2RBMA

Crystal structure of staphylococcal nuclease variant delta+phs i72k at cryogenic temperature
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
130
structure length
130
Chain Sequence
b'KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKKEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS I72K at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 36
structure length 130
sequence length 130
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2007-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2rbmA00
1EY7A 5HGTA 4K6DA 1STHA 4ZUIA 2F0VA 2EXZA 3TP8A 3DMUA 4QF4A 2F0IA 4KY7A 5KYLA 1STYA 1JOQA 5C4ZA 2EY2A 4H7BA 2LKVA 5CV9A 2EYJA 3D8GA 3QOLA 5CC4A 4PNYA 5M9OA 1TT2A 5HURA 1TR5A 3P75A 3OSOA 1SNPA 2EY5A 2QDBA 5IGEA 2F0OA 2SOBA 2F0UA 5KGUA 2PZUA 2M00A 3D4DA 4IUNA 1RKNA 5I9PA 4K2KA 3C1EA 5JAVA 5KYIA 1SNMA 5DAUA 5C3WA 1EY9A 2F0NA 3NK9A 1SYDA 3SXHA 3V2TA 3BDLA 5CV6A 5C6AA 5IGFA 1F2MA 4PMCA 2F0HA 3T13A 4ZUJA 4EQNA 4KTAA 3TMEA 3S9WA 4EQPA 5J22A 5J1ZA 1JOKA 2WACA 2F0SA 1AEXA 2F0QA 2SNSA 2F0JA 4LAAA 1JORA 3SK5A 3C1FA 3PMFA 3QOJA 4KY5A 1KDBA 3NXWA 4G57A 5F2DA 1SNDA 5EKLA 5E3FA 1NUCA 1F2ZA 2EYHA 2KHSA 5CGKA 4IZ8A 1TQOA 4WORA 3R3OA 4ODGA 3TP7A 5KIXA 1SYBA 4HMJA 1EZ8A 4R8NA 1SYFA 4OL7A 4NMZA 5NUCA 2OEOA 4TRDA 4F8MA 1STAA 2RKSA 1EY6A 1IHZA 2F0DA 3MZ5A 4J6HA 5E1FA 1SNOA 3SK8A 2SNMA 1A3TA 3MVVA 3SHLA 4N9TA 5DEHA 2F0KA 4DF7A 2F0GA 2RBMA 4DU9A 4HMIA 1EQVA 5CV7A 3OWFA 3NHHA 2EY1A 3HZXA 4IALA 2PYKA 3DHQA 4K2LA 3OMGA 3NQTA 4K8JA 2HQEA 2F0LA 3D6CA 1JOOA 4DFAA 3EJIA 2O4XA 3EVQA 4B9WA 2F0TA 2OF1A 2EYLA 2PQEA 3ITPA 1SYCA 5CV5A 5IODA 5CV4A 4K14A 4K5XA 3LX0A 4RKLA 2EYOA 1EYAA 5CR3A 1A3VA 1KDCA 1SYEA 1A3UA 5IGGA 1EY8A 4NP5A 5I6YA 4PMBA 5JOBA 2EYFA 1EYCA 3H6MA 2F0EA 1U9RA 5ISRA 4EVOA 5EGTA 1SYGA 3SK4A 1SNCA 1EZ6A 3ERQA 4K5VA 2PW7A 2OXPA 3MEHA 1KABA 2F0WA 1STGA 2PW5A 4EQOA 2PZTA 5EKKA 3D4WA 5C5LA 3QB3A 3RUZA 2F3VA 3SR1A 2PZWA 4J1MA 5IOCA 4RKBA 4KJNA 5KRUA 4KD3A 2F0FA 4S3SA 1ENAA 1KAAA 1ENCA 3U9OA 4DGZA 5IIFA 2F0MA 3MXPA 2EYPA 4KD4A 4NKLA 4E6IA 5I9OA 4NDXA 2NUCA 4HTHA 4KV6A 4ME5A 3TP5A 5KEEA 1STNA 4N9PA 1EY4A 2F3WA 3HEJA 2ENBA 4K8IA 3SK6A 4QMGA 4KY6A 4ZQ3A 5IGDA 5IGCA 3T16A 2KQ3A 3BDCA 2F0PA 5C4HA 1SNQA 5I6WA 5K5PA 4YIJA 4KHVA 3VA5A 5J39A 5C5MA 2EY6A 1EYDA 1EY0A 3P1HA 5IGBA 1A2UA 5CV8A 3MHBA 4QB4A 4KJOA 4B9XA 1A2TA 4F7XA 3EROA 2RDFA 1F2YA 3NUCA 1NSNS 3TP6A 3OMCA 5C3XA 4ID6A 4I65A 1KDAA 1STBA 3E5SA 1EY5A 4WRDA 4K5WA 4MIUA 1II3A 3NP8A 2EYMA
chains in the Genus database with same CATH superfamily
1NBWA 2R7ZH 4OEMB 4ZKCB 1F9SA 1JOQA 4APVA 5C4XH 2LKVA 4FNFA 2WV6D 1O7YA 3MA2B 1CA6A 1PH6A 4GOPA 2H5XA 3VDYA 5C4JH 3KLSA 1MJCA 5C3WA 5C6AA 2I5LX 1XNRQ 2F4VL 1FVIA 4ZUJA 4EQNA 5C3EH 4GKJL 4IJHA 2VNUD 4LUVA 4IN3A 3SEBA 3PUVA 3VR4A 1EOTA 1VQCA 3C1FA 3PMFA 4JOIC 1BNZA 1AW7A 2JXMB 3K8AA 1J5EL 1V43A 2HIXA 5GAGC 4QIWB 5IYCH 3HOUH 1NCVA 2OEOA 3EIVA 2A69D 1Y14B 1V1OA 5FLMG 3LWUA 2ZTCA 4MZ9A 1GUTA 3SHLA 5DEHA 2F0GA 4A3BB 4CKBA 1SBBB 2PQAB 1ESFA 3MEFA 4IJLA 4DK3C 2CFMA 3K5LA 1I94L 2KENA 1GVPA 3KYHC 5GQOA 2UXCL 1GJXA 3GTQH 1SLJA 3GTLH 5CV5A 1NTGA 4DR1L 3W1GA 3RZOH 1BDOA 5JOBA 5FKAC 2VUMB 1L0XB 4EVOA 5CBAE 3K58A 4I7ZC 1PH5A 3FVQA 1T5XD 1CT1D 1S72A 5LMUL 5JJLA 2K32A 3DM1A 1WVLA 1TKWB 4ME3A 4HIMA 2ATWA 2B2TA 2CH4A 2IT1A 3DLLA 5I9OA 5JVG3 4KV6A 2F3WA 3S24A 1T9HA 4JI4Q 1YNNC 2UXBL 2CWPA 1Z47A 1IYUA 5EQ0A 1B2TA 3H94A 4JG2A 1ASYA 1CK1A 1TWCH 4DR7Q 3UE0A 4QQBX 2HDLA 4BWGB 4JI0L 2EDGA 4F7XA 3BYYB 3NUCA 2JA8G 3G4SA 5C4XG 1G51A 4I65A 3S15H 1PRTB 1PFSA 1EY5A 3I4LA 1FNUA 4H0LC 3EA6A 4DV3L 4LF5Q 2DUDA 2B39A 1YBYA 5CV9A 2UUBQ 1JE5A 5T1IA 5C3EG 4HJAA 2CKZB 1B53A 5KGUA 1Z9FA 1UEBA 1M4VA 3C1EA 1W6KA 1PA6A 1AE3A 2F0NA 4OWTB 1YEZA 2JA5H 4B3RQ 1GUNA 1PTOD 3PIOA 1GM5A 3RLOA 1XNRL 4BBRH 1OXTA 1QE6A 2L1BA 1JB3A 2F0QA 1QWYA 1XMQQ 4DR6Q 3D4RA 3NXWA 2MP1A 1VQKA 1VQFA 3I4NG 3F2BA 1VMCA 1F2ZA 2N3SA 4P2CB 2UUCQ 2IPKD 3KLRA 3T53B 5BN4A 1EU3A 1N9WA 4TKOB 4O2DA 5C44B 2IHEA 5IWAQ 2F0KA 1BF4A 3OHXC 2ICIA 2FMCA 3A8IE 2PYKA 4XYQA 3J80i 1K0SA 2B8GA 2CW0D 4A3JB 4CDFC 4I7AA 4NXNQ 4NXMQ 1X55A 3CP0A 2G9HD 5A35A 2KHJA 3TDQA 5ELDA 2EPBA 3TZUA 4DV1Q 4X3TA 3PGZA 2Z4HA 1PZKD 2PZTA 2NZHA 2XVSA 2MHVA 4EQ5A 1X32A 3U9OA 2NVTH 3J7AV 1CKNA 4IOCA 2BE5D 1VDZA 3K7AB 3UI2A 3VYUA 5KEEA 5JJIA 3HOZB 1Y1VG 4U673 3OW7A 4CDCC 5JVH3 1JMCA 4JI4L 1Q3LA 2BA0A 3KF8A 5CORA 1EY0A 4XQQA 3O13A 1QNKA 2A6ED 2D5DA 4DR7L 2J0TD 4R4IA 3TP6A 2A73B 3FKIB 1WD0A 4C2MB 3HS0C 5ELEA 5I2YA 2VS1A 1VQBA 2EXZA 3TP8A 2F03A 4DV5L 2JA5G 3J81j 2QEXA 1YITA 3QOLA 4R4CA 5M9OA 2QF7A 2DNEA 4YY3Q 5IGEA 1I3QB 1UUPA 3A7LA 3E0EA 4BBRG 2UUBL 2NTTA 2NVYB 1LTID 2AUJD 3I56A 1O7IA 1UE6A 5LL6S 4UP8A 4GNXB 3PO3B 3NK9A 1DM0B 1KNAA 1SYDA 1CQVA 4CJ1B 3ND8A 1O7LA 5LL6X 4HIDA 3CCMA 1TWHH 3ERSX 3KJPA 4MN3A 3NTHA 1L1OB 4OO1I 1XMQL 2EYHA 1FGUA 2JA7B 3AQQA 2VY3A 2K4KA 1X54A 2UUCL 4OL7A 1CSPA 2RKSA 1N34Q 2UXDQ 2VB2X 2PO4A 1PFNA 4A3KG 4BY1G 3PIP3 3S1NB 1I4XA 1QB5D 3H0GH 4DU9A 1VCIA 1Q1BA 2ZXPA 5IWAL 4HSPA 2XN9C 1U4RA 4H02A 1LTRD 4L5QA 3GTGB 1LUZA 3PV0A 1LT5D 4C3HB 2ZM6Q 4KKSA 1CI3M 4QL5A 3K59A 2R92B 3ITPA 4O0AA 2LMCB 4K5XA 3NWSA 5CR3A 3U50C 2D0OA 4NXNL 3OYYA 5JJKA 3S2HB 1EYCA 1YNJD 1IYJB 1ZXTA 4WJ4A 3ICEA 2VQEQ 2XNAC 4UPAA 2PW7A 2XTIA 1VQEA 2CQAA 1W3SA 3HOVG 1YJNA 4DV1L 5C0XJ 2HD3A 2EIFA 3DWAA 5KRUA 2K5WA 4KD3A 1LT6D 1LO5D 1XPOA 3GTKB 2K50A 3HKZB 4KN4C 4BBSB 2B8FA 3M4PA 2R7FA 4GOPC 4O42A 2NVXH 2ENBA 5IGDA 2NYZD 1I4PA 3I4MH 5I6WA 4KKTA 2C35B 4JOIA 3VR5A 4YIJA 1IBLQ 5FK9C 4OO1H 5K36H 2RDGA 3F1ZA 4CDEC 3JAMi 1B8AA 1HCZA 3BU2A 3BVMA 1U4PA 2J4XA 1XPUA 1C4QA 3BJUA 4FXGC 4IPGA 3FHWA 1KDAA 2B2WC 3D8GA 2D9UA 2KJXA 4DV7Q 1SEBD 3QWNA 4ALPA 3R2IA 3RMHA 4YCWA 1I4QA 2DY8A 2E2IB 2UU9Q 1Q8KA 2B29A 1HHVA 3M4QA 5IYDG 3U58A 4FF1A 1PLFA 1JQYD 2F52A 1JICA 4YY3L 2Z6BA 2CCZA 5JPNC 3NELA 5JEAJ 3J80c 3TS2A 3NTKA 3S9WA 3TMEA 1SDFA 2MFIA 3PIO3 2K5QA 1IW7C 1PVOA 4KY5A 1LTAD 1DOLA 1K3RA 1HNZL 1G2TA 1ESRA 4H44C 4OELB 3H0GG 3C2PA 4IZ8A 1TQOA 1E1OA 4A93B 4B3TQ 4NMZA 3CQZH 4DNTB 3VR2A 3KFUA 1B4OA 1DYQA 1SMYC 2WB1G 2F0DA 4PZ6A 4X65L 3HOWB 1SNOA 1YHBA 1A3TA 3CCSA 1N34L 2UXDL 4BY7B 4DV0Q 2VUMH 4FP5D 1PMRA 4MTNA 2BA1A 3Q23A 3U4ZA 1DOMA 2B3GA 1UE1A 2CHBD 4ILWA 2ZM6L 5CV4A 4TSSA 1EYAA 2YU9B 2XWBB 2JSOA 4BA1I 1HH2P 3G6EA 4LWCA 1JCKB 5IP7H 1L2FA 4AQYQ 3GTJB 3MEHA 1FYCA 2K03A 4A3GG 1DD2A 2VQEL 2Z4IA 5IOCA 1TU2B 4PMWA 4EX5A 2YTXA 1K73C 2G9DA 4AYBG 4P71A 2ZJQA 4OIJA 4HTHA 2JP1A 2DY7A 4GS3A 2RVLA 2BH8A 2HQLA 1C7YA 1RF2D 1IBLL 3V96A 1MBYA 3F2CA 1HNXQ 3OTOQ 4OONA 4QY7A 4K5WA 3KLSX 3PUZA 5FLXL 3AYHB 1PFMA 3URYA 4BXXG 4DV7L 4L5RC 2H1EA 3R2TA 1D5XC 2CVRA 4JI8Q 2D62A 1HTPA 1L0YB 2M00A 4CHTB 4M8AA 1D5ZC 2E75C 1Y1WB 2Q2UA 3A8KE 5LMNQ 1JR0D 1EWCA 4CKEA 1CTMA 4A3FB 5J1ZA 1JOKA 2R3ZA 3HOXB 1TIID 2KBNA 1GD7A 5C44H 1HZAA 2X6GA 2Q8RE 1KDBA 1EIGA 1RIPA 2BH2A 3AB9A 4XQJA 3S14B 1H9KA 2LXKA 2XRQD 1XPRA 1EZ8A 4R8NA 3RZDB 2JN4A 5DM73 1HQRD 2AQ2B 4A3JH 4DUZL 1KNEA 3ND9A 4B3TL 4A3IG 1H9MA 5G3LD 2F4VQ 2RBMA 1SJHD 4RCNA 3BZCA 1VQGA 1PYWD 3CKIB 4DV0L 1N8RC 4LF9Q 1STEA 4JBKA 2BOSA 4IUTA 3PSIA 3M7GA 3CC4A 3JAMc 1SYGA 2Q8TA 1CZGA 5EKIA 3K7AH 3RN2A 2EZVA 1K83B 1XMOL 4AQYL 4FVMA 5EKKA 5C5LA 2PZWA 2B2VC 3HOZH 1ML0D 1Z6HA 5IT9c 4Y52H 3HFZB 3EQLC 1HZBA 1J6QA 3CCRA 1MKHA 1EY4A 4X3KA 4GN3B 2A19A 3FKIH 2IY5B 2WIIB 3BDCA 3D3RA 2N78A 5C4HA 1HR0W 1SR3A 4DN4M 4DV4L 1EYDA 1S5BD 4A3EH 2K7VA 2V1CC 1TWGB 3I72A 3BZDB 3Q24A 5EPKA 1NSNS 4X62Q 3OMCA 4ULLA 1PV4A 1I3QH 3WDNA 1HNXL 4KLKA 1N36Q 3OTOL 4IPHA 2NVYH 3CMAA 3PO3H 2EVBA 2YV5A 1K0RA 3I3CA 2RDHA 3ULPA 1HZCA 1G91A 2EY5A 1TS3A 2PMZB 2F0OA 1MI2A 4UP9A 2HCCA 1MGSA 2PNHA 3K5OA 5C44G 4JI8L 4N8FA 4GLAC 3BDLA 1MSHA 1ZKOA 1YNND 1TVXA 4R4OA 4LK1C 2JA7H 4A3CH 3KDFB 4LF6L 2VB3X 1WTXA 3KF6A 4DK1A 3HRZC 3CCJA 3S1NH 3TS0A 3TREA 4G57A 1LV9A 3MXNB 3DXJC 4C1NI 2Y0SB 4JV5Q 5IT9E 1VF7A 3A56A 4IPCA 2B63G 3HKSA 2MO1A 3GTGH 5IYBH 4DR3Q 3GP7A 4C3HH 1Q7YC 4CJ2C 2QW7A 3BS1A 2F1MA 2NWGA 1PTOB 3D6WA 4J6HA 2R92H 2F3IA 4N9TA 2NZOA 1OO9B 4AH6A 5IP9H 4L5SA 3S2HH 1QOHA 1PZJD 4K2LA 2GVBA 2AWNA 1UWVA 2WB1E 3EVQA 2PQEA 5D3DA 1PH1A 5IODA 3A55A 2B2WA 3GQBA 4DR5Q 4FF3A 1L0WA 3HOYG 1A3VA 3K6OA 4IUQA 1EY8A 3VYRA 3LWEA 2EYFA 4LF9L 2WKCA 2QEJC 4P74A 3GTKH 2KVMA 2DN8A 4BBSH 4P73A 1B44D 5E4WC 2UUAQ 2K75A 3G48A 1S5DD 3AMUA 2WKDA 3K81C 4KJNA 3QG1A 3FKIG 3TEHB 4C3IB 4Y7NH 2L4NA 3NBHB 1WTOA 3W5OA 4KD4A 1YJ9A 3FRPB 2R93B 1V1QA 1S4ZA 4OX9Q 3GTMB 4A3EG 1D5MC 2XSCA 4YWLA 1G6ZA 2RSNA 3E6ZX 2R7DA 3T1HQ 1MD2D 1R9TB 3DUZA 5D65A 4AYBE 1DZ1A 1AZQA 1GUOA 2E5LL 1JJ2A 4B9XA 4RFBA 3PO3G 2KHIA 1XTCD 2E2IH 2KCNA 1VQ5A 5EGTA 4X62L 2EJMA 1EY7A 1N36L 4QF4A 1A62A 4DK6C 4GOPB 1IL2A 4LUZA 1EIHA 2Q8IB 2SOBA 1TY0A 1JJCB 1RKNA 3UDGA 3A74A 1ET6A 3PUXA 1SNMA 2R7ZG 2O5JC 1JWSD 1I4RA 3CC2A 3ONAB 3KJOA 4KHPL 1F2MA 3CPFA 4A93H 3TBIB 4QUCA 2VZAA 4RGOS 1Y8OB 4YWKA 4C3HG 3HOWH 4IO9A 1SRUA 4DV5Q 5M3MB 5F2DA 1YJWA 1SNDA 5E3FA 4BY7H 1JWUD 3DWPA 3OIPA 2EE1A 1YHQA 3E0JA 4JV5L 1OXVA 4JW0A 2LFNA 1MSGA 4DR3L 1WCMB 1QUQA 4G4KA 1EYGA 2YU9H 1EQVA 3FPPA 3HZXA 3KBGA 1ASZA 1KAWA 2HCIA 3HKZG 1JOOA 3BZKA 3GTJH 3TN2A 2O4XA 3SGIA 1AZPA 1A63A 5IYCG 1H95A 2IX1A 3HOUG 1TWAB 5ELNA 4DR4Q 5M3FB 5KNBA 2KCMA 4DR5L 3L3OC 1TS4A 1IKMA 4HSVA 4HJ8A 1X65A 2VW9A 2OXPA 3CCQA 1KC8C 2L11A 1WTVA 4K0KQ 1A8VA 2I46A 3Q6SA 2L15A 2UUAL 5CMDA 3K5NA 5FJ8H 2JA6B 3DEOA 1ONLA 3E9HA 1GKHA 2K33A 1B1ZA 4OX9L 4ZQ3A 1AE2A 5J3BA 1LT3D 3K0XA 3CXCA 3T1HL 5M5YB 5ELBA 2AQ3B 4C3JB 4X66Q 2MNAA 1PHJA 4CGYB 1EIFA 3MHBA 4A3MB 1Q8IA 4G7ZC 3S16B 2I07B 1II3A 4IOAA 3NP8A 2EYMA 1BCPC 4YCUA 1I4HA 3KOJA 3R93A 4N8X1 2EY2A 1HXYD 3CMEA 4K6LA 4UY8C 1PH8A 1A15A 2ES2A 3P75A 3HOXH 3PO2B 1K8MA 4ZKBB 3ZYYX 3QO2A 4HJ9A 2NTSA 3HOWG 3I2ZA 1F2LA 4NPSA 3Q22A 5JJZA 3T56B 3S14H 2Z1CA 1Q46A 2K6AA 5J22A 4JI1Q 2QILA 1CKMA 4DNIA 2B2VA 1O80A 1VQ8A 1CKOA 1JORA 3QOJA 3ULLA 4JC0A 3GV3A 1EQTA 1IKLA 4CDDC 2RSOA 1Y8NB 2FJ2A 4IUVA 3T1YQ 4WORA 1NMGA 3R3OA 4ODGA 3LGJA 5E7NA 1SE8A 4HJ5A 1VQMA 1EY6A 2ID0A 4LMQD 2KECA 5M5XB 3RN5A 2L55A 4GN4B 3L0OA 1AFPA 4ZK9B 3MAQA 1XYIA 1X9NA 4XQNA 1OXSC 3D6CA 4DFAA 4DUYL 2ZTEA 4PZ7A 2F0TA 1TY2A 2XIWA 1K83H 5DNFA 1HNZQ 1ILPA 3LX0A 3I7FA 1EFWA 4LNQA 4JYAQ 1DCZA 4X65Q 4FDBA 5M5WB 4DR4L 1G2SA 3F2DA 1I6HB 1IW7D 3ERQA 1S3OA 5FJ8G 3HG9A 1UE7A 1PH2A 2F3VA 2JEBI 1CSQA 4X64Q 5L37A 4K0KL 3OWEB 4RG1A 2QA4A 1CKNB 1SMYD 2EYPA 4NKLA 2K5NA 2XRSD 3STBC 4DA2A 1EWHA 1TWGH 3GV6A 1QG7A 3HEJA 1FR3A 3JC66 5GADC 5LHY1 4QMGA 2N88A 5FO8B 3S1RB 1LLRD 2K52A 3PUWA 4DAYA 1I5FA 3KF8B 4JI3Q 2K28A 2JA8B 2Q2HA 4Q5VA 2E2DC 4V0BA 4X66L 4YCVA 1B70B 3K0YA 3Q0AA 1F2YA 4L5TA 1SE2A 2MGSA 3M4OB 3I4OA 4KI0A 3DEPA 1BQQT 2F0IA 2X69A 3CRLC 1RD9D 4RHSA 4ZYSA 5GAEC 2F0UA 2Z6KC 2IW3A 3I70A 3A5UA 2DJFC 1DOKA 3PUYA 3UDFA 2MPMA 1SN8A 4LW1A 3SXHA 5CV6A 2E2HB 5IE8A 4PMCA 1PXUA 4A3LH 1JJGA 3S1MB 1GXDC 1H9JA 1X3FA 4ZCKA 1C8CA 1PTOH 1GHKA 3I4NB 3IFDA 2IWHA 3WWVA 2A6HC 4JI1L 2Z9HA 1NUCA 3CRKC 4HN7A 4RGMA 3GTPB 3J7ZC 4M1UB 2OTLA 2LS01 4C1NK 5A2QL 1TS2A 2XWJB 3T1YL 4F8MA 1H9SA 3GTQB 1P8LA 1ILQA 1WTPA 1PRTC 5C0XI 1F77A 5BN3A 3NQTA 1QNUA 4K8JA 1ENFA 2HIVA 2JQOA 3MC0B 4LUOA 2AKWB 4NB3A 3M3YB 4FO2A 4K14A 1GUWA 1V9PA 3AFPA 1A3UA 5IGGA 4A3BH 2ZTDA 5I6YA 1IBKQ 4C3IH 3H6MA 1LTSD 4JI5L 3A54A 2B2UC 4DUZQ 3HKZE 1V1PB 1CUKA 4RMFA 4IFDI 4QCLA 3K80C 2R93H 1K8OA 4JYAL 1KABA 3GTMH 1O78A 4TVAB 2CQOA 4DNRB 1K9MC 3J81c 4UAIA 1R9TH 1A6XA 4JVZA 1S5FD 1W6JA 4X64L 2EJFC 4RGTA 2A5HA 3A5ZB 3I55A 3UDXA 1Y1VB 5EPJA 3T16A 4MNOA 1EL0A 2F4IA 1XMOQ 1UAPA 4JI3L 1OTCA 1RCVD 3X3NA 4UHVA 2ZJPA 5C0XH 2D2CC 3I4MG 3A7AB 4KN7C 4ZUIA 2KEDA 4OO1G 5K36G 4B08A 1ZEQX 2VXWA 3DMUA 1ET9A 3D31A 2WINB 2FFKB 4DV4Q 1EIYB 3GD7A 1B9NA 4A76A 2DJGC 4FYDA 3CU7A 1GO3E 5KYIA 2NZ1D 5AJ3Q 4IFDH 4R8IA 2IX0A 4A4IA 1FGBD 2F0SA 2HT1A 3SK5A 1WCMH 3J81E 1LTBD 1HFNA 2G5DA 3CCVA 2ZXRA 1SYBA 4PV1C 4JI7Q 5NUCA 1ICWA 4A3KB 4BY1B 2SNMA 5ELCA 3RD4A 3MVVA 1TWAH 1IBML 3J80L 2NVQB 5CV7A 4LF6Q 5M3FH 1KD1C 5EBCA 4A3BG 2WAQB 3G6JB 2MJ8A 2ASBA 4JCVE 2KCTA 1Q81C 1RODA 4C3IG 1NNXA 1BCPF 1S40A 3MXUA 3E9IA 2R93G 5JEAH 1SYCA 1FL0A 1E2WA 4FF4A 1I50B 2MUYA 4DV2Q 1SYEA 2YTYA 2KUMA 2J7ZA 4DAVA 2ZT9C 4GNXC 2VUMG 5GAHC 1K28A 1IBKL 3HOVB 1EZ6A 4DK0A 2PCFB 2JA6H 3S17B 5CYUA 3SR1A 3GTOB 3E3XA 1D7QA 4RKBA 3W3AA 1X6OA 1KXLA 1ENCA 2VQFQ 1JE4A 1L1OC 5M5YH 1U4LA 4HR7B 2KA7A 5IP7G 2AHOB 1VQ4A 4A3MH 3S16H 1HNWL 1M8AA 3H91A 3C46A 1EUJA 1LACA 3VA5A 1RHPA 3NEMA 3P1HA 3S1QB 3S2DB 2AUKA 4GLXA 3SDZA 2JA9A 3B6YA 1SMXA 1CM9A 4HIKA 3PO2H 1VF5C 4MIUA 1VS0A 3A8JE 2M9VA 2E74C 1WTHA 1IL8A 4IUUA 4H7BA 4R4QA 3V05A 4IFDG 4PNYA 3LNNA 1I6VC 1SNPA 4DAPA 2E5LQ 1RTNA 4C2MH 2NN6I 1TWHB 3N6RA 4R1JA 4IUNA 5EBDA 5JAVA 3QJYA 3NQIA 1BO0A 1I4GA 3T13A 1XX8A 2E2JB 4ZAIA 4KTAA 5FLMH 3CCUA 5AJ3L 3FMCA 4JBMA 1AEXA 2F0JA 1WJJA 1GUGA 3T51B 3H0GB 3PF5A 1Q1EA 2RA4A 4ZRZA 1HA5A 4KHZA 5M3FG 1Y69U 2QCPX 1RL2A 4JI7L 4KHPQ 2JE6I 3H3VI 1Q90A 4IALA 1E2ZA 2TSSA 2FHTA 5EAYA 2PQAA 5M5WH 1Q86C 2HHHQ 1I6HH 3NSWA 3EJIA 2IHFA 2OF1A 3W2DA 1JC7A 4A3JG 3VR6A 4RH6A 1VQHA 1CQFA 1B3QA 4DV2L 1T5EA 3NPPA 3VA7A 4A3GB 4WJ3M 2F0WA 1LT4D 4XYOA 2NN6H 3S1RH 2Z6KA 1KAAA 2MO0A 1BUVT 2NUCA 2VQFL 1HPCA 2JA8H 4RCOA 5KNCA 1TWFB 4PQXA 3JAML 2A68C 3IRBA 3HOZG 4DXFA 3M4OH 5J39A 5C5MA 3PO2G 2VL6A 4G7HC 1PRTF 4OGQC 5CV8A 4QB4A 2NB0A 4B3ML 1GHJA 2RDFA 1PH7A 2BDNA 3VYSA 4ID6A 1WOCA 5IT9L 4X3SA 4XXEA 3E5SA 1G291 2KEEA 1BBWA 5I2XA 2PMZE 1BXTA 3H3VH 2IJ0A 2A74C 2N8NA 2ZJRA 3UE1A 1VQOA 5C4ZA 2E2HH 1WFQA 2EYJA 4F87A 3H15A 4HEDA 3S1MH 1PZID 3H09A 3PIPA 3I4NH 3I73A 1DJRD 5I9PA 1F9QA 3WOEA 1OXXK 3FEWX 2I5HA 1K3BC 1ZYRC 1LTTD 1R4QB 1V8QA 2QGQA 3IL8A 2B2UA 2Y0SE 4XT3B 3GTPH 3KK7A 3KF6B 3CQZB 3PF4A 2WACA 5ELOA 1F9RA 1SAPA 1X3PA 2X6LA 2ICEC 1QZGA 4V190 1BOSA 1KLGD 4HMJA 3U4VA 3BVZA 2JA7G 1TS5A 4A3CG 1W2BA 1BCPD 5BN5A 4TRDA 1STAA 4A3IB 5E1FA 3M3YH 4QJFA 4JBJA 1XNQQ 1E2VA 1HR0Q 4X6AH 1A0IA 1YI2A 1HZ9A 4LJZC 4TQUS 2YYZA 1NR2A 3MTSA 1Z7TA 4QIWE 4B9WA 5IYBG 4DR2Q 1KRTA 2HHHL 1AN8A 4HJ7A 2R92G 4CBVA 2LSSA 5H1SE 1B3AA 4BS9A 4PMBA 2NN6G 2F0EA 5DLQE 3U9SA 5IY0A 5IP9G 4B3SQ 1BBUA 3EBEA 2PW5A 1DGSA 1Y1VH 3FP9A 3QB3A 1FJGQ 4J1MA 3OOCA 3WOFA 1QILA 3BG3A 1FD7D 2OTJA 2PI2E 4DUYQ 3FDTA 1KHIA 1VQNA 2F0MA 1YNXA 4RWSC 3ULJA 3HGBA 4NDXA 4RAUC 1EWIA 1FNWA 4ME5A 1KL9A 3EFXD 4BBSG 5FOBB 2L5TA 1X3QA 1E7ZA 3EN2A 1ICFB 2EOTA 4P72A 1NR4A 2EJGC 3MFYA 1SNQA 2FMMA 2BDOA 4IPDA 4OXPA 2Q2IA 3M4YA 1KRSA 1KLUD 4FF2A 2K5DA 2N55A 1A2UA 3KLWA 2TMPA 1LYLA 1C9OA 3CC7A 4WRDA 4DPGA 1UE5A 2A69C 2K1BA 1VQIA 1NY4A 4ABNA 4A3DB 4POGA 2L9HA 1STYA 4FXKC 4LFBL 3QIAA 1QZHA 2K5HA 4KMUC 5HURA 3OSOA 2PZUA 3STBD 1PFBA 1IXRA 3V2TA 5KNDA 4GNXA 3AEVA 1LTLA 4OWXB 1EEID 4EQPA 5T1GA 4LF4Q 3J81i 2SNSA 4A3KH 4BY1H 3CPWA 2L12A 2Z0SA 1CA5A 3IAYA 1Y1WH 1D8LA 2NVQH 2B63B 1L1OA 2KHSA 1HJPA 3UDIA 1X56A 4LF7Q 4A3FH 1C0AA 2L0CA 4A93G 3SK8A 1QUQB 1KIXA 4XDXA 5JPMC 1CHQD 1I50H 2N49A 3OPOA 4R4TA 2JJQA 1N33Q 1LTGD 1HQMC 1XNQL 4BY7G 1HR0L 2HQEA 3K57A 3RZDH 2NBFA 1QVFA 3HOVH 1U4MA 3S17H 5ELFA 3SVMA 4JBWA 2EYLA 2KOLA 1BR9A 3HOYB 3GTOH 1D1IA 2EYOA 2HDMA 4DR2L 1KDCA 3J7AF 4NP5A 2PPBC 1K8GA 2K01A 3P7JA 4XIGS 2ALYB 2A6HD 3N52A 2WFWA 4B3SL 4IURA 1WD1A 4XT1B 3RUZA 3J7A5 1FJGL 1WTWA 3MXPA 1EEFD 4A3EB 1JT8A 1VQDA 1PYSB 1PH9A 1MJEA 1PRTD 4UP7A 1STNA 3S2DH 3S1QH 4LF5L 3L7ZC 1CHPD 5FO7B 1TXYA 4JI5Q 1H9RA 1PTOC 2KQ3A 1RTOA 4KHVA 3C3LA 2LXJA 3T4AC 2XGTA 4RGNA 4DAMA 1HRJA 3EROA 4B3RL 5IYDH 1RDPD 4PZ8A 1M90C 1J9OA 5CBEE 1IZ6A 1NJIC 1NAPA 4DR6L 1KQSA 4G7OC 2E2JH 1PDQA 4Z9CB 4LFCQ 1YZ6A 4LFBQ 1TT2A 3G71A 2QDBA 1VQ6A 4LFAQ 2A8VA 1SFOB 3OW2A 2OQ0A 2R7ZB 4OIKA 2CW0C 4BA2I 1QVGA 5C4XB 1OXUA 1Y1WG 1AH9A 2F0HA 2RF4A 4CJ0B 4LF8Q 4MTKA 2WAQG 4JI6Q 1SXTA 2M2LA 1RJTA 1UNSA 4A3FG 1AP0A 3HOXG 3NTIA 2D0PA 5G3LF 5C4JB 4LF4L 2B2YC 4AIMA 3D0FA 2R6GA 4RA8A 1E24A 1SROA 4NXML 1QCBD 3AU7A 3TP7A 5C3EB 5KIXA 1MHWC 4F88A 1HUNA 1V1PA 1IHZA 2DGYA 5D14A 4LF7L 1G6PA 2BE5C 3RLFA 3X3MA 4DF7A 4X3UA 4DV6Q 2K05A 4HAEA 3NHHA 5A2QE 3NE5B 2RCFA 3DHQA 1N33L 4A3GH 2F0LA 3HOUB 3KUPA 1YHAA 3TQYA 1LM0A 3DWQA 5I4DA 2RCNA 1HUMA 5D3IB 3F8TA 2A6EC 1X3EA 3NBIA 5ISRA 4Y7NB 3L2PA 1YVCA 5LMNW 4IFDJ 4GN5A 1CZWA 2IX3A 4K5VA 1IBMQ 4GKKQ 2YTVA 1N32Q 1B7YB 1STGA 3GTLB 3KBXA 3D4WA 1EFID 1S5ED 1TWFH 3RZOB 3VR3A 1G8ZD 5IIFA 1HFGA 3CD6A 1DXMA 3BVGA 3CW2C 2K14A 1GOZA 3HP3A 4N9PA 5FLXc 4YHHQ 4JI2Q 3DM3A 4IUPA 2AWOA 5HGQA 1E22A 1BBXC 4DAYB 5K5PA 3F2UA 3RR5A 3SE0A 2K5VA 4R9WA 2FINB 4BXXH 5BR8Q 1SE4A 3VYTA 4RHRA 1STBA 2E8GA 2P5ZX 1WTQA 4DXGA 4JPBW 4K6DA 1STHA 1TWCB 2JK8A 5KYLA 1HNWQ 4NW2A 1WTRA 1VQJA 1IYVA 3I90A 1D1KA 2EXDA 3NENA 3TZDA 4J8QA 3S15B 3CCEA 2O5IC 3Q8DA 4LFCL 2WP8J 4L63B 3W1BA 1VMPA 3D4DA 1UEAB 3BDOA 4OHJA 3ER0A 4KKUA 1VQPA 5TSSA 3QR8A 3GO5A 5DAUA 1EY9A 5IGFA 2B2TC 4Q0FA 4LFAL 2GN5A 4ZLTF 2RHQB 1YNJC 4J15A 3RNUA 2AQ1B 4LF8L 4A3IH 1E1TA 4JI6L 4H13C 3MWYW 2JA5B 3OIQA 2QDLA 5CGKA 2Y0SG 2IL8A 1SYFA 4BBRB 4A3LG 1H9SB 5FLXE 4FXDA 1E0BA 1M1KC 4L8JA 5M3MH 1B9MA 4IQZA 1DONA 4HMIA 1EOVA 3RLNA 4DV6L 3OMGA 1Q82C 5HY6A 1PYBA 3J80E 4U68A 2RHSB 1VQLA 4L6TB 4RKLA 3CCLA 1E3PA 4OWWB 3CF5A 4GZYC 3K5MA 4C56C 1U9RA 1WI5A 3TRZA 2I0QA 3GDEA 1YIJA 3FPUB 1CFMA 1U0LA 5GROA 2H4OA 4EQOA 3TSSA 4GKKL 3M9BA 2RQXA 1N32L 1HTLD 4S3SA 1ENAA 3NWTA 3R8BA 3A0JA 5EJWA 4EGVA 1VQ7A 4E6IA 1GUSA 2C9OA 3PCOB 1HA6A 2JEAI 4K8IA 4POFA 1BKBA 4KY6A 1LABA 2Q2TA 4YHHL 3M7NA 2F0PA 4JI2L 2NVTB 1X3GA 2E76C 2UU9L 1EQRA 2MQHA 2EY6A 4A75A 4A3DH 4PG3A 3J81L 3IKJA 5C3XA 1XXGA 2V4DA 3I91A 5BR8L 1K8AC 2FXQA 3AFQA 3M85A 2AMCB 3IFTA 5HGTA 4C3JH 1XJVA 2F0VA 1Q12A 4KY7A 2OCEA 3I8ZA 5E4XA 5CC4A 4HCEA 1TR5A 2A1AA 4XTCS 1NE3A 1NMFA 2PNRC 1SJED 4B3MQ 4K2KA 5C0XG 1WYDA 4GKJQ 2I5MX 2B63H 1JB7A 2HUGA 1J8IA 5DM63 2A68D 3BYTB 1JWMD 3KDFA 2OWOA 4LAAA 4QUFA 5EPLA 1J5EQ 2R61A 2GVAA 5EKLA 4O1NA 4UDUC 1PTOF 3MXNA 5M3MG 1KTKA 3P20A 3ZJYC 2WAQE 2SEBD 3MZ5A 4QGUA 4WFN3 1R4PB 3HOYH 1QJOA 1I94Q 1XWEA 1WCMG 2LY7A 1Y8PB 2O2LD 3OWFA 2EQSA 4P75A 2EY1A 4HIOA 1VQAA 3PQIA 3J7YW 2UXCQ 4JK1C 4KK7A 4DR1Q 3MFGA 1ZYRD 1D6EC 2Z8LA 4YWMA 5M5XH 1BCPB 2OQKA 4DKAC 1S5CD 2K04A 1EU4A 3H3VC 1U5KA 5COYA 2KCCA 3L9AX 1PH4A 1D2BA 3SK4A 1P16A 1FNVA 4WJWA 1SNCA 2WB1B 1QVCA 5LMUQ 1PH3A 2QKIC 1F9PA 5AFWA 5JEAG 3MXGA 2F0FA 1MIUA 2OT2A 4DGZA 2ZXOA 1XTDA 3NBHA 3TP5A 2JA6G 4A3DG 2UXBQ 3SK6A 5IGCA 1VQ9A 3K7UC 1SSOA 5FO9B 4HCSA 1SE3A 2GA4B 2PI2A 2B2YA 3G7LA 1B50A 3CHBD 4JI0Q 1C48A 5IGBA 1O7ZA 4C3JG 1BVSA 2CH4W 3JAME 4KJOA 2NVXB 4MHEA 1A2TA 2DNCA 2BCOA 4GLVB 5LMNL 2SDFA 2JYOA 3I4MB 4CKCA 2C5CA 4DV3Q 4AYBB 3CAMA 4A3MG 1EQQA 2CWAA 1SFOH
chains in the Genus database with same CATH topology
4ZKCB 1F9SA 1JOQA 2LKVA 4FNFA 2WV6D 1O7YA 3MA2B 1CA6A 3KLSA 5C3WA 5C6AA 4EQNA 4ZUJA 2VNUD 4IN3A 3SEBA 3PUVA 3VR4A 1EOTA 3C1FA 3PMFA 1BNZA 1AW7A 2JXMB 1V43A 4QIWB 1NCVA 2OEOA 2A69D 1V1OA 3LWUA 1GUTA 3SHLA 5DEHA 2F0GA 4A3BB 4CKBA 1SBBB 1ESFA 3K5LA 1GJXA 5CV5A 1BDOA 5JOBA 5FKAC 2VUMB 1L0XB 4EVOA 5CBAE 3K58A 4I7ZC 3FVQA 1T5XD 1CT1D 2K32A 3DM1A 1WVLA 1TKWB 2B2TA 2IT1A 5I9OA 5JVG3 4KV6A 2F3WA 1YNNC 1Z47A 1IYUA 5EQ0A 1B2TA 3H94A 1CK1A 2HDLA 4BWGB 2EDGA 4F7XA 3BYYB 3NUCA 4I65A 1PRTB 1EY5A 3I4LA 1FNUA 4H0LC 3EA6A 2B39A 5CV9A 5T1IA 1B53A 5KGUA 1M4VA 3C1EA 1W6KA 2F0NA 1GUNA 1PTOD 1OXTA 1QE6A 2L1BA 1JB3A 2F0QA 1QWYA 3D4RA 3NXWA 2MP1A 1VMCA 1F2ZA 4P2CB 2IPKD 3KLRA 3T53B 5BN4A 1EU3A 4TKOB 5C44B 2F0KA 1BF4A 3OHXC 2ICIA 2FMCA 3A8IE 2PYKA 4XYQA 2B8GA 2CW0D 4A3JB 2G9HD 5A35A 3TDQA 5ELDA 2EPBA 3TZUA 4X3TA 2Z4HA 1PZKD 2PZTA 2XVSA 2MHVA 1X32A 3U9OA 3J7AV 2BE5D 1VDZA 3K7AB 3UI2A 3VYUA 5KEEA 3HOZB 4U673 3OW7A 5JVH3 1Q3LA 2BA0A 3KF8A 5CORA 1EY0A 4XQQA 3O13A 1QNKA 2A6ED 2D5DA 2J0TD 3TP6A 2A73B 3FKIB 1WD0A 4C2MB 3HS0C 5ELEA 5I2YA 2EXZA 3TP8A 2F03A 3QOLA 5M9OA 2QF7A 2DNEA 5IGEA 1I3QB 1UUPA 3A7LA 2NTTA 2NVYB 1LTID 2AUJD 5LL6S 3PO3B 3NK9A 1DM0B 1KNAA 1SYDA 1CQVA 4CJ1B 3ND8A 1O7LA 5LL6X 4MN3A 3NTHA 4OO1I 2EYHA 2JA7B 4OL7A 2RKSA 2VB2X 2PO4A 1PFNA 3S1NB 3PIP3 1I4XA 1QB5D 4DU9A 1VCIA 1Q1BA 2ZXPA 4HSPA 2XN9C 1U4RA 1LTRD 3GTGB 3PV0A 1LT5D 4C3HB 4KKSA 1CI3M 3K59A 2R92B 3ITPA 2LMCB 4K5XA 3NWSA 5CR3A 3S2HB 1EYCA 1YNJD 1ZXTA 2XNAC 2PW7A 2CQAA 5C0XJ 3DWAA 5KRUA 2K5WA 4KD3A 1LT6D 1LO5D 3GTKB 3HKZB 4KN4C 4BBSB 2B8FA 4O42A 2ENBA 5IGDA 2NYZD 1I4PA 5I6WA 4KKTA 3VR5A 4YIJA 4OO1H 5FK9C 5K36H 2RDGA 1HCZA 3BVMA 1U4PA 2J4XA 1C4QA 4FXGC 1KDAA 2B2WC 3D8GA 2D9UA 2KJXA 1SEBD 3QWNA 3R2IA 3RMHA 1I4QA 2DY8A 2E2IB 1HHVA 4FF1A 1PLFA 1JQYD 1JICA 5JPNC 5JEAJ 3NTKA 3S9WA 3TMEA 1SDFA 3PIO3 2K5QA 1IW7C 4KY5A 1LTAD 1DOLA 1G2TA 1ESRA 4H44C 3C2PA 4IZ8A 1TQOA 4A93B 4NMZA 4DNTB 3VR2A 1B4OA 1DYQA 1SMYC 2F0DA 3HOWB 1SNOA 1A3TA 4BY7B 4FP5D 1PMRA 2BA1A 3Q23A 1DOMA 2CHBD 4ILWA 5CV4A 4TSSA 1EYAA 2YU9B 2XWBB 2JSOA 4BA1I 1JCKB 3GTJB 3MEHA 1FYCA 2K03A 1DD2A 2Z4IA 5IOCA 1TU2B 4PMWA 2G9DA 4OIJA 4HTHA 2JP1A 2DY7A 2RVLA 1RF2D 3V96A 1MBYA 4K5WA 3KLSX 3PUZA 5FLXL 1PFMA 3URYA 2H1EA 3R2TA 1D5XC 2CVRA 2D62A 1HTPA 1L0YB 2M00A 4CHTB 4M8AA 1D5ZC 2E75C 1Y1WB 3A8KE 1JR0D 1EWCA 4CKEA 1CTMA 4A3FB 5J1ZA 1JOKA 2R3ZA 3HOXB 1TIID 2X6GA 2Q8RE 1KDBA 1EIGA 3AB9A 4XQJA 3S14B 1H9KA 2XRQD 1EZ8A 4R8NA 3RZDB 5DM73 1HQRD 2AQ2B 1KNEA 3ND9A 1H9MA 5G3LD 2RBMA 1SJHD 4RCNA 1PYWD 3CKIB 1STEA 2BOSA 4IUTA 3M7GA 1SYGA 2Q8TA 1CZGA 5EKIA 2EZVA 1K83B 4FVMA 5EKKA 5C5LA 2PZWA 2B2VC 1ML0D 1Z6HA 3EQLC 1EY4A 4X3KA 2WIIB 3BDCA 3D3RA 5C4HA 4DN4M 1EYDA 1S5BD 2K7VA 1TWGB 3I72A 3BZDB 3Q24A 5EPKA 1NSNS 3OMCA 4ULLA 3WDNA 2EVBA 3I3CA 2RDHA 1G91A 2EY5A 1TS3A 2PMZB 2F0OA 1MI2A 2HCCA 1MGSA 3K5OA 3BDLA 1MSHA 1ZKOA 1YNND 1TVXA 4LK1C 2VB3X 1WTXA 4DK1A 3HRZC 4G57A 1LV9A 3DXJC 4C1NI 2Y0SB 5IT9E 1VF7A 3A56A 3GP7A 4CJ2C 3BS1A 2F1MA 2NWGA 1PTOB 3D6WA 4J6HA 4N9TA 1OO9B 1QOHA 1PZJD 4K2LA 2AWNA 3EVQA 2PQEA 5D3DA 5IODA 3A55A 2B2WA 3GQBA 4FF3A 1A3VA 3K6OA 4IUQA 1EY8A 3VYRA 3LWEA 2EYFA 2WKCA 2QEJC 2KVMA 2DN8A 1B44D 5E4WC 3AMUA 1S5DD 2WKDA 4KJNA 3QG1A 4C3IB 2L4NA 1WTOA 4KD4A 3FRPB 2R93B 1S4ZA 3GTMB 1D5MC 2XSCA 1G6ZA 2RSNA 3E6ZX 1MD2D 1R9TB 3DUZA 5D65A 1DZ1A 1AZQA 1GUOA 4B9XA 4RFBA 1XTCD 2KCNA 5EGTA 2EJMA 1EY7A 4QF4A 1EIHA 2Q8IB 2SOBA 1TY0A 1RKNA 3PUXA 1ET6A 1SNMA 2O5JC 1JWSD 1I4RA 3ONAB 1F2MA 3TBIB 4QUCA 4RGOS 1Y8OB 4C3HG 5M3MB 5F2DA 1SNDA 5E3FA 1JWUD 3DWPA 3OIPA 2EE1A 3E0JA 1OXVA 2LFNA 1MSGA 1WCMB 4G4KA 1EQVA 3FPPA 3HZXA 3KBGA 2HCIA 1JOOA 1AZPA 3TN2A 2O4XA 2IX1A 1TWAB 5M3FB 5KNBA 3L3OC 1TS4A 1IKMA 4HSVA 2OXPA 2L11A 1WTVA 2I46A 3Q6SA 5CMDA 3K5NA 2JA6B 3DEOA 1ONLA 2K33A 1B1ZA 4ZQ3A 1LT3D 5M5YB 5ELBA 2AQ3B 4C3JB 4CGYB 3MHBA 4A3MB 1Q8IA 4G7ZC 3S16B 2I07B 1II3A 3NP8A 2EYMA 1BCPC 1I4HA 3R93A 2EY2A 1HXYD 4K6LA 1A15A 3P75A 3PO2B 1K8MA 4ZKBB 3ZYYX 3QO2A 2NTSA 1F2LA 3Q22A 5JJZA 3T56B 2Z1CA 2K6AA 5J22A 2QILA 2B2VA 1O80A 1JORA 3QOJA 3GV3A 1EQTA 1IKLA 2RSOA 1Y8NB 2FJ2A 4IUVA 4WORA 3R3OA 4ODGA 1EY6A 2ID0A 4LMQD 2KECA 5M5XB 2L55A 1AFPA 4ZK9B 3MAQA 1XYIA 4XQNA 1OXSC 3D6CA 4DFAA 2F0TA 1TY2A 2XIWA 5DNFA 1ILPA 3LX0A 1DCZA 5M5WB 1G2SA 1I6HB 1IW7D 3ERQA 3HG9A 2F3VA 2JEBI 3OWEB 1SMYD 2EYPA 4NKLA 2XRSD 4DA2A 1EWHA 3GV6A 1QG7A 3HEJA 1FR3A 5LHY1 4QMGA 2N88A 5FO8B 3S1RB 1LLRD 3PUWA 4DAYA 2K28A 2JA8B 4Q5VA 2E2DC 4V0BA 3K0YA 3Q0AA 1F2YA 1SE2A 2MGSA 3M4OB 4KI0A 3DEPA 1BQQT 2F0IA 2X69A 3CRLC 1RD9D 4RHSA 4ZYSA 2F0UA 3I70A 2IW3A 1DOKA 3PUYA 2MPMA 3SXHA 5CV6A 2E2HB 4PMCA 1PXUA 3S1MB 1GXDC 1H9JA 1C8CA 1PTOH 1GHKA 3I4NB 3IFDA 2IWHA 2A6HC 1NUCA 3CRKC 4HN7A 4RGMA 3GTPB 4M1UB 2LS01 4C1NK 5A2QL 1TS2A 2XWJB 4F8MA 1H9SA 3GTQB 1ILQA 1WTPA 1PRTC 5C0XI 1F77A 5BN3A 3NQTA 1QNUA 4K8JA 1ENFA 3MC0B 3M3YB 4FO2A 4K14A 1GUWA 1A3UA 5IGGA 5I6YA 3H6MA 1LTSD 3A54A 2B2UC 4IFDI 1V1PB 4QCLA 1K8OA 1KABA 1O78A 4DNRB 4UAIA 1A6XA 1S5FD 1W6JA 2EJFC 4RGTA 2A5HA 1Y1VB 5EPJA 3T16A 1EL0A 2F4IA 1UAPA 1RCVD 3X3NA 5C0XH 2D2CC 3A7AB 4KN7C 4ZUIA 2KEDA 4OO1G 5K36G 4B08A 1ZEQX 2VXWA 3DMUA 1ET9A 3D31A 2WINB 2FFKB 3GD7A 1B9NA 4FYDA 3CU7A 5KYIA 2NZ1D 4IFDH 4R8IA 2IX0A 1FGBD 2F0SA 3SK5A 3J81E 1LTBD 1HFNA 2ZXRA 1SYBA 4PV1C 5NUCA 1ICWA 4A3KB 4BY1B 2SNMA 5ELCA 3RD4A 3MVVA 3J80L 2NVQB 5CV7A 5EBCA 2WAQB 3G6JB 2MJ8A 1RODA 4C3IG 1BCPF 3MXUA 5JEAH 1SYCA 4FF4A 1E2WA 1I50B 2MUYA 1SYEA 2KUMA 2J7ZA 4DAVA 2ZT9C 3HOVB 1EZ6A 4DK0A 2PCFB 3S17B 5CYUA 3SR1A 3GTOB 4RKBA 3W3AA 1ENCA 1JE4A 1U4LA 4HR7B 2KA7A 1M8AA 3H91A 3C46A 1LACA 3VA5A 1RHPA 3P1HA 3S1QB 3S2DB 2AUKA 3SDZA 1CM9A 1VF5C 4MIUA 3A8JE 2M9VA 2E74C 1IL8A 4IUUA 4H7BA 3V05A 4IFDG 4PNYA 3LNNA 1I6VC 1SNPA 4DAPA 1RTNA 2NN6I 1TWHB 3N6RA 4IUNA 5EBDA 5JAVA 3QJYA 3NQIA 1BO0A 1I4GA 3T13A 1XX8A 2E2JB 4ZAIA 4KTAA 3FMCA 1AEXA 2F0JA 1GUGA 3T51B 3H0GB 1Q1EA 2RA4A 4ZRZA 1HA5A 4KHZA 1Y69U 2QCPX 2JE6I 1Q90A 4IALA 1E2ZA 2TSSA 2FHTA 3NSWA 3EJIA 2OF1A 3W2DA 1JC7A 3VR6A 4RH6A 1CQFA 1T5EA 3NPPA 3VA7A 4A3GB 2F0WA 1LT4D 4XYOA 2NN6H 1KAAA 1BUVT 2NUCA 1HPCA 4RCOA 5KNCA 1TWFB 4PQXA 3JAML 2A68C 4DXFA 5J39A 5C5MA 4G7HC 1PRTF 4OGQC 5CV8A 4QB4A 2NB0A 1GHJA 2RDFA 2BDNA 3VYSA 4ID6A 5IT9L 4X3SA 4XXEA 3E5SA 1G291 2KEEA 5I2XA 1BXTA 2IJ0A 2A74C 5C4ZA 2EYJA 4F87A 4HEDA 1PZID 3H09A 3I73A 1DJRD 5I9PA 1F9QA 3WOEA 1OXXK 3FEWX 1ZYRC 1LTTD 1R4QB 1V8QA 3IL8A 2B2UA 4XT3B 3KK7A 3CQZB 2WACA 1F9RA 1SAPA 1X3PA 2X6LA 2ICEC 4V190 1BOSA 1KLGD 4HMJA 3BVZA 1TS5A 5BN5A 1BCPD 4TRDA 1STAA 4A3IB 5E1FA 1E2VA 4LJZC 4TQUS 2YYZA 1NR2A 3MTSA 1Z7TA 4B9WA 1AN8A 4CBVA 1B3AA 4BS9A 4PMBA 2NN6G 2F0EA 3U9SA 2PW5A 3QB3A 4J1MA 3OOCA 3WOFA 1QILA 3BG3A 1FD7D 3FDTA 2F0MA 4RWSC 3HGBA 4NDXA 4RAUC 1FNWA 4ME5A 3EFXD 5FOBB 2L5TA 1X3QA 2EOTA 1NR4A 2EJGC 3MFYA 1SNQA 2FMMA 2BDOA 3M4YA 1KLUD 4FF2A 2K5DA 2N55A 1A2UA 2TMPA 4WRDA 2A69C 2K1BA 4A3DB 4ABNA 2L9HA 1STYA 4FXKC 3QIAA 4KMUC 5HURA 3OSOA 2PZUA 1PFBA 3V2TA 5KNDA 1EEID 4EQPA 5T1GA 2SNSA 2L12A 1CA5A 3IAYA 2B63B 2KHSA 2L0CA 3SK8A 4XDXA 5JPMC 1CHQD 3OPOA 1LTGD 1HQMC 2HQEA 3K57A 2NBFA 1U4MA 5ELFA 3SVMA 4JBWA 2EYLA 2KOLA 1BR9A 3HOYB 1D1IA 2EYOA 2HDMA 1KDCA 3J7AF 4NP5A 2PPBC 2K01A 3P7JA 4XIGS 2A6HD 3N52A 4IURA 1WD1A 4XT1B 3RUZA 1WTWA 3MXPA 1EEFD 4A3EB 1PRTD 1STNA 3L7ZC 1CHPD 5FO7B 1H9RA 1PTOC 2KQ3A 1RTOA 4KHVA 3C3LA 3T4AC 4RGNA 1HRJA 3EROA 1RDPD 1J9OA 5CBEE 1NAPA 4G7OC 1PDQA 4Z9CB 1TT2A 2QDBA 1SFOB 2R7ZB 4OIKA 2CW0C 4BA2I 5C4XB 1OXUA 2F0HA 4CJ0B 1SXTA 2M2LA 1RJTA 1UNSA 1AP0A 3NTIA 5G3LF 5C4JB 2B2YC 2R6GA 4RA8A 1QCBD 3AU7A 3TP7A 5C3EB 5KIXA 4F88A 1HUNA 1V1PA 1IHZA 5D14A 2BE5C 3RLFA 3X3MA 4DF7A 4X3UA 2K05A 4HAEA 3NHHA 5A2QE 3NE5B 3DHQA 2F0LA 3HOUB 3KUPA 3DWQA 5I4DA 1HUMA 5D3IB 2A6EC 3NBIA 5ISRA 4Y7NB 4IFDJ 1CZWA 2IX3A 4K5VA 3GTLB 1STGA 3KBXA 3D4WA 1EFID 1S5ED 3RZOB 3VR3A 1G8ZD 5IIFA 1HFGA 1DXMA 3BVGA 1GOZA 3HP3A 4N9PA 4IUPA 2AWOA 1BBXC 5K5PA 3F2UA 3SE0A 4R9WA 2FINB 1SE4A 3VYTA 4RHRA 1STBA 1WTQA 4DXGA 4K6DA 1STHA 1TWCB 5KYLA 4NW2A 1WTRA 1IYVA 3I90A 1D1KA 3TZDA 4J8QA 3S15B 2O5IC 4L63B 2WP8J 1VMPA 3BDOA 4OHJA 1UEAB 3D4DA 4KKUA 5TSSA 5DAUA 3GO5A 1EY9A 5IGFA 2B2TC 4Q0FA 4ZLTF 1YNJC 2AQ1B 4H13C 3MWYW 2JA5B 3OIQA 5CGKA 2IL8A 1SYFA 4BBRB 1H9SB 5FLXE 4FXDA 1E0BA 4L8JA 1B9MA 4IQZA 1DONA 4HMIA 3OMGA 3J80E 4U68A 4L6TB 4RKLA 4GZYC 3K5MA 4C56C 1U9RA 3FPUB 1CFMA 2H4OA 4EQOA 3TSSA 2RQXA 1HTLD 4S3SA 1ENAA 3NWTA 3R8BA 5EJWA 4EGVA 4E6IA 1GUSA 2C9OA 1HA6A 2JEAI 4K8IA 4KY6A 1LABA 3M7NA 2F0PA 2NVTB 2E76C 2EY6A 3J81L 3IKJA 5C3XA 1XXGA 2V4DA 3I91A 3M85A 3IFTA 5HGTA 2F0VA 1Q12A 4KY7A 3I8ZA 5E4XA 5CC4A 4HCEA 1TR5A 4XTCS 2PNRC 1SJED 4K2KA 5C0XG 2HUGA 1J8IA 5DM63 2A68D 3BYTB 1JWMD 4LAAA 4QUFA 5EPLA 2R61A 5EKLA 4O1NA 4UDUC 1PTOF 3MXNA 1KTKA 3P20A 2SEBD 3MZ5A 4WFN3 1R4PB 1QJOA 1XWEA 2LY7A 2O2LD 1Y8PB 3OWFA 2EY1A 3J7YW 4JK1C 4KK7A 3MFGA 1ZYRD 1D6EC 2Z8LA 1BCPB 1S5CD 2K04A 1EU4A 3H3VC 5COYA 2KCCA 3L9AX 1D2BA 3SK4A 1FNVA 4WJWA 1SNCA 2WB1B 2QKIC 1F9PA 5AFWA 5JEAG 3MXGA 2F0FA 2OT2A 4DGZA 2ZXOA 3NBHA 3TP5A 3SK6A 5IGCA 1SSOA 5FO9B 4HCSA 1SE3A 2GA4B 2B2YA 3G7LA 1B50A 3CHBD 1C48A 5IGBA 1O7ZA 4C3JG 3JAME 4KJOA 2NVXB 4MHEA 1A2TA 2DNCA 2BCOA 2SDFA 2JYOA 3I4MB 4CKCA 2C5CA 4AYBB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EY7 A;  5HGT A;  4K6D A;  1STH A;  4ZUI A;  2F0V A;  2EXZ A;  3TP8 A;  3DMU A;  4QF4 A;  2F0I A;  4KY7 A;  5KYL A;  1STY A;  1JOQ A;  5C4Z A;  2EY2 A;  4H7B A;  2LKV A;  5CV9 A;  2EYJ A;  3D8G A;  3QOL A;  5CC4 A;  4PNY A;  5M9O A;  1TT2 A;  5HUR A;  1TR5 A;  3P75 A;  3OSO A;  1SNP A;  2EY5 A;  2QDB A;  5IGE A;  2F0O A;  2SOB A;  2F0U A;  5KGU A;  2PZU A;  2M00 A;  3D4D A;  4IUN A;  1RKN A;  5I9P A;  4K2K A;  3C1E A;  5JAV A;  5KYI A;  1SNM A;  5DAU A;  5C3W A;  1EY9 A;  2F0N A;  3NK9 A;  1SYD A;  3SXH A;  3V2T A;  3BDL A;  5CV6 A;  5C6A A;  5IGF A;  1F2M A;  4PMC A;  2F0H A;  3T13 A;  4ZUJ A;  4EQN A;  4KTA A;  3TME A;  3S9W A;  4EQP A;  5J22 A;  5J1Z A;  1JOK A;  2WAC A;  2F0S A;  1AEX A;  2F0Q A;  2SNS A;  2F0J A;  4LAA A;  1JOR A;  3SK5 A;  3C1F A;  3PMF A;  3QOJ A;  4KY5 A;  1KDB A;  3NXW A;  4G57 A;  5F2D A;  1SND A;  5EKL A;  5E3F A;  1NUC A;  1F2Z A;  2EYH A;  2KHS A;  5CGK A;  4IZ8 A;  1TQO A;  4WOR A;  3R3O A;  4ODG A;  3TP7 A;  5KIX A;  1SYB A;  4HMJ A;  1EZ8 A;  4R8N A;  1SYF A;  4OL7 A;  4NMZ A;  5NUC A;  2OEO A;  4TRD A;  4F8M A;  1STA A;  2RKS A;  1EY6 A;  1IHZ A;  2F0D A;  3MZ5 A;  4J6H A;  5E1F A;  1SNO A;  3SK8 A;  2SNM A;  1A3T A;  3MVV A;  3SHL A;  4N9T A;  5DEH A;  2F0K A;  4DF7 A;  2F0G A;  2RBM A;  4DU9 A;  4HMI A;  1EQV A;  5CV7 A;  3OWF A;  3NHH A;  2EY1 A;  3HZX A;  4IAL A;  2PYK A;  3DHQ A;  4K2L A;  3OMG A;  3NQT A;  4K8J A;  2HQE A;  2F0L A;  3D6C A;  1JOO A;  4DFA A;  3EJI A;  2O4X A;  3EVQ A;  4B9W A;  2F0T A;  2OF1 A;  2EYL A;  2PQE A;  3ITP A;  1SYC A;  5CV5 A;  5IOD A;  5CV4 A;  4K14 A;  4K5X A;  3LX0 A;  4RKL A;  2EYO A;  1EYA A;  5CR3 A;  1A3V A;  1KDC A;  1SYE A;  1A3U A;  5IGG A;  1EY8 A;  4NP5 A;  5I6Y A;  4PMB A;  5JOB A;  2EYF A;  1EYC A;  3H6M A;  2F0E A;  1U9R A;  5ISR A;  4EVO A;  5EGT A;  1SYG A;  3SK4 A;  1SNC A;  1EZ6 A;  3ERQ A;  4K5V A;  2PW7 A;  2OXP A;  3MEH A;  1KAB A;  2F0W A;  1STG A;  2PW5 A;  4EQO A;  2PZT A;  5EKK A;  3D4W A;  5C5L A;  3QB3 A;  3RUZ A;  2F3V A;  3SR1 A;  2PZW A;  4J1M A;  5IOC A;  4RKB A;  4KJN A;  5KRU A;  4KD3 A;  2F0F A;  4S3S A;  1ENA A;  1KAA A;  1ENC A;  3U9O A;  4DGZ A;  5IIF A;  2F0M A;  3MXP A;  2EYP A;  4KD4 A;  4NKL A;  4E6I A;  5I9O A;  4NDX A;  2NUC A;  4HTH A;  4KV6 A;  4ME5 A;  3TP5 A;  5KEE A;  1STN A;  4N9P A;  1EY4 A;  2F3W A;  3HEJ A;  2ENB A;  4K8I A;  3SK6 A;  4QMG A;  4KY6 A;  4ZQ3 A;  5IGD A;  5IGC A;  3T16 A;  2KQ3 A;  3BDC A;  2F0P A;  5C4H A;  1SNQ A;  5I6W A;  5K5P A;  4YIJ A;  4KHV A;  3VA5 A;  5J39 A;  5C5M A;  2EY6 A;  1EYD A;  1EY0 A;  3P1H A;  5IGB A;  1A2U A;  5CV8 A;  3MHB A;  4QB4 A;  4KJO A;  4B9X A;  1A2T A;  4F7X A;  3ERO A;  2RDF A;  1F2Y A;  3NUC A;  1NSN S;  3TP6 A;  3OMC A;  5C3X A;  4ID6 A;  4I65 A;  1KDA A;  1STB A;  3E5S A;  1EY5 A;  4WRD A;  4K5W A;  4MIU A;  1II3 A;  3NP8 A;  2EYM A; 
#chains in the Genus database with same CATH topology
 1NBW A;  2R7Z H;  4OEM B;  4ZKC B;  1F9S A;  1JOQ A;  4APV A;  5C4X H;  2LKV A;  4FNF A;  2WV6 D;  1O7Y A;  3MA2 B;  1CA6 A;  1PH6 A;  4GOP A;  2H5X A;  3VDY A;  5C4J H;  3KLS A;  1MJC A;  5C3W A;  5C6A A;  2I5L X;  1XNR Q;  2F4V L;  1FVI A;  4ZUJ A;  4EQN A;  5C3E H;  4GKJ L;  4IJH A;  2VNU D;  4LUV A;  4IN3 A;  3SEB A;  3PUV A;  3VR4 A;  1EOT A;  1VQC A;  3C1F A;  3PMF A;  4JOI C;  1BNZ A;  1AW7 A;  2JXM B;  3K8A A;  1J5E L;  1V43 A;  2HIX A;  5GAG C;  4QIW B;  5IYC H;  3HOU H;  1NCV A;  2OEO A;  3EIV A;  2A69 D;  1Y14 B;  1V1O A;  5FLM G;  3LWU A;  2ZTC A;  4MZ9 A;  1GUT A;  3SHL A;  5DEH A;  2F0G A;  4A3B B;  4CKB A;  1SBB B;  2PQA B;  1ESF A;  3MEF A;  4IJL A;  4DK3 C;  2CFM A;  3K5L A;  1I94 L;  2KEN A;  1GVP A;  3KYH C;  5GQO A;  2UXC L;  1GJX A;  3GTQ H;  1SLJ A;  3GTL H;  5CV5 A;  1NTG A;  4DR1 L;  3W1G A;  3RZO H;  1BDO A;  5JOB A;  5FKA C;  2VUM B;  1L0X B;  4EVO A;  5CBA E;  3K58 A;  4I7Z C;  1PH5 A;  3FVQ A;  1T5X D;  1CT1 D;  1S72 A;  5LMU L;  5JJL A;  2K32 A;  3DM1 A;  1WVL A;  1TKW B;  4ME3 A;  4HIM A;  2ATW A;  2B2T A;  2CH4 A;  2IT1 A;  3DLL A;  5I9O A;  5JVG 3;  4KV6 A;  2F3W A;  3S24 A;  1T9H A;  4JI4 Q;  1YNN C;  2UXB L;  2CWP A;  1Z47 A;  1IYU A;  5EQ0 A;  1B2T A;  3H94 A;  4JG2 A;  1ASY A;  1CK1 A;  1TWC H;  4DR7 Q;  3UE0 A;  4QQB X;  2HDL A;  4BWG B;  4JI0 L;  2EDG A;  4F7X A;  3BYY B;  3NUC A;  2JA8 G;  3G4S A;  5C4X G;  1G51 A;  4I65 A;  3S15 H;  1PRT B;  1PFS A;  1EY5 A;  3I4L A;  1FNU A;  4H0L C;  3EA6 A;  4DV3 L;  4LF5 Q;  2DUD A;  2B39 A;  1YBY A;  5CV9 A;  2UUB Q;  1JE5 A;  5T1I A;  5C3E G;  4HJA A;  2CKZ B;  1B53 A;  5KGU A;  1Z9F A;  1UEB A;  1M4V A;  3C1E A;  1W6K A;  1PA6 A;  1AE3 A;  2F0N A;  4OWT B;  1YEZ A;  2JA5 H;  4B3R Q;  1GUN A;  1PTO D;  3PIO A;  1GM5 A;  3RLO A;  1XNR L;  4BBR H;  1OXT A;  1QE6 A;  2L1B A;  1JB3 A;  2F0Q A;  1QWY A;  1XMQ Q;  4DR6 Q;  3D4R A;  3NXW A;  2MP1 A;  1VQK A;  1VQF A;  3I4N G;  3F2B A;  1VMC A;  1F2Z A;  2N3S A;  4P2C B;  2UUC Q;  2IPK D;  3KLR A;  3T53 B;  5BN4 A;  1EU3 A;  1N9W A;  4TKO B;  4O2D A;  5C44 B;  2IHE A;  5IWA Q;  2F0K A;  1BF4 A;  3OHX C;  2ICI A;  2FMC A;  3A8I E;  2PYK A;  4XYQ A;  3J80 i;  1K0S A;  2B8G A;  2CW0 D;  4A3J B;  4CDF C;  4I7A A;  4NXN Q;  4NXM Q;  1X55 A;  3CP0 A;  2G9H D;  5A35 A;  2KHJ A;  3TDQ A;  5ELD A;  2EPB A;  3TZU A;  4DV1 Q;  4X3T A;  3PGZ A;  2Z4H A;  1PZK D;  2PZT A;  2NZH A;  2XVS A;  2MHV A;  4EQ5 A;  1X32 A;  3U9O A;  2NVT H;  3J7A V;  1CKN A;  4IOC A;  2BE5 D;  1VDZ A;  3K7A B;  3UI2 A;  3VYU A;  5KEE A;  5JJI A;  3HOZ B;  1Y1V G;  4U67 3;  3OW7 A;  4CDC C;  5JVH 3;  1JMC A;  4JI4 L;  1Q3L A;  2BA0 A;  3KF8 A;  5COR A;  1EY0 A;  4XQQ A;  3O13 A;  1QNK A;  2A6E D;  2D5D A;  4DR7 L;  2J0T D;  4R4I A;  3TP6 A;  2A73 B;  3FKI B;  1WD0 A;  4C2M B;  3HS0 C;  5ELE A;  5I2Y A;  2VS1 A;  1VQB A;  2EXZ A;  3TP8 A;  2F03 A;  4DV5 L;  2JA5 G;  3J81 j;  2QEX A;  1YIT A;  3QOL A;  4R4C A;  5M9O A;  2QF7 A;  2DNE A;  4YY3 Q;  5IGE A;  1I3Q B;  1UUP A;  3A7L A;  3E0E A;  4BBR G;  2UUB L;  2NTT A;  2NVY B;  1LTI D;  2AUJ D;  3I56 A;  1O7I A;  1UE6 A;  5LL6 S;  4UP8 A;  4GNX B;  3PO3 B;  3NK9 A;  1DM0 B;  1KNA A;  1SYD A;  1CQV A;  4CJ1 B;  3ND8 A;  1O7L A;  5LL6 X;  4HID A;  3CCM A;  1TWH H;  3ERS X;  3KJP A;  4MN3 A;  3NTH A;  1L1O B;  4OO1 I;  1XMQ L;  2EYH A;  1FGU A;  2JA7 B;  3AQQ A;  2VY3 A;  2K4K A;  1X54 A;  2UUC L;  4OL7 A;  1CSP A;  2RKS A;  1N34 Q;  2UXD Q;  2VB2 X;  2PO4 A;  1PFN A;  4A3K G;  4BY1 G;  3PIP 3;  3S1N B;  1I4X A;  1QB5 D;  3H0G H;  4DU9 A;  1VCI A;  1Q1B A;  2ZXP A;  5IWA L;  4HSP A;  2XN9 C;  1U4R A;  4H02 A;  1LTR D;  4L5Q A;  3GTG B;  1LUZ A;  3PV0 A;  1LT5 D;  4C3H B;  2ZM6 Q;  4KKS A;  1CI3 M;  4QL5 A;  3K59 A;  2R92 B;  3ITP A;  4O0A A;  2LMC B;  4K5X A;  3NWS A;  5CR3 A;  3U50 C;  2D0O A;  4NXN L;  3OYY A;  5JJK A;  3S2H B;  1EYC A;  1YNJ D;  1IYJ B;  1ZXT A;  4WJ4 A;  3ICE A;  2VQE Q;  2XNA C;  4UPA A;  2PW7 A;  2XTI A;  1VQE A;  2CQA A;  1W3S A;  3HOV G;  1YJN A;  4DV1 L;  5C0X J;  2HD3 A;  2EIF A;  3DWA A;  5KRU A;  2K5W A;  4KD3 A;  1LT6 D;  1LO5 D;  1XPO A;  3GTK B;  2K50 A;  3HKZ B;  4KN4 C;  4BBS B;  2B8F A;  3M4P A;  2R7F A;  4GOP C;  4O42 A;  2NVX H;  2ENB A;  5IGD A;  2NYZ D;  1I4P A;  3I4M H;  5I6W A;  4KKT A;  2C35 B;  4JOI A;  3VR5 A;  4YIJ A;  1IBL Q;  5FK9 C;  4OO1 H;  5K36 H;  2RDG A;  3F1Z A;  4CDE C;  3JAM i;  1B8A A;  1HCZ A;  3BU2 A;  3BVM A;  1U4P A;  2J4X A;  1XPU A;  1C4Q A;  3BJU A;  4FXG C;  4IPG A;  3FHW A;  1KDA A;  2B2W C;  3D8G A;  2D9U A;  2KJX A;  4DV7 Q;  1SEB D;  3QWN A;  4ALP A;  3R2I A;  3RMH A;  4YCW A;  1I4Q A;  2DY8 A;  2E2I B;  2UU9 Q;  1Q8K A;  2B29 A;  1HHV A;  3M4Q A;  5IYD G;  3U58 A;  4FF1 A;  1PLF A;  1JQY D;  2F52 A;  1JIC A;  4YY3 L;  2Z6B A;  2CCZ A;  5JPN C;  3NEL A;  5JEA J;  3J80 c;  3TS2 A;  3NTK A;  3S9W A;  3TME A;  1SDF A;  2MFI A;  3PIO 3;  2K5Q A;  1IW7 C;  1PVO A;  4KY5 A;  1LTA D;  1DOL A;  1K3R A;  1HNZ L;  1G2T A;  1ESR A;  4H44 C;  4OEL B;  3H0G G;  3C2P A;  4IZ8 A;  1TQO A;  1E1O A;  4A93 B;  4B3T Q;  4NMZ A;  3CQZ H;  4DNT B;  3VR2 A;  3KFU A;  1B4O A;  1DYQ A;  1SMY C;  2WB1 G;  2F0D A;  4PZ6 A;  4X65 L;  3HOW B;  1SNO A;  1YHB A;  1A3T A;  3CCS A;  1N34 L;  2UXD L;  4BY7 B;  4DV0 Q;  2VUM H;  4FP5 D;  1PMR A;  4MTN A;  2BA1 A;  3Q23 A;  3U4Z A;  1DOM A;  2B3G A;  1UE1 A;  2CHB D;  4ILW A;  2ZM6 L;  5CV4 A;  4TSS A;  1EYA A;  2YU9 B;  2XWB B;  2JSO A;  4BA1 I;  1HH2 P;  3G6E A;  4LWC A;  1JCK B;  5IP7 H;  1L2F A;  4AQY Q;  3GTJ B;  3MEH A;  1FYC A;  2K03 A;  4A3G G;  1DD2 A;  2VQE L;  2Z4I A;  5IOC A;  1TU2 B;  4PMW A;  4EX5 A;  2YTX A;  1K73 C;  2G9D A;  4AYB G;  4P71 A;  2ZJQ A;  4OIJ A;  4HTH A;  2JP1 A;  2DY7 A;  4GS3 A;  2RVL A;  2BH8 A;  2HQL A;  1C7Y A;  1RF2 D;  1IBL L;  3V96 A;  1MBY A;  3F2C A;  1HNX Q;  3OTO Q;  4OON A;  4QY7 A;  4K5W A;  3KLS X;  3PUZ A;  5FLX L;  3AYH B;  1PFM A;  3URY A;  4BXX G;  4DV7 L;  4L5R C;  2H1E A;  3R2T A;  1D5X C;  2CVR A;  4JI8 Q;  2D62 A;  1HTP A;  1L0Y B;  2M00 A;  4CHT B;  4M8A A;  1D5Z C;  2E75 C;  1Y1W B;  2Q2U A;  3A8K E;  5LMN Q;  1JR0 D;  1EWC A;  4CKE A;  1CTM A;  4A3F B;  5J1Z A;  1JOK A;  2R3Z A;  3HOX B;  1TII D;  2KBN A;  1GD7 A;  5C44 H;  1HZA A;  2X6G A;  2Q8R E;  1KDB A;  1EIG A;  1RIP A;  2BH2 A;  3AB9 A;  4XQJ A;  3S14 B;  1H9K A;  2LXK A;  2XRQ D;  1XPR A;  1EZ8 A;  4R8N A;  3RZD B;  2JN4 A;  5DM7 3;  1HQR D;  2AQ2 B;  4A3J H;  4DUZ L;  1KNE A;  3ND9 A;  4B3T L;  4A3I G;  1H9M A;  5G3L D;  2F4V Q;  2RBM A;  1SJH D;  4RCN A;  3BZC A;  1VQG A;  1PYW D;  3CKI B;  4DV0 L;  1N8R C;  4LF9 Q;  1STE A;  4JBK A;  2BOS A;  4IUT A;  3PSI A;  3M7G A;  3CC4 A;  3JAM c;  1SYG A;  2Q8T A;  1CZG A;  5EKI A;  3K7A H;  3RN2 A;  2EZV A;  1K83 B;  1XMO L;  4AQY L;  4FVM A;  5EKK A;  5C5L A;  2PZW A;  2B2V C;  3HOZ H;  1ML0 D;  1Z6H A;  5IT9 c;  4Y52 H;  3HFZ B;  3EQL C;  1HZB A;  1J6Q A;  3CCR A;  1MKH A;  1EY4 A;  4X3K A;  4GN3 B;  2A19 A;  3FKI H;  2IY5 B;  2WII B;  3BDC A;  3D3R A;  2N78 A;  5C4H A;  1HR0 W;  1SR3 A;  4DN4 M;  4DV4 L;  1EYD A;  1S5B D;  4A3E H;  2K7V A;  2V1C C;  1TWG B;  3I72 A;  3BZD B;  3Q24 A;  5EPK A;  1NSN S;  4X62 Q;  3OMC A;  4ULL A;  1PV4 A;  1I3Q H;  3WDN A;  1HNX L;  4KLK A;  1N36 Q;  3OTO L;  4IPH A;  2NVY H;  3CMA A;  3PO3 H;  2EVB A;  2YV5 A;  1K0R A;  3I3C A;  2RDH A;  3ULP A;  1HZC A;  1G91 A;  2EY5 A;  1TS3 A;  2PMZ B;  2F0O A;  1MI2 A;  4UP9 A;  2HCC A;  1MGS A;  2PNH A;  3K5O A;  5C44 G;  4JI8 L;  4N8F A;  4GLA C;  3BDL A;  1MSH A;  1ZKO A;  1YNN D;  1TVX A;  4R4O A;  4LK1 C;  2JA7 H;  4A3C H;  3KDF B;  4LF6 L;  2VB3 X;  1WTX A;  3KF6 A;  4DK1 A;  3HRZ C;  3CCJ A;  3S1N H;  3TS0 A;  3TRE A;  4G57 A;  1LV9 A;  3MXN B;  3DXJ C;  4C1N I;  2Y0S B;  4JV5 Q;  5IT9 E;  1VF7 A;  3A56 A;  4IPC A;  2B63 G;  3HKS A;  2MO1 A;  3GTG H;  5IYB H;  4DR3 Q;  3GP7 A;  4C3H H;  1Q7Y C;  4CJ2 C;  2QW7 A;  3BS1 A;  2F1M A;  2NWG A;  1PTO B;  3D6W A;  4J6H A;  2R92 H;  2F3I A;  4N9T A;  2NZO A;  1OO9 B;  4AH6 A;  5IP9 H;  4L5S A;  3S2H H;  1QOH A;  1PZJ D;  4K2L A;  2GVB A;  2AWN A;  1UWV A;  2WB1 E;  3EVQ A;  2PQE A;  5D3D A;  1PH1 A;  5IOD A;  3A55 A;  2B2W A;  3GQB A;  4DR5 Q;  4FF3 A;  1L0W A;  3HOY G;  1A3V A;  3K6O A;  4IUQ A;  1EY8 A;  3VYR A;  3LWE A;  2EYF A;  4LF9 L;  2WKC A;  2QEJ C;  4P74 A;  3GTK H;  2KVM A;  2DN8 A;  4BBS H;  4P73 A;  1B44 D;  5E4W C;  2UUA Q;  2K75 A;  3G48 A;  1S5D D;  3AMU A;  2WKD A;  3K81 C;  4KJN A;  3QG1 A;  3FKI G;  3TEH B;  4C3I B;  4Y7N H;  2L4N A;  3NBH B;  1WTO A;  3W5O A;  4KD4 A;  1YJ9 A;  3FRP B;  2R93 B;  1V1Q A;  1S4Z A;  4OX9 Q;  3GTM B;  4A3E G;  1D5M C;  2XSC A;  4YWL A;  1G6Z A;  2RSN A;  3E6Z X;  2R7D A;  3T1H Q;  1MD2 D;  1R9T B;  3DUZ A;  5D65 A;  4AYB E;  1DZ1 A;  1AZQ A;  1GUO A;  2E5L L;  1JJ2 A;  4B9X A;  4RFB A;  3PO3 G;  2KHI A;  1XTC D;  2E2I H;  2KCN A;  1VQ5 A;  5EGT A;  4X62 L;  2EJM A;  1EY7 A;  1N36 L;  4QF4 A;  1A62 A;  4DK6 C;  4GOP B;  1IL2 A;  4LUZ A;  1EIH A;  2Q8I B;  2SOB A;  1TY0 A;  1JJC B;  1RKN A;  3UDG A;  3A74 A;  1ET6 A;  3PUX A;  1SNM A;  2R7Z G;  2O5J C;  1JWS D;  1I4R A;  3CC2 A;  3ONA B;  3KJO A;  4KHP L;  1F2M A;  3CPF A;  4A93 H;  3TBI B;  4QUC A;  2VZA A;  4RGO S;  1Y8O B;  4YWK A;  4C3H G;  3HOW H;  4IO9 A;  1SRU A;  4DV5 Q;  5M3M B;  5F2D A;  1YJW A;  1SND A;  5E3F A;  4BY7 H;  1JWU D;  3DWP A;  3OIP A;  2EE1 A;  1YHQ A;  3E0J A;  4JV5 L;  1OXV A;  4JW0 A;  2LFN A;  1MSG A;  4DR3 L;  1WCM B;  1QUQ A;  4G4K A;  1EYG A;  2YU9 H;  1EQV A;  3FPP A;  3HZX A;  3KBG A;  1ASZ A;  1KAW A;  2HCI A;  3HKZ G;  1JOO A;  3BZK A;  3GTJ H;  3TN2 A;  2O4X A;  3SGI A;  1AZP A;  1A63 A;  5IYC G;  1H95 A;  2IX1 A;  3HOU G;  1TWA B;  5ELN A;  4DR4 Q;  5M3F B;  5KNB A;  2KCM A;  4DR5 L;  3L3O C;  1TS4 A;  1IKM A;  4HSV A;  4HJ8 A;  1X65 A;  2VW9 A;  2OXP A;  3CCQ A;  1KC8 C;  2L11 A;  1WTV A;  4K0K Q;  1A8V A;  2I46 A;  3Q6S A;  2L15 A;  2UUA L;  5CMD A;  3K5N A;  5FJ8 H;  2JA6 B;  3DEO A;  1ONL A;  3E9H A;  1GKH A;  2K33 A;  1B1Z A;  4OX9 L;  4ZQ3 A;  1AE2 A;  5J3B A;  1LT3 D;  3K0X A;  3CXC A;  3T1H L;  5M5Y B;  5ELB A;  2AQ3 B;  4C3J B;  4X66 Q;  2MNA A;  1PHJ A;  4CGY B;  1EIF A;  3MHB A;  4A3M B;  1Q8I A;  4G7Z C;  3S16 B;  2I07 B;  1II3 A;  4IOA A;  3NP8 A;  2EYM A;  1BCP C;  4YCU A;  1I4H A;  3KOJ A;  3R93 A;  4N8X 1;  2EY2 A;  1HXY D;  3CME A;  4K6L A;  4UY8 C;  1PH8 A;  1A15 A;  2ES2 A;  3P75 A;  3HOX H;  3PO2 B;  1K8M A;  4ZKB B;  3ZYY X;  3QO2 A;  4HJ9 A;  2NTS A;  3HOW G;  3I2Z A;  1F2L A;  4NPS A;  3Q22 A;  5JJZ A;  3T56 B;  3S14 H;  2Z1C A;  1Q46 A;  2K6A A;  5J22 A;  4JI1 Q;  2QIL A;  1CKM A;  4DNI A;  2B2V A;  1O80 A;  1VQ8 A;  1CKO A;  1JOR A;  3QOJ A;  3ULL A;  4JC0 A;  3GV3 A;  1EQT A;  1IKL A;  4CDD C;  2RSO A;  1Y8N B;  2FJ2 A;  4IUV A;  3T1Y Q;  4WOR A;  1NMG A;  3R3O A;  4ODG A;  3LGJ A;  5E7N A;  1SE8 A;  4HJ5 A;  1VQM A;  1EY6 A;  2ID0 A;  4LMQ D;  2KEC A;  5M5X B;  3RN5 A;  2L55 A;  4GN4 B;  3L0O A;  1AFP A;  4ZK9 B;  3MAQ A;  1XYI A;  1X9N A;  4XQN A;  1OXS C;  3D6C A;  4DFA A;  4DUY L;  2ZTE A;  4PZ7 A;  2F0T A;  1TY2 A;  2XIW A;  1K83 H;  5DNF A;  1HNZ Q;  1ILP A;  3LX0 A;  3I7F A;  1EFW A;  4LNQ A;  4JYA Q;  1DCZ A;  4X65 Q;  4FDB A;  5M5W B;  4DR4 L;  1G2S A;  3F2D A;  1I6H B;  1IW7 D;  3ERQ A;  1S3O A;  5FJ8 G;  3HG9 A;  1UE7 A;  1PH2 A;  2F3V A;  2JEB I;  1CSQ A;  4X64 Q;  5L37 A;  4K0K L;  3OWE B;  4RG1 A;  2QA4 A;  1CKN B;  1SMY D;  2EYP A;  4NKL A;  2K5N A;  2XRS D;  3STB C;  4DA2 A;  1EWH A;  1TWG H;  3GV6 A;  1QG7 A;  3HEJ A;  1FR3 A;  3JC6 6;  5GAD C;  5LHY 1;  4QMG A;  2N88 A;  5FO8 B;  3S1R B;  1LLR D;  2K52 A;  3PUW A;  4DAY A;  1I5F A;  3KF8 B;  4JI3 Q;  2K28 A;  2JA8 B;  2Q2H A;  4Q5V A;  2E2D C;  4V0B A;  4X66 L;  4YCV A;  1B70 B;  3K0Y A;  3Q0A A;  1F2Y A;  4L5T A;  1SE2 A;  2MGS A;  3M4O B;  3I4O A;  4KI0 A;  3DEP A;  1BQQ T;  2F0I A;  2X69 A;  3CRL C;  1RD9 D;  4RHS A;  4ZYS A;  5GAE C;  2F0U A;  2Z6K C;  2IW3 A;  3I70 A;  3A5U A;  2DJF C;  1DOK A;  3PUY A;  3UDF A;  2MPM A;  1SN8 A;  4LW1 A;  3SXH A;  5CV6 A;  2E2H B;  5IE8 A;  4PMC A;  1PXU A;  4A3L H;  1JJG A;  3S1M B;  1GXD C;  1H9J A;  1X3F A;  4ZCK A;  1C8C A;  1PTO H;  1GHK A;  3I4N B;  3IFD A;  2IWH A;  3WWV A;  2A6H C;  4JI1 L;  2Z9H A;  1NUC A;  3CRK C;  4HN7 A;  4RGM A;  3GTP B;  3J7Z C;  4M1U B;  2OTL A;  2LS0 1;  4C1N K;  5A2Q L;  1TS2 A;  2XWJ B;  3T1Y L;  4F8M A;  1H9S A;  3GTQ B;  1P8L A;  1ILQ A;  1WTP A;  1PRT C;  5C0X I;  1F77 A;  5BN3 A;  3NQT A;  1QNU A;  4K8J A;  1ENF A;  2HIV A;  2JQO A;  3MC0 B;  4LUO A;  2AKW B;  4NB3 A;  3M3Y B;  4FO2 A;  4K14 A;  1GUW A;  1V9P A;  3AFP A;  1A3U A;  5IGG A;  4A3B H;  2ZTD A;  5I6Y A;  1IBK Q;  4C3I H;  3H6M A;  1LTS D;  4JI5 L;  3A54 A;  2B2U C;  4DUZ Q;  3HKZ E;  1V1P B;  1CUK A;  4RMF A;  4IFD I;  4QCL A;  3K80 C;  2R93 H;  1K8O A;  4JYA L;  1KAB A;  3GTM H;  1O78 A;  4TVA B;  2CQO A;  4DNR B;  1K9M C;  3J81 c;  4UAI A;  1R9T H;  1A6X A;  4JVZ A;  1S5F D;  1W6J A;  4X64 L;  2EJF C;  4RGT A;  2A5H A;  3A5Z B;  3I55 A;  3UDX A;  1Y1V B;  5EPJ A;  3T16 A;  4MNO A;  1EL0 A;  2F4I A;  1XMO Q;  1UAP A;  4JI3 L;  1OTC A;  1RCV D;  3X3N A;  4UHV A;  2ZJP A;  5C0X H;  2D2C C;  3I4M G;  3A7A B;  4KN7 C;  4ZUI A;  2KED A;  4OO1 G;  5K36 G;  4B08 A;  1ZEQ X;  2VXW A;  3DMU A;  1ET9 A;  3D31 A;  2WIN B;  2FFK B;  4DV4 Q;  1EIY B;  3GD7 A;  1B9N A;  4A76 A;  2DJG C;  4FYD A;  3CU7 A;  1GO3 E;  5KYI A;  2NZ1 D;  5AJ3 Q;  4IFD H;  4R8I A;  2IX0 A;  4A4I A;  1FGB D;  2F0S A;  2HT1 A;  3SK5 A;  1WCM H;  3J81 E;  1LTB D;  1HFN A;  2G5D A;  3CCV A;  2ZXR A;  1SYB A;  4PV1 C;  4JI7 Q;  5NUC A;  1ICW A;  4A3K B;  4BY1 B;  2SNM A;  5ELC A;  3RD4 A;  3MVV A;  1TWA H;  1IBM L;  3J80 L;  2NVQ B;  5CV7 A;  4LF6 Q;  5M3F H;  1KD1 C;  5EBC A;  4A3B G;  2WAQ B;  3G6J B;  2MJ8 A;  2ASB A;  4JCV E;  2KCT A;  1Q81 C;  1ROD A;  4C3I G;  1NNX A;  1BCP F;  1S40 A;  3MXU A;  3E9I A;  2R93 G;  5JEA H;  1SYC A;  1FL0 A;  1E2W A;  4FF4 A;  1I50 B;  2MUY A;  4DV2 Q;  1SYE A;  2YTY A;  2KUM A;  2J7Z A;  4DAV A;  2ZT9 C;  4GNX C;  2VUM G;  5GAH C;  1K28 A;  1IBK L;  3HOV B;  1EZ6 A;  4DK0 A;  2PCF B;  2JA6 H;  3S17 B;  5CYU A;  3SR1 A;  3GTO B;  3E3X A;  1D7Q A;  4RKB A;  3W3A A;  1X6O A;  1KXL A;  1ENC A;  2VQF Q;  1JE4 A;  1L1O C;  5M5Y H;  1U4L A;  4HR7 B;  2KA7 A;  5IP7 G;  2AHO B;  1VQ4 A;  4A3M H;  3S16 H;  1HNW L;  1M8A A;  3H91 A;  3C46 A;  1EUJ A;  1LAC A;  3VA5 A;  1RHP A;  3NEM A;  3P1H A;  3S1Q B;  3S2D B;  2AUK A;  4GLX A;  3SDZ A;  2JA9 A;  3B6Y A;  1SMX A;  1CM9 A;  4HIK A;  3PO2 H;  1VF5 C;  4MIU A;  1VS0 A;  3A8J E;  2M9V A;  2E74 C;  1WTH A;  1IL8 A;  4IUU A;  4H7B A;  4R4Q A;  3V05 A;  4IFD G;  4PNY A;  3LNN A;  1I6V C;  1SNP A;  4DAP A;  2E5L Q;  1RTN A;  4C2M H;  2NN6 I;  1TWH B;  3N6R A;  4R1J A;  4IUN A;  5EBD A;  5JAV A;  3QJY A;  3NQI A;  1BO0 A;  1I4G A;  3T13 A;  1XX8 A;  2E2J B;  4ZAI A;  4KTA A;  5FLM H;  3CCU A;  5AJ3 L;  3FMC A;  4JBM A;  1AEX A;  2F0J A;  1WJJ A;  1GUG A;  3T51 B;  3H0G B;  3PF5 A;  1Q1E A;  2RA4 A;  4ZRZ A;  1HA5 A;  4KHZ A;  5M3F G;  1Y69 U;  2QCP X;  1RL2 A;  4JI7 L;  4KHP Q;  2JE6 I;  3H3V I;  1Q90 A;  4IAL A;  1E2Z A;  2TSS A;  2FHT A;  5EAY A;  2PQA A;  5M5W H;  1Q86 C;  2HHH Q;  1I6H H;  3NSW A;  3EJI A;  2IHF A;  2OF1 A;  3W2D A;  1JC7 A;  4A3J G;  3VR6 A;  4RH6 A;  1VQH A;  1CQF A;  1B3Q A;  4DV2 L;  1T5E A;  3NPP A;  3VA7 A;  4A3G B;  4WJ3 M;  2F0W A;  1LT4 D;  4XYO A;  2NN6 H;  3S1R H;  2Z6K A;  1KAA A;  2MO0 A;  1BUV T;  2NUC A;  2VQF L;  1HPC A;  2JA8 H;  4RCO A;  5KNC A;  1TWF B;  4PQX A;  3JAM L;  2A68 C;  3IRB A;  3HOZ G;  4DXF A;  3M4O H;  5J39 A;  5C5M A;  3PO2 G;  2VL6 A;  4G7H C;  1PRT F;  4OGQ C;  5CV8 A;  4QB4 A;  2NB0 A;  4B3M L;  1GHJ A;  2RDF A;  1PH7 A;  2BDN A;  3VYS A;  4ID6 A;  1WOC A;  5IT9 L;  4X3S A;  4XXE A;  3E5S A;  1G29 1;  2KEE A;  1BBW A;  5I2X A;  2PMZ E;  1BXT A;  3H3V H;  2IJ0 A;  2A74 C;  2N8N A;  2ZJR A;  3UE1 A;  1VQO A;  5C4Z A;  2E2H H;  1WFQ A;  2EYJ A;  4F87 A;  3H15 A;  4HED A;  3S1M H;  1PZI D;  3H09 A;  3PIP A;  3I4N H;  3I73 A;  1DJR D;  5I9P A;  1F9Q A;  3WOE A;  1OXX K;  3FEW X;  2I5H A;  1K3B C;  1ZYR C;  1LTT D;  1R4Q B;  1V8Q A;  2QGQ A;  3IL8 A;  2B2U A;  2Y0S E;  4XT3 B;  3GTP H;  3KK7 A;  3KF6 B;  3CQZ B;  3PF4 A;  2WAC A;  5ELO A;  1F9R A;  1SAP A;  1X3P A;  2X6L A;  2ICE C;  1QZG A;  4V19 0;  1BOS A;  1KLG D;  4HMJ A;  3U4V A;  3BVZ A;  2JA7 G;  1TS5 A;  4A3C G;  1W2B A;  1BCP D;  5BN5 A;  4TRD A;  1STA A;  4A3I B;  5E1F A;  3M3Y H;  4QJF A;  4JBJ A;  1XNQ Q;  1E2V A;  1HR0 Q;  4X6A H;  1A0I A;  1YI2 A;  1HZ9 A;  4LJZ C;  4TQU S;  2YYZ A;  1NR2 A;  3MTS A;  1Z7T A;  4QIW E;  4B9W A;  5IYB G;  4DR2 Q;  1KRT A;  2HHH L;  1AN8 A;  4HJ7 A;  2R92 G;  4CBV A;  2LSS A;  5H1S E;  1B3A A;  4BS9 A;  4PMB A;  2NN6 G;  2F0E A;  5DLQ E;  3U9S A;  5IY0 A;  5IP9 G;  4B3S Q;  1BBU A;  3EBE A;  2PW5 A;  1DGS A;  1Y1V H;  3FP9 A;  3QB3 A;  1FJG Q;  4J1M A;  3OOC A;  3WOF A;  1QIL A;  3BG3 A;  1FD7 D;  2OTJ A;  2PI2 E;  4DUY Q;  3FDT A;  1KHI A;  1VQN A;  2F0M A;  1YNX A;  4RWS C;  3ULJ A;  3HGB A;  4NDX A;  4RAU C;  1EWI A;  1FNW A;  4ME5 A;  1KL9 A;  3EFX D;  4BBS G;  5FOB B;  2L5T A;  1X3Q A;  1E7Z A;  3EN2 A;  1ICF B;  2EOT A;  4P72 A;  1NR4 A;  2EJG C;  3MFY A;  1SNQ A;  2FMM A;  2BDO A;  4IPD A;  4OXP A;  2Q2I A;  3M4Y A;  1KRS A;  1KLU D;  4FF2 A;  2K5D A;  2N55 A;  1A2U A;  3KLW A;  2TMP A;  1LYL A;  1C9O A;  3CC7 A;  4WRD A;  4DPG A;  1UE5 A;  2A69 C;  2K1B A;  1VQI A;  1NY4 A;  4ABN A;  4A3D B;  4POG A;  2L9H A;  1STY A;  4FXK C;  4LFB L;  3QIA A;  1QZH A;  2K5H A;  4KMU C;  5HUR A;  3OSO A;  2PZU A;  3STB D;  1PFB A;  1IXR A;  3V2T A;  5KND A;  4GNX A;  3AEV A;  1LTL A;  4OWX B;  1EEI D;  4EQP A;  5T1G A;  4LF4 Q;  3J81 i;  2SNS A;  4A3K H;  4BY1 H;  3CPW A;  2L12 A;  2Z0S A;  1CA5 A;  3IAY A;  1Y1W H;  1D8L A;  2NVQ H;  2B63 B;  1L1O A;  2KHS A;  1HJP A;  3UDI A;  1X56 A;  4LF7 Q;  4A3F H;  1C0A A;  2L0C A;  4A93 G;  3SK8 A;  1QUQ B;  1KIX A;  4XDX A;  5JPM C;  1CHQ D;  1I50 H;  2N49 A;  3OPO A;  4R4T A;  2JJQ A;  1N33 Q;  1LTG D;  1HQM C;  1XNQ L;  4BY7 G;  1HR0 L;  2HQE A;  3K57 A;  3RZD H;  2NBF A;  1QVF A;  3HOV H;  1U4M A;  3S17 H;  5ELF A;  3SVM A;  4JBW A;  2EYL A;  2KOL A;  1BR9 A;  3HOY B;  3GTO H;  1D1I A;  2EYO A;  2HDM A;  4DR2 L;  1KDC A;  3J7A F;  4NP5 A;  2PPB C;  1K8G A;  2K01 A;  3P7J A;  4XIG S;  2ALY B;  2A6H D;  3N52 A;  2WFW A;  4B3S L;  4IUR A;  1WD1 A;  4XT1 B;  3RUZ A;  3J7A 5;  1FJG L;  1WTW A;  3MXP A;  1EEF D;  4A3E B;  1JT8 A;  1VQD A;  1PYS B;  1PH9 A;  1MJE A;  1PRT D;  4UP7 A;  1STN A;  3S2D H;  3S1Q H;  4LF5 L;  3L7Z C;  1CHP D;  5FO7 B;  1TXY A;  4JI5 Q;  1H9R A;  1PTO C;  2KQ3 A;  1RTO A;  4KHV A;  3C3L A;  2LXJ A;  3T4A C;  2XGT A;  4RGN A;  4DAM A;  1HRJ A;  3ERO A;  4B3R L;  5IYD H;  1RDP D;  4PZ8 A;  1M90 C;  1J9O A;  5CBE E;  1IZ6 A;  1NJI C;  1NAP A;  4DR6 L;  1KQS A;  4G7O C;  2E2J H;  1PDQ A;  4Z9C B;  4LFC Q;  1YZ6 A;  4LFB Q;  1TT2 A;  3G71 A;  2QDB A;  1VQ6 A;  4LFA Q;  2A8V A;  1SFO B;  3OW2 A;  2OQ0 A;  2R7Z B;  4OIK A;  2CW0 C;  4BA2 I;  1QVG A;  5C4X B;  1OXU A;  1Y1W G;  1AH9 A;  2F0H A;  2RF4 A;  4CJ0 B;  4LF8 Q;  4MTK A;  2WAQ G;  4JI6 Q;  1SXT A;  2M2L A;  1RJT A;  1UNS A;  4A3F G;  1AP0 A;  3HOX G;  3NTI A;  2D0P A;  5G3L F;  5C4J B;  4LF4 L;  2B2Y C;  4AIM A;  3D0F A;  2R6G A;  4RA8 A;  1E24 A;  1SRO A;  4NXM L;  1QCB D;  3AU7 A;  3TP7 A;  5C3E B;  5KIX A;  1MHW C;  4F88 A;  1HUN A;  1V1P A;  1IHZ A;  2DGY A;  5D14 A;  4LF7 L;  1G6P A;  2BE5 C;  3RLF A;  3X3M A;  4DF7 A;  4X3U A;  4DV6 Q;  2K05 A;  4HAE A;  3NHH A;  5A2Q E;  3NE5 B;  2RCF A;  3DHQ A;  1N33 L;  4A3G H;  2F0L A;  3HOU B;  3KUP A;  1YHA A;  3TQY A;  1LM0 A;  3DWQ A;  5I4D A;  2RCN A;  1HUM A;  5D3I B;  3F8T A;  2A6E C;  1X3E A;  3NBI A;  5ISR A;  4Y7N B;  3L2P A;  1YVC A;  5LMN W;  4IFD J;  4GN5 A;  1CZW A;  2IX3 A;  4K5V A;  1IBM Q;  4GKK Q;  2YTV A;  1N32 Q;  1B7Y B;  1STG A;  3GTL B;  3KBX A;  3D4W A;  1EFI D;  1S5E D;  1TWF H;  3RZO B;  3VR3 A;  1G8Z D;  5IIF A;  1HFG A;  3CD6 A;  1DXM A;  3BVG A;  3CW2 C;  2K14 A;  1GOZ A;  3HP3 A;  4N9P A;  5FLX c;  4YHH Q;  4JI2 Q;  3DM3 A;  4IUP A;  2AWO A;  5HGQ A;  1E22 A;  1BBX C;  4DAY B;  5K5P A;  3F2U A;  3RR5 A;  3SE0 A;  2K5V A;  4R9W A;  2FIN B;  4BXX H;  5BR8 Q;  1SE4 A;  3VYT A;  4RHR A;  1STB A;  2E8G A;  2P5Z X;  1WTQ A;  4DXG A;  4JPB W;  4K6D A;  1STH A;  1TWC B;  2JK8 A;  5KYL A;  1HNW Q;  4NW2 A;  1WTR A;  1VQJ A;  1IYV A;  3I90 A;  1D1K A;  2EXD A;  3NEN A;  3TZD A;  4J8Q A;  3S15 B;  3CCE A;  2O5I C;  3Q8D A;  4LFC L;  2WP8 J;  4L63 B;  3W1B A;  1VMP A;  3D4D A;  1UEA B;  3BDO A;  4OHJ A;  3ER0 A;  4KKU A;  1VQP A;  5TSS A;  3QR8 A;  3GO5 A;  5DAU A;  1EY9 A;  5IGF A;  2B2T C;  4Q0F A;  4LFA L;  2GN5 A;  4ZLT F;  2RHQ B;  1YNJ C;  4J15 A;  3RNU A;  2AQ1 B;  4LF8 L;  4A3I H;  1E1T A;  4JI6 L;  4H13 C;  3MWY W;  2JA5 B;  3OIQ A;  2QDL A;  5CGK A;  2Y0S G;  2IL8 A;  1SYF A;  4BBR B;  4A3L G;  1H9S B;  5FLX E;  4FXD A;  1E0B A;  1M1K C;  4L8J A;  5M3M H;  1B9M A;  4IQZ A;  1DON A;  4HMI A;  1EOV A;  3RLN A;  4DV6 L;  3OMG A;  1Q82 C;  5HY6 A;  1PYB A;  3J80 E;  4U68 A;  2RHS B;  1VQL A;  4L6T B;  4RKL A;  3CCL A;  1E3P A;  4OWW B;  3CF5 A;  4GZY C;  3K5M A;  4C56 C;  1U9R A;  1WI5 A;  3TRZ A;  2I0Q A;  3GDE A;  1YIJ A;  3FPU B;  1CFM A;  1U0L A;  5GRO A;  2H4O A;  4EQO A;  3TSS A;  4GKK L;  3M9B A;  2RQX A;  1N32 L;  1HTL D;  4S3S A;  1ENA A;  3NWT A;  3R8B A;  3A0J A;  5EJW A;  4EGV A;  1VQ7 A;  4E6I A;  1GUS A;  2C9O A;  3PCO B;  1HA6 A;  2JEA I;  4K8I A;  4POF A;  1BKB A;  4KY6 A;  1LAB A;  2Q2T A;  4YHH L;  3M7N A;  2F0P A;  4JI2 L;  2NVT B;  1X3G A;  2E76 C;  2UU9 L;  1EQR A;  2MQH A;  2EY6 A;  4A75 A;  4A3D H;  4PG3 A;  3J81 L;  3IKJ A;  5C3X A;  1XXG A;  2V4D A;  3I91 A;  5BR8 L;  1K8A C;  2FXQ A;  3AFQ A;  3M85 A;  2AMC B;  3IFT A;  5HGT A;  4C3J H;  1XJV A;  2F0V A;  1Q12 A;  4KY7 A;  2OCE A;  3I8Z A;  5E4X A;  5CC4 A;  4HCE A;  1TR5 A;  2A1A A;  4XTC S;  1NE3 A;  1NMF A;  2PNR C;  1SJE D;  4B3M Q;  4K2K A;  5C0X G;  1WYD A;  4GKJ Q;  2I5M X;  2B63 H;  1JB7 A;  2HUG A;  1J8I A;  5DM6 3;  2A68 D;  3BYT B;  1JWM D;  3KDF A;  2OWO A;  4LAA A;  4QUF A;  5EPL A;  1J5E Q;  2R61 A;  2GVA A;  5EKL A;  4O1N A;  4UDU C;  1PTO F;  3MXN A;  5M3M G;  1KTK A;  3P20 A;  3ZJY C;  2WAQ E;  2SEB D;  3MZ5 A;  4QGU A;  4WFN 3;  1R4P B;  3HOY H;  1QJO A;  1I94 Q;  1XWE A;  1WCM G;  2LY7 A;  1Y8P B;  2O2L D;  3OWF A;  2EQS A;  4P75 A;  2EY1 A;  4HIO A;  1VQA A;  3PQI A;  3J7Y W;  2UXC Q;  4JK1 C;  4KK7 A;  4DR1 Q;  3MFG A;  1ZYR D;  1D6E C;  2Z8L A;  4YWM A;  5M5X H;  1BCP B;  2OQK A;  4DKA C;  1S5C D;  2K04 A;  1EU4 A;  3H3V C;  1U5K A;  5COY A;  2KCC A;  3L9A X;  1PH4 A;  1D2B A;  3SK4 A;  1P16 A;  1FNV A;  4WJW A;  1SNC A;  2WB1 B;  1QVC A;  5LMU Q;  1PH3 A;  2QKI C;  1F9P A;  5AFW A;  5JEA G;  3MXG A;  2F0F A;  1MIU A;  2OT2 A;  4DGZ A;  2ZXO A;  1XTD A;  3NBH A;  3TP5 A;  2JA6 G;  4A3D G;  2UXB Q;  3SK6 A;  5IGC A;  1VQ9 A;  3K7U C;  1SSO A;  5FO9 B;  4HCS A;  1SE3 A;  2GA4 B;  2PI2 A;  2B2Y A;  3G7L A;  1B50 A;  3CHB D;  4JI0 Q;  1C48 A;  5IGB A;  1O7Z A;  4C3J G;  1BVS A;  2CH4 W;  3JAM E;  4KJO A;  2NVX B;  4MHE A;  1A2T A;  2DNC A;  2BCO A;  4GLV B;  5LMN L;  2SDF A;  2JYO A;  3I4M B;  4CKC A;  2C5C A;  4DV3 Q;  4AYB B;  3CAM A;  4A3M G;  1EQQ A;  2CWA A;  1SFO H; 
#chains in the Genus database with same CATH homology
 4ZKC B;  1F9S A;  1JOQ A;  2LKV A;  4FNF A;  2WV6 D;  1O7Y A;  3MA2 B;  1CA6 A;  3KLS A;  5C3W A;  5C6A A;  4EQN A;  4ZUJ A;  2VNU D;  4IN3 A;  3SEB A;  3PUV A;  3VR4 A;  1EOT A;  3C1F A;  3PMF A;  1BNZ A;  1AW7 A;  2JXM B;  1V43 A;  4QIW B;  1NCV A;  2OEO A;  2A69 D;  1V1O A;  3LWU A;  1GUT A;  3SHL A;  5DEH A;  2F0G A;  4A3B B;  4CKB A;  1SBB B;  1ESF A;  3K5L A;  1GJX A;  5CV5 A;  1BDO A;  5JOB A;  5FKA C;  2VUM B;  1L0X B;  4EVO A;  5CBA E;  3K58 A;  4I7Z C;  3FVQ A;  1T5X D;  1CT1 D;  2K32 A;  3DM1 A;  1WVL A;  1TKW B;  2B2T A;  2IT1 A;  5I9O A;  5JVG 3;  4KV6 A;  2F3W A;  1YNN C;  1Z47 A;  1IYU A;  5EQ0 A;  1B2T A;  3H94 A;  1CK1 A;  2HDL A;  4BWG B;  2EDG A;  4F7X A;  3BYY B;  3NUC A;  4I65 A;  1PRT B;  1EY5 A;  3I4L A;  1FNU A;  4H0L C;  3EA6 A;  2B39 A;  5CV9 A;  5T1I A;  1B53 A;  5KGU A;  1M4V A;  3C1E A;  1W6K A;  2F0N A;  1GUN A;  1PTO D;  1OXT A;  1QE6 A;  2L1B A;  1JB3 A;  2F0Q A;  1QWY A;  3D4R A;  3NXW A;  2MP1 A;  1VMC A;  1F2Z A;  4P2C B;  2IPK D;  3KLR A;  3T53 B;  5BN4 A;  1EU3 A;  4TKO B;  5C44 B;  2F0K A;  1BF4 A;  3OHX C;  2ICI A;  2FMC A;  3A8I E;  2PYK A;  4XYQ A;  2B8G A;  2CW0 D;  4A3J B;  2G9H D;  5A35 A;  3TDQ A;  5ELD A;  2EPB A;  3TZU A;  4X3T A;  2Z4H A;  1PZK D;  2PZT A;  2XVS A;  2MHV A;  1X32 A;  3U9O A;  3J7A V;  2BE5 D;  1VDZ A;  3K7A B;  3UI2 A;  3VYU A;  5KEE A;  3HOZ B;  4U67 3;  3OW7 A;  5JVH 3;  1Q3L A;  2BA0 A;  3KF8 A;  5COR A;  1EY0 A;  4XQQ A;  3O13 A;  1QNK A;  2A6E D;  2D5D A;  2J0T D;  3TP6 A;  2A73 B;  3FKI B;  1WD0 A;  4C2M B;  3HS0 C;  5ELE A;  5I2Y A;  2EXZ A;  3TP8 A;  2F03 A;  3QOL A;  5M9O A;  2QF7 A;  2DNE A;  5IGE A;  1I3Q B;  1UUP A;  3A7L A;  2NTT A;  2NVY B;  1LTI D;  2AUJ D;  5LL6 S;  3PO3 B;  3NK9 A;  1DM0 B;  1KNA A;  1SYD A;  1CQV A;  4CJ1 B;  3ND8 A;  1O7L A;  5LL6 X;  4MN3 A;  3NTH A;  4OO1 I;  2EYH A;  2JA7 B;  4OL7 A;  2RKS A;  2VB2 X;  2PO4 A;  1PFN A;  3S1N B;  3PIP 3;  1I4X A;  1QB5 D;  4DU9 A;  1VCI A;  1Q1B A;  2ZXP A;  4HSP A;  2XN9 C;  1U4R A;  1LTR D;  3GTG B;  3PV0 A;  1LT5 D;  4C3H B;  4KKS A;  1CI3 M;  3K59 A;  2R92 B;  3ITP A;  2LMC B;  4K5X A;  3NWS A;  5CR3 A;  3S2H B;  1EYC A;  1YNJ D;  1ZXT A;  2XNA C;  2PW7 A;  2CQA A;  5C0X J;  3DWA A;  5KRU A;  2K5W A;  4KD3 A;  1LT6 D;  1LO5 D;  3GTK B;  3HKZ B;  4KN4 C;  4BBS B;  2B8F A;  4O42 A;  2ENB A;  5IGD A;  2NYZ D;  1I4P A;  5I6W A;  4KKT A;  3VR5 A;  4YIJ A;  4OO1 H;  5FK9 C;  5K36 H;  2RDG A;  1HCZ A;  3BVM A;  1U4P A;  2J4X A;  1C4Q A;  4FXG C;  1KDA A;  2B2W C;  3D8G A;  2D9U A;  2KJX A;  1SEB D;  3QWN A;  3R2I A;  3RMH A;  1I4Q A;  2DY8 A;  2E2I B;  1HHV A;  4FF1 A;  1PLF A;  1JQY D;  1JIC A;  5JPN C;  5JEA J;  3NTK A;  3S9W A;  3TME A;  1SDF A;  3PIO 3;  2K5Q A;  1IW7 C;  4KY5 A;  1LTA D;  1DOL A;  1G2T A;  1ESR A;  4H44 C;  3C2P A;  4IZ8 A;  1TQO A;  4A93 B;  4NMZ A;  4DNT B;  3VR2 A;  1B4O A;  1DYQ A;  1SMY C;  2F0D A;  3HOW B;  1SNO A;  1A3T A;  4BY7 B;  4FP5 D;  1PMR A;  2BA1 A;  3Q23 A;  1DOM A;  2CHB D;  4ILW A;  5CV4 A;  4TSS A;  1EYA A;  2YU9 B;  2XWB B;  2JSO A;  4BA1 I;  1JCK B;  3GTJ B;  3MEH A;  1FYC A;  2K03 A;  1DD2 A;  2Z4I A;  5IOC A;  1TU2 B;  4PMW A;  2G9D A;  4OIJ A;  4HTH A;  2JP1 A;  2DY7 A;  2RVL A;  1RF2 D;  3V96 A;  1MBY A;  4K5W A;  3KLS X;  3PUZ A;  5FLX L;  1PFM A;  3URY A;  2H1E A;  3R2T A;  1D5X C;  2CVR A;  2D62 A;  1HTP A;  1L0Y B;  2M00 A;  4CHT B;  4M8A A;  1D5Z C;  2E75 C;  1Y1W B;  3A8K E;  1JR0 D;  1EWC A;  4CKE A;  1CTM A;  4A3F B;  5J1Z A;  1JOK A;  2R3Z A;  3HOX B;  1TII D;  2X6G A;  2Q8R E;  1KDB A;  1EIG A;  3AB9 A;  4XQJ A;  3S14 B;  1H9K A;  2XRQ D;  1EZ8 A;  4R8N A;  3RZD B;  5DM7 3;  1HQR D;  2AQ2 B;  1KNE A;  3ND9 A;  1H9M A;  5G3L D;  2RBM A;  1SJH D;  4RCN A;  1PYW D;  3CKI B;  1STE A;  2BOS A;  4IUT A;  3M7G A;  1SYG A;  2Q8T A;  1CZG A;  5EKI A;  2EZV A;  1K83 B;  4FVM A;  5EKK A;  5C5L A;  2PZW A;  2B2V C;  1ML0 D;  1Z6H A;  3EQL C;  1EY4 A;  4X3K A;  2WII B;  3BDC A;  3D3R A;  5C4H A;  4DN4 M;  1EYD A;  1S5B D;  2K7V A;  1TWG B;  3I72 A;  3BZD B;  3Q24 A;  5EPK A;  1NSN S;  3OMC A;  4ULL A;  3WDN A;  2EVB A;  3I3C A;  2RDH A;  1G91 A;  2EY5 A;  1TS3 A;  2PMZ B;  2F0O A;  1MI2 A;  2HCC A;  1MGS A;  3K5O A;  3BDL A;  1MSH A;  1ZKO A;  1YNN D;  1TVX A;  4LK1 C;  2VB3 X;  1WTX A;  4DK1 A;  3HRZ C;  4G57 A;  1LV9 A;  3DXJ C;  4C1N I;  2Y0S B;  5IT9 E;  1VF7 A;  3A56 A;  3GP7 A;  4CJ2 C;  3BS1 A;  2F1M A;  2NWG A;  1PTO B;  3D6W A;  4J6H A;  4N9T A;  1OO9 B;  1QOH A;  1PZJ D;  4K2L A;  2AWN A;  3EVQ A;  2PQE A;  5D3D A;  5IOD A;  3A55 A;  2B2W A;  3GQB A;  4FF3 A;  1A3V A;  3K6O A;  4IUQ A;  1EY8 A;  3VYR A;  3LWE A;  2EYF A;  2WKC A;  2QEJ C;  2KVM A;  2DN8 A;  1B44 D;  5E4W C;  3AMU A;  1S5D D;  2WKD A;  4KJN A;  3QG1 A;  4C3I B;  2L4N A;  1WTO A;  4KD4 A;  3FRP B;  2R93 B;  1S4Z A;  3GTM B;  1D5M C;  2XSC A;  1G6Z A;  2RSN A;  3E6Z X;  1MD2 D;  1R9T B;  3DUZ A;  5D65 A;  1DZ1 A;  1AZQ A;  1GUO A;  4B9X A;  4RFB A;  1XTC D;  2KCN A;  5EGT A;  2EJM A;  1EY7 A;  4QF4 A;  1EIH A;  2Q8I B;  2SOB A;  1TY0 A;  1RKN A;  3PUX A;  1ET6 A;  1SNM A;  2O5J C;  1JWS D;  1I4R A;  3ONA B;  1F2M A;  3TBI B;  4QUC A;  4RGO S;  1Y8O B;  4C3H G;  5M3M B;  5F2D A;  1SND A;  5E3F A;  1JWU D;  3DWP A;  3OIP A;  2EE1 A;  3E0J A;  1OXV A;  2LFN A;  1MSG A;  1WCM B;  4G4K A;  1EQV A;  3FPP A;  3HZX A;  3KBG A;  2HCI A;  1JOO A;  1AZP A;  3TN2 A;  2O4X A;  2IX1 A;  1TWA B;  5M3F B;  5KNB A;  3L3O C;  1TS4 A;  1IKM A;  4HSV A;  2OXP A;  2L11 A;  1WTV A;  2I46 A;  3Q6S A;  5CMD A;  3K5N A;  2JA6 B;  3DEO A;  1ONL A;  2K33 A;  1B1Z A;  4ZQ3 A;  1LT3 D;  5M5Y B;  5ELB A;  2AQ3 B;  4C3J B;  4CGY B;  3MHB A;  4A3M B;  1Q8I A;  4G7Z C;  3S16 B;  2I07 B;  1II3 A;  3NP8 A;  2EYM A;  1BCP C;  1I4H A;  3R93 A;  2EY2 A;  1HXY D;  4K6L A;  1A15 A;  3P75 A;  3PO2 B;  1K8M A;  4ZKB B;  3ZYY X;  3QO2 A;  2NTS A;  1F2L A;  3Q22 A;  5JJZ A;  3T56 B;  2Z1C A;  2K6A A;  5J22 A;  2QIL A;  2B2V A;  1O80 A;  1JOR A;  3QOJ A;  3GV3 A;  1EQT A;  1IKL A;  2RSO A;  1Y8N B;  2FJ2 A;  4IUV A;  4WOR A;  3R3O A;  4ODG A;  1EY6 A;  2ID0 A;  4LMQ D;  2KEC A;  5M5X B;  2L55 A;  1AFP A;  4ZK9 B;  3MAQ A;  1XYI A;  4XQN A;  1OXS C;  3D6C A;  4DFA A;  2F0T A;  1TY2 A;  2XIW A;  5DNF A;  1ILP A;  3LX0 A;  1DCZ A;  5M5W B;  1G2S A;  1I6H B;  1IW7 D;  3ERQ A;  3HG9 A;  2F3V A;  2JEB I;  3OWE B;  1SMY D;  2EYP A;  4NKL A;  2XRS D;  4DA2 A;  1EWH A;  3GV6 A;  1QG7 A;  3HEJ A;  1FR3 A;  5LHY 1;  4QMG A;  2N88 A;  5FO8 B;  3S1R B;  1LLR D;  3PUW A;  4DAY A;  2K28 A;  2JA8 B;  4Q5V A;  2E2D C;  4V0B A;  3K0Y A;  3Q0A A;  1F2Y A;  1SE2 A;  2MGS A;  3M4O B;  4KI0 A;  3DEP A;  1BQQ T;  2F0I A;  2X69 A;  3CRL C;  1RD9 D;  4RHS A;  4ZYS A;  2F0U A;  3I70 A;  2IW3 A;  1DOK A;  3PUY A;  2MPM A;  3SXH A;  5CV6 A;  2E2H B;  4PMC A;  1PXU A;  3S1M B;  1GXD C;  1H9J A;  1C8C A;  1PTO H;  1GHK A;  3I4N B;  3IFD A;  2IWH A;  2A6H C;  1NUC A;  3CRK C;  4HN7 A;  4RGM A;  3GTP B;  4M1U B;  2LS0 1;  4C1N K;  5A2Q L;  1TS2 A;  2XWJ B;  4F8M A;  1H9S A;  3GTQ B;  1ILQ A;  1WTP A;  1PRT C;  5C0X I;  1F77 A;  5BN3 A;  3NQT A;  1QNU A;  4K8J A;  1ENF A;  3MC0 B;  3M3Y B;  4FO2 A;  4K14 A;  1GUW A;  1A3U A;  5IGG A;  5I6Y A;  3H6M A;  1LTS D;  3A54 A;  2B2U C;  4IFD I;  1V1P B;  4QCL A;  1K8O A;  1KAB A;  1O78 A;  4DNR B;  4UAI A;  1A6X A;  1S5F D;  1W6J A;  2EJF C;  4RGT A;  2A5H A;  1Y1V B;  5EPJ A;  3T16 A;  1EL0 A;  2F4I A;  1UAP A;  1RCV D;  3X3N A;  5C0X H;  2D2C C;  3A7A B;  4KN7 C;  4ZUI A;  2KED A;  4OO1 G;  5K36 G;  4B08 A;  1ZEQ X;  2VXW A;  3DMU A;  1ET9 A;  3D31 A;  2WIN B;  2FFK B;  3GD7 A;  1B9N A;  4FYD A;  3CU7 A;  5KYI A;  2NZ1 D;  4IFD H;  4R8I A;  2IX0 A;  1FGB D;  2F0S A;  3SK5 A;  3J81 E;  1LTB D;  1HFN A;  2ZXR A;  1SYB A;  4PV1 C;  5NUC A;  1ICW A;  4A3K B;  4BY1 B;  2SNM A;  5ELC A;  3RD4 A;  3MVV A;  3J80 L;  2NVQ B;  5CV7 A;  5EBC A;  2WAQ B;  3G6J B;  2MJ8 A;  1ROD A;  4C3I G;  1BCP F;  3MXU A;  5JEA H;  1SYC A;  4FF4 A;  1E2W A;  1I50 B;  2MUY A;  1SYE A;  2KUM A;  2J7Z A;  4DAV A;  2ZT9 C;  3HOV B;  1EZ6 A;  4DK0 A;  2PCF B;  3S17 B;  5CYU A;  3SR1 A;  3GTO B;  4RKB A;  3W3A A;  1ENC A;  1JE4 A;  1U4L A;  4HR7 B;  2KA7 A;  1M8A A;  3H91 A;  3C46 A;  1LAC A;  3VA5 A;  1RHP A;  3P1H A;  3S1Q B;  3S2D B;  2AUK A;  3SDZ A;  1CM9 A;  1VF5 C;  4MIU A;  3A8J E;  2M9V A;  2E74 C;  1IL8 A;  4IUU A;  4H7B A;  3V05 A;  4IFD G;  4PNY A;  3LNN A;  1I6V C;  1SNP A;  4DAP A;  1RTN A;  2NN6 I;  1TWH B;  3N6R A;  4IUN A;  5EBD A;  5JAV A;  3QJY A;  3NQI A;  1BO0 A;  1I4G A;  3T13 A;  1XX8 A;  2E2J B;  4ZAI A;  4KTA A;  3FMC A;  1AEX A;  2F0J A;  1GUG A;  3T51 B;  3H0G B;  1Q1E A;  2RA4 A;  4ZRZ A;  1HA5 A;  4KHZ A;  1Y69 U;  2QCP X;  2JE6 I;  1Q90 A;  4IAL A;  1E2Z A;  2TSS A;  2FHT A;  3NSW A;  3EJI A;  2OF1 A;  3W2D A;  1JC7 A;  3VR6 A;  4RH6 A;  1CQF A;  1T5E A;  3NPP A;  3VA7 A;  4A3G B;  2F0W A;  1LT4 D;  4XYO A;  2NN6 H;  1KAA A;  1BUV T;  2NUC A;  1HPC A;  4RCO A;  5KNC A;  1TWF B;  4PQX A;  3JAM L;  2A68 C;  4DXF A;  5J39 A;  5C5M A;  4G7H C;  1PRT F;  4OGQ C;  5CV8 A;  4QB4 A;  2NB0 A;  1GHJ A;  2RDF A;  2BDN A;  3VYS A;  4ID6 A;  5IT9 L;  4X3S A;  4XXE A;  3E5S A;  1G29 1;  2KEE A;  5I2X A;  1BXT A;  2IJ0 A;  2A74 C;  5C4Z A;  2EYJ A;  4F87 A;  4HED A;  1PZI D;  3H09 A;  3I73 A;  1DJR D;  5I9P A;  1F9Q A;  3WOE A;  1OXX K;  3FEW X;  1ZYR C;  1LTT D;  1R4Q B;  1V8Q A;  3IL8 A;  2B2U A;  4XT3 B;  3KK7 A;  3CQZ B;  2WAC A;  1F9R A;  1SAP A;  1X3P A;  2X6L A;  2ICE C;  4V19 0;  1BOS A;  1KLG D;  4HMJ A;  3BVZ A;  1TS5 A;  5BN5 A;  1BCP D;  4TRD A;  1STA A;  4A3I B;  5E1F A;  1E2V A;  4LJZ C;  4TQU S;  2YYZ A;  1NR2 A;  3MTS A;  1Z7T A;  4B9W A;  1AN8 A;  4CBV A;  1B3A A;  4BS9 A;  4PMB A;  2NN6 G;  2F0E A;  3U9S A;  2PW5 A;  3QB3 A;  4J1M A;  3OOC A;  3WOF A;  1QIL A;  3BG3 A;  1FD7 D;  3FDT A;  2F0M A;  4RWS C;  3HGB A;  4NDX A;  4RAU C;  1FNW A;  4ME5 A;  3EFX D;  5FOB B;  2L5T A;  1X3Q A;  2EOT A;  1NR4 A;  2EJG C;  3MFY A;  1SNQ A;  2FMM A;  2BDO A;  3M4Y A;  1KLU D;  4FF2 A;  2K5D A;  2N55 A;  1A2U A;  2TMP A;  4WRD A;  2A69 C;  2K1B A;  4A3D B;  4ABN A;  2L9H A;  1STY A;  4FXK C;  3QIA A;  4KMU C;  5HUR A;  3OSO A;  2PZU A;  1PFB A;  3V2T A;  5KND A;  1EEI D;  4EQP A;  5T1G A;  2SNS A;  2L12 A;  1CA5 A;  3IAY A;  2B63 B;  2KHS A;  2L0C A;  3SK8 A;  4XDX A;  5JPM C;  1CHQ D;  3OPO A;  1LTG D;  1HQM C;  2HQE A;  3K57 A;  2NBF A;  1U4M A;  5ELF A;  3SVM A;  4JBW A;  2EYL A;  2KOL A;  1BR9 A;  3HOY B;  1D1I A;  2EYO A;  2HDM A;  1KDC A;  3J7A F;  4NP5 A;  2PPB C;  2K01 A;  3P7J A;  4XIG S;  2A6H D;  3N52 A;  4IUR A;  1WD1 A;  4XT1 B;  3RUZ A;  1WTW A;  3MXP A;  1EEF D;  4A3E B;  1PRT D;  1STN A;  3L7Z C;  1CHP D;  5FO7 B;  1H9R A;  1PTO C;  2KQ3 A;  1RTO A;  4KHV A;  3C3L A;  3T4A C;  4RGN A;  1HRJ A;  3ERO A;  1RDP D;  1J9O A;  5CBE E;  1NAP A;  4G7O C;  1PDQ A;  4Z9C B;  1TT2 A;  2QDB A;  1SFO B;  2R7Z B;  4OIK A;  2CW0 C;  4BA2 I;  5C4X B;  1OXU A;  2F0H A;  4CJ0 B;  1SXT A;  2M2L A;  1RJT A;  1UNS A;  1AP0 A;  3NTI A;  5G3L F;  5C4J B;  2B2Y C;  2R6G A;  4RA8 A;  1QCB D;  3AU7 A;  3TP7 A;  5C3E B;  5KIX A;  4F88 A;  1HUN A;  1V1P A;  1IHZ A;  5D14 A;  2BE5 C;  3RLF A;  3X3M A;  4DF7 A;  4X3U A;  2K05 A;  4HAE A;  3NHH A;  5A2Q E;  3NE5 B;  3DHQ A;  2F0L A;  3HOU B;  3KUP A;  3DWQ A;  5I4D A;  1HUM A;  5D3I B;  2A6E C;  3NBI A;  5ISR A;  4Y7N B;  4IFD J;  1CZW A;  2IX3 A;  4K5V A;  3GTL B;  1STG A;  3KBX A;  3D4W A;  1EFI D;  1S5E D;  3RZO B;  3VR3 A;  1G8Z D;  5IIF A;  1HFG A;  1DXM A;  3BVG A;  1GOZ A;  3HP3 A;  4N9P A;  4IUP A;  2AWO A;  1BBX C;  5K5P A;  3F2U A;  3SE0 A;  4R9W A;  2FIN B;  1SE4 A;  3VYT A;  4RHR A;  1STB A;  1WTQ A;  4DXG A;  4K6D A;  1STH A;  1TWC B;  5KYL A;  4NW2 A;  1WTR A;  1IYV A;  3I90 A;  1D1K A;  3TZD A;  4J8Q A;  3S15 B;  2O5I C;  4L63 B;  2WP8 J;  1VMP A;  3BDO A;  4OHJ A;  1UEA B;  3D4D A;  4KKU A;  5TSS A;  5DAU A;  3GO5 A;  1EY9 A;  5IGF A;  2B2T C;  4Q0F A;  4ZLT F;  1YNJ C;  2AQ1 B;  4H13 C;  3MWY W;  2JA5 B;  3OIQ A;  5CGK A;  2IL8 A;  1SYF A;  4BBR B;  1H9S B;  5FLX E;  4FXD A;  1E0B A;  4L8J A;  1B9M A;  4IQZ A;  1DON A;  4HMI A;  3OMG A;  3J80 E;  4U68 A;  4L6T B;  4RKL A;  4GZY C;  3K5M A;  4C56 C;  1U9R A;  3FPU B;  1CFM A;  2H4O A;  4EQO A;  3TSS A;  2RQX A;  1HTL D;  4S3S A;  1ENA A;  3NWT A;  3R8B A;  5EJW A;  4EGV A;  4E6I A;  1GUS A;  2C9O A;  1HA6 A;  2JEA I;  4K8I A;  4KY6 A;  1LAB A;  3M7N A;  2F0P A;  2NVT B;  2E76 C;  2EY6 A;  3J81 L;  3IKJ A;  5C3X A;  1XXG A;  2V4D A;  3I91 A;  3M85 A;  3IFT A;  5HGT A;  2F0V A;  1Q12 A;  4KY7 A;  3I8Z A;  5E4X A;  5CC4 A;  4HCE A;  1TR5 A;  4XTC S;  2PNR C;  1SJE D;  4K2K A;  5C0X G;  2HUG A;  1J8I A;  5DM6 3;  2A68 D;  3BYT B;  1JWM D;  4LAA A;  4QUF A;  5EPL A;  2R61 A;  5EKL A;  4O1N A;  4UDU C;  1PTO F;  3MXN A;  1KTK A;  3P20 A;  2SEB D;  3MZ5 A;  4WFN 3;  1R4P B;  1QJO A;  1XWE A;  2LY7 A;  2O2L D;  1Y8P B;  3OWF A;  2EY1 A;  3J7Y W;  4JK1 C;  4KK7 A;  3MFG A;  1ZYR D;  1D6E C;  2Z8L A;  1BCP B;  1S5C D;  2K04 A;  1EU4 A;  3H3V C;  5COY A;  2KCC A;  3L9A X;  1D2B A;  3SK4 A;  1FNV A;  4WJW A;  1SNC A;  2WB1 B;  2QKI C;  1F9P A;  5AFW A;  5JEA G;  3MXG A;  2F0F A;  2OT2 A;  4DGZ A;  2ZXO A;  3NBH A;  3TP5 A;  3SK6 A;  5IGC A;  1SSO A;  5FO9 B;  4HCS A;  1SE3 A;  2GA4 B;  2B2Y A;  3G7L A;  1B50 A;  3CHB D;  1C48 A;  5IGB A;  1O7Z A;  4C3J G;  3JAM E;  4KJO A;  2NVX B;  4MHE A;  1A2T A;  2DNC A;  2BCO A;  2SDF A;  2JYO A;  3I4M B;  4CKC A;  2C5C A;  4AYB B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...