2RBMA

Crystal structure of staphylococcal nuclease variant delta+phs i72k at cryogenic temperature
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
130
structure length
130
Chain Sequence
KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKKEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS I72K at cryogenic temperature
rcsb
source organism Staphylococcus aureus
total genus 36
structure length 130
sequence length 130
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2007-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2rbmA00
1F2YA 5CV9A 1EY9A 2F0FA 2PYKA 5CV4A 2PW5A 3D8GA 2EY1A 2F0QA 3RUZA 4DFAA 5IGGA 1EYDA 1KDAA 2F0UA 1TR5A 2OXPA 3OSOA 4WRDA 1KDCA 4MIUA 4EVOA 3TP7A 2O4XA 4K14A 2F0KA 4G57A 3SK6A 5C3XA 1A3TA 2SNSA 1SYBA 4F7XA 3TP6A 5C4HA 3BDCA 4K2LA 2EYLA 1SNCA 4K5VA 5F2DA 4KJOA 5I9OA 5CGKA 3EROA 4F8MA 1JOKA 1EY4A 1U9RA 5IIFA 2PZTA 4EQOA 1EZ6A 4KD4A 4NP5A 5IODA 4RKLA 1STHA 2F0TA 4R8NA 1KDBA 5E3FA 2ENBA 4HTHA 3OWFA 1EYCA 4H7BA 5EKKA 2EYOA 3SHLA 5IGBA 2F0DA 4KJNA 2F0IA 2HQEA 3HZXA 2F0EA 3U9OA 1A2UA 4KY6A 3QB3A 3R3OA 5KEEA 3C1FA 3HEJA 3VA5A 5M9OA 1SYFA 2PZUA 2EYFA 3EJIA 3OMGA 5J39A 3ITPA 4B9XA 1II3A 5CV8A 3H6MA 3NXWA 1STGA 2F3VA 4QB4A 1SYCA 2EYMA 3QOJA 3NP8A 4YIJA 3SK8A 5KIXA 3MVVA 5C6AA 2F0HA 2SOBA 5E1FA 1A2TA 4PNYA 5JAVA 2F0NA 4S3SA 4DU9A 1SYDA 1KAAA 2F0WA 4KY5A 4NMZA 5CV5A 1F2ZA 1JOOA 4K2KA 2F0JA 4ID6A 3D4DA 3SK4A 2F0OA 1SNPA 2PW7A 4ME5A 3SR1A 5K5PA 2RBMA 3MHBA 3LX0A 4EQPA 2F0GA 4IALA 3TP5A 5HGTA 5I6WA 4K6DA 4HMIA 3OMCA 4NKLA 2QDBA 5I6YA 3P1HA 3NK9A 4E6IA 2EY6A 1EY8A 2F0PA 2M00A 3S9WA 5CR3A 5CC4A 4DGZA 3PMFA 4K5WA 1SNOA 1TQOA 3TMEA 5C3WA 4PMCA 5J1ZA 1SNDA 2PQEA 4TRDA 4K8JA 4LAAA 2SNMA 3ERQA 4NDXA 4K5XA 4ZUJA 4K8IA 5C5LA 3T13A 3V2TA 3C1EA 2F0MA 1NSNS 2F0LA 4EQNA 2NUCA 5I9PA 1EQVA 1AEXA 1SNMA 2EY2A 5HURA 3NQTA 1F2MA 5CV7A 2F0VA 1EYAA 4OL7A 5KGUA 4ZQ3A 4J1MA 1ENAA 1RKNA 1JORA 4PMBA 4ODGA 5IGFA 1NUCA 4DF7A 1SYEA 5J22A 3MXPA 1STBA 2RDFA 1TT2A 2EYJA 3QOLA 4KV6A 5DEHA 5C5MA 4B9WA 2F3WA 4ZUIA 5NUCA 1STYA 1EY5A 5KRUA 1IHZA 1STAA 4QMGA 1A3UA 3NHHA 3TP8A 2EYHA 3P75A 2EYPA 3EVQA 4RKBA 2OF1A 5IGEA 4KY7A 2EY5A 1ENCA 2KHSA 4J6HA 1JOQA 4IUNA 5DAUA 1SNQA 5EGTA 2RKSA 3D6CA 4N9PA 5IOCA 3D4WA 4KHVA 1EY7A 4IZ8A 3T16A 4KD3A 1EZ8A 1A3VA 3MZ5A 3DHQA 3NUCA 1STNA 5IGDA 5KYLA 3MEHA 1KABA 2LKVA 3DMUA 3SK5A 5CV6A 1EY0A 4QF4A 2EXZA 1SYGA 2PZWA 4N9TA 5C4ZA 2KQ3A 1EY6A 2OEOA 3E5SA 2F0SA 4KTAA 4WORA 2WACA 5EKLA 3BDLA 4I65A 5ISRA 3SXHA 4HMJA 5JOBA 5KYIA 5IGCA
chains in the Genus database with same CATH superfamily
4JBWA 4LFAL 2NVQH 2WB1E 1WI5A 1LT4D 3CQZH 4K14A 5IP9G 4AYBG 1JMCA 3OPOA 3CPFA 3HOWB 4P74A 4ABNA 4CBVA 5C0XJ 3K57A 4DV5Q 4JI0L 1JC7A 1EY4A 1Y1WH 3A5UA 4A3DG 3UDFA 4FXDA 5IGBA 1ENFA 3S2DB 2E8GA 2B63B 5AJ3Q 2E2HB 3L3OC 3R3OA 2NB0A 2H4OA 2IJ0A 1KNEA 4PZ7A 3PO2G 2BH8A 4IFDI 1WJJA 4X3TA 2VNUD 3BG3A 3SE0A 1VQ6A 1HZCA 3GQBA 2WB1B 3QOJA 2IHEA 1J8IA 4C56C 4PNYA 2K04A 2C9OA 4BBSG 4X3UA 3UE1A 4AQYQ 2F0WA 5IP7G 5CV5A 3L0OA 2VY3A 1YNNC 1B1ZA 4R4CA 4ME5A 4EQPA 2NVQB 1F9SA 4GNXC 2XRSD 1EY8A 3CQZB 3QO2A 4IN3A 4FO2A 3MXUA 4B3ML 1DYQA 2HUGA 3TS0A 1STEA 3A74A 1Y1WB 4OL7A 5CBAE 1RTOA 4YHHQ 1JORA 1IBKL 3PSIA 4GN5A 5DEHA 2ZXOA 5G3LF 4FDBA 2NVTH 4IPGA 3M85A 3T51B 4X64Q 3PCOB 1WCMG 1ICWA 4I7ZC 1PXUA 1H9SA 1IW7D 2IT1A 1SE2A 1XTDA 1OXVA 4RGOS 2B2YC 3GV3A 3K58A 3VDYA 3DM3A 2ICEC 3TREA 4DR6L 4P2CB 2UXDQ 1GJXA 1TS5A 2KQ3A 1Z6HA 5ISRA 5M5XH 1DOKA 2NWGA 1NTGA 2PW5A 1MSHA 1PYSB 1WTRA 1LT3D 1DXMA 3I7FA 2B29A 4GOPB 1BUVT 1HZ9A 4LF5Q 1TKWB 5JEAH 4A3GB 4R4TA 4AQYL 1B9MA 2PZTA 1GO3E 3CD6A 1EZ6A 3NE5B 4IUQA 2Q2IA 4ZKBB 4A3MG 2GVAA 2K03A 5EKKA 1TY0A 4HCEA 2F0DA 2Y0SG 5LL6S 3RMHA 4X62Q 2NVTB 2HQEA 1HTLD 1D5MC 1M4VA 2XRQD 1HA6A 4LFCQ 1C0AA 4M8AA 2ZM6L 2V1CC 3LWEA 2N88A 3MVVA 4JI6L 1GOZA 4HIKA 4DV1Q 4S3SA 4LUVA 5EBCA 2ASBA 3KYHC 1MBYA 1PH6A 2BA1A 4BA1I 3CP0A 3D4DA 3HOZB 1SNPA 4A3BG 2K6AA 4YY3L 2A69D 3ND9A 2G9DA 4FXKC 1CK1A 4NKLA 1EWCA 3BU2A 3P1HA 2A19A 5LL6X 5C3EB 5IYDH 5C4JH 5GROA 1TWAB 5C3WA 4GZYC 1PRTD 2B2TC 1CQFA 2GN5A 2X6GA 3NSWA 3G71A 2ZJPA 3PUYA 5TSSA 2WFWA 1O7IA 4FNFA 1E3PA 1YZ6A 4BBRH 3J80L 4C3HG 3A8KE 3EBEA 4MTNA 3V96A 1WTXA 4FF2A 4YCUA 1SE3A 5ELDA 2NVXB 3FPUB 1E2VA 4MN3A 1SFOH 3A55A 2RA4A 3S2HB 5JVG3 4DR1L 2Q2HA 4J8QA 4F88A 2LXJA 4C2MH 1IBMQ 2AUKA 3CCRA 3I73A 2VW9A 2Z8LA 1CA6A 1SNQA 1F9PA 1EEID 1Z47A 2XWJB 4KHPL 4Z9CB 3WOFA 1EY0A 3PGZA 2HT1A 1D5ZC 4KTAA 1RF2D 2XGTA 3CC4A 2VL6A 3K0YA 4P72A 3KLRA 2M9VA 3CCEA 1EWHA 5CV4A 5C4JB 3K5LA 1QNUA 1EYDA 2K14A 3HS0C 3OSOA 1TR5A 4JYAQ 2UUCQ 3CC7A 4PV1C 2VQEQ 4A3JH 2SNSA 1LO5D 1LABA 4IO9A 2EQSA 3TP6A 4K2LA 1YNJD 4RH6A 1MKHA 3VR5A 4A3KG 1A8VA 2RQXA 4DR7L 2YTXA 1STHA 1KDBA 1AH9A 4JBJA 4ZLTF 1W3SA 4GN3B 1YJNA 3H3VH 1SFOB 1B50A 3E9IA 3MXNB 5KEEA 1SRUA 4QY7A 5M3MH 2EZVA 4YCVA 1L0XB 1V43A 4CKCA 3GTGB 4JCVE 3VYTA 1D7QA 3S14B 3K6OA 1VQJA 1R4QB 4LJZC 2ATWA 1VCIA 3BVMA 2Z6BA 4DXFA 1BDOA 4X3KA 1A2TA 3C46A 3X3NA 1TVXA 1CKOA 1BBXC 1CT1D 2MUYA 3KF6A 1K3BC 1FVIA 4ID6A 5K5PA 2LY7A 3MHBA 1N32Q 5I6YA 1O80A 1X56A 3I72A 1TWCH 4A3LH 2FMMA 1IBML 1TQOA 2N78A 4A3JB 3QR8A 2RDGA 3C2PA 4HJ9A 1ASYA 4ALPA 4A3IG 3J81i 1Q3LA 2LFNA 2L5TA 5K36G 2F4IA 1F2MA 4A93B 4CDFC 3JAMi 1QNKA 4IOCA 2ZJQA 1O7ZA 3MTSA 3PIPA 1VQPA 1FGUA 3FHWA 1LTLA 1STBA 2Q2UA 3AMUA 4JC0A 4DV6L 4IPDA 1L1OC 2VS1A 5M3MB 1I4PA 3NHHA 3TP8A 3EVQA 2CQOA 2EXDA 1FYCA 2I07B 4V0BA 4JI3L 3K7AB 1EZ8A 5M3FG 3PO3G 2R7ZB 1KABA 3H3VI 2K32A 4GKJL 1PLFA 3OTOL 3VR3A 2RF4A 1P8LA 4MNOA 4I65A 4LUZA 4LK1C 3CC2A 1TWCB 1AN8A 1BCPB 3S17B 3G48A 1L0WA 2L11A 1X6OA 1HJPA 2O4XA 2HDLA 3A54A 1Q1BA 4MHEA 2ZJRA 4G4KA 1FNUA 5GAGC 4BY7G 2G5DA 2A5HA 1SROA 2KCCA 4DK0A 4NP5A 1EU3A 2MFIA 3AFQA 4IJHA 4LUOA 1Q81C 3BVZA 3NBHA 1A63A 1H9KA 2JA6G 1LACA 1HFNA 1HR0L 1K8AC 2PZUA 1WD1A 1NMFA 1Q8KA 5CV8A 2PQAA 2KEDA 4JI5Q 1VDZA 4Y7NH 1MJEA 1XPRA 3SK8A 5FO7B 3K0XA 2OQ0A 3J7AF 4PMWA 2JA7H 3FEWX 4IUVA 1HNZL 4OX9Q 1WD0A 1OO9B 1B70B 1PFBA 3RNUA 2J7ZA 3HOUG 1VF7A 2HIVA 2F0JA 3M4QA 1VQ9A 2L9HA 4JPBW 3CU7A 2IPKD 2RBMA 1YHBA 3P7JA 3MAQA 4LFBQ 4JI4Q 1D8LA 5COYA 1FGBD 2EY6A 1B2TA 3HKZE 2OT2A 3MC0B 5C4XG 2NYZD 2A74C 3DWQA 4IUPA 4DGZA 4ZK9B 4GOPA 1H95A 2DGYA 2JA5B 5GADC 4QCLA 2V4DA 4HSVA 3IFDA 1HUNA 1FR3A 4DV2L 3KK7A 1PMRA 2WAQB 3HOXB 1EFID 1AE3A 1N33Q 4MZ9A 1ZYRD 2MPMA 1CHPD 2R92H 3J7A5 1TT2A 4OELB 1VQCA 4KV6A 4A3EG 1Y1VH 1B3AA 3UDIA 1GUWA 1KRSA 2MJ8A 1DJRD 1SEBD 3J80c 4HCSA 1X3FA 4DV4L 1UE6A 3QG1A 2HD3A 5IYBH 1F77A 3HKZB 5T1GA 1V9PA 2E5LL 4IZ8A 2KECA 3NUCA 2I5MX 4RAUC 1EWIA 5JVH3 1DOMA 4FXGC 2NVYH 3I4MH 3GTLB 4IPHA 3FKIG 1JR0D 1BQQT 5M5WH 5ELEA 1ILQA 1U0LA 1EEFD 1CQVA 2F0FA 5C0XG 1BCPF 1G8ZD 1KDAA 1WTPA 3J81E 4JI1L 1SE4A 4G57A 1CZGA 1YBYA 1CFMA 3Q23A 3I4NH 3S1NH 1MGSA 2EYLA 5C44H 2BCOA 3JAME 3BDOA 3MFYA 5CGKA 1T5EA 1JOKA 2OCEA 5EPLA 3H0GB 2HDMA 1A0IA 4C3IH 2R92B 3Q8DA 1J6QA 3E0EA 3OWFA 1IL8A 1EYCA 1VQGA 1Y1VB 3R8BA 1WTVA 1D1IA 4IURA 3STBC 1A2UA 2IX0A 3QB3A 2AQ2B 4JI4L 1XTCD 1QVFA 3PF5A 1XPOA 3HOYB 3D4RA 3OMGA 5BN3A 3GTKB 2OQKA 1PH4A 1CA5A 2CWAA 4PZ8A 5E1FA 4L8JA 3AEVA 2NVYB 3I4MB 2CCZA 3MXGA 2EJMA 1YITA 5IP9H 1N33L 1F2ZA 5M5WB 2HHHL 3L7ZC 3LWUA 1UE1A 3VYUA 2DY8A 3TP5A 1RODA 4FF4A 3MA2B 2NN6G 2B2UA 1Q12A 2RSNA 2VB3X 4GKKQ 4YWMA 1VQDA 5LMNQ 4KHZA 4KK7A 3BZCA 4GNXB 4HEDA 3I4NB 3S1NB 4AYBE 2I0QA 2M2LA 5FJ8G 3S16H 3H94A 3T4AC 1SJED 3PO2H 1LT5D 1BCPD 5CV7A 3S1QB 2UXCQ 3TRZA 2A6HC 4CHTB 2CVRA 2PMZE 4J1MA 4OGQC 2PO4A 1NUCA 1PTOC 5ELCA 1HNWL 1Z9FA 3F8TA 5FK9C 4BBSH 1STYA 1A3UA 5IP7H 1LTBD 2LXKA 2K4KA 1X3EA 2K7VA 3I90A 4KY7A 2EY5A 2IX1A 2BE5D 2R93G 1RJTA 1A15A 3KF8B 1J5EQ 2EJGC 1NY4A 1K0SA 2NBFA 2EXZA 3BVGA 4AYBB 1AFPA 3I55A 2TMPA 1A6XA 2F0SA 4H0LC 1ASZA 3GTMH 3VR4A 1X65A 2PMZB 1H9MA 4DK6C 4N8X1 4DAVA 2CW0C 5IT9E 5EPJA 3D0FA 5C3XA 1JJ2A 1I94L 3S16B 3PO2B 4DN4M 2AKWB 1PH9A 1WCMH 3N6RA 1OXSC 1G291 1UWVA 2IHFA 3KF6B 4UAIA 3K80C 4BBSB 1JWSD 3Q6SA 5D65A 3KOJA 2KJXA 4GKKL 3TSSA 1BBUA 2UXBQ 3NXWA 4UDUC 2K28A 4DR4L 5C6AA 2MNAA 1Y69U 2D2CC 4XQNA 1CM9A 5ELBA 1R4PB 2DJGC 2F0NA 1B9NA 2PCFB 4RFBA 4WJWA 5IT9c 2UXCL 3T1HQ 1BNZA 3GTMB 3M4OB 4OO1G 4LF4L 2O5IC 1Y8OB 4OIKA 4YCWA 3PUWA 4K6LA 5DM73 4A3FG 4GLAC 1DOLA 1ICFB 2ZXRA 4R4QA 1NR4A 4A3MH 3NTHA 2QDLA 1JJGA 4X65Q 4NDXA 3V2TA 1OXTA 2Q8TA 2FINB 2E75C 2NUCA 1K8OA 4LWCA 3E9HA 4GN4B 1AP0A 3O13A 1N36Q 3F2CA 3I8ZA 1TY2A 5IE8A 4DF7A 2MO1A 5J22A 1WTHA 4U68A 2B39A 2Y0SE 5CYUA 3NTKA 1K8GA 3OOCA 1M1KC 2QKIC 2A1AA 1EY5A 3ULJA 1CTMA 1UAPA 1PYWD 4P71A 1I50H 5ELOA 1ENCA 4A3BH 4J6HA 2Z1CA 3I4LA 4LF7Q 1I4XA 2RKSA 1VQ5A 1HH2P 2C35B 1IW7C 1RHPA 2R61A 4DKAC 2F03A 4QF4A 2IY5B 1YJWA 3GTQH 1YI2A 4JI8Q 2PZWA 3ERSX 3G6EA 3CKIB 4X66L 4JG2A 1GUNA 3NBHB 3OIPA 4C3HH 4IFDG 2K5HA 3HOWG 4MIUA 2UXBL 4ME3A 2F0KA 3SK6A 5EBDA 2PQAB 3J7AV 5EAYA 4HIMA 4GLVB 1H9JA 5DLQE 4B3RQ 4C1NK 2A6ED 4I7AA 2B63G 4IOAA 2WP8J 3F2UA 3VYSA 1OXUA 4F8MA 3U9SA 5FO9B 4DV5L 3K81C 2K5QA 5E4WC 3HG9A 3A56A 5L37A 2ENBA 3MEFA 4B08A 2EJFC 2QW7A 5AJ3L 2AHOB 3C1FA 4RWSC 1I50B 1JQYD 3GTPH 1SYFA 5J39A 3F1ZA 4FP5D 4A3BB 3WDNA 3H6MA 2B2VC 2FXQA 4KI0A 3HP3A 1RD9D 2OTLA 3GTQB 1Z7TA 2RHSB 4RMFA 1SYDA 1KAAA 4UP9A 1DZ1A 1ILPA 1PH8A 1PDQA 4RGNA 4CDEC 1BBWA 2GA4B 1AZQA 4A3KH 3EFXD 5D14A 2A69C 4R4IA 4KMUC 2WIIB 1FNWA 1ZKOA 3W1BA 3UE0A 1U4MA 3CMEA 2NZOA 1GM5A 5G3LD 1PRTC 1QUQB 4JI8L 1TS2A 1F9RA 4YHHL 2K33A 5M5XB 5A2QE 3MXPA 3ULPA 4B9WA 1GUGA 3QJYA 4ZUIA 4G7HC 1OXXK 1YIJA 3FPPA 4X64L 1PZJD 2I5LX 1NCVA 5BR8Q 1XYIA 3EIVA 3GTOH 2E2DC 4XDXA 1B44D 4EQ5A 4B3RL 1SAPA 2QGQA 3ONAB 2L1BA 4JOIC 1E2ZA 1XMQQ 1IXRA 1HR0W 1EOTA 2UUAQ 1NNXA 2UXDL 1PH2A 1EY6A 3E5SA 4A75A 4A3IH 2WACA 3FRPB 1N34Q 1UNSA 1PH3A 5K36H 1S5CD 5KNCA 5GAEC 3RUZA 4A3GG 4RG1A 4GNXA 2JEBI 1SYBA 3BYYB 4UPAA 5C4HA 3WOEA 2K50A 3W5OA 4LF5L 2KEEA 2N3SA 4K5VA 3CCUA 4P73A 4KJOA 2K05A 1K73C 4XYQA 2E2JH 1YNJC 5H1SE 1I6HH 3DWPA 3ICEA 5BN4A 4H7BA 1JT8A 5M3FH 3PO3H 4KJNA 2X69A 4X62L 1U4PA 2EYFA 4R9WA 1S5ED 3ITPA 1QCBD 5IYCG 4KN7C 4LFCL 1HPCA 2TSSA 1WTOA 3PIOA 1QWYA 4DV7Q 4DR2Q 1N8RC 3T1YQ 2F0HA 2SOBA 3HOZG 3KF8A 4BBRB 2KHJA 1EQRA 2XTIA 4BA2I 1K28A 4DV1L 4IFDJ 5C3EG 2B2YA 3H15A 3IFTA 3K5MA 2EOTA 3SR1A 4DNIA 4RHSA 5I6WA 3D6WA 2UU9Q 1ML0D 3NTIA 4C2MB 5ELFA 3E3XA 4LAAA 2SNMA 2Z6KA 1HRJA 4A76A 3VR2A 1NSNS 4B3TQ 1D5XC 2CFMA 4XTCS 4JI7Q 3JAML 4BWGB 1I6HB 5D3DA 4U673 2XNAC 5FKAC 3PO3B 4PMBA 1GUOA 1K9MC 5IGFA 1B53A 2CWPA 2K75A 1KAWA 2LSSA 1N34L 3DLLA 1PH1A 4GOPC 1VF5C 3IL8A 1T5XD 2MGSA 1QVCA 2XN9C 3NEMA 4OWTB 3TN2A 3T16A 4F87A 1IYVA 1A3VA 3MZ5A 4Q0FA 5E7NA 2P5ZX 5C4XH 1Q46A 2J4XA 3DMUA 3SK5A 1SYGA 2CQAA 1SXTA 2KENA 5EJWA 4N9TA 3M3YH 4UY8C 4TKOB 3AU7A 3BDLA 1XWEA 3DWAA 4JK1C 2K5WA 4EX5A 3OYYA 4OWWB 2EY1A 3PV0A 2WKDA 4DFAA 3TS2A 4TVAB 2BDNA 4DV3Q 5ELNA 4HJ5A 4G7ZC 2UUCL 4JYAL 3HOVG 4A3EH 2VQEL 3EN2A 1KNAA 2RHQB 3ULLA 1XMOQ 1SNCA 2KCMA 5F2DA 2B2TA 2A8VA 1AE2A 2DJFC 4H13C 1O7YA 2EPBA 5LMUQ 4R8NA 2E74C 3CHBD 3VA7A 2KVMA 3P20A 2EYOA 5CORA 4PQXA 2O2LD 1VQBA 1A62A 3NWTA 4LF8Q 4R1JA 1B7YB 4KY6A 2JA8H 3OHXC 4NPSA 1HNXQ 3FKIH 4CJ1B 4B9XA 1PTOH 2HCIA 3EA6A 2F4VQ 2F3VA 2OWOA 4YIJA 5C4XB 3PIP3 5C0XH 3RD4A 1IL2A 2ALYB 2DNEA 1E0BA 1E22A 2SEBD 2JYOA 3K7UC 3OW2A 3M3YB 4KY5A 4NW2A 2JP1A 2ZTDA 3R2TA 4G7OC 3FP9A 1VMPA 4DR5Q 2Z9HA 4ZAIA 4DR3Q 4HIOA 1G6PA 1N32L 2E76C 5JJLA 4E6IA 3A8IE 2ZT9C 4DK1A 4C3JH 5IT9L 4A93G 1MJCA 4DNRB 1VQHA 3ERQA 4ZUJA 4PG3A 1EIHA 1EQVA 2VUMG 2BA0A 2EY2A 5KGUA 2HQLA 2WINB 2HCCA 3CCQA 5EQ0A 2HIXA 2RDFA 2KUMA 1ZYRC 2JA8B 3M4YA 1JWUD 4L5RC 1PTOB 3JC66 2R7ZG 3SDZA 3PF4A 1V1QA 4DV3L 4KKSA 4DXGA 1U4LA 4UP7A 4KHVA 3CXCA 2Z4IA 1G2TA 3MEHA 2LKVA 3NBIA 2VQFQ 1V1PA 2B3GA 4CJ0B 1BVSA 4XYOA 1M8AA 5EPKA 2L4NA 5LMNW 5FJ8H 4CJ2C 1TXYA 3I4OA 3X3MA 4J15A 3W1GA 4C3JB 1WVLA 1ONLA 1D6EC 1S5DD 1C8CA 2DUDA 2NTSA 3KUPA 1IBLQ 3KLSA 4Y7NB 1X9NA 2F4VL 2FFKB 4DV0Q 1BKBA 4AIMA 4WJ4A 3T56B 3BDCA 3VYRA 2JA9A 4OEMB 1UEBA 3CCVA 2JA7B 1EL0A 1QUQA 1TU2B 1CHQD 4EQOA 2R93H 1TWFH 4DR5L 1UUPA 4DR3L 3G4SA 2E2IH 2WV6D 1PH5A 2B2WA 1GUTA 1GXDC 2A73B 1BXTA 1L1OA 3J81j 2KBNA 4BXXG 2OTJA 3OW7A 2L15A 4JI5L 4NB3A 3I70A 2YU9H 4QB4A 2EYMA 4B3SQ 2EE1A 3NP8A 3H3VC 4TSSA 3K5OA 4TQUS 4FF3A 4DUZQ 4OX9L 4KLKA 3IAYA 4O0AA 3LX0A 4IALA 2JA5G 5FLMG 4LFBL 1K0RA 3S9WA 1HZBA 3S15H 4R4OA 3TMEA 3HOXG 4TRDA 2WAQG 3I2ZA 3LGJA 4XT3B 2AQ1B 1EIGA 2QILA 3W3AA 1LTGD 2N49A 2Z0SA 2R93B 3J81c 1TWFB 1X3QA 1H9RA 1BCPC 1EOVA 1SSOA 1KXLA 5C5MA 2MHVA 3JAMc 5AFWA 2L0CA 3KLWA 1G51A 1PTOF 3NWSA 1RL2A 4PZ6A 4OO1H 4A3DH 1PHJA 4RGTA 1AZPA 3TBIB 3WWVA 5IOCA 3D4WA 2BE5C 5C44B 4A3FH 1O78A 1I4HA 1SMYD 3D31A 3K8AA 5M5YH 4C3IB 2ES2A 2B8GA 2H5XA 3LNNA 2FMCA 3DM1A 4BY1G 1VQOA 4HMJA 4LFAQ 1EY9A 2K1BA 3S15B 1SR3A 3A8JE 4CDDC 4FVMA 3TP7A 3H0GG 4OXPA 3C3LA 1F2LA 2CH4A 3PUVA 1HUMA 3A5ZB 4JI0Q 3OWEB 1HFGA 5IIFA 5KNDA 5IODA 4DUZL 3HOYG 4HTHA 2A68D 1ZEQX 5A2QL 3ER0A 1EYGA 3IRBA 4A3CG 2BH2A 3UDGA 1QOHA 5I2YA 1CZWA 4RHRA 1C7YA 4A3DB 3AFPA 1KQSA 4KKTA 2X6LA 1EFWA 1MSGA 2KOLA 1SMXA 3E0JA 4A3FB 4LW1A 1E2WA 4XT1B 4IFDH 3HOWH 5M5YB 3BYTB 4XXEA 4HAEA 1DONA 3D3RA 4RA8A 1KLUD 5BN5A 1RTNA 4XQQA 3BZKA 3IKJA 1JOOA 2AWNA 2RCFA 4V190 2PW7A 3TZDA 3S2DH 1QE6A 2B63H 1VQKA 4OIJA 2E2HH 1Y8NB 3CRLC 5CC4A 3PMFA 5LMNL 4ULLA 4IUTA 4XQJA 2PPBC 4K8JA 1QJOA 2PI2A 5I4DA 3C1EA 2J0TD 1Q82C 1AEXA 4IJLA 3HKSA 4R8IA 4ILWA 1IBKQ 2Q8IB 4L5TA 1JWMD 3BS1A 1HZAA 3W2DA 2PNRC 5NUCA 3P75A 1OTCA 4LNQA 1B3QA 1BF4A 4YWKA 4X3SA 1HQMC 1K83H 1WCMB 3KBGA 4XIGS 1J5EL 4DR6Q 1X3GA 3PUXA 2K5NA 1NE3A 1ET6A 2OEOA 1NJIC 2VZAA 1LYLA 4QUFA 2NZHA 2Q8RE 2DN8A 1YEZA 5I2XA 2UUBQ 4JI2Q 1W6KA 1GKHA 4BS9A 1VQ7A 2JEAI 4JBMA 1WOCA 1BO0A 2A6EC 5FLXE 4RCNA 1KRTA 1I4GA 3SHLA 3DEPA 3PQIA 1PYBA 3HZXA 1TWGH 2F0EA 1I4QA 3HRZC 2YV5A 3VR6A 4A3MB 1DD2A 1FNVA 3M4PA 1II3A 2Y0SB 1S4ZA 2ZM6Q 2ZXPA 1YNXA 2IWHA 1K83B 2F1MA 1ESRA 3KDFB 4JI6Q 4A3GH 1IKMA 1YNND 4NMZA 1MI2A 1YJ9A 4IUUA 3T1HL 3H91A 4JBKA 1M90C 4YY3Q 1D1KA 1BR9A 3RR5A 5HGTA 3FMCA 2D5DA 3OMCA 2QDBA 2QEJC 2WB1G 3NK9A 5FLXc 2M00A 1K3RA 1VS0A 4QGUA 5J1ZA 3SVMA 4X65L 3NQIA 3T13A 1KLGD 5C5LA 1Q86C 4H02A 1Q7YC 1XXGA 1KD1C 2H1EA 5DNFA 4O1NA 5IYCH 2LS01 4ZQ3A 1N36L 1G6ZA 1V1PB 1PRTF 3DXJC 1PFMA 1SYEA 3MFGA 1TWGB 2NZ1D 2EYJA 3HOZH 1CUKA 1W6JA 4OHJA 4FF1A 4C3HB 2Z6KC 4DR1Q 5C3EH 3GDEA 4A4IA 2UUBL 1LTRD 3E6ZX 4JI2L 3MWYW 1CSPA 1TWAH 2KHSA 1Y1WG 4LF7L 4N9PA 1LTAD 4KHPQ 4APVA 3ZJYC 3DHQA 1STNA 3G6JB 4HIDA 2MO0A 1YVCA 2RSOA 2EDGA 1CSQA 4POGA 2NVXH 5JOBA 3HGBA 2R7FA 5CV9A 1VQNA 3GTPB 4ZKCB 2F0QA 3S2HH 2JSOA 1HA5A 4WRDA 1L1OB 1L0YB 4IPCA 1TS3A 4F7XA 2EIFA 1C48A 5T1IA 1TWHH 4DPGA 5I9OA 2IL8A 3EROA 4DR7Q 1E7ZA 2DNCA 4IQZA 5JPMC 3OIQA 1JB3A 1MD2D 2KCTA 4A3KB 4UP8A 3RZOH 5M9OA 3R93A 3GD7A 3HEJA 2N55A 3FVQA 1UE5A 2GVBA 3KLSX 1PH7A 1C4QA 1O7LA 1BOSA 3CCSA 2N8NA 1R9TH 1C9OA 4DNTB 1KHIA 4DU9A 4DUYQ 3GTJH 4LF9Q 1HTPA 3A7LA 3HOVH 1PFSA 1VQIA 4K2KA 2I46A 4QIWE 2G9HD 3J7ZC 3F2BA 1B8AA 3ND8A 4AH6A 1ESFA 2F0GA 4K6DA 2D9UA 3A0JA 1L2FA 3RLOA 1GHJA 3GTGH 3GTOB 4PMCA 3S14H 1G2SA 1I3QH 4K5XA 4ZCKA 1QB5D 1TWHB 1SNMA 4KN4C 2ID0A 2F0VA 4A3IB 4JW0A 2R7DA 3J80i 2DY7A 3RZOB 4DV6Q 4BY7H 3CF5A 1PZID 1IHZA 5KRUA 1QVGA 4QMGA 4QIWB 5JEAG 4CKBA 1V1OA 2D0PA 4DAPA 5BR8L 3J81L 3Q0AA 1JOQA 4JI3Q 1Y14B 5EGTA 3U4VA 4NXNQ 1GVPA 1JE5A 1R9TB 1EQTA 2JA6H 4GKJQ 2E2JB 1UEAB 2B2VA 3GTJB 4HJ8A 1XMQL 3OTOQ 3HOVB 3KJOA 4A93H 3EQLC 3NENA 4OWXB 2UUAL 5IY0A 1NMGA 2R6GA 1TIID 1Y8PB 2WKCA 3NPPA 5EKLA 5M3FB 3AB9A 1VQFA 4FYDA 4HR7B 2VUMH 2KA7A 3PIO3 5IGCA 5GAHC 3Q24A 4QUCA 5JJIA 5IGGA 2BDOA 3M9BA 3TDQA 2PI2E 2F0UA 4EVOA 2EVBA 1NBWA 1KDCA 1I3QB 3HOUH 1A3TA 2L12A 3SGIA 3K7AH 2D62A 2YTVA 1CKNA 3BZDB 2R7ZH 1I5FA 1LLRD 3FDTA 1U9RA 5IYDG 4DUYL 1X54A 4LF9L 1RDPD 2F0TA 2JN4A 2ZTCA 2B8FA 1VQMA 4BY7B 4DAYB 2F0IA 3K5NA 3U9OA 1HR0Q 1E1OA 3VA5A 3V05A 3EJIA 3TZUA 3S17H 5J3BA 1LM0A 4BBRG 1W2BA 1MIUA 4JV5Q 2JA6B 4H44C 4DV7L 1T9HA 4DR2L 1S5BD 3T1YL 5JAVA 3G7LA 1HNZQ 2ICIA 1X3PA 1P16A 4MTKA 2B2WC 4JOIA 1S5FD 2RDHA 2MP1A 2VUMB 2F0OA 3TQYA 1X32A 5CBEE 1HCZA 2PNHA 2SDFA 1YHAA 2VXWA 2UU9L 3GV6A 5KNBA 1WTWA 3HOUB 1G91A 4K5WA 1TS4A 4LF6Q 1YHQA 4K8IA 4NXNL 1QZGA 3J7YW 1IZ6A 2AMCB 4B3TL 4JI7L 4DV2Q 3NELA 5HURA 4BXXH 1EYAA 5HY6A 2JXMB 1RKNA 3KBXA 4A3JG 4QJFA 3Q22A 4Q5VA 1VQAA 1X55A 4POFA 4DV4Q 2EYHA 2Z4HA 2VB2X 4QQBX 4RKBA 2OF1A 3GO5A 3RZDH 1SLJA 1FD7D 1AW7A 3F2DA 4A3EB 1EIYB 4IUNA 5DAUA 1XNQQ 5GQOA 5CMDA 2E5LQ 4K0KQ 1EY7A 1HXYD 1J9OA 3KDFA 5FLMH 2AUJD 2JA5H 1KL9A 2JQOA 1V8QA 3T53B 4RGMA 3HOXH 5M3MG 1Q1EA 2QF7A 4EGVA 2B2UC 1KIXA 1IYUA 2D0OA 1FL0A 4X6AH 4Y52H 1F2YA 5IWAQ 1XPUA 1VQ4A 1DM0B 3FKIB 1PV4A 1QG7A 2OXPA 5EKIA 4JI1Q 3CCLA 3AYHB 4DK3C 2WAQE 1VQEA 4JV5L 2NN6H 3QWNA 1XMOL 1LV9A 2RVLA 4O2DA 1ZXTA 5HGQA 3J80E 2JJQA 5JEAJ 4KD4A 4A3LG 3GTLH 1KC8C 5E3FA 5LMUL 2XWBB 3CMAA 1XJVA 2XIWA 3B6YA 1EU4A 1JB7A 4LF8L 1IYJB 4UHVA 3RZDB 1PA6A 1E1TA 1HNXL 5C0XI 1UE7A 3N52A 4LF6L 4BY1H 1F9QA 1H9SB 3CW2C 1STGA 1E24A 1Q90A 5LHY1 2R3ZA 3RN2A 5KIXA 5JPNC 1B4OA 3BJUA 3KJPA 4M1UB 4C1NI 4WJ3M 2CH4W 3H0GH 4NXMQ 1LT6D 2HHHQ 4P75A 2Q2TA 3SK4A 4O42A 1RIPA 2QCPX 1JCKB 3HOYH 1IKLA 1DGSA 1SNOA 2YTYA 3GTKH 1PVOA 1WFQA 1XNQL 3KFUA 1GHKA 5FOBB 2C5CA 4A3CH 4L5QA 3U58A 4K0KL 2QA4A 2F0MA 1S72A 1SBBB 4EQNA 1D2BA 3CAMA 1QZHA 4HJAA 1CI3M 1K8MA 3NQTA 2JA8G 1XNRQ 5FLXL 4ODGA 1HNWQ 3RLFA 4CGYB 4L6TB 3L9AX 2F3WA 2K5DA 3U50C 3ZYYX 5IWAL 2YYZA 1XX8A 1GUSA 1LTTD 2NN6I 1EIFA 3CCJA 4BY1B 3S1MH 2NTTA 2CKZB 5FO8B 2XVSA 2O5JC 5DM63 1N9WA 3D6CA 4ZYSA 3S1RH 2IX3A 2I5HA 4QL5A 5KYLA 2MQHA 5CV6A 1PZKD 1NAPA 1KTKA 1U5KA 1SMYC 2VQFL 2K5VA 3S1QH 4C3JG 3I91A 3U4ZA 4GLXA 1HQRD 4WORA 2KCNA 1WTQA 2F52A 3SXHA 2E2IB 5KYIA 1Q8IA 3I3CA 2PYKA 3L2PA 3RN5A 3D8GA 3HKZG 2K01A 2JA7G 2YU9B 1IBLL 1I94Q 3PUZA 2FHTA 4HN7A 4JVZA 4DV0L 1QILA 4CDCC 1MHWC 2JK8A 1VMCA 1PFNA 4GS3A 1EUJA 4RKLA 4NXML 1LTSD 3M7GA 3STBD 2ZTEA 2A68C 1FJGQ 1DCZA 3S1MB 4ZRZA 2FJ2A 1HHVA 3S1RB 4DR4Q 5E4XA 4N8FA 3A7AB 1SYCA 1VQLA 2R92G 4B3SL 1SE8A 2KHIA 1Y1VG 5JJZA 1XNRL 3UDXA 3SEBA 1JE4A 4OONA 1LTID 1NR2A 4LF4Q 2L55A 2XSCA 4CKEA 3MXNA 5IYBG 3I56A 1JJCB 2QEXA 4HMIA 3K59A 2F0PA 2AWOA 4DAMA 5CR3A 3UI2A 3I4MG 1SNDA 2PQEA 4KKUA 1S40A 3URYA 3S24A 4WFN3 3HFZB 2K52A 2F0LA 1VQ8A 2A6HD 1SJHD 1JICA 5I9PA 3QIAA 1S3OA 1PTOD 1WYDA 1ENAA 4DA2A 2CHBD 3M4OH 1EQQA 2LMCB 3DEOA 3QOLA 4DAYA 5D3IB 4OO1I 3CRKC 2F3IA 1GD7A 3R2IA 1SDFA 1STAA 3I4NG 5C44G 2EYPA 1I4RA 5JJKA 4L63B 4LMQD 4L5SA 5IGEA 2RCNA 1RCVD 3GP7A 3M7NA 1ET9A 4C3IG 4HJ7A 5A35A 4B3MQ 4YWLA 4RCOA 4KD3A 1LUZA 3DUZA 4HSPA 5IGDA 2AQ3B 1I6VC 3CPWA 3H09A 1CKNB 1SN8A 3AQQA 2IW3A 3TEHB 5C4ZA 3CCMA 1U4RA 1PRTB 2BOSA 2JE6I 1CKMA 3RLNA 4X66Q 2CW0D 1FJGL
chains in the Genus database with same CATH topology
4JBWA 1LT4D 4K14A 3OPOA 3HOWB 4ABNA 4CBVA 5C0XJ 3K57A 1JC7A 1EY4A 4FXDA 5IGBA 1ENFA 3S2DB 2B63B 2E2HB 3L3OC 3R3OA 2NB0A 2H4OA 2IJ0A 1KNEA 4IFDI 2VNUD 4X3TA 3BG3A 3SE0A 3GQBA 2WB1B 3QOJA 1J8IA 4C56C 4PNYA 2K04A 2C9OA 4X3UA 2F0WA 5CV5A 1YNNC 1B1ZA 4ME5A 4EQPA 2NVQB 1F9SA 2XRSD 1EY8A 3CQZB 3QO2A 4IN3A 4FO2A 3MXUA 1DYQA 2HUGA 1STEA 1Y1WB 4OL7A 5CBAE 1RTOA 1JORA 5DEHA 2ZXOA 5G3LF 3M85A 3T51B 1ICWA 4I7ZC 1PXUA 1H9SA 1IW7D 2IT1A 1SE2A 1OXVA 4RGOS 2B2YC 3GV3A 3K58A 2ICEC 4P2CB 1GJXA 1TS5A 2KQ3A 1Z6HA 5ISRA 1DOKA 2NWGA 2PW5A 1MSHA 1WTRA 1LT3D 1DXMA 1BUVT 1TKWB 5JEAH 4A3GB 1B9MA 2PZTA 1EZ6A 3NE5B 4IUQA 4ZKBB 2K03A 5EKKA 1TY0A 4HCEA 2F0DA 5LL6S 3RMHA 2NVTB 2HQEA 1HTLD 1D5MC 1M4VA 2XRQD 1HA6A 4M8AA 3LWEA 2N88A 3MVVA 1GOZA 4S3SA 5EBCA 1MBYA 2BA1A 4BA1I 3D4DA 3HOZB 1SNPA 2K6AA 2A69D 3ND9A 2G9DA 4FXKC 1CK1A 4NKLA 1EWCA 5LL6X 3P1HA 5C3EB 1TWAB 5C3WA 4GZYC 1PRTD 2B2TC 1CQFA 3NSWA 2X6GA 3PUYA 5TSSA 4FNFA 3J80L 4C3HG 3A8KE 3V96A 1WTXA 4FF2A 1SE3A 5ELDA 2NVXB 3FPUB 1E2VA 4MN3A 3A55A 2RA4A 3S2HB 5JVG3 4J8QA 4F88A 2AUKA 3I73A 2Z8LA 1CA6A 1SNQA 1F9PA 1EEID 1Z47A 2XWJB 4Z9CB 3WOFA 1EY0A 1D5ZC 4KTAA 1RF2D 3K0YA 3KLRA 2M9VA 1EWHA 5CV4A 5C4JB 3K5LA 1QNUA 1EYDA 3HS0C 3OSOA 1TR5A 4PV1C 2SNSA 1LO5D 1LABA 3TP6A 4K2LA 1YNJD 4RH6A 3VR5A 2RQXA 1STHA 1KDBA 4ZLTF 1SFOB 1B50A 5KEEA 2EZVA 1L0XB 1V43A 4CKCA 3GTGB 3VYTA 3S14B 3K6OA 1R4QB 4LJZC 1VCIA 3BVMA 4DXFA 1BDOA 4X3KA 1A2TA 3C46A 3X3NA 1TVXA 1BBXC 1CT1D 2MUYA 4ID6A 5K5PA 2LY7A 3MHBA 5I6YA 1O80A 3I72A 2FMMA 1TQOA 4A3JB 2RDGA 3C2PA 1Q3LA 2LFNA 2L5TA 5K36G 2F4IA 1F2MA 4A93B 1QNKA 1O7ZA 3MTSA 1STBA 3AMUA 5M3MB 1I4PA 3NHHA 3TP8A 3EVQA 1FYCA 2I07B 4V0BA 3K7AB 1EZ8A 2R7ZB 1KABA 2K32A 1PLFA 3VR3A 4I65A 4LK1C 1TWCB 1AN8A 1BCPB 3S17B 2L11A 2O4XA 2HDLA 3A54A 1Q1BA 4MHEA 4G4KA 1FNUA 2A5HA 2KCCA 4DK0A 4NP5A 1EU3A 3BVZA 3NBHA 1H9KA 1LACA 1HFNA 2PZUA 1WD1A 5CV8A 2KEDA 1VDZA 3SK8A 5FO7B 3J7AF 4PMWA 3FEWX 4IUVA 1WD0A 1OO9B 1PFBA 2J7ZA 1VF7A 2F0JA 2L9HA 3CU7A 2IPKD 2RBMA 3P7JA 3MAQA 5COYA 1FGBD 2EY6A 1B2TA 2OT2A 3MC0B 2NYZD 2A74C 3DWQA 4IUPA 4DGZA 4ZK9B 2JA5B 4QCLA 2V4DA 4HSVA 3IFDA 1HUNA 1FR3A 3HOXB 3KK7A 1PMRA 2WAQB 1EFID 1ZYRD 2MPMA 1CHPD 1TT2A 4KV6A 1B3AA 1GUWA 2MJ8A 1DJRD 1SEBD 4HCSA 3QG1A 1F77A 3HKZB 5T1GA 4IZ8A 2KECA 4RAUC 3NUCA 5JVH3 1DOMA 4FXGC 3GTLB 1JR0D 1BQQT 5ELEA 1ILQA 1EEFD 1CQVA 2F0FA 5C0XG 1BCPF 1G8ZD 1KDAA 1WTPA 3J81E 1SE4A 4G57A 1CZGA 1CFMA 3Q23A 1MGSA 2EYLA 2BCOA 3JAME 3BDOA 3MFYA 5CGKA 1T5EA 1JOKA 5EPLA 3H0GB 2HDMA 2R92B 3OWFA 1IL8A 1EYCA 1Y1VB 3R8BA 1WTVA 1D1IA 4IURA 1A2UA 2IX0A 3QB3A 2AQ2B 1XTCD 3HOYB 3D4RA 3OMGA 5BN3A 3GTKB 1CA5A 5E1FA 4L8JA 2NVYB 3I4MB 3MXGA 2EJMA 1F2ZA 5M5WB 3L7ZC 3LWUA 3VYUA 2DY8A 3TP5A 1RODA 4FF4A 3MA2B 2NN6G 2B2UA 1Q12A 2RSNA 2VB3X 4KHZA 4KK7A 4HEDA 3I4NB 3S1NB 2M2LA 3H94A 3T4AC 1SJED 1LT5D 1BCPD 5CV7A 3S1QB 2A6HC 4CHTB 2CVRA 4J1MA 4OGQC 2PO4A 1NUCA 1PTOC 5ELCA 5FK9C 1STYA 1A3UA 1LTBD 2K7VA 3I90A 4KY7A 2EY5A 2IX1A 2BE5D 1RJTA 1A15A 2EJGC 2NBFA 2EXZA 3BVGA 4AYBB 1AFPA 2TMPA 1A6XA 2F0SA 4H0LC 3VR4A 2PMZB 1H9MA 4DAVA 2CW0C 5IT9E 5EPJA 5C3XA 3S16B 3PO2B 4DN4M 3N6RA 1OXSC 1G291 4UAIA 4BBSB 1JWSD 3Q6SA 5D65A 2KJXA 3TSSA 3NXWA 4UDUC 2K28A 5C6AA 1Y69U 2D2CC 4XQNA 1CM9A 5ELBA 1R4PB 2F0NA 4RFBA 1B9NA 2PCFB 4WJWA 1BNZA 3GTMB 3M4OB 4OO1G 2O5IC 1Y8OB 4OIKA 3PUWA 4K6LA 5DM73 1DOLA 2ZXRA 1NR4A 3NTHA 4NDXA 3V2TA 1OXTA 2Q8TA 2FINB 2E75C 2NUCA 1K8OA 1AP0A 3O13A 3I8ZA 1TY2A 4DF7A 5J22A 4U68A 2B39A 5CYUA 3NTKA 3OOCA 2QKIC 1EY5A 1CTMA 1UAPA 1PYWD 1ENCA 4J6HA 2Z1CA 3I4LA 1I4XA 2RKSA 1IW7C 1RHPA 2R61A 2F03A 4QF4A 2PZWA 3CKIB 1GUNA 3OIPA 4IFDG 4MIUA 2F0KA 3SK6A 5EBDA 3J7AV 1H9JA 4C1NK 2A6ED 2WP8J 3F2UA 3VYSA 1OXUA 4F8MA 3U9SA 5FO9B 2K5QA 5E4WC 3HG9A 3A56A 2ENBA 4B08A 2EJFC 3C1FA 4RWSC 1I50B 1JQYD 1SYFA 5J39A 4FP5D 4A3BB 3WDNA 3H6MA 2B2VC 4KI0A 3HP3A 1RD9D 3GTQB 1Z7TA 1SYDA 1KAAA 1DZ1A 1ILPA 1PDQA 4RGNA 2GA4B 1AZQA 3EFXD 5D14A 2A69C 4KMUC 2WIIB 1FNWA 1ZKOA 1U4MA 5G3LD 1PRTC 1TS2A 1F9RA 2K33A 5M5XB 5A2QE 3MXPA 4B9WA 1GUGA 3QJYA 4ZUIA 4G7HC 1OXXK 3FPPA 1PZJD 1NCVA 1XYIA 2E2DC 4XDXA 1B44D 1SAPA 3ONAB 2L1BA 1E2ZA 1EOTA 1EY6A 3E5SA 2WACA 3FRPB 1UNSA 5K36H 1S5CD 5KNCA 3RUZA 2JEBI 1SYBA 3BYYB 5C4HA 3WOEA 2KEEA 4K5VA 4KJOA 2K05A 4XYQA 1YNJC 3DWPA 5BN4A 4H7BA 4KJNA 2X69A 1U4PA 2EYFA 4R9WA 1S5ED 3ITPA 1QCBD 4KN7C 1HPCA 2TSSA 1WTOA 1QWYA 2F0HA 2SOBA 3KF8A 4BBRB 4BA2I 4IFDJ 2B2YA 3IFTA 3K5MA 2EOTA 3SR1A 4RHSA 5I6WA 3D6WA 1ML0D 3NTIA 4C2MB 5ELFA 4LAAA 2SNMA 1HRJA 3VR2A 1NSNS 1D5XC 4XTCS 3JAML 4BWGB 1I6HB 5D3DA 4U673 2XNAC 5FKAC 3PO3B 4PMBA 1GUOA 5IGFA 1B53A 1VF5C 3IL8A 1T5XD 2MGSA 2XN9C 3TN2A 4F87A 3T16A 1IYVA 1A3VA 3MZ5A 4Q0FA 2J4XA 3DMUA 3SK5A 1SYGA 2CQAA 1SXTA 5EJWA 4N9TA 4TKOB 3AU7A 3BDLA 1XWEA 3DWAA 4JK1C 2K5WA 2EY1A 3PV0A 2WKDA 4DFAA 2BDNA 4G7ZC 1KNAA 1SNCA 5F2DA 2B2TA 4H13C 1O7YA 2EPBA 4R8NA 2E74C 3CHBD 3VA7A 2KVMA 3P20A 2EYOA 5CORA 4PQXA 2O2LD 3NWTA 4KY6A 3OHXC 4CJ1B 4B9XA 1PTOH 2HCIA 3EA6A 2F3VA 4YIJA 5C4XB 3PIP3 5C0XH 3RD4A 2DNEA 1E0BA 3M3YB 2SEBD 2JYOA 4KY5A 4NW2A 2JP1A 3R2TA 4G7OC 1VMPA 4ZAIA 2E76C 4E6IA 3A8IE 2ZT9C 4DK1A 5IT9L 4DNRB 3ERQA 4ZUJA 1EIHA 1EQVA 2BA0A 2EY2A 5KGUA 2WINB 2HCCA 5EQ0A 2RDFA 2KUMA 1ZYRC 2JA8B 3M4YA 1JWUD 1PTOB 3SDZA 4KKSA 4DXGA 1U4LA 4KHVA 1G2TA 2Z4IA 3MEHA 2LKVA 3NBIA 1V1PA 4CJ0B 4XYOA 1M8AA 5EPKA 2L4NA 4CJ2C 3X3MA 4C3JB 1WVLA 1ONLA 1D6EC 1S5DD 1C8CA 2NTSA 3KUPA 3KLSA 4Y7NB 2FFKB 3T56B 3BDCA 3VYRA 2JA7B 1EL0A 1TU2B 1CHQD 4EQOA 1UUPA 2WV6D 2B2WA 1GUTA 1GXDC 2A73B 1BXTA 3OW7A 3I70A 4QB4A 2EYMA 2EE1A 3NP8A 3H3VC 4TSSA 3K5OA 4TQUS 4FF3A 3IAYA 3LX0A 4IALA 3S9WA 3TMEA 4TRDA 4XT3B 2AQ1B 1EIGA 2QILA 3W3AA 1LTGD 2R93B 1TWFB 1X3QA 1H9RA 1BCPC 1SSOA 5C5MA 2MHVA 5AFWA 2L0CA 1PTOF 3NWSA 4OO1H 4RGTA 1AZPA 3TBIB 5IOCA 3D4WA 2BE5C 5C44B 1O78A 1I4HA 1SMYD 3D31A 4C3IB 2B8GA 3LNNA 2FMCA 3DM1A 4HMJA 1EY9A 2K1BA 3S15B 3A8JE 4FVMA 3TP7A 3C3LA 1F2LA 3PUVA 1HUMA 3OWEB 1HFGA 5IIFA 5KNDA 5IODA 4HTHA 2A68D 1ZEQX 5A2QL 1QOHA 5I2YA 1CZWA 4RHRA 4A3DB 4KKTA 2X6LA 1MSGA 2KOLA 3E0JA 4A3FB 1E2WA 4XT1B 4IFDH 5M5YB 3BYTB 4XXEA 4HAEA 1DONA 3D3RA 4RA8A 1KLUD 5BN5A 1RTNA 4XQQA 3IKJA 1JOOA 2AWNA 4V190 2PW7A 3TZDA 1QE6A 4OIJA 1Y8NB 5CC4A 3CRLC 3PMFA 4ULLA 4IUTA 4XQJA 2PPBC 4K8JA 1QJOA 5I4DA 3C1EA 2J0TD 1AEXA 4R8IA 4ILWA 2Q8IB 1JWMD 3BS1A 3W2DA 2PNRC 5NUCA 3P75A 1BF4A 4X3SA 1HQMC 1WCMB 3KBGA 4XIGS 3PUXA 1ET6A 2OEOA 4QUFA 2Q8RE 2DN8A 5I2XA 1W6KA 4BS9A 2JEAI 1BO0A 2A6EC 5FLXE 4RCNA 1I4GA 3SHLA 3DEPA 3HZXA 2F0EA 1I4QA 3HRZC 3VR6A 4A3MB 1DD2A 1FNVA 1II3A 2Y0SB 1S4ZA 2ZXPA 2IWHA 1K83B 2F1MA 1ESRA 1IKMA 1YNND 4NMZA 1MI2A 4IUUA 3H91A 1D1KA 1BR9A 5HGTA 3FMCA 2D5DA 3OMCA 2QDBA 2QEJC 3NK9A 2M00A 5J1ZA 3SVMA 3NQIA 3T13A 1KLGD 5C5LA 1XXGA 2H1EA 5DNFA 4O1NA 2LS01 4ZQ3A 1G6ZA 1V1PB 1PRTF 3DXJC 1PFMA 1SYEA 3MFGA 1TWGB 2NZ1D 2EYJA 1W6JA 4OHJA 4FF1A 4C3HB 1LTRD 3E6ZX 3MWYW 2KHSA 4N9PA 1LTAD 3DHQA 1STNA 3G6JB 2RSOA 2EDGA 5JOBA 3HGBA 5CV9A 3GTPB 4ZKCB 2F0QA 2JSOA 1HA5A 4WRDA 1L0YB 1TS3A 4F7XA 1C48A 5T1IA 5I9OA 2IL8A 3EROA 2DNCA 4IQZA 5JPMC 3OIQA 1JB3A 1MD2D 4A3KB 5M9OA 3R93A 3GD7A 3HEJA 2N55A 3FVQA 3KLSX 1C4QA 1O7LA 1BOSA 4DNTB 4DU9A 1HTPA 3A7LA 4K2KA 2I46A 2G9HD 3ND8A 1ESFA 2F0GA 4K6DA 2D9UA 1GHJA 3GTOB 4PMCA 1G2SA 4K5XA 1QB5D 1TWHB 1SNMA 4KN4C 2ID0A 2F0VA 4A3IB 2DY7A 3RZOB 1PZID 1IHZA 5KRUA 4QMGA 4QIWB 5JEAG 4CKBA 1V1OA 4DAPA 3J81L 3Q0AA 1JOQA 5EGTA 1R9TB 1EQTA 2E2JB 1UEAB 2B2VA 3GTJB 3HOVB 3EQLC 2R6GA 1TIID 1Y8PB 2WKCA 3NPPA 5EKLA 5M3FB 3AB9A 4FYDA 4HR7B 2KA7A 3PIO3 5IGCA 3Q24A 4QUCA 5IGGA 2BDOA 3TDQA 4EVOA 2F0UA 2EVBA 1KDCA 1I3QB 1A3TA 2L12A 2D62A 3BZDB 3FDTA 1LLRD 1U9RA 1RDPD 2F0TA 2B8FA 4BY7B 2F0IA 3K5NA 3U9OA 3VA5A 3V05A 3EJIA 3TZUA 2JA6B 4H44C 1S5BD 5JAVA 3G7LA 2ICIA 1X3PA 2B2WC 1S5FD 2RDHA 2MP1A 2VUMB 2F0OA 1X32A 5CBEE 1HCZA 2SDFA 2VXWA 3GV6A 5KNBA 1WTWA 3HOUB 1G91A 4K5WA 1TS4A 4K8IA 3J7YW 5HURA 1EYAA 2JXMB 1RKNA 3KBXA 3Q22A 4Q5VA 2EYHA 2Z4HA 2VB2X 4RKBA 2OF1A 3GO5A 1FD7D 1AW7A 4A3EB 4IUNA 5DAUA 5CMDA 1EY7A 1HXYD 1J9OA 2AUJD 1V8QA 3T53B 4RGMA 1Q1EA 2QF7A 4EGVA 2B2UC 1IYUA 1F2YA 1DM0B 3FKIB 1QG7A 2OXPA 5EKIA 2NN6H 3QWNA 1LV9A 2RVLA 1ZXTA 3J80E 5JEAJ 4KD4A 5E3FA 2XWBB 2XIWA 1EU4A 3RZDB 5C0XI 3N52A 1F9QA 1H9SB 1STGA 1Q90A 5LHY1 2R3ZA 5KIXA 5JPNC 1B4OA 4M1UB 4C1NI 1LT6D 3SK4A 4O42A 2QCPX 1JCKB 1IKLA 1SNOA 1GHKA 5FOBB 2C5CA 2F0MA 1SBBB 4EQNA 1D2BA 1CI3M 1K8MA 3NQTA 5FLXL 4ODGA 3RLFA 4CGYB 4L6TB 3L9AX 2F3WA 2K5DA 3ZYYX 2YYZA 1XX8A 1GUSA 1LTTD 2NN6I 4BY1B 2NTTA 5FO8B 2XVSA 2O5JC 5DM63 3D6CA 4ZYSA 2IX3A 5KYLA 5CV6A 1PZKD 1NAPA 1KTKA 1SMYC 4C3JG 3I91A 1HQRD 4WORA 2KCNA 1WTQA 3SXHA 2E2IB 5KYIA 1Q8IA 3I3CA 2PYKA 3D8GA 2K01A 2YU9B 3PUZA 2FHTA 4HN7A 1QILA 1VMCA 1PFNA 4RKLA 1LTSD 3M7GA 2A68C 1DCZA 3S1MB 4ZRZA 2FJ2A 1HHVA 3S1RB 5E4XA 3A7AB 1SYCA 5JJZA 3SEBA 1JE4A 1LTID 1NR2A 2L55A 2XSCA 4CKEA 3MXNA 4HMIA 3K59A 2F0PA 2AWOA 5CR3A 3UI2A 1SNDA 2PQEA 4KKUA 3URYA 4WFN3 2F0LA 2A6HD 1SJHD 5I9PA 1JICA 3QIAA 1PTOD 1ENAA 4DA2A 2CHBD 4DAYA 2LMCB 3DEOA 3QOLA 5D3IB 4OO1I 3CRKC 1SDFA 1STAA 3R2IA 2EYPA 1I4RA 4L63B 4LMQD 5IGEA 1RCVD 3GP7A 3M7NA 1ET9A 4C3IG 5A35A 4RCOA 4KD3A 3DUZA 4HSPA 5IGDA 2AQ3B 1I6VC 3H09A 2IW3A 5C4ZA 1U4RA 1PRTB 2BOSA 2JE6I 2CW0D
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F2Y A;  5CV9 A;  1EY9 A;  2F0F A;  2PYK A;  5CV4 A;  2PW5 A;  3D8G A;  2EY1 A;  2F0Q A;  3RUZ A;  4DFA A;  5IGG A;  1EYD A;  1KDA A;  2F0U A;  1TR5 A;  2OXP A;  3OSO A;  4WRD A;  1KDC A;  4MIU A;  4EVO A;  3TP7 A;  2O4X A;  4K14 A;  2F0K A;  4G57 A;  3SK6 A;  5C3X A;  1A3T A;  2SNS A;  1SYB A;  4F7X A;  3TP6 A;  5C4H A;  3BDC A;  4K2L A;  2EYL A;  1SNC A;  4K5V A;  5F2D A;  4KJO A;  5I9O A;  5CGK A;  3ERO A;  4F8M A;  1JOK A;  1EY4 A;  1U9R A;  5IIF A;  2PZT A;  4EQO A;  1EZ6 A;  4KD4 A;  4NP5 A;  5IOD A;  4RKL A;  1STH A;  2F0T A;  4R8N A;  1KDB A;  5E3F A;  2ENB A;  4HTH A;  3OWF A;  1EYC A;  4H7B A;  5EKK A;  2EYO A;  3SHL A;  5IGB A;  2F0D A;  4KJN A;  2F0I A;  2HQE A;  3HZX A;  2F0E A;  3U9O A;  1A2U A;  4KY6 A;  3QB3 A;  3R3O A;  5KEE A;  3C1F A;  3HEJ A;  3VA5 A;  5M9O A;  1SYF A;  2PZU A;  2EYF A;  3EJI A;  3OMG A;  5J39 A;  3ITP A;  4B9X A;  1II3 A;  5CV8 A;  3H6M A;  3NXW A;  1STG A;  2F3V A;  4QB4 A;  1SYC A;  2EYM A;  3QOJ A;  3NP8 A;  4YIJ A;  3SK8 A;  5KIX A;  3MVV A;  5C6A A;  2F0H A;  2SOB A;  5E1F A;  1A2T A;  4PNY A;  5JAV A;  2F0N A;  4S3S A;  4DU9 A;  1SYD A;  1KAA A;  2F0W A;  4KY5 A;  4NMZ A;  5CV5 A;  1F2Z A;  1JOO A;  4K2K A;  2F0J A;  4ID6 A;  3D4D A;  3SK4 A;  2F0O A;  1SNP A;  2PW7 A;  4ME5 A;  3SR1 A;  5K5P A;  2RBM A;  3MHB A;  3LX0 A;  4EQP A;  2F0G A;  4IAL A;  3TP5 A;  5HGT A;  5I6W A;  4K6D A;  4HMI A;  3OMC A;  4NKL A;  2QDB A;  5I6Y A;  3P1H A;  3NK9 A;  4E6I A;  2EY6 A;  1EY8 A;  2F0P A;  2M00 A;  3S9W A;  5CR3 A;  5CC4 A;  4DGZ A;  3PMF A;  4K5W A;  1SNO A;  1TQO A;  3TME A;  5C3W A;  4PMC A;  5J1Z A;  1SND A;  2PQE A;  4TRD A;  4K8J A;  4LAA A;  2SNM A;  3ERQ A;  4NDX A;  4K5X A;  4ZUJ A;  4K8I A;  5C5L A;  3T13 A;  3V2T A;  3C1E A;  2F0M A;  1NSN S;  2F0L A;  4EQN A;  2NUC A;  5I9P A;  1EQV A;  1AEX A;  1SNM A;  2EY2 A;  5HUR A;  3NQT A;  1F2M A;  5CV7 A;  2F0V A;  1EYA A;  4OL7 A;  5KGU A;  4ZQ3 A;  4J1M A;  1ENA A;  1RKN A;  1JOR A;  4PMB A;  4ODG A;  5IGF A;  1NUC A;  4DF7 A;  1SYE A;  5J22 A;  3MXP A;  1STB A;  2RDF A;  1TT2 A;  2EYJ A;  3QOL A;  4KV6 A;  5DEH A;  5C5M A;  4B9W A;  2F3W A;  4ZUI A;  5NUC A;  1STY A;  1EY5 A;  5KRU A;  1IHZ A;  1STA A;  4QMG A;  1A3U A;  3NHH A;  3TP8 A;  2EYH A;  3P75 A;  2EYP A;  3EVQ A;  4RKB A;  2OF1 A;  5IGE A;  4KY7 A;  2EY5 A;  1ENC A;  2KHS A;  4J6H A;  1JOQ A;  4IUN A;  5DAU A;  1SNQ A;  5EGT A;  2RKS A;  3D6C A;  4N9P A;  5IOC A;  3D4W A;  4KHV A;  1EY7 A;  4IZ8 A;  3T16 A;  4KD3 A;  1EZ8 A;  1A3V A;  3MZ5 A;  3DHQ A;  3NUC A;  1STN A;  5IGD A;  5KYL A;  3MEH A;  1KAB A;  2LKV A;  3DMU A;  3SK5 A;  5CV6 A;  1EY0 A;  4QF4 A;  2EXZ A;  1SYG A;  2PZW A;  4N9T A;  5C4Z A;  2KQ3 A;  1EY6 A;  2OEO A;  3E5S A;  2F0S A;  4KTA A;  4WOR A;  2WAC A;  5EKL A;  3BDL A;  4I65 A;  5ISR A;  3SXH A;  4HMJ A;  5JOB A;  5KYI A;  5IGC A; 
#chains in the Genus database with same CATH topology
 4JBW A;  4LFA L;  2NVQ H;  2WB1 E;  1WI5 A;  1LT4 D;  3CQZ H;  4K14 A;  5IP9 G;  4AYB G;  1JMC A;  3OPO A;  3CPF A;  3HOW B;  4P74 A;  4ABN A;  4CBV A;  5C0X J;  3K57 A;  4DV5 Q;  4JI0 L;  1JC7 A;  1EY4 A;  1Y1W H;  3A5U A;  4A3D G;  3UDF A;  4FXD A;  5IGB A;  1ENF A;  3S2D B;  2E8G A;  2B63 B;  5AJ3 Q;  2E2H B;  3L3O C;  3R3O A;  2NB0 A;  2H4O A;  2IJ0 A;  1KNE A;  4PZ7 A;  3PO2 G;  2BH8 A;  4IFD I;  1WJJ A;  4X3T A;  2VNU D;  3BG3 A;  3SE0 A;  1VQ6 A;  1HZC A;  3GQB A;  2WB1 B;  3QOJ A;  2IHE A;  1J8I A;  4C56 C;  4PNY A;  2K04 A;  2C9O A;  4BBS G;  4X3U A;  3UE1 A;  4AQY Q;  2F0W A;  5IP7 G;  5CV5 A;  3L0O A;  2VY3 A;  1YNN C;  1B1Z A;  4R4C A;  4ME5 A;  4EQP A;  2NVQ B;  1F9S A;  4GNX C;  2XRS D;  1EY8 A;  3CQZ B;  3QO2 A;  4IN3 A;  4FO2 A;  3MXU A;  4B3M L;  1DYQ A;  2HUG A;  3TS0 A;  1STE A;  3A74 A;  1Y1W B;  4OL7 A;  5CBA E;  1RTO A;  4YHH Q;  1JOR A;  1IBK L;  3PSI A;  4GN5 A;  5DEH A;  2ZXO A;  5G3L F;  4FDB A;  2NVT H;  4IPG A;  3M85 A;  3T51 B;  4X64 Q;  3PCO B;  1WCM G;  1ICW A;  4I7Z C;  1PXU A;  1H9S A;  1IW7 D;  2IT1 A;  1SE2 A;  1XTD A;  1OXV A;  4RGO S;  2B2Y C;  3GV3 A;  3K58 A;  3VDY A;  3DM3 A;  2ICE C;  3TRE A;  4DR6 L;  4P2C B;  2UXD Q;  1GJX A;  1TS5 A;  2KQ3 A;  1Z6H A;  5ISR A;  5M5X H;  1DOK A;  2NWG A;  1NTG A;  2PW5 A;  1MSH A;  1PYS B;  1WTR A;  1LT3 D;  1DXM A;  3I7F A;  2B29 A;  4GOP B;  1BUV T;  1HZ9 A;  4LF5 Q;  1TKW B;  5JEA H;  4A3G B;  4R4T A;  4AQY L;  1B9M A;  2PZT A;  1GO3 E;  3CD6 A;  1EZ6 A;  3NE5 B;  4IUQ A;  2Q2I A;  4ZKB B;  4A3M G;  2GVA A;  2K03 A;  5EKK A;  1TY0 A;  4HCE A;  2F0D A;  2Y0S G;  5LL6 S;  3RMH A;  4X62 Q;  2NVT B;  2HQE A;  1HTL D;  1D5M C;  1M4V A;  2XRQ D;  1HA6 A;  4LFC Q;  1C0A A;  4M8A A;  2ZM6 L;  2V1C C;  3LWE A;  2N88 A;  3MVV A;  4JI6 L;  1GOZ A;  4HIK A;  4DV1 Q;  4S3S A;  4LUV A;  5EBC A;  2ASB A;  3KYH C;  1MBY A;  1PH6 A;  2BA1 A;  4BA1 I;  3CP0 A;  3D4D A;  3HOZ B;  1SNP A;  4A3B G;  2K6A A;  4YY3 L;  2A69 D;  3ND9 A;  2G9D A;  4FXK C;  1CK1 A;  4NKL A;  1EWC A;  3BU2 A;  3P1H A;  2A19 A;  5LL6 X;  5C3E B;  5IYD H;  5C4J H;  5GRO A;  1TWA B;  5C3W A;  4GZY C;  1PRT D;  2B2T C;  1CQF A;  2GN5 A;  2X6G A;  3NSW A;  3G71 A;  2ZJP A;  3PUY A;  5TSS A;  2WFW A;  1O7I A;  4FNF A;  1E3P A;  1YZ6 A;  4BBR H;  3J80 L;  4C3H G;  3A8K E;  3EBE A;  4MTN A;  3V96 A;  1WTX A;  4FF2 A;  4YCU A;  1SE3 A;  5ELD A;  2NVX B;  3FPU B;  1E2V A;  4MN3 A;  1SFO H;  3A55 A;  2RA4 A;  3S2H B;  5JVG 3;  4DR1 L;  2Q2H A;  4J8Q A;  4F88 A;  2LXJ A;  4C2M H;  1IBM Q;  2AUK A;  3CCR A;  3I73 A;  2VW9 A;  2Z8L A;  1CA6 A;  1SNQ A;  1F9P A;  1EEI D;  1Z47 A;  2XWJ B;  4KHP L;  4Z9C B;  3WOF A;  1EY0 A;  3PGZ A;  2HT1 A;  1D5Z C;  4KTA A;  1RF2 D;  2XGT A;  3CC4 A;  2VL6 A;  3K0Y A;  4P72 A;  3KLR A;  2M9V A;  3CCE A;  1EWH A;  5CV4 A;  5C4J B;  3K5L A;  1QNU A;  1EYD A;  2K14 A;  3HS0 C;  3OSO A;  1TR5 A;  4JYA Q;  2UUC Q;  3CC7 A;  4PV1 C;  2VQE Q;  4A3J H;  2SNS A;  1LO5 D;  1LAB A;  4IO9 A;  2EQS A;  3TP6 A;  4K2L A;  1YNJ D;  4RH6 A;  1MKH A;  3VR5 A;  4A3K G;  1A8V A;  2RQX A;  4DR7 L;  2YTX A;  1STH A;  1KDB A;  1AH9 A;  4JBJ A;  4ZLT F;  1W3S A;  4GN3 B;  1YJN A;  3H3V H;  1SFO B;  1B50 A;  3E9I A;  3MXN B;  5KEE A;  1SRU A;  4QY7 A;  5M3M H;  2EZV A;  4YCV A;  1L0X B;  1V43 A;  4CKC A;  3GTG B;  4JCV E;  3VYT A;  1D7Q A;  3S14 B;  3K6O A;  1VQJ A;  1R4Q B;  4LJZ C;  2ATW A;  1VCI A;  3BVM A;  2Z6B A;  4DXF A;  1BDO A;  4X3K A;  1A2T A;  3C46 A;  3X3N A;  1TVX A;  1CKO A;  1BBX C;  1CT1 D;  2MUY A;  3KF6 A;  1K3B C;  1FVI A;  4ID6 A;  5K5P A;  2LY7 A;  3MHB A;  1N32 Q;  5I6Y A;  1O80 A;  1X56 A;  3I72 A;  1TWC H;  4A3L H;  2FMM A;  1IBM L;  1TQO A;  2N78 A;  4A3J B;  3QR8 A;  2RDG A;  3C2P A;  4HJ9 A;  1ASY A;  4ALP A;  4A3I G;  3J81 i;  1Q3L A;  2LFN A;  2L5T A;  5K36 G;  2F4I A;  1F2M A;  4A93 B;  4CDF C;  3JAM i;  1QNK A;  4IOC A;  2ZJQ A;  1O7Z A;  3MTS A;  3PIP A;  1VQP A;  1FGU A;  3FHW A;  1LTL A;  1STB A;  2Q2U A;  3AMU A;  4JC0 A;  4DV6 L;  4IPD A;  1L1O C;  2VS1 A;  5M3M B;  1I4P A;  3NHH A;  3TP8 A;  3EVQ A;  2CQO A;  2EXD A;  1FYC A;  2I07 B;  4V0B A;  4JI3 L;  3K7A B;  1EZ8 A;  5M3F G;  3PO3 G;  2R7Z B;  1KAB A;  3H3V I;  2K32 A;  4GKJ L;  1PLF A;  3OTO L;  3VR3 A;  2RF4 A;  1P8L A;  4MNO A;  4I65 A;  4LUZ A;  4LK1 C;  3CC2 A;  1TWC B;  1AN8 A;  1BCP B;  3S17 B;  3G48 A;  1L0W A;  2L11 A;  1X6O A;  1HJP A;  2O4X A;  2HDL A;  3A54 A;  1Q1B A;  4MHE A;  2ZJR A;  4G4K A;  1FNU A;  5GAG C;  4BY7 G;  2G5D A;  2A5H A;  1SRO A;  2KCC A;  4DK0 A;  4NP5 A;  1EU3 A;  2MFI A;  3AFQ A;  4IJH A;  4LUO A;  1Q81 C;  3BVZ A;  3NBH A;  1A63 A;  1H9K A;  2JA6 G;  1LAC A;  1HFN A;  1HR0 L;  1K8A C;  2PZU A;  1WD1 A;  1NMF A;  1Q8K A;  5CV8 A;  2PQA A;  2KED A;  4JI5 Q;  1VDZ A;  4Y7N H;  1MJE A;  1XPR A;  3SK8 A;  5FO7 B;  3K0X A;  2OQ0 A;  3J7A F;  4PMW A;  2JA7 H;  3FEW X;  4IUV A;  1HNZ L;  4OX9 Q;  1WD0 A;  1OO9 B;  1B70 B;  1PFB A;  3RNU A;  2J7Z A;  3HOU G;  1VF7 A;  2HIV A;  2F0J A;  3M4Q A;  1VQ9 A;  2L9H A;  4JPB W;  3CU7 A;  2IPK D;  2RBM A;  1YHB A;  3P7J A;  3MAQ A;  4LFB Q;  4JI4 Q;  1D8L A;  5COY A;  1FGB D;  2EY6 A;  1B2T A;  3HKZ E;  2OT2 A;  3MC0 B;  5C4X G;  2NYZ D;  2A74 C;  3DWQ A;  4IUP A;  4DGZ A;  4ZK9 B;  4GOP A;  1H95 A;  2DGY A;  2JA5 B;  5GAD C;  4QCL A;  2V4D A;  4HSV A;  3IFD A;  1HUN A;  1FR3 A;  4DV2 L;  3KK7 A;  1PMR A;  2WAQ B;  3HOX B;  1EFI D;  1AE3 A;  1N33 Q;  4MZ9 A;  1ZYR D;  2MPM A;  1CHP D;  2R92 H;  3J7A 5;  1TT2 A;  4OEL B;  1VQC A;  4KV6 A;  4A3E G;  1Y1V H;  1B3A A;  3UDI A;  1GUW A;  1KRS A;  2MJ8 A;  1DJR D;  1SEB D;  3J80 c;  4HCS A;  1X3F A;  4DV4 L;  1UE6 A;  3QG1 A;  2HD3 A;  5IYB H;  1F77 A;  3HKZ B;  5T1G A;  1V9P A;  2E5L L;  4IZ8 A;  2KEC A;  3NUC A;  2I5M X;  4RAU C;  1EWI A;  5JVH 3;  1DOM A;  4FXG C;  2NVY H;  3I4M H;  3GTL B;  4IPH A;  3FKI G;  1JR0 D;  1BQQ T;  5M5W H;  5ELE A;  1ILQ A;  1U0L A;  1EEF D;  1CQV A;  2F0F A;  5C0X G;  1BCP F;  1G8Z D;  1KDA A;  1WTP A;  3J81 E;  4JI1 L;  1SE4 A;  4G57 A;  1CZG A;  1YBY A;  1CFM A;  3Q23 A;  3I4N H;  3S1N H;  1MGS A;  2EYL A;  5C44 H;  2BCO A;  3JAM E;  3BDO A;  3MFY A;  5CGK A;  1T5E A;  1JOK A;  2OCE A;  5EPL A;  3H0G B;  2HDM A;  1A0I A;  4C3I H;  2R92 B;  3Q8D A;  1J6Q A;  3E0E A;  3OWF A;  1IL8 A;  1EYC A;  1VQG A;  1Y1V B;  3R8B A;  1WTV A;  1D1I A;  4IUR A;  3STB C;  1A2U A;  2IX0 A;  3QB3 A;  2AQ2 B;  4JI4 L;  1XTC D;  1QVF A;  3PF5 A;  1XPO A;  3HOY B;  3D4R A;  3OMG A;  5BN3 A;  3GTK B;  2OQK A;  1PH4 A;  1CA5 A;  2CWA A;  4PZ8 A;  5E1F A;  4L8J A;  3AEV A;  2NVY B;  3I4M B;  2CCZ A;  3MXG A;  2EJM A;  1YIT A;  5IP9 H;  1N33 L;  1F2Z A;  5M5W B;  2HHH L;  3L7Z C;  3LWU A;  1UE1 A;  3VYU A;  2DY8 A;  3TP5 A;  1ROD A;  4FF4 A;  3MA2 B;  2NN6 G;  2B2U A;  1Q12 A;  2RSN A;  2VB3 X;  4GKK Q;  4YWM A;  1VQD A;  5LMN Q;  4KHZ A;  4KK7 A;  3BZC A;  4GNX B;  4HED A;  3I4N B;  3S1N B;  4AYB E;  2I0Q A;  2M2L A;  5FJ8 G;  3S16 H;  3H94 A;  3T4A C;  1SJE D;  3PO2 H;  1LT5 D;  1BCP D;  5CV7 A;  3S1Q B;  2UXC Q;  3TRZ A;  2A6H C;  4CHT B;  2CVR A;  2PMZ E;  4J1M A;  4OGQ C;  2PO4 A;  1NUC A;  1PTO C;  5ELC A;  1HNW L;  1Z9F A;  3F8T A;  5FK9 C;  4BBS H;  1STY A;  1A3U A;  5IP7 H;  1LTB D;  2LXK A;  2K4K A;  1X3E A;  2K7V A;  3I90 A;  4KY7 A;  2EY5 A;  2IX1 A;  2BE5 D;  2R93 G;  1RJT A;  1A15 A;  3KF8 B;  1J5E Q;  2EJG C;  1NY4 A;  1K0S A;  2NBF A;  2EXZ A;  3BVG A;  4AYB B;  1AFP A;  3I55 A;  2TMP A;  1A6X A;  2F0S A;  4H0L C;  1ASZ A;  3GTM H;  3VR4 A;  1X65 A;  2PMZ B;  1H9M A;  4DK6 C;  4N8X 1;  4DAV A;  2CW0 C;  5IT9 E;  5EPJ A;  3D0F A;  5C3X A;  1JJ2 A;  1I94 L;  3S16 B;  3PO2 B;  4DN4 M;  2AKW B;  1PH9 A;  1WCM H;  3N6R A;  1OXS C;  1G29 1;  1UWV A;  2IHF A;  3KF6 B;  4UAI A;  3K80 C;  4BBS B;  1JWS D;  3Q6S A;  5D65 A;  3KOJ A;  2KJX A;  4GKK L;  3TSS A;  1BBU A;  2UXB Q;  3NXW A;  4UDU C;  2K28 A;  4DR4 L;  5C6A A;  2MNA A;  1Y69 U;  2D2C C;  4XQN A;  1CM9 A;  5ELB A;  1R4P B;  2DJG C;  2F0N A;  1B9N A;  2PCF B;  4RFB A;  4WJW A;  5IT9 c;  2UXC L;  3T1H Q;  1BNZ A;  3GTM B;  3M4O B;  4OO1 G;  4LF4 L;  2O5I C;  1Y8O B;  4OIK A;  4YCW A;  3PUW A;  4K6L A;  5DM7 3;  4A3F G;  4GLA C;  1DOL A;  1ICF B;  2ZXR A;  4R4Q A;  1NR4 A;  4A3M H;  3NTH A;  2QDL A;  1JJG A;  4X65 Q;  4NDX A;  3V2T A;  1OXT A;  2Q8T A;  2FIN B;  2E75 C;  2NUC A;  1K8O A;  4LWC A;  3E9H A;  4GN4 B;  1AP0 A;  3O13 A;  1N36 Q;  3F2C A;  3I8Z A;  1TY2 A;  5IE8 A;  4DF7 A;  2MO1 A;  5J22 A;  1WTH A;  4U68 A;  2B39 A;  2Y0S E;  5CYU A;  3NTK A;  1K8G A;  3OOC A;  1M1K C;  2QKI C;  2A1A A;  1EY5 A;  3ULJ A;  1CTM A;  1UAP A;  1PYW D;  4P71 A;  1I50 H;  5ELO A;  1ENC A;  4A3B H;  4J6H A;  2Z1C A;  3I4L A;  4LF7 Q;  1I4X A;  2RKS A;  1VQ5 A;  1HH2 P;  2C35 B;  1IW7 C;  1RHP A;  2R61 A;  4DKA C;  2F03 A;  4QF4 A;  2IY5 B;  1YJW A;  3GTQ H;  1YI2 A;  4JI8 Q;  2PZW A;  3ERS X;  3G6E A;  3CKI B;  4X66 L;  4JG2 A;  1GUN A;  3NBH B;  3OIP A;  4C3H H;  4IFD G;  2K5H A;  3HOW G;  4MIU A;  2UXB L;  4ME3 A;  2F0K A;  3SK6 A;  5EBD A;  2PQA B;  3J7A V;  5EAY A;  4HIM A;  4GLV B;  1H9J A;  5DLQ E;  4B3R Q;  4C1N K;  2A6E D;  4I7A A;  2B63 G;  4IOA A;  2WP8 J;  3F2U A;  3VYS A;  1OXU A;  4F8M A;  3U9S A;  5FO9 B;  4DV5 L;  3K81 C;  2K5Q A;  5E4W C;  3HG9 A;  3A56 A;  5L37 A;  2ENB A;  3MEF A;  4B08 A;  2EJF C;  2QW7 A;  5AJ3 L;  2AHO B;  3C1F A;  4RWS C;  1I50 B;  1JQY D;  3GTP H;  1SYF A;  5J39 A;  3F1Z A;  4FP5 D;  4A3B B;  3WDN A;  3H6M A;  2B2V C;  2FXQ A;  4KI0 A;  3HP3 A;  1RD9 D;  2OTL A;  3GTQ B;  1Z7T A;  2RHS B;  4RMF A;  1SYD A;  1KAA A;  4UP9 A;  1DZ1 A;  1ILP A;  1PH8 A;  1PDQ A;  4RGN A;  4CDE C;  1BBW A;  2GA4 B;  1AZQ A;  4A3K H;  3EFX D;  5D14 A;  2A69 C;  4R4I A;  4KMU C;  2WII B;  1FNW A;  1ZKO A;  3W1B A;  3UE0 A;  1U4M A;  3CME A;  2NZO A;  1GM5 A;  5G3L D;  1PRT C;  1QUQ B;  4JI8 L;  1TS2 A;  1F9R A;  4YHH L;  2K33 A;  5M5X B;  5A2Q E;  3MXP A;  3ULP A;  4B9W A;  1GUG A;  3QJY A;  4ZUI A;  4G7H C;  1OXX K;  1YIJ A;  3FPP A;  4X64 L;  1PZJ D;  2I5L X;  1NCV A;  5BR8 Q;  1XYI A;  3EIV A;  3GTO H;  2E2D C;  4XDX A;  1B44 D;  4EQ5 A;  4B3R L;  1SAP A;  2QGQ A;  3ONA B;  2L1B A;  4JOI C;  1E2Z A;  1XMQ Q;  1IXR A;  1HR0 W;  1EOT A;  2UUA Q;  1NNX A;  2UXD L;  1PH2 A;  1EY6 A;  3E5S A;  4A75 A;  4A3I H;  2WAC A;  3FRP B;  1N34 Q;  1UNS A;  1PH3 A;  5K36 H;  1S5C D;  5KNC A;  5GAE C;  3RUZ A;  4A3G G;  4RG1 A;  4GNX A;  2JEB I;  1SYB A;  3BYY B;  4UPA A;  5C4H A;  3WOE A;  2K50 A;  3W5O A;  4LF5 L;  2KEE A;  2N3S A;  4K5V A;  3CCU A;  4P73 A;  4KJO A;  2K05 A;  1K73 C;  4XYQ A;  2E2J H;  1YNJ C;  5H1S E;  1I6H H;  3DWP A;  3ICE A;  5BN4 A;  4H7B A;  1JT8 A;  5M3F H;  3PO3 H;  4KJN A;  2X69 A;  4X62 L;  1U4P A;  2EYF A;  4R9W A;  1S5E D;  3ITP A;  1QCB D;  5IYC G;  4KN7 C;  4LFC L;  1HPC A;  2TSS A;  1WTO A;  3PIO A;  1QWY A;  4DV7 Q;  4DR2 Q;  1N8R C;  3T1Y Q;  2F0H A;  2SOB A;  3HOZ G;  3KF8 A;  4BBR B;  2KHJ A;  1EQR A;  2XTI A;  4BA2 I;  1K28 A;  4DV1 L;  4IFD J;  5C3E G;  2B2Y A;  3H15 A;  3IFT A;  3K5M A;  2EOT A;  3SR1 A;  4DNI A;  4RHS A;  5I6W A;  3D6W A;  2UU9 Q;  1ML0 D;  3NTI A;  4C2M B;  5ELF A;  3E3X A;  4LAA A;  2SNM A;  2Z6K A;  1HRJ A;  4A76 A;  3VR2 A;  1NSN S;  4B3T Q;  1D5X C;  2CFM A;  4XTC S;  4JI7 Q;  3JAM L;  4BWG B;  1I6H B;  5D3D A;  4U67 3;  2XNA C;  5FKA C;  3PO3 B;  4PMB A;  1GUO A;  1K9M C;  5IGF A;  1B53 A;  2CWP A;  2K75 A;  1KAW A;  2LSS A;  1N34 L;  3DLL A;  1PH1 A;  4GOP C;  1VF5 C;  3IL8 A;  1T5X D;  2MGS A;  1QVC A;  2XN9 C;  3NEM A;  4OWT B;  3TN2 A;  3T16 A;  4F87 A;  1IYV A;  1A3V A;  3MZ5 A;  4Q0F A;  5E7N A;  2P5Z X;  5C4X H;  1Q46 A;  2J4X A;  3DMU A;  3SK5 A;  1SYG A;  2CQA A;  1SXT A;  2KEN A;  5EJW A;  4N9T A;  3M3Y H;  4UY8 C;  4TKO B;  3AU7 A;  3BDL A;  1XWE A;  3DWA A;  4JK1 C;  2K5W A;  4EX5 A;  3OYY A;  4OWW B;  2EY1 A;  3PV0 A;  2WKD A;  4DFA A;  3TS2 A;  4TVA B;  2BDN A;  4DV3 Q;  5ELN A;  4HJ5 A;  4G7Z C;  2UUC L;  4JYA L;  3HOV G;  4A3E H;  2VQE L;  3EN2 A;  1KNA A;  2RHQ B;  3ULL A;  1XMO Q;  1SNC A;  2KCM A;  5F2D A;  2B2T A;  2A8V A;  1AE2 A;  2DJF C;  4H13 C;  1O7Y A;  2EPB A;  5LMU Q;  4R8N A;  2E74 C;  3CHB D;  3VA7 A;  2KVM A;  3P20 A;  2EYO A;  5COR A;  4PQX A;  2O2L D;  1VQB A;  1A62 A;  3NWT A;  4LF8 Q;  4R1J A;  1B7Y B;  4KY6 A;  2JA8 H;  3OHX C;  4NPS A;  1HNX Q;  3FKI H;  4CJ1 B;  4B9X A;  1PTO H;  2HCI A;  3EA6 A;  2F4V Q;  2F3V A;  2OWO A;  4YIJ A;  5C4X B;  3PIP 3;  5C0X H;  3RD4 A;  1IL2 A;  2ALY B;  2DNE A;  1E0B A;  1E22 A;  2SEB D;  2JYO A;  3K7U C;  3OW2 A;  3M3Y B;  4KY5 A;  4NW2 A;  2JP1 A;  2ZTD A;  3R2T A;  4G7O C;  3FP9 A;  1VMP A;  4DR5 Q;  2Z9H A;  4ZAI A;  4DR3 Q;  4HIO A;  1G6P A;  1N32 L;  2E76 C;  5JJL A;  4E6I A;  3A8I E;  2ZT9 C;  4DK1 A;  4C3J H;  5IT9 L;  4A93 G;  1MJC A;  4DNR B;  1VQH A;  3ERQ A;  4ZUJ A;  4PG3 A;  1EIH A;  1EQV A;  2VUM G;  2BA0 A;  2EY2 A;  5KGU A;  2HQL A;  2WIN B;  2HCC A;  3CCQ A;  5EQ0 A;  2HIX A;  2RDF A;  2KUM A;  1ZYR C;  2JA8 B;  3M4Y A;  1JWU D;  4L5R C;  1PTO B;  3JC6 6;  2R7Z G;  3SDZ A;  3PF4 A;  1V1Q A;  4DV3 L;  4KKS A;  4DXG A;  1U4L A;  4UP7 A;  4KHV A;  3CXC A;  2Z4I A;  1G2T A;  3MEH A;  2LKV A;  3NBI A;  2VQF Q;  1V1P A;  2B3G A;  4CJ0 B;  1BVS A;  4XYO A;  1M8A A;  5EPK A;  2L4N A;  5LMN W;  5FJ8 H;  4CJ2 C;  1TXY A;  3I4O A;  3X3M A;  4J15 A;  3W1G A;  4C3J B;  1WVL A;  1ONL A;  1D6E C;  1S5D D;  1C8C A;  2DUD A;  2NTS A;  3KUP A;  1IBL Q;  3KLS A;  4Y7N B;  1X9N A;  2F4V L;  2FFK B;  4DV0 Q;  1BKB A;  4AIM A;  4WJ4 A;  3T56 B;  3BDC A;  3VYR A;  2JA9 A;  4OEM B;  1UEB A;  3CCV A;  2JA7 B;  1EL0 A;  1QUQ A;  1TU2 B;  1CHQ D;  4EQO A;  2R93 H;  1TWF H;  4DR5 L;  1UUP A;  4DR3 L;  3G4S A;  2E2I H;  2WV6 D;  1PH5 A;  2B2W A;  1GUT A;  1GXD C;  2A73 B;  1BXT A;  1L1O A;  3J81 j;  2KBN A;  4BXX G;  2OTJ A;  3OW7 A;  2L15 A;  4JI5 L;  4NB3 A;  3I70 A;  2YU9 H;  4QB4 A;  2EYM A;  4B3S Q;  2EE1 A;  3NP8 A;  3H3V C;  4TSS A;  3K5O A;  4TQU S;  4FF3 A;  4DUZ Q;  4OX9 L;  4KLK A;  3IAY A;  4O0A A;  3LX0 A;  4IAL A;  2JA5 G;  5FLM G;  4LFB L;  1K0R A;  3S9W A;  1HZB A;  3S15 H;  4R4O A;  3TME A;  3HOX G;  4TRD A;  2WAQ G;  3I2Z A;  3LGJ A;  4XT3 B;  2AQ1 B;  1EIG A;  2QIL A;  3W3A A;  1LTG D;  2N49 A;  2Z0S A;  2R93 B;  3J81 c;  1TWF B;  1X3Q A;  1H9R A;  1BCP C;  1EOV A;  1SSO A;  1KXL A;  5C5M A;  2MHV A;  3JAM c;  5AFW A;  2L0C A;  3KLW A;  1G51 A;  1PTO F;  3NWS A;  1RL2 A;  4PZ6 A;  4OO1 H;  4A3D H;  1PHJ A;  4RGT A;  1AZP A;  3TBI B;  3WWV A;  5IOC A;  3D4W A;  2BE5 C;  5C44 B;  4A3F H;  1O78 A;  1I4H A;  1SMY D;  3D31 A;  3K8A A;  5M5Y H;  4C3I B;  2ES2 A;  2B8G A;  2H5X A;  3LNN A;  2FMC A;  3DM1 A;  4BY1 G;  1VQO A;  4HMJ A;  4LFA Q;  1EY9 A;  2K1B A;  3S15 B;  1SR3 A;  3A8J E;  4CDD C;  4FVM A;  3TP7 A;  3H0G G;  4OXP A;  3C3L A;  1F2L A;  2CH4 A;  3PUV A;  1HUM A;  3A5Z B;  4JI0 Q;  3OWE B;  1HFG A;  5IIF A;  5KND A;  5IOD A;  4DUZ L;  3HOY G;  4HTH A;  2A68 D;  1ZEQ X;  5A2Q L;  3ER0 A;  1EYG A;  3IRB A;  4A3C G;  2BH2 A;  3UDG A;  1QOH A;  5I2Y A;  1CZW A;  4RHR A;  1C7Y A;  4A3D B;  3AFP A;  1KQS A;  4KKT A;  2X6L A;  1EFW A;  1MSG A;  2KOL A;  1SMX A;  3E0J A;  4A3F B;  4LW1 A;  1E2W A;  4XT1 B;  4IFD H;  3HOW H;  5M5Y B;  3BYT B;  4XXE A;  4HAE A;  1DON A;  3D3R A;  4RA8 A;  1KLU D;  5BN5 A;  1RTN A;  4XQQ A;  3BZK A;  3IKJ A;  1JOO A;  2AWN A;  2RCF A;  4V19 0;  2PW7 A;  3TZD A;  3S2D H;  1QE6 A;  2B63 H;  1VQK A;  4OIJ A;  2E2H H;  1Y8N B;  3CRL C;  5CC4 A;  3PMF A;  5LMN L;  4ULL A;  4IUT A;  4XQJ A;  2PPB C;  4K8J A;  1QJO A;  2PI2 A;  5I4D A;  3C1E A;  2J0T D;  1Q82 C;  1AEX A;  4IJL A;  3HKS A;  4R8I A;  4ILW A;  1IBK Q;  2Q8I B;  4L5T A;  1JWM D;  3BS1 A;  1HZA A;  3W2D A;  2PNR C;  5NUC A;  3P75 A;  1OTC A;  4LNQ A;  1B3Q A;  1BF4 A;  4YWK A;  4X3S A;  1HQM C;  1K83 H;  1WCM B;  3KBG A;  4XIG S;  1J5E L;  4DR6 Q;  1X3G A;  3PUX A;  2K5N A;  1NE3 A;  1ET6 A;  2OEO A;  1NJI C;  2VZA A;  1LYL A;  4QUF A;  2NZH A;  2Q8R E;  2DN8 A;  1YEZ A;  5I2X A;  2UUB Q;  4JI2 Q;  1W6K A;  1GKH A;  4BS9 A;  1VQ7 A;  2JEA I;  4JBM A;  1WOC A;  1BO0 A;  2A6E C;  5FLX E;  4RCN A;  1KRT A;  1I4G A;  3SHL A;  3DEP A;  3PQI A;  1PYB A;  3HZX A;  1TWG H;  2F0E A;  1I4Q A;  3HRZ C;  2YV5 A;  3VR6 A;  4A3M B;  1DD2 A;  1FNV A;  3M4P A;  1II3 A;  2Y0S B;  1S4Z A;  2ZM6 Q;  2ZXP A;  1YNX A;  2IWH A;  1K83 B;  2F1M A;  1ESR A;  3KDF B;  4JI6 Q;  4A3G H;  1IKM A;  1YNN D;  4NMZ A;  1MI2 A;  1YJ9 A;  4IUU A;  3T1H L;  3H91 A;  4JBK A;  1M90 C;  4YY3 Q;  1D1K A;  1BR9 A;  3RR5 A;  5HGT A;  3FMC A;  2D5D A;  3OMC A;  2QDB A;  2QEJ C;  2WB1 G;  3NK9 A;  5FLX c;  2M00 A;  1K3R A;  1VS0 A;  4QGU A;  5J1Z A;  3SVM A;  4X65 L;  3NQI A;  3T13 A;  1KLG D;  5C5L A;  1Q86 C;  4H02 A;  1Q7Y C;  1XXG A;  1KD1 C;  2H1E A;  5DNF A;  4O1N A;  5IYC H;  2LS0 1;  4ZQ3 A;  1N36 L;  1G6Z A;  1V1P B;  1PRT F;  3DXJ C;  1PFM A;  1SYE A;  3MFG A;  1TWG B;  2NZ1 D;  2EYJ A;  3HOZ H;  1CUK A;  1W6J A;  4OHJ A;  4FF1 A;  4C3H B;  2Z6K C;  4DR1 Q;  5C3E H;  3GDE A;  4A4I A;  2UUB L;  1LTR D;  3E6Z X;  4JI2 L;  3MWY W;  1CSP A;  1TWA H;  2KHS A;  1Y1W G;  4LF7 L;  4N9P A;  1LTA D;  4KHP Q;  4APV A;  3ZJY C;  3DHQ A;  1STN A;  3G6J B;  4HID A;  2MO0 A;  1YVC A;  2RSO A;  2EDG A;  1CSQ A;  4POG A;  2NVX H;  5JOB A;  3HGB A;  2R7F A;  5CV9 A;  1VQN A;  3GTP B;  4ZKC B;  2F0Q A;  3S2H H;  2JSO A;  1HA5 A;  4WRD A;  1L1O B;  1L0Y B;  4IPC A;  1TS3 A;  4F7X A;  2EIF A;  1C48 A;  5T1I A;  1TWH H;  4DPG A;  5I9O A;  2IL8 A;  3ERO A;  4DR7 Q;  1E7Z A;  2DNC A;  4IQZ A;  5JPM C;  3OIQ A;  1JB3 A;  1MD2 D;  2KCT A;  4A3K B;  4UP8 A;  3RZO H;  5M9O A;  3R93 A;  3GD7 A;  3HEJ A;  2N55 A;  3FVQ A;  1UE5 A;  2GVB A;  3KLS X;  1PH7 A;  1C4Q A;  1O7L A;  1BOS A;  3CCS A;  2N8N A;  1R9T H;  1C9O A;  4DNT B;  1KHI A;  4DU9 A;  4DUY Q;  3GTJ H;  4LF9 Q;  1HTP A;  3A7L A;  3HOV H;  1PFS A;  1VQI A;  4K2K A;  2I46 A;  4QIW E;  2G9H D;  3J7Z C;  3F2B A;  1B8A A;  3ND8 A;  4AH6 A;  1ESF A;  2F0G A;  4K6D A;  2D9U A;  3A0J A;  1L2F A;  3RLO A;  1GHJ A;  3GTG H;  3GTO B;  4PMC A;  3S14 H;  1G2S A;  1I3Q H;  4K5X A;  4ZCK A;  1QB5 D;  1TWH B;  1SNM A;  4KN4 C;  2ID0 A;  2F0V A;  4A3I B;  4JW0 A;  2R7D A;  3J80 i;  2DY7 A;  3RZO B;  4DV6 Q;  4BY7 H;  3CF5 A;  1PZI D;  1IHZ A;  5KRU A;  1QVG A;  4QMG A;  4QIW B;  5JEA G;  4CKB A;  1V1O A;  2D0P A;  4DAP A;  5BR8 L;  3J81 L;  3Q0A A;  1JOQ A;  4JI3 Q;  1Y14 B;  5EGT A;  3U4V A;  4NXN Q;  1GVP A;  1JE5 A;  1R9T B;  1EQT A;  2JA6 H;  4GKJ Q;  2E2J B;  1UEA B;  2B2V A;  3GTJ B;  4HJ8 A;  1XMQ L;  3OTO Q;  3HOV B;  3KJO A;  4A93 H;  3EQL C;  3NEN A;  4OWX B;  2UUA L;  5IY0 A;  1NMG A;  2R6G A;  1TII D;  1Y8P B;  2WKC A;  3NPP A;  5EKL A;  5M3F B;  3AB9 A;  1VQF A;  4FYD A;  4HR7 B;  2VUM H;  2KA7 A;  3PIO 3;  5IGC A;  5GAH C;  3Q24 A;  4QUC A;  5JJI A;  5IGG A;  2BDO A;  3M9B A;  3TDQ A;  2PI2 E;  2F0U A;  4EVO A;  2EVB A;  1NBW A;  1KDC A;  1I3Q B;  3HOU H;  1A3T A;  2L12 A;  3SGI A;  3K7A H;  2D62 A;  2YTV A;  1CKN A;  3BZD B;  2R7Z H;  1I5F A;  1LLR D;  3FDT A;  1U9R A;  5IYD G;  4DUY L;  1X54 A;  4LF9 L;  1RDP D;  2F0T A;  2JN4 A;  2ZTC A;  2B8F A;  1VQM A;  4BY7 B;  4DAY B;  2F0I A;  3K5N A;  3U9O A;  1HR0 Q;  1E1O A;  3VA5 A;  3V05 A;  3EJI A;  3TZU A;  3S17 H;  5J3B A;  1LM0 A;  4BBR G;  1W2B A;  1MIU A;  4JV5 Q;  2JA6 B;  4H44 C;  4DV7 L;  1T9H A;  4DR2 L;  1S5B D;  3T1Y L;  5JAV A;  3G7L A;  1HNZ Q;  2ICI A;  1X3P A;  1P16 A;  4MTK A;  2B2W C;  4JOI A;  1S5F D;  2RDH A;  2MP1 A;  2VUM B;  2F0O A;  3TQY A;  1X32 A;  5CBE E;  1HCZ A;  2PNH A;  2SDF A;  1YHA A;  2VXW A;  2UU9 L;  3GV6 A;  5KNB A;  1WTW A;  3HOU B;  1G91 A;  4K5W A;  1TS4 A;  4LF6 Q;  1YHQ A;  4K8I A;  4NXN L;  1QZG A;  3J7Y W;  1IZ6 A;  2AMC B;  4B3T L;  4JI7 L;  4DV2 Q;  3NEL A;  5HUR A;  4BXX H;  1EYA A;  5HY6 A;  2JXM B;  1RKN A;  3KBX A;  4A3J G;  4QJF A;  3Q22 A;  4Q5V A;  1VQA A;  1X55 A;  4POF A;  4DV4 Q;  2EYH A;  2Z4H A;  2VB2 X;  4QQB X;  4RKB A;  2OF1 A;  3GO5 A;  3RZD H;  1SLJ A;  1FD7 D;  1AW7 A;  3F2D A;  4A3E B;  1EIY B;  4IUN A;  5DAU A;  1XNQ Q;  5GQO A;  5CMD A;  2E5L Q;  4K0K Q;  1EY7 A;  1HXY D;  1J9O A;  3KDF A;  5FLM H;  2AUJ D;  2JA5 H;  1KL9 A;  2JQO A;  1V8Q A;  3T53 B;  4RGM A;  3HOX H;  5M3M G;  1Q1E A;  2QF7 A;  4EGV A;  2B2U C;  1KIX A;  1IYU A;  2D0O A;  1FL0 A;  4X6A H;  4Y52 H;  1F2Y A;  5IWA Q;  1XPU A;  1VQ4 A;  1DM0 B;  3FKI B;  1PV4 A;  1QG7 A;  2OXP A;  5EKI A;  4JI1 Q;  3CCL A;  3AYH B;  4DK3 C;  2WAQ E;  1VQE A;  4JV5 L;  2NN6 H;  3QWN A;  1XMO L;  1LV9 A;  2RVL A;  4O2D A;  1ZXT A;  5HGQ A;  3J80 E;  2JJQ A;  5JEA J;  4KD4 A;  4A3L G;  3GTL H;  1KC8 C;  5E3F A;  5LMU L;  2XWB B;  3CMA A;  1XJV A;  2XIW A;  3B6Y A;  1EU4 A;  1JB7 A;  4LF8 L;  1IYJ B;  4UHV A;  3RZD B;  1PA6 A;  1E1T A;  1HNX L;  5C0X I;  1UE7 A;  3N52 A;  4LF6 L;  4BY1 H;  1F9Q A;  1H9S B;  3CW2 C;  1STG A;  1E24 A;  1Q90 A;  5LHY 1;  2R3Z A;  3RN2 A;  5KIX A;  5JPN C;  1B4O A;  3BJU A;  3KJP A;  4M1U B;  4C1N I;  4WJ3 M;  2CH4 W;  3H0G H;  4NXM Q;  1LT6 D;  2HHH Q;  4P75 A;  2Q2T A;  3SK4 A;  4O42 A;  1RIP A;  2QCP X;  1JCK B;  3HOY H;  1IKL A;  1DGS A;  1SNO A;  2YTY A;  3GTK H;  1PVO A;  1WFQ A;  1XNQ L;  3KFU A;  1GHK A;  5FOB B;  2C5C A;  4A3C H;  4L5Q A;  3U58 A;  4K0K L;  2QA4 A;  2F0M A;  1S72 A;  1SBB B;  4EQN A;  1D2B A;  3CAM A;  1QZH A;  4HJA A;  1CI3 M;  1K8M A;  3NQT A;  2JA8 G;  1XNR Q;  5FLX L;  4ODG A;  1HNW Q;  3RLF A;  4CGY B;  4L6T B;  3L9A X;  2F3W A;  2K5D A;  3U50 C;  3ZYY X;  5IWA L;  2YYZ A;  1XX8 A;  1GUS A;  1LTT D;  2NN6 I;  1EIF A;  3CCJ A;  4BY1 B;  3S1M H;  2NTT A;  2CKZ B;  5FO8 B;  2XVS A;  2O5J C;  5DM6 3;  1N9W A;  3D6C A;  4ZYS A;  3S1R H;  2IX3 A;  2I5H A;  4QL5 A;  5KYL A;  2MQH A;  5CV6 A;  1PZK D;  1NAP A;  1KTK A;  1U5K A;  1SMY C;  2VQF L;  2K5V A;  3S1Q H;  4C3J G;  3I91 A;  3U4Z A;  4GLX A;  1HQR D;  4WOR A;  2KCN A;  1WTQ A;  2F52 A;  3SXH A;  2E2I B;  5KYI A;  1Q8I A;  3I3C A;  2PYK A;  3L2P A;  3RN5 A;  3D8G A;  3HKZ G;  2K01 A;  2JA7 G;  2YU9 B;  1IBL L;  1I94 Q;  3PUZ A;  2FHT A;  4HN7 A;  4JVZ A;  4DV0 L;  1QIL A;  4CDC C;  1MHW C;  2JK8 A;  1VMC A;  1PFN A;  4GS3 A;  1EUJ A;  4RKL A;  4NXM L;  1LTS D;  3M7G A;  3STB D;  2ZTE A;  2A68 C;  1FJG Q;  1DCZ A;  3S1M B;  4ZRZ A;  2FJ2 A;  1HHV A;  3S1R B;  4DR4 Q;  5E4X A;  4N8F A;  3A7A B;  1SYC A;  1VQL A;  2R92 G;  4B3S L;  1SE8 A;  2KHI A;  1Y1V G;  5JJZ A;  1XNR L;  3UDX A;  3SEB A;  1JE4 A;  4OON A;  1LTI D;  1NR2 A;  4LF4 Q;  2L55 A;  2XSC A;  4CKE A;  3MXN A;  5IYB G;  3I56 A;  1JJC B;  2QEX A;  4HMI A;  3K59 A;  2F0P A;  2AWO A;  4DAM A;  5CR3 A;  3UI2 A;  3I4M G;  1SND A;  2PQE A;  4KKU A;  1S40 A;  3URY A;  3S24 A;  4WFN 3;  3HFZ B;  2K52 A;  2F0L A;  1VQ8 A;  2A6H D;  1SJH D;  1JIC A;  5I9P A;  3QIA A;  1S3O A;  1PTO D;  1WYD A;  1ENA A;  4DA2 A;  2CHB D;  3M4O H;  1EQQ A;  2LMC B;  3DEO A;  3QOL A;  4DAY A;  5D3I B;  4OO1 I;  3CRK C;  2F3I A;  1GD7 A;  3R2I A;  1SDF A;  1STA A;  3I4N G;  5C44 G;  2EYP A;  1I4R A;  5JJK A;  4L63 B;  4LMQ D;  4L5S A;  5IGE A;  2RCN A;  1RCV D;  3GP7 A;  3M7N A;  1ET9 A;  4C3I G;  4HJ7 A;  5A35 A;  4B3M Q;  4YWL A;  4RCO A;  4KD3 A;  1LUZ A;  3DUZ A;  4HSP A;  5IGD A;  2AQ3 B;  1I6V C;  3CPW A;  3H09 A;  1CKN B;  1SN8 A;  3AQQ A;  2IW3 A;  3TEH B;  5C4Z A;  3CCM A;  1U4R A;  1PRT B;  2BOS A;  2JE6 I;  1CKM A;  3RLN A;  4X66 Q;  2CW0 D;  1FJG L; 
#chains in the Genus database with same CATH homology
 4JBW A;  1LT4 D;  4K14 A;  3OPO A;  3HOW B;  4ABN A;  4CBV A;  5C0X J;  3K57 A;  1JC7 A;  1EY4 A;  4FXD A;  5IGB A;  1ENF A;  3S2D B;  2B63 B;  2E2H B;  3L3O C;  3R3O A;  2NB0 A;  2H4O A;  2IJ0 A;  1KNE A;  4IFD I;  2VNU D;  4X3T A;  3BG3 A;  3SE0 A;  3GQB A;  2WB1 B;  3QOJ A;  1J8I A;  4C56 C;  4PNY A;  2K04 A;  2C9O A;  4X3U A;  2F0W A;  5CV5 A;  1YNN C;  1B1Z A;  4ME5 A;  4EQP A;  2NVQ B;  1F9S A;  2XRS D;  1EY8 A;  3CQZ B;  3QO2 A;  4IN3 A;  4FO2 A;  3MXU A;  1DYQ A;  2HUG A;  1STE A;  1Y1W B;  4OL7 A;  5CBA E;  1RTO A;  1JOR A;  5DEH A;  2ZXO A;  5G3L F;  3M85 A;  3T51 B;  1ICW A;  4I7Z C;  1PXU A;  1H9S A;  1IW7 D;  2IT1 A;  1SE2 A;  1OXV A;  4RGO S;  2B2Y C;  3GV3 A;  3K58 A;  2ICE C;  4P2C B;  1GJX A;  1TS5 A;  2KQ3 A;  1Z6H A;  5ISR A;  1DOK A;  2NWG A;  2PW5 A;  1MSH A;  1WTR A;  1LT3 D;  1DXM A;  1BUV T;  1TKW B;  5JEA H;  4A3G B;  1B9M A;  2PZT A;  1EZ6 A;  3NE5 B;  4IUQ A;  4ZKB B;  2K03 A;  5EKK A;  1TY0 A;  4HCE A;  2F0D A;  5LL6 S;  3RMH A;  2NVT B;  2HQE A;  1HTL D;  1D5M C;  1M4V A;  2XRQ D;  1HA6 A;  4M8A A;  3LWE A;  2N88 A;  3MVV A;  1GOZ A;  4S3S A;  5EBC A;  1MBY A;  2BA1 A;  4BA1 I;  3D4D A;  3HOZ B;  1SNP A;  2K6A A;  2A69 D;  3ND9 A;  2G9D A;  4FXK C;  1CK1 A;  4NKL A;  1EWC A;  5LL6 X;  3P1H A;  5C3E B;  1TWA B;  5C3W A;  4GZY C;  1PRT D;  2B2T C;  1CQF A;  3NSW A;  2X6G A;  3PUY A;  5TSS A;  4FNF A;  3J80 L;  4C3H G;  3A8K E;  3V96 A;  1WTX A;  4FF2 A;  1SE3 A;  5ELD A;  2NVX B;  3FPU B;  1E2V A;  4MN3 A;  3A55 A;  2RA4 A;  3S2H B;  5JVG 3;  4J8Q A;  4F88 A;  2AUK A;  3I73 A;  2Z8L A;  1CA6 A;  1SNQ A;  1F9P A;  1EEI D;  1Z47 A;  2XWJ B;  4Z9C B;  3WOF A;  1EY0 A;  1D5Z C;  4KTA A;  1RF2 D;  3K0Y A;  3KLR A;  2M9V A;  1EWH A;  5CV4 A;  5C4J B;  3K5L A;  1QNU A;  1EYD A;  3HS0 C;  3OSO A;  1TR5 A;  4PV1 C;  2SNS A;  1LO5 D;  1LAB A;  3TP6 A;  4K2L A;  1YNJ D;  4RH6 A;  3VR5 A;  2RQX A;  1STH A;  1KDB A;  4ZLT F;  1SFO B;  1B50 A;  5KEE A;  2EZV A;  1L0X B;  1V43 A;  4CKC A;  3GTG B;  3VYT A;  3S14 B;  3K6O A;  1R4Q B;  4LJZ C;  1VCI A;  3BVM A;  4DXF A;  1BDO A;  4X3K A;  1A2T A;  3C46 A;  3X3N A;  1TVX A;  1BBX C;  1CT1 D;  2MUY A;  4ID6 A;  5K5P A;  2LY7 A;  3MHB A;  5I6Y A;  1O80 A;  3I72 A;  2FMM A;  1TQO A;  4A3J B;  2RDG A;  3C2P A;  1Q3L A;  2LFN A;  2L5T A;  5K36 G;  2F4I A;  1F2M A;  4A93 B;  1QNK A;  1O7Z A;  3MTS A;  1STB A;  3AMU A;  5M3M B;  1I4P A;  3NHH A;  3TP8 A;  3EVQ A;  1FYC A;  2I07 B;  4V0B A;  3K7A B;  1EZ8 A;  2R7Z B;  1KAB A;  2K32 A;  1PLF A;  3VR3 A;  4I65 A;  4LK1 C;  1TWC B;  1AN8 A;  1BCP B;  3S17 B;  2L11 A;  2O4X A;  2HDL A;  3A54 A;  1Q1B A;  4MHE A;  4G4K A;  1FNU A;  2A5H A;  2KCC A;  4DK0 A;  4NP5 A;  1EU3 A;  3BVZ A;  3NBH A;  1H9K A;  1LAC A;  1HFN A;  2PZU A;  1WD1 A;  5CV8 A;  2KED A;  1VDZ A;  3SK8 A;  5FO7 B;  3J7A F;  4PMW A;  3FEW X;  4IUV A;  1WD0 A;  1OO9 B;  1PFB A;  2J7Z A;  1VF7 A;  2F0J A;  2L9H A;  3CU7 A;  2IPK D;  2RBM A;  3P7J A;  3MAQ A;  5COY A;  1FGB D;  2EY6 A;  1B2T A;  2OT2 A;  3MC0 B;  2NYZ D;  2A74 C;  3DWQ A;  4IUP A;  4DGZ A;  4ZK9 B;  2JA5 B;  4QCL A;  2V4D A;  4HSV A;  3IFD A;  1HUN A;  1FR3 A;  3HOX B;  3KK7 A;  1PMR A;  2WAQ B;  1EFI D;  1ZYR D;  2MPM A;  1CHP D;  1TT2 A;  4KV6 A;  1B3A A;  1GUW A;  2MJ8 A;  1DJR D;  1SEB D;  4HCS A;  3QG1 A;  1F77 A;  3HKZ B;  5T1G A;  4IZ8 A;  2KEC A;  4RAU C;  3NUC A;  5JVH 3;  1DOM A;  4FXG C;  3GTL B;  1JR0 D;  1BQQ T;  5ELE A;  1ILQ A;  1EEF D;  1CQV A;  2F0F A;  5C0X G;  1BCP F;  1G8Z D;  1KDA A;  1WTP A;  3J81 E;  1SE4 A;  4G57 A;  1CZG A;  1CFM A;  3Q23 A;  1MGS A;  2EYL A;  2BCO A;  3JAM E;  3BDO A;  3MFY A;  5CGK A;  1T5E A;  1JOK A;  5EPL A;  3H0G B;  2HDM A;  2R92 B;  3OWF A;  1IL8 A;  1EYC A;  1Y1V B;  3R8B A;  1WTV A;  1D1I A;  4IUR A;  1A2U A;  2IX0 A;  3QB3 A;  2AQ2 B;  1XTC D;  3HOY B;  3D4R A;  3OMG A;  5BN3 A;  3GTK B;  1CA5 A;  5E1F A;  4L8J A;  2NVY B;  3I4M B;  3MXG A;  2EJM A;  1F2Z A;  5M5W B;  3L7Z C;  3LWU A;  3VYU A;  2DY8 A;  3TP5 A;  1ROD A;  4FF4 A;  3MA2 B;  2NN6 G;  2B2U A;  1Q12 A;  2RSN A;  2VB3 X;  4KHZ A;  4KK7 A;  4HED A;  3I4N B;  3S1N B;  2M2L A;  3H94 A;  3T4A C;  1SJE D;  1LT5 D;  1BCP D;  5CV7 A;  3S1Q B;  2A6H C;  4CHT B;  2CVR A;  4J1M A;  4OGQ C;  2PO4 A;  1NUC A;  1PTO C;  5ELC A;  5FK9 C;  1STY A;  1A3U A;  1LTB D;  2K7V A;  3I90 A;  4KY7 A;  2EY5 A;  2IX1 A;  2BE5 D;  1RJT A;  1A15 A;  2EJG C;  2NBF A;  2EXZ A;  3BVG A;  4AYB B;  1AFP A;  2TMP A;  1A6X A;  2F0S A;  4H0L C;  3VR4 A;  2PMZ B;  1H9M A;  4DAV A;  2CW0 C;  5IT9 E;  5EPJ A;  5C3X A;  3S16 B;  3PO2 B;  4DN4 M;  3N6R A;  1OXS C;  1G29 1;  4UAI A;  4BBS B;  1JWS D;  3Q6S A;  5D65 A;  2KJX A;  3TSS A;  3NXW A;  4UDU C;  2K28 A;  5C6A A;  1Y69 U;  2D2C C;  4XQN A;  1CM9 A;  5ELB A;  1R4P B;  2F0N A;  4RFB A;  1B9N A;  2PCF B;  4WJW A;  1BNZ A;  3GTM B;  3M4O B;  4OO1 G;  2O5I C;  1Y8O B;  4OIK A;  3PUW A;  4K6L A;  5DM7 3;  1DOL A;  2ZXR A;  1NR4 A;  3NTH A;  4NDX A;  3V2T A;  1OXT A;  2Q8T A;  2FIN B;  2E75 C;  2NUC A;  1K8O A;  1AP0 A;  3O13 A;  3I8Z A;  1TY2 A;  4DF7 A;  5J22 A;  4U68 A;  2B39 A;  5CYU A;  3NTK A;  3OOC A;  2QKI C;  1EY5 A;  1CTM A;  1UAP A;  1PYW D;  1ENC A;  4J6H A;  2Z1C A;  3I4L A;  1I4X A;  2RKS A;  1IW7 C;  1RHP A;  2R61 A;  2F03 A;  4QF4 A;  2PZW A;  3CKI B;  1GUN A;  3OIP A;  4IFD G;  4MIU A;  2F0K A;  3SK6 A;  5EBD A;  3J7A V;  1H9J A;  4C1N K;  2A6E D;  2WP8 J;  3F2U A;  3VYS A;  1OXU A;  4F8M A;  3U9S A;  5FO9 B;  2K5Q A;  5E4W C;  3HG9 A;  3A56 A;  2ENB A;  4B08 A;  2EJF C;  3C1F A;  4RWS C;  1I50 B;  1JQY D;  1SYF A;  5J39 A;  4FP5 D;  4A3B B;  3WDN A;  3H6M A;  2B2V C;  4KI0 A;  3HP3 A;  1RD9 D;  3GTQ B;  1Z7T A;  1SYD A;  1KAA A;  1DZ1 A;  1ILP A;  1PDQ A;  4RGN A;  2GA4 B;  1AZQ A;  3EFX D;  5D14 A;  2A69 C;  4KMU C;  2WII B;  1FNW A;  1ZKO A;  1U4M A;  5G3L D;  1PRT C;  1TS2 A;  1F9R A;  2K33 A;  5M5X B;  5A2Q E;  3MXP A;  4B9W A;  1GUG A;  3QJY A;  4ZUI A;  4G7H C;  1OXX K;  3FPP A;  1PZJ D;  1NCV A;  1XYI A;  2E2D C;  4XDX A;  1B44 D;  1SAP A;  3ONA B;  2L1B A;  1E2Z A;  1EOT A;  1EY6 A;  3E5S A;  2WAC A;  3FRP B;  1UNS A;  5K36 H;  1S5C D;  5KNC A;  3RUZ A;  2JEB I;  1SYB A;  3BYY B;  5C4H A;  3WOE A;  2KEE A;  4K5V A;  4KJO A;  2K05 A;  4XYQ A;  1YNJ C;  3DWP A;  5BN4 A;  4H7B A;  4KJN A;  2X69 A;  1U4P A;  2EYF A;  4R9W A;  1S5E D;  3ITP A;  1QCB D;  4KN7 C;  1HPC A;  2TSS A;  1WTO A;  1QWY A;  2F0H A;  2SOB A;  3KF8 A;  4BBR B;  4BA2 I;  4IFD J;  2B2Y A;  3IFT A;  3K5M A;  2EOT A;  3SR1 A;  4RHS A;  5I6W A;  3D6W A;  1ML0 D;  3NTI A;  4C2M B;  5ELF A;  4LAA A;  2SNM A;  1HRJ A;  3VR2 A;  1NSN S;  1D5X C;  4XTC S;  3JAM L;  4BWG B;  1I6H B;  5D3D A;  4U67 3;  2XNA C;  5FKA C;  3PO3 B;  4PMB A;  1GUO A;  5IGF A;  1B53 A;  1VF5 C;  3IL8 A;  1T5X D;  2MGS A;  2XN9 C;  3TN2 A;  4F87 A;  3T16 A;  1IYV A;  1A3V A;  3MZ5 A;  4Q0F A;  2J4X A;  3DMU A;  3SK5 A;  1SYG A;  2CQA A;  1SXT A;  5EJW A;  4N9T A;  4TKO B;  3AU7 A;  3BDL A;  1XWE A;  3DWA A;  4JK1 C;  2K5W A;  2EY1 A;  3PV0 A;  2WKD A;  4DFA A;  2BDN A;  4G7Z C;  1KNA A;  1SNC A;  5F2D A;  2B2T A;  4H13 C;  1O7Y A;  2EPB A;  4R8N A;  2E74 C;  3CHB D;  3VA7 A;  2KVM A;  3P20 A;  2EYO A;  5COR A;  4PQX A;  2O2L D;  3NWT A;  4KY6 A;  3OHX C;  4CJ1 B;  4B9X A;  1PTO H;  2HCI A;  3EA6 A;  2F3V A;  4YIJ A;  5C4X B;  3PIP 3;  5C0X H;  3RD4 A;  2DNE A;  1E0B A;  3M3Y B;  2SEB D;  2JYO A;  4KY5 A;  4NW2 A;  2JP1 A;  3R2T A;  4G7O C;  1VMP A;  4ZAI A;  2E76 C;  4E6I A;  3A8I E;  2ZT9 C;  4DK1 A;  5IT9 L;  4DNR B;  3ERQ A;  4ZUJ A;  1EIH A;  1EQV A;  2BA0 A;  2EY2 A;  5KGU A;  2WIN B;  2HCC A;  5EQ0 A;  2RDF A;  2KUM A;  1ZYR C;  2JA8 B;  3M4Y A;  1JWU D;  1PTO B;  3SDZ A;  4KKS A;  4DXG A;  1U4L A;  4KHV A;  1G2T A;  2Z4I A;  3MEH A;  2LKV A;  3NBI A;  1V1P A;  4CJ0 B;  4XYO A;  1M8A A;  5EPK A;  2L4N A;  4CJ2 C;  3X3M A;  4C3J B;  1WVL A;  1ONL A;  1D6E C;  1S5D D;  1C8C A;  2NTS A;  3KUP A;  3KLS A;  4Y7N B;  2FFK B;  3T56 B;  3BDC A;  3VYR A;  2JA7 B;  1EL0 A;  1TU2 B;  1CHQ D;  4EQO A;  1UUP A;  2WV6 D;  2B2W A;  1GUT A;  1GXD C;  2A73 B;  1BXT A;  3OW7 A;  3I70 A;  4QB4 A;  2EYM A;  2EE1 A;  3NP8 A;  3H3V C;  4TSS A;  3K5O A;  4TQU S;  4FF3 A;  3IAY A;  3LX0 A;  4IAL A;  3S9W A;  3TME A;  4TRD A;  4XT3 B;  2AQ1 B;  1EIG A;  2QIL A;  3W3A A;  1LTG D;  2R93 B;  1TWF B;  1X3Q A;  1H9R A;  1BCP C;  1SSO A;  5C5M A;  2MHV A;  5AFW A;  2L0C A;  1PTO F;  3NWS A;  4OO1 H;  4RGT A;  1AZP A;  3TBI B;  5IOC A;  3D4W A;  2BE5 C;  5C44 B;  1O78 A;  1I4H A;  1SMY D;  3D31 A;  4C3I B;  2B8G A;  3LNN A;  2FMC A;  3DM1 A;  4HMJ A;  1EY9 A;  2K1B A;  3S15 B;  3A8J E;  4FVM A;  3TP7 A;  3C3L A;  1F2L A;  3PUV A;  1HUM A;  3OWE B;  1HFG A;  5IIF A;  5KND A;  5IOD A;  4HTH A;  2A68 D;  1ZEQ X;  5A2Q L;  1QOH A;  5I2Y A;  1CZW A;  4RHR A;  4A3D B;  4KKT A;  2X6L A;  1MSG A;  2KOL A;  3E0J A;  4A3F B;  1E2W A;  4XT1 B;  4IFD H;  5M5Y B;  3BYT B;  4XXE A;  4HAE A;  1DON A;  3D3R A;  4RA8 A;  1KLU D;  5BN5 A;  1RTN A;  4XQQ A;  3IKJ A;  1JOO A;  2AWN A;  4V19 0;  2PW7 A;  3TZD A;  1QE6 A;  4OIJ A;  1Y8N B;  5CC4 A;  3CRL C;  3PMF A;  4ULL A;  4IUT A;  4XQJ A;  2PPB C;  4K8J A;  1QJO A;  5I4D A;  3C1E A;  2J0T D;  1AEX A;  4R8I A;  4ILW A;  2Q8I B;  1JWM D;  3BS1 A;  3W2D A;  2PNR C;  5NUC A;  3P75 A;  1BF4 A;  4X3S A;  1HQM C;  1WCM B;  3KBG A;  4XIG S;  3PUX A;  1ET6 A;  2OEO A;  4QUF A;  2Q8R E;  2DN8 A;  5I2X A;  1W6K A;  4BS9 A;  2JEA I;  1BO0 A;  2A6E C;  5FLX E;  4RCN A;  1I4G A;  3SHL A;  3DEP A;  3HZX A;  2F0E A;  1I4Q A;  3HRZ C;  3VR6 A;  4A3M B;  1DD2 A;  1FNV A;  1II3 A;  2Y0S B;  1S4Z A;  2ZXP A;  2IWH A;  1K83 B;  2F1M A;  1ESR A;  1IKM A;  1YNN D;  4NMZ A;  1MI2 A;  4IUU A;  3H91 A;  1D1K A;  1BR9 A;  5HGT A;  3FMC A;  2D5D A;  3OMC A;  2QDB A;  2QEJ C;  3NK9 A;  2M00 A;  5J1Z A;  3SVM A;  3NQI A;  3T13 A;  1KLG D;  5C5L A;  1XXG A;  2H1E A;  5DNF A;  4O1N A;  2LS0 1;  4ZQ3 A;  1G6Z A;  1V1P B;  1PRT F;  3DXJ C;  1PFM A;  1SYE A;  3MFG A;  1TWG B;  2NZ1 D;  2EYJ A;  1W6J A;  4OHJ A;  4FF1 A;  4C3H B;  1LTR D;  3E6Z X;  3MWY W;  2KHS A;  4N9P A;  1LTA D;  3DHQ A;  1STN A;  3G6J B;  2RSO A;  2EDG A;  5JOB A;  3HGB A;  5CV9 A;  3GTP B;  4ZKC B;  2F0Q A;  2JSO A;  1HA5 A;  4WRD A;  1L0Y B;  1TS3 A;  4F7X A;  1C48 A;  5T1I A;  5I9O A;  2IL8 A;  3ERO A;  2DNC A;  4IQZ A;  5JPM C;  3OIQ A;  1JB3 A;  1MD2 D;  4A3K B;  5M9O A;  3R93 A;  3GD7 A;  3HEJ A;  2N55 A;  3FVQ A;  3KLS X;  1C4Q A;  1O7L A;  1BOS A;  4DNT B;  4DU9 A;  1HTP A;  3A7L A;  4K2K A;  2I46 A;  2G9H D;  3ND8 A;  1ESF A;  2F0G A;  4K6D A;  2D9U A;  1GHJ A;  3GTO B;  4PMC A;  1G2S A;  4K5X A;  1QB5 D;  1TWH B;  1SNM A;  4KN4 C;  2ID0 A;  2F0V A;  4A3I B;  2DY7 A;  3RZO B;  1PZI D;  1IHZ A;  5KRU A;  4QMG A;  4QIW B;  5JEA G;  4CKB A;  1V1O A;  4DAP A;  3J81 L;  3Q0A A;  1JOQ A;  5EGT A;  1R9T B;  1EQT A;  2E2J B;  1UEA B;  2B2V A;  3GTJ B;  3HOV B;  3EQL C;  2R6G A;  1TII D;  1Y8P B;  2WKC A;  3NPP A;  5EKL A;  5M3F B;  3AB9 A;  4FYD A;  4HR7 B;  2KA7 A;  3PIO 3;  5IGC A;  3Q24 A;  4QUC A;  5IGG A;  2BDO A;  3TDQ A;  4EVO A;  2F0U A;  2EVB A;  1KDC A;  1I3Q B;  1A3T A;  2L12 A;  2D62 A;  3BZD B;  3FDT A;  1LLR D;  1U9R A;  1RDP D;  2F0T A;  2B8F A;  4BY7 B;  2F0I A;  3K5N A;  3U9O A;  3VA5 A;  3V05 A;  3EJI A;  3TZU A;  2JA6 B;  4H44 C;  1S5B D;  5JAV A;  3G7L A;  2ICI A;  1X3P A;  2B2W C;  1S5F D;  2RDH A;  2MP1 A;  2VUM B;  2F0O A;  1X32 A;  5CBE E;  1HCZ A;  2SDF A;  2VXW A;  3GV6 A;  5KNB A;  1WTW A;  3HOU B;  1G91 A;  4K5W A;  1TS4 A;  4K8I A;  3J7Y W;  5HUR A;  1EYA A;  2JXM B;  1RKN A;  3KBX A;  3Q22 A;  4Q5V A;  2EYH A;  2Z4H A;  2VB2 X;  4RKB A;  2OF1 A;  3GO5 A;  1FD7 D;  1AW7 A;  4A3E B;  4IUN A;  5DAU A;  5CMD A;  1EY7 A;  1HXY D;  1J9O A;  2AUJ D;  1V8Q A;  3T53 B;  4RGM A;  1Q1E A;  2QF7 A;  4EGV A;  2B2U C;  1IYU A;  1F2Y A;  1DM0 B;  3FKI B;  1QG7 A;  2OXP A;  5EKI A;  2NN6 H;  3QWN A;  1LV9 A;  2RVL A;  1ZXT A;  3J80 E;  5JEA J;  4KD4 A;  5E3F A;  2XWB B;  2XIW A;  1EU4 A;  3RZD B;  5C0X I;  3N52 A;  1F9Q A;  1H9S B;  1STG A;  1Q90 A;  5LHY 1;  2R3Z A;  5KIX A;  5JPN C;  1B4O A;  4M1U B;  4C1N I;  1LT6 D;  3SK4 A;  4O42 A;  2QCP X;  1JCK B;  1IKL A;  1SNO A;  1GHK A;  5FOB B;  2C5C A;  2F0M A;  1SBB B;  4EQN A;  1D2B A;  1CI3 M;  1K8M A;  3NQT A;  5FLX L;  4ODG A;  3RLF A;  4CGY B;  4L6T B;  3L9A X;  2F3W A;  2K5D A;  3ZYY X;  2YYZ A;  1XX8 A;  1GUS A;  1LTT D;  2NN6 I;  4BY1 B;  2NTT A;  5FO8 B;  2XVS A;  2O5J C;  5DM6 3;  3D6C A;  4ZYS A;  2IX3 A;  5KYL A;  5CV6 A;  1PZK D;  1NAP A;  1KTK A;  1SMY C;  4C3J G;  3I91 A;  1HQR D;  4WOR A;  2KCN A;  1WTQ A;  3SXH A;  2E2I B;  5KYI A;  1Q8I A;  3I3C A;  2PYK A;  3D8G A;  2K01 A;  2YU9 B;  3PUZ A;  2FHT A;  4HN7 A;  1QIL A;  1VMC A;  1PFN A;  4RKL A;  1LTS D;  3M7G A;  2A68 C;  1DCZ A;  3S1M B;  4ZRZ A;  2FJ2 A;  1HHV A;  3S1R B;  5E4X A;  3A7A B;  1SYC A;  5JJZ A;  3SEB A;  1JE4 A;  1LTI D;  1NR2 A;  2L55 A;  2XSC A;  4CKE A;  3MXN A;  4HMI A;  3K59 A;  2F0P A;  2AWO A;  5CR3 A;  3UI2 A;  1SND A;  2PQE A;  4KKU A;  3URY A;  4WFN 3;  2F0L A;  2A6H D;  1SJH D;  5I9P A;  1JIC A;  3QIA A;  1PTO D;  1ENA A;  4DA2 A;  2CHB D;  4DAY A;  2LMC B;  3DEO A;  3QOL A;  5D3I B;  4OO1 I;  3CRK C;  1SDF A;  1STA A;  3R2I A;  2EYP A;  1I4R A;  4L63 B;  4LMQ D;  5IGE A;  1RCV D;  3GP7 A;  3M7N A;  1ET9 A;  4C3I G;  5A35 A;  4RCO A;  4KD3 A;  3DUZ A;  4HSP A;  5IGD A;  2AQ3 B;  1I6V C;  3H09 A;  2IW3 A;  5C4Z A;  1U4R A;  1PRT B;  2BOS A;  2JE6 I;  2CW0 D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...