2H4OA

X-ray crystal structure of protein yonk from bacillus subtilis. northeast structural genomics consortium target sr415
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
62
structure length
62
Chain Sequence
ASKKVHQINVKGFFDMDVMEVTEQTKEAEYTYDFKEILSEFNGKNVSITVKEENELPVKGVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords YonK protein
publication title Crystal structure of the hypothetical protein from bacillus subtilis (yonk).
rcsb
source organism Bacillus subtilis
total genus 6
structure length 62
sequence length 62
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09642 YonK YonK protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.280 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2h4oA00
2H4OA
chains in the Genus database with same CATH superfamily
3B6YA 3HP3A 2CQOA 4K5XA 2A69D 1A2TA 3S1QH 2BDOA 4GKJL 2R93G 2PQAB 1ESFA 4ILWA 5C4XH 3AEVA 2CW0C 1RIPA 4XXEA 1W2BA 1CA6A 2VQEQ 5IYCH 3GTPB 2OF1A 1ZYRC 2CW0D 2B2TA 1X3PA 1KAWA 2B63G 2YU9H 3MZ5A 5IYBG 4DA2A 4HJ7A 1X3GA 4A3GB 1M90C 1ZYRD 2A19A 1EL0A 3M85A 4C3IB 5EGTA 2XIWA 2B8FA 3NE5B 1XMOQ 2NVXH 4OELB 2F0UA 2Q8IB 3S1RH 3A5ZB 1E2WA 2VUMH 5JOBA 1SYBA 4CKCA 4Z9CB 1L1OA 3L9AX 1SSOA 3KBGA 3T4AC 3MXPA 4XTCS 2VQFQ 4C1NK 3KLRA 4XQNA 3G6EA 3D6WA 4A3FG 5C3XA 2OQKA 1W6JA 1SAPA 1PRTB 4LNQA 4LF9Q 2MJ8A 4C3HH 3AFPA 2M00A 1Q3LA 2WAQG 1I4PA 4HMJA 4CDEC 1F77A 3K0XA 1Y8NB 2Q2HA 2CH4W 1PRTF 4OIJA 2ZXOA 3CCVA 4FF2A 2C9OA 1MHWC 2RSOA 4KHPL 3GTJB 1VQBA 3KF8B 4O0AA 4HSVA 4JI2L 2C5CA 3ERQA 3CC4A 1IKMA 4OXPA 2F03A 2WINB 2MO0A 4GKKL 1S5CD 5M5WH 2HIVA 3SHLA 3I56A 2VXWA 3GTKH 1U0LA 1LT5D 2E2JB 1BO0A 3LWEA 4JPBW 3QOJA 2HD3A 1N33Q 2Z4HA 1HNXL 2ZM6L 4QIWB 1DONA 4KHVA 2RDGA 2Y0SE 1H9MA 1N34L 4BXXH 4XDXA 3M4PA 1BF4A 1HZBA 4YWLA 1TKWB 5GAHC 3VR5A 1FJGL 2RHSB 2Z1CA 1KTKA 2Q2TA 1S4ZA 4GKJQ 5E1FA 4QUFA 3R2IA 2NVTH 2ALYB 1RL2A 3UDGA 3FKIB 2MFIA 2LY7A 5C0XI 1CI3M 1EQTA 2DNEA 1S72A 4XT3B 5IGGA 1B44D 2SNMA 2NZOA 4DN4M 5EKIA 4TKOB 1K9MC 5IOCA 3RN5A 3H09A 1HTPA 2A73B 3CP0A 4KN7C 2QW7A 1MJEA 1X3QA 4KV6A 4B3TL 5EBCA 3SK8A 1AN8A 4K2LA 1B7YB 1HA6A 1E2VA 1VQ5A 1ASYA 4LFAL 1I4RA 1L2FA 1X54A 4DNIA 3S16H 2QGQA 4A93B 1SEBD 4IOAA 3SVMA 1KIXA 2WV6D 1NMGA 1J6QA 3AQQA 2EXDA 2A8VA 2KECA 1KHIA 1EQRA 1VQ6A 3H0GG 2JA8G 1H9JA 1XX8A 1SYDA 4IFDH 1K3RA 5CC4A 2Q8TA 3BYTB 1G6PA 2NZ1D 1WVLA 4MN3A 1MKHA 5IWAL 4MHEA 2UUCL 3I55A 4C56C 5G3LD 1LT3D 3PO3G 1YZ6A 2IX3A 1A3UA 5JEAJ 4Y7NB 4KHPQ 4LF5L 1NY4A 4AH6A 3WOEA 3DWQA 4JI2Q 4HSPA 1R9TH 2UUBL 1OO9B 2B2YA 2RSNA 3W3AA 1H9KA 1OXVA 3RMHA 5IGBA 4EQOA 4JI4L 4QL5A 3D0FA 4POGA 4GKKQ 3S2DH 3A7AB 1PFBA 2I5HA 1QUQA 3TN2A 1N9WA 2OXPA 4AYBE 1Y1WH 4BBSB 2QCPX 2ZT9C 5JJZA 1JR0D 1HNXQ 2ZM6Q 4DV2L 4LWCA 4IUTA 3STBD 1A6XA 3F2DA 1HZAA 4F88A 1N34Q 2VS1A 4AQYL 4BY7H 1PH4A 4Q5VA 1NNXA 1CKNA 3PIP3 1FJGQ 2F0NA 1BQQT 1NMFA 3H6MA 1DD2A 4IUVA 4A3MB 2LSSA 3K8AA 1Q1BA 1TU2B 1C7YA 4A3BG 3JAMc 2F52A 1ASZA 4X3SA 2N3SA 5FO9B 2ID0A 3EIVA 3LNNA 4X3KA 1GUTA 3K5MA 2HUGA 4DR4L 1KDCA 4C2MB 3KF6A 3I4NG 3VA7A 5C44B 1TS4A 1KDAA 1BKBA 4F7XA 2RA4A 1R4PB 4YCWA 3TZUA 2EYOA 1QILA 4B3TQ 2EQSA 2FJ2A 2E2DC 1IZ6A 3S14H 2K04A 4IUUA 3NQIA 4LFAQ 4EX5A 4LUOA 3I4OA 4M1UB 3VYRA 4U68A 2PW7A 1YNND 2B2WC 3ULLA 1PTOB 3A8JE 1IXRA 1VDZA 1S5DD 1M4VA 1BXTA 3M7GA 1PDQA 1H95A 4LAAA 1G2SA 1WTPA 2KEEA 4NPSA 4UPAA 1L0WA 5LMUL 1PTOF 4A3DB 1TS2A 1IBKL 4KKSA 5IIFA 2NTSA 3MWYW 5JVH3 5IWAQ 2UUCQ 1Q86C 1HRJA 3MEHA 1TR5A 2EXZA 4A3GG 5CMDA 1TXYA 2ES2A 4LF5Q 1VQFA 1AE2A 1E24A 2JYOA 2WKCA 1ZKOA 3HEJA 4YCVA 5K5PA 2E5LL 2UUBQ 4DXGA 1TWCH 1XTCD 3T13A 1FGBD 4A3JH 4HJAA 4JI4Q 5ELCA 1U9RA 4P2CB 1F2LA 2K5QA 3I8ZA 4FNFA 4HMIA 4TQUS 3HOXH 2OQ0A 2N88A 2NN6I 5C3EG 1I4QA 1RD9D 1ENFA 1JE5A 4DV2Q 5M3FH 2K75A 5I6YA 5CV6A 2F0SA 3LWUA 4AQYQ 1W3SA 2CWPA 3JAME 3KLSA 4R4IA 3HOWB 3PIPA 1IW7D 4HAEA 3I4MH 4PMCA 4HJ8A 2A6HD 3ND9A 3BJUA 5LL6S 1SE4A 1XMQQ 1EYDA 1UE1A 1G291 1MSHA 2R93B 3FMCA 2QILA 1S3OA 4AIMA 3JAMi 4DR4Q 4DR7L 1SBBB 3HOYH 1Z6HA 3CPFA 1Y8OB 3UDXA 2WKDA 3TMEA 3TZDA 3T51B 1EYAA 3VR4A 1PHJA 2P5ZX 1LT6D 1ILQA 2VUMG 3GTLB 1T5EA 4QCLA 2FMCA 2RDFA 5KYLA 2RVLA 2M9VA 4FF4A 1KNAA 1VQPA 3F2CA 4LF7L 4DK1A 3S2HH 1CA5A 4PMWA 5FO8B 1DXMA 5C0XG 1U4MA 1DJRD 2BH8A 2K6AA 4L8JA 2N8NA 1O7YA 4GNXB 2EY1A 3P20A 3GTGH 4L5QA 1GVPA 3I73A 4L5RC 2ICIA 4DR5L 1I5FA 4A3FB 1TY2A 3MXNA 5LMUQ 4DKAC 5EBDA 4IUPA 1D5ZC 2JA6H 1IBKQ 4FO2A 1R4QB 3S1NB 2IT1A 3NTKA 2EJMA 1E22A 1HZ9A 4P72A 3BZCA 2IL8A 3HGBA 4DV0L 2E5LQ 1H9RA 2VNUD 1EIFA 4PZ8A 1VQIA 3BDCA 1WD1A 4KLKA 3BS1A 1O7LA 4ZCKA 4IN3A 4ZAIA 3E9IA 4A3EH 1PH8A 4A93G 4A3CG 1HZCA 3AB9A 4BXXG 1FL0A 2IWHA 5G3LF 1S40A 1NUCA 4C1NI 3NUCA 1QVFA 5IYDH 4IPCA 1GUNA 1D6EC 3BVZA 1EY7A 2K03A 4HIMA 1Q7YC 1H9SA 3GD7A 1B53A 2N78A 4KMUC 2AQ3B 3A5UA 4A76A 5C5MA 1EOTA 1AP0A 1FGUA 2O5JC 2F0JA 1RKNA 2UXCL 1CK1A 1I94L 4DR7Q 4R4CA 3KDFB 5M9OA 1V1PA 4DPGA 2K5VA 3F2BA 1O78A 3CD6A 2AQ2B 1E1TA 4IFDJ 3CCSA 2EZVA 1M1KC 1PLFA 5ELOA 2PZWA 4X3TA 1MGSA 2F4IA 1JWMD 3HOZH 4LF7Q 4DGZA 4NB3A 3P75A 4HIKA 3C1EA 4O42A 5COYA 5F2DA 4J15A 2KCCA 2HQLA 1EUJA 4CDFC 1VF5C 4IPDA 3K7AH 2Q2IA 1MI2A 4DR5Q 4R1JA 1WTXA 2YTYA 2IPKD 5KIXA 4IZ8A 2JP1A 3GTQH 3H0GB 2JA8B 3ZYYX 4WORA 3J81c 4JK1C 4UP9A 3GTMH 3DUZA 1KLGD 3FPUB 2RCFA 3ICEA 1TWGH 3DEOA 4FDBA 3T53B 2F1MA 3CXCA 4DR3L 3PO3B 4K5VA 2Z6BA 4FXGC 2VZAA 5JPMC 4HTHA 3E3XA 2CH4A 3RZOH 1KABA 1GHKA 2I5MX 4DV0Q 3IFDA 1GUOA 4BS9A 3J7YW 2A5HA 1AEXA 3CCRA 3IAYA 5D3IB 2MP1A 1EIGA 1Y1WG 2ICEC 1GXDC 3QOLA 2L4NA 1J9OA 4GLXA 5K36G 2VB3X 3GTOH 1LUZA 3HZXA 1I6HH 5EKKA 2IJ0A 2JA9A 3SDZA 1HA5A 4QIWE 2VB2X 1HTLD 2Z4IA 5NUCA 1GM5A 4DF7A 1ZEQX 1PFMA 3V05A 4IO9A 5BR8Q 1AZQA 3A8IE 2L11A 1X3EA 2NN6G 4K8IA 1VQAA 3CMAA 2EY2A 1KXLA 1U4RA 2K5NA 2PZUA 1I94Q 1XTDA 1MBYA 4X62L 5EQ0A 3N52A 2E2HB 1VQLA 3MTSA 4K0KL 3M7NA 4CJ1B 3PUWA 1EY5A 3M4OB 2NVQB 3K7UC 1JCKB 4DR6L 1X9NA 4NW2A 1S5FD 3V2TA 4JBJA 1SJED 2B2YC 1FNVA 3KK7A 2BDNA 2F4VL 4OEMB 4P73A 1TT2A 4OGQC 3HOWG 3J81L 3R93A 4CBVA 4GOPA 4IJLA 3PO2H 3J81E 3NWSA 1K3BC 3L7ZC 5CBEE 5KNBA 1A0IA 2TSSA 1QE6A 3CCEA 2OTLA 1TQOA 3S17B 1PZID 1IBML 4BBRH 4BY1B 1JICA 2PZTA 1G51A 2BE5C 2VL6A 4N9PA 3J81i 3ERSX 3ONAB 4JCVE 1PXUA 3OW7A 4DR3Q 1WJJA 4HJ5A 2DN8A 3TRZA 4RCNA 3QR8A 5CV9A 3MHBA 2EYHA 2BE5D 2DJFC 5AFWA 3HOVH 1TWHB 1X56A 1XJVA 5GAGC 2F0PA 3Q22A 2XVSA 3HOXG 2MPMA 2XN9C 1ZXTA 2YTXA 3GTJH 1S5BD 2RKSA 4ABNA 2EOTA 5M3FG 1G91A 4PV1C 2XWBB 1JB7A 3PF4A 4DK6C 2R92H 1SFOB 1TS5A 2ENBA 1LLRD 4PG3A 1LO5D 5C3EB 4LFBL 3RZDH 1BVSA 4K5WA 2Q2UA 1QNKA 1RHPA 1B1ZA 2B8GA 3I4MG 1LT4D 1PYSB 3S1QB 1JJGA 2D0OA 3DWPA 5M5XH 5C4XB 1UE6A 2F3WA 3G6JB 5ELBA 1D1IA 2HHHL 4I65A 3I3CA 1T5XD 3U50C 1RDPD 3K81C 4QMGA 3EBEA 2KHIA 3MVVA 1BBUA 2YU9B 1HNZL 3RD4A 4C3JG 4X62Q 1GJXA 1GOZA 1L1OB 4JI8L 4K0KQ 4DUZL 2JXMB 4B9XA 3BDLA 3E5SA 3HKZE 4FVMA 2NVXB 1CHQD 3S1RB 4NXNL 3TBIB 4DR6Q 1PH5A 1BCPC 2JJQA 2VUMB 3K57A 3I90A 4RKBA 2EY5A 5M5YB 1SYCA 4HN7A 1CSPA 1CHPD 1N8RC 2F4VQ 2QF7A 3P7JA 2L1BA 4YCUA 2OTJA 3SGIA 3TP8A 3GP7A 5J22A 1BCPD 2KCNA 4ZUJA 2JA5H 1JORA 2F0OA 2TMPA 2BOSA 4L6TB 5E7NA 2KA7A 2JA6G 1QG7A 4CDCC 3HS0C 2R7ZH 2PCFB 1STHA 3CQZH 1SMYC 2GVBA 3MAQA 2EYMA 5GAEC 3CCMA 1F2ZA 4KKTA 4GN4B 2PMZB 3R8BA 3H3VC 1BBWA 4DV1L 4APVA 4MIUA 1IBMQ 3PSIA 3AYHB 5IY0A 1AH9A 1LTBD 3MFGA 1VQ7A 1VQDA 3JC66 4P74A 4UP8A 4J6HA 3VR6A 5ELDA 1VCIA 1QB5D 2E74C 1M8AA 1D5XC 2MQHA 5A35A 2KCMA 2KENA 1UE5A 5M5WB 1I4HA 5IP9H 2L5TA 1KQSA 3OPOA 1JB3A 4JI6L 5FOBB 1CQVA 3GTKB 1U4PA 3Q6SA 2L9HA 1FNUA 2IX1A 1DOKA 2J7ZA 4FF1A 1Q82C 2R7DA 2QEJC 2BA1A 5KEEA 2NVYH 3DMUA 3RLNA 1GHJA 5C4JH 3AU7A 2JA7H 1SLJA 4LFBQ 3U4ZA 2E2IH 1EWHA 3U4VA 4JI0L 3WWVA 4FXDA 4XYQA 3RLOA 3CCLA 2NTTA 4OL7A 5IGEA 2I0QA 2ZXRA 2NVTB 2HHHQ 1HUMA 1VQMA 3CCJA 1OXXK 3BG3A 5T1IA 1NBWA 4B3SL 1HNZQ 4DUYL 1CZGA 2CFMA 3K5NA 1DYQA 4JI8Q 4QGUA 4DUZQ 2EYFA 1YJWA 1PH7A 5JEAG 4NXNQ 5GROA 1ENCA 4BA2I 5FLXc 1RTOA 1STGA 2KHSA 4DAMA 1K83B 2PQEA 2GN5A 3S16B 1HNWL 1EFID 3NTIA 3RR5A 3UI2A 4CGYB 4TSSA 3N6RA 1EYGA 2FHTA 3L2PA 3F2UA 1B9MA 1CZWA 3I72A 2QEXA 1QWYA 5CYUA 4LF8L 1B8AA 3T16A 2ZTCA 3BYYB 2KJXA 1PZJD 3M3YH 1XMQL 1X6OA 2LKVA 1QOHA 4DV1Q 3NPPA 4QF4A 1KC8C 2F0QA 1R9TB 1E3PA 2WAQE 4IFDI 1TWFH 3G4SA 1QUQB 1PZKD 3D4WA 1I50H 2L55A 3T1YL 4B3RL 4CHTB 2WB1G 5HY6A 3S2DB 1YI2A 4JI6Q 4EQPA 2MGSA 4P71A 2DNCA 2ATWA 1I4XA 1Q81C 3C1FA 3OTOL 2M2LA 4KTAA 1Y1WB 1CKNB 1Y1VH 2D5DA 3NBHA 1SMXA 1C9OA 3F1ZA 1EYCA 3TEHB 1XNQL 1EY8A 5C4HA 5ELNA 4ZUIA 4BY7B 3BZKA 1V1OA 2R3ZA 3AFQA 2OEOA 1LTTD 3D6CA 4JI0Q 4BY1G 3TS0A 3KF6B 4CDDC 3EVQA 4A3KH 1N36L 1I6VC 3DHQA 4QJFA 5C3WA 3KJOA 1LABA 1JT8A 1SNDA 1L0XB 1Q8IA 2RHQB 4ME5A 5FLXL 1UE7A 4PZ6A 3TREA 4B3SQ 5FLMH 4JI7L 1D8LA 5I9OA 4DUYQ 5FLXE 2B29A 4OO1H 3H91A 1X32A 5EPKA 4UDUC 3S14B 1UNSA 5CORA 2L12A 1F9RA 3H3VH 2HIXA 3CRKC 2QDBA 1QVCA 3OYYA 5CV7A 4JYAL 3U9SA 1TVXA 1GO3E 2F0GA 4YWMA 4RHSA 1IKLA 4KY5A 1HNWQ 4R4OA 1XNRL 2B63H 1EWCA 2HQEA 5IYBH 3GTLH 5C4XG 4OONA 4QQBX 1KD1C 1SNCA 3FEWX 1ENAA 4PMBA 5IYCG 3Q8DA 4LF8Q 1FNWA 3I4LA 2O2LD 4DXFA 1A15A 3PIO3 4ID6A 3TSSA 1BCPB 3PV0A 1K8GA 1J8IA 3J81j 4G7ZC 2SEBD 3MC0B 1I3QH 3PGZA 4HEDA 3UE1A 1QZHA 3G48A 2Z0SA 5IGCA 1Q90A 3HOVG 3EA6A 1VQ4A 1A2UA 1IYJB 1BCPF 1Q46A 4DK0A 2DJGC 1HQRD 4N9TA 1B70B 1ML0D 3K58A 2I07B 1TWCB 4UHVA 4WRDA 3T1YQ 1A62A 3OHXC 3MXGA 4B3RQ 2PYKA 2R61A 4PQXA 1RTNA 1QNUA 1YBYA 1NR4A 1PMRA 3E0EA 1FVIA 1E0BA 4JG2A 3HOUH 4NP5A 1F2MA 1HUNA 3OTOQ 3HOXB 1DGSA 2IW3A 4A3LH 5M3FB 1ICFB 1CFMA 2HDLA 1Y69U 4RGOS 1XNQQ 5EPLA 3X3MA 4C3HG 4P75A 5GADC 2UU9L 4OO1I 3J7AV 2G9HD 5C6AA 4EQNA 1F9QA 1EIHA 1NJIC 4L5SA 4X3UA 4DNRB 4DV4L 4JBMA 1U4LA 3H3VI 3I4MB 1WYDA 3TP5A 4GOPC 1DCZA 4IUQA 1ICWA 1N36Q 4XIGS 4IPHA 1C48A 3A56A 1K0RA 3SR1A 3NTHA 2JSOA 3R2TA 3TQYA 3CF5A 2DY8A 2A68C 3HOYB 4RCOA 1HHVA 1IHZA 3SK4A 2E8GA 1ET9A 2YYZA 3KLSX 4JI7Q 2X6GA 2O5IC 2JN4A 1LYLA 1WI5A 4C3JB 4I7AA 1A63A 4XQQA 4NXML 1VQKA 1V9PA 5KRUA 4R9WA 2JA5G 4JYAQ 3S2HB 2UUAL 5LL6X 3S1MB 1MSGA 4IQZA 4CKBA 3MXNB 4POFA 1XNRQ 4V0BA 3GTGB 1OXUA 5FJ8H 5KNDA 4ALPA 2R6GA 3OSOA 2D62A 1LTID 4KHZA 1LACA 3GQBA 4R4QA 4BA1I 5CV5A 2B3GA 2X6LA 2JA6B 1KRTA 5BR8L 3EROA 1L0YB 2EY6A 3PIOA 1E2ZA 1GUGA 1DOMA 2AQ1B 2F0WA 4X66L 1KLUD 4GLVB 4X64L 1STYA 4R8NA 1SNQA 4DAYA 1BNZA 3E6ZX 5IP9G 5HURA 1EU4A 3HRZC 1JJ2A 2HDMA 2Z6KC 5IGDA 1TY0A 3M4YA 5EKLA 1LTLA 2ZJRA 4WFN3 1QVGA 3IKJA 4G7HC 4A3EB 3FP9A 1PA6A 2AUKA 3CMEA 5IP7H 3MA2B 1XPRA 1H9SB 2C35B 2JA7G 1STEA 1YVCA 1KL9A 2JEAI 4GZYC 1E7ZA 1HXYD 1NTGA 4IFDG 3UE0A 1Z7TA 2UU9Q 2J4XA 4UY8C 2JQOA 5M3MH 2XGTA 4DV5L 1CTMA 4G4KA 4RHRA 5JAVA 3QO2A 3CRLC 3D4DA 3OMGA 5KYIA 4UAIA 4L63B 2CCZA 2K33A 4DV4Q 3P1HA 2UXDL 1OXTA 2F3IA 3PUVA 1V1PB 1T9HA 3MXUA 4ODGA 2YV5A 5JJIA 3S15H 3RUZA 4YIJA 1HFNA 2KQ3A 2IHEA 4XYOA 1HQMC 1V8QA 4G57A 3OMCA 1HR0L 1SE8A 2IHFA 2F0LA 4DR1L 4DV7L 4XT1B 3M4QA 1RJTA 3HKZG 2VW9A 2H4OA 4NXMQ 4A3BH 3PUZA 5ELEA 2AKWB 3HOZB 4F8MA 3PF5A 3K6OA 2UUAQ 4BY7G 2QA4A 4ZKCB 1TWAH 1SE2A 2Y0SG 3CCUA 3BDOA 3I4NH 2K01A 1SYFA 4GN5A 3K7AB 3QB3A 4A3IH 1RODA 1W6KA 1WCMH 4OWWB 1F9PA 1F2YA 4OHJA 3NEMA 4F87A 4LW1A 1STNA 3NWTA 5LMNL 3GTQB 3J7A5 2PI2E 2PO4A 1VQ9A 1BR9A 4V190 3OWFA 5L37A 1B4OA 2VY3A 3M9BA 3W1GA 2OT2A 4X66Q 1PH3A 2PMZE 4X64Q 3RZOB 4JV5L 1SYEA 1NE3A 2CQAA 3URYA 1SXTA 3GTPH 3S17H 1II3A 2KOLA 2A74C 1GUSA 1IYVA 2EYJA 2K5WA 1Y1VG 1QZGA 3Q0AA 3D4RA 2LFNA 2PQAA 3J7ZC 1EU3A 1AW7A 3CHBD 2WB1B 1AZPA 4RFBA 3GTOB 1JWUD 4R8IA 2EVBA 1K73C 4A3GH 3I7FA 2BA0A 5TSSA 2LS01 1MD2D 1PYBA 3BU2A 4C3IH 4KI0A 4H0LC 4RWSC 3CU7A 1EEFD 1VS0A 4YY3L 1ONLA 4DV5Q 1FR3A 4IALA 5H1SE 2EYLA 5J3BA 4A3KG 1KDBA 4RGTA 1VF7A 4H13C 1Q1EA 3UDFA 2UXDQ 3MEFA 3KOJA 1SFOH 2SDFA 2R7FA 3C46A 5J39A 4LF4L 2LXKA 4RAUC 3R3OA 3ZJYC 2A6EC 4A3JG 1B3QA 1EQVA 2RCNA 1YJ9A 3KFUA 4OO1G 1HR0Q 3SEBA 1YHAA 4GLAC 2K50A 4DR1Q 2A6ED 4DV7Q 4DFAA 1B9NA 1G6ZA 1XWEA 4M8AA 2E76C 1PTOC 4FXKC 4GOPB 4B3MQ 1CQFA 2V4DA 4AYBG 3RLFA 1S5ED 3I91A 3DEPA 4H44C 1KAAA 2KBNA 4FP5D 4CJ0B 1VQCA 2HCCA 4CJ2C 1LTRD 1PTOD 1JOKA 3KF8A 3H15A 5DNFA 4K2KA 1HJPA 4A4IA 1U5KA 3PO2B 2E2JH 1SNPA 5M5YH 3L0OA 4FYDA 4IOCA 5LMNQ 4LUZA 3HOYG 4DV3L 1NSNS 2Z6KA 5C0XH 4BBRB 3KBXA 4LF6L 1SNMA 2KHJA 3NSWA 1EQQA 1XXGA 4JBKA 3SK6A 5IE8A 2NYZD 3ER0A 4JOIC 3HOVB 4JV5Q 1LV9A 2GVAA 4ZLTF 1WTRA 2CKZB 1YHQA 3FKIH 3HOUG 5EPJA 5BN3A 2ASBA 2F0KA 2PI2A 4A3LG 4IPGA 2K14A 4IURA 2DGYA 1HFGA 3G71A 3K0YA 1EFWA 2EJGC 3W5OA 2R92B 1CKMA 4ZYSA 1BUVT 2IX0A 2DY7A 3VR2A 4PNYA 3L3OC 4KK7A 1QJOA 4O2DA 3OW2A 3RZDB 4YY3Q 1VQEA 1PV4A 3DM3A 1EY9A 3EQLC 5C5LA 4LK1C 3VA5A 1JMCA 4C3HB 1EEID 3OOCA 4QB4A 4WJWA 3HG9A 5M5XB 1K0SA 3DWAA 3PQIA 4A93H 2NBFA 1K8MA 3Q23A 3HFZB 3BVMA 4A3CH 1K8OA 1WTQA 2B2VC 1SMYD 4LF4Q 2I46A 1TS3A 1VMPA 4O1NA 3PUXA 4ZRZA 4X6AH 2BCOA 1YNJC 1Z9FA 4A3EG 4EGVA 2F3VA 1YIJA 3DLLA 2K5HA 4DNTB 4JW0A 3BVGA 2DUDA 4ZQ3A 5AJ3L 1FD7D 4Y7NH 1K28A 1YNJD 1LTGD 4LUVA 3OWEB 4GNXC 1BBXC 5IYDG 2SNSA 5FJ8G 1OTCA 1WTOA 1EOVA 2ZXPA 3VDYA 3VYUA 3T1HL 2JA5B 5KNCA 1JOQA 5DAUA 2XRSD 2F0DA 4N8FA 4Q0FA 2GA4B 2CHBD 2O4XA 2EDGA 4BBSH 2D9UA 2R7ZB 3CQZB 4K6LA 1K83H 4JC0A 3E9HA 3WDNA 4ZKBB 3CC7A 5CR3A 2MO1A 4DV3Q 1STBA 3A8KE 2MHVA 4HIOA 3TP7A 5E4WC 4LF6Q 1CUKA 1O7ZA 2XSCA 3A54A 4JBWA 3U58A 1SROA 4DU9A 4A3MH 4MNOA 2F0EA 3HOZG 3OIPA 1EZ6A 1MIUA 2IY5B 5IP7G 1EWIA 4DAPA 4C2MH 2BH2A 1HR0W 5EJWA 3QG1A 5BN4A 5C44H 2OWOA 2Z9HA 3TS2A 4TVAB 4KD3A 3K5LA 2FFKB 5M3MG 3QIAA 3VR3A 2NVYB 1DM0B 4JVZA 5C4JB 2JA7B 3NP8A 3MFYA 4RKLA 1D1KA 3EN2A 4ULLA 4NKLA 2EE1A 3STBC 4YHHL 2E2IB 3DXJC 5CV8A 1HH2P 4QUCA 1PTOH 3ULPA 5K36H 1YEZA 1JC7A 5J1ZA 3K59A 4B9WA 3SE0A 1UWVA 1PH1A 1O80A 1ILPA 4A3DH 2K4KA 1EY4A 5LMNW 5EAYA 4OX9L 3NHHA 1P16A 1B3AA 1HCZA 1C4QA 4EQ5A 1HPCA 3GV6A 2V1CC 4DV6L 5AJ3Q 4MZ9A 3RN2A 2G5DA 4HJ9A 1EY6A 2NUCA 2JE6I 2NN6H 2NWGA 1KNEA 3HKZB 4X65L 3E0JA 1GUWA 1VQGA 4LMQD 3GDEA 4A3IG 3T1HQ 1PH6A 4KY7A 1Y8PB 1WCMG 4I7ZC 1KRSA 2KVMA 3CW2C 1YNNC 2Y0SB 2UXBL 2CWAA 1CM9A 1VQHA 2SOBA 1P8LA 3LX0A 5FK9C 3U9OA 1VQ8A 3M3YB 2Q8RE 4JOIA 2QDLA 4K8JA 1F9SA 4HIDA 5CGKA 3HOWH 1VQOA 3FPPA 4LJZC 3NXWA 4WJ4A 4QY7A 2I5LX 4OWTB 3D31A 2AUJD 1TWFB 4ME3A 3GV3A 3O13A 1I50B 2XTIA 2AHOB 1NR2A 2E75C 2R93H 3NBHB 1SN8A 1D7QA 4KJNA 2JK8A 1EY0A 1G2TA 1YJNA 4UP7A 4C3IG 3S24A 4FF3A 3CPWA 1Y1VB 1JE4A 3HKSA 3PO2G 1JOOA 4J1MA 1GKHA 1J5EL 5I4DA 2RBMA 4HR7B 5FO7B 1CT1D 2H1EA 2RF4A 2B2VA 1Q8KA 2HCIA 2B2UC 4EVOA 4YHHQ 1JJCB 3WOFA 2K7VA 4BBRG 5BN5A 4A75A 1UEBA 1SJHD 4NMZA 3K80C 4CKEA 1B50A 2D0PA 4BWGB 1IW7C 4A3KB 3JAML 3FHWA 2JEBI 1DZ1A 3C2PA 1SDFA 2AWNA 2A6HC 2F0VA 3QJYA 4A3FH 1UUPA 1FYCA 1X3FA 4GNXA 4H7BA 2Z8LA 4OX9Q 2X69A 3S1NH 4A3JB 5D14A 4DV6Q 3SXHA 2MNAA 3BZDB 2WACA 4KY6A 1TIID 2L15A 2R92G 5C0XJ 4X65Q 1VMCA 4RGNA 1D5MC 4DK3C 2WP8J 1K8AC 2B39A 4AYBB 1A3VA 2WIIB 2B63B 1E1OA 4C3JH 2D2CC 2FINB 2XWJB 4J8QA 3CAMA 2UXBQ 1LM0A 4RMFA 3EFXD 2F0HA 1N32L 2CVRA 2RQXA 1SE3A 1DOLA 3S1MH 4KN4C 1I4GA 4JI1L 4LFCL 1AFPA 1EIYB 1I3QB 3PMFA 4DR2L 5JPNC 3ITPA 3VYTA 2K1BA 5JVG3 3FKIG 5JJLA 4XQJA 2K32A 1V43A 2A68D 1GD7A 1Z47A 5D65A 5DLQE 2WAQB 4RGMA 1SR3A 2PW5A 1ET6A 2A1AA 3CCQA 1A3TA 2MUYA 4KJOA 3HOUB 1PVOA 5KGUA 1PRTC 4JI5L 4R4TA 5IT9c 1LTSD 1Y14B 3TP6A 1YNXA 4MTNA 2AWOA 1IBLL 3J80c 3I70A 2WB1E 1J5EQ 2R7ZG 2ZTEA 1PRTD 3KDFA 2B2TC 1XPOA 3Q24A 2ZJPA 4IUNA 1STAA 2RDHA 1SNOA 4L5TA 5FKAC 4G7OC 5DEHA 5ELFA 1BOSA 4JI3L 3C3LA 1V1QA 5CV4A 3K5OA 2KEDA 1B2TA 2F0MA 2LXJA 3A55A 4K6DA 1L1OC 3FVQA 4TRDA 1IL8A 2EJFC 3LGJA 3PUYA 5DM63 5CBAE 2PNRC 2K05A 1Q12A 3H0GH 2JA8H 2LMCB 3T56B 1OXSC 4DAVA 1LTAD 2H5XA 2ZJQA 3A74A 1X65A 1UAPA 1NAPA 4OIKA 5E3FA 3PO3H 5A2QL 1YHBA 2K28A 2G9DA 1RCVD 2AMCB 3A7LA 3KYHC 2ZTDA 5DM73 2J0TD 3ULJA 2FMMA 1SYGA 3W1BA 5A2QE 4IJHA 4KKUA 2B2WA 3D3RA 3VYSA 3NELA 3D8GA 3OIQA 1WFQA 1CKOA 5I6WA 4BBSG 3NQTA 3NK9A 2OCEA 1IYUA 1WTWA 1D2BA 5GQOA 1X55A 4GS3A 1WOCA 2HT1A 3QWNA 5JEAH 2KCTA 1N32Q 4HCSA 4DAYB 1MJCA 4JI1Q 1C0AA 4K14A 5LHY1 4MTKA 1YITA 4LFCQ 3FRPB 5IODA 4A3MG 4RA8A 4DR2Q 2EPBA 3RNUA 5HGTA 2N49A 1RF2D 3A0JA 5E4XA 5IT9L 1CSQA 3KJPA 3J80L 5T1GA 2VQEL 2FXQA 2PPBC 2F0FA 5IT9E 5C44G 3CKIB 4B3ML 3KLWA 4YWKA 2N55A 3IRBA 3J80E 1XYIA 3J7AF 4GN3B 2B2UA 2WFWA 2K5DA 4B08A 5I9PA 4JI5Q 4HCEA 2E2HH 1JWSD 1AE3A 1IBLQ 1XMOL 5I2XA 1A8VA 3AMUA 1JQYD 4E6IA 2NVQH 3M4OH 2EIFA 1ESRA 3H94A 4PZ7A 1PFSA 2F0IA 5M3MB 3J80i 1WTVA 1O7IA 3F8TA 3NENA 4RH6A 1PH9A 3NBIA 3ND8A 2VQFL 4Y52H 4JI3Q 4N8X1 3GTMB 2KUMA 4A3DG 1PFNA 1BDOA 3W2DA 3FDTA 1TWGB 1WD0A 2NB0A 4OWXB 4LF9L 3S15B 4RG1A 2EYPA 2F0TA 1PH2A 1VQJA 3GO5A 4ZK9B 5C4ZA 1EZ8A 3KUPA 4U673 4WJ3M 2XRQD 1C8CA 4BY1H 1XPUA 1NCVA 3G7LA 5D3DA 4A3BB 2UXCQ 2YTVA 3PCOB 3EJIA 3DM1A 1I6HB 3IFTA 1QCBD 1IL2A 1TWAB 5ISRA 1TWHH 2K52A 2PNHA 2L0CA 3I4NB 1SRUA 3S9WA 4NDXA 4A3IB 2QKIC 3CC2A 5HGQA 5I2YA 2XNAC 3I2ZA 3IL8A 4KD4A 1WCMB 4S3SA 1WTHA 5IGFA 1N33L 3V96A 3X3NA 1PYWD 3SK5A 2NZHA 5JJKA 2A69C 1UEAB 5C3EH 3UDIA 4H02A 5FLMG 1G8ZD 3TDQA 1VQNA
chains in the Genus database with same CATH topology
3HP3A 4K5XA 2A69D 1A2TA 2BDOA 1ESFA 4ILWA 2CW0C 4XXEA 1CA6A 3GTPB 2OF1A 1ZYRC 2CW0D 2B2TA 1X3PA 3MZ5A 4DA2A 4A3GB 1ZYRD 1EL0A 3M85A 4C3IB 5EGTA 2XIWA 2B8FA 3NE5B 2F0UA 2Q8IB 1E2WA 5JOBA 1SYBA 4CKCA 4Z9CB 3L9AX 1SSOA 3KBGA 3T4AC 3MXPA 4XTCS 4C1NK 3KLRA 4XQNA 3D6WA 5C3XA 1W6JA 1SAPA 1PRTB 2MJ8A 2M00A 1Q3LA 1I4PA 4HMJA 1F77A 1Y8NB 1PRTF 4OIJA 2ZXOA 4FF2A 2C9OA 2RSOA 3GTJB 4HSVA 2C5CA 3ERQA 1IKMA 2F03A 2WINB 1S5CD 3SHLA 2VXWA 1LT5D 2E2JB 1BO0A 3LWEA 3QOJA 2Z4HA 4QIWB 1DONA 4KHVA 2RDGA 1H9MA 4XDXA 1BF4A 1TKWB 3VR5A 2Z1CA 1KTKA 1S4ZA 5E1FA 4QUFA 3R2IA 3FKIB 2LY7A 5C0XI 1CI3M 1EQTA 2DNEA 4XT3B 5IGGA 1B44D 2SNMA 4DN4M 5EKIA 4TKOB 5IOCA 3H09A 1HTPA 2A73B 4KN7C 1X3QA 4KV6A 5EBCA 3SK8A 1AN8A 4K2LA 1HA6A 1E2VA 1I4RA 4A93B 1SEBD 3SVMA 2WV6D 2KECA 1H9JA 1XX8A 1SYDA 4IFDH 5CC4A 2Q8TA 3BYTB 2NZ1D 1WVLA 4MN3A 4MHEA 4C56C 5G3LD 1LT3D 2IX3A 1A3UA 5JEAJ 4Y7NB 3WOEA 3DWQA 4HSPA 1OO9B 2B2YA 2RSNA 3W3AA 1H9KA 1OXVA 3RMHA 5IGBA 4EQOA 3A7AB 1PFBA 3TN2A 2OXPA 4BBSB 2QCPX 2ZT9C 5JJZA 1JR0D 4IUTA 1A6XA 4F88A 4Q5VA 3PIP3 2F0NA 1BQQT 3H6MA 1DD2A 4IUVA 4A3MB 1Q1BA 1TU2B 4X3SA 5FO9B 2ID0A 3LNNA 4X3KA 1GUTA 3K5MA 2HUGA 1KDCA 4C2MB 3VA7A 5C44B 1TS4A 1KDAA 4F7XA 2RA4A 1R4PB 3TZUA 2EYOA 1QILA 2FJ2A 2E2DC 2K04A 4IUUA 3NQIA 4M1UB 3VYRA 4U68A 2PW7A 1YNND 2B2WC 1PTOB 3A8JE 1VDZA 1S5DD 1M4VA 1BXTA 3M7GA 1PDQA 4LAAA 1G2SA 1WTPA 2KEEA 4A3DB 1PTOF 1TS2A 4KKSA 5IIFA 2NTSA 3MWYW 5JVH3 1HRJA 3MEHA 1TR5A 2EXZA 5CMDA 2JYOA 2WKCA 1ZKOA 3HEJA 5K5PA 4DXGA 1XTCD 3T13A 1FGBD 5ELCA 1U9RA 4P2CB 1F2LA 2K5QA 3I8ZA 4FNFA 4HMIA 4TQUS 2N88A 2NN6I 1I4QA 1RD9D 1ENFA 5I6YA 5CV6A 2F0SA 3LWUA 3JAME 3KLSA 3HOWB 1IW7D 4HAEA 4PMCA 2A6HD 3ND9A 5LL6S 1SE4A 2R93B 1EYDA 1G291 1MSHA 3FMCA 2QILA 1SBBB 1Z6HA 1Y8OB 2WKDA 3TMEA 3TZDA 3T51B 1EYAA 3VR4A 1LT6D 1ILQA 3GTLB 1T5EA 4QCLA 2FMCA 2RDFA 5KYLA 2RVLA 2M9VA 4FF4A 1KNAA 4DK1A 1CA5A 4PMWA 5FO8B 1DXMA 5C0XG 1U4MA 1DJRD 2K6AA 4L8JA 1O7YA 2EY1A 3P20A 3I73A 2ICIA 4A3FB 1TY2A 3MXNA 5EBDA 4IUPA 1D5ZC 4FO2A 1R4QB 3S1NB 2IT1A 3NTKA 2EJMA 2IL8A 3HGBA 1H9RA 2VNUD 3BDCA 1WD1A 3BS1A 1O7LA 4IN3A 4ZAIA 3AB9A 2IWHA 5G3LF 1NUCA 4C1NI 3NUCA 1GUNA 1D6EC 3BVZA 1EY7A 2K03A 1H9SA 3GD7A 1B53A 4KMUC 2AQ3B 5C5MA 1EOTA 1AP0A 2O5JC 2F0JA 1RKNA 1CK1A 5M9OA 1V1PA 1O78A 2AQ2B 4IFDJ 2EZVA 1PLFA 2PZWA 4X3TA 1MGSA 2F4IA 1JWMD 4DGZA 3P75A 3C1EA 4O42A 5COYA 5F2DA 2KCCA 1VF5C 1MI2A 1WTXA 2IPKD 5KIXA 4IZ8A 2JP1A 3H0GB 2JA8B 3ZYYX 4WORA 4JK1C 3DUZA 1KLGD 3FPUB 3DEOA 3T53B 2F1MA 3PO3B 4K5VA 4FXGC 5JPMC 4HTHA 1KABA 1GHKA 3IFDA 1GUOA 4BS9A 3J7YW 2A5HA 1AEXA 3IAYA 5D3IB 2MP1A 1EIGA 2ICEC 1GXDC 3QOLA 2L4NA 1J9OA 5K36G 2VB3X 3HZXA 5EKKA 2IJ0A 3SDZA 1HA5A 2VB2X 1HTLD 2Z4IA 5NUCA 4DF7A 1ZEQX 1PFMA 3V05A 1AZQA 3A8IE 2L11A 2NN6G 4K8IA 2EY2A 1U4RA 2PZUA 1MBYA 5EQ0A 3N52A 2E2HB 3MTSA 3M7NA 4CJ1B 3PUWA 1EY5A 3M4OB 2NVQB 1JCKB 4NW2A 1S5FD 3V2TA 1SJED 2B2YC 1FNVA 3KK7A 2BDNA 1TT2A 4OGQC 3J81L 3R93A 4CBVA 3J81E 3NWSA 3L7ZC 5CBEE 5KNBA 2TSSA 1QE6A 1TQOA 3S17B 1PZID 4BY1B 1JICA 2PZTA 2BE5C 4N9PA 3ONAB 1PXUA 3OW7A 2DN8A 4RCNA 5CV9A 3MHBA 2EYHA 2BE5D 5AFWA 1TWHB 2F0PA 3Q22A 2XVSA 2MPMA 2XN9C 1ZXTA 1S5BD 2RKSA 4ABNA 2EOTA 1G91A 4PV1C 2XWBB 1SFOB 1TS5A 2ENBA 1LLRD 1LO5D 5C3EB 4K5WA 1QNKA 1RHPA 1B1ZA 2B8GA 1LT4D 3S1QB 3DWPA 5C4XB 2F3WA 3G6JB 5ELBA 1D1IA 4I65A 3I3CA 1T5XD 1RDPD 4QMGA 3MVVA 2YU9B 3RD4A 4C3JG 1GJXA 1GOZA 2JXMB 4B9XA 3BDLA 3E5SA 4FVMA 2NVXB 1CHQD 3S1RB 3TBIB 1BCPC 2VUMB 3K57A 3I90A 4RKBA 2EY5A 5M5YB 1SYCA 4HN7A 1CHPD 2QF7A 3P7JA 2L1BA 3TP8A 3GP7A 5J22A 1BCPD 2KCNA 4ZUJA 1JORA 2F0OA 2TMPA 2BOSA 4L6TB 2KA7A 1QG7A 3HS0C 2PCFB 1STHA 1SMYC 3MAQA 2EYMA 1F2ZA 4KKTA 2PMZB 3R8BA 3H3VC 4MIUA 1LTBD 3MFGA 3VR6A 4J6HA 5ELDA 1VCIA 1QB5D 2E74C 1M8AA 1D5XC 5A35A 5M5WB 1I4HA 2L5TA 1JB3A 3OPOA 5FOBB 1CQVA 3GTKB 1U4PA 3Q6SA 2L9HA 1FNUA 2IX1A 1DOKA 2J7ZA 4FF1A 2QEJC 2BA1A 5KEEA 3DMUA 1GHJA 3AU7A 1EWHA 4FXDA 4XYQA 2NTTA 4OL7A 5IGEA 2ZXRA 2NVTB 1HUMA 1OXXK 3BG3A 5T1IA 1CZGA 3K5NA 1DYQA 2EYFA 5JEAG 1ENCA 4BA2I 1RTOA 1STGA 2KHSA 1K83B 2PQEA 3S16B 1EFID 3NTIA 3UI2A 4CGYB 4TSSA 3N6RA 2FHTA 3F2UA 1B9MA 1CZWA 3I72A 1QWYA 5CYUA 3T16A 3BYYB 2KJXA 1PZJD 2LKVA 1QOHA 3NPPA 4QF4A 2F0QA 1R9TB 4IFDI 1PZKD 3D4WA 2L55A 4CHTB 3S2DB 4EQPA 2MGSA 2DNCA 1I4XA 3C1FA 2M2LA 4KTAA 1Y1WB 2D5DA 3NBHA 1EYCA 1EY8A 5C4HA 4ZUIA 4BY7B 1V1OA 2R3ZA 2OEOA 1LTTD 3D6CA 3EVQA 1I6VC 3DHQA 5C3WA 1LABA 1SNDA 1L0XB 1Q8IA 4ME5A 5FLXL 5I9OA 5FLXE 4OO1H 3H91A 1X32A 5EPKA 4UDUC 3S14B 1UNSA 5CORA 2L12A 1F9RA 3CRKC 2QDBA 5CV7A 3U9SA 1TVXA 2F0GA 4RHSA 1IKLA 4KY5A 1EWCA 2HQEA 1SNCA 3FEWX 1ENAA 4PMBA 1FNWA 3I4LA 2O2LD 4DXFA 1A15A 3PIO3 4ID6A 3TSSA 1BCPB 3PV0A 1J8IA 4G7ZC 2SEBD 3MC0B 4HEDA 5IGCA 1Q90A 3EA6A 1A2UA 1BCPF 4DK0A 1HQRD 4N9TA 1ML0D 3K58A 2I07B 1TWCB 4WRDA 3OHXC 3MXGA 2PYKA 2R61A 4PQXA 1RTNA 1QNUA 1NR4A 1PMRA 1E0BA 4NP5A 1F2MA 1HUNA 3HOXB 2IW3A 5M3FB 1CFMA 2HDLA 1Y69U 4RGOS 5EPLA 3X3MA 4C3HG 4OO1I 3J7AV 2G9HD 5C6AA 4EQNA 1F9QA 1EIHA 4X3UA 4DNRB 3I4MB 1U4LA 3TP5A 1DCZA 4IUQA 1ICWA 4XIGS 1C48A 3A56A 3SR1A 3NTHA 2JSOA 3R2TA 2DY8A 2A68C 3HOYB 4RCOA 1HHVA 1IHZA 3SK4A 1ET9A 2YYZA 3KLSX 2X6GA 2O5IC 4C3JB 4XQQA 5KRUA 4R9WA 3S2HB 5LL6X 3S1MB 1MSGA 4IQZA 4CKBA 4V0BA 3GTGB 1OXUA 5KNDA 2R6GA 3OSOA 2D62A 1LTID 4KHZA 1LACA 3GQBA 4BA1I 5CV5A 2X6LA 2JA6B 3EROA 1L0YB 2EY6A 1E2ZA 1GUGA 1DOMA 2AQ1B 2F0WA 1KLUD 1STYA 4R8NA 1SNQA 4DAYA 1BNZA 3E6ZX 5HURA 1EU4A 3HRZC 2HDMA 5IGDA 1TY0A 3M4YA 5EKLA 4WFN3 3IKJA 4G7HC 4A3EB 2AUKA 3MA2B 1H9SB 1STEA 2JEAI 4GZYC 4IFDG 1HXYD 1Z7TA 2J4XA 1CTMA 4G4KA 4RHRA 5JAVA 3QO2A 3CRLC 3D4DA 3OMGA 5KYIA 4UAIA 4L63B 2K33A 3P1HA 1OXTA 3PUVA 1V1PB 3MXUA 4ODGA 3RUZA 4YIJA 1HFNA 2KQ3A 4XYOA 1HQMC 1V8QA 4G57A 3OMCA 2F0LA 4XT1B 1RJTA 2H4OA 3PUZA 5ELEA 3HOZB 4F8MA 3K6OA 4ZKCB 1SE2A 3BDOA 2K01A 1SYFA 3K7AB 3QB3A 1RODA 1W6KA 1F9PA 1F2YA 4OHJA 4F87A 3GTQB 1STNA 3NWTA 2PO4A 1BR9A 4V190 3OWFA 1B4OA 2OT2A 3RZOB 1SYEA 2CQAA 3URYA 1SXTA 1IYVA 1II3A 2KOLA 2A74C 1GUSA 2EYJA 2K5WA 3Q0AA 3D4RA 2LFNA 1EU3A 1AW7A 3CHBD 2WB1B 1AZPA 4RFBA 3GTOB 1JWUD 4R8IA 2EVBA 2BA0A 5TSSA 2LS01 1MD2D 4KI0A 4H0LC 4RWSC 3CU7A 1EEFD 1ONLA 1FR3A 4IALA 2EYLA 1KDBA 4RGTA 1VF7A 4H13C 1Q1EA 2SDFA 3C46A 5J39A 4RAUC 3R3OA 2A6EC 1EQVA 4OO1G 3SEBA 2A6ED 4DFAA 1B9NA 1G6ZA 1XWEA 4M8AA 2E76C 1PTOC 4FXKC 1CQFA 2V4DA 3RLFA 1S5ED 3I91A 3DEPA 4H44C 1KAAA 4FP5D 4CJ0B 2HCCA 4CJ2C 1LTRD 1PTOD 1JOKA 3KF8A 5DNFA 4K2KA 3PO2B 1SNPA 4FYDA 1NSNS 5C0XH 4BBRB 3KBXA 1SNMA 3NSWA 1XXGA 3SK6A 2NYZD 3HOVB 1LV9A 4ZLTF 1WTRA 5EPJA 5BN3A 2F0KA 4IURA 1HFGA 3K0YA 2EJGC 2R92B 4ZYSA 1BUVT 2IX0A 2DY7A 3VR2A 4PNYA 3L3OC 4KK7A 1QJOA 3RZDB 1EY9A 3EQLC 5C5LA 4LK1C 3VA5A 4C3HB 1EEID 3OOCA 4QB4A 4WJWA 3HG9A 5M5XB 3DWAA 2NBFA 1K8MA 3Q23A 3BVMA 1K8OA 1WTQA 2B2VC 1SMYD 2I46A 1TS3A 1VMPA 4O1NA 3PUXA 4ZRZA 2BCOA 1YNJC 4EGVA 2F3VA 4DNTB 3BVGA 4ZQ3A 1FD7D 1YNJD 1LTGD 3OWEB 1BBXC 2SNSA 1WTOA 2ZXPA 3VYUA 2JA5B 5KNCA 1JOQA 5DAUA 2XRSD 2F0DA 4Q0FA 2GA4B 2CHBD 2O4XA 2EDGA 2D9UA 2R7ZB 3CQZB 4K6LA 3WDNA 4ZKBB 5CR3A 1STBA 3A8KE 2MHVA 3TP7A 5E4WC 1O7ZA 2XSCA 3A54A 4JBWA 4DU9A 2F0EA 3OIPA 1EZ6A 4DAPA 5EJWA 3QG1A 5BN4A 4KD3A 3K5LA 2FFKB 3QIAA 3VR3A 2NVYB 1DM0B 5C4JB 2JA7B 3NP8A 3MFYA 4RKLA 1D1KA 4ULLA 4NKLA 2EE1A 2E2IB 3DXJC 5CV8A 4QUCA 1PTOH 5K36H 1JC7A 5J1ZA 3K59A 4B9WA 3SE0A 1O80A 1ILPA 1EY4A 3NHHA 1B3AA 1HCZA 1C4QA 1HPCA 3GV6A 1EY6A 2NUCA 2JE6I 2NN6H 2NWGA 1KNEA 3HKZB 3E0JA 1GUWA 4LMQD 4KY7A 1Y8PB 4I7ZC 2KVMA 1YNNC 2Y0SB 1CM9A 2SOBA 5FK9C 3LX0A 3U9OA 3M3YB 2Q8RE 4K8JA 1F9SA 5CGKA 3FPPA 4LJZC 3NXWA 3D31A 2AUJD 1TWFB 3GV3A 3O13A 1I50B 1NR2A 2E75C 4KJNA 1EY0A 1G2TA 4C3IG 4FF3A 1Y1VB 1JE4A 1JOOA 4J1MA 5I4DA 2RBMA 4HR7B 5FO7B 1CT1D 2H1EA 2B2VA 2HCIA 2B2UC 4EVOA 3WOFA 2K7VA 5BN5A 1SJHD 4NMZA 4CKEA 1B50A 4BWGB 1IW7C 4A3KB 3JAML 2JEBI 1DZ1A 3C2PA 1SDFA 2AWNA 2A6HC 2F0VA 3QJYA 1UUPA 1FYCA 4H7BA 2Z8LA 2X69A 4A3JB 5D14A 3SXHA 3BZDB 2WACA 4KY6A 1TIID 5C0XJ 4RGNA 1VMCA 1D5MC 2WP8J 2B39A 4AYBB 1A3VA 2WIIB 2B63B 2D2CC 2FINB 2XWJB 4J8QA 3EFXD 2F0HA 2CVRA 2RQXA 1SE3A 1DOLA 4KN4C 1I4GA 1AFPA 1I3QB 3PMFA 5JPNC 3ITPA 3VYTA 2K1BA 5JVG3 4XQJA 2K32A 1V43A 2A68D 1Z47A 5D65A 2WAQB 4RGMA 2PW5A 1ET6A 1A3TA 2MUYA 4KJOA 3HOUB 5KGUA 1PRTC 1LTSD 3TP6A 2AWOA 3I70A 1PRTD 2B2TC 3Q24A 4IUNA 1STAA 2RDHA 1SNOA 5FKAC 4G7OC 5DEHA 5ELFA 1BOSA 3C3LA 5CV4A 3K5OA 2KEDA 1B2TA 2F0MA 3A55A 4K6DA 3FVQA 4TRDA 1IL8A 2EJFC 3PUYA 5DM63 5CBAE 2PNRC 2K05A 1Q12A 2LMCB 3T56B 1OXSC 4DAVA 1LTAD 1UAPA 1NAPA 4OIKA 5E3FA 5A2QL 2K28A 2G9DA 1RCVD 3A7LA 5DM73 2J0TD 2FMMA 1SYGA 5A2QE 4KKUA 2B2WA 3D3RA 3VYSA 3D8GA 3OIQA 5I6WA 3NQTA 3NK9A 1IYUA 1WTWA 1D2BA 3QWNA 5JEAH 4HCSA 4K14A 5LHY1 3FRPB 5IODA 4RA8A 2EPBA 5HGTA 1RF2D 5E4XA 5IT9L 3J80L 5T1GA 2PPBC 2F0FA 5IT9E 3CKIB 1XYIA 2N55A 3J80E 3J7AF 2B2UA 2K5DA 4B08A 5I9PA 4HCEA 1JWSD 5I2XA 3AMUA 1JQYD 4E6IA 1ESRA 3H94A 2F0IA 5M3MB 1WTVA 4RH6A 3NBIA 3ND8A 3GTMB 2KUMA 1PFNA 1BDOA 3W2DA 3FDTA 1TWGB 1WD0A 2NB0A 3S15B 2EYPA 2F0TA 3GO5A 4ZK9B 5C4ZA 1EZ8A 3KUPA 4U673 2XRQD 1C8CA 1NCVA 3G7LA 5D3DA 4A3BB 3EJIA 3DM1A 1I6HB 3IFTA 1QCBD 1TWAB 5ISRA 2L0CA 3I4NB 3S9WA 4NDXA 4A3IB 2QKIC 5I2YA 2XNAC 3IL8A 4KD4A 1WCMB 4S3SA 5IGFA 3V96A 3X3NA 1PYWD 3SK5A 2A69C 1UEAB 1G8ZD 3TDQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H4O A; 
#chains in the Genus database with same CATH topology
 3B6Y A;  3HP3 A;  2CQO A;  4K5X A;  2A69 D;  1A2T A;  3S1Q H;  2BDO A;  4GKJ L;  2R93 G;  2PQA B;  1ESF A;  4ILW A;  5C4X H;  3AEV A;  2CW0 C;  1RIP A;  4XXE A;  1W2B A;  1CA6 A;  2VQE Q;  5IYC H;  3GTP B;  2OF1 A;  1ZYR C;  2CW0 D;  2B2T A;  1X3P A;  1KAW A;  2B63 G;  2YU9 H;  3MZ5 A;  5IYB G;  4DA2 A;  4HJ7 A;  1X3G A;  4A3G B;  1M90 C;  1ZYR D;  2A19 A;  1EL0 A;  3M85 A;  4C3I B;  5EGT A;  2XIW A;  2B8F A;  3NE5 B;  1XMO Q;  2NVX H;  4OEL B;  2F0U A;  2Q8I B;  3S1R H;  3A5Z B;  1E2W A;  2VUM H;  5JOB A;  1SYB A;  4CKC A;  4Z9C B;  1L1O A;  3L9A X;  1SSO A;  3KBG A;  3T4A C;  3MXP A;  4XTC S;  2VQF Q;  4C1N K;  3KLR A;  4XQN A;  3G6E A;  3D6W A;  4A3F G;  5C3X A;  2OQK A;  1W6J A;  1SAP A;  1PRT B;  4LNQ A;  4LF9 Q;  2MJ8 A;  4C3H H;  3AFP A;  2M00 A;  1Q3L A;  2WAQ G;  1I4P A;  4HMJ A;  4CDE C;  1F77 A;  3K0X A;  1Y8N B;  2Q2H A;  2CH4 W;  1PRT F;  4OIJ A;  2ZXO A;  3CCV A;  4FF2 A;  2C9O A;  1MHW C;  2RSO A;  4KHP L;  3GTJ B;  1VQB A;  3KF8 B;  4O0A A;  4HSV A;  4JI2 L;  2C5C A;  3ERQ A;  3CC4 A;  1IKM A;  4OXP A;  2F03 A;  2WIN B;  2MO0 A;  4GKK L;  1S5C D;  5M5W H;  2HIV A;  3SHL A;  3I56 A;  2VXW A;  3GTK H;  1U0L A;  1LT5 D;  2E2J B;  1BO0 A;  3LWE A;  4JPB W;  3QOJ A;  2HD3 A;  1N33 Q;  2Z4H A;  1HNX L;  2ZM6 L;  4QIW B;  1DON A;  4KHV A;  2RDG A;  2Y0S E;  1H9M A;  1N34 L;  4BXX H;  4XDX A;  3M4P A;  1BF4 A;  1HZB A;  4YWL A;  1TKW B;  5GAH C;  3VR5 A;  1FJG L;  2RHS B;  2Z1C A;  1KTK A;  2Q2T A;  1S4Z A;  4GKJ Q;  5E1F A;  4QUF A;  3R2I A;  2NVT H;  2ALY B;  1RL2 A;  3UDG A;  3FKI B;  2MFI A;  2LY7 A;  5C0X I;  1CI3 M;  1EQT A;  2DNE A;  1S72 A;  4XT3 B;  5IGG A;  1B44 D;  2SNM A;  2NZO A;  4DN4 M;  5EKI A;  4TKO B;  1K9M C;  5IOC A;  3RN5 A;  3H09 A;  1HTP A;  2A73 B;  3CP0 A;  4KN7 C;  2QW7 A;  1MJE A;  1X3Q A;  4KV6 A;  4B3T L;  5EBC A;  3SK8 A;  1AN8 A;  4K2L A;  1B7Y B;  1HA6 A;  1E2V A;  1VQ5 A;  1ASY A;  4LFA L;  1I4R A;  1L2F A;  1X54 A;  4DNI A;  3S16 H;  2QGQ A;  4A93 B;  1SEB D;  4IOA A;  3SVM A;  1KIX A;  2WV6 D;  1NMG A;  1J6Q A;  3AQQ A;  2EXD A;  2A8V A;  2KEC A;  1KHI A;  1EQR A;  1VQ6 A;  3H0G G;  2JA8 G;  1H9J A;  1XX8 A;  1SYD A;  4IFD H;  1K3R A;  5CC4 A;  2Q8T A;  3BYT B;  1G6P A;  2NZ1 D;  1WVL A;  4MN3 A;  1MKH A;  5IWA L;  4MHE A;  2UUC L;  3I55 A;  4C56 C;  5G3L D;  1LT3 D;  3PO3 G;  1YZ6 A;  2IX3 A;  1A3U A;  5JEA J;  4Y7N B;  4KHP Q;  4LF5 L;  1NY4 A;  4AH6 A;  3WOE A;  3DWQ A;  4JI2 Q;  4HSP A;  1R9T H;  2UUB L;  1OO9 B;  2B2Y A;  2RSN A;  3W3A A;  1H9K A;  1OXV A;  3RMH A;  5IGB A;  4EQO A;  4JI4 L;  4QL5 A;  3D0F A;  4POG A;  4GKK Q;  3S2D H;  3A7A B;  1PFB A;  2I5H A;  1QUQ A;  3TN2 A;  1N9W A;  2OXP A;  4AYB E;  1Y1W H;  4BBS B;  2QCP X;  2ZT9 C;  5JJZ A;  1JR0 D;  1HNX Q;  2ZM6 Q;  4DV2 L;  4LWC A;  4IUT A;  3STB D;  1A6X A;  3F2D A;  1HZA A;  4F88 A;  1N34 Q;  2VS1 A;  4AQY L;  4BY7 H;  1PH4 A;  4Q5V A;  1NNX A;  1CKN A;  3PIP 3;  1FJG Q;  2F0N A;  1BQQ T;  1NMF A;  3H6M A;  1DD2 A;  4IUV A;  4A3M B;  2LSS A;  3K8A A;  1Q1B A;  1TU2 B;  1C7Y A;  4A3B G;  3JAM c;  2F52 A;  1ASZ A;  4X3S A;  2N3S A;  5FO9 B;  2ID0 A;  3EIV A;  3LNN A;  4X3K A;  1GUT A;  3K5M A;  2HUG A;  4DR4 L;  1KDC A;  4C2M B;  3KF6 A;  3I4N G;  3VA7 A;  5C44 B;  1TS4 A;  1KDA A;  1BKB A;  4F7X A;  2RA4 A;  1R4P B;  4YCW A;  3TZU A;  2EYO A;  1QIL A;  4B3T Q;  2EQS A;  2FJ2 A;  2E2D C;  1IZ6 A;  3S14 H;  2K04 A;  4IUU A;  3NQI A;  4LFA Q;  4EX5 A;  4LUO A;  3I4O A;  4M1U B;  3VYR A;  4U68 A;  2PW7 A;  1YNN D;  2B2W C;  3ULL A;  1PTO B;  3A8J E;  1IXR A;  1VDZ A;  1S5D D;  1M4V A;  1BXT A;  3M7G A;  1PDQ A;  1H95 A;  4LAA A;  1G2S A;  1WTP A;  2KEE A;  4NPS A;  4UPA A;  1L0W A;  5LMU L;  1PTO F;  4A3D B;  1TS2 A;  1IBK L;  4KKS A;  5IIF A;  2NTS A;  3MWY W;  5JVH 3;  5IWA Q;  2UUC Q;  1Q86 C;  1HRJ A;  3MEH A;  1TR5 A;  2EXZ A;  4A3G G;  5CMD A;  1TXY A;  2ES2 A;  4LF5 Q;  1VQF A;  1AE2 A;  1E24 A;  2JYO A;  2WKC A;  1ZKO A;  3HEJ A;  4YCV A;  5K5P A;  2E5L L;  2UUB Q;  4DXG A;  1TWC H;  1XTC D;  3T13 A;  1FGB D;  4A3J H;  4HJA A;  4JI4 Q;  5ELC A;  1U9R A;  4P2C B;  1F2L A;  2K5Q A;  3I8Z A;  4FNF A;  4HMI A;  4TQU S;  3HOX H;  2OQ0 A;  2N88 A;  2NN6 I;  5C3E G;  1I4Q A;  1RD9 D;  1ENF A;  1JE5 A;  4DV2 Q;  5M3F H;  2K75 A;  5I6Y A;  5CV6 A;  2F0S A;  3LWU A;  4AQY Q;  1W3S A;  2CWP A;  3JAM E;  3KLS A;  4R4I A;  3HOW B;  3PIP A;  1IW7 D;  4HAE A;  3I4M H;  4PMC A;  4HJ8 A;  2A6H D;  3ND9 A;  3BJU A;  5LL6 S;  1SE4 A;  1XMQ Q;  1EYD A;  1UE1 A;  1G29 1;  1MSH A;  2R93 B;  3FMC A;  2QIL A;  1S3O A;  4AIM A;  3JAM i;  4DR4 Q;  4DR7 L;  1SBB B;  3HOY H;  1Z6H A;  3CPF A;  1Y8O B;  3UDX A;  2WKD A;  3TME A;  3TZD A;  3T51 B;  1EYA A;  3VR4 A;  1PHJ A;  2P5Z X;  1LT6 D;  1ILQ A;  2VUM G;  3GTL B;  1T5E A;  4QCL A;  2FMC A;  2RDF A;  5KYL A;  2RVL A;  2M9V A;  4FF4 A;  1KNA A;  1VQP A;  3F2C A;  4LF7 L;  4DK1 A;  3S2H H;  1CA5 A;  4PMW A;  5FO8 B;  1DXM A;  5C0X G;  1U4M A;  1DJR D;  2BH8 A;  2K6A A;  4L8J A;  2N8N A;  1O7Y A;  4GNX B;  2EY1 A;  3P20 A;  3GTG H;  4L5Q A;  1GVP A;  3I73 A;  4L5R C;  2ICI A;  4DR5 L;  1I5F A;  4A3F B;  1TY2 A;  3MXN A;  5LMU Q;  4DKA C;  5EBD A;  4IUP A;  1D5Z C;  2JA6 H;  1IBK Q;  4FO2 A;  1R4Q B;  3S1N B;  2IT1 A;  3NTK A;  2EJM A;  1E22 A;  1HZ9 A;  4P72 A;  3BZC A;  2IL8 A;  3HGB A;  4DV0 L;  2E5L Q;  1H9R A;  2VNU D;  1EIF A;  4PZ8 A;  1VQI A;  3BDC A;  1WD1 A;  4KLK A;  3BS1 A;  1O7L A;  4ZCK A;  4IN3 A;  4ZAI A;  3E9I A;  4A3E H;  1PH8 A;  4A93 G;  4A3C G;  1HZC A;  3AB9 A;  4BXX G;  1FL0 A;  2IWH A;  5G3L F;  1S40 A;  1NUC A;  4C1N I;  3NUC A;  1QVF A;  5IYD H;  4IPC A;  1GUN A;  1D6E C;  3BVZ A;  1EY7 A;  2K03 A;  4HIM A;  1Q7Y C;  1H9S A;  3GD7 A;  1B53 A;  2N78 A;  4KMU C;  2AQ3 B;  3A5U A;  4A76 A;  5C5M A;  1EOT A;  1AP0 A;  1FGU A;  2O5J C;  2F0J A;  1RKN A;  2UXC L;  1CK1 A;  1I94 L;  4DR7 Q;  4R4C A;  3KDF B;  5M9O A;  1V1P A;  4DPG A;  2K5V A;  3F2B A;  1O78 A;  3CD6 A;  2AQ2 B;  1E1T A;  4IFD J;  3CCS A;  2EZV A;  1M1K C;  1PLF A;  5ELO A;  2PZW A;  4X3T A;  1MGS A;  2F4I A;  1JWM D;  3HOZ H;  4LF7 Q;  4DGZ A;  4NB3 A;  3P75 A;  4HIK A;  3C1E A;  4O42 A;  5COY A;  5F2D A;  4J15 A;  2KCC A;  2HQL A;  1EUJ A;  4CDF C;  1VF5 C;  4IPD A;  3K7A H;  2Q2I A;  1MI2 A;  4DR5 Q;  4R1J A;  1WTX A;  2YTY A;  2IPK D;  5KIX A;  4IZ8 A;  2JP1 A;  3GTQ H;  3H0G B;  2JA8 B;  3ZYY X;  4WOR A;  3J81 c;  4JK1 C;  4UP9 A;  3GTM H;  3DUZ A;  1KLG D;  3FPU B;  2RCF A;  3ICE A;  1TWG H;  3DEO A;  4FDB A;  3T53 B;  2F1M A;  3CXC A;  4DR3 L;  3PO3 B;  4K5V A;  2Z6B A;  4FXG C;  2VZA A;  5JPM C;  4HTH A;  3E3X A;  2CH4 A;  3RZO H;  1KAB A;  1GHK A;  2I5M X;  4DV0 Q;  3IFD A;  1GUO A;  4BS9 A;  3J7Y W;  2A5H A;  1AEX A;  3CCR A;  3IAY A;  5D3I B;  2MP1 A;  1EIG A;  1Y1W G;  2ICE C;  1GXD C;  3QOL A;  2L4N A;  1J9O A;  4GLX A;  5K36 G;  2VB3 X;  3GTO H;  1LUZ A;  3HZX A;  1I6H H;  5EKK A;  2IJ0 A;  2JA9 A;  3SDZ A;  1HA5 A;  4QIW E;  2VB2 X;  1HTL D;  2Z4I A;  5NUC A;  1GM5 A;  4DF7 A;  1ZEQ X;  1PFM A;  3V05 A;  4IO9 A;  5BR8 Q;  1AZQ A;  3A8I E;  2L11 A;  1X3E A;  2NN6 G;  4K8I A;  1VQA A;  3CMA A;  2EY2 A;  1KXL A;  1U4R A;  2K5N A;  2PZU A;  1I94 Q;  1XTD A;  1MBY A;  4X62 L;  5EQ0 A;  3N52 A;  2E2H B;  1VQL A;  3MTS A;  4K0K L;  3M7N A;  4CJ1 B;  3PUW A;  1EY5 A;  3M4O B;  2NVQ B;  3K7U C;  1JCK B;  4DR6 L;  1X9N A;  4NW2 A;  1S5F D;  3V2T A;  4JBJ A;  1SJE D;  2B2Y C;  1FNV A;  3KK7 A;  2BDN A;  2F4V L;  4OEM B;  4P73 A;  1TT2 A;  4OGQ C;  3HOW G;  3J81 L;  3R93 A;  4CBV A;  4GOP A;  4IJL A;  3PO2 H;  3J81 E;  3NWS A;  1K3B C;  3L7Z C;  5CBE E;  5KNB A;  1A0I A;  2TSS A;  1QE6 A;  3CCE A;  2OTL A;  1TQO A;  3S17 B;  1PZI D;  1IBM L;  4BBR H;  4BY1 B;  1JIC A;  2PZT A;  1G51 A;  2BE5 C;  2VL6 A;  4N9P A;  3J81 i;  3ERS X;  3ONA B;  4JCV E;  1PXU A;  3OW7 A;  4DR3 Q;  1WJJ A;  4HJ5 A;  2DN8 A;  3TRZ A;  4RCN A;  3QR8 A;  5CV9 A;  3MHB A;  2EYH A;  2BE5 D;  2DJF C;  5AFW A;  3HOV H;  1TWH B;  1X56 A;  1XJV A;  5GAG C;  2F0P A;  3Q22 A;  2XVS A;  3HOX G;  2MPM A;  2XN9 C;  1ZXT A;  2YTX A;  3GTJ H;  1S5B D;  2RKS A;  4ABN A;  2EOT A;  5M3F G;  1G91 A;  4PV1 C;  2XWB B;  1JB7 A;  3PF4 A;  4DK6 C;  2R92 H;  1SFO B;  1TS5 A;  2ENB A;  1LLR D;  4PG3 A;  1LO5 D;  5C3E B;  4LFB L;  3RZD H;  1BVS A;  4K5W A;  2Q2U A;  1QNK A;  1RHP A;  1B1Z A;  2B8G A;  3I4M G;  1LT4 D;  1PYS B;  3S1Q B;  1JJG A;  2D0O A;  3DWP A;  5M5X H;  5C4X B;  1UE6 A;  2F3W A;  3G6J B;  5ELB A;  1D1I A;  2HHH L;  4I65 A;  3I3C A;  1T5X D;  3U50 C;  1RDP D;  3K81 C;  4QMG A;  3EBE A;  2KHI A;  3MVV A;  1BBU A;  2YU9 B;  1HNZ L;  3RD4 A;  4C3J G;  4X62 Q;  1GJX A;  1GOZ A;  1L1O B;  4JI8 L;  4K0K Q;  4DUZ L;  2JXM B;  4B9X A;  3BDL A;  3E5S A;  3HKZ E;  4FVM A;  2NVX B;  1CHQ D;  3S1R B;  4NXN L;  3TBI B;  4DR6 Q;  1PH5 A;  1BCP C;  2JJQ A;  2VUM B;  3K57 A;  3I90 A;  4RKB A;  2EY5 A;  5M5Y B;  1SYC A;  4HN7 A;  1CSP A;  1CHP D;  1N8R C;  2F4V Q;  2QF7 A;  3P7J A;  2L1B A;  4YCU A;  2OTJ A;  3SGI A;  3TP8 A;  3GP7 A;  5J22 A;  1BCP D;  2KCN A;  4ZUJ A;  2JA5 H;  1JOR A;  2F0O A;  2TMP A;  2BOS A;  4L6T B;  5E7N A;  2KA7 A;  2JA6 G;  1QG7 A;  4CDC C;  3HS0 C;  2R7Z H;  2PCF B;  1STH A;  3CQZ H;  1SMY C;  2GVB A;  3MAQ A;  2EYM A;  5GAE C;  3CCM A;  1F2Z A;  4KKT A;  4GN4 B;  2PMZ B;  3R8B A;  3H3V C;  1BBW A;  4DV1 L;  4APV A;  4MIU A;  1IBM Q;  3PSI A;  3AYH B;  5IY0 A;  1AH9 A;  1LTB D;  3MFG A;  1VQ7 A;  1VQD A;  3JC6 6;  4P74 A;  4UP8 A;  4J6H A;  3VR6 A;  5ELD A;  1VCI A;  1QB5 D;  2E74 C;  1M8A A;  1D5X C;  2MQH A;  5A35 A;  2KCM A;  2KEN A;  1UE5 A;  5M5W B;  1I4H A;  5IP9 H;  2L5T A;  1KQS A;  3OPO A;  1JB3 A;  4JI6 L;  5FOB B;  1CQV A;  3GTK B;  1U4P A;  3Q6S A;  2L9H A;  1FNU A;  2IX1 A;  1DOK A;  2J7Z A;  4FF1 A;  1Q82 C;  2R7D A;  2QEJ C;  2BA1 A;  5KEE A;  2NVY H;  3DMU A;  3RLN A;  1GHJ A;  5C4J H;  3AU7 A;  2JA7 H;  1SLJ A;  4LFB Q;  3U4Z A;  2E2I H;  1EWH A;  3U4V A;  4JI0 L;  3WWV A;  4FXD A;  4XYQ A;  3RLO A;  3CCL A;  2NTT A;  4OL7 A;  5IGE A;  2I0Q A;  2ZXR A;  2NVT B;  2HHH Q;  1HUM A;  1VQM A;  3CCJ A;  1OXX K;  3BG3 A;  5T1I A;  1NBW A;  4B3S L;  1HNZ Q;  4DUY L;  1CZG A;  2CFM A;  3K5N A;  1DYQ A;  4JI8 Q;  4QGU A;  4DUZ Q;  2EYF A;  1YJW A;  1PH7 A;  5JEA G;  4NXN Q;  5GRO A;  1ENC A;  4BA2 I;  5FLX c;  1RTO A;  1STG A;  2KHS A;  4DAM A;  1K83 B;  2PQE A;  2GN5 A;  3S16 B;  1HNW L;  1EFI D;  3NTI A;  3RR5 A;  3UI2 A;  4CGY B;  4TSS A;  3N6R A;  1EYG A;  2FHT A;  3L2P A;  3F2U A;  1B9M A;  1CZW A;  3I72 A;  2QEX A;  1QWY A;  5CYU A;  4LF8 L;  1B8A A;  3T16 A;  2ZTC A;  3BYY B;  2KJX A;  1PZJ D;  3M3Y H;  1XMQ L;  1X6O A;  2LKV A;  1QOH A;  4DV1 Q;  3NPP A;  4QF4 A;  1KC8 C;  2F0Q A;  1R9T B;  1E3P A;  2WAQ E;  4IFD I;  1TWF H;  3G4S A;  1QUQ B;  1PZK D;  3D4W A;  1I50 H;  2L55 A;  3T1Y L;  4B3R L;  4CHT B;  2WB1 G;  5HY6 A;  3S2D B;  1YI2 A;  4JI6 Q;  4EQP A;  2MGS A;  4P71 A;  2DNC A;  2ATW A;  1I4X A;  1Q81 C;  3C1F A;  3OTO L;  2M2L A;  4KTA A;  1Y1W B;  1CKN B;  1Y1V H;  2D5D A;  3NBH A;  1SMX A;  1C9O A;  3F1Z A;  1EYC A;  3TEH B;  1XNQ L;  1EY8 A;  5C4H A;  5ELN A;  4ZUI A;  4BY7 B;  3BZK A;  1V1O A;  2R3Z A;  3AFQ A;  2OEO A;  1LTT D;  3D6C A;  4JI0 Q;  4BY1 G;  3TS0 A;  3KF6 B;  4CDD C;  3EVQ A;  4A3K H;  1N36 L;  1I6V C;  3DHQ A;  4QJF A;  5C3W A;  3KJO A;  1LAB A;  1JT8 A;  1SND A;  1L0X B;  1Q8I A;  2RHQ B;  4ME5 A;  5FLX L;  1UE7 A;  4PZ6 A;  3TRE A;  4B3S Q;  5FLM H;  4JI7 L;  1D8L A;  5I9O A;  4DUY Q;  5FLX E;  2B29 A;  4OO1 H;  3H91 A;  1X32 A;  5EPK A;  4UDU C;  3S14 B;  1UNS A;  5COR A;  2L12 A;  1F9R A;  3H3V H;  2HIX A;  3CRK C;  2QDB A;  1QVC A;  3OYY A;  5CV7 A;  4JYA L;  3U9S A;  1TVX A;  1GO3 E;  2F0G A;  4YWM A;  4RHS A;  1IKL A;  4KY5 A;  1HNW Q;  4R4O A;  1XNR L;  2B63 H;  1EWC A;  2HQE A;  5IYB H;  3GTL H;  5C4X G;  4OON A;  4QQB X;  1KD1 C;  1SNC A;  3FEW X;  1ENA A;  4PMB A;  5IYC G;  3Q8D A;  4LF8 Q;  1FNW A;  3I4L A;  2O2L D;  4DXF A;  1A15 A;  3PIO 3;  4ID6 A;  3TSS A;  1BCP B;  3PV0 A;  1K8G A;  1J8I A;  3J81 j;  4G7Z C;  2SEB D;  3MC0 B;  1I3Q H;  3PGZ A;  4HED A;  3UE1 A;  1QZH A;  3G48 A;  2Z0S A;  5IGC A;  1Q90 A;  3HOV G;  3EA6 A;  1VQ4 A;  1A2U A;  1IYJ B;  1BCP F;  1Q46 A;  4DK0 A;  2DJG C;  1HQR D;  4N9T A;  1B70 B;  1ML0 D;  3K58 A;  2I07 B;  1TWC B;  4UHV A;  4WRD A;  3T1Y Q;  1A62 A;  3OHX C;  3MXG A;  4B3R Q;  2PYK A;  2R61 A;  4PQX A;  1RTN A;  1QNU A;  1YBY A;  1NR4 A;  1PMR A;  3E0E A;  1FVI A;  1E0B A;  4JG2 A;  3HOU H;  4NP5 A;  1F2M A;  1HUN A;  3OTO Q;  3HOX B;  1DGS A;  2IW3 A;  4A3L H;  5M3F B;  1ICF B;  1CFM A;  2HDL A;  1Y69 U;  4RGO S;  1XNQ Q;  5EPL A;  3X3M A;  4C3H G;  4P75 A;  5GAD C;  2UU9 L;  4OO1 I;  3J7A V;  2G9H D;  5C6A A;  4EQN A;  1F9Q A;  1EIH A;  1NJI C;  4L5S A;  4X3U A;  4DNR B;  4DV4 L;  4JBM A;  1U4L A;  3H3V I;  3I4M B;  1WYD A;  3TP5 A;  4GOP C;  1DCZ A;  4IUQ A;  1ICW A;  1N36 Q;  4XIG S;  4IPH A;  1C48 A;  3A56 A;  1K0R A;  3SR1 A;  3NTH A;  2JSO A;  3R2T A;  3TQY A;  3CF5 A;  2DY8 A;  2A68 C;  3HOY B;  4RCO A;  1HHV A;  1IHZ A;  3SK4 A;  2E8G A;  1ET9 A;  2YYZ A;  3KLS X;  4JI7 Q;  2X6G A;  2O5I C;  2JN4 A;  1LYL A;  1WI5 A;  4C3J B;  4I7A A;  1A63 A;  4XQQ A;  4NXM L;  1VQK A;  1V9P A;  5KRU A;  4R9W A;  2JA5 G;  4JYA Q;  3S2H B;  2UUA L;  5LL6 X;  3S1M B;  1MSG A;  4IQZ A;  4CKB A;  3MXN B;  4POF A;  1XNR Q;  4V0B A;  3GTG B;  1OXU A;  5FJ8 H;  5KND A;  4ALP A;  2R6G A;  3OSO A;  2D62 A;  1LTI D;  4KHZ A;  1LAC A;  3GQB A;  4R4Q A;  4BA1 I;  5CV5 A;  2B3G A;  2X6L A;  2JA6 B;  1KRT A;  5BR8 L;  3ERO A;  1L0Y B;  2EY6 A;  3PIO A;  1E2Z A;  1GUG A;  1DOM A;  2AQ1 B;  2F0W A;  4X66 L;  1KLU D;  4GLV B;  4X64 L;  1STY A;  4R8N A;  1SNQ A;  4DAY A;  1BNZ A;  3E6Z X;  5IP9 G;  5HUR A;  1EU4 A;  3HRZ C;  1JJ2 A;  2HDM A;  2Z6K C;  5IGD A;  1TY0 A;  3M4Y A;  5EKL A;  1LTL A;  2ZJR A;  4WFN 3;  1QVG A;  3IKJ A;  4G7H C;  4A3E B;  3FP9 A;  1PA6 A;  2AUK A;  3CME A;  5IP7 H;  3MA2 B;  1XPR A;  1H9S B;  2C35 B;  2JA7 G;  1STE A;  1YVC A;  1KL9 A;  2JEA I;  4GZY C;  1E7Z A;  1HXY D;  1NTG A;  4IFD G;  3UE0 A;  1Z7T A;  2UU9 Q;  2J4X A;  4UY8 C;  2JQO A;  5M3M H;  2XGT A;  4DV5 L;  1CTM A;  4G4K A;  4RHR A;  5JAV A;  3QO2 A;  3CRL C;  3D4D A;  3OMG A;  5KYI A;  4UAI A;  4L63 B;  2CCZ A;  2K33 A;  4DV4 Q;  3P1H A;  2UXD L;  1OXT A;  2F3I A;  3PUV A;  1V1P B;  1T9H A;  3MXU A;  4ODG A;  2YV5 A;  5JJI A;  3S15 H;  3RUZ A;  4YIJ A;  1HFN A;  2KQ3 A;  2IHE A;  4XYO A;  1HQM C;  1V8Q A;  4G57 A;  3OMC A;  1HR0 L;  1SE8 A;  2IHF A;  2F0L A;  4DR1 L;  4DV7 L;  4XT1 B;  3M4Q A;  1RJT A;  3HKZ G;  2VW9 A;  2H4O A;  4NXM Q;  4A3B H;  3PUZ A;  5ELE A;  2AKW B;  3HOZ B;  4F8M A;  3PF5 A;  3K6O A;  2UUA Q;  4BY7 G;  2QA4 A;  4ZKC B;  1TWA H;  1SE2 A;  2Y0S G;  3CCU A;  3BDO A;  3I4N H;  2K01 A;  1SYF A;  4GN5 A;  3K7A B;  3QB3 A;  4A3I H;  1ROD A;  1W6K A;  1WCM H;  4OWW B;  1F9P A;  1F2Y A;  4OHJ A;  3NEM A;  4F87 A;  4LW1 A;  1STN A;  3NWT A;  5LMN L;  3GTQ B;  3J7A 5;  2PI2 E;  2PO4 A;  1VQ9 A;  1BR9 A;  4V19 0;  3OWF A;  5L37 A;  1B4O A;  2VY3 A;  3M9B A;  3W1G A;  2OT2 A;  4X66 Q;  1PH3 A;  2PMZ E;  4X64 Q;  3RZO B;  4JV5 L;  1SYE A;  1NE3 A;  2CQA A;  3URY A;  1SXT A;  3GTP H;  3S17 H;  1II3 A;  2KOL A;  2A74 C;  1GUS A;  1IYV A;  2EYJ A;  2K5W A;  1Y1V G;  1QZG A;  3Q0A A;  3D4R A;  2LFN A;  2PQA A;  3J7Z C;  1EU3 A;  1AW7 A;  3CHB D;  2WB1 B;  1AZP A;  4RFB A;  3GTO B;  1JWU D;  4R8I A;  2EVB A;  1K73 C;  4A3G H;  3I7F A;  2BA0 A;  5TSS A;  2LS0 1;  1MD2 D;  1PYB A;  3BU2 A;  4C3I H;  4KI0 A;  4H0L C;  4RWS C;  3CU7 A;  1EEF D;  1VS0 A;  4YY3 L;  1ONL A;  4DV5 Q;  1FR3 A;  4IAL A;  5H1S E;  2EYL A;  5J3B A;  4A3K G;  1KDB A;  4RGT A;  1VF7 A;  4H13 C;  1Q1E A;  3UDF A;  2UXD Q;  3MEF A;  3KOJ A;  1SFO H;  2SDF A;  2R7F A;  3C46 A;  5J39 A;  4LF4 L;  2LXK A;  4RAU C;  3R3O A;  3ZJY C;  2A6E C;  4A3J G;  1B3Q A;  1EQV A;  2RCN A;  1YJ9 A;  3KFU A;  4OO1 G;  1HR0 Q;  3SEB A;  1YHA A;  4GLA C;  2K50 A;  4DR1 Q;  2A6E D;  4DV7 Q;  4DFA A;  1B9N A;  1G6Z A;  1XWE A;  4M8A A;  2E76 C;  1PTO C;  4FXK C;  4GOP B;  4B3M Q;  1CQF A;  2V4D A;  4AYB G;  3RLF A;  1S5E D;  3I91 A;  3DEP A;  4H44 C;  1KAA A;  2KBN A;  4FP5 D;  4CJ0 B;  1VQC A;  2HCC A;  4CJ2 C;  1LTR D;  1PTO D;  1JOK A;  3KF8 A;  3H15 A;  5DNF A;  4K2K A;  1HJP A;  4A4I A;  1U5K A;  3PO2 B;  2E2J H;  1SNP A;  5M5Y H;  3L0O A;  4FYD A;  4IOC A;  5LMN Q;  4LUZ A;  3HOY G;  4DV3 L;  1NSN S;  2Z6K A;  5C0X H;  4BBR B;  3KBX A;  4LF6 L;  1SNM A;  2KHJ A;  3NSW A;  1EQQ A;  1XXG A;  4JBK A;  3SK6 A;  5IE8 A;  2NYZ D;  3ER0 A;  4JOI C;  3HOV B;  4JV5 Q;  1LV9 A;  2GVA A;  4ZLT F;  1WTR A;  2CKZ B;  1YHQ A;  3FKI H;  3HOU G;  5EPJ A;  5BN3 A;  2ASB A;  2F0K A;  2PI2 A;  4A3L G;  4IPG A;  2K14 A;  4IUR A;  2DGY A;  1HFG A;  3G71 A;  3K0Y A;  1EFW A;  2EJG C;  3W5O A;  2R92 B;  1CKM A;  4ZYS A;  1BUV T;  2IX0 A;  2DY7 A;  3VR2 A;  4PNY A;  3L3O C;  4KK7 A;  1QJO A;  4O2D A;  3OW2 A;  3RZD B;  4YY3 Q;  1VQE A;  1PV4 A;  3DM3 A;  1EY9 A;  3EQL C;  5C5L A;  4LK1 C;  3VA5 A;  1JMC A;  4C3H B;  1EEI D;  3OOC A;  4QB4 A;  4WJW A;  3HG9 A;  5M5X B;  1K0S A;  3DWA A;  3PQI A;  4A93 H;  2NBF A;  1K8M A;  3Q23 A;  3HFZ B;  3BVM A;  4A3C H;  1K8O A;  1WTQ A;  2B2V C;  1SMY D;  4LF4 Q;  2I46 A;  1TS3 A;  1VMP A;  4O1N A;  3PUX A;  4ZRZ A;  4X6A H;  2BCO A;  1YNJ C;  1Z9F A;  4A3E G;  4EGV A;  2F3V A;  1YIJ A;  3DLL A;  2K5H A;  4DNT B;  4JW0 A;  3BVG A;  2DUD A;  4ZQ3 A;  5AJ3 L;  1FD7 D;  4Y7N H;  1K28 A;  1YNJ D;  1LTG D;  4LUV A;  3OWE B;  4GNX C;  1BBX C;  5IYD G;  2SNS A;  5FJ8 G;  1OTC A;  1WTO A;  1EOV A;  2ZXP A;  3VDY A;  3VYU A;  3T1H L;  2JA5 B;  5KNC A;  1JOQ A;  5DAU A;  2XRS D;  2F0D A;  4N8F A;  4Q0F A;  2GA4 B;  2CHB D;  2O4X A;  2EDG A;  4BBS H;  2D9U A;  2R7Z B;  3CQZ B;  4K6L A;  1K83 H;  4JC0 A;  3E9H A;  3WDN A;  4ZKB B;  3CC7 A;  5CR3 A;  2MO1 A;  4DV3 Q;  1STB A;  3A8K E;  2MHV A;  4HIO A;  3TP7 A;  5E4W C;  4LF6 Q;  1CUK A;  1O7Z A;  2XSC A;  3A54 A;  4JBW A;  3U58 A;  1SRO A;  4DU9 A;  4A3M H;  4MNO A;  2F0E A;  3HOZ G;  3OIP A;  1EZ6 A;  1MIU A;  2IY5 B;  5IP7 G;  1EWI A;  4DAP A;  4C2M H;  2BH2 A;  1HR0 W;  5EJW A;  3QG1 A;  5BN4 A;  5C44 H;  2OWO A;  2Z9H A;  3TS2 A;  4TVA B;  4KD3 A;  3K5L A;  2FFK B;  5M3M G;  3QIA A;  3VR3 A;  2NVY B;  1DM0 B;  4JVZ A;  5C4J B;  2JA7 B;  3NP8 A;  3MFY A;  4RKL A;  1D1K A;  3EN2 A;  4ULL A;  4NKL A;  2EE1 A;  3STB C;  4YHH L;  2E2I B;  3DXJ C;  5CV8 A;  1HH2 P;  4QUC A;  1PTO H;  3ULP A;  5K36 H;  1YEZ A;  1JC7 A;  5J1Z A;  3K59 A;  4B9W A;  3SE0 A;  1UWV A;  1PH1 A;  1O80 A;  1ILP A;  4A3D H;  2K4K A;  1EY4 A;  5LMN W;  5EAY A;  4OX9 L;  3NHH A;  1P16 A;  1B3A A;  1HCZ A;  1C4Q A;  4EQ5 A;  1HPC A;  3GV6 A;  2V1C C;  4DV6 L;  5AJ3 Q;  4MZ9 A;  3RN2 A;  2G5D A;  4HJ9 A;  1EY6 A;  2NUC A;  2JE6 I;  2NN6 H;  2NWG A;  1KNE A;  3HKZ B;  4X65 L;  3E0J A;  1GUW A;  1VQG A;  4LMQ D;  3GDE A;  4A3I G;  3T1H Q;  1PH6 A;  4KY7 A;  1Y8P B;  1WCM G;  4I7Z C;  1KRS A;  2KVM A;  3CW2 C;  1YNN C;  2Y0S B;  2UXB L;  2CWA A;  1CM9 A;  1VQH A;  2SOB A;  1P8L A;  3LX0 A;  5FK9 C;  3U9O A;  1VQ8 A;  3M3Y B;  2Q8R E;  4JOI A;  2QDL A;  4K8J A;  1F9S A;  4HID A;  5CGK A;  3HOW H;  1VQO A;  3FPP A;  4LJZ C;  3NXW A;  4WJ4 A;  4QY7 A;  2I5L X;  4OWT B;  3D31 A;  2AUJ D;  1TWF B;  4ME3 A;  3GV3 A;  3O13 A;  1I50 B;  2XTI A;  2AHO B;  1NR2 A;  2E75 C;  2R93 H;  3NBH B;  1SN8 A;  1D7Q A;  4KJN A;  2JK8 A;  1EY0 A;  1G2T A;  1YJN A;  4UP7 A;  4C3I G;  3S24 A;  4FF3 A;  3CPW A;  1Y1V B;  1JE4 A;  3HKS A;  3PO2 G;  1JOO A;  4J1M A;  1GKH A;  1J5E L;  5I4D A;  2RBM A;  4HR7 B;  5FO7 B;  1CT1 D;  2H1E A;  2RF4 A;  2B2V A;  1Q8K A;  2HCI A;  2B2U C;  4EVO A;  4YHH Q;  1JJC B;  3WOF A;  2K7V A;  4BBR G;  5BN5 A;  4A75 A;  1UEB A;  1SJH D;  4NMZ A;  3K80 C;  4CKE A;  1B50 A;  2D0P A;  4BWG B;  1IW7 C;  4A3K B;  3JAM L;  3FHW A;  2JEB I;  1DZ1 A;  3C2P A;  1SDF A;  2AWN A;  2A6H C;  2F0V A;  3QJY A;  4A3F H;  1UUP A;  1FYC A;  1X3F A;  4GNX A;  4H7B A;  2Z8L A;  4OX9 Q;  2X69 A;  3S1N H;  4A3J B;  5D14 A;  4DV6 Q;  3SXH A;  2MNA A;  3BZD B;  2WAC A;  4KY6 A;  1TII D;  2L15 A;  2R92 G;  5C0X J;  4X65 Q;  1VMC A;  4RGN A;  1D5M C;  4DK3 C;  2WP8 J;  1K8A C;  2B39 A;  4AYB B;  1A3V A;  2WII B;  2B63 B;  1E1O A;  4C3J H;  2D2C C;  2FIN B;  2XWJ B;  4J8Q A;  3CAM A;  2UXB Q;  1LM0 A;  4RMF A;  3EFX D;  2F0H A;  1N32 L;  2CVR A;  2RQX A;  1SE3 A;  1DOL A;  3S1M H;  4KN4 C;  1I4G A;  4JI1 L;  4LFC L;  1AFP A;  1EIY B;  1I3Q B;  3PMF A;  4DR2 L;  5JPN C;  3ITP A;  3VYT A;  2K1B A;  5JVG 3;  3FKI G;  5JJL A;  4XQJ A;  2K32 A;  1V43 A;  2A68 D;  1GD7 A;  1Z47 A;  5D65 A;  5DLQ E;  2WAQ B;  4RGM A;  1SR3 A;  2PW5 A;  1ET6 A;  2A1A A;  3CCQ A;  1A3T A;  2MUY A;  4KJO A;  3HOU B;  1PVO A;  5KGU A;  1PRT C;  4JI5 L;  4R4T A;  5IT9 c;  1LTS D;  1Y14 B;  3TP6 A;  1YNX A;  4MTN A;  2AWO A;  1IBL L;  3J80 c;  3I70 A;  2WB1 E;  1J5E Q;  2R7Z G;  2ZTE A;  1PRT D;  3KDF A;  2B2T C;  1XPO A;  3Q24 A;  2ZJP A;  4IUN A;  1STA A;  2RDH A;  1SNO A;  4L5T A;  5FKA C;  4G7O C;  5DEH A;  5ELF A;  1BOS A;  4JI3 L;  3C3L A;  1V1Q A;  5CV4 A;  3K5O A;  2KED A;  1B2T A;  2F0M A;  2LXJ A;  3A55 A;  4K6D A;  1L1O C;  3FVQ A;  4TRD A;  1IL8 A;  2EJF C;  3LGJ A;  3PUY A;  5DM6 3;  5CBA E;  2PNR C;  2K05 A;  1Q12 A;  3H0G H;  2JA8 H;  2LMC B;  3T56 B;  1OXS C;  4DAV A;  1LTA D;  2H5X A;  2ZJQ A;  3A74 A;  1X65 A;  1UAP A;  1NAP A;  4OIK A;  5E3F A;  3PO3 H;  5A2Q L;  1YHB A;  2K28 A;  2G9D A;  1RCV D;  2AMC B;  3A7L A;  3KYH C;  2ZTD A;  5DM7 3;  2J0T D;  3ULJ A;  2FMM A;  1SYG A;  3W1B A;  5A2Q E;  4IJH A;  4KKU A;  2B2W A;  3D3R A;  3VYS A;  3NEL A;  3D8G A;  3OIQ A;  1WFQ A;  1CKO A;  5I6W A;  4BBS G;  3NQT A;  3NK9 A;  2OCE A;  1IYU A;  1WTW A;  1D2B A;  5GQO A;  1X55 A;  4GS3 A;  1WOC A;  2HT1 A;  3QWN A;  5JEA H;  2KCT A;  1N32 Q;  4HCS A;  4DAY B;  1MJC A;  4JI1 Q;  1C0A A;  4K14 A;  5LHY 1;  4MTK A;  1YIT A;  4LFC Q;  3FRP B;  5IOD A;  4A3M G;  4RA8 A;  4DR2 Q;  2EPB A;  3RNU A;  5HGT A;  2N49 A;  1RF2 D;  3A0J A;  5E4X A;  5IT9 L;  1CSQ A;  3KJP A;  3J80 L;  5T1G A;  2VQE L;  2FXQ A;  2PPB C;  2F0F A;  5IT9 E;  5C44 G;  3CKI B;  4B3M L;  3KLW A;  4YWK A;  2N55 A;  3IRB A;  3J80 E;  1XYI A;  3J7A F;  4GN3 B;  2B2U A;  2WFW A;  2K5D A;  4B08 A;  5I9P A;  4JI5 Q;  4HCE A;  2E2H H;  1JWS D;  1AE3 A;  1IBL Q;  1XMO L;  5I2X A;  1A8V A;  3AMU A;  1JQY D;  4E6I A;  2NVQ H;  3M4O H;  2EIF A;  1ESR A;  3H94 A;  4PZ7 A;  1PFS A;  2F0I A;  5M3M B;  3J80 i;  1WTV A;  1O7I A;  3F8T A;  3NEN A;  4RH6 A;  1PH9 A;  3NBI A;  3ND8 A;  2VQF L;  4Y52 H;  4JI3 Q;  4N8X 1;  3GTM B;  2KUM A;  4A3D G;  1PFN A;  1BDO A;  3W2D A;  3FDT A;  1TWG B;  1WD0 A;  2NB0 A;  4OWX B;  4LF9 L;  3S15 B;  4RG1 A;  2EYP A;  2F0T A;  1PH2 A;  1VQJ A;  3GO5 A;  4ZK9 B;  5C4Z A;  1EZ8 A;  3KUP A;  4U67 3;  4WJ3 M;  2XRQ D;  1C8C A;  4BY1 H;  1XPU A;  1NCV A;  3G7L A;  5D3D A;  4A3B B;  2UXC Q;  2YTV A;  3PCO B;  3EJI A;  3DM1 A;  1I6H B;  3IFT A;  1QCB D;  1IL2 A;  1TWA B;  5ISR A;  1TWH H;  2K52 A;  2PNH A;  2L0C A;  3I4N B;  1SRU A;  3S9W A;  4NDX A;  4A3I B;  2QKI C;  3CC2 A;  5HGQ A;  5I2Y A;  2XNA C;  3I2Z A;  3IL8 A;  4KD4 A;  1WCM B;  4S3S A;  1WTH A;  5IGF A;  1N33 L;  3V96 A;  3X3N A;  1PYW D;  3SK5 A;  2NZH A;  5JJK A;  2A69 C;  1UEA B;  5C3E H;  3UDI A;  4H02 A;  5FLM G;  1G8Z D;  3TDQ A;  1VQN A; 
#chains in the Genus database with same CATH homology
 3HP3 A;  4K5X A;  2A69 D;  1A2T A;  2BDO A;  1ESF A;  4ILW A;  2CW0 C;  4XXE A;  1CA6 A;  3GTP B;  2OF1 A;  1ZYR C;  2CW0 D;  2B2T A;  1X3P A;  3MZ5 A;  4DA2 A;  4A3G B;  1ZYR D;  1EL0 A;  3M85 A;  4C3I B;  5EGT A;  2XIW A;  2B8F A;  3NE5 B;  2F0U A;  2Q8I B;  1E2W A;  5JOB A;  1SYB A;  4CKC A;  4Z9C B;  3L9A X;  1SSO A;  3KBG A;  3T4A C;  3MXP A;  4XTC S;  4C1N K;  3KLR A;  4XQN A;  3D6W A;  5C3X A;  1W6J A;  1SAP A;  1PRT B;  2MJ8 A;  2M00 A;  1Q3L A;  1I4P A;  4HMJ A;  1F77 A;  1Y8N B;  1PRT F;  4OIJ A;  2ZXO A;  4FF2 A;  2C9O A;  2RSO A;  3GTJ B;  4HSV A;  2C5C A;  3ERQ A;  1IKM A;  2F03 A;  2WIN B;  1S5C D;  3SHL A;  2VXW A;  1LT5 D;  2E2J B;  1BO0 A;  3LWE A;  3QOJ A;  2Z4H A;  4QIW B;  1DON A;  4KHV A;  2RDG A;  1H9M A;  4XDX A;  1BF4 A;  1TKW B;  3VR5 A;  2Z1C A;  1KTK A;  1S4Z A;  5E1F A;  4QUF A;  3R2I A;  3FKI B;  2LY7 A;  5C0X I;  1CI3 M;  1EQT A;  2DNE A;  4XT3 B;  5IGG A;  1B44 D;  2SNM A;  4DN4 M;  5EKI A;  4TKO B;  5IOC A;  3H09 A;  1HTP A;  2A73 B;  4KN7 C;  1X3Q A;  4KV6 A;  5EBC A;  3SK8 A;  1AN8 A;  4K2L A;  1HA6 A;  1E2V A;  1I4R A;  4A93 B;  1SEB D;  3SVM A;  2WV6 D;  2KEC A;  1H9J A;  1XX8 A;  1SYD A;  4IFD H;  5CC4 A;  2Q8T A;  3BYT B;  2NZ1 D;  1WVL A;  4MN3 A;  4MHE A;  4C56 C;  5G3L D;  1LT3 D;  2IX3 A;  1A3U A;  5JEA J;  4Y7N B;  3WOE A;  3DWQ A;  4HSP A;  1OO9 B;  2B2Y A;  2RSN A;  3W3A A;  1H9K A;  1OXV A;  3RMH A;  5IGB A;  4EQO A;  3A7A B;  1PFB A;  3TN2 A;  2OXP A;  4BBS B;  2QCP X;  2ZT9 C;  5JJZ A;  1JR0 D;  4IUT A;  1A6X A;  4F88 A;  4Q5V A;  3PIP 3;  2F0N A;  1BQQ T;  3H6M A;  1DD2 A;  4IUV A;  4A3M B;  1Q1B A;  1TU2 B;  4X3S A;  5FO9 B;  2ID0 A;  3LNN A;  4X3K A;  1GUT A;  3K5M A;  2HUG A;  1KDC A;  4C2M B;  3VA7 A;  5C44 B;  1TS4 A;  1KDA A;  4F7X A;  2RA4 A;  1R4P B;  3TZU A;  2EYO A;  1QIL A;  2FJ2 A;  2E2D C;  2K04 A;  4IUU A;  3NQI A;  4M1U B;  3VYR A;  4U68 A;  2PW7 A;  1YNN D;  2B2W C;  1PTO B;  3A8J E;  1VDZ A;  1S5D D;  1M4V A;  1BXT A;  3M7G A;  1PDQ A;  4LAA A;  1G2S A;  1WTP A;  2KEE A;  4A3D B;  1PTO F;  1TS2 A;  4KKS A;  5IIF A;  2NTS A;  3MWY W;  5JVH 3;  1HRJ A;  3MEH A;  1TR5 A;  2EXZ A;  5CMD A;  2JYO A;  2WKC A;  1ZKO A;  3HEJ A;  5K5P A;  4DXG A;  1XTC D;  3T13 A;  1FGB D;  5ELC A;  1U9R A;  4P2C B;  1F2L A;  2K5Q A;  3I8Z A;  4FNF A;  4HMI A;  4TQU S;  2N88 A;  2NN6 I;  1I4Q A;  1RD9 D;  1ENF A;  5I6Y A;  5CV6 A;  2F0S A;  3LWU A;  3JAM E;  3KLS A;  3HOW B;  1IW7 D;  4HAE A;  4PMC A;  2A6H D;  3ND9 A;  5LL6 S;  1SE4 A;  2R93 B;  1EYD A;  1G29 1;  1MSH A;  3FMC A;  2QIL A;  1SBB B;  1Z6H A;  1Y8O B;  2WKD A;  3TME A;  3TZD A;  3T51 B;  1EYA A;  3VR4 A;  1LT6 D;  1ILQ A;  3GTL B;  1T5E A;  4QCL A;  2FMC A;  2RDF A;  5KYL A;  2RVL A;  2M9V A;  4FF4 A;  1KNA A;  4DK1 A;  1CA5 A;  4PMW A;  5FO8 B;  1DXM A;  5C0X G;  1U4M A;  1DJR D;  2K6A A;  4L8J A;  1O7Y A;  2EY1 A;  3P20 A;  3I73 A;  2ICI A;  4A3F B;  1TY2 A;  3MXN A;  5EBD A;  4IUP A;  1D5Z C;  4FO2 A;  1R4Q B;  3S1N B;  2IT1 A;  3NTK A;  2EJM A;  2IL8 A;  3HGB A;  1H9R A;  2VNU D;  3BDC A;  1WD1 A;  3BS1 A;  1O7L A;  4IN3 A;  4ZAI A;  3AB9 A;  2IWH A;  5G3L F;  1NUC A;  4C1N I;  3NUC A;  1GUN A;  1D6E C;  3BVZ A;  1EY7 A;  2K03 A;  1H9S A;  3GD7 A;  1B53 A;  4KMU C;  2AQ3 B;  5C5M A;  1EOT A;  1AP0 A;  2O5J C;  2F0J A;  1RKN A;  1CK1 A;  5M9O A;  1V1P A;  1O78 A;  2AQ2 B;  4IFD J;  2EZV A;  1PLF A;  2PZW A;  4X3T A;  1MGS A;  2F4I A;  1JWM D;  4DGZ A;  3P75 A;  3C1E A;  4O42 A;  5COY A;  5F2D A;  2KCC A;  1VF5 C;  1MI2 A;  1WTX A;  2IPK D;  5KIX A;  4IZ8 A;  2JP1 A;  3H0G B;  2JA8 B;  3ZYY X;  4WOR A;  4JK1 C;  3DUZ A;  1KLG D;  3FPU B;  3DEO A;  3T53 B;  2F1M A;  3PO3 B;  4K5V A;  4FXG C;  5JPM C;  4HTH A;  1KAB A;  1GHK A;  3IFD A;  1GUO A;  4BS9 A;  3J7Y W;  2A5H A;  1AEX A;  3IAY A;  5D3I B;  2MP1 A;  1EIG A;  2ICE C;  1GXD C;  3QOL A;  2L4N A;  1J9O A;  5K36 G;  2VB3 X;  3HZX A;  5EKK A;  2IJ0 A;  3SDZ A;  1HA5 A;  2VB2 X;  1HTL D;  2Z4I A;  5NUC A;  4DF7 A;  1ZEQ X;  1PFM A;  3V05 A;  1AZQ A;  3A8I E;  2L11 A;  2NN6 G;  4K8I A;  2EY2 A;  1U4R A;  2PZU A;  1MBY A;  5EQ0 A;  3N52 A;  2E2H B;  3MTS A;  3M7N A;  4CJ1 B;  3PUW A;  1EY5 A;  3M4O B;  2NVQ B;  1JCK B;  4NW2 A;  1S5F D;  3V2T A;  1SJE D;  2B2Y C;  1FNV A;  3KK7 A;  2BDN A;  1TT2 A;  4OGQ C;  3J81 L;  3R93 A;  4CBV A;  3J81 E;  3NWS A;  3L7Z C;  5CBE E;  5KNB A;  2TSS A;  1QE6 A;  1TQO A;  3S17 B;  1PZI D;  4BY1 B;  1JIC A;  2PZT A;  2BE5 C;  4N9P A;  3ONA B;  1PXU A;  3OW7 A;  2DN8 A;  4RCN A;  5CV9 A;  3MHB A;  2EYH A;  2BE5 D;  5AFW A;  1TWH B;  2F0P A;  3Q22 A;  2XVS A;  2MPM A;  2XN9 C;  1ZXT A;  1S5B D;  2RKS A;  4ABN A;  2EOT A;  1G91 A;  4PV1 C;  2XWB B;  1SFO B;  1TS5 A;  2ENB A;  1LLR D;  1LO5 D;  5C3E B;  4K5W A;  1QNK A;  1RHP A;  1B1Z A;  2B8G A;  1LT4 D;  3S1Q B;  3DWP A;  5C4X B;  2F3W A;  3G6J B;  5ELB A;  1D1I A;  4I65 A;  3I3C A;  1T5X D;  1RDP D;  4QMG A;  3MVV A;  2YU9 B;  3RD4 A;  4C3J G;  1GJX A;  1GOZ A;  2JXM B;  4B9X A;  3BDL A;  3E5S A;  4FVM A;  2NVX B;  1CHQ D;  3S1R B;  3TBI B;  1BCP C;  2VUM B;  3K57 A;  3I90 A;  4RKB A;  2EY5 A;  5M5Y B;  1SYC A;  4HN7 A;  1CHP D;  2QF7 A;  3P7J A;  2L1B A;  3TP8 A;  3GP7 A;  5J22 A;  1BCP D;  2KCN A;  4ZUJ A;  1JOR A;  2F0O A;  2TMP A;  2BOS A;  4L6T B;  2KA7 A;  1QG7 A;  3HS0 C;  2PCF B;  1STH A;  1SMY C;  3MAQ A;  2EYM A;  1F2Z A;  4KKT A;  2PMZ B;  3R8B A;  3H3V C;  4MIU A;  1LTB D;  3MFG A;  3VR6 A;  4J6H A;  5ELD A;  1VCI A;  1QB5 D;  2E74 C;  1M8A A;  1D5X C;  5A35 A;  5M5W B;  1I4H A;  2L5T A;  1JB3 A;  3OPO A;  5FOB B;  1CQV A;  3GTK B;  1U4P A;  3Q6S A;  2L9H A;  1FNU A;  2IX1 A;  1DOK A;  2J7Z A;  4FF1 A;  2QEJ C;  2BA1 A;  5KEE A;  3DMU A;  1GHJ A;  3AU7 A;  1EWH A;  4FXD A;  4XYQ A;  2NTT A;  4OL7 A;  5IGE A;  2ZXR A;  2NVT B;  1HUM A;  1OXX K;  3BG3 A;  5T1I A;  1CZG A;  3K5N A;  1DYQ A;  2EYF A;  5JEA G;  1ENC A;  4BA2 I;  1RTO A;  1STG A;  2KHS A;  1K83 B;  2PQE A;  3S16 B;  1EFI D;  3NTI A;  3UI2 A;  4CGY B;  4TSS A;  3N6R A;  2FHT A;  3F2U A;  1B9M A;  1CZW A;  3I72 A;  1QWY A;  5CYU A;  3T16 A;  3BYY B;  2KJX A;  1PZJ D;  2LKV A;  1QOH A;  3NPP A;  4QF4 A;  2F0Q A;  1R9T B;  4IFD I;  1PZK D;  3D4W A;  2L55 A;  4CHT B;  3S2D B;  4EQP A;  2MGS A;  2DNC A;  1I4X A;  3C1F A;  2M2L A;  4KTA A;  1Y1W B;  2D5D A;  3NBH A;  1EYC A;  1EY8 A;  5C4H A;  4ZUI A;  4BY7 B;  1V1O A;  2R3Z A;  2OEO A;  1LTT D;  3D6C A;  3EVQ A;  1I6V C;  3DHQ A;  5C3W A;  1LAB A;  1SND A;  1L0X B;  1Q8I A;  4ME5 A;  5FLX L;  5I9O A;  5FLX E;  4OO1 H;  3H91 A;  1X32 A;  5EPK A;  4UDU C;  3S14 B;  1UNS A;  5COR A;  2L12 A;  1F9R A;  3CRK C;  2QDB A;  5CV7 A;  3U9S A;  1TVX A;  2F0G A;  4RHS A;  1IKL A;  4KY5 A;  1EWC A;  2HQE A;  1SNC A;  3FEW X;  1ENA A;  4PMB A;  1FNW A;  3I4L A;  2O2L D;  4DXF A;  1A15 A;  3PIO 3;  4ID6 A;  3TSS A;  1BCP B;  3PV0 A;  1J8I A;  4G7Z C;  2SEB D;  3MC0 B;  4HED A;  5IGC A;  1Q90 A;  3EA6 A;  1A2U A;  1BCP F;  4DK0 A;  1HQR D;  4N9T A;  1ML0 D;  3K58 A;  2I07 B;  1TWC B;  4WRD A;  3OHX C;  3MXG A;  2PYK A;  2R61 A;  4PQX A;  1RTN A;  1QNU A;  1NR4 A;  1PMR A;  1E0B A;  4NP5 A;  1F2M A;  1HUN A;  3HOX B;  2IW3 A;  5M3F B;  1CFM A;  2HDL A;  1Y69 U;  4RGO S;  5EPL A;  3X3M A;  4C3H G;  4OO1 I;  3J7A V;  2G9H D;  5C6A A;  4EQN A;  1F9Q A;  1EIH A;  4X3U A;  4DNR B;  3I4M B;  1U4L A;  3TP5 A;  1DCZ A;  4IUQ A;  1ICW A;  4XIG S;  1C48 A;  3A56 A;  3SR1 A;  3NTH A;  2JSO A;  3R2T A;  2DY8 A;  2A68 C;  3HOY B;  4RCO A;  1HHV A;  1IHZ A;  3SK4 A;  1ET9 A;  2YYZ A;  3KLS X;  2X6G A;  2O5I C;  4C3J B;  4XQQ A;  5KRU A;  4R9W A;  3S2H B;  5LL6 X;  3S1M B;  1MSG A;  4IQZ A;  4CKB A;  4V0B A;  3GTG B;  1OXU A;  5KND A;  2R6G A;  3OSO A;  2D62 A;  1LTI D;  4KHZ A;  1LAC A;  3GQB A;  4BA1 I;  5CV5 A;  2X6L A;  2JA6 B;  3ERO A;  1L0Y B;  2EY6 A;  1E2Z A;  1GUG A;  1DOM A;  2AQ1 B;  2F0W A;  1KLU D;  1STY A;  4R8N A;  1SNQ A;  4DAY A;  1BNZ A;  3E6Z X;  5HUR A;  1EU4 A;  3HRZ C;  2HDM A;  5IGD A;  1TY0 A;  3M4Y A;  5EKL A;  4WFN 3;  3IKJ A;  4G7H C;  4A3E B;  2AUK A;  3MA2 B;  1H9S B;  1STE A;  2JEA I;  4GZY C;  4IFD G;  1HXY D;  1Z7T A;  2J4X A;  1CTM A;  4G4K A;  4RHR A;  5JAV A;  3QO2 A;  3CRL C;  3D4D A;  3OMG A;  5KYI A;  4UAI A;  4L63 B;  2K33 A;  3P1H A;  1OXT A;  3PUV A;  1V1P B;  3MXU A;  4ODG A;  3RUZ A;  4YIJ A;  1HFN A;  2KQ3 A;  4XYO A;  1HQM C;  1V8Q A;  4G57 A;  3OMC A;  2F0L A;  4XT1 B;  1RJT A;  2H4O A;  3PUZ A;  5ELE A;  3HOZ B;  4F8M A;  3K6O A;  4ZKC B;  1SE2 A;  3BDO A;  2K01 A;  1SYF A;  3K7A B;  3QB3 A;  1ROD A;  1W6K A;  1F9P A;  1F2Y A;  4OHJ A;  4F87 A;  3GTQ B;  1STN A;  3NWT A;  2PO4 A;  1BR9 A;  4V19 0;  3OWF A;  1B4O A;  2OT2 A;  3RZO B;  1SYE A;  2CQA A;  3URY A;  1SXT A;  1IYV A;  1II3 A;  2KOL A;  2A74 C;  1GUS A;  2EYJ A;  2K5W A;  3Q0A A;  3D4R A;  2LFN A;  1EU3 A;  1AW7 A;  3CHB D;  2WB1 B;  1AZP A;  4RFB A;  3GTO B;  1JWU D;  4R8I A;  2EVB A;  2BA0 A;  5TSS A;  2LS0 1;  1MD2 D;  4KI0 A;  4H0L C;  4RWS C;  3CU7 A;  1EEF D;  1ONL A;  1FR3 A;  4IAL A;  2EYL A;  1KDB A;  4RGT A;  1VF7 A;  4H13 C;  1Q1E A;  2SDF A;  3C46 A;  5J39 A;  4RAU C;  3R3O A;  2A6E C;  1EQV A;  4OO1 G;  3SEB A;  2A6E D;  4DFA A;  1B9N A;  1G6Z A;  1XWE A;  4M8A A;  2E76 C;  1PTO C;  4FXK C;  1CQF A;  2V4D A;  3RLF A;  1S5E D;  3I91 A;  3DEP A;  4H44 C;  1KAA A;  4FP5 D;  4CJ0 B;  2HCC A;  4CJ2 C;  1LTR D;  1PTO D;  1JOK A;  3KF8 A;  5DNF A;  4K2K A;  3PO2 B;  1SNP A;  4FYD A;  1NSN S;  5C0X H;  4BBR B;  3KBX A;  1SNM A;  3NSW A;  1XXG A;  3SK6 A;  2NYZ D;  3HOV B;  1LV9 A;  4ZLT F;  1WTR A;  5EPJ A;  5BN3 A;  2F0K A;  4IUR A;  1HFG A;  3K0Y A;  2EJG C;  2R92 B;  4ZYS A;  1BUV T;  2IX0 A;  2DY7 A;  3VR2 A;  4PNY A;  3L3O C;  4KK7 A;  1QJO A;  3RZD B;  1EY9 A;  3EQL C;  5C5L A;  4LK1 C;  3VA5 A;  4C3H B;  1EEI D;  3OOC A;  4QB4 A;  4WJW A;  3HG9 A;  5M5X B;  3DWA A;  2NBF A;  1K8M A;  3Q23 A;  3BVM A;  1K8O A;  1WTQ A;  2B2V C;  1SMY D;  2I46 A;  1TS3 A;  1VMP A;  4O1N A;  3PUX A;  4ZRZ A;  2BCO A;  1YNJ C;  4EGV A;  2F3V A;  4DNT B;  3BVG A;  4ZQ3 A;  1FD7 D;  1YNJ D;  1LTG D;  3OWE B;  1BBX C;  2SNS A;  1WTO A;  2ZXP A;  3VYU A;  2JA5 B;  5KNC A;  1JOQ A;  5DAU A;  2XRS D;  2F0D A;  4Q0F A;  2GA4 B;  2CHB D;  2O4X A;  2EDG A;  2D9U A;  2R7Z B;  3CQZ B;  4K6L A;  3WDN A;  4ZKB B;  5CR3 A;  1STB A;  3A8K E;  2MHV A;  3TP7 A;  5E4W C;  1O7Z A;  2XSC A;  3A54 A;  4JBW A;  4DU9 A;  2F0E A;  3OIP A;  1EZ6 A;  4DAP A;  5EJW A;  3QG1 A;  5BN4 A;  4KD3 A;  3K5L A;  2FFK B;  3QIA A;  3VR3 A;  2NVY B;  1DM0 B;  5C4J B;  2JA7 B;  3NP8 A;  3MFY A;  4RKL A;  1D1K A;  4ULL A;  4NKL A;  2EE1 A;  2E2I B;  3DXJ C;  5CV8 A;  4QUC A;  1PTO H;  5K36 H;  1JC7 A;  5J1Z A;  3K59 A;  4B9W A;  3SE0 A;  1O80 A;  1ILP A;  1EY4 A;  3NHH A;  1B3A A;  1HCZ A;  1C4Q A;  1HPC A;  3GV6 A;  1EY6 A;  2NUC A;  2JE6 I;  2NN6 H;  2NWG A;  1KNE A;  3HKZ B;  3E0J A;  1GUW A;  4LMQ D;  4KY7 A;  1Y8P B;  4I7Z C;  2KVM A;  1YNN C;  2Y0S B;  1CM9 A;  2SOB A;  5FK9 C;  3LX0 A;  3U9O A;  3M3Y B;  2Q8R E;  4K8J A;  1F9S A;  5CGK A;  3FPP A;  4LJZ C;  3NXW A;  3D31 A;  2AUJ D;  1TWF B;  3GV3 A;  3O13 A;  1I50 B;  1NR2 A;  2E75 C;  4KJN A;  1EY0 A;  1G2T A;  4C3I G;  4FF3 A;  1Y1V B;  1JE4 A;  1JOO A;  4J1M A;  5I4D A;  2RBM A;  4HR7 B;  5FO7 B;  1CT1 D;  2H1E A;  2B2V A;  2HCI A;  2B2U C;  4EVO A;  3WOF A;  2K7V A;  5BN5 A;  1SJH D;  4NMZ A;  4CKE A;  1B50 A;  4BWG B;  1IW7 C;  4A3K B;  3JAM L;  2JEB I;  1DZ1 A;  3C2P A;  1SDF A;  2AWN A;  2A6H C;  2F0V A;  3QJY A;  1UUP A;  1FYC A;  4H7B A;  2Z8L A;  2X69 A;  4A3J B;  5D14 A;  3SXH A;  3BZD B;  2WAC A;  4KY6 A;  1TII D;  5C0X J;  4RGN A;  1VMC A;  1D5M C;  2WP8 J;  2B39 A;  4AYB B;  1A3V A;  2WII B;  2B63 B;  2D2C C;  2FIN B;  2XWJ B;  4J8Q A;  3EFX D;  2F0H A;  2CVR A;  2RQX A;  1SE3 A;  1DOL A;  4KN4 C;  1I4G A;  1AFP A;  1I3Q B;  3PMF A;  5JPN C;  3ITP A;  3VYT A;  2K1B A;  5JVG 3;  4XQJ A;  2K32 A;  1V43 A;  2A68 D;  1Z47 A;  5D65 A;  2WAQ B;  4RGM A;  2PW5 A;  1ET6 A;  1A3T A;  2MUY A;  4KJO A;  3HOU B;  5KGU A;  1PRT C;  1LTS D;  3TP6 A;  2AWO A;  3I70 A;  1PRT D;  2B2T C;  3Q24 A;  4IUN A;  1STA A;  2RDH A;  1SNO A;  5FKA C;  4G7O C;  5DEH A;  5ELF A;  1BOS A;  3C3L A;  5CV4 A;  3K5O A;  2KED A;  1B2T A;  2F0M A;  3A55 A;  4K6D A;  3FVQ A;  4TRD A;  1IL8 A;  2EJF C;  3PUY A;  5DM6 3;  5CBA E;  2PNR C;  2K05 A;  1Q12 A;  2LMC B;  3T56 B;  1OXS C;  4DAV A;  1LTA D;  1UAP A;  1NAP A;  4OIK A;  5E3F A;  5A2Q L;  2K28 A;  2G9D A;  1RCV D;  3A7L A;  5DM7 3;  2J0T D;  2FMM A;  1SYG A;  5A2Q E;  4KKU A;  2B2W A;  3D3R A;  3VYS A;  3D8G A;  3OIQ A;  5I6W A;  3NQT A;  3NK9 A;  1IYU A;  1WTW A;  1D2B A;  3QWN A;  5JEA H;  4HCS A;  4K14 A;  5LHY 1;  3FRP B;  5IOD A;  4RA8 A;  2EPB A;  5HGT A;  1RF2 D;  5E4X A;  5IT9 L;  3J80 L;  5T1G A;  2PPB C;  2F0F A;  5IT9 E;  3CKI B;  1XYI A;  2N55 A;  3J80 E;  3J7A F;  2B2U A;  2K5D A;  4B08 A;  5I9P A;  4HCE A;  1JWS D;  5I2X A;  3AMU A;  1JQY D;  4E6I A;  1ESR A;  3H94 A;  2F0I A;  5M3M B;  1WTV A;  4RH6 A;  3NBI A;  3ND8 A;  3GTM B;  2KUM A;  1PFN A;  1BDO A;  3W2D A;  3FDT A;  1TWG B;  1WD0 A;  2NB0 A;  3S15 B;  2EYP A;  2F0T A;  3GO5 A;  4ZK9 B;  5C4Z A;  1EZ8 A;  3KUP A;  4U67 3;  2XRQ D;  1C8C A;  1NCV A;  3G7L A;  5D3D A;  4A3B B;  3EJI A;  3DM1 A;  1I6H B;  3IFT A;  1QCB D;  1TWA B;  5ISR A;  2L0C A;  3I4N B;  3S9W A;  4NDX A;  4A3I B;  2QKI C;  5I2Y A;  2XNA C;  3IL8 A;  4KD4 A;  1WCM B;  4S3S A;  5IGF A;  3V96 A;  3X3N A;  1PYW D;  3SK5 A;  2A69 C;  1UEA B;  1G8Z D;  3TDQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...