3C1EA

Crystal structure of staphylococcal nuclease variant delta+phs l125k at cryogenic temperature
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
131
structure length
131
Chain Sequence
KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLKRKAEAQAKKEKLNIWSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS L125K at cryogenic temperature
rcsb
source organism Staphylococcus aureus
total genus 36
structure length 131
sequence length 131
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2008-01-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3c1eA00
3C1EA 1STHA 4MIUA 3OWFA 2QDBA 1SYFA 3QB3A 1EY5A 3EJIA 3NP8A 5C6AA 2PZWA 5I6WA 4DF7A 2WACA 2F3VA 3SK4A 5HURA 1F2ZA 4EVOA 1EY9A 1TQOA 3D6CA 4HMIA 4N9PA 5JOBA 5HGTA 5NUCA 1EY8A 5CGKA 2EYPA 5CV5A 3ERQA 4K8JA 3H6MA 5IGDA 4J1MA 5KRUA 5M9OA 4PMCA 1IHZA 4PNYA 5CC4A 4K14A 1A3TA 3V2TA 2RDFA 2KQ3A 2HQEA 2PW5A 3MHBA 3QOLA 5C4ZA 1STGA 5DAUA 2EY6A 3SK5A 1F2MA 3U9OA 1KABA 4B9XA 2SNSA 4OL7A 4NKLA 4YIJA 3TP7A 4E6IA 3D4WA 4WRDA 4EQOA 4KJNA 2EY2A 5IGEA 2F0EA 2F0JA 4DFAA 5J22A 1EZ6A 3SK8A 5CV6A 1A3UA 4B9WA 4DU9A 1ENCA 2NUCA 3T16A 1EYCA 2F0FA 3MZ5A 3NXWA 4KY6A 1EY4A 3DHQA 3R3OA 3HZXA 4NP5A 5I6YA 2SOBA 4K5WA 5F2DA 5IGFA 5ISRA 4DGZA 5E1FA 1A2TA 1ENAA 2EYFA 3TP5A 3E5SA 1SNDA 3VA5A 2M00A 1AEXA 3BDCA 2F0QA 2EY1A 3OSOA 4ZUIA 2F0KA 3NHHA 5C5LA 1SNPA 1SNOA 4KD3A 4K2LA 1TR5A 4NDXA 1KDBA 4S3SA 5IODA 1SYEA 4HMJA 4RKBA 4KV6A 2F0DA 5EKLA 1STBA 3T13A 1SYGA 1SNMA 1II3A 2OEOA 5IOCA 2F0WA 2PW7A 4G57A 4KJOA 2EYJA 3EVQA 3MVVA 4QB4A 3TMEA 3S9WA 1KAAA 5CR3A 5J39A 3P75A 5IGCA 1EZ8A 5CV9A 5KGUA 1NSNS 3LX0A 4K8IA 2F0GA 5C5MA 1A2UA 2SNMA 3P1HA 4I65A 4K6DA 2PZUA 1JOOA 1TT2A 4EQNA 2F0HA 1JOKA 4KY7A 5J1ZA 5C3XA 4ID6A 4KD4A 2O4XA 5KYLA 3D4DA 1EY6A 1EY7A 1NUCA 2RBMA 2ENBA 4ME5A 4WORA 5DEHA 5EKKA 3SHLA 5KIXA 3HEJA 1EY0A 2F0LA 1STAA 3C1FA 2F0SA 1SYDA 3MXPA 4KY5A 4QMGA 2F0TA 2F0MA 2LKVA 1SNCA 4IZ8A 1KDCA 4QF4A 5IIFA 5I9OA 2EYLA 5IGGA 4ODGA 2EY5A 4N9TA 3SXHA 4F8MA 4R8NA 2OXPA 1SYBA 4ZQ3A 4IUNA 2EXZA 1KDAA 1F2YA 2F0IA 2F3WA 4J6HA 5CV8A 1STYA 2PYKA 2F0UA 5CV4A 2KHSA 4PMBA 2EYMA 4EQPA 3TP6A 4KHVA 4F7XA 3NK9A 2F0NA 3NQTA 5I9PA 5C3WA 1SYCA 3PMFA 4ZUJA 4H7BA 4KTAA 2RKSA 4LAAA 2PZTA 3EROA 5JAVA 2OF1A 3TP8A 3BDLA 2EYOA 4K5VA 2EYHA 1RKNA 1SNQA 5CV7A 3DMUA 1A3VA 5KYIA 4K2KA 3SR1A 1STNA 3D8GA 4HTHA 4K5XA 5K5PA 4TRDA 3NUCA 1JOQA 1EYAA 3QOJA 3RUZA 3SK6A 4RKLA 1U9RA 1EQVA 2F0VA 5KEEA 1JORA 2PQEA 3ITPA 2F0OA 3OMGA 5E3FA 5EGTA 5IGBA 1EYDA 4NMZA 5C4HA 3MEHA 3OMCA 4IALA 2F0PA
chains in the Genus database with same CATH superfamily
3C1EA 1V8QA 4RH6A 1HR0Q 4DUZL 5JJKA 1H95A 4DF7A 3HRZC 1GUNA 4PZ8A 5HURA 1UNSA 4ABNA 1KRTA 4DV7L 3OW2A 2NBFA 3MC0B 3Q6SA 5CGKA 4FNFA 1UE1A 4ZAIA 4OWWB 3ERQA 3WOEA 1CUKA 2KUMA 3AQQA 3KLSA 4FF2A 1IYUA 2VQEQ 2VW9A 3PF5A 5C3EH 1CT1D 1RIPA 4I7ZC 1WI5A 1STGA 2JA9A 3A55A 1WTVA 2K5DA 3KF8A 4DFAA 1X3PA 1BBXC 2HCCA 2F0FA 2A1AA 3AMUA 3RD4A 3K8AA 1YITA 2PQAA 2F03A 5L37A 1GUSA 3U4ZA 2F1MA 3E0EA 2BE5C 1AH9A 1TS5A 4R8IA 3M7NA 2RDHA 1EWIA 1H9JA 1ZYRC 3EVQA 2MUYA 3OYYA 3W3AA 3VYSA 1CQFA 1PH9A 2JE6I 2ZJPA 1D2BA 3H09A 4DR3Q 4RA8A 3OHXC 1YNND 1GM5A 4F88A 1PRTF 2NTSA 1STEA 2CH4W 1JC7A 1I3QH 5EKKA 3HOZB 3HEJA 2F0TA 3NWSA 1HNZL 2E2IB 1HQMC 1RDPD 5FLXc 3TQYA 2OXPA 1SYBA 4Y7NB 5BN3A 1G2SA 5ELFA 3KLWA 2JA6G 2FXQA 4UP7A 1BQQT 5I9PA 2NVQH 1SYCA 3J80E 1HZ9A 4JI8Q 1KXLA 2D9UA 1QILA 5K36H 4O0AA 1M8AA 1YNNC 3A54A 3T1HL 1S40A 4JBKA 3Q0AA 4BBRB 2EQSA 2N3SA 4DAYB 3OTOQ 4GOPC 1D5XC 4R4CA 3VR3A 3A8JE 1W2BA 1JORA 3D0FA 5CMDA 3LWUA 1IBLQ 1EQRA 1QWYA 4H0LC 3H15A 3TEHB 1LLRD 4DAPA 3PGZA 2KCMA 3Q23A 4LNQA 2SEBD 4XYOA 2WACA 2XWJB 1XYIA 1A63A 4AH6A 5BN4A 2FMMA 4FVMA 3T51B 4GNXC 2JA8H 1O7LA 1ZKOA 2LY7A 4C3IG 3GTGB 1NR4A 4PMCA 5LL6S 5C44H 1X3GA 2P5ZX 2ZTCA 1SSOA 2QEXA 4OL7A 3R8BA 3NBHA 2I5HA 3RLNA 2D62A 4A3BG 3SK8A 4YWLA 2NUCA 4OO1I 1EYCA 1L1OB 3PCOB 1BF4A 2DNCA 5ISRA 3EIVA 1TWHB 1SJED 2EYFA 4JI2Q 1BBWA 2AQ2B 3OSOA 1S5BD 4DV5Q 5IODA 2B2TA 1QNKA 4A3DB 4JI3Q 1PTOF 3SGIA 3G6EA 1MSHA 2GVBA 1P16A 3W5OA 1PZID 5IGCA 1JB3A 2HIVA 1DOMA 1J6QA 4ME5A 3PIPA 4GS3A 4HJAA 2M9VA 3JAME 3F8TA 3M4YA 4DUYL 1BBUA 1DCZA 5IIFA 4GLXA 5I2XA 2VY3A 4O1NA 5JJLA 3K5MA 4DV6L 4IURA 5C0XJ 2B8GA 5HGQA 4RG1A 4MTKA 1QG7A 2F0UA 4PMBA 3NPPA 3JAML 3PUXA 1BXTA 3H0GH 1YEZA 3TRZA 1PH6A 1V1PA 2YTYA 4MZ9A 2HDMA 1STNA 2Y0SG 3HG9A 3GD7A 5C4JH 1TWAH 3A5UA 4B3SL 2XWBB 3CPWA 2PQEA 3ITPA 1W3SA 4KKUA 1B3QA 3S1NB 3JAMc 2KEDA 3QO2A 2F4VQ 1X3FA 3MWYW 1IZ6A 5BR8L 4GN3B 1NBWA 1LT4D 2R7ZB 1N32L 1O7ZA 2AHOB 1F9QA 5M9OA 3K6OA 1UEAB 3N6RA 3OIPA 3CQZH 3H91A 1KTKA 4JI7Q 3S15B 3VYTA 1VQJA 3DUZA 4C2MB 5M3FG 2XGTA 4RHRA 3RZDB 4IOAA 1Y14B 2LFNA 2NN6H 4YIJA 5KNDA 1IBKL 4QUCA 1A3UA 4DU9A 4L6TB 1IXRA 4WFN3 4KK7A 2VS1A 4DR1L 4IFDI 1A2TA 1Q81C 1ASZA 2HHHL 3MEFA 1HFNA 2JJQA 3KOJA 1X56A 2XNAC 4OO1H 2O5IC 4ZUIA 2B2WC 1Y1VG 1S5DD 3NQIA 3BZCA 4KD3A 4UP9A 2DN8A 4A93G 3GV3A 4DR7Q 2AUKA 5M5XB 1CK1A 1JJGA 4X3UA 1D7QA 2YV5A 1Y8PB 3GP7A 1NSNS 4HJ7A 3R2IA 4IUQA 1HRJA 2WV6D 3S1RH 4DV0Q 1EOTA 5J1ZA 3A8KE 5KYLA 5JPNC 2BDOA 2JK8A 2A73B 4F87A 2KCCA 2PO4A 4JI4Q 1TWGH 2KBNA 1EY0A 4FF4A 1BCPD 1WTQA 4DNRB 5I9OA 3VDYA 3PUZA 4APVA 1LTSD 4IUNA 2EXZA 4QQBX 3DWPA 3E3XA 1R9TH 4A3EB 5IY0A 3ER0A 3U50C 1LTID 2K50A 1QVCA 3L2PA 4IPHA 3BYTB 2UXBL 1B9MA 5IYCH 1A3VA 3NELA 2K5WA 3I3CA 3HOVH 3HOXG 1BCPC 3K7AB 3S16B 3GTJB 5M3MG 2G9HD 1HNZQ 1SMYD 1SR3A 4UHVA 3QG1A 2E2HB 5IP9G 1HR0L 2IW3A 4MIUA 3A56A 1VQ8A 1R4QB 3ND8A 3RN5A 2RF4A 4EVOA 4N9PA 1A0IA 1KAWA 1QUQB 1VQ5A 3HOWB 1JR0D 1SMXA 2ZXPA 1WOCA 4NW2A 3NWTA 5CBAE 4TKOB 4RCOA 5EBDA 2VQEL 4J1MA 2MHVA 3V2TA 2UXCQ 2RDFA 1WTXA 1BKBA 3CCSA 1XTDA 2CWAA 3MHBA 4BY7G 1NE3A 1SMYC 4JOIC 4JVZA 4WRDA 2QDLA 1NMGA 4XYQA 1B1ZA 2F0JA 1EZ6A 1H9RA 5CV6A 4A3LG 3MZ5A 1E2VA 1VQEA 2BA1A 5JJIA 4HSVA 4DKAC 4KKTA 4CKCA 3UDGA 3DM1A 1I5FA 1PH5A 3BDCA 2F0QA 1SROA 3K5NA 3NHHA 1YBYA 1Q90A 2I46A 1H9SA 4DV2Q 4IFDH 2F0DA 5EKLA 3TMEA 2EYJA 2JA7B 3PO2B 2C5CA 5IP7G 4A3MH 5EKIA 1CKNB 3LX0A 5ELDA 3S2HB 5ELOA 4DR3L 5FLMH 2NVXB 3O13A 1G291 3I4NB 3GTOB 2R92B 4R4QA 1Q8IA 2MGSA 1XPOA 2RBMA 1YJWA 1GO3E 3FKIG 2LKVA 2EYLA 5IYDH 2I5MX 4GLVB 4Q5VA 4IUVA 5CBEE 4H13C 4H02A 1PH7A 3I70A 1A62A 1H9SB 3NBIA 3LGJA 1WCMB 4IN3A 5EAYA 3NK9A 2K7VA 2I5LX 4JI8L 1AZPA 3C3LA 3FHWA 3J81j 3KYHC 5CV7A 3ONAB 1Y69U 1I4XA 1C48A 3SDZA 4HTHA 4NB3A 1WTOA 3OTOL 1TS3A 3M4PA 4L63B 4RKLA 1LTTD 3S1MB 4H44C 2XSCA 1MIUA 4Q0FA 4JW0A 1IBLL 1CSPA 2HQLA 2SDFA 4DAVA 3TDQA 2F3VA 1QZGA 4RMFA 1F9SA 2A6ED 3IFDA 2H1EA 4DA2A 2QF7A 3FEWX 2ICEC 2X6LA 4DN4M 3S17B 1CQVA 3RLOA 4QGUA 2B2UA 1KIXA 2KQ3A 1Q46A 2N78A 2PW5A 2EY6A 3W1GA 3JC66 4LFCQ 3GTKB 3IAYA 4BBSG 1V9PA 2FINB 1EY4A 3DHQA 4L5TA 3K0XA 1VQPA 4JI2L 2H5XA 3ULJA 4TSSA 4DV4Q 1SBBB 1ENFA 3PUYA 4DV5L 1AEXA 2FHTA 5C5LA 3GTLB 4JI3L 2YTXA 4M1UB 1F77A 1A15A 1HFGA 5BN5A 4RCNA 3M3YB 1DZ1A 3KFUA 4L8JA 1CSQA 4I7AA 5C3EG 1EZ8A 5EPKA 1MI2A 4QL5A 4RFBA 3J81L 2CFMA 3LWEA 1JOKA 4YCWA 2X6GA 1M90C 2QA4A 4K0KQ 2EOTA 2ENBA 3BVGA 2HDLA 5KIXA 3CW2C 4GLAC 4BXXH 2N49A 4DR1Q 2F0LA 2RVLA 4JI0Q 3N52A 1P8LA 4P74A 3I4LA 4AQYQ 5GAGC 1E0BA 4QJFA 1ESRA 2F0IA 3NE5B 2ID0A 1RCVD 2KHSA 3J81c 1K3BC 1U4MA 4KLKA 1BO0A 1AFPA 3GTQH 4H7BA 1D6EC 2D0OA 2A19A 3D4RA 5T1GA 3RLFA 2VUMH 1U5KA 4JPBW 1HUNA 3E9IA 3DMUA 3VR4A 3HOUH 3J80i 2RSOA 2ZJRA 2EE1A 5M5YH 2MQHA 4QUFA 2GA4B 3C46A 1B44D 5EGTA 4DR6Q 3S14H 1I94Q 1IL2A 2MJ8A 4C3IB 2F4VL 2EPBA 1K28A 1SE4A 3NP8A 5IWAQ 1JMCA 2H4OA 1E2ZA 1EY9A 3D6CA 3CQZB 5M5WB 2DY7A 2JYOA 2RHQB 1ICWA 4YWKA 2AUJD 1LTRD 4A3BB 1Z7TA 1E1TA 4IUTA 3OIQA 3U4VA 1I50H 3UE1A 5K36G 1RJTA 1LTAD 2A5HA 1OO9B 3QOLA 3HGBA 3K57A 4B9XA 1U4PA 2SNSA 1DONA 1Q82C 1G8ZD 1HNWQ 1G91A 3HKZG 3I8ZA 3M85A 4EGVA 4JK1C 3QJYA 2SOBA 4A3FB 1VF5C 4A3GH 5LMNL 2LXJA 1ENAA 2CHBD 1W6JA 1MSGA 1RHPA 2JA8G 1VQDA 1DD2A 4DR7L 2WAQG 1SNMA 1II3A 2MO1A 5C44G 3PO3H 2E2JH 3MVVA 5J39A 4JI6Q 3MAQA 3GTPB 1SDFA 4C3HH 2F0GA 4DV0L 4C3JH 1XXGA 2Z4HA 3KBGA 5FLXE 4JI4L 1EY6A 1NUCA 4C56C 5DEHA 3A7LA 1H9KA 1TIID 2IX1A 4U673 1STAA 1VQAA 4NXMQ 1AP0A 4WJWA 4QMGA 4XQNA 4IO9A 4KHPQ 1GHJA 2B2TC 4R1JA 1HTLD 2RA4A 1DYQA 2Y0SB 1Y1WH 2E8GA 5FLXL 1SFOB 5CV4A 5COYA 4JBMA 2NVYH 2PPBC 2XRQD 2F4IA 1I4QA 4UY8C 2F0NA 5H1SE 2VL6A 4OHJA 3BG3A 5EPJA 4ZKBB 3HOVB 2PZTA 2IX3A 3E0JA 1FD7D 5IT9L 1VQLA 2D2CC 1ESFA 4LWCA 4K2KA 2JA5H 1F9PA 1PTOH 4CJ0B 3CKIB 4LW1A 4DAYA 2A8VA 3RUZA 4LFBQ 2B8FA 2RCNA 1Z9FA 1G6ZA 4CBVA 2F0OA 5E3FA 4IPGA 1OXTA 1J9OA 1PYBA 4IALA 1ZXTA 4RWSC 2N55A 2Q8IB 1OXXK 1S4ZA 3RNUA 4X3SA 1EY5A 4UPAA 2VXWA 2Q2UA 5M3FB 5IT9c 1Q3LA 4P2CB 1JJCB 1Y8NB 3OOCA 3DM3A 3H0GG 2D5DA 2EYPA 4HJ9A 1K8GA 1PRTD 3Q8DA 5IGDA 3J7YW 3S1QH 2UXCL 2V1CC 4OWXB 2ZM6Q 2AWNA 4DR2Q 1ML0D 3STBD 4Z9CB 2K28A 4POFA 3AYHB 1X3EA 1WVLA 1KABA 3I4MH 1Y1VB 1XWEA 4UP8A 1QVFA 4L5QA 1GKHA 2TMPA 2CQOA 1TU2B 3CCMA 4A93B 1L1OA 1WTPA 2K05A 1HZBA 2E75C 3R3OA 3HZXA 2HUGA 2LXKA 5F2DA 2A68D 1WJJA 1XMQQ 1PH3A 4DK1A 4JCVE 3BJUA 3ND9A 1PDQA 2NN6I 4RGMA 4S3SA 4DV2L 2UUAQ 1KDBA 3S2DB 4XT1B 3X3NA 1VQHA 2WINB 4LK1C 3STBC 1AZQA 3M4OH 5IOCA 2PW7A 1B7YB 1QVGA 2WFWA 4A3IH 1FL0A 2XIWA 2SNMA 1K8OA 2NN6G 4K6DA 4EQNA 2VB3X 5IYBH 4ID6A 5AJ3Q 3Q24A 3HOYH 1WD0A 2XTIA 2HIXA 3D4DA 1EY7A 4DR4Q 3CRKC 3C1FA 1XX8A 2K5HA 1QE6A 4IZ8A 4OX9Q 1F9RA 2K5NA 5IGGA 3PQIA 4F8MA 2R93H 4GN5A 3ULLA 4OO1G 1SRUA 4IQZA 1EIYB 1L0YB 2N8NA 4OGQC 4A3FG 3HOXB 3HS0C 1WTWA 1JCKB 5M3MB 1PFMA 3BZDB 4KI0A 1Q1EA 2EYHA 1SNQA 2K33A 2RSNA 1S5CD 3J7AV 4XDXA 1EFWA 4UAIA 3PIO3 1K73C 2EDGA 4V0BA 5FJ8H 3M7GA 1ONLA 1M1KC 3J7A5 3FP9A 2Z0SA 1D1IA 1E2WA 1PTOD 1TWFB 1NY4A 3OWFA 2Y0SE 1CA6A 2B2YA 2PZWA 5I6WA 4LFAL 2ATWA 2TSSA 2ASBA 4BY7B 3MFYA 4HMIA 1LT5D 1PH4A 1EY8A 3L3OC 1HXYD 1B2TA 4NXNQ 3FPPA 2RDGA 1K0RA 2B63H 2K75A 2OWOA 3W2DA 1PFNA 3UDIA 3HOVG 1F2MA 4LFCL 1V1QA 2BCOA 1PTOC 1U0LA 2L55A 5EBCA 4ALPA 1L2FA 2K5QA 2F0EA 4HAEA 1ENCA 1ILQA 3V96A 4Y52H 4DV4L 5E1FA 4A3JH 1EEID 2RHSB 1AW7A 4YHHQ 2WKDA 3U9SA 1SNPA 1KC8C 2GN5A 3FMCA 4OWTB 5IE8A 1WTRA 1XPRA 2LMCB 4A4IA 1I6HH 1BDOA 2OEOA 3CCLA 3LNNA 4G57A 2UUCQ 1IYVA 3FKIB 1KAAA 5CV9A 1B50A 4X62Q 2XRSD 2B39A 1JWUD 1EWCA 4CDEC 4KY7A 4K0KL 4GNXA 1EEFD 3AEVA 2NVTB 3S24A 1HNXQ 4JI0L 4OONA 4AQYL 5LMNQ 1K83H 4DV3Q 3H3VI 1HUMA 4HR7B 5AFWA 4ZK9B 2EY5A 3GTMH 2VUMB 4R8NA 4GOPB 2L0CA 4HSPA 2PNHA 4ZCKA 2UU9Q 1F2YA 1BOSA 2PMZB 4IFDG 4WJ3M 1CI3M 3NQTA 4CHTB 1D8LA 2VZAA 3CCVA 1HR0W 4BY1H 3EROA 4CDDC 5JAVA 1LABA 2OF1A 4A3MG 2Z9HA 5D3IB 3QIAA 4B3RQ 1B4OA 5FLMG 4LF8Q 1H9MA 1VMPA 4M8AA 1JWMD 4LMQD 4BS9A 5FO9B 3SK6A 4GNXB 4QCLA 1LTGD 4DR6L 1SE2A 1I94L 1VQBA 1ASYA 3RZOB 1GXDC 1JE5A 1S72A 5IWAL 2BOSA 1ZEQX 2Z6KA 1VQCA 4LUVA 2V4DA 1QUQA 1HQRD 2R7DA 1Z6HA 4FDBA 4BA1I 2YU9B 5CV5A 4P75A 4BBSB 2CWPA 3PSIA 2QW7A 1DXMA 3Q22A 4OIKA 3NSWA 5DAUA 1HNWL 2O2LD 4L5SA 4FF1A 4A3GB 1CZGA 4KJNA 3ICEA 5J22A 2PI2E 1RTOA 5JEAH 3UI2A 1IYJB 2M2LA 2K1BA 5C3EB 4V190 5IGFA 2KENA 2MO0A 4YCVA 4P73A 2X69A 1AE3A 1DM0B 2F0KA 2B2UC 5E7NA 2BH2A 1SYEA 4HMJA 1X3QA 2CQAA 4KV6A 1AE2A 4JI6L 3HOZH 3ULPA 2VB2X 3K5LA 4G7HC 5ELBA 3HFZB 1CKNA 3I2ZA 5CR3A 4JG2A 4DK0A 2E2IH 1S5ED 5KGUA 2L12A 1UWVA 1FNWA 4O2DA 3T1YQ 4I65A 5I2YA 4Y7NH 1PFBA 2OQ0A 3D3RA 4KD4A 4JBWA 3SHLA 1X32A 4NXML 5DLQE 4KHPL 1W6KA 1KDCA 1V43A 4AIMA 1FJGQ 3AFPA 4N9TA 3SXHA 1JICA 4C1NK 3TZDA 3H3VH 4BBRH 2EYMA 1VQGA 1I3QB 3I91A 2OTJA 1EWHA 4ZUJA 3PF4A 1YVCA 3T4AC 1CTMA 1RKNA 2KOLA 1R4PB 3SR1A 4LFBL 1J5EQ 1EYAA 1G51A 1HZAA 1ILPA 4XQJA 2E2DC 3EN2A 5ELEA 2NVQB 5IGBA 4BXXG 3QR8A 1X9NA 1HZCA 2F0PA 4NKLA 2EJFC 5KNBA 1Q1BA 5CYUA 3GTGH 3MXGA 2ZT9C 4XQQA 5CORA 1FGBD 3QWNA 2PMZE 4X65Q 1KL9A 1X54A 4ZYSA 3G48A 5FK9C 2VUMG 3HKZB 5G3LF 1EQQA 5FKAC 5KRUA 2ZM6L 4CKBA 1TVXA 2BDNA 2K03A 4DR2L 3HOUG 2QCPX 2HQEA 3CHBD 3CCEA 5D65A 3E6ZX 1TWHH 4FYDA 5ELCA 3SK5A 4DXFA 3UDXA 1XTCD 2RQXA 2A69D 2JA8B 3RR5A 4A3KH 4A3DH 4B9WA 2WAQB 4LFAQ 5C44B 4JV5Q 1SEBD 1XMQL 1OTCA 2BH8A 3GV6A 3VA5A 1A8VA 1XMOQ 2UUAL 5G3LD 1XNQQ 4R9WA 1O7IA 1D5ZC 2KJXA 1STBA 3CF5A 1AN8A 2UXDQ 2Z6BA 2JEBI 1RL2A 1T5XD 1QZHA 4IUPA 5AJ3L 1EUJA 2E5LL 4CJ2C 2A6EC 2KA7A 4DR4L 3I73A 3PUWA 4WORA 4OX9L 3J81E 1SYDA 2K5VA 4A3GG 2MPMA 1SNCA 1VQFA 4ODGA 1BCPB 4JC0A 2Q8TA 1WTHA 2G5DA 4R4TA 2IHFA 4ZKCB 4MN3A 3BVMA 1UEBA 4KHVA 2R3ZA 4TQUS 2LSSA 1B3AA 1EIGA 3PO3G 1PZKD 2FMCA 2ALYB 1MKHA 2RKSA 4LAAA 3WWVA 1C0AA 1PYWD 2N88A 1VQOA 2A6HD 3S1NH 4C3HG 1TWCH 4MTNA 2J0TD 4C3JG 5KYIA 2WKCA 4X3KA 2KECA 4RGNA 1VQ7A 4LF7Q 1IKMA 3QOJA 3I55A 2EVBA 2HT1A 1U9RA 1RD9D 4LF9Q 2R7ZH 4MNOA 2IJ0A 4DK3C 3H0GB 1ET6A 4RHSA 1NTGA 3UE0A 1PH8A 3KJOA 2L1BA 1PXUA 1FVIA 1UUPA 4CDFC 4LF5Q 1Y1WG 2FJ2A 4O42A 3DEOA 3S15H 1EIFA 5C4JB 4GKKQ 4C2MH 1TWAB 1LTBD 3RZDH 4JBJA 1WFQA 4XT3B 4AYBG 2B2VA 4NXNL 3BZKA 3H3VC 1YHBA 1VQIA 1TS4A 4OIJA 1UE7A 2WB1G 5GQOA 1IHZA 3J7AF 1JB7A 1C8CA 4DNIA 3CCUA 2JA5G 1K3RA 2ZTDA 5DM73 1C7YA 1VQMA 3TS0A 3AB9A 4E6IA 3TREA 1MBYA 5IGEA 4EX5A 3L0OA 3DXJC 4PZ7A 5TSSA 1FYCA 2HD3A 1YHAA 2CCZA 2NTTA 5I6YA 5M5XH 2D0PA 3DWQA 1PH2A 4YHHL 3TP5A 1ICFB 4KN7C 3OW7A 2DJGC 4RGOS 3ZJYC 3TSSA 2EY1A 3HKZE 5DM63 1TR5A 2UUCL 3K58A 3A74A 1VDZA 2ES2A 4X62L 3MXNB 3EFXD 1VQ9A 5E4XA 3VR5A 4LF4Q 4G7ZC 1HJPA 3P1HA 3PIOA 1EL0A 1Q12A 3I4MG 3KF6B 5C0XH 4FXDA 2WAQE 2O4XA 4A3EH 4IFDJ 1HNXL 1SN8A 1T9HA 4DV3L 1BUVT 1YNJD 3M4QA 2PCFB 2WP8J 2J4XA 4DR5Q 4BY1B 2UU9L 1LV9A 1KHIA 2C35B 4ZQ3A 3S1RB 1KDAA 1IL8A 4EQPA 3TN2A 3K7AH 3S16H 3B6YA 3GTJH 1TWGB 1YZ6A 2NWGA 2AWOA 2FFKB 3TP8A 4B3RL 2E2HH 4LF8L 4A3IG 5C4XH 1PA6A 1BNZA 1RF2D 1XNRL 3OPOA 5K5PA 2BE5D 4J15A 5IYBG 4A3CH 3HOYG 1R9TB 3VYUA 1NAPA 2BA0A 1EQVA 1CHPD 1YNJC 1PV4A 1O80A 3HOWH 5IT9E 4JI5Q 1ZYRD 3SE0A 1XJVA 1L0XB 2DGYA 3JAMi 4EQOA 1I4HA 2AQ1B 3A7AB 1LM0A 1YI2A 2R93G 1GVPA 4EQ5A 2B3GA 1N36Q 1F2ZA 1U4RA 3BDOA 4PQXA 1B9NA 1LYLA 4HCEA 1ET9A 5T1IA 2OCEA 3PUVA 3MA2B 3NTKA 1GUOA 1PFSA 1EYGA 1KQSA 4K14A 1A3TA 2R61A 1CKMA 2K6AA 4QY7A 5C4ZA 3SVMA 1QCBD 2CKZB 3TP7A 2B2YC 3KK7A 5FJ8G 3W1BA 1BVSA 3KF8B 1I4RA 1SLJA 4CDCC 2A74C 1D5MC 3CC2A 2JA7H 4B3TL 3PO2H 1N33Q 1UE5A 2PQAB 3E5SA 1SNDA 2E74C 3S2HH 1PH1A 3AU7A 2NVXH 3CCQA 4KMUC 3I4NH 1SNOA 4OEMB 3GTOH 2XVSA 2R92H 3I90A 4BWGB 1IBMQ 2L5TA 2IY5B 1SAPA 2PNRC 2B63G 1RODA 4QB4A 2KHIA 4KKSA 3T1YL 2R7FA 1I4PA 3VR6A 2Q8RE 1LT3D 2PZUA 3K59A 4ZRZA 5JVH3 1N34Q 3NENA 2K52A 1WCMH 1JJ2A 1E7ZA 1TS2A 1SXTA 2E76C 4G4KA 1PRTC 3MXPA 1BR9A 2F0MA 1PZJD 1FJGL 4A3MB 3D6WA 4PZ6A 3J80L 4A3JG 4DAMA 3ZYYX 1NR2A 3CD6A 3IRBA 1LTLA 3S1MH 1MJCA 4KTAA 2MFIA 2OT2A 3NEMA 5I4DA 3CU7A 3IKJA 5D14A 3WDNA 2E5LQ 1VS0A 1J5EL 4IUUA 2A68C 3NUCA 1SE8A 4DNTB 3J80c 4FXKC 1D1KA 5FO7B 2L15A 2PI2A 4YY3Q 2L4NA 1STHA 1L0WA 4CKEA 2IWHA 1SJHD 3S17H 4OXPA 3BU2A 4X65L 5HY6A 3T56B 4A75A 4L5RC 1YJ9A 1Q8KA 5JVG3 2MP1A 5HGTA 3WOFA 2I07B 4BY1G 1I4GA 3H6MA 3GTKH 2EIFA 4DV1Q 5CC4A 3EBEA 3G71A 3G4SA 4A3KB 1QOHA 1KNEA 2C9OA 5FOBB 1X6OA 2JXMB 3U9OA 2IPKD 3GTLH 2Z6KC 4PG3A 1N9WA 2UUBQ 4C1NI 4B3MQ 3NBHB 2EZVA 4JV5L 3M3YH 2K01A 4KY6A 4HIDA 1HHVA 1NJIC 1DOKA 4GKJQ 4K5WA 1XMOL 1XNQL 3FVQA 5LHY1 3U58A 4FXGC 3I4OA 2AQ3B 1FR3A 5IYCG 1U4LA 4KN4C 1VMCA 4LF6Q 2JA6H 1GHKA 3AFQA 3R2TA 2UXDL 4N8FA 2F52A 1QB5D 4K8IA 1Y8OB 1A2UA 1QJOA 2NZ1D 1FNVA 2K14A 4X66Q 3F2BA 2DNEA 4ILWA 3GDEA 5JEAG 2CVRA 2OTLA 1GUGA 3MXUA 4HIMA 4KY5A 3H94A 2NZHA 4POGA 4QF4A 1WD1A 5D3DA 1KRSA 3CP0A 4GOPA 4JYAQ 2DUDA 2KVMA 1YNXA 4ME3A 4FF3A 4J6HA 1TWCB 3URYA 4ULLA 4YWMA 1LT6D 2I0QA 4DXGA 3I72A 4HN7A 3HOZG 3CMAA 2JQOA 1OXUA 1C9OA 4K5VA 4C3IH 4X64Q 2VQFQ 2JN4A 1V1PB 4LF7L 1G6PA 3CXCA 1EFID 4LF9L 5M5WH 1OXSC 2F0VA 3KLRA 2KCNA 4J8QA 3A5ZB 4PV1C 4NMZA 3GTQB 4JI1Q 3PV0A 1PHJA 4A3BH 1A6XA 1XPUA 4FO2A 3GO5A 4R4IA 2QDBA 1SYFA 4LF5L 1MGSA 3HOUB 4LUOA 3KDFA 1YJNA 5C6AA 4GKKL 1K0SA 5JPMC 1MHWC 3SK4A 1HA5A 4DUZQ 1Q86C 5M5YB 3VA7A 4BBRG 3ERSX 3UDFA 5NUCA 2QKIC 4DV7Q 3A8IE 3MTSA 3S14B 1G2TA 1BCPF 1VF7A 2Q2TA 1CKOA 1PYSB 1K9MC 4RAUC 4PNYA 1VQNA 1XNRQ 2GVAA 1DJRD 3CCJA 4XXEA 1PRTB 1KD1C 1F2LA 4A3FH 1B8AA 1EU4A 2QEJC 4IJLA 5IYDG 5LMUL 4XIGS 2EY2A 1CHQD 4HJ5A 1I50B 3KDFB 4IPCA 2ZXRA 2JEAI 1VQ4A 2IT1A 5GAHC 2IL8A 4XTCS 3RMHA 3I56A 3GTPH 2JP1A 2CW0D 4DK6C 2M00A 2IX0A 2YYZA 3HKSA 2DJFC 4K2LA 1TKWB 1KLGD 4RKBA 4A76A 1CFMA 2KEEA 2K04A 5JJZA 4HCSA 1C4QA 1E3PA 2NZOA 3HP3A 4KJOA 3P75A 4LF4L 1GUWA 1JQYD 2XN9C 1YHQA 3NTIA 4HIOA 5C3XA 4A3KG 1SFOH 1TY0A 4A3DG 4HJ8A 3PO3B 2Z1CA 1FGUA 2CW0C 1MJEA 4B3TQ 2E2JB 2F0SA 4F7XA 4DR5L 1MD2D 2K32A 3F2CA 2QILA 4C3HB 3R93A 4C3JB 5GAEC 3G6JB 3IL8A 1I6VC 1IW7D 1KLUD 1UAPA 3J81i 2F3WA 5LL6X 1GD7A 5C4XB 2PYKA 3TP6A 5A2QE 3PMFA 3DWAA 2L11A 4IJHA 2EYOA 3F2DA 4G7OC 2DY8A 4K5XA 3T1HQ 1Y1WB 4HEDA 3DEPA 1S5FD 4LJZC 1E22A 2ZTEA 1QNUA 5M3FH 2NVYB 1K8MA 5A2QL 4X3TA 4YCUA 4JI5L 3OMGA 4AYBB 1X55A 3CC4A 3L9AX 4NP5A 1HPCA 1IW7C 3PIP3 2WB1B 4PMWA 1GOZA 5GROA 4IPDA 5EPLA 5E4WC 2JA5B 1N36L 1PTOB 2YTVA 3DLLA 2EXDA 5JOBA 3BS1A 1SE3A 3F2UA 2B29A 1Y1VH 2AKWB 2K4KA 4A93H 2B2WA 1EQTA 1FNUA 3MFGA 4WJ4A 2NYZD 3V05A 1E1OA 4HIKA 2R7ZG 2EJMA 5EQ0A 3P7JA 2ICIA 4DPGA 3P20A 1S3OA 3S1QB 3S2DH 3CPFA 1NNXA 3T16A 1EIHA 1RTNA 5EJWA 4QIWB 1K8AC 4GZYC 2B2VC 1N33L 4LUZA 3EA6A 1LUZA 3I4MB 1IBML 2R6GA 3CRLC 2IHEA 2HCIA 1HA6A 3T13A 1SYGA 3K0YA 2OQKA 3FDTA 3S9WA 1CZWA 4RGTA 1N8RC 2F3IA 3CAMA 5KNCA 1N34L 1JOOA 1TT2A 1Z47A 3C2PA 1JE4A 4K6LA 4P72A 2L9HA 4CGYB 1M4VA 3HOXH 3M4OB 2Z4IA 4FP5D 5FO8B 5M3MH 3TBIB 4BA2I 4MHEA 5IP9H 4DUYQ 3E9HA 4A3IB 3BYYB 2VNUD 5CV8A 5C0XI 4DV6Q 1LACA 3HOYB 3G7LA 3D31A 3OWEB 4U68A 3K81C 1EU3A 3CCRA 1O78A 2A69C 3TZUA 3GQBA 4NPSA 1GJXA 3BDLA 2ZJQA 1TWFH 1X65A 2R93B 5C0XG 3BVZA 3A0JA 1T5EA 1VQKA 2NB0A 4BY7H 2LS01 3J7ZC 4A3EG 4IOCA 5KEEA 5GADC 4B08A 5A35A 4B3SQ 1V1OA 1EYDA 4YY3L 1WYDA 3OMCA 1HCZA 3F1ZA 4A3LH 1YIJA 3CC7A 4JOIA 3QB3A 3EJIA 3K7UC 3L7ZC 3FRPB 1TQOA 5BR8Q 2EJGC 1N32Q 1JWSD 4K8JA 4DV1L 3FPUB 5C4XG 1HTPA 1B70B 4R4OA 5DNFA 4A3CG 3IFTA 5IP7H 1PLFA 4AYBE 2KCTA 3HOWG 3VYRA 1NCVA 2Q2IA 1J8IA 2JSOA 3D4WA 2UUBL 4B3ML 1KNAA 3K5OA 2WB1E 4UDUC 1IBKQ 4GKJL 3NXWA 2B63B 2CH4A 1LO5D 2G9DA 3FKIH 1E24A 2JA6B 2A6HC 1PMRA 4DGZA 1TXYA 1NMFA 4GN4B 2HHHQ 4OELB 3X3MA 4LF6L 4NDXA 1VCIA 1EOVA 3NTHA 5LMNW 4N8X1 5JEAJ 2NVTH 1CA5A 1B53A 3MXNA 2F0WA 4KHZA 2AMCB 1PVOA 3KBXA 4A3JB 2J7ZA 2MNAA 3KF6A 5C5MA 4X66L 1O7YA 5LMUQ 1IKLA 2F0HA 4CJ1B 1DGSA 3KUPA 3KJPA 1DOLA 3I7FA 1I6HB 4QIWE 1UE6A 2O5JC 2JA7G 4JYAL 3SEBA 3PO2G 1JT8A 2RCFA 3I4NG 2R92G 1STYA 2Q2HA 1GUTA 3CMEA 4TVAB 2WIIB 1HH2P 5C3WA 1CM9A 2KHJA 1L1OC 5ELNA 1K83B 3EQLC 4X64L 2VQFL 1VQ6A 3K80C 3RZOH 3TS2A 2Z8LA 3GTMB 2UXBQ 2QGQA 4ZLTF 3D8GA 1OXVA 3KLSX 4TRDA 4JI7L 1JOQA 4P71A 5J3BA 3T53B 3RN2A 1WCMG 3VR2A 1TY2A 2ZXOA 4JI1L 1Q7YC 4X6AH 2YU9H 5C4HA 3MEHA 3M9BA 4BBSH
chains in the Genus database with same CATH topology
3C1EA 1V8QA 4RH6A 4DF7A 3HRZC 1GUNA 5HURA 1UNSA 4ABNA 2NBFA 3MC0B 3Q6SA 5CGKA 4FNFA 4ZAIA 3ERQA 3WOEA 2KUMA 4FF2A 3KLSA 1IYUA 1CT1D 4I7ZC 1STGA 3A55A 1WTVA 2K5DA 3KF8A 4DFAA 1X3PA 1BBXC 2HCCA 2F0FA 3AMUA 3RD4A 2F03A 1GUSA 2F1MA 2BE5C 1TS5A 4R8IA 3M7NA 2RDHA 1H9JA 1ZYRC 3EVQA 2MUYA 3W3AA 3VYSA 1CQFA 2JE6I 1D2BA 3H09A 4RA8A 3OHXC 1YNND 4F88A 1PRTF 2NTSA 1STEA 1JC7A 5EKKA 3HOZB 3HEJA 2F0TA 3NWSA 2E2IB 1HQMC 1RDPD 2OXPA 1SYBA 4Y7NB 5BN3A 1G2SA 5ELFA 1BQQT 5I9PA 1SYCA 3J80E 2D9UA 1QILA 5K36H 1M8AA 1YNNC 3A54A 3Q0AA 4BBRB 1D5XC 3VR3A 3A8JE 1JORA 5CMDA 3LWUA 1QWYA 4H0LC 1LLRD 4DAPA 3Q23A 2SEBD 4XYOA 2WACA 2XWJB 1XYIA 5BN4A 2FMMA 4FVMA 3T51B 1O7LA 1ZKOA 2LY7A 4C3IG 3GTGB 1NR4A 4PMCA 5LL6S 1SSOA 4OL7A 3R8BA 3NBHA 2D62A 3SK8A 4OO1I 2NUCA 1EYCA 1BF4A 2DNCA 5ISRA 1TWHB 1SJED 2EYFA 2AQ2B 3OSOA 1S5BD 5IODA 2B2TA 1QNKA 4A3DB 1PTOF 1MSHA 1PZID 5IGCA 1JB3A 1DOMA 4ME5A 2M9VA 3JAME 3M4YA 1DCZA 5IIFA 5I2XA 4O1NA 3K5MA 4IURA 5C0XJ 2B8GA 1QG7A 2F0UA 4PMBA 3NPPA 3JAML 3PUXA 1BXTA 1V1PA 2HDMA 1STNA 3HG9A 3GD7A 2XWBB 2PQEA 3ITPA 4KKUA 3S1NB 2KEDA 3QO2A 3MWYW 1LT4D 2R7ZB 1O7ZA 1F9QA 5M9OA 3K6OA 1UEAB 3N6RA 3OIPA 3H91A 1KTKA 3S15B 3VYTA 3DUZA 4C2MB 4RHRA 3RZDB 2LFNA 2NN6H 4YIJA 5KNDA 4QUCA 1A3UA 4DU9A 4L6TB 4WFN3 4KK7A 4IFDI 1A2TA 1HFNA 2XNAC 4OO1H 2O5IC 4ZUIA 2B2WC 1S5DD 3NQIA 4KD3A 2DN8A 3GV3A 2AUKA 5M5XB 1CK1A 4X3UA 1Y8PB 3GP7A 1NSNS 3R2IA 4IUQA 1HRJA 2WV6D 1EOTA 5J1ZA 3A8KE 5KYLA 5JPNC 2BDOA 2A73B 4F87A 2KCCA 2PO4A 4FF4A 1EY0A 1BCPD 1WTQA 4DNRB 5I9OA 3PUZA 1LTSD 4IUNA 2EXZA 3DWPA 4A3EB 1LTID 3BYTB 1B9MA 1A3VA 2K5WA 3I3CA 1BCPC 3K7AB 3S16B 3GTJB 2G9HD 1SMYD 3QG1A 2E2HB 2IW3A 4MIUA 3A56A 1R4QB 3ND8A 4EVOA 4N9PA 3HOWB 1JR0D 2ZXPA 4NW2A 3NWTA 5CBAE 4TKOB 4RCOA 5EBDA 4J1MA 2MHVA 3V2TA 2RDFA 1WTXA 3MHBA 1SMYC 4WRDA 4XYQA 1B1ZA 2F0JA 1EZ6A 1H9RA 5CV6A 3MZ5A 1E2VA 2BA1A 4HSVA 4KKTA 4CKCA 3DM1A 3BDCA 2F0QA 3K5NA 3NHHA 1Q90A 2I46A 1H9SA 4IFDH 2F0DA 5EKLA 3TMEA 2EYJA 2JA7B 3PO2B 2C5CA 5EKIA 3LX0A 5ELDA 3S2HB 2NVXB 3O13A 1G291 3I4NB 3GTOB 2R92B 1Q8IA 2MGSA 2RBMA 2LKVA 2EYLA 4Q5VA 4IUVA 5CBEE 4H13C 3I70A 1H9SB 3NBIA 1WCMB 4IN3A 3NK9A 2K7VA 1AZPA 3C3LA 5CV7A 3ONAB 1Y69U 1I4XA 1C48A 3SDZA 4HTHA 1WTOA 1TS3A 4L63B 4RKLA 1LTTD 3S1MB 4H44C 2XSCA 4Q0FA 2SDFA 4DAVA 3TDQA 2F3VA 1F9SA 2A6ED 3IFDA 2H1EA 4DA2A 2QF7A 3FEWX 2ICEC 2X6LA 4DN4M 3S17B 1CQVA 2B2UA 2KQ3A 2PW5A 2EY6A 3GTKB 3IAYA 2FINB 1EY4A 3DHQA 4TSSA 1SBBB 1ENFA 3PUYA 1AEXA 2FHTA 5C5LA 3GTLB 4M1UB 1F77A 1A15A 1HFGA 5BN5A 4RCNA 3M3YB 1DZ1A 4L8JA 1EZ8A 5EPKA 1MI2A 4RFBA 3J81L 3LWEA 1JOKA 2X6GA 2EOTA 2ENBA 3BVGA 2HDLA 5KIXA 2F0LA 2RVLA 3N52A 3I4LA 1E0BA 1ESRA 2F0IA 3NE5B 2ID0A 1RCVD 2KHSA 1U4MA 1BO0A 1AFPA 4H7BA 1D6EC 3RLFA 3D4RA 5T1GA 1HUNA 3DMUA 3VR4A 2RSOA 2EE1A 4QUFA 2GA4B 3C46A 1B44D 5EGTA 2MJ8A 4C3IB 2EPBA 1SE4A 3NP8A 2H4OA 1E2ZA 1EY9A 3D6CA 3CQZB 5M5WB 2DY7A 2JYOA 1ICWA 2AUJD 1LTRD 4A3BB 1Z7TA 4IUTA 3OIQA 5K36G 1RJTA 1LTAD 2A5HA 1OO9B 3QOLA 3HGBA 3K57A 4B9XA 1U4PA 2SNSA 1DONA 1G8ZD 1G91A 3I8ZA 3M85A 4EGVA 4JK1C 3QJYA 2SOBA 4A3FB 1VF5C 1ENAA 2CHBD 1W6JA 1MSGA 1RHPA 1DD2A 1SNMA 1II3A 3MVVA 5J39A 3MAQA 3GTPB 1SDFA 2F0GA 1XXGA 2Z4HA 3KBGA 5FLXE 1EY6A 1NUCA 4C56C 5DEHA 3A7LA 1H9KA 1TIID 2IX1A 4U673 1STAA 1AP0A 4WJWA 4QMGA 4XQNA 1GHJA 2B2TC 1HTLD 2RA4A 1DYQA 2Y0SB 5FLXL 1SFOB 5CV4A 5COYA 2PPBC 2XRQD 2F4IA 1I4QA 2F0NA 4OHJA 3BG3A 5EPJA 4ZKBB 3HOVB 2PZTA 2IX3A 3E0JA 1FD7D 5IT9L 2D2CC 1ESFA 4K2KA 1F9PA 1PTOH 4CJ0B 3CKIB 4DAYA 3RUZA 2B8FA 1G6ZA 4CBVA 2F0OA 5E3FA 1OXTA 1J9OA 4IALA 1ZXTA 4RWSC 2N55A 2Q8IB 1OXXK 1S4ZA 4X3SA 1EY5A 2VXWA 5M3FB 1Q3LA 4P2CB 1Y8NB 3OOCA 2D5DA 2EYPA 1PRTD 3J7YW 5IGDA 2AWNA 1ML0D 4Z9CB 2K28A 1WVLA 1KABA 1Y1VB 1XWEA 2TMPA 1TU2B 4A93B 1WTPA 2K05A 2E75C 3R3OA 3HZXA 2HUGA 5F2DA 2A68D 4DK1A 1PDQA 3ND9A 2NN6I 4RGMA 4S3SA 1KDBA 3S2DB 4XT1B 3X3NA 2WINB 4LK1C 1AZQA 5IOCA 2PW7A 2XIWA 2SNMA 1K8OA 2NN6G 4K6DA 4EQNA 2VB3X 4ID6A 3Q24A 1WD0A 3D4DA 1EY7A 3CRKC 3C1FA 1XX8A 1QE6A 4IZ8A 1F9RA 5IGGA 4F8MA 4OO1G 4IQZA 1L0YB 4OGQC 3HOXB 3HS0C 1WTWA 1JCKB 5M3MB 1PFMA 3BZDB 4KI0A 1Q1EA 2EYHA 1SNQA 2K33A 2RSNA 1S5CD 3J7AV 4XDXA 4UAIA 3PIO3 2EDGA 4V0BA 3M7GA 1ONLA 1D1IA 1E2WA 1PTOD 1TWFB 3OWFA 1CA6A 2B2YA 2PZWA 5I6WA 2TSSA 4BY7B 3MFYA 4HMIA 1LT5D 1EY8A 3L3OC 1HXYD 1B2TA 3FPPA 2RDGA 3W2DA 1PFNA 1F2MA 2BCOA 1PTOC 2L55A 5EBCA 2K5QA 2F0EA 4HAEA 1ENCA 1ILQA 3V96A 5E1FA 1EEID 1AW7A 2WKDA 3U9SA 1SNPA 3FMCA 1WTRA 2LMCB 1BDOA 2OEOA 3LNNA 4G57A 1IYVA 3FKIB 1KAAA 5CV9A 1B50A 2XRSD 2B39A 1JWUD 1EWCA 4KY7A 2NVTB 1EEFD 1HUMA 4HR7B 5AFWA 4ZK9B 2EY5A 2VUMB 4R8NA 2L0CA 4HSPA 1F2YA 1BOSA 2PMZB 4IFDG 1CI3M 3NQTA 4CHTB 3EROA 5JAVA 1LABA 2OF1A 5D3IB 3QIAA 1B4OA 1H9MA 1VMPA 4M8AA 1JWMD 4BS9A 4LMQD 5FO9B 3SK6A 4QCLA 1LTGD 1SE2A 3RZOB 1GXDC 2BOSA 1ZEQX 2V4DA 1HQRD 1Z6HA 4BA1I 2YU9B 5CV5A 4BBSB 1DXMA 3Q22A 4OIKA 3NSWA 5DAUA 2O2LD 4FF1A 4A3GB 1CZGA 4KJNA 5J22A 1RTOA 5JEAH 3UI2A 2M2LA 2K1BA 5C3EB 4V190 5IGFA 2X69A 1DM0B 2F0KA 2B2UC 1SYEA 4HMJA 1X3QA 2CQAA 4KV6A 2VB2X 3K5LA 4G7HC 5ELBA 5CR3A 4DK0A 1S5ED 5KGUA 2L12A 1FNWA 4I65A 5I2YA 1PFBA 3D3RA 4KD4A 4JBWA 3SHLA 1X32A 1W6KA 1KDCA 1V43A 4N9TA 3SXHA 1JICA 4C1NK 3TZDA 2EYMA 1I3QB 3I91A 1EWHA 4ZUJA 3T4AC 1CTMA 1RKNA 2KOLA 1R4PB 3SR1A 1EYAA 1ILPA 4XQJA 2E2DC 5ELEA 2NVQB 5IGBA 2F0PA 4NKLA 2EJFC 5KNBA 1Q1BA 5CYUA 3MXGA 2ZT9C 4XQQA 5CORA 1FGBD 3QWNA 4ZYSA 5FK9C 3HKZB 5G3LF 5FKAC 5KRUA 4CKBA 1TVXA 2BDNA 2K03A 2QCPX 2HQEA 3CHBD 5D65A 3E6ZX 4FYDA 5ELCA 3SK5A 4DXFA 1XTCD 2RQXA 2A69D 2JA8B 4B9WA 2WAQB 5C44B 1SEBD 3GV6A 3VA5A 5G3LD 4R9WA 1D5ZC 2KJXA 1STBA 1AN8A 2JEBI 1T5XD 4IUPA 4CJ2C 2A6EC 2KA7A 3I73A 3PUWA 4WORA 3J81E 1SYDA 2MPMA 1SNCA 4ODGA 1BCPB 2Q8TA 4ZKCB 4MN3A 3BVMA 4KHVA 2R3ZA 4TQUS 1B3AA 1EIGA 1PZKD 2FMCA 2RKSA 4LAAA 1PYWD 2N88A 2A6HD 4C3HG 2J0TD 4C3JG 5KYIA 2WKCA 4X3KA 2KECA 4RGNA 1IKMA 3QOJA 2EVBA 1U9RA 1RD9D 2IJ0A 3H0GB 1ET6A 4RHSA 2L1BA 1PXUA 1UUPA 2FJ2A 4O42A 3DEOA 5C4JB 1TWAB 1LTBD 4XT3B 2B2VA 3H3VC 1TS4A 4OIJA 1IHZA 3J7AF 1C8CA 5DM73 3AB9A 4E6IA 1MBYA 5IGEA 3DXJC 5TSSA 1FYCA 2NTTA 5I6YA 3DWQA 3TP5A 4KN7C 3OW7A 4RGOS 3TSSA 2EY1A 5DM63 1TR5A 3K58A 1VDZA 3EFXD 5E4XA 3VR5A 4G7ZC 3P1HA 1EL0A 1Q12A 4FXDA 5C0XH 2O4XA 4IFDJ 1BUVT 1YNJD 2PCFB 2WP8J 2J4XA 4BY1B 1LV9A 4ZQ3A 3S1RB 1KDAA 1IL8A 4EQPA 3TN2A 1TWGB 2NWGA 2AWOA 2FFKB 3TP8A 1BNZA 1RF2D 3OPOA 5K5PA 2BE5D 1R9TB 3VYUA 1NAPA 2BA0A 1EQVA 1CHPD 1YNJC 1O80A 5IT9E 1ZYRD 3SE0A 1L0XB 4EQOA 1I4HA 2AQ1B 3A7AB 1F2ZA 1U4RA 3BDOA 4PQXA 1B9NA 4HCEA 1ET9A 5T1IA 3PUVA 3MA2B 3NTKA 1GUOA 4K14A 1A3TA 2R61A 2K6AA 5C4ZA 3SVMA 1QCBD 3TP7A 2B2YC 3KK7A 1I4RA 2A74C 1D5MC 3E5SA 1SNDA 2E74C 3AU7A 4KMUC 1SNOA 2XVSA 3I90A 4BWGB 2L5TA 1SAPA 2PNRC 1RODA 4QB4A 4KKSA 1I4PA 3VR6A 2Q8RE 1LT3D 2PZUA 3K59A 4ZRZA 5JVH3 1TS2A 1SXTA 2E76C 4G4KA 1PRTC 3MXPA 1BR9A 2F0MA 1PZJD 4A3MB 3D6WA 3J80L 3ZYYX 1NR2A 4KTAA 2OT2A 5I4DA 3CU7A 3IKJA 5D14A 3WDNA 4IUUA 2A68C 3NUCA 4DNTB 4FXKC 1D1KA 5FO7B 2L4NA 1STHA 4CKEA 2IWHA 1SJHD 3T56B 5JVG3 2MP1A 5HGTA 3WOFA 2I07B 1I4GA 3H6MA 5CC4A 4A3KB 1QOHA 1KNEA 2C9OA 5FOBB 2JXMB 3U9OA 2IPKD 4C1NI 2EZVA 2K01A 4KY6A 1HHVA 1DOKA 4K5WA 3FVQA 5LHY1 4FXGC 2AQ3B 1FR3A 1U4LA 4KN4C 1VMCA 1GHKA 3R2TA 1QB5D 4K8IA 1Y8OB 1A2UA 1QJOA 2NZ1D 1FNVA 2DNEA 4ILWA 5JEAG 2CVRA 1GUGA 3MXUA 4KY5A 3H94A 4QF4A 1WD1A 5D3DA 2KVMA 4FF3A 4J6HA 1TWCB 3URYA 4ULLA 1LT6D 4DXGA 3I72A 4HN7A 1OXUA 4K5VA 1V1PB 1EFID 1OXSC 2F0VA 3KLRA 2KCNA 4J8QA 4PV1C 4NMZA 3GTQB 3PV0A 1A6XA 4FO2A 3GO5A 2QDBA 1SYFA 1MGSA 3HOUB 5C6AA 5JPMC 3SK4A 1HA5A 5M5YB 3VA7A 5NUCA 2QKIC 3A8IE 3MTSA 3S14B 1G2TA 1BCPF 1VF7A 4RAUC 4PNYA 1DJRD 4XXEA 1PRTB 1F2LA 1EU4A 2QEJC 4XIGS 2EY2A 1CHQD 1I50B 2JEAI 2ZXRA 2IT1A 2IL8A 4XTCS 3RMHA 2JP1A 2CW0D 2M00A 2IX0A 2YYZA 4K2LA 1TKWB 1KLGD 4RKBA 1CFMA 2KEEA 2K04A 5JJZA 4HCSA 1C4QA 3HP3A 4KJOA 3P75A 1GUWA 1JQYD 2XN9C 3NTIA 5C3XA 1TY0A 3PO3B 2Z1CA 2E2JB 2CW0C 2F0SA 4F7XA 1MD2D 2K32A 2QILA 4C3HB 3R93A 4C3JB 3G6JB 3IL8A 1I6VC 1IW7D 1KLUD 1UAPA 2F3WA 5LL6X 5C4XB 2PYKA 3TP6A 5A2QE 3PMFA 3DWAA 2L11A 2EYOA 4G7OC 2DY8A 4K5XA 1Y1WB 4HEDA 3DEPA 1S5FD 4LJZC 1QNUA 2NVYB 1K8MA 5A2QL 4X3TA 3OMGA 4AYBB 3L9AX 4NP5A 1HPCA 1IW7C 3PIP3 2WB1B 4PMWA 1GOZA 5EPLA 5E4WC 2JA5B 1PTOB 5JOBA 3BS1A 1SE3A 3F2UA 2B2WA 1EQTA 1FNUA 3MFGA 2NYZD 3V05A 2EJMA 5EQ0A 3P7JA 2ICIA 3P20A 3S1QB 3T16A 1EIHA 1RTNA 5EJWA 4QIWB 4GZYC 2B2VC 3EA6A 3I4MB 2R6GA 3CRLC 2HCIA 1HA6A 3T13A 1SYGA 3K0YA 3FDTA 3S9WA 1CZWA 4RGTA 5KNCA 1JOOA 1TT2A 1Z47A 3C2PA 1JE4A 4K6LA 2L9HA 4CGYB 1M4VA 3M4OB 2Z4IA 4FP5D 5FO8B 3TBIB 4BA2I 4MHEA 4A3IB 3BYYB 2VNUD 5CV8A 5C0XI 1LACA 3HOYB 3G7LA 3D31A 3OWEB 4U68A 1EU3A 1O78A 2A69C 3TZUA 3GQBA 1GJXA 3BDLA 2R93B 5C0XG 3BVZA 1T5EA 2NB0A 2LS01 5KEEA 4B08A 5A35A 1V1OA 1EYDA 3OMCA 1HCZA 3QB3A 3EJIA 3L7ZC 3FRPB 1TQOA 2EJGC 1JWSD 4K8JA 3FPUB 1HTPA 5DNFA 3IFTA 1PLFA 3VYRA 1NCVA 1J8IA 2JSOA 3D4WA 1KNAA 3K5OA 4UDUC 3NXWA 2B63B 1LO5D 2G9DA 2JA6B 2A6HC 1PMRA 4DGZA 3X3MA 4NDXA 1VCIA 3NTHA 5JEAJ 1CA5A 1B53A 3MXNA 2F0WA 4KHZA 3KBXA 4A3JB 2J7ZA 5C5MA 1O7YA 1IKLA 2F0HA 4CJ1B 3KUPA 1DOLA 1I6HB 2O5JC 3SEBA 1STYA 1GUTA 2WIIB 5C3WA 1CM9A 1K83B 3EQLC 2Z8LA 3GTMB 4ZLTF 3D8GA 1OXVA 3KLSX 4TRDA 1JOQA 3T53B 3VR2A 1TY2A 2ZXOA 5C4HA 3MEHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C1E A;  1STH A;  4MIU A;  3OWF A;  2QDB A;  1SYF A;  3QB3 A;  1EY5 A;  3EJI A;  3NP8 A;  5C6A A;  2PZW A;  5I6W A;  4DF7 A;  2WAC A;  2F3V A;  3SK4 A;  5HUR A;  1F2Z A;  4EVO A;  1EY9 A;  1TQO A;  3D6C A;  4HMI A;  4N9P A;  5JOB A;  5HGT A;  5NUC A;  1EY8 A;  5CGK A;  2EYP A;  5CV5 A;  3ERQ A;  4K8J A;  3H6M A;  5IGD A;  4J1M A;  5KRU A;  5M9O A;  4PMC A;  1IHZ A;  4PNY A;  5CC4 A;  4K14 A;  1A3T A;  3V2T A;  2RDF A;  2KQ3 A;  2HQE A;  2PW5 A;  3MHB A;  3QOL A;  5C4Z A;  1STG A;  5DAU A;  2EY6 A;  3SK5 A;  1F2M A;  3U9O A;  1KAB A;  4B9X A;  2SNS A;  4OL7 A;  4NKL A;  4YIJ A;  3TP7 A;  4E6I A;  3D4W A;  4WRD A;  4EQO A;  4KJN A;  2EY2 A;  5IGE A;  2F0E A;  2F0J A;  4DFA A;  5J22 A;  1EZ6 A;  3SK8 A;  5CV6 A;  1A3U A;  4B9W A;  4DU9 A;  1ENC A;  2NUC A;  3T16 A;  1EYC A;  2F0F A;  3MZ5 A;  3NXW A;  4KY6 A;  1EY4 A;  3DHQ A;  3R3O A;  3HZX A;  4NP5 A;  5I6Y A;  2SOB A;  4K5W A;  5F2D A;  5IGF A;  5ISR A;  4DGZ A;  5E1F A;  1A2T A;  1ENA A;  2EYF A;  3TP5 A;  3E5S A;  1SND A;  3VA5 A;  2M00 A;  1AEX A;  3BDC A;  2F0Q A;  2EY1 A;  3OSO A;  4ZUI A;  2F0K A;  3NHH A;  5C5L A;  1SNP A;  1SNO A;  4KD3 A;  4K2L A;  1TR5 A;  4NDX A;  1KDB A;  4S3S A;  5IOD A;  1SYE A;  4HMJ A;  4RKB A;  4KV6 A;  2F0D A;  5EKL A;  1STB A;  3T13 A;  1SYG A;  1SNM A;  1II3 A;  2OEO A;  5IOC A;  2F0W A;  2PW7 A;  4G57 A;  4KJO A;  2EYJ A;  3EVQ A;  3MVV A;  4QB4 A;  3TME A;  3S9W A;  1KAA A;  5CR3 A;  5J39 A;  3P75 A;  5IGC A;  1EZ8 A;  5CV9 A;  5KGU A;  1NSN S;  3LX0 A;  4K8I A;  2F0G A;  5C5M A;  1A2U A;  2SNM A;  3P1H A;  4I65 A;  4K6D A;  2PZU A;  1JOO A;  1TT2 A;  4EQN A;  2F0H A;  1JOK A;  4KY7 A;  5J1Z A;  5C3X A;  4ID6 A;  4KD4 A;  2O4X A;  5KYL A;  3D4D A;  1EY6 A;  1EY7 A;  1NUC A;  2RBM A;  2ENB A;  4ME5 A;  4WOR A;  5DEH A;  5EKK A;  3SHL A;  5KIX A;  3HEJ A;  1EY0 A;  2F0L A;  1STA A;  3C1F A;  2F0S A;  1SYD A;  3MXP A;  4KY5 A;  4QMG A;  2F0T A;  2F0M A;  2LKV A;  1SNC A;  4IZ8 A;  1KDC A;  4QF4 A;  5IIF A;  5I9O A;  2EYL A;  5IGG A;  4ODG A;  2EY5 A;  4N9T A;  3SXH A;  4F8M A;  4R8N A;  2OXP A;  1SYB A;  4ZQ3 A;  4IUN A;  2EXZ A;  1KDA A;  1F2Y A;  2F0I A;  2F3W A;  4J6H A;  5CV8 A;  1STY A;  2PYK A;  2F0U A;  5CV4 A;  2KHS A;  4PMB A;  2EYM A;  4EQP A;  3TP6 A;  4KHV A;  4F7X A;  3NK9 A;  2F0N A;  3NQT A;  5I9P A;  5C3W A;  1SYC A;  3PMF A;  4ZUJ A;  4H7B A;  4KTA A;  2RKS A;  4LAA A;  2PZT A;  3ERO A;  5JAV A;  2OF1 A;  3TP8 A;  3BDL A;  2EYO A;  4K5V A;  2EYH A;  1RKN A;  1SNQ A;  5CV7 A;  3DMU A;  1A3V A;  5KYI A;  4K2K A;  3SR1 A;  1STN A;  3D8G A;  4HTH A;  4K5X A;  5K5P A;  4TRD A;  3NUC A;  1JOQ A;  1EYA A;  3QOJ A;  3RUZ A;  3SK6 A;  4RKL A;  1U9R A;  1EQV A;  2F0V A;  5KEE A;  1JOR A;  2PQE A;  3ITP A;  2F0O A;  3OMG A;  5E3F A;  5EGT A;  5IGB A;  1EYD A;  4NMZ A;  5C4H A;  3MEH A;  3OMC A;  4IAL A;  2F0P A; 
#chains in the Genus database with same CATH topology
 3C1E A;  1V8Q A;  4RH6 A;  1HR0 Q;  4DUZ L;  5JJK A;  1H95 A;  4DF7 A;  3HRZ C;  1GUN A;  4PZ8 A;  5HUR A;  1UNS A;  4ABN A;  1KRT A;  4DV7 L;  3OW2 A;  2NBF A;  3MC0 B;  3Q6S A;  5CGK A;  4FNF A;  1UE1 A;  4ZAI A;  4OWW B;  3ERQ A;  3WOE A;  1CUK A;  2KUM A;  3AQQ A;  3KLS A;  4FF2 A;  1IYU A;  2VQE Q;  2VW9 A;  3PF5 A;  5C3E H;  1CT1 D;  1RIP A;  4I7Z C;  1WI5 A;  1STG A;  2JA9 A;  3A55 A;  1WTV A;  2K5D A;  3KF8 A;  4DFA A;  1X3P A;  1BBX C;  2HCC A;  2F0F A;  2A1A A;  3AMU A;  3RD4 A;  3K8A A;  1YIT A;  2PQA A;  2F03 A;  5L37 A;  1GUS A;  3U4Z A;  2F1M A;  3E0E A;  2BE5 C;  1AH9 A;  1TS5 A;  4R8I A;  3M7N A;  2RDH A;  1EWI A;  1H9J A;  1ZYR C;  3EVQ A;  2MUY A;  3OYY A;  3W3A A;  3VYS A;  1CQF A;  1PH9 A;  2JE6 I;  2ZJP A;  1D2B A;  3H09 A;  4DR3 Q;  4RA8 A;  3OHX C;  1YNN D;  1GM5 A;  4F88 A;  1PRT F;  2NTS A;  1STE A;  2CH4 W;  1JC7 A;  1I3Q H;  5EKK A;  3HOZ B;  3HEJ A;  2F0T A;  3NWS A;  1HNZ L;  2E2I B;  1HQM C;  1RDP D;  5FLX c;  3TQY A;  2OXP A;  1SYB A;  4Y7N B;  5BN3 A;  1G2S A;  5ELF A;  3KLW A;  2JA6 G;  2FXQ A;  4UP7 A;  1BQQ T;  5I9P A;  2NVQ H;  1SYC A;  3J80 E;  1HZ9 A;  4JI8 Q;  1KXL A;  2D9U A;  1QIL A;  5K36 H;  4O0A A;  1M8A A;  1YNN C;  3A54 A;  3T1H L;  1S40 A;  4JBK A;  3Q0A A;  4BBR B;  2EQS A;  2N3S A;  4DAY B;  3OTO Q;  4GOP C;  1D5X C;  4R4C A;  3VR3 A;  3A8J E;  1W2B A;  1JOR A;  3D0F A;  5CMD A;  3LWU A;  1IBL Q;  1EQR A;  1QWY A;  4H0L C;  3H15 A;  3TEH B;  1LLR D;  4DAP A;  3PGZ A;  2KCM A;  3Q23 A;  4LNQ A;  2SEB D;  4XYO A;  2WAC A;  2XWJ B;  1XYI A;  1A63 A;  4AH6 A;  5BN4 A;  2FMM A;  4FVM A;  3T51 B;  4GNX C;  2JA8 H;  1O7L A;  1ZKO A;  2LY7 A;  4C3I G;  3GTG B;  1NR4 A;  4PMC A;  5LL6 S;  5C44 H;  1X3G A;  2P5Z X;  2ZTC A;  1SSO A;  2QEX A;  4OL7 A;  3R8B A;  3NBH A;  2I5H A;  3RLN A;  2D62 A;  4A3B G;  3SK8 A;  4YWL A;  2NUC A;  4OO1 I;  1EYC A;  1L1O B;  3PCO B;  1BF4 A;  2DNC A;  5ISR A;  3EIV A;  1TWH B;  1SJE D;  2EYF A;  4JI2 Q;  1BBW A;  2AQ2 B;  3OSO A;  1S5B D;  4DV5 Q;  5IOD A;  2B2T A;  1QNK A;  4A3D B;  4JI3 Q;  1PTO F;  3SGI A;  3G6E A;  1MSH A;  2GVB A;  1P16 A;  3W5O A;  1PZI D;  5IGC A;  1JB3 A;  2HIV A;  1DOM A;  1J6Q A;  4ME5 A;  3PIP A;  4GS3 A;  4HJA A;  2M9V A;  3JAM E;  3F8T A;  3M4Y A;  4DUY L;  1BBU A;  1DCZ A;  5IIF A;  4GLX A;  5I2X A;  2VY3 A;  4O1N A;  5JJL A;  3K5M A;  4DV6 L;  4IUR A;  5C0X J;  2B8G A;  5HGQ A;  4RG1 A;  4MTK A;  1QG7 A;  2F0U A;  4PMB A;  3NPP A;  3JAM L;  3PUX A;  1BXT A;  3H0G H;  1YEZ A;  3TRZ A;  1PH6 A;  1V1P A;  2YTY A;  4MZ9 A;  2HDM A;  1STN A;  2Y0S G;  3HG9 A;  3GD7 A;  5C4J H;  1TWA H;  3A5U A;  4B3S L;  2XWB B;  3CPW A;  2PQE A;  3ITP A;  1W3S A;  4KKU A;  1B3Q A;  3S1N B;  3JAM c;  2KED A;  3QO2 A;  2F4V Q;  1X3F A;  3MWY W;  1IZ6 A;  5BR8 L;  4GN3 B;  1NBW A;  1LT4 D;  2R7Z B;  1N32 L;  1O7Z A;  2AHO B;  1F9Q A;  5M9O A;  3K6O A;  1UEA B;  3N6R A;  3OIP A;  3CQZ H;  3H91 A;  1KTK A;  4JI7 Q;  3S15 B;  3VYT A;  1VQJ A;  3DUZ A;  4C2M B;  5M3F G;  2XGT A;  4RHR A;  3RZD B;  4IOA A;  1Y14 B;  2LFN A;  2NN6 H;  4YIJ A;  5KND A;  1IBK L;  4QUC A;  1A3U A;  4DU9 A;  4L6T B;  1IXR A;  4WFN 3;  4KK7 A;  2VS1 A;  4DR1 L;  4IFD I;  1A2T A;  1Q81 C;  1ASZ A;  2HHH L;  3MEF A;  1HFN A;  2JJQ A;  3KOJ A;  1X56 A;  2XNA C;  4OO1 H;  2O5I C;  4ZUI A;  2B2W C;  1Y1V G;  1S5D D;  3NQI A;  3BZC A;  4KD3 A;  4UP9 A;  2DN8 A;  4A93 G;  3GV3 A;  4DR7 Q;  2AUK A;  5M5X B;  1CK1 A;  1JJG A;  4X3U A;  1D7Q A;  2YV5 A;  1Y8P B;  3GP7 A;  1NSN S;  4HJ7 A;  3R2I A;  4IUQ A;  1HRJ A;  2WV6 D;  3S1R H;  4DV0 Q;  1EOT A;  5J1Z A;  3A8K E;  5KYL A;  5JPN C;  2BDO A;  2JK8 A;  2A73 B;  4F87 A;  2KCC A;  2PO4 A;  4JI4 Q;  1TWG H;  2KBN A;  1EY0 A;  4FF4 A;  1BCP D;  1WTQ A;  4DNR B;  5I9O A;  3VDY A;  3PUZ A;  4APV A;  1LTS D;  4IUN A;  2EXZ A;  4QQB X;  3DWP A;  3E3X A;  1R9T H;  4A3E B;  5IY0 A;  3ER0 A;  3U50 C;  1LTI D;  2K50 A;  1QVC A;  3L2P A;  4IPH A;  3BYT B;  2UXB L;  1B9M A;  5IYC H;  1A3V A;  3NEL A;  2K5W A;  3I3C A;  3HOV H;  3HOX G;  1BCP C;  3K7A B;  3S16 B;  3GTJ B;  5M3M G;  2G9H D;  1HNZ Q;  1SMY D;  1SR3 A;  4UHV A;  3QG1 A;  2E2H B;  5IP9 G;  1HR0 L;  2IW3 A;  4MIU A;  3A56 A;  1VQ8 A;  1R4Q B;  3ND8 A;  3RN5 A;  2RF4 A;  4EVO A;  4N9P A;  1A0I A;  1KAW A;  1QUQ B;  1VQ5 A;  3HOW B;  1JR0 D;  1SMX A;  2ZXP A;  1WOC A;  4NW2 A;  3NWT A;  5CBA E;  4TKO B;  4RCO A;  5EBD A;  2VQE L;  4J1M A;  2MHV A;  3V2T A;  2UXC Q;  2RDF A;  1WTX A;  1BKB A;  3CCS A;  1XTD A;  2CWA A;  3MHB A;  4BY7 G;  1NE3 A;  1SMY C;  4JOI C;  4JVZ A;  4WRD A;  2QDL A;  1NMG A;  4XYQ A;  1B1Z A;  2F0J A;  1EZ6 A;  1H9R A;  5CV6 A;  4A3L G;  3MZ5 A;  1E2V A;  1VQE A;  2BA1 A;  5JJI A;  4HSV A;  4DKA C;  4KKT A;  4CKC A;  3UDG A;  3DM1 A;  1I5F A;  1PH5 A;  3BDC A;  2F0Q A;  1SRO A;  3K5N A;  3NHH A;  1YBY A;  1Q90 A;  2I46 A;  1H9S A;  4DV2 Q;  4IFD H;  2F0D A;  5EKL A;  3TME A;  2EYJ A;  2JA7 B;  3PO2 B;  2C5C A;  5IP7 G;  4A3M H;  5EKI A;  1CKN B;  3LX0 A;  5ELD A;  3S2H B;  5ELO A;  4DR3 L;  5FLM H;  2NVX B;  3O13 A;  1G29 1;  3I4N B;  3GTO B;  2R92 B;  4R4Q A;  1Q8I A;  2MGS A;  1XPO A;  2RBM A;  1YJW A;  1GO3 E;  3FKI G;  2LKV A;  2EYL A;  5IYD H;  2I5M X;  4GLV B;  4Q5V A;  4IUV A;  5CBE E;  4H13 C;  4H02 A;  1PH7 A;  3I70 A;  1A62 A;  1H9S B;  3NBI A;  3LGJ A;  1WCM B;  4IN3 A;  5EAY A;  3NK9 A;  2K7V A;  2I5L X;  4JI8 L;  1AZP A;  3C3L A;  3FHW A;  3J81 j;  3KYH C;  5CV7 A;  3ONA B;  1Y69 U;  1I4X A;  1C48 A;  3SDZ A;  4HTH A;  4NB3 A;  1WTO A;  3OTO L;  1TS3 A;  3M4P A;  4L63 B;  4RKL A;  1LTT D;  3S1M B;  4H44 C;  2XSC A;  1MIU A;  4Q0F A;  4JW0 A;  1IBL L;  1CSP A;  2HQL A;  2SDF A;  4DAV A;  3TDQ A;  2F3V A;  1QZG A;  4RMF A;  1F9S A;  2A6E D;  3IFD A;  2H1E A;  4DA2 A;  2QF7 A;  3FEW X;  2ICE C;  2X6L A;  4DN4 M;  3S17 B;  1CQV A;  3RLO A;  4QGU A;  2B2U A;  1KIX A;  2KQ3 A;  1Q46 A;  2N78 A;  2PW5 A;  2EY6 A;  3W1G A;  3JC6 6;  4LFC Q;  3GTK B;  3IAY A;  4BBS G;  1V9P A;  2FIN B;  1EY4 A;  3DHQ A;  4L5T A;  3K0X A;  1VQP A;  4JI2 L;  2H5X A;  3ULJ A;  4TSS A;  4DV4 Q;  1SBB B;  1ENF A;  3PUY A;  4DV5 L;  1AEX A;  2FHT A;  5C5L A;  3GTL B;  4JI3 L;  2YTX A;  4M1U B;  1F77 A;  1A15 A;  1HFG A;  5BN5 A;  4RCN A;  3M3Y B;  1DZ1 A;  3KFU A;  4L8J A;  1CSQ A;  4I7A A;  5C3E G;  1EZ8 A;  5EPK A;  1MI2 A;  4QL5 A;  4RFB A;  3J81 L;  2CFM A;  3LWE A;  1JOK A;  4YCW A;  2X6G A;  1M90 C;  2QA4 A;  4K0K Q;  2EOT A;  2ENB A;  3BVG A;  2HDL A;  5KIX A;  3CW2 C;  4GLA C;  4BXX H;  2N49 A;  4DR1 Q;  2F0L A;  2RVL A;  4JI0 Q;  3N52 A;  1P8L A;  4P74 A;  3I4L A;  4AQY Q;  5GAG C;  1E0B A;  4QJF A;  1ESR A;  2F0I A;  3NE5 B;  2ID0 A;  1RCV D;  2KHS A;  3J81 c;  1K3B C;  1U4M A;  4KLK A;  1BO0 A;  1AFP A;  3GTQ H;  4H7B A;  1D6E C;  2D0O A;  2A19 A;  3D4R A;  5T1G A;  3RLF A;  2VUM H;  1U5K A;  4JPB W;  1HUN A;  3E9I A;  3DMU A;  3VR4 A;  3HOU H;  3J80 i;  2RSO A;  2ZJR A;  2EE1 A;  5M5Y H;  2MQH A;  4QUF A;  2GA4 B;  3C46 A;  1B44 D;  5EGT A;  4DR6 Q;  3S14 H;  1I94 Q;  1IL2 A;  2MJ8 A;  4C3I B;  2F4V L;  2EPB A;  1K28 A;  1SE4 A;  3NP8 A;  5IWA Q;  1JMC A;  2H4O A;  1E2Z A;  1EY9 A;  3D6C A;  3CQZ B;  5M5W B;  2DY7 A;  2JYO A;  2RHQ B;  1ICW A;  4YWK A;  2AUJ D;  1LTR D;  4A3B B;  1Z7T A;  1E1T A;  4IUT A;  3OIQ A;  3U4V A;  1I50 H;  3UE1 A;  5K36 G;  1RJT A;  1LTA D;  2A5H A;  1OO9 B;  3QOL A;  3HGB A;  3K57 A;  4B9X A;  1U4P A;  2SNS A;  1DON A;  1Q82 C;  1G8Z D;  1HNW Q;  1G91 A;  3HKZ G;  3I8Z A;  3M85 A;  4EGV A;  4JK1 C;  3QJY A;  2SOB A;  4A3F B;  1VF5 C;  4A3G H;  5LMN L;  2LXJ A;  1ENA A;  2CHB D;  1W6J A;  1MSG A;  1RHP A;  2JA8 G;  1VQD A;  1DD2 A;  4DR7 L;  2WAQ G;  1SNM A;  1II3 A;  2MO1 A;  5C44 G;  3PO3 H;  2E2J H;  3MVV A;  5J39 A;  4JI6 Q;  3MAQ A;  3GTP B;  1SDF A;  4C3H H;  2F0G A;  4DV0 L;  4C3J H;  1XXG A;  2Z4H A;  3KBG A;  5FLX E;  4JI4 L;  1EY6 A;  1NUC A;  4C56 C;  5DEH A;  3A7L A;  1H9K A;  1TII D;  2IX1 A;  4U67 3;  1STA A;  1VQA A;  4NXM Q;  1AP0 A;  4WJW A;  4QMG A;  4XQN A;  4IO9 A;  4KHP Q;  1GHJ A;  2B2T C;  4R1J A;  1HTL D;  2RA4 A;  1DYQ A;  2Y0S B;  1Y1W H;  2E8G A;  5FLX L;  1SFO B;  5CV4 A;  5COY A;  4JBM A;  2NVY H;  2PPB C;  2XRQ D;  2F4I A;  1I4Q A;  4UY8 C;  2F0N A;  5H1S E;  2VL6 A;  4OHJ A;  3BG3 A;  5EPJ A;  4ZKB B;  3HOV B;  2PZT A;  2IX3 A;  3E0J A;  1FD7 D;  5IT9 L;  1VQL A;  2D2C C;  1ESF A;  4LWC A;  4K2K A;  2JA5 H;  1F9P A;  1PTO H;  4CJ0 B;  3CKI B;  4LW1 A;  4DAY A;  2A8V A;  3RUZ A;  4LFB Q;  2B8F A;  2RCN A;  1Z9F A;  1G6Z A;  4CBV A;  2F0O A;  5E3F A;  4IPG A;  1OXT A;  1J9O A;  1PYB A;  4IAL A;  1ZXT A;  4RWS C;  2N55 A;  2Q8I B;  1OXX K;  1S4Z A;  3RNU A;  4X3S A;  1EY5 A;  4UPA A;  2VXW A;  2Q2U A;  5M3F B;  5IT9 c;  1Q3L A;  4P2C B;  1JJC B;  1Y8N B;  3OOC A;  3DM3 A;  3H0G G;  2D5D A;  2EYP A;  4HJ9 A;  1K8G A;  1PRT D;  3Q8D A;  5IGD A;  3J7Y W;  3S1Q H;  2UXC L;  2V1C C;  4OWX B;  2ZM6 Q;  2AWN A;  4DR2 Q;  1ML0 D;  3STB D;  4Z9C B;  2K28 A;  4POF A;  3AYH B;  1X3E A;  1WVL A;  1KAB A;  3I4M H;  1Y1V B;  1XWE A;  4UP8 A;  1QVF A;  4L5Q A;  1GKH A;  2TMP A;  2CQO A;  1TU2 B;  3CCM A;  4A93 B;  1L1O A;  1WTP A;  2K05 A;  1HZB A;  2E75 C;  3R3O A;  3HZX A;  2HUG A;  2LXK A;  5F2D A;  2A68 D;  1WJJ A;  1XMQ Q;  1PH3 A;  4DK1 A;  4JCV E;  3BJU A;  3ND9 A;  1PDQ A;  2NN6 I;  4RGM A;  4S3S A;  4DV2 L;  2UUA Q;  1KDB A;  3S2D B;  4XT1 B;  3X3N A;  1VQH A;  2WIN B;  4LK1 C;  3STB C;  1AZQ A;  3M4O H;  5IOC A;  2PW7 A;  1B7Y B;  1QVG A;  2WFW A;  4A3I H;  1FL0 A;  2XIW A;  2SNM A;  1K8O A;  2NN6 G;  4K6D A;  4EQN A;  2VB3 X;  5IYB H;  4ID6 A;  5AJ3 Q;  3Q24 A;  3HOY H;  1WD0 A;  2XTI A;  2HIX A;  3D4D A;  1EY7 A;  4DR4 Q;  3CRK C;  3C1F A;  1XX8 A;  2K5H A;  1QE6 A;  4IZ8 A;  4OX9 Q;  1F9R A;  2K5N A;  5IGG A;  3PQI A;  4F8M A;  2R93 H;  4GN5 A;  3ULL A;  4OO1 G;  1SRU A;  4IQZ A;  1EIY B;  1L0Y B;  2N8N A;  4OGQ C;  4A3F G;  3HOX B;  3HS0 C;  1WTW A;  1JCK B;  5M3M B;  1PFM A;  3BZD B;  4KI0 A;  1Q1E A;  2EYH A;  1SNQ A;  2K33 A;  2RSN A;  1S5C D;  3J7A V;  4XDX A;  1EFW A;  4UAI A;  3PIO 3;  1K73 C;  2EDG A;  4V0B A;  5FJ8 H;  3M7G A;  1ONL A;  1M1K C;  3J7A 5;  3FP9 A;  2Z0S A;  1D1I A;  1E2W A;  1PTO D;  1TWF B;  1NY4 A;  3OWF A;  2Y0S E;  1CA6 A;  2B2Y A;  2PZW A;  5I6W A;  4LFA L;  2ATW A;  2TSS A;  2ASB A;  4BY7 B;  3MFY A;  4HMI A;  1LT5 D;  1PH4 A;  1EY8 A;  3L3O C;  1HXY D;  1B2T A;  4NXN Q;  3FPP A;  2RDG A;  1K0R A;  2B63 H;  2K75 A;  2OWO A;  3W2D A;  1PFN A;  3UDI A;  3HOV G;  1F2M A;  4LFC L;  1V1Q A;  2BCO A;  1PTO C;  1U0L A;  2L55 A;  5EBC A;  4ALP A;  1L2F A;  2K5Q A;  2F0E A;  4HAE A;  1ENC A;  1ILQ A;  3V96 A;  4Y52 H;  4DV4 L;  5E1F A;  4A3J H;  1EEI D;  2RHS B;  1AW7 A;  4YHH Q;  2WKD A;  3U9S A;  1SNP A;  1KC8 C;  2GN5 A;  3FMC A;  4OWT B;  5IE8 A;  1WTR A;  1XPR A;  2LMC B;  4A4I A;  1I6H H;  1BDO A;  2OEO A;  3CCL A;  3LNN A;  4G57 A;  2UUC Q;  1IYV A;  3FKI B;  1KAA A;  5CV9 A;  1B50 A;  4X62 Q;  2XRS D;  2B39 A;  1JWU D;  1EWC A;  4CDE C;  4KY7 A;  4K0K L;  4GNX A;  1EEF D;  3AEV A;  2NVT B;  3S24 A;  1HNX Q;  4JI0 L;  4OON A;  4AQY L;  5LMN Q;  1K83 H;  4DV3 Q;  3H3V I;  1HUM A;  4HR7 B;  5AFW A;  4ZK9 B;  2EY5 A;  3GTM H;  2VUM B;  4R8N A;  4GOP B;  2L0C A;  4HSP A;  2PNH A;  4ZCK A;  2UU9 Q;  1F2Y A;  1BOS A;  2PMZ B;  4IFD G;  4WJ3 M;  1CI3 M;  3NQT A;  4CHT B;  1D8L A;  2VZA A;  3CCV A;  1HR0 W;  4BY1 H;  3ERO A;  4CDD C;  5JAV A;  1LAB A;  2OF1 A;  4A3M G;  2Z9H A;  5D3I B;  3QIA A;  4B3R Q;  1B4O A;  5FLM G;  4LF8 Q;  1H9M A;  1VMP A;  4M8A A;  1JWM D;  4LMQ D;  4BS9 A;  5FO9 B;  3SK6 A;  4GNX B;  4QCL A;  1LTG D;  4DR6 L;  1SE2 A;  1I94 L;  1VQB A;  1ASY A;  3RZO B;  1GXD C;  1JE5 A;  1S72 A;  5IWA L;  2BOS A;  1ZEQ X;  2Z6K A;  1VQC A;  4LUV A;  2V4D A;  1QUQ A;  1HQR D;  2R7D A;  1Z6H A;  4FDB A;  4BA1 I;  2YU9 B;  5CV5 A;  4P75 A;  4BBS B;  2CWP A;  3PSI A;  2QW7 A;  1DXM A;  3Q22 A;  4OIK A;  3NSW A;  5DAU A;  1HNW L;  2O2L D;  4L5S A;  4FF1 A;  4A3G B;  1CZG A;  4KJN A;  3ICE A;  5J22 A;  2PI2 E;  1RTO A;  5JEA H;  3UI2 A;  1IYJ B;  2M2L A;  2K1B A;  5C3E B;  4V19 0;  5IGF A;  2KEN A;  2MO0 A;  4YCV A;  4P73 A;  2X69 A;  1AE3 A;  1DM0 B;  2F0K A;  2B2U C;  5E7N A;  2BH2 A;  1SYE A;  4HMJ A;  1X3Q A;  2CQA A;  4KV6 A;  1AE2 A;  4JI6 L;  3HOZ H;  3ULP A;  2VB2 X;  3K5L A;  4G7H C;  5ELB A;  3HFZ B;  1CKN A;  3I2Z A;  5CR3 A;  4JG2 A;  4DK0 A;  2E2I H;  1S5E D;  5KGU A;  2L12 A;  1UWV A;  1FNW A;  4O2D A;  3T1Y Q;  4I65 A;  5I2Y A;  4Y7N H;  1PFB A;  2OQ0 A;  3D3R A;  4KD4 A;  4JBW A;  3SHL A;  1X32 A;  4NXM L;  5DLQ E;  4KHP L;  1W6K A;  1KDC A;  1V43 A;  4AIM A;  1FJG Q;  3AFP A;  4N9T A;  3SXH A;  1JIC A;  4C1N K;  3TZD A;  3H3V H;  4BBR H;  2EYM A;  1VQG A;  1I3Q B;  3I91 A;  2OTJ A;  1EWH A;  4ZUJ A;  3PF4 A;  1YVC A;  3T4A C;  1CTM A;  1RKN A;  2KOL A;  1R4P B;  3SR1 A;  4LFB L;  1J5E Q;  1EYA A;  1G51 A;  1HZA A;  1ILP A;  4XQJ A;  2E2D C;  3EN2 A;  5ELE A;  2NVQ B;  5IGB A;  4BXX G;  3QR8 A;  1X9N A;  1HZC A;  2F0P A;  4NKL A;  2EJF C;  5KNB A;  1Q1B A;  5CYU A;  3GTG H;  3MXG A;  2ZT9 C;  4XQQ A;  5COR A;  1FGB D;  3QWN A;  2PMZ E;  4X65 Q;  1KL9 A;  1X54 A;  4ZYS A;  3G48 A;  5FK9 C;  2VUM G;  3HKZ B;  5G3L F;  1EQQ A;  5FKA C;  5KRU A;  2ZM6 L;  4CKB A;  1TVX A;  2BDN A;  2K03 A;  4DR2 L;  3HOU G;  2QCP X;  2HQE A;  3CHB D;  3CCE A;  5D65 A;  3E6Z X;  1TWH H;  4FYD A;  5ELC A;  3SK5 A;  4DXF A;  3UDX A;  1XTC D;  2RQX A;  2A69 D;  2JA8 B;  3RR5 A;  4A3K H;  4A3D H;  4B9W A;  2WAQ B;  4LFA Q;  5C44 B;  4JV5 Q;  1SEB D;  1XMQ L;  1OTC A;  2BH8 A;  3GV6 A;  3VA5 A;  1A8V A;  1XMO Q;  2UUA L;  5G3L D;  1XNQ Q;  4R9W A;  1O7I A;  1D5Z C;  2KJX A;  1STB A;  3CF5 A;  1AN8 A;  2UXD Q;  2Z6B A;  2JEB I;  1RL2 A;  1T5X D;  1QZH A;  4IUP A;  5AJ3 L;  1EUJ A;  2E5L L;  4CJ2 C;  2A6E C;  2KA7 A;  4DR4 L;  3I73 A;  3PUW A;  4WOR A;  4OX9 L;  3J81 E;  1SYD A;  2K5V A;  4A3G G;  2MPM A;  1SNC A;  1VQF A;  4ODG A;  1BCP B;  4JC0 A;  2Q8T A;  1WTH A;  2G5D A;  4R4T A;  2IHF A;  4ZKC B;  4MN3 A;  3BVM A;  1UEB A;  4KHV A;  2R3Z A;  4TQU S;  2LSS A;  1B3A A;  1EIG A;  3PO3 G;  1PZK D;  2FMC A;  2ALY B;  1MKH A;  2RKS A;  4LAA A;  3WWV A;  1C0A A;  1PYW D;  2N88 A;  1VQO A;  2A6H D;  3S1N H;  4C3H G;  1TWC H;  4MTN A;  2J0T D;  4C3J G;  5KYI A;  2WKC A;  4X3K A;  2KEC A;  4RGN A;  1VQ7 A;  4LF7 Q;  1IKM A;  3QOJ A;  3I55 A;  2EVB A;  2HT1 A;  1U9R A;  1RD9 D;  4LF9 Q;  2R7Z H;  4MNO A;  2IJ0 A;  4DK3 C;  3H0G B;  1ET6 A;  4RHS A;  1NTG A;  3UE0 A;  1PH8 A;  3KJO A;  2L1B A;  1PXU A;  1FVI A;  1UUP A;  4CDF C;  4LF5 Q;  1Y1W G;  2FJ2 A;  4O42 A;  3DEO A;  3S15 H;  1EIF A;  5C4J B;  4GKK Q;  4C2M H;  1TWA B;  1LTB D;  3RZD H;  4JBJ A;  1WFQ A;  4XT3 B;  4AYB G;  2B2V A;  4NXN L;  3BZK A;  3H3V C;  1YHB A;  1VQI A;  1TS4 A;  4OIJ A;  1UE7 A;  2WB1 G;  5GQO A;  1IHZ A;  3J7A F;  1JB7 A;  1C8C A;  4DNI A;  3CCU A;  2JA5 G;  1K3R A;  2ZTD A;  5DM7 3;  1C7Y A;  1VQM A;  3TS0 A;  3AB9 A;  4E6I A;  3TRE A;  1MBY A;  5IGE A;  4EX5 A;  3L0O A;  3DXJ C;  4PZ7 A;  5TSS A;  1FYC A;  2HD3 A;  1YHA A;  2CCZ A;  2NTT A;  5I6Y A;  5M5X H;  2D0P A;  3DWQ A;  1PH2 A;  4YHH L;  3TP5 A;  1ICF B;  4KN7 C;  3OW7 A;  2DJG C;  4RGO S;  3ZJY C;  3TSS A;  2EY1 A;  3HKZ E;  5DM6 3;  1TR5 A;  2UUC L;  3K58 A;  3A74 A;  1VDZ A;  2ES2 A;  4X62 L;  3MXN B;  3EFX D;  1VQ9 A;  5E4X A;  3VR5 A;  4LF4 Q;  4G7Z C;  1HJP A;  3P1H A;  3PIO A;  1EL0 A;  1Q12 A;  3I4M G;  3KF6 B;  5C0X H;  4FXD A;  2WAQ E;  2O4X A;  4A3E H;  4IFD J;  1HNX L;  1SN8 A;  1T9H A;  4DV3 L;  1BUV T;  1YNJ D;  3M4Q A;  2PCF B;  2WP8 J;  2J4X A;  4DR5 Q;  4BY1 B;  2UU9 L;  1LV9 A;  1KHI A;  2C35 B;  4ZQ3 A;  3S1R B;  1KDA A;  1IL8 A;  4EQP A;  3TN2 A;  3K7A H;  3S16 H;  3B6Y A;  3GTJ H;  1TWG B;  1YZ6 A;  2NWG A;  2AWO A;  2FFK B;  3TP8 A;  4B3R L;  2E2H H;  4LF8 L;  4A3I G;  5C4X H;  1PA6 A;  1BNZ A;  1RF2 D;  1XNR L;  3OPO A;  5K5P A;  2BE5 D;  4J15 A;  5IYB G;  4A3C H;  3HOY G;  1R9T B;  3VYU A;  1NAP A;  2BA0 A;  1EQV A;  1CHP D;  1YNJ C;  1PV4 A;  1O80 A;  3HOW H;  5IT9 E;  4JI5 Q;  1ZYR D;  3SE0 A;  1XJV A;  1L0X B;  2DGY A;  3JAM i;  4EQO A;  1I4H A;  2AQ1 B;  3A7A B;  1LM0 A;  1YI2 A;  2R93 G;  1GVP A;  4EQ5 A;  2B3G A;  1N36 Q;  1F2Z A;  1U4R A;  3BDO A;  4PQX A;  1B9N A;  1LYL A;  4HCE A;  1ET9 A;  5T1I A;  2OCE A;  3PUV A;  3MA2 B;  3NTK A;  1GUO A;  1PFS A;  1EYG A;  1KQS A;  4K14 A;  1A3T A;  2R61 A;  1CKM A;  2K6A A;  4QY7 A;  5C4Z A;  3SVM A;  1QCB D;  2CKZ B;  3TP7 A;  2B2Y C;  3KK7 A;  5FJ8 G;  3W1B A;  1BVS A;  3KF8 B;  1I4R A;  1SLJ A;  4CDC C;  2A74 C;  1D5M C;  3CC2 A;  2JA7 H;  4B3T L;  3PO2 H;  1N33 Q;  1UE5 A;  2PQA B;  3E5S A;  1SND A;  2E74 C;  3S2H H;  1PH1 A;  3AU7 A;  2NVX H;  3CCQ A;  4KMU C;  3I4N H;  1SNO A;  4OEM B;  3GTO H;  2XVS A;  2R92 H;  3I90 A;  4BWG B;  1IBM Q;  2L5T A;  2IY5 B;  1SAP A;  2PNR C;  2B63 G;  1ROD A;  4QB4 A;  2KHI A;  4KKS A;  3T1Y L;  2R7F A;  1I4P A;  3VR6 A;  2Q8R E;  1LT3 D;  2PZU A;  3K59 A;  4ZRZ A;  5JVH 3;  1N34 Q;  3NEN A;  2K52 A;  1WCM H;  1JJ2 A;  1E7Z A;  1TS2 A;  1SXT A;  2E76 C;  4G4K A;  1PRT C;  3MXP A;  1BR9 A;  2F0M A;  1PZJ D;  1FJG L;  4A3M B;  3D6W A;  4PZ6 A;  3J80 L;  4A3J G;  4DAM A;  3ZYY X;  1NR2 A;  3CD6 A;  3IRB A;  1LTL A;  3S1M H;  1MJC A;  4KTA A;  2MFI A;  2OT2 A;  3NEM A;  5I4D A;  3CU7 A;  3IKJ A;  5D14 A;  3WDN A;  2E5L Q;  1VS0 A;  1J5E L;  4IUU A;  2A68 C;  3NUC A;  1SE8 A;  4DNT B;  3J80 c;  4FXK C;  1D1K A;  5FO7 B;  2L15 A;  2PI2 A;  4YY3 Q;  2L4N A;  1STH A;  1L0W A;  4CKE A;  2IWH A;  1SJH D;  3S17 H;  4OXP A;  3BU2 A;  4X65 L;  5HY6 A;  3T56 B;  4A75 A;  4L5R C;  1YJ9 A;  1Q8K A;  5JVG 3;  2MP1 A;  5HGT A;  3WOF A;  2I07 B;  4BY1 G;  1I4G A;  3H6M A;  3GTK H;  2EIF A;  4DV1 Q;  5CC4 A;  3EBE A;  3G71 A;  3G4S A;  4A3K B;  1QOH A;  1KNE A;  2C9O A;  5FOB B;  1X6O A;  2JXM B;  3U9O A;  2IPK D;  3GTL H;  2Z6K C;  4PG3 A;  1N9W A;  2UUB Q;  4C1N I;  4B3M Q;  3NBH B;  2EZV A;  4JV5 L;  3M3Y H;  2K01 A;  4KY6 A;  4HID A;  1HHV A;  1NJI C;  1DOK A;  4GKJ Q;  4K5W A;  1XMO L;  1XNQ L;  3FVQ A;  5LHY 1;  3U58 A;  4FXG C;  3I4O A;  2AQ3 B;  1FR3 A;  5IYC G;  1U4L A;  4KN4 C;  1VMC A;  4LF6 Q;  2JA6 H;  1GHK A;  3AFQ A;  3R2T A;  2UXD L;  4N8F A;  2F52 A;  1QB5 D;  4K8I A;  1Y8O B;  1A2U A;  1QJO A;  2NZ1 D;  1FNV A;  2K14 A;  4X66 Q;  3F2B A;  2DNE A;  4ILW A;  3GDE A;  5JEA G;  2CVR A;  2OTL A;  1GUG A;  3MXU A;  4HIM A;  4KY5 A;  3H94 A;  2NZH A;  4POG A;  4QF4 A;  1WD1 A;  5D3D A;  1KRS A;  3CP0 A;  4GOP A;  4JYA Q;  2DUD A;  2KVM A;  1YNX A;  4ME3 A;  4FF3 A;  4J6H A;  1TWC B;  3URY A;  4ULL A;  4YWM A;  1LT6 D;  2I0Q A;  4DXG A;  3I72 A;  4HN7 A;  3HOZ G;  3CMA A;  2JQO A;  1OXU A;  1C9O A;  4K5V A;  4C3I H;  4X64 Q;  2VQF Q;  2JN4 A;  1V1P B;  4LF7 L;  1G6P A;  3CXC A;  1EFI D;  4LF9 L;  5M5W H;  1OXS C;  2F0V A;  3KLR A;  2KCN A;  4J8Q A;  3A5Z B;  4PV1 C;  4NMZ A;  3GTQ B;  4JI1 Q;  3PV0 A;  1PHJ A;  4A3B H;  1A6X A;  1XPU A;  4FO2 A;  3GO5 A;  4R4I A;  2QDB A;  1SYF A;  4LF5 L;  1MGS A;  3HOU B;  4LUO A;  3KDF A;  1YJN A;  5C6A A;  4GKK L;  1K0S A;  5JPM C;  1MHW C;  3SK4 A;  1HA5 A;  4DUZ Q;  1Q86 C;  5M5Y B;  3VA7 A;  4BBR G;  3ERS X;  3UDF A;  5NUC A;  2QKI C;  4DV7 Q;  3A8I E;  3MTS A;  3S14 B;  1G2T A;  1BCP F;  1VF7 A;  2Q2T A;  1CKO A;  1PYS B;  1K9M C;  4RAU C;  4PNY A;  1VQN A;  1XNR Q;  2GVA A;  1DJR D;  3CCJ A;  4XXE A;  1PRT B;  1KD1 C;  1F2L A;  4A3F H;  1B8A A;  1EU4 A;  2QEJ C;  4IJL A;  5IYD G;  5LMU L;  4XIG S;  2EY2 A;  1CHQ D;  4HJ5 A;  1I50 B;  3KDF B;  4IPC A;  2ZXR A;  2JEA I;  1VQ4 A;  2IT1 A;  5GAH C;  2IL8 A;  4XTC S;  3RMH A;  3I56 A;  3GTP H;  2JP1 A;  2CW0 D;  4DK6 C;  2M00 A;  2IX0 A;  2YYZ A;  3HKS A;  2DJF C;  4K2L A;  1TKW B;  1KLG D;  4RKB A;  4A76 A;  1CFM A;  2KEE A;  2K04 A;  5JJZ A;  4HCS A;  1C4Q A;  1E3P A;  2NZO A;  3HP3 A;  4KJO A;  3P75 A;  4LF4 L;  1GUW A;  1JQY D;  2XN9 C;  1YHQ A;  3NTI A;  4HIO A;  5C3X A;  4A3K G;  1SFO H;  1TY0 A;  4A3D G;  4HJ8 A;  3PO3 B;  2Z1C A;  1FGU A;  2CW0 C;  1MJE A;  4B3T Q;  2E2J B;  2F0S A;  4F7X A;  4DR5 L;  1MD2 D;  2K32 A;  3F2C A;  2QIL A;  4C3H B;  3R93 A;  4C3J B;  5GAE C;  3G6J B;  3IL8 A;  1I6V C;  1IW7 D;  1KLU D;  1UAP A;  3J81 i;  2F3W A;  5LL6 X;  1GD7 A;  5C4X B;  2PYK A;  3TP6 A;  5A2Q E;  3PMF A;  3DWA A;  2L11 A;  4IJH A;  2EYO A;  3F2D A;  4G7O C;  2DY8 A;  4K5X A;  3T1H Q;  1Y1W B;  4HED A;  3DEP A;  1S5F D;  4LJZ C;  1E22 A;  2ZTE A;  1QNU A;  5M3F H;  2NVY B;  1K8M A;  5A2Q L;  4X3T A;  4YCU A;  4JI5 L;  3OMG A;  4AYB B;  1X55 A;  3CC4 A;  3L9A X;  4NP5 A;  1HPC A;  1IW7 C;  3PIP 3;  2WB1 B;  4PMW A;  1GOZ A;  5GRO A;  4IPD A;  5EPL A;  5E4W C;  2JA5 B;  1N36 L;  1PTO B;  2YTV A;  3DLL A;  2EXD A;  5JOB A;  3BS1 A;  1SE3 A;  3F2U A;  2B29 A;  1Y1V H;  2AKW B;  2K4K A;  4A93 H;  2B2W A;  1EQT A;  1FNU A;  3MFG A;  4WJ4 A;  2NYZ D;  3V05 A;  1E1O A;  4HIK A;  2R7Z G;  2EJM A;  5EQ0 A;  3P7J A;  2ICI A;  4DPG A;  3P20 A;  1S3O A;  3S1Q B;  3S2D H;  3CPF A;  1NNX A;  3T16 A;  1EIH A;  1RTN A;  5EJW A;  4QIW B;  1K8A C;  4GZY C;  2B2V C;  1N33 L;  4LUZ A;  3EA6 A;  1LUZ A;  3I4M B;  1IBM L;  2R6G A;  3CRL C;  2IHE A;  2HCI A;  1HA6 A;  3T13 A;  1SYG A;  3K0Y A;  2OQK A;  3FDT A;  3S9W A;  1CZW A;  4RGT A;  1N8R C;  2F3I A;  3CAM A;  5KNC A;  1N34 L;  1JOO A;  1TT2 A;  1Z47 A;  3C2P A;  1JE4 A;  4K6L A;  4P72 A;  2L9H A;  4CGY B;  1M4V A;  3HOX H;  3M4O B;  2Z4I A;  4FP5 D;  5FO8 B;  5M3M H;  3TBI B;  4BA2 I;  4MHE A;  5IP9 H;  4DUY Q;  3E9H A;  4A3I B;  3BYY B;  2VNU D;  5CV8 A;  5C0X I;  4DV6 Q;  1LAC A;  3HOY B;  3G7L A;  3D31 A;  3OWE B;  4U68 A;  3K81 C;  1EU3 A;  3CCR A;  1O78 A;  2A69 C;  3TZU A;  3GQB A;  4NPS A;  1GJX A;  3BDL A;  2ZJQ A;  1TWF H;  1X65 A;  2R93 B;  5C0X G;  3BVZ A;  3A0J A;  1T5E A;  1VQK A;  2NB0 A;  4BY7 H;  2LS0 1;  3J7Z C;  4A3E G;  4IOC A;  5KEE A;  5GAD C;  4B08 A;  5A35 A;  4B3S Q;  1V1O A;  1EYD A;  4YY3 L;  1WYD A;  3OMC A;  1HCZ A;  3F1Z A;  4A3L H;  1YIJ A;  3CC7 A;  4JOI A;  3QB3 A;  3EJI A;  3K7U C;  3L7Z C;  3FRP B;  1TQO A;  5BR8 Q;  2EJG C;  1N32 Q;  1JWS D;  4K8J A;  4DV1 L;  3FPU B;  5C4X G;  1HTP A;  1B70 B;  4R4O A;  5DNF A;  4A3C G;  3IFT A;  5IP7 H;  1PLF A;  4AYB E;  2KCT A;  3HOW G;  3VYR A;  1NCV A;  2Q2I A;  1J8I A;  2JSO A;  3D4W A;  2UUB L;  4B3M L;  1KNA A;  3K5O A;  2WB1 E;  4UDU C;  1IBK Q;  4GKJ L;  3NXW A;  2B63 B;  2CH4 A;  1LO5 D;  2G9D A;  3FKI H;  1E24 A;  2JA6 B;  2A6H C;  1PMR A;  4DGZ A;  1TXY A;  1NMF A;  4GN4 B;  2HHH Q;  4OEL B;  3X3M A;  4LF6 L;  4NDX A;  1VCI A;  1EOV A;  3NTH A;  5LMN W;  4N8X 1;  5JEA J;  2NVT H;  1CA5 A;  1B53 A;  3MXN A;  2F0W A;  4KHZ A;  2AMC B;  1PVO A;  3KBX A;  4A3J B;  2J7Z A;  2MNA A;  3KF6 A;  5C5M A;  4X66 L;  1O7Y A;  5LMU Q;  1IKL A;  2F0H A;  4CJ1 B;  1DGS A;  3KUP A;  3KJP A;  1DOL A;  3I7F A;  1I6H B;  4QIW E;  1UE6 A;  2O5J C;  2JA7 G;  4JYA L;  3SEB A;  3PO2 G;  1JT8 A;  2RCF A;  3I4N G;  2R92 G;  1STY A;  2Q2H A;  1GUT A;  3CME A;  4TVA B;  2WII B;  1HH2 P;  5C3W A;  1CM9 A;  2KHJ A;  1L1O C;  5ELN A;  1K83 B;  3EQL C;  4X64 L;  2VQF L;  1VQ6 A;  3K80 C;  3RZO H;  3TS2 A;  2Z8L A;  3GTM B;  2UXB Q;  2QGQ A;  4ZLT F;  3D8G A;  1OXV A;  3KLS X;  4TRD A;  4JI7 L;  1JOQ A;  4P71 A;  5J3B A;  3T53 B;  3RN2 A;  1WCM G;  3VR2 A;  1TY2 A;  2ZXO A;  4JI1 L;  1Q7Y C;  4X6A H;  2YU9 H;  5C4H A;  3MEH A;  3M9B A;  4BBS H; 
#chains in the Genus database with same CATH homology
 3C1E A;  1V8Q A;  4RH6 A;  4DF7 A;  3HRZ C;  1GUN A;  5HUR A;  1UNS A;  4ABN A;  2NBF A;  3MC0 B;  3Q6S A;  5CGK A;  4FNF A;  4ZAI A;  3ERQ A;  3WOE A;  2KUM A;  4FF2 A;  3KLS A;  1IYU A;  1CT1 D;  4I7Z C;  1STG A;  3A55 A;  1WTV A;  2K5D A;  3KF8 A;  4DFA A;  1X3P A;  1BBX C;  2HCC A;  2F0F A;  3AMU A;  3RD4 A;  2F03 A;  1GUS A;  2F1M A;  2BE5 C;  1TS5 A;  4R8I A;  3M7N A;  2RDH A;  1H9J A;  1ZYR C;  3EVQ A;  2MUY A;  3W3A A;  3VYS A;  1CQF A;  2JE6 I;  1D2B A;  3H09 A;  4RA8 A;  3OHX C;  1YNN D;  4F88 A;  1PRT F;  2NTS A;  1STE A;  1JC7 A;  5EKK A;  3HOZ B;  3HEJ A;  2F0T A;  3NWS A;  2E2I B;  1HQM C;  1RDP D;  2OXP A;  1SYB A;  4Y7N B;  5BN3 A;  1G2S A;  5ELF A;  1BQQ T;  5I9P A;  1SYC A;  3J80 E;  2D9U A;  1QIL A;  5K36 H;  1M8A A;  1YNN C;  3A54 A;  3Q0A A;  4BBR B;  1D5X C;  3VR3 A;  3A8J E;  1JOR A;  5CMD A;  3LWU A;  1QWY A;  4H0L C;  1LLR D;  4DAP A;  3Q23 A;  2SEB D;  4XYO A;  2WAC A;  2XWJ B;  1XYI A;  5BN4 A;  2FMM A;  4FVM A;  3T51 B;  1O7L A;  1ZKO A;  2LY7 A;  4C3I G;  3GTG B;  1NR4 A;  4PMC A;  5LL6 S;  1SSO A;  4OL7 A;  3R8B A;  3NBH A;  2D62 A;  3SK8 A;  4OO1 I;  2NUC A;  1EYC A;  1BF4 A;  2DNC A;  5ISR A;  1TWH B;  1SJE D;  2EYF A;  2AQ2 B;  3OSO A;  1S5B D;  5IOD A;  2B2T A;  1QNK A;  4A3D B;  1PTO F;  1MSH A;  1PZI D;  5IGC A;  1JB3 A;  1DOM A;  4ME5 A;  2M9V A;  3JAM E;  3M4Y A;  1DCZ A;  5IIF A;  5I2X A;  4O1N A;  3K5M A;  4IUR A;  5C0X J;  2B8G A;  1QG7 A;  2F0U A;  4PMB A;  3NPP A;  3JAM L;  3PUX A;  1BXT A;  1V1P A;  2HDM A;  1STN A;  3HG9 A;  3GD7 A;  2XWB B;  2PQE A;  3ITP A;  4KKU A;  3S1N B;  2KED A;  3QO2 A;  3MWY W;  1LT4 D;  2R7Z B;  1O7Z A;  1F9Q A;  5M9O A;  3K6O A;  1UEA B;  3N6R A;  3OIP A;  3H91 A;  1KTK A;  3S15 B;  3VYT A;  3DUZ A;  4C2M B;  4RHR A;  3RZD B;  2LFN A;  2NN6 H;  4YIJ A;  5KND A;  4QUC A;  1A3U A;  4DU9 A;  4L6T B;  4WFN 3;  4KK7 A;  4IFD I;  1A2T A;  1HFN A;  2XNA C;  4OO1 H;  2O5I C;  4ZUI A;  2B2W C;  1S5D D;  3NQI A;  4KD3 A;  2DN8 A;  3GV3 A;  2AUK A;  5M5X B;  1CK1 A;  4X3U A;  1Y8P B;  3GP7 A;  1NSN S;  3R2I A;  4IUQ A;  1HRJ A;  2WV6 D;  1EOT A;  5J1Z A;  3A8K E;  5KYL A;  5JPN C;  2BDO A;  2A73 B;  4F87 A;  2KCC A;  2PO4 A;  4FF4 A;  1EY0 A;  1BCP D;  1WTQ A;  4DNR B;  5I9O A;  3PUZ A;  1LTS D;  4IUN A;  2EXZ A;  3DWP A;  4A3E B;  1LTI D;  3BYT B;  1B9M A;  1A3V A;  2K5W A;  3I3C A;  1BCP C;  3K7A B;  3S16 B;  3GTJ B;  2G9H D;  1SMY D;  3QG1 A;  2E2H B;  2IW3 A;  4MIU A;  3A56 A;  1R4Q B;  3ND8 A;  4EVO A;  4N9P A;  3HOW B;  1JR0 D;  2ZXP A;  4NW2 A;  3NWT A;  5CBA E;  4TKO B;  4RCO A;  5EBD A;  4J1M A;  2MHV A;  3V2T A;  2RDF A;  1WTX A;  3MHB A;  1SMY C;  4WRD A;  4XYQ A;  1B1Z A;  2F0J A;  1EZ6 A;  1H9R A;  5CV6 A;  3MZ5 A;  1E2V A;  2BA1 A;  4HSV A;  4KKT A;  4CKC A;  3DM1 A;  3BDC A;  2F0Q A;  3K5N A;  3NHH A;  1Q90 A;  2I46 A;  1H9S A;  4IFD H;  2F0D A;  5EKL A;  3TME A;  2EYJ A;  2JA7 B;  3PO2 B;  2C5C A;  5EKI A;  3LX0 A;  5ELD A;  3S2H B;  2NVX B;  3O13 A;  1G29 1;  3I4N B;  3GTO B;  2R92 B;  1Q8I A;  2MGS A;  2RBM A;  2LKV A;  2EYL A;  4Q5V A;  4IUV A;  5CBE E;  4H13 C;  3I70 A;  1H9S B;  3NBI A;  1WCM B;  4IN3 A;  3NK9 A;  2K7V A;  1AZP A;  3C3L A;  5CV7 A;  3ONA B;  1Y69 U;  1I4X A;  1C48 A;  3SDZ A;  4HTH A;  1WTO A;  1TS3 A;  4L63 B;  4RKL A;  1LTT D;  3S1M B;  4H44 C;  2XSC A;  4Q0F A;  2SDF A;  4DAV A;  3TDQ A;  2F3V A;  1F9S A;  2A6E D;  3IFD A;  2H1E A;  4DA2 A;  2QF7 A;  3FEW X;  2ICE C;  2X6L A;  4DN4 M;  3S17 B;  1CQV A;  2B2U A;  2KQ3 A;  2PW5 A;  2EY6 A;  3GTK B;  3IAY A;  2FIN B;  1EY4 A;  3DHQ A;  4TSS A;  1SBB B;  1ENF A;  3PUY A;  1AEX A;  2FHT A;  5C5L A;  3GTL B;  4M1U B;  1F77 A;  1A15 A;  1HFG A;  5BN5 A;  4RCN A;  3M3Y B;  1DZ1 A;  4L8J A;  1EZ8 A;  5EPK A;  1MI2 A;  4RFB A;  3J81 L;  3LWE A;  1JOK A;  2X6G A;  2EOT A;  2ENB A;  3BVG A;  2HDL A;  5KIX A;  2F0L A;  2RVL A;  3N52 A;  3I4L A;  1E0B A;  1ESR A;  2F0I A;  3NE5 B;  2ID0 A;  1RCV D;  2KHS A;  1U4M A;  1BO0 A;  1AFP A;  4H7B A;  1D6E C;  3RLF A;  3D4R A;  5T1G A;  1HUN A;  3DMU A;  3VR4 A;  2RSO A;  2EE1 A;  4QUF A;  2GA4 B;  3C46 A;  1B44 D;  5EGT A;  2MJ8 A;  4C3I B;  2EPB A;  1SE4 A;  3NP8 A;  2H4O A;  1E2Z A;  1EY9 A;  3D6C A;  3CQZ B;  5M5W B;  2DY7 A;  2JYO A;  1ICW A;  2AUJ D;  1LTR D;  4A3B B;  1Z7T A;  4IUT A;  3OIQ A;  5K36 G;  1RJT A;  1LTA D;  2A5H A;  1OO9 B;  3QOL A;  3HGB A;  3K57 A;  4B9X A;  1U4P A;  2SNS A;  1DON A;  1G8Z D;  1G91 A;  3I8Z A;  3M85 A;  4EGV A;  4JK1 C;  3QJY A;  2SOB A;  4A3F B;  1VF5 C;  1ENA A;  2CHB D;  1W6J A;  1MSG A;  1RHP A;  1DD2 A;  1SNM A;  1II3 A;  3MVV A;  5J39 A;  3MAQ A;  3GTP B;  1SDF A;  2F0G A;  1XXG A;  2Z4H A;  3KBG A;  5FLX E;  1EY6 A;  1NUC A;  4C56 C;  5DEH A;  3A7L A;  1H9K A;  1TII D;  2IX1 A;  4U67 3;  1STA A;  1AP0 A;  4WJW A;  4QMG A;  4XQN A;  1GHJ A;  2B2T C;  1HTL D;  2RA4 A;  1DYQ A;  2Y0S B;  5FLX L;  1SFO B;  5CV4 A;  5COY A;  2PPB C;  2XRQ D;  2F4I A;  1I4Q A;  2F0N A;  4OHJ A;  3BG3 A;  5EPJ A;  4ZKB B;  3HOV B;  2PZT A;  2IX3 A;  3E0J A;  1FD7 D;  5IT9 L;  2D2C C;  1ESF A;  4K2K A;  1F9P A;  1PTO H;  4CJ0 B;  3CKI B;  4DAY A;  3RUZ A;  2B8F A;  1G6Z A;  4CBV A;  2F0O A;  5E3F A;  1OXT A;  1J9O A;  4IAL A;  1ZXT A;  4RWS C;  2N55 A;  2Q8I B;  1OXX K;  1S4Z A;  4X3S A;  1EY5 A;  2VXW A;  5M3F B;  1Q3L A;  4P2C B;  1Y8N B;  3OOC A;  2D5D A;  2EYP A;  1PRT D;  3J7Y W;  5IGD A;  2AWN A;  1ML0 D;  4Z9C B;  2K28 A;  1WVL A;  1KAB A;  1Y1V B;  1XWE A;  2TMP A;  1TU2 B;  4A93 B;  1WTP A;  2K05 A;  2E75 C;  3R3O A;  3HZX A;  2HUG A;  5F2D A;  2A68 D;  4DK1 A;  1PDQ A;  3ND9 A;  2NN6 I;  4RGM A;  4S3S A;  1KDB A;  3S2D B;  4XT1 B;  3X3N A;  2WIN B;  4LK1 C;  1AZQ A;  5IOC A;  2PW7 A;  2XIW A;  2SNM A;  1K8O A;  2NN6 G;  4K6D A;  4EQN A;  2VB3 X;  4ID6 A;  3Q24 A;  1WD0 A;  3D4D A;  1EY7 A;  3CRK C;  3C1F A;  1XX8 A;  1QE6 A;  4IZ8 A;  1F9R A;  5IGG A;  4F8M A;  4OO1 G;  4IQZ A;  1L0Y B;  4OGQ C;  3HOX B;  3HS0 C;  1WTW A;  1JCK B;  5M3M B;  1PFM A;  3BZD B;  4KI0 A;  1Q1E A;  2EYH A;  1SNQ A;  2K33 A;  2RSN A;  1S5C D;  3J7A V;  4XDX A;  4UAI A;  3PIO 3;  2EDG A;  4V0B A;  3M7G A;  1ONL A;  1D1I A;  1E2W A;  1PTO D;  1TWF B;  3OWF A;  1CA6 A;  2B2Y A;  2PZW A;  5I6W A;  2TSS A;  4BY7 B;  3MFY A;  4HMI A;  1LT5 D;  1EY8 A;  3L3O C;  1HXY D;  1B2T A;  3FPP A;  2RDG A;  3W2D A;  1PFN A;  1F2M A;  2BCO A;  1PTO C;  2L55 A;  5EBC A;  2K5Q A;  2F0E A;  4HAE A;  1ENC A;  1ILQ A;  3V96 A;  5E1F A;  1EEI D;  1AW7 A;  2WKD A;  3U9S A;  1SNP A;  3FMC A;  1WTR A;  2LMC B;  1BDO A;  2OEO A;  3LNN A;  4G57 A;  1IYV A;  3FKI B;  1KAA A;  5CV9 A;  1B50 A;  2XRS D;  2B39 A;  1JWU D;  1EWC A;  4KY7 A;  2NVT B;  1EEF D;  1HUM A;  4HR7 B;  5AFW A;  4ZK9 B;  2EY5 A;  2VUM B;  4R8N A;  2L0C A;  4HSP A;  1F2Y A;  1BOS A;  2PMZ B;  4IFD G;  1CI3 M;  3NQT A;  4CHT B;  3ERO A;  5JAV A;  1LAB A;  2OF1 A;  5D3I B;  3QIA A;  1B4O A;  1H9M A;  1VMP A;  4M8A A;  1JWM D;  4BS9 A;  4LMQ D;  5FO9 B;  3SK6 A;  4QCL A;  1LTG D;  1SE2 A;  3RZO B;  1GXD C;  2BOS A;  1ZEQ X;  2V4D A;  1HQR D;  1Z6H A;  4BA1 I;  2YU9 B;  5CV5 A;  4BBS B;  1DXM A;  3Q22 A;  4OIK A;  3NSW A;  5DAU A;  2O2L D;  4FF1 A;  4A3G B;  1CZG A;  4KJN A;  5J22 A;  1RTO A;  5JEA H;  3UI2 A;  2M2L A;  2K1B A;  5C3E B;  4V19 0;  5IGF A;  2X69 A;  1DM0 B;  2F0K A;  2B2U C;  1SYE A;  4HMJ A;  1X3Q A;  2CQA A;  4KV6 A;  2VB2 X;  3K5L A;  4G7H C;  5ELB A;  5CR3 A;  4DK0 A;  1S5E D;  5KGU A;  2L12 A;  1FNW A;  4I65 A;  5I2Y A;  1PFB A;  3D3R A;  4KD4 A;  4JBW A;  3SHL A;  1X32 A;  1W6K A;  1KDC A;  1V43 A;  4N9T A;  3SXH A;  1JIC A;  4C1N K;  3TZD A;  2EYM A;  1I3Q B;  3I91 A;  1EWH A;  4ZUJ A;  3T4A C;  1CTM A;  1RKN A;  2KOL A;  1R4P B;  3SR1 A;  1EYA A;  1ILP A;  4XQJ A;  2E2D C;  5ELE A;  2NVQ B;  5IGB A;  2F0P A;  4NKL A;  2EJF C;  5KNB A;  1Q1B A;  5CYU A;  3MXG A;  2ZT9 C;  4XQQ A;  5COR A;  1FGB D;  3QWN A;  4ZYS A;  5FK9 C;  3HKZ B;  5G3L F;  5FKA C;  5KRU A;  4CKB A;  1TVX A;  2BDN A;  2K03 A;  2QCP X;  2HQE A;  3CHB D;  5D65 A;  3E6Z X;  4FYD A;  5ELC A;  3SK5 A;  4DXF A;  1XTC D;  2RQX A;  2A69 D;  2JA8 B;  4B9W A;  2WAQ B;  5C44 B;  1SEB D;  3GV6 A;  3VA5 A;  5G3L D;  4R9W A;  1D5Z C;  2KJX A;  1STB A;  1AN8 A;  2JEB I;  1T5X D;  4IUP A;  4CJ2 C;  2A6E C;  2KA7 A;  3I73 A;  3PUW A;  4WOR A;  3J81 E;  1SYD A;  2MPM A;  1SNC A;  4ODG A;  1BCP B;  2Q8T A;  4ZKC B;  4MN3 A;  3BVM A;  4KHV A;  2R3Z A;  4TQU S;  1B3A A;  1EIG A;  1PZK D;  2FMC A;  2RKS A;  4LAA A;  1PYW D;  2N88 A;  2A6H D;  4C3H G;  2J0T D;  4C3J G;  5KYI A;  2WKC A;  4X3K A;  2KEC A;  4RGN A;  1IKM A;  3QOJ A;  2EVB A;  1U9R A;  1RD9 D;  2IJ0 A;  3H0G B;  1ET6 A;  4RHS A;  2L1B A;  1PXU A;  1UUP A;  2FJ2 A;  4O42 A;  3DEO A;  5C4J B;  1TWA B;  1LTB D;  4XT3 B;  2B2V A;  3H3V C;  1TS4 A;  4OIJ A;  1IHZ A;  3J7A F;  1C8C A;  5DM7 3;  3AB9 A;  4E6I A;  1MBY A;  5IGE A;  3DXJ C;  5TSS A;  1FYC A;  2NTT A;  5I6Y A;  3DWQ A;  3TP5 A;  4KN7 C;  3OW7 A;  4RGO S;  3TSS A;  2EY1 A;  5DM6 3;  1TR5 A;  3K58 A;  1VDZ A;  3EFX D;  5E4X A;  3VR5 A;  4G7Z C;  3P1H A;  1EL0 A;  1Q12 A;  4FXD A;  5C0X H;  2O4X A;  4IFD J;  1BUV T;  1YNJ D;  2PCF B;  2WP8 J;  2J4X A;  4BY1 B;  1LV9 A;  4ZQ3 A;  3S1R B;  1KDA A;  1IL8 A;  4EQP A;  3TN2 A;  1TWG B;  2NWG A;  2AWO A;  2FFK B;  3TP8 A;  1BNZ A;  1RF2 D;  3OPO A;  5K5P A;  2BE5 D;  1R9T B;  3VYU A;  1NAP A;  2BA0 A;  1EQV A;  1CHP D;  1YNJ C;  1O80 A;  5IT9 E;  1ZYR D;  3SE0 A;  1L0X B;  4EQO A;  1I4H A;  2AQ1 B;  3A7A B;  1F2Z A;  1U4R A;  3BDO A;  4PQX A;  1B9N A;  4HCE A;  1ET9 A;  5T1I A;  3PUV A;  3MA2 B;  3NTK A;  1GUO A;  4K14 A;  1A3T A;  2R61 A;  2K6A A;  5C4Z A;  3SVM A;  1QCB D;  3TP7 A;  2B2Y C;  3KK7 A;  1I4R A;  2A74 C;  1D5M C;  3E5S A;  1SND A;  2E74 C;  3AU7 A;  4KMU C;  1SNO A;  2XVS A;  3I90 A;  4BWG B;  2L5T A;  1SAP A;  2PNR C;  1ROD A;  4QB4 A;  4KKS A;  1I4P A;  3VR6 A;  2Q8R E;  1LT3 D;  2PZU A;  3K59 A;  4ZRZ A;  5JVH 3;  1TS2 A;  1SXT A;  2E76 C;  4G4K A;  1PRT C;  3MXP A;  1BR9 A;  2F0M A;  1PZJ D;  4A3M B;  3D6W A;  3J80 L;  3ZYY X;  1NR2 A;  4KTA A;  2OT2 A;  5I4D A;  3CU7 A;  3IKJ A;  5D14 A;  3WDN A;  4IUU A;  2A68 C;  3NUC A;  4DNT B;  4FXK C;  1D1K A;  5FO7 B;  2L4N A;  1STH A;  4CKE A;  2IWH A;  1SJH D;  3T56 B;  5JVG 3;  2MP1 A;  5HGT A;  3WOF A;  2I07 B;  1I4G A;  3H6M A;  5CC4 A;  4A3K B;  1QOH A;  1KNE A;  2C9O A;  5FOB B;  2JXM B;  3U9O A;  2IPK D;  4C1N I;  2EZV A;  2K01 A;  4KY6 A;  1HHV A;  1DOK A;  4K5W A;  3FVQ A;  5LHY 1;  4FXG C;  2AQ3 B;  1FR3 A;  1U4L A;  4KN4 C;  1VMC A;  1GHK A;  3R2T A;  1QB5 D;  4K8I A;  1Y8O B;  1A2U A;  1QJO A;  2NZ1 D;  1FNV A;  2DNE A;  4ILW A;  5JEA G;  2CVR A;  1GUG A;  3MXU A;  4KY5 A;  3H94 A;  4QF4 A;  1WD1 A;  5D3D A;  2KVM A;  4FF3 A;  4J6H A;  1TWC B;  3URY A;  4ULL A;  1LT6 D;  4DXG A;  3I72 A;  4HN7 A;  1OXU A;  4K5V A;  1V1P B;  1EFI D;  1OXS C;  2F0V A;  3KLR A;  2KCN A;  4J8Q A;  4PV1 C;  4NMZ A;  3GTQ B;  3PV0 A;  1A6X A;  4FO2 A;  3GO5 A;  2QDB A;  1SYF A;  1MGS A;  3HOU B;  5C6A A;  5JPM C;  3SK4 A;  1HA5 A;  5M5Y B;  3VA7 A;  5NUC A;  2QKI C;  3A8I E;  3MTS A;  3S14 B;  1G2T A;  1BCP F;  1VF7 A;  4RAU C;  4PNY A;  1DJR D;  4XXE A;  1PRT B;  1F2L A;  1EU4 A;  2QEJ C;  4XIG S;  2EY2 A;  1CHQ D;  1I50 B;  2JEA I;  2ZXR A;  2IT1 A;  2IL8 A;  4XTC S;  3RMH A;  2JP1 A;  2CW0 D;  2M00 A;  2IX0 A;  2YYZ A;  4K2L A;  1TKW B;  1KLG D;  4RKB A;  1CFM A;  2KEE A;  2K04 A;  5JJZ A;  4HCS A;  1C4Q A;  3HP3 A;  4KJO A;  3P75 A;  1GUW A;  1JQY D;  2XN9 C;  3NTI A;  5C3X A;  1TY0 A;  3PO3 B;  2Z1C A;  2E2J B;  2CW0 C;  2F0S A;  4F7X A;  1MD2 D;  2K32 A;  2QIL A;  4C3H B;  3R93 A;  4C3J B;  3G6J B;  3IL8 A;  1I6V C;  1IW7 D;  1KLU D;  1UAP A;  2F3W A;  5LL6 X;  5C4X B;  2PYK A;  3TP6 A;  5A2Q E;  3PMF A;  3DWA A;  2L11 A;  2EYO A;  4G7O C;  2DY8 A;  4K5X A;  1Y1W B;  4HED A;  3DEP A;  1S5F D;  4LJZ C;  1QNU A;  2NVY B;  1K8M A;  5A2Q L;  4X3T A;  3OMG A;  4AYB B;  3L9A X;  4NP5 A;  1HPC A;  1IW7 C;  3PIP 3;  2WB1 B;  4PMW A;  1GOZ A;  5EPL A;  5E4W C;  2JA5 B;  1PTO B;  5JOB A;  3BS1 A;  1SE3 A;  3F2U A;  2B2W A;  1EQT A;  1FNU A;  3MFG A;  2NYZ D;  3V05 A;  2EJM A;  5EQ0 A;  3P7J A;  2ICI A;  3P20 A;  3S1Q B;  3T16 A;  1EIH A;  1RTN A;  5EJW A;  4QIW B;  4GZY C;  2B2V C;  3EA6 A;  3I4M B;  2R6G A;  3CRL C;  2HCI A;  1HA6 A;  3T13 A;  1SYG A;  3K0Y A;  3FDT A;  3S9W A;  1CZW A;  4RGT A;  5KNC A;  1JOO A;  1TT2 A;  1Z47 A;  3C2P A;  1JE4 A;  4K6L A;  2L9H A;  4CGY B;  1M4V A;  3M4O B;  2Z4I A;  4FP5 D;  5FO8 B;  3TBI B;  4BA2 I;  4MHE A;  4A3I B;  3BYY B;  2VNU D;  5CV8 A;  5C0X I;  1LAC A;  3HOY B;  3G7L A;  3D31 A;  3OWE B;  4U68 A;  1EU3 A;  1O78 A;  2A69 C;  3TZU A;  3GQB A;  1GJX A;  3BDL A;  2R93 B;  5C0X G;  3BVZ A;  1T5E A;  2NB0 A;  2LS0 1;  5KEE A;  4B08 A;  5A35 A;  1V1O A;  1EYD A;  3OMC A;  1HCZ A;  3QB3 A;  3EJI A;  3L7Z C;  3FRP B;  1TQO A;  2EJG C;  1JWS D;  4K8J A;  3FPU B;  1HTP A;  5DNF A;  3IFT A;  1PLF A;  3VYR A;  1NCV A;  1J8I A;  2JSO A;  3D4W A;  1KNA A;  3K5O A;  4UDU C;  3NXW A;  2B63 B;  1LO5 D;  2G9D A;  2JA6 B;  2A6H C;  1PMR A;  4DGZ A;  3X3M A;  4NDX A;  1VCI A;  3NTH A;  5JEA J;  1CA5 A;  1B53 A;  3MXN A;  2F0W A;  4KHZ A;  3KBX A;  4A3J B;  2J7Z A;  5C5M A;  1O7Y A;  1IKL A;  2F0H A;  4CJ1 B;  3KUP A;  1DOL A;  1I6H B;  2O5J C;  3SEB A;  1STY A;  1GUT A;  2WII B;  5C3W A;  1CM9 A;  1K83 B;  3EQL C;  2Z8L A;  3GTM B;  4ZLT F;  3D8G A;  1OXV A;  3KLS X;  4TRD A;  1JOQ A;  3T53 B;  3VR2 A;  1TY2 A;  2ZXO A;  5C4H A;  3MEH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...