1EIFA 2KHSA 5IGCA 2VQFQ 3GTOH 3RZOB 3TS2A 2MQHA 1JCKB 4YWLA 3RLFA 1H95A 1ET9A 1EY7A 2KEEA 2AQ2B 5JEAH 1Q81C 2UXDQ 3C46A 5C5LA 1K3RA 5CV9A 3KFUA 4UP7A 1I4HA 1CKOA 2KCMA 3FRPB 3GTLB 4CJ1B 1PXUA 3A7LA 5CR3A 3UDFA 1WTQA 2EY1A 1JOQA 4GLXA 2N3SA 4DV6L 1ICWA 1RKNA 3PO2G 4IFDI 1SE8A 3GTPB 1BF4A 3MZ5A 4BBRG 1VQ9A 1EYCA 5BR8Q 4B3RQ 1EQTA 3QO2A 3I4OA 4MTNA 4M8AA 1B7YB 1NTGA 1PVOA 2NVTH 4EQNA 4DV7Q 4C3JG 5CBAE 5C3EG 2CKZB 1D5MC 4IFDJ 2H1EA 3FKIH 4K14A 4ZCKA 3DUZA 2JJQA 2Q8IB 1BXTA 5CV4A 1V43A 2CFMA 3ULJA 1J8IA 2EYPA 3PIO3 2R7ZG 2NZOA 1ET6A 5IYDG 1ML0D 4A3LG 1Q8IA 3EVQA 4OO1G 1AZPA 4CDFC 5IWAQ 1WD1A 2FMMA 4K5WA 4LUVA 3MEFA 1BKBA 5HURA 4AYBE 4DR5Q 3S2HH 2K01A 1BBUA 2IX1A 1C9OA 4XIGS 1XJVA 4G7ZC 1GKHA 5EPJA 5IGFA 1JWMD 1ASZA 2BOSA 1PH5A 3CCMA 2B2VC 1Z47A 1I50B 1QZHA 5GADC 4LF5L 3HZXA 2HIXA 1D5XC 4DUZQ 4DR4Q 2RBMA 1TWHB 1IL2A 1J6QA 3U4VA 4Z9CB 3J80c 4DU9A 4LF7L 3Q23A 5E4XA 3LX0A 2K28A 1E2WA 3K6OA 2KBNA 2F4VL 3ND8A 1LTSD 2ZXOA 4R4TA 2VY3A 1O78A 2LS01 2UU9L 3MC0B 3OIPA 3HOWH 3K58A 2K5QA 2E5LL 4KY6A 3GTQB 4CDEC 5BN3A 3NENA 3KLSX 4MNOA 2EYOA 4UAIA 2WIIB 1XMQQ 1X55A 3OTOL 2SDFA 2NTTA 1WCMG 2R61A 4EX5A 2RA4A 3I91A 4L5TA 1HRJA 4LWCA 2MP1A 3MA2B 1AEXA 2NVXH 4DV2Q 3UE0A 4X66Q 1QOHA 3M4YA 1NJIC 2UUAQ 1HUNA 2Z8LA 1HTLD 2A6EC 1LABA 4X6AH 2JA9A 4BY1H 3WOEA 3G6JB 1A62A 3A7AB 1MJEA 3IAYA 3AMUA 3OWEB 3NQTA 2P5ZX 4BY7G 3JAMc 4RA8A 3EFXD 2VB2X 5CC4A 2ALYB 1SNPA 4IFDH 4TKOB 3CCUA 2WB1G 3EJIA 3PIP3 4DR7L 1WD0A 4N9PA 4OHJA 1SYEA 3D8GA 2ZJRA 3HOXG 1PFBA 1IYVA 4RGOS 3RLOA 3J81c 3HOYG 4C1NK 1GOZA 3K0XA 3PV0A 2QEXA 1L2FA 4HCSA 4IZ8A 1L1OB 3DHQA 4ZAIA 4FF2A 1CM9A 3W5OA 4A93H 3HS0C 2NVYB 4R4QA 2YU9H 3KBGA 5IT9L 2F0SA 3CW2C 5D65A 4FF4A 2OT2A 4IN3A 5KYLA 2HDLA 1SN8A 2CW0D 2ZXRA 2ZM6Q 1LT3D 4R4OA 5JPNC 2EXDA 1IYUA 2BH2A 3S15H 3CPFA 3SK8A 4A3EB 4JI4L 2Z9HA 4QY7A 1ESRA 1I5FA 1LT6D 2ES2A 1YEZA 2B2WC 2M9VA 3GTKB 2DNCA 3A56A 4DN4M 2MJ8A 4DXFA 1QVGA 5E1FA 1B3AA 2WFWA 3D4RA 2VQFL 2JA6G 1K83H 1TY2A 4HN7A 4A75A 1FJGL 2IW3A 1Q46A 4DUYL 5M5XH 2MFIA 3S17B 3STBD 1WYDA 1EY0A 3PUXA 2EY2A 3K8AA 1UAPA 4K5VA 1STYA 5M3FB 5AFWA 1XWEA 3H0GB 3T53B 3S1RH 1V1QA 4NMZA 1HNXL 1X6OA 5COYA 3D3RA 2D62A 2VQEQ 3BYTB 2JA8H 5GAEC 2K03A 3H3VC 1IXRA 2D0PA 3GTOB 2BE5D 4B3RL 5BR8L 2K7VA 5EKIA 5EPLA 1K0SA 1UWVA 3SVMA 5FLMH 1CQVA 2X69A 3A54A 4DNRB 2JSOA 1RDPD 4GNXB 1KLUD 3O13A 4LMQD 3AB9A 2YYZA 1NY4A 1YNJC 2EJFC 2L15A 4X3TA 4Q5VA 5J22A 3G71A 2PZTA 3DEOA 5IODA 1Q86C 1U4LA 3EQLC 3PMFA 3TP6A 4NKLA 2NTSA 1R9TH 2WACA 1STHA 2A1AA 3Q22A 4LFCQ 1UUPA 2B2YA 1JICA 1P8LA 4LF8L 3F2BA 3DWPA 4J1MA 5IWAL 4C56C 1K8GA 2E2DC 4IUTA 2NVQH 1IW7C 4RKLA 5C0XG 1IHZA 2NVTB 4FYDA 4A3FG 3S24A 3I4MH 4HIMA 1F2LA 1MBYA 1Q82C 3J7AV 3PGZA 1SMXA 5KGUA 2K52A 3FKIB 1HR0Q 2A68C 4XT1B 4JBJA 3TQYA 1D6EC 1B8AA 3A8IE 3NEMA 3QOJA 2E2IH 4LF4L 3E0JA 1C7YA 4DR4L 3P1HA 5IYCH 1SE2A 5LL6S 2IX0A 1FNVA 1KTKA 2Q2HA 3F8TA 2RHQB 4RWSC 3OIQA 1VQMA 1GD7A 4K0KQ 1V9PA 5C5MA 3S2HB 4C3HH 2E2JH 4B3SQ 1WTOA 1PRTD 2JA5H 2NN6H 1SMYD 1AFPA 4OELB 3L3OC 4EGVA 4WJWA 4F8MA 4LNQA 1EFWA 2A69D 3VYSA 4ALPA 4QB4A 3I55A 3D6WA 3IRBA 1YNND 1TU2B 2AHOB 2Z4IA 1SJED 1AN8A 3RZOH 1EWCA 5KNDA 4X3KA 3J7ZC 4JC0A 2PMZB 4A3CG 3HOUH 1OXSC 4CKBA 1VQLA 2F0FA 1AE3A 5C3WA 4JI7L 4P73A 2KQ3A 2Z6KA 3DWQA 4N9TA 1IZ6A 3JC66 4RAUC 5IE8A 2UUAL 2X6GA 1SFOH 2Y0SE 1F2MA 1ZYRD 1GO3E 1XTDA 3UDIA 5IYBG 3HOWB 2QDBA 4XT3B 1I4PA 1EZ8A 2O4XA 4ZYSA 2F0LA 1PRTB 1EU4A 1EY8A 1SE4A 2NB0A 4UP9A 1VQGA 4NW2A 1IBKL 1U4PA 4KN4C 4X64Q 4ZK9B 1RF2D 5C6AA 1G2SA 1TIID 4A3IG 3H15A 3W3AA 3A5UA 5D3IB 4JI6L 1XMOL 2K75A 1GUTA 2IL8A 1CKMA 1KDBA 1RD9D 3ICEA 1Q1BA 3L9AX 2EXZA 2NVXB 1PLFA 4RKBA 3I73A 2F0TA 1EY9A 4C2MH 1BO0A 3KDFA 5DM73 5FJ8G 5E4WC 3MHBA 3K59A 2UXCL 3OSOA 3VR4A 1ESFA 4I65A 3J80E 2EOTA 4KD4A 4GLVB 1PTOD 4ZUIA 1VMCA 1J9OA 1Y1WH 1JORA 1VCIA 1JJGA 2WKDA 1H9SA 5CMDA 4DNTB 3CD6A 3M7GA 3S1QH 1NUCA 4DV4L 1EWHA 4A93B 3VR5A 1D5ZC 2PMZE 1JWSD 1SEBD 1AE2A 3H91A 2Q2UA 1AP0A 1HA5A 4QIWB 3RN5A 2Q2TA 1TWHH 5DAUA 4DK6C 1G6PA 3S15B 5G3LD 2VZAA 3V96A 4K6DA 1UE7A 1NBWA 1PTOB 3J7AF 4JBWA 4GOPA 3D4DA 2G9HD 2Z6KC 3MXPA 3I2ZA 2BCOA 2A6HC 3J81j 4LFAL 3JAME 1DM0B 3OHXC 1AH9A 1G91A 1EFID 2DGYA 5KNBA 3QJYA 4HJ9A 1HUMA 5M5XB 3W2DA 2OTJA 3TMEA 3OPOA 4DR6Q 5LMNW 2D9UA 3J81E 4LF5Q 3F1ZA 2RVLA 2L0CA 1F2YA 1KLGD 3F2CA 1LYLA 3I72A 4DAYB 1H9KA 4KY5A 3R3OA 3S1RB 4LF7Q 1QUQB 1YIJA 2F4VQ 3H6MA 4FO2A 1CHPD 1NE3A 5LHY1 4LFCL 1MKHA 1LTTD 2JA8B 2UU9Q 3PO3H 2E5LQ 5HGQA 5NUCA 5LMUL 1BBWA 2MPMA 2NBFA 4F88A 3GP7A 3BDOA 2ZJPA 3OTOQ 1KRTA 1J5EQ 2JEBI 3H3VI 3TSSA 1HPCA 3OWFA 1NSNS 3NSWA 4RCNA 5JOBA 2LMCB 1WTPA 1FNUA 3KBXA 1IL8A 1STBA 4DFAA 5IY0A 5IGBA 5IP7G 1R9TB 4DPGA 1C0AA 4HJ5A 3MXGA 5C4XG 4KHZA 4RH6A 3J7A5 1CKNA 4HR7B 4UHVA 4GKKL 4QIWE 3HOVG 1ONLA 4K0KL 3TN2A 3K81C 2NVQB 2EDGA 4CGYB 3SGIA 3PUZA 5JVG3 3VYTA 2JP1A 1A0IA 3NXWA 4IOAA 5C44G 1EUJA 4DR7Q 1C8CA 1S5FD 4OO1I 4RMFA 3R2TA 3SXHA 1I4QA 3V05A 4KJOA 5A2QE 4GOPC 2A73B 3MAQA 3EBEA 1MHWC 2E2IB 4C3IG 1DONA 3FHWA 2PQEA 5I2XA 1X56A 1QNKA 5K36G 2SEBD 5IP9G 1KIXA 1YJNA 3ERQA 1WFQA 4TQUS 4DXGA 2XWBB 4WJ3M 4RCOA 4DA2A 4C3HB 2Z4HA 4K8IA 2E2JB 4AYBB 2K4KA 2B2VA 1A2TA 4JI4Q 2JA5B 4DV3L 3I90A 2TSSA 4NDXA 2PZUA 1DCZA 2KJXA 4ILWA 5JPMC 2JQOA 4LFBL 3R8BA 4JW0A 2L5TA 4H13C 4HJAA 2PI2E 1FJGQ 3HOUB 1A3VA 4DUYQ 2SNMA 5FO7B 5JJIA 2I0QA 1K8AC 1WI5A 3OYYA 5GROA 1Y8NB 4I7AA 4KHVA 4ZRZA 4A3JG 1EIHA 3L7ZC 4JI8Q 2CQAA 4IUPA 1X9NA 4UP8A 1RL2A 1SFOB 5FLXc 2AKWB 4FXDA 3VYRA 3HOZH 2F0IA 3MFYA 4DNIA 2N8NA 1T9HA 4LW1A 1HNXQ 4OX9Q 5I6WA 2GN5A 3IFTA 4H02A 1CHQD 3ND9A 4O42A 2K33A 3QB3A 4R4CA 2B8GA 4GN3B 3K0YA 3NP8A 4CBVA 1CA5A 4XTCS 4IPDA 4YWMA 3NE5B 1M1KC 1KQSA 1EOTA 1RCVD 3I3CA 2QKIC 3LWEA 1EEID 1TS3A 2XWJB 3A8JE 1GXDC 1GUNA 3H3VH 3I4NG 2G9DA 3PO2H 4C2MB 4A3BH 2QCPX 1D1KA 2MHVA 4DR1L 4OONA 4A3DG 1VF5C 2NYZD 4BBRH 2RKSA 1LM0A 4DF7A 4X3SA 2I5LX 2CWAA 4G7HC 1U4RA 1PV4A 3IKJA 3GTJH 4LK1C 4BS9A 4L5RC 1EIGA 4LF8Q 4GZYC 4G57A 4C3JH 5C3EH 1EY6A 1VQJA 4LF9L 1Y69U 3T56B 2XNAC 5JJLA 3TZDA 4B3ML 2E2HH 5CGKA 4QGUA 4ODGA 1S40A 1Y1WB 3MWYW 1CSPA 2R93G 3C3LA 1CZGA 1VQ8A 1LTID 2OEOA 2R7ZH 1U9RA 2ICEC 3PQIA 4UY8C 3S1QB 1O7LA 2O5JC 3UDGA 1IBLQ 4DR6L 1H9JA 2DY7A 3P20A 1CKNB 2EQSA 5ELEA 4LF4Q 3KJPA 1TS5A 1PFSA 3QIAA 2F03A 2B2WA 1JB3A 1STGA 1NCVA 3CF5A 3VYUA 5DLQE 2J0TD 1HZAA 4EQ5A 2L12A 3TP7A 1E1TA 1K8OA 5EBCA 3A5ZB 3BZCA 3BVZA 2F52A 2IHFA 4A3MG 2KCNA 5CV5A 3BDCA 3HKZB 2D2CC 1DD2A 4DK1A 4DKAC 5I9PA 1TKWB 1UEAB 1S5CD 2F3WA 4OIJA 3DM1A 1D8LA 3KJOA 5M5YH 2XTIA 3RD4A 4A3GG 5C4HA 1QVFA 1OXTA 1J5EL 3HFZB 2UUCL 1MI2A 1ENCA 3J80L 1KAAA 1SNOA 4RGTA 1KC8C 3K7UC 4OEMB 2IHEA 4B9XA 1TS2A 3LNNA 4HJ7A 2LXJA 1KDCA 4JI7Q 2E75C 2FJ2A 4UDUC 1TVXA 2PPBC 2NWGA 4YCVA 1Y14B 1WOCA 3I56A 1L1OC 1ENFA 5CV6A 2B29A 3PO3B 4BY1G 1WCMH 4LF6L 3Q6SA 2ASBA 4YCUA 4BXXG 2A6ED 1IBKQ 2GA4B 2M2LA 1RJTA 5J3BA 4JI6Q 1XMOQ 1VQCA 2Q8RE 3QOLA 4IJHA 4F7XA 3K80C 2PW5A 2I5HA 1JB7A 5C0XI 4E6IA 4BY7H 5DNFA 2K14A 1YJ9A 3CXCA 4DAVA 4HTHA 3DWAA 3JAML 1KL9A 1R4PB 2V1CC 2UXCQ 4IALA 4DGZA 1EY5A 1STAA 4FP5D 3BVGA 4O2DA 1N32L 1WTWA 4JI2L 2AWNA 5C0XJ 3EA6A 1HTPA 1PTOH 3J81L 1T5XD 4A4IA 3HKZE 5FK9C 2CVRA 2CW0C 3NELA 4XQJA 3BS1A 4G7OC 3PUVA 2F0JA 3KF8A 3K57A 1O7ZA 1Z6HA 1UNSA 1B50A 2ICIA 3E6ZX 4CJ2C 4DV4Q 1X32A 1N34L 2LKVA 1XNQL 4ME5A 2YTXA 2RCNA 2CH4W 2RDGA 1E2VA 1KD1C 1X3GA 1LTAD 5H1SE 1SNQA 2PO4A 3A74A 4N8FA 4JI8L 4GNXC 2BA0A 3E9HA 5E3FA 2JA7H 2JA6H 2QILA 3KLWA 3E3XA 3BU2A 1LACA 5K5PA 1XNRL 4OX9L 3NHHA 2MO0A 5FKAC 5IOCA 1E24A 3QG1A 1EYGA 1CK1A 4NXML 3TS0A 4LFAQ 5CORA 3SDZA 2GVBA 4Y7NH 3CC4A 3RUZA 1I4GA 5ELDA 5EPKA 1N36L 3TDQA 4AIMA 2JYOA 3FP9A 4QUFA 5M3MG 1PA6A 3CCLA 1KAWA 2GVAA 3I7FA 1Y1VB 2F0OA 3NBHA 3F2UA 2WAQG 4ULLA 4HMIA 4WORA 2Y0SB 3HOZB 2AUJD 1A63A 3FVQA 1PHJA 2IY5B 2VUMG 2VW9A 1F2ZA 4XDXA 4PMCA 1JMCA 5LMUQ 1PRTF 1XPUA 3C1EA 5TSSA 3RNUA 1LV9A 2PZWA 1JWUD 3I70A 2F3IA 3I4MG 1JC7A 3QWNA 1GUSA 2RDHA 1WTHA 3PO2B 3GTGB 4A3BB 3TEHB 1VQ5A 5J1ZA 4DV0Q 2F0WA 5ELOA 4BBRB 1IBLL 1IBMQ 2HHHQ 2XN9C 2B63G 1PMRA 1Q3LA 4KY7A 4AQYQ 1DGSA 3GTJB 5C0XH 2A68D 4PQXA 3J80i 3S2DH 2K1BA 3PUYA 4A3FH 2I46A 1M90C 1SLJA 4C3JB 2IPKD 1X65A 5C3EB 5IYCG 2KENA 5FLXE 1W6KA 1H9MA 1HFGA 4GKKQ 3M3YB 1L0XB 3KUPA 4S3SA 5D14A 1HZCA 3NPPA 1NR2A 4ZUJA 1PDQA 2E2HB 1JE4A 4H7BA 1XTCD 1Y8PB 1FGBD 4AH6A 4HIKA 3S1MB 4JBMA 1SYCA 2JA5G 1IKMA 2R7ZB 3AEVA 1TWCH 2I5MX 2QA4A 5FO8B 1PRTC 1EQRA 2ZTCA 3GDEA 1K73C 1EL0A 4MN3A 4IUQA 1B2TA 5CYUA 5KRUA 4PZ7A 1E1OA
chains in the Genus database with same CATH topology
2L4NA 4K8JA 5I2YA 3HRZC 3OMGA 4RHRA 1IKLA 1X3QA 2F0NA 3FMCA 1LT4D 1HHVA 1BR9A 5M5YB 4R9WA 2JE6I 4ZLTF 1ZYRC 1E2ZA 1JQYD 2EYFA 4KKUA 2EPBA 2F0QA 1EYAA 4KN7C 3K5NA 5BN4A 5EBDA 4ZKCB 2VNUD 1GHJA 3NK9A 2A5HA 1C4QA 4IQZA 1S5BD 4U673 4RHSA 4F87A 1WCMB 5G3LF 1MSHA 4DK0A 3HG9A 4X3UA 2WKCA 4KKTA 2B2UC 3Q24A 3MFGA 4P2CB 3SE0A 4WRDA 2L55A 2B8FA 4K5XA 3NTKA 4BY7B 1BUVT 5DM63 1SNDA 2WB1B 1OXVA 2JEAI 1GHKA 3HOYB 5EKKA 1B9MA 3URYA 3ITPA 1D1IA 1JOOA 4KK7A 3E5SA 2HDMA 3T51B 3T16A 2EY5A 2XRQD 3VA5A 1OXUA 2A6HD 1F9RA 1XXGA 1I4RA 2EYJA 4PMBA 1QWYA 2KECA 1JR0D 1BOSA 2EY6A 3P7JA 1ENAA 4XYQA 3SK6A 3FPUB 2JA7B 4PNYA 2E76C 2HUGA 1DJRD 2C9OA 2JA6B 2KOLA 4L63B 1X3PA 4RFBA 1CQFA 3NBIA 4CKEA 4Y7NB 3Q0AA 3CKIB 1RHPA 3EROA 1E0BA 1HFNA 2AQ3B 4TRDA 5T1IA 5JVH3 4R8NA 1JOKA 1TT2A 2F0PA 3VR6A 2Z1CA 1CI3M 4ZQ3A 1GUOA 4OGQC 3M85A 2J4XA 4BA1I 2Q8TA 1SSOA 2EE1A 3C2PA 2O5IC 2NZ1D 1FD7D 2JXMB 1EU3A 1MD2D 2PW7A 3K5LA 1I6VC 4CKCA 3I8ZA 4BWGB 1TR5A 2DNEA 3VA7A 2N88A 3V2TA 4J8QA 2KUMA 3S2DB 2NUCA 4A3FB 1STEA 1BCPD 3OW7A 1DOMA 1EY4A 1EYDA 4HCEA 2IX3A 1U4MA 2RQXA 2R3ZA 3SK5A 1H9SB 5IIFA 2IT1A 4XQNA 3CHBD 3GQBA 5FO9B 1TWCB 1M4VA 2FMCA 4KJNA 1HCZA 1SYGA 2F0VA 3BG3A 1F9SA 3NWSA 3NTHA 4MHEA 1B44D 3S9WA 1D2BA 5JEAG 3A8KE 1BCPB 1TQOA 4H0LC 5CBEE 3SHLA 3TP8A 4I7ZC 2F0EA 4RGNA 1V1OA 4V190 1QILA 4HEDA 1A15A 5T1GA 1SDFA 3MXUA 3D31A 3HGBA 2HQEA 2B2TA 3IFDA 5FLXL 3HP3A 1LLRD 3DEPA 3KLSA 5FOBB 1CFMA 1LTGD 1T5EA 1NR4A 1B9NA 3S14B 1TY0A 5CV7A 2AWOA 4FVMA 4A3IB 1LTRD 2KEDA 2A74C 1BQQT 4V0BA 2TMPA 1AW7A 5M5WB 1II3A 3U9SA 4FF1A 2PCFB 2H4OA 1OO9B 4A3KB 3AU7A 5KYIA 2IJ0A 1VDZA 3TBIB 2HCCA 2R92B 1EZ6A 4OO1H 1RTNA 3R93A 3U9OA 2AUKA 2J7ZA 1RODA 1TS4A 4H44C 2DN8A 1SNMA 3SEBA 3WOFA 2K5WA 2KCCA 2B39A 2L11A 2PNRC 2XRSD 1WVLA 1WTVA 1A2UA 3T13A 1VMPA 1TWFB 1KNEA 2QF7A 3LWUA 4RGMA 1L0YB 1QG7A 3OOCA 2C5CA 2XIWA 1B1ZA 2SOBA 1A6XA 4HSVA 4CHTB 1G6ZA 2ID0A 1PZKD 2B2TC 4ID6A 1F77A 2F0UA 4QF4A 5I6YA 1GUWA 3MXNA 1I6HB 2L9HA 3KK7A 5LL6X 1WTRA 3M4OB 5KNCA 4NP5A 1HQMC 2V4DA 1DOKA 1F9PA 4IFDG 3CU7A 3OMCA 4OIKA 2L1BA 5ISRA 3M7NA 1CZWA 4B08A 5JAVA 1FYCA 2X6LA 1XX8A 4XXEA 3K5OA 4EQPA 1GJXA 2K04A 1QB5D 3RZDB 5EQ0A 4MIUA 4BA2I 1S4ZA 4IUUA 5C4XB 1TWGB 3K5MA 1XYIA 2ENBA 3HOVB 4U68A 4FF3A 3N52A 4BBSB 1LT5D 1I3QB 1ILQA 1Q90A 2NN6I 5C44B 4LJZC 3NUCA 4CJ0B 1HA6A 3PUWA 1AZQA 1Q12A 1LTBD 2F1MA 5F2DA 1QCBD 3RMHA 4K2LA 4C3IB 3H09A 1VF7A 5BN5A 4IURA 4XQQA 1LO5D 2IWHA 1EQVA 1STNA 3MEHA 2K5DA 2RSNA 4QMGA 2EJGC 3K7AB 5C4JB 3WDNA 2BE5C 2R6GA 2F4IA 2DY8A 1PZJD 1F9QA 1KDAA 4QCLA 2K32A 1MSGA 1EEFD 4B9WA 4L8JA 1YNJD 1FNWA 3D4WA 2I07B 4KKSA 2MGSA 2WP8J 5IGGA 4IUNA 2LFNA 5A2QL 4A3JB 3CRLC 4Q0FA 3TP5A 3A55A 3NTIA 2BA1A 1IW7D 2XSCA 5HGTA 1MGSA 1B4OA 2ZT9C 4O1NA 2B2UA 4OL7A 3SK4A 1SNCA 4R8IA 1PFNA 3I4NB 2K6AA 3NWTA 4A3DB 2EVBA 4C3HG 5EGTA 2OXPA 2NN6G 3BZDB 2CHBD 1OXXK 3UI2A 3GO5A 1H9RA 4YIJA 1SE3A 1ZEQX 2LY7A 4J6HA 1SMYC 2SNSA 2A69C 2F0HA 5D3DA 1A3UA 3I4LA 3MTSA 3VR2A 4DAYA 2R93B 1YNNC 2AQ1B 2F0KA 1G2TA 4KV6A 1O80A 2QEJC 1PTOF 1Z7TA 3BYYB 4G4KA 1SJHD 1BNZA 1SXTA 5ELFA 1HXYD 4HAEA 3FPPA 2F0DA 3SR1A 1ZXTA 4M1UB 1TWAB 4A3MB 1KABA 1SBBB 3GD7A 4FXGC 4KI0A 3S1NB 4KMUC 3P75A 3KLRA 1WTXA 4A3GB 1CTMA 4K6LA 3HEJA 1CA6A 4ZKBB 4DAPA 2B2YC 5JJZA 4JK1C 3C1FA 2BDOA 2WV6D 1ZKOA 3GTMB 3BDLA 2PYKA 2KA7A 2M00A 3X3MA 1V1PA 1PTOC 4BY1B 1PYWD 1PFMA 2F0MA 2FINB 3FDTA 5IGDA 1R4QB 1O7YA 3HOXB 1A3TA 3ZYYX 2HCIA 1I4XA 5CV8A 1SYFA 3BVMA 5DEHA 3DMUA 3NQIA 2KVMA 4QUCA 3IL8A 2YU9B 3G7LA 1BDOA 4PV1C 3X3NA 5M9OA 2N55A 3CRKC 2FFKB 3S16B 1CT1D 1DZ1A 4XYOA 5ELCA 5IT9E 5I9OA 3N6RA 3VR3A 1K83B 5KIXA 5I4DA 5EKLA 1QNUA 5C3XA 3DXJC 4KTAA 5KEEA 5EJWA 1C48A 1S5ED 4HMJA 2EZVA 1FR3A 4ABNA 4K2KA 5JEAJ 1K8MA 4L6TB 2EYMA 1B53A 2WINB 1BCPF 4HSPA 4EVOA 4EQOA 2XVSA 1QJOA 5M3MB 1G291 2RSOA 3CQZB 2EYLA 1NAPA 1DXMA 1SAPA 1KNAA 1W6JA 4C1NI 1SYDA 2RDFA 2WAQB 1BBXC 4KD3A 1SYBA 4IUVA 2VUMB 2O2LD 2VB3X 4PMWA 3R2IA 1G8ZD 5A35A 3H94A 1ILPA 3GV6A 3MVVA 2K05A 5ELBA 2ZXPA 1V8QA 2BDNA 3I4MB 2F3VA 2E74C 4FNFA 1GUGA 3GV3A 1DYQA 1RTOA 5J39A 1QE6A 1V1PB 2FHTA 5IGEA 2F0GA 3FEWX 2B63B 1BCPC 1HQRD 2OF1A 2MUYA 2D5DA 3T4AC 2EYHA 5K36H 3J7YW 4TSSA 4LAAA 3D6CA 1Y8OB 2EJMA 3TZUA 2VXWA 1DOLA 1PZID 1S5DD 4FXKC 5C4ZA 1Q1EA 3ONAB 4WFN3 1M8AA 2KHSA 3RZOB 5IGCA 1JCKB 3RLFA 1ET9A 1EY7A 2KEEA 2AQ2B 5JEAH 3C46A 5C5LA 5CV9A 1I4HA 3FRPB 3GTLB 4CJ1B 1PXUA 3A7LA 5CR3A 1WTQA 2EY1A 1JOQA 1ICWA 1RKNA 4IFDI 3GTPB 1BF4A 3MZ5A 1EYCA 1EQTA 3QO2A 4M8AA 4EQNA 4C3JG 5CBAE 1D5MC 4IFDJ 2H1EA 4K14A 3DUZA 2Q8IB 1BXTA 5CV4A 1V43A 1J8IA 2EYPA 3PIO3 1ET6A 1ML0D 1Q8IA 3EVQA 4OO1G 1AZPA 1WD1A 2FMMA 4K5WA 5HURA 2K01A 2IX1A 4XIGS 4G7ZC 5EPJA 5IGFA 1JWMD 2BOSA 2B2VC 1Z47A 1I50B 3HZXA 1D5XC 2RBMA 1TWHB 4Z9CB 4DU9A 3Q23A 5E4XA 3LX0A 2K28A 1E2WA 3K6OA 3ND8A 1LTSD 2ZXOA 1O78A 2LS01 3MC0B 3OIPA 3K58A 2K5QA 3GTQB 4KY6A 5BN3A 3KLSX 2EYOA 4UAIA 2WIIB 2SDFA 2NTTA 2R61A 2RA4A 3I91A 1HRJA 2MP1A 3MA2B 1AEXA 1QOHA 3M4YA 1HUNA 2Z8LA 1HTLD 2A6EC 1LABA 3WOEA 3G6JB 3A7AB 3IAYA 3AMUA 3OWEB 3NQTA 4RA8A 3EFXD 2VB2X 5CC4A 1SNPA 4IFDH 4TKOB 3EJIA 3PIP3 1WD0A 4N9PA 4OHJA 1SYEA 3D8GA 1PFBA 1IYVA 4RGOS 4C1NK 1GOZA 3PV0A 4HCSA 4IZ8A 3DHQA 4ZAIA 4FF2A 1CM9A 3HS0C 2NVYB 3KBGA 5IT9L 2F0SA 5D65A 4FF4A 2OT2A 4IN3A 5KYLA 2HDLA 2CW0D 2ZXRA 1LT3D 5JPNC 1IYUA 3SK8A 4A3EB 1ESRA 1LT6D 2B2WC 2M9VA 3GTKB 2DNCA 4DN4M 3A56A 2MJ8A 4DXFA 5E1FA 1B3AA 3D4RA 1TY2A 4HN7A 2IW3A 3S17B 1EY0A 3PUXA 2EY2A 1UAPA 4K5VA 1STYA 5M3FB 5AFWA 1XWEA 3H0GB 3T53B 4NMZA 5COYA 3D3RA 2D62A 3BYTB 2K03A 3H3VC 3GTOB 2BE5D 2K7VA 5EKIA 5EPLA 3SVMA 1CQVA 2X69A 3A54A 4DNRB 2JSOA 1RDPD 1KLUD 3O13A 4LMQD 3AB9A 2YYZA 1YNJC 2EJFC 4X3TA 4Q5VA 5J22A 2PZTA 3DEOA 5IODA 1U4LA 3EQLC 3PMFA 3TP6A 4NKLA 2NTSA 2WACA 1STHA 3Q22A 1UUPA 2B2YA 1JICA 3DWPA 4J1MA 4C56C 2E2DC 4IUTA 1IW7C 4RKLA 5C0XG 1IHZA 2NVTB 4FYDA 1F2LA 1MBYA 3J7AV 5KGUA 3FKIB 2A68C 4XT1B 1D6EC 3A8IE 3QOJA 3E0JA 3P1HA 1SE2A 5LL6S 2IX0A 1FNVA 1KTKA 4RWSC 3OIQA 5C5MA 3S2HB 1WTOA 1PRTD 2NN6H 1SMYD 1AFPA 3L3OC 4EGVA 4WJWA 4F8MA 2A69D 3VYSA 4QB4A 3D6WA 1YNND 1TU2B 2Z4IA 1SJED 1AN8A 1EWCA 5KNDA 4X3KA 2PMZB 1OXSC 4CKBA 2F0FA 5C3WA 2KQ3A 3DWQA 4N9TA 4RAUC 2X6GA 1F2MA 1ZYRD 3HOWB 2QDBA 4XT3B 1I4PA 1EZ8A 2O4XA 4ZYSA 2F0LA 1PRTB 1EU4A 1EY8A 1SE4A 2NB0A 4NW2A 1U4PA 4KN4C 4ZK9B 1RF2D 5C6AA 1TIID 1G2SA 3W3AA 5D3IB 1GUTA 2IL8A 1KDBA 1RD9D 1Q1BA 3L9AX 2EXZA 2NVXB 1PLFA 4RKBA 3I73A 2F0TA 1EY9A 1BO0A 5DM73 5E4WC 3MHBA 3K59A 3OSOA 3VR4A 1ESFA 4I65A 3J80E 2EOTA 4KD4A 1PTOD 4ZUIA 1VMCA 1J9OA 1JORA 1VCIA 2WKDA 1H9SA 5CMDA 4DNTB 3M7GA 1NUCA 1EWHA 4A93B 3VR5A 1D5ZC 1JWSD 1SEBD 3H91A 1AP0A 1HA5A 4QIWB 5DAUA 3S15B 5G3LD 3V96A 4K6DA 3J7AF 1PTOB 4JBWA 3D4DA 2G9HD 3MXPA 2BCOA 2A6HC 3JAME 1DM0B 3OHXC 1G91A 1EFID 5KNBA 3QJYA 1HUMA 5M5XB 3W2DA 3TMEA 3OPOA 2D9UA 3J81E 2RVLA 2L0CA 1F2YA 1KLGD 3I72A 1H9KA 4KY5A 3R3OA 3S1RB 3H6MA 4FO2A 1CHPD 5LHY1 1LTTD 2JA8B 5NUCA 2MPMA 2NBFA 4F88A 3GP7A 3BDOA 2JEBI 3TSSA 1HPCA 3OWFA 1NSNS 3NSWA 4RCNA 5JOBA 2LMCB 1WTPA 1FNUA 3KBXA 1IL8A 1STBA 4DFAA 5IGBA 1R9TB 3MXGA 4KHZA 4RH6A 4HR7B 1ONLA 3TN2A 2NVQB 2EDGA 4CGYB 3PUZA 5JVG3 3VYTA 2JP1A 3NXWA 1C8CA 1S5FD 4OO1I 3R2TA 3SXHA 1I4QA 3V05A 4KJOA 5A2QE 2A73B 3MAQA 2E2IB 4C3IG 1DONA 2PQEA 5I2XA 1QNKA 5K36G 2SEBD 3ERQA 4TQUS 4DXGA 2XWBB 4RCOA 4DA2A 4C3HB 2Z4HA 4K8IA 2E2JB 4AYBB 2JA5B 2B2VA 1A2TA 3I90A 2TSSA 4NDXA 2PZUA 1DCZA 2KJXA 4ILWA 5JPMC 3R8BA 2L5TA 4H13C 3HOUB 1A3VA 2SNMA 5FO7B 1Y8NB 4KHVA 4ZRZA 1EIHA 3L7ZC 2CQAA 4IUPA 1SFOB 4FXDA 3VYRA 2F0IA 3MFYA 5I6WA 3IFTA 1CHQD 3ND9A 4O42A 2K33A 3QB3A 2B8GA 3K0YA 3NP8A 4CBVA 1CA5A 4XTCS 3NE5B 1EOTA 1RCVD 3I3CA 2QKIC 3LWEA 1EEID 1TS3A 2XWJB 3A8JE 1GXDC 1GUNA 2G9DA 4C2MB 2QCPX 1D1KA 2MHVA 1VF5C 2NYZD 2RKSA 4DF7A 4X3SA 4G7HC 1U4RA 3IKJA 4LK1C 4BS9A 1EIGA 4GZYC 4G57A 1EY6A 1Y69U 3T56B 2XNAC 3TZDA 5CGKA 4ODGA 1Y1WB 3MWYW 3C3LA 1CZGA 1LTID 2OEOA 1U9RA 2ICEC 3S1QB 1O7LA 2O5JC 1H9JA 2DY7A 3P20A 5ELEA 1TS5A 3QIAA 2F03A 2B2WA 1JB3A 1STGA 1NCVA 3VYUA 2J0TD 2L12A 3TP7A 1K8OA 5EBCA 3BVZA 2KCNA 5CV5A 3BDCA 3HKZB 2D2CC 1DD2A 4DK1A 5I9PA 1TKWB 1UEAB 1S5CD 2F3WA 4OIJA 3DM1A 3RD4A 5C4HA 1OXTA 1MI2A 1ENCA 3J80L 1KAAA 1SNOA 4RGTA 4B9XA 1TS2A 3LNNA 1KDCA 2E75C 2FJ2A 4UDUC 1TVXA 2PPBC 2NWGA 1ENFA 5CV6A 3PO3B 3Q6SA 2A6ED 2GA4B 2M2LA 1RJTA 2Q8RE 3QOLA 4F7XA 2PW5A 5C0XI 4E6IA 5DNFA 4DAVA 4HTHA 3DWAA 3JAML 1R4PB 4IALA 4DGZA 1EY5A 1STAA 4FP5D 3BVGA 1WTWA 2AWNA 5C0XJ 3EA6A 1HTPA 1PTOH 3J81L 1T5XD 5FK9C 2CVRA 2CW0C 4XQJA 3BS1A 4G7OC 2F0JA 3PUVA 3KF8A 3K57A 1O7ZA 1Z6HA 1UNSA 1B50A 2ICIA 3E6ZX 4CJ2C 1X32A 2LKVA 4ME5A 2RDGA 1E2VA 1LTAD 1SNQA 2PO4A 2BA0A 5E3FA 2QILA 1LACA 5K5PA 3NHHA 5FKAC 5IOCA 3QG1A 1CK1A 5CORA 3SDZA 3RUZA 1I4GA 5ELDA 5EPKA 3TDQA 2JYOA 4QUFA 1Y1VB 2F0OA 3NBHA 3F2UA 4ULLA 4HMIA 4WORA 2Y0SB 3HOZB 2AUJD 3FVQA 1F2ZA 4XDXA 4PMCA 1PRTF 3C1EA 5TSSA 1LV9A 2PZWA 1JWUD 3I70A 1JC7A 3QWNA 1GUSA 2RDHA 3PO2B 3GTGB 4A3BB 5J1ZA 2F0WA 4BBRB 2XN9C 1PMRA 1Q3LA 4KY7A 3GTJB 5C0XH 2A68D 4PQXA 2K1BA 3PUYA 2I46A 4C3JB 2IPKD 5C3EB 5FLXE 1W6KA 1H9MA 1HFGA 3M3YB 1L0XB 3KUPA 4S3SA 5D14A 3NPPA 1NR2A 4ZUJA 1PDQA 2E2HB 1JE4A 4H7BA 1XTCD 1Y8PB 1FGBD 3S1MB 1SYCA 1IKMA 2R7ZB 5FO8B 1PRTC 1EL0A 4MN3A 4IUQA 1B2TA 5CYUA 5KRUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SK5 A;  4EQN A;  3NHH A;  2F0M A;  3VA5 A;  3NQT A;  2ENB A;  5IOC A;  4K8J A;  3PMF A;  3TP6 A;  3U9O A;  1ENC A;  1KDB A;  5NUC A;  4NKL A;  2EYJ A;  5CC4 A;  1KAA A;  5IIF A;  1SNP A;  1SNO A;  2WAC A;  2F0I A;  1STH A;  2EXZ A;  1A3T A;  3OMG A;  4RKB A;  4K14 A;  2OXP A;  4PMB A;  5CV8 A;  5EGT A;  4B9X A;  1SNM A;  1SYF A;  2F0T A;  3DMU A;  5DEH A;  3RUZ A;  3EJI A;  1EY9 A;  1KDC A;  3MVV A;  4N9P A;  5I6W A;  2EY6 A;  1SYE A;  3D8G A;  4KJN A;  5CV4 A;  2F0N A;  4J1M A;  1SYG A;  1ENA A;  3NUC A;  2F0V A;  2EYP A;  4YIJ A;  1A2U A;  3SK6 A;  3QB3 A;  3T13 A;  3OWF A;  4PNY A;  3MHB A;  1NSN S;  3NP8 A;  4RKL A;  3OSO A;  4J6H A;  2F3V A;  4IZ8 A;  3DHQ A;  2SNS A;  1IHZ A;  4I65 A;  5JOB A;  5F2D A;  5CV6 A;  4KD4 A;  2F0H A;  3EVQ A;  3S9W A;  1A3U A;  1STB A;  2F0O A;  4DFA A;  5J22 A;  5J39 A;  4K2L A;  5IGE A;  2F0G A;  4ZUI A;  4K5W A;  5IGB A;  4HMI A;  4WOR A;  2EYF A;  5KGU A;  2F0S A;  5HUR A;  2F0Q A;  1EYA A;  5IOD A;  2OF1 A;  3ERO A;  5KYL A;  1TQO A;  2F0K A;  5M9O A;  5IGD A;  2EYH A;  2SOB A;  4KV6 A;  1F2Z A;  3QOJ A;  4TRD A;  1JOR A;  3SHL A;  2RKS A;  5IGF A;  3TP8 A;  4PMC A;  4R8N A;  4DF7 A;  2F0E A;  1JOK A;  1TT2 A;  3SK8 A;  3P1H A;  3QOL A;  1EQV A;  1STN A;  3NK9 A;  4LAA A;  3C1E A;  4F7X A;  3MEH A;  3D6C A;  2F0P A;  2PW5 A;  1NUC A;  3NXW A;  4QMG A;  5I9O A;  2PZW A;  4ID6 A;  4G57 A;  3HZX A;  4ZQ3 A;  1EY6 A;  4E6I A;  5KIX A;  5E1F A;  2HQE A;  2F0D A;  2F0U A;  5EKL A;  3SR1 A;  5C5M A;  2RBM A;  3SXH A;  4HTH A;  4QF4 A;  1KDA A;  4KJO A;  5I6Y A;  1KAB A;  4DU9 A;  4IAL A;  5C3X A;  4KTA A;  4ODG A;  4DGZ A;  4B9W A;  4F8M A;  3LX0 A;  5C4Z A;  5J1Z A;  1EY5 A;  1STA A;  3D4W A;  5DAU A;  5KEE A;  2F0W A;  4NP5 A;  4QB4 A;  4WRD A;  2KHS A;  4K6D A;  5IGG A;  1EY0 A;  2OEO A;  5IGC A;  4KY7 A;  5CV7 A;  4IUN A;  1U9R A;  2PQE A;  2EY2 A;  3P75 A;  4HMJ A;  3OMC A;  4K5V A;  1STY A;  4KY6 A;  3D4D A;  4K5X A;  5ISR A;  3MXP A;  3ERQ A;  1EY7 A;  3TP5 A;  4K2K A;  2PW7 A;  3HEJ A;  5CGK A;  5JAV A;  2EYO A;  1II3 A;  4NMZ A;  2F0F A;  4S3S A;  2EYM A;  5C5L A;  5C3W A;  5CV9 A;  4K8I A;  2KQ3 A;  1A2T A;  4N9T A;  4ZUJ A;  1SND A;  1TR5 A;  2F0J A;  4H7B A;  3C1F A;  1STG A;  4NDX A;  4EQP A;  3TME A;  2PZU A;  4EVO A;  2PZT A;  3V2T A;  3BDL A;  4EQO A;  1F2M A;  4KHV A;  1SYC A;  5CR3 A;  3TP7 A;  5HGT A;  2PYK A;  2LKV A;  5EKK A;  4ME5 A;  5KYI A;  1AEX A;  2EY1 A;  2EYL A;  1F2Y A;  1JOQ A;  2M00 A;  2QDB A;  3ITP A;  1EZ8 A;  1RKN A;  1JOO A;  4KY5 A;  2O4X A;  2NUC A;  1SNQ A;  3R3O A;  5CV5 A;  3BDC A;  2F0L A;  1SYD A;  4MIU A;  4OL7 A;  1A3V A;  1EY8 A;  3SK4 A;  3E5S A;  3MZ5 A;  5I9P A;  1EY4 A;  2SNM A;  1EZ6 A;  1EYD A;  1EYC A;  2RDF A;  3T16 A;  1SNC A;  4KD3 A;  5E3F A;  2F3W A;  3H6M A;  5KRU A;  5C6A A;  1SYB A;  5C4H A;  5K5P A;  2EY5 A; 
#chains in the Genus database with same CATH topology
 4JV5 L;  1W3S A;  4JOI C;  4CDC C;  2L4N A;  4K8J A;  3M4Q A;  5I2Y A;  3HRZ C;  3OMG A;  4RHR A;  1IKL A;  4HJ8 A;  2ZTE A;  1X3Q A;  2F0N A;  3AFP A;  3FMC A;  1HR0 W;  4DV3 Q;  1LT4 D;  3JAM i;  3KF8 B;  4OWT B;  1HHV A;  1BR9 A;  5M5Y B;  4R9W A;  2JE6 I;  4ZLT F;  1ZYR C;  4LFB Q;  4ME3 A;  1E2Z A;  2VS1 A;  2OTL A;  3PF5 A;  1JQY D;  3BZK A;  3J81 i;  2EYF A;  4KKU A;  3PSI A;  2EPB A;  2F0Q A;  1EYA A;  4KN7 C;  1SRO A;  1E22 A;  3K5N A;  2N78 A;  3U58 A;  5JJK A;  4MTK A;  5BN4 A;  5EBD A;  4ZKC B;  2HT1 A;  2VNU D;  3DLL A;  3S14 H;  1GHJ A;  3NK9 A;  2A5H A;  4A3I H;  1C4Q A;  4IQZ A;  1S5B D;  3CCS A;  2YTY A;  4RHS A;  4F87 A;  4U67 3;  1WCM B;  5G3L F;  5M5W H;  1MSH A;  4YHH Q;  4DK0 A;  3HG9 A;  4X3U A;  2WKC A;  1N33 L;  4KKT A;  2B2U C;  3Q24 A;  3MFG A;  3CC7 A;  4P2C B;  3SE0 A;  1RIP A;  4WRD A;  5FJ8 H;  4A3K H;  2L55 A;  2B8F A;  1JJC B;  2C35 B;  2CH4 A;  4K5X A;  3CP0 A;  1GM5 A;  4X65 Q;  2R92 H;  3NTK A;  3ERS X;  4BY7 B;  4DR1 Q;  1BUV T;  5DM6 3;  1SND A;  2WB1 B;  1OXV A;  4P71 A;  2JEA I;  1GHK A;  2RHS B;  3HOY B;  5EKK A;  1B9M A;  1HZB A;  3URY A;  4JBK A;  1VQK A;  3ITP A;  1D1I A;  1JOO A;  1UEB A;  4LF9 Q;  1PYS B;  4KK7 A;  4B3M Q;  3E5S A;  2HDM A;  3T51 B;  3T16 A;  1TWF H;  2PQA A;  2FXQ A;  2EY5 A;  2HD3 A;  2XRQ D;  3VA5 A;  1OXU A;  2A6H D;  1F9R A;  1XXG A;  1I4R A;  2EYJ A;  1VQA A;  4B3T Q;  3ZJY C;  3HKS A;  4PMB A;  1QWY A;  2KEC A;  1JR0 D;  1PH2 A;  1BOS A;  2EY6 A;  3P7J A;  1ENA A;  4XYQ A;  1B3Q A;  3SK6 A;  3FPU B;  2JA7 B;  3D0F A;  4PNY A;  2E76 C;  2HUG A;  1DJR D;  2C9O A;  2JA6 B;  3AYH B;  2UUB L;  1FL0 A;  2KOL A;  4L63 B;  1X3P A;  3W1B A;  4YWK A;  4RFB A;  2HIV A;  4NPS A;  1CQF A;  3NBI A;  4HIO A;  4CKE A;  3T1H L;  1YJW A;  1K3B C;  4Y7N B;  3Q0A A;  3CKI B;  1RHP A;  1I94 L;  1X3F A;  3ERO A;  4DR2 L;  1E0B A;  1HFN A;  2AQ3 B;  4TRD A;  5T1I A;  4YY3 L;  4JI5 L;  5JVH 3;  4R8N A;  1VQF A;  1JOK A;  1TT2 A;  2UUC Q;  4KHP L;  3OW2 A;  2F0P A;  3DM3 A;  3VR6 A;  4J15 A;  1PH4 A;  2Z1C A;  1CI3 M;  4ZQ3 A;  1GUO A;  3PF4 A;  4DV0 L;  3AQQ A;  1IBM L;  2HHH L;  4OGQ C;  4AQY L;  3M85 A;  2J4X A;  4BA1 I;  2Q8T A;  1SSO A;  3TRZ A;  2WB1 E;  2EE1 A;  3ER0 A;  3C2P A;  4LF6 Q;  2O5I C;  2NZ1 D;  4P74 A;  3RZD H;  1FD7 D;  2JXM B;  1EU3 A;  4JI3 L;  1MD2 D;  2Z6B A;  2K5H A;  2PW7 A;  3K5L A;  5IP7 H;  1I6V C;  4A3E G;  4LUO A;  1EOV A;  4JCV E;  4CKC A;  5C4X H;  1TWG H;  3I8Z A;  1TR5 A;  4BWG B;  2DNE A;  3VA7 A;  2N88 A;  3KDF B;  3V2T A;  3HOV H;  4J8Q A;  2KUM A;  4BBS H;  1I3Q H;  2B3G A;  4DV5 Q;  3S2D B;  2NUC A;  4A3F B;  1STE A;  5C44 H;  1BCP D;  3OW7 A;  1DOM A;  1EY4 A;  1EYD A;  4HCE A;  2QW7 A;  1FVI A;  2IX3 A;  1PH8 A;  1U4M A;  1N32 Q;  2RQX A;  1JE5 A;  2R3Z A;  5M3F G;  4LUZ A;  3SK5 A;  4WJ4 A;  4JI2 Q;  3H0G G;  1H9S B;  4OWX B;  5IIF A;  2IT1 A;  4XQN A;  3CCE A;  4C3I H;  3CHB D;  3GQB A;  3LGJ A;  5FO9 B;  1TWC B;  3UE1 A;  1M4V A;  2FMC A;  5IP9 H;  4KJN A;  4OXP A;  3ULL A;  1HCZ A;  1SYG A;  2F0V A;  3BG3 A;  1F9S A;  1HJP A;  5E7N A;  3RR5 A;  3NWS A;  1N34 Q;  3NTH A;  1XNQ Q;  5HY6 A;  4MHE A;  1B44 D;  3S9W A;  3K7A H;  5C4J H;  2BH8 A;  1D2B A;  5JEA G;  1Y1V H;  3A8K E;  1BCP B;  4GOP B;  1YHB A;  2QGQ A;  3G6E A;  3G48 A;  1TQO A;  3HOZ G;  2PQA B;  4H0L C;  5CBE E;  1XNR Q;  5L37 A;  3SHL A;  3TP8 A;  4I7Z C;  4DAM A;  2F0E A;  4RGN A;  1V1O A;  2JK8 A;  4YHH L;  4NXM Q;  1QIL A;  4V19 0;  4HED A;  1A15 A;  1VQD A;  3Q8D A;  5T1G A;  1SDF A;  4A3J H;  3MXU A;  2ATW A;  1EIY B;  1X54 A;  2WAQ E;  3D31 A;  3HGB A;  1N36 Q;  2HQE A;  2B2T A;  3IFD A;  4TVA B;  1N9W A;  5FLX L;  3HP3 A;  1LLR D;  3DEP A;  3KLS A;  5FOB B;  4NXN L;  1L1O A;  1CFM A;  2VL6 A;  4X65 L;  1LTG D;  1T5E A;  1NR4 A;  4GKJ L;  2MNA A;  1B9N A;  3GTG H;  5LMN L;  3S14 B;  1TY0 A;  5CV7 A;  3FKI G;  4A3B G;  2AWO A;  4FVM A;  2KHJ A;  4JI1 Q;  4A3I B;  1LTR D;  2KED A;  1IYJ B;  2AMC B;  2A74 C;  1BQQ T;  4V0B A;  2TMP A;  1AW7 A;  5M5W B;  1II3 A;  3U9S A;  4FF1 A;  1JJ2 A;  4JI0 Q;  3M3Y H;  3I4N H;  2PCF B;  2H4O A;  3KYH C;  4P75 A;  4A3D H;  1OO9 B;  4A3K B;  3AU7 A;  5KYI A;  2IJ0 A;  3S1M H;  1VDZ A;  3TBI B;  1ASY A;  2HCC A;  2R92 B;  2E8G A;  4GN4 B;  3CCJ A;  5IYD H;  4A3L H;  1EZ6 A;  4OO1 H;  2RF4 A;  4B3T L;  1RTN A;  1PH6 A;  5GAH C;  3L2P A;  3R93 A;  2R93 H;  3U9O A;  2AUK A;  2J7Z A;  1ROD A;  1TS4 A;  1OTC A;  4H44 C;  2DN8 A;  4PZ6 A;  1HNZ L;  1S72 A;  2OCE A;  1SNM A;  3SEB A;  3WOF A;  2K5W A;  2KCC A;  2B39 A;  2L11 A;  2CCZ A;  2PNR C;  2XRS D;  1WVL A;  1WTV A;  1MJC A;  1A2U A;  3T13 A;  4GLA C;  1VMP A;  4DV1 L;  1E7Z A;  1TWF B;  3HOW G;  4OWW B;  4DR3 Q;  1NNX A;  1KNE A;  1VQB A;  2QF7 A;  3LWU A;  2OWO A;  4RGM A;  1Z9F A;  1L0Y B;  2PNH A;  3PCO B;  4GNX A;  1QG7 A;  3OOC A;  4IOC A;  1PYB A;  2C5C A;  2XIW A;  1TWA H;  4A3M H;  4L5Q A;  1B1Z A;  2SOB A;  4JV5 Q;  1A6X A;  4HSV A;  4O0A A;  3S1N H;  4CHT B;  1G6Z A;  2ID0 A;  1BVS A;  1PZK D;  2B2T C;  4MZ9 A;  4A3G H;  1ICF B;  4GS3 A;  4ID6 A;  5GQO A;  1P16 A;  1VQN A;  4R1J A;  1F77 A;  2F0U A;  2JN4 A;  3UDX A;  4QF4 A;  5I6Y A;  1GUW A;  3MXN A;  1I6H B;  3T1Y L;  2R7D A;  2L9H A;  3KK7 A;  5LL6 X;  5AJ3 L;  1WTR A;  3M4O B;  3GTM H;  5KNC A;  4NP5 A;  1HQM C;  2V4D A;  3BJU A;  1DOK A;  1F9P A;  4X62 L;  3CU7 A;  4IFD G;  4JYA L;  4POG A;  3OMC A;  4OIK A;  2L1B A;  5ISR A;  1U5K A;  3M7N A;  3CMA A;  1CZW A;  4B08 A;  5JAV A;  1FYC A;  3F2D A;  2X6L A;  4BXX H;  1TXY A;  1XX8 A;  1SR3 A;  2ZJQ A;  4XXE A;  4DV5 L;  5IT9 c;  2QDL A;  4A93 G;  3K5O A;  4EQP A;  1E3P A;  1GJX A;  2K04 A;  1QB5 D;  3HOX H;  2UXB L;  3RZD B;  5EQ0 A;  3HOY H;  1N33 Q;  4MIU A;  4BA2 I;  1VQI A;  3G4S A;  1S4Z A;  4IUU A;  5C4X B;  1TWG B;  3K5M A;  1XYI A;  2ENB A;  3HOV B;  4U68 A;  4FF3 A;  3N52 A;  1PH7 A;  4BBS B;  1LT5 D;  1I3Q B;  1ILQ A;  3E9I A;  1Q90 A;  2NN6 I;  5C44 B;  1HNW Q;  4LJZ C;  3NUC A;  4RG1 A;  1PH9 A;  3S16 H;  4CJ0 B;  4POF A;  1HA6 A;  2KCT A;  3PUW A;  1AZQ A;  1WJJ A;  1Q12 A;  1K0R A;  1LTB D;  2F1M A;  2Z0S A;  5F2D A;  3E0E A;  1QCB D;  1NMG A;  3W1G A;  3RMH A;  2JA7 G;  2K5V A;  3STB C;  4K2L A;  3CC2 A;  4C3I B;  3H09 A;  1VF7 A;  3L0O A;  4NB3 A;  5BN5 A;  2JA8 G;  4JG2 A;  2K5N A;  4UPA A;  2UXD L;  4IUR A;  4JOI A;  3EIV A;  4XQQ A;  1LO5 D;  2IWH A;  1EQV A;  1STN A;  5FLM G;  5EAY A;  1VQ7 A;  3MEH A;  2K5D A;  2DUD A;  2R7F A;  2RSN A;  4QMG A;  2EJG C;  1VQ4 A;  3K7A B;  5C4J B;  3WDN A;  2BE5 C;  2R6G A;  2F4I A;  2DY8 A;  1PZJ D;  4DK3 C;  1F9Q A;  2YTV A;  1KDA A;  2CWP A;  4QCL A;  4JI1 L;  2K32 A;  1MSG A;  1EEF D;  2UUB Q;  4B9W A;  4L8J A;  1YNJ D;  1FNW A;  3D4W A;  2I07 B;  4KKS A;  2MGS A;  4P72 A;  1XPR A;  2WP8 J;  5IGG A;  1UE1 A;  5M3M H;  4IUN A;  1PH1 A;  3CQZ H;  2LFN A;  3T1H Q;  4JI0 L;  5A2Q L;  4DV7 L;  4A3J B;  3CRL C;  4Q0F A;  2D0O A;  3TP5 A;  1I94 Q;  4IJL A;  3A55 A;  4DR2 Q;  1VQ6 A;  4YY3 Q;  4IPH A;  4JI5 Q;  2G5D A;  3AFQ A;  3NTI A;  4KHP Q;  2BA1 A;  1IW7 D;  2VUM H;  2XSC A;  4FDB A;  1EQQ A;  2RCF A;  5HGT A;  1MGS A;  1B4O A;  4QJF A;  2ZT9 C;  4O1N A;  2B2U A;  1B70 B;  4OL7 A;  3SK4 A;  3MXN B;  1QVC A;  4DR5 L;  1SNC A;  4R8I A;  1PFN A;  3I4N B;  3TRE A;  2K6A A;  3VDY A;  3NWT A;  4JI3 Q;  4A3D B;  2YV5 A;  2B63 H;  1VQP A;  1G51 A;  2EVB A;  4C3H G;  5EGT A;  2OXP A;  4AYB G;  2NN6 G;  2H5X A;  4DR3 L;  3BZD B;  2CHB D;  1OXX K;  3UI2 A;  1O7I A;  4L5S A;  4APV A;  1K28 A;  3GO5 A;  4DUZ L;  1H9R A;  4YIJ A;  1FGU A;  3A0J A;  2NZH A;  4PG3 A;  1SE3 A;  1ZEQ X;  2LY7 A;  4QQB X;  2HQL A;  2MO1 A;  4J6H A;  1SMY C;  2SNS A;  2A69 C;  2F0H A;  5D3D A;  1A3U A;  2Q2I A;  3I4L A;  3MTS A;  3VR2 A;  4DAY A;  3CPW A;  3HOU G;  1MIU A;  2R93 B;  1YNN C;  1L0W A;  1QUQ A;  2AQ1 B;  2F0K A;  1G2T A;  4KV6 A;  1O80 A;  2QEJ C;  1XMQ L;  1PTO F;  1HH2 P;  1Z7T A;  4A3C H;  4Y52 H;  3BYY B;  4G4K A;  1SJH D;  1BNZ A;  1SXT A;  2PI2 A;  5ELF A;  1HXY D;  4HAE A;  3RN2 A;  4DV2 L;  3FPP A;  2F0D A;  4X66 L;  1LUZ A;  3SR1 A;  1ZXT A;  4M1U B;  1TWA B;  1KRS A;  1CSQ A;  1S3O A;  4A3M B;  1KAB A;  1SBB B;  5IYB H;  3GD7 A;  4FXG C;  3GTL H;  4IPC A;  3KF6 A;  4KI0 A;  3S1N B;  2ZTD A;  4KMU C;  3P75 A;  3KLR A;  1WTX A;  4A3G B;  1CTM A;  2K50 A;  2CQO A;  1YIT A;  1SRU A;  4K6L A;  3GTP H;  2DJG C;  3HEJ A;  1CA6 A;  3QR8 A;  4ZKB B;  4DAP A;  3M9B A;  2B2Y C;  5JJZ A;  4JK1 C;  3C1F A;  2BDO A;  2WV6 D;  4JVZ A;  1ZKO A;  3GTM B;  3BDL A;  3CME A;  2EIF A;  3CCQ A;  2PYK A;  2KA7 A;  2M00 A;  3X3M A;  1V1P A;  3NBH B;  1PTO C;  4A3K G;  1Y1W G;  2XGT A;  4BY1 B;  4NXN Q;  1PYW D;  4GKJ Q;  1PFM A;  2R92 G;  5LMN Q;  2ZM6 L;  4DV6 Q;  1PH3 A;  3M4P A;  2F0M A;  1HNW L;  2FIN B;  3FDT A;  5IGD A;  4R4I A;  1R4Q B;  1O7Y A;  3HOX B;  1A3T A;  3ZYY X;  2HCI A;  3U4Z A;  1I4X A;  5CV8 A;  3CCV A;  1SYF A;  3BVM A;  5DEH A;  3DMU A;  3NQI A;  3CCR A;  4GN5 A;  1YZ6 A;  2A19 A;  2KVM A;  4QUC A;  1LTL A;  1U0L A;  3IL8 A;  2YU9 B;  3HKZ G;  1I50 H;  3G7L A;  1BDO A;  4PV1 C;  3WWV A;  3RLN A;  3X3N A;  5M9O A;  1X3E A;  2N55 A;  3CRK C;  1NMF A;  2FFK B;  3S16 B;  1CT1 D;  4A76 A;  1QZG A;  4QL5 A;  1DZ1 A;  2VQE L;  1VQH A;  4XYO A;  5ELC A;  3GTQ H;  5IT9 E;  1HNZ Q;  5I9O A;  3N6R A;  3VR3 A;  1K83 B;  5KIX A;  5I4D A;  5ELN A;  5EKL A;  1N8R C;  1QNU A;  4DV1 Q;  1D7Q A;  3ULP A;  5C3X A;  3PO3 G;  3DXJ C;  4KTA A;  5KEE A;  3PIO A;  3EN2 A;  1EWI A;  5EJW A;  1C48 A;  1I6H H;  1S5E D;  1VS0 A;  3M4O H;  4HMJ A;  2EZV A;  1FR3 A;  3KOJ A;  4ABN A;  4K2K A;  5JEA J;  1K8M A;  4L6T B;  3B6Y A;  2EYM A;  1B53 A;  2WIN B;  1BCP F;  4HSP A;  4EVO A;  4EQO A;  2XVS A;  1VQE A;  1QJO A;  5M3M B;  1G29 1;  2LSS A;  2RSO A;  3CQZ B;  2EYL A;  1NAP A;  1JT8 A;  1DXM A;  1SAP A;  1KNA A;  1W6J A;  1KHI A;  1VQO A;  4C1N I;  1SYD A;  2KHI A;  1HR0 L;  3T1Y Q;  2RDF A;  2WAQ B;  5AJ3 Q;  1BBX C;  4KD3 A;  2N49 A;  1KXL A;  3U50 C;  3KF6 B;  1SYB A;  4X62 Q;  4JYA Q;  4IUV A;  1CUK A;  2VUM B;  2O2L D;  2VB3 X;  1YVC A;  2NVY H;  4JPB W;  2OQK A;  4PMW A;  1W2B A;  3R2I A;  1G8Z D;  2LXK A;  5A35 A;  3H94 A;  1K9M C;  4IO9 A;  1ILP A;  3GV6 A;  3MVV A;  2OQ0 A;  2K05 A;  5ELB A;  1YI2 A;  4BBS G;  1YHQ A;  4B3S L;  2ZXP A;  4A3E H;  1V8Q A;  2BDN A;  3I4M B;  2DJF C;  1XPO A;  2F3V A;  1Q7Y C;  2E74 C;  2UXB Q;  4FNF A;  1GUG A;  3GV3 A;  1DYQ A;  3GTK H;  4CDD C;  1RTO A;  1UE5 A;  4IPG A;  5J39 A;  1QE6 A;  1V1P B;  2FHT A;  3FEW X;  2F0G A;  5IGE A;  2B63 B;  5GAG C;  4HID A;  2A8V A;  1BCP C;  1HQR D;  1YHA A;  2OF1 A;  1HZ9 A;  2MUY A;  1UE6 A;  2D5D A;  1A8V A;  3T4A C;  2EYH A;  4N8X 1;  5K36 H;  4KLK A;  3S17 H;  4YCW A;  3J7Y W;  4TSS A;  4LAA A;  4PZ8 A;  3D6C A;  1Y8O B;  2EJM A;  3CAM A;  3TZU A;  5M3F H;  2VXW A;  3H0G H;  1DOL A;  1GVP A;  1YNX A;  1PZI D;  1YBY A;  1S5D D;  4FXK C;  3PIP A;  1Y1V G;  5C4Z A;  1Q1E A;  1Q8K A;  3ONA B;  4WFN 3;  1M8A A;  4X64 L;  2Y0S G;  1EIF A;  2KHS A;  5IGC A;  2VQF Q;  3GTO H;  3RZO B;  3TS2 A;  2MQH A;  1JCK B;  4YWL A;  3RLF A;  1H95 A;  1ET9 A;  1EY7 A;  2KEE A;  2AQ2 B;  5JEA H;  1Q81 C;  2UXD Q;  3C46 A;  5C5L A;  1K3R A;  5CV9 A;  3KFU A;  4UP7 A;  1I4H A;  1CKO A;  2KCM A;  3FRP B;  3GTL B;  4CJ1 B;  1PXU A;  3A7L A;  5CR3 A;  3UDF A;  1WTQ A;  2EY1 A;  1JOQ A;  4GLX A;  2N3S A;  4DV6 L;  1ICW A;  1RKN A;  3PO2 G;  4IFD I;  1SE8 A;  3GTP B;  1BF4 A;  3MZ5 A;  4BBR G;  1VQ9 A;  1EYC A;  5BR8 Q;  4B3R Q;  1EQT A;  3QO2 A;  3I4O A;  4MTN A;  4M8A A;  1B7Y B;  1NTG A;  1PVO A;  2NVT H;  4EQN A;  4DV7 Q;  4C3J G;  5CBA E;  5C3E G;  2CKZ B;  1D5M C;  4IFD J;  2H1E A;  3FKI H;  4K14 A;  4ZCK A;  3DUZ A;  2JJQ A;  2Q8I B;  1BXT A;  5CV4 A;  1V43 A;  2CFM A;  3ULJ A;  1J8I A;  2EYP A;  3PIO 3;  2R7Z G;  2NZO A;  1ET6 A;  5IYD G;  1ML0 D;  4A3L G;  1Q8I A;  3EVQ A;  4OO1 G;  1AZP A;  4CDF C;  5IWA Q;  1WD1 A;  2FMM A;  4K5W A;  4LUV A;  3MEF A;  1BKB A;  5HUR A;  4AYB E;  4DR5 Q;  3S2H H;  2K01 A;  1BBU A;  2IX1 A;  1C9O A;  4XIG S;  1XJV A;  4G7Z C;  1GKH A;  5EPJ A;  5IGF A;  1JWM D;  1ASZ A;  2BOS A;  1PH5 A;  3CCM A;  2B2V C;  1Z47 A;  1I50 B;  1QZH A;  5GAD C;  4LF5 L;  3HZX A;  2HIX A;  1D5X C;  4DUZ Q;  4DR4 Q;  2RBM A;  1TWH B;  1IL2 A;  1J6Q A;  3U4V A;  4Z9C B;  3J80 c;  4DU9 A;  4LF7 L;  3Q23 A;  5E4X A;  3LX0 A;  2K28 A;  1E2W A;  3K6O A;  2KBN A;  2F4V L;  3ND8 A;  1LTS D;  2ZXO A;  4R4T A;  2VY3 A;  1O78 A;  2LS0 1;  2UU9 L;  3MC0 B;  3OIP A;  3HOW H;  3K58 A;  2K5Q A;  2E5L L;  4KY6 A;  3GTQ B;  4CDE C;  5BN3 A;  3NEN A;  3KLS X;  4MNO A;  2EYO A;  4UAI A;  2WII B;  1XMQ Q;  1X55 A;  3OTO L;  2SDF A;  2NTT A;  1WCM G;  2R61 A;  4EX5 A;  2RA4 A;  3I91 A;  4L5T A;  1HRJ A;  4LWC A;  2MP1 A;  3MA2 B;  1AEX A;  2NVX H;  4DV2 Q;  3UE0 A;  4X66 Q;  1QOH A;  3M4Y A;  1NJI C;  2UUA Q;  1HUN A;  2Z8L A;  1HTL D;  2A6E C;  1LAB A;  4X6A H;  2JA9 A;  4BY1 H;  3WOE A;  3G6J B;  1A62 A;  3A7A B;  1MJE A;  3IAY A;  3AMU A;  3OWE B;  3NQT A;  2P5Z X;  4BY7 G;  3JAM c;  4RA8 A;  3EFX D;  2VB2 X;  5CC4 A;  2ALY B;  1SNP A;  4IFD H;  4TKO B;  3CCU A;  2WB1 G;  3EJI A;  3PIP 3;  4DR7 L;  1WD0 A;  4N9P A;  4OHJ A;  1SYE A;  3D8G A;  2ZJR A;  3HOX G;  1PFB A;  1IYV A;  4RGO S;  3RLO A;  3J81 c;  3HOY G;  4C1N K;  1GOZ A;  3K0X A;  3PV0 A;  2QEX A;  1L2F A;  4HCS A;  4IZ8 A;  1L1O B;  3DHQ A;  4ZAI A;  4FF2 A;  1CM9 A;  3W5O A;  4A93 H;  3HS0 C;  2NVY B;  4R4Q A;  2YU9 H;  3KBG A;  5IT9 L;  2F0S A;  3CW2 C;  5D65 A;  4FF4 A;  2OT2 A;  4IN3 A;  5KYL A;  2HDL A;  1SN8 A;  2CW0 D;  2ZXR A;  2ZM6 Q;  1LT3 D;  4R4O A;  5JPN C;  2EXD A;  1IYU A;  2BH2 A;  3S15 H;  3CPF A;  3SK8 A;  4A3E B;  4JI4 L;  2Z9H A;  4QY7 A;  1ESR A;  1I5F A;  1LT6 D;  2ES2 A;  1YEZ A;  2B2W C;  2M9V A;  3GTK B;  2DNC A;  3A56 A;  4DN4 M;  2MJ8 A;  4DXF A;  1QVG A;  5E1F A;  1B3A A;  2WFW A;  3D4R A;  2VQF L;  2JA6 G;  1K83 H;  1TY2 A;  4HN7 A;  4A75 A;  1FJG L;  2IW3 A;  1Q46 A;  4DUY L;  5M5X H;  2MFI A;  3S17 B;  3STB D;  1WYD A;  1EY0 A;  3PUX A;  2EY2 A;  3K8A A;  1UAP A;  4K5V A;  1STY A;  5M3F B;  5AFW A;  1XWE A;  3H0G B;  3T53 B;  3S1R H;  1V1Q A;  4NMZ A;  1HNX L;  1X6O A;  5COY A;  3D3R A;  2D62 A;  2VQE Q;  3BYT B;  2JA8 H;  5GAE C;  2K03 A;  3H3V C;  1IXR A;  2D0P A;  3GTO B;  2BE5 D;  4B3R L;  5BR8 L;  2K7V A;  5EKI A;  5EPL A;  1K0S A;  1UWV A;  3SVM A;  5FLM H;  1CQV A;  2X69 A;  3A54 A;  4DNR B;  2JSO A;  1RDP D;  4GNX B;  1KLU D;  3O13 A;  4LMQ D;  3AB9 A;  2YYZ A;  1NY4 A;  1YNJ C;  2EJF C;  2L15 A;  4X3T A;  4Q5V A;  5J22 A;  3G71 A;  2PZT A;  3DEO A;  5IOD A;  1Q86 C;  1U4L A;  3EQL C;  3PMF A;  3TP6 A;  4NKL A;  2NTS A;  1R9T H;  2WAC A;  1STH A;  2A1A A;  3Q22 A;  4LFC Q;  1UUP A;  2B2Y A;  1JIC A;  1P8L A;  4LF8 L;  3F2B A;  3DWP A;  4J1M A;  5IWA L;  4C56 C;  1K8G A;  2E2D C;  4IUT A;  2NVQ H;  1IW7 C;  4RKL A;  5C0X G;  1IHZ A;  2NVT B;  4FYD A;  4A3F G;  3S24 A;  3I4M H;  4HIM A;  1F2L A;  1MBY A;  1Q82 C;  3J7A V;  3PGZ A;  1SMX A;  5KGU A;  2K52 A;  3FKI B;  1HR0 Q;  2A68 C;  4XT1 B;  4JBJ A;  3TQY A;  1D6E C;  1B8A A;  3A8I E;  3NEM A;  3QOJ A;  2E2I H;  4LF4 L;  3E0J A;  1C7Y A;  4DR4 L;  3P1H A;  5IYC H;  1SE2 A;  5LL6 S;  2IX0 A;  1FNV A;  1KTK A;  2Q2H A;  3F8T A;  2RHQ B;  4RWS C;  3OIQ A;  1VQM A;  1GD7 A;  4K0K Q;  1V9P A;  5C5M A;  3S2H B;  4C3H H;  2E2J H;  4B3S Q;  1WTO A;  1PRT D;  2JA5 H;  2NN6 H;  1SMY D;  1AFP A;  4OEL B;  3L3O C;  4EGV A;  4WJW A;  4F8M A;  4LNQ A;  1EFW A;  2A69 D;  3VYS A;  4ALP A;  4QB4 A;  3I55 A;  3D6W A;  3IRB A;  1YNN D;  1TU2 B;  2AHO B;  2Z4I A;  1SJE D;  1AN8 A;  3RZO H;  1EWC A;  5KND A;  4X3K A;  3J7Z C;  4JC0 A;  2PMZ B;  4A3C G;  3HOU H;  1OXS C;  4CKB A;  1VQL A;  2F0F A;  1AE3 A;  5C3W A;  4JI7 L;  4P73 A;  2KQ3 A;  2Z6K A;  3DWQ A;  4N9T A;  1IZ6 A;  3JC6 6;  4RAU C;  5IE8 A;  2UUA L;  2X6G A;  1SFO H;  2Y0S E;  1F2M A;  1ZYR D;  1GO3 E;  1XTD A;  3UDI A;  5IYB G;  3HOW B;  2QDB A;  4XT3 B;  1I4P A;  1EZ8 A;  2O4X A;  4ZYS A;  2F0L A;  1PRT B;  1EU4 A;  1EY8 A;  1SE4 A;  2NB0 A;  4UP9 A;  1VQG A;  4NW2 A;  1IBK L;  1U4P A;  4KN4 C;  4X64 Q;  4ZK9 B;  1RF2 D;  5C6A A;  1G2S A;  1TII D;  4A3I G;  3H15 A;  3W3A A;  3A5U A;  5D3I B;  4JI6 L;  1XMO L;  2K75 A;  1GUT A;  2IL8 A;  1CKM A;  1KDB A;  1RD9 D;  3ICE A;  1Q1B A;  3L9A X;  2EXZ A;  2NVX B;  1PLF A;  4RKB A;  3I73 A;  2F0T A;  1EY9 A;  4C2M H;  1BO0 A;  3KDF A;  5DM7 3;  5FJ8 G;  5E4W C;  3MHB A;  3K59 A;  2UXC L;  3OSO A;  3VR4 A;  1ESF A;  4I65 A;  3J80 E;  2EOT A;  4KD4 A;  4GLV B;  1PTO D;  4ZUI A;  1VMC A;  1J9O A;  1Y1W H;  1JOR A;  1VCI A;  1JJG A;  2WKD A;  1H9S A;  5CMD A;  4DNT B;  3CD6 A;  3M7G A;  3S1Q H;  1NUC A;  4DV4 L;  1EWH A;  4A93 B;  3VR5 A;  1D5Z C;  2PMZ E;  1JWS D;  1SEB D;  1AE2 A;  3H91 A;  2Q2U A;  1AP0 A;  1HA5 A;  4QIW B;  3RN5 A;  2Q2T A;  1TWH H;  5DAU A;  4DK6 C;  1G6P A;  3S15 B;  5G3L D;  2VZA A;  3V96 A;  4K6D A;  1UE7 A;  1NBW A;  1PTO B;  3J7A F;  4JBW A;  4GOP A;  3D4D A;  2G9H D;  2Z6K C;  3MXP A;  3I2Z A;  2BCO A;  2A6H C;  3J81 j;  4LFA L;  3JAM E;  1DM0 B;  3OHX C;  1AH9 A;  1G91 A;  1EFI D;  2DGY A;  5KNB A;  3QJY A;  4HJ9 A;  1HUM A;  5M5X B;  3W2D A;  2OTJ A;  3TME A;  3OPO A;  4DR6 Q;  5LMN W;  2D9U A;  3J81 E;  4LF5 Q;  3F1Z A;  2RVL A;  2L0C A;  1F2Y A;  1KLG D;  3F2C A;  1LYL A;  3I72 A;  4DAY B;  1H9K A;  4KY5 A;  3R3O A;  3S1R B;  4LF7 Q;  1QUQ B;  1YIJ A;  2F4V Q;  3H6M A;  4FO2 A;  1CHP D;  1NE3 A;  5LHY 1;  4LFC L;  1MKH A;  1LTT D;  2JA8 B;  2UU9 Q;  3PO3 H;  2E5L Q;  5HGQ A;  5NUC A;  5LMU L;  1BBW A;  2MPM A;  2NBF A;  4F88 A;  3GP7 A;  3BDO A;  2ZJP A;  3OTO Q;  1KRT A;  1J5E Q;  2JEB I;  3H3V I;  3TSS A;  1HPC A;  3OWF A;  1NSN S;  3NSW A;  4RCN A;  5JOB A;  2LMC B;  1WTP A;  1FNU A;  3KBX A;  1IL8 A;  1STB A;  4DFA A;  5IY0 A;  5IGB A;  5IP7 G;  1R9T B;  4DPG A;  1C0A A;  4HJ5 A;  3MXG A;  5C4X G;  4KHZ A;  4RH6 A;  3J7A 5;  1CKN A;  4HR7 B;  4UHV A;  4GKK L;  4QIW E;  3HOV G;  1ONL A;  4K0K L;  3TN2 A;  3K81 C;  2NVQ B;  2EDG A;  4CGY B;  3SGI A;  3PUZ A;  5JVG 3;  3VYT A;  2JP1 A;  1A0I A;  3NXW A;  4IOA A;  5C44 G;  1EUJ A;  4DR7 Q;  1C8C A;  1S5F D;  4OO1 I;  4RMF A;  3R2T A;  3SXH A;  1I4Q A;  3V05 A;  4KJO A;  5A2Q E;  4GOP C;  2A73 B;  3MAQ A;  3EBE A;  1MHW C;  2E2I B;  4C3I G;  1DON A;  3FHW A;  2PQE A;  5I2X A;  1X56 A;  1QNK A;  5K36 G;  2SEB D;  5IP9 G;  1KIX A;  1YJN A;  3ERQ A;  1WFQ A;  4TQU S;  4DXG A;  2XWB B;  4WJ3 M;  4RCO A;  4DA2 A;  4C3H B;  2Z4H A;  4K8I A;  2E2J B;  4AYB B;  2K4K A;  2B2V A;  1A2T A;  4JI4 Q;  2JA5 B;  4DV3 L;  3I90 A;  2TSS A;  4NDX A;  2PZU A;  1DCZ A;  2KJX A;  4ILW A;  5JPM C;  2JQO A;  4LFB L;  3R8B A;  4JW0 A;  2L5T A;  4H13 C;  4HJA A;  2PI2 E;  1FJG Q;  3HOU B;  1A3V A;  4DUY Q;  2SNM A;  5FO7 B;  5JJI A;  2I0Q A;  1K8A C;  1WI5 A;  3OYY A;  5GRO A;  1Y8N B;  4I7A A;  4KHV A;  4ZRZ A;  4A3J G;  1EIH A;  3L7Z C;  4JI8 Q;  2CQA A;  4IUP A;  1X9N A;  4UP8 A;  1RL2 A;  1SFO B;  5FLX c;  2AKW B;  4FXD A;  3VYR A;  3HOZ H;  2F0I A;  3MFY A;  4DNI A;  2N8N A;  1T9H A;  4LW1 A;  1HNX Q;  4OX9 Q;  5I6W A;  2GN5 A;  3IFT A;  4H02 A;  1CHQ D;  3ND9 A;  4O42 A;  2K33 A;  3QB3 A;  4R4C A;  2B8G A;  4GN3 B;  3K0Y A;  3NP8 A;  4CBV A;  1CA5 A;  4XTC S;  4IPD A;  4YWM A;  3NE5 B;  1M1K C;  1KQS A;  1EOT A;  1RCV D;  3I3C A;  2QKI C;  3LWE A;  1EEI D;  1TS3 A;  2XWJ B;  3A8J E;  1GXD C;  1GUN A;  3H3V H;  3I4N G;  2G9D A;  3PO2 H;  4C2M B;  4A3B H;  2QCP X;  1D1K A;  2MHV A;  4DR1 L;  4OON A;  4A3D G;  1VF5 C;  2NYZ D;  4BBR H;  2RKS A;  1LM0 A;  4DF7 A;  4X3S A;  2I5L X;  2CWA A;  4G7H C;  1U4R A;  1PV4 A;  3IKJ A;  3GTJ H;  4LK1 C;  4BS9 A;  4L5R C;  1EIG A;  4LF8 Q;  4GZY C;  4G57 A;  4C3J H;  5C3E H;  1EY6 A;  1VQJ A;  4LF9 L;  1Y69 U;  3T56 B;  2XNA C;  5JJL A;  3TZD A;  4B3M L;  2E2H H;  5CGK A;  4QGU A;  4ODG A;  1S40 A;  1Y1W B;  3MWY W;  1CSP A;  2R93 G;  3C3L A;  1CZG A;  1VQ8 A;  1LTI D;  2OEO A;  2R7Z H;  1U9R A;  2ICE C;  3PQI A;  4UY8 C;  3S1Q B;  1O7L A;  2O5J C;  3UDG A;  1IBL Q;  4DR6 L;  1H9J A;  2DY7 A;  3P20 A;  1CKN B;  2EQS A;  5ELE A;  4LF4 Q;  3KJP A;  1TS5 A;  1PFS A;  3QIA A;  2F03 A;  2B2W A;  1JB3 A;  1STG A;  1NCV A;  3CF5 A;  3VYU A;  5DLQ E;  2J0T D;  1HZA A;  4EQ5 A;  2L12 A;  3TP7 A;  1E1T A;  1K8O A;  5EBC A;  3A5Z B;  3BZC A;  3BVZ A;  2F52 A;  2IHF A;  4A3M G;  2KCN A;  5CV5 A;  3BDC A;  3HKZ B;  2D2C C;  1DD2 A;  4DK1 A;  4DKA C;  5I9P A;  1TKW B;  1UEA B;  1S5C D;  2F3W A;  4OIJ A;  3DM1 A;  1D8L A;  3KJO A;  5M5Y H;  2XTI A;  3RD4 A;  4A3G G;  5C4H A;  1QVF A;  1OXT A;  1J5E L;  3HFZ B;  2UUC L;  1MI2 A;  1ENC A;  3J80 L;  1KAA A;  1SNO A;  4RGT A;  1KC8 C;  3K7U C;  4OEM B;  2IHE A;  4B9X A;  1TS2 A;  3LNN A;  4HJ7 A;  2LXJ A;  1KDC A;  4JI7 Q;  2E75 C;  2FJ2 A;  4UDU C;  1TVX A;  2PPB C;  2NWG A;  4YCV A;  1Y14 B;  1WOC A;  3I56 A;  1L1O C;  1ENF A;  5CV6 A;  2B29 A;  3PO3 B;  4BY1 G;  1WCM H;  4LF6 L;  3Q6S A;  2ASB A;  4YCU A;  4BXX G;  2A6E D;  1IBK Q;  2GA4 B;  2M2L A;  1RJT A;  5J3B A;  4JI6 Q;  1XMO Q;  1VQC A;  2Q8R E;  3QOL A;  4IJH A;  4F7X A;  3K80 C;  2PW5 A;  2I5H A;  1JB7 A;  5C0X I;  4E6I A;  4BY7 H;  5DNF A;  2K14 A;  1YJ9 A;  3CXC A;  4DAV A;  4HTH A;  3DWA A;  3JAM L;  1KL9 A;  1R4P B;  2V1C C;  2UXC Q;  4IAL A;  4DGZ A;  1EY5 A;  1STA A;  4FP5 D;  3BVG A;  4O2D A;  1N32 L;  1WTW A;  4JI2 L;  2AWN A;  5C0X J;  3EA6 A;  1HTP A;  1PTO H;  3J81 L;  1T5X D;  4A4I A;  3HKZ E;  5FK9 C;  2CVR A;  2CW0 C;  3NEL A;  4XQJ A;  3BS1 A;  4G7O C;  3PUV A;  2F0J A;  3KF8 A;  3K57 A;  1O7Z A;  1Z6H A;  1UNS A;  1B50 A;  2ICI A;  3E6Z X;  4CJ2 C;  4DV4 Q;  1X32 A;  1N34 L;  2LKV A;  1XNQ L;  4ME5 A;  2YTX A;  2RCN A;  2CH4 W;  2RDG A;  1E2V A;  1KD1 C;  1X3G A;  1LTA D;  5H1S E;  1SNQ A;  2PO4 A;  3A74 A;  4N8F A;  4JI8 L;  4GNX C;  2BA0 A;  3E9H A;  5E3F A;  2JA7 H;  2JA6 H;  2QIL A;  3KLW A;  3E3X A;  3BU2 A;  1LAC A;  5K5P A;  1XNR L;  4OX9 L;  3NHH A;  2MO0 A;  5FKA C;  5IOC A;  1E24 A;  3QG1 A;  1EYG A;  1CK1 A;  4NXM L;  3TS0 A;  4LFA Q;  5COR A;  3SDZ A;  2GVB A;  4Y7N H;  3CC4 A;  3RUZ A;  1I4G A;  5ELD A;  5EPK A;  1N36 L;  3TDQ A;  4AIM A;  2JYO A;  3FP9 A;  4QUF A;  5M3M G;  1PA6 A;  3CCL A;  1KAW A;  2GVA A;  3I7F A;  1Y1V B;  2F0O A;  3NBH A;  3F2U A;  2WAQ G;  4ULL A;  4HMI A;  4WOR A;  2Y0S B;  3HOZ B;  2AUJ D;  1A63 A;  3FVQ A;  1PHJ A;  2IY5 B;  2VUM G;  2VW9 A;  1F2Z A;  4XDX A;  4PMC A;  1JMC A;  5LMU Q;  1PRT F;  1XPU A;  3C1E A;  5TSS A;  3RNU A;  1LV9 A;  2PZW A;  1JWU D;  3I70 A;  2F3I A;  3I4M G;  1JC7 A;  3QWN A;  1GUS A;  2RDH A;  1WTH A;  3PO2 B;  3GTG B;  4A3B B;  3TEH B;  1VQ5 A;  5J1Z A;  4DV0 Q;  2F0W A;  5ELO A;  4BBR B;  1IBL L;  1IBM Q;  2HHH Q;  2XN9 C;  2B63 G;  1PMR A;  1Q3L A;  4KY7 A;  4AQY Q;  1DGS A;  3GTJ B;  5C0X H;  2A68 D;  4PQX A;  3J80 i;  3S2D H;  2K1B A;  3PUY A;  4A3F H;  2I46 A;  1M90 C;  1SLJ A;  4C3J B;  2IPK D;  1X65 A;  5C3E B;  5IYC G;  2KEN A;  5FLX E;  1W6K A;  1H9M A;  1HFG A;  4GKK Q;  3M3Y B;  1L0X B;  3KUP A;  4S3S A;  5D14 A;  1HZC A;  3NPP A;  1NR2 A;  4ZUJ A;  1PDQ A;  2E2H B;  1JE4 A;  4H7B A;  1XTC D;  1Y8P B;  1FGB D;  4AH6 A;  4HIK A;  3S1M B;  4JBM A;  1SYC A;  2JA5 G;  1IKM A;  2R7Z B;  3AEV A;  1TWC H;  2I5M X;  2QA4 A;  5FO8 B;  1PRT C;  1EQR A;  2ZTC A;  3GDE A;  1K73 C;  1EL0 A;  4MN3 A;  4IUQ A;  1B2T A;  5CYU A;  5KRU A;  4PZ7 A;  1E1O A; 
#chains in the Genus database with same CATH homology
 2L4N A;  4K8J A;  5I2Y A;  3HRZ C;  3OMG A;  4RHR A;  1IKL A;  1X3Q A;  2F0N A;  3FMC A;  1LT4 D;  1HHV A;  1BR9 A;  5M5Y B;  4R9W A;  2JE6 I;  4ZLT F;  1ZYR C;  1E2Z A;  1JQY D;  2EYF A;  4KKU A;  2EPB A;  2F0Q A;  1EYA A;  4KN7 C;  3K5N A;  5BN4 A;  5EBD A;  4ZKC B;  2VNU D;  1GHJ A;  3NK9 A;  2A5H A;  1C4Q A;  4IQZ A;  1S5B D;  4U67 3;  4RHS A;  4F87 A;  1WCM B;  5G3L F;  1MSH A;  4DK0 A;  3HG9 A;  4X3U A;  2WKC A;  4KKT A;  2B2U C;  3Q24 A;  3MFG A;  4P2C B;  3SE0 A;  4WRD A;  2L55 A;  2B8F A;  4K5X A;  3NTK A;  4BY7 B;  1BUV T;  5DM6 3;  1SND A;  2WB1 B;  1OXV A;  2JEA I;  1GHK A;  3HOY B;  5EKK A;  1B9M A;  3URY A;  3ITP A;  1D1I A;  1JOO A;  4KK7 A;  3E5S A;  2HDM A;  3T51 B;  3T16 A;  2EY5 A;  2XRQ D;  3VA5 A;  1OXU A;  2A6H D;  1F9R A;  1XXG A;  1I4R A;  2EYJ A;  4PMB A;  1QWY A;  2KEC A;  1JR0 D;  1BOS A;  2EY6 A;  3P7J A;  1ENA A;  4XYQ A;  3SK6 A;  3FPU B;  2JA7 B;  4PNY A;  2E76 C;  2HUG A;  1DJR D;  2C9O A;  2JA6 B;  2KOL A;  4L63 B;  1X3P A;  4RFB A;  1CQF A;  3NBI A;  4CKE A;  4Y7N B;  3Q0A A;  3CKI B;  1RHP A;  3ERO A;  1E0B A;  1HFN A;  2AQ3 B;  4TRD A;  5T1I A;  5JVH 3;  4R8N A;  1JOK A;  1TT2 A;  2F0P A;  3VR6 A;  2Z1C A;  1CI3 M;  4ZQ3 A;  1GUO A;  4OGQ C;  3M85 A;  2J4X A;  4BA1 I;  2Q8T A;  1SSO A;  2EE1 A;  3C2P A;  2O5I C;  2NZ1 D;  1FD7 D;  2JXM B;  1EU3 A;  1MD2 D;  2PW7 A;  3K5L A;  1I6V C;  4CKC A;  3I8Z A;  4BWG B;  1TR5 A;  2DNE A;  3VA7 A;  2N88 A;  3V2T A;  4J8Q A;  2KUM A;  3S2D B;  2NUC A;  4A3F B;  1STE A;  1BCP D;  3OW7 A;  1DOM A;  1EY4 A;  1EYD A;  4HCE A;  2IX3 A;  1U4M A;  2RQX A;  2R3Z A;  3SK5 A;  1H9S B;  5IIF A;  2IT1 A;  4XQN A;  3CHB D;  3GQB A;  5FO9 B;  1TWC B;  1M4V A;  2FMC A;  4KJN A;  1HCZ A;  1SYG A;  2F0V A;  3BG3 A;  1F9S A;  3NWS A;  3NTH A;  4MHE A;  1B44 D;  3S9W A;  1D2B A;  5JEA G;  3A8K E;  1BCP B;  1TQO A;  4H0L C;  5CBE E;  3SHL A;  3TP8 A;  4I7Z C;  2F0E A;  4RGN A;  1V1O A;  4V19 0;  1QIL A;  4HED A;  1A15 A;  5T1G A;  1SDF A;  3MXU A;  3D31 A;  3HGB A;  2HQE A;  2B2T A;  3IFD A;  5FLX L;  3HP3 A;  1LLR D;  3DEP A;  3KLS A;  5FOB B;  1CFM A;  1LTG D;  1T5E A;  1NR4 A;  1B9N A;  3S14 B;  1TY0 A;  5CV7 A;  2AWO A;  4FVM A;  4A3I B;  1LTR D;  2KED A;  2A74 C;  1BQQ T;  4V0B A;  2TMP A;  1AW7 A;  5M5W B;  1II3 A;  3U9S A;  4FF1 A;  2PCF B;  2H4O A;  1OO9 B;  4A3K B;  3AU7 A;  5KYI A;  2IJ0 A;  1VDZ A;  3TBI B;  2HCC A;  2R92 B;  1EZ6 A;  4OO1 H;  1RTN A;  3R93 A;  3U9O A;  2AUK A;  2J7Z A;  1ROD A;  1TS4 A;  4H44 C;  2DN8 A;  1SNM A;  3SEB A;  3WOF A;  2K5W A;  2KCC A;  2B39 A;  2L11 A;  2PNR C;  2XRS D;  1WVL A;  1WTV A;  1A2U A;  3T13 A;  1VMP A;  1TWF B;  1KNE A;  2QF7 A;  3LWU A;  4RGM A;  1L0Y B;  1QG7 A;  3OOC A;  2C5C A;  2XIW A;  1B1Z A;  2SOB A;  1A6X A;  4HSV A;  4CHT B;  1G6Z A;  2ID0 A;  1PZK D;  2B2T C;  4ID6 A;  1F77 A;  2F0U A;  4QF4 A;  5I6Y A;  1GUW A;  3MXN A;  1I6H B;  2L9H A;  3KK7 A;  5LL6 X;  1WTR A;  3M4O B;  5KNC A;  4NP5 A;  1HQM C;  2V4D A;  1DOK A;  1F9P A;  4IFD G;  3CU7 A;  3OMC A;  4OIK A;  2L1B A;  5ISR A;  3M7N A;  1CZW A;  4B08 A;  5JAV A;  1FYC A;  2X6L A;  1XX8 A;  4XXE A;  3K5O A;  4EQP A;  1GJX A;  2K04 A;  1QB5 D;  3RZD B;  5EQ0 A;  4MIU A;  4BA2 I;  1S4Z A;  4IUU A;  5C4X B;  1TWG B;  3K5M A;  1XYI A;  2ENB A;  3HOV B;  4U68 A;  4FF3 A;  3N52 A;  4BBS B;  1LT5 D;  1I3Q B;  1ILQ A;  1Q90 A;  2NN6 I;  5C44 B;  4LJZ C;  3NUC A;  4CJ0 B;  1HA6 A;  3PUW A;  1AZQ A;  1Q12 A;  1LTB D;  2F1M A;  5F2D A;  1QCB D;  3RMH A;  4K2L A;  4C3I B;  3H09 A;  1VF7 A;  5BN5 A;  4IUR A;  4XQQ A;  1LO5 D;  2IWH A;  1EQV A;  1STN A;  3MEH A;  2K5D A;  2RSN A;  4QMG A;  2EJG C;  3K7A B;  5C4J B;  3WDN A;  2BE5 C;  2R6G A;  2F4I A;  2DY8 A;  1PZJ D;  1F9Q A;  1KDA A;  4QCL A;  2K32 A;  1MSG A;  1EEF D;  4B9W A;  4L8J A;  1YNJ D;  1FNW A;  3D4W A;  2I07 B;  4KKS A;  2MGS A;  2WP8 J;  5IGG A;  4IUN A;  2LFN A;  5A2Q L;  4A3J B;  3CRL C;  4Q0F A;  3TP5 A;  3A55 A;  3NTI A;  2BA1 A;  1IW7 D;  2XSC A;  5HGT A;  1MGS A;  1B4O A;  2ZT9 C;  4O1N A;  2B2U A;  4OL7 A;  3SK4 A;  1SNC A;  4R8I A;  1PFN A;  3I4N B;  2K6A A;  3NWT A;  4A3D B;  2EVB A;  4C3H G;  5EGT A;  2OXP A;  2NN6 G;  3BZD B;  2CHB D;  1OXX K;  3UI2 A;  3GO5 A;  1H9R A;  4YIJ A;  1SE3 A;  1ZEQ X;  2LY7 A;  4J6H A;  1SMY C;  2SNS A;  2A69 C;  2F0H A;  5D3D A;  1A3U A;  3I4L A;  3MTS A;  3VR2 A;  4DAY A;  2R93 B;  1YNN C;  2AQ1 B;  2F0K A;  1G2T A;  4KV6 A;  1O80 A;  2QEJ C;  1PTO F;  1Z7T A;  3BYY B;  4G4K A;  1SJH D;  1BNZ A;  1SXT A;  5ELF A;  1HXY D;  4HAE A;  3FPP A;  2F0D A;  3SR1 A;  1ZXT A;  4M1U B;  1TWA B;  4A3M B;  1KAB A;  1SBB B;  3GD7 A;  4FXG C;  4KI0 A;  3S1N B;  4KMU C;  3P75 A;  3KLR A;  1WTX A;  4A3G B;  1CTM A;  4K6L A;  3HEJ A;  1CA6 A;  4ZKB B;  4DAP A;  2B2Y C;  5JJZ A;  4JK1 C;  3C1F A;  2BDO A;  2WV6 D;  1ZKO A;  3GTM B;  3BDL A;  2PYK A;  2KA7 A;  2M00 A;  3X3M A;  1V1P A;  1PTO C;  4BY1 B;  1PYW D;  1PFM A;  2F0M A;  2FIN B;  3FDT A;  5IGD A;  1R4Q B;  1O7Y A;  3HOX B;  1A3T A;  3ZYY X;  2HCI A;  1I4X A;  5CV8 A;  1SYF A;  3BVM A;  5DEH A;  3DMU A;  3NQI A;  2KVM A;  4QUC A;  3IL8 A;  2YU9 B;  3G7L A;  1BDO A;  4PV1 C;  3X3N A;  5M9O A;  2N55 A;  3CRK C;  2FFK B;  3S16 B;  1CT1 D;  1DZ1 A;  4XYO A;  5ELC A;  5IT9 E;  5I9O A;  3N6R A;  3VR3 A;  1K83 B;  5KIX A;  5I4D A;  5EKL A;  1QNU A;  5C3X A;  3DXJ C;  4KTA A;  5KEE A;  5EJW A;  1C48 A;  1S5E D;  4HMJ A;  2EZV A;  1FR3 A;  4ABN A;  4K2K A;  5JEA J;  1K8M A;  4L6T B;  2EYM A;  1B53 A;  2WIN B;  1BCP F;  4HSP A;  4EVO A;  4EQO A;  2XVS A;  1QJO A;  5M3M B;  1G29 1;  2RSO A;  3CQZ B;  2EYL A;  1NAP A;  1DXM A;  1SAP A;  1KNA A;  1W6J A;  4C1N I;  1SYD A;  2RDF A;  2WAQ B;  1BBX C;  4KD3 A;  1SYB A;  4IUV A;  2VUM B;  2O2L D;  2VB3 X;  4PMW A;  3R2I A;  1G8Z D;  5A35 A;  3H94 A;  1ILP A;  3GV6 A;  3MVV A;  2K05 A;  5ELB A;  2ZXP A;  1V8Q A;  2BDN A;  3I4M B;  2F3V A;  2E74 C;  4FNF A;  1GUG A;  3GV3 A;  1DYQ A;  1RTO A;  5J39 A;  1QE6 A;  1V1P B;  2FHT A;  5IGE A;  2F0G A;  3FEW X;  2B63 B;  1BCP C;  1HQR D;  2OF1 A;  2MUY A;  2D5D A;  3T4A C;  2EYH A;  5K36 H;  3J7Y W;  4TSS A;  4LAA A;  3D6C A;  1Y8O B;  2EJM A;  3TZU A;  2VXW A;  1DOL A;  1PZI D;  1S5D D;  4FXK C;  5C4Z A;  1Q1E A;  3ONA B;  4WFN 3;  1M8A A;  2KHS A;  3RZO B;  5IGC A;  1JCK B;  3RLF A;  1ET9 A;  1EY7 A;  2KEE A;  2AQ2 B;  5JEA H;  3C46 A;  5C5L A;  5CV9 A;  1I4H A;  3FRP B;  3GTL B;  4CJ1 B;  1PXU A;  3A7L A;  5CR3 A;  1WTQ A;  2EY1 A;  1JOQ A;  1ICW A;  1RKN A;  4IFD I;  3GTP B;  1BF4 A;  3MZ5 A;  1EYC A;  1EQT A;  3QO2 A;  4M8A A;  4EQN A;  4C3J G;  5CBA E;  1D5M C;  4IFD J;  2H1E A;  4K14 A;  3DUZ A;  2Q8I B;  1BXT A;  5CV4 A;  1V43 A;  1J8I A;  2EYP A;  3PIO 3;  1ET6 A;  1ML0 D;  1Q8I A;  3EVQ A;  4OO1 G;  1AZP A;  1WD1 A;  2FMM A;  4K5W A;  5HUR A;  2K01 A;  2IX1 A;  4XIG S;  4G7Z C;  5EPJ A;  5IGF A;  1JWM D;  2BOS A;  2B2V C;  1Z47 A;  1I50 B;  3HZX A;  1D5X C;  2RBM A;  1TWH B;  4Z9C B;  4DU9 A;  3Q23 A;  5E4X A;  3LX0 A;  2K28 A;  1E2W A;  3K6O A;  3ND8 A;  1LTS D;  2ZXO A;  1O78 A;  2LS0 1;  3MC0 B;  3OIP A;  3K58 A;  2K5Q A;  3GTQ B;  4KY6 A;  5BN3 A;  3KLS X;  2EYO A;  4UAI A;  2WII B;  2SDF A;  2NTT A;  2R61 A;  2RA4 A;  3I91 A;  1HRJ A;  2MP1 A;  3MA2 B;  1AEX A;  1QOH A;  3M4Y A;  1HUN A;  2Z8L A;  1HTL D;  2A6E C;  1LAB A;  3WOE A;  3G6J B;  3A7A B;  3IAY A;  3AMU A;  3OWE B;  3NQT A;  4RA8 A;  3EFX D;  2VB2 X;  5CC4 A;  1SNP A;  4IFD H;  4TKO B;  3EJI A;  3PIP 3;  1WD0 A;  4N9P A;  4OHJ A;  1SYE A;  3D8G A;  1PFB A;  1IYV A;  4RGO S;  4C1N K;  1GOZ A;  3PV0 A;  4HCS A;  4IZ8 A;  3DHQ A;  4ZAI A;  4FF2 A;  1CM9 A;  3HS0 C;  2NVY B;  3KBG A;  5IT9 L;  2F0S A;  5D65 A;  4FF4 A;  2OT2 A;  4IN3 A;  5KYL A;  2HDL A;  2CW0 D;  2ZXR A;  1LT3 D;  5JPN C;  1IYU A;  3SK8 A;  4A3E B;  1ESR A;  1LT6 D;  2B2W C;  2M9V A;  3GTK B;  2DNC A;  4DN4 M;  3A56 A;  2MJ8 A;  4DXF A;  5E1F A;  1B3A A;  3D4R A;  1TY2 A;  4HN7 A;  2IW3 A;  3S17 B;  1EY0 A;  3PUX A;  2EY2 A;  1UAP A;  4K5V A;  1STY A;  5M3F B;  5AFW A;  1XWE A;  3H0G B;  3T53 B;  4NMZ A;  5COY A;  3D3R A;  2D62 A;  3BYT B;  2K03 A;  3H3V C;  3GTO B;  2BE5 D;  2K7V A;  5EKI A;  5EPL A;  3SVM A;  1CQV A;  2X69 A;  3A54 A;  4DNR B;  2JSO A;  1RDP D;  1KLU D;  3O13 A;  4LMQ D;  3AB9 A;  2YYZ A;  1YNJ C;  2EJF C;  4X3T A;  4Q5V A;  5J22 A;  2PZT A;  3DEO A;  5IOD A;  1U4L A;  3EQL C;  3PMF A;  3TP6 A;  4NKL A;  2NTS A;  2WAC A;  1STH A;  3Q22 A;  1UUP A;  2B2Y A;  1JIC A;  3DWP A;  4J1M A;  4C56 C;  2E2D C;  4IUT A;  1IW7 C;  4RKL A;  5C0X G;  1IHZ A;  2NVT B;  4FYD A;  1F2L A;  1MBY A;  3J7A V;  5KGU A;  3FKI B;  2A68 C;  4XT1 B;  1D6E C;  3A8I E;  3QOJ A;  3E0J A;  3P1H A;  1SE2 A;  5LL6 S;  2IX0 A;  1FNV A;  1KTK A;  4RWS C;  3OIQ A;  5C5M A;  3S2H B;  1WTO A;  1PRT D;  2NN6 H;  1SMY D;  1AFP A;  3L3O C;  4EGV A;  4WJW A;  4F8M A;  2A69 D;  3VYS A;  4QB4 A;  3D6W A;  1YNN D;  1TU2 B;  2Z4I A;  1SJE D;  1AN8 A;  1EWC A;  5KND A;  4X3K A;  2PMZ B;  1OXS C;  4CKB A;  2F0F A;  5C3W A;  2KQ3 A;  3DWQ A;  4N9T A;  4RAU C;  2X6G A;  1F2M A;  1ZYR D;  3HOW B;  2QDB A;  4XT3 B;  1I4P A;  1EZ8 A;  2O4X A;  4ZYS A;  2F0L A;  1PRT B;  1EU4 A;  1EY8 A;  1SE4 A;  2NB0 A;  4NW2 A;  1U4P A;  4KN4 C;  4ZK9 B;  1RF2 D;  5C6A A;  1TII D;  1G2S A;  3W3A A;  5D3I B;  1GUT A;  2IL8 A;  1KDB A;  1RD9 D;  1Q1B A;  3L9A X;  2EXZ A;  2NVX B;  1PLF A;  4RKB A;  3I73 A;  2F0T A;  1EY9 A;  1BO0 A;  5DM7 3;  5E4W C;  3MHB A;  3K59 A;  3OSO A;  3VR4 A;  1ESF A;  4I65 A;  3J80 E;  2EOT A;  4KD4 A;  1PTO D;  4ZUI A;  1VMC A;  1J9O A;  1JOR A;  1VCI A;  2WKD A;  1H9S A;  5CMD A;  4DNT B;  3M7G A;  1NUC A;  1EWH A;  4A93 B;  3VR5 A;  1D5Z C;  1JWS D;  1SEB D;  3H91 A;  1AP0 A;  1HA5 A;  4QIW B;  5DAU A;  3S15 B;  5G3L D;  3V96 A;  4K6D A;  3J7A F;  1PTO B;  4JBW A;  3D4D A;  2G9H D;  3MXP A;  2BCO A;  2A6H C;  3JAM E;  1DM0 B;  3OHX C;  1G91 A;  1EFI D;  5KNB A;  3QJY A;  1HUM A;  5M5X B;  3W2D A;  3TME A;  3OPO A;  2D9U A;  3J81 E;  2RVL A;  2L0C A;  1F2Y A;  1KLG D;  3I72 A;  1H9K A;  4KY5 A;  3R3O A;  3S1R B;  3H6M A;  4FO2 A;  1CHP D;  5LHY 1;  1LTT D;  2JA8 B;  5NUC A;  2MPM A;  2NBF A;  4F88 A;  3GP7 A;  3BDO A;  2JEB I;  3TSS A;  1HPC A;  3OWF A;  1NSN S;  3NSW A;  4RCN A;  5JOB A;  2LMC B;  1WTP A;  1FNU A;  3KBX A;  1IL8 A;  1STB A;  4DFA A;  5IGB A;  1R9T B;  3MXG A;  4KHZ A;  4RH6 A;  4HR7 B;  1ONL A;  3TN2 A;  2NVQ B;  2EDG A;  4CGY B;  3PUZ A;  5JVG 3;  3VYT A;  2JP1 A;  3NXW A;  1C8C A;  1S5F D;  4OO1 I;  3R2T A;  3SXH A;  1I4Q A;  3V05 A;  4KJO A;  5A2Q E;  2A73 B;  3MAQ A;  2E2I B;  4C3I G;  1DON A;  2PQE A;  5I2X A;  1QNK A;  5K36 G;  2SEB D;  3ERQ A;  4TQU S;  4DXG A;  2XWB B;  4RCO A;  4DA2 A;  4C3H B;  2Z4H A;  4K8I A;  2E2J B;  4AYB B;  2JA5 B;  2B2V A;  1A2T A;  3I90 A;  2TSS A;  4NDX A;  2PZU A;  1DCZ A;  2KJX A;  4ILW A;  5JPM C;  3R8B A;  2L5T A;  4H13 C;  3HOU B;  1A3V A;  2SNM A;  5FO7 B;  1Y8N B;  4KHV A;  4ZRZ A;  1EIH A;  3L7Z C;  2CQA A;  4IUP A;  1SFO B;  4FXD A;  3VYR A;  2F0I A;  3MFY A;  5I6W A;  3IFT A;  1CHQ D;  3ND9 A;  4O42 A;  2K33 A;  3QB3 A;  2B8G A;  3K0Y A;  3NP8 A;  4CBV A;  1CA5 A;  4XTC S;  3NE5 B;  1EOT A;  1RCV D;  3I3C A;  2QKI C;  3LWE A;  1EEI D;  1TS3 A;  2XWJ B;  3A8J E;  1GXD C;  1GUN A;  2G9D A;  4C2M B;  2QCP X;  1D1K A;  2MHV A;  1VF5 C;  2NYZ D;  2RKS A;  4DF7 A;  4X3S A;  4G7H C;  1U4R A;  3IKJ A;  4LK1 C;  4BS9 A;  1EIG A;  4GZY C;  4G57 A;  1EY6 A;  1Y69 U;  3T56 B;  2XNA C;  3TZD A;  5CGK A;  4ODG A;  1Y1W B;  3MWY W;  3C3L A;  1CZG A;  1LTI D;  2OEO A;  1U9R A;  2ICE C;  3S1Q B;  1O7L A;  2O5J C;  1H9J A;  2DY7 A;  3P20 A;  5ELE A;  1TS5 A;  3QIA A;  2F03 A;  2B2W A;  1JB3 A;  1STG A;  1NCV A;  3VYU A;  2J0T D;  2L12 A;  3TP7 A;  1K8O A;  5EBC A;  3BVZ A;  2KCN A;  5CV5 A;  3BDC A;  3HKZ B;  2D2C C;  1DD2 A;  4DK1 A;  5I9P A;  1TKW B;  1UEA B;  1S5C D;  2F3W A;  4OIJ A;  3DM1 A;  3RD4 A;  5C4H A;  1OXT A;  1MI2 A;  1ENC A;  3J80 L;  1KAA A;  1SNO A;  4RGT A;  4B9X A;  1TS2 A;  3LNN A;  1KDC A;  2E75 C;  2FJ2 A;  4UDU C;  1TVX A;  2PPB C;  2NWG A;  1ENF A;  5CV6 A;  3PO3 B;  3Q6S A;  2A6E D;  2GA4 B;  2M2L A;  1RJT A;  2Q8R E;  3QOL A;  4F7X A;  2PW5 A;  5C0X I;  4E6I A;  5DNF A;  4DAV A;  4HTH A;  3DWA A;  3JAM L;  1R4P B;  4IAL A;  4DGZ A;  1EY5 A;  1STA A;  4FP5 D;  3BVG A;  1WTW A;  2AWN A;  5C0X J;  3EA6 A;  1HTP A;  1PTO H;  3J81 L;  1T5X D;  5FK9 C;  2CVR A;  2CW0 C;  4XQJ A;  3BS1 A;  4G7O C;  2F0J A;  3PUV A;  3KF8 A;  3K57 A;  1O7Z A;  1Z6H A;  1UNS A;  1B50 A;  2ICI A;  3E6Z X;  4CJ2 C;  1X32 A;  2LKV A;  4ME5 A;  2RDG A;  1E2V A;  1LTA D;  1SNQ A;  2PO4 A;  2BA0 A;  5E3F A;  2QIL A;  1LAC A;  5K5P A;  3NHH A;  5FKA C;  5IOC A;  3QG1 A;  1CK1 A;  5COR A;  3SDZ A;  3RUZ A;  1I4G A;  5ELD A;  5EPK A;  3TDQ A;  2JYO A;  4QUF A;  1Y1V B;  2F0O A;  3NBH A;  3F2U A;  4ULL A;  4HMI A;  4WOR A;  2Y0S B;  3HOZ B;  2AUJ D;  3FVQ A;  1F2Z A;  4XDX A;  4PMC A;  1PRT F;  3C1E A;  5TSS A;  1LV9 A;  2PZW A;  1JWU D;  3I70 A;  1JC7 A;  3QWN A;  1GUS A;  2RDH A;  3PO2 B;  3GTG B;  4A3B B;  5J1Z A;  2F0W A;  4BBR B;  2XN9 C;  1PMR A;  1Q3L A;  4KY7 A;  3GTJ B;  5C0X H;  2A68 D;  4PQX A;  2K1B A;  3PUY A;  2I46 A;  4C3J B;  2IPK D;  5C3E B;  5FLX E;  1W6K A;  1H9M A;  1HFG A;  3M3Y B;  1L0X B;  3KUP A;  4S3S A;  5D14 A;  3NPP A;  1NR2 A;  4ZUJ A;  1PDQ A;  2E2H B;  1JE4 A;  4H7B A;  1XTC D;  1Y8P B;  1FGB D;  3S1M B;  1SYC A;  1IKM A;  2R7Z B;  5FO8 B;  1PRT C;  1EL0 A;  4MN3 A;  4IUQ A;  1B2T A;  5CYU A;  5KRU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...