3STBC

A complex of two editosome proteins and two nanobodies
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
111
structure length
111
Chain Sequence
AAHWRCVNHCVMLGVVQNIQEGFVFEDKVLQFTLITDFEGPSPGDPDKDFHTVRVFDSDYSSRVKEQLRDGEWFLVTGRLRMVPQYDGSMRKYYHYPVIQVHPGCGSVLKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords single domain antibody VHH
publication title Crystal structure of a heterodimer of editosome interaction proteins in complex with two copies of a cross-reacting nanobody.
pubmed doi rcsb
source organism Lama glama
molecule tags Rna binding protein/immune system
total genus 17
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2011-07-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3stbC00
4DV6Q 4DV6L 1E22A 1Q46A 3L0OA 3CC2A 1BVSA 1K3RA 3AYHB 1TWAH 1TWHH 4A76A 2I5HA 2VS1A 3CD6A 3CCRA 3CCVA 1EFWA 3SGIA 2XTIA 1OXUA 4JOIA 4JBWA 2QA4A 3PUXA 1VQCA 2K50A 2B63H 4A3LG 1FJGQ 3CMAA 1FJGL 4JI0Q 4JI0L 3PUWA 4R4QA 3I2ZA 4JV5L 1D8LA 4L5SA 4O2DA 3JAMc 2Q2UA 1E1TA 2IHFA 3STBD 1VQPA 3CCLA 4QL5A 3ER0A 5ELOA 3MXNB 5M5YH 1OTCA 2Z0SA 4A3GH 1GO3E 1A62A 4LF5Q 4LF5L 4IPHA 1I5FA 3CC4A 5IP9H 3BU2A 4OO1I 2R92G 1OXXK 4GOPC 4A3EG 1EIFA 2HQLA 3GTKH 1AH9A 1HR0Q 1HR0L 3A0JA 4DKAC 5C0XG 2PQAA 1YHBA 3W5OA 4DV3Q 3CCQA 4DV3L 5IWAQ 2K14A 3CCUA 1Y1WH 1O7IA 4EX5A 2JK8A 4JC0A 1N8RC 4P75A 1NJIC 3E0EA 2D0PA 3D31A 3RLFA 3HOZG 5JJLA 4LUZA 2E2JH 2MQHA 2ID0A 3OW2A 3K0XA 1CKMA 3S2HH 4LFBQ 4LFBL 1S40A 1EUJA 2A19A 1VQKA 1B7YB 2E5LQ 2E5LL 1VQ4A 3S15H 2A8VA 5ELNA 1GD7A 2VL6A 4IOCA 4NPSA 3RNUA 3T1YQ 1SMXA 1KL9A 3PGZA 3I55A 1EOVA 5IYDG 1C7YA 1N36Q 1N36L 3ULLA 1J5EL 2I0QA 4IPCA 4HJAA 3M7NA 4X6AH 2C35B 1JJGA 2IT1A 1S72A 3TRZA 3K7AH 1QZHA 1CKNA 2VW9A 2NVXH 3KDFA 4A3IH 1S3OA 1HZCA 2OQKA 4RMFA 3HOVH 2NVYH 4UP7A 3H0GH 2ASBA 4JCVE 4KHZA 4A3FH 1C0AA 4TVAB 3J81i 4HJ5A 4JI6Q 4JI6L 1JJCB 4IO9A 4UP9A 4NXNL 1PH7A 1GM5A 1QVGA 4NXNQ 4A3CH 1BBWA 1VQBA 1PFSA 4PZ7A 1JMCA 3CCEA 2IX1A 1IBML 1KRTA 1PYSB 3UDGA 2D62A 2B29A 2IX0A 4YWMA 4R1JA 4RG1A 2JA6H 1PH8A 5GADC 1SRUA 2OTJA 3VDYA 4GOPB 3PIPA 3DLLA 2HHHQ 2HHHL 2EQSA 4X65Q 4X65L 2L15A 4GLVB 4DV4L 2VQEQ 2VQEL 2BA1A 4DV4Q 3TS0A 4OWWB 2F52A 2QEXA 4BY1G 2Q2HA 4AIMA 3M4PA 1YI2A 1PH6A 1FL0A 1V9PA 4A3BG 4TQUS 3U4VA 4BXXH 4B3MQ 4B3ML 5C4JH 1Y1VH 4DV2L 4DV2Q 1I50H 4BA1I 4DR2L 2DUDA 3H15A 4DR2Q 1XPUA 4QY7A 2FXQA 3J7A5 1VQHA 1XJVA 1QVFA 3HOYG 3M4QA 3FKIG 3J81j 1W3SA 2ES2A 2RF4A 4PZ8A 1MJCA 1PA6A 2VUMH 3PO3H 1VQOA 1XNQQ 1XTDA 2R6GA 1MJEA 4APVA 1VQ8A 1XNQL 1CSPA 1FGUA 3OYYA 2PMZE 5GAGC 4LFCQ 4LFCL 1CKOA 4R4IA 4JI1L 5JJKA 5M3MH 2JA9A 4X66L 4LF6Q 4LF6L 2R7ZG 4C3JH 4UP8A 2NVTH 5C44H 3TREA 1M90C 1K0RA 2WP8J 2K75A 1X3EA 5GAEC 4A3JG 2JA5H 3JAMi 1QUQB 2PI2A 3AFQA 3HKZG 4P73A 5H1SE 5M3FG 2E2HH 2R7DA 1XMQQ 1XMQL 2YTYA 2NN6G 4MNOA 1HH2P 5IP7H 1Y1WG 1KQSA 1N32L 3F2DA 1N32Q 1N9WA 1VQ9A 1K83H 4GKJQ 4GN4B 4B3RQ 4B3RL 4LUOA 2EIFA 3FHWA 4QGUA 1G51A 1NMFA 4BBRH 1JT8A 1V1QA 3GTGH 3PV0A 4GNXC 2PI2E 4JBJA 5C0XJ 2ZJRA 1E24A 1SN8A 2HT1A 4JI2Q 2QGQA 5IYCH 3GTLH 2BA0A 3I4NH 1YHQA 2JA8H 2N3SA 4DR1Q 2ZJQA 2VNUD 1B70B 4DPGA 4JI5Q 4JG2A 4JI5L 5IYBH 2MFIA 1VQLA 2NVQH 1IXRA 1YJ9A 1I6HH 4A93H 1HZ9A 1NY4A 1X3FA 1KC8C 1A63A 1YEZA 1W2BA 1VQNA 2KCMA 1LM0A 1CUKA 4KI0A 4HJ7A 1PH1A 1IBKL 1IBKQ 4AYBE 5GQOA 4O0AA 1HNZL 1AE2A 5M5WH 1HNZQ 1I94Q 1I94L 4QJFA 4JI3L 4JI3Q 1LUZA 3GTOH 2AWNA 4LW1A 3K7UC 4C3IH 2RHSB 2ZTCA 4OONA 4YCVA 4POFA 2K52A 5IWAL 2Z6KA 3HKSA 5AJ3Q 3CP0A 5AJ3L 1X65A 3KF6B 1PH5A 4LF9Q 1L1OA 2YV5A 3J7ZC 4LF9L 3STBC 1E3PA 5C4XH 5JEAG 1A0IA 2A1AA 2JEAI 1IYJB 3M4OH 4DV0Q 4DV0L 4L5TA 4QIWE 1E1OA 1Y14B 4DR7L 4DR7Q 1K73C 3H3VH 2MO0A 4R4TA 2Y0SE 4FDBA 3HOWG 2JE6I 1YVCA 3OTOL 3BJUA 3OTOQ 1XPRA 4HJ8A 1EIYB 4B3TL 4B3TQ 2F4VQ 2F4VL 3HOUG 1HNWL 1X56A 1KAWA 3BZKA 1YIJA 1Q82C 4OO1G 2UUAQ 2UUAL 3G6EA 3ICEA 1UE1A 1MKHA 2WAQG 3CMEA 3KOJA 2AWOA 4YWLA 1U5KA 2YTXA 3TEHB 2D0OA 2CFMA 3GTJH 1YBYA 3G48A 4A3KH 3D0FA 3RZOH 1X55A 4AQYQ 4P71A 4AQYL 4A3IG 5FJ8G 5C3EH 4MTNA 4GNXB 2E8GA 2WAQE 3H0GG 5FLMH 3K8AA 4A3MH 3HOZH 1H95A 3S14H 1UE6A 4B3SQ 1SLJA 4DK3C 4A3CG 1N34Q 2OCEA 3CW2C 1N34L 3BZCA 1EQQA 3AEVA 1WYDA 3EN2A 4H02A 4IOAA 4P74A 2OWOA 2WB1E 3F2CA 3PUYA 1HJPA 2JA6G 1YNXA 1SFOH 3I4MH 2CWAA 1LTLA 4POGA 3E9IA 1G291 2PNHA 4DR4Q 4DR4L 5LMNW 2IY5B 4IFDJ 2NZHA 2LXJA 2R93G 4BBSH 3CPWA 4L5RC 3S1NH 4ALPA 4BXXG 1Y1VG 4GLAC 1VS0A 4LFAQ 3F2BA 4DV5L 4DV5Q 4LFAL 3GTQH 1XMOQ 3CAMA 1IL2A 1KD1C 1NBWA 1SR3A 2LSSA 2BH8A 1NTGA 3HOXG 1HZBA 2JQOA 2ZJPA 1Q7YC 2VUMG 3PO3G 1VQJA 3NBHB 4A3DH 2RCNA 2GN5A 3FP9A 2KENA 3I4OA 4YY3Q 4YY3L 1KIXA 2ZM6Q 1T9HA 2ZM6L 4K0KQ 4K0KL 3S16H 1L0WA 2VQFL 4GN5A 2VQFQ 3S24A 4JOIC 3KFUA 3DM3A 4PZ6A 5GROA 3CXCA 4JI8Q 2AHOB 4JI8L 2LXKA 4OWXB 3ZJYC 5K36G 3A74A 3AFPA 2JA7G 1NE3A 3EIVA 5C44G 1YITA 4DV1Q 4DV1L 4NB3A 2JA5G 2BH2A 3JC66 3M9BA 3KF8B 4X62L 3UDFA 4X62Q 4DUYQ 4DUYL 2UXDQ 4A75A 2UXDL 2R7FA 1VQDA 3K80C 5IP7G 1X3GA 3KJPA 2WFWA 4Y52H 4GLXA 2YTVA 2ATWA 2AMCB 2K5HA 4P72A 3ULPA 4BY7H 1Q12A 1WCMG 2Z6KC 4BBRG 5LMUQ 5LMUL 4GKJL 4HIMA 4L5QA 1L1OC 3PUVA 4DV7Q 4DV7L 1ASZA 4WJ4A 1QVCA 3U58A 3H3VI 2VY3A 5IYCG 1BKBA 1JE5A 1VQMA 1IBLQ 1IBLL 3I4NG 1P8LA 2JA8G 1LYLA 1IZ6A 4R4CA 4JI2L 3L2PA 2B63G 3CC7A 1Z9FA 2MO1A 1VQFA 1EQRA 3GD7A 1SE8A 4DR1L 1VQ6A 1CSQA 3F8TA 1Z47A 2KHIA 3PUZA 4YWKA 1YJNA 1PH3A 1HNXQ 4AYBG 1PHJA 4BA2I 1N33Q 1N33L 4A93G 4DUZQ 3CCJA 4DUZL 1KXLA 4A3GG 3T1HQ 2H5XA 3T1HL 3I56A 5M3FH 5J3BA 4C3HH 5IP9G 2AKWB 4HIOA 3GTMH 3PO2H 4IFDG 1WJJA 4AH6A 3S2DH 5C0XI 1UE7A 3PIOA 1SROA 2YYZA 2ALYB 3PF5A 3KF6A 4WJ3M 4IPDA 4DR5Q 4DR5L 5IY0A 4LF7Q 4LF7L 2JEBI 3UDIA 3RN5A 1FVIA 4HIKA 2Y0SG 2IHEA 4HJ9A 2E2IH 1VCIA 4A3LH 1I3QH 3HFZB 2EXDA 3KLWA 4IJLA 2JJQA 3J80c 2Q2TA 4KHPQ 4KHPL 1OXVA 3B6YA 3KJOA 3RN2A 4DR3Q 1MIUA 1V43A 3RLNA 3RLOA 4DR3L 1PH4A 1JJ2A 1G6PA 1VQAA 2I5LX 3EBEA 4UPAA 1X6OA 4ME3A 2R92H 1R9TH 1HNWQ 3AQQA 1BBUA 3TQYA 3CCSA 4A3EH 1XNRQ 4LUVA 2K4KA 2PQAB 1B8AA 1RIPA 4JBMA 1XNRL 4A3KG 2CKZB 3M85A 2N49A 1AE3A 1X54A 1OXSC 3E9HA 3PSIA 1Q81C 2YU9H 3PF4A 1L1OB 3W1GA 3IRBA 5C3EG 5FLXc 3K81C 1GKHA 5E7NA 5FLMG 4A3MG 2KBNA 4EQ5A 3A5UA 4GNXA 5IE8A 3HOVG 1UEBA 1HR0W 2K5NA 3G4SA 4DAMA 4B3SL 4A3FG 2WB1G 3UE1A 4J15A 1U0LA 1XPOA 1OXTA 2CQOA 1X9NA 4OXPA 3CQZH 4PMWA 1A8VA 5GAHC 1UE5A 5LMNL 5LMNQ 4HIDA 3HOWH 3GDEA 3HOUH 2GVBA 2DGYA 3CPFA 4DNIA 3I4MG 2UU9Q 1TWGH 4DK6C 2UU9L 5HY6A 5C4XG 3NEMA 4YCWA 1P16A 4JBKA 4DR6Q 4DR6L 2NZOA 1J5EQ 2I5MX 1E7ZA 5IYDH 4BBSG 2VZAA 4GOPA 1VQEA 4GN3B 1EWIA 2OQ0A 1WOCA 3KYHC 4LNQA 2UXBQ 3MEFA 2UXBL 1CKNB 3S1RH 5FJ8H 1HNXL 3KDFB 2UUBL 3NELA 2UUBQ 4JV5Q 3M3YH 2B3GA 4LF4Q 4A4IA 4LF4L 4OX9L 4OX9Q 3S1QH 1D7QA 1GVPA 1KRSA 4GKKQ 1J6QA 4GKKL 2CWPA 1HZAA 4QQBX 3TS2A 2UXCQ 2UXCL 1C9OA 3LGJA 1DGSA 2UUCL 2UUCQ 1XMOL 1VQIA 1PV4A 3ULJA 1K9MC 1IBMQ 1JB7A 4A3DG 3S17H 3UDXA 5EAYA 3RR5A 4JI4L 4JI4Q 2XGTA 1TWFH 1M1KC 4LF8L 4LF8Q 4IFDI 2V1CC 3A5ZB 5JJIA 4YCUA 1K8AC 5DLQE 5M3MG 4MZ9A 1Q86C 4UY8C 5IT9c 3UE0A 4JI7Q 4JI7L 2HIXA 2R93H 2K5VA 3Q8DA 4XIGS 2Q2IA 3U50C 1PH9A 5BR8Q 5BR8L 1VQ5A 2MNAA 1TXYA 3WWVA 3G71A 2F3IA 1YHAA 1Q1BA 5HGQA 4BY1H 3J81c 1RL2A 4PG3A 1YJWA 4A3BH 3ERSX 1QUQA 1KHIA 2NN6I 2KHJA 1Q1EA 2CCZA 4BY7G 4IPGA 3HOXH 1PH2A 3GTPH 2N78A 1EYGA 4DAYB 4XTCS 3HOYH 3FKIH 2KCTA 3W1BA 4YHHQ 4YHHL 1PYBA 2RHQB 4Y7NH 1WFQA 3F1ZA 2GVAA 3GO5A 4JI1Q 1ASYA 3RZDH 4GS3A 4X64Q 1Q8KA 4X64L 3NENA 4X66Q 3CCMA 2OTLA 1NMGA 1YZ6A 4NXMQ 4NXML 2JA7H 1PVOA 2N8NA 1WI5A 1L2FA 4IJHA 4R4OA 5IYBG 2R7ZH 5M5XH 1TWCH 1VQGA 2ZTEA 4C2MH 4LWCA 5JEAJ 4KLKA 3J80i 4A3JH 3PCOB 4JYAL 3CF5A 3PO2G 4JYAQ 2ZTDA 3I7FA 3L7ZC 3S1MH 4OWTB 2HIVA 3U4ZA 1VQ7A 1QZGA 1K8GA 3HKZE 1UWVA 1WCMH 3T1YL
chains in the Genus database with same CATH superfamily
1ESRA 5I2XA 3CCRA 3CCVA 4A93B 3SGIA 4XQJA 1OXUA 5L37A 2QA4A 4A3GB 2FFKB 5ELFA 5DAUA 4X3UA 1FJGQ 3CMAA 4A3LG 4JI0L 3PUWA 3I2ZA 2X69A 3NWSA 2IHFA 4QL5A 3ER0A 4PNYA 1U4PA 4A3GH 2Z0SA 1M4VA 1EZ6A 3NWTA 1I5FA 2H1EA 5IP9H 3MWYW 3BU2A 1OXXK 2PNRC 1ENFA 4WJWA 2HUGA 4IUPA 4DV3Q 5IWAQ 3M4OB 1N8RC 4P75A 1NJIC 3HOZG 5JJLA 2E2JH 2ID0A 3FDTA 3OIQA 3GV6A 3S15B 1U9RA 3MXUA 4LFBQ 5JEAH 1BQQT 2E5LQ 1VQ4A 3S15H 2WACA 1XX8A 1L0YB 5BN3A 1SMXA 3PGZA 2KA7A 1DJRD 4CDDC 1HUNA 3I55A 1N36Q 1J5EL 3A8IE 2XRSD 4HJAA 3M7NA 1JJGA 3TRZA 1A2UA 1S3OA 3GV3A 2ENBA 4G7ZC 4JI6Q 3VYUA 1JJCB 4NXNQ 4A3CH 1RHPA 1JWUD 3EQLC 4PZ7A 2IX1A 3Q6SA 4G7OC 2IJ0A 1V1OA 3IFTA 3DHQA 5ELDA 1F2YA 1V8QA 2PCFB 2JA6H 4DAPA 1PH8A 5GADC 1SRUA 3PIPA 2HHHQ 2EQSA 3WDNA 2B8GA 2F03A 5C4JB 3KK7A 2Z9HA 4GLVB 4ABNA 5JVH3 1QJOA 3TS0A 1X32A 1EEID 2Q2HA 3M4PA 4RCOA 4AIMA 3KF8A 3K5NA 5C4JH 1Y1VH 1FGBD 1I50H 4BA1I 4DR2Q 2DUDA 3VR5A 4O1NA 4QY7A 2FXQA 3J7A5 4HMIA 2OEOA 4HEDA 4H44C 1MJEA 4APVA 4L6TB 4C3JB 3OYYA 1ILPA 3C2PA 1HQRD 1SNCA 4LJZC 3VYRA 2MPMA 4IUTA 5D3DA 3C46A 4C3JH 2NVTH 1EY8A 3MA2B 5C44H 1M90C 3J80L 2E76C 4XT1B 3HG9A 3OSOA 1QUQB 1QWYA 3AFQA 3HKZG 2J0TD 5H1SE 2E2HH 2YTYA 5IP7H 1Y1WG 3GTGB 2B2UC 2F0VA 1VQ9A 1K83H 5D14A 5COYA 2O5JC 4LUOA 1NMFA 1WTQA 2RVLA 3GTGH 4JI2Q 5IYCH 1YHQA 1ICWA 3PO2B 2VNUD 4KJNA 4K5VA 1S5BD 1YJ9A 4ZCKA 1I6HH 1KC8C 1A63A 1YEZA 4C3IB 1VQNA 4KI0A 1IBKQ 2PPBC 4AYBE 3PIO3 1HNZL 3F2UA 1I94Q 5C3WA 1MSHA 4B9WA 4C3IH 2DJGC 3RUZA 2ZTCA 1I3QB 5IWAL 3CP0A 3KF6B 2R61A 4LF9Q 1L1OA 3J7ZC 3STBC 4B9XA 3Q22A 3ONAB 2JEAI 1A0IA 2A1AA 5EBCA 4DV0Q 1JOOA 4DR7Q 4A3EB 1K73C 1STHA 2MO0A 4R4TA 1SMYD 2Y0SE 4I65A 2JE6I 3OMGA 1EIYB 2BE5C 1EFID 1A3TA 1E2VA 3GTJB 1LT3D 1X56A 1Q82C 2WAQG 4ZUIA 1AN8A 4YWLA 2D0OA 2CFMA 3GTJH 1DONA 4A3KH 1X55A 4C1NI 1PTOB 3EROA 4X3KA 5FJ8G 3CQZB 1ESFA 1MBYA 5C3EH 3H0GG 2WAQE 4GNXB 2RQXA 1FD7D 3U9OA 1SLJA 3KBGA 1B44D 1PTOH 1N34Q 1SFOB 1NNXA 1EQQA 2FINB 2HCCA 3EN2A 1YNNC 3EJIA 4IOAA 4P74A 1XTCD 2KJXA 1HJPA 1YNXA 1SFOH 3S1RB 2CWAA 1R4PB 5A2QL 3E9IA 1G291 2PNHA 4DR4L 4DA2A 4BBSH 4L5RC 3J80E 1GOZA 4BXXG 4RCNA 4RGNA 1PRTD 4Q0FA 2RDHA 4GLAC 1VS0A 3F2BA 4LFAL 3NE5B 1BF4A 1XMOQ 3CAMA 3IAYA 2XIWA 1IL2A 1NBWA 1SR3A 4IUUA 1NTGA 4FO2A 3HOXG 2F0GA 1KNAA 3HGBA 3ND8A 2WV6D 4K0KL 2ZM6Q 3A56A 3BDLA 3S16H 2VQFQ 3S24A 4BY1B 3KFUA 3V2TA 1D5XC 4OWXB 4A3BB 3ZJYC 1PZKD 2A74C 5LL6X 4DV1Q 2JA5G 1NCVA 3I91A 3JAML 3UDFA 1II3A 1TT2A 1YNJC 3K80C 2ICIA 2YTVA 2ATWA 2AMCB 2K5HA 2A6EC 4BY7H 1Q12A 4CBVA 2Z6KC 5ISRA 5LMUQ 4L5QA 5E4WC 3A7AB 4ODGA 3C1EA 1ASZA 1SYGA 1LYLA 1PTOD 3WOEA 3BYYB 4JI2L 2B63G 4HCEA 5M3FB 3BVGA 4EQOA 1CSQA 1Z47A 3FMCA 4ULLA 4IUQA 1PHJA 4DUZQ 1M8AA 4ZRZA 1TS3A 5M3FH 1EQVA 2AKWB 4HCSA 4P2CB 1PMRA 1ML0D 1WJJA 1UEAB 1Q90A 3S2DH 2AQ3B 5C0XI 3PIOA 1SROA 1B3QA 3TBIB 4K6LA 4KJOA 3BYTB 1PYWD 5C4ZA 4IPDA 1UNSA 3HZXA 3K5OA 5I2YA 2BCOA 2NZ1D 1VCIA 2MGSA 2A5HA 2PO4A 2Q2TA 1SE2A 3B6YA 5DEHA 5IOCA 1MIUA 1XYIA 5M9OA 3T16A 2F0TA 5IGDA 3AQQA 1O7YA 1BXTA 2PQAB 5KEEA 1STEA 3QO2A 3DWAA 1X54A 2Z6BA 4EQPA 3W1GA 5E7NA 5FLMG 2K32A 1HR0W 3HOWB 4DN4M 4R9WA 4DAMA 1V1PB 3VR6A 2WB1G 4A3FG 1U0LA 1XPOA 1OXTA 1EOTA 2Q8RE 1QB5D 2L0CA 1A8VA 5GAHC 3HOWH 2DGYA 2UU9Q 1TWGH 4DK6C 1C4QA 1TS5A 1U4LA 4DR6Q 1E7ZA 2EPBA 3T53B 1LTID 2VZAA 4N9PA 5IYDH 2KEDA 1HTPA 2HQEA 1JORA 2OQ0A 3JAME 1STAA 3MEFA 2IX3A 2B3GA 4LF4Q 4A4IA 1D7QA 1EIHA 3DEOA 4GKKQ 4QQBX 2UXCQ 2PW7A 1XMOL 1IKLA 2OT2A 1NSNS 1I6VC 2NWGA 1PV4A 1LABA 3S17H 5CV8A 1IYVA 4LF8Q 4G7HC 4IFDI 2CW0C 5DLQE 4FYDA 5M3MG 1QOHA 3DXJC 1F9QA 1A15A 2Q2IA 1SNDA 3A55A 5BR8L 1VQ5A 2F3IA 3NBIA 1LLRD 2PMZB 3E0JA 1RL2A 1YJWA 3ERSX 4V0BA 2NN6I 1T5EA 2KHJA 4Y7NB 2CCZA 3NSWA 4FVMA 4DAYB 3FKIH 2K5DA 1MGSA 2KCTA 5EKKA 1PYBA 2Z4IA 4Y7NH 1ASYA 5CV6A 2GVAA 4JI1Q 3UI2A 1Q8KA 4C2MB 3CCMA 1HTLD 2OTLA 5CV4A 4L63B 1NMGA 1YZ6A 4NXML 1PDQA 1PVOA 1A6XA 4R4OA 3PQIA 1XXGA 5IYBG 1BNZA 4G4KA 4C2MH 4LWCA 5JEAJ 3PCOB 4K14A 3I7FA 2ZTDA 1ENAA 4OWTB 1VQ7A 2B2VC 5IGGA 1QZGA 1UWVA 3I4NB 2JA8B 3K58A 4DV6L 3L0OA 3M4YA 1DOKA 1H9JA 4KN4C 3D8GA 3AYHB 2F0JA 1K8OA 2VS1A 3CD6A 3VR2A 1EFWA 1VQCA 2K50A 4IALA 4JI0Q 2KCNA 1D8LA 1JE4A 3GTOB 1E1TA 3STBD 5CR3A 5ELOA 3MXNB 1QG7A 5IODA 1LT4D 4KKUA 2R92G 4CJ0B 1SE3A 2EY1A 2HQLA 1AH9A 2CVRA 1HR0L 5C0XG 3MAQA 1CA6A 1YHBA 2EYOA 1O7IA 4ME5A 2JK8A 4EX5A 2EOTA 3K5MA 4C1NK 3RD4A 3RLFA 3QR8A 1RDPD 2MQHA 2FJ2A 1WTOA 3NK9A 1SMYC 1SYBA 5ELEA 2A19A 2RDGA 1VQKA 1B7YB 2L9HA 2IL8A 2PZWA 2A8VA 3RZOB 1B9NA 1GD7A 4NPSA 3ERQA 3K7AB 1YNND 4OO1H 4A3MB 4A3IB 3HOVB 2NVYB 4X6AH 2F0NA 4DK1A 1B50A 1S72A 3K7AH 3N52A 3NTHA 1ILQA 3KDFA 4A3IH 1SYEA 2OQKA 4RMFA 2XNAC 2F0LA 5EPJA 2NVYH 4KY6A 3HOVH 3LWUA 4KHZA 2F0UA 1QVGA 1JMCA 1MI2A 1CZWA 1JCKB 2E74C 2KOLA 2IX0A 4RG1A 3VDYA 4GOPB 1NR4A 3DLLA 1CZGA 4ZK9B 3DWQA 3GTQB 2KQ3A 5EQ0A 2JSOA 5CBEE 2VQEL 2BA1A 1F2ZA 4RGOS 2F52A 2QEXA 3NHHA 4XXEA 1FL0A 4TQUS 3U4VA 4A3DB 5EKLA 3PO3B 2VUMB 2B2WC 4DK0A 1ZKOA 5DM63 3NQTA 4QCLA 2ZXPA 3HOYG 3M4QA 2ES2A 2VUMH 4PZ8A 3PO3H 1KDBA 4IFDG 1VQ8A 2MJ8A 2A6ED 2SEBD 5D3IB 4R4IA 4JI1L 2K33A 2EYHA 2JA9A 4LF6L 2R7ZG 5K36H 4NP5A 3VA5A 3TREA 5GAEC 4A3JG 1X3EA 2O5IC 2KCCA 2PI2A 3WOFA 3Q23A 5JVG3 1H9SA 5IGBA 5C5MA 1C0AA 2NN6G 1N32L 5EBDA 2K01A 4GN4B 4B3RL 2D2CC 2EIFA 3FHWA 4BBRH 1PTOC 4DF7A 1PTOF 4GNXC 2PI2E 4JBJA 3I70A 2NVQB 1SN8A 2QGQA 3GTLH 4CKBA 2N3SA 4C3HB 4DR1Q 3OHXC 1BOSA 4DPGA 1J8IA 4JG2A 4JI5L 2MFIA 5J22A 5M5WB 2NVQH 1C8CA 3P75A 1IXRA 2DY7A 4A93H 1HZ9A 2Q8IB 1X3FA 2R3ZA 1K8MA 2KCMA 2Q8TA 5G3LD 1KNEA 5GQOA 1HNZQ 1AE2A 3MFGA 5M5WH 1RTNA 4QJFA 4JI3L 1LUZA 2AWNA 2E2IB 4YCVA 5AJ3L 1X65A 1Y8OB 4TSSA 1PFBA 5JEAG 2L4NA 1IYJB 3M4OH 2EY5A 2A68C 4C56C 1DXMA 3KLRA 3TDQA 3HOUG 4B3TL 2F4VL 1KAWA 1YIJA 3O13A 3G6EA 2F0WA 4BWGB 4NW2A 2B2VA 3HOZB 1U5KA 2YTXA 5IT9L 3V05A 4DNTB 1YBYA 2FMCA 1JOKA 2SOBA 3D0FA 1X3QA 4P71A 4KN7C 2E2DC 1STBA 4XYOA 1VDZA 3HOZH 5C5LA 1UE6A 2C9OA 3J81L 1I4XA 4RKBA 4A3CG 3I4MB 3BZCA 2H4OA 2DNEA 2OWOA 4UDUC 4N8X1 4OGQC 2JA6G 3ITPA 3I4MH 4POGA 3S1NB 2EY6A 4DR4Q 2JP1A 3R3OA 2R93G 3S1NH 1C48A 2CW0D 4ALPA 4J6HA 2WINB 1Y1VG 4LFAQ 1QCBD 5HGTA 3P20A 1G91A 2EYLA 2MHVA 3AMUA 2ZJPA 1WD1A 4KV6A 2KENA 3I4OA 4K0KQ 4YY3L 3H6MA 4GN5A 1X3PA 1GUOA 5GROA 2AHOB 3A74A 3LNNA 1NE3A 5C44G 4NB3A 5EJWA 2BH2A 3FRPB 5IIFA 3KF8B 4X62L 2RSOA 4DUYL 2R7FA 1VQDA 4I7ZC 3H09A 5IP7G 5IGEA 2WFWA 4WFN3 1JWMD 1F9RA 2EDGA 1EYDA 3K0YA 4DV7L 3T13A 1K3BC 4WJ4A 3H3VI 1DOMA 2K05A 4FF3A 5IYCG 1BKBA 1KABA 1Y69U 1IBLL 1P8LA 2XN9C 3DEPA 3MTSA 3CC7A 3HKZB 2RA4A 3H94A 4DR1L 5K5PA 1VQ6A 2IWHA 1HNXL 4BA2I 2QF7A 1Y1WB 4AYBG 3SE0A 3TP7A 3V96A 1HA6A 4DU9A 2L11A 4MN3A 3PO2H 1EU4A 3OMCA 4C3IG 5IT9E 3W2DA 3X3MA 1RD9D 1SAPA 1UAPA 2YYZA 2ALYB 2WIIB 1KTKA 1HQMC 1UUPA 1I4QA 3KF6A 3G7LA 4DR5L 3J81E 4LF7L 3UDIA 3RN5A 1HXYD 1WTPA 2X6LA 4HIKA 2Y0SG 4U673 1JB3A 1I3QH 3HFZB 3KLWA 5CMDA 3J80c 3GTKB 1IKMA 1D1IA 3U9SA 4KHPL 4S3SA 1RJTA 4DR3L 4KY7A 5CYUA 3RLOA 2I5LX 3OPOA 5EGTA 2NTTA 1X6OA 1EYCA 2PZTA 1HNWL 1K28A 1BBUA 3TQYA 3CCSA 4A3EH 1WTXA 1BBXC 2EXZA 4H13C 4A3KG 2F0KA 2D5DA 3QG1A 2N49A 2EJMA 1S5CD 5KNCA 1Q81C 1L1OB 1FNVA 5C3EG 1A3UA 3K81C 1WTVA 4EQ5A 4GNXA 3A5UA 4QF4A 1UEBA 2ZXRA 1GUSA 5LL6S 1X9NA 3W3AA 3CQZH 4FF1A 4DNRB 1UE5A 2WAQB 4JW0A 3CPFA 3KLSX 4DNIA 1PLFA 4F87A 1Q8IA 2NVXB 4JBKA 4EGVA 3H0GB 1Q3LA 4BBSG 4K5XA 4U68A 1WOCA 1SE4A 4HTHA 1CKNB 2EE1A 4RWSC 5FJ8H 5TSSA 3S1RH 1WTRA 4JPBW 4MIUA 3K6OA 5E1FA 3TS2A 1TWFB 2UUCL 1VF5C 4PMBA 1SYCA 4DXFA 5EAYA 5FKAC 1TWFH 5I6YA 5JJIA 5CGKA 4L8JA 2JN4A 4UY8C 1SYFA 3Q8DA 2K5VA 4MHEA 3U50C 2LY7A 1PH9A 1E2ZA 5BR8Q 1EWHA 3WWVA 3HOXB 4BY1H 3BZDB 5C6AA 2K28A 4A3BH 1RCVD 1KHIA 3A8KE 2F3WA 4KD4A 3TP5A 4BY7G 4KKTA 3HOXH 3D6WA 1SNMA 1PH2A 1GJXA 2XSCA 2ICEC 1I4PA 2F0HA 3DMUA 3MC0B 4G57A 1WFQA 4XT3B 5ELBA 2JA5B 2B8FA 4X64L 2JYOA 4X66Q 2CHBD 4NXMQ 5D65A 2N8NA 1I4HA 1L2FA 1HPCA 4KHVA 1AP0A 1VQGA 3BG3A 4KLKA 3J80i 4JYAL 1DM0B 1G6ZA 2V4DA 1EWCA 3OOCA 1O7LA 1TWHB 2HIVA 2RDFA 3U4ZA 1PFNA 3R2TA 1A62A 4DV6Q 2MP1A 1Q46A 4E6IA 3CC2A 2B63B 1K3RA 3KLSA 2F0MA 1TWHH 2I5HA 3A54A 1TIID 2XTIA 3BVMA 1H9MA 4JBWA 2B63H 5C4XG 3NPPA 4R4QA 4RGTA 4L5SA 4O2DA 4X3TA 5JPMC 3JAMc 1EY4A 1ZYRC 5G3LF 3P1HA 4K2KA 1GO3E 4LF5L 2A68D 4IPHA 1WD0A 4OO1I 4GOPC 2CH4W 4HN7A 1TU2B 1HR0Q 1LACA 3A0JA 4QIWB 2PQAA 3W5OA 2B2UA 2K14A 3CCUA 2Z4HA 3M7GA 1SNOA 3D31A 3FVQA 1S5FD 4LUZA 2SNSA 3OW2A 3TP8A 3BVZA 1EUJA 4DAVA 2QCPX 5JOBA 1D5ZC 3QIAA 2NB0A 5I6WA 1EYAA 2M00A 4KMUC 5ELNA 2VL6A 3RNUA 4IN3A 3L3OC 5IYDG 1C7YA 3ULLA 2C35B 2IT1A 4ZKCB 4A3FB 2WB1B 1EY6A 1QZHA 1A2TA 2KHSA 1HZCA 4KTAA 4JCVE 4A3FH 4TVAB 1VMCA 1D6EC 4HJ5A 5KRUA 1PH7A 2K03A 1VQBA 1PFSA 1F2MA 3OWEB 4LK1C 2K5QA 1GHJA 3NBHA 2KEEA 2N55A 3QWNA 1JC7A 1KDAA 5KNBA 4X65L 1PXUA 4FF4A 2L15A 3QOLA 2VQEQ 4DV4L 2K1BA 2QDLA 2DY8A 4RA8A 1YI2A 2AUKA 1V9PA 1W6JA 1EY9A 3HRZC 4B3ML 2N88A 4DV2L 3H15A 5I9PA 3MXPA 3A8JE 1S4ZA 1QVFA 5M3MB 3FKIG 3I8ZA 3J81j 3R2IA 1I4GA 1XTDA 4RAUC 1XNQL 1IL8A 2KECA 2PMZE 4ZLTF 4LFCL 1CKOA 3DUZA 5M3MH 2M9VA 2QILA 3CRLC 2M2LA 3VA7A 3D4WA 4X66L 4LF6Q 2F0QA 1DZ1A 5CBAE 1RODA 2K75A 3JAMi 3URYA 5JJZA 2R7DA 1XMQL 3RMHA 1DYQA 4MNOA 1LTTD 1N32Q 1N9WA 4B3RQ 4WORA 4QGUA 4XYQA 2P5ZX 1AFPA 1JT8A 1V1QA 5FLXL 1E24A 1SYDA 4OEMB 3I4NH 2JA8H 2K7VA 2QKIC 2HDLA 1B70B 4JI5Q 5IYBH 1FR3A 1NY4A 3MHBA 3MXNA 1W2BA 4HJ7A 1PH1A 2AQ1B 4O0AA 4HAEA 3OW7A 4JI3Q 3GTOH 3K7UC 4F8MA 1U4RA 1D2BA 4OONA 5AJ3Q 2Z6KA 3PMFA 1PH5A 4ZYSA 4XDXA 4J8QA 1E3PA 1H9KA 5J39A 4YIJA 1E0BA 1F2LA 4IURA 4L5TA 1Y14B 2R92B 2PZUA 3N6RA 4IUVA 4UHVA 4FDBA 1O7ZA 1VF7A 1IW7C 1YVCA 2XWJB 1S5ED 3OTOL 1XPRA 2HDMA 2XWBB 4B3TQ 2YU9B 2F4VQ 3CU7A 4OO1G 2UUAL 3ICEA 1UE1A 3MVVA 2EYJA 2D9UA 1EY0A 1GUNA 3CMEA 3KOJA 5C0XH 2AWOA 4EQNA 3TEHB 1B9MA 3S14B 5AFWA 4HMJA 2IPKD 1KLUD 3RZOH 1BR9A 4A3IG 4AQYL 2OF1A 4MTNA 2E8GA 3ZYYX 4A3MH 1HFGA 3K8AA 3OIPA 2VXWA 1H95A 4PMCA 3NP8A 4B3SQ 3S14H 2OCEA 2TSSA 2VB2X 4NMZA 4H02A 3EVQA 1CM9A 3F2CA 1LO5D 1LTLA 2PYKA 1Z7TA 5EKIA 3M3YB 3S1QB 3G6JB 5LMNW 2IY5B 3TZDA 1LV9A 2NZHA 2LXJA 4K8IA 4LMQD 3VYTA 2AUJD 3S9WA 1F9PA 3EA6A 4EVOA 4DV5L 3GTQH 2C5CA 1GUGA 2LSSA 2XRQD 2HCIA 4N9TA 1SBBB 2VUMG 3PO3G 1VQJA 3PIP3 4A3DH 2RCFA 5DNFA 3FP9A 5FLXE 1KIXA 4YY3Q 1T9HA 1TS4A 1D5MC 5DM73 1L0WA 4K6DA 4JOIC 5LHY1 4PZ6A 1D1KA 4JI8L 5K36G 4RFBA 4OHJA 2JA7G 1QILA 1YITA 3GTPB 4X62Q 3HOYB 1F77A 4DUYQ 4A75A 2UXDL 1X3GA 2O2LD 4BS9A 1CA5A 4P72A 3H91A 1PZID 1WCMG 4BBRG 4HIMA 1L1OC 4DV7Q 1A3VA 2R7ZB 3U58A 5J1ZA 5M5XB 2VY3A 1G2SA 1JE5A 2AQ2B 5HURA 2EZVA 1VQMA 3IKJA 1IBLQ 1IZ6A 4R4CA 5NUCA 2EYPA 1JOQA 1Z9FA 5FO7B 3S1MB 1VQFA 1EQRA 3GD7A 1SE8A 5FOBB 1HNXQ 3PUZA 4YWKA 1BCPB 4A93G 1ET9A 1N33L 2QEJC 3CCJA 4A3GG 3T1HL 1H9SB 3I56A 2A69D 5J3BA 4C3HH 5IP9G 4CDEC 1IHZA 2NN6H 1ZYRD 3NQIA 1B1ZA 5FK9C 4AH6A 1UE7A 2F0EA 3MEHA 5EPKA 3VR3A 1L0XB 2DN8A 3PF5A 5E4XA 5KGUA 4WJ3M 4DR5Q 2EVBA 4LF7Q 1TS2A 2JEBI 4OIKA 4CKEA 4HJ9A 2E2IH 3VR4A 4A3LH 2EXDA 2JJQA 1FNUA 4CJ2C 2J4XA 1R9TB 4KHPQ 3KJOA 3RN2A 4DR3Q 1V43A 1JJ2A 1PH4A 1VQAA 3EBEA 2RKSA 4CJ1B 1LT6D 4NDXA 4ME3A 1HNWQ 1R9TH 2VB3X 3SR1A 3T51B 2E2JB 1XNRL 4JBMA 1B8AA 3D4RA 1EZ8A 1PFMA 3IRBA 3Q0AA 1GKHA 3J7AF 2KBNA 2HD3A 5IE8A 1JR0D 2L5TA 3HOUB 1CI3M 4B3SL 2F0OA 3OWFA 3UE1A 3E3XA 2CQOA 4M8AA 4M1UB 4PMWA 5LMNL 4HIDA 1TQOA 3GDEA 3HOUH 4F7XA 3I4MG 1QNKA 4TKOB 3X3NA 3HS0C 3NEMA 4YCWA 1P16A 3SK8A 2NZOA 4DXGA 1AW7A 2I5MX 1BUVT 1LT5D 1VQEA 4K5WA 2K04A 2ZT9C 2UXBL 2J7ZA 4RGMA 2UUBL 2GA4B 4JV5L 1KDCA 1EL0A 4OX9L 1GVPA 1KRSA 1BCPD 2CWPA 1GHKA 4MTKA 3IL8A 2UUCQ 2JA6B 3EFXD 1VQIA 2E75C 3I4LA 1IBMQ 3UDXA 1H9RA 3RR5A 4JI4L 3TSSA 1M1KC 2R93B 3IFDA 2V1CC 4YCUA 4B08A 1FNWA 1Q86C 1GUTA 5IT9c 4RHRA 4JI7L 1Y1VB 1I50B 2HIXA 2R93H 4XIGS 4C3JG 3G71A 1Q1BA 3H3VC 4LAAA 3J81c 1QUQA 1Q1EA 4FXGC 4IPGA 5BN5A 4RHSA 3RZDB 1U4MA 1W6KA 2A73B 1CHPD 2N78A 1CT1D 1TY0A 3K5LA 5ELCA 3D6CA 2NVTB 4YHHL 3SK4A 5C44B 3F1ZA 3GO5A 3RZDH 5KNDA 4Q5VA 1TWCB 4GS3A 4X64Q 3NENA 3SVMA 2E2HB 2KUMA 4PV1C 1WI5A 4IJHA 1K83B 2NBFA 1TWCH 1HCZA 4JYAQ 3BDCA 3PO2G 4F88A 3R93A 3MXGA 1TWAB 5KIXA 2L12A 2DNCA 3HKZE 2A6HC 2B2WA 1Y1WH 3Q24A 3T1YL 1E22A 1BVSA 3NTKA 1TWAH 1K0SA 2I07B 4A76A 1LTBD 2F4IA 1EQTA 1I6HB 4AYBB 1Z6HA 1I4RA 2Z8LA 3NXWA 5M5YB 4JOIA 3PUXA 1FJGL 1PRTB 4KKSA 2Q2UA 1VQPA 3CCLA 5M5YH 1OTCA 1EIGA 4LF5Q 3CC4A 1XWEA 2KVMA 2K6AA 4A3EG 1EIFA 3GTKH 1IW7D 4DKAC 2F1MA 3CCQA 4DV3L 2Y0SB 1T5XD 5JAVA 3S2HB 5CV9A 4JC0A 4QUFA 3E0EA 2D0PA 2X6GA 1VMPA 2BDOA 5FO9B 2DJFC 3K0XA 1CKMA 3S2HH 4LFBL 1R4QB 1S40A 5FO8B 2E5LL 3D4DA 3BDOA 4A3KB 2EY2A 3QJYA 1EU3A 4IOCA 4TRDA 3T1YQ 1KL9A 2B39A 5C3EB 1CFMA 1EOVA 1PZJD 1N36L 4IUNA 4GZYC 5EPLA 1LTRD 2I0QA 2QW7A 4IPCA 1HHVA 4ILWA 1AZPA 1AEXA 1CKNA 2VW9A 4ZUJA 2NVXH 1JICA 4HR7B 1CQVA 3H0GH 4UP7A 2ASBA 4IZ8A 1HRJA 3CRKC 4Z9CB 3J81i 2B2YC 4JI6L 4IO9A 4UP9A 4NXNL 1GM5A 1BBWA 4I7AA 3I3CA 3CCEA 1IBML 4BBSB 1KRTA 1PYSB 3UDGA 2D62A 2B29A 2EYMA 4YWMA 4R1JA 1O80A 2L1BA 3L9AX 2OTJA 4R8IA 4V190 2HHHL 4X65Q 4FF2A 4DV4Q 4OWWB 4WRDA 3SHLA 1DD2A 4BY1G 4CKCA 1MSGA 1PH6A 4A3BG 3KUPA 4BXXH 4B3MQ 5F2DA 4DV2Q 1XPUA 4DR2L 4OIJA 4DGZA 3S16B 5C3XA 1VQHA 1DCZA 3A7LA 1XJVA 3SDZA 4ZKBB 2PW5A 1W3SA 1SJHD 2RF4A 1MJCA 1PA6A 1VQOA 1XNQQ 2R6GA 1ZXTA 1CSPA 1FGUA 3LX0A 5GAGC 4LFCQ 4N8FA 5JJKA 4RH6A 2NYZD 4K8JA 1BDOA 4UP8A 1WVLA 2G9DA 4BY7B 1K0RA 2WP8J 2JA5H 3R8BA 4P73A 1WTHA 5M3FG 3CKIB 3FEWX 1XMQQ 5KYIA 1HH2P 1KQSA 2F0SA 1Y8NB 1TKWB 2WKCA 3F2DA 4GKJQ 2EYFA 4X3SA 5IGFA 1G51A 1CQFA 5A35A 5CC4A 3PV0A 4JK1C 5C0XJ 2ZJRA 1OO9B 2HT1A 4UAIA 2BA0A 1Y8PB 3FPUB 2ZJQA 3BS1A 3T56B 1B2TA 2XVSA 2A69C 1VQLA 4ZQ3A 3S2DB 2ZXOA 2B2TC 4NKLA 1LM0A 1CUKA 1IBKL 4H0LC 1I94L 1WTWA 4LW1A 1E2WA 5C4XB 2RHSB 4POFA 2K52A 3H3VH 3HKSA 4KD3A 2YV5A 4LF9L 5C4XH 5KYLA 3AB9A 3MZ5A 2O4XA 4DV0L 4QIWE 3GP7A 1E1OA 4DR7L 4H7BA 1V1PA 2PQEA 2TMPA 3HOWG 1SNPA 3OTOQ 3BJUA 1DOLA 4HJ8A 3SK6A 5A2QE 4J1MA 3BZKA 2UUAQ 1MKHA 2SNMA 2MUYA 1STGA 3C1FA 3G48A 1JQYD 3TMEA 4AQYQ 5FLMH 3I72A 1TWGB 4PQXA 4DK3C 1NUCA 3CW2C 1N34L 4K2LA 3AEVA 1WYDA 3J7AV 4QB4A 2WB1E 1SDFA 3PUYA 3D3RA 3MFYA 5I9OA 4FP5D 4IFDJ 3FPPA 3CPWA 4CDCC 1BCPC 2LMCB 1BCPF 3S17B 1SJED 3I73A 4DV5Q 1FYCA 1RTOA 1TVXA 5JPNC 3TN2A 2SDFA 1KD1C 1ICFB 1KLGD 2BH8A 1HFNA 2WKDA 1ZEQX 1HZBA 2JQOA 1Q7YC 1KAAA 1F9SA 3E5SA 4ZAIA 3NBHB 2RCNA 3NTIA 2GN5A 4DAYA 2ZM6L 2VQFL 4XQQA 3DM3A 1B3AA 4RKLA 3CXCA 4JI8Q 2LXKA 4O42A 3AFPA 3EIVA 1HA5A 3I90A 4DV1L 3JC66 3M9BA 4QMGA 3ND9A 3E6ZX 3FKIB 2UXDQ 3KJPA 1QNUA 4Y52H 4JVZA 4GLXA 2G9HD 3J7YW 2B2YA 3ULPA 2F0PA 5LMUL 4GKJL 3PUVA 1EEFD 1QVCA 2A6HD 3I4NG 2EJFC 2JA8G 4DFAA 1B4OA 3TP6A 4HSPA 3L2PA 1GXDC 1MHWC 1MD2D 2MO1A 3GTMB 3F8TA 1YJNA 2KHIA 1PH3A 3P7JA 1N33Q 4CDFC 1KXLA 4DUZL 1LTGD 3T1HQ 2H5XA 2NTSA 1TR5A 4OL7A 1J9OA 5IGCA 4HIOA 3GTMH 1BO0A 3C3LA 1ONLA 3GQBA 3QB3A 2FHTA 5CV7A 5CV5A 5T1GA 3K57A 1STNA 5IY0A 5C4HA 2RSNA 4KY5A 1FVIA 2IHEA 4R8NA 1SSOA 2CQAA 4IJLA 2Z1CA 1OXVA 3RLNA 1G6PA 3SK5A 4UPAA 2F3VA 3AU7A 3T4AC 2BE5D 2R92H 1XNRQ 4LUVA 2K4KA 3PF4A 1RIPA 1TY2A 2CKZB 3M85A 3PSIA 1AE3A 3E9HA 1HUMA 1OXSC 5T1IA 2LKVA 2YU9H 3SEBA 2L55A 5FLXc 4A3MG 5BN4A 2LFNA 3HEJA 3HOVG 2F0IA 2K5NA 3G4SA 1B53A 1STYA 4J15A 4OELB 4FNFA 4OXPA 5LMNQ 4IQZA 1SNQA 2GVBA 2B2TA 2EJGC 2G5DA 2UU9L 5HY6A 3K59A 1LTSD 2LS01 4DR6L 1J5EQ 4GOPA 2IW3A 4GN3B 1EWIA 3KYHC 3SXHA 4LNQA 2UXBQ 2UUBQ 5CORA 3KDFB 4JV5Q 3NELA 3KBXA 3M3YH 4LF4L 4OX9Q 3S1QH 1AZQA 1RKNA 1J6QA 2BOSA 5E3FA 1HZAA 4GKKL 2UXCL 1C9OA 3LGJA 1DGSA 3NUCA 1IYUA 4FXDA 1ENCA 1EY5A 4QUCA 2F0FA 4KK7A 2CH4A 3ULJA 4CGYB 1K9MC 4A3DG 1JB7A 2FMMA 3DWPA 4JI4Q 2RBMA 1SXTA 2I46A 2XGTA 4LF8L 1GUWA 3A5ZB 1K8AC 1ET6A 4XQNA 4MZ9A 3UE0A 4JI7Q 1PRTC 1NR2A 1JWSD 1PRTF 3DM1A 2JXMB 1CK1A 1QE6A 2MNAA 1TXYA 1EY7A 1YHAA 3QOJA 5HGQA 3VYSA 2NUCA 4PG3A 3HP3A 3GTPH 1YNJD 1EYGA 5I4DA 1SEBD 4XTCS 3HOYH 2BDNA 2JA7B 3W1BA 4YHHQ 4FXKC 2RHQB 2K5WA 1RF2D 4IFDH 1CTMA 4A3JB 3CHBD 2JA7H 4CHTB 2OXPA 2R7ZH 5M5XH 4ID6A 3TZUA 2ZTEA 2QDBA 1G2TA 1WCMB 4C3HG 4BBRB 1LTAD 3LWEA 3CF5A 4A3JH 1CHQD 3L7ZC 2F0DA 1S5DD 3S1MH 1NAPA 1G8ZD 1K8GA 3GTLB 4HSVA 1O78A 1WCMH
chains in the Genus database with same CATH topology
4DV6Q 4DV6L 1E22A 1Q46A 3L0OA 3CC2A 1BVSA 1K3RA 3AYHB 1TWAH 1TWHH 4A76A 2I5HA 2VS1A 3CD6A 3CCRA 3CCVA 1EFWA 3SGIA 2XTIA 1OXUA 4JOIA 4JBWA 2QA4A 3PUXA 1VQCA 2K50A 2B63H 4A3LG 1FJGQ 3CMAA 1FJGL 4JI0Q 4JI0L 3PUWA 4R4QA 3I2ZA 4JV5L 1D8LA 4L5SA 4O2DA 3JAMc 2Q2UA 1E1TA 2IHFA 3STBD 1VQPA 3CCLA 4QL5A 3ER0A 5ELOA 3MXNB 5M5YH 1OTCA 2Z0SA 4A3GH 1GO3E 1A62A 4LF5Q 4LF5L 4IPHA 1I5FA 3CC4A 5IP9H 3BU2A 4OO1I 2R92G 1OXXK 4GOPC 4A3EG 1EIFA 2HQLA 3GTKH 1AH9A 1HR0Q 1HR0L 3A0JA 4DKAC 5C0XG 2PQAA 1YHBA 3W5OA 4DV3Q 3CCQA 4DV3L 5IWAQ 2K14A 3CCUA 1Y1WH 1O7IA 4EX5A 2JK8A 4JC0A 1N8RC 4P75A 1NJIC 3E0EA 2D0PA 3D31A 3RLFA 3HOZG 5JJLA 4LUZA 2E2JH 2MQHA 2ID0A 3OW2A 3K0XA 1CKMA 3S2HH 4LFBQ 4LFBL 1S40A 1EUJA 2A19A 1VQKA 1B7YB 2E5LQ 2E5LL 1VQ4A 3S15H 2A8VA 5ELNA 1GD7A 2VL6A 4IOCA 4NPSA 3RNUA 3T1YQ 1SMXA 1KL9A 3PGZA 3I55A 1EOVA 5IYDG 1C7YA 1N36Q 1N36L 3ULLA 1J5EL 2I0QA 4IPCA 4HJAA 3M7NA 4X6AH 2C35B 1JJGA 2IT1A 1S72A 3TRZA 3K7AH 1QZHA 1CKNA 2VW9A 2NVXH 3KDFA 4A3IH 1S3OA 1HZCA 2OQKA 4RMFA 3HOVH 2NVYH 4UP7A 3H0GH 2ASBA 4JCVE 4KHZA 4A3FH 1C0AA 4TVAB 3J81i 4HJ5A 4JI6Q 4JI6L 1JJCB 4IO9A 4UP9A 4NXNL 1PH7A 1GM5A 1QVGA 4NXNQ 4A3CH 1BBWA 1VQBA 1PFSA 4PZ7A 1JMCA 3CCEA 2IX1A 1IBML 1KRTA 1PYSB 3UDGA 2D62A 2B29A 2IX0A 4YWMA 4R1JA 4RG1A 2JA6H 1PH8A 5GADC 1SRUA 2OTJA 3VDYA 4GOPB 3PIPA 3DLLA 2HHHQ 2HHHL 2EQSA 4X65Q 4X65L 2L15A 4GLVB 4DV4L 2VQEQ 2VQEL 2BA1A 4DV4Q 3TS0A 4OWWB 2F52A 2QEXA 4BY1G 2Q2HA 4AIMA 3M4PA 1YI2A 1PH6A 1FL0A 1V9PA 4A3BG 4TQUS 3U4VA 4BXXH 4B3MQ 4B3ML 5C4JH 1Y1VH 4DV2L 4DV2Q 1I50H 4BA1I 4DR2L 2DUDA 3H15A 4DR2Q 1XPUA 4QY7A 2FXQA 3J7A5 1VQHA 1XJVA 1QVFA 3HOYG 3M4QA 3FKIG 3J81j 1W3SA 2ES2A 2RF4A 4PZ8A 1MJCA 1PA6A 2VUMH 3PO3H 1VQOA 1XNQQ 1XTDA 2R6GA 1MJEA 4APVA 1VQ8A 1XNQL 1CSPA 1FGUA 3OYYA 2PMZE 5GAGC 4LFCQ 4LFCL 1CKOA 4R4IA 4JI1L 5JJKA 5M3MH 2JA9A 4X66L 4LF6Q 4LF6L 2R7ZG 4C3JH 4UP8A 2NVTH 5C44H 3TREA 1M90C 1K0RA 2WP8J 2K75A 1X3EA 5GAEC 4A3JG 2JA5H 3JAMi 1QUQB 2PI2A 3AFQA 3HKZG 4P73A 5H1SE 5M3FG 2E2HH 2R7DA 1XMQQ 1XMQL 2YTYA 2NN6G 4MNOA 1HH2P 5IP7H 1Y1WG 1KQSA 1N32L 3F2DA 1N32Q 1N9WA 1VQ9A 1K83H 4GKJQ 4GN4B 4B3RQ 4B3RL 4LUOA 2EIFA 3FHWA 4QGUA 1G51A 1NMFA 4BBRH 1JT8A 1V1QA 3GTGH 3PV0A 4GNXC 2PI2E 4JBJA 5C0XJ 2ZJRA 1E24A 1SN8A 2HT1A 4JI2Q 2QGQA 5IYCH 3GTLH 2BA0A 3I4NH 1YHQA 2JA8H 2N3SA 4DR1Q 2ZJQA 2VNUD 1B70B 4DPGA 4JI5Q 4JG2A 4JI5L 5IYBH 2MFIA 1VQLA 2NVQH 1IXRA 1YJ9A 1I6HH 4A93H 1HZ9A 1NY4A 1X3FA 1KC8C 1A63A 1YEZA 1W2BA 1VQNA 2KCMA 1LM0A 1CUKA 4KI0A 4HJ7A 1PH1A 1IBKL 1IBKQ 4AYBE 5GQOA 4O0AA 1HNZL 1AE2A 5M5WH 1HNZQ 1I94Q 1I94L 4QJFA 4JI3L 4JI3Q 1LUZA 3GTOH 2AWNA 4LW1A 3K7UC 4C3IH 2RHSB 2ZTCA 4OONA 4YCVA 4POFA 2K52A 5IWAL 2Z6KA 3HKSA 5AJ3Q 3CP0A 5AJ3L 1X65A 3KF6B 1PH5A 4LF9Q 1L1OA 2YV5A 3J7ZC 4LF9L 3STBC 1E3PA 5C4XH 5JEAG 1A0IA 2A1AA 2JEAI 1IYJB 3M4OH 4DV0Q 4DV0L 4L5TA 4QIWE 1E1OA 1Y14B 4DR7L 4DR7Q 1K73C 3H3VH 2MO0A 4R4TA 2Y0SE 4FDBA 3HOWG 2JE6I 1YVCA 3OTOL 3BJUA 3OTOQ 1XPRA 4HJ8A 1EIYB 4B3TL 4B3TQ 2F4VQ 2F4VL 3HOUG 1HNWL 1X56A 1KAWA 3BZKA 1YIJA 1Q82C 4OO1G 2UUAQ 2UUAL 3G6EA 3ICEA 1UE1A 1MKHA 2WAQG 3CMEA 3KOJA 2AWOA 4YWLA 1U5KA 2YTXA 3TEHB 2D0OA 2CFMA 3GTJH 1YBYA 3G48A 4A3KH 3D0FA 3RZOH 1X55A 4AQYQ 4P71A 4AQYL 4A3IG 5FJ8G 5C3EH 4MTNA 4GNXB 2E8GA 2WAQE 3H0GG 5FLMH 3K8AA 4A3MH 3HOZH 1H95A 3S14H 1UE6A 4B3SQ 1SLJA 4DK3C 4A3CG 1N34Q 2OCEA 3CW2C 1N34L 3BZCA 1EQQA 3AEVA 1WYDA 3EN2A 4H02A 4IOAA 4P74A 2OWOA 2WB1E 3F2CA 3PUYA 1HJPA 2JA6G 1YNXA 1SFOH 3I4MH 2CWAA 1LTLA 4POGA 3E9IA 1G291 2PNHA 4DR4Q 4DR4L 5LMNW 2IY5B 4IFDJ 2NZHA 2LXJA 2R93G 4BBSH 3CPWA 4L5RC 3S1NH 4ALPA 4BXXG 1Y1VG 4GLAC 1VS0A 4LFAQ 3F2BA 4DV5L 4DV5Q 4LFAL 3GTQH 1XMOQ 3CAMA 1IL2A 1KD1C 1NBWA 1SR3A 2LSSA 2BH8A 1NTGA 3HOXG 1HZBA 2JQOA 2ZJPA 1Q7YC 2VUMG 3PO3G 1VQJA 3NBHB 4A3DH 2RCNA 2GN5A 3FP9A 2KENA 3I4OA 4YY3Q 4YY3L 1KIXA 2ZM6Q 1T9HA 2ZM6L 4K0KQ 4K0KL 3S16H 1L0WA 2VQFL 4GN5A 2VQFQ 3S24A 4JOIC 3KFUA 3DM3A 4PZ6A 5GROA 3CXCA 4JI8Q 2AHOB 4JI8L 2LXKA 4OWXB 3ZJYC 5K36G 3A74A 3AFPA 2JA7G 1NE3A 3EIVA 5C44G 1YITA 4DV1Q 4DV1L 4NB3A 2JA5G 2BH2A 3JC66 3M9BA 3KF8B 4X62L 3UDFA 4X62Q 4DUYQ 4DUYL 2UXDQ 4A75A 2UXDL 2R7FA 1VQDA 3K80C 5IP7G 1X3GA 3KJPA 2WFWA 4Y52H 4GLXA 2YTVA 2ATWA 2AMCB 2K5HA 4P72A 3ULPA 4BY7H 1Q12A 1WCMG 2Z6KC 4BBRG 5LMUQ 5LMUL 4GKJL 4HIMA 4L5QA 1L1OC 3PUVA 4DV7Q 4DV7L 1ASZA 4WJ4A 1QVCA 3U58A 3H3VI 2VY3A 5IYCG 1BKBA 1JE5A 1VQMA 1IBLQ 1IBLL 3I4NG 1P8LA 2JA8G 1LYLA 1IZ6A 4R4CA 4JI2L 3L2PA 2B63G 3CC7A 1Z9FA 2MO1A 1VQFA 1EQRA 3GD7A 1SE8A 4DR1L 1VQ6A 1CSQA 3F8TA 1Z47A 2KHIA 3PUZA 4YWKA 1YJNA 1PH3A 1HNXQ 4AYBG 1PHJA 4BA2I 1N33Q 1N33L 4A93G 4DUZQ 3CCJA 4DUZL 1KXLA 4A3GG 3T1HQ 2H5XA 3T1HL 3I56A 5M3FH 5J3BA 4C3HH 5IP9G 2AKWB 4HIOA 3GTMH 3PO2H 4IFDG 1WJJA 4AH6A 3S2DH 5C0XI 1UE7A 3PIOA 1SROA 2YYZA 2ALYB 3PF5A 3KF6A 4WJ3M 4IPDA 4DR5Q 4DR5L 5IY0A 4LF7Q 4LF7L 2JEBI 3UDIA 3RN5A 1FVIA 4HIKA 2Y0SG 2IHEA 4HJ9A 2E2IH 1VCIA 4A3LH 1I3QH 3HFZB 2EXDA 3KLWA 4IJLA 2JJQA 3J80c 2Q2TA 4KHPQ 4KHPL 1OXVA 3B6YA 3KJOA 3RN2A 4DR3Q 1MIUA 1V43A 3RLNA 3RLOA 4DR3L 1PH4A 1JJ2A 1G6PA 1VQAA 2I5LX 3EBEA 4UPAA 1X6OA 4ME3A 2R92H 1R9TH 1HNWQ 3AQQA 1BBUA 3TQYA 3CCSA 4A3EH 1XNRQ 4LUVA 2K4KA 2PQAB 1B8AA 1RIPA 4JBMA 1XNRL 4A3KG 2CKZB 3M85A 2N49A 1AE3A 1X54A 1OXSC 3E9HA 3PSIA 1Q81C 2YU9H 3PF4A 1L1OB 3W1GA 3IRBA 5C3EG 5FLXc 3K81C 1GKHA 5E7NA 5FLMG 4A3MG 2KBNA 4EQ5A 3A5UA 4GNXA 5IE8A 3HOVG 1UEBA 1HR0W 2K5NA 3G4SA 4DAMA 4B3SL 4A3FG 2WB1G 3UE1A 4J15A 1U0LA 1XPOA 1OXTA 2CQOA 1X9NA 4OXPA 3CQZH 4PMWA 1A8VA 5GAHC 1UE5A 5LMNL 5LMNQ 4HIDA 3HOWH 3GDEA 3HOUH 2GVBA 2DGYA 3CPFA 4DNIA 3I4MG 2UU9Q 1TWGH 4DK6C 2UU9L 5HY6A 5C4XG 3NEMA 4YCWA 1P16A 4JBKA 4DR6Q 4DR6L 2NZOA 1J5EQ 2I5MX 1E7ZA 5IYDH 4BBSG 2VZAA 4GOPA 1VQEA 4GN3B 1EWIA 2OQ0A 1WOCA 3KYHC 4LNQA 2UXBQ 3MEFA 2UXBL 1CKNB 3S1RH 5FJ8H 1HNXL 3KDFB 2UUBL 3NELA 2UUBQ 4JV5Q 3M3YH 2B3GA 4LF4Q 4A4IA 4LF4L 4OX9L 4OX9Q 3S1QH 1D7QA 1GVPA 1KRSA 4GKKQ 1J6QA 4GKKL 2CWPA 1HZAA 4QQBX 3TS2A 2UXCQ 2UXCL 1C9OA 3LGJA 1DGSA 2UUCL 2UUCQ 1XMOL 1VQIA 1PV4A 3ULJA 1K9MC 1IBMQ 1JB7A 4A3DG 3S17H 3UDXA 5EAYA 3RR5A 4JI4L 4JI4Q 2XGTA 1TWFH 1M1KC 4LF8L 4LF8Q 4IFDI 2V1CC 3A5ZB 5JJIA 4YCUA 1K8AC 5DLQE 5M3MG 4MZ9A 1Q86C 4UY8C 5IT9c 3UE0A 4JI7Q 4JI7L 2HIXA 2R93H 2K5VA 3Q8DA 4XIGS 2Q2IA 3U50C 1PH9A 5BR8Q 5BR8L 1VQ5A 2MNAA 1TXYA 3WWVA 3G71A 2F3IA 1YHAA 1Q1BA 5HGQA 4BY1H 3J81c 1RL2A 4PG3A 1YJWA 4A3BH 3ERSX 1QUQA 1KHIA 2NN6I 2KHJA 1Q1EA 2CCZA 4BY7G 4IPGA 3HOXH 1PH2A 3GTPH 2N78A 1EYGA 4DAYB 4XTCS 3HOYH 3FKIH 2KCTA 3W1BA 4YHHQ 4YHHL 1PYBA 2RHQB 4Y7NH 1WFQA 3F1ZA 2GVAA 3GO5A 4JI1Q 1ASYA 3RZDH 4GS3A 4X64Q 1Q8KA 4X64L 3NENA 4X66Q 3CCMA 2OTLA 1NMGA 1YZ6A 4NXMQ 4NXML 2JA7H 1PVOA 2N8NA 1WI5A 1L2FA 4IJHA 4R4OA 5IYBG 2R7ZH 5M5XH 1TWCH 1VQGA 2ZTEA 4C2MH 4LWCA 5JEAJ 4KLKA 3J80i 4A3JH 3PCOB 4JYAL 3CF5A 3PO2G 4JYAQ 2ZTDA 3I7FA 3L7ZC 3S1MH 4OWTB 2HIVA 3U4ZA 1VQ7A 1QZGA 1K8GA 3HKZE 1UWVA 1WCMH 3T1YL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DV6 Q;  4DV6 L;  1E22 A;  1Q46 A;  3L0O A;  3CC2 A;  1BVS A;  1K3R A;  3AYH B;  1TWA H;  1TWH H;  4A76 A;  2I5H A;  2VS1 A;  3CD6 A;  3CCR A;  3CCV A;  1EFW A;  3SGI A;  2XTI A;  1OXU A;  4JOI A;  4JBW A;  2QA4 A;  3PUX A;  1VQC A;  2K50 A;  2B63 H;  4A3L G;  1FJG Q;  3CMA A;  1FJG L;  4JI0 Q;  4JI0 L;  3PUW A;  4R4Q A;  3I2Z A;  4JV5 L;  1D8L A;  4L5S A;  4O2D A;  3JAM c;  2Q2U A;  1E1T A;  2IHF A;  3STB D;  1VQP A;  3CCL A;  4QL5 A;  3ER0 A;  5ELO A;  3MXN B;  5M5Y H;  1OTC A;  2Z0S A;  4A3G H;  1GO3 E;  1A62 A;  4LF5 Q;  4LF5 L;  4IPH A;  1I5F A;  3CC4 A;  5IP9 H;  3BU2 A;  4OO1 I;  2R92 G;  1OXX K;  4GOP C;  4A3E G;  1EIF A;  2HQL A;  3GTK H;  1AH9 A;  1HR0 Q;  1HR0 L;  3A0J A;  4DKA C;  5C0X G;  2PQA A;  1YHB A;  3W5O A;  4DV3 Q;  3CCQ A;  4DV3 L;  5IWA Q;  2K14 A;  3CCU A;  1Y1W H;  1O7I A;  4EX5 A;  2JK8 A;  4JC0 A;  1N8R C;  4P75 A;  1NJI C;  3E0E A;  2D0P A;  3D31 A;  3RLF A;  3HOZ G;  5JJL A;  4LUZ A;  2E2J H;  2MQH A;  2ID0 A;  3OW2 A;  3K0X A;  1CKM A;  3S2H H;  4LFB Q;  4LFB L;  1S40 A;  1EUJ A;  2A19 A;  1VQK A;  1B7Y B;  2E5L Q;  2E5L L;  1VQ4 A;  3S15 H;  2A8V A;  5ELN A;  1GD7 A;  2VL6 A;  4IOC A;  4NPS A;  3RNU A;  3T1Y Q;  1SMX A;  1KL9 A;  3PGZ A;  3I55 A;  1EOV A;  5IYD G;  1C7Y A;  1N36 Q;  1N36 L;  3ULL A;  1J5E L;  2I0Q A;  4IPC A;  4HJA A;  3M7N A;  4X6A H;  2C35 B;  1JJG A;  2IT1 A;  1S72 A;  3TRZ A;  3K7A H;  1QZH A;  1CKN A;  2VW9 A;  2NVX H;  3KDF A;  4A3I H;  1S3O A;  1HZC A;  2OQK A;  4RMF A;  3HOV H;  2NVY H;  4UP7 A;  3H0G H;  2ASB A;  4JCV E;  4KHZ A;  4A3F H;  1C0A A;  4TVA B;  3J81 i;  4HJ5 A;  4JI6 Q;  4JI6 L;  1JJC B;  4IO9 A;  4UP9 A;  4NXN L;  1PH7 A;  1GM5 A;  1QVG A;  4NXN Q;  4A3C H;  1BBW A;  1VQB A;  1PFS A;  4PZ7 A;  1JMC A;  3CCE A;  2IX1 A;  1IBM L;  1KRT A;  1PYS B;  3UDG A;  2D62 A;  2B29 A;  2IX0 A;  4YWM A;  4R1J A;  4RG1 A;  2JA6 H;  1PH8 A;  5GAD C;  1SRU A;  2OTJ A;  3VDY A;  4GOP B;  3PIP A;  3DLL A;  2HHH Q;  2HHH L;  2EQS A;  4X65 Q;  4X65 L;  2L15 A;  4GLV B;  4DV4 L;  2VQE Q;  2VQE L;  2BA1 A;  4DV4 Q;  3TS0 A;  4OWW B;  2F52 A;  2QEX A;  4BY1 G;  2Q2H A;  4AIM A;  3M4P A;  1YI2 A;  1PH6 A;  1FL0 A;  1V9P A;  4A3B G;  4TQU S;  3U4V A;  4BXX H;  4B3M Q;  4B3M L;  5C4J H;  1Y1V H;  4DV2 L;  4DV2 Q;  1I50 H;  4BA1 I;  4DR2 L;  2DUD A;  3H15 A;  4DR2 Q;  1XPU A;  4QY7 A;  2FXQ A;  3J7A 5;  1VQH A;  1XJV A;  1QVF A;  3HOY G;  3M4Q A;  3FKI G;  3J81 j;  1W3S A;  2ES2 A;  2RF4 A;  4PZ8 A;  1MJC A;  1PA6 A;  2VUM H;  3PO3 H;  1VQO A;  1XNQ Q;  1XTD A;  2R6G A;  1MJE A;  4APV A;  1VQ8 A;  1XNQ L;  1CSP A;  1FGU A;  3OYY A;  2PMZ E;  5GAG C;  4LFC Q;  4LFC L;  1CKO A;  4R4I A;  4JI1 L;  5JJK A;  5M3M H;  2JA9 A;  4X66 L;  4LF6 Q;  4LF6 L;  2R7Z G;  4C3J H;  4UP8 A;  2NVT H;  5C44 H;  3TRE A;  1M90 C;  1K0R A;  2WP8 J;  2K75 A;  1X3E A;  5GAE C;  4A3J G;  2JA5 H;  3JAM i;  1QUQ B;  2PI2 A;  3AFQ A;  3HKZ G;  4P73 A;  5H1S E;  5M3F G;  2E2H H;  2R7D A;  1XMQ Q;  1XMQ L;  2YTY A;  2NN6 G;  4MNO A;  1HH2 P;  5IP7 H;  1Y1W G;  1KQS A;  1N32 L;  3F2D A;  1N32 Q;  1N9W A;  1VQ9 A;  1K83 H;  4GKJ Q;  4GN4 B;  4B3R Q;  4B3R L;  4LUO A;  2EIF A;  3FHW A;  4QGU A;  1G51 A;  1NMF A;  4BBR H;  1JT8 A;  1V1Q A;  3GTG H;  3PV0 A;  4GNX C;  2PI2 E;  4JBJ A;  5C0X J;  2ZJR A;  1E24 A;  1SN8 A;  2HT1 A;  4JI2 Q;  2QGQ A;  5IYC H;  3GTL H;  2BA0 A;  3I4N H;  1YHQ A;  2JA8 H;  2N3S A;  4DR1 Q;  2ZJQ A;  2VNU D;  1B70 B;  4DPG A;  4JI5 Q;  4JG2 A;  4JI5 L;  5IYB H;  2MFI A;  1VQL A;  2NVQ H;  1IXR A;  1YJ9 A;  1I6H H;  4A93 H;  1HZ9 A;  1NY4 A;  1X3F A;  1KC8 C;  1A63 A;  1YEZ A;  1W2B A;  1VQN A;  2KCM A;  1LM0 A;  1CUK A;  4KI0 A;  4HJ7 A;  1PH1 A;  1IBK L;  1IBK Q;  4AYB E;  5GQO A;  4O0A A;  1HNZ L;  1AE2 A;  5M5W H;  1HNZ Q;  1I94 Q;  1I94 L;  4QJF A;  4JI3 L;  4JI3 Q;  1LUZ A;  3GTO H;  2AWN A;  4LW1 A;  3K7U C;  4C3I H;  2RHS B;  2ZTC A;  4OON A;  4YCV A;  4POF A;  2K52 A;  5IWA L;  2Z6K A;  3HKS A;  5AJ3 Q;  3CP0 A;  5AJ3 L;  1X65 A;  3KF6 B;  1PH5 A;  4LF9 Q;  1L1O A;  2YV5 A;  3J7Z C;  4LF9 L;  3STB C;  1E3P A;  5C4X H;  5JEA G;  1A0I A;  2A1A A;  2JEA I;  1IYJ B;  3M4O H;  4DV0 Q;  4DV0 L;  4L5T A;  4QIW E;  1E1O A;  1Y14 B;  4DR7 L;  4DR7 Q;  1K73 C;  3H3V H;  2MO0 A;  4R4T A;  2Y0S E;  4FDB A;  3HOW G;  2JE6 I;  1YVC A;  3OTO L;  3BJU A;  3OTO Q;  1XPR A;  4HJ8 A;  1EIY B;  4B3T L;  4B3T Q;  2F4V Q;  2F4V L;  3HOU G;  1HNW L;  1X56 A;  1KAW A;  3BZK A;  1YIJ A;  1Q82 C;  4OO1 G;  2UUA Q;  2UUA L;  3G6E A;  3ICE A;  1UE1 A;  1MKH A;  2WAQ G;  3CME A;  3KOJ A;  2AWO A;  4YWL A;  1U5K A;  2YTX A;  3TEH B;  2D0O A;  2CFM A;  3GTJ H;  1YBY A;  3G48 A;  4A3K H;  3D0F A;  3RZO H;  1X55 A;  4AQY Q;  4P71 A;  4AQY L;  4A3I G;  5FJ8 G;  5C3E H;  4MTN A;  4GNX B;  2E8G A;  2WAQ E;  3H0G G;  5FLM H;  3K8A A;  4A3M H;  3HOZ H;  1H95 A;  3S14 H;  1UE6 A;  4B3S Q;  1SLJ A;  4DK3 C;  4A3C G;  1N34 Q;  2OCE A;  3CW2 C;  1N34 L;  3BZC A;  1EQQ A;  3AEV A;  1WYD A;  3EN2 A;  4H02 A;  4IOA A;  4P74 A;  2OWO A;  2WB1 E;  3F2C A;  3PUY A;  1HJP A;  2JA6 G;  1YNX A;  1SFO H;  3I4M H;  2CWA A;  1LTL A;  4POG A;  3E9I A;  1G29 1;  2PNH A;  4DR4 Q;  4DR4 L;  5LMN W;  2IY5 B;  4IFD J;  2NZH A;  2LXJ A;  2R93 G;  4BBS H;  3CPW A;  4L5R C;  3S1N H;  4ALP A;  4BXX G;  1Y1V G;  4GLA C;  1VS0 A;  4LFA Q;  3F2B A;  4DV5 L;  4DV5 Q;  4LFA L;  3GTQ H;  1XMO Q;  3CAM A;  1IL2 A;  1KD1 C;  1NBW A;  1SR3 A;  2LSS A;  2BH8 A;  1NTG A;  3HOX G;  1HZB A;  2JQO A;  2ZJP A;  1Q7Y C;  2VUM G;  3PO3 G;  1VQJ A;  3NBH B;  4A3D H;  2RCN A;  2GN5 A;  3FP9 A;  2KEN A;  3I4O A;  4YY3 Q;  4YY3 L;  1KIX A;  2ZM6 Q;  1T9H A;  2ZM6 L;  4K0K Q;  4K0K L;  3S16 H;  1L0W A;  2VQF L;  4GN5 A;  2VQF Q;  3S24 A;  4JOI C;  3KFU A;  3DM3 A;  4PZ6 A;  5GRO A;  3CXC A;  4JI8 Q;  2AHO B;  4JI8 L;  2LXK A;  4OWX B;  3ZJY C;  5K36 G;  3A74 A;  3AFP A;  2JA7 G;  1NE3 A;  3EIV A;  5C44 G;  1YIT A;  4DV1 Q;  4DV1 L;  4NB3 A;  2JA5 G;  2BH2 A;  3JC6 6;  3M9B A;  3KF8 B;  4X62 L;  3UDF A;  4X62 Q;  4DUY Q;  4DUY L;  2UXD Q;  4A75 A;  2UXD L;  2R7F A;  1VQD A;  3K80 C;  5IP7 G;  1X3G A;  3KJP A;  2WFW A;  4Y52 H;  4GLX A;  2YTV A;  2ATW A;  2AMC B;  2K5H A;  4P72 A;  3ULP A;  4BY7 H;  1Q12 A;  1WCM G;  2Z6K C;  4BBR G;  5LMU Q;  5LMU L;  4GKJ L;  4HIM A;  4L5Q A;  1L1O C;  3PUV A;  4DV7 Q;  4DV7 L;  1ASZ A;  4WJ4 A;  1QVC A;  3U58 A;  3H3V I;  2VY3 A;  5IYC G;  1BKB A;  1JE5 A;  1VQM A;  1IBL Q;  1IBL L;  3I4N G;  1P8L A;  2JA8 G;  1LYL A;  1IZ6 A;  4R4C A;  4JI2 L;  3L2P A;  2B63 G;  3CC7 A;  1Z9F A;  2MO1 A;  1VQF A;  1EQR A;  3GD7 A;  1SE8 A;  4DR1 L;  1VQ6 A;  1CSQ A;  3F8T A;  1Z47 A;  2KHI A;  3PUZ A;  4YWK A;  1YJN A;  1PH3 A;  1HNX Q;  4AYB G;  1PHJ A;  4BA2 I;  1N33 Q;  1N33 L;  4A93 G;  4DUZ Q;  3CCJ A;  4DUZ L;  1KXL A;  4A3G G;  3T1H Q;  2H5X A;  3T1H L;  3I56 A;  5M3F H;  5J3B A;  4C3H H;  5IP9 G;  2AKW B;  4HIO A;  3GTM H;  3PO2 H;  4IFD G;  1WJJ A;  4AH6 A;  3S2D H;  5C0X I;  1UE7 A;  3PIO A;  1SRO A;  2YYZ A;  2ALY B;  3PF5 A;  3KF6 A;  4WJ3 M;  4IPD A;  4DR5 Q;  4DR5 L;  5IY0 A;  4LF7 Q;  4LF7 L;  2JEB I;  3UDI A;  3RN5 A;  1FVI A;  4HIK A;  2Y0S G;  2IHE A;  4HJ9 A;  2E2I H;  1VCI A;  4A3L H;  1I3Q H;  3HFZ B;  2EXD A;  3KLW A;  4IJL A;  2JJQ A;  3J80 c;  2Q2T A;  4KHP Q;  4KHP L;  1OXV A;  3B6Y A;  3KJO A;  3RN2 A;  4DR3 Q;  1MIU A;  1V43 A;  3RLN A;  3RLO A;  4DR3 L;  1PH4 A;  1JJ2 A;  1G6P A;  1VQA A;  2I5L X;  3EBE A;  4UPA A;  1X6O A;  4ME3 A;  2R92 H;  1R9T H;  1HNW Q;  3AQQ A;  1BBU A;  3TQY A;  3CCS A;  4A3E H;  1XNR Q;  4LUV A;  2K4K A;  2PQA B;  1B8A A;  1RIP A;  4JBM A;  1XNR L;  4A3K G;  2CKZ B;  3M85 A;  2N49 A;  1AE3 A;  1X54 A;  1OXS C;  3E9H A;  3PSI A;  1Q81 C;  2YU9 H;  3PF4 A;  1L1O B;  3W1G A;  3IRB A;  5C3E G;  5FLX c;  3K81 C;  1GKH A;  5E7N A;  5FLM G;  4A3M G;  2KBN A;  4EQ5 A;  3A5U A;  4GNX A;  5IE8 A;  3HOV G;  1UEB A;  1HR0 W;  2K5N A;  3G4S A;  4DAM A;  4B3S L;  4A3F G;  2WB1 G;  3UE1 A;  4J15 A;  1U0L A;  1XPO A;  1OXT A;  2CQO A;  1X9N A;  4OXP A;  3CQZ H;  4PMW A;  1A8V A;  5GAH C;  1UE5 A;  5LMN L;  5LMN Q;  4HID A;  3HOW H;  3GDE A;  3HOU H;  2GVB A;  2DGY A;  3CPF A;  4DNI A;  3I4M G;  2UU9 Q;  1TWG H;  4DK6 C;  2UU9 L;  5HY6 A;  5C4X G;  3NEM A;  4YCW A;  1P16 A;  4JBK A;  4DR6 Q;  4DR6 L;  2NZO A;  1J5E Q;  2I5M X;  1E7Z A;  5IYD H;  4BBS G;  2VZA A;  4GOP A;  1VQE A;  4GN3 B;  1EWI A;  2OQ0 A;  1WOC A;  3KYH C;  4LNQ A;  2UXB Q;  3MEF A;  2UXB L;  1CKN B;  3S1R H;  5FJ8 H;  1HNX L;  3KDF B;  2UUB L;  3NEL A;  2UUB Q;  4JV5 Q;  3M3Y H;  2B3G A;  4LF4 Q;  4A4I A;  4LF4 L;  4OX9 L;  4OX9 Q;  3S1Q H;  1D7Q A;  1GVP A;  1KRS A;  4GKK Q;  1J6Q A;  4GKK L;  2CWP A;  1HZA A;  4QQB X;  3TS2 A;  2UXC Q;  2UXC L;  1C9O A;  3LGJ A;  1DGS A;  2UUC L;  2UUC Q;  1XMO L;  1VQI A;  1PV4 A;  3ULJ A;  1K9M C;  1IBM Q;  1JB7 A;  4A3D G;  3S17 H;  3UDX A;  5EAY A;  3RR5 A;  4JI4 L;  4JI4 Q;  2XGT A;  1TWF H;  1M1K C;  4LF8 L;  4LF8 Q;  4IFD I;  2V1C C;  3A5Z B;  5JJI A;  4YCU A;  1K8A C;  5DLQ E;  5M3M G;  4MZ9 A;  1Q86 C;  4UY8 C;  5IT9 c;  3UE0 A;  4JI7 Q;  4JI7 L;  2HIX A;  2R93 H;  2K5V A;  3Q8D A;  4XIG S;  2Q2I A;  3U50 C;  1PH9 A;  5BR8 Q;  5BR8 L;  1VQ5 A;  2MNA A;  1TXY A;  3WWV A;  3G71 A;  2F3I A;  1YHA A;  1Q1B A;  5HGQ A;  4BY1 H;  3J81 c;  1RL2 A;  4PG3 A;  1YJW A;  4A3B H;  3ERS X;  1QUQ A;  1KHI A;  2NN6 I;  2KHJ A;  1Q1E A;  2CCZ A;  4BY7 G;  4IPG A;  3HOX H;  1PH2 A;  3GTP H;  2N78 A;  1EYG A;  4DAY B;  4XTC S;  3HOY H;  3FKI H;  2KCT A;  3W1B A;  4YHH Q;  4YHH L;  1PYB A;  2RHQ B;  4Y7N H;  1WFQ A;  3F1Z A;  2GVA A;  3GO5 A;  4JI1 Q;  1ASY A;  3RZD H;  4GS3 A;  4X64 Q;  1Q8K A;  4X64 L;  3NEN A;  4X66 Q;  3CCM A;  2OTL A;  1NMG A;  1YZ6 A;  4NXM Q;  4NXM L;  2JA7 H;  1PVO A;  2N8N A;  1WI5 A;  1L2F A;  4IJH A;  4R4O A;  5IYB G;  2R7Z H;  5M5X H;  1TWC H;  1VQG A;  2ZTE A;  4C2M H;  4LWC A;  5JEA J;  4KLK A;  3J80 i;  4A3J H;  3PCO B;  4JYA L;  3CF5 A;  3PO2 G;  4JYA Q;  2ZTD A;  3I7F A;  3L7Z C;  3S1M H;  4OWT B;  2HIV A;  3U4Z A;  1VQ7 A;  1QZG A;  1K8G A;  3HKZ E;  1UWV A;  1WCM H;  3T1Y L; 
#chains in the Genus database with same CATH topology
 1ESR A;  5I2X A;  3CCR A;  3CCV A;  4A93 B;  3SGI A;  4XQJ A;  1OXU A;  5L37 A;  2QA4 A;  4A3G B;  2FFK B;  5ELF A;  5DAU A;  4X3U A;  1FJG Q;  3CMA A;  4A3L G;  4JI0 L;  3PUW A;  3I2Z A;  2X69 A;  3NWS A;  2IHF A;  4QL5 A;  3ER0 A;  4PNY A;  1U4P A;  4A3G H;  2Z0S A;  1M4V A;  1EZ6 A;  3NWT A;  1I5F A;  2H1E A;  5IP9 H;  3MWY W;  3BU2 A;  1OXX K;  2PNR C;  1ENF A;  4WJW A;  2HUG A;  4IUP A;  4DV3 Q;  5IWA Q;  3M4O B;  1N8R C;  4P75 A;  1NJI C;  3HOZ G;  5JJL A;  2E2J H;  2ID0 A;  3FDT A;  3OIQ A;  3GV6 A;  3S15 B;  1U9R A;  3MXU A;  4LFB Q;  5JEA H;  1BQQ T;  2E5L Q;  1VQ4 A;  3S15 H;  2WAC A;  1XX8 A;  1L0Y B;  5BN3 A;  1SMX A;  3PGZ A;  2KA7 A;  1DJR D;  4CDD C;  1HUN A;  3I55 A;  1N36 Q;  1J5E L;  3A8I E;  2XRS D;  4HJA A;  3M7N A;  1JJG A;  3TRZ A;  1A2U A;  1S3O A;  3GV3 A;  2ENB A;  4G7Z C;  4JI6 Q;  3VYU A;  1JJC B;  4NXN Q;  4A3C H;  1RHP A;  1JWU D;  3EQL C;  4PZ7 A;  2IX1 A;  3Q6S A;  4G7O C;  2IJ0 A;  1V1O A;  3IFT A;  3DHQ A;  5ELD A;  1F2Y A;  1V8Q A;  2PCF B;  2JA6 H;  4DAP A;  1PH8 A;  5GAD C;  1SRU A;  3PIP A;  2HHH Q;  2EQS A;  3WDN A;  2B8G A;  2F03 A;  5C4J B;  3KK7 A;  2Z9H A;  4GLV B;  4ABN A;  5JVH 3;  1QJO A;  3TS0 A;  1X32 A;  1EEI D;  2Q2H A;  3M4P A;  4RCO A;  4AIM A;  3KF8 A;  3K5N A;  5C4J H;  1Y1V H;  1FGB D;  1I50 H;  4BA1 I;  4DR2 Q;  2DUD A;  3VR5 A;  4O1N A;  4QY7 A;  2FXQ A;  3J7A 5;  4HMI A;  2OEO A;  4HED A;  4H44 C;  1MJE A;  4APV A;  4L6T B;  4C3J B;  3OYY A;  1ILP A;  3C2P A;  1HQR D;  1SNC A;  4LJZ C;  3VYR A;  2MPM A;  4IUT A;  5D3D A;  3C46 A;  4C3J H;  2NVT H;  1EY8 A;  3MA2 B;  5C44 H;  1M90 C;  3J80 L;  2E76 C;  4XT1 B;  3HG9 A;  3OSO A;  1QUQ B;  1QWY A;  3AFQ A;  3HKZ G;  2J0T D;  5H1S E;  2E2H H;  2YTY A;  5IP7 H;  1Y1W G;  3GTG B;  2B2U C;  2F0V A;  1VQ9 A;  1K83 H;  5D14 A;  5COY A;  2O5J C;  4LUO A;  1NMF A;  1WTQ A;  2RVL A;  3GTG H;  4JI2 Q;  5IYC H;  1YHQ A;  1ICW A;  3PO2 B;  2VNU D;  4KJN A;  4K5V A;  1S5B D;  1YJ9 A;  4ZCK A;  1I6H H;  1KC8 C;  1A63 A;  1YEZ A;  4C3I B;  1VQN A;  4KI0 A;  1IBK Q;  2PPB C;  4AYB E;  3PIO 3;  1HNZ L;  3F2U A;  1I94 Q;  5C3W A;  1MSH A;  4B9W A;  4C3I H;  2DJG C;  3RUZ A;  2ZTC A;  1I3Q B;  5IWA L;  3CP0 A;  3KF6 B;  2R61 A;  4LF9 Q;  1L1O A;  3J7Z C;  3STB C;  4B9X A;  3Q22 A;  3ONA B;  2JEA I;  1A0I A;  2A1A A;  5EBC A;  4DV0 Q;  1JOO A;  4DR7 Q;  4A3E B;  1K73 C;  1STH A;  2MO0 A;  4R4T A;  1SMY D;  2Y0S E;  4I65 A;  2JE6 I;  3OMG A;  1EIY B;  2BE5 C;  1EFI D;  1A3T A;  1E2V A;  3GTJ B;  1LT3 D;  1X56 A;  1Q82 C;  2WAQ G;  4ZUI A;  1AN8 A;  4YWL A;  2D0O A;  2CFM A;  3GTJ H;  1DON A;  4A3K H;  1X55 A;  4C1N I;  1PTO B;  3ERO A;  4X3K A;  5FJ8 G;  3CQZ B;  1ESF A;  1MBY A;  5C3E H;  3H0G G;  2WAQ E;  4GNX B;  2RQX A;  1FD7 D;  3U9O A;  1SLJ A;  3KBG A;  1B44 D;  1PTO H;  1N34 Q;  1SFO B;  1NNX A;  1EQQ A;  2FIN B;  2HCC A;  3EN2 A;  1YNN C;  3EJI A;  4IOA A;  4P74 A;  1XTC D;  2KJX A;  1HJP A;  1YNX A;  1SFO H;  3S1R B;  2CWA A;  1R4P B;  5A2Q L;  3E9I A;  1G29 1;  2PNH A;  4DR4 L;  4DA2 A;  4BBS H;  4L5R C;  3J80 E;  1GOZ A;  4BXX G;  4RCN A;  4RGN A;  1PRT D;  4Q0F A;  2RDH A;  4GLA C;  1VS0 A;  3F2B A;  4LFA L;  3NE5 B;  1BF4 A;  1XMO Q;  3CAM A;  3IAY A;  2XIW A;  1IL2 A;  1NBW A;  1SR3 A;  4IUU A;  1NTG A;  4FO2 A;  3HOX G;  2F0G A;  1KNA A;  3HGB A;  3ND8 A;  2WV6 D;  4K0K L;  2ZM6 Q;  3A56 A;  3BDL A;  3S16 H;  2VQF Q;  3S24 A;  4BY1 B;  3KFU A;  3V2T A;  1D5X C;  4OWX B;  4A3B B;  3ZJY C;  1PZK D;  2A74 C;  5LL6 X;  4DV1 Q;  2JA5 G;  1NCV A;  3I91 A;  3JAM L;  3UDF A;  1II3 A;  1TT2 A;  1YNJ C;  3K80 C;  2ICI A;  2YTV A;  2ATW A;  2AMC B;  2K5H A;  2A6E C;  4BY7 H;  1Q12 A;  4CBV A;  2Z6K C;  5ISR A;  5LMU Q;  4L5Q A;  5E4W C;  3A7A B;  4ODG A;  3C1E A;  1ASZ A;  1SYG A;  1LYL A;  1PTO D;  3WOE A;  3BYY B;  4JI2 L;  2B63 G;  4HCE A;  5M3F B;  3BVG A;  4EQO A;  1CSQ A;  1Z47 A;  3FMC A;  4ULL A;  4IUQ A;  1PHJ A;  4DUZ Q;  1M8A A;  4ZRZ A;  1TS3 A;  5M3F H;  1EQV A;  2AKW B;  4HCS A;  4P2C B;  1PMR A;  1ML0 D;  1WJJ A;  1UEA B;  1Q90 A;  3S2D H;  2AQ3 B;  5C0X I;  3PIO A;  1SRO A;  1B3Q A;  3TBI B;  4K6L A;  4KJO A;  3BYT B;  1PYW D;  5C4Z A;  4IPD A;  1UNS A;  3HZX A;  3K5O A;  5I2Y A;  2BCO A;  2NZ1 D;  1VCI A;  2MGS A;  2A5H A;  2PO4 A;  2Q2T A;  1SE2 A;  3B6Y A;  5DEH A;  5IOC A;  1MIU A;  1XYI A;  5M9O A;  3T16 A;  2F0T A;  5IGD A;  3AQQ A;  1O7Y A;  1BXT A;  2PQA B;  5KEE A;  1STE A;  3QO2 A;  3DWA A;  1X54 A;  2Z6B A;  4EQP A;  3W1G A;  5E7N A;  5FLM G;  2K32 A;  1HR0 W;  3HOW B;  4DN4 M;  4R9W A;  4DAM A;  1V1P B;  3VR6 A;  2WB1 G;  4A3F G;  1U0L A;  1XPO A;  1OXT A;  1EOT A;  2Q8R E;  1QB5 D;  2L0C A;  1A8V A;  5GAH C;  3HOW H;  2DGY A;  2UU9 Q;  1TWG H;  4DK6 C;  1C4Q A;  1TS5 A;  1U4L A;  4DR6 Q;  1E7Z A;  2EPB A;  3T53 B;  1LTI D;  2VZA A;  4N9P A;  5IYD H;  2KED A;  1HTP A;  2HQE A;  1JOR A;  2OQ0 A;  3JAM E;  1STA A;  3MEF A;  2IX3 A;  2B3G A;  4LF4 Q;  4A4I A;  1D7Q A;  1EIH A;  3DEO A;  4GKK Q;  4QQB X;  2UXC Q;  2PW7 A;  1XMO L;  1IKL A;  2OT2 A;  1NSN S;  1I6V C;  2NWG A;  1PV4 A;  1LAB A;  3S17 H;  5CV8 A;  1IYV A;  4LF8 Q;  4G7H C;  4IFD I;  2CW0 C;  5DLQ E;  4FYD A;  5M3M G;  1QOH A;  3DXJ C;  1F9Q A;  1A15 A;  2Q2I A;  1SND A;  3A55 A;  5BR8 L;  1VQ5 A;  2F3I A;  3NBI A;  1LLR D;  2PMZ B;  3E0J A;  1RL2 A;  1YJW A;  3ERS X;  4V0B A;  2NN6 I;  1T5E A;  2KHJ A;  4Y7N B;  2CCZ A;  3NSW A;  4FVM A;  4DAY B;  3FKI H;  2K5D A;  1MGS A;  2KCT A;  5EKK A;  1PYB A;  2Z4I A;  4Y7N H;  1ASY A;  5CV6 A;  2GVA A;  4JI1 Q;  3UI2 A;  1Q8K A;  4C2M B;  3CCM A;  1HTL D;  2OTL A;  5CV4 A;  4L63 B;  1NMG A;  1YZ6 A;  4NXM L;  1PDQ A;  1PVO A;  1A6X A;  4R4O A;  3PQI A;  1XXG A;  5IYB G;  1BNZ A;  4G4K A;  4C2M H;  4LWC A;  5JEA J;  3PCO B;  4K14 A;  3I7F A;  2ZTD A;  1ENA A;  4OWT B;  1VQ7 A;  2B2V C;  5IGG A;  1QZG A;  1UWV A;  3I4N B;  2JA8 B;  3K58 A;  4DV6 L;  3L0O A;  3M4Y A;  1DOK A;  1H9J A;  4KN4 C;  3D8G A;  3AYH B;  2F0J A;  1K8O A;  2VS1 A;  3CD6 A;  3VR2 A;  1EFW A;  1VQC A;  2K50 A;  4IAL A;  4JI0 Q;  2KCN A;  1D8L A;  1JE4 A;  3GTO B;  1E1T A;  3STB D;  5CR3 A;  5ELO A;  3MXN B;  1QG7 A;  5IOD A;  1LT4 D;  4KKU A;  2R92 G;  4CJ0 B;  1SE3 A;  2EY1 A;  2HQL A;  1AH9 A;  2CVR A;  1HR0 L;  5C0X G;  3MAQ A;  1CA6 A;  1YHB A;  2EYO A;  1O7I A;  4ME5 A;  2JK8 A;  4EX5 A;  2EOT A;  3K5M A;  4C1N K;  3RD4 A;  3RLF A;  3QR8 A;  1RDP D;  2MQH A;  2FJ2 A;  1WTO A;  3NK9 A;  1SMY C;  1SYB A;  5ELE A;  2A19 A;  2RDG A;  1VQK A;  1B7Y B;  2L9H A;  2IL8 A;  2PZW A;  2A8V A;  3RZO B;  1B9N A;  1GD7 A;  4NPS A;  3ERQ A;  3K7A B;  1YNN D;  4OO1 H;  4A3M B;  4A3I B;  3HOV B;  2NVY B;  4X6A H;  2F0N A;  4DK1 A;  1B50 A;  1S72 A;  3K7A H;  3N52 A;  3NTH A;  1ILQ A;  3KDF A;  4A3I H;  1SYE A;  2OQK A;  4RMF A;  2XNA C;  2F0L A;  5EPJ A;  2NVY H;  4KY6 A;  3HOV H;  3LWU A;  4KHZ A;  2F0U A;  1QVG A;  1JMC A;  1MI2 A;  1CZW A;  1JCK B;  2E74 C;  2KOL A;  2IX0 A;  4RG1 A;  3VDY A;  4GOP B;  1NR4 A;  3DLL A;  1CZG A;  4ZK9 B;  3DWQ A;  3GTQ B;  2KQ3 A;  5EQ0 A;  2JSO A;  5CBE E;  2VQE L;  2BA1 A;  1F2Z A;  4RGO S;  2F52 A;  2QEX A;  3NHH A;  4XXE A;  1FL0 A;  4TQU S;  3U4V A;  4A3D B;  5EKL A;  3PO3 B;  2VUM B;  2B2W C;  4DK0 A;  1ZKO A;  5DM6 3;  3NQT A;  4QCL A;  2ZXP A;  3HOY G;  3M4Q A;  2ES2 A;  2VUM H;  4PZ8 A;  3PO3 H;  1KDB A;  4IFD G;  1VQ8 A;  2MJ8 A;  2A6E D;  2SEB D;  5D3I B;  4R4I A;  4JI1 L;  2K33 A;  2EYH A;  2JA9 A;  4LF6 L;  2R7Z G;  5K36 H;  4NP5 A;  3VA5 A;  3TRE A;  5GAE C;  4A3J G;  1X3E A;  2O5I C;  2KCC A;  2PI2 A;  3WOF A;  3Q23 A;  5JVG 3;  1H9S A;  5IGB A;  5C5M A;  1C0A A;  2NN6 G;  1N32 L;  5EBD A;  2K01 A;  4GN4 B;  4B3R L;  2D2C C;  2EIF A;  3FHW A;  4BBR H;  1PTO C;  4DF7 A;  1PTO F;  4GNX C;  2PI2 E;  4JBJ A;  3I70 A;  2NVQ B;  1SN8 A;  2QGQ A;  3GTL H;  4CKB A;  2N3S A;  4C3H B;  4DR1 Q;  3OHX C;  1BOS A;  4DPG A;  1J8I A;  4JG2 A;  4JI5 L;  2MFI A;  5J22 A;  5M5W B;  2NVQ H;  1C8C A;  3P75 A;  1IXR A;  2DY7 A;  4A93 H;  1HZ9 A;  2Q8I B;  1X3F A;  2R3Z A;  1K8M A;  2KCM A;  2Q8T A;  5G3L D;  1KNE A;  5GQO A;  1HNZ Q;  1AE2 A;  3MFG A;  5M5W H;  1RTN A;  4QJF A;  4JI3 L;  1LUZ A;  2AWN A;  2E2I B;  4YCV A;  5AJ3 L;  1X65 A;  1Y8O B;  4TSS A;  1PFB A;  5JEA G;  2L4N A;  1IYJ B;  3M4O H;  2EY5 A;  2A68 C;  4C56 C;  1DXM A;  3KLR A;  3TDQ A;  3HOU G;  4B3T L;  2F4V L;  1KAW A;  1YIJ A;  3O13 A;  3G6E A;  2F0W A;  4BWG B;  4NW2 A;  2B2V A;  3HOZ B;  1U5K A;  2YTX A;  5IT9 L;  3V05 A;  4DNT B;  1YBY A;  2FMC A;  1JOK A;  2SOB A;  3D0F A;  1X3Q A;  4P71 A;  4KN7 C;  2E2D C;  1STB A;  4XYO A;  1VDZ A;  3HOZ H;  5C5L A;  1UE6 A;  2C9O A;  3J81 L;  1I4X A;  4RKB A;  4A3C G;  3I4M B;  3BZC A;  2H4O A;  2DNE A;  2OWO A;  4UDU C;  4N8X 1;  4OGQ C;  2JA6 G;  3ITP A;  3I4M H;  4POG A;  3S1N B;  2EY6 A;  4DR4 Q;  2JP1 A;  3R3O A;  2R93 G;  3S1N H;  1C48 A;  2CW0 D;  4ALP A;  4J6H A;  2WIN B;  1Y1V G;  4LFA Q;  1QCB D;  5HGT A;  3P20 A;  1G91 A;  2EYL A;  2MHV A;  3AMU A;  2ZJP A;  1WD1 A;  4KV6 A;  2KEN A;  3I4O A;  4K0K Q;  4YY3 L;  3H6M A;  4GN5 A;  1X3P A;  1GUO A;  5GRO A;  2AHO B;  3A74 A;  3LNN A;  1NE3 A;  5C44 G;  4NB3 A;  5EJW A;  2BH2 A;  3FRP B;  5IIF A;  3KF8 B;  4X62 L;  2RSO A;  4DUY L;  2R7F A;  1VQD A;  4I7Z C;  3H09 A;  5IP7 G;  5IGE A;  2WFW A;  4WFN 3;  1JWM D;  1F9R A;  2EDG A;  1EYD A;  3K0Y A;  4DV7 L;  3T13 A;  1K3B C;  4WJ4 A;  3H3V I;  1DOM A;  2K05 A;  4FF3 A;  5IYC G;  1BKB A;  1KAB A;  1Y69 U;  1IBL L;  1P8L A;  2XN9 C;  3DEP A;  3MTS A;  3CC7 A;  3HKZ B;  2RA4 A;  3H94 A;  4DR1 L;  5K5P A;  1VQ6 A;  2IWH A;  1HNX L;  4BA2 I;  2QF7 A;  1Y1W B;  4AYB G;  3SE0 A;  3TP7 A;  3V96 A;  1HA6 A;  4DU9 A;  2L11 A;  4MN3 A;  3PO2 H;  1EU4 A;  3OMC A;  4C3I G;  5IT9 E;  3W2D A;  3X3M A;  1RD9 D;  1SAP A;  1UAP A;  2YYZ A;  2ALY B;  2WII B;  1KTK A;  1HQM C;  1UUP A;  1I4Q A;  3KF6 A;  3G7L A;  4DR5 L;  3J81 E;  4LF7 L;  3UDI A;  3RN5 A;  1HXY D;  1WTP A;  2X6L A;  4HIK A;  2Y0S G;  4U67 3;  1JB3 A;  1I3Q H;  3HFZ B;  3KLW A;  5CMD A;  3J80 c;  3GTK B;  1IKM A;  1D1I A;  3U9S A;  4KHP L;  4S3S A;  1RJT A;  4DR3 L;  4KY7 A;  5CYU A;  3RLO A;  2I5L X;  3OPO A;  5EGT A;  2NTT A;  1X6O A;  1EYC A;  2PZT A;  1HNW L;  1K28 A;  1BBU A;  3TQY A;  3CCS A;  4A3E H;  1WTX A;  1BBX C;  2EXZ A;  4H13 C;  4A3K G;  2F0K A;  2D5D A;  3QG1 A;  2N49 A;  2EJM A;  1S5C D;  5KNC A;  1Q81 C;  1L1O B;  1FNV A;  5C3E G;  1A3U A;  3K81 C;  1WTV A;  4EQ5 A;  4GNX A;  3A5U A;  4QF4 A;  1UEB A;  2ZXR A;  1GUS A;  5LL6 S;  1X9N A;  3W3A A;  3CQZ H;  4FF1 A;  4DNR B;  1UE5 A;  2WAQ B;  4JW0 A;  3CPF A;  3KLS X;  4DNI A;  1PLF A;  4F87 A;  1Q8I A;  2NVX B;  4JBK A;  4EGV A;  3H0G B;  1Q3L A;  4BBS G;  4K5X A;  4U68 A;  1WOC A;  1SE4 A;  4HTH A;  1CKN B;  2EE1 A;  4RWS C;  5FJ8 H;  5TSS A;  3S1R H;  1WTR A;  4JPB W;  4MIU A;  3K6O A;  5E1F A;  3TS2 A;  1TWF B;  2UUC L;  1VF5 C;  4PMB A;  1SYC A;  4DXF A;  5EAY A;  5FKA C;  1TWF H;  5I6Y A;  5JJI A;  5CGK A;  4L8J A;  2JN4 A;  4UY8 C;  1SYF A;  3Q8D A;  2K5V A;  4MHE A;  3U50 C;  2LY7 A;  1PH9 A;  1E2Z A;  5BR8 Q;  1EWH A;  3WWV A;  3HOX B;  4BY1 H;  3BZD B;  5C6A A;  2K28 A;  4A3B H;  1RCV D;  1KHI A;  3A8K E;  2F3W A;  4KD4 A;  3TP5 A;  4BY7 G;  4KKT A;  3HOX H;  3D6W A;  1SNM A;  1PH2 A;  1GJX A;  2XSC A;  2ICE C;  1I4P A;  2F0H A;  3DMU A;  3MC0 B;  4G57 A;  1WFQ A;  4XT3 B;  5ELB A;  2JA5 B;  2B8F A;  4X64 L;  2JYO A;  4X66 Q;  2CHB D;  4NXM Q;  5D65 A;  2N8N A;  1I4H A;  1L2F A;  1HPC A;  4KHV A;  1AP0 A;  1VQG A;  3BG3 A;  4KLK A;  3J80 i;  4JYA L;  1DM0 B;  1G6Z A;  2V4D A;  1EWC A;  3OOC A;  1O7L A;  1TWH B;  2HIV A;  2RDF A;  3U4Z A;  1PFN A;  3R2T A;  1A62 A;  4DV6 Q;  2MP1 A;  1Q46 A;  4E6I A;  3CC2 A;  2B63 B;  1K3R A;  3KLS A;  2F0M A;  1TWH H;  2I5H A;  3A54 A;  1TII D;  2XTI A;  3BVM A;  1H9M A;  4JBW A;  2B63 H;  5C4X G;  3NPP A;  4R4Q A;  4RGT A;  4L5S A;  4O2D A;  4X3T A;  5JPM C;  3JAM c;  1EY4 A;  1ZYR C;  5G3L F;  3P1H A;  4K2K A;  1GO3 E;  4LF5 L;  2A68 D;  4IPH A;  1WD0 A;  4OO1 I;  4GOP C;  2CH4 W;  4HN7 A;  1TU2 B;  1HR0 Q;  1LAC A;  3A0J A;  4QIW B;  2PQA A;  3W5O A;  2B2U A;  2K14 A;  3CCU A;  2Z4H A;  3M7G A;  1SNO A;  3D31 A;  3FVQ A;  1S5F D;  4LUZ A;  2SNS A;  3OW2 A;  3TP8 A;  3BVZ A;  1EUJ A;  4DAV A;  2QCP X;  5JOB A;  1D5Z C;  3QIA A;  2NB0 A;  5I6W A;  1EYA A;  2M00 A;  4KMU C;  5ELN A;  2VL6 A;  3RNU A;  4IN3 A;  3L3O C;  5IYD G;  1C7Y A;  3ULL A;  2C35 B;  2IT1 A;  4ZKC B;  4A3F B;  2WB1 B;  1EY6 A;  1QZH A;  1A2T A;  2KHS A;  1HZC A;  4KTA A;  4JCV E;  4A3F H;  4TVA B;  1VMC A;  1D6E C;  4HJ5 A;  5KRU A;  1PH7 A;  2K03 A;  1VQB A;  1PFS A;  1F2M A;  3OWE B;  4LK1 C;  2K5Q A;  1GHJ A;  3NBH A;  2KEE A;  2N55 A;  3QWN A;  1JC7 A;  1KDA A;  5KNB A;  4X65 L;  1PXU A;  4FF4 A;  2L15 A;  3QOL A;  2VQE Q;  4DV4 L;  2K1B A;  2QDL A;  2DY8 A;  4RA8 A;  1YI2 A;  2AUK A;  1V9P A;  1W6J A;  1EY9 A;  3HRZ C;  4B3M L;  2N88 A;  4DV2 L;  3H15 A;  5I9P A;  3MXP A;  3A8J E;  1S4Z A;  1QVF A;  5M3M B;  3FKI G;  3I8Z A;  3J81 j;  3R2I A;  1I4G A;  1XTD A;  4RAU C;  1XNQ L;  1IL8 A;  2KEC A;  2PMZ E;  4ZLT F;  4LFC L;  1CKO A;  3DUZ A;  5M3M H;  2M9V A;  2QIL A;  3CRL C;  2M2L A;  3VA7 A;  3D4W A;  4X66 L;  4LF6 Q;  2F0Q A;  1DZ1 A;  5CBA E;  1ROD A;  2K75 A;  3JAM i;  3URY A;  5JJZ A;  2R7D A;  1XMQ L;  3RMH A;  1DYQ A;  4MNO A;  1LTT D;  1N32 Q;  1N9W A;  4B3R Q;  4WOR A;  4QGU A;  4XYQ A;  2P5Z X;  1AFP A;  1JT8 A;  1V1Q A;  5FLX L;  1E24 A;  1SYD A;  4OEM B;  3I4N H;  2JA8 H;  2K7V A;  2QKI C;  2HDL A;  1B70 B;  4JI5 Q;  5IYB H;  1FR3 A;  1NY4 A;  3MHB A;  3MXN A;  1W2B A;  4HJ7 A;  1PH1 A;  2AQ1 B;  4O0A A;  4HAE A;  3OW7 A;  4JI3 Q;  3GTO H;  3K7U C;  4F8M A;  1U4R A;  1D2B A;  4OON A;  5AJ3 Q;  2Z6K A;  3PMF A;  1PH5 A;  4ZYS A;  4XDX A;  4J8Q A;  1E3P A;  1H9K A;  5J39 A;  4YIJ A;  1E0B A;  1F2L A;  4IUR A;  4L5T A;  1Y14 B;  2R92 B;  2PZU A;  3N6R A;  4IUV A;  4UHV A;  4FDB A;  1O7Z A;  1VF7 A;  1IW7 C;  1YVC A;  2XWJ B;  1S5E D;  3OTO L;  1XPR A;  2HDM A;  2XWB B;  4B3T Q;  2YU9 B;  2F4V Q;  3CU7 A;  4OO1 G;  2UUA L;  3ICE A;  1UE1 A;  3MVV A;  2EYJ A;  2D9U A;  1EY0 A;  1GUN A;  3CME A;  3KOJ A;  5C0X H;  2AWO A;  4EQN A;  3TEH B;  1B9M A;  3S14 B;  5AFW A;  4HMJ A;  2IPK D;  1KLU D;  3RZO H;  1BR9 A;  4A3I G;  4AQY L;  2OF1 A;  4MTN A;  2E8G A;  3ZYY X;  4A3M H;  1HFG A;  3K8A A;  3OIP A;  2VXW A;  1H95 A;  4PMC A;  3NP8 A;  4B3S Q;  3S14 H;  2OCE A;  2TSS A;  2VB2 X;  4NMZ A;  4H02 A;  3EVQ A;  1CM9 A;  3F2C A;  1LO5 D;  1LTL A;  2PYK A;  1Z7T A;  5EKI A;  3M3Y B;  3S1Q B;  3G6J B;  5LMN W;  2IY5 B;  3TZD A;  1LV9 A;  2NZH A;  2LXJ A;  4K8I A;  4LMQ D;  3VYT A;  2AUJ D;  3S9W A;  1F9P A;  3EA6 A;  4EVO A;  4DV5 L;  3GTQ H;  2C5C A;  1GUG A;  2LSS A;  2XRQ D;  2HCI A;  4N9T A;  1SBB B;  2VUM G;  3PO3 G;  1VQJ A;  3PIP 3;  4A3D H;  2RCF A;  5DNF A;  3FP9 A;  5FLX E;  1KIX A;  4YY3 Q;  1T9H A;  1TS4 A;  1D5M C;  5DM7 3;  1L0W A;  4K6D A;  4JOI C;  5LHY 1;  4PZ6 A;  1D1K A;  4JI8 L;  5K36 G;  4RFB A;  4OHJ A;  2JA7 G;  1QIL A;  1YIT A;  3GTP B;  4X62 Q;  3HOY B;  1F77 A;  4DUY Q;  4A75 A;  2UXD L;  1X3G A;  2O2L D;  4BS9 A;  1CA5 A;  4P72 A;  3H91 A;  1PZI D;  1WCM G;  4BBR G;  4HIM A;  1L1O C;  4DV7 Q;  1A3V A;  2R7Z B;  3U58 A;  5J1Z A;  5M5X B;  2VY3 A;  1G2S A;  1JE5 A;  2AQ2 B;  5HUR A;  2EZV A;  1VQM A;  3IKJ A;  1IBL Q;  1IZ6 A;  4R4C A;  5NUC A;  2EYP A;  1JOQ A;  1Z9F A;  5FO7 B;  3S1M B;  1VQF A;  1EQR A;  3GD7 A;  1SE8 A;  5FOB B;  1HNX Q;  3PUZ A;  4YWK A;  1BCP B;  4A93 G;  1ET9 A;  1N33 L;  2QEJ C;  3CCJ A;  4A3G G;  3T1H L;  1H9S B;  3I56 A;  2A69 D;  5J3B A;  4C3H H;  5IP9 G;  4CDE C;  1IHZ A;  2NN6 H;  1ZYR D;  3NQI A;  1B1Z A;  5FK9 C;  4AH6 A;  1UE7 A;  2F0E A;  3MEH A;  5EPK A;  3VR3 A;  1L0X B;  2DN8 A;  3PF5 A;  5E4X A;  5KGU A;  4WJ3 M;  4DR5 Q;  2EVB A;  4LF7 Q;  1TS2 A;  2JEB I;  4OIK A;  4CKE A;  4HJ9 A;  2E2I H;  3VR4 A;  4A3L H;  2EXD A;  2JJQ A;  1FNU A;  4CJ2 C;  2J4X A;  1R9T B;  4KHP Q;  3KJO A;  3RN2 A;  4DR3 Q;  1V43 A;  1JJ2 A;  1PH4 A;  1VQA A;  3EBE A;  2RKS A;  4CJ1 B;  1LT6 D;  4NDX A;  4ME3 A;  1HNW Q;  1R9T H;  2VB3 X;  3SR1 A;  3T51 B;  2E2J B;  1XNR L;  4JBM A;  1B8A A;  3D4R A;  1EZ8 A;  1PFM A;  3IRB A;  3Q0A A;  1GKH A;  3J7A F;  2KBN A;  2HD3 A;  5IE8 A;  1JR0 D;  2L5T A;  3HOU B;  1CI3 M;  4B3S L;  2F0O A;  3OWF A;  3UE1 A;  3E3X A;  2CQO A;  4M8A A;  4M1U B;  4PMW A;  5LMN L;  4HID A;  1TQO A;  3GDE A;  3HOU H;  4F7X A;  3I4M G;  1QNK A;  4TKO B;  3X3N A;  3HS0 C;  3NEM A;  4YCW A;  1P16 A;  3SK8 A;  2NZO A;  4DXG A;  1AW7 A;  2I5M X;  1BUV T;  1LT5 D;  1VQE A;  4K5W A;  2K04 A;  2ZT9 C;  2UXB L;  2J7Z A;  4RGM A;  2UUB L;  2GA4 B;  4JV5 L;  1KDC A;  1EL0 A;  4OX9 L;  1GVP A;  1KRS A;  1BCP D;  2CWP A;  1GHK A;  4MTK A;  3IL8 A;  2UUC Q;  2JA6 B;  3EFX D;  1VQI A;  2E75 C;  3I4L A;  1IBM Q;  3UDX A;  1H9R A;  3RR5 A;  4JI4 L;  3TSS A;  1M1K C;  2R93 B;  3IFD A;  2V1C C;  4YCU A;  4B08 A;  1FNW A;  1Q86 C;  1GUT A;  5IT9 c;  4RHR A;  4JI7 L;  1Y1V B;  1I50 B;  2HIX A;  2R93 H;  4XIG S;  4C3J G;  3G71 A;  1Q1B A;  3H3V C;  4LAA A;  3J81 c;  1QUQ A;  1Q1E A;  4FXG C;  4IPG A;  5BN5 A;  4RHS A;  3RZD B;  1U4M A;  1W6K A;  2A73 B;  1CHP D;  2N78 A;  1CT1 D;  1TY0 A;  3K5L A;  5ELC A;  3D6C A;  2NVT B;  4YHH L;  3SK4 A;  5C44 B;  3F1Z A;  3GO5 A;  3RZD H;  5KND A;  4Q5V A;  1TWC B;  4GS3 A;  4X64 Q;  3NEN A;  3SVM A;  2E2H B;  2KUM A;  4PV1 C;  1WI5 A;  4IJH A;  1K83 B;  2NBF A;  1TWC H;  1HCZ A;  4JYA Q;  3BDC A;  3PO2 G;  4F88 A;  3R93 A;  3MXG A;  1TWA B;  5KIX A;  2L12 A;  2DNC A;  3HKZ E;  2A6H C;  2B2W A;  1Y1W H;  3Q24 A;  3T1Y L;  1E22 A;  1BVS A;  3NTK A;  1TWA H;  1K0S A;  2I07 B;  4A76 A;  1LTB D;  2F4I A;  1EQT A;  1I6H B;  4AYB B;  1Z6H A;  1I4R A;  2Z8L A;  3NXW A;  5M5Y B;  4JOI A;  3PUX A;  1FJG L;  1PRT B;  4KKS A;  2Q2U A;  1VQP A;  3CCL A;  5M5Y H;  1OTC A;  1EIG A;  4LF5 Q;  3CC4 A;  1XWE A;  2KVM A;  2K6A A;  4A3E G;  1EIF A;  3GTK H;  1IW7 D;  4DKA C;  2F1M A;  3CCQ A;  4DV3 L;  2Y0S B;  1T5X D;  5JAV A;  3S2H B;  5CV9 A;  4JC0 A;  4QUF A;  3E0E A;  2D0P A;  2X6G A;  1VMP A;  2BDO A;  5FO9 B;  2DJF C;  3K0X A;  1CKM A;  3S2H H;  4LFB L;  1R4Q B;  1S40 A;  5FO8 B;  2E5L L;  3D4D A;  3BDO A;  4A3K B;  2EY2 A;  3QJY A;  1EU3 A;  4IOC A;  4TRD A;  3T1Y Q;  1KL9 A;  2B39 A;  5C3E B;  1CFM A;  1EOV A;  1PZJ D;  1N36 L;  4IUN A;  4GZY C;  5EPL A;  1LTR D;  2I0Q A;  2QW7 A;  4IPC A;  1HHV A;  4ILW A;  1AZP A;  1AEX A;  1CKN A;  2VW9 A;  4ZUJ A;  2NVX H;  1JIC A;  4HR7 B;  1CQV A;  3H0G H;  4UP7 A;  2ASB A;  4IZ8 A;  1HRJ A;  3CRK C;  4Z9C B;  3J81 i;  2B2Y C;  4JI6 L;  4IO9 A;  4UP9 A;  4NXN L;  1GM5 A;  1BBW A;  4I7A A;  3I3C A;  3CCE A;  1IBM L;  4BBS B;  1KRT A;  1PYS B;  3UDG A;  2D62 A;  2B29 A;  2EYM A;  4YWM A;  4R1J A;  1O80 A;  2L1B A;  3L9A X;  2OTJ A;  4R8I A;  4V19 0;  2HHH L;  4X65 Q;  4FF2 A;  4DV4 Q;  4OWW B;  4WRD A;  3SHL A;  1DD2 A;  4BY1 G;  4CKC A;  1MSG A;  1PH6 A;  4A3B G;  3KUP A;  4BXX H;  4B3M Q;  5F2D A;  4DV2 Q;  1XPU A;  4DR2 L;  4OIJ A;  4DGZ A;  3S16 B;  5C3X A;  1VQH A;  1DCZ A;  3A7L A;  1XJV A;  3SDZ A;  4ZKB B;  2PW5 A;  1W3S A;  1SJH D;  2RF4 A;  1MJC A;  1PA6 A;  1VQO A;  1XNQ Q;  2R6G A;  1ZXT A;  1CSP A;  1FGU A;  3LX0 A;  5GAG C;  4LFC Q;  4N8F A;  5JJK A;  4RH6 A;  2NYZ D;  4K8J A;  1BDO A;  4UP8 A;  1WVL A;  2G9D A;  4BY7 B;  1K0R A;  2WP8 J;  2JA5 H;  3R8B A;  4P73 A;  1WTH A;  5M3F G;  3CKI B;  3FEW X;  1XMQ Q;  5KYI A;  1HH2 P;  1KQS A;  2F0S A;  1Y8N B;  1TKW B;  2WKC A;  3F2D A;  4GKJ Q;  2EYF A;  4X3S A;  5IGF A;  1G51 A;  1CQF A;  5A35 A;  5CC4 A;  3PV0 A;  4JK1 C;  5C0X J;  2ZJR A;  1OO9 B;  2HT1 A;  4UAI A;  2BA0 A;  1Y8P B;  3FPU B;  2ZJQ A;  3BS1 A;  3T56 B;  1B2T A;  2XVS A;  2A69 C;  1VQL A;  4ZQ3 A;  3S2D B;  2ZXO A;  2B2T C;  4NKL A;  1LM0 A;  1CUK A;  1IBK L;  4H0L C;  1I94 L;  1WTW A;  4LW1 A;  1E2W A;  5C4X B;  2RHS B;  4POF A;  2K52 A;  3H3V H;  3HKS A;  4KD3 A;  2YV5 A;  4LF9 L;  5C4X H;  5KYL A;  3AB9 A;  3MZ5 A;  2O4X A;  4DV0 L;  4QIW E;  3GP7 A;  1E1O A;  4DR7 L;  4H7B A;  1V1P A;  2PQE A;  2TMP A;  3HOW G;  1SNP A;  3OTO Q;  3BJU A;  1DOL A;  4HJ8 A;  3SK6 A;  5A2Q E;  4J1M A;  3BZK A;  2UUA Q;  1MKH A;  2SNM A;  2MUY A;  1STG A;  3C1F A;  3G48 A;  1JQY D;  3TME A;  4AQY Q;  5FLM H;  3I72 A;  1TWG B;  4PQX A;  4DK3 C;  1NUC A;  3CW2 C;  1N34 L;  4K2L A;  3AEV A;  1WYD A;  3J7A V;  4QB4 A;  2WB1 E;  1SDF A;  3PUY A;  3D3R A;  3MFY A;  5I9O A;  4FP5 D;  4IFD J;  3FPP A;  3CPW A;  4CDC C;  1BCP C;  2LMC B;  1BCP F;  3S17 B;  1SJE D;  3I73 A;  4DV5 Q;  1FYC A;  1RTO A;  1TVX A;  5JPN C;  3TN2 A;  2SDF A;  1KD1 C;  1ICF B;  1KLG D;  2BH8 A;  1HFN A;  2WKD A;  1ZEQ X;  1HZB A;  2JQO A;  1Q7Y C;  1KAA A;  1F9S A;  3E5S A;  4ZAI A;  3NBH B;  2RCN A;  3NTI A;  2GN5 A;  4DAY A;  2ZM6 L;  2VQF L;  4XQQ A;  3DM3 A;  1B3A A;  4RKL A;  3CXC A;  4JI8 Q;  2LXK A;  4O42 A;  3AFP A;  3EIV A;  1HA5 A;  3I90 A;  4DV1 L;  3JC6 6;  3M9B A;  4QMG A;  3ND9 A;  3E6Z X;  3FKI B;  2UXD Q;  3KJP A;  1QNU A;  4Y52 H;  4JVZ A;  4GLX A;  2G9H D;  3J7Y W;  2B2Y A;  3ULP A;  2F0P A;  5LMU L;  4GKJ L;  3PUV A;  1EEF D;  1QVC A;  2A6H D;  3I4N G;  2EJF C;  2JA8 G;  4DFA A;  1B4O A;  3TP6 A;  4HSP A;  3L2P A;  1GXD C;  1MHW C;  1MD2 D;  2MO1 A;  3GTM B;  3F8T A;  1YJN A;  2KHI A;  1PH3 A;  3P7J A;  1N33 Q;  4CDF C;  1KXL A;  4DUZ L;  1LTG D;  3T1H Q;  2H5X A;  2NTS A;  1TR5 A;  4OL7 A;  1J9O A;  5IGC A;  4HIO A;  3GTM H;  1BO0 A;  3C3L A;  1ONL A;  3GQB A;  3QB3 A;  2FHT A;  5CV7 A;  5CV5 A;  5T1G A;  3K57 A;  1STN A;  5IY0 A;  5C4H A;  2RSN A;  4KY5 A;  1FVI A;  2IHE A;  4R8N A;  1SSO A;  2CQA A;  4IJL A;  2Z1C A;  1OXV A;  3RLN A;  1G6P A;  3SK5 A;  4UPA A;  2F3V A;  3AU7 A;  3T4A C;  2BE5 D;  2R92 H;  1XNR Q;  4LUV A;  2K4K A;  3PF4 A;  1RIP A;  1TY2 A;  2CKZ B;  3M85 A;  3PSI A;  1AE3 A;  3E9H A;  1HUM A;  1OXS C;  5T1I A;  2LKV A;  2YU9 H;  3SEB A;  2L55 A;  5FLX c;  4A3M G;  5BN4 A;  2LFN A;  3HEJ A;  3HOV G;  2F0I A;  2K5N A;  3G4S A;  1B53 A;  1STY A;  4J15 A;  4OEL B;  4FNF A;  4OXP A;  5LMN Q;  4IQZ A;  1SNQ A;  2GVB A;  2B2T A;  2EJG C;  2G5D A;  2UU9 L;  5HY6 A;  3K59 A;  1LTS D;  2LS0 1;  4DR6 L;  1J5E Q;  4GOP A;  2IW3 A;  4GN3 B;  1EWI A;  3KYH C;  3SXH A;  4LNQ A;  2UXB Q;  2UUB Q;  5COR A;  3KDF B;  4JV5 Q;  3NEL A;  3KBX A;  3M3Y H;  4LF4 L;  4OX9 Q;  3S1Q H;  1AZQ A;  1RKN A;  1J6Q A;  2BOS A;  5E3F A;  1HZA A;  4GKK L;  2UXC L;  1C9O A;  3LGJ A;  1DGS A;  3NUC A;  1IYU A;  4FXD A;  1ENC A;  1EY5 A;  4QUC A;  2F0F A;  4KK7 A;  2CH4 A;  3ULJ A;  4CGY B;  1K9M C;  4A3D G;  1JB7 A;  2FMM A;  3DWP A;  4JI4 Q;  2RBM A;  1SXT A;  2I46 A;  2XGT A;  4LF8 L;  1GUW A;  3A5Z B;  1K8A C;  1ET6 A;  4XQN A;  4MZ9 A;  3UE0 A;  4JI7 Q;  1PRT C;  1NR2 A;  1JWS D;  1PRT F;  3DM1 A;  2JXM B;  1CK1 A;  1QE6 A;  2MNA A;  1TXY A;  1EY7 A;  1YHA A;  3QOJ A;  5HGQ A;  3VYS A;  2NUC A;  4PG3 A;  3HP3 A;  3GTP H;  1YNJ D;  1EYG A;  5I4D A;  1SEB D;  4XTC S;  3HOY H;  2BDN A;  2JA7 B;  3W1B A;  4YHH Q;  4FXK C;  2RHQ B;  2K5W A;  1RF2 D;  4IFD H;  1CTM A;  4A3J B;  3CHB D;  2JA7 H;  4CHT B;  2OXP A;  2R7Z H;  5M5X H;  4ID6 A;  3TZU A;  2ZTE A;  2QDB A;  1G2T A;  1WCM B;  4C3H G;  4BBR B;  1LTA D;  3LWE A;  3CF5 A;  4A3J H;  1CHQ D;  3L7Z C;  2F0D A;  1S5D D;  3S1M H;  1NAP A;  1G8Z D;  1K8G A;  3GTL B;  4HSV A;  1O78 A;  1WCM H; 
#chains in the Genus database with same CATH homology
 4DV6 Q;  4DV6 L;  1E22 A;  1Q46 A;  3L0O A;  3CC2 A;  1BVS A;  1K3R A;  3AYH B;  1TWA H;  1TWH H;  4A76 A;  2I5H A;  2VS1 A;  3CD6 A;  3CCR A;  3CCV A;  1EFW A;  3SGI A;  2XTI A;  1OXU A;  4JOI A;  4JBW A;  2QA4 A;  3PUX A;  1VQC A;  2K50 A;  2B63 H;  4A3L G;  1FJG Q;  3CMA A;  1FJG L;  4JI0 Q;  4JI0 L;  3PUW A;  4R4Q A;  3I2Z A;  4JV5 L;  1D8L A;  4L5S A;  4O2D A;  3JAM c;  2Q2U A;  1E1T A;  2IHF A;  3STB D;  1VQP A;  3CCL A;  4QL5 A;  3ER0 A;  5ELO A;  3MXN B;  5M5Y H;  1OTC A;  2Z0S A;  4A3G H;  1GO3 E;  1A62 A;  4LF5 Q;  4LF5 L;  4IPH A;  1I5F A;  3CC4 A;  5IP9 H;  3BU2 A;  4OO1 I;  2R92 G;  1OXX K;  4GOP C;  4A3E G;  1EIF A;  2HQL A;  3GTK H;  1AH9 A;  1HR0 Q;  1HR0 L;  3A0J A;  4DKA C;  5C0X G;  2PQA A;  1YHB A;  3W5O A;  4DV3 Q;  3CCQ A;  4DV3 L;  5IWA Q;  2K14 A;  3CCU A;  1Y1W H;  1O7I A;  4EX5 A;  2JK8 A;  4JC0 A;  1N8R C;  4P75 A;  1NJI C;  3E0E A;  2D0P A;  3D31 A;  3RLF A;  3HOZ G;  5JJL A;  4LUZ A;  2E2J H;  2MQH A;  2ID0 A;  3OW2 A;  3K0X A;  1CKM A;  3S2H H;  4LFB Q;  4LFB L;  1S40 A;  1EUJ A;  2A19 A;  1VQK A;  1B7Y B;  2E5L Q;  2E5L L;  1VQ4 A;  3S15 H;  2A8V A;  5ELN A;  1GD7 A;  2VL6 A;  4IOC A;  4NPS A;  3RNU A;  3T1Y Q;  1SMX A;  1KL9 A;  3PGZ A;  3I55 A;  1EOV A;  5IYD G;  1C7Y A;  1N36 Q;  1N36 L;  3ULL A;  1J5E L;  2I0Q A;  4IPC A;  4HJA A;  3M7N A;  4X6A H;  2C35 B;  1JJG A;  2IT1 A;  1S72 A;  3TRZ A;  3K7A H;  1QZH A;  1CKN A;  2VW9 A;  2NVX H;  3KDF A;  4A3I H;  1S3O A;  1HZC A;  2OQK A;  4RMF A;  3HOV H;  2NVY H;  4UP7 A;  3H0G H;  2ASB A;  4JCV E;  4KHZ A;  4A3F H;  1C0A A;  4TVA B;  3J81 i;  4HJ5 A;  4JI6 Q;  4JI6 L;  1JJC B;  4IO9 A;  4UP9 A;  4NXN L;  1PH7 A;  1GM5 A;  1QVG A;  4NXN Q;  4A3C H;  1BBW A;  1VQB A;  1PFS A;  4PZ7 A;  1JMC A;  3CCE A;  2IX1 A;  1IBM L;  1KRT A;  1PYS B;  3UDG A;  2D62 A;  2B29 A;  2IX0 A;  4YWM A;  4R1J A;  4RG1 A;  2JA6 H;  1PH8 A;  5GAD C;  1SRU A;  2OTJ A;  3VDY A;  4GOP B;  3PIP A;  3DLL A;  2HHH Q;  2HHH L;  2EQS A;  4X65 Q;  4X65 L;  2L15 A;  4GLV B;  4DV4 L;  2VQE Q;  2VQE L;  2BA1 A;  4DV4 Q;  3TS0 A;  4OWW B;  2F52 A;  2QEX A;  4BY1 G;  2Q2H A;  4AIM A;  3M4P A;  1YI2 A;  1PH6 A;  1FL0 A;  1V9P A;  4A3B G;  4TQU S;  3U4V A;  4BXX H;  4B3M Q;  4B3M L;  5C4J H;  1Y1V H;  4DV2 L;  4DV2 Q;  1I50 H;  4BA1 I;  4DR2 L;  2DUD A;  3H15 A;  4DR2 Q;  1XPU A;  4QY7 A;  2FXQ A;  3J7A 5;  1VQH A;  1XJV A;  1QVF A;  3HOY G;  3M4Q A;  3FKI G;  3J81 j;  1W3S A;  2ES2 A;  2RF4 A;  4PZ8 A;  1MJC A;  1PA6 A;  2VUM H;  3PO3 H;  1VQO A;  1XNQ Q;  1XTD A;  2R6G A;  1MJE A;  4APV A;  1VQ8 A;  1XNQ L;  1CSP A;  1FGU A;  3OYY A;  2PMZ E;  5GAG C;  4LFC Q;  4LFC L;  1CKO A;  4R4I A;  4JI1 L;  5JJK A;  5M3M H;  2JA9 A;  4X66 L;  4LF6 Q;  4LF6 L;  2R7Z G;  4C3J H;  4UP8 A;  2NVT H;  5C44 H;  3TRE A;  1M90 C;  1K0R A;  2WP8 J;  2K75 A;  1X3E A;  5GAE C;  4A3J G;  2JA5 H;  3JAM i;  1QUQ B;  2PI2 A;  3AFQ A;  3HKZ G;  4P73 A;  5H1S E;  5M3F G;  2E2H H;  2R7D A;  1XMQ Q;  1XMQ L;  2YTY A;  2NN6 G;  4MNO A;  1HH2 P;  5IP7 H;  1Y1W G;  1KQS A;  1N32 L;  3F2D A;  1N32 Q;  1N9W A;  1VQ9 A;  1K83 H;  4GKJ Q;  4GN4 B;  4B3R Q;  4B3R L;  4LUO A;  2EIF A;  3FHW A;  4QGU A;  1G51 A;  1NMF A;  4BBR H;  1JT8 A;  1V1Q A;  3GTG H;  3PV0 A;  4GNX C;  2PI2 E;  4JBJ A;  5C0X J;  2ZJR A;  1E24 A;  1SN8 A;  2HT1 A;  4JI2 Q;  2QGQ A;  5IYC H;  3GTL H;  2BA0 A;  3I4N H;  1YHQ A;  2JA8 H;  2N3S A;  4DR1 Q;  2ZJQ A;  2VNU D;  1B70 B;  4DPG A;  4JI5 Q;  4JG2 A;  4JI5 L;  5IYB H;  2MFI A;  1VQL A;  2NVQ H;  1IXR A;  1YJ9 A;  1I6H H;  4A93 H;  1HZ9 A;  1NY4 A;  1X3F A;  1KC8 C;  1A63 A;  1YEZ A;  1W2B A;  1VQN A;  2KCM A;  1LM0 A;  1CUK A;  4KI0 A;  4HJ7 A;  1PH1 A;  1IBK L;  1IBK Q;  4AYB E;  5GQO A;  4O0A A;  1HNZ L;  1AE2 A;  5M5W H;  1HNZ Q;  1I94 Q;  1I94 L;  4QJF A;  4JI3 L;  4JI3 Q;  1LUZ A;  3GTO H;  2AWN A;  4LW1 A;  3K7U C;  4C3I H;  2RHS B;  2ZTC A;  4OON A;  4YCV A;  4POF A;  2K52 A;  5IWA L;  2Z6K A;  3HKS A;  5AJ3 Q;  3CP0 A;  5AJ3 L;  1X65 A;  3KF6 B;  1PH5 A;  4LF9 Q;  1L1O A;  2YV5 A;  3J7Z C;  4LF9 L;  3STB C;  1E3P A;  5C4X H;  5JEA G;  1A0I A;  2A1A A;  2JEA I;  1IYJ B;  3M4O H;  4DV0 Q;  4DV0 L;  4L5T A;  4QIW E;  1E1O A;  1Y14 B;  4DR7 L;  4DR7 Q;  1K73 C;  3H3V H;  2MO0 A;  4R4T A;  2Y0S E;  4FDB A;  3HOW G;  2JE6 I;  1YVC A;  3OTO L;  3BJU A;  3OTO Q;  1XPR A;  4HJ8 A;  1EIY B;  4B3T L;  4B3T Q;  2F4V Q;  2F4V L;  3HOU G;  1HNW L;  1X56 A;  1KAW A;  3BZK A;  1YIJ A;  1Q82 C;  4OO1 G;  2UUA Q;  2UUA L;  3G6E A;  3ICE A;  1UE1 A;  1MKH A;  2WAQ G;  3CME A;  3KOJ A;  2AWO A;  4YWL A;  1U5K A;  2YTX A;  3TEH B;  2D0O A;  2CFM A;  3GTJ H;  1YBY A;  3G48 A;  4A3K H;  3D0F A;  3RZO H;  1X55 A;  4AQY Q;  4P71 A;  4AQY L;  4A3I G;  5FJ8 G;  5C3E H;  4MTN A;  4GNX B;  2E8G A;  2WAQ E;  3H0G G;  5FLM H;  3K8A A;  4A3M H;  3HOZ H;  1H95 A;  3S14 H;  1UE6 A;  4B3S Q;  1SLJ A;  4DK3 C;  4A3C G;  1N34 Q;  2OCE A;  3CW2 C;  1N34 L;  3BZC A;  1EQQ A;  3AEV A;  1WYD A;  3EN2 A;  4H02 A;  4IOA A;  4P74 A;  2OWO A;  2WB1 E;  3F2C A;  3PUY A;  1HJP A;  2JA6 G;  1YNX A;  1SFO H;  3I4M H;  2CWA A;  1LTL A;  4POG A;  3E9I A;  1G29 1;  2PNH A;  4DR4 Q;  4DR4 L;  5LMN W;  2IY5 B;  4IFD J;  2NZH A;  2LXJ A;  2R93 G;  4BBS H;  3CPW A;  4L5R C;  3S1N H;  4ALP A;  4BXX G;  1Y1V G;  4GLA C;  1VS0 A;  4LFA Q;  3F2B A;  4DV5 L;  4DV5 Q;  4LFA L;  3GTQ H;  1XMO Q;  3CAM A;  1IL2 A;  1KD1 C;  1NBW A;  1SR3 A;  2LSS A;  2BH8 A;  1NTG A;  3HOX G;  1HZB A;  2JQO A;  2ZJP A;  1Q7Y C;  2VUM G;  3PO3 G;  1VQJ A;  3NBH B;  4A3D H;  2RCN A;  2GN5 A;  3FP9 A;  2KEN A;  3I4O A;  4YY3 Q;  4YY3 L;  1KIX A;  2ZM6 Q;  1T9H A;  2ZM6 L;  4K0K Q;  4K0K L;  3S16 H;  1L0W A;  2VQF L;  4GN5 A;  2VQF Q;  3S24 A;  4JOI C;  3KFU A;  3DM3 A;  4PZ6 A;  5GRO A;  3CXC A;  4JI8 Q;  2AHO B;  4JI8 L;  2LXK A;  4OWX B;  3ZJY C;  5K36 G;  3A74 A;  3AFP A;  2JA7 G;  1NE3 A;  3EIV A;  5C44 G;  1YIT A;  4DV1 Q;  4DV1 L;  4NB3 A;  2JA5 G;  2BH2 A;  3JC6 6;  3M9B A;  3KF8 B;  4X62 L;  3UDF A;  4X62 Q;  4DUY Q;  4DUY L;  2UXD Q;  4A75 A;  2UXD L;  2R7F A;  1VQD A;  3K80 C;  5IP7 G;  1X3G A;  3KJP A;  2WFW A;  4Y52 H;  4GLX A;  2YTV A;  2ATW A;  2AMC B;  2K5H A;  4P72 A;  3ULP A;  4BY7 H;  1Q12 A;  1WCM G;  2Z6K C;  4BBR G;  5LMU Q;  5LMU L;  4GKJ L;  4HIM A;  4L5Q A;  1L1O C;  3PUV A;  4DV7 Q;  4DV7 L;  1ASZ A;  4WJ4 A;  1QVC A;  3U58 A;  3H3V I;  2VY3 A;  5IYC G;  1BKB A;  1JE5 A;  1VQM A;  1IBL Q;  1IBL L;  3I4N G;  1P8L A;  2JA8 G;  1LYL A;  1IZ6 A;  4R4C A;  4JI2 L;  3L2P A;  2B63 G;  3CC7 A;  1Z9F A;  2MO1 A;  1VQF A;  1EQR A;  3GD7 A;  1SE8 A;  4DR1 L;  1VQ6 A;  1CSQ A;  3F8T A;  1Z47 A;  2KHI A;  3PUZ A;  4YWK A;  1YJN A;  1PH3 A;  1HNX Q;  4AYB G;  1PHJ A;  4BA2 I;  1N33 Q;  1N33 L;  4A93 G;  4DUZ Q;  3CCJ A;  4DUZ L;  1KXL A;  4A3G G;  3T1H Q;  2H5X A;  3T1H L;  3I56 A;  5M3F H;  5J3B A;  4C3H H;  5IP9 G;  2AKW B;  4HIO A;  3GTM H;  3PO2 H;  4IFD G;  1WJJ A;  4AH6 A;  3S2D H;  5C0X I;  1UE7 A;  3PIO A;  1SRO A;  2YYZ A;  2ALY B;  3PF5 A;  3KF6 A;  4WJ3 M;  4IPD A;  4DR5 Q;  4DR5 L;  5IY0 A;  4LF7 Q;  4LF7 L;  2JEB I;  3UDI A;  3RN5 A;  1FVI A;  4HIK A;  2Y0S G;  2IHE A;  4HJ9 A;  2E2I H;  1VCI A;  4A3L H;  1I3Q H;  3HFZ B;  2EXD A;  3KLW A;  4IJL A;  2JJQ A;  3J80 c;  2Q2T A;  4KHP Q;  4KHP L;  1OXV A;  3B6Y A;  3KJO A;  3RN2 A;  4DR3 Q;  1MIU A;  1V43 A;  3RLN A;  3RLO A;  4DR3 L;  1PH4 A;  1JJ2 A;  1G6P A;  1VQA A;  2I5L X;  3EBE A;  4UPA A;  1X6O A;  4ME3 A;  2R92 H;  1R9T H;  1HNW Q;  3AQQ A;  1BBU A;  3TQY A;  3CCS A;  4A3E H;  1XNR Q;  4LUV A;  2K4K A;  2PQA B;  1B8A A;  1RIP A;  4JBM A;  1XNR L;  4A3K G;  2CKZ B;  3M85 A;  2N49 A;  1AE3 A;  1X54 A;  1OXS C;  3E9H A;  3PSI A;  1Q81 C;  2YU9 H;  3PF4 A;  1L1O B;  3W1G A;  3IRB A;  5C3E G;  5FLX c;  3K81 C;  1GKH A;  5E7N A;  5FLM G;  4A3M G;  2KBN A;  4EQ5 A;  3A5U A;  4GNX A;  5IE8 A;  3HOV G;  1UEB A;  1HR0 W;  2K5N A;  3G4S A;  4DAM A;  4B3S L;  4A3F G;  2WB1 G;  3UE1 A;  4J15 A;  1U0L A;  1XPO A;  1OXT A;  2CQO A;  1X9N A;  4OXP A;  3CQZ H;  4PMW A;  1A8V A;  5GAH C;  1UE5 A;  5LMN L;  5LMN Q;  4HID A;  3HOW H;  3GDE A;  3HOU H;  2GVB A;  2DGY A;  3CPF A;  4DNI A;  3I4M G;  2UU9 Q;  1TWG H;  4DK6 C;  2UU9 L;  5HY6 A;  5C4X G;  3NEM A;  4YCW A;  1P16 A;  4JBK A;  4DR6 Q;  4DR6 L;  2NZO A;  1J5E Q;  2I5M X;  1E7Z A;  5IYD H;  4BBS G;  2VZA A;  4GOP A;  1VQE A;  4GN3 B;  1EWI A;  2OQ0 A;  1WOC A;  3KYH C;  4LNQ A;  2UXB Q;  3MEF A;  2UXB L;  1CKN B;  3S1R H;  5FJ8 H;  1HNX L;  3KDF B;  2UUB L;  3NEL A;  2UUB Q;  4JV5 Q;  3M3Y H;  2B3G A;  4LF4 Q;  4A4I A;  4LF4 L;  4OX9 L;  4OX9 Q;  3S1Q H;  1D7Q A;  1GVP A;  1KRS A;  4GKK Q;  1J6Q A;  4GKK L;  2CWP A;  1HZA A;  4QQB X;  3TS2 A;  2UXC Q;  2UXC L;  1C9O A;  3LGJ A;  1DGS A;  2UUC L;  2UUC Q;  1XMO L;  1VQI A;  1PV4 A;  3ULJ A;  1K9M C;  1IBM Q;  1JB7 A;  4A3D G;  3S17 H;  3UDX A;  5EAY A;  3RR5 A;  4JI4 L;  4JI4 Q;  2XGT A;  1TWF H;  1M1K C;  4LF8 L;  4LF8 Q;  4IFD I;  2V1C C;  3A5Z B;  5JJI A;  4YCU A;  1K8A C;  5DLQ E;  5M3M G;  4MZ9 A;  1Q86 C;  4UY8 C;  5IT9 c;  3UE0 A;  4JI7 Q;  4JI7 L;  2HIX A;  2R93 H;  2K5V A;  3Q8D A;  4XIG S;  2Q2I A;  3U50 C;  1PH9 A;  5BR8 Q;  5BR8 L;  1VQ5 A;  2MNA A;  1TXY A;  3WWV A;  3G71 A;  2F3I A;  1YHA A;  1Q1B A;  5HGQ A;  4BY1 H;  3J81 c;  1RL2 A;  4PG3 A;  1YJW A;  4A3B H;  3ERS X;  1QUQ A;  1KHI A;  2NN6 I;  2KHJ A;  1Q1E A;  2CCZ A;  4BY7 G;  4IPG A;  3HOX H;  1PH2 A;  3GTP H;  2N78 A;  1EYG A;  4DAY B;  4XTC S;  3HOY H;  3FKI H;  2KCT A;  3W1B A;  4YHH Q;  4YHH L;  1PYB A;  2RHQ B;  4Y7N H;  1WFQ A;  3F1Z A;  2GVA A;  3GO5 A;  4JI1 Q;  1ASY A;  3RZD H;  4GS3 A;  4X64 Q;  1Q8K A;  4X64 L;  3NEN A;  4X66 Q;  3CCM A;  2OTL A;  1NMG A;  1YZ6 A;  4NXM Q;  4NXM L;  2JA7 H;  1PVO A;  2N8N A;  1WI5 A;  1L2F A;  4IJH A;  4R4O A;  5IYB G;  2R7Z H;  5M5X H;  1TWC H;  1VQG A;  2ZTE A;  4C2M H;  4LWC A;  5JEA J;  4KLK A;  3J80 i;  4A3J H;  3PCO B;  4JYA L;  3CF5 A;  3PO2 G;  4JYA Q;  2ZTD A;  3I7F A;  3L7Z C;  3S1M H;  4OWT B;  2HIV A;  3U4Z A;  1VQ7 A;  1QZG A;  1K8G A;  3HKZ E;  1UWV A;  1WCM H;  3T1Y L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...