3M4OH

Rna polymerase ii elongation complex b
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title X-ray structure and mechanism of RNA polymerase II stalled at an antineoplastic monofunctional platinum-DNA adduct.
pubmed doi rcsb
molecule tags Transferase/dna-rna hybrid
total genus 15
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2010-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3m4oH00
1W2BA 4A3LH 4ALPA 4QL5A 5H1SE 4YY3Q 5IYBG 2AKWB 3M85A 1VQLA 1PV4A 1Q12A 4DUZL 4HIOA 1C7YA 3KOJA 4JI3L 5IYDH 3J7ZC 4KHZA 3J80c 2AWNA 1R9TH 2ATWA 4A3FG 1VQ6A 2NVQH 3GTJH 4OO1I 2MO0A 5ELOA 1O7IA 5BR8L 5C4JH 3A0JA 1XNRQ 4JYAL 3I4NH 2KCMA 4BY7H 3CW2C 3PUXA 4OX9L 1PH8A 4Y52H 1HR0L 3H3VI 2WAQE 1XNQQ 4DAMA 2NN6G 3PCOB 4LW1A 3NELA 1EWIA 4X62Q 2F52A 4C3JH 3H15A 3W5OA 5IP7H 3PF4A 4BBSH 2YYZA 2OTJA 4WJ3M 1X3GA 4KHPL 1KD1C 2JE6I 1BBWA 3HKZE 1FJGL 1OXXK 2L15A 1E22A 2JQOA 3CF5A 2PMZE 3PSIA 4JI5Q 3JAMi 4JI6L 2BH2A 2RHSB 4X65Q 3CCQA 1X9NA 1PYSB 4TVAB 2HHHQ 2UUCL 4DR6L 3GTKH 4DV4Q 4A3EG 3L2PA 1SLJA 3ER0A 4JI7L 2UXDL 2VQEL 4JV5Q 2R92H 2Z6KC 5JEAG 1G51A 4AQYQ 3VDYA 2UXBL 1PH2A 5IYCG 1NMFA 3TS2A 4A3JH 1T9HA 4KLKA 4LUVA 4OO1G 5C0XJ 1HNZL 4APVA 4FDBA 1MJCA 4L5SA 1KL9A 4YCVA 4C3IH 1TWHH 3J81i 1CUKA 4POFA 1D7QA 1EFWA 1GKHA 4MZ9A 2GVAA 1VQDA 3HOWG 3S1NH 2QGQA 1YVCA 2R7DA 2AMCB 2VS1A 3FKIG 4JOIA 4MNOA 3STBD 4EQ5A 2EXDA 4QGUA 1PA6A 3Q8DA 1UE1A 3F2BA 4X62L 2YTYA 4DV5Q 4DR1Q 4A3GH 4A3KG 2IX1A 1GM5A 1WFQA 3HFZB 4LF9Q 2K4KA 4X66Q 1XPRA 4XTCS 4AYBG 2CFMA 1VQ9A 1X54A 2D62A 3I56A 1KIXA 2A19A 4JI5L 4BXXG 2HIXA 4DR7Q 3UE0A 4X65L 5LMNL 4EX5A 3HOXG 3PIPA 1J6QA 4IO9A 1XMOQ 2HHHL 1L1OC 1E1TA 2JA5H 2Q2TA 1KRSA 4YHHQ 2K50A 3HOYH 3HOVG 4GN5A 2Y0SE 3KJOA 1VQCA 4IPDA 4YWMA 4O0AA 3A5ZB 5IYBH 4JBKA 4AQYL 5C4XG 1SMXA 4L5RC 2UXCQ 1VQPA 1XJVA 1MIUA 2CCZA 4DR2Q 1PH6A 1K8GA 2MFIA 1VQGA 4A3FH 4UP9A 1Z9FA 2KBNA 1Q1BA 2I5LX 2K5HA 2Q2HA 2YV5A 1CSPA 4DK6C 4LF7L 3M7NA 1YZ6A 3PUZA 1VQAA 3BZCA 4OONA 2ZJRA 2ZM6Q 2H5XA 1VQFA 2V1CC 4DV5L 2EQSA 1HJPA 5C3EG 1ASZA 4IFDJ 1FVIA 1VCIA 4A3MG 3E0EA 4DUYQ 4B3MQ 1X6OA 4B3TQ 4X66L 2B63H 3SGIA 3BU2A 4JBMA 5J3BA 4DR7L 5JJLA 1KQSA 1H95A 5M3FG 4JI3Q 1IBLQ 5DLQE 3CCJA 4PZ7A 3CXCA 1X55A 4DV7L 3TRZA 3RLNA 4DK3C 4YHHL 4GKJQ 4QY7A 5BR8Q 3RLFA 2VW9A 4A3EH 4JYAQ 2JK8A 1PYBA 4IPHA 4L5TA 2VUMG 5HY6A 1N32Q 4OWWB 1HR0Q 2I5MX 1BKBA 4DR2L 5EAYA 1VQBA 2MQHA 1GVPA 3K8AA 2I5HA 4JI2L 4GNXC 2KENA 4LF4L 3RR5A 1AE3A 2A8VA 3B6YA 3TREA 2KCTA 2MNAA 1N34Q 3KDFA 3RZOH 4HIKA 3T1YL 2F3IA 3S14H 5K36G 4QJFA 4JI6Q 4P72A 2ZM6L 4A3CG 1YNXA 3TS0A 3H3VH 3IRBA 3HOWH 2CKZB 3E9IA 4DV1L 5FJ8G 3HOUG 3FKIH 1X3FA 1PH5A 3G6EA 1PH9A 4C3HH 4DV6Q 2UUCQ 4DUYL 4B3ML 4B3TL 1TXYA 4NB3A 4DR6Q 2WB1G 3KF8B 1WCMG 1Y1VG 1K83H 1VQHA 3PV0A 1Q7YC 4JI7Q 2WFWA 3S17H 2VQEQ 2UXDQ 2IY5B 2ASBA 3TEHB 3RZDH 4BXXH 1IBLL 1P16A 2UXBQ 3H0GG 3NBHB 2R7ZG 4A3IG 4R4CA 4A75A 3PO3H 4HJ5A 1QVCA 5IP9G 3JAMc 2R6GA 1HNZQ 3M4OH 4GKJL 4R4OA 2ZJQA 1UE5A 2ZTDA 2LXJA 3W1BA 2ZTEA 1Q82C 3CPFA 2JA8G 1AE2A 2ALYB 2QEXA 1N32L 1YJ9A 2JEAI 2FXQA 1YI2A 5C4XH 5LMUL 4LNQA 2B3GA 4NPSA 1XMQL 3HOZG 1KHIA 4R4IA 1NMGA 1XPOA 4HJ7A 1A62A 3OTOQ 1VQ4A 1N34L 2OWOA 2NVXH 1B8AA 1Z47A 2N78A 1L0WA 2D0PA 2JJQA 2XTIA 2OTLA 4IOAA 4DPGA 1KAWA 5IY0A 3J81c 5LMNQ 5C0XG 4BA2I 4P75A 3AFPA 4LWCA 4RG1A 4DV6L 4BY1G 4LFAL 1I50H 2JA7H 1ASYA 3W1GA 5C3EH 2PQAB 4A93G 1LUZA 3STBC 1U0LA 3CD6A 2WAQG 2N49A 2NVYH 1A0IA 1YITA 1N36Q 2YTXA 3L0OA 1YJNA 3M4PA 1YEZA 3GTGH 4K0KQ 2CWPA 4HJ9A 2RF4A 3GTMH 4IFDI 3S24A 5IE8A 3UE1A 2E2HH 3CQZH 1W3SA 4UY8C 3HKZG 1J5EL 4A3BG 3M3YH 4PG3A 1BVSA 2Z6KA 2VY3A 4BBRH 2JEBI 1QZGA 1EIFA 1NE3A 1OXSC 3CC2A 1MKHA 1OXTA 4HJAA 4LF7Q 4TQUS 4LFCQ 2R93G 2VUMH 1QVFA 1C0AA 1VQEA 4A4IA 1QZHA 2AWOA 1P8LA 2PQAA 3CCMA 2I0QA 1IL2A 3OTOL 1U5KA 1I3QH 1NBWA 5IT9c 4PZ6A 2YU9H 4NXNL 4JI8L 1K73C 3T1HL 3S2HH 1HR0W 3L7ZC 1JJ2A 4YCWA 1UWVA 1YHAA 2WP8J 4GOPC 1PVOA 2ZTCA 4JOIC 3BJUA 2A1AA 2E8GA 3DLLA 4A3CH 1AH9A 4WJ4A 4DV7Q 5FJ8H 1JE5A 3EBEA 3HOUH 1B70B 3ULPA 4DKAC 3K7AH 2QA4A 1Y1VH 1VQMA 4UPAA 4HIDA 1N36L 4UP7A 3GTOH 2NZOA 5AJ3L 4K0KL 1NTGA 1QVGA 4IFDG 3K0XA 4LF6Q 2VL6A 2R7ZH 1CSQA 5GQOA 4JI2Q 4LF4Q 3KLWA 5IP9H 1UE6A 3K80C 5FLMG 1PH4A 1IBML 3PO2G 4LFCL 3I55A 1E1OA 4C2MH 2ES2A 3T1YQ 1WI5A 2JA8H 4JI0Q 1VS0A 1HZAA 2C35B 1HNXQ 3OW2A 4HIMA 1C9OA 3G48A 3PF5A 3I4NG 4IPCA 4DV1Q 4BY7G 3NENA 5FLXc 2Y0SG 1HZCA 1CKOA 1L2FA 3HKSA 3HOZH 1IXRA 3M9BA 3CAMA 2MO1A 1LTLA 1VQOA 1M1KC 4MTNA 3JC66 4J15A 1RIPA 1X56A 3K81C 4IJLA 2UUAQ 1LYLA 5M5YH 4BA1I 5IP7G 5GAEC 1EQQA 1Q46A 2HQLA 4GLVB 5ELNA 4DR3Q 4BY1H 4Y7NH 3RNUA 2N3SA 1Q86C 4YWKA 1V1QA 2R7FA 2IT1A 2YTVA 1XPUA 3CCRA 5LMNW 3AEVA 3ZJYC 2B29A 2OCEA 3GDEA 4JI1Q 5LMUQ 1VQKA 5IYCH 4LF8Q 4LF6L 1SROA 1Q8KA 1N33L 1XMQQ 1YHQA 4HJ8A 4PZ8A 1YJWA 4POGA 4R4TA 3I2ZA 3CC7A 2VNUD 4A3BH 3AYHB 3CCSA 3LGJA 3KYHC 4JI0L 3PUVA 1HNXL 2R93H 2F4VL 2K75A 1UE7A 1VQIA 5C0XI 2UUBL 1BBUA 1JT8A 3PGZA 3RN2A 4LFAQ 4YWLA 3D31A 3CCVA 4A3KH 3TQYA 1CKNB 3AQQA 4B3RQ 1HZ9A 2Q2IA 2UUAL 1WJJA 3M4QA 3ICEA 4A3GG 2Z0SA 1OTCA 2Q2UA 1PFSA 3HOXH 3S16H 3GTPH 4DR3L 2VQFQ 2BH8A 3RN5A 1G6PA 5JJKA 1J5EQ 2PI2A 4AIMA 1SFOH 2E5LL 3S1MH 3HOVH 1D8LA 4JI4Q 3I4MG 4A3DG 2IHEA 3A74A 1OXVA 2NZHA 4DR5Q 1DGSA 1I5FA 4JI1L 4LF8L 3HOYG 1VQ5A 1TWGH 1IYJB 1E24A 3MXNB 1A63A 2PI2E 1CKNA 2IX0A 4NXML 1VQ8A 3S1RH 2HT1A 1JJCB 1S3OA 2CWAA 2DUDA 3ERSX 4DR4Q 4NXNQ 3KF6B 4XIGS 4JI8Q 5M3MG 5FLMH 3CP0A 3J81j 3PO2H 5M5XH 3T1HQ 2E2JH 3CCLA 1X3EA 3PUWA 1Y1WG 4H02A 4JBJA 4DAYB 3F1ZA 2E2IH 3J7A5 3FP9A 1IZ6A 1OXUA 3ULLA 1UEBA 1PHJA 4OXPA 1S72A 3PIOA 4A3MH 1X65A 4RMFA 4B3RL 1HZBA 2K5NA 2JA6G 3CC4A 4GKKQ 4LFBL 4LF5Q 5C44G 1K8AC 5AJ3Q 5M3FH 4A76A 1K9MC 1K3RA 3U50C 3UDGA 2B63G 2VQFL 1PH3A 3KF6A 3KFUA 1E7ZA 2ZJPA 1SE8A 4QIWE 3J80i 1IBMQ 4DV2Q 4JI4L 1WOCA 1EIYB 4UP8A 4DR5L 4JCVE 2K52A 3E9HA 3CMEA 4P74A 4GOPB 1HNWQ 3D0FA 1EYGA 2EIFA 1L1OB 2PNHA 4YY3L 3RLOA 3GD7A 4DR4L 3PUYA 2AHOB 4AYBE 1XTDA 1S40A 2N8NA 1KC8C 1A8VA 1JB7A 3U58A 1XNRL 3EN2A 3NEMA 1JJGA 1EQRA 3GTQH 5GAHC 1M90C 4JBWA 1WCMH 4JC0A 4GOPA 1IBKQ 1XNQL 4GKKL 4P71A 1NY4A 4YCUA 5JEAJ 3UDXA 4LF5L 4A3LG 1L1OA 4L5QA 2VZAA 3S2DH 3H0GH 3DM3A 4P73A 2BA0A 4DV3Q 4A3IH 3AFQA 5GADC 1N8RC 1VQ7A 1Q81C 1PH1A 4AH6A 1N33Q 1LM0A 1RL2A 1SR3A 1VQJA 5IYDG 2RCNA 4DV2L 4DV0Q 4GN3B 2JA9A 4GLAC 1V43A 3PO3G 4GLXA 3I4MH 3CMAA 4A3DH 5E7NA 1HNWL 2OQKA 4DV4L 1KRTA 4IOCA 2F4VQ 5GROA 2UUBQ 1G291 1TWCH 2BA1A 2K14A 1GD7A 3U4ZA 1E3PA 3WWVA 4JV5L 1FGUA 3G4SA 1EOVA 2GVBA 1QUQB 2DGYA 1TWAH 2OQ0A 1I94Q 1WYDA 5M3MH 4GN4B 5IWAQ 3F2DA 2NVTH 1Y1WH 3EIVA 4B3SQ 4BBSG 2LXKA 4X6AH 4GNXB 4DNIA 2XGTA 1MJEA 2UU9Q 4X64Q 1FL0A 1Q1EA 4R4QA 3F8TA 3K7UC 3U4VA 1IBKL 1JMCA 2E5LQ 3CPWA 4A93H 2HIVA 1YHBA 1K0RA 4ME3A 4DR1L 2GN5A 2JA6H 2JA7G 1CKMA 5C44H 4JG2A 2KHJA 3CCEA 1I6HH 4OWTB 4IPGA 4DV3L 4LF9L 1QUQA 2K5VA 3FHWA 3G71A 1GO3E 3I4OA 2CQOA 3OYYA 1YIJA 4NXMQ 2R92G 1YBYA 4DV0L 3CCUA 4OWXB 3KDFB 4DUZQ 1HH2P 4A3JG 5JJIA 1XMOL 4GS3A 3BZKA 4GNXA 1V9PA 2ID0A 4BBRG 4LUOA 3GTLH 3UDIA 1NJIC 2RHQB 1KXLA 2KHIA 2WB1E 4LUZA 3S15H 4QQBX 3MEFA 2UXCL 4OX9Q 3KJPA 3A5UA 1I94L 1PH7A 2LSSA 2IHFA 5IWAL 4LFBQ 2NN6I 1SN8A 1VQNA 5HGQA 3F2CA 4B3SL 4R1JA 1EUJA 3S1QH 3I7FA 1TWFH 4KI0A 3GO5A 2UU9L 4KHPQ 1B7YB 4X64L 1FJGQ 1N9WA 2D0OA 1SRUA 3UDFA 5GAGC 4IJHA 5M5WH 3ULJA 4PMWA 4O2DA 2JA5G 1Y14B
chains in the Genus database with same CATH superfamily
1W2BA 4ALPA 3QO2A 3I4LA 5EGTA 3DEOA 3M85A 1T5EA 4HAEA 5IGCA 5IYDH 4RKBA 2F0FA 3S15B 4A3FG 3M7GA 3NE5B 3ND9A 5ELOA 2PO4A 3KK7A 4JYAL 2KEEA 3PUXA 4E6IA 4OX9L 3Q6SA 2K32A 1TWFB 1XTCD 1XNQQ 4DAMA 1UEAB 5M5WB 4C3JH 2LKVA 1KD1C 2HCIA 1BBWA 2JE6I 4LK1C 3CF5A 4FXKC 1E22A 1G6ZA 4JI5Q 1VMCA 4XYQA 4BWGB 1VMPA 3I72A 4A3EG 4NKLA 1HA5A 1SLJA 1DCZA 2UXDL 1ILPA 2DJGC 2R92H 3BDLA 2Z6KC 4AQYQ 4XQJA 1KLUD 5IYCG 1SNDA 4CDDC 4LUVA 4OO1G 3V05A 3NWTA 3DHQA 4FDBA 3TP8A 2L55A 3TZDA 4C3IH 1S5DD 5ELDA 1D7QA 4RH6A 1STGA 1SSOA 4C3JB 3HOWG 1YVCA 4L8JA 1PA6A 2KCCA 1X3QA 2EXDA 4C3HG 1HUMA 4A3KG 2B2TA 4LF9Q 1EU4A 1XPRA 4XTCS 4AYBG 2F0NA 4BXXG 4DR7Q 2A19A 4JI5L 3T4AC 5LMNL 1HA6A 4LMQD 1J6QA 1KDCA 1L1OC 2R92B 1KRSA 5IOCA 5DM73 1WTRA 1WTPA 4GN5A 2Y0SE 1CZGA 1VDZA 3A5ZB 4AQYL 5C4XG 4L5RC 1SE4A 1EEID 1VQPA 4C3IB 3I3CA 4DR2Q 1VQGA 1F9SA 3MWYW 1NR4A 1QWYA 3OSOA 1Q1BA 1CSPA 2O4XA 2JN4A 1KLGD 3WDNA 3E0EA 4OELB 2F0MA 4OEMB 4B3TQ 2B63H 4RGOS 4DR7L 3TBIB 3TP7A 2JXMB 1D5ZC 4PZ7A 4DV7L 3RLNA 4DK3C 1EY9A 4GKJQ 4QY7A 3RLFA 1R4QB 3QR8A 2JK8A 3C3LA 4KKSA 4DR2L 4KHVA 3ND8A 4LF4L 3RR5A 2A8VA 3TREA 2KCTA 2OXPA 5ELBA 5K36G 4QJFA 1LTID 2KOLA 4K8IA 3TS0A 1J9OA 2B63B 3H3VH 2CKZB 2P5ZX 3E9IA 1GUOA 4DV1L 3MC0B 5JPNC 4B3TL 1TXYA 1B3QA 1Y1VG 3LNNA 3H94A 3PV0A 4JI7Q 2VQEQ 2ASBA 2F0TA 2A74C 3H0GG 3NBHB 3NTIA 4R4CA 2JSOA 3JAMc 4GKJL 3K0YA 1UE5A 2RKSA 2RSNA 2LXJA 3V96A 2ZTEA 2JA8G 2QEXA 1Y8PB 1DOKA 1QILA 1RD9D 3D4WA 3C1FA 3E6ZX 3OWFA 3OIPA 3SK5A 2O5JC 1XMQL 1KHIA 2K5QA 1A62A 4UDUC 5DAUA 5A2QL 5CMDA 2OWOA 1HTPA 2NVXH 2JJQA 5KNCA 4DPGA 1XYIA 1LV9A 4BA2I 4CKEA 1K3BC 4BY1G 5JJZA 4LFAL 1WTOA 2KCNA 3R2IA 2PQAB 3CD6A 2WAQG 2N49A 1A0IA 2Z6BA 1EY5A 3L0OA 1YJNA 1CQVA 3M4PA 1AP0A 2X6LA 4K8JA 4HJ9A 3GTMH 1YNJC 3S24A 5IE8A 4UY8C 3CQZH 1LACA 1J5EL 1I6VC 4PG3A 1BVSA 2VY3A 3CC2A 4LFCQ 2VUMH 2A5HA 1QVFA 2EYMA 1H9MA 4ZUJA 4UAIA 2NVXB 1PTOC 1IL2A 1U5KA 1EOTA 1NBWA 5IT9c 2YU9H 2EY1A 4NXNL 4JI8L 1PRTC 3T1HL 3S2HH 1BOSA 1HR0W 1YHAA 5EKIA 2NWGA 1T5XD 1S4ZA 4EVOA 1TR5A 1AH9A 4HMIA 4WJ4A 5CR3A 3ULPA 3QB3A 1JC7A 3GTMB 2QA4A 3CQZB 4HIDA 3IFTA 1Y69U 1QVGA 2B8FA 3K0XA 4LF6Q 1CSQA 2VUMB 1F2ZA 3K80C 5FLMG 4LFCL 5I9OA 1E1OA 1U4MA 4C2MH 2YU9B 3EA6A 2DY8A 1HNXQ 2C5CA 3OW2A 4J1MA 3I4NG 3S2HB 4ABNA 5FLXc 3HKSA 3HOZH 2XIWA 1IXRA 5FO9B 4JK1C 2XN9C 3QG1A 1RIPA 3ONAB 1G91A 1LTSD 2PQEA 5GAEC 1I4GA 4IUVA 4DR3Q 3RNUA 1AZPA 3A7LA 4YWKA 1V1QA 5K5PA 2R7FA 4ZLTF 2HD3A 1XPUA 2A68D 3MXPA 2CH4W 4C2MB 5IYCH 4LF6L 1ESRA 1K0SA 1IL8A 4PZ8A 5F2DA 5NUCA 3CCSA 4OIJA 1LTBD 3HOZB 1C4QA 3DEPA 1HNXL 1B53A 2J4XA 1Q3LA 4N8X1 5EPLA 4ZYSA 2F3WA 4A3KH 3NQTA 1HFGA 5CV8A 5AFWA 3KBXA 1SE3A 4X3KA 3ICEA 2EJMA 2Q2UA 3C46A 1U4LA 2WV6D 3GTPH 4DR3L 2VQFQ 2BH8A 1G6PA 1CFMA 3NPPA 2IHEA 1B9MA 2A6HD 4DR5Q 1Q8IA 1VQ5A 1IYJB 5E4WC 1MD2D 1CKNA 2IX0A 1X3PA 3S1RH 2HT1A 1JJCB 2Z4HA 3ERSX 3NTKA 2CHBD 2E2JH 4A3KB 3H91A 1IYVA 1U4PA 2F0JA 3J7A5 3FP9A 3ULLA 2QDLA 1EU3A 1S72A 1U4RA 4V190 3GTPB 2PCFB 4ULLA 4R8IA 2XWJB 1DM0B 1K9MC 3UDGA 2VQFL 4ODGA 1XWEA 1ZEQX 1RCVD 4QIWE 3J80i 4DV2Q 1EIYB 4DAYA 4DR5L 3S1RB 1QOHA 4JCVE 3CMEA 3NQIA 2IW3A 3D0FA 1EYGA 5ISRA 1L1OB 2E2JB 3PUYA 4Z9CB 2AQ3B 5KYLA 1FYCA 5K36H 1WD1A 1XNRL 3EN2A 3VR2A 1TS2A 3QIAA 2IPKD 1HQRD 4G7HC 3K5LA 4B9XA 4GOPA 1IBKQ 4P71A 3Q22A 1QJOA 3H0GH 1N8RC 2BA0A 2EXZA 2F3VA 3AFQA 4KTAA 5GADC 3OIQA 1LT3D 1SR3A 1VQJA 5IYDG 4DV2L 3MHBA 4GN3B 2EDGA 1E2VA 3I4MH 1XXGA 4CDCC 4DV4L 3LWUA 1G291 4F88A 2K28A 4F87A 1E3PA 3WWVA 1FGUA 1DXMA 1IW7C 1PFNA 5M3MH 3J80E 2O2LD 3PQIA 3F2DA 4C3JG 4FF2A 3EIVA 4ZKCB 2QEJC 4X6AH 4TKOB 2FINB 3CRLC 3NSWA 3H0GB 4DNIA 1MJEA 1IBKL 1JMCA 1YHBA 4ME3A 2JA7G 1I6HH 5D3IB 4IPGA 3I4MB 1GO3E 3I4OA 3OYYA 4CHTB 4NXMQ 2R92G 1YBYA 1GHJA 3MAQA 3BZDB 3I91A 1I4HA 1EFID 2K05A 3J81L 3EFXD 1D6EC 3L9AX 3BS1A 4GNXA 3J7AF 4O1NA 4C3IG 5M3MB 4BBRG 4LUOA 3TMEA 3T16A 1SBBB 1JWSD 4KD3A 4HMJA 4LFBQ 1NR2A 4RWSC 5CBAE 1SNQA 3S1QH 1AEXA 2WAQB 1E2ZA 2FMCA 5EBDA 2F0IA 1JQYD 1FJGQ 2D0OA 1I6HB 1DZ1A 4O2DA 1PTOH 3PIP3 1BCPB 4A3LH 5IGGA 5COYA 4YY3Q 1V1PB 2AKWB 4KV6A 1C7YA 4JI3L 4FP5D 1VQ6A 2XSCA 3RUZA 1QG7A 2NVQH 3GTJH 4OO1I 5BN4A 3J7AV 4F8MA 3EROA 5BR8L 3A0JA 3I4NH 2KCMA 4MHEA 2EY2A 1O7YA 1DONA 3PCOB 1S5BD 5CV5A 3PF4A 4WJ3M 4BBSH 1PTOB 2YYZA 4HCEA 1X3GA 3OMCA 3HKZE 1FJGL 3KBGA 1A6XA 1OXXK 2BH2A 2PMZE 3PSIA 1LT4D 1HFNA 5KEEA 1CI3M 1PYSB 2IWHA 1GOZA 2HHHQ 4DR6L 3MVVA 3ER0A 3QWNA 2NVQB 3P20A 1TS3A 3ZYYX 5C4HA 3GTJB 5JEAG 3AB9A 3I4NB 4XT3B 2MHVA 1NMFA 4A3JH 1T9HA 4KLKA 1ESFA 1HNZL 5LL6X 1WTQA 4L5SA 4YCVA 1TWHH 2E74C 3ERQA 4MZ9A 4BBSB 2I46A 4JOIA 1UE1A 3SK4A 4DV5Q 3HFZB 1J8IA 2K4KA 3RD4A 1YNJD 1VQ9A 2CFMA 2D62A 3I56A 4CJ2C 3UE0A 3VYTA 4EQNA 4EX5A 2HHHL 4DK0A 1E1TA 2Q2TA 3D3RA 4B9WA 4A3JB 1PTOD 4IPDA 4JBKA 1LABA 1SMXA 2F4IA 2Z8LA 2UXCQ 2EYHA 1PRTD 1TWHB 1K8GA 3K5OA 2K33A 3W2DA 1KDBA 1Z9FA 2KBNA 2I5LX 2Q2HA 4DK6C 4I7AA 5JPMC 1O78A 3CU7A 1YZ6A 4LF7L 5CV7A 3QJYA 2V1CC 4DV5L 2EQSA 1HJPA 2DN8A 1SYFA 4B3MQ 1X6OA 2V4DA 4PNYA 3SGIA 3BU2A 2F0OA 5JJLA 2MPMA 1KQSA 4QB4A 3TRZA 4JYAQ 4IPHA 4L5TA 1EY6A 5CV4A 1HPCA 2VUMG 2Q8RE 4JVZA 4OWWB 1BKBA 2XRQD 2MQHA 2EJGC 2WKDA 2KENA 1AE3A 3B6YA 2PNRC 4K6LA 3KLRA 4HIKA 1DOLA 3C2PA 2BOSA 4FXGC 4P72A 1PXUA 1STNA 5CGKA 3IRBA 3P75A 2MJ8A 3G6EA 4DV6Q 4B3ML 4NB3A 4PMBA 2WB1G 1WCMG 3DMUA 1VQHA 2UXDQ 1F2MA 1P16A 4HSVA 4A75A 4IN3A 3M4OH 2TSSA 3GQBA 1HXYD 1BR9A 1O7LA 1IKLA 4JW0A 5HURA 1Q82C 1B9NA 2ALYB 2K5DA 1JWMD 1SEBD 1EYAA 2JEAI 2EYPA 5LMUL 1VF5C 4TRDA 4XT1B 3HOZG 4K2KA 1XPOA 4HN7A 4XQQA 3OTOQ 2K7VA 3F2UA 2N78A 3N6RA 3KLSA 1KAWA 1VF7A 5LMNQ 4ILWA 5C0XG 4LWCA 3I70A 4DV6L 3TP6A 2JA7H 5C3EH 4H13C 4MIUA 3STBC 1U0LA 3QOLA 3M4OB 3HGBA 1GUNA 3TP5A 3VA7A 5A35A 3UE1A 3K58A 2E2HH 3M3YH 4BBRH 2Z6KA 2JEBI 4OGQC 1NE3A 4FF1A 4K14A 2HUGA 4HSPA 3FPPA 1VQEA 3ITPA 3A55A 1P8LA 3OTOL 5C3WA 2JA7B 3L7ZC 1JJ2A 3BVZA 5C3EB 1PVOA 1BF4A 4A3CH 2BDOA 4DV7Q 1JORA 1DYQA 2E2HB 5C5LA 5EPKA 3M3YB 4BBRB 1NTGA 1F9QA 1K28A 5G3LD 4LF4Q 2RDFA 5IP9H 1SYEA 2DNEA 3I55A 2ES2A 1SJED 3G48A 3PF5A 1AN8A 3PMFA 4DV1Q 4BY7G 1CKOA 1L2FA 1D1IA 3CAMA 4MTNA 3HG9A 1X56A 3K81C 4XYOA 2XRSD 5M5YH 4BA1I 5IP7G 1HTLD 4Y7NH 5I4DA 2N3SA 2NZ1D 1Q86C 3SR1A 3K57A 1C48A 2PYKA 2YTVA 5I6YA 2B29A 2FFKB 3GV3A 5JEAH 1IW7D 2L9HA 1PFMA 1QE6A 1SROA 5CV9A 1XMQQ 1YHQA 4POGA 2L0CA 3CC7A 5CV6A 3U9OA 1G8ZD 5C5MA 2R93H 2D2CC 2F4VL 1UE7A 1AW7A 2SOBA 2UUBL 3BVGA 2KJXA 1JT8A 3MFYA 4LFAQ 3SDZA 3D31A 5M5YB 3CCVA 3P1HA 3AQQA 1RTNA 4B3RQ 4Y7NB 1NNXA 4ZCKA 2X6GA 1PFSA 2N55A 3GV6A 5JJKA 1J5EQ 2ZXOA 3I4MG 2QILA 5D14A 1OXVA 2NZHA 2J7ZA 1DGSA 3HOYG 1TWGH 4IFDH 2R93B 4IUUA 5A2QE 4KJOA 4NXNQ 3KF6B 3BVMA 4XIGS 4JI8Q 5M3MG 3CP0A 1WTVA 5HGTA 3T1HQ 3CCLA 1BCPC 1X3EA 1EY7A 2B2YA 2SEBD 4H02A 1HUNA 2F0KA 4CKCA 3R2TA 1MSGA 2ZXPA 3OHXC 3PIOA 4C1NK 4RMFA 2EJFC 4B3RL 2DJFC 1LTGD 3OW7A 3MXNA 1K3RA 1LT5D 2BE5C 3KFUA 1E7ZA 2ZJPA 1IYUA 2AQ2B 1TWGB 2L4NA 2H1EA 1FD7D 5D3DA 4WFN3 2L1BA 3E9HA 1SYBA 4FNFA 1HNWQ 4H0LC 2CH4A 2EIFA 4FF3A 1EEFD 1PZJD 4S3SA 2KEDA 3URYA 4AYBE 1EL0A 5C4ZA 1S40A 1KC8C 1A3TA 2Y0SB 4OL7A 3NEMA 3HP3A 5EJWA 1M90C 4JBWA 1RKNA 1WCMH 2B2VC 2CQAA 4YCUA 2E2DC 5JEAJ 4A3LG 4ME5A 2A73B 2VZAA 3S2DH 3DM3A 1DJRD 1RL2A 2RCNA 4L6TB 2JA9A 3DUZA 1FGBD 2KECA 2WKCA 1HNWL 1KRTA 4IOCA 2F0UA 1TWCH 4JV5L 1EOVA 2DGYA 2QF7A 4QMGA 2WB1B 5J39A 3JAML 1WCMB 1Y1WH 4BBSG 5C0XH 1B4OA 4EQOA 1E0BA 3S2DB 1FL0A 1YNNC 1EY4A 4R4QA 3U4VA 1PZKD 1ENAA 3Q23A 4DR1L 2PZTA 2EVBA 1QUQA 2HCCA 3FHWA 2J0TD 3MEHA 4IURA 1SMYC 1TWCB 4OWXB 1HH2P 4A3JG 5JVH3 1EY8A 1JCKB 1XMOL 5JJIA 4GS3A 2ID0A 5C6AA 3I8ZA 1X32A 4RA8A 1DD2A 2KQ3A 2KVMA 3GTLH 1NJIC 1KXLA 2L11A 1Y1WB 1V8QA 4QQBX 3KJPA 3A5UA 1PH7A 2B8GA 2IHFA 4XXEA 1KTKA 4G7OC 4KK7A 4KI0A 1RODA 1N9WA 5GAGC 2EZVA 1BNZA 4PMWA 3CCEA 5CC4A 3DWAA 1A3VA 4Q5VA 1LO5D 5H1SE 1NUCA 2B2WA 5IT9L 1VQLA 5D65A 1PV4A 1ZKOA 4HIOA 3KOJA 5IGDA 1H9SA 3J7ZC 3GTLB 4ID6A 1I4QA 3J80c 2AWNA 3I73A 2MO0A 1O7IA 3A8JE 5C4JH 1XNRQ 3BDOA 4BY7H 1A2UA 1F77A 1S5ED 1PH8A 4Y52H 4RGNA 1HR0L 2LY7A 2M00A 1QNUA 3H3VI 2WAQE 2NBFA 1QNKA 4LW1A 3Q24A 1EWIA 2ZT9C 3VR4A 4B08A 4X62Q 3X3NA 2OT2A 5IP7H 1QB5D 2K1BA 2L15A 2JQOA 4JI6L 4GZYC 2RHSB 3CCQA 1X9NA 4IUPA 2UUCL 2EYOA 4DV4Q 5FLXL 1OO9B 1HRJA 2PW5A 3E0JA 2EYJA 2G5DA 5C4JB 2UXBL 3VDYA 5I9PA 4V0BA 1PH2A 1C8CA 4BY7B 1EIHA 3TS2A 1SYCA 5C0XJ 1GUGA 4QUCA 1K8MA 3SHLA 1KL9A 3J81i 1CUKA 4POFA 1ET6A 1EFWA 1GKHA 2MUYA 3IKJA 2GVAA 3STBD 3CXCA 2VS1A 2AMCB 3BYTB 4MNOA 4EQ5A 4QUFA 4QGUA 4X62L 1GM5A 4KKTA 2KUMA 1X54A 1B50A 1KIXA 4ZRZA 2HIXA 3MZ5A 2JA5H 4YHHQ 3HOYH 3QOJA 1GUTA 5IYBH 4YWMA 4O0AA 1CHQD 1TVXA 1XJVA 2CCZA 1PH6A 2MFIA 4DA2A 1F9RA 2Q8TA 1D5XC 1PTOF 3HEJA 4MN3A 3PUZA 1PRTF 1EY0A 3BZCA 4OONA 4C1NI 2ZM6Q 2H5XA 5EKKA 2Q8IB 3VR3A 2JP1A 1CA5A 2NN6H 5C3EG 3S9WA 1FVIA 4A3MG 3CKIB 3TSSA 4DUYQ 1JR0D 4M1UB 2JA5B 2F0LA 4K2LA 1H95A 3HOYB 4K5WA 4JI3Q 4KD4A 3J81E 2RA4A 2WINB 3CCJA 1X55A 1UUPA 4YHHL 5BR8Q 2VW9A 2RBMA 3D8GA 1LT6D 1EYDA 5KRUA 2I5MX 4KKUA 5EAYA 1CM9A 1GVPA 3K8AA 1XX8A 2FHTA 5KNDA 4JI2L 4GNXC 1E2WA 4XQNA 1U9RA 2MNAA 4DGZA 3T1YL 3NTHA 3K5NA 3VYUA 1WTXA 2ZM6L 4A3CG 1YNXA 3FKIH 1X3FA 1SYGA 1PH5A 1PH9A 4DR6Q 3A54A 3H6MA 3H09A 4DUYL 1K83H 2A6EC 1Q7YC 3S17H 2IY5B 2WFWA 1D2BA 3RZDH 2E76C 2B2UA 2LMCB 1W6JA 4A3IG 2CW0C 5IP9G 2R6GA 1HNZQ 4R4OA 2ZJQA 3NHHA 3CPFA 1AE2A 1YJ9A 3S1QB 2F0EA 2RDHA 2F0HA 4QIWB 5LL6S 2LS01 4NPSA 4OHJA 1NMGA 4HJ7A 1I4RA 3FKIB 5DNFA 1TY0A 2HQEA 1B8AA 2XTIA 2OTLA 5IY0A 1K83B 3S17B 1STAA 4P75A 3AFPA 2O5IC 4RG1A 3RZDB 3NUCA 1STEA 5E3FA 3W1GA 1HCZA 1JOKA 4A93G 4FXDA 1LUZA 4U68A 2NVYH 2L5TA 1YITA 3GTGH 1YEZA 2CWPA 1TS4A 1BCPD 1W3SA 1F9PA 4CJ0B 3SXHA 1QZGA 5EQ0A 2R93G 1MKHA 2TMPA 3R3OA 2HDLA 4HJAA 4LF7Q 5M9OA 1ENCA 2QDBA 4TSSA 2F0SA 1C0AA 1B44D 1QZHA 2AWOA 4BS9A 1GHKA 2PQAA 3CCMA 2WACA 5IGEA 2I0QA 3VR5A 1I3QH 4HTHA 2BE5D 2KA7A 3HRZC 3GP7A 5LHY1 3SE0A 2WP8J 2ZTCA 2VXWA 2E8GA 3BJUA 4JOIC 1MBYA 2NVYB 5FJ8H 3HOUH 2E75C 2X69A 3GTGB 1TKWB 2QCPX 1NAPA 4LAAA 1DOMA 1GUSA 4UPAA 4UP7A 2NZOA 4RAUC 5AJ3L 1BXTA 4IFDG 2R7ZH 2EPBA 5GQOA 2R3ZA 2A69C 1CHPD 1UE6A 4HCSA 1IBML 4CKBA 4JI0Q 1I3QB 5CYUA 1HZAA 4HIMA 4O42A 1C9OA 5G3LF 2F1MA 1ENFA 2Y0SG 1HZCA 2Z4IA 2MO1A 1FNVA 1VQOA 1M1KC 3VYSA 3HOUB 2N88A 4R9WA 1LLRD 3UI2A 4DK1A 2UUAQ 3W3AA 1Q46A 1CT1D 4WJWA 5ELNA 2I07B 5JOBA 2R7ZB 2F0QA 1WTHA 4IQZA 5LMNW 3TDQA 1BDOA 3ZJYC 5LMUQ 3P7JA 1KNEA 4KMUC 1Q8KA 4Q0FA 4ZK9B 1N33L 3FDTA 3NK9A 4R4TA 4K5VA 2F03A 4A3BH 3KYHC 4JI0L 3PUVA 1YNND 1PLFA 2PZUA 2MP1A 1BBUA 4RKLA 1CKNB 2Q2IA 4RGTA 1WJJA 2UUAL 3M4QA 1SMYD 4A3GG 3DM1A 1RF2D 3TZUA 2DNCA 3KLSX 3RN5A 4DNRB 4G57A 2BDNA 1I4XA 4ZAIA 3S1MH 2E5LL 1D8LA 4JI4Q 2JYOA 1MSHA 1NCVA 1I5FA 3A56A 1I4PA 3HKZB 4A3BB 2PMZB 5TSSA 3KF8A 1E24A 2PI2E 1KABA 1VQ8A 3MTSA 2DUDA 3J81j 3PO2H 5M5XH 4IALA 4RCOA 1Y1WG 4DAYB 3F1ZA 4N8FA 1UEBA 4OXPA 1ZXTA 3FMCA 4A3MH 1JICA 1X65A 3G6JB 1STHA 3CC4A 2Z9HA 4GKKQ 4LF5Q 1K8AC 3S1MB 2EOTA 2LFNA 4A76A 1RHPA 3U50C 1TS5A 2AUJD 4I65A 4JI4L 4RGMA 4X3TA 4UP8A 2F0VA 2K52A 4L63B 4GOPB 2ICEC 5EPJA 3PO2B 4P2CB 5M5XB 2QKIC 1B2TA 2PNHA 4KY6A 2AHOB 2NTTA 2C9OA 1XTDA 4PQXA 4FYDA 1TQOA 1A8VA 4RHRA 4RCNA 4A3MB 3U58A 4XDXA 1SXTA 3GTQH 4DF7A 5ELEA 2B2TC 5GAHC 1UNSA 1XNQL 4GKKL 4LF5L 1SAPA 1KAAA 1L1OA 4IUTA 4A3IH 1VQ7A 1Q81C 1PH1A 3BG3A 4K6DA 1EQVA 1LM0A 1EIGA 4LJZC 4DV0Q 1V43A 3PO3G 3CMAA 4A3DH 4EGVA 2F4VQ 3R93A 2UUBQ 4FO2A 1LTAD 4UHVA 2BA1A 2K14A 3LWEA 1V1OA 3K59A 2GVBA 3G7LA 1TWAH 1D1KA 3GTQB 1WYDA 4GN4B 5IWAQ 3CHBD 4B3SQ 2LXKA 4GNXB 1IKMA 2K6AA 1ICWA 3CRKC 2XGTA 4X64Q 2EY6A 4A3IB 3F8TA 1ZYRC 3K7UC 4A93H 3CPWA 4F7XA 1K0RA 1TY2A 2GN5A 2JA6H 3RMHA 5C44H 1HHVA 2AQ1B 4LF9L 5CBEE 1PZID 4WORA 3WOFA 4A3DB 2K5VA 3G71A 4JPBW 4DV0L 2RQXA 4DUZQ 3D6WA 5C3XA 3BZKA 4WRDA 4DN4M 1V9PA 1TWAB 3T51B 3UDIA 2RHQB 2KHIA 2WB1E 3FEWX 3MEFA 2LSSA 5IWAL 1BBXC 1SN8A 3F2CA 4B3SL 4A93B 4R1JA 2VB2X 5I2XA 3I7FA 4KN4C 1Z6HA 2JA6B 4KHPQ 4X64L 5C44B 3R8BA 3ULJA 1MI2A 1Y14B 2JA5G 1LTTD 2AUKA 4CBVA 4QL5A 5IYBG 2QW7A 1Q12A 4DUZL 1RJTA 1AZQA 5BN3A 1W6KA 1B1ZA 4KHZA 1K8OA 1R9TH 2ATWA 1SNOA 5DM63 3CW2C 2A6ED 2NN6G 1TU2B 5J22A 1PFBA 2B2YC 3NBIA 3NELA 1S5FD 1V1PA 2F52A 3H15A 2CW0D 3W5OA 2OTJA 4KHPL 2EYFA 3IFDA 4C56C 2F0PA 3JAMi 5ELCA 4X65Q 5L37A 4TVAB 3L3OC 5FK9C 1KNAA 3GTKH 1WVLA 1A3UA 3L2PA 1R9TB 1R4PB 4JI7L 2VQEL 4JV5Q 4X3UA 3VR6A 1G51A 1B3AA 4IUNA 2RVLA 4NW2A 3AU7A 4APVA 1MJCA 1SNMA 3VYRA 3MXGA 2PW7A 3EVQA 1VQDA 3S1NH 2QGQA 2R7DA 3FKIG 3Q8DA 4DR1Q 3F2BA 2YTYA 4A3GH 2IX1A 1WFQA 3M4YA 2DY7A 1IHZA 4X66Q 3BDCA 2B2VA 3FPUB 1SNPA 3GTKB 1H9JA 4X65L 3EJIA 4CDFC 1ILQA 3HOXG 3PIPA 4IO9A 1XMOQ 5JAVA 3SK8A 5BN5A 2F0GA 2K50A 2RCFA 4QF4A 3HOVG 5FKAC 1STBA 3KJOA 1BUVT 1BQQT 1VQCA 3OWEB 1MIUA 3JAME 4A3FH 4UP9A 3S1NB 2K5HA 1TT2A 5T1IA 3SVMA 2YV5A 1L0XB 2F0WA 3M7NA 4A3GB 1VQAA 2ZJRA 4MTKA 1CQFA 1VQFA 3IL8A 1ASZA 4IFDJ 2NB0A 1VCIA 1EWCA 4X66L 1PYWD 3OPOA 4JBMA 5J3BA 2A69D 1SDFA 5M3FG 1IBLQ 5DLQE 5I6WA 3T13A 2EE1A 1SE2A 4A3EH 3D6CA 5CORA 1PMRA 4YIJA 1M4VA 1PYBA 4A3FB 5HY6A 1N32Q 1HR0Q 2FJ2A 3OOCA 1VQBA 3FVQA 2I5HA 4OO1H 1N34Q 3RZOH 3KDFA 2R61A 2F3IA 3S14H 4JI6Q 3MA2B 3HOWH 3U9SA 3A7AB 5FJ8G 3HOUG 4C3HH 2VB3X 4I7ZC 2UUCQ 3KF8B 5IT9E 3O13A 3TEHB 3HS0C 2ZXRA 5T1GA 1WD0A 4BXXH 1IBLL 4A3EB 2UXBQ 1FNUA 1STYA 2R7ZG 3MXUA 4DAVA 3PO3H 4HJ5A 1QVCA 4NDXA 3J7YW 2ZTDA 1NSNS 3W1BA 2B2WC 1RTOA 1N32L 1TIID 5DEHA 2K01A 2FXQA 1YI2A 5C4XH 4LNQA 3RZOB 2B3GA 2NYZD 4N9PA 3S14B 4R4IA 3V2TA 2D5DA 1VQ4A 1N34L 3HOWB 1L0WA 1Z47A 4C3HB 2D0PA 3EQLC 3KUPA 4IOAA 1SYDA 3J81c 2SNMA 4AYBB 5I2YA 1CTMA 3BYYB 1RDPD 5FLXE 1I50H 1ASYA 3C1EA 3PO3B 3MFGA 3I90A 2L12A 2RDGA 2YTXA 1N36Q 4K0KQ 2RF4A 2D9UA 5IGFA 4IFDI 4PV1C 1JB3A 5C4XB 3HKZG 4A3BG 1A2TA 3DWPA 3AMUA 1EIFA 1OXSC 1OXTA 4TQUS 3FRPB 1HQMC 4KN7C 4A4IA 4NP5A 5IIFA 1BCPF 4IZ8A 1QCBD 2RSOA 2NTSA 4PZ6A 1K73C 5FOBB 4HEDA 1I50B 4YCWA 1UWVA 4GOPC 1JOQA 1ML0D 1O7ZA 2A1AA 3DLLA 4G7ZC 2PPBC 1JE5A 3EBEA 1B70B 4DKAC 3K7AH 1CK1A 1Q90A 1Y1VH 1VQMA 3E3XA 1N36L 3T56B 4ZQ3A 3GTOH 2F0DA 4K0KL 3SK6A 4CJ1B 2VL6A 3OMGA 4JI2Q 3KLWA 4RFBA 1MGSA 1PH4A 3PO2G 2IL8A 2OF1A 3T1YQ 1WI5A 4KJNA 2JA8H 1VS0A 2C35B 4G4KA 1G2TA 4H7BA 5KIXA 4NMZA 4IPCA 3D4DA 3NENA 1O80A 3M9BA 1H9KA 3PIO3 1LTLA 2SNSA 3JC66 3WOEA 4J15A 3J80L 4IJLA 3K7AB 1LYLA 1Y1VB 1EQQA 3LX0A 2HQLA 4GLVB 3GTOB 2CVRA 4BY1H 2SDFA 1M8AA 2IT1A 3CCRA 3AEVA 2M2LA 4DXGA 2OCEA 3GDEA 4JI1Q 4DXFA 2NUCA 1VQKA 4LF8Q 1A15A 1FR3A 2MGSA 2JA8B 4HJ8A 3NXWA 1YJWA 3I2ZA 2VNUD 4OIKA 3AYHB 3N52A 3LGJA 1ZYRD 2K75A 1VQIA 1S5CD 5C0XI 2K5WA 5KNBA 2FMMA 1JWUD 3PGZA 4ZKBB 3RN2A 4YWLA 1FNWA 4M8AA 3TQYA 1HZ9A 2B39A 2KHSA 4BY1B 1ET9A 2Z0SA 1OTCA 3HOXH 3S16H 2OEOA 3TN2A 3X3MA 5IODA 4FVMA 1II3A 5FO8B 4DNTB 2PI2A 4AIMA 1SFOH 3HOVH 1JE4A 4A3DG 1SNCA 3A74A 2GA4B 2B2UC 4JI1L 1JOOA 1CZWA 4LF8L 2K03A 1CA6A 4DFAA 1KDAA 2Z1CA 4J8QA 3MXNB 1A63A 4N9TA 4NXML 4CGYB 4HR7B 1WTWA 2M9VA 2CWAA 1S3OA 2G9HD 4DR4Q 3NWSA 5FLMH 1Y8NB 3NBHA 4QCLA 3PUWA 2WIIB 4JBJA 2XVSA 2E2IH 1IZ6A 1GXDC 1OXUA 4KY7A 1PHJA 3Q0AA 3K5MA 1GUWA 5E1FA 3HOXB 3S16B 4U673 1HZBA 5ELFA 2K5NA 5FO7B 2JA6G 4LFBL 5C44G 1SFOB 5AJ3Q 5M3FH 3HOVB 1EWHA 2B63G 1PH3A 1EZ6A 3KF6A 4J6HA 4KY5A 1SE8A 1IBMQ 1Y8OB 1WOCA 1PRTB 1EQTA 4P74A 5JVG3 3H3VC 4YY3L 4IUQA 3RLOA 3GD7A 4DR4L 2E2IB 4H44C 1F2LA 5KYIA 3T53B 2N8NA 4PMCA 1JB7A 5KGUA 1JJGA 3SEBA 1GJXA 2IJ0A 2PZWA 1EQRA 5J1ZA 4DU9A 5M3FB 2IX3A 3A8KE 4DAPA 4JC0A 2H4OA 1NY4A 2HDMA 3UDXA 3DXJC 4L5QA 2EY5A 3NP8A 1MHWC 4P73A 4DV3Q 1LTRD 4K5XA 1N33Q 1ICFB 4AH6A 5EKLA 2XNAC 2K04A 1ONLA 1PDQA 4GLAC 1F2YA 4GLXA 1EZ8A 5E7NA 2ICIA 2OQKA 2ENBA 5GROA 1BO0A 1AFPA 1GD7A 2BCOA 4R8NA 3U4ZA 1H9RA 3G4SA 2A68C 1QUQB 2OQ0A 1I94Q 1EYCA 5E4XA 4RHSA 2NVTH 3D4RA 1Z7TA 2EYLA 3DWQA 1L0YB 1G2SA 2UU9Q 1Q1EA 2E5LQ 2HIVA 1CKMA 4JG2A 2KHJA 1D5MC 4OWTB 4DV3L 1YIJA 2CQOA 3CCUA 3KDFB 3A8IE 3IAYA 2G9DA 3VA5A 1SJHD 3K6OA 5EBCA 4FF4A 2NVTB 4LUZA 3S15H 2A6HC 2UXCL 2XWBB 4OX9Q 1I94L 5IGBA 1H9SB 2NN6I 3HZXA 1VQNA 4CDEC 5HGQA 1EUJA 3E5SA 1TWFH 4X3SA 1UAPA 3GO5A 2UU9L 1B7YB 3UDFA 1SRUA 4IJHA 4EQPA 5M5WH 4ZUIA
chains in the Genus database with same CATH topology
1W2BA 4A3LH 4ALPA 4QL5A 5H1SE 4YY3Q 5IYBG 2AKWB 3M85A 1VQLA 1PV4A 1Q12A 4DUZL 4HIOA 1C7YA 3KOJA 4JI3L 5IYDH 3J7ZC 4KHZA 3J80c 2AWNA 1R9TH 2ATWA 4A3FG 1VQ6A 2NVQH 3GTJH 4OO1I 2MO0A 5ELOA 1O7IA 5BR8L 5C4JH 3A0JA 1XNRQ 4JYAL 3I4NH 2KCMA 4BY7H 3CW2C 3PUXA 4OX9L 1PH8A 4Y52H 1HR0L 3H3VI 2WAQE 1XNQQ 4DAMA 2NN6G 3PCOB 4LW1A 3NELA 1EWIA 4X62Q 2F52A 4C3JH 3H15A 3W5OA 5IP7H 3PF4A 4BBSH 2YYZA 2OTJA 4WJ3M 1X3GA 4KHPL 1KD1C 2JE6I 1BBWA 3HKZE 1FJGL 1OXXK 2L15A 1E22A 2JQOA 3CF5A 2PMZE 3PSIA 4JI5Q 3JAMi 4JI6L 2BH2A 2RHSB 4X65Q 3CCQA 1X9NA 1PYSB 4TVAB 2HHHQ 2UUCL 4DR6L 3GTKH 4DV4Q 4A3EG 3L2PA 1SLJA 3ER0A 4JI7L 2UXDL 2VQEL 4JV5Q 2R92H 2Z6KC 5JEAG 1G51A 4AQYQ 3VDYA 2UXBL 1PH2A 5IYCG 1NMFA 3TS2A 4A3JH 1T9HA 4KLKA 4LUVA 4OO1G 5C0XJ 1HNZL 4APVA 4FDBA 1MJCA 4L5SA 1KL9A 4YCVA 4C3IH 1TWHH 3J81i 1CUKA 4POFA 1D7QA 1EFWA 1GKHA 4MZ9A 2GVAA 1VQDA 3HOWG 3S1NH 2QGQA 1YVCA 2R7DA 2AMCB 2VS1A 3FKIG 4JOIA 4MNOA 3STBD 4EQ5A 2EXDA 4QGUA 1PA6A 3Q8DA 1UE1A 3F2BA 4X62L 2YTYA 4DV5Q 4DR1Q 4A3GH 4A3KG 2IX1A 1GM5A 1WFQA 3HFZB 4LF9Q 2K4KA 4X66Q 1XPRA 4XTCS 4AYBG 2CFMA 1VQ9A 1X54A 2D62A 3I56A 1KIXA 2A19A 4JI5L 4BXXG 2HIXA 4DR7Q 3UE0A 4X65L 5LMNL 4EX5A 3HOXG 3PIPA 1J6QA 4IO9A 1XMOQ 2HHHL 1L1OC 1E1TA 2JA5H 2Q2TA 1KRSA 4YHHQ 2K50A 3HOYH 3HOVG 4GN5A 2Y0SE 3KJOA 1VQCA 4IPDA 4YWMA 4O0AA 3A5ZB 5IYBH 4JBKA 4AQYL 5C4XG 1SMXA 4L5RC 2UXCQ 1VQPA 1XJVA 1MIUA 2CCZA 4DR2Q 1PH6A 1K8GA 2MFIA 1VQGA 4A3FH 4UP9A 1Z9FA 2KBNA 1Q1BA 2I5LX 2K5HA 2Q2HA 2YV5A 1CSPA 4DK6C 4LF7L 3M7NA 1YZ6A 3PUZA 1VQAA 3BZCA 4OONA 2ZJRA 2ZM6Q 2H5XA 1VQFA 2V1CC 4DV5L 2EQSA 1HJPA 5C3EG 1ASZA 4IFDJ 1FVIA 1VCIA 4A3MG 3E0EA 4DUYQ 4B3MQ 1X6OA 4B3TQ 4X66L 2B63H 3SGIA 3BU2A 4JBMA 5J3BA 4DR7L 5JJLA 1KQSA 1H95A 5M3FG 4JI3Q 1IBLQ 5DLQE 3CCJA 4PZ7A 3CXCA 1X55A 4DV7L 3TRZA 3RLNA 4DK3C 4YHHL 4GKJQ 4QY7A 5BR8Q 3RLFA 2VW9A 4A3EH 4JYAQ 2JK8A 1PYBA 4IPHA 4L5TA 2VUMG 5HY6A 1N32Q 4OWWB 1HR0Q 2I5MX 1BKBA 4DR2L 5EAYA 1VQBA 2MQHA 1GVPA 3K8AA 2I5HA 4JI2L 4GNXC 2KENA 4LF4L 3RR5A 1AE3A 2A8VA 3B6YA 3TREA 2KCTA 2MNAA 1N34Q 3KDFA 3RZOH 4HIKA 3T1YL 2F3IA 3S14H 5K36G 4QJFA 4JI6Q 4P72A 2ZM6L 4A3CG 1YNXA 3TS0A 3H3VH 3IRBA 3HOWH 2CKZB 3E9IA 4DV1L 5FJ8G 3HOUG 3FKIH 1X3FA 1PH5A 3G6EA 1PH9A 4C3HH 4DV6Q 2UUCQ 4DUYL 4B3ML 4B3TL 1TXYA 4NB3A 4DR6Q 2WB1G 3KF8B 1WCMG 1Y1VG 1K83H 1VQHA 3PV0A 1Q7YC 4JI7Q 2WFWA 3S17H 2VQEQ 2UXDQ 2IY5B 2ASBA 3TEHB 3RZDH 4BXXH 1IBLL 1P16A 2UXBQ 3H0GG 3NBHB 2R7ZG 4A3IG 4R4CA 4A75A 3PO3H 4HJ5A 1QVCA 5IP9G 3JAMc 2R6GA 1HNZQ 3M4OH 4GKJL 4R4OA 2ZJQA 1UE5A 2ZTDA 2LXJA 3W1BA 2ZTEA 1Q82C 3CPFA 2JA8G 1AE2A 2ALYB 2QEXA 1N32L 1YJ9A 2JEAI 2FXQA 1YI2A 5C4XH 5LMUL 4LNQA 2B3GA 4NPSA 1XMQL 3HOZG 1KHIA 4R4IA 1NMGA 1XPOA 4HJ7A 1A62A 3OTOQ 1VQ4A 1N34L 2OWOA 2NVXH 1B8AA 1Z47A 2N78A 1L0WA 2D0PA 2JJQA 2XTIA 2OTLA 4IOAA 4DPGA 1KAWA 5IY0A 3J81c 5LMNQ 5C0XG 4BA2I 4P75A 3AFPA 4LWCA 4RG1A 4DV6L 4BY1G 4LFAL 1I50H 2JA7H 1ASYA 3W1GA 5C3EH 2PQAB 4A93G 1LUZA 3STBC 1U0LA 3CD6A 2WAQG 2N49A 2NVYH 1A0IA 1YITA 1N36Q 2YTXA 3L0OA 1YJNA 3M4PA 1YEZA 3GTGH 4K0KQ 2CWPA 4HJ9A 2RF4A 3GTMH 4IFDI 3S24A 5IE8A 3UE1A 2E2HH 3CQZH 1W3SA 4UY8C 3HKZG 1J5EL 4A3BG 3M3YH 4PG3A 1BVSA 2Z6KA 2VY3A 4BBRH 2JEBI 1QZGA 1EIFA 1NE3A 1OXSC 3CC2A 1MKHA 1OXTA 4HJAA 4LF7Q 4TQUS 4LFCQ 2R93G 2VUMH 1QVFA 1C0AA 1VQEA 4A4IA 1QZHA 2AWOA 1P8LA 2PQAA 3CCMA 2I0QA 1IL2A 3OTOL 1U5KA 1I3QH 1NBWA 5IT9c 4PZ6A 2YU9H 4NXNL 4JI8L 1K73C 3T1HL 3S2HH 1HR0W 3L7ZC 1JJ2A 4YCWA 1UWVA 1YHAA 2WP8J 4GOPC 1PVOA 2ZTCA 4JOIC 3BJUA 2A1AA 2E8GA 3DLLA 4A3CH 1AH9A 4WJ4A 4DV7Q 5FJ8H 1JE5A 3EBEA 3HOUH 1B70B 3ULPA 4DKAC 3K7AH 2QA4A 1Y1VH 1VQMA 4UPAA 4HIDA 1N36L 4UP7A 3GTOH 2NZOA 5AJ3L 4K0KL 1NTGA 1QVGA 4IFDG 3K0XA 4LF6Q 2VL6A 2R7ZH 1CSQA 5GQOA 4JI2Q 4LF4Q 3KLWA 5IP9H 1UE6A 3K80C 5FLMG 1PH4A 1IBML 3PO2G 4LFCL 3I55A 1E1OA 4C2MH 2ES2A 3T1YQ 1WI5A 2JA8H 4JI0Q 1VS0A 1HZAA 2C35B 1HNXQ 3OW2A 4HIMA 1C9OA 3G48A 3PF5A 3I4NG 4IPCA 4DV1Q 4BY7G 3NENA 5FLXc 2Y0SG 1HZCA 1CKOA 1L2FA 3HKSA 3HOZH 1IXRA 3M9BA 3CAMA 2MO1A 1LTLA 1VQOA 1M1KC 4MTNA 3JC66 4J15A 1RIPA 1X56A 3K81C 4IJLA 2UUAQ 1LYLA 5M5YH 4BA1I 5IP7G 5GAEC 1EQQA 1Q46A 2HQLA 4GLVB 5ELNA 4DR3Q 4BY1H 4Y7NH 3RNUA 2N3SA 1Q86C 4YWKA 1V1QA 2R7FA 2IT1A 2YTVA 1XPUA 3CCRA 5LMNW 3AEVA 3ZJYC 2B29A 2OCEA 3GDEA 4JI1Q 5LMUQ 1VQKA 5IYCH 4LF8Q 4LF6L 1SROA 1Q8KA 1N33L 1XMQQ 1YHQA 4HJ8A 4PZ8A 1YJWA 4POGA 4R4TA 3I2ZA 3CC7A 2VNUD 4A3BH 3AYHB 3CCSA 3LGJA 3KYHC 4JI0L 3PUVA 1HNXL 2R93H 2F4VL 2K75A 1UE7A 1VQIA 5C0XI 2UUBL 1BBUA 1JT8A 3PGZA 3RN2A 4LFAQ 4YWLA 3D31A 3CCVA 4A3KH 3TQYA 1CKNB 3AQQA 4B3RQ 1HZ9A 2Q2IA 2UUAL 1WJJA 3M4QA 3ICEA 4A3GG 2Z0SA 1OTCA 2Q2UA 1PFSA 3HOXH 3S16H 3GTPH 4DR3L 2VQFQ 2BH8A 3RN5A 1G6PA 5JJKA 1J5EQ 2PI2A 4AIMA 1SFOH 2E5LL 3S1MH 3HOVH 1D8LA 4JI4Q 3I4MG 4A3DG 2IHEA 3A74A 1OXVA 2NZHA 4DR5Q 1DGSA 1I5FA 4JI1L 4LF8L 3HOYG 1VQ5A 1TWGH 1IYJB 1E24A 3MXNB 1A63A 2PI2E 1CKNA 2IX0A 4NXML 1VQ8A 3S1RH 2HT1A 1JJCB 1S3OA 2CWAA 2DUDA 3ERSX 4DR4Q 4NXNQ 3KF6B 4XIGS 4JI8Q 5M3MG 5FLMH 3CP0A 3J81j 3PO2H 5M5XH 3T1HQ 2E2JH 3CCLA 1X3EA 3PUWA 1Y1WG 4H02A 4JBJA 4DAYB 3F1ZA 2E2IH 3J7A5 3FP9A 1IZ6A 1OXUA 3ULLA 1UEBA 1PHJA 4OXPA 1S72A 3PIOA 4A3MH 1X65A 4RMFA 4B3RL 1HZBA 2K5NA 2JA6G 3CC4A 4GKKQ 4LFBL 4LF5Q 5C44G 1K8AC 5AJ3Q 5M3FH 4A76A 1K9MC 1K3RA 3U50C 3UDGA 2B63G 2VQFL 1PH3A 3KF6A 3KFUA 1E7ZA 2ZJPA 1SE8A 4QIWE 3J80i 1IBMQ 4DV2Q 4JI4L 1WOCA 1EIYB 4UP8A 4DR5L 4JCVE 2K52A 3E9HA 3CMEA 4P74A 4GOPB 1HNWQ 3D0FA 1EYGA 2EIFA 1L1OB 2PNHA 4YY3L 3RLOA 3GD7A 4DR4L 3PUYA 2AHOB 4AYBE 1XTDA 1S40A 2N8NA 1KC8C 1A8VA 1JB7A 3U58A 1XNRL 3EN2A 3NEMA 1JJGA 1EQRA 3GTQH 5GAHC 1M90C 4JBWA 1WCMH 4JC0A 4GOPA 1IBKQ 1XNQL 4GKKL 4P71A 1NY4A 4YCUA 5JEAJ 3UDXA 4LF5L 4A3LG 1L1OA 4L5QA 2VZAA 3S2DH 3H0GH 3DM3A 4P73A 2BA0A 4DV3Q 4A3IH 3AFQA 5GADC 1N8RC 1VQ7A 1Q81C 1PH1A 4AH6A 1N33Q 1LM0A 1RL2A 1SR3A 1VQJA 5IYDG 2RCNA 4DV2L 4DV0Q 4GN3B 2JA9A 4GLAC 1V43A 3PO3G 4GLXA 3I4MH 3CMAA 4A3DH 5E7NA 1HNWL 2OQKA 4DV4L 1KRTA 4IOCA 2F4VQ 5GROA 2UUBQ 1G291 1TWCH 2BA1A 2K14A 1GD7A 3U4ZA 1E3PA 3WWVA 4JV5L 1FGUA 3G4SA 1EOVA 2GVBA 1QUQB 2DGYA 1TWAH 2OQ0A 1I94Q 1WYDA 5M3MH 4GN4B 5IWAQ 3F2DA 2NVTH 1Y1WH 3EIVA 4B3SQ 4BBSG 2LXKA 4X6AH 4GNXB 4DNIA 2XGTA 1MJEA 2UU9Q 4X64Q 1FL0A 1Q1EA 4R4QA 3F8TA 3K7UC 3U4VA 1IBKL 1JMCA 2E5LQ 3CPWA 4A93H 2HIVA 1YHBA 1K0RA 4ME3A 4DR1L 2GN5A 2JA6H 2JA7G 1CKMA 5C44H 4JG2A 2KHJA 3CCEA 1I6HH 4OWTB 4IPGA 4DV3L 4LF9L 1QUQA 2K5VA 3FHWA 3G71A 1GO3E 3I4OA 2CQOA 3OYYA 1YIJA 4NXMQ 2R92G 1YBYA 4DV0L 3CCUA 4OWXB 3KDFB 4DUZQ 1HH2P 4A3JG 5JJIA 1XMOL 4GS3A 3BZKA 4GNXA 1V9PA 2ID0A 4BBRG 4LUOA 3GTLH 3UDIA 1NJIC 2RHQB 1KXLA 2KHIA 2WB1E 4LUZA 3S15H 4QQBX 3MEFA 2UXCL 4OX9Q 3KJPA 3A5UA 1I94L 1PH7A 2LSSA 2IHFA 5IWAL 4LFBQ 2NN6I 1SN8A 1VQNA 5HGQA 3F2CA 4B3SL 4R1JA 1EUJA 3S1QH 3I7FA 1TWFH 4KI0A 3GO5A 2UU9L 4KHPQ 1B7YB 4X64L 1FJGQ 1N9WA 2D0OA 1SRUA 3UDFA 5GAGC 4IJHA 5M5WH 3ULJA 4PMWA 4O2DA 2JA5G 1Y14B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W2B A;  4A3L H;  4ALP A;  4QL5 A;  5H1S E;  4YY3 Q;  5IYB G;  2AKW B;  3M85 A;  1VQL A;  1PV4 A;  1Q12 A;  4DUZ L;  4HIO A;  1C7Y A;  3KOJ A;  4JI3 L;  5IYD H;  3J7Z C;  4KHZ A;  3J80 c;  2AWN A;  1R9T H;  2ATW A;  4A3F G;  1VQ6 A;  2NVQ H;  3GTJ H;  4OO1 I;  2MO0 A;  5ELO A;  1O7I A;  5BR8 L;  5C4J H;  3A0J A;  1XNR Q;  4JYA L;  3I4N H;  2KCM A;  4BY7 H;  3CW2 C;  3PUX A;  4OX9 L;  1PH8 A;  4Y52 H;  1HR0 L;  3H3V I;  2WAQ E;  1XNQ Q;  4DAM A;  2NN6 G;  3PCO B;  4LW1 A;  3NEL A;  1EWI A;  4X62 Q;  2F52 A;  4C3J H;  3H15 A;  3W5O A;  5IP7 H;  3PF4 A;  4BBS H;  2YYZ A;  2OTJ A;  4WJ3 M;  1X3G A;  4KHP L;  1KD1 C;  2JE6 I;  1BBW A;  3HKZ E;  1FJG L;  1OXX K;  2L15 A;  1E22 A;  2JQO A;  3CF5 A;  2PMZ E;  3PSI A;  4JI5 Q;  3JAM i;  4JI6 L;  2BH2 A;  2RHS B;  4X65 Q;  3CCQ A;  1X9N A;  1PYS B;  4TVA B;  2HHH Q;  2UUC L;  4DR6 L;  3GTK H;  4DV4 Q;  4A3E G;  3L2P A;  1SLJ A;  3ER0 A;  4JI7 L;  2UXD L;  2VQE L;  4JV5 Q;  2R92 H;  2Z6K C;  5JEA G;  1G51 A;  4AQY Q;  3VDY A;  2UXB L;  1PH2 A;  5IYC G;  1NMF A;  3TS2 A;  4A3J H;  1T9H A;  4KLK A;  4LUV A;  4OO1 G;  5C0X J;  1HNZ L;  4APV A;  4FDB A;  1MJC A;  4L5S A;  1KL9 A;  4YCV A;  4C3I H;  1TWH H;  3J81 i;  1CUK A;  4POF A;  1D7Q A;  1EFW A;  1GKH A;  4MZ9 A;  2GVA A;  1VQD A;  3HOW G;  3S1N H;  2QGQ A;  1YVC A;  2R7D A;  2AMC B;  2VS1 A;  3FKI G;  4JOI A;  4MNO A;  3STB D;  4EQ5 A;  2EXD A;  4QGU A;  1PA6 A;  3Q8D A;  1UE1 A;  3F2B A;  4X62 L;  2YTY A;  4DV5 Q;  4DR1 Q;  4A3G H;  4A3K G;  2IX1 A;  1GM5 A;  1WFQ A;  3HFZ B;  4LF9 Q;  2K4K A;  4X66 Q;  1XPR A;  4XTC S;  4AYB G;  2CFM A;  1VQ9 A;  1X54 A;  2D62 A;  3I56 A;  1KIX A;  2A19 A;  4JI5 L;  4BXX G;  2HIX A;  4DR7 Q;  3UE0 A;  4X65 L;  5LMN L;  4EX5 A;  3HOX G;  3PIP A;  1J6Q A;  4IO9 A;  1XMO Q;  2HHH L;  1L1O C;  1E1T A;  2JA5 H;  2Q2T A;  1KRS A;  4YHH Q;  2K50 A;  3HOY H;  3HOV G;  4GN5 A;  2Y0S E;  3KJO A;  1VQC A;  4IPD A;  4YWM A;  4O0A A;  3A5Z B;  5IYB H;  4JBK A;  4AQY L;  5C4X G;  1SMX A;  4L5R C;  2UXC Q;  1VQP A;  1XJV A;  1MIU A;  2CCZ A;  4DR2 Q;  1PH6 A;  1K8G A;  2MFI A;  1VQG A;  4A3F H;  4UP9 A;  1Z9F A;  2KBN A;  1Q1B A;  2I5L X;  2K5H A;  2Q2H A;  2YV5 A;  1CSP A;  4DK6 C;  4LF7 L;  3M7N A;  1YZ6 A;  3PUZ A;  1VQA A;  3BZC A;  4OON A;  2ZJR A;  2ZM6 Q;  2H5X A;  1VQF A;  2V1C C;  4DV5 L;  2EQS A;  1HJP A;  5C3E G;  1ASZ A;  4IFD J;  1FVI A;  1VCI A;  4A3M G;  3E0E A;  4DUY Q;  4B3M Q;  1X6O A;  4B3T Q;  4X66 L;  2B63 H;  3SGI A;  3BU2 A;  4JBM A;  5J3B A;  4DR7 L;  5JJL A;  1KQS A;  1H95 A;  5M3F G;  4JI3 Q;  1IBL Q;  5DLQ E;  3CCJ A;  4PZ7 A;  3CXC A;  1X55 A;  4DV7 L;  3TRZ A;  3RLN A;  4DK3 C;  4YHH L;  4GKJ Q;  4QY7 A;  5BR8 Q;  3RLF A;  2VW9 A;  4A3E H;  4JYA Q;  2JK8 A;  1PYB A;  4IPH A;  4L5T A;  2VUM G;  5HY6 A;  1N32 Q;  4OWW B;  1HR0 Q;  2I5M X;  1BKB A;  4DR2 L;  5EAY A;  1VQB A;  2MQH A;  1GVP A;  3K8A A;  2I5H A;  4JI2 L;  4GNX C;  2KEN A;  4LF4 L;  3RR5 A;  1AE3 A;  2A8V A;  3B6Y A;  3TRE A;  2KCT A;  2MNA A;  1N34 Q;  3KDF A;  3RZO H;  4HIK A;  3T1Y L;  2F3I A;  3S14 H;  5K36 G;  4QJF A;  4JI6 Q;  4P72 A;  2ZM6 L;  4A3C G;  1YNX A;  3TS0 A;  3H3V H;  3IRB A;  3HOW H;  2CKZ B;  3E9I A;  4DV1 L;  5FJ8 G;  3HOU G;  3FKI H;  1X3F A;  1PH5 A;  3G6E A;  1PH9 A;  4C3H H;  4DV6 Q;  2UUC Q;  4DUY L;  4B3M L;  4B3T L;  1TXY A;  4NB3 A;  4DR6 Q;  2WB1 G;  3KF8 B;  1WCM G;  1Y1V G;  1K83 H;  1VQH A;  3PV0 A;  1Q7Y C;  4JI7 Q;  2WFW A;  3S17 H;  2VQE Q;  2UXD Q;  2IY5 B;  2ASB A;  3TEH B;  3RZD H;  4BXX H;  1IBL L;  1P16 A;  2UXB Q;  3H0G G;  3NBH B;  2R7Z G;  4A3I G;  4R4C A;  4A75 A;  3PO3 H;  4HJ5 A;  1QVC A;  5IP9 G;  3JAM c;  2R6G A;  1HNZ Q;  3M4O H;  4GKJ L;  4R4O A;  2ZJQ A;  1UE5 A;  2ZTD A;  2LXJ A;  3W1B A;  2ZTE A;  1Q82 C;  3CPF A;  2JA8 G;  1AE2 A;  2ALY B;  2QEX A;  1N32 L;  1YJ9 A;  2JEA I;  2FXQ A;  1YI2 A;  5C4X H;  5LMU L;  4LNQ A;  2B3G A;  4NPS A;  1XMQ L;  3HOZ G;  1KHI A;  4R4I A;  1NMG A;  1XPO A;  4HJ7 A;  1A62 A;  3OTO Q;  1VQ4 A;  1N34 L;  2OWO A;  2NVX H;  1B8A A;  1Z47 A;  2N78 A;  1L0W A;  2D0P A;  2JJQ A;  2XTI A;  2OTL A;  4IOA A;  4DPG A;  1KAW A;  5IY0 A;  3J81 c;  5LMN Q;  5C0X G;  4BA2 I;  4P75 A;  3AFP A;  4LWC A;  4RG1 A;  4DV6 L;  4BY1 G;  4LFA L;  1I50 H;  2JA7 H;  1ASY A;  3W1G A;  5C3E H;  2PQA B;  4A93 G;  1LUZ A;  3STB C;  1U0L A;  3CD6 A;  2WAQ G;  2N49 A;  2NVY H;  1A0I A;  1YIT A;  1N36 Q;  2YTX A;  3L0O A;  1YJN A;  3M4P A;  1YEZ A;  3GTG H;  4K0K Q;  2CWP A;  4HJ9 A;  2RF4 A;  3GTM H;  4IFD I;  3S24 A;  5IE8 A;  3UE1 A;  2E2H H;  3CQZ H;  1W3S A;  4UY8 C;  3HKZ G;  1J5E L;  4A3B G;  3M3Y H;  4PG3 A;  1BVS A;  2Z6K A;  2VY3 A;  4BBR H;  2JEB I;  1QZG A;  1EIF A;  1NE3 A;  1OXS C;  3CC2 A;  1MKH A;  1OXT A;  4HJA A;  4LF7 Q;  4TQU S;  4LFC Q;  2R93 G;  2VUM H;  1QVF A;  1C0A A;  1VQE A;  4A4I A;  1QZH A;  2AWO A;  1P8L A;  2PQA A;  3CCM A;  2I0Q A;  1IL2 A;  3OTO L;  1U5K A;  1I3Q H;  1NBW A;  5IT9 c;  4PZ6 A;  2YU9 H;  4NXN L;  4JI8 L;  1K73 C;  3T1H L;  3S2H H;  1HR0 W;  3L7Z C;  1JJ2 A;  4YCW A;  1UWV A;  1YHA A;  2WP8 J;  4GOP C;  1PVO A;  2ZTC A;  4JOI C;  3BJU A;  2A1A A;  2E8G A;  3DLL A;  4A3C H;  1AH9 A;  4WJ4 A;  4DV7 Q;  5FJ8 H;  1JE5 A;  3EBE A;  3HOU H;  1B70 B;  3ULP A;  4DKA C;  3K7A H;  2QA4 A;  1Y1V H;  1VQM A;  4UPA A;  4HID A;  1N36 L;  4UP7 A;  3GTO H;  2NZO A;  5AJ3 L;  4K0K L;  1NTG A;  1QVG A;  4IFD G;  3K0X A;  4LF6 Q;  2VL6 A;  2R7Z H;  1CSQ A;  5GQO A;  4JI2 Q;  4LF4 Q;  3KLW A;  5IP9 H;  1UE6 A;  3K80 C;  5FLM G;  1PH4 A;  1IBM L;  3PO2 G;  4LFC L;  3I55 A;  1E1O A;  4C2M H;  2ES2 A;  3T1Y Q;  1WI5 A;  2JA8 H;  4JI0 Q;  1VS0 A;  1HZA A;  2C35 B;  1HNX Q;  3OW2 A;  4HIM A;  1C9O A;  3G48 A;  3PF5 A;  3I4N G;  4IPC A;  4DV1 Q;  4BY7 G;  3NEN A;  5FLX c;  2Y0S G;  1HZC A;  1CKO A;  1L2F A;  3HKS A;  3HOZ H;  1IXR A;  3M9B A;  3CAM A;  2MO1 A;  1LTL A;  1VQO A;  1M1K C;  4MTN A;  3JC6 6;  4J15 A;  1RIP A;  1X56 A;  3K81 C;  4IJL A;  2UUA Q;  1LYL A;  5M5Y H;  4BA1 I;  5IP7 G;  5GAE C;  1EQQ A;  1Q46 A;  2HQL A;  4GLV B;  5ELN A;  4DR3 Q;  4BY1 H;  4Y7N H;  3RNU A;  2N3S A;  1Q86 C;  4YWK A;  1V1Q A;  2R7F A;  2IT1 A;  2YTV A;  1XPU A;  3CCR A;  5LMN W;  3AEV A;  3ZJY C;  2B29 A;  2OCE A;  3GDE A;  4JI1 Q;  5LMU Q;  1VQK A;  5IYC H;  4LF8 Q;  4LF6 L;  1SRO A;  1Q8K A;  1N33 L;  1XMQ Q;  1YHQ A;  4HJ8 A;  4PZ8 A;  1YJW A;  4POG A;  4R4T A;  3I2Z A;  3CC7 A;  2VNU D;  4A3B H;  3AYH B;  3CCS A;  3LGJ A;  3KYH C;  4JI0 L;  3PUV A;  1HNX L;  2R93 H;  2F4V L;  2K75 A;  1UE7 A;  1VQI A;  5C0X I;  2UUB L;  1BBU A;  1JT8 A;  3PGZ A;  3RN2 A;  4LFA Q;  4YWL A;  3D31 A;  3CCV A;  4A3K H;  3TQY A;  1CKN B;  3AQQ A;  4B3R Q;  1HZ9 A;  2Q2I A;  2UUA L;  1WJJ A;  3M4Q A;  3ICE A;  4A3G G;  2Z0S A;  1OTC A;  2Q2U A;  1PFS A;  3HOX H;  3S16 H;  3GTP H;  4DR3 L;  2VQF Q;  2BH8 A;  3RN5 A;  1G6P A;  5JJK A;  1J5E Q;  2PI2 A;  4AIM A;  1SFO H;  2E5L L;  3S1M H;  3HOV H;  1D8L A;  4JI4 Q;  3I4M G;  4A3D G;  2IHE A;  3A74 A;  1OXV A;  2NZH A;  4DR5 Q;  1DGS A;  1I5F A;  4JI1 L;  4LF8 L;  3HOY G;  1VQ5 A;  1TWG H;  1IYJ B;  1E24 A;  3MXN B;  1A63 A;  2PI2 E;  1CKN A;  2IX0 A;  4NXM L;  1VQ8 A;  3S1R H;  2HT1 A;  1JJC B;  1S3O A;  2CWA A;  2DUD A;  3ERS X;  4DR4 Q;  4NXN Q;  3KF6 B;  4XIG S;  4JI8 Q;  5M3M G;  5FLM H;  3CP0 A;  3J81 j;  3PO2 H;  5M5X H;  3T1H Q;  2E2J H;  3CCL A;  1X3E A;  3PUW A;  1Y1W G;  4H02 A;  4JBJ A;  4DAY B;  3F1Z A;  2E2I H;  3J7A 5;  3FP9 A;  1IZ6 A;  1OXU A;  3ULL A;  1UEB A;  1PHJ A;  4OXP A;  1S72 A;  3PIO A;  4A3M H;  1X65 A;  4RMF A;  4B3R L;  1HZB A;  2K5N A;  2JA6 G;  3CC4 A;  4GKK Q;  4LFB L;  4LF5 Q;  5C44 G;  1K8A C;  5AJ3 Q;  5M3F H;  4A76 A;  1K9M C;  1K3R A;  3U50 C;  3UDG A;  2B63 G;  2VQF L;  1PH3 A;  3KF6 A;  3KFU A;  1E7Z A;  2ZJP A;  1SE8 A;  4QIW E;  3J80 i;  1IBM Q;  4DV2 Q;  4JI4 L;  1WOC A;  1EIY B;  4UP8 A;  4DR5 L;  4JCV E;  2K52 A;  3E9H A;  3CME A;  4P74 A;  4GOP B;  1HNW Q;  3D0F A;  1EYG A;  2EIF A;  1L1O B;  2PNH A;  4YY3 L;  3RLO A;  3GD7 A;  4DR4 L;  3PUY A;  2AHO B;  4AYB E;  1XTD A;  1S40 A;  2N8N A;  1KC8 C;  1A8V A;  1JB7 A;  3U58 A;  1XNR L;  3EN2 A;  3NEM A;  1JJG A;  1EQR A;  3GTQ H;  5GAH C;  1M90 C;  4JBW A;  1WCM H;  4JC0 A;  4GOP A;  1IBK Q;  1XNQ L;  4GKK L;  4P71 A;  1NY4 A;  4YCU A;  5JEA J;  3UDX A;  4LF5 L;  4A3L G;  1L1O A;  4L5Q A;  2VZA A;  3S2D H;  3H0G H;  3DM3 A;  4P73 A;  2BA0 A;  4DV3 Q;  4A3I H;  3AFQ A;  5GAD C;  1N8R C;  1VQ7 A;  1Q81 C;  1PH1 A;  4AH6 A;  1N33 Q;  1LM0 A;  1RL2 A;  1SR3 A;  1VQJ A;  5IYD G;  2RCN A;  4DV2 L;  4DV0 Q;  4GN3 B;  2JA9 A;  4GLA C;  1V43 A;  3PO3 G;  4GLX A;  3I4M H;  3CMA A;  4A3D H;  5E7N A;  1HNW L;  2OQK A;  4DV4 L;  1KRT A;  4IOC A;  2F4V Q;  5GRO A;  2UUB Q;  1G29 1;  1TWC H;  2BA1 A;  2K14 A;  1GD7 A;  3U4Z A;  1E3P A;  3WWV A;  4JV5 L;  1FGU A;  3G4S A;  1EOV A;  2GVB A;  1QUQ B;  2DGY A;  1TWA H;  2OQ0 A;  1I94 Q;  1WYD A;  5M3M H;  4GN4 B;  5IWA Q;  3F2D A;  2NVT H;  1Y1W H;  3EIV A;  4B3S Q;  4BBS G;  2LXK A;  4X6A H;  4GNX B;  4DNI A;  2XGT A;  1MJE A;  2UU9 Q;  4X64 Q;  1FL0 A;  1Q1E A;  4R4Q A;  3F8T A;  3K7U C;  3U4V A;  1IBK L;  1JMC A;  2E5L Q;  3CPW A;  4A93 H;  2HIV A;  1YHB A;  1K0R A;  4ME3 A;  4DR1 L;  2GN5 A;  2JA6 H;  2JA7 G;  1CKM A;  5C44 H;  4JG2 A;  2KHJ A;  3CCE A;  1I6H H;  4OWT B;  4IPG A;  4DV3 L;  4LF9 L;  1QUQ A;  2K5V A;  3FHW A;  3G71 A;  1GO3 E;  3I4O A;  2CQO A;  3OYY A;  1YIJ A;  4NXM Q;  2R92 G;  1YBY A;  4DV0 L;  3CCU A;  4OWX B;  3KDF B;  4DUZ Q;  1HH2 P;  4A3J G;  5JJI A;  1XMO L;  4GS3 A;  3BZK A;  4GNX A;  1V9P A;  2ID0 A;  4BBR G;  4LUO A;  3GTL H;  3UDI A;  1NJI C;  2RHQ B;  1KXL A;  2KHI A;  2WB1 E;  4LUZ A;  3S15 H;  4QQB X;  3MEF A;  2UXC L;  4OX9 Q;  3KJP A;  3A5U A;  1I94 L;  1PH7 A;  2LSS A;  2IHF A;  5IWA L;  4LFB Q;  2NN6 I;  1SN8 A;  1VQN A;  5HGQ A;  3F2C A;  4B3S L;  4R1J A;  1EUJ A;  3S1Q H;  3I7F A;  1TWF H;  4KI0 A;  3GO5 A;  2UU9 L;  4KHP Q;  1B7Y B;  4X64 L;  1FJG Q;  1N9W A;  2D0O A;  1SRU A;  3UDF A;  5GAG C;  4IJH A;  5M5W H;  3ULJ A;  4PMW A;  4O2D A;  2JA5 G;  1Y14 B; 
#chains in the Genus database with same CATH topology
 1W2B A;  4ALP A;  3QO2 A;  3I4L A;  5EGT A;  3DEO A;  3M85 A;  1T5E A;  4HAE A;  5IGC A;  5IYD H;  4RKB A;  2F0F A;  3S15 B;  4A3F G;  3M7G A;  3NE5 B;  3ND9 A;  5ELO A;  2PO4 A;  3KK7 A;  4JYA L;  2KEE A;  3PUX A;  4E6I A;  4OX9 L;  3Q6S A;  2K32 A;  1TWF B;  1XTC D;  1XNQ Q;  4DAM A;  1UEA B;  5M5W B;  4C3J H;  2LKV A;  1KD1 C;  2HCI A;  1BBW A;  2JE6 I;  4LK1 C;  3CF5 A;  4FXK C;  1E22 A;  1G6Z A;  4JI5 Q;  1VMC A;  4XYQ A;  4BWG B;  1VMP A;  3I72 A;  4A3E G;  4NKL A;  1HA5 A;  1SLJ A;  1DCZ A;  2UXD L;  1ILP A;  2DJG C;  2R92 H;  3BDL A;  2Z6K C;  4AQY Q;  4XQJ A;  1KLU D;  5IYC G;  1SND A;  4CDD C;  4LUV A;  4OO1 G;  3V05 A;  3NWT A;  3DHQ A;  4FDB A;  3TP8 A;  2L55 A;  3TZD A;  4C3I H;  1S5D D;  5ELD A;  1D7Q A;  4RH6 A;  1STG A;  1SSO A;  4C3J B;  3HOW G;  1YVC A;  4L8J A;  1PA6 A;  2KCC A;  1X3Q A;  2EXD A;  4C3H G;  1HUM A;  4A3K G;  2B2T A;  4LF9 Q;  1EU4 A;  1XPR A;  4XTC S;  4AYB G;  2F0N A;  4BXX G;  4DR7 Q;  2A19 A;  4JI5 L;  3T4A C;  5LMN L;  1HA6 A;  4LMQ D;  1J6Q A;  1KDC A;  1L1O C;  2R92 B;  1KRS A;  5IOC A;  5DM7 3;  1WTR A;  1WTP A;  4GN5 A;  2Y0S E;  1CZG A;  1VDZ A;  3A5Z B;  4AQY L;  5C4X G;  4L5R C;  1SE4 A;  1EEI D;  1VQP A;  4C3I B;  3I3C A;  4DR2 Q;  1VQG A;  1F9S A;  3MWY W;  1NR4 A;  1QWY A;  3OSO A;  1Q1B A;  1CSP A;  2O4X A;  2JN4 A;  1KLG D;  3WDN A;  3E0E A;  4OEL B;  2F0M A;  4OEM B;  4B3T Q;  2B63 H;  4RGO S;  4DR7 L;  3TBI B;  3TP7 A;  2JXM B;  1D5Z C;  4PZ7 A;  4DV7 L;  3RLN A;  4DK3 C;  1EY9 A;  4GKJ Q;  4QY7 A;  3RLF A;  1R4Q B;  3QR8 A;  2JK8 A;  3C3L A;  4KKS A;  4DR2 L;  4KHV A;  3ND8 A;  4LF4 L;  3RR5 A;  2A8V A;  3TRE A;  2KCT A;  2OXP A;  5ELB A;  5K36 G;  4QJF A;  1LTI D;  2KOL A;  4K8I A;  3TS0 A;  1J9O A;  2B63 B;  3H3V H;  2CKZ B;  2P5Z X;  3E9I A;  1GUO A;  4DV1 L;  3MC0 B;  5JPN C;  4B3T L;  1TXY A;  1B3Q A;  1Y1V G;  3LNN A;  3H94 A;  3PV0 A;  4JI7 Q;  2VQE Q;  2ASB A;  2F0T A;  2A74 C;  3H0G G;  3NBH B;  3NTI A;  4R4C A;  2JSO A;  3JAM c;  4GKJ L;  3K0Y A;  1UE5 A;  2RKS A;  2RSN A;  2LXJ A;  3V96 A;  2ZTE A;  2JA8 G;  2QEX A;  1Y8P B;  1DOK A;  1QIL A;  1RD9 D;  3D4W A;  3C1F A;  3E6Z X;  3OWF A;  3OIP A;  3SK5 A;  2O5J C;  1XMQ L;  1KHI A;  2K5Q A;  1A62 A;  4UDU C;  5DAU A;  5A2Q L;  5CMD A;  2OWO A;  1HTP A;  2NVX H;  2JJQ A;  5KNC A;  4DPG A;  1XYI A;  1LV9 A;  4BA2 I;  4CKE A;  1K3B C;  4BY1 G;  5JJZ A;  4LFA L;  1WTO A;  2KCN A;  3R2I A;  2PQA B;  3CD6 A;  2WAQ G;  2N49 A;  1A0I A;  2Z6B A;  1EY5 A;  3L0O A;  1YJN A;  1CQV A;  3M4P A;  1AP0 A;  2X6L A;  4K8J A;  4HJ9 A;  3GTM H;  1YNJ C;  3S24 A;  5IE8 A;  4UY8 C;  3CQZ H;  1LAC A;  1J5E L;  1I6V C;  4PG3 A;  1BVS A;  2VY3 A;  3CC2 A;  4LFC Q;  2VUM H;  2A5H A;  1QVF A;  2EYM A;  1H9M A;  4ZUJ A;  4UAI A;  2NVX B;  1PTO C;  1IL2 A;  1U5K A;  1EOT A;  1NBW A;  5IT9 c;  2YU9 H;  2EY1 A;  4NXN L;  4JI8 L;  1PRT C;  3T1H L;  3S2H H;  1BOS A;  1HR0 W;  1YHA A;  5EKI A;  2NWG A;  1T5X D;  1S4Z A;  4EVO A;  1TR5 A;  1AH9 A;  4HMI A;  4WJ4 A;  5CR3 A;  3ULP A;  3QB3 A;  1JC7 A;  3GTM B;  2QA4 A;  3CQZ B;  4HID A;  3IFT A;  1Y69 U;  1QVG A;  2B8F A;  3K0X A;  4LF6 Q;  1CSQ A;  2VUM B;  1F2Z A;  3K80 C;  5FLM G;  4LFC L;  5I9O A;  1E1O A;  1U4M A;  4C2M H;  2YU9 B;  3EA6 A;  2DY8 A;  1HNX Q;  2C5C A;  3OW2 A;  4J1M A;  3I4N G;  3S2H B;  4ABN A;  5FLX c;  3HKS A;  3HOZ H;  2XIW A;  1IXR A;  5FO9 B;  4JK1 C;  2XN9 C;  3QG1 A;  1RIP A;  3ONA B;  1G91 A;  1LTS D;  2PQE A;  5GAE C;  1I4G A;  4IUV A;  4DR3 Q;  3RNU A;  1AZP A;  3A7L A;  4YWK A;  1V1Q A;  5K5P A;  2R7F A;  4ZLT F;  2HD3 A;  1XPU A;  2A68 D;  3MXP A;  2CH4 W;  4C2M B;  5IYC H;  4LF6 L;  1ESR A;  1K0S A;  1IL8 A;  4PZ8 A;  5F2D A;  5NUC A;  3CCS A;  4OIJ A;  1LTB D;  3HOZ B;  1C4Q A;  3DEP A;  1HNX L;  1B53 A;  2J4X A;  1Q3L A;  4N8X 1;  5EPL A;  4ZYS A;  2F3W A;  4A3K H;  3NQT A;  1HFG A;  5CV8 A;  5AFW A;  3KBX A;  1SE3 A;  4X3K A;  3ICE A;  2EJM A;  2Q2U A;  3C46 A;  1U4L A;  2WV6 D;  3GTP H;  4DR3 L;  2VQF Q;  2BH8 A;  1G6P A;  1CFM A;  3NPP A;  2IHE A;  1B9M A;  2A6H D;  4DR5 Q;  1Q8I A;  1VQ5 A;  1IYJ B;  5E4W C;  1MD2 D;  1CKN A;  2IX0 A;  1X3P A;  3S1R H;  2HT1 A;  1JJC B;  2Z4H A;  3ERS X;  3NTK A;  2CHB D;  2E2J H;  4A3K B;  3H91 A;  1IYV A;  1U4P A;  2F0J A;  3J7A 5;  3FP9 A;  3ULL A;  2QDL A;  1EU3 A;  1S72 A;  1U4R A;  4V19 0;  3GTP B;  2PCF B;  4ULL A;  4R8I A;  2XWJ B;  1DM0 B;  1K9M C;  3UDG A;  2VQF L;  4ODG A;  1XWE A;  1ZEQ X;  1RCV D;  4QIW E;  3J80 i;  4DV2 Q;  1EIY B;  4DAY A;  4DR5 L;  3S1R B;  1QOH A;  4JCV E;  3CME A;  3NQI A;  2IW3 A;  3D0F A;  1EYG A;  5ISR A;  1L1O B;  2E2J B;  3PUY A;  4Z9C B;  2AQ3 B;  5KYL A;  1FYC A;  5K36 H;  1WD1 A;  1XNR L;  3EN2 A;  3VR2 A;  1TS2 A;  3QIA A;  2IPK D;  1HQR D;  4G7H C;  3K5L A;  4B9X A;  4GOP A;  1IBK Q;  4P71 A;  3Q22 A;  1QJO A;  3H0G H;  1N8R C;  2BA0 A;  2EXZ A;  2F3V A;  3AFQ A;  4KTA A;  5GAD C;  3OIQ A;  1LT3 D;  1SR3 A;  1VQJ A;  5IYD G;  4DV2 L;  3MHB A;  4GN3 B;  2EDG A;  1E2V A;  3I4M H;  1XXG A;  4CDC C;  4DV4 L;  3LWU A;  1G29 1;  4F88 A;  2K28 A;  4F87 A;  1E3P A;  3WWV A;  1FGU A;  1DXM A;  1IW7 C;  1PFN A;  5M3M H;  3J80 E;  2O2L D;  3PQI A;  3F2D A;  4C3J G;  4FF2 A;  3EIV A;  4ZKC B;  2QEJ C;  4X6A H;  4TKO B;  2FIN B;  3CRL C;  3NSW A;  3H0G B;  4DNI A;  1MJE A;  1IBK L;  1JMC A;  1YHB A;  4ME3 A;  2JA7 G;  1I6H H;  5D3I B;  4IPG A;  3I4M B;  1GO3 E;  3I4O A;  3OYY A;  4CHT B;  4NXM Q;  2R92 G;  1YBY A;  1GHJ A;  3MAQ A;  3BZD B;  3I91 A;  1I4H A;  1EFI D;  2K05 A;  3J81 L;  3EFX D;  1D6E C;  3L9A X;  3BS1 A;  4GNX A;  3J7A F;  4O1N A;  4C3I G;  5M3M B;  4BBR G;  4LUO A;  3TME A;  3T16 A;  1SBB B;  1JWS D;  4KD3 A;  4HMJ A;  4LFB Q;  1NR2 A;  4RWS C;  5CBA E;  1SNQ A;  3S1Q H;  1AEX A;  2WAQ B;  1E2Z A;  2FMC A;  5EBD A;  2F0I A;  1JQY D;  1FJG Q;  2D0O A;  1I6H B;  1DZ1 A;  4O2D A;  1PTO H;  3PIP 3;  1BCP B;  4A3L H;  5IGG A;  5COY A;  4YY3 Q;  1V1P B;  2AKW B;  4KV6 A;  1C7Y A;  4JI3 L;  4FP5 D;  1VQ6 A;  2XSC A;  3RUZ A;  1QG7 A;  2NVQ H;  3GTJ H;  4OO1 I;  5BN4 A;  3J7A V;  4F8M A;  3ERO A;  5BR8 L;  3A0J A;  3I4N H;  2KCM A;  4MHE A;  2EY2 A;  1O7Y A;  1DON A;  3PCO B;  1S5B D;  5CV5 A;  3PF4 A;  4WJ3 M;  4BBS H;  1PTO B;  2YYZ A;  4HCE A;  1X3G A;  3OMC A;  3HKZ E;  1FJG L;  3KBG A;  1A6X A;  1OXX K;  2BH2 A;  2PMZ E;  3PSI A;  1LT4 D;  1HFN A;  5KEE A;  1CI3 M;  1PYS B;  2IWH A;  1GOZ A;  2HHH Q;  4DR6 L;  3MVV A;  3ER0 A;  3QWN A;  2NVQ B;  3P20 A;  1TS3 A;  3ZYY X;  5C4H A;  3GTJ B;  5JEA G;  3AB9 A;  3I4N B;  4XT3 B;  2MHV A;  1NMF A;  4A3J H;  1T9H A;  4KLK A;  1ESF A;  1HNZ L;  5LL6 X;  1WTQ A;  4L5S A;  4YCV A;  1TWH H;  2E74 C;  3ERQ A;  4MZ9 A;  4BBS B;  2I46 A;  4JOI A;  1UE1 A;  3SK4 A;  4DV5 Q;  3HFZ B;  1J8I A;  2K4K A;  3RD4 A;  1YNJ D;  1VQ9 A;  2CFM A;  2D62 A;  3I56 A;  4CJ2 C;  3UE0 A;  3VYT A;  4EQN A;  4EX5 A;  2HHH L;  4DK0 A;  1E1T A;  2Q2T A;  3D3R A;  4B9W A;  4A3J B;  1PTO D;  4IPD A;  4JBK A;  1LAB A;  1SMX A;  2F4I A;  2Z8L A;  2UXC Q;  2EYH A;  1PRT D;  1TWH B;  1K8G A;  3K5O A;  2K33 A;  3W2D A;  1KDB A;  1Z9F A;  2KBN A;  2I5L X;  2Q2H A;  4DK6 C;  4I7A A;  5JPM C;  1O78 A;  3CU7 A;  1YZ6 A;  4LF7 L;  5CV7 A;  3QJY A;  2V1C C;  4DV5 L;  2EQS A;  1HJP A;  2DN8 A;  1SYF A;  4B3M Q;  1X6O A;  2V4D A;  4PNY A;  3SGI A;  3BU2 A;  2F0O A;  5JJL A;  2MPM A;  1KQS A;  4QB4 A;  3TRZ A;  4JYA Q;  4IPH A;  4L5T A;  1EY6 A;  5CV4 A;  1HPC A;  2VUM G;  2Q8R E;  4JVZ A;  4OWW B;  1BKB A;  2XRQ D;  2MQH A;  2EJG C;  2WKD A;  2KEN A;  1AE3 A;  3B6Y A;  2PNR C;  4K6L A;  3KLR A;  4HIK A;  1DOL A;  3C2P A;  2BOS A;  4FXG C;  4P72 A;  1PXU A;  1STN A;  5CGK A;  3IRB A;  3P75 A;  2MJ8 A;  3G6E A;  4DV6 Q;  4B3M L;  4NB3 A;  4PMB A;  2WB1 G;  1WCM G;  3DMU A;  1VQH A;  2UXD Q;  1F2M A;  1P16 A;  4HSV A;  4A75 A;  4IN3 A;  3M4O H;  2TSS A;  3GQB A;  1HXY D;  1BR9 A;  1O7L A;  1IKL A;  4JW0 A;  5HUR A;  1Q82 C;  1B9N A;  2ALY B;  2K5D A;  1JWM D;  1SEB D;  1EYA A;  2JEA I;  2EYP A;  5LMU L;  1VF5 C;  4TRD A;  4XT1 B;  3HOZ G;  4K2K A;  1XPO A;  4HN7 A;  4XQQ A;  3OTO Q;  2K7V A;  3F2U A;  2N78 A;  3N6R A;  3KLS A;  1KAW A;  1VF7 A;  5LMN Q;  4ILW A;  5C0X G;  4LWC A;  3I70 A;  4DV6 L;  3TP6 A;  2JA7 H;  5C3E H;  4H13 C;  4MIU A;  3STB C;  1U0L A;  3QOL A;  3M4O B;  3HGB A;  1GUN A;  3TP5 A;  3VA7 A;  5A35 A;  3UE1 A;  3K58 A;  2E2H H;  3M3Y H;  4BBR H;  2Z6K A;  2JEB I;  4OGQ C;  1NE3 A;  4FF1 A;  4K14 A;  2HUG A;  4HSP A;  3FPP A;  1VQE A;  3ITP A;  3A55 A;  1P8L A;  3OTO L;  5C3W A;  2JA7 B;  3L7Z C;  1JJ2 A;  3BVZ A;  5C3E B;  1PVO A;  1BF4 A;  4A3C H;  2BDO A;  4DV7 Q;  1JOR A;  1DYQ A;  2E2H B;  5C5L A;  5EPK A;  3M3Y B;  4BBR B;  1NTG A;  1F9Q A;  1K28 A;  5G3L D;  4LF4 Q;  2RDF A;  5IP9 H;  1SYE A;  2DNE A;  3I55 A;  2ES2 A;  1SJE D;  3G48 A;  3PF5 A;  1AN8 A;  3PMF A;  4DV1 Q;  4BY7 G;  1CKO A;  1L2F A;  1D1I A;  3CAM A;  4MTN A;  3HG9 A;  1X56 A;  3K81 C;  4XYO A;  2XRS D;  5M5Y H;  4BA1 I;  5IP7 G;  1HTL D;  4Y7N H;  5I4D A;  2N3S A;  2NZ1 D;  1Q86 C;  3SR1 A;  3K57 A;  1C48 A;  2PYK A;  2YTV A;  5I6Y A;  2B29 A;  2FFK B;  3GV3 A;  5JEA H;  1IW7 D;  2L9H A;  1PFM A;  1QE6 A;  1SRO A;  5CV9 A;  1XMQ Q;  1YHQ A;  4POG A;  2L0C A;  3CC7 A;  5CV6 A;  3U9O A;  1G8Z D;  5C5M A;  2R93 H;  2D2C C;  2F4V L;  1UE7 A;  1AW7 A;  2SOB A;  2UUB L;  3BVG A;  2KJX A;  1JT8 A;  3MFY A;  4LFA Q;  3SDZ A;  3D31 A;  5M5Y B;  3CCV A;  3P1H A;  3AQQ A;  1RTN A;  4B3R Q;  4Y7N B;  1NNX A;  4ZCK A;  2X6G A;  1PFS A;  2N55 A;  3GV6 A;  5JJK A;  1J5E Q;  2ZXO A;  3I4M G;  2QIL A;  5D14 A;  1OXV A;  2NZH A;  2J7Z A;  1DGS A;  3HOY G;  1TWG H;  4IFD H;  2R93 B;  4IUU A;  5A2Q E;  4KJO A;  4NXN Q;  3KF6 B;  3BVM A;  4XIG S;  4JI8 Q;  5M3M G;  3CP0 A;  1WTV A;  5HGT A;  3T1H Q;  3CCL A;  1BCP C;  1X3E A;  1EY7 A;  2B2Y A;  2SEB D;  4H02 A;  1HUN A;  2F0K A;  4CKC A;  3R2T A;  1MSG A;  2ZXP A;  3OHX C;  3PIO A;  4C1N K;  4RMF A;  2EJF C;  4B3R L;  2DJF C;  1LTG D;  3OW7 A;  3MXN A;  1K3R A;  1LT5 D;  2BE5 C;  3KFU A;  1E7Z A;  2ZJP A;  1IYU A;  2AQ2 B;  1TWG B;  2L4N A;  2H1E A;  1FD7 D;  5D3D A;  4WFN 3;  2L1B A;  3E9H A;  1SYB A;  4FNF A;  1HNW Q;  4H0L C;  2CH4 A;  2EIF A;  4FF3 A;  1EEF D;  1PZJ D;  4S3S A;  2KED A;  3URY A;  4AYB E;  1EL0 A;  5C4Z A;  1S40 A;  1KC8 C;  1A3T A;  2Y0S B;  4OL7 A;  3NEM A;  3HP3 A;  5EJW A;  1M90 C;  4JBW A;  1RKN A;  1WCM H;  2B2V C;  2CQA A;  4YCU A;  2E2D C;  5JEA J;  4A3L G;  4ME5 A;  2A73 B;  2VZA A;  3S2D H;  3DM3 A;  1DJR D;  1RL2 A;  2RCN A;  4L6T B;  2JA9 A;  3DUZ A;  1FGB D;  2KEC A;  2WKC A;  1HNW L;  1KRT A;  4IOC A;  2F0U A;  1TWC H;  4JV5 L;  1EOV A;  2DGY A;  2QF7 A;  4QMG A;  2WB1 B;  5J39 A;  3JAM L;  1WCM B;  1Y1W H;  4BBS G;  5C0X H;  1B4O A;  4EQO A;  1E0B A;  3S2D B;  1FL0 A;  1YNN C;  1EY4 A;  4R4Q A;  3U4V A;  1PZK D;  1ENA A;  3Q23 A;  4DR1 L;  2PZT A;  2EVB A;  1QUQ A;  2HCC A;  3FHW A;  2J0T D;  3MEH A;  4IUR A;  1SMY C;  1TWC B;  4OWX B;  1HH2 P;  4A3J G;  5JVH 3;  1EY8 A;  1JCK B;  1XMO L;  5JJI A;  4GS3 A;  2ID0 A;  5C6A A;  3I8Z A;  1X32 A;  4RA8 A;  1DD2 A;  2KQ3 A;  2KVM A;  3GTL H;  1NJI C;  1KXL A;  2L11 A;  1Y1W B;  1V8Q A;  4QQB X;  3KJP A;  3A5U A;  1PH7 A;  2B8G A;  2IHF A;  4XXE A;  1KTK A;  4G7O C;  4KK7 A;  4KI0 A;  1ROD A;  1N9W A;  5GAG C;  2EZV A;  1BNZ A;  4PMW A;  3CCE A;  5CC4 A;  3DWA A;  1A3V A;  4Q5V A;  1LO5 D;  5H1S E;  1NUC A;  2B2W A;  5IT9 L;  1VQL A;  5D65 A;  1PV4 A;  1ZKO A;  4HIO A;  3KOJ A;  5IGD A;  1H9S A;  3J7Z C;  3GTL B;  4ID6 A;  1I4Q A;  3J80 c;  2AWN A;  3I73 A;  2MO0 A;  1O7I A;  3A8J E;  5C4J H;  1XNR Q;  3BDO A;  4BY7 H;  1A2U A;  1F77 A;  1S5E D;  1PH8 A;  4Y52 H;  4RGN A;  1HR0 L;  2LY7 A;  2M00 A;  1QNU A;  3H3V I;  2WAQ E;  2NBF A;  1QNK A;  4LW1 A;  3Q24 A;  1EWI A;  2ZT9 C;  3VR4 A;  4B08 A;  4X62 Q;  3X3N A;  2OT2 A;  5IP7 H;  1QB5 D;  2K1B A;  2L15 A;  2JQO A;  4JI6 L;  4GZY C;  2RHS B;  3CCQ A;  1X9N A;  4IUP A;  2UUC L;  2EYO A;  4DV4 Q;  5FLX L;  1OO9 B;  1HRJ A;  2PW5 A;  3E0J A;  2EYJ A;  2G5D A;  5C4J B;  2UXB L;  3VDY A;  5I9P A;  4V0B A;  1PH2 A;  1C8C A;  4BY7 B;  1EIH A;  3TS2 A;  1SYC A;  5C0X J;  1GUG A;  4QUC A;  1K8M A;  3SHL A;  1KL9 A;  3J81 i;  1CUK A;  4POF A;  1ET6 A;  1EFW A;  1GKH A;  2MUY A;  3IKJ A;  2GVA A;  3STB D;  3CXC A;  2VS1 A;  2AMC B;  3BYT B;  4MNO A;  4EQ5 A;  4QUF A;  4QGU A;  4X62 L;  1GM5 A;  4KKT A;  2KUM A;  1X54 A;  1B50 A;  1KIX A;  4ZRZ A;  2HIX A;  3MZ5 A;  2JA5 H;  4YHH Q;  3HOY H;  3QOJ A;  1GUT A;  5IYB H;  4YWM A;  4O0A A;  1CHQ D;  1TVX A;  1XJV A;  2CCZ A;  1PH6 A;  2MFI A;  4DA2 A;  1F9R A;  2Q8T A;  1D5X C;  1PTO F;  3HEJ A;  4MN3 A;  3PUZ A;  1PRT F;  1EY0 A;  3BZC A;  4OON A;  4C1N I;  2ZM6 Q;  2H5X A;  5EKK A;  2Q8I B;  3VR3 A;  2JP1 A;  1CA5 A;  2NN6 H;  5C3E G;  3S9W A;  1FVI A;  4A3M G;  3CKI B;  3TSS A;  4DUY Q;  1JR0 D;  4M1U B;  2JA5 B;  2F0L A;  4K2L A;  1H95 A;  3HOY B;  4K5W A;  4JI3 Q;  4KD4 A;  3J81 E;  2RA4 A;  2WIN B;  3CCJ A;  1X55 A;  1UUP A;  4YHH L;  5BR8 Q;  2VW9 A;  2RBM A;  3D8G A;  1LT6 D;  1EYD A;  5KRU A;  2I5M X;  4KKU A;  5EAY A;  1CM9 A;  1GVP A;  3K8A A;  1XX8 A;  2FHT A;  5KND A;  4JI2 L;  4GNX C;  1E2W A;  4XQN A;  1U9R A;  2MNA A;  4DGZ A;  3T1Y L;  3NTH A;  3K5N A;  3VYU A;  1WTX A;  2ZM6 L;  4A3C G;  1YNX A;  3FKI H;  1X3F A;  1SYG A;  1PH5 A;  1PH9 A;  4DR6 Q;  3A54 A;  3H6M A;  3H09 A;  4DUY L;  1K83 H;  2A6E C;  1Q7Y C;  3S17 H;  2IY5 B;  2WFW A;  1D2B A;  3RZD H;  2E76 C;  2B2U A;  2LMC B;  1W6J A;  4A3I G;  2CW0 C;  5IP9 G;  2R6G A;  1HNZ Q;  4R4O A;  2ZJQ A;  3NHH A;  3CPF A;  1AE2 A;  1YJ9 A;  3S1Q B;  2F0E A;  2RDH A;  2F0H A;  4QIW B;  5LL6 S;  2LS0 1;  4NPS A;  4OHJ A;  1NMG A;  4HJ7 A;  1I4R A;  3FKI B;  5DNF A;  1TY0 A;  2HQE A;  1B8A A;  2XTI A;  2OTL A;  5IY0 A;  1K83 B;  3S17 B;  1STA A;  4P75 A;  3AFP A;  2O5I C;  4RG1 A;  3RZD B;  3NUC A;  1STE A;  5E3F A;  3W1G A;  1HCZ A;  1JOK A;  4A93 G;  4FXD A;  1LUZ A;  4U68 A;  2NVY H;  2L5T A;  1YIT A;  3GTG H;  1YEZ A;  2CWP A;  1TS4 A;  1BCP D;  1W3S A;  1F9P A;  4CJ0 B;  3SXH A;  1QZG A;  5EQ0 A;  2R93 G;  1MKH A;  2TMP A;  3R3O A;  2HDL A;  4HJA A;  4LF7 Q;  5M9O A;  1ENC A;  2QDB A;  4TSS A;  2F0S A;  1C0A A;  1B44 D;  1QZH A;  2AWO A;  4BS9 A;  1GHK A;  2PQA A;  3CCM A;  2WAC A;  5IGE A;  2I0Q A;  3VR5 A;  1I3Q H;  4HTH A;  2BE5 D;  2KA7 A;  3HRZ C;  3GP7 A;  5LHY 1;  3SE0 A;  2WP8 J;  2ZTC A;  2VXW A;  2E8G A;  3BJU A;  4JOI C;  1MBY A;  2NVY B;  5FJ8 H;  3HOU H;  2E75 C;  2X69 A;  3GTG B;  1TKW B;  2QCP X;  1NAP A;  4LAA A;  1DOM A;  1GUS A;  4UPA A;  4UP7 A;  2NZO A;  4RAU C;  5AJ3 L;  1BXT A;  4IFD G;  2R7Z H;  2EPB A;  5GQO A;  2R3Z A;  2A69 C;  1CHP D;  1UE6 A;  4HCS A;  1IBM L;  4CKB A;  4JI0 Q;  1I3Q B;  5CYU A;  1HZA A;  4HIM A;  4O42 A;  1C9O A;  5G3L F;  2F1M A;  1ENF A;  2Y0S G;  1HZC A;  2Z4I A;  2MO1 A;  1FNV A;  1VQO A;  1M1K C;  3VYS A;  3HOU B;  2N88 A;  4R9W A;  1LLR D;  3UI2 A;  4DK1 A;  2UUA Q;  3W3A A;  1Q46 A;  1CT1 D;  4WJW A;  5ELN A;  2I07 B;  5JOB A;  2R7Z B;  2F0Q A;  1WTH A;  4IQZ A;  5LMN W;  3TDQ A;  1BDO A;  3ZJY C;  5LMU Q;  3P7J A;  1KNE A;  4KMU C;  1Q8K A;  4Q0F A;  4ZK9 B;  1N33 L;  3FDT A;  3NK9 A;  4R4T A;  4K5V A;  2F03 A;  4A3B H;  3KYH C;  4JI0 L;  3PUV A;  1YNN D;  1PLF A;  2PZU A;  2MP1 A;  1BBU A;  4RKL A;  1CKN B;  2Q2I A;  4RGT A;  1WJJ A;  2UUA L;  3M4Q A;  1SMY D;  4A3G G;  3DM1 A;  1RF2 D;  3TZU A;  2DNC A;  3KLS X;  3RN5 A;  4DNR B;  4G57 A;  2BDN A;  1I4X A;  4ZAI A;  3S1M H;  2E5L L;  1D8L A;  4JI4 Q;  2JYO A;  1MSH A;  1NCV A;  1I5F A;  3A56 A;  1I4P A;  3HKZ B;  4A3B B;  2PMZ B;  5TSS A;  3KF8 A;  1E24 A;  2PI2 E;  1KAB A;  1VQ8 A;  3MTS A;  2DUD A;  3J81 j;  3PO2 H;  5M5X H;  4IAL A;  4RCO A;  1Y1W G;  4DAY B;  3F1Z A;  4N8F A;  1UEB A;  4OXP A;  1ZXT A;  3FMC A;  4A3M H;  1JIC A;  1X65 A;  3G6J B;  1STH A;  3CC4 A;  2Z9H A;  4GKK Q;  4LF5 Q;  1K8A C;  3S1M B;  2EOT A;  2LFN A;  4A76 A;  1RHP A;  3U50 C;  1TS5 A;  2AUJ D;  4I65 A;  4JI4 L;  4RGM A;  4X3T A;  4UP8 A;  2F0V A;  2K52 A;  4L63 B;  4GOP B;  2ICE C;  5EPJ A;  3PO2 B;  4P2C B;  5M5X B;  2QKI C;  1B2T A;  2PNH A;  4KY6 A;  2AHO B;  2NTT A;  2C9O A;  1XTD A;  4PQX A;  4FYD A;  1TQO A;  1A8V A;  4RHR A;  4RCN A;  4A3M B;  3U58 A;  4XDX A;  1SXT A;  3GTQ H;  4DF7 A;  5ELE A;  2B2T C;  5GAH C;  1UNS A;  1XNQ L;  4GKK L;  4LF5 L;  1SAP A;  1KAA A;  1L1O A;  4IUT A;  4A3I H;  1VQ7 A;  1Q81 C;  1PH1 A;  3BG3 A;  4K6D A;  1EQV A;  1LM0 A;  1EIG A;  4LJZ C;  4DV0 Q;  1V43 A;  3PO3 G;  3CMA A;  4A3D H;  4EGV A;  2F4V Q;  3R93 A;  2UUB Q;  4FO2 A;  1LTA D;  4UHV A;  2BA1 A;  2K14 A;  3LWE A;  1V1O A;  3K59 A;  2GVB A;  3G7L A;  1TWA H;  1D1K A;  3GTQ B;  1WYD A;  4GN4 B;  5IWA Q;  3CHB D;  4B3S Q;  2LXK A;  4GNX B;  1IKM A;  2K6A A;  1ICW A;  3CRK C;  2XGT A;  4X64 Q;  2EY6 A;  4A3I B;  3F8T A;  1ZYR C;  3K7U C;  4A93 H;  3CPW A;  4F7X A;  1K0R A;  1TY2 A;  2GN5 A;  2JA6 H;  3RMH A;  5C44 H;  1HHV A;  2AQ1 B;  4LF9 L;  5CBE E;  1PZI D;  4WOR A;  3WOF A;  4A3D B;  2K5V A;  3G71 A;  4JPB W;  4DV0 L;  2RQX A;  4DUZ Q;  3D6W A;  5C3X A;  3BZK A;  4WRD A;  4DN4 M;  1V9P A;  1TWA B;  3T51 B;  3UDI A;  2RHQ B;  2KHI A;  2WB1 E;  3FEW X;  3MEF A;  2LSS A;  5IWA L;  1BBX C;  1SN8 A;  3F2C A;  4B3S L;  4A93 B;  4R1J A;  2VB2 X;  5I2X A;  3I7F A;  4KN4 C;  1Z6H A;  2JA6 B;  4KHP Q;  4X64 L;  5C44 B;  3R8B A;  3ULJ A;  1MI2 A;  1Y14 B;  2JA5 G;  1LTT D;  2AUK A;  4CBV A;  4QL5 A;  5IYB G;  2QW7 A;  1Q12 A;  4DUZ L;  1RJT A;  1AZQ A;  5BN3 A;  1W6K A;  1B1Z A;  4KHZ A;  1K8O A;  1R9T H;  2ATW A;  1SNO A;  5DM6 3;  3CW2 C;  2A6E D;  2NN6 G;  1TU2 B;  5J22 A;  1PFB A;  2B2Y C;  3NBI A;  3NEL A;  1S5F D;  1V1P A;  2F52 A;  3H15 A;  2CW0 D;  3W5O A;  2OTJ A;  4KHP L;  2EYF A;  3IFD A;  4C56 C;  2F0P A;  3JAM i;  5ELC A;  4X65 Q;  5L37 A;  4TVA B;  3L3O C;  5FK9 C;  1KNA A;  3GTK H;  1WVL A;  1A3U A;  3L2P A;  1R9T B;  1R4P B;  4JI7 L;  2VQE L;  4JV5 Q;  4X3U A;  3VR6 A;  1G51 A;  1B3A A;  4IUN A;  2RVL A;  4NW2 A;  3AU7 A;  4APV A;  1MJC A;  1SNM A;  3VYR A;  3MXG A;  2PW7 A;  3EVQ A;  1VQD A;  3S1N H;  2QGQ A;  2R7D A;  3FKI G;  3Q8D A;  4DR1 Q;  3F2B A;  2YTY A;  4A3G H;  2IX1 A;  1WFQ A;  3M4Y A;  2DY7 A;  1IHZ A;  4X66 Q;  3BDC A;  2B2V A;  3FPU B;  1SNP A;  3GTK B;  1H9J A;  4X65 L;  3EJI A;  4CDF C;  1ILQ A;  3HOX G;  3PIP A;  4IO9 A;  1XMO Q;  5JAV A;  3SK8 A;  5BN5 A;  2F0G A;  2K50 A;  2RCF A;  4QF4 A;  3HOV G;  5FKA C;  1STB A;  3KJO A;  1BUV T;  1BQQ T;  1VQC A;  3OWE B;  1MIU A;  3JAM E;  4A3F H;  4UP9 A;  3S1N B;  2K5H A;  1TT2 A;  5T1I A;  3SVM A;  2YV5 A;  1L0X B;  2F0W A;  3M7N A;  4A3G B;  1VQA A;  2ZJR A;  4MTK A;  1CQF A;  1VQF A;  3IL8 A;  1ASZ A;  4IFD J;  2NB0 A;  1VCI A;  1EWC A;  4X66 L;  1PYW D;  3OPO A;  4JBM A;  5J3B A;  2A69 D;  1SDF A;  5M3F G;  1IBL Q;  5DLQ E;  5I6W A;  3T13 A;  2EE1 A;  1SE2 A;  4A3E H;  3D6C A;  5COR A;  1PMR A;  4YIJ A;  1M4V A;  1PYB A;  4A3F B;  5HY6 A;  1N32 Q;  1HR0 Q;  2FJ2 A;  3OOC A;  1VQB A;  3FVQ A;  2I5H A;  4OO1 H;  1N34 Q;  3RZO H;  3KDF A;  2R61 A;  2F3I A;  3S14 H;  4JI6 Q;  3MA2 B;  3HOW H;  3U9S A;  3A7A B;  5FJ8 G;  3HOU G;  4C3H H;  2VB3 X;  4I7Z C;  2UUC Q;  3KF8 B;  5IT9 E;  3O13 A;  3TEH B;  3HS0 C;  2ZXR A;  5T1G A;  1WD0 A;  4BXX H;  1IBL L;  4A3E B;  2UXB Q;  1FNU A;  1STY A;  2R7Z G;  3MXU A;  4DAV A;  3PO3 H;  4HJ5 A;  1QVC A;  4NDX A;  3J7Y W;  2ZTD A;  1NSN S;  3W1B A;  2B2W C;  1RTO A;  1N32 L;  1TII D;  5DEH A;  2K01 A;  2FXQ A;  1YI2 A;  5C4X H;  4LNQ A;  3RZO B;  2B3G A;  2NYZ D;  4N9P A;  3S14 B;  4R4I A;  3V2T A;  2D5D A;  1VQ4 A;  1N34 L;  3HOW B;  1L0W A;  1Z47 A;  4C3H B;  2D0P A;  3EQL C;  3KUP A;  4IOA A;  1SYD A;  3J81 c;  2SNM A;  4AYB B;  5I2Y A;  1CTM A;  3BYY B;  1RDP D;  5FLX E;  1I50 H;  1ASY A;  3C1E A;  3PO3 B;  3MFG A;  3I90 A;  2L12 A;  2RDG A;  2YTX A;  1N36 Q;  4K0K Q;  2RF4 A;  2D9U A;  5IGF A;  4IFD I;  4PV1 C;  1JB3 A;  5C4X B;  3HKZ G;  4A3B G;  1A2T A;  3DWP A;  3AMU A;  1EIF A;  1OXS C;  1OXT A;  4TQU S;  3FRP B;  1HQM C;  4KN7 C;  4A4I A;  4NP5 A;  5IIF A;  1BCP F;  4IZ8 A;  1QCB D;  2RSO A;  2NTS A;  4PZ6 A;  1K73 C;  5FOB B;  4HED A;  1I50 B;  4YCW A;  1UWV A;  4GOP C;  1JOQ A;  1ML0 D;  1O7Z A;  2A1A A;  3DLL A;  4G7Z C;  2PPB C;  1JE5 A;  3EBE A;  1B70 B;  4DKA C;  3K7A H;  1CK1 A;  1Q90 A;  1Y1V H;  1VQM A;  3E3X A;  1N36 L;  3T56 B;  4ZQ3 A;  3GTO H;  2F0D A;  4K0K L;  3SK6 A;  4CJ1 B;  2VL6 A;  3OMG A;  4JI2 Q;  3KLW A;  4RFB A;  1MGS A;  1PH4 A;  3PO2 G;  2IL8 A;  2OF1 A;  3T1Y Q;  1WI5 A;  4KJN A;  2JA8 H;  1VS0 A;  2C35 B;  4G4K A;  1G2T A;  4H7B A;  5KIX A;  4NMZ A;  4IPC A;  3D4D A;  3NEN A;  1O80 A;  3M9B A;  1H9K A;  3PIO 3;  1LTL A;  2SNS A;  3JC6 6;  3WOE A;  4J15 A;  3J80 L;  4IJL A;  3K7A B;  1LYL A;  1Y1V B;  1EQQ A;  3LX0 A;  2HQL A;  4GLV B;  3GTO B;  2CVR A;  4BY1 H;  2SDF A;  1M8A A;  2IT1 A;  3CCR A;  3AEV A;  2M2L A;  4DXG A;  2OCE A;  3GDE A;  4JI1 Q;  4DXF A;  2NUC A;  1VQK A;  4LF8 Q;  1A15 A;  1FR3 A;  2MGS A;  2JA8 B;  4HJ8 A;  3NXW A;  1YJW A;  3I2Z A;  2VNU D;  4OIK A;  3AYH B;  3N52 A;  3LGJ A;  1ZYR D;  2K75 A;  1VQI A;  1S5C D;  5C0X I;  2K5W A;  5KNB A;  2FMM A;  1JWU D;  3PGZ A;  4ZKB B;  3RN2 A;  4YWL A;  1FNW A;  4M8A A;  3TQY A;  1HZ9 A;  2B39 A;  2KHS A;  4BY1 B;  1ET9 A;  2Z0S A;  1OTC A;  3HOX H;  3S16 H;  2OEO A;  3TN2 A;  3X3M A;  5IOD A;  4FVM A;  1II3 A;  5FO8 B;  4DNT B;  2PI2 A;  4AIM A;  1SFO H;  3HOV H;  1JE4 A;  4A3D G;  1SNC A;  3A74 A;  2GA4 B;  2B2U C;  4JI1 L;  1JOO A;  1CZW A;  4LF8 L;  2K03 A;  1CA6 A;  4DFA A;  1KDA A;  2Z1C A;  4J8Q A;  3MXN B;  1A63 A;  4N9T A;  4NXM L;  4CGY B;  4HR7 B;  1WTW A;  2M9V A;  2CWA A;  1S3O A;  2G9H D;  4DR4 Q;  3NWS A;  5FLM H;  1Y8N B;  3NBH A;  4QCL A;  3PUW A;  2WII B;  4JBJ A;  2XVS A;  2E2I H;  1IZ6 A;  1GXD C;  1OXU A;  4KY7 A;  1PHJ A;  3Q0A A;  3K5M A;  1GUW A;  5E1F A;  3HOX B;  3S16 B;  4U67 3;  1HZB A;  5ELF A;  2K5N A;  5FO7 B;  2JA6 G;  4LFB L;  5C44 G;  1SFO B;  5AJ3 Q;  5M3F H;  3HOV B;  1EWH A;  2B63 G;  1PH3 A;  1EZ6 A;  3KF6 A;  4J6H A;  4KY5 A;  1SE8 A;  1IBM Q;  1Y8O B;  1WOC A;  1PRT B;  1EQT A;  4P74 A;  5JVG 3;  3H3V C;  4YY3 L;  4IUQ A;  3RLO A;  3GD7 A;  4DR4 L;  2E2I B;  4H44 C;  1F2L A;  5KYI A;  3T53 B;  2N8N A;  4PMC A;  1JB7 A;  5KGU A;  1JJG A;  3SEB A;  1GJX A;  2IJ0 A;  2PZW A;  1EQR A;  5J1Z A;  4DU9 A;  5M3F B;  2IX3 A;  3A8K E;  4DAP A;  4JC0 A;  2H4O A;  1NY4 A;  2HDM A;  3UDX A;  3DXJ C;  4L5Q A;  2EY5 A;  3NP8 A;  1MHW C;  4P73 A;  4DV3 Q;  1LTR D;  4K5X A;  1N33 Q;  1ICF B;  4AH6 A;  5EKL A;  2XNA C;  2K04 A;  1ONL A;  1PDQ A;  4GLA C;  1F2Y A;  4GLX A;  1EZ8 A;  5E7N A;  2ICI A;  2OQK A;  2ENB A;  5GRO A;  1BO0 A;  1AFP A;  1GD7 A;  2BCO A;  4R8N A;  3U4Z A;  1H9R A;  3G4S A;  2A68 C;  1QUQ B;  2OQ0 A;  1I94 Q;  1EYC A;  5E4X A;  4RHS A;  2NVT H;  3D4R A;  1Z7T A;  2EYL A;  3DWQ A;  1L0Y B;  1G2S A;  2UU9 Q;  1Q1E A;  2E5L Q;  2HIV A;  1CKM A;  4JG2 A;  2KHJ A;  1D5M C;  4OWT B;  4DV3 L;  1YIJ A;  2CQO A;  3CCU A;  3KDF B;  3A8I E;  3IAY A;  2G9D A;  3VA5 A;  1SJH D;  3K6O A;  5EBC A;  4FF4 A;  2NVT B;  4LUZ A;  3S15 H;  2A6H C;  2UXC L;  2XWB B;  4OX9 Q;  1I94 L;  5IGB A;  1H9S B;  2NN6 I;  3HZX A;  1VQN A;  4CDE C;  5HGQ A;  1EUJ A;  3E5S A;  1TWF H;  4X3S A;  1UAP A;  3GO5 A;  2UU9 L;  1B7Y B;  3UDF A;  1SRU A;  4IJH A;  4EQP A;  5M5W H;  4ZUI A; 
#chains in the Genus database with same CATH homology
 1W2B A;  4A3L H;  4ALP A;  4QL5 A;  5H1S E;  4YY3 Q;  5IYB G;  2AKW B;  3M85 A;  1VQL A;  1PV4 A;  1Q12 A;  4DUZ L;  4HIO A;  1C7Y A;  3KOJ A;  4JI3 L;  5IYD H;  3J7Z C;  4KHZ A;  3J80 c;  2AWN A;  1R9T H;  2ATW A;  4A3F G;  1VQ6 A;  2NVQ H;  3GTJ H;  4OO1 I;  2MO0 A;  5ELO A;  1O7I A;  5BR8 L;  5C4J H;  3A0J A;  1XNR Q;  4JYA L;  3I4N H;  2KCM A;  4BY7 H;  3CW2 C;  3PUX A;  4OX9 L;  1PH8 A;  4Y52 H;  1HR0 L;  3H3V I;  2WAQ E;  1XNQ Q;  4DAM A;  2NN6 G;  3PCO B;  4LW1 A;  3NEL A;  1EWI A;  4X62 Q;  2F52 A;  4C3J H;  3H15 A;  3W5O A;  5IP7 H;  3PF4 A;  4BBS H;  2YYZ A;  2OTJ A;  4WJ3 M;  1X3G A;  4KHP L;  1KD1 C;  2JE6 I;  1BBW A;  3HKZ E;  1FJG L;  1OXX K;  2L15 A;  1E22 A;  2JQO A;  3CF5 A;  2PMZ E;  3PSI A;  4JI5 Q;  3JAM i;  4JI6 L;  2BH2 A;  2RHS B;  4X65 Q;  3CCQ A;  1X9N A;  1PYS B;  4TVA B;  2HHH Q;  2UUC L;  4DR6 L;  3GTK H;  4DV4 Q;  4A3E G;  3L2P A;  1SLJ A;  3ER0 A;  4JI7 L;  2UXD L;  2VQE L;  4JV5 Q;  2R92 H;  2Z6K C;  5JEA G;  1G51 A;  4AQY Q;  3VDY A;  2UXB L;  1PH2 A;  5IYC G;  1NMF A;  3TS2 A;  4A3J H;  1T9H A;  4KLK A;  4LUV A;  4OO1 G;  5C0X J;  1HNZ L;  4APV A;  4FDB A;  1MJC A;  4L5S A;  1KL9 A;  4YCV A;  4C3I H;  1TWH H;  3J81 i;  1CUK A;  4POF A;  1D7Q A;  1EFW A;  1GKH A;  4MZ9 A;  2GVA A;  1VQD A;  3HOW G;  3S1N H;  2QGQ A;  1YVC A;  2R7D A;  2AMC B;  2VS1 A;  3FKI G;  4JOI A;  4MNO A;  3STB D;  4EQ5 A;  2EXD A;  4QGU A;  1PA6 A;  3Q8D A;  1UE1 A;  3F2B A;  4X62 L;  2YTY A;  4DV5 Q;  4DR1 Q;  4A3G H;  4A3K G;  2IX1 A;  1GM5 A;  1WFQ A;  3HFZ B;  4LF9 Q;  2K4K A;  4X66 Q;  1XPR A;  4XTC S;  4AYB G;  2CFM A;  1VQ9 A;  1X54 A;  2D62 A;  3I56 A;  1KIX A;  2A19 A;  4JI5 L;  4BXX G;  2HIX A;  4DR7 Q;  3UE0 A;  4X65 L;  5LMN L;  4EX5 A;  3HOX G;  3PIP A;  1J6Q A;  4IO9 A;  1XMO Q;  2HHH L;  1L1O C;  1E1T A;  2JA5 H;  2Q2T A;  1KRS A;  4YHH Q;  2K50 A;  3HOY H;  3HOV G;  4GN5 A;  2Y0S E;  3KJO A;  1VQC A;  4IPD A;  4YWM A;  4O0A A;  3A5Z B;  5IYB H;  4JBK A;  4AQY L;  5C4X G;  1SMX A;  4L5R C;  2UXC Q;  1VQP A;  1XJV A;  1MIU A;  2CCZ A;  4DR2 Q;  1PH6 A;  1K8G A;  2MFI A;  1VQG A;  4A3F H;  4UP9 A;  1Z9F A;  2KBN A;  1Q1B A;  2I5L X;  2K5H A;  2Q2H A;  2YV5 A;  1CSP A;  4DK6 C;  4LF7 L;  3M7N A;  1YZ6 A;  3PUZ A;  1VQA A;  3BZC A;  4OON A;  2ZJR A;  2ZM6 Q;  2H5X A;  1VQF A;  2V1C C;  4DV5 L;  2EQS A;  1HJP A;  5C3E G;  1ASZ A;  4IFD J;  1FVI A;  1VCI A;  4A3M G;  3E0E A;  4DUY Q;  4B3M Q;  1X6O A;  4B3T Q;  4X66 L;  2B63 H;  3SGI A;  3BU2 A;  4JBM A;  5J3B A;  4DR7 L;  5JJL A;  1KQS A;  1H95 A;  5M3F G;  4JI3 Q;  1IBL Q;  5DLQ E;  3CCJ A;  4PZ7 A;  3CXC A;  1X55 A;  4DV7 L;  3TRZ A;  3RLN A;  4DK3 C;  4YHH L;  4GKJ Q;  4QY7 A;  5BR8 Q;  3RLF A;  2VW9 A;  4A3E H;  4JYA Q;  2JK8 A;  1PYB A;  4IPH A;  4L5T A;  2VUM G;  5HY6 A;  1N32 Q;  4OWW B;  1HR0 Q;  2I5M X;  1BKB A;  4DR2 L;  5EAY A;  1VQB A;  2MQH A;  1GVP A;  3K8A A;  2I5H A;  4JI2 L;  4GNX C;  2KEN A;  4LF4 L;  3RR5 A;  1AE3 A;  2A8V A;  3B6Y A;  3TRE A;  2KCT A;  2MNA A;  1N34 Q;  3KDF A;  3RZO H;  4HIK A;  3T1Y L;  2F3I A;  3S14 H;  5K36 G;  4QJF A;  4JI6 Q;  4P72 A;  2ZM6 L;  4A3C G;  1YNX A;  3TS0 A;  3H3V H;  3IRB A;  3HOW H;  2CKZ B;  3E9I A;  4DV1 L;  5FJ8 G;  3HOU G;  3FKI H;  1X3F A;  1PH5 A;  3G6E A;  1PH9 A;  4C3H H;  4DV6 Q;  2UUC Q;  4DUY L;  4B3M L;  4B3T L;  1TXY A;  4NB3 A;  4DR6 Q;  2WB1 G;  3KF8 B;  1WCM G;  1Y1V G;  1K83 H;  1VQH A;  3PV0 A;  1Q7Y C;  4JI7 Q;  2WFW A;  3S17 H;  2VQE Q;  2UXD Q;  2IY5 B;  2ASB A;  3TEH B;  3RZD H;  4BXX H;  1IBL L;  1P16 A;  2UXB Q;  3H0G G;  3NBH B;  2R7Z G;  4A3I G;  4R4C A;  4A75 A;  3PO3 H;  4HJ5 A;  1QVC A;  5IP9 G;  3JAM c;  2R6G A;  1HNZ Q;  3M4O H;  4GKJ L;  4R4O A;  2ZJQ A;  1UE5 A;  2ZTD A;  2LXJ A;  3W1B A;  2ZTE A;  1Q82 C;  3CPF A;  2JA8 G;  1AE2 A;  2ALY B;  2QEX A;  1N32 L;  1YJ9 A;  2JEA I;  2FXQ A;  1YI2 A;  5C4X H;  5LMU L;  4LNQ A;  2B3G A;  4NPS A;  1XMQ L;  3HOZ G;  1KHI A;  4R4I A;  1NMG A;  1XPO A;  4HJ7 A;  1A62 A;  3OTO Q;  1VQ4 A;  1N34 L;  2OWO A;  2NVX H;  1B8A A;  1Z47 A;  2N78 A;  1L0W A;  2D0P A;  2JJQ A;  2XTI A;  2OTL A;  4IOA A;  4DPG A;  1KAW A;  5IY0 A;  3J81 c;  5LMN Q;  5C0X G;  4BA2 I;  4P75 A;  3AFP A;  4LWC A;  4RG1 A;  4DV6 L;  4BY1 G;  4LFA L;  1I50 H;  2JA7 H;  1ASY A;  3W1G A;  5C3E H;  2PQA B;  4A93 G;  1LUZ A;  3STB C;  1U0L A;  3CD6 A;  2WAQ G;  2N49 A;  2NVY H;  1A0I A;  1YIT A;  1N36 Q;  2YTX A;  3L0O A;  1YJN A;  3M4P A;  1YEZ A;  3GTG H;  4K0K Q;  2CWP A;  4HJ9 A;  2RF4 A;  3GTM H;  4IFD I;  3S24 A;  5IE8 A;  3UE1 A;  2E2H H;  3CQZ H;  1W3S A;  4UY8 C;  3HKZ G;  1J5E L;  4A3B G;  3M3Y H;  4PG3 A;  1BVS A;  2Z6K A;  2VY3 A;  4BBR H;  2JEB I;  1QZG A;  1EIF A;  1NE3 A;  1OXS C;  3CC2 A;  1MKH A;  1OXT A;  4HJA A;  4LF7 Q;  4TQU S;  4LFC Q;  2R93 G;  2VUM H;  1QVF A;  1C0A A;  1VQE A;  4A4I A;  1QZH A;  2AWO A;  1P8L A;  2PQA A;  3CCM A;  2I0Q A;  1IL2 A;  3OTO L;  1U5K A;  1I3Q H;  1NBW A;  5IT9 c;  4PZ6 A;  2YU9 H;  4NXN L;  4JI8 L;  1K73 C;  3T1H L;  3S2H H;  1HR0 W;  3L7Z C;  1JJ2 A;  4YCW A;  1UWV A;  1YHA A;  2WP8 J;  4GOP C;  1PVO A;  2ZTC A;  4JOI C;  3BJU A;  2A1A A;  2E8G A;  3DLL A;  4A3C H;  1AH9 A;  4WJ4 A;  4DV7 Q;  5FJ8 H;  1JE5 A;  3EBE A;  3HOU H;  1B70 B;  3ULP A;  4DKA C;  3K7A H;  2QA4 A;  1Y1V H;  1VQM A;  4UPA A;  4HID A;  1N36 L;  4UP7 A;  3GTO H;  2NZO A;  5AJ3 L;  4K0K L;  1NTG A;  1QVG A;  4IFD G;  3K0X A;  4LF6 Q;  2VL6 A;  2R7Z H;  1CSQ A;  5GQO A;  4JI2 Q;  4LF4 Q;  3KLW A;  5IP9 H;  1UE6 A;  3K80 C;  5FLM G;  1PH4 A;  1IBM L;  3PO2 G;  4LFC L;  3I55 A;  1E1O A;  4C2M H;  2ES2 A;  3T1Y Q;  1WI5 A;  2JA8 H;  4JI0 Q;  1VS0 A;  1HZA A;  2C35 B;  1HNX Q;  3OW2 A;  4HIM A;  1C9O A;  3G48 A;  3PF5 A;  3I4N G;  4IPC A;  4DV1 Q;  4BY7 G;  3NEN A;  5FLX c;  2Y0S G;  1HZC A;  1CKO A;  1L2F A;  3HKS A;  3HOZ H;  1IXR A;  3M9B A;  3CAM A;  2MO1 A;  1LTL A;  1VQO A;  1M1K C;  4MTN A;  3JC6 6;  4J15 A;  1RIP A;  1X56 A;  3K81 C;  4IJL A;  2UUA Q;  1LYL A;  5M5Y H;  4BA1 I;  5IP7 G;  5GAE C;  1EQQ A;  1Q46 A;  2HQL A;  4GLV B;  5ELN A;  4DR3 Q;  4BY1 H;  4Y7N H;  3RNU A;  2N3S A;  1Q86 C;  4YWK A;  1V1Q A;  2R7F A;  2IT1 A;  2YTV A;  1XPU A;  3CCR A;  5LMN W;  3AEV A;  3ZJY C;  2B29 A;  2OCE A;  3GDE A;  4JI1 Q;  5LMU Q;  1VQK A;  5IYC H;  4LF8 Q;  4LF6 L;  1SRO A;  1Q8K A;  1N33 L;  1XMQ Q;  1YHQ A;  4HJ8 A;  4PZ8 A;  1YJW A;  4POG A;  4R4T A;  3I2Z A;  3CC7 A;  2VNU D;  4A3B H;  3AYH B;  3CCS A;  3LGJ A;  3KYH C;  4JI0 L;  3PUV A;  1HNX L;  2R93 H;  2F4V L;  2K75 A;  1UE7 A;  1VQI A;  5C0X I;  2UUB L;  1BBU A;  1JT8 A;  3PGZ A;  3RN2 A;  4LFA Q;  4YWL A;  3D31 A;  3CCV A;  4A3K H;  3TQY A;  1CKN B;  3AQQ A;  4B3R Q;  1HZ9 A;  2Q2I A;  2UUA L;  1WJJ A;  3M4Q A;  3ICE A;  4A3G G;  2Z0S A;  1OTC A;  2Q2U A;  1PFS A;  3HOX H;  3S16 H;  3GTP H;  4DR3 L;  2VQF Q;  2BH8 A;  3RN5 A;  1G6P A;  5JJK A;  1J5E Q;  2PI2 A;  4AIM A;  1SFO H;  2E5L L;  3S1M H;  3HOV H;  1D8L A;  4JI4 Q;  3I4M G;  4A3D G;  2IHE A;  3A74 A;  1OXV A;  2NZH A;  4DR5 Q;  1DGS A;  1I5F A;  4JI1 L;  4LF8 L;  3HOY G;  1VQ5 A;  1TWG H;  1IYJ B;  1E24 A;  3MXN B;  1A63 A;  2PI2 E;  1CKN A;  2IX0 A;  4NXM L;  1VQ8 A;  3S1R H;  2HT1 A;  1JJC B;  1S3O A;  2CWA A;  2DUD A;  3ERS X;  4DR4 Q;  4NXN Q;  3KF6 B;  4XIG S;  4JI8 Q;  5M3M G;  5FLM H;  3CP0 A;  3J81 j;  3PO2 H;  5M5X H;  3T1H Q;  2E2J H;  3CCL A;  1X3E A;  3PUW A;  1Y1W G;  4H02 A;  4JBJ A;  4DAY B;  3F1Z A;  2E2I H;  3J7A 5;  3FP9 A;  1IZ6 A;  1OXU A;  3ULL A;  1UEB A;  1PHJ A;  4OXP A;  1S72 A;  3PIO A;  4A3M H;  1X65 A;  4RMF A;  4B3R L;  1HZB A;  2K5N A;  2JA6 G;  3CC4 A;  4GKK Q;  4LFB L;  4LF5 Q;  5C44 G;  1K8A C;  5AJ3 Q;  5M3F H;  4A76 A;  1K9M C;  1K3R A;  3U50 C;  3UDG A;  2B63 G;  2VQF L;  1PH3 A;  3KF6 A;  3KFU A;  1E7Z A;  2ZJP A;  1SE8 A;  4QIW E;  3J80 i;  1IBM Q;  4DV2 Q;  4JI4 L;  1WOC A;  1EIY B;  4UP8 A;  4DR5 L;  4JCV E;  2K52 A;  3E9H A;  3CME A;  4P74 A;  4GOP B;  1HNW Q;  3D0F A;  1EYG A;  2EIF A;  1L1O B;  2PNH A;  4YY3 L;  3RLO A;  3GD7 A;  4DR4 L;  3PUY A;  2AHO B;  4AYB E;  1XTD A;  1S40 A;  2N8N A;  1KC8 C;  1A8V A;  1JB7 A;  3U58 A;  1XNR L;  3EN2 A;  3NEM A;  1JJG A;  1EQR A;  3GTQ H;  5GAH C;  1M90 C;  4JBW A;  1WCM H;  4JC0 A;  4GOP A;  1IBK Q;  1XNQ L;  4GKK L;  4P71 A;  1NY4 A;  4YCU A;  5JEA J;  3UDX A;  4LF5 L;  4A3L G;  1L1O A;  4L5Q A;  2VZA A;  3S2D H;  3H0G H;  3DM3 A;  4P73 A;  2BA0 A;  4DV3 Q;  4A3I H;  3AFQ A;  5GAD C;  1N8R C;  1VQ7 A;  1Q81 C;  1PH1 A;  4AH6 A;  1N33 Q;  1LM0 A;  1RL2 A;  1SR3 A;  1VQJ A;  5IYD G;  2RCN A;  4DV2 L;  4DV0 Q;  4GN3 B;  2JA9 A;  4GLA C;  1V43 A;  3PO3 G;  4GLX A;  3I4M H;  3CMA A;  4A3D H;  5E7N A;  1HNW L;  2OQK A;  4DV4 L;  1KRT A;  4IOC A;  2F4V Q;  5GRO A;  2UUB Q;  1G29 1;  1TWC H;  2BA1 A;  2K14 A;  1GD7 A;  3U4Z A;  1E3P A;  3WWV A;  4JV5 L;  1FGU A;  3G4S A;  1EOV A;  2GVB A;  1QUQ B;  2DGY A;  1TWA H;  2OQ0 A;  1I94 Q;  1WYD A;  5M3M H;  4GN4 B;  5IWA Q;  3F2D A;  2NVT H;  1Y1W H;  3EIV A;  4B3S Q;  4BBS G;  2LXK A;  4X6A H;  4GNX B;  4DNI A;  2XGT A;  1MJE A;  2UU9 Q;  4X64 Q;  1FL0 A;  1Q1E A;  4R4Q A;  3F8T A;  3K7U C;  3U4V A;  1IBK L;  1JMC A;  2E5L Q;  3CPW A;  4A93 H;  2HIV A;  1YHB A;  1K0R A;  4ME3 A;  4DR1 L;  2GN5 A;  2JA6 H;  2JA7 G;  1CKM A;  5C44 H;  4JG2 A;  2KHJ A;  3CCE A;  1I6H H;  4OWT B;  4IPG A;  4DV3 L;  4LF9 L;  1QUQ A;  2K5V A;  3FHW A;  3G71 A;  1GO3 E;  3I4O A;  2CQO A;  3OYY A;  1YIJ A;  4NXM Q;  2R92 G;  1YBY A;  4DV0 L;  3CCU A;  4OWX B;  3KDF B;  4DUZ Q;  1HH2 P;  4A3J G;  5JJI A;  1XMO L;  4GS3 A;  3BZK A;  4GNX A;  1V9P A;  2ID0 A;  4BBR G;  4LUO A;  3GTL H;  3UDI A;  1NJI C;  2RHQ B;  1KXL A;  2KHI A;  2WB1 E;  4LUZ A;  3S15 H;  4QQB X;  3MEF A;  2UXC L;  4OX9 Q;  3KJP A;  3A5U A;  1I94 L;  1PH7 A;  2LSS A;  2IHF A;  5IWA L;  4LFB Q;  2NN6 I;  1SN8 A;  1VQN A;  5HGQ A;  3F2C A;  4B3S L;  4R1J A;  1EUJ A;  3S1Q H;  3I7F A;  1TWF H;  4KI0 A;  3GO5 A;  2UU9 L;  4KHP Q;  1B7Y B;  4X64 L;  1FJG Q;  1N9W A;  2D0O A;  1SRU A;  3UDF A;  5GAG C;  4IJH A;  5M5W H;  3ULJ A;  4PMW A;  4O2D A;  2JA5 G;  1Y14 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...