3M4OH

Rna polymerase ii elongation complex b
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna-rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title X-ray structure and mechanism of RNA polymerase II stalled at an antineoplastic monofunctional platinum-DNA adduct.
pubmed doi rcsb
total genus 15
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2010-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3m4oH00
1VQ7A 3G71A 4UP9A 4GKKQ 2ZJRA 2UXCQ 4MNOA 1K8GA 2JE6I 1XPRA 3JAMi 2UXBQ 3U4ZA 1VQ6A 2IX1A 1X3EA 1VQ9A 4HIDA 2E2IH 2OQKA 5H1SE 3S16H 1OXUA 4R4IA 4ALPA 4MZ9A 3KOJA 2HQLA 4IPDA 2BA1A 3BZCA 4JI8Q 2QEXA 4OO1I 2JA8H 4PZ8A 1P16A 1TWGH 1V43A 1OXVA 1YZ6A 4JI4L 3M4QA 3I4NH 5JJLA 4R4TA 3BJUA 2LXJA 4GLVB 3CCQA 3CXCA 1PHJA 3I2ZA 2JA5G 2N3SA 2UXCL 2VQEQ 2HIVA 4DR3L 4A3MH 1A0IA 1X9NA 2XTIA 1NY4A 1B7YB 4P74A 2VY3A 1PH6A 4LF5Q 2E8GA 3H0GH 5FLMH 2UUCQ 1KRSA 4BBSH 2CFMA 1IBLQ 3HKZE 1PH2A 4NXNQ 1X3FA 2AMCB 2K75A 4O0AA 2OCEA 3UDXA 4DUYL 3CPFA 3CF5A 2R7ZG 4JI8L 4LF9Q 2B3GA 4XTCS 1UWVA 4HJ7A 1J6QA 2JA6G 2B29A 2C35B 4QY7A 3PF5A 1N33Q 4GN4B 4DR1Q 2Z6KA 2NZHA 1T9HA 2IHEA 3GO5A 4DPGA 2UU9Q 3K7UC 4JI7Q 1Q81C 1JE5A 2K5HA 1EUJA 2WB1E 3PUWA 4APVA 3RN5A 2GVBA 1VQLA 4JI1L 1QVFA 2OTJA 3H15A 2UUCL 4GLAC 1VQKA 2WAQG 4DK3C 3FP9A 1M1KC 3UDFA 5GADC 1HR0W 3A5ZB 1Y14B 2EQSA 3PUVA 4IPHA 3STBD 4GKJQ 4JG2A 4B3SL 1FJGL 1EOVA 4DKAC 4GLXA 1K3RA 4IO9A 4JI6Q 1GVPA 1FVIA 2JJQA 3PO3H 4Y52H 4A3LG 1LYLA 1A62A 4DK6C 1X55A 1UE1A 3W5OA 2KCTA 2KHIA 4LUVA 2YTYA 3DLLA 3FKIG 4DV3Q 4A3JH 2HT1A 3GTLH 3I4MG 2WFWA 2Y0SG 3GTMH 4JI7L 5C4XG 3PF4A 1BKBA 2QGQA 1VQAA 2UUBL 3CCLA 4B3TL 1JJCB 3ULJA 1XPOA 4A3DG 4BA2I 4IJLA 2L15A 2PQAB 3OTOL 2IX0A 1AE2A 4A3GG 3I55A 1CKNA 3F2CA 1HR0L 1K0RA 1UEBA 1E3PA 2CKZB 4K0KQ 4NPSA 4JI2Q 1WCMG 2JA7G 1PFSA 1YBYA 4A4IA 2UXDL 2KHJA 1HH2P 4DV2Q 3W1GA 3T1YL 4KHPL 3ERSX 4LWCA 4GNXB 1E1OA 2RHSB 4HJ5A 4ME3A 5ELNA 2NVYH 4QQBX 4QJFA 3WWVA 3HOXG 4POGA 1VQOA 5M3MH 1OXXK 2NZOA 3S1MH 1WI5A 3ZJYC 1X54A 4GN5A 1PH3A 1U0LA 5ELOA 1C9OA 4BBRH 1N36L 1KQSA 1YHBA 3MEFA 2K5NA 4L5RC 1DGSA 4LF7Q 3HOWG 4BY1G 4DV6Q 2VZAA 2R93H 2EIFA 5C0XI 3KF6B 1IBKL 4DR6Q 5C3EG 1VQJA 1Q12A 2LSSA 4A3KH 1PV4A 2N78A 3ER0A 1AE3A 4TQUS 1YJNA 1HNZL 3A5UA 3W1BA 1Z9FA 4JBWA 2R7FA 5C4JH 2ZTDA 2KBNA 4B3ML 2UUAL 2K14A 3KFUA 4DR7Q 5JJIA 1PH7A 4OWTB 4DR2Q 1GO3E 4JBKA 1SRUA 5IYBH 3AEVA 1HZCA 1VQEA 3J80c 4DV6L 4X66Q 3STBC 3CC7A 4A75A 4JI5Q 1WJJA 4GOPC 2VUMH 1VS0A 1L1OA 2ALYB 5FJ8H 2NVXH 1N34Q 3M4OH 1ASYA 4GOPA 1K8AC 1TWAH 1MKHA 4LW1A 1VQHA 1GM5A 1VQFA 1QZHA 3RLNA 1X56A 1W2BA 3KJPA 3HOVG 3G48A 4JOIC 2VQFQ 5BR8L 2JQOA 2B63G 4YWLA 3U58A 4A3EH 1OXSC 2A8VA 2F52A 5IYDH 3AFPA 4FDBA 4JV5L 4BXXH 5LMUQ 1Q1EA 4DV4Q 4DV0Q 1G51A 1IBMQ 4LFCL 1NTGA 4X66L 2RF4A 5FLXc 2DGYA 4HJAA 1GKHA 3E9HA 4MTNA 4WJ3M 3K8AA 2PMZE 3PUXA 4LF8Q 3PSIA 1NE3A 2JEBI 3CW2C 4J15A 2ZTCA 5M5YH 1E7ZA 3CCMA 4LFAQ 4DV1Q 4GKKL 4X64Q 2NVTH 3K80C 3RZOH 3OW2A 5IP7H 4X62Q 2ID0A 2RCNA 4O2DA 3UDIA 3CC2A 2F4VQ 1PA6A 4YY3Q 1EYGA 2UXBL 3J7A5 2K52A 1YVCA 4P75A 1YJWA 4L5SA 1W3SA 3FHWA 4OX9Q 2ASBA 3KF8B 2MQHA 4OWXB 1NMFA 3F2BA 2VW9A 2R7ZH 3UE1A 1Y1VH 3CMAA 4A3BG 1UE5A 2N8NA 4IPCA 4DV4L 1VQNA 2JA6H 1SROA 3PCOB 1HNXQ 4RMFA 1QVCA 4LUZA 1N32Q 3J81j 4HJ9A 1VCIA 3TREA 1PH8A 1PYSB 3CQZH 3EBEA 2AHOB 2VS1A 3S1QH 2ZTEA 5M5WH 4A3CH 2IHFA 2VQEL 3T1HQ 1YNXA 1EQQA 2A19A 1I94Q 2F4VL 1CKOA 1MJCA 3RLFA 2ZM6Q 4B3RQ 4AYBE 1XJVA 4IFDJ 1CKMA 1XTDA 4L5QA 4LF5L 4OX9L 4LFBQ 3HOUG 2VNUD 3TRZA 2LXKA 1IBLL 4C3IH 4QIWE 4NXNL 1XMQQ 4RG1A 3PO2G 5HGQA 4GN3B 1G6PA 3H0GG 4H02A 4POFA 1SR3A 5FLMG 1MJEA 4LF9L 3FKIH 1VQIA 2MO1A 4EX5A 3HKSA 5AJ3Q 4DV7Q 4PZ7A 1R9TH 1PH1A 1TWHH 4LF4Q 5C4XH 2A1AA 1N33L 3K7AH 4DR1L 3J7ZC 1SMXA 2YV5A 3RN2A 2AWOA 1I50H 3JAMc 3T1HL 2UU9L 3D0FA 1O7IA 1OXTA 1JJGA 2K50A 4UY8C 4JCVE 4L5TA 2ZM6L 4B3RL 2H5XA 2MO0A 2R92H 1C7YA 3KJOA 4OO1G 2CCZA 1Y1WH 2GN5A 4A3FH 4GKJL 1Q7YC 4YCWA 3L0OA 1SLJA 3HFZB 2BH2A 3I7FA 2JA7H 3G4SA 3I56A 1CSPA 1RL2A 2F3IA 5IYCH 4JI6L 3GTQH 4JI3Q 1X65A 4LF4L 4A76A 2WP8J 3MXNB 3PUYA 1FL0A 3HOXH 4HJ8A 4R1JA 1LM0A 4DV3L 3CPWA 3PO3G 4A3IG 3B6YA 1PH9A 3M85A 2OWOA 3U50C 4BY7G 1PYBA 5GAGC 3OYYA 3UE0A 4DR5Q 5M3FH 4A3JG 1NBWA 1YIJA 1JB7A 3E0EA 1S3OA 1V1QA 3HOWH 1V9PA 1YHQA 4DAYB 5IWAQ 4OONA 1X6OA 5IE8A 1QUQB 4JI3L 4HIKA 2ES2A 4JI2L 3GTKH 2AKWB 4K0KL 4WJ4A 1Z47A 5GROA 2D62A 3D31A 3I4OA 1YITA 1QVGA 3TEHB 3BU2A 1KRTA 4R4QA 4DV2L 2DUDA 1PH4A 2RHQB 1TWFH 4R4CA 4DUZQ 2VL6A 4KHZA 3HKZG 5DLQE 5IP9H 4X65Q 3RNUA 3RLOA 4OWWB 2HIXA 4DR5L 3M3YH 4YHHQ 1D7QA 4GNXC 1IZ6A 1L1OB 2CWPA 3NENA 3CCEA 1BVSA 2PI2E 3TQYA 2N49A 3GTGH 1K9MC 1H95A 5M3MG 4GNXA 4LF7L 5LMNW 4X6AH 1VQPA 1M90C 3HOYG 2I0QA 2WAQE 5JEAG 1NMGA 4BA1I 3CCUA 3GTOH 3HOVH 3KDFA 4AQYQ 1HNWQ 2WB1G 4DR6L 1L2FA 5LMNQ 3A0JA 1XMOQ 3S2DH 3S17H 1YEZA 3NELA 2R93G 2B63H 1D8LA 1U5KA 4YCVA 4DUZL 5GQOA 1KIXA 1PVOA 2E2JH 3S2HH 1EIFA 4PZ6A 1KL9A 1VQGA 1Q82C 3ICEA 3Q8DA 4Y7NH 1WFQA 4YHHL 3KF6A 3AYHB 3CP0A 4JOIA 4DR7L 3ULPA 2KCMA 3GTJH 3H3VI 4JBMA 4DR2L 4NXMQ 2I5MX 5HY6A 4HIOA 2IY5B 4A93G 5C44G 4JI5L 3HOZG 1E1TA 2BA0A 3S15H 2I5HA 3CCJA 2I5LX 5IYBG 4YWKA 3PIPA 1N34L 2JA5H 5GAEC 1ASZA 5LMNL 1XMOL 1TXYA 3BZKA 1E22A 1SE8A 2Q2HA 2JA9A 2EXDA 5FJ8G 1CSQA 3GD7A 2ZJPA 1LUZA 4UP8A 4AH6A 3IRBA 4DR3Q 1SFOH 3DM3A 2VQFL 2PNHA 4A3BH 1C0AA 3F1ZA 3M9BA 1EWIA 4NXML 4IJHA 5LMUL 5C0XG 3K81C 4DUYQ 4DV0L 4HIMA 4A3EG 1IBML 1MIUA 1NJIC 3CD6A 3M4PA 5IYDG 4JI0Q 1Q1BA 2JEAI 4BXXG 3RZDH 4LF8L 3CCSA 1P8LA 3H3VH 2JA8G 3NBHB 4IFDI 2Q2IA 2YYZA 4DV1L 4LFAL 1KHIA 4X64L 3I4NG 2K5VA 1N9WA 3GDEA 4OXPA 4X62L 2QA4A 4DV5Q 3HOUH 5E7NA 3CC4A 1A8VA 4YY3L 3TS2A 4C3JH 2CWAA 4LNQA 3PO2H 4JI1Q 5IP7G 1J5EQ 4PMWA 4TVAB 2IT1A 4KI0A 2GVAA 4IPGA 4A3MG 2NN6I 2PI2A 1YJ9A 2Z0SA 1TWCH 1HNXL 1Q86C 1VQBA 4A3LH 1BBUA 4BBSG 4B3SQ 1FJGQ 1SN8A 3I4MH 4JI0L 1IYJB 1Y1VG 4XIGS 1N32L 2Z6KC 3LGJA 2CQOA 3RR5A 1VQ4A 1KXLA 3J81i 1KC8C 3UDGA 1UE6A 4DR4Q 3EN2A 1VQ5A 4DV5L 2HHHQ 3A74A 1WOCA 4UP7A 2JK8A 1I94L 5GAHC 3PIOA 3CMEA 2YU9H 1JMCA 1CKNB 4A3DH 1S40A 1J5EL 3PGZA 2E5LQ 2UUBQ 4A3CG 4LFBL 2BH8A 3F8TA 2Q2UA 2ZJQA 2AWNA 4PG3A 1VQCA 4DNIA 4B3TQ 4A3GH 1XMQL 3CCVA 3NEMA 1WCMH 3OTOQ 3JC66 4C2MH 1JT8A 1QZGA 1HR0Q 3J80i 5AJ3L 4DV7L 4A3IH 1N8RC 1VQ8A 4BY7H 4JC0A 2UXDQ 3CAMA 4DR4L 3T1YQ 2HHHL 4KHPQ 1B70B 2D0PA 1IXRA 1VQDA 4QGUA 1S72A 1X3GA 4AIMA 2R6GA 2OQ0A 3AQQA 2KENA 2E5LL 1A63A 5M5XH 5JEAJ 2FXQA 4KLKA 2MNAA 4BY1H 1Q46A 1N36Q 1K83H 1EFWA 2YTXA 2R92G 4LUOA 3U4VA 3GTPH 5C3EH 5J3BA 1Y1WG 4IFDG 4QL5A 1AH9A 4A3FG 1E24A 4YCUA 1WYDA 2D0OA 4C3HH 2XGTA 4R4OA 2V1CC 2OTLA 1IBKQ 1FGUA 4DAMA 1L0WA 5IYCG 2PQAA 1G291 3CCRA 1IL2A 2YTVA 2R7DA 2K4KA 4P73A 1HNZQ 1YHAA 1UE7A 2NN6G 4IOAA 3S24A 5IT9c 4NB3A 3ULLA 2MFIA 1XNRQ 3M7NA 1LTLA 3KDFB 1XNQQ 3F2DA 4B3MQ 2UUAQ 3HOYH 4YWMA 3KLWA 1B8AA 4GOPB 2NVQH 5IWAL 5M3FG 5EAYA 1EIYB 1CUKA 1EQRA 3VDYA 4BBRG 2Q2TA 1HZAA 4GS3A 3AFQA 2ATWA 5JJKA 5IY0A 3L2PA 3J81c 4JYAQ 1KD1C 1I3QH 1YI2A 4P72A 4AYBG 2E2HH 4LF6Q 3TS0A 3S14H 1I5FA 1Q8KA 1HJPA 3KYHC 3E9IA 3G6EA 4X65L 1HZ9A 1QUQA 4UPAA 5C0XJ 1HZBA 3K0XA 4A3KG 5BR8Q 1XNRL 1K73C 4JBJA 1I6HH 1RIPA 3SGIA 3S1RH 1XNQL 4A93H 1GD7A 5IP9G 5C44H 4IOCA 2Y0SE 1BBWA 3HOZH 4JV5Q 3PUZA 3S1NH 1L1OC 3L7ZC 4LFCQ 1JJ2A 1KAWA 3EIVA 1PH5A 1OTCA 4P71A 3PV0A 4AQYL 4JI4Q 4JYAL 1HNWL 5K36G 1XPUA 4LF6L 4EQ5A 1VQMA 2VUMG
chains in the Genus database with same CATH superfamily
4GKKQ 1PZID 5CV8A 5M5YB 2NVTB 1U9RA 5H1SE 1PTOB 1CHPD 3MFGA 2HQLA 3BYTB 1CQFA 1TWGH 1WVLA 1V43A 1OXVA 1Y1VB 3I4NH 1D2BA 2LXJA 1Q8IA 3CXCA 2BE5C 4N8X1 1PHJA 2JA5G 2N3SA 2OF1A 4A3MH 2EY6A 1GUTA 2EY1A 2VY3A 3K59A 3VR2A 5M5WB 3QOLA 1XX8A 2UUCQ 4BBSH 1KRSA 5G3LD 5ELFA 2L11A 1MSGA 1PH2A 1II3A 4O0AA 3CF5A 4LF9Q 4GZYC 2B8FA 5CMDA 4DR1Q 5IT9L 4DN4M 1GHKA 2K04A 3GO5A 4DPGA 2F0KA 2IWHA 2K5HA 1EUJA 1V1PA 4APVA 3W2DA 1VQLA 2OTJA 2UUCL 4EQPA 1VQKA 1HR0W 1M1KC 5GADC 2F0FA 1NCVA 3PUVA 4IPHA 3STBD 3M7GA 2MJ8A 4RKLA 2Q8IB 1STBA 1NAPA 1FVIA 1I4PA 4DK6C 1X55A 1UE1A 2KCTA 2KHIA 5NUCA 2KVMA 5CR3A 3PF4A 2DJGC 3HOXB 2AUKA 2UUBL 1KABA 3FPUB 1JJCB 1XPOA 1XYIA 2IX0A 1FYCA 2CKZB 4NPSA 4JI2Q 1WCMG 2JA7G 1U4RA 1YBYA 4NP5A 5A35A 2UXDL 2O5JC 1HH2P 4DV2Q 4KHPL 3ERSX 3GTKB 4EGVA 3MWYW 4ME3A 1VQOA 1OXXK 3BZDB 2NZOA 4K14A 2K5WA 2DY7A 1TWFB 3ZJYC 1PH3A 4MN3A 1N36L 1KQSA 1YHBA 4BY1G 3GTGB 2R93H 2EIFA 3KF6B 4G7ZC 2LSSA 1Q12A 4ZCKA 3DUZA 5DEHA 1TS4A 2MP1A 1YJNA 1HNZL 1Z9FA 2EJMA 2ZTDA 2SDFA 1DCZA 3S2HB 3X3MA 1GO3E 1KLGD 1SRUA 4FVMA 1HZCA 3J80c 1F9SA 3NWSA 2VUMH 1LTGD 4DAVA 1VF5C 3TZUA 4KY7A 1ASYA 1TWAH 2XRQD 3K58A 3RLNA 1X56A 3KJPA 2WKDA 3EJIA 3K6OA 2JXMB 3NP8A 3U58A 2F52A 1YNJD 4RGOS 1PRTB 4A3BB 4DV4Q 3I91A 1G51A 4CDCC 1WTOA 1H9RA 2MHVA 2DGYA 1FD7D 4WJ3M 3J80E 1BCPF 2JEBI 2F3VA 3CCMA 3AU7A 3T51B 4DV1Q 4LFAQ 3RZOH 1MBYA 2ID0A 2RCNA 4O2DA 3RUZA 1I4QA 4OL7A 3UDIA 3CC2A 1ENFA 2ASBA 3V96A 2R7ZH 4OX9Q 2RSNA 1QOHA 2N8NA 4DV4L 2F3WA 1VQNA 3PCOB 1HNXQ 1JOOA 3PO2B 5D65A 1G2SA 3VYSA 1EQTA 3CQZH 3I4MB 2VS1A 3S1QH 2ZTEA 2IHFA 2VQEL 3T1HQ 1YNXA 2A19A 1ICWA 1JE4A 3R3OA 1MJCA 4K6DA 2F0HA 2ZM6Q 2M00A 4AYBE 4HEDA 1CKMA 1QCBD 4LF5L 4OX9L 4LFBQ 3HOUG 1BCPC 1IBLL 3H3VC 1ESFA 1XMQQ 1XXGA 1E0BA 1AW7A 2G5DA 4K6LA 4RG1A 1K8MA 1RTOA 2XWBB 1ESRA 4H02A 1MJEA 2F0DA 4A3GB 2PW5A 3FKIH 1TVXA 3HKSA 1F2MA 3MEHA 1PH1A 4ZRZA 3T1HL 5CYUA 1SE2A 2K5QA 2K50A 4L5TA 2ZM6L 4BY7B 2H5XA 2R92H 3KJOA 4OO1G 1Y1WH 1JB3A 2GN5A 4A3FH 4YCWA 4CKBA 2BH2A 3I7FA 5DM63 3I56A 4EVOA 3VR5A 1KDAA 5IYCH 3I90A 1K83B 2O2LD 3K57A 2WP8J 4QF4A 3PUYA 5E4WC 5C3EB 4DV3L 1HPCA 2F0EA 3PO3G 2OWOA 3U50C 3UE0A 4J8QA 1EY0A 3HOWH 1S3OA 1V9PA 5C4ZA 1YHQA 4DAYB 5IWAQ 2D9UA 4OONA 5IE8A 4K0KL 4E6IA 4WJ4A 1EWHA 5GROA 3D31A 3I4OA 2BDOA 4R4QA 2RHQB 4K2LA 1PLFA 4DUZQ 1SMYD 5C6AA 4H7BA 1D7QA 4IUQA 4GNXC 2CWPA 1L1OB 3SE0A 3CCEA 1BVSA 2PI2E 1KTKA 5T1GA 3WOEA 4TKOB 1ET6A 5M3MG 4GNXA 1H95A 3LWUA 2F0GA 1HA5A 4I7AA 5ISRA 5LMNW 1S5BD 1M90C 3H94A 5C44B 3HOYG 1GOZA 1NMGA 2A6HD 4RH6A 1JICA 3IL8A 4DR6L 4O1NA 2A68D 3S17H 4P2CB 2B63H 1D8LA 1U5KA 4XXEA 5CBAE 4DUZL 4V190 1PVOA 2E2JH 2HUGA 5EKLA 1VQGA 1V8QA 1SYCA 2DJFC 3A56A 5JPNC 2Z1CA 3GTJH 1D1IA 5HY6A 2E75C 1EY8A 2JSOA 3HP3A 1E1TA 2EY5A 2I5HA 2I5LX 4YWKA 3JAML 4G7OC 5GAEC 1LT3D 1MI2A 1ASZA 3AB9A 1QILA 1TXYA 2F0SA 2Q2HA 1TWGB 5FJ8G 1CSQA 3I4NB 1LO5D 5DNFA 3RMHA 1SFOH 1AP0A 1ZYRD 3QJYA 1QB5D 1EWIA 4DUYQ 3BS1A 4BBSB 5KRUA 2SNMA 4IUPA 1V1PB 3TP8A 4F8MA 4LF8L 4PMBA 1SYFA 3CCSA 1P8LA 2KEDA 2JA8G 3NBHB 5FLXE 2F03A 4X62L 1F2YA 5E7NA 3A7AB 1ML0D 1W6KA 2F0JA 4LNQA 3SVMA 5IP7G 4TVAB 2SEBD 4KI0A 2NN6I 5A2QL 1VQBA 1QNKA 4CKEA 3R2TA 1LT4D 2B2YC 3I73A 1Y1VG 3FDTA 2Z6KC 2WV6D 4CJ2C 3RR5A 1KXLA 1UE6A 2PZWA 4M8AA 2HHHQ 2N88A 1WOCA 2JK8A 2KEEA 1I94L 2NUCA 3IKJA 4A3CG 4IUVA 2ZJQA 2AWNA 4PG3A 4DNIA 1IYUA 1Q90A 3NEMA 5ELCA 2CW0C 2L1BA 1JT8A 1HR0Q 4NMZA 3J80i 4UDUC 5KNBA 4A3IH 1CZGA 2KUMA 2G9HD 2HHHL 2D0PA 1VQDA 3DWAA 1X3GA 1C4QA 4Q5VA 3V2TA 1H9KA 5JPMC 4RHRA 1A63A 5JEAJ 2K01A 3U4VA 4QL5A 1UAPA 2D0OA 4R4OA 3NE5B 4G4KA 1IBKQ 1FGUA 1G291 2R93B 2YTVA 2R7DA 2NN6G 2F1MA 4NB3A 1LTLA 3KDFB 3F2DA 4B3MQ 2UUAQ 1B8AA 2NVQH 1DOKA 1NR2A 1PTOD 4OELB 2DNCA 1EIYB 1CUKA 1DONA 5JJKA 1HFGA 3U9SA 1KD1C 1YI2A 1Q8KA 4CKCA 4CDDC 3S9WA 3AMUA 2VUMB 3E9IA 3G6EA 1CZWA 4R9WA 2I46A 2MUYA 1TWAB 3EROA 5BR8Q 3CU7A 1RIPA 3SGIA 4A93H 1R4PB 1GD7A 2RCFA 5IP9G 1BBWA 3HOZH 2A74C 4HN7A 4KJNA 1G6ZA 3S1NH 1JJ2A 1KAWA 3X3NA 4P71A 3QG1A 3NSWA 4JI4Q 1RHPA 4EQ5A 1HA6A 5KEEA 3DHQA 3G71A 2ZJRA 2UXCQ 1CTMA 3U4ZA 2IX1A 1X3EA 3OHXC 5C0XH 2H1EA 4HIDA 3RZOB 4O42A 3M4YA 2ICEC 3S16H 4ZQ3A 3E6ZX 3GQBA 3KOJA 4IPDA 4MZ9A 3NQTA 4JI8Q 2QEXA 2R7ZB 1K0SA 5JOBA 4JI4L 4RAUC 4B9XA 5KYIA 3BJUA 1K3BC 3CCQA 2UXCL 1BCPB 2B2WC 5LHY1 3GV3A 4DR3L 1A0IA 3CQZB 4P74A 4K8JA 3S1QB 5IGCA 3H0GH 5FLMH 2WAQB 3R93A 3PIP3 2AMCB 2AQ2B 2OCEA 3UDXA 2PQEA 4JI8L 1BBXC 4XTCS 1UWVA 4ZYSA 1J6QA 2JA6G 2EOTA 2B29A 3PF5A 2EYHA 1O80A 2EYOA 3FKIB 2UU9Q 4JI7Q 1B3QA 3K7UC 1Q81C 3H6MA 4KN7C 1L0XB 1PFMA 3H15A 4GLAC 2F0UA 4DK3C 1K8OA 1JWSD 1PDQA 3UDFA 2CH4A 2JN4A 3A5ZB 1ONLA 2EQSA 4GKJQ 4ILWA 4B3SL 2R92B 4DKAC 2L12A 1Y1WB 2F0VA 1M4VA 3I70A 4IO9A 4JI6Q 4A3FB 1DD2A 4A3LG 1A62A 3W5OA 1GJXA 3I4MG 2YTYA 5C5LA 3DLLA 4A3JH 2M2LA 3DXJC 2NBFA 5C4XG 4JI7L 3HS0C 1EYDA 2QGQA 1F2LA 1SAPA 3Q24A 5EKIA 4IJLA 4JK1C 1LTTD 2B2UC 2MPMA 3HOWB 4A3GG 1CKNA 5EPJA 3F2CA 3PIO3 3KLSX 4A4IA 1EYCA 5BN3A 2KHJA 1VF7A 3T1YL 4GNXB 4HJ5A 1E1OA 2NVYH 4K5XA 4QJFA 3URYA 1AFPA 3S1MH 1X54A 5ELOA 1EY6A 4LF7Q 1SE3A 4DV6Q 1VDZA 4LK1C 2KJXA 3HGBA 1LTAD 1MSHA 2EZVA 5C3EG 4A3KH 1STAA 2SOBA 1AE3A 3A5UA 1X32A 1SNPA 4JBWA 3S17B 1DJRD 1FGBD 2R7FA 5C4JH 2B63B 3D3RA 2E2JB 2K14A 3KFUA 4DR7Q 4ZKBB 4CJ1B 5JJIA 1PH7A 4JBKA 4DV6L 1HHVA 3STBC 1WJJA 4GOPC 5D3IB 3GTJB 1L1OA 2N55A 3M4OH 4GOPA 4XYQA 1MKHA 4LW1A 1VQHA 1VQFA 1W2BA 4J1MA 3SK5A 3HOVG 2RKSA 4WRDA 1B50A 2VQFQ 4DA2A 4YWLA 4G57A 2A8VA 2QW7A 3D6WA 1RD9D 1SFOB 2K5DA 4BXXH 4JV5L 4ZK9B 1ILQA 4DV0Q 1IBMQ 2BCOA 1NTGA 1SYEA 5EQ0A 3K8AA 1A3TA 4GKKL 3OW2A 4L6TB 1BO0A 5E4XA 4YY3Q 2K52A 1YVCA 4L5SA 4LMQD 1W3SA 3KLSA 3F2BA 2MQHA 2VW9A 3UE1A 3CMAA 1UE5A 1YNNC 4RMFA 1QVCA 1NSNS 1HRJA 1EL0A 4HJ9A 3TREA 1STNA 2B2TC 4BWGB 1PH8A 1PYSB 4HAEA 4Q0FA 1JR0D 2Y0SB 1KAAA 4IQZA 4B3RQ 3MAQA 1FR3A 1BDOA 4L5QA 2VNUD 1KNAA 3NBHA 2LXKA 4C3IH 1B2TA 3NBIA 4C3JG 4KY5A 2ZXPA 1IL8A 3J81L 4LF9L 5AJ3Q 1R9TH 1SNOA 2O4XA 1TWHH 1IHZA 3K7AH 3P20A 4DR1L 3J7ZC 4NW2A 3TP5A 2D2CC 2AWOA 1I50H 4UY8C 4JCVE 3K0YA 4B3RL 1WTHA 3OW7A 4PQXA 4IFDH 1EY4A 4DXGA 1YNJC 2JA7H 1SLJA 3MFYA 5COYA 1CSPA 1RL2A 3GTQH 4JI3Q 4MIUA 1D5XC 4A76A 2L0CA 3K5OA 4HJ8A 4F88A 5E3FA 2VB3X 4H44C 3ONAB 1G8ZD 3MXPA 2K1BA 1H9MA 4DR5Q 1EU3A 1NBWA 2CQAA 1HTPA 2EDGA 1YIJA 1V1QA 4ZLTF 3I3CA 1TS2A 5J39A 5FLXL 3QIAA 4DF7A 2FMCA 3A8KE 5C3WA 4JI3L 1LTSD 2ES2A 4JI2L 2QF7A 2AKWB 4J6HA 2NVQB 1Z47A 2D62A 3TSSA 2BE5D 2L9HA 4DV2L 2DUDA 4R4CA 5DLQE 4X65Q 3HKZG 2RDHA 1AZPA 1CK1A 4F7XA 4DR5L 4IUNA 1IZ6A 3NENA 5K36H 4X6AH 3HOZB 4BA1I 1S5CD 3CCUA 3GTOH 3KDFA 4AQYQ 3S1NB 2RQXA 2X69A 1L2FA 1TKWB 1XMOQ 5I4DA 2Q8TA 1YEZA 3NELA 2KA7A 4K5VA 4RGNA 1WTQA 2R93G 1QG7A 5GQOA 3F2UA 1EIFA 1KL9A 1QJOA 1MD2D 3Q8DA 5DM73 4K2KA 1I4RA 3D4RA 3CP0A 4G7HC 1CT1D 1SSOA 3ULPA 4OGQC 1LTID 3H3VI 2IY5B 5HURA 1QWYA 3KBGA 2BA0A 3S15H 2J0TD 3TP7A 3S16B 1LACA 4TSSA 1XMOL 3BZKA 3GD7A 4AH6A 4C1NI 3DM3A 5KNCA 1IW7C 5EKKA 2SNSA 1WTXA 1QNUA 5CBEE 1BXTA 1HQRD 3ND9A 4HIMA 1NJIC 3CD6A 3H0GB 3M4PA 3KUPA 4I7ZC 2JEAI 4K5WA 3C1EA 4B9WA 1I4HA 5L37A 3H3VH 3RD4A 4DV1L 4LFAL 2K03A 3K5NA 1N9WA 2WINB 4DV5Q 3HOUH 4KK7A 1A8VA 3TS2A 1SMYC 4QUCA 1GUGA 2ICIA 4JI1Q 1KDBA 2JYOA 3E3XA 2Z0SA 1TWCH 4H0LC 3T4AC 1HNXL 2TSSA 1FJGQ 1SN8A 1CA6A 1IYJB 4XIGS 1SYDA 3SR1A 4RHSA 1VQ4A 4C2MB 5CORA 2F0OA 4DV5L 4WORA 4UP7A 2A68C 4OO1H 4BS9A 2YU9H 1CKNB 2IL8A 1S40A 1ENAA 4A3JB 2E5LQ 4A3DH 4LFBL 2BH8A 2Q2UA 4KHVA 4B3TQ 1UNSA 1VQCA 1GUSA 1XMQL 1PXUA 3OTOQ 3HRZC 2L4NA 4JC0A 3MC0B 4HCSA 1B70B 4CHTB 1VMCA 3P7JA 2R6GA 2PNRC 4F87A 2RA4A 1W6JA 2E5LL 1JOKA 3VR3A 5M5XH 4KLKA 2MNAA 1ZYRC 2NVYB 1B53A 1CI3M 4X3SA 4EQNA 2YTXA 2WACA 2R92G 4LUOA 3S1MB 3GTPH 1Y1WG 1C8CA 1AH9A 4A3FG 1WYDA 4C3HH 2XGTA 2WB1B 4AYBB 1IYVA 5IYCG 1LTBD 4JPBW 1YHAA 1UE7A 3NK9A 5IT9c 2B8GA 4A3KB 5IGBA 1XNRQ 3N6RA 4KKTA 3HOYH 1SE4A 4KN4C 4GOPB 5EBCA 5IWAL 2B39A 2F0PA 1NNXA 5C4JB 1F9PA 1TS3A 2CHBD 4BBRG 1J8IA 3D4DA 4GS3A 5JVG3 2OEOA 2ATWA 3J81c 2EYFA 2K6AA 2EYPA 3M4OB 1HZ9A 2RBMA 4UPAA 5C0XJ 5CV4A 4X3KA 4FXKC 1K73C 1XNRL 1I6HH 3S1RH 2TMPA 4KV6A 2V4DA 3PUZA 2NTSA 2RSOA 3L7ZC 4LFCQ 1PH5A 3PV0A 1EEFD 3K5LA 2OT2A 1VQMA 3SEBA 1K8GA 2JE6I 1PTOF 2UXBQ 4CBVA 4IUTA 1VQ9A 2E2IH 1SYBA 2OQKA 4A3MB 2B2VC 1NR4A 3DWQA 1OXUA 2BA1A 2IW3A 3BZCA 2B2VA 2JA8H 1SJED 1RDPD 1X3QA 3M4QA 5JJLA 1O7YA 4GLVB 3G6JB 1JCKB 3EVQA 3TMEA 1D1KA 1X9NA 1NY4A 1B7YB 1PH6A 2F0WA 2E8GA 4ID6A 5JJZA 2PYKA 3HKZE 1UEAB 4N9TA 4NXNQ 1X3FA 2AUJD 4DUYL 2Z9HA 4DFAA 5CV5A 1PTOC 4C3IB 4HJ7A 5IIFA 5I6YA 5K5PA 2B2YA 1N33Q 2Z6KA 2HQEA 5C4HA 3C1FA 2NZHA 1R9TB 1TWHB 2F0IA 2IHEA 3K7AB 3NTKA 1JE5A 1M8AA 3RN5A 2GVBA 1SEBD 1I50B 3FP9A 2X6LA 4N8FA 3P1HA 2O5IC 4JG2A 4DNTB 3E0JA 1EOVA 1GUWA 1STYA 2Z8LA 2JA7B 4KJOA 4KMUC 4DU9A 4LUVA 2HT1A 3GTLH 3GTQB 2Y0SG 5T1IA 1VQAA 3A8IE 2RDFA 3CCLA 4NDXA 2NB0A 4IN3A 1WTVA 3ULJA 4BA2I 2PQAB 2LFNA 3LNNA 1AE2A 1HR0L 3Q23A 1E3PA 2PO4A 3Q6SA 2FMMA 1PFSA 3ZYYX 1E2WA 1PZJD 5M9OA 1TS5A 1OO9B 4LAAA 4LWCA 2CVRA 2RHSB 1WTWA 3OPOA 4QQBX 1CFMA 3WWVA 3HOXG 4POGA 5FO9B 4DXFA 1T5EA 1WI5A 1Q3LA 1BR9A 1C9OA 2BOSA 3MEFA 1DGSA 2MGSA 1RTNA 5JVH3 1STGA 1Z7TA 4RA8A 3FEWX 5C0XI 1LABA 2K33A 1IBKL 4DGZA 2E2DC 1EWCA 1LTRD 3GTOB 1HFNA 3BVMA 1O7ZA 1HXYD 4B3ML 2UUAL 3R8BA 2D5DA 4OWTB 4DR2Q 1DZ1A 5IYBH 4XQNA 1VQEA 4OEMB 4X66Q 4JI5Q 4LJZC 1VS0A 1U4MA 2KQ3A 2NVXH 1N34Q 2A6EC 2EE1A 3S15B 5I2XA 2L55A 4JOIC 5BR8L 1R4QB 4A3EH 5IYDH 5EBDA 5LMUQ 1Q1EA 3T56B 4X66L 1F9QA 2RF4A 1GKHA 3E9HA 4MTNA 2PMZE 3PUXA 3BDOA 3PSIA 2LMCB 4FO2A 1DOMA 4X64Q 1PA6A 1EYGA 3J7A5 2B2WA 3FHWA 3KF8B 3HOUB 1Y8OB 4DK1A 1KLUD 4A3BG 2R61A 2JA6H 2PZTA 1LLRD 1SROA 4ABNA 1N32Q 1RODA 1TWCB 3WDNA 1EIHA 2AHOB 1EY5A 4XYOA 1EQQA 1BF4A 3QOJA 1CKOA 1XJVA 4IFDJ 4QIWE 4EQOA 2YU9B 3MA2B 1K28A 1Y8PB 3PO2G 5HGQA 4A3DB 4GN3B 1G6PA 3GP7A 3H0GG 4POFA 5FLMG 3H91A 3HG9A 3HZXA 2MO1A 1EY9A 4DV7Q 4PZ7A 2C9OA 4LF4Q 5C4XH 2A1AA 3I72A 1SMXA 4XQQA 2OXPA 5G3LF 3JAMc 2UU9L 5BN4A 1O7IA 1OXTA 1Z6HA 1C7YA 3J80L 2VB2X 2CCZA 2J7ZA 3J7AF 4GKJL 4Z9CB 2KHSA 5M5XB 4B08A 5FOBB 4JI6L 4DK0A 2B2UA 3J7YW 2BDNA 4LF4L 1L0YB 3MXNB 1JORA 3GTPB 4R1JA 4RGTA 1GUNA 1PH9A 4C3HB 4BY7G 1PYBA 5GAGC 4IURA 3OYYA 4A3JG 5M3FH 3T53B 3E0EA 4S3SA 1LV9A 4ULLA 1BNZA 1PRTD 4K8IA 3HOYB 4R8NA 1YITA 2XNAC 3TEHB 4KY6A 3BU2A 3OIPA 3M3YH 1WD0A 3TQYA 2DN8A 2N49A 1PZKD 4QCLA 1BOSA 4LF7L 1I6HB 3S1RB 2I0QA 4C56C 4FXDA 5JEAG 3HOVH 1HNWQ 2WB1G 5LMNQ 1TY0A 3S2DH 5D14A 3BDLA 5A2QE 4YCVA 2QKIC 4FF1A 4PZ6A 3VYRA 4WFN3 3FMCA 1T5XD 3ICEA 4Y7NH 1WFQA 5C5MA 1F2ZA 3VYTA 4IALA 4OHJA 4DR7L 4JBMA 4RKBA 3A8JE 2NWGA 1DXMA 1ICFB 2E2IB 5C44G 1XTCD 3CCJA 5CV7A 3J7AV 4CDEC 2JA5H 3PIPA 5LMNL 3UI2A 2JA8B 3U9OA 2DNEA 2EXDA 2ZJPA 4UP8A 3IRBA 1B9MA 4IZ8A 2VQFL 2PNHA 2F0QA 3WOFA 4KKUA 4IJHA 1FNWA 4DV0L 3OIQA 1IBML 2WIIB 5KIXA 2K05A 4KD4A 4BXXG 3RZDH 4N9PA 4IFDI 2IX3A 1NUCA 1KHIA 2B2TA 3GV6A 2K5VA 3I4NG 2F0MA 3GDEA 4OXPA 2QA4A 1EOTA 1JWUD 4YY3L 4QUFA 1SBBB 4C3JH 1SNCA 2CWAA 3TBIB 1J5EQ 4PMWA 1RCVD 2IT1A 2GVAA 4IPGA 3W3AA 4WJWA 4A3MG 2E76C 2PI2A 3NTHA 1YJ9A 5EGTA 1Q86C 1KDCA 1BBUA 4BBSG 2PW7A 1E2ZA 1CM9A 1J9OA 2HD3A 4KD3A 1JC7A 1HUMA 2XSCA 1B44D 1KC8C 1H9SA 1VQ5A 3A74A 4A3IB 1TIID 2XWJB 3CMEA 3PIOA 3OMCA 5IGFA 1JMCA 3GTLB 3IFTA 1J5EL 3PGZA 3KBXA 2UUBQ 4HMJA 3C46A 4KKSA 3CCVA 2JP1A 1A15A 1WCMH 2G9DA 1Y8NB 2A69D 4C3IG 5TSSA 5AJ3L 2LS01 2IJ0A 5EPKA 4CDFC 1N8RC 1IKLA 1U4LA 2UXDQ 3EA6A 4KHPQ 1IXRA 1EFID 5CGKA 5FO7B 4H13C 2OQ0A 3AQQA 4MTKA 4X3UA 4HCEA 1EQVA 1G91A 2FXQA 4BY1H 2XN9C 1CHQD 1Q46A 1N36Q 2KECA 5J3BA 1ILPA 4IFDG 4U673 1E24A 4YCUA 4ZUJA 2V1CC 2VXWA 4DAMA 1L0WA 2PQAA 2KCCA 3CCRA 1IL2A 1EZ8A 2K4KA 4P73A 1TR5A 1HNZQ 2M9VA 1XNQQ 1YNND 1D5ZC 3SHLA 3KLWA 4MHEA 1EQRA 1O7LA 3FRPB 3VDYA 4A93B 1GXDC 1HCZA 4DNRB 1HZAA 2KOLA 2Q2TA 3AFQA 1SJHD 1I3QH 2E2HH 3TS0A 3S14H 1HJPA 2NVXB 4X65L 1B4OA 2XIWA 1AN8A 1QUQA 1STEA 1BQQT 1TT2A 2QILA 4JBJA 1TQOA 1XNQL 4IOCA 2EPBA 4A3EB 1ET9A 2RDGA 3EIVA 5FO8B 1OTCA 4U68A 2Q8RE 4AQYL 5K36G 1XPUA 4FYDA 2VUMG 1VQ7A 4UP9A 3O13A 4MNOA 3L9AX 1XPRA 3JAMi 1VQ6A 3DMUA 1Y69U 3QR8A 4X3TA 2CH4W 2EJFC 3SK8A 4R4IA 4ALPA 5C3XA 1PFNA 4OO1I 1RKNA 4PZ8A 1P16A 1V1OA 1YZ6A 1HQMC 2JA6B 4R4TA 1UUPA 3VR4A 2I07B 3I2ZA 3R2IA 2VQEQ 2HIVA 1AZQA 1PFBA 2XTIA 5D3DA 2A5HA 1ZEQX 5E1FA 4LF5Q 2H4OA 2CFMA 1IBLQ 2K75A 1S4ZA 3CPFA 2R7ZG 3ITPA 2F4IA 2B3GA 4ZKCB 1F9RA 3KF8A 5DAUA 3TZDA 2C35B 4QY7A 4PNYA 4GN4B 2A6HC 1T9HA 5I2YA 4FP5D 1JOQA 5C4XB 1CQVA 2WB1E 3MXUA 3PUWA 3EFXD 2ENBA 4ZUIA 1QVFA 1LT6D 4JI1L 1FNUA 4ODGA 5IODA 2WAQG 3ERQA 3NQIA 1Y14B 5JAVA 5LL6X 1FJGL 4GLXA 1K3RA 2K28A 3T13A 2LKVA 1GVPA 4Y52H 2JJQA 3PO3H 1LYLA 3C2PA 4R8IA 3FKIG 4DV3Q 2WFWA 3GTMH 1MGSA 1BKBA 1F77A 3SXHA 4B3TL 1FNVA 1S5ED 2FJ2A 2ZXRA 4A3DG 1EEID 2L15A 3OTOL 5M3FB 4FXGC 5CC4A 3DWPA 3I55A 1K0RA 1UEBA 4K0KQ 3NUCA 1RJTA 3BYYB 2DY8A 3W1GA 1DOLA 3Q0AA 5ELNA 4PV1C 1IW7D 4XT3B 5M3MH 1SDFA 4ME5A 3MXNA 4GN5A 1U0LA 1PMRA 1ZXTA 4BBRH 3NWTA 2K5NA 1KNEA 4L5RC 3M3YB 5J1ZA 3HOWG 5EJWA 1ZKOA 5IOCA 2Z4IA 2VZAA 1D6EC 4DR6Q 1VQJA 1PV4A 2N78A 3ER0A 2KCNA 4TQUS 3BVGA 4C3HG 3HOVB 2GA4B 3VA7A 2F0NA 3W1BA 1BCPD 3S2DB 1DM0B 2KBNA 5IGDA 5KNDA 3C3LA 1EY7A 5IT9E 2NZ1D 4Y7NB 3AEVA 4I65A 4RGMA 3CC7A 4A75A 2ZXOA 3DEOA 3Q22A 2ALYB 2PZUA 5FJ8H 4HTHA 4JVZA 1K8AC 2F0LA 1GM5A 2EYJA 1EYAA 1B1ZA 1QZHA 3J81E 4JW0A 2JA5B 3G48A 1SXTA 2JQOA 2B63G 1OXSC 1S5FD 3P75A 5FK9C 1AEXA 3AFPA 2EYMA 4FDBA 5IGEA 2PCFB 2QEJC 2R3ZA 2X6GA 3NXWA 3DEPA 1U4PA 4LFCL 5FLXc 3L3OC 4CJ0B 4HJAA 2WKCA 3MHBA 4LF8Q 4XT1B 1NE3A 4J15A 3CW2C 3NHHA 2ZTCA 5KYLA 1E7ZA 5M5YH 2NVTH 4L8JA 3K80C 5IP7H 4X62Q 3RZDB 1PTOH 2F4VQ 1A3UA 1WTPA 2UXBL 5BN5A 2C5CA 1YJWA 4P75A 1I4XA 2RVLA 1SNMA 3OWFA 1NMFA 4OWXB 4HSPA 3E5SA 1Y1VH 4RCOA 4IPCA 4C3JB 1H9SB 2XRSD 4LUZA 1HTLD 3J81j 1VCIA 3TN2A 2AQ3B 3EBEA 4HMIA 1TU2B 5M5WH 4A3CH 1I94Q 2F4VL 2K7VA 3RLFA 5HGTA 5ELDA 2ZT9C 1XTDA 2L5TA 3A7LA 4QB4A 3TRZA 5CV6A 3LX0A 3OMGA 4NXNL 2QDLA 3BG3A 1SR3A 2LY7A 1VQIA 4EX5A 1WCMB 1N33L 2XVSA 1I4GA 2E74C 2YV5A 3RN2A 3T16A 3CKIB 3D0FA 2EY2A 1JJGA 1TY2A 3KK7A 2MO0A 1JWMD 2FFKB 1Q7YC 3L0OA 3HFZB 3G4SA 4V0BA 1ENCA 4BY1B 2F3IA 3TDQA 1X65A 4XQJA 1FL0A 2FHTA 2NN6H 3HOXH 1LM0A 3PMFA 5ELEA 3CPWA 4OIKA 3QO2A 3B6YA 4A3IG 3M85A 3HKZB 1EZ6A 3QB3A 5J22A 1GHJA 2QCPX 3OWEB 1JB7A 1SYGA 3K5MA 1X6OA 4UHVA 1QUQB 4HIKA 3GTKH 2NYZD 5IGGA 1QVGA 1KRTA 3IFDA 3MTSA 1PH4A 1WTRA 1TWFH 3BDCA 2VL6A 4KHZA 3RNUA 5IP9H 4RFBA 1I3QB 3A54A 5KGUA 2E2HB 3RLOA 4OWWB 1A3VA 2HIXA 3S14B 4YHHQ 3OSOA 5I6WA 3GTGH 1K9MC 4YIJA 3MXGA 1VQPA 1WD1A 2WAQE 4KTAA 2EYLA 1SNDA 3EQLC 1HUNA 4RCNA 3A0JA 4C1NK 1KIXA 3S2HH 1A6XA 1Q82C 3N52A 4YHHL 1PRTF 2HDMA 3KF6A 3AYHB 3FPPA 4JOIA 2KCMA 2CW0D 1EIGA 4NXMQ 4DR2L 2I5MX 1A2TA 4HIOA 3CRLC 4A93G 4JI5L 3HOZG 3I4LA 5IYBG 1N34L 4NKLA 1STHA 1E22A 1SE8A 2JA9A 1LUZA 4DR3Q 4A3BH 2AQ1B 5FKAC 1C0AA 5I9PA 3F1ZA 1DYQA 3I8ZA 3M9BA 4HR7B 3PQIA 1GUOA 3CHBD 4NXML 5AFWA 5LMUL 5C0XG 3K81C 4A3EG 2NTTA 1D5MC 3SDZA 1MIUA 1H9JA 4L63B 1JQYD 5IYDG 4JI0Q 1Q1BA 1PRTC 3LWEA 1B9NA 2Q2IA 2YYZA 2F0TA 4X64L 3CC4A 4ZAIA 2HCCA 3PO2H 4FF2A 1B3AA 3D4WA 5ELBA 3SK6A 1S5DD 5F2DA 4A3LH 4B3SQ 3NPPA 2EXZA 3CRKC 3I4MH 1CA5A 4JI0L 4UAIA 1N32L 4IUUA 3LGJA 1E2VA 2CQOA 1I6VC 3J81i 2QDBA 3UDGA 1QE6A 2K32A 3EN2A 4DR4Q 1BUVT 2P5ZX 3PO3B 5GAHC 3MVVA 4FF4A 2HDLA 3F8TA 3GTMB 4A3GH 3MZ5A 2FINB 2PMZB 3FVQA 3JC66 1XWEA 4C2MH 2Z4HA 3V05A 1QZGA 2A6ED 4DV7L 3KLRA 3VYUA 1X3PA 1VQ8A 1RF2D 4BY7H 3CAMA 1VMPA 4TRDA 3NTIA 4DR4L 3T1YQ 1S72A 4QGUA 3BVZA 4AIMA 2IPKD 5LL6S 5I9OA 2KENA 3VA5A 3JAME 3DM1A 4XDXA 1K83H 5M3MB 1EFWA 3OOCA 3SK4A 2J4XA 3D8GA 4CGYB 5C3EH 3D6CA 1A2UA 4BBRB 3HEJA 3ND8A 4DAPA 2OTLA 2A73B 1MHWC 1PYWD 4M1UB 4QMGA 2EVBA 4QIWB 3A55A 4IOAA 3S24A 4FNFA 1C48A 2MFIA 3ULLA 3M7NA 4PMCA 1G2TA 1EU4A 3QWNA 4YWMA 5JEAH 5M3FG 5EAYA 1SNQA 4RWSC 1O78A 3G7LA 4HSVA 5IY0A 3L2PA 4JYAQ 4P72A 4AYBG 4LF6Q 4DAYA 1I5FA 3TP6A 3KYHC 5CV9A 1IKMA 1HZBA 3H09A 3K0XA 4A3KG 4FF3A 2Z6BA 4OIJA 5C44H 2HCIA 5EPLA 2Y0SE 4JV5Q 3VR6A 3IAYA 2EJGC 1L1OC 1HNWL 4JYAL 2A69C 2PPBC 4LF6L 1LT5D
chains in the Genus database with same CATH topology
1VQ7A 3G71A 4UP9A 4GKKQ 2ZJRA 2UXCQ 4MNOA 1K8GA 2JE6I 1XPRA 3JAMi 2UXBQ 3U4ZA 1VQ6A 2IX1A 1X3EA 1VQ9A 4HIDA 2E2IH 2OQKA 5H1SE 3S16H 1OXUA 4R4IA 4ALPA 4MZ9A 3KOJA 2HQLA 4IPDA 2BA1A 3BZCA 4JI8Q 2QEXA 4OO1I 2JA8H 4PZ8A 1P16A 1TWGH 1V43A 1OXVA 1YZ6A 4JI4L 3M4QA 3I4NH 5JJLA 4R4TA 3BJUA 2LXJA 4GLVB 3CCQA 3CXCA 1PHJA 3I2ZA 2JA5G 2N3SA 2UXCL 2VQEQ 2HIVA 4DR3L 4A3MH 1A0IA 1X9NA 2XTIA 1NY4A 1B7YB 4P74A 2VY3A 1PH6A 4LF5Q 2E8GA 3H0GH 5FLMH 2UUCQ 1KRSA 4BBSH 2CFMA 1IBLQ 3HKZE 1PH2A 4NXNQ 1X3FA 2AMCB 2K75A 4O0AA 2OCEA 3UDXA 4DUYL 3CPFA 3CF5A 2R7ZG 4JI8L 4LF9Q 2B3GA 4XTCS 1UWVA 4HJ7A 1J6QA 2JA6G 2B29A 2C35B 4QY7A 3PF5A 1N33Q 4GN4B 4DR1Q 2Z6KA 2NZHA 1T9HA 2IHEA 3GO5A 4DPGA 2UU9Q 3K7UC 4JI7Q 1Q81C 1JE5A 2K5HA 1EUJA 2WB1E 3PUWA 4APVA 3RN5A 2GVBA 1VQLA 4JI1L 1QVFA 2OTJA 3H15A 2UUCL 4GLAC 1VQKA 2WAQG 4DK3C 3FP9A 1M1KC 3UDFA 5GADC 1HR0W 3A5ZB 1Y14B 2EQSA 3PUVA 4IPHA 3STBD 4GKJQ 4JG2A 4B3SL 1FJGL 1EOVA 4DKAC 4GLXA 1K3RA 4IO9A 4JI6Q 1GVPA 1FVIA 2JJQA 3PO3H 4Y52H 4A3LG 1LYLA 1A62A 4DK6C 1X55A 1UE1A 3W5OA 2KCTA 2KHIA 4LUVA 2YTYA 3DLLA 3FKIG 4DV3Q 4A3JH 2HT1A 3GTLH 3I4MG 2WFWA 2Y0SG 3GTMH 4JI7L 5C4XG 3PF4A 1BKBA 2QGQA 1VQAA 2UUBL 3CCLA 4B3TL 1JJCB 3ULJA 1XPOA 4A3DG 4BA2I 4IJLA 2L15A 2PQAB 3OTOL 2IX0A 1AE2A 4A3GG 3I55A 1CKNA 3F2CA 1HR0L 1K0RA 1UEBA 1E3PA 2CKZB 4K0KQ 4NPSA 4JI2Q 1WCMG 2JA7G 1PFSA 1YBYA 4A4IA 2UXDL 2KHJA 1HH2P 4DV2Q 3W1GA 3T1YL 4KHPL 3ERSX 4LWCA 4GNXB 1E1OA 2RHSB 4HJ5A 4ME3A 5ELNA 2NVYH 4QQBX 4QJFA 3WWVA 3HOXG 4POGA 1VQOA 5M3MH 1OXXK 2NZOA 3S1MH 1WI5A 3ZJYC 1X54A 4GN5A 1PH3A 1U0LA 5ELOA 1C9OA 4BBRH 1N36L 1KQSA 1YHBA 3MEFA 2K5NA 4L5RC 1DGSA 4LF7Q 3HOWG 4BY1G 4DV6Q 2VZAA 2R93H 2EIFA 5C0XI 3KF6B 1IBKL 4DR6Q 5C3EG 1VQJA 1Q12A 2LSSA 4A3KH 1PV4A 2N78A 3ER0A 1AE3A 4TQUS 1YJNA 1HNZL 3A5UA 3W1BA 1Z9FA 4JBWA 2R7FA 5C4JH 2ZTDA 2KBNA 4B3ML 2UUAL 2K14A 3KFUA 4DR7Q 5JJIA 1PH7A 4OWTB 4DR2Q 1GO3E 4JBKA 1SRUA 5IYBH 3AEVA 1HZCA 1VQEA 3J80c 4DV6L 4X66Q 3STBC 3CC7A 4A75A 4JI5Q 1WJJA 4GOPC 2VUMH 1VS0A 1L1OA 2ALYB 5FJ8H 2NVXH 1N34Q 3M4OH 1ASYA 4GOPA 1K8AC 1TWAH 1MKHA 4LW1A 1VQHA 1GM5A 1VQFA 1QZHA 3RLNA 1X56A 1W2BA 3KJPA 3HOVG 3G48A 4JOIC 2VQFQ 5BR8L 2JQOA 2B63G 4YWLA 3U58A 4A3EH 1OXSC 2A8VA 2F52A 5IYDH 3AFPA 4FDBA 4JV5L 4BXXH 5LMUQ 1Q1EA 4DV4Q 4DV0Q 1G51A 1IBMQ 4LFCL 1NTGA 4X66L 2RF4A 5FLXc 2DGYA 4HJAA 1GKHA 3E9HA 4MTNA 4WJ3M 3K8AA 2PMZE 3PUXA 4LF8Q 3PSIA 1NE3A 2JEBI 3CW2C 4J15A 2ZTCA 5M5YH 1E7ZA 3CCMA 4LFAQ 4DV1Q 4GKKL 4X64Q 2NVTH 3K80C 3RZOH 3OW2A 5IP7H 4X62Q 2ID0A 2RCNA 4O2DA 3UDIA 3CC2A 2F4VQ 1PA6A 4YY3Q 1EYGA 2UXBL 3J7A5 2K52A 1YVCA 4P75A 1YJWA 4L5SA 1W3SA 3FHWA 4OX9Q 2ASBA 3KF8B 2MQHA 4OWXB 1NMFA 3F2BA 2VW9A 2R7ZH 3UE1A 1Y1VH 3CMAA 4A3BG 1UE5A 2N8NA 4IPCA 4DV4L 1VQNA 2JA6H 1SROA 3PCOB 1HNXQ 4RMFA 1QVCA 4LUZA 1N32Q 3J81j 4HJ9A 1VCIA 3TREA 1PH8A 1PYSB 3CQZH 3EBEA 2AHOB 2VS1A 3S1QH 2ZTEA 5M5WH 4A3CH 2IHFA 2VQEL 3T1HQ 1YNXA 1EQQA 2A19A 1I94Q 2F4VL 1CKOA 1MJCA 3RLFA 2ZM6Q 4B3RQ 4AYBE 1XJVA 4IFDJ 1CKMA 1XTDA 4L5QA 4LF5L 4OX9L 4LFBQ 3HOUG 2VNUD 3TRZA 2LXKA 1IBLL 4C3IH 4QIWE 4NXNL 1XMQQ 4RG1A 3PO2G 5HGQA 4GN3B 1G6PA 3H0GG 4H02A 4POFA 1SR3A 5FLMG 1MJEA 4LF9L 3FKIH 1VQIA 2MO1A 4EX5A 3HKSA 5AJ3Q 4DV7Q 4PZ7A 1R9TH 1PH1A 1TWHH 4LF4Q 5C4XH 2A1AA 1N33L 3K7AH 4DR1L 3J7ZC 1SMXA 2YV5A 3RN2A 2AWOA 1I50H 3JAMc 3T1HL 2UU9L 3D0FA 1O7IA 1OXTA 1JJGA 2K50A 4UY8C 4JCVE 4L5TA 2ZM6L 4B3RL 2H5XA 2MO0A 2R92H 1C7YA 3KJOA 4OO1G 2CCZA 1Y1WH 2GN5A 4A3FH 4GKJL 1Q7YC 4YCWA 3L0OA 1SLJA 3HFZB 2BH2A 3I7FA 2JA7H 3G4SA 3I56A 1CSPA 1RL2A 2F3IA 5IYCH 4JI6L 3GTQH 4JI3Q 1X65A 4LF4L 4A76A 2WP8J 3MXNB 3PUYA 1FL0A 3HOXH 4HJ8A 4R1JA 1LM0A 4DV3L 3CPWA 3PO3G 4A3IG 3B6YA 1PH9A 3M85A 2OWOA 3U50C 4BY7G 1PYBA 5GAGC 3OYYA 3UE0A 4DR5Q 5M3FH 4A3JG 1NBWA 1YIJA 1JB7A 3E0EA 1S3OA 1V1QA 3HOWH 1V9PA 1YHQA 4DAYB 5IWAQ 4OONA 1X6OA 5IE8A 1QUQB 4JI3L 4HIKA 2ES2A 4JI2L 3GTKH 2AKWB 4K0KL 4WJ4A 1Z47A 5GROA 2D62A 3D31A 3I4OA 1YITA 1QVGA 3TEHB 3BU2A 1KRTA 4R4QA 4DV2L 2DUDA 1PH4A 2RHQB 1TWFH 4R4CA 4DUZQ 2VL6A 4KHZA 3HKZG 5DLQE 5IP9H 4X65Q 3RNUA 3RLOA 4OWWB 2HIXA 4DR5L 3M3YH 4YHHQ 1D7QA 4GNXC 1IZ6A 1L1OB 2CWPA 3NENA 3CCEA 1BVSA 2PI2E 3TQYA 2N49A 3GTGH 1K9MC 1H95A 5M3MG 4GNXA 4LF7L 5LMNW 4X6AH 1VQPA 1M90C 3HOYG 2I0QA 2WAQE 5JEAG 1NMGA 4BA1I 3CCUA 3GTOH 3HOVH 3KDFA 4AQYQ 1HNWQ 2WB1G 4DR6L 1L2FA 5LMNQ 3A0JA 1XMOQ 3S2DH 3S17H 1YEZA 3NELA 2R93G 2B63H 1D8LA 1U5KA 4YCVA 4DUZL 5GQOA 1KIXA 1PVOA 2E2JH 3S2HH 1EIFA 4PZ6A 1KL9A 1VQGA 1Q82C 3ICEA 3Q8DA 4Y7NH 1WFQA 4YHHL 3KF6A 3AYHB 3CP0A 4JOIA 4DR7L 3ULPA 2KCMA 3GTJH 3H3VI 4JBMA 4DR2L 4NXMQ 2I5MX 5HY6A 4HIOA 2IY5B 4A93G 5C44G 4JI5L 3HOZG 1E1TA 2BA0A 3S15H 2I5HA 3CCJA 2I5LX 5IYBG 4YWKA 3PIPA 1N34L 2JA5H 5GAEC 1ASZA 5LMNL 1XMOL 1TXYA 3BZKA 1E22A 1SE8A 2Q2HA 2JA9A 2EXDA 5FJ8G 1CSQA 3GD7A 2ZJPA 1LUZA 4UP8A 4AH6A 3IRBA 4DR3Q 1SFOH 3DM3A 2VQFL 2PNHA 4A3BH 1C0AA 3F1ZA 3M9BA 1EWIA 4NXML 4IJHA 5LMUL 5C0XG 3K81C 4DUYQ 4DV0L 4HIMA 4A3EG 1IBML 1MIUA 1NJIC 3CD6A 3M4PA 5IYDG 4JI0Q 1Q1BA 2JEAI 4BXXG 3RZDH 4LF8L 3CCSA 1P8LA 3H3VH 2JA8G 3NBHB 4IFDI 2Q2IA 2YYZA 4DV1L 4LFAL 1KHIA 4X64L 3I4NG 2K5VA 1N9WA 3GDEA 4OXPA 4X62L 2QA4A 4DV5Q 3HOUH 5E7NA 3CC4A 1A8VA 4YY3L 3TS2A 4C3JH 2CWAA 4LNQA 3PO2H 4JI1Q 5IP7G 1J5EQ 4PMWA 4TVAB 2IT1A 4KI0A 2GVAA 4IPGA 4A3MG 2NN6I 2PI2A 1YJ9A 2Z0SA 1TWCH 1HNXL 1Q86C 1VQBA 4A3LH 1BBUA 4BBSG 4B3SQ 1FJGQ 1SN8A 3I4MH 4JI0L 1IYJB 1Y1VG 4XIGS 1N32L 2Z6KC 3LGJA 2CQOA 3RR5A 1VQ4A 1KXLA 3J81i 1KC8C 3UDGA 1UE6A 4DR4Q 3EN2A 1VQ5A 4DV5L 2HHHQ 3A74A 1WOCA 4UP7A 2JK8A 1I94L 5GAHC 3PIOA 3CMEA 2YU9H 1JMCA 1CKNB 4A3DH 1S40A 1J5EL 3PGZA 2E5LQ 2UUBQ 4A3CG 4LFBL 2BH8A 3F8TA 2Q2UA 2ZJQA 2AWNA 4PG3A 1VQCA 4DNIA 4B3TQ 4A3GH 1XMQL 3CCVA 3NEMA 1WCMH 3OTOQ 3JC66 4C2MH 1JT8A 1QZGA 1HR0Q 3J80i 5AJ3L 4DV7L 4A3IH 1N8RC 1VQ8A 4BY7H 4JC0A 2UXDQ 3CAMA 4DR4L 3T1YQ 2HHHL 4KHPQ 1B70B 2D0PA 1IXRA 1VQDA 4QGUA 1S72A 1X3GA 4AIMA 2R6GA 2OQ0A 3AQQA 2KENA 2E5LL 1A63A 5M5XH 5JEAJ 2FXQA 4KLKA 2MNAA 4BY1H 1Q46A 1N36Q 1K83H 1EFWA 2YTXA 2R92G 4LUOA 3U4VA 3GTPH 5C3EH 5J3BA 1Y1WG 4IFDG 4QL5A 1AH9A 4A3FG 1E24A 4YCUA 1WYDA 2D0OA 4C3HH 2XGTA 4R4OA 2V1CC 2OTLA 1IBKQ 1FGUA 4DAMA 1L0WA 5IYCG 2PQAA 1G291 3CCRA 1IL2A 2YTVA 2R7DA 2K4KA 4P73A 1HNZQ 1YHAA 1UE7A 2NN6G 4IOAA 3S24A 5IT9c 4NB3A 3ULLA 2MFIA 1XNRQ 3M7NA 1LTLA 3KDFB 1XNQQ 3F2DA 4B3MQ 2UUAQ 3HOYH 4YWMA 3KLWA 1B8AA 4GOPB 2NVQH 5IWAL 5M3FG 5EAYA 1EIYB 1CUKA 1EQRA 3VDYA 4BBRG 2Q2TA 1HZAA 4GS3A 3AFQA 2ATWA 5JJKA 5IY0A 3L2PA 3J81c 4JYAQ 1KD1C 1I3QH 1YI2A 4P72A 4AYBG 2E2HH 4LF6Q 3TS0A 3S14H 1I5FA 1Q8KA 1HJPA 3KYHC 3E9IA 3G6EA 4X65L 1HZ9A 1QUQA 4UPAA 5C0XJ 1HZBA 3K0XA 4A3KG 5BR8Q 1XNRL 1K73C 4JBJA 1I6HH 1RIPA 3SGIA 3S1RH 1XNQL 4A93H 1GD7A 5IP9G 5C44H 4IOCA 2Y0SE 1BBWA 3HOZH 4JV5Q 3PUZA 3S1NH 1L1OC 3L7ZC 4LFCQ 1JJ2A 1KAWA 3EIVA 1PH5A 1OTCA 4P71A 3PV0A 4AQYL 4JI4Q 4JYAL 1HNWL 5K36G 1XPUA 4LF6L 4EQ5A 1VQMA 2VUMG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ7 A;  3G71 A;  4UP9 A;  4GKK Q;  2ZJR A;  2UXC Q;  4MNO A;  1K8G A;  2JE6 I;  1XPR A;  3JAM i;  2UXB Q;  3U4Z A;  1VQ6 A;  2IX1 A;  1X3E A;  1VQ9 A;  4HID A;  2E2I H;  2OQK A;  5H1S E;  3S16 H;  1OXU A;  4R4I A;  4ALP A;  4MZ9 A;  3KOJ A;  2HQL A;  4IPD A;  2BA1 A;  3BZC A;  4JI8 Q;  2QEX A;  4OO1 I;  2JA8 H;  4PZ8 A;  1P16 A;  1TWG H;  1V43 A;  1OXV A;  1YZ6 A;  4JI4 L;  3M4Q A;  3I4N H;  5JJL A;  4R4T A;  3BJU A;  2LXJ A;  4GLV B;  3CCQ A;  3CXC A;  1PHJ A;  3I2Z A;  2JA5 G;  2N3S A;  2UXC L;  2VQE Q;  2HIV A;  4DR3 L;  4A3M H;  1A0I A;  1X9N A;  2XTI A;  1NY4 A;  1B7Y B;  4P74 A;  2VY3 A;  1PH6 A;  4LF5 Q;  2E8G A;  3H0G H;  5FLM H;  2UUC Q;  1KRS A;  4BBS H;  2CFM A;  1IBL Q;  3HKZ E;  1PH2 A;  4NXN Q;  1X3F A;  2AMC B;  2K75 A;  4O0A A;  2OCE A;  3UDX A;  4DUY L;  3CPF A;  3CF5 A;  2R7Z G;  4JI8 L;  4LF9 Q;  2B3G A;  4XTC S;  1UWV A;  4HJ7 A;  1J6Q A;  2JA6 G;  2B29 A;  2C35 B;  4QY7 A;  3PF5 A;  1N33 Q;  4GN4 B;  4DR1 Q;  2Z6K A;  2NZH A;  1T9H A;  2IHE A;  3GO5 A;  4DPG A;  2UU9 Q;  3K7U C;  4JI7 Q;  1Q81 C;  1JE5 A;  2K5H A;  1EUJ A;  2WB1 E;  3PUW A;  4APV A;  3RN5 A;  2GVB A;  1VQL A;  4JI1 L;  1QVF A;  2OTJ A;  3H15 A;  2UUC L;  4GLA C;  1VQK A;  2WAQ G;  4DK3 C;  3FP9 A;  1M1K C;  3UDF A;  5GAD C;  1HR0 W;  3A5Z B;  1Y14 B;  2EQS A;  3PUV A;  4IPH A;  3STB D;  4GKJ Q;  4JG2 A;  4B3S L;  1FJG L;  1EOV A;  4DKA C;  4GLX A;  1K3R A;  4IO9 A;  4JI6 Q;  1GVP A;  1FVI A;  2JJQ A;  3PO3 H;  4Y52 H;  4A3L G;  1LYL A;  1A62 A;  4DK6 C;  1X55 A;  1UE1 A;  3W5O A;  2KCT A;  2KHI A;  4LUV A;  2YTY A;  3DLL A;  3FKI G;  4DV3 Q;  4A3J H;  2HT1 A;  3GTL H;  3I4M G;  2WFW A;  2Y0S G;  3GTM H;  4JI7 L;  5C4X G;  3PF4 A;  1BKB A;  2QGQ A;  1VQA A;  2UUB L;  3CCL A;  4B3T L;  1JJC B;  3ULJ A;  1XPO A;  4A3D G;  4BA2 I;  4IJL A;  2L15 A;  2PQA B;  3OTO L;  2IX0 A;  1AE2 A;  4A3G G;  3I55 A;  1CKN A;  3F2C A;  1HR0 L;  1K0R A;  1UEB A;  1E3P A;  2CKZ B;  4K0K Q;  4NPS A;  4JI2 Q;  1WCM G;  2JA7 G;  1PFS A;  1YBY A;  4A4I A;  2UXD L;  2KHJ A;  1HH2 P;  4DV2 Q;  3W1G A;  3T1Y L;  4KHP L;  3ERS X;  4LWC A;  4GNX B;  1E1O A;  2RHS B;  4HJ5 A;  4ME3 A;  5ELN A;  2NVY H;  4QQB X;  4QJF A;  3WWV A;  3HOX G;  4POG A;  1VQO A;  5M3M H;  1OXX K;  2NZO A;  3S1M H;  1WI5 A;  3ZJY C;  1X54 A;  4GN5 A;  1PH3 A;  1U0L A;  5ELO A;  1C9O A;  4BBR H;  1N36 L;  1KQS A;  1YHB A;  3MEF A;  2K5N A;  4L5R C;  1DGS A;  4LF7 Q;  3HOW G;  4BY1 G;  4DV6 Q;  2VZA A;  2R93 H;  2EIF A;  5C0X I;  3KF6 B;  1IBK L;  4DR6 Q;  5C3E G;  1VQJ A;  1Q12 A;  2LSS A;  4A3K H;  1PV4 A;  2N78 A;  3ER0 A;  1AE3 A;  4TQU S;  1YJN A;  1HNZ L;  3A5U A;  3W1B A;  1Z9F A;  4JBW A;  2R7F A;  5C4J H;  2ZTD A;  2KBN A;  4B3M L;  2UUA L;  2K14 A;  3KFU A;  4DR7 Q;  5JJI A;  1PH7 A;  4OWT B;  4DR2 Q;  1GO3 E;  4JBK A;  1SRU A;  5IYB H;  3AEV A;  1HZC A;  1VQE A;  3J80 c;  4DV6 L;  4X66 Q;  3STB C;  3CC7 A;  4A75 A;  4JI5 Q;  1WJJ A;  4GOP C;  2VUM H;  1VS0 A;  1L1O A;  2ALY B;  5FJ8 H;  2NVX H;  1N34 Q;  3M4O H;  1ASY A;  4GOP A;  1K8A C;  1TWA H;  1MKH A;  4LW1 A;  1VQH A;  1GM5 A;  1VQF A;  1QZH A;  3RLN A;  1X56 A;  1W2B A;  3KJP A;  3HOV G;  3G48 A;  4JOI C;  2VQF Q;  5BR8 L;  2JQO A;  2B63 G;  4YWL A;  3U58 A;  4A3E H;  1OXS C;  2A8V A;  2F52 A;  5IYD H;  3AFP A;  4FDB A;  4JV5 L;  4BXX H;  5LMU Q;  1Q1E A;  4DV4 Q;  4DV0 Q;  1G51 A;  1IBM Q;  4LFC L;  1NTG A;  4X66 L;  2RF4 A;  5FLX c;  2DGY A;  4HJA A;  1GKH A;  3E9H A;  4MTN A;  4WJ3 M;  3K8A A;  2PMZ E;  3PUX A;  4LF8 Q;  3PSI A;  1NE3 A;  2JEB I;  3CW2 C;  4J15 A;  2ZTC A;  5M5Y H;  1E7Z A;  3CCM A;  4LFA Q;  4DV1 Q;  4GKK L;  4X64 Q;  2NVT H;  3K80 C;  3RZO H;  3OW2 A;  5IP7 H;  4X62 Q;  2ID0 A;  2RCN A;  4O2D A;  3UDI A;  3CC2 A;  2F4V Q;  1PA6 A;  4YY3 Q;  1EYG A;  2UXB L;  3J7A 5;  2K52 A;  1YVC A;  4P75 A;  1YJW A;  4L5S A;  1W3S A;  3FHW A;  4OX9 Q;  2ASB A;  3KF8 B;  2MQH A;  4OWX B;  1NMF A;  3F2B A;  2VW9 A;  2R7Z H;  3UE1 A;  1Y1V H;  3CMA A;  4A3B G;  1UE5 A;  2N8N A;  4IPC A;  4DV4 L;  1VQN A;  2JA6 H;  1SRO A;  3PCO B;  1HNX Q;  4RMF A;  1QVC A;  4LUZ A;  1N32 Q;  3J81 j;  4HJ9 A;  1VCI A;  3TRE A;  1PH8 A;  1PYS B;  3CQZ H;  3EBE A;  2AHO B;  2VS1 A;  3S1Q H;  2ZTE A;  5M5W H;  4A3C H;  2IHF A;  2VQE L;  3T1H Q;  1YNX A;  1EQQ A;  2A19 A;  1I94 Q;  2F4V L;  1CKO A;  1MJC A;  3RLF A;  2ZM6 Q;  4B3R Q;  4AYB E;  1XJV A;  4IFD J;  1CKM A;  1XTD A;  4L5Q A;  4LF5 L;  4OX9 L;  4LFB Q;  3HOU G;  2VNU D;  3TRZ A;  2LXK A;  1IBL L;  4C3I H;  4QIW E;  4NXN L;  1XMQ Q;  4RG1 A;  3PO2 G;  5HGQ A;  4GN3 B;  1G6P A;  3H0G G;  4H02 A;  4POF A;  1SR3 A;  5FLM G;  1MJE A;  4LF9 L;  3FKI H;  1VQI A;  2MO1 A;  4EX5 A;  3HKS A;  5AJ3 Q;  4DV7 Q;  4PZ7 A;  1R9T H;  1PH1 A;  1TWH H;  4LF4 Q;  5C4X H;  2A1A A;  1N33 L;  3K7A H;  4DR1 L;  3J7Z C;  1SMX A;  2YV5 A;  3RN2 A;  2AWO A;  1I50 H;  3JAM c;  3T1H L;  2UU9 L;  3D0F A;  1O7I A;  1OXT A;  1JJG A;  2K50 A;  4UY8 C;  4JCV E;  4L5T A;  2ZM6 L;  4B3R L;  2H5X A;  2MO0 A;  2R92 H;  1C7Y A;  3KJO A;  4OO1 G;  2CCZ A;  1Y1W H;  2GN5 A;  4A3F H;  4GKJ L;  1Q7Y C;  4YCW A;  3L0O A;  1SLJ A;  3HFZ B;  2BH2 A;  3I7F A;  2JA7 H;  3G4S A;  3I56 A;  1CSP A;  1RL2 A;  2F3I A;  5IYC H;  4JI6 L;  3GTQ H;  4JI3 Q;  1X65 A;  4LF4 L;  4A76 A;  2WP8 J;  3MXN B;  3PUY A;  1FL0 A;  3HOX H;  4HJ8 A;  4R1J A;  1LM0 A;  4DV3 L;  3CPW A;  3PO3 G;  4A3I G;  3B6Y A;  1PH9 A;  3M85 A;  2OWO A;  3U50 C;  4BY7 G;  1PYB A;  5GAG C;  3OYY A;  3UE0 A;  4DR5 Q;  5M3F H;  4A3J G;  1NBW A;  1YIJ A;  1JB7 A;  3E0E A;  1S3O A;  1V1Q A;  3HOW H;  1V9P A;  1YHQ A;  4DAY B;  5IWA Q;  4OON A;  1X6O A;  5IE8 A;  1QUQ B;  4JI3 L;  4HIK A;  2ES2 A;  4JI2 L;  3GTK H;  2AKW B;  4K0K L;  4WJ4 A;  1Z47 A;  5GRO A;  2D62 A;  3D31 A;  3I4O A;  1YIT A;  1QVG A;  3TEH B;  3BU2 A;  1KRT A;  4R4Q A;  4DV2 L;  2DUD A;  1PH4 A;  2RHQ B;  1TWF H;  4R4C A;  4DUZ Q;  2VL6 A;  4KHZ A;  3HKZ G;  5DLQ E;  5IP9 H;  4X65 Q;  3RNU A;  3RLO A;  4OWW B;  2HIX A;  4DR5 L;  3M3Y H;  4YHH Q;  1D7Q A;  4GNX C;  1IZ6 A;  1L1O B;  2CWP A;  3NEN A;  3CCE A;  1BVS A;  2PI2 E;  3TQY A;  2N49 A;  3GTG H;  1K9M C;  1H95 A;  5M3M G;  4GNX A;  4LF7 L;  5LMN W;  4X6A H;  1VQP A;  1M90 C;  3HOY G;  2I0Q A;  2WAQ E;  5JEA G;  1NMG A;  4BA1 I;  3CCU A;  3GTO H;  3HOV H;  3KDF A;  4AQY Q;  1HNW Q;  2WB1 G;  4DR6 L;  1L2F A;  5LMN Q;  3A0J A;  1XMO Q;  3S2D H;  3S17 H;  1YEZ A;  3NEL A;  2R93 G;  2B63 H;  1D8L A;  1U5K A;  4YCV A;  4DUZ L;  5GQO A;  1KIX A;  1PVO A;  2E2J H;  3S2H H;  1EIF A;  4PZ6 A;  1KL9 A;  1VQG A;  1Q82 C;  3ICE A;  3Q8D A;  4Y7N H;  1WFQ A;  4YHH L;  3KF6 A;  3AYH B;  3CP0 A;  4JOI A;  4DR7 L;  3ULP A;  2KCM A;  3GTJ H;  3H3V I;  4JBM A;  4DR2 L;  4NXM Q;  2I5M X;  5HY6 A;  4HIO A;  2IY5 B;  4A93 G;  5C44 G;  4JI5 L;  3HOZ G;  1E1T A;  2BA0 A;  3S15 H;  2I5H A;  3CCJ A;  2I5L X;  5IYB G;  4YWK A;  3PIP A;  1N34 L;  2JA5 H;  5GAE C;  1ASZ A;  5LMN L;  1XMO L;  1TXY A;  3BZK A;  1E22 A;  1SE8 A;  2Q2H A;  2JA9 A;  2EXD A;  5FJ8 G;  1CSQ A;  3GD7 A;  2ZJP A;  1LUZ A;  4UP8 A;  4AH6 A;  3IRB A;  4DR3 Q;  1SFO H;  3DM3 A;  2VQF L;  2PNH A;  4A3B H;  1C0A A;  3F1Z A;  3M9B A;  1EWI A;  4NXM L;  4IJH A;  5LMU L;  5C0X G;  3K81 C;  4DUY Q;  4DV0 L;  4HIM A;  4A3E G;  1IBM L;  1MIU A;  1NJI C;  3CD6 A;  3M4P A;  5IYD G;  4JI0 Q;  1Q1B A;  2JEA I;  4BXX G;  3RZD H;  4LF8 L;  3CCS A;  1P8L A;  3H3V H;  2JA8 G;  3NBH B;  4IFD I;  2Q2I A;  2YYZ A;  4DV1 L;  4LFA L;  1KHI A;  4X64 L;  3I4N G;  2K5V A;  1N9W A;  3GDE A;  4OXP A;  4X62 L;  2QA4 A;  4DV5 Q;  3HOU H;  5E7N A;  3CC4 A;  1A8V A;  4YY3 L;  3TS2 A;  4C3J H;  2CWA A;  4LNQ A;  3PO2 H;  4JI1 Q;  5IP7 G;  1J5E Q;  4PMW A;  4TVA B;  2IT1 A;  4KI0 A;  2GVA A;  4IPG A;  4A3M G;  2NN6 I;  2PI2 A;  1YJ9 A;  2Z0S A;  1TWC H;  1HNX L;  1Q86 C;  1VQB A;  4A3L H;  1BBU A;  4BBS G;  4B3S Q;  1FJG Q;  1SN8 A;  3I4M H;  4JI0 L;  1IYJ B;  1Y1V G;  4XIG S;  1N32 L;  2Z6K C;  3LGJ A;  2CQO A;  3RR5 A;  1VQ4 A;  1KXL A;  3J81 i;  1KC8 C;  3UDG A;  1UE6 A;  4DR4 Q;  3EN2 A;  1VQ5 A;  4DV5 L;  2HHH Q;  3A74 A;  1WOC A;  4UP7 A;  2JK8 A;  1I94 L;  5GAH C;  3PIO A;  3CME A;  2YU9 H;  1JMC A;  1CKN B;  4A3D H;  1S40 A;  1J5E L;  3PGZ A;  2E5L Q;  2UUB Q;  4A3C G;  4LFB L;  2BH8 A;  3F8T A;  2Q2U A;  2ZJQ A;  2AWN A;  4PG3 A;  1VQC A;  4DNI A;  4B3T Q;  4A3G H;  1XMQ L;  3CCV A;  3NEM A;  1WCM H;  3OTO Q;  3JC6 6;  4C2M H;  1JT8 A;  1QZG A;  1HR0 Q;  3J80 i;  5AJ3 L;  4DV7 L;  4A3I H;  1N8R C;  1VQ8 A;  4BY7 H;  4JC0 A;  2UXD Q;  3CAM A;  4DR4 L;  3T1Y Q;  2HHH L;  4KHP Q;  1B70 B;  2D0P A;  1IXR A;  1VQD A;  4QGU A;  1S72 A;  1X3G A;  4AIM A;  2R6G A;  2OQ0 A;  3AQQ A;  2KEN A;  2E5L L;  1A63 A;  5M5X H;  5JEA J;  2FXQ A;  4KLK A;  2MNA A;  4BY1 H;  1Q46 A;  1N36 Q;  1K83 H;  1EFW A;  2YTX A;  2R92 G;  4LUO A;  3U4V A;  3GTP H;  5C3E H;  5J3B A;  1Y1W G;  4IFD G;  4QL5 A;  1AH9 A;  4A3F G;  1E24 A;  4YCU A;  1WYD A;  2D0O A;  4C3H H;  2XGT A;  4R4O A;  2V1C C;  2OTL A;  1IBK Q;  1FGU A;  4DAM A;  1L0W A;  5IYC G;  2PQA A;  1G29 1;  3CCR A;  1IL2 A;  2YTV A;  2R7D A;  2K4K A;  4P73 A;  1HNZ Q;  1YHA A;  1UE7 A;  2NN6 G;  4IOA A;  3S24 A;  5IT9 c;  4NB3 A;  3ULL A;  2MFI A;  1XNR Q;  3M7N A;  1LTL A;  3KDF B;  1XNQ Q;  3F2D A;  4B3M Q;  2UUA Q;  3HOY H;  4YWM A;  3KLW A;  1B8A A;  4GOP B;  2NVQ H;  5IWA L;  5M3F G;  5EAY A;  1EIY B;  1CUK A;  1EQR A;  3VDY A;  4BBR G;  2Q2T A;  1HZA A;  4GS3 A;  3AFQ A;  2ATW A;  5JJK A;  5IY0 A;  3L2P A;  3J81 c;  4JYA Q;  1KD1 C;  1I3Q H;  1YI2 A;  4P72 A;  4AYB G;  2E2H H;  4LF6 Q;  3TS0 A;  3S14 H;  1I5F A;  1Q8K A;  1HJP A;  3KYH C;  3E9I A;  3G6E A;  4X65 L;  1HZ9 A;  1QUQ A;  4UPA A;  5C0X J;  1HZB A;  3K0X A;  4A3K G;  5BR8 Q;  1XNR L;  1K73 C;  4JBJ A;  1I6H H;  1RIP A;  3SGI A;  3S1R H;  1XNQ L;  4A93 H;  1GD7 A;  5IP9 G;  5C44 H;  4IOC A;  2Y0S E;  1BBW A;  3HOZ H;  4JV5 Q;  3PUZ A;  3S1N H;  1L1O C;  3L7Z C;  4LFC Q;  1JJ2 A;  1KAW A;  3EIV A;  1PH5 A;  1OTC A;  4P71 A;  3PV0 A;  4AQY L;  4JI4 Q;  4JYA L;  1HNW L;  5K36 G;  1XPU A;  4LF6 L;  4EQ5 A;  1VQM A;  2VUM G; 
#chains in the Genus database with same CATH topology
 4GKK Q;  1PZI D;  5CV8 A;  5M5Y B;  2NVT B;  1U9R A;  5H1S E;  1PTO B;  1CHP D;  3MFG A;  2HQL A;  3BYT B;  1CQF A;  1TWG H;  1WVL A;  1V43 A;  1OXV A;  1Y1V B;  3I4N H;  1D2B A;  2LXJ A;  1Q8I A;  3CXC A;  2BE5 C;  4N8X 1;  1PHJ A;  2JA5 G;  2N3S A;  2OF1 A;  4A3M H;  2EY6 A;  1GUT A;  2EY1 A;  2VY3 A;  3K59 A;  3VR2 A;  5M5W B;  3QOL A;  1XX8 A;  2UUC Q;  4BBS H;  1KRS A;  5G3L D;  5ELF A;  2L11 A;  1MSG A;  1PH2 A;  1II3 A;  4O0A A;  3CF5 A;  4LF9 Q;  4GZY C;  2B8F A;  5CMD A;  4DR1 Q;  5IT9 L;  4DN4 M;  1GHK A;  2K04 A;  3GO5 A;  4DPG A;  2F0K A;  2IWH A;  2K5H A;  1EUJ A;  1V1P A;  4APV A;  3W2D A;  1VQL A;  2OTJ A;  2UUC L;  4EQP A;  1VQK A;  1HR0 W;  1M1K C;  5GAD C;  2F0F A;  1NCV A;  3PUV A;  4IPH A;  3STB D;  3M7G A;  2MJ8 A;  4RKL A;  2Q8I B;  1STB A;  1NAP A;  1FVI A;  1I4P A;  4DK6 C;  1X55 A;  1UE1 A;  2KCT A;  2KHI A;  5NUC A;  2KVM A;  5CR3 A;  3PF4 A;  2DJG C;  3HOX B;  2AUK A;  2UUB L;  1KAB A;  3FPU B;  1JJC B;  1XPO A;  1XYI A;  2IX0 A;  1FYC A;  2CKZ B;  4NPS A;  4JI2 Q;  1WCM G;  2JA7 G;  1U4R A;  1YBY A;  4NP5 A;  5A35 A;  2UXD L;  2O5J C;  1HH2 P;  4DV2 Q;  4KHP L;  3ERS X;  3GTK B;  4EGV A;  3MWY W;  4ME3 A;  1VQO A;  1OXX K;  3BZD B;  2NZO A;  4K14 A;  2K5W A;  2DY7 A;  1TWF B;  3ZJY C;  1PH3 A;  4MN3 A;  1N36 L;  1KQS A;  1YHB A;  4BY1 G;  3GTG B;  2R93 H;  2EIF A;  3KF6 B;  4G7Z C;  2LSS A;  1Q12 A;  4ZCK A;  3DUZ A;  5DEH A;  1TS4 A;  2MP1 A;  1YJN A;  1HNZ L;  1Z9F A;  2EJM A;  2ZTD A;  2SDF A;  1DCZ A;  3S2H B;  3X3M A;  1GO3 E;  1KLG D;  1SRU A;  4FVM A;  1HZC A;  3J80 c;  1F9S A;  3NWS A;  2VUM H;  1LTG D;  4DAV A;  1VF5 C;  3TZU A;  4KY7 A;  1ASY A;  1TWA H;  2XRQ D;  3K58 A;  3RLN A;  1X56 A;  3KJP A;  2WKD A;  3EJI A;  3K6O A;  2JXM B;  3NP8 A;  3U58 A;  2F52 A;  1YNJ D;  4RGO S;  1PRT B;  4A3B B;  4DV4 Q;  3I91 A;  1G51 A;  4CDC C;  1WTO A;  1H9R A;  2MHV A;  2DGY A;  1FD7 D;  4WJ3 M;  3J80 E;  1BCP F;  2JEB I;  2F3V A;  3CCM A;  3AU7 A;  3T51 B;  4DV1 Q;  4LFA Q;  3RZO H;  1MBY A;  2ID0 A;  2RCN A;  4O2D A;  3RUZ A;  1I4Q A;  4OL7 A;  3UDI A;  3CC2 A;  1ENF A;  2ASB A;  3V96 A;  2R7Z H;  4OX9 Q;  2RSN A;  1QOH A;  2N8N A;  4DV4 L;  2F3W A;  1VQN A;  3PCO B;  1HNX Q;  1JOO A;  3PO2 B;  5D65 A;  1G2S A;  3VYS A;  1EQT A;  3CQZ H;  3I4M B;  2VS1 A;  3S1Q H;  2ZTE A;  2IHF A;  2VQE L;  3T1H Q;  1YNX A;  2A19 A;  1ICW A;  1JE4 A;  3R3O A;  1MJC A;  4K6D A;  2F0H A;  2ZM6 Q;  2M00 A;  4AYB E;  4HED A;  1CKM A;  1QCB D;  4LF5 L;  4OX9 L;  4LFB Q;  3HOU G;  1BCP C;  1IBL L;  3H3V C;  1ESF A;  1XMQ Q;  1XXG A;  1E0B A;  1AW7 A;  2G5D A;  4K6L A;  4RG1 A;  1K8M A;  1RTO A;  2XWB B;  1ESR A;  4H02 A;  1MJE A;  2F0D A;  4A3G B;  2PW5 A;  3FKI H;  1TVX A;  3HKS A;  1F2M A;  3MEH A;  1PH1 A;  4ZRZ A;  3T1H L;  5CYU A;  1SE2 A;  2K5Q A;  2K50 A;  4L5T A;  2ZM6 L;  4BY7 B;  2H5X A;  2R92 H;  3KJO A;  4OO1 G;  1Y1W H;  1JB3 A;  2GN5 A;  4A3F H;  4YCW A;  4CKB A;  2BH2 A;  3I7F A;  5DM6 3;  3I56 A;  4EVO A;  3VR5 A;  1KDA A;  5IYC H;  3I90 A;  1K83 B;  2O2L D;  3K57 A;  2WP8 J;  4QF4 A;  3PUY A;  5E4W C;  5C3E B;  4DV3 L;  1HPC A;  2F0E A;  3PO3 G;  2OWO A;  3U50 C;  3UE0 A;  4J8Q A;  1EY0 A;  3HOW H;  1S3O A;  1V9P A;  5C4Z A;  1YHQ A;  4DAY B;  5IWA Q;  2D9U A;  4OON A;  5IE8 A;  4K0K L;  4E6I A;  4WJ4 A;  1EWH A;  5GRO A;  3D31 A;  3I4O A;  2BDO A;  4R4Q A;  2RHQ B;  4K2L A;  1PLF A;  4DUZ Q;  1SMY D;  5C6A A;  4H7B A;  1D7Q A;  4IUQ A;  4GNX C;  2CWP A;  1L1O B;  3SE0 A;  3CCE A;  1BVS A;  2PI2 E;  1KTK A;  5T1G A;  3WOE A;  4TKO B;  1ET6 A;  5M3M G;  4GNX A;  1H95 A;  3LWU A;  2F0G A;  1HA5 A;  4I7A A;  5ISR A;  5LMN W;  1S5B D;  1M90 C;  3H94 A;  5C44 B;  3HOY G;  1GOZ A;  1NMG A;  2A6H D;  4RH6 A;  1JIC A;  3IL8 A;  4DR6 L;  4O1N A;  2A68 D;  3S17 H;  4P2C B;  2B63 H;  1D8L A;  1U5K A;  4XXE A;  5CBA E;  4DUZ L;  4V19 0;  1PVO A;  2E2J H;  2HUG A;  5EKL A;  1VQG A;  1V8Q A;  1SYC A;  2DJF C;  3A56 A;  5JPN C;  2Z1C A;  3GTJ H;  1D1I A;  5HY6 A;  2E75 C;  1EY8 A;  2JSO A;  3HP3 A;  1E1T A;  2EY5 A;  2I5H A;  2I5L X;  4YWK A;  3JAM L;  4G7O C;  5GAE C;  1LT3 D;  1MI2 A;  1ASZ A;  3AB9 A;  1QIL A;  1TXY A;  2F0S A;  2Q2H A;  1TWG B;  5FJ8 G;  1CSQ A;  3I4N B;  1LO5 D;  5DNF A;  3RMH A;  1SFO H;  1AP0 A;  1ZYR D;  3QJY A;  1QB5 D;  1EWI A;  4DUY Q;  3BS1 A;  4BBS B;  5KRU A;  2SNM A;  4IUP A;  1V1P B;  3TP8 A;  4F8M A;  4LF8 L;  4PMB A;  1SYF A;  3CCS A;  1P8L A;  2KED A;  2JA8 G;  3NBH B;  5FLX E;  2F03 A;  4X62 L;  1F2Y A;  5E7N A;  3A7A B;  1ML0 D;  1W6K A;  2F0J A;  4LNQ A;  3SVM A;  5IP7 G;  4TVA B;  2SEB D;  4KI0 A;  2NN6 I;  5A2Q L;  1VQB A;  1QNK A;  4CKE A;  3R2T A;  1LT4 D;  2B2Y C;  3I73 A;  1Y1V G;  3FDT A;  2Z6K C;  2WV6 D;  4CJ2 C;  3RR5 A;  1KXL A;  1UE6 A;  2PZW A;  4M8A A;  2HHH Q;  2N88 A;  1WOC A;  2JK8 A;  2KEE A;  1I94 L;  2NUC A;  3IKJ A;  4A3C G;  4IUV A;  2ZJQ A;  2AWN A;  4PG3 A;  4DNI A;  1IYU A;  1Q90 A;  3NEM A;  5ELC A;  2CW0 C;  2L1B A;  1JT8 A;  1HR0 Q;  4NMZ A;  3J80 i;  4UDU C;  5KNB A;  4A3I H;  1CZG A;  2KUM A;  2G9H D;  2HHH L;  2D0P A;  1VQD A;  3DWA A;  1X3G A;  1C4Q A;  4Q5V A;  3V2T A;  1H9K A;  5JPM C;  4RHR A;  1A63 A;  5JEA J;  2K01 A;  3U4V A;  4QL5 A;  1UAP A;  2D0O A;  4R4O A;  3NE5 B;  4G4K A;  1IBK Q;  1FGU A;  1G29 1;  2R93 B;  2YTV A;  2R7D A;  2NN6 G;  2F1M A;  4NB3 A;  1LTL A;  3KDF B;  3F2D A;  4B3M Q;  2UUA Q;  1B8A A;  2NVQ H;  1DOK A;  1NR2 A;  1PTO D;  4OEL B;  2DNC A;  1EIY B;  1CUK A;  1DON A;  5JJK A;  1HFG A;  3U9S A;  1KD1 C;  1YI2 A;  1Q8K A;  4CKC A;  4CDD C;  3S9W A;  3AMU A;  2VUM B;  3E9I A;  3G6E A;  1CZW A;  4R9W A;  2I46 A;  2MUY A;  1TWA B;  3ERO A;  5BR8 Q;  3CU7 A;  1RIP A;  3SGI A;  4A93 H;  1R4P B;  1GD7 A;  2RCF A;  5IP9 G;  1BBW A;  3HOZ H;  2A74 C;  4HN7 A;  4KJN A;  1G6Z A;  3S1N H;  1JJ2 A;  1KAW A;  3X3N A;  4P71 A;  3QG1 A;  3NSW A;  4JI4 Q;  1RHP A;  4EQ5 A;  1HA6 A;  5KEE A;  3DHQ A;  3G71 A;  2ZJR A;  2UXC Q;  1CTM A;  3U4Z A;  2IX1 A;  1X3E A;  3OHX C;  5C0X H;  2H1E A;  4HID A;  3RZO B;  4O42 A;  3M4Y A;  2ICE C;  3S16 H;  4ZQ3 A;  3E6Z X;  3GQB A;  3KOJ A;  4IPD A;  4MZ9 A;  3NQT A;  4JI8 Q;  2QEX A;  2R7Z B;  1K0S A;  5JOB A;  4JI4 L;  4RAU C;  4B9X A;  5KYI A;  3BJU A;  1K3B C;  3CCQ A;  2UXC L;  1BCP B;  2B2W C;  5LHY 1;  3GV3 A;  4DR3 L;  1A0I A;  3CQZ B;  4P74 A;  4K8J A;  3S1Q B;  5IGC A;  3H0G H;  5FLM H;  2WAQ B;  3R93 A;  3PIP 3;  2AMC B;  2AQ2 B;  2OCE A;  3UDX A;  2PQE A;  4JI8 L;  1BBX C;  4XTC S;  1UWV A;  4ZYS A;  1J6Q A;  2JA6 G;  2EOT A;  2B29 A;  3PF5 A;  2EYH A;  1O80 A;  2EYO A;  3FKI B;  2UU9 Q;  4JI7 Q;  1B3Q A;  3K7U C;  1Q81 C;  3H6M A;  4KN7 C;  1L0X B;  1PFM A;  3H15 A;  4GLA C;  2F0U A;  4DK3 C;  1K8O A;  1JWS D;  1PDQ A;  3UDF A;  2CH4 A;  2JN4 A;  3A5Z B;  1ONL A;  2EQS A;  4GKJ Q;  4ILW A;  4B3S L;  2R92 B;  4DKA C;  2L12 A;  1Y1W B;  2F0V A;  1M4V A;  3I70 A;  4IO9 A;  4JI6 Q;  4A3F B;  1DD2 A;  4A3L G;  1A62 A;  3W5O A;  1GJX A;  3I4M G;  2YTY A;  5C5L A;  3DLL A;  4A3J H;  2M2L A;  3DXJ C;  2NBF A;  5C4X G;  4JI7 L;  3HS0 C;  1EYD A;  2QGQ A;  1F2L A;  1SAP A;  3Q24 A;  5EKI A;  4IJL A;  4JK1 C;  1LTT D;  2B2U C;  2MPM A;  3HOW B;  4A3G G;  1CKN A;  5EPJ A;  3F2C A;  3PIO 3;  3KLS X;  4A4I A;  1EYC A;  5BN3 A;  2KHJ A;  1VF7 A;  3T1Y L;  4GNX B;  4HJ5 A;  1E1O A;  2NVY H;  4K5X A;  4QJF A;  3URY A;  1AFP A;  3S1M H;  1X54 A;  5ELO A;  1EY6 A;  4LF7 Q;  1SE3 A;  4DV6 Q;  1VDZ A;  4LK1 C;  2KJX A;  3HGB A;  1LTA D;  1MSH A;  2EZV A;  5C3E G;  4A3K H;  1STA A;  2SOB A;  1AE3 A;  3A5U A;  1X32 A;  1SNP A;  4JBW A;  3S17 B;  1DJR D;  1FGB D;  2R7F A;  5C4J H;  2B63 B;  3D3R A;  2E2J B;  2K14 A;  3KFU A;  4DR7 Q;  4ZKB B;  4CJ1 B;  5JJI A;  1PH7 A;  4JBK A;  4DV6 L;  1HHV A;  3STB C;  1WJJ A;  4GOP C;  5D3I B;  3GTJ B;  1L1O A;  2N55 A;  3M4O H;  4GOP A;  4XYQ A;  1MKH A;  4LW1 A;  1VQH A;  1VQF A;  1W2B A;  4J1M A;  3SK5 A;  3HOV G;  2RKS A;  4WRD A;  1B50 A;  2VQF Q;  4DA2 A;  4YWL A;  4G57 A;  2A8V A;  2QW7 A;  3D6W A;  1RD9 D;  1SFO B;  2K5D A;  4BXX H;  4JV5 L;  4ZK9 B;  1ILQ A;  4DV0 Q;  1IBM Q;  2BCO A;  1NTG A;  1SYE A;  5EQ0 A;  3K8A A;  1A3T A;  4GKK L;  3OW2 A;  4L6T B;  1BO0 A;  5E4X A;  4YY3 Q;  2K52 A;  1YVC A;  4L5S A;  4LMQ D;  1W3S A;  3KLS A;  3F2B A;  2MQH A;  2VW9 A;  3UE1 A;  3CMA A;  1UE5 A;  1YNN C;  4RMF A;  1QVC A;  1NSN S;  1HRJ A;  1EL0 A;  4HJ9 A;  3TRE A;  1STN A;  2B2T C;  4BWG B;  1PH8 A;  1PYS B;  4HAE A;  4Q0F A;  1JR0 D;  2Y0S B;  1KAA A;  4IQZ A;  4B3R Q;  3MAQ A;  1FR3 A;  1BDO A;  4L5Q A;  2VNU D;  1KNA A;  3NBH A;  2LXK A;  4C3I H;  1B2T A;  3NBI A;  4C3J G;  4KY5 A;  2ZXP A;  1IL8 A;  3J81 L;  4LF9 L;  5AJ3 Q;  1R9T H;  1SNO A;  2O4X A;  1TWH H;  1IHZ A;  3K7A H;  3P20 A;  4DR1 L;  3J7Z C;  4NW2 A;  3TP5 A;  2D2C C;  2AWO A;  1I50 H;  4UY8 C;  4JCV E;  3K0Y A;  4B3R L;  1WTH A;  3OW7 A;  4PQX A;  4IFD H;  1EY4 A;  4DXG A;  1YNJ C;  2JA7 H;  1SLJ A;  3MFY A;  5COY A;  1CSP A;  1RL2 A;  3GTQ H;  4JI3 Q;  4MIU A;  1D5X C;  4A76 A;  2L0C A;  3K5O A;  4HJ8 A;  4F88 A;  5E3F A;  2VB3 X;  4H44 C;  3ONA B;  1G8Z D;  3MXP A;  2K1B A;  1H9M A;  4DR5 Q;  1EU3 A;  1NBW A;  2CQA A;  1HTP A;  2EDG A;  1YIJ A;  1V1Q A;  4ZLT F;  3I3C A;  1TS2 A;  5J39 A;  5FLX L;  3QIA A;  4DF7 A;  2FMC A;  3A8K E;  5C3W A;  4JI3 L;  1LTS D;  2ES2 A;  4JI2 L;  2QF7 A;  2AKW B;  4J6H A;  2NVQ B;  1Z47 A;  2D62 A;  3TSS A;  2BE5 D;  2L9H A;  4DV2 L;  2DUD A;  4R4C A;  5DLQ E;  4X65 Q;  3HKZ G;  2RDH A;  1AZP A;  1CK1 A;  4F7X A;  4DR5 L;  4IUN A;  1IZ6 A;  3NEN A;  5K36 H;  4X6A H;  3HOZ B;  4BA1 I;  1S5C D;  3CCU A;  3GTO H;  3KDF A;  4AQY Q;  3S1N B;  2RQX A;  2X69 A;  1L2F A;  1TKW B;  1XMO Q;  5I4D A;  2Q8T A;  1YEZ A;  3NEL A;  2KA7 A;  4K5V A;  4RGN A;  1WTQ A;  2R93 G;  1QG7 A;  5GQO A;  3F2U A;  1EIF A;  1KL9 A;  1QJO A;  1MD2 D;  3Q8D A;  5DM7 3;  4K2K A;  1I4R A;  3D4R A;  3CP0 A;  4G7H C;  1CT1 D;  1SSO A;  3ULP A;  4OGQ C;  1LTI D;  3H3V I;  2IY5 B;  5HUR A;  1QWY A;  3KBG A;  2BA0 A;  3S15 H;  2J0T D;  3TP7 A;  3S16 B;  1LAC A;  4TSS A;  1XMO L;  3BZK A;  3GD7 A;  4AH6 A;  4C1N I;  3DM3 A;  5KNC A;  1IW7 C;  5EKK A;  2SNS A;  1WTX A;  1QNU A;  5CBE E;  1BXT A;  1HQR D;  3ND9 A;  4HIM A;  1NJI C;  3CD6 A;  3H0G B;  3M4P A;  3KUP A;  4I7Z C;  2JEA I;  4K5W A;  3C1E A;  4B9W A;  1I4H A;  5L37 A;  3H3V H;  3RD4 A;  4DV1 L;  4LFA L;  2K03 A;  3K5N A;  1N9W A;  2WIN B;  4DV5 Q;  3HOU H;  4KK7 A;  1A8V A;  3TS2 A;  1SMY C;  4QUC A;  1GUG A;  2ICI A;  4JI1 Q;  1KDB A;  2JYO A;  3E3X A;  2Z0S A;  1TWC H;  4H0L C;  3T4A C;  1HNX L;  2TSS A;  1FJG Q;  1SN8 A;  1CA6 A;  1IYJ B;  4XIG S;  1SYD A;  3SR1 A;  4RHS A;  1VQ4 A;  4C2M B;  5COR A;  2F0O A;  4DV5 L;  4WOR A;  4UP7 A;  2A68 C;  4OO1 H;  4BS9 A;  2YU9 H;  1CKN B;  2IL8 A;  1S40 A;  1ENA A;  4A3J B;  2E5L Q;  4A3D H;  4LFB L;  2BH8 A;  2Q2U A;  4KHV A;  4B3T Q;  1UNS A;  1VQC A;  1GUS A;  1XMQ L;  1PXU A;  3OTO Q;  3HRZ C;  2L4N A;  4JC0 A;  3MC0 B;  4HCS A;  1B70 B;  4CHT B;  1VMC A;  3P7J A;  2R6G A;  2PNR C;  4F87 A;  2RA4 A;  1W6J A;  2E5L L;  1JOK A;  3VR3 A;  5M5X H;  4KLK A;  2MNA A;  1ZYR C;  2NVY B;  1B53 A;  1CI3 M;  4X3S A;  4EQN A;  2YTX A;  2WAC A;  2R92 G;  4LUO A;  3S1M B;  3GTP H;  1Y1W G;  1C8C A;  1AH9 A;  4A3F G;  1WYD A;  4C3H H;  2XGT A;  2WB1 B;  4AYB B;  1IYV A;  5IYC G;  1LTB D;  4JPB W;  1YHA A;  1UE7 A;  3NK9 A;  5IT9 c;  2B8G A;  4A3K B;  5IGB A;  1XNR Q;  3N6R A;  4KKT A;  3HOY H;  1SE4 A;  4KN4 C;  4GOP B;  5EBC A;  5IWA L;  2B39 A;  2F0P A;  1NNX A;  5C4J B;  1F9P A;  1TS3 A;  2CHB D;  4BBR G;  1J8I A;  3D4D A;  4GS3 A;  5JVG 3;  2OEO A;  2ATW A;  3J81 c;  2EYF A;  2K6A A;  2EYP A;  3M4O B;  1HZ9 A;  2RBM A;  4UPA A;  5C0X J;  5CV4 A;  4X3K A;  4FXK C;  1K73 C;  1XNR L;  1I6H H;  3S1R H;  2TMP A;  4KV6 A;  2V4D A;  3PUZ A;  2NTS A;  2RSO A;  3L7Z C;  4LFC Q;  1PH5 A;  3PV0 A;  1EEF D;  3K5L A;  2OT2 A;  1VQM A;  3SEB A;  1K8G A;  2JE6 I;  1PTO F;  2UXB Q;  4CBV A;  4IUT A;  1VQ9 A;  2E2I H;  1SYB A;  2OQK A;  4A3M B;  2B2V C;  1NR4 A;  3DWQ A;  1OXU A;  2BA1 A;  2IW3 A;  3BZC A;  2B2V A;  2JA8 H;  1SJE D;  1RDP D;  1X3Q A;  3M4Q A;  5JJL A;  1O7Y A;  4GLV B;  3G6J B;  1JCK B;  3EVQ A;  3TME A;  1D1K A;  1X9N A;  1NY4 A;  1B7Y B;  1PH6 A;  2F0W A;  2E8G A;  4ID6 A;  5JJZ A;  2PYK A;  3HKZ E;  1UEA B;  4N9T A;  4NXN Q;  1X3F A;  2AUJ D;  4DUY L;  2Z9H A;  4DFA A;  5CV5 A;  1PTO C;  4C3I B;  4HJ7 A;  5IIF A;  5I6Y A;  5K5P A;  2B2Y A;  1N33 Q;  2Z6K A;  2HQE A;  5C4H A;  3C1F A;  2NZH A;  1R9T B;  1TWH B;  2F0I A;  2IHE A;  3K7A B;  3NTK A;  1JE5 A;  1M8A A;  3RN5 A;  2GVB A;  1SEB D;  1I50 B;  3FP9 A;  2X6L A;  4N8F A;  3P1H A;  2O5I C;  4JG2 A;  4DNT B;  3E0J A;  1EOV A;  1GUW A;  1STY A;  2Z8L A;  2JA7 B;  4KJO A;  4KMU C;  4DU9 A;  4LUV A;  2HT1 A;  3GTL H;  3GTQ B;  2Y0S G;  5T1I A;  1VQA A;  3A8I E;  2RDF A;  3CCL A;  4NDX A;  2NB0 A;  4IN3 A;  1WTV A;  3ULJ A;  4BA2 I;  2PQA B;  2LFN A;  3LNN A;  1AE2 A;  1HR0 L;  3Q23 A;  1E3P A;  2PO4 A;  3Q6S A;  2FMM A;  1PFS A;  3ZYY X;  1E2W A;  1PZJ D;  5M9O A;  1TS5 A;  1OO9 B;  4LAA A;  4LWC A;  2CVR A;  2RHS B;  1WTW A;  3OPO A;  4QQB X;  1CFM A;  3WWV A;  3HOX G;  4POG A;  5FO9 B;  4DXF A;  1T5E A;  1WI5 A;  1Q3L A;  1BR9 A;  1C9O A;  2BOS A;  3MEF A;  1DGS A;  2MGS A;  1RTN A;  5JVH 3;  1STG A;  1Z7T A;  4RA8 A;  3FEW X;  5C0X I;  1LAB A;  2K33 A;  1IBK L;  4DGZ A;  2E2D C;  1EWC A;  1LTR D;  3GTO B;  1HFN A;  3BVM A;  1O7Z A;  1HXY D;  4B3M L;  2UUA L;  3R8B A;  2D5D A;  4OWT B;  4DR2 Q;  1DZ1 A;  5IYB H;  4XQN A;  1VQE A;  4OEM B;  4X66 Q;  4JI5 Q;  4LJZ C;  1VS0 A;  1U4M A;  2KQ3 A;  2NVX H;  1N34 Q;  2A6E C;  2EE1 A;  3S15 B;  5I2X A;  2L55 A;  4JOI C;  5BR8 L;  1R4Q B;  4A3E H;  5IYD H;  5EBD A;  5LMU Q;  1Q1E A;  3T56 B;  4X66 L;  1F9Q A;  2RF4 A;  1GKH A;  3E9H A;  4MTN A;  2PMZ E;  3PUX A;  3BDO A;  3PSI A;  2LMC B;  4FO2 A;  1DOM A;  4X64 Q;  1PA6 A;  1EYG A;  3J7A 5;  2B2W A;  3FHW A;  3KF8 B;  3HOU B;  1Y8O B;  4DK1 A;  1KLU D;  4A3B G;  2R61 A;  2JA6 H;  2PZT A;  1LLR D;  1SRO A;  4ABN A;  1N32 Q;  1ROD A;  1TWC B;  3WDN A;  1EIH A;  2AHO B;  1EY5 A;  4XYO A;  1EQQ A;  1BF4 A;  3QOJ A;  1CKO A;  1XJV A;  4IFD J;  4QIW E;  4EQO A;  2YU9 B;  3MA2 B;  1K28 A;  1Y8P B;  3PO2 G;  5HGQ A;  4A3D B;  4GN3 B;  1G6P A;  3GP7 A;  3H0G G;  4POF A;  5FLM G;  3H91 A;  3HG9 A;  3HZX A;  2MO1 A;  1EY9 A;  4DV7 Q;  4PZ7 A;  2C9O A;  4LF4 Q;  5C4X H;  2A1A A;  3I72 A;  1SMX A;  4XQQ A;  2OXP A;  5G3L F;  3JAM c;  2UU9 L;  5BN4 A;  1O7I A;  1OXT A;  1Z6H A;  1C7Y A;  3J80 L;  2VB2 X;  2CCZ A;  2J7Z A;  3J7A F;  4GKJ L;  4Z9C B;  2KHS A;  5M5X B;  4B08 A;  5FOB B;  4JI6 L;  4DK0 A;  2B2U A;  3J7Y W;  2BDN A;  4LF4 L;  1L0Y B;  3MXN B;  1JOR A;  3GTP B;  4R1J A;  4RGT A;  1GUN A;  1PH9 A;  4C3H B;  4BY7 G;  1PYB A;  5GAG C;  4IUR A;  3OYY A;  4A3J G;  5M3F H;  3T53 B;  3E0E A;  4S3S A;  1LV9 A;  4ULL A;  1BNZ A;  1PRT D;  4K8I A;  3HOY B;  4R8N A;  1YIT A;  2XNA C;  3TEH B;  4KY6 A;  3BU2 A;  3OIP A;  3M3Y H;  1WD0 A;  3TQY A;  2DN8 A;  2N49 A;  1PZK D;  4QCL A;  1BOS A;  4LF7 L;  1I6H B;  3S1R B;  2I0Q A;  4C56 C;  4FXD A;  5JEA G;  3HOV H;  1HNW Q;  2WB1 G;  5LMN Q;  1TY0 A;  3S2D H;  5D14 A;  3BDL A;  5A2Q E;  4YCV A;  2QKI C;  4FF1 A;  4PZ6 A;  3VYR A;  4WFN 3;  3FMC A;  1T5X D;  3ICE A;  4Y7N H;  1WFQ A;  5C5M A;  1F2Z A;  3VYT A;  4IAL A;  4OHJ A;  4DR7 L;  4JBM A;  4RKB A;  3A8J E;  2NWG A;  1DXM A;  1ICF B;  2E2I B;  5C44 G;  1XTC D;  3CCJ A;  5CV7 A;  3J7A V;  4CDE C;  2JA5 H;  3PIP A;  5LMN L;  3UI2 A;  2JA8 B;  3U9O A;  2DNE A;  2EXD A;  2ZJP A;  4UP8 A;  3IRB A;  1B9M A;  4IZ8 A;  2VQF L;  2PNH A;  2F0Q A;  3WOF A;  4KKU A;  4IJH A;  1FNW A;  4DV0 L;  3OIQ A;  1IBM L;  2WII B;  5KIX A;  2K05 A;  4KD4 A;  4BXX G;  3RZD H;  4N9P A;  4IFD I;  2IX3 A;  1NUC A;  1KHI A;  2B2T A;  3GV6 A;  2K5V A;  3I4N G;  2F0M A;  3GDE A;  4OXP A;  2QA4 A;  1EOT A;  1JWU D;  4YY3 L;  4QUF A;  1SBB B;  4C3J H;  1SNC A;  2CWA A;  3TBI B;  1J5E Q;  4PMW A;  1RCV D;  2IT1 A;  2GVA A;  4IPG A;  3W3A A;  4WJW A;  4A3M G;  2E76 C;  2PI2 A;  3NTH A;  1YJ9 A;  5EGT A;  1Q86 C;  1KDC A;  1BBU A;  4BBS G;  2PW7 A;  1E2Z A;  1CM9 A;  1J9O A;  2HD3 A;  4KD3 A;  1JC7 A;  1HUM A;  2XSC A;  1B44 D;  1KC8 C;  1H9S A;  1VQ5 A;  3A74 A;  4A3I B;  1TII D;  2XWJ B;  3CME A;  3PIO A;  3OMC A;  5IGF A;  1JMC A;  3GTL B;  3IFT A;  1J5E L;  3PGZ A;  3KBX A;  2UUB Q;  4HMJ A;  3C46 A;  4KKS A;  3CCV A;  2JP1 A;  1A15 A;  1WCM H;  2G9D A;  1Y8N B;  2A69 D;  4C3I G;  5TSS A;  5AJ3 L;  2LS0 1;  2IJ0 A;  5EPK A;  4CDF C;  1N8R C;  1IKL A;  1U4L A;  2UXD Q;  3EA6 A;  4KHP Q;  1IXR A;  1EFI D;  5CGK A;  5FO7 B;  4H13 C;  2OQ0 A;  3AQQ A;  4MTK A;  4X3U A;  4HCE A;  1EQV A;  1G91 A;  2FXQ A;  4BY1 H;  2XN9 C;  1CHQ D;  1Q46 A;  1N36 Q;  2KEC A;  5J3B A;  1ILP A;  4IFD G;  4U67 3;  1E24 A;  4YCU A;  4ZUJ A;  2V1C C;  2VXW A;  4DAM A;  1L0W A;  2PQA A;  2KCC A;  3CCR A;  1IL2 A;  1EZ8 A;  2K4K A;  4P73 A;  1TR5 A;  1HNZ Q;  2M9V A;  1XNQ Q;  1YNN D;  1D5Z C;  3SHL A;  3KLW A;  4MHE A;  1EQR A;  1O7L A;  3FRP B;  3VDY A;  4A93 B;  1GXD C;  1HCZ A;  4DNR B;  1HZA A;  2KOL A;  2Q2T A;  3AFQ A;  1SJH D;  1I3Q H;  2E2H H;  3TS0 A;  3S14 H;  1HJP A;  2NVX B;  4X65 L;  1B4O A;  2XIW A;  1AN8 A;  1QUQ A;  1STE A;  1BQQ T;  1TT2 A;  2QIL A;  4JBJ A;  1TQO A;  1XNQ L;  4IOC A;  2EPB A;  4A3E B;  1ET9 A;  2RDG A;  3EIV A;  5FO8 B;  1OTC A;  4U68 A;  2Q8R E;  4AQY L;  5K36 G;  1XPU A;  4FYD A;  2VUM G;  1VQ7 A;  4UP9 A;  3O13 A;  4MNO A;  3L9A X;  1XPR A;  3JAM i;  1VQ6 A;  3DMU A;  1Y69 U;  3QR8 A;  4X3T A;  2CH4 W;  2EJF C;  3SK8 A;  4R4I A;  4ALP A;  5C3X A;  1PFN A;  4OO1 I;  1RKN A;  4PZ8 A;  1P16 A;  1V1O A;  1YZ6 A;  1HQM C;  2JA6 B;  4R4T A;  1UUP A;  3VR4 A;  2I07 B;  3I2Z A;  3R2I A;  2VQE Q;  2HIV A;  1AZQ A;  1PFB A;  2XTI A;  5D3D A;  2A5H A;  1ZEQ X;  5E1F A;  4LF5 Q;  2H4O A;  2CFM A;  1IBL Q;  2K75 A;  1S4Z A;  3CPF A;  2R7Z G;  3ITP A;  2F4I A;  2B3G A;  4ZKC B;  1F9R A;  3KF8 A;  5DAU A;  3TZD A;  2C35 B;  4QY7 A;  4PNY A;  4GN4 B;  2A6H C;  1T9H A;  5I2Y A;  4FP5 D;  1JOQ A;  5C4X B;  1CQV A;  2WB1 E;  3MXU A;  3PUW A;  3EFX D;  2ENB A;  4ZUI A;  1QVF A;  1LT6 D;  4JI1 L;  1FNU A;  4ODG A;  5IOD A;  2WAQ G;  3ERQ A;  3NQI A;  1Y14 B;  5JAV A;  5LL6 X;  1FJG L;  4GLX A;  1K3R A;  2K28 A;  3T13 A;  2LKV A;  1GVP A;  4Y52 H;  2JJQ A;  3PO3 H;  1LYL A;  3C2P A;  4R8I A;  3FKI G;  4DV3 Q;  2WFW A;  3GTM H;  1MGS A;  1BKB A;  1F77 A;  3SXH A;  4B3T L;  1FNV A;  1S5E D;  2FJ2 A;  2ZXR A;  4A3D G;  1EEI D;  2L15 A;  3OTO L;  5M3F B;  4FXG C;  5CC4 A;  3DWP A;  3I55 A;  1K0R A;  1UEB A;  4K0K Q;  3NUC A;  1RJT A;  3BYY B;  2DY8 A;  3W1G A;  1DOL A;  3Q0A A;  5ELN A;  4PV1 C;  1IW7 D;  4XT3 B;  5M3M H;  1SDF A;  4ME5 A;  3MXN A;  4GN5 A;  1U0L A;  1PMR A;  1ZXT A;  4BBR H;  3NWT A;  2K5N A;  1KNE A;  4L5R C;  3M3Y B;  5J1Z A;  3HOW G;  5EJW A;  1ZKO A;  5IOC A;  2Z4I A;  2VZA A;  1D6E C;  4DR6 Q;  1VQJ A;  1PV4 A;  2N78 A;  3ER0 A;  2KCN A;  4TQU S;  3BVG A;  4C3H G;  3HOV B;  2GA4 B;  3VA7 A;  2F0N A;  3W1B A;  1BCP D;  3S2D B;  1DM0 B;  2KBN A;  5IGD A;  5KND A;  3C3L A;  1EY7 A;  5IT9 E;  2NZ1 D;  4Y7N B;  3AEV A;  4I65 A;  4RGM A;  3CC7 A;  4A75 A;  2ZXO A;  3DEO A;  3Q22 A;  2ALY B;  2PZU A;  5FJ8 H;  4HTH A;  4JVZ A;  1K8A C;  2F0L A;  1GM5 A;  2EYJ A;  1EYA A;  1B1Z A;  1QZH A;  3J81 E;  4JW0 A;  2JA5 B;  3G48 A;  1SXT A;  2JQO A;  2B63 G;  1OXS C;  1S5F D;  3P75 A;  5FK9 C;  1AEX A;  3AFP A;  2EYM A;  4FDB A;  5IGE A;  2PCF B;  2QEJ C;  2R3Z A;  2X6G A;  3NXW A;  3DEP A;  1U4P A;  4LFC L;  5FLX c;  3L3O C;  4CJ0 B;  4HJA A;  2WKC A;  3MHB A;  4LF8 Q;  4XT1 B;  1NE3 A;  4J15 A;  3CW2 C;  3NHH A;  2ZTC A;  5KYL A;  1E7Z A;  5M5Y H;  2NVT H;  4L8J A;  3K80 C;  5IP7 H;  4X62 Q;  3RZD B;  1PTO H;  2F4V Q;  1A3U A;  1WTP A;  2UXB L;  5BN5 A;  2C5C A;  1YJW A;  4P75 A;  1I4X A;  2RVL A;  1SNM A;  3OWF A;  1NMF A;  4OWX B;  4HSP A;  3E5S A;  1Y1V H;  4RCO A;  4IPC A;  4C3J B;  1H9S B;  2XRS D;  4LUZ A;  1HTL D;  3J81 j;  1VCI A;  3TN2 A;  2AQ3 B;  3EBE A;  4HMI A;  1TU2 B;  5M5W H;  4A3C H;  1I94 Q;  2F4V L;  2K7V A;  3RLF A;  5HGT A;  5ELD A;  2ZT9 C;  1XTD A;  2L5T A;  3A7L A;  4QB4 A;  3TRZ A;  5CV6 A;  3LX0 A;  3OMG A;  4NXN L;  2QDL A;  3BG3 A;  1SR3 A;  2LY7 A;  1VQI A;  4EX5 A;  1WCM B;  1N33 L;  2XVS A;  1I4G A;  2E74 C;  2YV5 A;  3RN2 A;  3T16 A;  3CKI B;  3D0F A;  2EY2 A;  1JJG A;  1TY2 A;  3KK7 A;  2MO0 A;  1JWM D;  2FFK B;  1Q7Y C;  3L0O A;  3HFZ B;  3G4S A;  4V0B A;  1ENC A;  4BY1 B;  2F3I A;  3TDQ A;  1X65 A;  4XQJ A;  1FL0 A;  2FHT A;  2NN6 H;  3HOX H;  1LM0 A;  3PMF A;  5ELE A;  3CPW A;  4OIK A;  3QO2 A;  3B6Y A;  4A3I G;  3M85 A;  3HKZ B;  1EZ6 A;  3QB3 A;  5J22 A;  1GHJ A;  2QCP X;  3OWE B;  1JB7 A;  1SYG A;  3K5M A;  1X6O A;  4UHV A;  1QUQ B;  4HIK A;  3GTK H;  2NYZ D;  5IGG A;  1QVG A;  1KRT A;  3IFD A;  3MTS A;  1PH4 A;  1WTR A;  1TWF H;  3BDC A;  2VL6 A;  4KHZ A;  3RNU A;  5IP9 H;  4RFB A;  1I3Q B;  3A54 A;  5KGU A;  2E2H B;  3RLO A;  4OWW B;  1A3V A;  2HIX A;  3S14 B;  4YHH Q;  3OSO A;  5I6W A;  3GTG H;  1K9M C;  4YIJ A;  3MXG A;  1VQP A;  1WD1 A;  2WAQ E;  4KTA A;  2EYL A;  1SND A;  3EQL C;  1HUN A;  4RCN A;  3A0J A;  4C1N K;  1KIX A;  3S2H H;  1A6X A;  1Q82 C;  3N52 A;  4YHH L;  1PRT F;  2HDM A;  3KF6 A;  3AYH B;  3FPP A;  4JOI A;  2KCM A;  2CW0 D;  1EIG A;  4NXM Q;  4DR2 L;  2I5M X;  1A2T A;  4HIO A;  3CRL C;  4A93 G;  4JI5 L;  3HOZ G;  3I4L A;  5IYB G;  1N34 L;  4NKL A;  1STH A;  1E22 A;  1SE8 A;  2JA9 A;  1LUZ A;  4DR3 Q;  4A3B H;  2AQ1 B;  5FKA C;  1C0A A;  5I9P A;  3F1Z A;  1DYQ A;  3I8Z A;  3M9B A;  4HR7 B;  3PQI A;  1GUO A;  3CHB D;  4NXM L;  5AFW A;  5LMU L;  5C0X G;  3K81 C;  4A3E G;  2NTT A;  1D5M C;  3SDZ A;  1MIU A;  1H9J A;  4L63 B;  1JQY D;  5IYD G;  4JI0 Q;  1Q1B A;  1PRT C;  3LWE A;  1B9N A;  2Q2I A;  2YYZ A;  2F0T A;  4X64 L;  3CC4 A;  4ZAI A;  2HCC A;  3PO2 H;  4FF2 A;  1B3A A;  3D4W A;  5ELB A;  3SK6 A;  1S5D D;  5F2D A;  4A3L H;  4B3S Q;  3NPP A;  2EXZ A;  3CRK C;  3I4M H;  1CA5 A;  4JI0 L;  4UAI A;  1N32 L;  4IUU A;  3LGJ A;  1E2V A;  2CQO A;  1I6V C;  3J81 i;  2QDB A;  3UDG A;  1QE6 A;  2K32 A;  3EN2 A;  4DR4 Q;  1BUV T;  2P5Z X;  3PO3 B;  5GAH C;  3MVV A;  4FF4 A;  2HDL A;  3F8T A;  3GTM B;  4A3G H;  3MZ5 A;  2FIN B;  2PMZ B;  3FVQ A;  3JC6 6;  1XWE A;  4C2M H;  2Z4H A;  3V05 A;  1QZG A;  2A6E D;  4DV7 L;  3KLR A;  3VYU A;  1X3P A;  1VQ8 A;  1RF2 D;  4BY7 H;  3CAM A;  1VMP A;  4TRD A;  3NTI A;  4DR4 L;  3T1Y Q;  1S72 A;  4QGU A;  3BVZ A;  4AIM A;  2IPK D;  5LL6 S;  5I9O A;  2KEN A;  3VA5 A;  3JAM E;  3DM1 A;  4XDX A;  1K83 H;  5M3M B;  1EFW A;  3OOC A;  3SK4 A;  2J4X A;  3D8G A;  4CGY B;  5C3E H;  3D6C A;  1A2U A;  4BBR B;  3HEJ A;  3ND8 A;  4DAP A;  2OTL A;  2A73 B;  1MHW C;  1PYW D;  4M1U B;  4QMG A;  2EVB A;  4QIW B;  3A55 A;  4IOA A;  3S24 A;  4FNF A;  1C48 A;  2MFI A;  3ULL A;  3M7N A;  4PMC A;  1G2T A;  1EU4 A;  3QWN A;  4YWM A;  5JEA H;  5M3F G;  5EAY A;  1SNQ A;  4RWS C;  1O78 A;  3G7L A;  4HSV A;  5IY0 A;  3L2P A;  4JYA Q;  4P72 A;  4AYB G;  4LF6 Q;  4DAY A;  1I5F A;  3TP6 A;  3KYH C;  5CV9 A;  1IKM A;  1HZB A;  3H09 A;  3K0X A;  4A3K G;  4FF3 A;  2Z6B A;  4OIJ A;  5C44 H;  2HCI A;  5EPL A;  2Y0S E;  4JV5 Q;  3VR6 A;  3IAY A;  2EJG C;  1L1O C;  1HNW L;  4JYA L;  2A69 C;  2PPB C;  4LF6 L;  1LT5 D; 
#chains in the Genus database with same CATH homology
 1VQ7 A;  3G71 A;  4UP9 A;  4GKK Q;  2ZJR A;  2UXC Q;  4MNO A;  1K8G A;  2JE6 I;  1XPR A;  3JAM i;  2UXB Q;  3U4Z A;  1VQ6 A;  2IX1 A;  1X3E A;  1VQ9 A;  4HID A;  2E2I H;  2OQK A;  5H1S E;  3S16 H;  1OXU A;  4R4I A;  4ALP A;  4MZ9 A;  3KOJ A;  2HQL A;  4IPD A;  2BA1 A;  3BZC A;  4JI8 Q;  2QEX A;  4OO1 I;  2JA8 H;  4PZ8 A;  1P16 A;  1TWG H;  1V43 A;  1OXV A;  1YZ6 A;  4JI4 L;  3M4Q A;  3I4N H;  5JJL A;  4R4T A;  3BJU A;  2LXJ A;  4GLV B;  3CCQ A;  3CXC A;  1PHJ A;  3I2Z A;  2JA5 G;  2N3S A;  2UXC L;  2VQE Q;  2HIV A;  4DR3 L;  4A3M H;  1A0I A;  1X9N A;  2XTI A;  1NY4 A;  1B7Y B;  4P74 A;  2VY3 A;  1PH6 A;  4LF5 Q;  2E8G A;  3H0G H;  5FLM H;  2UUC Q;  1KRS A;  4BBS H;  2CFM A;  1IBL Q;  3HKZ E;  1PH2 A;  4NXN Q;  1X3F A;  2AMC B;  2K75 A;  4O0A A;  2OCE A;  3UDX A;  4DUY L;  3CPF A;  3CF5 A;  2R7Z G;  4JI8 L;  4LF9 Q;  2B3G A;  4XTC S;  1UWV A;  4HJ7 A;  1J6Q A;  2JA6 G;  2B29 A;  2C35 B;  4QY7 A;  3PF5 A;  1N33 Q;  4GN4 B;  4DR1 Q;  2Z6K A;  2NZH A;  1T9H A;  2IHE A;  3GO5 A;  4DPG A;  2UU9 Q;  3K7U C;  4JI7 Q;  1Q81 C;  1JE5 A;  2K5H A;  1EUJ A;  2WB1 E;  3PUW A;  4APV A;  3RN5 A;  2GVB A;  1VQL A;  4JI1 L;  1QVF A;  2OTJ A;  3H15 A;  2UUC L;  4GLA C;  1VQK A;  2WAQ G;  4DK3 C;  3FP9 A;  1M1K C;  3UDF A;  5GAD C;  1HR0 W;  3A5Z B;  1Y14 B;  2EQS A;  3PUV A;  4IPH A;  3STB D;  4GKJ Q;  4JG2 A;  4B3S L;  1FJG L;  1EOV A;  4DKA C;  4GLX A;  1K3R A;  4IO9 A;  4JI6 Q;  1GVP A;  1FVI A;  2JJQ A;  3PO3 H;  4Y52 H;  4A3L G;  1LYL A;  1A62 A;  4DK6 C;  1X55 A;  1UE1 A;  3W5O A;  2KCT A;  2KHI A;  4LUV A;  2YTY A;  3DLL A;  3FKI G;  4DV3 Q;  4A3J H;  2HT1 A;  3GTL H;  3I4M G;  2WFW A;  2Y0S G;  3GTM H;  4JI7 L;  5C4X G;  3PF4 A;  1BKB A;  2QGQ A;  1VQA A;  2UUB L;  3CCL A;  4B3T L;  1JJC B;  3ULJ A;  1XPO A;  4A3D G;  4BA2 I;  4IJL A;  2L15 A;  2PQA B;  3OTO L;  2IX0 A;  1AE2 A;  4A3G G;  3I55 A;  1CKN A;  3F2C A;  1HR0 L;  1K0R A;  1UEB A;  1E3P A;  2CKZ B;  4K0K Q;  4NPS A;  4JI2 Q;  1WCM G;  2JA7 G;  1PFS A;  1YBY A;  4A4I A;  2UXD L;  2KHJ A;  1HH2 P;  4DV2 Q;  3W1G A;  3T1Y L;  4KHP L;  3ERS X;  4LWC A;  4GNX B;  1E1O A;  2RHS B;  4HJ5 A;  4ME3 A;  5ELN A;  2NVY H;  4QQB X;  4QJF A;  3WWV A;  3HOX G;  4POG A;  1VQO A;  5M3M H;  1OXX K;  2NZO A;  3S1M H;  1WI5 A;  3ZJY C;  1X54 A;  4GN5 A;  1PH3 A;  1U0L A;  5ELO A;  1C9O A;  4BBR H;  1N36 L;  1KQS A;  1YHB A;  3MEF A;  2K5N A;  4L5R C;  1DGS A;  4LF7 Q;  3HOW G;  4BY1 G;  4DV6 Q;  2VZA A;  2R93 H;  2EIF A;  5C0X I;  3KF6 B;  1IBK L;  4DR6 Q;  5C3E G;  1VQJ A;  1Q12 A;  2LSS A;  4A3K H;  1PV4 A;  2N78 A;  3ER0 A;  1AE3 A;  4TQU S;  1YJN A;  1HNZ L;  3A5U A;  3W1B A;  1Z9F A;  4JBW A;  2R7F A;  5C4J H;  2ZTD A;  2KBN A;  4B3M L;  2UUA L;  2K14 A;  3KFU A;  4DR7 Q;  5JJI A;  1PH7 A;  4OWT B;  4DR2 Q;  1GO3 E;  4JBK A;  1SRU A;  5IYB H;  3AEV A;  1HZC A;  1VQE A;  3J80 c;  4DV6 L;  4X66 Q;  3STB C;  3CC7 A;  4A75 A;  4JI5 Q;  1WJJ A;  4GOP C;  2VUM H;  1VS0 A;  1L1O A;  2ALY B;  5FJ8 H;  2NVX H;  1N34 Q;  3M4O H;  1ASY A;  4GOP A;  1K8A C;  1TWA H;  1MKH A;  4LW1 A;  1VQH A;  1GM5 A;  1VQF A;  1QZH A;  3RLN A;  1X56 A;  1W2B A;  3KJP A;  3HOV G;  3G48 A;  4JOI C;  2VQF Q;  5BR8 L;  2JQO A;  2B63 G;  4YWL A;  3U58 A;  4A3E H;  1OXS C;  2A8V A;  2F52 A;  5IYD H;  3AFP A;  4FDB A;  4JV5 L;  4BXX H;  5LMU Q;  1Q1E A;  4DV4 Q;  4DV0 Q;  1G51 A;  1IBM Q;  4LFC L;  1NTG A;  4X66 L;  2RF4 A;  5FLX c;  2DGY A;  4HJA A;  1GKH A;  3E9H A;  4MTN A;  4WJ3 M;  3K8A A;  2PMZ E;  3PUX A;  4LF8 Q;  3PSI A;  1NE3 A;  2JEB I;  3CW2 C;  4J15 A;  2ZTC A;  5M5Y H;  1E7Z A;  3CCM A;  4LFA Q;  4DV1 Q;  4GKK L;  4X64 Q;  2NVT H;  3K80 C;  3RZO H;  3OW2 A;  5IP7 H;  4X62 Q;  2ID0 A;  2RCN A;  4O2D A;  3UDI A;  3CC2 A;  2F4V Q;  1PA6 A;  4YY3 Q;  1EYG A;  2UXB L;  3J7A 5;  2K52 A;  1YVC A;  4P75 A;  1YJW A;  4L5S A;  1W3S A;  3FHW A;  4OX9 Q;  2ASB A;  3KF8 B;  2MQH A;  4OWX B;  1NMF A;  3F2B A;  2VW9 A;  2R7Z H;  3UE1 A;  1Y1V H;  3CMA A;  4A3B G;  1UE5 A;  2N8N A;  4IPC A;  4DV4 L;  1VQN A;  2JA6 H;  1SRO A;  3PCO B;  1HNX Q;  4RMF A;  1QVC A;  4LUZ A;  1N32 Q;  3J81 j;  4HJ9 A;  1VCI A;  3TRE A;  1PH8 A;  1PYS B;  3CQZ H;  3EBE A;  2AHO B;  2VS1 A;  3S1Q H;  2ZTE A;  5M5W H;  4A3C H;  2IHF A;  2VQE L;  3T1H Q;  1YNX A;  1EQQ A;  2A19 A;  1I94 Q;  2F4V L;  1CKO A;  1MJC A;  3RLF A;  2ZM6 Q;  4B3R Q;  4AYB E;  1XJV A;  4IFD J;  1CKM A;  1XTD A;  4L5Q A;  4LF5 L;  4OX9 L;  4LFB Q;  3HOU G;  2VNU D;  3TRZ A;  2LXK A;  1IBL L;  4C3I H;  4QIW E;  4NXN L;  1XMQ Q;  4RG1 A;  3PO2 G;  5HGQ A;  4GN3 B;  1G6P A;  3H0G G;  4H02 A;  4POF A;  1SR3 A;  5FLM G;  1MJE A;  4LF9 L;  3FKI H;  1VQI A;  2MO1 A;  4EX5 A;  3HKS A;  5AJ3 Q;  4DV7 Q;  4PZ7 A;  1R9T H;  1PH1 A;  1TWH H;  4LF4 Q;  5C4X H;  2A1A A;  1N33 L;  3K7A H;  4DR1 L;  3J7Z C;  1SMX A;  2YV5 A;  3RN2 A;  2AWO A;  1I50 H;  3JAM c;  3T1H L;  2UU9 L;  3D0F A;  1O7I A;  1OXT A;  1JJG A;  2K50 A;  4UY8 C;  4JCV E;  4L5T A;  2ZM6 L;  4B3R L;  2H5X A;  2MO0 A;  2R92 H;  1C7Y A;  3KJO A;  4OO1 G;  2CCZ A;  1Y1W H;  2GN5 A;  4A3F H;  4GKJ L;  1Q7Y C;  4YCW A;  3L0O A;  1SLJ A;  3HFZ B;  2BH2 A;  3I7F A;  2JA7 H;  3G4S A;  3I56 A;  1CSP A;  1RL2 A;  2F3I A;  5IYC H;  4JI6 L;  3GTQ H;  4JI3 Q;  1X65 A;  4LF4 L;  4A76 A;  2WP8 J;  3MXN B;  3PUY A;  1FL0 A;  3HOX H;  4HJ8 A;  4R1J A;  1LM0 A;  4DV3 L;  3CPW A;  3PO3 G;  4A3I G;  3B6Y A;  1PH9 A;  3M85 A;  2OWO A;  3U50 C;  4BY7 G;  1PYB A;  5GAG C;  3OYY A;  3UE0 A;  4DR5 Q;  5M3F H;  4A3J G;  1NBW A;  1YIJ A;  1JB7 A;  3E0E A;  1S3O A;  1V1Q A;  3HOW H;  1V9P A;  1YHQ A;  4DAY B;  5IWA Q;  4OON A;  1X6O A;  5IE8 A;  1QUQ B;  4JI3 L;  4HIK A;  2ES2 A;  4JI2 L;  3GTK H;  2AKW B;  4K0K L;  4WJ4 A;  1Z47 A;  5GRO A;  2D62 A;  3D31 A;  3I4O A;  1YIT A;  1QVG A;  3TEH B;  3BU2 A;  1KRT A;  4R4Q A;  4DV2 L;  2DUD A;  1PH4 A;  2RHQ B;  1TWF H;  4R4C A;  4DUZ Q;  2VL6 A;  4KHZ A;  3HKZ G;  5DLQ E;  5IP9 H;  4X65 Q;  3RNU A;  3RLO A;  4OWW B;  2HIX A;  4DR5 L;  3M3Y H;  4YHH Q;  1D7Q A;  4GNX C;  1IZ6 A;  1L1O B;  2CWP A;  3NEN A;  3CCE A;  1BVS A;  2PI2 E;  3TQY A;  2N49 A;  3GTG H;  1K9M C;  1H95 A;  5M3M G;  4GNX A;  4LF7 L;  5LMN W;  4X6A H;  1VQP A;  1M90 C;  3HOY G;  2I0Q A;  2WAQ E;  5JEA G;  1NMG A;  4BA1 I;  3CCU A;  3GTO H;  3HOV H;  3KDF A;  4AQY Q;  1HNW Q;  2WB1 G;  4DR6 L;  1L2F A;  5LMN Q;  3A0J A;  1XMO Q;  3S2D H;  3S17 H;  1YEZ A;  3NEL A;  2R93 G;  2B63 H;  1D8L A;  1U5K A;  4YCV A;  4DUZ L;  5GQO A;  1KIX A;  1PVO A;  2E2J H;  3S2H H;  1EIF A;  4PZ6 A;  1KL9 A;  1VQG A;  1Q82 C;  3ICE A;  3Q8D A;  4Y7N H;  1WFQ A;  4YHH L;  3KF6 A;  3AYH B;  3CP0 A;  4JOI A;  4DR7 L;  3ULP A;  2KCM A;  3GTJ H;  3H3V I;  4JBM A;  4DR2 L;  4NXM Q;  2I5M X;  5HY6 A;  4HIO A;  2IY5 B;  4A93 G;  5C44 G;  4JI5 L;  3HOZ G;  1E1T A;  2BA0 A;  3S15 H;  2I5H A;  3CCJ A;  2I5L X;  5IYB G;  4YWK A;  3PIP A;  1N34 L;  2JA5 H;  5GAE C;  1ASZ A;  5LMN L;  1XMO L;  1TXY A;  3BZK A;  1E22 A;  1SE8 A;  2Q2H A;  2JA9 A;  2EXD A;  5FJ8 G;  1CSQ A;  3GD7 A;  2ZJP A;  1LUZ A;  4UP8 A;  4AH6 A;  3IRB A;  4DR3 Q;  1SFO H;  3DM3 A;  2VQF L;  2PNH A;  4A3B H;  1C0A A;  3F1Z A;  3M9B A;  1EWI A;  4NXM L;  4IJH A;  5LMU L;  5C0X G;  3K81 C;  4DUY Q;  4DV0 L;  4HIM A;  4A3E G;  1IBM L;  1MIU A;  1NJI C;  3CD6 A;  3M4P A;  5IYD G;  4JI0 Q;  1Q1B A;  2JEA I;  4BXX G;  3RZD H;  4LF8 L;  3CCS A;  1P8L A;  3H3V H;  2JA8 G;  3NBH B;  4IFD I;  2Q2I A;  2YYZ A;  4DV1 L;  4LFA L;  1KHI A;  4X64 L;  3I4N G;  2K5V A;  1N9W A;  3GDE A;  4OXP A;  4X62 L;  2QA4 A;  4DV5 Q;  3HOU H;  5E7N A;  3CC4 A;  1A8V A;  4YY3 L;  3TS2 A;  4C3J H;  2CWA A;  4LNQ A;  3PO2 H;  4JI1 Q;  5IP7 G;  1J5E Q;  4PMW A;  4TVA B;  2IT1 A;  4KI0 A;  2GVA A;  4IPG A;  4A3M G;  2NN6 I;  2PI2 A;  1YJ9 A;  2Z0S A;  1TWC H;  1HNX L;  1Q86 C;  1VQB A;  4A3L H;  1BBU A;  4BBS G;  4B3S Q;  1FJG Q;  1SN8 A;  3I4M H;  4JI0 L;  1IYJ B;  1Y1V G;  4XIG S;  1N32 L;  2Z6K C;  3LGJ A;  2CQO A;  3RR5 A;  1VQ4 A;  1KXL A;  3J81 i;  1KC8 C;  3UDG A;  1UE6 A;  4DR4 Q;  3EN2 A;  1VQ5 A;  4DV5 L;  2HHH Q;  3A74 A;  1WOC A;  4UP7 A;  2JK8 A;  1I94 L;  5GAH C;  3PIO A;  3CME A;  2YU9 H;  1JMC A;  1CKN B;  4A3D H;  1S40 A;  1J5E L;  3PGZ A;  2E5L Q;  2UUB Q;  4A3C G;  4LFB L;  2BH8 A;  3F8T A;  2Q2U A;  2ZJQ A;  2AWN A;  4PG3 A;  1VQC A;  4DNI A;  4B3T Q;  4A3G H;  1XMQ L;  3CCV A;  3NEM A;  1WCM H;  3OTO Q;  3JC6 6;  4C2M H;  1JT8 A;  1QZG A;  1HR0 Q;  3J80 i;  5AJ3 L;  4DV7 L;  4A3I H;  1N8R C;  1VQ8 A;  4BY7 H;  4JC0 A;  2UXD Q;  3CAM A;  4DR4 L;  3T1Y Q;  2HHH L;  4KHP Q;  1B70 B;  2D0P A;  1IXR A;  1VQD A;  4QGU A;  1S72 A;  1X3G A;  4AIM A;  2R6G A;  2OQ0 A;  3AQQ A;  2KEN A;  2E5L L;  1A63 A;  5M5X H;  5JEA J;  2FXQ A;  4KLK A;  2MNA A;  4BY1 H;  1Q46 A;  1N36 Q;  1K83 H;  1EFW A;  2YTX A;  2R92 G;  4LUO A;  3U4V A;  3GTP H;  5C3E H;  5J3B A;  1Y1W G;  4IFD G;  4QL5 A;  1AH9 A;  4A3F G;  1E24 A;  4YCU A;  1WYD A;  2D0O A;  4C3H H;  2XGT A;  4R4O A;  2V1C C;  2OTL A;  1IBK Q;  1FGU A;  4DAM A;  1L0W A;  5IYC G;  2PQA A;  1G29 1;  3CCR A;  1IL2 A;  2YTV A;  2R7D A;  2K4K A;  4P73 A;  1HNZ Q;  1YHA A;  1UE7 A;  2NN6 G;  4IOA A;  3S24 A;  5IT9 c;  4NB3 A;  3ULL A;  2MFI A;  1XNR Q;  3M7N A;  1LTL A;  3KDF B;  1XNQ Q;  3F2D A;  4B3M Q;  2UUA Q;  3HOY H;  4YWM A;  3KLW A;  1B8A A;  4GOP B;  2NVQ H;  5IWA L;  5M3F G;  5EAY A;  1EIY B;  1CUK A;  1EQR A;  3VDY A;  4BBR G;  2Q2T A;  1HZA A;  4GS3 A;  3AFQ A;  2ATW A;  5JJK A;  5IY0 A;  3L2P A;  3J81 c;  4JYA Q;  1KD1 C;  1I3Q H;  1YI2 A;  4P72 A;  4AYB G;  2E2H H;  4LF6 Q;  3TS0 A;  3S14 H;  1I5F A;  1Q8K A;  1HJP A;  3KYH C;  3E9I A;  3G6E A;  4X65 L;  1HZ9 A;  1QUQ A;  4UPA A;  5C0X J;  1HZB A;  3K0X A;  4A3K G;  5BR8 Q;  1XNR L;  1K73 C;  4JBJ A;  1I6H H;  1RIP A;  3SGI A;  3S1R H;  1XNQ L;  4A93 H;  1GD7 A;  5IP9 G;  5C44 H;  4IOC A;  2Y0S E;  1BBW A;  3HOZ H;  4JV5 Q;  3PUZ A;  3S1N H;  1L1O C;  3L7Z C;  4LFC Q;  1JJ2 A;  1KAW A;  3EIV A;  1PH5 A;  1OTC A;  4P71 A;  3PV0 A;  4AQY L;  4JI4 Q;  4JYA L;  1HNW L;  5K36 G;  1XPU A;  4LF6 L;  4EQ5 A;  1VQM A;  2VUM G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...