2RBMA

Crystal structure of staphylococcal nuclease variant delta+phs i72k at cryogenic temperature
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
130
structure length
130
Chain Sequence
b'KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKKEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
molecule tags Hydrolase
source organism Staphylococcus aureus
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS I72K at cryogenic temperature
rcsb
total genus 36
structure length 130
sequence length 130
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2007-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2rbmA00
1KDAA 1EY9A 3H6MA 5J1ZA 1F2MA 4F8MA 5IGBA 1STYA 5C3WA 4KY6A 5C3XA 4K6DA 4HMIA 4KY5A 5CV9A 5F2DA 3EROA 3LX0A 2RKSA 5C4HA 3D8GA 4K14A 1SNCA 4EQOA 1SNOA 4KTAA 2F0VA 1SYGA 2F0OA 3MEHA 3PMFA 4H7BA 2F0HA 3RUZA 4NP5A 1A2UA 4IUNA 5NUCA 5HGTA 4DU9A 5IGEA 3S9WA 1TR5A 2EY6A 1STHA 3E5SA 5CV7A 5EKKA 5KYLA 5IGGA 1SNQA 2KQ3A 1STGA 5J22A 2F0WA 3NUCA 5JAVA 4ID6A 4DGZA 5I6WA 1ENCA 5C5MA 4QB4A 2EYHA 3OWFA 2F0GA 2EXZA 3MXPA 4R8NA 4MIUA 1EZ8A 3SXHA 1IHZA 4EQPA 1EY7A 4IALA 4EQNA 1STAA 4IZ8A 5JOBA 4PNYA 5CV8A 2F3VA 5C6AA 2F0JA 4DF7A 4K5WA 4ZUJA 3P1HA 5E3FA 1NUCA 3TP6A 4B9XA 2QDBA 3D4DA 3D6CA 3NQTA 2F0PA 4KD3A 4KY7A 4YIJA 4K8JA 3T13A 3U9OA 2SNSA 1KABA 2F0KA 5CV4A 1EY8A 2F0IA 4NKLA 4ZQ3A 2OXPA 3TP5A 5IGFA 1SYBA 1EY6A 3OSOA 1SNPA 2F0EA 5I9OA 1A3VA 4B9WA 2EYPA 2WACA 1SYFA 2RBMA 1EY0A 2F0LA 2EYJA 4N9TA 4K5XA 1SYDA 1AEXA 3MHBA 1TQOA 4QF4A 5DAUA 2ENBA 4KHVA 4E6IA 4ME5A 5I9PA 4N9PA 1A2TA 5C4ZA 4RKLA 1EYAA 1U9RA 2SNMA 1ENAA 4HMJA 3DHQA 1KDCA 1EYCA 1SYEA 2EY1A 2PZWA 4F7XA 4KD4A 1JORA 3BDCA 5CV5A 5EKLA 4J6HA 3TP7A 1II3A 2EYOA 2F0FA 4K2LA 3QOLA 4NMZA 4TRDA 3NK9A 5KEEA 3NP8A 3C1EA 5KRUA 5KYIA 4PMBA 2F0UA 4S3SA 5CR3A 5EGTA 3V2TA 3ERQA 3QOJA 4I65A 4OL7A 1EY4A 5M9OA 2EY2A 4DFAA 1KDBA 3OMGA 4WORA 3OMCA 2EYFA 1JOOA 2F3WA 4RKBA 3SR1A 1F2ZA 2OF1A 1A3UA 2EY5A 1EY5A 2PW7A 2M00A 3HZXA 2HQEA 4J1MA 3SK6A 3SK8A 5IODA 1JOQA 3NXWA 3TMEA 3EVQA 2F0SA 2EYMA 4WRDA 1RKNA 5IOCA 3ITPA 5IGDA 2PZTA 1SNMA 3C1FA 3BDLA 2SOBA 2O4XA 4K2KA 3T16A 3D4WA 1A3TA 1EZ6A 2F0DA 3TP8A 2PW5A 2PYKA 3DMUA 2PZUA 5IIFA 1STBA 5DEHA 1STNA 4G57A 5K5PA 4ZUIA 4LAAA 1KAAA 1TT2A 2RDFA 2EYLA 5I6YA 5IGCA 3NHHA 4QMGA 1SYCA 2LKVA 4EVOA 3SHLA 4HTHA 5ISRA 5KGUA 1JOKA 5CGKA 2KHSA 3HEJA 3MVVA 4PMCA 1SNDA 1EQVA 1EYDA 2F0NA 3EJIA 2F0MA 5C5LA 3SK5A 1F2YA 3QB3A 5CC4A 3VA5A 1NSNS 2F0TA 4K5VA 3MZ5A 4ODGA 5HURA 2F0QA 4K8IA 4KJNA 2NUCA 4NDXA 5KIXA 5CV6A 4KJOA 3SK4A 2PQEA 5J39A 5E1FA 3R3OA 3P75A 4KV6A 2OEOA
chains in the Genus database with same CATH superfamily
4RCNA 3TDQA 3MXGA 1A6XA 4LK1C 1K0RA 4KY6A 1MSGA 2PI2A 1YJ9A 3D8GA 5BN3A 2UU9L 4POFA 4DR7Q 3C3LA 1SNOA 1CM9A 2NTSA 2WKCA 1H9KA 1ZYRC 3K5LA 1RF2D 2ZTEA 4DV3Q 2I46A 1H9RA 4A3CG 4DR4Q 1HA5A 2IX1A 1HNZL 1A0IA 3GTKH 1W6JA 4DUZQ 1RTNA 5FJ8G 5IT9c 2ZTDA 2VXWA 3R93A 4ZCKA 3PGZA 4JCVE 1ZEQX 4K5WA 1PFMA 2UUCQ 3KK7A 2R93H 4Y52H 1Q3LA 2R93B 2OXPA 1I6HH 1MSHA 4G7HC 4IQZA 4B9WA 4XYQA 5LMNL 1TU2B 2OQ0A 4IUTA 5C5MA 1RD9D 5DAUA 2K5HA 3DWPA 4LF8Q 1IL2A 1PRTB 2WAQB 1UEBA 3ND8A 4OX9Q 3S2DH 1KDCA 2QEJC 5FK9C 1VQOA 5M3FG 2EPBA 4PG3A 1WOCA 2N8NA 4DK3C 5M3FB 3NBHA 2FJ2A 1C8CA 1N33Q 3I4NH 5KRUA 2VL6A 3M4YA 4PMBA 1H9SB 2EJGC 3BJUA 3RZDH 2ATWA 3HOUH 1Z9FA 3FPPA 3PUVA 1BBXC 5FLXE 4I65A 1J8IA 1V1PA 1GHJA 1FR3A 2R7ZG 4A76A 3NSWA 2GVAA 1XYIA 4IFDG 2K01A 2A6ED 3OMCA 2CH4A 3DM3A 5E4XA 1JOQA 3SK6A 2D9UA 5C4JB 4RFBA 3A8JE 2K52A 3I55A 3U50C 1VQCA 2MPMA 3I3CA 4TQUS 2A6HD 2K6AA 2O4XA 2F3IA 3TP8A 3Q6SA 1STBA 4JPBW 5DEHA 2OTJA 4C3JB 4QQBX 4OIJA 4CJ1B 4C3JH 4C56C 5IGCA 1YVCA 5JJIA 4BA2I 2H5XA 1TS4A 4IJHA 5M3MH 1X3PA 4DUYL 3PO2G 3K5OA 3HOYB 1E2WA 1VQIA 3BYTB 1HUNA 1DD2A 2AQ3B 3CPWA 2NB0A 3E0EA 4C3IB 1PMRA 4A3DG 5A2QE 1SFOH 3T1YL 3GDEA 1X55A 1KDAA 3N52A 5IWAL 3FKIH 3W5OA 3F2DA 2JA8G 4LUVA 4K6DA 3CKIB 3K57A 4HIDA 1B4OA 5CYUA 3UI2A 4H7BA 3PMFA 1EQRA 1TWFH 3EN2A 4HJAA 4GN4B 1IXRA 1A8VA 1FGBD 1VDZA 3BYYB 1OXTA 1STHA 3AMUA 3NUCA 1S4ZA 2RCFA 4ID6A 1EIYB 4JOIC 1UWVA 4LJZC 3PO2B 1U0LA 2Q8IB 3JAME 4GLVB 3S14H 2JA7H 4B3SL 1K8OA 4A3IB 2LY7A 4IUVA 1VQAA 3HOVG 2GA4B 3Q24A 3VR5A 4KD3A 4PZ7A 2PI2E 2EJFC 3Q23A 1FYCA 5GAEC 2F0EA 4GOPC 3C2PA 1K28A 1M4VA 3GD7A 2AWNA 1WTPA 2Z9HA 1PV4A 1J9OA 1EYAA 4X3SA 5FJ8H 1MBYA 3X3NA 5LMUL 1SYEA 4B3MQ 2RVLA 5L37A 4WJ4A 1NMFA 2QDLA 1QNUA 1BF4A 4KKTA 4ZRZA 1L0YB 3T51B 3S1QB 1DOKA 4S3SA 1PH5A 3UE0A 3IRBA 2TSSA 2CW0D 4X65Q 4O2DA 5CBAE 5C0XH 1JR0D 2HIVA 1HFNA 3GP7A 2HQEA 2RF4A 2Z6KC 1BCPB 1YNND 1H95A 1TWCH 4L5SA 4XYOA 2L1BA 3M4OB 5IWAQ 3M4OH 1HR0Q 1P8LA 5C0XI 5EJWA 2R7ZB 4L5RC 5KNCA 1CKNA 1QUQA 4P73A 3KJOA 2HCCA 3MVVA 4OWXB 1X54A 1PH4A 4L8JA 4BWGB 3G6EA 4KKSA 3GTMB 2L0CA 4C3HG 3GTLB 4JI2Q 1A15A 1SMXA 3FKIG 3GQBA 3VR2A 3E9IA 3S2DB 2IW3A 4F87A 1EY9A 1VCIA 5JPNC 3MC0B 4LNQA 4DV7Q 1EL0A 1TWAB 3HOXB 3MAQA 3F8TA 4B3TL 1HPCA 1TWHB 3ULJA 4C3JG 2UUBQ 4K14A 4Y7NH 2JP1A 1YNJC 4RHRA 5C4XG 4DR6L 5M5WB 3CU7A 2Q8TA 3ULPA 2WV6D 2UXBQ 5JAVA 4DAYB 3J81L 4DR2Q 2EQSA 1GUOA 2HHHQ 4DV0Q 1FD7D 4B3ML 1X6OA 1JWMD 3KF6B 3Q8DA 5LL6X 1Q90A 4EQNA 4IZ8A 1HNZQ 1DJRD 5C6AA 2F0JA 4RGTA 1Z7TA 3N6RA 1PFSA 4A3KG 1CHQD 2F0PA 3GTOH 2DJFC 2SDFA 2B2YA 4A3EG 2XWJB 2MHVA 4A93B 1X3GA 2NZOA 4LF9Q 1I4XA 4M8AA 4QF4A 2E2IH 4MHEA 2G9DA 1I6VC 1B50A 5ELEA 1G6ZA 2A69C 4OHJA 4BBSG 4UAIA 3I4LA 1T5EA 3JAML 2F0FA 3G6JB 4TVAB 3QOLA 5IYDG 3C1EA 5BN4A 1EQQA 4PV1C 1KHIA 5EGTA 4R4OA 1Q82C 5JJZA 1YITA 1JT8A 2A68C 1KDBA 2JA6B 5FOBB 3RZOB 3W3AA 1LT4D 4LF4L 3PUXA 4J1MA 3MEFA 5FO9B 4KN4C 1HZCA 3TMEA 3EVQA 1MKHA 4H44C 4WRDA 1CZWA 5DLQE 1YNJD 2PZUA 3SDZA 4CDCC 4LAAA 1HNXL 1VQ5A 5I2XA 4GNXB 1XMQL 2K5VA 5KGUA 1GUTA 3NQIA 1G2SA 4HR7B 3KBXA 2ZT9C 3HP3A 1E3PA 4I7ZC 1NY4A 4KJNA 1R4PB 3NEMA 3R3OA 1UE7A 2IWHA 1J5EQ 4HCEA 3X3MA 5J1ZA 5BR8L 1IBMQ 1BKBA 1E24A 4XQQA 5GROA 2DY7A 4QIWB 2J0TD 1I4RA 3J81j 1X56A 3M7GA 3T4AC 1Q1BA 1EWIA 1A2UA 4LF7Q 4DU9A 4AYBG 3I4MB 1JWUD 4C2MH 3CC4A 2DGYA 4OEMB 2PNRC 3OIPA 3H09A 3HOWG 3BZDB 4DV1Q 3GTPH 4YWMA 4DA2A 1I94L 4RGOS 1OO9B 5JJLA 2NYZD 4X66L 2VNUD 2X69A 3J7AF 4IALA 1STAA 1VQ8A 1CKOA 2B39A 1SRUA 2DNCA 1TS5A 1TWGH 3G48A 2E5LL 4IJLA 2HDMA 3OHXC 1BCPC 1IZ6A 1K3BC 1AW7A 4TSSA 3S16B 5CV4A 5A35A 1RCVD 3S16H 3M4QA 1Y8PB 4A3KH 2E2JH 1MGSA 2KEEA 4RMFA 2VUMH 2B2TA 4LMQD 4DV3L 2VUMB 4K5XA 3H15A 1B44D 2JK8A 2EOTA 3UDFA 4NXNQ 4LF4Q 4RKLA 1VQEA 1PH3A 3CCJA 1FNUA 2A74C 1JCKB 4WJ3M 1QWYA 3OW7A 1DM0B 4UP8A 4C3IG 3S15H 1D2BA 3EBEA 3BDCA 2CQOA 1N33L 1NBWA 4DXFA 3U4ZA 5BR8Q 1IBML 2UXCQ 1TXYA 2F0UA 4NXML 1HUMA 3H94A 1O7YA 4OWWB 4BY7H 1HJPA 1JOOA 2NVTB 4HSPA 2EYMA 2F0SA 4FF2A 2Q2UA 3GTQH 3T16A 3D4WA 1Y1VG 1PZID 1TVXA 2B2TC 1U4LA 2Q2TA 1L1OC 1JJCB 1VQMA 3K8AA 4OGQC 1X3EA 2R93G 3HEJA 1S3OA 1BVSA 2B2VA 4BY1B 4HJ9A 1PTOC 1S5DD 5FLXL 1BXTA 4K8IA 2K5DA 5IYBH 2QILA 2MUYA 3T1HQ 3EIVA 1VMPA 2D62A 2DNEA 3VA7A 5IGBA 4OWTB 4DR6Q 1C0AA 4LFAL 3H3VH 5CV9A 5ELBA 4A3JG 3DWAA 1DYQA 2CFMA 3CHBD 3CCSA 1CSQA 1PA6A 2IX0A 2YTVA 2E2HB 4IOCA 1I3QH 5EKKA 1M1KC 3NWSA 1F9QA 3I4NB 2HUGA 2KEDA 4JBMA 5LHY1 1SAPA 2OWOA 3PF4A 3OWFA 1ILPA 4L63B 4IUUA 2B63G 2R92G 4CDEC 2UUAQ 2BCOA 3PIPA 1CKNB 1MD2D 1QUQB 2A69D 3ONAB 1XMQQ 1O7ZA 1SE3A 4OX9L 3QO2A 4V190 2QDBA 3D4DA 3S2HB 4JI1Q 1HRJA 1B3AA 4DV2L 4NKLA 2JA5B 1SYBA 2JA5H 4KKUA 1PYWD 3PUWA 1E1OA 3UDIA 4UP9A 1JE4A 1SYFA 2F0LA 5ISRA 3HOWH 1IYJB 1TS3A 1S5ED 3FPUB 1WTXA 4X3UA 1WTOA 4ME5A 3K6OA 3A74A 2JQOA 1PH1A 4FXGC 2YU9H 2P5ZX 2GN5A 5CV5A 2JJQA 3DEPA 4K2LA 1I4GA 1XNRQ 4DPGA 2B63B 4BXXH 3V2TA 2R92B 2VB2X 4C2MB 1WCMB 4HIMA 5G3LD 3I4OA 2NVXB 1I50B 1Q12A 3HZXA 3MA2B 5IOCA 5IGDA 1XWEA 5GADC 4H0LC 4GKKQ 4K2KA 3RN5A 5EPLA 1UE6A 1EZ6A 3P7JA 1XPRA 2ASBA 4GLAC 5K5PA 4CDDC 4A3MB 3NHHA 1ZKOA 4JYAL 1YZ6A 2KOLA 1O80A 2XVSA 3BVMA 1Y8NB 4GLXA 1QJOA 2ZXPA 3FHWA 4B3RL 5ELDA 3PO3B 3HKSA 4JI4L 1OXXK 5E1FA 4IN3A 1LT6D 2WB1B 1JMCA 5EPJA 2OEOA 1VQLA 3CC7A 2Z4IA 3NTKA 1G51A 1HTPA 5C3WA 1E2VA 4ABNA 1LTTD 4KLKA 4NP5A 1D5XC 4A3GG 3TBIB 4MN3A 1EIFA 1PRTD 2KQ3A 5FLXc 5IYBG 4HAEA 1D8LA 1SJED 1JJ2A 2G9HD 2HCIA 1C48A 4P71A 2EXZA 1XNQQ 4UHVA 3TREA 2AKWB 1EY7A 5I4DA 4GN5A 2NWGA 1PTOB 1STEA 4B3TQ 3KOJA 5TSSA 3GTKB 1NUCA 2I5MX 1TIID 2EIFA 4A3BH 4YIJA 2D5DA 3HOUG 3E6ZX 4IOAA 1M8AA 4QGUA 4N9TA 2PQAA 1B9MA 1AEXA 2J7ZA 1TQOA 2LFNA 4LUOA 2QKIC 3RLOA 3HOZG 2K05A 2JEAI 1F77A 1A63A 3RZDB 3HOUB 1YNNC 1IL8A 2AWOA 4BBRB 1V1PB 3RMHA 1AFPA 4F7XA 1JORA 1B8AA 1GOZA 3OW2A 4G4KA 5KEEA 1LT3D 3PIP3 4IFDH 1CSPA 3NWTA 4GKKL 3W1BA 4DR2L 1ET9A 1I3QB 1UE5A 2XNAC 3BZCA 4JBJA 1TWHH 1I4QA 5FO8B 1GHKA 2PW7A 5JVG3 4AYBB 2PCFB 5DM73 1LABA 1L0XB 3I72A 5IIFA 2HT1A 1WD0A 1JWSD 3TRZA 2EYLA 1TY0A 4QMGA 1KRSA 3FMCA 5LMNW 3T1HL 3QWNA 1BCPF 3FRPB 3MZ5A 3UDGA 1IYUA 1N36Q 1KLGD 4LF6Q 2CVRA 1L1OA 4KJOA 2MO1A 1S5BD 4XDXA 1L1OB 3L0OA 2M9VA 4HJ8A 2MP1A 2FHTA 2Y0SB 3D4RA 2NVYH 2QCPX 1WTHA 4CKCA 2KUMA 4R4IA 3KFUA 3DEOA 1QVCA 4OONA 2A6HC 2VB3X 3PO2H 4KK7A 1SBBB 2E74C 2B8FA 3JAMi 1YBYA 2EVBA 3HKZE 4ZKCB 1D1KA 5CV7A 5KYLA 3DM1A 1VQBA 5FLMG 1F9SA 1SE2A 5LL6S 3KLSA 5M5XB 1VQKA 3CRKC 2Q2IA 2VQEQ 3CC2A 2DJGC 1F9RA 2JA6H 3GTJH 2HD3A 2ICEC 3BDOA 1YJNA 1Y1VB 4CBVA 1JE5A 4KHPL 1XMOQ 3TP6A 1HZAA 3CAMA 1NR4A 2IL8A 4X66Q 3I8ZA 1WJJA 3GO5A 4DV6L 5I9OA 5CMDA 3PO3H 2EYJA 1AZQA 1EFWA 1HA6A 1GXDC 3KBGA 4A93G 1FL0A 2ID0A 2SNMA 4P72A 2E5LQ 1Y1WH 3TSSA 2B2UA 4JI0L 1GUWA 4A3JH 1HXYD 2WAQG 2YYZA 2N55A 4WJWA 2OQKA 2Q2HA 4EGVA 4LFCL 3I73A 1ET6A 3CW2C 1Q1EA 2E8GA 2L55A 1N34L 1Q81C 5EKIA 2I0QA 2K32A 1KAWA 4OO1I 1LT5D 1SJHD 2PQAB 1YIJA 4B08A 4KN7C 4IUQA 3S1NH 2ZJRA 1SN8A 5C44B 3AU7A 1HZBA 3ITPA 4CHTB 5C44H 4MTNA 3BDLA 5C4XB 3E0JA 2C5CA 4GKJQ 1I6HB 2PW5A 3BVGA 4QY7A 2HIXA 2K5WA 4JC0A 4X62L 4ZUIA 2RDFA 3HOXG 5I6YA 3WOFA 4XXEA 2A5HA 2LKVA 4FXKC 4A3BG 2RHQB 1VMCA 4IURA 5CGKA 2K04A 3ZJYC 4QJFA 2HQLA 4DV0L 4C3HB 1HNXQ 4PZ8A 2R7ZH 4YWKA 5EQ0A 3G71A 3HOYG 3M9BA 2E2DC 1HFGA 3E3XA 1WD1A 2PMZE 4F8MA 1WYDA 2BA1A 2NTTA 2PNHA 1JC7A 4R9WA 2WP8J 2Z8LA 1SNCA 4IPCA 2V1CC 1VQGA 3MEHA 1KD1C 2I5HA 4MZ9A 1YJWA 1TR5A 4AH6A 2L12A 3WDNA 3L7ZC 1STGA 3CPFA 4CJ0B 4KHPQ 3TQYA 1K8AC 2OT2A 4O42A 3TEHB 3ZYYX 2KCMA 1AH9A 1IYVA 5H1SE 2UUAL 1EZ8A 1Q7YC 1HNWL 2N49A 1XPOA 1G291 4PNYA 1IBKL 3P20A 1HTLD 1NR2A 2BH8A 1P16A 1ASYA 4A3GB 1TS2A 2CH4W 3A5UA 3D6WA 1WI5A 2YTYA 5IGFA 2K03A 1D7QA 3ICEA 4A75A 2NN6I 1N9WA 2R61A 5GAGC 1AE2A 4CKEA 5FKAC 4DNRB 1Y1WG 3K7UC 4C1NI 1A2TA 1DZ1A 4GN3B 5IYCH 4M1UB 1EOTA 3CP0A 3DHQA 1EYCA 4OXPA 1NTGA 3T1YQ 1FJGL 1SSOA 4J6HA 1KXLA 5BN5A 2A1AA 2KVMA 2R7DA 4LF6L 5KYIA 3JC66 4XT1B 1EEFD 4XQJA 2UUCL 3ERQA 2YTXA 3KDFB 2K28A 3CD6A 1JQYD 1EOVA 5M9OA 4DFAA 2UXBL 1XJVA 4XT3B 1Y14B 1YHQA 4A3IH 3OMGA 4RKBA 2X6LA 2DY8A 2LXJA 1JJGA 3SK8A 4L6TB 5IODA 1LUZA 1EFID 1RJTA 1RKNA 1TWCB 2NZ1D 5M5YB 1ESRA 4G57A 1K73C 4HEDA 5A2QL 1BQQT 3CCQA 1SEBD 4JI3Q 4K0KL 3MFGA 4OO1G 2VW9A 3D31A 1OXUA 2F0NA 2MFIA 4JV5Q 2UU9Q 2CWAA 2RQXA 3QB3A 3VA5A 1D5ZC 2F0QA 2NUCA 1SMYD 1R4QB 2E75C 3CCUA 2RSNA 1XTCD 3P75A 2DN8A 4KV6A 5JVH3 1VQ7A 3TS2A 5M3FH 3D3RA 4K6LA 2JA8B 3EROA 4LF5Q 4N8X1 4KHZA 2F4VL 2JA5G 2IPKD 4X64L 5IGEA 4JBKA 3KYHC 4FXDA 1F2LA 4X65L 4JW0A 4A3DH 4DGZA 3V05A 1HCZA 4DV5Q 2F0GA 4R8NA 4RH6A 4IPHA 4EQPA 1C7YA 3I4NG 4ULLA 1HQMC 2F3VA 4NW2A 1EU4A 4A3FH 4V0BA 1QVFA 3QG1A 2O5IC 1B1ZA 4KI0A 3IKJA 1PRTC 2A19A 2CHBD 1H9MA 1O78A 2M2LA 4E6IA 4N9PA 1UNSA 1IBLL 3FKIB 3G4SA 4J8QA 1L2FA 1UEAB 3UE1A 4I7AA 4AIMA 1S72A 3LNNA 1I94Q 1GO3E 1Z47A 1II3A 1EIHA 2IJ0A 4BY7G 1ENFA 1J5EL 1PZKD 3NELA 4OL7A 3NE5B 4OIKA 1F2ZA 4ZYSA 1EYGA 2G5DA 2L15A 2L5TA 1X3FA 2PZTA 4FDBA 4O0AA 2HHHL 2BH2A 3HOVB 1A3TA 2F0DA 4DR3L 4A93H 5HY6A 3MXUA 2TMPA 5IT9L 1CTMA 4HTHA 1D5MC 1XMOL 2KHSA 4PMCA 1RDPD 3PUYA 2FXQA 4PQXA 2RDGA 3K80C 3R2TA 3PO3G 4A3CH 4GS3A 3STBC 2K4KA 5D3IB 3M3YH 4NDXA 4RHSA 2AQ2B 3W2DA 5KIXA 1N8RC 4AYBE 4LW1A 4JI6Q 1SROA 4KY5A 3U4VA 2RKSA 3K7AH 2D2CC 3RZOH 3B6YA 5ELCA 3GTGH 2JA9A 1M90C 4B3SQ 2F0VA 4C1NK 1B53A 4MNOA 1CQVA 2JEBI 3V96A 3H0GH 1G91A 2O5JC 1SNQA 2EXDA 1NNXA 2B8GA 3RR5A 1VS0A 4A3LG 1ICFB 1ENCA 2CW0C 4HN7A 4DAVA 2EYHA 4DV4L 1T9HA 4MIUA 1PVOA 3H3VC 5CV8A 3PIOA 4ZUJA 2K7VA 3OYYA 1BR9A 4YHHL 4GNXA 3IL8A 4B9XA 1SLJA 3I70A 3K0YA 2B2WA 2F0KA 1VQPA 4XTCS 4R4QA 3RD4A 3OOCA 1SNPA 3GTMH 3HKZB 2CCZA 2Z4HA 3CCMA 1I4HA 3TN2A 2B63H 2R92H 1K83H 1LTGD 4HMJA 2ZM6L 4YWLA 2NVQB 2JN4A 1QOHA 1U5KA 5T1IA 4LF5L 1CQFA 1J6QA 5ELNA 3L2PA 4DUZL 5AJ3L 4YY3L 3GTPB 3O13A 5M3MG 2NBFA 1EY4A 2YU9B 4DR4L 3VDYA 4BXXG 4WORA 3J7A5 2MGSA 1TWGB 2KCTA 4R8IA 3J80E 5AFWA 4DXGA 4ZLTF 4GKJL 1SNMA 5EBCA 4JI3L 3IFTA 4JI2L 5CORA 2A6EC 1STNA 1G2TA 4JI0Q 2EJMA 3D0FA 1WTRA 3FVQA 3GTOB 1IBKQ 1NMGA 4CKBA 1LACA 1Q8KA 5CBEE 1KC8C 4NXNL 1EQVA 1DONA 1KLUD 4LFCQ 1N34Q 2AHOB 2F0TA 2R3ZA 3Q22A 4R1JA 4A3MH 1KQSA 1QNKA 3PQIA 3HRZC 3SK4A 3OTOQ 3PIO3 3K81C 2ALYB 1NCVA 1V8QA 4OELB 1X9NA 1KTKA 2WIIB 3VR3A 1EIGA 2RDHA 1PDQA 4DR1Q 5KNBA 1YI2A 4RCOA 5JEAG 3S24A 2L4NA 1RODA 4PZ6A 3A5ZB 2ZM6Q 1LYLA 3T53B 3HFZB 2OTLA 1K0SA 1B3QA 2Z6BA 4DV7L 1YHBA 1K8MA 4NPSA 4A3JB 4YHHQ 1UAPA 4JG2A 3A7LA 1U4RA 4DK6C 1PH8A 4B3RQ 4A3BB 3MXPA 4BY1H 1C9OA 1Q46A 1OXVA 1V43A 4BA1I 4JYAQ 4HJ5A 4QIWE 4EX5A 3MXNA 2VQEL 2SNSA 2MNAA 3S17H 1CT1D 1EY6A 3VYRA 1PTOH 3M7NA 3NTHA 2F4VQ 2MQHA 3J7ZC 1KIXA 3CCEA 2KENA 2B2UC 2BA0A 2ICIA 1UUPA 3HOYH 1U9RA 1PYBA 1CZGA 2KHJA 2AQ1B 1CUKA 2R6GA 3JAMc 4RAUC 3ERSX 4JI7L 4UDUC 5K36G 1XNQL 2QA4A 4TRDA 2JYOA 1SFOB 1MJEA 1N32L 2CWPA 1FNWA 3AYHB 5IY0A 2K1BA 3QJYA 4FO2A 2K5QA 2SEBD 2RSOA 2N88A 1CA5A 2OF1A 1A3UA 3CQZB 5GQOA 2SOBA 3H91A 2WAQE 4DV2Q 2B3GA 2DUDA 1WCMG 1NE3A 4UY8C 4Z9CB 3OTOL 1SDFA 1BNZA 3EQLC 2IHFA 2H1EA 5M3MB 1NJIC 5IYDH 3RN2A 2NN6H 1LTAD 1V9PA 1F2YA 1NSNS 3GV6A 5IP7H 4ODGA 2NVYB 2IX3A 1LV9A 3GV3A 4LWCA 1PH2A 3HS0C 4GNXC 3A56A 4LF7L 4P2CB 2B2YC 2H4OA 2BE5D 2C9OA 3LX0A 5E7NA 3RLFA 3RUZA 4JOIA 3S9WA 3UDXA 2RCNA 2EY6A 3E5SA 1BCPD 1DXMA 3STBD 2NVTH 3E9HA 2IY5B 4IPDA 1IW7D 4G7ZC 4BY1G 3ER0A 4QB4A 5AJ3Q 3GTQB 4DK0A 2XSCA 1GKHA 1C4QA 3DLLA 5KNDA 1GUGA 3BG3A 4FF4A 4ME3A 1N36L 3EA6A 1CK1A 5JOBA 1VQ9A 3AB9A 4BBSH 4DF7A 3DUZA 4BBSB 1ML0D 3NQTA 4KY7A 1HQRD 3D6CA 2ES2A 3U9OA 1Q86C 2KCNA 2F0IA 1PFBA 1VF7A 1QVGA 4RGMA 1H9JA 4J15A 5D65A 1A3VA 2XRSD 2A68D 2L11A 2RBMA 3CRLC 1EY0A 3J81c 5COYA 3R2IA 3H3VI 1PFNA 2ENBA 3CCRA 3F2CA 1VQ6A 2OCEA 1KNEA 4RGNA 2AUKA 4NXMQ 3NBHB 2E76C 5C4JH 2I07B 1B70B 1GJXA 4YCVA 1VQJA 4JI4Q 2EY2A 5I2YA 2QEXA 2FMMA 2F3WA 1AN8A 2MO0A 1U4PA 2EY5A 1PLFA 2M00A 3RLNA 3L9AX 5IT9E 4BBRG 4LF9L 2K33A 4LF8L 4G7OC 3HOZH 2UXCL 1LLRD 2ZXRA 3K59A 4DK1A 4IO9A 1LTSD 3FP9A 3HOZB 1MI2A 5K36H 1TT2A 2N3SA 3MXNB 2QF7A 4C3IH 3S1MH 3KLSX 1VF5C 4DR5L 4ZKBB 3RNUA 4K0KQ 2XIWA 1GVPA 3BU2A 4LFBL 4A3KB 1QCBD 4LFAQ 4JK1C 5JPMC 3A55A 1W3SA 1BOSA 2D0PA 4XIGS 3KF8A 3PCOB 1AP0A 1XXGA 2LS01 1PH9A 2EE1A 3NENA 5C3XA 4DR3Q 1BDOA 1X32A 5C4HA 4H13C 3HOXH 3CMEA 2K50A 4Y7NB 2F0OA 2WB1G 3KUPA 4HCSA 4YCWA 1SXTA 3I91A 1KNAA 4NB3A 1R9TB 3S14B 2GVBA 1NAPA 2JSOA 2Q8RE 1BO0A 2V4DA 3I56A 1PHJA 5E4WC 3J7YW 4X6AH 1KRTA 4P75A 1HH2P 1GM5A 1PH7A 4CDFC 1MHWC 2Y0SE 3KLWA 5C0XJ 4ZK9B 1U4MA 2WINB 2KECA 1IBLQ 3HGBA 4QL5A 3J7AV 4R4TA 1LTLA 1RL2A 2EZVA 2JA7B 1X65A 1MJCA 3MWYW 1EY8A 3HOVH 4ZQ3A 2K14A 4GZYC 4CJ2C 4FYDA 3J80i 4GOPB 4A3MG 1CFMA 1B9NA 1BBUA 2XN9C 2C35B 3KJPA 3W1GA 5FLMH 1E0BA 2VZAA 3Q0AA 1OXSC 2JA7G 2BDOA 4ILWA 2RA4A 3F2BA 1IW7C 3IFDA 5J3BA 2PZWA 4KD4A 4BS9A 3KDFA 1H9SA 2EYOA 4DR1L 3BZKA 1O7IA 4JI5L 5EBDA 3URYA 4HIOA 4OO1H 2CQAA 3FEWX 1PRTF 1S5FD 3GTJB 2BE5C 3SR1A 2KCCA 1HZ9A 4LFBQ 1CI3M 1WTVA 1I4PA 2FMCA 2I5LX 1EWCA 1QG7A 4GOPA 5IYCG 2PMZB 1Z6HA 1ASZA 1BBWA 1L0WA 3DMUA 4DAMA 2J4XA 1PZJD 1KAAA 2AUJD 4YCUA 2F4IA 2FFKB 3H0GG 3PSIA 1SYCA 3GTLH 1K9MC 3WWVA 3NBIA 3SK5A 1EYDA 5CC4A 2VS1A 4K5VA 4RWSC 5ELFA 3KF8B 4APVA 1QZGA 2PQEA 4HJ7A 3A0JA 3PV0A 1T5XD 1I5FA 3DXJC 1G6PA 2K5NA 4X3TA 2F0HA 1K83B 2Z0SA 4ZAIA 3S1NB 3KLRA 1WTWA 1SR3A 1TWAH 5C4XH 1BUVT 4IUPA 3I4MH 3AFPA 3S1RH 3S1RB 4UPAA 3C46A 5I6WA 3PUZA 1WFQA 5M5WH 4RA8A 2EDGA 2Y0SG 1Y8OB 1D1IA 1ILQA 3SXHA 3OIQA 4BY7B 1IKLA 3U58A 4A3DB 3HG9A 1PTOD 3P1HA 4X3KA 5E3FA 4X62Q 4DN4M 2E2IB 4QUFA 3SGIA 3J81E 5IP9H 1UE1A 1KABA 1WTQA 2K75A 1DGSA 2KBNA 4N8FA 4JI1L 3OSOA 3T56B 1LTID 2EYPA 1VQDA 2WACA 5CR3A 3MFYA 4A3FB 1SYDA 3MHBA 1EWHA 2N78A 3MTSA 5I9PA 1ZYRD 5C4ZA 5EAYA 3K58A 1TY2A 3CMAA 1PXUA 4UP7A 2IHEA 2O2LD 3U9SA 3NK9A 3NP8A 5D14A 1O7LA 4A4IA 1R9TH 1RTOA 1CA6A 5C3EH 5C3EB 4DKAC 5DM63 3KF6A 3VYTA 1IKMA 5JEAJ 2EYFA 5C5LA 1XTDA 1G8ZD 3TP5A 1DOLA 2WB1E 2LSSA 4JI6L 1D6EC 1EQTA 5M5YH 1W6KA 4POGA 1B2TA 3C1FA 4CGYB 2LMCB 2PYKA 1EEID 5G3LF 1ZXTA 3OPOA 3AQQA 1PYSB 3FDTA 4R4CA 1ESFA 2B2WC 2L9HA 3J81i 5IE8A 3F2UA 3K5MA 2B2VC 1V1QA 1XX8A 2IT1A 3TZDA 3WOEA 3I2ZA 4F88A 4DR5Q 5CV6A 4HSVA 5J39A 4JI7Q 3VYSA 4JI8L 4DV5L 3CCLA 4L5TA 3S1QH 1HR0W 3S17B 5HGQA 3R8BA 1Y1WB 3H0GB 1STYA 4BBRH 1LM0A 5ELOA 3M3YB 1HHVA 3HOWB 3I7FA 4EQOA 3QR8A 1E1TA 1QE6A 1EU3A 3I4MG 3G7LA 4JBWA 5NUCA 4IUNA 2B29A 1RIPA 4QUCA 2JXMB 2MJ8A 4A3LH 2WKDA 1QB5D 2F0WA 2BOSA 3CXCA 4IFDI 2D0OA 3SE0A 3NTIA 2Z6KA 1S40A 1LTRD 1K8GA 2KA7A 2RHSB 2A8VA 1HNWQ 3I90A 1V1OA 2NVXH 1I50H 3LWEA 5LMUQ 3CQZH 3TZUA 1FNVA 2HDLA 4H02A 1QZHA 4P74A 3T13A 4MTKA 3A8KE 4JI5Q 3VR6A 2NVQH 3CF5A 4L5QA 3S15B 4DV6Q 5D3DA 3F1ZA 2FINB 4KHVA 2UXDQ 4DUYQ 1E7ZA 1XPUA 1GD7A 4DNTB 2EY1A 1WVLA 1HR0L 3TP7A 1Q8IA 2QGQA 4U673 2XWBB 1VQ4A 4NMZA 2JA6G 2NN6G 2PPBC 3AFQA 5C3EG 1OTCA 5IP9G 3IAYA 1CKMA 3SVMA 4FF3A 1RHPA 4A3FG 2XTIA 2VUMG 4TKOB 1Y69U 3LWUA 3QIAA 5GAHC 5M5XH 4IFDJ 1LO5D 4KMUC 1AZPA 4JI8Q 4RG1A 4PMWA 4DNIA 2PO4A 4A3GH 1Y1VH 2A73B 3SHLA 1AE3A 2XGTA 3M4PA 4A3EH 4U68A 1LTBD 1ONLA 4A3EB 1SNDA 2F0MA 4HIKA 4AQYL 1X3QA 5HURA 4YY3Q 4EQ5A 5DNFA 3OWEB 1B7YB 4LUZA 1XNRL 2CKZB 3H6MA 1F2MA 2WFWA 1F9PA 1GUSA 2UXDL 4HMIA 5F2DA 2JE6I 1EUJA 2ZJPA 3A54A 5EPKA 3J80L 3GTGB 1SE8A 4X64Q 2KHIA 3EFXD 4KTAA 1SYGA 5HGTA 1A62A 4DV1L 5IGGA 4FP5D 5J22A 5C0XG 3SEBA 3L3OC 4IPGA 1SE4A 2E2HH 1S5CD 3S2HH 3AEVA 1DCZA 1YHAA 4QCLA 1E22A 1IHZA 3M85A 3LGJA 4DR7L 3K0XA 1JB3A 5JEAH 4FVMA 2VQFQ 3DWQA 2Z1CA 4WFN3 3TS0A 3ULLA 1PH6A 3PF5A 1YEZA 2BDNA 3NPPA 4K8JA 1JB7A 3VYUA 4XQNA 1FGUA 1QILA 2F03A 4C3HH 3K7AB 2XRQD 5T1GA 3S1MB 2R7FA 2ZTCA 5FO7B 2AMCB 2LXKA 1ENAA 3K5NA 5C44G 1VQNA 2JA8H 2YV5A 5LMNQ 5EKLA 2VY3A 2X6GA 3VR4A 1PTOF 4O1NA 4ALPA 3CCVA 3QOJA 4JVZA 1TWFB 3J80c 1ICWA 1FJGQ 2UUBL 4AQYQ 1EY5A 4Q0FA 2KJXA 3NXWA 3ND9A 1JICA 4DAYA 3A8IE 1CHPD 1E2ZA 1WCMH 3BVZA 2F52A 1SMYC 3BS1A 2E2JB 2QW7A 2F1MA 2ZJQA 1KL9A 1YNXA 3HKZG 4EVOA 1DOMA 1JOKA 1TKWB 2ZXOA 4FNFA 1MIUA 2VQFL 3EJIA 1VQHA 4DAPA 4DV4Q 1N32Q 4JV5L 3A7AB 1GUNA 4FF1A 5JJKA 2NZHA 1K3RA 1FVIA 1W2BA 5IP7G 4Q5VA 4A3IG 1VQFA
chains in the Genus database with same CATH topology
4RCNA 3TDQA 3MXGA 1A6XA 4LK1C 4KY6A 1MSGA 3D8GA 5BN3A 3C3LA 1SNOA 1CM9A 2NTSA 2WKCA 1H9KA 1ZYRC 3K5LA 1RF2D 2I46A 1H9RA 1HA5A 2IX1A 1W6JA 1RTNA 2VXWA 3R93A 1ZEQX 4K5WA 1PFMA 3KK7A 1Q3LA 2R93B 2OXPA 1MSHA 4G7HC 4IQZA 4B9WA 4XYQA 1TU2B 4IUTA 5C5MA 1RD9D 5DAUA 3DWPA 1PRTB 2WAQB 3ND8A 1KDCA 2QEJC 5FK9C 2EPBA 5M3FB 3NBHA 2FJ2A 1C8CA 5KRUA 3M4YA 4PMBA 1H9SB 2EJGC 3FPPA 3PUVA 1BBXC 5FLXE 4I65A 1J8IA 1V1PA 1GHJA 1FR3A 3NSWA 1XYIA 4IFDG 2K01A 2A6ED 3OMCA 5E4XA 1JOQA 3SK6A 2D9UA 5C4JB 4RFBA 3A8JE 2MPMA 3I3CA 4TQUS 2A6HD 2K6AA 2O4XA 3TP8A 3Q6SA 1STBA 5DEHA 4C3JB 4OIJA 4CJ1B 4C56C 5IGCA 4BA2I 1TS4A 1X3PA 3K5OA 3HOYB 1E2WA 3BYTB 1HUNA 1DD2A 2AQ3B 2NB0A 4C3IB 1PMRA 5A2QE 1KDAA 3N52A 4K6DA 3CKIB 3K57A 1B4OA 5CYUA 3UI2A 4H7BA 3PMFA 1VDZA 1FGBD 3BYYB 1OXTA 1STHA 3AMUA 3NUCA 1S4ZA 4ID6A 4LJZC 3PO2B 2Q8IB 3JAME 1K8OA 4A3IB 2LY7A 4IUVA 2GA4B 3Q24A 3VR5A 4KD3A 2EJFC 3Q23A 1FYCA 3C2PA 2F0EA 1M4VA 3GD7A 2AWNA 1WTPA 1J9OA 1EYAA 4X3SA 1MBYA 3X3NA 1SYEA 2RVLA 1QNUA 1BF4A 4KKTA 4ZRZA 1L0YB 3T51B 3S1QB 1DOKA 4S3SA 2TSSA 2CW0D 5CBAE 5C0XH 1JR0D 1HFNA 3GP7A 2HQEA 1BCPB 1YNND 4XYOA 2L1BA 3M4OB 5C0XI 5EJWA 2R7ZB 5KNCA 2HCCA 3MVVA 4L8JA 4BWGB 4KKSA 3GTMB 2L0CA 4C3HG 3GTLB 1A15A 3GQBA 3VR2A 3S2DB 2IW3A 4F87A 1EY9A 1VCIA 5JPNC 3MC0B 1EL0A 1TWAB 3HOXB 3MAQA 1HPCA 1TWHB 4C3JG 4K14A 2JP1A 1YNJC 4RHRA 5M5WB 3CU7A 2Q8TA 2WV6D 5JAVA 3J81L 1GUOA 1FD7D 1JWMD 5LL6X 1Q90A 4EQNA 4IZ8A 1DJRD 5C6AA 2F0JA 4RGTA 1Z7TA 3N6RA 1CHQD 2F0PA 2SDFA 2B2YA 2XWJB 2MHVA 4A93B 1I4XA 4M8AA 4QF4A 4MHEA 2G9DA 1I6VC 1B50A 5ELEA 1G6ZA 2A69C 4OHJA 4UAIA 3I4LA 1T5EA 3JAML 2F0FA 3G6JB 3QOLA 3C1EA 5BN4A 4PV1C 5EGTA 5JJZA 2A68C 1KDBA 2JA6B 5FOBB 3RZOB 3W3AA 1LT4D 3PUXA 4J1MA 5FO9B 4KN4C 3TMEA 3EVQA 4H44C 4WRDA 1CZWA 1YNJD 2PZUA 3SDZA 4LAAA 5I2XA 5KGUA 1GUTA 3NQIA 1G2SA 4HR7B 3KBXA 2ZT9C 3HP3A 4I7ZC 4KJNA 1R4PB 3R3OA 2IWHA 4HCEA 3X3MA 5J1ZA 4XQQA 2DY7A 4QIWB 2J0TD 1I4RA 3M7GA 3T4AC 1Q1BA 1A2UA 4DU9A 3I4MB 1JWUD 2PNRC 3OIPA 3H09A 3BZDB 4DA2A 4RGOS 1OO9B 2NYZD 2VNUD 2X69A 3J7AF 4IALA 1STAA 2B39A 2DNCA 1TS5A 2HDMA 3OHXC 1BCPC 1AW7A 4TSSA 3S16B 5CV4A 5A35A 1RCVD 1Y8PB 1MGSA 2KEEA 2B2TA 4LMQD 2VUMB 4K5XA 1B44D 2EOTA 4RKLA 1FNUA 2A74C 1JCKB 1QWYA 3OW7A 1DM0B 4C3IG 1D2BA 3BDCA 4DXFA 2F0UA 1HUMA 3H94A 1O7YA 1JOOA 2NVTB 4HSPA 2EYMA 2F0SA 4FF2A 3T16A 3D4WA 2B2TC 1PZID 1TVXA 1U4LA 4OGQC 3HEJA 2B2VA 4BY1B 1PTOC 1S5DD 5FLXL 1BXTA 4K8IA 2K5DA 2QILA 2MUYA 1VMPA 2D62A 2DNEA 3VA7A 5IGBA 5CV9A 5ELBA 3DWAA 1DYQA 3CHBD 2IX0A 2E2HB 5EKKA 3NWSA 1F9QA 3I4NB 2HUGA 2KEDA 5LHY1 1SAPA 3OWFA 1ILPA 4L63B 4IUUA 2BCOA 1MD2D 2A69D 3ONAB 1O7ZA 1SE3A 3QO2A 4V190 2QDBA 3D4DA 3S2HB 1HRJA 1B3AA 4NKLA 2JA5B 1SYBA 4KKUA 1PYWD 3PUWA 1JE4A 1SYFA 2F0LA 5ISRA 1TS3A 1S5ED 3FPUB 1WTXA 4X3UA 1WTOA 4ME5A 3K6OA 4FXGC 5CV5A 3DEPA 4K2LA 1I4GA 2B63B 2R92B 3V2TA 2VB2X 4C2MB 1WCMB 5G3LD 2NVXB 1I50B 1Q12A 3HZXA 3MA2B 5IOCA 5IGDA 1XWEA 4H0LC 4K2KA 5EPLA 1EZ6A 3P7JA 5K5PA 4A3MB 3NHHA 1ZKOA 2KOLA 1O80A 2XVSA 3BVMA 1Y8NB 1QJOA 2ZXPA 5ELDA 3PO3B 1OXXK 5E1FA 4IN3A 1LT6D 2WB1B 5EPJA 2OEOA 2Z4IA 3NTKA 1HTPA 5C3WA 1E2VA 4ABNA 1LTTD 4NP5A 1D5XC 3TBIB 4MN3A 1PRTD 2KQ3A 4HAEA 1SJED 2G9HD 2HCIA 1C48A 2EXZA 1EY7A 5I4DA 2NWGA 1PTOB 1STEA 5TSSA 3GTKB 1NUCA 1TIID 4YIJA 2D5DA 3E6ZX 1M8AA 4N9TA 1B9MA 1AEXA 2J7ZA 1TQOA 2LFNA 2QKIC 2K05A 2JEAI 1F77A 3RZDB 3HOUB 1YNNC 1IL8A 2AWOA 4BBRB 1V1PB 3RMHA 1AFPA 4F7XA 1JORA 1GOZA 4G4KA 5KEEA 1LT3D 3PIP3 4IFDH 3NWTA 1ET9A 1I3QB 2XNAC 1I4QA 5FO8B 1GHKA 2PW7A 5JVG3 4AYBB 2PCFB 5DM73 1LABA 1L0XB 3I72A 5IIFA 1WD0A 1JWSD 2EYLA 1TY0A 4QMGA 3FMCA 3QWNA 1BCPF 3FRPB 3MZ5A 1IYUA 1KLGD 2CVRA 4KJOA 1S5BD 4XDXA 2M9VA 2MP1A 2FHTA 2Y0SB 3D4RA 2QCPX 4CKCA 2KUMA 3DEOA 2A6HC 2VB3X 4KK7A 1SBBB 2E74C 2B8FA 2EVBA 4ZKCB 1D1KA 5CV7A 5KYLA 3DM1A 1F9SA 1SE2A 5LL6S 3KLSA 5M5XB 3CRKC 1F9RA 2ICEC 3BDOA 1Y1VB 4CBVA 3TP6A 1NR4A 2IL8A 3I8ZA 3GO5A 5I9OA 5CMDA 2EYJA 1AZQA 1HA6A 1GXDC 3KBGA 2ID0A 2SNMA 3TSSA 2B2UA 1GUWA 1HXYD 2YYZA 2N55A 4WJWA 4EGVA 3I73A 1ET6A 1Q1EA 2L55A 5EKIA 2K32A 4OO1I 1LT5D 1SJHD 4B08A 4KN7C 4IUQA 5C44B 3AU7A 3ITPA 4CHTB 3BDLA 5C4XB 3E0JA 2C5CA 1I6HB 2PW5A 3BVGA 2K5WA 4ZUIA 2RDFA 5I6YA 3WOFA 4XXEA 2A5HA 2LKVA 4FXKC 1VMCA 4IURA 5CGKA 2K04A 4C3HB 5EQ0A 2E2DC 1HFGA 1WD1A 4F8MA 2BA1A 2NTTA 1JC7A 4R9WA 2WP8J 2Z8LA 1SNCA 3MEHA 1TR5A 2L12A 3WDNA 3L7ZC 1STGA 4CJ0B 2OT2A 4O42A 3ZYYX 1IYVA 1EZ8A 1G291 4PNYA 3P20A 1HTLD 1NR2A 4A3GB 1TS2A 3D6WA 5IGFA 2K03A 2NN6I 2R61A 4CKEA 5FKAC 4DNRB 4C1NI 1A2TA 1DZ1A 4M1UB 1EOTA 3DHQA 1EYCA 1SSOA 4J6HA 5BN5A 2KVMA 5KYIA 4XT1B 1EEFD 4XQJA 3ERQA 2K28A 1JQYD 5M9OA 4DFAA 4XT3B 3OMGA 4RKBA 2X6LA 2DY8A 3SK8A 4L6TB 5IODA 1EFID 1RJTA 1RKNA 1TWCB 2NZ1D 5M5YB 1ESRA 4G57A 4HEDA 5A2QL 1BQQT 1SEBD 3MFGA 4OO1G 3D31A 1OXUA 2F0NA 3QB3A 2RQXA 3VA5A 1D5ZC 2F0QA 2NUCA 1SMYD 1R4QB 2E75C 2RSNA 1XTCD 3P75A 2DN8A 4KV6A 5JVH3 3D3RA 4K6LA 2JA8B 3EROA 4KHZA 2IPKD 5IGEA 4FXDA 1F2LA 4DGZA 3V05A 1HCZA 2F0GA 4R8NA 4RH6A 4EQPA 4ULLA 1HQMC 2F3VA 4NW2A 1EU4A 4V0BA 3QG1A 2O5IC 1B1ZA 4KI0A 3IKJA 1PRTC 2CHBD 1H9MA 1O78A 2M2LA 4E6IA 4N9PA 1UNSA 3FKIB 4J8QA 1UEAB 3LNNA 1Z47A 1II3A 1EIHA 2IJ0A 1ENFA 1PZKD 4OL7A 3NE5B 4OIKA 1F2ZA 4ZYSA 2PZTA 2L5TA 3HOVB 1A3TA 2F0DA 3MXUA 2TMPA 5IT9L 1CTMA 4HTHA 1D5MC 2KHSA 4PMCA 1RDPD 3PUYA 4PQXA 2RDGA 3R2TA 5D3IB 4NDXA 4RHSA 2AQ2B 3W2DA 5KIXA 4KY5A 2RKSA 2D2CC 5ELCA 2F0VA 4C1NK 1B53A 1CQVA 2JEBI 3V96A 1G91A 2O5JC 1SNQA 2B8GA 1ENCA 2CW0C 4HN7A 4DAVA 2EYHA 4MIUA 3H3VC 5CV8A 4ZUJA 2K7VA 1BR9A 3IL8A 4B9XA 3I70A 3K0YA 2B2WA 2F0KA 4XTCS 3RD4A 3OOCA 1SNPA 3HKZB 2Z4HA 1I4HA 3TN2A 1LTGD 4HMJA 2NVQB 1QOHA 5T1IA 1CQFA 3GTPB 3O13A 2NBFA 1EY4A 2YU9B 4WORA 2MGSA 1TWGB 4R8IA 3J80E 5AFWA 4DXGA 4ZLTF 1SNMA 5EBCA 3IFTA 5CORA 2A6EC 1STNA 1G2TA 2EJMA 1WTRA 3FVQA 3GTOB 4CKBA 1LACA 5CBEE 1EQVA 1DONA 1KLUD 2F0TA 2R3ZA 3Q22A 1QNKA 3HRZC 3SK4A 3PIO3 1NCVA 1V8QA 1KTKA 2WIIB 3VR3A 1EIGA 2RDHA 1PDQA 5KNBA 4RCOA 5JEAG 2L4NA 1RODA 3T53B 1K8MA 4A3JB 1UAPA 3A7LA 1U4RA 4A3BB 3MXPA 1OXVA 1V43A 4BA1I 3MXNA 2SNSA 1CT1D 1EY6A 3VYRA 1PTOH 3M7NA 3NTHA 2B2UC 2BA0A 2ICIA 1UUPA 1U9RA 1CZGA 2AQ1B 2R6GA 4RAUC 4UDUC 5K36G 4TRDA 2JYOA 1SFOB 1FNWA 2K1BA 3QJYA 4FO2A 2K5QA 2SEBD 2RSOA 2N88A 1CA5A 2OF1A 1A3UA 3CQZB 2SOBA 3H91A 4Z9CB 1SDFA 1BNZA 3EQLC 2H1EA 5M3MB 2NN6H 1LTAD 1F2YA 1NSNS 3GV6A 4ODGA 2NVYB 2IX3A 1LV9A 3GV3A 3HS0C 3A56A 4P2CB 2B2YC 2H4OA 2BE5D 2C9OA 3LX0A 3RLFA 3RUZA 3S9WA 2EY6A 3E5SA 1BCPD 1DXMA 1IW7D 4G7ZC 4QB4A 3GTQB 4DK0A 2XSCA 1C4QA 5KNDA 1GUGA 3BG3A 4FF4A 3EA6A 1CK1A 5JOBA 3AB9A 4DF7A 3DUZA 4BBSB 1ML0D 1HQRD 3D6CA 3NQTA 4KY7A 3U9OA 2KCNA 2F0IA 1PFBA 1VF7A 4RGMA 1H9JA 5D65A 1A3VA 2XRSD 2A68D 2L11A 2RBMA 3CRLC 1EY0A 5COYA 3R2IA 1PFNA 2ENBA 1KNEA 4RGNA 2AUKA 2E76C 2I07B 1GJXA 2EY2A 5I2YA 2FMMA 2F3WA 1AN8A 1U4PA 2EY5A 1PLFA 2M00A 3L9AX 5IT9E 2K33A 4G7OC 1LLRD 2ZXRA 3K59A 4DK1A 3HOZB 1LTSD 1MI2A 5K36H 1TT2A 2QF7A 3KLSX 1VF5C 4ZKBB 2XIWA 4A3KB 1QCBD 4JK1C 5JPMC 3A55A 1BOSA 4XIGS 3KF8A 1AP0A 1XXGA 2LS01 2EE1A 5C3XA 1BDOA 1X32A 5C4HA 4H13C 4Y7NB 2F0OA 3KUPA 4HCSA 1SXTA 3I91A 1KNAA 1R9TB 3S14B 1NAPA 2JSOA 2Q8RE 1BO0A 2V4DA 5E4WC 3J7YW 5C0XJ 4ZK9B 1U4MA 2WINB 2KECA 3HGBA 3J7AV 2EZVA 2JA7B 3MWYW 1EY8A 4ZQ3A 4GZYC 4CJ2C 4FYDA 1CFMA 1B9NA 2XN9C 1E0BA 3Q0AA 1OXSC 2BDOA 4ILWA 2RA4A 1IW7C 3IFDA 2PZWA 4KD4A 4BS9A 1H9SA 2EYOA 5EBDA 3URYA 4OO1H 2CQAA 3FEWX 1PRTF 1S5FD 3GTJB 2BE5C 3SR1A 2KCCA 1CI3M 1WTVA 1I4PA 2FMCA 1EWCA 1QG7A 2PMZB 1Z6HA 3DMUA 2J4XA 1PZJD 1KAAA 2AUJD 2F4IA 2FFKB 1SYCA 3NBIA 3SK5A 1EYDA 5CC4A 4K5VA 4RWSC 5ELFA 2PQEA 3PV0A 1T5XD 3DXJC 4X3TA 2F0HA 1K83B 4ZAIA 3S1NB 3KLRA 1WTWA 1BUVT 4IUPA 3S1RB 3C46A 5I6WA 3PUZA 4RA8A 2EDGA 1Y8OB 1D1IA 1ILQA 3SXHA 3OIQA 4BY7B 1IKLA 4A3DB 3HG9A 1PTOD 3P1HA 4X3KA 5E3FA 4DN4M 2E2IB 4QUFA 3J81E 1KABA 1WTQA 3OSOA 3T56B 1LTID 2EYPA 2WACA 5CR3A 3MFYA 4A3FB 1SYDA 3MHBA 1EWHA 3MTSA 5I9PA 1ZYRD 5C4ZA 3K58A 1TY2A 1PXUA 2O2LD 3U9SA 3NK9A 3NP8A 5D14A 1O7LA 1RTOA 1CA6A 5C3EB 5DM63 3VYTA 1IKMA 5JEAJ 2EYFA 5C5LA 3TP5A 1G8ZD 1DOLA 1EQTA 1D6EC 1W6KA 1B2TA 3C1FA 4CGYB 2LMCB 2PYKA 1EEID 5G3LF 1ZXTA 3OPOA 3FDTA 1ESFA 2B2WC 2L9HA 3F2UA 3K5MA 2B2VC 1XX8A 2IT1A 3TZDA 3WOEA 4F88A 5CV6A 4HSVA 5J39A 3VYSA 3S17B 3R8BA 1Y1WB 3H0GB 1STYA 3M3YB 1HHVA 3HOWB 4EQOA 1QE6A 1EU3A 3G7LA 4JBWA 5NUCA 4IUNA 4QUCA 2JXMB 2MJ8A 2WKDA 1QB5D 2F0WA 2BOSA 4IFDI 3SE0A 3NTIA 1LTRD 2KA7A 3I90A 1V1OA 3LWEA 3TZUA 1FNVA 2HDLA 3T13A 3A8KE 3VR6A 3S15B 5D3DA 4KHVA 2FINB 4DNTB 2EY1A 1WVLA 3TP7A 1Q8IA 4U673 2XWBB 4NMZA 2NN6G 2PPBC 3IAYA 3SVMA 4FF3A 1RHPA 4TKOB 1Y69U 3LWUA 3QIAA 4IFDJ 1LO5D 4KMUC 1AZPA 4PMWA 2PO4A 2A73B 3SHLA 4U68A 1LTBD 1ONLA 4A3EB 1SNDA 2F0MA 1X3QA 5HURA 5DNFA 3OWEB 3H6MA 1F2MA 1F9PA 1GUSA 4HMIA 5F2DA 2JE6I 3A54A 5EPKA 3J80L 3GTGB 3EFXD 4KTAA 1SYGA 5HGTA 5IGGA 4FP5D 5J22A 5C0XG 3SEBA 3L3OC 1SE4A 1S5CD 1DCZA 4QCLA 1IHZA 3M85A 1JB3A 5JEAH 4FVMA 3DWQA 2Z1CA 4WFN3 2BDNA 3NPPA 4K8JA 3VYUA 4XQNA 2F03A 1QILA 3K7AB 2XRQD 5T1GA 3S1MB 5FO7B 1ENAA 3K5NA 5EKLA 2X6GA 3VR4A 1PTOF 4O1NA 3QOJA 1TWFB 1ICWA 1EY5A 4Q0FA 2KJXA 3NXWA 3ND9A 1JICA 4DAYA 3A8IE 1CHPD 1E2ZA 3BVZA 1SMYC 3BS1A 2E2JB 2F1MA 4EVOA 1DOMA 1JOKA 1TKWB 2ZXOA 4FNFA 3EJIA 4DAPA 3A7AB 1GUNA 4FF1A 4Q5VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KDA A;  1EY9 A;  3H6M A;  5J1Z A;  1F2M A;  4F8M A;  5IGB A;  1STY A;  5C3W A;  4KY6 A;  5C3X A;  4K6D A;  4HMI A;  4KY5 A;  5CV9 A;  5F2D A;  3ERO A;  3LX0 A;  2RKS A;  5C4H A;  3D8G A;  4K14 A;  1SNC A;  4EQO A;  1SNO A;  4KTA A;  2F0V A;  1SYG A;  2F0O A;  3MEH A;  3PMF A;  4H7B A;  2F0H A;  3RUZ A;  4NP5 A;  1A2U A;  4IUN A;  5NUC A;  5HGT A;  4DU9 A;  5IGE A;  3S9W A;  1TR5 A;  2EY6 A;  1STH A;  3E5S A;  5CV7 A;  5EKK A;  5KYL A;  5IGG A;  1SNQ A;  2KQ3 A;  1STG A;  5J22 A;  2F0W A;  3NUC A;  5JAV A;  4ID6 A;  4DGZ A;  5I6W A;  1ENC A;  5C5M A;  4QB4 A;  2EYH A;  3OWF A;  2F0G A;  2EXZ A;  3MXP A;  4R8N A;  4MIU A;  1EZ8 A;  3SXH A;  1IHZ A;  4EQP A;  1EY7 A;  4IAL A;  4EQN A;  1STA A;  4IZ8 A;  5JOB A;  4PNY A;  5CV8 A;  2F3V A;  5C6A A;  2F0J A;  4DF7 A;  4K5W A;  4ZUJ A;  3P1H A;  5E3F A;  1NUC A;  3TP6 A;  4B9X A;  2QDB A;  3D4D A;  3D6C A;  3NQT A;  2F0P A;  4KD3 A;  4KY7 A;  4YIJ A;  4K8J A;  3T13 A;  3U9O A;  2SNS A;  1KAB A;  2F0K A;  5CV4 A;  1EY8 A;  2F0I A;  4NKL A;  4ZQ3 A;  2OXP A;  3TP5 A;  5IGF A;  1SYB A;  1EY6 A;  3OSO A;  1SNP A;  2F0E A;  5I9O A;  1A3V A;  4B9W A;  2EYP A;  2WAC A;  1SYF A;  2RBM A;  1EY0 A;  2F0L A;  2EYJ A;  4N9T A;  4K5X A;  1SYD A;  1AEX A;  3MHB A;  1TQO A;  4QF4 A;  5DAU A;  2ENB A;  4KHV A;  4E6I A;  4ME5 A;  5I9P A;  4N9P A;  1A2T A;  5C4Z A;  4RKL A;  1EYA A;  1U9R A;  2SNM A;  1ENA A;  4HMJ A;  3DHQ A;  1KDC A;  1EYC A;  1SYE A;  2EY1 A;  2PZW A;  4F7X A;  4KD4 A;  1JOR A;  3BDC A;  5CV5 A;  5EKL A;  4J6H A;  3TP7 A;  1II3 A;  2EYO A;  2F0F A;  4K2L A;  3QOL A;  4NMZ A;  4TRD A;  3NK9 A;  5KEE A;  3NP8 A;  3C1E A;  5KRU A;  5KYI A;  4PMB A;  2F0U A;  4S3S A;  5CR3 A;  5EGT A;  3V2T A;  3ERQ A;  3QOJ A;  4I65 A;  4OL7 A;  1EY4 A;  5M9O A;  2EY2 A;  4DFA A;  1KDB A;  3OMG A;  4WOR A;  3OMC A;  2EYF A;  1JOO A;  2F3W A;  4RKB A;  3SR1 A;  1F2Z A;  2OF1 A;  1A3U A;  2EY5 A;  1EY5 A;  2PW7 A;  2M00 A;  3HZX A;  2HQE A;  4J1M A;  3SK6 A;  3SK8 A;  5IOD A;  1JOQ A;  3NXW A;  3TME A;  3EVQ A;  2F0S A;  2EYM A;  4WRD A;  1RKN A;  5IOC A;  3ITP A;  5IGD A;  2PZT A;  1SNM A;  3C1F A;  3BDL A;  2SOB A;  2O4X A;  4K2K A;  3T16 A;  3D4W A;  1A3T A;  1EZ6 A;  2F0D A;  3TP8 A;  2PW5 A;  2PYK A;  3DMU A;  2PZU A;  5IIF A;  1STB A;  5DEH A;  1STN A;  4G57 A;  5K5P A;  4ZUI A;  4LAA A;  1KAA A;  1TT2 A;  2RDF A;  2EYL A;  5I6Y A;  5IGC A;  3NHH A;  4QMG A;  1SYC A;  2LKV A;  4EVO A;  3SHL A;  4HTH A;  5ISR A;  5KGU A;  1JOK A;  5CGK A;  2KHS A;  3HEJ A;  3MVV A;  4PMC A;  1SND A;  1EQV A;  1EYD A;  2F0N A;  3EJI A;  2F0M A;  5C5L A;  3SK5 A;  1F2Y A;  3QB3 A;  5CC4 A;  3VA5 A;  1NSN S;  2F0T A;  4K5V A;  3MZ5 A;  4ODG A;  5HUR A;  2F0Q A;  4K8I A;  4KJN A;  2NUC A;  4NDX A;  5KIX A;  5CV6 A;  4KJO A;  3SK4 A;  2PQE A;  5J39 A;  5E1F A;  3R3O A;  3P75 A;  4KV6 A;  2OEO A; 
#chains in the Genus database with same CATH topology
 4RCN A;  3TDQ A;  3MXG A;  1A6X A;  4LK1 C;  1K0R A;  4KY6 A;  1MSG A;  2PI2 A;  1YJ9 A;  3D8G A;  5BN3 A;  2UU9 L;  4POF A;  4DR7 Q;  3C3L A;  1SNO A;  1CM9 A;  2NTS A;  2WKC A;  1H9K A;  1ZYR C;  3K5L A;  1RF2 D;  2ZTE A;  4DV3 Q;  2I46 A;  1H9R A;  4A3C G;  4DR4 Q;  1HA5 A;  2IX1 A;  1HNZ L;  1A0I A;  3GTK H;  1W6J A;  4DUZ Q;  1RTN A;  5FJ8 G;  5IT9 c;  2ZTD A;  2VXW A;  3R93 A;  4ZCK A;  3PGZ A;  4JCV E;  1ZEQ X;  4K5W A;  1PFM A;  2UUC Q;  3KK7 A;  2R93 H;  4Y52 H;  1Q3L A;  2R93 B;  2OXP A;  1I6H H;  1MSH A;  4G7H C;  4IQZ A;  4B9W A;  4XYQ A;  5LMN L;  1TU2 B;  2OQ0 A;  4IUT A;  5C5M A;  1RD9 D;  5DAU A;  2K5H A;  3DWP A;  4LF8 Q;  1IL2 A;  1PRT B;  2WAQ B;  1UEB A;  3ND8 A;  4OX9 Q;  3S2D H;  1KDC A;  2QEJ C;  5FK9 C;  1VQO A;  5M3F G;  2EPB A;  4PG3 A;  1WOC A;  2N8N A;  4DK3 C;  5M3F B;  3NBH A;  2FJ2 A;  1C8C A;  1N33 Q;  3I4N H;  5KRU A;  2VL6 A;  3M4Y A;  4PMB A;  1H9S B;  2EJG C;  3BJU A;  3RZD H;  2ATW A;  3HOU H;  1Z9F A;  3FPP A;  3PUV A;  1BBX C;  5FLX E;  4I65 A;  1J8I A;  1V1P A;  1GHJ A;  1FR3 A;  2R7Z G;  4A76 A;  3NSW A;  2GVA A;  1XYI A;  4IFD G;  2K01 A;  2A6E D;  3OMC A;  2CH4 A;  3DM3 A;  5E4X A;  1JOQ A;  3SK6 A;  2D9U A;  5C4J B;  4RFB A;  3A8J E;  2K52 A;  3I55 A;  3U50 C;  1VQC A;  2MPM A;  3I3C A;  4TQU S;  2A6H D;  2K6A A;  2O4X A;  2F3I A;  3TP8 A;  3Q6S A;  1STB A;  4JPB W;  5DEH A;  2OTJ A;  4C3J B;  4QQB X;  4OIJ A;  4CJ1 B;  4C3J H;  4C56 C;  5IGC A;  1YVC A;  5JJI A;  4BA2 I;  2H5X A;  1TS4 A;  4IJH A;  5M3M H;  1X3P A;  4DUY L;  3PO2 G;  3K5O A;  3HOY B;  1E2W A;  1VQI A;  3BYT B;  1HUN A;  1DD2 A;  2AQ3 B;  3CPW A;  2NB0 A;  3E0E A;  4C3I B;  1PMR A;  4A3D G;  5A2Q E;  1SFO H;  3T1Y L;  3GDE A;  1X55 A;  1KDA A;  3N52 A;  5IWA L;  3FKI H;  3W5O A;  3F2D A;  2JA8 G;  4LUV A;  4K6D A;  3CKI B;  3K57 A;  4HID A;  1B4O A;  5CYU A;  3UI2 A;  4H7B A;  3PMF A;  1EQR A;  1TWF H;  3EN2 A;  4HJA A;  4GN4 B;  1IXR A;  1A8V A;  1FGB D;  1VDZ A;  3BYY B;  1OXT A;  1STH A;  3AMU A;  3NUC A;  1S4Z A;  2RCF A;  4ID6 A;  1EIY B;  4JOI C;  1UWV A;  4LJZ C;  3PO2 B;  1U0L A;  2Q8I B;  3JAM E;  4GLV B;  3S14 H;  2JA7 H;  4B3S L;  1K8O A;  4A3I B;  2LY7 A;  4IUV A;  1VQA A;  3HOV G;  2GA4 B;  3Q24 A;  3VR5 A;  4KD3 A;  4PZ7 A;  2PI2 E;  2EJF C;  3Q23 A;  1FYC A;  5GAE C;  2F0E A;  4GOP C;  3C2P A;  1K28 A;  1M4V A;  3GD7 A;  2AWN A;  1WTP A;  2Z9H A;  1PV4 A;  1J9O A;  1EYA A;  4X3S A;  5FJ8 H;  1MBY A;  3X3N A;  5LMU L;  1SYE A;  4B3M Q;  2RVL A;  5L37 A;  4WJ4 A;  1NMF A;  2QDL A;  1QNU A;  1BF4 A;  4KKT A;  4ZRZ A;  1L0Y B;  3T51 B;  3S1Q B;  1DOK A;  4S3S A;  1PH5 A;  3UE0 A;  3IRB A;  2TSS A;  2CW0 D;  4X65 Q;  4O2D A;  5CBA E;  5C0X H;  1JR0 D;  2HIV A;  1HFN A;  3GP7 A;  2HQE A;  2RF4 A;  2Z6K C;  1BCP B;  1YNN D;  1H95 A;  1TWC H;  4L5S A;  4XYO A;  2L1B A;  3M4O B;  5IWA Q;  3M4O H;  1HR0 Q;  1P8L A;  5C0X I;  5EJW A;  2R7Z B;  4L5R C;  5KNC A;  1CKN A;  1QUQ A;  4P73 A;  3KJO A;  2HCC A;  3MVV A;  4OWX B;  1X54 A;  1PH4 A;  4L8J A;  4BWG B;  3G6E A;  4KKS A;  3GTM B;  2L0C A;  4C3H G;  3GTL B;  4JI2 Q;  1A15 A;  1SMX A;  3FKI G;  3GQB A;  3VR2 A;  3E9I A;  3S2D B;  2IW3 A;  4F87 A;  1EY9 A;  1VCI A;  5JPN C;  3MC0 B;  4LNQ A;  4DV7 Q;  1EL0 A;  1TWA B;  3HOX B;  3MAQ A;  3F8T A;  4B3T L;  1HPC A;  1TWH B;  3ULJ A;  4C3J G;  2UUB Q;  4K14 A;  4Y7N H;  2JP1 A;  1YNJ C;  4RHR A;  5C4X G;  4DR6 L;  5M5W B;  3CU7 A;  2Q8T A;  3ULP A;  2WV6 D;  2UXB Q;  5JAV A;  4DAY B;  3J81 L;  4DR2 Q;  2EQS A;  1GUO A;  2HHH Q;  4DV0 Q;  1FD7 D;  4B3M L;  1X6O A;  1JWM D;  3KF6 B;  3Q8D A;  5LL6 X;  1Q90 A;  4EQN A;  4IZ8 A;  1HNZ Q;  1DJR D;  5C6A A;  2F0J A;  4RGT A;  1Z7T A;  3N6R A;  1PFS A;  4A3K G;  1CHQ D;  2F0P A;  3GTO H;  2DJF C;  2SDF A;  2B2Y A;  4A3E G;  2XWJ B;  2MHV A;  4A93 B;  1X3G A;  2NZO A;  4LF9 Q;  1I4X A;  4M8A A;  4QF4 A;  2E2I H;  4MHE A;  2G9D A;  1I6V C;  1B50 A;  5ELE A;  1G6Z A;  2A69 C;  4OHJ A;  4BBS G;  4UAI A;  3I4L A;  1T5E A;  3JAM L;  2F0F A;  3G6J B;  4TVA B;  3QOL A;  5IYD G;  3C1E A;  5BN4 A;  1EQQ A;  4PV1 C;  1KHI A;  5EGT A;  4R4O A;  1Q82 C;  5JJZ A;  1YIT A;  1JT8 A;  2A68 C;  1KDB A;  2JA6 B;  5FOB B;  3RZO B;  3W3A A;  1LT4 D;  4LF4 L;  3PUX A;  4J1M A;  3MEF A;  5FO9 B;  4KN4 C;  1HZC A;  3TME A;  3EVQ A;  1MKH A;  4H44 C;  4WRD A;  1CZW A;  5DLQ E;  1YNJ D;  2PZU A;  3SDZ A;  4CDC C;  4LAA A;  1HNX L;  1VQ5 A;  5I2X A;  4GNX B;  1XMQ L;  2K5V A;  5KGU A;  1GUT A;  3NQI A;  1G2S A;  4HR7 B;  3KBX A;  2ZT9 C;  3HP3 A;  1E3P A;  4I7Z C;  1NY4 A;  4KJN A;  1R4P B;  3NEM A;  3R3O A;  1UE7 A;  2IWH A;  1J5E Q;  4HCE A;  3X3M A;  5J1Z A;  5BR8 L;  1IBM Q;  1BKB A;  1E24 A;  4XQQ A;  5GRO A;  2DY7 A;  4QIW B;  2J0T D;  1I4R A;  3J81 j;  1X56 A;  3M7G A;  3T4A C;  1Q1B A;  1EWI A;  1A2U A;  4LF7 Q;  4DU9 A;  4AYB G;  3I4M B;  1JWU D;  4C2M H;  3CC4 A;  2DGY A;  4OEM B;  2PNR C;  3OIP A;  3H09 A;  3HOW G;  3BZD B;  4DV1 Q;  3GTP H;  4YWM A;  4DA2 A;  1I94 L;  4RGO S;  1OO9 B;  5JJL A;  2NYZ D;  4X66 L;  2VNU D;  2X69 A;  3J7A F;  4IAL A;  1STA A;  1VQ8 A;  1CKO A;  2B39 A;  1SRU A;  2DNC A;  1TS5 A;  1TWG H;  3G48 A;  2E5L L;  4IJL A;  2HDM A;  3OHX C;  1BCP C;  1IZ6 A;  1K3B C;  1AW7 A;  4TSS A;  3S16 B;  5CV4 A;  5A35 A;  1RCV D;  3S16 H;  3M4Q A;  1Y8P B;  4A3K H;  2E2J H;  1MGS A;  2KEE A;  4RMF A;  2VUM H;  2B2T A;  4LMQ D;  4DV3 L;  2VUM B;  4K5X A;  3H15 A;  1B44 D;  2JK8 A;  2EOT A;  3UDF A;  4NXN Q;  4LF4 Q;  4RKL A;  1VQE A;  1PH3 A;  3CCJ A;  1FNU A;  2A74 C;  1JCK B;  4WJ3 M;  1QWY A;  3OW7 A;  1DM0 B;  4UP8 A;  4C3I G;  3S15 H;  1D2B A;  3EBE A;  3BDC A;  2CQO A;  1N33 L;  1NBW A;  4DXF A;  3U4Z A;  5BR8 Q;  1IBM L;  2UXC Q;  1TXY A;  2F0U A;  4NXM L;  1HUM A;  3H94 A;  1O7Y A;  4OWW B;  4BY7 H;  1HJP A;  1JOO A;  2NVT B;  4HSP A;  2EYM A;  2F0S A;  4FF2 A;  2Q2U A;  3GTQ H;  3T16 A;  3D4W A;  1Y1V G;  1PZI D;  1TVX A;  2B2T C;  1U4L A;  2Q2T A;  1L1O C;  1JJC B;  1VQM A;  3K8A A;  4OGQ C;  1X3E A;  2R93 G;  3HEJ A;  1S3O A;  1BVS A;  2B2V A;  4BY1 B;  4HJ9 A;  1PTO C;  1S5D D;  5FLX L;  1BXT A;  4K8I A;  2K5D A;  5IYB H;  2QIL A;  2MUY A;  3T1H Q;  3EIV A;  1VMP A;  2D62 A;  2DNE A;  3VA7 A;  5IGB A;  4OWT B;  4DR6 Q;  1C0A A;  4LFA L;  3H3V H;  5CV9 A;  5ELB A;  4A3J G;  3DWA A;  1DYQ A;  2CFM A;  3CHB D;  3CCS A;  1CSQ A;  1PA6 A;  2IX0 A;  2YTV A;  2E2H B;  4IOC A;  1I3Q H;  5EKK A;  1M1K C;  3NWS A;  1F9Q A;  3I4N B;  2HUG A;  2KED A;  4JBM A;  5LHY 1;  1SAP A;  2OWO A;  3PF4 A;  3OWF A;  1ILP A;  4L63 B;  4IUU A;  2B63 G;  2R92 G;  4CDE C;  2UUA Q;  2BCO A;  3PIP A;  1CKN B;  1MD2 D;  1QUQ B;  2A69 D;  3ONA B;  1XMQ Q;  1O7Z A;  1SE3 A;  4OX9 L;  3QO2 A;  4V19 0;  2QDB A;  3D4D A;  3S2H B;  4JI1 Q;  1HRJ A;  1B3A A;  4DV2 L;  4NKL A;  2JA5 B;  1SYB A;  2JA5 H;  4KKU A;  1PYW D;  3PUW A;  1E1O A;  3UDI A;  4UP9 A;  1JE4 A;  1SYF A;  2F0L A;  5ISR A;  3HOW H;  1IYJ B;  1TS3 A;  1S5E D;  3FPU B;  1WTX A;  4X3U A;  1WTO A;  4ME5 A;  3K6O A;  3A74 A;  2JQO A;  1PH1 A;  4FXG C;  2YU9 H;  2P5Z X;  2GN5 A;  5CV5 A;  2JJQ A;  3DEP A;  4K2L A;  1I4G A;  1XNR Q;  4DPG A;  2B63 B;  4BXX H;  3V2T A;  2R92 B;  2VB2 X;  4C2M B;  1WCM B;  4HIM A;  5G3L D;  3I4O A;  2NVX B;  1I50 B;  1Q12 A;  3HZX A;  3MA2 B;  5IOC A;  5IGD A;  1XWE A;  5GAD C;  4H0L C;  4GKK Q;  4K2K A;  3RN5 A;  5EPL A;  1UE6 A;  1EZ6 A;  3P7J A;  1XPR A;  2ASB A;  4GLA C;  5K5P A;  4CDD C;  4A3M B;  3NHH A;  1ZKO A;  4JYA L;  1YZ6 A;  2KOL A;  1O80 A;  2XVS A;  3BVM A;  1Y8N B;  4GLX A;  1QJO A;  2ZXP A;  3FHW A;  4B3R L;  5ELD A;  3PO3 B;  3HKS A;  4JI4 L;  1OXX K;  5E1F A;  4IN3 A;  1LT6 D;  2WB1 B;  1JMC A;  5EPJ A;  2OEO A;  1VQL A;  3CC7 A;  2Z4I A;  3NTK A;  1G51 A;  1HTP A;  5C3W A;  1E2V A;  4ABN A;  1LTT D;  4KLK A;  4NP5 A;  1D5X C;  4A3G G;  3TBI B;  4MN3 A;  1EIF A;  1PRT D;  2KQ3 A;  5FLX c;  5IYB G;  4HAE A;  1D8L A;  1SJE D;  1JJ2 A;  2G9H D;  2HCI A;  1C48 A;  4P71 A;  2EXZ A;  1XNQ Q;  4UHV A;  3TRE A;  2AKW B;  1EY7 A;  5I4D A;  4GN5 A;  2NWG A;  1PTO B;  1STE A;  4B3T Q;  3KOJ A;  5TSS A;  3GTK B;  1NUC A;  2I5M X;  1TII D;  2EIF A;  4A3B H;  4YIJ A;  2D5D A;  3HOU G;  3E6Z X;  4IOA A;  1M8A A;  4QGU A;  4N9T A;  2PQA A;  1B9M A;  1AEX A;  2J7Z A;  1TQO A;  2LFN A;  4LUO A;  2QKI C;  3RLO A;  3HOZ G;  2K05 A;  2JEA I;  1F77 A;  1A63 A;  3RZD B;  3HOU B;  1YNN C;  1IL8 A;  2AWO A;  4BBR B;  1V1P B;  3RMH A;  1AFP A;  4F7X A;  1JOR A;  1B8A A;  1GOZ A;  3OW2 A;  4G4K A;  5KEE A;  1LT3 D;  3PIP 3;  4IFD H;  1CSP A;  3NWT A;  4GKK L;  3W1B A;  4DR2 L;  1ET9 A;  1I3Q B;  1UE5 A;  2XNA C;  3BZC A;  4JBJ A;  1TWH H;  1I4Q A;  5FO8 B;  1GHK A;  2PW7 A;  5JVG 3;  4AYB B;  2PCF B;  5DM7 3;  1LAB A;  1L0X B;  3I72 A;  5IIF A;  2HT1 A;  1WD0 A;  1JWS D;  3TRZ A;  2EYL A;  1TY0 A;  4QMG A;  1KRS A;  3FMC A;  5LMN W;  3T1H L;  3QWN A;  1BCP F;  3FRP B;  3MZ5 A;  3UDG A;  1IYU A;  1N36 Q;  1KLG D;  4LF6 Q;  2CVR A;  1L1O A;  4KJO A;  2MO1 A;  1S5B D;  4XDX A;  1L1O B;  3L0O A;  2M9V A;  4HJ8 A;  2MP1 A;  2FHT A;  2Y0S B;  3D4R A;  2NVY H;  2QCP X;  1WTH A;  4CKC A;  2KUM A;  4R4I A;  3KFU A;  3DEO A;  1QVC A;  4OON A;  2A6H C;  2VB3 X;  3PO2 H;  4KK7 A;  1SBB B;  2E74 C;  2B8F A;  3JAM i;  1YBY A;  2EVB A;  3HKZ E;  4ZKC B;  1D1K A;  5CV7 A;  5KYL A;  3DM1 A;  1VQB A;  5FLM G;  1F9S A;  1SE2 A;  5LL6 S;  3KLS A;  5M5X B;  1VQK A;  3CRK C;  2Q2I A;  2VQE Q;  3CC2 A;  2DJG C;  1F9R A;  2JA6 H;  3GTJ H;  2HD3 A;  2ICE C;  3BDO A;  1YJN A;  1Y1V B;  4CBV A;  1JE5 A;  4KHP L;  1XMO Q;  3TP6 A;  1HZA A;  3CAM A;  1NR4 A;  2IL8 A;  4X66 Q;  3I8Z A;  1WJJ A;  3GO5 A;  4DV6 L;  5I9O A;  5CMD A;  3PO3 H;  2EYJ A;  1AZQ A;  1EFW A;  1HA6 A;  1GXD C;  3KBG A;  4A93 G;  1FL0 A;  2ID0 A;  2SNM A;  4P72 A;  2E5L Q;  1Y1W H;  3TSS A;  2B2U A;  4JI0 L;  1GUW A;  4A3J H;  1HXY D;  2WAQ G;  2YYZ A;  2N55 A;  4WJW A;  2OQK A;  2Q2H A;  4EGV A;  4LFC L;  3I73 A;  1ET6 A;  3CW2 C;  1Q1E A;  2E8G A;  2L55 A;  1N34 L;  1Q81 C;  5EKI A;  2I0Q A;  2K32 A;  1KAW A;  4OO1 I;  1LT5 D;  1SJH D;  2PQA B;  1YIJ A;  4B08 A;  4KN7 C;  4IUQ A;  3S1N H;  2ZJR A;  1SN8 A;  5C44 B;  3AU7 A;  1HZB A;  3ITP A;  4CHT B;  5C44 H;  4MTN A;  3BDL A;  5C4X B;  3E0J A;  2C5C A;  4GKJ Q;  1I6H B;  2PW5 A;  3BVG A;  4QY7 A;  2HIX A;  2K5W A;  4JC0 A;  4X62 L;  4ZUI A;  2RDF A;  3HOX G;  5I6Y A;  3WOF A;  4XXE A;  2A5H A;  2LKV A;  4FXK C;  4A3B G;  2RHQ B;  1VMC A;  4IUR A;  5CGK A;  2K04 A;  3ZJY C;  4QJF A;  2HQL A;  4DV0 L;  4C3H B;  1HNX Q;  4PZ8 A;  2R7Z H;  4YWK A;  5EQ0 A;  3G71 A;  3HOY G;  3M9B A;  2E2D C;  1HFG A;  3E3X A;  1WD1 A;  2PMZ E;  4F8M A;  1WYD A;  2BA1 A;  2NTT A;  2PNH A;  1JC7 A;  4R9W A;  2WP8 J;  2Z8L A;  1SNC A;  4IPC A;  2V1C C;  1VQG A;  3MEH A;  1KD1 C;  2I5H A;  4MZ9 A;  1YJW A;  1TR5 A;  4AH6 A;  2L12 A;  3WDN A;  3L7Z C;  1STG A;  3CPF A;  4CJ0 B;  4KHP Q;  3TQY A;  1K8A C;  2OT2 A;  4O42 A;  3TEH B;  3ZYY X;  2KCM A;  1AH9 A;  1IYV A;  5H1S E;  2UUA L;  1EZ8 A;  1Q7Y C;  1HNW L;  2N49 A;  1XPO A;  1G29 1;  4PNY A;  1IBK L;  3P20 A;  1HTL D;  1NR2 A;  2BH8 A;  1P16 A;  1ASY A;  4A3G B;  1TS2 A;  2CH4 W;  3A5U A;  3D6W A;  1WI5 A;  2YTY A;  5IGF A;  2K03 A;  1D7Q A;  3ICE A;  4A75 A;  2NN6 I;  1N9W A;  2R61 A;  5GAG C;  1AE2 A;  4CKE A;  5FKA C;  4DNR B;  1Y1W G;  3K7U C;  4C1N I;  1A2T A;  1DZ1 A;  4GN3 B;  5IYC H;  4M1U B;  1EOT A;  3CP0 A;  3DHQ A;  1EYC A;  4OXP A;  1NTG A;  3T1Y Q;  1FJG L;  1SSO A;  4J6H A;  1KXL A;  5BN5 A;  2A1A A;  2KVM A;  2R7D A;  4LF6 L;  5KYI A;  3JC6 6;  4XT1 B;  1EEF D;  4XQJ A;  2UUC L;  3ERQ A;  2YTX A;  3KDF B;  2K28 A;  3CD6 A;  1JQY D;  1EOV A;  5M9O A;  4DFA A;  2UXB L;  1XJV A;  4XT3 B;  1Y14 B;  1YHQ A;  4A3I H;  3OMG A;  4RKB A;  2X6L A;  2DY8 A;  2LXJ A;  1JJG A;  3SK8 A;  4L6T B;  5IOD A;  1LUZ A;  1EFI D;  1RJT A;  1RKN A;  1TWC B;  2NZ1 D;  5M5Y B;  1ESR A;  4G57 A;  1K73 C;  4HED A;  5A2Q L;  1BQQ T;  3CCQ A;  1SEB D;  4JI3 Q;  4K0K L;  3MFG A;  4OO1 G;  2VW9 A;  3D31 A;  1OXU A;  2F0N A;  2MFI A;  4JV5 Q;  2UU9 Q;  2CWA A;  2RQX A;  3QB3 A;  3VA5 A;  1D5Z C;  2F0Q A;  2NUC A;  1SMY D;  1R4Q B;  2E75 C;  3CCU A;  2RSN A;  1XTC D;  3P75 A;  2DN8 A;  4KV6 A;  5JVH 3;  1VQ7 A;  3TS2 A;  5M3F H;  3D3R A;  4K6L A;  2JA8 B;  3ERO A;  4LF5 Q;  4N8X 1;  4KHZ A;  2F4V L;  2JA5 G;  2IPK D;  4X64 L;  5IGE A;  4JBK A;  3KYH C;  4FXD A;  1F2L A;  4X65 L;  4JW0 A;  4A3D H;  4DGZ A;  3V05 A;  1HCZ A;  4DV5 Q;  2F0G A;  4R8N A;  4RH6 A;  4IPH A;  4EQP A;  1C7Y A;  3I4N G;  4ULL A;  1HQM C;  2F3V A;  4NW2 A;  1EU4 A;  4A3F H;  4V0B A;  1QVF A;  3QG1 A;  2O5I C;  1B1Z A;  4KI0 A;  3IKJ A;  1PRT C;  2A19 A;  2CHB D;  1H9M A;  1O78 A;  2M2L A;  4E6I A;  4N9P A;  1UNS A;  1IBL L;  3FKI B;  3G4S A;  4J8Q A;  1L2F A;  1UEA B;  3UE1 A;  4I7A A;  4AIM A;  1S72 A;  3LNN A;  1I94 Q;  1GO3 E;  1Z47 A;  1II3 A;  1EIH A;  2IJ0 A;  4BY7 G;  1ENF A;  1J5E L;  1PZK D;  3NEL A;  4OL7 A;  3NE5 B;  4OIK A;  1F2Z A;  4ZYS A;  1EYG A;  2G5D A;  2L15 A;  2L5T A;  1X3F A;  2PZT A;  4FDB A;  4O0A A;  2HHH L;  2BH2 A;  3HOV B;  1A3T A;  2F0D A;  4DR3 L;  4A93 H;  5HY6 A;  3MXU A;  2TMP A;  5IT9 L;  1CTM A;  4HTH A;  1D5M C;  1XMO L;  2KHS A;  4PMC A;  1RDP D;  3PUY A;  2FXQ A;  4PQX A;  2RDG A;  3K80 C;  3R2T A;  3PO3 G;  4A3C H;  4GS3 A;  3STB C;  2K4K A;  5D3I B;  3M3Y H;  4NDX A;  4RHS A;  2AQ2 B;  3W2D A;  5KIX A;  1N8R C;  4AYB E;  4LW1 A;  4JI6 Q;  1SRO A;  4KY5 A;  3U4V A;  2RKS A;  3K7A H;  2D2C C;  3RZO H;  3B6Y A;  5ELC A;  3GTG H;  2JA9 A;  1M90 C;  4B3S Q;  2F0V A;  4C1N K;  1B53 A;  4MNO A;  1CQV A;  2JEB I;  3V96 A;  3H0G H;  1G91 A;  2O5J C;  1SNQ A;  2EXD A;  1NNX A;  2B8G A;  3RR5 A;  1VS0 A;  4A3L G;  1ICF B;  1ENC A;  2CW0 C;  4HN7 A;  4DAV A;  2EYH A;  4DV4 L;  1T9H A;  4MIU A;  1PVO A;  3H3V C;  5CV8 A;  3PIO A;  4ZUJ A;  2K7V A;  3OYY A;  1BR9 A;  4YHH L;  4GNX A;  3IL8 A;  4B9X A;  1SLJ A;  3I70 A;  3K0Y A;  2B2W A;  2F0K A;  1VQP A;  4XTC S;  4R4Q A;  3RD4 A;  3OOC A;  1SNP A;  3GTM H;  3HKZ B;  2CCZ A;  2Z4H A;  3CCM A;  1I4H A;  3TN2 A;  2B63 H;  2R92 H;  1K83 H;  1LTG D;  4HMJ A;  2ZM6 L;  4YWL A;  2NVQ B;  2JN4 A;  1QOH A;  1U5K A;  5T1I A;  4LF5 L;  1CQF A;  1J6Q A;  5ELN A;  3L2P A;  4DUZ L;  5AJ3 L;  4YY3 L;  3GTP B;  3O13 A;  5M3M G;  2NBF A;  1EY4 A;  2YU9 B;  4DR4 L;  3VDY A;  4BXX G;  4WOR A;  3J7A 5;  2MGS A;  1TWG B;  2KCT A;  4R8I A;  3J80 E;  5AFW A;  4DXG A;  4ZLT F;  4GKJ L;  1SNM A;  5EBC A;  4JI3 L;  3IFT A;  4JI2 L;  5COR A;  2A6E C;  1STN A;  1G2T A;  4JI0 Q;  2EJM A;  3D0F A;  1WTR A;  3FVQ A;  3GTO B;  1IBK Q;  1NMG A;  4CKB A;  1LAC A;  1Q8K A;  5CBE E;  1KC8 C;  4NXN L;  1EQV A;  1DON A;  1KLU D;  4LFC Q;  1N34 Q;  2AHO B;  2F0T A;  2R3Z A;  3Q22 A;  4R1J A;  4A3M H;  1KQS A;  1QNK A;  3PQI A;  3HRZ C;  3SK4 A;  3OTO Q;  3PIO 3;  3K81 C;  2ALY B;  1NCV A;  1V8Q A;  4OEL B;  1X9N A;  1KTK A;  2WII B;  3VR3 A;  1EIG A;  2RDH A;  1PDQ A;  4DR1 Q;  5KNB A;  1YI2 A;  4RCO A;  5JEA G;  3S24 A;  2L4N A;  1ROD A;  4PZ6 A;  3A5Z B;  2ZM6 Q;  1LYL A;  3T53 B;  3HFZ B;  2OTL A;  1K0S A;  1B3Q A;  2Z6B A;  4DV7 L;  1YHB A;  1K8M A;  4NPS A;  4A3J B;  4YHH Q;  1UAP A;  4JG2 A;  3A7L A;  1U4R A;  4DK6 C;  1PH8 A;  4B3R Q;  4A3B B;  3MXP A;  4BY1 H;  1C9O A;  1Q46 A;  1OXV A;  1V43 A;  4BA1 I;  4JYA Q;  4HJ5 A;  4QIW E;  4EX5 A;  3MXN A;  2VQE L;  2SNS A;  2MNA A;  3S17 H;  1CT1 D;  1EY6 A;  3VYR A;  1PTO H;  3M7N A;  3NTH A;  2F4V Q;  2MQH A;  3J7Z C;  1KIX A;  3CCE A;  2KEN A;  2B2U C;  2BA0 A;  2ICI A;  1UUP A;  3HOY H;  1U9R A;  1PYB A;  1CZG A;  2KHJ A;  2AQ1 B;  1CUK A;  2R6G A;  3JAM c;  4RAU C;  3ERS X;  4JI7 L;  4UDU C;  5K36 G;  1XNQ L;  2QA4 A;  4TRD A;  2JYO A;  1SFO B;  1MJE A;  1N32 L;  2CWP A;  1FNW A;  3AYH B;  5IY0 A;  2K1B A;  3QJY A;  4FO2 A;  2K5Q A;  2SEB D;  2RSO A;  2N88 A;  1CA5 A;  2OF1 A;  1A3U A;  3CQZ B;  5GQO A;  2SOB A;  3H91 A;  2WAQ E;  4DV2 Q;  2B3G A;  2DUD A;  1WCM G;  1NE3 A;  4UY8 C;  4Z9C B;  3OTO L;  1SDF A;  1BNZ A;  3EQL C;  2IHF A;  2H1E A;  5M3M B;  1NJI C;  5IYD H;  3RN2 A;  2NN6 H;  1LTA D;  1V9P A;  1F2Y A;  1NSN S;  3GV6 A;  5IP7 H;  4ODG A;  2NVY B;  2IX3 A;  1LV9 A;  3GV3 A;  4LWC A;  1PH2 A;  3HS0 C;  4GNX C;  3A56 A;  4LF7 L;  4P2C B;  2B2Y C;  2H4O A;  2BE5 D;  2C9O A;  3LX0 A;  5E7N A;  3RLF A;  3RUZ A;  4JOI A;  3S9W A;  3UDX A;  2RCN A;  2EY6 A;  3E5S A;  1BCP D;  1DXM A;  3STB D;  2NVT H;  3E9H A;  2IY5 B;  4IPD A;  1IW7 D;  4G7Z C;  4BY1 G;  3ER0 A;  4QB4 A;  5AJ3 Q;  3GTQ B;  4DK0 A;  2XSC A;  1GKH A;  1C4Q A;  3DLL A;  5KND A;  1GUG A;  3BG3 A;  4FF4 A;  4ME3 A;  1N36 L;  3EA6 A;  1CK1 A;  5JOB A;  1VQ9 A;  3AB9 A;  4BBS H;  4DF7 A;  3DUZ A;  4BBS B;  1ML0 D;  3NQT A;  4KY7 A;  1HQR D;  3D6C A;  2ES2 A;  3U9O A;  1Q86 C;  2KCN A;  2F0I A;  1PFB A;  1VF7 A;  1QVG A;  4RGM A;  1H9J A;  4J15 A;  5D65 A;  1A3V A;  2XRS D;  2A68 D;  2L11 A;  2RBM A;  3CRL C;  1EY0 A;  3J81 c;  5COY A;  3R2I A;  3H3V I;  1PFN A;  2ENB A;  3CCR A;  3F2C A;  1VQ6 A;  2OCE A;  1KNE A;  4RGN A;  2AUK A;  4NXM Q;  3NBH B;  2E76 C;  5C4J H;  2I07 B;  1B70 B;  1GJX A;  4YCV A;  1VQJ A;  4JI4 Q;  2EY2 A;  5I2Y A;  2QEX A;  2FMM A;  2F3W A;  1AN8 A;  2MO0 A;  1U4P A;  2EY5 A;  1PLF A;  2M00 A;  3RLN A;  3L9A X;  5IT9 E;  4BBR G;  4LF9 L;  2K33 A;  4LF8 L;  4G7O C;  3HOZ H;  2UXC L;  1LLR D;  2ZXR A;  3K59 A;  4DK1 A;  4IO9 A;  1LTS D;  3FP9 A;  3HOZ B;  1MI2 A;  5K36 H;  1TT2 A;  2N3S A;  3MXN B;  2QF7 A;  4C3I H;  3S1M H;  3KLS X;  1VF5 C;  4DR5 L;  4ZKB B;  3RNU A;  4K0K Q;  2XIW A;  1GVP A;  3BU2 A;  4LFB L;  4A3K B;  1QCB D;  4LFA Q;  4JK1 C;  5JPM C;  3A55 A;  1W3S A;  1BOS A;  2D0P A;  4XIG S;  3KF8 A;  3PCO B;  1AP0 A;  1XXG A;  2LS0 1;  1PH9 A;  2EE1 A;  3NEN A;  5C3X A;  4DR3 Q;  1BDO A;  1X32 A;  5C4H A;  4H13 C;  3HOX H;  3CME A;  2K50 A;  4Y7N B;  2F0O A;  2WB1 G;  3KUP A;  4HCS A;  4YCW A;  1SXT A;  3I91 A;  1KNA A;  4NB3 A;  1R9T B;  3S14 B;  2GVB A;  1NAP A;  2JSO A;  2Q8R E;  1BO0 A;  2V4D A;  3I56 A;  1PHJ A;  5E4W C;  3J7Y W;  4X6A H;  1KRT A;  4P75 A;  1HH2 P;  1GM5 A;  1PH7 A;  4CDF C;  1MHW C;  2Y0S E;  3KLW A;  5C0X J;  4ZK9 B;  1U4M A;  2WIN B;  2KEC A;  1IBL Q;  3HGB A;  4QL5 A;  3J7A V;  4R4T A;  1LTL A;  1RL2 A;  2EZV A;  2JA7 B;  1X65 A;  1MJC A;  3MWY W;  1EY8 A;  3HOV H;  4ZQ3 A;  2K14 A;  4GZY C;  4CJ2 C;  4FYD A;  3J80 i;  4GOP B;  4A3M G;  1CFM A;  1B9N A;  1BBU A;  2XN9 C;  2C35 B;  3KJP A;  3W1G A;  5FLM H;  1E0B A;  2VZA A;  3Q0A A;  1OXS C;  2JA7 G;  2BDO A;  4ILW A;  2RA4 A;  3F2B A;  1IW7 C;  3IFD A;  5J3B A;  2PZW A;  4KD4 A;  4BS9 A;  3KDF A;  1H9S A;  2EYO A;  4DR1 L;  3BZK A;  1O7I A;  4JI5 L;  5EBD A;  3URY A;  4HIO A;  4OO1 H;  2CQA A;  3FEW X;  1PRT F;  1S5F D;  3GTJ B;  2BE5 C;  3SR1 A;  2KCC A;  1HZ9 A;  4LFB Q;  1CI3 M;  1WTV A;  1I4P A;  2FMC A;  2I5L X;  1EWC A;  1QG7 A;  4GOP A;  5IYC G;  2PMZ B;  1Z6H A;  1ASZ A;  1BBW A;  1L0W A;  3DMU A;  4DAM A;  2J4X A;  1PZJ D;  1KAA A;  2AUJ D;  4YCU A;  2F4I A;  2FFK B;  3H0G G;  3PSI A;  1SYC A;  3GTL H;  1K9M C;  3WWV A;  3NBI A;  3SK5 A;  1EYD A;  5CC4 A;  2VS1 A;  4K5V A;  4RWS C;  5ELF A;  3KF8 B;  4APV A;  1QZG A;  2PQE A;  4HJ7 A;  3A0J A;  3PV0 A;  1T5X D;  1I5F A;  3DXJ C;  1G6P A;  2K5N A;  4X3T A;  2F0H A;  1K83 B;  2Z0S A;  4ZAI A;  3S1N B;  3KLR A;  1WTW A;  1SR3 A;  1TWA H;  5C4X H;  1BUV T;  4IUP A;  3I4M H;  3AFP A;  3S1R H;  3S1R B;  4UPA A;  3C46 A;  5I6W A;  3PUZ A;  1WFQ A;  5M5W H;  4RA8 A;  2EDG A;  2Y0S G;  1Y8O B;  1D1I A;  1ILQ A;  3SXH A;  3OIQ A;  4BY7 B;  1IKL A;  3U58 A;  4A3D B;  3HG9 A;  1PTO D;  3P1H A;  4X3K A;  5E3F A;  4X62 Q;  4DN4 M;  2E2I B;  4QUF A;  3SGI A;  3J81 E;  5IP9 H;  1UE1 A;  1KAB A;  1WTQ A;  2K75 A;  1DGS A;  2KBN A;  4N8F A;  4JI1 L;  3OSO A;  3T56 B;  1LTI D;  2EYP A;  1VQD A;  2WAC A;  5CR3 A;  3MFY A;  4A3F B;  1SYD A;  3MHB A;  1EWH A;  2N78 A;  3MTS A;  5I9P A;  1ZYR D;  5C4Z A;  5EAY A;  3K58 A;  1TY2 A;  3CMA A;  1PXU A;  4UP7 A;  2IHE A;  2O2L D;  3U9S A;  3NK9 A;  3NP8 A;  5D14 A;  1O7L A;  4A4I A;  1R9T H;  1RTO A;  1CA6 A;  5C3E H;  5C3E B;  4DKA C;  5DM6 3;  3KF6 A;  3VYT A;  1IKM A;  5JEA J;  2EYF A;  5C5L A;  1XTD A;  1G8Z D;  3TP5 A;  1DOL A;  2WB1 E;  2LSS A;  4JI6 L;  1D6E C;  1EQT A;  5M5Y H;  1W6K A;  4POG A;  1B2T A;  3C1F A;  4CGY B;  2LMC B;  2PYK A;  1EEI D;  5G3L F;  1ZXT A;  3OPO A;  3AQQ A;  1PYS B;  3FDT A;  4R4C A;  1ESF A;  2B2W C;  2L9H A;  3J81 i;  5IE8 A;  3F2U A;  3K5M A;  2B2V C;  1V1Q A;  1XX8 A;  2IT1 A;  3TZD A;  3WOE A;  3I2Z A;  4F88 A;  4DR5 Q;  5CV6 A;  4HSV A;  5J39 A;  4JI7 Q;  3VYS A;  4JI8 L;  4DV5 L;  3CCL A;  4L5T A;  3S1Q H;  1HR0 W;  3S17 B;  5HGQ A;  3R8B A;  1Y1W B;  3H0G B;  1STY A;  4BBR H;  1LM0 A;  5ELO A;  3M3Y B;  1HHV A;  3HOW B;  3I7F A;  4EQO A;  3QR8 A;  1E1T A;  1QE6 A;  1EU3 A;  3I4M G;  3G7L A;  4JBW A;  5NUC A;  4IUN A;  2B29 A;  1RIP A;  4QUC A;  2JXM B;  2MJ8 A;  4A3L H;  2WKD A;  1QB5 D;  2F0W A;  2BOS A;  3CXC A;  4IFD I;  2D0O A;  3SE0 A;  3NTI A;  2Z6K A;  1S40 A;  1LTR D;  1K8G A;  2KA7 A;  2RHS B;  2A8V A;  1HNW Q;  3I90 A;  1V1O A;  2NVX H;  1I50 H;  3LWE A;  5LMU Q;  3CQZ H;  3TZU A;  1FNV A;  2HDL A;  4H02 A;  1QZH A;  4P74 A;  3T13 A;  4MTK A;  3A8K E;  4JI5 Q;  3VR6 A;  2NVQ H;  3CF5 A;  4L5Q A;  3S15 B;  4DV6 Q;  5D3D A;  3F1Z A;  2FIN B;  4KHV A;  2UXD Q;  4DUY Q;  1E7Z A;  1XPU A;  1GD7 A;  4DNT B;  2EY1 A;  1WVL A;  1HR0 L;  3TP7 A;  1Q8I A;  2QGQ A;  4U67 3;  2XWB B;  1VQ4 A;  4NMZ A;  2JA6 G;  2NN6 G;  2PPB C;  3AFQ A;  5C3E G;  1OTC A;  5IP9 G;  3IAY A;  1CKM A;  3SVM A;  4FF3 A;  1RHP A;  4A3F G;  2XTI A;  2VUM G;  4TKO B;  1Y69 U;  3LWU A;  3QIA A;  5GAH C;  5M5X H;  4IFD J;  1LO5 D;  4KMU C;  1AZP A;  4JI8 Q;  4RG1 A;  4PMW A;  4DNI A;  2PO4 A;  4A3G H;  1Y1V H;  2A73 B;  3SHL A;  1AE3 A;  2XGT A;  3M4P A;  4A3E H;  4U68 A;  1LTB D;  1ONL A;  4A3E B;  1SND A;  2F0M A;  4HIK A;  4AQY L;  1X3Q A;  5HUR A;  4YY3 Q;  4EQ5 A;  5DNF A;  3OWE B;  1B7Y B;  4LUZ A;  1XNR L;  2CKZ B;  3H6M A;  1F2M A;  2WFW A;  1F9P A;  1GUS A;  2UXD L;  4HMI A;  5F2D A;  2JE6 I;  1EUJ A;  2ZJP A;  3A54 A;  5EPK A;  3J80 L;  3GTG B;  1SE8 A;  4X64 Q;  2KHI A;  3EFX D;  4KTA A;  1SYG A;  5HGT A;  1A62 A;  4DV1 L;  5IGG A;  4FP5 D;  5J22 A;  5C0X G;  3SEB A;  3L3O C;  4IPG A;  1SE4 A;  2E2H H;  1S5C D;  3S2H H;  3AEV A;  1DCZ A;  1YHA A;  4QCL A;  1E22 A;  1IHZ A;  3M85 A;  3LGJ A;  4DR7 L;  3K0X A;  1JB3 A;  5JEA H;  4FVM A;  2VQF Q;  3DWQ A;  2Z1C A;  4WFN 3;  3TS0 A;  3ULL A;  1PH6 A;  3PF5 A;  1YEZ A;  2BDN A;  3NPP A;  4K8J A;  1JB7 A;  3VYU A;  4XQN A;  1FGU A;  1QIL A;  2F03 A;  4C3H H;  3K7A B;  2XRQ D;  5T1G A;  3S1M B;  2R7F A;  2ZTC A;  5FO7 B;  2AMC B;  2LXK A;  1ENA A;  3K5N A;  5C44 G;  1VQN A;  2JA8 H;  2YV5 A;  5LMN Q;  5EKL A;  2VY3 A;  2X6G A;  3VR4 A;  1PTO F;  4O1N A;  4ALP A;  3CCV A;  3QOJ A;  4JVZ A;  1TWF B;  3J80 c;  1ICW A;  1FJG Q;  2UUB L;  4AQY Q;  1EY5 A;  4Q0F A;  2KJX A;  3NXW A;  3ND9 A;  1JIC A;  4DAY A;  3A8I E;  1CHP D;  1E2Z A;  1WCM H;  3BVZ A;  2F52 A;  1SMY C;  3BS1 A;  2E2J B;  2QW7 A;  2F1M A;  2ZJQ A;  1KL9 A;  1YNX A;  3HKZ G;  4EVO A;  1DOM A;  1JOK A;  1TKW B;  2ZXO A;  4FNF A;  1MIU A;  2VQF L;  3EJI A;  1VQH A;  4DAP A;  4DV4 Q;  1N32 Q;  4JV5 L;  3A7A B;  1GUN A;  4FF1 A;  5JJK A;  2NZH A;  1K3R A;  1FVI A;  1W2B A;  5IP7 G;  4Q5V A;  4A3I G;  1VQF A; 
#chains in the Genus database with same CATH homology
 4RCN A;  3TDQ A;  3MXG A;  1A6X A;  4LK1 C;  4KY6 A;  1MSG A;  3D8G A;  5BN3 A;  3C3L A;  1SNO A;  1CM9 A;  2NTS A;  2WKC A;  1H9K A;  1ZYR C;  3K5L A;  1RF2 D;  2I46 A;  1H9R A;  1HA5 A;  2IX1 A;  1W6J A;  1RTN A;  2VXW A;  3R93 A;  1ZEQ X;  4K5W A;  1PFM A;  3KK7 A;  1Q3L A;  2R93 B;  2OXP A;  1MSH A;  4G7H C;  4IQZ A;  4B9W A;  4XYQ A;  1TU2 B;  4IUT A;  5C5M A;  1RD9 D;  5DAU A;  3DWP A;  1PRT B;  2WAQ B;  3ND8 A;  1KDC A;  2QEJ C;  5FK9 C;  2EPB A;  5M3F B;  3NBH A;  2FJ2 A;  1C8C A;  5KRU A;  3M4Y A;  4PMB A;  1H9S B;  2EJG C;  3FPP A;  3PUV A;  1BBX C;  5FLX E;  4I65 A;  1J8I A;  1V1P A;  1GHJ A;  1FR3 A;  3NSW A;  1XYI A;  4IFD G;  2K01 A;  2A6E D;  3OMC A;  5E4X A;  1JOQ A;  3SK6 A;  2D9U A;  5C4J B;  4RFB A;  3A8J E;  2MPM A;  3I3C A;  4TQU S;  2A6H D;  2K6A A;  2O4X A;  3TP8 A;  3Q6S A;  1STB A;  5DEH A;  4C3J B;  4OIJ A;  4CJ1 B;  4C56 C;  5IGC A;  4BA2 I;  1TS4 A;  1X3P A;  3K5O A;  3HOY B;  1E2W A;  3BYT B;  1HUN A;  1DD2 A;  2AQ3 B;  2NB0 A;  4C3I B;  1PMR A;  5A2Q E;  1KDA A;  3N52 A;  4K6D A;  3CKI B;  3K57 A;  1B4O A;  5CYU A;  3UI2 A;  4H7B A;  3PMF A;  1VDZ A;  1FGB D;  3BYY B;  1OXT A;  1STH A;  3AMU A;  3NUC A;  1S4Z A;  4ID6 A;  4LJZ C;  3PO2 B;  2Q8I B;  3JAM E;  1K8O A;  4A3I B;  2LY7 A;  4IUV A;  2GA4 B;  3Q24 A;  3VR5 A;  4KD3 A;  2EJF C;  3Q23 A;  1FYC A;  3C2P A;  2F0E A;  1M4V A;  3GD7 A;  2AWN A;  1WTP A;  1J9O A;  1EYA A;  4X3S A;  1MBY A;  3X3N A;  1SYE A;  2RVL A;  1QNU A;  1BF4 A;  4KKT A;  4ZRZ A;  1L0Y B;  3T51 B;  3S1Q B;  1DOK A;  4S3S A;  2TSS A;  2CW0 D;  5CBA E;  5C0X H;  1JR0 D;  1HFN A;  3GP7 A;  2HQE A;  1BCP B;  1YNN D;  4XYO A;  2L1B A;  3M4O B;  5C0X I;  5EJW A;  2R7Z B;  5KNC A;  2HCC A;  3MVV A;  4L8J A;  4BWG B;  4KKS A;  3GTM B;  2L0C A;  4C3H G;  3GTL B;  1A15 A;  3GQB A;  3VR2 A;  3S2D B;  2IW3 A;  4F87 A;  1EY9 A;  1VCI A;  5JPN C;  3MC0 B;  1EL0 A;  1TWA B;  3HOX B;  3MAQ A;  1HPC A;  1TWH B;  4C3J G;  4K14 A;  2JP1 A;  1YNJ C;  4RHR A;  5M5W B;  3CU7 A;  2Q8T A;  2WV6 D;  5JAV A;  3J81 L;  1GUO A;  1FD7 D;  1JWM D;  5LL6 X;  1Q90 A;  4EQN A;  4IZ8 A;  1DJR D;  5C6A A;  2F0J A;  4RGT A;  1Z7T A;  3N6R A;  1CHQ D;  2F0P A;  2SDF A;  2B2Y A;  2XWJ B;  2MHV A;  4A93 B;  1I4X A;  4M8A A;  4QF4 A;  4MHE A;  2G9D A;  1I6V C;  1B50 A;  5ELE A;  1G6Z A;  2A69 C;  4OHJ A;  4UAI A;  3I4L A;  1T5E A;  3JAM L;  2F0F A;  3G6J B;  3QOL A;  3C1E A;  5BN4 A;  4PV1 C;  5EGT A;  5JJZ A;  2A68 C;  1KDB A;  2JA6 B;  5FOB B;  3RZO B;  3W3A A;  1LT4 D;  3PUX A;  4J1M A;  5FO9 B;  4KN4 C;  3TME A;  3EVQ A;  4H44 C;  4WRD A;  1CZW A;  1YNJ D;  2PZU A;  3SDZ A;  4LAA A;  5I2X A;  5KGU A;  1GUT A;  3NQI A;  1G2S A;  4HR7 B;  3KBX A;  2ZT9 C;  3HP3 A;  4I7Z C;  4KJN A;  1R4P B;  3R3O A;  2IWH A;  4HCE A;  3X3M A;  5J1Z A;  4XQQ A;  2DY7 A;  4QIW B;  2J0T D;  1I4R A;  3M7G A;  3T4A C;  1Q1B A;  1A2U A;  4DU9 A;  3I4M B;  1JWU D;  2PNR C;  3OIP A;  3H09 A;  3BZD B;  4DA2 A;  4RGO S;  1OO9 B;  2NYZ D;  2VNU D;  2X69 A;  3J7A F;  4IAL A;  1STA A;  2B39 A;  2DNC A;  1TS5 A;  2HDM A;  3OHX C;  1BCP C;  1AW7 A;  4TSS A;  3S16 B;  5CV4 A;  5A35 A;  1RCV D;  1Y8P B;  1MGS A;  2KEE A;  2B2T A;  4LMQ D;  2VUM B;  4K5X A;  1B44 D;  2EOT A;  4RKL A;  1FNU A;  2A74 C;  1JCK B;  1QWY A;  3OW7 A;  1DM0 B;  4C3I G;  1D2B A;  3BDC A;  4DXF A;  2F0U A;  1HUM A;  3H94 A;  1O7Y A;  1JOO A;  2NVT B;  4HSP A;  2EYM A;  2F0S A;  4FF2 A;  3T16 A;  3D4W A;  2B2T C;  1PZI D;  1TVX A;  1U4L A;  4OGQ C;  3HEJ A;  2B2V A;  4BY1 B;  1PTO C;  1S5D D;  5FLX L;  1BXT A;  4K8I A;  2K5D A;  2QIL A;  2MUY A;  1VMP A;  2D62 A;  2DNE A;  3VA7 A;  5IGB A;  5CV9 A;  5ELB A;  3DWA A;  1DYQ A;  3CHB D;  2IX0 A;  2E2H B;  5EKK A;  3NWS A;  1F9Q A;  3I4N B;  2HUG A;  2KED A;  5LHY 1;  1SAP A;  3OWF A;  1ILP A;  4L63 B;  4IUU A;  2BCO A;  1MD2 D;  2A69 D;  3ONA B;  1O7Z A;  1SE3 A;  3QO2 A;  4V19 0;  2QDB A;  3D4D A;  3S2H B;  1HRJ A;  1B3A A;  4NKL A;  2JA5 B;  1SYB A;  4KKU A;  1PYW D;  3PUW A;  1JE4 A;  1SYF A;  2F0L A;  5ISR A;  1TS3 A;  1S5E D;  3FPU B;  1WTX A;  4X3U A;  1WTO A;  4ME5 A;  3K6O A;  4FXG C;  5CV5 A;  3DEP A;  4K2L A;  1I4G A;  2B63 B;  2R92 B;  3V2T A;  2VB2 X;  4C2M B;  1WCM B;  5G3L D;  2NVX B;  1I50 B;  1Q12 A;  3HZX A;  3MA2 B;  5IOC A;  5IGD A;  1XWE A;  4H0L C;  4K2K A;  5EPL A;  1EZ6 A;  3P7J A;  5K5P A;  4A3M B;  3NHH A;  1ZKO A;  2KOL A;  1O80 A;  2XVS A;  3BVM A;  1Y8N B;  1QJO A;  2ZXP A;  5ELD A;  3PO3 B;  1OXX K;  5E1F A;  4IN3 A;  1LT6 D;  2WB1 B;  5EPJ A;  2OEO A;  2Z4I A;  3NTK A;  1HTP A;  5C3W A;  1E2V A;  4ABN A;  1LTT D;  4NP5 A;  1D5X C;  3TBI B;  4MN3 A;  1PRT D;  2KQ3 A;  4HAE A;  1SJE D;  2G9H D;  2HCI A;  1C48 A;  2EXZ A;  1EY7 A;  5I4D A;  2NWG A;  1PTO B;  1STE A;  5TSS A;  3GTK B;  1NUC A;  1TII D;  4YIJ A;  2D5D A;  3E6Z X;  1M8A A;  4N9T A;  1B9M A;  1AEX A;  2J7Z A;  1TQO A;  2LFN A;  2QKI C;  2K05 A;  2JEA I;  1F77 A;  3RZD B;  3HOU B;  1YNN C;  1IL8 A;  2AWO A;  4BBR B;  1V1P B;  3RMH A;  1AFP A;  4F7X A;  1JOR A;  1GOZ A;  4G4K A;  5KEE A;  1LT3 D;  3PIP 3;  4IFD H;  3NWT A;  1ET9 A;  1I3Q B;  2XNA C;  1I4Q A;  5FO8 B;  1GHK A;  2PW7 A;  5JVG 3;  4AYB B;  2PCF B;  5DM7 3;  1LAB A;  1L0X B;  3I72 A;  5IIF A;  1WD0 A;  1JWS D;  2EYL A;  1TY0 A;  4QMG A;  3FMC A;  3QWN A;  1BCP F;  3FRP B;  3MZ5 A;  1IYU A;  1KLG D;  2CVR A;  4KJO A;  1S5B D;  4XDX A;  2M9V A;  2MP1 A;  2FHT A;  2Y0S B;  3D4R A;  2QCP X;  4CKC A;  2KUM A;  3DEO A;  2A6H C;  2VB3 X;  4KK7 A;  1SBB B;  2E74 C;  2B8F A;  2EVB A;  4ZKC B;  1D1K A;  5CV7 A;  5KYL A;  3DM1 A;  1F9S A;  1SE2 A;  5LL6 S;  3KLS A;  5M5X B;  3CRK C;  1F9R A;  2ICE C;  3BDO A;  1Y1V B;  4CBV A;  3TP6 A;  1NR4 A;  2IL8 A;  3I8Z A;  3GO5 A;  5I9O A;  5CMD A;  2EYJ A;  1AZQ A;  1HA6 A;  1GXD C;  3KBG A;  2ID0 A;  2SNM A;  3TSS A;  2B2U A;  1GUW A;  1HXY D;  2YYZ A;  2N55 A;  4WJW A;  4EGV A;  3I73 A;  1ET6 A;  1Q1E A;  2L55 A;  5EKI A;  2K32 A;  4OO1 I;  1LT5 D;  1SJH D;  4B08 A;  4KN7 C;  4IUQ A;  5C44 B;  3AU7 A;  3ITP A;  4CHT B;  3BDL A;  5C4X B;  3E0J A;  2C5C A;  1I6H B;  2PW5 A;  3BVG A;  2K5W A;  4ZUI A;  2RDF A;  5I6Y A;  3WOF A;  4XXE A;  2A5H A;  2LKV A;  4FXK C;  1VMC A;  4IUR A;  5CGK A;  2K04 A;  4C3H B;  5EQ0 A;  2E2D C;  1HFG A;  1WD1 A;  4F8M A;  2BA1 A;  2NTT A;  1JC7 A;  4R9W A;  2WP8 J;  2Z8L A;  1SNC A;  3MEH A;  1TR5 A;  2L12 A;  3WDN A;  3L7Z C;  1STG A;  4CJ0 B;  2OT2 A;  4O42 A;  3ZYY X;  1IYV A;  1EZ8 A;  1G29 1;  4PNY A;  3P20 A;  1HTL D;  1NR2 A;  4A3G B;  1TS2 A;  3D6W A;  5IGF A;  2K03 A;  2NN6 I;  2R61 A;  4CKE A;  5FKA C;  4DNR B;  4C1N I;  1A2T A;  1DZ1 A;  4M1U B;  1EOT A;  3DHQ A;  1EYC A;  1SSO A;  4J6H A;  5BN5 A;  2KVM A;  5KYI A;  4XT1 B;  1EEF D;  4XQJ A;  3ERQ A;  2K28 A;  1JQY D;  5M9O A;  4DFA A;  4XT3 B;  3OMG A;  4RKB A;  2X6L A;  2DY8 A;  3SK8 A;  4L6T B;  5IOD A;  1EFI D;  1RJT A;  1RKN A;  1TWC B;  2NZ1 D;  5M5Y B;  1ESR A;  4G57 A;  4HED A;  5A2Q L;  1BQQ T;  1SEB D;  3MFG A;  4OO1 G;  3D31 A;  1OXU A;  2F0N A;  3QB3 A;  2RQX A;  3VA5 A;  1D5Z C;  2F0Q A;  2NUC A;  1SMY D;  1R4Q B;  2E75 C;  2RSN A;  1XTC D;  3P75 A;  2DN8 A;  4KV6 A;  5JVH 3;  3D3R A;  4K6L A;  2JA8 B;  3ERO A;  4KHZ A;  2IPK D;  5IGE A;  4FXD A;  1F2L A;  4DGZ A;  3V05 A;  1HCZ A;  2F0G A;  4R8N A;  4RH6 A;  4EQP A;  4ULL A;  1HQM C;  2F3V A;  4NW2 A;  1EU4 A;  4V0B A;  3QG1 A;  2O5I C;  1B1Z A;  4KI0 A;  3IKJ A;  1PRT C;  2CHB D;  1H9M A;  1O78 A;  2M2L A;  4E6I A;  4N9P A;  1UNS A;  3FKI B;  4J8Q A;  1UEA B;  3LNN A;  1Z47 A;  1II3 A;  1EIH A;  2IJ0 A;  1ENF A;  1PZK D;  4OL7 A;  3NE5 B;  4OIK A;  1F2Z A;  4ZYS A;  2PZT A;  2L5T A;  3HOV B;  1A3T A;  2F0D A;  3MXU A;  2TMP A;  5IT9 L;  1CTM A;  4HTH A;  1D5M C;  2KHS A;  4PMC A;  1RDP D;  3PUY A;  4PQX A;  2RDG A;  3R2T A;  5D3I B;  4NDX A;  4RHS A;  2AQ2 B;  3W2D A;  5KIX A;  4KY5 A;  2RKS A;  2D2C C;  5ELC A;  2F0V A;  4C1N K;  1B53 A;  1CQV A;  2JEB I;  3V96 A;  1G91 A;  2O5J C;  1SNQ A;  2B8G A;  1ENC A;  2CW0 C;  4HN7 A;  4DAV A;  2EYH A;  4MIU A;  3H3V C;  5CV8 A;  4ZUJ A;  2K7V A;  1BR9 A;  3IL8 A;  4B9X A;  3I70 A;  3K0Y A;  2B2W A;  2F0K A;  4XTC S;  3RD4 A;  3OOC A;  1SNP A;  3HKZ B;  2Z4H A;  1I4H A;  3TN2 A;  1LTG D;  4HMJ A;  2NVQ B;  1QOH A;  5T1I A;  1CQF A;  3GTP B;  3O13 A;  2NBF A;  1EY4 A;  2YU9 B;  4WOR A;  2MGS A;  1TWG B;  4R8I A;  3J80 E;  5AFW A;  4DXG A;  4ZLT F;  1SNM A;  5EBC A;  3IFT A;  5COR A;  2A6E C;  1STN A;  1G2T A;  2EJM A;  1WTR A;  3FVQ A;  3GTO B;  4CKB A;  1LAC A;  5CBE E;  1EQV A;  1DON A;  1KLU D;  2F0T A;  2R3Z A;  3Q22 A;  1QNK A;  3HRZ C;  3SK4 A;  3PIO 3;  1NCV A;  1V8Q A;  1KTK A;  2WII B;  3VR3 A;  1EIG A;  2RDH A;  1PDQ A;  5KNB A;  4RCO A;  5JEA G;  2L4N A;  1ROD A;  3T53 B;  1K8M A;  4A3J B;  1UAP A;  3A7L A;  1U4R A;  4A3B B;  3MXP A;  1OXV A;  1V43 A;  4BA1 I;  3MXN A;  2SNS A;  1CT1 D;  1EY6 A;  3VYR A;  1PTO H;  3M7N A;  3NTH A;  2B2U C;  2BA0 A;  2ICI A;  1UUP A;  1U9R A;  1CZG A;  2AQ1 B;  2R6G A;  4RAU C;  4UDU C;  5K36 G;  4TRD A;  2JYO A;  1SFO B;  1FNW A;  2K1B A;  3QJY A;  4FO2 A;  2K5Q A;  2SEB D;  2RSO A;  2N88 A;  1CA5 A;  2OF1 A;  1A3U A;  3CQZ B;  2SOB A;  3H91 A;  4Z9C B;  1SDF A;  1BNZ A;  3EQL C;  2H1E A;  5M3M B;  2NN6 H;  1LTA D;  1F2Y A;  1NSN S;  3GV6 A;  4ODG A;  2NVY B;  2IX3 A;  1LV9 A;  3GV3 A;  3HS0 C;  3A56 A;  4P2C B;  2B2Y C;  2H4O A;  2BE5 D;  2C9O A;  3LX0 A;  3RLF A;  3RUZ A;  3S9W A;  2EY6 A;  3E5S A;  1BCP D;  1DXM A;  1IW7 D;  4G7Z C;  4QB4 A;  3GTQ B;  4DK0 A;  2XSC A;  1C4Q A;  5KND A;  1GUG A;  3BG3 A;  4FF4 A;  3EA6 A;  1CK1 A;  5JOB A;  3AB9 A;  4DF7 A;  3DUZ A;  4BBS B;  1ML0 D;  1HQR D;  3D6C A;  3NQT A;  4KY7 A;  3U9O A;  2KCN A;  2F0I A;  1PFB A;  1VF7 A;  4RGM A;  1H9J A;  5D65 A;  1A3V A;  2XRS D;  2A68 D;  2L11 A;  2RBM A;  3CRL C;  1EY0 A;  5COY A;  3R2I A;  1PFN A;  2ENB A;  1KNE A;  4RGN A;  2AUK A;  2E76 C;  2I07 B;  1GJX A;  2EY2 A;  5I2Y A;  2FMM A;  2F3W A;  1AN8 A;  1U4P A;  2EY5 A;  1PLF A;  2M00 A;  3L9A X;  5IT9 E;  2K33 A;  4G7O C;  1LLR D;  2ZXR A;  3K59 A;  4DK1 A;  3HOZ B;  1LTS D;  1MI2 A;  5K36 H;  1TT2 A;  2QF7 A;  3KLS X;  1VF5 C;  4ZKB B;  2XIW A;  4A3K B;  1QCB D;  4JK1 C;  5JPM C;  3A55 A;  1BOS A;  4XIG S;  3KF8 A;  1AP0 A;  1XXG A;  2LS0 1;  2EE1 A;  5C3X A;  1BDO A;  1X32 A;  5C4H A;  4H13 C;  4Y7N B;  2F0O A;  3KUP A;  4HCS A;  1SXT A;  3I91 A;  1KNA A;  1R9T B;  3S14 B;  1NAP A;  2JSO A;  2Q8R E;  1BO0 A;  2V4D A;  5E4W C;  3J7Y W;  5C0X J;  4ZK9 B;  1U4M A;  2WIN B;  2KEC A;  3HGB A;  3J7A V;  2EZV A;  2JA7 B;  3MWY W;  1EY8 A;  4ZQ3 A;  4GZY C;  4CJ2 C;  4FYD A;  1CFM A;  1B9N A;  2XN9 C;  1E0B A;  3Q0A A;  1OXS C;  2BDO A;  4ILW A;  2RA4 A;  1IW7 C;  3IFD A;  2PZW A;  4KD4 A;  4BS9 A;  1H9S A;  2EYO A;  5EBD A;  3URY A;  4OO1 H;  2CQA A;  3FEW X;  1PRT F;  1S5F D;  3GTJ B;  2BE5 C;  3SR1 A;  2KCC A;  1CI3 M;  1WTV A;  1I4P A;  2FMC A;  1EWC A;  1QG7 A;  2PMZ B;  1Z6H A;  3DMU A;  2J4X A;  1PZJ D;  1KAA A;  2AUJ D;  2F4I A;  2FFK B;  1SYC A;  3NBI A;  3SK5 A;  1EYD A;  5CC4 A;  4K5V A;  4RWS C;  5ELF A;  2PQE A;  3PV0 A;  1T5X D;  3DXJ C;  4X3T A;  2F0H A;  1K83 B;  4ZAI A;  3S1N B;  3KLR A;  1WTW A;  1BUV T;  4IUP A;  3S1R B;  3C46 A;  5I6W A;  3PUZ A;  4RA8 A;  2EDG A;  1Y8O B;  1D1I A;  1ILQ A;  3SXH A;  3OIQ A;  4BY7 B;  1IKL A;  4A3D B;  3HG9 A;  1PTO D;  3P1H A;  4X3K A;  5E3F A;  4DN4 M;  2E2I B;  4QUF A;  3J81 E;  1KAB A;  1WTQ A;  3OSO A;  3T56 B;  1LTI D;  2EYP A;  2WAC A;  5CR3 A;  3MFY A;  4A3F B;  1SYD A;  3MHB A;  1EWH A;  3MTS A;  5I9P A;  1ZYR D;  5C4Z A;  3K58 A;  1TY2 A;  1PXU A;  2O2L D;  3U9S A;  3NK9 A;  3NP8 A;  5D14 A;  1O7L A;  1RTO A;  1CA6 A;  5C3E B;  5DM6 3;  3VYT A;  1IKM A;  5JEA J;  2EYF A;  5C5L A;  3TP5 A;  1G8Z D;  1DOL A;  1EQT A;  1D6E C;  1W6K A;  1B2T A;  3C1F A;  4CGY B;  2LMC B;  2PYK A;  1EEI D;  5G3L F;  1ZXT A;  3OPO A;  3FDT A;  1ESF A;  2B2W C;  2L9H A;  3F2U A;  3K5M A;  2B2V C;  1XX8 A;  2IT1 A;  3TZD A;  3WOE A;  4F88 A;  5CV6 A;  4HSV A;  5J39 A;  3VYS A;  3S17 B;  3R8B A;  1Y1W B;  3H0G B;  1STY A;  3M3Y B;  1HHV A;  3HOW B;  4EQO A;  1QE6 A;  1EU3 A;  3G7L A;  4JBW A;  5NUC A;  4IUN A;  4QUC A;  2JXM B;  2MJ8 A;  2WKD A;  1QB5 D;  2F0W A;  2BOS A;  4IFD I;  3SE0 A;  3NTI A;  1LTR D;  2KA7 A;  3I90 A;  1V1O A;  3LWE A;  3TZU A;  1FNV A;  2HDL A;  3T13 A;  3A8K E;  3VR6 A;  3S15 B;  5D3D A;  4KHV A;  2FIN B;  4DNT B;  2EY1 A;  1WVL A;  3TP7 A;  1Q8I A;  4U67 3;  2XWB B;  4NMZ A;  2NN6 G;  2PPB C;  3IAY A;  3SVM A;  4FF3 A;  1RHP A;  4TKO B;  1Y69 U;  3LWU A;  3QIA A;  4IFD J;  1LO5 D;  4KMU C;  1AZP A;  4PMW A;  2PO4 A;  2A73 B;  3SHL A;  4U68 A;  1LTB D;  1ONL A;  4A3E B;  1SND A;  2F0M A;  1X3Q A;  5HUR A;  5DNF A;  3OWE B;  3H6M A;  1F2M A;  1F9P A;  1GUS A;  4HMI A;  5F2D A;  2JE6 I;  3A54 A;  5EPK A;  3J80 L;  3GTG B;  3EFX D;  4KTA A;  1SYG A;  5HGT A;  5IGG A;  4FP5 D;  5J22 A;  5C0X G;  3SEB A;  3L3O C;  1SE4 A;  1S5C D;  1DCZ A;  4QCL A;  1IHZ A;  3M85 A;  1JB3 A;  5JEA H;  4FVM A;  3DWQ A;  2Z1C A;  4WFN 3;  2BDN A;  3NPP A;  4K8J A;  3VYU A;  4XQN A;  2F03 A;  1QIL A;  3K7A B;  2XRQ D;  5T1G A;  3S1M B;  5FO7 B;  1ENA A;  3K5N A;  5EKL A;  2X6G A;  3VR4 A;  1PTO F;  4O1N A;  3QOJ A;  1TWF B;  1ICW A;  1EY5 A;  4Q0F A;  2KJX A;  3NXW A;  3ND9 A;  1JIC A;  4DAY A;  3A8I E;  1CHP D;  1E2Z A;  3BVZ A;  1SMY C;  3BS1 A;  2E2J B;  2F1M A;  4EVO A;  1DOM A;  1JOK A;  1TKW B;  2ZXO A;  4FNF A;  3EJI A;  4DAP A;  3A7A B;  1GUN A;  4FF1 A;  4Q5V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...