2X6LA

X-ray structure of macrophage inflammatory protein-1 beta
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
66
structure length
66
Chain Sequence
GSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRSKQVCADPSESWVQEYVYDLELN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Polymerization of Mip-1 Chemokine (Ccl3 and Ccl4) and Clearance of Mip-1 by Insulin-Degrading Enzyme.
pubmed doi rcsb
molecule tags Immune system
molecule keywords C-C MOTIF CHEMOKINE 4
total genus 13
structure length 66
sequence length 66
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2010-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2x6lA00
2KOLA 2L1BA 2X69A 4DN4M 5D65A 4UAIA 4CJ0B 1NCVA 2J7ZA 2DY8A 2B2TA 3DEPA 1PFNA 4X3UA 1SAPA 2K28A 2FJ2A 2L4NA 1DOKA 4HSVA 1ILPA 1LV9A 2KVMA 2L11A 1M8AA 1BNZA 2NZ1D 1IKMA 4HCSA 2DY7A 3H91A 3DM1A 2RVLA 2RA4A 3DEOA 3Q6SA 4CJ2C 3ONAB 2B2WA 4R8IA 1WTVA 4OIKA 3KUPA 3N52A 5E4WC 2H1EA 3I91A 4ZAIA 5COYA 2RSNA 2B2UC 5CBEE 3LWEA 1EL0A 1F2LA 2K05A 5AFWA 5DNFA 1IKLA 4R9WA 4QUFA 2KEEA 2D9UA 1G2TA 2EPBA 4IUPA 2B2WC 1RHPA 4IUTA 1HA6A 1CA5A 1B4OA 1HUNA 3FDTA 1WTPA 2K04A 3G7LA 4U68A 4IURA 1QNKA 3TZDA 4XDXA 1HRJA 2K03A 1ESRA 3IL8A 2FINB 4MHEA 5D14A 1DZ1A 1X32A 1B3AA 3MTSA 1ML0D 2BDNA 1IL8A 2R3ZA 4LMQD 1EIHA 4RAUC 3MWYW 3GV6A 5T1IA 1NR4A 3TN2A 4ZK9B 1O80A 1TVXA 1PFMA 1Q3LA 1F9PA 1EQTA 4ZKBB 4ZLTF 1HUMA 2B2YA 1WTXA 1BBXC 5EPJA 1G91A 1PFBA 1JICA 1AP0A 3FPUB 3I90A 3D6WA 4MN3A 1WD0A 2B2VC 2HCCA 1WTOA 2XIWA 1WTRA 1B53A 1KNAA 2FMMA 2M2LA 1A15A 1U4LA 2KUMA 4X3TA 1B2TA 2KEDA 2HDMA 2Q8TA 5EPLA 2K1BA 1VMPA 4IUVA 4X3SA 1EIGA 1ZXTA 4RA8A 4NW2A 1J8IA 1O7YA 1RJTA 1C8CA 5EPKA 1RTOA 1QE6A 4OIJA 4XT1B 1WVLA 1BO0A 5CMDA 4HEDA 1U4MA 2SDFA 5EJWA 1RTNA 1X3PA 4ZKCB 5JJZA 1O7ZA 3I3CA 1BF4A 2EOTA 1U4PA 1F9QA 1G6ZA 2HCIA 2VXWA 1QG7A 3UI2A 2MGSA 2MJ8A 3R93A 1SSOA 1WTQA 3F2UA 3GV3A 1PLFA 2MP1A 4HAEA 2Q8RE 1J9OA 2JYOA 1XYIA 1AZQA 2HUGA 4IUUA 1F9SA 1WD1A 4RWSC 2B2VA 1NAPA 1JE4A 1AZPA 1HFNA 5EKIA 5CORA 2L12A 1G2SA 2NYZD 3KBXA 1WTWA 1NR2A 4QUCA 2FHTA 2N88A 2X6GA 5T1GA 4IUQA 1DOMA 1U4RA 2JP1A 3QO2A 1CM9A 2RSOA 2CVRA 2KECA 3SVMA 1S4ZA 4X3KA 1PDQA 1CA6A 1B50A 1GUWA 4XT3B 2HDLA 1KNEA 1MSGA 1VMCA 4O42A 1F9RA 5EQ0A 2MPMA 1DOLA 2K01A 2FFKB 1E0BA 1RODA 1SDFA 3IFDA 3I8ZA 4CJ1B 2B2YC 5E4XA 2N55A 3P7JA 2NWGA 5CBAE 1HHVA 1EOTA 1HFGA 1DONA 2EE1A 1X3QA 2L9HA 2X6LA 2B2TC 3HP3A 1ILQA 1ICWA 1MSHA 2B2UA 2IL8A 1MI2A 1MGSA 1XX8A
chains in the Genus database with same CATH superfamily
2L1BA 2EJGC 1PH3A 3ZJYC 1H9SA 3TP5A 4H0LC 1HZAA 3HS0C 2JA5G 1VDZA 1SE2A 3A8IE 3MEFA 2CWAA 3MXNB 4DAYA 2VY3A 1J6QA 1E22A 3T51B 4H44C 5ELNA 1CKOA 3J81i 2EVBA 1EYCA 1F2LA 2B8GA 1VQLA 2D9UA 2K33A 2ZTEA 2E2JB 1B4OA 4DUZL 1HCZA 3LNNA 1I5FA 5CR3A 1MKHA 4WJ3M 4MHEA 1FVIA 1BUVT 2R61A 3SDZA 2YV5A 4LMQD 5C5LA 5BN3A 1SE3A 4BA1I 4ZK9B 1O80A 3D4DA 3MHBA 1CI3M 2Z4HA 2LKVA 2UXDL 1G291 4X66Q 3G71A 1WTRA 4LFAL 1QNUA 4GKJQ 1BBUA 1K3RA 2F0UA 1RIPA 2QCPX 2ZXOA 1VQ7A 3KF6B 1EY4A 2F0OA 5KNBA 5K36H 4XIGS 1SMXA 5JJZA 2NVXB 1G6ZA 3OW7A 4QGUA 4B08A 4K5WA 3A5UA 5IYCG 1HQRD 5M3MB 3DHQA 3E9IA 4OGQC 4XQJA 1EEID 1HFNA 1LTTD 1AZPA 1D5MC 3O13A 3CQZB 2FHTA 1XNRQ 4BBRB 3QO2A 3S14B 3SK8A 4YWMA 1GM5A 3SVMA 2NN6H 2PMZE 5G3LF 1SNPA 2VQEL 2ZXRA 4JI4Q 3V2TA 2E2HH 1O7LA 3K58A 1L2FA 1Y8PB 3A7LA 3MFGA 3M3YH 1Y1VG 4DV6Q 5E4XA 1DYQA 3CU7A 4A3FB 3TZUA 2JA7G 4DR4L 4DV3L 4FP5D 5C4ZA 4NP5A 2JA8G 2EYPA 3K7AH 5DLQE 4IPCA 1EQQA 3HOZB 2Z9HA 1PFNA 1XNQL 4R4IA 3RUZA 3OWFA 4YIJA 4B3RL 2ICIA 3TS2A 1SJED 2KVMA 3GTJH 2JA7B 4U673 2IJ0A 1J5EQ 1D2BA 4ZUIA 3DEOA 1WTVA 1QVGA 3J80c 3KUPA 3PO2G 3JAMi 3R2IA 4B3TQ 3I4OA 1S5BD 1YVCA 1GO3E 5EKLA 1Y8OB 2N78A 5KRUA 4CBVA 1CA5A 4B9XA 5E7NA 3G7LA 4IURA 4XDXA 3GTMB 2OQKA 3J7ZC 1K73C 3CCUA 1ML0D 1OXSC 4LFCQ 4FF4A 2D2CC 3T4AC 2LY7A 3BDCA 2OCEA 1SNQA 1F9PA 5KGUA 1YITA 1HZ9A 3ER0A 3EJIA 2VQFL 1NMGA 3VYSA 3I4NB 3VYRA 4L5RC 3NSWA 1PHJA 2M2LA 5LMNW 4LF5Q 1GXDC 1RDPD 2EYJA 1V1QA 1VMPA 4KKUA 3VR5A 3KBGA 5C3EB 5J1ZA 3J80L 4HJ5A 2OEOA 3NQTA 2DGYA 3HRZC 3PV0A 4DUZQ 3CCRA 4LF6L 1DCZA 2B2VA 4FDBA 1A2TA 4C3IG 1CFMA 2E75C 3OMCA 3QOJA 4DGZA 3STBC 1PH1A 4JVZA 5JJLA 3T53B 4UHVA 3V96A 1I4GA 2UXCQ 5IYCH 2NVYB 4X6AH 3IFDA 4PZ6A 2KCTA 4LF5L 4PV1C 1YNND 1VQOA 4OELB 4LJZC 3HP3A 2D0OA 4GLAC 4WRDA 1N36L 3BVGA 2NN6I 3X3MA 1XPRA 2KQ3A 2RCNA 5IT9E 1NCVA 4JBWA 2DY8A 4H13C 1FGUA 3LGJA 5IT9L 1PV4A 5J39A 3CCMA 4HIDA 3HOYH 2JA9A 2NBFA 5IYBH 1YNNC 2AKWB 5BR8Q 5AJ3Q 2Y0SB 3T1HL 1HNZQ 4JI7Q 2EJMA 2EXDA 3DM1A 4R8IA 2LXJA 1WCMB 2VB3X 4ZAIA 2IX3A 3K59A 1TIID 2BDOA 3HEJA 3H09A 1JB7A 2KEEA 1JCKB 4DAYB 4XTCS 5LL6X 4NB3A 1HNZL 2RKSA 1C0AA 1WTPA 2K04A 4RCOA 3NWTA 1Q1EA 1H9SB 3I70A 5AJ3L 2M00A 3M7GA 1CUKA 3PCOB 3IL8A 1QJOA 3NBHB 4YCWA 5M3FB 4RGNA 1NR4A 1IHZA 4P73A 4XQQA 4A3EB 4ZUJA 2EY6A 4QB4A 2NVQH 3KF6A 4DR2Q 2HQLA 1TWHB 1CSQA 4KKTA 1TR5A 2F0IA 1Q90A 5JJKA 1VQDA 3S1QH 2D62A 4FXDA 2HD3A 1A3UA 2K5NA 4R4TA 2IW3A 3U9SA 4RA8A 4JBKA 2VQEQ 1H9RA 2AMCB 3L0OA 4XT1B 1Q8KA 3S17H 2C35B 4DAVA 1RTNA 4IOAA 3VYUA 3GTLH 5IYDG 1W6JA 3SK4A 5IOCA 2AUJD 4K14A 3KLSX 4LUOA 3F2UA 2ZJRA 1OTCA 4IUUA 5M5XH 3VR6A 2KENA 4HIKA 4EGVA 4B3SQ 4C2MB 4P72A 3KLSA 4O2DA 1I4HA 1STAA 2HQEA 4KN4C 4JI7L 2WIIB 2RSOA 4C3HG 4K5XA 2MNAA 3SK5A 5C44B 4KHPQ 1TS2A 2NUCA 3CCQA 1B3QA 1HJPA 2PI2E 1AW7A 3SHLA 1S5CD 4J8QA 3TP8A 2CQOA 1N36Q 2BCOA 2L9HA 4IQZA 4C1NI 1OXXK 1SFOB 1VQ4A 3CC2A 3MZ5A 3ULJA 3HOVH 2BA0A 2KCMA 3S2HB 3CCEA 2K5QA 1Z9FA 3NEMA 5FLMH 2Z4IA 3H91A 1AFPA 1R9TH 2RHSB 2A69D 4J1MA 1PZKD 4DNIA 1CHPD 1GUNA 1SJHD 2FMCA 4CKCA 2F0KA 4BY7G 2PQAB 4N9TA 4GS3A 4NXMQ 4POFA 3BDOA 2E5LQ 1UEAB 2L15A 2K03A 3H0GG 3UDIA 1STHA 3N6RA 2A68D 3TREA 1PH6A 1CT1D 5FO8B 2F4IA 4JPBW 4UP7A 5T1IA 1SYDA 2SNSA 4JI0L 3C3LA 4YY3Q 4UPAA 1JICA 2PNHA 3D6WA 3MXGA 2E2JH 4DR4Q 2R7ZG 1VS0A 2XIWA 2CCZA 5DM63 4GNXC 3I7FA 3NTHA 3S15B 5EPLA 3DWAA 3U4ZA 2RQXA 3J7YW 3OMGA 4XXEA 4DV0Q 2B63B 3MA2B 2A6EC 3L3OC 1O7YA 1Y1VH 2QEJC 3QOLA 4PMBA 4KY7A 3MAQA 3OOCA 4HEDA 2JA6G 5EJWA 5C6AA 1YI2A 1C4QA 2K5DA 3FRPB 2Y0SG 2XRQD 4GN4B 3A56A 4LF9L 4LF4L 3DUZA 1KRSA 1Y14B 1SSOA 3EN2A 4ALPA 4L5TA 5C4JB 2JYOA 2R93G 1XYIA 1ASYA 4A3DG 4X65L 2HUGA 2I5LX 4RGOS 5M5WH 1B9NA 2B29A 5EKKA 2Z6BA 1SYFA 4HSPA 1N9WA 4M1UB 1NUCA 1DOMA 4IUQA 1FL0A 5IGDA 2KECA 4XQNA 1J5EL 2VUMG 3GTPB 3TBIB 3FEWX 1Y1WB 5FLXL 1EUJA 4ZCKA 5FLXE 3K0XA 4JI2Q 4A3IB 1RODA 3CXCA 4EVOA 3DM3A 4K6LA 4X66L 2R7DA 1SROA 1ZEQX 4A3KH 2EE1A 3PO3G 1GUTA 1EY5A 1EYGA 1Z47A 1TKWB 5LMUQ 1YJNA 3U9OA 4DV4Q 4DR6L 1XTDA 4UAIA 1LTSD 2CH4W 1CKNA 2E2HB 1K8GA 3EROA 4Y52H 4JI4L 3M3YB 2O4XA 4QF4A 1STYA 5CC4A 2XTIA 3I4MG 3KLRA 3J81E 1E2WA 1LLRD 1STEA 4XYQA 1N32Q 3H15A 2NVTH 4EQPA 2Z1CA 3MFYA 1T5EA 5A35A 4RKLA 1GKHA 1JQYD 4N8FA 4DV1Q 4DA2A 4V190 3GTJB 4NKLA 4LUVA 1KDBA 3MXUA 4LUZA 4DV7Q 3HKZE 1JOOA 4DR3L 2G9DA 3GV6A 1ET6A 3DMUA 3BVZA 5HGTA 1EQTA 4HTHA 3IFTA 1WTXA 1VQPA 5K36G 1AP0A 3FPUB 2ZTDA 5IE8A 1EWIA 2F0NA 4ME5A 2XNAC 1FGBD 2EXZA 3GTMH 2UXDQ 1VQBA 1LT4D 1I6HB 1B2TA 4CDCC 3PF4A 2Q8TA 3I72A 4H7BA 1EIGA 1A3TA 2ZJQA 1J8IA 4K0KL 1XXGA 2OWOA 3HFZB 4OIJA 1E2ZA 3J81L 1XMQL 4G7HC 1S5ED 1M90C 4IFDG 1EYDA 1D5XC 1D8LA 2MO0A 4AH6A 3K5OA 2HCIA 4KN7C 3QIAA 5L37A 4B3SL 4IFDI 4JOIA 5EBDA 3S1NB 3I4MB 3BU2A 2PZTA 3SE0A 1PRTF 1Q12A 4ZRZA 5EKIA 3KBXA 1P8LA 1HTLD 4R1JA 1V1PB 3KDFA 2Z0SA 4YCVA 1SYGA 4C3HB 1B50A 4PZ8A 2VB2X 3W1BA 4JV5L 3D0FA 2K01A 4IN3A 1E0BA 1KABA 2B2YC 3J7AV 1EEFD 2WB1G 4ZYSA 3DLLA 1VQ5A 2JSOA 2UUCQ 4CDFC 4A3BB 4IFDJ 4DPGA 1WFQA 3RLOA 1KIXA 5C4HA 2NVYH 2GVBA 1JWSD 1ILPA 1LV9A 3RD4A 4C3JH 3MEHA 4V0BA 1BNZA 4A75A 4HIMA 3SEBA 3RZDH 1N33L 1FJGL 2A5HA 3N52A 1MJCA 4GOPC 3L2PA 1G2TA 3PGZA 2EPBA 3VR3A 1HA6A 4ABNA 3GTQH 1VF5C 1HRJA 3T1YL 3GTOB 1H9JA 1LT3D 2G9HD 2NTSA 1DJRD 5C44G 1H9KA 2F4VQ 1B7YB 2KJXA 1KAAA 3HOWH 4BXXG 2IHEA 1QVFA 3E5SA 1EIHA 1GUGA 3AMUA 1PFMA 1GJXA 1VQHA 3CC4A 1CK1A 1ZYRD 3SGIA 3FPPA 3SXHA 4J6HA 2B2VC 4DV5Q 1PTOF 2N8NA 4ID6A 1B53A 3T16A 1GHJA 2UXBQ 2E2DC 2K1BA 3CAMA 1K83H 2UU9L 1VQJA 3GTGB 1RJTA 4Y7NB 2IWHA 5C0XH 1LTGD 4A3EH 1GOZA 1X3FA 1U4MA 5ELFA 1L1OA 2NVQB 3HZXA 4DK1A 4JI8Q 1T9HA 1FD7D 1TY2A 5CV5A 1VQIA 1WTQA 3BJUA 3GV3A 1AZQA 1WD1A 2KHIA 1NMFA 5CGKA 5CORA 2NYZD 1G2SA 5I2XA 4NXNQ 5GAHC 1NR2A 2N88A 1FYCA 1U4RA 3GP7A 3S17B 1X3GA 1VQFA 2AWNA 3OW2A 3OYYA 2F3VA 3AYHB 1WTHA 2VL6A 1Q8IA 4F87A 2R7ZH 3Q24A 1Y69U 3PO2B 2PNRC 1SDFA 4CJ1B 1LTLA 1NY4A 2RF4A 2F0JA 4C2MH 1RCVD 3EVQA 3ERSX 2F3WA 5M9OA 1V8QA 3WOEA 1LACA 4P75A 4GOPA 3NBIA 2DJGC 4A3MH 2AWOA 1BDOA 4OO1I 4IALA 4DR1Q 1IBLQ 4WFN3 4F8MA 1HQMC 3EIVA 5GADC 4X3UA 2K28A 1A0IA 1XMOL 3CP0A 5E3FA 4BY7B 2B2WA 4GNXA 1LTBD 1JOKA 4G7ZC 1E1OA 2WAQB 2V1CC 3K5NA 3M9BA 2EIFA 2EY2A 1GD7A 5BN4A 2JEBI 4JG2A 2MQHA 4EQOA 3S2HH 3FDTA 1VQ9A 3NPPA 1TWFB 3R2TA 1CKNB 5DAUA 3UDFA 2AQ3B 2IT1A 1IBML 1XNQQ 4LF7L 2XVSA 4UP8A 4PNYA 1IL8A 1KDAA 3GTKB 1WJJA 3RZOB 2XN9C 4KHZA 4RAUC 2YU9B 1D1IA 2B2YA 4A3EG 2F0SA 4C3IB 3K5MA 3I90A 3A7AB 4OL7A 4QIWE 4P2CB 1PH9A 3JAME 5FK9C 2FMMA 1R4PB 3HGBA 1PMRA 4IPGA 2QA4A 5KNCA 1VQMA 1PXUA 1EY6A 4JI1L 5JJIA 1LO5D 3Q23A 1V1OA 2YYZA 1AE2A 2ASBA 1JWMD 1RTOA 4LF8Q 1KQSA 3C46A 4UDUC 3TS0A 1HR0Q 1UWVA 1HNWQ 3D4RA 1A3VA 3PUVA 3G48A 1TS3A 5JVH3 3FVQA 3S1MH 4BY1H 1BCPF 1L1OC 1TWAB 2RBMA 2UUAL 2G5DA 2F0EA 3PO3B 1Y1VB 5C0XI 1WTWA 3TQYA 1STGA 3CCVA 1DM0B 1TS4A 4EQ5A 4A3BG 4X3KA 3K6OA 1D6EC 2EYMA 2LXKA 4YWKA 1PH8A 4JW0A 4KJOA 1VMCA 1SNDA 1HR0W 2E74C 4GKJL 1AN8A 3RLFA 1JORA 1DOLA 5C4JH 1PZJD 2EJFC 4JI6L 4A3LG 1G6PA 1BCPB 2WAQG 1Z7TA 4A3DB 1VQNA 1HHVA 5C4XH 1X3QA 4KD4A 3A5ZB 2OQ0A 3FHWA 2JA5B 4LFBQ 5IWAQ 4JOIC 4RFBA 3A74A 1Y1WH 4OHJA 2KCNA 4CJ0B 2MHVA 3VYTA 4AYBG 3BZKA 2WP8J 1O7IA 2F0QA 4A3IH 2R6GA 2OTLA 4BBSB 2QDBA 3CMAA 4A3KB 4KHVA 3A0JA 3OTOQ 3S16H 3ONAB 2F0HA 4IJLA 1XWEA 4B9WA 1K8AC 5COYA 3TP6A 4TVAB 2B2UC 1KHIA 1I94Q 1YBYA 5ISRA 1K8MA 4Z9CB 1ZKOA 3G4SA 4GKKQ 3J81c 1GHKA 4AQYL 3E3XA 2ZT9C 5ELCA 2A6ED 3BYYB 3UE1A 3U58A 4R4CA 2PW5A 4ZKBB 4YHHL 4JYAQ 2PPBC 5EPJA 2HIVA 4QY7A 2NVXH 2DJFC 4MN3A 3KJOA 2HCCA 1LT6D 1KL9A 1KNAA 2F0WA 1IBKL 1BQQT 4JBMA 4IZ8A 3NK9A 2Q2TA 4X3SA 2CHBD 1YJWA 1X6OA 1SN8A 1I4QA 4C1NK 5I2YA 1ENCA 4MIUA 3WWVA 1I4PA 2KA7A 1X3PA 2HT1A 1S5FD 4TKOB 2RDFA 2E76C 3TDQA 1JJCB 2VXWA 4HMJA 1FNUA 1S5DD 3RR5A 4EQNA 3BYTB 2MP1A 4HAEA 4OX9L 1SYEA 1OO9B 2A6HC 1PRTD 4A3FH 2YTXA 1IW7D 1YHQA 1JWUD 2F0PA 4K5VA 1TWGH 1QUQA 1UE5A 4XYOA 5G3LD 3VA7A 4FXKC 3K7AB 3S2DH 3ITPA 4RGMA 4JI3Q 4DR7Q 1LTAD 2HDLA 5JEAH 4A93H 2O5JC 2KHJA 5I6WA 1PFSA 4Q5VA 2MPMA 4X64L 3I4MH 3NTKA 3K57A 3SK6A 4A3IG 3D8GA 2NWGA 1BXTA 3FMCA 3GQBA 4RKBA 1VQ8A 2VUMH 3I73A 3M4QA 3ULLA 4CDDC 5LMNL 4ODGA 1CHQD 3I56A 3I4NG 1SBBB 1IYUA 3ND8A 2WFWA 4FXGC 1M8AA 2CQAA 4B3MQ 1QILA 2RVLA 3Q6SA 4JI5L 2F0FA 4BA2I 3HKSA 4A3BH 4NXNL 2PZWA 5J3BA 3F2DA 3CF5A 2JEAI 1IKLA 1N34Q 1WOCA 5ELDA 4IUPA 1Q86C 3CC7A 1K3BC 3M4PA 3I4NH 4C3JB 1E1TA 1PH2A 5D14A 1X32A 5JPMC 1B3AA 1SXTA 2XRSD 3J80E 1K9MC 3KK7A 4ZLTF 4DUYQ 2IX0A 1ESFA 3X3NA 1IL2A 1TQOA 1G51A 1WD0A 4X62L 1EY7A 1WTOA 1SLJA 3GTQB 3I2ZA 2EQSA 1G8ZD 3SR1A 2I5MX 1F2YA 1KDCA 2F1MA 3PUXA 5C3WA 2EYOA 1QCBD 3VR4A 3ERQA 2J0TD 2SDFA 5C4XG 3HOUB 2MFIA 2HHHL 3BG3A 3I3CA 1LTRD 4MNOA 4A3LH 2Q2IA 1U4PA 1AEXA 1I50B 4HJ7A 1NSNS 3K8AA 1AE3A 3D6CA 1VF7A 2PO4A 1F9SA 1EZ6A 4Y7NH 1EIYB 1QUQB 2ZM6L 3QJYA 3CHBD 1IXRA 1CM9A 2BA1A 5I9OA 1HPCA 1GUWA 1EYAA 1M1KC 5FKAC 1AH9A 3QB3A 3I4LA 2F0LA 4UY8C 2CH4A 1A2UA 2HIXA 3AB9A 2F52A 1YIJA 5IGCA 1HFGA 1HNXQ 3DWPA 4I7AA 2K5VA 1WCMH 4GLXA 4I7ZC 5GAEC 3Q8DA 4K6DA 4GN5A 1YNXA 3TRZA 2K6AA 2J7ZA 2OF1A 4L6TB 2FJ2A 1WYDA 4AYBB 2N3SA 4HSVA 5C3EG 1L1OB 3U50C 1EY9A 3E0JA 4CJ2C 1KLUD 4A3KG 2M9VA 5DEHA 4OIKA 3P1HA 1B8AA 1I94L 2XWJB 1WI5A 5HY6A 3HOXB 1ZYRC 1EY8A 4A76A 2GN5A 2Z6KC 3W5OA 5GROA 5KNDA 2KCCA 2WKDA 1RD9D 1TU2B 3NENA 4A3JG 1A63A 4U68A 4DK0A 3IRBA 2AQ2B 4BY7H 1EOVA 2FINB 1DZ1A 1YHAA 5IYDH 4FNFA 1KXLA 4BY1G 1G91A 4DR5L 3PUYA 3EFXD 5M3FG 3GTLB 4HMIA 1TWFH 1U4LA 2JN4A 2KUMA 3IKJA 3R8BA 1JOQA 1UUPA 1MJEA 2JA6H 2HDMA 3ND9A 4OEMB 1Y8NB 5M5XB 2EY1A 4JYAL 3K0YA 2QF7A 4NW2A 4DV2Q 2ICEC 4A3CG 1XPOA 2QW7A 1PH7A 5I6YA 5CMDA 3CMEA 1LM0A 2BH8A 1B70B 4DV7L 1W6KA 5M5YB 5CV8A 4GKKL 4DV1L 2C9OA 5EAYA 5IGEA 2Q8RE 1J9OA 2Z6KA 1VQ6A 1EY0A 5ELOA 4M8AA 3ZYYX 5H1SE 2C5CA 3JAML 1SFOH 5FO9B 2EDGA 2VZAA 2B3GA 3H0GB 3NBHA 1VCIA 4KV6A 4KTAA 3UDGA 2GVAA 3AU7A 4K8JA 3RMHA 1STBA 5I4DA 4BY1B 3PIO3 4IPHA 2PMZB 3PO3H 1BCPD 3HOYG 5CBAE 1EOTA 5F2DA 1R9TB 5BN5A 4BBRH 5M3MG 3S24A 3ULPA 2O5IC 2OTJA 4RH6A 2F0GA 1L0XB 2WKCA 2I07B 3HKZG 2WB1B 1LYLA 4Q0FA 2PW7A 4X64Q 1EQVA 1SAPA 1IBMQ 1DOKA 1TT2A 4FO2A 1BCPC 4A3MG 2L11A 1KAWA 1IKMA 1OXVA 2E2IH 3A54A 5C4XB 1NNXA 3URYA 1SE8A 3NWSA 1YZ6A 2H1EA 2EYHA 4OWWB 3HOWG 1E2VA 3KF8B 3P20A 3HOZH 2F0TA 1ICFB 1I4RA 5JVG3 4A3GH 2ALYB 1IYJB 4DFAA 1RHPA 1PTOH 3TEHB 3W1GA 4EX5A 1YNJC 2JA7H 1XMOQ 2JA8B 1PH5A 1B9MA 1HR0L 3QG1A 4YWLA 1LT5D 3S16B 1IBLL 2WINB 3RN5A 2R3ZA 5J22A 3PMFA 2VS1A 3MWYW 3BS1A 1STNA 1Q3LA 1NJIC 1TWCB 1E7ZA 3S9WA 4C3JG 5FOBB 3OIQA 2AUKA 4X3TA 5E1FA 1EFID 4KI0A 4LW1A 4DXFA 5IY0A 3LX0A 3FKIH 4YY3L 5C0XG 4H02A 3D4WA 1KC8C 2JE6I 1C8CA 4PG3A 2H5XA 2VW9A 1BO0A 3T56B 3KF8A 2JK8A 1SR3A 1D5ZC 2ZM6Q 1NBWA 4HJ8A 1HA5A 1O7ZA 3GTPH 3NP8A 2SOBA 3BVMA 3NHHA 2LMCB 2CKZB 2SNMA 3R93A 1PZID 2XWBB 4KY6A 1JE4A 3HG9A 4K2KA 2L12A 4NPSA 4JI8L 4KD3A 4LK1C 4P71A 5IGFA 2RCFA 5C3EH 2HHHQ 2VNUD 5T1GA 2F0MA 1OXTA 3OHXC 1H9MA 1SMYD 2K75A 3CRLC 1UE1A 1MSGA 4G4KA 2UU9Q 4HR7B 3NE5B 2NZOA 4A3CH 1QB5D 1L0YB 5FLXc 2N55A 1UNSA 3PIOA 1U5KA 4LFBL 1DONA 1RF2D 2L55A 1TWGB 2BH2A 1ILQA 1MSHA 1FR3A 4FF1A 3S2DB 2NVTB 3W3AA 3TP7A 5IT9c 3CPFA 2BE5C 3K81C 1Q82C 1PTOC 1I6VC 4F7XA 3M85A 2CFMA 1JJ2A 4RHRA 1V9PA 3CD6A 2NZ1D 2ENBA 4OONA 1TS5A 4P74A 2DY7A 1D1KA 2VUMB 5FO7B 3G6EA 1X3EA 1F77A 1N34L 4WORA 4K8IA 1BVSA 4F88A 4A3JH 4MZ9A 3D3RA 2Q8IB 2A6HD 2RSNA 2F03A 4R4OA 3LWEA 2EYLA 1N33Q 1JMCA 3HOYB 3K5LA 1GUSA 1Q46A 3VR2A 1MBYA 2QGQA 1C7YA 3QWNA 3PF5A 3CW2C 5C0XJ 4J15A 5KEEA 3MXPA 4OWTB 4DNTB 1ASZA 4DV2L 2MO1A 3VDYA 1JR0D 1ET9A 1HNXL 1RL2A 2TSSA 4QQBX 1QOHA 4OWXB 1VQAA 2PQAA 2Y0SE 4DV5L 2KEDA 4JV5Q 3S1NH 1CTMA 1P16A 2GA4B 3BDLA 1ZXTA 4L8JA 1IW7C 5M3FH 4DR7L 2YTYA 5EPKA 2DN8A 1QE6A 3G6JB 3T13A 4QCLA 3FP9A 1EZ8A 2F0DA 2JQOA 2L0CA 4A3FG 4LF7Q 2ATWA 2J4XA 2K52A 2KBNA 1CZGA 3T1YQ 4C3HH 2WACA 1T5XD 5CV6A 2ZJPA 1I3QB 3D31A 3A8KE 5JAVA 5CV9A 1NAPA 1CZWA 3K80C 4WJ4A 2B39A 4DK6C 3TSSA 1V43A 4TQUS 1EWHA 4IOCA 1XMQQ 1UE7A 3H3VI 1S4ZA 3B6YA 1PYSB 3M4OB 1CA6A 1VQCA 1EWCA 2DNCA 4YCUA 3HOXG 1GUOA 4RCNA 2D0PA 2EY5A 3STBD 4DR1L 1CQVA 3I8ZA 1HZCA 1U0LA 1DXMA 1NTGA 3P7JA 1YEZA 4X62Q 1IZ6A 2KHSA 3A55A 1ICWA 3NXWA 1VQGA 1MI2A 4YHHQ 3HOVG 1XX8A 1KD1C 2X69A 2D5DA 5JEAG 4A93G 4DN4M 3I55A 1VQEA 2OT2A 1H95A 2B2TA 4TRDA 1UE6A 2R7FA 3RN2A 2UXCL 4DKAC 1UAPA 3HOZG 3GTOH 4QJFA 1B1ZA 2BOSA 2P5ZX 5I9PA 3HOWB 1K0RA 2LSSA 1UEBA 4BBSG 5CBEE 2K5HA 5K5PA 1X54A 5CV7A 1HUNA 2CWPA 2K7VA 1Y1WG 3J80i 2PI2A 4KK7A 1K28A 4PQXA 1K83B 2JJQA 4N9PA 3KDFB 3GTGH 4GOPB 5LMNQ 1Q7YC 5CYUA 3MVVA 3HOXH 1V1PA 5A2QL 5HGQA 4S3SA 2IX1A 1TVXA 5LMUL 4HN7A 1HXYD 2JXMB 2R93B 1X56A 1W3SA 1HTPA 1EQRA 3S1RB 3ICEA 3AFQA 1KTKA 3PIPA 4R4QA 1PVOA 2R92B 3KYHC 4LFCL 1DGSA 4HJ9A 3CCSA 5A2QE 3Q22A 2WAQE 3GD7A 2EOTA 4A3GG 1F9QA 2CW0C 2MJ8A 2RHQB 4X65Q 3KFUA 2R7ZB 2UUAQ 2JA6B 3S15H 1XTCD 2WV6D 3PO2H 2B63H 2NB0A 1CSPA 4LF4Q 3RNUA 1PRTB 4HIOA 1HNWL 4AYBE 4QUCA 2X6GA 1A8VA 3WDNA 1FJGQ 2B8FA 1N32L 4OXPA 4A3MB 5M5YH 4B3ML 2CW0D 2N49A 4ILWA 2Q2HA 3C1FA 5NUCA 5M5WB 3FKIG 4GLVB 3PIP3 2X6LA 1W2BA 2B2TC 2I0QA 3H0GH 1SNMA 1YHBA 1QVCA 2DUDA 5IGBA 1U9RA 4DV6L 1S40A 4JI2L 4HCEA 2Z8LA 2FXQA 1DD2A 2WB1E 1EFWA 1JJGA 4JI3L 4DU9A 1O78A 5KIXA 5IP9G 2RA4A 4JBJA 3PQIA 1BKBA 4CGYB 3GTKH 3I91A 2RDHA 2IY5B 4ULLA 3RLNA 1EL0A 4MTNA 5AFWA 1Q81C 1C9OA 4CKEA 4OX9Q 3TMEA 4C3IH 5IODA 1EU4A 2A69C 4IUTA 3OTOL 4IO9A 4CHTB 4RG1A 4LF9Q 3VA5A 5C5MA 1QNKA 2A73B 3TZDA 2AQ1B 2E2IB 2K32A 1S3OA 1PYBA 1X9NA 5LL6S 1SEBD 3MTSA 1KLGD 2ES2A 4C56C 4DAMA 3E6ZX 2SEBD 3TN2A 5IWAL 3BZCA 4DV0L 3UE0A 4A3GB 1PFBA 4RGTA 3PUWA 4LNQA 2A68C 3OWEB 1PTOB 1MIUA 1IBKQ 4HJAA 1Z6HA 3LWUA 3EBEA 1CQFA 2JA8H 4BBRG 5M3MH 3S1MB 2NZHA 1TWAH 4G7OC 2PCFB 5D3IB 2QDLA 3CQZH 4O1NA 3IAYA 3PSIA 4L63B 3F2CA 3AEVA 2O2LD 3S14H 5TSSA 2ID0A 5JEAJ 2XSCA 1TWCH 4PMCA 3CCLA 2A19A 2AHOB 3KOJA 4AQYQ 2E5LL 2ZXPA 4IJHA 4LAAA 4NXML 1I6HH 1LUZA 1L0WA 3FKIB 3KLWA 4N8X1 4RWSC 1VQKA 4A3DH 1K0SA 2JP1A 4DAPA 1M4VA 2JA5H 3EA6A 4LF8L 4IUNA 4XT3B 3DWQA 3CKIB 1F2MA 1F9RA 5EQ0A 2TMPA 3AQQA 2UXBL 4BBSH 1EIFA 4DR6Q 4DV4L 1JC7A 3WOFA 5IIFA 2I5HA 5HURA 3GO5A 3OSOA 3CCJA 3DXJC 4DR5Q 2IL8A 3EQLC 3C2PA 1MGSA 3C1EA 1E24A 4JI6Q 2Q2UA 5KYLA 2L4NA 4L5SA 4DK3C 4HCSA 4RHSA 4CDEC 1HH2P 3OIPA 2ZTCA 4KY5A 5CV4A 2K50A 3NQIA 4G57A 2NN6G 3HKZB 3J7A5 1PYWD 2V4DA 3AFPA 3CRKC 2IHFA 2A74C 5GQOA 2PQEA 2K05A 2YTVA 4PZ7A 4MTKA 5EGTA 2PYKA 2K4KA 1F2ZA 3NTIA 4A4IA 5FJ8H 3F1ZA 4TSSA 3QR8A 3RZDB 1ESRA 1ENAA 4A3JB 4WJWA 4JK1C 4CKBA 1BR9A 1BBXC 4JCVE 2UUCL 5ELBA 4JI1Q 4K2LA 4KLKA 1SNOA 4ME3A 3HOUG 4GN3B 5C3XA 2E8GA 5JPNC 1S72A 2BE5D 1A15A 1BBWA 4BWGB 3H3VH 1PTOD 4IUVA 2UUBL 3E9HA 3F2BA 2DNEA 3NUCA 1FNVA 1WVLA 2PZUA 3U4VA 4ZKCB 1SMYC 2NTTA 3MXNA 3OPOA 3K7UC 3KJPA 1BF4A 4GNXB 3W2DA 5EBCA 4O0AA 2XGTA 1QG7A 3H6MA 4ZQ3A 4POGA 2MGSA 4A93B 1B44D 2K5WA 1PLFA 4LF6Q 1QZGA 4FVMA 2EZVA 4GZYC 1GVPA 1RKNA 4UP9A 1SRUA 2RDGA 5ELEA 4OO1H 1SE4A 3T1HQ 2F0VA 1BOSA 4RMFA 5BR8L 1KNEA 3MC0B 4O42A 5IP7H 3V05A 1I3QH 3A8JE 5FLMG 1FNWA 4KJNA 1QWYA 1KRTA 1X55A 1XJVA 1HZBA 3L7ZC 2QILA 2A8VA 3L9AX 2IPKD 1MD2D 3H94A 3R3OA 4DUYL 4KMUC 2KOLA 2L5TA 3M4OH 3J81j 1JB3A 2EYFA 4LWCA 4QL5A 5D65A 2F4VL 2QEXA 3DEPA 2B63G 4DR3Q 2I46A 4AIMA 4KHPL 3H3VC 4BXXH 1EU3A 4KKSA 1II3A 3F8TA 1K8OA 1PRTC 1N8RC 5E4WC 1JE5A 5DNFA 4QUFA 4R9WA 4R8NA 2B2WC 4JI5Q 1YNJD 1WCMG 1TWHH 4DF7A 4FF2A 4IFDH 5GAGC 1OXUA 5DM73 2R92G 3JC66 3J7AF 1C48A 2LFNA 4B3RQ 3P75A 3S1QB 4E6IA 4QMGA 2K14A 1I4XA 2BDNA 4BS9A 1LTID 5IYBG 4QIWB 5IP7G 1PH4A 5D3DA 1CKMA 1LABA 1HUMA 5IP9H 4OO1G 3NELA 4DNRB 2UUBQ 3HOUH 3UDXA 4IPDA 1I50H 1SYCA 1A6XA 2VQFQ 4FYDA 1JT8A 1SYBA 4DR2L 5LHY1 4FF3A 1A62A 3CPWA 3RZOH 1D7QA 1SNCA 1QZHA 2YU9H 3BZDB 4PMWA 2MUYA 2QKIC 5JOBA 2R93H 1XNRL 2A1AA 3S1RH 4NMZA 5IGGA 1ENFA 3UI2A 5C44H 4DXGA 3JAMc 5KYIA 1IYVA 3PUZA 2H4OA 1TY0A 3GDEA 4NDXA 4APVA 2R92H 1R4QB 4B3TL 4I65A 3E0EA 3Q0AA 1MHWC 1ONLA 1Q1BA 3M7NA 4L5QA 2OXPA 2CVRA 2F3IA 1X65A 2LS01 3HOVB 1PDQA 4K0KQ 1NE3A 1PA6A 1E3PA 3M4YA 2FFKB 1TXYA 4LFAQ 4JC0A 1YJ9A 5FJ8G 2B2UA 1XPUA 4JI0Q 4DV3Q
chains in the Genus database with same CATH topology
2L1BA 2EJGC 1H9SA 3TP5A 4H0LC 3HS0C 1VDZA 1SE2A 3A8IE 4DAYA 3T51B 4H44C 2EVBA 1EYCA 1F2LA 2B8GA 2D9UA 2K33A 2E2JB 1B4OA 1HCZA 3LNNA 5CR3A 4MHEA 1BUVT 2R61A 3SDZA 4LMQD 5C5LA 5BN3A 1SE3A 4BA1I 4ZK9B 1O80A 3D4DA 3MHBA 1CI3M 2Z4HA 2LKVA 1G291 1WTRA 1QNUA 2F0UA 2QCPX 2ZXOA 1EY4A 2F0OA 5KNBA 5K36H 4XIGS 5JJZA 2NVXB 1G6ZA 3OW7A 4B08A 4K5WA 1HQRD 5M3MB 3DHQA 4OGQC 4XQJA 1EEID 1HFNA 1LTTD 1AZPA 1D5MC 3O13A 3CQZB 2FHTA 4BBRB 3QO2A 3S14B 3SK8A 3SVMA 2NN6H 5G3LF 1SNPA 2ZXRA 3V2TA 1O7LA 3K58A 1Y8PB 3A7LA 3MFGA 5E4XA 1DYQA 3CU7A 4A3FB 3TZUA 4FP5D 5C4ZA 4NP5A 2EYPA 3HOZB 1PFNA 3RUZA 3OWFA 4YIJA 2ICIA 1SJED 2KVMA 2JA7B 4U673 2IJ0A 1D2BA 4ZUIA 3DEOA 1WTVA 3KUPA 3R2IA 1S5BD 5EKLA 1Y8OB 5KRUA 4CBVA 1CA5A 4B9XA 3G7LA 4IURA 4XDXA 3GTMB 1ML0D 1OXSC 4FF4A 2D2CC 3T4AC 2LY7A 3BDCA 1SNQA 1F9PA 5KGUA 3EJIA 3VYSA 3I4NB 3VYRA 3NSWA 2M2LA 1GXDC 1RDPD 2EYJA 1VMPA 4KKUA 3VR5A 3KBGA 5C3EB 5J1ZA 3J80L 2OEOA 3NQTA 3HRZC 3PV0A 1DCZA 2B2VA 1A2TA 4C3IG 1CFMA 2E75C 3OMCA 3QOJA 4DGZA 3T53B 3V96A 1I4GA 2NVYB 3IFDA 4PV1C 1YNND 4LJZC 3HP3A 4WRDA 3BVGA 2NN6I 3X3MA 2KQ3A 5IT9E 1NCVA 4JBWA 2DY8A 4H13C 5IT9L 5J39A 2NBFA 1YNNC 2Y0SB 2EJMA 3DM1A 4R8IA 1WCMB 2VB3X 4ZAIA 2IX3A 3K59A 1TIID 2BDOA 3HEJA 3H09A 2KEEA 1JCKB 4XTCS 5LL6X 2RKSA 1WTPA 2K04A 4RCOA 3NWTA 1Q1EA 1H9SB 3I70A 2M00A 3M7GA 3IL8A 1QJOA 5M3FB 4RGNA 1NR4A 1IHZA 4XQQA 4A3EB 4ZUJA 2EY6A 4QB4A 1TWHB 4KKTA 1TR5A 2F0IA 1Q90A 2D62A 4FXDA 1A3UA 3U9SA 2IW3A 4RA8A 1H9RA 4XT1B 4DAVA 1RTNA 3VYUA 1W6JA 3SK4A 5IOCA 2AUJD 4K14A 3KLSX 3F2UA 4IUUA 3VR6A 4EGVA 4C2MB 3KLSA 1I4HA 1STAA 2HQEA 4KN4C 2WIIB 2RSOA 4C3HG 4K5XA 3SK5A 5C44B 1TS2A 2NUCA 1AW7A 3SHLA 1S5CD 4J8QA 3TP8A 2BCOA 2L9HA 4IQZA 4C1NI 1OXXK 1SFOB 3MZ5A 2BA0A 3S2HB 2K5QA 2Z4IA 3H91A 1AFPA 2A69D 4J1MA 1PZKD 1CHPD 1GUNA 1SJHD 2FMCA 4CKCA 2F0KA 4N9TA 3BDOA 1UEAB 2K03A 1STHA 3N6RA 2A68D 1CT1D 5FO8B 2F4IA 5T1IA 1SYDA 2SNSA 3C3LA 1JICA 3D6WA 3MXGA 2XIWA 5DM63 3NTHA 3S15B 5EPLA 3J7YW 3DWAA 2RQXA 3OMGA 4XXEA 2B63B 3MA2B 2A6EC 3L3OC 1O7YA 2QEJC 3QOLA 4PMBA 4KY7A 3MAQA 3OOCA 4HEDA 5EJWA 5C6AA 1C4QA 2K5DA 3FRPB 2XRQD 3A56A 3DUZA 1SSOA 5C4JB 2JYOA 1XYIA 2HUGA 4RGOS 1B9NA 5EKKA 1SYFA 4HSPA 4M1UB 1NUCA 1DOMA 4IUQA 5IGDA 2KECA 4XQNA 3GTPB 3TBIB 3FEWX 1Y1WB 5FLXL 5FLXE 4A3IB 1RODA 4EVOA 4K6LA 1ZEQX 2EE1A 1GUTA 1EY5A 1Z47A 1TKWB 3U9OA 4UAIA 1LTSD 2E2HB 3EROA 3M3YB 2O4XA 4QF4A 1STYA 5CC4A 3KLRA 3J81E 1E2WA 1LLRD 1STEA 4XYQA 4EQPA 2Z1CA 3MFYA 1T5EA 5A35A 4RKLA 1JQYD 4DA2A 4V190 3GTJB 4NKLA 1KDBA 3MXUA 1JOOA 2G9DA 3GV6A 1ET6A 3DMUA 3BVZA 5HGTA 1EQTA 4HTHA 3IFTA 1WTXA 5K36G 1AP0A 3FPUB 2F0NA 4ME5A 2XNAC 1FGBD 2EXZA 1B2TA 1LT4D 1I6HB 2Q8TA 3I72A 4H7BA 1EIGA 1A3TA 1J8IA 1XXGA 4OIJA 1E2ZA 3J81L 4G7HC 1S5ED 4IFDG 1EYDA 1D5XC 3K5OA 2HCIA 4KN7C 3QIAA 4IFDI 5EBDA 3S1NB 3I4MB 2PZTA 3SE0A 1Q12A 1PRTF 4ZRZA 5EKIA 3KBXA 1HTLD 1V1PB 1B50A 1SYGA 4C3HB 2VB2X 2K01A 4IN3A 1E0BA 1KABA 2B2YC 3J7AV 1EEFD 4ZYSA 2JSOA 4A3BB 4IFDJ 5C4HA 1JWSD 1ILPA 1LV9A 3RD4A 3MEHA 4V0BA 1BNZA 3SEBA 2A5HA 3N52A 1G2TA 2EPBA 3VR3A 1HA6A 4ABNA 1VF5C 1HRJA 3GTOB 1H9JA 1LT3D 2G9HD 2NTSA 1DJRD 1H9KA 2KJXA 1KAAA 1EIHA 3E5SA 1GUGA 3AMUA 1PFMA 1GJXA 1CK1A 1ZYRD 3FPPA 3SXHA 4J6HA 2B2VC 1PTOF 4ID6A 1B53A 3T16A 1GHJA 2E2DC 2K1BA 3GTGB 1RJTA 4Y7NB 2IWHA 5C0XH 1LTGD 1GOZA 1U4MA 5ELFA 2NVQB 3HZXA 4DK1A 1FD7D 1TY2A 5CV5A 1WTQA 3GV3A 1AZQA 1WD1A 5CGKA 5CORA 2NYZD 1G2SA 5I2XA 1NR2A 2N88A 1FYCA 1U4RA 3GP7A 3S17B 2AWNA 2F3VA 1Q8IA 4F87A 3Q24A 1Y69U 3PO2B 2PNRC 1SDFA 4CJ1B 2F0JA 1RCVD 3EVQA 2F3WA 5M9OA 1V8QA 3WOEA 1LACA 3NBIA 2AWOA 1BDOA 4OO1I 4IALA 4WFN3 4F8MA 1HQMC 4X3UA 2K28A 5E3FA 4BY7B 2B2WA 1LTBD 1JOKA 4G7ZC 2WAQB 3K5NA 2EY2A 5BN4A 2JEBI 4EQOA 3FDTA 3NPPA 1TWFB 3R2TA 5DAUA 2AQ3B 2IT1A 2XVSA 4PNYA 1IL8A 1KDAA 3GTKB 3RZOB 2XN9C 4KHZA 4RAUC 2YU9B 1D1IA 2B2YA 2F0SA 4C3IB 3K5MA 3I90A 3A7AB 4OL7A 4P2CB 3JAME 5FK9C 2FMMA 1R4PB 3HGBA 1PMRA 5KNCA 1PXUA 1EY6A 1LO5D 3Q23A 1V1OA 2YYZA 1JWMD 1RTOA 3C46A 4UDUC 3D4RA 1A3VA 3PUVA 1TS3A 5JVH3 3FVQA 1BCPF 1TWAB 2RBMA 2F0EA 3PO3B 1Y1VB 5C0XI 1WTWA 1STGA 1DM0B 1TS4A 4X3KA 3K6OA 1D6EC 2EYMA 1VMCA 4KJOA 1SNDA 2E74C 1AN8A 3RLFA 1JORA 1DOLA 1PZJD 2EJFC 1BCPB 1HHVA 1Z7TA 4A3DB 1X3QA 4KD4A 2JA5B 4RFBA 4OHJA 2KCNA 4CJ0B 2MHVA 3VYTA 2WP8J 2F0QA 2R6GA 4BBSB 2QDBA 4A3KB 4KHVA 3ONAB 2F0HA 1XWEA 4B9WA 5COYA 3TP6A 2B2UC 5ISRA 1K8MA 4Z9CB 1ZKOA 1GHKA 2ZT9C 5ELCA 2A6ED 3BYYB 2PW5A 4ZKBB 2PPBC 5EPJA 4MN3A 2HCCA 1LT6D 1KNAA 2F0WA 1BQQT 4IZ8A 3NK9A 4X3SA 2CHBD 5I2YA 1I4QA 4C1NK 1ENCA 4MIUA 1I4PA 2KA7A 1X3PA 1S5FD 4TKOB 2RDFA 2E76C 3TDQA 2VXWA 4HMJA 1FNUA 1S5DD 4EQNA 3BYTB 2MP1A 4HAEA 1SYEA 1OO9B 2A6HC 1PRTD 1IW7D 1JWUD 2F0PA 4K5VA 4XYOA 5G3LD 3VA7A 4FXKC 3K7AB 3ITPA 4RGMA 1LTAD 2HDLA 5JEAH 2O5JC 5I6WA 4Q5VA 2MPMA 3NTKA 3K57A 3SK6A 3D8GA 2NWGA 1BXTA 3FMCA 3GQBA 4RKBA 3I73A 4ODGA 1CHQD 1SBBB 1IYUA 3ND8A 4FXGC 1M8AA 2CQAA 1QILA 2RVLA 3Q6SA 2F0FA 4BA2I 2PZWA 2JEAI 1IKLA 5ELDA 4IUPA 4C3JB 5D14A 1X32A 5JPMC 1B3AA 1SXTA 2XRSD 3J80E 3KK7A 4ZLTF 2IX0A 1ESFA 3X3NA 1TQOA 1WD0A 1EY7A 1WTOA 3GTQB 1G8ZD 3SR1A 1F2YA 1KDCA 2F1MA 3PUXA 5C3WA 2EYOA 1QCBD 3VR4A 3ERQA 2J0TD 2SDFA 3HOUB 3BG3A 3I3CA 1LTRD 1U4PA 1AEXA 1I50B 1NSNS 3D6CA 1VF7A 2PO4A 1F9SA 1EZ6A 3QJYA 3CHBD 1CM9A 2BA1A 5I9OA 1HPCA 1GUWA 1EYAA 5FKAC 3QB3A 3I4LA 2F0LA 1A2UA 3AB9A 5IGCA 1HFGA 3DWPA 4I7ZC 4K6DA 2K6AA 2J7ZA 2OF1A 4L6TB 2FJ2A 4AYBB 4HSVA 1EY9A 3E0JA 4CJ2C 1KLUD 2M9VA 5DEHA 4OIKA 3P1HA 2XWJB 3HOXB 1ZYRC 1EY8A 5KNDA 2KCCA 2WKDA 1RD9D 1TU2B 4U68A 4DK0A 2AQ2B 2FINB 1DZ1A 4FNFA 1G91A 3PUYA 3EFXD 3GTLB 4HMIA 1U4LA 2KUMA 3IKJA 3R8BA 1JOQA 1UUPA 2HDMA 3ND9A 1Y8NB 5M5XB 2EY1A 3K0YA 2QF7A 4NW2A 2ICEC 5I6YA 5CMDA 1W6KA 5M5YB 5CV8A 2C9OA 5IGEA 2Q8RE 1J9OA 1EY0A 4M8AA 3ZYYX 2C5CA 3JAML 5FO9B 2EDGA 3H0GB 3NBHA 1VCIA 4KV6A 4KTAA 3AU7A 4K8JA 3RMHA 1STBA 5I4DA 4BY1B 3PIO3 2PMZB 1BCPD 5CBAE 1EOTA 5F2DA 1R9TB 5BN5A 2O5IC 4RH6A 2F0GA 1L0XB 2WKCA 2I07B 2WB1B 4Q0FA 2PW7A 1EQVA 1SAPA 1DOKA 1TT2A 4FO2A 1BCPC 2L11A 1IKMA 1OXVA 3A54A 5C4XB 3URYA 3NWSA 2H1EA 2EYHA 1E2VA 3P20A 2F0TA 1I4RA 5JVG3 4DFAA 1RHPA 1PTOH 1YNJC 2JA8B 1B9MA 3QG1A 3S16B 1LT5D 2WINB 2R3ZA 5J22A 3PMFA 3MWYW 3BS1A 1STNA 1Q3LA 1TWCB 3S9WA 4C3JG 5FOBB 3OIQA 2AUKA 4X3TA 5E1FA 1EFID 4KI0A 4DXFA 3LX0A 5C0XG 3D4WA 2JE6I 1C8CA 1BO0A 3T56B 3KF8A 1D5ZC 1HA5A 1O7ZA 3NP8A 2SOBA 3BVMA 3NHHA 2LMCB 2SNMA 3R93A 1PZID 2XWBB 4KY6A 1JE4A 3HG9A 4K2KA 2L12A 4KD3A 4LK1C 5IGFA 2VNUD 5T1GA 2F0MA 1OXTA 3OHXC 1H9MA 1SMYD 3CRLC 1MSGA 4G4KA 4HR7B 3NE5B 1QB5D 1L0YB 2N55A 1UNSA 1DONA 1RF2D 2L55A 1TWGB 1ILQA 1MSHA 1FR3A 4FF1A 3S2DB 2NVTB 3W3AA 3TP7A 2BE5C 1PTOC 1I6VC 4F7XA 3M85A 4RHRA 2NZ1D 2ENBA 1TS5A 2DY7A 1D1KA 2VUMB 5FO7B 1F77A 4WORA 4K8IA 4F88A 3D3RA 2Q8IB 2A6HD 2RSNA 2F03A 3LWEA 2EYLA 3HOYB 3K5LA 1GUSA 3VR2A 1MBYA 3QWNA 5C0XJ 5KEEA 3MXPA 4DNTB 1JR0D 1ET9A 2TSSA 1QOHA 2KEDA 1CTMA 2GA4B 3BDLA 1ZXTA 4L8JA 1IW7C 5EPKA 2DN8A 1QE6A 3G6JB 3T13A 4QCLA 1EZ8A 2F0DA 2L0CA 2J4XA 1CZGA 2WACA 1T5XD 5CV6A 1I3QB 3D31A 3A8KE 5JAVA 5CV9A 1NAPA 1CZWA 2B39A 3TSSA 1V43A 4TQUS 1EWHA 1S4ZA 3M4OB 1CA6A 1EWCA 2DNCA 1GUOA 4RCNA 2EY5A 1CQVA 3I8ZA 1DXMA 3P7JA 2KHSA 3A55A 1ICWA 3NXWA 1MI2A 1XX8A 2X69A 2D5DA 5JEAG 4DN4M 2OT2A 2B2TA 4TRDA 1UAPA 1B1ZA 2BOSA 5I9PA 3HOWB 5CBEE 5K5PA 5CV7A 1HUNA 2K7VA 4KK7A 4PQXA 1K83B 4N9PA 5CYUA 3MVVA 2IX1A 1V1PA 5A2QL 4S3SA 1TVXA 4HN7A 1HXYD 2JXMB 2R93B 1HTPA 3S1RB 1KTKA 2R92B 5A2QE 3Q22A 3GD7A 2EOTA 1F9QA 2CW0C 2MJ8A 2R7ZB 2JA6B 1XTCD 2WV6D 2NB0A 1PRTB 4QUCA 2X6GA 3WDNA 2B8FA 4A3MB 2CW0D 4ILWA 3C1FA 5NUCA 5M5WB 3PIP3 2X6LA 2B2TC 1SNMA 5IGBA 1U9RA 4HCEA 2Z8LA 1DD2A 4DU9A 1O78A 5KIXA 2RA4A 4CGYB 3I91A 2RDHA 4ULLA 1EL0A 5AFWA 4CKEA 3TMEA 5IODA 1EU4A 2A69C 4IUTA 4CHTB 3VA5A 5C5MA 1QNKA 2A73B 3TZDA 2AQ1B 2E2IB 2K32A 5LL6S 1SEBD 3MTSA 1KLGD 4C56C 3E6ZX 2SEBD 3TN2A 4A3GB 1PFBA 4RGTA 3PUWA 2A68C 3OWEB 1PTOB 1Z6HA 3LWUA 1CQFA 3S1MB 4G7OC 2PCFB 5D3IB 4O1NA 3IAYA 4L63B 2O2LD 5TSSA 2ID0A 5JEAJ 2XSCA 4PMCA 2ZXPA 4LAAA 3FKIB 4RWSC 2JP1A 4DAPA 1M4VA 3EA6A 4IUNA 4XT3B 3DWQA 3CKIB 1F2MA 1F9RA 5EQ0A 2TMPA 1JC7A 3WOFA 5IIFA 5HURA 3GO5A 3OSOA 3DXJC 2IL8A 3EQLC 3C2PA 1MGSA 3C1EA 5KYLA 2L4NA 4HCSA 4RHSA 3OIPA 4KY5A 5CV4A 3NQIA 4G57A 2NN6G 3HKZB 1PYWD 2V4DA 3CRKC 2A74C 2PQEA 2K05A 5EGTA 2PYKA 3NTIA 1F2ZA 4TSSA 3RZDB 1ESRA 1ENAA 4A3JB 4WJWA 4JK1C 4CKBA 1BR9A 1BBXC 5ELBA 4K2LA 1SNOA 5C3XA 5JPNC 2BE5D 1A15A 4BWGB 1PTOD 4IUVA 2DNEA 3NUCA 1FNVA 1WVLA 2PZUA 4ZKCB 1SMYC 2NTTA 3MXNA 3OPOA 1BF4A 3W2DA 5EBCA 3H6MA 1QG7A 4ZQ3A 4A93B 2MGSA 1B44D 2K5WA 1PLFA 4FVMA 2EZVA 4GZYC 1RKNA 2RDGA 5ELEA 4OO1H 1SE4A 2F0VA 1BOSA 1KNEA 3MC0B 4O42A 3V05A 3A8JE 1FNWA 4KJNA 1QWYA 3L7ZC 2QILA 3L9AX 2IPKD 1MD2D 3H94A 3R3OA 4KMUC 2KOLA 2L5TA 1JB3A 2EYFA 5D65A 3DEPA 2I46A 3H3VC 1EU3A 4KKSA 1II3A 1K8OA 1PRTC 5E4WC 5DNFA 4QUFA 4R9WA 4R8NA 2B2WC 1YNJD 4IFDH 4DF7A 4FF2A 1OXUA 5DM73 3J7AF 1C48A 2LFNA 3P75A 3S1QB 4E6IA 4QMGA 1I4XA 2BDNA 4BS9A 1LTID 4QIWB 5D3DA 1LABA 1HUMA 4OO1G 4DNRB 1A6XA 1SYCA 4FYDA 1SYBA 5LHY1 4FF3A 1SNCA 3BZDB 4PMWA 2MUYA 2QKIC 5JOBA 4NMZA 5IGGA 1ENFA 3UI2A 4DXGA 5KYIA 1IYVA 3PUZA 2H4OA 1TY0A 4NDXA 1R4QB 4I65A 3Q0AA 1ONLA 1Q1BA 3M7NA 2OXPA 2CVRA 2LS01 3HOVB 1PDQA 3M4YA 2FFKB 2B2UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KOL A;  2L1B A;  2X69 A;  4DN4 M;  5D65 A;  4UAI A;  4CJ0 B;  1NCV A;  2J7Z A;  2DY8 A;  2B2T A;  3DEP A;  1PFN A;  4X3U A;  1SAP A;  2K28 A;  2FJ2 A;  2L4N A;  1DOK A;  4HSV A;  1ILP A;  1LV9 A;  2KVM A;  2L11 A;  1M8A A;  1BNZ A;  2NZ1 D;  1IKM A;  4HCS A;  2DY7 A;  3H91 A;  3DM1 A;  2RVL A;  2RA4 A;  3DEO A;  3Q6S A;  4CJ2 C;  3ONA B;  2B2W A;  4R8I A;  1WTV A;  4OIK A;  3KUP A;  3N52 A;  5E4W C;  2H1E A;  3I91 A;  4ZAI A;  5COY A;  2RSN A;  2B2U C;  5CBE E;  3LWE A;  1EL0 A;  1F2L A;  2K05 A;  5AFW A;  5DNF A;  1IKL A;  4R9W A;  4QUF A;  2KEE A;  2D9U A;  1G2T A;  2EPB A;  4IUP A;  2B2W C;  1RHP A;  4IUT A;  1HA6 A;  1CA5 A;  1B4O A;  1HUN A;  3FDT A;  1WTP A;  2K04 A;  3G7L A;  4U68 A;  4IUR A;  1QNK A;  3TZD A;  4XDX A;  1HRJ A;  2K03 A;  1ESR A;  3IL8 A;  2FIN B;  4MHE A;  5D14 A;  1DZ1 A;  1X32 A;  1B3A A;  3MTS A;  1ML0 D;  2BDN A;  1IL8 A;  2R3Z A;  4LMQ D;  1EIH A;  4RAU C;  3MWY W;  3GV6 A;  5T1I A;  1NR4 A;  3TN2 A;  4ZK9 B;  1O80 A;  1TVX A;  1PFM A;  1Q3L A;  1F9P A;  1EQT A;  4ZKB B;  4ZLT F;  1HUM A;  2B2Y A;  1WTX A;  1BBX C;  5EPJ A;  1G91 A;  1PFB A;  1JIC A;  1AP0 A;  3FPU B;  3I90 A;  3D6W A;  4MN3 A;  1WD0 A;  2B2V C;  2HCC A;  1WTO A;  2XIW A;  1WTR A;  1B53 A;  1KNA A;  2FMM A;  2M2L A;  1A15 A;  1U4L A;  2KUM A;  4X3T A;  1B2T A;  2KED A;  2HDM A;  2Q8T A;  5EPL A;  2K1B A;  1VMP A;  4IUV A;  4X3S A;  1EIG A;  1ZXT A;  4RA8 A;  4NW2 A;  1J8I A;  1O7Y A;  1RJT A;  1C8C A;  5EPK A;  1RTO A;  1QE6 A;  4OIJ A;  4XT1 B;  1WVL A;  1BO0 A;  5CMD A;  4HED A;  1U4M A;  2SDF A;  5EJW A;  1RTN A;  1X3P A;  4ZKC B;  5JJZ A;  1O7Z A;  3I3C A;  1BF4 A;  2EOT A;  1U4P A;  1F9Q A;  1G6Z A;  2HCI A;  2VXW A;  1QG7 A;  3UI2 A;  2MGS A;  2MJ8 A;  3R93 A;  1SSO A;  1WTQ A;  3F2U A;  3GV3 A;  1PLF A;  2MP1 A;  4HAE A;  2Q8R E;  1J9O A;  2JYO A;  1XYI A;  1AZQ A;  2HUG A;  4IUU A;  1F9S A;  1WD1 A;  4RWS C;  2B2V A;  1NAP A;  1JE4 A;  1AZP A;  1HFN A;  5EKI A;  5COR A;  2L12 A;  1G2S A;  2NYZ D;  3KBX A;  1WTW A;  1NR2 A;  4QUC A;  2FHT A;  2N88 A;  2X6G A;  5T1G A;  4IUQ A;  1DOM A;  1U4R A;  2JP1 A;  3QO2 A;  1CM9 A;  2RSO A;  2CVR A;  2KEC A;  3SVM A;  1S4Z A;  4X3K A;  1PDQ A;  1CA6 A;  1B50 A;  1GUW A;  4XT3 B;  2HDL A;  1KNE A;  1MSG A;  1VMC A;  4O42 A;  1F9R A;  5EQ0 A;  2MPM A;  1DOL A;  2K01 A;  2FFK B;  1E0B A;  1ROD A;  1SDF A;  3IFD A;  3I8Z A;  4CJ1 B;  2B2Y C;  5E4X A;  2N55 A;  3P7J A;  2NWG A;  5CBA E;  1HHV A;  1EOT A;  1HFG A;  1DON A;  2EE1 A;  1X3Q A;  2L9H A;  2X6L A;  2B2T C;  3HP3 A;  1ILQ A;  1ICW A;  1MSH A;  2B2U A;  2IL8 A;  1MI2 A;  1MGS A;  1XX8 A; 
#chains in the Genus database with same CATH topology
 2L1B A;  2EJG C;  1PH3 A;  3ZJY C;  1H9S A;  3TP5 A;  4H0L C;  1HZA A;  3HS0 C;  2JA5 G;  1VDZ A;  1SE2 A;  3A8I E;  3MEF A;  2CWA A;  3MXN B;  4DAY A;  2VY3 A;  1J6Q A;  1E22 A;  3T51 B;  4H44 C;  5ELN A;  1CKO A;  3J81 i;  2EVB A;  1EYC A;  1F2L A;  2B8G A;  1VQL A;  2D9U A;  2K33 A;  2ZTE A;  2E2J B;  1B4O A;  4DUZ L;  1HCZ A;  3LNN A;  1I5F A;  5CR3 A;  1MKH A;  4WJ3 M;  4MHE A;  1FVI A;  1BUV T;  2R61 A;  3SDZ A;  2YV5 A;  4LMQ D;  5C5L A;  5BN3 A;  1SE3 A;  4BA1 I;  4ZK9 B;  1O80 A;  3D4D A;  3MHB A;  1CI3 M;  2Z4H A;  2LKV A;  2UXD L;  1G29 1;  4X66 Q;  3G71 A;  1WTR A;  4LFA L;  1QNU A;  4GKJ Q;  1BBU A;  1K3R A;  2F0U A;  1RIP A;  2QCP X;  2ZXO A;  1VQ7 A;  3KF6 B;  1EY4 A;  2F0O A;  5KNB A;  5K36 H;  4XIG S;  1SMX A;  5JJZ A;  2NVX B;  1G6Z A;  3OW7 A;  4QGU A;  4B08 A;  4K5W A;  3A5U A;  5IYC G;  1HQR D;  5M3M B;  3DHQ A;  3E9I A;  4OGQ C;  4XQJ A;  1EEI D;  1HFN A;  1LTT D;  1AZP A;  1D5M C;  3O13 A;  3CQZ B;  2FHT A;  1XNR Q;  4BBR B;  3QO2 A;  3S14 B;  3SK8 A;  4YWM A;  1GM5 A;  3SVM A;  2NN6 H;  2PMZ E;  5G3L F;  1SNP A;  2VQE L;  2ZXR A;  4JI4 Q;  3V2T A;  2E2H H;  1O7L A;  3K58 A;  1L2F A;  1Y8P B;  3A7L A;  3MFG A;  3M3Y H;  1Y1V G;  4DV6 Q;  5E4X A;  1DYQ A;  3CU7 A;  4A3F B;  3TZU A;  2JA7 G;  4DR4 L;  4DV3 L;  4FP5 D;  5C4Z A;  4NP5 A;  2JA8 G;  2EYP A;  3K7A H;  5DLQ E;  4IPC A;  1EQQ A;  3HOZ B;  2Z9H A;  1PFN A;  1XNQ L;  4R4I A;  3RUZ A;  3OWF A;  4YIJ A;  4B3R L;  2ICI A;  3TS2 A;  1SJE D;  2KVM A;  3GTJ H;  2JA7 B;  4U67 3;  2IJ0 A;  1J5E Q;  1D2B A;  4ZUI A;  3DEO A;  1WTV A;  1QVG A;  3J80 c;  3KUP A;  3PO2 G;  3JAM i;  3R2I A;  4B3T Q;  3I4O A;  1S5B D;  1YVC A;  1GO3 E;  5EKL A;  1Y8O B;  2N78 A;  5KRU A;  4CBV A;  1CA5 A;  4B9X A;  5E7N A;  3G7L A;  4IUR A;  4XDX A;  3GTM B;  2OQK A;  3J7Z C;  1K73 C;  3CCU A;  1ML0 D;  1OXS C;  4LFC Q;  4FF4 A;  2D2C C;  3T4A C;  2LY7 A;  3BDC A;  2OCE A;  1SNQ A;  1F9P A;  5KGU A;  1YIT A;  1HZ9 A;  3ER0 A;  3EJI A;  2VQF L;  1NMG A;  3VYS A;  3I4N B;  3VYR A;  4L5R C;  3NSW A;  1PHJ A;  2M2L A;  5LMN W;  4LF5 Q;  1GXD C;  1RDP D;  2EYJ A;  1V1Q A;  1VMP A;  4KKU A;  3VR5 A;  3KBG A;  5C3E B;  5J1Z A;  3J80 L;  4HJ5 A;  2OEO A;  3NQT A;  2DGY A;  3HRZ C;  3PV0 A;  4DUZ Q;  3CCR A;  4LF6 L;  1DCZ A;  2B2V A;  4FDB A;  1A2T A;  4C3I G;  1CFM A;  2E75 C;  3OMC A;  3QOJ A;  4DGZ A;  3STB C;  1PH1 A;  4JVZ A;  5JJL A;  3T53 B;  4UHV A;  3V96 A;  1I4G A;  2UXC Q;  5IYC H;  2NVY B;  4X6A H;  3IFD A;  4PZ6 A;  2KCT A;  4LF5 L;  4PV1 C;  1YNN D;  1VQO A;  4OEL B;  4LJZ C;  3HP3 A;  2D0O A;  4GLA C;  4WRD A;  1N36 L;  3BVG A;  2NN6 I;  3X3M A;  1XPR A;  2KQ3 A;  2RCN A;  5IT9 E;  1NCV A;  4JBW A;  2DY8 A;  4H13 C;  1FGU A;  3LGJ A;  5IT9 L;  1PV4 A;  5J39 A;  3CCM A;  4HID A;  3HOY H;  2JA9 A;  2NBF A;  5IYB H;  1YNN C;  2AKW B;  5BR8 Q;  5AJ3 Q;  2Y0S B;  3T1H L;  1HNZ Q;  4JI7 Q;  2EJM A;  2EXD A;  3DM1 A;  4R8I A;  2LXJ A;  1WCM B;  2VB3 X;  4ZAI A;  2IX3 A;  3K59 A;  1TII D;  2BDO A;  3HEJ A;  3H09 A;  1JB7 A;  2KEE A;  1JCK B;  4DAY B;  4XTC S;  5LL6 X;  4NB3 A;  1HNZ L;  2RKS A;  1C0A A;  1WTP A;  2K04 A;  4RCO A;  3NWT A;  1Q1E A;  1H9S B;  3I70 A;  5AJ3 L;  2M00 A;  3M7G A;  1CUK A;  3PCO B;  3IL8 A;  1QJO A;  3NBH B;  4YCW A;  5M3F B;  4RGN A;  1NR4 A;  1IHZ A;  4P73 A;  4XQQ A;  4A3E B;  4ZUJ A;  2EY6 A;  4QB4 A;  2NVQ H;  3KF6 A;  4DR2 Q;  2HQL A;  1TWH B;  1CSQ A;  4KKT A;  1TR5 A;  2F0I A;  1Q90 A;  5JJK A;  1VQD A;  3S1Q H;  2D62 A;  4FXD A;  2HD3 A;  1A3U A;  2K5N A;  4R4T A;  2IW3 A;  3U9S A;  4RA8 A;  4JBK A;  2VQE Q;  1H9R A;  2AMC B;  3L0O A;  4XT1 B;  1Q8K A;  3S17 H;  2C35 B;  4DAV A;  1RTN A;  4IOA A;  3VYU A;  3GTL H;  5IYD G;  1W6J A;  3SK4 A;  5IOC A;  2AUJ D;  4K14 A;  3KLS X;  4LUO A;  3F2U A;  2ZJR A;  1OTC A;  4IUU A;  5M5X H;  3VR6 A;  2KEN A;  4HIK A;  4EGV A;  4B3S Q;  4C2M B;  4P72 A;  3KLS A;  4O2D A;  1I4H A;  1STA A;  2HQE A;  4KN4 C;  4JI7 L;  2WII B;  2RSO A;  4C3H G;  4K5X A;  2MNA A;  3SK5 A;  5C44 B;  4KHP Q;  1TS2 A;  2NUC A;  3CCQ A;  1B3Q A;  1HJP A;  2PI2 E;  1AW7 A;  3SHL A;  1S5C D;  4J8Q A;  3TP8 A;  2CQO A;  1N36 Q;  2BCO A;  2L9H A;  4IQZ A;  4C1N I;  1OXX K;  1SFO B;  1VQ4 A;  3CC2 A;  3MZ5 A;  3ULJ A;  3HOV H;  2BA0 A;  2KCM A;  3S2H B;  3CCE A;  2K5Q A;  1Z9F A;  3NEM A;  5FLM H;  2Z4I A;  3H91 A;  1AFP A;  1R9T H;  2RHS B;  2A69 D;  4J1M A;  1PZK D;  4DNI A;  1CHP D;  1GUN A;  1SJH D;  2FMC A;  4CKC A;  2F0K A;  4BY7 G;  2PQA B;  4N9T A;  4GS3 A;  4NXM Q;  4POF A;  3BDO A;  2E5L Q;  1UEA B;  2L15 A;  2K03 A;  3H0G G;  3UDI A;  1STH A;  3N6R A;  2A68 D;  3TRE A;  1PH6 A;  1CT1 D;  5FO8 B;  2F4I A;  4JPB W;  4UP7 A;  5T1I A;  1SYD A;  2SNS A;  4JI0 L;  3C3L A;  4YY3 Q;  4UPA A;  1JIC A;  2PNH A;  3D6W A;  3MXG A;  2E2J H;  4DR4 Q;  2R7Z G;  1VS0 A;  2XIW A;  2CCZ A;  5DM6 3;  4GNX C;  3I7F A;  3NTH A;  3S15 B;  5EPL A;  3DWA A;  3U4Z A;  2RQX A;  3J7Y W;  3OMG A;  4XXE A;  4DV0 Q;  2B63 B;  3MA2 B;  2A6E C;  3L3O C;  1O7Y A;  1Y1V H;  2QEJ C;  3QOL A;  4PMB A;  4KY7 A;  3MAQ A;  3OOC A;  4HED A;  2JA6 G;  5EJW A;  5C6A A;  1YI2 A;  1C4Q A;  2K5D A;  3FRP B;  2Y0S G;  2XRQ D;  4GN4 B;  3A56 A;  4LF9 L;  4LF4 L;  3DUZ A;  1KRS A;  1Y14 B;  1SSO A;  3EN2 A;  4ALP A;  4L5T A;  5C4J B;  2JYO A;  2R93 G;  1XYI A;  1ASY A;  4A3D G;  4X65 L;  2HUG A;  2I5L X;  4RGO S;  5M5W H;  1B9N A;  2B29 A;  5EKK A;  2Z6B A;  1SYF A;  4HSP A;  1N9W A;  4M1U B;  1NUC A;  1DOM A;  4IUQ A;  1FL0 A;  5IGD A;  2KEC A;  4XQN A;  1J5E L;  2VUM G;  3GTP B;  3TBI B;  3FEW X;  1Y1W B;  5FLX L;  1EUJ A;  4ZCK A;  5FLX E;  3K0X A;  4JI2 Q;  4A3I B;  1ROD A;  3CXC A;  4EVO A;  3DM3 A;  4K6L A;  4X66 L;  2R7D A;  1SRO A;  1ZEQ X;  4A3K H;  2EE1 A;  3PO3 G;  1GUT A;  1EY5 A;  1EYG A;  1Z47 A;  1TKW B;  5LMU Q;  1YJN A;  3U9O A;  4DV4 Q;  4DR6 L;  1XTD A;  4UAI A;  1LTS D;  2CH4 W;  1CKN A;  2E2H B;  1K8G A;  3ERO A;  4Y52 H;  4JI4 L;  3M3Y B;  2O4X A;  4QF4 A;  1STY A;  5CC4 A;  2XTI A;  3I4M G;  3KLR A;  3J81 E;  1E2W A;  1LLR D;  1STE A;  4XYQ A;  1N32 Q;  3H15 A;  2NVT H;  4EQP A;  2Z1C A;  3MFY A;  1T5E A;  5A35 A;  4RKL A;  1GKH A;  1JQY D;  4N8F A;  4DV1 Q;  4DA2 A;  4V19 0;  3GTJ B;  4NKL A;  4LUV A;  1KDB A;  3MXU A;  4LUZ A;  4DV7 Q;  3HKZ E;  1JOO A;  4DR3 L;  2G9D A;  3GV6 A;  1ET6 A;  3DMU A;  3BVZ A;  5HGT A;  1EQT A;  4HTH A;  3IFT A;  1WTX A;  1VQP A;  5K36 G;  1AP0 A;  3FPU B;  2ZTD A;  5IE8 A;  1EWI A;  2F0N A;  4ME5 A;  2XNA C;  1FGB D;  2EXZ A;  3GTM H;  2UXD Q;  1VQB A;  1LT4 D;  1I6H B;  1B2T A;  4CDC C;  3PF4 A;  2Q8T A;  3I72 A;  4H7B A;  1EIG A;  1A3T A;  2ZJQ A;  1J8I A;  4K0K L;  1XXG A;  2OWO A;  3HFZ B;  4OIJ A;  1E2Z A;  3J81 L;  1XMQ L;  4G7H C;  1S5E D;  1M90 C;  4IFD G;  1EYD A;  1D5X C;  1D8L A;  2MO0 A;  4AH6 A;  3K5O A;  2HCI A;  4KN7 C;  3QIA A;  5L37 A;  4B3S L;  4IFD I;  4JOI A;  5EBD A;  3S1N B;  3I4M B;  3BU2 A;  2PZT A;  3SE0 A;  1PRT F;  1Q12 A;  4ZRZ A;  5EKI A;  3KBX A;  1P8L A;  1HTL D;  4R1J A;  1V1P B;  3KDF A;  2Z0S A;  4YCV A;  1SYG A;  4C3H B;  1B50 A;  4PZ8 A;  2VB2 X;  3W1B A;  4JV5 L;  3D0F A;  2K01 A;  4IN3 A;  1E0B A;  1KAB A;  2B2Y C;  3J7A V;  1EEF D;  2WB1 G;  4ZYS A;  3DLL A;  1VQ5 A;  2JSO A;  2UUC Q;  4CDF C;  4A3B B;  4IFD J;  4DPG A;  1WFQ A;  3RLO A;  1KIX A;  5C4H A;  2NVY H;  2GVB A;  1JWS D;  1ILP A;  1LV9 A;  3RD4 A;  4C3J H;  3MEH A;  4V0B A;  1BNZ A;  4A75 A;  4HIM A;  3SEB A;  3RZD H;  1N33 L;  1FJG L;  2A5H A;  3N52 A;  1MJC A;  4GOP C;  3L2P A;  1G2T A;  3PGZ A;  2EPB A;  3VR3 A;  1HA6 A;  4ABN A;  3GTQ H;  1VF5 C;  1HRJ A;  3T1Y L;  3GTO B;  1H9J A;  1LT3 D;  2G9H D;  2NTS A;  1DJR D;  5C44 G;  1H9K A;  2F4V Q;  1B7Y B;  2KJX A;  1KAA A;  3HOW H;  4BXX G;  2IHE A;  1QVF A;  3E5S A;  1EIH A;  1GUG A;  3AMU A;  1PFM A;  1GJX A;  1VQH A;  3CC4 A;  1CK1 A;  1ZYR D;  3SGI A;  3FPP A;  3SXH A;  4J6H A;  2B2V C;  4DV5 Q;  1PTO F;  2N8N A;  4ID6 A;  1B53 A;  3T16 A;  1GHJ A;  2UXB Q;  2E2D C;  2K1B A;  3CAM A;  1K83 H;  2UU9 L;  1VQJ A;  3GTG B;  1RJT A;  4Y7N B;  2IWH A;  5C0X H;  1LTG D;  4A3E H;  1GOZ A;  1X3F A;  1U4M A;  5ELF A;  1L1O A;  2NVQ B;  3HZX A;  4DK1 A;  4JI8 Q;  1T9H A;  1FD7 D;  1TY2 A;  5CV5 A;  1VQI A;  1WTQ A;  3BJU A;  3GV3 A;  1AZQ A;  1WD1 A;  2KHI A;  1NMF A;  5CGK A;  5COR A;  2NYZ D;  1G2S A;  5I2X A;  4NXN Q;  5GAH C;  1NR2 A;  2N88 A;  1FYC A;  1U4R A;  3GP7 A;  3S17 B;  1X3G A;  1VQF A;  2AWN A;  3OW2 A;  3OYY A;  2F3V A;  3AYH B;  1WTH A;  2VL6 A;  1Q8I A;  4F87 A;  2R7Z H;  3Q24 A;  1Y69 U;  3PO2 B;  2PNR C;  1SDF A;  4CJ1 B;  1LTL A;  1NY4 A;  2RF4 A;  2F0J A;  4C2M H;  1RCV D;  3EVQ A;  3ERS X;  2F3W A;  5M9O A;  1V8Q A;  3WOE A;  1LAC A;  4P75 A;  4GOP A;  3NBI A;  2DJG C;  4A3M H;  2AWO A;  1BDO A;  4OO1 I;  4IAL A;  4DR1 Q;  1IBL Q;  4WFN 3;  4F8M A;  1HQM C;  3EIV A;  5GAD C;  4X3U A;  2K28 A;  1A0I A;  1XMO L;  3CP0 A;  5E3F A;  4BY7 B;  2B2W A;  4GNX A;  1LTB D;  1JOK A;  4G7Z C;  1E1O A;  2WAQ B;  2V1C C;  3K5N A;  3M9B A;  2EIF A;  2EY2 A;  1GD7 A;  5BN4 A;  2JEB I;  4JG2 A;  2MQH A;  4EQO A;  3S2H H;  3FDT A;  1VQ9 A;  3NPP A;  1TWF B;  3R2T A;  1CKN B;  5DAU A;  3UDF A;  2AQ3 B;  2IT1 A;  1IBM L;  1XNQ Q;  4LF7 L;  2XVS A;  4UP8 A;  4PNY A;  1IL8 A;  1KDA A;  3GTK B;  1WJJ A;  3RZO B;  2XN9 C;  4KHZ A;  4RAU C;  2YU9 B;  1D1I A;  2B2Y A;  4A3E G;  2F0S A;  4C3I B;  3K5M A;  3I90 A;  3A7A B;  4OL7 A;  4QIW E;  4P2C B;  1PH9 A;  3JAM E;  5FK9 C;  2FMM A;  1R4P B;  3HGB A;  1PMR A;  4IPG A;  2QA4 A;  5KNC A;  1VQM A;  1PXU A;  1EY6 A;  4JI1 L;  5JJI A;  1LO5 D;  3Q23 A;  1V1O A;  2YYZ A;  1AE2 A;  2ASB A;  1JWM D;  1RTO A;  4LF8 Q;  1KQS A;  3C46 A;  4UDU C;  3TS0 A;  1HR0 Q;  1UWV A;  1HNW Q;  3D4R A;  1A3V A;  3PUV A;  3G48 A;  1TS3 A;  5JVH 3;  3FVQ A;  3S1M H;  4BY1 H;  1BCP F;  1L1O C;  1TWA B;  2RBM A;  2UUA L;  2G5D A;  2F0E A;  3PO3 B;  1Y1V B;  5C0X I;  1WTW A;  3TQY A;  1STG A;  3CCV A;  1DM0 B;  1TS4 A;  4EQ5 A;  4A3B G;  4X3K A;  3K6O A;  1D6E C;  2EYM A;  2LXK A;  4YWK A;  1PH8 A;  4JW0 A;  4KJO A;  1VMC A;  1SND A;  1HR0 W;  2E74 C;  4GKJ L;  1AN8 A;  3RLF A;  1JOR A;  1DOL A;  5C4J H;  1PZJ D;  2EJF C;  4JI6 L;  4A3L G;  1G6P A;  1BCP B;  2WAQ G;  1Z7T A;  4A3D B;  1VQN A;  1HHV A;  5C4X H;  1X3Q A;  4KD4 A;  3A5Z B;  2OQ0 A;  3FHW A;  2JA5 B;  4LFB Q;  5IWA Q;  4JOI C;  4RFB A;  3A74 A;  1Y1W H;  4OHJ A;  2KCN A;  4CJ0 B;  2MHV A;  3VYT A;  4AYB G;  3BZK A;  2WP8 J;  1O7I A;  2F0Q A;  4A3I H;  2R6G A;  2OTL A;  4BBS B;  2QDB A;  3CMA A;  4A3K B;  4KHV A;  3A0J A;  3OTO Q;  3S16 H;  3ONA B;  2F0H A;  4IJL A;  1XWE A;  4B9W A;  1K8A C;  5COY A;  3TP6 A;  4TVA B;  2B2U C;  1KHI A;  1I94 Q;  1YBY A;  5ISR A;  1K8M A;  4Z9C B;  1ZKO A;  3G4S A;  4GKK Q;  3J81 c;  1GHK A;  4AQY L;  3E3X A;  2ZT9 C;  5ELC A;  2A6E D;  3BYY B;  3UE1 A;  3U58 A;  4R4C A;  2PW5 A;  4ZKB B;  4YHH L;  4JYA Q;  2PPB C;  5EPJ A;  2HIV A;  4QY7 A;  2NVX H;  2DJF C;  4MN3 A;  3KJO A;  2HCC A;  1LT6 D;  1KL9 A;  1KNA A;  2F0W A;  1IBK L;  1BQQ T;  4JBM A;  4IZ8 A;  3NK9 A;  2Q2T A;  4X3S A;  2CHB D;  1YJW A;  1X6O A;  1SN8 A;  1I4Q A;  4C1N K;  5I2Y A;  1ENC A;  4MIU A;  3WWV A;  1I4P A;  2KA7 A;  1X3P A;  2HT1 A;  1S5F D;  4TKO B;  2RDF A;  2E76 C;  3TDQ A;  1JJC B;  2VXW A;  4HMJ A;  1FNU A;  1S5D D;  3RR5 A;  4EQN A;  3BYT B;  2MP1 A;  4HAE A;  4OX9 L;  1SYE A;  1OO9 B;  2A6H C;  1PRT D;  4A3F H;  2YTX A;  1IW7 D;  1YHQ A;  1JWU D;  2F0P A;  4K5V A;  1TWG H;  1QUQ A;  1UE5 A;  4XYO A;  5G3L D;  3VA7 A;  4FXK C;  3K7A B;  3S2D H;  3ITP A;  4RGM A;  4JI3 Q;  4DR7 Q;  1LTA D;  2HDL A;  5JEA H;  4A93 H;  2O5J C;  2KHJ A;  5I6W A;  1PFS A;  4Q5V A;  2MPM A;  4X64 L;  3I4M H;  3NTK A;  3K57 A;  3SK6 A;  4A3I G;  3D8G A;  2NWG A;  1BXT A;  3FMC A;  3GQB A;  4RKB A;  1VQ8 A;  2VUM H;  3I73 A;  3M4Q A;  3ULL A;  4CDD C;  5LMN L;  4ODG A;  1CHQ D;  3I56 A;  3I4N G;  1SBB B;  1IYU A;  3ND8 A;  2WFW A;  4FXG C;  1M8A A;  2CQA A;  4B3M Q;  1QIL A;  2RVL A;  3Q6S A;  4JI5 L;  2F0F A;  4BA2 I;  3HKS A;  4A3B H;  4NXN L;  2PZW A;  5J3B A;  3F2D A;  3CF5 A;  2JEA I;  1IKL A;  1N34 Q;  1WOC A;  5ELD A;  4IUP A;  1Q86 C;  3CC7 A;  1K3B C;  3M4P A;  3I4N H;  4C3J B;  1E1T A;  1PH2 A;  5D14 A;  1X32 A;  5JPM C;  1B3A A;  1SXT A;  2XRS D;  3J80 E;  1K9M C;  3KK7 A;  4ZLT F;  4DUY Q;  2IX0 A;  1ESF A;  3X3N A;  1IL2 A;  1TQO A;  1G51 A;  1WD0 A;  4X62 L;  1EY7 A;  1WTO A;  1SLJ A;  3GTQ B;  3I2Z A;  2EQS A;  1G8Z D;  3SR1 A;  2I5M X;  1F2Y A;  1KDC A;  2F1M A;  3PUX A;  5C3W A;  2EYO A;  1QCB D;  3VR4 A;  3ERQ A;  2J0T D;  2SDF A;  5C4X G;  3HOU B;  2MFI A;  2HHH L;  3BG3 A;  3I3C A;  1LTR D;  4MNO A;  4A3L H;  2Q2I A;  1U4P A;  1AEX A;  1I50 B;  4HJ7 A;  1NSN S;  3K8A A;  1AE3 A;  3D6C A;  1VF7 A;  2PO4 A;  1F9S A;  1EZ6 A;  4Y7N H;  1EIY B;  1QUQ B;  2ZM6 L;  3QJY A;  3CHB D;  1IXR A;  1CM9 A;  2BA1 A;  5I9O A;  1HPC A;  1GUW A;  1EYA A;  1M1K C;  5FKA C;  1AH9 A;  3QB3 A;  3I4L A;  2F0L A;  4UY8 C;  2CH4 A;  1A2U A;  2HIX A;  3AB9 A;  2F52 A;  1YIJ A;  5IGC A;  1HFG A;  1HNX Q;  3DWP A;  4I7A A;  2K5V A;  1WCM H;  4GLX A;  4I7Z C;  5GAE C;  3Q8D A;  4K6D A;  4GN5 A;  1YNX A;  3TRZ A;  2K6A A;  2J7Z A;  2OF1 A;  4L6T B;  2FJ2 A;  1WYD A;  4AYB B;  2N3S A;  4HSV A;  5C3E G;  1L1O B;  3U50 C;  1EY9 A;  3E0J A;  4CJ2 C;  1KLU D;  4A3K G;  2M9V A;  5DEH A;  4OIK A;  3P1H A;  1B8A A;  1I94 L;  2XWJ B;  1WI5 A;  5HY6 A;  3HOX B;  1ZYR C;  1EY8 A;  4A76 A;  2GN5 A;  2Z6K C;  3W5O A;  5GRO A;  5KND A;  2KCC A;  2WKD A;  1RD9 D;  1TU2 B;  3NEN A;  4A3J G;  1A63 A;  4U68 A;  4DK0 A;  3IRB A;  2AQ2 B;  4BY7 H;  1EOV A;  2FIN B;  1DZ1 A;  1YHA A;  5IYD H;  4FNF A;  1KXL A;  4BY1 G;  1G91 A;  4DR5 L;  3PUY A;  3EFX D;  5M3F G;  3GTL B;  4HMI A;  1TWF H;  1U4L A;  2JN4 A;  2KUM A;  3IKJ A;  3R8B A;  1JOQ A;  1UUP A;  1MJE A;  2JA6 H;  2HDM A;  3ND9 A;  4OEM B;  1Y8N B;  5M5X B;  2EY1 A;  4JYA L;  3K0Y A;  2QF7 A;  4NW2 A;  4DV2 Q;  2ICE C;  4A3C G;  1XPO A;  2QW7 A;  1PH7 A;  5I6Y A;  5CMD A;  3CME A;  1LM0 A;  2BH8 A;  1B70 B;  4DV7 L;  1W6K A;  5M5Y B;  5CV8 A;  4GKK L;  4DV1 L;  2C9O A;  5EAY A;  5IGE A;  2Q8R E;  1J9O A;  2Z6K A;  1VQ6 A;  1EY0 A;  5ELO A;  4M8A A;  3ZYY X;  5H1S E;  2C5C A;  3JAM L;  1SFO H;  5FO9 B;  2EDG A;  2VZA A;  2B3G A;  3H0G B;  3NBH A;  1VCI A;  4KV6 A;  4KTA A;  3UDG A;  2GVA A;  3AU7 A;  4K8J A;  3RMH A;  1STB A;  5I4D A;  4BY1 B;  3PIO 3;  4IPH A;  2PMZ B;  3PO3 H;  1BCP D;  3HOY G;  5CBA E;  1EOT A;  5F2D A;  1R9T B;  5BN5 A;  4BBR H;  5M3M G;  3S24 A;  3ULP A;  2O5I C;  2OTJ A;  4RH6 A;  2F0G A;  1L0X B;  2WKC A;  2I07 B;  3HKZ G;  2WB1 B;  1LYL A;  4Q0F A;  2PW7 A;  4X64 Q;  1EQV A;  1SAP A;  1IBM Q;  1DOK A;  1TT2 A;  4FO2 A;  1BCP C;  4A3M G;  2L11 A;  1KAW A;  1IKM A;  1OXV A;  2E2I H;  3A54 A;  5C4X B;  1NNX A;  3URY A;  1SE8 A;  3NWS A;  1YZ6 A;  2H1E A;  2EYH A;  4OWW B;  3HOW G;  1E2V A;  3KF8 B;  3P20 A;  3HOZ H;  2F0T A;  1ICF B;  1I4R A;  5JVG 3;  4A3G H;  2ALY B;  1IYJ B;  4DFA A;  1RHP A;  1PTO H;  3TEH B;  3W1G A;  4EX5 A;  1YNJ C;  2JA7 H;  1XMO Q;  2JA8 B;  1PH5 A;  1B9M A;  1HR0 L;  3QG1 A;  4YWL A;  1LT5 D;  3S16 B;  1IBL L;  2WIN B;  3RN5 A;  2R3Z A;  5J22 A;  3PMF A;  2VS1 A;  3MWY W;  3BS1 A;  1STN A;  1Q3L A;  1NJI C;  1TWC B;  1E7Z A;  3S9W A;  4C3J G;  5FOB B;  3OIQ A;  2AUK A;  4X3T A;  5E1F A;  1EFI D;  4KI0 A;  4LW1 A;  4DXF A;  5IY0 A;  3LX0 A;  3FKI H;  4YY3 L;  5C0X G;  4H02 A;  3D4W A;  1KC8 C;  2JE6 I;  1C8C A;  4PG3 A;  2H5X A;  2VW9 A;  1BO0 A;  3T56 B;  3KF8 A;  2JK8 A;  1SR3 A;  1D5Z C;  2ZM6 Q;  1NBW A;  4HJ8 A;  1HA5 A;  1O7Z A;  3GTP H;  3NP8 A;  2SOB A;  3BVM A;  3NHH A;  2LMC B;  2CKZ B;  2SNM A;  3R93 A;  1PZI D;  2XWB B;  4KY6 A;  1JE4 A;  3HG9 A;  4K2K A;  2L12 A;  4NPS A;  4JI8 L;  4KD3 A;  4LK1 C;  4P71 A;  5IGF A;  2RCF A;  5C3E H;  2HHH Q;  2VNU D;  5T1G A;  2F0M A;  1OXT A;  3OHX C;  1H9M A;  1SMY D;  2K75 A;  3CRL C;  1UE1 A;  1MSG A;  4G4K A;  2UU9 Q;  4HR7 B;  3NE5 B;  2NZO A;  4A3C H;  1QB5 D;  1L0Y B;  5FLX c;  2N55 A;  1UNS A;  3PIO A;  1U5K A;  4LFB L;  1DON A;  1RF2 D;  2L55 A;  1TWG B;  2BH2 A;  1ILQ A;  1MSH A;  1FR3 A;  4FF1 A;  3S2D B;  2NVT B;  3W3A A;  3TP7 A;  5IT9 c;  3CPF A;  2BE5 C;  3K81 C;  1Q82 C;  1PTO C;  1I6V C;  4F7X A;  3M85 A;  2CFM A;  1JJ2 A;  4RHR A;  1V9P A;  3CD6 A;  2NZ1 D;  2ENB A;  4OON A;  1TS5 A;  4P74 A;  2DY7 A;  1D1K A;  2VUM B;  5FO7 B;  3G6E A;  1X3E A;  1F77 A;  1N34 L;  4WOR A;  4K8I A;  1BVS A;  4F88 A;  4A3J H;  4MZ9 A;  3D3R A;  2Q8I B;  2A6H D;  2RSN A;  2F03 A;  4R4O A;  3LWE A;  2EYL A;  1N33 Q;  1JMC A;  3HOY B;  3K5L A;  1GUS A;  1Q46 A;  3VR2 A;  1MBY A;  2QGQ A;  1C7Y A;  3QWN A;  3PF5 A;  3CW2 C;  5C0X J;  4J15 A;  5KEE A;  3MXP A;  4OWT B;  4DNT B;  1ASZ A;  4DV2 L;  2MO1 A;  3VDY A;  1JR0 D;  1ET9 A;  1HNX L;  1RL2 A;  2TSS A;  4QQB X;  1QOH A;  4OWX B;  1VQA A;  2PQA A;  2Y0S E;  4DV5 L;  2KED A;  4JV5 Q;  3S1N H;  1CTM A;  1P16 A;  2GA4 B;  3BDL A;  1ZXT A;  4L8J A;  1IW7 C;  5M3F H;  4DR7 L;  2YTY A;  5EPK A;  2DN8 A;  1QE6 A;  3G6J B;  3T13 A;  4QCL A;  3FP9 A;  1EZ8 A;  2F0D A;  2JQO A;  2L0C A;  4A3F G;  4LF7 Q;  2ATW A;  2J4X A;  2K52 A;  2KBN A;  1CZG A;  3T1Y Q;  4C3H H;  2WAC A;  1T5X D;  5CV6 A;  2ZJP A;  1I3Q B;  3D31 A;  3A8K E;  5JAV A;  5CV9 A;  1NAP A;  1CZW A;  3K80 C;  4WJ4 A;  2B39 A;  4DK6 C;  3TSS A;  1V43 A;  4TQU S;  1EWH A;  4IOC A;  1XMQ Q;  1UE7 A;  3H3V I;  1S4Z A;  3B6Y A;  1PYS B;  3M4O B;  1CA6 A;  1VQC A;  1EWC A;  2DNC A;  4YCU A;  3HOX G;  1GUO A;  4RCN A;  2D0P A;  2EY5 A;  3STB D;  4DR1 L;  1CQV A;  3I8Z A;  1HZC A;  1U0L A;  1DXM A;  1NTG A;  3P7J A;  1YEZ A;  4X62 Q;  1IZ6 A;  2KHS A;  3A55 A;  1ICW A;  3NXW A;  1VQG A;  1MI2 A;  4YHH Q;  3HOV G;  1XX8 A;  1KD1 C;  2X69 A;  2D5D A;  5JEA G;  4A93 G;  4DN4 M;  3I55 A;  1VQE A;  2OT2 A;  1H95 A;  2B2T A;  4TRD A;  1UE6 A;  2R7F A;  3RN2 A;  2UXC L;  4DKA C;  1UAP A;  3HOZ G;  3GTO H;  4QJF A;  1B1Z A;  2BOS A;  2P5Z X;  5I9P A;  3HOW B;  1K0R A;  2LSS A;  1UEB A;  4BBS G;  5CBE E;  2K5H A;  5K5P A;  1X54 A;  5CV7 A;  1HUN A;  2CWP A;  2K7V A;  1Y1W G;  3J80 i;  2PI2 A;  4KK7 A;  1K28 A;  4PQX A;  1K83 B;  2JJQ A;  4N9P A;  3KDF B;  3GTG H;  4GOP B;  5LMN Q;  1Q7Y C;  5CYU A;  3MVV A;  3HOX H;  1V1P A;  5A2Q L;  5HGQ A;  4S3S A;  2IX1 A;  1TVX A;  5LMU L;  4HN7 A;  1HXY D;  2JXM B;  2R93 B;  1X56 A;  1W3S A;  1HTP A;  1EQR A;  3S1R B;  3ICE A;  3AFQ A;  1KTK A;  3PIP A;  4R4Q A;  1PVO A;  2R92 B;  3KYH C;  4LFC L;  1DGS A;  4HJ9 A;  3CCS A;  5A2Q E;  3Q22 A;  2WAQ E;  3GD7 A;  2EOT A;  4A3G G;  1F9Q A;  2CW0 C;  2MJ8 A;  2RHQ B;  4X65 Q;  3KFU A;  2R7Z B;  2UUA Q;  2JA6 B;  3S15 H;  1XTC D;  2WV6 D;  3PO2 H;  2B63 H;  2NB0 A;  1CSP A;  4LF4 Q;  3RNU A;  1PRT B;  4HIO A;  1HNW L;  4AYB E;  4QUC A;  2X6G A;  1A8V A;  3WDN A;  1FJG Q;  2B8F A;  1N32 L;  4OXP A;  4A3M B;  5M5Y H;  4B3M L;  2CW0 D;  2N49 A;  4ILW A;  2Q2H A;  3C1F A;  5NUC A;  5M5W B;  3FKI G;  4GLV B;  3PIP 3;  2X6L A;  1W2B A;  2B2T C;  2I0Q A;  3H0G H;  1SNM A;  1YHB A;  1QVC A;  2DUD A;  5IGB A;  1U9R A;  4DV6 L;  1S40 A;  4JI2 L;  4HCE A;  2Z8L A;  2FXQ A;  1DD2 A;  2WB1 E;  1EFW A;  1JJG A;  4JI3 L;  4DU9 A;  1O78 A;  5KIX A;  5IP9 G;  2RA4 A;  4JBJ A;  3PQI A;  1BKB A;  4CGY B;  3GTK H;  3I91 A;  2RDH A;  2IY5 B;  4ULL A;  3RLN A;  1EL0 A;  4MTN A;  5AFW A;  1Q81 C;  1C9O A;  4CKE A;  4OX9 Q;  3TME A;  4C3I H;  5IOD A;  1EU4 A;  2A69 C;  4IUT A;  3OTO L;  4IO9 A;  4CHT B;  4RG1 A;  4LF9 Q;  3VA5 A;  5C5M A;  1QNK A;  2A73 B;  3TZD A;  2AQ1 B;  2E2I B;  2K32 A;  1S3O A;  1PYB A;  1X9N A;  5LL6 S;  1SEB D;  3MTS A;  1KLG D;  2ES2 A;  4C56 C;  4DAM A;  3E6Z X;  2SEB D;  3TN2 A;  5IWA L;  3BZC A;  4DV0 L;  3UE0 A;  4A3G B;  1PFB A;  4RGT A;  3PUW A;  4LNQ A;  2A68 C;  3OWE B;  1PTO B;  1MIU A;  1IBK Q;  4HJA A;  1Z6H A;  3LWU A;  3EBE A;  1CQF A;  2JA8 H;  4BBR G;  5M3M H;  3S1M B;  2NZH A;  1TWA H;  4G7O C;  2PCF B;  5D3I B;  2QDL A;  3CQZ H;  4O1N A;  3IAY A;  3PSI A;  4L63 B;  3F2C A;  3AEV A;  2O2L D;  3S14 H;  5TSS A;  2ID0 A;  5JEA J;  2XSC A;  1TWC H;  4PMC A;  3CCL A;  2A19 A;  2AHO B;  3KOJ A;  4AQY Q;  2E5L L;  2ZXP A;  4IJH A;  4LAA A;  4NXM L;  1I6H H;  1LUZ A;  1L0W A;  3FKI B;  3KLW A;  4N8X 1;  4RWS C;  1VQK A;  4A3D H;  1K0S A;  2JP1 A;  4DAP A;  1M4V A;  2JA5 H;  3EA6 A;  4LF8 L;  4IUN A;  4XT3 B;  3DWQ A;  3CKI B;  1F2M A;  1F9R A;  5EQ0 A;  2TMP A;  3AQQ A;  2UXB L;  4BBS H;  1EIF A;  4DR6 Q;  4DV4 L;  1JC7 A;  3WOF A;  5IIF A;  2I5H A;  5HUR A;  3GO5 A;  3OSO A;  3CCJ A;  3DXJ C;  4DR5 Q;  2IL8 A;  3EQL C;  3C2P A;  1MGS A;  3C1E A;  1E24 A;  4JI6 Q;  2Q2U A;  5KYL A;  2L4N A;  4L5S A;  4DK3 C;  4HCS A;  4RHS A;  4CDE C;  1HH2 P;  3OIP A;  2ZTC A;  4KY5 A;  5CV4 A;  2K50 A;  3NQI A;  4G57 A;  2NN6 G;  3HKZ B;  3J7A 5;  1PYW D;  2V4D A;  3AFP A;  3CRK C;  2IHF A;  2A74 C;  5GQO A;  2PQE A;  2K05 A;  2YTV A;  4PZ7 A;  4MTK A;  5EGT A;  2PYK A;  2K4K A;  1F2Z A;  3NTI A;  4A4I A;  5FJ8 H;  3F1Z A;  4TSS A;  3QR8 A;  3RZD B;  1ESR A;  1ENA A;  4A3J B;  4WJW A;  4JK1 C;  4CKB A;  1BR9 A;  1BBX C;  4JCV E;  2UUC L;  5ELB A;  4JI1 Q;  4K2L A;  4KLK A;  1SNO A;  4ME3 A;  3HOU G;  4GN3 B;  5C3X A;  2E8G A;  5JPN C;  1S72 A;  2BE5 D;  1A15 A;  1BBW A;  4BWG B;  3H3V H;  1PTO D;  4IUV A;  2UUB L;  3E9H A;  3F2B A;  2DNE A;  3NUC A;  1FNV A;  1WVL A;  2PZU A;  3U4V A;  4ZKC B;  1SMY C;  2NTT A;  3MXN A;  3OPO A;  3K7U C;  3KJP A;  1BF4 A;  4GNX B;  3W2D A;  5EBC A;  4O0A A;  2XGT A;  1QG7 A;  3H6M A;  4ZQ3 A;  4POG A;  2MGS A;  4A93 B;  1B44 D;  2K5W A;  1PLF A;  4LF6 Q;  1QZG A;  4FVM A;  2EZV A;  4GZY C;  1GVP A;  1RKN A;  4UP9 A;  1SRU A;  2RDG A;  5ELE A;  4OO1 H;  1SE4 A;  3T1H Q;  2F0V A;  1BOS A;  4RMF A;  5BR8 L;  1KNE A;  3MC0 B;  4O42 A;  5IP7 H;  3V05 A;  1I3Q H;  3A8J E;  5FLM G;  1FNW A;  4KJN A;  1QWY A;  1KRT A;  1X55 A;  1XJV A;  1HZB A;  3L7Z C;  2QIL A;  2A8V A;  3L9A X;  2IPK D;  1MD2 D;  3H94 A;  3R3O A;  4DUY L;  4KMU C;  2KOL A;  2L5T A;  3M4O H;  3J81 j;  1JB3 A;  2EYF A;  4LWC A;  4QL5 A;  5D65 A;  2F4V L;  2QEX A;  3DEP A;  2B63 G;  4DR3 Q;  2I46 A;  4AIM A;  4KHP L;  3H3V C;  4BXX H;  1EU3 A;  4KKS A;  1II3 A;  3F8T A;  1K8O A;  1PRT C;  1N8R C;  5E4W C;  1JE5 A;  5DNF A;  4QUF A;  4R9W A;  4R8N A;  2B2W C;  4JI5 Q;  1YNJ D;  1WCM G;  1TWH H;  4DF7 A;  4FF2 A;  4IFD H;  5GAG C;  1OXU A;  5DM7 3;  2R92 G;  3JC6 6;  3J7A F;  1C48 A;  2LFN A;  4B3R Q;  3P75 A;  3S1Q B;  4E6I A;  4QMG A;  2K14 A;  1I4X A;  2BDN A;  4BS9 A;  1LTI D;  5IYB G;  4QIW B;  5IP7 G;  1PH4 A;  5D3D A;  1CKM A;  1LAB A;  1HUM A;  5IP9 H;  4OO1 G;  3NEL A;  4DNR B;  2UUB Q;  3HOU H;  3UDX A;  4IPD A;  1I50 H;  1SYC A;  1A6X A;  2VQF Q;  4FYD A;  1JT8 A;  1SYB A;  4DR2 L;  5LHY 1;  4FF3 A;  1A62 A;  3CPW A;  3RZO H;  1D7Q A;  1SNC A;  1QZH A;  2YU9 H;  3BZD B;  4PMW A;  2MUY A;  2QKI C;  5JOB A;  2R93 H;  1XNR L;  2A1A A;  3S1R H;  4NMZ A;  5IGG A;  1ENF A;  3UI2 A;  5C44 H;  4DXG A;  3JAM c;  5KYI A;  1IYV A;  3PUZ A;  2H4O A;  1TY0 A;  3GDE A;  4NDX A;  4APV A;  2R92 H;  1R4Q B;  4B3T L;  4I65 A;  3E0E A;  3Q0A A;  1MHW C;  1ONL A;  1Q1B A;  3M7N A;  4L5Q A;  2OXP A;  2CVR A;  2F3I A;  1X65 A;  2LS0 1;  3HOV B;  1PDQ A;  4K0K Q;  1NE3 A;  1PA6 A;  1E3P A;  3M4Y A;  2FFK B;  1TXY A;  4LFA Q;  4JC0 A;  1YJ9 A;  5FJ8 G;  2B2U A;  1XPU A;  4JI0 Q;  4DV3 Q; 
#chains in the Genus database with same CATH homology
 2L1B A;  2EJG C;  1H9S A;  3TP5 A;  4H0L C;  3HS0 C;  1VDZ A;  1SE2 A;  3A8I E;  4DAY A;  3T51 B;  4H44 C;  2EVB A;  1EYC A;  1F2L A;  2B8G A;  2D9U A;  2K33 A;  2E2J B;  1B4O A;  1HCZ A;  3LNN A;  5CR3 A;  4MHE A;  1BUV T;  2R61 A;  3SDZ A;  4LMQ D;  5C5L A;  5BN3 A;  1SE3 A;  4BA1 I;  4ZK9 B;  1O80 A;  3D4D A;  3MHB A;  1CI3 M;  2Z4H A;  2LKV A;  1G29 1;  1WTR A;  1QNU A;  2F0U A;  2QCP X;  2ZXO A;  1EY4 A;  2F0O A;  5KNB A;  5K36 H;  4XIG S;  5JJZ A;  2NVX B;  1G6Z A;  3OW7 A;  4B08 A;  4K5W A;  1HQR D;  5M3M B;  3DHQ A;  4OGQ C;  4XQJ A;  1EEI D;  1HFN A;  1LTT D;  1AZP A;  1D5M C;  3O13 A;  3CQZ B;  2FHT A;  4BBR B;  3QO2 A;  3S14 B;  3SK8 A;  3SVM A;  2NN6 H;  5G3L F;  1SNP A;  2ZXR A;  3V2T A;  1O7L A;  3K58 A;  1Y8P B;  3A7L A;  3MFG A;  5E4X A;  1DYQ A;  3CU7 A;  4A3F B;  3TZU A;  4FP5 D;  5C4Z A;  4NP5 A;  2EYP A;  3HOZ B;  1PFN A;  3RUZ A;  3OWF A;  4YIJ A;  2ICI A;  1SJE D;  2KVM A;  2JA7 B;  4U67 3;  2IJ0 A;  1D2B A;  4ZUI A;  3DEO A;  1WTV A;  3KUP A;  3R2I A;  1S5B D;  5EKL A;  1Y8O B;  5KRU A;  4CBV A;  1CA5 A;  4B9X A;  3G7L A;  4IUR A;  4XDX A;  3GTM B;  1ML0 D;  1OXS C;  4FF4 A;  2D2C C;  3T4A C;  2LY7 A;  3BDC A;  1SNQ A;  1F9P A;  5KGU A;  3EJI A;  3VYS A;  3I4N B;  3VYR A;  3NSW A;  2M2L A;  1GXD C;  1RDP D;  2EYJ A;  1VMP A;  4KKU A;  3VR5 A;  3KBG A;  5C3E B;  5J1Z A;  3J80 L;  2OEO A;  3NQT A;  3HRZ C;  3PV0 A;  1DCZ A;  2B2V A;  1A2T A;  4C3I G;  1CFM A;  2E75 C;  3OMC A;  3QOJ A;  4DGZ A;  3T53 B;  3V96 A;  1I4G A;  2NVY B;  3IFD A;  4PV1 C;  1YNN D;  4LJZ C;  3HP3 A;  4WRD A;  3BVG A;  2NN6 I;  3X3M A;  2KQ3 A;  5IT9 E;  1NCV A;  4JBW A;  2DY8 A;  4H13 C;  5IT9 L;  5J39 A;  2NBF A;  1YNN C;  2Y0S B;  2EJM A;  3DM1 A;  4R8I A;  1WCM B;  2VB3 X;  4ZAI A;  2IX3 A;  3K59 A;  1TII D;  2BDO A;  3HEJ A;  3H09 A;  2KEE A;  1JCK B;  4XTC S;  5LL6 X;  2RKS A;  1WTP A;  2K04 A;  4RCO A;  3NWT A;  1Q1E A;  1H9S B;  3I70 A;  2M00 A;  3M7G A;  3IL8 A;  1QJO A;  5M3F B;  4RGN A;  1NR4 A;  1IHZ A;  4XQQ A;  4A3E B;  4ZUJ A;  2EY6 A;  4QB4 A;  1TWH B;  4KKT A;  1TR5 A;  2F0I A;  1Q90 A;  2D62 A;  4FXD A;  1A3U A;  3U9S A;  2IW3 A;  4RA8 A;  1H9R A;  4XT1 B;  4DAV A;  1RTN A;  3VYU A;  1W6J A;  3SK4 A;  5IOC A;  2AUJ D;  4K14 A;  3KLS X;  3F2U A;  4IUU A;  3VR6 A;  4EGV A;  4C2M B;  3KLS A;  1I4H A;  1STA A;  2HQE A;  4KN4 C;  2WII B;  2RSO A;  4C3H G;  4K5X A;  3SK5 A;  5C44 B;  1TS2 A;  2NUC A;  1AW7 A;  3SHL A;  1S5C D;  4J8Q A;  3TP8 A;  2BCO A;  2L9H A;  4IQZ A;  4C1N I;  1OXX K;  1SFO B;  3MZ5 A;  2BA0 A;  3S2H B;  2K5Q A;  2Z4I A;  3H91 A;  1AFP A;  2A69 D;  4J1M A;  1PZK D;  1CHP D;  1GUN A;  1SJH D;  2FMC A;  4CKC A;  2F0K A;  4N9T A;  3BDO A;  1UEA B;  2K03 A;  1STH A;  3N6R A;  2A68 D;  1CT1 D;  5FO8 B;  2F4I A;  5T1I A;  1SYD A;  2SNS A;  3C3L A;  1JIC A;  3D6W A;  3MXG A;  2XIW A;  5DM6 3;  3NTH A;  3S15 B;  5EPL A;  3J7Y W;  3DWA A;  2RQX A;  3OMG A;  4XXE A;  2B63 B;  3MA2 B;  2A6E C;  3L3O C;  1O7Y A;  2QEJ C;  3QOL A;  4PMB A;  4KY7 A;  3MAQ A;  3OOC A;  4HED A;  5EJW A;  5C6A A;  1C4Q A;  2K5D A;  3FRP B;  2XRQ D;  3A56 A;  3DUZ A;  1SSO A;  5C4J B;  2JYO A;  1XYI A;  2HUG A;  4RGO S;  1B9N A;  5EKK A;  1SYF A;  4HSP A;  4M1U B;  1NUC A;  1DOM A;  4IUQ A;  5IGD A;  2KEC A;  4XQN A;  3GTP B;  3TBI B;  3FEW X;  1Y1W B;  5FLX L;  5FLX E;  4A3I B;  1ROD A;  4EVO A;  4K6L A;  1ZEQ X;  2EE1 A;  1GUT A;  1EY5 A;  1Z47 A;  1TKW B;  3U9O A;  4UAI A;  1LTS D;  2E2H B;  3ERO A;  3M3Y B;  2O4X A;  4QF4 A;  1STY A;  5CC4 A;  3KLR A;  3J81 E;  1E2W A;  1LLR D;  1STE A;  4XYQ A;  4EQP A;  2Z1C A;  3MFY A;  1T5E A;  5A35 A;  4RKL A;  1JQY D;  4DA2 A;  4V19 0;  3GTJ B;  4NKL A;  1KDB A;  3MXU A;  1JOO A;  2G9D A;  3GV6 A;  1ET6 A;  3DMU A;  3BVZ A;  5HGT A;  1EQT A;  4HTH A;  3IFT A;  1WTX A;  5K36 G;  1AP0 A;  3FPU B;  2F0N A;  4ME5 A;  2XNA C;  1FGB D;  2EXZ A;  1B2T A;  1LT4 D;  1I6H B;  2Q8T A;  3I72 A;  4H7B A;  1EIG A;  1A3T A;  1J8I A;  1XXG A;  4OIJ A;  1E2Z A;  3J81 L;  4G7H C;  1S5E D;  4IFD G;  1EYD A;  1D5X C;  3K5O A;  2HCI A;  4KN7 C;  3QIA A;  4IFD I;  5EBD A;  3S1N B;  3I4M B;  2PZT A;  3SE0 A;  1Q12 A;  1PRT F;  4ZRZ A;  5EKI A;  3KBX A;  1HTL D;  1V1P B;  1B50 A;  1SYG A;  4C3H B;  2VB2 X;  2K01 A;  4IN3 A;  1E0B A;  1KAB A;  2B2Y C;  3J7A V;  1EEF D;  4ZYS A;  2JSO A;  4A3B B;  4IFD J;  5C4H A;  1JWS D;  1ILP A;  1LV9 A;  3RD4 A;  3MEH A;  4V0B A;  1BNZ A;  3SEB A;  2A5H A;  3N52 A;  1G2T A;  2EPB A;  3VR3 A;  1HA6 A;  4ABN A;  1VF5 C;  1HRJ A;  3GTO B;  1H9J A;  1LT3 D;  2G9H D;  2NTS A;  1DJR D;  1H9K A;  2KJX A;  1KAA A;  1EIH A;  3E5S A;  1GUG A;  3AMU A;  1PFM A;  1GJX A;  1CK1 A;  1ZYR D;  3FPP A;  3SXH A;  4J6H A;  2B2V C;  1PTO F;  4ID6 A;  1B53 A;  3T16 A;  1GHJ A;  2E2D C;  2K1B A;  3GTG B;  1RJT A;  4Y7N B;  2IWH A;  5C0X H;  1LTG D;  1GOZ A;  1U4M A;  5ELF A;  2NVQ B;  3HZX A;  4DK1 A;  1FD7 D;  1TY2 A;  5CV5 A;  1WTQ A;  3GV3 A;  1AZQ A;  1WD1 A;  5CGK A;  5COR A;  2NYZ D;  1G2S A;  5I2X A;  1NR2 A;  2N88 A;  1FYC A;  1U4R A;  3GP7 A;  3S17 B;  2AWN A;  2F3V A;  1Q8I A;  4F87 A;  3Q24 A;  1Y69 U;  3PO2 B;  2PNR C;  1SDF A;  4CJ1 B;  2F0J A;  1RCV D;  3EVQ A;  2F3W A;  5M9O A;  1V8Q A;  3WOE A;  1LAC A;  3NBI A;  2AWO A;  1BDO A;  4OO1 I;  4IAL A;  4WFN 3;  4F8M A;  1HQM C;  4X3U A;  2K28 A;  5E3F A;  4BY7 B;  2B2W A;  1LTB D;  1JOK A;  4G7Z C;  2WAQ B;  3K5N A;  2EY2 A;  5BN4 A;  2JEB I;  4EQO A;  3FDT A;  3NPP A;  1TWF B;  3R2T A;  5DAU A;  2AQ3 B;  2IT1 A;  2XVS A;  4PNY A;  1IL8 A;  1KDA A;  3GTK B;  3RZO B;  2XN9 C;  4KHZ A;  4RAU C;  2YU9 B;  1D1I A;  2B2Y A;  2F0S A;  4C3I B;  3K5M A;  3I90 A;  3A7A B;  4OL7 A;  4P2C B;  3JAM E;  5FK9 C;  2FMM A;  1R4P B;  3HGB A;  1PMR A;  5KNC A;  1PXU A;  1EY6 A;  1LO5 D;  3Q23 A;  1V1O A;  2YYZ A;  1JWM D;  1RTO A;  3C46 A;  4UDU C;  3D4R A;  1A3V A;  3PUV A;  1TS3 A;  5JVH 3;  3FVQ A;  1BCP F;  1TWA B;  2RBM A;  2F0E A;  3PO3 B;  1Y1V B;  5C0X I;  1WTW A;  1STG A;  1DM0 B;  1TS4 A;  4X3K A;  3K6O A;  1D6E C;  2EYM A;  1VMC A;  4KJO A;  1SND A;  2E74 C;  1AN8 A;  3RLF A;  1JOR A;  1DOL A;  1PZJ D;  2EJF C;  1BCP B;  1HHV A;  1Z7T A;  4A3D B;  1X3Q A;  4KD4 A;  2JA5 B;  4RFB A;  4OHJ A;  2KCN A;  4CJ0 B;  2MHV A;  3VYT A;  2WP8 J;  2F0Q A;  2R6G A;  4BBS B;  2QDB A;  4A3K B;  4KHV A;  3ONA B;  2F0H A;  1XWE A;  4B9W A;  5COY A;  3TP6 A;  2B2U C;  5ISR A;  1K8M A;  4Z9C B;  1ZKO A;  1GHK A;  2ZT9 C;  5ELC A;  2A6E D;  3BYY B;  2PW5 A;  4ZKB B;  2PPB C;  5EPJ A;  4MN3 A;  2HCC A;  1LT6 D;  1KNA A;  2F0W A;  1BQQ T;  4IZ8 A;  3NK9 A;  4X3S A;  2CHB D;  5I2Y A;  1I4Q A;  4C1N K;  1ENC A;  4MIU A;  1I4P A;  2KA7 A;  1X3P A;  1S5F D;  4TKO B;  2RDF A;  2E76 C;  3TDQ A;  2VXW A;  4HMJ A;  1FNU A;  1S5D D;  4EQN A;  3BYT B;  2MP1 A;  4HAE A;  1SYE A;  1OO9 B;  2A6H C;  1PRT D;  1IW7 D;  1JWU D;  2F0P A;  4K5V A;  4XYO A;  5G3L D;  3VA7 A;  4FXK C;  3K7A B;  3ITP A;  4RGM A;  1LTA D;  2HDL A;  5JEA H;  2O5J C;  5I6W A;  4Q5V A;  2MPM A;  3NTK A;  3K57 A;  3SK6 A;  3D8G A;  2NWG A;  1BXT A;  3FMC A;  3GQB A;  4RKB A;  3I73 A;  4ODG A;  1CHQ D;  1SBB B;  1IYU A;  3ND8 A;  4FXG C;  1M8A A;  2CQA A;  1QIL A;  2RVL A;  3Q6S A;  2F0F A;  4BA2 I;  2PZW A;  2JEA I;  1IKL A;  5ELD A;  4IUP A;  4C3J B;  5D14 A;  1X32 A;  5JPM C;  1B3A A;  1SXT A;  2XRS D;  3J80 E;  3KK7 A;  4ZLT F;  2IX0 A;  1ESF A;  3X3N A;  1TQO A;  1WD0 A;  1EY7 A;  1WTO A;  3GTQ B;  1G8Z D;  3SR1 A;  1F2Y A;  1KDC A;  2F1M A;  3PUX A;  5C3W A;  2EYO A;  1QCB D;  3VR4 A;  3ERQ A;  2J0T D;  2SDF A;  3HOU B;  3BG3 A;  3I3C A;  1LTR D;  1U4P A;  1AEX A;  1I50 B;  1NSN S;  3D6C A;  1VF7 A;  2PO4 A;  1F9S A;  1EZ6 A;  3QJY A;  3CHB D;  1CM9 A;  2BA1 A;  5I9O A;  1HPC A;  1GUW A;  1EYA A;  5FKA C;  3QB3 A;  3I4L A;  2F0L A;  1A2U A;  3AB9 A;  5IGC A;  1HFG A;  3DWP A;  4I7Z C;  4K6D A;  2K6A A;  2J7Z A;  2OF1 A;  4L6T B;  2FJ2 A;  4AYB B;  4HSV A;  1EY9 A;  3E0J A;  4CJ2 C;  1KLU D;  2M9V A;  5DEH A;  4OIK A;  3P1H A;  2XWJ B;  3HOX B;  1ZYR C;  1EY8 A;  5KND A;  2KCC A;  2WKD A;  1RD9 D;  1TU2 B;  4U68 A;  4DK0 A;  2AQ2 B;  2FIN B;  1DZ1 A;  4FNF A;  1G91 A;  3PUY A;  3EFX D;  3GTL B;  4HMI A;  1U4L A;  2KUM A;  3IKJ A;  3R8B A;  1JOQ A;  1UUP A;  2HDM A;  3ND9 A;  1Y8N B;  5M5X B;  2EY1 A;  3K0Y A;  2QF7 A;  4NW2 A;  2ICE C;  5I6Y A;  5CMD A;  1W6K A;  5M5Y B;  5CV8 A;  2C9O A;  5IGE A;  2Q8R E;  1J9O A;  1EY0 A;  4M8A A;  3ZYY X;  2C5C A;  3JAM L;  5FO9 B;  2EDG A;  3H0G B;  3NBH A;  1VCI A;  4KV6 A;  4KTA A;  3AU7 A;  4K8J A;  3RMH A;  1STB A;  5I4D A;  4BY1 B;  3PIO 3;  2PMZ B;  1BCP D;  5CBA E;  1EOT A;  5F2D A;  1R9T B;  5BN5 A;  2O5I C;  4RH6 A;  2F0G A;  1L0X B;  2WKC A;  2I07 B;  2WB1 B;  4Q0F A;  2PW7 A;  1EQV A;  1SAP A;  1DOK A;  1TT2 A;  4FO2 A;  1BCP C;  2L11 A;  1IKM A;  1OXV A;  3A54 A;  5C4X B;  3URY A;  3NWS A;  2H1E A;  2EYH A;  1E2V A;  3P20 A;  2F0T A;  1I4R A;  5JVG 3;  4DFA A;  1RHP A;  1PTO H;  1YNJ C;  2JA8 B;  1B9M A;  3QG1 A;  3S16 B;  1LT5 D;  2WIN B;  2R3Z A;  5J22 A;  3PMF A;  3MWY W;  3BS1 A;  1STN A;  1Q3L A;  1TWC B;  3S9W A;  4C3J G;  5FOB B;  3OIQ A;  2AUK A;  4X3T A;  5E1F A;  1EFI D;  4KI0 A;  4DXF A;  3LX0 A;  5C0X G;  3D4W A;  2JE6 I;  1C8C A;  1BO0 A;  3T56 B;  3KF8 A;  1D5Z C;  1HA5 A;  1O7Z A;  3NP8 A;  2SOB A;  3BVM A;  3NHH A;  2LMC B;  2SNM A;  3R93 A;  1PZI D;  2XWB B;  4KY6 A;  1JE4 A;  3HG9 A;  4K2K A;  2L12 A;  4KD3 A;  4LK1 C;  5IGF A;  2VNU D;  5T1G A;  2F0M A;  1OXT A;  3OHX C;  1H9M A;  1SMY D;  3CRL C;  1MSG A;  4G4K A;  4HR7 B;  3NE5 B;  1QB5 D;  1L0Y B;  2N55 A;  1UNS A;  1DON A;  1RF2 D;  2L55 A;  1TWG B;  1ILQ A;  1MSH A;  1FR3 A;  4FF1 A;  3S2D B;  2NVT B;  3W3A A;  3TP7 A;  2BE5 C;  1PTO C;  1I6V C;  4F7X A;  3M85 A;  4RHR A;  2NZ1 D;  2ENB A;  1TS5 A;  2DY7 A;  1D1K A;  2VUM B;  5FO7 B;  1F77 A;  4WOR A;  4K8I A;  4F88 A;  3D3R A;  2Q8I B;  2A6H D;  2RSN A;  2F03 A;  3LWE A;  2EYL A;  3HOY B;  3K5L A;  1GUS A;  3VR2 A;  1MBY A;  3QWN A;  5C0X J;  5KEE A;  3MXP A;  4DNT B;  1JR0 D;  1ET9 A;  2TSS A;  1QOH A;  2KED A;  1CTM A;  2GA4 B;  3BDL A;  1ZXT A;  4L8J A;  1IW7 C;  5EPK A;  2DN8 A;  1QE6 A;  3G6J B;  3T13 A;  4QCL A;  1EZ8 A;  2F0D A;  2L0C A;  2J4X A;  1CZG A;  2WAC A;  1T5X D;  5CV6 A;  1I3Q B;  3D31 A;  3A8K E;  5JAV A;  5CV9 A;  1NAP A;  1CZW A;  2B39 A;  3TSS A;  1V43 A;  4TQU S;  1EWH A;  1S4Z A;  3M4O B;  1CA6 A;  1EWC A;  2DNC A;  1GUO A;  4RCN A;  2EY5 A;  1CQV A;  3I8Z A;  1DXM A;  3P7J A;  2KHS A;  3A55 A;  1ICW A;  3NXW A;  1MI2 A;  1XX8 A;  2X69 A;  2D5D A;  5JEA G;  4DN4 M;  2OT2 A;  2B2T A;  4TRD A;  1UAP A;  1B1Z A;  2BOS A;  5I9P A;  3HOW B;  5CBE E;  5K5P A;  5CV7 A;  1HUN A;  2K7V A;  4KK7 A;  4PQX A;  1K83 B;  4N9P A;  5CYU A;  3MVV A;  2IX1 A;  1V1P A;  5A2Q L;  4S3S A;  1TVX A;  4HN7 A;  1HXY D;  2JXM B;  2R93 B;  1HTP A;  3S1R B;  1KTK A;  2R92 B;  5A2Q E;  3Q22 A;  3GD7 A;  2EOT A;  1F9Q A;  2CW0 C;  2MJ8 A;  2R7Z B;  2JA6 B;  1XTC D;  2WV6 D;  2NB0 A;  1PRT B;  4QUC A;  2X6G A;  3WDN A;  2B8F A;  4A3M B;  2CW0 D;  4ILW A;  3C1F A;  5NUC A;  5M5W B;  3PIP 3;  2X6L A;  2B2T C;  1SNM A;  5IGB A;  1U9R A;  4HCE A;  2Z8L A;  1DD2 A;  4DU9 A;  1O78 A;  5KIX A;  2RA4 A;  4CGY B;  3I91 A;  2RDH A;  4ULL A;  1EL0 A;  5AFW A;  4CKE A;  3TME A;  5IOD A;  1EU4 A;  2A69 C;  4IUT A;  4CHT B;  3VA5 A;  5C5M A;  1QNK A;  2A73 B;  3TZD A;  2AQ1 B;  2E2I B;  2K32 A;  5LL6 S;  1SEB D;  3MTS A;  1KLG D;  4C56 C;  3E6Z X;  2SEB D;  3TN2 A;  4A3G B;  1PFB A;  4RGT A;  3PUW A;  2A68 C;  3OWE B;  1PTO B;  1Z6H A;  3LWU A;  1CQF A;  3S1M B;  4G7O C;  2PCF B;  5D3I B;  4O1N A;  3IAY A;  4L63 B;  2O2L D;  5TSS A;  2ID0 A;  5JEA J;  2XSC A;  4PMC A;  2ZXP A;  4LAA A;  3FKI B;  4RWS C;  2JP1 A;  4DAP A;  1M4V A;  3EA6 A;  4IUN A;  4XT3 B;  3DWQ A;  3CKI B;  1F2M A;  1F9R A;  5EQ0 A;  2TMP A;  1JC7 A;  3WOF A;  5IIF A;  5HUR A;  3GO5 A;  3OSO A;  3DXJ C;  2IL8 A;  3EQL C;  3C2P A;  1MGS A;  3C1E A;  5KYL A;  2L4N A;  4HCS A;  4RHS A;  3OIP A;  4KY5 A;  5CV4 A;  3NQI A;  4G57 A;  2NN6 G;  3HKZ B;  1PYW D;  2V4D A;  3CRK C;  2A74 C;  2PQE A;  2K05 A;  5EGT A;  2PYK A;  3NTI A;  1F2Z A;  4TSS A;  3RZD B;  1ESR A;  1ENA A;  4A3J B;  4WJW A;  4JK1 C;  4CKB A;  1BR9 A;  1BBX C;  5ELB A;  4K2L A;  1SNO A;  5C3X A;  5JPN C;  2BE5 D;  1A15 A;  4BWG B;  1PTO D;  4IUV A;  2DNE A;  3NUC A;  1FNV A;  1WVL A;  2PZU A;  4ZKC B;  1SMY C;  2NTT A;  3MXN A;  3OPO A;  1BF4 A;  3W2D A;  5EBC A;  3H6M A;  1QG7 A;  4ZQ3 A;  4A93 B;  2MGS A;  1B44 D;  2K5W A;  1PLF A;  4FVM A;  2EZV A;  4GZY C;  1RKN A;  2RDG A;  5ELE A;  4OO1 H;  1SE4 A;  2F0V A;  1BOS A;  1KNE A;  3MC0 B;  4O42 A;  3V05 A;  3A8J E;  1FNW A;  4KJN A;  1QWY A;  3L7Z C;  2QIL A;  3L9A X;  2IPK D;  1MD2 D;  3H94 A;  3R3O A;  4KMU C;  2KOL A;  2L5T A;  1JB3 A;  2EYF A;  5D65 A;  3DEP A;  2I46 A;  3H3V C;  1EU3 A;  4KKS A;  1II3 A;  1K8O A;  1PRT C;  5E4W C;  5DNF A;  4QUF A;  4R9W A;  4R8N A;  2B2W C;  1YNJ D;  4IFD H;  4DF7 A;  4FF2 A;  1OXU A;  5DM7 3;  3J7A F;  1C48 A;  2LFN A;  3P75 A;  3S1Q B;  4E6I A;  4QMG A;  1I4X A;  2BDN A;  4BS9 A;  1LTI D;  4QIW B;  5D3D A;  1LAB A;  1HUM A;  4OO1 G;  4DNR B;  1A6X A;  1SYC A;  4FYD A;  1SYB A;  5LHY 1;  4FF3 A;  1SNC A;  3BZD B;  4PMW A;  2MUY A;  2QKI C;  5JOB A;  4NMZ A;  5IGG A;  1ENF A;  3UI2 A;  4DXG A;  5KYI A;  1IYV A;  3PUZ A;  2H4O A;  1TY0 A;  4NDX A;  1R4Q B;  4I65 A;  3Q0A A;  1ONL A;  1Q1B A;  3M7N A;  2OXP A;  2CVR A;  2LS0 1;  3HOV B;  1PDQ A;  3M4Y A;  2FFK B;  2B2U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...