2RBMA

Crystal structure of staphylococcal nuclease variant delta+phs i72k at cryogenic temperature
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
130
structure length
130
Chain Sequence
KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKKEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS I72K at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Thermonuclease
total genus 36
structure length 130
sequence length 130
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2007-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2rbmA00
4TRDA 4K6DA 5C5MA 4DU9A 3BDLA 3NP8A 4G57A 1F2ZA 4K5XA 4KTAA 2EY6A 2F0SA 2F0GA 2F0OA 4K8JA 4EQPA 5C4ZA 3C1EA 4YIJA 5CC4A 4WRDA 3TP6A 3QOLA 4KY7A 2WACA 4DFAA 1EY6A 4QF4A 2RKSA 2SNMA 3MEHA 5F2DA 4DF7A 3MZ5A 4IZ8A 1KAAA 1SNOA 1A3TA 1EY8A 4ZUIA 1ENAA 4ODGA 1JORA 2PZTA 5CV7A 3R3OA 3SXHA 2PZUA 3H6MA 4K14A 3EROA 5EKKA 4HMJA 5JOBA 1U9RA 5CV4A 1SYGA 4K5WA 5K5PA 5E1FA 3S9WA 4IUNA 4ZUJA 5I6WA 1KDCA 1EY9A 1STYA 3T16A 2EY5A 3HEJA 3MHBA 4KJNA 4RKBA 3RUZA 3TP8A 4EQNA 1SNPA 5CGKA 1EQVA 1JOKA 5IGFA 3SK6A 2EXZA 3DHQA 2F0DA 3TMEA 3TP7A 2F0PA 1SNCA 1JOQA 3MVVA 3OSOA 1TT2A 5EKLA 5IGEA 2F0QA 2OEOA 3DMUA 5IODA 2EYFA 1TQOA 5KYLA 2SOBA 5IIFA 2PZWA 5C3WA 2RBMA 2KQ3A 5DAUA 5C4HA 2F0TA 4IALA 4KY6A 2F0HA 1SYCA 2F0UA 2EYOA 2ENBA 1II3A 1SYDA 4QMGA 1A3UA 3QOJA 5C6AA 5KRUA 2OXPA 4N9PA 1EZ8A 3QB3A 1NUCA 1EY7A 5CV9A 1KDBA 1NSNS 2O4XA 1IHZA 3OMCA 3SK4A 3D4DA 2F0WA 3SK5A 1ENCA 2F0KA 3SR1A 4K5VA 5HURA 5IGDA 5IGCA 3ITPA 5J22A 4J6HA 5IOCA 2EYPA 4QB4A 5DEHA 2EYJA 5HGTA 5KIXA 1SNDA 5M9OA 1RKNA 3EVQA 4RKLA 1SYEA 4F7XA 4K2KA 2QDBA 2F0JA 4KJOA 2HQEA 4KY5A 4OL7A 5CV8A 5ISRA 5E3FA 2PW5A 4ZQ3A 4KD4A 4S3SA 5KEEA 3D4WA 1EYDA 4EQOA 1STNA 1STAA 1SYFA 2RDFA 5C3XA 4F8MA 4EVOA 1F2YA 5I9PA 4I65A 4PNYA 1SNMA 2F0NA 3NHHA 2SNSA 4H7BA 4KD3A 1SYBA 4J1MA 5J39A 2F0EA 2EYHA 2PW7A 2F0FA 5KGUA 1STGA 1EYCA 2F0IA 5I9OA 3T13A 1EY5A 2F0MA 3EJIA 3V2TA 1KDAA 2KHSA 4N9TA 1TR5A 4LAAA 4R8NA 2LKVA 4ID6A 5CR3A 3NUCA 3NXWA 5KYIA 4MIUA 5IGBA 3NK9A 3D8GA 1A2UA 1STBA 2F3WA 2PQEA 3OMGA 2EYMA 4NKLA 3U9OA 1EZ6A 3P75A 4E6IA 1EY0A 4HMIA 4NP5A 3BDCA 4B9XA 4B9WA 3P1HA 2F3VA 2F0VA 2EYLA 3MXPA 1A3VA 1STHA 2EY2A 4K8IA 4DGZA 1A2TA 4PMBA 4WORA 3TP5A 2OF1A 3ERQA 2EY1A 4K2LA 5CV5A 3SHLA 3PMFA 5J1ZA 5JAVA 1JOOA 4HTHA 5CV6A 3D6CA 4NDXA 3VA5A 1AEXA 3NQTA 4KHVA 5EGTA 2F0LA 4NMZA 1SNQA 5C5LA 3OWFA 3HZXA 5I6YA 4PMCA 1KABA 1EYAA 2NUCA 3E5SA 3LX0A 4KV6A 1F2MA 3SK8A 1EY4A 2M00A 4ME5A 5IGGA 3C1FA 5NUCA 2PYKA
chains in the Genus database with same CATH superfamily
2VL6A 4GNXB 2E75C 2EY6A 2F0SA 1FNWA 1UEBA 3S2HB 3LWEA 4OEMB 4X3KA 2G9DA 2QDLA 3GTKB 4DV4L 4P75A 4JCVE 2EIFA 1Q8IA 4WFN3 3CCRA 4IUUA 2L11A 2PZUA 1Y8PB 1CKNA 3K7UC 4CJ0B 2RDGA 2MO0A 4IUNA 2WAQB 1XTDA 1E1TA 1LTBD 2EJGC 3RLOA 5CGKA 1TWFB 1G291 1TU2B 3OSOA 3HKSA 3DWAA 4WJ4A 4A3FH 1NCVA 4HCSA 2JA6B 5KNCA 3S1QB 4BY7G 5IWAL 5EJWA 2K1BA 4DR2Q 2N3SA 3ZJYC 1T5XD 1RODA 2EDGA 5M3MH 1I50B 2Z0SA 1LLRD 2X6LA 3SK5A 3W5OA 2ZJQA 5DEHA 3UDIA 4YWKA 4RH6A 4FF4A 2WB1G 3T56B 2KBNA 3NQIA 5CMDA 4A3JB 1SMXA 1YNND 2DNEA 5M3FG 3KBGA 2UXCQ 2K03A 2K5DA 2YTXA 2JQOA 2NN6I 5I4DA 1F2YA 1AH9A 2JA7H 1AZQA 2UXCL 2Z6KA 1Z7TA 4NXML 1VQDA 2IPKD 4C56C 4ALPA 4MTNA 3RLFA 2F0IA 3E0JA 1EY5A 3SDZA 4DAYB 2OT2A 3QWNA 3JAME 5A2QE 1YIJA 3H0GH 5LMNQ 2ZTCA 3NUCA 1RTNA 4P72A 5M3FB 5JJZA 1PZJD 5FLXL 2JEAI 2F3WA 2PQEA 3HG9A 3P7JA 2YU9B 1IW7C 1F9PA 2HD3A 4NP5A 5BN4A 1LTID 4A3LG 2B2TA 4JYAQ 3MXPA 1A3VA 3DEPA 4K8IA 4POGA 3W2DA 3ERQA 3HOYG 4LW1A 4C3HH 3H0GG 1O7ZA 3KJOA 3HOUH 3I4NG 1LT6D 4JV5L 4IOCA 1HHVA 1U4RA 2D0OA 1X55A 4LWCA 2N49A 3C1FA 4K14A 4CKEA 4TRDA 3JAMc 2BE5C 5LMNL 3S14B 4IPCA 3HOWB 2WP8J 1MGSA 2I5HA 2KECA 1X9NA 3MEHA 3MWYW 1PDQA 4DF7A 1EIYB 5ELBA 1A62A 5JJLA 5CV7A 3B6YA 2OWOA 3GDEA 4X3TA 1YITA 1AN8A 3LWUA 4J15A 3CF5A 4Y7NH 2Z6KC 1PH7A 4DAYA 1KDCA 1BVSA 3KLWA 3J81j 2VW9A 3BYYB 3DHQA 3TMEA 1CT1D 4C3JB 1YHQA 4KMUC 4Z9CB 1SNCA 4RHSA 4L5TA 1PFSA 1X32A 4OXPA 3A56A 5IODA 1M90C 1HTLD 3FEWX 4YWLA 1PH1A 1NMGA 4KK7A 2R7FA 3GD7A 2NVXB 3FRPB 3GTLH 4LUZA 3CXCA 2Q8RE 4JI3L 1M1KC 1MSGA 1IHZA 2B29A 1TY0A 3BZDB 5HURA 3J7YW 1I3QH 4IURA 3HKZG 3Q8DA 1UUPA 3GTJB 4K2KA 5C3EG 2CW0D 4X62L 3E6ZX 5E3FA 3A8JE 4GN3B 2NN6G 4X66Q 1WFQA 5HY6A 4LJZC 3F2BA 1WTQA 2OTJA 4F8MA 4GOPC 1SMYD 3X3NA 2RHQB 1BXTA 2MP1A 3OYYA 1G8ZD 3NTIA 2XWJB 1CK1A 2L12A 5JEAJ 1STGA 1HZAA 5IP7G 1DM0B 4RCOA 3TS2A 1XMOL 5GADC 1SBBB 1XNQQ 4JI4L 1EEFD 2ZXRA 1STBA 4JI0L 4X65Q 1VDZA 4C2MH 4X65L 5ELFA 1STHA 2EY2A 4DGZA 3H0GB 3AMUA 4FXKC 1ET9A 2VZAA 4R4TA 3SHLA 5IYBH 1KC8C 2F52A 4DV6L 1NTGA 2IX3A 3OWFA 1QG7A 3JAML 4NB3A 3GTGH 1I4QA 1C9OA 2RF4A 1VQEA 3RZOH 2A68C 4OONA 3M4QA 3K58A 1VQBA 3PUVA 4R4IA 5F2DA 3DWQA 1SNOA 1L0YB 1FGUA 1GM5A 3H3VH 4B3TQ 1BCPC 2RDHA 2K5HA 2Z9HA 1YNJD 3S9WA 1Q7YC 4OWWB 5I6WA 3T16A 1R4QB 3JC66 4MNOA 3A8KE 3NENA 5ELOA 2E2IB 2JA6G 4B3RQ 3U4ZA 2VY3A 4QGUA 1PA6A 1V1PB 1GD7A 3OIPA 5IIFA 3S1MH 1HJPA 4N8FA 1LTLA 4APVA 5C6AA 4N9PA 3OOCA 5COYA 4IFDI 1PYBA 3K5OA 1KAWA 1E7ZA 1BCPD 1AZPA 3S16B 2KEDA 4LF8L 4ULLA 4BA1I 3UI2A 1TWGB 1C48A 4JC0A 3FVQA 2G9HD 1RKNA 3EVQA 4RKLA 1F9RA 1YVCA 4LFAL 1GUOA 3HP3A 5EKIA 1AE3A 3OTOL 1PYWD 4RGNA 1VQAA 3E9IA 1D2BA 1LT5D 4BBSB 3RZDH 4OGQC 2IY5B 4WJ3M 4LUOA 3RLNA 3J81L 2R93B 4HJAA 4A3JG 4CDFC 2A69C 4YHHQ 2KHSA 2UUBQ 1QNKA 3FPUB 4IOAA 2YU9H 1HUNA 4CDEC 5C44G 3T1YQ 3HOUG 3NK9A 3VYRA 1TKWB 1CKOA 1IBLL 5EPKA 1K73C 3R8BA 4E6IA 4JI2L 1ZKOA 2F3VA 1Y1WG 4DXGA 2PPBC 2Y0SB 2L9HA 2OF1A 1W6KA 1B8AA 3TEHB 2QW7A 5JAVA 1IYUA 1PH4A 1YZ6A 3GTPH 2F3IA 4JI8L 4OWXB 4UP7A 4ZKCB 4NMZA 2NVYB 2D2CC 1EY4A 3TREA 3UDXA 5IT9E 4RG1A 2IL8A 5C5MA 4IPGA 3J7AF 1K8OA 4DV3L 1VQJA 1Z9FA 2DY8A 3CP0A 2D5DA 4YCWA 2K75A 4DFAA 1EY6A 2SNMA 1VQCA 3M3YH 1P8LA 2R92B 2VXWA 3A7LA 5K5PA 2KVMA 1SE4A 2G5DA 2ZXPA 4DR1Q 1STYA 2K32A 1QWYA 3NEMA 3DWPA 2DNCA 5IGFA 3VR4A 5HGQA 5GROA 1BR9A 1TQOA 3HOVH 3GP7A 5C3WA 2K52A 2EXDA 3PIP3 2JEBI 3HKZE 1I4HA 4IFDG 3NBIA 1EIHA 1EZ8A 3QB3A 1FVIA 1NUCA 3EN2A 4G7ZC 3OW2A 4A3DH 3IFTA 5D65A 3A55A 3NBHA 2B63G 1ICWA 4LF6L 2ALYB 1PH5A 5TSSA 4A3MB 3W1BA 5JVH3 1TWAB 3URYA 5L37A 4HIDA 1XNRL 4O42A 1PLFA 2DN8A 2F0JA 3CW2C 2K33A 2DUDA 2HT1A 3L9AX 3I4OA 4DV4Q 5IP9H 4HCEA 5IYDH 2K5VA 1K28A 3E3XA 4QUFA 1BBUA 4JI3Q 3KBXA 4TSSA 5I9PA 1HZBA 1SNMA 2HDMA 3MEFA 1SE3A 4DKAC 5J39A 4DNTB 1EYCA 2F0MA 3PCOB 4IJHA 4XDXA 4R8NA 1LTSD 1E2WA 4LFBQ 4C2MB 3D8GA 2GVBA 3U9OA 2M9VA 4BXXH 3PF4A 2LSSA 1BCPB 1CZWA 2ZXOA 1L2FA 1WCMG 1JQYD 4R4OA 2NVQH 1XXGA 1F77A 3M4PA 2MJ8A 5EGTA 2K04A 4MHEA 3AB9A 4A3EH 3J81E 1EYAA 4DV7Q 5EBCA 4GNXA 3G6EA 3GQBA 2SEBD 3NP8A 4K5XA 4A3GB 4KTAA 3T51B 1DOKA 1TS4A 1C8CA 3L3OC 2R92G 2WACA 1Y8NB 5FLXE 2NTTA 4XYOA 2NWGA 1IXRA 1A3TA 1B70B 4HSPA 5M3MG 5FJ8H 3SXHA 2SDFA 1Y69U 1FNVA 1I4XA 3RN5A 4CKCA 4A3EG 1K3RA 4DV2L 3HEJA 5KNDA 1XPRA 1AE2A 4FF1A 3FP9A 1JJCB 4A93G 4PZ6A 1JOQA 3MVVA 5JEAH 2OEOA 2E2JB 4DUYQ 2KQ3A 3I55A 1P16A 5JJIA 3ULLA 3NWTA 2EYOA 1SSOA 1YNJC 4ZAIA 2NVXH 1G91A 5E7NA 3HRZC 2A73B 5CV9A 3W1GA 1PH9A 3I70A 3HOZH 1YHAA 2EYPA 1ICFB 3MAQA 4H0LC 4QIWB 1KIXA 1L0XB 4DK3C 1Q81C 4DR7Q 2N78A 4N8X1 2L5TA 1VMCA 5EPJA 4OX9Q 3KDFA 1HPCA 2E76C 2QGQA 3VYSA 4JI0Q 1WTWA 3HOWG 4B3SQ 1VQNA 1I50H 3RN2A 1B53A 4DA2A 3Q6SA 1Q8KA 4DR1L 1S40A 4Q0FA 1SEBD 5KYIA 2KA7A 1I4PA 2PI2E 3OMGA 1QB5D 1UEAB 1YNNC 1VF5C 3BDCA 2AHOB 2NBFA 3DUZA 1V1PA 2UUAQ 2PNRC 1IYJB 2JXMB 4K2LA 1BBXC 3PMFA 2ZTDA 4BY1G 3AFPA 2YTYA 4C3JG 2KOLA 3D6CA 4KHVA 1SNQA 4FP5D 4HR7B 1B50A 3BG3A 3GV6A 5CBAE 5M5XH 2IX0A 3D0FA 4MTKA 1UE5A 3KYHC 1TS3A 2JE6I 3I3CA 1F2LA 2EOTA 4JOIC 1IBMQ 2L0CA 1SDFA 3NE5B 3TP6A 2B2WC 4CJ1B 3HGBA 4IZ8A 4HJ5A 1ENAA 1IW7D 2F4IA 2A1AA 3CQZB 2MUYA 5CV4A 3OHXC 1IL2A 1LM0A 2RCNA 1EQTA 5KNBA 1B2TA 3Q24A 1TY2A 2BA0A 2LS01 2BOSA 1HZ9A 2B3GA 3CAMA 3RUZA 5BR8L 4B3ML 4DAVA 1TWAH 2KCCA 1Q90A 1L1OB 3BVZA 1CI3M 4V0BA 1X54A 1O7IA 5E4WC 3S1QH 1HR0W 5LMUL 5A35A 2MHVA 4A3DB 1S5FD 1TVXA 2F0UA 1IBML 3TRZA 3G71A 3WOFA 3H15A 4BBRB 1KDBA 1OXVA 4IUTA 4KKTA 4ZKBB 4Y7NB 3GTMB 1QVGA 1WTXA 3ITPA 4RA8A 1ZYRD 4C1NI 2XTIA 4KJOA 4OL7A 1PZKD 3H09A 4DV6Q 2PNHA 4X3SA 4QIWE 1TWCB 2RDFA 3GO5A 3S15H 5DNFA 1FNUA 3Q0AA 4PZ7A 2IHEA 2ZTEA 2N88A 2J4XA 4PNYA 4KLKA 2IJ0A 1A0IA 1SYBA 1J5EL 1CTMA 1DD2A 1VQ5A 1QUQA 2NZ1D 5KGUA 4B3RL 1ZEQX 3AYHB 3T1HL 1O7LA 4UHVA 1DCZA 1D5ZC 2WKDA 3CC7A 1ESRA 1R9TH 1VF7A 3A5ZB 4L5SA 4QJFA 1H9KA 3T1HQ 1B1ZA 1IL8A 1QNUA 4BBSH 1KRSA 2WB1B 5FLMH 1HNXQ 1Q3LA 3PO3G 2VQFL 1FYCA 1C7YA 1CUKA 4L8JA 1SRUA 2EYLA 2OQKA 3K7AH 3HOWH 4DUYL 3FHWA 4H44C 1PTOH 4JI6L 1X3QA 4K6LA 5I2XA 3VA5A 4NDXA 5EAYA 4KHPL 5C5LA 3KLRA 4HN7A 2R7ZG 1KABA 3HOUB 1IYVA 1QILA 4GLXA 1S5CD 2XSCA 2KCNA 4DV2Q 2VB2X 2F0OA 3K0YA 4K8JA 2UUCL 1CHPD 4CHTB 2EVBA 4KN4C 5LMNW 4LFCL 1E2ZA 1BDOA 2CHBD 2XVSA 1KLGD 1EIFA 1CQVA 1VMPA 4LMQD 3I4NB 3UDFA 2GVAA 4A3CH 4ZCKA 1I4GA 3CMEA 2DGYA 3KLSA 1JICA 4C1NK 1EY9A 2Q2TA 1TWGH 4KJNA 3GTLB 1HNWL 2E8GA 1Q1EA 5H1SE 1XMOQ 4LF7Q 1HR0L 1K8AC 1E2VA 4J8QA 1EL0A 1WTVA 5IGEA 4C3IB 1JE4A 4TVAB 3J7A5 3H94A 2B63H 1FJGQ 5GQOA 4DR6Q 3I8ZA 4BBRG 1VQ7A 1SYCA 3BYTB 4QMGA 4HAEA 1E1OA 2MQHA 4FXGC 3CPWA 3ICEA 2UU9Q 2VS1A 1VQLA 2QILA 2MFIA 3PO2G 1Y1WB 2VUMH 4K5VA 1N33L 2XWBB 3OIQA 1SNDA 1GVPA 2HQEA 3CHBD 1WTHA 1KRTA 4AQYQ 3IAYA 4EX5A 1A8VA 1STAA 3U50C 3LNNA 4P2CB 1L0WA 1QE6A 4LF4Q 1U4LA 3I72A 5C3EH 3NHHA 2SNSA 4O1NA 1VQ4A 4J1MA 3GTPB 1EWIA 3A74A 1AW7A 4X64L 5IYCH 5AJ3Q 4XTCS 3RNUA 3R2TA 2BH2A 5D14A 1ML0D 2FMCA 2RSOA 2JYOA 2QEJC 3R93A 2LXJA 1NNXA 2Q2HA 2Q8TA 5FO9B 4ZYSA 3CCEA 1MSHA 4A3IG 1S4ZA 3K0XA 5M3FH 1FR3A 2AMCB 3NELA 1VQ9A 1PTOF 1EU3A 2B2VC 2IW3A 4M8AA 2HDLA 4BY7B 1B7YB 2K6AA 2D9UA 1PRTF 4IUQA 2R93H 1AEXA 3PO2H 5M5YB 2F0LA 4BY7H 5ELNA 2BCOA 3X3MA 4BWGB 4UDUC 4JI5Q 4MN3A 4K6DA 3OPOA 4A93H 2O2LD 2F0GA 3KF6A 4GKJL 2JA5H 2XN9C 1WJJA 2QCPX 3UE1A 1V1QA 4GNXC 1VQGA 1NR2A 3EBEA 1JORA 3BZCA 4IJLA 4A3CG 5IWAQ 4A75A 4KKUA 2H1EA 4DV1Q 5EKKA 1SYGA 3QJYA 1D1KA 2D62A 4A3GH 3J81i 3AEVA 4RKBA 4JI1Q 1MI2A 1TXYA 2BH8A 2F0PA 2JA8H 1V8QA 4GOPA 1H9RA 3S16H 1CHQD 2X6GA 3MTSA 5I2YA 4B08A 2QEXA 4HIMA 3G6JB 2C5CA 2F03A 4R4CA 1LUZA 1QZHA 4YCVA 2HIXA 2C35B 1H95A 1X56A 1EY7A 4OIKA 1NSNS 1WCMH 1N36L 3OMCA 4JBMA 5IGCA 3T1YL 1PV4A 3TQYA 3S1RB 4JI8Q 4BY1B 1M4VA 4QB4A 5M9OA 4GN5A 1TWCH 2FFKB 2ZM6Q 4DV5L 4CDCC 4JPBW 1HH2P 1VQIA 1U0LA 3HOVB 1WTOA 1OXSC 3MXNA 3GTJH 4ME3A 2XGTA 2ZJRA 2P5ZX 1Q46A 1N8RC 2DY7A 1OXTA 2UUCQ 1IBLQ 4DR6L 2FMMA 3ONAB 4YCUA 1G6PA 5I9OA 4LFAQ 2ZM6L 3KFUA 3K5LA 1KDAA 2I07B 4N9TA 4A3GG 1W6JA 4DUZQ 2E5LQ 1SN8A 1J9OA 1VQ6A 2QKIC 4JOIA 4C3HB 3PQIA 2CH4A 2EYMA 1JJGA 1EY0A 2M2LA 3NPPA 1EFWA 3QR8A 1DJRD 4PMBA 4FNFA 1O80A 1R4PB 1I94L 2CWAA 4OELB 5CV6A 1BCPF 5IT9c 4BBSG 1O78A 1LT3D 1JWSD 2K50A 2Y0SG 3L2PA 3QG1A 2O5IC 5M5XB 1F9SA 1XX8A 1EQQA 4RMFA 1SLJA 4MZ9A 2Q2UA 4X6AH 3DLLA 1RJTA 4NPSA 4DV1L 4HSVA 2I5LX 3Q23A 4X3UA 3D4RA 4DAPA 3U58A 4QF4A 3S2DB 1LTTD 3MZ5A 4ZUIA 1BO0A 3EIVA 4NW2A 4L5QA 2ZJPA 4H13C 4A76A 1N34L 2L55A 3OW7A 2XRQD 5E4XA 4OWTB 5E1FA 3VR3A 1JJ2A 1TWFH 2V1CC 4RHRA 1WD0A 1U5KA 4A3EB 4GN4B 1SNPA 4EQNA 2PMZB 1H9MA 4GLAC 1JOKA 2A68D 2JA6H 3OWEB 3SK6A 3PO3H 4R1JA 2A6HD 4GLVB 1TT2A 4A3MG 3STBC 4ZLTF 1PZID 2IX1A 3GTOB 2EQSA 1LTAD 4CJ2C 1Q86C 2F0HA 1SYDA 1PRTD 3CPFA 4ZRZA 4NXMQ 3QOJA 4RGOS 2VUMB 2OXPA 4KKSA 1V1OA 3PUWA 4I7AA 2XNAC 1XNQL 1I4RA 5J22A 3A7AB 2A19A 1BUVT 1JB7A 4X64Q 1YHBA 2VQEL 3MXUA 2K5QA 1IBKL 4B3MQ 4U673 2A74C 1TS2A 1SYFA 4A3JH 2K5WA 4CDDC 3I4MH 2K14A 4IQZA 1B9NA 2F0NA 4AQYL 1MIUA 3J7ZC 4DR2L 3KF8A 2NVTB 1EWCA 2D0PA 3NWSA 3N52A 3TZUA 4LNQA 5K36G 4G7OC 1V9PA 2CWPA 3CU7A 2HIVA 1R9TB 1EOVA 3F1ZA 4DN4M 3MFYA 1HA6A 2Z1CA 3D31A 1CFMA 1A2UA 4LF5L 2B8GA 4TQUS 2EZVA 2WINB 2Z6BA 3VR2A 4DR3Q 1A2TA 1Y1VH 4BA2I 3KK7A 4XT3B 1HQMC 1PTOB 3IRBA 3NQTA 3S24A 1Y1VB 4P73A 5C44B 4KV6A 1N36Q 5CORA 5IGGA 1BOSA 2H4OA 4DU9A 3BDLA 4B9WA 1VQOA 1GOZA 5GAGC 4YIJA 4QY7A 1EEID 4DK1A 2YV5A 1E24A 1YNXA 1KAAA 2WFWA 1K3BC 2BDNA 4LFCQ 2AQ2B 2PZTA 3F2CA 2UXBQ 1WYDA 5JOBA 1U9RA 4L6TB 4DPGA 3I4NH 3M3YB 2R92H 4BY1H 2CW0C 4AYBB 2B2YA 2QF7A 4UP9A 2EXZA 2F0DA 3TP7A 1SROA 5C4XB 3DMUA 1OTCA 5T1IA 2VUMG 4B3SL 1SMYC 2OTLA 1OXUA 1PYSB 1PFMA 2NN6H 3E9HA 1A3UA 5GAEC 1SR3A 2KJXA 2UXDL 1K0SA 4OX9L 2L1BA 3S1RH 3SGIA 2LFNA 2NZHA 1JWUD 4IPHA 1SJHD 4DR7L 1JB3A 3HOXG 1QOHA 4J6HA 5IOCA 3FKIH 4X62Q 1D8LA 4ILWA 1YI2A 2B2UC 1UWVA 2B2TC 5AJ3L 5FK9C 4RCNA 4F88A 2AUKA 1XMQL 4JI7L 1LTRD 4HJ7A 1GUTA 5LL6S 1STNA 5C0XH 3IKJA 4EVOA 2YTVA 4X66L 3T4AC 3J7AV 3HKZB 2CKZB 2K01A 4RAUC 4YY3Q 3KDFB 4JVZA 2AWOA 4G7HC 5D3DA 3S17B 3HOZG 3PIPA 1I94Q 3PUYA 5CR3A 2I46A 4KN7C 1J8IA 1D6EC 2AQ1B 1Y8OB 3UDGA 1M8AA 1HRJA 3PF5A 4RGMA 4HMIA 1VQKA 2BA1A 3TP5A 1LYLA 1EOTA 1KNEA 1N9WA 3GV3A 3CCQA 3CCSA 2KENA 2PMZE 2CCZA 1RTOA 4POFA 1GXDC 2NUCA 3PO2B 4IPDA 1EIGA 3SK8A 1PTOC 4IFDH 1GKHA 3RD4A 2ASBA 1GO3E 2PCFB 4QQBX 1BKBA 3C1EA 3TN2A 2PI2A 4WRDA 3TSSA 1HA5A 2YYZA 3NSWA 1KQSA 1EY8A 1SFOH 5JJKA 1JE5A 3R3OA 2R7DA 5C0XG 4CBVA 4JYAL 3E0EA 4HMJA 3I2ZA 3ERSX 3CQZH 4K5WA 2CVRA 1YJ9A 4GZYC 1CZGA 3TP8A 2JA5G 1T5EA 1UNSA 4AH6A 4HJ8A 2ATWA 4KHPQ 2UXDQ 3J80i 1VQMA 5CYUA 1PTOD 3HS0C 2SOBA 1I6VC 1UE1A 5C4HA 4DV0Q 4KY6A 1MKHA 3AQQA 3DM1A 4UPAA 2RCFA 4A3KH 5J3BA 4FF3A 1WCMB 1NBWA 1BF4A 2EYJA 1CKNB 3I90A 2WKCA 5IP9G 1RL2A 3J80L 4JI6Q 1SJED 3FMCA 2QDBA 4LF9Q 1CSQA 4P74A 4OO1G 1CA6A 2A5HA 4ZQ3A 3VYUA 2OCEA 1EYDA 2AKWB 3WDNA 2EJFC 3K5NA 4HIOA 4A3BG 5M5WB 1KHIA 4O0AA 4JI5L 3GTQH 2R7ZB 1UE7A 2CQOA 2E2HH 1BBWA 1B9MA 1QUQB 4DXFA 1JR0D 3KOJA 2KCMA 2OQ0A 3CC2A 3HOVG 1RHPA 3LGJA 5IGBA 1G2SA 4NKLA 3CCMA 2JA5B 4ABNA 3P75A 3BS1A 4DAMA 4XYQA 3V96A 2AUJD 1KXLA 2WIIB 4A3IH 1Q82C 1X3EA 1DOMA 2ID0A 3V05A 2ICEC 3CCUA 2KCTA 4HTHA 4AYBE 1PH6A 1D1IA 1HR0Q 2A6HC 3CCLA 4PMCA 3N6RA 1DGSA 4C3IG 1VQHA 5NUCA 3F2DA 4EQPA 3I91A 3QOLA 4KY7A 4JG2A 2UU9L 3I73A 4QUCA 4RFBA 1ENFA 3MA2B 4G4KA 2JK8A 3P20A 2WV6D 4JI2Q 1ASYA 1ASZA 2E2JH 2KHJA 4OO1H 4K0KQ 3PUXA 4GKKL 1FD7D 3C46A 3M4YA 1NMFA 1JWMD 4LF7L 1VCIA 1NAPA 4BS9A 1N32L 4NXNL 3GTOH 2BDOA 2L4NA 3M4OH 5G3LF 1PFBA 1ESFA 5DAUA 1TWHB 4IALA 3A8IE 3KF8B 5IYDG 1DONA 2B2WA 1D7QA 2VB3X 1QVFA 3VYTA 2E2IH 1HNWQ 4LFBL 3SR1A 3IFDA 2Q2IA 2F4VL 1Z47A 2NZOA 3BVGA 2I5MX 5KIXA 2MO1A 1Q1BA 4F7XA 3Q22A 1WOCA 4KY5A 5ISRA 2LXKA 2JN4A 4KD4A 5KEEA 1CM9A 2NTSA 2Z4IA 1N34Q 4I65A 2K4KA 2VQFQ 1XMQQ 4JI7Q 3DXJC 2LY7A 4L63B 2F0EA 3VR6A 2VQEQ 1ILPA 2IHFA 2Z4HA 2R61A 3QIAA 5C0XJ 4LF6Q 2CH4W 4MIUA 3CD6A 4OIJA 1YEZA 4FF2A 4IUPA 1ONLA 4FVMA 4JBJA 1NR4A 4KI0A 2HHHL 1C0AA 2E2HB 3CRKC 1F9QA 3L7ZC 3M7GA 3I56A 4DV0L 1X3GA 2AWNA 5J1ZA 2TSSA 4FDBA 1JOOA 1CQFA 5BN5A 2B2YC 4DNIA 3D3RA 3LX0A 5M5YH 4JK1C 1JT8A 2X69A 4G57A 4RWSC 5IGDA 5C4ZA 4A3FB 1GUSA 5CC4A 1KNAA 5G3LD 1UAPA 2K28A 2JA8G 3PGZA 2EE1A 4JBWA 4FO2A 3PUZA 5C44H 3H6MA 1JMCA 1TIID 5LL6X 4XQJA 4A3KB 2DJFC 4XQQA 5JVG3 3WWVA 2NB0A 3RR5A 4LF5Q 1XPOA 1HUMA 3HOXH 1EU4A 4I7ZC 4UAIA 2I0QA 4CKBA 1B3QA 2Y0SE 2F0QA 1FL0A 2EYFA 2JA8B 2PQAB 3S2HH 2PZWA 2RBMA 3ND8A 3I4MB 2ENBA 1II3A 2PQAA 1U4MA 2CFMA 1WTPA 4DR5Q 1G6ZA 4C3JH 4AYBG 2F0WA 2F1MA 5C4XH 1HFNA 1O7YA 3K59A 1EWHA 5BN3A 5FO8B 4Q5VA 4GKKQ 3NBHB 4H02A 3PO3B 4PMWA 1IKLA 5IY0A 3J80c 3MXGA 3VR5A 3WOEA 1CA5A 5JPMC 2PW5A 2LMCB 1S72A 3F2UA 1GHKA 1VQPA 1PFNA 3STBD 4A3BB 1VS0A 1SAPA 3CCJA 1W2BA 3FKIB 4KD3A 4A3BH 5M3MB 4JV5Q 2K7VA 5C3EB 4NXNQ 3EJIA 1RCVD 3S17H 1XNRQ 4YY3L 5DM73 3K7AB 2E2DC 1KLUD 4LUVA 5A2QL 2UUAL 2WAQE 4A4IA 3K80C 3HOYH 1IZ6A 1XWEA 4XXEA 4A3KG 1EUJA 2WB1E 2JA7B 2MNAA 3T53B 2HCIA 4WORA 1WVLA 1K83H 5JPNC 1X3FA 1SE2A 1GUNA 2RSNA 1H9SB 3ER0A 1RIPA 4U68A 1QCBD 5C0XI 4A3FG 1F2MA 3R2IA 3S1NB 2FJ2A 4ZK9B 4XIGS 1YJNA 5LHY1 4LF4L 3PSIA 3SE0A 3K8AA 1ILQA 2NVQB 2RKSA 1XTCD 5DLQE 1C4QA 1PHJA 4AIMA 4C3IH 1RF2D 4RGTA 2HHHQ 4LK1C 3EFXD 2NYZD 1N33Q 4UY8C 1BNZA 3VDYA 2A6EC 3MHBA 5DM63 1S3OA 3G4SA 1EQVA 2CQAA 2H5XA 1OO9B 5FOBB 5EKLA 1CKMA 3ULPA 2J0TD 1XJVA 5KYLA 1HNZL 3TZDA 1KD1C 4L5RC 3HFZB 4UP8A 1TS5A 3K6OA 4EQ5A 1E3PA 3PIO3 3HOXB 4R9WA 4A3MH 4IFDJ 4HIKA 3EQLC 5IYCG 1S5ED 2JA7G 5FKAC 1GUWA 1LABA 1H9JA 2J7ZA 4YHHL 3GTMH 4P71A 5FO7B 1I6HH 5CV8A 4XQNA 4DR3L 4BXXG 2F4VQ 1RDPD 1HFGA 2KUMA 1EYGA 1XPUA 3L0OA 5C3XA 1JC7A 1NE3A 1PH8A 3O13A 5FLXc 5CBEE 4H7BA 4GS3A 5EQ0A 3TBIB 3TS0A 2EYHA 2PW7A 3RZDB 2MPMA 4CGYB 3V2TA 4V190 2B8FA 2JA9A 3ZYYX 4GOPB 3QO2A 3NXWA 3RZOB 1PVOA 1EFID 5M5WH 3I7FA 3H91A 2FINB 1STEA 1RD9D 1S5DD 4HEDA 2XIWA 4B9XA 4A3IB 2JP1A 3K5MA 1B44D 4A3DG 4OO1I 1HNZQ 1AP0A 3MC0B 5AFWA 3FPPA 5FJ8G 2B2VA 1G51A 1MHWC 4O2DA 2A8VA 3A5UA 3U9SA 2R93G 4EGVA 4ME5A 2FHTA 5KRUA 4JBKA 3H3VI 2WAQG 2HCCA 3A0JA 1PH3A 3ND9A 3G48A 4YWMA 3S1MB 4A3LH 4TKOB 1LO5D 2R3ZA 1BQQT 3MFGA 4QCLA 1ZXTA 2NVYH 2B39A 3EROA 2RHSB 2B2UA 2FXQA 1JCKB 4M1UB 3S1NH 2DJGC 3CRLC 1B3AA 4ZUJA 2K5NA 1L1OC 2JSOA 1DZ1A 1PRTB 1E22A 1HCZA 3PV0A 2B63B 1K8GA 1DYQA 1U4PA 4R4QA 1A6XA 3C3LA 1L1OA 1FGBD 2KHIA 5ELEA 1TWHH 5D3IB 1E0BA 5FLMG 1D5XC 4IUVA 2UXBL 3S2DH 1K0RA 1GUGA 2EPBA 3EA6A 1GHJA 3J80E 1QJOA 3U4VA 3M4OB 2F0KA 1SE8A 3KF6B 5C4XG 1IKMA 1LT4D 1Y1WH 3I4LA 5BR8Q 1YJWA 1G2TA 1J5EQ 4BBRH 1X3PA 2Z8LA 3FKIG 5K36H 4FYDA 4DR5L 2VNUD 1SXTA 2RA4A 4XT1B 5C4JH 5LMUQ 1QZGA 2GA4B 2HQLA 3JAMi 1DXMA 1V43A 2F0FA 3D6WA 5C4JB 3DM3A 3T13A 1X6OA 3IL8A 5IE8A 2R6GA 1B4OA 2RVLA 4DV3Q 4LAAA 2LKVA 2EJMA 4LF8Q 4R8IA 1W3SA 3UE0A 3I4MG 1DOLA 3KUPA 3G7LA 1K8MA 3M9BA 1ZYRC 1NY4A 1EZ6A 3CC4A 1PMRA 2IWHA 1Q12A 1K83B 1QVCA 3P1HA 2AQ3B 2F0VA 4DK6C 3OTOQ 2N8NA 1I5FA 5CV5A 4DV5Q 4DNRB 1XYIA 3GTKH 3M7NA 1MJEA 3TDQA 2NVTH 2R7ZH 1IBKQ 2GN5A 1SFOB 2TMPA 2JJQA 4A93B 1N32Q 1MD2D 2PO4A 3HZXA 2O5JC 3GTGB 1J6QA 3BDOA 3CCVA 2M00A 2L15A 5T1GA 4FXDA 1F2ZA 2UUBL 1YBYA 2QA4A 1OXXK 1HXYD 3KJPA 5JEAG 1X65A 5IT9L 2V4DA 4ODGA 1WTRA 3AFQA 2ES2A 3AU7A 1KTKA 3KLSX 1PRTC 4PQXA 1Y1VG 1VQFA 4PZ8A 2ZT9C 3W3AA 4JI1L 4F87A 3K81C 2IT1A 2EY5A 2BE5D 1HTPA 1WD1A 3F8TA 2Q8IB 3CMAA 4IO9A 1KL9A 1PXUA 2F0TA 4Y52H 4B3TL 3S15B 1H9SA 4GKJQ 5EPLA 5EBDA 2N55A 3VA7A 1S5BD 2C9OA 1HNXL 3CKIB 3BJUA 2HUGA 2O4XA 4JW0A 3SEBA 3M85A 1A15A 3SK4A 4LF9L 4OHJA 3D4DA 1ENCA 1D5MC 1I6HB 1EQRA 1UE6A 5HGTA 1LV9A 4DR4Q 1SYEA 3GTQB 3PIOA 1I3QB 1LTGD 4PG3A 3SVMA 2XRSD 4S3SA 1MJCA 4QL5A 1K9MC 3D4WA 4EQOA 1T9HA 1Z6HA 3MXNB 1MBYA 3C2PA 1HQRD 4IN3A 1GJXA 1WI5A 5IP7H 4DV7L 4JI4Q 1HZCA 2K05A 3K57A 4DR4L 4WJWA 3NTHA 1VQ8A 1TR5A 3J81c 3RMHA 4ID6A 4DK0A 1NJIC 5IYBG 2E74C 1PH2A 2RQXA 3A54A 4K0KL 3ULJA 3HOYB 1A63A 3FDTA 4KHZA 3DEOA 3BVMA 5ELDA 1CSPA 3BZKA 3S14H 5ELCA 1AFPA 3NTKA 2EY1A 4HJ9A 1FJGL 1LACA 2MGSA 3BU2A 5GAHC 1ET6A 4DUZL 2E5LL 3HOZB 4PV1C 1Y14B 4C3HG 5I6YA 2ICIA 2KEEA 3E5SA 2A69D 2A6ED 3H3VC 2PYKA
chains in the Genus database with same CATH topology
2E75C 2EY6A 2F0SA 1FNWA 3S2HB 3LWEA 4X3KA 2G9DA 3GTKB 1Q8IA 4WFN3 4IUUA 2L11A 2PZUA 1Y8PB 4CJ0B 2RDGA 4IUNA 2WAQB 1LTBD 2EJGC 5CGKA 1TWFB 1G291 1TU2B 3OSOA 3DWAA 1NCVA 4HCSA 2JA6B 5KNCA 3S1QB 5EJWA 2K1BA 1T5XD 1RODA 2EDGA 1I50B 1LLRD 2X6LA 3SK5A 5DEHA 4RH6A 4FF4A 3T56B 5CMDA 3NQIA 4A3JB 1YNND 2DNEA 3KBGA 2K03A 2K5DA 2NN6I 5I4DA 1F2YA 1AZQA 1Z7TA 2IPKD 4C56C 3RLFA 2F0IA 3E0JA 1EY5A 3SDZA 3JAME 2OT2A 3QWNA 5A2QE 3NUCA 1RTNA 5M3FB 5JJZA 1PZJD 5FLXL 2JEAI 2F3WA 2PQEA 3HG9A 3P7JA 2YU9B 1IW7C 1F9PA 4NP5A 5BN4A 1LTID 2B2TA 3MXPA 1A3VA 3DEPA 4K8IA 3W2DA 3ERQA 1O7ZA 1LT6D 1HHVA 1U4RA 3C1FA 4K14A 4CKEA 4TRDA 2BE5C 3S14B 3HOWB 2WP8J 1MGSA 2KECA 3MEHA 3MWYW 1PDQA 4DF7A 5ELBA 5CV7A 4X3TA 1AN8A 3LWUA 4DAYA 1KDCA 3BYYB 3DHQA 3TMEA 1CT1D 4C3JB 4KMUC 4Z9CB 1SNCA 4RHSA 1X32A 5IODA 3A56A 1HTLD 3FEWX 4KK7A 3GD7A 2NVXB 3FRPB 2Q8RE 1MSGA 1IHZA 1TY0A 3BZDB 5HURA 3J7YW 4IURA 1UUPA 3GTJB 4K2KA 2CW0D 3E6ZX 5E3FA 3A8JE 2NN6G 4LJZC 1WTQA 4F8MA 1SMYD 3X3NA 1BXTA 2MP1A 1G8ZD 3NTIA 2XWJB 1CK1A 2L12A 5JEAJ 1STGA 1DM0B 4RCOA 1SBBB 1EEFD 2ZXRA 1STBA 1VDZA 5ELFA 1STHA 2EY2A 4DGZA 3H0GB 3AMUA 4FXKC 1ET9A 3SHLA 2IX3A 3OWFA 1QG7A 3JAML 1I4QA 2A68C 3K58A 3PUVA 5F2DA 3DWQA 1SNOA 1L0YB 1BCPC 2RDHA 1YNJD 3S9WA 5I6WA 3T16A 1R4QB 3A8KE 2E2IB 1V1PB 3OIPA 5IIFA 5C6AA 4N9PA 3OOCA 5COYA 4IFDI 3K5OA 1BCPD 1AZPA 3S16B 2KEDA 4ULLA 4BA1I 3UI2A 1TWGB 1C48A 3FVQA 2G9HD 1RKNA 3EVQA 4RKLA 1F9RA 1GUOA 3HP3A 5EKIA 1PYWD 4RGNA 1D2BA 1LT5D 4BBSB 4OGQC 3J81L 2R93B 2A69C 2KHSA 1QNKA 3FPUB 1HUNA 3NK9A 3VYRA 1TKWB 5EPKA 3R8BA 4E6IA 1ZKOA 2F3VA 4DXGA 2PPBC 2Y0SB 2L9HA 2OF1A 1W6KA 5JAVA 1IYUA 4ZKCB 4NMZA 2NVYB 2D2CC 1EY4A 5IT9E 5C5MA 2IL8A 3J7AF 1K8OA 2DY8A 2D5DA 4DFAA 1EY6A 2SNMA 2R92B 2VXWA 3A7LA 5K5PA 2KVMA 1SE4A 2ZXPA 1STYA 2K32A 1QWYA 3DWPA 2DNCA 5IGFA 3VR4A 1BR9A 1TQOA 3GP7A 5C3WA 3PIP3 2JEBI 1I4HA 4IFDG 3NBIA 1EIHA 1EZ8A 3QB3A 1NUCA 4G7ZC 3IFTA 5D65A 3A55A 3NBHA 1ICWA 5TSSA 4A3MB 5JVH3 1TWAB 3URYA 4O42A 1PLFA 2DN8A 2F0JA 2K33A 3L9AX 4HCEA 4QUFA 3KBXA 4TSSA 5I9PA 1SNMA 2HDMA 1SE3A 5J39A 4DNTB 1EYCA 2F0MA 4XDXA 4R8NA 1LTSD 1E2WA 4C2MB 3D8GA 3U9OA 2M9VA 1BCPB 1CZWA 2ZXOA 1JQYD 1XXGA 1F77A 2MJ8A 5EGTA 2K04A 4MHEA 3AB9A 3J81E 1EYAA 5EBCA 3GQBA 2SEBD 3NP8A 4K5XA 4A3GB 4KTAA 3T51B 1DOKA 1TS4A 1C8CA 3L3OC 2WACA 1Y8NB 5FLXE 2NTTA 4XYOA 2NWGA 1A3TA 4HSPA 3SXHA 2SDFA 1Y69U 1FNVA 1I4XA 4CKCA 3HEJA 5KNDA 4FF1A 1JOQA 3MVVA 5JEAH 2OEOA 2E2JB 2KQ3A 3NWTA 2EYOA 1SSOA 1YNJC 4ZAIA 1G91A 3HRZC 2A73B 5CV9A 3I70A 2EYPA 3MAQA 4H0LC 4QIWB 1L0XB 2L5TA 1VMCA 5EPJA 1HPCA 2E76C 3VYSA 1WTWA 1B53A 4DA2A 3Q6SA 4Q0FA 1SEBD 5KYIA 2KA7A 1I4PA 3OMGA 1QB5D 1UEAB 1YNNC 1VF5C 3BDCA 2NBFA 3DUZA 1V1PA 2PNRC 2JXMB 4K2LA 1BBXC 3PMFA 4C3JG 2KOLA 3D6CA 4KHVA 1SNQA 4FP5D 4HR7B 1B50A 3BG3A 3GV6A 5CBAE 2IX0A 1TS3A 2JE6I 3I3CA 1F2LA 2EOTA 2L0CA 1SDFA 3NE5B 3TP6A 2B2WC 4CJ1B 3HGBA 4IZ8A 1ENAA 1IW7D 2F4IA 3CQZB 2MUYA 5CV4A 3OHXC 1EQTA 5KNBA 1B2TA 3Q24A 1TY2A 2BA0A 2LS01 2BOSA 3RUZA 4DAVA 2KCCA 1Q90A 3BVZA 4V0BA 1CI3M 5E4WC 5A35A 2MHVA 4A3DB 1S5FD 1TVXA 2F0UA 3WOFA 4BBRB 1KDBA 1OXVA 4IUTA 4KKTA 4ZKBB 4Y7NB 3GTMB 1WTXA 3ITPA 4RA8A 1ZYRD 4C1NI 4KJOA 4OL7A 1PZKD 3H09A 4X3SA 1TWCB 2RDFA 3GO5A 5DNFA 1FNUA 3Q0AA 2N88A 2J4XA 4PNYA 2IJ0A 1SYBA 1CTMA 1DD2A 2NZ1D 5KGUA 1ZEQX 1O7LA 1DCZA 1D5ZC 2WKDA 1ESRA 1VF7A 1H9KA 1B1ZA 1IL8A 1QNUA 2WB1B 1Q3LA 1FYCA 4L8JA 2EYLA 4H44C 1PTOH 1X3QA 4K6LA 5I2XA 3VA5A 4NDXA 5C5LA 3KLRA 4HN7A 1KABA 3HOUB 1IYVA 1QILA 1S5CD 2XSCA 2KCNA 2VB2X 2F0OA 3K0YA 4K8JA 1CHPD 4CHTB 2EVBA 4KN4C 1E2ZA 1BDOA 2CHBD 2XVSA 1KLGD 1CQVA 1VMPA 4LMQD 3I4NB 1I4GA 3KLSA 1JICA 4C1NK 1EY9A 4KJNA 3GTLB 1Q1EA 1E2VA 4J8QA 1EL0A 1WTVA 5IGEA 4C3IB 1JE4A 3H94A 3I8ZA 1SYCA 3BYTB 4QMGA 4HAEA 4FXGC 2QILA 1Y1WB 4K5VA 2XWBB 3OIQA 1SNDA 2HQEA 3CHBD 3IAYA 1STAA 3LNNA 4P2CB 1QE6A 1U4LA 3I72A 3NHHA 2SNSA 4O1NA 4J1MA 3GTPB 1AW7A 4XTCS 3R2TA 5D14A 1ML0D 2FMCA 2RSOA 2JYOA 2QEJC 3R93A 5FO9B 2Q8TA 4ZYSA 1MSHA 1S4ZA 1FR3A 1PTOF 1EU3A 2B2VC 2IW3A 4M8AA 2HDLA 4BY7B 2K6AA 2D9UA 1PRTF 4IUQA 1AEXA 5M5YB 2F0LA 2BCOA 3X3MA 4BWGB 4UDUC 4MN3A 4K6DA 3OPOA 2O2LD 2F0GA 2XN9C 2QCPX 1NR2A 1JORA 4KKUA 2H1EA 5EKKA 1SYGA 3QJYA 1D1KA 2D62A 4RKBA 1MI2A 2F0PA 1V8QA 1H9RA 1CHQD 2X6GA 3MTSA 5I2YA 4B08A 3G6JB 2C5CA 2F03A 1EY7A 4OIKA 1NSNS 3OMCA 5IGCA 3S1RB 4BY1B 1M4VA 4QB4A 5M9OA 2FFKB 3HOVB 1WTOA 1OXSC 3MXNA 2DY7A 1OXTA 2FMMA 3ONAB 5I9OA 3K5LA 1KDAA 2I07B 4N9TA 1W6JA 1J9OA 2QKIC 4C3HB 2EYMA 1EY0A 2M2LA 3NPPA 1DJRD 4PMBA 4FNFA 1O80A 1R4PB 5CV6A 1BCPF 1O78A 1LT3D 1JWSD 3QG1A 2O5IC 5M5XB 1F9SA 1XX8A 1RJTA 4HSVA 3Q23A 4X3UA 3D4RA 4DAPA 4QF4A 3S2DB 1LTTD 3MZ5A 4ZUIA 1BO0A 4NW2A 4H13C 2L55A 3OW7A 2XRQD 5E4XA 3VR3A 5E1FA 4RHRA 1WD0A 4A3EB 4EQNA 1SNPA 2PMZB 1H9MA 1JOKA 2A68D 3OWEB 3SK6A 2A6HD 1TT2A 4ZLTF 1PZID 2IX1A 3GTOB 1LTAD 4CJ2C 2F0HA 1SYDA 1PRTD 4ZRZA 3QOJA 4RGOS 2VUMB 2OXPA 4KKSA 1V1OA 3PUWA 2XNAC 1I4RA 5J22A 3A7AB 1BUVT 3MXUA 2K5QA 4U673 2A74C 1TS2A 1SYFA 2K5WA 4IQZA 1B9NA 2F0NA 3KF8A 2NVTB 1EWCA 3TZUA 3NWSA 3N52A 5K36G 4G7OC 3CU7A 1R9TB 4DN4M 3MFYA 1HA6A 2Z1CA 3D31A 1CFMA 1A2UA 2B8GA 4TQUS 2EZVA 2WINB 3VR2A 1A2TA 4BA2I 3KK7A 4XT3B 1HQMC 1PTOB 3NQTA 1Y1VB 5C44B 4KV6A 5CORA 5IGGA 1BOSA 2H4OA 4DU9A 3BDLA 4B9WA 1GOZA 4YIJA 1EEID 4DK1A 1KAAA 2BDNA 2AQ2B 2PZTA 5JOBA 1U9RA 4L6TB 3M3YB 2CW0C 4AYBB 2B2YA 2QF7A 2EXZA 2F0DA 3TP7A 5C4XB 3DMUA 5T1IA 1SMYC 1OXUA 1PFMA 2NN6H 1A3UA 2KJXA 2L1BA 2LFNA 1JWUD 1SJHD 1JB3A 1QOHA 4J6HA 5IOCA 4ILWA 2B2UC 2B2TC 5FK9C 4RCNA 4F88A 2AUKA 1LTRD 1GUTA 5LL6S 1STNA 5C0XH 3IKJA 4EVOA 3T4AC 3J7AV 3HKZB 2K01A 4RAUC 2AWOA 4G7HC 5D3DA 3S17B 3PUYA 5CR3A 2I46A 4KN7C 1J8IA 1D6EC 2AQ1B 1Y8OB 1M8AA 1HRJA 4RGMA 4HMIA 2BA1A 3TP5A 1EOTA 1KNEA 3GV3A 1RTOA 1GXDC 2NUCA 3PO2B 1EIGA 3SK8A 1PTOC 4IFDH 3RD4A 2PCFB 3C1EA 3TN2A 4WRDA 3TSSA 1HA5A 2YYZA 3NSWA 1EY8A 3R3OA 5C0XG 4CBVA 4HMJA 4K5WA 2CVRA 4GZYC 1CZGA 3TP8A 1T5EA 1UNSA 5CYUA 1PTOD 3HS0C 2SOBA 1I6VC 5C4HA 4KY6A 3DM1A 4FF3A 1WCMB 1BF4A 2EYJA 3I90A 2WKCA 3J80L 1SJED 3FMCA 2QDBA 4OO1G 1CA6A 2A5HA 4ZQ3A 3VYUA 1EYDA 3WDNA 2EJFC 3K5NA 5M5WB 2R7ZB 1B9MA 4DXFA 1JR0D 1RHPA 5IGBA 1G2SA 4NKLA 2JA5B 4ABNA 3P75A 3BS1A 4XYQA 3V96A 2AUJD 2WIIB 1DOMA 2ID0A 3V05A 2ICEC 4HTHA 1D1IA 2A6HC 4PMCA 3N6RA 4C3IG 5NUCA 4EQPA 3I91A 3QOLA 4KY7A 3I73A 4QUCA 4RFBA 1ENFA 3MA2B 4G4KA 3P20A 2WV6D 4OO1H 3PUXA 1FD7D 3C46A 3M4YA 1JWMD 1VCIA 1NAPA 4BS9A 2BDOA 2L4NA 5G3LF 1PFBA 1ESFA 5DAUA 1TWHB 4IALA 3A8IE 1DONA 2B2WA 2VB3X 3VYTA 3SR1A 3IFDA 1Z47A 3BVGA 5KIXA 1Q1BA 4F7XA 3Q22A 4KY5A 5ISRA 4KD4A 5KEEA 1CM9A 2NTSA 2Z4IA 4I65A 3DXJC 2LY7A 4L63B 2F0EA 3VR6A 1ILPA 2Z4HA 2R61A 3QIAA 5C0XJ 4MIUA 4OIJA 4FF2A 4IUPA 1ONLA 4FVMA 1NR4A 4KI0A 2E2HB 3CRKC 1F9QA 3L7ZC 3M7GA 2AWNA 5J1ZA 2TSSA 1JOOA 1CQFA 5BN5A 2B2YC 3D3RA 3LX0A 4JK1C 2X69A 4G57A 4RWSC 5IGDA 5C4ZA 4A3FB 1GUSA 5CC4A 1KNAA 5G3LD 1UAPA 2K28A 2EE1A 4JBWA 4FO2A 3PUZA 3H6MA 1TIID 5LL6X 4XQJA 4A3KB 4XQQA 5JVG3 2NB0A 1HUMA 1EU4A 4I7ZC 4UAIA 4CKBA 2F0QA 2EYFA 2JA8B 2PZWA 2RBMA 3ND8A 3I4MB 2ENBA 1II3A 1U4MA 1WTPA 1G6ZA 2F0WA 2F1MA 1HFNA 1O7YA 3K59A 1EWHA 5BN3A 5FO8B 4Q5VA 3PO3B 4PMWA 1IKLA 3MXGA 3VR5A 3WOEA 1CA5A 5JPMC 2PW5A 2LMCB 3F2UA 1GHKA 1PFNA 4A3BB 1SAPA 3FKIB 4KD3A 5M3MB 2K7VA 5C3EB 3EJIA 1RCVD 5DM73 3K7AB 2E2DC 1KLUD 5A2QL 1XWEA 4XXEA 2JA7B 3T53B 2HCIA 4WORA 1WVLA 5JPNC 1SE2A 1GUNA 2RSNA 1H9SB 4U68A 1QCBD 5C0XI 1F2MA 3R2IA 3S1NB 2FJ2A 4ZK9B 4XIGS 5LHY1 3SE0A 1ILQA 2NVQB 2RKSA 1XTCD 1C4QA 1RF2D 4RGTA 4LK1C 3EFXD 2NYZD 1BNZA 2A6EC 3MHBA 5DM63 1EQVA 2CQAA 1OO9B 5FOBB 5EKLA 2J0TD 5KYLA 3TZDA 1TS5A 3K6OA 3PIO3 3HOXB 4R9WA 4IFDJ 3EQLC 1S5ED 5FKAC 1GUWA 1LABA 1H9JA 2J7ZA 5FO7B 5CV8A 4XQNA 1RDPD 1HFGA 2KUMA 5C3XA 1JC7A 3O13A 5CBEE 4H7BA 5EQ0A 3TBIB 2EYHA 2PW7A 3RZDB 2MPMA 4CGYB 3V2TA 4V190 2B8FA 3ZYYX 3QO2A 3NXWA 3RZOB 1EFID 3H91A 2FINB 1STEA 1RD9D 1S5DD 4HEDA 2XIWA 4B9XA 4A3IB 2JP1A 3K5MA 1B44D 4OO1I 1AP0A 3MC0B 5AFWA 3FPPA 2B2VA 3U9SA 4EGVA 4ME5A 2FHTA 5KRUA 2HCCA 3ND9A 3S1MB 4TKOB 1LO5D 2R3ZA 1BQQT 3MFGA 4QCLA 1ZXTA 2B39A 3EROA 2B2UA 4M1UB 1JCKB 3CRLC 1B3AA 4ZUJA 2JSOA 1DZ1A 1PRTB 1HCZA 3PV0A 2B63B 1DYQA 1U4PA 1A6XA 3C3LA 1FGBD 5ELEA 5D3IB 1E0BA 1D5XC 4IUVA 1GUGA 2EPBA 3EA6A 1GHJA 3J80E 1QJOA 3M4OB 2F0KA 1IKMA 1LT4D 3I4LA 1G2TA 1X3PA 2Z8LA 5K36H 4FYDA 2VNUD 1SXTA 2RA4A 4XT1B 2GA4B 1DXMA 1V43A 2F0FA 3D6WA 5C4JB 3T13A 3IL8A 2R6GA 1B4OA 2RVLA 4LAAA 2LKVA 2EJMA 4R8IA 1DOLA 3KUPA 3G7LA 1K8MA 1ZYRC 1EZ6A 1PMRA 2IWHA 1Q12A 1K83B 3P1HA 2AQ3B 2F0VA 5CV5A 4DNRB 1XYIA 3M7NA 3TDQA 1SFOB 2TMPA 4A93B 1MD2D 2PO4A 3HZXA 2O5JC 3GTGB 3BDOA 2M00A 5T1GA 4FXDA 1F2ZA 1OXXK 1HXYD 5JEAG 5IT9L 2V4DA 4ODGA 1WTRA 3AU7A 1KTKA 3KLSX 1PRTC 4PQXA 2ZT9C 3W3AA 4F87A 2IT1A 2EY5A 2BE5D 1HTPA 1WD1A 2Q8IB 1PXUA 2F0TA 3S15B 1H9SA 5EPLA 5EBDA 2N55A 3VA7A 1S5BD 2C9OA 3CKIB 2HUGA 2O4XA 3SEBA 3M85A 1A15A 3SK4A 4OHJA 3D4DA 1ENCA 1D5MC 1I6HB 5HGTA 1LV9A 1SYEA 3GTQB 1I3QB 1LTGD 3SVMA 2XRSD 4S3SA 3D4WA 4EQOA 1Z6HA 1MBYA 3C2PA 1HQRD 4IN3A 1GJXA 2K05A 3K57A 4WJWA 3NTHA 1TR5A 3RMHA 4ID6A 4DK0A 2E74C 2RQXA 3A54A 3HOYB 3FDTA 4KHZA 3DEOA 3BVMA 5ELDA 5ELCA 1AFPA 3NTKA 2EY1A 1LACA 2MGSA 1ET6A 3HOZB 4PV1C 4C3HG 5I6YA 2ICIA 2KEEA 3E5SA 2A69D 2A6ED 3H3VC 2PYKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4TRD A;  4K6D A;  5C5M A;  4DU9 A;  3BDL A;  3NP8 A;  4G57 A;  1F2Z A;  4K5X A;  4KTA A;  2EY6 A;  2F0S A;  2F0G A;  2F0O A;  4K8J A;  4EQP A;  5C4Z A;  3C1E A;  4YIJ A;  5CC4 A;  4WRD A;  3TP6 A;  3QOL A;  4KY7 A;  2WAC A;  4DFA A;  1EY6 A;  4QF4 A;  2RKS A;  2SNM A;  3MEH A;  5F2D A;  4DF7 A;  3MZ5 A;  4IZ8 A;  1KAA A;  1SNO A;  1A3T A;  1EY8 A;  4ZUI A;  1ENA A;  4ODG A;  1JOR A;  2PZT A;  5CV7 A;  3R3O A;  3SXH A;  2PZU A;  3H6M A;  4K14 A;  3ERO A;  5EKK A;  4HMJ A;  5JOB A;  1U9R A;  5CV4 A;  1SYG A;  4K5W A;  5K5P A;  5E1F A;  3S9W A;  4IUN A;  4ZUJ A;  5I6W A;  1KDC A;  1EY9 A;  1STY A;  3T16 A;  2EY5 A;  3HEJ A;  3MHB A;  4KJN A;  4RKB A;  3RUZ A;  3TP8 A;  4EQN A;  1SNP A;  5CGK A;  1EQV A;  1JOK A;  5IGF A;  3SK6 A;  2EXZ A;  3DHQ A;  2F0D A;  3TME A;  3TP7 A;  2F0P A;  1SNC A;  1JOQ A;  3MVV A;  3OSO A;  1TT2 A;  5EKL A;  5IGE A;  2F0Q A;  2OEO A;  3DMU A;  5IOD A;  2EYF A;  1TQO A;  5KYL A;  2SOB A;  5IIF A;  2PZW A;  5C3W A;  2RBM A;  2KQ3 A;  5DAU A;  5C4H A;  2F0T A;  4IAL A;  4KY6 A;  2F0H A;  1SYC A;  2F0U A;  2EYO A;  2ENB A;  1II3 A;  1SYD A;  4QMG A;  1A3U A;  3QOJ A;  5C6A A;  5KRU A;  2OXP A;  4N9P A;  1EZ8 A;  3QB3 A;  1NUC A;  1EY7 A;  5CV9 A;  1KDB A;  1NSN S;  2O4X A;  1IHZ A;  3OMC A;  3SK4 A;  3D4D A;  2F0W A;  3SK5 A;  1ENC A;  2F0K A;  3SR1 A;  4K5V A;  5HUR A;  5IGD A;  5IGC A;  3ITP A;  5J22 A;  4J6H A;  5IOC A;  2EYP A;  4QB4 A;  5DEH A;  2EYJ A;  5HGT A;  5KIX A;  1SND A;  5M9O A;  1RKN A;  3EVQ A;  4RKL A;  1SYE A;  4F7X A;  4K2K A;  2QDB A;  2F0J A;  4KJO A;  2HQE A;  4KY5 A;  4OL7 A;  5CV8 A;  5ISR A;  5E3F A;  2PW5 A;  4ZQ3 A;  4KD4 A;  4S3S A;  5KEE A;  3D4W A;  1EYD A;  4EQO A;  1STN A;  1STA A;  1SYF A;  2RDF A;  5C3X A;  4F8M A;  4EVO A;  1F2Y A;  5I9P A;  4I65 A;  4PNY A;  1SNM A;  2F0N A;  3NHH A;  2SNS A;  4H7B A;  4KD3 A;  1SYB A;  4J1M A;  5J39 A;  2F0E A;  2EYH A;  2PW7 A;  2F0F A;  5KGU A;  1STG A;  1EYC A;  2F0I A;  5I9O A;  3T13 A;  1EY5 A;  2F0M A;  3EJI A;  3V2T A;  1KDA A;  2KHS A;  4N9T A;  1TR5 A;  4LAA A;  4R8N A;  2LKV A;  4ID6 A;  5CR3 A;  3NUC A;  3NXW A;  5KYI A;  4MIU A;  5IGB A;  3NK9 A;  3D8G A;  1A2U A;  1STB A;  2F3W A;  2PQE A;  3OMG A;  2EYM A;  4NKL A;  3U9O A;  1EZ6 A;  3P75 A;  4E6I A;  1EY0 A;  4HMI A;  4NP5 A;  3BDC A;  4B9X A;  4B9W A;  3P1H A;  2F3V A;  2F0V A;  2EYL A;  3MXP A;  1A3V A;  1STH A;  2EY2 A;  4K8I A;  4DGZ A;  1A2T A;  4PMB A;  4WOR A;  3TP5 A;  2OF1 A;  3ERQ A;  2EY1 A;  4K2L A;  5CV5 A;  3SHL A;  3PMF A;  5J1Z A;  5JAV A;  1JOO A;  4HTH A;  5CV6 A;  3D6C A;  4NDX A;  3VA5 A;  1AEX A;  3NQT A;  4KHV A;  5EGT A;  2F0L A;  4NMZ A;  1SNQ A;  5C5L A;  3OWF A;  3HZX A;  5I6Y A;  4PMC A;  1KAB A;  1EYA A;  2NUC A;  3E5S A;  3LX0 A;  4KV6 A;  1F2M A;  3SK8 A;  1EY4 A;  2M00 A;  4ME5 A;  5IGG A;  3C1F A;  5NUC A;  2PYK A; 
#chains in the Genus database with same CATH topology
 2VL6 A;  4GNX B;  2E75 C;  2EY6 A;  2F0S A;  1FNW A;  1UEB A;  3S2H B;  3LWE A;  4OEM B;  4X3K A;  2G9D A;  2QDL A;  3GTK B;  4DV4 L;  4P75 A;  4JCV E;  2EIF A;  1Q8I A;  4WFN 3;  3CCR A;  4IUU A;  2L11 A;  2PZU A;  1Y8P B;  1CKN A;  3K7U C;  4CJ0 B;  2RDG A;  2MO0 A;  4IUN A;  2WAQ B;  1XTD A;  1E1T A;  1LTB D;  2EJG C;  3RLO A;  5CGK A;  1TWF B;  1G29 1;  1TU2 B;  3OSO A;  3HKS A;  3DWA A;  4WJ4 A;  4A3F H;  1NCV A;  4HCS A;  2JA6 B;  5KNC A;  3S1Q B;  4BY7 G;  5IWA L;  5EJW A;  2K1B A;  4DR2 Q;  2N3S A;  3ZJY C;  1T5X D;  1ROD A;  2EDG A;  5M3M H;  1I50 B;  2Z0S A;  1LLR D;  2X6L A;  3SK5 A;  3W5O A;  2ZJQ A;  5DEH A;  3UDI A;  4YWK A;  4RH6 A;  4FF4 A;  2WB1 G;  3T56 B;  2KBN A;  3NQI A;  5CMD A;  4A3J B;  1SMX A;  1YNN D;  2DNE A;  5M3F G;  3KBG A;  2UXC Q;  2K03 A;  2K5D A;  2YTX A;  2JQO A;  2NN6 I;  5I4D A;  1F2Y A;  1AH9 A;  2JA7 H;  1AZQ A;  2UXC L;  2Z6K A;  1Z7T A;  4NXM L;  1VQD A;  2IPK D;  4C56 C;  4ALP A;  4MTN A;  3RLF A;  2F0I A;  3E0J A;  1EY5 A;  3SDZ A;  4DAY B;  2OT2 A;  3QWN A;  3JAM E;  5A2Q E;  1YIJ A;  3H0G H;  5LMN Q;  2ZTC A;  3NUC A;  1RTN A;  4P72 A;  5M3F B;  5JJZ A;  1PZJ D;  5FLX L;  2JEA I;  2F3W A;  2PQE A;  3HG9 A;  3P7J A;  2YU9 B;  1IW7 C;  1F9P A;  2HD3 A;  4NP5 A;  5BN4 A;  1LTI D;  4A3L G;  2B2T A;  4JYA Q;  3MXP A;  1A3V A;  3DEP A;  4K8I A;  4POG A;  3W2D A;  3ERQ A;  3HOY G;  4LW1 A;  4C3H H;  3H0G G;  1O7Z A;  3KJO A;  3HOU H;  3I4N G;  1LT6 D;  4JV5 L;  4IOC A;  1HHV A;  1U4R A;  2D0O A;  1X55 A;  4LWC A;  2N49 A;  3C1F A;  4K14 A;  4CKE A;  4TRD A;  3JAM c;  2BE5 C;  5LMN L;  3S14 B;  4IPC A;  3HOW B;  2WP8 J;  1MGS A;  2I5H A;  2KEC A;  1X9N A;  3MEH A;  3MWY W;  1PDQ A;  4DF7 A;  1EIY B;  5ELB A;  1A62 A;  5JJL A;  5CV7 A;  3B6Y A;  2OWO A;  3GDE A;  4X3T A;  1YIT A;  1AN8 A;  3LWU A;  4J15 A;  3CF5 A;  4Y7N H;  2Z6K C;  1PH7 A;  4DAY A;  1KDC A;  1BVS A;  3KLW A;  3J81 j;  2VW9 A;  3BYY B;  3DHQ A;  3TME A;  1CT1 D;  4C3J B;  1YHQ A;  4KMU C;  4Z9C B;  1SNC A;  4RHS A;  4L5T A;  1PFS A;  1X32 A;  4OXP A;  3A56 A;  5IOD A;  1M90 C;  1HTL D;  3FEW X;  4YWL A;  1PH1 A;  1NMG A;  4KK7 A;  2R7F A;  3GD7 A;  2NVX B;  3FRP B;  3GTL H;  4LUZ A;  3CXC A;  2Q8R E;  4JI3 L;  1M1K C;  1MSG A;  1IHZ A;  2B29 A;  1TY0 A;  3BZD B;  5HUR A;  3J7Y W;  1I3Q H;  4IUR A;  3HKZ G;  3Q8D A;  1UUP A;  3GTJ B;  4K2K A;  5C3E G;  2CW0 D;  4X62 L;  3E6Z X;  5E3F A;  3A8J E;  4GN3 B;  2NN6 G;  4X66 Q;  1WFQ A;  5HY6 A;  4LJZ C;  3F2B A;  1WTQ A;  2OTJ A;  4F8M A;  4GOP C;  1SMY D;  3X3N A;  2RHQ B;  1BXT A;  2MP1 A;  3OYY A;  1G8Z D;  3NTI A;  2XWJ B;  1CK1 A;  2L12 A;  5JEA J;  1STG A;  1HZA A;  5IP7 G;  1DM0 B;  4RCO A;  3TS2 A;  1XMO L;  5GAD C;  1SBB B;  1XNQ Q;  4JI4 L;  1EEF D;  2ZXR A;  1STB A;  4JI0 L;  4X65 Q;  1VDZ A;  4C2M H;  4X65 L;  5ELF A;  1STH A;  2EY2 A;  4DGZ A;  3H0G B;  3AMU A;  4FXK C;  1ET9 A;  2VZA A;  4R4T A;  3SHL A;  5IYB H;  1KC8 C;  2F52 A;  4DV6 L;  1NTG A;  2IX3 A;  3OWF A;  1QG7 A;  3JAM L;  4NB3 A;  3GTG H;  1I4Q A;  1C9O A;  2RF4 A;  1VQE A;  3RZO H;  2A68 C;  4OON A;  3M4Q A;  3K58 A;  1VQB A;  3PUV A;  4R4I A;  5F2D A;  3DWQ A;  1SNO A;  1L0Y B;  1FGU A;  1GM5 A;  3H3V H;  4B3T Q;  1BCP C;  2RDH A;  2K5H A;  2Z9H A;  1YNJ D;  3S9W A;  1Q7Y C;  4OWW B;  5I6W A;  3T16 A;  1R4Q B;  3JC6 6;  4MNO A;  3A8K E;  3NEN A;  5ELO A;  2E2I B;  2JA6 G;  4B3R Q;  3U4Z A;  2VY3 A;  4QGU A;  1PA6 A;  1V1P B;  1GD7 A;  3OIP A;  5IIF A;  3S1M H;  1HJP A;  4N8F A;  1LTL A;  4APV A;  5C6A A;  4N9P A;  3OOC A;  5COY A;  4IFD I;  1PYB A;  3K5O A;  1KAW A;  1E7Z A;  1BCP D;  1AZP A;  3S16 B;  2KED A;  4LF8 L;  4ULL A;  4BA1 I;  3UI2 A;  1TWG B;  1C48 A;  4JC0 A;  3FVQ A;  2G9H D;  1RKN A;  3EVQ A;  4RKL A;  1F9R A;  1YVC A;  4LFA L;  1GUO A;  3HP3 A;  5EKI A;  1AE3 A;  3OTO L;  1PYW D;  4RGN A;  1VQA A;  3E9I A;  1D2B A;  1LT5 D;  4BBS B;  3RZD H;  4OGQ C;  2IY5 B;  4WJ3 M;  4LUO A;  3RLN A;  3J81 L;  2R93 B;  4HJA A;  4A3J G;  4CDF C;  2A69 C;  4YHH Q;  2KHS A;  2UUB Q;  1QNK A;  3FPU B;  4IOA A;  2YU9 H;  1HUN A;  4CDE C;  5C44 G;  3T1Y Q;  3HOU G;  3NK9 A;  3VYR A;  1TKW B;  1CKO A;  1IBL L;  5EPK A;  1K73 C;  3R8B A;  4E6I A;  4JI2 L;  1ZKO A;  2F3V A;  1Y1W G;  4DXG A;  2PPB C;  2Y0S B;  2L9H A;  2OF1 A;  1W6K A;  1B8A A;  3TEH B;  2QW7 A;  5JAV A;  1IYU A;  1PH4 A;  1YZ6 A;  3GTP H;  2F3I A;  4JI8 L;  4OWX B;  4UP7 A;  4ZKC B;  4NMZ A;  2NVY B;  2D2C C;  1EY4 A;  3TRE A;  3UDX A;  5IT9 E;  4RG1 A;  2IL8 A;  5C5M A;  4IPG A;  3J7A F;  1K8O A;  4DV3 L;  1VQJ A;  1Z9F A;  2DY8 A;  3CP0 A;  2D5D A;  4YCW A;  2K75 A;  4DFA A;  1EY6 A;  2SNM A;  1VQC A;  3M3Y H;  1P8L A;  2R92 B;  2VXW A;  3A7L A;  5K5P A;  2KVM A;  1SE4 A;  2G5D A;  2ZXP A;  4DR1 Q;  1STY A;  2K32 A;  1QWY A;  3NEM A;  3DWP A;  2DNC A;  5IGF A;  3VR4 A;  5HGQ A;  5GRO A;  1BR9 A;  1TQO A;  3HOV H;  3GP7 A;  5C3W A;  2K52 A;  2EXD A;  3PIP 3;  2JEB I;  3HKZ E;  1I4H A;  4IFD G;  3NBI A;  1EIH A;  1EZ8 A;  3QB3 A;  1FVI A;  1NUC A;  3EN2 A;  4G7Z C;  3OW2 A;  4A3D H;  3IFT A;  5D65 A;  3A55 A;  3NBH A;  2B63 G;  1ICW A;  4LF6 L;  2ALY B;  1PH5 A;  5TSS A;  4A3M B;  3W1B A;  5JVH 3;  1TWA B;  3URY A;  5L37 A;  4HID A;  1XNR L;  4O42 A;  1PLF A;  2DN8 A;  2F0J A;  3CW2 C;  2K33 A;  2DUD A;  2HT1 A;  3L9A X;  3I4O A;  4DV4 Q;  5IP9 H;  4HCE A;  5IYD H;  2K5V A;  1K28 A;  3E3X A;  4QUF A;  1BBU A;  4JI3 Q;  3KBX A;  4TSS A;  5I9P A;  1HZB A;  1SNM A;  2HDM A;  3MEF A;  1SE3 A;  4DKA C;  5J39 A;  4DNT B;  1EYC A;  2F0M A;  3PCO B;  4IJH A;  4XDX A;  4R8N A;  1LTS D;  1E2W A;  4LFB Q;  4C2M B;  3D8G A;  2GVB A;  3U9O A;  2M9V A;  4BXX H;  3PF4 A;  2LSS A;  1BCP B;  1CZW A;  2ZXO A;  1L2F A;  1WCM G;  1JQY D;  4R4O A;  2NVQ H;  1XXG A;  1F77 A;  3M4P A;  2MJ8 A;  5EGT A;  2K04 A;  4MHE A;  3AB9 A;  4A3E H;  3J81 E;  1EYA A;  4DV7 Q;  5EBC A;  4GNX A;  3G6E A;  3GQB A;  2SEB D;  3NP8 A;  4K5X A;  4A3G B;  4KTA A;  3T51 B;  1DOK A;  1TS4 A;  1C8C A;  3L3O C;  2R92 G;  2WAC A;  1Y8N B;  5FLX E;  2NTT A;  4XYO A;  2NWG A;  1IXR A;  1A3T A;  1B70 B;  4HSP A;  5M3M G;  5FJ8 H;  3SXH A;  2SDF A;  1Y69 U;  1FNV A;  1I4X A;  3RN5 A;  4CKC A;  4A3E G;  1K3R A;  4DV2 L;  3HEJ A;  5KND A;  1XPR A;  1AE2 A;  4FF1 A;  3FP9 A;  1JJC B;  4A93 G;  4PZ6 A;  1JOQ A;  3MVV A;  5JEA H;  2OEO A;  2E2J B;  4DUY Q;  2KQ3 A;  3I55 A;  1P16 A;  5JJI A;  3ULL A;  3NWT A;  2EYO A;  1SSO A;  1YNJ C;  4ZAI A;  2NVX H;  1G91 A;  5E7N A;  3HRZ C;  2A73 B;  5CV9 A;  3W1G A;  1PH9 A;  3I70 A;  3HOZ H;  1YHA A;  2EYP A;  1ICF B;  3MAQ A;  4H0L C;  4QIW B;  1KIX A;  1L0X B;  4DK3 C;  1Q81 C;  4DR7 Q;  2N78 A;  4N8X 1;  2L5T A;  1VMC A;  5EPJ A;  4OX9 Q;  3KDF A;  1HPC A;  2E76 C;  2QGQ A;  3VYS A;  4JI0 Q;  1WTW A;  3HOW G;  4B3S Q;  1VQN A;  1I50 H;  3RN2 A;  1B53 A;  4DA2 A;  3Q6S A;  1Q8K A;  4DR1 L;  1S40 A;  4Q0F A;  1SEB D;  5KYI A;  2KA7 A;  1I4P A;  2PI2 E;  3OMG A;  1QB5 D;  1UEA B;  1YNN C;  1VF5 C;  3BDC A;  2AHO B;  2NBF A;  3DUZ A;  1V1P A;  2UUA Q;  2PNR C;  1IYJ B;  2JXM B;  4K2L A;  1BBX C;  3PMF A;  2ZTD A;  4BY1 G;  3AFP A;  2YTY A;  4C3J G;  2KOL A;  3D6C A;  4KHV A;  1SNQ A;  4FP5 D;  4HR7 B;  1B50 A;  3BG3 A;  3GV6 A;  5CBA E;  5M5X H;  2IX0 A;  3D0F A;  4MTK A;  1UE5 A;  3KYH C;  1TS3 A;  2JE6 I;  3I3C A;  1F2L A;  2EOT A;  4JOI C;  1IBM Q;  2L0C A;  1SDF A;  3NE5 B;  3TP6 A;  2B2W C;  4CJ1 B;  3HGB A;  4IZ8 A;  4HJ5 A;  1ENA A;  1IW7 D;  2F4I A;  2A1A A;  3CQZ B;  2MUY A;  5CV4 A;  3OHX C;  1IL2 A;  1LM0 A;  2RCN A;  1EQT A;  5KNB A;  1B2T A;  3Q24 A;  1TY2 A;  2BA0 A;  2LS0 1;  2BOS A;  1HZ9 A;  2B3G A;  3CAM A;  3RUZ A;  5BR8 L;  4B3M L;  4DAV A;  1TWA H;  2KCC A;  1Q90 A;  1L1O B;  3BVZ A;  1CI3 M;  4V0B A;  1X54 A;  1O7I A;  5E4W C;  3S1Q H;  1HR0 W;  5LMU L;  5A35 A;  2MHV A;  4A3D B;  1S5F D;  1TVX A;  2F0U A;  1IBM L;  3TRZ A;  3G71 A;  3WOF A;  3H15 A;  4BBR B;  1KDB A;  1OXV A;  4IUT A;  4KKT A;  4ZKB B;  4Y7N B;  3GTM B;  1QVG A;  1WTX A;  3ITP A;  4RA8 A;  1ZYR D;  4C1N I;  2XTI A;  4KJO A;  4OL7 A;  1PZK D;  3H09 A;  4DV6 Q;  2PNH A;  4X3S A;  4QIW E;  1TWC B;  2RDF A;  3GO5 A;  3S15 H;  5DNF A;  1FNU A;  3Q0A A;  4PZ7 A;  2IHE A;  2ZTE A;  2N88 A;  2J4X A;  4PNY A;  4KLK A;  2IJ0 A;  1A0I A;  1SYB A;  1J5E L;  1CTM A;  1DD2 A;  1VQ5 A;  1QUQ A;  2NZ1 D;  5KGU A;  4B3R L;  1ZEQ X;  3AYH B;  3T1H L;  1O7L A;  4UHV A;  1DCZ A;  1D5Z C;  2WKD A;  3CC7 A;  1ESR A;  1R9T H;  1VF7 A;  3A5Z B;  4L5S A;  4QJF A;  1H9K A;  3T1H Q;  1B1Z A;  1IL8 A;  1QNU A;  4BBS H;  1KRS A;  2WB1 B;  5FLM H;  1HNX Q;  1Q3L A;  3PO3 G;  2VQF L;  1FYC A;  1C7Y A;  1CUK A;  4L8J A;  1SRU A;  2EYL A;  2OQK A;  3K7A H;  3HOW H;  4DUY L;  3FHW A;  4H44 C;  1PTO H;  4JI6 L;  1X3Q A;  4K6L A;  5I2X A;  3VA5 A;  4NDX A;  5EAY A;  4KHP L;  5C5L A;  3KLR A;  4HN7 A;  2R7Z G;  1KAB A;  3HOU B;  1IYV A;  1QIL A;  4GLX A;  1S5C D;  2XSC A;  2KCN A;  4DV2 Q;  2VB2 X;  2F0O A;  3K0Y A;  4K8J A;  2UUC L;  1CHP D;  4CHT B;  2EVB A;  4KN4 C;  5LMN W;  4LFC L;  1E2Z A;  1BDO A;  2CHB D;  2XVS A;  1KLG D;  1EIF A;  1CQV A;  1VMP A;  4LMQ D;  3I4N B;  3UDF A;  2GVA A;  4A3C H;  4ZCK A;  1I4G A;  3CME A;  2DGY A;  3KLS A;  1JIC A;  4C1N K;  1EY9 A;  2Q2T A;  1TWG H;  4KJN A;  3GTL B;  1HNW L;  2E8G A;  1Q1E A;  5H1S E;  1XMO Q;  4LF7 Q;  1HR0 L;  1K8A C;  1E2V A;  4J8Q A;  1EL0 A;  1WTV A;  5IGE A;  4C3I B;  1JE4 A;  4TVA B;  3J7A 5;  3H94 A;  2B63 H;  1FJG Q;  5GQO A;  4DR6 Q;  3I8Z A;  4BBR G;  1VQ7 A;  1SYC A;  3BYT B;  4QMG A;  4HAE A;  1E1O A;  2MQH A;  4FXG C;  3CPW A;  3ICE A;  2UU9 Q;  2VS1 A;  1VQL A;  2QIL A;  2MFI A;  3PO2 G;  1Y1W B;  2VUM H;  4K5V A;  1N33 L;  2XWB B;  3OIQ A;  1SND A;  1GVP A;  2HQE A;  3CHB D;  1WTH A;  1KRT A;  4AQY Q;  3IAY A;  4EX5 A;  1A8V A;  1STA A;  3U50 C;  3LNN A;  4P2C B;  1L0W A;  1QE6 A;  4LF4 Q;  1U4L A;  3I72 A;  5C3E H;  3NHH A;  2SNS A;  4O1N A;  1VQ4 A;  4J1M A;  3GTP B;  1EWI A;  3A74 A;  1AW7 A;  4X64 L;  5IYC H;  5AJ3 Q;  4XTC S;  3RNU A;  3R2T A;  2BH2 A;  5D14 A;  1ML0 D;  2FMC A;  2RSO A;  2JYO A;  2QEJ C;  3R93 A;  2LXJ A;  1NNX A;  2Q2H A;  2Q8T A;  5FO9 B;  4ZYS A;  3CCE A;  1MSH A;  4A3I G;  1S4Z A;  3K0X A;  5M3F H;  1FR3 A;  2AMC B;  3NEL A;  1VQ9 A;  1PTO F;  1EU3 A;  2B2V C;  2IW3 A;  4M8A A;  2HDL A;  4BY7 B;  1B7Y B;  2K6A A;  2D9U A;  1PRT F;  4IUQ A;  2R93 H;  1AEX A;  3PO2 H;  5M5Y B;  2F0L A;  4BY7 H;  5ELN A;  2BCO A;  3X3M A;  4BWG B;  4UDU C;  4JI5 Q;  4MN3 A;  4K6D A;  3OPO A;  4A93 H;  2O2L D;  2F0G A;  3KF6 A;  4GKJ L;  2JA5 H;  2XN9 C;  1WJJ A;  2QCP X;  3UE1 A;  1V1Q A;  4GNX C;  1VQG A;  1NR2 A;  3EBE A;  1JOR A;  3BZC A;  4IJL A;  4A3C G;  5IWA Q;  4A75 A;  4KKU A;  2H1E A;  4DV1 Q;  5EKK A;  1SYG A;  3QJY A;  1D1K A;  2D62 A;  4A3G H;  3J81 i;  3AEV A;  4RKB A;  4JI1 Q;  1MI2 A;  1TXY A;  2BH8 A;  2F0P A;  2JA8 H;  1V8Q A;  4GOP A;  1H9R A;  3S16 H;  1CHQ D;  2X6G A;  3MTS A;  5I2Y A;  4B08 A;  2QEX A;  4HIM A;  3G6J B;  2C5C A;  2F03 A;  4R4C A;  1LUZ A;  1QZH A;  4YCV A;  2HIX A;  2C35 B;  1H95 A;  1X56 A;  1EY7 A;  4OIK A;  1NSN S;  1WCM H;  1N36 L;  3OMC A;  4JBM A;  5IGC A;  3T1Y L;  1PV4 A;  3TQY A;  3S1R B;  4JI8 Q;  4BY1 B;  1M4V A;  4QB4 A;  5M9O A;  4GN5 A;  1TWC H;  2FFK B;  2ZM6 Q;  4DV5 L;  4CDC C;  4JPB W;  1HH2 P;  1VQI A;  1U0L A;  3HOV B;  1WTO A;  1OXS C;  3MXN A;  3GTJ H;  4ME3 A;  2XGT A;  2ZJR A;  2P5Z X;  1Q46 A;  1N8R C;  2DY7 A;  1OXT A;  2UUC Q;  1IBL Q;  4DR6 L;  2FMM A;  3ONA B;  4YCU A;  1G6P A;  5I9O A;  4LFA Q;  2ZM6 L;  3KFU A;  3K5L A;  1KDA A;  2I07 B;  4N9T A;  4A3G G;  1W6J A;  4DUZ Q;  2E5L Q;  1SN8 A;  1J9O A;  1VQ6 A;  2QKI C;  4JOI A;  4C3H B;  3PQI A;  2CH4 A;  2EYM A;  1JJG A;  1EY0 A;  2M2L A;  3NPP A;  1EFW A;  3QR8 A;  1DJR D;  4PMB A;  4FNF A;  1O80 A;  1R4P B;  1I94 L;  2CWA A;  4OEL B;  5CV6 A;  1BCP F;  5IT9 c;  4BBS G;  1O78 A;  1LT3 D;  1JWS D;  2K50 A;  2Y0S G;  3L2P A;  3QG1 A;  2O5I C;  5M5X B;  1F9S A;  1XX8 A;  1EQQ A;  4RMF A;  1SLJ A;  4MZ9 A;  2Q2U A;  4X6A H;  3DLL A;  1RJT A;  4NPS A;  4DV1 L;  4HSV A;  2I5L X;  3Q23 A;  4X3U A;  3D4R A;  4DAP A;  3U58 A;  4QF4 A;  3S2D B;  1LTT D;  3MZ5 A;  4ZUI A;  1BO0 A;  3EIV A;  4NW2 A;  4L5Q A;  2ZJP A;  4H13 C;  4A76 A;  1N34 L;  2L55 A;  3OW7 A;  2XRQ D;  5E4X A;  4OWT B;  5E1F A;  3VR3 A;  1JJ2 A;  1TWF H;  2V1C C;  4RHR A;  1WD0 A;  1U5K A;  4A3E B;  4GN4 B;  1SNP A;  4EQN A;  2PMZ B;  1H9M A;  4GLA C;  1JOK A;  2A68 D;  2JA6 H;  3OWE B;  3SK6 A;  3PO3 H;  4R1J A;  2A6H D;  4GLV B;  1TT2 A;  4A3M G;  3STB C;  4ZLT F;  1PZI D;  2IX1 A;  3GTO B;  2EQS A;  1LTA D;  4CJ2 C;  1Q86 C;  2F0H A;  1SYD A;  1PRT D;  3CPF A;  4ZRZ A;  4NXM Q;  3QOJ A;  4RGO S;  2VUM B;  2OXP A;  4KKS A;  1V1O A;  3PUW A;  4I7A A;  2XNA C;  1XNQ L;  1I4R A;  5J22 A;  3A7A B;  2A19 A;  1BUV T;  1JB7 A;  4X64 Q;  1YHB A;  2VQE L;  3MXU A;  2K5Q A;  1IBK L;  4B3M Q;  4U67 3;  2A74 C;  1TS2 A;  1SYF A;  4A3J H;  2K5W A;  4CDD C;  3I4M H;  2K14 A;  4IQZ A;  1B9N A;  2F0N A;  4AQY L;  1MIU A;  3J7Z C;  4DR2 L;  3KF8 A;  2NVT B;  1EWC A;  2D0P A;  3NWS A;  3N52 A;  3TZU A;  4LNQ A;  5K36 G;  4G7O C;  1V9P A;  2CWP A;  3CU7 A;  2HIV A;  1R9T B;  1EOV A;  3F1Z A;  4DN4 M;  3MFY A;  1HA6 A;  2Z1C A;  3D31 A;  1CFM A;  1A2U A;  4LF5 L;  2B8G A;  4TQU S;  2EZV A;  2WIN B;  2Z6B A;  3VR2 A;  4DR3 Q;  1A2T A;  1Y1V H;  4BA2 I;  3KK7 A;  4XT3 B;  1HQM C;  1PTO B;  3IRB A;  3NQT A;  3S24 A;  1Y1V B;  4P73 A;  5C44 B;  4KV6 A;  1N36 Q;  5COR A;  5IGG A;  1BOS A;  2H4O A;  4DU9 A;  3BDL A;  4B9W A;  1VQO A;  1GOZ A;  5GAG C;  4YIJ A;  4QY7 A;  1EEI D;  4DK1 A;  2YV5 A;  1E24 A;  1YNX A;  1KAA A;  2WFW A;  1K3B C;  2BDN A;  4LFC Q;  2AQ2 B;  2PZT A;  3F2C A;  2UXB Q;  1WYD A;  5JOB A;  1U9R A;  4L6T B;  4DPG A;  3I4N H;  3M3Y B;  2R92 H;  4BY1 H;  2CW0 C;  4AYB B;  2B2Y A;  2QF7 A;  4UP9 A;  2EXZ A;  2F0D A;  3TP7 A;  1SRO A;  5C4X B;  3DMU A;  1OTC A;  5T1I A;  2VUM G;  4B3S L;  1SMY C;  2OTL A;  1OXU A;  1PYS B;  1PFM A;  2NN6 H;  3E9H A;  1A3U A;  5GAE C;  1SR3 A;  2KJX A;  2UXD L;  1K0S A;  4OX9 L;  2L1B A;  3S1R H;  3SGI A;  2LFN A;  2NZH A;  1JWU D;  4IPH A;  1SJH D;  4DR7 L;  1JB3 A;  3HOX G;  1QOH A;  4J6H A;  5IOC A;  3FKI H;  4X62 Q;  1D8L A;  4ILW A;  1YI2 A;  2B2U C;  1UWV A;  2B2T C;  5AJ3 L;  5FK9 C;  4RCN A;  4F88 A;  2AUK A;  1XMQ L;  4JI7 L;  1LTR D;  4HJ7 A;  1GUT A;  5LL6 S;  1STN A;  5C0X H;  3IKJ A;  4EVO A;  2YTV A;  4X66 L;  3T4A C;  3J7A V;  3HKZ B;  2CKZ B;  2K01 A;  4RAU C;  4YY3 Q;  3KDF B;  4JVZ A;  2AWO A;  4G7H C;  5D3D A;  3S17 B;  3HOZ G;  3PIP A;  1I94 Q;  3PUY A;  5CR3 A;  2I46 A;  4KN7 C;  1J8I A;  1D6E C;  2AQ1 B;  1Y8O B;  3UDG A;  1M8A A;  1HRJ A;  3PF5 A;  4RGM A;  4HMI A;  1VQK A;  2BA1 A;  3TP5 A;  1LYL A;  1EOT A;  1KNE A;  1N9W A;  3GV3 A;  3CCQ A;  3CCS A;  2KEN A;  2PMZ E;  2CCZ A;  1RTO A;  4POF A;  1GXD C;  2NUC A;  3PO2 B;  4IPD A;  1EIG A;  3SK8 A;  1PTO C;  4IFD H;  1GKH A;  3RD4 A;  2ASB A;  1GO3 E;  2PCF B;  4QQB X;  1BKB A;  3C1E A;  3TN2 A;  2PI2 A;  4WRD A;  3TSS A;  1HA5 A;  2YYZ A;  3NSW A;  1KQS A;  1EY8 A;  1SFO H;  5JJK A;  1JE5 A;  3R3O A;  2R7D A;  5C0X G;  4CBV A;  4JYA L;  3E0E A;  4HMJ A;  3I2Z A;  3ERS X;  3CQZ H;  4K5W A;  2CVR A;  1YJ9 A;  4GZY C;  1CZG A;  3TP8 A;  2JA5 G;  1T5E A;  1UNS A;  4AH6 A;  4HJ8 A;  2ATW A;  4KHP Q;  2UXD Q;  3J80 i;  1VQM A;  5CYU A;  1PTO D;  3HS0 C;  2SOB A;  1I6V C;  1UE1 A;  5C4H A;  4DV0 Q;  4KY6 A;  1MKH A;  3AQQ A;  3DM1 A;  4UPA A;  2RCF A;  4A3K H;  5J3B A;  4FF3 A;  1WCM B;  1NBW A;  1BF4 A;  2EYJ A;  1CKN B;  3I90 A;  2WKC A;  5IP9 G;  1RL2 A;  3J80 L;  4JI6 Q;  1SJE D;  3FMC A;  2QDB A;  4LF9 Q;  1CSQ A;  4P74 A;  4OO1 G;  1CA6 A;  2A5H A;  4ZQ3 A;  3VYU A;  2OCE A;  1EYD A;  2AKW B;  3WDN A;  2EJF C;  3K5N A;  4HIO A;  4A3B G;  5M5W B;  1KHI A;  4O0A A;  4JI5 L;  3GTQ H;  2R7Z B;  1UE7 A;  2CQO A;  2E2H H;  1BBW A;  1B9M A;  1QUQ B;  4DXF A;  1JR0 D;  3KOJ A;  2KCM A;  2OQ0 A;  3CC2 A;  3HOV G;  1RHP A;  3LGJ A;  5IGB A;  1G2S A;  4NKL A;  3CCM A;  2JA5 B;  4ABN A;  3P75 A;  3BS1 A;  4DAM A;  4XYQ A;  3V96 A;  2AUJ D;  1KXL A;  2WII B;  4A3I H;  1Q82 C;  1X3E A;  1DOM A;  2ID0 A;  3V05 A;  2ICE C;  3CCU A;  2KCT A;  4HTH A;  4AYB E;  1PH6 A;  1D1I A;  1HR0 Q;  2A6H C;  3CCL A;  4PMC A;  3N6R A;  1DGS A;  4C3I G;  1VQH A;  5NUC A;  3F2D A;  4EQP A;  3I91 A;  3QOL A;  4KY7 A;  4JG2 A;  2UU9 L;  3I73 A;  4QUC A;  4RFB A;  1ENF A;  3MA2 B;  4G4K A;  2JK8 A;  3P20 A;  2WV6 D;  4JI2 Q;  1ASY A;  1ASZ A;  2E2J H;  2KHJ A;  4OO1 H;  4K0K Q;  3PUX A;  4GKK L;  1FD7 D;  3C46 A;  3M4Y A;  1NMF A;  1JWM D;  4LF7 L;  1VCI A;  1NAP A;  4BS9 A;  1N32 L;  4NXN L;  3GTO H;  2BDO A;  2L4N A;  3M4O H;  5G3L F;  1PFB A;  1ESF A;  5DAU A;  1TWH B;  4IAL A;  3A8I E;  3KF8 B;  5IYD G;  1DON A;  2B2W A;  1D7Q A;  2VB3 X;  1QVF A;  3VYT A;  2E2I H;  1HNW Q;  4LFB L;  3SR1 A;  3IFD A;  2Q2I A;  2F4V L;  1Z47 A;  2NZO A;  3BVG A;  2I5M X;  5KIX A;  2MO1 A;  1Q1B A;  4F7X A;  3Q22 A;  1WOC A;  4KY5 A;  5ISR A;  2LXK A;  2JN4 A;  4KD4 A;  5KEE A;  1CM9 A;  2NTS A;  2Z4I A;  1N34 Q;  4I65 A;  2K4K A;  2VQF Q;  1XMQ Q;  4JI7 Q;  3DXJ C;  2LY7 A;  4L63 B;  2F0E A;  3VR6 A;  2VQE Q;  1ILP A;  2IHF A;  2Z4H A;  2R61 A;  3QIA A;  5C0X J;  4LF6 Q;  2CH4 W;  4MIU A;  3CD6 A;  4OIJ A;  1YEZ A;  4FF2 A;  4IUP A;  1ONL A;  4FVM A;  4JBJ A;  1NR4 A;  4KI0 A;  2HHH L;  1C0A A;  2E2H B;  3CRK C;  1F9Q A;  3L7Z C;  3M7G A;  3I56 A;  4DV0 L;  1X3G A;  2AWN A;  5J1Z A;  2TSS A;  4FDB A;  1JOO A;  1CQF A;  5BN5 A;  2B2Y C;  4DNI A;  3D3R A;  3LX0 A;  5M5Y H;  4JK1 C;  1JT8 A;  2X69 A;  4G57 A;  4RWS C;  5IGD A;  5C4Z A;  4A3F B;  1GUS A;  5CC4 A;  1KNA A;  5G3L D;  1UAP A;  2K28 A;  2JA8 G;  3PGZ A;  2EE1 A;  4JBW A;  4FO2 A;  3PUZ A;  5C44 H;  3H6M A;  1JMC A;  1TII D;  5LL6 X;  4XQJ A;  4A3K B;  2DJF C;  4XQQ A;  5JVG 3;  3WWV A;  2NB0 A;  3RR5 A;  4LF5 Q;  1XPO A;  1HUM A;  3HOX H;  1EU4 A;  4I7Z C;  4UAI A;  2I0Q A;  4CKB A;  1B3Q A;  2Y0S E;  2F0Q A;  1FL0 A;  2EYF A;  2JA8 B;  2PQA B;  3S2H H;  2PZW A;  2RBM A;  3ND8 A;  3I4M B;  2ENB A;  1II3 A;  2PQA A;  1U4M A;  2CFM A;  1WTP A;  4DR5 Q;  1G6Z A;  4C3J H;  4AYB G;  2F0W A;  2F1M A;  5C4X H;  1HFN A;  1O7Y A;  3K59 A;  1EWH A;  5BN3 A;  5FO8 B;  4Q5V A;  4GKK Q;  3NBH B;  4H02 A;  3PO3 B;  4PMW A;  1IKL A;  5IY0 A;  3J80 c;  3MXG A;  3VR5 A;  3WOE A;  1CA5 A;  5JPM C;  2PW5 A;  2LMC B;  1S72 A;  3F2U A;  1GHK A;  1VQP A;  1PFN A;  3STB D;  4A3B B;  1VS0 A;  1SAP A;  3CCJ A;  1W2B A;  3FKI B;  4KD3 A;  4A3B H;  5M3M B;  4JV5 Q;  2K7V A;  5C3E B;  4NXN Q;  3EJI A;  1RCV D;  3S17 H;  1XNR Q;  4YY3 L;  5DM7 3;  3K7A B;  2E2D C;  1KLU D;  4LUV A;  5A2Q L;  2UUA L;  2WAQ E;  4A4I A;  3K80 C;  3HOY H;  1IZ6 A;  1XWE A;  4XXE A;  4A3K G;  1EUJ A;  2WB1 E;  2JA7 B;  2MNA A;  3T53 B;  2HCI A;  4WOR A;  1WVL A;  1K83 H;  5JPN C;  1X3F A;  1SE2 A;  1GUN A;  2RSN A;  1H9S B;  3ER0 A;  1RIP A;  4U68 A;  1QCB D;  5C0X I;  4A3F G;  1F2M A;  3R2I A;  3S1N B;  2FJ2 A;  4ZK9 B;  4XIG S;  1YJN A;  5LHY 1;  4LF4 L;  3PSI A;  3SE0 A;  3K8A A;  1ILQ A;  2NVQ B;  2RKS A;  1XTC D;  5DLQ E;  1C4Q A;  1PHJ A;  4AIM A;  4C3I H;  1RF2 D;  4RGT A;  2HHH Q;  4LK1 C;  3EFX D;  2NYZ D;  1N33 Q;  4UY8 C;  1BNZ A;  3VDY A;  2A6E C;  3MHB A;  5DM6 3;  1S3O A;  3G4S A;  1EQV A;  2CQA A;  2H5X A;  1OO9 B;  5FOB B;  5EKL A;  1CKM A;  3ULP A;  2J0T D;  1XJV A;  5KYL A;  1HNZ L;  3TZD A;  1KD1 C;  4L5R C;  3HFZ B;  4UP8 A;  1TS5 A;  3K6O A;  4EQ5 A;  1E3P A;  3PIO 3;  3HOX B;  4R9W A;  4A3M H;  4IFD J;  4HIK A;  3EQL C;  5IYC G;  1S5E D;  2JA7 G;  5FKA C;  1GUW A;  1LAB A;  1H9J A;  2J7Z A;  4YHH L;  3GTM H;  4P71 A;  5FO7 B;  1I6H H;  5CV8 A;  4XQN A;  4DR3 L;  4BXX G;  2F4V Q;  1RDP D;  1HFG A;  2KUM A;  1EYG A;  1XPU A;  3L0O A;  5C3X A;  1JC7 A;  1NE3 A;  1PH8 A;  3O13 A;  5FLX c;  5CBE E;  4H7B A;  4GS3 A;  5EQ0 A;  3TBI B;  3TS0 A;  2EYH A;  2PW7 A;  3RZD B;  2MPM A;  4CGY B;  3V2T A;  4V19 0;  2B8F A;  2JA9 A;  3ZYY X;  4GOP B;  3QO2 A;  3NXW A;  3RZO B;  1PVO A;  1EFI D;  5M5W H;  3I7F A;  3H91 A;  2FIN B;  1STE A;  1RD9 D;  1S5D D;  4HED A;  2XIW A;  4B9X A;  4A3I B;  2JP1 A;  3K5M A;  1B44 D;  4A3D G;  4OO1 I;  1HNZ Q;  1AP0 A;  3MC0 B;  5AFW A;  3FPP A;  5FJ8 G;  2B2V A;  1G51 A;  1MHW C;  4O2D A;  2A8V A;  3A5U A;  3U9S A;  2R93 G;  4EGV A;  4ME5 A;  2FHT A;  5KRU A;  4JBK A;  3H3V I;  2WAQ G;  2HCC A;  3A0J A;  1PH3 A;  3ND9 A;  3G48 A;  4YWM A;  3S1M B;  4A3L H;  4TKO B;  1LO5 D;  2R3Z A;  1BQQ T;  3MFG A;  4QCL A;  1ZXT A;  2NVY H;  2B39 A;  3ERO A;  2RHS B;  2B2U A;  2FXQ A;  1JCK B;  4M1U B;  3S1N H;  2DJG C;  3CRL C;  1B3A A;  4ZUJ A;  2K5N A;  1L1O C;  2JSO A;  1DZ1 A;  1PRT B;  1E22 A;  1HCZ A;  3PV0 A;  2B63 B;  1K8G A;  1DYQ A;  1U4P A;  4R4Q A;  1A6X A;  3C3L A;  1L1O A;  1FGB D;  2KHI A;  5ELE A;  1TWH H;  5D3I B;  1E0B A;  5FLM G;  1D5X C;  4IUV A;  2UXB L;  3S2D H;  1K0R A;  1GUG A;  2EPB A;  3EA6 A;  1GHJ A;  3J80 E;  1QJO A;  3U4V A;  3M4O B;  2F0K A;  1SE8 A;  3KF6 B;  5C4X G;  1IKM A;  1LT4 D;  1Y1W H;  3I4L A;  5BR8 Q;  1YJW A;  1G2T A;  1J5E Q;  4BBR H;  1X3P A;  2Z8L A;  3FKI G;  5K36 H;  4FYD A;  4DR5 L;  2VNU D;  1SXT A;  2RA4 A;  4XT1 B;  5C4J H;  5LMU Q;  1QZG A;  2GA4 B;  2HQL A;  3JAM i;  1DXM A;  1V43 A;  2F0F A;  3D6W A;  5C4J B;  3DM3 A;  3T13 A;  1X6O A;  3IL8 A;  5IE8 A;  2R6G A;  1B4O A;  2RVL A;  4DV3 Q;  4LAA A;  2LKV A;  2EJM A;  4LF8 Q;  4R8I A;  1W3S A;  3UE0 A;  3I4M G;  1DOL A;  3KUP A;  3G7L A;  1K8M A;  3M9B A;  1ZYR C;  1NY4 A;  1EZ6 A;  3CC4 A;  1PMR A;  2IWH A;  1Q12 A;  1K83 B;  1QVC A;  3P1H A;  2AQ3 B;  2F0V A;  4DK6 C;  3OTO Q;  2N8N A;  1I5F A;  5CV5 A;  4DV5 Q;  4DNR B;  1XYI A;  3GTK H;  3M7N A;  1MJE A;  3TDQ A;  2NVT H;  2R7Z H;  1IBK Q;  2GN5 A;  1SFO B;  2TMP A;  2JJQ A;  4A93 B;  1N32 Q;  1MD2 D;  2PO4 A;  3HZX A;  2O5J C;  3GTG B;  1J6Q A;  3BDO A;  3CCV A;  2M00 A;  2L15 A;  5T1G A;  4FXD A;  1F2Z A;  2UUB L;  1YBY A;  2QA4 A;  1OXX K;  1HXY D;  3KJP A;  5JEA G;  1X65 A;  5IT9 L;  2V4D A;  4ODG A;  1WTR A;  3AFQ A;  2ES2 A;  3AU7 A;  1KTK A;  3KLS X;  1PRT C;  4PQX A;  1Y1V G;  1VQF A;  4PZ8 A;  2ZT9 C;  3W3A A;  4JI1 L;  4F87 A;  3K81 C;  2IT1 A;  2EY5 A;  2BE5 D;  1HTP A;  1WD1 A;  3F8T A;  2Q8I B;  3CMA A;  4IO9 A;  1KL9 A;  1PXU A;  2F0T A;  4Y52 H;  4B3T L;  3S15 B;  1H9S A;  4GKJ Q;  5EPL A;  5EBD A;  2N55 A;  3VA7 A;  1S5B D;  2C9O A;  1HNX L;  3CKI B;  3BJU A;  2HUG A;  2O4X A;  4JW0 A;  3SEB A;  3M85 A;  1A15 A;  3SK4 A;  4LF9 L;  4OHJ A;  3D4D A;  1ENC A;  1D5M C;  1I6H B;  1EQR A;  1UE6 A;  5HGT A;  1LV9 A;  4DR4 Q;  1SYE A;  3GTQ B;  3PIO A;  1I3Q B;  1LTG D;  4PG3 A;  3SVM A;  2XRS D;  4S3S A;  1MJC A;  4QL5 A;  1K9M C;  3D4W A;  4EQO A;  1T9H A;  1Z6H A;  3MXN B;  1MBY A;  3C2P A;  1HQR D;  4IN3 A;  1GJX A;  1WI5 A;  5IP7 H;  4DV7 L;  4JI4 Q;  1HZC A;  2K05 A;  3K57 A;  4DR4 L;  4WJW A;  3NTH A;  1VQ8 A;  1TR5 A;  3J81 c;  3RMH A;  4ID6 A;  4DK0 A;  1NJI C;  5IYB G;  2E74 C;  1PH2 A;  2RQX A;  3A54 A;  4K0K L;  3ULJ A;  3HOY B;  1A63 A;  3FDT A;  4KHZ A;  3DEO A;  3BVM A;  5ELD A;  1CSP A;  3BZK A;  3S14 H;  5ELC A;  1AFP A;  3NTK A;  2EY1 A;  4HJ9 A;  1FJG L;  1LAC A;  2MGS A;  3BU2 A;  5GAH C;  1ET6 A;  4DUZ L;  2E5L L;  3HOZ B;  4PV1 C;  1Y14 B;  4C3H G;  5I6Y A;  2ICI A;  2KEE A;  3E5S A;  2A69 D;  2A6E D;  3H3V C;  2PYK A; 
#chains in the Genus database with same CATH homology
 2E75 C;  2EY6 A;  2F0S A;  1FNW A;  3S2H B;  3LWE A;  4X3K A;  2G9D A;  3GTK B;  1Q8I A;  4WFN 3;  4IUU A;  2L11 A;  2PZU A;  1Y8P B;  4CJ0 B;  2RDG A;  4IUN A;  2WAQ B;  1LTB D;  2EJG C;  5CGK A;  1TWF B;  1G29 1;  1TU2 B;  3OSO A;  3DWA A;  1NCV A;  4HCS A;  2JA6 B;  5KNC A;  3S1Q B;  5EJW A;  2K1B A;  1T5X D;  1ROD A;  2EDG A;  1I50 B;  1LLR D;  2X6L A;  3SK5 A;  5DEH A;  4RH6 A;  4FF4 A;  3T56 B;  5CMD A;  3NQI A;  4A3J B;  1YNN D;  2DNE A;  3KBG A;  2K03 A;  2K5D A;  2NN6 I;  5I4D A;  1F2Y A;  1AZQ A;  1Z7T A;  2IPK D;  4C56 C;  3RLF A;  2F0I A;  3E0J A;  1EY5 A;  3SDZ A;  3JAM E;  2OT2 A;  3QWN A;  5A2Q E;  3NUC A;  1RTN A;  5M3F B;  5JJZ A;  1PZJ D;  5FLX L;  2JEA I;  2F3W A;  2PQE A;  3HG9 A;  3P7J A;  2YU9 B;  1IW7 C;  1F9P A;  4NP5 A;  5BN4 A;  1LTI D;  2B2T A;  3MXP A;  1A3V A;  3DEP A;  4K8I A;  3W2D A;  3ERQ A;  1O7Z A;  1LT6 D;  1HHV A;  1U4R A;  3C1F A;  4K14 A;  4CKE A;  4TRD A;  2BE5 C;  3S14 B;  3HOW B;  2WP8 J;  1MGS A;  2KEC A;  3MEH A;  3MWY W;  1PDQ A;  4DF7 A;  5ELB A;  5CV7 A;  4X3T A;  1AN8 A;  3LWU A;  4DAY A;  1KDC A;  3BYY B;  3DHQ A;  3TME A;  1CT1 D;  4C3J B;  4KMU C;  4Z9C B;  1SNC A;  4RHS A;  1X32 A;  5IOD A;  3A56 A;  1HTL D;  3FEW X;  4KK7 A;  3GD7 A;  2NVX B;  3FRP B;  2Q8R E;  1MSG A;  1IHZ A;  1TY0 A;  3BZD B;  5HUR A;  3J7Y W;  4IUR A;  1UUP A;  3GTJ B;  4K2K A;  2CW0 D;  3E6Z X;  5E3F A;  3A8J E;  2NN6 G;  4LJZ C;  1WTQ A;  4F8M A;  1SMY D;  3X3N A;  1BXT A;  2MP1 A;  1G8Z D;  3NTI A;  2XWJ B;  1CK1 A;  2L12 A;  5JEA J;  1STG A;  1DM0 B;  4RCO A;  1SBB B;  1EEF D;  2ZXR A;  1STB A;  1VDZ A;  5ELF A;  1STH A;  2EY2 A;  4DGZ A;  3H0G B;  3AMU A;  4FXK C;  1ET9 A;  3SHL A;  2IX3 A;  3OWF A;  1QG7 A;  3JAM L;  1I4Q A;  2A68 C;  3K58 A;  3PUV A;  5F2D A;  3DWQ A;  1SNO A;  1L0Y B;  1BCP C;  2RDH A;  1YNJ D;  3S9W A;  5I6W A;  3T16 A;  1R4Q B;  3A8K E;  2E2I B;  1V1P B;  3OIP A;  5IIF A;  5C6A A;  4N9P A;  3OOC A;  5COY A;  4IFD I;  3K5O A;  1BCP D;  1AZP A;  3S16 B;  2KED A;  4ULL A;  4BA1 I;  3UI2 A;  1TWG B;  1C48 A;  3FVQ A;  2G9H D;  1RKN A;  3EVQ A;  4RKL A;  1F9R A;  1GUO A;  3HP3 A;  5EKI A;  1PYW D;  4RGN A;  1D2B A;  1LT5 D;  4BBS B;  4OGQ C;  3J81 L;  2R93 B;  2A69 C;  2KHS A;  1QNK A;  3FPU B;  1HUN A;  3NK9 A;  3VYR A;  1TKW B;  5EPK A;  3R8B A;  4E6I A;  1ZKO A;  2F3V A;  4DXG A;  2PPB C;  2Y0S B;  2L9H A;  2OF1 A;  1W6K A;  5JAV A;  1IYU A;  4ZKC B;  4NMZ A;  2NVY B;  2D2C C;  1EY4 A;  5IT9 E;  5C5M A;  2IL8 A;  3J7A F;  1K8O A;  2DY8 A;  2D5D A;  4DFA A;  1EY6 A;  2SNM A;  2R92 B;  2VXW A;  3A7L A;  5K5P A;  2KVM A;  1SE4 A;  2ZXP A;  1STY A;  2K32 A;  1QWY A;  3DWP A;  2DNC A;  5IGF A;  3VR4 A;  1BR9 A;  1TQO A;  3GP7 A;  5C3W A;  3PIP 3;  2JEB I;  1I4H A;  4IFD G;  3NBI A;  1EIH A;  1EZ8 A;  3QB3 A;  1NUC A;  4G7Z C;  3IFT A;  5D65 A;  3A55 A;  3NBH A;  1ICW A;  5TSS A;  4A3M B;  5JVH 3;  1TWA B;  3URY A;  4O42 A;  1PLF A;  2DN8 A;  2F0J A;  2K33 A;  3L9A X;  4HCE A;  4QUF A;  3KBX A;  4TSS A;  5I9P A;  1SNM A;  2HDM A;  1SE3 A;  5J39 A;  4DNT B;  1EYC A;  2F0M A;  4XDX A;  4R8N A;  1LTS D;  1E2W A;  4C2M B;  3D8G A;  3U9O A;  2M9V A;  1BCP B;  1CZW A;  2ZXO A;  1JQY D;  1XXG A;  1F77 A;  2MJ8 A;  5EGT A;  2K04 A;  4MHE A;  3AB9 A;  3J81 E;  1EYA A;  5EBC A;  3GQB A;  2SEB D;  3NP8 A;  4K5X A;  4A3G B;  4KTA A;  3T51 B;  1DOK A;  1TS4 A;  1C8C A;  3L3O C;  2WAC A;  1Y8N B;  5FLX E;  2NTT A;  4XYO A;  2NWG A;  1A3T A;  4HSP A;  3SXH A;  2SDF A;  1Y69 U;  1FNV A;  1I4X A;  4CKC A;  3HEJ A;  5KND A;  4FF1 A;  1JOQ A;  3MVV A;  5JEA H;  2OEO A;  2E2J B;  2KQ3 A;  3NWT A;  2EYO A;  1SSO A;  1YNJ C;  4ZAI A;  1G91 A;  3HRZ C;  2A73 B;  5CV9 A;  3I70 A;  2EYP A;  3MAQ A;  4H0L C;  4QIW B;  1L0X B;  2L5T A;  1VMC A;  5EPJ A;  1HPC A;  2E76 C;  3VYS A;  1WTW A;  1B53 A;  4DA2 A;  3Q6S A;  4Q0F A;  1SEB D;  5KYI A;  2KA7 A;  1I4P A;  3OMG A;  1QB5 D;  1UEA B;  1YNN C;  1VF5 C;  3BDC A;  2NBF A;  3DUZ A;  1V1P A;  2PNR C;  2JXM B;  4K2L A;  1BBX C;  3PMF A;  4C3J G;  2KOL A;  3D6C A;  4KHV A;  1SNQ A;  4FP5 D;  4HR7 B;  1B50 A;  3BG3 A;  3GV6 A;  5CBA E;  2IX0 A;  1TS3 A;  2JE6 I;  3I3C A;  1F2L A;  2EOT A;  2L0C A;  1SDF A;  3NE5 B;  3TP6 A;  2B2W C;  4CJ1 B;  3HGB A;  4IZ8 A;  1ENA A;  1IW7 D;  2F4I A;  3CQZ B;  2MUY A;  5CV4 A;  3OHX C;  1EQT A;  5KNB A;  1B2T A;  3Q24 A;  1TY2 A;  2BA0 A;  2LS0 1;  2BOS A;  3RUZ A;  4DAV A;  2KCC A;  1Q90 A;  3BVZ A;  4V0B A;  1CI3 M;  5E4W C;  5A35 A;  2MHV A;  4A3D B;  1S5F D;  1TVX A;  2F0U A;  3WOF A;  4BBR B;  1KDB A;  1OXV A;  4IUT A;  4KKT A;  4ZKB B;  4Y7N B;  3GTM B;  1WTX A;  3ITP A;  4RA8 A;  1ZYR D;  4C1N I;  4KJO A;  4OL7 A;  1PZK D;  3H09 A;  4X3S A;  1TWC B;  2RDF A;  3GO5 A;  5DNF A;  1FNU A;  3Q0A A;  2N88 A;  2J4X A;  4PNY A;  2IJ0 A;  1SYB A;  1CTM A;  1DD2 A;  2NZ1 D;  5KGU A;  1ZEQ X;  1O7L A;  1DCZ A;  1D5Z C;  2WKD A;  1ESR A;  1VF7 A;  1H9K A;  1B1Z A;  1IL8 A;  1QNU A;  2WB1 B;  1Q3L A;  1FYC A;  4L8J A;  2EYL A;  4H44 C;  1PTO H;  1X3Q A;  4K6L A;  5I2X A;  3VA5 A;  4NDX A;  5C5L A;  3KLR A;  4HN7 A;  1KAB A;  3HOU B;  1IYV A;  1QIL A;  1S5C D;  2XSC A;  2KCN A;  2VB2 X;  2F0O A;  3K0Y A;  4K8J A;  1CHP D;  4CHT B;  2EVB A;  4KN4 C;  1E2Z A;  1BDO A;  2CHB D;  2XVS A;  1KLG D;  1CQV A;  1VMP A;  4LMQ D;  3I4N B;  1I4G A;  3KLS A;  1JIC A;  4C1N K;  1EY9 A;  4KJN A;  3GTL B;  1Q1E A;  1E2V A;  4J8Q A;  1EL0 A;  1WTV A;  5IGE A;  4C3I B;  1JE4 A;  3H94 A;  3I8Z A;  1SYC A;  3BYT B;  4QMG A;  4HAE A;  4FXG C;  2QIL A;  1Y1W B;  4K5V A;  2XWB B;  3OIQ A;  1SND A;  2HQE A;  3CHB D;  3IAY A;  1STA A;  3LNN A;  4P2C B;  1QE6 A;  1U4L A;  3I72 A;  3NHH A;  2SNS A;  4O1N A;  4J1M A;  3GTP B;  1AW7 A;  4XTC S;  3R2T A;  5D14 A;  1ML0 D;  2FMC A;  2RSO A;  2JYO A;  2QEJ C;  3R93 A;  5FO9 B;  2Q8T A;  4ZYS A;  1MSH A;  1S4Z A;  1FR3 A;  1PTO F;  1EU3 A;  2B2V C;  2IW3 A;  4M8A A;  2HDL A;  4BY7 B;  2K6A A;  2D9U A;  1PRT F;  4IUQ A;  1AEX A;  5M5Y B;  2F0L A;  2BCO A;  3X3M A;  4BWG B;  4UDU C;  4MN3 A;  4K6D A;  3OPO A;  2O2L D;  2F0G A;  2XN9 C;  2QCP X;  1NR2 A;  1JOR A;  4KKU A;  2H1E A;  5EKK A;  1SYG A;  3QJY A;  1D1K A;  2D62 A;  4RKB A;  1MI2 A;  2F0P A;  1V8Q A;  1H9R A;  1CHQ D;  2X6G A;  3MTS A;  5I2Y A;  4B08 A;  3G6J B;  2C5C A;  2F03 A;  1EY7 A;  4OIK A;  1NSN S;  3OMC A;  5IGC A;  3S1R B;  4BY1 B;  1M4V A;  4QB4 A;  5M9O A;  2FFK B;  3HOV B;  1WTO A;  1OXS C;  3MXN A;  2DY7 A;  1OXT A;  2FMM A;  3ONA B;  5I9O A;  3K5L A;  1KDA A;  2I07 B;  4N9T A;  1W6J A;  1J9O A;  2QKI C;  4C3H B;  2EYM A;  1EY0 A;  2M2L A;  3NPP A;  1DJR D;  4PMB A;  4FNF A;  1O80 A;  1R4P B;  5CV6 A;  1BCP F;  1O78 A;  1LT3 D;  1JWS D;  3QG1 A;  2O5I C;  5M5X B;  1F9S A;  1XX8 A;  1RJT A;  4HSV A;  3Q23 A;  4X3U A;  3D4R A;  4DAP A;  4QF4 A;  3S2D B;  1LTT D;  3MZ5 A;  4ZUI A;  1BO0 A;  4NW2 A;  4H13 C;  2L55 A;  3OW7 A;  2XRQ D;  5E4X A;  3VR3 A;  5E1F A;  4RHR A;  1WD0 A;  4A3E B;  4EQN A;  1SNP A;  2PMZ B;  1H9M A;  1JOK A;  2A68 D;  3OWE B;  3SK6 A;  2A6H D;  1TT2 A;  4ZLT F;  1PZI D;  2IX1 A;  3GTO B;  1LTA D;  4CJ2 C;  2F0H A;  1SYD A;  1PRT D;  4ZRZ A;  3QOJ A;  4RGO S;  2VUM B;  2OXP A;  4KKS A;  1V1O A;  3PUW A;  2XNA C;  1I4R A;  5J22 A;  3A7A B;  1BUV T;  3MXU A;  2K5Q A;  4U67 3;  2A74 C;  1TS2 A;  1SYF A;  2K5W A;  4IQZ A;  1B9N A;  2F0N A;  3KF8 A;  2NVT B;  1EWC A;  3TZU A;  3NWS A;  3N52 A;  5K36 G;  4G7O C;  3CU7 A;  1R9T B;  4DN4 M;  3MFY A;  1HA6 A;  2Z1C A;  3D31 A;  1CFM A;  1A2U A;  2B8G A;  4TQU S;  2EZV A;  2WIN B;  3VR2 A;  1A2T A;  4BA2 I;  3KK7 A;  4XT3 B;  1HQM C;  1PTO B;  3NQT A;  1Y1V B;  5C44 B;  4KV6 A;  5COR A;  5IGG A;  1BOS A;  2H4O A;  4DU9 A;  3BDL A;  4B9W A;  1GOZ A;  4YIJ A;  1EEI D;  4DK1 A;  1KAA A;  2BDN A;  2AQ2 B;  2PZT A;  5JOB A;  1U9R A;  4L6T B;  3M3Y B;  2CW0 C;  4AYB B;  2B2Y A;  2QF7 A;  2EXZ A;  2F0D A;  3TP7 A;  5C4X B;  3DMU A;  5T1I A;  1SMY C;  1OXU A;  1PFM A;  2NN6 H;  1A3U A;  2KJX A;  2L1B A;  2LFN A;  1JWU D;  1SJH D;  1JB3 A;  1QOH A;  4J6H A;  5IOC A;  4ILW A;  2B2U C;  2B2T C;  5FK9 C;  4RCN A;  4F88 A;  2AUK A;  1LTR D;  1GUT A;  5LL6 S;  1STN A;  5C0X H;  3IKJ A;  4EVO A;  3T4A C;  3J7A V;  3HKZ B;  2K01 A;  4RAU C;  2AWO A;  4G7H C;  5D3D A;  3S17 B;  3PUY A;  5CR3 A;  2I46 A;  4KN7 C;  1J8I A;  1D6E C;  2AQ1 B;  1Y8O B;  1M8A A;  1HRJ A;  4RGM A;  4HMI A;  2BA1 A;  3TP5 A;  1EOT A;  1KNE A;  3GV3 A;  1RTO A;  1GXD C;  2NUC A;  3PO2 B;  1EIG A;  3SK8 A;  1PTO C;  4IFD H;  3RD4 A;  2PCF B;  3C1E A;  3TN2 A;  4WRD A;  3TSS A;  1HA5 A;  2YYZ A;  3NSW A;  1EY8 A;  3R3O A;  5C0X G;  4CBV A;  4HMJ A;  4K5W A;  2CVR A;  4GZY C;  1CZG A;  3TP8 A;  1T5E A;  1UNS A;  5CYU A;  1PTO D;  3HS0 C;  2SOB A;  1I6V C;  5C4H A;  4KY6 A;  3DM1 A;  4FF3 A;  1WCM B;  1BF4 A;  2EYJ A;  3I90 A;  2WKC A;  3J80 L;  1SJE D;  3FMC A;  2QDB A;  4OO1 G;  1CA6 A;  2A5H A;  4ZQ3 A;  3VYU A;  1EYD A;  3WDN A;  2EJF C;  3K5N A;  5M5W B;  2R7Z B;  1B9M A;  4DXF A;  1JR0 D;  1RHP A;  5IGB A;  1G2S A;  4NKL A;  2JA5 B;  4ABN A;  3P75 A;  3BS1 A;  4XYQ A;  3V96 A;  2AUJ D;  2WII B;  1DOM A;  2ID0 A;  3V05 A;  2ICE C;  4HTH A;  1D1I A;  2A6H C;  4PMC A;  3N6R A;  4C3I G;  5NUC A;  4EQP A;  3I91 A;  3QOL A;  4KY7 A;  3I73 A;  4QUC A;  4RFB A;  1ENF A;  3MA2 B;  4G4K A;  3P20 A;  2WV6 D;  4OO1 H;  3PUX A;  1FD7 D;  3C46 A;  3M4Y A;  1JWM D;  1VCI A;  1NAP A;  4BS9 A;  2BDO A;  2L4N A;  5G3L F;  1PFB A;  1ESF A;  5DAU A;  1TWH B;  4IAL A;  3A8I E;  1DON A;  2B2W A;  2VB3 X;  3VYT A;  3SR1 A;  3IFD A;  1Z47 A;  3BVG A;  5KIX A;  1Q1B A;  4F7X A;  3Q22 A;  4KY5 A;  5ISR A;  4KD4 A;  5KEE A;  1CM9 A;  2NTS A;  2Z4I A;  4I65 A;  3DXJ C;  2LY7 A;  4L63 B;  2F0E A;  3VR6 A;  1ILP A;  2Z4H A;  2R61 A;  3QIA A;  5C0X J;  4MIU A;  4OIJ A;  4FF2 A;  4IUP A;  1ONL A;  4FVM A;  1NR4 A;  4KI0 A;  2E2H B;  3CRK C;  1F9Q A;  3L7Z C;  3M7G A;  2AWN A;  5J1Z A;  2TSS A;  1JOO A;  1CQF A;  5BN5 A;  2B2Y C;  3D3R A;  3LX0 A;  4JK1 C;  2X69 A;  4G57 A;  4RWS C;  5IGD A;  5C4Z A;  4A3F B;  1GUS A;  5CC4 A;  1KNA A;  5G3L D;  1UAP A;  2K28 A;  2EE1 A;  4JBW A;  4FO2 A;  3PUZ A;  3H6M A;  1TII D;  5LL6 X;  4XQJ A;  4A3K B;  4XQQ A;  5JVG 3;  2NB0 A;  1HUM A;  1EU4 A;  4I7Z C;  4UAI A;  4CKB A;  2F0Q A;  2EYF A;  2JA8 B;  2PZW A;  2RBM A;  3ND8 A;  3I4M B;  2ENB A;  1II3 A;  1U4M A;  1WTP A;  1G6Z A;  2F0W A;  2F1M A;  1HFN A;  1O7Y A;  3K59 A;  1EWH A;  5BN3 A;  5FO8 B;  4Q5V A;  3PO3 B;  4PMW A;  1IKL A;  3MXG A;  3VR5 A;  3WOE A;  1CA5 A;  5JPM C;  2PW5 A;  2LMC B;  3F2U A;  1GHK A;  1PFN A;  4A3B B;  1SAP A;  3FKI B;  4KD3 A;  5M3M B;  2K7V A;  5C3E B;  3EJI A;  1RCV D;  5DM7 3;  3K7A B;  2E2D C;  1KLU D;  5A2Q L;  1XWE A;  4XXE A;  2JA7 B;  3T53 B;  2HCI A;  4WOR A;  1WVL A;  5JPN C;  1SE2 A;  1GUN A;  2RSN A;  1H9S B;  4U68 A;  1QCB D;  5C0X I;  1F2M A;  3R2I A;  3S1N B;  2FJ2 A;  4ZK9 B;  4XIG S;  5LHY 1;  3SE0 A;  1ILQ A;  2NVQ B;  2RKS A;  1XTC D;  1C4Q A;  1RF2 D;  4RGT A;  4LK1 C;  3EFX D;  2NYZ D;  1BNZ A;  2A6E C;  3MHB A;  5DM6 3;  1EQV A;  2CQA A;  1OO9 B;  5FOB B;  5EKL A;  2J0T D;  5KYL A;  3TZD A;  1TS5 A;  3K6O A;  3PIO 3;  3HOX B;  4R9W A;  4IFD J;  3EQL C;  1S5E D;  5FKA C;  1GUW A;  1LAB A;  1H9J A;  2J7Z A;  5FO7 B;  5CV8 A;  4XQN A;  1RDP D;  1HFG A;  2KUM A;  5C3X A;  1JC7 A;  3O13 A;  5CBE E;  4H7B A;  5EQ0 A;  3TBI B;  2EYH A;  2PW7 A;  3RZD B;  2MPM A;  4CGY B;  3V2T A;  4V19 0;  2B8F A;  3ZYY X;  3QO2 A;  3NXW A;  3RZO B;  1EFI D;  3H91 A;  2FIN B;  1STE A;  1RD9 D;  1S5D D;  4HED A;  2XIW A;  4B9X A;  4A3I B;  2JP1 A;  3K5M A;  1B44 D;  4OO1 I;  1AP0 A;  3MC0 B;  5AFW A;  3FPP A;  2B2V A;  3U9S A;  4EGV A;  4ME5 A;  2FHT A;  5KRU A;  2HCC A;  3ND9 A;  3S1M B;  4TKO B;  1LO5 D;  2R3Z A;  1BQQ T;  3MFG A;  4QCL A;  1ZXT A;  2B39 A;  3ERO A;  2B2U A;  4M1U B;  1JCK B;  3CRL C;  1B3A A;  4ZUJ A;  2JSO A;  1DZ1 A;  1PRT B;  1HCZ A;  3PV0 A;  2B63 B;  1DYQ A;  1U4P A;  1A6X A;  3C3L A;  1FGB D;  5ELE A;  5D3I B;  1E0B A;  1D5X C;  4IUV A;  1GUG A;  2EPB A;  3EA6 A;  1GHJ A;  3J80 E;  1QJO A;  3M4O B;  2F0K A;  1IKM A;  1LT4 D;  3I4L A;  1G2T A;  1X3P A;  2Z8L A;  5K36 H;  4FYD A;  2VNU D;  1SXT A;  2RA4 A;  4XT1 B;  2GA4 B;  1DXM A;  1V43 A;  2F0F A;  3D6W A;  5C4J B;  3T13 A;  3IL8 A;  2R6G A;  1B4O A;  2RVL A;  4LAA A;  2LKV A;  2EJM A;  4R8I A;  1DOL A;  3KUP A;  3G7L A;  1K8M A;  1ZYR C;  1EZ6 A;  1PMR A;  2IWH A;  1Q12 A;  1K83 B;  3P1H A;  2AQ3 B;  2F0V A;  5CV5 A;  4DNR B;  1XYI A;  3M7N A;  3TDQ A;  1SFO B;  2TMP A;  4A93 B;  1MD2 D;  2PO4 A;  3HZX A;  2O5J C;  3GTG B;  3BDO A;  2M00 A;  5T1G A;  4FXD A;  1F2Z A;  1OXX K;  1HXY D;  5JEA G;  5IT9 L;  2V4D A;  4ODG A;  1WTR A;  3AU7 A;  1KTK A;  3KLS X;  1PRT C;  4PQX A;  2ZT9 C;  3W3A A;  4F87 A;  2IT1 A;  2EY5 A;  2BE5 D;  1HTP A;  1WD1 A;  2Q8I B;  1PXU A;  2F0T A;  3S15 B;  1H9S A;  5EPL A;  5EBD A;  2N55 A;  3VA7 A;  1S5B D;  2C9O A;  3CKI B;  2HUG A;  2O4X A;  3SEB A;  3M85 A;  1A15 A;  3SK4 A;  4OHJ A;  3D4D A;  1ENC A;  1D5M C;  1I6H B;  5HGT A;  1LV9 A;  1SYE A;  3GTQ B;  1I3Q B;  1LTG D;  3SVM A;  2XRS D;  4S3S A;  3D4W A;  4EQO A;  1Z6H A;  1MBY A;  3C2P A;  1HQR D;  4IN3 A;  1GJX A;  2K05 A;  3K57 A;  4WJW A;  3NTH A;  1TR5 A;  3RMH A;  4ID6 A;  4DK0 A;  2E74 C;  2RQX A;  3A54 A;  3HOY B;  3FDT A;  4KHZ A;  3DEO A;  3BVM A;  5ELD A;  5ELC A;  1AFP A;  3NTK A;  2EY1 A;  1LAC A;  2MGS A;  1ET6 A;  3HOZ B;  4PV1 C;  4C3H G;  5I6Y A;  2ICI A;  2KEE A;  3E5S A;  2A69 D;  2A6E D;  3H3V C;  2PYK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...