2X6LA

X-ray structure of macrophage inflammatory protein-1 beta
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
66
structure length
66
Chain Sequence
GSDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRSKQVCADPSESWVQEYVYDLELN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords C-C MOTIF CHEMOKINE 4
publication title Polymerization of Mip-1 Chemokine (Ccl3 and Ccl4) and Clearance of Mip-1 by Insulin-Degrading Enzyme.
pubmed doi rcsb
total genus 13
structure length 66
sequence length 66
chains with identical sequence B, C, D, E
ec nomenclature
pdb deposition date 2010-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2x6lA00
1S4ZA 1ZXTA 2KOLA 1CA6A 1A15A 2L1BA 5CBAE 3MWYW 4HCSA 1KNAA 1HHVA 4O42A 1PFBA 2FMMA 3F2UA 5AFWA 2KECA 1M8AA 1MSHA 5EQ0A 4IUVA 3FPUB 1ILPA 1JE4A 1ILQA 2EPBA 2L9HA 3HP3A 2RSNA 1WVLA 1NAPA 1TVXA 2M2LA 4HAEA 1NR4A 5D14A 2L4NA 2N55A 4HEDA 1GUWA 2VXWA 1ESRA 4RWSC 2JYOA 4HSVA 2XIWA 1MSGA 2KEDA 1VMPA 3N52A 2IL8A 4X3KA 2X6GA 4XT1B 4CJ2C 4RAUC 5JJZA 2HDLA 3MTSA 2HCIA 1CA5A 2B2UA 1DOKA 4X3TA 1RHPA 1F9SA 5EPJA 3KBXA 1WTWA 1DONA 4OIJA 1U4RA 5EPKA 4ZLTF 5CMDA 2K1BA 1X32A 2B2VA 2KUMA 2MJ8A 1X3PA 1DOLA 3ONAB 1PDQA 4XDXA 2CVRA 3TZDA 1ML0D 3DM1A 1F9RA 1VMCA 1RODA 1G2TA 4IUTA 1B3AA 5E4WC 2B2YC 2FFKB 1NCVA 2RSOA 1IKMA 3GV6A 1U4PA 1U4MA 2K01A 1F9PA 3R93A 1BBXC 1IL8A 3DEPA 3TN2A 1X3QA 4OIKA 1G91A 3LWEA 1HA6A 5CBEE 5COYA 1ICWA 3D6WA 1B2TA 1O80A 2L11A 3I91A 5EPLA 3UI2A 4ZKCB 2NWGA 2Q8RE 1B4OA 1B50A 2B2TA 5D65A 2KVMA 1KNEA 1PLFA 4QUCA 5EKIA 2HDMA 5T1GA 5T1IA 1B53A 2X6LA 1EOTA 1HRJA 3I3CA 1RJTA 5DNFA 1SSOA 5EJWA 1SAPA 2RA4A 1CM9A 1XYIA 2X69A 4IUUA 2L12A 1DOMA 3IL8A 1IKLA 4LMQD 2B2WC 3Q6SA 1F9QA 2JP1A 1LV9A 2HUGA 4X3UA 4IUQA 4R8IA 1J8IA 2N88A 3G7LA 4R9WA 3QO2A 2B2UC 2NZ1D 4IURA 1AP0A 1DZ1A 1EL0A 1WTPA 1BF4A 2D9UA 2NYZD 1MI2A 1WTVA 3KUPA 2H1EA 2K05A 2DY8A 2K28A 1BNZA 4IUPA 1WTQA 2DY7A 4CJ0B 1AZQA 1J9OA 1QE6A 2MGSA 3IFDA 3SVMA 4XT3B 2SDFA 2B2VC 1WTXA 3FDTA 3GV3A 1EIGA 1O7ZA 2EE1A 4DN4M 3DEOA 4ZAIA 4ZK9B 1SDFA 5CORA 3P7JA 4ZKBB 1QG7A 4CJ1B 2MP1A 2FHTA 1BO0A 1HFNA 1O7YA 1MGSA 4MHEA 4X3SA 1Q3LA 4QUFA 4MN3A 2K04A 4U68A 4UAIA 1RTOA 1PFMA 2EOTA 1G2SA 3I8ZA 1F2LA 1XX8A 2RVLA 4NW2A 1EQTA 1JICA 1U4LA 2BDNA 1WD1A 1HFGA 2FJ2A 3I90A 1HUMA 2R3ZA 4RA8A 1WTRA 1E0BA 2J7ZA 2MPMA 2B2WA 1NR2A 1RTNA 2KEEA 5E4XA 2Q8TA 2B2YA 1QNKA 2B2TC 1WTOA 1AZPA 1G6ZA 1C8CA 2HCCA 1HUNA 1EIHA 1PFNA 1WD0A 3H91A 2K03A 2FINB
chains in the Genus database with same CATH superfamily
4CKEA 4CHTB 3KLRA 4TVAB 3HOXH 2FMMA 4LF9L 1M8AA 4JI4L 3J81E 3S24A 1JWMD 4A3MH 4DXGA 1EIFA 1TWHH 3IFTA 2M2LA 1CKNA 4HEDA 2YYZA 3D4WA 1ENFA 1GKHA 2JYOA 1EWHA 3VYTA 5IT9L 2OT2A 2JA5G 3T56B 4OHJA 4ZYSA 1F9SA 1STYA 2XVSA 3CC4A 2OTLA 3FPPA 3EA6A 2CCZA 2WB1G 3A7AB 3R2TA 3NQIA 1X32A 3HFZB 1JC7A 4K5XA 3UDXA 2VZAA 3AB9A 1KTKA 1F9RA 5ELBA 1K73C 4RGOS 1GHJA 4PZ6A 1I3QB 2EIFA 1PTOB 4N9PA 1XMQQ 2MO0A 2XTIA 1IBKL 4L5RC 3M7NA 1ENAA 1VQJA 5T1GA 3TREA 3I4NH 1BBWA 2NN6H 3ZJYC 2E2HH 2OXPA 1QZGA 5JPNC 1XYIA 3DWQA 5C4JB 1KDAA 2G9DA 3CMAA 5EKKA 5G3LF 1EUJA 1MI2A 3ND8A 3PUYA 1XNQQ 3HOYH 3HRZC 1W3SA 2F0OA 1YNXA 2ZJPA 3BZDB 5JOBA 2A68C 4F8MA 3ICEA 1KABA 4ZK9B 2QGQA 4IJHA 5LL6S 1GD7A 1JB7A 4OO1G 1MGSA 3IRBA 5IOCA 4A3EG 3BDCA 3SHLA 1PRTD 4JI5L 1IYVA 4GKKL 4PMWA 2K5HA 3CCLA 3GTPH 2OF1A 1HNXL 4PZ7A 5M3MH 1WTOA 2EYJA 4I7AA 1OXVA 1VQ7A 2O5IC 4H02A 4X66L 3BG3A 3PMFA 4KHPL 1PMRA 3W1GA 1I5FA 2K5QA 3F2UA 1BCPF 2DN8A 5I9OA 3NBHA 4HSVA 2AWNA 4C2MH 3BS1A 1Y1WG 3KLWA 4HSPA 2EVBA 2B2UA 2K5NA 4DR2Q 4LF7L 3CD6A 2H5XA 1D5XC 3C46A 2CW0C 3DMUA 2JA5B 5CR3A 3HOUG 4GLVB 1IHZA 1IBLQ 1HNZL 1VMCA 3GTQH 3OHXC 4CDFC 1HH2P 3S1RH 2CFMA 2WB1B 1IBKQ 2HQLA 1F9PA 1U9RA 2F0PA 1D7QA 4DK3C 3EBEA 2R7ZH 1XTCD 2QEXA 5COYA 4FF1A 4GN5A 1D1IA 3C1FA 4R4IA 3GTKH 5D65A 5M5XB 2HDMA 5FOBB 3W2DA 4UDUC 1S5DD 4WJ4A 1SSOA 1SAPA 5K5PA 3NPPA 1LTLA 2QF7A 5C44G 3HOVG 1STGA 3CC7A 5BN5A 2A69C 1J8IA 1SFOH 3QJYA 3EJIA 1GUSA 2NYZD 3MAQA 1WTVA 1WTQA 1E22A 2EJFC 3SVMA 5CV9A 1RF2D 1Y14B 2NTSA 3DWAA 2JA7G 3URYA 2K5VA 2QDLA 4GKKQ 4ZKBB 4DV7L 4R1JA 1W6JA 1Z47A 2KBNA 1TQOA 4U68A 1B9NA 2RVLA 4NW2A 4RGMA 1JICA 4A75A 4YCWA 4A3EB 4A4IA 2B2WA 4YY3L 4KHPQ 2UXDL 2VL6A 4EGVA 4A3KB 2K7VA 1YEZA 1YZ6A 2Q8TA 3D8GA 1YJWA 2K5DA 1PFNA 3J81c 2F0WA 5ELEA 3I56A 3KF8A 2L1BA 2MNAA 5A2QL 4OO1I 1E2WA 1MSHA 5EBDA 2D5DA 1ILPA 2EPBA 2KHJA 4G7HC 1GUNA 1TVXA 3NSWA 1H9SB 3SE0A 4LF7Q 2N55A 3RLFA 2EYFA 2WKDA 2F0LA 4FXKC 4P2CB 5C3EH 2IL8A 3EN2A 2CH4W 4O0AA 4P74A 1HNZQ 4A3FG 4OWWB 1VQAA 4QMGA 3SK4A 1Y1WB 1SRUA 1DONA 2R6GA 1EIYB 4DAMA 3J80E 3OPOA 1CKOA 3TP7A 2PPBC 3P75A 4K14A 3HOUB 2JQOA 4J1MA 2VQEQ 1A3TA 2VUMH 5CBEE 1E1TA 2K5WA 3RZDB 1NE3A 2KVMA 1KNEA 3PIP3 2FMCA 1WTHA 2Q2HA 4JOIC 2X6LA 4LAAA 1LTTD 2AQ1B 5IT9E 4DR3L 1PRTC 1YI2A 2NZOA 1PYBA 4IUUA 2EYHA 1IKLA 3PO2B 2N8NA 4R4QA 4BY7G 1F77A 2Q2IA 5IYCH 2NZ1D 2F1MA 4B3ML 1LT3D 3PF5A 5FLMG 3S15H 4I65A 5C44B 3PUXA 3HOVB 2DY8A 3NK9A 2DY7A 4A93B 1KL9A 2UUAL 3MZ5A 4JBKA 3OOCA 2AMCB 4DK0A 3ERQA 3R3OA 4IN3A 3TP5A 4DN4M 3OYYA 3OW2A 2RBMA 3S1QH 1O7YA 2JA7B 4YY3Q 5KGUA 1TIID 3SR1A 4G4KA 1L1OA 1PFMA 2HD3A 1X3EA 1MIUA 4YWMA 3U50C 1WD1A 3O13A 4HIOA 3BYYB 4LW1A 5HY6A 3E3XA 1ET6A 2Q8IB 3U9SA 2NN6I 5C4ZA 5E4XA 4XXEA 3NBHB 2WAQE 3H15A 5IYDH 4BWGB 3J81L 4DPGA 4L8JA 1I6HH 4LFBL 4DV5Q 3GO5A 3M9BA 1EY9A 1V1PB 3CU7A 1HHVA 4AIMA 4FXDA 4DUYL 1DYQA 5NUCA 3GTGB 2L9HA 3BDOA 3OSOA 3M4OH 5ELNA 3VYSA 1Z6HA 4WJ3M 1KDBA 1CSPA 4RHRA 4JI2L 1VQPA 1PRTB 1R4PB 1YVCA 1CHQD 4B3RL 3EROA 4HIDA 5CV5A 4X3TA 2A6HD 3FKIH 2AWOA 4CDEC 1R9TH 2KHSA 1C4QA 4A3IB 3GQBA 2D62A 1WOCA 2KUMA 2F0IA 4A3FB 4NPSA 1DJRD 2Z4IA 5K36G 5D3IB 1PTOD 1QJOA 4KN4C 1PV4A 1B3AA 1J5EQ 1WCMB 2FFKB 4FDBA 4H44C 3CCVA 2Q2TA 1XXGA 3NXWA 1N9WA 3S1NB 1K83H 1H9KA 3F2BA 3NENA 4MTKA 4G57A 3LNNA 1D1KA 5IWAL 5IYBH 1Q46A 4DR3Q 1ICWA 2F0MA 1N34L 1O80A 4O2DA 4JI6L 1T9HA 4JI1L 2B2TA 4DV1L 2ZXPA 1K0RA 1I50B 4QUCA 1AE3A 5IGEA 5IP7G 3I4LA 4LF8Q 2MUYA 1HRJA 2OWOA 2PQAB 2X69A 1STAA 2O2LD 3ND9A 2UUAQ 3HGBA 4DAPA 4LUVA 2JA8G 3RZOB 3QB3A 4IPDA 2WINB 1NMFA 3HG9A 2RF4A 2A8VA 1ET9A 2F0KA 3KDFA 4BY7B 4CJ0B 1UE5A 4FNFA 5EGTA 3ER0A 4XT3B 4X65L 1JORA 1PH7A 4BY1H 4IPHA 4DR7Q 3DEOA 1I94L 2F03A 3KF8B 1BO0A 1KRTA 4B9XA 2XRSD 2R61A 2Y0SE 5JEAG 3S14H 3OMCA 1FL0A 1CHPD 2PZTA 1X3GA 2QDBA 4LFBQ 1WTRA 4WJWA 2NVTH 3J7A5 2A73B 3K7AB 5IE8A 5C4XB 2I0QA 3BZKA 3AEVA 2ICEC 2N78A 2UUBL 1MHWC 4JI8Q 4G7ZC 4A3JH 4RKBA 3NTIA 1LABA 4RMFA 3G71A 1KAWA 2JA9A 3K81C 2JA6H 2N3SA 2QA4A 2OQ0A 5IP9H 3G6EA 2F3WA 5J22A 1Y1VG 4FO2A 1XJVA 1N33L 5J3BA 5DEHA 4PMCA 5CV6A 1CI3M 1SE3A 3MTSA 2F0JA 3J80c 3GTOH 4E6IA 4HJ5A 3S1MH 3F1ZA 3TS2A 5EPJA 3KBXA 4C3JG 4L5SA 2HIVA 1STNA 4QJFA 1X55A 2E2DC 4R8NA 2V1CC 5M3FH 3ONAB 4KHZA 3JC66 2F52A 1HCZA 2LKVA 2B29A 1LO5D 3QR8A 1EU3A 3WOEA 4JV5L 2L15A 4C3IG 5FKAC 1N34Q 4BBSG 1U4PA 3PUZA 5A2QE 2SEBD 4JI6Q 4JI1Q 1LUZA 3DEPA 4DV1Q 1Q90A 1N32L 3HOZB 3E5SA 1H9MA 4NB3A 4DKAC 5HGTA 1QVGA 4MZ9A 4UP7A 1TWGH 1TXYA 2R92H 1TR5A 3CHBD 2K4KA 4GOPC 1JOQA 2WACA 4ZQ3A 1RJTA 4RG1A 2VB3X 2NVYB 1N36Q 3ZYYX 2JSOA 3FRPB 4R8IA 1LT4D 1WYDA 1EY0A 2ZM6L 1WTPA 1VQLA 4KD4A 4QF4A 1EL0A 3PGZA 3L2PA 1STBA 1PHJA 1EQVA 5LMNL 2JA8B 1I4PA 1PH9A 4A3DH 2IX3A 4G7OC 3Q0AA 2K52A 4C3HH 1KD1C 1TKWB 3GTMB 5CV7A 5CORA 3CKIB 1KHIA 3PQIA 3W5OA 2ASBA 2JK8A 4KV6A 4QCLA 3M4QA 4IPGA 2VY3A 3CRLC 1VQHA 2WKCA 4V0BA 4X64Q 1JMCA 1IL2A 3TRZA 1K0SA 1Y69U 2FXQA 1SJHD 2A6ED 2A6HC 4ABNA 3CCQA 1EIHA 4S3SA 3J81i 1PVOA 2E76C 1N33Q 1PTOC 4KY6A 1EWIA 4PMBA 2E74C 1WVLA 2XSCA 1EYDA 1K3RA 2G5DA 4HJAA 4IFDH 1BDOA 1EOVA 1BQQT 1AN8A 2CWAA 1HR0L 3J80L 1KQSA 4HN7A 2NVXB 4Y7NB 1XPUA 3K5NA 1WTWA 4EQOA 4DUZQ 4KMUC 2K1BA 1WFQA 3AYHB 1PDQA 2IWHA 1TWFB 1N32Q 4C3JB 3GTJB 1BUVT 2PW5A 1OXTA 2B2YC 2BOSA 2BA0A 2RHQB 4TSSA 3SK8A 5KNBA 1PH6A 5M5YB 4OIKA 3J81j 4C3IB 3RLNA 4K5WA 4BBSB 5AJ3L 2WIIB 1FNVA 4N9TA 2QEJC 3A74A 1Y1WH 4LF4Q 1XMOQ 3FEWX 1DXMA 1LT6D 1D6EC 3RUZA 4OEMB 4PV1C 5M9OA 1SNPA 4A3CG 4P71A 1SROA 3PIPA 4EQ5A 4R9WA 1ONLA 1F2YA 2CWPA 1TS3A 1TWAB 1GJXA 2BE5C 4DR4L 4H7BA 1EYAA 2H1EA 1I4HA 1VQ6A 3DXJC 1WTXA 4A3BH 4HMJA 1CTMA 1STHA 3BVMA 2E2IH 1L2FA 1RKNA 4ID6A 5C5MA 4LF6L 1VQ8A 2FHTA 4K2LA 1SE4A 2KA7A 1W6KA 2E75C 4QY7A 1NMGA 1RTOA 4YWKA 3M3YB 4F88A 4K6DA 3I90A 4RA8A 5C44H 2J7ZA 1A6XA 2LY7A 4X62Q 4DR6L 3M4YA 4NXML 4YHHL 1HQMC 4DGZA 4DV6L 1QOHA 1OXSC 3VA5A 4IO9A 4O42A 1XPRA 1OTCA 1PZKD 3J7AF 1U0LA 1T5XD 3FPUB 2YV5A 3IKJA 1VQFA 1YITA 4A3KG 1HR0Q 3OMGA 5LMUL 4JPBW 4OX9L 1ESRA 4DXFA 2F0QA 2YU9B 5TSSA 3CW2C 2Y0SG 1FYCA 4LF9Q 4JI4Q 1KLUD 3A8IE 4H13C 1BXTA 4A3GH 2RCFA 4EQNA 3H3VC 1U4RA 2IT1A 5CMDA 1TWCH 1YHQA 4K8IA 2NVQB 2M9VA 3T1HL 1SNOA 1SMYC 3EFXD 5I6WA 4IZ8A 1S3OA 2O5JC 2CQAA 5C0XH 3EVQA 3I73A 3HOWH 1SE2A 1VQ9A 4AQYL 2WAQB 3R93A 1B70B 4UHVA 1E3PA 3A8JE 4DV4L 1HTLD 2GVAA 3M7GA 1CZWA 4XYQA 1Z7TA 3NHHA 4A3MG 2RDFA 2C9OA 3VR3A 1PTOF 3I3CA 4QGUA 2R93B 4JBWA 2ES2A 2ZXRA 4DR4Q 4DR1L 1G291 1DOMA 2ZXOA 4ZUJA 3S1NH 1QUQA 4RFBA 1F9QA 2WFWA 4IUQA 5KEEA 3K5LA 1SXTA 2QCPX 1X3FA 3S17B 2KENA 1I4GA 2A6EC 3PIO3 4LF6Q 1QE6A 3IFDA 3S2DH 2MQHA 1O7ZA 1UE6A 3BJUA 2DJFC 4BA1I 4ODGA 3PO2G 3K8AA 3RLOA 2MP1A 5I4DA 5GAEC 1VQKA 1GVPA 2K32A 5M5WB 1S5BD 1L0WA 2PCFB 4ILWA 4A93G 1D5MC 1OO9B 4ZUIA 1CK1A 4JI0L 4UY8C 1AZPA 1UEAB 4DK6C 3I4NG 1QVCA 2NN6G 2D0OA 3PO3H 4OONA 4JI5Q 3MWYW 1AFPA 2DUDA 2UUCL 2DJGC 3H3VI 1Y8PB 2F0FA 3I4MH 1HNXQ 4NP5A 3T4AC 1EU4A 4OGQC 5CV4A 2Q2UA 4N8X1 1JJGA 4HAEA 3L0OA 1K8GA 2L4NA 3HOYG 3H0GB 3DWPA 1KAAA 5KYLA 4X66Q 2KEDA 1SYBA 1CKNB 4J6HA 1CFMA 2I5HA 3P1HA 3V05A 1YHBA 3NTKA 1VQEA 1RHPA 2C35B 1KXLA 3J80i 1B1ZA 3K6OA 4GKJL 2Y0SB 1VS0A 4GNXA 2GA4B 4AQYQ 2B63H 1HZBA 2PW7A 3K5OA 1ML0D 5M3MG 4GZYC 2L55A 3TP6A 3E9IA 4YCUA 1FJGL 3X3MA 1ASZA 1U4MA 2K01A 2IHEA 4IPCA 4QIWB 3RN5A 3NWSA 5DAUA 1EY4A 1S5FD 4A3IG 3U4VA 3D6WA 1B2TA 3KLSX 3LX0A 3A56A 3KF6A 3CRKC 4PZ8A 3HOXB 1WCMG 4JG2A 5GROA 4UP9A 2H4OA 2A1AA 1Y8NB 4KJNA 3GTLH 3CMEA 1S40A 4A3MB 1IZ6A 2M00A 4GN4B 1H9RA 2F0VA 1TWHB 1LV9A 2EY5A 1YBYA 5K36H 2N88A 2B2UC 4IURA 3H94A 4GN3B 5IIFA 2VW9A 4GS3A 5I6YA 1V9PA 2PZWA 4IUPA 1F2ZA 2MHVA 1X54A 3CCEA 4LFAL 4K0KL 2CQOA 4KTAA 1Q81C 3L7ZC 1IYUA 3CQZH 1LACA 2MFIA 3SEBA 2K75A 5IP7H 1DGSA 2NTTA 5GQOA 1QCBD 4IALA 2MPMA 2VNUD 3TS0A 4POGA 4NXNL 1SYDA 4DV7Q 2I07B 2E2JH 2YTVA 1HJPA 3S16H 1A15A 2DNCA 3I4NB 2E2HB 2B39A 2UXDQ 5H1SE 2RSNA 5CC4A 1NR4A 1P8LA 5C4XG 4K5VA 4ALPA 5IGGA 2JXMB 1Q8IA 4JVZA 4B9WA 2Z0SA 2A19A 1VF5C 5EAYA 4UP8A 5G3LD 3HOYB 2LMCB 1RL2A 4MNOA 1PXUA 3CCJA 5JJIA 2PMZE 1CSQA 4P73A 2GN5A 1FJGQ 5JVH3 1NUCA 2EYOA 4DV0L 1IBML 1V43A 1SNQA 3FVQA 2B2VA 5FK9C 4ULLA 1CUKA 5ISRA 3NWTA 4KY7A 3CCSA 3GTPB 3S2HH 5M3MB 1Y1VH 1FR3A 1X65A 1Q82C 2LSSA 2L5TA 3I91A 3OW7A 2PO4A 4LFCL 5EKIA 3B6YA 2WV6D 3NBIA 1QB5D 4FF3A 3MXNA 4KJOA 4C3JH 4DAYA 1QNUA 2EY2A 1VQGA 4PG3A 5C3EG 1BCPD 4B3SL 4DR5L 1X9NA 2PYKA 1AP0A 3F2DA 1BF4A 5IODA 4C2MB 1QWYA 2EJGC 3GV3A 4ZAIA 5IGFA 1XNRL 5I9PA 4HIMA 1TY0A 4CJ1B 1TT2A 1AW7A 3T16A 4B3MQ 4QUFA 4UAIA 2EOTA 4LF5L 3GTQB 1KC8C 3S1RB 3U9OA 1V1QA 1EQTA 1VQOA 1SNCA 2K6AA 2FJ2A 1I3QH 5C5LA 2XNAC 3C1EA 1PTOH 1C0AA 1G6ZA 2R7ZB 1A3UA 4XTCS 1WD0A 3PUVA 2Z6BA 1KDCA 2EXZA 2KOLA 1CA6A 2XWJB 3GTKB 3I72A 1CQFA 1QILA 1KNAA 1SNMA 1PFBA 2KECA 1NJIC 3BDLA 5IYCG 3K5MA 1JE4A 5C4JH 3CCUA 4GNXB 4FF4A 1A2TA 5LHY1 2N49A 1K9MC 2Z6KA 2KQ3A 4FVMA 2Z1CA 1HNWL 1SFOB 2MO1A 4LUOA 2HIXA 4CJ2C 1IBMQ 2BE5D 3PV0A 1SNDA 4X6AH 4DUYQ 4QIWE 1JJ2A 3MFYA 3CP0A 5C4HA 1V1OA 1L1OC 3DLLA 2ZTEA 1PRTF 2MJ8A 1X3PA 4JI7L 1Q7YC 1VCIA 3A54A 4KK7A 4JI2Q 2L0CA 5E1FA 2UXCL 2F0NA 5IYDG 4B3RQ 3GV6A 1VQ4A 3PCOB 4HJ9A 1VQIA 4NDXA 1E2VA 1TS2A 4ZKCB 3FHWA 2QKIC 4DR5Q 3TDQA 1OXXK 5GAGC 5EKLA 3HS0C 3NTHA 5IWAQ 1FNWA 3VYUA 3HZXA 1I6VC 2I46A 3A55A 3QO2A 5JEAJ 4XQJA 1M90C 3KOJA 2O4XA 5C3EB 4B3TL 1XNRQ 1C48A 4QL5A 1AZQA 3ITPA 5IY0A 5GAHC 1L0XB 3CC2A 1PFSA 1M1KC 1BVSA 1K28A 4XIGS 4LF5Q 2PNHA 2JA5H 3KK7A 2RDGA 1AEXA 3PIOA 3TZUA 1YNND 4UPAA 4MHEA 4X3SA 1Q3LA 3NE5B 2K04A 1VQCA 4KN7C 5IYBG 5LMNW 4Y52H 1SMYD 1FVIA 1A8VA 3MEHA 1D8LA 2PZUA 4X65Q 1L1OB 1NR2A 1PH2A 1EFWA 2B2TC 1C8CA 1I4RA 1TS4A 2VUMB 2D0PA 4BA2I 4HR7B 1O78A 1I94Q 4TRDA 3VDYA 3HOZG 1HUNA 1ZXTA 1UE1A 5M5XH 5EBCA 4HCSA 3T53B 2EDGA 3I4OA 5AFWA 1SR3A 3KFUA 5EQ0A 3K0YA 2RCNA 3T1YL 1LTID 4DA2A 1EY6A 4DU9A 2VB2X 2ENBA 2PI2A 1S72A 4RWSC 3HKZE 3KJPA 2UUBQ 3ULJA 4C1NI 4BY1G 4FYDA 5JJLA 3S15B 3MXPA 3L9AX 1KRSA 2KCCA 2E8GA 4DNRB 3IAYA 1DOKA 3AMUA 5HURA 2EJMA 2UXCQ 3FMCA 5C6AA 5F2DA 4ZLTF 4XQQA 4JI3L 4KD3A 2YTYA 4L5QA 1BCPC 3S1QB 3UE0A 2Z4HA 1HR0W 1YJ9A 1ESFA 4QQBX 1JOOA 3M85A 4OO1H 1PZJD 4A3EH 1MJCA 1HZAA 1RDPD 4A3KH 1G6PA 4DV3L 4A3JG 1L0YB 3LWEA 4P72A 1UUPA 1M4VA 1I6HB 2JA6G 1RCVD 1II3A 1XNQL 3JAMc 4OXPA 4JV5Q 3SDZA 5DNFA 1JOKA 5IP9G 2J0TD 4YIJA 2WAQG 2QILA 3RMHA 1HPCA 3QOJA 2F0SA 4Q5VA 3M4OB 1CZGA 4J15A 1C9OA 1RIPA 1S5CD 4N8FA 2K05A 2K28A 5L37A 5JJKA 4A3LG 2KCMA 3D4RA 5M3FG 2R93G 4JBMA 3KDFB 3FKIB 2UU9L 2K50A 1SEBD 2PQEA 3KBGA 4APVA 3KJOA 1R9TB 2BH8A 3A0JA 2ZM6Q 2XWBB 2IX1A 4BXXG 3MA2B 2ICIA 2ZT9C 3HOUH 4LWCA 1XX8A 3QG1A 5KYIA 3CCMA 5LMNQ 5IGDA 3E0EA 1K83B 3NP8A 5ELFA 4HMIA 2A74C 1IYJB 1RTNA 2KEEA 5I2YA 1CT1D 2R92G 3D4DA 1BCPB 2F0UA 5FJ8G 3T1YQ 2FINB 3C2PA 2IW3A 1D2BA 3RZDH 4O1NA 3AFPA 1UE7A 4KKTA 5GADC 2NUCA 3NUCA 1GUTA 4DR2L 1H9SA 3UDFA 2NB0A 2EYPA 4F87A 5FLXE 3PO2H 4OELB 1LTGD 3TMEA 3C3LA 1GUWA 1LLRD 3I7FA 1IBLL 2XRQD 1GUGA 2F0DA 2XIWA 4A3DG 2KCNA 1G51A 2LS01 3N52A 3HOVH 4C3HG 4IJLA 2X6GA 4A93H 2HCIA 1CA5A 4JI3Q 1VQMA 4RCOA 5BN4A 1WI5A 4BY1B 2HT1A 4OIJA 3VR4A 2EYLA 4BBRG 1VQ5A 4EVOA 3TSSA 2JA7H 3H0GG 1DOLA 2IPKD 4XDXA 3CXCA 1VDZA 1H95A 4DV3Q 3DM1A 1G2TA 1RODA 2HQEA 4WFN3 1VQNA 3R2IA 3S14B 2JJQA 2D2CC 4ME5A 2RSOA 4RKLA 1I4QA 1IKMA 4U673 1OXUA 1E1OA 2AQ2B 4RGNA 2NVTB 1PH8A 1VQBA 1YJNA 4K8JA 1ZEQX 3RN2A 1GUOA 1NY4A 5A35A 1B4OA 4A3JB 4L6TB 3JAML 1GHKA 3CAMA 1V8QA 1YNNC 1PH1A 4JBJA 1ZKOA 1VF7A 4B08A 1N8RC 3GTGH 3J7ZC 3VR6A 2TMPA 4IFDG 1LYLA 2JA6B 3I2ZA 3IL8A 4P75A 2DGYA 1A0IA 2A5HA 3W1BA 3UDIA 2BH2A 5CGKA 3K80C 2BA1A 5E3FA 3WDNA 1Q12A 5AJ3Q 1DD2A 1DZ1A 2BDOA 1PH3A 2UU9Q 1PH4A 2IX0A 3V2TA 1TS5A 1YHAA 2PMZB 2ZTDA 1SYGA 1J9OA 4NMZA 4R4CA 4JC0A 5FO8B 3HOXG 1JB3A 3GTOB 3A7LA 3S1MB 3FDTA 1EIGA 5IGBA 4A3IH 5HGQA 1JWUD 4H0LC 3OWEB 2F0GA 3N6RA 3CPFA 4A3FH 1HFNA 1X56A 2CH4A 5M3FB 3VR5A 4DF7A 1EEFD 2K14A 1WCMH 4IOAA 3A5ZB 3STBD 2F4IA 4Z9CB 3TEHB 2V4DA 4BS9A 1V1PA 5KNCA 1R4QB 3AU7A 3CCRA 1EYGA 1I50H 2IY5B 1B44D 3QWNA 1TWGB 5CBAE 2R92B 3M4PA 3P20A 1CKMA 4K6LA 1LTBD 1XPOA 1D5ZC 1ILQA 4FF2A 4DFAA 3HP3A 4JOIA 4IFDJ 4DR6Q 4NXMQ 3RZOH 3E9HA 4XYOA 4KHVA 4RGTA 4YHHQ 3SK5A 4DV6Q 1G8ZD 1ENCA 3PF4A 2EY6A 1VMPA 4A3BG 3AQQA 4XQNA 1EY7A 4XT1B 5JPMC 4BY7H 3EIVA 1Y8OB 1IW7C 3WWVA 2YTXA 5FLMH 4A3DB 1YNJD 4AYBE 2VQEL 1SN8A 4C3HB 1E7ZA 2I5MX 3BU2A 5LMUQ 4OX9Q 4WORA 2BCOA 4ZRZA 3MVVA 4DNTB 3LGJA 2CHBD 3F8TA 5KNDA 2OQKA 2SNMA 3LWUA 1NCVA 4BBRB 2F3IA 1STEA 3H09A 3K7AH 1I4XA 3K57A 4JK1C 5C4XH 1HA6A 4WRDA 1DM0B 1B9MA 1NTGA 1SYEA 2AUKA 1ZYRD 3T1HQ 3HKZG 2PQAA 3TQYA 4GLXA 1EOTA 1QZHA 3AFQA 2GVBA 2JE6I 2RA4A 2B8FA 1EWCA 1CM9A 4LK1C 1H9JA 3VYRA 4HJ8A 4DV4Q 5E7NA 2Z9HA 4FP5D 3G7LA 1JT8A 4OL7A 1K8OA 3D0FA 4JYAL 4IUNA 3DM3A 3TBIB 2RKSA 1Q1BA 3CF5A 4A3GG 1SE8A 1EZ6A 4MIUA 1GXDC 1P16A 2E5LL 1A63A 4GLAC 4DR1Q 3K58A 4YCVA 2OTJA 3DUZA 4IFDI 5C0XG 3G4SA 1PA6A 3HOWG 1U5KA 1SLJA 4DV5L 4CGYB 2WP8J 1UAPA 5JAVA 2B3GA 2EQSA 3QOLA 5DM63 1MBYA 2AUJD 3X3NA 3HOZH 1X6OA 2HCCA 3SGIA 1HQRD 1FGBD 4RCNA 5FLXc 1AH9A 2IHFA 3U4ZA 3MFGA 1SYFA 2NVYH 4IUVA 4JI0Q 4LUZA 1JQYD 1K3BC 2B8GA 4PQXA 1EEID 2R7ZG 1PZID 5ELOA 1IXRA 4L5TA 1MSGA 1FGUA 1J5EL 2NZHA 5JJZA 2JA8H 2HDLA 2UUCQ 5C3XA 3GTMH 2R7FA 4A3BB 3ULPA 2E2IB 3KLSA 2HHHL 4EX5A 2KCTA 1SBBB 1JWSD 5C0XJ 3HKSA 3MC0B 4HIKA 4JCVE 2ID0A 3RR5A 1UEBA 4HTHA 4M8AA 5I2XA 4LF8L 1S5ED 3PO3G 5JEAH 3BVGA 4GKJQ 1G91A 1ICFB 3SK6A 4A76A 2L11A 3I4MG 2AKWB 1XWEA 4L63B 2ATWA 2IJ0A 2OCEA 3Q23A 5T1IA 4TKOB 1B53A 4YWLA 1MKHA 1A3VA 3PUWA 5ELCA 4V190 3JAMi 4C56C 4JYAQ 2F0TA 1WJJA 2LXJA 3HKZB 4DR7L 2JEAI 2B2WC 3Q6SA 1GO3E 3STBC 4CBVA 2E5LQ 3Q8DA 3I55A 4IOCA 1HTPA 3CPWA 1O7LA 1QUQB 1VQDA 3BYTB 1PYSB 3KUPA 2F4VL 1EYCA 2VS1A 4ZCKA 4CKBA 3D31A 2PI2E 5D3DA 4DV2L 2NVXH 4Y7NH 4GNXC 2B63G 1Z9FA 4DK1A 3Q22A 4EQPA 4A3GB 1KLGD 1DCZA 1LTRD 1QG7A 2Z8LA 2RDHA 1TWCB 5DM73 2F0EA 1JR0D 4JI8L 1TWFH 1FNUA 4MN3A 3GTJH 2VQFL 2J4XA 3MXGA 2CKZB 3I8ZA 4POFA 2KHIA 2BDNA 1JE5A 3JAME 4I7ZC 5M5YH 4LFAQ 5KRUA 3HOWB 4K0KQ 1E0BA 1BR9A 2WB1E 3KYHC 3S9WA 4C3IH 1Q1EA 3PSIA 4BBSH 4CDCC 3MEFA 3A5UA 1YNJC 5CV8A 5FLXL 1FD7D 4F7XA 3E0JA 4K2KA 3EQLC 5C0XI 3T13A 3VA7A 2G9HD 4NKLA 4CDDC 5BR8L 1MJEA 1O7IA 3ULLA 1NAPA 4NXNQ 4GOPA 2LXKA 3MHBA 2QW7A 3I70A 1KIXA 2VXWA 2ZTCA 2VUMG 1TWAH 2XGTA 4MTNA 1UWVA 1LTAD 3RD4A 4RHSA 1UNSA 2EY1A 4PNYA 5KIXA 1BKBA 2HHHQ 1ZYRC 1HZ9A 4HJ7A 1HA5A 4KLKA 3S2DB 2EZVA 3NEMA 4LJZC 2CVRA 1NNXA 4OWTB 3M3YH 4IUTA 1TU2B 5CYUA 1BBXC 4R4OA 2C5CA 1N36L 2RQXA 3TN2A 1X3QA 1EQQA 4DV0Q 3OTOL 1BBUA 1T5EA 4TQUS 4DNIA 3UI2A 1LT5D 2LFNA 2NWGA 3PO3B 2Q8RE 3G6JB 1EZ8A 1MD2D 4KKUA 4KKSA 1EY5A 2KJXA 5JVG3 5IGCA 5C3WA 3OIPA 3I4MB 1E2ZA 3KF6B 4QB4A 2L12A 2F4VQ 5FO9B 3L3OC 3U58A 2ZJQA 4AYBG 4DV2Q 2JN4A 2YU9H 1ASYA 2F0HA 1JCKB 4LFCQ 3MXUA 3VR2A 3K59A 2MGSA 1A62A 2RHSB 2B2VC 2VQFQ 4X64L 3T51B 1HZCA 1E24A 1CQVA 1SYCA 1SDFA 4B3SQ 4FXGC 3HEJA 3NQTA 2NVQH 3D3RA 5LL6X 2K33A 2B63B 3K0XA 1EQRA 2AHOB 1GM5A 1RD9D 2ZJRA 2EXDA 1TY2A 4OWXB 1F2LA 1U4LA 4Q0FA 2SNSA 3OIQA 1XTDA 4HCEA 3ERSX 3G48A 2EYMA 3WOFA 2B2YA 3FKIG 1HXYD 5BR8Q 1A2UA 2K03A 1S4ZA 2OEOA 2A68D 2XN9C 2TSSA 2ALYB 4AH6A 2UXBL 4A3LH 4KY5A 1PYWD 2R93H 4RH6A 3GTLB 4KI0A 4DUZL 5D14A 1K8MA 3R8BA 3OWFA 3Q24A 3BVZA 3S17H 4BXXH 3RNUA 1B8AA 5ELDA 4A3CH 5J1ZA 1NBWA 4X3KA 2DNEA 4JW0A 4RAUC 2R7DA 5BN3A 5IT9c 1BOSA 3A8KE 2PNRC 1JJCB 3D6CA 3GD7A 5FJ8H 3UDGA 5EPKA 3CQZB 1HNWQ 3DHQA 3TZDA 4LF4L 5M5WH 1XMOL 1YIJA 4M1UB 3QIAA 3OTOQ 5E4WC 3H6MA 4ME3A 1SJED 1EY8A 1B3QA 3H3VH 1J6QA 3K7UC 1IL8A 3E6ZX 2JEBI 4JI7Q 5EPLA 1Q8KA 1B50A 2SOBA 2E2JB 1PLFA 3S16B 5FO7B 1F2MA 2CW0D 1XMQL 2Z6KC 3J7AV 5EJWA 5J39A 3FP9A 1B7YB 1EFID 4BBRH 4LMQD 3H0GH 3MXNB 2JP1A 4LNQA 2HUGA 4X3UA 4DAYB 2NBFA 1NSNS 1AE2A 2D9UA 1K8AC 3J7YW 3GDEA 3TP8A 3W3AA 1BNZA 4AYBB 5DLQE 4DAVA 2SDFA 3UE1A 1LM0A 4CKCA 2EE1A 1LTSD 1SMXA 1QVFA 1IW7D 4X62L 3P7JA 4C1NK 3GP7A 3SXHA 4B3TQ 4IQZA 1G2SA 2I5LX 4J8QA 2P5ZX 1Q86C 3BZCA 3V96A 3NELA 1HFGA 2A69D 1GOZA 1HUMA 2R3ZA 4GOPB 1C7YA 2AQ3B 3S2HB 3F2CA 2UXBQ 1QNKA 2F3VA 1Y1VB 4R4TA 1W2BA 3H91A 1PH5A
chains in the Genus database with same CATH topology
4CKEA 4CHTB 3KLRA 2FMMA 1M8AA 3J81E 1JWMD 4DXGA 3IFTA 2M2LA 4HEDA 2YYZA 3D4WA 1ENFA 2JYOA 1EWHA 3VYTA 5IT9L 2OT2A 3T56B 4OHJA 4ZYSA 1F9SA 1STYA 2XVSA 3FPPA 3EA6A 3A7AB 3R2TA 3NQIA 1X32A 1JC7A 4K5XA 3AB9A 1KTKA 1F9RA 5ELBA 4RGOS 1GHJA 1I3QB 1PTOB 4N9PA 3M7NA 1ENAA 5T1GA 2NN6H 2OXPA 5JPNC 1XYIA 3DWQA 5C4JB 1KDAA 2G9DA 5EKKA 5G3LF 1MI2A 3ND8A 3PUYA 3HRZC 2F0OA 3BZDB 5JOBA 2A68C 4F8MA 1KABA 4ZK9B 5LL6S 4OO1G 1MGSA 5IOCA 3BDCA 3SHLA 1PRTD 1IYVA 4PMWA 2OF1A 1WTOA 2EYJA 1OXVA 2O5IC 3BG3A 3PMFA 1PMRA 2K5QA 3F2UA 1BCPF 2DN8A 5I9OA 3NBHA 4HSVA 2AWNA 3BS1A 4HSPA 2EVBA 2B2UA 1D5XC 3C46A 2CW0C 3DMUA 2JA5B 5CR3A 1IHZA 1VMCA 3OHXC 2WB1B 1F9PA 1U9RA 2F0PA 1XTCD 5COYA 4FF1A 1D1IA 3C1FA 5D65A 5M5XB 2HDMA 5FOBB 3W2DA 4UDUC 1S5DD 1SSOA 1SAPA 5K5PA 3NPPA 2QF7A 1STGA 5BN5A 2A69C 1J8IA 3EJIA 3QJYA 1GUSA 2NYZD 3MAQA 1WTVA 1WTQA 2EJFC 3SVMA 5CV9A 1RF2D 2NTSA 3DWAA 3URYA 4ZKBB 1W6JA 1Z47A 1TQOA 4U68A 1B9NA 2RVLA 4NW2A 4RGMA 1JICA 4A3EB 2B2WA 4EGVA 4A3KB 2K7VA 2Q8TA 3D8GA 2K5DA 1PFNA 2F0WA 5ELEA 3KF8A 2L1BA 5A2QL 4OO1I 1E2WA 1MSHA 5EBDA 2D5DA 1ILPA 2EPBA 4G7HC 1GUNA 1TVXA 3NSWA 1H9SB 3SE0A 2N55A 3RLFA 2EYFA 2WKDA 2F0LA 4FXKC 4P2CB 2IL8A 4QMGA 3SK4A 1Y1WB 1DONA 2R6GA 3J80E 3OPOA 3TP7A 2PPBC 3P75A 4K14A 3HOUB 4J1MA 1A3TA 5CBEE 2K5WA 3RZDB 2KVMA 1KNEA 3PIP3 2FMCA 2X6LA 4LAAA 1LTTD 2AQ1B 5IT9E 1PRTC 4IUUA 2EYHA 1IKLA 3PO2B 1F77A 2NZ1D 2F1MA 1LT3D 4I65A 5C44B 3PUXA 3HOVB 2DY8A 3NK9A 2DY7A 4A93B 3MZ5A 3OOCA 4DK0A 3ERQA 3R3OA 4IN3A 3TP5A 4DN4M 2RBMA 1O7YA 2JA7B 5KGUA 1TIID 3SR1A 4G4KA 1PFMA 1WD1A 3O13A 3BYYB 1ET6A 2Q8IB 3U9SA 2NN6I 5C4ZA 5E4XA 4XXEA 4BWGB 3J81L 4L8JA 3GO5A 1EY9A 1V1PB 3CU7A 1HHVA 4FXDA 1DYQA 5NUCA 3GTGB 2L9HA 3BDOA 3OSOA 3VYSA 1Z6HA 1KDBA 4RHRA 1PRTB 1R4PB 1CHQD 3EROA 5CV5A 4X3TA 2A6HD 2AWOA 2KHSA 1C4QA 4A3IB 3GQBA 2D62A 2KUMA 2F0IA 4A3FB 1DJRD 2Z4IA 5K36G 5D3IB 1PTOD 1QJOA 4KN4C 1B3AA 1WCMB 2FFKB 4H44C 3S1NB 1XXGA 3NXWA 1H9KA 4G57A 3LNNA 1D1KA 1ICWA 2F0MA 1O80A 2B2TA 2ZXPA 4QUCA 1I50B 5IGEA 3I4LA 2MUYA 1HRJA 2X69A 1STAA 2O2LD 3ND9A 3HGBA 4DAPA 3RZOB 3QB3A 2WINB 3HG9A 1ET9A 2F0KA 4BY7B 4CJ0B 4FNFA 5EGTA 4XT3B 1JORA 3DEOA 2F03A 1BO0A 4B9XA 2XRSD 2R61A 5JEAG 3OMCA 1CHPD 2PZTA 2QDBA 1WTRA 4WJWA 2A73B 3K7AB 5C4XB 2ICEC 4G7ZC 4RKBA 3NTIA 1LABA 2F3WA 5J22A 4FO2A 5DEHA 4PMCA 5CV6A 1CI3M 1SE3A 3MTSA 2F0JA 4E6IA 5EPJA 3KBXA 4C3JG 1STNA 2E2DC 4R8NA 3ONAB 4KHZA 1HCZA 2LKVA 1LO5D 1EU3A 3WOEA 4C3IG 5FKAC 1U4PA 3PUZA 5A2QE 2SEBD 3DEPA 1Q90A 3HOZB 3E5SA 1H9MA 5HGTA 1TR5A 3CHBD 1JOQA 2WACA 4ZQ3A 1RJTA 2VB3X 2NVYB 3ZYYX 2JSOA 3FRPB 4R8IA 1LT4D 1EY0A 1WTPA 4KD4A 4QF4A 1EL0A 1STBA 1EQVA 2JA8B 1I4PA 2IX3A 4G7OC 3Q0AA 1TKWB 3GTMB 5CV7A 5CORA 3CKIB 4KV6A 4QCLA 3CRLC 2WKCA 4V0BA 1Y69U 1SJHD 2A6ED 2A6HC 4ABNA 1EIHA 4S3SA 2E76C 1PTOC 4KY6A 4PMBA 2E74C 1WVLA 2XSCA 1EYDA 4IFDH 1BDOA 1BQQT 1AN8A 3J80L 4HN7A 2NVXB 4Y7NB 3K5NA 1WTWA 4EQOA 4KMUC 2K1BA 2IWHA 1PDQA 1TWFB 4C3JB 3GTJB 1BUVT 2PW5A 1OXTA 2B2YC 2BOSA 2BA0A 4TSSA 3SK8A 5KNBA 5M5YB 4OIKA 4C3IB 4K5WA 4BBSB 2WIIB 1FNVA 4N9TA 2QEJC 3FEWX 1DXMA 1LT6D 1D6EC 3RUZA 4PV1C 5M9OA 1SNPA 4R9WA 1ONLA 1F2YA 1TS3A 1TWAB 1GJXA 2BE5C 4H7BA 1EYAA 2H1EA 1I4HA 3DXJC 1WTXA 4HMJA 1CTMA 1STHA 3BVMA 4ID6A 1RKNA 5C5MA 2FHTA 4K2LA 1SE4A 2KA7A 1W6KA 2E75C 1RTOA 3M3YB 4F88A 4K6DA 3I90A 4RA8A 1A6XA 2J7ZA 2LY7A 3M4YA 1HQMC 4DGZA 1QOHA 1OXSC 3VA5A 4O42A 1PZKD 3J7AF 1T5XD 3FPUB 3IKJA 3OMGA 1ESRA 4DXFA 2F0QA 2YU9B 5TSSA 1FYCA 1KLUD 3A8IE 4H13C 1BXTA 4EQNA 3H3VC 1U4RA 2IT1A 5CMDA 4K8IA 2NVQB 2M9VA 1SNOA 1SMYC 3EFXD 5I6WA 4IZ8A 2O5JC 2CQAA 5C0XH 3EVQA 3I73A 1SE2A 2WAQB 3R93A 3A8JE 1HTLD 3M7GA 1CZWA 4XYQA 1Z7TA 3NHHA 2RDFA 2C9OA 3VR3A 1PTOF 3I3CA 2R93B 4JBWA 2ZXRA 1G291 1DOMA 2ZXOA 4ZUJA 4RFBA 1F9QA 4IUQA 5KEEA 3K5LA 1SXTA 2QCPX 3S17B 1I4GA 2A6EC 3PIO3 1QE6A 3IFDA 1O7ZA 4BA1I 4ODGA 2MP1A 5I4DA 2K32A 5M5WB 1S5BD 2PCFB 4ILWA 1D5MC 1OO9B 4ZUIA 1CK1A 1AZPA 1UEAB 2NN6G 3MWYW 1AFPA 1Y8PB 2F0FA 4NP5A 3T4AC 1EU4A 4OGQC 5CV4A 4HAEA 2L4NA 3H0GB 3DWPA 1KAAA 5KYLA 2KEDA 1SYBA 4J6HA 1CFMA 3P1HA 3V05A 3NTKA 1RHPA 1B1ZA 3K6OA 2Y0SB 2GA4B 2PW7A 3K5OA 1ML0D 4GZYC 2L55A 3TP6A 3X3MA 1U4MA 2K01A 4QIWB 3NWSA 5DAUA 1EY4A 1S5FD 3D6WA 1B2TA 3KLSX 3LX0A 3A56A 3CRKC 3HOXB 2H4OA 1Y8NB 4KJNA 4A3MB 2M00A 1H9RA 2F0VA 1TWHB 1LV9A 2EY5A 5K36H 2N88A 2B2UC 4IURA 3H94A 5IIFA 5I6YA 2PZWA 4IUPA 1F2ZA 2MHVA 4KTAA 3L7ZC 1IYUA 1LACA 3SEBA 2NTTA 1QCBD 4IALA 2MPMA 2VNUD 1SYDA 2I07B 1A15A 2DNCA 3I4NB 2E2HB 2B39A 2RSNA 5CC4A 1NR4A 4K5VA 5IGGA 2JXMB 1Q8IA 4B9WA 1VF5C 5G3LD 3HOYB 2LMCB 1PXUA 5JVH3 1NUCA 2EYOA 1V43A 1SNQA 5FK9C 2B2VA 3FVQA 4ULLA 5ISRA 3NWTA 4KY7A 3GTPB 5M3MB 1FR3A 2L5TA 3I91A 3OW7A 2PO4A 5EKIA 2WV6D 3NBIA 1QB5D 4FF3A 3MXNA 4KJOA 4DAYA 1QNUA 2EY2A 1BCPD 2PYKA 1AP0A 1BF4A 5IODA 4C2MB 1QWYA 2EJGC 3GV3A 4ZAIA 5IGFA 5I9PA 1TY0A 4CJ1B 1TT2A 1AW7A 3T16A 4QUFA 4UAIA 2EOTA 3GTQB 3S1RB 3U9OA 1EQTA 1SNCA 2K6AA 2FJ2A 5C5LA 2XNAC 3C1EA 1PTOH 1G6ZA 2R7ZB 1A3UA 4XTCS 1WD0A 3PUVA 1KDCA 2EXZA 2KOLA 1CA6A 2XWJB 3GTKB 3I72A 1CQFA 1QILA 1KNAA 1SNMA 1PFBA 2KECA 3BDLA 3K5MA 1JE4A 4FF4A 1A2TA 5LHY1 2KQ3A 4FVMA 2Z1CA 1SFOB 4CJ2C 2BE5D 3PV0A 1SNDA 3MFYA 5C4HA 1V1OA 1PRTF 2MJ8A 1X3PA 1VCIA 3A54A 4KK7A 2L0CA 5E1FA 2F0NA 3GV6A 4NDXA 1E2VA 1TS2A 4ZKCB 2QKIC 3TDQA 1OXXK 5EKLA 3HS0C 3NTHA 1FNWA 3VYUA 3HZXA 1I6VC 2I46A 3A55A 3QO2A 5JEAJ 4XQJA 2O4XA 5C3EB 1C48A 1AZQA 3ITPA 1L0XB 4XIGS 3KK7A 2RDGA 1AEXA 3TZUA 1YNND 4MHEA 4X3SA 1Q3LA 3NE5B 2K04A 4KN7C 1SMYD 3MEHA 2PZUA 1NR2A 2B2TC 1C8CA 1I4RA 1TS4A 2VUMB 4BA2I 4HR7B 1O78A 1HUNA 4TRDA 1ZXTA 5EBCA 4HCSA 3T53B 2EDGA 5AFWA 5EQ0A 3K0YA 1LTID 4DA2A 1EY6A 4DU9A 2VB2X 2ENBA 4RWSC 4FYDA 4C1NI 3S15B 3MXPA 3L9AX 2KCCA 4DNRB 3IAYA 1DOKA 3AMUA 5HURA 2EJMA 3FMCA 5C6AA 5F2DA 4ZLTF 4XQQA 4KD3A 3S1QB 1BCPC 2Z4HA 1ESFA 1JOOA 3M85A 4OO1H 1PZJD 1RDPD 1L0YB 3LWEA 1UUPA 1M4VA 1I6HB 1RCVD 1II3A 3SDZA 5DNFA 1JOKA 2J0TD 4YIJA 2QILA 3RMHA 1HPCA 3QOJA 2F0SA 4Q5VA 3M4OB 1CZGA 1S5CD 2K05A 2K28A 3D4RA 3FKIB 2PQEA 1SEBD 3KBGA 1R9TB 2XWBB 2IX1A 3MA2B 2ICIA 2ZT9C 1XX8A 3QG1A 5KYIA 5IGDA 1K83B 3NP8A 5ELFA 4HMIA 2A74C 1RTNA 2KEEA 5I2YA 1CT1D 3D4DA 1BCPB 2F0UA 2FINB 3C2PA 2IW3A 1D2BA 4O1NA 4KKTA 2NUCA 3NUCA 1GUTA 1H9SA 2NB0A 2EYPA 4F87A 5FLXE 1LTGD 3TMEA 3C3LA 1GUWA 1LLRD 2XRQD 1GUGA 2F0DA 2XIWA 2KCNA 2LS01 3N52A 4C3HG 2X6GA 2HCIA 1CA5A 4RCOA 5BN4A 4BY1B 4OIJA 3VR4A 2EYLA 4EVOA 3TSSA 1DOLA 2IPKD 4XDXA 1VDZA 3DM1A 1G2TA 1RODA 2HQEA 4WFN3 3R2IA 3S14B 2D2CC 4ME5A 2RSOA 4RKLA 1I4QA 1IKMA 4U673 1OXUA 2AQ2B 4RGNA 2NVTB 4K8JA 1ZEQX 1GUOA 5A35A 1B4OA 4A3JB 4L6TB 3JAML 1GHKA 1V8QA 1YNNC 4B08A 1ZKOA 1VF7A 3VR6A 2TMPA 4IFDG 2JA6B 3IL8A 2A5HA 5CGKA 2BA1A 5E3FA 3WDNA 1Q12A 1DD2A 1DZ1A 2BDOA 2IX0A 3V2TA 1TS5A 2PMZB 1SYGA 1J9OA 4NMZA 5FO8B 1JB3A 3GTOB 3A7LA 3S1MB 3FDTA 1EIGA 5IGBA 1JWUD 4H0LC 3OWEB 2F0GA 3N6RA 1HFNA 5M3FB 3VR5A 4DF7A 1EEFD 2F4IA 4Z9CB 2V4DA 4BS9A 1V1PA 5KNCA 1R4QB 3AU7A 1B44D 3QWNA 1TWGB 5CBAE 2R92B 3P20A 4K6LA 1LTBD 1D5ZC 1ILQA 4FF2A 4DFAA 3HP3A 4IFDJ 4XYOA 4KHVA 4RGTA 3SK5A 1G8ZD 1ENCA 2EY6A 1VMPA 4XQNA 1EY7A 4XT1B 5JPMC 1Y8OB 1IW7C 4A3DB 1YNJD 4C3HB 4WORA 2BCOA 4ZRZA 3MVVA 4DNTB 2CHBD 5KNDA 2SNMA 3LWUA 1NCVA 4BBRB 1STEA 3H09A 1I4XA 3K57A 4JK1C 1HA6A 4WRDA 1DM0B 1B9MA 2AUKA 1SYEA 1ZYRD 1EOTA 2JE6I 2RA4A 2B8FA 1EWCA 1CM9A 4LK1C 1H9JA 3VYRA 4FP5D 3G7LA 4OL7A 1K8OA 4IUNA 3TBIB 2RKSA 1Q1BA 1EZ6A 4MIUA 1GXDC 3K58A 3DUZA 4IFDI 5C0XG 4CGYB 2WP8J 1UAPA 5JAVA 3QOLA 5DM63 1MBYA 2AUJD 3X3NA 2HCCA 1HQRD 1FGBD 4RCNA 3MFGA 1SYFA 4IUVA 1JQYD 2B8GA 4PQXA 1EEID 1PZID 1MSGA 5JJZA 2HDLA 5C3XA 4A3BB 2E2IB 3KLSA 1SBBB 1JWSD 5C0XJ 3MC0B 2ID0A 4M8AA 4HTHA 5I2XA 1S5ED 5JEAH 3BVGA 1G91A 3SK6A 2L11A 1XWEA 4L63B 2IJ0A 3Q23A 5T1IA 4TKOB 1B53A 1A3VA 3PUWA 5ELCA 4V190 4C56C 2F0TA 3HKZB 2JEAI 2B2WC 3Q6SA 4CBVA 1HTPA 1O7LA 3BYTB 3KUPA 1EYCA 4CKBA 3D31A 5D3DA 4DK1A 3Q22A 4EQPA 4A3GB 1KLGD 1DCZA 1LTRD 1QG7A 2Z8LA 2RDHA 5DM73 1TWCB 2F0EA 1JR0D 1FNUA 4MN3A 2J4XA 3MXGA 3I8ZA 2BDNA 3JAME 4I7ZC 5KRUA 3HOWB 1E0BA 1BR9A 3S9WA 1Q1EA 1YNJC 5CV8A 5FLXL 1FD7D 4F7XA 3E0JA 4K2KA 3EQLC 5C0XI 3T13A 3VA7A 2G9HD 4NKLA 1NAPA 3MHBA 3I70A 2VXWA 1LTAD 3RD4A 4RHSA 1UNSA 2EY1A 4PNYA 5KIXA 1ZYRC 1HA5A 3S2DB 2EZVA 4LJZC 2CVRA 4IUTA 1TU2B 5CYUA 1BBXC 2C5CA 2RQXA 3TN2A 1X3QA 1T5EA 4TQUS 3UI2A 1LT5D 2LFNA 2NWGA 3PO3B 2Q8RE 3G6JB 1EZ8A 1MD2D 4KKUA 4KKSA 1EY5A 2KJXA 5JVG3 5IGCA 5C3WA 3OIPA 3I4MB 1E2ZA 4QB4A 2L12A 5FO9B 3L3OC 2F0HA 1JCKB 3MXUA 3VR2A 3K59A 2MGSA 2B2VC 3T51B 1CQVA 1SYCA 1SDFA 4FXGC 3HEJA 3NQTA 3D3RA 5LL6X 2K33A 2B63B 1RD9D 1TY2A 1F2LA 1U4LA 4Q0FA 2SNSA 3OIQA 4HCEA 2EYMA 3WOFA 2B2YA 1HXYD 1A2UA 2K03A 1S4ZA 2OEOA 2A68D 2XN9C 2TSSA 4KY5A 1PYWD 4RH6A 3GTLB 4KI0A 5D14A 1K8MA 3R8BA 3OWFA 3Q24A 3BVZA 5ELDA 5J1ZA 4X3KA 2DNEA 4RAUC 5BN3A 1BOSA 3A8KE 2PNRC 3GD7A 3D6CA 5EPKA 3CQZB 3DHQA 3TZDA 4M1UB 3QIAA 5E4WC 3H6MA 1SJED 1EY8A 1IL8A 3E6ZX 2JEBI 5EPLA 1B50A 2SOBA 2E2JB 1PLFA 3S16B 5FO7B 1F2MA 2CW0D 3J7AV 5EJWA 5J39A 1EFID 4LMQD 2JP1A 2HUGA 4X3UA 2NBFA 1NSNS 2D9UA 3J7YW 3TP8A 3W3AA 1BNZA 4AYBB 4DAVA 2SDFA 4CKCA 2EE1A 1LTSD 1IW7D 3P7JA 4C1NK 3GP7A 3SXHA 4IQZA 1G2SA 4J8QA 3V96A 1HFGA 2A69D 1GOZA 1HUMA 2R3ZA 2AQ3B 3S2HB 1QNKA 2F3VA 1Y1VB 3H91A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S4Z A;  1ZXT A;  2KOL A;  1CA6 A;  1A15 A;  2L1B A;  5CBA E;  3MWY W;  4HCS A;  1KNA A;  1HHV A;  4O42 A;  1PFB A;  2FMM A;  3F2U A;  5AFW A;  2KEC A;  1M8A A;  1MSH A;  5EQ0 A;  4IUV A;  3FPU B;  1ILP A;  1JE4 A;  1ILQ A;  2EPB A;  2L9H A;  3HP3 A;  2RSN A;  1WVL A;  1NAP A;  1TVX A;  2M2L A;  4HAE A;  1NR4 A;  5D14 A;  2L4N A;  2N55 A;  4HED A;  1GUW A;  2VXW A;  1ESR A;  4RWS C;  2JYO A;  4HSV A;  2XIW A;  1MSG A;  2KED A;  1VMP A;  3N52 A;  2IL8 A;  4X3K A;  2X6G A;  4XT1 B;  4CJ2 C;  4RAU C;  5JJZ A;  2HDL A;  3MTS A;  2HCI A;  1CA5 A;  2B2U A;  1DOK A;  4X3T A;  1RHP A;  1F9S A;  5EPJ A;  3KBX A;  1WTW A;  1DON A;  4OIJ A;  1U4R A;  5EPK A;  4ZLT F;  5CMD A;  2K1B A;  1X32 A;  2B2V A;  2KUM A;  2MJ8 A;  1X3P A;  1DOL A;  3ONA B;  1PDQ A;  4XDX A;  2CVR A;  3TZD A;  1ML0 D;  3DM1 A;  1F9R A;  1VMC A;  1ROD A;  1G2T A;  4IUT A;  1B3A A;  5E4W C;  2B2Y C;  2FFK B;  1NCV A;  2RSO A;  1IKM A;  3GV6 A;  1U4P A;  1U4M A;  2K01 A;  1F9P A;  3R93 A;  1BBX C;  1IL8 A;  3DEP A;  3TN2 A;  1X3Q A;  4OIK A;  1G91 A;  3LWE A;  1HA6 A;  5CBE E;  5COY A;  1ICW A;  3D6W A;  1B2T A;  1O80 A;  2L11 A;  3I91 A;  5EPL A;  3UI2 A;  4ZKC B;  2NWG A;  2Q8R E;  1B4O A;  1B50 A;  2B2T A;  5D65 A;  2KVM A;  1KNE A;  1PLF A;  4QUC A;  5EKI A;  2HDM A;  5T1G A;  5T1I A;  1B53 A;  2X6L A;  1EOT A;  1HRJ A;  3I3C A;  1RJT A;  5DNF A;  1SSO A;  5EJW A;  1SAP A;  2RA4 A;  1CM9 A;  1XYI A;  2X69 A;  4IUU A;  2L12 A;  1DOM A;  3IL8 A;  1IKL A;  4LMQ D;  2B2W C;  3Q6S A;  1F9Q A;  2JP1 A;  1LV9 A;  2HUG A;  4X3U A;  4IUQ A;  4R8I A;  1J8I A;  2N88 A;  3G7L A;  4R9W A;  3QO2 A;  2B2U C;  2NZ1 D;  4IUR A;  1AP0 A;  1DZ1 A;  1EL0 A;  1WTP A;  1BF4 A;  2D9U A;  2NYZ D;  1MI2 A;  1WTV A;  3KUP A;  2H1E A;  2K05 A;  2DY8 A;  2K28 A;  1BNZ A;  4IUP A;  1WTQ A;  2DY7 A;  4CJ0 B;  1AZQ A;  1J9O A;  1QE6 A;  2MGS A;  3IFD A;  3SVM A;  4XT3 B;  2SDF A;  2B2V C;  1WTX A;  3FDT A;  3GV3 A;  1EIG A;  1O7Z A;  2EE1 A;  4DN4 M;  3DEO A;  4ZAI A;  4ZK9 B;  1SDF A;  5COR A;  3P7J A;  4ZKB B;  1QG7 A;  4CJ1 B;  2MP1 A;  2FHT A;  1BO0 A;  1HFN A;  1O7Y A;  1MGS A;  4MHE A;  4X3S A;  1Q3L A;  4QUF A;  4MN3 A;  2K04 A;  4U68 A;  4UAI A;  1RTO A;  1PFM A;  2EOT A;  1G2S A;  3I8Z A;  1F2L A;  1XX8 A;  2RVL A;  4NW2 A;  1EQT A;  1JIC A;  1U4L A;  2BDN A;  1WD1 A;  1HFG A;  2FJ2 A;  3I90 A;  1HUM A;  2R3Z A;  4RA8 A;  1WTR A;  1E0B A;  2J7Z A;  2MPM A;  2B2W A;  1NR2 A;  1RTN A;  2KEE A;  5E4X A;  2Q8T A;  2B2Y A;  1QNK A;  2B2T C;  1WTO A;  1AZP A;  1G6Z A;  1C8C A;  2HCC A;  1HUN A;  1EIH A;  1PFN A;  1WD0 A;  3H91 A;  2K03 A;  2FIN B; 
#chains in the Genus database with same CATH topology
 4CKE A;  4CHT B;  3KLR A;  4TVA B;  3HOX H;  2FMM A;  4LF9 L;  1M8A A;  4JI4 L;  3J81 E;  3S24 A;  1JWM D;  4A3M H;  4DXG A;  1EIF A;  1TWH H;  3IFT A;  2M2L A;  1CKN A;  4HED A;  2YYZ A;  3D4W A;  1ENF A;  1GKH A;  2JYO A;  1EWH A;  3VYT A;  5IT9 L;  2OT2 A;  2JA5 G;  3T56 B;  4OHJ A;  4ZYS A;  1F9S A;  1STY A;  2XVS A;  3CC4 A;  2OTL A;  3FPP A;  3EA6 A;  2CCZ A;  2WB1 G;  3A7A B;  3R2T A;  3NQI A;  1X32 A;  3HFZ B;  1JC7 A;  4K5X A;  3UDX A;  2VZA A;  3AB9 A;  1KTK A;  1F9R A;  5ELB A;  1K73 C;  4RGO S;  1GHJ A;  4PZ6 A;  1I3Q B;  2EIF A;  1PTO B;  4N9P A;  1XMQ Q;  2MO0 A;  2XTI A;  1IBK L;  4L5R C;  3M7N A;  1ENA A;  1VQJ A;  5T1G A;  3TRE A;  3I4N H;  1BBW A;  2NN6 H;  3ZJY C;  2E2H H;  2OXP A;  1QZG A;  5JPN C;  1XYI A;  3DWQ A;  5C4J B;  1KDA A;  2G9D A;  3CMA A;  5EKK A;  5G3L F;  1EUJ A;  1MI2 A;  3ND8 A;  3PUY A;  1XNQ Q;  3HOY H;  3HRZ C;  1W3S A;  2F0O A;  1YNX A;  2ZJP A;  3BZD B;  5JOB A;  2A68 C;  4F8M A;  3ICE A;  1KAB A;  4ZK9 B;  2QGQ A;  4IJH A;  5LL6 S;  1GD7 A;  1JB7 A;  4OO1 G;  1MGS A;  3IRB A;  5IOC A;  4A3E G;  3BDC A;  3SHL A;  1PRT D;  4JI5 L;  1IYV A;  4GKK L;  4PMW A;  2K5H A;  3CCL A;  3GTP H;  2OF1 A;  1HNX L;  4PZ7 A;  5M3M H;  1WTO A;  2EYJ A;  4I7A A;  1OXV A;  1VQ7 A;  2O5I C;  4H02 A;  4X66 L;  3BG3 A;  3PMF A;  4KHP L;  1PMR A;  3W1G A;  1I5F A;  2K5Q A;  3F2U A;  1BCP F;  2DN8 A;  5I9O A;  3NBH A;  4HSV A;  2AWN A;  4C2M H;  3BS1 A;  1Y1W G;  3KLW A;  4HSP A;  2EVB A;  2B2U A;  2K5N A;  4DR2 Q;  4LF7 L;  3CD6 A;  2H5X A;  1D5X C;  3C46 A;  2CW0 C;  3DMU A;  2JA5 B;  5CR3 A;  3HOU G;  4GLV B;  1IHZ A;  1IBL Q;  1HNZ L;  1VMC A;  3GTQ H;  3OHX C;  4CDF C;  1HH2 P;  3S1R H;  2CFM A;  2WB1 B;  1IBK Q;  2HQL A;  1F9P A;  1U9R A;  2F0P A;  1D7Q A;  4DK3 C;  3EBE A;  2R7Z H;  1XTC D;  2QEX A;  5COY A;  4FF1 A;  4GN5 A;  1D1I A;  3C1F A;  4R4I A;  3GTK H;  5D65 A;  5M5X B;  2HDM A;  5FOB B;  3W2D A;  4UDU C;  1S5D D;  4WJ4 A;  1SSO A;  1SAP A;  5K5P A;  3NPP A;  1LTL A;  2QF7 A;  5C44 G;  3HOV G;  1STG A;  3CC7 A;  5BN5 A;  2A69 C;  1J8I A;  1SFO H;  3QJY A;  3EJI A;  1GUS A;  2NYZ D;  3MAQ A;  1WTV A;  1WTQ A;  1E22 A;  2EJF C;  3SVM A;  5CV9 A;  1RF2 D;  1Y14 B;  2NTS A;  3DWA A;  2JA7 G;  3URY A;  2K5V A;  2QDL A;  4GKK Q;  4ZKB B;  4DV7 L;  4R1J A;  1W6J A;  1Z47 A;  2KBN A;  1TQO A;  4U68 A;  1B9N A;  2RVL A;  4NW2 A;  4RGM A;  1JIC A;  4A75 A;  4YCW A;  4A3E B;  4A4I A;  2B2W A;  4YY3 L;  4KHP Q;  2UXD L;  2VL6 A;  4EGV A;  4A3K B;  2K7V A;  1YEZ A;  1YZ6 A;  2Q8T A;  3D8G A;  1YJW A;  2K5D A;  1PFN A;  3J81 c;  2F0W A;  5ELE A;  3I56 A;  3KF8 A;  2L1B A;  2MNA A;  5A2Q L;  4OO1 I;  1E2W A;  1MSH A;  5EBD A;  2D5D A;  1ILP A;  2EPB A;  2KHJ A;  4G7H C;  1GUN A;  1TVX A;  3NSW A;  1H9S B;  3SE0 A;  4LF7 Q;  2N55 A;  3RLF A;  2EYF A;  2WKD A;  2F0L A;  4FXK C;  4P2C B;  5C3E H;  2IL8 A;  3EN2 A;  2CH4 W;  4O0A A;  4P74 A;  1HNZ Q;  4A3F G;  4OWW B;  1VQA A;  4QMG A;  3SK4 A;  1Y1W B;  1SRU A;  1DON A;  2R6G A;  1EIY B;  4DAM A;  3J80 E;  3OPO A;  1CKO A;  3TP7 A;  2PPB C;  3P75 A;  4K14 A;  3HOU B;  2JQO A;  4J1M A;  2VQE Q;  1A3T A;  2VUM H;  5CBE E;  1E1T A;  2K5W A;  3RZD B;  1NE3 A;  2KVM A;  1KNE A;  3PIP 3;  2FMC A;  1WTH A;  2Q2H A;  4JOI C;  2X6L A;  4LAA A;  1LTT D;  2AQ1 B;  5IT9 E;  4DR3 L;  1PRT C;  1YI2 A;  2NZO A;  1PYB A;  4IUU A;  2EYH A;  1IKL A;  3PO2 B;  2N8N A;  4R4Q A;  4BY7 G;  1F77 A;  2Q2I A;  5IYC H;  2NZ1 D;  2F1M A;  4B3M L;  1LT3 D;  3PF5 A;  5FLM G;  3S15 H;  4I65 A;  5C44 B;  3PUX A;  3HOV B;  2DY8 A;  3NK9 A;  2DY7 A;  4A93 B;  1KL9 A;  2UUA L;  3MZ5 A;  4JBK A;  3OOC A;  2AMC B;  4DK0 A;  3ERQ A;  3R3O A;  4IN3 A;  3TP5 A;  4DN4 M;  3OYY A;  3OW2 A;  2RBM A;  3S1Q H;  1O7Y A;  2JA7 B;  4YY3 Q;  5KGU A;  1TII D;  3SR1 A;  4G4K A;  1L1O A;  1PFM A;  2HD3 A;  1X3E A;  1MIU A;  4YWM A;  3U50 C;  1WD1 A;  3O13 A;  4HIO A;  3BYY B;  4LW1 A;  5HY6 A;  3E3X A;  1ET6 A;  2Q8I B;  3U9S A;  2NN6 I;  5C4Z A;  5E4X A;  4XXE A;  3NBH B;  2WAQ E;  3H15 A;  5IYD H;  4BWG B;  3J81 L;  4DPG A;  4L8J A;  1I6H H;  4LFB L;  4DV5 Q;  3GO5 A;  3M9B A;  1EY9 A;  1V1P B;  3CU7 A;  1HHV A;  4AIM A;  4FXD A;  4DUY L;  1DYQ A;  5NUC A;  3GTG B;  2L9H A;  3BDO A;  3OSO A;  3M4O H;  5ELN A;  3VYS A;  1Z6H A;  4WJ3 M;  1KDB A;  1CSP A;  4RHR A;  4JI2 L;  1VQP A;  1PRT B;  1R4P B;  1YVC A;  1CHQ D;  4B3R L;  3ERO A;  4HID A;  5CV5 A;  4X3T A;  2A6H D;  3FKI H;  2AWO A;  4CDE C;  1R9T H;  2KHS A;  1C4Q A;  4A3I B;  3GQB A;  2D62 A;  1WOC A;  2KUM A;  2F0I A;  4A3F B;  4NPS A;  1DJR D;  2Z4I A;  5K36 G;  5D3I B;  1PTO D;  1QJO A;  4KN4 C;  1PV4 A;  1B3A A;  1J5E Q;  1WCM B;  2FFK B;  4FDB A;  4H44 C;  3CCV A;  2Q2T A;  1XXG A;  3NXW A;  1N9W A;  3S1N B;  1K83 H;  1H9K A;  3F2B A;  3NEN A;  4MTK A;  4G57 A;  3LNN A;  1D1K A;  5IWA L;  5IYB H;  1Q46 A;  4DR3 Q;  1ICW A;  2F0M A;  1N34 L;  1O80 A;  4O2D A;  4JI6 L;  1T9H A;  4JI1 L;  2B2T A;  4DV1 L;  2ZXP A;  1K0R A;  1I50 B;  4QUC A;  1AE3 A;  5IGE A;  5IP7 G;  3I4L A;  4LF8 Q;  2MUY A;  1HRJ A;  2OWO A;  2PQA B;  2X69 A;  1STA A;  2O2L D;  3ND9 A;  2UUA Q;  3HGB A;  4DAP A;  4LUV A;  2JA8 G;  3RZO B;  3QB3 A;  4IPD A;  2WIN B;  1NMF A;  3HG9 A;  2RF4 A;  2A8V A;  1ET9 A;  2F0K A;  3KDF A;  4BY7 B;  4CJ0 B;  1UE5 A;  4FNF A;  5EGT A;  3ER0 A;  4XT3 B;  4X65 L;  1JOR A;  1PH7 A;  4BY1 H;  4IPH A;  4DR7 Q;  3DEO A;  1I94 L;  2F03 A;  3KF8 B;  1BO0 A;  1KRT A;  4B9X A;  2XRS D;  2R61 A;  2Y0S E;  5JEA G;  3S14 H;  3OMC A;  1FL0 A;  1CHP D;  2PZT A;  1X3G A;  2QDB A;  4LFB Q;  1WTR A;  4WJW A;  2NVT H;  3J7A 5;  2A73 B;  3K7A B;  5IE8 A;  5C4X B;  2I0Q A;  3BZK A;  3AEV A;  2ICE C;  2N78 A;  2UUB L;  1MHW C;  4JI8 Q;  4G7Z C;  4A3J H;  4RKB A;  3NTI A;  1LAB A;  4RMF A;  3G71 A;  1KAW A;  2JA9 A;  3K81 C;  2JA6 H;  2N3S A;  2QA4 A;  2OQ0 A;  5IP9 H;  3G6E A;  2F3W A;  5J22 A;  1Y1V G;  4FO2 A;  1XJV A;  1N33 L;  5J3B A;  5DEH A;  4PMC A;  5CV6 A;  1CI3 M;  1SE3 A;  3MTS A;  2F0J A;  3J80 c;  3GTO H;  4E6I A;  4HJ5 A;  3S1M H;  3F1Z A;  3TS2 A;  5EPJ A;  3KBX A;  4C3J G;  4L5S A;  2HIV A;  1STN A;  4QJF A;  1X55 A;  2E2D C;  4R8N A;  2V1C C;  5M3F H;  3ONA B;  4KHZ A;  3JC6 6;  2F52 A;  1HCZ A;  2LKV A;  2B29 A;  1LO5 D;  3QR8 A;  1EU3 A;  3WOE A;  4JV5 L;  2L15 A;  4C3I G;  5FKA C;  1N34 Q;  4BBS G;  1U4P A;  3PUZ A;  5A2Q E;  2SEB D;  4JI6 Q;  4JI1 Q;  1LUZ A;  3DEP A;  4DV1 Q;  1Q90 A;  1N32 L;  3HOZ B;  3E5S A;  1H9M A;  4NB3 A;  4DKA C;  5HGT A;  1QVG A;  4MZ9 A;  4UP7 A;  1TWG H;  1TXY A;  2R92 H;  1TR5 A;  3CHB D;  2K4K A;  4GOP C;  1JOQ A;  2WAC A;  4ZQ3 A;  1RJT A;  4RG1 A;  2VB3 X;  2NVY B;  1N36 Q;  3ZYY X;  2JSO A;  3FRP B;  4R8I A;  1LT4 D;  1WYD A;  1EY0 A;  2ZM6 L;  1WTP A;  1VQL A;  4KD4 A;  4QF4 A;  1EL0 A;  3PGZ A;  3L2P A;  1STB A;  1PHJ A;  1EQV A;  5LMN L;  2JA8 B;  1I4P A;  1PH9 A;  4A3D H;  2IX3 A;  4G7O C;  3Q0A A;  2K52 A;  4C3H H;  1KD1 C;  1TKW B;  3GTM B;  5CV7 A;  5COR A;  3CKI B;  1KHI A;  3PQI A;  3W5O A;  2ASB A;  2JK8 A;  4KV6 A;  4QCL A;  3M4Q A;  4IPG A;  2VY3 A;  3CRL C;  1VQH A;  2WKC A;  4V0B A;  4X64 Q;  1JMC A;  1IL2 A;  3TRZ A;  1K0S A;  1Y69 U;  2FXQ A;  1SJH D;  2A6E D;  2A6H C;  4ABN A;  3CCQ A;  1EIH A;  4S3S A;  3J81 i;  1PVO A;  2E76 C;  1N33 Q;  1PTO C;  4KY6 A;  1EWI A;  4PMB A;  2E74 C;  1WVL A;  2XSC A;  1EYD A;  1K3R A;  2G5D A;  4HJA A;  4IFD H;  1BDO A;  1EOV A;  1BQQ T;  1AN8 A;  2CWA A;  1HR0 L;  3J80 L;  1KQS A;  4HN7 A;  2NVX B;  4Y7N B;  1XPU A;  3K5N A;  1WTW A;  4EQO A;  4DUZ Q;  4KMU C;  2K1B A;  1WFQ A;  3AYH B;  1PDQ A;  2IWH A;  1TWF B;  1N32 Q;  4C3J B;  3GTJ B;  1BUV T;  2PW5 A;  1OXT A;  2B2Y C;  2BOS A;  2BA0 A;  2RHQ B;  4TSS A;  3SK8 A;  5KNB A;  1PH6 A;  5M5Y B;  4OIK A;  3J81 j;  4C3I B;  3RLN A;  4K5W A;  4BBS B;  5AJ3 L;  2WII B;  1FNV A;  4N9T A;  2QEJ C;  3A74 A;  1Y1W H;  4LF4 Q;  1XMO Q;  3FEW X;  1DXM A;  1LT6 D;  1D6E C;  3RUZ A;  4OEM B;  4PV1 C;  5M9O A;  1SNP A;  4A3C G;  4P71 A;  1SRO A;  3PIP A;  4EQ5 A;  4R9W A;  1ONL A;  1F2Y A;  2CWP A;  1TS3 A;  1TWA B;  1GJX A;  2BE5 C;  4DR4 L;  4H7B A;  1EYA A;  2H1E A;  1I4H A;  1VQ6 A;  3DXJ C;  1WTX A;  4A3B H;  4HMJ A;  1CTM A;  1STH A;  3BVM A;  2E2I H;  1L2F A;  1RKN A;  4ID6 A;  5C5M A;  4LF6 L;  1VQ8 A;  2FHT A;  4K2L A;  1SE4 A;  2KA7 A;  1W6K A;  2E75 C;  4QY7 A;  1NMG A;  1RTO A;  4YWK A;  3M3Y B;  4F88 A;  4K6D A;  3I90 A;  4RA8 A;  5C44 H;  2J7Z A;  1A6X A;  2LY7 A;  4X62 Q;  4DR6 L;  3M4Y A;  4NXM L;  4YHH L;  1HQM C;  4DGZ A;  4DV6 L;  1QOH A;  1OXS C;  3VA5 A;  4IO9 A;  4O42 A;  1XPR A;  1OTC A;  1PZK D;  3J7A F;  1U0L A;  1T5X D;  3FPU B;  2YV5 A;  3IKJ A;  1VQF A;  1YIT A;  4A3K G;  1HR0 Q;  3OMG A;  5LMU L;  4JPB W;  4OX9 L;  1ESR A;  4DXF A;  2F0Q A;  2YU9 B;  5TSS A;  3CW2 C;  2Y0S G;  1FYC A;  4LF9 Q;  4JI4 Q;  1KLU D;  3A8I E;  4H13 C;  1BXT A;  4A3G H;  2RCF A;  4EQN A;  3H3V C;  1U4R A;  2IT1 A;  5CMD A;  1TWC H;  1YHQ A;  4K8I A;  2NVQ B;  2M9V A;  3T1H L;  1SNO A;  1SMY C;  3EFX D;  5I6W A;  4IZ8 A;  1S3O A;  2O5J C;  2CQA A;  5C0X H;  3EVQ A;  3I73 A;  3HOW H;  1SE2 A;  1VQ9 A;  4AQY L;  2WAQ B;  3R93 A;  1B70 B;  4UHV A;  1E3P A;  3A8J E;  4DV4 L;  1HTL D;  2GVA A;  3M7G A;  1CZW A;  4XYQ A;  1Z7T A;  3NHH A;  4A3M G;  2RDF A;  2C9O A;  3VR3 A;  1PTO F;  3I3C A;  4QGU A;  2R93 B;  4JBW A;  2ES2 A;  2ZXR A;  4DR4 Q;  4DR1 L;  1G29 1;  1DOM A;  2ZXO A;  4ZUJ A;  3S1N H;  1QUQ A;  4RFB A;  1F9Q A;  2WFW A;  4IUQ A;  5KEE A;  3K5L A;  1SXT A;  2QCP X;  1X3F A;  3S17 B;  2KEN A;  1I4G A;  2A6E C;  3PIO 3;  4LF6 Q;  1QE6 A;  3IFD A;  3S2D H;  2MQH A;  1O7Z A;  1UE6 A;  3BJU A;  2DJF C;  4BA1 I;  4ODG A;  3PO2 G;  3K8A A;  3RLO A;  2MP1 A;  5I4D A;  5GAE C;  1VQK A;  1GVP A;  2K32 A;  5M5W B;  1S5B D;  1L0W A;  2PCF B;  4ILW A;  4A93 G;  1D5M C;  1OO9 B;  4ZUI A;  1CK1 A;  4JI0 L;  4UY8 C;  1AZP A;  1UEA B;  4DK6 C;  3I4N G;  1QVC A;  2NN6 G;  2D0O A;  3PO3 H;  4OON A;  4JI5 Q;  3MWY W;  1AFP A;  2DUD A;  2UUC L;  2DJG C;  3H3V I;  1Y8P B;  2F0F A;  3I4M H;  1HNX Q;  4NP5 A;  3T4A C;  1EU4 A;  4OGQ C;  5CV4 A;  2Q2U A;  4N8X 1;  1JJG A;  4HAE A;  3L0O A;  1K8G A;  2L4N A;  3HOY G;  3H0G B;  3DWP A;  1KAA A;  5KYL A;  4X66 Q;  2KED A;  1SYB A;  1CKN B;  4J6H A;  1CFM A;  2I5H A;  3P1H A;  3V05 A;  1YHB A;  3NTK A;  1VQE A;  1RHP A;  2C35 B;  1KXL A;  3J80 i;  1B1Z A;  3K6O A;  4GKJ L;  2Y0S B;  1VS0 A;  4GNX A;  2GA4 B;  4AQY Q;  2B63 H;  1HZB A;  2PW7 A;  3K5O A;  1ML0 D;  5M3M G;  4GZY C;  2L55 A;  3TP6 A;  3E9I A;  4YCU A;  1FJG L;  3X3M A;  1ASZ A;  1U4M A;  2K01 A;  2IHE A;  4IPC A;  4QIW B;  3RN5 A;  3NWS A;  5DAU A;  1EY4 A;  1S5F D;  4A3I G;  3U4V A;  3D6W A;  1B2T A;  3KLS X;  3LX0 A;  3A56 A;  3KF6 A;  3CRK C;  4PZ8 A;  3HOX B;  1WCM G;  4JG2 A;  5GRO A;  4UP9 A;  2H4O A;  2A1A A;  1Y8N B;  4KJN A;  3GTL H;  3CME A;  1S40 A;  4A3M B;  1IZ6 A;  2M00 A;  4GN4 B;  1H9R A;  2F0V A;  1TWH B;  1LV9 A;  2EY5 A;  1YBY A;  5K36 H;  2N88 A;  2B2U C;  4IUR A;  3H94 A;  4GN3 B;  5IIF A;  2VW9 A;  4GS3 A;  5I6Y A;  1V9P A;  2PZW A;  4IUP A;  1F2Z A;  2MHV A;  1X54 A;  3CCE A;  4LFA L;  4K0K L;  2CQO A;  4KTA A;  1Q81 C;  3L7Z C;  1IYU A;  3CQZ H;  1LAC A;  2MFI A;  3SEB A;  2K75 A;  5IP7 H;  1DGS A;  2NTT A;  5GQO A;  1QCB D;  4IAL A;  2MPM A;  2VNU D;  3TS0 A;  4POG A;  4NXN L;  1SYD A;  4DV7 Q;  2I07 B;  2E2J H;  2YTV A;  1HJP A;  3S16 H;  1A15 A;  2DNC A;  3I4N B;  2E2H B;  2B39 A;  2UXD Q;  5H1S E;  2RSN A;  5CC4 A;  1NR4 A;  1P8L A;  5C4X G;  4K5V A;  4ALP A;  5IGG A;  2JXM B;  1Q8I A;  4JVZ A;  4B9W A;  2Z0S A;  2A19 A;  1VF5 C;  5EAY A;  4UP8 A;  5G3L D;  3HOY B;  2LMC B;  1RL2 A;  4MNO A;  1PXU A;  3CCJ A;  5JJI A;  2PMZ E;  1CSQ A;  4P73 A;  2GN5 A;  1FJG Q;  5JVH 3;  1NUC A;  2EYO A;  4DV0 L;  1IBM L;  1V43 A;  1SNQ A;  3FVQ A;  2B2V A;  5FK9 C;  4ULL A;  1CUK A;  5ISR A;  3NWT A;  4KY7 A;  3CCS A;  3GTP B;  3S2H H;  5M3M B;  1Y1V H;  1FR3 A;  1X65 A;  1Q82 C;  2LSS A;  2L5T A;  3I91 A;  3OW7 A;  2PO4 A;  4LFC L;  5EKI A;  3B6Y A;  2WV6 D;  3NBI A;  1QB5 D;  4FF3 A;  3MXN A;  4KJO A;  4C3J H;  4DAY A;  1QNU A;  2EY2 A;  1VQG A;  4PG3 A;  5C3E G;  1BCP D;  4B3S L;  4DR5 L;  1X9N A;  2PYK A;  1AP0 A;  3F2D A;  1BF4 A;  5IOD A;  4C2M B;  1QWY A;  2EJG C;  3GV3 A;  4ZAI A;  5IGF A;  1XNR L;  5I9P A;  4HIM A;  1TY0 A;  4CJ1 B;  1TT2 A;  1AW7 A;  3T16 A;  4B3M Q;  4QUF A;  4UAI A;  2EOT A;  4LF5 L;  3GTQ B;  1KC8 C;  3S1R B;  3U9O A;  1V1Q A;  1EQT A;  1VQO A;  1SNC A;  2K6A A;  2FJ2 A;  1I3Q H;  5C5L A;  2XNA C;  3C1E A;  1PTO H;  1C0A A;  1G6Z A;  2R7Z B;  1A3U A;  4XTC S;  1WD0 A;  3PUV A;  2Z6B A;  1KDC A;  2EXZ A;  2KOL A;  1CA6 A;  2XWJ B;  3GTK B;  3I72 A;  1CQF A;  1QIL A;  1KNA A;  1SNM A;  1PFB A;  2KEC A;  1NJI C;  3BDL A;  5IYC G;  3K5M A;  1JE4 A;  5C4J H;  3CCU A;  4GNX B;  4FF4 A;  1A2T A;  5LHY 1;  2N49 A;  1K9M C;  2Z6K A;  2KQ3 A;  4FVM A;  2Z1C A;  1HNW L;  1SFO B;  2MO1 A;  4LUO A;  2HIX A;  4CJ2 C;  1IBM Q;  2BE5 D;  3PV0 A;  1SND A;  4X6A H;  4DUY Q;  4QIW E;  1JJ2 A;  3MFY A;  3CP0 A;  5C4H A;  1V1O A;  1L1O C;  3DLL A;  2ZTE A;  1PRT F;  2MJ8 A;  1X3P A;  4JI7 L;  1Q7Y C;  1VCI A;  3A54 A;  4KK7 A;  4JI2 Q;  2L0C A;  5E1F A;  2UXC L;  2F0N A;  5IYD G;  4B3R Q;  3GV6 A;  1VQ4 A;  3PCO B;  4HJ9 A;  1VQI A;  4NDX A;  1E2V A;  1TS2 A;  4ZKC B;  3FHW A;  2QKI C;  4DR5 Q;  3TDQ A;  1OXX K;  5GAG C;  5EKL A;  3HS0 C;  3NTH A;  5IWA Q;  1FNW A;  3VYU A;  3HZX A;  1I6V C;  2I46 A;  3A55 A;  3QO2 A;  5JEA J;  4XQJ A;  1M90 C;  3KOJ A;  2O4X A;  5C3E B;  4B3T L;  1XNR Q;  1C48 A;  4QL5 A;  1AZQ A;  3ITP A;  5IY0 A;  5GAH C;  1L0X B;  3CC2 A;  1PFS A;  1M1K C;  1BVS A;  1K28 A;  4XIG S;  4LF5 Q;  2PNH A;  2JA5 H;  3KK7 A;  2RDG A;  1AEX A;  3PIO A;  3TZU A;  1YNN D;  4UPA A;  4MHE A;  4X3S A;  1Q3L A;  3NE5 B;  2K04 A;  1VQC A;  4KN7 C;  5IYB G;  5LMN W;  4Y52 H;  1SMY D;  1FVI A;  1A8V A;  3MEH A;  1D8L A;  2PZU A;  4X65 Q;  1L1O B;  1NR2 A;  1PH2 A;  1EFW A;  2B2T C;  1C8C A;  1I4R A;  1TS4 A;  2VUM B;  2D0P A;  4BA2 I;  4HR7 B;  1O78 A;  1I94 Q;  4TRD A;  3VDY A;  3HOZ G;  1HUN A;  1ZXT A;  1UE1 A;  5M5X H;  5EBC A;  4HCS A;  3T53 B;  2EDG A;  3I4O A;  5AFW A;  1SR3 A;  3KFU A;  5EQ0 A;  3K0Y A;  2RCN A;  3T1Y L;  1LTI D;  4DA2 A;  1EY6 A;  4DU9 A;  2VB2 X;  2ENB A;  2PI2 A;  1S72 A;  4RWS C;  3HKZ E;  3KJP A;  2UUB Q;  3ULJ A;  4C1N I;  4BY1 G;  4FYD A;  5JJL A;  3S15 B;  3MXP A;  3L9A X;  1KRS A;  2KCC A;  2E8G A;  4DNR B;  3IAY A;  1DOK A;  3AMU A;  5HUR A;  2EJM A;  2UXC Q;  3FMC A;  5C6A A;  5F2D A;  4ZLT F;  4XQQ A;  4JI3 L;  4KD3 A;  2YTY A;  4L5Q A;  1BCP C;  3S1Q B;  3UE0 A;  2Z4H A;  1HR0 W;  1YJ9 A;  1ESF A;  4QQB X;  1JOO A;  3M85 A;  4OO1 H;  1PZJ D;  4A3E H;  1MJC A;  1HZA A;  1RDP D;  4A3K H;  1G6P A;  4DV3 L;  4A3J G;  1L0Y B;  3LWE A;  4P72 A;  1UUP A;  1M4V A;  1I6H B;  2JA6 G;  1RCV D;  1II3 A;  1XNQ L;  3JAM c;  4OXP A;  4JV5 Q;  3SDZ A;  5DNF A;  1JOK A;  5IP9 G;  2J0T D;  4YIJ A;  2WAQ G;  2QIL A;  3RMH A;  1HPC A;  3QOJ A;  2F0S A;  4Q5V A;  3M4O B;  1CZG A;  4J15 A;  1C9O A;  1RIP A;  1S5C D;  4N8F A;  2K05 A;  2K28 A;  5L37 A;  5JJK A;  4A3L G;  2KCM A;  3D4R A;  5M3F G;  2R93 G;  4JBM A;  3KDF B;  3FKI B;  2UU9 L;  2K50 A;  1SEB D;  2PQE A;  3KBG A;  4APV A;  3KJO A;  1R9T B;  2BH8 A;  3A0J A;  2ZM6 Q;  2XWB B;  2IX1 A;  4BXX G;  3MA2 B;  2ICI A;  2ZT9 C;  3HOU H;  4LWC A;  1XX8 A;  3QG1 A;  5KYI A;  3CCM A;  5LMN Q;  5IGD A;  3E0E A;  1K83 B;  3NP8 A;  5ELF A;  4HMI A;  2A74 C;  1IYJ B;  1RTN A;  2KEE A;  5I2Y A;  1CT1 D;  2R92 G;  3D4D A;  1BCP B;  2F0U A;  5FJ8 G;  3T1Y Q;  2FIN B;  3C2P A;  2IW3 A;  1D2B A;  3RZD H;  4O1N A;  3AFP A;  1UE7 A;  4KKT A;  5GAD C;  2NUC A;  3NUC A;  1GUT A;  4DR2 L;  1H9S A;  3UDF A;  2NB0 A;  2EYP A;  4F87 A;  5FLX E;  3PO2 H;  4OEL B;  1LTG D;  3TME A;  3C3L A;  1GUW A;  1LLR D;  3I7F A;  1IBL L;  2XRQ D;  1GUG A;  2F0D A;  2XIW A;  4A3D G;  2KCN A;  1G51 A;  2LS0 1;  3N52 A;  3HOV H;  4C3H G;  4IJL A;  2X6G A;  4A93 H;  2HCI A;  1CA5 A;  4JI3 Q;  1VQM A;  4RCO A;  5BN4 A;  1WI5 A;  4BY1 B;  2HT1 A;  4OIJ A;  3VR4 A;  2EYL A;  4BBR G;  1VQ5 A;  4EVO A;  3TSS A;  2JA7 H;  3H0G G;  1DOL A;  2IPK D;  4XDX A;  3CXC A;  1VDZ A;  1H95 A;  4DV3 Q;  3DM1 A;  1G2T A;  1ROD A;  2HQE A;  4WFN 3;  1VQN A;  3R2I A;  3S14 B;  2JJQ A;  2D2C C;  4ME5 A;  2RSO A;  4RKL A;  1I4Q A;  1IKM A;  4U67 3;  1OXU A;  1E1O A;  2AQ2 B;  4RGN A;  2NVT B;  1PH8 A;  1VQB A;  1YJN A;  4K8J A;  1ZEQ X;  3RN2 A;  1GUO A;  1NY4 A;  5A35 A;  1B4O A;  4A3J B;  4L6T B;  3JAM L;  1GHK A;  3CAM A;  1V8Q A;  1YNN C;  1PH1 A;  4JBJ A;  1ZKO A;  1VF7 A;  4B08 A;  1N8R C;  3GTG H;  3J7Z C;  3VR6 A;  2TMP A;  4IFD G;  1LYL A;  2JA6 B;  3I2Z A;  3IL8 A;  4P75 A;  2DGY A;  1A0I A;  2A5H A;  3W1B A;  3UDI A;  2BH2 A;  5CGK A;  3K80 C;  2BA1 A;  5E3F A;  3WDN A;  1Q12 A;  5AJ3 Q;  1DD2 A;  1DZ1 A;  2BDO A;  1PH3 A;  2UU9 Q;  1PH4 A;  2IX0 A;  3V2T A;  1TS5 A;  1YHA A;  2PMZ B;  2ZTD A;  1SYG A;  1J9O A;  4NMZ A;  4R4C A;  4JC0 A;  5FO8 B;  3HOX G;  1JB3 A;  3GTO B;  3A7L A;  3S1M B;  3FDT A;  1EIG A;  5IGB A;  4A3I H;  5HGQ A;  1JWU D;  4H0L C;  3OWE B;  2F0G A;  3N6R A;  3CPF A;  4A3F H;  1HFN A;  1X56 A;  2CH4 A;  5M3F B;  3VR5 A;  4DF7 A;  1EEF D;  2K14 A;  1WCM H;  4IOA A;  3A5Z B;  3STB D;  2F4I A;  4Z9C B;  3TEH B;  2V4D A;  4BS9 A;  1V1P A;  5KNC A;  1R4Q B;  3AU7 A;  3CCR A;  1EYG A;  1I50 H;  2IY5 B;  1B44 D;  3QWN A;  1TWG B;  5CBA E;  2R92 B;  3M4P A;  3P20 A;  1CKM A;  4K6L A;  1LTB D;  1XPO A;  1D5Z C;  1ILQ A;  4FF2 A;  4DFA A;  3HP3 A;  4JOI A;  4IFD J;  4DR6 Q;  4NXM Q;  3RZO H;  3E9H A;  4XYO A;  4KHV A;  4RGT A;  4YHH Q;  3SK5 A;  4DV6 Q;  1G8Z D;  1ENC A;  3PF4 A;  2EY6 A;  1VMP A;  4A3B G;  3AQQ A;  4XQN A;  1EY7 A;  4XT1 B;  5JPM C;  4BY7 H;  3EIV A;  1Y8O B;  1IW7 C;  3WWV A;  2YTX A;  5FLM H;  4A3D B;  1YNJ D;  4AYB E;  2VQE L;  1SN8 A;  4C3H B;  1E7Z A;  2I5M X;  3BU2 A;  5LMU Q;  4OX9 Q;  4WOR A;  2BCO A;  4ZRZ A;  3MVV A;  4DNT B;  3LGJ A;  2CHB D;  3F8T A;  5KND A;  2OQK A;  2SNM A;  3LWU A;  1NCV A;  4BBR B;  2F3I A;  1STE A;  3H09 A;  3K7A H;  1I4X A;  3K57 A;  4JK1 C;  5C4X H;  1HA6 A;  4WRD A;  1DM0 B;  1B9M A;  1NTG A;  1SYE A;  2AUK A;  1ZYR D;  3T1H Q;  3HKZ G;  2PQA A;  3TQY A;  4GLX A;  1EOT A;  1QZH A;  3AFQ A;  2GVB A;  2JE6 I;  2RA4 A;  2B8F A;  1EWC A;  1CM9 A;  4LK1 C;  1H9J A;  3VYR A;  4HJ8 A;  4DV4 Q;  5E7N A;  2Z9H A;  4FP5 D;  3G7L A;  1JT8 A;  4OL7 A;  1K8O A;  3D0F A;  4JYA L;  4IUN A;  3DM3 A;  3TBI B;  2RKS A;  1Q1B A;  3CF5 A;  4A3G G;  1SE8 A;  1EZ6 A;  4MIU A;  1GXD C;  1P16 A;  2E5L L;  1A63 A;  4GLA C;  4DR1 Q;  3K58 A;  4YCV A;  2OTJ A;  3DUZ A;  4IFD I;  5C0X G;  3G4S A;  1PA6 A;  3HOW G;  1U5K A;  1SLJ A;  4DV5 L;  4CGY B;  2WP8 J;  1UAP A;  5JAV A;  2B3G A;  2EQS A;  3QOL A;  5DM6 3;  1MBY A;  2AUJ D;  3X3N A;  3HOZ H;  1X6O A;  2HCC A;  3SGI A;  1HQR D;  1FGB D;  4RCN A;  5FLX c;  1AH9 A;  2IHF A;  3U4Z A;  3MFG A;  1SYF A;  2NVY H;  4IUV A;  4JI0 Q;  4LUZ A;  1JQY D;  1K3B C;  2B8G A;  4PQX A;  1EEI D;  2R7Z G;  1PZI D;  5ELO A;  1IXR A;  4L5T A;  1MSG A;  1FGU A;  1J5E L;  2NZH A;  5JJZ A;  2JA8 H;  2HDL A;  2UUC Q;  5C3X A;  3GTM H;  2R7F A;  4A3B B;  3ULP A;  2E2I B;  3KLS A;  2HHH L;  4EX5 A;  2KCT A;  1SBB B;  1JWS D;  5C0X J;  3HKS A;  3MC0 B;  4HIK A;  4JCV E;  2ID0 A;  3RR5 A;  1UEB A;  4HTH A;  4M8A A;  5I2X A;  4LF8 L;  1S5E D;  3PO3 G;  5JEA H;  3BVG A;  4GKJ Q;  1G91 A;  1ICF B;  3SK6 A;  4A76 A;  2L11 A;  3I4M G;  2AKW B;  1XWE A;  4L63 B;  2ATW A;  2IJ0 A;  2OCE A;  3Q23 A;  5T1I A;  4TKO B;  1B53 A;  4YWL A;  1MKH A;  1A3V A;  3PUW A;  5ELC A;  4V19 0;  3JAM i;  4C56 C;  4JYA Q;  2F0T A;  1WJJ A;  2LXJ A;  3HKZ B;  4DR7 L;  2JEA I;  2B2W C;  3Q6S A;  1GO3 E;  3STB C;  4CBV A;  2E5L Q;  3Q8D A;  3I55 A;  4IOC A;  1HTP A;  3CPW A;  1O7L A;  1QUQ B;  1VQD A;  3BYT B;  1PYS B;  3KUP A;  2F4V L;  1EYC A;  2VS1 A;  4ZCK A;  4CKB A;  3D31 A;  2PI2 E;  5D3D A;  4DV2 L;  2NVX H;  4Y7N H;  4GNX C;  2B63 G;  1Z9F A;  4DK1 A;  3Q22 A;  4EQP A;  4A3G B;  1KLG D;  1DCZ A;  1LTR D;  1QG7 A;  2Z8L A;  2RDH A;  1TWC B;  5DM7 3;  2F0E A;  1JR0 D;  4JI8 L;  1TWF H;  1FNU A;  4MN3 A;  3GTJ H;  2VQF L;  2J4X A;  3MXG A;  2CKZ B;  3I8Z A;  4POF A;  2KHI A;  2BDN A;  1JE5 A;  3JAM E;  4I7Z C;  5M5Y H;  4LFA Q;  5KRU A;  3HOW B;  4K0K Q;  1E0B A;  1BR9 A;  2WB1 E;  3KYH C;  3S9W A;  4C3I H;  1Q1E A;  3PSI A;  4BBS H;  4CDC C;  3MEF A;  3A5U A;  1YNJ C;  5CV8 A;  5FLX L;  1FD7 D;  4F7X A;  3E0J A;  4K2K A;  3EQL C;  5C0X I;  3T13 A;  3VA7 A;  2G9H D;  4NKL A;  4CDD C;  5BR8 L;  1MJE A;  1O7I A;  3ULL A;  1NAP A;  4NXN Q;  4GOP A;  2LXK A;  3MHB A;  2QW7 A;  3I70 A;  1KIX A;  2VXW A;  2ZTC A;  2VUM G;  1TWA H;  2XGT A;  4MTN A;  1UWV A;  1LTA D;  3RD4 A;  4RHS A;  1UNS A;  2EY1 A;  4PNY A;  5KIX A;  1BKB A;  2HHH Q;  1ZYR C;  1HZ9 A;  4HJ7 A;  1HA5 A;  4KLK A;  3S2D B;  2EZV A;  3NEM A;  4LJZ C;  2CVR A;  1NNX A;  4OWT B;  3M3Y H;  4IUT A;  1TU2 B;  5CYU A;  1BBX C;  4R4O A;  2C5C A;  1N36 L;  2RQX A;  3TN2 A;  1X3Q A;  1EQQ A;  4DV0 Q;  3OTO L;  1BBU A;  1T5E A;  4TQU S;  4DNI A;  3UI2 A;  1LT5 D;  2LFN A;  2NWG A;  3PO3 B;  2Q8R E;  3G6J B;  1EZ8 A;  1MD2 D;  4KKU A;  4KKS A;  1EY5 A;  2KJX A;  5JVG 3;  5IGC A;  5C3W A;  3OIP A;  3I4M B;  1E2Z A;  3KF6 B;  4QB4 A;  2L12 A;  2F4V Q;  5FO9 B;  3L3O C;  3U58 A;  2ZJQ A;  4AYB G;  4DV2 Q;  2JN4 A;  2YU9 H;  1ASY A;  2F0H A;  1JCK B;  4LFC Q;  3MXU A;  3VR2 A;  3K59 A;  2MGS A;  1A62 A;  2RHS B;  2B2V C;  2VQF Q;  4X64 L;  3T51 B;  1HZC A;  1E24 A;  1CQV A;  1SYC A;  1SDF A;  4B3S Q;  4FXG C;  3HEJ A;  3NQT A;  2NVQ H;  3D3R A;  5LL6 X;  2K33 A;  2B63 B;  3K0X A;  1EQR A;  2AHO B;  1GM5 A;  1RD9 D;  2ZJR A;  2EXD A;  1TY2 A;  4OWX B;  1F2L A;  1U4L A;  4Q0F A;  2SNS A;  3OIQ A;  1XTD A;  4HCE A;  3ERS X;  3G48 A;  2EYM A;  3WOF A;  2B2Y A;  3FKI G;  1HXY D;  5BR8 Q;  1A2U A;  2K03 A;  1S4Z A;  2OEO A;  2A68 D;  2XN9 C;  2TSS A;  2ALY B;  4AH6 A;  2UXB L;  4A3L H;  4KY5 A;  1PYW D;  2R93 H;  4RH6 A;  3GTL B;  4KI0 A;  4DUZ L;  5D14 A;  1K8M A;  3R8B A;  3OWF A;  3Q24 A;  3BVZ A;  3S17 H;  4BXX H;  3RNU A;  1B8A A;  5ELD A;  4A3C H;  5J1Z A;  1NBW A;  4X3K A;  2DNE A;  4JW0 A;  4RAU C;  2R7D A;  5BN3 A;  5IT9 c;  1BOS A;  3A8K E;  2PNR C;  1JJC B;  3D6C A;  3GD7 A;  5FJ8 H;  3UDG A;  5EPK A;  3CQZ B;  1HNW Q;  3DHQ A;  3TZD A;  4LF4 L;  5M5W H;  1XMO L;  1YIJ A;  4M1U B;  3QIA A;  3OTO Q;  5E4W C;  3H6M A;  4ME3 A;  1SJE D;  1EY8 A;  1B3Q A;  3H3V H;  1J6Q A;  3K7U C;  1IL8 A;  3E6Z X;  2JEB I;  4JI7 Q;  5EPL A;  1Q8K A;  1B50 A;  2SOB A;  2E2J B;  1PLF A;  3S16 B;  5FO7 B;  1F2M A;  2CW0 D;  1XMQ L;  2Z6K C;  3J7A V;  5EJW A;  5J39 A;  3FP9 A;  1B7Y B;  1EFI D;  4BBR H;  4LMQ D;  3H0G H;  3MXN B;  2JP1 A;  4LNQ A;  2HUG A;  4X3U A;  4DAY B;  2NBF A;  1NSN S;  1AE2 A;  2D9U A;  1K8A C;  3J7Y W;  3GDE A;  3TP8 A;  3W3A A;  1BNZ A;  4AYB B;  5DLQ E;  4DAV A;  2SDF A;  3UE1 A;  1LM0 A;  4CKC A;  2EE1 A;  1LTS D;  1SMX A;  1QVF A;  1IW7 D;  4X62 L;  3P7J A;  4C1N K;  3GP7 A;  3SXH A;  4B3T Q;  4IQZ A;  1G2S A;  2I5L X;  4J8Q A;  2P5Z X;  1Q86 C;  3BZC A;  3V96 A;  3NEL A;  1HFG A;  2A69 D;  1GOZ A;  1HUM A;  2R3Z A;  4GOP B;  1C7Y A;  2AQ3 B;  3S2H B;  3F2C A;  2UXB Q;  1QNK A;  2F3V A;  1Y1V B;  4R4T A;  1W2B A;  3H91 A;  1PH5 A; 
#chains in the Genus database with same CATH homology
 4CKE A;  4CHT B;  3KLR A;  2FMM A;  1M8A A;  3J81 E;  1JWM D;  4DXG A;  3IFT A;  2M2L A;  4HED A;  2YYZ A;  3D4W A;  1ENF A;  2JYO A;  1EWH A;  3VYT A;  5IT9 L;  2OT2 A;  3T56 B;  4OHJ A;  4ZYS A;  1F9S A;  1STY A;  2XVS A;  3FPP A;  3EA6 A;  3A7A B;  3R2T A;  3NQI A;  1X32 A;  1JC7 A;  4K5X A;  3AB9 A;  1KTK A;  1F9R A;  5ELB A;  4RGO S;  1GHJ A;  1I3Q B;  1PTO B;  4N9P A;  3M7N A;  1ENA A;  5T1G A;  2NN6 H;  2OXP A;  5JPN C;  1XYI A;  3DWQ A;  5C4J B;  1KDA A;  2G9D A;  5EKK A;  5G3L F;  1MI2 A;  3ND8 A;  3PUY A;  3HRZ C;  2F0O A;  3BZD B;  5JOB A;  2A68 C;  4F8M A;  1KAB A;  4ZK9 B;  5LL6 S;  4OO1 G;  1MGS A;  5IOC A;  3BDC A;  3SHL A;  1PRT D;  1IYV A;  4PMW A;  2OF1 A;  1WTO A;  2EYJ A;  1OXV A;  2O5I C;  3BG3 A;  3PMF A;  1PMR A;  2K5Q A;  3F2U A;  1BCP F;  2DN8 A;  5I9O A;  3NBH A;  4HSV A;  2AWN A;  3BS1 A;  4HSP A;  2EVB A;  2B2U A;  1D5X C;  3C46 A;  2CW0 C;  3DMU A;  2JA5 B;  5CR3 A;  1IHZ A;  1VMC A;  3OHX C;  2WB1 B;  1F9P A;  1U9R A;  2F0P A;  1XTC D;  5COY A;  4FF1 A;  1D1I A;  3C1F A;  5D65 A;  5M5X B;  2HDM A;  5FOB B;  3W2D A;  4UDU C;  1S5D D;  1SSO A;  1SAP A;  5K5P A;  3NPP A;  2QF7 A;  1STG A;  5BN5 A;  2A69 C;  1J8I A;  3EJI A;  3QJY A;  1GUS A;  2NYZ D;  3MAQ A;  1WTV A;  1WTQ A;  2EJF C;  3SVM A;  5CV9 A;  1RF2 D;  2NTS A;  3DWA A;  3URY A;  4ZKB B;  1W6J A;  1Z47 A;  1TQO A;  4U68 A;  1B9N A;  2RVL A;  4NW2 A;  4RGM A;  1JIC A;  4A3E B;  2B2W A;  4EGV A;  4A3K B;  2K7V A;  2Q8T A;  3D8G A;  2K5D A;  1PFN A;  2F0W A;  5ELE A;  3KF8 A;  2L1B A;  5A2Q L;  4OO1 I;  1E2W A;  1MSH A;  5EBD A;  2D5D A;  1ILP A;  2EPB A;  4G7H C;  1GUN A;  1TVX A;  3NSW A;  1H9S B;  3SE0 A;  2N55 A;  3RLF A;  2EYF A;  2WKD A;  2F0L A;  4FXK C;  4P2C B;  2IL8 A;  4QMG A;  3SK4 A;  1Y1W B;  1DON A;  2R6G A;  3J80 E;  3OPO A;  3TP7 A;  2PPB C;  3P75 A;  4K14 A;  3HOU B;  4J1M A;  1A3T A;  5CBE E;  2K5W A;  3RZD B;  2KVM A;  1KNE A;  3PIP 3;  2FMC A;  2X6L A;  4LAA A;  1LTT D;  2AQ1 B;  5IT9 E;  1PRT C;  4IUU A;  2EYH A;  1IKL A;  3PO2 B;  1F77 A;  2NZ1 D;  2F1M A;  1LT3 D;  4I65 A;  5C44 B;  3PUX A;  3HOV B;  2DY8 A;  3NK9 A;  2DY7 A;  4A93 B;  3MZ5 A;  3OOC A;  4DK0 A;  3ERQ A;  3R3O A;  4IN3 A;  3TP5 A;  4DN4 M;  2RBM A;  1O7Y A;  2JA7 B;  5KGU A;  1TII D;  3SR1 A;  4G4K A;  1PFM A;  1WD1 A;  3O13 A;  3BYY B;  1ET6 A;  2Q8I B;  3U9S A;  2NN6 I;  5C4Z A;  5E4X A;  4XXE A;  4BWG B;  3J81 L;  4L8J A;  3GO5 A;  1EY9 A;  1V1P B;  3CU7 A;  1HHV A;  4FXD A;  1DYQ A;  5NUC A;  3GTG B;  2L9H A;  3BDO A;  3OSO A;  3VYS A;  1Z6H A;  1KDB A;  4RHR A;  1PRT B;  1R4P B;  1CHQ D;  3ERO A;  5CV5 A;  4X3T A;  2A6H D;  2AWO A;  2KHS A;  1C4Q A;  4A3I B;  3GQB A;  2D62 A;  2KUM A;  2F0I A;  4A3F B;  1DJR D;  2Z4I A;  5K36 G;  5D3I B;  1PTO D;  1QJO A;  4KN4 C;  1B3A A;  1WCM B;  2FFK B;  4H44 C;  3S1N B;  1XXG A;  3NXW A;  1H9K A;  4G57 A;  3LNN A;  1D1K A;  1ICW A;  2F0M A;  1O80 A;  2B2T A;  2ZXP A;  4QUC A;  1I50 B;  5IGE A;  3I4L A;  2MUY A;  1HRJ A;  2X69 A;  1STA A;  2O2L D;  3ND9 A;  3HGB A;  4DAP A;  3RZO B;  3QB3 A;  2WIN B;  3HG9 A;  1ET9 A;  2F0K A;  4BY7 B;  4CJ0 B;  4FNF A;  5EGT A;  4XT3 B;  1JOR A;  3DEO A;  2F03 A;  1BO0 A;  4B9X A;  2XRS D;  2R61 A;  5JEA G;  3OMC A;  1CHP D;  2PZT A;  2QDB A;  1WTR A;  4WJW A;  2A73 B;  3K7A B;  5C4X B;  2ICE C;  4G7Z C;  4RKB A;  3NTI A;  1LAB A;  2F3W A;  5J22 A;  4FO2 A;  5DEH A;  4PMC A;  5CV6 A;  1CI3 M;  1SE3 A;  3MTS A;  2F0J A;  4E6I A;  5EPJ A;  3KBX A;  4C3J G;  1STN A;  2E2D C;  4R8N A;  3ONA B;  4KHZ A;  1HCZ A;  2LKV A;  1LO5 D;  1EU3 A;  3WOE A;  4C3I G;  5FKA C;  1U4P A;  3PUZ A;  5A2Q E;  2SEB D;  3DEP A;  1Q90 A;  3HOZ B;  3E5S A;  1H9M A;  5HGT A;  1TR5 A;  3CHB D;  1JOQ A;  2WAC A;  4ZQ3 A;  1RJT A;  2VB3 X;  2NVY B;  3ZYY X;  2JSO A;  3FRP B;  4R8I A;  1LT4 D;  1EY0 A;  1WTP A;  4KD4 A;  4QF4 A;  1EL0 A;  1STB A;  1EQV A;  2JA8 B;  1I4P A;  2IX3 A;  4G7O C;  3Q0A A;  1TKW B;  3GTM B;  5CV7 A;  5COR A;  3CKI B;  4KV6 A;  4QCL A;  3CRL C;  2WKC A;  4V0B A;  1Y69 U;  1SJH D;  2A6E D;  2A6H C;  4ABN A;  1EIH A;  4S3S A;  2E76 C;  1PTO C;  4KY6 A;  4PMB A;  2E74 C;  1WVL A;  2XSC A;  1EYD A;  4IFD H;  1BDO A;  1BQQ T;  1AN8 A;  3J80 L;  4HN7 A;  2NVX B;  4Y7N B;  3K5N A;  1WTW A;  4EQO A;  4KMU C;  2K1B A;  2IWH A;  1PDQ A;  1TWF B;  4C3J B;  3GTJ B;  1BUV T;  2PW5 A;  1OXT A;  2B2Y C;  2BOS A;  2BA0 A;  4TSS A;  3SK8 A;  5KNB A;  5M5Y B;  4OIK A;  4C3I B;  4K5W A;  4BBS B;  2WII B;  1FNV A;  4N9T A;  2QEJ C;  3FEW X;  1DXM A;  1LT6 D;  1D6E C;  3RUZ A;  4PV1 C;  5M9O A;  1SNP A;  4R9W A;  1ONL A;  1F2Y A;  1TS3 A;  1TWA B;  1GJX A;  2BE5 C;  4H7B A;  1EYA A;  2H1E A;  1I4H A;  3DXJ C;  1WTX A;  4HMJ A;  1CTM A;  1STH A;  3BVM A;  4ID6 A;  1RKN A;  5C5M A;  2FHT A;  4K2L A;  1SE4 A;  2KA7 A;  1W6K A;  2E75 C;  1RTO A;  3M3Y B;  4F88 A;  4K6D A;  3I90 A;  4RA8 A;  1A6X A;  2J7Z A;  2LY7 A;  3M4Y A;  1HQM C;  4DGZ A;  1QOH A;  1OXS C;  3VA5 A;  4O42 A;  1PZK D;  3J7A F;  1T5X D;  3FPU B;  3IKJ A;  3OMG A;  1ESR A;  4DXF A;  2F0Q A;  2YU9 B;  5TSS A;  1FYC A;  1KLU D;  3A8I E;  4H13 C;  1BXT A;  4EQN A;  3H3V C;  1U4R A;  2IT1 A;  5CMD A;  4K8I A;  2NVQ B;  2M9V A;  1SNO A;  1SMY C;  3EFX D;  5I6W A;  4IZ8 A;  2O5J C;  2CQA A;  5C0X H;  3EVQ A;  3I73 A;  1SE2 A;  2WAQ B;  3R93 A;  3A8J E;  1HTL D;  3M7G A;  1CZW A;  4XYQ A;  1Z7T A;  3NHH A;  2RDF A;  2C9O A;  3VR3 A;  1PTO F;  3I3C A;  2R93 B;  4JBW A;  2ZXR A;  1G29 1;  1DOM A;  2ZXO A;  4ZUJ A;  4RFB A;  1F9Q A;  4IUQ A;  5KEE A;  3K5L A;  1SXT A;  2QCP X;  3S17 B;  1I4G A;  2A6E C;  3PIO 3;  1QE6 A;  3IFD A;  1O7Z A;  4BA1 I;  4ODG A;  2MP1 A;  5I4D A;  2K32 A;  5M5W B;  1S5B D;  2PCF B;  4ILW A;  1D5M C;  1OO9 B;  4ZUI A;  1CK1 A;  1AZP A;  1UEA B;  2NN6 G;  3MWY W;  1AFP A;  1Y8P B;  2F0F A;  4NP5 A;  3T4A C;  1EU4 A;  4OGQ C;  5CV4 A;  4HAE A;  2L4N A;  3H0G B;  3DWP A;  1KAA A;  5KYL A;  2KED A;  1SYB A;  4J6H A;  1CFM A;  3P1H A;  3V05 A;  3NTK A;  1RHP A;  1B1Z A;  3K6O A;  2Y0S B;  2GA4 B;  2PW7 A;  3K5O A;  1ML0 D;  4GZY C;  2L55 A;  3TP6 A;  3X3M A;  1U4M A;  2K01 A;  4QIW B;  3NWS A;  5DAU A;  1EY4 A;  1S5F D;  3D6W A;  1B2T A;  3KLS X;  3LX0 A;  3A56 A;  3CRK C;  3HOX B;  2H4O A;  1Y8N B;  4KJN A;  4A3M B;  2M00 A;  1H9R A;  2F0V A;  1TWH B;  1LV9 A;  2EY5 A;  5K36 H;  2N88 A;  2B2U C;  4IUR A;  3H94 A;  5IIF A;  5I6Y A;  2PZW A;  4IUP A;  1F2Z A;  2MHV A;  4KTA A;  3L7Z C;  1IYU A;  1LAC A;  3SEB A;  2NTT A;  1QCB D;  4IAL A;  2MPM A;  2VNU D;  1SYD A;  2I07 B;  1A15 A;  2DNC A;  3I4N B;  2E2H B;  2B39 A;  2RSN A;  5CC4 A;  1NR4 A;  4K5V A;  5IGG A;  2JXM B;  1Q8I A;  4B9W A;  1VF5 C;  5G3L D;  3HOY B;  2LMC B;  1PXU A;  5JVH 3;  1NUC A;  2EYO A;  1V43 A;  1SNQ A;  5FK9 C;  2B2V A;  3FVQ A;  4ULL A;  5ISR A;  3NWT A;  4KY7 A;  3GTP B;  5M3M B;  1FR3 A;  2L5T A;  3I91 A;  3OW7 A;  2PO4 A;  5EKI A;  2WV6 D;  3NBI A;  1QB5 D;  4FF3 A;  3MXN A;  4KJO A;  4DAY A;  1QNU A;  2EY2 A;  1BCP D;  2PYK A;  1AP0 A;  1BF4 A;  5IOD A;  4C2M B;  1QWY A;  2EJG C;  3GV3 A;  4ZAI A;  5IGF A;  5I9P A;  1TY0 A;  4CJ1 B;  1TT2 A;  1AW7 A;  3T16 A;  4QUF A;  4UAI A;  2EOT A;  3GTQ B;  3S1R B;  3U9O A;  1EQT A;  1SNC A;  2K6A A;  2FJ2 A;  5C5L A;  2XNA C;  3C1E A;  1PTO H;  1G6Z A;  2R7Z B;  1A3U A;  4XTC S;  1WD0 A;  3PUV A;  1KDC A;  2EXZ A;  2KOL A;  1CA6 A;  2XWJ B;  3GTK B;  3I72 A;  1CQF A;  1QIL A;  1KNA A;  1SNM A;  1PFB A;  2KEC A;  3BDL A;  3K5M A;  1JE4 A;  4FF4 A;  1A2T A;  5LHY 1;  2KQ3 A;  4FVM A;  2Z1C A;  1SFO B;  4CJ2 C;  2BE5 D;  3PV0 A;  1SND A;  3MFY A;  5C4H A;  1V1O A;  1PRT F;  2MJ8 A;  1X3P A;  1VCI A;  3A54 A;  4KK7 A;  2L0C A;  5E1F A;  2F0N A;  3GV6 A;  4NDX A;  1E2V A;  1TS2 A;  4ZKC B;  2QKI C;  3TDQ A;  1OXX K;  5EKL A;  3HS0 C;  3NTH A;  1FNW A;  3VYU A;  3HZX A;  1I6V C;  2I46 A;  3A55 A;  3QO2 A;  5JEA J;  4XQJ A;  2O4X A;  5C3E B;  1C48 A;  1AZQ A;  3ITP A;  1L0X B;  4XIG S;  3KK7 A;  2RDG A;  1AEX A;  3TZU A;  1YNN D;  4MHE A;  4X3S A;  1Q3L A;  3NE5 B;  2K04 A;  4KN7 C;  1SMY D;  3MEH A;  2PZU A;  1NR2 A;  2B2T C;  1C8C A;  1I4R A;  1TS4 A;  2VUM B;  4BA2 I;  4HR7 B;  1O78 A;  1HUN A;  4TRD A;  1ZXT A;  5EBC A;  4HCS A;  3T53 B;  2EDG A;  5AFW A;  5EQ0 A;  3K0Y A;  1LTI D;  4DA2 A;  1EY6 A;  4DU9 A;  2VB2 X;  2ENB A;  4RWS C;  4FYD A;  4C1N I;  3S15 B;  3MXP A;  3L9A X;  2KCC A;  4DNR B;  3IAY A;  1DOK A;  3AMU A;  5HUR A;  2EJM A;  3FMC A;  5C6A A;  5F2D A;  4ZLT F;  4XQQ A;  4KD3 A;  3S1Q B;  1BCP C;  2Z4H A;  1ESF A;  1JOO A;  3M85 A;  4OO1 H;  1PZJ D;  1RDP D;  1L0Y B;  3LWE A;  1UUP A;  1M4V A;  1I6H B;  1RCV D;  1II3 A;  3SDZ A;  5DNF A;  1JOK A;  2J0T D;  4YIJ A;  2QIL A;  3RMH A;  1HPC A;  3QOJ A;  2F0S A;  4Q5V A;  3M4O B;  1CZG A;  1S5C D;  2K05 A;  2K28 A;  3D4R A;  3FKI B;  2PQE A;  1SEB D;  3KBG A;  1R9T B;  2XWB B;  2IX1 A;  3MA2 B;  2ICI A;  2ZT9 C;  1XX8 A;  3QG1 A;  5KYI A;  5IGD A;  1K83 B;  3NP8 A;  5ELF A;  4HMI A;  2A74 C;  1RTN A;  2KEE A;  5I2Y A;  1CT1 D;  3D4D A;  1BCP B;  2F0U A;  2FIN B;  3C2P A;  2IW3 A;  1D2B A;  4O1N A;  4KKT A;  2NUC A;  3NUC A;  1GUT A;  1H9S A;  2NB0 A;  2EYP A;  4F87 A;  5FLX E;  1LTG D;  3TME A;  3C3L A;  1GUW A;  1LLR D;  2XRQ D;  1GUG A;  2F0D A;  2XIW A;  2KCN A;  2LS0 1;  3N52 A;  4C3H G;  2X6G A;  2HCI A;  1CA5 A;  4RCO A;  5BN4 A;  4BY1 B;  4OIJ A;  3VR4 A;  2EYL A;  4EVO A;  3TSS A;  1DOL A;  2IPK D;  4XDX A;  1VDZ A;  3DM1 A;  1G2T A;  1ROD A;  2HQE A;  4WFN 3;  3R2I A;  3S14 B;  2D2C C;  4ME5 A;  2RSO A;  4RKL A;  1I4Q A;  1IKM A;  4U67 3;  1OXU A;  2AQ2 B;  4RGN A;  2NVT B;  4K8J A;  1ZEQ X;  1GUO A;  5A35 A;  1B4O A;  4A3J B;  4L6T B;  3JAM L;  1GHK A;  1V8Q A;  1YNN C;  4B08 A;  1ZKO A;  1VF7 A;  3VR6 A;  2TMP A;  4IFD G;  2JA6 B;  3IL8 A;  2A5H A;  5CGK A;  2BA1 A;  5E3F A;  3WDN A;  1Q12 A;  1DD2 A;  1DZ1 A;  2BDO A;  2IX0 A;  3V2T A;  1TS5 A;  2PMZ B;  1SYG A;  1J9O A;  4NMZ A;  5FO8 B;  1JB3 A;  3GTO B;  3A7L A;  3S1M B;  3FDT A;  1EIG A;  5IGB A;  1JWU D;  4H0L C;  3OWE B;  2F0G A;  3N6R A;  1HFN A;  5M3F B;  3VR5 A;  4DF7 A;  1EEF D;  2F4I A;  4Z9C B;  2V4D A;  4BS9 A;  1V1P A;  5KNC A;  1R4Q B;  3AU7 A;  1B44 D;  3QWN A;  1TWG B;  5CBA E;  2R92 B;  3P20 A;  4K6L A;  1LTB D;  1D5Z C;  1ILQ A;  4FF2 A;  4DFA A;  3HP3 A;  4IFD J;  4XYO A;  4KHV A;  4RGT A;  3SK5 A;  1G8Z D;  1ENC A;  2EY6 A;  1VMP A;  4XQN A;  1EY7 A;  4XT1 B;  5JPM C;  1Y8O B;  1IW7 C;  4A3D B;  1YNJ D;  4C3H B;  4WOR A;  2BCO A;  4ZRZ A;  3MVV A;  4DNT B;  2CHB D;  5KND A;  2SNM A;  3LWU A;  1NCV A;  4BBR B;  1STE A;  3H09 A;  1I4X A;  3K57 A;  4JK1 C;  1HA6 A;  4WRD A;  1DM0 B;  1B9M A;  2AUK A;  1SYE A;  1ZYR D;  1EOT A;  2JE6 I;  2RA4 A;  2B8F A;  1EWC A;  1CM9 A;  4LK1 C;  1H9J A;  3VYR A;  4FP5 D;  3G7L A;  4OL7 A;  1K8O A;  4IUN A;  3TBI B;  2RKS A;  1Q1B A;  1EZ6 A;  4MIU A;  1GXD C;  3K58 A;  3DUZ A;  4IFD I;  5C0X G;  4CGY B;  2WP8 J;  1UAP A;  5JAV A;  3QOL A;  5DM6 3;  1MBY A;  2AUJ D;  3X3N A;  2HCC A;  1HQR D;  1FGB D;  4RCN A;  3MFG A;  1SYF A;  4IUV A;  1JQY D;  2B8G A;  4PQX A;  1EEI D;  1PZI D;  1MSG A;  5JJZ A;  2HDL A;  5C3X A;  4A3B B;  2E2I B;  3KLS A;  1SBB B;  1JWS D;  5C0X J;  3MC0 B;  2ID0 A;  4M8A A;  4HTH A;  5I2X A;  1S5E D;  5JEA H;  3BVG A;  1G91 A;  3SK6 A;  2L11 A;  1XWE A;  4L63 B;  2IJ0 A;  3Q23 A;  5T1I A;  4TKO B;  1B53 A;  1A3V A;  3PUW A;  5ELC A;  4V19 0;  4C56 C;  2F0T A;  3HKZ B;  2JEA I;  2B2W C;  3Q6S A;  4CBV A;  1HTP A;  1O7L A;  3BYT B;  3KUP A;  1EYC A;  4CKB A;  3D31 A;  5D3D A;  4DK1 A;  3Q22 A;  4EQP A;  4A3G B;  1KLG D;  1DCZ A;  1LTR D;  1QG7 A;  2Z8L A;  2RDH A;  5DM7 3;  1TWC B;  2F0E A;  1JR0 D;  1FNU A;  4MN3 A;  2J4X A;  3MXG A;  3I8Z A;  2BDN A;  3JAM E;  4I7Z C;  5KRU A;  3HOW B;  1E0B A;  1BR9 A;  3S9W A;  1Q1E A;  1YNJ C;  5CV8 A;  5FLX L;  1FD7 D;  4F7X A;  3E0J A;  4K2K A;  3EQL C;  5C0X I;  3T13 A;  3VA7 A;  2G9H D;  4NKL A;  1NAP A;  3MHB A;  3I70 A;  2VXW A;  1LTA D;  3RD4 A;  4RHS A;  1UNS A;  2EY1 A;  4PNY A;  5KIX A;  1ZYR C;  1HA5 A;  3S2D B;  2EZV A;  4LJZ C;  2CVR A;  4IUT A;  1TU2 B;  5CYU A;  1BBX C;  2C5C A;  2RQX A;  3TN2 A;  1X3Q A;  1T5E A;  4TQU S;  3UI2 A;  1LT5 D;  2LFN A;  2NWG A;  3PO3 B;  2Q8R E;  3G6J B;  1EZ8 A;  1MD2 D;  4KKU A;  4KKS A;  1EY5 A;  2KJX A;  5JVG 3;  5IGC A;  5C3W A;  3OIP A;  3I4M B;  1E2Z A;  4QB4 A;  2L12 A;  5FO9 B;  3L3O C;  2F0H A;  1JCK B;  3MXU A;  3VR2 A;  3K59 A;  2MGS A;  2B2V C;  3T51 B;  1CQV A;  1SYC A;  1SDF A;  4FXG C;  3HEJ A;  3NQT A;  3D3R A;  5LL6 X;  2K33 A;  2B63 B;  1RD9 D;  1TY2 A;  1F2L A;  1U4L A;  4Q0F A;  2SNS A;  3OIQ A;  4HCE A;  2EYM A;  3WOF A;  2B2Y A;  1HXY D;  1A2U A;  2K03 A;  1S4Z A;  2OEO A;  2A68 D;  2XN9 C;  2TSS A;  4KY5 A;  1PYW D;  4RH6 A;  3GTL B;  4KI0 A;  5D14 A;  1K8M A;  3R8B A;  3OWF A;  3Q24 A;  3BVZ A;  5ELD A;  5J1Z A;  4X3K A;  2DNE A;  4RAU C;  5BN3 A;  1BOS A;  3A8K E;  2PNR C;  3GD7 A;  3D6C A;  5EPK A;  3CQZ B;  3DHQ A;  3TZD A;  4M1U B;  3QIA A;  5E4W C;  3H6M A;  1SJE D;  1EY8 A;  1IL8 A;  3E6Z X;  2JEB I;  5EPL A;  1B50 A;  2SOB A;  2E2J B;  1PLF A;  3S16 B;  5FO7 B;  1F2M A;  2CW0 D;  3J7A V;  5EJW A;  5J39 A;  1EFI D;  4LMQ D;  2JP1 A;  2HUG A;  4X3U A;  2NBF A;  1NSN S;  2D9U A;  3J7Y W;  3TP8 A;  3W3A A;  1BNZ A;  4AYB B;  4DAV A;  2SDF A;  4CKC A;  2EE1 A;  1LTS D;  1IW7 D;  3P7J A;  4C1N K;  3GP7 A;  3SXH A;  4IQZ A;  1G2S A;  4J8Q A;  3V96 A;  1HFG A;  2A69 D;  1GOZ A;  1HUM A;  2R3Z A;  2AQ3 B;  3S2H B;  1QNK A;  2F3V A;  1Y1V B;  3H91 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...