3C1EA

Crystal structure of staphylococcal nuclease variant delta+phs l125k at cryogenic temperature
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
131
structure length
131
Chain Sequence
b'KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLKRKAEAQAKKEKLNIWSE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS L125K at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 36
structure length 131
sequence length 131
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2008-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3c1eA00
3NUCA 3EVQA 4HMIA 3DHQA 4OL7A 3DMUA 3ERQA 4F8MA 5I6WA 1STHA 5IODA 1KDCA 2F0MA 3D4DA 1KAAA 4KD4A 2EY5A 3T13A 2F0NA 2ENBA 4NKLA 5J22A 5C4ZA 4HMJA 4RKLA 1NUCA 3D4WA 3OSOA 5EGTA 4YIJA 3TMEA 4EVOA 5C3XA 4HTHA 1EY8A 3NP8A 4J1MA 4NDXA 1STAA 5IGBA 3NK9A 1STGA 4DGZA 2F3VA 5CV5A 3TP7A 4WORA 1SNDA 4LAAA 1JORA 5IIFA 1TT2A 2RBMA 3SK4A 4NMZA 3TP5A 1EY5A 3MVVA 5C6AA 5NUCA 4KHVA 4QB4A 3D6CA 2WACA 4QMGA 1F2MA 2EY1A 2PZTA 3EJIA 2SNMA 2F0TA 3HEJA 3TP8A 3P75A 4ZQ3A 2RKSA 3SK8A 2KHSA 4PMCA 5KGUA 4K2LA 4WRDA 5CV6A 5EKKA 1EYDA 2EYMA 4KTAA 1F2ZA 4J6HA 4E6IA 4MIUA 4ID6A 1ENAA 5EKLA 2OF1A 3QOJA 4B9WA 4I65A 4EQNA 4KD3A 4B9XA 2SNSA 2KQ3A 4IZ8A 2F0EA 5C5MA 1A3TA 4R8NA 1SNCA 2F0QA 1EY9A 5IGFA 2F0OA 4ZUIA 1EY7A 3T16A 2EXZA 4DFAA 5KIXA 5DEHA 1SNPA 2EYOA 3SR1A 3SXHA 3QB3A 5M9OA 1AEXA 2EYLA 1SYEA 3NQTA 4RKBA 4KY5A 1SNQA 2F0FA 2QDBA 5JOBA 2PQEA 5IOCA 5IGCA 1RKNA 1JOOA 3R3OA 1EZ8A 2EY6A 4K8JA 4K5WA 4NP5A 5CV7A 5KEEA 2M00A 4KJOA 1EYAA 1KDBA 2EY2A 5F2DA 5I9PA 3LX0A 5CV9A 1TQOA 3SK5A 1KDAA 3V2TA 3BDLA 5IGEA 1A2TA 1KABA 5CGKA 3C1EA 4K6DA 5IGGA 1NSNS 2PYKA 1TR5A 4ODGA 3ITPA 5DAUA 3SHLA 5KRUA 1STYA 1STNA 1SYFA 1A2UA 2F3WA 4DF7A 1SYDA 3MHBA 4KY6A 2SOBA 4PMBA 3MEHA 5C3WA 2LKVA 1A3UA 5KYIA 2F0VA 1JOKA 3EROA 4PNYA 5CC4A 3NHHA 4TRDA 2EYJA 2F0UA 3QOLA 3MXPA 1ENCA 3VA5A 5IGDA 3NXWA 5I6YA 4ZUJA 4F7XA 2HQEA 5J39A 5E1FA 1EZ6A 2F0IA 2F0WA 4KJNA 5CV8A 4G57A 4H7BA 1EYCA 1SYBA 5J1ZA 4IALA 2PW7A 4K2KA 4QF4A 2F0LA 2RDFA 3D8GA 4K5VA 2F0GA 3MZ5A 1II3A 1STBA 1U9RA 4N9TA 1JOQA 2F0KA 3P1HA 1EY6A 5ISRA 3H6MA 2EYFA 4EQOA 2O4XA 5KYLA 2PZWA 2PZUA 5C5LA 3S9WA 1EY4A 4IUNA 4S3SA 5I9OA 5CV4A 4KV6A 3RUZA 3OMGA 2OEOA 2F0PA 1IHZA 4EQPA 2PW5A 5HGTA 3SK6A 1SYCA 1SNOA 1F2YA 3BDCA 5HURA 1SNMA 2F0DA 4K5XA 1EQVA 5E3FA 4K8IA 3C1FA 2OXPA 2NUCA 3PMFA 4K14A 5JAVA 1SYGA 5K5PA 3OWFA 1A3VA 2EYPA 5CR3A 3TP6A 2F0SA 3E5SA 4KY7A 4DU9A 5C4HA 1EY0A 2F0JA 2F0HA 3HZXA 4N9PA 3U9OA 4ME5A 3OMCA 2EYHA
chains in the Genus database with same CATH superfamily
1BCPB 3WDNA 2CWPA 1SRUA 1IKMA 1C48A 4ZCKA 4R8IA 2UXDQ 1F9PA 5C3EG 4JOIA 3S17B 4XTCS 1K8AC 2HHHL 3HOVB 4PQXA 2F3VA 4DXGA 2WAQB 4KI0A 1G51A 1BKBA 1BOSA 2KENA 4OWXB 3TP5A 3AMUA 1K8MA 3IKJA 3C2PA 2PZTA 1KC8C 2CH4A 2A68C 4L5SA 1KL9A 2L15A 4PMCA 4K2LA 3T4AC 4X64L 1FD7D 1ESFA 2HDLA 4X65L 3PUXA 2L5TA 3L9AX 3H0GH 1NBWA 2RDGA 3NTIA 3EQLC 4A3DH 1RHPA 1CA5A 1SE8A 1TWFB 1EFID 1YNND 3PO3G 4C3JH 4KY5A 1BQQT 5C4JH 2QDBA 4A93B 2PQEA 2UUBQ 1VMCA 2L0CA 5E4XA 2R92B 1QVGA 4LF9L 3I3CA 4A4IA 4FF4A 4L8JA 1ET9A 2OTJA 1KNEA 4HCSA 2WKCA 5FLXL 4P73A 3GTLB 1Y69U 4IFDH 1TR5A 5T1IA 4A3BG 4KY6A 5JEAJ 1O7YA 5IE8A 2RHQB 3F2DA 5HGQA 4DUYL 4XXEA 3VA5A 3HKZB 2TMPA 1L2FA 2MPMA 5IYBG 4R4OA 2A69D 1E7ZA 3FKIH 4K2KA 4OO1G 2R7FA 3R2TA 2DNCA 2LS01 3MA2B 1H9RA 4RWSC 4B3TQ 3MTSA 3CF5A 5C3EH 1EY4A 4CJ0B 1U4MA 1NTGA 2G5DA 2YTYA 1LUZA 2F4IA 1Y8PB 4DA2A 1XNRL 1EQVA 2CQAA 3C1FA 2N78A 2NBFA 2HIVA 4C3HG 1A3VA 3LNNA 3S1RH 1BDOA 4QJFA 2F0JA 4LFAL 3ZJYC 5I9PA 3S16B 1PTOC 1QNKA 1QUQA 1PH2A 3CW2C 4DR5Q 4TVAB 1CTMA 2DY8A 2F0NA 1A62A 2JSOA 5EAYA 2YU9B 1WJJA 3M4OB 3VYSA 3O13A 1BCPC 1S5ED 2G9HD 4FXGC 5IGBA 1M8AA 3CCRA 4BBSG 4BA1I 2XN9C 3PO3H 5EPJA 2JA8H 3E9IA 1JCKB 1QZHA 3KJPA 4ULLA 4ZQ3A 3I4NB 2V1CC 5KGUA 3E0JA 4E6IA 3X3NA 4B9WA 2C5CA 4KD3A 4Q0FA 5AJ3L 4C3IG 3W5OA 5C5MA 1PH8A 2WP8J 4A3BH 2B29A 1LM0A 3BDOA 4JI3L 4JI6Q 4OXPA 2CKZB 1WYDA 5IOCA 5JOBA 4HIMA 1S5DD 3VYRA 5IGCA 1NCVA 2Z9HA 2DY7A 3ULLA 5IYBH 3LX0A 1MKHA 4KKUA 4OO1H 2HHHQ 3GTMB 1XPRA 2OQ0A 5IGGA 1Q81C 2KUMA 3FVQA 4LF7L 4BY7H 5C0XG 1XJVA 2E76C 3C46A 1CK1A 3MEHA 2K28A 1PH5A 2JQOA 2HCCA 2JXMB 1WCMH 4A3CH 4TRDA 2K32A 2PCFB 1FVIA 4X64Q 1IL2A 1B3AA 4C3HH 4A3JG 4X65Q 1IBLQ 3KF6B 4A3EG 3DXJC 4KJNA 5J1ZA 4IFDI 1B7YB 2I5MX 3E3XA 3MZ5A 2HDMA 4JI7L 3D3RA 1WD1A 3GTPH 2PQAB 1VQCA 2M2LA 1Y1VG 3AEVA 1I6HB 5CV4A 3MEFA 4ZKCB 1V8QA 4H0LC 3CP0A 3S1NB 4LF9Q 3U50C 1VQGA 1B4OA 2KECA 3S1QB 1PYWD 5JAVA 4DNTB 3PO2H 1GUWA 1ZYRD 5LHY1 1HZ9A 4Q5VA 1XYIA 1GHKA 2SDFA 1QILA 2CFMA 1BBXC 2EY5A 4G7ZC 1YNJC 4AH6A 4FNFA 1G6PA 4X3TA 5COYA 1BUVT 3NWTA 3E9HA 4EX5A 4DUYQ 2B2VC 2F03A 4NMZA 2R93B 3NEMA 5IYCG 4DK0A 2MUYA 4KHPL 1QG7A 1QOHA 2RKSA 4DR4L 4JYAL 2BDNA 3Q24A 3DEOA 1Z9FA 1JWSD 1W6KA 3RMHA 3I70A 1XNRQ 2YTVA 4YWLA 1EY9A 5A35A 1JJGA 2IX3A 4DAYB 1PH7A 1AEXA 4LFAQ 3CPFA 1CKNA 3CMEA 5IWAL 1IYJB 1DYQA 4K8JA 3C3LA 4X6AH 2QF7A 1SMYD 3H0GB 3U4VA 1H9KA 2Y0SE 4A3JH 2VZAA 2K14A 3Q0AA 3J7AV 2XNAC 2F1MA 1JJ2A 3BDLA 1YBYA 1ESRA 2PMZB 2E74C 4K6DA 4ZLTF 1ILPA 2VNUD 4H02A 2EDGA 3OTOL 1E2ZA 2RF4A 4PMBA 5M5WH 1VQMA 2LKVA 4J8QA 1O7IA 1LTLA 2XVSA 5KYIA 1AH9A 1R9TB 2K75A 1XTCD 1MSHA 4QUCA 3I7FA 1HR0L 1CKMA 5C0XJ 5JJZA 2EPBA 4OO1I 4IUQA 1UAPA 5AFWA 5FO8B 1SMXA 5AJ3Q 3Q23A 4A3MH 1PH1A 4P75A 4JI3Q 3GO5A 3KLWA 3HOZH 1WOCA 4IJLA 5I4DA 4ME3A 2QGQA 4KV6A 3RUZA 1LTBD 4BBRG 1RDPD 4K8IA 4JPBW 3M4QA 5IYCH 5C3EB 3BZCA 3DHQA 3J81E 1EOVA 1I5FA 1U4RA 4LF7Q 4CKEA 4POGA 4C2MB 4KD4A 5C44H 3MXNA 4NKLA 3NTHA 1KRTA 2AMCB 4IJHA 2PNHA 1I50B 2JYOA 5FLXc 2Q2UA 2M9VA 1HR0W 2N49A 5IIFA 3D6WA 3EIVA 3CAMA 2JN4A 3KLSX 2J4XA 1B8AA 2DJGC 4GNXA 2EY1A 4KKTA 1SLJA 3SK8A 4JI7Q 5CV6A 1XWEA 4MZ9A 3STBD 3CRLC 1VDZA 2K5HA 4LFCL 1AN8A 1UEAB 3PO3B 1CI3M 1Q7YC 2OCEA 1LTSD 4RGMA 2F0OA 4R4QA 4RCNA 4ZUIA 2K03A 2MO1A 4ZYSA 1BVSA 3J80E 2ZM6L 2EYLA 5EKIA 1SDFA 1CQFA 1SNQA 2KA7A 3I4LA 5KNBA 2KCMA 1JOOA 3R3OA 4GOPB 1UUPA 2YYZA 1Z47A 3R2IA 5DLQE 4A3BB 2EY2A 3SK5A 1IW7C 3OIPA 3VR2A 4TQUS 4IUVA 3D31A 3VR3A 3SEBA 3WOFA 1M90C 1QWYA 4ABNA 4XT3B 1STYA 4BXXG 2R6GA 3KF8B 4A3KB 3H15A 1A0IA 4PZ7A 2E2JB 4BBRH 1SE4A 4HJ9A 1PH4A 4DR3L 3CCJA 1WTWA 1BO0A 1K8GA 4DR4Q 1F2LA 4HIKA 4JYAQ 2XWBB 1RTOA 1V43A 3UE0A 1E22A 2RDFA 4P2CB 4TSSA 3TS2A 3P1HA 2D2CC 3H6MA 2EYFA 3OPOA 1O80A 4PZ6A 1U4PA 4DAPA 1WVLA 4LNQA 1GM5A 4C3HB 1MSGA 2NVYB 3L0OA 1NJIC 1PLFA 4A3GG 5IWAQ 3VYUA 3E6ZX 3OMGA 1SNOA 3BDCA 2ZJRA 3LGJA 4AIMA 3F2BA 1LT3D 2BE5C 5E3FA 1SE3A 3PMFA 5JJIA 5DNFA 3OWFA 3VR6A 1KLGD 4LUOA 1Z7TA 4GLXA 2ALYB 3DUZA 5ELDA 3M3YB 5JVH3 1I4HA 3ULJA 2MHVA 3KJOA 1STHA 1I4PA 2F0MA 4IPDA 4IUTA 3GDEA 3OTOQ 2GN5A 4BBSB 1PV4A 3NBHB 3JAML 5J22A 4FVMA 3BU2A 1LT5D 2CH4W 1JB3A 5CBAE 2NVXH 3KK7A 3BZKA 4GN4B 5KNDA 1HR0Q 1PH6A 5ELBA 2O2LD 3CCUA 3RZDB 4C3IB 1JR0D 4DPGA 1RL2A 4HJAA 5GAGC 1CSPA 3GTQB 4GLAC 1P16A 4CBVA 4K0KQ 3PIOA 4BXXH 1ENFA 5KIXA 5DEHA 1KTKA 3SR1A 3JAMi 5IP7G 3UDGA 3KDFA 4UP7A 4RGTA 4KJOA 2D9UA 4LW1A 3CC4A 1CFMA 2NZOA 1PYSB 1TQOA 3PUWA 3V2TA 1F9SA 1HJPA 2N55A 1OTCA 4GOPC 5JJKA 3SHLA 4C1NK 2UUAL 2A6ED 1A2UA 1HCZA 3GD7A 2KOLA 3HRZC 3TS0A 5JPNC 2AQ1B 1FYCA 2AUKA 4A3EB 1RTNA 3K81C 1A3UA 2P5ZX 4JBWA 1I94L 1GO3E 4FO2A 2F0UA 4WFN3 3NXWA 3A0JA 3Q6SA 1KRSA 4LFCQ 2AKWB 5LMUL 1TS3A 3FPUB 1Y1VB 1YHAA 1CSQA 4N9TA 2AWNA 1S4ZA 2Y0SG 1KNAA 3S24A 4DK6C 2Q8IB 2ZM6Q 3T1HL 1WTPA 1VQKA 1HFNA 3SDZA 3MXUA 1BXTA 3J7ZC 2KCNA 1MIUA 4A3DG 1F2YA 4C3JG 5L37A 1EYGA 1HZCA 2ZXPA 3S14H 2UXBL 4OWWB 3U9OA 4UDUC 1JB7A 3EVQA 2K5DA 5I6WA 3S2DH 1XPOA 4XQNA 4QIWE 2RA4A 1H9SB 1S5CD 2ENBA 1PRTF 3A8KE 3K0YA 4IFDG 1W6JA 3TMEA 1NUCA 1JC7A 5C3XA 4R1JA 3F2UA 4DR3Q 2K01A 2QILA 1EY5A 1EU4A 1KQSA 1E24A 3B6YA 3CCEA 3PF5A 4A3IB 3DWAA 2XRQD 5G3LF 2VQFL 4JVZA 3FKIG 3QOJA 2F0EA 3V96A 4KK7A 5BN4A 1MD2D 4DV4L 3FDTA 1GUNA 3CXCA 4UHVA 4KN7C 4HJ8A 3K7UC 4HCEA 4OWTB 1K3RA 2F3IA 3GTJH 2OWOA 1PFBA 2I46A 3IL8A 5J3BA 3GV3A 3LWEA 5EBDA 3HS0C 2BA1A 1TWAH 3K57A 1RD9D 2A68D 4DAVA 5M3FG 3RZOB 1STEA 4XYOA 4R4TA 1KABA 3NWSA 2E2IH 1A15A 4HN7A 3ITPA 2ZT9C 1BR9A 1HHVA 2VW9A 3BZDB 2K7VA 4WJ4A 2O5IC 2BDOA 2D0OA 2WAQE 1DD2A 2JA8G 4A3FB 1PZID 5IGDA 3QWNA 4HAEA 3T1YL 1JQYD 1QB5D 5A2QE 4LF4L 2RVLA 2ZXOA 1TWHB 4BBRB 1HNZL 1LACA 2QEXA 4LUZA 3CCQA 1X32A 5KYLA 2IHFA 2PZUA 2NN6G 1O7LA 2RCFA 1VF5C 1CM9A 4LF5L 3NQIA 4KKSA 2HD3A 1IL8A 1VQLA 3I90A 4DR1L 1SJED 1HNXL 2RDHA 4K14A 1LABA 2J7ZA 2ZTCA 1HTPA 1T9HA 2K33A 1B1ZA 1EY0A 4JC0A 2NZHA 3CHBD 4HMIA 4OL7A 2ES2A 1SN8A 2UUAQ 4RHRA 1SFOH 1L1OB 3MXGA 1I94Q 3NSWA 4BY7G 5IT9L 5C4ZA 1TWCH 1D5XC 3OSOA 4AYBE 4JCVE 3TP7A 4CJ1B 3J81j 1WCMG 1A63A 4RGNA 3MFYA 4A3CG 1YIJA 3S1MH 1VQAA 5LMNL 3RN2A 5D65A 1GXDC 4QMGA 4IFDJ 2F0TA 3HKZE 3G6JB 3P75A 1XPUA 5M3FH 1PTOD 3T1HQ 3H3VC 2NVXB 3ICEA 3IFDA 4EQNA 1RODA 3I2ZA 1VQ9A 3ER0A 4G7HC 1SNCA 4X62L 2EIFA 3GQBA 1EY7A 1EOTA 3T16A 4DFAA 1KLUD 2VXWA 3J81L 4HIOA 1BCPD 2AWOA 2UXBQ 3TQYA 3HFZB 4B3RL 3VA7A 1EL0A 2B2VA 4NXNL 1Q8KA 1S40A 3PO2G 1XNQL 4GZYC 1IYUA 4LF6L 2N8NA 5FLMG 3F2CA 5IP9G 2Z0SA 1YNXA 1FNVA 2PYKA 4ODGA 2A19A 5KRUA 2B63B 4V190 5LMNW 2QW7A 4DF7A 1NR4A 2NN6H 1X3GA 4IO9A 3G4SA 1EWCA 3EROA 1QJOA 2GVAA 3JAMc 4LJZC 2VQFQ 2GA4B 3BYTB 4IPCA 4CDFC 3J81i 4ZK9B 1LO5D 1EU3A 2F0IA 4DN4M 1LV9A 3NE5B 4A3GB 3J80L 3VYTA 1IBKL 3A7AB 1BBUA 1GUGA 3RLOA 1STBA 4DV4Q 2R7ZH 1H95A 2IJ0A 2B2YA 3OWEB 2H5XA 4DV0L 2LY7A 1OXUA 2NTTA 2Z6KC 4O0AA 1Q3LA 5I9OA 1N9WA 2B2WC 2OEOA 3I91A 4OHJA 2WINB 3CRKC 5FOBB 4C1NI 4DV1L 1LTAD 2NUCA 3E5SA 1UNSA 1JJCB 4GN3B 1AZQA 1NY4A 1M1KC 2A73B 3CD6A 3HOYH 3BYYB 3D4DA 2K04A 1JE5A 2HQLA 3BVZA 1S5BD 1SEBD 3J80i 4LK1C 1FL0A 4RA8A 1XXGA 3A54A 3KF6A 3S2DB 1K83H 2G9DA 1JORA 2X6GA 1EQRA 4PG3A 1L1OC 5C6AA 2JA7G 1HNZQ 4BS9A 3PIPA 2PQAA 2RQXA 4HR7B 5M3MG 3TZDA 4KTAA 1QCBD 4A3MG 2FMMA 2EVBA 4MIUA 5FLMH 3PV0A 4UP8A 4LF5Q 2NVQB 3HOXB 2Q2HA 5IP9H 1DZ1A 1YNJD 3J7AF 2E2HB 3HOZG 4GS3A 4DR1Q 1HNXQ 3CPWA 2EYOA 3KBGA 4JI1L 1FGUA 2XIWA 4DUZL 1KXLA 2E2DC 4RH6A 3J7A5 4JI2L 3TZUA 4ZKBB 3A8JE 4DR2L 1XMQL 5CV9A 3U9SA 3EA6A 1NR2A 5IGEA 1N34L 1A2TA 5C44G 2C9OA 3GTJB 5CGKA 5M5YH 1NSNS 2Z4IA 3NELA 3KLSA 3S2HH 3QR8A 1E2WA 5JPMC 4ZAIA 1YI2A 1JOKA 2A8VA 1O7ZA 4X66L 1S72A 1NMGA 1YJWA 2E2IB 2B2UC 1R4PB 2Y0SB 4ZUJA 5E1FA 2OTLA 1FJGL 3OHXC 1MHWC 1EYCA 2WV6D 1SYBA 3T51B 1TKWB 3TDQA 1D6EC 2B2YC 2F0LA 5CC4A 4X62Q 4A3DB 2BCOA 4L63B 4BY1G 4C3JB 4DAYA 2NN6I 5C4JB 3GTGH 2N3SA 2O4XA 2K50A 3HOWG 3S9WA 3PIO3 4CDDC 4DV5L 4NXNQ 1LTTD 3IAYA 1XNQQ 3GTKH 4GN5A 4QGUA 2HUGA 3PUZA 4LF6Q 3Q8DA 2RSOA 4U68A 3EFXD 2JA7H 1ASZA 3HOVG 1G8ZD 4B3ML 3M7GA 2KEEA 3G48A 2WAQG 2B3GA 3ERQA 2EQSA 3ZYYX 1E1OA 5M3MH 2JE6I 2PMZE 2A6HC 3RLFA 1DCZA 1EUJA 2CW0D 3NP8A 3V05A 3NK9A 5ELNA 3ONAB 4DV7L 4RG1A 4G7OC 2RBMA 3FKIB 4MNOA 4R4CA 5C4XH 2EJMA 1IBKQ 3HEJA 1VQ5A 1Z6HA 3ND9A 3OYYA 4WRDA 5EKKA 4DV0Q 2JA5G 4A93G 1SE2A 1FR3A 1IXRA 4I7ZC 3I4MH 1Q1BA 5CBEE 3S1MB 2XRSD 2KQ3A 1X6OA 4DV1Q 4Y52H 3RN5A 2F0QA 3S1RB 2EXZA 2WB1E 3H09A 3PUVA 5DM63 2R3ZA 3SE0A 3ND8A 3W1GA 5EJWA 3PCOB 1VS0A 4AYBG 1D7QA 2EY6A 1NMFA 1PTOH 1A8VA 3HKSA 1TS5A 4DKAC 2QEJC 4P72A 3AU7A 3K7AH 3HKZG 2MNAA 1IYVA 2LXKA 1GUOA 2Q2TA 4BY1H 5KNCA 4LF8L 2JA8B 3HOWH 4WJ3M 1HTLD 1X54A 2B8FA 4U673 3A56A 3DWQA 2EZVA 1N8RC 5IT9c 3S17H 1BBWA 1FNUA 3GP7A 3PQIA 1YVCA 5I6YA 4GKKL 5J39A 3J7YW 3HOVH 1LTRD 2DGYA 3PGZA 4L5TA 2UUCL 1IW7D 2OT2A 2F0KA 5ISRA 4NPSA 1VQBA 2IX0A 2ID0A 4S3SA 2R7DA 3AB9A 3NPPA 2JA6G 4GOPA 5DM73 3G7LA 4JI2Q 2PW5A 1B9MA 1HRJA 2K1BA 4KHPQ 1WTVA 3L2PA 2OXPA 4DR2Q 1PMRA 5GQOA 1RJTA 1P8LA 3HZXA 3J81c 2B8GA 4BY7B 2EYHA 1TWFH 1V1PB 1EFWA 4G4KA 4V0BA 3KF8A 1TS2A 3M85A 1KDCA 2JA5H 4A93H 1ML0D 1WCMB 5FO7B 1OXSC 3I4NG 2FMCA 3DWPA 1G291 2KCCA 4X3KA 4X66Q 1VQ7A 4QQBX 1X3PA 5A2QL 2KHJA 4WORA 3GTLH 2PPBC 4NXML 3CCSA 2SEBD 3TSSA 1ET6A 1FJGQ 1G6ZA 1K0SA 2XGTA 1I6VC 2BE5D 2EXDA 2SNMA 4CKBA 3GTPB 1Q82C 4OIJA 1XMOL 1PRTB 1HZBA 1K83B 4ILWA 1GHJA 4DV5Q 4I65A 4TKOB 1R4QB 4UP9A 3T53B 1A3TA 1TVXA 2IPKD 3PO2B 3J80c 2CQOA 1B70B 4B3MQ 3HOUG 3MWYW 1F77A 1B9NA 1PA6A 1D5ZC 2IWHA 3CQZH 4XYQA 3NBHA 2DNEA 4XT1B 3FEWX 4XDXA 1N33L 1Y14B 1G2SA 1VCIA 1TY2A 2MQHA 1KDAA 4N8FA 2FHTA 1L0YB 1OXXK 3IRBA 4F87A 1C4QA 4DV7Q 1ZXTA 5DAUA 3K0XA 5EPKA 1SYDA 2SOBA 4O1NA 2JA6H 1LLRD 1D8LA 1HA6A 2RSNA 1VF7A 3F8TA 3S15H 4C56C 5EBCA 1HZAA 3TRZA 4KLKA 3MXPA 3M4OH 4RCOA 3Q22A 2PI2A 4F7XA 1Q1EA 2E8GA 3DEPA 1WTHA 2A5HA 3CMAA 4QF4A 5NUCA 1U9RA 3FMCA 1EWHA 2PI2E 5GAEC 4BA2I 4A3LG 3I4NH 1ZEQX 1UEBA 4EQPA 4HSVA 4A3JB 1HUNA 3SK6A 1SNMA 3U4ZA 4K5XA 2ICEC 1IZ6A 2VB2X 1MJEA 3TP6A 4YCVA 1VQJA 3E0EA 3K6OA 1F9RA 4ME5A 3AFPA 4RFBA 3DMUA 3I73A 5M5XH 5M5WB 4WJWA 4CKCA 2A1AA 4HJ5A 1X3EA 2B2TC 4RKLA 3NENA 4POFA 1DOLA 1EIHA 1EY8A 3K58A 2ZXRA 1IBML 4APVA 5CV5A 1SNDA 4GKKQ 4QL5A 2XSCA 3HOUH 2O5JC 2EJGC 4A3MB 3RLNA 2H1EA 1H9MA 4IN3A 1F2MA 3QO2A 5ELOA 5JEAG 3G6EA 3HOZB 4PZ8A 4B3SL 1X3QA 2EYMA 4QY7A 1B2TA 2DUDA 4IPGA 1I4GA 1MI2A 2OF1A 1HNWL 3MAQA 2Z4HA 5LL6S 3K5OA 4YWKA 1V9PA 3UE1A 2LFNA 1TXYA 3SXHA 3QB3A 3K5NA 1PRTC 3NQTA 2F0FA 3K5MA 1VQHA 4IOAA 2EJFC 1CKOA 5C44B 2K5NA 1H9SA 4A76A 1I6HH 3W2DA 4RAUC 5F2DA 1YJNA 3S1NH 3S1QH 4IUUA 1LTID 3KUPA 5BN3A 1I4RA 4OGQC 1E0BA 2OQKA 4NXMQ 4A3LH 1D1IA 1NNXA 1LT6D 4P74A 5C3WA 2NVTH 2F0VA 3K7AB 5GROA 2WB1G 2UU9L 3I72A 1EWIA 3KFUA 3PUYA 3HOWB 2AQ3B 3PIP3 4H7BA 4PV1C 2Q2IA 1TS4A 4JG2A 2R93H 3LWUA 1II3A 3A74A 1Q86C 2XTIA 4CHTB 1GKHA 1SR3A 4IUNA 4N8X1 1DONA 4Y7NH 4FP5D 3UDIA 2F0PA 2VY3A 4K6LA 4O42A 3D4RA 2F0DA 4M8AA 1V1OA 2KEDA 4JV5L 1MGSA 1GD7A 1OXTA 1N33Q 2F0SA 4KY7A 2IX1A 2BOSA 2KHIA 4F8MA 5JEAH 5GADC 1ICWA 1IBLL 3EBEA 1K3BC 4FXDA 2CWAA 4MHEA 5EGTA 2VQEL 1QZGA 4NDXA 2Z6KA 1STAA 2B39A 4DGZA 1YNNC 2VB3X 1UE6A 1Q12A 5EQ0A 1TT2A 1TWGH 4HJ7A 2L55A 2JA5B 3SK4A 2B2WA 3TEHB 3HGBA 5E4WC 4JI5L 4H44C 1VQEA 2C35B 2FINB 1R9TH 1C8CA 3PSIA 2K5QA 1ENAA 2R7ZG 1AFPA 4HIDA 4AYBB 2JEBI 1CHQD 5FJ8G 4UPAA 1B44D 5I2XA 2AHOB 1VQ6A 2ATWA 1B53A 1RIPA 1X65A 4DV2L 4H13C 1YZ6A 3ERSX 2AUJD 1KHIA 2RCNA 5LMUQ 3JAME 4A3KG 3FHWA 5CV7A 3K5LA 1PFNA 1VMPA 1L1OA 2A69C 1SJHD 5FO9B 1K73C 3HOYG 5TSSA 2ZTDA 3M4YA 1SROA 3AYHB 2IW3A 4YWMA 1IBMQ 5FK9C 3DLLA 1QUQB 1STNA 1UE7A 4JW0A 3CQZB 1YITA 1FNWA 1CZWA 1HH2P 2JEAI 1J8IA 1MJCA 4C2MH 4M1UB 1CA6A 3K59A 1QNUA 4PNYA 2HIXA 2WKDA 1PTOF 3QOLA 3IFTA 4JI0L 4B3SQ 1I50H 2HQEA 2F0WA 4X3SA 3TREA 1HNWQ 2JA6B 4HEDA 4MTKA 2NTSA 3S15B 4OELB 3QIAA 1BCPF 4JOIC 2V4DA 2PZWA 2K4KA 2Q8TA 1B50A 3CKIB 2CCZA 1EIFA 1JWMD 2A74C 3OOCA 3UDFA 4IQZA 4DR6L 2Q8RE 1ICFB 3EN2A 2JP1A 4DV6L 4N9PA 1AW7A 5ELCA 3OMCA 5C5LA 2B2UA 3A5ZB 3CCMA 4CDEC 3T13A 2NB0A 3MC0B 1D5MC 2R61A 4DXFA 5FJ8H 1QE6A 5IY0A 1STGA 1T5XD 2UU9Q 1ZKOA 5LL6X 1K9MC 5M5XB 1CHPD 1JE4A 3MVVA 4KHVA 1PH9A 4FYDA 4A3KH 3TP8A 2E2JH 4JI4L 2KHSA 1CQVA 2J0TD 3L7ZC 2K6AA 4GKJL 1HA5A 3HOUB 3BJUA 1EEFD 3QG1A 4OONA 4R8NA 3S14B 4JV5Q 2RHSB 1W2BA 1OO9B 1SNPA 4O2DA 2L1BA 1E3PA 1PZJD 4RKBA 1TU2B 3T1YQ 4OEMB 3D0FA 2NVYH 5KEEA 4YY3L 4LF4Q 4MN3A 3T56B 2JJQA 1PDQA 1HQRD 1HXYD 1Y1WG 1EYAA 1KDBA 4RMFA 1VQOA 4FF2A 2FFKB 2VQEQ 2CHBD 3F1ZA 3C1EA 3M3YH 2IT1A 5EPLA 1RCVD 1A6XA 1SYFA 2F3WA 1WTQA 3K8AA 5JJLA 1UWVA 4JI5Q 3X3MA 3NHHA 4BBSH 1Q8IA 4DAMA 5C4XG 1U4LA 1ZYRC 5H1SE 4P71A 2KVMA 1D1KA 2K5WA 1SAPA 1V1QA 5T1GA 2AQ2B 4KHZA 2NVTB 3I4MG 5BN5A 1EY6A 3N52A 3VDYA 3RZDH 3GTOH 4C3IH 4DV2Q 2L4NA 1I4XA 4DNRB 5LMNQ 2VUMG 3GV6A 1TWAB 5HGTA 3GTQH 4F88A 2E5LL 1AE3A 2BA0A 5K5PA 4IURA 1UE1A 3A8IE 1I3QH 5HY6A 1WD0A 1SXTA 1ILQA 1Y8OB 1E1TA 1PFSA 3NUCA 1CKNB 3UDXA 4Y7NB 1BNZA 2L11A 2PO4A 4FF1A 3M7NA 1VQFA 4YHHL 1PZKD 4A3IG 3L3OC 2QA4A 1EQTA 4L6TB 4PMWA 2ICIA 4EVOA 3D4WA 3TN2A 1B3QA 1K0RA 4YIJA 5C0XH 1VQPA 4B3RQ 1L0XB 4HTHA 4JBJA 4J1MA 1NE3A 4JI0Q 4DR7L 5D3IB 2X69A 4IUPA 3G71A 3WWVA 4EQ5A 2GVBA 5FLXE 2BH8A 2LMCB 1C9OA 1SMYC 3D6CA 4X3UA 2EE1A 1YEZA 2L12A 3EJIA 4A3EH 3M4PA 3UI2A 2LSSA 1Y1WH 2MJ8A 1Q46A 2WIIB 1F2ZA 1DOMA 1TWGB 3SVMA 1ONLA 2A6HD 2SNSA 1HQMC 4IZ8A 2NYZD 5BR8L 1DXMA 1Y1VH 2XWJB 3N6RA 5IGFA 1XX8A 5D3DA 5ELFA 4DR6Q 1DOKA 1VQIA 1DM0B 3H94A 1K28A 1SYEA 4DV6Q 1N32L 5K36G 1JT8A 5IT9E 1EZ8A 1SFOB 3VR4A 1S3OA 1LTGD 4ZRZA 2CVRA 2DJFC 1TWCB 4AQYL 1YHBA 1PFMA 4A3FG 4JI8L 1CT1D 1N36L 1SSOA 5JVG3 4DK3C 3KOJA 2R92G 4LFBL 3CCVA 1E2VA 2CW0C 4DNIA 2WB1B 4MTNA 5CMDA 1GOZA 4K0KL 2VUMH 3MXNB 1U0LA 3FP9A 5M3FB 1FGBD 4JI4Q 3BG3A 2NWGA 4UAIA 3I55A 1TIID 2ASBA 4GKJQ 1F9QA 2WFWA 4G57A 3H3VH 2PW7A 3D8GA 4GNXB 2L9HA 2ZTEA 4FXKC 2D5DA 3BVMA 2YTXA 4A3IH 1PHJA 1K8OA 5CORA 4L5QA 2MO0A 4OIKA 1C7YA 1Q90A 1J5EL 3W3AA 3OW2A 4YY3Q 2F4VL 1ASYA 3CU7A 4DK1A 2HT1A 3A55A 4YCUA 3RR5A 1GUSA 1X56A 5E7NA 2VS1A 4XQQA 2K05A 3KLRA 1X55A 3FRPB 4I7AA 2K52A 3STBC 2I07B 1QVFA 4R9WA 3NTKA 1KAAA 1EQQA 3H91A 4LUVA 4CJ2C 4JI1Q 4HMJA 4NB3A 3RZOH 2EOTA 3I56A 4DUZQ 3PF4A 3DM1A 3W1BA 4LAAA 1D2BA 1BF4A 1C0AA 1W3SA 1T5EA 1LT4D 4OX9L 5K36H 2JK8A 2WACA 1RF2D 2MP1A 4A75A 1XMQQ 2R7ZB 2LXJA 1N34Q 1LYLA 3K80C 4JK1C 4FDBA 3P7JA 5CYUA 4B08A 4A3FH 4J6HA 1KD1C 4DV3L 1M4VA 5C0XI 1VQ8A 2R92H 1HPCA 3ULPA 4B9XA 4YCWA 2E5LQ 1KAWA 2N88A 3M9BA 2QCPX 1JICA 2B2TA 2D0PA 1TWHH 3R8BA 2D62A 2MGSA 1V1PA 2B63G 3HOYB 1SBBB 2YV5A 2UXCL 1KIXA 1TY0A 3AFQA 4CGYB 1J9OA 4HSPA 4YHHQ 1S5FD 4Z9CB 1GVPA 1PVOA 4QUFA 1EIYB 2H4OA 2IY5B 1U5KA 2E75C 4DR7Q 1I4QA 2DN8A 1QVCA 2IL8A 4FF3A 2UXDL 2BH2A 2Z1CA 4R4IA 3MFGA 2F52A 2EYJA 3A7LA 1ENCA 5IYDG 1YHQA 3QJYA 3I8ZA 4IALA 4IPHA 5D14A 5BR8Q 2Z6BA 1IKLA 1XTDA 2ZJQA 3P20A 3RD4A 3S16H 1N32Q 1DJRD 2ZJPA 1PXUA 4GNXC 1H9JA 3JC66 3URYA 2HCIA 4AQYQ 1AP0A 2YU9H 1SYGA 5CR3A 2EYPA 1J6QA 4DU9A 4JBKA 1GUTA 4JI8Q 2IHEA 3HP3A 1WTRA 1N36Q 3H3VI 2F0HA 3GTOB 5M5YB 3CC2A 2UUBL 4LFBQ 5FKAC 3S2HB 3A5UA 3KDFB 3CC7A 3BS1A 2MFIA 1G2TA 4RHSA 3TBIB 5ELEA 1I3QB 2VL6A 1O78A 3SGIA 3HOXG 5GAHC 4EGVA 4RGOS 2KBNA 1NAPA 1AE2A 2B63H 1G91A 4QB4A 5IODA 1AZPA 3GTGB 2JA9A 3VR5A 1GJXA 3KBXA 1EYDA 2QDLA 2I0QA 2PNRC 4XIGS 4LF8Q 2R93G 3GTKB 4ID6A 5EKLA 4ALPA 1J5EQ 3FPPA 2A6EC 4UY8C 3AQQA 2F4VQ 4IOCA 3CCLA 4A3GH 2JA7B 3NBIA 1HUMA 4LWCA 4B3TL 5M9OA 1Y1WB 1X9NA 3GTMH 4JBMA 5M3MB 2NZ1D 1RKNA 4K5WA 4NP5A 5IYDH 3HG9A 2UUCQ 1Y8NB 2M00A 4KN4C 1PYBA 4QIWB 2K5VA 1EIGA 3OW7A 3KYHC 3R93A 3H0GG 1PH3A 5C4XB 4DR5L 5I2YA 3MHBA 3U58A 3BVGA 4OX9Q 1JMCA 1VQNA 4QCLA 1OXVA 1X3FA 2KJXA 3I4OA 1PRTD 1DGSA 2QKIC 1CZGA 1L0WA 3I4MB 1WTXA 3OIQA 4L5RC 1CUKA 4DV3Q 4CDCC 1EZ6A 1JWUD 2I5LX 2Z8LA 4J15A 5CV8A 4GLVB 3DM3A 3WOEA 4BWGB 2VUMB 4K5VA 2F0GA 3RNUA 1JOQA 2KCTA 2FXQA 2TSSA 1MBYA 2I5HA 4LMQD 4EQOA 4KMUC 1VQDA 5G3LD 2UXCQ 2FJ2A 1PTOB 1UE5A 1IHZA 2NVQH 1SYCA 4NW2A 1WI5A 5HURA 3HOXH 5IP7H 1EEID 2E2HH 1YJ9A 4XQJA 1HFGA 1WFQA 4JI6L 5C4HA 1XMOQ 1VQ4A 4BY1B 1WTOA 2X6LA
chains in the Genus database with same CATH topology
1BCPB 3WDNA 1IKMA 1C48A 4R8IA 1F9PA 3S17B 4XTCS 3HOVB 4PQXA 2F3VA 4DXGA 2WAQB 4KI0A 1BOSA 3TP5A 3AMUA 1K8MA 3IKJA 3C2PA 2PZTA 2A68C 4PMCA 4K2LA 3T4AC 1FD7D 1ESFA 2HDLA 3PUXA 2L5TA 3L9AX 2RDGA 3NTIA 3EQLC 1RHPA 1CA5A 1TWFB 1EFID 1YNND 4KY5A 1BQQT 2QDBA 4A93B 2PQEA 1VMCA 2L0CA 5E4XA 2R92B 3I3CA 4FF4A 4L8JA 1ET9A 1KNEA 4HCSA 2WKCA 5FLXL 3GTLB 1Y69U 4IFDH 1TR5A 5T1IA 4KY6A 5JEAJ 1O7YA 4XXEA 3VA5A 3HKZB 2TMPA 2MPMA 2A69D 4K2KA 4OO1G 3R2TA 2DNCA 2LS01 3MA2B 1H9RA 4RWSC 3MTSA 1EY4A 4CJ0B 1U4MA 2F4IA 1Y8PB 4DA2A 1EQVA 2CQAA 3C1FA 2NBFA 4C3HG 1A3VA 3LNNA 1BDOA 2F0JA 5I9PA 3S16B 1PTOC 1QNKA 1CTMA 2DY8A 2F0NA 2JSOA 2YU9B 3M4OB 3VYSA 3O13A 1BCPC 1S5ED 2G9HD 4FXGC 5IGBA 1M8AA 4BA1I 2XN9C 5EPJA 1JCKB 4ULLA 4ZQ3A 3I4NB 5KGUA 3E0JA 4E6IA 3X3NA 4B9WA 2C5CA 4KD3A 4Q0FA 4C3IG 5C5MA 2WP8J 3BDOA 5IOCA 5JOBA 1S5DD 3VYRA 5IGCA 1NCVA 2DY7A 3LX0A 4KKUA 4OO1H 3GTMB 5IGGA 2KUMA 3FVQA 5C0XG 2E76C 3C46A 1CK1A 3MEHA 2K28A 2HCCA 2JXMB 4TRDA 2K32A 2PCFB 1B3AA 3DXJC 4KJNA 5J1ZA 4IFDI 3MZ5A 2HDMA 3D3RA 1WD1A 2M2LA 1I6HB 5CV4A 4ZKCB 1V8QA 4H0LC 3S1NB 1B4OA 2KECA 3S1QB 1PYWD 5JAVA 4DNTB 1GUWA 1ZYRD 5LHY1 4Q5VA 1XYIA 1GHKA 2SDFA 1QILA 1BBXC 2EY5A 4G7ZC 1YNJC 4FNFA 4X3TA 5COYA 1BUVT 3NWTA 2B2VC 2F03A 4NMZA 2R93B 4DK0A 2MUYA 1QG7A 1QOHA 2RKSA 2BDNA 3Q24A 3DEOA 1JWSD 1W6KA 3RMHA 3I70A 1EY9A 5A35A 2IX3A 1AEXA 1DYQA 4K8JA 3C3LA 2QF7A 1SMYD 3H0GB 1H9KA 3Q0AA 3J7AV 2XNAC 2F1MA 3BDLA 1ESRA 2PMZB 2E74C 4K6DA 4ZLTF 1ILPA 2VNUD 2EDGA 1E2ZA 4PMBA 2LKVA 4J8QA 5KYIA 2XVSA 1R9TB 1XTCD 1MSHA 4QUCA 5C0XJ 5JJZA 2EPBA 4OO1I 4IUQA 1UAPA 5AFWA 5FO8B 3Q23A 3GO5A 5I4DA 4KV6A 3RUZA 1LTBD 1RDPD 4K8IA 5C3EB 3DHQA 3J81E 1U4RA 4CKEA 4C2MB 4KD4A 3MXNA 4NKLA 3NTHA 1I50B 2JYOA 2M9VA 5IIFA 3D6WA 3KLSX 2J4XA 2EY1A 4KKTA 3SK8A 5CV6A 1XWEA 3CRLC 1VDZA 1AN8A 1UEAB 3PO3B 1CI3M 1LTSD 4RGMA 2F0OA 4RCNA 4ZUIA 2K03A 4ZYSA 3J80E 2EYLA 5EKIA 1SDFA 1CQFA 1SNQA 2KA7A 3I4LA 5KNBA 1JOOA 3R3OA 1UUPA 2YYZA 1Z47A 3R2IA 4A3BB 2EY2A 3SK5A 1IW7C 3OIPA 3VR2A 4TQUS 4IUVA 3D31A 3VR3A 3SEBA 3WOFA 1QWYA 4ABNA 4XT3B 1STYA 2R6GA 4A3KB 2E2JB 1SE4A 1WTWA 1BO0A 1F2LA 2XWBB 1RTOA 1V43A 2RDFA 4P2CB 4TSSA 3P1HA 2D2CC 3H6MA 2EYFA 3OPOA 1O80A 4DAPA 1U4PA 1WVLA 4C3HB 1MSGA 2NVYB 1PLFA 3VYUA 3E6ZX 3OMGA 1SNOA 3BDCA 1LT3D 2BE5C 5E3FA 1SE3A 3PMFA 5DNFA 3OWFA 3VR6A 1KLGD 1Z7TA 3DUZA 5ELDA 3M3YB 5JVH3 1I4HA 2MHVA 1STHA 1I4PA 2F0MA 4IUTA 4BBSB 3JAML 5J22A 4FVMA 1LT5D 1JB3A 5CBAE 3KK7A 5KNDA 5ELBA 2O2LD 3RZDB 4C3IB 1JR0D 3GTQB 4CBVA 1ENFA 5KIXA 5DEHA 1KTKA 3SR1A 4RGTA 4KJOA 2D9UA 1CFMA 3PUWA 1TQOA 3V2TA 1F9SA 2N55A 3SHLA 4C1NK 2A6ED 1A2UA 1HCZA 3GD7A 2KOLA 3HRZC 5JPNC 2AQ1B 1FYCA 2AUKA 4A3EB 1RTNA 4JBWA 1A3UA 4FO2A 2F0UA 4WFN3 3NXWA 3Q6SA 1TS3A 3FPUB 1Y1VB 4N9TA 2AWNA 1S4ZA 1KNAA 2Q8IB 1WTPA 1HFNA 3SDZA 3MXUA 1BXTA 2KCNA 1F2YA 4C3JG 2ZXPA 3U9OA 4UDUC 3EVQA 2K5DA 5I6WA 4XQNA 2RA4A 1H9SB 1S5CD 2ENBA 1PRTF 3A8KE 3K0YA 4IFDG 1W6JA 3TMEA 1NUCA 1JC7A 5C3XA 3F2UA 2K01A 2QILA 1EY5A 1EU4A 4A3IB 3DWAA 2XRQD 5G3LF 3QOJA 2F0EA 3V96A 4KK7A 5BN4A 1MD2D 3FDTA 1GUNA 4KN7C 4HCEA 1PFBA 2I46A 3IL8A 3GV3A 3LWEA 5EBDA 3HS0C 2BA1A 3K57A 1RD9D 2A68D 4DAVA 3RZOB 1STEA 4XYOA 1KABA 3NWSA 1A15A 4HN7A 3ITPA 2ZT9C 1BR9A 1HHVA 3BZDB 2K7VA 2O5IC 2BDOA 1DD2A 4A3FB 1PZID 5IGDA 3QWNA 4HAEA 1JQYD 1QB5D 5A2QE 2RVLA 2ZXOA 1TWHB 4BBRB 1LACA 1X32A 5KYLA 2PZUA 2NN6G 1O7LA 1VF5C 1CM9A 3NQIA 4KKSA 1IL8A 3I90A 1SJED 2RDHA 4K14A 1LABA 2J7ZA 1HTPA 2K33A 1B1ZA 1EY0A 3CHBD 4HMIA 4OL7A 4RHRA 3MXGA 3NSWA 5IT9L 5C4ZA 1D5XC 3OSOA 3TP7A 4CJ1B 4RGNA 3MFYA 5D65A 1GXDC 4QMGA 4IFDJ 2F0TA 3G6JB 3P75A 1PTOD 3H3VC 2NVXB 3IFDA 4EQNA 1RODA 4G7HC 1SNCA 3GQBA 4DFAA 1EY7A 1EOTA 3T16A 1KLUD 2VXWA 3J81L 1BCPD 2AWOA 3VA7A 1EL0A 2B2VA 4GZYC 1IYUA 1FNVA 2PYKA 4ODGA 5KRUA 2B63B 4V190 4DF7A 1NR4A 2NN6H 1EWCA 3EROA 1QJOA 4LJZC 2GA4B 3BYTB 4ZK9B 1LO5D 1EU3A 2F0IA 4DN4M 1LV9A 3NE5B 4A3GB 3J80L 3VYTA 3A7AB 1GUGA 1STBA 2IJ0A 2B2YA 3OWEB 2LY7A 1OXUA 2NTTA 1Q3LA 5I9OA 2B2WC 2OEOA 3I91A 4OHJA 2WINB 3CRKC 5FOBB 4C1NI 1LTAD 2NUCA 3E5SA 1UNSA 1AZQA 2A73B 3BYYB 3D4DA 2K04A 3BVZA 1S5BD 1SEBD 4LK1C 4RA8A 1XXGA 3A54A 3S2DB 1JORA 2G9DA 2X6GA 5C6AA 4BS9A 2RQXA 4HR7B 3TZDA 4KTAA 1QCBD 2FMMA 2EVBA 4MIUA 3PV0A 2NVQB 3HOXB 1DZ1A 1YNJD 3J7AF 2E2HB 2EYOA 3KBGA 2XIWA 2E2DC 4RH6A 3TZUA 4ZKBB 3A8JE 5CV9A 3U9SA 3EA6A 1NR2A 5IGEA 1A2TA 2C9OA 3GTJB 5CGKA 1NSNS 2Z4IA 3KLSA 1E2WA 5JPMC 4ZAIA 1JOKA 1O7ZA 2E2IB 2B2UC 1R4PB 2Y0SB 4ZUJA 5E1FA 3OHXC 1EYCA 2WV6D 1SYBA 3T51B 1TKWB 3TDQA 1D6EC 5CC4A 2B2YC 2F0LA 4A3DB 2BCOA 4L63B 4C3JB 4DAYA 2NN6I 5C4JB 2O4XA 3S9WA 3PIO3 1LTTD 3IAYA 2HUGA 3PUZA 2RSOA 4U68A 3EFXD 1G8ZD 3M7GA 2KEEA 3ERQA 3ZYYX 2JE6I 2A6HC 3RLFA 1DCZA 2CW0D 3NP8A 3V05A 3NK9A 3ONAB 4G7OC 2RBMA 3FKIB 2EJMA 3HEJA 1Z6HA 3ND9A 4WRDA 5EKKA 1SE2A 1FR3A 4I7ZC 1Q1BA 5CBEE 3S1MB 2XRSD 2KQ3A 2F0QA 3S1RB 2EXZA 3H09A 3PUVA 5DM63 2R3ZA 3SE0A 3ND8A 5EJWA 2EY6A 1PTOH 1TS5A 2QEJC 3AU7A 1IYVA 1GUOA 5KNCA 2JA8B 1HTLD 2B8FA 4U673 3A56A 3DWQA 2EZVA 1FNUA 3GP7A 5I6YA 5J39A 3J7YW 1LTRD 1IW7D 2OT2A 2F0KA 5ISRA 2IX0A 2ID0A 4S3SA 3AB9A 3NPPA 5DM73 3G7LA 2PW5A 1B9MA 1HRJA 2K1BA 1WTVA 2OXPA 1PMRA 1RJTA 3HZXA 2B8GA 4BY7B 2EYHA 1V1PB 4G4KA 4V0BA 3KF8A 1TS2A 3M85A 1KDCA 1ML0D 1WCMB 5FO7B 1OXSC 2FMCA 3DWPA 1G291 2KCCA 4X3KA 1X3PA 5A2QL 4WORA 2PPBC 2SEBD 3TSSA 1ET6A 1G6ZA 1I6VC 2BE5D 2SNMA 4CKBA 3GTPB 4OIJA 1PRTB 1K83B 4ILWA 1GHJA 4I65A 4TKOB 1R4QB 3T53B 1A3TA 1TVXA 2IPKD 3PO2B 3MWYW 1F77A 1B9NA 1D5ZC 2IWHA 4XYQA 3NBHA 2DNEA 4XT1B 3FEWX 4XDXA 1G2SA 1VCIA 1TY2A 1KDAA 2FHTA 1L0YB 1OXXK 4F87A 1C4QA 1ZXTA 5DAUA 5EPKA 1SYDA 2SOBA 4O1NA 1LLRD 1HA6A 2RSNA 1VF7A 4C56C 5EBCA 3MXPA 4RCOA 3Q22A 4F7XA 1Q1EA 3DEPA 2A5HA 4QF4A 5NUCA 1U9RA 3FMCA 1EWHA 4BA2I 1ZEQX 4EQPA 4HSVA 4A3JB 1HUNA 3SK6A 1SNMA 4K5XA 2ICEC 2VB2X 3TP6A 3K6OA 1F9RA 4ME5A 4RFBA 3DMUA 3I73A 5M5WB 4WJWA 4CKCA 2B2TC 4RKLA 1DOLA 1EIHA 1EY8A 3K58A 2ZXRA 5CV5A 1SNDA 2XSCA 2O5JC 2EJGC 4A3MB 2H1EA 1H9MA 4IN3A 1F2MA 3QO2A 5JEAG 3HOZB 1X3QA 2EYMA 1B2TA 1I4GA 1MI2A 2OF1A 3MAQA 2Z4HA 5LL6S 3K5OA 2LFNA 3SXHA 3QB3A 3K5NA 1PRTC 3NQTA 2F0FA 3K5MA 2EJFC 5C44B 1H9SA 3W2DA 4RAUC 5F2DA 4IUUA 1LTID 3KUPA 5BN3A 1I4RA 4OGQC 1E0BA 1D1IA 1LT6D 5C3WA 2F0VA 3K7AB 3I72A 3PUYA 3HOWB 2AQ3B 3PIP3 4H7BA 4PV1C 1TS4A 3LWUA 1II3A 4CHTB 4IUNA 1DONA 4FP5D 2F0PA 4K6LA 4O42A 3D4RA 2F0DA 4M8AA 1V1OA 2KEDA 1MGSA 1OXTA 2F0SA 4KY7A 2IX1A 2BOSA 4F8MA 5JEAH 1ICWA 4FXDA 4MHEA 5EGTA 4NDXA 1STAA 2B39A 4DGZA 1YNNC 2VB3X 1Q12A 5EQ0A 1TT2A 2JA5B 2L55A 3SK4A 2B2WA 3HGBA 5E4WC 4H44C 2FINB 1C8CA 2K5QA 1ENAA 1AFPA 4AYBB 2JEBI 1CHQD 1B44D 5I2XA 1B53A 4H13C 2AUJD 3JAME 5CV7A 3K5LA 1PFNA 1VMPA 2A69C 1SJHD 5FO9B 5TSSA 3M4YA 2IW3A 5FK9C 1STNA 3CQZB 2JEAI 1FNWA 1CZWA 1J8IA 4M1UB 1CA6A 3K59A 1QNUA 4PNYA 2WKDA 1PTOF 3QOLA 3IFTA 2HQEA 2F0WA 4X3SA 2JA6B 4HEDA 2NTSA 3S15B 3QIAA 1BCPF 2V4DA 2PZWA 2Q8TA 1B50A 3CKIB 1JWMD 2A74C 3OOCA 4IQZA 2Q8RE 2JP1A 4N9PA 1AW7A 5ELCA 3OMCA 5C5LA 2B2UA 3T13A 2NB0A 3MC0B 1D5MC 2R61A 4DXFA 1QE6A 1STGA 1T5XD 1ZKOA 5LL6X 5M5XB 1CHPD 1JE4A 3MVVA 4KHVA 4FYDA 3TP8A 2KHSA 1CQVA 2J0TD 3L7ZC 2K6AA 1HA5A 3HOUB 1EEFD 3QG1A 4R8NA 3S14B 1OO9B 1SNPA 2L1BA 4RKBA 1PZJD 1TU2B 5KEEA 4MN3A 3T56B 1PDQA 1HQRD 1HXYD 4FF2A 1EYAA 1KDBA 2FFKB 2CHBD 3C1EA 2IT1A 5EPLA 1RCVD 1A6XA 1SYFA 2F3WA 1WTQA 3X3MA 3NHHA 1Q8IA 1U4LA 1ZYRC 2KVMA 1D1KA 2K5WA 1SAPA 5T1GA 2AQ2B 4KHZA 2NVTB 5BN5A 1EY6A 3N52A 2L4NA 1I4XA 4DNRB 3GV6A 1TWAB 5HGTA 4F88A 2BA0A 5K5PA 4IURA 3A8IE 1WD0A 1SXTA 1ILQA 1Y8OB 3NUCA 4Y7NB 1BNZA 2L11A 2PO4A 4FF1A 3M7NA 1PZKD 3L3OC 1EQTA 4L6TB 4PMWA 2ICIA 4EVOA 3D4WA 3TN2A 5C0XH 4YIJA 1L0XB 4HTHA 4J1MA 5D3IB 2X69A 4IUPA 5FLXE 2LMCB 1SMYC 3D6CA 4X3UA 2EE1A 3EJIA 2L12A 3UI2A 2MJ8A 2WIIB 1F2ZA 1DOMA 1TWGB 3SVMA 1ONLA 2A6HD 2SNSA 1HQMC 4IZ8A 2NYZD 1DXMA 2XWJB 3N6RA 5IGFA 1XX8A 5D3DA 5ELFA 1DOKA 1DM0B 3H94A 1SYEA 5K36G 5IT9E 1EZ8A 1SFOB 3VR4A 1LTGD 4ZRZA 2CVRA 1TWCB 1PFMA 1CT1D 1SSOA 5JVG3 1E2VA 2CW0C 2WB1B 5CMDA 1GOZA 5M3FB 1FGBD 3BG3A 2NWGA 4UAIA 1TIID 1F9QA 4G57A 2PW7A 3D8GA 2L9HA 4FXKC 2D5DA 3BVMA 1K8OA 5CORA 4OIKA 1Q90A 3W3AA 3CU7A 4DK1A 3A55A 1GUSA 4XQQA 2K05A 3KLRA 3FRPB 2I07B 4R9WA 3NTKA 1KAAA 3H91A 4CJ2C 4HMJA 2EOTA 3DM1A 4LAAA 1D2BA 1BF4A 1T5EA 1LT4D 5K36H 2R7ZB 2WACA 1RF2D 2MP1A 4JK1C 3P7JA 5CYUA 4B08A 4J6HA 1M4VA 5C0XI 1HPCA 4B9XA 2N88A 2QCPX 1JICA 2B2TA 3R8BA 2D62A 2MGSA 1V1PA 3HOYB 1SBBB 1TY0A 4CGYB 1J9OA 4HSPA 1S5FD 4Z9CB 4QUFA 2H4OA 2E75C 1I4QA 2DN8A 2IL8A 4FF3A 2Z1CA 3MFGA 2EYJA 3A7LA 1ENCA 3QJYA 3I8ZA 4IALA 5D14A 1IKLA 3P20A 3RD4A 1DJRD 1PXUA 1H9JA 3URYA 2HCIA 1AP0A 1SYGA 5CR3A 2EYPA 4DU9A 1GUTA 5M5YB 1WTRA 3HP3A 3GTOB 2F0HA 3S2HB 5FKAC 3BS1A 1G2TA 4RHSA 3TBIB 5ELEA 1I3QB 1O78A 4EGVA 4RGOS 1NAPA 1G91A 4QB4A 5IODA 1AZPA 3GTGB 3VR5A 1GJXA 3KBXA 1EYDA 2PNRC 4XIGS 3GTKB 4ID6A 5EKLA 3FPPA 2A6EC 2JA7B 3NBIA 1HUMA 5M9OA 1Y1WB 5M3MB 2NZ1D 1RKNA 4K5WA 4NP5A 3HG9A 1Y8NB 2M00A 4KN4C 4QIWB 1EIGA 3OW7A 3R93A 5C4XB 5I2YA 3MHBA 3BVGA 4QCLA 1OXVA 2KJXA 1PRTD 2QKIC 1CZGA 3I4MB 1WTXA 3OIQA 1EZ6A 1JWUD 2Z8LA 5CV8A 4BWGB 3WOEA 2VUMB 4K5VA 2F0GA 1JOQA 2TSSA 1MBYA 4EQOA 4LMQD 4KMUC 5G3LD 2FJ2A 1PTOB 1IHZA 1SYCA 4NW2A 5HURA 1EEID 4XQJA 1HFGA 5C4HA 4BY1B 1WTOA 2X6LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NUC A;  3EVQ A;  4HMI A;  3DHQ A;  4OL7 A;  3DMU A;  3ERQ A;  4F8M A;  5I6W A;  1STH A;  5IOD A;  1KDC A;  2F0M A;  3D4D A;  1KAA A;  4KD4 A;  2EY5 A;  3T13 A;  2F0N A;  2ENB A;  4NKL A;  5J22 A;  5C4Z A;  4HMJ A;  4RKL A;  1NUC A;  3D4W A;  3OSO A;  5EGT A;  4YIJ A;  3TME A;  4EVO A;  5C3X A;  4HTH A;  1EY8 A;  3NP8 A;  4J1M A;  4NDX A;  1STA A;  5IGB A;  3NK9 A;  1STG A;  4DGZ A;  2F3V A;  5CV5 A;  3TP7 A;  4WOR A;  1SND A;  4LAA A;  1JOR A;  5IIF A;  1TT2 A;  2RBM A;  3SK4 A;  4NMZ A;  3TP5 A;  1EY5 A;  3MVV A;  5C6A A;  5NUC A;  4KHV A;  4QB4 A;  3D6C A;  2WAC A;  4QMG A;  1F2M A;  2EY1 A;  2PZT A;  3EJI A;  2SNM A;  2F0T A;  3HEJ A;  3TP8 A;  3P75 A;  4ZQ3 A;  2RKS A;  3SK8 A;  2KHS A;  4PMC A;  5KGU A;  4K2L A;  4WRD A;  5CV6 A;  5EKK A;  1EYD A;  2EYM A;  4KTA A;  1F2Z A;  4J6H A;  4E6I A;  4MIU A;  4ID6 A;  1ENA A;  5EKL A;  2OF1 A;  3QOJ A;  4B9W A;  4I65 A;  4EQN A;  4KD3 A;  4B9X A;  2SNS A;  2KQ3 A;  4IZ8 A;  2F0E A;  5C5M A;  1A3T A;  4R8N A;  1SNC A;  2F0Q A;  1EY9 A;  5IGF A;  2F0O A;  4ZUI A;  1EY7 A;  3T16 A;  2EXZ A;  4DFA A;  5KIX A;  5DEH A;  1SNP A;  2EYO A;  3SR1 A;  3SXH A;  3QB3 A;  5M9O A;  1AEX A;  2EYL A;  1SYE A;  3NQT A;  4RKB A;  4KY5 A;  1SNQ A;  2F0F A;  2QDB A;  5JOB A;  2PQE A;  5IOC A;  5IGC A;  1RKN A;  1JOO A;  3R3O A;  1EZ8 A;  2EY6 A;  4K8J A;  4K5W A;  4NP5 A;  5CV7 A;  5KEE A;  2M00 A;  4KJO A;  1EYA A;  1KDB A;  2EY2 A;  5F2D A;  5I9P A;  3LX0 A;  5CV9 A;  1TQO A;  3SK5 A;  1KDA A;  3V2T A;  3BDL A;  5IGE A;  1A2T A;  1KAB A;  5CGK A;  3C1E A;  4K6D A;  5IGG A;  1NSN S;  2PYK A;  1TR5 A;  4ODG A;  3ITP A;  5DAU A;  3SHL A;  5KRU A;  1STY A;  1STN A;  1SYF A;  1A2U A;  2F3W A;  4DF7 A;  1SYD A;  3MHB A;  4KY6 A;  2SOB A;  4PMB A;  3MEH A;  5C3W A;  2LKV A;  1A3U A;  5KYI A;  2F0V A;  1JOK A;  3ERO A;  4PNY A;  5CC4 A;  3NHH A;  4TRD A;  2EYJ A;  2F0U A;  3QOL A;  3MXP A;  1ENC A;  3VA5 A;  5IGD A;  3NXW A;  5I6Y A;  4ZUJ A;  4F7X A;  2HQE A;  5J39 A;  5E1F A;  1EZ6 A;  2F0I A;  2F0W A;  4KJN A;  5CV8 A;  4G57 A;  4H7B A;  1EYC A;  1SYB A;  5J1Z A;  4IAL A;  2PW7 A;  4K2K A;  4QF4 A;  2F0L A;  2RDF A;  3D8G A;  4K5V A;  2F0G A;  3MZ5 A;  1II3 A;  1STB A;  1U9R A;  4N9T A;  1JOQ A;  2F0K A;  3P1H A;  1EY6 A;  5ISR A;  3H6M A;  2EYF A;  4EQO A;  2O4X A;  5KYL A;  2PZW A;  2PZU A;  5C5L A;  3S9W A;  1EY4 A;  4IUN A;  4S3S A;  5I9O A;  5CV4 A;  4KV6 A;  3RUZ A;  3OMG A;  2OEO A;  2F0P A;  1IHZ A;  4EQP A;  2PW5 A;  5HGT A;  3SK6 A;  1SYC A;  1SNO A;  1F2Y A;  3BDC A;  5HUR A;  1SNM A;  2F0D A;  4K5X A;  1EQV A;  5E3F A;  4K8I A;  3C1F A;  2OXP A;  2NUC A;  3PMF A;  4K14 A;  5JAV A;  1SYG A;  5K5P A;  3OWF A;  1A3V A;  2EYP A;  5CR3 A;  3TP6 A;  2F0S A;  3E5S A;  4KY7 A;  4DU9 A;  5C4H A;  1EY0 A;  2F0J A;  2F0H A;  3HZX A;  4N9P A;  3U9O A;  4ME5 A;  3OMC A;  2EYH A; 
#chains in the Genus database with same CATH topology
 1BCP B;  3WDN A;  2CWP A;  1SRU A;  1IKM A;  1C48 A;  4ZCK A;  4R8I A;  2UXD Q;  1F9P A;  5C3E G;  4JOI A;  3S17 B;  4XTC S;  1K8A C;  2HHH L;  3HOV B;  4PQX A;  2F3V A;  4DXG A;  2WAQ B;  4KI0 A;  1G51 A;  1BKB A;  1BOS A;  2KEN A;  4OWX B;  3TP5 A;  3AMU A;  1K8M A;  3IKJ A;  3C2P A;  2PZT A;  1KC8 C;  2CH4 A;  2A68 C;  4L5S A;  1KL9 A;  2L15 A;  4PMC A;  4K2L A;  3T4A C;  4X64 L;  1FD7 D;  1ESF A;  2HDL A;  4X65 L;  3PUX A;  2L5T A;  3L9A X;  3H0G H;  1NBW A;  2RDG A;  3NTI A;  3EQL C;  4A3D H;  1RHP A;  1CA5 A;  1SE8 A;  1TWF B;  1EFI D;  1YNN D;  3PO3 G;  4C3J H;  4KY5 A;  1BQQ T;  5C4J H;  2QDB A;  4A93 B;  2PQE A;  2UUB Q;  1VMC A;  2L0C A;  5E4X A;  2R92 B;  1QVG A;  4LF9 L;  3I3C A;  4A4I A;  4FF4 A;  4L8J A;  1ET9 A;  2OTJ A;  1KNE A;  4HCS A;  2WKC A;  5FLX L;  4P73 A;  3GTL B;  1Y69 U;  4IFD H;  1TR5 A;  5T1I A;  4A3B G;  4KY6 A;  5JEA J;  1O7Y A;  5IE8 A;  2RHQ B;  3F2D A;  5HGQ A;  4DUY L;  4XXE A;  3VA5 A;  3HKZ B;  2TMP A;  1L2F A;  2MPM A;  5IYB G;  4R4O A;  2A69 D;  1E7Z A;  3FKI H;  4K2K A;  4OO1 G;  2R7F A;  3R2T A;  2DNC A;  2LS0 1;  3MA2 B;  1H9R A;  4RWS C;  4B3T Q;  3MTS A;  3CF5 A;  5C3E H;  1EY4 A;  4CJ0 B;  1U4M A;  1NTG A;  2G5D A;  2YTY A;  1LUZ A;  2F4I A;  1Y8P B;  4DA2 A;  1XNR L;  1EQV A;  2CQA A;  3C1F A;  2N78 A;  2NBF A;  2HIV A;  4C3H G;  1A3V A;  3LNN A;  3S1R H;  1BDO A;  4QJF A;  2F0J A;  4LFA L;  3ZJY C;  5I9P A;  3S16 B;  1PTO C;  1QNK A;  1QUQ A;  1PH2 A;  3CW2 C;  4DR5 Q;  4TVA B;  1CTM A;  2DY8 A;  2F0N A;  1A62 A;  2JSO A;  5EAY A;  2YU9 B;  1WJJ A;  3M4O B;  3VYS A;  3O13 A;  1BCP C;  1S5E D;  2G9H D;  4FXG C;  5IGB A;  1M8A A;  3CCR A;  4BBS G;  4BA1 I;  2XN9 C;  3PO3 H;  5EPJ A;  2JA8 H;  3E9I A;  1JCK B;  1QZH A;  3KJP A;  4ULL A;  4ZQ3 A;  3I4N B;  2V1C C;  5KGU A;  3E0J A;  4E6I A;  3X3N A;  4B9W A;  2C5C A;  4KD3 A;  4Q0F A;  5AJ3 L;  4C3I G;  3W5O A;  5C5M A;  1PH8 A;  2WP8 J;  4A3B H;  2B29 A;  1LM0 A;  3BDO A;  4JI3 L;  4JI6 Q;  4OXP A;  2CKZ B;  1WYD A;  5IOC A;  5JOB A;  4HIM A;  1S5D D;  3VYR A;  5IGC A;  1NCV A;  2Z9H A;  2DY7 A;  3ULL A;  5IYB H;  3LX0 A;  1MKH A;  4KKU A;  4OO1 H;  2HHH Q;  3GTM B;  1XPR A;  2OQ0 A;  5IGG A;  1Q81 C;  2KUM A;  3FVQ A;  4LF7 L;  4BY7 H;  5C0X G;  1XJV A;  2E76 C;  3C46 A;  1CK1 A;  3MEH A;  2K28 A;  1PH5 A;  2JQO A;  2HCC A;  2JXM B;  1WCM H;  4A3C H;  4TRD A;  2K32 A;  2PCF B;  1FVI A;  4X64 Q;  1IL2 A;  1B3A A;  4C3H H;  4A3J G;  4X65 Q;  1IBL Q;  3KF6 B;  4A3E G;  3DXJ C;  4KJN A;  5J1Z A;  4IFD I;  1B7Y B;  2I5M X;  3E3X A;  3MZ5 A;  2HDM A;  4JI7 L;  3D3R A;  1WD1 A;  3GTP H;  2PQA B;  1VQC A;  2M2L A;  1Y1V G;  3AEV A;  1I6H B;  5CV4 A;  3MEF A;  4ZKC B;  1V8Q A;  4H0L C;  3CP0 A;  3S1N B;  4LF9 Q;  3U50 C;  1VQG A;  1B4O A;  2KEC A;  3S1Q B;  1PYW D;  5JAV A;  4DNT B;  3PO2 H;  1GUW A;  1ZYR D;  5LHY 1;  1HZ9 A;  4Q5V A;  1XYI A;  1GHK A;  2SDF A;  1QIL A;  2CFM A;  1BBX C;  2EY5 A;  4G7Z C;  1YNJ C;  4AH6 A;  4FNF A;  1G6P A;  4X3T A;  5COY A;  1BUV T;  3NWT A;  3E9H A;  4EX5 A;  4DUY Q;  2B2V C;  2F03 A;  4NMZ A;  2R93 B;  3NEM A;  5IYC G;  4DK0 A;  2MUY A;  4KHP L;  1QG7 A;  1QOH A;  2RKS A;  4DR4 L;  4JYA L;  2BDN A;  3Q24 A;  3DEO A;  1Z9F A;  1JWS D;  1W6K A;  3RMH A;  3I70 A;  1XNR Q;  2YTV A;  4YWL A;  1EY9 A;  5A35 A;  1JJG A;  2IX3 A;  4DAY B;  1PH7 A;  1AEX A;  4LFA Q;  3CPF A;  1CKN A;  3CME A;  5IWA L;  1IYJ B;  1DYQ A;  4K8J A;  3C3L A;  4X6A H;  2QF7 A;  1SMY D;  3H0G B;  3U4V A;  1H9K A;  2Y0S E;  4A3J H;  2VZA A;  2K14 A;  3Q0A A;  3J7A V;  2XNA C;  2F1M A;  1JJ2 A;  3BDL A;  1YBY A;  1ESR A;  2PMZ B;  2E74 C;  4K6D A;  4ZLT F;  1ILP A;  2VNU D;  4H02 A;  2EDG A;  3OTO L;  1E2Z A;  2RF4 A;  4PMB A;  5M5W H;  1VQM A;  2LKV A;  4J8Q A;  1O7I A;  1LTL A;  2XVS A;  5KYI A;  1AH9 A;  1R9T B;  2K75 A;  1XTC D;  1MSH A;  4QUC A;  3I7F A;  1HR0 L;  1CKM A;  5C0X J;  5JJZ A;  2EPB A;  4OO1 I;  4IUQ A;  1UAP A;  5AFW A;  5FO8 B;  1SMX A;  5AJ3 Q;  3Q23 A;  4A3M H;  1PH1 A;  4P75 A;  4JI3 Q;  3GO5 A;  3KLW A;  3HOZ H;  1WOC A;  4IJL A;  5I4D A;  4ME3 A;  2QGQ A;  4KV6 A;  3RUZ A;  1LTB D;  4BBR G;  1RDP D;  4K8I A;  4JPB W;  3M4Q A;  5IYC H;  5C3E B;  3BZC A;  3DHQ A;  3J81 E;  1EOV A;  1I5F A;  1U4R A;  4LF7 Q;  4CKE A;  4POG A;  4C2M B;  4KD4 A;  5C44 H;  3MXN A;  4NKL A;  3NTH A;  1KRT A;  2AMC B;  4IJH A;  2PNH A;  1I50 B;  2JYO A;  5FLX c;  2Q2U A;  2M9V A;  1HR0 W;  2N49 A;  5IIF A;  3D6W A;  3EIV A;  3CAM A;  2JN4 A;  3KLS X;  2J4X A;  1B8A A;  2DJG C;  4GNX A;  2EY1 A;  4KKT A;  1SLJ A;  3SK8 A;  4JI7 Q;  5CV6 A;  1XWE A;  4MZ9 A;  3STB D;  3CRL C;  1VDZ A;  2K5H A;  4LFC L;  1AN8 A;  1UEA B;  3PO3 B;  1CI3 M;  1Q7Y C;  2OCE A;  1LTS D;  4RGM A;  2F0O A;  4R4Q A;  4RCN A;  4ZUI A;  2K03 A;  2MO1 A;  4ZYS A;  1BVS A;  3J80 E;  2ZM6 L;  2EYL A;  5EKI A;  1SDF A;  1CQF A;  1SNQ A;  2KA7 A;  3I4L A;  5KNB A;  2KCM A;  1JOO A;  3R3O A;  4GOP B;  1UUP A;  2YYZ A;  1Z47 A;  3R2I A;  5DLQ E;  4A3B B;  2EY2 A;  3SK5 A;  1IW7 C;  3OIP A;  3VR2 A;  4TQU S;  4IUV A;  3D31 A;  3VR3 A;  3SEB A;  3WOF A;  1M90 C;  1QWY A;  4ABN A;  4XT3 B;  1STY A;  4BXX G;  2R6G A;  3KF8 B;  4A3K B;  3H15 A;  1A0I A;  4PZ7 A;  2E2J B;  4BBR H;  1SE4 A;  4HJ9 A;  1PH4 A;  4DR3 L;  3CCJ A;  1WTW A;  1BO0 A;  1K8G A;  4DR4 Q;  1F2L A;  4HIK A;  4JYA Q;  2XWB B;  1RTO A;  1V43 A;  3UE0 A;  1E22 A;  2RDF A;  4P2C B;  4TSS A;  3TS2 A;  3P1H A;  2D2C C;  3H6M A;  2EYF A;  3OPO A;  1O80 A;  4PZ6 A;  1U4P A;  4DAP A;  1WVL A;  4LNQ A;  1GM5 A;  4C3H B;  1MSG A;  2NVY B;  3L0O A;  1NJI C;  1PLF A;  4A3G G;  5IWA Q;  3VYU A;  3E6Z X;  3OMG A;  1SNO A;  3BDC A;  2ZJR A;  3LGJ A;  4AIM A;  3F2B A;  1LT3 D;  2BE5 C;  5E3F A;  1SE3 A;  3PMF A;  5JJI A;  5DNF A;  3OWF A;  3VR6 A;  1KLG D;  4LUO A;  1Z7T A;  4GLX A;  2ALY B;  3DUZ A;  5ELD A;  3M3Y B;  5JVH 3;  1I4H A;  3ULJ A;  2MHV A;  3KJO A;  1STH A;  1I4P A;  2F0M A;  4IPD A;  4IUT A;  3GDE A;  3OTO Q;  2GN5 A;  4BBS B;  1PV4 A;  3NBH B;  3JAM L;  5J22 A;  4FVM A;  3BU2 A;  1LT5 D;  2CH4 W;  1JB3 A;  5CBA E;  2NVX H;  3KK7 A;  3BZK A;  4GN4 B;  5KND A;  1HR0 Q;  1PH6 A;  5ELB A;  2O2L D;  3CCU A;  3RZD B;  4C3I B;  1JR0 D;  4DPG A;  1RL2 A;  4HJA A;  5GAG C;  1CSP A;  3GTQ B;  4GLA C;  1P16 A;  4CBV A;  4K0K Q;  3PIO A;  4BXX H;  1ENF A;  5KIX A;  5DEH A;  1KTK A;  3SR1 A;  3JAM i;  5IP7 G;  3UDG A;  3KDF A;  4UP7 A;  4RGT A;  4KJO A;  2D9U A;  4LW1 A;  3CC4 A;  1CFM A;  2NZO A;  1PYS B;  1TQO A;  3PUW A;  3V2T A;  1F9S A;  1HJP A;  2N55 A;  1OTC A;  4GOP C;  5JJK A;  3SHL A;  4C1N K;  2UUA L;  2A6E D;  1A2U A;  1HCZ A;  3GD7 A;  2KOL A;  3HRZ C;  3TS0 A;  5JPN C;  2AQ1 B;  1FYC A;  2AUK A;  4A3E B;  1RTN A;  3K81 C;  1A3U A;  2P5Z X;  4JBW A;  1I94 L;  1GO3 E;  4FO2 A;  2F0U A;  4WFN 3;  3NXW A;  3A0J A;  3Q6S A;  1KRS A;  4LFC Q;  2AKW B;  5LMU L;  1TS3 A;  3FPU B;  1Y1V B;  1YHA A;  1CSQ A;  4N9T A;  2AWN A;  1S4Z A;  2Y0S G;  1KNA A;  3S24 A;  4DK6 C;  2Q8I B;  2ZM6 Q;  3T1H L;  1WTP A;  1VQK A;  1HFN A;  3SDZ A;  3MXU A;  1BXT A;  3J7Z C;  2KCN A;  1MIU A;  4A3D G;  1F2Y A;  4C3J G;  5L37 A;  1EYG A;  1HZC A;  2ZXP A;  3S14 H;  2UXB L;  4OWW B;  3U9O A;  4UDU C;  1JB7 A;  3EVQ A;  2K5D A;  5I6W A;  3S2D H;  1XPO A;  4XQN A;  4QIW E;  2RA4 A;  1H9S B;  1S5C D;  2ENB A;  1PRT F;  3A8K E;  3K0Y A;  4IFD G;  1W6J A;  3TME A;  1NUC A;  1JC7 A;  5C3X A;  4R1J A;  3F2U A;  4DR3 Q;  2K01 A;  2QIL A;  1EY5 A;  1EU4 A;  1KQS A;  1E24 A;  3B6Y A;  3CCE A;  3PF5 A;  4A3I B;  3DWA A;  2XRQ D;  5G3L F;  2VQF L;  4JVZ A;  3FKI G;  3QOJ A;  2F0E A;  3V96 A;  4KK7 A;  5BN4 A;  1MD2 D;  4DV4 L;  3FDT A;  1GUN A;  3CXC A;  4UHV A;  4KN7 C;  4HJ8 A;  3K7U C;  4HCE A;  4OWT B;  1K3R A;  2F3I A;  3GTJ H;  2OWO A;  1PFB A;  2I46 A;  3IL8 A;  5J3B A;  3GV3 A;  3LWE A;  5EBD A;  3HS0 C;  2BA1 A;  1TWA H;  3K57 A;  1RD9 D;  2A68 D;  4DAV A;  5M3F G;  3RZO B;  1STE A;  4XYO A;  4R4T A;  1KAB A;  3NWS A;  2E2I H;  1A15 A;  4HN7 A;  3ITP A;  2ZT9 C;  1BR9 A;  1HHV A;  2VW9 A;  3BZD B;  2K7V A;  4WJ4 A;  2O5I C;  2BDO A;  2D0O A;  2WAQ E;  1DD2 A;  2JA8 G;  4A3F B;  1PZI D;  5IGD A;  3QWN A;  4HAE A;  3T1Y L;  1JQY D;  1QB5 D;  5A2Q E;  4LF4 L;  2RVL A;  2ZXO A;  1TWH B;  4BBR B;  1HNZ L;  1LAC A;  2QEX A;  4LUZ A;  3CCQ A;  1X32 A;  5KYL A;  2IHF A;  2PZU A;  2NN6 G;  1O7L A;  2RCF A;  1VF5 C;  1CM9 A;  4LF5 L;  3NQI A;  4KKS A;  2HD3 A;  1IL8 A;  1VQL A;  3I90 A;  4DR1 L;  1SJE D;  1HNX L;  2RDH A;  4K14 A;  1LAB A;  2J7Z A;  2ZTC A;  1HTP A;  1T9H A;  2K33 A;  1B1Z A;  1EY0 A;  4JC0 A;  2NZH A;  3CHB D;  4HMI A;  4OL7 A;  2ES2 A;  1SN8 A;  2UUA Q;  4RHR A;  1SFO H;  1L1O B;  3MXG A;  1I94 Q;  3NSW A;  4BY7 G;  5IT9 L;  5C4Z A;  1TWC H;  1D5X C;  3OSO A;  4AYB E;  4JCV E;  3TP7 A;  4CJ1 B;  3J81 j;  1WCM G;  1A63 A;  4RGN A;  3MFY A;  4A3C G;  1YIJ A;  3S1M H;  1VQA A;  5LMN L;  3RN2 A;  5D65 A;  1GXD C;  4QMG A;  4IFD J;  2F0T A;  3HKZ E;  3G6J B;  3P75 A;  1XPU A;  5M3F H;  1PTO D;  3T1H Q;  3H3V C;  2NVX B;  3ICE A;  3IFD A;  4EQN A;  1ROD A;  3I2Z A;  1VQ9 A;  3ER0 A;  4G7H C;  1SNC A;  4X62 L;  2EIF A;  3GQB A;  1EY7 A;  1EOT A;  3T16 A;  4DFA A;  1KLU D;  2VXW A;  3J81 L;  4HIO A;  1BCP D;  2AWO A;  2UXB Q;  3TQY A;  3HFZ B;  4B3R L;  3VA7 A;  1EL0 A;  2B2V A;  4NXN L;  1Q8K A;  1S40 A;  3PO2 G;  1XNQ L;  4GZY C;  1IYU A;  4LF6 L;  2N8N A;  5FLM G;  3F2C A;  5IP9 G;  2Z0S A;  1YNX A;  1FNV A;  2PYK A;  4ODG A;  2A19 A;  5KRU A;  2B63 B;  4V19 0;  5LMN W;  2QW7 A;  4DF7 A;  1NR4 A;  2NN6 H;  1X3G A;  4IO9 A;  3G4S A;  1EWC A;  3ERO A;  1QJO A;  2GVA A;  3JAM c;  4LJZ C;  2VQF Q;  2GA4 B;  3BYT B;  4IPC A;  4CDF C;  3J81 i;  4ZK9 B;  1LO5 D;  1EU3 A;  2F0I A;  4DN4 M;  1LV9 A;  3NE5 B;  4A3G B;  3J80 L;  3VYT A;  1IBK L;  3A7A B;  1BBU A;  1GUG A;  3RLO A;  1STB A;  4DV4 Q;  2R7Z H;  1H95 A;  2IJ0 A;  2B2Y A;  3OWE B;  2H5X A;  4DV0 L;  2LY7 A;  1OXU A;  2NTT A;  2Z6K C;  4O0A A;  1Q3L A;  5I9O A;  1N9W A;  2B2W C;  2OEO A;  3I91 A;  4OHJ A;  2WIN B;  3CRK C;  5FOB B;  4C1N I;  4DV1 L;  1LTA D;  2NUC A;  3E5S A;  1UNS A;  1JJC B;  4GN3 B;  1AZQ A;  1NY4 A;  1M1K C;  2A73 B;  3CD6 A;  3HOY H;  3BYY B;  3D4D A;  2K04 A;  1JE5 A;  2HQL A;  3BVZ A;  1S5B D;  1SEB D;  3J80 i;  4LK1 C;  1FL0 A;  4RA8 A;  1XXG A;  3A54 A;  3KF6 A;  3S2D B;  1K83 H;  2G9D A;  1JOR A;  2X6G A;  1EQR A;  4PG3 A;  1L1O C;  5C6A A;  2JA7 G;  1HNZ Q;  4BS9 A;  3PIP A;  2PQA A;  2RQX A;  4HR7 B;  5M3M G;  3TZD A;  4KTA A;  1QCB D;  4A3M G;  2FMM A;  2EVB A;  4MIU A;  5FLM H;  3PV0 A;  4UP8 A;  4LF5 Q;  2NVQ B;  3HOX B;  2Q2H A;  5IP9 H;  1DZ1 A;  1YNJ D;  3J7A F;  2E2H B;  3HOZ G;  4GS3 A;  4DR1 Q;  1HNX Q;  3CPW A;  2EYO A;  3KBG A;  4JI1 L;  1FGU A;  2XIW A;  4DUZ L;  1KXL A;  2E2D C;  4RH6 A;  3J7A 5;  4JI2 L;  3TZU A;  4ZKB B;  3A8J E;  4DR2 L;  1XMQ L;  5CV9 A;  3U9S A;  3EA6 A;  1NR2 A;  5IGE A;  1N34 L;  1A2T A;  5C44 G;  2C9O A;  3GTJ B;  5CGK A;  5M5Y H;  1NSN S;  2Z4I A;  3NEL A;  3KLS A;  3S2H H;  3QR8 A;  1E2W A;  5JPM C;  4ZAI A;  1YI2 A;  1JOK A;  2A8V A;  1O7Z A;  4X66 L;  1S72 A;  1NMG A;  1YJW A;  2E2I B;  2B2U C;  1R4P B;  2Y0S B;  4ZUJ A;  5E1F A;  2OTL A;  1FJG L;  3OHX C;  1MHW C;  1EYC A;  2WV6 D;  1SYB A;  3T51 B;  1TKW B;  3TDQ A;  1D6E C;  2B2Y C;  2F0L A;  5CC4 A;  4X62 Q;  4A3D B;  2BCO A;  4L63 B;  4BY1 G;  4C3J B;  4DAY A;  2NN6 I;  5C4J B;  3GTG H;  2N3S A;  2O4X A;  2K50 A;  3HOW G;  3S9W A;  3PIO 3;  4CDD C;  4DV5 L;  4NXN Q;  1LTT D;  3IAY A;  1XNQ Q;  3GTK H;  4GN5 A;  4QGU A;  2HUG A;  3PUZ A;  4LF6 Q;  3Q8D A;  2RSO A;  4U68 A;  3EFX D;  2JA7 H;  1ASZ A;  3HOV G;  1G8Z D;  4B3M L;  3M7G A;  2KEE A;  3G48 A;  2WAQ G;  2B3G A;  3ERQ A;  2EQS A;  3ZYY X;  1E1O A;  5M3M H;  2JE6 I;  2PMZ E;  2A6H C;  3RLF A;  1DCZ A;  1EUJ A;  2CW0 D;  3NP8 A;  3V05 A;  3NK9 A;  5ELN A;  3ONA B;  4DV7 L;  4RG1 A;  4G7O C;  2RBM A;  3FKI B;  4MNO A;  4R4C A;  5C4X H;  2EJM A;  1IBK Q;  3HEJ A;  1VQ5 A;  1Z6H A;  3ND9 A;  3OYY A;  4WRD A;  5EKK A;  4DV0 Q;  2JA5 G;  4A93 G;  1SE2 A;  1FR3 A;  1IXR A;  4I7Z C;  3I4M H;  1Q1B A;  5CBE E;  3S1M B;  2XRS D;  2KQ3 A;  1X6O A;  4DV1 Q;  4Y52 H;  3RN5 A;  2F0Q A;  3S1R B;  2EXZ A;  2WB1 E;  3H09 A;  3PUV A;  5DM6 3;  2R3Z A;  3SE0 A;  3ND8 A;  3W1G A;  5EJW A;  3PCO B;  1VS0 A;  4AYB G;  1D7Q A;  2EY6 A;  1NMF A;  1PTO H;  1A8V A;  3HKS A;  1TS5 A;  4DKA C;  2QEJ C;  4P72 A;  3AU7 A;  3K7A H;  3HKZ G;  2MNA A;  1IYV A;  2LXK A;  1GUO A;  2Q2T A;  4BY1 H;  5KNC A;  4LF8 L;  2JA8 B;  3HOW H;  4WJ3 M;  1HTL D;  1X54 A;  2B8F A;  4U67 3;  3A56 A;  3DWQ A;  2EZV A;  1N8R C;  5IT9 c;  3S17 H;  1BBW A;  1FNU A;  3GP7 A;  3PQI A;  1YVC A;  5I6Y A;  4GKK L;  5J39 A;  3J7Y W;  3HOV H;  1LTR D;  2DGY A;  3PGZ A;  4L5T A;  2UUC L;  1IW7 D;  2OT2 A;  2F0K A;  5ISR A;  4NPS A;  1VQB A;  2IX0 A;  2ID0 A;  4S3S A;  2R7D A;  3AB9 A;  3NPP A;  2JA6 G;  4GOP A;  5DM7 3;  3G7L A;  4JI2 Q;  2PW5 A;  1B9M A;  1HRJ A;  2K1B A;  4KHP Q;  1WTV A;  3L2P A;  2OXP A;  4DR2 Q;  1PMR A;  5GQO A;  1RJT A;  1P8L A;  3HZX A;  3J81 c;  2B8G A;  4BY7 B;  2EYH A;  1TWF H;  1V1P B;  1EFW A;  4G4K A;  4V0B A;  3KF8 A;  1TS2 A;  3M85 A;  1KDC A;  2JA5 H;  4A93 H;  1ML0 D;  1WCM B;  5FO7 B;  1OXS C;  3I4N G;  2FMC A;  3DWP A;  1G29 1;  2KCC A;  4X3K A;  4X66 Q;  1VQ7 A;  4QQB X;  1X3P A;  5A2Q L;  2KHJ A;  4WOR A;  3GTL H;  2PPB C;  4NXM L;  3CCS A;  2SEB D;  3TSS A;  1ET6 A;  1FJG Q;  1G6Z A;  1K0S A;  2XGT A;  1I6V C;  2BE5 D;  2EXD A;  2SNM A;  4CKB A;  3GTP B;  1Q82 C;  4OIJ A;  1XMO L;  1PRT B;  1HZB A;  1K83 B;  4ILW A;  1GHJ A;  4DV5 Q;  4I65 A;  4TKO B;  1R4Q B;  4UP9 A;  3T53 B;  1A3T A;  1TVX A;  2IPK D;  3PO2 B;  3J80 c;  2CQO A;  1B70 B;  4B3M Q;  3HOU G;  3MWY W;  1F77 A;  1B9N A;  1PA6 A;  1D5Z C;  2IWH A;  3CQZ H;  4XYQ A;  3NBH A;  2DNE A;  4XT1 B;  3FEW X;  4XDX A;  1N33 L;  1Y14 B;  1G2S A;  1VCI A;  1TY2 A;  2MQH A;  1KDA A;  4N8F A;  2FHT A;  1L0Y B;  1OXX K;  3IRB A;  4F87 A;  1C4Q A;  4DV7 Q;  1ZXT A;  5DAU A;  3K0X A;  5EPK A;  1SYD A;  2SOB A;  4O1N A;  2JA6 H;  1LLR D;  1D8L A;  1HA6 A;  2RSN A;  1VF7 A;  3F8T A;  3S15 H;  4C56 C;  5EBC A;  1HZA A;  3TRZ A;  4KLK A;  3MXP A;  3M4O H;  4RCO A;  3Q22 A;  2PI2 A;  4F7X A;  1Q1E A;  2E8G A;  3DEP A;  1WTH A;  2A5H A;  3CMA A;  4QF4 A;  5NUC A;  1U9R A;  3FMC A;  1EWH A;  2PI2 E;  5GAE C;  4BA2 I;  4A3L G;  3I4N H;  1ZEQ X;  1UEB A;  4EQP A;  4HSV A;  4A3J B;  1HUN A;  3SK6 A;  1SNM A;  3U4Z A;  4K5X A;  2ICE C;  1IZ6 A;  2VB2 X;  1MJE A;  3TP6 A;  4YCV A;  1VQJ A;  3E0E A;  3K6O A;  1F9R A;  4ME5 A;  3AFP A;  4RFB A;  3DMU A;  3I73 A;  5M5X H;  5M5W B;  4WJW A;  4CKC A;  2A1A A;  4HJ5 A;  1X3E A;  2B2T C;  4RKL A;  3NEN A;  4POF A;  1DOL A;  1EIH A;  1EY8 A;  3K58 A;  2ZXR A;  1IBM L;  4APV A;  5CV5 A;  1SND A;  4GKK Q;  4QL5 A;  2XSC A;  3HOU H;  2O5J C;  2EJG C;  4A3M B;  3RLN A;  2H1E A;  1H9M A;  4IN3 A;  1F2M A;  3QO2 A;  5ELO A;  5JEA G;  3G6E A;  3HOZ B;  4PZ8 A;  4B3S L;  1X3Q A;  2EYM A;  4QY7 A;  1B2T A;  2DUD A;  4IPG A;  1I4G A;  1MI2 A;  2OF1 A;  1HNW L;  3MAQ A;  2Z4H A;  5LL6 S;  3K5O A;  4YWK A;  1V9P A;  3UE1 A;  2LFN A;  1TXY A;  3SXH A;  3QB3 A;  3K5N A;  1PRT C;  3NQT A;  2F0F A;  3K5M A;  1VQH A;  4IOA A;  2EJF C;  1CKO A;  5C44 B;  2K5N A;  1H9S A;  4A76 A;  1I6H H;  3W2D A;  4RAU C;  5F2D A;  1YJN A;  3S1N H;  3S1Q H;  4IUU A;  1LTI D;  3KUP A;  5BN3 A;  1I4R A;  4OGQ C;  1E0B A;  2OQK A;  4NXM Q;  4A3L H;  1D1I A;  1NNX A;  1LT6 D;  4P74 A;  5C3W A;  2NVT H;  2F0V A;  3K7A B;  5GRO A;  2WB1 G;  2UU9 L;  3I72 A;  1EWI A;  3KFU A;  3PUY A;  3HOW B;  2AQ3 B;  3PIP 3;  4H7B A;  4PV1 C;  2Q2I A;  1TS4 A;  4JG2 A;  2R93 H;  3LWU A;  1II3 A;  3A74 A;  1Q86 C;  2XTI A;  4CHT B;  1GKH A;  1SR3 A;  4IUN A;  4N8X 1;  1DON A;  4Y7N H;  4FP5 D;  3UDI A;  2F0P A;  2VY3 A;  4K6L A;  4O42 A;  3D4R A;  2F0D A;  4M8A A;  1V1O A;  2KED A;  4JV5 L;  1MGS A;  1GD7 A;  1OXT A;  1N33 Q;  2F0S A;  4KY7 A;  2IX1 A;  2BOS A;  2KHI A;  4F8M A;  5JEA H;  5GAD C;  1ICW A;  1IBL L;  3EBE A;  1K3B C;  4FXD A;  2CWA A;  4MHE A;  5EGT A;  2VQE L;  1QZG A;  4NDX A;  2Z6K A;  1STA A;  2B39 A;  4DGZ A;  1YNN C;  2VB3 X;  1UE6 A;  1Q12 A;  5EQ0 A;  1TT2 A;  1TWG H;  4HJ7 A;  2L55 A;  2JA5 B;  3SK4 A;  2B2W A;  3TEH B;  3HGB A;  5E4W C;  4JI5 L;  4H44 C;  1VQE A;  2C35 B;  2FIN B;  1R9T H;  1C8C A;  3PSI A;  2K5Q A;  1ENA A;  2R7Z G;  1AFP A;  4HID A;  4AYB B;  2JEB I;  1CHQ D;  5FJ8 G;  4UPA A;  1B44 D;  5I2X A;  2AHO B;  1VQ6 A;  2ATW A;  1B53 A;  1RIP A;  1X65 A;  4DV2 L;  4H13 C;  1YZ6 A;  3ERS X;  2AUJ D;  1KHI A;  2RCN A;  5LMU Q;  3JAM E;  4A3K G;  3FHW A;  5CV7 A;  3K5L A;  1PFN A;  1VMP A;  1L1O A;  2A69 C;  1SJH D;  5FO9 B;  1K73 C;  3HOY G;  5TSS A;  2ZTD A;  3M4Y A;  1SRO A;  3AYH B;  2IW3 A;  4YWM A;  1IBM Q;  5FK9 C;  3DLL A;  1QUQ B;  1STN A;  1UE7 A;  4JW0 A;  3CQZ B;  1YIT A;  1FNW A;  1CZW A;  1HH2 P;  2JEA I;  1J8I A;  1MJC A;  4C2M H;  4M1U B;  1CA6 A;  3K59 A;  1QNU A;  4PNY A;  2HIX A;  2WKD A;  1PTO F;  3QOL A;  3IFT A;  4JI0 L;  4B3S Q;  1I50 H;  2HQE A;  2F0W A;  4X3S A;  3TRE A;  1HNW Q;  2JA6 B;  4HED A;  4MTK A;  2NTS A;  3S15 B;  4OEL B;  3QIA A;  1BCP F;  4JOI C;  2V4D A;  2PZW A;  2K4K A;  2Q8T A;  1B50 A;  3CKI B;  2CCZ A;  1EIF A;  1JWM D;  2A74 C;  3OOC A;  3UDF A;  4IQZ A;  4DR6 L;  2Q8R E;  1ICF B;  3EN2 A;  2JP1 A;  4DV6 L;  4N9P A;  1AW7 A;  5ELC A;  3OMC A;  5C5L A;  2B2U A;  3A5Z B;  3CCM A;  4CDE C;  3T13 A;  2NB0 A;  3MC0 B;  1D5M C;  2R61 A;  4DXF A;  5FJ8 H;  1QE6 A;  5IY0 A;  1STG A;  1T5X D;  2UU9 Q;  1ZKO A;  5LL6 X;  1K9M C;  5M5X B;  1CHP D;  1JE4 A;  3MVV A;  4KHV A;  1PH9 A;  4FYD A;  4A3K H;  3TP8 A;  2E2J H;  4JI4 L;  2KHS A;  1CQV A;  2J0T D;  3L7Z C;  2K6A A;  4GKJ L;  1HA5 A;  3HOU B;  3BJU A;  1EEF D;  3QG1 A;  4OON A;  4R8N A;  3S14 B;  4JV5 Q;  2RHS B;  1W2B A;  1OO9 B;  1SNP A;  4O2D A;  2L1B A;  1E3P A;  1PZJ D;  4RKB A;  1TU2 B;  3T1Y Q;  4OEM B;  3D0F A;  2NVY H;  5KEE A;  4YY3 L;  4LF4 Q;  4MN3 A;  3T56 B;  2JJQ A;  1PDQ A;  1HQR D;  1HXY D;  1Y1W G;  1EYA A;  1KDB A;  4RMF A;  1VQO A;  4FF2 A;  2FFK B;  2VQE Q;  2CHB D;  3F1Z A;  3C1E A;  3M3Y H;  2IT1 A;  5EPL A;  1RCV D;  1A6X A;  1SYF A;  2F3W A;  1WTQ A;  3K8A A;  5JJL A;  1UWV A;  4JI5 Q;  3X3M A;  3NHH A;  4BBS H;  1Q8I A;  4DAM A;  5C4X G;  1U4L A;  1ZYR C;  5H1S E;  4P71 A;  2KVM A;  1D1K A;  2K5W A;  1SAP A;  1V1Q A;  5T1G A;  2AQ2 B;  4KHZ A;  2NVT B;  3I4M G;  5BN5 A;  1EY6 A;  3N52 A;  3VDY A;  3RZD H;  3GTO H;  4C3I H;  4DV2 Q;  2L4N A;  1I4X A;  4DNR B;  5LMN Q;  2VUM G;  3GV6 A;  1TWA B;  5HGT A;  3GTQ H;  4F88 A;  2E5L L;  1AE3 A;  2BA0 A;  5K5P A;  4IUR A;  1UE1 A;  3A8I E;  1I3Q H;  5HY6 A;  1WD0 A;  1SXT A;  1ILQ A;  1Y8O B;  1E1T A;  1PFS A;  3NUC A;  1CKN B;  3UDX A;  4Y7N B;  1BNZ A;  2L11 A;  2PO4 A;  4FF1 A;  3M7N A;  1VQF A;  4YHH L;  1PZK D;  4A3I G;  3L3O C;  2QA4 A;  1EQT A;  4L6T B;  4PMW A;  2ICI A;  4EVO A;  3D4W A;  3TN2 A;  1B3Q A;  1K0R A;  4YIJ A;  5C0X H;  1VQP A;  4B3R Q;  1L0X B;  4HTH A;  4JBJ A;  4J1M A;  1NE3 A;  4JI0 Q;  4DR7 L;  5D3I B;  2X69 A;  4IUP A;  3G71 A;  3WWV A;  4EQ5 A;  2GVB A;  5FLX E;  2BH8 A;  2LMC B;  1C9O A;  1SMY C;  3D6C A;  4X3U A;  2EE1 A;  1YEZ A;  2L12 A;  3EJI A;  4A3E H;  3M4P A;  3UI2 A;  2LSS A;  1Y1W H;  2MJ8 A;  1Q46 A;  2WII B;  1F2Z A;  1DOM A;  1TWG B;  3SVM A;  1ONL A;  2A6H D;  2SNS A;  1HQM C;  4IZ8 A;  2NYZ D;  5BR8 L;  1DXM A;  1Y1V H;  2XWJ B;  3N6R A;  5IGF A;  1XX8 A;  5D3D A;  5ELF A;  4DR6 Q;  1DOK A;  1VQI A;  1DM0 B;  3H94 A;  1K28 A;  1SYE A;  4DV6 Q;  1N32 L;  5K36 G;  1JT8 A;  5IT9 E;  1EZ8 A;  1SFO B;  3VR4 A;  1S3O A;  1LTG D;  4ZRZ A;  2CVR A;  2DJF C;  1TWC B;  4AQY L;  1YHB A;  1PFM A;  4A3F G;  4JI8 L;  1CT1 D;  1N36 L;  1SSO A;  5JVG 3;  4DK3 C;  3KOJ A;  2R92 G;  4LFB L;  3CCV A;  1E2V A;  2CW0 C;  4DNI A;  2WB1 B;  4MTN A;  5CMD A;  1GOZ A;  4K0K L;  2VUM H;  3MXN B;  1U0L A;  3FP9 A;  5M3F B;  1FGB D;  4JI4 Q;  3BG3 A;  2NWG A;  4UAI A;  3I55 A;  1TII D;  2ASB A;  4GKJ Q;  1F9Q A;  2WFW A;  4G57 A;  3H3V H;  2PW7 A;  3D8G A;  4GNX B;  2L9H A;  2ZTE A;  4FXK C;  2D5D A;  3BVM A;  2YTX A;  4A3I H;  1PHJ A;  1K8O A;  5COR A;  4L5Q A;  2MO0 A;  4OIK A;  1C7Y A;  1Q90 A;  1J5E L;  3W3A A;  3OW2 A;  4YY3 Q;  2F4V L;  1ASY A;  3CU7 A;  4DK1 A;  2HT1 A;  3A55 A;  4YCU A;  3RR5 A;  1GUS A;  1X56 A;  5E7N A;  2VS1 A;  4XQQ A;  2K05 A;  3KLR A;  1X55 A;  3FRP B;  4I7A A;  2K52 A;  3STB C;  2I07 B;  1QVF A;  4R9W A;  3NTK A;  1KAA A;  1EQQ A;  3H91 A;  4LUV A;  4CJ2 C;  4JI1 Q;  4HMJ A;  4NB3 A;  3RZO H;  2EOT A;  3I56 A;  4DUZ Q;  3PF4 A;  3DM1 A;  3W1B A;  4LAA A;  1D2B A;  1BF4 A;  1C0A A;  1W3S A;  1T5E A;  1LT4 D;  4OX9 L;  5K36 H;  2JK8 A;  2WAC A;  1RF2 D;  2MP1 A;  4A75 A;  1XMQ Q;  2R7Z B;  2LXJ A;  1N34 Q;  1LYL A;  3K80 C;  4JK1 C;  4FDB A;  3P7J A;  5CYU A;  4B08 A;  4A3F H;  4J6H A;  1KD1 C;  4DV3 L;  1M4V A;  5C0X I;  1VQ8 A;  2R92 H;  1HPC A;  3ULP A;  4B9X A;  4YCW A;  2E5L Q;  1KAW A;  2N88 A;  3M9B A;  2QCP X;  1JIC A;  2B2T A;  2D0P A;  1TWH H;  3R8B A;  2D62 A;  2MGS A;  1V1P A;  2B63 G;  3HOY B;  1SBB B;  2YV5 A;  2UXC L;  1KIX A;  1TY0 A;  3AFQ A;  4CGY B;  1J9O A;  4HSP A;  4YHH Q;  1S5F D;  4Z9C B;  1GVP A;  1PVO A;  4QUF A;  1EIY B;  2H4O A;  2IY5 B;  1U5K A;  2E75 C;  4DR7 Q;  1I4Q A;  2DN8 A;  1QVC A;  2IL8 A;  4FF3 A;  2UXD L;  2BH2 A;  2Z1C A;  4R4I A;  3MFG A;  2F52 A;  2EYJ A;  3A7L A;  1ENC A;  5IYD G;  1YHQ A;  3QJY A;  3I8Z A;  4IAL A;  4IPH A;  5D14 A;  5BR8 Q;  2Z6B A;  1IKL A;  1XTD A;  2ZJQ A;  3P20 A;  3RD4 A;  3S16 H;  1N32 Q;  1DJR D;  2ZJP A;  1PXU A;  4GNX C;  1H9J A;  3JC6 6;  3URY A;  2HCI A;  4AQY Q;  1AP0 A;  2YU9 H;  1SYG A;  5CR3 A;  2EYP A;  1J6Q A;  4DU9 A;  4JBK A;  1GUT A;  4JI8 Q;  2IHE A;  3HP3 A;  1WTR A;  1N36 Q;  3H3V I;  2F0H A;  3GTO B;  5M5Y B;  3CC2 A;  2UUB L;  4LFB Q;  5FKA C;  3S2H B;  3A5U A;  3KDF B;  3CC7 A;  3BS1 A;  2MFI A;  1G2T A;  4RHS A;  3TBI B;  5ELE A;  1I3Q B;  2VL6 A;  1O78 A;  3SGI A;  3HOX G;  5GAH C;  4EGV A;  4RGO S;  2KBN A;  1NAP A;  1AE2 A;  2B63 H;  1G91 A;  4QB4 A;  5IOD A;  1AZP A;  3GTG B;  2JA9 A;  3VR5 A;  1GJX A;  3KBX A;  1EYD A;  2QDL A;  2I0Q A;  2PNR C;  4XIG S;  4LF8 Q;  2R93 G;  3GTK B;  4ID6 A;  5EKL A;  4ALP A;  1J5E Q;  3FPP A;  2A6E C;  4UY8 C;  3AQQ A;  2F4V Q;  4IOC A;  3CCL A;  4A3G H;  2JA7 B;  3NBI A;  1HUM A;  4LWC A;  4B3T L;  5M9O A;  1Y1W B;  1X9N A;  3GTM H;  4JBM A;  5M3M B;  2NZ1 D;  1RKN A;  4K5W A;  4NP5 A;  5IYD H;  3HG9 A;  2UUC Q;  1Y8N B;  2M00 A;  4KN4 C;  1PYB A;  4QIW B;  2K5V A;  1EIG A;  3OW7 A;  3KYH C;  3R93 A;  3H0G G;  1PH3 A;  5C4X B;  4DR5 L;  5I2Y A;  3MHB A;  3U58 A;  3BVG A;  4OX9 Q;  1JMC A;  1VQN A;  4QCL A;  1OXV A;  1X3F A;  2KJX A;  3I4O A;  1PRT D;  1DGS A;  2QKI C;  1CZG A;  1L0W A;  3I4M B;  1WTX A;  3OIQ A;  4L5R C;  1CUK A;  4DV3 Q;  4CDC C;  1EZ6 A;  1JWU D;  2I5L X;  2Z8L A;  4J15 A;  5CV8 A;  4GLV B;  3DM3 A;  3WOE A;  4BWG B;  2VUM B;  4K5V A;  2F0G A;  3RNU A;  1JOQ A;  2KCT A;  2FXQ A;  2TSS A;  1MBY A;  2I5H A;  4LMQ D;  4EQO A;  4KMU C;  1VQD A;  5G3L D;  2UXC Q;  2FJ2 A;  1PTO B;  1UE5 A;  1IHZ A;  2NVQ H;  1SYC A;  4NW2 A;  1WI5 A;  5HUR A;  3HOX H;  5IP7 H;  1EEI D;  2E2H H;  1YJ9 A;  4XQJ A;  1HFG A;  1WFQ A;  4JI6 L;  5C4H A;  1XMO Q;  1VQ4 A;  4BY1 B;  1WTO A;  2X6L A; 
#chains in the Genus database with same CATH homology
 1BCP B;  3WDN A;  1IKM A;  1C48 A;  4R8I A;  1F9P A;  3S17 B;  4XTC S;  3HOV B;  4PQX A;  2F3V A;  4DXG A;  2WAQ B;  4KI0 A;  1BOS A;  3TP5 A;  3AMU A;  1K8M A;  3IKJ A;  3C2P A;  2PZT A;  2A68 C;  4PMC A;  4K2L A;  3T4A C;  1FD7 D;  1ESF A;  2HDL A;  3PUX A;  2L5T A;  3L9A X;  2RDG A;  3NTI A;  3EQL C;  1RHP A;  1CA5 A;  1TWF B;  1EFI D;  1YNN D;  4KY5 A;  1BQQ T;  2QDB A;  4A93 B;  2PQE A;  1VMC A;  2L0C A;  5E4X A;  2R92 B;  3I3C A;  4FF4 A;  4L8J A;  1ET9 A;  1KNE A;  4HCS A;  2WKC A;  5FLX L;  3GTL B;  1Y69 U;  4IFD H;  1TR5 A;  5T1I A;  4KY6 A;  5JEA J;  1O7Y A;  4XXE A;  3VA5 A;  3HKZ B;  2TMP A;  2MPM A;  2A69 D;  4K2K A;  4OO1 G;  3R2T A;  2DNC A;  2LS0 1;  3MA2 B;  1H9R A;  4RWS C;  3MTS A;  1EY4 A;  4CJ0 B;  1U4M A;  2F4I A;  1Y8P B;  4DA2 A;  1EQV A;  2CQA A;  3C1F A;  2NBF A;  4C3H G;  1A3V A;  3LNN A;  1BDO A;  2F0J A;  5I9P A;  3S16 B;  1PTO C;  1QNK A;  1CTM A;  2DY8 A;  2F0N A;  2JSO A;  2YU9 B;  3M4O B;  3VYS A;  3O13 A;  1BCP C;  1S5E D;  2G9H D;  4FXG C;  5IGB A;  1M8A A;  4BA1 I;  2XN9 C;  5EPJ A;  1JCK B;  4ULL A;  4ZQ3 A;  3I4N B;  5KGU A;  3E0J A;  4E6I A;  3X3N A;  4B9W A;  2C5C A;  4KD3 A;  4Q0F A;  4C3I G;  5C5M A;  2WP8 J;  3BDO A;  5IOC A;  5JOB A;  1S5D D;  3VYR A;  5IGC A;  1NCV A;  2DY7 A;  3LX0 A;  4KKU A;  4OO1 H;  3GTM B;  5IGG A;  2KUM A;  3FVQ A;  5C0X G;  2E76 C;  3C46 A;  1CK1 A;  3MEH A;  2K28 A;  2HCC A;  2JXM B;  4TRD A;  2K32 A;  2PCF B;  1B3A A;  3DXJ C;  4KJN A;  5J1Z A;  4IFD I;  3MZ5 A;  2HDM A;  3D3R A;  1WD1 A;  2M2L A;  1I6H B;  5CV4 A;  4ZKC B;  1V8Q A;  4H0L C;  3S1N B;  1B4O A;  2KEC A;  3S1Q B;  1PYW D;  5JAV A;  4DNT B;  1GUW A;  1ZYR D;  5LHY 1;  4Q5V A;  1XYI A;  1GHK A;  2SDF A;  1QIL A;  1BBX C;  2EY5 A;  4G7Z C;  1YNJ C;  4FNF A;  4X3T A;  5COY A;  1BUV T;  3NWT A;  2B2V C;  2F03 A;  4NMZ A;  2R93 B;  4DK0 A;  2MUY A;  1QG7 A;  1QOH A;  2RKS A;  2BDN A;  3Q24 A;  3DEO A;  1JWS D;  1W6K A;  3RMH A;  3I70 A;  1EY9 A;  5A35 A;  2IX3 A;  1AEX A;  1DYQ A;  4K8J A;  3C3L A;  2QF7 A;  1SMY D;  3H0G B;  1H9K A;  3Q0A A;  3J7A V;  2XNA C;  2F1M A;  3BDL A;  1ESR A;  2PMZ B;  2E74 C;  4K6D A;  4ZLT F;  1ILP A;  2VNU D;  2EDG A;  1E2Z A;  4PMB A;  2LKV A;  4J8Q A;  5KYI A;  2XVS A;  1R9T B;  1XTC D;  1MSH A;  4QUC A;  5C0X J;  5JJZ A;  2EPB A;  4OO1 I;  4IUQ A;  1UAP A;  5AFW A;  5FO8 B;  3Q23 A;  3GO5 A;  5I4D A;  4KV6 A;  3RUZ A;  1LTB D;  1RDP D;  4K8I A;  5C3E B;  3DHQ A;  3J81 E;  1U4R A;  4CKE A;  4C2M B;  4KD4 A;  3MXN A;  4NKL A;  3NTH A;  1I50 B;  2JYO A;  2M9V A;  5IIF A;  3D6W A;  3KLS X;  2J4X A;  2EY1 A;  4KKT A;  3SK8 A;  5CV6 A;  1XWE A;  3CRL C;  1VDZ A;  1AN8 A;  1UEA B;  3PO3 B;  1CI3 M;  1LTS D;  4RGM A;  2F0O A;  4RCN A;  4ZUI A;  2K03 A;  4ZYS A;  3J80 E;  2EYL A;  5EKI A;  1SDF A;  1CQF A;  1SNQ A;  2KA7 A;  3I4L A;  5KNB A;  1JOO A;  3R3O A;  1UUP A;  2YYZ A;  1Z47 A;  3R2I A;  4A3B B;  2EY2 A;  3SK5 A;  1IW7 C;  3OIP A;  3VR2 A;  4TQU S;  4IUV A;  3D31 A;  3VR3 A;  3SEB A;  3WOF A;  1QWY A;  4ABN A;  4XT3 B;  1STY A;  2R6G A;  4A3K B;  2E2J B;  1SE4 A;  1WTW A;  1BO0 A;  1F2L A;  2XWB B;  1RTO A;  1V43 A;  2RDF A;  4P2C B;  4TSS A;  3P1H A;  2D2C C;  3H6M A;  2EYF A;  3OPO A;  1O80 A;  4DAP A;  1U4P A;  1WVL A;  4C3H B;  1MSG A;  2NVY B;  1PLF A;  3VYU A;  3E6Z X;  3OMG A;  1SNO A;  3BDC A;  1LT3 D;  2BE5 C;  5E3F A;  1SE3 A;  3PMF A;  5DNF A;  3OWF A;  3VR6 A;  1KLG D;  1Z7T A;  3DUZ A;  5ELD A;  3M3Y B;  5JVH 3;  1I4H A;  2MHV A;  1STH A;  1I4P A;  2F0M A;  4IUT A;  4BBS B;  3JAM L;  5J22 A;  4FVM A;  1LT5 D;  1JB3 A;  5CBA E;  3KK7 A;  5KND A;  5ELB A;  2O2L D;  3RZD B;  4C3I B;  1JR0 D;  3GTQ B;  4CBV A;  1ENF A;  5KIX A;  5DEH A;  1KTK A;  3SR1 A;  4RGT A;  4KJO A;  2D9U A;  1CFM A;  3PUW A;  1TQO A;  3V2T A;  1F9S A;  2N55 A;  3SHL A;  4C1N K;  2A6E D;  1A2U A;  1HCZ A;  3GD7 A;  2KOL A;  3HRZ C;  5JPN C;  2AQ1 B;  1FYC A;  2AUK A;  4A3E B;  1RTN A;  4JBW A;  1A3U A;  4FO2 A;  2F0U A;  4WFN 3;  3NXW A;  3Q6S A;  1TS3 A;  3FPU B;  1Y1V B;  4N9T A;  2AWN A;  1S4Z A;  1KNA A;  2Q8I B;  1WTP A;  1HFN A;  3SDZ A;  3MXU A;  1BXT A;  2KCN A;  1F2Y A;  4C3J G;  2ZXP A;  3U9O A;  4UDU C;  3EVQ A;  2K5D A;  5I6W A;  4XQN A;  2RA4 A;  1H9S B;  1S5C D;  2ENB A;  1PRT F;  3A8K E;  3K0Y A;  4IFD G;  1W6J A;  3TME A;  1NUC A;  1JC7 A;  5C3X A;  3F2U A;  2K01 A;  2QIL A;  1EY5 A;  1EU4 A;  4A3I B;  3DWA A;  2XRQ D;  5G3L F;  3QOJ A;  2F0E A;  3V96 A;  4KK7 A;  5BN4 A;  1MD2 D;  3FDT A;  1GUN A;  4KN7 C;  4HCE A;  1PFB A;  2I46 A;  3IL8 A;  3GV3 A;  3LWE A;  5EBD A;  3HS0 C;  2BA1 A;  3K57 A;  1RD9 D;  2A68 D;  4DAV A;  3RZO B;  1STE A;  4XYO A;  1KAB A;  3NWS A;  1A15 A;  4HN7 A;  3ITP A;  2ZT9 C;  1BR9 A;  1HHV A;  3BZD B;  2K7V A;  2O5I C;  2BDO A;  1DD2 A;  4A3F B;  1PZI D;  5IGD A;  3QWN A;  4HAE A;  1JQY D;  1QB5 D;  5A2Q E;  2RVL A;  2ZXO A;  1TWH B;  4BBR B;  1LAC A;  1X32 A;  5KYL A;  2PZU A;  2NN6 G;  1O7L A;  1VF5 C;  1CM9 A;  3NQI A;  4KKS A;  1IL8 A;  3I90 A;  1SJE D;  2RDH A;  4K14 A;  1LAB A;  2J7Z A;  1HTP A;  2K33 A;  1B1Z A;  1EY0 A;  3CHB D;  4HMI A;  4OL7 A;  4RHR A;  3MXG A;  3NSW A;  5IT9 L;  5C4Z A;  1D5X C;  3OSO A;  3TP7 A;  4CJ1 B;  4RGN A;  3MFY A;  5D65 A;  1GXD C;  4QMG A;  4IFD J;  2F0T A;  3G6J B;  3P75 A;  1PTO D;  3H3V C;  2NVX B;  3IFD A;  4EQN A;  1ROD A;  4G7H C;  1SNC A;  3GQB A;  4DFA A;  1EY7 A;  1EOT A;  3T16 A;  1KLU D;  2VXW A;  3J81 L;  1BCP D;  2AWO A;  3VA7 A;  1EL0 A;  2B2V A;  4GZY C;  1IYU A;  1FNV A;  2PYK A;  4ODG A;  5KRU A;  2B63 B;  4V19 0;  4DF7 A;  1NR4 A;  2NN6 H;  1EWC A;  3ERO A;  1QJO A;  4LJZ C;  2GA4 B;  3BYT B;  4ZK9 B;  1LO5 D;  1EU3 A;  2F0I A;  4DN4 M;  1LV9 A;  3NE5 B;  4A3G B;  3J80 L;  3VYT A;  3A7A B;  1GUG A;  1STB A;  2IJ0 A;  2B2Y A;  3OWE B;  2LY7 A;  1OXU A;  2NTT A;  1Q3L A;  5I9O A;  2B2W C;  2OEO A;  3I91 A;  4OHJ A;  2WIN B;  3CRK C;  5FOB B;  4C1N I;  1LTA D;  2NUC A;  3E5S A;  1UNS A;  1AZQ A;  2A73 B;  3BYY B;  3D4D A;  2K04 A;  3BVZ A;  1S5B D;  1SEB D;  4LK1 C;  4RA8 A;  1XXG A;  3A54 A;  3S2D B;  1JOR A;  2G9D A;  2X6G A;  5C6A A;  4BS9 A;  2RQX A;  4HR7 B;  3TZD A;  4KTA A;  1QCB D;  2FMM A;  2EVB A;  4MIU A;  3PV0 A;  2NVQ B;  3HOX B;  1DZ1 A;  1YNJ D;  3J7A F;  2E2H B;  2EYO A;  3KBG A;  2XIW A;  2E2D C;  4RH6 A;  3TZU A;  4ZKB B;  3A8J E;  5CV9 A;  3U9S A;  3EA6 A;  1NR2 A;  5IGE A;  1A2T A;  2C9O A;  3GTJ B;  5CGK A;  1NSN S;  2Z4I A;  3KLS A;  1E2W A;  5JPM C;  4ZAI A;  1JOK A;  1O7Z A;  2E2I B;  2B2U C;  1R4P B;  2Y0S B;  4ZUJ A;  5E1F A;  3OHX C;  1EYC A;  2WV6 D;  1SYB A;  3T51 B;  1TKW B;  3TDQ A;  1D6E C;  5CC4 A;  2B2Y C;  2F0L A;  4A3D B;  2BCO A;  4L63 B;  4C3J B;  4DAY A;  2NN6 I;  5C4J B;  2O4X A;  3S9W A;  3PIO 3;  1LTT D;  3IAY A;  2HUG A;  3PUZ A;  2RSO A;  4U68 A;  3EFX D;  1G8Z D;  3M7G A;  2KEE A;  3ERQ A;  3ZYY X;  2JE6 I;  2A6H C;  3RLF A;  1DCZ A;  2CW0 D;  3NP8 A;  3V05 A;  3NK9 A;  3ONA B;  4G7O C;  2RBM A;  3FKI B;  2EJM A;  3HEJ A;  1Z6H A;  3ND9 A;  4WRD A;  5EKK A;  1SE2 A;  1FR3 A;  4I7Z C;  1Q1B A;  5CBE E;  3S1M B;  2XRS D;  2KQ3 A;  2F0Q A;  3S1R B;  2EXZ A;  3H09 A;  3PUV A;  5DM6 3;  2R3Z A;  3SE0 A;  3ND8 A;  5EJW A;  2EY6 A;  1PTO H;  1TS5 A;  2QEJ C;  3AU7 A;  1IYV A;  1GUO A;  5KNC A;  2JA8 B;  1HTL D;  2B8F A;  4U67 3;  3A56 A;  3DWQ A;  2EZV A;  1FNU A;  3GP7 A;  5I6Y A;  5J39 A;  3J7Y W;  1LTR D;  1IW7 D;  2OT2 A;  2F0K A;  5ISR A;  2IX0 A;  2ID0 A;  4S3S A;  3AB9 A;  3NPP A;  5DM7 3;  3G7L A;  2PW5 A;  1B9M A;  1HRJ A;  2K1B A;  1WTV A;  2OXP A;  1PMR A;  1RJT A;  3HZX A;  2B8G A;  4BY7 B;  2EYH A;  1V1P B;  4G4K A;  4V0B A;  3KF8 A;  1TS2 A;  3M85 A;  1KDC A;  1ML0 D;  1WCM B;  5FO7 B;  1OXS C;  2FMC A;  3DWP A;  1G29 1;  2KCC A;  4X3K A;  1X3P A;  5A2Q L;  4WOR A;  2PPB C;  2SEB D;  3TSS A;  1ET6 A;  1G6Z A;  1I6V C;  2BE5 D;  2SNM A;  4CKB A;  3GTP B;  4OIJ A;  1PRT B;  1K83 B;  4ILW A;  1GHJ A;  4I65 A;  4TKO B;  1R4Q B;  3T53 B;  1A3T A;  1TVX A;  2IPK D;  3PO2 B;  3MWY W;  1F77 A;  1B9N A;  1D5Z C;  2IWH A;  4XYQ A;  3NBH A;  2DNE A;  4XT1 B;  3FEW X;  4XDX A;  1G2S A;  1VCI A;  1TY2 A;  1KDA A;  2FHT A;  1L0Y B;  1OXX K;  4F87 A;  1C4Q A;  1ZXT A;  5DAU A;  5EPK A;  1SYD A;  2SOB A;  4O1N A;  1LLR D;  1HA6 A;  2RSN A;  1VF7 A;  4C56 C;  5EBC A;  3MXP A;  4RCO A;  3Q22 A;  4F7X A;  1Q1E A;  3DEP A;  2A5H A;  4QF4 A;  5NUC A;  1U9R A;  3FMC A;  1EWH A;  4BA2 I;  1ZEQ X;  4EQP A;  4HSV A;  4A3J B;  1HUN A;  3SK6 A;  1SNM A;  4K5X A;  2ICE C;  2VB2 X;  3TP6 A;  3K6O A;  1F9R A;  4ME5 A;  4RFB A;  3DMU A;  3I73 A;  5M5W B;  4WJW A;  4CKC A;  2B2T C;  4RKL A;  1DOL A;  1EIH A;  1EY8 A;  3K58 A;  2ZXR A;  5CV5 A;  1SND A;  2XSC A;  2O5J C;  2EJG C;  4A3M B;  2H1E A;  1H9M A;  4IN3 A;  1F2M A;  3QO2 A;  5JEA G;  3HOZ B;  1X3Q A;  2EYM A;  1B2T A;  1I4G A;  1MI2 A;  2OF1 A;  3MAQ A;  2Z4H A;  5LL6 S;  3K5O A;  2LFN A;  3SXH A;  3QB3 A;  3K5N A;  1PRT C;  3NQT A;  2F0F A;  3K5M A;  2EJF C;  5C44 B;  1H9S A;  3W2D A;  4RAU C;  5F2D A;  4IUU A;  1LTI D;  3KUP A;  5BN3 A;  1I4R A;  4OGQ C;  1E0B A;  1D1I A;  1LT6 D;  5C3W A;  2F0V A;  3K7A B;  3I72 A;  3PUY A;  3HOW B;  2AQ3 B;  3PIP 3;  4H7B A;  4PV1 C;  1TS4 A;  3LWU A;  1II3 A;  4CHT B;  4IUN A;  1DON A;  4FP5 D;  2F0P A;  4K6L A;  4O42 A;  3D4R A;  2F0D A;  4M8A A;  1V1O A;  2KED A;  1MGS A;  1OXT A;  2F0S A;  4KY7 A;  2IX1 A;  2BOS A;  4F8M A;  5JEA H;  1ICW A;  4FXD A;  4MHE A;  5EGT A;  4NDX A;  1STA A;  2B39 A;  4DGZ A;  1YNN C;  2VB3 X;  1Q12 A;  5EQ0 A;  1TT2 A;  2JA5 B;  2L55 A;  3SK4 A;  2B2W A;  3HGB A;  5E4W C;  4H44 C;  2FIN B;  1C8C A;  2K5Q A;  1ENA A;  1AFP A;  4AYB B;  2JEB I;  1CHQ D;  1B44 D;  5I2X A;  1B53 A;  4H13 C;  2AUJ D;  3JAM E;  5CV7 A;  3K5L A;  1PFN A;  1VMP A;  2A69 C;  1SJH D;  5FO9 B;  5TSS A;  3M4Y A;  2IW3 A;  5FK9 C;  1STN A;  3CQZ B;  2JEA I;  1FNW A;  1CZW A;  1J8I A;  4M1U B;  1CA6 A;  3K59 A;  1QNU A;  4PNY A;  2WKD A;  1PTO F;  3QOL A;  3IFT A;  2HQE A;  2F0W A;  4X3S A;  2JA6 B;  4HED A;  2NTS A;  3S15 B;  3QIA A;  1BCP F;  2V4D A;  2PZW A;  2Q8T A;  1B50 A;  3CKI B;  1JWM D;  2A74 C;  3OOC A;  4IQZ A;  2Q8R E;  2JP1 A;  4N9P A;  1AW7 A;  5ELC A;  3OMC A;  5C5L A;  2B2U A;  3T13 A;  2NB0 A;  3MC0 B;  1D5M C;  2R61 A;  4DXF A;  1QE6 A;  1STG A;  1T5X D;  1ZKO A;  5LL6 X;  5M5X B;  1CHP D;  1JE4 A;  3MVV A;  4KHV A;  4FYD A;  3TP8 A;  2KHS A;  1CQV A;  2J0T D;  3L7Z C;  2K6A A;  1HA5 A;  3HOU B;  1EEF D;  3QG1 A;  4R8N A;  3S14 B;  1OO9 B;  1SNP A;  2L1B A;  4RKB A;  1PZJ D;  1TU2 B;  5KEE A;  4MN3 A;  3T56 B;  1PDQ A;  1HQR D;  1HXY D;  4FF2 A;  1EYA A;  1KDB A;  2FFK B;  2CHB D;  3C1E A;  2IT1 A;  5EPL A;  1RCV D;  1A6X A;  1SYF A;  2F3W A;  1WTQ A;  3X3M A;  3NHH A;  1Q8I A;  1U4L A;  1ZYR C;  2KVM A;  1D1K A;  2K5W A;  1SAP A;  5T1G A;  2AQ2 B;  4KHZ A;  2NVT B;  5BN5 A;  1EY6 A;  3N52 A;  2L4N A;  1I4X A;  4DNR B;  3GV6 A;  1TWA B;  5HGT A;  4F88 A;  2BA0 A;  5K5P A;  4IUR A;  3A8I E;  1WD0 A;  1SXT A;  1ILQ A;  1Y8O B;  3NUC A;  4Y7N B;  1BNZ A;  2L11 A;  2PO4 A;  4FF1 A;  3M7N A;  1PZK D;  3L3O C;  1EQT A;  4L6T B;  4PMW A;  2ICI A;  4EVO A;  3D4W A;  3TN2 A;  5C0X H;  4YIJ A;  1L0X B;  4HTH A;  4J1M A;  5D3I B;  2X69 A;  4IUP A;  5FLX E;  2LMC B;  1SMY C;  3D6C A;  4X3U A;  2EE1 A;  3EJI A;  2L12 A;  3UI2 A;  2MJ8 A;  2WII B;  1F2Z A;  1DOM A;  1TWG B;  3SVM A;  1ONL A;  2A6H D;  2SNS A;  1HQM C;  4IZ8 A;  2NYZ D;  1DXM A;  2XWJ B;  3N6R A;  5IGF A;  1XX8 A;  5D3D A;  5ELF A;  1DOK A;  1DM0 B;  3H94 A;  1SYE A;  5K36 G;  5IT9 E;  1EZ8 A;  1SFO B;  3VR4 A;  1LTG D;  4ZRZ A;  2CVR A;  1TWC B;  1PFM A;  1CT1 D;  1SSO A;  5JVG 3;  1E2V A;  2CW0 C;  2WB1 B;  5CMD A;  1GOZ A;  5M3F B;  1FGB D;  3BG3 A;  2NWG A;  4UAI A;  1TII D;  1F9Q A;  4G57 A;  2PW7 A;  3D8G A;  2L9H A;  4FXK C;  2D5D A;  3BVM A;  1K8O A;  5COR A;  4OIK A;  1Q90 A;  3W3A A;  3CU7 A;  4DK1 A;  3A55 A;  1GUS A;  4XQQ A;  2K05 A;  3KLR A;  3FRP B;  2I07 B;  4R9W A;  3NTK A;  1KAA A;  3H91 A;  4CJ2 C;  4HMJ A;  2EOT A;  3DM1 A;  4LAA A;  1D2B A;  1BF4 A;  1T5E A;  1LT4 D;  5K36 H;  2R7Z B;  2WAC A;  1RF2 D;  2MP1 A;  4JK1 C;  3P7J A;  5CYU A;  4B08 A;  4J6H A;  1M4V A;  5C0X I;  1HPC A;  4B9X A;  2N88 A;  2QCP X;  1JIC A;  2B2T A;  3R8B A;  2D62 A;  2MGS A;  1V1P A;  3HOY B;  1SBB B;  1TY0 A;  4CGY B;  1J9O A;  4HSP A;  1S5F D;  4Z9C B;  4QUF A;  2H4O A;  2E75 C;  1I4Q A;  2DN8 A;  2IL8 A;  4FF3 A;  2Z1C A;  3MFG A;  2EYJ A;  3A7L A;  1ENC A;  3QJY A;  3I8Z A;  4IAL A;  5D14 A;  1IKL A;  3P20 A;  3RD4 A;  1DJR D;  1PXU A;  1H9J A;  3URY A;  2HCI A;  1AP0 A;  1SYG A;  5CR3 A;  2EYP A;  4DU9 A;  1GUT A;  5M5Y B;  1WTR A;  3HP3 A;  3GTO B;  2F0H A;  3S2H B;  5FKA C;  3BS1 A;  1G2T A;  4RHS A;  3TBI B;  5ELE A;  1I3Q B;  1O78 A;  4EGV A;  4RGO S;  1NAP A;  1G91 A;  4QB4 A;  5IOD A;  1AZP A;  3GTG B;  3VR5 A;  1GJX A;  3KBX A;  1EYD A;  2PNR C;  4XIG S;  3GTK B;  4ID6 A;  5EKL A;  3FPP A;  2A6E C;  2JA7 B;  3NBI A;  1HUM A;  5M9O A;  1Y1W B;  5M3M B;  2NZ1 D;  1RKN A;  4K5W A;  4NP5 A;  3HG9 A;  1Y8N B;  2M00 A;  4KN4 C;  4QIW B;  1EIG A;  3OW7 A;  3R93 A;  5C4X B;  5I2Y A;  3MHB A;  3BVG A;  4QCL A;  1OXV A;  2KJX A;  1PRT D;  2QKI C;  1CZG A;  3I4M B;  1WTX A;  3OIQ A;  1EZ6 A;  1JWU D;  2Z8L A;  5CV8 A;  4BWG B;  3WOE A;  2VUM B;  4K5V A;  2F0G A;  1JOQ A;  2TSS A;  1MBY A;  4EQO A;  4LMQ D;  4KMU C;  5G3L D;  2FJ2 A;  1PTO B;  1IHZ A;  1SYC A;  4NW2 A;  5HUR A;  1EEI D;  4XQJ A;  1HFG A;  5C4H A;  4BY1 B;  1WTO A;  2X6L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...