2RBMA

Crystal structure of staphylococcal nuclease variant delta+phs i72k at cryogenic temperature
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
130
structure length
130
Chain Sequence
KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKKEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS I72K at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 36
structure length 130
sequence length 130
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2007-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2rbmA00
4MIUA 4S3SA 1SYFA 2F0QA 2EY2A 3EJIA 4J1MA 1EZ8A 4KY7A 3DMUA 4EVOA 4OL7A 1SYEA 5NUCA 5I6WA 5C3XA 2F0IA 3TMEA 1EY6A 2PW7A 1EY9A 1A2TA 5CV8A 3S9WA 4KHVA 3NP8A 2F0LA 4PMCA 5CGKA 4G57A 5CV4A 5HURA 1JOQA 3SXHA 4I65A 1EYAA 4WRDA 3SHLA 4K2KA 1EY8A 3TP8A 4F7XA 2F0FA 2PYKA 4H7BA 3EVQA 5DAUA 3SK8A 3MVVA 2SNMA 2OXPA 3R3OA 3OWFA 5IGCA 2WACA 4N9TA 4HTHA 5C3WA 5IGFA 1STGA 2F0NA 5DEHA 3QB3A 5IGEA 2PQEA 5CV6A 1KDCA 3ITPA 1KAAA 3MHBA 5E3FA 5I6YA 5KGUA 2EYMA 5C6AA 4KV6A 2F0PA 5IIFA 2EY5A 5KYLA 5J39A 4KTAA 2OEOA 5F2DA 2F0MA 2F0VA 1EY0A 2EYFA 3OMCA 4ZQ3A 4F8MA 2KQ3A 1ENCA 3HEJA 4KY5A 1STHA 4K2LA 4RKLA 4K8IA 5KEEA 5KRUA 5J22A 4EQPA 2EYOA 2F0UA 2F0JA 4K5WA 4YIJA 4ZUIA 5J1ZA 5C5MA 3TP5A 3QOLA 1KABA 4IALA 2F0OA 4K14A 3MZ5A 4KD3A 4KY6A 1STAA 4TRDA 2RKSA 4EQOA 4K6DA 3NUCA 4IZ8A 3SK5A 2PW5A 3U9OA 1SNQA 2F3WA 2F0KA 4EQNA 4IUNA 4ODGA 4WORA 1SYBA 5KYIA 1EYDA 5EGTA 1EQVA 3E5SA 3EROA 1KDAA 1JOOA 4KJOA 5IGDA 1SYCA 1NSNS 1AEXA 2QDBA 3P1HA 4R8NA 4NKLA 2F0HA 1SYDA 1SYGA 5EKLA 5M9OA 2O4XA 3TP6A 4PNYA 3QOJA 5E1FA 3SK6A 3MXPA 1EZ6A 2F0WA 4NMZA 2OF1A 3C1EA 2F0GA 2F0SA 4HMJA 5CC4A 3DHQA 1A3UA 3P75A 3ERQA 2LKVA 3H6MA 1TQOA 1TR5A 5JOBA 5C4HA 4B9XA 1EYCA 1II3A 3C1FA 3NK9A 2EYLA 5EKKA 4ID6A 4NP5A 1U9RA 2EY6A 3PMFA 2NUCA 3MEHA 1ENAA 1SNOA 1F2YA 2F3VA 4K5VA 4RKBA 5IOCA 4QMGA 3D4DA 2F0EA 5CR3A 1TT2A 1SNMA 3LX0A 1A2UA 4QF4A 1F2ZA 5CV9A 4ZUJA 1A3VA 1EY4A 2EYJA 3TP7A 3SR1A 1NUCA 2EYPA 1JOKA 4N9PA 4B9WA 4KD4A 2ENBA 2EY1A 4DGZA 5HGTA 5I9PA 2KHSA 4KJNA 2PZTA 2EYHA 4LAAA 3NXWA 5C5LA 3D8GA 3NHHA 4DF7A 5KIXA 3HZXA 2EXZA 1RKNA 3D4WA 3T13A 2SOBA 5C4ZA 1JORA 1EY7A 2F0DA 5I9OA 5IGBA 4DU9A 3BDLA 4K5XA 4J6HA 4HMIA 2SNSA 3SK4A 1STBA 1STNA 2PZWA 3RUZA 5K5PA 2RBMA 1SNCA 5CV7A 3NQTA 4PMBA 2M00A 1SNPA 4E6IA 3OSOA 1EY5A 5IGGA 3OMGA 5JAVA 5ISRA 3D6CA 2HQEA 4K8JA 2F0TA 3BDCA 1KDBA 3VA5A 3V2TA 2RDFA 1A3TA 4NDXA 4DFAA 2PZUA 5IODA 1STYA 5CV5A 4ME5A 3T16A 1IHZA 4QB4A 1SNDA 1F2MA
chains in the Genus database with same CATH superfamily
2BDNA 4DN4M 2OWOA 4KKUA 4OWXB 1Q81C 3EQLC 1G291 1U4MA 1SBBB 1JR0D 2VQEQ 4NPSA 2RDHA 1X65A 3OW7A 3E3XA 5CV4A 3RZOH 2BDOA 3OTOQ 2E2HB 4FXGC 3RR5A 4QUFA 2NVQB 3HOUH 4DAMA 3GTGB 3T1YQ 1IW7C 2WAQG 1RJTA 4IPHA 3DLLA 2H1EA 1CHQD 2OTLA 2PQAB 1KL9A 5C6AA 5IIFA 1KC8C 2EY5A 2K6AA 3QJYA 3J81E 2F0VA 1H9SA 1PH1A 1ENCA 4DV3L 1J6QA 3D31A 1SMYC 4C1NK 3I3CA 4KD3A 4ZQ3A 2RCNA 3U9SA 2B2UC 5IP9H 1ILPA 2PI2E 2C9OA 3N52A 1EYDA 1DOKA 1ZEQX 3M4OB 4DV4Q 1EQQA 5C3EG 4LK1C 1WTXA 2D2CC 2F0HA 4LF6Q 1SYDA 3MAQA 2B39A 3KDFB 4PNYA 4DNIA 1EZ6A 3H09A 4X3UA 1EQRA 1C0AA 2F0SA 2KOLA 3K6OA 2K33A 4R4CA 1A62A 1WVLA 4FP5D 1HZCA 2NVYB 3HOYB 4ILWA 2R7ZH 5LMNQ 1O7IA 3PO2G 2R92B 5IOCA 1TWAB 1YIJA 4POGA 1SNMA 1CQFA 2E74C 1FGBD 4X3KA 1NBWA 3A8JE 2XRQD 2BCOA 4O42A 4N9PA 4CKBA 1HRJA 1UNSA 1GM5A 2F52A 3I56A 2EXZA 2D5DA 3NWSA 5DLQE 1HXYD 3U4VA 3FDTA 3AFQA 1BBXC 4NXMQ 5FLXE 1LYLA 3VYUA 1KRSA 3I72A 4A3EB 3TBIB 2E2IB 1N34L 2AHOB 2ID0A 2R93H 1WCMB 4L5TA 5G3LF 1CT1D 2A74C 5A2QL 4MZ9A 3PUVA 2ICEC 3PUYA 3VR5A 5GADC 4QY7A 2EE1A 3KOJA 3UE1A 2IX1A 4ZRZA 5C3XA 4IOAA 3GTOH 3W3AA 4J8QA 2XIWA 5CV8A 3TRZA 1I50B 1KXLA 1SMXA 2JQOA 4LMQD 1GUWA 3S1RH 2YYZA 4A3CH 3DWPA 1ESFA 1PH2A 4P71A 4GLAC 4OO1I 1YHAA 5C4JH 2HT1A 4IUVA 2F0PA 4OXPA 2G9HD 5IYBH 2OQ0A 3JAME 5FJ8H 4AH6A 2KQ3A 5KEEA 3S1NH 3D3RA 3P7JA 4F8MA 1KABA 3NEMA 1SLJA 5LMNW 2BH2A 2IW3A 4IUNA 1SJED 3PUZA 3G48A 5ELOA 4LF4L 2AUKA 3A5ZB 3VR6A 4R8NA 3J7ZC 3J7AV 4FVMA 1IYUA 1VCIA 5EPLA 2X69A 3V05A 1XPUA 4CGYB 1OXTA 3SK6A 4F87A 4X6AH 3CCJA 3BYTB 4A3GB 2OF1A 1TU2B 3S2HH 3VDYA 5M3FG 1W2BA 3GTLB 4JYAQ 2BOSA 2MHVA 2RCFA 1LUZA 4MHEA 3GD7A 3KLRA 1ENAA 2EIFA 1LT3D 4DR4L 4MTNA 4IJHA 4A3JB 4O0AA 3ONAB 1AH9A 2Y0SG 5M5WB 3NHHA 4CDDC 2ASBA 4QIWB 1BBWA 4PZ8A 2IPKD 4X3SA 1PZKD 2N78A 2RBMA 1H9RA 1WTPA 4GOPA 4HAEA 2Z6KC 1IYVA 5GAGC 4UP8A 1SROA 4JBMA 3S14B 5CV5A 4IUQA 1H9KA 2M2LA 2F0QA 3EJIA 3TZDA 4A3LH 4GN3B 4DAPA 3J81L 4G7OC 2WB1G 2K03A 3GTPB 1DYQA 3HOVH 1A2TA 3CW2C 1GVPA 1L0YB 4KK7A 4POFA 1ILQA 5IE8A 1IBKQ 1QOHA 3QG1A 3DUZA 1IZ6A 1Q46A 3NELA 4DV1Q 2K5VA 2PQEA 1Z47A 1YJWA 1QNUA 3J7A5 3VA7A 1MBYA 2MO0A 5KYLA 3K5NA 1GXDC 4R1JA 1B2TA 3HG9A 1JC7A 1G91A 3C46A 2K5QA 2EVBA 2JA8B 4A3MG 2M9VA 3HOZB 5J1ZA 5C5MA 2J4XA 3TEHB 2AQ1B 4KN4C 3DWQA 4L8JA 1SE8A 3CHBD 4A3KG 3VYRA 1QNKA 1N36L 3I2ZA 4MN3A 3S1MH 4BY1B 2K04A 3RLFA 3TREA 2AMCB 1GUTA 4DV7L 1T5EA 4H02A 2FXQA 3KJPA 1PZID 3WOFA 1FL0A 2RDGA 2L5TA 2NTTA 1PFMA 4I7AA 4RA8A 5C44B 4DXFA 5CC4A 5FLXL 1CKMA 1G8ZD 1TR5A 3V96A 3KYHC 3LWUA 1F9PA 3STBD 4F88A 4QGUA 4PQXA 4DR7Q 1PZJD 1EYGA 4KHPL 1AE3A 3S16B 2KUMA 3L2PA 3T1HL 2ALYB 1JOKA 5I9PA 2QILA 2KHJA 2Q2IA 2UUAL 2VS1A 4KJNA 4DF7A 1E24A 4H13C 5IYCH 4UP9A 1RKNA 3D4WA 3KJOA 2XSCA 3A7LA 3KF8A 4DA2A 3F1ZA 4JI8Q 4HSVA 2B8FA 1UEAB 1PYBA 1VF5C 3WWVA 1Q7YC 4OEMB 4Y52H 4E6IA 3GTKB 3G6JB 5JVG3 3W2DA 2R7DA 5E4WC 2Z8LA 1V1PA 4B3ML 2VQFL 2E76C 2QA4A 3CU7A 3BS1A 4KY7A 1D7QA 2CWAA 3LWEA 3JAML 4OIJA 4GZYC 3FKIG 1NAPA 1SDFA 3OPOA 5M5YH 4JI0Q 4R4QA 1MHWC 4J15A 3HOXB 1U4LA 1J9OA 1JE4A 1J5EL 3T1HQ 3OWFA 2FMMA 3CPFA 2A19A 5I2XA 1RDPD 4DV5L 2F0NA 2F4VL 3QB3A 4LF5L 1VQ6A 4OO1G 2Q2HA 1BCPD 1HHVA 1VQOA 2UXDL 4C1NI 1A63A 1CZGA 1CA6A 1B1ZA 1XMQL 1K8GA 5ELCA 4DAYA 3KBGA 5M3FH 3OMCA 2CFMA 3OOCA 2A6ED 3PCOB 4OONA 1HPCA 1E2VA 5IT9E 2DJFC 4DU9A 4KY6A 3VR2A 2VUMB 2GN5A 3PSIA 3CXCA 4KN7C 5JPMC 1EQVA 1EEFD 2FINB 5C4XB 3J80i 2SDFA 3EFXD 3P1HA 2K28A 2N49A 4JCVE 4FDBA 4K0KQ 4JI4Q 1TWCB 1BNZA 3TP6A 2WKDA 5CORA 2BE5D 3MXPA 2YV5A 5CYUA 2E8GA 1OXXK 2PNHA 1MIUA 5FLXc 1K0SA 4QIWE 3A8IE 1CM9A 3PUWA 4LF7L 4B3TQ 4IUUA 3C1FA 1E2ZA 1H9SB 2NB0A 4ID6A 4IJLA 4LF5Q 1GHJA 4FYDA 2NZ1D 4JG2A 2KCCA 1EFWA 1LLRD 1DCZA 5JJIA 2EQSA 1E1TA 2VW9A 4A3IG 4YCVA 2ZT9C 2XWJB 5IYDH 1AN8A 4KD4A 4R8IA 3AB9A 2AQ2B 4BWGB 4X65L 1XYIA 4OIKA 2WV6D 2K75A 1E2WA 3K7AH 3BVZA 4BXXG 4K5XA 2UUBL 3RUZA 4R9WA 3K80C 3CCSA 1VDZA 1AZQA 3PO3G 1FGUA 1O7YA 1F2LA 1L2FA 2QCPX 5EAYA 1I6HB 1KNAA 1I3QB 1RTOA 1E22A 2F03A 1IL8A 4DR5L 2HCCA 1F2MA 1X54A 2KCNA 2K5DA 3SXHA 3STBC 3I4NG 2CQOA 1N9WA 4A3MH 3MTSA 4UDUC 2B63B 4LF8L 4LF7Q 2NVTH 2DN8A 1F77A 3TMEA 4ZK9B 1EY9A 3BVMA 3UDXA 5GAHC 4A3KH 1HR0L 4RH6A 1DZ1A 1EYAA 4TSSA 4DV2L 1I94Q 1M4VA 3CRLC 4AQYQ 1VQ5A 2CH4W 2Q8TA 4YCUA 1A8VA 1P8LA 2A1AA 1RHPA 4KLKA 1VQ8A 2Z0SA 4X65Q 2X6LA 4OHJA 1TWFB 2LY7A 2B2TC 4JK1C 4KV6A 2JA6G 4OWTB 2UUBQ 3HEJA 4LFBL 1JMCA 4B3SQ 1I4PA 1XJVA 4C3HB 3I70A 4G4KA 1FD7D 4ZLTF 4R4TA 5M3MB 3F2UA 1SYBA 1Y1WB 2LXKA 4A3DB 1H9JA 2RVLA 4DR5Q 4RCNA 4KJOA 4KMUC 3MXNB 3L3OC 3SVMA 1S5BD 1X32A 2B2YC 3PV0A 2R7FA 1KRTA 5JEAH 4DK0A 1HNWL 5IP7G 5HGQA 5FOBB 1KNEA 3I4MH 2NN6G 2Q2UA 1JQYD 2B2WA 4L6TB 1ONLA 4DR3Q 1HR0Q 1S5ED 1LACA 3MFGA 4B08A 4PG3A 5BN5A 4I7ZC 5E7NA 2E5LL 1R9TH 3H0GB 2EOTA 1SNOA 1PFSA 2A6EC 2HHHL 4DR6L 4LFAL 1GUSA 5DM63 4X62L 2ZJQA 3SDZA 1WTOA 3I7FA 3FKIH 2K5HA 1AW7A 1QVGA 1Q8IA 4LFCL 1TS2A 3Q6SA 4NB3A 2EPBA 5IGBA 1HUNA 1N32Q 1CI3M 3GDEA 4DXGA 5C0XI 4IFDH 4HR7B 3MC0B 4FF2A 5CV7A 3HOUB 5M5XH 3CCLA 4L5SA 5IGGA 1YNJD 4L63B 1D1IA 2UXCQ 2MJ8A 1G6PA 3HOYG 1EIGA 3H3VC 2R92G 1B70B 2KHIA 4MIUA 4S3SA 1UE7A 5EJWA 3J81i 4EVOA 4X64Q 1XMOL 3H94A 2I5HA 3UDIA 1X3GA 4DV0Q 1B53A 2K32A 5IT9L 3S9WA 4PMCA 3M3YH 1OTCA 2DUDA 3BJUA 3SHLA 4RFBA 2OT2A 2HHHQ 2PYKA 1RODA 4LFAQ 3BU2A 2L55A 4GN4B 4X62Q 3HOWB 4LUVA 2OXPA 4C3IH 2OTJA 1STGA 1HUMA 4A3EG 2QEJC 1EIHA 5E3FA 4GOPB 1WCMG 2JA5B 1HZAA 2OEOA 3W1GA 1HR0W 1VQCA 2ZJRA 3VYSA 1VQ4A 1STAA 3RNUA 3WDNA 1Q90A 2IT1A 5GROA 2L12A 3J81j 3A55A 1X6OA 4A3IH 4CDCC 1ZKOA 1FJGL 3GTQH 1TIID 1AEXA 3I4LA 2L9HA 3H91A 5EKLA 3DM3A 4BXXH 2F0WA 2WKCA 4NMZA 1WTWA 2CVRA 1BR9A 4WJ4A 3FVQA 3PO3H 1M90C 1PA6A 1S5FD 5EKKA 2I07B 4NP5A 4A3BG 2NVXH 2PNRC 4GNXA 1F2YA 4RKBA 1K9MC 5CR3A 1VQIA 2YU9H 1ICWA 2D0OA 1PMRA 1F2ZA 1Y8OB 5ELFA 5FO8B 1PFBA 3J80L 5HGTA 3DEPA 1WD0A 3A54A 1WFQA 2N88A 3BDLA 3S1QH 1EWCA 4A3GG 1KQSA 2ZXOA 2ZXPA 3S1RB 4PMBA 3M4YA 1SNPA 4GKJL 4JI1L 1BBUA 4LUZA 1PHJA 1S4ZA 5C4JB 3X3NA 3ND9A 4NDXA 4QUCA 3EN2A 4H44C 1CK1A 1W3SA 2JA6H 5DAUA 2L11A 2EY2A 3JAMi 1Z9FA 4DV3Q 4A3JG 2CWPA 5H1SE 3S1NB 5IT9c 1U0LA 2HDLA 1ZXTA 4RHSA 3TN2A 2VB2X 3NP8A 2MFIA 4HIDA 3GV6A 3KF8B 2NWGA 2UUCL 3NPPA 3GTGH 1QG7A 1L0WA 3GTMB 4N9TA 5BN3A 5IGFA 2ZJPA 3Q23A 3Q8DA 1B9NA 3MHBA 1PV4A 5C0XJ 2NN6H 5FO7B 1BUVT 1ET9A 3BVGA 4AYBB 1I6VC 2EXDA 3HKZB 4ULLA 2A68D 3S2HB 1HFGA 1NNXA 1Y69U 3G7LA 1HNXL 1ASZA 4KY5A 3KK7A 1IBML 4EQPA 4A75A 4BY7H 2EJMA 1A6XA 3QOLA 4RAUC 3NUCA 4IZ8A 2LFNA 1GO3E 2MPMA 2IWHA 4Q0FA 2HIXA 4XYOA 1SYCA 1G2SA 1NSNS 4A93B 2UXBL 3A5UA 3E9IA 2QF7A 2DY8A 3K0XA 4DV6L 4JI6L 2A69D 5JJKA 3CCMA 1ASYA 3SE0A 1F9RA 4BBSH 3OIPA 3M7NA 4TKOB 1K83H 3KF6A 3ERQA 2WAQB 1N34Q 2F3IA 1Y14B 4DAYB 4RGOS 1QVFA 5IWAL 2JA8G 2HUGA 4Y7NB 1FR3A 3HOZG 4DKAC 3HOYH 1XX8A 1PH4A 2JE6I 1PLFA 4A3FB 3D4DA 2LXJA 3HRZC 4FXDA 3J80c 3HS0C 1TWGB 1VQPA 2MQHA 1A3VA 2WIIB 4LUOA 4BY1G 1G6ZA 3FMCA 3FEWX 3M7GA 3D8GA 3J7AF 3HOVB 3TQYA 1YVCA 2JEAI 3SK4A 2AKWB 3NQTA 5C44G 3R2IA 3U50C 3K7UC 3AEVA 1VQAA 2P5ZX 4GS3A 4GOPC 4JI2L 4BBRG 1N33L 2Z1CA 5D3IB 3LGJA 3PF5A 3CC2A 3A8KE 3QWNA 4LWCA 3K5MA 4JI7L 2EZVA 1B4OA 5EKIA 2IX0A 1DXMA 5IWAQ 2WINB 4F7XA 3S15B 3U4ZA 1QVCA 4LF4Q 3VR4A 3CP0A 3S1MB 1LTTD 1TVXA 1XPOA 2N55A 1UE1A 5LL6S 5C3WA 5IGEA 1WTVA 4YHHL 1RCVD 5EPKA 5CMDA 3KLSA 2MP1A 4BA2I 1WD1A 1EWHA 4JPBW 4IPGA 2L0CA 1HNZL 1STHA 4K2LA 5EBCA 3IL8A 1O80A 1Y8PB 1Q82C 1Y1VB 4A3BH 2KJXA 4JI2Q 3U9OA 1TKWB 3EA6A 1D1KA 5C3EH 3PIOA 1RIPA 4DR4Q 3HOXG 1KDAA 3RD4A 3S17H 4DR1L 1PRTD 1MKHA 1X9NA 4JI7Q 1IXRA 1SYGA 4PMWA 3NWTA 5M9OA 2XRSD 1B7YB 4L5QA 4BA1I 3CPWA 1D2BA 1NR4A 3F8TA 1CTMA 3HFZB 2Z4HA 3AQQA 1BF4A 3OWEB 1LO5D 3QIAA 3PO2H 1JJCB 2EYLA 3J7YW 5JEAJ 2JA7B 1U4RA 1QILA 3L7ZC 5D65A 2VUMG 5AFWA 5FLMG 2V1CC 4DK1A 1EY4A 1NTGA 4B9WA 5C4XG 4M8AA 1HNZQ 2KHSA 5C5LA 1DOMA 1UE6A 1KD1C 5KIXA 5M5WH 5M5YB 3S24A 5I9OA 1IL2A 4HMIA 2D0PA 3GV3A 1S5CD 3GTJB 2A69C 2JP1A 1QUQA 5AJ3L 4GN5A 4IQZA 2J7ZA 1AP0A 4FF1A 2LSSA 1TY0A 3M85A 3V2TA 1EIFA 5K36G 2BA1A 5IODA 1VMPA 3RZDH 1QWYA 1V43A 1HQRD 5J3BA 5CBEE 1HH2P 4APVA 4IFDJ 4AYBE 3HKZE 1Y8NB 3NTIA 4ALPA 1B44D 1PH5A 2MNAA 1JOQA 5DM73 5LMUL 1N36Q 1P16A 3T56B 1X3EA 1S5DD 4QJFA 1BCPB 2SNMA 5DNFA 4HIOA 1GD7A 1OXUA 3RN5A 4DV7Q 2Y0SB 1KAAA 1K28A 1M1KC 4H0LC 2G9DA 4CKEA 3J81c 3CAMA 4KKTA 2EYFA 1J8IA 4PZ7A 1FNVA 2K01A 5AJ3Q 4G7HC 3HOZH 4U673 1E3PA 4IALA 2B63G 2I0QA 2WAQE 4K14A 1YNND 1M8AA 3W1BA 4KHPQ 1PYWD 4HJ9A 2K52A 4JV5L 2YTVA 2RHQB 4P72A 1WYDA 4EX5A 4DR2L 3ULPA 2UUAQ 3NBHA 5EBDA 2NYZD 4NKLA 3DEOA 1MJEA 4XIGS 2PO4A 5E1FA 4HN7A 2L15A 4P73A 3FPPA 1PTOD 2WP8J 1XNQL 1CSPA 1E7ZA 3P75A 5C44H 3H6MA 4B9XA 4HJAA 2Z4IA 4BBRH 4CJ1B 2OCEA 1YHQA 2F3VA 2MUYA 4C3HG 2F0EA 4B3MQ 2VQFQ 1KIXA 4IURA 5CV9A 3MWYW 1Y1WG 3S16H 4A3DG 1LTGD 2EY1A 4ZCKA 1Q12A 1PTOH 2XN9C 1XNRL 1X3FA 4DUYL 1AFPA 1F9SA 2J0TD 2AWNA 1GUGA 1TWHH 1OO9B 1J5EQ 2JXMB 2M00A 1AZPA 1VQLA 3SGIA 4DV5Q 2F4VQ 2H5XA 3BDCA 2UXDQ 1KDBA 3WOEA 1LT5D 2PZUA 5L37A 1XMQQ 2BA0A 1IHZA 2FFKB 1PVOA 2DJGC 4GNXB 1I4XA 1TS5A 3G4SA 1SYEA 3VYTA 1I5FA 1L1OA 2KEDA 4JC0A 1NMFA 4C2MH 1D5ZC 4XDXA 3A74A 2A8VA 2F4IA 4I65A 1PH9A 3ER0A 2BH8A 4NXNL 4QCLA 3CQZB 4GKKL 1BKBA 1BCPF 2JSOA 3EVQA 1VQ9A 3KBXA 2SEBD 3T53B 1SFOH 4FF3A 5IGCA 1HTPA 1LV9A 3HOUG 2OQKA 1LT4D 1YZ6A 2HQLA 3NQIA 2EYMA 1YJNA 3I4MB 1Q3LA 1U5KA 5J39A 3JAMc 2F0MA 4DNTB 4DUZL 1NJIC 2A6HD 1XTCD 2UU9L 5E4XA 1V1OA 3I4OA 5J22A 2VXWA 1R9TB 2F0OA 4EQOA 2O2LD 3PUXA 2RKSA 2K5NA 4EQNA 4A76A 1BVSA 1NMGA 2WFWA 4JI5L 2A5HA 2QEXA 2IY5B 3B6YA 5IP9G 5C4XH 3HOWG 1VQJA 4FF4A 1G51A 3FKIB 3I8ZA 3TZUA 1HCZA 1TY2A 1S40A 2XVSA 2E2JH 1F9QA 4B3RL 4KKSA 4X66L 1VS0A 4C3JB 1IW7D 1HA5A 2F0GA 2JA5G 2B2WC 3NTHA 2ZTCA 5LHY1 1JB3A 3UE0A 4LF9L 1D8LA 4DK6C 1CKNA 2Q8IB 1SMYD 3CC4A 3NE5B 4JVZA 4ZUJA 1B3AA 2K05A 3CD6A 3TP7A 1YNNC 3URYA 4LF8Q 2EYHA 4LAAA 4IOCA 1IBLL 3HZXA 3T13A 3NBIA 4ZKBB 4MTKA 3AU7A 4DV2Q 3M3YB 2K7VA 2RSNA 4OX9L 2I5MX 1BCPC 2AWOA 4JI5Q 1HJPA 5K5PA 1Q1BA 1X3PA 3OSOA 4C3IB 1PTOC 4K8JA 1I6HH 3T16A 1DD2A 1R4QB 2Y0SE 4X66Q 3P20A 3A7AB 4AIMA 5F2DA 3EIVA 1YBYA 1IYJB 4RWSC 4UHVA 4CKCA 2DGYA 4LFBQ 2B63H 4R4IA 2PW7A 1EFID 2XNAC 4KHVA 1AE2A 1KHIA 5HURA 3RZOB 3KFUA 3HP3A 1UEBA 2BE5C 4OO1H 2WACA 4HTHA 2Q8RE 4MNOA 1HNWQ 1KDCA 2KCTA 4M1UB 2HCIA 1JE5A 1K3BC 1C48A 4KTAA 1BO0A 1W6KA 1S72A 4JBWA 1SE3A 4OGQC 5IYBG 1QZGA 2E5LQ 4FO2A 2F0UA 3JC66 2JN4A 4N8X1 5GAEC 2VQEL 3OW2A 1YJ9A 1LTID 2NVXB 1SNQA 3K8AA 2JA9A 4DR6Q 4WORA 2YU9B 3OTOL 3T1YL 3ZJYC 1D6EC 2GVBA 3M4QA 3I55A 4WFN3 4LFCQ 3E9HA 2B3GA 2RF4A 4HIMA 3GP7A 3FPUB 3S1QB 2PPBC 4PV1C 1LT6D 4R4OA 2EJGC 3L0OA 2FJ2A 3HKZG 1VQBA 2PMZB 2R7ZB 1LTRD 4IN3A 2C5CA 2A6HC 4Z9CB 3LX0A 1X56A 3Q0AA 3ERSX 4GNXC 3SR1A 2EYPA 1VQNA 1XMOQ 4A93G 4UAIA 3MA2B 1X55A 4LF6L 1A15A 3RLOA 3S2DH 1ML0D 1XXGA 1JORA 2F0DA 5T1IA 1SE2A 1HZBA 5JJZA 4J6HA 3H3VI 1STNA 4YWLA 1STEA 5JPNC 2CHBD 2I5LX 2KECA 3M4PA 1W6JA 1KAWA 2HQEA 2PCFB 2R93B 4KHZA 2RDFA 3AYHB 5LMNL 1JT8A 4QQBX 3I4NH 4A3FG 4QB4A 1SNDA 1JICA 1K3RA 4IPCA 5G3LD 1PXUA 4XTCS 3GTOB 1PDQA 4A3LG 2F0IA 4BY7B 1S3OA 1XTDA 4XT3B 3G6EA 3DWAA 4G57A 3HOVG 4NXML 4K2KA 2KA7A 1FJGQ 1DM0B 2IHEA 1VQKA 3HOWH 2ES2A 1JWMD 3CCEA 1QUQB 3ITPA 1VQMA 4WJ3M 5I2YA 4RGNA 2JA5H 4BBSB 2QW7A 2PI2A 2DY7A 2KBNA 1PH3A 1K83B 1KTKA 5GQOA 5KRUA 1GJXA 5ELEA 2B2UA 2QGQA 1N8RC 1H95A 1YHBA 1EL0A 4UP7A 2FMCA 1WTRA 1D5XC 3E0EA 2E2HH 3UDFA 1HZ9A 2NVQH 3E5SA 4A4IA 1A0IA 4ME3A 1C9OA 1SAPA 5IGDA 1H9MA 5IP7H 1WTQA 3D6WA 4GLVB 4DPGA 3TS0A 2R3ZA 1YNJC 1I4RA 4IO9A 3CKIB 4FNFA 1V1PB 2X6GA 2RA4A 1LTLA 5JOBA 4GKJQ 2VNUD 4JI1Q 1WOCA 2AQ3B 3NTKA 3NK9A 1OXSC 1Y1VG 2EY6A 2ZTEA 1O7ZA 4K5VA 3CF5A 3RLNA 3M4OH 3BZDB 3L9AX 3TDQA 1DGSA 4QF4A 4ABNA 4DNRB 4DAVA 1C8CA 3TS2A 4TQUS 4NW2A 5CBAE 3MFYA 2L4NA 1K8OA 2G5DA 1EIYB 5IYCG 2SOBA 3NBHB 4OELB 3MXNA 2PZWA 2V4DA 3VR3A 1KLGD 3E6ZX 2UUCQ 2NZHA 3ZYYX 1PFNA 4IFDI 4JYAL 2NVYH 4HEDA 3VA5A 2R92H 2RSOA 1QE6A 1TWAH 3OIQA 2JA7G 1SEBD 1DJRD 1HNXQ 2I46A 3DMUA 1NCVA 3BZKA 1IBMQ 4OL7A 1LTBD 1ENFA 5BN4A 1HA6A 2KCMA 2N3SA 1JWSD 1VQ7A 3IRBA 4A3BB 4BS9A 5C0XG 2CH4A 2NTSA 4N8FA 3PIPA 5C3EB 2F0FA 4H7BA 4YCWA 5BR8L 2UXBQ 3R3OA 3U58A 1UUPA 1O7LA 4A3EH 2E2IH 3S17B 4LJZC 4DV6Q 4JI6Q 3GTMH 3CCQA 2E2DC 4HIKA 2VB3X 1EOTA 1WCMH 1BQQT 2K5WA 2LMCB 1QJOA 3CC7A 5A35A 1EQTA 3CCRA 1YITA 4CDEC 1IKLA 2R6GA 3C3LA 1T9HA 3BG3A 2EYOA 4K5WA 1HTLD 1LTSD 3PO2B 3MZ5A 2PMZE 4TRDA 1I50H 4K6DA 5FO9B 1ET6A 1L1OB 1PRTB 3EROA 2TMPA 1PH8A 2K14A 1IBKL 4A93H 1G2TA 1EU3A 1PYSB 4XXEA 1BXTA 2F1MA 4DV1L 2H4OA 2D62A 2O4XA 1QCBD 1I4QA 2Q2TA 4YWMA 2GVAA 5ELBA 4HMJA 1QB5D 3DHQA 5BR8Q 2XGTA 1V1QA 1TQOA 4RG1A 3R8BA 5C4HA 4ZKCB 4Y7NH 3Q24A 3PMFA 1CHPD 3HGBA 1N33Q 3DXJC 3PQIA 3RN2A 4A3FH 3RZDB 5D14A 4XT1B 1A2UA 1TWGH 1GUOA 4P75A 4ZAIA 3K5LA 5IYDG 4GLXA 1EOVA 2ATWA 1B9MA 1K0RA 4TVAB 3FHWA 2IJ0A 2VL6A 4A3GH 5HY6A 3QO2A 3R2TA 5ELNA 1I4GA 4YY3L 1SNCA 3GTLH 4LNQA 2NBFA 2Z6KA 2JK8A 2PQAA 1FYCA 5JAVA 5ISRA 1SE4A 3CMEA 4CJ2C 2A68C 2MGSA 4YHHQ 4RCOA 2B8GA 3EBEA 3RMHA 4DR7L 4ZYSA 3K5OA 3K58A 1V8QA 4A3JH 1SYFA 4RGMA 4V190 4J1MA 2YTXA 4CHTB 1DOLA 1YEZA 1CKNB 4FXKC 4DK3C 5NUCA 1EY6A 5FK9C 2EDGA 1Z6HA 1EY8A 4JI8L 3TP8A 3S15H 2B2VC 3FRPB 1X3QA 3KDFA 3CCUA 4DR1Q 1OXVA 1JCKB 1QZHA 1I4HA 2L1BA 3TSSA 2CKZB 4IUTA 1XPRA 3S14H 4Q5VA 2DNCA 2NN6I 5M3FB 1TXYA 2KVMA 1EY0A 4YY3Q 1SRUA 4RKLA 3K57A 4K8IA 3K0YA 4YIJA 1E0BA 3I73A 3TP5A 4CDFC 3GTPH 1Y1VH 3BDOA 2AUJD 2B2VA 4BBRB 4JI0L 1PRTF 2F0KA 2FHTA 5EGTA 3D4RA 2D9UA 1EWIA 1V9PA 3DM1A 3MXGA 1PTOB 1MSHA 1B3QA 1FNUA 4XYQA 1ZYRD 4JOIC 5JEAG 4JI3L 4K6LA 3I4MG 1TWHB 3M9BA 1EEID 2MO1A 4XQNA 2LKVA 2JA8H 2QDLA 2LS01 4X3TA 4XQJA 1II3A 4CBVA 1CSQA 2IX3A 1JJ2A 1XWEA 2JA7H 5ELDA 3LNNA 4BY1H 3KLSX 2K1BA 1SJHD 3MXUA 3O13A 1WJJA 2WB1B 2ENBA 4JOIA 3G71A 1EUJA 4G7ZC 4JI4L 4K0KL 3K7AB 4U68A 1CKOA 4C2MB 5C0XH 2IHFA 1RF2D 1GHKA 5LMUQ 3C2PA 2SNSA 4C3JG 3GTJH 5FKAC 5JJLA 1SFOB 4IFDG 4B3TL 2NZOA 4PZ6A 4HJ8A 1CA5A 2F0TA 5KNDA 3E0JA 1A3TA 1RL2A 5M3MG 4DFAA 1B8AA 3OHXC 3F2BA 1SR3A 4JI3Q 3OMGA 3AMUA 1JJGA 4A3MB 5I6WA 4IUPA 2NVTB 1C4QA 4O1NA 5LL6X 1Q86C 4A3KB 1L1OC 1PRTC 2F0LA 4KI0A 4JV5Q 4XQQA 3UDGA 1NY4A 1VQGA 2R61A 4DR2Q 3H15A 1NR2A 3GTKH 3T4AC 5KYIA 3K59A 5DEHA 5CV6A 1FVIA 4C3IG 2E2JB 3H0GG 1CZWA 2RQXA 2JYOA 1B50A 3I91A 4QL5A 3IFDA 1XNQQ 1JB7A 5KNBA 4V0BA 2CW0D 1BOSA 4CJ0B 1Q1EA 2F0JA 2CCZA 2ZXRA 1K73C 4HCSA 5KNCA 2F3WA 3HOXH 5JVH3 4ODGA 2ZTDA 1I94L 2K4KA 1RD9D 1Z7TA 4AQYL 1MD2D 3BZCA 4HJ7A 1PTOF 1XNRQ 1K8MA 1WTHA 1EU4A 2YTYA 1YI2A 1VQDA 4DUYQ 1LTAD 1UAPA 1KLUD 3BYYB 3QOJA 1PH6A 3N6RA 2N8NA 3H3VH 1WI5A 1FNWA 2E75C 3QR8A 4RHRA 4C56C 1LM0A 1O78A 4OWWB 1U4PA 3ND8A 4JBJA 4B3SL 5EQ0A 2B29A 2VUMH 1SN8A 1R4PB 2NUCA 3GQBA 3MEHA 3UI2A 3Q22A 5FLMH 1TT2A 3W5OA 3J80E 1D5MC 4DGZA 1GUNA 1NUCA 1TWCH 1HFNA 3R93A 1MSGA 2C35B 4LW1A 5C4ZA 1EY7A 1PH7A 3MEFA 3PIP3 4DR3L 4NXNQ 4GKKQ 3ULLA 2QKIC 5M5XB 5D3DA 3CCVA 2ZM6L 1ZYRC 1LABA 3I90A 5K36H 1MI2A 4HJ5A 1UE5A 2R7ZG 2IL8A 1TS3A 4ME5A 1VF7A 3D6CA 1GKHA 4DUZQ 1EZ8A 1TS4A 2UU9Q 1VQFA 3F2DA 5COYA 2CQAA 1SXTA 3GO5A 4EQ5A 5CGKA 1CUKA 1GOZA 4WRDA 1N32L 3PF4A 4WJWA 1BDOA 4YWKA 1K8AC 3SK8A 3CQZH 3MVVA 2O5IC 3FP9A 2DNEA 3KF6B 1IKMA 5A2QE 2B2TA 4O2DA 4B3RQ 2HIVA 1I3QH 2UXCL 3OYYA 5I6YA 2R93G 5KGUA 2XTIA 4JW0A 1DONA 2ICIA 4HSPA 1ESRA 3IFTA 4X64L 3NSWA 3KUPA 2K50A 2ZM6Q 5IY0A 4ZUIA 5EPJA 4L5RC 4LF9Q 4HCEA 4UPAA 4DV0L 2GA4B 4BY7G 3SK5A 3ICEA 2PW5A 3PIO3 4A3IB 5TSSA 3GTQB 1MGSA 1NE3A 1JOOA 2B2YA 4A3CG 3CMAA 2QDBA 1HQMC 1SSOA 2KEEA 1RTNA 1IBLQ 1TWFH 2A73B 2WB1E 3K81C 3S2DB 2VY3A 2XWBB 1YNXA 2O5JC 5I4DA 4C3JH 3C1EA 4RGTA 4OX9Q 1CQVA 2HD3A 2JJQA 5FJ8G 1A3UA 3PO3B 4BBSG 5T1GA 1CFMA 3NENA 3X3MA 3HKSA 4P2CB 1Q8KA 1EYCA 4IPDA 3T51B 1E1OA 4C3HH 1U9RA 5M3MH 2HDMA 2CW0C 2EJFC 4QMGA 1Y1WH 4JBKA 4A3DH 3I4NB 2EYJA 1UWVA 3D0FA 4EGVA 2KENA 2PZTA 3NXWA 1JWUD 3SEBA 3F2CA 3AFPA 1T5XD 3PGZA 4AYBG 3A56A 1L0XB 1ICFB 1STBA 1C7YA 3ULJA 1EY5A 2TSSA 1VQEA 1VMCA 3IAYA 4UY8C 4RMFA 3H0GH 3KLWA 3IKJA 4P74A 3CRKC 2RHSB 2JEBI 1MJCA 1STYA 3A0JA 2JA6B 2VZAA 4DV4L 2Z9HA 1VQHA 2Z6BA
chains in the Genus database with same CATH topology
2BDNA 4DN4M 4KKUA 3EQLC 1G291 1U4MA 1SBBB 1JR0D 2RDHA 3OW7A 5CV4A 2BDOA 2E2HB 4FXGC 4QUFA 2NVQB 3GTGB 1IW7C 1RJTA 2H1EA 1CHQD 5C6AA 5IIFA 2EY5A 2K6AA 3QJYA 3J81E 2F0VA 1H9SA 1ENCA 3D31A 1SMYC 4C1NK 3I3CA 4KD3A 4ZQ3A 3U9SA 2B2UC 1ILPA 2C9OA 3N52A 1EYDA 1DOKA 1ZEQX 3M4OB 4LK1C 1WTXA 2D2CC 2F0HA 1SYDA 3MAQA 2B39A 4PNYA 1EZ6A 3H09A 4X3UA 2F0SA 2KOLA 3K6OA 2K33A 1WVLA 4FP5D 2NVYB 3HOYB 4ILWA 2R92B 5IOCA 1TWAB 1SNMA 1CQFA 2E74C 1FGBD 4X3KA 3A8JE 2XRQD 2BCOA 4O42A 4N9PA 4CKBA 1HRJA 1UNSA 2EXZA 2D5DA 3NWSA 1HXYD 3FDTA 1BBXC 5FLXE 3VYUA 3I72A 4A3EB 3TBIB 2E2IB 2ID0A 1WCMB 5G3LF 1CT1D 2A74C 5A2QL 3PUVA 2ICEC 3PUYA 3VR5A 2EE1A 2IX1A 4ZRZA 5C3XA 3W3AA 4J8QA 2XIWA 5CV8A 1I50B 4LMQD 1GUWA 2YYZA 3DWPA 1ESFA 4OO1I 4IUVA 2F0PA 2G9HD 3JAME 2KQ3A 5KEEA 3D3RA 3P7JA 4F8MA 1KABA 2IW3A 4IUNA 1SJED 3PUZA 2AUKA 3VR6A 4R8NA 3J7AV 4FVMA 1IYUA 1VCIA 5EPLA 2X69A 3V05A 4CGYB 1OXTA 3SK6A 4F87A 3BYTB 4A3GB 2OF1A 1TU2B 3GTLB 2BOSA 2MHVA 4MHEA 3GD7A 3KLRA 1ENAA 1LT3D 4A3JB 3ONAB 5M5WB 3NHHA 4QIWB 2IPKD 4X3SA 1PZKD 2RBMA 1H9RA 1WTPA 4HAEA 1IYVA 3S14B 5CV5A 4IUQA 1H9KA 2M2LA 2F0QA 3EJIA 3TZDA 4DAPA 3J81L 4G7OC 2K03A 3GTPB 1DYQA 1A2TA 1L0YB 4KK7A 1ILQA 1QOHA 3QG1A 3DUZA 2PQEA 1Z47A 1QNUA 3VA7A 1MBYA 5KYLA 3K5NA 1GXDC 1B2TA 3HG9A 1JC7A 1G91A 3C46A 2K5QA 2EVBA 2JA8B 2M9VA 3HOZB 5J1ZA 5C5MA 2J4XA 2AQ1B 4KN4C 3DWQA 4L8JA 3CHBD 3VYRA 1QNKA 4MN3A 4BY1B 2K04A 3RLFA 1GUTA 1T5EA 1PZID 3WOFA 2RDGA 2L5TA 2NTTA 1PFMA 4RA8A 5C44B 4DXFA 5CC4A 5FLXL 1G8ZD 1TR5A 3V96A 3LWUA 1F9PA 4F88A 4PQXA 1PZJD 3S16B 2KUMA 1JOKA 5I9PA 2QILA 4KJNA 4DF7A 4H13C 1RKNA 3D4WA 2XSCA 3A7LA 3KF8A 4DA2A 4HSVA 2B8FA 1UEAB 1VF5C 4E6IA 3GTKB 3G6JB 5JVG3 3W2DA 5E4WC 2Z8LA 1V1PA 2E76C 3CU7A 3BS1A 4KY7A 3LWEA 3JAML 4OIJA 4GZYC 1NAPA 1SDFA 3OPOA 3HOXB 1U4LA 1J9OA 1JE4A 3OWFA 2FMMA 5I2XA 1RDPD 2F0NA 3QB3A 4OO1G 1BCPD 1HHVA 4C1NI 1CZGA 1CA6A 1B1ZA 5ELCA 4DAYA 3KBGA 3OMCA 3OOCA 2A6ED 1HPCA 1E2VA 5IT9E 4DU9A 4KY6A 3VR2A 2VUMB 4KN7C 5JPMC 1EQVA 1EEFD 2FINB 5C4XB 2SDFA 3EFXD 3P1HA 2K28A 1TWCB 1BNZA 3TP6A 2WKDA 5CORA 2BE5D 3MXPA 5CYUA 1OXXK 3A8IE 1CM9A 3PUWA 4IUUA 3C1FA 1E2ZA 1H9SB 2NB0A 4ID6A 4FYDA 1GHJA 2NZ1D 2KCCA 1LLRD 1DCZA 2ZT9C 2XWJB 1AN8A 4KD4A 4R8IA 3AB9A 2AQ2B 4BWGB 1XYIA 4OIKA 2WV6D 1E2WA 3BVZA 4K5XA 3RUZA 4R9WA 1VDZA 1AZQA 1O7YA 1F2LA 2QCPX 1I6HB 1KNAA 1I3QB 1RTOA 2F03A 1IL8A 3SXHA 2HCCA 2KCNA 1F2MA 2K5DA 3MTSA 4UDUC 2B63B 2DN8A 1F77A 3TMEA 4ZK9B 1EY9A 3BVMA 4RH6A 1DZ1A 1EYAA 4TSSA 1M4VA 3CRLC 2Q8TA 1RHPA 2X6LA 4OHJA 1TWFB 2LY7A 2B2TC 4JK1C 4KV6A 3HEJA 1I4PA 4C3HB 3I70A 4G4KA 1FD7D 4ZLTF 5M3MB 3F2UA 1SYBA 1Y1WB 4A3DB 1H9JA 2RVLA 4RCNA 4KJOA 4KMUC 3L3OC 3SVMA 1S5BD 1X32A 2B2YC 3PV0A 5JEAH 4DK0A 5FOBB 1KNEA 2NN6G 1JQYD 2B2WA 4L6TB 1ONLA 1S5ED 1LACA 3MFGA 4B08A 5BN5A 4I7ZC 3H0GB 2EOTA 1SNOA 2A6EC 1GUSA 5DM63 3SDZA 1WTOA 1AW7A 1Q8IA 1TS2A 3Q6SA 2EPBA 5IGBA 1HUNA 1CI3M 4DXGA 5C0XI 4IFDH 4HR7B 3MC0B 4FF2A 5CV7A 3HOUB 5IGGA 1YNJD 4L63B 1D1IA 2MJ8A 1EIGA 3H3VC 4MIUA 4S3SA 5EJWA 4EVOA 3H94A 1B53A 2K32A 5IT9L 3S9WA 4PMCA 3SHLA 4RFBA 2OT2A 2PYKA 1RODA 3HOWB 2L55A 2OXPA 1STGA 1HUMA 2QEJC 1EIHA 5E3FA 2JA5B 2OEOA 3VYSA 1STAA 3WDNA 1Q90A 2IT1A 2L12A 3A55A 1ZKOA 1TIID 1AEXA 3I4LA 2L9HA 3H91A 5EKLA 2F0WA 2WKCA 4NMZA 1WTWA 2CVRA 1BR9A 3FVQA 1S5FD 5EKKA 2I07B 4NP5A 2PNRC 1F2YA 4RKBA 5CR3A 1ICWA 1PMRA 1F2ZA 5FO8B 1Y8OB 5ELFA 1PFBA 3J80L 5HGTA 3DEPA 1WD0A 3A54A 2N88A 3BDLA 1EWCA 2ZXOA 2ZXPA 3S1RB 4PMBA 3M4YA 1SNPA 1S4ZA 5C4JB 3X3NA 3ND9A 4NDXA 4QUCA 4H44C 1CK1A 5DAUA 2L11A 2EY2A 3S1NB 2HDLA 1ZXTA 4RHSA 3TN2A 2VB2X 3NP8A 3GV6A 2NWGA 3NPPA 1QG7A 3GTMB 4N9TA 5BN3A 5IGFA 3Q23A 1B9NA 3MHBA 5C0XJ 2NN6H 5FO7B 1BUVT 1ET9A 3BVGA 4AYBB 1I6VC 3HKZB 4ULLA 2A68D 3S2HB 1HFGA 1Y69U 3G7LA 4KY5A 3KK7A 4EQPA 2EJMA 1A6XA 3QOLA 4RAUC 3NUCA 4IZ8A 2LFNA 2MPMA 2IWHA 4Q0FA 4XYOA 1SYCA 1G2SA 1NSNS 4A93B 2QF7A 2DY8A 2A69D 3SE0A 1F9RA 3OIPA 3M7NA 4TKOB 3ERQA 2WAQB 4RGOS 2HUGA 4Y7NB 1FR3A 1XX8A 2JE6I 1PLFA 4A3FB 3D4DA 3HRZC 4FXDA 3HS0C 1TWGB 1A3VA 2WIIB 1G6ZA 3FMCA 3FEWX 3M7GA 3D8GA 3J7AF 3HOVB 2JEAI 3SK4A 3NQTA 3R2IA 2Z1CA 5D3IB 3A8KE 3QWNA 3K5MA 2EZVA 1B4OA 5EKIA 2IX0A 1DXMA 2WINB 4F7XA 3S15B 3VR4A 3S1MB 1LTTD 1TVXA 2N55A 5C3WA 5LL6S 5IGEA 1WTVA 1RCVD 5EPKA 5CMDA 3KLSA 2MP1A 4BA2I 1WD1A 1EWHA 2L0CA 1STHA 4K2LA 5EBCA 3IL8A 1O80A 1Y8PB 1Y1VB 2KJXA 3U9OA 1TKWB 3EA6A 1D1KA 1KDAA 3RD4A 1PRTD 1SYGA 4PMWA 3NWTA 5M9OA 2XRSD 4BA1I 1D2BA 1NR4A 1CTMA 2Z4HA 1BF4A 3OWEB 1LO5D 3QIAA 2EYLA 3J7YW 5JEAJ 2JA7B 1U4RA 1QILA 3L7ZC 5D65A 5AFWA 4DK1A 1EY4A 4B9WA 4M8AA 2KHSA 5C5LA 1DOMA 5KIXA 5M5YB 5I9OA 4HMIA 3GV3A 1S5CD 3GTJB 2A69C 2JP1A 4IQZA 2J7ZA 1AP0A 4FF1A 1TY0A 3M85A 3V2TA 5K36G 2BA1A 5IODA 1VMPA 1QWYA 1V43A 1HQRD 5CBEE 4IFDJ 1Y8NB 3NTIA 1B44D 1JOQA 5DM73 3T56B 1S5DD 1BCPB 2SNMA 5DNFA 1OXUA 2Y0SB 1KAAA 4H0LC 2G9DA 4CKEA 4KKTA 2EYFA 1J8IA 1FNVA 2K01A 4G7HC 4U673 4IALA 4K14A 1YNND 1M8AA 1PYWD 3NBHA 5EBDA 2NYZD 4NKLA 3DEOA 4XIGS 2PO4A 5E1FA 4HN7A 3FPPA 1PTOD 2WP8J 3P75A 3H6MA 4B9XA 2Z4IA 4CJ1B 2F3VA 2MUYA 4C3HG 2F0EA 4IURA 5CV9A 3MWYW 1LTGD 2EY1A 1Q12A 1PTOH 2XN9C 1AFPA 1F9SA 2J0TD 2AWNA 1GUGA 1OO9B 2JXMB 2M00A 1AZPA 3BDCA 1KDBA 3WOEA 1LT5D 2PZUA 2BA0A 1IHZA 2FFKB 1I4XA 1TS5A 1SYEA 3VYTA 2KEDA 1D5ZC 4XDXA 2F4IA 4I65A 4QCLA 3CQZB 1BCPF 2JSOA 3EVQA 3KBXA 2SEBD 3T53B 4FF3A 5IGCA 1HTPA 1LV9A 1LT4D 3NQIA 2EYMA 3I4MB 1Q3LA 5J39A 2F0MA 4DNTB 2A6HD 1XTCD 5E4XA 1V1OA 5J22A 2VXWA 1R9TB 2F0OA 4EQOA 2O2LD 3PUXA 2RKSA 4EQNA 2A5HA 4FF4A 3FKIB 3TZUA 3I8ZA 1HCZA 1TY2A 2XVSA 1F9QA 4KKSA 4C3JB 1IW7D 1HA5A 2F0GA 2B2WC 3NTHA 5LHY1 1JB3A 2Q8IB 1SMYD 3NE5B 4ZUJA 1B3AA 2K05A 3TP7A 1YNNC 3URYA 2EYHA 4LAAA 3HZXA 3T13A 3NBIA 4ZKBB 3AU7A 3M3YB 2K7VA 2RSNA 1BCPC 2AWOA 5K5PA 1Q1BA 1X3PA 3OSOA 4C3IB 1PTOC 4K8JA 1DD2A 1R4QB 3P20A 3A7AB 5F2DA 4RWSC 4CKCA 2PW7A 1EFID 2XNAC 4KHVA 5HURA 3RZOB 3HP3A 2BE5C 4OO1H 2WACA 4HTHA 2Q8RE 1KDCA 4M1UB 2HCIA 1C48A 4KTAA 1BO0A 1W6KA 4JBWA 1SE3A 4OGQC 4FO2A 2F0UA 1LTID 2NVXB 1SNQA 4WORA 2YU9B 1D6EC 4WFN3 3GP7A 3FPUB 3S1QB 2PPBC 4PV1C 1LT6D 2EJGC 2FJ2A 2PMZB 2R7ZB 1LTRD 4IN3A 2C5CA 2A6HC 4Z9CB 3LX0A 3Q0AA 3SR1A 2EYPA 4UAIA 3MA2B 1A15A 1ML0D 1XXGA 1JORA 2F0DA 5T1IA 1SE2A 5JJZA 4J6HA 1STNA 1STEA 5JPNC 2CHBD 2KECA 1W6JA 2HQEA 2PCFB 2R93B 4KHZA 2RDFA 4QB4A 1SNDA 1JICA 5G3LD 1PXUA 4XTCS 3GTOB 1PDQA 2F0IA 4BY7B 4XT3B 3DWAA 4G57A 4K2KA 2KA7A 1DM0B 1JWMD 3ITPA 5I2YA 4RGNA 4BBSB 2DY7A 1K83B 1KTKA 5KRUA 1GJXA 5ELEA 2B2UA 1EL0A 2FMCA 1WTRA 1D5XC 3E5SA 1SAPA 5IGDA 1H9MA 1WTQA 3D6WA 2R3ZA 1YNJC 1I4RA 3CKIB 4FNFA 1V1PB 2X6GA 2RA4A 5JOBA 2VNUD 3NTKA 2AQ3B 3NK9A 1OXSC 2EY6A 1O7ZA 4K5VA 3BZDB 3L9AX 3TDQA 4QF4A 4ABNA 4DNRB 4DAVA 1C8CA 4TQUS 4NW2A 5CBAE 3MFYA 2L4NA 1K8OA 2SOBA 3MXNA 2PZWA 2V4DA 3VR3A 1KLGD 3E6ZX 3ZYYX 1PFNA 4IFDI 4HEDA 3VA5A 2RSOA 1QE6A 3OIQA 1SEBD 1DJRD 2I46A 3DMUA 1NCVA 4OL7A 1LTBD 1ENFA 5BN4A 1HA6A 1JWSD 4A3BB 4BS9A 5C0XG 2NTSA 5C3EB 2F0FA 4H7BA 3R3OA 1UUPA 1O7LA 3S17B 4LJZC 2E2DC 2VB3X 1EOTA 2K5WA 1BQQT 2LMCB 1QJOA 5A35A 1EQTA 1IKLA 2R6GA 3C3LA 3BG3A 2EYOA 4K5WA 1HTLD 1LTSD 3PO2B 3MZ5A 4TRDA 4K6DA 5FO9B 1ET6A 1PRTB 3EROA 2TMPA 1G2TA 1EU3A 4XXEA 1BXTA 2F1MA 2H4OA 2D62A 2O4XA 1QCBD 1I4QA 5ELBA 4HMJA 1QB5D 3DHQA 1TQOA 3R8BA 5C4HA 4ZKCB 3Q24A 3PMFA 1CHPD 3HGBA 3DXJC 3RZDB 5D14A 4XT1B 1A2UA 1GUOA 4ZAIA 3K5LA 1B9MA 2IJ0A 3QO2A 3R2TA 1I4GA 1SNCA 2NBFA 1FYCA 5JAVA 5ISRA 1SE4A 4CJ2C 2A68C 2MGSA 4RCOA 2B8GA 3RMHA 4ZYSA 3K5OA 3K58A 1V8QA 1SYFA 4RGMA 4V190 4J1MA 4CHTB 1DOLA 4FXKC 5NUCA 1EY6A 5FK9C 2EDGA 1Z6HA 1EY8A 3TP8A 2B2VC 3FRPB 1X3QA 1OXVA 1JCKB 1I4HA 2L1BA 3TSSA 4IUTA 4Q5VA 2DNCA 2NN6I 5M3FB 2KVMA 1EY0A 3K57A 4RKLA 4K8IA 3K0YA 4YIJA 1E0BA 3I73A 3TP5A 3BDOA 2AUJD 2B2VA 4BBRB 1PRTF 2F0KA 2FHTA 5EGTA 3D4RA 2D9UA 3DM1A 3MXGA 1PTOB 1MSHA 1FNUA 4XYQA 1ZYRD 5JEAG 4K6LA 1TWHB 1EEID 4XQNA 2LKVA 2LS01 4X3TA 4XQJA 1II3A 4CBVA 2IX3A 1XWEA 5ELDA 3LNNA 3KLSX 2K1BA 1SJHD 3MXUA 3O13A 2WB1B 2ENBA 4G7ZC 3K7AB 4U68A 4C2MB 5C0XH 1RF2D 1GHKA 3C2PA 2SNSA 4C3JG 5FKAC 1SFOB 4IFDG 1CA5A 2F0TA 5KNDA 3E0JA 1A3TA 4DFAA 3OHXC 3OMGA 3AMUA 4A3MB 5I6WA 4IUPA 2NVTB 1C4QA 4O1NA 5LL6X 4A3KB 1PRTC 2F0LA 4KI0A 4XQQA 2R61A 1NR2A 3T4AC 5KYIA 3K59A 5DEHA 5CV6A 4C3IG 2E2JB 1CZWA 2RQXA 2JYOA 1B50A 3I91A 3IFDA 5KNBA 4V0BA 2CW0D 1BOSA 4CJ0B 1Q1EA 2F0JA 2ZXRA 4HCSA 5KNCA 2F3WA 5JVH3 4ODGA 1RD9D 1Z7TA 1MD2D 1PTOF 1K8MA 1EU4A 1LTAD 1UAPA 1KLUD 3BYYB 3QOJA 3N6RA 1FNWA 2E75C 4RHRA 4C56C 1O78A 1U4PA 3ND8A 5EQ0A 1R4PB 2NUCA 3GQBA 3MEHA 3UI2A 3Q22A 1TT2A 3J80E 1D5MC 4DGZA 1GUNA 1NUCA 1HFNA 3R93A 1MSGA 5C4ZA 1EY7A 3PIP3 2QKIC 5M5XB 5D3DA 1ZYRC 1LABA 3I90A 5K36H 1MI2A 2IL8A 1TS3A 4ME5A 1VF7A 3D6CA 1EZ8A 1TS4A 5COYA 2CQAA 1SXTA 3GO5A 5CGKA 1GOZA 4WRDA 4WJWA 1BDOA 3SK8A 3MVVA 2O5IC 2DNEA 1IKMA 5A2QE 2B2TA 5I6YA 5KGUA 1DONA 2ICIA 4HSPA 1ESRA 3IFTA 3NSWA 3KUPA 4ZUIA 5EPJA 4HCEA 2GA4B 3SK5A 2PW5A 3PIO3 4A3IB 5TSSA 3GTQB 1MGSA 1JOOA 2B2YA 2QDBA 1HQMC 1SSOA 2KEEA 1RTNA 2A73B 3S2DB 2XWBB 2O5JC 5I4DA 3C1EA 4RGTA 1CQVA 3PO3B 1A3UA 5T1GA 1CFMA 3X3MA 4P2CB 1EYCA 3T51B 1U9RA 2HDMA 2CW0C 2EJFC 4QMGA 3I4NB 2EYJA 4EGVA 2PZTA 3NXWA 1JWUD 3SEBA 1T5XD 3A56A 1L0XB 1STBA 1EY5A 2TSSA 1VMCA 3IAYA 3IKJA 3CRKC 2JEBI 1STYA 2JA6B 3T16A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MIU A;  4S3S A;  1SYF A;  2F0Q A;  2EY2 A;  3EJI A;  4J1M A;  1EZ8 A;  4KY7 A;  3DMU A;  4EVO A;  4OL7 A;  1SYE A;  5NUC A;  5I6W A;  5C3X A;  2F0I A;  3TME A;  1EY6 A;  2PW7 A;  1EY9 A;  1A2T A;  5CV8 A;  3S9W A;  4KHV A;  3NP8 A;  2F0L A;  4PMC A;  5CGK A;  4G57 A;  5CV4 A;  5HUR A;  1JOQ A;  3SXH A;  4I65 A;  1EYA A;  4WRD A;  3SHL A;  4K2K A;  1EY8 A;  3TP8 A;  4F7X A;  2F0F A;  2PYK A;  4H7B A;  3EVQ A;  5DAU A;  3SK8 A;  3MVV A;  2SNM A;  2OXP A;  3R3O A;  3OWF A;  5IGC A;  2WAC A;  4N9T A;  4HTH A;  5C3W A;  5IGF A;  1STG A;  2F0N A;  5DEH A;  3QB3 A;  5IGE A;  2PQE A;  5CV6 A;  1KDC A;  3ITP A;  1KAA A;  3MHB A;  5E3F A;  5I6Y A;  5KGU A;  2EYM A;  5C6A A;  4KV6 A;  2F0P A;  5IIF A;  2EY5 A;  5KYL A;  5J39 A;  4KTA A;  2OEO A;  5F2D A;  2F0M A;  2F0V A;  1EY0 A;  2EYF A;  3OMC A;  4ZQ3 A;  4F8M A;  2KQ3 A;  1ENC A;  3HEJ A;  4KY5 A;  1STH A;  4K2L A;  4RKL A;  4K8I A;  5KEE A;  5KRU A;  5J22 A;  4EQP A;  2EYO A;  2F0U A;  2F0J A;  4K5W A;  4YIJ A;  4ZUI A;  5J1Z A;  5C5M A;  3TP5 A;  3QOL A;  1KAB A;  4IAL A;  2F0O A;  4K14 A;  3MZ5 A;  4KD3 A;  4KY6 A;  1STA A;  4TRD A;  2RKS A;  4EQO A;  4K6D A;  3NUC A;  4IZ8 A;  3SK5 A;  2PW5 A;  3U9O A;  1SNQ A;  2F3W A;  2F0K A;  4EQN A;  4IUN A;  4ODG A;  4WOR A;  1SYB A;  5KYI A;  1EYD A;  5EGT A;  1EQV A;  3E5S A;  3ERO A;  1KDA A;  1JOO A;  4KJO A;  5IGD A;  1SYC A;  1NSN S;  1AEX A;  2QDB A;  3P1H A;  4R8N A;  4NKL A;  2F0H A;  1SYD A;  1SYG A;  5EKL A;  5M9O A;  2O4X A;  3TP6 A;  4PNY A;  3QOJ A;  5E1F A;  3SK6 A;  3MXP A;  1EZ6 A;  2F0W A;  4NMZ A;  2OF1 A;  3C1E A;  2F0G A;  2F0S A;  4HMJ A;  5CC4 A;  3DHQ A;  1A3U A;  3P75 A;  3ERQ A;  2LKV A;  3H6M A;  1TQO A;  1TR5 A;  5JOB A;  5C4H A;  4B9X A;  1EYC A;  1II3 A;  3C1F A;  3NK9 A;  2EYL A;  5EKK A;  4ID6 A;  4NP5 A;  1U9R A;  2EY6 A;  3PMF A;  2NUC A;  3MEH A;  1ENA A;  1SNO A;  1F2Y A;  2F3V A;  4K5V A;  4RKB A;  5IOC A;  4QMG A;  3D4D A;  2F0E A;  5CR3 A;  1TT2 A;  1SNM A;  3LX0 A;  1A2U A;  4QF4 A;  1F2Z A;  5CV9 A;  4ZUJ A;  1A3V A;  1EY4 A;  2EYJ A;  3TP7 A;  3SR1 A;  1NUC A;  2EYP A;  1JOK A;  4N9P A;  4B9W A;  4KD4 A;  2ENB A;  2EY1 A;  4DGZ A;  5HGT A;  5I9P A;  2KHS A;  4KJN A;  2PZT A;  2EYH A;  4LAA A;  3NXW A;  5C5L A;  3D8G A;  3NHH A;  4DF7 A;  5KIX A;  3HZX A;  2EXZ A;  1RKN A;  3D4W A;  3T13 A;  2SOB A;  5C4Z A;  1JOR A;  1EY7 A;  2F0D A;  5I9O A;  5IGB A;  4DU9 A;  3BDL A;  4K5X A;  4J6H A;  4HMI A;  2SNS A;  3SK4 A;  1STB A;  1STN A;  2PZW A;  3RUZ A;  5K5P A;  2RBM A;  1SNC A;  5CV7 A;  3NQT A;  4PMB A;  2M00 A;  1SNP A;  4E6I A;  3OSO A;  1EY5 A;  5IGG A;  3OMG A;  5JAV A;  5ISR A;  3D6C A;  2HQE A;  4K8J A;  2F0T A;  3BDC A;  1KDB A;  3VA5 A;  3V2T A;  2RDF A;  1A3T A;  4NDX A;  4DFA A;  2PZU A;  5IOD A;  1STY A;  5CV5 A;  4ME5 A;  3T16 A;  1IHZ A;  4QB4 A;  1SND A;  1F2M A; 
#chains in the Genus database with same CATH topology
 2BDN A;  4DN4 M;  2OWO A;  4KKU A;  4OWX B;  1Q81 C;  3EQL C;  1G29 1;  1U4M A;  1SBB B;  1JR0 D;  2VQE Q;  4NPS A;  2RDH A;  1X65 A;  3OW7 A;  3E3X A;  5CV4 A;  3RZO H;  2BDO A;  3OTO Q;  2E2H B;  4FXG C;  3RR5 A;  4QUF A;  2NVQ B;  3HOU H;  4DAM A;  3GTG B;  3T1Y Q;  1IW7 C;  2WAQ G;  1RJT A;  4IPH A;  3DLL A;  2H1E A;  1CHQ D;  2OTL A;  2PQA B;  1KL9 A;  5C6A A;  5IIF A;  1KC8 C;  2EY5 A;  2K6A A;  3QJY A;  3J81 E;  2F0V A;  1H9S A;  1PH1 A;  1ENC A;  4DV3 L;  1J6Q A;  3D31 A;  1SMY C;  4C1N K;  3I3C A;  4KD3 A;  4ZQ3 A;  2RCN A;  3U9S A;  2B2U C;  5IP9 H;  1ILP A;  2PI2 E;  2C9O A;  3N52 A;  1EYD A;  1DOK A;  1ZEQ X;  3M4O B;  4DV4 Q;  1EQQ A;  5C3E G;  4LK1 C;  1WTX A;  2D2C C;  2F0H A;  4LF6 Q;  1SYD A;  3MAQ A;  2B39 A;  3KDF B;  4PNY A;  4DNI A;  1EZ6 A;  3H09 A;  4X3U A;  1EQR A;  1C0A A;  2F0S A;  2KOL A;  3K6O A;  2K33 A;  4R4C A;  1A62 A;  1WVL A;  4FP5 D;  1HZC A;  2NVY B;  3HOY B;  4ILW A;  2R7Z H;  5LMN Q;  1O7I A;  3PO2 G;  2R92 B;  5IOC A;  1TWA B;  1YIJ A;  4POG A;  1SNM A;  1CQF A;  2E74 C;  1FGB D;  4X3K A;  1NBW A;  3A8J E;  2XRQ D;  2BCO A;  4O42 A;  4N9P A;  4CKB A;  1HRJ A;  1UNS A;  1GM5 A;  2F52 A;  3I56 A;  2EXZ A;  2D5D A;  3NWS A;  5DLQ E;  1HXY D;  3U4V A;  3FDT A;  3AFQ A;  1BBX C;  4NXM Q;  5FLX E;  1LYL A;  3VYU A;  1KRS A;  3I72 A;  4A3E B;  3TBI B;  2E2I B;  1N34 L;  2AHO B;  2ID0 A;  2R93 H;  1WCM B;  4L5T A;  5G3L F;  1CT1 D;  2A74 C;  5A2Q L;  4MZ9 A;  3PUV A;  2ICE C;  3PUY A;  3VR5 A;  5GAD C;  4QY7 A;  2EE1 A;  3KOJ A;  3UE1 A;  2IX1 A;  4ZRZ A;  5C3X A;  4IOA A;  3GTO H;  3W3A A;  4J8Q A;  2XIW A;  5CV8 A;  3TRZ A;  1I50 B;  1KXL A;  1SMX A;  2JQO A;  4LMQ D;  1GUW A;  3S1R H;  2YYZ A;  4A3C H;  3DWP A;  1ESF A;  1PH2 A;  4P71 A;  4GLA C;  4OO1 I;  1YHA A;  5C4J H;  2HT1 A;  4IUV A;  2F0P A;  4OXP A;  2G9H D;  5IYB H;  2OQ0 A;  3JAM E;  5FJ8 H;  4AH6 A;  2KQ3 A;  5KEE A;  3S1N H;  3D3R A;  3P7J A;  4F8M A;  1KAB A;  3NEM A;  1SLJ A;  5LMN W;  2BH2 A;  2IW3 A;  4IUN A;  1SJE D;  3PUZ A;  3G48 A;  5ELO A;  4LF4 L;  2AUK A;  3A5Z B;  3VR6 A;  4R8N A;  3J7Z C;  3J7A V;  4FVM A;  1IYU A;  1VCI A;  5EPL A;  2X69 A;  3V05 A;  1XPU A;  4CGY B;  1OXT A;  3SK6 A;  4F87 A;  4X6A H;  3CCJ A;  3BYT B;  4A3G B;  2OF1 A;  1TU2 B;  3S2H H;  3VDY A;  5M3F G;  1W2B A;  3GTL B;  4JYA Q;  2BOS A;  2MHV A;  2RCF A;  1LUZ A;  4MHE A;  3GD7 A;  3KLR A;  1ENA A;  2EIF A;  1LT3 D;  4DR4 L;  4MTN A;  4IJH A;  4A3J B;  4O0A A;  3ONA B;  1AH9 A;  2Y0S G;  5M5W B;  3NHH A;  4CDD C;  2ASB A;  4QIW B;  1BBW A;  4PZ8 A;  2IPK D;  4X3S A;  1PZK D;  2N78 A;  2RBM A;  1H9R A;  1WTP A;  4GOP A;  4HAE A;  2Z6K C;  1IYV A;  5GAG C;  4UP8 A;  1SRO A;  4JBM A;  3S14 B;  5CV5 A;  4IUQ A;  1H9K A;  2M2L A;  2F0Q A;  3EJI A;  3TZD A;  4A3L H;  4GN3 B;  4DAP A;  3J81 L;  4G7O C;  2WB1 G;  2K03 A;  3GTP B;  1DYQ A;  3HOV H;  1A2T A;  3CW2 C;  1GVP A;  1L0Y B;  4KK7 A;  4POF A;  1ILQ A;  5IE8 A;  1IBK Q;  1QOH A;  3QG1 A;  3DUZ A;  1IZ6 A;  1Q46 A;  3NEL A;  4DV1 Q;  2K5V A;  2PQE A;  1Z47 A;  1YJW A;  1QNU A;  3J7A 5;  3VA7 A;  1MBY A;  2MO0 A;  5KYL A;  3K5N A;  1GXD C;  4R1J A;  1B2T A;  3HG9 A;  1JC7 A;  1G91 A;  3C46 A;  2K5Q A;  2EVB A;  2JA8 B;  4A3M G;  2M9V A;  3HOZ B;  5J1Z A;  5C5M A;  2J4X A;  3TEH B;  2AQ1 B;  4KN4 C;  3DWQ A;  4L8J A;  1SE8 A;  3CHB D;  4A3K G;  3VYR A;  1QNK A;  1N36 L;  3I2Z A;  4MN3 A;  3S1M H;  4BY1 B;  2K04 A;  3RLF A;  3TRE A;  2AMC B;  1GUT A;  4DV7 L;  1T5E A;  4H02 A;  2FXQ A;  3KJP A;  1PZI D;  3WOF A;  1FL0 A;  2RDG A;  2L5T A;  2NTT A;  1PFM A;  4I7A A;  4RA8 A;  5C44 B;  4DXF A;  5CC4 A;  5FLX L;  1CKM A;  1G8Z D;  1TR5 A;  3V96 A;  3KYH C;  3LWU A;  1F9P A;  3STB D;  4F88 A;  4QGU A;  4PQX A;  4DR7 Q;  1PZJ D;  1EYG A;  4KHP L;  1AE3 A;  3S16 B;  2KUM A;  3L2P A;  3T1H L;  2ALY B;  1JOK A;  5I9P A;  2QIL A;  2KHJ A;  2Q2I A;  2UUA L;  2VS1 A;  4KJN A;  4DF7 A;  1E24 A;  4H13 C;  5IYC H;  4UP9 A;  1RKN A;  3D4W A;  3KJO A;  2XSC A;  3A7L A;  3KF8 A;  4DA2 A;  3F1Z A;  4JI8 Q;  4HSV A;  2B8F A;  1UEA B;  1PYB A;  1VF5 C;  3WWV A;  1Q7Y C;  4OEM B;  4Y52 H;  4E6I A;  3GTK B;  3G6J B;  5JVG 3;  3W2D A;  2R7D A;  5E4W C;  2Z8L A;  1V1P A;  4B3M L;  2VQF L;  2E76 C;  2QA4 A;  3CU7 A;  3BS1 A;  4KY7 A;  1D7Q A;  2CWA A;  3LWE A;  3JAM L;  4OIJ A;  4GZY C;  3FKI G;  1NAP A;  1SDF A;  3OPO A;  5M5Y H;  4JI0 Q;  4R4Q A;  1MHW C;  4J15 A;  3HOX B;  1U4L A;  1J9O A;  1JE4 A;  1J5E L;  3T1H Q;  3OWF A;  2FMM A;  3CPF A;  2A19 A;  5I2X A;  1RDP D;  4DV5 L;  2F0N A;  2F4V L;  3QB3 A;  4LF5 L;  1VQ6 A;  4OO1 G;  2Q2H A;  1BCP D;  1HHV A;  1VQO A;  2UXD L;  4C1N I;  1A63 A;  1CZG A;  1CA6 A;  1B1Z A;  1XMQ L;  1K8G A;  5ELC A;  4DAY A;  3KBG A;  5M3F H;  3OMC A;  2CFM A;  3OOC A;  2A6E D;  3PCO B;  4OON A;  1HPC A;  1E2V A;  5IT9 E;  2DJF C;  4DU9 A;  4KY6 A;  3VR2 A;  2VUM B;  2GN5 A;  3PSI A;  3CXC A;  4KN7 C;  5JPM C;  1EQV A;  1EEF D;  2FIN B;  5C4X B;  3J80 i;  2SDF A;  3EFX D;  3P1H A;  2K28 A;  2N49 A;  4JCV E;  4FDB A;  4K0K Q;  4JI4 Q;  1TWC B;  1BNZ A;  3TP6 A;  2WKD A;  5COR A;  2BE5 D;  3MXP A;  2YV5 A;  5CYU A;  2E8G A;  1OXX K;  2PNH A;  1MIU A;  5FLX c;  1K0S A;  4QIW E;  3A8I E;  1CM9 A;  3PUW A;  4LF7 L;  4B3T Q;  4IUU A;  3C1F A;  1E2Z A;  1H9S B;  2NB0 A;  4ID6 A;  4IJL A;  4LF5 Q;  1GHJ A;  4FYD A;  2NZ1 D;  4JG2 A;  2KCC A;  1EFW A;  1LLR D;  1DCZ A;  5JJI A;  2EQS A;  1E1T A;  2VW9 A;  4A3I G;  4YCV A;  2ZT9 C;  2XWJ B;  5IYD H;  1AN8 A;  4KD4 A;  4R8I A;  3AB9 A;  2AQ2 B;  4BWG B;  4X65 L;  1XYI A;  4OIK A;  2WV6 D;  2K75 A;  1E2W A;  3K7A H;  3BVZ A;  4BXX G;  4K5X A;  2UUB L;  3RUZ A;  4R9W A;  3K80 C;  3CCS A;  1VDZ A;  1AZQ A;  3PO3 G;  1FGU A;  1O7Y A;  1F2L A;  1L2F A;  2QCP X;  5EAY A;  1I6H B;  1KNA A;  1I3Q B;  1RTO A;  1E22 A;  2F03 A;  1IL8 A;  4DR5 L;  2HCC A;  1F2M A;  1X54 A;  2KCN A;  2K5D A;  3SXH A;  3STB C;  3I4N G;  2CQO A;  1N9W A;  4A3M H;  3MTS A;  4UDU C;  2B63 B;  4LF8 L;  4LF7 Q;  2NVT H;  2DN8 A;  1F77 A;  3TME A;  4ZK9 B;  1EY9 A;  3BVM A;  3UDX A;  5GAH C;  4A3K H;  1HR0 L;  4RH6 A;  1DZ1 A;  1EYA A;  4TSS A;  4DV2 L;  1I94 Q;  1M4V A;  3CRL C;  4AQY Q;  1VQ5 A;  2CH4 W;  2Q8T A;  4YCU A;  1A8V A;  1P8L A;  2A1A A;  1RHP A;  4KLK A;  1VQ8 A;  2Z0S A;  4X65 Q;  2X6L A;  4OHJ A;  1TWF B;  2LY7 A;  2B2T C;  4JK1 C;  4KV6 A;  2JA6 G;  4OWT B;  2UUB Q;  3HEJ A;  4LFB L;  1JMC A;  4B3S Q;  1I4P A;  1XJV A;  4C3H B;  3I70 A;  4G4K A;  1FD7 D;  4ZLT F;  4R4T A;  5M3M B;  3F2U A;  1SYB A;  1Y1W B;  2LXK A;  4A3D B;  1H9J A;  2RVL A;  4DR5 Q;  4RCN A;  4KJO A;  4KMU C;  3MXN B;  3L3O C;  3SVM A;  1S5B D;  1X32 A;  2B2Y C;  3PV0 A;  2R7F A;  1KRT A;  5JEA H;  4DK0 A;  1HNW L;  5IP7 G;  5HGQ A;  5FOB B;  1KNE A;  3I4M H;  2NN6 G;  2Q2U A;  1JQY D;  2B2W A;  4L6T B;  1ONL A;  4DR3 Q;  1HR0 Q;  1S5E D;  1LAC A;  3MFG A;  4B08 A;  4PG3 A;  5BN5 A;  4I7Z C;  5E7N A;  2E5L L;  1R9T H;  3H0G B;  2EOT A;  1SNO A;  1PFS A;  2A6E C;  2HHH L;  4DR6 L;  4LFA L;  1GUS A;  5DM6 3;  4X62 L;  2ZJQ A;  3SDZ A;  1WTO A;  3I7F A;  3FKI H;  2K5H A;  1AW7 A;  1QVG A;  1Q8I A;  4LFC L;  1TS2 A;  3Q6S A;  4NB3 A;  2EPB A;  5IGB A;  1HUN A;  1N32 Q;  1CI3 M;  3GDE A;  4DXG A;  5C0X I;  4IFD H;  4HR7 B;  3MC0 B;  4FF2 A;  5CV7 A;  3HOU B;  5M5X H;  3CCL A;  4L5S A;  5IGG A;  1YNJ D;  4L63 B;  1D1I A;  2UXC Q;  2MJ8 A;  1G6P A;  3HOY G;  1EIG A;  3H3V C;  2R92 G;  1B70 B;  2KHI A;  4MIU A;  4S3S A;  1UE7 A;  5EJW A;  3J81 i;  4EVO A;  4X64 Q;  1XMO L;  3H94 A;  2I5H A;  3UDI A;  1X3G A;  4DV0 Q;  1B53 A;  2K32 A;  5IT9 L;  3S9W A;  4PMC A;  3M3Y H;  1OTC A;  2DUD A;  3BJU A;  3SHL A;  4RFB A;  2OT2 A;  2HHH Q;  2PYK A;  1ROD A;  4LFA Q;  3BU2 A;  2L55 A;  4GN4 B;  4X62 Q;  3HOW B;  4LUV A;  2OXP A;  4C3I H;  2OTJ A;  1STG A;  1HUM A;  4A3E G;  2QEJ C;  1EIH A;  5E3F A;  4GOP B;  1WCM G;  2JA5 B;  1HZA A;  2OEO A;  3W1G A;  1HR0 W;  1VQC A;  2ZJR A;  3VYS A;  1VQ4 A;  1STA A;  3RNU A;  3WDN A;  1Q90 A;  2IT1 A;  5GRO A;  2L12 A;  3J81 j;  3A55 A;  1X6O A;  4A3I H;  4CDC C;  1ZKO A;  1FJG L;  3GTQ H;  1TII D;  1AEX A;  3I4L A;  2L9H A;  3H91 A;  5EKL A;  3DM3 A;  4BXX H;  2F0W A;  2WKC A;  4NMZ A;  1WTW A;  2CVR A;  1BR9 A;  4WJ4 A;  3FVQ A;  3PO3 H;  1M90 C;  1PA6 A;  1S5F D;  5EKK A;  2I07 B;  4NP5 A;  4A3B G;  2NVX H;  2PNR C;  4GNX A;  1F2Y A;  4RKB A;  1K9M C;  5CR3 A;  1VQI A;  2YU9 H;  1ICW A;  2D0O A;  1PMR A;  1F2Z A;  1Y8O B;  5ELF A;  5FO8 B;  1PFB A;  3J80 L;  5HGT A;  3DEP A;  1WD0 A;  3A54 A;  1WFQ A;  2N88 A;  3BDL A;  3S1Q H;  1EWC A;  4A3G G;  1KQS A;  2ZXO A;  2ZXP A;  3S1R B;  4PMB A;  3M4Y A;  1SNP A;  4GKJ L;  4JI1 L;  1BBU A;  4LUZ A;  1PHJ A;  1S4Z A;  5C4J B;  3X3N A;  3ND9 A;  4NDX A;  4QUC A;  3EN2 A;  4H44 C;  1CK1 A;  1W3S A;  2JA6 H;  5DAU A;  2L11 A;  2EY2 A;  3JAM i;  1Z9F A;  4DV3 Q;  4A3J G;  2CWP A;  5H1S E;  3S1N B;  5IT9 c;  1U0L A;  2HDL A;  1ZXT A;  4RHS A;  3TN2 A;  2VB2 X;  3NP8 A;  2MFI A;  4HID A;  3GV6 A;  3KF8 B;  2NWG A;  2UUC L;  3NPP A;  3GTG H;  1QG7 A;  1L0W A;  3GTM B;  4N9T A;  5BN3 A;  5IGF A;  2ZJP A;  3Q23 A;  3Q8D A;  1B9N A;  3MHB A;  1PV4 A;  5C0X J;  2NN6 H;  5FO7 B;  1BUV T;  1ET9 A;  3BVG A;  4AYB B;  1I6V C;  2EXD A;  3HKZ B;  4ULL A;  2A68 D;  3S2H B;  1HFG A;  1NNX A;  1Y69 U;  3G7L A;  1HNX L;  1ASZ A;  4KY5 A;  3KK7 A;  1IBM L;  4EQP A;  4A75 A;  4BY7 H;  2EJM A;  1A6X A;  3QOL A;  4RAU C;  3NUC A;  4IZ8 A;  2LFN A;  1GO3 E;  2MPM A;  2IWH A;  4Q0F A;  2HIX A;  4XYO A;  1SYC A;  1G2S A;  1NSN S;  4A93 B;  2UXB L;  3A5U A;  3E9I A;  2QF7 A;  2DY8 A;  3K0X A;  4DV6 L;  4JI6 L;  2A69 D;  5JJK A;  3CCM A;  1ASY A;  3SE0 A;  1F9R A;  4BBS H;  3OIP A;  3M7N A;  4TKO B;  1K83 H;  3KF6 A;  3ERQ A;  2WAQ B;  1N34 Q;  2F3I A;  1Y14 B;  4DAY B;  4RGO S;  1QVF A;  5IWA L;  2JA8 G;  2HUG A;  4Y7N B;  1FR3 A;  3HOZ G;  4DKA C;  3HOY H;  1XX8 A;  1PH4 A;  2JE6 I;  1PLF A;  4A3F B;  3D4D A;  2LXJ A;  3HRZ C;  4FXD A;  3J80 c;  3HS0 C;  1TWG B;  1VQP A;  2MQH A;  1A3V A;  2WII B;  4LUO A;  4BY1 G;  1G6Z A;  3FMC A;  3FEW X;  3M7G A;  3D8G A;  3J7A F;  3HOV B;  3TQY A;  1YVC A;  2JEA I;  3SK4 A;  2AKW B;  3NQT A;  5C44 G;  3R2I A;  3U50 C;  3K7U C;  3AEV A;  1VQA A;  2P5Z X;  4GS3 A;  4GOP C;  4JI2 L;  4BBR G;  1N33 L;  2Z1C A;  5D3I B;  3LGJ A;  3PF5 A;  3CC2 A;  3A8K E;  3QWN A;  4LWC A;  3K5M A;  4JI7 L;  2EZV A;  1B4O A;  5EKI A;  2IX0 A;  1DXM A;  5IWA Q;  2WIN B;  4F7X A;  3S15 B;  3U4Z A;  1QVC A;  4LF4 Q;  3VR4 A;  3CP0 A;  3S1M B;  1LTT D;  1TVX A;  1XPO A;  2N55 A;  1UE1 A;  5LL6 S;  5C3W A;  5IGE A;  1WTV A;  4YHH L;  1RCV D;  5EPK A;  5CMD A;  3KLS A;  2MP1 A;  4BA2 I;  1WD1 A;  1EWH A;  4JPB W;  4IPG A;  2L0C A;  1HNZ L;  1STH A;  4K2L A;  5EBC A;  3IL8 A;  1O80 A;  1Y8P B;  1Q82 C;  1Y1V B;  4A3B H;  2KJX A;  4JI2 Q;  3U9O A;  1TKW B;  3EA6 A;  1D1K A;  5C3E H;  3PIO A;  1RIP A;  4DR4 Q;  3HOX G;  1KDA A;  3RD4 A;  3S17 H;  4DR1 L;  1PRT D;  1MKH A;  1X9N A;  4JI7 Q;  1IXR A;  1SYG A;  4PMW A;  3NWT A;  5M9O A;  2XRS D;  1B7Y B;  4L5Q A;  4BA1 I;  3CPW A;  1D2B A;  1NR4 A;  3F8T A;  1CTM A;  3HFZ B;  2Z4H A;  3AQQ A;  1BF4 A;  3OWE B;  1LO5 D;  3QIA A;  3PO2 H;  1JJC B;  2EYL A;  3J7Y W;  5JEA J;  2JA7 B;  1U4R A;  1QIL A;  3L7Z C;  5D65 A;  2VUM G;  5AFW A;  5FLM G;  2V1C C;  4DK1 A;  1EY4 A;  1NTG A;  4B9W A;  5C4X G;  4M8A A;  1HNZ Q;  2KHS A;  5C5L A;  1DOM A;  1UE6 A;  1KD1 C;  5KIX A;  5M5W H;  5M5Y B;  3S24 A;  5I9O A;  1IL2 A;  4HMI A;  2D0P A;  3GV3 A;  1S5C D;  3GTJ B;  2A69 C;  2JP1 A;  1QUQ A;  5AJ3 L;  4GN5 A;  4IQZ A;  2J7Z A;  1AP0 A;  4FF1 A;  2LSS A;  1TY0 A;  3M85 A;  3V2T A;  1EIF A;  5K36 G;  2BA1 A;  5IOD A;  1VMP A;  3RZD H;  1QWY A;  1V43 A;  1HQR D;  5J3B A;  5CBE E;  1HH2 P;  4APV A;  4IFD J;  4AYB E;  3HKZ E;  1Y8N B;  3NTI A;  4ALP A;  1B44 D;  1PH5 A;  2MNA A;  1JOQ A;  5DM7 3;  5LMU L;  1N36 Q;  1P16 A;  3T56 B;  1X3E A;  1S5D D;  4QJF A;  1BCP B;  2SNM A;  5DNF A;  4HIO A;  1GD7 A;  1OXU A;  3RN5 A;  4DV7 Q;  2Y0S B;  1KAA A;  1K28 A;  1M1K C;  4H0L C;  2G9D A;  4CKE A;  3J81 c;  3CAM A;  4KKT A;  2EYF A;  1J8I A;  4PZ7 A;  1FNV A;  2K01 A;  5AJ3 Q;  4G7H C;  3HOZ H;  4U67 3;  1E3P A;  4IAL A;  2B63 G;  2I0Q A;  2WAQ E;  4K14 A;  1YNN D;  1M8A A;  3W1B A;  4KHP Q;  1PYW D;  4HJ9 A;  2K52 A;  4JV5 L;  2YTV A;  2RHQ B;  4P72 A;  1WYD A;  4EX5 A;  4DR2 L;  3ULP A;  2UUA Q;  3NBH A;  5EBD A;  2NYZ D;  4NKL A;  3DEO A;  1MJE A;  4XIG S;  2PO4 A;  5E1F A;  4HN7 A;  2L15 A;  4P73 A;  3FPP A;  1PTO D;  2WP8 J;  1XNQ L;  1CSP A;  1E7Z A;  3P75 A;  5C44 H;  3H6M A;  4B9X A;  4HJA A;  2Z4I A;  4BBR H;  4CJ1 B;  2OCE A;  1YHQ A;  2F3V A;  2MUY A;  4C3H G;  2F0E A;  4B3M Q;  2VQF Q;  1KIX A;  4IUR A;  5CV9 A;  3MWY W;  1Y1W G;  3S16 H;  4A3D G;  1LTG D;  2EY1 A;  4ZCK A;  1Q12 A;  1PTO H;  2XN9 C;  1XNR L;  1X3F A;  4DUY L;  1AFP A;  1F9S A;  2J0T D;  2AWN A;  1GUG A;  1TWH H;  1OO9 B;  1J5E Q;  2JXM B;  2M00 A;  1AZP A;  1VQL A;  3SGI A;  4DV5 Q;  2F4V Q;  2H5X A;  3BDC A;  2UXD Q;  1KDB A;  3WOE A;  1LT5 D;  2PZU A;  5L37 A;  1XMQ Q;  2BA0 A;  1IHZ A;  2FFK B;  1PVO A;  2DJG C;  4GNX B;  1I4X A;  1TS5 A;  3G4S A;  1SYE A;  3VYT A;  1I5F A;  1L1O A;  2KED A;  4JC0 A;  1NMF A;  4C2M H;  1D5Z C;  4XDX A;  3A74 A;  2A8V A;  2F4I A;  4I65 A;  1PH9 A;  3ER0 A;  2BH8 A;  4NXN L;  4QCL A;  3CQZ B;  4GKK L;  1BKB A;  1BCP F;  2JSO A;  3EVQ A;  1VQ9 A;  3KBX A;  2SEB D;  3T53 B;  1SFO H;  4FF3 A;  5IGC A;  1HTP A;  1LV9 A;  3HOU G;  2OQK A;  1LT4 D;  1YZ6 A;  2HQL A;  3NQI A;  2EYM A;  1YJN A;  3I4M B;  1Q3L A;  1U5K A;  5J39 A;  3JAM c;  2F0M A;  4DNT B;  4DUZ L;  1NJI C;  2A6H D;  1XTC D;  2UU9 L;  5E4X A;  1V1O A;  3I4O A;  5J22 A;  2VXW A;  1R9T B;  2F0O A;  4EQO A;  2O2L D;  3PUX A;  2RKS A;  2K5N A;  4EQN A;  4A76 A;  1BVS A;  1NMG A;  2WFW A;  4JI5 L;  2A5H A;  2QEX A;  2IY5 B;  3B6Y A;  5IP9 G;  5C4X H;  3HOW G;  1VQJ A;  4FF4 A;  1G51 A;  3FKI B;  3I8Z A;  3TZU A;  1HCZ A;  1TY2 A;  1S40 A;  2XVS A;  2E2J H;  1F9Q A;  4B3R L;  4KKS A;  4X66 L;  1VS0 A;  4C3J B;  1IW7 D;  1HA5 A;  2F0G A;  2JA5 G;  2B2W C;  3NTH A;  2ZTC A;  5LHY 1;  1JB3 A;  3UE0 A;  4LF9 L;  1D8L A;  4DK6 C;  1CKN A;  2Q8I B;  1SMY D;  3CC4 A;  3NE5 B;  4JVZ A;  4ZUJ A;  1B3A A;  2K05 A;  3CD6 A;  3TP7 A;  1YNN C;  3URY A;  4LF8 Q;  2EYH A;  4LAA A;  4IOC A;  1IBL L;  3HZX A;  3T13 A;  3NBI A;  4ZKB B;  4MTK A;  3AU7 A;  4DV2 Q;  3M3Y B;  2K7V A;  2RSN A;  4OX9 L;  2I5M X;  1BCP C;  2AWO A;  4JI5 Q;  1HJP A;  5K5P A;  1Q1B A;  1X3P A;  3OSO A;  4C3I B;  1PTO C;  4K8J A;  1I6H H;  3T16 A;  1DD2 A;  1R4Q B;  2Y0S E;  4X66 Q;  3P20 A;  3A7A B;  4AIM A;  5F2D A;  3EIV A;  1YBY A;  1IYJ B;  4RWS C;  4UHV A;  4CKC A;  2DGY A;  4LFB Q;  2B63 H;  4R4I A;  2PW7 A;  1EFI D;  2XNA C;  4KHV A;  1AE2 A;  1KHI A;  5HUR A;  3RZO B;  3KFU A;  3HP3 A;  1UEB A;  2BE5 C;  4OO1 H;  2WAC A;  4HTH A;  2Q8R E;  4MNO A;  1HNW Q;  1KDC A;  2KCT A;  4M1U B;  2HCI A;  1JE5 A;  1K3B C;  1C48 A;  4KTA A;  1BO0 A;  1W6K A;  1S72 A;  4JBW A;  1SE3 A;  4OGQ C;  5IYB G;  1QZG A;  2E5L Q;  4FO2 A;  2F0U A;  3JC6 6;  2JN4 A;  4N8X 1;  5GAE C;  2VQE L;  3OW2 A;  1YJ9 A;  1LTI D;  2NVX B;  1SNQ A;  3K8A A;  2JA9 A;  4DR6 Q;  4WOR A;  2YU9 B;  3OTO L;  3T1Y L;  3ZJY C;  1D6E C;  2GVB A;  3M4Q A;  3I55 A;  4WFN 3;  4LFC Q;  3E9H A;  2B3G A;  2RF4 A;  4HIM A;  3GP7 A;  3FPU B;  3S1Q B;  2PPB C;  4PV1 C;  1LT6 D;  4R4O A;  2EJG C;  3L0O A;  2FJ2 A;  3HKZ G;  1VQB A;  2PMZ B;  2R7Z B;  1LTR D;  4IN3 A;  2C5C A;  2A6H C;  4Z9C B;  3LX0 A;  1X56 A;  3Q0A A;  3ERS X;  4GNX C;  3SR1 A;  2EYP A;  1VQN A;  1XMO Q;  4A93 G;  4UAI A;  3MA2 B;  1X55 A;  4LF6 L;  1A15 A;  3RLO A;  3S2D H;  1ML0 D;  1XXG A;  1JOR A;  2F0D A;  5T1I A;  1SE2 A;  1HZB A;  5JJZ A;  4J6H A;  3H3V I;  1STN A;  4YWL A;  1STE A;  5JPN C;  2CHB D;  2I5L X;  2KEC A;  3M4P A;  1W6J A;  1KAW A;  2HQE A;  2PCF B;  2R93 B;  4KHZ A;  2RDF A;  3AYH B;  5LMN L;  1JT8 A;  4QQB X;  3I4N H;  4A3F G;  4QB4 A;  1SND A;  1JIC A;  1K3R A;  4IPC A;  5G3L D;  1PXU A;  4XTC S;  3GTO B;  1PDQ A;  4A3L G;  2F0I A;  4BY7 B;  1S3O A;  1XTD A;  4XT3 B;  3G6E A;  3DWA A;  4G57 A;  3HOV G;  4NXM L;  4K2K A;  2KA7 A;  1FJG Q;  1DM0 B;  2IHE A;  1VQK A;  3HOW H;  2ES2 A;  1JWM D;  3CCE A;  1QUQ B;  3ITP A;  1VQM A;  4WJ3 M;  5I2Y A;  4RGN A;  2JA5 H;  4BBS B;  2QW7 A;  2PI2 A;  2DY7 A;  2KBN A;  1PH3 A;  1K83 B;  1KTK A;  5GQO A;  5KRU A;  1GJX A;  5ELE A;  2B2U A;  2QGQ A;  1N8R C;  1H95 A;  1YHB A;  1EL0 A;  4UP7 A;  2FMC A;  1WTR A;  1D5X C;  3E0E A;  2E2H H;  3UDF A;  1HZ9 A;  2NVQ H;  3E5S A;  4A4I A;  1A0I A;  4ME3 A;  1C9O A;  1SAP A;  5IGD A;  1H9M A;  5IP7 H;  1WTQ A;  3D6W A;  4GLV B;  4DPG A;  3TS0 A;  2R3Z A;  1YNJ C;  1I4R A;  4IO9 A;  3CKI B;  4FNF A;  1V1P B;  2X6G A;  2RA4 A;  1LTL A;  5JOB A;  4GKJ Q;  2VNU D;  4JI1 Q;  1WOC A;  2AQ3 B;  3NTK A;  3NK9 A;  1OXS C;  1Y1V G;  2EY6 A;  2ZTE A;  1O7Z A;  4K5V A;  3CF5 A;  3RLN A;  3M4O H;  3BZD B;  3L9A X;  3TDQ A;  1DGS A;  4QF4 A;  4ABN A;  4DNR B;  4DAV A;  1C8C A;  3TS2 A;  4TQU S;  4NW2 A;  5CBA E;  3MFY A;  2L4N A;  1K8O A;  2G5D A;  1EIY B;  5IYC G;  2SOB A;  3NBH B;  4OEL B;  3MXN A;  2PZW A;  2V4D A;  3VR3 A;  1KLG D;  3E6Z X;  2UUC Q;  2NZH A;  3ZYY X;  1PFN A;  4IFD I;  4JYA L;  2NVY H;  4HED A;  3VA5 A;  2R92 H;  2RSO A;  1QE6 A;  1TWA H;  3OIQ A;  2JA7 G;  1SEB D;  1DJR D;  1HNX Q;  2I46 A;  3DMU A;  1NCV A;  3BZK A;  1IBM Q;  4OL7 A;  1LTB D;  1ENF A;  5BN4 A;  1HA6 A;  2KCM A;  2N3S A;  1JWS D;  1VQ7 A;  3IRB A;  4A3B B;  4BS9 A;  5C0X G;  2CH4 A;  2NTS A;  4N8F A;  3PIP A;  5C3E B;  2F0F A;  4H7B A;  4YCW A;  5BR8 L;  2UXB Q;  3R3O A;  3U58 A;  1UUP A;  1O7L A;  4A3E H;  2E2I H;  3S17 B;  4LJZ C;  4DV6 Q;  4JI6 Q;  3GTM H;  3CCQ A;  2E2D C;  4HIK A;  2VB3 X;  1EOT A;  1WCM H;  1BQQ T;  2K5W A;  2LMC B;  1QJO A;  3CC7 A;  5A35 A;  1EQT A;  3CCR A;  1YIT A;  4CDE C;  1IKL A;  2R6G A;  3C3L A;  1T9H A;  3BG3 A;  2EYO A;  4K5W A;  1HTL D;  1LTS D;  3PO2 B;  3MZ5 A;  2PMZ E;  4TRD A;  1I50 H;  4K6D A;  5FO9 B;  1ET6 A;  1L1O B;  1PRT B;  3ERO A;  2TMP A;  1PH8 A;  2K14 A;  1IBK L;  4A93 H;  1G2T A;  1EU3 A;  1PYS B;  4XXE A;  1BXT A;  2F1M A;  4DV1 L;  2H4O A;  2D62 A;  2O4X A;  1QCB D;  1I4Q A;  2Q2T A;  4YWM A;  2GVA A;  5ELB A;  4HMJ A;  1QB5 D;  3DHQ A;  5BR8 Q;  2XGT A;  1V1Q A;  1TQO A;  4RG1 A;  3R8B A;  5C4H A;  4ZKC B;  4Y7N H;  3Q24 A;  3PMF A;  1CHP D;  3HGB A;  1N33 Q;  3DXJ C;  3PQI A;  3RN2 A;  4A3F H;  3RZD B;  5D14 A;  4XT1 B;  1A2U A;  1TWG H;  1GUO A;  4P75 A;  4ZAI A;  3K5L A;  5IYD G;  4GLX A;  1EOV A;  2ATW A;  1B9M A;  1K0R A;  4TVA B;  3FHW A;  2IJ0 A;  2VL6 A;  4A3G H;  5HY6 A;  3QO2 A;  3R2T A;  5ELN A;  1I4G A;  4YY3 L;  1SNC A;  3GTL H;  4LNQ A;  2NBF A;  2Z6K A;  2JK8 A;  2PQA A;  1FYC A;  5JAV A;  5ISR A;  1SE4 A;  3CME A;  4CJ2 C;  2A68 C;  2MGS A;  4YHH Q;  4RCO A;  2B8G A;  3EBE A;  3RMH A;  4DR7 L;  4ZYS A;  3K5O A;  3K58 A;  1V8Q A;  4A3J H;  1SYF A;  4RGM A;  4V19 0;  4J1M A;  2YTX A;  4CHT B;  1DOL A;  1YEZ A;  1CKN B;  4FXK C;  4DK3 C;  5NUC A;  1EY6 A;  5FK9 C;  2EDG A;  1Z6H A;  1EY8 A;  4JI8 L;  3TP8 A;  3S15 H;  2B2V C;  3FRP B;  1X3Q A;  3KDF A;  3CCU A;  4DR1 Q;  1OXV A;  1JCK B;  1QZH A;  1I4H A;  2L1B A;  3TSS A;  2CKZ B;  4IUT A;  1XPR A;  3S14 H;  4Q5V A;  2DNC A;  2NN6 I;  5M3F B;  1TXY A;  2KVM A;  1EY0 A;  4YY3 Q;  1SRU A;  4RKL A;  3K57 A;  4K8I A;  3K0Y A;  4YIJ A;  1E0B A;  3I73 A;  3TP5 A;  4CDF C;  3GTP H;  1Y1V H;  3BDO A;  2AUJ D;  2B2V A;  4BBR B;  4JI0 L;  1PRT F;  2F0K A;  2FHT A;  5EGT A;  3D4R A;  2D9U A;  1EWI A;  1V9P A;  3DM1 A;  3MXG A;  1PTO B;  1MSH A;  1B3Q A;  1FNU A;  4XYQ A;  1ZYR D;  4JOI C;  5JEA G;  4JI3 L;  4K6L A;  3I4M G;  1TWH B;  3M9B A;  1EEI D;  2MO1 A;  4XQN A;  2LKV A;  2JA8 H;  2QDL A;  2LS0 1;  4X3T A;  4XQJ A;  1II3 A;  4CBV A;  1CSQ A;  2IX3 A;  1JJ2 A;  1XWE A;  2JA7 H;  5ELD A;  3LNN A;  4BY1 H;  3KLS X;  2K1B A;  1SJH D;  3MXU A;  3O13 A;  1WJJ A;  2WB1 B;  2ENB A;  4JOI A;  3G71 A;  1EUJ A;  4G7Z C;  4JI4 L;  4K0K L;  3K7A B;  4U68 A;  1CKO A;  4C2M B;  5C0X H;  2IHF A;  1RF2 D;  1GHK A;  5LMU Q;  3C2P A;  2SNS A;  4C3J G;  3GTJ H;  5FKA C;  5JJL A;  1SFO B;  4IFD G;  4B3T L;  2NZO A;  4PZ6 A;  4HJ8 A;  1CA5 A;  2F0T A;  5KND A;  3E0J A;  1A3T A;  1RL2 A;  5M3M G;  4DFA A;  1B8A A;  3OHX C;  3F2B A;  1SR3 A;  4JI3 Q;  3OMG A;  3AMU A;  1JJG A;  4A3M B;  5I6W A;  4IUP A;  2NVT B;  1C4Q A;  4O1N A;  5LL6 X;  1Q86 C;  4A3K B;  1L1O C;  1PRT C;  2F0L A;  4KI0 A;  4JV5 Q;  4XQQ A;  3UDG A;  1NY4 A;  1VQG A;  2R61 A;  4DR2 Q;  3H15 A;  1NR2 A;  3GTK H;  3T4A C;  5KYI A;  3K59 A;  5DEH A;  5CV6 A;  1FVI A;  4C3I G;  2E2J B;  3H0G G;  1CZW A;  2RQX A;  2JYO A;  1B50 A;  3I91 A;  4QL5 A;  3IFD A;  1XNQ Q;  1JB7 A;  5KNB A;  4V0B A;  2CW0 D;  1BOS A;  4CJ0 B;  1Q1E A;  2F0J A;  2CCZ A;  2ZXR A;  1K73 C;  4HCS A;  5KNC A;  2F3W A;  3HOX H;  5JVH 3;  4ODG A;  2ZTD A;  1I94 L;  2K4K A;  1RD9 D;  1Z7T A;  4AQY L;  1MD2 D;  3BZC A;  4HJ7 A;  1PTO F;  1XNR Q;  1K8M A;  1WTH A;  1EU4 A;  2YTY A;  1YI2 A;  1VQD A;  4DUY Q;  1LTA D;  1UAP A;  1KLU D;  3BYY B;  3QOJ A;  1PH6 A;  3N6R A;  2N8N A;  3H3V H;  1WI5 A;  1FNW A;  2E75 C;  3QR8 A;  4RHR A;  4C56 C;  1LM0 A;  1O78 A;  4OWW B;  1U4P A;  3ND8 A;  4JBJ A;  4B3S L;  5EQ0 A;  2B29 A;  2VUM H;  1SN8 A;  1R4P B;  2NUC A;  3GQB A;  3MEH A;  3UI2 A;  3Q22 A;  5FLM H;  1TT2 A;  3W5O A;  3J80 E;  1D5M C;  4DGZ A;  1GUN A;  1NUC A;  1TWC H;  1HFN A;  3R93 A;  1MSG A;  2C35 B;  4LW1 A;  5C4Z A;  1EY7 A;  1PH7 A;  3MEF A;  3PIP 3;  4DR3 L;  4NXN Q;  4GKK Q;  3ULL A;  2QKI C;  5M5X B;  5D3D A;  3CCV A;  2ZM6 L;  1ZYR C;  1LAB A;  3I90 A;  5K36 H;  1MI2 A;  4HJ5 A;  1UE5 A;  2R7Z G;  2IL8 A;  1TS3 A;  4ME5 A;  1VF7 A;  3D6C A;  1GKH A;  4DUZ Q;  1EZ8 A;  1TS4 A;  2UU9 Q;  1VQF A;  3F2D A;  5COY A;  2CQA A;  1SXT A;  3GO5 A;  4EQ5 A;  5CGK A;  1CUK A;  1GOZ A;  4WRD A;  1N32 L;  3PF4 A;  4WJW A;  1BDO A;  4YWK A;  1K8A C;  3SK8 A;  3CQZ H;  3MVV A;  2O5I C;  3FP9 A;  2DNE A;  3KF6 B;  1IKM A;  5A2Q E;  2B2T A;  4O2D A;  4B3R Q;  2HIV A;  1I3Q H;  2UXC L;  3OYY A;  5I6Y A;  2R93 G;  5KGU A;  2XTI A;  4JW0 A;  1DON A;  2ICI A;  4HSP A;  1ESR A;  3IFT A;  4X64 L;  3NSW A;  3KUP A;  2K50 A;  2ZM6 Q;  5IY0 A;  4ZUI A;  5EPJ A;  4L5R C;  4LF9 Q;  4HCE A;  4UPA A;  4DV0 L;  2GA4 B;  4BY7 G;  3SK5 A;  3ICE A;  2PW5 A;  3PIO 3;  4A3I B;  5TSS A;  3GTQ B;  1MGS A;  1NE3 A;  1JOO A;  2B2Y A;  4A3C G;  3CMA A;  2QDB A;  1HQM C;  1SSO A;  2KEE A;  1RTN A;  1IBL Q;  1TWF H;  2A73 B;  2WB1 E;  3K81 C;  3S2D B;  2VY3 A;  2XWB B;  1YNX A;  2O5J C;  5I4D A;  4C3J H;  3C1E A;  4RGT A;  4OX9 Q;  1CQV A;  2HD3 A;  2JJQ A;  5FJ8 G;  1A3U A;  3PO3 B;  4BBS G;  5T1G A;  1CFM A;  3NEN A;  3X3M A;  3HKS A;  4P2C B;  1Q8K A;  1EYC A;  4IPD A;  3T51 B;  1E1O A;  4C3H H;  1U9R A;  5M3M H;  2HDM A;  2CW0 C;  2EJF C;  4QMG A;  1Y1W H;  4JBK A;  4A3D H;  3I4N B;  2EYJ A;  1UWV A;  3D0F A;  4EGV A;  2KEN A;  2PZT A;  3NXW A;  1JWU D;  3SEB A;  3F2C A;  3AFP A;  1T5X D;  3PGZ A;  4AYB G;  3A56 A;  1L0X B;  1ICF B;  1STB A;  1C7Y A;  3ULJ A;  1EY5 A;  2TSS A;  1VQE A;  1VMC A;  3IAY A;  4UY8 C;  4RMF A;  3H0G H;  3KLW A;  3IKJ A;  4P74 A;  3CRK C;  2RHS B;  2JEB I;  1MJC A;  1STY A;  3A0J A;  2JA6 B;  2VZA A;  4DV4 L;  2Z9H A;  1VQH A;  2Z6B A; 
#chains in the Genus database with same CATH homology
 2BDN A;  4DN4 M;  4KKU A;  3EQL C;  1G29 1;  1U4M A;  1SBB B;  1JR0 D;  2RDH A;  3OW7 A;  5CV4 A;  2BDO A;  2E2H B;  4FXG C;  4QUF A;  2NVQ B;  3GTG B;  1IW7 C;  1RJT A;  2H1E A;  1CHQ D;  5C6A A;  5IIF A;  2EY5 A;  2K6A A;  3QJY A;  3J81 E;  2F0V A;  1H9S A;  1ENC A;  3D31 A;  1SMY C;  4C1N K;  3I3C A;  4KD3 A;  4ZQ3 A;  3U9S A;  2B2U C;  1ILP A;  2C9O A;  3N52 A;  1EYD A;  1DOK A;  1ZEQ X;  3M4O B;  4LK1 C;  1WTX A;  2D2C C;  2F0H A;  1SYD A;  3MAQ A;  2B39 A;  4PNY A;  1EZ6 A;  3H09 A;  4X3U A;  2F0S A;  2KOL A;  3K6O A;  2K33 A;  1WVL A;  4FP5 D;  2NVY B;  3HOY B;  4ILW A;  2R92 B;  5IOC A;  1TWA B;  1SNM A;  1CQF A;  2E74 C;  1FGB D;  4X3K A;  3A8J E;  2XRQ D;  2BCO A;  4O42 A;  4N9P A;  4CKB A;  1HRJ A;  1UNS A;  2EXZ A;  2D5D A;  3NWS A;  1HXY D;  3FDT A;  1BBX C;  5FLX E;  3VYU A;  3I72 A;  4A3E B;  3TBI B;  2E2I B;  2ID0 A;  1WCM B;  5G3L F;  1CT1 D;  2A74 C;  5A2Q L;  3PUV A;  2ICE C;  3PUY A;  3VR5 A;  2EE1 A;  2IX1 A;  4ZRZ A;  5C3X A;  3W3A A;  4J8Q A;  2XIW A;  5CV8 A;  1I50 B;  4LMQ D;  1GUW A;  2YYZ A;  3DWP A;  1ESF A;  4OO1 I;  4IUV A;  2F0P A;  2G9H D;  3JAM E;  2KQ3 A;  5KEE A;  3D3R A;  3P7J A;  4F8M A;  1KAB A;  2IW3 A;  4IUN A;  1SJE D;  3PUZ A;  2AUK A;  3VR6 A;  4R8N A;  3J7A V;  4FVM A;  1IYU A;  1VCI A;  5EPL A;  2X69 A;  3V05 A;  4CGY B;  1OXT A;  3SK6 A;  4F87 A;  3BYT B;  4A3G B;  2OF1 A;  1TU2 B;  3GTL B;  2BOS A;  2MHV A;  4MHE A;  3GD7 A;  3KLR A;  1ENA A;  1LT3 D;  4A3J B;  3ONA B;  5M5W B;  3NHH A;  4QIW B;  2IPK D;  4X3S A;  1PZK D;  2RBM A;  1H9R A;  1WTP A;  4HAE A;  1IYV A;  3S14 B;  5CV5 A;  4IUQ A;  1H9K A;  2M2L A;  2F0Q A;  3EJI A;  3TZD A;  4DAP A;  3J81 L;  4G7O C;  2K03 A;  3GTP B;  1DYQ A;  1A2T A;  1L0Y B;  4KK7 A;  1ILQ A;  1QOH A;  3QG1 A;  3DUZ A;  2PQE A;  1Z47 A;  1QNU A;  3VA7 A;  1MBY A;  5KYL A;  3K5N A;  1GXD C;  1B2T A;  3HG9 A;  1JC7 A;  1G91 A;  3C46 A;  2K5Q A;  2EVB A;  2JA8 B;  2M9V A;  3HOZ B;  5J1Z A;  5C5M A;  2J4X A;  2AQ1 B;  4KN4 C;  3DWQ A;  4L8J A;  3CHB D;  3VYR A;  1QNK A;  4MN3 A;  4BY1 B;  2K04 A;  3RLF A;  1GUT A;  1T5E A;  1PZI D;  3WOF A;  2RDG A;  2L5T A;  2NTT A;  1PFM A;  4RA8 A;  5C44 B;  4DXF A;  5CC4 A;  5FLX L;  1G8Z D;  1TR5 A;  3V96 A;  3LWU A;  1F9P A;  4F88 A;  4PQX A;  1PZJ D;  3S16 B;  2KUM A;  1JOK A;  5I9P A;  2QIL A;  4KJN A;  4DF7 A;  4H13 C;  1RKN A;  3D4W A;  2XSC A;  3A7L A;  3KF8 A;  4DA2 A;  4HSV A;  2B8F A;  1UEA B;  1VF5 C;  4E6I A;  3GTK B;  3G6J B;  5JVG 3;  3W2D A;  5E4W C;  2Z8L A;  1V1P A;  2E76 C;  3CU7 A;  3BS1 A;  4KY7 A;  3LWE A;  3JAM L;  4OIJ A;  4GZY C;  1NAP A;  1SDF A;  3OPO A;  3HOX B;  1U4L A;  1J9O A;  1JE4 A;  3OWF A;  2FMM A;  5I2X A;  1RDP D;  2F0N A;  3QB3 A;  4OO1 G;  1BCP D;  1HHV A;  4C1N I;  1CZG A;  1CA6 A;  1B1Z A;  5ELC A;  4DAY A;  3KBG A;  3OMC A;  3OOC A;  2A6E D;  1HPC A;  1E2V A;  5IT9 E;  4DU9 A;  4KY6 A;  3VR2 A;  2VUM B;  4KN7 C;  5JPM C;  1EQV A;  1EEF D;  2FIN B;  5C4X B;  2SDF A;  3EFX D;  3P1H A;  2K28 A;  1TWC B;  1BNZ A;  3TP6 A;  2WKD A;  5COR A;  2BE5 D;  3MXP A;  5CYU A;  1OXX K;  3A8I E;  1CM9 A;  3PUW A;  4IUU A;  3C1F A;  1E2Z A;  1H9S B;  2NB0 A;  4ID6 A;  4FYD A;  1GHJ A;  2NZ1 D;  2KCC A;  1LLR D;  1DCZ A;  2ZT9 C;  2XWJ B;  1AN8 A;  4KD4 A;  4R8I A;  3AB9 A;  2AQ2 B;  4BWG B;  1XYI A;  4OIK A;  2WV6 D;  1E2W A;  3BVZ A;  4K5X A;  3RUZ A;  4R9W A;  1VDZ A;  1AZQ A;  1O7Y A;  1F2L A;  2QCP X;  1I6H B;  1KNA A;  1I3Q B;  1RTO A;  2F03 A;  1IL8 A;  3SXH A;  2HCC A;  2KCN A;  1F2M A;  2K5D A;  3MTS A;  4UDU C;  2B63 B;  2DN8 A;  1F77 A;  3TME A;  4ZK9 B;  1EY9 A;  3BVM A;  4RH6 A;  1DZ1 A;  1EYA A;  4TSS A;  1M4V A;  3CRL C;  2Q8T A;  1RHP A;  2X6L A;  4OHJ A;  1TWF B;  2LY7 A;  2B2T C;  4JK1 C;  4KV6 A;  3HEJ A;  1I4P A;  4C3H B;  3I70 A;  4G4K A;  1FD7 D;  4ZLT F;  5M3M B;  3F2U A;  1SYB A;  1Y1W B;  4A3D B;  1H9J A;  2RVL A;  4RCN A;  4KJO A;  4KMU C;  3L3O C;  3SVM A;  1S5B D;  1X32 A;  2B2Y C;  3PV0 A;  5JEA H;  4DK0 A;  5FOB B;  1KNE A;  2NN6 G;  1JQY D;  2B2W A;  4L6T B;  1ONL A;  1S5E D;  1LAC A;  3MFG A;  4B08 A;  5BN5 A;  4I7Z C;  3H0G B;  2EOT A;  1SNO A;  2A6E C;  1GUS A;  5DM6 3;  3SDZ A;  1WTO A;  1AW7 A;  1Q8I A;  1TS2 A;  3Q6S A;  2EPB A;  5IGB A;  1HUN A;  1CI3 M;  4DXG A;  5C0X I;  4IFD H;  4HR7 B;  3MC0 B;  4FF2 A;  5CV7 A;  3HOU B;  5IGG A;  1YNJ D;  4L63 B;  1D1I A;  2MJ8 A;  1EIG A;  3H3V C;  4MIU A;  4S3S A;  5EJW A;  4EVO A;  3H94 A;  1B53 A;  2K32 A;  5IT9 L;  3S9W A;  4PMC A;  3SHL A;  4RFB A;  2OT2 A;  2PYK A;  1ROD A;  3HOW B;  2L55 A;  2OXP A;  1STG A;  1HUM A;  2QEJ C;  1EIH A;  5E3F A;  2JA5 B;  2OEO A;  3VYS A;  1STA A;  3WDN A;  1Q90 A;  2IT1 A;  2L12 A;  3A55 A;  1ZKO A;  1TII D;  1AEX A;  3I4L A;  2L9H A;  3H91 A;  5EKL A;  2F0W A;  2WKC A;  4NMZ A;  1WTW A;  2CVR A;  1BR9 A;  3FVQ A;  1S5F D;  5EKK A;  2I07 B;  4NP5 A;  2PNR C;  1F2Y A;  4RKB A;  5CR3 A;  1ICW A;  1PMR A;  1F2Z A;  5FO8 B;  1Y8O B;  5ELF A;  1PFB A;  3J80 L;  5HGT A;  3DEP A;  1WD0 A;  3A54 A;  2N88 A;  3BDL A;  1EWC A;  2ZXO A;  2ZXP A;  3S1R B;  4PMB A;  3M4Y A;  1SNP A;  1S4Z A;  5C4J B;  3X3N A;  3ND9 A;  4NDX A;  4QUC A;  4H44 C;  1CK1 A;  5DAU A;  2L11 A;  2EY2 A;  3S1N B;  2HDL A;  1ZXT A;  4RHS A;  3TN2 A;  2VB2 X;  3NP8 A;  3GV6 A;  2NWG A;  3NPP A;  1QG7 A;  3GTM B;  4N9T A;  5BN3 A;  5IGF A;  3Q23 A;  1B9N A;  3MHB A;  5C0X J;  2NN6 H;  5FO7 B;  1BUV T;  1ET9 A;  3BVG A;  4AYB B;  1I6V C;  3HKZ B;  4ULL A;  2A68 D;  3S2H B;  1HFG A;  1Y69 U;  3G7L A;  4KY5 A;  3KK7 A;  4EQP A;  2EJM A;  1A6X A;  3QOL A;  4RAU C;  3NUC A;  4IZ8 A;  2LFN A;  2MPM A;  2IWH A;  4Q0F A;  4XYO A;  1SYC A;  1G2S A;  1NSN S;  4A93 B;  2QF7 A;  2DY8 A;  2A69 D;  3SE0 A;  1F9R A;  3OIP A;  3M7N A;  4TKO B;  3ERQ A;  2WAQ B;  4RGO S;  2HUG A;  4Y7N B;  1FR3 A;  1XX8 A;  2JE6 I;  1PLF A;  4A3F B;  3D4D A;  3HRZ C;  4FXD A;  3HS0 C;  1TWG B;  1A3V A;  2WII B;  1G6Z A;  3FMC A;  3FEW X;  3M7G A;  3D8G A;  3J7A F;  3HOV B;  2JEA I;  3SK4 A;  3NQT A;  3R2I A;  2Z1C A;  5D3I B;  3A8K E;  3QWN A;  3K5M A;  2EZV A;  1B4O A;  5EKI A;  2IX0 A;  1DXM A;  2WIN B;  4F7X A;  3S15 B;  3VR4 A;  3S1M B;  1LTT D;  1TVX A;  2N55 A;  5C3W A;  5LL6 S;  5IGE A;  1WTV A;  1RCV D;  5EPK A;  5CMD A;  3KLS A;  2MP1 A;  4BA2 I;  1WD1 A;  1EWH A;  2L0C A;  1STH A;  4K2L A;  5EBC A;  3IL8 A;  1O80 A;  1Y8P B;  1Y1V B;  2KJX A;  3U9O A;  1TKW B;  3EA6 A;  1D1K A;  1KDA A;  3RD4 A;  1PRT D;  1SYG A;  4PMW A;  3NWT A;  5M9O A;  2XRS D;  4BA1 I;  1D2B A;  1NR4 A;  1CTM A;  2Z4H A;  1BF4 A;  3OWE B;  1LO5 D;  3QIA A;  2EYL A;  3J7Y W;  5JEA J;  2JA7 B;  1U4R A;  1QIL A;  3L7Z C;  5D65 A;  5AFW A;  4DK1 A;  1EY4 A;  4B9W A;  4M8A A;  2KHS A;  5C5L A;  1DOM A;  5KIX A;  5M5Y B;  5I9O A;  4HMI A;  3GV3 A;  1S5C D;  3GTJ B;  2A69 C;  2JP1 A;  4IQZ A;  2J7Z A;  1AP0 A;  4FF1 A;  1TY0 A;  3M85 A;  3V2T A;  5K36 G;  2BA1 A;  5IOD A;  1VMP A;  1QWY A;  1V43 A;  1HQR D;  5CBE E;  4IFD J;  1Y8N B;  3NTI A;  1B44 D;  1JOQ A;  5DM7 3;  3T56 B;  1S5D D;  1BCP B;  2SNM A;  5DNF A;  1OXU A;  2Y0S B;  1KAA A;  4H0L C;  2G9D A;  4CKE A;  4KKT A;  2EYF A;  1J8I A;  1FNV A;  2K01 A;  4G7H C;  4U67 3;  4IAL A;  4K14 A;  1YNN D;  1M8A A;  1PYW D;  3NBH A;  5EBD A;  2NYZ D;  4NKL A;  3DEO A;  4XIG S;  2PO4 A;  5E1F A;  4HN7 A;  3FPP A;  1PTO D;  2WP8 J;  3P75 A;  3H6M A;  4B9X A;  2Z4I A;  4CJ1 B;  2F3V A;  2MUY A;  4C3H G;  2F0E A;  4IUR A;  5CV9 A;  3MWY W;  1LTG D;  2EY1 A;  1Q12 A;  1PTO H;  2XN9 C;  1AFP A;  1F9S A;  2J0T D;  2AWN A;  1GUG A;  1OO9 B;  2JXM B;  2M00 A;  1AZP A;  3BDC A;  1KDB A;  3WOE A;  1LT5 D;  2PZU A;  2BA0 A;  1IHZ A;  2FFK B;  1I4X A;  1TS5 A;  1SYE A;  3VYT A;  2KED A;  1D5Z C;  4XDX A;  2F4I A;  4I65 A;  4QCL A;  3CQZ B;  1BCP F;  2JSO A;  3EVQ A;  3KBX A;  2SEB D;  3T53 B;  4FF3 A;  5IGC A;  1HTP A;  1LV9 A;  1LT4 D;  3NQI A;  2EYM A;  3I4M B;  1Q3L A;  5J39 A;  2F0M A;  4DNT B;  2A6H D;  1XTC D;  5E4X A;  1V1O A;  5J22 A;  2VXW A;  1R9T B;  2F0O A;  4EQO A;  2O2L D;  3PUX A;  2RKS A;  4EQN A;  2A5H A;  4FF4 A;  3FKI B;  3TZU A;  3I8Z A;  1HCZ A;  1TY2 A;  2XVS A;  1F9Q A;  4KKS A;  4C3J B;  1IW7 D;  1HA5 A;  2F0G A;  2B2W C;  3NTH A;  5LHY 1;  1JB3 A;  2Q8I B;  1SMY D;  3NE5 B;  4ZUJ A;  1B3A A;  2K05 A;  3TP7 A;  1YNN C;  3URY A;  2EYH A;  4LAA A;  3HZX A;  3T13 A;  3NBI A;  4ZKB B;  3AU7 A;  3M3Y B;  2K7V A;  2RSN A;  1BCP C;  2AWO A;  5K5P A;  1Q1B A;  1X3P A;  3OSO A;  4C3I B;  1PTO C;  4K8J A;  1DD2 A;  1R4Q B;  3P20 A;  3A7A B;  5F2D A;  4RWS C;  4CKC A;  2PW7 A;  1EFI D;  2XNA C;  4KHV A;  5HUR A;  3RZO B;  3HP3 A;  2BE5 C;  4OO1 H;  2WAC A;  4HTH A;  2Q8R E;  1KDC A;  4M1U B;  2HCI A;  1C48 A;  4KTA A;  1BO0 A;  1W6K A;  4JBW A;  1SE3 A;  4OGQ C;  4FO2 A;  2F0U A;  1LTI D;  2NVX B;  1SNQ A;  4WOR A;  2YU9 B;  1D6E C;  4WFN 3;  3GP7 A;  3FPU B;  3S1Q B;  2PPB C;  4PV1 C;  1LT6 D;  2EJG C;  2FJ2 A;  2PMZ B;  2R7Z B;  1LTR D;  4IN3 A;  2C5C A;  2A6H C;  4Z9C B;  3LX0 A;  3Q0A A;  3SR1 A;  2EYP A;  4UAI A;  3MA2 B;  1A15 A;  1ML0 D;  1XXG A;  1JOR A;  2F0D A;  5T1I A;  1SE2 A;  5JJZ A;  4J6H A;  1STN A;  1STE A;  5JPN C;  2CHB D;  2KEC A;  1W6J A;  2HQE A;  2PCF B;  2R93 B;  4KHZ A;  2RDF A;  4QB4 A;  1SND A;  1JIC A;  5G3L D;  1PXU A;  4XTC S;  3GTO B;  1PDQ A;  2F0I A;  4BY7 B;  4XT3 B;  3DWA A;  4G57 A;  4K2K A;  2KA7 A;  1DM0 B;  1JWM D;  3ITP A;  5I2Y A;  4RGN A;  4BBS B;  2DY7 A;  1K83 B;  1KTK A;  5KRU A;  1GJX A;  5ELE A;  2B2U A;  1EL0 A;  2FMC A;  1WTR A;  1D5X C;  3E5S A;  1SAP A;  5IGD A;  1H9M A;  1WTQ A;  3D6W A;  2R3Z A;  1YNJ C;  1I4R A;  3CKI B;  4FNF A;  1V1P B;  2X6G A;  2RA4 A;  5JOB A;  2VNU D;  3NTK A;  2AQ3 B;  3NK9 A;  1OXS C;  2EY6 A;  1O7Z A;  4K5V A;  3BZD B;  3L9A X;  3TDQ A;  4QF4 A;  4ABN A;  4DNR B;  4DAV A;  1C8C A;  4TQU S;  4NW2 A;  5CBA E;  3MFY A;  2L4N A;  1K8O A;  2SOB A;  3MXN A;  2PZW A;  2V4D A;  3VR3 A;  1KLG D;  3E6Z X;  3ZYY X;  1PFN A;  4IFD I;  4HED A;  3VA5 A;  2RSO A;  1QE6 A;  3OIQ A;  1SEB D;  1DJR D;  2I46 A;  3DMU A;  1NCV A;  4OL7 A;  1LTB D;  1ENF A;  5BN4 A;  1HA6 A;  1JWS D;  4A3B B;  4BS9 A;  5C0X G;  2NTS A;  5C3E B;  2F0F A;  4H7B A;  3R3O A;  1UUP A;  1O7L A;  3S17 B;  4LJZ C;  2E2D C;  2VB3 X;  1EOT A;  2K5W A;  1BQQ T;  2LMC B;  1QJO A;  5A35 A;  1EQT A;  1IKL A;  2R6G A;  3C3L A;  3BG3 A;  2EYO A;  4K5W A;  1HTL D;  1LTS D;  3PO2 B;  3MZ5 A;  4TRD A;  4K6D A;  5FO9 B;  1ET6 A;  1PRT B;  3ERO A;  2TMP A;  1G2T A;  1EU3 A;  4XXE A;  1BXT A;  2F1M A;  2H4O A;  2D62 A;  2O4X A;  1QCB D;  1I4Q A;  5ELB A;  4HMJ A;  1QB5 D;  3DHQ A;  1TQO A;  3R8B A;  5C4H A;  4ZKC B;  3Q24 A;  3PMF A;  1CHP D;  3HGB A;  3DXJ C;  3RZD B;  5D14 A;  4XT1 B;  1A2U A;  1GUO A;  4ZAI A;  3K5L A;  1B9M A;  2IJ0 A;  3QO2 A;  3R2T A;  1I4G A;  1SNC A;  2NBF A;  1FYC A;  5JAV A;  5ISR A;  1SE4 A;  4CJ2 C;  2A68 C;  2MGS A;  4RCO A;  2B8G A;  3RMH A;  4ZYS A;  3K5O A;  3K58 A;  1V8Q A;  1SYF A;  4RGM A;  4V19 0;  4J1M A;  4CHT B;  1DOL A;  4FXK C;  5NUC A;  1EY6 A;  5FK9 C;  2EDG A;  1Z6H A;  1EY8 A;  3TP8 A;  2B2V C;  3FRP B;  1X3Q A;  1OXV A;  1JCK B;  1I4H A;  2L1B A;  3TSS A;  4IUT A;  4Q5V A;  2DNC A;  2NN6 I;  5M3F B;  2KVM A;  1EY0 A;  3K57 A;  4RKL A;  4K8I A;  3K0Y A;  4YIJ A;  1E0B A;  3I73 A;  3TP5 A;  3BDO A;  2AUJ D;  2B2V A;  4BBR B;  1PRT F;  2F0K A;  2FHT A;  5EGT A;  3D4R A;  2D9U A;  3DM1 A;  3MXG A;  1PTO B;  1MSH A;  1FNU A;  4XYQ A;  1ZYR D;  5JEA G;  4K6L A;  1TWH B;  1EEI D;  4XQN A;  2LKV A;  2LS0 1;  4X3T A;  4XQJ A;  1II3 A;  4CBV A;  2IX3 A;  1XWE A;  5ELD A;  3LNN A;  3KLS X;  2K1B A;  1SJH D;  3MXU A;  3O13 A;  2WB1 B;  2ENB A;  4G7Z C;  3K7A B;  4U68 A;  4C2M B;  5C0X H;  1RF2 D;  1GHK A;  3C2P A;  2SNS A;  4C3J G;  5FKA C;  1SFO B;  4IFD G;  1CA5 A;  2F0T A;  5KND A;  3E0J A;  1A3T A;  4DFA A;  3OHX C;  3OMG A;  3AMU A;  4A3M B;  5I6W A;  4IUP A;  2NVT B;  1C4Q A;  4O1N A;  5LL6 X;  4A3K B;  1PRT C;  2F0L A;  4KI0 A;  4XQQ A;  2R61 A;  1NR2 A;  3T4A C;  5KYI A;  3K59 A;  5DEH A;  5CV6 A;  4C3I G;  2E2J B;  1CZW A;  2RQX A;  2JYO A;  1B50 A;  3I91 A;  3IFD A;  5KNB A;  4V0B A;  2CW0 D;  1BOS A;  4CJ0 B;  1Q1E A;  2F0J A;  2ZXR A;  4HCS A;  5KNC A;  2F3W A;  5JVH 3;  4ODG A;  1RD9 D;  1Z7T A;  1MD2 D;  1PTO F;  1K8M A;  1EU4 A;  1LTA D;  1UAP A;  1KLU D;  3BYY B;  3QOJ A;  3N6R A;  1FNW A;  2E75 C;  4RHR A;  4C56 C;  1O78 A;  1U4P A;  3ND8 A;  5EQ0 A;  1R4P B;  2NUC A;  3GQB A;  3MEH A;  3UI2 A;  3Q22 A;  1TT2 A;  3J80 E;  1D5M C;  4DGZ A;  1GUN A;  1NUC A;  1HFN A;  3R93 A;  1MSG A;  5C4Z A;  1EY7 A;  3PIP 3;  2QKI C;  5M5X B;  5D3D A;  1ZYR C;  1LAB A;  3I90 A;  5K36 H;  1MI2 A;  2IL8 A;  1TS3 A;  4ME5 A;  1VF7 A;  3D6C A;  1EZ8 A;  1TS4 A;  5COY A;  2CQA A;  1SXT A;  3GO5 A;  5CGK A;  1GOZ A;  4WRD A;  4WJW A;  1BDO A;  3SK8 A;  3MVV A;  2O5I C;  2DNE A;  1IKM A;  5A2Q E;  2B2T A;  5I6Y A;  5KGU A;  1DON A;  2ICI A;  4HSP A;  1ESR A;  3IFT A;  3NSW A;  3KUP A;  4ZUI A;  5EPJ A;  4HCE A;  2GA4 B;  3SK5 A;  2PW5 A;  3PIO 3;  4A3I B;  5TSS A;  3GTQ B;  1MGS A;  1JOO A;  2B2Y A;  2QDB A;  1HQM C;  1SSO A;  2KEE A;  1RTN A;  2A73 B;  3S2D B;  2XWB B;  2O5J C;  5I4D A;  3C1E A;  4RGT A;  1CQV A;  3PO3 B;  1A3U A;  5T1G A;  1CFM A;  3X3M A;  4P2C B;  1EYC A;  3T51 B;  1U9R A;  2HDM A;  2CW0 C;  2EJF C;  4QMG A;  3I4N B;  2EYJ A;  4EGV A;  2PZT A;  3NXW A;  1JWU D;  3SEB A;  1T5X D;  3A56 A;  1L0X B;  1STB A;  1EY5 A;  2TSS A;  1VMC A;  3IAY A;  3IKJ A;  3CRK C;  2JEB I;  1STY A;  2JA6 B;  3T16 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...