3STBC

A complex of two editosome proteins and two nanobodies
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
111
structure length
111
Chain Sequence
AAHWRCVNHCVMLGVVQNIQEGFVFEDKVLQFTLITDFEGPSPGDPDKDFHTVRVFDSDYSSRVKEQLRDGEWFLVTGRLRMVPQYDGSMRKYYHYPVIQVHPGCGSVLKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein/immune system
molecule keywords single domain antibody VHH
publication title Crystal structure of a heterodimer of editosome interaction proteins in complex with two copies of a cross-reacting nanobody.
pubmed doi rcsb
source organism Lama glama
total genus 17
structure length 111
sequence length 111
ec nomenclature
pdb deposition date 2011-07-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3stbC00
1IBMQ 4K0KQ 1IYJB 1VQIA 4DV4L 3L0OA 2RCNA 1GD7A 4LFCL 3NENA 4X66Q 4DV3Q 3M85A 5C0XG 1ASYA 4LF6L 1WCMH 3CCLA 4LF7Q 1PYBA 3J80c 3CPWA 3KJOA 1HH2P 3HKZE 4OXPA 1FJGL 2KCMA 3GTKH 1RL2A 2B63G 4PZ7A 5IWAL 5K36G 4DR4Q 3KJPA 1L1OC 4NPSA 4C3HH 4DKAC 3PF4A 1BVSA 1X6OA 2VL6A 2ZJRA 4A3MG 3CPFA 1MJCA 3AFQA 4JI3L 3U4VA 3VDYA 3K7UC 4DV6Q 4HIKA 2YTVA 4JI2L 3HOVG 1Q82C 4L5SA 3PO2H 2UXCQ 1UE1A 3TEHB 5C44H 1ASZA 1R9TH 3HOZG 1D8LA 4JBWA 1PH3A 1AE3A 4PG3A 5BR8Q 4IJHA 1U0LA 4LF5Q 1HNXL 1VS0A 4LF9Q 4BY7G 3OYYA 1HR0W 3K0XA 3FP9A 1HNWQ 3GTJH 1X56A 2H5XA 4A3IG 4HJAA 1GO3E 2K5HA 3S17H 1XPUA 5IY0A 1XTDA 1XPRA 2B63H 3EIVA 3AEVA 3HOYH 1YHBA 3E0EA 2LXKA 3H0GG 3KYHC 2QGQA 2Y0SE 5J3BA 3CCJA 3W1BA 3TRZA 5IT9c 4BXXG 1CUKA 1V1QA 2B29A 4X62L 1YVCA 2DGYA 1GM5A 1N8RC 1HNZQ 3RN2A 3OTOQ 4HIOA 3HOUH 3KFUA 2VQFQ 2JJQA 1YI2A 1DGSA 1X65A 4GNXA 3HKSA 1TWAH 4KHPQ 1OXXK 2MNAA 5LMUL 1UE7A 3KOJA 2K5NA 4BY7H 1W2BA 2JA8H 1WJJA 4GN4B 3PF5A 2ID0A 1VQAA 3E9HA 3PUWA 2LSSA 3SGIA 3S2HH 2JEBI 4ME3A 1Q81C 3J7ZC 4H02A 3L2PA 4UPAA 1S72A 4C2MH 3AYHB 3H0GH 5IP7G 4DPGA 3PIOA 1VQNA 1GKHA 2K50A 2UU9L 4A93H 2YYZA 4QJFA 1T9HA 1KXLA 4DR6Q 1NBWA 4OWXB 5FLMH 5IP9H 4IOAA 1YBYA 1KRTA 4Y52H 5C4XH 3RLOA 4GOPB 1YJWA 4A3BH 1V43A 1HZCA 1LYLA 2JK8A 2R7DA 4DV7L 2NN6I 2VS1A 5C4JH 1WFQA 2R6GA 4DUYL 3HKZG 4DAMA 4JI0Q 1C0AA 5JJKA 4DV1L 1I5FA 1UWVA 4HJ8A 3GDEA 4OWTB 2K5VA 1U5KA 3F1ZA 4A3GH 2UXBL 1UE6A 1NY4A 2E5LL 2YV5A 3W1GA 4DR5L 4HIDA 1XNRL 4IPDA 1LTLA 4DR7L 5IP7H 4GLAC 4NXNL 5LMNQ 3D31A 2OWOA 1UEBA 4X64L 3HOXH 4DV0L 2UXDQ 1OXUA 2K75A 1Q1BA 4J15A 2WAQE 3CW2C 1IXRA 5ELNA 4A4IA 4DV3L 1PYSB 4DV5Q 3FKIG 3J80i 4JV5Q 1SR3A 1P8LA 1EQRA 1HR0L 3AQQA 3PO3G 4R4CA 2BH2A 3G6EA 4LFBL 2PI2A 1SN8A 1VCIA 3CCEA 4DR4L 3CC2A 4P74A 1VQPA 3GTPH 4A3EG 1OTCA 2CKZB 2UUAQ 4YCWA 4POFA 3DM3A 4OONA 1EIFA 4DK3C 5JJLA 2R7FA 2QEXA 5GAHC 4DV6L 1K0RA 5H1SE 4YCVA 4X65Q 1EUJA 5LMNW 3CMAA 2GVBA 1X55A 4EQ5A 4DR2L 4JBJA 2UUBQ 2ZM6L 2Z0SA 3UDIA 2K4KA 2PMZE 2R7ZH 1VQFA 1J5EL 2OTJA 3U4ZA 3F2DA 1XNQL 1X3EA 2D0OA 4LF5L 3UE0A 2XTIA 3CCUA 2KCTA 1C9OA 5M5YH 4JI4L 4LW1A 3RN5A 2MO1A 1VQKA 3K7AH 2HQLA 3MEFA 4APVA 1KC8C 4A3CG 3NBHB 1PH6A 1QVFA 4DR1Q 4A3EH 1PH8A 4DV2L 3TQYA 1X3FA 5M5WH 4HJ7A 4BY1G 4JCVE 3HOYG 3I56A 4YWKA 3OTOL 2UUCQ 1YHQA 4B3TL 2K52A 1EOVA 3CXCA 2JA7H 2D62A 1N34Q 3I4NG 4MTNA 2R93H 1O7IA 1K8GA 2Z6KC 4O2DA 3J81c 2CCZA 1EYGA 4JYAQ 3HOUG 4OO1I 2F4VQ 4C3JH 2EIFA 1QVCA 4A3LG 1Q46A 4MZ9A 3TS2A 3CMEA 2VW9A 4R4OA 4TQUS 4R4TA 3B6YA 5M5XH 4A3CH 1HZBA 3T1HQ 1K83H 1XMOQ 4JI5Q 2NN6G 3DLLA 4GNXB 2JA8G 1CKNA 3NELA 1FGUA 4AYBG 4IPGA 3HFZB 4XIGS 1N33Q 4BY1H 1NTGA 1XMQL 1D7QA 1E3PA 2CFMA 4JI1L 3BJUA 3FHWA 4YCUA 1Q86C 1IL2A 5FJ8G 5GROA 4LF8Q 4YHHQ 3S16H 3K80C 4A93G 3ICEA 1VQ9A 3KDFB 5FLMG 1QZHA 3ULLA 5IP9G 4ALPA 1VQLA 4JI7Q 4JI0L 4JBKA 4JI8Q 3U58A 5C4XG 1I50H 1Q8KA 4A3BG 3PSIA 2ASBA 4LF4L 3D0FA 4B3SQ 2CWAA 3TS0A 4A3LH 2CQOA 4P73A 1IBLQ 2NVXH 2NVQH 2E2JH 2HHHL 3H15A 4GS3A 1N36L 2IHEA 4UP8A 4DR5Q 5LMNL 4DV4Q 2WFWA 4LFCQ 2IX1A 4HJ5A 3RNUA 1L1OA 3KDFA 2NVYH 1UE5A 2VQEL 4OX9L 1IBKL 1B8AA 4LF6Q 4DAYB 1H95A 1MIUA 4JI6L 1K9MC 3BU2A 3I4NH 2HIXA 3F8TA 4GOPC 5FJ8H 3AFPA 5GAEC 1NMGA 1I3QH 3K8AA 4JV5L 1L2FA 1HJPA 3T1YL 5IWAQ 2ZJQA 3CAMA 3STBD 4DNIA 3HOXG 3S1NH 1OXVA 5IE8A 1V9PA 3CCQA 1PH5A 4LFAL 1AH9A 4JI3Q 1BBWA 2WB1E 1VQOA 4B3RL 4NXML 1N32Q 4R4QA 1X9NA 4GLXA 3S1RH 4LUZA 5AJ3Q 3RZOH 2N78A 3CD6A 1SLJA 4JI2Q 1VQ5A 2NVTH 3HOWH 3J81j 1VQHA 1J6QA 4YWMA 2UUBL 4JBMA 1Z47A 3RZDH 1G6PA 5M3MH 4YY3L 1K73C 1HNXQ 2JE6I 3GTLH 2VZAA 1KIXA 1PH1A 4DUZQ 3CP0A 2N8NA 1SROA 1JMCA 2N3SA 5JJIA 3PUXA 1PH2A 1FVIA 1E22A 1S40A 5HY6A 1A62A 3F2BA 4L5QA 4P71A 1IBML 2E2IH 2R7ZG 4K0KL 1JT8A 4IOCA 4X66L 2JEAI 3CCRA 3M4PA 3CCMA 1E24A 1BBUA 4LF7L 4P75A 4FDBA 4YWLA 1EQQA 1M1KC 2I5MX 4OO1G 1CSPA 1YJ9A 4R4IA 1I6HH 4NB3A 2UUCL 1VQMA 2Y0SG 3S14H 2I5HA 4QY7A 1Y1WG 4B3MQ 3J81i 1QUQA 4AQYQ 1N34L 1KD1C 1I94Q 1VQ8A 1MKHA 4GN3B 3UDFA 4C3IH 4OWWB 1WYDA 3A0JA 2VUMG 2F4VL 1A8VA 2C35B 2XGTA 3I55A 1QZGA 2RHQB 4IJLA 2UXCL 1SRUA 4Y7NH 2UU9Q 1NE3A 2L15A 4L5RC 2JA7G 1YEZA 2R93G 4POGA 2HT1A 1TWFH 4KI0A 5BR8L 4BA1I 1WOCA 2ATWA 5ELOA 4LF9L 1VQ6A 2AMCB 2KBNA 2F3IA 1XPOA 1G291 1KRSA 3PV0A 2AWNA 2I0QA 4GKJQ 1HNWL 3W5OA 3F2CA 4KLKA 1SE8A 3ULJA 2Q2IA 5GAGC 3J7A5 4DV7Q 4L5TA 5GADC 2AKWB 2VY3A 5JEAG 4A3FH 4DV1Q 5FLXc 4A3DH 2K14A 1CKOA 3MXNB 3TREA 1Y1WH 4WJ3M 3ZJYC 5C3EG 2YTYA 4XTCS 5IYCG 4IFDJ 4GKKQ 2E5LQ 1S3OA 3JAMc 1HNZL 1YIJA 2VUMH 2VQFL 4IPHA 3K81C 1JJCB 1VQCA 3EN2A 5JEAJ 2QA4A 1CKNB 1RIPA 4DR7Q 1KQSA 4PZ8A 4KHPL 4X64Q 2ZTEA 3CC4A 2BA0A 4DR3Q 2BA1A 4BA2I 1CKMA 5IYDH 4GLVB 3S2DH 2ES2A 1X54A 1EFWA 4GNXC 3GTGH 4JOIA 1B70B 1YJNA 3NEMA 1HR0Q 2OCEA 3KLWA 3A5ZB 3UE1A 2ZJPA 4LFBQ 4BBRH 4HIMA 3STBC 3KF8B 3ULPA 3G48A 1Y1VH 4JG2A 2JA5H 4RMFA 5C3EH 4DR6L 5C0XJ 1JJ2A 1TXYA 4AIMA 5IYCH 5GQOA 1Z9FA 1CSQA 3WWVA 2WAQG 4AH6A 3UDGA 1N32L 2B3GA 4QIWE 1L1OB 3PUYA 5AJ3L 1YHAA 4DR2Q 2ZM6Q 1YZ6A 4QGUA 3S1MH 2VNUD 1E7ZA 2JA6H 4R1JA 1J5EQ 4IFDI 3OW2A 1A0IA 4TVAB 3RLFA 3UDXA 1XNQQ 4LUVA 1PA6A 1PFSA 1IZ6A 4DUZL 4JI4Q 1E1TA 1YITA 3HOWG 1W3SA 1P16A 2JQOA 4QQBX 1A63A 2I5LX 2YTXA 5M3MG 2UXDL 2Q2HA 3ER0A 4DV2Q 4A3MH 2RF4A 2LXJA 2Q2UA 2PNHA 3CQZH 1YNXA 2Z6KA 4EX5A 1KL9A 1FJGQ 3M9BA 2NZHA 4DV5L 2IHFA 3G4SA 2E2HH 1K8AC 3CCSA 1NMFA 5DLQE 4QL5A 1EIYB 3JC66 4B3TQ 1KHIA 2FXQA 3HOVH 2F52A 3PCOB 5C0XI 2DUDA 5IYBG 1VQ4A 2GN5A 3M3YH 2NZOA 2ALYB 1M90C 3HOZH 2PQAB 4A76A 1PH7A 4MNOA 4UP7A 1E1OA 2UUAL 1Y14B 4B3ML 1VQ7A 1I94L 4AQYL 4A3IH 3GTQH 1JJGA 1PHJA 3BZKA 4X65L 2MO0A 3H3VH 1L0WA 3I4OA 1QVGA 4X6AH 1TWCH 3GTOH 3GD7A 3PUVA 4RG1A 2IX0A 1G51A 3Q8DA 3I4MG 4BXXH 2V1CC 2A1AA 1KAWA 4IO9A 2BH8A 1PH4A 1PH9A 2EXDA 1SFOH 2N49A 1XMQQ 2PQAA 2KENA 1X3GA 2MFIA 4BBSG 1N9WA 5E7NA 4JI1Q 3U50C 4GKJL 3ERSX 1QUQB 2KHIA 2E8GA 5IYBH 2MQHA 4GN5A 4X62Q 1NJIC 1AE2A 3S24A 2ZTDA 4DR1L 1Q7YC 4UP9A 1MJEA 3H3VI 4LF4Q 4A75A 3JAMi 3L7ZC 1FL0A 3I2ZA 4GKKL 5LMUQ 1GVPA 4PZ6A 1VQGA 2HIVA 3PUZA 2HHHQ 4GOPA 4A3FG 1N36Q 5M3FG 4A3GG 4A3DG 3GO5A 1PVOA 2GVAA 3RLNA 3I4MH 1BKBA 4A3KG 4AYBE 3EBEA 4IPCA 3I7FA 4O0AA 2VQEQ 4DR3L 1HZAA 1IBKQ 4DK6C 4OX9Q 5HGQA 4A3JG 4UY8C 3M7NA 3S1QH 3GTMH 4JI6Q 4LNQA 4BBSH 2EQSA 2JA9A 4LWCA 2PI2E 3S15H 1LUZA 3IRBA 3T1YQ 2R92G 2AHOB 3CF5A 1TWGH 3RR5A 3T1HL 4JI5L 1XMOL 2A8VA 4WJ4A 4LUOA 2CWPA 5IYDG 3A5UA 2YU9H 1Q1EA 4LFAQ 3PIPA 1WI5A 5EAYA 3M4OH 1SMXA 2OQKA 4JC0A 1HZ9A 1OXSC 4P72A 4B3RQ 1LM0A 3KF6B 4NXMQ 4JOIC 1N33L 2IY5B 3PGZA 1Q12A 2Q2TA 1VQDA 1XJVA 4IFDG 2IT1A 3A74A 1WCMG 4DUYQ 1JB7A 1PV4A 4BBRG 4PMWA 1C7YA 4YHHL 5M3FH 4LF8L 3CCVA 4KHZA 1Y1VG 2JA5G 3CC7A 1VQEA 3LGJA 2KHJA 4A3KH 2A19A 2D0PA 2AWOA 3BZCA 4JI7L 4HJ9A 4YY3Q 1EWIA 2UXBQ 4JI8L 4JYAL 1VQJA 2WB1G 2OQ0A 4A3JH 1XNRQ 2WP8J 2RHSB 4B3SL 1VQBA 1B7YB 4NXNQ 1IBLL 1K3RA 3KF6A 2OTLA 1JE5A 1TWHH 3FKIH 3G71A 2R92H 2ZTCA 3E9IA 4DV0Q 3PO2G 3PO3H 3M4QA 2JA6G 1OXTA 5C44G
chains in the Genus database with same CATH superfamily
2OT2A 1IBMQ 1IYJB 4DV4L 1GD7A 4X66Q 1G2SA 3M85A 2BCOA 4LF6L 2LY7A 2Y0SB 2FINB 4A3GB 3H6MA 4A3DB 1Y1WB 3KJOA 3HKZE 1FJGL 1QNKA 4CDEC 5IWAL 4DR4Q 1SNMA 1BVSA 2DY7A 2VUMB 4DV6Q 3DM1A 5CR3A 3GQBA 1DONA 1EWCA 3TEHB 1VMCA 3KBGA 1D8LA 4PG3A 4IJHA 4KV6A 1F2ZA 1STNA 1MD2D 1VS0A 1JWMD 3OYYA 3K0XA 3FP9A 1HNWQ 1MSHA 4A3IG 4HJAA 2NZ1D 1ZYRD 1XTDA 3EIVA 5K36H 1BF4A 5J3BA 3CCJA 1V1QA 4X62L 2B29A 1GM5A 2DGYA 1HNZQ 4HMJA 4HIOA 2XVSA 2VQFQ 1U4LA 1YI2A 1X65A 4GNXA 1WTXA 3PMFA 1VDZA 3QO2A 2I46A 5KRUA 1BCPB 1IL8A 3KOJA 4FNFA 2Z1CA 1JICA 3KBXA 2JA8H 1WJJA 2XN9C 1VQAA 2OF1A 1S5DD 3S2HH 1ICWA 2H4OA 4I65A 4H02A 2EXZA 3L2PA 1LTBD 1SMYC 3AYHB 3H0GH 3TMEA 4DPGA 1VQNA 2K50A 1PXUA 3Q22A 4DR6Q 1DYQA 4OWXB 3BZDB 5C5MA 4Y52H 4HSVA 4IALA 3D4WA 1MBYA 4A3BH 1VF7A 4KMUC 2R7DA 3HOZB 4HN7A 2ZXRA 1I5FA 1K8OA 3GTQB 3MA2B 4C56C 1U5KA 1A2TA 5M3MB 2A73B 4QB4A 3SHLA 3H09A 1XNRL 2G9DA 4NXNL 2XWBB 5LMNQ 1DOMA 4ZQ3A 1SFOB 4X64L 2O5JC 1OXUA 4XYOA 1SJHD 3CHBD 5CORA 2E2IB 1IXRA 1PFNA 1RJTA 5C4ZA 4DV5Q 3AQQA 1PRTC 3OSOA 3BYYB 2IJ0A 1VCIA 3P1HA 4DR4L 3CC2A 2MUYA 1IYVA 2DNEA 4YCWA 4OONA 5E3FA 5GAHC 4DV6L 1K0RA 1EUJA 2MGSA 3CMAA 2GVBA 1X55A 3QR8A 3PIP3 3GTMB 3L9AX 4ABNA 2F0MA 2R7ZH 1VQFA 2OTJA 3U4ZA 1XNQL 1SE3A 1TWGB 5I9OA 4JI4L 1VQKA 3J80E 1JWSD 2Z6BA 3MEFA 4APVA 1QVFA 4A3EH 1STHA 4QIWB 4CHTB 4JCVE 4A3KB 3HOYG 1B1ZA 2UUCQ 1YHQA 3G7LA 3C3LA 2F0UA 3CXCA 3A54A 2JA7H 2D62A 3R2TA 2Z6KC 1TWHB 1EYGA 1ENCA 2NB0A 2F4VQ 4MZ9A 4NKLA 3TS2A 4JK1C 5G3LF 4R4OA 4TQUS 5M5XH 5C3WA 3T1HQ 4CKBA 2NN6G 4GNXB 2G5DA 1JR0D 1GXDC 4AYBG 3HFZB 3DXJC 4XIGS 5FK9C 1NTGA 2A6HD 1XMQL 3DWQA 2JA5B 1D7QA 3URYA 1E3PA 2KA7A 1IL2A 3FHWA 2WB1B 3S16H 3K80C 4ILWA 3ULLA 5IP9G 3DMUA 3U58A 1BCPC 3C1EA 4N8X1 4LF4L 3D0FA 4TSSA 4B3SQ 4A3LH 1IBLQ 2NVXH 1EU4A 1LTID 2E2JH 1GUSA 3H15A 3NXWA 4GZYC 2IHEA 3L3OC 5LMNL 4LFCQ 2IX1A 2K05A 4X3KA 1H95A 4YIJA 3I4NH 3BU2A 1CI3M 3AFPA 5IGEA 1I3QH 2X6LA 3QOJA 1HJPA 4ZUJA 2ZJQA 1D1KA 2JXMB 3TDQA 4DNIA 4CDFC 3CCQA 1BBWA 2DNCA 2J0TD 1VQOA 5CV5A 2JYOA 5CBEE 1X9NA 2VB2X 3H3VC 2AQ1B 2H1EA 2GA4B 1J6QA 1Z47A 3RZDH 1JORA 3ZYYX 2G9HD 3H0GB 3IL8A 2N8NA 3WOEA 5JJIA 2F0EA 3PUXA 1FVIA 4ZKCB 1A62A 4A3BB 3GP7A 4P71A 1JT8A 1HRJA 4OHJA 2K01A 3SK8A 3CCMA 1M1KC 1KDCA 3HZXA 2I5MX 1F2LA 1YJ9A 2EYFA 2UUCL 3I3CA 3FPUB 1SAPA 3MTSA 5T1GA 1EQTA 3J81i 1PFMA 5DM63 2KQ3A 2F4VL 1BXTA 2C35B 2RHQB 4K2LA 1SRUA 2K5WA 1NE3A 2L15A 3QB3A 3K6OA 1STEA 4C3JG 1G291 1KRSA 4IUQA 1ZYRC 4BS9A 3J7A5 2Q2IA 2F0DA 2B2UC 4OO1H 1NSNS 5GADC 2AKWB 2VY3A 4A3FH 5FLXc 2K14A 1CKOA 2ZT9C 4XTCS 5EPJA 4QUFA 1Q3LA 2LMCB 4IFDJ 2E5LQ 4J8QA 4IPHA 5JEAJ 1VQCA 2QA4A 1FNWA 1WTOA 1KQSA 5HGTA 1I4HA 3CU7A 3MFYA 2BA0A 3K59A 4BA2I 2OEOA 1QNUA 1X54A 4GNXC 3GTGH 1B70B 5E4XA 2PZWA 1V1OA 4A3EB 3MEHA 4LJZC 3G48A 1CA5A 5C3EH 4PMBA 1Z9FA 2F0NA 1CSQA 4AH6A 3TZDA 1WVLA 2EJGC 2XNAC 4QIWE 4M1UB 1IYUA 1YHAA 2VNUD 1E7ZA 3X3NA 1LTTD 2IPKD 2KEEA 5CC4A 1NR2A 1J5EQ 4R9WA 3RLFA 3UDXA 1CT1D 2RQXA 5M5XB 1A15A 1PFSA 1UNSA 4U68A 1YITA 1P16A 3HS0C 4DXFA 1BR9A 1Y69U 3S16B 1KL9A 3M9BA 1ET9A 3G4SA 1B4OA 1K8AC 4B3TQ 2FXQA 1MGSA 1EY7A 3HOUB 1K3BC 3TP8A 5C0XI 1XYIA 2DUDA 2NZOA 2ALYB 4K2KA 4MNOA 1E1OA 3QOLA 2E2JB 3PIO3 4NDXA 4A3IH 3BZKA 4X65L 2NTTA 1SDFA 1QVGA 2F0IA 5IGDA 3I4NB 5CV4A 1I3QB 1KAWA 4KTAA 2EXDA 2PQAA 2KENA 1X3GA 1JOOA 3LWEA 3Q23A 4DA2A 4DR1L 1SXTA 2M00A 3W3AA 2RDFA 4G57A 3RZDB 3BVMA 1GVPA 3G6JB 4DAPA 1VQGA 5CGKA 4DAVA 4GOPA 3OIQA 1KNEA 2GVAA 3RLNA 3VA7A 4TRDA 3C46A 3I4MH 3NTIA 4OX9Q 1BOSA 4UY8C 3S1QH 4JYAL 2RCFA 2KHSA 3HOXB 4BBSH 4JI6Q 4L63B 1WTWA 4LWCA 3RUZA 5CMDA 2VB3X 4J1MA 3T1YQ 2R92G 1PYWD 2B8FA 2CWPA 1B53A 4B3RQ 1A3VA 1ZKOA 4JOIC 3CRLC 1Q12A 2EJMA 1Z6HA 1VQDA 1XJVA 3I70A 4DUYQ 4BBRG 5M3FH 3FRPB 1EOTA 4IN3A 1EWIA 1CM9A 3I72A 1B7YB 1S5BD 4H44C 3G71A 2EVBA 2ZTCA 3E9IA 1ESFA 4F88A 1VQIA 4CJ1B 1ASYA 1K28A 3SR1A 4A3FB 3CCLA 3FVQA 1DCZA 4KN4C 2PQEA 1RL2A 2B63G 4OEMB 1PRTD 3NQIA 4PZ7A 3KJPA 4MTKA 2VL6A 2NYZD 3FEWX 3CPFA 2ZJRA 4A3MG 1MJCA 1PTOH 1O80A 2R93B 2YTVA 3NBHA 2WINB 1XWEA 4JI2L 5EBCA 3AU7A 3HOVG 2UXCQ 5C44H 3GTGB 1R9TH 5BR8Q 1U0LA 4LF5Q 4BY7G 2RBMA 5E1FA 3S17H 4ZRZA 1XPUA 5C3EB 1NNXA 3N6RA 1XPRA 3HOYH 2QGQA 5IT9c 1RF2D 1CUKA 3D3RA 1CA6A 1YVCA 3RN2A 3KFUA 1S5FD 2JJQA 4PV1C 2X6GA 1F9QA 1TWAH 2AUJD 4K6DA 4KHPQ 1EZ8A 1M4VA 2NN6H 2RDHA 1EY9A 2ID0A 4RHSA 4LK1C 2LSSA 3SGIA 4ME3A 3J7ZC 3A7LA 1X3QA 4UPAA 1S72A 4C2MH 1GHJA 5IP7G 1Y8NB 1ENFA 3PIOA 2UU9L 1T9HA 1EWHA 1A3TA 1WTRA 5IP9H 4IOAA 1YBYA 5LL6X 4GOPB 2BDNA 2L1BA 1PZJD 5G3LD 4O1NA 3I73A 1RD9D 1JE4A 1IW7C 4DUYL 3HKZG 4DAMA 4DAYA 1EY5A 4CJ0B 3TP7A 1UWVA 1EYDA 1PZKD 2F0JA 1NY4A 3SK4A 4XQNA 2HDLA 3D31A 2B2WC 5EPKA 4WJWA 2WAQE 2B8GA 4OL7A 3FKIG 1SR3A 1HR0L 2FHTA 3PO3G 2F0FA 4R4CA 3I4LA 3J80L 3G6EA 1TS4A 2PI2A 1SN8A 5IGGA 1A3UA 5ELDA 3S9WA 1YNJC 1PDQA 4OIJA 3MXUA 2CKZB 5J39A 3V05A 4DK3C 4F7XA 2R7FA 3I4MB 5LMNW 4JBJA 1Q8IA 2ZM6L 4C3HG 3S1QB 1YNND 2Z0SA 1TIID 4BBSB 4ZAIA 1K8MA 5IGBA 4Y7NB 4LF5L 2ZXOA 3NHHA 3CCUA 3EQLC 1U4MA 3K7AH 2HQLA 2SOBA 1KC8C 4A3CG 3NBHB 1BQQT 2K1BA 3NBIA 1RHPA 5M3FB 2F4IA 5M5WH 1EY8A 4KHVA 2R3ZA 4BY1G 3RD4A 2KJXA 2BOSA 5CYUA 5KIXA 5EGTA 2ENBA 4ZKBB 5I2YA 1O7IA 1K8GA 4O2DA 1II3A 2CCZA 4FP5D 4OO1I 4C3JH 5C4HA 3S2DB 1Q46A 3CMEA 2B2UA 2TSSA 4KK7A 4R4TA 4O42A 4JI5Q 5ELCA 1SNPA 2WV6D 1FGUA 4QUCA 4IPGA 1Y1VB 2L11A 3E5SA 2CFMA 4JI1L 1Q86C 2Z8LA 4IURA 1CHPD 5GROA 5FJ8G 4YHHQ 4LF8Q 2I07B 2KUMA 2VXWA 3OW7A 4JI7Q 4JBKA 4JI8Q 5C4XG 1I50H 1Q8KA 4G4KA 2CWAA 3OWFA 4KKTA 2JA6B 5C44B 2CQOA 1R9TB 5COYA 3K5MA 1S5CD 1AW7A 2NVQH 2HHHL 2B2TA 4GS3A 1O78A 1N36L 4DR5Q 3S17B 2WFWA 4HJ5A 1KLGD 2NVYH 1UE5A 3HOYB 1IBKL 1TS5A 4DAYB 4ULLA 4GOPC 4MN3A 3K8AA 3CQZB 1L2FA 3VA5A 1V9PA 1PH5A 1LTAD 4LFAL 2EY6A 4JI3Q 1TWAB 1BNZA 2M2LA 4H13C 4ZCKA 4R4QA 4NXML 3M3YB 4GLXA 3S1RH 2EYLA 5FO7B 1SLJA 2O4XA 1LT6D 2NVTH 3J81j 3ONAB 4AYBB 2QILA 4JBMA 1HNXQ 4C2MB 2VZAA 2Z4IA 1SROA 2N3SA 5HURA 1C48A 4V190 1IBML 1FNUA 3VR3A 2P5ZX 4X66L 3CCRA 4K5WA 3OMCA 2L55A 1EQQA 5CV8A 5EKKA 5EKLA 4NB3A 1I6HH 1EL0A 1FGBD 2Y0SG 3S14H 4XYQA 1RDPD 2SEBD 4G7ZC 3A55A 1Y1WG 2QW7A 1KAAA 1QUQA 3TP5A 5L37A 1KD1C 1I94Q 1MKHA 1FYCA 4GN3B 2IX3A 3UDFA 2L5TA 2F3VA 1GOZA 4C3IH 1WYDA 3A0JA 2VUMG 3E3XA 1A8VA 2XGTA 4KD4A 4RGOS 1D5ZC 3RMHA 4IJLA 3TBIB 4L5RC 4Q5VA 1SE4A 3S15B 4KI0A 3KK7A 1WOCA 5ELOA 2KBNA 1J9OA 1QCBD 2F0TA 4P2CB 1HNWL 1G2TA 4K5VA 3F2CA 1SE8A 4PQXA 4DV7Q 1SYBA 2CVRA 1ICFB 5JEAG 2J7ZA 4PMCA 4DV1Q 4WJ3M 1QWYA 3CKIB 3FPPA 5IT9L 3ZJYC 4CDCC 5IYCG 5I6YA 1S3OA 3JAMc 3J81E 1HNZL 1S4ZA 2VQFL 4DR7Q 1QG7A 2LS01 3CC4A 5DNFA 2MJ8A 2BA1A 3DEOA 2SNSA 4M8AA 2ES2A 3LNNA 4JOIA 1PTOF 1YJNA 4PNYA 3K5OA 3A5ZB 3UE1A 3D4DA 5DM73 4BBRH 4LFBQ 3STBC 3ULPA 2F0WA 4JG2A 5M5WB 4DR6L 1JJ2A 1TXYA 1D5XC 1R4PB 4AIMA 1KDAA 2D5DA 3UDGA 5IODA 1D1IA 1CQFA 2EOTA 3KLRA 2FFKB 4DR2Q 1E2ZA 4QF4A 3S1MH 1Z7TA 1EIHA 3P7JA 1KTKA 3IFTA 1OXTA 1X32A 4K5XA 4C3JB 4IFDI 1JWUD 4MHEA 4L8JA 4LUVA 5CV9A 3BS1A 3HOWG 4DK0A 4RKBA 2O2LD 4QMGA 2I5LX 3NWSA 5M3MG 2KCNA 4KY5A 2Q2HA 1DZ1A 4DV2Q 4A3MH 1MSGA 2RF4A 3MZ5A 4EX5A 5I4DA 4DV5L 2E2HH 2IHFA 1NMFA 5FOBB 4K14A 1KHIA 1I50B 2KEDA 3HOVH 4RCOA 4FF1A 3PCOB 5IYBG 5JPMC 4A76A 1PH7A 2NVQB 4H7BA 2QKIC 1I94L 1JJGA 2JA8B 1YNNC 2F0HA 1AN8A 3S2HB 1L0WA 2NVYB 4X6AH 3GTOH 3GD7A 3PUVA 4RG1A 2O5IC 2IX0A 1G51A 2V1CC 2A1AA 3H91A 2MFIA 1GUNA 1T5EA 4XT1B 1N9WA 2RKSA 3ERSX 4XT3B 4CJ2C 1QUQB 1C8CA 2MQHA 4GN5A 3S1RB 3S24A 1IHZA 4ID6A 1Q7YC 4WFN3 1MJEA 3H3VI 5I2XA 4ZLTF 3FMCA 1F2YA 5JPNC 2JN4A 1HHVA 5LMUQ 4PZ6A 4RH6A 2PMZB 4OGQC 4HR7B 4A3KG 1LV9A 4AYBE 4RWSC 2VQEQ 3OIPA 3T13A 3PQIA 1B3QA 1HTLD 1UAPA 2RSOA 2PI2E 2RVLA 3NPPA 2D2CC 2AHOB 3CF5A 1SSOA 3T1HL 1R4QB 2A8VA 4G7OC 4WJ4A 4LUOA 3HGBA 5IYDG 3M4OH 3PIPA 1HFNA 4JC0A 1HZ9A 2IY5B 4K6LA 5DAUA 4FO2A 2F0KA 3K58A 4N8FA 3PGZA 1I6HB 2QCPX 3T16A 1ILQA 4DNRB 3S14B 2IT1A 3A74A 1QE6A 1X3PA 3CCVA 1IW7D 4KHZA 2JA5G 1BDOA 4C3IB 1I4GA 2AWOA 1Y8OB 2WACA 5BN4A 4YY3Q 4HJ9A 3WOFA 2B2WA 2UXBQ 2WB1G 4A3JH 4B3SL 2RHSB 4NMZA 2EYMA 2R7ZB 2EY5A 1IBLL 2OTLA 3FKIH 1JE5A 2HUGA 2K33A 1ENAA 3PO3H 3M4QA 4K0KQ 4LFCL 2RCNA 4DV3Q 5C0XG 2WKCA 4IUTA 4X3TA 1WCMH 2B2TC 4LF7Q 1JOQA 3J80c 3CPWA 3GTKH 1LTRD 5K36G 4C3HH 1YNJD 2F0OA 3U4VA 3AFQA 4ME5A 3VR5A 1E2VA 2L4NA 5A2QL 2JA7B 3PO2H 3NWTA 2B2VA 3WDNA 2KCCA 3SK6A 3MXPA 3AMUA 1HA6A 2OXPA 5I6WA 4LF9Q 1HR0W 4BBRB 2H5XA 1GO3E 2EDGA 2K5HA 3EJIA 5IY0A 1G6ZA 3AEVA 3E0EA 3H0GG 3KYHC 3BG3A 2E2DC 3AB9A 1WD1A 2HD3A 4UDUC 1B44D 2WKDA 3S1MB 4R8NA 1DGSA 4N9PA 4FVMA 4HEDA 4UHVA 2K32A 5LMUL 1UE7A 2X69A 2NVXB 2K5NA 2EYJA 3KUPA 4HAEA 3PUWA 2JEBI 1ONLA 1Q81C 2IL8A 4A3MB 1QB5D 2WAQB 5ELEA 2CH4W 2K6AA 1KXLA 3SXHA 3EFXD 5C4XH 1YJWA 1W6KA 3UI2A 3TN2A 5C6AA 1WFQA 3I90A 3K0YA 3SVMA 3K5LA 4UAIA 5JJKA 4ZYSA 4HJ8A 1F77A 2UXBL 3JAML 2E5LL 1F9RA 2YV5A 3W1GA 4HIDA 3GTOB 1LTLA 4HTHA 4GLAC 2OWOA 1UEBA 1QILA 1SEBD 3HG9A 2UXDQ 2K75A 2ICIA 5KGUA 2B39A 3CW2C 4A4IA 4DV3L 4FXGC 5EJWA 1P8LA 1EQRA 2BH2A 1OO9B 2XWJB 2EY1A 2AUKA 4A3EG 2K04A 2UUAQ 4POFA 3DM3A 1EIFA 3VYSA 2SNMA 5EKIA 3T4AC 5H1SE 1LT5D 4YCVA 5C5LA 4EQ5A 2UUBQ 1AZQA 1ZXTA 2PMZE 2F0PA 3O13A 1J5EL 3F2DA 1X3EA 2EPBA 3I91A 2KCTA 1C9OA 1I4PA 5M5YH 3M4OB 3R2IA 3RN5A 1TU2B 4JVZA 2C5CA 3SDZA 1PH8A 2E75C 1D6EC 3TQYA 4BWGB 4EQNA 1JCKB 1EZ6A 1CTMA 3A56A 4N9TA 1O7LA 2A69D 1CQVA 1F2MA 4B3TL 4A3JB 1EOVA 1SBBB 1QOHA 2A68C 4MTNA 1N34Q 4B9WA 3FKIB 1Y8PB 5J22A 3GV3A 1WD0A 3HOUG 5TSSA 1ESRA 2HQEA 2SDFA 3A8KE 4A3LG 1UEAB 2VW9A 1WTVA 1HZBA 1XMOQ 5JEAH 3DLLA 2A74C 1WCMB 1CKNA 3NELA 2JP1A 1EYAA 1N33Q 1XTCD 3NE5B 1L0YB 4C3HB 3I4NG 3BJUA 3C2PA 1W6JA 4DFAA 4A93G 2ZXPA 3KDFB 5D65A 5FLMG 1QZHA 4ALPA 1VQLA 1CHQD 2HCCA 1MI2A 3PO2B 3TS0A 1L0XB 2EZVA 1AEXA 4UP8A 4RCNA 1EYCA 4DV4Q 4G7HC 1BBXC 1L1OA 4OX9L 1MHWC 1F9SA 4LF6Q 1MIUA 4JI6L 1K9MC 4Q0FA 2HIXA 1NMGA 4DNTB 2IW3A 5EBDA 3T1YL 5IWAQ 3CAMA 1SYDA 3STBD 3HOXG 3S1NH 1OXVA 1SYGA 1PTOD 5JJZA 3FDTA 4B3RL 4LAAA 5JOBA 2EYHA 3RZOH 2N78A 3CRKC 5IGFA 1VQ5A 3HOWH 2IWHA 1VQHA 4A3IB 3K5NA 1HQRD 1TS2A 2UUBL 1G6PA 5M3MH 4KKSA 2JE6I 1KIXA 1PH1A 4E6IA 4DUZQ 2Q8IB 5BN5A 1HXYD 1JMCA 1GUGA 1QJOA 1GJXA 2J4XA 3F2BA 4L5QA 2E2IH 4C1NK 4IOCA 2JEAI 1CZGA 4IUVA 1LT3D 1BBUA 4XDXA 4P75A 4FDBA 4OO1G 1HQMC 2PW5A 3M4YA 1VQMA 4FF4A 3VYTA 2I5HA 2D9UA 4B3MQ 2C9OA 3LX0A 3OHXC 4AQYQ 1N34L 1VQ8A 4OWWB 4FF2A 2KOLA 4RGMA 4CKCA 4HMIA 1WTQA 1LLRD 1TS3A 1STAA 1QZGA 2UXCL 4X3UA 1H9SA 2R93G 1SYCA 1TWFH 5BR8L 4BA1I 1GUTA 2AMCB 1XPOA 3DHQA 4K8IA 1BO0A 2DJGC 4KY7A 4KLKA 3ULJA 2F1MA 2B2VC 5JVG3 4WRDA 3TZUA 1EY4A 1ILPA 3R8BA 5C3EG 3VR2A 2YTYA 2PNRC 2A6ED 2L0CA 1JJCB 3EN2A 3K81C 1PVOA 1CKNB 2CW0C 4KHPL 1B50A 4X64Q 2ZTEA 2V4DA 3EA6A 4DR3Q 1CKMA 3N52A 5IYDH 4GLVB 5M5YB 4WORA 4QCLA 2OCEA 3KLWA 3EVQA 4ZK9B 2TMPA 3Q24A 2JA5H 2PW7A 1JC7A 3KLSX 2XRSD 4RFBA 3WWVA 3DWPA 4DF7A 2B3GA 1PTOB 5KEEA 4F87A 1L1OB 2QF7A 1YZ6A 4QGUA 4ODGA 5CBAE 3EROA 4XQJA 1KABA 1GHKA 1LABA 4R1JA 2RA4A 4TVAB 4J6HA 1XNQQ 5C0XH 3BDCA 1PA6A 1IZ6A 4DUZL 4JI4Q 2JQOA 1CZWA 4QQBX 1A63A 2M9VA 5KYIA 1T5XD 2KECA 4FXDA 3ER0A 2Q2UA 3VR6A 3U9OA 1EIYB 3CCSA 5DLQE 2NWGA 3JC66 1H9RA 2EE1A 1VQ4A 2GN5A 3A7AB 4MIUA 4K8JA 2K03A 1Y14B 4B3ML 3V2TA 4AQYL 2K7VA 1G91A 1PHJA 2MO0A 1TWCH 4KY6A 2EY2A 1SYFA 4S3SA 3I4MG 1A6XA 3OMGA 2BH8A 1SJED 4IO9A 1PH4A 1LTGD 1XMQQ 4BBSG 3S1NB 3BVZA 3NQTA 3U50C 2L12A 1KLUD 1NJIC 1B9NA 3F2UA 2ZTDA 3RZOB 4UP9A 2A69C 3HOWB 4LF4Q 3JAMi 1H9SB 3I2ZA 2HIVA 3PUZA 3MAQA 2RDGA 3VYRA 5M3FG 4A3GG 4A3DG 1BKBA 4JPBW 3EBEA 3I7FA 4DR3L 1LTSD 1HZAA 4DK6C 1FD7D 1PRTF 3M7NA 2F0VA 2FMCA 2EQSA 2JA9A 5AFWA 5IGCA 1SE2A 2HCIA 3IRBA 4JI5L 4NW2A 1PMRA 3A5UA 2YU9H 1Q1EA 5FLXE 1WI5A 1SMXA 1OXSC 4H0LC 3KF6B 2PPBC 4FF3A 2N55A 2Q2TA 1KNAA 5ISRA 4IFDG 4LMQD 4C1NI 1JB7A 3NTHA 4PMWA 1C7YA 4YHHL 4LF8L 2E74C 1Y1VG 5CV6A 3LGJA 4JI7L 5I9PA 1HPCA 2PYKA 4JI8L 1VQJA 5FO9B 2OQ0A 1TT2A 2R61A 2WP8J 2F0GA 3A8IE 1TWFB 2R92H 1RCVD 4DV0Q 1JOKA 4DR5L 2JA6G 3HP3A 3SE0A 5C44G 3L0OA 1PLFA 3K7AB 3NENA 4Z9CB 3DWAA 3ND9A 1SNOA 1IKLA 1PYBA 1HH2P 4OXPA 2KCMA 2N88A 5NUCA 1PTOC 3D6WA 1L1OC 4NPSA 4DKAC 2QDLA 3E6ZX 3PF4A 1X6OA 4KJNA 4JI3L 1XXGA 3VDYA 3K7UC 1SNCA 2RSNA 2NBFA 4HIKA 1G8ZD 5D3DA 1Q82C 1AZPA 4L5SA 5CV7A 1UE1A 1B2TA 1ASZA 4B9XA 3HOZG 4JBWA 1PH3A 1AE3A 1GUWA 3C1FA 1CFMA 4ZUIA 1HNXL 4EVOA 1X56A 3GTJH 2WIIB 3DUZA 2B63H 1BCPF 1YHBA 2LXKA 2Y0SE 1RKNA 1I6VC 3W1BA 3TRZA 1C4QA 4BXXG 4KKUA 1TY0A 1N8RC 4X3SA 3OTOQ 1WTPA 3HOUH 3HKSA 2BE5C 5D3IB 1I4XA 4IUUA 4EQPA 1OXXK 2MNAA 1M8AA 4R8IA 4EQOA 5FO8B 4BY7H 2A68D 1W2BA 4XXEA 4GN4B 3PF5A 3E9HA 1JQYD 3K57A 1DOKA 1KDBA 3T51B 1GKHA 2F0QA 4A93H 2YYZA 3E0JA 4QJFA 1CK1A 4U673 1NBWA 5FLMH 2L9HA 5J1ZA 1KRTA 3IAYA 3RLOA 1EY6A 1V43A 1AP0A 4DN4M 1EEFD 1HZCA 1LYLA 2JK8A 3TSSA 4DV7L 2NN6I 1U9RA 2BDOA 2VS1A 3MFGA 5C4JH 2R6GA 5LL6S 1C0AA 4JI0Q 3J7AF 2B2YA 5KYLA 2CHBD 4DV1L 3MWYW 2A6EC 3SEBA 2NVTB 2XRQD 4OIKA 1D5MC 3GDEA 4NP5A 4OWTB 2K5VA 3F1ZA 1Q90A 1VF5C 1UE6A 2F0LA 2HDMA 1TWCB 5KNBA 4IPDA 4OELB 4DR7L 3QG1A 5IP7H 4CDDC 4HCEA 3HOXH 4DV0L 3MHBA 1Q1BA 4J15A 5JAVA 1STBA 3P20A 2A5HA 5ELNA 1PYSB 3LWUA 4JV5Q 3J80i 3QIAA 3DEPA 2Z4HA 3IFDA 4LFBL 3Q6SA 1NUCA 1RTOA 2XSCA 4B08A 4RA8A 3NTKA 1DOLA 1BUVT 3CCEA 4P74A 1VQPA 3GTPH 3QJYA 1OTCA 1D2BA 1XX8A 4I7AA 3U9SA 5JJLA 1V1PA 2AQ2B 2QEXA 3VYUA 3MVVA 4X65Q 4DR2L 5BN3A 5IOCA 3UDIA 2MPMA 2K4KA 2DJFC 4EGVA 2D0OA 3UE0A 2XTIA 3I8ZA 1RTNA 2YU9B 4LW1A 2MO1A 1I4QA 5ELBA 1PH6A 4DR1Q 3W2DA 3D6CA 4RGTA 1HA5A 4DV2L 1X3FA 4HJ7A 3MXGA 2Q8RE 3I56A 1TQOA 4YWKA 3OTOL 2K52A 1GUOA 3Q0AA 5EQ0A 1HUNA 2R93H 2R92B 3J81c 4JYAQ 1S5ED 2EIFA 1QVCA 3MXNA 4I7ZC 2Q8TA 3B6YA 4A3CH 1K83H 4V0BA 3T56B 2JA8G 5IT9E 1EY0A 4BY1H 4YCUA 3MC0B 5M9OA 1I4RA 1VMPA 3ICEA 4RHRA 1V8QA 1VQ9A 2ICEC 4JI0L 1LO5D 5JVH3 4A3BG 3PSIA 2ASBA 3KF8A 4P73A 1B3AA 2DN8A 1F9PA 2CW0D 2EYOA 3GTJB 1DJRD 1RODA 2PZUA 3BYTB 3HEJA 3RNUA 2VQEL 3KDFA 2B63B 5LHY1 1B8AA 3KLSA 1TVXA 3F8TA 1SYEA 5FJ8H 5GAEC 3HRZC 5T1IA 4JV5L 2PCFB 2E2HB 3R93A 5IE8A 3VR4A 1HUMA 1AH9A 3HOVB 2WB1E 1N32Q 3QWNA 4LUZA 5AJ3Q 3CD6A 4JI2Q 4BY7B 1LT4D 5EPLA 4YWMA 2QDBA 3GV6A 2MHVA 5IIFA 1O7ZA 1NR4A 4YY3L 1K73C 4RGNA 3GTLH 1TR5A 3CP0A 4A93B 4C3IG 5A35A 1DM0B 1STGA 1PH2A 2PZTA 1E22A 1S40A 5HY6A 5D14A 1EQVA 1H9MA 1V1PB 5KNCA 2R7ZG 4K0KL 3M7GA 1PZID 5C4JB 3M4PA 3P75A 1E24A 4LF7L 4YWLA 4HSPA 3T53B 1FR3A 1CSPA 2KVMA 4R4IA 4IUPA 3ND8A 3V96A 3X3MA 1U4RA 4QY7A 2EYPA 4DK1A 1ML0D 1TKWB 3BVGA 4CBVA 3I55A 4Y7NH 2XIWA 2UU9Q 2JA7G 1SMYD 3NP8A 1YEZA 4POGA 1K0SA 2HT1A 2PO4A 2ATWA 2LKVA 5F2DA 1VQ6A 4LF9L 2F3IA 3NUCA 1A2UA 2A6HC 2LFNA 3HKZB 3PV0A 2I0QA 2AWNA 4GKJQ 3BDOA 3W5OA 3OPOA 5GAGC 3GTPB 4L5TA 5C3XA 1IKMA 4A3GH 4A3DH 3MXNB 3TREA 1Y1WH 2K5QA 2CQAA 5FKAC 4GKKQ 1YIJA 2VUMH 3R3OA 1TY2A 1RIPA 3OOCA 2QEJC 2K5DA 4PZ8A 4FXKC 4FYDA 1SNQA 3S2DH 3PO3B 2E76C 1EFWA 5DEHA 3NEMA 1SNDA 4DU9A 1HR0Q 4F8MA 4IFDH 2ZJPA 1UUPA 3D8GA 4TKOB 1DXMA 4HIMA 3KF8B 3OWEB 3H94A 1Y1VH 4RMFA 3TP6A 4KJOA 5C0XJ 3GTKB 5IYCH 5GQOA 3ITPA 5K5PA 2WAQG 2CH4A 1STYA 2DY8A 1J8IA 1N32L 2FMMA 1HFGA 3PUYA 5AJ3L 2ZM6Q 1PFBA 2JA6H 1EFID 3OW2A 1A0IA 3NSWA 3J7YW 5E4WC 1EU3A 1K83B 1AFPA 1E1TA 2B2YC 1W3SA 3IKJA 3D4RA 2K28A 5ELFA 3A8JE 4BY1B 2YTXA 3BDLA 1LACA 2UXDL 3ERQA 2Z9HA 2LXJA 2PNHA 3CQZH 1YNXA 2Z6KA 1FJGQ 2NZHA 5A2QE 1FNVA 4QL5A 1NAPA 2F52A 4RAUC 3M3YH 1B9MA 1M90C 2EJFC 3HOZH 2F0SA 2PQAB 1ET6A 1U4PA 4UP7A 2UUAL 1NCVA 1VQ7A 1JB3A 1H9KA 3GTQH 3H3VH 3I4OA 3Q8DA 1DD2A 4BXXH 1PH9A 1SFOH 2N49A 1O7YA 2FJ2A 4DGZA 3NK9A 4JI1Q 5E7NA 4GKJL 5C4XB 2KHIA 2E8GA 5IYBH 4X62Q 2NUCA 1AE2A 4KN7C 1ZEQX 5FLXL 2AQ3B 1EIGA 4RKLA 4DXGA 4A75A 3L7ZC 1BCPD 4CGYB 1FL0A 4GKKL 2BE5D 2HHHQ 4A3FG 4IZ8A 1N36Q 3GTLB 3GO5A 4IPCA 1HTPA 4O0AA 3J81L 1IBKQ 5HGQA 4A3JG 3GTMH 4LNQA 4L6TB 1HCZA 3S15H 1LUZA 2F03A 5KNDA 4IUNA 1TWGH 2JSOA 4IQZA 3RR5A 1XMOL 4LFAQ 5EAYA 2OQKA 3SK5A 4P72A 1LM0A 2NTSA 4NXMQ 1N33L 1E0BA 4CKEA 1EEID 1PRTB 3JAME 4JW0A 1WCMG 1PV4A 4KD3A 4HCSA 2F3WA 3CC7A 1VQEA 1H9JA 2KHJA 4A3KH 2A19A 2D0PA 3BZCA 2MP1A 1XNRQ 3J7AV 4XQQA 1VQBA 4NXNQ 1K3RA 3KF6A 1TWHH 1WTHA 3PO2G 1E2WA
chains in the Genus database with same CATH topology
1IBMQ 4K0KQ 1IYJB 1VQIA 4DV4L 3L0OA 2RCNA 1GD7A 4LFCL 3NENA 4X66Q 4DV3Q 3M85A 5C0XG 1ASYA 4LF6L 1WCMH 3CCLA 4LF7Q 1PYBA 3J80c 3CPWA 3KJOA 1HH2P 3HKZE 4OXPA 1FJGL 2KCMA 3GTKH 1RL2A 2B63G 4PZ7A 5IWAL 5K36G 4DR4Q 3KJPA 1L1OC 4NPSA 4C3HH 4DKAC 3PF4A 1BVSA 1X6OA 2VL6A 2ZJRA 4A3MG 3CPFA 1MJCA 3AFQA 4JI3L 3U4VA 3VDYA 3K7UC 4DV6Q 4HIKA 2YTVA 4JI2L 3HOVG 1Q82C 4L5SA 3PO2H 2UXCQ 1UE1A 3TEHB 5C44H 1ASZA 1R9TH 3HOZG 1D8LA 4JBWA 1PH3A 1AE3A 4PG3A 5BR8Q 4IJHA 1U0LA 4LF5Q 1HNXL 1VS0A 4LF9Q 4BY7G 3OYYA 1HR0W 3K0XA 3FP9A 1HNWQ 3GTJH 1X56A 2H5XA 4A3IG 4HJAA 1GO3E 2K5HA 3S17H 1XPUA 5IY0A 1XTDA 1XPRA 2B63H 3EIVA 3AEVA 3HOYH 1YHBA 3E0EA 2LXKA 3H0GG 3KYHC 2QGQA 2Y0SE 5J3BA 3CCJA 3W1BA 3TRZA 5IT9c 4BXXG 1CUKA 1V1QA 2B29A 4X62L 1YVCA 2DGYA 1GM5A 1N8RC 1HNZQ 3RN2A 3OTOQ 4HIOA 3HOUH 3KFUA 2VQFQ 2JJQA 1YI2A 1DGSA 1X65A 4GNXA 3HKSA 1TWAH 4KHPQ 1OXXK 2MNAA 5LMUL 1UE7A 3KOJA 2K5NA 4BY7H 1W2BA 2JA8H 1WJJA 4GN4B 3PF5A 2ID0A 1VQAA 3E9HA 3PUWA 2LSSA 3SGIA 3S2HH 2JEBI 4ME3A 1Q81C 3J7ZC 4H02A 3L2PA 4UPAA 1S72A 4C2MH 3AYHB 3H0GH 5IP7G 4DPGA 3PIOA 1VQNA 1GKHA 2K50A 2UU9L 4A93H 2YYZA 4QJFA 1T9HA 1KXLA 4DR6Q 1NBWA 4OWXB 5FLMH 5IP9H 4IOAA 1YBYA 1KRTA 4Y52H 5C4XH 3RLOA 4GOPB 1YJWA 4A3BH 1V43A 1HZCA 1LYLA 2JK8A 2R7DA 4DV7L 2NN6I 2VS1A 5C4JH 1WFQA 2R6GA 4DUYL 3HKZG 4DAMA 4JI0Q 1C0AA 5JJKA 4DV1L 1I5FA 1UWVA 4HJ8A 3GDEA 4OWTB 2K5VA 1U5KA 3F1ZA 4A3GH 2UXBL 1UE6A 1NY4A 2E5LL 2YV5A 3W1GA 4DR5L 4HIDA 1XNRL 4IPDA 1LTLA 4DR7L 5IP7H 4GLAC 4NXNL 5LMNQ 3D31A 2OWOA 1UEBA 4X64L 3HOXH 4DV0L 2UXDQ 1OXUA 2K75A 1Q1BA 4J15A 2WAQE 3CW2C 1IXRA 5ELNA 4A4IA 4DV3L 1PYSB 4DV5Q 3FKIG 3J80i 4JV5Q 1SR3A 1P8LA 1EQRA 1HR0L 3AQQA 3PO3G 4R4CA 2BH2A 3G6EA 4LFBL 2PI2A 1SN8A 1VCIA 3CCEA 4DR4L 3CC2A 4P74A 1VQPA 3GTPH 4A3EG 1OTCA 2CKZB 2UUAQ 4YCWA 4POFA 3DM3A 4OONA 1EIFA 4DK3C 5JJLA 2R7FA 2QEXA 5GAHC 4DV6L 1K0RA 5H1SE 4YCVA 4X65Q 1EUJA 5LMNW 3CMAA 2GVBA 1X55A 4EQ5A 4DR2L 4JBJA 2UUBQ 2ZM6L 2Z0SA 3UDIA 2K4KA 2PMZE 2R7ZH 1VQFA 1J5EL 2OTJA 3U4ZA 3F2DA 1XNQL 1X3EA 2D0OA 4LF5L 3UE0A 2XTIA 3CCUA 2KCTA 1C9OA 5M5YH 4JI4L 4LW1A 3RN5A 2MO1A 1VQKA 3K7AH 2HQLA 3MEFA 4APVA 1KC8C 4A3CG 3NBHB 1PH6A 1QVFA 4DR1Q 4A3EH 1PH8A 4DV2L 3TQYA 1X3FA 5M5WH 4HJ7A 4BY1G 4JCVE 3HOYG 3I56A 4YWKA 3OTOL 2UUCQ 1YHQA 4B3TL 2K52A 1EOVA 3CXCA 2JA7H 2D62A 1N34Q 3I4NG 4MTNA 2R93H 1O7IA 1K8GA 2Z6KC 4O2DA 3J81c 2CCZA 1EYGA 4JYAQ 3HOUG 4OO1I 2F4VQ 4C3JH 2EIFA 1QVCA 4A3LG 1Q46A 4MZ9A 3TS2A 3CMEA 2VW9A 4R4OA 4TQUS 4R4TA 3B6YA 5M5XH 4A3CH 1HZBA 3T1HQ 1K83H 1XMOQ 4JI5Q 2NN6G 3DLLA 4GNXB 2JA8G 1CKNA 3NELA 1FGUA 4AYBG 4IPGA 3HFZB 4XIGS 1N33Q 4BY1H 1NTGA 1XMQL 1D7QA 1E3PA 2CFMA 4JI1L 3BJUA 3FHWA 4YCUA 1Q86C 1IL2A 5FJ8G 5GROA 4LF8Q 4YHHQ 3S16H 3K80C 4A93G 3ICEA 1VQ9A 3KDFB 5FLMG 1QZHA 3ULLA 5IP9G 4ALPA 1VQLA 4JI7Q 4JI0L 4JBKA 4JI8Q 3U58A 5C4XG 1I50H 1Q8KA 4A3BG 3PSIA 2ASBA 4LF4L 3D0FA 4B3SQ 2CWAA 3TS0A 4A3LH 2CQOA 4P73A 1IBLQ 2NVXH 2NVQH 2E2JH 2HHHL 3H15A 4GS3A 1N36L 2IHEA 4UP8A 4DR5Q 5LMNL 4DV4Q 2WFWA 4LFCQ 2IX1A 4HJ5A 3RNUA 1L1OA 3KDFA 2NVYH 1UE5A 2VQEL 4OX9L 1IBKL 1B8AA 4LF6Q 4DAYB 1H95A 1MIUA 4JI6L 1K9MC 3BU2A 3I4NH 2HIXA 3F8TA 4GOPC 5FJ8H 3AFPA 5GAEC 1NMGA 1I3QH 3K8AA 4JV5L 1L2FA 1HJPA 3T1YL 5IWAQ 2ZJQA 3CAMA 3STBD 4DNIA 3HOXG 3S1NH 1OXVA 5IE8A 1V9PA 3CCQA 1PH5A 4LFAL 1AH9A 4JI3Q 1BBWA 2WB1E 1VQOA 4B3RL 4NXML 1N32Q 4R4QA 1X9NA 4GLXA 3S1RH 4LUZA 5AJ3Q 3RZOH 2N78A 3CD6A 1SLJA 4JI2Q 1VQ5A 2NVTH 3HOWH 3J81j 1VQHA 1J6QA 4YWMA 2UUBL 4JBMA 1Z47A 3RZDH 1G6PA 5M3MH 4YY3L 1K73C 1HNXQ 2JE6I 3GTLH 2VZAA 1KIXA 1PH1A 4DUZQ 3CP0A 2N8NA 1SROA 1JMCA 2N3SA 5JJIA 3PUXA 1PH2A 1FVIA 1E22A 1S40A 5HY6A 1A62A 3F2BA 4L5QA 4P71A 1IBML 2E2IH 2R7ZG 4K0KL 1JT8A 4IOCA 4X66L 2JEAI 3CCRA 3M4PA 3CCMA 1E24A 1BBUA 4LF7L 4P75A 4FDBA 4YWLA 1EQQA 1M1KC 2I5MX 4OO1G 1CSPA 1YJ9A 4R4IA 1I6HH 4NB3A 2UUCL 1VQMA 2Y0SG 3S14H 2I5HA 4QY7A 1Y1WG 4B3MQ 3J81i 1QUQA 4AQYQ 1N34L 1KD1C 1I94Q 1VQ8A 1MKHA 4GN3B 3UDFA 4C3IH 4OWWB 1WYDA 3A0JA 2VUMG 2F4VL 1A8VA 2C35B 2XGTA 3I55A 1QZGA 2RHQB 4IJLA 2UXCL 1SRUA 4Y7NH 2UU9Q 1NE3A 2L15A 4L5RC 2JA7G 1YEZA 2R93G 4POGA 2HT1A 1TWFH 4KI0A 5BR8L 4BA1I 1WOCA 2ATWA 5ELOA 4LF9L 1VQ6A 2AMCB 2KBNA 2F3IA 1XPOA 1G291 1KRSA 3PV0A 2AWNA 2I0QA 4GKJQ 1HNWL 3W5OA 3F2CA 4KLKA 1SE8A 3ULJA 2Q2IA 5GAGC 3J7A5 4DV7Q 4L5TA 5GADC 2AKWB 2VY3A 5JEAG 4A3FH 4DV1Q 5FLXc 4A3DH 2K14A 1CKOA 3MXNB 3TREA 1Y1WH 4WJ3M 3ZJYC 5C3EG 2YTYA 4XTCS 5IYCG 4IFDJ 4GKKQ 2E5LQ 1S3OA 3JAMc 1HNZL 1YIJA 2VUMH 2VQFL 4IPHA 3K81C 1JJCB 1VQCA 3EN2A 5JEAJ 2QA4A 1CKNB 1RIPA 4DR7Q 1KQSA 4PZ8A 4KHPL 4X64Q 2ZTEA 3CC4A 2BA0A 4DR3Q 2BA1A 4BA2I 1CKMA 5IYDH 4GLVB 3S2DH 2ES2A 1X54A 1EFWA 4GNXC 3GTGH 4JOIA 1B70B 1YJNA 3NEMA 1HR0Q 2OCEA 3KLWA 3A5ZB 3UE1A 2ZJPA 4LFBQ 4BBRH 4HIMA 3STBC 3KF8B 3ULPA 3G48A 1Y1VH 4JG2A 2JA5H 4RMFA 5C3EH 4DR6L 5C0XJ 1JJ2A 1TXYA 4AIMA 5IYCH 5GQOA 1Z9FA 1CSQA 3WWVA 2WAQG 4AH6A 3UDGA 1N32L 2B3GA 4QIWE 1L1OB 3PUYA 5AJ3L 1YHAA 4DR2Q 2ZM6Q 1YZ6A 4QGUA 3S1MH 2VNUD 1E7ZA 2JA6H 4R1JA 1J5EQ 4IFDI 3OW2A 1A0IA 4TVAB 3RLFA 3UDXA 1XNQQ 4LUVA 1PA6A 1PFSA 1IZ6A 4DUZL 4JI4Q 1E1TA 1YITA 3HOWG 1W3SA 1P16A 2JQOA 4QQBX 1A63A 2I5LX 2YTXA 5M3MG 2UXDL 2Q2HA 3ER0A 4DV2Q 4A3MH 2RF4A 2LXJA 2Q2UA 2PNHA 3CQZH 1YNXA 2Z6KA 4EX5A 1KL9A 1FJGQ 3M9BA 2NZHA 4DV5L 2IHFA 3G4SA 2E2HH 1K8AC 3CCSA 1NMFA 5DLQE 4QL5A 1EIYB 3JC66 4B3TQ 1KHIA 2FXQA 3HOVH 2F52A 3PCOB 5C0XI 2DUDA 5IYBG 1VQ4A 2GN5A 3M3YH 2NZOA 2ALYB 1M90C 3HOZH 2PQAB 4A76A 1PH7A 4MNOA 4UP7A 1E1OA 2UUAL 1Y14B 4B3ML 1VQ7A 1I94L 4AQYL 4A3IH 3GTQH 1JJGA 1PHJA 3BZKA 4X65L 2MO0A 3H3VH 1L0WA 3I4OA 1QVGA 4X6AH 1TWCH 3GTOH 3GD7A 3PUVA 4RG1A 2IX0A 1G51A 3Q8DA 3I4MG 4BXXH 2V1CC 2A1AA 1KAWA 4IO9A 2BH8A 1PH4A 1PH9A 2EXDA 1SFOH 2N49A 1XMQQ 2PQAA 2KENA 1X3GA 2MFIA 4BBSG 1N9WA 5E7NA 4JI1Q 3U50C 4GKJL 3ERSX 1QUQB 2KHIA 2E8GA 5IYBH 2MQHA 4GN5A 4X62Q 1NJIC 1AE2A 3S24A 2ZTDA 4DR1L 1Q7YC 4UP9A 1MJEA 3H3VI 4LF4Q 4A75A 3JAMi 3L7ZC 1FL0A 3I2ZA 4GKKL 5LMUQ 1GVPA 4PZ6A 1VQGA 2HIVA 3PUZA 2HHHQ 4GOPA 4A3FG 1N36Q 5M3FG 4A3GG 4A3DG 3GO5A 1PVOA 2GVAA 3RLNA 3I4MH 1BKBA 4A3KG 4AYBE 3EBEA 4IPCA 3I7FA 4O0AA 2VQEQ 4DR3L 1HZAA 1IBKQ 4DK6C 4OX9Q 5HGQA 4A3JG 4UY8C 3M7NA 3S1QH 3GTMH 4JI6Q 4LNQA 4BBSH 2EQSA 2JA9A 4LWCA 2PI2E 3S15H 1LUZA 3IRBA 3T1YQ 2R92G 2AHOB 3CF5A 1TWGH 3RR5A 3T1HL 4JI5L 1XMOL 2A8VA 4WJ4A 4LUOA 2CWPA 5IYDG 3A5UA 2YU9H 1Q1EA 4LFAQ 3PIPA 1WI5A 5EAYA 3M4OH 1SMXA 2OQKA 4JC0A 1HZ9A 1OXSC 4P72A 4B3RQ 1LM0A 3KF6B 4NXMQ 4JOIC 1N33L 2IY5B 3PGZA 1Q12A 2Q2TA 1VQDA 1XJVA 4IFDG 2IT1A 3A74A 1WCMG 4DUYQ 1JB7A 1PV4A 4BBRG 4PMWA 1C7YA 4YHHL 5M3FH 4LF8L 3CCVA 4KHZA 1Y1VG 2JA5G 3CC7A 1VQEA 3LGJA 2KHJA 4A3KH 2A19A 2D0PA 2AWOA 3BZCA 4JI7L 4HJ9A 4YY3Q 1EWIA 2UXBQ 4JI8L 4JYAL 1VQJA 2WB1G 2OQ0A 4A3JH 1XNRQ 2WP8J 2RHSB 4B3SL 1VQBA 1B7YB 4NXNQ 1IBLL 1K3RA 3KF6A 2OTLA 1JE5A 1TWHH 3FKIH 3G71A 2R92H 2ZTCA 3E9IA 4DV0Q 3PO2G 3PO3H 3M4QA 2JA6G 1OXTA 5C44G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IBM Q;  4K0K Q;  1IYJ B;  1VQI A;  4DV4 L;  3L0O A;  2RCN A;  1GD7 A;  4LFC L;  3NEN A;  4X66 Q;  4DV3 Q;  3M85 A;  5C0X G;  1ASY A;  4LF6 L;  1WCM H;  3CCL A;  4LF7 Q;  1PYB A;  3J80 c;  3CPW A;  3KJO A;  1HH2 P;  3HKZ E;  4OXP A;  1FJG L;  2KCM A;  3GTK H;  1RL2 A;  2B63 G;  4PZ7 A;  5IWA L;  5K36 G;  4DR4 Q;  3KJP A;  1L1O C;  4NPS A;  4C3H H;  4DKA C;  3PF4 A;  1BVS A;  1X6O A;  2VL6 A;  2ZJR A;  4A3M G;  3CPF A;  1MJC A;  3AFQ A;  4JI3 L;  3U4V A;  3VDY A;  3K7U C;  4DV6 Q;  4HIK A;  2YTV A;  4JI2 L;  3HOV G;  1Q82 C;  4L5S A;  3PO2 H;  2UXC Q;  1UE1 A;  3TEH B;  5C44 H;  1ASZ A;  1R9T H;  3HOZ G;  1D8L A;  4JBW A;  1PH3 A;  1AE3 A;  4PG3 A;  5BR8 Q;  4IJH A;  1U0L A;  4LF5 Q;  1HNX L;  1VS0 A;  4LF9 Q;  4BY7 G;  3OYY A;  1HR0 W;  3K0X A;  3FP9 A;  1HNW Q;  3GTJ H;  1X56 A;  2H5X A;  4A3I G;  4HJA A;  1GO3 E;  2K5H A;  3S17 H;  1XPU A;  5IY0 A;  1XTD A;  1XPR A;  2B63 H;  3EIV A;  3AEV A;  3HOY H;  1YHB A;  3E0E A;  2LXK A;  3H0G G;  3KYH C;  2QGQ A;  2Y0S E;  5J3B A;  3CCJ A;  3W1B A;  3TRZ A;  5IT9 c;  4BXX G;  1CUK A;  1V1Q A;  2B29 A;  4X62 L;  1YVC A;  2DGY A;  1GM5 A;  1N8R C;  1HNZ Q;  3RN2 A;  3OTO Q;  4HIO A;  3HOU H;  3KFU A;  2VQF Q;  2JJQ A;  1YI2 A;  1DGS A;  1X65 A;  4GNX A;  3HKS A;  1TWA H;  4KHP Q;  1OXX K;  2MNA A;  5LMU L;  1UE7 A;  3KOJ A;  2K5N A;  4BY7 H;  1W2B A;  2JA8 H;  1WJJ A;  4GN4 B;  3PF5 A;  2ID0 A;  1VQA A;  3E9H A;  3PUW A;  2LSS A;  3SGI A;  3S2H H;  2JEB I;  4ME3 A;  1Q81 C;  3J7Z C;  4H02 A;  3L2P A;  4UPA A;  1S72 A;  4C2M H;  3AYH B;  3H0G H;  5IP7 G;  4DPG A;  3PIO A;  1VQN A;  1GKH A;  2K50 A;  2UU9 L;  4A93 H;  2YYZ A;  4QJF A;  1T9H A;  1KXL A;  4DR6 Q;  1NBW A;  4OWX B;  5FLM H;  5IP9 H;  4IOA A;  1YBY A;  1KRT A;  4Y52 H;  5C4X H;  3RLO A;  4GOP B;  1YJW A;  4A3B H;  1V43 A;  1HZC A;  1LYL A;  2JK8 A;  2R7D A;  4DV7 L;  2NN6 I;  2VS1 A;  5C4J H;  1WFQ A;  2R6G A;  4DUY L;  3HKZ G;  4DAM A;  4JI0 Q;  1C0A A;  5JJK A;  4DV1 L;  1I5F A;  1UWV A;  4HJ8 A;  3GDE A;  4OWT B;  2K5V A;  1U5K A;  3F1Z A;  4A3G H;  2UXB L;  1UE6 A;  1NY4 A;  2E5L L;  2YV5 A;  3W1G A;  4DR5 L;  4HID A;  1XNR L;  4IPD A;  1LTL A;  4DR7 L;  5IP7 H;  4GLA C;  4NXN L;  5LMN Q;  3D31 A;  2OWO A;  1UEB A;  4X64 L;  3HOX H;  4DV0 L;  2UXD Q;  1OXU A;  2K75 A;  1Q1B A;  4J15 A;  2WAQ E;  3CW2 C;  1IXR A;  5ELN A;  4A4I A;  4DV3 L;  1PYS B;  4DV5 Q;  3FKI G;  3J80 i;  4JV5 Q;  1SR3 A;  1P8L A;  1EQR A;  1HR0 L;  3AQQ A;  3PO3 G;  4R4C A;  2BH2 A;  3G6E A;  4LFB L;  2PI2 A;  1SN8 A;  1VCI A;  3CCE A;  4DR4 L;  3CC2 A;  4P74 A;  1VQP A;  3GTP H;  4A3E G;  1OTC A;  2CKZ B;  2UUA Q;  4YCW A;  4POF A;  3DM3 A;  4OON A;  1EIF A;  4DK3 C;  5JJL A;  2R7F A;  2QEX A;  5GAH C;  4DV6 L;  1K0R A;  5H1S E;  4YCV A;  4X65 Q;  1EUJ A;  5LMN W;  3CMA A;  2GVB A;  1X55 A;  4EQ5 A;  4DR2 L;  4JBJ A;  2UUB Q;  2ZM6 L;  2Z0S A;  3UDI A;  2K4K A;  2PMZ E;  2R7Z H;  1VQF A;  1J5E L;  2OTJ A;  3U4Z A;  3F2D A;  1XNQ L;  1X3E A;  2D0O A;  4LF5 L;  3UE0 A;  2XTI A;  3CCU A;  2KCT A;  1C9O A;  5M5Y H;  4JI4 L;  4LW1 A;  3RN5 A;  2MO1 A;  1VQK A;  3K7A H;  2HQL A;  3MEF A;  4APV A;  1KC8 C;  4A3C G;  3NBH B;  1PH6 A;  1QVF A;  4DR1 Q;  4A3E H;  1PH8 A;  4DV2 L;  3TQY A;  1X3F A;  5M5W H;  4HJ7 A;  4BY1 G;  4JCV E;  3HOY G;  3I56 A;  4YWK A;  3OTO L;  2UUC Q;  1YHQ A;  4B3T L;  2K52 A;  1EOV A;  3CXC A;  2JA7 H;  2D62 A;  1N34 Q;  3I4N G;  4MTN A;  2R93 H;  1O7I A;  1K8G A;  2Z6K C;  4O2D A;  3J81 c;  2CCZ A;  1EYG A;  4JYA Q;  3HOU G;  4OO1 I;  2F4V Q;  4C3J H;  2EIF A;  1QVC A;  4A3L G;  1Q46 A;  4MZ9 A;  3TS2 A;  3CME A;  2VW9 A;  4R4O A;  4TQU S;  4R4T A;  3B6Y A;  5M5X H;  4A3C H;  1HZB A;  3T1H Q;  1K83 H;  1XMO Q;  4JI5 Q;  2NN6 G;  3DLL A;  4GNX B;  2JA8 G;  1CKN A;  3NEL A;  1FGU A;  4AYB G;  4IPG A;  3HFZ B;  4XIG S;  1N33 Q;  4BY1 H;  1NTG A;  1XMQ L;  1D7Q A;  1E3P A;  2CFM A;  4JI1 L;  3BJU A;  3FHW A;  4YCU A;  1Q86 C;  1IL2 A;  5FJ8 G;  5GRO A;  4LF8 Q;  4YHH Q;  3S16 H;  3K80 C;  4A93 G;  3ICE A;  1VQ9 A;  3KDF B;  5FLM G;  1QZH A;  3ULL A;  5IP9 G;  4ALP A;  1VQL A;  4JI7 Q;  4JI0 L;  4JBK A;  4JI8 Q;  3U58 A;  5C4X G;  1I50 H;  1Q8K A;  4A3B G;  3PSI A;  2ASB A;  4LF4 L;  3D0F A;  4B3S Q;  2CWA A;  3TS0 A;  4A3L H;  2CQO A;  4P73 A;  1IBL Q;  2NVX H;  2NVQ H;  2E2J H;  2HHH L;  3H15 A;  4GS3 A;  1N36 L;  2IHE A;  4UP8 A;  4DR5 Q;  5LMN L;  4DV4 Q;  2WFW A;  4LFC Q;  2IX1 A;  4HJ5 A;  3RNU A;  1L1O A;  3KDF A;  2NVY H;  1UE5 A;  2VQE L;  4OX9 L;  1IBK L;  1B8A A;  4LF6 Q;  4DAY B;  1H95 A;  1MIU A;  4JI6 L;  1K9M C;  3BU2 A;  3I4N H;  2HIX A;  3F8T A;  4GOP C;  5FJ8 H;  3AFP A;  5GAE C;  1NMG A;  1I3Q H;  3K8A A;  4JV5 L;  1L2F A;  1HJP A;  3T1Y L;  5IWA Q;  2ZJQ A;  3CAM A;  3STB D;  4DNI A;  3HOX G;  3S1N H;  1OXV A;  5IE8 A;  1V9P A;  3CCQ A;  1PH5 A;  4LFA L;  1AH9 A;  4JI3 Q;  1BBW A;  2WB1 E;  1VQO A;  4B3R L;  4NXM L;  1N32 Q;  4R4Q A;  1X9N A;  4GLX A;  3S1R H;  4LUZ A;  5AJ3 Q;  3RZO H;  2N78 A;  3CD6 A;  1SLJ A;  4JI2 Q;  1VQ5 A;  2NVT H;  3HOW H;  3J81 j;  1VQH A;  1J6Q A;  4YWM A;  2UUB L;  4JBM A;  1Z47 A;  3RZD H;  1G6P A;  5M3M H;  4YY3 L;  1K73 C;  1HNX Q;  2JE6 I;  3GTL H;  2VZA A;  1KIX A;  1PH1 A;  4DUZ Q;  3CP0 A;  2N8N A;  1SRO A;  1JMC A;  2N3S A;  5JJI A;  3PUX A;  1PH2 A;  1FVI A;  1E22 A;  1S40 A;  5HY6 A;  1A62 A;  3F2B A;  4L5Q A;  4P71 A;  1IBM L;  2E2I H;  2R7Z G;  4K0K L;  1JT8 A;  4IOC A;  4X66 L;  2JEA I;  3CCR A;  3M4P A;  3CCM A;  1E24 A;  1BBU A;  4LF7 L;  4P75 A;  4FDB A;  4YWL A;  1EQQ A;  1M1K C;  2I5M X;  4OO1 G;  1CSP A;  1YJ9 A;  4R4I A;  1I6H H;  4NB3 A;  2UUC L;  1VQM A;  2Y0S G;  3S14 H;  2I5H A;  4QY7 A;  1Y1W G;  4B3M Q;  3J81 i;  1QUQ A;  4AQY Q;  1N34 L;  1KD1 C;  1I94 Q;  1VQ8 A;  1MKH A;  4GN3 B;  3UDF A;  4C3I H;  4OWW B;  1WYD A;  3A0J A;  2VUM G;  2F4V L;  1A8V A;  2C35 B;  2XGT A;  3I55 A;  1QZG A;  2RHQ B;  4IJL A;  2UXC L;  1SRU A;  4Y7N H;  2UU9 Q;  1NE3 A;  2L15 A;  4L5R C;  2JA7 G;  1YEZ A;  2R93 G;  4POG A;  2HT1 A;  1TWF H;  4KI0 A;  5BR8 L;  4BA1 I;  1WOC A;  2ATW A;  5ELO A;  4LF9 L;  1VQ6 A;  2AMC B;  2KBN A;  2F3I A;  1XPO A;  1G29 1;  1KRS A;  3PV0 A;  2AWN A;  2I0Q A;  4GKJ Q;  1HNW L;  3W5O A;  3F2C A;  4KLK A;  1SE8 A;  3ULJ A;  2Q2I A;  5GAG C;  3J7A 5;  4DV7 Q;  4L5T A;  5GAD C;  2AKW B;  2VY3 A;  5JEA G;  4A3F H;  4DV1 Q;  5FLX c;  4A3D H;  2K14 A;  1CKO A;  3MXN B;  3TRE A;  1Y1W H;  4WJ3 M;  3ZJY C;  5C3E G;  2YTY A;  4XTC S;  5IYC G;  4IFD J;  4GKK Q;  2E5L Q;  1S3O A;  3JAM c;  1HNZ L;  1YIJ A;  2VUM H;  2VQF L;  4IPH A;  3K81 C;  1JJC B;  1VQC A;  3EN2 A;  5JEA J;  2QA4 A;  1CKN B;  1RIP A;  4DR7 Q;  1KQS A;  4PZ8 A;  4KHP L;  4X64 Q;  2ZTE A;  3CC4 A;  2BA0 A;  4DR3 Q;  2BA1 A;  4BA2 I;  1CKM A;  5IYD H;  4GLV B;  3S2D H;  2ES2 A;  1X54 A;  1EFW A;  4GNX C;  3GTG H;  4JOI A;  1B70 B;  1YJN A;  3NEM A;  1HR0 Q;  2OCE A;  3KLW A;  3A5Z B;  3UE1 A;  2ZJP A;  4LFB Q;  4BBR H;  4HIM A;  3STB C;  3KF8 B;  3ULP A;  3G48 A;  1Y1V H;  4JG2 A;  2JA5 H;  4RMF A;  5C3E H;  4DR6 L;  5C0X J;  1JJ2 A;  1TXY A;  4AIM A;  5IYC H;  5GQO A;  1Z9F A;  1CSQ A;  3WWV A;  2WAQ G;  4AH6 A;  3UDG A;  1N32 L;  2B3G A;  4QIW E;  1L1O B;  3PUY A;  5AJ3 L;  1YHA A;  4DR2 Q;  2ZM6 Q;  1YZ6 A;  4QGU A;  3S1M H;  2VNU D;  1E7Z A;  2JA6 H;  4R1J A;  1J5E Q;  4IFD I;  3OW2 A;  1A0I A;  4TVA B;  3RLF A;  3UDX A;  1XNQ Q;  4LUV A;  1PA6 A;  1PFS A;  1IZ6 A;  4DUZ L;  4JI4 Q;  1E1T A;  1YIT A;  3HOW G;  1W3S A;  1P16 A;  2JQO A;  4QQB X;  1A63 A;  2I5L X;  2YTX A;  5M3M G;  2UXD L;  2Q2H A;  3ER0 A;  4DV2 Q;  4A3M H;  2RF4 A;  2LXJ A;  2Q2U A;  2PNH A;  3CQZ H;  1YNX A;  2Z6K A;  4EX5 A;  1KL9 A;  1FJG Q;  3M9B A;  2NZH A;  4DV5 L;  2IHF A;  3G4S A;  2E2H H;  1K8A C;  3CCS A;  1NMF A;  5DLQ E;  4QL5 A;  1EIY B;  3JC6 6;  4B3T Q;  1KHI A;  2FXQ A;  3HOV H;  2F52 A;  3PCO B;  5C0X I;  2DUD A;  5IYB G;  1VQ4 A;  2GN5 A;  3M3Y H;  2NZO A;  2ALY B;  1M90 C;  3HOZ H;  2PQA B;  4A76 A;  1PH7 A;  4MNO A;  4UP7 A;  1E1O A;  2UUA L;  1Y14 B;  4B3M L;  1VQ7 A;  1I94 L;  4AQY L;  4A3I H;  3GTQ H;  1JJG A;  1PHJ A;  3BZK A;  4X65 L;  2MO0 A;  3H3V H;  1L0W A;  3I4O A;  1QVG A;  4X6A H;  1TWC H;  3GTO H;  3GD7 A;  3PUV A;  4RG1 A;  2IX0 A;  1G51 A;  3Q8D A;  3I4M G;  4BXX H;  2V1C C;  2A1A A;  1KAW A;  4IO9 A;  2BH8 A;  1PH4 A;  1PH9 A;  2EXD A;  1SFO H;  2N49 A;  1XMQ Q;  2PQA A;  2KEN A;  1X3G A;  2MFI A;  4BBS G;  1N9W A;  5E7N A;  4JI1 Q;  3U50 C;  4GKJ L;  3ERS X;  1QUQ B;  2KHI A;  2E8G A;  5IYB H;  2MQH A;  4GN5 A;  4X62 Q;  1NJI C;  1AE2 A;  3S24 A;  2ZTD A;  4DR1 L;  1Q7Y C;  4UP9 A;  1MJE A;  3H3V I;  4LF4 Q;  4A75 A;  3JAM i;  3L7Z C;  1FL0 A;  3I2Z A;  4GKK L;  5LMU Q;  1GVP A;  4PZ6 A;  1VQG A;  2HIV A;  3PUZ A;  2HHH Q;  4GOP A;  4A3F G;  1N36 Q;  5M3F G;  4A3G G;  4A3D G;  3GO5 A;  1PVO A;  2GVA A;  3RLN A;  3I4M H;  1BKB A;  4A3K G;  4AYB E;  3EBE A;  4IPC A;  3I7F A;  4O0A A;  2VQE Q;  4DR3 L;  1HZA A;  1IBK Q;  4DK6 C;  4OX9 Q;  5HGQ A;  4A3J G;  4UY8 C;  3M7N A;  3S1Q H;  3GTM H;  4JI6 Q;  4LNQ A;  4BBS H;  2EQS A;  2JA9 A;  4LWC A;  2PI2 E;  3S15 H;  1LUZ A;  3IRB A;  3T1Y Q;  2R92 G;  2AHO B;  3CF5 A;  1TWG H;  3RR5 A;  3T1H L;  4JI5 L;  1XMO L;  2A8V A;  4WJ4 A;  4LUO A;  2CWP A;  5IYD G;  3A5U A;  2YU9 H;  1Q1E A;  4LFA Q;  3PIP A;  1WI5 A;  5EAY A;  3M4O H;  1SMX A;  2OQK A;  4JC0 A;  1HZ9 A;  1OXS C;  4P72 A;  4B3R Q;  1LM0 A;  3KF6 B;  4NXM Q;  4JOI C;  1N33 L;  2IY5 B;  3PGZ A;  1Q12 A;  2Q2T A;  1VQD A;  1XJV A;  4IFD G;  2IT1 A;  3A74 A;  1WCM G;  4DUY Q;  1JB7 A;  1PV4 A;  4BBR G;  4PMW A;  1C7Y A;  4YHH L;  5M3F H;  4LF8 L;  3CCV A;  4KHZ A;  1Y1V G;  2JA5 G;  3CC7 A;  1VQE A;  3LGJ A;  2KHJ A;  4A3K H;  2A19 A;  2D0P A;  2AWO A;  3BZC A;  4JI7 L;  4HJ9 A;  4YY3 Q;  1EWI A;  2UXB Q;  4JI8 L;  4JYA L;  1VQJ A;  2WB1 G;  2OQ0 A;  4A3J H;  1XNR Q;  2WP8 J;  2RHS B;  4B3S L;  1VQB A;  1B7Y B;  4NXN Q;  1IBL L;  1K3R A;  3KF6 A;  2OTL A;  1JE5 A;  1TWH H;  3FKI H;  3G71 A;  2R92 H;  2ZTC A;  3E9I A;  4DV0 Q;  3PO2 G;  3PO3 H;  3M4Q A;  2JA6 G;  1OXT A;  5C44 G; 
#chains in the Genus database with same CATH topology
 2OT2 A;  1IBM Q;  1IYJ B;  4DV4 L;  1GD7 A;  4X66 Q;  1G2S A;  3M85 A;  2BCO A;  4LF6 L;  2LY7 A;  2Y0S B;  2FIN B;  4A3G B;  3H6M A;  4A3D B;  1Y1W B;  3KJO A;  3HKZ E;  1FJG L;  1QNK A;  4CDE C;  5IWA L;  4DR4 Q;  1SNM A;  1BVS A;  2DY7 A;  2VUM B;  4DV6 Q;  3DM1 A;  5CR3 A;  3GQB A;  1DON A;  1EWC A;  3TEH B;  1VMC A;  3KBG A;  1D8L A;  4PG3 A;  4IJH A;  4KV6 A;  1F2Z A;  1STN A;  1MD2 D;  1VS0 A;  1JWM D;  3OYY A;  3K0X A;  3FP9 A;  1HNW Q;  1MSH A;  4A3I G;  4HJA A;  2NZ1 D;  1ZYR D;  1XTD A;  3EIV A;  5K36 H;  1BF4 A;  5J3B A;  3CCJ A;  1V1Q A;  4X62 L;  2B29 A;  1GM5 A;  2DGY A;  1HNZ Q;  4HMJ A;  4HIO A;  2XVS A;  2VQF Q;  1U4L A;  1YI2 A;  1X65 A;  4GNX A;  1WTX A;  3PMF A;  1VDZ A;  3QO2 A;  2I46 A;  5KRU A;  1BCP B;  1IL8 A;  3KOJ A;  4FNF A;  2Z1C A;  1JIC A;  3KBX A;  2JA8 H;  1WJJ A;  2XN9 C;  1VQA A;  2OF1 A;  1S5D D;  3S2H H;  1ICW A;  2H4O A;  4I65 A;  4H02 A;  2EXZ A;  3L2P A;  1LTB D;  1SMY C;  3AYH B;  3H0G H;  3TME A;  4DPG A;  1VQN A;  2K50 A;  1PXU A;  3Q22 A;  4DR6 Q;  1DYQ A;  4OWX B;  3BZD B;  5C5M A;  4Y52 H;  4HSV A;  4IAL A;  3D4W A;  1MBY A;  4A3B H;  1VF7 A;  4KMU C;  2R7D A;  3HOZ B;  4HN7 A;  2ZXR A;  1I5F A;  1K8O A;  3GTQ B;  3MA2 B;  4C56 C;  1U5K A;  1A2T A;  5M3M B;  2A73 B;  4QB4 A;  3SHL A;  3H09 A;  1XNR L;  2G9D A;  4NXN L;  2XWB B;  5LMN Q;  1DOM A;  4ZQ3 A;  1SFO B;  4X64 L;  2O5J C;  1OXU A;  4XYO A;  1SJH D;  3CHB D;  5COR A;  2E2I B;  1IXR A;  1PFN A;  1RJT A;  5C4Z A;  4DV5 Q;  3AQQ A;  1PRT C;  3OSO A;  3BYY B;  2IJ0 A;  1VCI A;  3P1H A;  4DR4 L;  3CC2 A;  2MUY A;  1IYV A;  2DNE A;  4YCW A;  4OON A;  5E3F A;  5GAH C;  4DV6 L;  1K0R A;  1EUJ A;  2MGS A;  3CMA A;  2GVB A;  1X55 A;  3QR8 A;  3PIP 3;  3GTM B;  3L9A X;  4ABN A;  2F0M A;  2R7Z H;  1VQF A;  2OTJ A;  3U4Z A;  1XNQ L;  1SE3 A;  1TWG B;  5I9O A;  4JI4 L;  1VQK A;  3J80 E;  1JWS D;  2Z6B A;  3MEF A;  4APV A;  1QVF A;  4A3E H;  1STH A;  4QIW B;  4CHT B;  4JCV E;  4A3K B;  3HOY G;  1B1Z A;  2UUC Q;  1YHQ A;  3G7L A;  3C3L A;  2F0U A;  3CXC A;  3A54 A;  2JA7 H;  2D62 A;  3R2T A;  2Z6K C;  1TWH B;  1EYG A;  1ENC A;  2NB0 A;  2F4V Q;  4MZ9 A;  4NKL A;  3TS2 A;  4JK1 C;  5G3L F;  4R4O A;  4TQU S;  5M5X H;  5C3W A;  3T1H Q;  4CKB A;  2NN6 G;  4GNX B;  2G5D A;  1JR0 D;  1GXD C;  4AYB G;  3HFZ B;  3DXJ C;  4XIG S;  5FK9 C;  1NTG A;  2A6H D;  1XMQ L;  3DWQ A;  2JA5 B;  1D7Q A;  3URY A;  1E3P A;  2KA7 A;  1IL2 A;  3FHW A;  2WB1 B;  3S16 H;  3K80 C;  4ILW A;  3ULL A;  5IP9 G;  3DMU A;  3U58 A;  1BCP C;  3C1E A;  4N8X 1;  4LF4 L;  3D0F A;  4TSS A;  4B3S Q;  4A3L H;  1IBL Q;  2NVX H;  1EU4 A;  1LTI D;  2E2J H;  1GUS A;  3H15 A;  3NXW A;  4GZY C;  2IHE A;  3L3O C;  5LMN L;  4LFC Q;  2IX1 A;  2K05 A;  4X3K A;  1H95 A;  4YIJ A;  3I4N H;  3BU2 A;  1CI3 M;  3AFP A;  5IGE A;  1I3Q H;  2X6L A;  3QOJ A;  1HJP A;  4ZUJ A;  2ZJQ A;  1D1K A;  2JXM B;  3TDQ A;  4DNI A;  4CDF C;  3CCQ A;  1BBW A;  2DNC A;  2J0T D;  1VQO A;  5CV5 A;  2JYO A;  5CBE E;  1X9N A;  2VB2 X;  3H3V C;  2AQ1 B;  2H1E A;  2GA4 B;  1J6Q A;  1Z47 A;  3RZD H;  1JOR A;  3ZYY X;  2G9H D;  3H0G B;  3IL8 A;  2N8N A;  3WOE A;  5JJI A;  2F0E A;  3PUX A;  1FVI A;  4ZKC B;  1A62 A;  4A3B B;  3GP7 A;  4P71 A;  1JT8 A;  1HRJ A;  4OHJ A;  2K01 A;  3SK8 A;  3CCM A;  1M1K C;  1KDC A;  3HZX A;  2I5M X;  1F2L A;  1YJ9 A;  2EYF A;  2UUC L;  3I3C A;  3FPU B;  1SAP A;  3MTS A;  5T1G A;  1EQT A;  3J81 i;  1PFM A;  5DM6 3;  2KQ3 A;  2F4V L;  1BXT A;  2C35 B;  2RHQ B;  4K2L A;  1SRU A;  2K5W A;  1NE3 A;  2L15 A;  3QB3 A;  3K6O A;  1STE A;  4C3J G;  1G29 1;  1KRS A;  4IUQ A;  1ZYR C;  4BS9 A;  3J7A 5;  2Q2I A;  2F0D A;  2B2U C;  4OO1 H;  1NSN S;  5GAD C;  2AKW B;  2VY3 A;  4A3F H;  5FLX c;  2K14 A;  1CKO A;  2ZT9 C;  4XTC S;  5EPJ A;  4QUF A;  1Q3L A;  2LMC B;  4IFD J;  2E5L Q;  4J8Q A;  4IPH A;  5JEA J;  1VQC A;  2QA4 A;  1FNW A;  1WTO A;  1KQS A;  5HGT A;  1I4H A;  3CU7 A;  3MFY A;  2BA0 A;  3K59 A;  4BA2 I;  2OEO A;  1QNU A;  1X54 A;  4GNX C;  3GTG H;  1B70 B;  5E4X A;  2PZW A;  1V1O A;  4A3E B;  3MEH A;  4LJZ C;  3G48 A;  1CA5 A;  5C3E H;  4PMB A;  1Z9F A;  2F0N A;  1CSQ A;  4AH6 A;  3TZD A;  1WVL A;  2EJG C;  2XNA C;  4QIW E;  4M1U B;  1IYU A;  1YHA A;  2VNU D;  1E7Z A;  3X3N A;  1LTT D;  2IPK D;  2KEE A;  5CC4 A;  1NR2 A;  1J5E Q;  4R9W A;  3RLF A;  3UDX A;  1CT1 D;  2RQX A;  5M5X B;  1A15 A;  1PFS A;  1UNS A;  4U68 A;  1YIT A;  1P16 A;  3HS0 C;  4DXF A;  1BR9 A;  1Y69 U;  3S16 B;  1KL9 A;  3M9B A;  1ET9 A;  3G4S A;  1B4O A;  1K8A C;  4B3T Q;  2FXQ A;  1MGS A;  1EY7 A;  3HOU B;  1K3B C;  3TP8 A;  5C0X I;  1XYI A;  2DUD A;  2NZO A;  2ALY B;  4K2K A;  4MNO A;  1E1O A;  3QOL A;  2E2J B;  3PIO 3;  4NDX A;  4A3I H;  3BZK A;  4X65 L;  2NTT A;  1SDF A;  1QVG A;  2F0I A;  5IGD A;  3I4N B;  5CV4 A;  1I3Q B;  1KAW A;  4KTA A;  2EXD A;  2PQA A;  2KEN A;  1X3G A;  1JOO A;  3LWE A;  3Q23 A;  4DA2 A;  4DR1 L;  1SXT A;  2M00 A;  3W3A A;  2RDF A;  4G57 A;  3RZD B;  3BVM A;  1GVP A;  3G6J B;  4DAP A;  1VQG A;  5CGK A;  4DAV A;  4GOP A;  3OIQ A;  1KNE A;  2GVA A;  3RLN A;  3VA7 A;  4TRD A;  3C46 A;  3I4M H;  3NTI A;  4OX9 Q;  1BOS A;  4UY8 C;  3S1Q H;  4JYA L;  2RCF A;  2KHS A;  3HOX B;  4BBS H;  4JI6 Q;  4L63 B;  1WTW A;  4LWC A;  3RUZ A;  5CMD A;  2VB3 X;  4J1M A;  3T1Y Q;  2R92 G;  1PYW D;  2B8F A;  2CWP A;  1B53 A;  4B3R Q;  1A3V A;  1ZKO A;  4JOI C;  3CRL C;  1Q12 A;  2EJM A;  1Z6H A;  1VQD A;  1XJV A;  3I70 A;  4DUY Q;  4BBR G;  5M3F H;  3FRP B;  1EOT A;  4IN3 A;  1EWI A;  1CM9 A;  3I72 A;  1B7Y B;  1S5B D;  4H44 C;  3G71 A;  2EVB A;  2ZTC A;  3E9I A;  1ESF A;  4F88 A;  1VQI A;  4CJ1 B;  1ASY A;  1K28 A;  3SR1 A;  4A3F B;  3CCL A;  3FVQ A;  1DCZ A;  4KN4 C;  2PQE A;  1RL2 A;  2B63 G;  4OEM B;  1PRT D;  3NQI A;  4PZ7 A;  3KJP A;  4MTK A;  2VL6 A;  2NYZ D;  3FEW X;  3CPF A;  2ZJR A;  4A3M G;  1MJC A;  1PTO H;  1O80 A;  2R93 B;  2YTV A;  3NBH A;  2WIN B;  1XWE A;  4JI2 L;  5EBC A;  3AU7 A;  3HOV G;  2UXC Q;  5C44 H;  3GTG B;  1R9T H;  5BR8 Q;  1U0L A;  4LF5 Q;  4BY7 G;  2RBM A;  5E1F A;  3S17 H;  4ZRZ A;  1XPU A;  5C3E B;  1NNX A;  3N6R A;  1XPR A;  3HOY H;  2QGQ A;  5IT9 c;  1RF2 D;  1CUK A;  3D3R A;  1CA6 A;  1YVC A;  3RN2 A;  3KFU A;  1S5F D;  2JJQ A;  4PV1 C;  2X6G A;  1F9Q A;  1TWA H;  2AUJ D;  4K6D A;  4KHP Q;  1EZ8 A;  1M4V A;  2NN6 H;  2RDH A;  1EY9 A;  2ID0 A;  4RHS A;  4LK1 C;  2LSS A;  3SGI A;  4ME3 A;  3J7Z C;  3A7L A;  1X3Q A;  4UPA A;  1S72 A;  4C2M H;  1GHJ A;  5IP7 G;  1Y8N B;  1ENF A;  3PIO A;  2UU9 L;  1T9H A;  1EWH A;  1A3T A;  1WTR A;  5IP9 H;  4IOA A;  1YBY A;  5LL6 X;  4GOP B;  2BDN A;  2L1B A;  1PZJ D;  5G3L D;  4O1N A;  3I73 A;  1RD9 D;  1JE4 A;  1IW7 C;  4DUY L;  3HKZ G;  4DAM A;  4DAY A;  1EY5 A;  4CJ0 B;  3TP7 A;  1UWV A;  1EYD A;  1PZK D;  2F0J A;  1NY4 A;  3SK4 A;  4XQN A;  2HDL A;  3D31 A;  2B2W C;  5EPK A;  4WJW A;  2WAQ E;  2B8G A;  4OL7 A;  3FKI G;  1SR3 A;  1HR0 L;  2FHT A;  3PO3 G;  2F0F A;  4R4C A;  3I4L A;  3J80 L;  3G6E A;  1TS4 A;  2PI2 A;  1SN8 A;  5IGG A;  1A3U A;  5ELD A;  3S9W A;  1YNJ C;  1PDQ A;  4OIJ A;  3MXU A;  2CKZ B;  5J39 A;  3V05 A;  4DK3 C;  4F7X A;  2R7F A;  3I4M B;  5LMN W;  4JBJ A;  1Q8I A;  2ZM6 L;  4C3H G;  3S1Q B;  1YNN D;  2Z0S A;  1TII D;  4BBS B;  4ZAI A;  1K8M A;  5IGB A;  4Y7N B;  4LF5 L;  2ZXO A;  3NHH A;  3CCU A;  3EQL C;  1U4M A;  3K7A H;  2HQL A;  2SOB A;  1KC8 C;  4A3C G;  3NBH B;  1BQQ T;  2K1B A;  3NBI A;  1RHP A;  5M3F B;  2F4I A;  5M5W H;  1EY8 A;  4KHV A;  2R3Z A;  4BY1 G;  3RD4 A;  2KJX A;  2BOS A;  5CYU A;  5KIX A;  5EGT A;  2ENB A;  4ZKB B;  5I2Y A;  1O7I A;  1K8G A;  4O2D A;  1II3 A;  2CCZ A;  4FP5 D;  4OO1 I;  4C3J H;  5C4H A;  3S2D B;  1Q46 A;  3CME A;  2B2U A;  2TSS A;  4KK7 A;  4R4T A;  4O42 A;  4JI5 Q;  5ELC A;  1SNP A;  2WV6 D;  1FGU A;  4QUC A;  4IPG A;  1Y1V B;  2L11 A;  3E5S A;  2CFM A;  4JI1 L;  1Q86 C;  2Z8L A;  4IUR A;  1CHP D;  5GRO A;  5FJ8 G;  4YHH Q;  4LF8 Q;  2I07 B;  2KUM A;  2VXW A;  3OW7 A;  4JI7 Q;  4JBK A;  4JI8 Q;  5C4X G;  1I50 H;  1Q8K A;  4G4K A;  2CWA A;  3OWF A;  4KKT A;  2JA6 B;  5C44 B;  2CQO A;  1R9T B;  5COY A;  3K5M A;  1S5C D;  1AW7 A;  2NVQ H;  2HHH L;  2B2T A;  4GS3 A;  1O78 A;  1N36 L;  4DR5 Q;  3S17 B;  2WFW A;  4HJ5 A;  1KLG D;  2NVY H;  1UE5 A;  3HOY B;  1IBK L;  1TS5 A;  4DAY B;  4ULL A;  4GOP C;  4MN3 A;  3K8A A;  3CQZ B;  1L2F A;  3VA5 A;  1V9P A;  1PH5 A;  1LTA D;  4LFA L;  2EY6 A;  4JI3 Q;  1TWA B;  1BNZ A;  2M2L A;  4H13 C;  4ZCK A;  4R4Q A;  4NXM L;  3M3Y B;  4GLX A;  3S1R H;  2EYL A;  5FO7 B;  1SLJ A;  2O4X A;  1LT6 D;  2NVT H;  3J81 j;  3ONA B;  4AYB B;  2QIL A;  4JBM A;  1HNX Q;  4C2M B;  2VZA A;  2Z4I A;  1SRO A;  2N3S A;  5HUR A;  1C48 A;  4V19 0;  1IBM L;  1FNU A;  3VR3 A;  2P5Z X;  4X66 L;  3CCR A;  4K5W A;  3OMC A;  2L55 A;  1EQQ A;  5CV8 A;  5EKK A;  5EKL A;  4NB3 A;  1I6H H;  1EL0 A;  1FGB D;  2Y0S G;  3S14 H;  4XYQ A;  1RDP D;  2SEB D;  4G7Z C;  3A55 A;  1Y1W G;  2QW7 A;  1KAA A;  1QUQ A;  3TP5 A;  5L37 A;  1KD1 C;  1I94 Q;  1MKH A;  1FYC A;  4GN3 B;  2IX3 A;  3UDF A;  2L5T A;  2F3V A;  1GOZ A;  4C3I H;  1WYD A;  3A0J A;  2VUM G;  3E3X A;  1A8V A;  2XGT A;  4KD4 A;  4RGO S;  1D5Z C;  3RMH A;  4IJL A;  3TBI B;  4L5R C;  4Q5V A;  1SE4 A;  3S15 B;  4KI0 A;  3KK7 A;  1WOC A;  5ELO A;  2KBN A;  1J9O A;  1QCB D;  2F0T A;  4P2C B;  1HNW L;  1G2T A;  4K5V A;  3F2C A;  1SE8 A;  4PQX A;  4DV7 Q;  1SYB A;  2CVR A;  1ICF B;  5JEA G;  2J7Z A;  4PMC A;  4DV1 Q;  4WJ3 M;  1QWY A;  3CKI B;  3FPP A;  5IT9 L;  3ZJY C;  4CDC C;  5IYC G;  5I6Y A;  1S3O A;  3JAM c;  3J81 E;  1HNZ L;  1S4Z A;  2VQF L;  4DR7 Q;  1QG7 A;  2LS0 1;  3CC4 A;  5DNF A;  2MJ8 A;  2BA1 A;  3DEO A;  2SNS A;  4M8A A;  2ES2 A;  3LNN A;  4JOI A;  1PTO F;  1YJN A;  4PNY A;  3K5O A;  3A5Z B;  3UE1 A;  3D4D A;  5DM7 3;  4BBR H;  4LFB Q;  3STB C;  3ULP A;  2F0W A;  4JG2 A;  5M5W B;  4DR6 L;  1JJ2 A;  1TXY A;  1D5X C;  1R4P B;  4AIM A;  1KDA A;  2D5D A;  3UDG A;  5IOD A;  1D1I A;  1CQF A;  2EOT A;  3KLR A;  2FFK B;  4DR2 Q;  1E2Z A;  4QF4 A;  3S1M H;  1Z7T A;  1EIH A;  3P7J A;  1KTK A;  3IFT A;  1OXT A;  1X32 A;  4K5X A;  4C3J B;  4IFD I;  1JWU D;  4MHE A;  4L8J A;  4LUV A;  5CV9 A;  3BS1 A;  3HOW G;  4DK0 A;  4RKB A;  2O2L D;  4QMG A;  2I5L X;  3NWS A;  5M3M G;  2KCN A;  4KY5 A;  2Q2H A;  1DZ1 A;  4DV2 Q;  4A3M H;  1MSG A;  2RF4 A;  3MZ5 A;  4EX5 A;  5I4D A;  4DV5 L;  2E2H H;  2IHF A;  1NMF A;  5FOB B;  4K14 A;  1KHI A;  1I50 B;  2KED A;  3HOV H;  4RCO A;  4FF1 A;  3PCO B;  5IYB G;  5JPM C;  4A76 A;  1PH7 A;  2NVQ B;  4H7B A;  2QKI C;  1I94 L;  1JJG A;  2JA8 B;  1YNN C;  2F0H A;  1AN8 A;  3S2H B;  1L0W A;  2NVY B;  4X6A H;  3GTO H;  3GD7 A;  3PUV A;  4RG1 A;  2O5I C;  2IX0 A;  1G51 A;  2V1C C;  2A1A A;  3H91 A;  2MFI A;  1GUN A;  1T5E A;  4XT1 B;  1N9W A;  2RKS A;  3ERS X;  4XT3 B;  4CJ2 C;  1QUQ B;  1C8C A;  2MQH A;  4GN5 A;  3S1R B;  3S24 A;  1IHZ A;  4ID6 A;  1Q7Y C;  4WFN 3;  1MJE A;  3H3V I;  5I2X A;  4ZLT F;  3FMC A;  1F2Y A;  5JPN C;  2JN4 A;  1HHV A;  5LMU Q;  4PZ6 A;  4RH6 A;  2PMZ B;  4OGQ C;  4HR7 B;  4A3K G;  1LV9 A;  4AYB E;  4RWS C;  2VQE Q;  3OIP A;  3T13 A;  3PQI A;  1B3Q A;  1HTL D;  1UAP A;  2RSO A;  2PI2 E;  2RVL A;  3NPP A;  2D2C C;  2AHO B;  3CF5 A;  1SSO A;  3T1H L;  1R4Q B;  2A8V A;  4G7O C;  4WJ4 A;  4LUO A;  3HGB A;  5IYD G;  3M4O H;  3PIP A;  1HFN A;  4JC0 A;  1HZ9 A;  2IY5 B;  4K6L A;  5DAU A;  4FO2 A;  2F0K A;  3K58 A;  4N8F A;  3PGZ A;  1I6H B;  2QCP X;  3T16 A;  1ILQ A;  4DNR B;  3S14 B;  2IT1 A;  3A74 A;  1QE6 A;  1X3P A;  3CCV A;  1IW7 D;  4KHZ A;  2JA5 G;  1BDO A;  4C3I B;  1I4G A;  2AWO A;  1Y8O B;  2WAC A;  5BN4 A;  4YY3 Q;  4HJ9 A;  3WOF A;  2B2W A;  2UXB Q;  2WB1 G;  4A3J H;  4B3S L;  2RHS B;  4NMZ A;  2EYM A;  2R7Z B;  2EY5 A;  1IBL L;  2OTL A;  3FKI H;  1JE5 A;  2HUG A;  2K33 A;  1ENA A;  3PO3 H;  3M4Q A;  4K0K Q;  4LFC L;  2RCN A;  4DV3 Q;  5C0X G;  2WKC A;  4IUT A;  4X3T A;  1WCM H;  2B2T C;  4LF7 Q;  1JOQ A;  3J80 c;  3CPW A;  3GTK H;  1LTR D;  5K36 G;  4C3H H;  1YNJ D;  2F0O A;  3U4V A;  3AFQ A;  4ME5 A;  3VR5 A;  1E2V A;  2L4N A;  5A2Q L;  2JA7 B;  3PO2 H;  3NWT A;  2B2V A;  3WDN A;  2KCC A;  3SK6 A;  3MXP A;  3AMU A;  1HA6 A;  2OXP A;  5I6W A;  4LF9 Q;  1HR0 W;  4BBR B;  2H5X A;  1GO3 E;  2EDG A;  2K5H A;  3EJI A;  5IY0 A;  1G6Z A;  3AEV A;  3E0E A;  3H0G G;  3KYH C;  3BG3 A;  2E2D C;  3AB9 A;  1WD1 A;  2HD3 A;  4UDU C;  1B44 D;  2WKD A;  3S1M B;  4R8N A;  1DGS A;  4N9P A;  4FVM A;  4HED A;  4UHV A;  2K32 A;  5LMU L;  1UE7 A;  2X69 A;  2NVX B;  2K5N A;  2EYJ A;  3KUP A;  4HAE A;  3PUW A;  2JEB I;  1ONL A;  1Q81 C;  2IL8 A;  4A3M B;  1QB5 D;  2WAQ B;  5ELE A;  2CH4 W;  2K6A A;  1KXL A;  3SXH A;  3EFX D;  5C4X H;  1YJW A;  1W6K A;  3UI2 A;  3TN2 A;  5C6A A;  1WFQ A;  3I90 A;  3K0Y A;  3SVM A;  3K5L A;  4UAI A;  5JJK A;  4ZYS A;  4HJ8 A;  1F77 A;  2UXB L;  3JAM L;  2E5L L;  1F9R A;  2YV5 A;  3W1G A;  4HID A;  3GTO B;  1LTL A;  4HTH A;  4GLA C;  2OWO A;  1UEB A;  1QIL A;  1SEB D;  3HG9 A;  2UXD Q;  2K75 A;  2ICI A;  5KGU A;  2B39 A;  3CW2 C;  4A4I A;  4DV3 L;  4FXG C;  5EJW A;  1P8L A;  1EQR A;  2BH2 A;  1OO9 B;  2XWJ B;  2EY1 A;  2AUK A;  4A3E G;  2K04 A;  2UUA Q;  4POF A;  3DM3 A;  1EIF A;  3VYS A;  2SNM A;  5EKI A;  3T4A C;  5H1S E;  1LT5 D;  4YCV A;  5C5L A;  4EQ5 A;  2UUB Q;  1AZQ A;  1ZXT A;  2PMZ E;  2F0P A;  3O13 A;  1J5E L;  3F2D A;  1X3E A;  2EPB A;  3I91 A;  2KCT A;  1C9O A;  1I4P A;  5M5Y H;  3M4O B;  3R2I A;  3RN5 A;  1TU2 B;  4JVZ A;  2C5C A;  3SDZ A;  1PH8 A;  2E75 C;  1D6E C;  3TQY A;  4BWG B;  4EQN A;  1JCK B;  1EZ6 A;  1CTM A;  3A56 A;  4N9T A;  1O7L A;  2A69 D;  1CQV A;  1F2M A;  4B3T L;  4A3J B;  1EOV A;  1SBB B;  1QOH A;  2A68 C;  4MTN A;  1N34 Q;  4B9W A;  3FKI B;  1Y8P B;  5J22 A;  3GV3 A;  1WD0 A;  3HOU G;  5TSS A;  1ESR A;  2HQE A;  2SDF A;  3A8K E;  4A3L G;  1UEA B;  2VW9 A;  1WTV A;  1HZB A;  1XMO Q;  5JEA H;  3DLL A;  2A74 C;  1WCM B;  1CKN A;  3NEL A;  2JP1 A;  1EYA A;  1N33 Q;  1XTC D;  3NE5 B;  1L0Y B;  4C3H B;  3I4N G;  3BJU A;  3C2P A;  1W6J A;  4DFA A;  4A93 G;  2ZXP A;  3KDF B;  5D65 A;  5FLM G;  1QZH A;  4ALP A;  1VQL A;  1CHQ D;  2HCC A;  1MI2 A;  3PO2 B;  3TS0 A;  1L0X B;  2EZV A;  1AEX A;  4UP8 A;  4RCN A;  1EYC A;  4DV4 Q;  4G7H C;  1BBX C;  1L1O A;  4OX9 L;  1MHW C;  1F9S A;  4LF6 Q;  1MIU A;  4JI6 L;  1K9M C;  4Q0F A;  2HIX A;  1NMG A;  4DNT B;  2IW3 A;  5EBD A;  3T1Y L;  5IWA Q;  3CAM A;  1SYD A;  3STB D;  3HOX G;  3S1N H;  1OXV A;  1SYG A;  1PTO D;  5JJZ A;  3FDT A;  4B3R L;  4LAA A;  5JOB A;  2EYH A;  3RZO H;  2N78 A;  3CRK C;  5IGF A;  1VQ5 A;  3HOW H;  2IWH A;  1VQH A;  4A3I B;  3K5N A;  1HQR D;  1TS2 A;  2UUB L;  1G6P A;  5M3M H;  4KKS A;  2JE6 I;  1KIX A;  1PH1 A;  4E6I A;  4DUZ Q;  2Q8I B;  5BN5 A;  1HXY D;  1JMC A;  1GUG A;  1QJO A;  1GJX A;  2J4X A;  3F2B A;  4L5Q A;  2E2I H;  4C1N K;  4IOC A;  2JEA I;  1CZG A;  4IUV A;  1LT3 D;  1BBU A;  4XDX A;  4P75 A;  4FDB A;  4OO1 G;  1HQM C;  2PW5 A;  3M4Y A;  1VQM A;  4FF4 A;  3VYT A;  2I5H A;  2D9U A;  4B3M Q;  2C9O A;  3LX0 A;  3OHX C;  4AQY Q;  1N34 L;  1VQ8 A;  4OWW B;  4FF2 A;  2KOL A;  4RGM A;  4CKC A;  4HMI A;  1WTQ A;  1LLR D;  1TS3 A;  1STA A;  1QZG A;  2UXC L;  4X3U A;  1H9S A;  2R93 G;  1SYC A;  1TWF H;  5BR8 L;  4BA1 I;  1GUT A;  2AMC B;  1XPO A;  3DHQ A;  4K8I A;  1BO0 A;  2DJG C;  4KY7 A;  4KLK A;  3ULJ A;  2F1M A;  2B2V C;  5JVG 3;  4WRD A;  3TZU A;  1EY4 A;  1ILP A;  3R8B A;  5C3E G;  3VR2 A;  2YTY A;  2PNR C;  2A6E D;  2L0C A;  1JJC B;  3EN2 A;  3K81 C;  1PVO A;  1CKN B;  2CW0 C;  4KHP L;  1B50 A;  4X64 Q;  2ZTE A;  2V4D A;  3EA6 A;  4DR3 Q;  1CKM A;  3N52 A;  5IYD H;  4GLV B;  5M5Y B;  4WOR A;  4QCL A;  2OCE A;  3KLW A;  3EVQ A;  4ZK9 B;  2TMP A;  3Q24 A;  2JA5 H;  2PW7 A;  1JC7 A;  3KLS X;  2XRS D;  4RFB A;  3WWV A;  3DWP A;  4DF7 A;  2B3G A;  1PTO B;  5KEE A;  4F87 A;  1L1O B;  2QF7 A;  1YZ6 A;  4QGU A;  4ODG A;  5CBA E;  3ERO A;  4XQJ A;  1KAB A;  1GHK A;  1LAB A;  4R1J A;  2RA4 A;  4TVA B;  4J6H A;  1XNQ Q;  5C0X H;  3BDC A;  1PA6 A;  1IZ6 A;  4DUZ L;  4JI4 Q;  2JQO A;  1CZW A;  4QQB X;  1A63 A;  2M9V A;  5KYI A;  1T5X D;  2KEC A;  4FXD A;  3ER0 A;  2Q2U A;  3VR6 A;  3U9O A;  1EIY B;  3CCS A;  5DLQ E;  2NWG A;  3JC6 6;  1H9R A;  2EE1 A;  1VQ4 A;  2GN5 A;  3A7A B;  4MIU A;  4K8J A;  2K03 A;  1Y14 B;  4B3M L;  3V2T A;  4AQY L;  2K7V A;  1G91 A;  1PHJ A;  2MO0 A;  1TWC H;  4KY6 A;  2EY2 A;  1SYF A;  4S3S A;  3I4M G;  1A6X A;  3OMG A;  2BH8 A;  1SJE D;  4IO9 A;  1PH4 A;  1LTG D;  1XMQ Q;  4BBS G;  3S1N B;  3BVZ A;  3NQT A;  3U50 C;  2L12 A;  1KLU D;  1NJI C;  1B9N A;  3F2U A;  2ZTD A;  3RZO B;  4UP9 A;  2A69 C;  3HOW B;  4LF4 Q;  3JAM i;  1H9S B;  3I2Z A;  2HIV A;  3PUZ A;  3MAQ A;  2RDG A;  3VYR A;  5M3F G;  4A3G G;  4A3D G;  1BKB A;  4JPB W;  3EBE A;  3I7F A;  4DR3 L;  1LTS D;  1HZA A;  4DK6 C;  1FD7 D;  1PRT F;  3M7N A;  2F0V A;  2FMC A;  2EQS A;  2JA9 A;  5AFW A;  5IGC A;  1SE2 A;  2HCI A;  3IRB A;  4JI5 L;  4NW2 A;  1PMR A;  3A5U A;  2YU9 H;  1Q1E A;  5FLX E;  1WI5 A;  1SMX A;  1OXS C;  4H0L C;  3KF6 B;  2PPB C;  4FF3 A;  2N55 A;  2Q2T A;  1KNA A;  5ISR A;  4IFD G;  4LMQ D;  4C1N I;  1JB7 A;  3NTH A;  4PMW A;  1C7Y A;  4YHH L;  4LF8 L;  2E74 C;  1Y1V G;  5CV6 A;  3LGJ A;  4JI7 L;  5I9P A;  1HPC A;  2PYK A;  4JI8 L;  1VQJ A;  5FO9 B;  2OQ0 A;  1TT2 A;  2R61 A;  2WP8 J;  2F0G A;  3A8I E;  1TWF B;  2R92 H;  1RCV D;  4DV0 Q;  1JOK A;  4DR5 L;  2JA6 G;  3HP3 A;  3SE0 A;  5C44 G;  3L0O A;  1PLF A;  3K7A B;  3NEN A;  4Z9C B;  3DWA A;  3ND9 A;  1SNO A;  1IKL A;  1PYB A;  1HH2 P;  4OXP A;  2KCM A;  2N88 A;  5NUC A;  1PTO C;  3D6W A;  1L1O C;  4NPS A;  4DKA C;  2QDL A;  3E6Z X;  3PF4 A;  1X6O A;  4KJN A;  4JI3 L;  1XXG A;  3VDY A;  3K7U C;  1SNC A;  2RSN A;  2NBF A;  4HIK A;  1G8Z D;  5D3D A;  1Q82 C;  1AZP A;  4L5S A;  5CV7 A;  1UE1 A;  1B2T A;  1ASZ A;  4B9X A;  3HOZ G;  4JBW A;  1PH3 A;  1AE3 A;  1GUW A;  3C1F A;  1CFM A;  4ZUI A;  1HNX L;  4EVO A;  1X56 A;  3GTJ H;  2WII B;  3DUZ A;  2B63 H;  1BCP F;  1YHB A;  2LXK A;  2Y0S E;  1RKN A;  1I6V C;  3W1B A;  3TRZ A;  1C4Q A;  4BXX G;  4KKU A;  1TY0 A;  1N8R C;  4X3S A;  3OTO Q;  1WTP A;  3HOU H;  3HKS A;  2BE5 C;  5D3I B;  1I4X A;  4IUU A;  4EQP A;  1OXX K;  2MNA A;  1M8A A;  4R8I A;  4EQO A;  5FO8 B;  4BY7 H;  2A68 D;  1W2B A;  4XXE A;  4GN4 B;  3PF5 A;  3E9H A;  1JQY D;  3K57 A;  1DOK A;  1KDB A;  3T51 B;  1GKH A;  2F0Q A;  4A93 H;  2YYZ A;  3E0J A;  4QJF A;  1CK1 A;  4U67 3;  1NBW A;  5FLM H;  2L9H A;  5J1Z A;  1KRT A;  3IAY A;  3RLO A;  1EY6 A;  1V43 A;  1AP0 A;  4DN4 M;  1EEF D;  1HZC A;  1LYL A;  2JK8 A;  3TSS A;  4DV7 L;  2NN6 I;  1U9R A;  2BDO A;  2VS1 A;  3MFG A;  5C4J H;  2R6G A;  5LL6 S;  1C0A A;  4JI0 Q;  3J7A F;  2B2Y A;  5KYL A;  2CHB D;  4DV1 L;  3MWY W;  2A6E C;  3SEB A;  2NVT B;  2XRQ D;  4OIK A;  1D5M C;  3GDE A;  4NP5 A;  4OWT B;  2K5V A;  3F1Z A;  1Q90 A;  1VF5 C;  1UE6 A;  2F0L A;  2HDM A;  1TWC B;  5KNB A;  4IPD A;  4OEL B;  4DR7 L;  3QG1 A;  5IP7 H;  4CDD C;  4HCE A;  3HOX H;  4DV0 L;  3MHB A;  1Q1B A;  4J15 A;  5JAV A;  1STB A;  3P20 A;  2A5H A;  5ELN A;  1PYS B;  3LWU A;  4JV5 Q;  3J80 i;  3QIA A;  3DEP A;  2Z4H A;  3IFD A;  4LFB L;  3Q6S A;  1NUC A;  1RTO A;  2XSC A;  4B08 A;  4RA8 A;  3NTK A;  1DOL A;  1BUV T;  3CCE A;  4P74 A;  1VQP A;  3GTP H;  3QJY A;  1OTC A;  1D2B A;  1XX8 A;  4I7A A;  3U9S A;  5JJL A;  1V1P A;  2AQ2 B;  2QEX A;  3VYU A;  3MVV A;  4X65 Q;  4DR2 L;  5BN3 A;  5IOC A;  3UDI A;  2MPM A;  2K4K A;  2DJF C;  4EGV A;  2D0O A;  3UE0 A;  2XTI A;  3I8Z A;  1RTN A;  2YU9 B;  4LW1 A;  2MO1 A;  1I4Q A;  5ELB A;  1PH6 A;  4DR1 Q;  3W2D A;  3D6C A;  4RGT A;  1HA5 A;  4DV2 L;  1X3F A;  4HJ7 A;  3MXG A;  2Q8R E;  3I56 A;  1TQO A;  4YWK A;  3OTO L;  2K52 A;  1GUO A;  3Q0A A;  5EQ0 A;  1HUN A;  2R93 H;  2R92 B;  3J81 c;  4JYA Q;  1S5E D;  2EIF A;  1QVC A;  3MXN A;  4I7Z C;  2Q8T A;  3B6Y A;  4A3C H;  1K83 H;  4V0B A;  3T56 B;  2JA8 G;  5IT9 E;  1EY0 A;  4BY1 H;  4YCU A;  3MC0 B;  5M9O A;  1I4R A;  1VMP A;  3ICE A;  4RHR A;  1V8Q A;  1VQ9 A;  2ICE C;  4JI0 L;  1LO5 D;  5JVH 3;  4A3B G;  3PSI A;  2ASB A;  3KF8 A;  4P73 A;  1B3A A;  2DN8 A;  1F9P A;  2CW0 D;  2EYO A;  3GTJ B;  1DJR D;  1ROD A;  2PZU A;  3BYT B;  3HEJ A;  3RNU A;  2VQE L;  3KDF A;  2B63 B;  5LHY 1;  1B8A A;  3KLS A;  1TVX A;  3F8T A;  1SYE A;  5FJ8 H;  5GAE C;  3HRZ C;  5T1I A;  4JV5 L;  2PCF B;  2E2H B;  3R93 A;  5IE8 A;  3VR4 A;  1HUM A;  1AH9 A;  3HOV B;  2WB1 E;  1N32 Q;  3QWN A;  4LUZ A;  5AJ3 Q;  3CD6 A;  4JI2 Q;  4BY7 B;  1LT4 D;  5EPL A;  4YWM A;  2QDB A;  3GV6 A;  2MHV A;  5IIF A;  1O7Z A;  1NR4 A;  4YY3 L;  1K73 C;  4RGN A;  3GTL H;  1TR5 A;  3CP0 A;  4A93 B;  4C3I G;  5A35 A;  1DM0 B;  1STG A;  1PH2 A;  2PZT A;  1E22 A;  1S40 A;  5HY6 A;  5D14 A;  1EQV A;  1H9M A;  1V1P B;  5KNC A;  2R7Z G;  4K0K L;  3M7G A;  1PZI D;  5C4J B;  3M4P A;  3P75 A;  1E24 A;  4LF7 L;  4YWL A;  4HSP A;  3T53 B;  1FR3 A;  1CSP A;  2KVM A;  4R4I A;  4IUP A;  3ND8 A;  3V96 A;  3X3M A;  1U4R A;  4QY7 A;  2EYP A;  4DK1 A;  1ML0 D;  1TKW B;  3BVG A;  4CBV A;  3I55 A;  4Y7N H;  2XIW A;  2UU9 Q;  2JA7 G;  1SMY D;  3NP8 A;  1YEZ A;  4POG A;  1K0S A;  2HT1 A;  2PO4 A;  2ATW A;  2LKV A;  5F2D A;  1VQ6 A;  4LF9 L;  2F3I A;  3NUC A;  1A2U A;  2A6H C;  2LFN A;  3HKZ B;  3PV0 A;  2I0Q A;  2AWN A;  4GKJ Q;  3BDO A;  3W5O A;  3OPO A;  5GAG C;  3GTP B;  4L5T A;  5C3X A;  1IKM A;  4A3G H;  4A3D H;  3MXN B;  3TRE A;  1Y1W H;  2K5Q A;  2CQA A;  5FKA C;  4GKK Q;  1YIJ A;  2VUM H;  3R3O A;  1TY2 A;  1RIP A;  3OOC A;  2QEJ C;  2K5D A;  4PZ8 A;  4FXK C;  4FYD A;  1SNQ A;  3S2D H;  3PO3 B;  2E76 C;  1EFW A;  5DEH A;  3NEM A;  1SND A;  4DU9 A;  1HR0 Q;  4F8M A;  4IFD H;  2ZJP A;  1UUP A;  3D8G A;  4TKO B;  1DXM A;  4HIM A;  3KF8 B;  3OWE B;  3H94 A;  1Y1V H;  4RMF A;  3TP6 A;  4KJO A;  5C0X J;  3GTK B;  5IYC H;  5GQO A;  3ITP A;  5K5P A;  2WAQ G;  2CH4 A;  1STY A;  2DY8 A;  1J8I A;  1N32 L;  2FMM A;  1HFG A;  3PUY A;  5AJ3 L;  2ZM6 Q;  1PFB A;  2JA6 H;  1EFI D;  3OW2 A;  1A0I A;  3NSW A;  3J7Y W;  5E4W C;  1EU3 A;  1K83 B;  1AFP A;  1E1T A;  2B2Y C;  1W3S A;  3IKJ A;  3D4R A;  2K28 A;  5ELF A;  3A8J E;  4BY1 B;  2YTX A;  3BDL A;  1LAC A;  2UXD L;  3ERQ A;  2Z9H A;  2LXJ A;  2PNH A;  3CQZ H;  1YNX A;  2Z6K A;  1FJG Q;  2NZH A;  5A2Q E;  1FNV A;  4QL5 A;  1NAP A;  2F52 A;  4RAU C;  3M3Y H;  1B9M A;  1M90 C;  2EJF C;  3HOZ H;  2F0S A;  2PQA B;  1ET6 A;  1U4P A;  4UP7 A;  2UUA L;  1NCV A;  1VQ7 A;  1JB3 A;  1H9K A;  3GTQ H;  3H3V H;  3I4O A;  3Q8D A;  1DD2 A;  4BXX H;  1PH9 A;  1SFO H;  2N49 A;  1O7Y A;  2FJ2 A;  4DGZ A;  3NK9 A;  4JI1 Q;  5E7N A;  4GKJ L;  5C4X B;  2KHI A;  2E8G A;  5IYB H;  4X62 Q;  2NUC A;  1AE2 A;  4KN7 C;  1ZEQ X;  5FLX L;  2AQ3 B;  1EIG A;  4RKL A;  4DXG A;  4A75 A;  3L7Z C;  1BCP D;  4CGY B;  1FL0 A;  4GKK L;  2BE5 D;  2HHH Q;  4A3F G;  4IZ8 A;  1N36 Q;  3GTL B;  3GO5 A;  4IPC A;  1HTP A;  4O0A A;  3J81 L;  1IBK Q;  5HGQ A;  4A3J G;  3GTM H;  4LNQ A;  4L6T B;  1HCZ A;  3S15 H;  1LUZ A;  2F03 A;  5KND A;  4IUN A;  1TWG H;  2JSO A;  4IQZ A;  3RR5 A;  1XMO L;  4LFA Q;  5EAY A;  2OQK A;  3SK5 A;  4P72 A;  1LM0 A;  2NTS A;  4NXM Q;  1N33 L;  1E0B A;  4CKE A;  1EEI D;  1PRT B;  3JAM E;  4JW0 A;  1WCM G;  1PV4 A;  4KD3 A;  4HCS A;  2F3W A;  3CC7 A;  1VQE A;  1H9J A;  2KHJ A;  4A3K H;  2A19 A;  2D0P A;  3BZC A;  2MP1 A;  1XNR Q;  3J7A V;  4XQQ A;  1VQB A;  4NXN Q;  1K3R A;  3KF6 A;  1TWH H;  1WTH A;  3PO2 G;  1E2W A; 
#chains in the Genus database with same CATH homology
 1IBM Q;  4K0K Q;  1IYJ B;  1VQI A;  4DV4 L;  3L0O A;  2RCN A;  1GD7 A;  4LFC L;  3NEN A;  4X66 Q;  4DV3 Q;  3M85 A;  5C0X G;  1ASY A;  4LF6 L;  1WCM H;  3CCL A;  4LF7 Q;  1PYB A;  3J80 c;  3CPW A;  3KJO A;  1HH2 P;  3HKZ E;  4OXP A;  1FJG L;  2KCM A;  3GTK H;  1RL2 A;  2B63 G;  4PZ7 A;  5IWA L;  5K36 G;  4DR4 Q;  3KJP A;  1L1O C;  4NPS A;  4C3H H;  4DKA C;  3PF4 A;  1BVS A;  1X6O A;  2VL6 A;  2ZJR A;  4A3M G;  3CPF A;  1MJC A;  3AFQ A;  4JI3 L;  3U4V A;  3VDY A;  3K7U C;  4DV6 Q;  4HIK A;  2YTV A;  4JI2 L;  3HOV G;  1Q82 C;  4L5S A;  3PO2 H;  2UXC Q;  1UE1 A;  3TEH B;  5C44 H;  1ASZ A;  1R9T H;  3HOZ G;  1D8L A;  4JBW A;  1PH3 A;  1AE3 A;  4PG3 A;  5BR8 Q;  4IJH A;  1U0L A;  4LF5 Q;  1HNX L;  1VS0 A;  4LF9 Q;  4BY7 G;  3OYY A;  1HR0 W;  3K0X A;  3FP9 A;  1HNW Q;  3GTJ H;  1X56 A;  2H5X A;  4A3I G;  4HJA A;  1GO3 E;  2K5H A;  3S17 H;  1XPU A;  5IY0 A;  1XTD A;  1XPR A;  2B63 H;  3EIV A;  3AEV A;  3HOY H;  1YHB A;  3E0E A;  2LXK A;  3H0G G;  3KYH C;  2QGQ A;  2Y0S E;  5J3B A;  3CCJ A;  3W1B A;  3TRZ A;  5IT9 c;  4BXX G;  1CUK A;  1V1Q A;  2B29 A;  4X62 L;  1YVC A;  2DGY A;  1GM5 A;  1N8R C;  1HNZ Q;  3RN2 A;  3OTO Q;  4HIO A;  3HOU H;  3KFU A;  2VQF Q;  2JJQ A;  1YI2 A;  1DGS A;  1X65 A;  4GNX A;  3HKS A;  1TWA H;  4KHP Q;  1OXX K;  2MNA A;  5LMU L;  1UE7 A;  3KOJ A;  2K5N A;  4BY7 H;  1W2B A;  2JA8 H;  1WJJ A;  4GN4 B;  3PF5 A;  2ID0 A;  1VQA A;  3E9H A;  3PUW A;  2LSS A;  3SGI A;  3S2H H;  2JEB I;  4ME3 A;  1Q81 C;  3J7Z C;  4H02 A;  3L2P A;  4UPA A;  1S72 A;  4C2M H;  3AYH B;  3H0G H;  5IP7 G;  4DPG A;  3PIO A;  1VQN A;  1GKH A;  2K50 A;  2UU9 L;  4A93 H;  2YYZ A;  4QJF A;  1T9H A;  1KXL A;  4DR6 Q;  1NBW A;  4OWX B;  5FLM H;  5IP9 H;  4IOA A;  1YBY A;  1KRT A;  4Y52 H;  5C4X H;  3RLO A;  4GOP B;  1YJW A;  4A3B H;  1V43 A;  1HZC A;  1LYL A;  2JK8 A;  2R7D A;  4DV7 L;  2NN6 I;  2VS1 A;  5C4J H;  1WFQ A;  2R6G A;  4DUY L;  3HKZ G;  4DAM A;  4JI0 Q;  1C0A A;  5JJK A;  4DV1 L;  1I5F A;  1UWV A;  4HJ8 A;  3GDE A;  4OWT B;  2K5V A;  1U5K A;  3F1Z A;  4A3G H;  2UXB L;  1UE6 A;  1NY4 A;  2E5L L;  2YV5 A;  3W1G A;  4DR5 L;  4HID A;  1XNR L;  4IPD A;  1LTL A;  4DR7 L;  5IP7 H;  4GLA C;  4NXN L;  5LMN Q;  3D31 A;  2OWO A;  1UEB A;  4X64 L;  3HOX H;  4DV0 L;  2UXD Q;  1OXU A;  2K75 A;  1Q1B A;  4J15 A;  2WAQ E;  3CW2 C;  1IXR A;  5ELN A;  4A4I A;  4DV3 L;  1PYS B;  4DV5 Q;  3FKI G;  3J80 i;  4JV5 Q;  1SR3 A;  1P8L A;  1EQR A;  1HR0 L;  3AQQ A;  3PO3 G;  4R4C A;  2BH2 A;  3G6E A;  4LFB L;  2PI2 A;  1SN8 A;  1VCI A;  3CCE A;  4DR4 L;  3CC2 A;  4P74 A;  1VQP A;  3GTP H;  4A3E G;  1OTC A;  2CKZ B;  2UUA Q;  4YCW A;  4POF A;  3DM3 A;  4OON A;  1EIF A;  4DK3 C;  5JJL A;  2R7F A;  2QEX A;  5GAH C;  4DV6 L;  1K0R A;  5H1S E;  4YCV A;  4X65 Q;  1EUJ A;  5LMN W;  3CMA A;  2GVB A;  1X55 A;  4EQ5 A;  4DR2 L;  4JBJ A;  2UUB Q;  2ZM6 L;  2Z0S A;  3UDI A;  2K4K A;  2PMZ E;  2R7Z H;  1VQF A;  1J5E L;  2OTJ A;  3U4Z A;  3F2D A;  1XNQ L;  1X3E A;  2D0O A;  4LF5 L;  3UE0 A;  2XTI A;  3CCU A;  2KCT A;  1C9O A;  5M5Y H;  4JI4 L;  4LW1 A;  3RN5 A;  2MO1 A;  1VQK A;  3K7A H;  2HQL A;  3MEF A;  4APV A;  1KC8 C;  4A3C G;  3NBH B;  1PH6 A;  1QVF A;  4DR1 Q;  4A3E H;  1PH8 A;  4DV2 L;  3TQY A;  1X3F A;  5M5W H;  4HJ7 A;  4BY1 G;  4JCV E;  3HOY G;  3I56 A;  4YWK A;  3OTO L;  2UUC Q;  1YHQ A;  4B3T L;  2K52 A;  1EOV A;  3CXC A;  2JA7 H;  2D62 A;  1N34 Q;  3I4N G;  4MTN A;  2R93 H;  1O7I A;  1K8G A;  2Z6K C;  4O2D A;  3J81 c;  2CCZ A;  1EYG A;  4JYA Q;  3HOU G;  4OO1 I;  2F4V Q;  4C3J H;  2EIF A;  1QVC A;  4A3L G;  1Q46 A;  4MZ9 A;  3TS2 A;  3CME A;  2VW9 A;  4R4O A;  4TQU S;  4R4T A;  3B6Y A;  5M5X H;  4A3C H;  1HZB A;  3T1H Q;  1K83 H;  1XMO Q;  4JI5 Q;  2NN6 G;  3DLL A;  4GNX B;  2JA8 G;  1CKN A;  3NEL A;  1FGU A;  4AYB G;  4IPG A;  3HFZ B;  4XIG S;  1N33 Q;  4BY1 H;  1NTG A;  1XMQ L;  1D7Q A;  1E3P A;  2CFM A;  4JI1 L;  3BJU A;  3FHW A;  4YCU A;  1Q86 C;  1IL2 A;  5FJ8 G;  5GRO A;  4LF8 Q;  4YHH Q;  3S16 H;  3K80 C;  4A93 G;  3ICE A;  1VQ9 A;  3KDF B;  5FLM G;  1QZH A;  3ULL A;  5IP9 G;  4ALP A;  1VQL A;  4JI7 Q;  4JI0 L;  4JBK A;  4JI8 Q;  3U58 A;  5C4X G;  1I50 H;  1Q8K A;  4A3B G;  3PSI A;  2ASB A;  4LF4 L;  3D0F A;  4B3S Q;  2CWA A;  3TS0 A;  4A3L H;  2CQO A;  4P73 A;  1IBL Q;  2NVX H;  2NVQ H;  2E2J H;  2HHH L;  3H15 A;  4GS3 A;  1N36 L;  2IHE A;  4UP8 A;  4DR5 Q;  5LMN L;  4DV4 Q;  2WFW A;  4LFC Q;  2IX1 A;  4HJ5 A;  3RNU A;  1L1O A;  3KDF A;  2NVY H;  1UE5 A;  2VQE L;  4OX9 L;  1IBK L;  1B8A A;  4LF6 Q;  4DAY B;  1H95 A;  1MIU A;  4JI6 L;  1K9M C;  3BU2 A;  3I4N H;  2HIX A;  3F8T A;  4GOP C;  5FJ8 H;  3AFP A;  5GAE C;  1NMG A;  1I3Q H;  3K8A A;  4JV5 L;  1L2F A;  1HJP A;  3T1Y L;  5IWA Q;  2ZJQ A;  3CAM A;  3STB D;  4DNI A;  3HOX G;  3S1N H;  1OXV A;  5IE8 A;  1V9P A;  3CCQ A;  1PH5 A;  4LFA L;  1AH9 A;  4JI3 Q;  1BBW A;  2WB1 E;  1VQO A;  4B3R L;  4NXM L;  1N32 Q;  4R4Q A;  1X9N A;  4GLX A;  3S1R H;  4LUZ A;  5AJ3 Q;  3RZO H;  2N78 A;  3CD6 A;  1SLJ A;  4JI2 Q;  1VQ5 A;  2NVT H;  3HOW H;  3J81 j;  1VQH A;  1J6Q A;  4YWM A;  2UUB L;  4JBM A;  1Z47 A;  3RZD H;  1G6P A;  5M3M H;  4YY3 L;  1K73 C;  1HNX Q;  2JE6 I;  3GTL H;  2VZA A;  1KIX A;  1PH1 A;  4DUZ Q;  3CP0 A;  2N8N A;  1SRO A;  1JMC A;  2N3S A;  5JJI A;  3PUX A;  1PH2 A;  1FVI A;  1E22 A;  1S40 A;  5HY6 A;  1A62 A;  3F2B A;  4L5Q A;  4P71 A;  1IBM L;  2E2I H;  2R7Z G;  4K0K L;  1JT8 A;  4IOC A;  4X66 L;  2JEA I;  3CCR A;  3M4P A;  3CCM A;  1E24 A;  1BBU A;  4LF7 L;  4P75 A;  4FDB A;  4YWL A;  1EQQ A;  1M1K C;  2I5M X;  4OO1 G;  1CSP A;  1YJ9 A;  4R4I A;  1I6H H;  4NB3 A;  2UUC L;  1VQM A;  2Y0S G;  3S14 H;  2I5H A;  4QY7 A;  1Y1W G;  4B3M Q;  3J81 i;  1QUQ A;  4AQY Q;  1N34 L;  1KD1 C;  1I94 Q;  1VQ8 A;  1MKH A;  4GN3 B;  3UDF A;  4C3I H;  4OWW B;  1WYD A;  3A0J A;  2VUM G;  2F4V L;  1A8V A;  2C35 B;  2XGT A;  3I55 A;  1QZG A;  2RHQ B;  4IJL A;  2UXC L;  1SRU A;  4Y7N H;  2UU9 Q;  1NE3 A;  2L15 A;  4L5R C;  2JA7 G;  1YEZ A;  2R93 G;  4POG A;  2HT1 A;  1TWF H;  4KI0 A;  5BR8 L;  4BA1 I;  1WOC A;  2ATW A;  5ELO A;  4LF9 L;  1VQ6 A;  2AMC B;  2KBN A;  2F3I A;  1XPO A;  1G29 1;  1KRS A;  3PV0 A;  2AWN A;  2I0Q A;  4GKJ Q;  1HNW L;  3W5O A;  3F2C A;  4KLK A;  1SE8 A;  3ULJ A;  2Q2I A;  5GAG C;  3J7A 5;  4DV7 Q;  4L5T A;  5GAD C;  2AKW B;  2VY3 A;  5JEA G;  4A3F H;  4DV1 Q;  5FLX c;  4A3D H;  2K14 A;  1CKO A;  3MXN B;  3TRE A;  1Y1W H;  4WJ3 M;  3ZJY C;  5C3E G;  2YTY A;  4XTC S;  5IYC G;  4IFD J;  4GKK Q;  2E5L Q;  1S3O A;  3JAM c;  1HNZ L;  1YIJ A;  2VUM H;  2VQF L;  4IPH A;  3K81 C;  1JJC B;  1VQC A;  3EN2 A;  5JEA J;  2QA4 A;  1CKN B;  1RIP A;  4DR7 Q;  1KQS A;  4PZ8 A;  4KHP L;  4X64 Q;  2ZTE A;  3CC4 A;  2BA0 A;  4DR3 Q;  2BA1 A;  4BA2 I;  1CKM A;  5IYD H;  4GLV B;  3S2D H;  2ES2 A;  1X54 A;  1EFW A;  4GNX C;  3GTG H;  4JOI A;  1B70 B;  1YJN A;  3NEM A;  1HR0 Q;  2OCE A;  3KLW A;  3A5Z B;  3UE1 A;  2ZJP A;  4LFB Q;  4BBR H;  4HIM A;  3STB C;  3KF8 B;  3ULP A;  3G48 A;  1Y1V H;  4JG2 A;  2JA5 H;  4RMF A;  5C3E H;  4DR6 L;  5C0X J;  1JJ2 A;  1TXY A;  4AIM A;  5IYC H;  5GQO A;  1Z9F A;  1CSQ A;  3WWV A;  2WAQ G;  4AH6 A;  3UDG A;  1N32 L;  2B3G A;  4QIW E;  1L1O B;  3PUY A;  5AJ3 L;  1YHA A;  4DR2 Q;  2ZM6 Q;  1YZ6 A;  4QGU A;  3S1M H;  2VNU D;  1E7Z A;  2JA6 H;  4R1J A;  1J5E Q;  4IFD I;  3OW2 A;  1A0I A;  4TVA B;  3RLF A;  3UDX A;  1XNQ Q;  4LUV A;  1PA6 A;  1PFS A;  1IZ6 A;  4DUZ L;  4JI4 Q;  1E1T A;  1YIT A;  3HOW G;  1W3S A;  1P16 A;  2JQO A;  4QQB X;  1A63 A;  2I5L X;  2YTX A;  5M3M G;  2UXD L;  2Q2H A;  3ER0 A;  4DV2 Q;  4A3M H;  2RF4 A;  2LXJ A;  2Q2U A;  2PNH A;  3CQZ H;  1YNX A;  2Z6K A;  4EX5 A;  1KL9 A;  1FJG Q;  3M9B A;  2NZH A;  4DV5 L;  2IHF A;  3G4S A;  2E2H H;  1K8A C;  3CCS A;  1NMF A;  5DLQ E;  4QL5 A;  1EIY B;  3JC6 6;  4B3T Q;  1KHI A;  2FXQ A;  3HOV H;  2F52 A;  3PCO B;  5C0X I;  2DUD A;  5IYB G;  1VQ4 A;  2GN5 A;  3M3Y H;  2NZO A;  2ALY B;  1M90 C;  3HOZ H;  2PQA B;  4A76 A;  1PH7 A;  4MNO A;  4UP7 A;  1E1O A;  2UUA L;  1Y14 B;  4B3M L;  1VQ7 A;  1I94 L;  4AQY L;  4A3I H;  3GTQ H;  1JJG A;  1PHJ A;  3BZK A;  4X65 L;  2MO0 A;  3H3V H;  1L0W A;  3I4O A;  1QVG A;  4X6A H;  1TWC H;  3GTO H;  3GD7 A;  3PUV A;  4RG1 A;  2IX0 A;  1G51 A;  3Q8D A;  3I4M G;  4BXX H;  2V1C C;  2A1A A;  1KAW A;  4IO9 A;  2BH8 A;  1PH4 A;  1PH9 A;  2EXD A;  1SFO H;  2N49 A;  1XMQ Q;  2PQA A;  2KEN A;  1X3G A;  2MFI A;  4BBS G;  1N9W A;  5E7N A;  4JI1 Q;  3U50 C;  4GKJ L;  3ERS X;  1QUQ B;  2KHI A;  2E8G A;  5IYB H;  2MQH A;  4GN5 A;  4X62 Q;  1NJI C;  1AE2 A;  3S24 A;  2ZTD A;  4DR1 L;  1Q7Y C;  4UP9 A;  1MJE A;  3H3V I;  4LF4 Q;  4A75 A;  3JAM i;  3L7Z C;  1FL0 A;  3I2Z A;  4GKK L;  5LMU Q;  1GVP A;  4PZ6 A;  1VQG A;  2HIV A;  3PUZ A;  2HHH Q;  4GOP A;  4A3F G;  1N36 Q;  5M3F G;  4A3G G;  4A3D G;  3GO5 A;  1PVO A;  2GVA A;  3RLN A;  3I4M H;  1BKB A;  4A3K G;  4AYB E;  3EBE A;  4IPC A;  3I7F A;  4O0A A;  2VQE Q;  4DR3 L;  1HZA A;  1IBK Q;  4DK6 C;  4OX9 Q;  5HGQ A;  4A3J G;  4UY8 C;  3M7N A;  3S1Q H;  3GTM H;  4JI6 Q;  4LNQ A;  4BBS H;  2EQS A;  2JA9 A;  4LWC A;  2PI2 E;  3S15 H;  1LUZ A;  3IRB A;  3T1Y Q;  2R92 G;  2AHO B;  3CF5 A;  1TWG H;  3RR5 A;  3T1H L;  4JI5 L;  1XMO L;  2A8V A;  4WJ4 A;  4LUO A;  2CWP A;  5IYD G;  3A5U A;  2YU9 H;  1Q1E A;  4LFA Q;  3PIP A;  1WI5 A;  5EAY A;  3M4O H;  1SMX A;  2OQK A;  4JC0 A;  1HZ9 A;  1OXS C;  4P72 A;  4B3R Q;  1LM0 A;  3KF6 B;  4NXM Q;  4JOI C;  1N33 L;  2IY5 B;  3PGZ A;  1Q12 A;  2Q2T A;  1VQD A;  1XJV A;  4IFD G;  2IT1 A;  3A74 A;  1WCM G;  4DUY Q;  1JB7 A;  1PV4 A;  4BBR G;  4PMW A;  1C7Y A;  4YHH L;  5M3F H;  4LF8 L;  3CCV A;  4KHZ A;  1Y1V G;  2JA5 G;  3CC7 A;  1VQE A;  3LGJ A;  2KHJ A;  4A3K H;  2A19 A;  2D0P A;  2AWO A;  3BZC A;  4JI7 L;  4HJ9 A;  4YY3 Q;  1EWI A;  2UXB Q;  4JI8 L;  4JYA L;  1VQJ A;  2WB1 G;  2OQ0 A;  4A3J H;  1XNR Q;  2WP8 J;  2RHS B;  4B3S L;  1VQB A;  1B7Y B;  4NXN Q;  1IBL L;  1K3R A;  3KF6 A;  2OTL A;  1JE5 A;  1TWH H;  3FKI H;  3G71 A;  2R92 H;  2ZTC A;  3E9I A;  4DV0 Q;  3PO2 G;  3PO3 H;  3M4Q A;  2JA6 G;  1OXT A;  5C44 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...