2H4OA

X-ray crystal structure of protein yonk from bacillus subtilis. northeast structural genomics consortium target sr415
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
62
structure length
62
Chain Sequence
ASKKVHQINVKGFFDMDVMEVTEQTKEAEYTYDFKEILSEFNGKNVSITVKEENELPVKGVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords YonK protein
publication title Crystal structure of the hypothetical protein from bacillus subtilis (yonk).
rcsb
source organism Bacillus subtilis
molecule tags Structural genomics, unknown function
total genus 6
structure length 62
sequence length 62
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09642 YonK YonK protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.280 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2h4oA00
2H4OA
chains in the Genus database with same CATH superfamily
4O0AA 3KOJA 2E2HH 2PMZB 2K50A 1CKNB 3HOZB 2HDMA 4LK1C 2DJGC 1A3UA 1I94L 4NW2A 4O2DA 1CKNA 5IE8A 1SJED 3GTLB 4UAIA 5EKIA 5T1IA 4ALPA 2XWBB 1CZWA 1D6EC 2JA7H 1TWFH 1Q86C 5IYBH 1I6HB 1XTDA 2R93H 2LXKA 3NBHB 4BBSB 3JAMc 4DR7L 3W1BA 2RA4A 1WI5A 3T53B 1X3FA 5I9OA 4R4TA 3S1MH 3J81j 3MXGA 1SN8A 4GKKQ 1D1IA 3A0JA 4EQPA 1LABA 1MSGA 4X65Q 4LFBQ 4OONA 4WJWA 4B9XA 4NPSA 1B50A 3P20A 1IL8A 3TP5A 2A73B 1WCMH 4HIOA 5CBEE 2M2LA 1LTLA 3STBD 3G6EA 4X62L 1STYA 5M5XH 1GKHA 2GN5A 2I0QA 4NXML 5JAVA 3RZDB 5EBDA 3UDIA 3J80E 2N3SA 2JA5H 4BXXH 1B44D 2HHHQ 2PZUA 3L0OA 2JA9A 2VUMB 3D4DA 2K5WA 1RD9D 1GUSA 2RF4A 3GD7A 1ENFA 4K0KL 1B1ZA 1VMPA 2UUBQ 3GTKH 1EEID 2B2VC 4POGA 2F0GA 1HNWL 3U4VA 1U0LA 5ELDA 2F0FA 3OMCA 3FKIB 1K8AC 3SK8A 1V1QA 5D14A 1HCZA 3K0YA 2MO0A 5EKKA 1I4QA 4IUVA 4C3JG 3PF5A 4ZRZA 3DM3A 5FJ8G 1Y8NB 3NTKA 4DV1Q 1W6KA 4E6IA 3I90A 3SVMA 3HZXA 2ZJRA 2A74C 5G3LD 2JEBI 3A7AB 1NUCA 2JA8G 5IGEA 5GROA 1HZAA 2OQ0A 2RDGA 1E1TA 2B2VA 3K58A 4QCLA 3PUVA 2A6EC 2WAQB 2VZAA 2VL6A 3RNUA 3I8ZA 3CMEA 1PTOD 3OTOQ 3VA5A 1T9HA 4CBVA 3J7A5 2PO4A 1MJCA 4PZ6A 1HRJA 4TRDA 1EU3A 4YCVA 3RUZA 2WIIB 3RN5A 1STNA 3PO2H 3NXWA 4XQQA 2SNSA 2IL8A 3E9HA 2IX3A 1L1OC 1VQGA 4WJ4A 2JE6I 1LYLA 2NZ1D 4YY3Q 3S16B 4DR4Q 1H95A 4BBSG 1PH7A 4A3MG 1JJCB 3VR3A 2R61A 5EKLA 1PFNA 3TRZA 5C4JB 3BDOA 4DV6L 4C56C 1JB7A 1D5MC 3EJIA 1UE7A 1EWCA 3NEMA 4JW0A 4DV2L 4LF9L 1I50B 2D62A 1L1OB 3HKZE 3AB9A 4LAAA 3FRPB 1ILQA 4RWSC 1L1OA 2MNAA 4DK1A 1IL2A 4GZYC 3C3LA 3SK5A 4NP5A 5KEEA 5BR8Q 3D31A 1SNOA 4IUTA 4EVOA 2L5TA 1NNXA 4OX9L 3M9BA 4CJ0B 4JI2Q 1A3VA 2LMCB 4DR5L 1A15A 2J4XA 4JI8Q 1J5EQ 3OPOA 5J39A 2WFWA 3A8KE 4QGUA 1N32L 4RH6A 1N34Q 1M8AA 4C3JH 3NENA 1G6PA 5HY6A 3L3OC 4G7OC 2Z4HA 5FJ8H 1H9MA 1HQMC 4DXGA 1GM5A 1YJNA 3S15B 1QZHA 4X3UA 3SGIA 5DM73 1S72A 2JA8H 1LTSD 4HJ5A 2CH4W 3FKIG 2NTSA 4PZ8A 1YHAA 5GAHC 5BN3A 2X6LA 4X66L 2LKVA 3OW7A 3OSOA 1ILPA 1PMRA 5IP7G 1JB3A 1SNMA 1JORA 2F3IA 1SE4A 3HOZH 2HQLA 3KDFB 4BBRB 1D5XC 5LMNQ 3ERSX 5I2XA 3GTLH 1BUVT 1QUQB 2A6HD 2P5ZX 1XNQQ 1I6HH 1K8OA 2ZT9C 2UXDL 4BBSH 3EVQA 2WAQG 1VQHA 1K9MC 4A3CH 2K32A 3IL8A 3CC4A 1B7YB 2RQXA 3DWAA 1JOOA 2YU9B 2VQFQ 1IBKQ 1NSNS 1Q12A 4GLAC 1H9KA 2VNUD 3F2DA 1EIHA 3X3NA 1VQ4A 2B39A 3A8JE 1SJHD 1DCZA 5KYIA 2HT1A 4P71A 3M85A 3PUXA 1GOZA 4A93G 1Q1EA 3S24A 4DV4Q 4JI3L 3DM1A 2K01A 1FGBD 1NY4A 2TSSA 3GV6A 2NZHA 4EQNA 1LTTD 5EBCA 3RZDH 1TXYA 3TBIB 5ELNA 1AZPA 1HZ9A 3ZJYC 3KLSX 2VUMH 3EQLC 3N52A 4L63B 4LF8Q 4FYDA 2FJ2A 3MXUA 3U9OA 5E7NA 1X54A 4WJ3M 3CRKC 2GA4B 1EOTA 4GKJQ 4HSPA 4NDXA 1DJRD 1UEBA 3FKIH 3M4PA 3F1ZA 4MN3A 4FO2A 3BYYB 3RMHA 3T1HQ 3JAML 4MTKA 3ULPA 5IP7H 3DMUA 3HRZC 5C6AA 2UUCQ 4B3RL 2EXZA 5CV6A 3AQQA 2KCNA 3NP8A 3GV3A 5LL6S 3NQIA 4PQXA 5K36G 1LTBD 2RCNA 3CW2C 3MAQA 2RSNA 2A8VA 1C8CA 3NELA 2CVRA 2IT1A 3WWVA 3CCMA 4CKBA 4IUNA 4DR1L 1PYSB 4DUZQ 1QE6A 5L37A 1VQJA 3K80C 3KF8B 2Y0SB 3OW2A 1Q8KA 5IGGA 3PSIA 3TP6A 4BBRG 1E24A 2Q2UA 3CMAA 2G9DA 3OIQA 4WORA 1RTNA 2A1AA 1JOQA 3NTIA 3E6ZX 4TKOB 1AN8A 4OGQC 1LT3D 1I4RA 3S16H 2RSOA 3MZ5A 2K14A 4DV0L 3CCRA 1FGUA 5I6WA 4WFN3 5C4JH 1BO0A 3VA7A 3A54A 2VB3X 1CKMA 1S4ZA 3FMCA 5FO9B 4JBWA 2K5NA 5IGBA 1EIFA 5GAGC 1I50H 2F4VQ 1Q7YC 4DK3C 2VW9A 1LT5D 1AZQA 5EPJA 4LJZC 3F2BA 3NPPA 1LM0A 2YYZA 5ELOA 2YTXA 3T4AC 3MEHA 1B3QA 1I4XA 4LFAL 5FLXc 3H94A 3CAMA 4KKTA 4Q5VA 1SE2A 1VQNA 1BXTA 1YEZA 4GOPC 1UE1A 1EZ6A 3QB3A 5CR3A 4B3TQ 1XX8A 1ZYRC 1LLRD 3NUCA 2A69C 3U50C 1EY5A 1EWHA 1X55A 3ERQA 4CDEC 4KHPL 3D6CA 1IKMA 3CKIB 2N55A 1EWIA 3CRLC 3D8GA 2KCMA 3AMUA 2IX0A 1VQPA 2ZJPA 5K36H 3S15H 1EY6A 2FFKB 1Y1VB 3H0GH 3MXPA 2Q8IB 4GOPB 4K5VA 4PMWA 2AMCB 3GTPB 3E5SA 4AQYQ 2B63B 4GOPA 3PMFA 1STBA 1RF2D 4JBJA 2SEBD 4UP9A 2FMMA 2QW7A 4JI7L 1EQTA 1ZKOA 4BBRH 2MHVA 1UUPA 3LNNA 2JXMB 1V1PA 4ZAIA 1LTGD 1O7IA 4IFDG 3K8AA 2CCZA 1NMGA 1PA6A 2NWGA 2DNCA 3S1NB 5LMUQ 1ZXTA 2ICIA 2UUAQ 3K81C 5TSSA 4GN3B 1S5CD 4HN7A 4JI5L 1S3OA 2XGTA 2YU9H 3KBGA 2Y0SG 4P2CB 4JBKA 4EQOA 1GUGA 1Q1BA 1BOSA 2L11A 5CV5A 3U9SA 3GQBA 2DY8A 1A2UA 3FEWX 1K8GA 1F2MA 3VR2A 4AYBE 1ICWA 4LF4L 3D4RA 1WVLA 4JC0A 5M5WB 3CCEA 1QVGA 4DN4M 1GUOA 1YJ9A 2I5LX 1H9SB 4F87A 5D65A 2L55A 1H9JA 1HPCA 2BE5C 1GO3E 3J80c 2F0UA 5KNCA 1DYQA 1H9SA 3CC2A 4A3GB 2K7VA 2DY7A 1ZEQX 3F2UA 3PO3G 1HQRD 4QIWE 1E0BA 3PUYA 1U4LA 2EVBA 3R3OA 3C46A 1XXGA 3S2HB 1PFMA 4IFDI 1HA5A 3TZDA 4IN3A 1PZKD 1Q3LA 3PCOB 4L5SA 4IQZA 1T5EA 1XMQQ 4BWGB 4TVAB 1W6JA 3STBC 4X3KA 1NMFA 3QOJA 3QO2A 3MWYW 1WTVA 2E76C 4DV3Q 2PW7A 3DEPA 1IYUA 1EY0A 2EIFA 1AP0A 5EGTA 5D3IB 2FXQA 1PRTC 1IYVA 1ASYA 1X3QA 3BG3A 1II3A 1WTOA 3A56A 3A8IE 3MHBA 3NE5B 3K57A 1CSQA 4KHVA 2O4XA 3TDQA 4GKKL 4NB3A 1Y1VG 1YVCA 4OIKA 2IY5B 3ICEA 4X65L 1SEBD 4LFBL 2E5LQ 4FF1A 1MI2A 1HR0Q 1VMCA 2AQ2B 3BZCA 4DNRB 4IFDH 3TP7A 3CC7A 1AE2A 4A3FB 1F9RA 2B8FA 3NWTA 1PRTB 1Y8OB 2DN8A 4DR6Q 1TWHB 5C3WA 4J8QA 3X3MA 4K8JA 1RDPD 1I4GA 5NUCA 4RG1A 3CCJA 2SNMA 1FYCA 5IGFA 1VDZA 4X64Q 2HHHL 3KK7A 2OCEA 1D5ZC 1J6QA 4A3IB 5IWAQ 1G2SA 5CV8A 4F7XA 4JI4L 1GHJA 1E22A 4L8JA 3AYHB 2UUBL 1PZID 2M9VA 1PTOC 1WCMG 1O78A 3J81i 3M4QA 3DLLA 4FXDA 3I70A 2E8GA 2Z8LA 3NK9A 5C0XG 1VF7A 2PQAA 4A3BB 2EJGC 3HOYB 2WV6D 2JA5G 2NYZD 4XQJA 4ME5A 1NJIC 1N36L 4BXXG 4Q0FA 4O42A 4CKEA 2Z4IA 3F2CA 3D0FA 1GUNA 1VQEA 3FPUB 1VQDA 5BN5A 1BCPD 1PTOB 2F0VA 1GVPA 3CCLA 1U9RA 1YNJD 3HP3A 4A3GG 4DF7A 1O80A 1KD1C 5GAEC 3AFQA 2RHSB 2KUMA 4KD4A 3BZDB 3A55A 1LTRD 1WTHA 2LY7A 3OTOL 4LW1A 3H15A 1L2FA 1TS2A 1IYJB 2DNEA 3K5OA 2F0KA 1SDFA 4LUOA 3E0JA 1Y1VH 3MVVA 1SNPA 2F1MA 1UNSA 3E3XA 2WB1B 5EPLA 2G5DA 4YY3L 1WTPA 5C0XI 3GTPH 5C3XA 2B63H 3QIAA 4RKLA 2K04A 3U58A 4IUPA 3UI2A 4DR3Q 1PRTF 2LSSA 2FINB 4JV5L 4DNIA 1Q90A 3B6YA 1WD0A 1HNZQ 1SFOB 5DAUA 3HOVB 3VYSA 5H1SE 3CPFA 4LF5Q 3PO2G 2NN6I 3K7AB 2ASBA 1VQCA 1SNQA 1MIUA 2BH2A 2OTJA 4TQUS 1Y8PB 4HIDA 4MTNA 5I9PA 4IUQA 3OOCA 1G91A 1KDAA 3S1NH 4HCSA 1O7YA 3JC66 2EY1A 1K0RA 2E2DC 4RKBA 4IOCA 4OL7A 5BR8L 3PIOA 4GLXA 1ICFB 5FLXL 1CQVA 1IHZA 5EAYA 4JI2L 1HXYD 5C0XH 2D2CC 1EEFD 1IW7D 4JI8L 4F8MA 1J5EL 3LWUA 4IURA 2NB0A 4HJ8A 2AUJD 1N34L 4BY7B 2EYPA 1RODA 5BN4A 4XQNA 4B9WA 4IOAA 5M5WH 3EA6A 2K5QA 2VQEQ 3NHHA 3DXJC 1YBYA 3R2IA 3Q23A 1KNEA 3GTQB 1SAPA 3L9AX 1Q46A 1EYAA 3G71A 2KEEA 1EY4A 4A3GH 2BA1A 1IBLL 4A3BG 3J7YW 5JJIA 1WOCA 2J0TD 4X3SA 3HOYG 1LTAD 3S2HH 5ISRA 2CW0D 1GXDC 3S17B 1FJGL 3GTOB 1BBWA 3W2DA 3QR8A 3IFTA 4RGMA 5LMNL 1MD2D 1PV4A 1Y1WB 1MHWC 1F77A 1K3RA 1WFQA 4JPBW 3PGZA 2JQOA 1UWVA 3G7LA 2EY5A 2F0SA 3GTMB 5KNDA 1B2TA 1NAPA 1KABA 2BDNA 1XNQL 1VQIA 2F0QA 2KENA 3MC0B 4A3LG 3UE1A 4OHJA 2AUKA 1UAPA 1DZ1A 4IPCA 2K33A 1XMOQ 4ILWA 4XT3B 1HNXQ 1E2VA 1Y14B 2GVAA 4ZK9B 1PDQA 4A4IA 2BCOA 3HOZG 1RHPA 3OHXC 4KY5A 1BF4A 5CV4A 3EIVA 4H44C 1VQ5A 2K05A 2WB1G 4HEDA 2EPBA 2O5IC 2J7ZA 4PG3A 4OWTB 4GNXA 4DAVA 4A3FH 1Z6HA 5M3FB 4DV4L 1XJVA 2F4IA 4A3CG 1BQQT 1TWHH 3WDNA 3J80L 1KIXA 1STGA 1O7LA 3ER0A 5KIXA 5DLQE 1X3EA 3OIPA 5IODA 1RCVD 2UU9Q 3HOVG 3QOLA 3NBIA 1DXMA 1SE8A 1JWMD 2L0CA 4YCWA 4LF8L 4OIJA 1X56A 4A3IH 3KBXA 5M5YB 5C44B 2VXWA 3PIO3 4LF7Q 4LUVA 5JPNC 4R4QA 2KECA 5HURA 4B3SL 4L5TA 4QF4A 5IP9G 3TREA 4DNTB 4GKJL 3UDXA 3I3CA 1JT8A 2ZTCA 2BOSA 1XWEA 4OWXB 3N6RA 1X32A 3MFYA 1U4MA 3T1HL 1BDOA 3BVMA 4A3BH 2UXBQ 1V1OA 3HOYH 1R4PB 2NVQB 2UUCL 4BY7G 2KA7A 4BA1I 2I46A 2B2UC 2VUMG 1VQ8A 1KAAA 2XNAC 3R93A 1EYDA 2XIWA 1N9WA 1YNND 3ND8A 4KI0A 4CDDC 1PTOH 3J81c 2K4KA 1WTXA 1R4QB 3H0GB 1XNRQ 4A3LH 1YITA 1RKNA 2UXCL 4DUZL 1CK1A 2NUCA 4NXMQ 4A3JB 3HG9A 4LWCA 2PI2E 2B2UA 1Q8IA 4DAPA 1PZJD 1PHJA 3ULJA 3T51B 4HMJA 3CCSA 3DEOA 1SE3A 2B29A 5ELCA 4DV7Q 2JEAI 2RHQB 2R6GA 2I5MX 4KKSA 4R8IA 3KLWA 4R9WA 1F2LA 1KLUD 4K2LA 1WD1A 2MO1A 2ZXOA 3R8BA 4EGVA 4R1JA 1SFOH 1PH4A 3DUZA 1TWAB 1FD7D 3HOVH 3UDGA 2VY3A 3K7AH 4Z9CB 1SR3A 2Q8RE 1H9RA 1OXSC 2CHBD 2OTLA 2QDLA 1DOLA 5M3FG 1IXRA 2F0DA 4RMFA 3VR5A 5IP9H 5AJ3L 1IBMQ 4RHRA 1KL9A 2IW3A 1JR0D 2O5JC 2IJ0A 3I7FA 2D5DA 3K5NA 4B3TL 1RJTA 1X6OA 3LWEA 3E9IA 2LXJA 5JOBA 1HA6A 1VQAA 4KKUA 1U4PA 3IAYA 1EY9A 1PFBA 4BY7H 1MBYA 5C44G 4ABNA 4FDBA 1SYEA 2MQHA 2HDLA 3TEHB 3VDYA 5E4XA 1I4PA 4L5QA 1Q82C 3GTQH 5A2QE 1E7ZA 1PH3A 1HUMA 3TP8A 1X3GA 3A74A 4P73A 4GLVB 2K52A 1JE5A 3MFGA 1PXUA 1SLJA 1S5BD 1PH2A 3K6OA 4OXPA 4FXGC 2A19A 3S17H 1QVFA 4LF9Q 1STHA 3GTOH 2PMZE 3SR1A 2V4DA 4RHSA 1EFWA 2L1BA 2Q2TA 2KJXA 3GTGB 1Y1WH 4YIJA 1SYGA 3TS0A 3GTMH 2KVMA 2WP8J 4JI0Q 2QKIC 1N33L 3H0GG 2ES2A 1U5KA 2NBFA 2B2WA 4QB4A 4QJFA 3A5UA 5DEHA 1JJGA 2MPMA 3KLRA 2UUAL 3FDTA 4JYAQ 3T1YQ 4DAYB 1JWSD 3I73A 4QUCA 4CJ1B 2X69A 2AHOB 3IKJA 4A3JG 3HKSA 4DR5Q 2JJQA 4DAYA 1LUZA 4MIUA 3H09A 4IUUA 2QF7A 5ELBA 1HFNA 2MUYA 4FF2A 3I55A 3HOWB 1ASZA 4LUZA 1EYGA 1F2YA 1PH9A 1STAA 4TSSA 2PYKA 5C5LA 1OTCA 1BBUA 1CT1D 2B3GA 5M3FH 2LS01 1TS4A 1KNAA 2F0JA 1HFGA 3PQIA 2A5HA 4OWWB 4GS3A 4CJ2C 3CCQA 3L7ZC 1KQSA 2BDOA 4DK6C 4FF3A 2O2LD 3EBEA 2RKSA 5FK9C 5M5YH 5C44H 5C4HA 1XMQL 2MGSA 2H4OA 3NWSA 1QNKA 3SK6A 3HFZB 2F0NA 4ZUJA 4POFA 3P1HA 4IO9A 3S1QB 1IKLA 1K8MA 2C9OA 4DUYQ 4JI1Q 3QWNA 2XRSD 5EQ0A 2UXDQ 4FXKC 3CQZB 1QWYA 4DV3L 1PYBA 4PZ7A 1I5FA 4UHVA 2MFIA 3J81E 2NVQH 1SYBA 1EZ8A 2F0IA 1BVSA 4RA8A 4BY1B 2F0EA 5J1ZA 4OEMB 4DR2Q 5E3FA 2ZXRA 2BA0A 2E5LL 1CHQD 5LL6X 1OXVA 1HR0L 4U673 2E2IB 1JE4A 2HCCA 3HOXB 4KV6A 2AQ3B 5DM63 4G7ZC 5CC4A 1N8RC 3FPPA 3CXCA 4DR6L 3FVQA 3FP9A 2WAQE 4DXFA 2EOTA 3GP7A 1K3BC 1O7ZA 4A3JH 1QVCA 1D7QA 3JAMi 1K73C 4PMBA 4ULLA 4K8IA 4X64L 4FF4A 2N78A 1BCPC 1V1PB 2EJFC 5IT9E 4G4KA 4C2MB 1YNJC 4XDXA 1NBWA 1YI2A 3I91A 1J9OA 4RCNA 1JMCA 4A75A 2ZM6Q 4B3ML 4A3KB 3CU7A 4DV5L 1NR4A 4N8FA 4QQBX 2YV5A 2N8NA 1SYDA 2A68C 4KY6A 4KJOA 2OF1A 1BCPB 1X65A 4B3RQ 2F3VA 1TWAH 4LF6L 2K28A 1A62A 3HOWG 2AWNA 1OXUA 5T1GA 4K6DA 4FNFA 1WYDA 4G57A 5IIFA 4JK1C 1VQ6A 2M00A 1GUTA 1NE3A 1K83B 1F9SA 4OO1I 4ODGA 1IZ6A 4N9PA 3UDFA 2CWAA 4R4OA 3KF6B 4HTHA 4S3SA 2WKCA 1QILA 3PUWA 3KF6A 2HUGA 3V2TA 3KJOA 3PV0A 4A3DB 1KHIA 1AEXA 4HCEA 3HKZB 3NQTA 2R7ZB 3K5MA 3CPWA 3KUPA 4X3TA 1DONA 2NVXB 1K28A 4JI6Q 1PH6A 2L15A 5JVG3 1ENAA 4C3HB 5M3MB 3BDLA 3RLNA 1SMYD 1KAWA 4UY8C 2TMPA 1CM9A 2XRQD 1QNUA 3PIPA 2QEJC 5FO7B 4IPDA 4BY1G 1HNZL 5JPMC 4IFDJ 1EL0A 3GTGH 4DPGA 3U4ZA 3W1GA 4JVZA 3AFPA 1M90C 3PUZA 5IGDA 1X3PA 1EIGA 2EYOA 2RDHA 3HOXG 1E1OA 1TS3A 2B63G 1HTLD 3BS1A 4L6TB 1G2TA 4C1NK 2OWOA 1CHPD 2E75C 4P75A 4HAEA 4EX5A 3V96A 3QJYA 3HOWH 4M8AA 1EY8A 2EQSA 1ML0D 4KY7A 4PNYA 1G8ZD 2VQEL 1I6VC 3VR4A 1M4VA 2RVLA 5IOCA 5M9OA 4PV1C 1JQYD 1Q81C 5CORA 1TY2A 2KEDA 3WOFA 1FR3A 2PQAB 1T5XD 5ELEA 1I3QB 1TR5A 2PW5A 5E4WC 1FNWA 2NVTB 1CA5A 1CKOA 5D3DA 2EXDA 3OMGA 4IALA 4I65A 4DV1L 3S1QH 3Q0AA 1STEA 4KTAA 3G4SA 1PLFA 3EROA 1GJXA 3CQZH 3Q8DA 2XWJB 2KHSA 2NN6G 2K03A 3M7NA 4JI5Q 3SXHA 1C48A 1XMOL 2OXPA 2KCCA 4NXNQ 4A3DG 4R8NA 3BVGA 1ET9A 2PPBC 3HEJA 5IYCG 4DU9A 4BY1H 3HKZG 2R7ZG 4LFCQ 2Z6BA 1VF5C 1U4RA 1JOKA 4K6LA 2YTVA 3I4MB 2F0HA 5CMDA 2E2IH 2YTYA 4RGOS 4WRDA 4DR4L 2CQAA 3HOXH 4C3HG 5KRUA 5M3MG 1SXTA 1F2ZA 3PIP3 5J3BA 1TU2B 3QG1A 1BBXC 1MJEA 3W3AA 1QOHA 2IHEA 3HOUB 1FVIA 2UU9L 2Y0SE 1YNNC 3NTHA 3VYTA 4C2MH 1EFID 1EY7A 1VQ7A 5FKAC 4LF7L 4DA2A 3AEVA 4P72A 1X9NA 4LMQD 2K6AA 5C0XJ 4XTCS 3LGJA 5K5PA 2HQEA 2JSOA 4M1UB 4ZUIA 4A3KH 2JA6B 1GD7A 4A3FG 1QG7A 3I2ZA 3RZOB 2BE5D 4A3MB 2I5HA 3BJUA 3NBHA 1ESRA 2UXBL 5KGUA 4YHHQ 1VS0A 2CQOA 5G3LF 3P7JA 5FOBB 5HGTA 4A3IG 3NSWA 1KDCA 2EYLA 2A6HC 2HIVA 4UP8A 5COYA 5IYDG 1L0XB 1K83H 1TQOA 1UE6A 3GTJB 1W3SA 2PZWA 1PTOF 1XNRL 2Z1CA 2V1CC 3VYRA 2MP1A 2NN6H 1SNCA 2EYFA 3K7UC 2LFNA 1SRUA 4MNOA 2HD3A 4ID6A 4A3DH 3HGBA 3TZUA 5IYCH 4DAMA 4C3IB 1PRTD 2R7ZH 1KDBA 3UE0A 3TN2A 4ZLTF 2ATWA 2PNHA 4JI4Q 2KHJA 5FLMG 2NVXH 5GQOA 4DV7L 4GNXC 3VR6A 5JEAG 1A6XA 4PMCA 4C3HH 5M3MH 3I4LA 2QDBA 4Y52H 1VQFA 3HS0C 1AFPA 3ULLA 1GHKA 2VQFL 1IBKL 5FO8B 1YHBA 4NKLA 2IHFA 1N36Q 2F03A 4K2KA 1HH2P 4ZYSA 5J22A 2VB2X 4RAUC 1TWGB 1SYFA 2KQ3A 2PNRC 4KN4C 4GNXB 3I4MG 1WJJA 1K0SA 3BU2A 2WKDA 1LT6D 1YJWA 4UP7A 4CGYB 2G9HD 4C1NI 1IBML 3CP0A 1CA6A 3OWFA 4HIKA 4CDFC 3FHWA 1LT4D 2N88A 1ONLA 3HOUG 2L4NA 4YWKA 4IZ8A 4HSVA 4HJAA 4JOIC 1JC7A 3L2PA 1JWUD 1MSHA 2NVYB 3RD4A 2WINB 3RLFA 4A76A 5IY0A 1QB5D 2JA6G 1I94Q 2CFMA 2R7FA 3Q24A 5IYDH 4J1MA 1D2BA 3SDZA 4YWMA 4A93B 2HCIA 3S14B 4EQ5A 4DR7Q 2B2TC 1I3QH 5C4ZA 3BYTB 3KJPA 2K5DA 1FNUA 3RR5A 4JV5Q 2SDFA 2NVTH 3RLOA 4JOIA 1B70B 1ET6A 2EY2A 5JEAJ 4AYBB 2F3WA 2AWOA 3ITPA 1S5FD 3TSSA 1EQVA 4H13C 4R4CA 5CV7A 2D9UA 4BS9A 4JI0L 3BDCA 2KBNA 5FLMH 2ALYB 1E2ZA 1HHVA 2EY6A 2NZOA 4JYAL 2EDGA 3T1YL 1UE5A 1V8QA 2WACA 5JEAH 1R9TH 2B2TA 2X6GA 4X62Q 4QIWB 2D0PA 4H02A 4J15A 2KHIA 4C3IG 2JK8A 1DM0B 4IPGA 1NR2A 4RFBA 1EU4A 1CI3M 3BZKA 1Y1WG 1CQFA 1AE3A 3I4MH 1WTRA 4FP5D 3CF5A 1BR9A 4H0LC 3C1EA 4K0KQ 4H7BA 3MTSA 2D0OA 5E1FA 1IBLQ 4ZCKA 5IT9c 1HNWQ 1CUKA 4ZKBB 5F2DA 1MGSA 2ZXPA 4MHEA 1EOVA 3HOUH 1CTMA 1A0IA 3I4NB 1DD2A 1KTKA 1FJGQ 2AQ1B 2CKZB 1XPOA 2F4VL 3JAME 4KLKA 1SBBB 1NCVA 2RCFA 2HIXA 1YIJA 3KDFA 5C5MA 5I4DA 1TWCB 1RIPA 1VQKA 2JA6H 4DUYL 4JI1L 1C9OA 3M7GA 4V190 3E0EA 1QUQA 2F0WA 3PF4A 3RZOH 2L9HA 4A3MH 3AU7A 2VS1A 1SMXA 2F0LA 3H3VC 1G6ZA 3J80i 1OXXK 1EIYB 3VYUA 2BH8A 4R4IA 3S1RB 1B53A 4DR2L 3C2PA 3EN2A 5C4XB 4ZQ3A 1F9QA 1L0YB 4XIGS 5LMNW 1LTID 2ZTEA 1CZGA 3KFUA 1A3TA 4K5XA 3GTJH 1TVXA 2B2WC 3I56A 4IJHA 5I2YA 4AQYL 2ZJQA 2ZTDA 2I07B 4DV6Q 2B2YC 3K59A 2IWHA 1VQLA 1SSOA 2CH4A 4X6AH 1HJPA 2A6ED 4AYBG 4C3IH 5CV9A 4DV2Q 2E74C 2K75A 3V05A 1G291 2E2JB 1SROA 2H1EA 1E2WA 4B3SQ 5ELFA 5I6YA 2WB1E 2ZM6L 1Z47A 1DOKA 1S5ED 4QMGA 4AH6A 4NMZA 5LMUL 3SK4A 4ZKCB 1SNDA 3I72A 3MA2B 3CCVA 4OX9Q 2RBMA 5A35A 2B2YA 4RCOA 4KK7A 2PZTA 5JJZA 4LNQA 3T13A 1TWGH 4QY7A 2Q8TA 1N32Q 1D8LA 2FMCA 1ESFA 3ND9A 4P74A 3OYYA 3T56B 4KD3A 1SMYC 2F52A 3D3RA 4BA2I 3MEFA 1A2TA 2EYJA 4A3EB 4XXEA 3F8TA 1M1KC 2F0OA 4X66Q 2UXCQ 1C4QA 3H91A 3I4NG 1KRSA 5JJLA 1Z9FA 1KRTA 4JCVE 2IPKD 4XYOA 2NVYH 2RDFA 3KF8A 5A2QL 2Q2HA 4IJLA 4F88A 1TY0A 4MZ9A 5C3EB 3K0XA 1OO9B 4CKCA 4U68A 3W5OA 1QCBD 5EJWA 3J7ZC 1YHQA 4JI6L 4HR7B 4A93H 2QEXA 3S14H 3EFXD 3IRBA 3T16A 2SOBA 3M4OB 5CYUA 3LX0A 2R92B 4HIMA 3PO3B 4KJNA 1SYCA 2NTTA 4HJ7A 2OQKA 5C4XG 4KN7C 3S9WA 1CFMA 3A7LA 1FNVA 2XTIA 2OT2A 4KHZA 3SHLA 3M4YA 1CSPA 1W2BA 1F9PA 5AJ3Q 1EQRA 3M3YB 5KNBA 1JICA 1TKWB 4JI3Q 2QCPX 4I7ZC 1PVOA 4Y7NB 1VQMA 3S2DB 1FL0A 3WOEA 1QJOA 1OXTA 1LO5D 1LACA 2C35B 4OO1G 1PH5A 2Z9HA 2E2HB 1Z7TA 2DUDA 1QZGA 1LV9A 5IWAL 1C0AA 1DGSA 1PYWD 1DOMA 1HTPA 4B08A 5DNFA 5JVH3 2ID0A 5KYLA 4CHTB 2JA7B 1TWFB 2C5CA 3GDEA 2GVBA 2R93B 2XVSA 3RN2A 3TQYA 1ENCA 1PH8A 1HUNA 3I4NH 1D1KA 3P75A 4G7HC 4DFAA 1XPRA 3S1MB 2EJMA 4GN4B 3H3VI 1P16A 1AH9A 3DWQA 1JCKB 1B3AA 1TWCH 2EYHA 1N33Q 3D6WA 1P8LA 1KC8C 3G48A 4N8X1 2F0TA 1Y69U 1TT2A 3R2TA 4A3EG 1TS5A 4YWLA 4DGZA 2F0PA 4QL5A 3J81L 3I4OA 1WCMB 1GUWA 4IPHA 2EE1A 1EUJA 2F0MA 4NXNL 4DR1Q 5M5XB 1YZ6A 4HMIA 2R3ZA 3S1RH 5JJKA 2JA5B 4LFCL 5C3EG 5C4XH 2QGQA 5GADC 3J7AF 3ONAB 2QILA 2QA4A 3KYHC 2XN9C 3H3VH 3O13A 2IX1A 2KCTA 1VQOA 4DV0Q 3G6JB 3GTKB 2R92G 3TMEA 1IW7C 1WTWA 1VQBA 4DR3L 5IT9L 3D4WA 2PQEA 2K1BA 4I7AA 5CBAE 2H5XA 1C7YA 4OO1H 2Q2IA 5AFWA 2MJ8A 2XSCA 4ME3A 2E2JH 4LF5L 3OWEB 1JJ2A 3CD6A 2KOLA 3H6MA 2EZVA 2ENBA 2AKWB 4KMUC 4XYQA 3Q22A 4LFAQ 3SEBA 1S40A 4O1NA 3DWPA 3ZYYX 3KLSA 4K5WA 3K5LA 4OELB 2B8GA 1BKBA 2CW0C 4YHHL 3TS2A 1B9NA 2Z6KC 4FVMA 1VCIA 4KHPQ 1KXLA 1BCPF 1PH1A 1UEAB 4JG2A 3PO2B 2PI2A 1BNZA 3CHBD 1PFSA 1YNXA 3DHQA 4YCUA 1VQ9A 4UDUC 2JA7G 3Q6SA 4AIMA 5IYBG 4A3KG 4L5RC 2Z0SA 2R93G 4A3EH 1EYCA 2FHTA 5EPKA 1AW7A 5LHY1 2Z6KA 3SE0A 3GO5A 4JI7Q 1I4HA 1ZYRD 4XT1B 1HZBA 1S5DD 2JP1A 2A69D 1KLGD 5C3EH 3CCUA 3IFDA 2K5VA 1B8AA 2OEOA 1MKHA 2ICEC 3C1FA 4DK0A 4N9TA 2N49A 5CGKA 1HZCA 4B3MQ 2PCFB 4DV5Q 4QUFA 1HR0W 3BVZA 2EYMA 1RTOA 4V0BA 3M4OH 4CDCC 2R92H 1V43A 3MXNB 3PO3H 1R9TB 2JYOA 1L0WA 1G51A 4RGTA 5HGQA 2R7DA 1HNXL 4LF6Q 5FLXE 5IGCA 1B9MA 1XTCD 3MXNA 1TIID 3URYA 1RL2A 1E3PA 2L12A 4C3JB 4LF4Q 1A8VA 2K5HA 1B4OA 4J6HA 2CWPA 1WTQA 1EQQA 1XPUA 3A5ZB 4K14A 3M3YH 4DKAC 4HJ9A 1XYIA 2DJFC 4UPAA 1A63A 2JA8B 1NTGA 4APVA 4Y7NH 3S2DH 1J8IA 3J7AV 1V9PA 4JBMA 4GN5A 4RGNA 2DGYA 2JN4A 2A68D
chains in the Genus database with same CATH topology
2PMZB 3HOZB 2HDMA 4LK1C 1A3UA 4NW2A 1SJED 3GTLB 4UAIA 5EKIA 5T1IA 2XWBB 1CZWA 1D6EC 1I6HB 4BBSB 2RA4A 3T53B 5I9OA 3MXGA 1D1IA 4EQPA 1LABA 1MSGA 4WJWA 4B9XA 1B50A 3P20A 1IL8A 3TP5A 2A73B 5CBEE 2M2LA 1STYA 5JAVA 3RZDB 5EBDA 3J80E 1B44D 2PZUA 2VUMB 3D4DA 2K5WA 1RD9D 1GUSA 3GD7A 1ENFA 1B1ZA 1VMPA 1EEID 2B2VC 2F0GA 5ELDA 2F0FA 3OMCA 3FKIB 3SK8A 5D14A 1HCZA 3K0YA 5EKKA 1I4QA 4IUVA 4C3JG 4ZRZA 1Y8NB 3NTKA 1W6KA 4E6IA 3I90A 3SVMA 3HZXA 2A74C 5G3LD 2JEBI 3A7AB 1NUCA 5IGEA 2RDGA 2B2VA 3K58A 4QCLA 3PUVA 2A6EC 2WAQB 3I8ZA 1PTOD 3VA5A 4CBVA 2PO4A 1HRJA 4TRDA 1EU3A 3RUZA 2WIIB 1STNA 3NXWA 4XQQA 2SNSA 2IL8A 2IX3A 2JE6I 2NZ1D 3S16B 3VR3A 2R61A 5EKLA 1PFNA 5C4JB 3BDOA 4C56C 1D5MC 3EJIA 1EWCA 1I50B 2D62A 3AB9A 4LAAA 3FRPB 1ILQA 4RWSC 4DK1A 4GZYC 3C3LA 3SK5A 4NP5A 5KEEA 3D31A 1SNOA 4IUTA 4EVOA 2L5TA 4CJ0B 1A3VA 2LMCB 1A15A 2J4XA 3OPOA 5J39A 3A8KE 4RH6A 1M8AA 3L3OC 4G7OC 2Z4HA 1H9MA 1HQMC 4DXGA 3S15B 4X3UA 5DM73 1LTSD 2NTSA 5BN3A 2X6LA 2LKVA 3OW7A 3OSOA 1ILPA 1PMRA 1JB3A 1SNMA 1JORA 1SE4A 4BBRB 1D5XC 5I2XA 1BUVT 2A6HD 1K8OA 2ZT9C 3EVQA 2K32A 3IL8A 2RQXA 3DWAA 1JOOA 2YU9B 1NSNS 1Q12A 1H9KA 2VNUD 1EIHA 3X3NA 2B39A 3A8JE 1SJHD 1DCZA 5KYIA 3M85A 3PUXA 1GOZA 1Q1EA 3DM1A 2K01A 1FGBD 3GV6A 2TSSA 4EQNA 1LTTD 5EBCA 3TBIB 1AZPA 3KLSX 3EQLC 3N52A 4L63B 4FYDA 2FJ2A 3MXUA 3U9OA 3CRKC 2GA4B 1EOTA 4HSPA 4NDXA 1DJRD 4MN3A 4FO2A 3BYYB 3RMHA 3JAML 3DMUA 3HRZC 5C6AA 2EXZA 5CV6A 2KCNA 3NP8A 3GV3A 5LL6S 3NQIA 4PQXA 5K36G 1LTBD 3MAQA 2RSNA 1C8CA 2CVRA 2IT1A 4CKBA 4IUNA 1QE6A 2Y0SB 5IGGA 3TP6A 2G9DA 3OIQA 4WORA 1RTNA 1JOQA 3NTIA 3E6ZX 4TKOB 1AN8A 4OGQC 1LT3D 1I4RA 2RSOA 3MZ5A 5I6WA 4WFN3 1BO0A 3VA7A 3A54A 2VB3X 1S4ZA 3FMCA 5FO9B 4JBWA 5IGBA 1LT5D 1AZQA 5EPJA 4LJZC 3NPPA 2YYZA 3T4AC 3MEHA 1I4XA 3H94A 4KKTA 4Q5VA 1SE2A 1BXTA 1EZ6A 3QB3A 5CR3A 1XX8A 1ZYRC 1LLRD 3NUCA 2A69C 1EY5A 1EWHA 3ERQA 3D6CA 1IKMA 3CKIB 2N55A 3CRLC 3D8GA 3AMUA 2IX0A 5K36H 1EY6A 2FFKB 1Y1VB 3MXPA 2Q8IB 4K5VA 4PMWA 3GTPB 3E5SA 2B63B 3PMFA 1STBA 1RF2D 2SEBD 2FMMA 1EQTA 1ZKOA 2MHVA 1UUPA 3LNNA 2JXMB 1V1PA 4ZAIA 1LTGD 4IFDG 2NWGA 2DNCA 3S1NB 1ZXTA 2ICIA 5TSSA 1S5CD 4HN7A 3KBGA 4P2CB 4EQOA 1GUGA 1Q1BA 1BOSA 2L11A 5CV5A 3U9SA 3GQBA 2DY8A 1A2UA 3FEWX 1F2MA 3VR2A 1ICWA 3D4RA 1WVLA 5M5WB 4DN4M 1GUOA 1H9SB 4F87A 5D65A 2L55A 1H9JA 1HPCA 2BE5C 2F0UA 5KNCA 1DYQA 1H9SA 4A3GB 2K7VA 2DY7A 1ZEQX 3F2UA 1HQRD 1E0BA 3PUYA 1U4LA 2EVBA 3R3OA 3C46A 1XXGA 3S2HB 1PFMA 4IFDI 1HA5A 3TZDA 4IN3A 1PZKD 1Q3LA 4IQZA 1T5EA 4BWGB 1W6JA 4X3KA 3QOJA 3QO2A 3MWYW 1WTVA 2E76C 2PW7A 3DEPA 1IYUA 1EY0A 1AP0A 5EGTA 5D3IB 1PRTC 1IYVA 1X3QA 3BG3A 1II3A 1WTOA 3A56A 3A8IE 3MHBA 3NE5B 3K57A 3TDQA 4KHVA 2O4XA 4OIKA 1SEBD 4FF1A 1MI2A 1VMCA 2AQ2B 4DNRB 4IFDH 3TP7A 4A3FB 1F9RA 2B8FA 3NWTA 1PRTB 1Y8OB 2DN8A 1TWHB 5C3WA 4J8QA 3X3MA 4K8JA 1RDPD 1I4GA 5NUCA 2SNMA 1FYCA 5IGFA 1VDZA 3KK7A 1D5ZC 4A3IB 1G2SA 5CV8A 4F7XA 1GHJA 4L8JA 1PZID 2M9VA 1PTOC 1O78A 4FXDA 3I70A 2Z8LA 3NK9A 5C0XG 1VF7A 4A3BB 2EJGC 3HOYB 2WV6D 2NYZD 4XQJA 4ME5A 4Q0FA 4O42A 4CKEA 2Z4IA 1GUNA 3FPUB 5BN5A 1BCPD 1PTOB 2F0VA 1U9RA 1YNJD 3HP3A 4DF7A 1O80A 2KUMA 4KD4A 3BZDB 3A55A 1LTRD 2LY7A 1TS2A 2DNEA 3K5OA 2F0KA 1SDFA 3E0JA 1SNPA 3MVVA 2F1MA 1UNSA 2WB1B 5EPLA 1WTPA 5C0XI 5C3XA 3QIAA 4RKLA 2K04A 4IUPA 3UI2A 1PRTF 2FINB 1Q90A 1WD0A 1SFOB 5DAUA 3HOVB 3VYSA 2NN6I 3K7AB 1SNQA 4TQUS 1Y8PB 5I9PA 4IUQA 3OOCA 1G91A 1KDAA 4HCSA 1O7YA 2EY1A 2E2DC 4RKBA 4OL7A 5FLXL 1CQVA 1IHZA 1HXYD 5C0XH 2D2CC 1EEFD 1IW7D 4F8MA 3LWUA 4IURA 2NB0A 2AUJD 4BY7B 2EYPA 1RODA 5BN4A 4XQNA 4B9WA 3EA6A 2K5QA 3NHHA 3DXJC 3R2IA 3Q23A 1KNEA 3GTQB 1SAPA 3L9AX 1EYAA 2KEEA 1EY4A 2BA1A 3J7YW 2J0TD 4X3SA 1LTAD 5ISRA 2CW0D 1GXDC 3S17B 3GTOB 3W2DA 3IFTA 4RGMA 1MD2D 1Y1WB 1F77A 1B2TA 2EY5A 2F0SA 3G7LA 3GTMB 5KNDA 1NAPA 1KABA 2BDNA 2F0QA 3MC0B 4OHJA 2AUKA 1UAPA 1DZ1A 2K33A 4ILWA 4XT3B 1E2VA 4ZK9B 1PDQA 2BCOA 1RHPA 3OHXC 4KY5A 1BF4A 5CV4A 4H44C 2K05A 4HEDA 2EPBA 2O5IC 2J7ZA 4DAVA 1Z6HA 5M3FB 2F4IA 1BQQT 3WDNA 3J80L 1STGA 1O7LA 5KIXA 3OIPA 5IODA 1RCVD 3QOLA 3NBIA 1DXMA 1JWMD 2L0CA 4OIJA 3KBXA 5M5YB 5C44B 2VXWA 3PIO3 5JPNC 2KECA 5HURA 4QF4A 4DNTB 3I3CA 2BOSA 1XWEA 3N6RA 1X32A 3MFYA 1U4MA 1BDOA 3BVMA 1V1OA 1R4PB 2NVQB 2KA7A 4BA1I 2I46A 2B2UC 1KAAA 2XNAC 3R93A 1EYDA 2XIWA 1YNND 3ND8A 4KI0A 1PTOH 1WTXA 1R4QB 3H0GB 1RKNA 1CK1A 2NUCA 4A3JB 3HG9A 2B2UA 1Q8IA 4DAPA 1PZJD 3T51B 4HMJA 3DEOA 1SE3A 5ELCA 2JEAI 2R6GA 4KKSA 4R8IA 4R9WA 1F2LA 1KLUD 4K2LA 1WD1A 2ZXOA 3R8BA 4EGVA 3DUZA 1TWAB 1FD7D 4Z9CB 2Q8RE 1H9RA 1OXSC 2CHBD 1DOLA 2F0DA 3VR5A 4RHRA 2IW3A 1JR0D 2O5JC 2IJ0A 2D5DA 3K5NA 1RJTA 3LWEA 5JOBA 1HA6A 4KKUA 1U4PA 3IAYA 1EY9A 1PFBA 1MBYA 4ABNA 1SYEA 2HDLA 5E4XA 1I4PA 5A2QE 1HUMA 3TP8A 3MFGA 1PXUA 1S5BD 3K6OA 4FXGC 1STHA 3SR1A 2V4DA 4RHSA 2L1BA 2KJXA 3GTGB 4YIJA 1SYGA 2KVMA 2WP8J 2QKIC 2NBFA 4QB4A 2B2WA 5DEHA 2MPMA 3KLRA 3FDTA 4CJ1B 1JWSD 3I73A 4QUCA 2X69A 3IKJA 4DAYA 4MIUA 3H09A 4IUUA 2QF7A 5ELBA 1HFNA 2MUYA 4FF2A 3HOWB 1F2YA 1STAA 4TSSA 2PYKA 5C5LA 1CT1D 2LS01 1TS4A 1KNAA 2F0JA 1HFGA 2A5HA 4CJ2C 3L7ZC 2BDOA 4FF3A 2O2LD 2RKSA 5FK9C 5C4HA 2MGSA 2H4OA 3NWSA 1QNKA 3SK6A 2F0NA 4ZUJA 3P1HA 3S1QB 1IKLA 1K8MA 2C9OA 3QWNA 2XRSD 5EQ0A 4FXKC 3CQZB 1QWYA 3J81E 1SYBA 1EZ8A 2F0IA 4RA8A 4BY1B 2F0EA 5J1ZA 5E3FA 2ZXRA 2BA0A 1CHQD 5LL6X 1OXVA 4U673 2E2IB 1JE4A 2HCCA 3HOXB 4KV6A 2AQ3B 5DM63 4G7ZC 5CC4A 3FPPA 3FVQA 4DXFA 2EOTA 3GP7A 1O7ZA 4PMBA 4ULLA 4K8IA 4FF4A 1BCPC 1V1PB 2EJFC 5IT9E 4G4KA 4C2MB 1YNJC 4XDXA 3I91A 1J9OA 4RCNA 4A3KB 3CU7A 1NR4A 1SYDA 2A68C 4KY6A 4KJOA 2OF1A 1BCPB 2F3VA 2K28A 2AWNA 1OXUA 5T1GA 4K6DA 4FNFA 4G57A 5IIFA 4JK1C 2M00A 1GUTA 1K83B 1F9SA 4OO1I 4ODGA 4N9PA 4HTHA 4S3SA 2WKCA 1QILA 3PUWA 2HUGA 3V2TA 3PV0A 4A3DB 1AEXA 4HCEA 3HKZB 3NQTA 2R7ZB 3K5MA 3KUPA 4X3TA 1DONA 2NVXB 5JVG3 1ENAA 4C3HB 5M3MB 3BDLA 1SMYD 2TMPA 1CM9A 2XRQD 1QNUA 2QEJC 5FO7B 5JPMC 4IFDJ 1EL0A 3PUZA 5IGDA 1X3PA 1EIGA 2EYOA 2RDHA 1TS3A 1HTLD 3BS1A 4L6TB 1G2TA 4C1NK 1CHPD 2E75C 4HAEA 3V96A 3QJYA 4M8AA 1EY8A 4KY7A 1ML0D 4PNYA 1G8ZD 1I6VC 3VR4A 1M4VA 2RVLA 5IOCA 5M9OA 4PV1C 1JQYD 5CORA 1TY2A 2KEDA 3WOFA 1FR3A 1T5XD 5ELEA 1I3QB 1TR5A 2PW5A 5E4WC 1FNWA 2NVTB 1CA5A 5D3DA 3OMGA 4IALA 4I65A 3Q0AA 1STEA 4KTAA 1PLFA 3EROA 1GJXA 2XWJB 2KHSA 2NN6G 2K03A 3M7NA 3SXHA 1C48A 2OXPA 2KCCA 4R8NA 3BVGA 1ET9A 2PPBC 3HEJA 4DU9A 1VF5C 1U4RA 1JOKA 4K6LA 3I4MB 2F0HA 5CMDA 4RGOS 4WRDA 2CQAA 4C3HG 5KRUA 1SXTA 1F2ZA 3PIP3 1TU2B 3QG1A 1BBXC 3W3AA 1QOHA 3HOUB 1YNNC 3NTHA 3VYTA 1EFID 1EY7A 5FKAC 4DA2A 4LMQD 2K6AA 5C0XJ 4XTCS 5K5PA 2HQEA 2JSOA 4M1UB 4ZUIA 2JA6B 1QG7A 3RZOB 2BE5D 4A3MB 3NBHA 1ESRA 5KGUA 5G3LF 3P7JA 5FOBB 5HGTA 3NSWA 1KDCA 2EYLA 2A6HC 5COYA 1L0XB 1TQOA 3GTJB 2PZWA 1PTOF 2Z1CA 3VYRA 2MP1A 2NN6H 1SNCA 2EYFA 2LFNA 4ID6A 3HGBA 3TZUA 4C3IB 1PRTD 1KDBA 3TN2A 4ZLTF 3VR6A 5JEAG 1A6XA 4PMCA 3I4LA 2QDBA 3HS0C 1AFPA 1GHKA 5FO8B 4NKLA 2F03A 4K2KA 4ZYSA 5J22A 2VB2X 4RAUC 1TWGB 1SYFA 2KQ3A 2PNRC 4KN4C 2WKDA 1LT6D 4CGYB 2G9HD 4C1NI 1CA6A 3OWFA 1LT4D 2N88A 1ONLA 2L4NA 4IZ8A 4HSVA 1JC7A 1JWUD 1MSHA 2NVYB 3RD4A 2WINB 3RLFA 1QB5D 3Q24A 4J1MA 1D2BA 3SDZA 4A93B 2HCIA 3S14B 2B2TC 5C4ZA 3BYTB 2K5DA 1FNUA 2SDFA 1ET6A 2EY2A 5JEAJ 4AYBB 2F3WA 2AWOA 3ITPA 1S5FD 3TSSA 1EQVA 4H13C 5CV7A 2D9UA 4BS9A 3BDCA 1E2ZA 1HHVA 2EY6A 2EDGA 2WACA 1V8QA 5JEAH 2B2TA 2X6GA 4QIWB 4C3IG 1DM0B 1NR2A 4RFBA 1EU4A 1CI3M 1CQFA 1WTRA 4FP5D 1BR9A 4H0LC 3C1EA 4H7BA 3MTSA 5E1FA 4ZKBB 5F2DA 1MGSA 2ZXPA 4MHEA 1CTMA 3I4NB 1DD2A 1KTKA 2AQ1B 3JAME 1SBBB 1NCVA 5C5MA 5I4DA 1TWCB 3M7GA 4V190 2F0WA 2L9HA 3AU7A 2F0LA 3H3VC 1G6ZA 1OXXK 3VYUA 3S1RB 1B53A 3C2PA 5C4XB 4ZQ3A 1F9QA 1L0YB 4XIGS 1LTID 1CZGA 1A3TA 4K5XA 1TVXA 2B2WC 5I2YA 2I07B 2B2YC 3K59A 2IWHA 1SSOA 2A6ED 5CV9A 2E74C 3V05A 1G291 2E2JB 2H1EA 1E2WA 5ELFA 5I6YA 1Z47A 1DOKA 1S5ED 4QMGA 4NMZA 3SK4A 4ZKCB 1SNDA 3I72A 3MA2B 2RBMA 5A35A 2B2YA 4RCOA 4KK7A 2PZTA 5JJZA 3T13A 2Q8TA 2FMCA 1ESFA 3ND9A 3T56B 4KD3A 1SMYC 3D3RA 4BA2I 1A2TA 2EYJA 4A3EB 4XXEA 2F0OA 1C4QA 3H91A 2IPKD 4XYOA 2RDFA 3KF8A 5A2QL 4F88A 1TY0A 5C3EB 1OO9B 4CKCA 4U68A 1QCBD 5EJWA 4HR7B 3EFXD 3T16A 2SOBA 3M4OB 5CYUA 3LX0A 2R92B 3PO3B 4KJNA 1SYCA 2NTTA 4KN7C 3S9WA 1CFMA 3A7LA 1FNVA 2OT2A 4KHZA 3SHLA 3M4YA 1F9PA 3M3YB 5KNBA 1JICA 1TKWB 2QCPX 4I7ZC 4Y7NB 3S2DB 3WOEA 1QJOA 1OXTA 1LO5D 1LACA 4OO1G 2E2HB 1Z7TA 1LV9A 1PYWD 1DOMA 1HTPA 4B08A 5DNFA 5JVH3 2ID0A 5KYLA 4CHTB 2JA7B 1TWFB 2C5CA 2R93B 2XVSA 1ENCA 1HUNA 1D1KA 3P75A 4G7HC 4DFAA 3S1MB 2EJMA 3DWQA 1JCKB 1B3AA 2EYHA 3D6WA 2F0TA 1Y69U 1TT2A 3R2TA 1TS5A 4DGZA 2F0PA 3J81L 1WCMB 1GUWA 2EE1A 2F0MA 5M5XB 4HMIA 2R3ZA 2JA5B 3J7AF 3ONAB 2QILA 2XN9C 3O13A 2IX1A 3G6JB 3GTKB 3TMEA 1IW7C 1WTWA 5IT9L 3D4WA 2PQEA 2K1BA 5CBAE 4OO1H 5AFWA 2MJ8A 2XSCA 3OWEB 2KOLA 3H6MA 2EZVA 2ENBA 4KMUC 4XYQA 3Q22A 3SEBA 4O1NA 3DWPA 3ZYYX 3KLSA 4K5WA 3K5LA 2B8GA 2CW0C 1B9NA 4FVMA 1VCIA 1BCPF 1UEAB 3PO2B 1BNZA 3CHBD 3DHQA 4UDUC 3Q6SA 1EYCA 2FHTA 5EPKA 1AW7A 5LHY1 3SE0A 3GO5A 1I4HA 1ZYRD 4XT1B 1S5DD 2JP1A 2A69D 1KLGD 3IFDA 2OEOA 2ICEC 3C1FA 4DK0A 4N9TA 5CGKA 2PCFB 4QUFA 3BVZA 2EYMA 1RTOA 4V0BA 1V43A 1R9TB 2JYOA 4RGTA 5FLXE 5IGCA 1B9MA 1XTCD 3MXNA 1TIID 3URYA 2L12A 4C3JB 1B4OA 4J6HA 1WTQA 4K14A 1XYIA 2JA8B 1J8IA 3J7AV 4RGNA 2A68D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H4O A; 
#chains in the Genus database with same CATH topology
 4O0A A;  3KOJ A;  2E2H H;  2PMZ B;  2K50 A;  1CKN B;  3HOZ B;  2HDM A;  4LK1 C;  2DJG C;  1A3U A;  1I94 L;  4NW2 A;  4O2D A;  1CKN A;  5IE8 A;  1SJE D;  3GTL B;  4UAI A;  5EKI A;  5T1I A;  4ALP A;  2XWB B;  1CZW A;  1D6E C;  2JA7 H;  1TWF H;  1Q86 C;  5IYB H;  1I6H B;  1XTD A;  2R93 H;  2LXK A;  3NBH B;  4BBS B;  3JAM c;  4DR7 L;  3W1B A;  2RA4 A;  1WI5 A;  3T53 B;  1X3F A;  5I9O A;  4R4T A;  3S1M H;  3J81 j;  3MXG A;  1SN8 A;  4GKK Q;  1D1I A;  3A0J A;  4EQP A;  1LAB A;  1MSG A;  4X65 Q;  4LFB Q;  4OON A;  4WJW A;  4B9X A;  4NPS A;  1B50 A;  3P20 A;  1IL8 A;  3TP5 A;  2A73 B;  1WCM H;  4HIO A;  5CBE E;  2M2L A;  1LTL A;  3STB D;  3G6E A;  4X62 L;  1STY A;  5M5X H;  1GKH A;  2GN5 A;  2I0Q A;  4NXM L;  5JAV A;  3RZD B;  5EBD A;  3UDI A;  3J80 E;  2N3S A;  2JA5 H;  4BXX H;  1B44 D;  2HHH Q;  2PZU A;  3L0O A;  2JA9 A;  2VUM B;  3D4D A;  2K5W A;  1RD9 D;  1GUS A;  2RF4 A;  3GD7 A;  1ENF A;  4K0K L;  1B1Z A;  1VMP A;  2UUB Q;  3GTK H;  1EEI D;  2B2V C;  4POG A;  2F0G A;  1HNW L;  3U4V A;  1U0L A;  5ELD A;  2F0F A;  3OMC A;  3FKI B;  1K8A C;  3SK8 A;  1V1Q A;  5D14 A;  1HCZ A;  3K0Y A;  2MO0 A;  5EKK A;  1I4Q A;  4IUV A;  4C3J G;  3PF5 A;  4ZRZ A;  3DM3 A;  5FJ8 G;  1Y8N B;  3NTK A;  4DV1 Q;  1W6K A;  4E6I A;  3I90 A;  3SVM A;  3HZX A;  2ZJR A;  2A74 C;  5G3L D;  2JEB I;  3A7A B;  1NUC A;  2JA8 G;  5IGE A;  5GRO A;  1HZA A;  2OQ0 A;  2RDG A;  1E1T A;  2B2V A;  3K58 A;  4QCL A;  3PUV A;  2A6E C;  2WAQ B;  2VZA A;  2VL6 A;  3RNU A;  3I8Z A;  3CME A;  1PTO D;  3OTO Q;  3VA5 A;  1T9H A;  4CBV A;  3J7A 5;  2PO4 A;  1MJC A;  4PZ6 A;  1HRJ A;  4TRD A;  1EU3 A;  4YCV A;  3RUZ A;  2WII B;  3RN5 A;  1STN A;  3PO2 H;  3NXW A;  4XQQ A;  2SNS A;  2IL8 A;  3E9H A;  2IX3 A;  1L1O C;  1VQG A;  4WJ4 A;  2JE6 I;  1LYL A;  2NZ1 D;  4YY3 Q;  3S16 B;  4DR4 Q;  1H95 A;  4BBS G;  1PH7 A;  4A3M G;  1JJC B;  3VR3 A;  2R61 A;  5EKL A;  1PFN A;  3TRZ A;  5C4J B;  3BDO A;  4DV6 L;  4C56 C;  1JB7 A;  1D5M C;  3EJI A;  1UE7 A;  1EWC A;  3NEM A;  4JW0 A;  4DV2 L;  4LF9 L;  1I50 B;  2D62 A;  1L1O B;  3HKZ E;  3AB9 A;  4LAA A;  3FRP B;  1ILQ A;  4RWS C;  1L1O A;  2MNA A;  4DK1 A;  1IL2 A;  4GZY C;  3C3L A;  3SK5 A;  4NP5 A;  5KEE A;  5BR8 Q;  3D31 A;  1SNO A;  4IUT A;  4EVO A;  2L5T A;  1NNX A;  4OX9 L;  3M9B A;  4CJ0 B;  4JI2 Q;  1A3V A;  2LMC B;  4DR5 L;  1A15 A;  2J4X A;  4JI8 Q;  1J5E Q;  3OPO A;  5J39 A;  2WFW A;  3A8K E;  4QGU A;  1N32 L;  4RH6 A;  1N34 Q;  1M8A A;  4C3J H;  3NEN A;  1G6P A;  5HY6 A;  3L3O C;  4G7O C;  2Z4H A;  5FJ8 H;  1H9M A;  1HQM C;  4DXG A;  1GM5 A;  1YJN A;  3S15 B;  1QZH A;  4X3U A;  3SGI A;  5DM7 3;  1S72 A;  2JA8 H;  1LTS D;  4HJ5 A;  2CH4 W;  3FKI G;  2NTS A;  4PZ8 A;  1YHA A;  5GAH C;  5BN3 A;  2X6L A;  4X66 L;  2LKV A;  3OW7 A;  3OSO A;  1ILP A;  1PMR A;  5IP7 G;  1JB3 A;  1SNM A;  1JOR A;  2F3I A;  1SE4 A;  3HOZ H;  2HQL A;  3KDF B;  4BBR B;  1D5X C;  5LMN Q;  3ERS X;  5I2X A;  3GTL H;  1BUV T;  1QUQ B;  2A6H D;  2P5Z X;  1XNQ Q;  1I6H H;  1K8O A;  2ZT9 C;  2UXD L;  4BBS H;  3EVQ A;  2WAQ G;  1VQH A;  1K9M C;  4A3C H;  2K32 A;  3IL8 A;  3CC4 A;  1B7Y B;  2RQX A;  3DWA A;  1JOO A;  2YU9 B;  2VQF Q;  1IBK Q;  1NSN S;  1Q12 A;  4GLA C;  1H9K A;  2VNU D;  3F2D A;  1EIH A;  3X3N A;  1VQ4 A;  2B39 A;  3A8J E;  1SJH D;  1DCZ A;  5KYI A;  2HT1 A;  4P71 A;  3M85 A;  3PUX A;  1GOZ A;  4A93 G;  1Q1E A;  3S24 A;  4DV4 Q;  4JI3 L;  3DM1 A;  2K01 A;  1FGB D;  1NY4 A;  2TSS A;  3GV6 A;  2NZH A;  4EQN A;  1LTT D;  5EBC A;  3RZD H;  1TXY A;  3TBI B;  5ELN A;  1AZP A;  1HZ9 A;  3ZJY C;  3KLS X;  2VUM H;  3EQL C;  3N52 A;  4L63 B;  4LF8 Q;  4FYD A;  2FJ2 A;  3MXU A;  3U9O A;  5E7N A;  1X54 A;  4WJ3 M;  3CRK C;  2GA4 B;  1EOT A;  4GKJ Q;  4HSP A;  4NDX A;  1DJR D;  1UEB A;  3FKI H;  3M4P A;  3F1Z A;  4MN3 A;  4FO2 A;  3BYY B;  3RMH A;  3T1H Q;  3JAM L;  4MTK A;  3ULP A;  5IP7 H;  3DMU A;  3HRZ C;  5C6A A;  2UUC Q;  4B3R L;  2EXZ A;  5CV6 A;  3AQQ A;  2KCN A;  3NP8 A;  3GV3 A;  5LL6 S;  3NQI A;  4PQX A;  5K36 G;  1LTB D;  2RCN A;  3CW2 C;  3MAQ A;  2RSN A;  2A8V A;  1C8C A;  3NEL A;  2CVR A;  2IT1 A;  3WWV A;  3CCM A;  4CKB A;  4IUN A;  4DR1 L;  1PYS B;  4DUZ Q;  1QE6 A;  5L37 A;  1VQJ A;  3K80 C;  3KF8 B;  2Y0S B;  3OW2 A;  1Q8K A;  5IGG A;  3PSI A;  3TP6 A;  4BBR G;  1E24 A;  2Q2U A;  3CMA A;  2G9D A;  3OIQ A;  4WOR A;  1RTN A;  2A1A A;  1JOQ A;  3NTI A;  3E6Z X;  4TKO B;  1AN8 A;  4OGQ C;  1LT3 D;  1I4R A;  3S16 H;  2RSO A;  3MZ5 A;  2K14 A;  4DV0 L;  3CCR A;  1FGU A;  5I6W A;  4WFN 3;  5C4J H;  1BO0 A;  3VA7 A;  3A54 A;  2VB3 X;  1CKM A;  1S4Z A;  3FMC A;  5FO9 B;  4JBW A;  2K5N A;  5IGB A;  1EIF A;  5GAG C;  1I50 H;  2F4V Q;  1Q7Y C;  4DK3 C;  2VW9 A;  1LT5 D;  1AZQ A;  5EPJ A;  4LJZ C;  3F2B A;  3NPP A;  1LM0 A;  2YYZ A;  5ELO A;  2YTX A;  3T4A C;  3MEH A;  1B3Q A;  1I4X A;  4LFA L;  5FLX c;  3H94 A;  3CAM A;  4KKT A;  4Q5V A;  1SE2 A;  1VQN A;  1BXT A;  1YEZ A;  4GOP C;  1UE1 A;  1EZ6 A;  3QB3 A;  5CR3 A;  4B3T Q;  1XX8 A;  1ZYR C;  1LLR D;  3NUC A;  2A69 C;  3U50 C;  1EY5 A;  1EWH A;  1X55 A;  3ERQ A;  4CDE C;  4KHP L;  3D6C A;  1IKM A;  3CKI B;  2N55 A;  1EWI A;  3CRL C;  3D8G A;  2KCM A;  3AMU A;  2IX0 A;  1VQP A;  2ZJP A;  5K36 H;  3S15 H;  1EY6 A;  2FFK B;  1Y1V B;  3H0G H;  3MXP A;  2Q8I B;  4GOP B;  4K5V A;  4PMW A;  2AMC B;  3GTP B;  3E5S A;  4AQY Q;  2B63 B;  4GOP A;  3PMF A;  1STB A;  1RF2 D;  4JBJ A;  2SEB D;  4UP9 A;  2FMM A;  2QW7 A;  4JI7 L;  1EQT A;  1ZKO A;  4BBR H;  2MHV A;  1UUP A;  3LNN A;  2JXM B;  1V1P A;  4ZAI A;  1LTG D;  1O7I A;  4IFD G;  3K8A A;  2CCZ A;  1NMG A;  1PA6 A;  2NWG A;  2DNC A;  3S1N B;  5LMU Q;  1ZXT A;  2ICI A;  2UUA Q;  3K81 C;  5TSS A;  4GN3 B;  1S5C D;  4HN7 A;  4JI5 L;  1S3O A;  2XGT A;  2YU9 H;  3KBG A;  2Y0S G;  4P2C B;  4JBK A;  4EQO A;  1GUG A;  1Q1B A;  1BOS A;  2L11 A;  5CV5 A;  3U9S A;  3GQB A;  2DY8 A;  1A2U A;  3FEW X;  1K8G A;  1F2M A;  3VR2 A;  4AYB E;  1ICW A;  4LF4 L;  3D4R A;  1WVL A;  4JC0 A;  5M5W B;  3CCE A;  1QVG A;  4DN4 M;  1GUO A;  1YJ9 A;  2I5L X;  1H9S B;  4F87 A;  5D65 A;  2L55 A;  1H9J A;  1HPC A;  2BE5 C;  1GO3 E;  3J80 c;  2F0U A;  5KNC A;  1DYQ A;  1H9S A;  3CC2 A;  4A3G B;  2K7V A;  2DY7 A;  1ZEQ X;  3F2U A;  3PO3 G;  1HQR D;  4QIW E;  1E0B A;  3PUY A;  1U4L A;  2EVB A;  3R3O A;  3C46 A;  1XXG A;  3S2H B;  1PFM A;  4IFD I;  1HA5 A;  3TZD A;  4IN3 A;  1PZK D;  1Q3L A;  3PCO B;  4L5S A;  4IQZ A;  1T5E A;  1XMQ Q;  4BWG B;  4TVA B;  1W6J A;  3STB C;  4X3K A;  1NMF A;  3QOJ A;  3QO2 A;  3MWY W;  1WTV A;  2E76 C;  4DV3 Q;  2PW7 A;  3DEP A;  1IYU A;  1EY0 A;  2EIF A;  1AP0 A;  5EGT A;  5D3I B;  2FXQ A;  1PRT C;  1IYV A;  1ASY A;  1X3Q A;  3BG3 A;  1II3 A;  1WTO A;  3A56 A;  3A8I E;  3MHB A;  3NE5 B;  3K57 A;  1CSQ A;  4KHV A;  2O4X A;  3TDQ A;  4GKK L;  4NB3 A;  1Y1V G;  1YVC A;  4OIK A;  2IY5 B;  3ICE A;  4X65 L;  1SEB D;  4LFB L;  2E5L Q;  4FF1 A;  1MI2 A;  1HR0 Q;  1VMC A;  2AQ2 B;  3BZC A;  4DNR B;  4IFD H;  3TP7 A;  3CC7 A;  1AE2 A;  4A3F B;  1F9R A;  2B8F A;  3NWT A;  1PRT B;  1Y8O B;  2DN8 A;  4DR6 Q;  1TWH B;  5C3W A;  4J8Q A;  3X3M A;  4K8J A;  1RDP D;  1I4G A;  5NUC A;  4RG1 A;  3CCJ A;  2SNM A;  1FYC A;  5IGF A;  1VDZ A;  4X64 Q;  2HHH L;  3KK7 A;  2OCE A;  1D5Z C;  1J6Q A;  4A3I B;  5IWA Q;  1G2S A;  5CV8 A;  4F7X A;  4JI4 L;  1GHJ A;  1E22 A;  4L8J A;  3AYH B;  2UUB L;  1PZI D;  2M9V A;  1PTO C;  1WCM G;  1O78 A;  3J81 i;  3M4Q A;  3DLL A;  4FXD A;  3I70 A;  2E8G A;  2Z8L A;  3NK9 A;  5C0X G;  1VF7 A;  2PQA A;  4A3B B;  2EJG C;  3HOY B;  2WV6 D;  2JA5 G;  2NYZ D;  4XQJ A;  4ME5 A;  1NJI C;  1N36 L;  4BXX G;  4Q0F A;  4O42 A;  4CKE A;  2Z4I A;  3F2C A;  3D0F A;  1GUN A;  1VQE A;  3FPU B;  1VQD A;  5BN5 A;  1BCP D;  1PTO B;  2F0V A;  1GVP A;  3CCL A;  1U9R A;  1YNJ D;  3HP3 A;  4A3G G;  4DF7 A;  1O80 A;  1KD1 C;  5GAE C;  3AFQ A;  2RHS B;  2KUM A;  4KD4 A;  3BZD B;  3A55 A;  1LTR D;  1WTH A;  2LY7 A;  3OTO L;  4LW1 A;  3H15 A;  1L2F A;  1TS2 A;  1IYJ B;  2DNE A;  3K5O A;  2F0K A;  1SDF A;  4LUO A;  3E0J A;  1Y1V H;  3MVV A;  1SNP A;  2F1M A;  1UNS A;  3E3X A;  2WB1 B;  5EPL A;  2G5D A;  4YY3 L;  1WTP A;  5C0X I;  3GTP H;  5C3X A;  2B63 H;  3QIA A;  4RKL A;  2K04 A;  3U58 A;  4IUP A;  3UI2 A;  4DR3 Q;  1PRT F;  2LSS A;  2FIN B;  4JV5 L;  4DNI A;  1Q90 A;  3B6Y A;  1WD0 A;  1HNZ Q;  1SFO B;  5DAU A;  3HOV B;  3VYS A;  5H1S E;  3CPF A;  4LF5 Q;  3PO2 G;  2NN6 I;  3K7A B;  2ASB A;  1VQC A;  1SNQ A;  1MIU A;  2BH2 A;  2OTJ A;  4TQU S;  1Y8P B;  4HID A;  4MTN A;  5I9P A;  4IUQ A;  3OOC A;  1G91 A;  1KDA A;  3S1N H;  4HCS A;  1O7Y A;  3JC6 6;  2EY1 A;  1K0R A;  2E2D C;  4RKB A;  4IOC A;  4OL7 A;  5BR8 L;  3PIO A;  4GLX A;  1ICF B;  5FLX L;  1CQV A;  1IHZ A;  5EAY A;  4JI2 L;  1HXY D;  5C0X H;  2D2C C;  1EEF D;  1IW7 D;  4JI8 L;  4F8M A;  1J5E L;  3LWU A;  4IUR A;  2NB0 A;  4HJ8 A;  2AUJ D;  1N34 L;  4BY7 B;  2EYP A;  1ROD A;  5BN4 A;  4XQN A;  4B9W A;  4IOA A;  5M5W H;  3EA6 A;  2K5Q A;  2VQE Q;  3NHH A;  3DXJ C;  1YBY A;  3R2I A;  3Q23 A;  1KNE A;  3GTQ B;  1SAP A;  3L9A X;  1Q46 A;  1EYA A;  3G71 A;  2KEE A;  1EY4 A;  4A3G H;  2BA1 A;  1IBL L;  4A3B G;  3J7Y W;  5JJI A;  1WOC A;  2J0T D;  4X3S A;  3HOY G;  1LTA D;  3S2H H;  5ISR A;  2CW0 D;  1GXD C;  3S17 B;  1FJG L;  3GTO B;  1BBW A;  3W2D A;  3QR8 A;  3IFT A;  4RGM A;  5LMN L;  1MD2 D;  1PV4 A;  1Y1W B;  1MHW C;  1F77 A;  1K3R A;  1WFQ A;  4JPB W;  3PGZ A;  2JQO A;  1UWV A;  3G7L A;  2EY5 A;  2F0S A;  3GTM B;  5KND A;  1B2T A;  1NAP A;  1KAB A;  2BDN A;  1XNQ L;  1VQI A;  2F0Q A;  2KEN A;  3MC0 B;  4A3L G;  3UE1 A;  4OHJ A;  2AUK A;  1UAP A;  1DZ1 A;  4IPC A;  2K33 A;  1XMO Q;  4ILW A;  4XT3 B;  1HNX Q;  1E2V A;  1Y14 B;  2GVA A;  4ZK9 B;  1PDQ A;  4A4I A;  2BCO A;  3HOZ G;  1RHP A;  3OHX C;  4KY5 A;  1BF4 A;  5CV4 A;  3EIV A;  4H44 C;  1VQ5 A;  2K05 A;  2WB1 G;  4HED A;  2EPB A;  2O5I C;  2J7Z A;  4PG3 A;  4OWT B;  4GNX A;  4DAV A;  4A3F H;  1Z6H A;  5M3F B;  4DV4 L;  1XJV A;  2F4I A;  4A3C G;  1BQQ T;  1TWH H;  3WDN A;  3J80 L;  1KIX A;  1STG A;  1O7L A;  3ER0 A;  5KIX A;  5DLQ E;  1X3E A;  3OIP A;  5IOD A;  1RCV D;  2UU9 Q;  3HOV G;  3QOL A;  3NBI A;  1DXM A;  1SE8 A;  1JWM D;  2L0C A;  4YCW A;  4LF8 L;  4OIJ A;  1X56 A;  4A3I H;  3KBX A;  5M5Y B;  5C44 B;  2VXW A;  3PIO 3;  4LF7 Q;  4LUV A;  5JPN C;  4R4Q A;  2KEC A;  5HUR A;  4B3S L;  4L5T A;  4QF4 A;  5IP9 G;  3TRE A;  4DNT B;  4GKJ L;  3UDX A;  3I3C A;  1JT8 A;  2ZTC A;  2BOS A;  1XWE A;  4OWX B;  3N6R A;  1X32 A;  3MFY A;  1U4M A;  3T1H L;  1BDO A;  3BVM A;  4A3B H;  2UXB Q;  1V1O A;  3HOY H;  1R4P B;  2NVQ B;  2UUC L;  4BY7 G;  2KA7 A;  4BA1 I;  2I46 A;  2B2U C;  2VUM G;  1VQ8 A;  1KAA A;  2XNA C;  3R93 A;  1EYD A;  2XIW A;  1N9W A;  1YNN D;  3ND8 A;  4KI0 A;  4CDD C;  1PTO H;  3J81 c;  2K4K A;  1WTX A;  1R4Q B;  3H0G B;  1XNR Q;  4A3L H;  1YIT A;  1RKN A;  2UXC L;  4DUZ L;  1CK1 A;  2NUC A;  4NXM Q;  4A3J B;  3HG9 A;  4LWC A;  2PI2 E;  2B2U A;  1Q8I A;  4DAP A;  1PZJ D;  1PHJ A;  3ULJ A;  3T51 B;  4HMJ A;  3CCS A;  3DEO A;  1SE3 A;  2B29 A;  5ELC A;  4DV7 Q;  2JEA I;  2RHQ B;  2R6G A;  2I5M X;  4KKS A;  4R8I A;  3KLW A;  4R9W A;  1F2L A;  1KLU D;  4K2L A;  1WD1 A;  2MO1 A;  2ZXO A;  3R8B A;  4EGV A;  4R1J A;  1SFO H;  1PH4 A;  3DUZ A;  1TWA B;  1FD7 D;  3HOV H;  3UDG A;  2VY3 A;  3K7A H;  4Z9C B;  1SR3 A;  2Q8R E;  1H9R A;  1OXS C;  2CHB D;  2OTL A;  2QDL A;  1DOL A;  5M3F G;  1IXR A;  2F0D A;  4RMF A;  3VR5 A;  5IP9 H;  5AJ3 L;  1IBM Q;  4RHR A;  1KL9 A;  2IW3 A;  1JR0 D;  2O5J C;  2IJ0 A;  3I7F A;  2D5D A;  3K5N A;  4B3T L;  1RJT A;  1X6O A;  3LWE A;  3E9I A;  2LXJ A;  5JOB A;  1HA6 A;  1VQA A;  4KKU A;  1U4P A;  3IAY A;  1EY9 A;  1PFB A;  4BY7 H;  1MBY A;  5C44 G;  4ABN A;  4FDB A;  1SYE A;  2MQH A;  2HDL A;  3TEH B;  3VDY A;  5E4X A;  1I4P A;  4L5Q A;  1Q82 C;  3GTQ H;  5A2Q E;  1E7Z A;  1PH3 A;  1HUM A;  3TP8 A;  1X3G A;  3A74 A;  4P73 A;  4GLV B;  2K52 A;  1JE5 A;  3MFG A;  1PXU A;  1SLJ A;  1S5B D;  1PH2 A;  3K6O A;  4OXP A;  4FXG C;  2A19 A;  3S17 H;  1QVF A;  4LF9 Q;  1STH A;  3GTO H;  2PMZ E;  3SR1 A;  2V4D A;  4RHS A;  1EFW A;  2L1B A;  2Q2T A;  2KJX A;  3GTG B;  1Y1W H;  4YIJ A;  1SYG A;  3TS0 A;  3GTM H;  2KVM A;  2WP8 J;  4JI0 Q;  2QKI C;  1N33 L;  3H0G G;  2ES2 A;  1U5K A;  2NBF A;  2B2W A;  4QB4 A;  4QJF A;  3A5U A;  5DEH A;  1JJG A;  2MPM A;  3KLR A;  2UUA L;  3FDT A;  4JYA Q;  3T1Y Q;  4DAY B;  1JWS D;  3I73 A;  4QUC A;  4CJ1 B;  2X69 A;  2AHO B;  3IKJ A;  4A3J G;  3HKS A;  4DR5 Q;  2JJQ A;  4DAY A;  1LUZ A;  4MIU A;  3H09 A;  4IUU A;  2QF7 A;  5ELB A;  1HFN A;  2MUY A;  4FF2 A;  3I55 A;  3HOW B;  1ASZ A;  4LUZ A;  1EYG A;  1F2Y A;  1PH9 A;  1STA A;  4TSS A;  2PYK A;  5C5L A;  1OTC A;  1BBU A;  1CT1 D;  2B3G A;  5M3F H;  2LS0 1;  1TS4 A;  1KNA A;  2F0J A;  1HFG A;  3PQI A;  2A5H A;  4OWW B;  4GS3 A;  4CJ2 C;  3CCQ A;  3L7Z C;  1KQS A;  2BDO A;  4DK6 C;  4FF3 A;  2O2L D;  3EBE A;  2RKS A;  5FK9 C;  5M5Y H;  5C44 H;  5C4H A;  1XMQ L;  2MGS A;  2H4O A;  3NWS A;  1QNK A;  3SK6 A;  3HFZ B;  2F0N A;  4ZUJ A;  4POF A;  3P1H A;  4IO9 A;  3S1Q B;  1IKL A;  1K8M A;  2C9O A;  4DUY Q;  4JI1 Q;  3QWN A;  2XRS D;  5EQ0 A;  2UXD Q;  4FXK C;  3CQZ B;  1QWY A;  4DV3 L;  1PYB A;  4PZ7 A;  1I5F A;  4UHV A;  2MFI A;  3J81 E;  2NVQ H;  1SYB A;  1EZ8 A;  2F0I A;  1BVS A;  4RA8 A;  4BY1 B;  2F0E A;  5J1Z A;  4OEM B;  4DR2 Q;  5E3F A;  2ZXR A;  2BA0 A;  2E5L L;  1CHQ D;  5LL6 X;  1OXV A;  1HR0 L;  4U67 3;  2E2I B;  1JE4 A;  2HCC A;  3HOX B;  4KV6 A;  2AQ3 B;  5DM6 3;  4G7Z C;  5CC4 A;  1N8R C;  3FPP A;  3CXC A;  4DR6 L;  3FVQ A;  3FP9 A;  2WAQ E;  4DXF A;  2EOT A;  3GP7 A;  1K3B C;  1O7Z A;  4A3J H;  1QVC A;  1D7Q A;  3JAM i;  1K73 C;  4PMB A;  4ULL A;  4K8I A;  4X64 L;  4FF4 A;  2N78 A;  1BCP C;  1V1P B;  2EJF C;  5IT9 E;  4G4K A;  4C2M B;  1YNJ C;  4XDX A;  1NBW A;  1YI2 A;  3I91 A;  1J9O A;  4RCN A;  1JMC A;  4A75 A;  2ZM6 Q;  4B3M L;  4A3K B;  3CU7 A;  4DV5 L;  1NR4 A;  4N8F A;  4QQB X;  2YV5 A;  2N8N A;  1SYD A;  2A68 C;  4KY6 A;  4KJO A;  2OF1 A;  1BCP B;  1X65 A;  4B3R Q;  2F3V A;  1TWA H;  4LF6 L;  2K28 A;  1A62 A;  3HOW G;  2AWN A;  1OXU A;  5T1G A;  4K6D A;  4FNF A;  1WYD A;  4G57 A;  5IIF A;  4JK1 C;  1VQ6 A;  2M00 A;  1GUT A;  1NE3 A;  1K83 B;  1F9S A;  4OO1 I;  4ODG A;  1IZ6 A;  4N9P A;  3UDF A;  2CWA A;  4R4O A;  3KF6 B;  4HTH A;  4S3S A;  2WKC A;  1QIL A;  3PUW A;  3KF6 A;  2HUG A;  3V2T A;  3KJO A;  3PV0 A;  4A3D B;  1KHI A;  1AEX A;  4HCE A;  3HKZ B;  3NQT A;  2R7Z B;  3K5M A;  3CPW A;  3KUP A;  4X3T A;  1DON A;  2NVX B;  1K28 A;  4JI6 Q;  1PH6 A;  2L15 A;  5JVG 3;  1ENA A;  4C3H B;  5M3M B;  3BDL A;  3RLN A;  1SMY D;  1KAW A;  4UY8 C;  2TMP A;  1CM9 A;  2XRQ D;  1QNU A;  3PIP A;  2QEJ C;  5FO7 B;  4IPD A;  4BY1 G;  1HNZ L;  5JPM C;  4IFD J;  1EL0 A;  3GTG H;  4DPG A;  3U4Z A;  3W1G A;  4JVZ A;  3AFP A;  1M90 C;  3PUZ A;  5IGD A;  1X3P A;  1EIG A;  2EYO A;  2RDH A;  3HOX G;  1E1O A;  1TS3 A;  2B63 G;  1HTL D;  3BS1 A;  4L6T B;  1G2T A;  4C1N K;  2OWO A;  1CHP D;  2E75 C;  4P75 A;  4HAE A;  4EX5 A;  3V96 A;  3QJY A;  3HOW H;  4M8A A;  1EY8 A;  2EQS A;  1ML0 D;  4KY7 A;  4PNY A;  1G8Z D;  2VQE L;  1I6V C;  3VR4 A;  1M4V A;  2RVL A;  5IOC A;  5M9O A;  4PV1 C;  1JQY D;  1Q81 C;  5COR A;  1TY2 A;  2KED A;  3WOF A;  1FR3 A;  2PQA B;  1T5X D;  5ELE A;  1I3Q B;  1TR5 A;  2PW5 A;  5E4W C;  1FNW A;  2NVT B;  1CA5 A;  1CKO A;  5D3D A;  2EXD A;  3OMG A;  4IAL A;  4I65 A;  4DV1 L;  3S1Q H;  3Q0A A;  1STE A;  4KTA A;  3G4S A;  1PLF A;  3ERO A;  1GJX A;  3CQZ H;  3Q8D A;  2XWJ B;  2KHS A;  2NN6 G;  2K03 A;  3M7N A;  4JI5 Q;  3SXH A;  1C48 A;  1XMO L;  2OXP A;  2KCC A;  4NXN Q;  4A3D G;  4R8N A;  3BVG A;  1ET9 A;  2PPB C;  3HEJ A;  5IYC G;  4DU9 A;  4BY1 H;  3HKZ G;  2R7Z G;  4LFC Q;  2Z6B A;  1VF5 C;  1U4R A;  1JOK A;  4K6L A;  2YTV A;  3I4M B;  2F0H A;  5CMD A;  2E2I H;  2YTY A;  4RGO S;  4WRD A;  4DR4 L;  2CQA A;  3HOX H;  4C3H G;  5KRU A;  5M3M G;  1SXT A;  1F2Z A;  3PIP 3;  5J3B A;  1TU2 B;  3QG1 A;  1BBX C;  1MJE A;  3W3A A;  1QOH A;  2IHE A;  3HOU B;  1FVI A;  2UU9 L;  2Y0S E;  1YNN C;  3NTH A;  3VYT A;  4C2M H;  1EFI D;  1EY7 A;  1VQ7 A;  5FKA C;  4LF7 L;  4DA2 A;  3AEV A;  4P72 A;  1X9N A;  4LMQ D;  2K6A A;  5C0X J;  4XTC S;  3LGJ A;  5K5P A;  2HQE A;  2JSO A;  4M1U B;  4ZUI A;  4A3K H;  2JA6 B;  1GD7 A;  4A3F G;  1QG7 A;  3I2Z A;  3RZO B;  2BE5 D;  4A3M B;  2I5H A;  3BJU A;  3NBH A;  1ESR A;  2UXB L;  5KGU A;  4YHH Q;  1VS0 A;  2CQO A;  5G3L F;  3P7J A;  5FOB B;  5HGT A;  4A3I G;  3NSW A;  1KDC A;  2EYL A;  2A6H C;  2HIV A;  4UP8 A;  5COY A;  5IYD G;  1L0X B;  1K83 H;  1TQO A;  1UE6 A;  3GTJ B;  1W3S A;  2PZW A;  1PTO F;  1XNR L;  2Z1C A;  2V1C C;  3VYR A;  2MP1 A;  2NN6 H;  1SNC A;  2EYF A;  3K7U C;  2LFN A;  1SRU A;  4MNO A;  2HD3 A;  4ID6 A;  4A3D H;  3HGB A;  3TZU A;  5IYC H;  4DAM A;  4C3I B;  1PRT D;  2R7Z H;  1KDB A;  3UE0 A;  3TN2 A;  4ZLT F;  2ATW A;  2PNH A;  4JI4 Q;  2KHJ A;  5FLM G;  2NVX H;  5GQO A;  4DV7 L;  4GNX C;  3VR6 A;  5JEA G;  1A6X A;  4PMC A;  4C3H H;  5M3M H;  3I4L A;  2QDB A;  4Y52 H;  1VQF A;  3HS0 C;  1AFP A;  3ULL A;  1GHK A;  2VQF L;  1IBK L;  5FO8 B;  1YHB A;  4NKL A;  2IHF A;  1N36 Q;  2F03 A;  4K2K A;  1HH2 P;  4ZYS A;  5J22 A;  2VB2 X;  4RAU C;  1TWG B;  1SYF A;  2KQ3 A;  2PNR C;  4KN4 C;  4GNX B;  3I4M G;  1WJJ A;  1K0S A;  3BU2 A;  2WKD A;  1LT6 D;  1YJW A;  4UP7 A;  4CGY B;  2G9H D;  4C1N I;  1IBM L;  3CP0 A;  1CA6 A;  3OWF A;  4HIK A;  4CDF C;  3FHW A;  1LT4 D;  2N88 A;  1ONL A;  3HOU G;  2L4N A;  4YWK A;  4IZ8 A;  4HSV A;  4HJA A;  4JOI C;  1JC7 A;  3L2P A;  1JWU D;  1MSH A;  2NVY B;  3RD4 A;  2WIN B;  3RLF A;  4A76 A;  5IY0 A;  1QB5 D;  2JA6 G;  1I94 Q;  2CFM A;  2R7F A;  3Q24 A;  5IYD H;  4J1M A;  1D2B A;  3SDZ A;  4YWM A;  4A93 B;  2HCI A;  3S14 B;  4EQ5 A;  4DR7 Q;  2B2T C;  1I3Q H;  5C4Z A;  3BYT B;  3KJP A;  2K5D A;  1FNU A;  3RR5 A;  4JV5 Q;  2SDF A;  2NVT H;  3RLO A;  4JOI A;  1B70 B;  1ET6 A;  2EY2 A;  5JEA J;  4AYB B;  2F3W A;  2AWO A;  3ITP A;  1S5F D;  3TSS A;  1EQV A;  4H13 C;  4R4C A;  5CV7 A;  2D9U A;  4BS9 A;  4JI0 L;  3BDC A;  2KBN A;  5FLM H;  2ALY B;  1E2Z A;  1HHV A;  2EY6 A;  2NZO A;  4JYA L;  2EDG A;  3T1Y L;  1UE5 A;  1V8Q A;  2WAC A;  5JEA H;  1R9T H;  2B2T A;  2X6G A;  4X62 Q;  4QIW B;  2D0P A;  4H02 A;  4J15 A;  2KHI A;  4C3I G;  2JK8 A;  1DM0 B;  4IPG A;  1NR2 A;  4RFB A;  1EU4 A;  1CI3 M;  3BZK A;  1Y1W G;  1CQF A;  1AE3 A;  3I4M H;  1WTR A;  4FP5 D;  3CF5 A;  1BR9 A;  4H0L C;  3C1E A;  4K0K Q;  4H7B A;  3MTS A;  2D0O A;  5E1F A;  1IBL Q;  4ZCK A;  5IT9 c;  1HNW Q;  1CUK A;  4ZKB B;  5F2D A;  1MGS A;  2ZXP A;  4MHE A;  1EOV A;  3HOU H;  1CTM A;  1A0I A;  3I4N B;  1DD2 A;  1KTK A;  1FJG Q;  2AQ1 B;  2CKZ B;  1XPO A;  2F4V L;  3JAM E;  4KLK A;  1SBB B;  1NCV A;  2RCF A;  2HIX A;  1YIJ A;  3KDF A;  5C5M A;  5I4D A;  1TWC B;  1RIP A;  1VQK A;  2JA6 H;  4DUY L;  4JI1 L;  1C9O A;  3M7G A;  4V19 0;  3E0E A;  1QUQ A;  2F0W A;  3PF4 A;  3RZO H;  2L9H A;  4A3M H;  3AU7 A;  2VS1 A;  1SMX A;  2F0L A;  3H3V C;  1G6Z A;  3J80 i;  1OXX K;  1EIY B;  3VYU A;  2BH8 A;  4R4I A;  3S1R B;  1B53 A;  4DR2 L;  3C2P A;  3EN2 A;  5C4X B;  4ZQ3 A;  1F9Q A;  1L0Y B;  4XIG S;  5LMN W;  1LTI D;  2ZTE A;  1CZG A;  3KFU A;  1A3T A;  4K5X A;  3GTJ H;  1TVX A;  2B2W C;  3I56 A;  4IJH A;  5I2Y A;  4AQY L;  2ZJQ A;  2ZTD A;  2I07 B;  4DV6 Q;  2B2Y C;  3K59 A;  2IWH A;  1VQL A;  1SSO A;  2CH4 A;  4X6A H;  1HJP A;  2A6E D;  4AYB G;  4C3I H;  5CV9 A;  4DV2 Q;  2E74 C;  2K75 A;  3V05 A;  1G29 1;  2E2J B;  1SRO A;  2H1E A;  1E2W A;  4B3S Q;  5ELF A;  5I6Y A;  2WB1 E;  2ZM6 L;  1Z47 A;  1DOK A;  1S5E D;  4QMG A;  4AH6 A;  4NMZ A;  5LMU L;  3SK4 A;  4ZKC B;  1SND A;  3I72 A;  3MA2 B;  3CCV A;  4OX9 Q;  2RBM A;  5A35 A;  2B2Y A;  4RCO A;  4KK7 A;  2PZT A;  5JJZ A;  4LNQ A;  3T13 A;  1TWG H;  4QY7 A;  2Q8T A;  1N32 Q;  1D8L A;  2FMC A;  1ESF A;  3ND9 A;  4P74 A;  3OYY A;  3T56 B;  4KD3 A;  1SMY C;  2F52 A;  3D3R A;  4BA2 I;  3MEF A;  1A2T A;  2EYJ A;  4A3E B;  4XXE A;  3F8T A;  1M1K C;  2F0O A;  4X66 Q;  2UXC Q;  1C4Q A;  3H91 A;  3I4N G;  1KRS A;  5JJL A;  1Z9F A;  1KRT A;  4JCV E;  2IPK D;  4XYO A;  2NVY H;  2RDF A;  3KF8 A;  5A2Q L;  2Q2H A;  4IJL A;  4F88 A;  1TY0 A;  4MZ9 A;  5C3E B;  3K0X A;  1OO9 B;  4CKC A;  4U68 A;  3W5O A;  1QCB D;  5EJW A;  3J7Z C;  1YHQ A;  4JI6 L;  4HR7 B;  4A93 H;  2QEX A;  3S14 H;  3EFX D;  3IRB A;  3T16 A;  2SOB A;  3M4O B;  5CYU A;  3LX0 A;  2R92 B;  4HIM A;  3PO3 B;  4KJN A;  1SYC A;  2NTT A;  4HJ7 A;  2OQK A;  5C4X G;  4KN7 C;  3S9W A;  1CFM A;  3A7L A;  1FNV A;  2XTI A;  2OT2 A;  4KHZ A;  3SHL A;  3M4Y A;  1CSP A;  1W2B A;  1F9P A;  5AJ3 Q;  1EQR A;  3M3Y B;  5KNB A;  1JIC A;  1TKW B;  4JI3 Q;  2QCP X;  4I7Z C;  1PVO A;  4Y7N B;  1VQM A;  3S2D B;  1FL0 A;  3WOE A;  1QJO A;  1OXT A;  1LO5 D;  1LAC A;  2C35 B;  4OO1 G;  1PH5 A;  2Z9H A;  2E2H B;  1Z7T A;  2DUD A;  1QZG A;  1LV9 A;  5IWA L;  1C0A A;  1DGS A;  1PYW D;  1DOM A;  1HTP A;  4B08 A;  5DNF A;  5JVH 3;  2ID0 A;  5KYL A;  4CHT B;  2JA7 B;  1TWF B;  2C5C A;  3GDE A;  2GVB A;  2R93 B;  2XVS A;  3RN2 A;  3TQY A;  1ENC A;  1PH8 A;  1HUN A;  3I4N H;  1D1K A;  3P75 A;  4G7H C;  4DFA A;  1XPR A;  3S1M B;  2EJM A;  4GN4 B;  3H3V I;  1P16 A;  1AH9 A;  3DWQ A;  1JCK B;  1B3A A;  1TWC H;  2EYH A;  1N33 Q;  3D6W A;  1P8L A;  1KC8 C;  3G48 A;  4N8X 1;  2F0T A;  1Y69 U;  1TT2 A;  3R2T A;  4A3E G;  1TS5 A;  4YWL A;  4DGZ A;  2F0P A;  4QL5 A;  3J81 L;  3I4O A;  1WCM B;  1GUW A;  4IPH A;  2EE1 A;  1EUJ A;  2F0M A;  4NXN L;  4DR1 Q;  5M5X B;  1YZ6 A;  4HMI A;  2R3Z A;  3S1R H;  5JJK A;  2JA5 B;  4LFC L;  5C3E G;  5C4X H;  2QGQ A;  5GAD C;  3J7A F;  3ONA B;  2QIL A;  2QA4 A;  3KYH C;  2XN9 C;  3H3V H;  3O13 A;  2IX1 A;  2KCT A;  1VQO A;  4DV0 Q;  3G6J B;  3GTK B;  2R92 G;  3TME A;  1IW7 C;  1WTW A;  1VQB A;  4DR3 L;  5IT9 L;  3D4W A;  2PQE A;  2K1B A;  4I7A A;  5CBA E;  2H5X A;  1C7Y A;  4OO1 H;  2Q2I A;  5AFW A;  2MJ8 A;  2XSC A;  4ME3 A;  2E2J H;  4LF5 L;  3OWE B;  1JJ2 A;  3CD6 A;  2KOL A;  3H6M A;  2EZV A;  2ENB A;  2AKW B;  4KMU C;  4XYQ A;  3Q22 A;  4LFA Q;  3SEB A;  1S40 A;  4O1N A;  3DWP A;  3ZYY X;  3KLS A;  4K5W A;  3K5L A;  4OEL B;  2B8G A;  1BKB A;  2CW0 C;  4YHH L;  3TS2 A;  1B9N A;  2Z6K C;  4FVM A;  1VCI A;  4KHP Q;  1KXL A;  1BCP F;  1PH1 A;  1UEA B;  4JG2 A;  3PO2 B;  2PI2 A;  1BNZ A;  3CHB D;  1PFS A;  1YNX A;  3DHQ A;  4YCU A;  1VQ9 A;  4UDU C;  2JA7 G;  3Q6S A;  4AIM A;  5IYB G;  4A3K G;  4L5R C;  2Z0S A;  2R93 G;  4A3E H;  1EYC A;  2FHT A;  5EPK A;  1AW7 A;  5LHY 1;  2Z6K A;  3SE0 A;  3GO5 A;  4JI7 Q;  1I4H A;  1ZYR D;  4XT1 B;  1HZB A;  1S5D D;  2JP1 A;  2A69 D;  1KLG D;  5C3E H;  3CCU A;  3IFD A;  2K5V A;  1B8A A;  2OEO A;  1MKH A;  2ICE C;  3C1F A;  4DK0 A;  4N9T A;  2N49 A;  5CGK A;  1HZC A;  4B3M Q;  2PCF B;  4DV5 Q;  4QUF A;  1HR0 W;  3BVZ A;  2EYM A;  1RTO A;  4V0B A;  3M4O H;  4CDC C;  2R92 H;  1V43 A;  3MXN B;  3PO3 H;  1R9T B;  2JYO A;  1L0W A;  1G51 A;  4RGT A;  5HGQ A;  2R7D A;  1HNX L;  4LF6 Q;  5FLX E;  5IGC A;  1B9M A;  1XTC D;  3MXN A;  1TII D;  3URY A;  1RL2 A;  1E3P A;  2L12 A;  4C3J B;  4LF4 Q;  1A8V A;  2K5H A;  1B4O A;  4J6H A;  2CWP A;  1WTQ A;  1EQQ A;  1XPU A;  3A5Z B;  4K14 A;  3M3Y H;  4DKA C;  4HJ9 A;  1XYI A;  2DJF C;  4UPA A;  1A63 A;  2JA8 B;  1NTG A;  4APV A;  4Y7N H;  3S2D H;  1J8I A;  3J7A V;  1V9P A;  4JBM A;  4GN5 A;  4RGN A;  2DGY A;  2JN4 A;  2A68 D; 
#chains in the Genus database with same CATH homology
 2PMZ B;  3HOZ B;  2HDM A;  4LK1 C;  1A3U A;  4NW2 A;  1SJE D;  3GTL B;  4UAI A;  5EKI A;  5T1I A;  2XWB B;  1CZW A;  1D6E C;  1I6H B;  4BBS B;  2RA4 A;  3T53 B;  5I9O A;  3MXG A;  1D1I A;  4EQP A;  1LAB A;  1MSG A;  4WJW A;  4B9X A;  1B50 A;  3P20 A;  1IL8 A;  3TP5 A;  2A73 B;  5CBE E;  2M2L A;  1STY A;  5JAV A;  3RZD B;  5EBD A;  3J80 E;  1B44 D;  2PZU A;  2VUM B;  3D4D A;  2K5W A;  1RD9 D;  1GUS A;  3GD7 A;  1ENF A;  1B1Z A;  1VMP A;  1EEI D;  2B2V C;  2F0G A;  5ELD A;  2F0F A;  3OMC A;  3FKI B;  3SK8 A;  5D14 A;  1HCZ A;  3K0Y A;  5EKK A;  1I4Q A;  4IUV A;  4C3J G;  4ZRZ A;  1Y8N B;  3NTK A;  1W6K A;  4E6I A;  3I90 A;  3SVM A;  3HZX A;  2A74 C;  5G3L D;  2JEB I;  3A7A B;  1NUC A;  5IGE A;  2RDG A;  2B2V A;  3K58 A;  4QCL A;  3PUV A;  2A6E C;  2WAQ B;  3I8Z A;  1PTO D;  3VA5 A;  4CBV A;  2PO4 A;  1HRJ A;  4TRD A;  1EU3 A;  3RUZ A;  2WII B;  1STN A;  3NXW A;  4XQQ A;  2SNS A;  2IL8 A;  2IX3 A;  2JE6 I;  2NZ1 D;  3S16 B;  3VR3 A;  2R61 A;  5EKL A;  1PFN A;  5C4J B;  3BDO A;  4C56 C;  1D5M C;  3EJI A;  1EWC A;  1I50 B;  2D62 A;  3AB9 A;  4LAA A;  3FRP B;  1ILQ A;  4RWS C;  4DK1 A;  4GZY C;  3C3L A;  3SK5 A;  4NP5 A;  5KEE A;  3D31 A;  1SNO A;  4IUT A;  4EVO A;  2L5T A;  4CJ0 B;  1A3V A;  2LMC B;  1A15 A;  2J4X A;  3OPO A;  5J39 A;  3A8K E;  4RH6 A;  1M8A A;  3L3O C;  4G7O C;  2Z4H A;  1H9M A;  1HQM C;  4DXG A;  3S15 B;  4X3U A;  5DM7 3;  1LTS D;  2NTS A;  5BN3 A;  2X6L A;  2LKV A;  3OW7 A;  3OSO A;  1ILP A;  1PMR A;  1JB3 A;  1SNM A;  1JOR A;  1SE4 A;  4BBR B;  1D5X C;  5I2X A;  1BUV T;  2A6H D;  1K8O A;  2ZT9 C;  3EVQ A;  2K32 A;  3IL8 A;  2RQX A;  3DWA A;  1JOO A;  2YU9 B;  1NSN S;  1Q12 A;  1H9K A;  2VNU D;  1EIH A;  3X3N A;  2B39 A;  3A8J E;  1SJH D;  1DCZ A;  5KYI A;  3M85 A;  3PUX A;  1GOZ A;  1Q1E A;  3DM1 A;  2K01 A;  1FGB D;  3GV6 A;  2TSS A;  4EQN A;  1LTT D;  5EBC A;  3TBI B;  1AZP A;  3KLS X;  3EQL C;  3N52 A;  4L63 B;  4FYD A;  2FJ2 A;  3MXU A;  3U9O A;  3CRK C;  2GA4 B;  1EOT A;  4HSP A;  4NDX A;  1DJR D;  4MN3 A;  4FO2 A;  3BYY B;  3RMH A;  3JAM L;  3DMU A;  3HRZ C;  5C6A A;  2EXZ A;  5CV6 A;  2KCN A;  3NP8 A;  3GV3 A;  5LL6 S;  3NQI A;  4PQX A;  5K36 G;  1LTB D;  3MAQ A;  2RSN A;  1C8C A;  2CVR A;  2IT1 A;  4CKB A;  4IUN A;  1QE6 A;  2Y0S B;  5IGG A;  3TP6 A;  2G9D A;  3OIQ A;  4WOR A;  1RTN A;  1JOQ A;  3NTI A;  3E6Z X;  4TKO B;  1AN8 A;  4OGQ C;  1LT3 D;  1I4R A;  2RSO A;  3MZ5 A;  5I6W A;  4WFN 3;  1BO0 A;  3VA7 A;  3A54 A;  2VB3 X;  1S4Z A;  3FMC A;  5FO9 B;  4JBW A;  5IGB A;  1LT5 D;  1AZQ A;  5EPJ A;  4LJZ C;  3NPP A;  2YYZ A;  3T4A C;  3MEH A;  1I4X A;  3H94 A;  4KKT A;  4Q5V A;  1SE2 A;  1BXT A;  1EZ6 A;  3QB3 A;  5CR3 A;  1XX8 A;  1ZYR C;  1LLR D;  3NUC A;  2A69 C;  1EY5 A;  1EWH A;  3ERQ A;  3D6C A;  1IKM A;  3CKI B;  2N55 A;  3CRL C;  3D8G A;  3AMU A;  2IX0 A;  5K36 H;  1EY6 A;  2FFK B;  1Y1V B;  3MXP A;  2Q8I B;  4K5V A;  4PMW A;  3GTP B;  3E5S A;  2B63 B;  3PMF A;  1STB A;  1RF2 D;  2SEB D;  2FMM A;  1EQT A;  1ZKO A;  2MHV A;  1UUP A;  3LNN A;  2JXM B;  1V1P A;  4ZAI A;  1LTG D;  4IFD G;  2NWG A;  2DNC A;  3S1N B;  1ZXT A;  2ICI A;  5TSS A;  1S5C D;  4HN7 A;  3KBG A;  4P2C B;  4EQO A;  1GUG A;  1Q1B A;  1BOS A;  2L11 A;  5CV5 A;  3U9S A;  3GQB A;  2DY8 A;  1A2U A;  3FEW X;  1F2M A;  3VR2 A;  1ICW A;  3D4R A;  1WVL A;  5M5W B;  4DN4 M;  1GUO A;  1H9S B;  4F87 A;  5D65 A;  2L55 A;  1H9J A;  1HPC A;  2BE5 C;  2F0U A;  5KNC A;  1DYQ A;  1H9S A;  4A3G B;  2K7V A;  2DY7 A;  1ZEQ X;  3F2U A;  1HQR D;  1E0B A;  3PUY A;  1U4L A;  2EVB A;  3R3O A;  3C46 A;  1XXG A;  3S2H B;  1PFM A;  4IFD I;  1HA5 A;  3TZD A;  4IN3 A;  1PZK D;  1Q3L A;  4IQZ A;  1T5E A;  4BWG B;  1W6J A;  4X3K A;  3QOJ A;  3QO2 A;  3MWY W;  1WTV A;  2E76 C;  2PW7 A;  3DEP A;  1IYU A;  1EY0 A;  1AP0 A;  5EGT A;  5D3I B;  1PRT C;  1IYV A;  1X3Q A;  3BG3 A;  1II3 A;  1WTO A;  3A56 A;  3A8I E;  3MHB A;  3NE5 B;  3K57 A;  3TDQ A;  4KHV A;  2O4X A;  4OIK A;  1SEB D;  4FF1 A;  1MI2 A;  1VMC A;  2AQ2 B;  4DNR B;  4IFD H;  3TP7 A;  4A3F B;  1F9R A;  2B8F A;  3NWT A;  1PRT B;  1Y8O B;  2DN8 A;  1TWH B;  5C3W A;  4J8Q A;  3X3M A;  4K8J A;  1RDP D;  1I4G A;  5NUC A;  2SNM A;  1FYC A;  5IGF A;  1VDZ A;  3KK7 A;  1D5Z C;  4A3I B;  1G2S A;  5CV8 A;  4F7X A;  1GHJ A;  4L8J A;  1PZI D;  2M9V A;  1PTO C;  1O78 A;  4FXD A;  3I70 A;  2Z8L A;  3NK9 A;  5C0X G;  1VF7 A;  4A3B B;  2EJG C;  3HOY B;  2WV6 D;  2NYZ D;  4XQJ A;  4ME5 A;  4Q0F A;  4O42 A;  4CKE A;  2Z4I A;  1GUN A;  3FPU B;  5BN5 A;  1BCP D;  1PTO B;  2F0V A;  1U9R A;  1YNJ D;  3HP3 A;  4DF7 A;  1O80 A;  2KUM A;  4KD4 A;  3BZD B;  3A55 A;  1LTR D;  2LY7 A;  1TS2 A;  2DNE A;  3K5O A;  2F0K A;  1SDF A;  3E0J A;  1SNP A;  3MVV A;  2F1M A;  1UNS A;  2WB1 B;  5EPL A;  1WTP A;  5C0X I;  5C3X A;  3QIA A;  4RKL A;  2K04 A;  4IUP A;  3UI2 A;  1PRT F;  2FIN B;  1Q90 A;  1WD0 A;  1SFO B;  5DAU A;  3HOV B;  3VYS A;  2NN6 I;  3K7A B;  1SNQ A;  4TQU S;  1Y8P B;  5I9P A;  4IUQ A;  3OOC A;  1G91 A;  1KDA A;  4HCS A;  1O7Y A;  2EY1 A;  2E2D C;  4RKB A;  4OL7 A;  5FLX L;  1CQV A;  1IHZ A;  1HXY D;  5C0X H;  2D2C C;  1EEF D;  1IW7 D;  4F8M A;  3LWU A;  4IUR A;  2NB0 A;  2AUJ D;  4BY7 B;  2EYP A;  1ROD A;  5BN4 A;  4XQN A;  4B9W A;  3EA6 A;  2K5Q A;  3NHH A;  3DXJ C;  3R2I A;  3Q23 A;  1KNE A;  3GTQ B;  1SAP A;  3L9A X;  1EYA A;  2KEE A;  1EY4 A;  2BA1 A;  3J7Y W;  2J0T D;  4X3S A;  1LTA D;  5ISR A;  2CW0 D;  1GXD C;  3S17 B;  3GTO B;  3W2D A;  3IFT A;  4RGM A;  1MD2 D;  1Y1W B;  1F77 A;  1B2T A;  2EY5 A;  2F0S A;  3G7L A;  3GTM B;  5KND A;  1NAP A;  1KAB A;  2BDN A;  2F0Q A;  3MC0 B;  4OHJ A;  2AUK A;  1UAP A;  1DZ1 A;  2K33 A;  4ILW A;  4XT3 B;  1E2V A;  4ZK9 B;  1PDQ A;  2BCO A;  1RHP A;  3OHX C;  4KY5 A;  1BF4 A;  5CV4 A;  4H44 C;  2K05 A;  4HED A;  2EPB A;  2O5I C;  2J7Z A;  4DAV A;  1Z6H A;  5M3F B;  2F4I A;  1BQQ T;  3WDN A;  3J80 L;  1STG A;  1O7L A;  5KIX A;  3OIP A;  5IOD A;  1RCV D;  3QOL A;  3NBI A;  1DXM A;  1JWM D;  2L0C A;  4OIJ A;  3KBX A;  5M5Y B;  5C44 B;  2VXW A;  3PIO 3;  5JPN C;  2KEC A;  5HUR A;  4QF4 A;  4DNT B;  3I3C A;  2BOS A;  1XWE A;  3N6R A;  1X32 A;  3MFY A;  1U4M A;  1BDO A;  3BVM A;  1V1O A;  1R4P B;  2NVQ B;  2KA7 A;  4BA1 I;  2I46 A;  2B2U C;  1KAA A;  2XNA C;  3R93 A;  1EYD A;  2XIW A;  1YNN D;  3ND8 A;  4KI0 A;  1PTO H;  1WTX A;  1R4Q B;  3H0G B;  1RKN A;  1CK1 A;  2NUC A;  4A3J B;  3HG9 A;  2B2U A;  1Q8I A;  4DAP A;  1PZJ D;  3T51 B;  4HMJ A;  3DEO A;  1SE3 A;  5ELC A;  2JEA I;  2R6G A;  4KKS A;  4R8I A;  4R9W A;  1F2L A;  1KLU D;  4K2L A;  1WD1 A;  2ZXO A;  3R8B A;  4EGV A;  3DUZ A;  1TWA B;  1FD7 D;  4Z9C B;  2Q8R E;  1H9R A;  1OXS C;  2CHB D;  1DOL A;  2F0D A;  3VR5 A;  4RHR A;  2IW3 A;  1JR0 D;  2O5J C;  2IJ0 A;  2D5D A;  3K5N A;  1RJT A;  3LWE A;  5JOB A;  1HA6 A;  4KKU A;  1U4P A;  3IAY A;  1EY9 A;  1PFB A;  1MBY A;  4ABN A;  1SYE A;  2HDL A;  5E4X A;  1I4P A;  5A2Q E;  1HUM A;  3TP8 A;  3MFG A;  1PXU A;  1S5B D;  3K6O A;  4FXG C;  1STH A;  3SR1 A;  2V4D A;  4RHS A;  2L1B A;  2KJX A;  3GTG B;  4YIJ A;  1SYG A;  2KVM A;  2WP8 J;  2QKI C;  2NBF A;  4QB4 A;  2B2W A;  5DEH A;  2MPM A;  3KLR A;  3FDT A;  4CJ1 B;  1JWS D;  3I73 A;  4QUC A;  2X69 A;  3IKJ A;  4DAY A;  4MIU A;  3H09 A;  4IUU A;  2QF7 A;  5ELB A;  1HFN A;  2MUY A;  4FF2 A;  3HOW B;  1F2Y A;  1STA A;  4TSS A;  2PYK A;  5C5L A;  1CT1 D;  2LS0 1;  1TS4 A;  1KNA A;  2F0J A;  1HFG A;  2A5H A;  4CJ2 C;  3L7Z C;  2BDO A;  4FF3 A;  2O2L D;  2RKS A;  5FK9 C;  5C4H A;  2MGS A;  2H4O A;  3NWS A;  1QNK A;  3SK6 A;  2F0N A;  4ZUJ A;  3P1H A;  3S1Q B;  1IKL A;  1K8M A;  2C9O A;  3QWN A;  2XRS D;  5EQ0 A;  4FXK C;  3CQZ B;  1QWY A;  3J81 E;  1SYB A;  1EZ8 A;  2F0I A;  4RA8 A;  4BY1 B;  2F0E A;  5J1Z A;  5E3F A;  2ZXR A;  2BA0 A;  1CHQ D;  5LL6 X;  1OXV A;  4U67 3;  2E2I B;  1JE4 A;  2HCC A;  3HOX B;  4KV6 A;  2AQ3 B;  5DM6 3;  4G7Z C;  5CC4 A;  3FPP A;  3FVQ A;  4DXF A;  2EOT A;  3GP7 A;  1O7Z A;  4PMB A;  4ULL A;  4K8I A;  4FF4 A;  1BCP C;  1V1P B;  2EJF C;  5IT9 E;  4G4K A;  4C2M B;  1YNJ C;  4XDX A;  3I91 A;  1J9O A;  4RCN A;  4A3K B;  3CU7 A;  1NR4 A;  1SYD A;  2A68 C;  4KY6 A;  4KJO A;  2OF1 A;  1BCP B;  2F3V A;  2K28 A;  2AWN A;  1OXU A;  5T1G A;  4K6D A;  4FNF A;  4G57 A;  5IIF A;  4JK1 C;  2M00 A;  1GUT A;  1K83 B;  1F9S A;  4OO1 I;  4ODG A;  4N9P A;  4HTH A;  4S3S A;  2WKC A;  1QIL A;  3PUW A;  2HUG A;  3V2T A;  3PV0 A;  4A3D B;  1AEX A;  4HCE A;  3HKZ B;  3NQT A;  2R7Z B;  3K5M A;  3KUP A;  4X3T A;  1DON A;  2NVX B;  5JVG 3;  1ENA A;  4C3H B;  5M3M B;  3BDL A;  1SMY D;  2TMP A;  1CM9 A;  2XRQ D;  1QNU A;  2QEJ C;  5FO7 B;  5JPM C;  4IFD J;  1EL0 A;  3PUZ A;  5IGD A;  1X3P A;  1EIG A;  2EYO A;  2RDH A;  1TS3 A;  1HTL D;  3BS1 A;  4L6T B;  1G2T A;  4C1N K;  1CHP D;  2E75 C;  4HAE A;  3V96 A;  3QJY A;  4M8A A;  1EY8 A;  4KY7 A;  1ML0 D;  4PNY A;  1G8Z D;  1I6V C;  3VR4 A;  1M4V A;  2RVL A;  5IOC A;  5M9O A;  4PV1 C;  1JQY D;  5COR A;  1TY2 A;  2KED A;  3WOF A;  1FR3 A;  1T5X D;  5ELE A;  1I3Q B;  1TR5 A;  2PW5 A;  5E4W C;  1FNW A;  2NVT B;  1CA5 A;  5D3D A;  3OMG A;  4IAL A;  4I65 A;  3Q0A A;  1STE A;  4KTA A;  1PLF A;  3ERO A;  1GJX A;  2XWJ B;  2KHS A;  2NN6 G;  2K03 A;  3M7N A;  3SXH A;  1C48 A;  2OXP A;  2KCC A;  4R8N A;  3BVG A;  1ET9 A;  2PPB C;  3HEJ A;  4DU9 A;  1VF5 C;  1U4R A;  1JOK A;  4K6L A;  3I4M B;  2F0H A;  5CMD A;  4RGO S;  4WRD A;  2CQA A;  4C3H G;  5KRU A;  1SXT A;  1F2Z A;  3PIP 3;  1TU2 B;  3QG1 A;  1BBX C;  3W3A A;  1QOH A;  3HOU B;  1YNN C;  3NTH A;  3VYT A;  1EFI D;  1EY7 A;  5FKA C;  4DA2 A;  4LMQ D;  2K6A A;  5C0X J;  4XTC S;  5K5P A;  2HQE A;  2JSO A;  4M1U B;  4ZUI A;  2JA6 B;  1QG7 A;  3RZO B;  2BE5 D;  4A3M B;  3NBH A;  1ESR A;  5KGU A;  5G3L F;  3P7J A;  5FOB B;  5HGT A;  3NSW A;  1KDC A;  2EYL A;  2A6H C;  5COY A;  1L0X B;  1TQO A;  3GTJ B;  2PZW A;  1PTO F;  2Z1C A;  3VYR A;  2MP1 A;  2NN6 H;  1SNC A;  2EYF A;  2LFN A;  4ID6 A;  3HGB A;  3TZU A;  4C3I B;  1PRT D;  1KDB A;  3TN2 A;  4ZLT F;  3VR6 A;  5JEA G;  1A6X A;  4PMC A;  3I4L A;  2QDB A;  3HS0 C;  1AFP A;  1GHK A;  5FO8 B;  4NKL A;  2F03 A;  4K2K A;  4ZYS A;  5J22 A;  2VB2 X;  4RAU C;  1TWG B;  1SYF A;  2KQ3 A;  2PNR C;  4KN4 C;  2WKD A;  1LT6 D;  4CGY B;  2G9H D;  4C1N I;  1CA6 A;  3OWF A;  1LT4 D;  2N88 A;  1ONL A;  2L4N A;  4IZ8 A;  4HSV A;  1JC7 A;  1JWU D;  1MSH A;  2NVY B;  3RD4 A;  2WIN B;  3RLF A;  1QB5 D;  3Q24 A;  4J1M A;  1D2B A;  3SDZ A;  4A93 B;  2HCI A;  3S14 B;  2B2T C;  5C4Z A;  3BYT B;  2K5D A;  1FNU A;  2SDF A;  1ET6 A;  2EY2 A;  5JEA J;  4AYB B;  2F3W A;  2AWO A;  3ITP A;  1S5F D;  3TSS A;  1EQV A;  4H13 C;  5CV7 A;  2D9U A;  4BS9 A;  3BDC A;  1E2Z A;  1HHV A;  2EY6 A;  2EDG A;  2WAC A;  1V8Q A;  5JEA H;  2B2T A;  2X6G A;  4QIW B;  4C3I G;  1DM0 B;  1NR2 A;  4RFB A;  1EU4 A;  1CI3 M;  1CQF A;  1WTR A;  4FP5 D;  1BR9 A;  4H0L C;  3C1E A;  4H7B A;  3MTS A;  5E1F A;  4ZKB B;  5F2D A;  1MGS A;  2ZXP A;  4MHE A;  1CTM A;  3I4N B;  1DD2 A;  1KTK A;  2AQ1 B;  3JAM E;  1SBB B;  1NCV A;  5C5M A;  5I4D A;  1TWC B;  3M7G A;  4V19 0;  2F0W A;  2L9H A;  3AU7 A;  2F0L A;  3H3V C;  1G6Z A;  1OXX K;  3VYU A;  3S1R B;  1B53 A;  3C2P A;  5C4X B;  4ZQ3 A;  1F9Q A;  1L0Y B;  4XIG S;  1LTI D;  1CZG A;  1A3T A;  4K5X A;  1TVX A;  2B2W C;  5I2Y A;  2I07 B;  2B2Y C;  3K59 A;  2IWH A;  1SSO A;  2A6E D;  5CV9 A;  2E74 C;  3V05 A;  1G29 1;  2E2J B;  2H1E A;  1E2W A;  5ELF A;  5I6Y A;  1Z47 A;  1DOK A;  1S5E D;  4QMG A;  4NMZ A;  3SK4 A;  4ZKC B;  1SND A;  3I72 A;  3MA2 B;  2RBM A;  5A35 A;  2B2Y A;  4RCO A;  4KK7 A;  2PZT A;  5JJZ A;  3T13 A;  2Q8T A;  2FMC A;  1ESF A;  3ND9 A;  3T56 B;  4KD3 A;  1SMY C;  3D3R A;  4BA2 I;  1A2T A;  2EYJ A;  4A3E B;  4XXE A;  2F0O A;  1C4Q A;  3H91 A;  2IPK D;  4XYO A;  2RDF A;  3KF8 A;  5A2Q L;  4F88 A;  1TY0 A;  5C3E B;  1OO9 B;  4CKC A;  4U68 A;  1QCB D;  5EJW A;  4HR7 B;  3EFX D;  3T16 A;  2SOB A;  3M4O B;  5CYU A;  3LX0 A;  2R92 B;  3PO3 B;  4KJN A;  1SYC A;  2NTT A;  4KN7 C;  3S9W A;  1CFM A;  3A7L A;  1FNV A;  2OT2 A;  4KHZ A;  3SHL A;  3M4Y A;  1F9P A;  3M3Y B;  5KNB A;  1JIC A;  1TKW B;  2QCP X;  4I7Z C;  4Y7N B;  3S2D B;  3WOE A;  1QJO A;  1OXT A;  1LO5 D;  1LAC A;  4OO1 G;  2E2H B;  1Z7T A;  1LV9 A;  1PYW D;  1DOM A;  1HTP A;  4B08 A;  5DNF A;  5JVH 3;  2ID0 A;  5KYL A;  4CHT B;  2JA7 B;  1TWF B;  2C5C A;  2R93 B;  2XVS A;  1ENC A;  1HUN A;  1D1K A;  3P75 A;  4G7H C;  4DFA A;  3S1M B;  2EJM A;  3DWQ A;  1JCK B;  1B3A A;  2EYH A;  3D6W A;  2F0T A;  1Y69 U;  1TT2 A;  3R2T A;  1TS5 A;  4DGZ A;  2F0P A;  3J81 L;  1WCM B;  1GUW A;  2EE1 A;  2F0M A;  5M5X B;  4HMI A;  2R3Z A;  2JA5 B;  3J7A F;  3ONA B;  2QIL A;  2XN9 C;  3O13 A;  2IX1 A;  3G6J B;  3GTK B;  3TME A;  1IW7 C;  1WTW A;  5IT9 L;  3D4W A;  2PQE A;  2K1B A;  5CBA E;  4OO1 H;  5AFW A;  2MJ8 A;  2XSC A;  3OWE B;  2KOL A;  3H6M A;  2EZV A;  2ENB A;  4KMU C;  4XYQ A;  3Q22 A;  3SEB A;  4O1N A;  3DWP A;  3ZYY X;  3KLS A;  4K5W A;  3K5L A;  2B8G A;  2CW0 C;  1B9N A;  4FVM A;  1VCI A;  1BCP F;  1UEA B;  3PO2 B;  1BNZ A;  3CHB D;  3DHQ A;  4UDU C;  3Q6S A;  1EYC A;  2FHT A;  5EPK A;  1AW7 A;  5LHY 1;  3SE0 A;  3GO5 A;  1I4H A;  1ZYR D;  4XT1 B;  1S5D D;  2JP1 A;  2A69 D;  1KLG D;  3IFD A;  2OEO A;  2ICE C;  3C1F A;  4DK0 A;  4N9T A;  5CGK A;  2PCF B;  4QUF A;  3BVZ A;  2EYM A;  1RTO A;  4V0B A;  1V43 A;  1R9T B;  2JYO A;  4RGT A;  5FLX E;  5IGC A;  1B9M A;  1XTC D;  3MXN A;  1TII D;  3URY A;  2L12 A;  4C3J B;  1B4O A;  4J6H A;  1WTQ A;  4K14 A;  1XYI A;  2JA8 B;  1J8I A;  3J7A V;  4RGN A;  2A68 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...