3MZ5A

Crystal structure of staphylococcal nuclease variant delta+phs l103a at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
b'LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEAAVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Cavities determine the pressure unfolding of proteins.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2010-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3mz5A00
1KAAA 4NMZA 2EYFA 3C1FA 1U9RA 2F0LA 1A2UA 4HTHA 4F8MA 3P1HA 2F0JA 3MHBA 4ME5A 1JOKA 3HEJA 4NKLA 5C6AA 4EVOA 1TR5A 2SNSA 2PZTA 3NQTA 1ENAA 3ITPA 5EGTA 5IIFA 4J6HA 2F0MA 1JOQA 1EYAA 3D4DA 4KD3A 5J39A 3VA5A 5C3WA 5IGDA 1KDCA 2EXZA 4IALA 2OXPA 3PMFA 4K8JA 5CV7A 2ENBA 4QB4A 4R8NA 5C4ZA 1JORA 3NUCA 2PW5A 3DHQA 4EQPA 1STGA 1SYCA 3NP8A 5DEHA 3LX0A 5IGEA 4IZ8A 4ZUIA 5I9PA 3OMCA 1AEXA 1EY4A 5J1ZA 2EYHA 1EY6A 3NXWA 3HZXA 5KRUA 5JAVA 1SNQA 1JOOA 5CR3A 2EY2A 4K5VA 4K8IA 4PNYA 3QB3A 4RKBA 2F0HA 2SOBA 4S3SA 4KTAA 1EZ8A 5ISRA 3BDLA 4N9PA 1F2ZA 2EYMA 4HMIA 5KYLA 2HQEA 3TP7A 5I6WA 4KY6A 3ERQA 3R3OA 2EYLA 4KJNA 2NUCA 5KEEA 3NHHA 1TT2A 1SNDA 1EZ6A 4DU9A 2F0DA 4QF4A 3SXHA 1EYCA 3SR1A 4DGZA 3SK4A 4K6DA 5C4HA 1STBA 1KDAA 3D6CA 2EYOA 2F0PA 4B9WA 3OWFA 5I6YA 1TQOA 4DF7A 1SYDA 2EYPA 4DFAA 2F0SA 4ODGA 2F0KA 4WRDA 5F2DA 1SYFA 3OSOA 1SNOA 2F0OA 5JOBA 3SHLA 4I65A 2F0GA 2PZUA 4IUNA 4KD4A 4MIUA 4TRDA 4ZQ3A 3T16A 3QOJA 5CGKA 3D4WA 5HURA 1SYEA 1F2YA 1SYBA 4K2KA 5E3FA 4YIJA 1EY8A 3SK6A 1NSNS 3SK8A 5IGGA 2OEOA 2LKVA 1KDBA 2F0WA 4H7BA 5M9OA 4E6IA 2EY5A 5EKKA 4B9XA 4J1MA 3S9WA 1NUCA 2O4XA 2PW7A 5CC4A 3QOLA 5CV8A 1EY5A 3D8GA 5DAUA 1A3VA 4RKLA 1II3A 2F3WA 2F0VA 3MVVA 1EYDA 1RKNA 2PZWA 2F0EA 3C1EA 2F3VA 5C5LA 5C5MA 2PQEA 4NP5A 2EY6A 3TP6A 4F7XA 5C3XA 4PMCA 5K5PA 4K5XA 5KGUA 2F0UA 3NK9A 2F0FA 3V2TA 5IOCA 1SNPA 3MXPA 4ZUJA 1EY0A 4LAAA 2RDFA 3E5SA 3EJIA 3MZ5A 4K2LA 4KHVA 4N9TA 4NDXA 2QDBA 4QMGA 5IGFA 1EQVA 1SYGA 4KY7A 4EQOA 4EQNA 1F2MA 1STAA 5IGCA 1KABA 2F0IA 3MEHA 1SNCA 3P75A 4ID6A 4K5WA 4KV6A 1IHZA 3RUZA 1STHA 1EY9A 1STYA 2PYKA 3OMGA 4OL7A 5NUCA 3TP8A 5I9OA 3BDCA 5CV5A 3SK5A 5IGBA 5J22A 5KIXA 3EROA 5EKLA 2F0NA 2F0QA 2SNMA 3EVQA 2KHSA 5CV9A 1A3UA 1STNA 2WACA 3H6MA 3DMUA 5E1FA 5HGTA 5CV4A 5CV6A 3T13A 1A3TA 1SNMA 2EY1A 3U9OA 4PMBA 3TP5A 1ENCA 2M00A 4G57A 4WORA 4KJOA 1EY7A 4K14A 5IODA 4HMJA 2KQ3A 4KY5A 2F0TA 2RKSA 2OF1A 5KYIA 2EYJA 2RBMA 3TMEA 1A2TA
chains in the Genus database with same CATH superfamily
5AFWA 1KL9A 3PO2H 1EQQA 5IT9E 3DM3A 5G3LD 5M5YB 5IYDH 3M4QA 1EIGA 5M5XB 3CW2C 2VL6A 1XTDA 3D3RA 4DK6C 1EYGA 2F4VL 1EQRA 1HUMA 2AWNA 1N9WA 4DAPA 2KECA 4PG3A 1PH4A 2ENBA 5C0XG 3MXNA 1VF5C 2BOSA 5LMNW 1PH9A 2RHSB 4DKAC 2OTJA 2KCCA 3P20A 4ZKCB 1IL2A 2F0HA 3URYA 1D5MC 4S3SA 1MBYA 1XMOL 4X64L 4IUVA 2XRQD 3HOVH 3A56A 4DV6Q 1I3QB 1H9RA 4O2DA 4PQXA 1S5ED 4J15A 2F0DA 5CBEE 3AEVA 1MHWC 1K8OA 4GN3B 4IPGA 2RSNA 1YJ9A 4JI1Q 3OWFA 2CW0C 1SRUA 3FVQA 2MP1A 4A3CH 2QGQA 3K0XA 1GJXA 4KD4A 2A73B 1CSQA 3A55A 1SR3A 3KF6B 2N55A 1MSGA 5IP9G 2DNEA 1JE5A 2NB0A 3M4YA 2PMZB 4O42A 3CCVA 3HOYG 5JJKA 2LY7A 2PW7A 5G3LF 1ET6A 1BF4A 3K59A 4A3MH 1E2WA 2B2TA 3BYTB 5K5PA 2A8VA 2EVBA 3NK9A 4LF5Q 4A75A 2LMCB 1CUKA 4X3SA 2HCCA 2L0CA 3F2UA 3RZDH 2CWAA 2PI2A 4OL7A 2IW3A 2JQOA 1LABA 3PUZA 1XNQQ 1N34L 4BBRH 3W1GA 1X3GA 3T13A 1SJED 5CMDA 1XTCD 2A5HA 1NTGA 1TWFH 2ICEC 1MJCA 3HP3A 4KJOA 4JYAL 3U58A 3CRKC 3HOVG 1B4OA 4OEMB 2PCFB 3G7LA 3D4RA 1KAAA 1CZWA 1V8QA 2B29A 1U9RA 1B70B 1CKNB 2UUAL 4JBJA 4JI4L 3CMEA 2LFNA 3I4NB 1O7ZA 2B63B 3KLSA 4L5QA 2ZTDA 2CVRA 1WD1A 4KD3A 1VQMA 1CQVA 2UUCQ 1XPUA 4HSPA 1GKHA 3GDEA 4IPDA 3S1RB 3HOWG 1LYLA 1FGBD 4C3IG 2R7ZB 1MGSA 2VQFQ 3S1NH 4IZ8A 5EPLA 5A35A 1W3SA 5FO9B 4OWXB 4A3MG 4JI7Q 4KKSA 4G4KA 3ERQA 3IKJA 1PZKD 4Y7NH 2JA8H 4DUZQ 1QE6A 2Q2TA 1UEAB 1DM0B 1EOTA 3K7AB 5ELNA 4QIWE 1LACA 1QJOA 3J7YW 1EQTA 5C3EG 2F0KA 3TS2A 3Q0AA 3SHLA 3S2HB 1AW7A 1EY8A 1FNWA 4A3BB 5M9OA 1WD0A 1ENFA 1PXUA 4GOPB 3ULLA 4OGQC 1SE2A 1PH1A 1J5EL 1WTPA 5JJZA 1IBKQ 2F0EA 1I4HA 2NTTA 3A5UA 2Z4HA 1AE2A 2ZT9C 1P16A 3E5SA 1UAPA 4R4TA 5NUCA 1VMPA 1MJEA 3HOUH 1IL8A 4R4QA 3OIPA 3EVQA 2BDNA 5GROA 1W6JA 1PTOF 2KJXA 4LUVA 5M5YH 2B2VA 3GTJB 4KY5A 5M5XH 1ONLA 4XXEA 5ELCA 3KLSX 5M3MB 1WTVA 2JA8G 1XPOA 4JI0Q 1KC8C 4HJ7A 2EYFA 3ONAB 3TRZA 3P1HA 1CZGA 3IL8A 1BBUA 4DR3L 4RGOS 2K5HA 2PZTA 3I7FA 4UP9A 2MO0A 1KDCA 1WTHA 5CV7A 3BDOA 3PQIA 4HIMA 4EQPA 1I3QH 3RD4A 2RCFA 4L6TB 1DD2A 2EYHA 1RDPD 1L1OA 1XX8A 2RF4A 1GOZA 3HKSA 3NWSA 2R61A 3RLFA 3M3YB 5FKAC 3PIP3 4DR2L 1O7IA 2E76C 1KXLA 4KKTA 1IBLQ 4K0KL 3S24A 5KEEA 2O2LD 4HEDA 1TT2A 2X6LA 1Q46A 4FNFA 2K5QA 4YWKA 5IP7G 2GN5A 5EBCA 4QUFA 2RDGA 5D65A 1S5FD 5C44G 1D2BA 1NAPA 2ZTCA 3D6CA 4JI6L 2AUKA 1I6VC 5I6YA 2HQLA 4MTKA 4DFAA 1NE3A 1PYBA 2HCIA 1NNXA 3JC66 1VQ7A 4XT1B 2VQEQ 2UXCQ 1TS4A 3OSOA 2F0OA 4LUOA 4MHEA 4BA2I 4R1JA 1LT3D 1HNWL 1TS5A 2KOLA 4QGUA 4YIJA 3AMUA 3SK6A 1NSNS 4JW0A 4DR5Q 1VMCA 2F1MA 2OEOA 3WWVA 5L37A 3CXCA 4P72A 4UAIA 2E2HB 2GA4B 3H3VI 4RFBA 5DAUA 5ELBA 1IYJB 3ERSX 1VF7A 1YNJC 5D3DA 5C3XA 2PQEA 1MSHA 1Z9FA 2MNAA 3H3VC 4P71A 3OOCA 5IWAL 2Z0SA 2B8FA 4QMGA 1IBMQ 2QDBA 4DA2A 2QA4A 4KY7A 5IE8A 2OWOA 2ZJQA 2N8NA 3RUZA 3J81i 2KCMA 4NXNL 4A3DB 1S3OA 4HCSA 3KF8A 3SK5A 5KIXA 1G291 3VYUA 2KHSA 2IPKD 3H09A 1OXTA 1NY4A 5E1FA 1ZKOA 1CK1A 1J6QA 1TXYA 2R7DA 4KHPQ 1SMYD 4ME3A 4WJWA 3UE0A 4IPHA 4G57A 4OO1G 3I4NH 1I6HB 2UXDQ 1QVCA 3I4MB 3C2PA 2B8GA 1QNUA 1A2TA 4RGMA 2Q8TA 5DM63 4BY1G 1PFSA 2FFKB 3S1RH 1VQPA 4BWGB 4LF9Q 2L4NA 3J80E 2K5NA 4TQUS 4BY7G 2EXDA 4L8JA 1QUQB 2IX1A 5ELEA 4DV2L 1UEBA 4A3IB 5C4XB 4NXML 1HA6A 4IALA 1LTRD 2JJQA 2QCPX 1IYUA 4LF8L 3CC7A 1GO3E 3NUCA 4LW1A 2YTVA 4FF2A 4XT3B 5IGEA 3R93A 1M8AA 4QCLA 1B3AA 2BE5D 1QB5D 3HKZE 1ZYRD 3EN2A 5JAVA 4FXDA 2O5IC 2E74C 2FINB 3DEPA 5H1SE 3K7AH 4FYDA 5FJ8H 3RNUA 4LFBQ 1JQYD 5BN5A 4Q5VA 3DM1A 4RHRA 1PH2A 2PI2E 2CFMA 4A3BH 1IZ6A 2EYOA 3D6WA 2NN6I 1D6EC 1QOHA 1BCPD 4WRDA 3R2IA 3CKIB 2K7VA 2HDLA 2F0GA 3M4PA 4TRDA 1MI2A 3OW7A 5BR8L 3KOJA 1BO0A 3L2PA 1RL2A 1ASYA 2B63G 3RMHA 2HDMA 2EZVA 1SEBD 3GTKB 4IUTA 4ZRZA 3U9SA 3FPUB 3OTOQ 4XQJA 2R7ZG 3MVVA 1OXSC 2TMPA 1YHAA 4QIWB 1GUTA 4C3JG 2B2YC 2LS01 2MUYA 2L1BA 1X6OA 3GTJH 2X6GA 4K5WA 3HOZB 4YWMA 2PYKA 3OMGA 1BQQT 4FVMA 5M3MH 2YU9B 2QW7A 4GS3A 4QJFA 3U4ZA 3H6MA 5CV4A 3RN5A 4IPCA 2ID0A 1M90C 1K3BC 3M4OB 5C4JH 2E2IB 5IODA 1VQNA 3FKIB 2R93B 3H0GB 4J6HA 2Y0SE 4A3LG 4LF7Q 3K0YA 4ABNA 4RMFA 1BCPF 2F0LA 1A2UA 4A3BG 1GHJA 2F0JA 1YI2A 1JOKA 4B3TL 4DV1Q 2ASBA 2K6AA 3H91A 2CH4W 1Z6HA 2Q2UA 1QG7A 3M3YH 3OPOA 2H4OA 3I2ZA 2R92B 1RD9D 4GLAC 3J7ZC 2R7FA 1STGA 3M9BA 3LX0A 4JBWA 2AUJD 5FO8B 1AEXA 2ZXRA 2DJGC 4LFAQ 4DR6Q 5FO7B 3T51B 4I7AA 5FLXc 1SE3A 4LMQD 3KBGA 1XPRA 1Q7YC 2FMCA 1K3RA 2M9VA 3GP7A 1YNND 5KYLA 4KY6A 1NR4A 2JA7H 1K73C 1N32Q 2H5XA 3BZKA 1I4RA 2WINB 3SXHA 2EIFA 3SR1A 4A3FB 1AZPA 1V1QA 4PZ7A 2JA5H 4DAMA 2VNUD 1YHBA 3FEWX 2E2HH 4B3RL 4RGTA 2RCNA 1L0WA 4LF4L 5FLMH 3MC0B 3A54A 5CGKA 2A1AA 3EA6A 2Q2IA 5E3FA 2DGYA 2V4DA 5JJIA 3F2CA 4CDFC 1KDBA 1HUNA 4E6IA 3I91A 1F9PA 2NVTB 4UP7A 1DXMA 1SMYC 3D8GA 1HNXQ 1D8LA 2NBFA 2E5LL 2F0VA 4DV3L 1FJGQ 4A3DH 3PO3B 4JBKA 2F3VA 1DCZA 1GXDC 1OXXK 1VQFA 4PZ8A 1G6PA 4JOIC 4DR4L 3J7AF 1IW7C 4K2LA 3NBHA 1EQVA 1F2MA 2NTSA 1SDFA 2Q8RE 3HOXB 4ID6A 1I6HH 2DJFC 1BXTA 3I4MH 4DN4M 3IAYA 3JAML 5I9OA 4DV0Q 2CCZA 2Z8LA 3JAMi 3J80L 3M7NA 4HN7A 4HR7B 4KMUC 5EKLA 1S72A 4BXXG 2F0QA 5CV9A 1VQJA 3TREA 1KNAA 1Y69U 4OONA 5HGTA 4ALPA 1A6XA 4BBSB 4EGVA 4OIJA 4K14A 1KHIA 1I94L 1LLRD 1TS2A 2OF1A 2RKSA 5KYIA 2JA6B 4FF1A 4A3IH 1OXVA 1PDQA 2IHFA 3CCMA 1E2ZA 1ZYRC 4O0AA 1VQGA 1Y1VB 3TMEA 4UY8C 3T1YL 3AYHB 4X65L 3HFZB 4BS9A 4DK0A 3HEJA 3L3OC 5C6AA 2WB1G 1GVPA 4WJ3M 1ENAA 1NBWA 2K5VA 1YJWA 1JE4A 1PFBA 2D0OA 1JOQA 3OHXC 3C46A 2D9UA 1FYCA 1BCPC 2PW5A 5EAYA 1L1OC 4XDXA 2RQXA 4IFDI 1SNQA 5CR3A 4YCUA 3MXUA 3W1BA 3GTGB 3S17H 4A3DG 4Z9CB 1HQRD 4HMIA 1WTXA 1I4XA 3AFPA 1M4VA 2EYLA 2EJMA 1SFOB 4OIKA 1SNDA 1EZ6A 3NENA 2NVQB 5FOBB 3I4MG 1HQMC 1KLUD 1F9QA 1D1KA 4A3GB 3GTKH 1TQOA 3J81c 1G2TA 1EFID 1XMQL 1PMRA 2K1BA 4X62L 3W3AA 2IT1A 4RCOA 1Q82C 3I8ZA 4CJ0B 2JYOA 2NZOA 2UU9L 2BCOA 4A3IG 1BBWA 2C35B 5C4XG 1WTWA 1UNSA 4B9XA 3BU2A 2D62A 5ELFA 4DUYQ 1HR0Q 2RVLA 2VW9A 3HOZH 1UWVA 4JI3Q 1Y14B 1JB7A 3H94A 3PF5A 4U673 1I50B 4LF6Q 2YU9H 4XTCS 1JJ2A 2BA1A 1X55A 2L15A 3VR4A 4CBVA 4AQYL 2A74C 1C9OA 1ASZA 4KHVA 5M3FB 1CTMA 1DOKA 3M4OH 3UI2A 3P75A 2E2IH 2IWHA 1LTLA 2JP1A 3FKIH 1ICFB 4YCWA 2R93H 4K6LA 3H0GH 2AHOB 1JJCB 4H44C 5LMNQ 2XWJB 1X3FA 5CV6A 4LFCQ 3U50C 3TEHB 2WAQB 3PO2G 1TWCB 4DK1A 3O13A 4HMJA 1XXGA 1LV9A 5IYDG 4NMZA 1U4PA 2R92H 4LNQA 1VQEA 4GNXC 1EIFA 2B2YA 5E4WC 2WP8J 4F8MA 1RF2D 4ME5A 1YNNC 3EQLC 4IN3A 1BDOA 2IX3A 5J39A 1R4QB 4DGZA 2OXPA 1PVOA 1JICA 3SVMA 4AIMA 1PYWD 4FO2A 1XNRQ 4HIDA 1VQ8A 1XWEA 2IL8A 3OMCA 1L0XB 4A3FH 4XQQA 2Y0SB 4XIGS 5AJ3Q 4DV6L 3K8AA 1ESFA 1NMGA 1AFPA 2NYZD 2RDHA 1PA6A 4UP8A 4HIKA 4JI1L 3PIPA 3R3OA 1OTCA 1K0RA 2GVBA 4A3CG 1PRTB 1CQFA 4KLKA 3CCLA 3GV3A 3A5ZB 4RGNA 3PSIA 4DXGA 3NE5B 2R93G 1BBXC 3KF6A 4JI2Q 2A6EC 2NVTH 2LSSA 1VDZA 1SE8A 1VQKA 5C0XI 1F9RA 1N36Q 3PO3H 1H9SB 2FHTA 1SYEA 1SYBA 3NSWA 1UE5A 2EPBA 1ET9A 2EJFC 2KBNA 4IUQA 4GKKQ 4DR7Q 4LF5L 3I73A 5LL6X 3HOXH 2PO4A 3VYRA 3QOLA 3RLNA 2PQAB 5JVG3 4L5RC 2Z9HA 2K03A 1WJJA 4GKJQ 2D2CC 4B3MQ 3TP6A 1V1PB 1SN8A 1HRJA 3I56A 2K5WA 4LAAA 4BBSH 4BBRG 1XNQL 4JI8Q 1PV4A 1RODA 1G8ZD 1JC7A 2JA6H 1A0IA 4DV5Q 1Y1WB 1PFNA 1NJIC 1Y1VH 4PV1C 5D3IB 3M85A 1EFWA 3BYYB 3WDNA 1SJHD 2EDGA 5DNFA 4AH6A 1VQ5A 1CKNA 3ER0A 1HZCA 2BH8A 4C1NK 2KENA 2VS1A 2D5DA 4JOIA 1ICWA 4ILWA 1E1OA 3MHBA 1E3PA 2UUCL 4L5SA 1B50A 3NQIA 4OX9Q 4EVOA 5IT9L 2FMMA 3ITPA 1NR2A 4A3EB 1CSPA 2VQFL 3GTGH 1D5XC 3VA5A 3PO3G 4AYBG 4HSVA 5C3WA 1ZEQX 5KNBA 4WFN3 2NZHA 4X66Q 4JI7L 2LXKA 2B2UA 2YTYA 4DAYA 2B2WA 1S5CD 3SEBA 1SFOH 5I9PA 1C7YA 2NN6H 2NVQH 2A69D 1XJVA 2VB3X 1PH5A 2AKWB 3N52A 3S1MB 3QB3A 3CCEA 1FL0A 4DUZL 4A3GH 4DNTB 3BDLA 4DR1Q 5GAEC 2HQEA 5C4JB 3L7ZC 4DXFA 1TVXA 1TWGH 1YIJA 4YY3Q 1O78A 4A93B 3M7GA 4QUCA 5JVH3 1B53A 1R4PB 3QJYA 1CA6A 3S14B 2CWPA 5F2DA 3JAMc 4M1UB 1SNOA 1X9NA 1GUSA 4IURA 4IUNA 1GUGA 1I50H 3H15A 5LMUQ 1VQCA 3Q6SA 4K2KA 2HIXA 3WOFA 3VR6A 2EE1A 3PIOA 2UXBQ 1IBKL 2NVYB 5M3FH 1SLJA 4A3KB 1C48A 5I2XA 1C0AA 2AQ2B 1KNEA 2Z6KC 1PH8A 1GUNA 1PFMA 1D5ZC 2MJ8A 4POGA 3GO5A 2F4IA 3VR3A 3NBIA 3J81j 5JPMC 3HOUG 1EY0A 3EJIA 1JT8A 4N9TA 1PH6A 3NTKA 4F88A 2JA7B 1TWCH 1Z7TA 4HIOA 3UE1A 2Z1CA 1Y8PB 1IHZA 1STHA 1IKLA 1TY2A 3EROA 4RA8A 2JA5B 1A3UA 3V05A 1KTKA 4FP5D 1VQOA 1RIPA 4IUUA 1KAWA 2TSSA 4C3HB 4JI0L 1E24A 5EBDA 4ZYSA 2M00A 1EY7A 1HPCA 5IYBH 2HHHQ 1PLFA 3E9HA 2ZTEA 1EU4A 2E75C 2VB2X 3ND8A 1AH9A 2ZM6Q 3C3LA 3CD6A 2KEEA 1TY0A 3OIQA 4Q0FA 1LTBD 2LXJA 3T1HQ 2OCEA 2VZAA 2JA9A 2SNSA 2L55A 1HNZQ 3OWEB 5IY0A 1LT6D 3DHQA 5M3FG 3NP8A 5M5WB 4JV5Q 1DOLA 1PRTD 2XNAC 1EY6A 1IBLL 4IO9A 3PF4A 2N3SA 4PNYA 2CQOA 1KRSA 2K52A 4NPSA 4KTAA 2ATWA 4N9PA 3Q24A 4GNXA 3UDIA 4IOCA 2ALYB 3TP7A 3T53B 2WAQG 1ESRA 3CMAA 4FF3A 1YNXA 4CJ1B 4RAUC 2UXCL 2VQEL 1WTQA 3EFXD 3SK4A 4K6DA 3KBXA 2KHJA 4DF7A 1VQ6A 1G51A 4DR5L 1EUJA 5CORA 4UDUC 1HZBA 5TSSA 3L0OA 4FF4A 3NTIA 1LM0A 3FRPB 1F2YA 3I90A 4JVZA 1O7YA 1TKWB 2A6HD 4HJ5A 3NELA 4Y52H 3LGJA 3K81C 1B9NA 4J1MA 2I5MX 2QILA 2F03A 2R6GA 4QL5A 1IBML 1A3VA 4CGYB 1EYDA 4MN3A 1Y1WH 1OO9B 3K5MA 4F7XA 3S17B 1DZ1A 1T5EA 4K5XA 4OWTB 1BR9A 1U4MA 2F0FA 1VCIA 3S15H 1L2FA 2RDFA 4MNOA 2I0QA 3I3CA 1QNKA 5LL6S 3PIO3 3A7LA 2K4KA 4KHPL 3E6ZX 3I4NG 5GAHC 4FDBA 3TBIB 3DWQA 1MIUA 2UXDL 3PUVA 2K32A 3E9IA 3E0EA 3TS0A 2EY1A 5HY6A 4JI5Q 3RN2A 1VQ4A 4WORA 1K8MA 4A3EH 4LF9L 1G91A 2B39A 1KIXA 5IGDA 2UUBQ 1VQIA 3UDFA 1FD7D 4L63B 4IFDH 1N33Q 3K5NA 2FXQA 1TR5A 1Q8IA 4JG2A 1WTRA 3S1QB 3KDFB 3S1MH 2B3GA 4K8JA 3PMFA 3QIAA 1ILQA 4DK3C 4IJLA 5FJ8G 5BN3A 2VUMB 1CA5A 3QG1A 4LFBL 4A93H 4OO1I 3X3NA 3GTMB 1JOOA 2EY2A 2K75A 2EJGC 1QWYA 2DY7A 3ZYYX 1EZ8A 2K33A 3S14H 4PZ6A 3DXJC 2EQSA 5I6WA 2QEXA 2JEAI 4EX5A 4YWLA 3FDTA 3CC4A 3NHHA 1QVFA 1F77A 4JCVE 1JJGA 2WV6D 3BVZA 1PH3A 1STBA 1FNVA 2NVYH 4B9WA 2XIWA 1H95A 4A3KH 3HOWB 1JMCA 4C3IB 4GN5A 1WCMH 2DNCA 4DV7Q 1HH2P 1STEA 1TIID 3MEFA 3TN2A 4U68A 1SBBB 2JSOA 3OTOL 2VXWA 3ULJA 3SK8A 1VQHA 1EOVA 4DV4Q 1GM5A 3NBHB 5EKKA 3UDGA 2BH2A 2C9OA 3S9WA 1AP0A 2RA4A 3HRZC 1Y8OB 5JEAH 4JBMA 5J3BA 1QVGA 2XVSA 1JCKB 1RKNA 3KLWA 4G7OC 3VDYA 5C5MA 4A3JB 4B3SQ 2KA7A 5M3MG 4IUPA 4CJ2C 3DEOA 1FGUA 4NDXA 2QEJC 5C3EB 5IGFA 4C3HH 3ICEA 3PV0A 5IT9c 1STAA 4L5TA 5IGCA 3EIVA 1J8IA 2L11A 1EY9A 2F0NA 4X3KA 1V1OA 4A93G 3QR8A 1CKOA 5CBAE 2Z6KA 4LF7L 2DUDA 4LWCA 4H0LC 2RHQB 2EYJA 1VS0A 1ML0D 4DV1L 1WOCA 2OQ0A 4YHHQ 3G4SA 5COYA 3DLLA 5M5WH 1A15A 4A3KG 4KK7A 3I4LA 3J80i 1P8LA 3G6EA 4J8QA 4LFAL 2DN8A 3CCSA 2B2UC 1Q8KA 2OQKA 4DR6L 2B2WC 2IY5B 1UE1A 1YBYA 2YV5A 4P74A 3TDQA 1PTOB 5DEHA 2F4VQ 2JA7G 2BE5C 2K5DA 3K5OA 3HZXA 1E1TA 3RLOA 1N32L 4K5VA 3MXNB 4K8IA 2A6HC 3GTQB 1F2LA 2JA5G 3BVMA 1KLGD 1IKMA 1HXYD 5FLMG 3DWAA 1PYSB 2RSOA 4ZCKA 1DYQA 1XMOQ 1N8RC 4X64Q 2H1EA 3CF5A 1WFQA 4GOPC 4RWSC 1MD2D 1CHPD 4LUZA 3A74A 4I65A 1GD7A 3CC2A 3QOJA 1HNXL 5FLXE 1BVSA 1RHPA 3KJOA 1FJGL 2I46A 3KLRA 1R9TB 3N6RA 1NUCA 1CM9A 1VQ9A 1II3A 3VR5A 1HZAA 4DNIA 5C44B 4UHVA 4GLVB 1UE7A 1I4GA 1HR0W 4BA1I 4NP5A 3PUYA 1B44D 5IP9H 1LTTD 1X56A 1FR3A 4ZUJA 3K80C 4DV0L 3SE0A 4ULLA 4EQOA 3HKZB 1Q90A 3FP9A 3T56B 5KGUA 1G6ZA 1SNCA 4APVA 1TWGB 4QY7A 2J4XA 1RTOA 1E2VA 1X3QA 3GD7A 3B6YA 3SDZA 1QZGA 3DMUA 2N49A 1CT1D 1PHJA 1DGSA 1K83B 1B9MA 1U4LA 3A7AB 1SAPA 1N34Q 3S1QH 4X6AH 3D0FA 3CPFA 4IOAA 1VQDA 4JYAQ 1YZ6A 3F1ZA 2XGTA 4JPBW 4CDCC 4NKLA 2VUMH 2A68D 1T9HA 3MA2B 5DM73 2WB1E 3GTMH 1HCZA 1EYAA 3D4DA 4H13C 1SE4A 3PCOB 2UUAQ 5C4ZA 4JI4Q 4YCVA 3PGZA 2F3IA 5CYUA 2KUMA 1V9PA 1EY4A 1W6KA 4ZKBB 3F8TA 2L9HA 5KRUA 4RKBA 4IFDJ 4RCNA 1A62A 4BY1B 3HOWH 2K04A 3CP0A 1X65A 4C3IH 2CH4A 1I4PA 5E4XA 4XQNA 3CCQA 4BY7B 3V96A 3FMCA 1MKHA 2K14A 2Q2HA 3E3XA 5BN4A 3EBEA 3MWYW 1CKMA 2YYZA 3Q8DA 2F0SA 2YTXA 2L5TA 3FPPA 3WOEA 2V1CC 5HGQA 1X3EA 3HOZG 2IX0A 4MIUA 3T16A 1K0SA 2ZXOA 1EU3A 4A4IA 5HURA 1LTID 3D4WA 4DUYL 4A3JH 1HR0L 4JI3L 1HHVA 2K01A 2PPBC 4LF6L 5C3EH 4G7HC 3NEMA 2EY5A 2QKIC 5A2QE 3ULPA 2ICIA 2WKCA 3C1EA 1YNJD 2Z4IA 2VUMG 2MPMA 3FKIG 3H3VH 2JE6I 2F0UA 3D31A 3MXPA 3H0GG 3ZJYC 1J5EQ 3J81E 1LTGD 1F9SA 5JPNC 3CPWA 1WVLA 5LMNL 4LFCL 4ZLTF 4CKEA 2K28A 1CI3M 5J22A 1A8VA 3A8JE 1B7YB 1EWCA 4ZK9B 2FJ2A 2OTLA 3CHBD 2R92G 2E2JB 1LT5D 2XWBB 5JEAJ 2GVAA 1LT4D 1QILA 3PUXA 1GUWA 2G9DA 3X3MA 3S16B 2XN9C 2Z6BA 2G5DA 1X32A 1EIYB 3S2DB 4C3JB 3KUPA 2WACA 3A0JA 3C1FA 1YITA 4HAEA 1PTOH 4DAVA 4DAYB 1PTOD 1XNRL 5IIFA 3K57A 2J7ZA 2F0MA 1RJTA 3MAQA 1K8GA 1LO5D 4A3FG 3S15B 3BVGA 1H9KA 3W2DA 3GTQH 2EXZA 2KCNA 1T5XD 4N8X1 3CCJA 4A3JG 4DR3Q 5AJ3L 1BKBA 4HJ9A 5I4DA 1SYCA 3CU7A 3J7AV 2DY8A 3CQZB 1E0BA 2E2DC 1Q81C 2Q8IB 3VYSA 1Q12A 4JK1C 3MFYA 4RH6A 3T4AC 4CDEC 2MFIA 2P5ZX 2EOTA 1YHQA 2PNRC 2EYMA 1L0YB 1BCPB 5FLXL 4KJNA 4JI2L 3AB9A 1L1OB 5GAGC 4DU9A 4DR2Q 1EYCA 3GTOB 1H9SA 1N36L 3BS1A 1KDAA 2F0PA 4X3TA 4K0KQ 1M1KC 1G2SA 1K28A 2K50A 1R9TH 2IJ0A 2KHIA 3HS0C 1FVIA 5JOBA 5IP7H 3HOXG 3G71A 4JI6Q 4GKKL 4ZQ3A 5C44H 4DR7L 2PQAA 1TWHB 5C0XJ 3K7UC 3SGIA 2NVXB 2K05A 5IGGA 1I4QA 1YEZA 2AMCB 1V1PA 3GTPB 4GKJL 4B3ML 3K6OA 1BNZA 3A8KE 4BBSG 1HNWQ 4P75A 1RCVD 4JI8L 1HFNA 2JA6G 5T1IA 4F87A 2SEBD 1SNPA 1Y1VG 3I4OA 3MZ5A 4DV5L 5K36H 2NZ1D 1C4QA 2SDFA 1K83H 4GLXA 3J80c 1UE6A 4GOPA 4FXKC 3MEHA 2A68C 5IWAQ 1DOMA 4V0BA 1C8CA 5CV5A 1YVCA 2ES2A 3TSSA 4PMWA 1XYIA 3ND9A 3TQYA 3GTLB 3P7JA 1SNMA 3IRBA 1WCMB 1HA5A 4NB3A 4NXNQ 5EQ0A 3J7A5 3NWTA 2D0PA 4QQBX 3KF8B 4KHZA 1K9MC 3RZOB 2IHEA 3Q23A 2N88A 4OX9L 2JN4A 4R4IA 2MQHA 2WFWA 2BDOA 4HTHA 4OO1H 3STBD 1B1ZA 2HD3A 2J0TD 2O5JC 4X66L 3NQTA 3LWEA 2NN6G 3DWPA 3LWUA 3VR2A 4BY1H 1TWAB 4C56C 4AYBE 4A3GG 4GNXB 2I07B 1S5BD 4DV2Q 4BY7H 1B3QA 2AQ3B 3HKZG 4NXMQ 4DR1L 4UPAA 3G48A 3NXWA 4XYOA 1X3PA 4LF8Q 2QDLA 4KKUA 4LK1C 4YY3L 5ISRA 1E7ZA 1F2ZA 3MTSA 4JC0A 1HTLD 2CHBD 5K36G 3KJPA 2WB1B 4LJZC 2NWGA 1U4RA 2QF7A 4H02A 2MGSA 1HZ9A 1GUOA 5A2QL 1SSOA 5E7NA 4CKCA 2JK8A 1S40A 3G6JB 5ELDA 5LMUL 3VYTA 1SYDA 1Y8NB 4ODGA 2UXBL 2F52A 1SYFA 3J81L 1SMXA 1ZXTA 1K8AC 3HG9A 1Z47A 3NTHA 5EPKA 2C5CA 2LKVA 2F0WA 3I70A 4H7BA 2JXMB 4POFA 5BR8Q 4TSSA 1JWMD 5ELOA 1SXTA 3CCUA 3BZDB 2B63H 4MTNA 3KK7A 2EY6A 2ZXPA 5KNDA 1O80A 2E2JH 1IW7D 3L9AX 1I5FA 4EQNA 3JAME 2HUGA 3CAMA 1D1IA 1KABA 1PTOC 2F0IA 3QWNA 2R7ZH 4KV6A 5T1GA 3S16H 4ZAIA 3TP8A 5IYBG 5IGBA 3S2DH 4C3JH 5JJLA 2HHHL 1D7QA 2CKZB 3F2BA 1A3TA 2ZM6L 3U9OA 4PMBA 3TP5A 2MHVA 3GV6A 2WIIB 4DNRB 2I5HA 4C2MB 2KVMA 5KNCA 3RR5A 2Y0SG 3T1HL 5IYCH 1U0LA 2KCTA 4OELB 3PUWA 1FNUA 1HNZL 1JWUD 4X3UA 1IYVA 1PRTF 3CQZH 4O1NA 3S2HH 4R9WA 2M2LA 1QCBD 2MO1A 3I55A 4JV5L 4A3LH 1NMFA 4P73A 3UDXA 3HOYB 2E8GA 3PO2B 4B3TQ 2CQAA 4MZ9A 4ZUIA 3HGBA 1B8AA 1EEID 1QUQA 5J1ZA 3F2DA 1KQSA 3W5OA 1VQAA 2A69C 3GTOH 4B08A 1CFMA 1TS3A 4TVAB 4R4OA 4RG1A 1LTSD 3A8IE 2PMZE 1KRTA 1AN8A 3IFDA 2B2TC 2WAQE 1TWHH 1EEFD 3KFUA 1H9JA 2OT2A 1EL0A 4QF4A 2NVXH 1HTPA 2I5LX 5EJWA 4HJ8A 1HJPA 3GTPH 1BOSA 2ZJRA 2VY3A 4C1NI 3HOVB 2PZUA 3TZDA 3VA7A 1WYDA 2XSCA 4N8FA 1ILPA 1Y1WG 4B3RQ 4LF4Q 1S4ZA 1SROA 5IYCG 3DUZA 3OW2A 2O4XA 2PNHA 5CC4A 1H9MA 1EIHA 5CV8A 1EY5A 4GN4B 1WI5A 2F3WA 3KYHC 5D14A 2HIVA 4FXGC 4PMCA 4CHTB 1VQBA 5EKIA 5IOCA 3Q22A 2CW0D 3GTLH 1PZID 1HFGA 3K5LA 2E5LQ 4DV3Q 1W2BA 3CRLC 3STBC 3RZOH 1STYA 4A3MB 4DR4Q 4JI5L 4DPGA 2X69A 4R8IA 4A3EG 1V43A 1B2TA 2SNMA 1Q86C 2UUBL 1RTNA 3NPPA 4IJHA 4IFDG 3MFGA 2KEDA 3RZDB 1JWSD 2KQ3A 1N33L 4BXXH 3MXGA 3I72A 4KN4C 1TWAH 3KDFA 4BBRB 2A19A 4OWWB 1I94Q 3OYYA 1TWFB 4HCEA 4M8AA 5EGTA 3T1YQ 1PZJD 3IFTA 1BUVT 4X65Q 3E0JA 1EWHA 4QB4A 3CCRA 4R8NA 1JORA 4HJAA 1S5DD 4I7ZC 4EQ5A 1A63A 1PRTC 2JEBI 4KI0A 1X54A 5LHY1 4NW2A 1DONA 3R8BA 2AWOA 2SOBA 3AU7A 4R4CA 1DJRD 2AQ1B 5GADC 4KN7C 3FHWA 4IQZA 2NUCA 1AE3A 1WCMG 3S1NB 3QO2A 1JR0D 2N78A 2R3ZA 1UUPA 5FK9C 1Q3LA 4CDDC 4AYBB 1IXRA 5C4HA 3K58A 1E22A 4DV7L 2XRSD 3R2TA 1OXUA 2EYPA 2A6ED 4OXPA 1TU2B 3AFQA 3LNNA 4DV4L 3GQBA 1LTAD 4Y7NB 2BA0A 5JEAG 2G9HD 2JA8B 5C0XH 5EPJA 4TKOB 1EWIA 1GHKA 1XMQQ 5DLQE 4X62Q 4G7ZC 1U5KA 4B3SL 2XTIA 2B2VC 4C3HG 4RKLA 2UU9Q 1CHQD 2PZWA 3AQQA 5C5LA 5C4XH 3V2TA 4RHSA 4WJ4A 1PH7A 2HT1A 1Q1BA 4GZYC 1SYGA 3TZUA 1AZQA 4OHJA 1VQLA 3U4VA 4V190 4C2MH 1YJNA 1NCVA 4AQYQ 1O7LA 2ZJPA 3BDCA 1WTOA 3BG3A 5I2YA 4XYQA 1Q1EA 1STNA 1LUZA 2L12A 1QZHA 5GQOA 1J9OA 3BZCA 2WKDA 1ENCA 4A76A 4YHHL 4CKBA 1JB3A 2F0TA 4P2CB 1KD1C 3HOUB 3BJUA 2RBMA 3HOYH
chains in the Genus database with same CATH topology
5AFWA 5IT9E 5G3LD 5M5YB 1EIGA 5M5XB 3D3RA 1HUMA 2AWNA 4DAPA 2KECA 2ENBA 5C0XG 3MXNA 1VF5C 2BOSA 2KCCA 3P20A 4ZKCB 2F0HA 3URYA 1D5MC 4S3SA 1MBYA 4IUVA 2XRQD 3A56A 1I3QB 1H9RA 4PQXA 1S5ED 2F0DA 5CBEE 1K8OA 2RSNA 3OWFA 2CW0C 3FVQA 2MP1A 1GJXA 4KD4A 2A73B 3A55A 2N55A 1MSGA 2DNEA 2NB0A 3M4YA 2PMZB 4O42A 2LY7A 2PW7A 5G3LF 1ET6A 1BF4A 3K59A 1E2WA 2B2TA 3BYTB 5K5PA 2EVBA 3NK9A 2LMCB 4X3SA 2HCCA 2L0CA 3F2UA 4OL7A 2IW3A 1LABA 3PUZA 3T13A 1SJED 5CMDA 1XTCD 2A5HA 2ICEC 3HP3A 4KJOA 3CRKC 1B4OA 2PCFB 3G7LA 3D4RA 1KAAA 1CZWA 1V8QA 1U9RA 2LFNA 3I4NB 1O7ZA 2B63B 3KLSA 2CVRA 1WD1A 4KD3A 1CQVA 4HSPA 3S1RB 1FGBD 4C3IG 2R7ZB 1MGSA 4IZ8A 5EPLA 5A35A 5FO9B 4KKSA 4G4KA 3ERQA 3IKJA 1PZKD 1QE6A 1UEAB 1DM0B 1EOTA 3K7AB 1LACA 1QJOA 3J7YW 1EQTA 2F0KA 3Q0AA 3SHLA 3S2HB 1AW7A 1EY8A 1FNWA 4A3BB 5M9OA 1WD0A 1ENFA 1PXUA 4OGQC 1SE2A 1WTPA 5JJZA 2F0EA 1I4HA 2NTTA 2Z4HA 2ZT9C 3E5SA 1UAPA 5NUCA 1VMPA 1IL8A 3OIPA 3EVQA 2BDNA 1W6JA 1PTOF 2KJXA 2B2VA 3GTJB 4KY5A 1ONLA 4XXEA 5ELCA 3KLSX 5M3MB 1WTVA 2EYFA 3ONAB 3P1HA 1CZGA 3IL8A 4RGOS 2PZTA 1KDCA 5CV7A 3BDOA 4EQPA 3RD4A 4L6TB 1DD2A 2EYHA 1RDPD 1XX8A 1GOZA 3NWSA 2R61A 3RLFA 3M3YB 5FKAC 3PIP3 2E76C 4KKTA 5KEEA 2O2LD 4HEDA 1TT2A 2X6LA 2K5QA 4FNFA 5EBCA 4QUFA 2RDGA 5D65A 1S5FD 1D2BA 1NAPA 3D6CA 2AUKA 1I6VC 5I6YA 4DFAA 2HCIA 4XT1B 1TS4A 3OSOA 2F0OA 4MHEA 4BA2I 1LT3D 1TS5A 2KOLA 4YIJA 3AMUA 3SK6A 1NSNS 1VMCA 2F1MA 2OEOA 4UAIA 2E2HB 2GA4B 4RFBA 5DAUA 5ELBA 1VF7A 1YNJC 5D3DA 5C3XA 2PQEA 1MSHA 3H3VC 3OOCA 2B8FA 4QMGA 2QDBA 4DA2A 4KY7A 3RUZA 4A3DB 4HCSA 3SK5A 3KF8A 5KIXA 1G291 3VYUA 2KHSA 2IPKD 3H09A 1OXTA 5E1FA 1ZKOA 1CK1A 1SMYD 4WJWA 4G57A 4OO1G 1I6HB 3I4MB 3C2PA 2B8GA 1QNUA 1A2TA 4RGMA 2Q8TA 5DM63 2FFKB 4BWGB 2L4NA 3J80E 4TQUS 4L8JA 2IX1A 5ELEA 4A3IB 5C4XB 1HA6A 4IALA 1LTRD 2QCPX 1IYUA 3NUCA 4FF2A 4XT3B 5IGEA 3R93A 1M8AA 4QCLA 1B3AA 2BE5D 1QB5D 1ZYRD 5JAVA 4FXDA 2O5IC 2E74C 2FINB 3DEPA 4FYDA 1JQYD 5BN5A 4Q5VA 3DM1A 4RHRA 2EYOA 3D6WA 2NN6I 1D6EC 1QOHA 1BCPD 4WRDA 3R2IA 3CKIB 2K7VA 2HDLA 4TRDA 2F0GA 1MI2A 3OW7A 1BO0A 3RMHA 2HDMA 2EZVA 1SEBD 3GTKB 4IUTA 4ZRZA 3U9SA 3FPUB 4XQJA 3MVVA 1OXSC 2TMPA 4QIWB 1GUTA 4C3JG 2B2YC 2LS01 2MUYA 2L1BA 2X6GA 4K5WA 3HOZB 2PYKA 3OMGA 1BQQT 4FVMA 2YU9B 3H6MA 5CV4A 2ID0A 3M4OB 2E2IB 5IODA 3FKIB 2R93B 3H0GB 4J6HA 3K0YA 4ABNA 1BCPF 2F0LA 1A2UA 1GHJA 2F0JA 1JOKA 2K6AA 3H91A 1Z6HA 1QG7A 3OPOA 2H4OA 2R92B 1RD9D 1STGA 3LX0A 4JBWA 2AUJD 5FO8B 1AEXA 2ZXRA 5FO7B 3T51B 1SE3A 4LMQD 3KBGA 2FMCA 2M9VA 3GP7A 1YNND 5KYLA 4KY6A 1NR4A 1I4RA 2WINB 3SXHA 3SR1A 4A3FB 1AZPA 2VNUD 3FEWX 4RGTA 3MC0B 3A54A 5CGKA 3EA6A 5E3FA 2V4DA 1KDBA 1HUNA 4E6IA 3I91A 1F9PA 2NVTB 1DXMA 1SMYC 3D8GA 2NBFA 2F0VA 3PO3B 2F3VA 1DCZA 1GXDC 1OXXK 3J7AF 1IW7C 4K2LA 3NBHA 1EQVA 1F2MA 2NTSA 1SDFA 2Q8RE 3HOXB 4ID6A 1BXTA 4DN4M 3IAYA 3JAML 5I9OA 2Z8LA 3J80L 3M7NA 4HN7A 4HR7B 4KMUC 5EKLA 2F0QA 5CV9A 1KNAA 1Y69U 5HGTA 1A6XA 4BBSB 4EGVA 4OIJA 4K14A 1LLRD 1TS2A 2OF1A 2RKSA 5KYIA 2JA6B 4FF1A 1OXVA 1PDQA 1E2ZA 1ZYRC 1Y1VB 3TMEA 4BS9A 4DK0A 3HEJA 3L3OC 5C6AA 1ENAA 1JE4A 1PFBA 1JOQA 3OHXC 3C46A 2D9UA 1FYCA 1BCPC 2PW5A 4XDXA 2RQXA 4IFDI 1SNQA 5CR3A 3GTGB 3MXUA 4Z9CB 1HQRD 4HMIA 1WTXA 1I4XA 1M4VA 2EYLA 2EJMA 1SFOB 4OIKA 1SNDA 1EZ6A 2NVQB 5FOBB 1HQMC 1KLUD 1F9QA 1D1KA 4A3GB 1TQOA 1G2TA 1EFID 1PMRA 2K1BA 3W3AA 2IT1A 4RCOA 3I8ZA 4CJ0B 2JYOA 2BCOA 1WTWA 1UNSA 4B9XA 2D62A 5ELFA 2RVLA 3H94A 4U673 1I50B 4XTCS 2BA1A 3VR4A 4CBVA 2A74C 4KHVA 5M3FB 1CTMA 1DOKA 3UI2A 3P75A 2IWHA 2JP1A 4K6LA 4H44C 2XWJB 5CV6A 2WAQB 1TWCB 4DK1A 3O13A 4HMJA 1XXGA 1LV9A 4NMZA 1U4PA 2B2YA 5E4WC 2WP8J 4F8MA 1RF2D 4ME5A 1YNNC 3EQLC 4IN3A 1BDOA 2IX3A 5J39A 1R4QB 4DGZA 2OXPA 1JICA 3SVMA 1PYWD 4FO2A 1XWEA 2IL8A 3OMCA 1L0XB 4XQQA 2Y0SB 4XIGS 1ESFA 1AFPA 2NYZD 2RDHA 3R3OA 1PRTB 1CQFA 3GV3A 4DXGA 4RGNA 3NE5B 1BBXC 2A6EC 1VDZA 5C0XI 1F9RA 1H9SB 2FHTA 1SYEA 1SYBA 3NSWA 2EPBA 1ET9A 2EJFC 4IUQA 3I73A 5LL6X 2PO4A 3VYRA 3QOLA 5JVG3 2K03A 2D2CC 3TP6A 1V1PB 1HRJA 2K5WA 4LAAA 1RODA 1G8ZD 1JC7A 1Y1WB 1PFNA 4PV1C 5D3IB 3M85A 3BYYB 3WDNA 1SJHD 2EDGA 5DNFA 4C1NK 2D5DA 1ICWA 4ILWA 3MHBA 1B50A 3NQIA 4EVOA 5IT9L 2FMMA 3ITPA 1NR2A 4A3EB 1D5XC 3VA5A 4HSVA 5C3WA 1ZEQX 5KNBA 4WFN3 2B2UA 4DAYA 2B2WA 1S5CD 3SEBA 5I9PA 2NN6H 2A69D 2VB3X 3N52A 3S1MB 3QB3A 4DNTB 3BDLA 2HQEA 5C4JB 3L7ZC 4DXFA 1TVXA 1O78A 4A93B 3M7GA 4QUCA 5JVH3 1B53A 1R4PB 3QJYA 1CA6A 3S14B 5F2DA 4M1UB 1SNOA 1GUSA 4IUNA 4IURA 1GUGA 3Q6SA 4K2KA 3WOFA 3VR6A 2EE1A 2NVYB 4A3KB 1C48A 5I2XA 2AQ2B 1KNEA 1GUNA 1PFMA 1D5ZC 2MJ8A 3GO5A 2F4IA 3VR3A 3NBIA 5JPMC 1EY0A 3EJIA 4N9TA 3NTKA 4F88A 2JA7B 1Z7TA 2Z1CA 1Y8PB 1IHZA 1STHA 1IKLA 1TY2A 3EROA 4RA8A 2JA5B 1A3UA 3V05A 1KTKA 4FP5D 4IUUA 2TSSA 4C3HB 5EBDA 4ZYSA 2M00A 1EY7A 1HPCA 1PLFA 1EU4A 2E75C 2VB2X 3ND8A 3C3LA 2KEEA 1TY0A 3OIQA 4Q0FA 1LTBD 2SNSA 2L55A 3OWEB 1LT6D 3DHQA 3NP8A 5M5WB 1DOLA 1PRTD 2XNAC 1EY6A 4PNYA 4KTAA 4N9PA 3Q24A 3TP7A 3T53B 1ESRA 4FF3A 4CJ1B 4RAUC 1WTQA 3EFXD 3SK4A 4K6DA 3KBXA 4DF7A 5CORA 4UDUC 5TSSA 4FF4A 3NTIA 3FRPB 1F2YA 3I90A 1O7YA 1TKWB 2A6HD 1B9NA 4J1MA 2QILA 2F03A 2R6GA 1A3VA 4CGYB 1EYDA 4MN3A 1OO9B 3K5MA 4F7XA 3S17B 1DZ1A 1T5EA 4K5XA 1BR9A 1U4MA 2F0FA 1VCIA 2RDFA 3I3CA 1QNKA 5LL6S 3PIO3 3A7LA 3E6ZX 3TBIB 3DWQA 3PUVA 2K32A 2EY1A 4WORA 1K8MA 1G91A 2B39A 5IGDA 1FD7D 4L63B 4IFDH 3K5NA 1TR5A 1Q8IA 1WTRA 3S1QB 4K8JA 3PMFA 3QIAA 1ILQA 5BN3A 2VUMB 1CA5A 3QG1A 4OO1I 3X3NA 3GTMB 1JOOA 2EY2A 2EJGC 1QWYA 2DY7A 3ZYYX 1EZ8A 2K33A 3DXJC 5I6WA 2JEAI 3FDTA 3NHHA 1F77A 2WV6D 3BVZA 1STBA 1FNVA 4B9WA 2XIWA 3HOWB 4C3IB 2DNCA 1STEA 1TIID 3TN2A 4U68A 1SBBB 2JSOA 2VXWA 3SK8A 5EKKA 2C9OA 3S9WA 1AP0A 2RA4A 3HRZC 1Y8OB 5JEAH 2XVSA 1JCKB 1RKNA 4G7OC 5C5MA 4A3JB 2KA7A 4IUPA 4CJ2C 3DEOA 4NDXA 2QEJC 5C3EB 5IGFA 3PV0A 1STAA 5IGCA 1J8IA 2L11A 1EY9A 2F0NA 4X3KA 1V1OA 5CBAE 4H0LC 2EYJA 1ML0D 5COYA 1A15A 4KK7A 3I4LA 4J8QA 2DN8A 2B2UC 2B2WC 3TDQA 1PTOB 5DEHA 2BE5C 2K5DA 3K5OA 3HZXA 4K5VA 4K8IA 2A6HC 3GTQB 1F2LA 3BVMA 1KLGD 1IKMA 1HXYD 3DWAA 2RSOA 1DYQA 2H1EA 4RWSC 1MD2D 1CHPD 4I65A 3QOJA 5FLXE 1RHPA 2I46A 3KLRA 1R9TB 3N6RA 1NUCA 1CM9A 1II3A 3VR5A 5C44B 1I4GA 4BA1I 4NP5A 3PUYA 1B44D 1LTTD 1FR3A 4ZUJA 3SE0A 4ULLA 4EQOA 3HKZB 1Q90A 3T56B 5KGUA 1G6ZA 1SNCA 1TWGB 2J4XA 1RTOA 1E2VA 1X3QA 3GD7A 3SDZA 3DMUA 1CT1D 1K83B 1B9MA 1U4LA 3A7AB 1SAPA 4NKLA 2A68D 3MA2B 5DM73 1HCZA 1EYAA 3D4DA 4H13C 1SE4A 5C4ZA 5CYUA 2KUMA 1EY4A 1W6KA 4ZKBB 2L9HA 5KRUA 4RKBA 4IFDJ 4RCNA 4BY1B 2K04A 1I4PA 5E4XA 4XQNA 4BY7B 3V96A 3FMCA 5BN4A 3MWYW 2YYZA 2F0SA 3WOEA 2L5TA 3FPPA 4MIUA 2IX0A 3T16A 2ZXOA 1EU3A 5HURA 1LTID 3D4WA 1HHVA 2K01A 2PPBC 4G7HC 2EY5A 2QKIC 5A2QE 2ICIA 2WKCA 3C1EA 1YNJD 2Z4IA 2MPMA 2JE6I 2F0UA 3D31A 3MXPA 3J81E 1LTGD 1F9SA 5JPNC 1WVLA 4ZLTF 4CKEA 2K28A 1CI3M 5J22A 3A8JE 1EWCA 4ZK9B 2FJ2A 3CHBD 2E2JB 1LT5D 2XWBB 5JEAJ 1LT4D 1QILA 3PUXA 1GUWA 2G9DA 3X3MA 3S16B 2XN9C 1X32A 3S2DB 4C3JB 3KUPA 2WACA 3C1FA 4HAEA 1PTOH 4DAVA 1PTOD 5IIFA 3K57A 2J7ZA 2F0MA 1RJTA 3MAQA 1LO5D 3S15B 3BVGA 1H9KA 3W2DA 2EXZA 2KCNA 1T5XD 5I4DA 1SYCA 3CU7A 3J7AV 2DY8A 3CQZB 1E0BA 2E2DC 2Q8IB 3VYSA 1Q12A 4JK1C 3MFYA 4RH6A 3T4AC 2EOTA 2PNRC 2EYMA 1L0YB 1BCPB 5FLXL 4KJNA 3AB9A 4DU9A 1EYCA 3GTOB 1H9SA 3BS1A 1KDAA 2F0PA 4X3TA 1G2SA 2IJ0A 3HS0C 5JOBA 4ZQ3A 1TWHB 5C0XJ 2NVXB 2K05A 5IGGA 1I4QA 1V1PA 3GTPB 3K6OA 1BNZA 3A8KE 1RCVD 1HFNA 5T1IA 4F87A 2SEBD 1SNPA 3MZ5A 5K36H 2NZ1D 1C4QA 2SDFA 4FXKC 3MEHA 2A68C 1DOMA 4V0BA 1C8CA 5CV5A 3TSSA 4PMWA 1XYIA 3ND9A 3GTLB 3P7JA 1SNMA 1WCMB 1HA5A 5EQ0A 3NWTA 4KHZA 3RZOB 3Q23A 2N88A 2BDOA 4HTHA 4OO1H 1B1ZA 2J0TD 2O5JC 3NQTA 3LWEA 2NN6G 3DWPA 3LWUA 3VR2A 1TWAB 4C56C 2I07B 1S5BD 2AQ3B 3NXWA 4XYOA 1X3PA 4KKUA 4LK1C 5ISRA 1F2ZA 3MTSA 1HTLD 2CHBD 5K36G 2WB1B 4LJZC 2NWGA 1U4RA 2QF7A 2MGSA 1GUOA 5A2QL 1SSOA 4CKCA 3G6JB 5ELDA 3VYTA 1SYDA 1Y8NB 4ODGA 1SYFA 3J81L 1ZXTA 3HG9A 1Z47A 3NTHA 5EPKA 2C5CA 2LKVA 2F0WA 3I70A 4H7BA 2JXMB 4TSSA 1JWMD 1SXTA 3BZDB 3KK7A 2EY6A 2ZXPA 5KNDA 1O80A 1IW7D 3L9AX 4EQNA 3JAME 2HUGA 3QWNA 1D1IA 1KABA 1PTOC 2F0IA 4KV6A 5T1GA 4ZAIA 3TP8A 5IGBA 1A3TA 3U9OA 4PMBA 3TP5A 2MHVA 3GV6A 2WIIB 4DNRB 4C2MB 2KVMA 5KNCA 3PUWA 1FNUA 1JWUD 4X3UA 1IYVA 1PRTF 4O1NA 4R9WA 2M2LA 1QCBD 3HOYB 3PO2B 2CQAA 4ZUIA 3HGBA 1EEID 5J1ZA 2A69C 4B08A 1CFMA 1TS3A 1LTSD 3A8IE 1AN8A 3IFDA 2B2TC 1EEFD 1H9JA 2OT2A 1EL0A 4QF4A 1HTPA 5EJWA 1BOSA 4C1NI 3HOVB 2PZUA 3TZDA 3VA7A 2XSCA 1ILPA 1S4ZA 3DUZA 2O4XA 5CC4A 1H9MA 1EIHA 5CV8A 1EY5A 2F3WA 5D14A 4FXGC 4PMCA 4CHTB 5EKIA 5IOCA 3Q22A 2CW0D 1PZID 1HFGA 3K5LA 3CRLC 1STYA 4A3MB 2X69A 4R8IA 1V43A 1B2TA 2SNMA 1RTNA 3NPPA 4IFDG 3MFGA 2KEDA 3RZDB 1JWSD 2KQ3A 3MXGA 3I72A 4KN4C 4BBRB 1TWFB 4HCEA 4M8AA 5EGTA 1PZJD 3IFTA 1BUVT 3E0JA 1EWHA 4QB4A 4R8NA 1JORA 1S5DD 4I7ZC 1PRTC 2JEBI 4KI0A 5LHY1 4NW2A 1DONA 3R8BA 2AWOA 2SOBA 3AU7A 1DJRD 2AQ1B 4KN7C 4IQZA 2NUCA 3S1NB 3QO2A 1JR0D 2R3ZA 1UUPA 5FK9C 1Q3LA 4AYBB 5C4HA 3K58A 2XRSD 3R2TA 1OXUA 2EYPA 2A6ED 1TU2B 3LNNA 3GQBA 1LTAD 4Y7NB 2BA0A 5JEAG 2G9HD 2JA8B 5C0XH 5EPJA 4TKOB 1GHKA 4G7ZC 2B2VC 4C3HG 4RKLA 1CHQD 2PZWA 5C5LA 3V2TA 4RHSA 1Q1BA 4GZYC 1SYGA 3TZUA 1AZQA 4OHJA 4V190 1NCVA 1O7LA 3BDCA 1WTOA 3BG3A 5I2YA 4XYQA 1Q1EA 1STNA 2L12A 1J9OA 2WKDA 1ENCA 4CKBA 1JB3A 2F0TA 4P2CB 3HOUB 2RBMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KAA A;  4NMZ A;  2EYF A;  3C1F A;  1U9R A;  2F0L A;  1A2U A;  4HTH A;  4F8M A;  3P1H A;  2F0J A;  3MHB A;  4ME5 A;  1JOK A;  3HEJ A;  4NKL A;  5C6A A;  4EVO A;  1TR5 A;  2SNS A;  2PZT A;  3NQT A;  1ENA A;  3ITP A;  5EGT A;  5IIF A;  4J6H A;  2F0M A;  1JOQ A;  1EYA A;  3D4D A;  4KD3 A;  5J39 A;  3VA5 A;  5C3W A;  5IGD A;  1KDC A;  2EXZ A;  4IAL A;  2OXP A;  3PMF A;  4K8J A;  5CV7 A;  2ENB A;  4QB4 A;  4R8N A;  5C4Z A;  1JOR A;  3NUC A;  2PW5 A;  3DHQ A;  4EQP A;  1STG A;  1SYC A;  3NP8 A;  5DEH A;  3LX0 A;  5IGE A;  4IZ8 A;  4ZUI A;  5I9P A;  3OMC A;  1AEX A;  1EY4 A;  5J1Z A;  2EYH A;  1EY6 A;  3NXW A;  3HZX A;  5KRU A;  5JAV A;  1SNQ A;  1JOO A;  5CR3 A;  2EY2 A;  4K5V A;  4K8I A;  4PNY A;  3QB3 A;  4RKB A;  2F0H A;  2SOB A;  4S3S A;  4KTA A;  1EZ8 A;  5ISR A;  3BDL A;  4N9P A;  1F2Z A;  2EYM A;  4HMI A;  5KYL A;  2HQE A;  3TP7 A;  5I6W A;  4KY6 A;  3ERQ A;  3R3O A;  2EYL A;  4KJN A;  2NUC A;  5KEE A;  3NHH A;  1TT2 A;  1SND A;  1EZ6 A;  4DU9 A;  2F0D A;  4QF4 A;  3SXH A;  1EYC A;  3SR1 A;  4DGZ A;  3SK4 A;  4K6D A;  5C4H A;  1STB A;  1KDA A;  3D6C A;  2EYO A;  2F0P A;  4B9W A;  3OWF A;  5I6Y A;  1TQO A;  4DF7 A;  1SYD A;  2EYP A;  4DFA A;  2F0S A;  4ODG A;  2F0K A;  4WRD A;  5F2D A;  1SYF A;  3OSO A;  1SNO A;  2F0O A;  5JOB A;  3SHL A;  4I65 A;  2F0G A;  2PZU A;  4IUN A;  4KD4 A;  4MIU A;  4TRD A;  4ZQ3 A;  3T16 A;  3QOJ A;  5CGK A;  3D4W A;  5HUR A;  1SYE A;  1F2Y A;  1SYB A;  4K2K A;  5E3F A;  4YIJ A;  1EY8 A;  3SK6 A;  1NSN S;  3SK8 A;  5IGG A;  2OEO A;  2LKV A;  1KDB A;  2F0W A;  4H7B A;  5M9O A;  4E6I A;  2EY5 A;  5EKK A;  4B9X A;  4J1M A;  3S9W A;  1NUC A;  2O4X A;  2PW7 A;  5CC4 A;  3QOL A;  5CV8 A;  1EY5 A;  3D8G A;  5DAU A;  1A3V A;  4RKL A;  1II3 A;  2F3W A;  2F0V A;  3MVV A;  1EYD A;  1RKN A;  2PZW A;  2F0E A;  3C1E A;  2F3V A;  5C5L A;  5C5M A;  2PQE A;  4NP5 A;  2EY6 A;  3TP6 A;  4F7X A;  5C3X A;  4PMC A;  5K5P A;  4K5X A;  5KGU A;  2F0U A;  3NK9 A;  2F0F A;  3V2T A;  5IOC A;  1SNP A;  3MXP A;  4ZUJ A;  1EY0 A;  4LAA A;  2RDF A;  3E5S A;  3EJI A;  3MZ5 A;  4K2L A;  4KHV A;  4N9T A;  4NDX A;  2QDB A;  4QMG A;  5IGF A;  1EQV A;  1SYG A;  4KY7 A;  4EQO A;  4EQN A;  1F2M A;  1STA A;  5IGC A;  1KAB A;  2F0I A;  3MEH A;  1SNC A;  3P75 A;  4ID6 A;  4K5W A;  4KV6 A;  1IHZ A;  3RUZ A;  1STH A;  1EY9 A;  1STY A;  2PYK A;  3OMG A;  4OL7 A;  5NUC A;  3TP8 A;  5I9O A;  3BDC A;  5CV5 A;  3SK5 A;  5IGB A;  5J22 A;  5KIX A;  3ERO A;  5EKL A;  2F0N A;  2F0Q A;  2SNM A;  3EVQ A;  2KHS A;  5CV9 A;  1A3U A;  1STN A;  2WAC A;  3H6M A;  3DMU A;  5E1F A;  5HGT A;  5CV4 A;  5CV6 A;  3T13 A;  1A3T A;  1SNM A;  2EY1 A;  3U9O A;  4PMB A;  3TP5 A;  1ENC A;  2M00 A;  4G57 A;  4WOR A;  4KJO A;  1EY7 A;  4K14 A;  5IOD A;  4HMJ A;  2KQ3 A;  4KY5 A;  2F0T A;  2RKS A;  2OF1 A;  5KYI A;  2EYJ A;  2RBM A;  3TME A;  1A2T A; 
#chains in the Genus database with same CATH topology
 5AFW A;  1KL9 A;  3PO2 H;  1EQQ A;  5IT9 E;  3DM3 A;  5G3L D;  5M5Y B;  5IYD H;  3M4Q A;  1EIG A;  5M5X B;  3CW2 C;  2VL6 A;  1XTD A;  3D3R A;  4DK6 C;  1EYG A;  2F4V L;  1EQR A;  1HUM A;  2AWN A;  1N9W A;  4DAP A;  2KEC A;  4PG3 A;  1PH4 A;  2ENB A;  5C0X G;  3MXN A;  1VF5 C;  2BOS A;  5LMN W;  1PH9 A;  2RHS B;  4DKA C;  2OTJ A;  2KCC A;  3P20 A;  4ZKC B;  1IL2 A;  2F0H A;  3URY A;  1D5M C;  4S3S A;  1MBY A;  1XMO L;  4X64 L;  4IUV A;  2XRQ D;  3HOV H;  3A56 A;  4DV6 Q;  1I3Q B;  1H9R A;  4O2D A;  4PQX A;  1S5E D;  4J15 A;  2F0D A;  5CBE E;  3AEV A;  1MHW C;  1K8O A;  4GN3 B;  4IPG A;  2RSN A;  1YJ9 A;  4JI1 Q;  3OWF A;  2CW0 C;  1SRU A;  3FVQ A;  2MP1 A;  4A3C H;  2QGQ A;  3K0X A;  1GJX A;  4KD4 A;  2A73 B;  1CSQ A;  3A55 A;  1SR3 A;  3KF6 B;  2N55 A;  1MSG A;  5IP9 G;  2DNE A;  1JE5 A;  2NB0 A;  3M4Y A;  2PMZ B;  4O42 A;  3CCV A;  3HOY G;  5JJK A;  2LY7 A;  2PW7 A;  5G3L F;  1ET6 A;  1BF4 A;  3K59 A;  4A3M H;  1E2W A;  2B2T A;  3BYT B;  5K5P A;  2A8V A;  2EVB A;  3NK9 A;  4LF5 Q;  4A75 A;  2LMC B;  1CUK A;  4X3S A;  2HCC A;  2L0C A;  3F2U A;  3RZD H;  2CWA A;  2PI2 A;  4OL7 A;  2IW3 A;  2JQO A;  1LAB A;  3PUZ A;  1XNQ Q;  1N34 L;  4BBR H;  3W1G A;  1X3G A;  3T13 A;  1SJE D;  5CMD A;  1XTC D;  2A5H A;  1NTG A;  1TWF H;  2ICE C;  1MJC A;  3HP3 A;  4KJO A;  4JYA L;  3U58 A;  3CRK C;  3HOV G;  1B4O A;  4OEM B;  2PCF B;  3G7L A;  3D4R A;  1KAA A;  1CZW A;  1V8Q A;  2B29 A;  1U9R A;  1B70 B;  1CKN B;  2UUA L;  4JBJ A;  4JI4 L;  3CME A;  2LFN A;  3I4N B;  1O7Z A;  2B63 B;  3KLS A;  4L5Q A;  2ZTD A;  2CVR A;  1WD1 A;  4KD3 A;  1VQM A;  1CQV A;  2UUC Q;  1XPU A;  4HSP A;  1GKH A;  3GDE A;  4IPD A;  3S1R B;  3HOW G;  1LYL A;  1FGB D;  4C3I G;  2R7Z B;  1MGS A;  2VQF Q;  3S1N H;  4IZ8 A;  5EPL A;  5A35 A;  1W3S A;  5FO9 B;  4OWX B;  4A3M G;  4JI7 Q;  4KKS A;  4G4K A;  3ERQ A;  3IKJ A;  1PZK D;  4Y7N H;  2JA8 H;  4DUZ Q;  1QE6 A;  2Q2T A;  1UEA B;  1DM0 B;  1EOT A;  3K7A B;  5ELN A;  4QIW E;  1LAC A;  1QJO A;  3J7Y W;  1EQT A;  5C3E G;  2F0K A;  3TS2 A;  3Q0A A;  3SHL A;  3S2H B;  1AW7 A;  1EY8 A;  1FNW A;  4A3B B;  5M9O A;  1WD0 A;  1ENF A;  1PXU A;  4GOP B;  3ULL A;  4OGQ C;  1SE2 A;  1PH1 A;  1J5E L;  1WTP A;  5JJZ A;  1IBK Q;  2F0E A;  1I4H A;  2NTT A;  3A5U A;  2Z4H A;  1AE2 A;  2ZT9 C;  1P16 A;  3E5S A;  1UAP A;  4R4T A;  5NUC A;  1VMP A;  1MJE A;  3HOU H;  1IL8 A;  4R4Q A;  3OIP A;  3EVQ A;  2BDN A;  5GRO A;  1W6J A;  1PTO F;  2KJX A;  4LUV A;  5M5Y H;  2B2V A;  3GTJ B;  4KY5 A;  5M5X H;  1ONL A;  4XXE A;  5ELC A;  3KLS X;  5M3M B;  1WTV A;  2JA8 G;  1XPO A;  4JI0 Q;  1KC8 C;  4HJ7 A;  2EYF A;  3ONA B;  3TRZ A;  3P1H A;  1CZG A;  3IL8 A;  1BBU A;  4DR3 L;  4RGO S;  2K5H A;  2PZT A;  3I7F A;  4UP9 A;  2MO0 A;  1KDC A;  1WTH A;  5CV7 A;  3BDO A;  3PQI A;  4HIM A;  4EQP A;  1I3Q H;  3RD4 A;  2RCF A;  4L6T B;  1DD2 A;  2EYH A;  1RDP D;  1L1O A;  1XX8 A;  2RF4 A;  1GOZ A;  3HKS A;  3NWS A;  2R61 A;  3RLF A;  3M3Y B;  5FKA C;  3PIP 3;  4DR2 L;  1O7I A;  2E76 C;  1KXL A;  4KKT A;  1IBL Q;  4K0K L;  3S24 A;  5KEE A;  2O2L D;  4HED A;  1TT2 A;  2X6L A;  1Q46 A;  4FNF A;  2K5Q A;  4YWK A;  5IP7 G;  2GN5 A;  5EBC A;  4QUF A;  2RDG A;  5D65 A;  1S5F D;  5C44 G;  1D2B A;  1NAP A;  2ZTC A;  3D6C A;  4JI6 L;  2AUK A;  1I6V C;  5I6Y A;  2HQL A;  4MTK A;  4DFA A;  1NE3 A;  1PYB A;  2HCI A;  1NNX A;  3JC6 6;  1VQ7 A;  4XT1 B;  2VQE Q;  2UXC Q;  1TS4 A;  3OSO A;  2F0O A;  4LUO A;  4MHE A;  4BA2 I;  4R1J A;  1LT3 D;  1HNW L;  1TS5 A;  2KOL A;  4QGU A;  4YIJ A;  3AMU A;  3SK6 A;  1NSN S;  4JW0 A;  4DR5 Q;  1VMC A;  2F1M A;  2OEO A;  3WWV A;  5L37 A;  3CXC A;  4P72 A;  4UAI A;  2E2H B;  2GA4 B;  3H3V I;  4RFB A;  5DAU A;  5ELB A;  1IYJ B;  3ERS X;  1VF7 A;  1YNJ C;  5D3D A;  5C3X A;  2PQE A;  1MSH A;  1Z9F A;  2MNA A;  3H3V C;  4P71 A;  3OOC A;  5IWA L;  2Z0S A;  2B8F A;  4QMG A;  1IBM Q;  2QDB A;  4DA2 A;  2QA4 A;  4KY7 A;  5IE8 A;  2OWO A;  2ZJQ A;  2N8N A;  3RUZ A;  3J81 i;  2KCM A;  4NXN L;  4A3D B;  1S3O A;  4HCS A;  3KF8 A;  3SK5 A;  5KIX A;  1G29 1;  3VYU A;  2KHS A;  2IPK D;  3H09 A;  1OXT A;  1NY4 A;  5E1F A;  1ZKO A;  1CK1 A;  1J6Q A;  1TXY A;  2R7D A;  4KHP Q;  1SMY D;  4ME3 A;  4WJW A;  3UE0 A;  4IPH A;  4G57 A;  4OO1 G;  3I4N H;  1I6H B;  2UXD Q;  1QVC A;  3I4M B;  3C2P A;  2B8G A;  1QNU A;  1A2T A;  4RGM A;  2Q8T A;  5DM6 3;  4BY1 G;  1PFS A;  2FFK B;  3S1R H;  1VQP A;  4BWG B;  4LF9 Q;  2L4N A;  3J80 E;  2K5N A;  4TQU S;  4BY7 G;  2EXD A;  4L8J A;  1QUQ B;  2IX1 A;  5ELE A;  4DV2 L;  1UEB A;  4A3I B;  5C4X B;  4NXM L;  1HA6 A;  4IAL A;  1LTR D;  2JJQ A;  2QCP X;  1IYU A;  4LF8 L;  3CC7 A;  1GO3 E;  3NUC A;  4LW1 A;  2YTV A;  4FF2 A;  4XT3 B;  5IGE A;  3R93 A;  1M8A A;  4QCL A;  1B3A A;  2BE5 D;  1QB5 D;  3HKZ E;  1ZYR D;  3EN2 A;  5JAV A;  4FXD A;  2O5I C;  2E74 C;  2FIN B;  3DEP A;  5H1S E;  3K7A H;  4FYD A;  5FJ8 H;  3RNU A;  4LFB Q;  1JQY D;  5BN5 A;  4Q5V A;  3DM1 A;  4RHR A;  1PH2 A;  2PI2 E;  2CFM A;  4A3B H;  1IZ6 A;  2EYO A;  3D6W A;  2NN6 I;  1D6E C;  1QOH A;  1BCP D;  4WRD A;  3R2I A;  3CKI B;  2K7V A;  2HDL A;  2F0G A;  3M4P A;  4TRD A;  1MI2 A;  3OW7 A;  5BR8 L;  3KOJ A;  1BO0 A;  3L2P A;  1RL2 A;  1ASY A;  2B63 G;  3RMH A;  2HDM A;  2EZV A;  1SEB D;  3GTK B;  4IUT A;  4ZRZ A;  3U9S A;  3FPU B;  3OTO Q;  4XQJ A;  2R7Z G;  3MVV A;  1OXS C;  2TMP A;  1YHA A;  4QIW B;  1GUT A;  4C3J G;  2B2Y C;  2LS0 1;  2MUY A;  2L1B A;  1X6O A;  3GTJ H;  2X6G A;  4K5W A;  3HOZ B;  4YWM A;  2PYK A;  3OMG A;  1BQQ T;  4FVM A;  5M3M H;  2YU9 B;  2QW7 A;  4GS3 A;  4QJF A;  3U4Z A;  3H6M A;  5CV4 A;  3RN5 A;  4IPC A;  2ID0 A;  1M90 C;  1K3B C;  3M4O B;  5C4J H;  2E2I B;  5IOD A;  1VQN A;  3FKI B;  2R93 B;  3H0G B;  4J6H A;  2Y0S E;  4A3L G;  4LF7 Q;  3K0Y A;  4ABN A;  4RMF A;  1BCP F;  2F0L A;  1A2U A;  4A3B G;  1GHJ A;  2F0J A;  1YI2 A;  1JOK A;  4B3T L;  4DV1 Q;  2ASB A;  2K6A A;  3H91 A;  2CH4 W;  1Z6H A;  2Q2U A;  1QG7 A;  3M3Y H;  3OPO A;  2H4O A;  3I2Z A;  2R92 B;  1RD9 D;  4GLA C;  3J7Z C;  2R7F A;  1STG A;  3M9B A;  3LX0 A;  4JBW A;  2AUJ D;  5FO8 B;  1AEX A;  2ZXR A;  2DJG C;  4LFA Q;  4DR6 Q;  5FO7 B;  3T51 B;  4I7A A;  5FLX c;  1SE3 A;  4LMQ D;  3KBG A;  1XPR A;  1Q7Y C;  2FMC A;  1K3R A;  2M9V A;  3GP7 A;  1YNN D;  5KYL A;  4KY6 A;  1NR4 A;  2JA7 H;  1K73 C;  1N32 Q;  2H5X A;  3BZK A;  1I4R A;  2WIN B;  3SXH A;  2EIF A;  3SR1 A;  4A3F B;  1AZP A;  1V1Q A;  4PZ7 A;  2JA5 H;  4DAM A;  2VNU D;  1YHB A;  3FEW X;  2E2H H;  4B3R L;  4RGT A;  2RCN A;  1L0W A;  4LF4 L;  5FLM H;  3MC0 B;  3A54 A;  5CGK A;  2A1A A;  3EA6 A;  2Q2I A;  5E3F A;  2DGY A;  2V4D A;  5JJI A;  3F2C A;  4CDF C;  1KDB A;  1HUN A;  4E6I A;  3I91 A;  1F9P A;  2NVT B;  4UP7 A;  1DXM A;  1SMY C;  3D8G A;  1HNX Q;  1D8L A;  2NBF A;  2E5L L;  2F0V A;  4DV3 L;  1FJG Q;  4A3D H;  3PO3 B;  4JBK A;  2F3V A;  1DCZ A;  1GXD C;  1OXX K;  1VQF A;  4PZ8 A;  1G6P A;  4JOI C;  4DR4 L;  3J7A F;  1IW7 C;  4K2L A;  3NBH A;  1EQV A;  1F2M A;  2NTS A;  1SDF A;  2Q8R E;  3HOX B;  4ID6 A;  1I6H H;  2DJF C;  1BXT A;  3I4M H;  4DN4 M;  3IAY A;  3JAM L;  5I9O A;  4DV0 Q;  2CCZ A;  2Z8L A;  3JAM i;  3J80 L;  3M7N A;  4HN7 A;  4HR7 B;  4KMU C;  5EKL A;  1S72 A;  4BXX G;  2F0Q A;  5CV9 A;  1VQJ A;  3TRE A;  1KNA A;  1Y69 U;  4OON A;  5HGT A;  4ALP A;  1A6X A;  4BBS B;  4EGV A;  4OIJ A;  4K14 A;  1KHI A;  1I94 L;  1LLR D;  1TS2 A;  2OF1 A;  2RKS A;  5KYI A;  2JA6 B;  4FF1 A;  4A3I H;  1OXV A;  1PDQ A;  2IHF A;  3CCM A;  1E2Z A;  1ZYR C;  4O0A A;  1VQG A;  1Y1V B;  3TME A;  4UY8 C;  3T1Y L;  3AYH B;  4X65 L;  3HFZ B;  4BS9 A;  4DK0 A;  3HEJ A;  3L3O C;  5C6A A;  2WB1 G;  1GVP A;  4WJ3 M;  1ENA A;  1NBW A;  2K5V A;  1YJW A;  1JE4 A;  1PFB A;  2D0O A;  1JOQ A;  3OHX C;  3C46 A;  2D9U A;  1FYC A;  1BCP C;  2PW5 A;  5EAY A;  1L1O C;  4XDX A;  2RQX A;  4IFD I;  1SNQ A;  5CR3 A;  4YCU A;  3MXU A;  3W1B A;  3GTG B;  3S17 H;  4A3D G;  4Z9C B;  1HQR D;  4HMI A;  1WTX A;  1I4X A;  3AFP A;  1M4V A;  2EYL A;  2EJM A;  1SFO B;  4OIK A;  1SND A;  1EZ6 A;  3NEN A;  2NVQ B;  5FOB B;  3I4M G;  1HQM C;  1KLU D;  1F9Q A;  1D1K A;  4A3G B;  3GTK H;  1TQO A;  3J81 c;  1G2T A;  1EFI D;  1XMQ L;  1PMR A;  2K1B A;  4X62 L;  3W3A A;  2IT1 A;  4RCO A;  1Q82 C;  3I8Z A;  4CJ0 B;  2JYO A;  2NZO A;  2UU9 L;  2BCO A;  4A3I G;  1BBW A;  2C35 B;  5C4X G;  1WTW A;  1UNS A;  4B9X A;  3BU2 A;  2D62 A;  5ELF A;  4DUY Q;  1HR0 Q;  2RVL A;  2VW9 A;  3HOZ H;  1UWV A;  4JI3 Q;  1Y14 B;  1JB7 A;  3H94 A;  3PF5 A;  4U67 3;  1I50 B;  4LF6 Q;  2YU9 H;  4XTC S;  1JJ2 A;  2BA1 A;  1X55 A;  2L15 A;  3VR4 A;  4CBV A;  4AQY L;  2A74 C;  1C9O A;  1ASZ A;  4KHV A;  5M3F B;  1CTM A;  1DOK A;  3M4O H;  3UI2 A;  3P75 A;  2E2I H;  2IWH A;  1LTL A;  2JP1 A;  3FKI H;  1ICF B;  4YCW A;  2R93 H;  4K6L A;  3H0G H;  2AHO B;  1JJC B;  4H44 C;  5LMN Q;  2XWJ B;  1X3F A;  5CV6 A;  4LFC Q;  3U50 C;  3TEH B;  2WAQ B;  3PO2 G;  1TWC B;  4DK1 A;  3O13 A;  4HMJ A;  1XXG A;  1LV9 A;  5IYD G;  4NMZ A;  1U4P A;  2R92 H;  4LNQ A;  1VQE A;  4GNX C;  1EIF A;  2B2Y A;  5E4W C;  2WP8 J;  4F8M A;  1RF2 D;  4ME5 A;  1YNN C;  3EQL C;  4IN3 A;  1BDO A;  2IX3 A;  5J39 A;  1R4Q B;  4DGZ A;  2OXP A;  1PVO A;  1JIC A;  3SVM A;  4AIM A;  1PYW D;  4FO2 A;  1XNR Q;  4HID A;  1VQ8 A;  1XWE A;  2IL8 A;  3OMC A;  1L0X B;  4A3F H;  4XQQ A;  2Y0S B;  4XIG S;  5AJ3 Q;  4DV6 L;  3K8A A;  1ESF A;  1NMG A;  1AFP A;  2NYZ D;  2RDH A;  1PA6 A;  4UP8 A;  4HIK A;  4JI1 L;  3PIP A;  3R3O A;  1OTC A;  1K0R A;  2GVB A;  4A3C G;  1PRT B;  1CQF A;  4KLK A;  3CCL A;  3GV3 A;  3A5Z B;  4RGN A;  3PSI A;  4DXG A;  3NE5 B;  2R93 G;  1BBX C;  3KF6 A;  4JI2 Q;  2A6E C;  2NVT H;  2LSS A;  1VDZ A;  1SE8 A;  1VQK A;  5C0X I;  1F9R A;  1N36 Q;  3PO3 H;  1H9S B;  2FHT A;  1SYE A;  1SYB A;  3NSW A;  1UE5 A;  2EPB A;  1ET9 A;  2EJF C;  2KBN A;  4IUQ A;  4GKK Q;  4DR7 Q;  4LF5 L;  3I73 A;  5LL6 X;  3HOX H;  2PO4 A;  3VYR A;  3QOL A;  3RLN A;  2PQA B;  5JVG 3;  4L5R C;  2Z9H A;  2K03 A;  1WJJ A;  4GKJ Q;  2D2C C;  4B3M Q;  3TP6 A;  1V1P B;  1SN8 A;  1HRJ A;  3I56 A;  2K5W A;  4LAA A;  4BBS H;  4BBR G;  1XNQ L;  4JI8 Q;  1PV4 A;  1ROD A;  1G8Z D;  1JC7 A;  2JA6 H;  1A0I A;  4DV5 Q;  1Y1W B;  1PFN A;  1NJI C;  1Y1V H;  4PV1 C;  5D3I B;  3M85 A;  1EFW A;  3BYY B;  3WDN A;  1SJH D;  2EDG A;  5DNF A;  4AH6 A;  1VQ5 A;  1CKN A;  3ER0 A;  1HZC A;  2BH8 A;  4C1N K;  2KEN A;  2VS1 A;  2D5D A;  4JOI A;  1ICW A;  4ILW A;  1E1O A;  3MHB A;  1E3P A;  2UUC L;  4L5S A;  1B50 A;  3NQI A;  4OX9 Q;  4EVO A;  5IT9 L;  2FMM A;  3ITP A;  1NR2 A;  4A3E B;  1CSP A;  2VQF L;  3GTG H;  1D5X C;  3VA5 A;  3PO3 G;  4AYB G;  4HSV A;  5C3W A;  1ZEQ X;  5KNB A;  4WFN 3;  2NZH A;  4X66 Q;  4JI7 L;  2LXK A;  2B2U A;  2YTY A;  4DAY A;  2B2W A;  1S5C D;  3SEB A;  1SFO H;  5I9P A;  1C7Y A;  2NN6 H;  2NVQ H;  2A69 D;  1XJV A;  2VB3 X;  1PH5 A;  2AKW B;  3N52 A;  3S1M B;  3QB3 A;  3CCE A;  1FL0 A;  4DUZ L;  4A3G H;  4DNT B;  3BDL A;  4DR1 Q;  5GAE C;  2HQE A;  5C4J B;  3L7Z C;  4DXF A;  1TVX A;  1TWG H;  1YIJ A;  4YY3 Q;  1O78 A;  4A93 B;  3M7G A;  4QUC A;  5JVH 3;  1B53 A;  1R4P B;  3QJY A;  1CA6 A;  3S14 B;  2CWP A;  5F2D A;  3JAM c;  4M1U B;  1SNO A;  1X9N A;  1GUS A;  4IUR A;  4IUN A;  1GUG A;  1I50 H;  3H15 A;  5LMU Q;  1VQC A;  3Q6S A;  4K2K A;  2HIX A;  3WOF A;  3VR6 A;  2EE1 A;  3PIO A;  2UXB Q;  1IBK L;  2NVY B;  5M3F H;  1SLJ A;  4A3K B;  1C48 A;  5I2X A;  1C0A A;  2AQ2 B;  1KNE A;  2Z6K C;  1PH8 A;  1GUN A;  1PFM A;  1D5Z C;  2MJ8 A;  4POG A;  3GO5 A;  2F4I A;  3VR3 A;  3NBI A;  3J81 j;  5JPM C;  3HOU G;  1EY0 A;  3EJI A;  1JT8 A;  4N9T A;  1PH6 A;  3NTK A;  4F88 A;  2JA7 B;  1TWC H;  1Z7T A;  4HIO A;  3UE1 A;  2Z1C A;  1Y8P B;  1IHZ A;  1STH A;  1IKL A;  1TY2 A;  3ERO A;  4RA8 A;  2JA5 B;  1A3U A;  3V05 A;  1KTK A;  4FP5 D;  1VQO A;  1RIP A;  4IUU A;  1KAW A;  2TSS A;  4C3H B;  4JI0 L;  1E24 A;  5EBD A;  4ZYS A;  2M00 A;  1EY7 A;  1HPC A;  5IYB H;  2HHH Q;  1PLF A;  3E9H A;  2ZTE A;  1EU4 A;  2E75 C;  2VB2 X;  3ND8 A;  1AH9 A;  2ZM6 Q;  3C3L A;  3CD6 A;  2KEE A;  1TY0 A;  3OIQ A;  4Q0F A;  1LTB D;  2LXJ A;  3T1H Q;  2OCE A;  2VZA A;  2JA9 A;  2SNS A;  2L55 A;  1HNZ Q;  3OWE B;  5IY0 A;  1LT6 D;  3DHQ A;  5M3F G;  3NP8 A;  5M5W B;  4JV5 Q;  1DOL A;  1PRT D;  2XNA C;  1EY6 A;  1IBL L;  4IO9 A;  3PF4 A;  2N3S A;  4PNY A;  2CQO A;  1KRS A;  2K52 A;  4NPS A;  4KTA A;  2ATW A;  4N9P A;  3Q24 A;  4GNX A;  3UDI A;  4IOC A;  2ALY B;  3TP7 A;  3T53 B;  2WAQ G;  1ESR A;  3CMA A;  4FF3 A;  1YNX A;  4CJ1 B;  4RAU C;  2UXC L;  2VQE L;  1WTQ A;  3EFX D;  3SK4 A;  4K6D A;  3KBX A;  2KHJ A;  4DF7 A;  1VQ6 A;  1G51 A;  4DR5 L;  1EUJ A;  5COR A;  4UDU C;  1HZB A;  5TSS A;  3L0O A;  4FF4 A;  3NTI A;  1LM0 A;  3FRP B;  1F2Y A;  3I90 A;  4JVZ A;  1O7Y A;  1TKW B;  2A6H D;  4HJ5 A;  3NEL A;  4Y52 H;  3LGJ A;  3K81 C;  1B9N A;  4J1M A;  2I5M X;  2QIL A;  2F03 A;  2R6G A;  4QL5 A;  1IBM L;  1A3V A;  4CGY B;  1EYD A;  4MN3 A;  1Y1W H;  1OO9 B;  3K5M A;  4F7X A;  3S17 B;  1DZ1 A;  1T5E A;  4K5X A;  4OWT B;  1BR9 A;  1U4M A;  2F0F A;  1VCI A;  3S15 H;  1L2F A;  2RDF A;  4MNO A;  2I0Q A;  3I3C A;  1QNK A;  5LL6 S;  3PIO 3;  3A7L A;  2K4K A;  4KHP L;  3E6Z X;  3I4N G;  5GAH C;  4FDB A;  3TBI B;  3DWQ A;  1MIU A;  2UXD L;  3PUV A;  2K32 A;  3E9I A;  3E0E A;  3TS0 A;  2EY1 A;  5HY6 A;  4JI5 Q;  3RN2 A;  1VQ4 A;  4WOR A;  1K8M A;  4A3E H;  4LF9 L;  1G91 A;  2B39 A;  1KIX A;  5IGD A;  2UUB Q;  1VQI A;  3UDF A;  1FD7 D;  4L63 B;  4IFD H;  1N33 Q;  3K5N A;  2FXQ A;  1TR5 A;  1Q8I A;  4JG2 A;  1WTR A;  3S1Q B;  3KDF B;  3S1M H;  2B3G A;  4K8J A;  3PMF A;  3QIA A;  1ILQ A;  4DK3 C;  4IJL A;  5FJ8 G;  5BN3 A;  2VUM B;  1CA5 A;  3QG1 A;  4LFB L;  4A93 H;  4OO1 I;  3X3N A;  3GTM B;  1JOO A;  2EY2 A;  2K75 A;  2EJG C;  1QWY A;  2DY7 A;  3ZYY X;  1EZ8 A;  2K33 A;  3S14 H;  4PZ6 A;  3DXJ C;  2EQS A;  5I6W A;  2QEX A;  2JEA I;  4EX5 A;  4YWL A;  3FDT A;  3CC4 A;  3NHH A;  1QVF A;  1F77 A;  4JCV E;  1JJG A;  2WV6 D;  3BVZ A;  1PH3 A;  1STB A;  1FNV A;  2NVY H;  4B9W A;  2XIW A;  1H95 A;  4A3K H;  3HOW B;  1JMC A;  4C3I B;  4GN5 A;  1WCM H;  2DNC A;  4DV7 Q;  1HH2 P;  1STE A;  1TII D;  3MEF A;  3TN2 A;  4U68 A;  1SBB B;  2JSO A;  3OTO L;  2VXW A;  3ULJ A;  3SK8 A;  1VQH A;  1EOV A;  4DV4 Q;  1GM5 A;  3NBH B;  5EKK A;  3UDG A;  2BH2 A;  2C9O A;  3S9W A;  1AP0 A;  2RA4 A;  3HRZ C;  1Y8O B;  5JEA H;  4JBM A;  5J3B A;  1QVG A;  2XVS A;  1JCK B;  1RKN A;  3KLW A;  4G7O C;  3VDY A;  5C5M A;  4A3J B;  4B3S Q;  2KA7 A;  5M3M G;  4IUP A;  4CJ2 C;  3DEO A;  1FGU A;  4NDX A;  2QEJ C;  5C3E B;  5IGF A;  4C3H H;  3ICE A;  3PV0 A;  5IT9 c;  1STA A;  4L5T A;  5IGC A;  3EIV A;  1J8I A;  2L11 A;  1EY9 A;  2F0N A;  4X3K A;  1V1O A;  4A93 G;  3QR8 A;  1CKO A;  5CBA E;  2Z6K A;  4LF7 L;  2DUD A;  4LWC A;  4H0L C;  2RHQ B;  2EYJ A;  1VS0 A;  1ML0 D;  4DV1 L;  1WOC A;  2OQ0 A;  4YHH Q;  3G4S A;  5COY A;  3DLL A;  5M5W H;  1A15 A;  4A3K G;  4KK7 A;  3I4L A;  3J80 i;  1P8L A;  3G6E A;  4J8Q A;  4LFA L;  2DN8 A;  3CCS A;  2B2U C;  1Q8K A;  2OQK A;  4DR6 L;  2B2W C;  2IY5 B;  1UE1 A;  1YBY A;  2YV5 A;  4P74 A;  3TDQ A;  1PTO B;  5DEH A;  2F4V Q;  2JA7 G;  2BE5 C;  2K5D A;  3K5O A;  3HZX A;  1E1T A;  3RLO A;  1N32 L;  4K5V A;  3MXN B;  4K8I A;  2A6H C;  3GTQ B;  1F2L A;  2JA5 G;  3BVM A;  1KLG D;  1IKM A;  1HXY D;  5FLM G;  3DWA A;  1PYS B;  2RSO A;  4ZCK A;  1DYQ A;  1XMO Q;  1N8R C;  4X64 Q;  2H1E A;  3CF5 A;  1WFQ A;  4GOP C;  4RWS C;  1MD2 D;  1CHP D;  4LUZ A;  3A74 A;  4I65 A;  1GD7 A;  3CC2 A;  3QOJ A;  1HNX L;  5FLX E;  1BVS A;  1RHP A;  3KJO A;  1FJG L;  2I46 A;  3KLR A;  1R9T B;  3N6R A;  1NUC A;  1CM9 A;  1VQ9 A;  1II3 A;  3VR5 A;  1HZA A;  4DNI A;  5C44 B;  4UHV A;  4GLV B;  1UE7 A;  1I4G A;  1HR0 W;  4BA1 I;  4NP5 A;  3PUY A;  1B44 D;  5IP9 H;  1LTT D;  1X56 A;  1FR3 A;  4ZUJ A;  3K80 C;  4DV0 L;  3SE0 A;  4ULL A;  4EQO A;  3HKZ B;  1Q90 A;  3FP9 A;  3T56 B;  5KGU A;  1G6Z A;  1SNC A;  4APV A;  1TWG B;  4QY7 A;  2J4X A;  1RTO A;  1E2V A;  1X3Q A;  3GD7 A;  3B6Y A;  3SDZ A;  1QZG A;  3DMU A;  2N49 A;  1CT1 D;  1PHJ A;  1DGS A;  1K83 B;  1B9M A;  1U4L A;  3A7A B;  1SAP A;  1N34 Q;  3S1Q H;  4X6A H;  3D0F A;  3CPF A;  4IOA A;  1VQD A;  4JYA Q;  1YZ6 A;  3F1Z A;  2XGT A;  4JPB W;  4CDC C;  4NKL A;  2VUM H;  2A68 D;  1T9H A;  3MA2 B;  5DM7 3;  2WB1 E;  3GTM H;  1HCZ A;  1EYA A;  3D4D A;  4H13 C;  1SE4 A;  3PCO B;  2UUA Q;  5C4Z A;  4JI4 Q;  4YCV A;  3PGZ A;  2F3I A;  5CYU A;  2KUM A;  1V9P A;  1EY4 A;  1W6K A;  4ZKB B;  3F8T A;  2L9H A;  5KRU A;  4RKB A;  4IFD J;  4RCN A;  1A62 A;  4BY1 B;  3HOW H;  2K04 A;  3CP0 A;  1X65 A;  4C3I H;  2CH4 A;  1I4P A;  5E4X A;  4XQN A;  3CCQ A;  4BY7 B;  3V96 A;  3FMC A;  1MKH A;  2K14 A;  2Q2H A;  3E3X A;  5BN4 A;  3EBE A;  3MWY W;  1CKM A;  2YYZ A;  3Q8D A;  2F0S A;  2YTX A;  2L5T A;  3FPP A;  3WOE A;  2V1C C;  5HGQ A;  1X3E A;  3HOZ G;  2IX0 A;  4MIU A;  3T16 A;  1K0S A;  2ZXO A;  1EU3 A;  4A4I A;  5HUR A;  1LTI D;  3D4W A;  4DUY L;  4A3J H;  1HR0 L;  4JI3 L;  1HHV A;  2K01 A;  2PPB C;  4LF6 L;  5C3E H;  4G7H C;  3NEM A;  2EY5 A;  2QKI C;  5A2Q E;  3ULP A;  2ICI A;  2WKC A;  3C1E A;  1YNJ D;  2Z4I A;  2VUM G;  2MPM A;  3FKI G;  3H3V H;  2JE6 I;  2F0U A;  3D31 A;  3MXP A;  3H0G G;  3ZJY C;  1J5E Q;  3J81 E;  1LTG D;  1F9S A;  5JPN C;  3CPW A;  1WVL A;  5LMN L;  4LFC L;  4ZLT F;  4CKE A;  2K28 A;  1CI3 M;  5J22 A;  1A8V A;  3A8J E;  1B7Y B;  1EWC A;  4ZK9 B;  2FJ2 A;  2OTL A;  3CHB D;  2R92 G;  2E2J B;  1LT5 D;  2XWB B;  5JEA J;  2GVA A;  1LT4 D;  1QIL A;  3PUX A;  1GUW A;  2G9D A;  3X3M A;  3S16 B;  2XN9 C;  2Z6B A;  2G5D A;  1X32 A;  1EIY B;  3S2D B;  4C3J B;  3KUP A;  2WAC A;  3A0J A;  3C1F A;  1YIT A;  4HAE A;  1PTO H;  4DAV A;  4DAY B;  1PTO D;  1XNR L;  5IIF A;  3K57 A;  2J7Z A;  2F0M A;  1RJT A;  3MAQ A;  1K8G A;  1LO5 D;  4A3F G;  3S15 B;  3BVG A;  1H9K A;  3W2D A;  3GTQ H;  2EXZ A;  2KCN A;  1T5X D;  4N8X 1;  3CCJ A;  4A3J G;  4DR3 Q;  5AJ3 L;  1BKB A;  4HJ9 A;  5I4D A;  1SYC A;  3CU7 A;  3J7A V;  2DY8 A;  3CQZ B;  1E0B A;  2E2D C;  1Q81 C;  2Q8I B;  3VYS A;  1Q12 A;  4JK1 C;  3MFY A;  4RH6 A;  3T4A C;  4CDE C;  2MFI A;  2P5Z X;  2EOT A;  1YHQ A;  2PNR C;  2EYM A;  1L0Y B;  1BCP B;  5FLX L;  4KJN A;  4JI2 L;  3AB9 A;  1L1O B;  5GAG C;  4DU9 A;  4DR2 Q;  1EYC A;  3GTO B;  1H9S A;  1N36 L;  3BS1 A;  1KDA A;  2F0P A;  4X3T A;  4K0K Q;  1M1K C;  1G2S A;  1K28 A;  2K50 A;  1R9T H;  2IJ0 A;  2KHI A;  3HS0 C;  1FVI A;  5JOB A;  5IP7 H;  3HOX G;  3G71 A;  4JI6 Q;  4GKK L;  4ZQ3 A;  5C44 H;  4DR7 L;  2PQA A;  1TWH B;  5C0X J;  3K7U C;  3SGI A;  2NVX B;  2K05 A;  5IGG A;  1I4Q A;  1YEZ A;  2AMC B;  1V1P A;  3GTP B;  4GKJ L;  4B3M L;  3K6O A;  1BNZ A;  3A8K E;  4BBS G;  1HNW Q;  4P75 A;  1RCV D;  4JI8 L;  1HFN A;  2JA6 G;  5T1I A;  4F87 A;  2SEB D;  1SNP A;  1Y1V G;  3I4O A;  3MZ5 A;  4DV5 L;  5K36 H;  2NZ1 D;  1C4Q A;  2SDF A;  1K83 H;  4GLX A;  3J80 c;  1UE6 A;  4GOP A;  4FXK C;  3MEH A;  2A68 C;  5IWA Q;  1DOM A;  4V0B A;  1C8C A;  5CV5 A;  1YVC A;  2ES2 A;  3TSS A;  4PMW A;  1XYI A;  3ND9 A;  3TQY A;  3GTL B;  3P7J A;  1SNM A;  3IRB A;  1WCM B;  1HA5 A;  4NB3 A;  4NXN Q;  5EQ0 A;  3J7A 5;  3NWT A;  2D0P A;  4QQB X;  3KF8 B;  4KHZ A;  1K9M C;  3RZO B;  2IHE A;  3Q23 A;  2N88 A;  4OX9 L;  2JN4 A;  4R4I A;  2MQH A;  2WFW A;  2BDO A;  4HTH A;  4OO1 H;  3STB D;  1B1Z A;  2HD3 A;  2J0T D;  2O5J C;  4X66 L;  3NQT A;  3LWE A;  2NN6 G;  3DWP A;  3LWU A;  3VR2 A;  4BY1 H;  1TWA B;  4C56 C;  4AYB E;  4A3G G;  4GNX B;  2I07 B;  1S5B D;  4DV2 Q;  4BY7 H;  1B3Q A;  2AQ3 B;  3HKZ G;  4NXM Q;  4DR1 L;  4UPA A;  3G48 A;  3NXW A;  4XYO A;  1X3P A;  4LF8 Q;  2QDL A;  4KKU A;  4LK1 C;  4YY3 L;  5ISR A;  1E7Z A;  1F2Z A;  3MTS A;  4JC0 A;  1HTL D;  2CHB D;  5K36 G;  3KJP A;  2WB1 B;  4LJZ C;  2NWG A;  1U4R A;  2QF7 A;  4H02 A;  2MGS A;  1HZ9 A;  1GUO A;  5A2Q L;  1SSO A;  5E7N A;  4CKC A;  2JK8 A;  1S40 A;  3G6J B;  5ELD A;  5LMU L;  3VYT A;  1SYD A;  1Y8N B;  4ODG A;  2UXB L;  2F52 A;  1SYF A;  3J81 L;  1SMX A;  1ZXT A;  1K8A C;  3HG9 A;  1Z47 A;  3NTH A;  5EPK A;  2C5C A;  2LKV A;  2F0W A;  3I70 A;  4H7B A;  2JXM B;  4POF A;  5BR8 Q;  4TSS A;  1JWM D;  5ELO A;  1SXT A;  3CCU A;  3BZD B;  2B63 H;  4MTN A;  3KK7 A;  2EY6 A;  2ZXP A;  5KND A;  1O80 A;  2E2J H;  1IW7 D;  3L9A X;  1I5F A;  4EQN A;  3JAM E;  2HUG A;  3CAM A;  1D1I A;  1KAB A;  1PTO C;  2F0I A;  3QWN A;  2R7Z H;  4KV6 A;  5T1G A;  3S16 H;  4ZAI A;  3TP8 A;  5IYB G;  5IGB A;  3S2D H;  4C3J H;  5JJL A;  2HHH L;  1D7Q A;  2CKZ B;  3F2B A;  1A3T A;  2ZM6 L;  3U9O A;  4PMB A;  3TP5 A;  2MHV A;  3GV6 A;  2WII B;  4DNR B;  2I5H A;  4C2M B;  2KVM A;  5KNC A;  3RR5 A;  2Y0S G;  3T1H L;  5IYC H;  1U0L A;  2KCT A;  4OEL B;  3PUW A;  1FNU A;  1HNZ L;  1JWU D;  4X3U A;  1IYV A;  1PRT F;  3CQZ H;  4O1N A;  3S2H H;  4R9W A;  2M2L A;  1QCB D;  2MO1 A;  3I55 A;  4JV5 L;  4A3L H;  1NMF A;  4P73 A;  3UDX A;  3HOY B;  2E8G A;  3PO2 B;  4B3T Q;  2CQA A;  4MZ9 A;  4ZUI A;  3HGB A;  1B8A A;  1EEI D;  1QUQ A;  5J1Z A;  3F2D A;  1KQS A;  3W5O A;  1VQA A;  2A69 C;  3GTO H;  4B08 A;  1CFM A;  1TS3 A;  4TVA B;  4R4O A;  4RG1 A;  1LTS D;  3A8I E;  2PMZ E;  1KRT A;  1AN8 A;  3IFD A;  2B2T C;  2WAQ E;  1TWH H;  1EEF D;  3KFU A;  1H9J A;  2OT2 A;  1EL0 A;  4QF4 A;  2NVX H;  1HTP A;  2I5L X;  5EJW A;  4HJ8 A;  1HJP A;  3GTP H;  1BOS A;  2ZJR A;  2VY3 A;  4C1N I;  3HOV B;  2PZU A;  3TZD A;  3VA7 A;  1WYD A;  2XSC A;  4N8F A;  1ILP A;  1Y1W G;  4B3R Q;  4LF4 Q;  1S4Z A;  1SRO A;  5IYC G;  3DUZ A;  3OW2 A;  2O4X A;  2PNH A;  5CC4 A;  1H9M A;  1EIH A;  5CV8 A;  1EY5 A;  4GN4 B;  1WI5 A;  2F3W A;  3KYH C;  5D14 A;  2HIV A;  4FXG C;  4PMC A;  4CHT B;  1VQB A;  5EKI A;  5IOC A;  3Q22 A;  2CW0 D;  3GTL H;  1PZI D;  1HFG A;  3K5L A;  2E5L Q;  4DV3 Q;  1W2B A;  3CRL C;  3STB C;  3RZO H;  1STY A;  4A3M B;  4DR4 Q;  4JI5 L;  4DPG A;  2X69 A;  4R8I A;  4A3E G;  1V43 A;  1B2T A;  2SNM A;  1Q86 C;  2UUB L;  1RTN A;  3NPP A;  4IJH A;  4IFD G;  3MFG A;  2KED A;  3RZD B;  1JWS D;  2KQ3 A;  1N33 L;  4BXX H;  3MXG A;  3I72 A;  4KN4 C;  1TWA H;  3KDF A;  4BBR B;  2A19 A;  4OWW B;  1I94 Q;  3OYY A;  1TWF B;  4HCE A;  4M8A A;  5EGT A;  3T1Y Q;  1PZJ D;  3IFT A;  1BUV T;  4X65 Q;  3E0J A;  1EWH A;  4QB4 A;  3CCR A;  4R8N A;  1JOR A;  4HJA A;  1S5D D;  4I7Z C;  4EQ5 A;  1A63 A;  1PRT C;  2JEB I;  4KI0 A;  1X54 A;  5LHY 1;  4NW2 A;  1DON A;  3R8B A;  2AWO A;  2SOB A;  3AU7 A;  4R4C A;  1DJR D;  2AQ1 B;  5GAD C;  4KN7 C;  3FHW A;  4IQZ A;  2NUC A;  1AE3 A;  1WCM G;  3S1N B;  3QO2 A;  1JR0 D;  2N78 A;  2R3Z A;  1UUP A;  5FK9 C;  1Q3L A;  4CDD C;  4AYB B;  1IXR A;  5C4H A;  3K58 A;  1E22 A;  4DV7 L;  2XRS D;  3R2T A;  1OXU A;  2EYP A;  2A6E D;  4OXP A;  1TU2 B;  3AFQ A;  3LNN A;  4DV4 L;  3GQB A;  1LTA D;  4Y7N B;  2BA0 A;  5JEA G;  2G9H D;  2JA8 B;  5C0X H;  5EPJ A;  4TKO B;  1EWI A;  1GHK A;  1XMQ Q;  5DLQ E;  4X62 Q;  4G7Z C;  1U5K A;  4B3S L;  2XTI A;  2B2V C;  4C3H G;  4RKL A;  2UU9 Q;  1CHQ D;  2PZW A;  3AQQ A;  5C5L A;  5C4X H;  3V2T A;  4RHS A;  4WJ4 A;  1PH7 A;  2HT1 A;  1Q1B A;  4GZY C;  1SYG A;  3TZU A;  1AZQ A;  4OHJ A;  1VQL A;  3U4V A;  4V19 0;  4C2M H;  1YJN A;  1NCV A;  4AQY Q;  1O7L A;  2ZJP A;  3BDC A;  1WTO A;  3BG3 A;  5I2Y A;  4XYQ A;  1Q1E A;  1STN A;  1LUZ A;  2L12 A;  1QZH A;  5GQO A;  1J9O A;  3BZC A;  2WKD A;  1ENC A;  4A76 A;  4YHH L;  4CKB A;  1JB3 A;  2F0T A;  4P2C B;  1KD1 C;  3HOU B;  3BJU A;  2RBM A;  3HOY H; 
#chains in the Genus database with same CATH homology
 5AFW A;  5IT9 E;  5G3L D;  5M5Y B;  1EIG A;  5M5X B;  3D3R A;  1HUM A;  2AWN A;  4DAP A;  2KEC A;  2ENB A;  5C0X G;  3MXN A;  1VF5 C;  2BOS A;  2KCC A;  3P20 A;  4ZKC B;  2F0H A;  3URY A;  1D5M C;  4S3S A;  1MBY A;  4IUV A;  2XRQ D;  3A56 A;  1I3Q B;  1H9R A;  4PQX A;  1S5E D;  2F0D A;  5CBE E;  1K8O A;  2RSN A;  3OWF A;  2CW0 C;  3FVQ A;  2MP1 A;  1GJX A;  4KD4 A;  2A73 B;  3A55 A;  2N55 A;  1MSG A;  2DNE A;  2NB0 A;  3M4Y A;  2PMZ B;  4O42 A;  2LY7 A;  2PW7 A;  5G3L F;  1ET6 A;  1BF4 A;  3K59 A;  1E2W A;  2B2T A;  3BYT B;  5K5P A;  2EVB A;  3NK9 A;  2LMC B;  4X3S A;  2HCC A;  2L0C A;  3F2U A;  4OL7 A;  2IW3 A;  1LAB A;  3PUZ A;  3T13 A;  1SJE D;  5CMD A;  1XTC D;  2A5H A;  2ICE C;  3HP3 A;  4KJO A;  3CRK C;  1B4O A;  2PCF B;  3G7L A;  3D4R A;  1KAA A;  1CZW A;  1V8Q A;  1U9R A;  2LFN A;  3I4N B;  1O7Z A;  2B63 B;  3KLS A;  2CVR A;  1WD1 A;  4KD3 A;  1CQV A;  4HSP A;  3S1R B;  1FGB D;  4C3I G;  2R7Z B;  1MGS A;  4IZ8 A;  5EPL A;  5A35 A;  5FO9 B;  4KKS A;  4G4K A;  3ERQ A;  3IKJ A;  1PZK D;  1QE6 A;  1UEA B;  1DM0 B;  1EOT A;  3K7A B;  1LAC A;  1QJO A;  3J7Y W;  1EQT A;  2F0K A;  3Q0A A;  3SHL A;  3S2H B;  1AW7 A;  1EY8 A;  1FNW A;  4A3B B;  5M9O A;  1WD0 A;  1ENF A;  1PXU A;  4OGQ C;  1SE2 A;  1WTP A;  5JJZ A;  2F0E A;  1I4H A;  2NTT A;  2Z4H A;  2ZT9 C;  3E5S A;  1UAP A;  5NUC A;  1VMP A;  1IL8 A;  3OIP A;  3EVQ A;  2BDN A;  1W6J A;  1PTO F;  2KJX A;  2B2V A;  3GTJ B;  4KY5 A;  1ONL A;  4XXE A;  5ELC A;  3KLS X;  5M3M B;  1WTV A;  2EYF A;  3ONA B;  3P1H A;  1CZG A;  3IL8 A;  4RGO S;  2PZT A;  1KDC A;  5CV7 A;  3BDO A;  4EQP A;  3RD4 A;  4L6T B;  1DD2 A;  2EYH A;  1RDP D;  1XX8 A;  1GOZ A;  3NWS A;  2R61 A;  3RLF A;  3M3Y B;  5FKA C;  3PIP 3;  2E76 C;  4KKT A;  5KEE A;  2O2L D;  4HED A;  1TT2 A;  2X6L A;  2K5Q A;  4FNF A;  5EBC A;  4QUF A;  2RDG A;  5D65 A;  1S5F D;  1D2B A;  1NAP A;  3D6C A;  2AUK A;  1I6V C;  5I6Y A;  4DFA A;  2HCI A;  4XT1 B;  1TS4 A;  3OSO A;  2F0O A;  4MHE A;  4BA2 I;  1LT3 D;  1TS5 A;  2KOL A;  4YIJ A;  3AMU A;  3SK6 A;  1NSN S;  1VMC A;  2F1M A;  2OEO A;  4UAI A;  2E2H B;  2GA4 B;  4RFB A;  5DAU A;  5ELB A;  1VF7 A;  1YNJ C;  5D3D A;  5C3X A;  2PQE A;  1MSH A;  3H3V C;  3OOC A;  2B8F A;  4QMG A;  2QDB A;  4DA2 A;  4KY7 A;  3RUZ A;  4A3D B;  4HCS A;  3SK5 A;  3KF8 A;  5KIX A;  1G29 1;  3VYU A;  2KHS A;  2IPK D;  3H09 A;  1OXT A;  5E1F A;  1ZKO A;  1CK1 A;  1SMY D;  4WJW A;  4G57 A;  4OO1 G;  1I6H B;  3I4M B;  3C2P A;  2B8G A;  1QNU A;  1A2T A;  4RGM A;  2Q8T A;  5DM6 3;  2FFK B;  4BWG B;  2L4N A;  3J80 E;  4TQU S;  4L8J A;  2IX1 A;  5ELE A;  4A3I B;  5C4X B;  1HA6 A;  4IAL A;  1LTR D;  2QCP X;  1IYU A;  3NUC A;  4FF2 A;  4XT3 B;  5IGE A;  3R93 A;  1M8A A;  4QCL A;  1B3A A;  2BE5 D;  1QB5 D;  1ZYR D;  5JAV A;  4FXD A;  2O5I C;  2E74 C;  2FIN B;  3DEP A;  4FYD A;  1JQY D;  5BN5 A;  4Q5V A;  3DM1 A;  4RHR A;  2EYO A;  3D6W A;  2NN6 I;  1D6E C;  1QOH A;  1BCP D;  4WRD A;  3R2I A;  3CKI B;  2K7V A;  2HDL A;  4TRD A;  2F0G A;  1MI2 A;  3OW7 A;  1BO0 A;  3RMH A;  2HDM A;  2EZV A;  1SEB D;  3GTK B;  4IUT A;  4ZRZ A;  3U9S A;  3FPU B;  4XQJ A;  3MVV A;  1OXS C;  2TMP A;  4QIW B;  1GUT A;  4C3J G;  2B2Y C;  2LS0 1;  2MUY A;  2L1B A;  2X6G A;  4K5W A;  3HOZ B;  2PYK A;  3OMG A;  1BQQ T;  4FVM A;  2YU9 B;  3H6M A;  5CV4 A;  2ID0 A;  3M4O B;  2E2I B;  5IOD A;  3FKI B;  2R93 B;  3H0G B;  4J6H A;  3K0Y A;  4ABN A;  1BCP F;  2F0L A;  1A2U A;  1GHJ A;  2F0J A;  1JOK A;  2K6A A;  3H91 A;  1Z6H A;  1QG7 A;  3OPO A;  2H4O A;  2R92 B;  1RD9 D;  1STG A;  3LX0 A;  4JBW A;  2AUJ D;  5FO8 B;  1AEX A;  2ZXR A;  5FO7 B;  3T51 B;  1SE3 A;  4LMQ D;  3KBG A;  2FMC A;  2M9V A;  3GP7 A;  1YNN D;  5KYL A;  4KY6 A;  1NR4 A;  1I4R A;  2WIN B;  3SXH A;  3SR1 A;  4A3F B;  1AZP A;  2VNU D;  3FEW X;  4RGT A;  3MC0 B;  3A54 A;  5CGK A;  3EA6 A;  5E3F A;  2V4D A;  1KDB A;  1HUN A;  4E6I A;  3I91 A;  1F9P A;  2NVT B;  1DXM A;  1SMY C;  3D8G A;  2NBF A;  2F0V A;  3PO3 B;  2F3V A;  1DCZ A;  1GXD C;  1OXX K;  3J7A F;  1IW7 C;  4K2L A;  3NBH A;  1EQV A;  1F2M A;  2NTS A;  1SDF A;  2Q8R E;  3HOX B;  4ID6 A;  1BXT A;  4DN4 M;  3IAY A;  3JAM L;  5I9O A;  2Z8L A;  3J80 L;  3M7N A;  4HN7 A;  4HR7 B;  4KMU C;  5EKL A;  2F0Q A;  5CV9 A;  1KNA A;  1Y69 U;  5HGT A;  1A6X A;  4BBS B;  4EGV A;  4OIJ A;  4K14 A;  1LLR D;  1TS2 A;  2OF1 A;  2RKS A;  5KYI A;  2JA6 B;  4FF1 A;  1OXV A;  1PDQ A;  1E2Z A;  1ZYR C;  1Y1V B;  3TME A;  4BS9 A;  4DK0 A;  3HEJ A;  3L3O C;  5C6A A;  1ENA A;  1JE4 A;  1PFB A;  1JOQ A;  3OHX C;  3C46 A;  2D9U A;  1FYC A;  1BCP C;  2PW5 A;  4XDX A;  2RQX A;  4IFD I;  1SNQ A;  5CR3 A;  3GTG B;  3MXU A;  4Z9C B;  1HQR D;  4HMI A;  1WTX A;  1I4X A;  1M4V A;  2EYL A;  2EJM A;  1SFO B;  4OIK A;  1SND A;  1EZ6 A;  2NVQ B;  5FOB B;  1HQM C;  1KLU D;  1F9Q A;  1D1K A;  4A3G B;  1TQO A;  1G2T A;  1EFI D;  1PMR A;  2K1B A;  3W3A A;  2IT1 A;  4RCO A;  3I8Z A;  4CJ0 B;  2JYO A;  2BCO A;  1WTW A;  1UNS A;  4B9X A;  2D62 A;  5ELF A;  2RVL A;  3H94 A;  4U67 3;  1I50 B;  4XTC S;  2BA1 A;  3VR4 A;  4CBV A;  2A74 C;  4KHV A;  5M3F B;  1CTM A;  1DOK A;  3UI2 A;  3P75 A;  2IWH A;  2JP1 A;  4K6L A;  4H44 C;  2XWJ B;  5CV6 A;  2WAQ B;  1TWC B;  4DK1 A;  3O13 A;  4HMJ A;  1XXG A;  1LV9 A;  4NMZ A;  1U4P A;  2B2Y A;  5E4W C;  2WP8 J;  4F8M A;  1RF2 D;  4ME5 A;  1YNN C;  3EQL C;  4IN3 A;  1BDO A;  2IX3 A;  5J39 A;  1R4Q B;  4DGZ A;  2OXP A;  1JIC A;  3SVM A;  1PYW D;  4FO2 A;  1XWE A;  2IL8 A;  3OMC A;  1L0X B;  4XQQ A;  2Y0S B;  4XIG S;  1ESF A;  1AFP A;  2NYZ D;  2RDH A;  3R3O A;  1PRT B;  1CQF A;  3GV3 A;  4DXG A;  4RGN A;  3NE5 B;  1BBX C;  2A6E C;  1VDZ A;  5C0X I;  1F9R A;  1H9S B;  2FHT A;  1SYE A;  1SYB A;  3NSW A;  2EPB A;  1ET9 A;  2EJF C;  4IUQ A;  3I73 A;  5LL6 X;  2PO4 A;  3VYR A;  3QOL A;  5JVG 3;  2K03 A;  2D2C C;  3TP6 A;  1V1P B;  1HRJ A;  2K5W A;  4LAA A;  1ROD A;  1G8Z D;  1JC7 A;  1Y1W B;  1PFN A;  4PV1 C;  5D3I B;  3M85 A;  3BYY B;  3WDN A;  1SJH D;  2EDG A;  5DNF A;  4C1N K;  2D5D A;  1ICW A;  4ILW A;  3MHB A;  1B50 A;  3NQI A;  4EVO A;  5IT9 L;  2FMM A;  3ITP A;  1NR2 A;  4A3E B;  1D5X C;  3VA5 A;  4HSV A;  5C3W A;  1ZEQ X;  5KNB A;  4WFN 3;  2B2U A;  4DAY A;  2B2W A;  1S5C D;  3SEB A;  5I9P A;  2NN6 H;  2A69 D;  2VB3 X;  3N52 A;  3S1M B;  3QB3 A;  4DNT B;  3BDL A;  2HQE A;  5C4J B;  3L7Z C;  4DXF A;  1TVX A;  1O78 A;  4A93 B;  3M7G A;  4QUC A;  5JVH 3;  1B53 A;  1R4P B;  3QJY A;  1CA6 A;  3S14 B;  5F2D A;  4M1U B;  1SNO A;  1GUS A;  4IUN A;  4IUR A;  1GUG A;  3Q6S A;  4K2K A;  3WOF A;  3VR6 A;  2EE1 A;  2NVY B;  4A3K B;  1C48 A;  5I2X A;  2AQ2 B;  1KNE A;  1GUN A;  1PFM A;  1D5Z C;  2MJ8 A;  3GO5 A;  2F4I A;  3VR3 A;  3NBI A;  5JPM C;  1EY0 A;  3EJI A;  4N9T A;  3NTK A;  4F88 A;  2JA7 B;  1Z7T A;  2Z1C A;  1Y8P B;  1IHZ A;  1STH A;  1IKL A;  1TY2 A;  3ERO A;  4RA8 A;  2JA5 B;  1A3U A;  3V05 A;  1KTK A;  4FP5 D;  4IUU A;  2TSS A;  4C3H B;  5EBD A;  4ZYS A;  2M00 A;  1EY7 A;  1HPC A;  1PLF A;  1EU4 A;  2E75 C;  2VB2 X;  3ND8 A;  3C3L A;  2KEE A;  1TY0 A;  3OIQ A;  4Q0F A;  1LTB D;  2SNS A;  2L55 A;  3OWE B;  1LT6 D;  3DHQ A;  3NP8 A;  5M5W B;  1DOL A;  1PRT D;  2XNA C;  1EY6 A;  4PNY A;  4KTA A;  4N9P A;  3Q24 A;  3TP7 A;  3T53 B;  1ESR A;  4FF3 A;  4CJ1 B;  4RAU C;  1WTQ A;  3EFX D;  3SK4 A;  4K6D A;  3KBX A;  4DF7 A;  5COR A;  4UDU C;  5TSS A;  4FF4 A;  3NTI A;  3FRP B;  1F2Y A;  3I90 A;  1O7Y A;  1TKW B;  2A6H D;  1B9N A;  4J1M A;  2QIL A;  2F03 A;  2R6G A;  1A3V A;  4CGY B;  1EYD A;  4MN3 A;  1OO9 B;  3K5M A;  4F7X A;  3S17 B;  1DZ1 A;  1T5E A;  4K5X A;  1BR9 A;  1U4M A;  2F0F A;  1VCI A;  2RDF A;  3I3C A;  1QNK A;  5LL6 S;  3PIO 3;  3A7L A;  3E6Z X;  3TBI B;  3DWQ A;  3PUV A;  2K32 A;  2EY1 A;  4WOR A;  1K8M A;  1G91 A;  2B39 A;  5IGD A;  1FD7 D;  4L63 B;  4IFD H;  3K5N A;  1TR5 A;  1Q8I A;  1WTR A;  3S1Q B;  4K8J A;  3PMF A;  3QIA A;  1ILQ A;  5BN3 A;  2VUM B;  1CA5 A;  3QG1 A;  4OO1 I;  3X3N A;  3GTM B;  1JOO A;  2EY2 A;  2EJG C;  1QWY A;  2DY7 A;  3ZYY X;  1EZ8 A;  2K33 A;  3DXJ C;  5I6W A;  2JEA I;  3FDT A;  3NHH A;  1F77 A;  2WV6 D;  3BVZ A;  1STB A;  1FNV A;  4B9W A;  2XIW A;  3HOW B;  4C3I B;  2DNC A;  1STE A;  1TII D;  3TN2 A;  4U68 A;  1SBB B;  2JSO A;  2VXW A;  3SK8 A;  5EKK A;  2C9O A;  3S9W A;  1AP0 A;  2RA4 A;  3HRZ C;  1Y8O B;  5JEA H;  2XVS A;  1JCK B;  1RKN A;  4G7O C;  5C5M A;  4A3J B;  2KA7 A;  4IUP A;  4CJ2 C;  3DEO A;  4NDX A;  2QEJ C;  5C3E B;  5IGF A;  3PV0 A;  1STA A;  5IGC A;  1J8I A;  2L11 A;  1EY9 A;  2F0N A;  4X3K A;  1V1O A;  5CBA E;  4H0L C;  2EYJ A;  1ML0 D;  5COY A;  1A15 A;  4KK7 A;  3I4L A;  4J8Q A;  2DN8 A;  2B2U C;  2B2W C;  3TDQ A;  1PTO B;  5DEH A;  2BE5 C;  2K5D A;  3K5O A;  3HZX A;  4K5V A;  4K8I A;  2A6H C;  3GTQ B;  1F2L A;  3BVM A;  1KLG D;  1IKM A;  1HXY D;  3DWA A;  2RSO A;  1DYQ A;  2H1E A;  4RWS C;  1MD2 D;  1CHP D;  4I65 A;  3QOJ A;  5FLX E;  1RHP A;  2I46 A;  3KLR A;  1R9T B;  3N6R A;  1NUC A;  1CM9 A;  1II3 A;  3VR5 A;  5C44 B;  1I4G A;  4BA1 I;  4NP5 A;  3PUY A;  1B44 D;  1LTT D;  1FR3 A;  4ZUJ A;  3SE0 A;  4ULL A;  4EQO A;  3HKZ B;  1Q90 A;  3T56 B;  5KGU A;  1G6Z A;  1SNC A;  1TWG B;  2J4X A;  1RTO A;  1E2V A;  1X3Q A;  3GD7 A;  3SDZ A;  3DMU A;  1CT1 D;  1K83 B;  1B9M A;  1U4L A;  3A7A B;  1SAP A;  4NKL A;  2A68 D;  3MA2 B;  5DM7 3;  1HCZ A;  1EYA A;  3D4D A;  4H13 C;  1SE4 A;  5C4Z A;  5CYU A;  2KUM A;  1EY4 A;  1W6K A;  4ZKB B;  2L9H A;  5KRU A;  4RKB A;  4IFD J;  4RCN A;  4BY1 B;  2K04 A;  1I4P A;  5E4X A;  4XQN A;  4BY7 B;  3V96 A;  3FMC A;  5BN4 A;  3MWY W;  2YYZ A;  2F0S A;  3WOE A;  2L5T A;  3FPP A;  4MIU A;  2IX0 A;  3T16 A;  2ZXO A;  1EU3 A;  5HUR A;  1LTI D;  3D4W A;  1HHV A;  2K01 A;  2PPB C;  4G7H C;  2EY5 A;  2QKI C;  5A2Q E;  2ICI A;  2WKC A;  3C1E A;  1YNJ D;  2Z4I A;  2MPM A;  2JE6 I;  2F0U A;  3D31 A;  3MXP A;  3J81 E;  1LTG D;  1F9S A;  5JPN C;  1WVL A;  4ZLT F;  4CKE A;  2K28 A;  1CI3 M;  5J22 A;  3A8J E;  1EWC A;  4ZK9 B;  2FJ2 A;  3CHB D;  2E2J B;  1LT5 D;  2XWB B;  5JEA J;  1LT4 D;  1QIL A;  3PUX A;  1GUW A;  2G9D A;  3X3M A;  3S16 B;  2XN9 C;  1X32 A;  3S2D B;  4C3J B;  3KUP A;  2WAC A;  3C1F A;  4HAE A;  1PTO H;  4DAV A;  1PTO D;  5IIF A;  3K57 A;  2J7Z A;  2F0M A;  1RJT A;  3MAQ A;  1LO5 D;  3S15 B;  3BVG A;  1H9K A;  3W2D A;  2EXZ A;  2KCN A;  1T5X D;  5I4D A;  1SYC A;  3CU7 A;  3J7A V;  2DY8 A;  3CQZ B;  1E0B A;  2E2D C;  2Q8I B;  3VYS A;  1Q12 A;  4JK1 C;  3MFY A;  4RH6 A;  3T4A C;  2EOT A;  2PNR C;  2EYM A;  1L0Y B;  1BCP B;  5FLX L;  4KJN A;  3AB9 A;  4DU9 A;  1EYC A;  3GTO B;  1H9S A;  3BS1 A;  1KDA A;  2F0P A;  4X3T A;  1G2S A;  2IJ0 A;  3HS0 C;  5JOB A;  4ZQ3 A;  1TWH B;  5C0X J;  2NVX B;  2K05 A;  5IGG A;  1I4Q A;  1V1P A;  3GTP B;  3K6O A;  1BNZ A;  3A8K E;  1RCV D;  1HFN A;  5T1I A;  4F87 A;  2SEB D;  1SNP A;  3MZ5 A;  5K36 H;  2NZ1 D;  1C4Q A;  2SDF A;  4FXK C;  3MEH A;  2A68 C;  1DOM A;  4V0B A;  1C8C A;  5CV5 A;  3TSS A;  4PMW A;  1XYI A;  3ND9 A;  3GTL B;  3P7J A;  1SNM A;  1WCM B;  1HA5 A;  5EQ0 A;  3NWT A;  4KHZ A;  3RZO B;  3Q23 A;  2N88 A;  2BDO A;  4HTH A;  4OO1 H;  1B1Z A;  2J0T D;  2O5J C;  3NQT A;  3LWE A;  2NN6 G;  3DWP A;  3LWU A;  3VR2 A;  1TWA B;  4C56 C;  2I07 B;  1S5B D;  2AQ3 B;  3NXW A;  4XYO A;  1X3P A;  4KKU A;  4LK1 C;  5ISR A;  1F2Z A;  3MTS A;  1HTL D;  2CHB D;  5K36 G;  2WB1 B;  4LJZ C;  2NWG A;  1U4R A;  2QF7 A;  2MGS A;  1GUO A;  5A2Q L;  1SSO A;  4CKC A;  3G6J B;  5ELD A;  3VYT A;  1SYD A;  1Y8N B;  4ODG A;  1SYF A;  3J81 L;  1ZXT A;  3HG9 A;  1Z47 A;  3NTH A;  5EPK A;  2C5C A;  2LKV A;  2F0W A;  3I70 A;  4H7B A;  2JXM B;  4TSS A;  1JWM D;  1SXT A;  3BZD B;  3KK7 A;  2EY6 A;  2ZXP A;  5KND A;  1O80 A;  1IW7 D;  3L9A X;  4EQN A;  3JAM E;  2HUG A;  3QWN A;  1D1I A;  1KAB A;  1PTO C;  2F0I A;  4KV6 A;  5T1G A;  4ZAI A;  3TP8 A;  5IGB A;  1A3T A;  3U9O A;  4PMB A;  3TP5 A;  2MHV A;  3GV6 A;  2WII B;  4DNR B;  4C2M B;  2KVM A;  5KNC A;  3PUW A;  1FNU A;  1JWU D;  4X3U A;  1IYV A;  1PRT F;  4O1N A;  4R9W A;  2M2L A;  1QCB D;  3HOY B;  3PO2 B;  2CQA A;  4ZUI A;  3HGB A;  1EEI D;  5J1Z A;  2A69 C;  4B08 A;  1CFM A;  1TS3 A;  1LTS D;  3A8I E;  1AN8 A;  3IFD A;  2B2T C;  1EEF D;  1H9J A;  2OT2 A;  1EL0 A;  4QF4 A;  1HTP A;  5EJW A;  1BOS A;  4C1N I;  3HOV B;  2PZU A;  3TZD A;  3VA7 A;  2XSC A;  1ILP A;  1S4Z A;  3DUZ A;  2O4X A;  5CC4 A;  1H9M A;  1EIH A;  5CV8 A;  1EY5 A;  2F3W A;  5D14 A;  4FXG C;  4PMC A;  4CHT B;  5EKI A;  5IOC A;  3Q22 A;  2CW0 D;  1PZI D;  1HFG A;  3K5L A;  3CRL C;  1STY A;  4A3M B;  2X69 A;  4R8I A;  1V43 A;  1B2T A;  2SNM A;  1RTN A;  3NPP A;  4IFD G;  3MFG A;  2KED A;  3RZD B;  1JWS D;  2KQ3 A;  3MXG A;  3I72 A;  4KN4 C;  4BBR B;  1TWF B;  4HCE A;  4M8A A;  5EGT A;  1PZJ D;  3IFT A;  1BUV T;  3E0J A;  1EWH A;  4QB4 A;  4R8N A;  1JOR A;  1S5D D;  4I7Z C;  1PRT C;  2JEB I;  4KI0 A;  5LHY 1;  4NW2 A;  1DON A;  3R8B A;  2AWO A;  2SOB A;  3AU7 A;  1DJR D;  2AQ1 B;  4KN7 C;  4IQZ A;  2NUC A;  3S1N B;  3QO2 A;  1JR0 D;  2R3Z A;  1UUP A;  5FK9 C;  1Q3L A;  4AYB B;  5C4H A;  3K58 A;  2XRS D;  3R2T A;  1OXU A;  2EYP A;  2A6E D;  1TU2 B;  3LNN A;  3GQB A;  1LTA D;  4Y7N B;  2BA0 A;  5JEA G;  2G9H D;  2JA8 B;  5C0X H;  5EPJ A;  4TKO B;  1GHK A;  4G7Z C;  2B2V C;  4C3H G;  4RKL A;  1CHQ D;  2PZW A;  5C5L A;  3V2T A;  4RHS A;  1Q1B A;  4GZY C;  1SYG A;  3TZU A;  1AZQ A;  4OHJ A;  4V19 0;  1NCV A;  1O7L A;  3BDC A;  1WTO A;  3BG3 A;  5I2Y A;  4XYQ A;  1Q1E A;  1STN A;  2L12 A;  1J9O A;  2WKD A;  1ENC A;  4CKB A;  1JB3 A;  2F0T A;  4P2C B;  3HOU B;  2RBM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...