1EY7A

Structure of s. nuclease stabilizing mutant s128a
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
135
structure length
135
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords STAPHYLOCOCCAL NUCLEASE
publication title Increasing the thermostability of staphylococcal nuclease: implications for the origin of protein thermostability.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 35
structure length 135
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2000-05-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1ey7A00
1EY7A 1RKNA 3P75A 3D8GA 5IGEA 4EQPA 3HZXA 4DF7A 4KY6A 4K5WA 1KDBA 1SNCA 2M00A 3NXWA 4IALA 1ENAA 2EYJA 1IHZA 2EXZA 1SNMA 2O4XA 4K5XA 2F0OA 4NDXA 5DEHA 4B9XA 5C4ZA 5ISRA 3MZ5A 1EY0A 3EROA 5CV7A 1EYAA 2F0FA 1NSNS 5JAVA 2F0KA 1STBA 1STGA 2F3VA 4DU9A 5CC4A 4KJOA 4IUNA 4ZQ3A 3TP7A 1SNPA 1SNQA 5E3FA 5HGTA 2EYPA 5IGDA 1SYEA 2EYOA 4IZ8A 1AEXA 2F0SA 2LKVA 4PMBA 4DGZA 2F0TA 3V2TA 4KY7A 1JOOA 1SNDA 2PW7A 5IGGA 1U9RA 5CV8A 5C3WA 1JORA 4J6HA 5JOBA 5KYIA 2F0WA 5I9PA 5KRUA 2F0NA 4B9WA 3QB3A 5EKKA 4RKLA 4N9PA 3VA5A 4QB4A 5E1FA 2RDFA 4N9TA 2EYFA 2KQ3A 3EVQA 4R8NA 1A3TA 2F0UA 2ENBA 4NP5A 1STYA 4J1MA 3DHQA 5KIXA 1EYDA 3NHHA 3R3OA 2PW5A 3LX0A 4ME5A 4MIUA 4WORA 4PMCA 3NP8A 4OL7A 3TP6A 5IODA 2EY2A 2F0JA 4HMIA 3OWFA 5IOCA 3BDLA 4ZUJA 1STNA 2PZUA 4H7BA 4K8JA 5C3XA 3ITPA 2F0DA 1JOKA 1SYDA 4K5VA 3EJIA 4ODGA 5CGKA 5I6YA 5EGTA 1STHA 3HEJA 4TRDA 5C5LA 2SNMA 3ERQA 4KJNA 3OMCA 2EY6A 4E6IA 2EYMA 1A3VA 2EY1A 1EY6A 5CV5A 2F3WA 2F0EA 2RBMA 4EQOA 5IIFA 3P1HA 4LAAA 2PZWA 1TR5A 1EY9A 4WRDA 1II3A 2F0GA 4K14A 1STAA 2F0HA 3D4WA 1EYCA 1KDCA 1A2UA 1A2TA 2HQEA 4QF4A 1SYFA 4I65A 2F0QA 3C1EA 4HTHA 4NKLA 4S3SA 5NUCA 3SR1A 3T16A 2WACA 4ZUIA 3SK5A 2OEOA 1SYBA 5M9OA 3BDCA 1TT2A 5C5MA 3SK8A 3C1FA 1EY4A 5DAUA 2SOBA 3E5SA 3MEHA 3D6CA 2KHSA 1KDAA 4HMJA 3RUZA 5J22A 4PNYA 5KEEA 1JOQA 1EZ6A 4G57A 1NUCA 3NUCA 3OSOA 2EYLA 1EZ8A 3QOJA 2F0LA 5F2DA 4QMGA 3QOLA 3S9WA 2F0MA 5J1ZA 5CV9A 5IGFA 3MXPA 2OF1A 2F0IA 2PQEA 2QDBA 3MHBA 1ENCA 4KD4A 5CV4A 4EQNA 5KYLA 5CR3A 4K2LA 3TP5A 3NK9A 1F2ZA 1SYGA 2OXPA 1EY5A 1EY8A 2F0PA 1F2MA 2SNSA 4KD3A 4K8IA 4KV6A 3TP8A 5C6AA 5IGBA 4K6DA 1KABA 4F8MA 1KAAA 3NQTA 2RKSA 4KTAA 2NUCA 3SK4A 2PZTA 4KHVA 3TMEA 3SXHA 5I6WA 4KY5A 1SYCA 2F0VA 4ID6A 5I9OA 5IGCA 2EYHA 1TQOA 2EY5A 4EVOA 4YIJA 4NMZA 4RKBA 3PMFA 2PYKA 3OMGA 1EQVA 5K5PA 5J39A 4DFAA 5HURA 1SNOA 3SHLA 3T13A 3H6MA 1F2YA 4F7XA 1A3UA 3DMUA 5C4HA 5KGUA 5CV6A 3U9OA 3MVVA 4K2KA 5EKLA 3SK6A 3D4DA
chains in the Genus database with same CATH superfamily
5LL6S 5IYCG 4JI2Q 3OTOQ 4KY6A 1SAPA 1QWYA 2M00A 2HIXA 2FHTA 2HUGA 2O4XA 4BY7H 3JAME 4HJ8A 3DWPA 1JR0D 2CH4A 5A2QE 1Z9FA 2JJQA 5C0XH 1KC8C 4RA8A 2NBFA 3CCLA 4NXNL 1HNWL 1AEXA 1WCMB 2F0TA 3M4OH 3PUZA 1JB7A 1HZCA 3M7NA 1QG7A 2LXJA 1I3QB 2RDFA 3UDXA 1D2BA 4HIDA 1E3PA 1CHPD 2F0UA 5KIXA 1WCMH 1H9MA 1UE5A 1NAPA 1L0WA 4GN5A 4FP5D 2CCZA 3I91A 4JV5Q 4TRDA 1RHPA 1WTRA 2EY6A 1MSHA 2IHEA 2JE6I 1BOSA 4IUUA 4KKTA 5FJ8H 1PH7A 1CK1A 1Q90A 2F3WA 2RBMA 5HGQA 2X69A 3RNUA 3K81C 3PUWA 2FINB 1TS5A 3C1EA 1WYDA 4PZ7A 3OIQA 1CKMA 1MD2D 2A69D 3T51B 1TS2A 3C3LA 5LMUQ 2O5IC 2EDGA 3MAQA 4B3SQ 4X65L 2NN6G 2RCFA 3D6CA 2CHBD 5J22A 3A8KE 1LT4D 2EE1A 4FXKC 2B2UC 4X3TA 3J80L 1PA6A 2K33A 2K01A 4LF6L 2H4OA 1IKLA 4DV5L 4X64L 2C9OA 3QOLA 1NR2A 4TVAB 3S9WA 3UE0A 1F9QA 4MTNA 1A62A 5KYLA 4LFCL 1FGUA 3Q8DA 2R7ZB 2K75A 1F2MA 3TQYA 4OX9L 4UAIA 4DV1L 5IGCA 4WJ4A 5CBEE 4IFDI 4LF7Q 2YV5A 3X3NA 3KJPA 1I94L 2R7ZH 4F7XA 1PDQA 4C3JG 3K7AB 2AMCB 2UXDL 3GTMB 2GVBA 4RFBA 5FLXE 3G7LA 4DF7A 1LTRD 1V9PA 4LFBQ 2E2JB 4H0LC 1FYCA 4NDXA 3K7AH 3WWVA 3GTMH 2F0FA 2K14A 1SJED 4JW0A 1YHBA 1HTPA 2JA5B 4JI1Q 3L9AX 4CDFC 1ZEQX 3HFZB 1ENFA 2E2JH 5IYBG 1RDPD 2XIWA 3STBC 3AMUA 3T1YL 3GO5A 3ZJYC 5T1IA 1I6HB 4G4KA 3VR6A 3DXJC 2KBNA 1PH9A 4HAEA 4QB4A 1LYLA 1NMGA 3GTQB 4TKOB 4CJ2C 1SMYD 1Q1BA 1BO0A 2QCPX 1LM0A 1I6HH 1G91A 2QGQA 1XXGA 3ITPA 4RHRA 4UPAA 1JOKA 4L63B 2Q8TA 3TSSA 3L3OC 4A3FB 4B3RL 3GTQH 3AFPA 1G2SA 5EGTA 3HEJA 2F4VL 4KJNA 4A3LG 3CD6A 3KFUA 3D3RA 3IRBA 2B2TC 4DV3Q 5IIFA 3AEVA 4A3FH 2UUCL 2K05A 1Y1VB 3H3VI 3E0JA 4I65A 2HHHL 1NNXA 1K3BC 1JICA 4DK0A 1K8GA 3I4LA 1HXYD 3EIVA 3JC66 4DV0Q 1B7YB 1F9RA 2I07B 3L7ZC 1JWMD 1VQKA 1Y1VH 1LO5D 1CZGA 1XMOL 3I70A 4JI4Q 1S5ED 5DM63 2WAQE 5F2DA 4QMGA 1NTGA 1X55A 4N8X1 3G71A 3S2HB 3S1QH 2RHQB 4H13C 5KNDA 3AB9A 2K03A 2ZXOA 1A8VA 1V1OA 3RUZA 1OXXK 1EY5A 2SNSA 4R8IA 1GJXA 2A74C 4MHEA 4P75A 1GOZA 1S72A 1Q7YC 3S2HH 2PZTA 2K04A 2XGTA 2UUAQ 1E0BA 2PMZE 5G3LF 4PQXA 3M4PA 3GTOB 3A74A 4YIJA 3E9HA 4JI6Q 4JYAL 2JQOA 4R1JA 4NW2A 5I2YA 1T5EA 1VCIA 3ER0A 3H6MA 3U50C 4BY1G 3S1MB 4ZK9B 1IW7D 1HUNA 1YHAA 5C44G 3GTOH 2B2VA 3M7GA 2F52A 1E1TA 2H5XA 3D31A 3S1NB 4HEDA 1AW7A 1SEBD 4Q5VA 1VQ8A 3S1MH 2ZXRA 1IL2A 3F2DA 4IPCA 2XSCA 1XWEA 2KECA 4DAVA 4Y7NB 3SDZA 1YITA 4RGTA 3S1NH 5FO9B 3V2TA 1TWHH 2R92B 1DYQA 1YZ6A 5JPMC 1JORA 1QUQA 3VR5A 2F0WA 3QB3A 4AQYL 4LF8L 3WDNA 1EFWA 2QEXA 1EIGA 1A3TA 3DHQA 1PYWD 2PW5A 1X65A 3FKIG 2R92H 2F0JA 5JEAH 4Y52H 5CBAE 2A8VA 5C3XA 3BJUA 2TSSA 2YU9B 1QUQB 1D1IA 2A68C 3MFYA 1R9TB 3EQLC 3TZUA 2SNMA 3NBHA 2QEJC 1UAPA 2BE5C 4DV6Q 3WOEA 4E6IA 2ZT9C 5C4XG 2YU9H 1SLJA 1XMQL 2IJ0A 1MI2A 1EYCA 1R9TH 1A2TA 1T5XD 4BBSG 1SYFA 5NUCA 3T16A 2VUMB 3NBHB 5M3MG 1B1ZA 1JE5A 5M3FG 1G6PA 1CKOA 4PNYA 1EZ6A 1KLGD 1E2WA 4JI8Q 1FGBD 4L5RC 2VUMH 1B50A 3PIOA 3I4MB 1XPOA 3MXPA 1UWVA 4EQNA 1RD9D 4DR6Q 4ZKCB 1Y8NB 2CQOA 2VQEL 5IGBA 4NXML 1SFOB 4FNFA 3I4MH 3C2PA 4HIMA 4F88A 4OO1H 1HRJA 3D0FA 2EYHA 2JA7B 1TWAB 1N33L 2N78A 1IW7C 2O2LD 4DAMA 2VL6A 2R7FA 1SFOH 1GO3E 4A4IA 2LS01 5EKLA 4G7OC 1N36Q 5EAYA 3M3YB 1R4QB 1U5KA 3DM3A 4K5WA 2JA7H 1TWAH 1RTNA 1CM9A 2LFNA 1KL9A 4IALA 4ZRZA 4DNIA 1QNUA 3CPFA 1BBUA 1HPCA 4UP9A 4A3MG 3EROA 2BH8A 3M3YH 2D62A 5HGTA 4LF4Q 4IURA 1SYEA 2EYOA 3NEMA 3CCJA 1K3RA 4KN4C 2ASBA 3HOYB 5CV8A 4DV4L 3QWNA 1VQPA 3BZDB 1SE4A 1EWHA 4JI5L 1BQQT 4IUPA 4N9PA 3A8JE 2PI2A 1F77A 5BN3A 1IL8A 2Z1CA 3R3OA 2Q2TA 4DXFA 4PMCA 4CDEC 2CFMA 3HOYH 1GXDC 3BDLA 2E8GA 4RH6A 3H3VC 1HZ9A 2HDLA 1SXTA 1SJHD 4K5VA 5FO8B 1YI2A 4XYQA 1GVPA 5C3EB 1LACA 2IL8A 5IP7H 1VS0A 4LAAA 4WRDA 4A3DB 1STAA 2F0HA 3PF4A 4BY7G 3HKZB 3A5ZB 3U9SA 5C3EH 1QVCA 1RF2D 2A6HC 3SK5A 3P7JA 2OEOA 1X3PA 4OWXB 3OW7A 3OHXC 5C0XG 2QW7A 4EQ5A 5C0XI 3I73A 2R6GA 3MEHA 3JAMc 3F1ZA 1PH4A 1AZPA 3TBIB 2MO0A 1NUCA 3NUCA 1EQQA 2EYLA 4K6LA 2F0LA 3BVMA 4JVZA 3CCRA 3HRZC 2F0MA 5J1ZA 1SR3A 1HR0L 2IX1A 2R93B 1E1OA 2RCNA 3TP5A 2A1AA 4A3JB 2NZOA 4C2MB 4KV6A 3TS2A 2ICIA 5EPKA 2UXCQ 1I4GA 3I3CA 2B2YC 4DUYQ 4YY3L 3BYYB 5C4JH 2EY5A 1B2TA 1CQFA 4HJ9A 4A3JH 1MGSA 4C2MH 4WFN3 3H15A 1A3UA 2FFKB 3GV3A 2I5MX 4L5QA 2CW0C 3EN2A 2JEBI 3P75A 2MHVA 1E22A 3HZXA 3KBGA 3M85A 3HS0C 2HQLA 1B4OA 4LW1A 2EYJA 2EXZA 4JBWA 5IP9G 1SE3A 3M4QA 1RJTA 1WTHA 5CC4A 3MTSA 2QILA 2E76C 4IUQA 3QO2A 1K8AC 4YHHL 1SNDA 2MO1A 1SROA 5IT9E 4XT3B 4RWSC 3D4RA 2N3SA 5HY6A 5JVG3 2NVQH 2K1BA 2M9VA 1VQ4A 4JI3Q 4JI7Q 4JPBW 3J80i 1HFGA 4IOCA 1PYSB 3A5UA 4DK3C 3ULJA 1FJGQ 1EQTA 5LHY1 2MPMA 1EFID 4B3TL 5EJWA 1I4HA 4DR5Q 2VQFQ 1PV4A 4DR2L 2UUBL 2GN5A 1A3VA 2Z9HA 3NTKA 1LV9A 2PZWA 1VQ6A 1G291 3GTPB 3PO2B 4DUZQ 1X3GA 2KCNA 4NKLA 2JA6B 4RGNA 1Q3LA 3SK8A 3CQZH 4OONA 3LWEA 3PO2H 3GTPH 2E2IB 3J81L 3V96A 1IBKL 1J5EL 2L15A 3U58A 1BUVT 2EVBA 1UE7A 2UXBL 1C48A 2JA6H 4GN4B 1LLRD 1BCPB 3X3MA 2LXKA 2CH4W 5GADC 2QDBA 1PRTC 1VMPA 4JI2L 4K2LA 2E2IH 1FL0A 1RCVD 3OTOL 1TWFB 3I55A 2E5LL 4R4IA 1EY8A 2WKCA 4K8IA 1TIID 4F8MA 1B44D 2WV6D 5E4WC 1I4QA 3ONAB 4P72A 5I6WA 4BA2I 2RQXA 1L0YB 1TWFH 1K73C 3OW2A 1M1KC 4B3MQ 1SNOA 4OHJA 1SBBB 5KGUA 4XT1B 1PRTF 2KCCA 3AU7A 2FMMA 1RTOA 5FOBB 4GS3A 3S17B 4NPSA 4YCWA 2Q8IB 3CCSA 4X3UA 1IHZA 4HCEA 5DLQE 1B3QA 3MZ5A 5CV7A 1S5FD 3PO3G 1M90C 3HOUG 4QY7A 3FRPB 1ESRA 2WFWA 2NVYB 3MWYW 4LUVA 4FF1A 3RLNA 2R61A 4G7ZC 4JV5L 5GQOA 3PUXA 2ID0A 4U68A 1Y1WG 2NVYH 1YVCA 1TU2B 1DM0B 3PIP3 3ULPA 4DV2L 3A7LA 4AYBG 1DOMA 2HIVA 2IW3A 5LMUL 3J7A5 4ZUJA 2YTYA 2PZUA 4P74A 4DAYB 4LMQD 4WJ3M 2MGSA 1V1PA 4MNOA 1Q8IA 2MJ8A 4GLAC 2QKIC 1F9PA 4KHZA 4JG2A 4EQOA 3J7AF 4K14A 2F0GA 3STBD 1IYVA 1HJPA 1JJGA 2KA7A 4DV7Q 4OIKA 1PH5A 1TKWB 1YNXA 1I6VC 1CKNA 4S3SA 1K9MC 3LWUA 4CBVA 2RSOA 1V1PB 5LMNW 2XWBB 3GTGB 2FXQA 1KQSA 2Q2IA 2NTTA 4EX5A 2GA4B 4XQQA 1I3QH 1A6XA 1R4PB 4LF7L 4LUOA 4GOPC 1P16A 2TMPA 1CKNB 4GLXA 4YCUA 1QNKA 1HHVA 1DGSA 2UU9Q 1PTOB 4ME3A 4A3KG 2K5HA 2Z4HA 3HOWB 1SYGA 3E6ZX 5JEAG 3H0GB 3PF5A 1PTOH 3SXHA 1VQHA 4O2DA 1TQOA 2DY7A 3MEFA 4NMZA 2Y0SB 4JI1L 3HOWH 4QUFA 5H1SE 2B29A 1Y8PB 1PH8A 4R4TA 3CAMA 2OQKA 5G3LD 1JE4A 1KRSA 2J4XA 3FP9A 5FLMH 4R9WA 3NTHA 1J8IA 3CXCA 1TWCB 1ENAA 1SDFA 1XNRQ 2IY5B 4K5XA 4GKKQ 2HCIA 1Q82C 3K5NA 2YTVA 5EBCA 3CHBD 1YJWA 1HNWQ 3CCQA 2J0TD 4IFDG 5JPNC 3MC0B 2WB1E 4DNTB 1SSOA 2B63B 3FHWA 1TWCH 4LF9L 2E74C 4DR1L 2N55A 4H02A 3W5OA 3IKJA 1U4MA 1DD2A 1TY0A 1QOHA 2PI2E 4DV3L 1U4PA 1PH6A 3VA5A 2B63H 1DOKA 1H9SA 3I4MG 3FDTA 3TP6A 3IFDA 2KUMA 4DXGA 3I2ZA 2A6EC 2X6LA 4OO1I 3T1HL 2F0DA 3KF6A 4DV0L 1TY2A 2XWJB 3FMCA 3EJIA 3EFXD 3K6OA 2I0QA 4A3BG 3W1BA 3W3AA 1H9SB 3HOXB 4JI4L 4CKBA 1L2FA 3UE1A 1WOCA 3E0EA 4GKJQ 1VQLA 3KF6B 2JA5H 3VYSA 2E2DC 4A3IG 3SR1A 3SVMA 4X65Q 4ZUIA 1RL2A 3HOXH 1C8CA 2N88A 2PCFB 3CMEA 5GAEC 3RR5A 2JYOA 5ELFA 2PNHA 4IUVA 2UUAL 3R93A 4C3HB 4X62Q 4X64Q 1E2ZA 4JI6L 1YJNA 1N9WA 4LUZA 3MXUA 1CQVA 5LMNL 2A68D 4LFCQ 5BR8Q 3I4NG 1EOVA 3NELA 1ENCA 1DOLA 3FEWX 4HIOA 1LABA 2BE5D 4C3HH 2L5TA 4O42A 2IX0A 3HOYG 3J7AV 5JJLA 5C6AA 1D5XC 3KUPA 1OXSC 3CPWA 4DV1Q 1KABA 1CSQA 4IPDA 3NQTA 2RKSA 3NQIA 2EOTA 4CJ0B 1VQ9A 4A3EG 4JBMA 2B8GA 4OWWB 4Z9CB 3DWAA 2WB1G 2UXDQ 3DMUA 1H9RA 3HGBA 5EQ0A 3F2BA 1HA6A 2EJGC 1LTTD 2ZTEA 4AH6A 4JCVE 4UP7A 2XRQD 1FD7D 3IL8A 4C3IB 3H91A 3K5OA 2F0OA 2CQAA 3J81j 5C0XJ 1H9KA 1EY0A 1NBWA 4O1NA 3HOVG 1HCZA 2F0KA 1K28A 1STGA 1BR9A 2Z6KA 1Z47A 1RIPA 1Z6HA 1SNPA 2L4NA 4J15A 1IZ6A 5E4XA 4C3IH 4A3CG 3PGZA 3H94A 4DV6L 5IYDH 2AUKA 5I9PA 2F0NA 5IYCH 4RCNA 1D7QA 4NP5A 4CHTB 4ABNA 1CT1D 3OWFA 2JXMB 1VQCA 4FO2A 5ELNA 4LFAQ 3R2TA 1VQOA 5D3DA 1BF4A 1ZKOA 4ULLA 4OXPA 4JI8L 3TDQA 4YCVA 2UUCQ 4TSSA 2HHHQ 3EA6A 4Y7NH 4DR6L 2AQ1B 3K5LA 2B2VC 4CDDC 1DZ1A 1G2TA 1VQIA 2NB0A 2Z4IA 3E5SA 4CJ1B 3CC2A 5K36G 4KK7A 5KEEA 1IBLQ 2KJXA 1NY4A 4DPGA 3CP0A 4DK6C 1XMOQ 5M5YB 3Q22A 3L0OA 2JA8G 4QIWB 3DM1A 1IBMQ 2NTSA 4MTKA 1OXVA 1OXUA 1X32A 2ZTCA 2WAQG 1N36L 5M5YH 3GTLB 5IT9c 3NK9A 1FNWA 1N8RC 3PV0A 1EWCA 4BXXH 3TMEA 1HR0W 2NN6H 2A6HD 2MFIA 4EVOA 1QILA 1MBYA 3GTLH 2K5NA 1WTWA 4DN4M 3KYHC 1HNZQ 2JK8A 1GUWA 1WTPA 1W6KA 1UE6A 5A35A 5EBDA 5IGEA 3S14B 4KN7C 2NVTB 2QDLA 1OXTA 1VDZA 3HKSA 1K0SA 1HA5A 2G9HD 2V1CC 4DR4L 3CKIB 1PYBA 2X6GA 3F2CA 2F03A 3S14H 4ZQ3A 1VQ7A 4GN3B 2YTXA 2JA6G 4K0KQ 2F0SA 3VYUA 4YWKA 3MXGA 2NVTH 4V0BA 1G6ZA 2KCMA 5IWAQ 3RLFA 4BBRG 2YYZA 1X3FA 2AQ3B 3TREA 3CMAA 1JT8A 5EKKA 4IN3A 5E7NA 4A3GG 2EYFA 4L5TA 2CW0D 2IHFA 1WTXA 1O7IA 1Y69U 3J80E 3J81i 2DNEA 2C5CA 3JAML 4DR7Q 5A2QL 4FVMA 3R8BA 1XPUA 3G6EA 5AJ3Q 3ND8A 5IYBH 3HOZG 3A54A 2EYMA 5JVH3 4IPHA 5IY0A 4M8AA 2KCTA 3U4VA 2DJGC 4U673 1HNXQ 1ZYRC 1LUZA 1VF7A 1EIYB 1X6OA 2NVXB 5GROA 1V8QA 2ZJQA 2UXCL 1X3QA 4DUYL 4M1UB 1XNQL 1B8AA 3H09A 1T9HA 1YNJC 3IFTA 4XQNA 3AQQA 2MUYA 1ESFA 3W1GA 2NVXH 1MJEA 1L0XB 1KIXA 3S1RB 1WTVA 1QZHA 4HR7B 1QB5D 2HD3A 4NXMQ 4FXDA 1VQBA 1ILQA 3S1RH 3S24A 1SYCA 1N33Q 1EOTA 2NYZD 3T4AC 4A3DH 3TEHB 1EIFA 1PH2A 1LTSD 2CVRA 3GQBA 4H44C 3D4DA 3TN2A 3GDEA 2B2YA 3I4OA 1O7YA 1IXRA 1WCMG 1Y8OB 2EPBA 3QJYA 4R4QA 5DEHA 1PRTD 4JI3L 4I7ZC 4JI7L 1S5BD 5GAHC 2F3VA 2R93H 3TP7A 1SNQA 3DUZA 4P71A 5C44B 1GUOA 1STEA 5FJ8G 3CC7A 4DR3Q 4PMBA 4KLKA 3BDOA 3OYYA 1IKMA 2XN9C 2Z6BA 5JJZA 3PUYA 5C3WA 2VQFL 4J8QA 2K50A 5DNFA 5BN4A 5KYIA 4B9WA 1YBYA 1JWSD 2RSNA 3K0YA 3MFGA 5C44H 4HJAA 5JEAJ 2RF4A 3RZOB 5FLXL 1JC7A 1STYA 4J1MA 1HZAA 1B9NA 5COYA 3KLWA 4HMIA 4LNQA 1SE8A 1SE2A 1BNZA 3LNNA 4UY8C 1Q46A 1EYGA 3VR3A 3RZOH 5D14A 3S15B 4DKAC 4GNXA 3FKIB 1BVSA 2BDOA 4JC0A 2AQ2B 3VYRA 1A2UA 2JSOA 2F0QA 1O78A 3S15H 1JOQA 1B3AA 4QQBX 2KEDA 1TT2A 4KHPQ 5C5MA 3FKIH 1S5DD 1KTKA 2R7ZG 4IFDJ 4GNXB 4Q0FA 3BG3A 2LSSA 1HH2P 2B2WC 2DUDA 4R4OA 4BBSB 1D5MC 4X3SA 3A8IE 1J9OA 5CV9A 2F0IA 5M3MB 4ZKBB 1E7ZA 3MHBA 3MXNA 5M3FB 2OTLA 1DXMA 1LTBD 3T53B 1I4XA 1MJCA 1F2ZA 1HQMC 2K32A 2NZ1D 2F0PA 3J7ZC 2PMZB 1FNUA 4FXGC 5FLXc 1KRTA 1ICWA 4BBSH 4XTCS 2SDFA 4A75A 4YY3Q 3SK4A 5M3MH 5I9OA 1ASZA 5M3FH 1C9OA 3UI2A 4RKBA 2PYKA 3MXNB 1BXTA 3A0JA 2VB3X 5C4HA 1N32L 1KD1C 2WP8J 1EU3A 4JI0Q 5M5WB 1P8LA 1UEAB 5ELCA 2JA5G 1EY7A 4JOIC 3K7UC 3Q0AA 1VF5C 1AN8A 1HTLD 1D5ZC 2BH2A 3BYTB 1PRTB 5M5WH 1JB3A 1STBA 1U4RA 3FVQA 4KJOA 4KKSA 4RCOA 5CMDA 1DONA 1BCPC 1NMFA 4RGMA 3MA2B 2LY7A 4KY7A 3Q24A 4A3MB 2R3ZA 4A3FG 1BBWA 3RLOA 3VA7A 2ENBA 1SN8A 1MKHA 3OPOA 1L1OA 4FDBA 1BCPF 5IOCA 4A3MH 1Y1VG 3M4YA 4JBJA 2RDGA 1CUKA 3S17H 1V43A 1STHA 2UUBQ 5D3IB 2I46A 2VXWA 3RD4A 2CWAA 3NPPA 1OTCA 4DAYA 2BA1A 2FMCA 2J7ZA 1L1OB 3KLSA 4X66Q 1JWUD 2UU9L 4LF5Q 1TVXA 1YEZA 3N52A 4RHSA 4OWTB 2CKZB 4HTHA 1XTCD 3BZKA 2DGYA 2WACA 3KK7A 1EY4A 4HN7A 1KDAA 4B3SL 2BOSA 1M8AA 2L0CA 4UP8A 1JJCB 1ONLA 2A6ED 1FR3A 1VQMA 4BY7B 2EJFC 3CU7A 3ERSX 3GD7A 2DJFC 1IYUA 1EUJA 2F4IA 2ZTDA 4RG1A 2E5LQ 5CR3A 4LWCA 4MN3A 3DLLA 1HZBA 1YIJA 2OXPA 1WD0A 1X3EA 3M4OB 2Q2HA 4C1NI 4YWLA 2ES2A 1XNRL 4GOPA 2AWOA 1XYIA 4GKKL 1CA6A 2PQAA 2EXDA 4HSPA 4XXEA 1CSPA 2XVSA 1O80A 4HCSA 5CORA 5K5PA 1PH3A 1N34Q 1MIUA 2LMCB 4PZ6A 2VS1A 3WOFA 1YNNC 1E2VA 3G48A 3HP3A 3GTGH 1S3OA 3GV6A 3U4ZA 4GOPB 4EQPA 4GLVB 2PQAB 3BVGA 1NCVA 2R92G 1U4LA 2B2UA 4LFBL 4B9XA 2ZM6Q 2ZXPA 4L5SA 4CKCA 4I7AA 4JBKA 3PSIA 1O7LA 1PFMA 1PFNA 1AZQA 1MSGA 5IGDA 1PTOC 1G8ZD 1TS4A 3I7FA 1PVOA 2FJ2A 5JOBA 3H0GH 1FVIA 4BWGB 1XPRA 4PMWA 4DV2Q 4OIJA 5FK9C 2ICEC 4GKJL 4WJWA 1CI3M 4N9TA 3F8TA 1PH1A 4P73A 4BXXG 2SEBD 2EY2A 1VQ5A 1CFMA 2NN6I 5IP9H 1PTOF 4K8JA 2KHIA 1VQNA 2E75C 4NXNQ 2RVLA 3GTJB 2P5ZX 2VUMG 4X62L 3NWTA 3OMCA 2V4DA 3G6JB 1PLFA 3RN5A 1D8LA 1EY6A 5EKIA 4IQZA 3NBIA 1GKHA 4A93B 1CA5A 5BR8L 2K5QA 5EPLA 3GTJH 1E24A 2HQEA 2R7DA 4DGZA 1ZXTA 3K0XA 1VQDA 2BA0A 2VZAA 5M9OA 4OO1G 3HKZE 1AE2A 4A93H 4HIKA 2HDMA 4B08A 2IPKD 1BKBA 3OSOA 1EZ8A 1WTOA 2F3IA 3UDFA 4IUTA 2JA7G 3TS0A 1C7YA 1I4PA 1IYJB 2L11A 3K5MA 1GUGA 3T56B 2ZJPA 3CF5A 3TP8A 5AFWA 4IPGA 1LTGD 1YHQA 2I5HA 1TWGB 5ELOA 2F0VA 4FF3A 2B2TA 3GTKB 4LF6Q 2WIIB 2BDNA 4XYOA 3J80c 3OMGA 1EQVA 3K80C 5J39A 4DFAA 4LK1C 4DV5Q 1W2BA 3SHLA 3T13A 1JJ2A 3PIPA 4L6TB 3CCVA 3SK6A 4DAPA 1TWGH 2L55A 4APVA 3NSWA 2A73B 1QVFA 4QJFA 3GTKH 1LTID 3PIO3 4KI0A 2K5WA 3NXWA 1D1KA 3BVZA 1C0AA 5ISRA 4YWMA 4DA2A 4OX9Q 4CKEA 3JAMi 1WTQA 1K83B 1EYAA 1XTDA 1NSNS 3SEBA 5JAVA 4LFAL 4LF9Q 4DR1Q 3F2UA 3RMHA 1I94Q 4XDXA 4XIGS 4OGQC 1D6EC 1I50B 4IZ8A 4BA1I 2LKVA 3AYHB 2AKWB 1UNSA 1NR4A 1S40A 5IP7G 1U9RA 1K83H 3A55A 1TXYA 4J6HA 1PHJA 4FF2A 3RN2A 2A69C 4DNRB 3PO3B 2EJMA 1QCBD 2L9HA 3HOUB 5E1FA 5C3EG 1GUNA 1I50H 2ZJRA 4G7HC 2CWPA 1AH9A 3LX0A 4MIUA 3N6RA 3T1HQ 1XJVA 3BZCA 3Q23A 3S1QB 3P20A 4A3DG 3J81E 1UUPA 3PO3H 3HKZG 1Y1WB 3HOUH 1U0LA 1W6JA 5CGKA 1A0IA 1IBLL 1V1QA 5C5LA 1ASYA 2D2CC 3T1YQ 4AYBB 1IBML 1EWIA 2EY1A 2F0EA 3E3XA 3QG1A 4ILWA 1W3SA 3P1HA 1O7ZA 5KNBA 2OCEA 1Y1WH 5IT9L 1BBXC 1PZKD 3ND9A 5IGGA 2XTIA 1HUMA 4OEMB 2A5HA 2R93G 4UHVA 2K4KA 5DAUA 2IWHA 3VR2A 2MNAA 2VY3A 4A76A 2KHSA 4B3RQ 1H9JA 4A3JG 1I5FA 2F4VQ 2PO4A 1K8MA 2ALYB 4G57A 4ZLTF 3CCMA 5LMNQ 3W2DA 2WKDA 2PNRC 1FNVA 3S2DB 2Z6KC 1HNZL 1XX8A 2D0PA 2OF1A 2H1EA 4ZCKA 5CV4A 5ELEA 1LT5D 1RODA 4IJHA 1X56A 4AIMA 3FPPA 3A56A 1TWHB 1ZYRD 3S2DH 1KAAA 4KTAA 2WINB 2NUCA 1GM5A 4N8FA 2RHSB 4IOAA 2OQ0A 4KY5A 4A3KB 3I56A 3QIAA 4K0KL 3PUVA 1VQAA 3OWEB 5CV6A 1K8OA 3MVVA 4K2KA 4ME5A 5IWAL 1SMYC 1YNJD 2K5VA 1RKNA 1VQEA 2N8NA 2O5JC 3SE0A 1DJRD 4A3KH 2I5LX 2EQSA 3OIPA 5C4ZA 1X54A 1AFPA 4JK1C 5I2XA 4R4CA 4JYAQ 3NWSA 2K52A 4DR7L 1LT6D 1EU4A 4QUCA 4LF4L 1GHJA 2G9DA 5FKAC 2MQHA 2G5DA 3K8AA 5AJ3L 4QGUA 3I90A 1HNXL 5ELBA 5M5XB 3EVQA 3CCUA 4KKUA 3URYA 2ATWA 3NP8A 4OL7A 4HSVA 1EQRA 2DY8A 2B8FA 4C3JB 3V05A 3PO2G 4PV1C 4RMFA 1AP0A 2Q2UA 4CGYB 5M5XH 3DEOA 2BCOA 4IFDH 4POFA 4ZYSA 3ERQA 1VQGA 1EEFD 1M4VA 1KHIA 3M9BA 4F87A 2F1MA 2B39A 4C3JH 4AQYQ 4LF8Q 1TR5A 3UDGA 4V190 4ZAIA 3D4WA 4QF4A 1VMCA 1PXUA 4LJZC 2AUJD 5J3BA 4IJLA 4A3BB 3C1FA 4RAUC 4HMJA 2GVAA 5D65A 2JA9A 4QL5A 3LGJA 4FYDA 1Q12A 1GUTA 3DEPA 1KAWA 2DN8A 4A3IB 4A3BH 4POGA 2PQEA 1XMQQ 4BS9A 1AE3A 3OOCA 1EIHA 2PPBC 4K6DA 4A3IH 4L8JA 1WFQA 4X6AH 1G51A 5EPJA 3NE5B 3RZDB 3NENA 3I4NB 3CRLC 2QF7A 4IO9A 3TRZA 4KMUC 1F2YA 5LL6X 4DR3L 3U9OA 2HCCA 2Y0SE 3E9IA 3PQIA 4A3LH 3D8GA 2B3GA 3RZDH 3QR8A 2L1BA 2XNAC 2VW9A 3I4NH 5BN5A 1KDBA 1LTLA 2VQEQ 1SRUA 4NB3A 4GZYC 1SNMA 4A3EB 3CRKC 2NZHA 3H3VH 4DR4Q 2WB1B 1F2LA 4ALPA 4DU9A 1GUSA 2L12A 3CC4A 2RDHA 5E3FA 1WJJA 2KEEA 2JN4A 1JCKB 5IE8A 4A3EH 3SGIA 1LT3D 1NJIC 2PW7A 4FF4A 4MZ9A 1KLUD 3HOVB 2D5DA 4RKLA 3K59A 2HT1A 2IX3A 4R8NA 1CHQD 1Z7TA 1NE3A 4WORA 1K0RA 5IODA 4HJ7A 4HJ5A 2VB2X 4TQUS 3K58A 3K57A 4KHPL 3A7AB 4BY1B 3HOVH 2EZVA 1PZID 3VYTA 2N49A 3I8ZA 3TZDA 1GHKA 1FJGL 4DV4Q 1QE6A 4A3CH 1BCPD 2K28A 1PZJD 4DR5L 4JI5Q 4BY1H 5C4JB 3HG9A 1EY9A 2D0OA 5T1GA 1S5CD 3UDIA 3CW2C 4P2CB 1KNAA 2EIFA 4PZ8A 3PCOB 4DUZL 1SYBA 1EL0A 3IAYA 2IT1A 2Q8RE 2JEAI 2SOBA 3ZYYX 5JJIA 1XNQQ 3AFQA 1KNEA 2Z8LA 1LTAD 3HOWG 2Z0SA 3H0GG 2XRSD 3VR4A 2K6AA 3R2IA 5FLMG 3BU2A 4JI0L 1B9MA 5GAGC 1HQRD 3D6WA 2Y0SG 2E2HB 1A63A 1I4RA 2JA8B 5FO7B 2B2WA 3KDFA 4KHVA 3C46A 1CTMA 1DCZA 2KHJA 2E2HH 5K36H 5C4XB 2WAQB 2NVQB 1VQFA 2RA4A 2JA8H 2K5DA 4B3ML 1HR0Q 3NTIA 2B63G 1QVGA 1QZGA 3KDFB 4RGOS 5C4XH 1TS3A 1SNCA 2OWOA 4GNXC 1SMXA 4A93G 4UDUC 1Q81C 2KVMA 2NWGA 4IUNA 4JOIA 2EYPA 1WVLA 2K7VA 2A19A 1JOOA 1KXLA 3ICEA 3CCEA 3CQZB 1Q1EA 1BDOA 1PFBA 5KRUA 4O0AA 4AYBE 5DM73 2M2LA 4X66L 3B6YA 2KQ3A 1YNND 1S4ZA 4LF5L 4OELB 3HOXG 1EYDA 3NHHA 3G4SA 1B70B 1YJ9A 3J7YW 1STNA 4H7BA 4X3KA 4BBRB 5I4DA 1SYDA 1WI5A 2KENA 5TSSA 1MHWC 4C56C 1H95A 4ODGA 5I6YA 2MP1A 4YHHQ 1B53A 1ILPA 3KF8A 4A3GB 1C4QA 1ICFB 5CYUA 5CV5A 2VNUD 1PTOD 3DWQA 4C1NK 4XQJA 2KOLA 1ET9A 1QJOA 1UEBA 4BBRH 4C3HG 2OTJA 1II3A 4DK1A 1CZWA 1Q8KA 1KDCA 1WD1A 2QA4A 1ML0D 2AWNA 4A3GH 4DV7L 3KBXA 3KF8B 3BDCA 1Y14B 3HOZB 1GD7A 2DNCA 1EEID 1OO9B 3FPUB 3S16B 4B3TQ 3KJOA 3KLRA 4DR2Q 1X9NA 2C35B 4EGVA 1Q86C 2OT2A 1PFSA 3QOJA 1N34L 3I72A 3HOZH 4QIWE 5IGFA 1VQJA 4KD4A 3S16H 1UE1A 3KLSX 1HFNA 5L37A 4PG3A 3VDYA 4KD3A 3Q6SA 5ELDA 1JQYD 2D9UA 3L2PA 1JMCA 2ZM6L 1J6QA 3O13A 1F9SA 4ID6A 2JP1A 3KOJA 1IBKQ 1J5EQ 4C3IG 4QCLA 5KNCA 5JJKA 3J81c 3PMFA 1N32Q 1ET6A 2UXBQ 1L1OC 5HURA 3ULLA 3EBEA 4CDCC 5IYDG 2AHOB 3GP7A 1PMRA 1A15A 3BS1A
chains in the Genus database with same CATH topology
5LL6S 4KY6A 1SAPA 1QWYA 2M00A 2FHTA 2HUGA 2O4XA 3JAME 3DWPA 1JR0D 5A2QE 5C0XH 4RA8A 2NBFA 1AEXA 1WCMB 2F0TA 3PUZA 3M7NA 1QG7A 1I3QB 2RDFA 1D2BA 1CHPD 2F0UA 5KIXA 1H9MA 1NAPA 4FP5D 3I91A 4TRDA 1RHPA 1WTRA 2EY6A 1MSHA 4KKTA 2JE6I 1BOSA 4IUUA 1CK1A 1Q90A 2F3WA 2RBMA 2X69A 3PUWA 2FINB 1TS5A 3C1EA 3OIQA 3T51B 1MD2D 2A69D 3C3LA 1TS2A 2O5IC 2EDGA 3MAQA 2NN6G 3D6CA 2CHBD 5J22A 3A8KE 1LT4D 2EE1A 4FXKC 2B2UC 4X3TA 3J80L 2K33A 2K01A 2H4OA 1IKLA 2C9OA 3QOLA 1NR2A 3S9WA 1F9QA 5KYLA 2R7ZB 1F2MA 4UAIA 5IGCA 5CBEE 4IFDI 3X3NA 4F7XA 1PDQA 4C3JG 3K7AB 3GTMB 4RFBA 5FLXE 3G7LA 4DF7A 1LTRD 2E2JB 4H0LC 1FYCA 4NDXA 2F0FA 1SJED 1HTPA 2JA5B 3L9AX 1ZEQX 1ENFA 1RDPD 2XIWA 3AMUA 3GO5A 5T1IA 1I6HB 4G4KA 3VR6A 3DXJC 4HAEA 4QB4A 3GTQB 4TKOB 4CJ2C 1SMYD 1Q1BA 1BO0A 2QCPX 1G91A 1XXGA 3ITPA 4RHRA 1JOKA 4L63B 2Q8TA 3TSSA 3L3OC 4A3FB 1G2SA 5EGTA 3HEJA 4KJNA 3D3RA 2B2TC 5IIFA 2K05A 1Y1VB 3E0JA 4I65A 1JICA 4DK0A 3I4LA 1HXYD 1F9RA 2I07B 3L7ZC 1JWMD 1LO5D 1CZGA 3I70A 1S5ED 5DM63 5F2DA 4QMGA 3S2HB 4H13C 5KNDA 2K03A 3AB9A 2ZXOA 1V1OA 3RUZA 1OXXK 1EY5A 2SNSA 4R8IA 1GJXA 2A74C 4MHEA 1GOZA 2PZTA 2K04A 1E0BA 5G3LF 4PQXA 3GTOB 4YIJA 4NW2A 5I2YA 1T5EA 1VCIA 3H6MA 3S1MB 4ZK9B 1IW7D 1HUNA 2B2VA 3M7GA 3D31A 3S1NB 4HEDA 1AW7A 1SEBD 4Q5VA 2ZXRA 2XSCA 1XWEA 2KECA 4DAVA 4Y7NB 3SDZA 4RGTA 5FO9B 3V2TA 2R92B 1DYQA 5JPMC 1JORA 3VR5A 2F0WA 3QB3A 3WDNA 1EIGA 1A3TA 3DHQA 1PYWD 2PW5A 2F0JA 5JEAH 5CBAE 5C3XA 2YU9B 2TSSA 1D1IA 2A68C 3MFYA 1R9TB 3EQLC 3TZUA 2SNMA 3NBHA 2QEJC 1UAPA 2BE5C 3WOEA 4E6IA 2ZT9C 2IJ0A 1MI2A 1EYCA 1A2TA 1T5XD 1SYFA 5NUCA 3T16A 2VUMB 1B1ZA 4PNYA 1EZ6A 1KLGD 1E2WA 1FGBD 1B50A 3I4MB 3MXPA 4EQNA 1RD9D 4ZKCB 1Y8NB 5IGBA 1SFOB 4FNFA 3C2PA 4F88A 4OO1H 1HRJA 2EYHA 2JA7B 1TWAB 1IW7C 2O2LD 2LS01 5EKLA 4G7OC 3M3YB 1R4QB 4K5WA 1RTNA 1CM9A 2LFNA 4ZRZA 4IALA 1QNUA 1HPCA 3EROA 2D62A 5HGTA 4IURA 1SYEA 2EYOA 4KN4C 3HOYB 5CV8A 3QWNA 3BZDB 1SE4A 1EWHA 1BQQT 4IUPA 4N9PA 3A8JE 1F77A 5BN3A 1IL8A 2Z1CA 3R3OA 4DXFA 4PMCA 1GXDC 3BDLA 4RH6A 3H3VC 2HDLA 1SXTA 1SJHD 4K5VA 5FO8B 4XYQA 5C3EB 1LACA 2IL8A 4LAAA 4WRDA 4A3DB 1STAA 2F0HA 3HKZB 3U9SA 1RF2D 2A6HC 3SK5A 3P7JA 2OEOA 1X3PA 3OW7A 3OHXC 5C0XG 5C0XI 3I73A 2R6GA 3MEHA 1AZPA 3TBIB 1NUCA 3NUCA 2EYLA 4K6LA 2F0LA 3BVMA 3HRZC 2F0MA 5J1ZA 2IX1A 2R93B 3TP5A 4A3JB 4C2MB 4KV6A 2ICIA 5EPKA 1I4GA 3I3CA 2B2YC 3BYYB 2EY5A 1B2TA 1CQFA 1MGSA 4WFN3 1A3UA 2FFKB 3GV3A 2CW0C 2JEBI 3P75A 2MHVA 3HZXA 3KBGA 3M85A 3HS0C 1B4OA 2EYJA 2EXZA 4JBWA 1SE3A 1RJTA 5CC4A 3MTSA 2QILA 2E76C 4IUQA 3QO2A 1SNDA 5IT9E 4XT3B 4RWSC 3D4RA 5JVG3 2K1BA 2M9VA 1HFGA 1EQTA 5LHY1 2MPMA 1EFID 5EJWA 1I4HA 1A3VA 3NTKA 1LV9A 2PZWA 1G291 3GTPB 3PO2B 2KCNA 4NKLA 2JA6B 4RGNA 1Q3LA 3SK8A 3LWEA 2E2IB 3J81L 3V96A 1BUVT 2EVBA 1C48A 1LLRD 1BCPB 3X3MA 2QDBA 1PRTC 1VMPA 4K2LA 1RCVD 1TWFB 1EY8A 2WKCA 4K8IA 1TIID 4F8MA 1B44D 2WV6D 5E4WC 1I4QA 3ONAB 5I6WA 4BA2I 2RQXA 1L0YB 1SNOA 4OHJA 1SBBB 5KGUA 4XT1B 1PRTF 2KCCA 3AU7A 2FMMA 1RTOA 5FOBB 3S17B 2Q8IB 4X3UA 1IHZA 4HCEA 3MZ5A 5CV7A 1S5FD 3FRPB 1ESRA 2NVYB 3MWYW 4FF1A 2R61A 4G7ZC 3PUXA 2ID0A 4U68A 1TU2B 1DM0B 3PIP3 3A7LA 1DOMA 2IW3A 4ZUJA 2PZUA 4LMQD 2MGSA 1V1PA 1Q8IA 2MJ8A 2QKIC 1F9PA 4KHZA 4EQOA 3J7AF 4K14A 2F0GA 1IYVA 2KA7A 4OIKA 1TKWB 1I6VC 4S3SA 3LWUA 4CBVA 2RSOA 1V1PB 2XWBB 3GTGB 2NTTA 2GA4B 4XQQA 1A6XA 1R4PB 2TMPA 1QNKA 1HHVA 1PTOB 2Z4HA 3HOWB 1SYGA 3E6ZX 5JEAG 3H0GB 1PTOH 3SXHA 1TQOA 2DY7A 4NMZA 2Y0SB 4QUFA 1Y8PB 5G3LD 1JE4A 2J4XA 4R9WA 3NTHA 1J8IA 1TWCB 1ENAA 1SDFA 4K5XA 2HCIA 3K5NA 5EBCA 3CHBD 2J0TD 4IFDG 5JPNC 3MC0B 4DNTB 2B63B 1SSOA 2E74C 2N55A 3IKJA 1U4MA 1DD2A 1TY0A 1QOHA 1U4PA 3VA5A 1DOKA 1H9SA 3FDTA 3TP6A 3IFDA 2KUMA 4DXGA 2A6EC 2X6LA 4OO1I 2F0DA 1TY2A 2XWJB 3FMCA 3EJIA 3EFXD 3K6OA 3W3AA 1H9SB 3HOXB 4CKBA 3VYSA 2E2DC 3SR1A 3SVMA 4ZUIA 1C8CA 2N88A 2PCFB 2JYOA 5ELFA 4IUVA 3R93A 4C3HB 1E2ZA 3MXUA 1CQVA 2A68D 1ENCA 1DOLA 3FEWX 1LABA 2BE5D 2L5TA 4O42A 2IX0A 3J7AV 5C6AA 1D5XC 3KUPA 1OXSC 1KABA 3NQTA 2RKSA 3NQIA 2EOTA 4CJ0B 2B8GA 4Z9CB 3DWAA 3DMUA 1H9RA 3HGBA 5EQ0A 1HA6A 2EJGC 1LTTD 2XRQD 1FD7D 3IL8A 4C3IB 3H91A 3K5OA 2F0OA 2CQAA 5C0XJ 1H9KA 1EY0A 4O1NA 1HCZA 2F0KA 1STGA 1BR9A 1Z47A 1Z6HA 1SNPA 2L4NA 5E4XA 3H94A 2AUKA 5I9PA 2F0NA 4RCNA 4NP5A 4CHTB 4ABNA 1CT1D 3OWFA 2JXMB 4FO2A 3R2TA 5D3DA 1BF4A 1ZKOA 4ULLA 3TDQA 4TSSA 3EA6A 2AQ1B 3K5LA 2B2VC 1DZ1A 1G2TA 2NB0A 4CJ1B 2Z4IA 3E5SA 5K36G 4KK7A 5KEEA 5M5YB 2KJXA 3Q22A 4QIWB 3DM1A 2NTSA 1OXVA 1OXUA 1X32A 3GTLB 3NK9A 1FNWA 3PV0A 1EWCA 3TMEA 2NN6H 2A6HD 4EVOA 1QILA 1MBYA 1WTWA 4DN4M 1GUWA 1WTPA 1W6KA 5A35A 5EBDA 5IGEA 3S14B 4KN7C 2NVTB 1OXTA 1VDZA 1HA5A 2G9HD 3CKIB 2X6GA 2F03A 4ZQ3A 2F0SA 3VYUA 3MXGA 4V0BA 1G6ZA 3RLFA 2YYZA 2AQ3B 5EKKA 4IN3A 2EYFA 2CW0D 1WTXA 1Y69U 3J80E 2DNEA 2C5CA 3JAML 5A2QL 4FVMA 3R8BA 3ND8A 3A54A 2EYMA 5JVH3 4M8AA 4U673 1ZYRC 1VF7A 2NVXB 1V8QA 1X3QA 4M1UB 3H09A 1YNJC 3IFTA 4XQNA 2MUYA 1ESFA 1L0XB 3S1RB 1WTVA 4HR7B 1QB5D 4FXDA 1ILQA 1SYCA 1EOTA 2NYZD 3T4AC 1LTSD 2CVRA 3GQBA 4H44C 3D4DA 3TN2A 2B2YA 1O7YA 1Y8OB 2EPBA 3QJYA 5DEHA 1PRTD 4I7ZC 1S5BD 2F3VA 3TP7A 1SNQA 3DUZA 5C44B 1GUOA 1STEA 4PMBA 3BDOA 1IKMA 2XN9C 5JJZA 3PUYA 5C3WA 4J8QA 5BN4A 5DNFA 5KYIA 4B9WA 1JWSD 2RSNA 3K0YA 3MFGA 5JEAJ 3RZOB 5FLXL 1JC7A 1STYA 4J1MA 1B9NA 5COYA 4HMIA 1SE2A 1BNZA 3LNNA 3VR3A 5D14A 3S15B 3FKIB 2BDOA 2AQ2B 3VYRA 1A2UA 2JSOA 2F0QA 1O78A 1JOQA 1B3AA 2KEDA 1TT2A 5C5MA 1S5DD 1KTKA 4IFDJ 4Q0FA 3BG3A 2B2WC 4BBSB 1D5MC 4X3SA 3A8IE 1J9OA 5CV9A 2F0IA 5M3MB 4ZKBB 3MHBA 3MXNA 5M3FB 1DXMA 1LTBD 3T53B 1I4XA 1F2ZA 1HQMC 2K32A 2NZ1D 2F0PA 2PMZB 1FNUA 4FXGC 1ICWA 4XTCS 2SDFA 3SK4A 5I9OA 3UI2A 4RKBA 2PYKA 1BXTA 2VB3X 5C4HA 2WP8J 1EU3A 5M5WB 1UEAB 5ELCA 1EY7A 3Q0AA 1VF5C 1AN8A 1HTLD 1D5ZC 3BYTB 1PRTB 1JB3A 1STBA 1U4RA 3FVQA 4KJOA 4KKSA 4RCOA 5CMDA 1DONA 1BCPC 4RGMA 3MA2B 2LY7A 4KY7A 3Q24A 4A3MB 2R3ZA 3VA7A 2ENBA 3OPOA 1BCPF 5IOCA 3M4YA 2RDGA 1V43A 1STHA 5D3IB 2I46A 2VXWA 3RD4A 3NPPA 4DAYA 2BA1A 2FMCA 2J7ZA 3KLSA 1JWUD 1TVXA 3N52A 4RHSA 4HTHA 1XTCD 3KK7A 2WACA 1EY4A 4HN7A 1KDAA 2BOSA 1M8AA 2L0CA 1ONLA 2A6ED 1FR3A 4BY7B 2EJFC 3CU7A 3GD7A 1IYUA 2F4IA 5CR3A 4MN3A 2OXPA 1WD0A 3M4OB 4C1NI 2AWOA 1XYIA 1CA6A 4HSPA 4XXEA 2XVSA 1O80A 4HCSA 5CORA 5K5PA 2LMCB 3WOFA 1YNNC 1E2VA 3HP3A 3GV6A 4EQPA 3BVGA 1NCVA 1U4LA 2B2UA 4B9XA 2ZXPA 4CKCA 1O7LA 1PFMA 1PFNA 1AZQA 1MSGA 5IGDA 1PTOC 1G8ZD 1TS4A 2FJ2A 5JOBA 4BWGB 4PMWA 4OIJA 5FK9C 2ICEC 4WJWA 1CI3M 4N9TA 2SEBD 2EY2A 1CFMA 2NN6I 1PTOF 4K8JA 2E75C 2RVLA 3GTJB 3NWTA 3OMCA 2V4DA 3G6JB 1PLFA 1EY6A 5EKIA 4IQZA 3NBIA 4A93B 1CA5A 2K5QA 5EPLA 2HQEA 4DGZA 1ZXTA 2BA0A 5M9OA 4OO1G 2HDMA 4B08A 2IPKD 3OSOA 1EZ8A 1WTOA 4IUTA 1I4PA 2L11A 3K5MA 1GUGA 3T56B 3TP8A 5AFWA 1LTGD 1TWGB 2F0VA 4FF3A 2B2TA 3GTKB 2WIIB 2BDNA 4XYOA 3OMGA 1EQVA 5J39A 4DFAA 4LK1C 3SHLA 3T13A 4L6TB 4DAPA 3SK6A 2L55A 3NSWA 2A73B 1LTID 3PIO3 4KI0A 2K5WA 3NXWA 1D1KA 3BVZA 5ISRA 4DA2A 4CKEA 1WTQA 1K83B 1EYAA 5JAVA 1NSNS 3SEBA 3F2UA 3RMHA 4XDXA 4XIGS 4OGQC 1D6EC 1I50B 4IZ8A 4BA1I 2LKVA 1UNSA 1NR4A 1U9RA 3A55A 4J6HA 4FF2A 2A69C 4DNRB 3PO3B 2EJMA 1QCBD 2L9HA 3HOUB 5E1FA 1GUNA 4G7HC 3LX0A 4MIUA 3N6RA 3Q23A 3S1QB 3P20A 3J81E 1UUPA 1Y1WB 1W6JA 5CGKA 5C5LA 2D2CC 4AYBB 2EY1A 2F0EA 3QG1A 4ILWA 3P1HA 1O7ZA 5KNBA 5IT9L 1BBXC 1PZKD 3ND9A 5IGGA 1HUMA 2A5HA 5DAUA 2IWHA 3VR2A 2KHSA 1H9JA 2PO4A 1K8MA 4G57A 4ZLTF 3W2DA 2WKDA 2PNRC 1FNVA 3S2DB 1XX8A 2OF1A 2H1EA 5CV4A 5ELEA 1LT5D 1RODA 3FPPA 3A56A 1TWHB 1ZYRD 1KAAA 4KTAA 2WINB 2NUCA 4KY5A 4A3KB 3QIAA 3PUVA 3OWEB 5CV6A 1K8OA 3MVVA 4K2KA 4ME5A 1SMYC 1YNJD 1RKNA 2O5JC 3SE0A 1DJRD 3OIPA 5C4ZA 1AFPA 4JK1C 5I2XA 3NWSA 1LT6D 1EU4A 4QUCA 1GHJA 2G9DA 5FKAC 3I90A 5ELBA 5M5XB 3EVQA 4KKUA 3URYA 3NP8A 4OL7A 4HSVA 2DY8A 2B8FA 4C3JB 3V05A 4PV1C 1AP0A 3DEOA 2BCOA 4IFDH 4ZYSA 3ERQA 1EEFD 1M4VA 4F87A 2F1MA 2B39A 1TR5A 4V190 4ZAIA 3D4WA 4QF4A 1VMCA 1PXUA 4LJZC 2AUJD 4A3BB 3C1FA 4RAUC 4HMJA 5D65A 4FYDA 1Q12A 1GUTA 3DEPA 2DN8A 4A3IB 2PQEA 4BS9A 3OOCA 1EIHA 2PPBC 4K6DA 4L8JA 5EPJA 3NE5B 3RZDB 3I4NB 3CRLC 2QF7A 4KMUC 1F2YA 5LL6X 3U9OA 2HCCA 3D8GA 2L1BA 2XNAC 5BN5A 1KDBA 4GZYC 1SNMA 4A3EB 3CRKC 2WB1B 1F2LA 4DU9A 1GUSA 2L12A 2RDHA 5E3FA 2KEEA 1JCKB 1LT3D 2PW7A 4FF4A 1KLUD 3HOVB 2D5DA 4RKLA 3K59A 2IX3A 4R8NA 1CHQD 1Z7TA 4WORA 5IODA 2VB2X 4TQUS 3K58A 3K57A 3A7AB 4BY1B 2EZVA 1PZID 3VYTA 3I8ZA 3TZDA 1GHKA 1QE6A 1BCPD 2K28A 1PZJD 5C4JB 3HG9A 1EY9A 5T1GA 1S5CD 4P2CB 1KNAA 1SYBA 1EL0A 3IAYA 2IT1A 2Q8RE 2JEAI 2SOBA 3ZYYX 1KNEA 2Z8LA 1LTAD 2XRSD 3VR4A 2K6AA 3R2IA 1B9MA 1HQRD 3D6WA 2E2HB 1I4RA 2JA8B 5FO7B 2B2WA 4KHVA 3C46A 1CTMA 1DCZA 5K36H 5C4XB 2WAQB 2NVQB 2RA4A 2K5DA 3NTIA 4RGOS 1TS3A 1SNCA 4UDUC 2KVMA 2NWGA 4IUNA 2EYPA 1WVLA 2K7VA 1JOOA 3CQZB 1Q1EA 1BDOA 1PFBA 5KRUA 5DM73 2M2LA 2KQ3A 1YNND 1S4ZA 1EYDA 3NHHA 3J7YW 1STNA 4H7BA 4X3KA 4BBRB 5I4DA 1SYDA 5TSSA 4C56C 4ODGA 5I6YA 2MP1A 1PMRA 1B53A 1ILPA 3KF8A 4A3GB 1C4QA 5CYUA 5CV5A 2VNUD 1PTOD 3DWQA 4C1NK 4XQJA 2KOLA 1ET9A 1QJOA 4C3HG 1II3A 4DK1A 1CZWA 1KDCA 1WD1A 1ML0D 2AWNA 3KBXA 3BDCA 3HOZB 2DNCA 1EEID 1OO9B 3FPUB 3S16B 3KLRA 4EGVA 2OT2A 3QOJA 3I72A 5IGFA 4KD4A 3KLSX 1HFNA 4KD3A 3Q6SA 5ELDA 1JQYD 2D9UA 3O13A 1F9SA 4ID6A 2JP1A 4C3IG 4QCLA 5KNCA 3PMFA 1ET6A 5HURA 3GP7A 4CGYB 1A15A 3BS1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EY7 A;  1RKN A;  3P75 A;  3D8G A;  5IGE A;  4EQP A;  3HZX A;  4DF7 A;  4KY6 A;  4K5W A;  1KDB A;  1SNC A;  2M00 A;  3NXW A;  4IAL A;  1ENA A;  2EYJ A;  1IHZ A;  2EXZ A;  1SNM A;  2O4X A;  4K5X A;  2F0O A;  4NDX A;  5DEH A;  4B9X A;  5C4Z A;  5ISR A;  3MZ5 A;  1EY0 A;  3ERO A;  5CV7 A;  1EYA A;  2F0F A;  1NSN S;  5JAV A;  2F0K A;  1STB A;  1STG A;  2F3V A;  4DU9 A;  5CC4 A;  4KJO A;  4IUN A;  4ZQ3 A;  3TP7 A;  1SNP A;  1SNQ A;  5E3F A;  5HGT A;  2EYP A;  5IGD A;  1SYE A;  2EYO A;  4IZ8 A;  1AEX A;  2F0S A;  2LKV A;  4PMB A;  4DGZ A;  2F0T A;  3V2T A;  4KY7 A;  1JOO A;  1SND A;  2PW7 A;  5IGG A;  1U9R A;  5CV8 A;  5C3W A;  1JOR A;  4J6H A;  5JOB A;  5KYI A;  2F0W A;  5I9P A;  5KRU A;  2F0N A;  4B9W A;  3QB3 A;  5EKK A;  4RKL A;  4N9P A;  3VA5 A;  4QB4 A;  5E1F A;  2RDF A;  4N9T A;  2EYF A;  2KQ3 A;  3EVQ A;  4R8N A;  1A3T A;  2F0U A;  2ENB A;  4NP5 A;  1STY A;  4J1M A;  3DHQ A;  5KIX A;  1EYD A;  3NHH A;  3R3O A;  2PW5 A;  3LX0 A;  4ME5 A;  4MIU A;  4WOR A;  4PMC A;  3NP8 A;  4OL7 A;  3TP6 A;  5IOD A;  2EY2 A;  2F0J A;  4HMI A;  3OWF A;  5IOC A;  3BDL A;  4ZUJ A;  1STN A;  2PZU A;  4H7B A;  4K8J A;  5C3X A;  3ITP A;  2F0D A;  1JOK A;  1SYD A;  4K5V A;  3EJI A;  4ODG A;  5CGK A;  5I6Y A;  5EGT A;  1STH A;  3HEJ A;  4TRD A;  5C5L A;  2SNM A;  3ERQ A;  4KJN A;  3OMC A;  2EY6 A;  4E6I A;  2EYM A;  1A3V A;  2EY1 A;  1EY6 A;  5CV5 A;  2F3W A;  2F0E A;  2RBM A;  4EQO A;  5IIF A;  3P1H A;  4LAA A;  2PZW A;  1TR5 A;  1EY9 A;  4WRD A;  1II3 A;  2F0G A;  4K14 A;  1STA A;  2F0H A;  3D4W A;  1EYC A;  1KDC A;  1A2U A;  1A2T A;  2HQE A;  4QF4 A;  1SYF A;  4I65 A;  2F0Q A;  3C1E A;  4HTH A;  4NKL A;  4S3S A;  5NUC A;  3SR1 A;  3T16 A;  2WAC A;  4ZUI A;  3SK5 A;  2OEO A;  1SYB A;  5M9O A;  3BDC A;  1TT2 A;  5C5M A;  3SK8 A;  3C1F A;  1EY4 A;  5DAU A;  2SOB A;  3E5S A;  3MEH A;  3D6C A;  2KHS A;  1KDA A;  4HMJ A;  3RUZ A;  5J22 A;  4PNY A;  5KEE A;  1JOQ A;  1EZ6 A;  4G57 A;  1NUC A;  3NUC A;  3OSO A;  2EYL A;  1EZ8 A;  3QOJ A;  2F0L A;  5F2D A;  4QMG A;  3QOL A;  3S9W A;  2F0M A;  5J1Z A;  5CV9 A;  5IGF A;  3MXP A;  2OF1 A;  2F0I A;  2PQE A;  2QDB A;  3MHB A;  1ENC A;  4KD4 A;  5CV4 A;  4EQN A;  5KYL A;  5CR3 A;  4K2L A;  3TP5 A;  3NK9 A;  1F2Z A;  1SYG A;  2OXP A;  1EY5 A;  1EY8 A;  2F0P A;  1F2M A;  2SNS A;  4KD3 A;  4K8I A;  4KV6 A;  3TP8 A;  5C6A A;  5IGB A;  4K6D A;  1KAB A;  4F8M A;  1KAA A;  3NQT A;  2RKS A;  4KTA A;  2NUC A;  3SK4 A;  2PZT A;  4KHV A;  3TME A;  3SXH A;  5I6W A;  4KY5 A;  1SYC A;  2F0V A;  4ID6 A;  5I9O A;  5IGC A;  2EYH A;  1TQO A;  2EY5 A;  4EVO A;  4YIJ A;  4NMZ A;  4RKB A;  3PMF A;  2PYK A;  3OMG A;  1EQV A;  5K5P A;  5J39 A;  4DFA A;  5HUR A;  1SNO A;  3SHL A;  3T13 A;  3H6M A;  1F2Y A;  4F7X A;  1A3U A;  3DMU A;  5C4H A;  5KGU A;  5CV6 A;  3U9O A;  3MVV A;  4K2K A;  5EKL A;  3SK6 A;  3D4D A; 
#chains in the Genus database with same CATH topology
 5LL6 S;  5IYC G;  4JI2 Q;  3OTO Q;  4KY6 A;  1SAP A;  1QWY A;  2M00 A;  2HIX A;  2FHT A;  2HUG A;  2O4X A;  4BY7 H;  3JAM E;  4HJ8 A;  3DWP A;  1JR0 D;  2CH4 A;  5A2Q E;  1Z9F A;  2JJQ A;  5C0X H;  1KC8 C;  4RA8 A;  2NBF A;  3CCL A;  4NXN L;  1HNW L;  1AEX A;  1WCM B;  2F0T A;  3M4O H;  3PUZ A;  1JB7 A;  1HZC A;  3M7N A;  1QG7 A;  2LXJ A;  1I3Q B;  2RDF A;  3UDX A;  1D2B A;  4HID A;  1E3P A;  1CHP D;  2F0U A;  5KIX A;  1WCM H;  1H9M A;  1UE5 A;  1NAP A;  1L0W A;  4GN5 A;  4FP5 D;  2CCZ A;  3I91 A;  4JV5 Q;  4TRD A;  1RHP A;  1WTR A;  2EY6 A;  1MSH A;  2IHE A;  2JE6 I;  1BOS A;  4IUU A;  4KKT A;  5FJ8 H;  1PH7 A;  1CK1 A;  1Q90 A;  2F3W A;  2RBM A;  5HGQ A;  2X69 A;  3RNU A;  3K81 C;  3PUW A;  2FIN B;  1TS5 A;  3C1E A;  1WYD A;  4PZ7 A;  3OIQ A;  1CKM A;  1MD2 D;  2A69 D;  3T51 B;  1TS2 A;  3C3L A;  5LMU Q;  2O5I C;  2EDG A;  3MAQ A;  4B3S Q;  4X65 L;  2NN6 G;  2RCF A;  3D6C A;  2CHB D;  5J22 A;  3A8K E;  1LT4 D;  2EE1 A;  4FXK C;  2B2U C;  4X3T A;  3J80 L;  1PA6 A;  2K33 A;  2K01 A;  4LF6 L;  2H4O A;  1IKL A;  4DV5 L;  4X64 L;  2C9O A;  3QOL A;  1NR2 A;  4TVA B;  3S9W A;  3UE0 A;  1F9Q A;  4MTN A;  1A62 A;  5KYL A;  4LFC L;  1FGU A;  3Q8D A;  2R7Z B;  2K75 A;  1F2M A;  3TQY A;  4OX9 L;  4UAI A;  4DV1 L;  5IGC A;  4WJ4 A;  5CBE E;  4IFD I;  4LF7 Q;  2YV5 A;  3X3N A;  3KJP A;  1I94 L;  2R7Z H;  4F7X A;  1PDQ A;  4C3J G;  3K7A B;  2AMC B;  2UXD L;  3GTM B;  2GVB A;  4RFB A;  5FLX E;  3G7L A;  4DF7 A;  1LTR D;  1V9P A;  4LFB Q;  2E2J B;  4H0L C;  1FYC A;  4NDX A;  3K7A H;  3WWV A;  3GTM H;  2F0F A;  2K14 A;  1SJE D;  4JW0 A;  1YHB A;  1HTP A;  2JA5 B;  4JI1 Q;  3L9A X;  4CDF C;  1ZEQ X;  3HFZ B;  1ENF A;  2E2J H;  5IYB G;  1RDP D;  2XIW A;  3STB C;  3AMU A;  3T1Y L;  3GO5 A;  3ZJY C;  5T1I A;  1I6H B;  4G4K A;  3VR6 A;  3DXJ C;  2KBN A;  1PH9 A;  4HAE A;  4QB4 A;  1LYL A;  1NMG A;  3GTQ B;  4TKO B;  4CJ2 C;  1SMY D;  1Q1B A;  1BO0 A;  2QCP X;  1LM0 A;  1I6H H;  1G91 A;  2QGQ A;  1XXG A;  3ITP A;  4RHR A;  4UPA A;  1JOK A;  4L63 B;  2Q8T A;  3TSS A;  3L3O C;  4A3F B;  4B3R L;  3GTQ H;  3AFP A;  1G2S A;  5EGT A;  3HEJ A;  2F4V L;  4KJN A;  4A3L G;  3CD6 A;  3KFU A;  3D3R A;  3IRB A;  2B2T C;  4DV3 Q;  5IIF A;  3AEV A;  4A3F H;  2UUC L;  2K05 A;  1Y1V B;  3H3V I;  3E0J A;  4I65 A;  2HHH L;  1NNX A;  1K3B C;  1JIC A;  4DK0 A;  1K8G A;  3I4L A;  1HXY D;  3EIV A;  3JC6 6;  4DV0 Q;  1B7Y B;  1F9R A;  2I07 B;  3L7Z C;  1JWM D;  1VQK A;  1Y1V H;  1LO5 D;  1CZG A;  1XMO L;  3I70 A;  4JI4 Q;  1S5E D;  5DM6 3;  2WAQ E;  5F2D A;  4QMG A;  1NTG A;  1X55 A;  4N8X 1;  3G71 A;  3S2H B;  3S1Q H;  2RHQ B;  4H13 C;  5KND A;  3AB9 A;  2K03 A;  2ZXO A;  1A8V A;  1V1O A;  3RUZ A;  1OXX K;  1EY5 A;  2SNS A;  4R8I A;  1GJX A;  2A74 C;  4MHE A;  4P75 A;  1GOZ A;  1S72 A;  1Q7Y C;  3S2H H;  2PZT A;  2K04 A;  2XGT A;  2UUA Q;  1E0B A;  2PMZ E;  5G3L F;  4PQX A;  3M4P A;  3GTO B;  3A74 A;  4YIJ A;  3E9H A;  4JI6 Q;  4JYA L;  2JQO A;  4R1J A;  4NW2 A;  5I2Y A;  1T5E A;  1VCI A;  3ER0 A;  3H6M A;  3U50 C;  4BY1 G;  3S1M B;  4ZK9 B;  1IW7 D;  1HUN A;  1YHA A;  5C44 G;  3GTO H;  2B2V A;  3M7G A;  2F52 A;  1E1T A;  2H5X A;  3D31 A;  3S1N B;  4HED A;  1AW7 A;  1SEB D;  4Q5V A;  1VQ8 A;  3S1M H;  2ZXR A;  1IL2 A;  3F2D A;  4IPC A;  2XSC A;  1XWE A;  2KEC A;  4DAV A;  4Y7N B;  3SDZ A;  1YIT A;  4RGT A;  3S1N H;  5FO9 B;  3V2T A;  1TWH H;  2R92 B;  1DYQ A;  1YZ6 A;  5JPM C;  1JOR A;  1QUQ A;  3VR5 A;  2F0W A;  3QB3 A;  4AQY L;  4LF8 L;  3WDN A;  1EFW A;  2QEX A;  1EIG A;  1A3T A;  3DHQ A;  1PYW D;  2PW5 A;  1X65 A;  3FKI G;  2R92 H;  2F0J A;  5JEA H;  4Y52 H;  5CBA E;  2A8V A;  5C3X A;  3BJU A;  2TSS A;  2YU9 B;  1QUQ B;  1D1I A;  2A68 C;  3MFY A;  1R9T B;  3EQL C;  3TZU A;  2SNM A;  3NBH A;  2QEJ C;  1UAP A;  2BE5 C;  4DV6 Q;  3WOE A;  4E6I A;  2ZT9 C;  5C4X G;  2YU9 H;  1SLJ A;  1XMQ L;  2IJ0 A;  1MI2 A;  1EYC A;  1R9T H;  1A2T A;  1T5X D;  4BBS G;  1SYF A;  5NUC A;  3T16 A;  2VUM B;  3NBH B;  5M3M G;  1B1Z A;  1JE5 A;  5M3F G;  1G6P A;  1CKO A;  4PNY A;  1EZ6 A;  1KLG D;  1E2W A;  4JI8 Q;  1FGB D;  4L5R C;  2VUM H;  1B50 A;  3PIO A;  3I4M B;  1XPO A;  3MXP A;  1UWV A;  4EQN A;  1RD9 D;  4DR6 Q;  4ZKC B;  1Y8N B;  2CQO A;  2VQE L;  5IGB A;  4NXM L;  1SFO B;  4FNF A;  3I4M H;  3C2P A;  4HIM A;  4F88 A;  4OO1 H;  1HRJ A;  3D0F A;  2EYH A;  2JA7 B;  1TWA B;  1N33 L;  2N78 A;  1IW7 C;  2O2L D;  4DAM A;  2VL6 A;  2R7F A;  1SFO H;  1GO3 E;  4A4I A;  2LS0 1;  5EKL A;  4G7O C;  1N36 Q;  5EAY A;  3M3Y B;  1R4Q B;  1U5K A;  3DM3 A;  4K5W A;  2JA7 H;  1TWA H;  1RTN A;  1CM9 A;  2LFN A;  1KL9 A;  4IAL A;  4ZRZ A;  4DNI A;  1QNU A;  3CPF A;  1BBU A;  1HPC A;  4UP9 A;  4A3M G;  3ERO A;  2BH8 A;  3M3Y H;  2D62 A;  5HGT A;  4LF4 Q;  4IUR A;  1SYE A;  2EYO A;  3NEM A;  3CCJ A;  1K3R A;  4KN4 C;  2ASB A;  3HOY B;  5CV8 A;  4DV4 L;  3QWN A;  1VQP A;  3BZD B;  1SE4 A;  1EWH A;  4JI5 L;  1BQQ T;  4IUP A;  4N9P A;  3A8J E;  2PI2 A;  1F77 A;  5BN3 A;  1IL8 A;  2Z1C A;  3R3O A;  2Q2T A;  4DXF A;  4PMC A;  4CDE C;  2CFM A;  3HOY H;  1GXD C;  3BDL A;  2E8G A;  4RH6 A;  3H3V C;  1HZ9 A;  2HDL A;  1SXT A;  1SJH D;  4K5V A;  5FO8 B;  1YI2 A;  4XYQ A;  1GVP A;  5C3E B;  1LAC A;  2IL8 A;  5IP7 H;  1VS0 A;  4LAA A;  4WRD A;  4A3D B;  1STA A;  2F0H A;  3PF4 A;  4BY7 G;  3HKZ B;  3A5Z B;  3U9S A;  5C3E H;  1QVC A;  1RF2 D;  2A6H C;  3SK5 A;  3P7J A;  2OEO A;  1X3P A;  4OWX B;  3OW7 A;  3OHX C;  5C0X G;  2QW7 A;  4EQ5 A;  5C0X I;  3I73 A;  2R6G A;  3MEH A;  3JAM c;  3F1Z A;  1PH4 A;  1AZP A;  3TBI B;  2MO0 A;  1NUC A;  3NUC A;  1EQQ A;  2EYL A;  4K6L A;  2F0L A;  3BVM A;  4JVZ A;  3CCR A;  3HRZ C;  2F0M A;  5J1Z A;  1SR3 A;  1HR0 L;  2IX1 A;  2R93 B;  1E1O A;  2RCN A;  3TP5 A;  2A1A A;  4A3J B;  2NZO A;  4C2M B;  4KV6 A;  3TS2 A;  2ICI A;  5EPK A;  2UXC Q;  1I4G A;  3I3C A;  2B2Y C;  4DUY Q;  4YY3 L;  3BYY B;  5C4J H;  2EY5 A;  1B2T A;  1CQF A;  4HJ9 A;  4A3J H;  1MGS A;  4C2M H;  4WFN 3;  3H15 A;  1A3U A;  2FFK B;  3GV3 A;  2I5M X;  4L5Q A;  2CW0 C;  3EN2 A;  2JEB I;  3P75 A;  2MHV A;  1E22 A;  3HZX A;  3KBG A;  3M85 A;  3HS0 C;  2HQL A;  1B4O A;  4LW1 A;  2EYJ A;  2EXZ A;  4JBW A;  5IP9 G;  1SE3 A;  3M4Q A;  1RJT A;  1WTH A;  5CC4 A;  3MTS A;  2QIL A;  2E76 C;  4IUQ A;  3QO2 A;  1K8A C;  4YHH L;  1SND A;  2MO1 A;  1SRO A;  5IT9 E;  4XT3 B;  4RWS C;  3D4R A;  2N3S A;  5HY6 A;  5JVG 3;  2NVQ H;  2K1B A;  2M9V A;  1VQ4 A;  4JI3 Q;  4JI7 Q;  4JPB W;  3J80 i;  1HFG A;  4IOC A;  1PYS B;  3A5U A;  4DK3 C;  3ULJ A;  1FJG Q;  1EQT A;  5LHY 1;  2MPM A;  1EFI D;  4B3T L;  5EJW A;  1I4H A;  4DR5 Q;  2VQF Q;  1PV4 A;  4DR2 L;  2UUB L;  2GN5 A;  1A3V A;  2Z9H A;  3NTK A;  1LV9 A;  2PZW A;  1VQ6 A;  1G29 1;  3GTP B;  3PO2 B;  4DUZ Q;  1X3G A;  2KCN A;  4NKL A;  2JA6 B;  4RGN A;  1Q3L A;  3SK8 A;  3CQZ H;  4OON A;  3LWE A;  3PO2 H;  3GTP H;  2E2I B;  3J81 L;  3V96 A;  1IBK L;  1J5E L;  2L15 A;  3U58 A;  1BUV T;  2EVB A;  1UE7 A;  2UXB L;  1C48 A;  2JA6 H;  4GN4 B;  1LLR D;  1BCP B;  3X3M A;  2LXK A;  2CH4 W;  5GAD C;  2QDB A;  1PRT C;  1VMP A;  4JI2 L;  4K2L A;  2E2I H;  1FL0 A;  1RCV D;  3OTO L;  1TWF B;  3I55 A;  2E5L L;  4R4I A;  1EY8 A;  2WKC A;  4K8I A;  1TII D;  4F8M A;  1B44 D;  2WV6 D;  5E4W C;  1I4Q A;  3ONA B;  4P72 A;  5I6W A;  4BA2 I;  2RQX A;  1L0Y B;  1TWF H;  1K73 C;  3OW2 A;  1M1K C;  4B3M Q;  1SNO A;  4OHJ A;  1SBB B;  5KGU A;  4XT1 B;  1PRT F;  2KCC A;  3AU7 A;  2FMM A;  1RTO A;  5FOB B;  4GS3 A;  3S17 B;  4NPS A;  4YCW A;  2Q8I B;  3CCS A;  4X3U A;  1IHZ A;  4HCE A;  5DLQ E;  1B3Q A;  3MZ5 A;  5CV7 A;  1S5F D;  3PO3 G;  1M90 C;  3HOU G;  4QY7 A;  3FRP B;  1ESR A;  2WFW A;  2NVY B;  3MWY W;  4LUV A;  4FF1 A;  3RLN A;  2R61 A;  4G7Z C;  4JV5 L;  5GQO A;  3PUX A;  2ID0 A;  4U68 A;  1Y1W G;  2NVY H;  1YVC A;  1TU2 B;  1DM0 B;  3PIP 3;  3ULP A;  4DV2 L;  3A7L A;  4AYB G;  1DOM A;  2HIV A;  2IW3 A;  5LMU L;  3J7A 5;  4ZUJ A;  2YTY A;  2PZU A;  4P74 A;  4DAY B;  4LMQ D;  4WJ3 M;  2MGS A;  1V1P A;  4MNO A;  1Q8I A;  2MJ8 A;  4GLA C;  2QKI C;  1F9P A;  4KHZ A;  4JG2 A;  4EQO A;  3J7A F;  4K14 A;  2F0G A;  3STB D;  1IYV A;  1HJP A;  1JJG A;  2KA7 A;  4DV7 Q;  4OIK A;  1PH5 A;  1TKW B;  1YNX A;  1I6V C;  1CKN A;  4S3S A;  1K9M C;  3LWU A;  4CBV A;  2RSO A;  1V1P B;  5LMN W;  2XWB B;  3GTG B;  2FXQ A;  1KQS A;  2Q2I A;  2NTT A;  4EX5 A;  2GA4 B;  4XQQ A;  1I3Q H;  1A6X A;  1R4P B;  4LF7 L;  4LUO A;  4GOP C;  1P16 A;  2TMP A;  1CKN B;  4GLX A;  4YCU A;  1QNK A;  1HHV A;  1DGS A;  2UU9 Q;  1PTO B;  4ME3 A;  4A3K G;  2K5H A;  2Z4H A;  3HOW B;  1SYG A;  3E6Z X;  5JEA G;  3H0G B;  3PF5 A;  1PTO H;  3SXH A;  1VQH A;  4O2D A;  1TQO A;  2DY7 A;  3MEF A;  4NMZ A;  2Y0S B;  4JI1 L;  3HOW H;  4QUF A;  5H1S E;  2B29 A;  1Y8P B;  1PH8 A;  4R4T A;  3CAM A;  2OQK A;  5G3L D;  1JE4 A;  1KRS A;  2J4X A;  3FP9 A;  5FLM H;  4R9W A;  3NTH A;  1J8I A;  3CXC A;  1TWC B;  1ENA A;  1SDF A;  1XNR Q;  2IY5 B;  4K5X A;  4GKK Q;  2HCI A;  1Q82 C;  3K5N A;  2YTV A;  5EBC A;  3CHB D;  1YJW A;  1HNW Q;  3CCQ A;  2J0T D;  4IFD G;  5JPN C;  3MC0 B;  2WB1 E;  4DNT B;  1SSO A;  2B63 B;  3FHW A;  1TWC H;  4LF9 L;  2E74 C;  4DR1 L;  2N55 A;  4H02 A;  3W5O A;  3IKJ A;  1U4M A;  1DD2 A;  1TY0 A;  1QOH A;  2PI2 E;  4DV3 L;  1U4P A;  1PH6 A;  3VA5 A;  2B63 H;  1DOK A;  1H9S A;  3I4M G;  3FDT A;  3TP6 A;  3IFD A;  2KUM A;  4DXG A;  3I2Z A;  2A6E C;  2X6L A;  4OO1 I;  3T1H L;  2F0D A;  3KF6 A;  4DV0 L;  1TY2 A;  2XWJ B;  3FMC A;  3EJI A;  3EFX D;  3K6O A;  2I0Q A;  4A3B G;  3W1B A;  3W3A A;  1H9S B;  3HOX B;  4JI4 L;  4CKB A;  1L2F A;  3UE1 A;  1WOC A;  3E0E A;  4GKJ Q;  1VQL A;  3KF6 B;  2JA5 H;  3VYS A;  2E2D C;  4A3I G;  3SR1 A;  3SVM A;  4X65 Q;  4ZUI A;  1RL2 A;  3HOX H;  1C8C A;  2N88 A;  2PCF B;  3CME A;  5GAE C;  3RR5 A;  2JYO A;  5ELF A;  2PNH A;  4IUV A;  2UUA L;  3R93 A;  4C3H B;  4X62 Q;  4X64 Q;  1E2Z A;  4JI6 L;  1YJN A;  1N9W A;  4LUZ A;  3MXU A;  1CQV A;  5LMN L;  2A68 D;  4LFC Q;  5BR8 Q;  3I4N G;  1EOV A;  3NEL A;  1ENC A;  1DOL A;  3FEW X;  4HIO A;  1LAB A;  2BE5 D;  4C3H H;  2L5T A;  4O42 A;  2IX0 A;  3HOY G;  3J7A V;  5JJL A;  5C6A A;  1D5X C;  3KUP A;  1OXS C;  3CPW A;  4DV1 Q;  1KAB A;  1CSQ A;  4IPD A;  3NQT A;  2RKS A;  3NQI A;  2EOT A;  4CJ0 B;  1VQ9 A;  4A3E G;  4JBM A;  2B8G A;  4OWW B;  4Z9C B;  3DWA A;  2WB1 G;  2UXD Q;  3DMU A;  1H9R A;  3HGB A;  5EQ0 A;  3F2B A;  1HA6 A;  2EJG C;  1LTT D;  2ZTE A;  4AH6 A;  4JCV E;  4UP7 A;  2XRQ D;  1FD7 D;  3IL8 A;  4C3I B;  3H91 A;  3K5O A;  2F0O A;  2CQA A;  3J81 j;  5C0X J;  1H9K A;  1EY0 A;  1NBW A;  4O1N A;  3HOV G;  1HCZ A;  2F0K A;  1K28 A;  1STG A;  1BR9 A;  2Z6K A;  1Z47 A;  1RIP A;  1Z6H A;  1SNP A;  2L4N A;  4J15 A;  1IZ6 A;  5E4X A;  4C3I H;  4A3C G;  3PGZ A;  3H94 A;  4DV6 L;  5IYD H;  2AUK A;  5I9P A;  2F0N A;  5IYC H;  4RCN A;  1D7Q A;  4NP5 A;  4CHT B;  4ABN A;  1CT1 D;  3OWF A;  2JXM B;  1VQC A;  4FO2 A;  5ELN A;  4LFA Q;  3R2T A;  1VQO A;  5D3D A;  1BF4 A;  1ZKO A;  4ULL A;  4OXP A;  4JI8 L;  3TDQ A;  4YCV A;  2UUC Q;  4TSS A;  2HHH Q;  3EA6 A;  4Y7N H;  4DR6 L;  2AQ1 B;  3K5L A;  2B2V C;  4CDD C;  1DZ1 A;  1G2T A;  1VQI A;  2NB0 A;  2Z4I A;  3E5S A;  4CJ1 B;  3CC2 A;  5K36 G;  4KK7 A;  5KEE A;  1IBL Q;  2KJX A;  1NY4 A;  4DPG A;  3CP0 A;  4DK6 C;  1XMO Q;  5M5Y B;  3Q22 A;  3L0O A;  2JA8 G;  4QIW B;  3DM1 A;  1IBM Q;  2NTS A;  4MTK A;  1OXV A;  1OXU A;  1X32 A;  2ZTC A;  2WAQ G;  1N36 L;  5M5Y H;  3GTL B;  5IT9 c;  3NK9 A;  1FNW A;  1N8R C;  3PV0 A;  1EWC A;  4BXX H;  3TME A;  1HR0 W;  2NN6 H;  2A6H D;  2MFI A;  4EVO A;  1QIL A;  1MBY A;  3GTL H;  2K5N A;  1WTW A;  4DN4 M;  3KYH C;  1HNZ Q;  2JK8 A;  1GUW A;  1WTP A;  1W6K A;  1UE6 A;  5A35 A;  5EBD A;  5IGE A;  3S14 B;  4KN7 C;  2NVT B;  2QDL A;  1OXT A;  1VDZ A;  3HKS A;  1K0S A;  1HA5 A;  2G9H D;  2V1C C;  4DR4 L;  3CKI B;  1PYB A;  2X6G A;  3F2C A;  2F03 A;  3S14 H;  4ZQ3 A;  1VQ7 A;  4GN3 B;  2YTX A;  2JA6 G;  4K0K Q;  2F0S A;  3VYU A;  4YWK A;  3MXG A;  2NVT H;  4V0B A;  1G6Z A;  2KCM A;  5IWA Q;  3RLF A;  4BBR G;  2YYZ A;  1X3F A;  2AQ3 B;  3TRE A;  3CMA A;  1JT8 A;  5EKK A;  4IN3 A;  5E7N A;  4A3G G;  2EYF A;  4L5T A;  2CW0 D;  2IHF A;  1WTX A;  1O7I A;  1Y69 U;  3J80 E;  3J81 i;  2DNE A;  2C5C A;  3JAM L;  4DR7 Q;  5A2Q L;  4FVM A;  3R8B A;  1XPU A;  3G6E A;  5AJ3 Q;  3ND8 A;  5IYB H;  3HOZ G;  3A54 A;  2EYM A;  5JVH 3;  4IPH A;  5IY0 A;  4M8A A;  2KCT A;  3U4V A;  2DJG C;  4U67 3;  1HNX Q;  1ZYR C;  1LUZ A;  1VF7 A;  1EIY B;  1X6O A;  2NVX B;  5GRO A;  1V8Q A;  2ZJQ A;  2UXC L;  1X3Q A;  4DUY L;  4M1U B;  1XNQ L;  1B8A A;  3H09 A;  1T9H A;  1YNJ C;  3IFT A;  4XQN A;  3AQQ A;  2MUY A;  1ESF A;  3W1G A;  2NVX H;  1MJE A;  1L0X B;  1KIX A;  3S1R B;  1WTV A;  1QZH A;  4HR7 B;  1QB5 D;  2HD3 A;  4NXM Q;  4FXD A;  1VQB A;  1ILQ A;  3S1R H;  3S24 A;  1SYC A;  1N33 Q;  1EOT A;  2NYZ D;  3T4A C;  4A3D H;  3TEH B;  1EIF A;  1PH2 A;  1LTS D;  2CVR A;  3GQB A;  4H44 C;  3D4D A;  3TN2 A;  3GDE A;  2B2Y A;  3I4O A;  1O7Y A;  1IXR A;  1WCM G;  1Y8O B;  2EPB A;  3QJY A;  4R4Q A;  5DEH A;  1PRT D;  4JI3 L;  4I7Z C;  4JI7 L;  1S5B D;  5GAH C;  2F3V A;  2R93 H;  3TP7 A;  1SNQ A;  3DUZ A;  4P71 A;  5C44 B;  1GUO A;  1STE A;  5FJ8 G;  3CC7 A;  4DR3 Q;  4PMB A;  4KLK A;  3BDO A;  3OYY A;  1IKM A;  2XN9 C;  2Z6B A;  5JJZ A;  3PUY A;  5C3W A;  2VQF L;  4J8Q A;  2K50 A;  5DNF A;  5BN4 A;  5KYI A;  4B9W A;  1YBY A;  1JWS D;  2RSN A;  3K0Y A;  3MFG A;  5C44 H;  4HJA A;  5JEA J;  2RF4 A;  3RZO B;  5FLX L;  1JC7 A;  1STY A;  4J1M A;  1HZA A;  1B9N A;  5COY A;  3KLW A;  4HMI A;  4LNQ A;  1SE8 A;  1SE2 A;  1BNZ A;  3LNN A;  4UY8 C;  1Q46 A;  1EYG A;  3VR3 A;  3RZO H;  5D14 A;  3S15 B;  4DKA C;  4GNX A;  3FKI B;  1BVS A;  2BDO A;  4JC0 A;  2AQ2 B;  3VYR A;  1A2U A;  2JSO A;  2F0Q A;  1O78 A;  3S15 H;  1JOQ A;  1B3A A;  4QQB X;  2KED A;  1TT2 A;  4KHP Q;  5C5M A;  3FKI H;  1S5D D;  1KTK A;  2R7Z G;  4IFD J;  4GNX B;  4Q0F A;  3BG3 A;  2LSS A;  1HH2 P;  2B2W C;  2DUD A;  4R4O A;  4BBS B;  1D5M C;  4X3S A;  3A8I E;  1J9O A;  5CV9 A;  2F0I A;  5M3M B;  4ZKB B;  1E7Z A;  3MHB A;  3MXN A;  5M3F B;  2OTL A;  1DXM A;  1LTB D;  3T53 B;  1I4X A;  1MJC A;  1F2Z A;  1HQM C;  2K32 A;  2NZ1 D;  2F0P A;  3J7Z C;  2PMZ B;  1FNU A;  4FXG C;  5FLX c;  1KRT A;  1ICW A;  4BBS H;  4XTC S;  2SDF A;  4A75 A;  4YY3 Q;  3SK4 A;  5M3M H;  5I9O A;  1ASZ A;  5M3F H;  1C9O A;  3UI2 A;  4RKB A;  2PYK A;  3MXN B;  1BXT A;  3A0J A;  2VB3 X;  5C4H A;  1N32 L;  1KD1 C;  2WP8 J;  1EU3 A;  4JI0 Q;  5M5W B;  1P8L A;  1UEA B;  5ELC A;  2JA5 G;  1EY7 A;  4JOI C;  3K7U C;  3Q0A A;  1VF5 C;  1AN8 A;  1HTL D;  1D5Z C;  2BH2 A;  3BYT B;  1PRT B;  5M5W H;  1JB3 A;  1STB A;  1U4R A;  3FVQ A;  4KJO A;  4KKS A;  4RCO A;  5CMD A;  1DON A;  1BCP C;  1NMF A;  4RGM A;  3MA2 B;  2LY7 A;  4KY7 A;  3Q24 A;  4A3M B;  2R3Z A;  4A3F G;  1BBW A;  3RLO A;  3VA7 A;  2ENB A;  1SN8 A;  1MKH A;  3OPO A;  1L1O A;  4FDB A;  1BCP F;  5IOC A;  4A3M H;  1Y1V G;  3M4Y A;  4JBJ A;  2RDG A;  1CUK A;  3S17 H;  1V43 A;  1STH A;  2UUB Q;  5D3I B;  2I46 A;  2VXW A;  3RD4 A;  2CWA A;  3NPP A;  1OTC A;  4DAY A;  2BA1 A;  2FMC A;  2J7Z A;  1L1O B;  3KLS A;  4X66 Q;  1JWU D;  2UU9 L;  4LF5 Q;  1TVX A;  1YEZ A;  3N52 A;  4RHS A;  4OWT B;  2CKZ B;  4HTH A;  1XTC D;  3BZK A;  2DGY A;  2WAC A;  3KK7 A;  1EY4 A;  4HN7 A;  1KDA A;  4B3S L;  2BOS A;  1M8A A;  2L0C A;  4UP8 A;  1JJC B;  1ONL A;  2A6E D;  1FR3 A;  1VQM A;  4BY7 B;  2EJF C;  3CU7 A;  3ERS X;  3GD7 A;  2DJF C;  1IYU A;  1EUJ A;  2F4I A;  2ZTD A;  4RG1 A;  2E5L Q;  5CR3 A;  4LWC A;  4MN3 A;  3DLL A;  1HZB A;  1YIJ A;  2OXP A;  1WD0 A;  1X3E A;  3M4O B;  2Q2H A;  4C1N I;  4YWL A;  2ES2 A;  1XNR L;  4GOP A;  2AWO A;  1XYI A;  4GKK L;  1CA6 A;  2PQA A;  2EXD A;  4HSP A;  4XXE A;  1CSP A;  2XVS A;  1O80 A;  4HCS A;  5COR A;  5K5P A;  1PH3 A;  1N34 Q;  1MIU A;  2LMC B;  4PZ6 A;  2VS1 A;  3WOF A;  1YNN C;  1E2V A;  3G48 A;  3HP3 A;  3GTG H;  1S3O A;  3GV6 A;  3U4Z A;  4GOP B;  4EQP A;  4GLV B;  2PQA B;  3BVG A;  1NCV A;  2R92 G;  1U4L A;  2B2U A;  4LFB L;  4B9X A;  2ZM6 Q;  2ZXP A;  4L5S A;  4CKC A;  4I7A A;  4JBK A;  3PSI A;  1O7L A;  1PFM A;  1PFN A;  1AZQ A;  1MSG A;  5IGD A;  1PTO C;  1G8Z D;  1TS4 A;  3I7F A;  1PVO A;  2FJ2 A;  5JOB A;  3H0G H;  1FVI A;  4BWG B;  1XPR A;  4PMW A;  4DV2 Q;  4OIJ A;  5FK9 C;  2ICE C;  4GKJ L;  4WJW A;  1CI3 M;  4N9T A;  3F8T A;  1PH1 A;  4P73 A;  4BXX G;  2SEB D;  2EY2 A;  1VQ5 A;  1CFM A;  2NN6 I;  5IP9 H;  1PTO F;  4K8J A;  2KHI A;  1VQN A;  2E75 C;  4NXN Q;  2RVL A;  3GTJ B;  2P5Z X;  2VUM G;  4X62 L;  3NWT A;  3OMC A;  2V4D A;  3G6J B;  1PLF A;  3RN5 A;  1D8L A;  1EY6 A;  5EKI A;  4IQZ A;  3NBI A;  1GKH A;  4A93 B;  1CA5 A;  5BR8 L;  2K5Q A;  5EPL A;  3GTJ H;  1E24 A;  2HQE A;  2R7D A;  4DGZ A;  1ZXT A;  3K0X A;  1VQD A;  2BA0 A;  2VZA A;  5M9O A;  4OO1 G;  3HKZ E;  1AE2 A;  4A93 H;  4HIK A;  2HDM A;  4B08 A;  2IPK D;  1BKB A;  3OSO A;  1EZ8 A;  1WTO A;  2F3I A;  3UDF A;  4IUT A;  2JA7 G;  3TS0 A;  1C7Y A;  1I4P A;  1IYJ B;  2L11 A;  3K5M A;  1GUG A;  3T56 B;  2ZJP A;  3CF5 A;  3TP8 A;  5AFW A;  4IPG A;  1LTG D;  1YHQ A;  2I5H A;  1TWG B;  5ELO A;  2F0V A;  4FF3 A;  2B2T A;  3GTK B;  4LF6 Q;  2WII B;  2BDN A;  4XYO A;  3J80 c;  3OMG A;  1EQV A;  3K80 C;  5J39 A;  4DFA A;  4LK1 C;  4DV5 Q;  1W2B A;  3SHL A;  3T13 A;  1JJ2 A;  3PIP A;  4L6T B;  3CCV A;  3SK6 A;  4DAP A;  1TWG H;  2L55 A;  4APV A;  3NSW A;  2A73 B;  1QVF A;  4QJF A;  3GTK H;  1LTI D;  3PIO 3;  4KI0 A;  2K5W A;  3NXW A;  1D1K A;  3BVZ A;  1C0A A;  5ISR A;  4YWM A;  4DA2 A;  4OX9 Q;  4CKE A;  3JAM i;  1WTQ A;  1K83 B;  1EYA A;  1XTD A;  1NSN S;  3SEB A;  5JAV A;  4LFA L;  4LF9 Q;  4DR1 Q;  3F2U A;  3RMH A;  1I94 Q;  4XDX A;  4XIG S;  4OGQ C;  1D6E C;  1I50 B;  4IZ8 A;  4BA1 I;  2LKV A;  3AYH B;  2AKW B;  1UNS A;  1NR4 A;  1S40 A;  5IP7 G;  1U9R A;  1K83 H;  3A55 A;  1TXY A;  4J6H A;  1PHJ A;  4FF2 A;  3RN2 A;  2A69 C;  4DNR B;  3PO3 B;  2EJM A;  1QCB D;  2L9H A;  3HOU B;  5E1F A;  5C3E G;  1GUN A;  1I50 H;  2ZJR A;  4G7H C;  2CWP A;  1AH9 A;  3LX0 A;  4MIU A;  3N6R A;  3T1H Q;  1XJV A;  3BZC A;  3Q23 A;  3S1Q B;  3P20 A;  4A3D G;  3J81 E;  1UUP A;  3PO3 H;  3HKZ G;  1Y1W B;  3HOU H;  1U0L A;  1W6J A;  5CGK A;  1A0I A;  1IBL L;  1V1Q A;  5C5L A;  1ASY A;  2D2C C;  3T1Y Q;  4AYB B;  1IBM L;  1EWI A;  2EY1 A;  2F0E A;  3E3X A;  3QG1 A;  4ILW A;  1W3S A;  3P1H A;  1O7Z A;  5KNB A;  2OCE A;  1Y1W H;  5IT9 L;  1BBX C;  1PZK D;  3ND9 A;  5IGG A;  2XTI A;  1HUM A;  4OEM B;  2A5H A;  2R93 G;  4UHV A;  2K4K A;  5DAU A;  2IWH A;  3VR2 A;  2MNA A;  2VY3 A;  4A76 A;  2KHS A;  4B3R Q;  1H9J A;  4A3J G;  1I5F A;  2F4V Q;  2PO4 A;  1K8M A;  2ALY B;  4G57 A;  4ZLT F;  3CCM A;  5LMN Q;  3W2D A;  2WKD A;  2PNR C;  1FNV A;  3S2D B;  2Z6K C;  1HNZ L;  1XX8 A;  2D0P A;  2OF1 A;  2H1E A;  4ZCK A;  5CV4 A;  5ELE A;  1LT5 D;  1ROD A;  4IJH A;  1X56 A;  4AIM A;  3FPP A;  3A56 A;  1TWH B;  1ZYR D;  3S2D H;  1KAA A;  4KTA A;  2WIN B;  2NUC A;  1GM5 A;  4N8F A;  2RHS B;  4IOA A;  2OQ0 A;  4KY5 A;  4A3K B;  3I56 A;  3QIA A;  4K0K L;  3PUV A;  1VQA A;  3OWE B;  5CV6 A;  1K8O A;  3MVV A;  4K2K A;  4ME5 A;  5IWA L;  1SMY C;  1YNJ D;  2K5V A;  1RKN A;  1VQE A;  2N8N A;  2O5J C;  3SE0 A;  1DJR D;  4A3K H;  2I5L X;  2EQS A;  3OIP A;  5C4Z A;  1X54 A;  1AFP A;  4JK1 C;  5I2X A;  4R4C A;  4JYA Q;  3NWS A;  2K52 A;  4DR7 L;  1LT6 D;  1EU4 A;  4QUC A;  4LF4 L;  1GHJ A;  2G9D A;  5FKA C;  2MQH A;  2G5D A;  3K8A A;  5AJ3 L;  4QGU A;  3I90 A;  1HNX L;  5ELB A;  5M5X B;  3EVQ A;  3CCU A;  4KKU A;  3URY A;  2ATW A;  3NP8 A;  4OL7 A;  4HSV A;  1EQR A;  2DY8 A;  2B8F A;  4C3J B;  3V05 A;  3PO2 G;  4PV1 C;  4RMF A;  1AP0 A;  2Q2U A;  4CGY B;  5M5X H;  3DEO A;  2BCO A;  4IFD H;  4POF A;  4ZYS A;  3ERQ A;  1VQG A;  1EEF D;  1M4V A;  1KHI A;  3M9B A;  4F87 A;  2F1M A;  2B39 A;  4C3J H;  4AQY Q;  4LF8 Q;  1TR5 A;  3UDG A;  4V19 0;  4ZAI A;  3D4W A;  4QF4 A;  1VMC A;  1PXU A;  4LJZ C;  2AUJ D;  5J3B A;  4IJL A;  4A3B B;  3C1F A;  4RAU C;  4HMJ A;  2GVA A;  5D65 A;  2JA9 A;  4QL5 A;  3LGJ A;  4FYD A;  1Q12 A;  1GUT A;  3DEP A;  1KAW A;  2DN8 A;  4A3I B;  4A3B H;  4POG A;  2PQE A;  1XMQ Q;  4BS9 A;  1AE3 A;  3OOC A;  1EIH A;  2PPB C;  4K6D A;  4A3I H;  4L8J A;  1WFQ A;  4X6A H;  1G51 A;  5EPJ A;  3NE5 B;  3RZD B;  3NEN A;  3I4N B;  3CRL C;  2QF7 A;  4IO9 A;  3TRZ A;  4KMU C;  1F2Y A;  5LL6 X;  4DR3 L;  3U9O A;  2HCC A;  2Y0S E;  3E9I A;  3PQI A;  4A3L H;  3D8G A;  2B3G A;  3RZD H;  3QR8 A;  2L1B A;  2XNA C;  2VW9 A;  3I4N H;  5BN5 A;  1KDB A;  1LTL A;  2VQE Q;  1SRU A;  4NB3 A;  4GZY C;  1SNM A;  4A3E B;  3CRK C;  2NZH A;  3H3V H;  4DR4 Q;  2WB1 B;  1F2L A;  4ALP A;  4DU9 A;  1GUS A;  2L12 A;  3CC4 A;  2RDH A;  5E3F A;  1WJJ A;  2KEE A;  2JN4 A;  1JCK B;  5IE8 A;  4A3E H;  3SGI A;  1LT3 D;  1NJI C;  2PW7 A;  4FF4 A;  4MZ9 A;  1KLU D;  3HOV B;  2D5D A;  4RKL A;  3K59 A;  2HT1 A;  2IX3 A;  4R8N A;  1CHQ D;  1Z7T A;  1NE3 A;  4WOR A;  1K0R A;  5IOD A;  4HJ7 A;  4HJ5 A;  2VB2 X;  4TQU S;  3K58 A;  3K57 A;  4KHP L;  3A7A B;  4BY1 B;  3HOV H;  2EZV A;  1PZI D;  3VYT A;  2N49 A;  3I8Z A;  3TZD A;  1GHK A;  1FJG L;  4DV4 Q;  1QE6 A;  4A3C H;  1BCP D;  2K28 A;  1PZJ D;  4DR5 L;  4JI5 Q;  4BY1 H;  5C4J B;  3HG9 A;  1EY9 A;  2D0O A;  5T1G A;  1S5C D;  3UDI A;  3CW2 C;  4P2C B;  1KNA A;  2EIF A;  4PZ8 A;  3PCO B;  4DUZ L;  1SYB A;  1EL0 A;  3IAY A;  2IT1 A;  2Q8R E;  2JEA I;  2SOB A;  3ZYY X;  5JJI A;  1XNQ Q;  3AFQ A;  1KNE A;  2Z8L A;  1LTA D;  3HOW G;  2Z0S A;  3H0G G;  2XRS D;  3VR4 A;  2K6A A;  3R2I A;  5FLM G;  3BU2 A;  4JI0 L;  1B9M A;  5GAG C;  1HQR D;  3D6W A;  2Y0S G;  2E2H B;  1A63 A;  1I4R A;  2JA8 B;  5FO7 B;  2B2W A;  3KDF A;  4KHV A;  3C46 A;  1CTM A;  1DCZ A;  2KHJ A;  2E2H H;  5K36 H;  5C4X B;  2WAQ B;  2NVQ B;  1VQF A;  2RA4 A;  2JA8 H;  2K5D A;  4B3M L;  1HR0 Q;  3NTI A;  2B63 G;  1QVG A;  1QZG A;  3KDF B;  4RGO S;  5C4X H;  1TS3 A;  1SNC A;  2OWO A;  4GNX C;  1SMX A;  4A93 G;  4UDU C;  1Q81 C;  2KVM A;  2NWG A;  4IUN A;  4JOI A;  2EYP A;  1WVL A;  2K7V A;  2A19 A;  1JOO A;  1KXL A;  3ICE A;  3CCE A;  3CQZ B;  1Q1E A;  1BDO A;  1PFB A;  5KRU A;  4O0A A;  4AYB E;  5DM7 3;  2M2L A;  4X66 L;  3B6Y A;  2KQ3 A;  1YNN D;  1S4Z A;  4LF5 L;  4OEL B;  3HOX G;  1EYD A;  3NHH A;  3G4S A;  1B70 B;  1YJ9 A;  3J7Y W;  1STN A;  4H7B A;  4X3K A;  4BBR B;  5I4D A;  1SYD A;  1WI5 A;  2KEN A;  5TSS A;  1MHW C;  4C56 C;  1H95 A;  4ODG A;  5I6Y A;  2MP1 A;  4YHH Q;  1B53 A;  1ILP A;  3KF8 A;  4A3G B;  1C4Q A;  1ICF B;  5CYU A;  5CV5 A;  2VNU D;  1PTO D;  3DWQ A;  4C1N K;  4XQJ A;  2KOL A;  1ET9 A;  1QJO A;  1UEB A;  4BBR H;  4C3H G;  2OTJ A;  1II3 A;  4DK1 A;  1CZW A;  1Q8K A;  1KDC A;  1WD1 A;  2QA4 A;  1ML0 D;  2AWN A;  4A3G H;  4DV7 L;  3KBX A;  3KF8 B;  3BDC A;  1Y14 B;  3HOZ B;  1GD7 A;  2DNC A;  1EEI D;  1OO9 B;  3FPU B;  3S16 B;  4B3T Q;  3KJO A;  3KLR A;  4DR2 Q;  1X9N A;  2C35 B;  4EGV A;  1Q86 C;  2OT2 A;  1PFS A;  3QOJ A;  1N34 L;  3I72 A;  3HOZ H;  4QIW E;  5IGF A;  1VQJ A;  4KD4 A;  3S16 H;  1UE1 A;  3KLS X;  1HFN A;  5L37 A;  4PG3 A;  3VDY A;  4KD3 A;  3Q6S A;  5ELD A;  1JQY D;  2D9U A;  3L2P A;  1JMC A;  2ZM6 L;  1J6Q A;  3O13 A;  1F9S A;  4ID6 A;  2JP1 A;  3KOJ A;  1IBK Q;  1J5E Q;  4C3I G;  4QCL A;  5KNC A;  5JJK A;  3J81 c;  3PMF A;  1N32 Q;  1ET6 A;  2UXB Q;  1L1O C;  5HUR A;  3ULL A;  3EBE A;  4CDC C;  5IYD G;  2AHO B;  3GP7 A;  1PMR A;  1A15 A;  3BS1 A; 
#chains in the Genus database with same CATH homology
 5LL6 S;  4KY6 A;  1SAP A;  1QWY A;  2M00 A;  2FHT A;  2HUG A;  2O4X A;  3JAM E;  3DWP A;  1JR0 D;  5A2Q E;  5C0X H;  4RA8 A;  2NBF A;  1AEX A;  1WCM B;  2F0T A;  3PUZ A;  3M7N A;  1QG7 A;  1I3Q B;  2RDF A;  1D2B A;  1CHP D;  2F0U A;  5KIX A;  1H9M A;  1NAP A;  4FP5 D;  3I91 A;  4TRD A;  1RHP A;  1WTR A;  2EY6 A;  1MSH A;  4KKT A;  2JE6 I;  1BOS A;  4IUU A;  1CK1 A;  1Q90 A;  2F3W A;  2RBM A;  2X69 A;  3PUW A;  2FIN B;  1TS5 A;  3C1E A;  3OIQ A;  3T51 B;  1MD2 D;  2A69 D;  3C3L A;  1TS2 A;  2O5I C;  2EDG A;  3MAQ A;  2NN6 G;  3D6C A;  2CHB D;  5J22 A;  3A8K E;  1LT4 D;  2EE1 A;  4FXK C;  2B2U C;  4X3T A;  3J80 L;  2K33 A;  2K01 A;  2H4O A;  1IKL A;  2C9O A;  3QOL A;  1NR2 A;  3S9W A;  1F9Q A;  5KYL A;  2R7Z B;  1F2M A;  4UAI A;  5IGC A;  5CBE E;  4IFD I;  3X3N A;  4F7X A;  1PDQ A;  4C3J G;  3K7A B;  3GTM B;  4RFB A;  5FLX E;  3G7L A;  4DF7 A;  1LTR D;  2E2J B;  4H0L C;  1FYC A;  4NDX A;  2F0F A;  1SJE D;  1HTP A;  2JA5 B;  3L9A X;  1ZEQ X;  1ENF A;  1RDP D;  2XIW A;  3AMU A;  3GO5 A;  5T1I A;  1I6H B;  4G4K A;  3VR6 A;  3DXJ C;  4HAE A;  4QB4 A;  3GTQ B;  4TKO B;  4CJ2 C;  1SMY D;  1Q1B A;  1BO0 A;  2QCP X;  1G91 A;  1XXG A;  3ITP A;  4RHR A;  1JOK A;  4L63 B;  2Q8T A;  3TSS A;  3L3O C;  4A3F B;  1G2S A;  5EGT A;  3HEJ A;  4KJN A;  3D3R A;  2B2T C;  5IIF A;  2K05 A;  1Y1V B;  3E0J A;  4I65 A;  1JIC A;  4DK0 A;  3I4L A;  1HXY D;  1F9R A;  2I07 B;  3L7Z C;  1JWM D;  1LO5 D;  1CZG A;  3I70 A;  1S5E D;  5DM6 3;  5F2D A;  4QMG A;  3S2H B;  4H13 C;  5KND A;  2K03 A;  3AB9 A;  2ZXO A;  1V1O A;  3RUZ A;  1OXX K;  1EY5 A;  2SNS A;  4R8I A;  1GJX A;  2A74 C;  4MHE A;  1GOZ A;  2PZT A;  2K04 A;  1E0B A;  5G3L F;  4PQX A;  3GTO B;  4YIJ A;  4NW2 A;  5I2Y A;  1T5E A;  1VCI A;  3H6M A;  3S1M B;  4ZK9 B;  1IW7 D;  1HUN A;  2B2V A;  3M7G A;  3D31 A;  3S1N B;  4HED A;  1AW7 A;  1SEB D;  4Q5V A;  2ZXR A;  2XSC A;  1XWE A;  2KEC A;  4DAV A;  4Y7N B;  3SDZ A;  4RGT A;  5FO9 B;  3V2T A;  2R92 B;  1DYQ A;  5JPM C;  1JOR A;  3VR5 A;  2F0W A;  3QB3 A;  3WDN A;  1EIG A;  1A3T A;  3DHQ A;  1PYW D;  2PW5 A;  2F0J A;  5JEA H;  5CBA E;  5C3X A;  2YU9 B;  2TSS A;  1D1I A;  2A68 C;  3MFY A;  1R9T B;  3EQL C;  3TZU A;  2SNM A;  3NBH A;  2QEJ C;  1UAP A;  2BE5 C;  3WOE A;  4E6I A;  2ZT9 C;  2IJ0 A;  1MI2 A;  1EYC A;  1A2T A;  1T5X D;  1SYF A;  5NUC A;  3T16 A;  2VUM B;  1B1Z A;  4PNY A;  1EZ6 A;  1KLG D;  1E2W A;  1FGB D;  1B50 A;  3I4M B;  3MXP A;  4EQN A;  1RD9 D;  4ZKC B;  1Y8N B;  5IGB A;  1SFO B;  4FNF A;  3C2P A;  4F88 A;  4OO1 H;  1HRJ A;  2EYH A;  2JA7 B;  1TWA B;  1IW7 C;  2O2L D;  2LS0 1;  5EKL A;  4G7O C;  3M3Y B;  1R4Q B;  4K5W A;  1RTN A;  1CM9 A;  2LFN A;  4ZRZ A;  4IAL A;  1QNU A;  1HPC A;  3ERO A;  2D62 A;  5HGT A;  4IUR A;  1SYE A;  2EYO A;  4KN4 C;  3HOY B;  5CV8 A;  3QWN A;  3BZD B;  1SE4 A;  1EWH A;  1BQQ T;  4IUP A;  4N9P A;  3A8J E;  1F77 A;  5BN3 A;  1IL8 A;  2Z1C A;  3R3O A;  4DXF A;  4PMC A;  1GXD C;  3BDL A;  4RH6 A;  3H3V C;  2HDL A;  1SXT A;  1SJH D;  4K5V A;  5FO8 B;  4XYQ A;  5C3E B;  1LAC A;  2IL8 A;  4LAA A;  4WRD A;  4A3D B;  1STA A;  2F0H A;  3HKZ B;  3U9S A;  1RF2 D;  2A6H C;  3SK5 A;  3P7J A;  2OEO A;  1X3P A;  3OW7 A;  3OHX C;  5C0X G;  5C0X I;  3I73 A;  2R6G A;  3MEH A;  1AZP A;  3TBI B;  1NUC A;  3NUC A;  2EYL A;  4K6L A;  2F0L A;  3BVM A;  3HRZ C;  2F0M A;  5J1Z A;  2IX1 A;  2R93 B;  3TP5 A;  4A3J B;  4C2M B;  4KV6 A;  2ICI A;  5EPK A;  1I4G A;  3I3C A;  2B2Y C;  3BYY B;  2EY5 A;  1B2T A;  1CQF A;  1MGS A;  4WFN 3;  1A3U A;  2FFK B;  3GV3 A;  2CW0 C;  2JEB I;  3P75 A;  2MHV A;  3HZX A;  3KBG A;  3M85 A;  3HS0 C;  1B4O A;  2EYJ A;  2EXZ A;  4JBW A;  1SE3 A;  1RJT A;  5CC4 A;  3MTS A;  2QIL A;  2E76 C;  4IUQ A;  3QO2 A;  1SND A;  5IT9 E;  4XT3 B;  4RWS C;  3D4R A;  5JVG 3;  2K1B A;  2M9V A;  1HFG A;  1EQT A;  5LHY 1;  2MPM A;  1EFI D;  5EJW A;  1I4H A;  1A3V A;  3NTK A;  1LV9 A;  2PZW A;  1G29 1;  3GTP B;  3PO2 B;  2KCN A;  4NKL A;  2JA6 B;  4RGN A;  1Q3L A;  3SK8 A;  3LWE A;  2E2I B;  3J81 L;  3V96 A;  1BUV T;  2EVB A;  1C48 A;  1LLR D;  1BCP B;  3X3M A;  2QDB A;  1PRT C;  1VMP A;  4K2L A;  1RCV D;  1TWF B;  1EY8 A;  2WKC A;  4K8I A;  1TII D;  4F8M A;  1B44 D;  2WV6 D;  5E4W C;  1I4Q A;  3ONA B;  5I6W A;  4BA2 I;  2RQX A;  1L0Y B;  1SNO A;  4OHJ A;  1SBB B;  5KGU A;  4XT1 B;  1PRT F;  2KCC A;  3AU7 A;  2FMM A;  1RTO A;  5FOB B;  3S17 B;  2Q8I B;  4X3U A;  1IHZ A;  4HCE A;  3MZ5 A;  5CV7 A;  1S5F D;  3FRP B;  1ESR A;  2NVY B;  3MWY W;  4FF1 A;  2R61 A;  4G7Z C;  3PUX A;  2ID0 A;  4U68 A;  1TU2 B;  1DM0 B;  3PIP 3;  3A7L A;  1DOM A;  2IW3 A;  4ZUJ A;  2PZU A;  4LMQ D;  2MGS A;  1V1P A;  1Q8I A;  2MJ8 A;  2QKI C;  1F9P A;  4KHZ A;  4EQO A;  3J7A F;  4K14 A;  2F0G A;  1IYV A;  2KA7 A;  4OIK A;  1TKW B;  1I6V C;  4S3S A;  3LWU A;  4CBV A;  2RSO A;  1V1P B;  2XWB B;  3GTG B;  2NTT A;  2GA4 B;  4XQQ A;  1A6X A;  1R4P B;  2TMP A;  1QNK A;  1HHV A;  1PTO B;  2Z4H A;  3HOW B;  1SYG A;  3E6Z X;  5JEA G;  3H0G B;  1PTO H;  3SXH A;  1TQO A;  2DY7 A;  4NMZ A;  2Y0S B;  4QUF A;  1Y8P B;  5G3L D;  1JE4 A;  2J4X A;  4R9W A;  3NTH A;  1J8I A;  1TWC B;  1ENA A;  1SDF A;  4K5X A;  2HCI A;  3K5N A;  5EBC A;  3CHB D;  2J0T D;  4IFD G;  5JPN C;  3MC0 B;  4DNT B;  2B63 B;  1SSO A;  2E74 C;  2N55 A;  3IKJ A;  1U4M A;  1DD2 A;  1TY0 A;  1QOH A;  1U4P A;  3VA5 A;  1DOK A;  1H9S A;  3FDT A;  3TP6 A;  3IFD A;  2KUM A;  4DXG A;  2A6E C;  2X6L A;  4OO1 I;  2F0D A;  1TY2 A;  2XWJ B;  3FMC A;  3EJI A;  3EFX D;  3K6O A;  3W3A A;  1H9S B;  3HOX B;  4CKB A;  3VYS A;  2E2D C;  3SR1 A;  3SVM A;  4ZUI A;  1C8C A;  2N88 A;  2PCF B;  2JYO A;  5ELF A;  4IUV A;  3R93 A;  4C3H B;  1E2Z A;  3MXU A;  1CQV A;  2A68 D;  1ENC A;  1DOL A;  3FEW X;  1LAB A;  2BE5 D;  2L5T A;  4O42 A;  2IX0 A;  3J7A V;  5C6A A;  1D5X C;  3KUP A;  1OXS C;  1KAB A;  3NQT A;  2RKS A;  3NQI A;  2EOT A;  4CJ0 B;  2B8G A;  4Z9C B;  3DWA A;  3DMU A;  1H9R A;  3HGB A;  5EQ0 A;  1HA6 A;  2EJG C;  1LTT D;  2XRQ D;  1FD7 D;  3IL8 A;  4C3I B;  3H91 A;  3K5O A;  2F0O A;  2CQA A;  5C0X J;  1H9K A;  1EY0 A;  4O1N A;  1HCZ A;  2F0K A;  1STG A;  1BR9 A;  1Z47 A;  1Z6H A;  1SNP A;  2L4N A;  5E4X A;  3H94 A;  2AUK A;  5I9P A;  2F0N A;  4RCN A;  4NP5 A;  4CHT B;  4ABN A;  1CT1 D;  3OWF A;  2JXM B;  4FO2 A;  3R2T A;  5D3D A;  1BF4 A;  1ZKO A;  4ULL A;  3TDQ A;  4TSS A;  3EA6 A;  2AQ1 B;  3K5L A;  2B2V C;  1DZ1 A;  1G2T A;  2NB0 A;  4CJ1 B;  2Z4I A;  3E5S A;  5K36 G;  4KK7 A;  5KEE A;  5M5Y B;  2KJX A;  3Q22 A;  4QIW B;  3DM1 A;  2NTS A;  1OXV A;  1OXU A;  1X32 A;  3GTL B;  3NK9 A;  1FNW A;  3PV0 A;  1EWC A;  3TME A;  2NN6 H;  2A6H D;  4EVO A;  1QIL A;  1MBY A;  1WTW A;  4DN4 M;  1GUW A;  1WTP A;  1W6K A;  5A35 A;  5EBD A;  5IGE A;  3S14 B;  4KN7 C;  2NVT B;  1OXT A;  1VDZ A;  1HA5 A;  2G9H D;  3CKI B;  2X6G A;  2F03 A;  4ZQ3 A;  2F0S A;  3VYU A;  3MXG A;  4V0B A;  1G6Z A;  3RLF A;  2YYZ A;  2AQ3 B;  5EKK A;  4IN3 A;  2EYF A;  2CW0 D;  1WTX A;  1Y69 U;  3J80 E;  2DNE A;  2C5C A;  3JAM L;  5A2Q L;  4FVM A;  3R8B A;  3ND8 A;  3A54 A;  2EYM A;  5JVH 3;  4M8A A;  4U67 3;  1ZYR C;  1VF7 A;  2NVX B;  1V8Q A;  1X3Q A;  4M1U B;  3H09 A;  1YNJ C;  3IFT A;  4XQN A;  2MUY A;  1ESF A;  1L0X B;  3S1R B;  1WTV A;  4HR7 B;  1QB5 D;  4FXD A;  1ILQ A;  1SYC A;  1EOT A;  2NYZ D;  3T4A C;  1LTS D;  2CVR A;  3GQB A;  4H44 C;  3D4D A;  3TN2 A;  2B2Y A;  1O7Y A;  1Y8O B;  2EPB A;  3QJY A;  5DEH A;  1PRT D;  4I7Z C;  1S5B D;  2F3V A;  3TP7 A;  1SNQ A;  3DUZ A;  5C44 B;  1GUO A;  1STE A;  4PMB A;  3BDO A;  1IKM A;  2XN9 C;  5JJZ A;  3PUY A;  5C3W A;  4J8Q A;  5BN4 A;  5DNF A;  5KYI A;  4B9W A;  1JWS D;  2RSN A;  3K0Y A;  3MFG A;  5JEA J;  3RZO B;  5FLX L;  1JC7 A;  1STY A;  4J1M A;  1B9N A;  5COY A;  4HMI A;  1SE2 A;  1BNZ A;  3LNN A;  3VR3 A;  5D14 A;  3S15 B;  3FKI B;  2BDO A;  2AQ2 B;  3VYR A;  1A2U A;  2JSO A;  2F0Q A;  1O78 A;  1JOQ A;  1B3A A;  2KED A;  1TT2 A;  5C5M A;  1S5D D;  1KTK A;  4IFD J;  4Q0F A;  3BG3 A;  2B2W C;  4BBS B;  1D5M C;  4X3S A;  3A8I E;  1J9O A;  5CV9 A;  2F0I A;  5M3M B;  4ZKB B;  3MHB A;  3MXN A;  5M3F B;  1DXM A;  1LTB D;  3T53 B;  1I4X A;  1F2Z A;  1HQM C;  2K32 A;  2NZ1 D;  2F0P A;  2PMZ B;  1FNU A;  4FXG C;  1ICW A;  4XTC S;  2SDF A;  3SK4 A;  5I9O A;  3UI2 A;  4RKB A;  2PYK A;  1BXT A;  2VB3 X;  5C4H A;  2WP8 J;  1EU3 A;  5M5W B;  1UEA B;  5ELC A;  1EY7 A;  3Q0A A;  1VF5 C;  1AN8 A;  1HTL D;  1D5Z C;  3BYT B;  1PRT B;  1JB3 A;  1STB A;  1U4R A;  3FVQ A;  4KJO A;  4KKS A;  4RCO A;  5CMD A;  1DON A;  1BCP C;  4RGM A;  3MA2 B;  2LY7 A;  4KY7 A;  3Q24 A;  4A3M B;  2R3Z A;  3VA7 A;  2ENB A;  3OPO A;  1BCP F;  5IOC A;  3M4Y A;  2RDG A;  1V43 A;  1STH A;  5D3I B;  2I46 A;  2VXW A;  3RD4 A;  3NPP A;  4DAY A;  2BA1 A;  2FMC A;  2J7Z A;  3KLS A;  1JWU D;  1TVX A;  3N52 A;  4RHS A;  4HTH A;  1XTC D;  3KK7 A;  2WAC A;  1EY4 A;  4HN7 A;  1KDA A;  2BOS A;  1M8A A;  2L0C A;  1ONL A;  2A6E D;  1FR3 A;  4BY7 B;  2EJF C;  3CU7 A;  3GD7 A;  1IYU A;  2F4I A;  5CR3 A;  4MN3 A;  2OXP A;  1WD0 A;  3M4O B;  4C1N I;  2AWO A;  1XYI A;  1CA6 A;  4HSP A;  4XXE A;  2XVS A;  1O80 A;  4HCS A;  5COR A;  5K5P A;  2LMC B;  3WOF A;  1YNN C;  1E2V A;  3HP3 A;  3GV6 A;  4EQP A;  3BVG A;  1NCV A;  1U4L A;  2B2U A;  4B9X A;  2ZXP A;  4CKC A;  1O7L A;  1PFM A;  1PFN A;  1AZQ A;  1MSG A;  5IGD A;  1PTO C;  1G8Z D;  1TS4 A;  2FJ2 A;  5JOB A;  4BWG B;  4PMW A;  4OIJ A;  5FK9 C;  2ICE C;  4WJW A;  1CI3 M;  4N9T A;  2SEB D;  2EY2 A;  1CFM A;  2NN6 I;  1PTO F;  4K8J A;  2E75 C;  2RVL A;  3GTJ B;  3NWT A;  3OMC A;  2V4D A;  3G6J B;  1PLF A;  1EY6 A;  5EKI A;  4IQZ A;  3NBI A;  4A93 B;  1CA5 A;  2K5Q A;  5EPL A;  2HQE A;  4DGZ A;  1ZXT A;  2BA0 A;  5M9O A;  4OO1 G;  2HDM A;  4B08 A;  2IPK D;  3OSO A;  1EZ8 A;  1WTO A;  4IUT A;  1I4P A;  2L11 A;  3K5M A;  1GUG A;  3T56 B;  3TP8 A;  5AFW A;  1LTG D;  1TWG B;  2F0V A;  4FF3 A;  2B2T A;  3GTK B;  2WII B;  2BDN A;  4XYO A;  3OMG A;  1EQV A;  5J39 A;  4DFA A;  4LK1 C;  3SHL A;  3T13 A;  4L6T B;  4DAP A;  3SK6 A;  2L55 A;  3NSW A;  2A73 B;  1LTI D;  3PIO 3;  4KI0 A;  2K5W A;  3NXW A;  1D1K A;  3BVZ A;  5ISR A;  4DA2 A;  4CKE A;  1WTQ A;  1K83 B;  1EYA A;  5JAV A;  1NSN S;  3SEB A;  3F2U A;  3RMH A;  4XDX A;  4XIG S;  4OGQ C;  1D6E C;  1I50 B;  4IZ8 A;  4BA1 I;  2LKV A;  1UNS A;  1NR4 A;  1U9R A;  3A55 A;  4J6H A;  4FF2 A;  2A69 C;  4DNR B;  3PO3 B;  2EJM A;  1QCB D;  2L9H A;  3HOU B;  5E1F A;  1GUN A;  4G7H C;  3LX0 A;  4MIU A;  3N6R A;  3Q23 A;  3S1Q B;  3P20 A;  3J81 E;  1UUP A;  1Y1W B;  1W6J A;  5CGK A;  5C5L A;  2D2C C;  4AYB B;  2EY1 A;  2F0E A;  3QG1 A;  4ILW A;  3P1H A;  1O7Z A;  5KNB A;  5IT9 L;  1BBX C;  1PZK D;  3ND9 A;  5IGG A;  1HUM A;  2A5H A;  5DAU A;  2IWH A;  3VR2 A;  2KHS A;  1H9J A;  2PO4 A;  1K8M A;  4G57 A;  4ZLT F;  3W2D A;  2WKD A;  2PNR C;  1FNV A;  3S2D B;  1XX8 A;  2OF1 A;  2H1E A;  5CV4 A;  5ELE A;  1LT5 D;  1ROD A;  3FPP A;  3A56 A;  1TWH B;  1ZYR D;  1KAA A;  4KTA A;  2WIN B;  2NUC A;  4KY5 A;  4A3K B;  3QIA A;  3PUV A;  3OWE B;  5CV6 A;  1K8O A;  3MVV A;  4K2K A;  4ME5 A;  1SMY C;  1YNJ D;  1RKN A;  2O5J C;  3SE0 A;  1DJR D;  3OIP A;  5C4Z A;  1AFP A;  4JK1 C;  5I2X A;  3NWS A;  1LT6 D;  1EU4 A;  4QUC A;  1GHJ A;  2G9D A;  5FKA C;  3I90 A;  5ELB A;  5M5X B;  3EVQ A;  4KKU A;  3URY A;  3NP8 A;  4OL7 A;  4HSV A;  2DY8 A;  2B8F A;  4C3J B;  3V05 A;  4PV1 C;  1AP0 A;  3DEO A;  2BCO A;  4IFD H;  4ZYS A;  3ERQ A;  1EEF D;  1M4V A;  4F87 A;  2F1M A;  2B39 A;  1TR5 A;  4V19 0;  4ZAI A;  3D4W A;  4QF4 A;  1VMC A;  1PXU A;  4LJZ C;  2AUJ D;  4A3B B;  3C1F A;  4RAU C;  4HMJ A;  5D65 A;  4FYD A;  1Q12 A;  1GUT A;  3DEP A;  2DN8 A;  4A3I B;  2PQE A;  4BS9 A;  3OOC A;  1EIH A;  2PPB C;  4K6D A;  4L8J A;  5EPJ A;  3NE5 B;  3RZD B;  3I4N B;  3CRL C;  2QF7 A;  4KMU C;  1F2Y A;  5LL6 X;  3U9O A;  2HCC A;  3D8G A;  2L1B A;  2XNA C;  5BN5 A;  1KDB A;  4GZY C;  1SNM A;  4A3E B;  3CRK C;  2WB1 B;  1F2L A;  4DU9 A;  1GUS A;  2L12 A;  2RDH A;  5E3F A;  2KEE A;  1JCK B;  1LT3 D;  2PW7 A;  4FF4 A;  1KLU D;  3HOV B;  2D5D A;  4RKL A;  3K59 A;  2IX3 A;  4R8N A;  1CHQ D;  1Z7T A;  4WOR A;  5IOD A;  2VB2 X;  4TQU S;  3K58 A;  3K57 A;  3A7A B;  4BY1 B;  2EZV A;  1PZI D;  3VYT A;  3I8Z A;  3TZD A;  1GHK A;  1QE6 A;  1BCP D;  2K28 A;  1PZJ D;  5C4J B;  3HG9 A;  1EY9 A;  5T1G A;  1S5C D;  4P2C B;  1KNA A;  1SYB A;  1EL0 A;  3IAY A;  2IT1 A;  2Q8R E;  2JEA I;  2SOB A;  3ZYY X;  1KNE A;  2Z8L A;  1LTA D;  2XRS D;  3VR4 A;  2K6A A;  3R2I A;  1B9M A;  1HQR D;  3D6W A;  2E2H B;  1I4R A;  2JA8 B;  5FO7 B;  2B2W A;  4KHV A;  3C46 A;  1CTM A;  1DCZ A;  5K36 H;  5C4X B;  2WAQ B;  2NVQ B;  2RA4 A;  2K5D A;  3NTI A;  4RGO S;  1TS3 A;  1SNC A;  4UDU C;  2KVM A;  2NWG A;  4IUN A;  2EYP A;  1WVL A;  2K7V A;  1JOO A;  3CQZ B;  1Q1E A;  1BDO A;  1PFB A;  5KRU A;  5DM7 3;  2M2L A;  2KQ3 A;  1YNN D;  1S4Z A;  1EYD A;  3NHH A;  3J7Y W;  1STN A;  4H7B A;  4X3K A;  4BBR B;  5I4D A;  1SYD A;  5TSS A;  4C56 C;  4ODG A;  5I6Y A;  2MP1 A;  1PMR A;  1B53 A;  1ILP A;  3KF8 A;  4A3G B;  1C4Q A;  5CYU A;  5CV5 A;  2VNU D;  1PTO D;  3DWQ A;  4C1N K;  4XQJ A;  2KOL A;  1ET9 A;  1QJO A;  4C3H G;  1II3 A;  4DK1 A;  1CZW A;  1KDC A;  1WD1 A;  1ML0 D;  2AWN A;  3KBX A;  3BDC A;  3HOZ B;  2DNC A;  1EEI D;  1OO9 B;  3FPU B;  3S16 B;  3KLR A;  4EGV A;  2OT2 A;  3QOJ A;  3I72 A;  5IGF A;  4KD4 A;  3KLS X;  1HFN A;  4KD3 A;  3Q6S A;  5ELD A;  1JQY D;  2D9U A;  3O13 A;  1F9S A;  4ID6 A;  2JP1 A;  4C3I G;  4QCL A;  5KNC A;  3PMF A;  1ET6 A;  5HUR A;  3GP7 A;  4CGY B;  1A15 A;  3BS1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...