2X6LA

X-ray structure of macrophage inflammatory protein-1 beta
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
66
structure length
66
Chain Sequence
GSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRSKQVCADPSESWVQEYVYDLELN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Polymerization of Mip-1 Chemokine (Ccl3 and Ccl4) and Clearance of Mip-1 by Insulin-Degrading Enzyme.
pubmed doi rcsb
molecule tags Immune system
molecule keywords C-C MOTIF CHEMOKINE 4
total genus 13
structure length 66
sequence length 66
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2010-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2x6lA00
1B53A 3Q6SA 5COYA 2X6LA 1PDQA 2KECA 1DONA 5EKIA 3DEOA 1WVLA 4IUVA 4MN3A 2L11A 2X69A 4X3UA 3QO2A 2XIWA 1GUWA 1QE6A 5CMDA 4X3KA 1DOLA 1WD0A 1HFGA 5E4XA 1RTNA 3DEPA 2KEDA 1C8CA 3N52A 2EE1A 5EJWA 1MI2A 2KOLA 1XYIA 4MHEA 1B4OA 3D6WA 1G2SA 1EQTA 1ZXTA 2DY8A 3MWYW 1WTWA 1WTPA 1F9PA 4DN4M 1G2TA 2NZ1D 1KNEA 5DNFA 1U4LA 5CORA 1AZQA 1PFBA 3IFDA 1WD1A 5T1IA 2MPMA 3P7JA 2RVLA 1EL0A 4RWSC 4HSVA 2N88A 4XDXA 3MTSA 4RAUC 2L4NA 5CBAE 4U68A 1HHVA 3I90A 2IL8A 5D65A 2NWGA 1QNKA 1J9OA 3DM1A 2Q8RE 3GV3A 4IUTA 1G91A 2FHTA 1WTQA 1HA6A 3HP3A 1CA6A 1JE4A 1NCVA 5CBEE 1AP0A 2K03A 2SDFA 4IUUA 2B2VA 2D9UA 3I91A 1JICA 3SVMA 2L9HA 3KBXA 1WTVA 2HDMA 3I8ZA 2EPBA 2B2YC 3FDTA 3KUPA 3LWEA 2EOTA 4R9WA 2N55A 1B2TA 1BF4A 5JJZA 2B2UA 4OIJA 5T1GA 4ZKBB 1F9SA 1XX8A 3G7LA 1HUMA 2J7ZA 2K04A 4XT3B 3GV6A 3I3CA 2K05A 2R3ZA 1X3PA 1O7ZA 1O7YA 3TZDA 3IL8A 4CJ1B 2B2TA 2H1EA 2RSNA 1U4PA 1NR4A 2X6GA 3H91A 5D14A 1BNZA 2KUMA 1RTOA 1DOKA 1ESRA 4HEDA 4QUCA 1EIGA 2K1BA 1F9QA 4CJ0B 4O42A 1BO0A 1MSHA 4IURA 5EPJA 2FFKB 1AZPA 1G6ZA 2B2WC 2VXWA 1MSGA 2CVRA 1EOTA 1SDFA 1RODA 4R8IA 1PFMA 1VMPA 1DOMA 1HFNA 1NR2A 2K28A 1U4RA 3FPUB 1IKLA 1PFNA 2HUGA 2HCCA 4IUQA 1SAPA 4RA8A 2FJ2A 2NYZD 2BDNA 1EIHA 1ILQA 1F9RA 2K01A 2M2LA 4ZKCB 2B2VC 1X32A 1WTRA 2RA4A 1ICWA 1CA5A 1S4ZA 1LV9A 1MGSA 1RHPA 4HAEA 1U4MA 2L1BA 2MGSA 2KEEA 2B2YA 4CJ2C 1CM9A 4XT1B 4ZAIA 2RSOA 1WTXA 3ONAB 1HRJA 1J8IA 2B2UC 1KNAA 2HDLA 2MJ8A 1ML0D 2HCIA 1RJTA 1PLFA 4ZLTF 1B50A 1DZ1A 1NAPA 2MP1A 3UI2A 4QUFA 5E4WC 1B3AA 1TVXA 2FINB 4UAIA 2B2TC 1WTOA 1BBXC 4OIKA 2L12A 5EPLA 3F2UA 1HUNA 1E0BA 1SSOA 5EQ0A 3TN2A 4NW2A 4IUPA 1O80A 1M8AA 5AFWA 1ILPA 4LMQD 4X3TA 1QG7A 1A15A 1Q3LA 4HCSA 2B2WA 2JYOA 4ZK9B 1VMCA 2JP1A 1IL8A 2KVMA 1IKMA 1F2LA 3R93A 4X3SA 2DY7A 5EPKA 2FMMA 1X3QA 2Q8TA
chains in the Genus database with same CATH superfamily
2ICIA 3GTPB 1HXYD 2KECA 3NTHA 1STNA 2CHBD 2O5JC 1JB7A 1TY0A 2GVBA 1T5XD 1X56A 4K14A 5GROA 3U9OA 3M4YA 3HEJA 3ND9A 1EUJA 1GXDC 1G2SA 4BY1H 1SMYC 2Z6KC 4L5RC 4A93B 1VQMA 1GD7A 3JAMi 5DNFA 1IYVA 3M3YB 2AQ2B 1EIYB 2IX1A 4K2LA 4TKOB 1HZ9A 1TS3A 4HSVA 3M7NA 3DWAA 1LO5D 1HQRD 1ENFA 2F0SA 2IL8A 3T1HQ 2G9DA 2RHQB 2E5LQ 1LTGD 5HY6A 2WP8J 4JI0L 1XTDA 1WCMB 1DM0B 4WORA 2PPBC 2QGQA 3A8JE 4M1UB 3QOJA 1VQ4A 1VQCA 4CDDC 3SVMA 3MC0B 2HDMA 2IW3A 2EPBA 3LWEA 4LF9L 2EOTA 1OXUA 1DGSA 4OIJA 5T1GA 1VQKA 3G7LA 4FXDA 1G51A 1HNXL 3Q8DA 3C46A 3FKIH 1II3A 1LT4D 3K8AA 4KN4C 2RDGA 2OCEA 4JI1Q 2NVTB 3HKSA 3C1EA 3M4QA 1PZKD 4IURA 3Q0AA 3X3NA 1O78A 2KHJA 1CQVA 3SE0A 3CCQA 3A56A 1K83B 1E2ZA 5JPMC 2K6AA 3MFYA 1BCPD 3I56A 4DV5Q 2EYHA 3HS0C 2I5MX 4JI8L 3H0GH 4R1JA 1YEZA 1I6HH 1TWGB 2YYZA 1OXXK 5DM63 2GA4B 5ELBA 4JK1C 4AYBB 4WJWA 2Q2IA 4DV6Q 1MBYA 2QA4A 3HOUH 3UI2A 3PF4A 1DD2A 5KNDA 1M90C 3DHQA 2A1AA 3UDGA 3CQZH 1GM5A 4Y7NB 3SK8A 5HGTA 3A8KE 3A7AB 1VQAA 1E3PA 4A76A 3BU2A 1YVCA 5ELDA 2OT2A 1RF2D 2EY5A 3L7ZC 4CHTB 3R93A 4XQJA 3PF5A 1CKNA 1HR0W 3FVQA 1ZEQX 5IWAL 1KD1C 3VR4A 3CC7A 1D5XC 5DEHA 3J81i 1PTOH 1BCPF 2HT1A 2V1CC 3LWUA 4H02A 5CMDA 4A3GH 3T1YQ 4B3MQ 3J80E 5E4XA 1MJCA 1PRTC 1UE5A 3AFPA 3Q24A 2YU9H 4DR7Q 1UEBA 3X3MA 2F0JA 2ZM6L 5I6WA 5EJWA 3HOVB 3K5LA 2I5HA 1N32L 4H0LC 3K80C 2DY8A 3QB3A 3I4MH 4JI7L 4IFDG 4POGA 1K8OA 4B9WA 2XGTA 2AQ3B 4GNXA 3V05A 2N88A 2A5HA 3TZUA 1CSPA 1PYWD 1X3EA 5EBCA 2O5IC 4BXXG 4X6AH 5A35A 2Q8RE 3I4NB 1WTQA 2K5VA 4LF8Q 3TQYA 3OMGA 3RMHA 1VQ8A 4OX9Q 4LF6L 4A3CG 1O7LA 5KNBA 5JOBA 1V8QA 2J7ZA 4A3IB 4IUNA 2DJGC 3CRKC 3OYYA 1SMYD 2H1EA 3CMEA 1IBLL 4K5VA 2EYMA 4LK1C 1JJCB 1EIGA 3EA6A 2UUAL 3CCUA 1PVOA 3RN2A 4ABNA 4OELB 1GUGA 2B2WC 3TSSA 4DV0L 4DV3L 1KAAA 1RDPD 2HHHQ 4I65A 1NR2A 4EVOA 1VQEA 3HOXB 5GADC 2ES2A 4PMWA 2TSSA 1SAPA 4GN3B 4JI3Q 1HR0Q 4BBRG 4JVZA 1VQ5A 2NN6G 3OSOA 2RA4A 1VF7A 1X3FA 3SK5A 2SEBD 1PLFA 4QUFA 3ERQA 1K8GA 1N33L 4A3JB 4GS3A 4LF7L 3GTQB 1E1TA 4YWKA 3ULLA 1XNQL 4LMQD 2B2WA 1PTOF 2LMCB 2MO0A 1VMCA 4RCOA 3VR2A 5M5XB 1S5BD 3K5OA 4LUOA 3Q6SA 2X6LA 2XWJB 2A6EC 4HJ5A 4DAPA 2R92H 2L11A 4KKUA 1L0WA 1IYUA 3BDLA 3KLSA 1A62A 1HFGA 2K5DA 4HJAA 1B70B 2QKIC 1YNJD 2UXDL 2KOLA 3PO2H 5JJLA 1U9RA 3ULJA 3TS0A 4IPGA 1B9NA 2VNUD 4TRDA 1F9PA 1HZAA 1BXTA 1AZQA 1D1IA 1K9MC 4IPDA 1EU3A 1EY5A 1IBKL 2PNRC 3H3VI 1B3QA 1L0XB 3BDCA 3GTJH 2GVAA 3KBGA 1TWGH 2L4NA 3CPFA 5CBAE 4UP8A 4DK1A 1ONLA 2UXCL 3GV3A 3WOFA 2LKVA 3AB9A 4KY5A 5I2XA 3E9HA 1U5KA 3IKJA 2JA6H 2D0OA 1LTBD 3T56B 1BQQT 1KLGD 4YY3Q 1YIJA 1EZ8A 3AYHB 5JJZA 4A3KH 1JJGA 1C9OA 2JQOA 3BG3A 1YNJC 2R7ZB 1J5EL 4IALA 4YCVA 2DJFC 5D14A 1Q46A 2EJFC 2KUMA 1IBLQ 1F9QA 1HA5A 4RH6A 2JEAI 1BO0A 3HFZB 1I50H 1Y8PB 4B3TQ 1SDFA 3MXNA 1DOMA 4X62Q 3EIVA 4DNRB 5GAEC 4N8FA 1EY6A 2HUGA 4C3HG 2JA5B 1TS5A 3BDOA 2JJQA 3QOLA 2ID0A 2K5WA 1SYDA 4DR6Q 2N3SA 2FJ2A 1ZYRD 3OHXC 3U50C 1MGSA 1CI3M 1SMXA 4V190 4C3HB 3NK9A 1IBMQ 2ICEC 2BE5C 4KTAA 1VQPA 1BUVT 3E0EA 5LL6X 4B3RL 1HUNA 2Z6KA 1IW7D 1LTLA 1KHIA 1JT8A 1FR3A 2NZHA 1FD7D 1YHQA 2WIIB 4JI7Q 5AJ3Q 2R7ZG 2F0OA 3CCSA 4JI8Q 2Q2UA 1YNNC 4DFAA 1Q82C 2WKCA 2P5ZX 3ERSX 3W2DA 1ESFA 5M3MG 1Y1WH 1ZYRC 5JEAJ 5IWAQ 2NN6H 1I4HA 1IZ6A 1S40A 1FNVA 2YU9B 3ULPA 4C3IG 1VQDA 1E22A 4DN4M 1SJHD 1CKOA 2VUMG 3RR5A 2F4IA 2PO4A 3S1NH 4Q0FA 1G8ZD 5EBDA 2K52A 1W6JA 1A3TA 4BY1G 5C4XH 2PMZB 3DXJC 3NHHA 2ZXOA 2KBNA 1I5FA 3GTPH 1G91A 2PNHA 5IGCA 1N34Q 5H1SE 1XJVA 5CBEE 2D9UA 4JG2A 2A74C 5FLXc 2F0TA 3GTQH 4E6IA 3MHBA 3S1MB 5EKLA 4ZKBB 5M3FH 2F0FA 2K05A 1SNOA 1SNMA 4DV5L 3PO3B 3PCOB 1VQOA 1KQSA 2CW0D 3WOEA 2FFKB 4YHHL 1CZGA 2K32A 2BDNA 4ZKCB 1OXTA 5BN4A 4BBRB 4GOPA 3K7AB 3H0GB 3NP8A 5EKKA 1HRJA 3VA7A 1ML0D 2MUYA 3N6RA 4YWLA 4IOCA 5ELCA 4NKLA 4IJHA 1I4QA 1WOCA 5E4WC 4B3RQ 3QG1A 5G3LF 2QILA 3FRPB 1P16A 3KJOA 2UU9L 3H3VC 2PW5A 3NE5B 4X3TA 1S5CD 4QMGA 2DNCA 3HOZG 1FVIA 5A2QE 4JI5L 1EFID 1YJWA 3HOZB 1D8LA 5I4DA 2LY7A 4OO1I 4A3BB 1XTCD 4JV5Q 3W1BA 1XPRA 4MN3A 2N8NA 3KDFB 2PI2A 3T51B 2A6HC 1I6HB 1QE6A 3PUZA 4DUZQ 2R93B 1TIID 4OWTB 1J5EQ 1ZXTA 2NUCA 4A4IA 2CQAA 4CKCA 3PO2B 4P73A 3CQZB 4IFDJ 2NVYB 1WD1A 1A6XA 4KHZA 1KRTA 1PZJD 1QWYA 1G291 2YTVA 1NSNS 1V1OA 1STEA 4ZQ3A 1CTMA 3I4MG 1U0LA 4ME5A 3A8IE 3R8BA 1NY4A 1QNKA 1J9OA 4P74A 2G5DA 5IOCA 2XVSA 1BCPB 1H9JA 4JBWA 4QGUA 4KK7A 2JXMB 1R9TB 1JWUD 2YV5A 4EQNA 2SDFA 1WYDA 4A3GB 4JCVE 2JE6I 3A7LA 1E24A 5K36G 3KUPA 4K0KQ 5IT9c 4JI2L 1O7IA 1KTKA 4P75A 4B3SL 4XT3B 1AH9A 1H9RA 2WKDA 2CH4A 3CU7A 4H7BA 1NNXA 1EIFA 4GKJL 1EZ6A 1S5DD 4LFAQ 2K1BA 3HGBA 3LX0A 1X55A 3CMAA 4O42A 4FYDA 1R4PB 4BY1B 4DR1Q 3QWNA 1G6ZA 4KI0A 4A93H 1IL2A 1UAPA 3CAMA 4P71A 1W2BA 2VQEL 3RUZA 2E2IH 5ELEA 2HCCA 1HJPA 1YI2A 1PH1A 3GQBA 3S14B 2E74C 1CUKA 1EYAA 2RDHA 4LF7Q 2K01A 3URYA 3OPOA 1X32A 1QNUA 1EEFD 1Y1WG 4R8NA 5E1FA 4HAEA 4N9TA 1OO9B 3VYRA 2IY5B 3MXPA 1VQ6A 3KDFA 3M7GA 1D6EC 1TVXA 1RL2A 3CRLC 3E9IA 1HR0L 1MIUA 2OEOA 4S3SA 4XQQA 1C48A 2JN4A 3TN2A 1PH9A 2A6HD 1TWAH 1M8AA 4A3EB 1SYGA 5GAHC 3I55A 3KLRA 3PUWA 1PYBA 1YJNA 3K59A 2IX3A 2NVXB 1FJGQ 3G6EA 2PCFB 4RGMA 3M4PA 3J81E 3R2TA 5E7NA 1QVFA 2H5XA 1D5ZC 1C0AA 2UUAQ 5FKAC 2F3WA 4FF1A 3ZJYC 1X6OA 5KRUA 4K8IA 1EYGA 2K4KA 4A3JH 2L5TA 3A5ZB 4DUYL 1QUQA 4G57A 1JORA 3CP0A 1Z7TA 2BDOA 1PFBA 3PMFA 3TP5A 5NUCA 5JAVA 3DM3A 2O4XA 4OHJA 3P7JA 2XNAC 1GUSA 3K5NA 3KOJA 3WDNA 4DR3L 4IFDH 4BBRH 3ZYYX 4GKJQ 1BCPC 2EYOA 3T53B 1PRTB 2VS1A 1LTTD 3I90A 2F0WA 4RKBA 1PH7A 5GQOA 1CHQD 1FYCA 4GNXB 5LMNW 3LGJA 1PXUA 1IYJB 5IYBH 4PV1C 5IT9E 1NTGA 4LUZA 1LT3D 2UUBL 1GUNA 1KABA 4LF4Q 2V4DA 5IIFA 3MA2B 4I7AA 4JC0A 2R3ZA 4X64L 2B3GA 2KENA 1N32Q 4V0BA 1AW7A 2RSNA 2R7ZH 3M4OB 4HN7A 3Q23A 4DV7L 2UXCQ 2VXWA 3AU7A 1NJIC 4H13C 1W3SA 3P75A 2R93H 1IKLA 1VQJA 1JOOA 1SFOB 1XPUA 3I7FA 3GTMB 3EQLC 1H9MA 2L15A 4QY7A 4KMUC 5LMUQ 1UE6A 1NMFA 4BY7B 4IFDI 2F0VA 2HHHL 3HOWG 2RSOA 3ONAB 4WJ3M 1KNAA 4YCUA 1DZ1A 2Y0SE 4C3HH 5ELNA 1VQBA 2MP1A 3H6MA 3PQIA 1EYDA 4C3IH 4KHPL 2B63H 1STHA 1XXGA 1TS4A 5EPLA 3I72A 2DN8A 3JC66 1FGUA 2WAQG 3U4VA 1KRSA 5FJ8H 5C4XG 1LTSD 4KY7A 1I50B 2JP1A 2EYPA 2K50A 3JAML 1IL8A 3J80L 3S9WA 4JOIA 3STBC 1D2BA 2RQXA 1Q90A 1B53A 2JA8H 4JYAQ 3HOZH 1FGBD 1PDQA 5EKIA 2WB1B 1OXSC 4IUVA 4RCNA 2X69A 1LABA 1KIXA 3EN2A 4POFA 1DYQA 4CBVA 5AJ3L 4FVMA 3RZDH 4LWCA 5LMNQ 2F0MA 1MI2A 4B08A 1HQMC 1B4OA 1GVPA 1TWCB 3CCEA 4JI4Q 2ZJPA 2OXPA 2I5LX 1TT2A 4MTKA 5CORA 1BOSA 4WFN3 2E2HH 1LTAD 1EL0A 4QF4A 1TS2A 1UUPA 3S1NB 1Y1VH 4QB4A 4XDXA 1Y8NB 5IGBA 3FHWA 2Z4IA 2IHEA 4DNTB 1F2ZA 2RF4A 2IJ0A 4GOPB 5FK9C 4R4QA 2RHSB 2OWOA 2NB0A 4A3IG 1JR0D 1HNWQ 1DXMA 4R9WA 3FDTA 3KJPA 3S2DH 2EQSA 3GTLH 1V1PA 5LMUL 3F2DA 4YCWA 2K7VA 1VQNA 2K04A 2F3VA 5M3FB 2A19A 3VR3A 4P2CB 4QUCA 3UDXA 1ESRA 3I4LA 5JVH3 2IPKD 1TWHB 4DF7A 1C4QA 5EPJA 3VYUA 3CCJA 3SXHA 1STBA 3STBD 4NXNL 3SK6A 1D7QA 3H94A 4IUQA 1E2VA 4YY3L 4R4OA 2OTLA 2ZTEA 1VQLA 1YBYA 3CW2C 3CPWA 4HJ8A 2F1MA 1K8MA 2DUDA 3BYYB 5CV7A 2ZT9C 1GUOA 3GTKB 3ER0A 3RLNA 3S2HH 5JJIA 2JA6B 1V1QA 2RCNA 1LM0A 1CKMA 4DGZA 1B8AA 1ILPA 3CCVA 1LACA 2CH4W 1Q3LA 1VQ7A 4Q5VA 1KDCA 1TWAB 1F2LA 3OIQA 4K6LA 2AQ1B 2FMMA 1LTRD 5CV6A 2UXDQ 1BBUA 4B9XA 3D4WA 2AWOA 5I9PA 3DEOA 2PZWA 3F8TA 4GOPC 4A3CH 2Z9HA 2XIWA 1LT6D 2FXQA 3CD6A 2VW9A 2RCFA 5IYDG 5LHY1 3S17H 3N52A 1JOQA 1Z6HA 4FF2A 3MWYW 4A3FG 1KLUD 2JA7G 3FKIB 1EEID 1VF5C 1HCZA 2SNSA 5FLXE 2I0QA 2IWHA 3FP9A 3FPPA 3SK4A 4FNFA 5LMNL 4HMIA 1PTOD 3FEWX 1S5FD 4Z9CB 1K0SA 2EDGA 3TREA 3OTOL 3OWFA 4DV0Q 4PQXA 2NVQH 3S1QH 4JI1L 4GLVB 1JICA 1WJJA 2OF1A 4K5WA 1BF4A 2B2UA 3HOYH 3PV0A 2HIXA 3GP7A 2NVTH 4NMZA 4ILWA 1U4PA 1SLJA 2Q8IB 1MKHA 3CCMA 5JEAH 4LFBQ 1STGA 3CHBD 4O1NA 2XSCA 1LYLA 1HFNA 1AEXA 2C35B 2Z8LA 5M5WB 2K28A 1YJ9A 3BZCA 2VQEQ 3HOWB 1E7ZA 4JBMA 1SYBA 4RGTA 1Z9FA 4DR6L 2EZVA 4YWMA 1CA5A 2Y0SG 4KHVA 1WTXA 3OOCA 4J6HA 5C5LA 1HZBA 1AE3A 1WI5A 1STYA 4LF5Q 1QUQB 4G7HC 4TSSA 3GTOB 4EGVA 2K33A 2L12A 3I2ZA 1FJGL 4ZUIA 4C2MH 3DWQA 4IUPA 1JWMD 2E76C 4L5SA 3T13A 1BBWA 1PH5A 5JEAG 1EY4A 5C3XA 2XTIA 4F87A 2L55A 3HOUG 1CSQA 1WFQA 3K6OA 3NPPA 5J22A 4RHRA 4JBKA 4HIMA 2ZJQA 4DR5Q 2F0PA 2ZTCA 2LS01 2J0TD 3RZOB 2WACA 1V9PA 4FP5D 4AQYL 4DV1Q 4J15A 1N34L 4OEMB 3TP7A 2UXBQ 1A3UA 4MHEA 3CC2A 3G4SA 4JI3L 1Y8OB 4DUYQ 3J81L 3D4DA 1FNUA 1KNEA 1L0YB 3A54A 3VR6A 1NUCA 4F8MA 4ZYSA 4NDXA 1NMGA 4RWSC 3EFXD 4DR2L 1E1OA 2F52A 1EY0A 4ZUJA 5HGQA 3W5OA 3H09A 3CXCA 2FHTA 3E6ZX 4B3SQ 3KLSX 4QL5A 2E2JH 1PH6A 1AP0A 4CDCC 4J1MA 1WCMH 2B2YC 3NBIA 2KA7A 4DR4Q 5C4JB 4RG1A 5C4HA 1FL0A 1XX8A 3GV6A 2F3IA 3MEHA 4LF8L 1TY2A 2BA0A 3V2TA 3KF8A 3J81j 2AHOB 1XWEA 1X54A 2CWPA 2D62A 1I3QB 3NQTA 2LSSA 1EYCA 2QEJC 3J80i 1QILA 3HOXH 1SN8A 2NVYH 3FPUB 4JOIC 4BS9A 2PMZE 1K83H 3HZXA 3FKIG 5JPNC 2JA7B 4KJNA 2K75A 4A3FB 1K8AC 3WWVA 1Y69U 1U4MA 1QVGA 1G6PA 2B2YA 2E75C 3BVMA 4DV3Q 2ATWA 2HDLA 2QF7A 2MNAA 1XMOQ 4KHPQ 2FINB 5FOBB 4CDEC 2WFWA 1SJED 4OIKA 4PZ8A 3RLFA 1L2FA 5EQ0A 1SRUA 3GTGB 5J39A 2E2DC 5FO9B 1SYCA 1VQ9A 5IY0A 1I94Q 4XYOA 5BN5A 3KYHC 2AUKA 4K6DA 4LFCL 4IOAA 1SE8A 2DY7A 3SGIA 2Q8TA 1L1OC 4OL7A 3KF8B 4HIKA 1Q8IA 3AFQA 1DONA 4QQBX 1WVLA 4ODGA 2JA8B 3HOYB 5IT9L 2JA6G 4FF3A 4JI6L 1TR5A 2PQEA 2JA9A 3F2CA 4JPBW 3I4MB 4IPCA 2PQAA 2KJXA 1Q7YC 3D31A 4DXFA 1WTWA 2R92G 1G2TA 4DU9A 4MTNA 4DR4L 4CKEA 4R4IA 2EYLA 2MFIA 4NB3A 4A3MH 1H9KA 3PO2G 2BH2A 3E5SA 1JMCA 2R7DA 2UUCL 4FO2A 1L1OA 3OW7A 4RAUC 1SBBB 2AMCB 1R4QB 4DR1L 5E3FA 3AMUA 1J6QA 3VA5A 4AH6A 2R6GA 4A3EH 4LNQA 4QCLA 1GJXA 1PFSA 1YNND 3NUCA 1H95A 1JE4A 5IGDA 1HNZL 1SE3A 2B2VA 5IGEA 3RZDB 1EWCA 5CV8A 1HZCA 4RKLA 2I07B 4JI2Q 3CCLA 1A2UA 3S1QB 1N36Q 1CHPD 2NVQB 3A0JA 5JJKA 4EQPA 4IZ8A 1PZID 1K0RA 3I70A 4ID6A 4DV2Q 4C1NK 4OX9L 4GN5A 3MVVA 4A3IH 2SNMA 1SR3A 4R4TA 3A5UA 2PQAB 2WB1E 2MQHA 4CKBA 3J7AF 1RODA 1KC8C 3TEHB 2ZXRA 2EJMA 2QDBA 3RZOH 1ENCA 1EQVA 2F0HA 1LTID 5M5WH 2A73B 3GO5A 4LF4L 3L3OC 1GOZA 1RKNA 3MXUA 2MGSA 3TBIB 1CM9A 4XT1B 5JVG3 4OXPA 1GHJA 1EU4A 5KYLA 4G4KA 1NAPA 4FXKC 4DUZL 4UP7A 3G48A 5FLMH 1QCBD 5C44G 3EBEA 3UDIA 2B29A 3PO3G 5AFWA 3KK7A 4RGNA 1S72A 4HCSA 3KFUA 4DR3Q 1PTOC 4J8QA 1IKMA 4LF9Q 1CZWA 5C4XB 3HKZG 3K0XA 5C6AA 3K57A 3SEBA 5C5MA 4QIWB 3DLLA 2F4VL 3TP8A 1I6VC 5IYCH 1N36L 3DEPA 1AN8A 5M5YB 3PIOA 3S1MH 4BY7G 4A3MG 3D6WA 4DV2L 1EQTA 2VQFL 1MJEA 3MXNB 4LUVA 3HOVH 3I4OA 2EXZA 3PUXA 5L37A 2HD3A 4LFAL 4UP9A 1TU2B 3J7AV 1TXYA 3PO3H 2VUMB 3IFDA 4G7ZC 5T1IA 1EY9A 2MPMA 1JE5A 4C3IB 4L6TB 2Z6BA 2JA7H 2MHVA 5ELOA 3TDQA 3RD4A 2EYFA 3B6YA 1X65A 4PNYA 4U68A 3OIPA 4RHSA 2RKSA 3DM1A 4DV4L 1PA6A 5M3MB 1LLRD 1RD9D 4XQNA 4JYAL 3HP3A 3NELA 3S15B 1KXLA 4MIUA 2B8GA 4GKKL 3QIAA 5M9OA 4WJ4A 2E2JB 4XXEA 4BWGB 4HTHA 2Q2TA 5CR3A 1YHAA 3C1FA 5BR8L 5D3IB 2AWNA 1O7YA 2G9HD 5C4JH 2B2TA 3AQQA 3EJIA 4R4CA 4HJ9A 5ISRA 3F2BA 2PW7A 4CJ0B 2A68C 1QZHA 3T1HL 2E5LL 1JQYD 1SNPA 4FF4A 4ZRZA 4JI6Q 3ICEA 3LNNA 3VR5A 4X65L 2CVRA 1IBKQ 1HH2P 1V1PB 1Q81C 2JA5H 4IJLA 4OWWB 1AFPA 1PFMA 1U4RA 3GD7A 3NEMA 4GN4B 2KCCA 2BA1A 2QDLA 3TP6A 3PIP3 4RFBA 3I4NH 3T4AC 1PH3A 4RMFA 4HMJA 2NYZD 4LFCQ 2CFMA 4NPSA 4DXGA 4OO1G 1D1KA 2PZTA 3L9AX 1LV9A 1S4ZA 1EFWA 1RHPA 5LL6S 2IX0A 1MD2D 5IP9G 2B2UC 2HIVA 2M9VA 2D2CC 1HNWL 3TRZA 1SE4A 1B1ZA 1B9MA 1WTOA 2F0DA 2B2TC 1JCKB 1BBXC 4X64Q 1I4RA 1LUZA 1EWIA 3C3LA 2KHSA 5GAGC 3KF6A 4IO9A 3TS2A 3GTGH 1PH4A 3BYTB 1Y1VG 1QOHA 4A3EG 5CV5A 1X3QA 2Z4HA 2VZAA 4YHHQ 5J1ZA 1ZKOA 4PMCA 2BH8A 1WD0A 2KCTA 1RTNA 2AUJD 2MO1A 1C8CA 5F2DA 1Y1WB 1VQIA 2GN5A 4PMBA 2XRSD 1Q8KA 2JK8A 5KIXA 1S5ED 5C0XH 3S2HB 2ASBA 4K5XA 4MNOA 4X62L 4A3MB 1XMOL 5M5XH 2DNEA 3GTJB 1HHVA 5FO8B 5D65A 4F7XA 4IUTA 3KF6B 2WINB 2A68D 2K03A 5EGTA 2PI2E 4EQ5A 5J3BA 1WTVA 1H9SB 3HKZB 3I73A 4GZYC 2JSOA 4DV1L 1ET6A 1PRTD 5BN3A 4A3GG 3S1RH 2EY2A 2H4OA 3UE0A 1HPCA 3MAQA 1ICFB 4UDUC 2X6GA 4YIJA 3SR1A 1DCZA 4ULLA 3J81c 2TMPA 2C9OA 4QIWE 5K5PA 4R8IA 5BR8Q 1VMPA 1N8RC 3E0JA 3D4RA 2IT1A 3DUZA 3BJUA 2R7FA 4GKKQ 4FDBA 2WV6D 1ILQA 3P1HA 2CCZA 4KJOA 3DWPA 3M85A 4DR7L 2L1BA 4A3FH 1X9NA 2KHIA 1SNDA 4LAAA 4KN7C 4XTCS 3H15A 2R93G 1RJTA 4DKAC 1B3AA 4KY6A 1K73C 2NBFA 3NWSA 1O80A 3A74A 4A3BG 2EIFA 1I3QH 2JYOA 1A0IA 4DAMA 2XN9C 3PUVA 2EXDA 1MHWC 1UE1A 1ENAA 2NZOA 5C44H 3S15H 3D0FA 4UY8C 1LT5D 2LXKA 5K36H 1CK1A 2E8GA 3NQIA 5FJ8G 2I46A 1XMQL 3QO2A 4HCEA 4DV6L 3QJYA 1X3GA 3NSWA 3I4NG 1I4XA 1DJRD 2B8FA 2KEDA 3DMUA 1N9WA 1RCVD 2KCMA 2EE1A 2ZJRA 3H0GG 3PUYA 3SHLA 4B3TL 1A8VA 1CT1D 5EAYA 1Q12A 2ALYB 2VL6A 5M5YH 3K5MA 2UUBQ 1U4LA 3EVQA 3U4ZA 4DV4Q 1QJOA 4ME3A 3U58A 4P72A 1KDAA 3NXWA 1UEAB 5ELFA 2HQLA 2WAQE 1GO3E 1JOKA 2EY6A 5DLQE 1QZGA 4GLXA 3VYTA 3CF5A 3S24A 2VB2X 1SROA 4PZ6A 2XRQD 5KGUA 4IUUA 5M3MH 1R9TH 4JI5Q 3I91A 4ALPA 2L9HA 1K28A 3I8ZA 1PH2A 1YITA 1SE2A 4PZ7A 2N55A 2NTTA 1B2TA 1HUMA 1CFMA 1V43A 2J4XA 2PZUA 3HG9A 1IBML 4DK0A 5I6YA 4I7ZC 5IODA 4L63B 4XYQA 4A3DH 1M1KC 2E2IB 5C0XG 2LXJA 1FNWA 3S14H 2R61A 3GTMH 4AYBG 4A3LG 4DR2Q 1PFNA 2QW7A 3S16B 1F2MA 2B2VC 4APVA 1CQFA 2C5CA 4KKTA 1Y14B 4NXML 3K7AH 4CDFC 5CC4A 3CCRA 3GDEA 4ZLTF 3D8GA 1KAWA 1CKNB 1TWCH 2VB3X 4DNIA 3T1YL 2EJGC 5IP7H 3OTOQ 3RNUA 1HNXQ 2A69C 3NWTA 1XNQQ 4FXGC 4TQUS 2JEBI 4ZK9B 4IQZA 3OWEB 1Y1VB 1IHZA 5EPKA 1I4GA 3J80c 3QR8A 4JI0Q 2NTSA 4H44C 1B7YB 4BA1I 2KCNA 4AYBE 4X66Q 1BR9A 4X3UA 2NVXH 5KNCA 1XNRL 1WCMG 1HTLD 3L0OA 2D0PA 4TVAB 3G6JB 1WTPA 5IYDH 3P20A 2JA5G 5C0XI 4O0AA 2RVLA 4A93G 2N78A 2SOBA 2EY1A 4PG3A 2RDFA 1PYSB 4JW0A 3MTSA 3O13A 1GHKA 1PHJA 1K3BC 4X65Q 1HA6A 3D3RA 4UPAA 2D5DA 1CA6A 3NBHA 4C3JH 5HURA 2K5NA 3VYSA 3IAYA 1JWSD 4JBJA 1N33Q 1PV4A 4BBSH 3BS1A 3HOUB 1F9SA 3M4OH 2EYJA 1X3PA 1O7ZA 1RIPA 3TZDA 4KD3A 2N49A 3K0YA 5CGKA 2Q2HA 5C4ZA 5CV4A 5CYUA 2EVBA 1MSHA 3BVZA 1GUTA 4DAYB 1MSGA 1VQGA 4IN3A 2YTYA 2K5HA 5KYIA 1SFOH 3EROA 4NXMQ 3A55A 3IRBA 1I94L 4BXXH 4GLAC 3Q22A 2Y0SB 3J7ZC 1EY7A 1EY8A 1EIHA 1F9RA 1WTRA 4Y52H 3J7YW 1ICWA 3W1GA 3SDZA 1NBWA 3CKIB 4RGOS 2KEEA 2BOSA 4C1NI 4ZAIA 1AE2A 1SYEA 4C56C 2VQFQ 4DPGA 4KD4A 1XMQQ 3G71A 1I4PA 4U673 5IYBG 3AEVA 3BZKA 4Y7NH 3PGZA 3NBHB 2FMCA 3MXGA 5D3DA 1KDBA 1UWVA 4NW2A 5C3EG 1YNXA 1A3VA 4LJZC 3PIPA 2UXBL 2F4VQ 2F0UA 1JB3A 1S3OA 2L0CA 3U9SA 3OMCA 4JI4L 1YZ6A 1Z47A 4N9PA 5FLMG 1ASYA 4C3JG 5C3EH 1PTOB 5C44B 3H3VH 1EOVA 4A3JG 3C2PA 4A3KB 1Q86C 2AKWB 4DAYA 2ENBA 3K58A 1GUWA 5A2QL 4X3KA 1DOLA 2PYKA 2OTJA 4HJ7A 2UUCQ 2IHFA 3M3YH 4A3DB 5IGGA 4OONA 3HKZE 2NZ1D 4UHVA 1TWFH 2A6ED 4L8JA 2CWAA 3HOXG 4B3ML 2K5QA 2QEXA 1SNCA 2B63G 4KV6A 1SYFA 3S16H 2E2HB 4HIDA 1IXRA 3PSIA 4LF5L 1B44D 4L5QA 2NWGA 4IPHA 4DAVA 4BBSG 1F2YA 1W6KA 1QVCA 3PIO3 4DK6C 2F0NA 2F0QA 4LFBL 4LW1A 2F0KA 4O2DA 4ZCKA 5G3LD 4AQYQ 4L5TA 4F88A 3I3CA 3GTOH 5KEEA 3F1ZA 4CJ1B 1TWHH 3S1RB 4GNXC 3H91A 2F0GA 1RTOA 4HEDA 4BA2I 3KLWA 2CQOA 3ND8A 5FO7B 4DA2A 2BCOA 4DV7Q 2YTXA 3HOWH 4OGQC 2VUMH 1WTHA 2NN6I 5I9OA 1PH8A 3IFTA 3HRZC 4HR7B 1L1OB 1GKHA 1OTCA 5IYCG 1A63A 1JC7A 3M9BA 2R92B 3D6CA 1JJ2A 3W3AA 1NE3A 3GTKH 4A3LH 2F03A 4OWXB 4DK3C 3HOVG 2ZTDA 5IE8A 1KL9A 2MJ8A 3UDFA 4BY7H 4G7OC 1B50A 3VDYA 4UAIA 3HOYG 5FLXL 4QJFA 2JA8G 2Z1CA 3F2UA 1EQQA 1VDZA 1UNSA 1ET9A 2F0IA 4M8AA 2XWBB 5M3FG 3BVGA 1BDOA 4LF6Q 3J7A5 1SEBD 4X3SA 1VS0A 1XPOA 3E3XA 2HQEA 2K14A 5COYA 5I2YA 3V96A 1SNQA 3T16A 4BBSB 3UE1A 1P8LA 2Z0SA 3RLOA 2OQKA 4NP5A 1XYIA 3BZDB 2KQ3A 4X66L 1M4VA 2O2LD 1F77A 3S17B 2BE5D 2B63B 5C0XJ 1SXTA 4K0KL 4AIMA 5DM73 1PMRA 4KKSA 2F0LA 4N8X1 4EX5A 3CC4A 4A3DG 1Q1EA 4CGYB 3MZ5A 5DAUA 2CKZB 1YHBA 3NTKA 5IP9H 1TKWB 3OW2A 5CV9A 1Q1BA 4OO1H 4DR5L 1K3RA 1NCVA 1A2TA 4A3KG 2WB1G 2RBMA 1EQRA 3KBXA 3JAMc 1BKBA 4C3JB 5IP7G 5C3WA 1PRTF 3L2PA 4NXNQ 1IW7C 3GTLB 2A69D 1TQOA 4MZ9A 1VQFA 3IL8A 4KLKA 4XIGS 4HIOA 1STAA 2QCPX 1BNZA 1NR4A 2WAQB 5C3EB 3RN5A 1DOKA 3R3OA 4A3BH 3ITPA 4A75A 3R2IA 1AZPA 1H9SA 1EOTA 1HNZQ 2A8VA 1D5MC 2ZXPA 1BVSA 4JV5L 4WRDA 3MEFA 2M00A 4RA8A 2OQ0A 1QB5D 2M2LA 1T9HA 3K7UC 4EQOA 1T5EA 2F0EA 5IGFA 4CJ2C 2CW0C 1ASZA 3FMCA 2UU9Q 1TWFB 3NTIA 1J8IA 3S2DB 4HSPA 2HCIA 1XNRQ 2B39A 3JAME 5TSSA 1VCIA 4K8JA 2LFNA 2VY3A 1HTPA 1E2WA 3TMEA 1E0BA 1EWHA 1SSOA 4K2KA 1OXVA 3MFGA 1QG7A 1A15A 4C2MB 1VQHA 1C7YA 2DGYA 3K81C 3NENA 2KVMA 2ZM6Q 1UE7A
chains in the Genus database with same CATH topology
2ICIA 3GTPB 1HXYD 2KECA 3NTHA 1STNA 2CHBD 2O5JC 1TY0A 1T5XD 4K14A 3U9OA 3M4YA 3HEJA 3ND9A 1GXDC 1G2SA 1SMYC 4A93B 5DNFA 1IYVA 3M3YB 2AQ2B 2IX1A 4K2LA 4TKOB 1TS3A 4HSVA 3M7NA 3DWAA 1LO5D 1HQRD 1ENFA 2F0SA 2IL8A 2G9DA 1LTGD 2WP8J 1WCMB 1DM0B 4WORA 2PPBC 3A8JE 4M1UB 3QOJA 3SVMA 3MC0B 2HDMA 2IW3A 2EPBA 3LWEA 2EOTA 1OXUA 4OIJA 5T1GA 3G7LA 4FXDA 3C46A 1II3A 1LT4D 4KN4C 2RDGA 2NVTB 3C1EA 1PZKD 4IURA 3Q0AA 3X3NA 1O78A 3SE0A 1CQVA 3A56A 1K83B 1E2ZA 5JPMC 2K6AA 3MFYA 1BCPD 2EYHA 3HS0C 1TWGB 2YYZA 1OXXK 5DM63 2GA4B 5ELBA 4JK1C 4AYBB 4WJWA 1MBYA 3UI2A 1DD2A 5KNDA 3DHQA 4Y7NB 3SK8A 5HGTA 3A8KE 3A7AB 5ELDA 2OT2A 1RF2D 2EY5A 3L7ZC 4CHTB 3R93A 4XQJA 3FVQA 1ZEQX 3VR4A 1D5XC 5DEHA 1PTOH 1BCPF 3LWUA 5CMDA 3J80E 5E4XA 1PRTC 3Q24A 3X3MA 2F0JA 5I6WA 5EJWA 3HOVB 3K5LA 4H0LC 2DY8A 3QB3A 4IFDG 1K8OA 4B9WA 2AQ3B 3V05A 2N88A 2A5HA 3TZUA 1PYWD 5EBCA 2O5IC 5A35A 2Q8RE 3I4NB 1WTQA 3OMGA 3RMHA 1O7LA 5KNBA 5JOBA 1V8QA 2J7ZA 4A3IB 4IUNA 3CRKC 1SMYD 2H1EA 4K5VA 2EYMA 4LK1C 1EIGA 3EA6A 4ABNA 1GUGA 2B2WC 3TSSA 1KAAA 1RDPD 4I65A 1NR2A 4EVOA 3HOXB 4PMWA 2TSSA 1SAPA 2NN6G 3OSOA 2RA4A 1VF7A 3SK5A 2SEBD 1PLFA 4QUFA 3ERQA 4A3JB 3GTQB 4LMQD 2B2WA 1PTOF 2LMCB 1VMCA 4RCOA 3VR2A 5M5XB 1S5BD 3K5OA 3Q6SA 2X6LA 2XWJB 2A6EC 4DAPA 2L11A 4KKUA 1IYUA 3BDLA 3KLSA 1HFGA 2K5DA 2QKIC 1YNJD 2KOLA 1U9RA 1B9NA 2VNUD 4TRDA 1F9PA 1BXTA 1AZQA 1D1IA 1EU3A 1EY5A 2PNRC 1L0XB 3BDCA 3KBGA 2L4NA 5CBAE 4DK1A 1ONLA 3GV3A 3WOFA 2LKVA 3AB9A 4KY5A 5I2XA 3IKJA 1LTBD 3T56B 1BQQT 1KLGD 1EZ8A 5JJZA 3BG3A 1YNJC 2R7ZB 4IALA 5D14A 2EJFC 2KUMA 1F9QA 1HA5A 4RH6A 2JEAI 1BO0A 1Y8PB 1SDFA 3MXNA 1DOMA 4DNRB 1EY6A 2HUGA 4C3HG 2JA5B 1TS5A 3BDOA 3QOLA 2ID0A 2K5WA 1SYDA 2FJ2A 1ZYRD 3OHXC 1MGSA 1CI3M 4V190 4C3HB 3NK9A 2ICEC 2BE5C 4KTAA 1BUVT 5LL6X 1HUNA 1IW7D 1FR3A 1FD7D 2WIIB 2F0OA 1YNNC 4DFAA 2WKCA 3W2DA 1ESFA 1ZYRC 5JEAJ 2NN6H 1I4HA 1FNVA 2YU9B 4C3IG 4DN4M 1SJHD 2F4IA 2PO4A 4Q0FA 1G8ZD 5EBDA 1W6JA 1A3TA 2PMZB 3DXJC 3NHHA 2ZXOA 1G91A 5IGCA 5CBEE 2D9UA 2A74C 2F0TA 4E6IA 3MHBA 3S1MB 5EKLA 4ZKBB 2F0FA 2K05A 1SNOA 1SNMA 3PO3B 2CW0D 3WOEA 2FFKB 1CZGA 2K32A 2BDNA 4ZKCB 1OXTA 5BN4A 4BBRB 3K7AB 3H0GB 3NP8A 5EKKA 1HRJA 3VA7A 1ML0D 2MUYA 3N6RA 5ELCA 4NKLA 1I4QA 5E4WC 3QG1A 5G3LF 2QILA 3FRPB 3H3VC 2PW5A 3NE5B 4X3TA 1S5CD 4QMGA 2DNCA 5A2QE 1EFID 3HOZB 5I4DA 2LY7A 4OO1I 4A3BB 1XTCD 4MN3A 3T51B 2A6HC 1I6HB 1QE6A 3PUZA 2R93B 1TIID 1ZXTA 2NUCA 2CQAA 4CKCA 3PO2B 3CQZB 4IFDJ 2NVYB 1WD1A 1A6XA 4KHZA 1PZJD 1QWYA 1G291 1NSNS 1V1OA 1STEA 4ZQ3A 1CTMA 4ME5A 3A8IE 3R8BA 1QNKA 1J9OA 5IOCA 2XVSA 1BCPB 1H9JA 4JBWA 1R9TB 4KK7A 2JXMB 1JWUD 4EQNA 2SDFA 4A3GB 2JE6I 3A7LA 5K36G 3KUPA 1KTKA 4XT3B 1H9RA 2WKDA 3CU7A 4H7BA 1EZ6A 1S5DD 2K1BA 3HGBA 3LX0A 4O42A 4FYDA 1R4PB 4BY1B 1G6ZA 3QWNA 4KI0A 1UAPA 3RUZA 5ELEA 2HCCA 3GQBA 3S14B 2E74C 1EYAA 2RDHA 2K01A 3URYA 3OPOA 1X32A 1QNUA 1EEFD 4R8NA 5E1FA 4HAEA 4N9TA 1OO9B 3VYRA 3MXPA 3M7GA 1D6EC 1TVXA 3CRLC 2OEOA 4S3SA 4XQQA 1C48A 3TN2A 2A6HD 1M8AA 4A3EB 1SYGA 3KLRA 3PUWA 3K59A 2IX3A 2NVXB 2PCFB 4RGMA 3J81E 3R2TA 1D5ZC 5FKAC 2F3WA 4FF1A 5KRUA 4K8IA 2L5TA 1JORA 4G57A 1Z7TA 2BDOA 1PFBA 3PMFA 3TP5A 5NUCA 5JAVA 2O4XA 4OHJA 3P7JA 2XNAC 1GUSA 3K5NA 3WDNA 4IFDH 3ZYYX 1BCPC 2EYOA 3T53B 1PRTB 1LTTD 3I90A 2F0WA 4RKBA 1CHQD 1FYCA 1PXUA 4PV1C 5IT9E 1LT3D 1GUNA 1KABA 2V4DA 5IIFA 3MA2B 2R3ZA 4V0BA 1AW7A 2RSNA 3M4OB 4HN7A 3Q23A 2VXWA 3AU7A 4H13C 3P75A 1IKLA 1JOOA 1SFOB 3GTMB 3EQLC 1H9MA 4KMUC 4BY7B 4IFDI 2F0VA 2RSOA 3ONAB 1KNAA 1DZ1A 2MP1A 3H6MA 1EYDA 1STHA 1XXGA 1TS4A 5EPLA 3I72A 2DN8A 1LTSD 4KY7A 1I50B 2JP1A 2EYPA 3JAML 3J80L 1IL8A 3S9WA 1D2BA 2RQXA 1Q90A 1B53A 1FGBD 1PDQA 5EKIA 2WB1B 1OXSC 4IUVA 4RCNA 2X69A 1LABA 1DYQA 4CBVA 4FVMA 2F0MA 1MI2A 4B08A 1HQMC 1B4OA 1TWCB 2OXPA 1TT2A 5CORA 1BOSA 4WFN3 1LTAD 1EL0A 4QF4A 1TS2A 1UUPA 3S1NB 4QB4A 4XDXA 5IGBA 1Y8NB 2Z4IA 4DNTB 1F2ZA 2IJ0A 5FK9C 2NB0A 1JR0D 1DXMA 4R9WA 3FDTA 1V1PA 2K7VA 2K04A 2F3VA 5M3FB 3VR3A 4P2CB 4QUCA 1ESRA 3I4LA 5JVH3 2IPKD 1TWHB 4DF7A 1C4QA 5EPJA 3VYUA 3SXHA 1STBA 3SK6A 3H94A 4IUQA 1E2VA 2F1MA 1K8MA 3BYYB 5CV7A 2ZT9C 1GUOA 3GTKB 2JA6B 4DGZA 1ILPA 1LACA 1Q3LA 4Q5VA 1KDCA 1TWAB 1F2LA 3OIQA 4K6LA 2AQ1B 2FMMA 1LTRD 5CV6A 4B9XA 3D4WA 2AWOA 5I9PA 3DEOA 2PZWA 2XIWA 1LT6D 5LHY1 3N52A 1JOQA 1Z6HA 4FF2A 3MWYW 1KLUD 3FKIB 1EEID 1VF5C 1HCZA 2SNSA 5FLXE 2IWHA 3FPPA 3SK4A 4FNFA 4HMIA 1PTOD 3FEWX 1S5FD 4Z9CB 2EDGA 3OWFA 4PQXA 1JICA 2OF1A 4K5WA 1BF4A 2B2UA 3PV0A 3GP7A 4NMZA 4ILWA 1U4PA 2Q8IB 5JEAH 1STGA 3CHBD 4O1NA 2XSCA 1HFNA 1AEXA 2Z8LA 5M5WB 2K28A 3HOWB 1SYBA 4RGTA 2EZVA 1CA5A 4KHVA 1WTXA 3OOCA 4J6HA 5C5LA 1STYA 4G7HC 4TSSA 3GTOB 4EGVA 2K33A 2L12A 4ZUIA 3DWQA 4IUPA 1JWMD 2E76C 3T13A 5JEAG 1EY4A 5C3XA 4F87A 2L55A 3K6OA 3NPPA 5J22A 4RHRA 2F0PA 2LS01 2J0TD 3RZOB 2WACA 4FP5D 3TP7A 1A3UA 4MHEA 1Y8OB 3J81L 3D4DA 1FNUA 1KNEA 1L0YB 3A54A 3VR6A 1NUCA 4F8MA 4ZYSA 4NDXA 4RWSC 3EFXD 1EY0A 4ZUJA 3H09A 2FHTA 3E6ZX 3KLSX 1AP0A 4J1MA 2B2YC 3NBIA 2KA7A 5C4JB 5C4HA 1XX8A 3GV6A 3MEHA 1TY2A 2BA0A 3V2TA 3KF8A 1XWEA 2D62A 1I3QB 3NQTA 1EYCA 2QEJC 1QILA 3FPUB 4BS9A 3HZXA 5JPNC 2JA7B 4KJNA 4A3FB 1Y69U 1U4MA 2B2YA 2E75C 3BVMA 2HDLA 2QF7A 2FINB 5FOBB 4OIKA 1SJED 3RLFA 3GTGB 5EQ0A 5J39A 2E2DC 5FO9B 1SYCA 4XYOA 5BN5A 2AUKA 4K6DA 2DY7A 2Q8TA 4OL7A 1Q8IA 1DONA 1WVLA 4ODGA 2JA8B 3HOYB 5IT9L 4FF3A 1TR5A 2PQEA 3I4MB 2KJXA 3D31A 4DXFA 1WTWA 1G2TA 4DU9A 4CKEA 2EYLA 1H9KA 3E5SA 4FO2A 3OW7A 4RAUC 1SBBB 1R4QB 5E3FA 3AMUA 3VA5A 2R6GA 4QCLA 1GJXA 1YNND 3NUCA 1JE4A 5IGDA 1SE3A 2B2VA 5IGEA 3RZDB 1EWCA 5CV8A 4RKLA 2I07B 3S1QB 1A2UA 2NVQB 1CHPD 4EQPA 4IZ8A 1PZID 3I70A 4ID6A 4C1NK 3MVVA 2SNMA 4CKBA 3J7AF 1RODA 2ZXRA 2EJMA 2QDBA 1ENCA 1EQVA 2F0HA 1LTID 2A73B 3GO5A 3L3OC 1GOZA 1RKNA 3MXUA 2MGSA 3TBIB 1CM9A 5JVG3 4XT1B 1GHJA 1EU4A 5KYLA 4G4KA 1NAPA 4FXKC 1QCBD 5AFWA 3KK7A 4RGNA 4HCSA 1PTOC 4J8QA 1IKMA 1CZWA 5C4XB 5C6AA 3K57A 3SEBA 5C5MA 4QIWB 3TP8A 1I6VC 3DEPA 1AN8A 5M5YB 3D6WA 1EQTA 2EXZA 3PUXA 1TU2B 3J7AV 2VUMB 3IFDA 4G7ZC 5T1IA 1EY9A 2MPMA 4C3IB 4L6TB 2MHVA 3TDQA 3RD4A 2EYFA 4PNYA 4U68A 3OIPA 4RHSA 2RKSA 3DM1A 5M3MB 1LLRD 1RD9D 4XQNA 3HP3A 3S15B 4MIUA 2B8GA 5M9OA 3QIAA 2E2JB 4XXEA 4BWGB 4HTHA 5CR3A 3C1FA 5D3IB 2AWNA 1O7YA 2G9HD 2B2TA 3EJIA 5ISRA 2PW7A 4CJ0B 2A68C 1JQYD 4FF4A 1SNPA 4ZRZA 3LNNA 3VR5A 2CVRA 1V1PB 1AFPA 1PFMA 1U4RA 3GD7A 2KCCA 2BA1A 3PIP3 3TP6A 4RFBA 3T4AC 4HMJA 2NYZD 4DXGA 4OO1G 1D1KA 2PZTA 3L9AX 1LV9A 1S4ZA 1RHPA 5LL6S 2IX0A 1MD2D 2B2UC 2M9VA 2D2CC 1SE4A 1B1ZA 1B9MA 1WTOA 2F0DA 2B2TC 1JCKB 1BBXC 1I4RA 3C3LA 2KHSA 3BYTB 1QOHA 5CV5A 1X3QA 2Z4HA 5J1ZA 1ZKOA 4PMCA 1WD0A 1RTNA 2AUJD 1C8CA 5F2DA 1Y1WB 4PMBA 2XRSD 5KIXA 1S5ED 5C0XH 3S2HB 4K5XA 4A3MB 2DNEA 3GTJB 1HHVA 5FO8B 5D65A 4F7XA 4IUTA 2WINB 2A68D 2K03A 5EGTA 1WTVA 1H9SB 3HKZB 3I73A 4GZYC 2JSOA 1ET6A 1PRTD 5BN3A 2EY2A 2H4OA 1HPCA 3MAQA 4UDUC 2X6GA 4YIJA 3SR1A 1DCZA 4ULLA 2TMPA 2C9OA 5K5PA 4R8IA 1VMPA 3E0JA 3D4RA 2IT1A 3DUZA 2WV6D 1ILQA 3P1HA 4KJOA 3DWPA 3M85A 2L1BA 1SNDA 4LAAA 4KN7C 4XTCS 1RJTA 1B3AA 4KY6A 2NBFA 3NWSA 1O80A 2JYOA 2XN9C 3PUVA 1ENAA 1LT5D 5K36H 1CK1A 3NQIA 2I46A 3QO2A 4HCEA 3QJYA 3NSWA 1I4XA 1DJRD 2B8FA 2KEDA 3DMUA 1RCVD 2EE1A 3PUYA 3SHLA 1CT1D 1Q12A 3K5MA 1U4LA 3EVQA 1QJOA 1KDAA 3NXWA 1UEAB 5ELFA 1JOKA 2EY6A 3VYTA 2VB2X 2XRQD 5KGUA 4IUUA 3I91A 2L9HA 3I8ZA 1SE2A 2N55A 2NTTA 1B2TA 1HUMA 1CFMA 1V43A 2J4XA 2PZUA 3HG9A 4DK0A 5I6YA 4I7ZC 5IODA 4L63B 4XYQA 2E2IB 5C0XG 1FNWA 2R61A 1PFNA 3S16B 1F2MA 2B2VC 1CQFA 2C5CA 4KKTA 5CC4A 4ZLTF 3D8GA 2VB3X 2EJGC 2A69C 3NWTA 4FXGC 4TQUS 2JEBI 4ZK9B 4IQZA 3OWEB 1Y1VB 1IHZA 5EPKA 1I4GA 2NTSA 4H44C 4BA1I 2KCNA 1BR9A 4X3UA 5KNCA 1HTLD 3G6JB 1WTPA 3P20A 5C0XI 2RVLA 2SOBA 2EY1A 2RDFA 3MTSA 3O13A 1GHKA 1HA6A 3D3RA 2D5DA 1CA6A 3NBHA 5HURA 3VYSA 3IAYA 1JWSD 3BS1A 3HOUB 1F9SA 2EYJA 1X3PA 1O7ZA 3TZDA 4KD3A 3K0YA 5CGKA 5C4ZA 5CV4A 5CYUA 2EVBA 1MSHA 3BVZA 1GUTA 1MSGA 4IN3A 5KYIA 3EROA 3A55A 3Q22A 2Y0SB 1EY7A 1EY8A 1EIHA 1F9RA 1WTRA 3J7YW 1ICWA 3SDZA 3CKIB 4RGOS 2KEEA 2BOSA 4C1NI 4ZAIA 1SYEA 4C56C 4KD4A 1I4PA 4U673 2FMCA 3MXGA 5D3DA 1KDBA 4NW2A 1A3VA 4LJZC 2F0UA 1JB3A 3U9SA 2L0CA 3OMCA 1Z47A 4N9PA 4C3JG 1PTOB 5C44B 3C2PA 4A3KB 4DAYA 2ENBA 3K58A 1GUWA 5A2QL 4X3KA 1DOLA 2PYKA 4A3DB 5IGGA 2NZ1D 2A6ED 4L8JA 2K5QA 1SNCA 4KV6A 1SYFA 2E2HB 1B44D 2NWGA 4DAVA 1F2YA 1W6KA 3PIO3 2F0NA 2F0QA 2F0KA 5G3LD 4F88A 3I3CA 5KEEA 4CJ1B 3S1RB 3H91A 2F0GA 1RTOA 4HEDA 4BA2I 3ND8A 5FO7B 4DA2A 2BCOA 4OGQC 2NN6I 5I9OA 3IFTA 3HRZC 4HR7B 1JC7A 2R92B 3D6CA 3W3AA 2F03A 2MJ8A 4G7OC 1B50A 4UAIA 5FLXL 2Z1CA 3F2UA 1VDZA 1UNSA 1ET9A 2F0IA 4M8AA 2XWBB 3BVGA 1BDOA 1SEBD 4X3SA 2HQEA 5COYA 5I2YA 3V96A 1SNQA 3T16A 4BBSB 4NP5A 1XYIA 3BZDB 2KQ3A 1M4VA 2O2LD 1F77A 3S17B 2BE5D 2B63B 5C0XJ 1SXTA 5DM73 1PMRA 4KKSA 2F0LA 1Q1EA 4CGYB 3MZ5A 5DAUA 3NTKA 1TKWB 5CV9A 1Q1BA 4OO1H 1NCVA 1A2TA 2RBMA 3KBXA 4C3JB 5C3WA 1PRTF 1IW7C 3GTLB 2A69D 1TQOA 3IL8A 4XIGS 1STAA 2QCPX 1BNZA 1NR4A 2WAQB 5C3EB 1DOKA 3R3OA 3ITPA 3R2IA 1AZPA 1H9SA 1EOTA 1D5MC 2ZXPA 4WRDA 2M00A 4RA8A 1QB5D 2M2LA 4EQOA 1T5EA 2F0EA 5IGFA 4CJ2C 2CW0C 3FMCA 1TWFB 3NTIA 1J8IA 3S2DB 4HSPA 2HCIA 2B39A 3JAME 5TSSA 1VCIA 4K8JA 2LFNA 1HTPA 1E2WA 3TMEA 1E0BA 1EWHA 1SSOA 4K2KA 1OXVA 3MFGA 1QG7A 1A15A 4C2MB 2KVMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B53 A;  3Q6S A;  5COY A;  2X6L A;  1PDQ A;  2KEC A;  1DON A;  5EKI A;  3DEO A;  1WVL A;  4IUV A;  4MN3 A;  2L11 A;  2X69 A;  4X3U A;  3QO2 A;  2XIW A;  1GUW A;  1QE6 A;  5CMD A;  4X3K A;  1DOL A;  1WD0 A;  1HFG A;  5E4X A;  1RTN A;  3DEP A;  2KED A;  1C8C A;  3N52 A;  2EE1 A;  5EJW A;  1MI2 A;  2KOL A;  1XYI A;  4MHE A;  1B4O A;  3D6W A;  1G2S A;  1EQT A;  1ZXT A;  2DY8 A;  3MWY W;  1WTW A;  1WTP A;  1F9P A;  4DN4 M;  1G2T A;  2NZ1 D;  1KNE A;  5DNF A;  1U4L A;  5COR A;  1AZQ A;  1PFB A;  3IFD A;  1WD1 A;  5T1I A;  2MPM A;  3P7J A;  2RVL A;  1EL0 A;  4RWS C;  4HSV A;  2N88 A;  4XDX A;  3MTS A;  4RAU C;  2L4N A;  5CBA E;  4U68 A;  1HHV A;  3I90 A;  2IL8 A;  5D65 A;  2NWG A;  1QNK A;  1J9O A;  3DM1 A;  2Q8R E;  3GV3 A;  4IUT A;  1G91 A;  2FHT A;  1WTQ A;  1HA6 A;  3HP3 A;  1CA6 A;  1JE4 A;  1NCV A;  5CBE E;  1AP0 A;  2K03 A;  2SDF A;  4IUU A;  2B2V A;  2D9U A;  3I91 A;  1JIC A;  3SVM A;  2L9H A;  3KBX A;  1WTV A;  2HDM A;  3I8Z A;  2EPB A;  2B2Y C;  3FDT A;  3KUP A;  3LWE A;  2EOT A;  4R9W A;  2N55 A;  1B2T A;  1BF4 A;  5JJZ A;  2B2U A;  4OIJ A;  5T1G A;  4ZKB B;  1F9S A;  1XX8 A;  3G7L A;  1HUM A;  2J7Z A;  2K04 A;  4XT3 B;  3GV6 A;  3I3C A;  2K05 A;  2R3Z A;  1X3P A;  1O7Z A;  1O7Y A;  3TZD A;  3IL8 A;  4CJ1 B;  2B2T A;  2H1E A;  2RSN A;  1U4P A;  1NR4 A;  2X6G A;  3H91 A;  5D14 A;  1BNZ A;  2KUM A;  1RTO A;  1DOK A;  1ESR A;  4HED A;  4QUC A;  1EIG A;  2K1B A;  1F9Q A;  4CJ0 B;  4O42 A;  1BO0 A;  1MSH A;  4IUR A;  5EPJ A;  2FFK B;  1AZP A;  1G6Z A;  2B2W C;  2VXW A;  1MSG A;  2CVR A;  1EOT A;  1SDF A;  1ROD A;  4R8I A;  1PFM A;  1VMP A;  1DOM A;  1HFN A;  1NR2 A;  2K28 A;  1U4R A;  3FPU B;  1IKL A;  1PFN A;  2HUG A;  2HCC A;  4IUQ A;  1SAP A;  4RA8 A;  2FJ2 A;  2NYZ D;  2BDN A;  1EIH A;  1ILQ A;  1F9R A;  2K01 A;  2M2L A;  4ZKC B;  2B2V C;  1X32 A;  1WTR A;  2RA4 A;  1ICW A;  1CA5 A;  1S4Z A;  1LV9 A;  1MGS A;  1RHP A;  4HAE A;  1U4M A;  2L1B A;  2MGS A;  2KEE A;  2B2Y A;  4CJ2 C;  1CM9 A;  4XT1 B;  4ZAI A;  2RSO A;  1WTX A;  3ONA B;  1HRJ A;  1J8I A;  2B2U C;  1KNA A;  2HDL A;  2MJ8 A;  1ML0 D;  2HCI A;  1RJT A;  1PLF A;  4ZLT F;  1B50 A;  1DZ1 A;  1NAP A;  2MP1 A;  3UI2 A;  4QUF A;  5E4W C;  1B3A A;  1TVX A;  2FIN B;  4UAI A;  2B2T C;  1WTO A;  1BBX C;  4OIK A;  2L12 A;  5EPL A;  3F2U A;  1HUN A;  1E0B A;  1SSO A;  5EQ0 A;  3TN2 A;  4NW2 A;  4IUP A;  1O80 A;  1M8A A;  5AFW A;  1ILP A;  4LMQ D;  4X3T A;  1QG7 A;  1A15 A;  1Q3L A;  4HCS A;  2B2W A;  2JYO A;  4ZK9 B;  1VMC A;  2JP1 A;  1IL8 A;  2KVM A;  1IKM A;  1F2L A;  3R93 A;  4X3S A;  2DY7 A;  5EPK A;  2FMM A;  1X3Q A;  2Q8T A; 
#chains in the Genus database with same CATH topology
 2ICI A;  3GTP B;  1HXY D;  2KEC A;  3NTH A;  1STN A;  2CHB D;  2O5J C;  1JB7 A;  1TY0 A;  2GVB A;  1T5X D;  1X56 A;  4K14 A;  5GRO A;  3U9O A;  3M4Y A;  3HEJ A;  3ND9 A;  1EUJ A;  1GXD C;  1G2S A;  4BY1 H;  1SMY C;  2Z6K C;  4L5R C;  4A93 B;  1VQM A;  1GD7 A;  3JAM i;  5DNF A;  1IYV A;  3M3Y B;  2AQ2 B;  1EIY B;  2IX1 A;  4K2L A;  4TKO B;  1HZ9 A;  1TS3 A;  4HSV A;  3M7N A;  3DWA A;  1LO5 D;  1HQR D;  1ENF A;  2F0S A;  2IL8 A;  3T1H Q;  2G9D A;  2RHQ B;  2E5L Q;  1LTG D;  5HY6 A;  2WP8 J;  4JI0 L;  1XTD A;  1WCM B;  1DM0 B;  4WOR A;  2PPB C;  2QGQ A;  3A8J E;  4M1U B;  3QOJ A;  1VQ4 A;  1VQC A;  4CDD C;  3SVM A;  3MC0 B;  2HDM A;  2IW3 A;  2EPB A;  3LWE A;  4LF9 L;  2EOT A;  1OXU A;  1DGS A;  4OIJ A;  5T1G A;  1VQK A;  3G7L A;  4FXD A;  1G51 A;  1HNX L;  3Q8D A;  3C46 A;  3FKI H;  1II3 A;  1LT4 D;  3K8A A;  4KN4 C;  2RDG A;  2OCE A;  4JI1 Q;  2NVT B;  3HKS A;  3C1E A;  3M4Q A;  1PZK D;  4IUR A;  3Q0A A;  3X3N A;  1O78 A;  2KHJ A;  1CQV A;  3SE0 A;  3CCQ A;  3A56 A;  1K83 B;  1E2Z A;  5JPM C;  2K6A A;  3MFY A;  1BCP D;  3I56 A;  4DV5 Q;  2EYH A;  3HS0 C;  2I5M X;  4JI8 L;  3H0G H;  4R1J A;  1YEZ A;  1I6H H;  1TWG B;  2YYZ A;  1OXX K;  5DM6 3;  2GA4 B;  5ELB A;  4JK1 C;  4AYB B;  4WJW A;  2Q2I A;  4DV6 Q;  1MBY A;  2QA4 A;  3HOU H;  3UI2 A;  3PF4 A;  1DD2 A;  5KND A;  1M90 C;  3DHQ A;  2A1A A;  3UDG A;  3CQZ H;  1GM5 A;  4Y7N B;  3SK8 A;  5HGT A;  3A8K E;  3A7A B;  1VQA A;  1E3P A;  4A76 A;  3BU2 A;  1YVC A;  5ELD A;  2OT2 A;  1RF2 D;  2EY5 A;  3L7Z C;  4CHT B;  3R93 A;  4XQJ A;  3PF5 A;  1CKN A;  1HR0 W;  3FVQ A;  1ZEQ X;  5IWA L;  1KD1 C;  3VR4 A;  3CC7 A;  1D5X C;  5DEH A;  3J81 i;  1PTO H;  1BCP F;  2HT1 A;  2V1C C;  3LWU A;  4H02 A;  5CMD A;  4A3G H;  3T1Y Q;  4B3M Q;  3J80 E;  5E4X A;  1MJC A;  1PRT C;  1UE5 A;  3AFP A;  3Q24 A;  2YU9 H;  4DR7 Q;  1UEB A;  3X3M A;  2F0J A;  2ZM6 L;  5I6W A;  5EJW A;  3HOV B;  3K5L A;  2I5H A;  1N32 L;  4H0L C;  3K80 C;  2DY8 A;  3QB3 A;  3I4M H;  4JI7 L;  4IFD G;  4POG A;  1K8O A;  4B9W A;  2XGT A;  2AQ3 B;  4GNX A;  3V05 A;  2N88 A;  2A5H A;  3TZU A;  1CSP A;  1PYW D;  1X3E A;  5EBC A;  2O5I C;  4BXX G;  4X6A H;  5A35 A;  2Q8R E;  3I4N B;  1WTQ A;  2K5V A;  4LF8 Q;  3TQY A;  3OMG A;  3RMH A;  1VQ8 A;  4OX9 Q;  4LF6 L;  4A3C G;  1O7L A;  5KNB A;  5JOB A;  1V8Q A;  2J7Z A;  4A3I B;  4IUN A;  2DJG C;  3CRK C;  3OYY A;  1SMY D;  2H1E A;  3CME A;  1IBL L;  4K5V A;  2EYM A;  4LK1 C;  1JJC B;  1EIG A;  3EA6 A;  2UUA L;  3CCU A;  1PVO A;  3RN2 A;  4ABN A;  4OEL B;  1GUG A;  2B2W C;  3TSS A;  4DV0 L;  4DV3 L;  1KAA A;  1RDP D;  2HHH Q;  4I65 A;  1NR2 A;  4EVO A;  1VQE A;  3HOX B;  5GAD C;  2ES2 A;  4PMW A;  2TSS A;  1SAP A;  4GN3 B;  4JI3 Q;  1HR0 Q;  4BBR G;  4JVZ A;  1VQ5 A;  2NN6 G;  3OSO A;  2RA4 A;  1VF7 A;  1X3F A;  3SK5 A;  2SEB D;  1PLF A;  4QUF A;  3ERQ A;  1K8G A;  1N33 L;  4A3J B;  4GS3 A;  4LF7 L;  3GTQ B;  1E1T A;  4YWK A;  3ULL A;  1XNQ L;  4LMQ D;  2B2W A;  1PTO F;  2LMC B;  2MO0 A;  1VMC A;  4RCO A;  3VR2 A;  5M5X B;  1S5B D;  3K5O A;  4LUO A;  3Q6S A;  2X6L A;  2XWJ B;  2A6E C;  4HJ5 A;  4DAP A;  2R92 H;  2L11 A;  4KKU A;  1L0W A;  1IYU A;  3BDL A;  3KLS A;  1A62 A;  1HFG A;  2K5D A;  4HJA A;  1B70 B;  2QKI C;  1YNJ D;  2UXD L;  2KOL A;  3PO2 H;  5JJL A;  1U9R A;  3ULJ A;  3TS0 A;  4IPG A;  1B9N A;  2VNU D;  4TRD A;  1F9P A;  1HZA A;  1BXT A;  1AZQ A;  1D1I A;  1K9M C;  4IPD A;  1EU3 A;  1EY5 A;  1IBK L;  2PNR C;  3H3V I;  1B3Q A;  1L0X B;  3BDC A;  3GTJ H;  2GVA A;  3KBG A;  1TWG H;  2L4N A;  3CPF A;  5CBA E;  4UP8 A;  4DK1 A;  1ONL A;  2UXC L;  3GV3 A;  3WOF A;  2LKV A;  3AB9 A;  4KY5 A;  5I2X A;  3E9H A;  1U5K A;  3IKJ A;  2JA6 H;  2D0O A;  1LTB D;  3T56 B;  1BQQ T;  1KLG D;  4YY3 Q;  1YIJ A;  1EZ8 A;  3AYH B;  5JJZ A;  4A3K H;  1JJG A;  1C9O A;  2JQO A;  3BG3 A;  1YNJ C;  2R7Z B;  1J5E L;  4IAL A;  4YCV A;  2DJF C;  5D14 A;  1Q46 A;  2EJF C;  2KUM A;  1IBL Q;  1F9Q A;  1HA5 A;  4RH6 A;  2JEA I;  1BO0 A;  3HFZ B;  1I50 H;  1Y8P B;  4B3T Q;  1SDF A;  3MXN A;  1DOM A;  4X62 Q;  3EIV A;  4DNR B;  5GAE C;  4N8F A;  1EY6 A;  2HUG A;  4C3H G;  2JA5 B;  1TS5 A;  3BDO A;  2JJQ A;  3QOL A;  2ID0 A;  2K5W A;  1SYD A;  4DR6 Q;  2N3S A;  2FJ2 A;  1ZYR D;  3OHX C;  3U50 C;  1MGS A;  1CI3 M;  1SMX A;  4V19 0;  4C3H B;  3NK9 A;  1IBM Q;  2ICE C;  2BE5 C;  4KTA A;  1VQP A;  1BUV T;  3E0E A;  5LL6 X;  4B3R L;  1HUN A;  2Z6K A;  1IW7 D;  1LTL A;  1KHI A;  1JT8 A;  1FR3 A;  2NZH A;  1FD7 D;  1YHQ A;  2WII B;  4JI7 Q;  5AJ3 Q;  2R7Z G;  2F0O A;  3CCS A;  4JI8 Q;  2Q2U A;  1YNN C;  4DFA A;  1Q82 C;  2WKC A;  2P5Z X;  3ERS X;  3W2D A;  1ESF A;  5M3M G;  1Y1W H;  1ZYR C;  5JEA J;  5IWA Q;  2NN6 H;  1I4H A;  1IZ6 A;  1S40 A;  1FNV A;  2YU9 B;  3ULP A;  4C3I G;  1VQD A;  1E22 A;  4DN4 M;  1SJH D;  1CKO A;  2VUM G;  3RR5 A;  2F4I A;  2PO4 A;  3S1N H;  4Q0F A;  1G8Z D;  5EBD A;  2K52 A;  1W6J A;  1A3T A;  4BY1 G;  5C4X H;  2PMZ B;  3DXJ C;  3NHH A;  2ZXO A;  2KBN A;  1I5F A;  3GTP H;  1G91 A;  2PNH A;  5IGC A;  1N34 Q;  5H1S E;  1XJV A;  5CBE E;  2D9U A;  4JG2 A;  2A74 C;  5FLX c;  2F0T A;  3GTQ H;  4E6I A;  3MHB A;  3S1M B;  5EKL A;  4ZKB B;  5M3F H;  2F0F A;  2K05 A;  1SNO A;  1SNM A;  4DV5 L;  3PO3 B;  3PCO B;  1VQO A;  1KQS A;  2CW0 D;  3WOE A;  2FFK B;  4YHH L;  1CZG A;  2K32 A;  2BDN A;  4ZKC B;  1OXT A;  5BN4 A;  4BBR B;  4GOP A;  3K7A B;  3H0G B;  3NP8 A;  5EKK A;  1HRJ A;  3VA7 A;  1ML0 D;  2MUY A;  3N6R A;  4YWL A;  4IOC A;  5ELC A;  4NKL A;  4IJH A;  1I4Q A;  1WOC A;  5E4W C;  4B3R Q;  3QG1 A;  5G3L F;  2QIL A;  3FRP B;  1P16 A;  3KJO A;  2UU9 L;  3H3V C;  2PW5 A;  3NE5 B;  4X3T A;  1S5C D;  4QMG A;  2DNC A;  3HOZ G;  1FVI A;  5A2Q E;  4JI5 L;  1EFI D;  1YJW A;  3HOZ B;  1D8L A;  5I4D A;  2LY7 A;  4OO1 I;  4A3B B;  1XTC D;  4JV5 Q;  3W1B A;  1XPR A;  4MN3 A;  2N8N A;  3KDF B;  2PI2 A;  3T51 B;  2A6H C;  1I6H B;  1QE6 A;  3PUZ A;  4DUZ Q;  2R93 B;  1TII D;  4OWT B;  1J5E Q;  1ZXT A;  2NUC A;  4A4I A;  2CQA A;  4CKC A;  3PO2 B;  4P73 A;  3CQZ B;  4IFD J;  2NVY B;  1WD1 A;  1A6X A;  4KHZ A;  1KRT A;  1PZJ D;  1QWY A;  1G29 1;  2YTV A;  1NSN S;  1V1O A;  1STE A;  4ZQ3 A;  1CTM A;  3I4M G;  1U0L A;  4ME5 A;  3A8I E;  3R8B A;  1NY4 A;  1QNK A;  1J9O A;  4P74 A;  2G5D A;  5IOC A;  2XVS A;  1BCP B;  1H9J A;  4JBW A;  4QGU A;  4KK7 A;  2JXM B;  1R9T B;  1JWU D;  2YV5 A;  4EQN A;  2SDF A;  1WYD A;  4A3G B;  4JCV E;  2JE6 I;  3A7L A;  1E24 A;  5K36 G;  3KUP A;  4K0K Q;  5IT9 c;  4JI2 L;  1O7I A;  1KTK A;  4P75 A;  4B3S L;  4XT3 B;  1AH9 A;  1H9R A;  2WKD A;  2CH4 A;  3CU7 A;  4H7B A;  1NNX A;  1EIF A;  4GKJ L;  1EZ6 A;  1S5D D;  4LFA Q;  2K1B A;  3HGB A;  3LX0 A;  1X55 A;  3CMA A;  4O42 A;  4FYD A;  1R4P B;  4BY1 B;  4DR1 Q;  3QWN A;  1G6Z A;  4KI0 A;  4A93 H;  1IL2 A;  1UAP A;  3CAM A;  4P71 A;  1W2B A;  2VQE L;  3RUZ A;  2E2I H;  5ELE A;  2HCC A;  1HJP A;  1YI2 A;  1PH1 A;  3GQB A;  3S14 B;  2E74 C;  1CUK A;  1EYA A;  2RDH A;  4LF7 Q;  2K01 A;  3URY A;  3OPO A;  1X32 A;  1QNU A;  1EEF D;  1Y1W G;  4R8N A;  5E1F A;  4HAE A;  4N9T A;  1OO9 B;  3VYR A;  2IY5 B;  3MXP A;  1VQ6 A;  3KDF A;  3M7G A;  1D6E C;  1TVX A;  1RL2 A;  3CRL C;  3E9I A;  1HR0 L;  1MIU A;  2OEO A;  4S3S A;  4XQQ A;  1C48 A;  2JN4 A;  3TN2 A;  1PH9 A;  2A6H D;  1TWA H;  1M8A A;  4A3E B;  1SYG A;  5GAH C;  3I55 A;  3KLR A;  3PUW A;  1PYB A;  1YJN A;  3K59 A;  2IX3 A;  2NVX B;  1FJG Q;  3G6E A;  2PCF B;  4RGM A;  3M4P A;  3J81 E;  3R2T A;  5E7N A;  1QVF A;  2H5X A;  1D5Z C;  1C0A A;  2UUA Q;  5FKA C;  2F3W A;  4FF1 A;  3ZJY C;  1X6O A;  5KRU A;  4K8I A;  1EYG A;  2K4K A;  4A3J H;  2L5T A;  3A5Z B;  4DUY L;  1QUQ A;  4G57 A;  1JOR A;  3CP0 A;  1Z7T A;  2BDO A;  1PFB A;  3PMF A;  3TP5 A;  5NUC A;  5JAV A;  3DM3 A;  2O4X A;  4OHJ A;  3P7J A;  2XNA C;  1GUS A;  3K5N A;  3KOJ A;  3WDN A;  4DR3 L;  4IFD H;  4BBR H;  3ZYY X;  4GKJ Q;  1BCP C;  2EYO A;  3T53 B;  1PRT B;  2VS1 A;  1LTT D;  3I90 A;  2F0W A;  4RKB A;  1PH7 A;  5GQO A;  1CHQ D;  1FYC A;  4GNX B;  5LMN W;  3LGJ A;  1PXU A;  1IYJ B;  5IYB H;  4PV1 C;  5IT9 E;  1NTG A;  4LUZ A;  1LT3 D;  2UUB L;  1GUN A;  1KAB A;  4LF4 Q;  2V4D A;  5IIF A;  3MA2 B;  4I7A A;  4JC0 A;  2R3Z A;  4X64 L;  2B3G A;  2KEN A;  1N32 Q;  4V0B A;  1AW7 A;  2RSN A;  2R7Z H;  3M4O B;  4HN7 A;  3Q23 A;  4DV7 L;  2UXC Q;  2VXW A;  3AU7 A;  1NJI C;  4H13 C;  1W3S A;  3P75 A;  2R93 H;  1IKL A;  1VQJ A;  1JOO A;  1SFO B;  1XPU A;  3I7F A;  3GTM B;  3EQL C;  1H9M A;  2L15 A;  4QY7 A;  4KMU C;  5LMU Q;  1UE6 A;  1NMF A;  4BY7 B;  4IFD I;  2F0V A;  2HHH L;  3HOW G;  2RSO A;  3ONA B;  4WJ3 M;  1KNA A;  4YCU A;  1DZ1 A;  2Y0S E;  4C3H H;  5ELN A;  1VQB A;  2MP1 A;  3H6M A;  3PQI A;  1EYD A;  4C3I H;  4KHP L;  2B63 H;  1STH A;  1XXG A;  1TS4 A;  5EPL A;  3I72 A;  2DN8 A;  3JC6 6;  1FGU A;  2WAQ G;  3U4V A;  1KRS A;  5FJ8 H;  5C4X G;  1LTS D;  4KY7 A;  1I50 B;  2JP1 A;  2EYP A;  2K50 A;  3JAM L;  1IL8 A;  3J80 L;  3S9W A;  4JOI A;  3STB C;  1D2B A;  2RQX A;  1Q90 A;  1B53 A;  2JA8 H;  4JYA Q;  3HOZ H;  1FGB D;  1PDQ A;  5EKI A;  2WB1 B;  1OXS C;  4IUV A;  4RCN A;  2X69 A;  1LAB A;  1KIX A;  3EN2 A;  4POF A;  1DYQ A;  4CBV A;  5AJ3 L;  4FVM A;  3RZD H;  4LWC A;  5LMN Q;  2F0M A;  1MI2 A;  4B08 A;  1HQM C;  1B4O A;  1GVP A;  1TWC B;  3CCE A;  4JI4 Q;  2ZJP A;  2OXP A;  2I5L X;  1TT2 A;  4MTK A;  5COR A;  1BOS A;  4WFN 3;  2E2H H;  1LTA D;  1EL0 A;  4QF4 A;  1TS2 A;  1UUP A;  3S1N B;  1Y1V H;  4QB4 A;  4XDX A;  1Y8N B;  5IGB A;  3FHW A;  2Z4I A;  2IHE A;  4DNT B;  1F2Z A;  2RF4 A;  2IJ0 A;  4GOP B;  5FK9 C;  4R4Q A;  2RHS B;  2OWO A;  2NB0 A;  4A3I G;  1JR0 D;  1HNW Q;  1DXM A;  4R9W A;  3FDT A;  3KJP A;  3S2D H;  2EQS A;  3GTL H;  1V1P A;  5LMU L;  3F2D A;  4YCW A;  2K7V A;  1VQN A;  2K04 A;  2F3V A;  5M3F B;  2A19 A;  3VR3 A;  4P2C B;  4QUC A;  3UDX A;  1ESR A;  3I4L A;  5JVH 3;  2IPK D;  1TWH B;  4DF7 A;  1C4Q A;  5EPJ A;  3VYU A;  3CCJ A;  3SXH A;  1STB A;  3STB D;  4NXN L;  3SK6 A;  1D7Q A;  3H94 A;  4IUQ A;  1E2V A;  4YY3 L;  4R4O A;  2OTL A;  2ZTE A;  1VQL A;  1YBY A;  3CW2 C;  3CPW A;  4HJ8 A;  2F1M A;  1K8M A;  2DUD A;  3BYY B;  5CV7 A;  2ZT9 C;  1GUO A;  3GTK B;  3ER0 A;  3RLN A;  3S2H H;  5JJI A;  2JA6 B;  1V1Q A;  2RCN A;  1LM0 A;  1CKM A;  4DGZ A;  1B8A A;  1ILP A;  3CCV A;  1LAC A;  2CH4 W;  1Q3L A;  1VQ7 A;  4Q5V A;  1KDC A;  1TWA B;  1F2L A;  3OIQ A;  4K6L A;  2AQ1 B;  2FMM A;  1LTR D;  5CV6 A;  2UXD Q;  1BBU A;  4B9X A;  3D4W A;  2AWO A;  5I9P A;  3DEO A;  2PZW A;  3F8T A;  4GOP C;  4A3C H;  2Z9H A;  2XIW A;  1LT6 D;  2FXQ A;  3CD6 A;  2VW9 A;  2RCF A;  5IYD G;  5LHY 1;  3S17 H;  3N52 A;  1JOQ A;  1Z6H A;  4FF2 A;  3MWY W;  4A3F G;  1KLU D;  2JA7 G;  3FKI B;  1EEI D;  1VF5 C;  1HCZ A;  2SNS A;  5FLX E;  2I0Q A;  2IWH A;  3FP9 A;  3FPP A;  3SK4 A;  4FNF A;  5LMN L;  4HMI A;  1PTO D;  3FEW X;  1S5F D;  4Z9C B;  1K0S A;  2EDG A;  3TRE A;  3OTO L;  3OWF A;  4DV0 Q;  4PQX A;  2NVQ H;  3S1Q H;  4JI1 L;  4GLV B;  1JIC A;  1WJJ A;  2OF1 A;  4K5W A;  1BF4 A;  2B2U A;  3HOY H;  3PV0 A;  2HIX A;  3GP7 A;  2NVT H;  4NMZ A;  4ILW A;  1U4P A;  1SLJ A;  2Q8I B;  1MKH A;  3CCM A;  5JEA H;  4LFB Q;  1STG A;  3CHB D;  4O1N A;  2XSC A;  1LYL A;  1HFN A;  1AEX A;  2C35 B;  2Z8L A;  5M5W B;  2K28 A;  1YJ9 A;  3BZC A;  2VQE Q;  3HOW B;  1E7Z A;  4JBM A;  1SYB A;  4RGT A;  1Z9F A;  4DR6 L;  2EZV A;  4YWM A;  1CA5 A;  2Y0S G;  4KHV A;  1WTX A;  3OOC A;  4J6H A;  5C5L A;  1HZB A;  1AE3 A;  1WI5 A;  1STY A;  4LF5 Q;  1QUQ B;  4G7H C;  4TSS A;  3GTO B;  4EGV A;  2K33 A;  2L12 A;  3I2Z A;  1FJG L;  4ZUI A;  4C2M H;  3DWQ A;  4IUP A;  1JWM D;  2E76 C;  4L5S A;  3T13 A;  1BBW A;  1PH5 A;  5JEA G;  1EY4 A;  5C3X A;  2XTI A;  4F87 A;  2L55 A;  3HOU G;  1CSQ A;  1WFQ A;  3K6O A;  3NPP A;  5J22 A;  4RHR A;  4JBK A;  4HIM A;  2ZJQ A;  4DR5 Q;  2F0P A;  2ZTC A;  2LS0 1;  2J0T D;  3RZO B;  2WAC A;  1V9P A;  4FP5 D;  4AQY L;  4DV1 Q;  4J15 A;  1N34 L;  4OEM B;  3TP7 A;  2UXB Q;  1A3U A;  4MHE A;  3CC2 A;  3G4S A;  4JI3 L;  1Y8O B;  4DUY Q;  3J81 L;  3D4D A;  1FNU A;  1KNE A;  1L0Y B;  3A54 A;  3VR6 A;  1NUC A;  4F8M A;  4ZYS A;  4NDX A;  1NMG A;  4RWS C;  3EFX D;  4DR2 L;  1E1O A;  2F52 A;  1EY0 A;  4ZUJ A;  5HGQ A;  3W5O A;  3H09 A;  3CXC A;  2FHT A;  3E6Z X;  4B3S Q;  3KLS X;  4QL5 A;  2E2J H;  1PH6 A;  1AP0 A;  4CDC C;  4J1M A;  1WCM H;  2B2Y C;  3NBI A;  2KA7 A;  4DR4 Q;  5C4J B;  4RG1 A;  5C4H A;  1FL0 A;  1XX8 A;  3GV6 A;  2F3I A;  3MEH A;  4LF8 L;  1TY2 A;  2BA0 A;  3V2T A;  3KF8 A;  3J81 j;  2AHO B;  1XWE A;  1X54 A;  2CWP A;  2D62 A;  1I3Q B;  3NQT A;  2LSS A;  1EYC A;  2QEJ C;  3J80 i;  1QIL A;  3HOX H;  1SN8 A;  2NVY H;  3FPU B;  4JOI C;  4BS9 A;  2PMZ E;  1K83 H;  3HZX A;  3FKI G;  5JPN C;  2JA7 B;  4KJN A;  2K75 A;  4A3F B;  1K8A C;  3WWV A;  1Y69 U;  1U4M A;  1QVG A;  1G6P A;  2B2Y A;  2E75 C;  3BVM A;  4DV3 Q;  2ATW A;  2HDL A;  2QF7 A;  2MNA A;  1XMO Q;  4KHP Q;  2FIN B;  5FOB B;  4CDE C;  2WFW A;  1SJE D;  4OIK A;  4PZ8 A;  3RLF A;  1L2F A;  5EQ0 A;  1SRU A;  3GTG B;  5J39 A;  2E2D C;  5FO9 B;  1SYC A;  1VQ9 A;  5IY0 A;  1I94 Q;  4XYO A;  5BN5 A;  3KYH C;  2AUK A;  4K6D A;  4LFC L;  4IOA A;  1SE8 A;  2DY7 A;  3SGI A;  2Q8T A;  1L1O C;  4OL7 A;  3KF8 B;  4HIK A;  1Q8I A;  3AFQ A;  1DON A;  4QQB X;  1WVL A;  4ODG A;  2JA8 B;  3HOY B;  5IT9 L;  2JA6 G;  4FF3 A;  4JI6 L;  1TR5 A;  2PQE A;  2JA9 A;  3F2C A;  4JPB W;  3I4M B;  4IPC A;  2PQA A;  2KJX A;  1Q7Y C;  3D31 A;  4DXF A;  1WTW A;  2R92 G;  1G2T A;  4DU9 A;  4MTN A;  4DR4 L;  4CKE A;  4R4I A;  2EYL A;  2MFI A;  4NB3 A;  4A3M H;  1H9K A;  3PO2 G;  2BH2 A;  3E5S A;  1JMC A;  2R7D A;  2UUC L;  4FO2 A;  1L1O A;  3OW7 A;  4RAU C;  1SBB B;  2AMC B;  1R4Q B;  4DR1 L;  5E3F A;  3AMU A;  1J6Q A;  3VA5 A;  4AH6 A;  2R6G A;  4A3E H;  4LNQ A;  4QCL A;  1GJX A;  1PFS A;  1YNN D;  3NUC A;  1H95 A;  1JE4 A;  5IGD A;  1HNZ L;  1SE3 A;  2B2V A;  5IGE A;  3RZD B;  1EWC A;  5CV8 A;  1HZC A;  4RKL A;  2I07 B;  4JI2 Q;  3CCL A;  1A2U A;  3S1Q B;  1N36 Q;  1CHP D;  2NVQ B;  3A0J A;  5JJK A;  4EQP A;  4IZ8 A;  1PZI D;  1K0R A;  3I70 A;  4ID6 A;  4DV2 Q;  4C1N K;  4OX9 L;  4GN5 A;  3MVV A;  4A3I H;  2SNM A;  1SR3 A;  4R4T A;  3A5U A;  2PQA B;  2WB1 E;  2MQH A;  4CKB A;  3J7A F;  1ROD A;  1KC8 C;  3TEH B;  2ZXR A;  2EJM A;  2QDB A;  3RZO H;  1ENC A;  1EQV A;  2F0H A;  1LTI D;  5M5W H;  2A73 B;  3GO5 A;  4LF4 L;  3L3O C;  1GOZ A;  1RKN A;  3MXU A;  2MGS A;  3TBI B;  1CM9 A;  4XT1 B;  5JVG 3;  4OXP A;  1GHJ A;  1EU4 A;  5KYL A;  4G4K A;  1NAP A;  4FXK C;  4DUZ L;  4UP7 A;  3G48 A;  5FLM H;  1QCB D;  5C44 G;  3EBE A;  3UDI A;  2B29 A;  3PO3 G;  5AFW A;  3KK7 A;  4RGN A;  1S72 A;  4HCS A;  3KFU A;  4DR3 Q;  1PTO C;  4J8Q A;  1IKM A;  4LF9 Q;  1CZW A;  5C4X B;  3HKZ G;  3K0X A;  5C6A A;  3K57 A;  3SEB A;  5C5M A;  4QIW B;  3DLL A;  2F4V L;  3TP8 A;  1I6V C;  5IYC H;  1N36 L;  3DEP A;  1AN8 A;  5M5Y B;  3PIO A;  3S1M H;  4BY7 G;  4A3M G;  3D6W A;  4DV2 L;  1EQT A;  2VQF L;  1MJE A;  3MXN B;  4LUV A;  3HOV H;  3I4O A;  2EXZ A;  3PUX A;  5L37 A;  2HD3 A;  4LFA L;  4UP9 A;  1TU2 B;  3J7A V;  1TXY A;  3PO3 H;  2VUM B;  3IFD A;  4G7Z C;  5T1I A;  1EY9 A;  2MPM A;  1JE5 A;  4C3I B;  4L6T B;  2Z6B A;  2JA7 H;  2MHV A;  5ELO A;  3TDQ A;  3RD4 A;  2EYF A;  3B6Y A;  1X65 A;  4PNY A;  4U68 A;  3OIP A;  4RHS A;  2RKS A;  3DM1 A;  4DV4 L;  1PA6 A;  5M3M B;  1LLR D;  1RD9 D;  4XQN A;  4JYA L;  3HP3 A;  3NEL A;  3S15 B;  1KXL A;  4MIU A;  2B8G A;  4GKK L;  3QIA A;  5M9O A;  4WJ4 A;  2E2J B;  4XXE A;  4BWG B;  4HTH A;  2Q2T A;  5CR3 A;  1YHA A;  3C1F A;  5BR8 L;  5D3I B;  2AWN A;  1O7Y A;  2G9H D;  5C4J H;  2B2T A;  3AQQ A;  3EJI A;  4R4C A;  4HJ9 A;  5ISR A;  3F2B A;  2PW7 A;  4CJ0 B;  2A68 C;  1QZH A;  3T1H L;  2E5L L;  1JQY D;  1SNP A;  4FF4 A;  4ZRZ A;  4JI6 Q;  3ICE A;  3LNN A;  3VR5 A;  4X65 L;  2CVR A;  1IBK Q;  1HH2 P;  1V1P B;  1Q81 C;  2JA5 H;  4IJL A;  4OWW B;  1AFP A;  1PFM A;  1U4R A;  3GD7 A;  3NEM A;  4GN4 B;  2KCC A;  2BA1 A;  2QDL A;  3TP6 A;  3PIP 3;  4RFB A;  3I4N H;  3T4A C;  1PH3 A;  4RMF A;  4HMJ A;  2NYZ D;  4LFC Q;  2CFM A;  4NPS A;  4DXG A;  4OO1 G;  1D1K A;  2PZT A;  3L9A X;  1LV9 A;  1S4Z A;  1EFW A;  1RHP A;  5LL6 S;  2IX0 A;  1MD2 D;  5IP9 G;  2B2U C;  2HIV A;  2M9V A;  2D2C C;  1HNW L;  3TRZ A;  1SE4 A;  1B1Z A;  1B9M A;  1WTO A;  2F0D A;  2B2T C;  1JCK B;  1BBX C;  4X64 Q;  1I4R A;  1LUZ A;  1EWI A;  3C3L A;  2KHS A;  5GAG C;  3KF6 A;  4IO9 A;  3TS2 A;  3GTG H;  1PH4 A;  3BYT B;  1Y1V G;  1QOH A;  4A3E G;  5CV5 A;  1X3Q A;  2Z4H A;  2VZA A;  4YHH Q;  5J1Z A;  1ZKO A;  4PMC A;  2BH8 A;  1WD0 A;  2KCT A;  1RTN A;  2AUJ D;  2MO1 A;  1C8C A;  5F2D A;  1Y1W B;  1VQI A;  2GN5 A;  4PMB A;  2XRS D;  1Q8K A;  2JK8 A;  5KIX A;  1S5E D;  5C0X H;  3S2H B;  2ASB A;  4K5X A;  4MNO A;  4X62 L;  4A3M B;  1XMO L;  5M5X H;  2DNE A;  3GTJ B;  1HHV A;  5FO8 B;  5D65 A;  4F7X A;  4IUT A;  3KF6 B;  2WIN B;  2A68 D;  2K03 A;  5EGT A;  2PI2 E;  4EQ5 A;  5J3B A;  1WTV A;  1H9S B;  3HKZ B;  3I73 A;  4GZY C;  2JSO A;  4DV1 L;  1ET6 A;  1PRT D;  5BN3 A;  4A3G G;  3S1R H;  2EY2 A;  2H4O A;  3UE0 A;  1HPC A;  3MAQ A;  1ICF B;  4UDU C;  2X6G A;  4YIJ A;  3SR1 A;  1DCZ A;  4ULL A;  3J81 c;  2TMP A;  2C9O A;  4QIW E;  5K5P A;  4R8I A;  5BR8 Q;  1VMP A;  1N8R C;  3E0J A;  3D4R A;  2IT1 A;  3DUZ A;  3BJU A;  2R7F A;  4GKK Q;  4FDB A;  2WV6 D;  1ILQ A;  3P1H A;  2CCZ A;  4KJO A;  3DWP A;  3M85 A;  4DR7 L;  2L1B A;  4A3F H;  1X9N A;  2KHI A;  1SND A;  4LAA A;  4KN7 C;  4XTC S;  3H15 A;  2R93 G;  1RJT A;  4DKA C;  1B3A A;  4KY6 A;  1K73 C;  2NBF A;  3NWS A;  1O80 A;  3A74 A;  4A3B G;  2EIF A;  1I3Q H;  2JYO A;  1A0I A;  4DAM A;  2XN9 C;  3PUV A;  2EXD A;  1MHW C;  1UE1 A;  1ENA A;  2NZO A;  5C44 H;  3S15 H;  3D0F A;  4UY8 C;  1LT5 D;  2LXK A;  5K36 H;  1CK1 A;  2E8G A;  3NQI A;  5FJ8 G;  2I46 A;  1XMQ L;  3QO2 A;  4HCE A;  4DV6 L;  3QJY A;  1X3G A;  3NSW A;  3I4N G;  1I4X A;  1DJR D;  2B8F A;  2KED A;  3DMU A;  1N9W A;  1RCV D;  2KCM A;  2EE1 A;  2ZJR A;  3H0G G;  3PUY A;  3SHL A;  4B3T L;  1A8V A;  1CT1 D;  5EAY A;  1Q12 A;  2ALY B;  2VL6 A;  5M5Y H;  3K5M A;  2UUB Q;  1U4L A;  3EVQ A;  3U4Z A;  4DV4 Q;  1QJO A;  4ME3 A;  3U58 A;  4P72 A;  1KDA A;  3NXW A;  1UEA B;  5ELF A;  2HQL A;  2WAQ E;  1GO3 E;  1JOK A;  2EY6 A;  5DLQ E;  1QZG A;  4GLX A;  3VYT A;  3CF5 A;  3S24 A;  2VB2 X;  1SRO A;  4PZ6 A;  2XRQ D;  5KGU A;  4IUU A;  5M3M H;  1R9T H;  4JI5 Q;  3I91 A;  4ALP A;  2L9H A;  1K28 A;  3I8Z A;  1PH2 A;  1YIT A;  1SE2 A;  4PZ7 A;  2N55 A;  2NTT A;  1B2T A;  1HUM A;  1CFM A;  1V43 A;  2J4X A;  2PZU A;  3HG9 A;  1IBM L;  4DK0 A;  5I6Y A;  4I7Z C;  5IOD A;  4L63 B;  4XYQ A;  4A3D H;  1M1K C;  2E2I B;  5C0X G;  2LXJ A;  1FNW A;  3S14 H;  2R61 A;  3GTM H;  4AYB G;  4A3L G;  4DR2 Q;  1PFN A;  2QW7 A;  3S16 B;  1F2M A;  2B2V C;  4APV A;  1CQF A;  2C5C A;  4KKT A;  1Y14 B;  4NXM L;  3K7A H;  4CDF C;  5CC4 A;  3CCR A;  3GDE A;  4ZLT F;  3D8G A;  1KAW A;  1CKN B;  1TWC H;  2VB3 X;  4DNI A;  3T1Y L;  2EJG C;  5IP7 H;  3OTO Q;  3RNU A;  1HNX Q;  2A69 C;  3NWT A;  1XNQ Q;  4FXG C;  4TQU S;  2JEB I;  4ZK9 B;  4IQZ A;  3OWE B;  1Y1V B;  1IHZ A;  5EPK A;  1I4G A;  3J80 c;  3QR8 A;  4JI0 Q;  2NTS A;  4H44 C;  1B7Y B;  4BA1 I;  2KCN A;  4AYB E;  4X66 Q;  1BR9 A;  4X3U A;  2NVX H;  5KNC A;  1XNR L;  1WCM G;  1HTL D;  3L0O A;  2D0P A;  4TVA B;  3G6J B;  1WTP A;  5IYD H;  3P20 A;  2JA5 G;  5C0X I;  4O0A A;  2RVL A;  4A93 G;  2N78 A;  2SOB A;  2EY1 A;  4PG3 A;  2RDF A;  1PYS B;  4JW0 A;  3MTS A;  3O13 A;  1GHK A;  1PHJ A;  1K3B C;  4X65 Q;  1HA6 A;  3D3R A;  4UPA A;  2D5D A;  1CA6 A;  3NBH A;  4C3J H;  5HUR A;  2K5N A;  3VYS A;  3IAY A;  1JWS D;  4JBJ A;  1N33 Q;  1PV4 A;  4BBS H;  3BS1 A;  3HOU B;  1F9S A;  3M4O H;  2EYJ A;  1X3P A;  1O7Z A;  1RIP A;  3TZD A;  4KD3 A;  2N49 A;  3K0Y A;  5CGK A;  2Q2H A;  5C4Z A;  5CV4 A;  5CYU A;  2EVB A;  1MSH A;  3BVZ A;  1GUT A;  4DAY B;  1MSG A;  1VQG A;  4IN3 A;  2YTY A;  2K5H A;  5KYI A;  1SFO H;  3ERO A;  4NXM Q;  3A55 A;  3IRB A;  1I94 L;  4BXX H;  4GLA C;  3Q22 A;  2Y0S B;  3J7Z C;  1EY7 A;  1EY8 A;  1EIH A;  1F9R A;  1WTR A;  4Y52 H;  3J7Y W;  1ICW A;  3W1G A;  3SDZ A;  1NBW A;  3CKI B;  4RGO S;  2KEE A;  2BOS A;  4C1N I;  4ZAI A;  1AE2 A;  1SYE A;  4C56 C;  2VQF Q;  4DPG A;  4KD4 A;  1XMQ Q;  3G71 A;  1I4P A;  4U67 3;  5IYB G;  3AEV A;  3BZK A;  4Y7N H;  3PGZ A;  3NBH B;  2FMC A;  3MXG A;  5D3D A;  1KDB A;  1UWV A;  4NW2 A;  5C3E G;  1YNX A;  1A3V A;  4LJZ C;  3PIP A;  2UXB L;  2F4V Q;  2F0U A;  1JB3 A;  1S3O A;  2L0C A;  3U9S A;  3OMC A;  4JI4 L;  1YZ6 A;  1Z47 A;  4N9P A;  5FLM G;  1ASY A;  4C3J G;  5C3E H;  1PTO B;  5C44 B;  3H3V H;  1EOV A;  4A3J G;  3C2P A;  4A3K B;  1Q86 C;  2AKW B;  4DAY A;  2ENB A;  3K58 A;  1GUW A;  5A2Q L;  4X3K A;  1DOL A;  2PYK A;  2OTJ A;  4HJ7 A;  2UUC Q;  2IHF A;  3M3Y H;  4A3D B;  5IGG A;  4OON A;  3HKZ E;  2NZ1 D;  4UHV A;  1TWF H;  2A6E D;  4L8J A;  2CWA A;  3HOX G;  4B3M L;  2K5Q A;  2QEX A;  1SNC A;  2B63 G;  4KV6 A;  1SYF A;  3S16 H;  2E2H B;  4HID A;  1IXR A;  3PSI A;  4LF5 L;  1B44 D;  4L5Q A;  2NWG A;  4IPH A;  4DAV A;  4BBS G;  1F2Y A;  1W6K A;  1QVC A;  3PIO 3;  4DK6 C;  2F0N A;  2F0Q A;  4LFB L;  4LW1 A;  2F0K A;  4O2D A;  4ZCK A;  5G3L D;  4AQY Q;  4L5T A;  4F88 A;  3I3C A;  3GTO H;  5KEE A;  3F1Z A;  4CJ1 B;  1TWH H;  3S1R B;  4GNX C;  3H91 A;  2F0G A;  1RTO A;  4HED A;  4BA2 I;  3KLW A;  2CQO A;  3ND8 A;  5FO7 B;  4DA2 A;  2BCO A;  4DV7 Q;  2YTX A;  3HOW H;  4OGQ C;  2VUM H;  1WTH A;  2NN6 I;  5I9O A;  1PH8 A;  3IFT A;  3HRZ C;  4HR7 B;  1L1O B;  1GKH A;  1OTC A;  5IYC G;  1A63 A;  1JC7 A;  3M9B A;  2R92 B;  3D6C A;  1JJ2 A;  3W3A A;  1NE3 A;  3GTK H;  4A3L H;  2F03 A;  4OWX B;  4DK3 C;  3HOV G;  2ZTD A;  5IE8 A;  1KL9 A;  2MJ8 A;  3UDF A;  4BY7 H;  4G7O C;  1B50 A;  3VDY A;  4UAI A;  3HOY G;  5FLX L;  4QJF A;  2JA8 G;  2Z1C A;  3F2U A;  1EQQ A;  1VDZ A;  1UNS A;  1ET9 A;  2F0I A;  4M8A A;  2XWB B;  5M3F G;  3BVG A;  1BDO A;  4LF6 Q;  3J7A 5;  1SEB D;  4X3S A;  1VS0 A;  1XPO A;  3E3X A;  2HQE A;  2K14 A;  5COY A;  5I2Y A;  3V96 A;  1SNQ A;  3T16 A;  4BBS B;  3UE1 A;  1P8L A;  2Z0S A;  3RLO A;  2OQK A;  4NP5 A;  1XYI A;  3BZD B;  2KQ3 A;  4X66 L;  1M4V A;  2O2L D;  1F77 A;  3S17 B;  2BE5 D;  2B63 B;  5C0X J;  1SXT A;  4K0K L;  4AIM A;  5DM7 3;  1PMR A;  4KKS A;  2F0L A;  4N8X 1;  4EX5 A;  3CC4 A;  4A3D G;  1Q1E A;  4CGY B;  3MZ5 A;  5DAU A;  2CKZ B;  1YHB A;  3NTK A;  5IP9 H;  1TKW B;  3OW2 A;  5CV9 A;  1Q1B A;  4OO1 H;  4DR5 L;  1K3R A;  1NCV A;  1A2T A;  4A3K G;  2WB1 G;  2RBM A;  1EQR A;  3KBX A;  3JAM c;  1BKB A;  4C3J B;  5IP7 G;  5C3W A;  1PRT F;  3L2P A;  4NXN Q;  1IW7 C;  3GTL B;  2A69 D;  1TQO A;  4MZ9 A;  1VQF A;  3IL8 A;  4KLK A;  4XIG S;  4HIO A;  1STA A;  2QCP X;  1BNZ A;  1NR4 A;  2WAQ B;  5C3E B;  3RN5 A;  1DOK A;  3R3O A;  4A3B H;  3ITP A;  4A75 A;  3R2I A;  1AZP A;  1H9S A;  1EOT A;  1HNZ Q;  2A8V A;  1D5M C;  2ZXP A;  1BVS A;  4JV5 L;  4WRD A;  3MEF A;  2M00 A;  4RA8 A;  2OQ0 A;  1QB5 D;  2M2L A;  1T9H A;  3K7U C;  4EQO A;  1T5E A;  2F0E A;  5IGF A;  4CJ2 C;  2CW0 C;  1ASZ A;  3FMC A;  2UU9 Q;  1TWF B;  3NTI A;  1J8I A;  3S2D B;  4HSP A;  2HCI A;  1XNR Q;  2B39 A;  3JAM E;  5TSS A;  1VCI A;  4K8J A;  2LFN A;  2VY3 A;  1HTP A;  1E2W A;  3TME A;  1E0B A;  1EWH A;  1SSO A;  4K2K A;  1OXV A;  3MFG A;  1QG7 A;  1A15 A;  4C2M B;  1VQH A;  1C7Y A;  2DGY A;  3K81 C;  3NEN A;  2KVM A;  2ZM6 Q;  1UE7 A; 
#chains in the Genus database with same CATH homology
 2ICI A;  3GTP B;  1HXY D;  2KEC A;  3NTH A;  1STN A;  2CHB D;  2O5J C;  1TY0 A;  1T5X D;  4K14 A;  3U9O A;  3M4Y A;  3HEJ A;  3ND9 A;  1GXD C;  1G2S A;  1SMY C;  4A93 B;  5DNF A;  1IYV A;  3M3Y B;  2AQ2 B;  2IX1 A;  4K2L A;  4TKO B;  1TS3 A;  4HSV A;  3M7N A;  3DWA A;  1LO5 D;  1HQR D;  1ENF A;  2F0S A;  2IL8 A;  2G9D A;  1LTG D;  2WP8 J;  1WCM B;  1DM0 B;  4WOR A;  2PPB C;  3A8J E;  4M1U B;  3QOJ A;  3SVM A;  3MC0 B;  2HDM A;  2IW3 A;  2EPB A;  3LWE A;  2EOT A;  1OXU A;  4OIJ A;  5T1G A;  3G7L A;  4FXD A;  3C46 A;  1II3 A;  1LT4 D;  4KN4 C;  2RDG A;  2NVT B;  3C1E A;  1PZK D;  4IUR A;  3Q0A A;  3X3N A;  1O78 A;  3SE0 A;  1CQV A;  3A56 A;  1K83 B;  1E2Z A;  5JPM C;  2K6A A;  3MFY A;  1BCP D;  2EYH A;  3HS0 C;  1TWG B;  2YYZ A;  1OXX K;  5DM6 3;  2GA4 B;  5ELB A;  4JK1 C;  4AYB B;  4WJW A;  1MBY A;  3UI2 A;  1DD2 A;  5KND A;  3DHQ A;  4Y7N B;  3SK8 A;  5HGT A;  3A8K E;  3A7A B;  5ELD A;  2OT2 A;  1RF2 D;  2EY5 A;  3L7Z C;  4CHT B;  3R93 A;  4XQJ A;  3FVQ A;  1ZEQ X;  3VR4 A;  1D5X C;  5DEH A;  1PTO H;  1BCP F;  3LWU A;  5CMD A;  3J80 E;  5E4X A;  1PRT C;  3Q24 A;  3X3M A;  2F0J A;  5I6W A;  5EJW A;  3HOV B;  3K5L A;  4H0L C;  2DY8 A;  3QB3 A;  4IFD G;  1K8O A;  4B9W A;  2AQ3 B;  3V05 A;  2N88 A;  2A5H A;  3TZU A;  1PYW D;  5EBC A;  2O5I C;  5A35 A;  2Q8R E;  3I4N B;  1WTQ A;  3OMG A;  3RMH A;  1O7L A;  5KNB A;  5JOB A;  1V8Q A;  2J7Z A;  4A3I B;  4IUN A;  3CRK C;  1SMY D;  2H1E A;  4K5V A;  2EYM A;  4LK1 C;  1EIG A;  3EA6 A;  4ABN A;  1GUG A;  2B2W C;  3TSS A;  1KAA A;  1RDP D;  4I65 A;  1NR2 A;  4EVO A;  3HOX B;  4PMW A;  2TSS A;  1SAP A;  2NN6 G;  3OSO A;  2RA4 A;  1VF7 A;  3SK5 A;  2SEB D;  1PLF A;  4QUF A;  3ERQ A;  4A3J B;  3GTQ B;  4LMQ D;  2B2W A;  1PTO F;  2LMC B;  1VMC A;  4RCO A;  3VR2 A;  5M5X B;  1S5B D;  3K5O A;  3Q6S A;  2X6L A;  2XWJ B;  2A6E C;  4DAP A;  2L11 A;  4KKU A;  1IYU A;  3BDL A;  3KLS A;  1HFG A;  2K5D A;  2QKI C;  1YNJ D;  2KOL A;  1U9R A;  1B9N A;  2VNU D;  4TRD A;  1F9P A;  1BXT A;  1AZQ A;  1D1I A;  1EU3 A;  1EY5 A;  2PNR C;  1L0X B;  3BDC A;  3KBG A;  2L4N A;  5CBA E;  4DK1 A;  1ONL A;  3GV3 A;  3WOF A;  2LKV A;  3AB9 A;  4KY5 A;  5I2X A;  3IKJ A;  1LTB D;  3T56 B;  1BQQ T;  1KLG D;  1EZ8 A;  5JJZ A;  3BG3 A;  1YNJ C;  2R7Z B;  4IAL A;  5D14 A;  2EJF C;  2KUM A;  1F9Q A;  1HA5 A;  4RH6 A;  2JEA I;  1BO0 A;  1Y8P B;  1SDF A;  3MXN A;  1DOM A;  4DNR B;  1EY6 A;  2HUG A;  4C3H G;  2JA5 B;  1TS5 A;  3BDO A;  3QOL A;  2ID0 A;  2K5W A;  1SYD A;  2FJ2 A;  1ZYR D;  3OHX C;  1MGS A;  1CI3 M;  4V19 0;  4C3H B;  3NK9 A;  2ICE C;  2BE5 C;  4KTA A;  1BUV T;  5LL6 X;  1HUN A;  1IW7 D;  1FR3 A;  1FD7 D;  2WII B;  2F0O A;  1YNN C;  4DFA A;  2WKC A;  3W2D A;  1ESF A;  1ZYR C;  5JEA J;  2NN6 H;  1I4H A;  1FNV A;  2YU9 B;  4C3I G;  4DN4 M;  1SJH D;  2F4I A;  2PO4 A;  4Q0F A;  1G8Z D;  5EBD A;  1W6J A;  1A3T A;  2PMZ B;  3DXJ C;  3NHH A;  2ZXO A;  1G91 A;  5IGC A;  5CBE E;  2D9U A;  2A74 C;  2F0T A;  4E6I A;  3MHB A;  3S1M B;  5EKL A;  4ZKB B;  2F0F A;  2K05 A;  1SNO A;  1SNM A;  3PO3 B;  2CW0 D;  3WOE A;  2FFK B;  1CZG A;  2K32 A;  2BDN A;  4ZKC B;  1OXT A;  5BN4 A;  4BBR B;  3K7A B;  3H0G B;  3NP8 A;  5EKK A;  1HRJ A;  3VA7 A;  1ML0 D;  2MUY A;  3N6R A;  5ELC A;  4NKL A;  1I4Q A;  5E4W C;  3QG1 A;  5G3L F;  2QIL A;  3FRP B;  3H3V C;  2PW5 A;  3NE5 B;  4X3T A;  1S5C D;  4QMG A;  2DNC A;  5A2Q E;  1EFI D;  3HOZ B;  5I4D A;  2LY7 A;  4OO1 I;  4A3B B;  1XTC D;  4MN3 A;  3T51 B;  2A6H C;  1I6H B;  1QE6 A;  3PUZ A;  2R93 B;  1TII D;  1ZXT A;  2NUC A;  2CQA A;  4CKC A;  3PO2 B;  3CQZ B;  4IFD J;  2NVY B;  1WD1 A;  1A6X A;  4KHZ A;  1PZJ D;  1QWY A;  1G29 1;  1NSN S;  1V1O A;  1STE A;  4ZQ3 A;  1CTM A;  4ME5 A;  3A8I E;  3R8B A;  1QNK A;  1J9O A;  5IOC A;  2XVS A;  1BCP B;  1H9J A;  4JBW A;  1R9T B;  4KK7 A;  2JXM B;  1JWU D;  4EQN A;  2SDF A;  4A3G B;  2JE6 I;  3A7L A;  5K36 G;  3KUP A;  1KTK A;  4XT3 B;  1H9R A;  2WKD A;  3CU7 A;  4H7B A;  1EZ6 A;  1S5D D;  2K1B A;  3HGB A;  3LX0 A;  4O42 A;  4FYD A;  1R4P B;  4BY1 B;  1G6Z A;  3QWN A;  4KI0 A;  1UAP A;  3RUZ A;  5ELE A;  2HCC A;  3GQB A;  3S14 B;  2E74 C;  1EYA A;  2RDH A;  2K01 A;  3URY A;  3OPO A;  1X32 A;  1QNU A;  1EEF D;  4R8N A;  5E1F A;  4HAE A;  4N9T A;  1OO9 B;  3VYR A;  3MXP A;  3M7G A;  1D6E C;  1TVX A;  3CRL C;  2OEO A;  4S3S A;  4XQQ A;  1C48 A;  3TN2 A;  2A6H D;  1M8A A;  4A3E B;  1SYG A;  3KLR A;  3PUW A;  3K59 A;  2IX3 A;  2NVX B;  2PCF B;  4RGM A;  3J81 E;  3R2T A;  1D5Z C;  5FKA C;  2F3W A;  4FF1 A;  5KRU A;  4K8I A;  2L5T A;  1JOR A;  4G57 A;  1Z7T A;  2BDO A;  1PFB A;  3PMF A;  3TP5 A;  5NUC A;  5JAV A;  2O4X A;  4OHJ A;  3P7J A;  2XNA C;  1GUS A;  3K5N A;  3WDN A;  4IFD H;  3ZYY X;  1BCP C;  2EYO A;  3T53 B;  1PRT B;  1LTT D;  3I90 A;  2F0W A;  4RKB A;  1CHQ D;  1FYC A;  1PXU A;  4PV1 C;  5IT9 E;  1LT3 D;  1GUN A;  1KAB A;  2V4D A;  5IIF A;  3MA2 B;  2R3Z A;  4V0B A;  1AW7 A;  2RSN A;  3M4O B;  4HN7 A;  3Q23 A;  2VXW A;  3AU7 A;  4H13 C;  3P75 A;  1IKL A;  1JOO A;  1SFO B;  3GTM B;  3EQL C;  1H9M A;  4KMU C;  4BY7 B;  4IFD I;  2F0V A;  2RSO A;  3ONA B;  1KNA A;  1DZ1 A;  2MP1 A;  3H6M A;  1EYD A;  1STH A;  1XXG A;  1TS4 A;  5EPL A;  3I72 A;  2DN8 A;  1LTS D;  4KY7 A;  1I50 B;  2JP1 A;  2EYP A;  3JAM L;  3J80 L;  1IL8 A;  3S9W A;  1D2B A;  2RQX A;  1Q90 A;  1B53 A;  1FGB D;  1PDQ A;  5EKI A;  2WB1 B;  1OXS C;  4IUV A;  4RCN A;  2X69 A;  1LAB A;  1DYQ A;  4CBV A;  4FVM A;  2F0M A;  1MI2 A;  4B08 A;  1HQM C;  1B4O A;  1TWC B;  2OXP A;  1TT2 A;  5COR A;  1BOS A;  4WFN 3;  1LTA D;  1EL0 A;  4QF4 A;  1TS2 A;  1UUP A;  3S1N B;  4QB4 A;  4XDX A;  5IGB A;  1Y8N B;  2Z4I A;  4DNT B;  1F2Z A;  2IJ0 A;  5FK9 C;  2NB0 A;  1JR0 D;  1DXM A;  4R9W A;  3FDT A;  1V1P A;  2K7V A;  2K04 A;  2F3V A;  5M3F B;  3VR3 A;  4P2C B;  4QUC A;  1ESR A;  3I4L A;  5JVH 3;  2IPK D;  1TWH B;  4DF7 A;  1C4Q A;  5EPJ A;  3VYU A;  3SXH A;  1STB A;  3SK6 A;  3H94 A;  4IUQ A;  1E2V A;  2F1M A;  1K8M A;  3BYY B;  5CV7 A;  2ZT9 C;  1GUO A;  3GTK B;  2JA6 B;  4DGZ A;  1ILP A;  1LAC A;  1Q3L A;  4Q5V A;  1KDC A;  1TWA B;  1F2L A;  3OIQ A;  4K6L A;  2AQ1 B;  2FMM A;  1LTR D;  5CV6 A;  4B9X A;  3D4W A;  2AWO A;  5I9P A;  3DEO A;  2PZW A;  2XIW A;  1LT6 D;  5LHY 1;  3N52 A;  1JOQ A;  1Z6H A;  4FF2 A;  3MWY W;  1KLU D;  3FKI B;  1EEI D;  1VF5 C;  1HCZ A;  2SNS A;  5FLX E;  2IWH A;  3FPP A;  3SK4 A;  4FNF A;  4HMI A;  1PTO D;  3FEW X;  1S5F D;  4Z9C B;  2EDG A;  3OWF A;  4PQX A;  1JIC A;  2OF1 A;  4K5W A;  1BF4 A;  2B2U A;  3PV0 A;  3GP7 A;  4NMZ A;  4ILW A;  1U4P A;  2Q8I B;  5JEA H;  1STG A;  3CHB D;  4O1N A;  2XSC A;  1HFN A;  1AEX A;  2Z8L A;  5M5W B;  2K28 A;  3HOW B;  1SYB A;  4RGT A;  2EZV A;  1CA5 A;  4KHV A;  1WTX A;  3OOC A;  4J6H A;  5C5L A;  1STY A;  4G7H C;  4TSS A;  3GTO B;  4EGV A;  2K33 A;  2L12 A;  4ZUI A;  3DWQ A;  4IUP A;  1JWM D;  2E76 C;  3T13 A;  5JEA G;  1EY4 A;  5C3X A;  4F87 A;  2L55 A;  3K6O A;  3NPP A;  5J22 A;  4RHR A;  2F0P A;  2LS0 1;  2J0T D;  3RZO B;  2WAC A;  4FP5 D;  3TP7 A;  1A3U A;  4MHE A;  1Y8O B;  3J81 L;  3D4D A;  1FNU A;  1KNE A;  1L0Y B;  3A54 A;  3VR6 A;  1NUC A;  4F8M A;  4ZYS A;  4NDX A;  4RWS C;  3EFX D;  1EY0 A;  4ZUJ A;  3H09 A;  2FHT A;  3E6Z X;  3KLS X;  1AP0 A;  4J1M A;  2B2Y C;  3NBI A;  2KA7 A;  5C4J B;  5C4H A;  1XX8 A;  3GV6 A;  3MEH A;  1TY2 A;  2BA0 A;  3V2T A;  3KF8 A;  1XWE A;  2D62 A;  1I3Q B;  3NQT A;  1EYC A;  2QEJ C;  1QIL A;  3FPU B;  4BS9 A;  3HZX A;  5JPN C;  2JA7 B;  4KJN A;  4A3F B;  1Y69 U;  1U4M A;  2B2Y A;  2E75 C;  3BVM A;  2HDL A;  2QF7 A;  2FIN B;  5FOB B;  4OIK A;  1SJE D;  3RLF A;  3GTG B;  5EQ0 A;  5J39 A;  2E2D C;  5FO9 B;  1SYC A;  4XYO A;  5BN5 A;  2AUK A;  4K6D A;  2DY7 A;  2Q8T A;  4OL7 A;  1Q8I A;  1DON A;  1WVL A;  4ODG A;  2JA8 B;  3HOY B;  5IT9 L;  4FF3 A;  1TR5 A;  2PQE A;  3I4M B;  2KJX A;  3D31 A;  4DXF A;  1WTW A;  1G2T A;  4DU9 A;  4CKE A;  2EYL A;  1H9K A;  3E5S A;  4FO2 A;  3OW7 A;  4RAU C;  1SBB B;  1R4Q B;  5E3F A;  3AMU A;  3VA5 A;  2R6G A;  4QCL A;  1GJX A;  1YNN D;  3NUC A;  1JE4 A;  5IGD A;  1SE3 A;  2B2V A;  5IGE A;  3RZD B;  1EWC A;  5CV8 A;  4RKL A;  2I07 B;  3S1Q B;  1A2U A;  2NVQ B;  1CHP D;  4EQP A;  4IZ8 A;  1PZI D;  3I70 A;  4ID6 A;  4C1N K;  3MVV A;  2SNM A;  4CKB A;  3J7A F;  1ROD A;  2ZXR A;  2EJM A;  2QDB A;  1ENC A;  1EQV A;  2F0H A;  1LTI D;  2A73 B;  3GO5 A;  3L3O C;  1GOZ A;  1RKN A;  3MXU A;  2MGS A;  3TBI B;  1CM9 A;  5JVG 3;  4XT1 B;  1GHJ A;  1EU4 A;  5KYL A;  4G4K A;  1NAP A;  4FXK C;  1QCB D;  5AFW A;  3KK7 A;  4RGN A;  4HCS A;  1PTO C;  4J8Q A;  1IKM A;  1CZW A;  5C4X B;  5C6A A;  3K57 A;  3SEB A;  5C5M A;  4QIW B;  3TP8 A;  1I6V C;  3DEP A;  1AN8 A;  5M5Y B;  3D6W A;  1EQT A;  2EXZ A;  3PUX A;  1TU2 B;  3J7A V;  2VUM B;  3IFD A;  4G7Z C;  5T1I A;  1EY9 A;  2MPM A;  4C3I B;  4L6T B;  2MHV A;  3TDQ A;  3RD4 A;  2EYF A;  4PNY A;  4U68 A;  3OIP A;  4RHS A;  2RKS A;  3DM1 A;  5M3M B;  1LLR D;  1RD9 D;  4XQN A;  3HP3 A;  3S15 B;  4MIU A;  2B8G A;  5M9O A;  3QIA A;  2E2J B;  4XXE A;  4BWG B;  4HTH A;  5CR3 A;  3C1F A;  5D3I B;  2AWN A;  1O7Y A;  2G9H D;  2B2T A;  3EJI A;  5ISR A;  2PW7 A;  4CJ0 B;  2A68 C;  1JQY D;  4FF4 A;  1SNP A;  4ZRZ A;  3LNN A;  3VR5 A;  2CVR A;  1V1P B;  1AFP A;  1PFM A;  1U4R A;  3GD7 A;  2KCC A;  2BA1 A;  3PIP 3;  3TP6 A;  4RFB A;  3T4A C;  4HMJ A;  2NYZ D;  4DXG A;  4OO1 G;  1D1K A;  2PZT A;  3L9A X;  1LV9 A;  1S4Z A;  1RHP A;  5LL6 S;  2IX0 A;  1MD2 D;  2B2U C;  2M9V A;  2D2C C;  1SE4 A;  1B1Z A;  1B9M A;  1WTO A;  2F0D A;  2B2T C;  1JCK B;  1BBX C;  1I4R A;  3C3L A;  2KHS A;  3BYT B;  1QOH A;  5CV5 A;  1X3Q A;  2Z4H A;  5J1Z A;  1ZKO A;  4PMC A;  1WD0 A;  1RTN A;  2AUJ D;  1C8C A;  5F2D A;  1Y1W B;  4PMB A;  2XRS D;  5KIX A;  1S5E D;  5C0X H;  3S2H B;  4K5X A;  4A3M B;  2DNE A;  3GTJ B;  1HHV A;  5FO8 B;  5D65 A;  4F7X A;  4IUT A;  2WIN B;  2A68 D;  2K03 A;  5EGT A;  1WTV A;  1H9S B;  3HKZ B;  3I73 A;  4GZY C;  2JSO A;  1ET6 A;  1PRT D;  5BN3 A;  2EY2 A;  2H4O A;  1HPC A;  3MAQ A;  4UDU C;  2X6G A;  4YIJ A;  3SR1 A;  1DCZ A;  4ULL A;  2TMP A;  2C9O A;  5K5P A;  4R8I A;  1VMP A;  3E0J A;  3D4R A;  2IT1 A;  3DUZ A;  2WV6 D;  1ILQ A;  3P1H A;  4KJO A;  3DWP A;  3M85 A;  2L1B A;  1SND A;  4LAA A;  4KN7 C;  4XTC S;  1RJT A;  1B3A A;  4KY6 A;  2NBF A;  3NWS A;  1O80 A;  2JYO A;  2XN9 C;  3PUV A;  1ENA A;  1LT5 D;  5K36 H;  1CK1 A;  3NQI A;  2I46 A;  3QO2 A;  4HCE A;  3QJY A;  3NSW A;  1I4X A;  1DJR D;  2B8F A;  2KED A;  3DMU A;  1RCV D;  2EE1 A;  3PUY A;  3SHL A;  1CT1 D;  1Q12 A;  3K5M A;  1U4L A;  3EVQ A;  1QJO A;  1KDA A;  3NXW A;  1UEA B;  5ELF A;  1JOK A;  2EY6 A;  3VYT A;  2VB2 X;  2XRQ D;  5KGU A;  4IUU A;  3I91 A;  2L9H A;  3I8Z A;  1SE2 A;  2N55 A;  2NTT A;  1B2T A;  1HUM A;  1CFM A;  1V43 A;  2J4X A;  2PZU A;  3HG9 A;  4DK0 A;  5I6Y A;  4I7Z C;  5IOD A;  4L63 B;  4XYQ A;  2E2I B;  5C0X G;  1FNW A;  2R61 A;  1PFN A;  3S16 B;  1F2M A;  2B2V C;  1CQF A;  2C5C A;  4KKT A;  5CC4 A;  4ZLT F;  3D8G A;  2VB3 X;  2EJG C;  2A69 C;  3NWT A;  4FXG C;  4TQU S;  2JEB I;  4ZK9 B;  4IQZ A;  3OWE B;  1Y1V B;  1IHZ A;  5EPK A;  1I4G A;  2NTS A;  4H44 C;  4BA1 I;  2KCN A;  1BR9 A;  4X3U A;  5KNC A;  1HTL D;  3G6J B;  1WTP A;  3P20 A;  5C0X I;  2RVL A;  2SOB A;  2EY1 A;  2RDF A;  3MTS A;  3O13 A;  1GHK A;  1HA6 A;  3D3R A;  2D5D A;  1CA6 A;  3NBH A;  5HUR A;  3VYS A;  3IAY A;  1JWS D;  3BS1 A;  3HOU B;  1F9S A;  2EYJ A;  1X3P A;  1O7Z A;  3TZD A;  4KD3 A;  3K0Y A;  5CGK A;  5C4Z A;  5CV4 A;  5CYU A;  2EVB A;  1MSH A;  3BVZ A;  1GUT A;  1MSG A;  4IN3 A;  5KYI A;  3ERO A;  3A55 A;  3Q22 A;  2Y0S B;  1EY7 A;  1EY8 A;  1EIH A;  1F9R A;  1WTR A;  3J7Y W;  1ICW A;  3SDZ A;  3CKI B;  4RGO S;  2KEE A;  2BOS A;  4C1N I;  4ZAI A;  1SYE A;  4C56 C;  4KD4 A;  1I4P A;  4U67 3;  2FMC A;  3MXG A;  5D3D A;  1KDB A;  4NW2 A;  1A3V A;  4LJZ C;  2F0U A;  1JB3 A;  3U9S A;  2L0C A;  3OMC A;  1Z47 A;  4N9P A;  4C3J G;  1PTO B;  5C44 B;  3C2P A;  4A3K B;  4DAY A;  2ENB A;  3K58 A;  1GUW A;  5A2Q L;  4X3K A;  1DOL A;  2PYK A;  4A3D B;  5IGG A;  2NZ1 D;  2A6E D;  4L8J A;  2K5Q A;  1SNC A;  4KV6 A;  1SYF A;  2E2H B;  1B44 D;  2NWG A;  4DAV A;  1F2Y A;  1W6K A;  3PIO 3;  2F0N A;  2F0Q A;  2F0K A;  5G3L D;  4F88 A;  3I3C A;  5KEE A;  4CJ1 B;  3S1R B;  3H91 A;  2F0G A;  1RTO A;  4HED A;  4BA2 I;  3ND8 A;  5FO7 B;  4DA2 A;  2BCO A;  4OGQ C;  2NN6 I;  5I9O A;  3IFT A;  3HRZ C;  4HR7 B;  1JC7 A;  2R92 B;  3D6C A;  3W3A A;  2F03 A;  2MJ8 A;  4G7O C;  1B50 A;  4UAI A;  5FLX L;  2Z1C A;  3F2U A;  1VDZ A;  1UNS A;  1ET9 A;  2F0I A;  4M8A A;  2XWB B;  3BVG A;  1BDO A;  1SEB D;  4X3S A;  2HQE A;  5COY A;  5I2Y A;  3V96 A;  1SNQ A;  3T16 A;  4BBS B;  4NP5 A;  1XYI A;  3BZD B;  2KQ3 A;  1M4V A;  2O2L D;  1F77 A;  3S17 B;  2BE5 D;  2B63 B;  5C0X J;  1SXT A;  5DM7 3;  1PMR A;  4KKS A;  2F0L A;  1Q1E A;  4CGY B;  3MZ5 A;  5DAU A;  3NTK A;  1TKW B;  5CV9 A;  1Q1B A;  4OO1 H;  1NCV A;  1A2T A;  2RBM A;  3KBX A;  4C3J B;  5C3W A;  1PRT F;  1IW7 C;  3GTL B;  2A69 D;  1TQO A;  3IL8 A;  4XIG S;  1STA A;  2QCP X;  1BNZ A;  1NR4 A;  2WAQ B;  5C3E B;  1DOK A;  3R3O A;  3ITP A;  3R2I A;  1AZP A;  1H9S A;  1EOT A;  1D5M C;  2ZXP A;  4WRD A;  2M00 A;  4RA8 A;  1QB5 D;  2M2L A;  4EQO A;  1T5E A;  2F0E A;  5IGF A;  4CJ2 C;  2CW0 C;  3FMC A;  1TWF B;  3NTI A;  1J8I A;  3S2D B;  4HSP A;  2HCI A;  2B39 A;  3JAM E;  5TSS A;  1VCI A;  4K8J A;  2LFN A;  1HTP A;  1E2W A;  3TME A;  1E0B A;  1EWH A;  1SSO A;  4K2K A;  1OXV A;  3MFG A;  1QG7 A;  1A15 A;  4C2M B;  2KVM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...