3M4OH

Rna polymerase ii elongation complex b
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
145
structure length
133
Chain Sequence
b'SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title X-ray structure and mechanism of RNA polymerase II stalled at an antineoplastic monofunctional platinum-DNA adduct.
pubmed doi rcsb
molecule tags Transferase/dna-rna hybrid
total genus 15
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2010-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3m4oH00
1X55A 5M3MG 1A8VA 3CCLA 1VCIA 4JI0L 3M3YH 1UE6A 2EXDA 1YHBA 3IRBA 4LFBQ 2DGYA 5LMUL 1JJGA 4B3RQ 2PQAB 1PH3A 2OTLA 4UPAA 1Y1VH 5IYBH 4IJHA 3HOXG 3CPWA 4JI2Q 1CUKA 2L15A 5C4JH 2K14A 5M5XH 3CCEA 1PH1A 1S3OA 3AQQA 1W3SA 2RCNA 3WWVA 3L0OA 3TS2A 3CCQA 4KLKA 3ULLA 3J7ZC 1D7QA 1QVCA 5BR8Q 2RHQB 4DUYQ 4LF8L 4JI5L 3FKIH 5IP9H 5IWAQ 1QVGA 4JBJA 3K7AH 4DR5Q 1KIXA 3AFPA 1X54A 1QZGA 1YJWA 2VZAA 4BY1H 4A3GH 2A19A 1Q46A 3FP9A 4QIWE 2ALYB 1I5FA 4P72A 1XMOQ 1Q7YC 2I5MX 4A3EG 2XTIA 3ER0A 4A3MG 2OQKA 2NZHA 5JEAG 2UUCQ 4NXML 1JT8A 3GDEA 1FL0A 5DLQE 4GN5A 4A93G 1N32L 2ZTEA 1Y1WH 3F2BA 3D0FA 5GAHC 2EIFA 4PZ7A 1SE8A 4DK3C 1PH5A 2NN6I 1VQNA 4BA2I 1VQLA 1Q8KA 2K75A 2YYZA 4C3IH 5IY0A 4POFA 4HJ8A 4A3BG 2QEXA 3BZCA 4C2MH 4LF4Q 4JOIC 1AH9A 1A62A 4YHHL 4DV0Q 4GOPB 2NVQH 3RN2A 4X6AH 5HGQA 4DR2Q 3S2DH 3PUVA 2YTVA 4O2DA 1R9TH 4HJAA 4K0KL 2N8NA 1PVOA 2JA5G 3F8TA 1N34Q 3M9BA 1PA6A 4B3SQ 1QZHA 1J6QA 3I4OA 4BA1I 1M1KC 1HNXQ 3M4OH 1WFQA 2D0OA 4OONA 1PH8A 2HHHL 1Q82C 3CC2A 3CC7A 4IFDG 2UXCL 4DV7Q 1O7IA 2ZTCA 4BBRH 5GQOA 1KRSA 3T1YQ 1H95A 2ID0A 3NENA 1E1OA 1OXUA 4DV6Q 4JI4Q 3S1RH 1N33L 4C3HH 2JA9A 5M3MH 4Y52H 3AFQA 1X3EA 4UP8A 1XPRA 4LF6L 2CFMA 3KJOA 1YITA 2GVBA 1L1OA 1NE3A 1DGSA 1BBUA 4R4OA 3ULPA 2WP8J 4LUVA 4DKAC 1HNZQ 3S17H 3HOXH 4BXXG 4JI8Q 1HH2P 5LMNQ 2UUBQ 3J7A5 5J3BA 1UE1A 2HIVA 2KHJA 2EQSA 3KLWA 5GADC 4JBMA 1XNQL 3L7ZC 3H3VI 3I4MG 4GN4B 1J5EQ 3F1ZA 1WCMG 5M3FG 1BBWA 3GTQH 1WYDA 2CCZA 3S1NH 4BY7G 1PH9A 1HJPA 4A3DG 3E0EA 2VS1A 1VQ7A 1JE5A 2JA6G 1B8AA 4PG3A 1NJIC 1KAWA 4YCUA 3PO2G 3OW2A 2R7DA 4DR6Q 5FLMG 4WJ4A 1G6PA 2OTJA 4A3EH 3G48A 3PSIA 2PQAA 2Z6KA 3H15A 1XJVA 4LF7L 4A3CG 3UDIA 4DR1L 1RIPA 1B7YB 2VQFL 4UY8C 2R7ZG 1K0RA 1JMCA 1VQJA 2R92G 4DV5Q 1EIYB 4LUZA 1X3FA 2IHEA 3PUYA 5E7NA 3CMEA 4DUZL 3K81C 4A93H 4KHPQ 2K4KA 2Q2IA 3ERSX 1EWIA 3HOYG 1N8RC 2Y0SG 4JI6L 2UXDL 2IY5B 1YIJA 4DV2Q 4GKJL 4DR4L 1XNRL 4JV5L 1VQFA 4PMWA 4B3TL 4R4TA 4A3BH 4X62L 3J81i 3CCJA 2JA7G 5JEAJ 1OXXK 2JJQA 4TQUS 1KQSA 1BVSA 4HJ5A 1MIUA 2YV5A 4QGUA 2ZM6Q 4GKKQ 1SR3A 1PH2A 1OXVA 4A76A 2VQEQ 4DR7L 2E2HH 2YTYA 2JA5H 3HKZE 1TWAH 2F4VQ 2AMCB 3E9HA 1VQHA 3KF6A 3GTJH 1SROA 5JJLA 2Q2UA 2VNUD 1LTLA 3A5UA 4QJFA 4IJLA 1HNWL 2AWOA 1I94L 2OWOA 5LMUQ 2KENA 5JJIA 3CAMA 1SRUA 3M85A 1CKOA 2BA1A 2HT1A 2R93G 4HIKA 3RNUA 2XGTA 5IYDG 2I5HA 4JCVE 3RLNA 3MXNB 4GOPA 3STBD 1Z47A 4DV1L 4LF9Q 4BXXH 4IFDI 4EQ5A 3GD7A 1A0IA 2B3GA 3M4PA 2E5LL 1W2BA 3I4MH 3PO3G 1X56A 4LF8Q 4JI5Q 4NB3A 1SFOH 3KDFA 1WCMH 2ZTDA 5M3FH 4BY7H 1SMXA 3J81c 1YBYA 3AYHB 4YY3L 1PYSB 1VQ5A 3S24A 3BU2A 3J81j 4RG1A 4TVAB 3KJPA 4A3DH 4H02A 5C4XG 2GN5A 4LW1A 2JA6H 3RR5A 3CXCA 1CSPA 1IBML 2VL6A 3HOZH 3PO2H 5IWAL 4QY7A 2NVXH 4LFAL 4GLVB 1YNXA 1YVCA 5FLMH 3G71A 1IBLL 4HIDA 4NXMQ 4A3CH 3CW2C 2FXQA 1VQGA 3STBC 3EN2A 2NVYH 3PF4A 5ELNA 2R7ZH 3HOWG 4GNXA 2WAQG 4GS3A 2R92H 5GAEC 4EX5A 2B29A 1VQPA 3F2DA 2UUCL 1Q12A 3HOUG 1KXLA 3HFZB 3HOYH 2VY3A 2D0PA 5IP7G 3Q8DA 2QGQA 1FJGL 3G4SA 4JI3Q 5M5YH 3CD6A 4OX9L 4MTNA 4DNIA 1VQMA 2A1AA 4J15A 3J80i 4DAMA 1TWCH 5FLXc 4MNOA 4X64L 1TWFH 1GKHA 3ULJA 3ZJYC 3M7NA 3NBHB 1E3PA 2JA7H 1VQDA 3K80C 4C3JH 3JAMi 1Z9FA 4A75A 2UU9L 4LNQA 4LF4L 2MQHA 3S2HH 5IYCH 4DV3Q 1C0AA 2BH2A 1I3QH 3TQYA 3H3VH 1PHJA 4DR3L 4LFCQ 2HHHQ 4GLAC 2Z0SA 1L1OC 4IPDA 1IXRA 4YCVA 5IT9c 2H5XA 2MNAA 1KC8C 3S1QH 2UXCQ 1EYGA 2I5LX 4JBWA 4JI1Q 3RLFA 3OTOL 4JOIA 4P71A 2KCTA 2E2JH 2E8GA 3TS0A 1HR0W 1HZCA 1HNXL 4JYAL 1JB7A 4LF6Q 1A63A 4ALPA 1VQAA 3CCRA 4A3KG 4UP9A 1HR0L 1TWGH 1Q1BA 1U0LA 5GROA 1C7YA 2NVTH 2R93H 3PIPA 5IYDH 4OO1G 4A3LG 1I6HH 3W1GA 1CKNA 4X66L 2QA4A 1XNQQ 1SLJA 3S1MH 3HKSA 1L2FA 1GD7A 4KHZA 4NXNL 4JC0A 3J80c 4MZ9A 4YCWA 4JG2A 4X65L 3VDYA 2BH8A 3PO3H 4JI8L 1K8AC 2UUBL 5C0XI 2Z6KC 4OXPA 1MJEA 2K52A 4K0KQ 1G51A 1VQCA 2IHFA 1WOCA 3JAMc 5IE8A 1J5EL 1AE2A 1Q1EA 2WB1E 4R4CA 2F52A 4R4IA 5IP9G 4AQYL 1UWVA 4A3MH 3GTGH 4B3MQ 4AIMA 4LUOA 3T1HL 4LF5L 4LF7Q 4AYBG 1YI2A 3DM3A 1IBKL 4DR1Q 2JE6I 2VQFQ 1S72A 5M5WH 2R6GA 4ME3A 5ELOA 1NBWA 2LXJA 3AEVA 3A74A 4DPGA 5C3EG 2OQ0A 3CPFA 4OWWB 1VQBA 3G6EA 3HOWH 1UE5A 1NMFA 2GVAA 2OCEA 4L5TA 4JI6Q 2UXDQ 3U4VA 3GTPH 3PUZA 1N36L 3ICEA 5JJKA 1V1QA 1XNRQ 3HOUH 2DUDA 2PI2E 5AJ3L 1YEZA 4A3JG 2WFWA 1K8GA 2IX1A 1GO3E 5IP7H 4JV5Q 4B3TQ 1M90C 4IOAA 1KHIA 4XIGS 1EQQA 2UXBL 4IPGA 1K3RA 1XMQL 1EFWA 4KI0A 3D31A 1B70B 1NMGA 2CWAA 3UDXA 4IPHA 1L1OB 3TREA 1FGUA 1HZ9A 4A3IG 3M4QA 4QQBX 5K36G 3BZKA 4Y7NH 4DV4L 3U58A 1NTGA 1NY4A 1XTDA 3FHWA 1ASYA 4DAYB 4JI0Q 4DR7Q 5GAGC 1IYJB 1SN8A 2N78A 4JI7L 1HZAA 2AKWB 4FDBA 2ES2A 1CKMA 2KBNA 5C0XG 2JQOA 1MKHA 5FJ8G 3HKZG 2JEAI 2BA0A 2ZM6L 2UUAL 1GM5A 1E1TA 2ASBA 3CCVA 2D62A 1I94Q 1HNWQ 1X65A 4YWLA 3GTOH 1N9WA 1I50H 3F2CA 4GN3B 3S16H 4LFBL 1VS0A 2K50A 3NEMA 3U50C 4B3RL 3EBEA 4HJ9A 1IZ6A 4HIMA 4A3KH 4IFDJ 4DV1Q 4JI2L 3KOJA 4PZ8A 3DLLA 1LUZA 4BBSG 2F3IA 4R4QA 3HOVG 4UP7A 4A3LH 1AE3A 4NPSA 1VQ8A 4YWMA 2E5LQ 2B63G 1T9HA 3CF5A 4L5SA 5BR8L 4DUYL 4R1JA 1EIFA 4LF9L 4YY3Q 4LWCA 4DR5L 2VUMG 2N49A 1BKBA 4L5QA 3CMAA 1YJNA 1ASZA 1IBMQ 3H0GG 3W1BA 2VW9A 4GNXC 4OO1I 4LFAQ 1VQ4A 1XMOL 4IPCA 1KD1C 1PYBA 1QUQB 2MO0A 4IOCA 1IBLQ 2LXKA 1N32Q 1V9PA 1C9OA 3I56A 3RZOH 1VQ9A 1YHAA 2IX0A 2ZJQA 1RL2A 3L2PA 3K0XA 3PUWA 5C44G 1S40A 3KFUA 5C3EH 1XPOA 1U5KA 1Q86C 3CP0A 4IO9A 2WAQE 1OXSC 1WI5A 4YHHQ 2ZJRA 2RHSB 3OYYA 1PH7A 1FJGQ 4OWTB 3I4NG 4OX9Q 1MJCA 3B6YA 3KF6B 4A3JH 1IL2A 1JJCB 2LSSA 2CQOA 4X64Q 1Y14B 3E9IA 1TWHH 1EQRA 3PUXA 4OWXB 2JA8G 4HIOA 5EAYA 5H1SE 4L5RC 1VQ6A 2YTXA 4DV0L 1LYLA 4JI3L 2KHIA 2V1CC 2UU9Q 4DR2L 3RN5A 4QL5A 1X6OA 3UE0A 4GLXA 1VQOA 4RMFA 3GTKH 1VQEA 4A3IH 1WJJA 4B3SL 4DR3Q 1N34L 3KYHC 3NELA 4A3FG 2Q2TA 4JBKA 1N33Q 3MEFA 3PV0A 2NZOA 1PH4A 3CCMA 4PZ6A 1K9MC 4DV3L 3OTOQ 3UDFA 4AH6A 1JJ2A 4DV7L 5FJ8H 3UDGA 3KDFB 3T1YL 4JYAQ 2R7FA 2MFIA 5HY6A 4LFCL 3K7UC 4DV6L 3PF5A 4APVA 4JI4L 1X9NA 3A5ZB 1Y1VG 1UE7A 5IYBG 2K5VA 4JI1L 3GO5A 5LMNW 1K73C 1HR0Q 3TEHB 1HNZL 3PIOA 1G291 1PFSA 4P74A 4X66Q 1XPUA 3GTMH 5LMNL 3I2ZA 4BBSH 3HOVH 1X3GA 3I55A 1LM0A 2PNHA 1YHQA 2E2IH 3GTLH 5C0XJ 4NXNQ 4WJ3M 4X65Q 1V43A 1KL9A 3FKIG 3K8AA 2B63H 5C4XH 3RZDH 4GNXB 3S14H 1EUJA 1VQKA 1E22A 1KRTA 1YZ6A 3BJUA 3TRZA 1VQIA 3U4ZA 2CKZB 2PI2A 4BY1G 4A3GG 2RF4A 3UE1A 2NN6G 4AQYQ 2YU9H 2VUMH 2ATWA 3PCOB 2N3SA 1YJ9A 3T1HQ 4LF5Q 3H0GH 2K5NA 2WB1G 4DR6L 1IBKQ 2IT1A 2JEBI 4DUZQ 1EOVA 2AWNA 4XTCS 2JK8A 2AHOB 3HOZG 2Q2HA 1QVFA 1Q81C 4AYBE 2A8VA 1OTCA 4GKJQ 1Y1WG 4B3ML 4DR4Q 2MO1A 2ZJPA 2Y0SE 4DV5L 3A0JA 5C44H 3CCSA 4P75A 4HJ7A 3PGZA 4X62Q 4KHPL 3LGJA 1P8LA 1N36Q 1OXTA 3I7FA 3JC66 3KF8B 5AJ3Q 2K5HA 2CWPA 3EIVA 3CCUA 4DV2L 3W5OA 3SGIA 4YWKA 3I4NH 1E24A 1HZBA 4P73A 1UEBA 1FVIA 1GVPA 1E7ZA 2PMZE 1TXYA 2UXBQ 1P16A 1XMQQ 2JA8H 2HIXA 1PH6A 2I0QA 2KCMA 1QUQA 3CQZH 2HQLA 1L0WA 2C35B 4DV4Q 4GOPC 3CC4A 4GKKL 4A4IA 4JI7Q 1CSQA 2VQEL 1CKNB 1K83H 1PV4A 5IYCG 4A3FH 4POGA 4DK6C 3S15H 4BBRG 2F4VL 2UUAQ 4O0AA 1D8LA 3RLOA
chains in the Genus database with same CATH superfamily
1I4XA 1QCBD 3CCLA 4JI0L 1VCIA 1YHBA 1ZEQX 1SXTA 3JAME 2OTLA 1WD1A 4MTKA 2K14A 5M9OA 4L6TB 4RH6A 1STEA 5M5XH 3AQQA 1W3SA 2RCNA 3WWVA 3TS2A 3LX0A 4A3IB 3D3RA 1D7QA 5BR8Q 4JI5L 2NB0A 2Z6BA 1QZGA 3FEWX 4FXKC 2B8GA 4BY1H 3OSOA 2A19A 1Q46A 4A3GH 2ALYB 1I5FA 1XMOQ 4A3EG 3ER0A 2SOBA 4A3MG 2OQKA 2NZHA 3WOFA 2UUCQ 2RVLA 1BUVT 2VXWA 4WFN3 1S5BD 3DM1A 1N32L 1Y1WH 5DM63 3F2BA 2MP1A 4LMQD 1PH5A 1CQVA 4C3IH 4POFA 4P2CB 2QEXA 4LF4Q 1CT1D 4JOIC 4QIWB 5EPLA 1A62A 2NVQH 3RN2A 2WINB 5JVG3 5HGQA 1AP0A 2CW0D 3PUVA 1R9TH 2JA5G 1PA6A 1HUNA 1QZHA 1J6QA 3I4OA 1H9RA 4BA1I 1HNXQ 1WFQA 3MTSA 1SNMA 1TIID 2LS01 4OGQC 4DV7Q 2F4IA 4BBRH 1LTID 3T1YQ 4RA8A 4JI4Q 3S1RH 1XPRA 1PLFA 4LF6L 3K57A 3OW7A 1BBUA 4IUNA 1NR4A 4IALA 1BCPB 1WTOA 2CW0C 2UUBQ 3J7A5 4KN7C 2HIVA 5IGCA 2EQSA 1SJED 1JQYD 1J5EQ 4UDUC 1AN8A 1WYDA 1HJPA 3E0EA 4DXFA 3WDNA 1PRTF 1VQ7A 3M3YB 4PG3A 3GV6A 4K8JA 4YCUA 1NJIC 4ZKBB 4WORA 3KBXA 4L8JA 3QWNA 4HR7B 3OIPA 2OTJA 1Y1VB 2Z6KA 3QOLA 1XJVA 2XRQD 2IJ0A 1B7YB 1GXDC 1QJOA 5JEAH 2GA4B 1K0RA 2R92G 4LUZA 1X3FA 1GUOA 1CM9A 5C4ZA 2Q2IA 3ERSX 2IY5B 3FKIB 1YIJA 1TT2A 4RWSC 3FPPA 4RCNA 2EYLA 4R4TA 2F03A 4KKTA 4XQJA 2Q8TA 4N8X1 4TQUS 2YV5A 4F7XA 4M8AA 1OXVA 4DR7L 2E2HH 3MXUA 1SE4A 3A55A 4IUQA 2AMCB 3E9HA 1A2UA 5F2DA 1DOMA 1KDBA 1LTLA 4QJFA 2KENA 5IGGA 5JJIA 1HRJA 3M85A 1SRUA 4KTAA 2R93G 1ICFB 4J1MA 3DXJC 1SE2A 4IUUA 3RLNA 4IZ8A 3S2DB 2EJGC 1BOSA 3STBD 3C2PA 2B2YA 4LF9Q 4IFDI 2ZT9C 1EYDA 3VR4A 4IURA 4NB3A 2I46A 3KDFA 2ZTDA 5CYUA 3BZDB 4BY7H 1BXTA 3AYHB 3BU2A 3KJPA 4RG1A 5C4XG 4C3HB 3RR5A 3JAML 2EE1A 3HOZH 2NVXH 4LFAL 1LT3D 1JC7A 3G71A 3S17B 1YNJD 4ZCKA 3CW2C 2L0CA 3STBC 3EN2A 3PF4A 4ZLTF 2R7ZH 3HOWG 2OEOA 4GNXA 2A73B 5GAEC 2B29A 4UHVA 3SR1A 3GTQB 4K6LA 1BDOA 3S1NB 2KOLA 3HFZB 2VY3A 2D0PA 3CD6A 4DNIA 3K5MA 2A1AA 4DAMA 1XWEA 2D9UA 3M7NA 4UAIA 3GV3A 4CDDC 1E3PA 2JA7H 1EYAA 3K80C 3JAMi 3NK9A 4LNQA 1C0AA 2X69A 5IYCH 5I2XA 1UEAB 1I3QH 4FO2A 3TQYA 2BH2A 3H3VH 1A6XA 3KF8A 4IPDA 1Z7TA 4XQNA 2MNAA 4A93B 2H5XA 1BF4A 2F0NA 1CZGA 3K5OA 3TZDA 4JI1Q 1C8CA 1HZCA 3VR3A 1PZJD 4JYAL 1JB7A 3WOEA 4CDFC 1FNWA 3BDCA 4YIJA 3A7AB 2N55A 1HXYD 1LTAD 1TWGH 1U0LA 5IYDH 1ILQA 1CKNA 1KNAA 2QA4A 1XNQQ 1SLJA 1U4RA 4CHTB 4LJZC 4F88A 1GD7A 3EFXD 4X65L 2QCPX 1K8AC 4CJ2C 1PTOD 2Z6KC 3JAMc 5IP9G 4A3MH 1QNUA 1SNOA 1UWVA 3CRLC 4AIMA 4KMUC 4LUOA 3ONAB 4PMCA 3I73A 2IWHA 4AYBG 1X32A 3SE0A 5CV7A 1TY2A 4ZUJA 4ME3A 2EOTA 1NBWA 4IUTA 3QIAA 3A74A 4DPGA 5FLXE 1JWUD 2H4OA 3CPFA 4OWWB 1D1IA 3MAQA 4G4KA 1UE5A 5FOBB 4L5TA 3U4VA 1WCMB 1XNRQ 4LK1C 2PI2E 1F2LA 1PTOC 1YEZA 2IX1A 1AEXA 5IP7H 1VMPA 1IKMA 1KHIA 2JA6B 5EKIA 5IT9E 2UXBL 3HEJA 1B70B 2G9HD 3FMCA 3TREA 4DV4L 1XTDA 3Q6SA 1O7YA 1ASYA 3NHHA 1IYJB 4JI7L 2AKWB 4XXEA 1CKMA 2KBNA 1MKHA 1JORA 3TDQA 4Q5VA 3HOYB 2IW3A 1KDAA 1X65A 3F2CA 3TN2A 3UI2A 3S16H 1CHPD 4LFBL 4B3RL 4DAVA 2EVBA 3EBEA 1IZ6A 3NBHA 4C3JB 2TMPA 4UP7A 4OO1H 4QUCA 3U9OA 2B63G 1SAPA 3S1QB 1EIFA 3MFYA 1SE3A 4YY3Q 4LWCA 3G6JB 2VUMG 1EOTA 3IKJA 1BKBA 1IYUA 2L4NA 3I70A 2VW9A 4G57A 4GNXC 1VQ4A 1PYBA 2XWBB 1KLGD 2LXKA 1V9PA 2NVTB 1C9OA 3IFDA 4XQQA 1EEFD 1YHAA 5C44G 1G2TA 3OMCA 2PW5A 2K01A 5C3EH 4X3TA 2XSCA 4F87A 3CP0A 4YHHQ 1WI5A 1QOHA 3PO3B 2ZJRA 5CV8A 1PH7A 4OWTB 1SBBB 1D6EC 2LSSA 5ISRA 4KJOA 1TS4A 4OWXB 4DFAA 4HIOA 2I07B 3E0JA 3P7JA 4JI3L 1QNKA 4CJ0B 2L9HA 3RN5A 1V1PA 3UE0A 5I2YA 1VQOA 3SK8A 5M5WB 1WJJA 2AUKA 3SXHA 3KYHC 4DR3Q 4A3FG 4TKOB 3MEFA 3OWEB 4G7OC 2WAQB 1JJ2A 2Z9HA 4AH6A 3GTPB 3T13A 5FJ8H 3KBGA 1TS3A 2MFIA 4APVA 3TP5A 5LHY1 1K73C 3DWQA 5ELDA 1I4HA 3SK6A 3X3MA 2K32A 1XPUA 1KDCA 3R8BA 4BBSH 2QDLA 1X3GA 4G7HC 1LM0A 4RHSA 3GTLH 1SYCA 1STGA 5C0XJ 4NXNQ 1KL9A 2EJMA 5C4XH 1ET9A 2MHVA 3DEOA 1KRTA 1YZ6A 3BJUA 3TRZA 3U4ZA 2PI2A 4BY1G 4A3GG 2RF4A 4AQYQ 2YU9H 3GTOB 2N3SA 2XVSA 1YJ9A 2HDLA 3T1HQ 1EY0A 4DR6L 1IBKQ 2JEBI 4DUZQ 1EOVA 2AWNA 4H7BA 3J7AV 1QVFA 2IL8A 4AYBE 2KEEA 1Y1WG 1I4RA 3OOCA 3C3LA 4HJ7A 2LMCB 3I90A 4X62Q 4KHPL 1RTNA 1P8LA 1N36Q 4C3IG 1IYVA 2K5HA 3W5OA 3I4NH 2PCFB 1E24A 2DJFC 2FMCA 5CV4A 1UEBA 1FVIA 1GVPA 4QCLA 3VA5A 1HA6A 2JA8H 2HIXA 5CC4A 2KCMA 1L0WA 3ERQA 5FLXL 3CC4A 3NXWA 2Y0SB 2VQEL 1A3TA 4CDCC 4POGA 3K0YA 3T16A 3S15H 1STAA 4BBRG 5I9OA 2UUAQ 1X55A 1GHKA 2PYKA 3P1HA 1T5XD 5IT9L 4A3JB 3IRBA 2M9VA 5LMUL 1TWHB 1EZ6A 4XT3B 1PH3A 4X3UA 4HCSA 5IYBH 3CPWA 2HCCA 1CUKA 4JI2Q 4U68A 2B2UA 5C4JH 1B2TA 1X3QA 1PH1A 1S3OA 2PZUA 3L0OA 4JW0A 4KLKA 2K03A 3J7ZC 3GTKB 3QB3A 1STHA 1QVCA 1BCPC 1HTPA 2K33A 4LF8L 5IP9H 5IWAQ 4PMBA 3AFPA 3HKZB 5I6YA 3FRPB 5KYIA 1QILA 1LT4D 3FP9A 2NN6H 4RAUC 1Q7YC 1JCKB 2I5MX 1SJHD 2DJGC 2F0KA 5JEAG 4NXML 2PW7A 2F0EA 1JT8A 3GDEA 4EGVA 5DLQE 2JXMB 3HOVB 2XRSD 3D0FA 2E2IB 1JWSD 3V2TA 1FNVA 2XWJB 4CKEA 4BA2I 1MGSA 3RZDB 2YYZA 1ICWA 4NMZA 3S14B 5IY0A 2PZTA 4HJ8A 3MVVA 1DOKA 3KLRA 2EYMA 3BZCA 4C2MH 1I4PA 4DV0Q 3H0GB 2XNAC 2EY2A 4K0KL 1PVOA 1N34Q 1S5FD 1W6JA 1G6ZA 4RGMA 2UXCL 2ID0A 4DV6Q 1N33L 1EQVA 5M3MH 1HUMA 3HG9A 4I65A 2FJ2A 3ULPA 3AMUA 2NWGA 5KGUA 3OPOA 3NTIA 1TKWB 3HOXH 5ELBA 2ICEC 2F0TA 5J3BA 2KHJA 3D4RA 3H3VI 3F1ZA 1K83B 5ELFA 3FDTA 1EWCA 4BY7G 2CCZA 5JPMC 3CKIB 2VS1A 2KUMA 3D6WA 5NUCA 1EWHA 2WV6D 1HQMC 1HQRD 3IFTA 2R7DA 2LFNA 1TS2A 1GJXA 3H15A 1E2ZA 4DR1L 2B8FA 4IN3A 2VQFL 5E1FA 3R2TA 4UY8C 2R7ZG 3MZ5A 1VQJA 4DV5Q 3PMFA 5E7NA 3CMEA 1SNCA 2JYOA 1F2ZA 2K4KA 3BDOA 4X3KA 4JI6L 2A69D 2UXDL 2P5ZX 4GKJL 3K7AB 1VQFA 4B3TL 1WTWA 4A3BH 3CCJA 2JA7G 3PQIA 2F0SA 1KQSA 1ENAA 2WB1B 3Q24A 4QGUA 2ZM6Q 4GKKQ 3D8GA 1PH2A 3NQTA 2YTYA 3HKZE 3IAYA 1RDPD 1VQHA 3GTJH 2R61A 2B2UC 2A69C 4IJLA 4O1NA 1EY9A 3CAMA 1K8OA 2BA1A 3T4AC 4HIKA 2ENBA 4FYDA 5IYDG 4JCVE 2SNSA 2K5QA 5BN3A 1IL8A 4DV1L 1CZWA 4BXXH 4FF3A 4EQ5A 1Q90A 3M4PA 2B3GA 2E5LL 3I4MH 3M4OB 1X56A 4JI5Q 1SFOH 1F2YA 4Z9CB 5M3FH 5ELCA 3VA7A 4A3DH 2GN5A 1UAPA 3NQIA 4LW1A 5EBCA 3CXCA 1CSPA 1IBML 2VL6A 4V190 3PO2H 2KEDA 4GLVB 1YVCA 4HIDA 1VF7A 1STBA 1HA5A 2NVYH 3RUZA 1IKLA 3K59A 4IQZA 3ND8A 3MA2B 3F2DA 2UUCL 1D5MC 1Q12A 1KXLA 4S3SA 4C1NK 3L3OC 4HN7A 5IP7G 3Q8DA 2QGQA 2BE5C 5M5YH 3MC0B 4QMGA 4OEMB 4KJNA 1TWCH 4MNOA 3NUCA 1Z6HA 2E75C 3NBHB 3Q23A 4A3EB 2F0LA 2EXZA 1Z9FA 3S2HH 4ZKCB 4LF4L 4DV3Q 4A3MB 5I4DA 3D4DA 2J4XA 1EL0A 3DWAA 4QF4A 2O5JC 1D1KA 4LFCQ 3P20A 3RD4A 4YCVA 2SDFA 1IXRA 2F3WA 1B3QA 1EIHA 1EYGA 4JBWA 2E2JH 3P75A 2K05A 1HNXL 3FVQA 4LF6Q 2WKDA 1A63A 4ALPA 1SYEA 1VQAA 1SSOA 1LT5D 1HR0L 1Q1BA 4HTHA 1C7YA 3PIPA 1FD7D 3A8IE 4OO1G 4PV1C 3W1GA 3O13A 3S1MH 1PTOH 2KECA 1B3AA 1WTVA 1SMYD 2JA5B 5IGFA 2B2TA 2A74C 1TWAB 4YCWA 4K5XA 2UUBL 1VQCA 2WIIB 2FFKB 1B50A 1J5EL 3S9WA 2EPBA 2WB1E 5I9PA 2F52A 1C48A 4B3MQ 3K5LA 1PTOF 2B2WA 4LF5L 2N88A 1V1PB 1CA6A 3BDLA 3C1FA 3DM3A 3I72A 5KEEA 1S72A 3MFGA 5ELOA 2LXJA 2F0WA 5C3EG 2OQ0A 1GUWA 1DOLA 3G6EA 4FP5D 1SMYC 1NMFA 2GVAA 3DWPA 3ICEA 4ILWA 3HOUH 3RMHA 1STNA 1F9RA 3AB9A 5ELEA 1JOOA 1NCVA 4DK1A 4IOAA 1ZXTA 1PZKD 1EQQA 4IPGA 1XMQL 2IX3A 1TVXA 3DMUA 3SHLA 1HZ9A 3EQLC 1HTLD 4MHEA 4FVMA 4DR7Q 1NY4A 3FHWA 1SN8A 2R92B 1HCZA 1TR5A 5FJ8G 2JEAI 1GM5A 2D5DA 2XIWA 2RKSA 2D62A 4YWLA 5LL6S 1N9WA 5A2QE 4OIKA 5CV9A 1TWFB 2K50A 4A3KH 1H9SB 2PPBC 2PMZB 3KOJA 4BBSG 3DLLA 3R93A 4A3LH 4WJWA 3HGBA 2FMMA 2CH4A 3GP7A 1A3VA 2F0FA 4DUYL 4R1JA 3VR6A 4LF9L 1HPCA 1XXGA 3T56B 4KHVA 4DR5L 1F9PA 1MBYA 2N49A 4L5QA 1M4VA 4LFAQ 4I7ZC 4OL7A 3SK4A 2R93B 3RZOH 1VQ9A 2IX0A 1I6HB 1MSHA 5IGBA 4NP5A 1RKNA 1U5KA 1WTRA 1Q86C 1NUCA 5D65A 3I4NG 2F0GA 1SYFA 4RGTA 3J7AF 5C4XB 3E9IA 2JA8G 3GTGB 2NBFA 5EAYA 1VQ6A 2KHIA 4DR2L 4DAPA 4GLXA 4RMFA 1VQEA 4A3IH 4JBKA 4B3SL 5K36H 2Z1CA 2Q2TA 5EJWA 5JOBA 1PH4A 4DGZA 3LWEA 3HOWB 4LAAA 3PIP3 5C0XH 4DN4M 5DAUA 3C46A 4JYAQ 2R7FA 3K7UC 5EQ0A 1QB5D 1I4QA 3A5ZB 1I6VC 2B2TC 3MXGA 5IYBG 4JI1L 3GO5A 2KHSA 3TEHB 4EVOA 1HNZL 3PIOA 4P74A 1C4QA 1ZYRD 5LMNL 2ZXOA 1CQFA 4XYOA 4Y7NB 3I55A 2PNHA 4WJ3M 1B53A 4X65Q 1Y8PB 1E22A 4HMIA 3K6OA 1JOQA 3UE1A 2NN6G 3DEPA 2O5IC 1KLUD 1I50B 4CBVA 2IT1A 2MGSA 4K2KA 2JK8A 1Q81C 1WTPA 2A8VA 4DR4Q 1ZYRC 2MO1A 5E4WC 2E2DC 3A0JA 2ZXRA 4P75A 3H6MA 3PGZA 1PFBA 3I91A 5COYA 3R3OA 1GUNA 3CCUA 4DV2L 1LABA 1V1OA 1NAPA 2PMZE 1E7ZA 2L5TA 2UXBQ 1P16A 3LNNA 2WKCA 4R8IA 1PH6A 4AYBB 1K8MA 1F9QA 2F3VA 4DV4Q 1EEID 1LTRD 5CV5A 4JI7Q 2B2YC 2JSOA 2VB2X 4B08A 1STYA 2F4VL 4QUFA 4O0AA 1D8LA 5C5MA 3J80E 3TBIB 5M3MG 3M3YH 1UE6A 2L12A 1BCPF 1H9JA 1L0YB 2EXDA 1Y8NB 2RQXA 2X6LA 4LFBQ 2DGYA 1JJGA 4B3RQ 4OIJA 1Y1VH 3HOXG 2FHTA 3CCEA 4XYQA 3CCQA 2E74C 1VMCA 1GUGA 2RHQB 2QKIC 3FKIH 5DNFA 1QVGA 4JBJA 1KIXA 4DU9A 5A2QL 2F0DA 2VZAA 1EU4A 3BVZA 2DNEA 1JB3A 2K5WA 2AQ1B 2B2VA 4K5WA 4MN3A 3GTMB 1FL0A 4GN5A 5GAHC 3H94A 2OT2A 2B63B 1SE8A 3TSSA 1VQLA 2WACA 4C1NI 3C1EA 4A3BG 1DCZA 1U4PA 4JK1C 1Y69U 2VUMB 1WD0A 4YHHL 4RCOA 4J8QA 1S5CD 3S2DH 1EY7A 2YTVA 2N8NA 1L0XB 1KNEA 2BDNA 3F8TA 1LO5D 1M1KC 4OONA 5C44B 2HHHL 3CC2A 1ONLA 5T1IA 1II3A 1BO0A 3K58A 1O7IA 3PIO3 1KRSA 3KK7A 2CVRA 3NENA 1OXUA 4GZYC 4C3HH 2JA9A 4Y52H 1X3EA 1J8IA 3KJOA 1YITA 2Z4HA 5KNBA 1ET6A 1DGSA 4LUVA 4DKAC 2BCOA 2O4XA 3S17H 1TS5A 4BXXG 4JI8Q 2F0OA 1HH2P 3CQZB 1UE1A 3I4MG 3L7ZC 1V8QA 3ND9A 5M3FG 3GTQH 3E3XA 4DNTB 4A3FB 4V0BA 3S1NH 1PH9A 1B44D 2Q8IB 3BS1A 3ZYYX 3ITPA 4A3DG 1U4MA 3NE5B 2KCNA 1JE5A 2RDFA 1B8AA 3PO2G 3OW2A 1H9SA 1S4ZA 2HCIA 2QEJC 2RCFA 2TSSA 2AUJD 4DR6Q 4WJ4A 4LF7L 3G48A 3PSIA 2PQAA 3UDIA 4ULLA 1RIPA 1NNXA 5M5XB 1EIYB 2IHEA 3PUYA 4A93H 1WTHA 4DUZL 3VR2A 4DF7A 4KHPQ 1EY6A 4HEDA 2Y0SG 1Y8OB 3D6CA 2RDHA 1WVLA 4PNYA 4ZRZA 4JV5L 4PMWA 2EYHA 4X62L 4BY1B 2EYPA 4A3GB 2R3ZA 4R9WA 1WTQA 1QG7A 4KY6A 1ML0D 1BCPD 1OXXK 4H44C 1BVSA 5C4HA 4ID6A 1RTOA 3SDZA 4A76A 1LTSD 2VQEQ 3A7LA 1Y1WB 3EJIA 4IFDH 1PDQA 5AFWA 4O42A 4FXDA 4C3IB 2VNUD 5EBDA 1HNWL 1I94L 4BS9A 5LMUQ 3RNUA 4XT1B 2NVQB 1EZ8A 2EDGA 2I5HA 2F0MA 2HDMA 4TRDA 4GOPA 1R9TB 2EYJA 4EQPA 3A8JE 1CTMA 1W2BA 4RKLA 2L55A 4LF8Q 4F8MA 1AZPA 3J80L 1WCMH 3H91A 2NZ1D 4NW2A 4K5VA 4BBRB 3W2DA 3J81j 3OIQA 4H02A 3S1RB 2JA6H 3I8ZA 3LWUA 5IWAL 4QY7A 1R4QB 1PRTB 5FLMH 1IBLL 3J7YW 4NXMQ 4A3CH 2FXQA 1VQGA 4OELB 2NTTA 4EX5A 1VQPA 3SEBA 4CKCA 3HOUG 3HOYH 1ENCA 1FJGL 4OX9L 4MTNA 3J80i 3KLSX 4U673 5FLXc 2NYZD 4HCEA 4X64L 1GKHA 5IOCA 3ZJYC 5J39A 1B9MA 4K0KQ 4C3JH 1HHVA 2UU9L 3HS0C 1G2SA 1WTXA 2Z4IA 1PHJA 4GLAC 4IUPA 5IT9c 1KC8C 1VQ5A 3S1QH 2UXCQ 5FO8B 1PFNA 3RLFA 3OTOL 4JOIA 2J0TD 2H1EA 2E8GA 2L1BA 3MHBA 4I7AA 1LT6D 4A3KG 4UP9A 5GROA 2NVTH 1RF2D 1LTTD 1DJRD 4A3LG 4H13C 4X66L 1KTKA 4KV6A 2E2HB 5JJZA 2V4DA 3J80c 3VDYA 1LTGD 2KA7A 4JG2A 1I4GA 4MZ9A 1X3PA 3PO3H 5C0XI 3D4WA 4OXPA 1MJEA 2K52A 2RDGA 4XDXA 2KVMA 1AE2A 3T51B 4R4CA 5CMDA 1PYWD 4ZYSA 1F9SA 1H9MA 1UUPA 3QG1A 4DR1Q 2VQFQ 3IL8A 5M5WH 4TSSA 3AEVA 1O7LA 1VQBA 1JE4A 2OCEA 4JI6Q 2UXDQ 3TP6A 3GTPH 3PUZA 4BY7B 2DUDA 2QDBA 5TSSA 3CU7A 5AJ3L 2WFWA 3NWTA 4B3TQ 2A6EC 4J6HA 1KABA 4HSPA 3HOZB 1K3RA 4KI0A 2NVXB 4K14A 1NMGA 4IPHA 4RHRA 1L1OB 1S5ED 5C3XA 4A3IG 4QQBX 3M4QA 3OHXC 5LL6X 5K36G 1NTGA 3U9SA 1FR3A 4JI0Q 2R7ZB 2EYFA 3F2UA 2ES2A 5C0XG 4HSVA 2JQOA 2BA0A 2ZM6L 3NP8A 2JP1A 1FNUA 1E1TA 5L37A 2ASBA 1RODA 1VDZA 2K5DA 3GTOH 5CV6A 4GN3B 2MUYA 3U50C 3DHQA 2NTSA 4HIMA 4IFDJ 4CJ1B 4DV1Q 2JA7B 1ESFA 2F3IA 4R4QA 1AE3A 2BE5D 1JWMD 4H0LC 4YWMA 2AQ2B 1I3QB 4NDXA 1T9HA 2E5LQ 2DY7A 3CF5A 4L5SA 5BR8L 1EY8A 4IUVA 5D14A 1LLRD 3URYA 1ASZA 2F0HA 1IBMQ 4DK0A 4OO1I 1XMOL 1N32Q 4IPCA 1RD9D 2MO0A 4IOCA 1TWGB 2F0UA 4ABNA 3I56A 4HMJA 1O80A 3L2PA 2SNMA 1BNZA 1S40A 2KCCA 3EA6A 3T53B 1LTBD 1OXSC 4K6DA 3OYYA 2MJ8A 5FKAC 2CHBD 3B6YA 3KF6B 3A8KE 4A3JH 3M4YA 4OHJA 1JJCB 1Y14B 1TWHH 1EQRA 1TU2B 3I4LA 5CR3A 4L5RC 1JICA 1SNDA 3VYUA 2HUGA 1CI3M 3BG3A 4QL5A 1X6OA 3QO2A 3GTKH 3NELA 3PV0A 4E6IA 1U9RA 2JN4A 4DV3L 4DV7L 2LKVA 3UDGA 3T1YL 3QJYA 4LFCL 4EQNA 5HY6A 3J81E 4JI4L 2KJXA 1X9NA 4DNRB 1Y1VG 1HR0Q 2X6GA 4RGNA 2J7ZA 1ESRA 1G291 2PQEA 1DM0B 1XTCD 3HOVH 2K6AA 1YHQA 2E2IH 1K28A 3FKIG 3K8AA 4DAYA 3RZDH 3S14H 1VQKA 2G5DA 1PXUA 1VQIA 5FK9C 2C9OA 2CKZB 3VYSA 1DONA 3PCOB 1VF5C 4LF5Q 3S16B 3H0GH 1H9KA 3EROA 1RHPA 2KQ3A 3HRZC 1EY5A 4XTCS 1A15A 2AHOB 2OXPA 3M7GA 1OTCA 4B3ML 1A3UA 1F77A 2ZJPA 3JC66 3EIVA 2CWPA 3NTKA 4P73A 3KLSA 1TXYA 2XN9C 1EYCA 1XMQQ 5CBEE 2I0QA 1QUQA 2HQLA 1G91A 2C35B 1MHWC 1SYDA 1D2BA 1K83H 3BYYB 2E76C 5C3EB 4DK6C 1AFPA 1VQMA 3RLOA 4C3HG 1A8VA 2PQAB 1TQOA 4UPAA 4IJHA 2A5HA 2RSNA 2L15A 1UNSA 1QE6A 4HAEA 5KRUA 3ULLA 1S5DD 4DUYQ 3BYTB 5K5PA 2EY1A 4M1UB 3K7AH 4DR5Q 1X54A 1YJWA 1FGBD 3TP8A 4FXGC 5J1ZA 4QIWE 4P72A 2XTIA 2DY8A 1RJTA 5EKLA 2RBMA 4BBSB 5EPJA 4A93G 2ZTEA 5KNDA 3GTLB 2EIFA 2F0JA 4PZ7A 1VQNA 4DK3C 2NN6I 1Q8KA 2K75A 3KUPA 1IW7D 5IODA 5CBAE 2YU9B 4N8FA 1AH9A 4GOPB 4KKUA 3SK5A 4X6AH 3EVQA 4DR2Q 4O2DA 5FO9B 4HJAA 1R4PB 3NSWA 4KKSA 4B3SQ 3M9BA 3M4OH 1XX8A 2D0OA 2HD3A 1PH8A 1EY4A 3AU7A 1Q82C 3CC7A 4IFDG 1SEBD 2MPMA 1YNJC 2NUCA 2ZTCA 2F0QA 5GQOA 1H95A 1E1OA 4PQXA 2A6HD 3NBIA 1CA5A 1IW7C 3I4NB 3AFQA 4UP8A 2CFMA 5C3WA 1IHZA 2GVBA 1B9NA 4ZK9B 1L1OA 1NE3A 4R4OA 2JA8B 2WP8J 3Q22A 1HNZQ 2LY7A 2B2WC 1HFGA 5LMNQ 2PO4A 3L9AX 1DD2A 1PRTD 3KLWA 5GADC 4JBMA 1XNQL 4GN4B 3NPPA 1WCMG 1BBWA 4L63B 3S15B 1JR0D 1G8ZD 2RA4A 3J81L 1O7ZA 3G7LA 2JA6G 1F2MA 1KAWA 2A6HC 3TZUA 1SNQA 1BR9A 2AQ3B 5FLMG 1G6PA 4A3EH 4A3CG 3VR5A 2EJFC 5C4JB 1JMCA 1DXMA 4CKBA 1BQQT 1PRTC 1E2VA 3K81C 2C5CA 2Z8LA 4WRDA 1EWIA 3HOYG 1N8RC 3E5SA 4KD4A 4DV2Q 4DR4L 1XNRL 5JVH3 3J81i 1J9OA 1PZID 2FINB 5JEAJ 4C3JG 2JJQA 4EQOA 5CGKA 4HJ5A 1MIUA 1ILPA 1SR3A 4ZAIA 2JA5H 4RKBA 1TWAH 2F4VQ 5BN4A 3KF6A 1SROA 5JJLA 2Q2UA 3A5UA 4CGYB 2AWOA 2OF1A 2OWOA 1GUSA 4B9XA 4C2MB 1CKOA 4N9PA 2HT1A 4KY7A 2XGTA 3MXNB 1Z47A 3V96A 5HGTA 4C56C 5EPKA 3GD7A 1A0IA 3PO3G 1AW7A 3HZXA 1U4LA 4K2LA 1SMXA 3J81c 1YBYA 1E0BA 1MI2A 4YY3L 1PYSB 3S24A 1NR2A 4TVAB 2CQAA 5M3MB 1RCVD 5E3FA 1K3BC 5DM73 1AZQA 1GOZA 1YNXA 3MEHA 2ZXPA 3HOXB 3OMGA 5ELNA 1CK1A 2WAQG 4GS3A 2R92H 5CORA 4ODGA 4G7ZC 2EY6A 2QILA 2K7VA 4DXGA 3G4SA 1M8AA 4JI3Q 3Q0AA 4J15A 5BN5A 1TWFH 3W3AA 3ULJA 2DNCA 1VQDA 4A75A 1CFMA 2MQHA 5JAVA 4DR3L 2HHHQ 2Z0SA 1L1OC 3QR8A 2EZVA 1LV9A 2I5LX 4P71A 2D2CC 2KCTA 1HR0W 3TS0A 1YNND 2M00A 4KD3A 4A3BB 3CCRA 4JPBW 1SDFA 4MIUA 2R93H 2L11A 1SYBA 1I6HH 3HKSA 1L2FA 1Q8IA 3DUZA 4KHZA 4NXNL 4JC0A 4KN4C 2BH8A 4JI8L 3A54A 3GTJB 3BVMA 1G51A 2IHFA 5I6WA 3H3VC 1WOCA 5IE8A 4ZUIA 1Q1EA 4R4IA 3N52A 4AQYL 5G3LF 3GTGH 1YNNC 1GHJA 2ICIA 3T1HL 1B4OA 4LF7Q 1Q3LA 5IIFA 1YI2A 1IBKL 2JE6I 2M2LA 5KIXA 5D3DA 2R6GA 3V05A 2F0IA 2QF7A 3I4MB 3HOWH 4FNFA 4N9TA 5J22A 1SFOB 5M3FB 1N36L 5JJKA 1V1QA 4DA2A 4JV5Q 4A3JG 4FF1A 1K8GA 1GO3E 3NTHA 4A3DB 1M90C 1DZ1A 4XIGS 3MXPA 3H09A 2PNRC 3PO2B 1EFWA 1A2TA 3D31A 2CWAA 1T5EA 3UDXA 2DN8A 1FGUA 2QW7A 3BZKA 4Y7NH 3U58A 2NVYB 1B1ZA 4DAYB 5GAGC 2N78A 1DYQA 1HZAA 4FDBA 5A35A 3K5NA 3HKZG 5T1GA 2UUAL 3BVGA 5IGEA 4CDEC 1HNWQ 3CCVA 1I94Q 5DEHA 5M5YB 5KYLA 1I50H 2A68D 1TWCB 2Q8RE 1VS0A 3NEMA 5E4XA 1SYGA 4HJ9A 5EGTA 4JI2L 1OO9B 4BWGB 4PZ8A 1LUZA 3A56A 3HOVG 1E2WA 3S2HB 1W6KA 2B2VC 3HP3A 4NPSA 1VQ8A 4FF4A 2K04A 3R2IA 4X3SA 1LACA 3QOJA 2E2JB 3CMAA 1YJNA 1GUTA 3H0GG 3W1BA 2A68C 3VYRA 5HURA 1KD1C 1QUQB 1IBLQ 3TMEA 1HFNA 1NSNS 1SNPA 2ZJQA 1RL2A 3K0XA 1ZKOA 3PUWA 3S1MB 1PTOB 4R8NA 3CHBD 3KFUA 1XPOA 3N6RA 4FF2A 3FPUB 4QB4A 4IO9A 2WAQE 2RHSB 1PMRA 1FJGQ 4OX9Q 1MJCA 1QWYA 1IL2A 2CQOA 4X64Q 3PUXA 4ZQ3A 2CH4W 1TY0A 5H1SE 3I3CA 2YTXA 4DV0L 1LYLA 1ENFA 2V1CC 2UU9Q 2BOSA 2SEBD 1MD2D 2RSOA 5C5LA 1N34L 1N33Q 2NZOA 4JVZA 3CCMA 4PZ6A 1K9MC 3OTOQ 3UDFA 3TP7A 3HOUB 5KNCA 3KDFB 4DV6L 3PF5A 3MWYW 2EY5A 1EFID 2PZWA 1UE7A 5LMNW 2K5VA 2VB3X 1KAAA 4Q0FA 5G3LD 1PFSA 2G9DA 4X66Q 5D3IB 3GTMH 3I2ZA 2A6ED 1MSGA 1V43A 2HQEA 2B63H 4GNXB 1EUJA 1XYIA 2VUMH 3CRKC 2ATWA 3GQBA 3MXNA 4RGOS 2F0PA 5C6AA 2F1MA 2K5NA 2WB1G 4A3KB 1JOKA 3HOZG 2Q2HA 2IPKD 2F0VA 4GKJQ 3E6ZX 1O78A 2BDOA 2Y0SE 5JPNC 4DV5L 5C44H 4RFBA 3CCSA 3OWFA 3LGJA 1OXTA 3I7FA 3KF8B 5AJ3Q 1D5XC 1PFMA 4ME5A 3SGIA 4YWKA 1D5ZC 3VYTA 1HZBA 4KY5A 4B9WA 2O2LD 1BBXC 2K1BA 2B39A 2EYOA 3X3NA 1K0SA 1EIGA 3CQZH 3RZOB 1CHQD 4KK7A 4GOPC 4GKKL 4A4IA 1EQTA 1CSQA 1PV4A 1CKNB 5FO7B 2K28A 5IGDA 3SVMA 5IYCG 4A3FH 3NWSA 1EU3A 1FYCA 5EKKA 4NKLA 4K8IA
chains in the Genus database with same CATH topology
1X55A 5M3MG 1A8VA 3CCLA 1VCIA 4JI0L 3M3YH 1UE6A 2EXDA 1YHBA 3IRBA 4LFBQ 2DGYA 5LMUL 1JJGA 4B3RQ 2PQAB 1PH3A 2OTLA 4UPAA 1Y1VH 5IYBH 4IJHA 3HOXG 3CPWA 4JI2Q 1CUKA 2L15A 5C4JH 2K14A 5M5XH 3CCEA 1PH1A 1S3OA 3AQQA 1W3SA 2RCNA 3WWVA 3L0OA 3TS2A 3CCQA 4KLKA 3ULLA 3J7ZC 1D7QA 1QVCA 5BR8Q 2RHQB 4DUYQ 4LF8L 4JI5L 3FKIH 5IP9H 5IWAQ 1QVGA 4JBJA 3K7AH 4DR5Q 1KIXA 3AFPA 1X54A 1QZGA 1YJWA 2VZAA 4BY1H 4A3GH 2A19A 1Q46A 3FP9A 4QIWE 2ALYB 1I5FA 4P72A 1XMOQ 1Q7YC 2I5MX 4A3EG 2XTIA 3ER0A 4A3MG 2OQKA 2NZHA 5JEAG 2UUCQ 4NXML 1JT8A 3GDEA 1FL0A 5DLQE 4GN5A 4A93G 1N32L 2ZTEA 1Y1WH 3F2BA 3D0FA 5GAHC 2EIFA 4PZ7A 1SE8A 4DK3C 1PH5A 2NN6I 1VQNA 4BA2I 1VQLA 1Q8KA 2K75A 2YYZA 4C3IH 5IY0A 4POFA 4HJ8A 4A3BG 2QEXA 3BZCA 4C2MH 4LF4Q 4JOIC 1AH9A 1A62A 4YHHL 4DV0Q 4GOPB 2NVQH 3RN2A 4X6AH 5HGQA 4DR2Q 3S2DH 3PUVA 2YTVA 4O2DA 1R9TH 4HJAA 4K0KL 2N8NA 1PVOA 2JA5G 3F8TA 1N34Q 3M9BA 1PA6A 4B3SQ 1QZHA 1J6QA 3I4OA 4BA1I 1M1KC 1HNXQ 3M4OH 1WFQA 2D0OA 4OONA 1PH8A 2HHHL 1Q82C 3CC2A 3CC7A 4IFDG 2UXCL 4DV7Q 1O7IA 2ZTCA 4BBRH 5GQOA 1KRSA 3T1YQ 1H95A 2ID0A 3NENA 1E1OA 1OXUA 4DV6Q 4JI4Q 3S1RH 1N33L 4C3HH 2JA9A 5M3MH 4Y52H 3AFQA 1X3EA 4UP8A 1XPRA 4LF6L 2CFMA 3KJOA 1YITA 2GVBA 1L1OA 1NE3A 1DGSA 1BBUA 4R4OA 3ULPA 2WP8J 4LUVA 4DKAC 1HNZQ 3S17H 3HOXH 4BXXG 4JI8Q 1HH2P 5LMNQ 2UUBQ 3J7A5 5J3BA 1UE1A 2HIVA 2KHJA 2EQSA 3KLWA 5GADC 4JBMA 1XNQL 3L7ZC 3H3VI 3I4MG 4GN4B 1J5EQ 3F1ZA 1WCMG 5M3FG 1BBWA 3GTQH 1WYDA 2CCZA 3S1NH 4BY7G 1PH9A 1HJPA 4A3DG 3E0EA 2VS1A 1VQ7A 1JE5A 2JA6G 1B8AA 4PG3A 1NJIC 1KAWA 4YCUA 3PO2G 3OW2A 2R7DA 4DR6Q 5FLMG 4WJ4A 1G6PA 2OTJA 4A3EH 3G48A 3PSIA 2PQAA 2Z6KA 3H15A 1XJVA 4LF7L 4A3CG 3UDIA 4DR1L 1RIPA 1B7YB 2VQFL 4UY8C 2R7ZG 1K0RA 1JMCA 1VQJA 2R92G 4DV5Q 1EIYB 4LUZA 1X3FA 2IHEA 3PUYA 5E7NA 3CMEA 4DUZL 3K81C 4A93H 4KHPQ 2K4KA 2Q2IA 3ERSX 1EWIA 3HOYG 1N8RC 2Y0SG 4JI6L 2UXDL 2IY5B 1YIJA 4DV2Q 4GKJL 4DR4L 1XNRL 4JV5L 1VQFA 4PMWA 4B3TL 4R4TA 4A3BH 4X62L 3J81i 3CCJA 2JA7G 5JEAJ 1OXXK 2JJQA 4TQUS 1KQSA 1BVSA 4HJ5A 1MIUA 2YV5A 4QGUA 2ZM6Q 4GKKQ 1SR3A 1PH2A 1OXVA 4A76A 2VQEQ 4DR7L 2E2HH 2YTYA 2JA5H 3HKZE 1TWAH 2F4VQ 2AMCB 3E9HA 1VQHA 3KF6A 3GTJH 1SROA 5JJLA 2Q2UA 2VNUD 1LTLA 3A5UA 4QJFA 4IJLA 1HNWL 2AWOA 1I94L 2OWOA 5LMUQ 2KENA 5JJIA 3CAMA 1SRUA 3M85A 1CKOA 2BA1A 2HT1A 2R93G 4HIKA 3RNUA 2XGTA 5IYDG 2I5HA 4JCVE 3RLNA 3MXNB 4GOPA 3STBD 1Z47A 4DV1L 4LF9Q 4BXXH 4IFDI 4EQ5A 3GD7A 1A0IA 2B3GA 3M4PA 2E5LL 1W2BA 3I4MH 3PO3G 1X56A 4LF8Q 4JI5Q 4NB3A 1SFOH 3KDFA 1WCMH 2ZTDA 5M3FH 4BY7H 1SMXA 3J81c 1YBYA 3AYHB 4YY3L 1PYSB 1VQ5A 3S24A 3BU2A 3J81j 4RG1A 4TVAB 3KJPA 4A3DH 4H02A 5C4XG 2GN5A 4LW1A 2JA6H 3RR5A 3CXCA 1CSPA 1IBML 2VL6A 3HOZH 3PO2H 5IWAL 4QY7A 2NVXH 4LFAL 4GLVB 1YNXA 1YVCA 5FLMH 3G71A 1IBLL 4HIDA 4NXMQ 4A3CH 3CW2C 2FXQA 1VQGA 3STBC 3EN2A 2NVYH 3PF4A 5ELNA 2R7ZH 3HOWG 4GNXA 2WAQG 4GS3A 2R92H 5GAEC 4EX5A 2B29A 1VQPA 3F2DA 2UUCL 1Q12A 3HOUG 1KXLA 3HFZB 3HOYH 2VY3A 2D0PA 5IP7G 3Q8DA 2QGQA 1FJGL 3G4SA 4JI3Q 5M5YH 3CD6A 4OX9L 4MTNA 4DNIA 1VQMA 2A1AA 4J15A 3J80i 4DAMA 1TWCH 5FLXc 4MNOA 4X64L 1TWFH 1GKHA 3ULJA 3ZJYC 3M7NA 3NBHB 1E3PA 2JA7H 1VQDA 3K80C 4C3JH 3JAMi 1Z9FA 4A75A 2UU9L 4LNQA 4LF4L 2MQHA 3S2HH 5IYCH 4DV3Q 1C0AA 2BH2A 1I3QH 3TQYA 3H3VH 1PHJA 4DR3L 4LFCQ 2HHHQ 4GLAC 2Z0SA 1L1OC 4IPDA 1IXRA 4YCVA 5IT9c 2H5XA 2MNAA 1KC8C 3S1QH 2UXCQ 1EYGA 2I5LX 4JBWA 4JI1Q 3RLFA 3OTOL 4JOIA 4P71A 2KCTA 2E2JH 2E8GA 3TS0A 1HR0W 1HZCA 1HNXL 4JYAL 1JB7A 4LF6Q 1A63A 4ALPA 1VQAA 3CCRA 4A3KG 4UP9A 1HR0L 1TWGH 1Q1BA 1U0LA 5GROA 1C7YA 2NVTH 2R93H 3PIPA 5IYDH 4OO1G 4A3LG 1I6HH 3W1GA 1CKNA 4X66L 2QA4A 1XNQQ 1SLJA 3S1MH 3HKSA 1L2FA 1GD7A 4KHZA 4NXNL 4JC0A 3J80c 4MZ9A 4YCWA 4JG2A 4X65L 3VDYA 2BH8A 3PO3H 4JI8L 1K8AC 2UUBL 5C0XI 2Z6KC 4OXPA 1MJEA 2K52A 4K0KQ 1G51A 1VQCA 2IHFA 1WOCA 3JAMc 5IE8A 1J5EL 1AE2A 1Q1EA 2WB1E 4R4CA 2F52A 4R4IA 5IP9G 4AQYL 1UWVA 4A3MH 3GTGH 4B3MQ 4AIMA 4LUOA 3T1HL 4LF5L 4LF7Q 4AYBG 1YI2A 3DM3A 1IBKL 4DR1Q 2JE6I 2VQFQ 1S72A 5M5WH 2R6GA 4ME3A 5ELOA 1NBWA 2LXJA 3AEVA 3A74A 4DPGA 5C3EG 2OQ0A 3CPFA 4OWWB 1VQBA 3G6EA 3HOWH 1UE5A 1NMFA 2GVAA 2OCEA 4L5TA 4JI6Q 2UXDQ 3U4VA 3GTPH 3PUZA 1N36L 3ICEA 5JJKA 1V1QA 1XNRQ 3HOUH 2DUDA 2PI2E 5AJ3L 1YEZA 4A3JG 2WFWA 1K8GA 2IX1A 1GO3E 5IP7H 4JV5Q 4B3TQ 1M90C 4IOAA 1KHIA 4XIGS 1EQQA 2UXBL 4IPGA 1K3RA 1XMQL 1EFWA 4KI0A 3D31A 1B70B 1NMGA 2CWAA 3UDXA 4IPHA 1L1OB 3TREA 1FGUA 1HZ9A 4A3IG 3M4QA 4QQBX 5K36G 3BZKA 4Y7NH 4DV4L 3U58A 1NTGA 1NY4A 1XTDA 3FHWA 1ASYA 4DAYB 4JI0Q 4DR7Q 5GAGC 1IYJB 1SN8A 2N78A 4JI7L 1HZAA 2AKWB 4FDBA 2ES2A 1CKMA 2KBNA 5C0XG 2JQOA 1MKHA 5FJ8G 3HKZG 2JEAI 2BA0A 2ZM6L 2UUAL 1GM5A 1E1TA 2ASBA 3CCVA 2D62A 1I94Q 1HNWQ 1X65A 4YWLA 3GTOH 1N9WA 1I50H 3F2CA 4GN3B 3S16H 4LFBL 1VS0A 2K50A 3NEMA 3U50C 4B3RL 3EBEA 4HJ9A 1IZ6A 4HIMA 4A3KH 4IFDJ 4DV1Q 4JI2L 3KOJA 4PZ8A 3DLLA 1LUZA 4BBSG 2F3IA 4R4QA 3HOVG 4UP7A 4A3LH 1AE3A 4NPSA 1VQ8A 4YWMA 2E5LQ 2B63G 1T9HA 3CF5A 4L5SA 5BR8L 4DUYL 4R1JA 1EIFA 4LF9L 4YY3Q 4LWCA 4DR5L 2VUMG 2N49A 1BKBA 4L5QA 3CMAA 1YJNA 1ASZA 1IBMQ 3H0GG 3W1BA 2VW9A 4GNXC 4OO1I 4LFAQ 1VQ4A 1XMOL 4IPCA 1KD1C 1PYBA 1QUQB 2MO0A 4IOCA 1IBLQ 2LXKA 1N32Q 1V9PA 1C9OA 3I56A 3RZOH 1VQ9A 1YHAA 2IX0A 2ZJQA 1RL2A 3L2PA 3K0XA 3PUWA 5C44G 1S40A 3KFUA 5C3EH 1XPOA 1U5KA 1Q86C 3CP0A 4IO9A 2WAQE 1OXSC 1WI5A 4YHHQ 2ZJRA 2RHSB 3OYYA 1PH7A 1FJGQ 4OWTB 3I4NG 4OX9Q 1MJCA 3B6YA 3KF6B 4A3JH 1IL2A 1JJCB 2LSSA 2CQOA 4X64Q 1Y14B 3E9IA 1TWHH 1EQRA 3PUXA 4OWXB 2JA8G 4HIOA 5EAYA 5H1SE 4L5RC 1VQ6A 2YTXA 4DV0L 1LYLA 4JI3L 2KHIA 2V1CC 2UU9Q 4DR2L 3RN5A 4QL5A 1X6OA 3UE0A 4GLXA 1VQOA 4RMFA 3GTKH 1VQEA 4A3IH 1WJJA 4B3SL 4DR3Q 1N34L 3KYHC 3NELA 4A3FG 2Q2TA 4JBKA 1N33Q 3MEFA 3PV0A 2NZOA 1PH4A 3CCMA 4PZ6A 1K9MC 4DV3L 3OTOQ 3UDFA 4AH6A 1JJ2A 4DV7L 5FJ8H 3UDGA 3KDFB 3T1YL 4JYAQ 2R7FA 2MFIA 5HY6A 4LFCL 3K7UC 4DV6L 3PF5A 4APVA 4JI4L 1X9NA 3A5ZB 1Y1VG 1UE7A 5IYBG 2K5VA 4JI1L 3GO5A 5LMNW 1K73C 1HR0Q 3TEHB 1HNZL 3PIOA 1G291 1PFSA 4P74A 4X66Q 1XPUA 3GTMH 5LMNL 3I2ZA 4BBSH 3HOVH 1X3GA 3I55A 1LM0A 2PNHA 1YHQA 2E2IH 3GTLH 5C0XJ 4NXNQ 4WJ3M 4X65Q 1V43A 1KL9A 3FKIG 3K8AA 2B63H 5C4XH 3RZDH 4GNXB 3S14H 1EUJA 1VQKA 1E22A 1KRTA 1YZ6A 3BJUA 3TRZA 1VQIA 3U4ZA 2CKZB 2PI2A 4BY1G 4A3GG 2RF4A 3UE1A 2NN6G 4AQYQ 2YU9H 2VUMH 2ATWA 3PCOB 2N3SA 1YJ9A 3T1HQ 4LF5Q 3H0GH 2K5NA 2WB1G 4DR6L 1IBKQ 2IT1A 2JEBI 4DUZQ 1EOVA 2AWNA 4XTCS 2JK8A 2AHOB 3HOZG 2Q2HA 1QVFA 1Q81C 4AYBE 2A8VA 1OTCA 4GKJQ 1Y1WG 4B3ML 4DR4Q 2MO1A 2ZJPA 2Y0SE 4DV5L 3A0JA 5C44H 3CCSA 4P75A 4HJ7A 3PGZA 4X62Q 4KHPL 3LGJA 1P8LA 1N36Q 1OXTA 3I7FA 3JC66 3KF8B 5AJ3Q 2K5HA 2CWPA 3EIVA 3CCUA 4DV2L 3W5OA 3SGIA 4YWKA 3I4NH 1E24A 1HZBA 4P73A 1UEBA 1FVIA 1GVPA 1E7ZA 2PMZE 1TXYA 2UXBQ 1P16A 1XMQQ 2JA8H 2HIXA 1PH6A 2I0QA 2KCMA 1QUQA 3CQZH 2HQLA 1L0WA 2C35B 4DV4Q 4GOPC 3CC4A 4GKKL 4A4IA 4JI7Q 1CSQA 2VQEL 1CKNB 1K83H 1PV4A 5IYCG 4A3FH 4POGA 4DK6C 3S15H 4BBRG 2F4VL 2UUAQ 4O0AA 1D8LA 3RLOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X55 A;  5M3M G;  1A8V A;  3CCL A;  1VCI A;  4JI0 L;  3M3Y H;  1UE6 A;  2EXD A;  1YHB A;  3IRB A;  4LFB Q;  2DGY A;  5LMU L;  1JJG A;  4B3R Q;  2PQA B;  1PH3 A;  2OTL A;  4UPA A;  1Y1V H;  5IYB H;  4IJH A;  3HOX G;  3CPW A;  4JI2 Q;  1CUK A;  2L15 A;  5C4J H;  2K14 A;  5M5X H;  3CCE A;  1PH1 A;  1S3O A;  3AQQ A;  1W3S A;  2RCN A;  3WWV A;  3L0O A;  3TS2 A;  3CCQ A;  4KLK A;  3ULL A;  3J7Z C;  1D7Q A;  1QVC A;  5BR8 Q;  2RHQ B;  4DUY Q;  4LF8 L;  4JI5 L;  3FKI H;  5IP9 H;  5IWA Q;  1QVG A;  4JBJ A;  3K7A H;  4DR5 Q;  1KIX A;  3AFP A;  1X54 A;  1QZG A;  1YJW A;  2VZA A;  4BY1 H;  4A3G H;  2A19 A;  1Q46 A;  3FP9 A;  4QIW E;  2ALY B;  1I5F A;  4P72 A;  1XMO Q;  1Q7Y C;  2I5M X;  4A3E G;  2XTI A;  3ER0 A;  4A3M G;  2OQK A;  2NZH A;  5JEA G;  2UUC Q;  4NXM L;  1JT8 A;  3GDE A;  1FL0 A;  5DLQ E;  4GN5 A;  4A93 G;  1N32 L;  2ZTE A;  1Y1W H;  3F2B A;  3D0F A;  5GAH C;  2EIF A;  4PZ7 A;  1SE8 A;  4DK3 C;  1PH5 A;  2NN6 I;  1VQN A;  4BA2 I;  1VQL A;  1Q8K A;  2K75 A;  2YYZ A;  4C3I H;  5IY0 A;  4POF A;  4HJ8 A;  4A3B G;  2QEX A;  3BZC A;  4C2M H;  4LF4 Q;  4JOI C;  1AH9 A;  1A62 A;  4YHH L;  4DV0 Q;  4GOP B;  2NVQ H;  3RN2 A;  4X6A H;  5HGQ A;  4DR2 Q;  3S2D H;  3PUV A;  2YTV A;  4O2D A;  1R9T H;  4HJA A;  4K0K L;  2N8N A;  1PVO A;  2JA5 G;  3F8T A;  1N34 Q;  3M9B A;  1PA6 A;  4B3S Q;  1QZH A;  1J6Q A;  3I4O A;  4BA1 I;  1M1K C;  1HNX Q;  3M4O H;  1WFQ A;  2D0O A;  4OON A;  1PH8 A;  2HHH L;  1Q82 C;  3CC2 A;  3CC7 A;  4IFD G;  2UXC L;  4DV7 Q;  1O7I A;  2ZTC A;  4BBR H;  5GQO A;  1KRS A;  3T1Y Q;  1H95 A;  2ID0 A;  3NEN A;  1E1O A;  1OXU A;  4DV6 Q;  4JI4 Q;  3S1R H;  1N33 L;  4C3H H;  2JA9 A;  5M3M H;  4Y52 H;  3AFQ A;  1X3E A;  4UP8 A;  1XPR A;  4LF6 L;  2CFM A;  3KJO A;  1YIT A;  2GVB A;  1L1O A;  1NE3 A;  1DGS A;  1BBU A;  4R4O A;  3ULP A;  2WP8 J;  4LUV A;  4DKA C;  1HNZ Q;  3S17 H;  3HOX H;  4BXX G;  4JI8 Q;  1HH2 P;  5LMN Q;  2UUB Q;  3J7A 5;  5J3B A;  1UE1 A;  2HIV A;  2KHJ A;  2EQS A;  3KLW A;  5GAD C;  4JBM A;  1XNQ L;  3L7Z C;  3H3V I;  3I4M G;  4GN4 B;  1J5E Q;  3F1Z A;  1WCM G;  5M3F G;  1BBW A;  3GTQ H;  1WYD A;  2CCZ A;  3S1N H;  4BY7 G;  1PH9 A;  1HJP A;  4A3D G;  3E0E A;  2VS1 A;  1VQ7 A;  1JE5 A;  2JA6 G;  1B8A A;  4PG3 A;  1NJI C;  1KAW A;  4YCU A;  3PO2 G;  3OW2 A;  2R7D A;  4DR6 Q;  5FLM G;  4WJ4 A;  1G6P A;  2OTJ A;  4A3E H;  3G48 A;  3PSI A;  2PQA A;  2Z6K A;  3H15 A;  1XJV A;  4LF7 L;  4A3C G;  3UDI A;  4DR1 L;  1RIP A;  1B7Y B;  2VQF L;  4UY8 C;  2R7Z G;  1K0R A;  1JMC A;  1VQJ A;  2R92 G;  4DV5 Q;  1EIY B;  4LUZ A;  1X3F A;  2IHE A;  3PUY A;  5E7N A;  3CME A;  4DUZ L;  3K81 C;  4A93 H;  4KHP Q;  2K4K A;  2Q2I A;  3ERS X;  1EWI A;  3HOY G;  1N8R C;  2Y0S G;  4JI6 L;  2UXD L;  2IY5 B;  1YIJ A;  4DV2 Q;  4GKJ L;  4DR4 L;  1XNR L;  4JV5 L;  1VQF A;  4PMW A;  4B3T L;  4R4T A;  4A3B H;  4X62 L;  3J81 i;  3CCJ A;  2JA7 G;  5JEA J;  1OXX K;  2JJQ A;  4TQU S;  1KQS A;  1BVS A;  4HJ5 A;  1MIU A;  2YV5 A;  4QGU A;  2ZM6 Q;  4GKK Q;  1SR3 A;  1PH2 A;  1OXV A;  4A76 A;  2VQE Q;  4DR7 L;  2E2H H;  2YTY A;  2JA5 H;  3HKZ E;  1TWA H;  2F4V Q;  2AMC B;  3E9H A;  1VQH A;  3KF6 A;  3GTJ H;  1SRO A;  5JJL A;  2Q2U A;  2VNU D;  1LTL A;  3A5U A;  4QJF A;  4IJL A;  1HNW L;  2AWO A;  1I94 L;  2OWO A;  5LMU Q;  2KEN A;  5JJI A;  3CAM A;  1SRU A;  3M85 A;  1CKO A;  2BA1 A;  2HT1 A;  2R93 G;  4HIK A;  3RNU A;  2XGT A;  5IYD G;  2I5H A;  4JCV E;  3RLN A;  3MXN B;  4GOP A;  3STB D;  1Z47 A;  4DV1 L;  4LF9 Q;  4BXX H;  4IFD I;  4EQ5 A;  3GD7 A;  1A0I A;  2B3G A;  3M4P A;  2E5L L;  1W2B A;  3I4M H;  3PO3 G;  1X56 A;  4LF8 Q;  4JI5 Q;  4NB3 A;  1SFO H;  3KDF A;  1WCM H;  2ZTD A;  5M3F H;  4BY7 H;  1SMX A;  3J81 c;  1YBY A;  3AYH B;  4YY3 L;  1PYS B;  1VQ5 A;  3S24 A;  3BU2 A;  3J81 j;  4RG1 A;  4TVA B;  3KJP A;  4A3D H;  4H02 A;  5C4X G;  2GN5 A;  4LW1 A;  2JA6 H;  3RR5 A;  3CXC A;  1CSP A;  1IBM L;  2VL6 A;  3HOZ H;  3PO2 H;  5IWA L;  4QY7 A;  2NVX H;  4LFA L;  4GLV B;  1YNX A;  1YVC A;  5FLM H;  3G71 A;  1IBL L;  4HID A;  4NXM Q;  4A3C H;  3CW2 C;  2FXQ A;  1VQG A;  3STB C;  3EN2 A;  2NVY H;  3PF4 A;  5ELN A;  2R7Z H;  3HOW G;  4GNX A;  2WAQ G;  4GS3 A;  2R92 H;  5GAE C;  4EX5 A;  2B29 A;  1VQP A;  3F2D A;  2UUC L;  1Q12 A;  3HOU G;  1KXL A;  3HFZ B;  3HOY H;  2VY3 A;  2D0P A;  5IP7 G;  3Q8D A;  2QGQ A;  1FJG L;  3G4S A;  4JI3 Q;  5M5Y H;  3CD6 A;  4OX9 L;  4MTN A;  4DNI A;  1VQM A;  2A1A A;  4J15 A;  3J80 i;  4DAM A;  1TWC H;  5FLX c;  4MNO A;  4X64 L;  1TWF H;  1GKH A;  3ULJ A;  3ZJY C;  3M7N A;  3NBH B;  1E3P A;  2JA7 H;  1VQD A;  3K80 C;  4C3J H;  3JAM i;  1Z9F A;  4A75 A;  2UU9 L;  4LNQ A;  4LF4 L;  2MQH A;  3S2H H;  5IYC H;  4DV3 Q;  1C0A A;  2BH2 A;  1I3Q H;  3TQY A;  3H3V H;  1PHJ A;  4DR3 L;  4LFC Q;  2HHH Q;  4GLA C;  2Z0S A;  1L1O C;  4IPD A;  1IXR A;  4YCV A;  5IT9 c;  2H5X A;  2MNA A;  1KC8 C;  3S1Q H;  2UXC Q;  1EYG A;  2I5L X;  4JBW A;  4JI1 Q;  3RLF A;  3OTO L;  4JOI A;  4P71 A;  2KCT A;  2E2J H;  2E8G A;  3TS0 A;  1HR0 W;  1HZC A;  1HNX L;  4JYA L;  1JB7 A;  4LF6 Q;  1A63 A;  4ALP A;  1VQA A;  3CCR A;  4A3K G;  4UP9 A;  1HR0 L;  1TWG H;  1Q1B A;  1U0L A;  5GRO A;  1C7Y A;  2NVT H;  2R93 H;  3PIP A;  5IYD H;  4OO1 G;  4A3L G;  1I6H H;  3W1G A;  1CKN A;  4X66 L;  2QA4 A;  1XNQ Q;  1SLJ A;  3S1M H;  3HKS A;  1L2F A;  1GD7 A;  4KHZ A;  4NXN L;  4JC0 A;  3J80 c;  4MZ9 A;  4YCW A;  4JG2 A;  4X65 L;  3VDY A;  2BH8 A;  3PO3 H;  4JI8 L;  1K8A C;  2UUB L;  5C0X I;  2Z6K C;  4OXP A;  1MJE A;  2K52 A;  4K0K Q;  1G51 A;  1VQC A;  2IHF A;  1WOC A;  3JAM c;  5IE8 A;  1J5E L;  1AE2 A;  1Q1E A;  2WB1 E;  4R4C A;  2F52 A;  4R4I A;  5IP9 G;  4AQY L;  1UWV A;  4A3M H;  3GTG H;  4B3M Q;  4AIM A;  4LUO A;  3T1H L;  4LF5 L;  4LF7 Q;  4AYB G;  1YI2 A;  3DM3 A;  1IBK L;  4DR1 Q;  2JE6 I;  2VQF Q;  1S72 A;  5M5W H;  2R6G A;  4ME3 A;  5ELO A;  1NBW A;  2LXJ A;  3AEV A;  3A74 A;  4DPG A;  5C3E G;  2OQ0 A;  3CPF A;  4OWW B;  1VQB A;  3G6E A;  3HOW H;  1UE5 A;  1NMF A;  2GVA A;  2OCE A;  4L5T A;  4JI6 Q;  2UXD Q;  3U4V A;  3GTP H;  3PUZ A;  1N36 L;  3ICE A;  5JJK A;  1V1Q A;  1XNR Q;  3HOU H;  2DUD A;  2PI2 E;  5AJ3 L;  1YEZ A;  4A3J G;  2WFW A;  1K8G A;  2IX1 A;  1GO3 E;  5IP7 H;  4JV5 Q;  4B3T Q;  1M90 C;  4IOA A;  1KHI A;  4XIG S;  1EQQ A;  2UXB L;  4IPG A;  1K3R A;  1XMQ L;  1EFW A;  4KI0 A;  3D31 A;  1B70 B;  1NMG A;  2CWA A;  3UDX A;  4IPH A;  1L1O B;  3TRE A;  1FGU A;  1HZ9 A;  4A3I G;  3M4Q A;  4QQB X;  5K36 G;  3BZK A;  4Y7N H;  4DV4 L;  3U58 A;  1NTG A;  1NY4 A;  1XTD A;  3FHW A;  1ASY A;  4DAY B;  4JI0 Q;  4DR7 Q;  5GAG C;  1IYJ B;  1SN8 A;  2N78 A;  4JI7 L;  1HZA A;  2AKW B;  4FDB A;  2ES2 A;  1CKM A;  2KBN A;  5C0X G;  2JQO A;  1MKH A;  5FJ8 G;  3HKZ G;  2JEA I;  2BA0 A;  2ZM6 L;  2UUA L;  1GM5 A;  1E1T A;  2ASB A;  3CCV A;  2D62 A;  1I94 Q;  1HNW Q;  1X65 A;  4YWL A;  3GTO H;  1N9W A;  1I50 H;  3F2C A;  4GN3 B;  3S16 H;  4LFB L;  1VS0 A;  2K50 A;  3NEM A;  3U50 C;  4B3R L;  3EBE A;  4HJ9 A;  1IZ6 A;  4HIM A;  4A3K H;  4IFD J;  4DV1 Q;  4JI2 L;  3KOJ A;  4PZ8 A;  3DLL A;  1LUZ A;  4BBS G;  2F3I A;  4R4Q A;  3HOV G;  4UP7 A;  4A3L H;  1AE3 A;  4NPS A;  1VQ8 A;  4YWM A;  2E5L Q;  2B63 G;  1T9H A;  3CF5 A;  4L5S A;  5BR8 L;  4DUY L;  4R1J A;  1EIF A;  4LF9 L;  4YY3 Q;  4LWC A;  4DR5 L;  2VUM G;  2N49 A;  1BKB A;  4L5Q A;  3CMA A;  1YJN A;  1ASZ A;  1IBM Q;  3H0G G;  3W1B A;  2VW9 A;  4GNX C;  4OO1 I;  4LFA Q;  1VQ4 A;  1XMO L;  4IPC A;  1KD1 C;  1PYB A;  1QUQ B;  2MO0 A;  4IOC A;  1IBL Q;  2LXK A;  1N32 Q;  1V9P A;  1C9O A;  3I56 A;  3RZO H;  1VQ9 A;  1YHA A;  2IX0 A;  2ZJQ A;  1RL2 A;  3L2P A;  3K0X A;  3PUW A;  5C44 G;  1S40 A;  3KFU A;  5C3E H;  1XPO A;  1U5K A;  1Q86 C;  3CP0 A;  4IO9 A;  2WAQ E;  1OXS C;  1WI5 A;  4YHH Q;  2ZJR A;  2RHS B;  3OYY A;  1PH7 A;  1FJG Q;  4OWT B;  3I4N G;  4OX9 Q;  1MJC A;  3B6Y A;  3KF6 B;  4A3J H;  1IL2 A;  1JJC B;  2LSS A;  2CQO A;  4X64 Q;  1Y14 B;  3E9I A;  1TWH H;  1EQR A;  3PUX A;  4OWX B;  2JA8 G;  4HIO A;  5EAY A;  5H1S E;  4L5R C;  1VQ6 A;  2YTX A;  4DV0 L;  1LYL A;  4JI3 L;  2KHI A;  2V1C C;  2UU9 Q;  4DR2 L;  3RN5 A;  4QL5 A;  1X6O A;  3UE0 A;  4GLX A;  1VQO A;  4RMF A;  3GTK H;  1VQE A;  4A3I H;  1WJJ A;  4B3S L;  4DR3 Q;  1N34 L;  3KYH C;  3NEL A;  4A3F G;  2Q2T A;  4JBK A;  1N33 Q;  3MEF A;  3PV0 A;  2NZO A;  1PH4 A;  3CCM A;  4PZ6 A;  1K9M C;  4DV3 L;  3OTO Q;  3UDF A;  4AH6 A;  1JJ2 A;  4DV7 L;  5FJ8 H;  3UDG A;  3KDF B;  3T1Y L;  4JYA Q;  2R7F A;  2MFI A;  5HY6 A;  4LFC L;  3K7U C;  4DV6 L;  3PF5 A;  4APV A;  4JI4 L;  1X9N A;  3A5Z B;  1Y1V G;  1UE7 A;  5IYB G;  2K5V A;  4JI1 L;  3GO5 A;  5LMN W;  1K73 C;  1HR0 Q;  3TEH B;  1HNZ L;  3PIO A;  1G29 1;  1PFS A;  4P74 A;  4X66 Q;  1XPU A;  3GTM H;  5LMN L;  3I2Z A;  4BBS H;  3HOV H;  1X3G A;  3I55 A;  1LM0 A;  2PNH A;  1YHQ A;  2E2I H;  3GTL H;  5C0X J;  4NXN Q;  4WJ3 M;  4X65 Q;  1V43 A;  1KL9 A;  3FKI G;  3K8A A;  2B63 H;  5C4X H;  3RZD H;  4GNX B;  3S14 H;  1EUJ A;  1VQK A;  1E22 A;  1KRT A;  1YZ6 A;  3BJU A;  3TRZ A;  1VQI A;  3U4Z A;  2CKZ B;  2PI2 A;  4BY1 G;  4A3G G;  2RF4 A;  3UE1 A;  2NN6 G;  4AQY Q;  2YU9 H;  2VUM H;  2ATW A;  3PCO B;  2N3S A;  1YJ9 A;  3T1H Q;  4LF5 Q;  3H0G H;  2K5N A;  2WB1 G;  4DR6 L;  1IBK Q;  2IT1 A;  2JEB I;  4DUZ Q;  1EOV A;  2AWN A;  4XTC S;  2JK8 A;  2AHO B;  3HOZ G;  2Q2H A;  1QVF A;  1Q81 C;  4AYB E;  2A8V A;  1OTC A;  4GKJ Q;  1Y1W G;  4B3M L;  4DR4 Q;  2MO1 A;  2ZJP A;  2Y0S E;  4DV5 L;  3A0J A;  5C44 H;  3CCS A;  4P75 A;  4HJ7 A;  3PGZ A;  4X62 Q;  4KHP L;  3LGJ A;  1P8L A;  1N36 Q;  1OXT A;  3I7F A;  3JC6 6;  3KF8 B;  5AJ3 Q;  2K5H A;  2CWP A;  3EIV A;  3CCU A;  4DV2 L;  3W5O A;  3SGI A;  4YWK A;  3I4N H;  1E24 A;  1HZB A;  4P73 A;  1UEB A;  1FVI A;  1GVP A;  1E7Z A;  2PMZ E;  1TXY A;  2UXB Q;  1P16 A;  1XMQ Q;  2JA8 H;  2HIX A;  1PH6 A;  2I0Q A;  2KCM A;  1QUQ A;  3CQZ H;  2HQL A;  1L0W A;  2C35 B;  4DV4 Q;  4GOP C;  3CC4 A;  4GKK L;  4A4I A;  4JI7 Q;  1CSQ A;  2VQE L;  1CKN B;  1K83 H;  1PV4 A;  5IYC G;  4A3F H;  4POG A;  4DK6 C;  3S15 H;  4BBR G;  2F4V L;  2UUA Q;  4O0A A;  1D8L A;  3RLO A; 
#chains in the Genus database with same CATH topology
 1I4X A;  1QCB D;  3CCL A;  4JI0 L;  1VCI A;  1YHB A;  1ZEQ X;  1SXT A;  3JAM E;  2OTL A;  1WD1 A;  4MTK A;  2K14 A;  5M9O A;  4L6T B;  4RH6 A;  1STE A;  5M5X H;  3AQQ A;  1W3S A;  2RCN A;  3WWV A;  3TS2 A;  3LX0 A;  4A3I B;  3D3R A;  1D7Q A;  5BR8 Q;  4JI5 L;  2NB0 A;  2Z6B A;  1QZG A;  3FEW X;  4FXK C;  2B8G A;  4BY1 H;  3OSO A;  2A19 A;  1Q46 A;  4A3G H;  2ALY B;  1I5F A;  1XMO Q;  4A3E G;  3ER0 A;  2SOB A;  4A3M G;  2OQK A;  2NZH A;  3WOF A;  2UUC Q;  2RVL A;  1BUV T;  2VXW A;  4WFN 3;  1S5B D;  3DM1 A;  1N32 L;  1Y1W H;  5DM6 3;  3F2B A;  2MP1 A;  4LMQ D;  1PH5 A;  1CQV A;  4C3I H;  4POF A;  4P2C B;  2QEX A;  4LF4 Q;  1CT1 D;  4JOI C;  4QIW B;  5EPL A;  1A62 A;  2NVQ H;  3RN2 A;  2WIN B;  5JVG 3;  5HGQ A;  1AP0 A;  2CW0 D;  3PUV A;  1R9T H;  2JA5 G;  1PA6 A;  1HUN A;  1QZH A;  1J6Q A;  3I4O A;  1H9R A;  4BA1 I;  1HNX Q;  1WFQ A;  3MTS A;  1SNM A;  1TII D;  2LS0 1;  4OGQ C;  4DV7 Q;  2F4I A;  4BBR H;  1LTI D;  3T1Y Q;  4RA8 A;  4JI4 Q;  3S1R H;  1XPR A;  1PLF A;  4LF6 L;  3K57 A;  3OW7 A;  1BBU A;  4IUN A;  1NR4 A;  4IAL A;  1BCP B;  1WTO A;  2CW0 C;  2UUB Q;  3J7A 5;  4KN7 C;  2HIV A;  5IGC A;  2EQS A;  1SJE D;  1JQY D;  1J5E Q;  4UDU C;  1AN8 A;  1WYD A;  1HJP A;  3E0E A;  4DXF A;  3WDN A;  1PRT F;  1VQ7 A;  3M3Y B;  4PG3 A;  3GV6 A;  4K8J A;  4YCU A;  1NJI C;  4ZKB B;  4WOR A;  3KBX A;  4L8J A;  3QWN A;  4HR7 B;  3OIP A;  2OTJ A;  1Y1V B;  2Z6K A;  3QOL A;  1XJV A;  2XRQ D;  2IJ0 A;  1B7Y B;  1GXD C;  1QJO A;  5JEA H;  2GA4 B;  1K0R A;  2R92 G;  4LUZ A;  1X3F A;  1GUO A;  1CM9 A;  5C4Z A;  2Q2I A;  3ERS X;  2IY5 B;  3FKI B;  1YIJ A;  1TT2 A;  4RWS C;  3FPP A;  4RCN A;  2EYL A;  4R4T A;  2F03 A;  4KKT A;  4XQJ A;  2Q8T A;  4N8X 1;  4TQU S;  2YV5 A;  4F7X A;  4M8A A;  1OXV A;  4DR7 L;  2E2H H;  3MXU A;  1SE4 A;  3A55 A;  4IUQ A;  2AMC B;  3E9H A;  1A2U A;  5F2D A;  1DOM A;  1KDB A;  1LTL A;  4QJF A;  2KEN A;  5IGG A;  5JJI A;  1HRJ A;  3M85 A;  1SRU A;  4KTA A;  2R93 G;  1ICF B;  4J1M A;  3DXJ C;  1SE2 A;  4IUU A;  3RLN A;  4IZ8 A;  3S2D B;  2EJG C;  1BOS A;  3STB D;  3C2P A;  2B2Y A;  4LF9 Q;  4IFD I;  2ZT9 C;  1EYD A;  3VR4 A;  4IUR A;  4NB3 A;  2I46 A;  3KDF A;  2ZTD A;  5CYU A;  3BZD B;  4BY7 H;  1BXT A;  3AYH B;  3BU2 A;  3KJP A;  4RG1 A;  5C4X G;  4C3H B;  3RR5 A;  3JAM L;  2EE1 A;  3HOZ H;  2NVX H;  4LFA L;  1LT3 D;  1JC7 A;  3G71 A;  3S17 B;  1YNJ D;  4ZCK A;  3CW2 C;  2L0C A;  3STB C;  3EN2 A;  3PF4 A;  4ZLT F;  2R7Z H;  3HOW G;  2OEO A;  4GNX A;  2A73 B;  5GAE C;  2B29 A;  4UHV A;  3SR1 A;  3GTQ B;  4K6L A;  1BDO A;  3S1N B;  2KOL A;  3HFZ B;  2VY3 A;  2D0P A;  3CD6 A;  4DNI A;  3K5M A;  2A1A A;  4DAM A;  1XWE A;  2D9U A;  3M7N A;  4UAI A;  3GV3 A;  4CDD C;  1E3P A;  2JA7 H;  1EYA A;  3K80 C;  3JAM i;  3NK9 A;  4LNQ A;  1C0A A;  2X69 A;  5IYC H;  5I2X A;  1UEA B;  1I3Q H;  4FO2 A;  3TQY A;  2BH2 A;  3H3V H;  1A6X A;  3KF8 A;  4IPD A;  1Z7T A;  4XQN A;  2MNA A;  4A93 B;  2H5X A;  1BF4 A;  2F0N A;  1CZG A;  3K5O A;  3TZD A;  4JI1 Q;  1C8C A;  1HZC A;  3VR3 A;  1PZJ D;  4JYA L;  1JB7 A;  3WOE A;  4CDF C;  1FNW A;  3BDC A;  4YIJ A;  3A7A B;  2N55 A;  1HXY D;  1LTA D;  1TWG H;  1U0L A;  5IYD H;  1ILQ A;  1CKN A;  1KNA A;  2QA4 A;  1XNQ Q;  1SLJ A;  1U4R A;  4CHT B;  4LJZ C;  4F88 A;  1GD7 A;  3EFX D;  4X65 L;  2QCP X;  1K8A C;  4CJ2 C;  1PTO D;  2Z6K C;  3JAM c;  5IP9 G;  4A3M H;  1QNU A;  1SNO A;  1UWV A;  3CRL C;  4AIM A;  4KMU C;  4LUO A;  3ONA B;  4PMC A;  3I73 A;  2IWH A;  4AYB G;  1X32 A;  3SE0 A;  5CV7 A;  1TY2 A;  4ZUJ A;  4ME3 A;  2EOT A;  1NBW A;  4IUT A;  3QIA A;  3A74 A;  4DPG A;  5FLX E;  1JWU D;  2H4O A;  3CPF A;  4OWW B;  1D1I A;  3MAQ A;  4G4K A;  1UE5 A;  5FOB B;  4L5T A;  3U4V A;  1WCM B;  1XNR Q;  4LK1 C;  2PI2 E;  1F2L A;  1PTO C;  1YEZ A;  2IX1 A;  1AEX A;  5IP7 H;  1VMP A;  1IKM A;  1KHI A;  2JA6 B;  5EKI A;  5IT9 E;  2UXB L;  3HEJ A;  1B70 B;  2G9H D;  3FMC A;  3TRE A;  4DV4 L;  1XTD A;  3Q6S A;  1O7Y A;  1ASY A;  3NHH A;  1IYJ B;  4JI7 L;  2AKW B;  4XXE A;  1CKM A;  2KBN A;  1MKH A;  1JOR A;  3TDQ A;  4Q5V A;  3HOY B;  2IW3 A;  1KDA A;  1X65 A;  3F2C A;  3TN2 A;  3UI2 A;  3S16 H;  1CHP D;  4LFB L;  4B3R L;  4DAV A;  2EVB A;  3EBE A;  1IZ6 A;  3NBH A;  4C3J B;  2TMP A;  4UP7 A;  4OO1 H;  4QUC A;  3U9O A;  2B63 G;  1SAP A;  3S1Q B;  1EIF A;  3MFY A;  1SE3 A;  4YY3 Q;  4LWC A;  3G6J B;  2VUM G;  1EOT A;  3IKJ A;  1BKB A;  1IYU A;  2L4N A;  3I70 A;  2VW9 A;  4G57 A;  4GNX C;  1VQ4 A;  1PYB A;  2XWB B;  1KLG D;  2LXK A;  1V9P A;  2NVT B;  1C9O A;  3IFD A;  4XQQ A;  1EEF D;  1YHA A;  5C44 G;  1G2T A;  3OMC A;  2PW5 A;  2K01 A;  5C3E H;  4X3T A;  2XSC A;  4F87 A;  3CP0 A;  4YHH Q;  1WI5 A;  1QOH A;  3PO3 B;  2ZJR A;  5CV8 A;  1PH7 A;  4OWT B;  1SBB B;  1D6E C;  2LSS A;  5ISR A;  4KJO A;  1TS4 A;  4OWX B;  4DFA A;  4HIO A;  2I07 B;  3E0J A;  3P7J A;  4JI3 L;  1QNK A;  4CJ0 B;  2L9H A;  3RN5 A;  1V1P A;  3UE0 A;  5I2Y A;  1VQO A;  3SK8 A;  5M5W B;  1WJJ A;  2AUK A;  3SXH A;  3KYH C;  4DR3 Q;  4A3F G;  4TKO B;  3MEF A;  3OWE B;  4G7O C;  2WAQ B;  1JJ2 A;  2Z9H A;  4AH6 A;  3GTP B;  3T13 A;  5FJ8 H;  3KBG A;  1TS3 A;  2MFI A;  4APV A;  3TP5 A;  5LHY 1;  1K73 C;  3DWQ A;  5ELD A;  1I4H A;  3SK6 A;  3X3M A;  2K32 A;  1XPU A;  1KDC A;  3R8B A;  4BBS H;  2QDL A;  1X3G A;  4G7H C;  1LM0 A;  4RHS A;  3GTL H;  1SYC A;  1STG A;  5C0X J;  4NXN Q;  1KL9 A;  2EJM A;  5C4X H;  1ET9 A;  2MHV A;  3DEO A;  1KRT A;  1YZ6 A;  3BJU A;  3TRZ A;  3U4Z A;  2PI2 A;  4BY1 G;  4A3G G;  2RF4 A;  4AQY Q;  2YU9 H;  3GTO B;  2N3S A;  2XVS A;  1YJ9 A;  2HDL A;  3T1H Q;  1EY0 A;  4DR6 L;  1IBK Q;  2JEB I;  4DUZ Q;  1EOV A;  2AWN A;  4H7B A;  3J7A V;  1QVF A;  2IL8 A;  4AYB E;  2KEE A;  1Y1W G;  1I4R A;  3OOC A;  3C3L A;  4HJ7 A;  2LMC B;  3I90 A;  4X62 Q;  4KHP L;  1RTN A;  1P8L A;  1N36 Q;  4C3I G;  1IYV A;  2K5H A;  3W5O A;  3I4N H;  2PCF B;  1E24 A;  2DJF C;  2FMC A;  5CV4 A;  1UEB A;  1FVI A;  1GVP A;  4QCL A;  3VA5 A;  1HA6 A;  2JA8 H;  2HIX A;  5CC4 A;  2KCM A;  1L0W A;  3ERQ A;  5FLX L;  3CC4 A;  3NXW A;  2Y0S B;  2VQE L;  1A3T A;  4CDC C;  4POG A;  3K0Y A;  3T16 A;  3S15 H;  1STA A;  4BBR G;  5I9O A;  2UUA Q;  1X55 A;  1GHK A;  2PYK A;  3P1H A;  1T5X D;  5IT9 L;  4A3J B;  3IRB A;  2M9V A;  5LMU L;  1TWH B;  1EZ6 A;  4XT3 B;  1PH3 A;  4X3U A;  4HCS A;  5IYB H;  3CPW A;  2HCC A;  1CUK A;  4JI2 Q;  4U68 A;  2B2U A;  5C4J H;  1B2T A;  1X3Q A;  1PH1 A;  1S3O A;  2PZU A;  3L0O A;  4JW0 A;  4KLK A;  2K03 A;  3J7Z C;  3GTK B;  3QB3 A;  1STH A;  1QVC A;  1BCP C;  1HTP A;  2K33 A;  4LF8 L;  5IP9 H;  5IWA Q;  4PMB A;  3AFP A;  3HKZ B;  5I6Y A;  3FRP B;  5KYI A;  1QIL A;  1LT4 D;  3FP9 A;  2NN6 H;  4RAU C;  1Q7Y C;  1JCK B;  2I5M X;  1SJH D;  2DJG C;  2F0K A;  5JEA G;  4NXM L;  2PW7 A;  2F0E A;  1JT8 A;  3GDE A;  4EGV A;  5DLQ E;  2JXM B;  3HOV B;  2XRS D;  3D0F A;  2E2I B;  1JWS D;  3V2T A;  1FNV A;  2XWJ B;  4CKE A;  4BA2 I;  1MGS A;  3RZD B;  2YYZ A;  1ICW A;  4NMZ A;  3S14 B;  5IY0 A;  2PZT A;  4HJ8 A;  3MVV A;  1DOK A;  3KLR A;  2EYM A;  3BZC A;  4C2M H;  1I4P A;  4DV0 Q;  3H0G B;  2XNA C;  2EY2 A;  4K0K L;  1PVO A;  1N34 Q;  1S5F D;  1W6J A;  1G6Z A;  4RGM A;  2UXC L;  2ID0 A;  4DV6 Q;  1N33 L;  1EQV A;  5M3M H;  1HUM A;  3HG9 A;  4I65 A;  2FJ2 A;  3ULP A;  3AMU A;  2NWG A;  5KGU A;  3OPO A;  3NTI A;  1TKW B;  3HOX H;  5ELB A;  2ICE C;  2F0T A;  5J3B A;  2KHJ A;  3D4R A;  3H3V I;  3F1Z A;  1K83 B;  5ELF A;  3FDT A;  1EWC A;  4BY7 G;  2CCZ A;  5JPM C;  3CKI B;  2VS1 A;  2KUM A;  3D6W A;  5NUC A;  1EWH A;  2WV6 D;  1HQM C;  1HQR D;  3IFT A;  2R7D A;  2LFN A;  1TS2 A;  1GJX A;  3H15 A;  1E2Z A;  4DR1 L;  2B8F A;  4IN3 A;  2VQF L;  5E1F A;  3R2T A;  4UY8 C;  2R7Z G;  3MZ5 A;  1VQJ A;  4DV5 Q;  3PMF A;  5E7N A;  3CME A;  1SNC A;  2JYO A;  1F2Z A;  2K4K A;  3BDO A;  4X3K A;  4JI6 L;  2A69 D;  2UXD L;  2P5Z X;  4GKJ L;  3K7A B;  1VQF A;  4B3T L;  1WTW A;  4A3B H;  3CCJ A;  2JA7 G;  3PQI A;  2F0S A;  1KQS A;  1ENA A;  2WB1 B;  3Q24 A;  4QGU A;  2ZM6 Q;  4GKK Q;  3D8G A;  1PH2 A;  3NQT A;  2YTY A;  3HKZ E;  3IAY A;  1RDP D;  1VQH A;  3GTJ H;  2R61 A;  2B2U C;  2A69 C;  4IJL A;  4O1N A;  1EY9 A;  3CAM A;  1K8O A;  2BA1 A;  3T4A C;  4HIK A;  2ENB A;  4FYD A;  5IYD G;  4JCV E;  2SNS A;  2K5Q A;  5BN3 A;  1IL8 A;  4DV1 L;  1CZW A;  4BXX H;  4FF3 A;  4EQ5 A;  1Q90 A;  3M4P A;  2B3G A;  2E5L L;  3I4M H;  3M4O B;  1X56 A;  4JI5 Q;  1SFO H;  1F2Y A;  4Z9C B;  5M3F H;  5ELC A;  3VA7 A;  4A3D H;  2GN5 A;  1UAP A;  3NQI A;  4LW1 A;  5EBC A;  3CXC A;  1CSP A;  1IBM L;  2VL6 A;  4V19 0;  3PO2 H;  2KED A;  4GLV B;  1YVC A;  4HID A;  1VF7 A;  1STB A;  1HA5 A;  2NVY H;  3RUZ A;  1IKL A;  3K59 A;  4IQZ A;  3ND8 A;  3MA2 B;  3F2D A;  2UUC L;  1D5M C;  1Q12 A;  1KXL A;  4S3S A;  4C1N K;  3L3O C;  4HN7 A;  5IP7 G;  3Q8D A;  2QGQ A;  2BE5 C;  5M5Y H;  3MC0 B;  4QMG A;  4OEM B;  4KJN A;  1TWC H;  4MNO A;  3NUC A;  1Z6H A;  2E75 C;  3NBH B;  3Q23 A;  4A3E B;  2F0L A;  2EXZ A;  1Z9F A;  3S2H H;  4ZKC B;  4LF4 L;  4DV3 Q;  4A3M B;  5I4D A;  3D4D A;  2J4X A;  1EL0 A;  3DWA A;  4QF4 A;  2O5J C;  1D1K A;  4LFC Q;  3P20 A;  3RD4 A;  4YCV A;  2SDF A;  1IXR A;  2F3W A;  1B3Q A;  1EIH A;  1EYG A;  4JBW A;  2E2J H;  3P75 A;  2K05 A;  1HNX L;  3FVQ A;  4LF6 Q;  2WKD A;  1A63 A;  4ALP A;  1SYE A;  1VQA A;  1SSO A;  1LT5 D;  1HR0 L;  1Q1B A;  4HTH A;  1C7Y A;  3PIP A;  1FD7 D;  3A8I E;  4OO1 G;  4PV1 C;  3W1G A;  3O13 A;  3S1M H;  1PTO H;  2KEC A;  1B3A A;  1WTV A;  1SMY D;  2JA5 B;  5IGF A;  2B2T A;  2A74 C;  1TWA B;  4YCW A;  4K5X A;  2UUB L;  1VQC A;  2WII B;  2FFK B;  1B50 A;  1J5E L;  3S9W A;  2EPB A;  2WB1 E;  5I9P A;  2F52 A;  1C48 A;  4B3M Q;  3K5L A;  1PTO F;  2B2W A;  4LF5 L;  2N88 A;  1V1P B;  1CA6 A;  3BDL A;  3C1F A;  3DM3 A;  3I72 A;  5KEE A;  1S72 A;  3MFG A;  5ELO A;  2LXJ A;  2F0W A;  5C3E G;  2OQ0 A;  1GUW A;  1DOL A;  3G6E A;  4FP5 D;  1SMY C;  1NMF A;  2GVA A;  3DWP A;  3ICE A;  4ILW A;  3HOU H;  3RMH A;  1STN A;  1F9R A;  3AB9 A;  5ELE A;  1JOO A;  1NCV A;  4DK1 A;  4IOA A;  1ZXT A;  1PZK D;  1EQQ A;  4IPG A;  1XMQ L;  2IX3 A;  1TVX A;  3DMU A;  3SHL A;  1HZ9 A;  3EQL C;  1HTL D;  4MHE A;  4FVM A;  4DR7 Q;  1NY4 A;  3FHW A;  1SN8 A;  2R92 B;  1HCZ A;  1TR5 A;  5FJ8 G;  2JEA I;  1GM5 A;  2D5D A;  2XIW A;  2RKS A;  2D62 A;  4YWL A;  5LL6 S;  1N9W A;  5A2Q E;  4OIK A;  5CV9 A;  1TWF B;  2K50 A;  4A3K H;  1H9S B;  2PPB C;  2PMZ B;  3KOJ A;  4BBS G;  3DLL A;  3R93 A;  4A3L H;  4WJW A;  3HGB A;  2FMM A;  2CH4 A;  3GP7 A;  1A3V A;  2F0F A;  4DUY L;  4R1J A;  3VR6 A;  4LF9 L;  1HPC A;  1XXG A;  3T56 B;  4KHV A;  4DR5 L;  1F9P A;  1MBY A;  2N49 A;  4L5Q A;  1M4V A;  4LFA Q;  4I7Z C;  4OL7 A;  3SK4 A;  2R93 B;  3RZO H;  1VQ9 A;  2IX0 A;  1I6H B;  1MSH A;  5IGB A;  4NP5 A;  1RKN A;  1U5K A;  1WTR A;  1Q86 C;  1NUC A;  5D65 A;  3I4N G;  2F0G A;  1SYF A;  4RGT A;  3J7A F;  5C4X B;  3E9I A;  2JA8 G;  3GTG B;  2NBF A;  5EAY A;  1VQ6 A;  2KHI A;  4DR2 L;  4DAP A;  4GLX A;  4RMF A;  1VQE A;  4A3I H;  4JBK A;  4B3S L;  5K36 H;  2Z1C A;  2Q2T A;  5EJW A;  5JOB A;  1PH4 A;  4DGZ A;  3LWE A;  3HOW B;  4LAA A;  3PIP 3;  5C0X H;  4DN4 M;  5DAU A;  3C46 A;  4JYA Q;  2R7F A;  3K7U C;  5EQ0 A;  1QB5 D;  1I4Q A;  3A5Z B;  1I6V C;  2B2T C;  3MXG A;  5IYB G;  4JI1 L;  3GO5 A;  2KHS A;  3TEH B;  4EVO A;  1HNZ L;  3PIO A;  4P74 A;  1C4Q A;  1ZYR D;  5LMN L;  2ZXO A;  1CQF A;  4XYO A;  4Y7N B;  3I55 A;  2PNH A;  4WJ3 M;  1B53 A;  4X65 Q;  1Y8P B;  1E22 A;  4HMI A;  3K6O A;  1JOQ A;  3UE1 A;  2NN6 G;  3DEP A;  2O5I C;  1KLU D;  1I50 B;  4CBV A;  2IT1 A;  2MGS A;  4K2K A;  2JK8 A;  1Q81 C;  1WTP A;  2A8V A;  4DR4 Q;  1ZYR C;  2MO1 A;  5E4W C;  2E2D C;  3A0J A;  2ZXR A;  4P75 A;  3H6M A;  3PGZ A;  1PFB A;  3I91 A;  5COY A;  3R3O A;  1GUN A;  3CCU A;  4DV2 L;  1LAB A;  1V1O A;  1NAP A;  2PMZ E;  1E7Z A;  2L5T A;  2UXB Q;  1P16 A;  3LNN A;  2WKC A;  4R8I A;  1PH6 A;  4AYB B;  1K8M A;  1F9Q A;  2F3V A;  4DV4 Q;  1EEI D;  1LTR D;  5CV5 A;  4JI7 Q;  2B2Y C;  2JSO A;  2VB2 X;  4B08 A;  1STY A;  2F4V L;  4QUF A;  4O0A A;  1D8L A;  5C5M A;  3J80 E;  3TBI B;  5M3M G;  3M3Y H;  1UE6 A;  2L12 A;  1BCP F;  1H9J A;  1L0Y B;  2EXD A;  1Y8N B;  2RQX A;  2X6L A;  4LFB Q;  2DGY A;  1JJG A;  4B3R Q;  4OIJ A;  1Y1V H;  3HOX G;  2FHT A;  3CCE A;  4XYQ A;  3CCQ A;  2E74 C;  1VMC A;  1GUG A;  2RHQ B;  2QKI C;  3FKI H;  5DNF A;  1QVG A;  4JBJ A;  1KIX A;  4DU9 A;  5A2Q L;  2F0D A;  2VZA A;  1EU4 A;  3BVZ A;  2DNE A;  1JB3 A;  2K5W A;  2AQ1 B;  2B2V A;  4K5W A;  4MN3 A;  3GTM B;  1FL0 A;  4GN5 A;  5GAH C;  3H94 A;  2OT2 A;  2B63 B;  1SE8 A;  3TSS A;  1VQL A;  2WAC A;  4C1N I;  3C1E A;  4A3B G;  1DCZ A;  1U4P A;  4JK1 C;  1Y69 U;  2VUM B;  1WD0 A;  4YHH L;  4RCO A;  4J8Q A;  1S5C D;  3S2D H;  1EY7 A;  2YTV A;  2N8N A;  1L0X B;  1KNE A;  2BDN A;  3F8T A;  1LO5 D;  1M1K C;  4OON A;  5C44 B;  2HHH L;  3CC2 A;  1ONL A;  5T1I A;  1II3 A;  1BO0 A;  3K58 A;  1O7I A;  3PIO 3;  1KRS A;  3KK7 A;  2CVR A;  3NEN A;  1OXU A;  4GZY C;  4C3H H;  2JA9 A;  4Y52 H;  1X3E A;  1J8I A;  3KJO A;  1YIT A;  2Z4H A;  5KNB A;  1ET6 A;  1DGS A;  4LUV A;  4DKA C;  2BCO A;  2O4X A;  3S17 H;  1TS5 A;  4BXX G;  4JI8 Q;  2F0O A;  1HH2 P;  3CQZ B;  1UE1 A;  3I4M G;  3L7Z C;  1V8Q A;  3ND9 A;  5M3F G;  3GTQ H;  3E3X A;  4DNT B;  4A3F B;  4V0B A;  3S1N H;  1PH9 A;  1B44 D;  2Q8I B;  3BS1 A;  3ZYY X;  3ITP A;  4A3D G;  1U4M A;  3NE5 B;  2KCN A;  1JE5 A;  2RDF A;  1B8A A;  3PO2 G;  3OW2 A;  1H9S A;  1S4Z A;  2HCI A;  2QEJ C;  2RCF A;  2TSS A;  2AUJ D;  4DR6 Q;  4WJ4 A;  4LF7 L;  3G48 A;  3PSI A;  2PQA A;  3UDI A;  4ULL A;  1RIP A;  1NNX A;  5M5X B;  1EIY B;  2IHE A;  3PUY A;  4A93 H;  1WTH A;  4DUZ L;  3VR2 A;  4DF7 A;  4KHP Q;  1EY6 A;  4HED A;  2Y0S G;  1Y8O B;  3D6C A;  2RDH A;  1WVL A;  4PNY A;  4ZRZ A;  4JV5 L;  4PMW A;  2EYH A;  4X62 L;  4BY1 B;  2EYP A;  4A3G B;  2R3Z A;  4R9W A;  1WTQ A;  1QG7 A;  4KY6 A;  1ML0 D;  1BCP D;  1OXX K;  4H44 C;  1BVS A;  5C4H A;  4ID6 A;  1RTO A;  3SDZ A;  4A76 A;  1LTS D;  2VQE Q;  3A7L A;  1Y1W B;  3EJI A;  4IFD H;  1PDQ A;  5AFW A;  4O42 A;  4FXD A;  4C3I B;  2VNU D;  5EBD A;  1HNW L;  1I94 L;  4BS9 A;  5LMU Q;  3RNU A;  4XT1 B;  2NVQ B;  1EZ8 A;  2EDG A;  2I5H A;  2F0M A;  2HDM A;  4TRD A;  4GOP A;  1R9T B;  2EYJ A;  4EQP A;  3A8J E;  1CTM A;  1W2B A;  4RKL A;  2L55 A;  4LF8 Q;  4F8M A;  1AZP A;  3J80 L;  1WCM H;  3H91 A;  2NZ1 D;  4NW2 A;  4K5V A;  4BBR B;  3W2D A;  3J81 j;  3OIQ A;  4H02 A;  3S1R B;  2JA6 H;  3I8Z A;  3LWU A;  5IWA L;  4QY7 A;  1R4Q B;  1PRT B;  5FLM H;  1IBL L;  3J7Y W;  4NXM Q;  4A3C H;  2FXQ A;  1VQG A;  4OEL B;  2NTT A;  4EX5 A;  1VQP A;  3SEB A;  4CKC A;  3HOU G;  3HOY H;  1ENC A;  1FJG L;  4OX9 L;  4MTN A;  3J80 i;  3KLS X;  4U67 3;  5FLX c;  2NYZ D;  4HCE A;  4X64 L;  1GKH A;  5IOC A;  3ZJY C;  5J39 A;  1B9M A;  4K0K Q;  4C3J H;  1HHV A;  2UU9 L;  3HS0 C;  1G2S A;  1WTX A;  2Z4I A;  1PHJ A;  4GLA C;  4IUP A;  5IT9 c;  1KC8 C;  1VQ5 A;  3S1Q H;  2UXC Q;  5FO8 B;  1PFN A;  3RLF A;  3OTO L;  4JOI A;  2J0T D;  2H1E A;  2E8G A;  2L1B A;  3MHB A;  4I7A A;  1LT6 D;  4A3K G;  4UP9 A;  5GRO A;  2NVT H;  1RF2 D;  1LTT D;  1DJR D;  4A3L G;  4H13 C;  4X66 L;  1KTK A;  4KV6 A;  2E2H B;  5JJZ A;  2V4D A;  3J80 c;  3VDY A;  1LTG D;  2KA7 A;  4JG2 A;  1I4G A;  4MZ9 A;  1X3P A;  3PO3 H;  5C0X I;  3D4W A;  4OXP A;  1MJE A;  2K52 A;  2RDG A;  4XDX A;  2KVM A;  1AE2 A;  3T51 B;  4R4C A;  5CMD A;  1PYW D;  4ZYS A;  1F9S A;  1H9M A;  1UUP A;  3QG1 A;  4DR1 Q;  2VQF Q;  3IL8 A;  5M5W H;  4TSS A;  3AEV A;  1O7L A;  1VQB A;  1JE4 A;  2OCE A;  4JI6 Q;  2UXD Q;  3TP6 A;  3GTP H;  3PUZ A;  4BY7 B;  2DUD A;  2QDB A;  5TSS A;  3CU7 A;  5AJ3 L;  2WFW A;  3NWT A;  4B3T Q;  2A6E C;  4J6H A;  1KAB A;  4HSP A;  3HOZ B;  1K3R A;  4KI0 A;  2NVX B;  4K14 A;  1NMG A;  4IPH A;  4RHR A;  1L1O B;  1S5E D;  5C3X A;  4A3I G;  4QQB X;  3M4Q A;  3OHX C;  5LL6 X;  5K36 G;  1NTG A;  3U9S A;  1FR3 A;  4JI0 Q;  2R7Z B;  2EYF A;  3F2U A;  2ES2 A;  5C0X G;  4HSV A;  2JQO A;  2BA0 A;  2ZM6 L;  3NP8 A;  2JP1 A;  1FNU A;  1E1T A;  5L37 A;  2ASB A;  1ROD A;  1VDZ A;  2K5D A;  3GTO H;  5CV6 A;  4GN3 B;  2MUY A;  3U50 C;  3DHQ A;  2NTS A;  4HIM A;  4IFD J;  4CJ1 B;  4DV1 Q;  2JA7 B;  1ESF A;  2F3I A;  4R4Q A;  1AE3 A;  2BE5 D;  1JWM D;  4H0L C;  4YWM A;  2AQ2 B;  1I3Q B;  4NDX A;  1T9H A;  2E5L Q;  2DY7 A;  3CF5 A;  4L5S A;  5BR8 L;  1EY8 A;  4IUV A;  5D14 A;  1LLR D;  3URY A;  1ASZ A;  2F0H A;  1IBM Q;  4DK0 A;  4OO1 I;  1XMO L;  1N32 Q;  4IPC A;  1RD9 D;  2MO0 A;  4IOC A;  1TWG B;  2F0U A;  4ABN A;  3I56 A;  4HMJ A;  1O80 A;  3L2P A;  2SNM A;  1BNZ A;  1S40 A;  2KCC A;  3EA6 A;  3T53 B;  1LTB D;  1OXS C;  4K6D A;  3OYY A;  2MJ8 A;  5FKA C;  2CHB D;  3B6Y A;  3KF6 B;  3A8K E;  4A3J H;  3M4Y A;  4OHJ A;  1JJC B;  1Y14 B;  1TWH H;  1EQR A;  1TU2 B;  3I4L A;  5CR3 A;  4L5R C;  1JIC A;  1SND A;  3VYU A;  2HUG A;  1CI3 M;  3BG3 A;  4QL5 A;  1X6O A;  3QO2 A;  3GTK H;  3NEL A;  3PV0 A;  4E6I A;  1U9R A;  2JN4 A;  4DV3 L;  4DV7 L;  2LKV A;  3UDG A;  3T1Y L;  3QJY A;  4LFC L;  4EQN A;  5HY6 A;  3J81 E;  4JI4 L;  2KJX A;  1X9N A;  4DNR B;  1Y1V G;  1HR0 Q;  2X6G A;  4RGN A;  2J7Z A;  1ESR A;  1G29 1;  2PQE A;  1DM0 B;  1XTC D;  3HOV H;  2K6A A;  1YHQ A;  2E2I H;  1K28 A;  3FKI G;  3K8A A;  4DAY A;  3RZD H;  3S14 H;  1VQK A;  2G5D A;  1PXU A;  1VQI A;  5FK9 C;  2C9O A;  2CKZ B;  3VYS A;  1DON A;  3PCO B;  1VF5 C;  4LF5 Q;  3S16 B;  3H0G H;  1H9K A;  3ERO A;  1RHP A;  2KQ3 A;  3HRZ C;  1EY5 A;  4XTC S;  1A15 A;  2AHO B;  2OXP A;  3M7G A;  1OTC A;  4B3M L;  1A3U A;  1F77 A;  2ZJP A;  3JC6 6;  3EIV A;  2CWP A;  3NTK A;  4P73 A;  3KLS A;  1TXY A;  2XN9 C;  1EYC A;  1XMQ Q;  5CBE E;  2I0Q A;  1QUQ A;  2HQL A;  1G91 A;  2C35 B;  1MHW C;  1SYD A;  1D2B A;  1K83 H;  3BYY B;  2E76 C;  5C3E B;  4DK6 C;  1AFP A;  1VQM A;  3RLO A;  4C3H G;  1A8V A;  2PQA B;  1TQO A;  4UPA A;  4IJH A;  2A5H A;  2RSN A;  2L15 A;  1UNS A;  1QE6 A;  4HAE A;  5KRU A;  3ULL A;  1S5D D;  4DUY Q;  3BYT B;  5K5P A;  2EY1 A;  4M1U B;  3K7A H;  4DR5 Q;  1X54 A;  1YJW A;  1FGB D;  3TP8 A;  4FXG C;  5J1Z A;  4QIW E;  4P72 A;  2XTI A;  2DY8 A;  1RJT A;  5EKL A;  2RBM A;  4BBS B;  5EPJ A;  4A93 G;  2ZTE A;  5KND A;  3GTL B;  2EIF A;  2F0J A;  4PZ7 A;  1VQN A;  4DK3 C;  2NN6 I;  1Q8K A;  2K75 A;  3KUP A;  1IW7 D;  5IOD A;  5CBA E;  2YU9 B;  4N8F A;  1AH9 A;  4GOP B;  4KKU A;  3SK5 A;  4X6A H;  3EVQ A;  4DR2 Q;  4O2D A;  5FO9 B;  4HJA A;  1R4P B;  3NSW A;  4KKS A;  4B3S Q;  3M9B A;  3M4O H;  1XX8 A;  2D0O A;  2HD3 A;  1PH8 A;  1EY4 A;  3AU7 A;  1Q82 C;  3CC7 A;  4IFD G;  1SEB D;  2MPM A;  1YNJ C;  2NUC A;  2ZTC A;  2F0Q A;  5GQO A;  1H95 A;  1E1O A;  4PQX A;  2A6H D;  3NBI A;  1CA5 A;  1IW7 C;  3I4N B;  3AFQ A;  4UP8 A;  2CFM A;  5C3W A;  1IHZ A;  2GVB A;  1B9N A;  4ZK9 B;  1L1O A;  1NE3 A;  4R4O A;  2JA8 B;  2WP8 J;  3Q22 A;  1HNZ Q;  2LY7 A;  2B2W C;  1HFG A;  5LMN Q;  2PO4 A;  3L9A X;  1DD2 A;  1PRT D;  3KLW A;  5GAD C;  4JBM A;  1XNQ L;  4GN4 B;  3NPP A;  1WCM G;  1BBW A;  4L63 B;  3S15 B;  1JR0 D;  1G8Z D;  2RA4 A;  3J81 L;  1O7Z A;  3G7L A;  2JA6 G;  1F2M A;  1KAW A;  2A6H C;  3TZU A;  1SNQ A;  1BR9 A;  2AQ3 B;  5FLM G;  1G6P A;  4A3E H;  4A3C G;  3VR5 A;  2EJF C;  5C4J B;  1JMC A;  1DXM A;  4CKB A;  1BQQ T;  1PRT C;  1E2V A;  3K81 C;  2C5C A;  2Z8L A;  4WRD A;  1EWI A;  3HOY G;  1N8R C;  3E5S A;  4KD4 A;  4DV2 Q;  4DR4 L;  1XNR L;  5JVH 3;  3J81 i;  1J9O A;  1PZI D;  2FIN B;  5JEA J;  4C3J G;  2JJQ A;  4EQO A;  5CGK A;  4HJ5 A;  1MIU A;  1ILP A;  1SR3 A;  4ZAI A;  2JA5 H;  4RKB A;  1TWA H;  2F4V Q;  5BN4 A;  3KF6 A;  1SRO A;  5JJL A;  2Q2U A;  3A5U A;  4CGY B;  2AWO A;  2OF1 A;  2OWO A;  1GUS A;  4B9X A;  4C2M B;  1CKO A;  4N9P A;  2HT1 A;  4KY7 A;  2XGT A;  3MXN B;  1Z47 A;  3V96 A;  5HGT A;  4C56 C;  5EPK A;  3GD7 A;  1A0I A;  3PO3 G;  1AW7 A;  3HZX A;  1U4L A;  4K2L A;  1SMX A;  3J81 c;  1YBY A;  1E0B A;  1MI2 A;  4YY3 L;  1PYS B;  3S24 A;  1NR2 A;  4TVA B;  2CQA A;  5M3M B;  1RCV D;  5E3F A;  1K3B C;  5DM7 3;  1AZQ A;  1GOZ A;  1YNX A;  3MEH A;  2ZXP A;  3HOX B;  3OMG A;  5ELN A;  1CK1 A;  2WAQ G;  4GS3 A;  2R92 H;  5COR A;  4ODG A;  4G7Z C;  2EY6 A;  2QIL A;  2K7V A;  4DXG A;  3G4S A;  1M8A A;  4JI3 Q;  3Q0A A;  4J15 A;  5BN5 A;  1TWF H;  3W3A A;  3ULJ A;  2DNC A;  1VQD A;  4A75 A;  1CFM A;  2MQH A;  5JAV A;  4DR3 L;  2HHH Q;  2Z0S A;  1L1O C;  3QR8 A;  2EZV A;  1LV9 A;  2I5L X;  4P71 A;  2D2C C;  2KCT A;  1HR0 W;  3TS0 A;  1YNN D;  2M00 A;  4KD3 A;  4A3B B;  3CCR A;  4JPB W;  1SDF A;  4MIU A;  2R93 H;  2L11 A;  1SYB A;  1I6H H;  3HKS A;  1L2F A;  1Q8I A;  3DUZ A;  4KHZ A;  4NXN L;  4JC0 A;  4KN4 C;  2BH8 A;  4JI8 L;  3A54 A;  3GTJ B;  3BVM A;  1G51 A;  2IHF A;  5I6W A;  3H3V C;  1WOC A;  5IE8 A;  4ZUI A;  1Q1E A;  4R4I A;  3N52 A;  4AQY L;  5G3L F;  3GTG H;  1YNN C;  1GHJ A;  2ICI A;  3T1H L;  1B4O A;  4LF7 Q;  1Q3L A;  5IIF A;  1YI2 A;  1IBK L;  2JE6 I;  2M2L A;  5KIX A;  5D3D A;  2R6G A;  3V05 A;  2F0I A;  2QF7 A;  3I4M B;  3HOW H;  4FNF A;  4N9T A;  5J22 A;  1SFO B;  5M3F B;  1N36 L;  5JJK A;  1V1Q A;  4DA2 A;  4JV5 Q;  4A3J G;  4FF1 A;  1K8G A;  1GO3 E;  3NTH A;  4A3D B;  1M90 C;  1DZ1 A;  4XIG S;  3MXP A;  3H09 A;  2PNR C;  3PO2 B;  1EFW A;  1A2T A;  3D31 A;  2CWA A;  1T5E A;  3UDX A;  2DN8 A;  1FGU A;  2QW7 A;  3BZK A;  4Y7N H;  3U58 A;  2NVY B;  1B1Z A;  4DAY B;  5GAG C;  2N78 A;  1DYQ A;  1HZA A;  4FDB A;  5A35 A;  3K5N A;  3HKZ G;  5T1G A;  2UUA L;  3BVG A;  5IGE A;  4CDE C;  1HNW Q;  3CCV A;  1I94 Q;  5DEH A;  5M5Y B;  5KYL A;  1I50 H;  2A68 D;  1TWC B;  2Q8R E;  1VS0 A;  3NEM A;  5E4X A;  1SYG A;  4HJ9 A;  5EGT A;  4JI2 L;  1OO9 B;  4BWG B;  4PZ8 A;  1LUZ A;  3A56 A;  3HOV G;  1E2W A;  3S2H B;  1W6K A;  2B2V C;  3HP3 A;  4NPS A;  1VQ8 A;  4FF4 A;  2K04 A;  3R2I A;  4X3S A;  1LAC A;  3QOJ A;  2E2J B;  3CMA A;  1YJN A;  1GUT A;  3H0G G;  3W1B A;  2A68 C;  3VYR A;  5HUR A;  1KD1 C;  1QUQ B;  1IBL Q;  3TME A;  1HFN A;  1NSN S;  1SNP A;  2ZJQ A;  1RL2 A;  3K0X A;  1ZKO A;  3PUW A;  3S1M B;  1PTO B;  4R8N A;  3CHB D;  3KFU A;  1XPO A;  3N6R A;  4FF2 A;  3FPU B;  4QB4 A;  4IO9 A;  2WAQ E;  2RHS B;  1PMR A;  1FJG Q;  4OX9 Q;  1MJC A;  1QWY A;  1IL2 A;  2CQO A;  4X64 Q;  3PUX A;  4ZQ3 A;  2CH4 W;  1TY0 A;  5H1S E;  3I3C A;  2YTX A;  4DV0 L;  1LYL A;  1ENF A;  2V1C C;  2UU9 Q;  2BOS A;  2SEB D;  1MD2 D;  2RSO A;  5C5L A;  1N34 L;  1N33 Q;  2NZO A;  4JVZ A;  3CCM A;  4PZ6 A;  1K9M C;  3OTO Q;  3UDF A;  3TP7 A;  3HOU B;  5KNC A;  3KDF B;  4DV6 L;  3PF5 A;  3MWY W;  2EY5 A;  1EFI D;  2PZW A;  1UE7 A;  5LMN W;  2K5V A;  2VB3 X;  1KAA A;  4Q0F A;  5G3L D;  1PFS A;  2G9D A;  4X66 Q;  5D3I B;  3GTM H;  3I2Z A;  2A6E D;  1MSG A;  1V43 A;  2HQE A;  2B63 H;  4GNX B;  1EUJ A;  1XYI A;  2VUM H;  3CRK C;  2ATW A;  3GQB A;  3MXN A;  4RGO S;  2F0P A;  5C6A A;  2F1M A;  2K5N A;  2WB1 G;  4A3K B;  1JOK A;  3HOZ G;  2Q2H A;  2IPK D;  2F0V A;  4GKJ Q;  3E6Z X;  1O78 A;  2BDO A;  2Y0S E;  5JPN C;  4DV5 L;  5C44 H;  4RFB A;  3CCS A;  3OWF A;  3LGJ A;  1OXT A;  3I7F A;  3KF8 B;  5AJ3 Q;  1D5X C;  1PFM A;  4ME5 A;  3SGI A;  4YWK A;  1D5Z C;  3VYT A;  1HZB A;  4KY5 A;  4B9W A;  2O2L D;  1BBX C;  2K1B A;  2B39 A;  2EYO A;  3X3N A;  1K0S A;  1EIG A;  3CQZ H;  3RZO B;  1CHQ D;  4KK7 A;  4GOP C;  4GKK L;  4A4I A;  1EQT A;  1CSQ A;  1PV4 A;  1CKN B;  5FO7 B;  2K28 A;  5IGD A;  3SVM A;  5IYC G;  4A3F H;  3NWS A;  1EU3 A;  1FYC A;  5EKK A;  4NKL A;  4K8I A; 
#chains in the Genus database with same CATH homology
 1X55 A;  5M3M G;  1A8V A;  3CCL A;  1VCI A;  4JI0 L;  3M3Y H;  1UE6 A;  2EXD A;  1YHB A;  3IRB A;  4LFB Q;  2DGY A;  5LMU L;  1JJG A;  4B3R Q;  2PQA B;  1PH3 A;  2OTL A;  4UPA A;  1Y1V H;  5IYB H;  4IJH A;  3HOX G;  3CPW A;  4JI2 Q;  1CUK A;  2L15 A;  5C4J H;  2K14 A;  5M5X H;  3CCE A;  1PH1 A;  1S3O A;  3AQQ A;  1W3S A;  2RCN A;  3WWV A;  3L0O A;  3TS2 A;  3CCQ A;  4KLK A;  3ULL A;  3J7Z C;  1D7Q A;  1QVC A;  5BR8 Q;  2RHQ B;  4DUY Q;  4LF8 L;  4JI5 L;  3FKI H;  5IP9 H;  5IWA Q;  1QVG A;  4JBJ A;  3K7A H;  4DR5 Q;  1KIX A;  3AFP A;  1X54 A;  1QZG A;  1YJW A;  2VZA A;  4BY1 H;  4A3G H;  2A19 A;  1Q46 A;  3FP9 A;  4QIW E;  2ALY B;  1I5F A;  4P72 A;  1XMO Q;  1Q7Y C;  2I5M X;  4A3E G;  2XTI A;  3ER0 A;  4A3M G;  2OQK A;  2NZH A;  5JEA G;  2UUC Q;  4NXM L;  1JT8 A;  3GDE A;  1FL0 A;  5DLQ E;  4GN5 A;  4A93 G;  1N32 L;  2ZTE A;  1Y1W H;  3F2B A;  3D0F A;  5GAH C;  2EIF A;  4PZ7 A;  1SE8 A;  4DK3 C;  1PH5 A;  2NN6 I;  1VQN A;  4BA2 I;  1VQL A;  1Q8K A;  2K75 A;  2YYZ A;  4C3I H;  5IY0 A;  4POF A;  4HJ8 A;  4A3B G;  2QEX A;  3BZC A;  4C2M H;  4LF4 Q;  4JOI C;  1AH9 A;  1A62 A;  4YHH L;  4DV0 Q;  4GOP B;  2NVQ H;  3RN2 A;  4X6A H;  5HGQ A;  4DR2 Q;  3S2D H;  3PUV A;  2YTV A;  4O2D A;  1R9T H;  4HJA A;  4K0K L;  2N8N A;  1PVO A;  2JA5 G;  3F8T A;  1N34 Q;  3M9B A;  1PA6 A;  4B3S Q;  1QZH A;  1J6Q A;  3I4O A;  4BA1 I;  1M1K C;  1HNX Q;  3M4O H;  1WFQ A;  2D0O A;  4OON A;  1PH8 A;  2HHH L;  1Q82 C;  3CC2 A;  3CC7 A;  4IFD G;  2UXC L;  4DV7 Q;  1O7I A;  2ZTC A;  4BBR H;  5GQO A;  1KRS A;  3T1Y Q;  1H95 A;  2ID0 A;  3NEN A;  1E1O A;  1OXU A;  4DV6 Q;  4JI4 Q;  3S1R H;  1N33 L;  4C3H H;  2JA9 A;  5M3M H;  4Y52 H;  3AFQ A;  1X3E A;  4UP8 A;  1XPR A;  4LF6 L;  2CFM A;  3KJO A;  1YIT A;  2GVB A;  1L1O A;  1NE3 A;  1DGS A;  1BBU A;  4R4O A;  3ULP A;  2WP8 J;  4LUV A;  4DKA C;  1HNZ Q;  3S17 H;  3HOX H;  4BXX G;  4JI8 Q;  1HH2 P;  5LMN Q;  2UUB Q;  3J7A 5;  5J3B A;  1UE1 A;  2HIV A;  2KHJ A;  2EQS A;  3KLW A;  5GAD C;  4JBM A;  1XNQ L;  3L7Z C;  3H3V I;  3I4M G;  4GN4 B;  1J5E Q;  3F1Z A;  1WCM G;  5M3F G;  1BBW A;  3GTQ H;  1WYD A;  2CCZ A;  3S1N H;  4BY7 G;  1PH9 A;  1HJP A;  4A3D G;  3E0E A;  2VS1 A;  1VQ7 A;  1JE5 A;  2JA6 G;  1B8A A;  4PG3 A;  1NJI C;  1KAW A;  4YCU A;  3PO2 G;  3OW2 A;  2R7D A;  4DR6 Q;  5FLM G;  4WJ4 A;  1G6P A;  2OTJ A;  4A3E H;  3G48 A;  3PSI A;  2PQA A;  2Z6K A;  3H15 A;  1XJV A;  4LF7 L;  4A3C G;  3UDI A;  4DR1 L;  1RIP A;  1B7Y B;  2VQF L;  4UY8 C;  2R7Z G;  1K0R A;  1JMC A;  1VQJ A;  2R92 G;  4DV5 Q;  1EIY B;  4LUZ A;  1X3F A;  2IHE A;  3PUY A;  5E7N A;  3CME A;  4DUZ L;  3K81 C;  4A93 H;  4KHP Q;  2K4K A;  2Q2I A;  3ERS X;  1EWI A;  3HOY G;  1N8R C;  2Y0S G;  4JI6 L;  2UXD L;  2IY5 B;  1YIJ A;  4DV2 Q;  4GKJ L;  4DR4 L;  1XNR L;  4JV5 L;  1VQF A;  4PMW A;  4B3T L;  4R4T A;  4A3B H;  4X62 L;  3J81 i;  3CCJ A;  2JA7 G;  5JEA J;  1OXX K;  2JJQ A;  4TQU S;  1KQS A;  1BVS A;  4HJ5 A;  1MIU A;  2YV5 A;  4QGU A;  2ZM6 Q;  4GKK Q;  1SR3 A;  1PH2 A;  1OXV A;  4A76 A;  2VQE Q;  4DR7 L;  2E2H H;  2YTY A;  2JA5 H;  3HKZ E;  1TWA H;  2F4V Q;  2AMC B;  3E9H A;  1VQH A;  3KF6 A;  3GTJ H;  1SRO A;  5JJL A;  2Q2U A;  2VNU D;  1LTL A;  3A5U A;  4QJF A;  4IJL A;  1HNW L;  2AWO A;  1I94 L;  2OWO A;  5LMU Q;  2KEN A;  5JJI A;  3CAM A;  1SRU A;  3M85 A;  1CKO A;  2BA1 A;  2HT1 A;  2R93 G;  4HIK A;  3RNU A;  2XGT A;  5IYD G;  2I5H A;  4JCV E;  3RLN A;  3MXN B;  4GOP A;  3STB D;  1Z47 A;  4DV1 L;  4LF9 Q;  4BXX H;  4IFD I;  4EQ5 A;  3GD7 A;  1A0I A;  2B3G A;  3M4P A;  2E5L L;  1W2B A;  3I4M H;  3PO3 G;  1X56 A;  4LF8 Q;  4JI5 Q;  4NB3 A;  1SFO H;  3KDF A;  1WCM H;  2ZTD A;  5M3F H;  4BY7 H;  1SMX A;  3J81 c;  1YBY A;  3AYH B;  4YY3 L;  1PYS B;  1VQ5 A;  3S24 A;  3BU2 A;  3J81 j;  4RG1 A;  4TVA B;  3KJP A;  4A3D H;  4H02 A;  5C4X G;  2GN5 A;  4LW1 A;  2JA6 H;  3RR5 A;  3CXC A;  1CSP A;  1IBM L;  2VL6 A;  3HOZ H;  3PO2 H;  5IWA L;  4QY7 A;  2NVX H;  4LFA L;  4GLV B;  1YNX A;  1YVC A;  5FLM H;  3G71 A;  1IBL L;  4HID A;  4NXM Q;  4A3C H;  3CW2 C;  2FXQ A;  1VQG A;  3STB C;  3EN2 A;  2NVY H;  3PF4 A;  5ELN A;  2R7Z H;  3HOW G;  4GNX A;  2WAQ G;  4GS3 A;  2R92 H;  5GAE C;  4EX5 A;  2B29 A;  1VQP A;  3F2D A;  2UUC L;  1Q12 A;  3HOU G;  1KXL A;  3HFZ B;  3HOY H;  2VY3 A;  2D0P A;  5IP7 G;  3Q8D A;  2QGQ A;  1FJG L;  3G4S A;  4JI3 Q;  5M5Y H;  3CD6 A;  4OX9 L;  4MTN A;  4DNI A;  1VQM A;  2A1A A;  4J15 A;  3J80 i;  4DAM A;  1TWC H;  5FLX c;  4MNO A;  4X64 L;  1TWF H;  1GKH A;  3ULJ A;  3ZJY C;  3M7N A;  3NBH B;  1E3P A;  2JA7 H;  1VQD A;  3K80 C;  4C3J H;  3JAM i;  1Z9F A;  4A75 A;  2UU9 L;  4LNQ A;  4LF4 L;  2MQH A;  3S2H H;  5IYC H;  4DV3 Q;  1C0A A;  2BH2 A;  1I3Q H;  3TQY A;  3H3V H;  1PHJ A;  4DR3 L;  4LFC Q;  2HHH Q;  4GLA C;  2Z0S A;  1L1O C;  4IPD A;  1IXR A;  4YCV A;  5IT9 c;  2H5X A;  2MNA A;  1KC8 C;  3S1Q H;  2UXC Q;  1EYG A;  2I5L X;  4JBW A;  4JI1 Q;  3RLF A;  3OTO L;  4JOI A;  4P71 A;  2KCT A;  2E2J H;  2E8G A;  3TS0 A;  1HR0 W;  1HZC A;  1HNX L;  4JYA L;  1JB7 A;  4LF6 Q;  1A63 A;  4ALP A;  1VQA A;  3CCR A;  4A3K G;  4UP9 A;  1HR0 L;  1TWG H;  1Q1B A;  1U0L A;  5GRO A;  1C7Y A;  2NVT H;  2R93 H;  3PIP A;  5IYD H;  4OO1 G;  4A3L G;  1I6H H;  3W1G A;  1CKN A;  4X66 L;  2QA4 A;  1XNQ Q;  1SLJ A;  3S1M H;  3HKS A;  1L2F A;  1GD7 A;  4KHZ A;  4NXN L;  4JC0 A;  3J80 c;  4MZ9 A;  4YCW A;  4JG2 A;  4X65 L;  3VDY A;  2BH8 A;  3PO3 H;  4JI8 L;  1K8A C;  2UUB L;  5C0X I;  2Z6K C;  4OXP A;  1MJE A;  2K52 A;  4K0K Q;  1G51 A;  1VQC A;  2IHF A;  1WOC A;  3JAM c;  5IE8 A;  1J5E L;  1AE2 A;  1Q1E A;  2WB1 E;  4R4C A;  2F52 A;  4R4I A;  5IP9 G;  4AQY L;  1UWV A;  4A3M H;  3GTG H;  4B3M Q;  4AIM A;  4LUO A;  3T1H L;  4LF5 L;  4LF7 Q;  4AYB G;  1YI2 A;  3DM3 A;  1IBK L;  4DR1 Q;  2JE6 I;  2VQF Q;  1S72 A;  5M5W H;  2R6G A;  4ME3 A;  5ELO A;  1NBW A;  2LXJ A;  3AEV A;  3A74 A;  4DPG A;  5C3E G;  2OQ0 A;  3CPF A;  4OWW B;  1VQB A;  3G6E A;  3HOW H;  1UE5 A;  1NMF A;  2GVA A;  2OCE A;  4L5T A;  4JI6 Q;  2UXD Q;  3U4V A;  3GTP H;  3PUZ A;  1N36 L;  3ICE A;  5JJK A;  1V1Q A;  1XNR Q;  3HOU H;  2DUD A;  2PI2 E;  5AJ3 L;  1YEZ A;  4A3J G;  2WFW A;  1K8G A;  2IX1 A;  1GO3 E;  5IP7 H;  4JV5 Q;  4B3T Q;  1M90 C;  4IOA A;  1KHI A;  4XIG S;  1EQQ A;  2UXB L;  4IPG A;  1K3R A;  1XMQ L;  1EFW A;  4KI0 A;  3D31 A;  1B70 B;  1NMG A;  2CWA A;  3UDX A;  4IPH A;  1L1O B;  3TRE A;  1FGU A;  1HZ9 A;  4A3I G;  3M4Q A;  4QQB X;  5K36 G;  3BZK A;  4Y7N H;  4DV4 L;  3U58 A;  1NTG A;  1NY4 A;  1XTD A;  3FHW A;  1ASY A;  4DAY B;  4JI0 Q;  4DR7 Q;  5GAG C;  1IYJ B;  1SN8 A;  2N78 A;  4JI7 L;  1HZA A;  2AKW B;  4FDB A;  2ES2 A;  1CKM A;  2KBN A;  5C0X G;  2JQO A;  1MKH A;  5FJ8 G;  3HKZ G;  2JEA I;  2BA0 A;  2ZM6 L;  2UUA L;  1GM5 A;  1E1T A;  2ASB A;  3CCV A;  2D62 A;  1I94 Q;  1HNW Q;  1X65 A;  4YWL A;  3GTO H;  1N9W A;  1I50 H;  3F2C A;  4GN3 B;  3S16 H;  4LFB L;  1VS0 A;  2K50 A;  3NEM A;  3U50 C;  4B3R L;  3EBE A;  4HJ9 A;  1IZ6 A;  4HIM A;  4A3K H;  4IFD J;  4DV1 Q;  4JI2 L;  3KOJ A;  4PZ8 A;  3DLL A;  1LUZ A;  4BBS G;  2F3I A;  4R4Q A;  3HOV G;  4UP7 A;  4A3L H;  1AE3 A;  4NPS A;  1VQ8 A;  4YWM A;  2E5L Q;  2B63 G;  1T9H A;  3CF5 A;  4L5S A;  5BR8 L;  4DUY L;  4R1J A;  1EIF A;  4LF9 L;  4YY3 Q;  4LWC A;  4DR5 L;  2VUM G;  2N49 A;  1BKB A;  4L5Q A;  3CMA A;  1YJN A;  1ASZ A;  1IBM Q;  3H0G G;  3W1B A;  2VW9 A;  4GNX C;  4OO1 I;  4LFA Q;  1VQ4 A;  1XMO L;  4IPC A;  1KD1 C;  1PYB A;  1QUQ B;  2MO0 A;  4IOC A;  1IBL Q;  2LXK A;  1N32 Q;  1V9P A;  1C9O A;  3I56 A;  3RZO H;  1VQ9 A;  1YHA A;  2IX0 A;  2ZJQ A;  1RL2 A;  3L2P A;  3K0X A;  3PUW A;  5C44 G;  1S40 A;  3KFU A;  5C3E H;  1XPO A;  1U5K A;  1Q86 C;  3CP0 A;  4IO9 A;  2WAQ E;  1OXS C;  1WI5 A;  4YHH Q;  2ZJR A;  2RHS B;  3OYY A;  1PH7 A;  1FJG Q;  4OWT B;  3I4N G;  4OX9 Q;  1MJC A;  3B6Y A;  3KF6 B;  4A3J H;  1IL2 A;  1JJC B;  2LSS A;  2CQO A;  4X64 Q;  1Y14 B;  3E9I A;  1TWH H;  1EQR A;  3PUX A;  4OWX B;  2JA8 G;  4HIO A;  5EAY A;  5H1S E;  4L5R C;  1VQ6 A;  2YTX A;  4DV0 L;  1LYL A;  4JI3 L;  2KHI A;  2V1C C;  2UU9 Q;  4DR2 L;  3RN5 A;  4QL5 A;  1X6O A;  3UE0 A;  4GLX A;  1VQO A;  4RMF A;  3GTK H;  1VQE A;  4A3I H;  1WJJ A;  4B3S L;  4DR3 Q;  1N34 L;  3KYH C;  3NEL A;  4A3F G;  2Q2T A;  4JBK A;  1N33 Q;  3MEF A;  3PV0 A;  2NZO A;  1PH4 A;  3CCM A;  4PZ6 A;  1K9M C;  4DV3 L;  3OTO Q;  3UDF A;  4AH6 A;  1JJ2 A;  4DV7 L;  5FJ8 H;  3UDG A;  3KDF B;  3T1Y L;  4JYA Q;  2R7F A;  2MFI A;  5HY6 A;  4LFC L;  3K7U C;  4DV6 L;  3PF5 A;  4APV A;  4JI4 L;  1X9N A;  3A5Z B;  1Y1V G;  1UE7 A;  5IYB G;  2K5V A;  4JI1 L;  3GO5 A;  5LMN W;  1K73 C;  1HR0 Q;  3TEH B;  1HNZ L;  3PIO A;  1G29 1;  1PFS A;  4P74 A;  4X66 Q;  1XPU A;  3GTM H;  5LMN L;  3I2Z A;  4BBS H;  3HOV H;  1X3G A;  3I55 A;  1LM0 A;  2PNH A;  1YHQ A;  2E2I H;  3GTL H;  5C0X J;  4NXN Q;  4WJ3 M;  4X65 Q;  1V43 A;  1KL9 A;  3FKI G;  3K8A A;  2B63 H;  5C4X H;  3RZD H;  4GNX B;  3S14 H;  1EUJ A;  1VQK A;  1E22 A;  1KRT A;  1YZ6 A;  3BJU A;  3TRZ A;  1VQI A;  3U4Z A;  2CKZ B;  2PI2 A;  4BY1 G;  4A3G G;  2RF4 A;  3UE1 A;  2NN6 G;  4AQY Q;  2YU9 H;  2VUM H;  2ATW A;  3PCO B;  2N3S A;  1YJ9 A;  3T1H Q;  4LF5 Q;  3H0G H;  2K5N A;  2WB1 G;  4DR6 L;  1IBK Q;  2IT1 A;  2JEB I;  4DUZ Q;  1EOV A;  2AWN A;  4XTC S;  2JK8 A;  2AHO B;  3HOZ G;  2Q2H A;  1QVF A;  1Q81 C;  4AYB E;  2A8V A;  1OTC A;  4GKJ Q;  1Y1W G;  4B3M L;  4DR4 Q;  2MO1 A;  2ZJP A;  2Y0S E;  4DV5 L;  3A0J A;  5C44 H;  3CCS A;  4P75 A;  4HJ7 A;  3PGZ A;  4X62 Q;  4KHP L;  3LGJ A;  1P8L A;  1N36 Q;  1OXT A;  3I7F A;  3JC6 6;  3KF8 B;  5AJ3 Q;  2K5H A;  2CWP A;  3EIV A;  3CCU A;  4DV2 L;  3W5O A;  3SGI A;  4YWK A;  3I4N H;  1E24 A;  1HZB A;  4P73 A;  1UEB A;  1FVI A;  1GVP A;  1E7Z A;  2PMZ E;  1TXY A;  2UXB Q;  1P16 A;  1XMQ Q;  2JA8 H;  2HIX A;  1PH6 A;  2I0Q A;  2KCM A;  1QUQ A;  3CQZ H;  2HQL A;  1L0W A;  2C35 B;  4DV4 Q;  4GOP C;  3CC4 A;  4GKK L;  4A4I A;  4JI7 Q;  1CSQ A;  2VQE L;  1CKN B;  1K83 H;  1PV4 A;  5IYC G;  4A3F H;  4POG A;  4DK6 C;  3S15 H;  4BBR G;  2F4V L;  2UUA Q;  4O0A A;  1D8L A;  3RLO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...