2RBMA

Crystal structure of staphylococcal nuclease variant delta+phs i72k at cryogenic temperature
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
130
structure length
130
Chain Sequence
KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKKEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS I72K at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Thermonuclease
total genus 36
structure length 130
sequence length 130
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2007-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2rbmA00
3NXWA 1KDBA 4K2KA 4LAAA 3NK9A 1EY5A 4F7XA 2F0OA 4H7BA 3MZ5A 1A3UA 1EY0A 2F3VA 1A2TA 1IHZA 2F0PA 1JOOA 3MXPA 4N9PA 4PMBA 3SK6A 5E1FA 2F0WA 2OEOA 3SHLA 3SR1A 5HURA 2F0IA 3MHBA 2PYKA 3HEJA 2ENBA 1KAAA 2EYOA 5CV9A 5EGTA 2F0EA 4DFAA 1EYAA 5KYLA 4KD3A 1F2YA 4IZ8A 3E5SA 3D8GA 4QF4A 3TP6A 3V2TA 3H6MA 2PZWA 1EY7A 2QDBA 3NHHA 4K8IA 5F2DA 5CC4A 1KABA 3MVVA 5C6AA 4NMZA 5C4HA 1SYFA 4QMGA 5CV6A 1SYEA 2EYPA 4N9TA 1SNCA 3OWFA 5IGCA 3D4DA 4K2LA 3BDLA 5J22A 2PZUA 1ENAA 4NKLA 2NUCA 3OMCA 2F0UA 4KD4A 4NP5A 3T13A 4PMCA 4KTAA 1STYA 2F0SA 1STNA 3R3OA 2EYMA 2SNSA 4KJOA 4S3SA 5IGEA 3S9WA 4G57A 1EY9A 5I6WA 1TT2A 1NUCA 1STHA 4J6HA 4K5WA 5JOBA 4PNYA 4EQPA 5IGGA 2EYJA 4HTHA 1SYCA 1SYBA 1EZ8A 4DGZA 2F0MA 2F0TA 3D6CA 1NSNS 2F0VA 3EROA 1STAA 4I65A 1SNOA 4DF7A 3PMFA 5ISRA 3TMEA 1F2MA 2F0QA 3NUCA 1AEXA 1ENCA 1SYDA 2PW7A 2F0KA 1STBA 2EY2A 3OSOA 4OL7A 4YIJA 1JORA 2EY5A 5KEEA 1EYCA 2RKSA 2EYHA 3P75A 1A3TA 5IIFA 4QB4A 2WACA 1II3A 2EXZA 3ITPA 4ID6A 3D4WA 4K5XA 5KYIA 4HMIA 4KY6A 1JOQA 5I9PA 4IUNA 3VA5A 5EKKA 4MIUA 4RKBA 5IODA 2EYFA 2KHSA 5C3XA 4WRDA 1TR5A 4RKLA 3SK8A 2PZTA 2OXPA 4ODGA 1TQOA 3DMUA 1EQVA 5IGDA 4ME5A 5CV8A 3C1EA 5IOCA 5I6YA 4ZUJA 4KV6A 1KDCA 1SNMA 2F0JA 3HZXA 4EVOA 1JOKA 2F0NA 2F0HA 2SNMA 4KJNA 5K5PA 1SYGA 3SK5A 1A3VA 1SNPA 4TRDA 3DHQA 4B9XA 4K8JA 2EY1A 1STGA 1A2UA 2RBMA 4J1MA 3P1HA 4EQNA 5KGUA 3OMGA 4IALA 4F8MA 5CV5A 3C1FA 3QB3A 5C3WA 3U9OA 5JAVA 3NQTA 1EZ6A 5CV4A 4WORA 5I9OA 3EVQA 1SNDA 1EY4A 2PQEA 1F2ZA 2F0LA 2OF1A 1EY6A 5C5MA 3TP5A 4B9WA 5M9OA 3T16A 5DEHA 4ZQ3A 3SXHA 1U9RA 5IGFA 5NUCA 4DU9A 5IGBA 3LX0A 1RKNA 3TP7A 3QOLA 5C4ZA 3ERQA 2F3WA 3SK4A 2F0GA 3EJIA 5CV7A 4ZUIA 2HQEA 4EQOA 5E3FA 2EY6A 4NDXA 5HGTA 4KY5A 3RUZA 1EYDA 2PW5A 3BDCA 5KRUA 5CGKA 5EKLA 4HMJA 5CR3A 2EYLA 2KQ3A 4KY7A 5J39A 2F0FA 2LKVA 4K5VA 4R8NA 4K14A 3MEHA 4KHVA 1KDAA 2SOBA 5C5LA 2F0DA 4K6DA 1EY8A 5J1ZA 3NP8A 3QOJA 5KIXA 1SNQA 5DAUA 2O4XA 4E6IA 3TP8A 2M00A 2RDFA
chains in the Genus database with same CATH superfamily
2R92H 2M9VA 1JWMD 2JSOA 1HZAA 2MJ8A 3BS1A 2QKIC 2GA4B 3GQBA 2CWPA 2UXDL 3M85A 5LMNL 1HUNA 3HEJA 1PA6A 1VQ9A 4A3KH 5IE8A 1UEAB 1YNND 5DM73 3VYRA 1VQ8A 2XWJB 1KABA 3BU2A 3EFXD 2EJMA 1SYFA 2HIVA 4N8X1 4KN4C 2BOSA 2IX3A 1J5EQ 1CA6A 4JYAQ 4ZCKA 3T13A 2N8NA 3DXJC 4LFCL 1X56A 1SAPA 4J6HA 3PIP3 4K5WA 4X6AH 2QF7A 2AQ1B 5IGGA 1ICWA 1LTLA 3I7FA 1SYCA 2KECA 4P2CB 1XWEA 3VR4A 2O2LD 1EFWA 4UAIA 1CT1D 2IX1A 2Q8IB 3IKJA 5A35A 2K5VA 1EYCA 1QUQA 2C5CA 3I70A 1E7ZA 1SXTA 3OYYA 1DXMA 3IRBA 4CKCA 2IHEA 4RKLA 3PQIA 1EQVA 1TY0A 3T1YQ 4OO1H 1CQVA 1UE7A 3OWEB 4PV1C 1HNZQ 4IFDH 4R4IA 3P1HA 4XQJA 3KLSA 3RLNA 1YNJC 4C3HG 3QB3A 5IWAL 3RR5A 4JW0A 4WORA 4UP8A 3NELA 1SNDA 2A74C 1YITA 1Y69U 1CK1A 3CQZB 4FVMA 3HOXB 4ZQ3A 4X62L 1XMOL 5IGBA 1YI2A 3CC7A 4LF6Q 1PTOH 1NCVA 3EJIA 4B08A 1PH6A 2TSSA 4OHJA 5HGTA 5FLMH 1LT6D 3L2PA 1XPUA 3S1QB 3J80E 3J7AV 2Z9HA 2VUMG 2UXDQ 4H13C 5LMNQ 2RF4A 3RNUA 2GVBA 3AMUA 2CH4A 1BVSA 2CCZA 2B2WC 5EPKA 1V8QA 1QZGA 2K50A 2LFNA 1A2TA 1VQ7A 4N9PA 1CSQA 4LMQD 3HOXH 4JI7Q 3C2PA 4DPGA 1VF5C 2UXBQ 2SEBD 1MSGA 5BR8Q 3QIAA 4B3SL 2X6LA 1BXTA 1JT8A 1B7YB 3RZOH 1F9SA 3S15H 2B2VC 2GVAA 2JA6B 2A19A 4JOIC 4K2LA 1ENAA 5E4WC 1CTMA 3PUWA 4DK0A 1Q1BA 3DM3A 4KLKA 2XTIA 3NWTA 1ZYRC 1TT2A 4KHZA 1HNWL 1V1PA 4HTHA 4LF8Q 3K8AA 1I4GA 1K8MA 4GOPC 3D6CA 4R4CA 1NSNS 2L11A 4DF7A 3VYUA 4LUOA 2IHFA 3MXNA 1OXUA 1ZEQX 1HJPA 2B63G 1VQJA 1Q86C 2RVLA 2EYFA 1O7IA 4CJ1B 2K1BA 4A93H 1CHPD 1X3QA 3NSWA 4QQBX 1CKOA 1L2FA 2MP1A 4IFDJ 2DJGC 1H9RA 1O7LA 1BNZA 2SNMA 1VQKA 4B9XA 1SNPA 1XTCD 1Z47A 3HS0C 2EY1A 5EBDA 2MPMA 2K05A 4OEMB 2PQEA 5M3MG 2K4KA 4FDBA 4HAEA 5NUCA 4A3BH 4M8AA 1D2BA 1JR0D 3K0YA 4CKEA 4OONA 1GOZA 1MKHA 2RDHA 3Q8DA 1A63A 2KJXA 4NB3A 4HIMA 1X9NA 1EFID 1S5FD 3EN2A 4K5VA 2B8GA 2CW0D 3FHWA 1WTHA 4CJ2C 1LT5D 1VMCA 2L15A 2IJ0A 4HJ8A 4JI7L 1E2ZA 1VQ6A 2L4NA 1KLGD 3LGJA 3L0OA 3CMAA 3NP8A 3PO2H 2K01A 4DV2L 1HNWQ 1R9TH 2VZAA 1KDBA 1L0WA 3NK9A 1EIYB 2IL8A 3BYTB 2NVYH 2F0PA 3I4NG 4CHTB 2L9HA 1PFSA 2XWBB 3CCVA 2CHBD 2OEOA 5FLMG 3HKSA 4IUQA 3K7AH 1FJGL 5IP9H 2DN8A 2Z0SA 1EYAA 2A69D 3C46A 4IZ8A 1SE2A 1PYBA 1LM0A 1S72A 1T5XD 1ML0D 3AB9A 5M5XH 2L5TA 2BE5D 1Q8IA 2V1CC 2X69A 2PMZB 3RN2A 4C3JH 4XDXA 2R6GA 4DR3L 4CDEC 1VQNA 3OMCA 4IJHA 3KBXA 1BBXC 1HTLD 1DM0B 4JI0L 1D5MC 1J6QA 1PH4A 3TZDA 1Q7YC 2B2TC 2R61A 5AJ3Q 3H94A 5ISRA 1K8OA 1LTTD 5CBEE 2B2YC 3PO3H 2NBFA 3S2HH 2EYHA 5T1IA 2N49A 3Q0AA 1GJXA 2BCOA 4AQYL 2XSCA 4X66Q 2NWGA 2PQAA 4O2DA 5COYA 5GADC 3CMEA 2ATWA 5M5WB 2MO0A 2YV5A 2Z6KA 4Y7NB 1PH8A 4EVOA 2JQOA 1B1ZA 1DOKA 1VQOA 4ZLTF 3OOCA 2D5DA 1HFNA 2DNEA 2F03A 3G7LA 4CKBA 2WV6D 5KNCA 2V4DA 1PTOF 2A68C 1R4PB 4JI6Q 2R93B 2KBNA 4DV0L 1Q12A 3FKIB 5IP9G 1PXUA 4IUTA 4KKTA 3H0GG 1M90C 4OO1I 2UUCL 2F52A 5FOBB 3VA7A 2WAQG 2VB3X 1CM9A 4LW1A 2SDFA 4LFBL 1RTOA 3M7NA 2G5DA 4FF3A 3F2CA 1TS3A 1EY8A 3OPOA 4E6IA 1ET9A 3GD7A 1Y1WG 1K73C 1WTXA 4ZKBB 3E0EA 3FPUB 5AJ3L 3MZ5A 3Q22A 4FYDA 1VQEA 4MNOA 2R7ZH 3W1BA 2UU9Q 2FMCA 1B70B 5JVG3 3VR2A 3M4PA 3S2HB 2BDNA 1BBWA 1SE3A 3G6JB 4AQYQ 3PF4A 1EY7A 4WJWA 4K8IA 4DV4L 2ZM6Q 1LYLA 1SYEA 2AMCB 4FO2A 2BDOA 4A3IB 5J3BA 2MO1A 3NENA 2JXMB 2PZUA 5C3EG 3HOVB 2NUCA 2K52A 2R7DA 1Y8PB 2HCIA 3A7AB 5I6WA 1STHA 4PNYA 3MC0B 3GTJH 3T4AC 1TY2A 2N88A 5LL6S 3SGIA 1JB7A 1D8LA 4UPAA 5A2QE 5AFWA 4IN3A 1GUSA 2RHQB 3U50C 3I56A 4IOAA 1LTID 3I4MH 1HTPA 4KY6A 2M2LA 1D7QA 1E22A 2AQ2B 4IQZA 1TQOA 1XNQL 3KLSX 3PF5A 4QUFA 1K83H 1I3QH 1IBKQ 1YHAA 3F2BA 1SNMA 1D5ZC 4DR4Q 4DV7L 1VS0A 3R93A 5K5PA 2E2IH 2QEXA 1UWVA 2RCFA 2E8GA 2YTYA 3NBIA 2NTSA 5GAEC 4FP5D 3TEHB 1X65A 5IY0A 5JAVA 3RLFA 3CW2C 3MXNB 4WJ4A 3HG9A 1J8IA 2UU9L 4KHPL 1BQQT 1EYGA 2K5WA 2DY8A 4GN5A 3HOWG 3NBHB 4A93G 2N55A 3TDQA 4KKUA 2Y0SG 1EWCA 2HCCA 4A3IG 3ND8A 1PDQA 1M8AA 3DWPA 2E2DC 2DY7A 4Q0FA 1JJGA 4K14A 1FVIA 2ZJRA 2NZHA 4IUPA 4RAUC 4N8FA 3ULLA 3FPPA 4QJFA 2PO4A 1YEZA 1B53A 2JA9A 1ASYA 1HA6A 1YNJD 1EY5A 1ASZA 2ZM6L 2KCCA 2YTXA 4IUUA 1F9PA 2J0TD 2WB1B 3PSIA 5EAYA 2EOTA 3K81C 4C3HB 5C3EH 5CV9A 1KAAA 4JVZA 3JAML 1K8GA 2BH8A 2Z6KC 1F2YA 1YNXA 1RCVD 3V2TA 2Q2HA 4NPSA 5IP7G 2CVRA 4A3LG 4DR5Q 1GUWA 1B9NA 5EPLA 4APVA 2K28A 1S5CD 5IGEA 2EYMA 5LHY1 1AZPA 4DK6C 1S40A 4LF5Q 2K5DA 4XQNA 3W2DA 1I4PA 3J81E 5LMUL 2E2JB 1ONLA 2N3SA 4X64Q 3HOYG 1PVOA 3NUCA 1SYDA 5A2QL 1EQQA 1VQ5A 1JICA 1EOTA 1IBLQ 5IYBG 3G71A 3TS0A 1II3A 4DR4L 3D4WA 5GQOA 5C44H 2VQFL 4DR7L 3ER0A 1I94L 1FGUA 5JEAG 1LTBD 5ELEA 3CP0A 3RN5A 1X55A 5KNDA 4TQUS 1JE5A 1Y1VB 4KHPQ 3M9BA 3J81j 1HR0Q 3DHQA 3IFDA 3PGZA 2RQXA 1HNXQ 2K7VA 4MZ9A 1KRTA 2RA4A 1CZGA 2Q8RE 3D31A 1EUJA 1EIHA 2I5HA 4H0LC 3MAQA 4U673 4A3DB 4LK1C 4LFAL 1G91A 4DU9A 1IYUA 4GLVB 1LTGD 3IAYA 1VQHA 2VUMB 1RDPD 2Z1CA 3CCUA 1CUKA 1WVLA 3RZOB 1VQFA 3RZDB 3HOYH 1E2VA 3A8IE 1HXYD 4JOIA 4FXGC 4A3JH 2EIFA 4IOCA 4IPCA 1X3PA 5C5LA 3K6OA 1IYJB 4OWWB 2YU9H 1SRUA 1SNQA 3P20A 3HOUB 1BO0A 1UE1A 4O42A 4K2KA 1NAPA 5LMUQ 2LS01 1PTOB 5M3MH 1JJ2A 1MIUA 5LL6X 1N33L 4C3JG 1IKLA 4U68A 2ALYB 5C44B 3SR1A 4JI4L 4DN4M 1XX8A 3S17H 4HJ9A 4TSSA 4R4OA 1X3EA 4BBRG 2QDBA 5F2DA 4JBKA 3TS2A 1YJNA 2ZT9C 4OIKA 4DR2L 1QVCA 4X64L 3CCRA 4JCVE 3W3AA 2ZTDA 5BN3A 4A3KG 4B3TL 1PRTC 3A74A 3CCQA 5CBAE 4CDDC 1E0BA 2TMPA 2R92G 3LWEA 1QWYA 1ZYRD 1I94Q 1DGSA 2F0TA 1A15A 1WTVA 1I4RA 1L1OB 3E0JA 3GDEA 2WKCA 4A3MG 1UAPA 4F8MA 4B3RL 1ENCA 2PW7A 2F0KA 5M5WH 4YIJA 3VYTA 3KJOA 2WACA 1EOVA 1G6PA 1DOLA 5JJLA 3GTGB 3FMCA 5ELNA 1K28A 1ILPA 4GNXA 4QY7A 1IKMA 1FD7D 4L6TB 1YHBA 4JI8L 4IFDI 2AQ3B 4A3GH 2ES2A 1CKNB 4NXNL 3A55A 4LFAQ 2OT2A 2IWHA 2F0JA 3FVQA 4IPHA 4KJNA 4EGVA 3SK5A 1A3VA 1L0XB 4K8JA 1XMQL 2JEBI 2AUJD 1SLJA 3I4MG 4XTCS 4DNIA 3KLWA 1K83B 1QCBD 5D65A 2Q8TA 1I4QA 1G6ZA 4OELB 3BZCA 2QA4A 4R1JA 4RGTA 4H02A 2EY6A 3R2TA 4NDXA 3J80i 2KQ3A 1N33Q 1WCMG 4I7ZC 3A5ZB 4R8NA 3GTOB 1MHWC 1H9SB 4DUZQ 4UP9A 3VR6A 2EQSA 4B3TQ 3G4SA 4RGMA 3VR5A 3J80c 4J8QA 2F0OA 2AHOB 3PO2B 1R4QB 1JOOA 4BY7H 3ERSX 2UXCL 4BA1I 1HUMA 4FXKC 2PYKA 2HIXA 1BR9A 1TWCH 2Y0SE 4A3CG 4C2MB 2OQKA 4A3FH 1I50B 4Z9CB 4A4IA 3KF8B 1Z6HA 1PRTD 1DZ1A 2B2WA 4C3IB 5CC4A 1B3AA 2BH2A 1NNXA 4QMGA 2EYPA 3EQLC 3M7GA 4JI8Q 3AYHB 4QL5A 1ZXTA 2OTJA 2MQHA 2CWAA 1KC8C 3S16B 4YWLA 2K75A 4A75A 1Q1EA 2SNSA 1Q82C 5IT9L 4C56C 1AH9A 2EYJA 1K9MC 3GTKH 3F8TA 1EEID 5I2YA 1NMGA 5M3FB 5C0XG 3TQYA 4EQ5A 3D4RA 4GOPB 4YY3Q 4NXNQ 4X65Q 1NTGA 4QCLA 4UP7A 1O78A 2VW9A 2XNAC 3GTLB 4A76A 2HDMA 4FF1A 4O0AA 2KA7A 2ZJPA 4KN7C 2CQOA 3C1EA 4AYBE 4ZYSA 5IOCA 4A3GG 4DV1L 2H1EA 2RSOA 4OX9L 3NTIA 3HZXA 1MD2D 2G9HD 1WD1A 1HRJA 3A0JA 1FR3A 1KRSA 1STGA 1I5FA 3J7AF 5C0XJ 2WB1E 2JA7G 3UE0A 4IFDG 1K3BC 1EZ6A 1PZJD 3EVQA 2FINB 1EY6A 1EL0A 4KK7A 2B29A 1TWGH 2Z6BA 1CA5A 1VQMA 3SVMA 2F3WA 4DV3L 2R93H 4J15A 3HKZG 2IW3A 1RD9D 5EKLA 1SMYC 2EYLA 2VL6A 2ZTCA 3MXUA 3EBEA 4DAVA 3L9AX 1PH5A 4C1NI 1UE6A 3MEHA 4DXGA 3H91A 5CMDA 3S14B 2K6AA 3PO3B 3CAMA 1LTAD 2Z4HA 2WIIB 1D1IA 1KLUD 4XT3B 1LV9A 4XYOA 3D3RA 5D3IB 4RCNA 2F3VA 3SK6A 1TU2B 4K6LA 1VQCA 1ICFB 3NWSA 4A3DH 1BCPC 1SSOA 2D9UA 3MHBA 1Y8NB 3J81c 4JYAL 1SE8A 2F0EA 1O7YA 3E5SA 2A6ED 1VDZA 1UEBA 4X3SA 1GUOA 3H6MA 4C3JB 3RZDH 4XXEA 1G2TA 2KCNA 4RGOS 1I6HH 4JI2Q 3IFTA 4HCSA 2JA5B 4NKLA 1EWHA 4RHRA 4GKKL 4NP5A 3K5OA 3RMHA 1SFOH 4P71A 1G2SA 4EQPA 2E5LL 2NVYB 2LXKA 2PMZE 1U4LA 1JWSD 2ZXPA 1AW7A 2EDGA 4DGZA 1ESFA 3EROA 1V1QA 1H9KA 3F1ZA 3S24A 3TMEA 2XIWA 3BYYB 3S1NH 1KNEA 3QO2A 1JMCA 2E75C 4HJAA 1DCZA 3M3YB 4DXFA 3GTQB 1JOQA 3KOJA 1H95A 4YCVA 1S5DD 5IWAQ 2A69C 1VQPA 2NTTA 2NZ1D 3K7UC 3J7YW 1TWFB 1KXLA 2FHTA 4RWSC 3CC2A 4HJ5A 1LTSD 1PYSB 2NN6G 2R3ZA 2UUAQ 2JA6G 1G291 3PIO3 3ZJYC 2ZTEA 1BOSA 3M4OB 3ULPA 5KGUA 3JAME 2MNAA 5CV5A 3PIPA 1Y8OB 3M4OH 2A6HC 1EQTA 4PZ6A 4B9WA 4X3UA 1XNRL 2B63H 1U9RA 1PH7A 2HHHL 5C4ZA 4RHSA 4XT1B 1PZID 1JJCB 5FO8B 1V43A 5CV7A 3H3VH 3MXGA 1LABA 1EYDA 2KENA 2NVTB 2FMMA 1SROA 1WTWA 4A3KB 1F9QA 1V1PB 3M3YH 3NE5B 1GHKA 2PI2A 1IW7D 4FF2A 3VYSA 3N6RA 1HH2P 2B39A 1NY4A 4DR1Q 4A3EH 4L5SA 4FXDA 2K5NA 4JI5L 3RLOA 1N32L 2B63B 3GTPB 4DV5L 3A8KE 1C48A 3T1HL 1VQLA 1PH2A 3GV6A 5C4XG 2A6HD 4LF8L 3CCLA 1KD1C 4LF7Q 1L0YB 4X3TA 1RODA 1HZ9A 1DOMA 1TWAB 4KD4A 1MSHA 3EIVA 4MTKA 3K5NA 4KTAA 2UUBL 1STNA 2D2CC 3G48A 4G57A 1QUQB 5C4XH 2JA5H 1PFBA 1K0SA 3IL8A 2C9OA 1CHQD 1QJOA 2K5QA 5M3MB 1SYBA 2JA6H 1QVGA 1RHPA 4HIDA 3S1NB 3NEMA 3H09A 1XNRQ 2HD3A 1YHQA 2NVQB 1EIGA 1I4XA 1STBA 2EY2A 3DWQA 4BY1B 2QILA 2ZXRA 3J80L 3BDOA 4QB4A 3M4YA 5ELOA 1BCPB 2ZXOA 2B2TA 3QJYA 5C3XA 3UDXA 3I4MB 2PZTA 4P72A 4UHVA 3X3NA 3CXCA 3I90A 2K04A 2Z8LA 4ME5A 4ZUJA 1KDCA 4A3MH 1EU4A 1IBML 1GKHA 2QCPX 2RHSB 2RBMA 1VQIA 4LUZA 4EQNA 4IALA 1TWHB 4JI5Q 1E1TA 1WTPA 2WB1G 1B50A 1WCMH 2BE5C 1TXYA 2H5XA 2A6EC 4V190 3HRZC 4JBMA 5FJ8G 2VXWA 5EKIA 1KTKA 1CKNA 4WJ3M 2BA1A 4BBSG 2XN9C 3BG3A 1JCKB 1WD0A 1U0LA 1G51A 4HMJA 4OIJA 1WOCA 2L1BA 2PCFB 3R2IA 1U4MA 2HT1A 1HHVA 1A8VA 3V96A 4HCEA 1D1KA 5JPMC 1VQAA 4BA2I 2UUBQ 1RIPA 1IBKL 4PZ7A 4DUYQ 1VQGA 4DV7Q 2EZVA 3TP8A 4BWGB 2RDFA 3FKIH 2DGYA 1B8AA 4LF7L 1A3UA 1QE6A 4PMBA 1LACA 5E1FA 4DR3Q 1ET6A 3HOZH 2EYOA 3S16H 1KAWA 1A6XA 1LTRD 4QF4A 2VB2X 3I72A 5FKAC 2I07B 3X3MA 3UE1A 1RJTA 4XIGS 1NE3A 5ELCA 5M3FH 5GROA 5C6AA 1LT3D 4C3IH 2E2HB 4FNFA 1A0IA 1SNCA 3KF6B 4DR6L 4A3JG 3PO3G 2EE1A 2F0UA 3VR3A 3K59A 2F0SA 1HZCA 3ICEA 3AFQA 3N52A 1EY9A 2GN5A 3HKZE 3A5UA 1IYVA 4G7HC 2ASBA 3HOWB 3KFUA 1CZWA 2D0OA 3STBC 1F2MA 3OSOA 4L5TA 2H4OA 5KEEA 1LO5D 4BBRH 1TKWB 3LNNA 2PNRC 1VQDA 3G6EA 3ITPA 4O1NA 3K0XA 4IUNA 3GO5A 5C4XB 4MIUA 3CKIB 1L1OC 4ZAIA 1EU3A 1PTOC 3E9IA 5JPNC 3S1RH 1SEBD 1WTQA 3KK7A 1IL2A 1AP0A 1FNUA 3MA2B 1JOKA 1S5ED 3MWYW 3DEPA 4LF5L 2UUCQ 1TWCB 3KYHC 3K5MA 4CJ0B 3U4ZA 2BA0A 2R7FA 5I9OA 1HQMC 2PI2E 2WINB 2F0LA 4OWTB 3RD4A 2X6GA 3T16A 1E3PA 4ABNA 1I3QB 1E24A 2KOLA 3ERQA 3SK4A 3K58A 1HNZL 1VQBA 2VQEL 4IUVA 5M5XB 4A3FG 1NR2A 3GTGH 1QB5D 2F0FA 3AQQA 3GTPH 2VNUD 3A8JE 5JVH3 1GVPA 4KHVA 3QWNA 2YYZA 4X62Q 1XMOQ 1NBWA 4IPDA 2I5LX 1OTCA 1QNKA 5JEAJ 4LF6L 3DUZA 4X3KA 1HR0L 2JE6I 3CRLC 3DEOA 5DAUA 1Z9FA 4A3GB 3I4LA 1BBUA 2OCEA 3M4QA 3K5LA 4F7XA 3KF6A 4H7BA 4HSVA 4G7OC 1F2LA 4GKJQ 3CPFA 2KEDA 5JEAH 1N36L 2F0IA 1M4VA 1NMFA 3KLRA 4PQXA 3STBD 1GXDC 3WOFA 3URYA 1W6JA 3DLLA 3GV3A 2EJFC 3I4OA 1AE2A 1HFGA 2E2HH 3OW7A 3J7ZC 3NHHA 2CH4W 3JAMi 1P8LA 3BZKA 1HZBA 4HN7A 4GNXC 4RMFA 3BVGA 3K57A 3D4DA 4PMWA 5JJZA 2XVSA 2UXBL 5ELBA 5BR8L 1STYA 3R3OA 1PH3A 1U4PA 4KJOA 4KKSA 2DNCA 4LNQA 3SEBA 1FGBD 2WFWA 3QR8A 1TS5A 4C1NK 3F2DA 2L55A 1W2BA 1UUPA 1XNQQ 4FF4A 3QG1A 1FL0A 1S4ZA 5IP7H 1Q46A 4A93B 2FFKB 1LT4D 4K5XA 5GAHC 5IODA 4LJZC 1SDFA 2K14A 4LUVA 1TR5A 3SK8A 2HQLA 4P75A 1BDOA 2KEEA 2MFIA 1PH1A 2Q2IA 1WTOA 2O5JC 3OIPA 1PH9A 2NN6I 5GAGC 4K0KQ 3MFGA 5EJWA 2I46A 1A2UA 5L37A 3I73A 2B2YA 4HR7B 1P16A 4GKJL 1F9RA 1O7ZA 5C5MA 1PRTB 1Q81C 3TP5A 2VUMH 1Y1VH 1TS2A 3Q24A 3HOVG 1BCPF 3EA6A 3I55A 1J9OA 5I2XA 4AH6A 5E4XA 4KY5A 2I0QA 4G4KA 3PV0A 1PRTF 1MI2A 3WOEA 2LKVA 3BJUA 2JA8H 1N36Q 3PUVA 3C3LA 5EPJA 4YHHQ 4RFBA 4LFCQ 1EQRA 3QOJA 1EEFD 4GLAC 2DJFC 3OIQA 4GN4B 4RH6A 3MXPA 5EKKA 3R8BA 3FDTA 3SHLA 1WJJA 3CQZH 2PNHA 1H9JA 4Y52H 3FRPB 4MHEA 3CF5A 1C8CA 1UNSA 2F4VQ 3TP6A 2RSNA 5G3LD 2CFMA 1TIID 1GUTA 2PZWA 1IXRA 4F87A 5CV6A 5FO7B 4R4QA 1XPRA 3TN2A 1FJGQ 4DNTB 3UI2A 1SE4A 3I8ZA 1E1OA 1B4OA 1CSPA 1IBLL 1TWAH 1YZ6A 1PHJA 5JOBA 5BN4A 2EVBA 2F3IA 1B2TA 1DJRD 2NVXB 3AU7A 1STAA 2O5IC 2DUDA 2CQAA 2UXCQ 5DM63 3CCEA 5T1GA 3P75A 5IIFA 2JYOA 2EXZA 3S2DH 1D6EC 2JN4A 1AE3A 4HMIA 4ZKCB 4K0KL 3GTKB 3VA5A 1YNNC 4RKBA 4A3EB 5C44G 4JI3Q 3WDNA 1NR4A 5I6YA 4KV6A 3F2UA 4DV6L 2F0HA 4KI0A 4X66L 4J1MA 5IYCH 1LUZA 1Q8KA 4RGNA 1Q3LA 2JJQA 5M3FG 1EY4A 5H1SE 1F2ZA 4QGUA 1IW7C 4BY7B 5DEHA 2QW7A 4YHHL 1FNWA 3QOLA 4DK1A 4GLXA 2Q2TA 4B3SQ 2R92B 3FEWX 2F0GA 1KL9A 3JC66 2B3GA 3CRKC 3KF8A 3A54A 3E3XA 5E3FA 1E2WA 2OWOA 5C0XI 3BDCA 2Z4IA 1I50H 3J81i 5CR3A 4JI6L 3WWVA 3GTQH 4HEDA 1C9OA 1Y14B 1QNUA 3HP3A 4DV1Q 2F0DA 4K6DA 4L63B 5J1ZA 1FYCA 5M5YH 3TREA 4OWXB 2HUGA 5FO9B 3CC4A 2F4VL 1PFMA 1Y1VG 1PYWD 3NXWA 4G7ZC 3H3VI 1EY0A 3NTHA 1IHZA 1N9WA 2B2UC 2LY7A 3TBIB 5C0XH 5CORA 4DR2Q 3O13A 3T51B 4LFBQ 1K3RA 3L7ZC 3I4NH 3CHBD 4B3ML 4IURA 1BF4A 3GTOH 1WI5A 4JC0A 4BY1G 5KYLA 4KD3A 5FJ8H 4HIKA 4A3IH 1EIFA 1H9MA 1I6HB 5DLQE 2FJ2A 4NMZA 4V0BA 2AWNA 4JI3L 4YWMA 2LXJA 4L5QA 3GTJB 2JA7H 3BDLA 1HPCA 3S1MH 5FK9C 2A8VA 4PMCA 4DV6Q 5EQ0A 1XYIA 1TVXA 5K36H 4UY8C 2A73B 1WTRA 2A5HA 5IYDH 4DV4Q 2KHIA 1CI3M 3CCMA 4BBRB 3H0GB 3W5OA 4F88A 3SDZA 1QOHA 3MFYA 2EY5A 4JPBW 2JA8G 4ID6A 5KYIA 2K5HA 5I9PA 3PUYA 4HSPA 1YIJA 1IZ6A 3E9HA 2E74C 2B2VA 1MBYA 4LF9Q 1EWIA 1JC7A 3HOVH 2KCTA 4BS9A 1TWGB 2JA5G 4POGA 1SBBB 4PG3A 1GHJA 4DV2Q 1PFNA 1D5XC 4R8IA 4PZ8A 1PV4A 1VMPA 1W3SA 4IO9A 2MUYA 5CV4A 4HIOA 1OXSC 3LWUA 3J7A5 4JV5L 4JK1C 3I91A 4GN3B 4IPGA 4P74A 3UDIA 3VDYA 3KDFA 1RF2D 3LX0A 1RKNA 1PZKD 4RA8A 3TP7A 5FLXL 4DNRB 1OXVA 1RL2A 4A3CH 4AYBG 4LF4Q 4R4TA 1H9SA 3A7LA 1SMXA 2PW5A 1PMRA 5CGKA 2YU9B 1B9MA 1M1KC 2AKWB 5IYDG 4KY7A 1IL8A 4A3JB 4A3MB 4B3MQ 3V05A 4JI0Q 4CGYB 2NZOA 2UUAL 5E7NA 4YCWA 4MTNA 2KHJA 1X3GA 1ENFA 2IX0A 1ESRA 2HDLA 5HURA 5IT9c 4ILWA 2EJGC 2C35B 1X32A 1XPOA 2RCNA 4QIWB 2PQAB 2JA8B 2ENBA 3HOUG 4DAMA 5EGTA 4DA2A 2F4IA 2HHHQ 4JBJA 1TWHH 2JA7B 1N34Q 1PLFA 1Z7TA 4RG1A 3HOYB 3H0GH 4XQQA 1XXGA 3ONAB 2VY3A 4LF9L 3OWFA 5IGCA 4CBVA 4C2MH 4A3FB 3ZYYX 3KDFB 1QZHA 5ELDA 4X65L 4AYBB 2ICEC 1WFQA 2NYZD 2NN6H 4DAYB 2WAQE 3MEFA 3S1MB 3TZUA 2WAQB 2Q2UA 5DNFA 2G9DA 3AEVA 3DWAA 1UE5A 4I65A 4ZK9B 4GS3A 4JV5Q 4DR5L 1SJHD 5M5YB 5FLXc 1N32Q 4NW2A 1DYQA 2RKSA 4DV0Q 4M1UB 1A3TA 1DONA 3W1GA 1Y1WH 1QILA 5IT9E 1KIXA 1HQRD 4GZYC 2PPBC 5D14A 4CDCC 3HOXG 2E76C 1C4QA 3OTOL 1XTDA 3U58A 5IGDA 1SJED 1TS4A 2B2UA 4BY1H 3PCOB 1Q90A 3H3VC 2L12A 3BVZA 5BN5A 4A3BB 5ELFA 2I5MX 1V1OA 5I4DA 4H44C 2E2JH 4RCOA 3D0FA 4DV3Q 3GP7A 3I3CA 4LF4L 1ILQA 3Q23A 2NVTH 4GNXB 3U9OA 1BUVT 2ID0A 3CPWA 2K03A 3K7AB 1U4RA 1CKMA 2XRSD 2NB0A 1G8ZD 1DD2A 1N34L 2WKDA 3K80C 1BCPD 1R9TB 4EQOA 2EXDA 1V9PA 1N8RC 4ME3A 3NTKA 5KRUA 3UDGA 4CDFC 5J39A 3S2DB 5C3EB 1VCIA 4L8JA 4C3HH 5HY6A 2SOBA 3U9SA 4TVAB 5D3DA 1C0AA 1BKBA 2KUMA 4BBSH 2AWOA 4HJ7A 1IBMQ 2O4XA 5IYBH 2K32A 4LAAA 5FLXE 5IYCG 1KHIA 4C3IG 3PUXA 1OXXK 3CD6A 4JI2L 3OW2A 2F0WA 2LMCB 1JE4A 4I7AA 1X54A 2R93G 3E6ZX 4DFAA 4GKKQ 1RTNA 5C4JH 3NPPA 4KMUC 2E5LQ 2WP8J 5G3LF 3NBHA 2NVXH 3MVVA 1YBYA 3OTOQ 3J81L 4A3BG 1YJWA 4JBWA 5J22A 1TWFH 2RDGA 3HOZG 4DUYL 4A3DG 1NUCA 1AFPA 1K0RA 3B6YA 3FKIG 2EPBA 2E2IB 1EZ8A 3S15B 3DM1A 2F0VA 1B44D 1W6KA 1SNOA 1GUGA 3PMFA 1VF7A 4LWCA 4Q5VA 1AN8A 1YJ9A 1AEXA 1HCZA 1JORA 1S3OA 4JI1Q 3S17B 2QGQA 4R9WA 1CFMA 2QEJC 3BZDB 3S1RB 2OTLA 4YWKA 4OGQC 2Y0SB 3PO2G 2D0PA 3BVMA 2KHSA 4DAPA 1SFOB 3KJPA 2VS1A 3SE0A 1Y1WB 2JEAI 2OXPA 4ODGA 3DMUA 4EX5A 4DR6Q 3HFZB 4B3RQ 3HOUH 5CV8A 1GM5A 5CYUA 2D62A 3TSSA 1JQYD 1SMYD 3ND9A 2L0CA 1SYGA 3HOWH 4TRDA 5KNBA 1MGSA 3OMGA 3S1QH 4WFN3 5C3WA 3C1FA 4A3LH 4OXPA 4DAYA 2OF1A 3P7JA 2FXQA 5TSSA 2CW0C 5IGFA 2R7ZB 4TKOB 4JG2A 1S5BD 2ZJQA 4DKAC 3KBGA 1XMQQ 4ZUIA 2HQEA 1QG7A 1MJEA 3CCSA 1OO9B 2A1AA 1SR3A 3MTSA 3H15A 1GUNA 3S14H 4DR1L 3L3OC 1MJCA 2OQ0A 3HOZB 1KDAA 2QDLA 2IT1A 1I4HA 5LMNW 1PTOD 4DV5Q 1A62A 3A56A 1X6OA 4NXMQ 4ZRZA 3T1HQ 2P5ZX 1HA5A 1WYDA 1JWUD 4POFA 4BXXH 4MN3A 4DUZL 1VQ4A 2ICIA 1XJVA 2VQFQ 3D8GA 4DR7Q 2IPKD 1NJIC 4L5RC 2VQEQ 1B3QA 3UDFA 5C4HA 4A3EG 4N9TA 1F77A 1QVFA 1T5EA 5C4JB 1KQSA 3JAMc 2LSSA 1ZKOA 4S3SA 4JI1L 1T9HA 3PUZA 4DK3C 3S9WA 1WCMB 3NQIA 3OHXC 3GTLH 4BY7G 5JJKA 1HNXL 3D6WA 2MGSA 1STEA 2F0MA 3FP9A 2R7ZG 4BBSB 4YCUA 3Q6SA 2F0QA 4OL7A 1CQFA 4Y7NH 4OO1G 4XYQA 3HKZB 1AZQA 3HGBA 4ULLA 2JP1A 3T56B 4QIWE 4WRDA 2J7ZA 2KCMA 4AIMA 2N78A 4YY3L 2JK8A 4BXXG 1GO3E 1I6VC 1FNVA 2NVQH 1J5EL 1HR0W 1U5KA 1X3FA 2F0NA 2XRQD 1KNAA 3ULJA 4ALPA 3KUPA 5JJIA 3CCJA 2IY5B 3NQTA 3T1YL 1SN8A 3PIOA 2AUKA 3I4NB 5M9OA 1L1OA 4JI4Q 2A68D 3SXHA 2F1MA 2CKZB 4OX9Q 3U4VA 2K33A 3T53B 3TRZA 1K8AC 2XGTA 3I2ZA 4NXML 2YTVA 4GOPA 3GTMH 5EBCA 4QUCA 1OXTA 5K36G 2MHVA 3RUZA 5HGQA 4UDUC 1YVCA 3CU7A 3AFPA 2J4XA 1O80A 1GD7A 1LLRD 1JB3A 4IJLA 5KIXA 4P73A 1C7YA 2B8FA 3GTMB 2KVMA 2M00A
chains in the Genus database with same CATH topology
2M9VA 1JWMD 2JSOA 2MJ8A 3BS1A 2QKIC 2GA4B 3GQBA 3M85A 1HUNA 3HEJA 1UEAB 1YNND 5DM73 3VYRA 2XWJB 1KABA 3EFXD 2EJMA 1SYFA 2IX3A 4KN4C 2BOSA 1CA6A 3T13A 3DXJC 1SAPA 4J6HA 3PIP3 4K5WA 2QF7A 2AQ1B 5IGGA 1ICWA 1SYCA 2KECA 4P2CB 1XWEA 3VR4A 2O2LD 4UAIA 1CT1D 2IX1A 2Q8IB 3IKJA 5A35A 1EYCA 2C5CA 3I70A 1SXTA 1DXMA 4CKCA 4RKLA 1EQVA 1TY0A 4OO1H 1CQVA 3OWEB 4PV1C 4IFDH 3P1HA 4XQJA 3KLSA 1YNJC 4C3HG 3QB3A 4WORA 1SNDA 2A74C 1Y69U 1CK1A 3CQZB 4FVMA 3HOXB 4ZQ3A 5IGBA 1PTOH 1NCVA 3EJIA 4B08A 2TSSA 4OHJA 5HGTA 1LT6D 3S1QB 3J80E 3J7AV 4H13C 3AMUA 2B2WC 5EPKA 1V8QA 2LFNA 1A2TA 4N9PA 4LMQD 3C2PA 1VF5C 2SEBD 1MSGA 3QIAA 2X6LA 1BXTA 1F9SA 2B2VC 2JA6B 4K2LA 1ENAA 5E4WC 1CTMA 3PUWA 4DK0A 1Q1BA 3NWTA 1ZYRC 1TT2A 4KHZA 1V1PA 4HTHA 1I4GA 1K8MA 3D6CA 1NSNS 2L11A 4DF7A 3VYUA 3MXNA 1OXUA 1ZEQX 2M00A 2RVLA 2EYFA 4CJ1B 2K1BA 1CHPD 1X3QA 3NSWA 4IFDJ 2MP1A 1H9RA 1O7LA 1BNZA 2SNMA 4B9XA 1SNPA 1XTCD 1Z47A 3HS0C 2EY1A 5EBDA 2MPMA 2K05A 2PQEA 4HAEA 5NUCA 4M8AA 1D2BA 1JR0D 3K0YA 4CKEA 1GOZA 2RDHA 2KJXA 1EFID 1S5FD 4K5VA 2B8GA 4CJ2C 2CW0D 1LT5D 1VMCA 2IJ0A 1E2ZA 2L4NA 1KLGD 3NP8A 2K01A 1KDBA 3NK9A 2IL8A 3BYTB 2F0PA 4CHTB 2L9HA 2XWBB 2CHBD 2OEOA 4IUQA 2DN8A 1EYAA 2A69D 3C46A 4IZ8A 1SE2A 1T5XD 1ML0D 3AB9A 2L5TA 2BE5D 1Q8IA 2X69A 2PMZB 4XDXA 2R6GA 3OMCA 3KBXA 1BBXC 1HTLD 1DM0B 1D5MC 3TZDA 2B2TC 2R61A 3H94A 5ISRA 1K8OA 1LTTD 5CBEE 2B2YC 2NBFA 2EYHA 5T1IA 3Q0AA 1GJXA 2BCOA 2XSCA 2NWGA 5COYA 5M5WB 4Y7NB 4EVOA 1B1ZA 1DOKA 4ZLTF 3OOCA 2D5DA 1HFNA 2DNEA 2F03A 3G7LA 4CKBA 2WV6D 5KNCA 2V4DA 1PTOF 2A68C 1R4PB 2R93B 1Q12A 3FKIB 1PXUA 4IUTA 4KKTA 4OO1I 5FOBB 3VA7A 2VB3X 1CM9A 2SDFA 1RTOA 3M7NA 4FF3A 1TS3A 1EY8A 3OPOA 4E6IA 1ET9A 3GD7A 1WTXA 4ZKBB 3FPUB 3Q22A 3MZ5A 4FYDA 2FMCA 5JVG3 3VR2A 3S2HB 2BDNA 1SE3A 3G6JB 1EY7A 4WJWA 4K8IA 1SYEA 4FO2A 2BDOA 4A3IB 2JXMB 2PZUA 3HOVB 2NUCA 1Y8PB 2HCIA 3A7AB 5I6WA 1STHA 4PNYA 3MC0B 3T4AC 1TY2A 2N88A 5LL6S 5A2QE 5AFWA 4IN3A 1GUSA 1LTID 1HTPA 4KY6A 2M2LA 2AQ2B 4IQZA 1TQOA 3KLSX 4QUFA 1SNMA 1D5ZC 3R93A 5K5PA 3NBIA 2NTSA 4FP5D 5JAVA 3RLFA 3HG9A 1J8IA 1BQQT 2K5WA 2DY8A 2N55A 3TDQA 4KKUA 1EWCA 2HCCA 3ND8A 1PDQA 1M8AA 3DWPA 2E2DC 2DY7A 4Q0FA 4K14A 4IUPA 4RAUC 3FPPA 2PO4A 1B53A 1HA6A 1YNJD 1EY5A 2KCCA 4IUUA 1F9PA 2J0TD 2WB1B 2EOTA 4C3HB 5CV9A 1KAAA 3JAML 1F2YA 1RCVD 3V2TA 2CVRA 1GUWA 1B9NA 5EPLA 2K28A 1S5CD 5IGEA 2EYMA 5LHY1 1AZPA 2K5DA 4XQNA 3W2DA 1I4PA 3J81E 2E2JB 1ONLA 3NUCA 1SYDA 5A2QL 1JICA 1EOTA 1II3A 3D4WA 5JEAG 1LTBD 5ELEA 5KNDA 4TQUS 1Y1VB 3DHQA 3IFDA 2RQXA 2K7VA 2RA4A 1CZGA 2Q8RE 3D31A 1EIHA 4H0LC 3MAQA 4U673 4A3DB 4LK1C 1G91A 4DU9A 1IYUA 1LTGD 3IAYA 2VUMB 1RDPD 2Z1CA 1WVLA 3RZOB 3RZDB 1E2VA 3A8IE 1HXYD 4FXGC 1X3PA 5C5LA 3K6OA 1SNQA 3P20A 3HOUB 1BO0A 4O42A 4K2KA 1NAPA 2LS01 1PTOB 5LL6X 4C3JG 1IKLA 4U68A 5C44B 3SR1A 4DN4M 1XX8A 4TSSA 2QDBA 5F2DA 2ZT9C 4OIKA 3W3AA 5BN3A 1PRTC 5CBAE 1E0BA 2TMPA 3LWEA 1QWYA 1ZYRD 2F0TA 1A15A 1WTVA 1I4RA 3E0JA 2WKCA 1UAPA 4F8MA 1ENCA 2PW7A 2F0KA 4YIJA 3VYTA 2WACA 1DOLA 3GTGB 3FMCA 1ILPA 1IKMA 1FD7D 4L6TB 4IFDI 2AQ3B 3A55A 2OT2A 2IWHA 2F0JA 3FVQA 4KJNA 4EGVA 3SK5A 1A3VA 1L0XB 4K8JA 2JEBI 2AUJD 4XTCS 1K83B 1QCBD 5D65A 2Q8TA 1I4QA 1G6ZA 4RGTA 2EY6A 3R2TA 4NDXA 2KQ3A 4I7ZC 4R8NA 3GTOB 1H9SB 3VR6A 4RGMA 3VR5A 4J8QA 2F0OA 3PO2B 1R4QB 1JOOA 4BA1I 1HUMA 4FXKC 2PYKA 1BR9A 4C2MB 1I50B 4Z9CB 1Z6HA 1PRTD 1DZ1A 2B2WA 4C3IB 5CC4A 1B3AA 4QMGA 2EYPA 3EQLC 3M7GA 1ZXTA 3S16B 1Q1EA 2SNSA 5IT9L 4C56C 2EYJA 1EEID 5I2YA 5M3FB 5C0XG 3D4RA 4QCLA 1O78A 2XNAC 3GTLB 2HDMA 4FF1A 2KA7A 4KN7C 3C1EA 4ZYSA 5IOCA 2H1EA 2RSOA 3NTIA 3HZXA 1MD2D 2G9HD 1WD1A 1HRJA 1FR3A 1STGA 3J7AF 5C0XJ 4IFDG 1EZ6A 1PZJD 3EVQA 2FINB 1EY6A 1EL0A 4KK7A 1CA5A 3SVMA 2F3WA 2IW3A 1RD9D 5EKLA 1SMYC 2EYLA 3MXUA 4DAVA 3L9AX 4C1NI 3MEHA 4DXGA 3H91A 5CMDA 3S14B 2K6AA 3PO3B 1LTAD 2Z4HA 2WIIB 1D1IA 1KLUD 4XT3B 1LV9A 4XYOA 3D3RA 5D3IB 4RCNA 2F3VA 3SK6A 1TU2B 4K6LA 3NWSA 1BCPC 1SSOA 2D9UA 3MHBA 1Y8NB 2F0EA 1O7YA 3E5SA 2A6ED 1VDZA 4X3SA 1GUOA 3H6MA 4C3JB 4XXEA 1G2TA 2KCNA 4RGOS 3IFTA 4HCSA 2JA5B 4NKLA 1EWHA 4RHRA 4NP5A 3K5OA 3RMHA 4EQPA 1G2SA 2NVYB 1U4LA 1JWSD 2ZXPA 1AW7A 2EDGA 4DGZA 1ESFA 3EROA 1H9KA 3TMEA 2XIWA 3BYYB 1KNEA 2KVMA 3QO2A 2E75C 1DCZA 3M3YB 4DXFA 3GTQB 1JOQA 1S5DD 2A69C 2NTTA 2NZ1D 3J7YW 1TWFB 2FHTA 4RWSC 1LTSD 2NN6G 2R3ZA 1G291 3PIO3 1BOSA 3M4OB 5KGUA 3JAME 5CV5A 1Y8OB 2A6HC 1EQTA 4B9WA 4X3UA 1U9RA 5C4ZA 4RHSA 4XT1B 1PZID 5FO8B 1V43A 5CV7A 3MXGA 1LABA 1EYDA 2NVTB 2FMMA 1WTWA 4A3KB 1F9QA 1V1PB 3NE5B 1GHKA 1IW7D 4FF2A 3VYSA 3N6RA 2B39A 4FXDA 2B63B 3GTPB 3A8KE 1C48A 3GV6A 2A6HD 1L0YB 4X3TA 1RODA 1DOMA 1TWAB 4KD4A 1MSHA 3K5NA 4KTAA 1STNA 2D2CC 4G57A 1PFBA 3IL8A 2C9OA 1CHQD 1QJOA 2K5QA 5M3MB 1SYBA 1RHPA 3S1NB 3H09A 2NVQB 1EIGA 1I4XA 1STBA 2EY2A 3DWQA 4BY1B 2QILA 2ZXRA 3J80L 3BDOA 4QB4A 3M4YA 1BCPB 2ZXOA 2B2TA 3QJYA 5C3XA 3I4MB 2PZTA 3X3NA 3I90A 2K04A 2Z8LA 4ME5A 4ZUJA 1KDCA 1EU4A 2QCPX 2RBMA 4EQNA 4IALA 1TWHB 1WTPA 1B50A 2BE5C 2A6EC 4V190 3HRZC 2VXWA 5EKIA 1KTKA 2BA1A 2XN9C 3BG3A 1JCKB 1WD0A 4HMJA 4OIJA 2L1BA 2PCFB 3R2IA 1U4MA 1HHVA 3V96A 4HCEA 1D1KA 5JPMC 4BA2I 2EZVA 3TP8A 4BWGB 2RDFA 1A3UA 1QE6A 4PMBA 1LACA 5E1FA 1ET6A 2EYOA 1A6XA 1LTRD 4QF4A 2VB2X 3I72A 5FKAC 2I07B 3X3MA 1RJTA 4XIGS 5ELCA 5C6AA 1LT3D 2E2HB 4FNFA 1SNCA 2EE1A 2F0UA 3VR3A 3K59A 2F0SA 3N52A 1EY9A 1IYVA 4G7HC 3HOWB 1CZWA 1F2MA 3OSOA 2H4OA 5KEEA 1LO5D 1TKWB 3LNNA 2PNRC 3ITPA 4O1NA 4IUNA 3GO5A 5C4XB 4MIUA 3CKIB 4ZAIA 1EU3A 1PTOC 5JPNC 1SEBD 1WTQA 3KK7A 1AP0A 1FNUA 3MA2B 1JOKA 1S5ED 3MWYW 3DEPA 1TWCB 3K5MA 4CJ0B 2BA0A 5I9OA 1HQMC 2WINB 2F0LA 3RD4A 2X6GA 3T16A 4ABNA 1I3QB 2KOLA 3ERQA 3SK4A 3K58A 4IUVA 5M5XB 1NR2A 1QB5D 2F0FA 2VNUD 3A8JE 5JVH3 3QWNA 2YYZA 4KHVA 1QNKA 5JEAJ 3DUZA 4X3KA 2JE6I 3CRLC 3DEOA 5DAUA 4A3GB 3I4LA 3K5LA 4F7XA 4H7BA 4HSVA 4G7OC 1F2LA 5JEAH 2KEDA 2F0IA 1M4VA 4PQXA 3KLRA 3WOFA 1GXDC 3URYA 1W6JA 3GV3A 2EJFC 1HFGA 3OW7A 3NHHA 4HN7A 3BVGA 3K57A 3D4DA 4PMWA 5JJZA 2XVSA 5ELBA 1STYA 3R3OA 1U4PA 4KJOA 4KKSA 2DNCA 3SEBA 1FGBD 1TS5A 4C1NK 2L55A 1UUPA 4FF4A 3QG1A 1S4ZA 4A93B 2FFKB 1LT4D 4K5XA 5IODA 4LJZC 1SDFA 1TR5A 3SK8A 1BDOA 2KEEA 1WTOA 2O5JC 3OIPA 2NN6I 3MFGA 5EJWA 2I46A 1A2UA 3I73A 2B2YA 4HR7B 1F9RA 1O7ZA 5C5MA 1PRTB 3TP5A 1TS2A 3Q24A 1BCPF 3EA6A 1J9OA 5I2XA 5E4XA 4KY5A 4G4KA 3PV0A 1PRTF 1MI2A 3WOEA 2LKVA 3PUVA 3C3LA 5EPJA 4RFBA 3QOJA 1EEFD 3OIQA 4RH6A 3MXPA 5EKKA 3R8BA 3FDTA 3SHLA 1H9JA 3FRPB 4MHEA 1C8CA 1UNSA 3TP6A 2RSNA 5G3LD 1TIID 1GUTA 2PZWA 4F87A 5CV6A 5FO7B 3TN2A 4DNTB 3UI2A 1SE4A 3I8ZA 1B4OA 5JOBA 5BN4A 2EVBA 1B2TA 1DJRD 2NVXB 3AU7A 1STAA 2O5IC 2CQAA 5DM63 5T1GA 3P75A 5IIFA 2JYOA 2EXZA 1D6EC 4HMIA 4ZKCB 3GTKB 3VA5A 1YNNC 4RKBA 4A3EB 3WDNA 1NR4A 5I6YA 4KV6A 3F2UA 2F0HA 4KI0A 4J1MA 4RGNA 1Q3LA 1EY4A 1F2ZA 1IW7C 4BY7B 5DEHA 1FNWA 3QOLA 4DK1A 2R92B 3FEWX 2F0GA 5E3FA 3CRKC 3KF8A 3A54A 1E2WA 5C0XI 3BDCA 2Z4IA 5CR3A 4HEDA 1QNUA 3HP3A 2F0DA 4K6DA 4L63B 5J1ZA 1FYCA 2HUGA 5FO9B 1PFMA 1PYWD 3NXWA 4G7ZC 1EY0A 3NTHA 1IHZA 2B2UC 2LY7A 5C0XH 3TBIB 5CORA 3O13A 3T51B 3L7ZC 3CHBD 4IURA 1BF4A 5KYLA 4KD3A 1H9MA 1I6HB 2FJ2A 4NMZA 4V0BA 2AWNA 3GTJB 3BDLA 1HPCA 5FK9C 4PMCA 1XYIA 5EQ0A 1TVXA 5K36H 2A73B 1WTRA 2A5HA 1CI3M 4BBRB 3H0GB 4F88A 3SDZA 1QOHA 3MFYA 2EY5A 4ID6A 5I9PA 3PUYA 4HSPA 2E74C 2B2VA 1MBYA 1JC7A 4BS9A 1TWGB 1SBBB 1GHJA 1PFNA 1D5XC 4R8IA 1VMPA 2MUYA 5CV4A 1OXSC 3LWUA 4JK1C 3I91A 1RF2D 3LX0A 1RKNA 1PZKD 4RA8A 3TP7A 5FLXL 4DNRB 1OXVA 1H9SA 3A7LA 2PW5A 1PMRA 5CGKA 2YU9B 1B9MA 4KY7A 1IL8A 4A3JB 4A3MB 3V05A 4CGYB 1ENFA 2IX0A 1ESRA 2HDLA 5HURA 4ILWA 2EJGC 1X32A 4QIWB 2JA8B 2ENBA 5EGTA 4DA2A 2F4IA 2JA7B 1PLFA 1Z7TA 3HOYB 4XQQA 1XXGA 3ONAB 3OWFA 5IGCA 4CBVA 4A3FB 3ZYYX 5ELDA 4AYBB 2ICEC 2NYZD 2NN6H 3S1MB 3TZUA 2WAQB 5DNFA 2G9DA 3DWAA 4I65A 4ZK9B 1SJHD 5M5YB 4NW2A 1DYQA 2RKSA 4M1UB 1A3TA 1DONA 1QILA 5IT9E 1HQRD 4GZYC 2PPBC 5D14A 2E76C 1C4QA 5IGDA 1SJED 1TS4A 2B2UA 1Q90A 3H3VC 2L12A 3BVZA 5BN5A 4A3BB 5ELFA 1V1OA 5I4DA 4H44C 4RCOA 3GP7A 3I3CA 1ILQA 3Q23A 3U9OA 1BUVT 2ID0A 2K03A 3K7AB 1U4RA 2XRSD 2NB0A 1G8ZD 1DD2A 2WKDA 1BCPD 1R9TB 4EQOA 3NTKA 5KRUA 5J39A 3S2DB 5C3EB 1VCIA 4L8JA 2SOBA 3U9SA 5D3DA 2KUMA 2AWOA 2O4XA 2K32A 4LAAA 5FLXE 4C3IG 3PUXA 1OXXK 2F0WA 2LMCB 1JE4A 3E6ZX 4DFAA 1RTNA 3NPPA 4KMUC 2WP8J 5G3LF 3NBHA 3MVVA 3J81L 4JBWA 5J22A 2RDGA 1NUCA 1AFPA 2EPBA 2E2IB 1EZ8A 3S15B 3DM1A 2F0VA 1B44D 1W6KA 4Q5VA 1SNOA 1GUGA 3PMFA 1VF7A 1AN8A 1AEXA 1HCZA 1JORA 3S17B 1CFMA 2QEJC 3BZDB 3S1RB 4OGQC 2Y0SB 3BVMA 2KHSA 4DAPA 1SFOB 3SE0A 2JEAI 1Y1WB 2OXPA 4ODGA 3DMUA 5CV8A 5CYUA 2D62A 3TSSA 1JQYD 1SMYD 3ND9A 2L0CA 1SYGA 4TRDA 5KNBA 1MGSA 3OMGA 4WFN3 5C3WA 3C1FA 4DAYA 2OF1A 3P7JA 5TSSA 2CW0C 5IGFA 2R7ZB 4TKOB 1S5BD 3KBGA 4ZUIA 2HQEA 1QG7A 1OO9B 3MTSA 1GUNA 3L3OC 3HOZB 1KDAA 2IT1A 1I4HA 1PTOD 3A56A 4ZRZA 1HA5A 1JWUD 4MN3A 2ICIA 3D8GA 2IPKD 5C4HA 4N9TA 1F77A 1T5EA 5C4JB 1ZKOA 4S3SA 3PUZA 3S9WA 1WCMB 3NQIA 3OHXC 3D6WA 2MGSA 1STEA 2F0MA 4BBSB 3Q6SA 2F0QA 4OL7A 1CQFA 4OO1G 4XYQA 3HKZB 1AZQA 3HGBA 4ULLA 2JP1A 3T56B 4WRDA 2J7ZA 1I6VC 1FNVA 2F0NA 2XRQD 1KNAA 3KUPA 3NQTA 2AUKA 3I4NB 5M9OA 2A68D 3SXHA 2F1MA 2K33A 3T53B 5EBCA 4QUCA 1OXTA 5K36G 2MHVA 3RUZA 4UDUC 3CU7A 2J4XA 1O80A 1LLRD 1JB3A 5KIXA 3GTMB 2B8FA 4R9WA 5KYIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NXW A;  1KDB A;  4K2K A;  4LAA A;  3NK9 A;  1EY5 A;  4F7X A;  2F0O A;  4H7B A;  3MZ5 A;  1A3U A;  1EY0 A;  2F3V A;  1A2T A;  1IHZ A;  2F0P A;  1JOO A;  3MXP A;  4N9P A;  4PMB A;  3SK6 A;  5E1F A;  2F0W A;  2OEO A;  3SHL A;  3SR1 A;  5HUR A;  2F0I A;  3MHB A;  2PYK A;  3HEJ A;  2ENB A;  1KAA A;  2EYO A;  5CV9 A;  5EGT A;  2F0E A;  4DFA A;  1EYA A;  5KYL A;  4KD3 A;  1F2Y A;  4IZ8 A;  3E5S A;  3D8G A;  4QF4 A;  3TP6 A;  3V2T A;  3H6M A;  2PZW A;  1EY7 A;  2QDB A;  3NHH A;  4K8I A;  5F2D A;  5CC4 A;  1KAB A;  3MVV A;  5C6A A;  4NMZ A;  5C4H A;  1SYF A;  4QMG A;  5CV6 A;  1SYE A;  2EYP A;  4N9T A;  1SNC A;  3OWF A;  5IGC A;  3D4D A;  4K2L A;  3BDL A;  5J22 A;  2PZU A;  1ENA A;  4NKL A;  2NUC A;  3OMC A;  2F0U A;  4KD4 A;  4NP5 A;  3T13 A;  4PMC A;  4KTA A;  1STY A;  2F0S A;  1STN A;  3R3O A;  2EYM A;  2SNS A;  4KJO A;  4S3S A;  5IGE A;  3S9W A;  4G57 A;  1EY9 A;  5I6W A;  1TT2 A;  1NUC A;  1STH A;  4J6H A;  4K5W A;  5JOB A;  4PNY A;  4EQP A;  5IGG A;  2EYJ A;  4HTH A;  1SYC A;  1SYB A;  1EZ8 A;  4DGZ A;  2F0M A;  2F0T A;  3D6C A;  1NSN S;  2F0V A;  3ERO A;  1STA A;  4I65 A;  1SNO A;  4DF7 A;  3PMF A;  5ISR A;  3TME A;  1F2M A;  2F0Q A;  3NUC A;  1AEX A;  1ENC A;  1SYD A;  2PW7 A;  2F0K A;  1STB A;  2EY2 A;  3OSO A;  4OL7 A;  4YIJ A;  1JOR A;  2EY5 A;  5KEE A;  1EYC A;  2RKS A;  2EYH A;  3P75 A;  1A3T A;  5IIF A;  4QB4 A;  2WAC A;  1II3 A;  2EXZ A;  3ITP A;  4ID6 A;  3D4W A;  4K5X A;  5KYI A;  4HMI A;  4KY6 A;  1JOQ A;  5I9P A;  4IUN A;  3VA5 A;  5EKK A;  4MIU A;  4RKB A;  5IOD A;  2EYF A;  2KHS A;  5C3X A;  4WRD A;  1TR5 A;  4RKL A;  3SK8 A;  2PZT A;  2OXP A;  4ODG A;  1TQO A;  3DMU A;  1EQV A;  5IGD A;  4ME5 A;  5CV8 A;  3C1E A;  5IOC A;  5I6Y A;  4ZUJ A;  4KV6 A;  1KDC A;  1SNM A;  2F0J A;  3HZX A;  4EVO A;  1JOK A;  2F0N A;  2F0H A;  2SNM A;  4KJN A;  5K5P A;  1SYG A;  3SK5 A;  1A3V A;  1SNP A;  4TRD A;  3DHQ A;  4B9X A;  4K8J A;  2EY1 A;  1STG A;  1A2U A;  2RBM A;  4J1M A;  3P1H A;  4EQN A;  5KGU A;  3OMG A;  4IAL A;  4F8M A;  5CV5 A;  3C1F A;  3QB3 A;  5C3W A;  3U9O A;  5JAV A;  3NQT A;  1EZ6 A;  5CV4 A;  4WOR A;  5I9O A;  3EVQ A;  1SND A;  1EY4 A;  2PQE A;  1F2Z A;  2F0L A;  2OF1 A;  1EY6 A;  5C5M A;  3TP5 A;  4B9W A;  5M9O A;  3T16 A;  5DEH A;  4ZQ3 A;  3SXH A;  1U9R A;  5IGF A;  5NUC A;  4DU9 A;  5IGB A;  3LX0 A;  1RKN A;  3TP7 A;  3QOL A;  5C4Z A;  3ERQ A;  2F3W A;  3SK4 A;  2F0G A;  3EJI A;  5CV7 A;  4ZUI A;  2HQE A;  4EQO A;  5E3F A;  2EY6 A;  4NDX A;  5HGT A;  4KY5 A;  3RUZ A;  1EYD A;  2PW5 A;  3BDC A;  5KRU A;  5CGK A;  5EKL A;  4HMJ A;  5CR3 A;  2EYL A;  2KQ3 A;  4KY7 A;  5J39 A;  2F0F A;  2LKV A;  4K5V A;  4R8N A;  4K14 A;  3MEH A;  4KHV A;  1KDA A;  2SOB A;  5C5L A;  2F0D A;  4K6D A;  1EY8 A;  5J1Z A;  3NP8 A;  3QOJ A;  5KIX A;  1SNQ A;  5DAU A;  2O4X A;  4E6I A;  3TP8 A;  2M00 A;  2RDF A; 
#chains in the Genus database with same CATH topology
 2R92 H;  2M9V A;  1JWM D;  2JSO A;  1HZA A;  2MJ8 A;  3BS1 A;  2QKI C;  2GA4 B;  3GQB A;  2CWP A;  2UXD L;  3M85 A;  5LMN L;  1HUN A;  3HEJ A;  1PA6 A;  1VQ9 A;  4A3K H;  5IE8 A;  1UEA B;  1YNN D;  5DM7 3;  3VYR A;  1VQ8 A;  2XWJ B;  1KAB A;  3BU2 A;  3EFX D;  2EJM A;  1SYF A;  2HIV A;  4N8X 1;  4KN4 C;  2BOS A;  2IX3 A;  1J5E Q;  1CA6 A;  4JYA Q;  4ZCK A;  3T13 A;  2N8N A;  3DXJ C;  4LFC L;  1X56 A;  1SAP A;  4J6H A;  3PIP 3;  4K5W A;  4X6A H;  2QF7 A;  2AQ1 B;  5IGG A;  1ICW A;  1LTL A;  3I7F A;  1SYC A;  2KEC A;  4P2C B;  1XWE A;  3VR4 A;  2O2L D;  1EFW A;  4UAI A;  1CT1 D;  2IX1 A;  2Q8I B;  3IKJ A;  5A35 A;  2K5V A;  1EYC A;  1QUQ A;  2C5C A;  3I70 A;  1E7Z A;  1SXT A;  3OYY A;  1DXM A;  3IRB A;  4CKC A;  2IHE A;  4RKL A;  3PQI A;  1EQV A;  1TY0 A;  3T1Y Q;  4OO1 H;  1CQV A;  1UE7 A;  3OWE B;  4PV1 C;  1HNZ Q;  4IFD H;  4R4I A;  3P1H A;  4XQJ A;  3KLS A;  3RLN A;  1YNJ C;  4C3H G;  3QB3 A;  5IWA L;  3RR5 A;  4JW0 A;  4WOR A;  4UP8 A;  3NEL A;  1SND A;  2A74 C;  1YIT A;  1Y69 U;  1CK1 A;  3CQZ B;  4FVM A;  3HOX B;  4ZQ3 A;  4X62 L;  1XMO L;  5IGB A;  1YI2 A;  3CC7 A;  4LF6 Q;  1PTO H;  1NCV A;  3EJI A;  4B08 A;  1PH6 A;  2TSS A;  4OHJ A;  5HGT A;  5FLM H;  1LT6 D;  3L2P A;  1XPU A;  3S1Q B;  3J80 E;  3J7A V;  2Z9H A;  2VUM G;  2UXD Q;  4H13 C;  5LMN Q;  2RF4 A;  3RNU A;  2GVB A;  3AMU A;  2CH4 A;  1BVS A;  2CCZ A;  2B2W C;  5EPK A;  1V8Q A;  1QZG A;  2K50 A;  2LFN A;  1A2T A;  1VQ7 A;  4N9P A;  1CSQ A;  4LMQ D;  3HOX H;  4JI7 Q;  3C2P A;  4DPG A;  1VF5 C;  2UXB Q;  2SEB D;  1MSG A;  5BR8 Q;  3QIA A;  4B3S L;  2X6L A;  1BXT A;  1JT8 A;  1B7Y B;  3RZO H;  1F9S A;  3S15 H;  2B2V C;  2GVA A;  2JA6 B;  2A19 A;  4JOI C;  4K2L A;  1ENA A;  5E4W C;  1CTM A;  3PUW A;  4DK0 A;  1Q1B A;  3DM3 A;  4KLK A;  2XTI A;  3NWT A;  1ZYR C;  1TT2 A;  4KHZ A;  1HNW L;  1V1P A;  4HTH A;  4LF8 Q;  3K8A A;  1I4G A;  1K8M A;  4GOP C;  3D6C A;  4R4C A;  1NSN S;  2L11 A;  4DF7 A;  3VYU A;  4LUO A;  2IHF A;  3MXN A;  1OXU A;  1ZEQ X;  1HJP A;  2B63 G;  1VQJ A;  1Q86 C;  2RVL A;  2EYF A;  1O7I A;  4CJ1 B;  2K1B A;  4A93 H;  1CHP D;  1X3Q A;  3NSW A;  4QQB X;  1CKO A;  1L2F A;  2MP1 A;  4IFD J;  2DJG C;  1H9R A;  1O7L A;  1BNZ A;  2SNM A;  1VQK A;  4B9X A;  1SNP A;  1XTC D;  1Z47 A;  3HS0 C;  2EY1 A;  5EBD A;  2MPM A;  2K05 A;  4OEM B;  2PQE A;  5M3M G;  2K4K A;  4FDB A;  4HAE A;  5NUC A;  4A3B H;  4M8A A;  1D2B A;  1JR0 D;  3K0Y A;  4CKE A;  4OON A;  1GOZ A;  1MKH A;  2RDH A;  3Q8D A;  1A63 A;  2KJX A;  4NB3 A;  4HIM A;  1X9N A;  1EFI D;  1S5F D;  3EN2 A;  4K5V A;  2B8G A;  2CW0 D;  3FHW A;  1WTH A;  4CJ2 C;  1LT5 D;  1VMC A;  2L15 A;  2IJ0 A;  4HJ8 A;  4JI7 L;  1E2Z A;  1VQ6 A;  2L4N A;  1KLG D;  3LGJ A;  3L0O A;  3CMA A;  3NP8 A;  3PO2 H;  2K01 A;  4DV2 L;  1HNW Q;  1R9T H;  2VZA A;  1KDB A;  1L0W A;  3NK9 A;  1EIY B;  2IL8 A;  3BYT B;  2NVY H;  2F0P A;  3I4N G;  4CHT B;  2L9H A;  1PFS A;  2XWB B;  3CCV A;  2CHB D;  2OEO A;  5FLM G;  3HKS A;  4IUQ A;  3K7A H;  1FJG L;  5IP9 H;  2DN8 A;  2Z0S A;  1EYA A;  2A69 D;  3C46 A;  4IZ8 A;  1SE2 A;  1PYB A;  1LM0 A;  1S72 A;  1T5X D;  1ML0 D;  3AB9 A;  5M5X H;  2L5T A;  2BE5 D;  1Q8I A;  2V1C C;  2X69 A;  2PMZ B;  3RN2 A;  4C3J H;  4XDX A;  2R6G A;  4DR3 L;  4CDE C;  1VQN A;  3OMC A;  4IJH A;  3KBX A;  1BBX C;  1HTL D;  1DM0 B;  4JI0 L;  1D5M C;  1J6Q A;  1PH4 A;  3TZD A;  1Q7Y C;  2B2T C;  2R61 A;  5AJ3 Q;  3H94 A;  5ISR A;  1K8O A;  1LTT D;  5CBE E;  2B2Y C;  3PO3 H;  2NBF A;  3S2H H;  2EYH A;  5T1I A;  2N49 A;  3Q0A A;  1GJX A;  2BCO A;  4AQY L;  2XSC A;  4X66 Q;  2NWG A;  2PQA A;  4O2D A;  5COY A;  5GAD C;  3CME A;  2ATW A;  5M5W B;  2MO0 A;  2YV5 A;  2Z6K A;  4Y7N B;  1PH8 A;  4EVO A;  2JQO A;  1B1Z A;  1DOK A;  1VQO A;  4ZLT F;  3OOC A;  2D5D A;  1HFN A;  2DNE A;  2F03 A;  3G7L A;  4CKB A;  2WV6 D;  5KNC A;  2V4D A;  1PTO F;  2A68 C;  1R4P B;  4JI6 Q;  2R93 B;  2KBN A;  4DV0 L;  1Q12 A;  3FKI B;  5IP9 G;  1PXU A;  4IUT A;  4KKT A;  3H0G G;  1M90 C;  4OO1 I;  2UUC L;  2F52 A;  5FOB B;  3VA7 A;  2WAQ G;  2VB3 X;  1CM9 A;  4LW1 A;  2SDF A;  4LFB L;  1RTO A;  3M7N A;  2G5D A;  4FF3 A;  3F2C A;  1TS3 A;  1EY8 A;  3OPO A;  4E6I A;  1ET9 A;  3GD7 A;  1Y1W G;  1K73 C;  1WTX A;  4ZKB B;  3E0E A;  3FPU B;  5AJ3 L;  3MZ5 A;  3Q22 A;  4FYD A;  1VQE A;  4MNO A;  2R7Z H;  3W1B A;  2UU9 Q;  2FMC A;  1B70 B;  5JVG 3;  3VR2 A;  3M4P A;  3S2H B;  2BDN A;  1BBW A;  1SE3 A;  3G6J B;  4AQY Q;  3PF4 A;  1EY7 A;  4WJW A;  4K8I A;  4DV4 L;  2ZM6 Q;  1LYL A;  1SYE A;  2AMC B;  4FO2 A;  2BDO A;  4A3I B;  5J3B A;  2MO1 A;  3NEN A;  2JXM B;  2PZU A;  5C3E G;  3HOV B;  2NUC A;  2K52 A;  2R7D A;  1Y8P B;  2HCI A;  3A7A B;  5I6W A;  1STH A;  4PNY A;  3MC0 B;  3GTJ H;  3T4A C;  1TY2 A;  2N88 A;  5LL6 S;  3SGI A;  1JB7 A;  1D8L A;  4UPA A;  5A2Q E;  5AFW A;  4IN3 A;  1GUS A;  2RHQ B;  3U50 C;  3I56 A;  4IOA A;  1LTI D;  3I4M H;  1HTP A;  4KY6 A;  2M2L A;  1D7Q A;  1E22 A;  2AQ2 B;  4IQZ A;  1TQO A;  1XNQ L;  3KLS X;  3PF5 A;  4QUF A;  1K83 H;  1I3Q H;  1IBK Q;  1YHA A;  3F2B A;  1SNM A;  1D5Z C;  4DR4 Q;  4DV7 L;  1VS0 A;  3R93 A;  5K5P A;  2E2I H;  2QEX A;  1UWV A;  2RCF A;  2E8G A;  2YTY A;  3NBI A;  2NTS A;  5GAE C;  4FP5 D;  3TEH B;  1X65 A;  5IY0 A;  5JAV A;  3RLF A;  3CW2 C;  3MXN B;  4WJ4 A;  3HG9 A;  1J8I A;  2UU9 L;  4KHP L;  1BQQ T;  1EYG A;  2K5W A;  2DY8 A;  4GN5 A;  3HOW G;  3NBH B;  4A93 G;  2N55 A;  3TDQ A;  4KKU A;  2Y0S G;  1EWC A;  2HCC A;  4A3I G;  3ND8 A;  1PDQ A;  1M8A A;  3DWP A;  2E2D C;  2DY7 A;  4Q0F A;  1JJG A;  4K14 A;  1FVI A;  2ZJR A;  2NZH A;  4IUP A;  4RAU C;  4N8F A;  3ULL A;  3FPP A;  4QJF A;  2PO4 A;  1YEZ A;  1B53 A;  2JA9 A;  1ASY A;  1HA6 A;  1YNJ D;  1EY5 A;  1ASZ A;  2ZM6 L;  2KCC A;  2YTX A;  4IUU A;  1F9P A;  2J0T D;  2WB1 B;  3PSI A;  5EAY A;  2EOT A;  3K81 C;  4C3H B;  5C3E H;  5CV9 A;  1KAA A;  4JVZ A;  3JAM L;  1K8G A;  2BH8 A;  2Z6K C;  1F2Y A;  1YNX A;  1RCV D;  3V2T A;  2Q2H A;  4NPS A;  5IP7 G;  2CVR A;  4A3L G;  4DR5 Q;  1GUW A;  1B9N A;  5EPL A;  4APV A;  2K28 A;  1S5C D;  5IGE A;  2EYM A;  5LHY 1;  1AZP A;  4DK6 C;  1S40 A;  4LF5 Q;  2K5D A;  4XQN A;  3W2D A;  1I4P A;  3J81 E;  5LMU L;  2E2J B;  1ONL A;  2N3S A;  4X64 Q;  3HOY G;  1PVO A;  3NUC A;  1SYD A;  5A2Q L;  1EQQ A;  1VQ5 A;  1JIC A;  1EOT A;  1IBL Q;  5IYB G;  3G71 A;  3TS0 A;  1II3 A;  4DR4 L;  3D4W A;  5GQO A;  5C44 H;  2VQF L;  4DR7 L;  3ER0 A;  1I94 L;  1FGU A;  5JEA G;  1LTB D;  5ELE A;  3CP0 A;  3RN5 A;  1X55 A;  5KND A;  4TQU S;  1JE5 A;  1Y1V B;  4KHP Q;  3M9B A;  3J81 j;  1HR0 Q;  3DHQ A;  3IFD A;  3PGZ A;  2RQX A;  1HNX Q;  2K7V A;  4MZ9 A;  1KRT A;  2RA4 A;  1CZG A;  2Q8R E;  3D31 A;  1EUJ A;  1EIH A;  2I5H A;  4H0L C;  3MAQ A;  4U67 3;  4A3D B;  4LK1 C;  4LFA L;  1G91 A;  4DU9 A;  1IYU A;  4GLV B;  1LTG D;  3IAY A;  1VQH A;  2VUM B;  1RDP D;  2Z1C A;  3CCU A;  1CUK A;  1WVL A;  3RZO B;  1VQF A;  3RZD B;  3HOY H;  1E2V A;  3A8I E;  1HXY D;  4JOI A;  4FXG C;  4A3J H;  2EIF A;  4IOC A;  4IPC A;  1X3P A;  5C5L A;  3K6O A;  1IYJ B;  4OWW B;  2YU9 H;  1SRU A;  1SNQ A;  3P20 A;  3HOU B;  1BO0 A;  1UE1 A;  4O42 A;  4K2K A;  1NAP A;  5LMU Q;  2LS0 1;  1PTO B;  5M3M H;  1JJ2 A;  1MIU A;  5LL6 X;  1N33 L;  4C3J G;  1IKL A;  4U68 A;  2ALY B;  5C44 B;  3SR1 A;  4JI4 L;  4DN4 M;  1XX8 A;  3S17 H;  4HJ9 A;  4TSS A;  4R4O A;  1X3E A;  4BBR G;  2QDB A;  5F2D A;  4JBK A;  3TS2 A;  1YJN A;  2ZT9 C;  4OIK A;  4DR2 L;  1QVC A;  4X64 L;  3CCR A;  4JCV E;  3W3A A;  2ZTD A;  5BN3 A;  4A3K G;  4B3T L;  1PRT C;  3A74 A;  3CCQ A;  5CBA E;  4CDD C;  1E0B A;  2TMP A;  2R92 G;  3LWE A;  1QWY A;  1ZYR D;  1I94 Q;  1DGS A;  2F0T A;  1A15 A;  1WTV A;  1I4R A;  1L1O B;  3E0J A;  3GDE A;  2WKC A;  4A3M G;  1UAP A;  4F8M A;  4B3R L;  1ENC A;  2PW7 A;  2F0K A;  5M5W H;  4YIJ A;  3VYT A;  3KJO A;  2WAC A;  1EOV A;  1G6P A;  1DOL A;  5JJL A;  3GTG B;  3FMC A;  5ELN A;  1K28 A;  1ILP A;  4GNX A;  4QY7 A;  1IKM A;  1FD7 D;  4L6T B;  1YHB A;  4JI8 L;  4IFD I;  2AQ3 B;  4A3G H;  2ES2 A;  1CKN B;  4NXN L;  3A55 A;  4LFA Q;  2OT2 A;  2IWH A;  2F0J A;  3FVQ A;  4IPH A;  4KJN A;  4EGV A;  3SK5 A;  1A3V A;  1L0X B;  4K8J A;  1XMQ L;  2JEB I;  2AUJ D;  1SLJ A;  3I4M G;  4XTC S;  4DNI A;  3KLW A;  1K83 B;  1QCB D;  5D65 A;  2Q8T A;  1I4Q A;  1G6Z A;  4OEL B;  3BZC A;  2QA4 A;  4R1J A;  4RGT A;  4H02 A;  2EY6 A;  3R2T A;  4NDX A;  3J80 i;  2KQ3 A;  1N33 Q;  1WCM G;  4I7Z C;  3A5Z B;  4R8N A;  3GTO B;  1MHW C;  1H9S B;  4DUZ Q;  4UP9 A;  3VR6 A;  2EQS A;  4B3T Q;  3G4S A;  4RGM A;  3VR5 A;  3J80 c;  4J8Q A;  2F0O A;  2AHO B;  3PO2 B;  1R4Q B;  1JOO A;  4BY7 H;  3ERS X;  2UXC L;  4BA1 I;  1HUM A;  4FXK C;  2PYK A;  2HIX A;  1BR9 A;  1TWC H;  2Y0S E;  4A3C G;  4C2M B;  2OQK A;  4A3F H;  1I50 B;  4Z9C B;  4A4I A;  3KF8 B;  1Z6H A;  1PRT D;  1DZ1 A;  2B2W A;  4C3I B;  5CC4 A;  1B3A A;  2BH2 A;  1NNX A;  4QMG A;  2EYP A;  3EQL C;  3M7G A;  4JI8 Q;  3AYH B;  4QL5 A;  1ZXT A;  2OTJ A;  2MQH A;  2CWA A;  1KC8 C;  3S16 B;  4YWL A;  2K75 A;  4A75 A;  1Q1E A;  2SNS A;  1Q82 C;  5IT9 L;  4C56 C;  1AH9 A;  2EYJ A;  1K9M C;  3GTK H;  3F8T A;  1EEI D;  5I2Y A;  1NMG A;  5M3F B;  5C0X G;  3TQY A;  4EQ5 A;  3D4R A;  4GOP B;  4YY3 Q;  4NXN Q;  4X65 Q;  1NTG A;  4QCL A;  4UP7 A;  1O78 A;  2VW9 A;  2XNA C;  3GTL B;  4A76 A;  2HDM A;  4FF1 A;  4O0A A;  2KA7 A;  2ZJP A;  4KN7 C;  2CQO A;  3C1E A;  4AYB E;  4ZYS A;  5IOC A;  4A3G G;  4DV1 L;  2H1E A;  2RSO A;  4OX9 L;  3NTI A;  3HZX A;  1MD2 D;  2G9H D;  1WD1 A;  1HRJ A;  3A0J A;  1FR3 A;  1KRS A;  1STG A;  1I5F A;  3J7A F;  5C0X J;  2WB1 E;  2JA7 G;  3UE0 A;  4IFD G;  1K3B C;  1EZ6 A;  1PZJ D;  3EVQ A;  2FIN B;  1EY6 A;  1EL0 A;  4KK7 A;  2B29 A;  1TWG H;  2Z6B A;  1CA5 A;  1VQM A;  3SVM A;  2F3W A;  4DV3 L;  2R93 H;  4J15 A;  3HKZ G;  2IW3 A;  1RD9 D;  5EKL A;  1SMY C;  2EYL A;  2VL6 A;  2ZTC A;  3MXU A;  3EBE A;  4DAV A;  3L9A X;  1PH5 A;  4C1N I;  1UE6 A;  3MEH A;  4DXG A;  3H91 A;  5CMD A;  3S14 B;  2K6A A;  3PO3 B;  3CAM A;  1LTA D;  2Z4H A;  2WII B;  1D1I A;  1KLU D;  4XT3 B;  1LV9 A;  4XYO A;  3D3R A;  5D3I B;  4RCN A;  2F3V A;  3SK6 A;  1TU2 B;  4K6L A;  1VQC A;  1ICF B;  3NWS A;  4A3D H;  1BCP C;  1SSO A;  2D9U A;  3MHB A;  1Y8N B;  3J81 c;  4JYA L;  1SE8 A;  2F0E A;  1O7Y A;  3E5S A;  2A6E D;  1VDZ A;  1UEB A;  4X3S A;  1GUO A;  3H6M A;  4C3J B;  3RZD H;  4XXE A;  1G2T A;  2KCN A;  4RGO S;  1I6H H;  4JI2 Q;  3IFT A;  4HCS A;  2JA5 B;  4NKL A;  1EWH A;  4RHR A;  4GKK L;  4NP5 A;  3K5O A;  3RMH A;  1SFO H;  4P71 A;  1G2S A;  4EQP A;  2E5L L;  2NVY B;  2LXK A;  2PMZ E;  1U4L A;  1JWS D;  2ZXP A;  1AW7 A;  2EDG A;  4DGZ A;  1ESF A;  3ERO A;  1V1Q A;  1H9K A;  3F1Z A;  3S24 A;  3TME A;  2XIW A;  3BYY B;  3S1N H;  1KNE A;  3QO2 A;  1JMC A;  2E75 C;  4HJA A;  1DCZ A;  3M3Y B;  4DXF A;  3GTQ B;  1JOQ A;  3KOJ A;  1H95 A;  4YCV A;  1S5D D;  5IWA Q;  2A69 C;  1VQP A;  2NTT A;  2NZ1 D;  3K7U C;  3J7Y W;  1TWF B;  1KXL A;  2FHT A;  4RWS C;  3CC2 A;  4HJ5 A;  1LTS D;  1PYS B;  2NN6 G;  2R3Z A;  2UUA Q;  2JA6 G;  1G29 1;  3PIO 3;  3ZJY C;  2ZTE A;  1BOS A;  3M4O B;  3ULP A;  5KGU A;  3JAM E;  2MNA A;  5CV5 A;  3PIP A;  1Y8O B;  3M4O H;  2A6H C;  1EQT A;  4PZ6 A;  4B9W A;  4X3U A;  1XNR L;  2B63 H;  1U9R A;  1PH7 A;  2HHH L;  5C4Z A;  4RHS A;  4XT1 B;  1PZI D;  1JJC B;  5FO8 B;  1V43 A;  5CV7 A;  3H3V H;  3MXG A;  1LAB A;  1EYD A;  2KEN A;  2NVT B;  2FMM A;  1SRO A;  1WTW A;  4A3K B;  1F9Q A;  1V1P B;  3M3Y H;  3NE5 B;  1GHK A;  2PI2 A;  1IW7 D;  4FF2 A;  3VYS A;  3N6R A;  1HH2 P;  2B39 A;  1NY4 A;  4DR1 Q;  4A3E H;  4L5S A;  4FXD A;  2K5N A;  4JI5 L;  3RLO A;  1N32 L;  2B63 B;  3GTP B;  4DV5 L;  3A8K E;  1C48 A;  3T1H L;  1VQL A;  1PH2 A;  3GV6 A;  5C4X G;  2A6H D;  4LF8 L;  3CCL A;  1KD1 C;  4LF7 Q;  1L0Y B;  4X3T A;  1ROD A;  1HZ9 A;  1DOM A;  1TWA B;  4KD4 A;  1MSH A;  3EIV A;  4MTK A;  3K5N A;  4KTA A;  2UUB L;  1STN A;  2D2C C;  3G48 A;  4G57 A;  1QUQ B;  5C4X H;  2JA5 H;  1PFB A;  1K0S A;  3IL8 A;  2C9O A;  1CHQ D;  1QJO A;  2K5Q A;  5M3M B;  1SYB A;  2JA6 H;  1QVG A;  1RHP A;  4HID A;  3S1N B;  3NEM A;  3H09 A;  1XNR Q;  2HD3 A;  1YHQ A;  2NVQ B;  1EIG A;  1I4X A;  1STB A;  2EY2 A;  3DWQ A;  4BY1 B;  2QIL A;  2ZXR A;  3J80 L;  3BDO A;  4QB4 A;  3M4Y A;  5ELO A;  1BCP B;  2ZXO A;  2B2T A;  3QJY A;  5C3X A;  3UDX A;  3I4M B;  2PZT A;  4P72 A;  4UHV A;  3X3N A;  3CXC A;  3I90 A;  2K04 A;  2Z8L A;  4ME5 A;  4ZUJ A;  1KDC A;  4A3M H;  1EU4 A;  1IBM L;  1GKH A;  2QCP X;  2RHS B;  2RBM A;  1VQI A;  4LUZ A;  4EQN A;  4IAL A;  1TWH B;  4JI5 Q;  1E1T A;  1WTP A;  2WB1 G;  1B50 A;  1WCM H;  2BE5 C;  1TXY A;  2H5X A;  2A6E C;  4V19 0;  3HRZ C;  4JBM A;  5FJ8 G;  2VXW A;  5EKI A;  1KTK A;  1CKN A;  4WJ3 M;  2BA1 A;  4BBS G;  2XN9 C;  3BG3 A;  1JCK B;  1WD0 A;  1U0L A;  1G51 A;  4HMJ A;  4OIJ A;  1WOC A;  2L1B A;  2PCF B;  3R2I A;  1U4M A;  2HT1 A;  1HHV A;  1A8V A;  3V96 A;  4HCE A;  1D1K A;  5JPM C;  1VQA A;  4BA2 I;  2UUB Q;  1RIP A;  1IBK L;  4PZ7 A;  4DUY Q;  1VQG A;  4DV7 Q;  2EZV A;  3TP8 A;  4BWG B;  2RDF A;  3FKI H;  2DGY A;  1B8A A;  4LF7 L;  1A3U A;  1QE6 A;  4PMB A;  1LAC A;  5E1F A;  4DR3 Q;  1ET6 A;  3HOZ H;  2EYO A;  3S16 H;  1KAW A;  1A6X A;  1LTR D;  4QF4 A;  2VB2 X;  3I72 A;  5FKA C;  2I07 B;  3X3M A;  3UE1 A;  1RJT A;  4XIG S;  1NE3 A;  5ELC A;  5M3F H;  5GRO A;  5C6A A;  1LT3 D;  4C3I H;  2E2H B;  4FNF A;  1A0I A;  1SNC A;  3KF6 B;  4DR6 L;  4A3J G;  3PO3 G;  2EE1 A;  2F0U A;  3VR3 A;  3K59 A;  2F0S A;  1HZC A;  3ICE A;  3AFQ A;  3N52 A;  1EY9 A;  2GN5 A;  3HKZ E;  3A5U A;  1IYV A;  4G7H C;  2ASB A;  3HOW B;  3KFU A;  1CZW A;  2D0O A;  3STB C;  1F2M A;  3OSO A;  4L5T A;  2H4O A;  5KEE A;  1LO5 D;  4BBR H;  1TKW B;  3LNN A;  2PNR C;  1VQD A;  3G6E A;  3ITP A;  4O1N A;  3K0X A;  4IUN A;  3GO5 A;  5C4X B;  4MIU A;  3CKI B;  1L1O C;  4ZAI A;  1EU3 A;  1PTO C;  3E9I A;  5JPN C;  3S1R H;  1SEB D;  1WTQ A;  3KK7 A;  1IL2 A;  1AP0 A;  1FNU A;  3MA2 B;  1JOK A;  1S5E D;  3MWY W;  3DEP A;  4LF5 L;  2UUC Q;  1TWC B;  3KYH C;  3K5M A;  4CJ0 B;  3U4Z A;  2BA0 A;  2R7F A;  5I9O A;  1HQM C;  2PI2 E;  2WIN B;  2F0L A;  4OWT B;  3RD4 A;  2X6G A;  3T16 A;  1E3P A;  4ABN A;  1I3Q B;  1E24 A;  2KOL A;  3ERQ A;  3SK4 A;  3K58 A;  1HNZ L;  1VQB A;  2VQE L;  4IUV A;  5M5X B;  4A3F G;  1NR2 A;  3GTG H;  1QB5 D;  2F0F A;  3AQQ A;  3GTP H;  2VNU D;  3A8J E;  5JVH 3;  1GVP A;  4KHV A;  3QWN A;  2YYZ A;  4X62 Q;  1XMO Q;  1NBW A;  4IPD A;  2I5L X;  1OTC A;  1QNK A;  5JEA J;  4LF6 L;  3DUZ A;  4X3K A;  1HR0 L;  2JE6 I;  3CRL C;  3DEO A;  5DAU A;  1Z9F A;  4A3G B;  3I4L A;  1BBU A;  2OCE A;  3M4Q A;  3K5L A;  4F7X A;  3KF6 A;  4H7B A;  4HSV A;  4G7O C;  1F2L A;  4GKJ Q;  3CPF A;  2KED A;  5JEA H;  1N36 L;  2F0I A;  1M4V A;  1NMF A;  3KLR A;  4PQX A;  3STB D;  1GXD C;  3WOF A;  3URY A;  1W6J A;  3DLL A;  3GV3 A;  2EJF C;  3I4O A;  1AE2 A;  1HFG A;  2E2H H;  3OW7 A;  3J7Z C;  3NHH A;  2CH4 W;  3JAM i;  1P8L A;  3BZK A;  1HZB A;  4HN7 A;  4GNX C;  4RMF A;  3BVG A;  3K57 A;  3D4D A;  4PMW A;  5JJZ A;  2XVS A;  2UXB L;  5ELB A;  5BR8 L;  1STY A;  3R3O A;  1PH3 A;  1U4P A;  4KJO A;  4KKS A;  2DNC A;  4LNQ A;  3SEB A;  1FGB D;  2WFW A;  3QR8 A;  1TS5 A;  4C1N K;  3F2D A;  2L55 A;  1W2B A;  1UUP A;  1XNQ Q;  4FF4 A;  3QG1 A;  1FL0 A;  1S4Z A;  5IP7 H;  1Q46 A;  4A93 B;  2FFK B;  1LT4 D;  4K5X A;  5GAH C;  5IOD A;  4LJZ C;  1SDF A;  2K14 A;  4LUV A;  1TR5 A;  3SK8 A;  2HQL A;  4P75 A;  1BDO A;  2KEE A;  2MFI A;  1PH1 A;  2Q2I A;  1WTO A;  2O5J C;  3OIP A;  1PH9 A;  2NN6 I;  5GAG C;  4K0K Q;  3MFG A;  5EJW A;  2I46 A;  1A2U A;  5L37 A;  3I73 A;  2B2Y A;  4HR7 B;  1P16 A;  4GKJ L;  1F9R A;  1O7Z A;  5C5M A;  1PRT B;  1Q81 C;  3TP5 A;  2VUM H;  1Y1V H;  1TS2 A;  3Q24 A;  3HOV G;  1BCP F;  3EA6 A;  3I55 A;  1J9O A;  5I2X A;  4AH6 A;  5E4X A;  4KY5 A;  2I0Q A;  4G4K A;  3PV0 A;  1PRT F;  1MI2 A;  3WOE A;  2LKV A;  3BJU A;  2JA8 H;  1N36 Q;  3PUV A;  3C3L A;  5EPJ A;  4YHH Q;  4RFB A;  4LFC Q;  1EQR A;  3QOJ A;  1EEF D;  4GLA C;  2DJF C;  3OIQ A;  4GN4 B;  4RH6 A;  3MXP A;  5EKK A;  3R8B A;  3FDT A;  3SHL A;  1WJJ A;  3CQZ H;  2PNH A;  1H9J A;  4Y52 H;  3FRP B;  4MHE A;  3CF5 A;  1C8C A;  1UNS A;  2F4V Q;  3TP6 A;  2RSN A;  5G3L D;  2CFM A;  1TII D;  1GUT A;  2PZW A;  1IXR A;  4F87 A;  5CV6 A;  5FO7 B;  4R4Q A;  1XPR A;  3TN2 A;  1FJG Q;  4DNT B;  3UI2 A;  1SE4 A;  3I8Z A;  1E1O A;  1B4O A;  1CSP A;  1IBL L;  1TWA H;  1YZ6 A;  1PHJ A;  5JOB A;  5BN4 A;  2EVB A;  2F3I A;  1B2T A;  1DJR D;  2NVX B;  3AU7 A;  1STA A;  2O5I C;  2DUD A;  2CQA A;  2UXC Q;  5DM6 3;  3CCE A;  5T1G A;  3P75 A;  5IIF A;  2JYO A;  2EXZ A;  3S2D H;  1D6E C;  2JN4 A;  1AE3 A;  4HMI A;  4ZKC B;  4K0K L;  3GTK B;  3VA5 A;  1YNN C;  4RKB A;  4A3E B;  5C44 G;  4JI3 Q;  3WDN A;  1NR4 A;  5I6Y A;  4KV6 A;  3F2U A;  4DV6 L;  2F0H A;  4KI0 A;  4X66 L;  4J1M A;  5IYC H;  1LUZ A;  1Q8K A;  4RGN A;  1Q3L A;  2JJQ A;  5M3F G;  1EY4 A;  5H1S E;  1F2Z A;  4QGU A;  1IW7 C;  4BY7 B;  5DEH A;  2QW7 A;  4YHH L;  1FNW A;  3QOL A;  4DK1 A;  4GLX A;  2Q2T A;  4B3S Q;  2R92 B;  3FEW X;  2F0G A;  1KL9 A;  3JC6 6;  2B3G A;  3CRK C;  3KF8 A;  3A54 A;  3E3X A;  5E3F A;  1E2W A;  2OWO A;  5C0X I;  3BDC A;  2Z4I A;  1I50 H;  3J81 i;  5CR3 A;  4JI6 L;  3WWV A;  3GTQ H;  4HED A;  1C9O A;  1Y14 B;  1QNU A;  3HP3 A;  4DV1 Q;  2F0D A;  4K6D A;  4L63 B;  5J1Z A;  1FYC A;  5M5Y H;  3TRE A;  4OWX B;  2HUG A;  5FO9 B;  3CC4 A;  2F4V L;  1PFM A;  1Y1V G;  1PYW D;  3NXW A;  4G7Z C;  3H3V I;  1EY0 A;  3NTH A;  1IHZ A;  1N9W A;  2B2U C;  2LY7 A;  3TBI B;  5C0X H;  5COR A;  4DR2 Q;  3O13 A;  3T51 B;  4LFB Q;  1K3R A;  3L7Z C;  3I4N H;  3CHB D;  4B3M L;  4IUR A;  1BF4 A;  3GTO H;  1WI5 A;  4JC0 A;  4BY1 G;  5KYL A;  4KD3 A;  5FJ8 H;  4HIK A;  4A3I H;  1EIF A;  1H9M A;  1I6H B;  5DLQ E;  2FJ2 A;  4NMZ A;  4V0B A;  2AWN A;  4JI3 L;  4YWM A;  2LXJ A;  4L5Q A;  3GTJ B;  2JA7 H;  3BDL A;  1HPC A;  3S1M H;  5FK9 C;  2A8V A;  4PMC A;  4DV6 Q;  5EQ0 A;  1XYI A;  1TVX A;  5K36 H;  4UY8 C;  2A73 B;  1WTR A;  2A5H A;  5IYD H;  4DV4 Q;  2KHI A;  1CI3 M;  3CCM A;  4BBR B;  3H0G B;  3W5O A;  4F88 A;  3SDZ A;  1QOH A;  3MFY A;  2EY5 A;  4JPB W;  2JA8 G;  4ID6 A;  5KYI A;  2K5H A;  5I9P A;  3PUY A;  4HSP A;  1YIJ A;  1IZ6 A;  3E9H A;  2E74 C;  2B2V A;  1MBY A;  4LF9 Q;  1EWI A;  1JC7 A;  3HOV H;  2KCT A;  4BS9 A;  1TWG B;  2JA5 G;  4POG A;  1SBB B;  4PG3 A;  1GHJ A;  4DV2 Q;  1PFN A;  1D5X C;  4R8I A;  4PZ8 A;  1PV4 A;  1VMP A;  1W3S A;  4IO9 A;  2MUY A;  5CV4 A;  4HIO A;  1OXS C;  3LWU A;  3J7A 5;  4JV5 L;  4JK1 C;  3I91 A;  4GN3 B;  4IPG A;  4P74 A;  3UDI A;  3VDY A;  3KDF A;  1RF2 D;  3LX0 A;  1RKN A;  1PZK D;  4RA8 A;  3TP7 A;  5FLX L;  4DNR B;  1OXV A;  1RL2 A;  4A3C H;  4AYB G;  4LF4 Q;  4R4T A;  1H9S A;  3A7L A;  1SMX A;  2PW5 A;  1PMR A;  5CGK A;  2YU9 B;  1B9M A;  1M1K C;  2AKW B;  5IYD G;  4KY7 A;  1IL8 A;  4A3J B;  4A3M B;  4B3M Q;  3V05 A;  4JI0 Q;  4CGY B;  2NZO A;  2UUA L;  5E7N A;  4YCW A;  4MTN A;  2KHJ A;  1X3G A;  1ENF A;  2IX0 A;  1ESR A;  2HDL A;  5HUR A;  5IT9 c;  4ILW A;  2EJG C;  2C35 B;  1X32 A;  1XPO A;  2RCN A;  4QIW B;  2PQA B;  2JA8 B;  2ENB A;  3HOU G;  4DAM A;  5EGT A;  4DA2 A;  2F4I A;  2HHH Q;  4JBJ A;  1TWH H;  2JA7 B;  1N34 Q;  1PLF A;  1Z7T A;  4RG1 A;  3HOY B;  3H0G H;  4XQQ A;  1XXG A;  3ONA B;  2VY3 A;  4LF9 L;  3OWF A;  5IGC A;  4CBV A;  4C2M H;  4A3F B;  3ZYY X;  3KDF B;  1QZH A;  5ELD A;  4X65 L;  4AYB B;  2ICE C;  1WFQ A;  2NYZ D;  2NN6 H;  4DAY B;  2WAQ E;  3MEF A;  3S1M B;  3TZU A;  2WAQ B;  2Q2U A;  5DNF A;  2G9D A;  3AEV A;  3DWA A;  1UE5 A;  4I65 A;  4ZK9 B;  4GS3 A;  4JV5 Q;  4DR5 L;  1SJH D;  5M5Y B;  5FLX c;  1N32 Q;  4NW2 A;  1DYQ A;  2RKS A;  4DV0 Q;  4M1U B;  1A3T A;  1DON A;  3W1G A;  1Y1W H;  1QIL A;  5IT9 E;  1KIX A;  1HQR D;  4GZY C;  2PPB C;  5D14 A;  4CDC C;  3HOX G;  2E76 C;  1C4Q A;  3OTO L;  1XTD A;  3U58 A;  5IGD A;  1SJE D;  1TS4 A;  2B2U A;  4BY1 H;  3PCO B;  1Q90 A;  3H3V C;  2L12 A;  3BVZ A;  5BN5 A;  4A3B B;  5ELF A;  2I5M X;  1V1O A;  5I4D A;  4H44 C;  2E2J H;  4RCO A;  3D0F A;  4DV3 Q;  3GP7 A;  3I3C A;  4LF4 L;  1ILQ A;  3Q23 A;  2NVT H;  4GNX B;  3U9O A;  1BUV T;  2ID0 A;  3CPW A;  2K03 A;  3K7A B;  1U4R A;  1CKM A;  2XRS D;  2NB0 A;  1G8Z D;  1DD2 A;  1N34 L;  2WKD A;  3K80 C;  1BCP D;  1R9T B;  4EQO A;  2EXD A;  1V9P A;  1N8R C;  4ME3 A;  3NTK A;  5KRU A;  3UDG A;  4CDF C;  5J39 A;  3S2D B;  5C3E B;  1VCI A;  4L8J A;  4C3H H;  5HY6 A;  2SOB A;  3U9S A;  4TVA B;  5D3D A;  1C0A A;  1BKB A;  2KUM A;  4BBS H;  2AWO A;  4HJ7 A;  1IBM Q;  2O4X A;  5IYB H;  2K32 A;  4LAA A;  5FLX E;  5IYC G;  1KHI A;  4C3I G;  3PUX A;  1OXX K;  3CD6 A;  4JI2 L;  3OW2 A;  2F0W A;  2LMC B;  1JE4 A;  4I7A A;  1X54 A;  2R93 G;  3E6Z X;  4DFA A;  4GKK Q;  1RTN A;  5C4J H;  3NPP A;  4KMU C;  2E5L Q;  2WP8 J;  5G3L F;  3NBH A;  2NVX H;  3MVV A;  1YBY A;  3OTO Q;  3J81 L;  4A3B G;  1YJW A;  4JBW A;  5J22 A;  1TWF H;  2RDG A;  3HOZ G;  4DUY L;  4A3D G;  1NUC A;  1AFP A;  1K0R A;  3B6Y A;  3FKI G;  2EPB A;  2E2I B;  1EZ8 A;  3S15 B;  3DM1 A;  2F0V A;  1B44 D;  1W6K A;  1SNO A;  1GUG A;  3PMF A;  1VF7 A;  4LWC A;  4Q5V A;  1AN8 A;  1YJ9 A;  1AEX A;  1HCZ A;  1JOR A;  1S3O A;  4JI1 Q;  3S17 B;  2QGQ A;  4R9W A;  1CFM A;  2QEJ C;  3BZD B;  3S1R B;  2OTL A;  4YWK A;  4OGQ C;  2Y0S B;  3PO2 G;  2D0P A;  3BVM A;  2KHS A;  4DAP A;  1SFO B;  3KJP A;  2VS1 A;  3SE0 A;  1Y1W B;  2JEA I;  2OXP A;  4ODG A;  3DMU A;  4EX5 A;  4DR6 Q;  3HFZ B;  4B3R Q;  3HOU H;  5CV8 A;  1GM5 A;  5CYU A;  2D62 A;  3TSS A;  1JQY D;  1SMY D;  3ND9 A;  2L0C A;  1SYG A;  3HOW H;  4TRD A;  5KNB A;  1MGS A;  3OMG A;  3S1Q H;  4WFN 3;  5C3W A;  3C1F A;  4A3L H;  4OXP A;  4DAY A;  2OF1 A;  3P7J A;  2FXQ A;  5TSS A;  2CW0 C;  5IGF A;  2R7Z B;  4TKO B;  4JG2 A;  1S5B D;  2ZJQ A;  4DKA C;  3KBG A;  1XMQ Q;  4ZUI A;  2HQE A;  1QG7 A;  1MJE A;  3CCS A;  1OO9 B;  2A1A A;  1SR3 A;  3MTS A;  3H15 A;  1GUN A;  3S14 H;  4DR1 L;  3L3O C;  1MJC A;  2OQ0 A;  3HOZ B;  1KDA A;  2QDL A;  2IT1 A;  1I4H A;  5LMN W;  1PTO D;  4DV5 Q;  1A62 A;  3A56 A;  1X6O A;  4NXM Q;  4ZRZ A;  3T1H Q;  2P5Z X;  1HA5 A;  1WYD A;  1JWU D;  4POF A;  4BXX H;  4MN3 A;  4DUZ L;  1VQ4 A;  2ICI A;  1XJV A;  2VQF Q;  3D8G A;  4DR7 Q;  2IPK D;  1NJI C;  4L5R C;  2VQE Q;  1B3Q A;  3UDF A;  5C4H A;  4A3E G;  4N9T A;  1F77 A;  1QVF A;  1T5E A;  5C4J B;  1KQS A;  3JAM c;  2LSS A;  1ZKO A;  4S3S A;  4JI1 L;  1T9H A;  3PUZ A;  4DK3 C;  3S9W A;  1WCM B;  3NQI A;  3OHX C;  3GTL H;  4BY7 G;  5JJK A;  1HNX L;  3D6W A;  2MGS A;  1STE A;  2F0M A;  3FP9 A;  2R7Z G;  4BBS B;  4YCU A;  3Q6S A;  2F0Q A;  4OL7 A;  1CQF A;  4Y7N H;  4OO1 G;  4XYQ A;  3HKZ B;  1AZQ A;  3HGB A;  4ULL A;  2JP1 A;  3T56 B;  4QIW E;  4WRD A;  2J7Z A;  2KCM A;  4AIM A;  2N78 A;  4YY3 L;  2JK8 A;  4BXX G;  1GO3 E;  1I6V C;  1FNV A;  2NVQ H;  1J5E L;  1HR0 W;  1U5K A;  1X3F A;  2F0N A;  2XRQ D;  1KNA A;  3ULJ A;  4ALP A;  3KUP A;  5JJI A;  3CCJ A;  2IY5 B;  3NQT A;  3T1Y L;  1SN8 A;  3PIO A;  2AUK A;  3I4N B;  5M9O A;  1L1O A;  4JI4 Q;  2A68 D;  3SXH A;  2F1M A;  2CKZ B;  4OX9 Q;  3U4V A;  2K33 A;  3T53 B;  3TRZ A;  1K8A C;  2XGT A;  3I2Z A;  4NXM L;  2YTV A;  4GOP A;  3GTM H;  5EBC A;  4QUC A;  1OXT A;  5K36 G;  2MHV A;  3RUZ A;  5HGQ A;  4UDU C;  1YVC A;  3CU7 A;  3AFP A;  2J4X A;  1O80 A;  1GD7 A;  1LLR D;  1JB3 A;  4IJL A;  5KIX A;  4P73 A;  1C7Y A;  2B8F A;  3GTM B;  2KVM A;  2M00 A; 
#chains in the Genus database with same CATH homology
 2M9V A;  1JWM D;  2JSO A;  2MJ8 A;  3BS1 A;  2QKI C;  2GA4 B;  3GQB A;  3M85 A;  1HUN A;  3HEJ A;  1UEA B;  1YNN D;  5DM7 3;  3VYR A;  2XWJ B;  1KAB A;  3EFX D;  2EJM A;  1SYF A;  2IX3 A;  4KN4 C;  2BOS A;  1CA6 A;  3T13 A;  3DXJ C;  1SAP A;  4J6H A;  3PIP 3;  4K5W A;  2QF7 A;  2AQ1 B;  5IGG A;  1ICW A;  1SYC A;  2KEC A;  4P2C B;  1XWE A;  3VR4 A;  2O2L D;  4UAI A;  1CT1 D;  2IX1 A;  2Q8I B;  3IKJ A;  5A35 A;  1EYC A;  2C5C A;  3I70 A;  1SXT A;  1DXM A;  4CKC A;  4RKL A;  1EQV A;  1TY0 A;  4OO1 H;  1CQV A;  3OWE B;  4PV1 C;  4IFD H;  3P1H A;  4XQJ A;  3KLS A;  1YNJ C;  4C3H G;  3QB3 A;  4WOR A;  1SND A;  2A74 C;  1Y69 U;  1CK1 A;  3CQZ B;  4FVM A;  3HOX B;  4ZQ3 A;  5IGB A;  1PTO H;  1NCV A;  3EJI A;  4B08 A;  2TSS A;  4OHJ A;  5HGT A;  1LT6 D;  3S1Q B;  3J80 E;  3J7A V;  4H13 C;  3AMU A;  2B2W C;  5EPK A;  1V8Q A;  2LFN A;  1A2T A;  4N9P A;  4LMQ D;  3C2P A;  1VF5 C;  2SEB D;  1MSG A;  3QIA A;  2X6L A;  1BXT A;  1F9S A;  2B2V C;  2JA6 B;  4K2L A;  1ENA A;  5E4W C;  1CTM A;  3PUW A;  4DK0 A;  1Q1B A;  3NWT A;  1ZYR C;  1TT2 A;  4KHZ A;  1V1P A;  4HTH A;  1I4G A;  1K8M A;  3D6C A;  1NSN S;  2L11 A;  4DF7 A;  3VYU A;  3MXN A;  1OXU A;  1ZEQ X;  2M00 A;  2RVL A;  2EYF A;  4CJ1 B;  2K1B A;  1CHP D;  1X3Q A;  3NSW A;  4IFD J;  2MP1 A;  1H9R A;  1O7L A;  1BNZ A;  2SNM A;  4B9X A;  1SNP A;  1XTC D;  1Z47 A;  3HS0 C;  2EY1 A;  5EBD A;  2MPM A;  2K05 A;  2PQE A;  4HAE A;  5NUC A;  4M8A A;  1D2B A;  1JR0 D;  3K0Y A;  4CKE A;  1GOZ A;  2RDH A;  2KJX A;  1EFI D;  1S5F D;  4K5V A;  2B8G A;  4CJ2 C;  2CW0 D;  1LT5 D;  1VMC A;  2IJ0 A;  1E2Z A;  2L4N A;  1KLG D;  3NP8 A;  2K01 A;  1KDB A;  3NK9 A;  2IL8 A;  3BYT B;  2F0P A;  4CHT B;  2L9H A;  2XWB B;  2CHB D;  2OEO A;  4IUQ A;  2DN8 A;  1EYA A;  2A69 D;  3C46 A;  4IZ8 A;  1SE2 A;  1T5X D;  1ML0 D;  3AB9 A;  2L5T A;  2BE5 D;  1Q8I A;  2X69 A;  2PMZ B;  4XDX A;  2R6G A;  3OMC A;  3KBX A;  1BBX C;  1HTL D;  1DM0 B;  1D5M C;  3TZD A;  2B2T C;  2R61 A;  3H94 A;  5ISR A;  1K8O A;  1LTT D;  5CBE E;  2B2Y C;  2NBF A;  2EYH A;  5T1I A;  3Q0A A;  1GJX A;  2BCO A;  2XSC A;  2NWG A;  5COY A;  5M5W B;  4Y7N B;  4EVO A;  1B1Z A;  1DOK A;  4ZLT F;  3OOC A;  2D5D A;  1HFN A;  2DNE A;  2F03 A;  3G7L A;  4CKB A;  2WV6 D;  5KNC A;  2V4D A;  1PTO F;  2A68 C;  1R4P B;  2R93 B;  1Q12 A;  3FKI B;  1PXU A;  4IUT A;  4KKT A;  4OO1 I;  5FOB B;  3VA7 A;  2VB3 X;  1CM9 A;  2SDF A;  1RTO A;  3M7N A;  4FF3 A;  1TS3 A;  1EY8 A;  3OPO A;  4E6I A;  1ET9 A;  3GD7 A;  1WTX A;  4ZKB B;  3FPU B;  3Q22 A;  3MZ5 A;  4FYD A;  2FMC A;  5JVG 3;  3VR2 A;  3S2H B;  2BDN A;  1SE3 A;  3G6J B;  1EY7 A;  4WJW A;  4K8I A;  1SYE A;  4FO2 A;  2BDO A;  4A3I B;  2JXM B;  2PZU A;  3HOV B;  2NUC A;  1Y8P B;  2HCI A;  3A7A B;  5I6W A;  1STH A;  4PNY A;  3MC0 B;  3T4A C;  1TY2 A;  2N88 A;  5LL6 S;  5A2Q E;  5AFW A;  4IN3 A;  1GUS A;  1LTI D;  1HTP A;  4KY6 A;  2M2L A;  2AQ2 B;  4IQZ A;  1TQO A;  3KLS X;  4QUF A;  1SNM A;  1D5Z C;  3R93 A;  5K5P A;  3NBI A;  2NTS A;  4FP5 D;  5JAV A;  3RLF A;  3HG9 A;  1J8I A;  1BQQ T;  2K5W A;  2DY8 A;  2N55 A;  3TDQ A;  4KKU A;  1EWC A;  2HCC A;  3ND8 A;  1PDQ A;  1M8A A;  3DWP A;  2E2D C;  2DY7 A;  4Q0F A;  4K14 A;  4IUP A;  4RAU C;  3FPP A;  2PO4 A;  1B53 A;  1HA6 A;  1YNJ D;  1EY5 A;  2KCC A;  4IUU A;  1F9P A;  2J0T D;  2WB1 B;  2EOT A;  4C3H B;  5CV9 A;  1KAA A;  3JAM L;  1F2Y A;  1RCV D;  3V2T A;  2CVR A;  1GUW A;  1B9N A;  5EPL A;  2K28 A;  1S5C D;  5IGE A;  2EYM A;  5LHY 1;  1AZP A;  2K5D A;  4XQN A;  3W2D A;  1I4P A;  3J81 E;  2E2J B;  1ONL A;  3NUC A;  1SYD A;  5A2Q L;  1JIC A;  1EOT A;  1II3 A;  3D4W A;  5JEA G;  1LTB D;  5ELE A;  5KND A;  4TQU S;  1Y1V B;  3DHQ A;  3IFD A;  2RQX A;  2K7V A;  2RA4 A;  1CZG A;  2Q8R E;  3D31 A;  1EIH A;  4H0L C;  3MAQ A;  4U67 3;  4A3D B;  4LK1 C;  1G91 A;  4DU9 A;  1IYU A;  1LTG D;  3IAY A;  2VUM B;  1RDP D;  2Z1C A;  1WVL A;  3RZO B;  3RZD B;  1E2V A;  3A8I E;  1HXY D;  4FXG C;  1X3P A;  5C5L A;  3K6O A;  1SNQ A;  3P20 A;  3HOU B;  1BO0 A;  4O42 A;  4K2K A;  1NAP A;  2LS0 1;  1PTO B;  5LL6 X;  4C3J G;  1IKL A;  4U68 A;  5C44 B;  3SR1 A;  4DN4 M;  1XX8 A;  4TSS A;  2QDB A;  5F2D A;  2ZT9 C;  4OIK A;  3W3A A;  5BN3 A;  1PRT C;  5CBA E;  1E0B A;  2TMP A;  3LWE A;  1QWY A;  1ZYR D;  2F0T A;  1A15 A;  1WTV A;  1I4R A;  3E0J A;  2WKC A;  1UAP A;  4F8M A;  1ENC A;  2PW7 A;  2F0K A;  4YIJ A;  3VYT A;  2WAC A;  1DOL A;  3GTG B;  3FMC A;  1ILP A;  1IKM A;  1FD7 D;  4L6T B;  4IFD I;  2AQ3 B;  3A55 A;  2OT2 A;  2IWH A;  2F0J A;  3FVQ A;  4KJN A;  4EGV A;  3SK5 A;  1A3V A;  1L0X B;  4K8J A;  2JEB I;  2AUJ D;  4XTC S;  1K83 B;  1QCB D;  5D65 A;  2Q8T A;  1I4Q A;  1G6Z A;  4RGT A;  2EY6 A;  3R2T A;  4NDX A;  2KQ3 A;  4I7Z C;  4R8N A;  3GTO B;  1H9S B;  3VR6 A;  4RGM A;  3VR5 A;  4J8Q A;  2F0O A;  3PO2 B;  1R4Q B;  1JOO A;  4BA1 I;  1HUM A;  4FXK C;  2PYK A;  1BR9 A;  4C2M B;  1I50 B;  4Z9C B;  1Z6H A;  1PRT D;  1DZ1 A;  2B2W A;  4C3I B;  5CC4 A;  1B3A A;  4QMG A;  2EYP A;  3EQL C;  3M7G A;  1ZXT A;  3S16 B;  1Q1E A;  2SNS A;  5IT9 L;  4C56 C;  2EYJ A;  1EEI D;  5I2Y A;  5M3F B;  5C0X G;  3D4R A;  4QCL A;  1O78 A;  2XNA C;  3GTL B;  2HDM A;  4FF1 A;  2KA7 A;  4KN7 C;  3C1E A;  4ZYS A;  5IOC A;  2H1E A;  2RSO A;  3NTI A;  3HZX A;  1MD2 D;  2G9H D;  1WD1 A;  1HRJ A;  1FR3 A;  1STG A;  3J7A F;  5C0X J;  4IFD G;  1EZ6 A;  1PZJ D;  3EVQ A;  2FIN B;  1EY6 A;  1EL0 A;  4KK7 A;  1CA5 A;  3SVM A;  2F3W A;  2IW3 A;  1RD9 D;  5EKL A;  1SMY C;  2EYL A;  3MXU A;  4DAV A;  3L9A X;  4C1N I;  3MEH A;  4DXG A;  3H91 A;  5CMD A;  3S14 B;  2K6A A;  3PO3 B;  1LTA D;  2Z4H A;  2WII B;  1D1I A;  1KLU D;  4XT3 B;  1LV9 A;  4XYO A;  3D3R A;  5D3I B;  4RCN A;  2F3V A;  3SK6 A;  1TU2 B;  4K6L A;  3NWS A;  1BCP C;  1SSO A;  2D9U A;  3MHB A;  1Y8N B;  2F0E A;  1O7Y A;  3E5S A;  2A6E D;  1VDZ A;  4X3S A;  1GUO A;  3H6M A;  4C3J B;  4XXE A;  1G2T A;  2KCN A;  4RGO S;  3IFT A;  4HCS A;  2JA5 B;  4NKL A;  1EWH A;  4RHR A;  4NP5 A;  3K5O A;  3RMH A;  4EQP A;  1G2S A;  2NVY B;  1U4L A;  1JWS D;  2ZXP A;  1AW7 A;  2EDG A;  4DGZ A;  1ESF A;  3ERO A;  1H9K A;  3TME A;  2XIW A;  3BYY B;  1KNE A;  2KVM A;  3QO2 A;  2E75 C;  1DCZ A;  3M3Y B;  4DXF A;  3GTQ B;  1JOQ A;  1S5D D;  2A69 C;  2NTT A;  2NZ1 D;  3J7Y W;  1TWF B;  2FHT A;  4RWS C;  1LTS D;  2NN6 G;  2R3Z A;  1G29 1;  3PIO 3;  1BOS A;  3M4O B;  5KGU A;  3JAM E;  5CV5 A;  1Y8O B;  2A6H C;  1EQT A;  4B9W A;  4X3U A;  1U9R A;  5C4Z A;  4RHS A;  4XT1 B;  1PZI D;  5FO8 B;  1V43 A;  5CV7 A;  3MXG A;  1LAB A;  1EYD A;  2NVT B;  2FMM A;  1WTW A;  4A3K B;  1F9Q A;  1V1P B;  3NE5 B;  1GHK A;  1IW7 D;  4FF2 A;  3VYS A;  3N6R A;  2B39 A;  4FXD A;  2B63 B;  3GTP B;  3A8K E;  1C48 A;  3GV6 A;  2A6H D;  1L0Y B;  4X3T A;  1ROD A;  1DOM A;  1TWA B;  4KD4 A;  1MSH A;  3K5N A;  4KTA A;  1STN A;  2D2C C;  4G57 A;  1PFB A;  3IL8 A;  2C9O A;  1CHQ D;  1QJO A;  2K5Q A;  5M3M B;  1SYB A;  1RHP A;  3S1N B;  3H09 A;  2NVQ B;  1EIG A;  1I4X A;  1STB A;  2EY2 A;  3DWQ A;  4BY1 B;  2QIL A;  2ZXR A;  3J80 L;  3BDO A;  4QB4 A;  3M4Y A;  1BCP B;  2ZXO A;  2B2T A;  3QJY A;  5C3X A;  3I4M B;  2PZT A;  3X3N A;  3I90 A;  2K04 A;  2Z8L A;  4ME5 A;  4ZUJ A;  1KDC A;  1EU4 A;  2QCP X;  2RBM A;  4EQN A;  4IAL A;  1TWH B;  1WTP A;  1B50 A;  2BE5 C;  2A6E C;  4V19 0;  3HRZ C;  2VXW A;  5EKI A;  1KTK A;  2BA1 A;  2XN9 C;  3BG3 A;  1JCK B;  1WD0 A;  4HMJ A;  4OIJ A;  2L1B A;  2PCF B;  3R2I A;  1U4M A;  1HHV A;  3V96 A;  4HCE A;  1D1K A;  5JPM C;  4BA2 I;  2EZV A;  3TP8 A;  4BWG B;  2RDF A;  1A3U A;  1QE6 A;  4PMB A;  1LAC A;  5E1F A;  1ET6 A;  2EYO A;  1A6X A;  1LTR D;  4QF4 A;  2VB2 X;  3I72 A;  5FKA C;  2I07 B;  3X3M A;  1RJT A;  4XIG S;  5ELC A;  5C6A A;  1LT3 D;  2E2H B;  4FNF A;  1SNC A;  2EE1 A;  2F0U A;  3VR3 A;  3K59 A;  2F0S A;  3N52 A;  1EY9 A;  1IYV A;  4G7H C;  3HOW B;  1CZW A;  1F2M A;  3OSO A;  2H4O A;  5KEE A;  1LO5 D;  1TKW B;  3LNN A;  2PNR C;  3ITP A;  4O1N A;  4IUN A;  3GO5 A;  5C4X B;  4MIU A;  3CKI B;  4ZAI A;  1EU3 A;  1PTO C;  5JPN C;  1SEB D;  1WTQ A;  3KK7 A;  1AP0 A;  1FNU A;  3MA2 B;  1JOK A;  1S5E D;  3MWY W;  3DEP A;  1TWC B;  3K5M A;  4CJ0 B;  2BA0 A;  5I9O A;  1HQM C;  2WIN B;  2F0L A;  3RD4 A;  2X6G A;  3T16 A;  4ABN A;  1I3Q B;  2KOL A;  3ERQ A;  3SK4 A;  3K58 A;  4IUV A;  5M5X B;  1NR2 A;  1QB5 D;  2F0F A;  2VNU D;  3A8J E;  5JVH 3;  3QWN A;  2YYZ A;  4KHV A;  1QNK A;  5JEA J;  3DUZ A;  4X3K A;  2JE6 I;  3CRL C;  3DEO A;  5DAU A;  4A3G B;  3I4L A;  3K5L A;  4F7X A;  4H7B A;  4HSV A;  4G7O C;  1F2L A;  5JEA H;  2KED A;  2F0I A;  1M4V A;  4PQX A;  3KLR A;  3WOF A;  1GXD C;  3URY A;  1W6J A;  3GV3 A;  2EJF C;  1HFG A;  3OW7 A;  3NHH A;  4HN7 A;  3BVG A;  3K57 A;  3D4D A;  4PMW A;  5JJZ A;  2XVS A;  5ELB A;  1STY A;  3R3O A;  1U4P A;  4KJO A;  4KKS A;  2DNC A;  3SEB A;  1FGB D;  1TS5 A;  4C1N K;  2L55 A;  1UUP A;  4FF4 A;  3QG1 A;  1S4Z A;  4A93 B;  2FFK B;  1LT4 D;  4K5X A;  5IOD A;  4LJZ C;  1SDF A;  1TR5 A;  3SK8 A;  1BDO A;  2KEE A;  1WTO A;  2O5J C;  3OIP A;  2NN6 I;  3MFG A;  5EJW A;  2I46 A;  1A2U A;  3I73 A;  2B2Y A;  4HR7 B;  1F9R A;  1O7Z A;  5C5M A;  1PRT B;  3TP5 A;  1TS2 A;  3Q24 A;  1BCP F;  3EA6 A;  1J9O A;  5I2X A;  5E4X A;  4KY5 A;  4G4K A;  3PV0 A;  1PRT F;  1MI2 A;  3WOE A;  2LKV A;  3PUV A;  3C3L A;  5EPJ A;  4RFB A;  3QOJ A;  1EEF D;  3OIQ A;  4RH6 A;  3MXP A;  5EKK A;  3R8B A;  3FDT A;  3SHL A;  1H9J A;  3FRP B;  4MHE A;  1C8C A;  1UNS A;  3TP6 A;  2RSN A;  5G3L D;  1TII D;  1GUT A;  2PZW A;  4F87 A;  5CV6 A;  5FO7 B;  3TN2 A;  4DNT B;  3UI2 A;  1SE4 A;  3I8Z A;  1B4O A;  5JOB A;  5BN4 A;  2EVB A;  1B2T A;  1DJR D;  2NVX B;  3AU7 A;  1STA A;  2O5I C;  2CQA A;  5DM6 3;  5T1G A;  3P75 A;  5IIF A;  2JYO A;  2EXZ A;  1D6E C;  4HMI A;  4ZKC B;  3GTK B;  3VA5 A;  1YNN C;  4RKB A;  4A3E B;  3WDN A;  1NR4 A;  5I6Y A;  4KV6 A;  3F2U A;  2F0H A;  4KI0 A;  4J1M A;  4RGN A;  1Q3L A;  1EY4 A;  1F2Z A;  1IW7 C;  4BY7 B;  5DEH A;  1FNW A;  3QOL A;  4DK1 A;  2R92 B;  3FEW X;  2F0G A;  5E3F A;  3CRK C;  3KF8 A;  3A54 A;  1E2W A;  5C0X I;  3BDC A;  2Z4I A;  5CR3 A;  4HED A;  1QNU A;  3HP3 A;  2F0D A;  4K6D A;  4L63 B;  5J1Z A;  1FYC A;  2HUG A;  5FO9 B;  1PFM A;  1PYW D;  3NXW A;  4G7Z C;  1EY0 A;  3NTH A;  1IHZ A;  2B2U C;  2LY7 A;  5C0X H;  3TBI B;  5COR A;  3O13 A;  3T51 B;  3L7Z C;  3CHB D;  4IUR A;  1BF4 A;  5KYL A;  4KD3 A;  1H9M A;  1I6H B;  2FJ2 A;  4NMZ A;  4V0B A;  2AWN A;  3GTJ B;  3BDL A;  1HPC A;  5FK9 C;  4PMC A;  1XYI A;  5EQ0 A;  1TVX A;  5K36 H;  2A73 B;  1WTR A;  2A5H A;  1CI3 M;  4BBR B;  3H0G B;  4F88 A;  3SDZ A;  1QOH A;  3MFY A;  2EY5 A;  4ID6 A;  5I9P A;  3PUY A;  4HSP A;  2E74 C;  2B2V A;  1MBY A;  1JC7 A;  4BS9 A;  1TWG B;  1SBB B;  1GHJ A;  1PFN A;  1D5X C;  4R8I A;  1VMP A;  2MUY A;  5CV4 A;  1OXS C;  3LWU A;  4JK1 C;  3I91 A;  1RF2 D;  3LX0 A;  1RKN A;  1PZK D;  4RA8 A;  3TP7 A;  5FLX L;  4DNR B;  1OXV A;  1H9S A;  3A7L A;  2PW5 A;  1PMR A;  5CGK A;  2YU9 B;  1B9M A;  4KY7 A;  1IL8 A;  4A3J B;  4A3M B;  3V05 A;  4CGY B;  1ENF A;  2IX0 A;  1ESR A;  2HDL A;  5HUR A;  4ILW A;  2EJG C;  1X32 A;  4QIW B;  2JA8 B;  2ENB A;  5EGT A;  4DA2 A;  2F4I A;  2JA7 B;  1PLF A;  1Z7T A;  3HOY B;  4XQQ A;  1XXG A;  3ONA B;  3OWF A;  5IGC A;  4CBV A;  4A3F B;  3ZYY X;  5ELD A;  4AYB B;  2ICE C;  2NYZ D;  2NN6 H;  3S1M B;  3TZU A;  2WAQ B;  5DNF A;  2G9D A;  3DWA A;  4I65 A;  4ZK9 B;  1SJH D;  5M5Y B;  4NW2 A;  1DYQ A;  2RKS A;  4M1U B;  1A3T A;  1DON A;  1QIL A;  5IT9 E;  1HQR D;  4GZY C;  2PPB C;  5D14 A;  2E76 C;  1C4Q A;  5IGD A;  1SJE D;  1TS4 A;  2B2U A;  1Q90 A;  3H3V C;  2L12 A;  3BVZ A;  5BN5 A;  4A3B B;  5ELF A;  1V1O A;  5I4D A;  4H44 C;  4RCO A;  3GP7 A;  3I3C A;  1ILQ A;  3Q23 A;  3U9O A;  1BUV T;  2ID0 A;  2K03 A;  3K7A B;  1U4R A;  2XRS D;  2NB0 A;  1G8Z D;  1DD2 A;  2WKD A;  1BCP D;  1R9T B;  4EQO A;  3NTK A;  5KRU A;  5J39 A;  3S2D B;  5C3E B;  1VCI A;  4L8J A;  2SOB A;  3U9S A;  5D3D A;  2KUM A;  2AWO A;  2O4X A;  2K32 A;  4LAA A;  5FLX E;  4C3I G;  3PUX A;  1OXX K;  2F0W A;  2LMC B;  1JE4 A;  3E6Z X;  4DFA A;  1RTN A;  3NPP A;  4KMU C;  2WP8 J;  5G3L F;  3NBH A;  3MVV A;  3J81 L;  4JBW A;  5J22 A;  2RDG A;  1NUC A;  1AFP A;  2EPB A;  2E2I B;  1EZ8 A;  3S15 B;  3DM1 A;  2F0V A;  1B44 D;  1W6K A;  4Q5V A;  1SNO A;  1GUG A;  3PMF A;  1VF7 A;  1AN8 A;  1AEX A;  1HCZ A;  1JOR A;  3S17 B;  1CFM A;  2QEJ C;  3BZD B;  3S1R B;  4OGQ C;  2Y0S B;  3BVM A;  2KHS A;  4DAP A;  1SFO B;  3SE0 A;  2JEA I;  1Y1W B;  2OXP A;  4ODG A;  3DMU A;  5CV8 A;  5CYU A;  2D62 A;  3TSS A;  1JQY D;  1SMY D;  3ND9 A;  2L0C A;  1SYG A;  4TRD A;  5KNB A;  1MGS A;  3OMG A;  4WFN 3;  5C3W A;  3C1F A;  4DAY A;  2OF1 A;  3P7J A;  5TSS A;  2CW0 C;  5IGF A;  2R7Z B;  4TKO B;  1S5B D;  3KBG A;  4ZUI A;  2HQE A;  1QG7 A;  1OO9 B;  3MTS A;  1GUN A;  3L3O C;  3HOZ B;  1KDA A;  2IT1 A;  1I4H A;  1PTO D;  3A56 A;  4ZRZ A;  1HA5 A;  1JWU D;  4MN3 A;  2ICI A;  3D8G A;  2IPK D;  5C4H A;  4N9T A;  1F77 A;  1T5E A;  5C4J B;  1ZKO A;  4S3S A;  3PUZ A;  3S9W A;  1WCM B;  3NQI A;  3OHX C;  3D6W A;  2MGS A;  1STE A;  2F0M A;  4BBS B;  3Q6S A;  2F0Q A;  4OL7 A;  1CQF A;  4OO1 G;  4XYQ A;  3HKZ B;  1AZQ A;  3HGB A;  4ULL A;  2JP1 A;  3T56 B;  4WRD A;  2J7Z A;  1I6V C;  1FNV A;  2F0N A;  2XRQ D;  1KNA A;  3KUP A;  3NQT A;  2AUK A;  3I4N B;  5M9O A;  2A68 D;  3SXH A;  2F1M A;  2K33 A;  3T53 B;  5EBC A;  4QUC A;  1OXT A;  5K36 G;  2MHV A;  3RUZ A;  4UDU C;  3CU7 A;  2J4X A;  1O80 A;  1LLR D;  1JB3 A;  5KIX A;  3GTM B;  2B8F A;  4R9W A;  5KYI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...