3MZ5A

Crystal structure of staphylococcal nuclease variant delta+phs l103a at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEAAVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Cavities determine the pressure unfolding of proteins.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2010-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3mz5A00
2M00A 2SNMA 4PNYA 4TRDA 1KAAA 1A3UA 4KJNA 5C4ZA 1U9RA 1EY9A 2F0EA 4ODGA 4B9WA 1TR5A 3P75A 4K8IA 3TP6A 3D4DA 2RBMA 2F0PA 5DEHA 3C1EA 3PMFA 2OF1A 2ENBA 5E1FA 1STYA 2F0FA 1SYGA 2HQEA 1SNQA 3E5SA 4KY7A 1TT2A 2EYLA 3HZXA 5EGTA 5C3WA 5HGTA 5JAVA 4DFAA 1STAA 4MIUA 2NUCA 5ISRA 3OSOA 2F0DA 3OWFA 3R3OA 2QDBA 3EROA 4K14A 4LAAA 3T13A 3T16A 3TP8A 1F2YA 2PW7A 1F2ZA 1STNA 1EZ6A 1EYDA 4PMCA 5IGGA 3QB3A 2EYMA 1EQVA 2EYPA 3ERQA 4K5WA 1AEXA 4KHVA 1A3VA 1TQOA 4RKLA 3SR1A 4K5VA 1F2MA 3TP5A 2PYKA 5HURA 5K5PA 2SNSA 3DMUA 2EY6A 4H7BA 3SK4A 4EQPA 4N9TA 3ITPA 5C3XA 4KTAA 1JORA 1EY7A 1EYCA 2F0VA 2F0UA 5CR3A 4ZUIA 2RDFA 3NXWA 3SK5A 4DGZA 2F0KA 3BDCA 4ZUJA 3HEJA 5KYIA 4G57A 2F0QA 4ZQ3A 1JOQA 3NK9A 5KGUA 1KDAA 3MHBA 2EY2A 3NHHA 1EY8A 2EYJA 4I65A 1EYAA 2EYFA 4K2KA 5C5LA 5C6AA 5E3FA 2PZWA 3NUCA 5CGKA 4HMJA 1A3TA 1NSNS 1SNCA 1SNPA 2EYOA 2F3VA 4RKBA 3D8GA 4NDXA 5CC4A 3C1FA 5DAUA 3BDLA 4QB4A 5CV5A 2WACA 5CV9A 1A2TA 5IODA 1KABA 5KIXA 4EQOA 1STGA 5KEEA 5KRUA 3SHLA 4KY6A 4B9XA 3RUZA 4ME5A 4NKLA 1JOOA 1IHZA 3D6CA 3EJIA 3NP8A 4NP5A 5F2DA 2EXZA 2EY1A 4F7XA 5C4HA 4N9PA 2OXPA 4KY5A 4K8JA 2PW5A 3NQTA 2F0HA 4E6IA 2F0OA 5CV7A 1KDBA 4EVOA 5M9OA 2F0LA 3SK6A 3V2TA 1EY4A 5IIFA 4ID6A 2PQEA 1STHA 4F8MA 5EKKA 5KYLA 3QOLA 4QMGA 5C5MA 2PZTA 3U9OA 2KHSA 5J1ZA 1SYCA 4J6HA 4R8NA 2F0SA 5IGFA 4S3SA 3S9WA 3EVQA 3MEHA 3D4WA 3OMCA 1STBA 2F0NA 1SYDA 4KD4A 4K6DA 3SK8A 4PMBA 5I9OA 4WRDA 1EY0A 1EY5A 5IOCA 3QOJA 1SYBA 5IGBA 4K5XA 2SOBA 2F3WA 1EZ8A 5EKLA 5I6WA 1ENCA 2F0TA 4HTHA 5CV6A 3SXHA 3MXPA 5J22A 1SYFA 1ENAA 2OEOA 4KV6A 4QF4A 5IGDA 2LKVA 1RKNA 4KD3A 4EQNA 2F0JA 4IZ8A 1SNOA 1SNMA 2F0MA 4OL7A 1KDCA 2EYHA 5I9PA 4DF7A 4YIJA 1SNDA 5IGCA 2KQ3A 3MZ5A 2RKSA 1EY6A 3LX0A 1II3A 4NMZA 3TP7A 2F0GA 4HMIA 4J1MA 2F0IA 4WORA 3P1HA 3H6MA 4KJOA 5CV4A 5CV8A 1NUCA 5JOBA 3MVVA 3TMEA 5IGEA 1JOKA 2O4XA 5I6YA 4IALA 3OMGA 3VA5A 3DHQA 4DU9A 5J39A 4IUNA 4K2LA 1A2UA 1SYEA 2PZUA 5NUCA 2F0WA 2EY5A
chains in the Genus database with same CATH superfamily
1CT1D 4RCNA 1O7YA 4DK1A 2F0EA 3P75A 3RZOB 2F0PA 4A3EG 4QQBX 1FR3A 2JA5H 4CKEA 5C3WA 4MIUA 1BKBA 3M4QA 3MXUA 3C46A 1DONA 1XMOL 3S1NB 3A7AB 3BJUA 2E74C 1F2MA 3NENA 3I4MG 1TKWB 3FRPB 4LFCQ 4HJ7A 4ILWA 4OX9L 2CKZB 4G57A 3NELA 1IBKQ 5EKIA 3BVMA 4DR4Q 4RG1A 1SR3A 3PIP3 1NSNS 4A3GH 2A6EC 3J7AF 1CSPA 3BDLA 3OTOQ 4QB4A 2ID0A 5C4JH 2MFIA 1QUQB 5JEAH 2I46A 2N88A 3NTIA 5A35A 4LFAQ 4B3TQ 2M2LA 4ME5A 1JWUD 3NP8A 2N78A 3LWUA 1VQ4A 1K8OA 3CC7A 3HKSA 2F0OA 3VR2A 4A3KB 1UUPA 1VQBA 1HR0Q 2Q2UA 1STHA 4DAMA 1RIPA 4L6TB 5C5MA 1CQFA 4PG3A 4IOCA 4FDBA 4CJ2C 2ZJQA 2Y0SG 3J81i 2AQ3B 1GHKA 1G8ZD 2OCEA 1X3GA 2JA5B 2KCCA 2Z4IA 3M4YA 4IFDI 4B3ML 3KBGA 4OGQC 1QCBD 1N32Q 3S24A 1T9HA 1B1ZA 5J22A 1SYFA 1XNRQ 1IKLA 5BN3A 3I4LA 4CBVA 1RJTA 4BWGB 4MNOA 1PH4A 1WFQA 1QWYA 2UUAQ 2Q8TA 2D0OA 3T1YL 2RSNA 1CKNB 2QW7A 1JOKA 2C9OA 2OTLA 1PXUA 4ZCKA 4DU9A 4A3GB 5ELFA 1JWSD 2Z6KA 2ZM6Q 1PDQA 3E0JA 3K0YA 5C4JB 2EXDA 1YHAA 1TR5A 4HCEA 2OF1A 5C3EG 1Y1WG 2K5HA 4TSSA 5EGTA 3RLFA 3HS0C 2XTIA 4I7AA 2LY7A 3F2BA 4GN5A 2FJ2A 3OSOA 2AWNA 2A5HA 2PW7A 2JA6H 2N8NA 2KJXA 4PMCA 5BR8Q 5A2QE 4DV5L 3Q0AA 1VF5C 4P71A 4RA8A 3CCQA 1PTOH 3QJYA 5K5PA 2A1AA 2V4DA 4EQPA 4NXMQ 5IYBG 4DR2Q 4ZUIA 2WKDA 3CCLA 2F0QA 3HKZB 3NEMA 1WVLA 1GVPA 3EA6A 3W5OA 5FLXL 3T1HQ 1N8RC 4A3MG 2LSSA 2KA7A 4IFDH 4G7ZC 3CCJA 4FF2A 3BYTB 2OT2A 5IWAL 2K05A 1A2TA 1YITA 1WTWA 2JA7G 4NKLA 3TZUA 4AYBG 2Q2IA 1DOLA 3QG1A 4KY5A 4MTNA 3KJPA 1NMFA 4CJ0B 5AJ3L 1VQFA 1YEZA 1AW7A 3V2TA 1XPOA 2D62A 2PO4A 4U673 4TKOB 3DEOA 1Q81C 1EEID 3A8KE 1ICFB 3URYA 3ZJYC 3I2ZA 1QZHA 1Q90A 2NN6G 3DXJC 3OWEB 2PPBC 2JA6B 1H9SA 4FP5D 5K36G 5AFWA 3SXHA 3GTOB 5ELBA 1PTOB 1MI2A 4OL7A 3E0EA 5IYDH 4R1JA 2K28A 1EQTA 1Q3LA 1EY6A 2KCNA 4X62Q 5JJIA 4WORA 5LMUQ 2VL6A 2VUMH 1CM9A 5J39A 1EIYB 3AFPA 3R93A 1FD7D 4OO1G 2KEDA 3VYTA 4TVAB 1EY9A 4LFCL 1WTHA 3U50C 2R7DA 3SDZA 2EVBA 2RHQB 1IBKL 3BVGA 1DOMA 4GNXC 1S5DD 1AN8A 3G48A 3PUXA 1OO9B 2ES2A 3M4OH 3T16A 4P72A 4HEDA 3OTOL 2B2VC 5FJ8G 1PRTB 4QL5A 1M1KC 3HOWG 1CHPD 1MD2D 1BNZA 1W6KA 4LUOA 4B3TL 2SNSA 3TREA 3I3CA 4DGZA 3BDCA 1QNUA 4GNXA 2VQFQ 3IL8A 3LNNA 1HR0L 2KCMA 3FMCA 1IW7C 1V9PA 2VY3A 3Q22A 5E7NA 4HMJA 1X54A 2EYOA 1TWHH 3I72A 1QE6A 2K6AA 3KLSX 4BY1G 3BG3A 2WACA 1V8QA 4J8QA 4EQOA 1B3QA 5C44H 4L5RC 3L0OA 1I6HB 1UAPA 5IP7G 3Q24A 1N32L 2VUMB 2FHTA 3I90A 4X3UA 3VR3A 4BBRH 2GN5A 3LWEA 1QB5D 1GUTA 2K5VA 1XNRL 1E7ZA 1EY4A 4RGTA 1ET6A 1F2LA 1RL2A 1X65A 3PIOA 1PHJA 4BBSG 2KHSA 2UUAL 2B3GA 1S5CD 4QCLA 1S72A 1VQCA 2ZT9C 4ZRZA 3KF8B 4CGYB 4KD4A 1YZ6A 3MA2B 3CC2A 1BDOA 4BS9A 1XTCD 1EY5A 5IOCA 3M4OB 2K50A 2ZM6L 5M5YH 2C35B 4A3BG 3M85A 2XVSA 1RKNA 3S15H 1SNOA 3CCMA 2Q2HA 1WTQA 4LFBQ 1MJCA 4NMZA 3KBXA 1I6VC 1G51A 3UE1A 4A3JH 1OXTA 5JOBA 3TMEA 1B50A 1KNEA 4IALA 4H0LC 5BR8L 1VQ9A 3CP0A 2HCIA 1NTGA 1TWHB 3G6EA 4R8IA 1ENFA 3K5NA 4NXML 4WJ3M 1Q82C 4DR2L 3K5MA 1PH1A 4LWCA 4P73A 5C44B 4K8IA 4DV7Q 2CCZA 4Y7NB 1AE2A 1E3PA 1LTRD 2IWHA 5M3FH 1GJXA 3T1HL 3HOYG 4YHHQ 4JYAQ 4GOPC 4BBRB 3GD7A 2IPKD 1DOKA 1SN8A 3HOXH 1ESFA 2R7ZG 3C3LA 1EQVA 1S5FD 3PIPA 1Y1VG 4IN3A 1ZEQX 5HURA 3SK4A 2Y0SE 2IX1A 2NVQH 2XIWA 1EQQA 4LK1C 5M5YB 1Z6HA 4FVMA 1K8GA 2QA4A 5GROA 2PMZB 3GV6A 1S5ED 2N55A 3S15B 3C1FA 1AH9A 2Z4HA 2JQOA 3CHBD 2WP8J 3CAMA 1BCPF 2MJ8A 5KRUA 4JW0A 4A3JB 3AMUA 3QR8A 4MTKA 3A74A 1KRTA 3A5UA 4LF5L 2B2TC 2B8GA 2K5WA 1HA5A 3CF5A 1EL0A 2WAQG 4J15A 1QOHA 4M1UB 1UWVA 1KDBA 2ZJRA 4RMFA 1C9OA 2PQEA 3T56B 1ILQA 2EZVA 4GKKQ 3NSWA 2PI2A 4X62L 4WJ4A 5M3FB 1LT6D 5T1GA 4X3TA 3TQYA 1BO0A 4YWKA 3AQQA 1XMOQ 2L55A 3BZDB 1KD1C 1EY0A 2DNEA 4TQUS 5FLXE 3MEFA 1Q1BA 3DM3A 4UAIA 3H94A 1EOTA 5LL6X 4P75A 3D4RA 1ONLA 1SJED 3HOXB 2DNCA 3MXPA 4HJ5A 3WOEA 1O78A 3PUWA 3P20A 3R2IA 1KQSA 4LUZA 3HOZH 2NVQB 3TP7A 1UEAB 4V0BA 3TS0A 4Z9CB 3K5OA 3MVVA 1A63A 3QIAA 3GTLH 2D9UA 1B70B 2KOLA 2A8VA 2Z1CA 4FO2A 4TRDA 4FF3A 4L8JA 1KAAA 2XWJB 1WTPA 3RMHA 4CDEC 3H0GG 3D31A 4AYBE 2F0FA 2VQFL 1PFMA 1WD1A 4C56C 4NW2A 2GVBA 1Q12A 1G2TA 2IHFA 4DFAA 1KTKA 1RTOA 4JBKA 2MP1A 4OHJA 1HFNA 2K4KA 1F2YA 4O42A 4I7ZC 1JCKB 4LMQD 4G4KA 3E3XA 4YWMA 1CI3M 4H7BA 4HR7B 4JG2A 1EYCA 1MHWC 1SLJA 2F0UA 5D3DA 3PO2H 4ZUJA 2AUJD 4JCVE 2G5DA 2I5HA 1W3SA 1ML0D 1CUKA 1EY8A 3PUYA 5FLMH 1EYAA 5C5LA 1Y69U 2PQAB 1UE5A 3ND9A 2R92H 3HOZB 3D8GA 5CC4A 3J80i 1AE3A 4DV1Q 2K1BA 5IODA 2JJQA 4A3FH 3BZCA 2KCTA 3V96A 3K5LA 4KY6A 3ERSX 4IURA 3IRBA 3D6CA 4P74A 2H5XA 4ZYSA 3NBHB 2ZXRA 3GTLB 2J4XA 1Y8OB 4YCUA 1LTTD 3DWQA 4GS3A 4HJ9A 4LFBL 4QMGA 1S5BD 1F9QA 2YU9H 2HIVA 4DK0A 1S40A 1O7ZA 3VR6A 3FPUB 1JJ2A 4IOAA 3LGJA 1SYBA 1UEBA 2RF4A 5IGBA 3RZDH 1H95A 1PZKD 3KK7A 3HOVG 5IT9c 1EZ8A 2IX3A 2PNHA 4HTHA 4OXPA 4X66Q 4DV7L 4OELB 1VQJA 3A0JA 3L2PA 4C2MB 3MZ5A 1A6XA 2RKSA 1RF2D 1G2SA 5CORA 4YHHL 4JYAL 3PO2B 1QUQA 2XNAC 1VQPA 4YWLA 4POFA 2RA4A 3H6MA 2UXCQ 4G7HC 3DM1A 3PCOB 1IYVA 1U4PA 4IUPA 1SYEA 3SVMA 2R92B 4APVA 1MJEA 3CXCA 5C0XJ 1BOSA 2QCPX 3B6YA 1NY4A 3KUPA 4B3RQ 3Q23A 4A3FB 3TP6A 4Q0FA 5AJ3Q 2K5QA 2ZXPA 3ER0A 1IKMA 2ZTEA 1IL8A 3OOCA 2ENBA 4ME3A 2HQEA 1CHQD 2UU9Q 4R4IA 3KYHC 1W6JA 2NZHA 4C3IG 4QIWE 2J7ZA 1VQHA 2UUCQ 3L9AX 4A3LG 4A3IG 4A75A 3TP5A 2IW3A 3TRZA 2PYKA 1FYCA 3DMUA 1L0WA 2EJFC 3K59A 1JORA 5IYCH 3UE0A 2HT1A 1E2ZA 1TU2B 3IKJA 3RZDB 5EPLA 2HIXA 2AMCB 4A3CH 2KVMA 1CKNA 2EY2A 3NHHA 2XWBB 3JAML 4XQQA 4GKKL 1JICA 4RH6A 1LT5D 2PZWA 3SK8A 1SNPA 1L1OB 5EBDA 2KENA 4X6AH 4X3KA 1HFGA 4DKAC 5G3LF 3P7JA 3V05A 2IY5B 3H09A 1PTOF 3OYYA 1EWCA 4Q5VA 2DN8A 2E2IH 2OXPA 2Q8RE 3AEVA 4BA2I 2I07B 3FDTA 2A73B 4R8NA 1Q1EA 1OXUA 3CW2C 3VR4A 4C3HG 1A8VA 4K6DA 4GZYC 1FGBD 2ZTDA 1A0IA 3QOJA 2QF7A 4AQYQ 3WDNA 2MHVA 4BY7G 4KI0A 2VXWA 1GUNA 4NXNQ 1GUWA 4LF9Q 4FYDA 4HAEA 4EQNA 2K5NA 1VMCA 3A5ZB 1BBWA 1F77A 1I4XA 5IGCA 3PUVA 3J81c 2JA8G 2CW0D 2RSOA 2K52A 1PRTF 4JI4Q 3KLSA 1JJGA 1N33L 1VQNA 1NAPA 1X3FA 5DNFA 3DWAA 4A3EH 4K2LA 5JPMC 2E2DC 1F9RA 4F88A 5ELDA 1VCIA 1I4RA 3TEHB 3I73A 2Z6KC 2L12A 1PH7A 2BCOA 2E76C 2K03A 3MTSA 2E2IB 1D1IA 4H44C 4M8AA 3RD4A 1ICWA 2AHOB 5JJLA 3I4MH 3QO2A 3GV3A 1WJJA 2WAQE 1CK1A 1MBYA 1P16A 4A93H 5C4XG 2AQ2B 3T13A 2YV5A 4K14A 3MXNA 4HSVA 4XIGS 4DAPA 5IY0A 4IPCA 1T5EA 4DV1L 3CMAA 2EYPA 1AEXA 2I5MX 1DJRD 3SR1A 3CQZH 5GAEC 3T4AC 3CRKC 3U9SA 1L2FA 2NVYH 1YNXA 5M5XH 5CR3A 1HUMA 1WYDA 4LF6Q 5D65A 1KDAA 1KC8C 1OXSC 4IUTA 2DJGC 1R9TH 2BOSA 3NWTA 3S16H 5C6AA 1SE4A 1AFPA 1ZYRD 4HCSA 4CKBA 3KF6B 5DAUA 1KAWA 2CWAA 3SEBA 4A4IA 4R4TA 4JI7L 1HPCA 1RCVD 3MAQA 2DY7A 1GHJA 3EQLC 4KHPL 1S4ZA 3EJIA 4KKUA 4NP5A 3HOUG 1YIJA 3I4NH 1J6QA 2CHBD 4A3EB 1I3QH 4X66L 5CV7A 3NE5B 1YHQA 4DAYB 2LXJA 3VDYA 3OW2A 4DV3Q 1XPRA 2B63G 2GVAA 1QG7A 3RLNA 1RTNA 2V1CC 3R2TA 5IGFA 4DUZL 4JBJA 1VDZA 2UXCL 1BR9A 1YI2A 4X64L 2O5IC 5GADC 3I4MB 3N52A 2NTSA 4A93B 4K5XA 2F3WA 2QGQA 4IO9A 5E4WC 5I6WA 4RHSA 2E8GA 4B3RL 3FKIG 1BVSA 4KV6A 1U4LA 2RCNA 3NPPA 1DXMA 3CQZB 3STBD 4KKSA 5M5XB 2UU9L 1II3A 5DM73 4N8FA 1HJPA 2K33A 2O2LD 3BDOA 2QDLA 1NUCA 2NN6I 1R9TB 4A3DG 1QILA 1SRUA 1V1QA 3QWNA 3S16B 3AYHB 4JBWA 5C3EH 1Y1WH 2UUCL 4RGOS 2NZOA 2UXDQ 3K58A 1MIUA 2WB1E 3J7ZC 4LF5Q 4ZAIA 2R3ZA 2B29A 3D4DA 2ASBA 3G7LA 3ULLA 3I4NB 4KY7A 2MNAA 2Y0SB 1I3QB 1CTMA 3W3AA 1STAA 1ESRA 4PZ7A 5CMDA 5IYBH 5LMNQ 2F03A 1LTBD 3R3OA 2L9HA 2WIIB 3H3VC 5IGGA 2TSSA 4OO1I 2CWPA 1A3VA 1TQOA 1VMPA 4NB3A 4JVZA 3VYRA 4A3MH 1O7IA 1TS4A 4N9TA 3GQBA 4DK6C 4XTCS 4IUVA 1VQKA 3S1RH 2A68D 1V1PB 5D3IB 3IAYA 1XNQQ 3KJOA 3RLOA 1KLUD 3D3RA 2JA7H 1K3BC 1NR4A 2XGTA 3GDEA 4K2KA 5E3FA 1STEA 5CGKA 4DR5Q 2Z8LA 4NDXA 1LUZA 1TXYA 1U4RA 4XDXA 1PA6A 3MFGA 4YY3Q 1UE1A 1FGUA 1OXVA 4IPDA 4DV2L 3TZDA 4AQYL 1HQMC 3K0XA 1QVGA 4NXNL 1YNJD 3NQTA 4JOIA 4LF9L 5C3EB 1VQMA 1Y1WB 3UDFA 2F3IA 4PMWA 4HIKA 2NN6H 2Z9HA 1AZPA 3U58A 1SYCA 2EIFA 4GN3B 5COYA 2E5LQ 5K36H 5IT9L 5C0XI 2MQHA 3U4ZA 4JI4L 1V43A 1STBA 1B53A 1ET9A 4WRDA 5C0XG 1LO5D 1TWFH 3JAME 4CHTB 1FL0A 1WTRA 3X3MA 3OPOA 3PO3G 2RDGA 2IHEA 2N3SA 5I9PA 4A3MB 1DZ1A 4DF7A 3PSIA 1MKHA 2JE6I 5KNCA 5JEAJ 3S1RB 4OO1H 1C7YA 1LTLA 1Q86C 4K6LA 3E9HA 4HIOA 4AH6A 1KIXA 3CCSA 1EFID 2JA7B 1B9MA 1BCPD 4AYBB 5M3MG 1LM0A 4B08A 4GLAC 1YHBA 1LTSD 1B2TA 2F52A 3OIPA 2VQEL 4ZLTF 2BDOA 1K28A 1E2VA 4IUQA 2CH4W 3AU7A 3PQIA 4LF6L 3HOWH 3PMFA 3TS2A 2JYOA 4KMUC 1SYGA 4HN7A 1I4PA 3FP9A 3E5SA 3STBC 1LACA 2VW9A 2Q8IB 1OTCA 1DD2A 2F0DA 2BH2A 2X6LA 4C3JG 4QGUA 2HDMA 1RD9D 3C2PA 1N36Q 3N6RA 1Q8KA 3G6JB 5M5WH 3DWPA 1TWGH 5IP9G 2A74C 2K32A 3J7AV 2F0VA 2RDFA 1TWFB 3I4OA 3S17H 4FNFA 5ELCA 3HEJA 4BY1H 3S14H 3KLRA 5TSSA 3RR5A 5KGUA 1FNUA 4DV3L 4I65A 4PZ6A 4P2CB 5IP7H 4RKBA 3BU2A 1KLGD 1RHPA 5EPJA 1KABA 1SJHD 5EJWA 1N34Q 4BBSH 4JBMA 3O13A 2D0PA 4QUCA 1M90C 3HFZB 4N9PA 2VB3X 2F0HA 4QJFA 5D14A 2L0CA 3BYYB 2R93G 3BS1A 4IJLA 3CCEA 2A68C 1WCMG 5J1ZA 4GNXB 4JI6Q 3J81j 4S3SA 2B8FA 3S9WA 3K7AH 1V1OA 4A3BH 2A69D 3OMCA 2E2JH 3KDFB 2LMCB 3J7A5 4FXGC 2UXDL 1A62A 3J81L 1CKMA 1VQEA 2AUKA 2GA4B 4QF4A 1K83H 5M5WB 1TWGB 4WFN3 4DXFA 1KDCA 2EYHA 4V190 1X55A 5LL6S 4DUYQ 2PQAA 4FXDA 2F4VQ 2C5CA 4HMIA 3S17B 4BY1B 3S14B 1G291 1L0XB 3UDXA 3PV0A 4ZK9B 5LMNL 5CV8A 3VYUA 1EYGA 1Z7TA 1SAPA 1WI5A 2XRQD 4UP9A 1JQYD 1UE6A 1NCVA 3NBHA 3MFYA 3HOYH 2EY5A 1Y14B 3F2DA 1E24A 3CCUA 4KJNA 1O7LA 2IL8A 3OW7A 3W2DA 4QIWB 4O0AA 4BBSB 1B44D 1VF7A 1GOZA 1TY0A 3G71A 2R7ZH 2NYZD 1XNQL 1IBLQ 3CMEA 1Y1VH 1HZ9A 4BA1I 1XJVA 3HZXA 1YJWA 2K75A 4L5SA 1I94Q 4DR5L 3EROA 1LABA 1F2ZA 5FLXc 5JVG3 4H13C 2FINB 1HXYD 4K5WA 2QILA 4JI8Q 4YY3L 3K7AB 1YBYA 1PH5A 1Q7YC 4LF7Q 4A3BB 1GKHA 2E2JB 1Z9FA 5FO9B 1PH6A 1D7QA 1BCPC 2K7VA 1YVCA 3ICEA 1HNXQ 4JI3Q 1XWEA 3M4PA 4CDDC 2PNRC 1VQ5A 2EYJA 1K83B 1DYQA 4ALPA 2SEBD 2UXBQ 2F3VA 1DGSA 2E5LL 1N33Q 3T51B 1KL9A 4RFBA 5CYUA 1GO3E 2XSCA 3M9BA 1T5XD 1STGA 1VQ7A 1C4QA 5KEEA 4QY7A 1K73C 3A54A 3NWSA 4B9XA 1IHZA 2BA0A 3NTKA 1GUOA 1GXDC 5C4HA 4WJWA 5IIFA 3HOYB 4K0KQ 1NMGA 1DM0B 4EGVA 5EKKA 5KYLA 3QOLA 1GUGA 3J7YW 2BA1A 3J80c 4OIKA 4GOPB 2B2WC 3MEHA 1X56A 2B2UA 2R7ZB 4YCWA 4RCOA 1DCZA 1PYBA 4C1NI 1Y1VB 4PMBA 5EPKA 2RCFA 1LYLA 3GP7A 1SROA 2JP1A 1BBUA 3S2DH 2B2YC 2A6HD 1I4GA 4YIJA 4GLVB 2B2WA 2G9DA 1J5EQ 3FHWA 2RHSB 2WV6D 5IGEA 5G3LD 4JI7Q 1N36L 1BXTA 2A69C 2RDHA 3H0GH 1PTOD 4DV0Q 4LJZC 3SK5A 2M00A 4KHPQ 2WAQB 2EQSA 2B2YA 5IT9E 2KHJA 3I56A 4R4CA 3DUZA 1PVOA 2RBMA 1D8LA 4BXXG 3GTJH 3D0FA 4A3KG 2EE1A 4DR6L 5JAVA 4DUZQ 2HUGA 1IBML 2QDBA 3BVZA 1NJIC 4JC0A 2VB2X 4X64Q 1L0YB 2AQ1B 1QJOA 1XXGA 3QB3A 4A3CG 1EFWA 5JPNC 4K5VA 1B8AA 2JA5G 3R8BA 1SBBB 1N34L 1FJGQ 3W1BA 3K8AA 5KNDA 2VNUD 3UDIA 2NZ1D 4ZQ3A 4KKTA 1HZAA 1GD7A 2I5LX 5I4DA 4JI6L 1PRTD 1D6EC 3HGBA 3W1GA 1SNCA 2KUMA 4EQ5A 1VQAA 1VQOA 1CSQA 3SGIA 3ONAB 5FKAC 2MGSA 2YU9B 2AWOA 4XT3B 2L4NA 2BH8A 2FMCA 1K8AC 3M7GA 5CBAE 4A3GG 2PW5A 5EQ0A 3H0GB 3ULJA 3A56A 5JEAG 2ZTCA 4X65Q 3MC0B 4DUYL 1ZKOA 1KXLA 2F4VL 1VQ6A 3HOVH 2F0SA 3MXGA 1H9MA 4QUFA 2RQXA 4KK7A 4DV4Q 4UHVA 3NQIA 1WTOA 1EOVA 3GTJB 1IZ6A 1XYIA 1UNSA 4HSPA 5FOBB 1LTAD 3F1ZA 3CCRA 3A55A 2BE5D 1HHVA 4F87A 2IT1A 2EJGC 2L1BA 1Z47A 1UE7A 4O1NA 5L37A 4DR7Q 1LT3D 1F9PA 2L15A 3KF6A 1IBLL 3LX0A 3HKZG 4X3SA 1CA5A 2WB1B 3CKIB 1I94L 1D5MC 5CV4A 1VQLA 2X69A 1SE8A 1X9NA 1NE3A 3WOFA 2YTYA 3TBIB 3DHQA 4IUNA 5NUCA 2QEXA 2K5DA 1EIFA 4JI8L 4DV2Q 4B3SQ 4LF7L 1KRSA 4A93G 4DAYA 3E6ZX 1HNXL 4ODGA 2N49A 4HIDA 4JI3L 4C3IH 3IFTA 3MWYW 4O2DA 4ZKBB 1EIHA 1Q46A 3C1EA 3K81C 4GN4B 5E1FA 4A3IH 1STYA 1PV4A 4A3LH 2NTTA 1E1TA 4DA2A 2A6HC 5HGTA 1C8CA 2HQLA 3J81E 5ISRA 3VR5A 2UXBL 3TP8A 1X3QA 2WINB 3CPWA 3U4VA 3HOVB 4RKLA 1EU4A 2G9HD 4GKJL 4DK3C 3E9IA 2DUDA 3GTKH 3HP3A 3EFXD 1JJCB 1PTOC 2NB0A 2JA6G 1HR0W 2FXQA 4L63B 4HJAA 4K0KL 2PI2E 5J3BA 3S2HH 4RGNA 2HHHQ 2DGYA 4CDFC 3I4NG 4KLKA 2K04A 5DM63 1VS0A 4PZ8A 4OWWB 5CV5A 2D2CC 5CV9A 4XYQA 1I4QA 2DY8A 4L5QA 4Y52H 5F2DA 2VQEQ 4IFDG 2EY1A 3I8ZA 4PQXA 3CRLC 1J8IA 1R4QB 2YYZA 4C3HH 3CD6A 4ID6A 1PMRA 1U4MA 3U9OA 1OXXK 1J5EL 3L3OC 4IQZA 3X3NA 4C3IB 3EVQA 3H15A 1SSOA 4BY7H 4UPAA 1ASZA 2L5TA 4RWSC 4A3IB 2AKWB 1PRTC 2ATWA 1IL2A 2P5ZX 1PZJD 1TWAH 3H91A 4PV1C 2JA8H 3T53B 1SXTA 1VQGA 1V1PA 4DV0L 5EKLA 1ENCA 4JI5Q 2EOTA 1IW7D 4KD3A 3I91A 2F0JA 3G4SA 2UUBQ 3GTKB 5T1IA 1B4OA 2F4IA 2M9VA 2H1EA 3K6OA 5GQOA 2ICEC 5ELEA 1HNWQ 3GTOH 3S2HB 4R4QA 2O4XA 5IYDG 3OMGA 4DAVA 1E0BA 2NVTH 2R6GA 2PZUA 2NWGA 4AIMA 3PGZA 2SDFA 1JMCA 1A3UA 1FJGL 5C4XH 1U9RA 1HTLD 3VA7A 3F2CA 4B9WA 2BE5C 1X3EA 2VUMG 1SMXA 1JB3A 2KEEA 1TS5A 1XMQQ 3VYSA 2NVYB 4C3HB 1NR2A 1QZGA 2IX0A 1SDFA 2K14A 1J9OA 1KNAA 1BUVT 1CKOA 4KN4C 3CC4A 4BY7B 1EEFD 1I4HA 1YJ9A 3ITPA 4DV6Q 1HQRD 4ULLA 2Z6BA 1TWAB 2F0KA 2QKIC 2JA8B 3D6WA 2NVXH 1SEBD 4X65L 3I55A 2CQAA 1PLFA 3KF8A 2EPBA 4UP8A 4CKCA 3HOUH 1HA6A 1AZQA 2WFWA 4DV4L 1FVIA 1B3AA 1G6ZA 1TS3A 2CW0C 3WWVA 1LT4D 3H3VI 1HUNA 1X3PA 1TY2A 3MXNB 2B63H 1TS2A 3A7LA 3SHLA 2JEBI 1XPUA 1AP0A 4CDCC 1JE5A 1RDPD 4F7XA 5I2YA 3J80L 4K8JA 4LF4Q 4JV5Q 2NVTB 1PZID 3NBIA 4EVOA 2F0LA 2XRSD 1JB7A 4DR7L 4IJHA 1PYWD 4JOIC 5C44G 5LMNW 5C4XB 4DNRB 2E2HH 4JI2Q 1D2BA 1ASYA 1K0SA 3D4WA 1I6HH 3FKIH 3HG9A 4BBRG 4LNQA 1PFNA 3FPPA 2F0NA 1SYDA 3FVQA 1HNZQ 4EX5A 1W2BA 4UP7A 1PH3A 4R9WA 1RODA 3TSSA 4B3SL 1LV9A 2OQ0A 4G7OC 2LKVA 1SNMA 4A3DH 1PH2A 1SNDA 2KQ3A 3GO5A 3RN5A 4DR4L 1CZGA 4H02A 3M7NA 1B7YB 2ICIA 4FF4A 4CJ1B 3ULPA 2NVXB 3UI2A 1U0LA 5GAGC 1EWIA 4DR3Q 1A2UA 1ZYRC 3HOUB 1D1KA 4LFAL 2F0WA 1CFMA 1PYSB 4IPHA 1Y8PB 4RHRA 5C4ZA 4A3JG 2A19A 2B63B 3S1MH 3ND8A 2ZJPA 5DEHA 3KFUA 3BZKA 4FXKC 3PF5A 5FO7B 3K57A 5ELOA 1SNQA 3OHXC 3H3VH 1TT2A 1O80A 2HHHL 1E22A 2B2VA 1N9WA 3KDFA 3JAMc 2PCFB 1HH2P 5M3FG 2TMPA 5FK9C 4Y7NH 2E2HB 1H9RA 3FKIB 2NBFA 1BBXC 2KBNA 3JAMi 2CVRA 1EY7A 2MUYA 2B39A 3HOXG 1H9SB 5FJ8H 3GTQH 3FEWX 4NPSA 3TDQA 3AB9A 2EYFA 2KHIA 4HJ8A 2O5JC 4A3DB 4LF8Q 1VQ8A 1LTGD 4U68A 3Q6SA 3SE0A 3HKZE 4JI0Q 2Q2TA 5BN5A 4DNTB 1EUJA 2EXZA 1G6PA 2H4OA 4JI5L 3PF4A 4C1NK 3RN2A 1P8LA 1LLRD 4F8MA 5C0XH 1WD0A 2UUBL 4FF1A 1PH8A 2PZTA 1S3OA 1E1OA 5GAHC 3DLLA 2LXKA 4DR6Q 5JJZA 4J6HA 3S1MB 1U5KA 2JSOA 1IBMQ 5ELNA 1WTVA 2RVLA 3PO3H 1HNWL 2FMMA 4JI1Q 1TWCH 2SOBA 2F0TA 3TN2A 3K80C 1HCZA 1QVCA 1SFOH 1C0AA 5M3MH 3M3YH 1JC7A 4KHZA 1XMQL 4DNIA 2OQKA 5I2XA 3CCVA 2F0IA 2LS01 1HRJA 2KECA 1X6OA 3CU7A 2I0QA 3GTQB 1PFBA 3HOWB 3HOZG 1GM5A 1TVXA 5HGQA 3OIQA 3K7UC 4PNYA 1IYJB 3GTMH 1K8MA 1I50H 4DV6L 4C3JH 4L5TA 1H9KA 4HIMA 1K3RA 4GOPA 1VQIA 4IFDJ 5IP9H 1YNJC 2FFKB 2NUCA 1FNVA 3OWFA 4DN4M 4LAAA 4DR1Q 1YJNA 1SMYD 1B9NA 3ERQA 2MO1A 4KHVA 5HY6A 3A8JE 3EN2A 3PO3B 2EY6A 5C3XA 5FO8B 4KTAA 3I7FA 2JEAI 4DXGA 1MSGA 2D5DA 3NXWA 1EQRA 4LF4L 1TWCB 4JV5L 5KYIA 4IPGA 1SE2A 1JOQA 1JT8A 3NK9A 3MHBA 2CQOA 1SFOB 5E4XA 4N8X1 1LTID 1IXRA 3NUCA 2LFNA 4MN3A 2E75C 1A3TA 5LMUL 4JI2L 5M3MB 3EIVA 3PO2G 2WKCA 1GUSA 3M3YB 4RGMA 3PUZA 1ILPA 5KIXA 2R93H 1HNZL 2B2TA 4OONA 5FLMG 1WCMH 4JPBW 1JOOA 2R7FA 4OX9Q 5BN4A 2R92G 2K01A 1YNND 2XN9C 3HRZC 4DPGA 4E6IA 3SK6A 2BDNA 1H9JA 4A3FG 3GTMB 3DEPA 1Y8NB 1F9SA 1I50B 2JA9A 4C3JB 1TIID 3I70A 3AFQA 1WOCA 2JN4A 2B2UC 4DR3L 2EJMA 5EBCA 4GKJQ 4YCVA 1XTDA 1JR0D 1D5XC 3KOJA 2HDLA 2HCCA 5CBEE 3GTGH 4XT1B 4IZ8A 5A2QL 4XYOA 1BQQT 4XQNA 3CPFA 4ZKCB 3J80E 1PFSA 1L1OC 3EBEA 3P1HA 3NTHA 3KLWA 1JWMD 1M4VA 2ZXOA 3VA5A 2J0TD 4RAUC 4B3MQ 2SNMA 4C2MH 1G91A 4UY8C 2CH4A 1IYUA 2R93B 4A76A 1WCMB 4OWXB 3T1YQ 4ABNA 5H1SE 2A6ED 2HD3A 1L1OA 2EYLA 1HTPA 1M8AA 3S1QH 2WB1G 2F1MA 3UDGA 2JXMB 1STNA 4MZ9A 1EZ6A 1EYDA 4R4OA 4LF8L 1Q8IA 2EYMA 1ZXTA 4JI0L 4OEMB 4KN7C 3F8TA 1MGSA 4POGA 1WTXA 1JE4A 2MPMA 1SE3A 3JC66 3ZYYX 2CFMA 1EWHA 1QVFA 3GTPH 5LHY1 1NBWA 2YTVA 3GTGB 1R4PB 5IYCG 2MO0A 3IFDA 1QNKA 2X6GA 4DV5Q 4XXEA 2Z0SA 2R61A 3Q8DA 1NNXA 2DJFC 4JI1L 1CQVA 1SMYC 3RUZA 2OWOA 3RZOH 5DLQE 2PMZE 1CA6A 2L11A 1MSHA 5M9OA 5JVH3 1KHIA 1A15A 2JK8A 4XQJA 2ALYB 1VQDA 4LW1A 3S1NH 5JJKA 2QEJC 3S2DB 5IWAQ 1HZCA 4MHEA 4OWTB 5I9OA 3L7ZC 3S1QB 4JK1C 1FNWA 1K9MC 3RNUA 3PIO3 1EIGA 1BCPB 5CV6A 1K0RA 4UDUC 1ENAA 2OEOA 5IGDA 1E2WA 2VS1A 5IE8A 2F0MA 1I5FA 1YNNC 2YTXA 1CZWA 1XX8A 4IUUA 2F0GA 3A8IE 1PH9A 5KNBA 4J1MA 1EU3A 1C48A 4KJOA 2IJ0A 1BF4A 5EAYA 4DR1L 2OTJA 1D5ZC 3F2UA 4GLXA 3GTPB 2VZAA 5I6YA 1X32A 1HZBA 4LUVA 4BXXH 4OIJA 2EDGA 4A3KH
chains in the Genus database with same CATH topology
1CT1D 4RCNA 1O7YA 4DK1A 2F0EA 3P75A 3RZOB 2F0PA 1FR3A 4CKEA 5C3WA 4MIUA 3MXUA 3C46A 1DONA 3S1NB 3A7AB 2E74C 1F2MA 1TKWB 3FRPB 4ILWA 4G57A 5EKIA 3BVMA 3PIP3 1NSNS 2A6EC 3J7AF 3BDLA 4QB4A 2ID0A 5JEAH 2I46A 2N88A 3NTIA 5A35A 2M2LA 4ME5A 1JWUD 3NP8A 3LWUA 1K8OA 2F0OA 3VR2A 4A3KB 1UUPA 1STHA 4L6TB 5C5MA 1CQFA 4CJ2C 2AQ3B 1GHKA 1G8ZD 2JA5B 2KCCA 2Z4IA 3M4YA 4IFDI 3KBGA 4OGQC 1QCBD 1B1ZA 5J22A 1SYFA 1IKLA 5BN3A 3I4LA 4CBVA 1RJTA 4BWGB 1QWYA 2Q8TA 2RSNA 1JOKA 2C9OA 1PXUA 4DU9A 4A3GB 5ELFA 1JWSD 1PDQA 3E0JA 3K0YA 5C4JB 1TR5A 4HCEA 2OF1A 4TSSA 5EGTA 3RLFA 3HS0C 2LY7A 2FJ2A 3OSOA 2AWNA 2A5HA 2PW7A 2KJXA 4PMCA 5A2QE 3Q0AA 1VF5C 4RA8A 1PTOH 3QJYA 5K5PA 2V4DA 4EQPA 4ZUIA 2WKDA 2F0QA 3HKZB 1WVLA 3EA6A 5FLXL 2KA7A 4IFDH 4G7ZC 4FF2A 3BYTB 2OT2A 2K05A 1A2TA 1WTWA 4NKLA 3TZUA 1DOLA 3QG1A 4KY5A 4CJ0B 1AW7A 3V2TA 2D62A 2PO4A 4U673 4TKOB 3DEOA 1EEID 3A8KE 3URYA 1Q90A 2NN6G 3DXJC 3OWEB 2PPBC 2JA6B 1H9SA 4FP5D 5K36G 5AFWA 3SXHA 3GTOB 5ELBA 1PTOB 1MI2A 4OL7A 2K28A 1EQTA 1Q3LA 1EY6A 2KCNA 4WORA 1CM9A 5J39A 3R93A 1FD7D 4OO1G 2KEDA 3VYTA 1EY9A 3SDZA 2EVBA 3BVGA 1DOMA 1S5DD 1AN8A 3PUXA 1OO9B 3T16A 4HEDA 2B2VC 1PRTB 1CHPD 1MD2D 1BNZA 1W6KA 2SNSA 3I3CA 4DGZA 3BDCA 1QNUA 3IL8A 3LNNA 3FMCA 1IW7C 3Q22A 4HMJA 2EYOA 3I72A 1QE6A 2K6AA 3KLSX 3BG3A 2WACA 1V8QA 4J8QA 4EQOA 1I6HB 1UAPA 3Q24A 2VUMB 2FHTA 4X3UA 3I90A 3VR3A 3LWEA 1QB5D 1GUTA 1EY4A 4RGTA 1ET6A 1F2LA 2KHSA 1S5CD 4QCLA 2ZT9C 4ZRZA 4CGYB 4KD4A 3MA2B 1BDOA 4BS9A 1XTCD 1EY5A 5IOCA 3M4OB 3M85A 2XVSA 1RKNA 1SNOA 1WTQA 4NMZA 3KBXA 1I6VC 1OXTA 5JOBA 3TMEA 1B50A 1KNEA 4IALA 4H0LC 2HCIA 1TWHB 4R8IA 1ENFA 3K5NA 3K5MA 5C44B 4K8IA 4Y7NB 2IWHA 1LTRD 1GJXA 4BBRB 3GD7A 2IPKD 1DOKA 1ESFA 3C3LA 1EQVA 1S5FD 4IN3A 1ZEQX 5HURA 3SK4A 2IX1A 2XIWA 4LK1C 5M5YB 1Z6HA 4FVMA 2PMZB 3GV6A 1S5ED 2N55A 3S15B 3C1FA 2Z4HA 3CHBD 2WP8J 1BCPF 2MJ8A 5KRUA 4A3JB 3AMUA 2B2TC 2B8GA 2K5WA 1HA5A 1EL0A 4M1UB 1QOHA 1KDBA 2PQEA 3T56B 1ILQA 2EZVA 3NSWA 5M3FB 1LT6D 5T1GA 4X3TA 1BO0A 2L55A 3BZDB 1EY0A 2DNEA 4TQUS 5FLXE 1Q1BA 4UAIA 3H94A 1EOTA 5LL6X 3D4RA 1ONLA 1SJED 3HOXB 2DNCA 3MXPA 3WOEA 1O78A 3PUWA 3P20A 3R2IA 2NVQB 3TP7A 1UEAB 4V0BA 4Z9CB 3K5OA 3MVVA 3QIAA 2D9UA 2KOLA 2Z1CA 4FO2A 4TRDA 4FF3A 4L8JA 1KAAA 2XWJB 1WTPA 3RMHA 3D31A 1WD1A 2F0FA 1PFMA 4C56C 4NW2A 1Q12A 1G2TA 4DFAA 1KTKA 1RTOA 2MP1A 4OHJA 1HFNA 1F2YA 4O42A 4I7ZC 1JCKB 4LMQD 4G4KA 1CI3M 4H7BA 4HR7B 1EYCA 5D3DA 2F0UA 4ZUJA 2AUJD 1ML0D 1EY8A 3PUYA 1EYAA 5C5LA 1Y69U 3ND9A 3HOZB 3D8GA 5CC4A 2K1BA 5IODA 3V96A 3K5LA 4KY6A 4IURA 3D6CA 4ZYSA 2ZXRA 3GTLB 2J4XA 1Y8OB 1LTTD 3DWQA 4QMGA 1S5BD 1F9QA 4DK0A 1O7ZA 3VR6A 3FPUB 1SYBA 5IGBA 1PZKD 3KK7A 1EZ8A 2IX3A 4HTHA 4C2MB 3MZ5A 1A6XA 2RKSA 1RF2D 1G2SA 5CORA 3PO2B 2XNAC 2RA4A 3H6MA 4G7HC 3DM1A 1IYVA 1U4PA 4IUPA 1SYEA 3SVMA 2R92B 5C0XJ 1BOSA 2QCPX 3KUPA 3Q23A 4A3FB 3TP6A 4Q0FA 2K5QA 2ZXPA 1IKMA 1IL8A 3OOCA 2ENBA 2HQEA 1CHQD 1W6JA 4C3IG 2J7ZA 3L9AX 3TP5A 2IW3A 2PYKA 1FYCA 3DMUA 3K59A 2EJFC 1JORA 1E2ZA 1TU2B 3IKJA 3RZDB 5EPLA 2KVMA 2EY2A 3NHHA 2XWBB 3JAML 4XQQA 1JICA 4RH6A 1LT5D 2PZWA 3SK8A 1SNPA 5EBDA 4X3KA 1HFGA 5G3LF 3P7JA 3V05A 3H09A 1PTOF 1EWCA 4Q5VA 2DN8A 2OXPA 2Q8RE 4BA2I 2I07B 3FDTA 2A73B 4R8NA 1Q1EA 1OXUA 3VR4A 4C3HG 4K6DA 4GZYC 1FGBD 3QOJA 2QF7A 3WDNA 2MHVA 4KI0A 2VXWA 1GUNA 1GUWA 4FYDA 4HAEA 4EQNA 1VMCA 1F77A 1I4XA 5IGCA 3PUVA 2CW0D 2RSOA 1PRTF 3KLSA 1NAPA 5DNFA 3DWAA 4K2LA 5JPMC 2E2DC 1F9RA 4F88A 5ELDA 1VCIA 1I4RA 3I73A 2L12A 2BCOA 2E76C 2K03A 3MTSA 2E2IB 1D1IA 4H44C 4M8AA 3RD4A 1ICWA 3QO2A 3GV3A 1CK1A 1MBYA 2AQ2B 3T13A 4K14A 3MXNA 4HSVA 4XIGS 4DAPA 1T5EA 2EYPA 1AEXA 1DJRD 3SR1A 3T4AC 3CRKC 3U9SA 5CR3A 1HUMA 5D65A 1KDAA 1OXSC 4IUTA 2BOSA 3NWTA 5C6AA 1SE4A 1AFPA 1ZYRD 4HCSA 4CKBA 5DAUA 3SEBA 1HPCA 1RCVD 3MAQA 2DY7A 1GHJA 3EQLC 1S4ZA 3EJIA 4KKUA 4NP5A 2CHBD 4A3EB 5CV7A 3NE5B 1QG7A 1RTNA 3R2TA 5IGFA 1VDZA 1BR9A 2O5IC 3I4MB 3N52A 2NTSA 4A93B 4K5XA 2F3WA 5E4WC 5I6WA 4RHSA 4KV6A 1U4LA 3NPPA 1DXMA 3CQZB 4KKSA 5M5XB 1II3A 5DM73 2K33A 2O2LD 3BDOA 1NUCA 2NN6I 1R9TB 1QILA 3QWNA 3S16B 4JBWA 4RGOS 3K58A 4ZAIA 2R3ZA 3D4DA 3G7LA 3I4NB 4KY7A 2Y0SB 1I3QB 1CTMA 3W3AA 1STAA 1ESRA 5CMDA 2F03A 1LTBD 3R3OA 2L9HA 2WIIB 3H3VC 5IGGA 2TSSA 4OO1I 1A3VA 1TQOA 1VMPA 3VYRA 1TS4A 4N9TA 3GQBA 4XTCS 4IUVA 2A68D 1V1PB 5D3IB 3IAYA 1KLUD 3D3RA 1NR4A 4K2KA 5E3FA 1STEA 5CGKA 2Z8LA 4NDXA 1U4RA 4XDXA 3MFGA 1OXVA 3TZDA 1HQMC 1YNJD 3NQTA 5C3EB 1Y1WB 4PMWA 2NN6H 1AZPA 1SYCA 5COYA 5K36H 5IT9L 5C0XI 1V43A 1STBA 1B53A 1ET9A 4WRDA 5C0XG 1LO5D 3JAME 4CHTB 1WTRA 3X3MA 3OPOA 2RDGA 5I9PA 4A3MB 1DZ1A 4DF7A 2JE6I 5KNCA 5JEAJ 3S1RB 4OO1H 4K6LA 2JA7B 1EFID 1B9MA 1BCPD 4AYBB 4B08A 1LTSD 1B2TA 3OIPA 4ZLTF 2BDOA 1E2VA 4IUQA 3AU7A 3PMFA 2JYOA 4KMUC 1SYGA 4HN7A 1I4PA 3E5SA 1LACA 2Q8IB 1DD2A 2F0DA 2X6LA 4C3JG 2HDMA 1RD9D 3C2PA 3N6RA 3G6JB 3DWPA 2A74C 2K32A 3J7AV 2F0VA 2RDFA 1TWFB 4FNFA 5ELCA 3HEJA 3KLRA 5TSSA 5KGUA 1FNUA 4I65A 4P2CB 4RKBA 1KLGD 1RHPA 5EPJA 1KABA 1SJHD 5EJWA 3O13A 4QUCA 4N9PA 2VB3X 2F0HA 5D14A 2L0CA 3BYYB 3BS1A 2A68C 5J1ZA 4S3SA 2B8FA 3S9WA 1V1OA 2A69D 3OMCA 2LMCB 4FXGC 3J81L 2AUKA 2GA4B 4QF4A 5M5WB 1TWGB 4WFN3 4DXFA 1KDCA 2EYHA 4V190 5LL6S 4FXDA 2C5CA 4HMIA 3S17B 4BY1B 3S14B 1G291 1L0XB 4ZK9B 3PV0A 5CV8A 3VYUA 1Z7TA 1SAPA 2XRQD 1JQYD 3NBHA 1NCVA 3MFYA 2EY5A 4KJNA 1O7LA 2IL8A 3OW7A 3W2DA 4QIWB 4BBSB 1B44D 1VF7A 1GOZA 1TY0A 2NYZD 4BA1I 3HZXA 3EROA 1LABA 1F2ZA 5JVG3 4H13C 2FINB 1HXYD 4K5WA 2QILA 3K7AB 4A3BB 2E2JB 5FO9B 1BCPC 2K7VA 1XWEA 2PNRC 2EYJA 1K83B 1DYQA 2SEBD 2F3VA 3T51B 4RFBA 5CYUA 2XSCA 1T5XD 1STGA 1C4QA 5KEEA 3A54A 3NWSA 4B9XA 1IHZA 2BA0A 3NTKA 1GUOA 1GXDC 5C4HA 4WJWA 5IIFA 3HOYB 1DM0B 4EGVA 5EKKA 5KYLA 3QOLA 1GUGA 3J7YW 2BA1A 4OIKA 2B2WC 3MEHA 2B2UA 2R7ZB 4RCOA 1DCZA 4C1NI 1Y1VB 4PMBA 5EPKA 3GP7A 2JP1A 2B2YC 2A6HD 1I4GA 4YIJA 2B2WA 2G9DA 2WV6D 5IGEA 5G3LD 1BXTA 2A69C 2RDHA 1PTOD 4LJZC 3SK5A 2M00A 2WAQB 2B2YA 5IT9E 3DUZA 2RBMA 2EE1A 5JAVA 2HUGA 2QDBA 3BVZA 2VB2X 1L0YB 2AQ1B 1QJOA 1XXGA 3QB3A 5JPNC 4K5VA 3R8BA 1SBBB 5KNDA 2VNUD 2NZ1D 4ZQ3A 4KKTA 5I4DA 1PRTD 1D6EC 3HGBA 1SNCA 2KUMA 3ONAB 5FKAC 2MGSA 2YU9B 2AWOA 4XT3B 2L4NA 2FMCA 3M7GA 5CBAE 2PW5A 5EQ0A 3H0GB 3A56A 5JEAG 3MC0B 1ZKOA 2F0SA 3MXGA 1H9MA 4QUFA 2RQXA 4KK7A 3NQIA 1WTOA 3GTJB 1XYIA 1UNSA 4HSPA 5FOBB 1LTAD 3A55A 2BE5D 1HHVA 4F87A 2IT1A 2EJGC 2L1BA 1Z47A 4O1NA 1LT3D 1F9PA 3LX0A 4X3SA 1CA5A 2WB1B 3CKIB 1D5MC 5CV4A 2X69A 3WOFA 3TBIB 3DHQA 4IUNA 5NUCA 2K5DA 4DAYA 3E6ZX 4ODGA 3IFTA 3MWYW 4ZKBB 1EIHA 3C1EA 5E1FA 1STYA 2NTTA 4DA2A 2A6HC 5HGTA 1C8CA 3J81E 5ISRA 3VR5A 3TP8A 1X3QA 2WINB 3HOVB 4RKLA 1EU4A 2G9HD 3HP3A 3EFXD 1PTOC 2NB0A 4L63B 4RGNA 2K04A 5DM63 5CV5A 2D2CC 5CV9A 4XYQA 1I4QA 2DY8A 5F2DA 4IFDG 2EY1A 3I8ZA 4PQXA 3CRLC 1J8IA 1R4QB 2YYZA 4ID6A 1PMRA 1U4MA 3U9OA 1OXXK 3L3OC 4IQZA 3X3NA 4C3IB 3EVQA 1SSOA 2L5TA 4RWSC 4A3IB 1PRTC 1PZJD 3H91A 4PV1C 3T53B 1SXTA 1V1PA 5EKLA 1ENCA 2EOTA 1IW7D 4KD3A 3I91A 2F0JA 3GTKB 5T1IA 1B4OA 2F4IA 2M9VA 2H1EA 3K6OA 2ICEC 5ELEA 3S2HB 2O4XA 3OMGA 4DAVA 1E0BA 2R6GA 2PZUA 2NWGA 2SDFA 1A3UA 1U9RA 1HTLD 3VA7A 4B9WA 2BE5C 1JB3A 2KEEA 1TS5A 3VYSA 2NVYB 4C3HB 1NR2A 2IX0A 1SDFA 1J9OA 1KNAA 1BUVT 4KN4C 4BY7B 1EEFD 1I4HA 3ITPA 1HQRD 4ULLA 1TWAB 2F0KA 2QKIC 2JA8B 3D6WA 1SEBD 2CQAA 1PLFA 3KF8A 2EPBA 4CKCA 1HA6A 1AZQA 1B3AA 1G6ZA 1TS3A 2CW0C 1HUNA 1LT4D 1X3PA 1TY2A 1TS2A 3A7LA 3SHLA 2JEBI 1AP0A 1RDPD 4F7XA 5I2YA 3J80L 4K8JA 2NVTB 1PZID 3NBIA 4EVOA 2F0LA 2XRSD 1PYWD 5C4XB 4DNRB 1D2BA 3D4WA 3HG9A 1PFNA 3FPPA 2F0NA 1SYDA 3FVQA 4R9WA 1RODA 3TSSA 1LV9A 4G7OC 2LKVA 1SNMA 1SNDA 2KQ3A 3GO5A 1CZGA 3M7NA 2ICIA 4FF4A 4CJ1B 2NVXB 3UI2A 1A2UA 1ZYRC 3HOUB 1D1KA 2F0WA 1CFMA 1Y8PB 4RHRA 5C4ZA 2B63B 3ND8A 5DEHA 4FXKC 5FO7B 3K57A 1SNQA 3OHXC 1TT2A 1O80A 2B2VA 2PCFB 2TMPA 5FK9C 2E2HB 1H9RA 3FKIB 2NBFA 1BBXC 2CVRA 1EY7A 2MUYA 2B39A 1H9SB 3FEWX 3TDQA 3AB9A 2EYFA 2O5JC 4A3DB 1LTGD 4U68A 3Q6SA 3SE0A 5BN5A 4DNTB 2EXZA 2H4OA 4C1NK 1LLRD 4F8MA 5C0XH 1WD0A 4FF1A 2PZTA 5JJZA 4J6HA 3S1MB 2JSOA 1WTVA 2RVLA 2FMMA 2SOBA 2F0TA 3TN2A 1HCZA 1JC7A 4KHZA 5I2XA 2F0IA 2LS01 1HRJA 2KECA 3CU7A 3GTQB 1PFBA 3HOWB 1TVXA 3OIQA 4PNYA 1K8MA 1H9KA 4IFDJ 1YNJC 2FFKB 2NUCA 1FNVA 3OWFA 4DN4M 4LAAA 1SMYD 1B9NA 3ERQA 4KHVA 3A8JE 3PO3B 2EY6A 5C3XA 5FO8B 4KTAA 2JEAI 4DXGA 1MSGA 2D5DA 3NXWA 1TWCB 5KYIA 1SE2A 1JOQA 3NK9A 3MHBA 1SFOB 5E4XA 1LTID 3NUCA 4MN3A 2LFNA 2E75C 1A3TA 5M3MB 2WKCA 1GUSA 3M3YB 4RGMA 3PUZA 1ILPA 5KIXA 2B2TA 1JOOA 5BN4A 2K01A 1YNND 2XN9C 3HRZC 4E6IA 3SK6A 2BDNA 1H9JA 3GTMB 3DEPA 1Y8NB 1F9SA 1I50B 4C3JB 1TIID 3I70A 2B2UC 2EJMA 5EBCA 1JR0D 1D5XC 2HDLA 2HCCA 5CBEE 4XT1B 4IZ8A 5A2QL 4XYOA 1BQQT 4XQNA 4ZKCB 3J80E 3P1HA 3NTHA 1JWMD 3VA5A 1M4VA 2ZXOA 2J0TD 4RAUC 2SNMA 1G91A 1IYUA 2R93B 1WCMB 4ABNA 2A6ED 2EYLA 1HTPA 1M8AA 2F1MA 2JXMB 1STNA 1EZ6A 1EYDA 1Q8IA 2EYMA 1ZXTA 4KN7C 1MGSA 1WTXA 1JE4A 2MPMA 1SE3A 3ZYYX 1EWHA 5LHY1 3GTGB 1R4PB 3IFDA 1QNKA 2X6GA 4XXEA 2R61A 1CQVA 1SMYC 3RUZA 1CA6A 2L11A 1MSHA 5M9OA 5JVH3 1A15A 4XQJA 2QEJC 3S2DB 4MHEA 5I9OA 3L7ZC 3S1QB 4JK1C 1FNWA 3PIO3 1EIGA 1BCPB 5CV6A 4UDUC 1ENAA 2OEOA 5IGDA 1E2WA 2F0MA 1YNNC 1CZWA 1XX8A 4IUUA 2F0GA 3A8IE 5KNBA 4J1MA 1EU3A 1C48A 4KJOA 2IJ0A 1BF4A 1D5ZC 3F2UA 3GTPB 5I6YA 1X32A 4OIJA 2EDGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M00 A;  2SNM A;  4PNY A;  4TRD A;  1KAA A;  1A3U A;  4KJN A;  5C4Z A;  1U9R A;  1EY9 A;  2F0E A;  4ODG A;  4B9W A;  1TR5 A;  3P75 A;  4K8I A;  3TP6 A;  3D4D A;  2RBM A;  2F0P A;  5DEH A;  3C1E A;  3PMF A;  2OF1 A;  2ENB A;  5E1F A;  1STY A;  2F0F A;  1SYG A;  2HQE A;  1SNQ A;  3E5S A;  4KY7 A;  1TT2 A;  2EYL A;  3HZX A;  5EGT A;  5C3W A;  5HGT A;  5JAV A;  4DFA A;  1STA A;  4MIU A;  2NUC A;  5ISR A;  3OSO A;  2F0D A;  3OWF A;  3R3O A;  2QDB A;  3ERO A;  4K14 A;  4LAA A;  3T13 A;  3T16 A;  3TP8 A;  1F2Y A;  2PW7 A;  1F2Z A;  1STN A;  1EZ6 A;  1EYD A;  4PMC A;  5IGG A;  3QB3 A;  2EYM A;  1EQV A;  2EYP A;  3ERQ A;  4K5W A;  1AEX A;  4KHV A;  1A3V A;  1TQO A;  4RKL A;  3SR1 A;  4K5V A;  1F2M A;  3TP5 A;  2PYK A;  5HUR A;  5K5P A;  2SNS A;  3DMU A;  2EY6 A;  4H7B A;  3SK4 A;  4EQP A;  4N9T A;  3ITP A;  5C3X A;  4KTA A;  1JOR A;  1EY7 A;  1EYC A;  2F0V A;  2F0U A;  5CR3 A;  4ZUI A;  2RDF A;  3NXW A;  3SK5 A;  4DGZ A;  2F0K A;  3BDC A;  4ZUJ A;  3HEJ A;  5KYI A;  4G57 A;  2F0Q A;  4ZQ3 A;  1JOQ A;  3NK9 A;  5KGU A;  1KDA A;  3MHB A;  2EY2 A;  3NHH A;  1EY8 A;  2EYJ A;  4I65 A;  1EYA A;  2EYF A;  4K2K A;  5C5L A;  5C6A A;  5E3F A;  2PZW A;  3NUC A;  5CGK A;  4HMJ A;  1A3T A;  1NSN S;  1SNC A;  1SNP A;  2EYO A;  2F3V A;  4RKB A;  3D8G A;  4NDX A;  5CC4 A;  3C1F A;  5DAU A;  3BDL A;  4QB4 A;  5CV5 A;  2WAC A;  5CV9 A;  1A2T A;  5IOD A;  1KAB A;  5KIX A;  4EQO A;  1STG A;  5KEE A;  5KRU A;  3SHL A;  4KY6 A;  4B9X A;  3RUZ A;  4ME5 A;  4NKL A;  1JOO A;  1IHZ A;  3D6C A;  3EJI A;  3NP8 A;  4NP5 A;  5F2D A;  2EXZ A;  2EY1 A;  4F7X A;  5C4H A;  4N9P A;  2OXP A;  4KY5 A;  4K8J A;  2PW5 A;  3NQT A;  2F0H A;  4E6I A;  2F0O A;  5CV7 A;  1KDB A;  4EVO A;  5M9O A;  2F0L A;  3SK6 A;  3V2T A;  1EY4 A;  5IIF A;  4ID6 A;  2PQE A;  1STH A;  4F8M A;  5EKK A;  5KYL A;  3QOL A;  4QMG A;  5C5M A;  2PZT A;  3U9O A;  2KHS A;  5J1Z A;  1SYC A;  4J6H A;  4R8N A;  2F0S A;  5IGF A;  4S3S A;  3S9W A;  3EVQ A;  3MEH A;  3D4W A;  3OMC A;  1STB A;  2F0N A;  1SYD A;  4KD4 A;  4K6D A;  3SK8 A;  4PMB A;  5I9O A;  4WRD A;  1EY0 A;  1EY5 A;  5IOC A;  3QOJ A;  1SYB A;  5IGB A;  4K5X A;  2SOB A;  2F3W A;  1EZ8 A;  5EKL A;  5I6W A;  1ENC A;  2F0T A;  4HTH A;  5CV6 A;  3SXH A;  3MXP A;  5J22 A;  1SYF A;  1ENA A;  2OEO A;  4KV6 A;  4QF4 A;  5IGD A;  2LKV A;  1RKN A;  4KD3 A;  4EQN A;  2F0J A;  4IZ8 A;  1SNO A;  1SNM A;  2F0M A;  4OL7 A;  1KDC A;  2EYH A;  5I9P A;  4DF7 A;  4YIJ A;  1SND A;  5IGC A;  2KQ3 A;  3MZ5 A;  2RKS A;  1EY6 A;  3LX0 A;  1II3 A;  4NMZ A;  3TP7 A;  2F0G A;  4HMI A;  4J1M A;  2F0I A;  4WOR A;  3P1H A;  3H6M A;  4KJO A;  5CV4 A;  5CV8 A;  1NUC A;  5JOB A;  3MVV A;  3TME A;  5IGE A;  1JOK A;  2O4X A;  5I6Y A;  4IAL A;  3OMG A;  3VA5 A;  3DHQ A;  4DU9 A;  5J39 A;  4IUN A;  4K2L A;  1A2U A;  1SYE A;  2PZU A;  5NUC A;  2F0W A;  2EY5 A; 
#chains in the Genus database with same CATH topology
 1CT1 D;  4RCN A;  1O7Y A;  4DK1 A;  2F0E A;  3P75 A;  3RZO B;  2F0P A;  4A3E G;  4QQB X;  1FR3 A;  2JA5 H;  4CKE A;  5C3W A;  4MIU A;  1BKB A;  3M4Q A;  3MXU A;  3C46 A;  1DON A;  1XMO L;  3S1N B;  3A7A B;  3BJU A;  2E74 C;  1F2M A;  3NEN A;  3I4M G;  1TKW B;  3FRP B;  4LFC Q;  4HJ7 A;  4ILW A;  4OX9 L;  2CKZ B;  4G57 A;  3NEL A;  1IBK Q;  5EKI A;  3BVM A;  4DR4 Q;  4RG1 A;  1SR3 A;  3PIP 3;  1NSN S;  4A3G H;  2A6E C;  3J7A F;  1CSP A;  3BDL A;  3OTO Q;  4QB4 A;  2ID0 A;  5C4J H;  2MFI A;  1QUQ B;  5JEA H;  2I46 A;  2N88 A;  3NTI A;  5A35 A;  4LFA Q;  4B3T Q;  2M2L A;  4ME5 A;  1JWU D;  3NP8 A;  2N78 A;  3LWU A;  1VQ4 A;  1K8O A;  3CC7 A;  3HKS A;  2F0O A;  3VR2 A;  4A3K B;  1UUP A;  1VQB A;  1HR0 Q;  2Q2U A;  1STH A;  4DAM A;  1RIP A;  4L6T B;  5C5M A;  1CQF A;  4PG3 A;  4IOC A;  4FDB A;  4CJ2 C;  2ZJQ A;  2Y0S G;  3J81 i;  2AQ3 B;  1GHK A;  1G8Z D;  2OCE A;  1X3G A;  2JA5 B;  2KCC A;  2Z4I A;  3M4Y A;  4IFD I;  4B3M L;  3KBG A;  4OGQ C;  1QCB D;  1N32 Q;  3S24 A;  1T9H A;  1B1Z A;  5J22 A;  1SYF A;  1XNR Q;  1IKL A;  5BN3 A;  3I4L A;  4CBV A;  1RJT A;  4BWG B;  4MNO A;  1PH4 A;  1WFQ A;  1QWY A;  2UUA Q;  2Q8T A;  2D0O A;  3T1Y L;  2RSN A;  1CKN B;  2QW7 A;  1JOK A;  2C9O A;  2OTL A;  1PXU A;  4ZCK A;  4DU9 A;  4A3G B;  5ELF A;  1JWS D;  2Z6K A;  2ZM6 Q;  1PDQ A;  3E0J A;  3K0Y A;  5C4J B;  2EXD A;  1YHA A;  1TR5 A;  4HCE A;  2OF1 A;  5C3E G;  1Y1W G;  2K5H A;  4TSS A;  5EGT A;  3RLF A;  3HS0 C;  2XTI A;  4I7A A;  2LY7 A;  3F2B A;  4GN5 A;  2FJ2 A;  3OSO A;  2AWN A;  2A5H A;  2PW7 A;  2JA6 H;  2N8N A;  2KJX A;  4PMC A;  5BR8 Q;  5A2Q E;  4DV5 L;  3Q0A A;  1VF5 C;  4P71 A;  4RA8 A;  3CCQ A;  1PTO H;  3QJY A;  5K5P A;  2A1A A;  2V4D A;  4EQP A;  4NXM Q;  5IYB G;  4DR2 Q;  4ZUI A;  2WKD A;  3CCL A;  2F0Q A;  3HKZ B;  3NEM A;  1WVL A;  1GVP A;  3EA6 A;  3W5O A;  5FLX L;  3T1H Q;  1N8R C;  4A3M G;  2LSS A;  2KA7 A;  4IFD H;  4G7Z C;  3CCJ A;  4FF2 A;  3BYT B;  2OT2 A;  5IWA L;  2K05 A;  1A2T A;  1YIT A;  1WTW A;  2JA7 G;  4NKL A;  3TZU A;  4AYB G;  2Q2I A;  1DOL A;  3QG1 A;  4KY5 A;  4MTN A;  3KJP A;  1NMF A;  4CJ0 B;  5AJ3 L;  1VQF A;  1YEZ A;  1AW7 A;  3V2T A;  1XPO A;  2D62 A;  2PO4 A;  4U67 3;  4TKO B;  3DEO A;  1Q81 C;  1EEI D;  3A8K E;  1ICF B;  3URY A;  3ZJY C;  3I2Z A;  1QZH A;  1Q90 A;  2NN6 G;  3DXJ C;  3OWE B;  2PPB C;  2JA6 B;  1H9S A;  4FP5 D;  5K36 G;  5AFW A;  3SXH A;  3GTO B;  5ELB A;  1PTO B;  1MI2 A;  4OL7 A;  3E0E A;  5IYD H;  4R1J A;  2K28 A;  1EQT A;  1Q3L A;  1EY6 A;  2KCN A;  4X62 Q;  5JJI A;  4WOR A;  5LMU Q;  2VL6 A;  2VUM H;  1CM9 A;  5J39 A;  1EIY B;  3AFP A;  3R93 A;  1FD7 D;  4OO1 G;  2KED A;  3VYT A;  4TVA B;  1EY9 A;  4LFC L;  1WTH A;  3U50 C;  2R7D A;  3SDZ A;  2EVB A;  2RHQ B;  1IBK L;  3BVG A;  1DOM A;  4GNX C;  1S5D D;  1AN8 A;  3G48 A;  3PUX A;  1OO9 B;  2ES2 A;  3M4O H;  3T16 A;  4P72 A;  4HED A;  3OTO L;  2B2V C;  5FJ8 G;  1PRT B;  4QL5 A;  1M1K C;  3HOW G;  1CHP D;  1MD2 D;  1BNZ A;  1W6K A;  4LUO A;  4B3T L;  2SNS A;  3TRE A;  3I3C A;  4DGZ A;  3BDC A;  1QNU A;  4GNX A;  2VQF Q;  3IL8 A;  3LNN A;  1HR0 L;  2KCM A;  3FMC A;  1IW7 C;  1V9P A;  2VY3 A;  3Q22 A;  5E7N A;  4HMJ A;  1X54 A;  2EYO A;  1TWH H;  3I72 A;  1QE6 A;  2K6A A;  3KLS X;  4BY1 G;  3BG3 A;  2WAC A;  1V8Q A;  4J8Q A;  4EQO A;  1B3Q A;  5C44 H;  4L5R C;  3L0O A;  1I6H B;  1UAP A;  5IP7 G;  3Q24 A;  1N32 L;  2VUM B;  2FHT A;  3I90 A;  4X3U A;  3VR3 A;  4BBR H;  2GN5 A;  3LWE A;  1QB5 D;  1GUT A;  2K5V A;  1XNR L;  1E7Z A;  1EY4 A;  4RGT A;  1ET6 A;  1F2L A;  1RL2 A;  1X65 A;  3PIO A;  1PHJ A;  4BBS G;  2KHS A;  2UUA L;  2B3G A;  1S5C D;  4QCL A;  1S72 A;  1VQC A;  2ZT9 C;  4ZRZ A;  3KF8 B;  4CGY B;  4KD4 A;  1YZ6 A;  3MA2 B;  3CC2 A;  1BDO A;  4BS9 A;  1XTC D;  1EY5 A;  5IOC A;  3M4O B;  2K50 A;  2ZM6 L;  5M5Y H;  2C35 B;  4A3B G;  3M85 A;  2XVS A;  1RKN A;  3S15 H;  1SNO A;  3CCM A;  2Q2H A;  1WTQ A;  4LFB Q;  1MJC A;  4NMZ A;  3KBX A;  1I6V C;  1G51 A;  3UE1 A;  4A3J H;  1OXT A;  5JOB A;  3TME A;  1B50 A;  1KNE A;  4IAL A;  4H0L C;  5BR8 L;  1VQ9 A;  3CP0 A;  2HCI A;  1NTG A;  1TWH B;  3G6E A;  4R8I A;  1ENF A;  3K5N A;  4NXM L;  4WJ3 M;  1Q82 C;  4DR2 L;  3K5M A;  1PH1 A;  4LWC A;  4P73 A;  5C44 B;  4K8I A;  4DV7 Q;  2CCZ A;  4Y7N B;  1AE2 A;  1E3P A;  1LTR D;  2IWH A;  5M3F H;  1GJX A;  3T1H L;  3HOY G;  4YHH Q;  4JYA Q;  4GOP C;  4BBR B;  3GD7 A;  2IPK D;  1DOK A;  1SN8 A;  3HOX H;  1ESF A;  2R7Z G;  3C3L A;  1EQV A;  1S5F D;  3PIP A;  1Y1V G;  4IN3 A;  1ZEQ X;  5HUR A;  3SK4 A;  2Y0S E;  2IX1 A;  2NVQ H;  2XIW A;  1EQQ A;  4LK1 C;  5M5Y B;  1Z6H A;  4FVM A;  1K8G A;  2QA4 A;  5GRO A;  2PMZ B;  3GV6 A;  1S5E D;  2N55 A;  3S15 B;  3C1F A;  1AH9 A;  2Z4H A;  2JQO A;  3CHB D;  2WP8 J;  3CAM A;  1BCP F;  2MJ8 A;  5KRU A;  4JW0 A;  4A3J B;  3AMU A;  3QR8 A;  4MTK A;  3A74 A;  1KRT A;  3A5U A;  4LF5 L;  2B2T C;  2B8G A;  2K5W A;  1HA5 A;  3CF5 A;  1EL0 A;  2WAQ G;  4J15 A;  1QOH A;  4M1U B;  1UWV A;  1KDB A;  2ZJR A;  4RMF A;  1C9O A;  2PQE A;  3T56 B;  1ILQ A;  2EZV A;  4GKK Q;  3NSW A;  2PI2 A;  4X62 L;  4WJ4 A;  5M3F B;  1LT6 D;  5T1G A;  4X3T A;  3TQY A;  1BO0 A;  4YWK A;  3AQQ A;  1XMO Q;  2L55 A;  3BZD B;  1KD1 C;  1EY0 A;  2DNE A;  4TQU S;  5FLX E;  3MEF A;  1Q1B A;  3DM3 A;  4UAI A;  3H94 A;  1EOT A;  5LL6 X;  4P75 A;  3D4R A;  1ONL A;  1SJE D;  3HOX B;  2DNC A;  3MXP A;  4HJ5 A;  3WOE A;  1O78 A;  3PUW A;  3P20 A;  3R2I A;  1KQS A;  4LUZ A;  3HOZ H;  2NVQ B;  3TP7 A;  1UEA B;  4V0B A;  3TS0 A;  4Z9C B;  3K5O A;  3MVV A;  1A63 A;  3QIA A;  3GTL H;  2D9U A;  1B70 B;  2KOL A;  2A8V A;  2Z1C A;  4FO2 A;  4TRD A;  4FF3 A;  4L8J A;  1KAA A;  2XWJ B;  1WTP A;  3RMH A;  4CDE C;  3H0G G;  3D31 A;  4AYB E;  2F0F A;  2VQF L;  1PFM A;  1WD1 A;  4C56 C;  4NW2 A;  2GVB A;  1Q12 A;  1G2T A;  2IHF A;  4DFA A;  1KTK A;  1RTO A;  4JBK A;  2MP1 A;  4OHJ A;  1HFN A;  2K4K A;  1F2Y A;  4O42 A;  4I7Z C;  1JCK B;  4LMQ D;  4G4K A;  3E3X A;  4YWM A;  1CI3 M;  4H7B A;  4HR7 B;  4JG2 A;  1EYC A;  1MHW C;  1SLJ A;  2F0U A;  5D3D A;  3PO2 H;  4ZUJ A;  2AUJ D;  4JCV E;  2G5D A;  2I5H A;  1W3S A;  1ML0 D;  1CUK A;  1EY8 A;  3PUY A;  5FLM H;  1EYA A;  5C5L A;  1Y69 U;  2PQA B;  1UE5 A;  3ND9 A;  2R92 H;  3HOZ B;  3D8G A;  5CC4 A;  3J80 i;  1AE3 A;  4DV1 Q;  2K1B A;  5IOD A;  2JJQ A;  4A3F H;  3BZC A;  2KCT A;  3V96 A;  3K5L A;  4KY6 A;  3ERS X;  4IUR A;  3IRB A;  3D6C A;  4P74 A;  2H5X A;  4ZYS A;  3NBH B;  2ZXR A;  3GTL B;  2J4X A;  1Y8O B;  4YCU A;  1LTT D;  3DWQ A;  4GS3 A;  4HJ9 A;  4LFB L;  4QMG A;  1S5B D;  1F9Q A;  2YU9 H;  2HIV A;  4DK0 A;  1S40 A;  1O7Z A;  3VR6 A;  3FPU B;  1JJ2 A;  4IOA A;  3LGJ A;  1SYB A;  1UEB A;  2RF4 A;  5IGB A;  3RZD H;  1H95 A;  1PZK D;  3KK7 A;  3HOV G;  5IT9 c;  1EZ8 A;  2IX3 A;  2PNH A;  4HTH A;  4OXP A;  4X66 Q;  4DV7 L;  4OEL B;  1VQJ A;  3A0J A;  3L2P A;  4C2M B;  3MZ5 A;  1A6X A;  2RKS A;  1RF2 D;  1G2S A;  5COR A;  4YHH L;  4JYA L;  3PO2 B;  1QUQ A;  2XNA C;  1VQP A;  4YWL A;  4POF A;  2RA4 A;  3H6M A;  2UXC Q;  4G7H C;  3DM1 A;  3PCO B;  1IYV A;  1U4P A;  4IUP A;  1SYE A;  3SVM A;  2R92 B;  4APV A;  1MJE A;  3CXC A;  5C0X J;  1BOS A;  2QCP X;  3B6Y A;  1NY4 A;  3KUP A;  4B3R Q;  3Q23 A;  4A3F B;  3TP6 A;  4Q0F A;  5AJ3 Q;  2K5Q A;  2ZXP A;  3ER0 A;  1IKM A;  2ZTE A;  1IL8 A;  3OOC A;  2ENB A;  4ME3 A;  2HQE A;  1CHQ D;  2UU9 Q;  4R4I A;  3KYH C;  1W6J A;  2NZH A;  4C3I G;  4QIW E;  2J7Z A;  1VQH A;  2UUC Q;  3L9A X;  4A3L G;  4A3I G;  4A75 A;  3TP5 A;  2IW3 A;  3TRZ A;  2PYK A;  1FYC A;  3DMU A;  1L0W A;  2EJF C;  3K59 A;  1JOR A;  5IYC H;  3UE0 A;  2HT1 A;  1E2Z A;  1TU2 B;  3IKJ A;  3RZD B;  5EPL A;  2HIX A;  2AMC B;  4A3C H;  2KVM A;  1CKN A;  2EY2 A;  3NHH A;  2XWB B;  3JAM L;  4XQQ A;  4GKK L;  1JIC A;  4RH6 A;  1LT5 D;  2PZW A;  3SK8 A;  1SNP A;  1L1O B;  5EBD A;  2KEN A;  4X6A H;  4X3K A;  1HFG A;  4DKA C;  5G3L F;  3P7J A;  3V05 A;  2IY5 B;  3H09 A;  1PTO F;  3OYY A;  1EWC A;  4Q5V A;  2DN8 A;  2E2I H;  2OXP A;  2Q8R E;  3AEV A;  4BA2 I;  2I07 B;  3FDT A;  2A73 B;  4R8N A;  1Q1E A;  1OXU A;  3CW2 C;  3VR4 A;  4C3H G;  1A8V A;  4K6D A;  4GZY C;  1FGB D;  2ZTD A;  1A0I A;  3QOJ A;  2QF7 A;  4AQY Q;  3WDN A;  2MHV A;  4BY7 G;  4KI0 A;  2VXW A;  1GUN A;  4NXN Q;  1GUW A;  4LF9 Q;  4FYD A;  4HAE A;  4EQN A;  2K5N A;  1VMC A;  3A5Z B;  1BBW A;  1F77 A;  1I4X A;  5IGC A;  3PUV A;  3J81 c;  2JA8 G;  2CW0 D;  2RSO A;  2K52 A;  1PRT F;  4JI4 Q;  3KLS A;  1JJG A;  1N33 L;  1VQN A;  1NAP A;  1X3F A;  5DNF A;  3DWA A;  4A3E H;  4K2L A;  5JPM C;  2E2D C;  1F9R A;  4F88 A;  5ELD A;  1VCI A;  1I4R A;  3TEH B;  3I73 A;  2Z6K C;  2L12 A;  1PH7 A;  2BCO A;  2E76 C;  2K03 A;  3MTS A;  2E2I B;  1D1I A;  4H44 C;  4M8A A;  3RD4 A;  1ICW A;  2AHO B;  5JJL A;  3I4M H;  3QO2 A;  3GV3 A;  1WJJ A;  2WAQ E;  1CK1 A;  1MBY A;  1P16 A;  4A93 H;  5C4X G;  2AQ2 B;  3T13 A;  2YV5 A;  4K14 A;  3MXN A;  4HSV A;  4XIG S;  4DAP A;  5IY0 A;  4IPC A;  1T5E A;  4DV1 L;  3CMA A;  2EYP A;  1AEX A;  2I5M X;  1DJR D;  3SR1 A;  3CQZ H;  5GAE C;  3T4A C;  3CRK C;  3U9S A;  1L2F A;  2NVY H;  1YNX A;  5M5X H;  5CR3 A;  1HUM A;  1WYD A;  4LF6 Q;  5D65 A;  1KDA A;  1KC8 C;  1OXS C;  4IUT A;  2DJG C;  1R9T H;  2BOS A;  3NWT A;  3S16 H;  5C6A A;  1SE4 A;  1AFP A;  1ZYR D;  4HCS A;  4CKB A;  3KF6 B;  5DAU A;  1KAW A;  2CWA A;  3SEB A;  4A4I A;  4R4T A;  4JI7 L;  1HPC A;  1RCV D;  3MAQ A;  2DY7 A;  1GHJ A;  3EQL C;  4KHP L;  1S4Z A;  3EJI A;  4KKU A;  4NP5 A;  3HOU G;  1YIJ A;  3I4N H;  1J6Q A;  2CHB D;  4A3E B;  1I3Q H;  4X66 L;  5CV7 A;  3NE5 B;  1YHQ A;  4DAY B;  2LXJ A;  3VDY A;  3OW2 A;  4DV3 Q;  1XPR A;  2B63 G;  2GVA A;  1QG7 A;  3RLN A;  1RTN A;  2V1C C;  3R2T A;  5IGF A;  4DUZ L;  4JBJ A;  1VDZ A;  2UXC L;  1BR9 A;  1YI2 A;  4X64 L;  2O5I C;  5GAD C;  3I4M B;  3N52 A;  2NTS A;  4A93 B;  4K5X A;  2F3W A;  2QGQ A;  4IO9 A;  5E4W C;  5I6W A;  4RHS A;  2E8G A;  4B3R L;  3FKI G;  1BVS A;  4KV6 A;  1U4L A;  2RCN A;  3NPP A;  1DXM A;  3CQZ B;  3STB D;  4KKS A;  5M5X B;  2UU9 L;  1II3 A;  5DM7 3;  4N8F A;  1HJP A;  2K33 A;  2O2L D;  3BDO A;  2QDL A;  1NUC A;  2NN6 I;  1R9T B;  4A3D G;  1QIL A;  1SRU A;  1V1Q A;  3QWN A;  3S16 B;  3AYH B;  4JBW A;  5C3E H;  1Y1W H;  2UUC L;  4RGO S;  2NZO A;  2UXD Q;  3K58 A;  1MIU A;  2WB1 E;  3J7Z C;  4LF5 Q;  4ZAI A;  2R3Z A;  2B29 A;  3D4D A;  2ASB A;  3G7L A;  3ULL A;  3I4N B;  4KY7 A;  2MNA A;  2Y0S B;  1I3Q B;  1CTM A;  3W3A A;  1STA A;  1ESR A;  4PZ7 A;  5CMD A;  5IYB H;  5LMN Q;  2F03 A;  1LTB D;  3R3O A;  2L9H A;  2WII B;  3H3V C;  5IGG A;  2TSS A;  4OO1 I;  2CWP A;  1A3V A;  1TQO A;  1VMP A;  4NB3 A;  4JVZ A;  3VYR A;  4A3M H;  1O7I A;  1TS4 A;  4N9T A;  3GQB A;  4DK6 C;  4XTC S;  4IUV A;  1VQK A;  3S1R H;  2A68 D;  1V1P B;  5D3I B;  3IAY A;  1XNQ Q;  3KJO A;  3RLO A;  1KLU D;  3D3R A;  2JA7 H;  1K3B C;  1NR4 A;  2XGT A;  3GDE A;  4K2K A;  5E3F A;  1STE A;  5CGK A;  4DR5 Q;  2Z8L A;  4NDX A;  1LUZ A;  1TXY A;  1U4R A;  4XDX A;  1PA6 A;  3MFG A;  4YY3 Q;  1UE1 A;  1FGU A;  1OXV A;  4IPD A;  4DV2 L;  3TZD A;  4AQY L;  1HQM C;  3K0X A;  1QVG A;  4NXN L;  1YNJ D;  3NQT A;  4JOI A;  4LF9 L;  5C3E B;  1VQM A;  1Y1W B;  3UDF A;  2F3I A;  4PMW A;  4HIK A;  2NN6 H;  2Z9H A;  1AZP A;  3U58 A;  1SYC A;  2EIF A;  4GN3 B;  5COY A;  2E5L Q;  5K36 H;  5IT9 L;  5C0X I;  2MQH A;  3U4Z A;  4JI4 L;  1V43 A;  1STB A;  1B53 A;  1ET9 A;  4WRD A;  5C0X G;  1LO5 D;  1TWF H;  3JAM E;  4CHT B;  1FL0 A;  1WTR A;  3X3M A;  3OPO A;  3PO3 G;  2RDG A;  2IHE A;  2N3S A;  5I9P A;  4A3M B;  1DZ1 A;  4DF7 A;  3PSI A;  1MKH A;  2JE6 I;  5KNC A;  5JEA J;  3S1R B;  4OO1 H;  1C7Y A;  1LTL A;  1Q86 C;  4K6L A;  3E9H A;  4HIO A;  4AH6 A;  1KIX A;  3CCS A;  1EFI D;  2JA7 B;  1B9M A;  1BCP D;  4AYB B;  5M3M G;  1LM0 A;  4B08 A;  4GLA C;  1YHB A;  1LTS D;  1B2T A;  2F52 A;  3OIP A;  2VQE L;  4ZLT F;  2BDO A;  1K28 A;  1E2V A;  4IUQ A;  2CH4 W;  3AU7 A;  3PQI A;  4LF6 L;  3HOW H;  3PMF A;  3TS2 A;  2JYO A;  4KMU C;  1SYG A;  4HN7 A;  1I4P A;  3FP9 A;  3E5S A;  3STB C;  1LAC A;  2VW9 A;  2Q8I B;  1OTC A;  1DD2 A;  2F0D A;  2BH2 A;  2X6L A;  4C3J G;  4QGU A;  2HDM A;  1RD9 D;  3C2P A;  1N36 Q;  3N6R A;  1Q8K A;  3G6J B;  5M5W H;  3DWP A;  1TWG H;  5IP9 G;  2A74 C;  2K32 A;  3J7A V;  2F0V A;  2RDF A;  1TWF B;  3I4O A;  3S17 H;  4FNF A;  5ELC A;  3HEJ A;  4BY1 H;  3S14 H;  3KLR A;  5TSS A;  3RR5 A;  5KGU A;  1FNU A;  4DV3 L;  4I65 A;  4PZ6 A;  4P2C B;  5IP7 H;  4RKB A;  3BU2 A;  1KLG D;  1RHP A;  5EPJ A;  1KAB A;  1SJH D;  5EJW A;  1N34 Q;  4BBS H;  4JBM A;  3O13 A;  2D0P A;  4QUC A;  1M90 C;  3HFZ B;  4N9P A;  2VB3 X;  2F0H A;  4QJF A;  5D14 A;  2L0C A;  3BYY B;  2R93 G;  3BS1 A;  4IJL A;  3CCE A;  2A68 C;  1WCM G;  5J1Z A;  4GNX B;  4JI6 Q;  3J81 j;  4S3S A;  2B8F A;  3S9W A;  3K7A H;  1V1O A;  4A3B H;  2A69 D;  3OMC A;  2E2J H;  3KDF B;  2LMC B;  3J7A 5;  4FXG C;  2UXD L;  1A62 A;  3J81 L;  1CKM A;  1VQE A;  2AUK A;  2GA4 B;  4QF4 A;  1K83 H;  5M5W B;  1TWG B;  4WFN 3;  4DXF A;  1KDC A;  2EYH A;  4V19 0;  1X55 A;  5LL6 S;  4DUY Q;  2PQA A;  4FXD A;  2F4V Q;  2C5C A;  4HMI A;  3S17 B;  4BY1 B;  3S14 B;  1G29 1;  1L0X B;  3UDX A;  3PV0 A;  4ZK9 B;  5LMN L;  5CV8 A;  3VYU A;  1EYG A;  1Z7T A;  1SAP A;  1WI5 A;  2XRQ D;  4UP9 A;  1JQY D;  1UE6 A;  1NCV A;  3NBH A;  3MFY A;  3HOY H;  2EY5 A;  1Y14 B;  3F2D A;  1E24 A;  3CCU A;  4KJN A;  1O7L A;  2IL8 A;  3OW7 A;  3W2D A;  4QIW B;  4O0A A;  4BBS B;  1B44 D;  1VF7 A;  1GOZ A;  1TY0 A;  3G71 A;  2R7Z H;  2NYZ D;  1XNQ L;  1IBL Q;  3CME A;  1Y1V H;  1HZ9 A;  4BA1 I;  1XJV A;  3HZX A;  1YJW A;  2K75 A;  4L5S A;  1I94 Q;  4DR5 L;  3ERO A;  1LAB A;  1F2Z A;  5FLX c;  5JVG 3;  4H13 C;  2FIN B;  1HXY D;  4K5W A;  2QIL A;  4JI8 Q;  4YY3 L;  3K7A B;  1YBY A;  1PH5 A;  1Q7Y C;  4LF7 Q;  4A3B B;  1GKH A;  2E2J B;  1Z9F A;  5FO9 B;  1PH6 A;  1D7Q A;  1BCP C;  2K7V A;  1YVC A;  3ICE A;  1HNX Q;  4JI3 Q;  1XWE A;  3M4P A;  4CDD C;  2PNR C;  1VQ5 A;  2EYJ A;  1K83 B;  1DYQ A;  4ALP A;  2SEB D;  2UXB Q;  2F3V A;  1DGS A;  2E5L L;  1N33 Q;  3T51 B;  1KL9 A;  4RFB A;  5CYU A;  1GO3 E;  2XSC A;  3M9B A;  1T5X D;  1STG A;  1VQ7 A;  1C4Q A;  5KEE A;  4QY7 A;  1K73 C;  3A54 A;  3NWS A;  4B9X A;  1IHZ A;  2BA0 A;  3NTK A;  1GUO A;  1GXD C;  5C4H A;  4WJW A;  5IIF A;  3HOY B;  4K0K Q;  1NMG A;  1DM0 B;  4EGV A;  5EKK A;  5KYL A;  3QOL A;  1GUG A;  3J7Y W;  2BA1 A;  3J80 c;  4OIK A;  4GOP B;  2B2W C;  3MEH A;  1X56 A;  2B2U A;  2R7Z B;  4YCW A;  4RCO A;  1DCZ A;  1PYB A;  4C1N I;  1Y1V B;  4PMB A;  5EPK A;  2RCF A;  1LYL A;  3GP7 A;  1SRO A;  2JP1 A;  1BBU A;  3S2D H;  2B2Y C;  2A6H D;  1I4G A;  4YIJ A;  4GLV B;  2B2W A;  2G9D A;  1J5E Q;  3FHW A;  2RHS B;  2WV6 D;  5IGE A;  5G3L D;  4JI7 Q;  1N36 L;  1BXT A;  2A69 C;  2RDH A;  3H0G H;  1PTO D;  4DV0 Q;  4LJZ C;  3SK5 A;  2M00 A;  4KHP Q;  2WAQ B;  2EQS A;  2B2Y A;  5IT9 E;  2KHJ A;  3I56 A;  4R4C A;  3DUZ A;  1PVO A;  2RBM A;  1D8L A;  4BXX G;  3GTJ H;  3D0F A;  4A3K G;  2EE1 A;  4DR6 L;  5JAV A;  4DUZ Q;  2HUG A;  1IBM L;  2QDB A;  3BVZ A;  1NJI C;  4JC0 A;  2VB2 X;  4X64 Q;  1L0Y B;  2AQ1 B;  1QJO A;  1XXG A;  3QB3 A;  4A3C G;  1EFW A;  5JPN C;  4K5V A;  1B8A A;  2JA5 G;  3R8B A;  1SBB B;  1N34 L;  1FJG Q;  3W1B A;  3K8A A;  5KND A;  2VNU D;  3UDI A;  2NZ1 D;  4ZQ3 A;  4KKT A;  1HZA A;  1GD7 A;  2I5L X;  5I4D A;  4JI6 L;  1PRT D;  1D6E C;  3HGB A;  3W1G A;  1SNC A;  2KUM A;  4EQ5 A;  1VQA A;  1VQO A;  1CSQ A;  3SGI A;  3ONA B;  5FKA C;  2MGS A;  2YU9 B;  2AWO A;  4XT3 B;  2L4N A;  2BH8 A;  2FMC A;  1K8A C;  3M7G A;  5CBA E;  4A3G G;  2PW5 A;  5EQ0 A;  3H0G B;  3ULJ A;  3A56 A;  5JEA G;  2ZTC A;  4X65 Q;  3MC0 B;  4DUY L;  1ZKO A;  1KXL A;  2F4V L;  1VQ6 A;  3HOV H;  2F0S A;  3MXG A;  1H9M A;  4QUF A;  2RQX A;  4KK7 A;  4DV4 Q;  4UHV A;  3NQI A;  1WTO A;  1EOV A;  3GTJ B;  1IZ6 A;  1XYI A;  1UNS A;  4HSP A;  5FOB B;  1LTA D;  3F1Z A;  3CCR A;  3A55 A;  2BE5 D;  1HHV A;  4F87 A;  2IT1 A;  2EJG C;  2L1B A;  1Z47 A;  1UE7 A;  4O1N A;  5L37 A;  4DR7 Q;  1LT3 D;  1F9P A;  2L15 A;  3KF6 A;  1IBL L;  3LX0 A;  3HKZ G;  4X3S A;  1CA5 A;  2WB1 B;  3CKI B;  1I94 L;  1D5M C;  5CV4 A;  1VQL A;  2X69 A;  1SE8 A;  1X9N A;  1NE3 A;  3WOF A;  2YTY A;  3TBI B;  3DHQ A;  4IUN A;  5NUC A;  2QEX A;  2K5D A;  1EIF A;  4JI8 L;  4DV2 Q;  4B3S Q;  4LF7 L;  1KRS A;  4A93 G;  4DAY A;  3E6Z X;  1HNX L;  4ODG A;  2N49 A;  4HID A;  4JI3 L;  4C3I H;  3IFT A;  3MWY W;  4O2D A;  4ZKB B;  1EIH A;  1Q46 A;  3C1E A;  3K81 C;  4GN4 B;  5E1F A;  4A3I H;  1STY A;  1PV4 A;  4A3L H;  2NTT A;  1E1T A;  4DA2 A;  2A6H C;  5HGT A;  1C8C A;  2HQL A;  3J81 E;  5ISR A;  3VR5 A;  2UXB L;  3TP8 A;  1X3Q A;  2WIN B;  3CPW A;  3U4V A;  3HOV B;  4RKL A;  1EU4 A;  2G9H D;  4GKJ L;  4DK3 C;  3E9I A;  2DUD A;  3GTK H;  3HP3 A;  3EFX D;  1JJC B;  1PTO C;  2NB0 A;  2JA6 G;  1HR0 W;  2FXQ A;  4L63 B;  4HJA A;  4K0K L;  2PI2 E;  5J3B A;  3S2H H;  4RGN A;  2HHH Q;  2DGY A;  4CDF C;  3I4N G;  4KLK A;  2K04 A;  5DM6 3;  1VS0 A;  4PZ8 A;  4OWW B;  5CV5 A;  2D2C C;  5CV9 A;  4XYQ A;  1I4Q A;  2DY8 A;  4L5Q A;  4Y52 H;  5F2D A;  2VQE Q;  4IFD G;  2EY1 A;  3I8Z A;  4PQX A;  3CRL C;  1J8I A;  1R4Q B;  2YYZ A;  4C3H H;  3CD6 A;  4ID6 A;  1PMR A;  1U4M A;  3U9O A;  1OXX K;  1J5E L;  3L3O C;  4IQZ A;  3X3N A;  4C3I B;  3EVQ A;  3H15 A;  1SSO A;  4BY7 H;  4UPA A;  1ASZ A;  2L5T A;  4RWS C;  4A3I B;  2AKW B;  1PRT C;  2ATW A;  1IL2 A;  2P5Z X;  1PZJ D;  1TWA H;  3H91 A;  4PV1 C;  2JA8 H;  3T53 B;  1SXT A;  1VQG A;  1V1P A;  4DV0 L;  5EKL A;  1ENC A;  4JI5 Q;  2EOT A;  1IW7 D;  4KD3 A;  3I91 A;  2F0J A;  3G4S A;  2UUB Q;  3GTK B;  5T1I A;  1B4O A;  2F4I A;  2M9V A;  2H1E A;  3K6O A;  5GQO A;  2ICE C;  5ELE A;  1HNW Q;  3GTO H;  3S2H B;  4R4Q A;  2O4X A;  5IYD G;  3OMG A;  4DAV A;  1E0B A;  2NVT H;  2R6G A;  2PZU A;  2NWG A;  4AIM A;  3PGZ A;  2SDF A;  1JMC A;  1A3U A;  1FJG L;  5C4X H;  1U9R A;  1HTL D;  3VA7 A;  3F2C A;  4B9W A;  2BE5 C;  1X3E A;  2VUM G;  1SMX A;  1JB3 A;  2KEE A;  1TS5 A;  1XMQ Q;  3VYS A;  2NVY B;  4C3H B;  1NR2 A;  1QZG A;  2IX0 A;  1SDF A;  2K14 A;  1J9O A;  1KNA A;  1BUV T;  1CKO A;  4KN4 C;  3CC4 A;  4BY7 B;  1EEF D;  1I4H A;  1YJ9 A;  3ITP A;  4DV6 Q;  1HQR D;  4ULL A;  2Z6B A;  1TWA B;  2F0K A;  2QKI C;  2JA8 B;  3D6W A;  2NVX H;  1SEB D;  4X65 L;  3I55 A;  2CQA A;  1PLF A;  3KF8 A;  2EPB A;  4UP8 A;  4CKC A;  3HOU H;  1HA6 A;  1AZQ A;  2WFW A;  4DV4 L;  1FVI A;  1B3A A;  1G6Z A;  1TS3 A;  2CW0 C;  3WWV A;  1LT4 D;  3H3V I;  1HUN A;  1X3P A;  1TY2 A;  3MXN B;  2B63 H;  1TS2 A;  3A7L A;  3SHL A;  2JEB I;  1XPU A;  1AP0 A;  4CDC C;  1JE5 A;  1RDP D;  4F7X A;  5I2Y A;  3J80 L;  4K8J A;  4LF4 Q;  4JV5 Q;  2NVT B;  1PZI D;  3NBI A;  4EVO A;  2F0L A;  2XRS D;  1JB7 A;  4DR7 L;  4IJH A;  1PYW D;  4JOI C;  5C44 G;  5LMN W;  5C4X B;  4DNR B;  2E2H H;  4JI2 Q;  1D2B A;  1ASY A;  1K0S A;  3D4W A;  1I6H H;  3FKI H;  3HG9 A;  4BBR G;  4LNQ A;  1PFN A;  3FPP A;  2F0N A;  1SYD A;  3FVQ A;  1HNZ Q;  4EX5 A;  1W2B A;  4UP7 A;  1PH3 A;  4R9W A;  1ROD A;  3TSS A;  4B3S L;  1LV9 A;  2OQ0 A;  4G7O C;  2LKV A;  1SNM A;  4A3D H;  1PH2 A;  1SND A;  2KQ3 A;  3GO5 A;  3RN5 A;  4DR4 L;  1CZG A;  4H02 A;  3M7N A;  1B7Y B;  2ICI A;  4FF4 A;  4CJ1 B;  3ULP A;  2NVX B;  3UI2 A;  1U0L A;  5GAG C;  1EWI A;  4DR3 Q;  1A2U A;  1ZYR C;  3HOU B;  1D1K A;  4LFA L;  2F0W A;  1CFM A;  1PYS B;  4IPH A;  1Y8P B;  4RHR A;  5C4Z A;  4A3J G;  2A19 A;  2B63 B;  3S1M H;  3ND8 A;  2ZJP A;  5DEH A;  3KFU A;  3BZK A;  4FXK C;  3PF5 A;  5FO7 B;  3K57 A;  5ELO A;  1SNQ A;  3OHX C;  3H3V H;  1TT2 A;  1O80 A;  2HHH L;  1E22 A;  2B2V A;  1N9W A;  3KDF A;  3JAM c;  2PCF B;  1HH2 P;  5M3F G;  2TMP A;  5FK9 C;  4Y7N H;  2E2H B;  1H9R A;  3FKI B;  2NBF A;  1BBX C;  2KBN A;  3JAM i;  2CVR A;  1EY7 A;  2MUY A;  2B39 A;  3HOX G;  1H9S B;  5FJ8 H;  3GTQ H;  3FEW X;  4NPS A;  3TDQ A;  3AB9 A;  2EYF A;  2KHI A;  4HJ8 A;  2O5J C;  4A3D B;  4LF8 Q;  1VQ8 A;  1LTG D;  4U68 A;  3Q6S A;  3SE0 A;  3HKZ E;  4JI0 Q;  2Q2T A;  5BN5 A;  4DNT B;  1EUJ A;  2EXZ A;  1G6P A;  2H4O A;  4JI5 L;  3PF4 A;  4C1N K;  3RN2 A;  1P8L A;  1LLR D;  4F8M A;  5C0X H;  1WD0 A;  2UUB L;  4FF1 A;  1PH8 A;  2PZT A;  1S3O A;  1E1O A;  5GAH C;  3DLL A;  2LXK A;  4DR6 Q;  5JJZ A;  4J6H A;  3S1M B;  1U5K A;  2JSO A;  1IBM Q;  5ELN A;  1WTV A;  2RVL A;  3PO3 H;  1HNW L;  2FMM A;  4JI1 Q;  1TWC H;  2SOB A;  2F0T A;  3TN2 A;  3K80 C;  1HCZ A;  1QVC A;  1SFO H;  1C0A A;  5M3M H;  3M3Y H;  1JC7 A;  4KHZ A;  1XMQ L;  4DNI A;  2OQK A;  5I2X A;  3CCV A;  2F0I A;  2LS0 1;  1HRJ A;  2KEC A;  1X6O A;  3CU7 A;  2I0Q A;  3GTQ B;  1PFB A;  3HOW B;  3HOZ G;  1GM5 A;  1TVX A;  5HGQ A;  3OIQ A;  3K7U C;  4PNY A;  1IYJ B;  3GTM H;  1K8M A;  1I50 H;  4DV6 L;  4C3J H;  4L5T A;  1H9K A;  4HIM A;  1K3R A;  4GOP A;  1VQI A;  4IFD J;  5IP9 H;  1YNJ C;  2FFK B;  2NUC A;  1FNV A;  3OWF A;  4DN4 M;  4LAA A;  4DR1 Q;  1YJN A;  1SMY D;  1B9N A;  3ERQ A;  2MO1 A;  4KHV A;  5HY6 A;  3A8J E;  3EN2 A;  3PO3 B;  2EY6 A;  5C3X A;  5FO8 B;  4KTA A;  3I7F A;  2JEA I;  4DXG A;  1MSG A;  2D5D A;  3NXW A;  1EQR A;  4LF4 L;  1TWC B;  4JV5 L;  5KYI A;  4IPG A;  1SE2 A;  1JOQ A;  1JT8 A;  3NK9 A;  3MHB A;  2CQO A;  1SFO B;  5E4X A;  4N8X 1;  1LTI D;  1IXR A;  3NUC A;  2LFN A;  4MN3 A;  2E75 C;  1A3T A;  5LMU L;  4JI2 L;  5M3M B;  3EIV A;  3PO2 G;  2WKC A;  1GUS A;  3M3Y B;  4RGM A;  3PUZ A;  1ILP A;  5KIX A;  2R93 H;  1HNZ L;  2B2T A;  4OON A;  5FLM G;  1WCM H;  4JPB W;  1JOO A;  2R7F A;  4OX9 Q;  5BN4 A;  2R92 G;  2K01 A;  1YNN D;  2XN9 C;  3HRZ C;  4DPG A;  4E6I A;  3SK6 A;  2BDN A;  1H9J A;  4A3F G;  3GTM B;  3DEP A;  1Y8N B;  1F9S A;  1I50 B;  2JA9 A;  4C3J B;  1TII D;  3I70 A;  3AFQ A;  1WOC A;  2JN4 A;  2B2U C;  4DR3 L;  2EJM A;  5EBC A;  4GKJ Q;  4YCV A;  1XTD A;  1JR0 D;  1D5X C;  3KOJ A;  2HDL A;  2HCC A;  5CBE E;  3GTG H;  4XT1 B;  4IZ8 A;  5A2Q L;  4XYO A;  1BQQ T;  4XQN A;  3CPF A;  4ZKC B;  3J80 E;  1PFS A;  1L1O C;  3EBE A;  3P1H A;  3NTH A;  3KLW A;  1JWM D;  1M4V A;  2ZXO A;  3VA5 A;  2J0T D;  4RAU C;  4B3M Q;  2SNM A;  4C2M H;  1G91 A;  4UY8 C;  2CH4 A;  1IYU A;  2R93 B;  4A76 A;  1WCM B;  4OWX B;  3T1Y Q;  4ABN A;  5H1S E;  2A6E D;  2HD3 A;  1L1O A;  2EYL A;  1HTP A;  1M8A A;  3S1Q H;  2WB1 G;  2F1M A;  3UDG A;  2JXM B;  1STN A;  4MZ9 A;  1EZ6 A;  1EYD A;  4R4O A;  4LF8 L;  1Q8I A;  2EYM A;  1ZXT A;  4JI0 L;  4OEM B;  4KN7 C;  3F8T A;  1MGS A;  4POG A;  1WTX A;  1JE4 A;  2MPM A;  1SE3 A;  3JC6 6;  3ZYY X;  2CFM A;  1EWH A;  1QVF A;  3GTP H;  5LHY 1;  1NBW A;  2YTV A;  3GTG B;  1R4P B;  5IYC G;  2MO0 A;  3IFD A;  1QNK A;  2X6G A;  4DV5 Q;  4XXE A;  2Z0S A;  2R61 A;  3Q8D A;  1NNX A;  2DJF C;  4JI1 L;  1CQV A;  1SMY C;  3RUZ A;  2OWO A;  3RZO H;  5DLQ E;  2PMZ E;  1CA6 A;  2L11 A;  1MSH A;  5M9O A;  5JVH 3;  1KHI A;  1A15 A;  2JK8 A;  4XQJ A;  2ALY B;  1VQD A;  4LW1 A;  3S1N H;  5JJK A;  2QEJ C;  3S2D B;  5IWA Q;  1HZC A;  4MHE A;  4OWT B;  5I9O A;  3L7Z C;  3S1Q B;  4JK1 C;  1FNW A;  1K9M C;  3RNU A;  3PIO 3;  1EIG A;  1BCP B;  5CV6 A;  1K0R A;  4UDU C;  1ENA A;  2OEO A;  5IGD A;  1E2W A;  2VS1 A;  5IE8 A;  2F0M A;  1I5F A;  1YNN C;  2YTX A;  1CZW A;  1XX8 A;  4IUU A;  2F0G A;  3A8I E;  1PH9 A;  5KNB A;  4J1M A;  1EU3 A;  1C48 A;  4KJO A;  2IJ0 A;  1BF4 A;  5EAY A;  4DR1 L;  2OTJ A;  1D5Z C;  3F2U A;  4GLX A;  3GTP B;  2VZA A;  5I6Y A;  1X32 A;  1HZB A;  4LUV A;  4BXX H;  4OIJ A;  2EDG A;  4A3K H; 
#chains in the Genus database with same CATH homology
 1CT1 D;  4RCN A;  1O7Y A;  4DK1 A;  2F0E A;  3P75 A;  3RZO B;  2F0P A;  1FR3 A;  4CKE A;  5C3W A;  4MIU A;  3MXU A;  3C46 A;  1DON A;  3S1N B;  3A7A B;  2E74 C;  1F2M A;  1TKW B;  3FRP B;  4ILW A;  4G57 A;  5EKI A;  3BVM A;  3PIP 3;  1NSN S;  2A6E C;  3J7A F;  3BDL A;  4QB4 A;  2ID0 A;  5JEA H;  2I46 A;  2N88 A;  3NTI A;  5A35 A;  2M2L A;  4ME5 A;  1JWU D;  3NP8 A;  3LWU A;  1K8O A;  2F0O A;  3VR2 A;  4A3K B;  1UUP A;  1STH A;  4L6T B;  5C5M A;  1CQF A;  4CJ2 C;  2AQ3 B;  1GHK A;  1G8Z D;  2JA5 B;  2KCC A;  2Z4I A;  3M4Y A;  4IFD I;  3KBG A;  4OGQ C;  1QCB D;  1B1Z A;  5J22 A;  1SYF A;  1IKL A;  5BN3 A;  3I4L A;  4CBV A;  1RJT A;  4BWG B;  1QWY A;  2Q8T A;  2RSN A;  1JOK A;  2C9O A;  1PXU A;  4DU9 A;  4A3G B;  5ELF A;  1JWS D;  1PDQ A;  3E0J A;  3K0Y A;  5C4J B;  1TR5 A;  4HCE A;  2OF1 A;  4TSS A;  5EGT A;  3RLF A;  3HS0 C;  2LY7 A;  2FJ2 A;  3OSO A;  2AWN A;  2A5H A;  2PW7 A;  2KJX A;  4PMC A;  5A2Q E;  3Q0A A;  1VF5 C;  4RA8 A;  1PTO H;  3QJY A;  5K5P A;  2V4D A;  4EQP A;  4ZUI A;  2WKD A;  2F0Q A;  3HKZ B;  1WVL A;  3EA6 A;  5FLX L;  2KA7 A;  4IFD H;  4G7Z C;  4FF2 A;  3BYT B;  2OT2 A;  2K05 A;  1A2T A;  1WTW A;  4NKL A;  3TZU A;  1DOL A;  3QG1 A;  4KY5 A;  4CJ0 B;  1AW7 A;  3V2T A;  2D62 A;  2PO4 A;  4U67 3;  4TKO B;  3DEO A;  1EEI D;  3A8K E;  3URY A;  1Q90 A;  2NN6 G;  3DXJ C;  3OWE B;  2PPB C;  2JA6 B;  1H9S A;  4FP5 D;  5K36 G;  5AFW A;  3SXH A;  3GTO B;  5ELB A;  1PTO B;  1MI2 A;  4OL7 A;  2K28 A;  1EQT A;  1Q3L A;  1EY6 A;  2KCN A;  4WOR A;  1CM9 A;  5J39 A;  3R93 A;  1FD7 D;  4OO1 G;  2KED A;  3VYT A;  1EY9 A;  3SDZ A;  2EVB A;  3BVG A;  1DOM A;  1S5D D;  1AN8 A;  3PUX A;  1OO9 B;  3T16 A;  4HED A;  2B2V C;  1PRT B;  1CHP D;  1MD2 D;  1BNZ A;  1W6K A;  2SNS A;  3I3C A;  4DGZ A;  3BDC A;  1QNU A;  3IL8 A;  3LNN A;  3FMC A;  1IW7 C;  3Q22 A;  4HMJ A;  2EYO A;  3I72 A;  1QE6 A;  2K6A A;  3KLS X;  3BG3 A;  2WAC A;  1V8Q A;  4J8Q A;  4EQO A;  1I6H B;  1UAP A;  3Q24 A;  2VUM B;  2FHT A;  4X3U A;  3I90 A;  3VR3 A;  3LWE A;  1QB5 D;  1GUT A;  1EY4 A;  4RGT A;  1ET6 A;  1F2L A;  2KHS A;  1S5C D;  4QCL A;  2ZT9 C;  4ZRZ A;  4CGY B;  4KD4 A;  3MA2 B;  1BDO A;  4BS9 A;  1XTC D;  1EY5 A;  5IOC A;  3M4O B;  3M85 A;  2XVS A;  1RKN A;  1SNO A;  1WTQ A;  4NMZ A;  3KBX A;  1I6V C;  1OXT A;  5JOB A;  3TME A;  1B50 A;  1KNE A;  4IAL A;  4H0L C;  2HCI A;  1TWH B;  4R8I A;  1ENF A;  3K5N A;  3K5M A;  5C44 B;  4K8I A;  4Y7N B;  2IWH A;  1LTR D;  1GJX A;  4BBR B;  3GD7 A;  2IPK D;  1DOK A;  1ESF A;  3C3L A;  1EQV A;  1S5F D;  4IN3 A;  1ZEQ X;  5HUR A;  3SK4 A;  2IX1 A;  2XIW A;  4LK1 C;  5M5Y B;  1Z6H A;  4FVM A;  2PMZ B;  3GV6 A;  1S5E D;  2N55 A;  3S15 B;  3C1F A;  2Z4H A;  3CHB D;  2WP8 J;  1BCP F;  2MJ8 A;  5KRU A;  4A3J B;  3AMU A;  2B2T C;  2B8G A;  2K5W A;  1HA5 A;  1EL0 A;  4M1U B;  1QOH A;  1KDB A;  2PQE A;  3T56 B;  1ILQ A;  2EZV A;  3NSW A;  5M3F B;  1LT6 D;  5T1G A;  4X3T A;  1BO0 A;  2L55 A;  3BZD B;  1EY0 A;  2DNE A;  4TQU S;  5FLX E;  1Q1B A;  4UAI A;  3H94 A;  1EOT A;  5LL6 X;  3D4R A;  1ONL A;  1SJE D;  3HOX B;  2DNC A;  3MXP A;  3WOE A;  1O78 A;  3PUW A;  3P20 A;  3R2I A;  2NVQ B;  3TP7 A;  1UEA B;  4V0B A;  4Z9C B;  3K5O A;  3MVV A;  3QIA A;  2D9U A;  2KOL A;  2Z1C A;  4FO2 A;  4TRD A;  4FF3 A;  4L8J A;  1KAA A;  2XWJ B;  1WTP A;  3RMH A;  3D31 A;  1WD1 A;  2F0F A;  1PFM A;  4C56 C;  4NW2 A;  1Q12 A;  1G2T A;  4DFA A;  1KTK A;  1RTO A;  2MP1 A;  4OHJ A;  1HFN A;  1F2Y A;  4O42 A;  4I7Z C;  1JCK B;  4LMQ D;  4G4K A;  1CI3 M;  4H7B A;  4HR7 B;  1EYC A;  5D3D A;  2F0U A;  4ZUJ A;  2AUJ D;  1ML0 D;  1EY8 A;  3PUY A;  1EYA A;  5C5L A;  1Y69 U;  3ND9 A;  3HOZ B;  3D8G A;  5CC4 A;  2K1B A;  5IOD A;  3V96 A;  3K5L A;  4KY6 A;  4IUR A;  3D6C A;  4ZYS A;  2ZXR A;  3GTL B;  2J4X A;  1Y8O B;  1LTT D;  3DWQ A;  4QMG A;  1S5B D;  1F9Q A;  4DK0 A;  1O7Z A;  3VR6 A;  3FPU B;  1SYB A;  5IGB A;  1PZK D;  3KK7 A;  1EZ8 A;  2IX3 A;  4HTH A;  4C2M B;  3MZ5 A;  1A6X A;  2RKS A;  1RF2 D;  1G2S A;  5COR A;  3PO2 B;  2XNA C;  2RA4 A;  3H6M A;  4G7H C;  3DM1 A;  1IYV A;  1U4P A;  4IUP A;  1SYE A;  3SVM A;  2R92 B;  5C0X J;  1BOS A;  2QCP X;  3KUP A;  3Q23 A;  4A3F B;  3TP6 A;  4Q0F A;  2K5Q A;  2ZXP A;  1IKM A;  1IL8 A;  3OOC A;  2ENB A;  2HQE A;  1CHQ D;  1W6J A;  4C3I G;  2J7Z A;  3L9A X;  3TP5 A;  2IW3 A;  2PYK A;  1FYC A;  3DMU A;  3K59 A;  2EJF C;  1JOR A;  1E2Z A;  1TU2 B;  3IKJ A;  3RZD B;  5EPL A;  2KVM A;  2EY2 A;  3NHH A;  2XWB B;  3JAM L;  4XQQ A;  1JIC A;  4RH6 A;  1LT5 D;  2PZW A;  3SK8 A;  1SNP A;  5EBD A;  4X3K A;  1HFG A;  5G3L F;  3P7J A;  3V05 A;  3H09 A;  1PTO F;  1EWC A;  4Q5V A;  2DN8 A;  2OXP A;  2Q8R E;  4BA2 I;  2I07 B;  3FDT A;  2A73 B;  4R8N A;  1Q1E A;  1OXU A;  3VR4 A;  4C3H G;  4K6D A;  4GZY C;  1FGB D;  3QOJ A;  2QF7 A;  3WDN A;  2MHV A;  4KI0 A;  2VXW A;  1GUN A;  1GUW A;  4FYD A;  4HAE A;  4EQN A;  1VMC A;  1F77 A;  1I4X A;  5IGC A;  3PUV A;  2CW0 D;  2RSO A;  1PRT F;  3KLS A;  1NAP A;  5DNF A;  3DWA A;  4K2L A;  5JPM C;  2E2D C;  1F9R A;  4F88 A;  5ELD A;  1VCI A;  1I4R A;  3I73 A;  2L12 A;  2BCO A;  2E76 C;  2K03 A;  3MTS A;  2E2I B;  1D1I A;  4H44 C;  4M8A A;  3RD4 A;  1ICW A;  3QO2 A;  3GV3 A;  1CK1 A;  1MBY A;  2AQ2 B;  3T13 A;  4K14 A;  3MXN A;  4HSV A;  4XIG S;  4DAP A;  1T5E A;  2EYP A;  1AEX A;  1DJR D;  3SR1 A;  3T4A C;  3CRK C;  3U9S A;  5CR3 A;  1HUM A;  5D65 A;  1KDA A;  1OXS C;  4IUT A;  2BOS A;  3NWT A;  5C6A A;  1SE4 A;  1AFP A;  1ZYR D;  4HCS A;  4CKB A;  5DAU A;  3SEB A;  1HPC A;  1RCV D;  3MAQ A;  2DY7 A;  1GHJ A;  3EQL C;  1S4Z A;  3EJI A;  4KKU A;  4NP5 A;  2CHB D;  4A3E B;  5CV7 A;  3NE5 B;  1QG7 A;  1RTN A;  3R2T A;  5IGF A;  1VDZ A;  1BR9 A;  2O5I C;  3I4M B;  3N52 A;  2NTS A;  4A93 B;  4K5X A;  2F3W A;  5E4W C;  5I6W A;  4RHS A;  4KV6 A;  1U4L A;  3NPP A;  1DXM A;  3CQZ B;  4KKS A;  5M5X B;  1II3 A;  5DM7 3;  2K33 A;  2O2L D;  3BDO A;  1NUC A;  2NN6 I;  1R9T B;  1QIL A;  3QWN A;  3S16 B;  4JBW A;  4RGO S;  3K58 A;  4ZAI A;  2R3Z A;  3D4D A;  3G7L A;  3I4N B;  4KY7 A;  2Y0S B;  1I3Q B;  1CTM A;  3W3A A;  1STA A;  1ESR A;  5CMD A;  2F03 A;  1LTB D;  3R3O A;  2L9H A;  2WII B;  3H3V C;  5IGG A;  2TSS A;  4OO1 I;  1A3V A;  1TQO A;  1VMP A;  3VYR A;  1TS4 A;  4N9T A;  3GQB A;  4XTC S;  4IUV A;  2A68 D;  1V1P B;  5D3I B;  3IAY A;  1KLU D;  3D3R A;  1NR4 A;  4K2K A;  5E3F A;  1STE A;  5CGK A;  2Z8L A;  4NDX A;  1U4R A;  4XDX A;  3MFG A;  1OXV A;  3TZD A;  1HQM C;  1YNJ D;  3NQT A;  5C3E B;  1Y1W B;  4PMW A;  2NN6 H;  1AZP A;  1SYC A;  5COY A;  5K36 H;  5IT9 L;  5C0X I;  1V43 A;  1STB A;  1B53 A;  1ET9 A;  4WRD A;  5C0X G;  1LO5 D;  3JAM E;  4CHT B;  1WTR A;  3X3M A;  3OPO A;  2RDG A;  5I9P A;  4A3M B;  1DZ1 A;  4DF7 A;  2JE6 I;  5KNC A;  5JEA J;  3S1R B;  4OO1 H;  4K6L A;  2JA7 B;  1EFI D;  1B9M A;  1BCP D;  4AYB B;  4B08 A;  1LTS D;  1B2T A;  3OIP A;  4ZLT F;  2BDO A;  1E2V A;  4IUQ A;  3AU7 A;  3PMF A;  2JYO A;  4KMU C;  1SYG A;  4HN7 A;  1I4P A;  3E5S A;  1LAC A;  2Q8I B;  1DD2 A;  2F0D A;  2X6L A;  4C3J G;  2HDM A;  1RD9 D;  3C2P A;  3N6R A;  3G6J B;  3DWP A;  2A74 C;  2K32 A;  3J7A V;  2F0V A;  2RDF A;  1TWF B;  4FNF A;  5ELC A;  3HEJ A;  3KLR A;  5TSS A;  5KGU A;  1FNU A;  4I65 A;  4P2C B;  4RKB A;  1KLG D;  1RHP A;  5EPJ A;  1KAB A;  1SJH D;  5EJW A;  3O13 A;  4QUC A;  4N9P A;  2VB3 X;  2F0H A;  5D14 A;  2L0C A;  3BYY B;  3BS1 A;  2A68 C;  5J1Z A;  4S3S A;  2B8F A;  3S9W A;  1V1O A;  2A69 D;  3OMC A;  2LMC B;  4FXG C;  3J81 L;  2AUK A;  2GA4 B;  4QF4 A;  5M5W B;  1TWG B;  4WFN 3;  4DXF A;  1KDC A;  2EYH A;  4V19 0;  5LL6 S;  4FXD A;  2C5C A;  4HMI A;  3S17 B;  4BY1 B;  3S14 B;  1G29 1;  1L0X B;  4ZK9 B;  3PV0 A;  5CV8 A;  3VYU A;  1Z7T A;  1SAP A;  2XRQ D;  1JQY D;  3NBH A;  1NCV A;  3MFY A;  2EY5 A;  4KJN A;  1O7L A;  2IL8 A;  3OW7 A;  3W2D A;  4QIW B;  4BBS B;  1B44 D;  1VF7 A;  1GOZ A;  1TY0 A;  2NYZ D;  4BA1 I;  3HZX A;  3ERO A;  1LAB A;  1F2Z A;  5JVG 3;  4H13 C;  2FIN B;  1HXY D;  4K5W A;  2QIL A;  3K7A B;  4A3B B;  2E2J B;  5FO9 B;  1BCP C;  2K7V A;  1XWE A;  2PNR C;  2EYJ A;  1K83 B;  1DYQ A;  2SEB D;  2F3V A;  3T51 B;  4RFB A;  5CYU A;  2XSC A;  1T5X D;  1STG A;  1C4Q A;  5KEE A;  3A54 A;  3NWS A;  4B9X A;  1IHZ A;  2BA0 A;  3NTK A;  1GUO A;  1GXD C;  5C4H A;  4WJW A;  5IIF A;  3HOY B;  1DM0 B;  4EGV A;  5EKK A;  5KYL A;  3QOL A;  1GUG A;  3J7Y W;  2BA1 A;  4OIK A;  2B2W C;  3MEH A;  2B2U A;  2R7Z B;  4RCO A;  1DCZ A;  4C1N I;  1Y1V B;  4PMB A;  5EPK A;  3GP7 A;  2JP1 A;  2B2Y C;  2A6H D;  1I4G A;  4YIJ A;  2B2W A;  2G9D A;  2WV6 D;  5IGE A;  5G3L D;  1BXT A;  2A69 C;  2RDH A;  1PTO D;  4LJZ C;  3SK5 A;  2M00 A;  2WAQ B;  2B2Y A;  5IT9 E;  3DUZ A;  2RBM A;  2EE1 A;  5JAV A;  2HUG A;  2QDB A;  3BVZ A;  2VB2 X;  1L0Y B;  2AQ1 B;  1QJO A;  1XXG A;  3QB3 A;  5JPN C;  4K5V A;  3R8B A;  1SBB B;  5KND A;  2VNU D;  2NZ1 D;  4ZQ3 A;  4KKT A;  5I4D A;  1PRT D;  1D6E C;  3HGB A;  1SNC A;  2KUM A;  3ONA B;  5FKA C;  2MGS A;  2YU9 B;  2AWO A;  4XT3 B;  2L4N A;  2FMC A;  3M7G A;  5CBA E;  2PW5 A;  5EQ0 A;  3H0G B;  3A56 A;  5JEA G;  3MC0 B;  1ZKO A;  2F0S A;  3MXG A;  1H9M A;  4QUF A;  2RQX A;  4KK7 A;  3NQI A;  1WTO A;  3GTJ B;  1XYI A;  1UNS A;  4HSP A;  5FOB B;  1LTA D;  3A55 A;  2BE5 D;  1HHV A;  4F87 A;  2IT1 A;  2EJG C;  2L1B A;  1Z47 A;  4O1N A;  1LT3 D;  1F9P A;  3LX0 A;  4X3S A;  1CA5 A;  2WB1 B;  3CKI B;  1D5M C;  5CV4 A;  2X69 A;  3WOF A;  3TBI B;  3DHQ A;  4IUN A;  5NUC A;  2K5D A;  4DAY A;  3E6Z X;  4ODG A;  3IFT A;  3MWY W;  4ZKB B;  1EIH A;  3C1E A;  5E1F A;  1STY A;  2NTT A;  4DA2 A;  2A6H C;  5HGT A;  1C8C A;  3J81 E;  5ISR A;  3VR5 A;  3TP8 A;  1X3Q A;  2WIN B;  3HOV B;  4RKL A;  1EU4 A;  2G9H D;  3HP3 A;  3EFX D;  1PTO C;  2NB0 A;  4L63 B;  4RGN A;  2K04 A;  5DM6 3;  5CV5 A;  2D2C C;  5CV9 A;  4XYQ A;  1I4Q A;  2DY8 A;  5F2D A;  4IFD G;  2EY1 A;  3I8Z A;  4PQX A;  3CRL C;  1J8I A;  1R4Q B;  2YYZ A;  4ID6 A;  1PMR A;  1U4M A;  3U9O A;  1OXX K;  3L3O C;  4IQZ A;  3X3N A;  4C3I B;  3EVQ A;  1SSO A;  2L5T A;  4RWS C;  4A3I B;  1PRT C;  1PZJ D;  3H91 A;  4PV1 C;  3T53 B;  1SXT A;  1V1P A;  5EKL A;  1ENC A;  2EOT A;  1IW7 D;  4KD3 A;  3I91 A;  2F0J A;  3GTK B;  5T1I A;  1B4O A;  2F4I A;  2M9V A;  2H1E A;  3K6O A;  2ICE C;  5ELE A;  3S2H B;  2O4X A;  3OMG A;  4DAV A;  1E0B A;  2R6G A;  2PZU A;  2NWG A;  2SDF A;  1A3U A;  1U9R A;  1HTL D;  3VA7 A;  4B9W A;  2BE5 C;  1JB3 A;  2KEE A;  1TS5 A;  3VYS A;  2NVY B;  4C3H B;  1NR2 A;  2IX0 A;  1SDF A;  1J9O A;  1KNA A;  1BUV T;  4KN4 C;  4BY7 B;  1EEF D;  1I4H A;  3ITP A;  1HQR D;  4ULL A;  1TWA B;  2F0K A;  2QKI C;  2JA8 B;  3D6W A;  1SEB D;  2CQA A;  1PLF A;  3KF8 A;  2EPB A;  4CKC A;  1HA6 A;  1AZQ A;  1B3A A;  1G6Z A;  1TS3 A;  2CW0 C;  1HUN A;  1LT4 D;  1X3P A;  1TY2 A;  1TS2 A;  3A7L A;  3SHL A;  2JEB I;  1AP0 A;  1RDP D;  4F7X A;  5I2Y A;  3J80 L;  4K8J A;  2NVT B;  1PZI D;  3NBI A;  4EVO A;  2F0L A;  2XRS D;  1PYW D;  5C4X B;  4DNR B;  1D2B A;  3D4W A;  3HG9 A;  1PFN A;  3FPP A;  2F0N A;  1SYD A;  3FVQ A;  4R9W A;  1ROD A;  3TSS A;  1LV9 A;  4G7O C;  2LKV A;  1SNM A;  1SND A;  2KQ3 A;  3GO5 A;  1CZG A;  3M7N A;  2ICI A;  4FF4 A;  4CJ1 B;  2NVX B;  3UI2 A;  1A2U A;  1ZYR C;  3HOU B;  1D1K A;  2F0W A;  1CFM A;  1Y8P B;  4RHR A;  5C4Z A;  2B63 B;  3ND8 A;  5DEH A;  4FXK C;  5FO7 B;  3K57 A;  1SNQ A;  3OHX C;  1TT2 A;  1O80 A;  2B2V A;  2PCF B;  2TMP A;  5FK9 C;  2E2H B;  1H9R A;  3FKI B;  2NBF A;  1BBX C;  2CVR A;  1EY7 A;  2MUY A;  2B39 A;  1H9S B;  3FEW X;  3TDQ A;  3AB9 A;  2EYF A;  2O5J C;  4A3D B;  1LTG D;  4U68 A;  3Q6S A;  3SE0 A;  5BN5 A;  4DNT B;  2EXZ A;  2H4O A;  4C1N K;  1LLR D;  4F8M A;  5C0X H;  1WD0 A;  4FF1 A;  2PZT A;  5JJZ A;  4J6H A;  3S1M B;  2JSO A;  1WTV A;  2RVL A;  2FMM A;  2SOB A;  2F0T A;  3TN2 A;  1HCZ A;  1JC7 A;  4KHZ A;  5I2X A;  2F0I A;  2LS0 1;  1HRJ A;  2KEC A;  3CU7 A;  3GTQ B;  1PFB A;  3HOW B;  1TVX A;  3OIQ A;  4PNY A;  1K8M A;  1H9K A;  4IFD J;  1YNJ C;  2FFK B;  2NUC A;  1FNV A;  3OWF A;  4DN4 M;  4LAA A;  1SMY D;  1B9N A;  3ERQ A;  4KHV A;  3A8J E;  3PO3 B;  2EY6 A;  5C3X A;  5FO8 B;  4KTA A;  2JEA I;  4DXG A;  1MSG A;  2D5D A;  3NXW A;  1TWC B;  5KYI A;  1SE2 A;  1JOQ A;  3NK9 A;  3MHB A;  1SFO B;  5E4X A;  1LTI D;  3NUC A;  4MN3 A;  2LFN A;  2E75 C;  1A3T A;  5M3M B;  2WKC A;  1GUS A;  3M3Y B;  4RGM A;  3PUZ A;  1ILP A;  5KIX A;  2B2T A;  1JOO A;  5BN4 A;  2K01 A;  1YNN D;  2XN9 C;  3HRZ C;  4E6I A;  3SK6 A;  2BDN A;  1H9J A;  3GTM B;  3DEP A;  1Y8N B;  1F9S A;  1I50 B;  4C3J B;  1TII D;  3I70 A;  2B2U C;  2EJM A;  5EBC A;  1JR0 D;  1D5X C;  2HDL A;  2HCC A;  5CBE E;  4XT1 B;  4IZ8 A;  5A2Q L;  4XYO A;  1BQQ T;  4XQN A;  4ZKC B;  3J80 E;  3P1H A;  3NTH A;  1JWM D;  3VA5 A;  1M4V A;  2ZXO A;  2J0T D;  4RAU C;  2SNM A;  1G91 A;  1IYU A;  2R93 B;  1WCM B;  4ABN A;  2A6E D;  2EYL A;  1HTP A;  1M8A A;  2F1M A;  2JXM B;  1STN A;  1EZ6 A;  1EYD A;  1Q8I A;  2EYM A;  1ZXT A;  4KN7 C;  1MGS A;  1WTX A;  1JE4 A;  2MPM A;  1SE3 A;  3ZYY X;  1EWH A;  5LHY 1;  3GTG B;  1R4P B;  3IFD A;  1QNK A;  2X6G A;  4XXE A;  2R61 A;  1CQV A;  1SMY C;  3RUZ A;  1CA6 A;  2L11 A;  1MSH A;  5M9O A;  5JVH 3;  1A15 A;  4XQJ A;  2QEJ C;  3S2D B;  4MHE A;  5I9O A;  3L7Z C;  3S1Q B;  4JK1 C;  1FNW A;  3PIO 3;  1EIG A;  1BCP B;  5CV6 A;  4UDU C;  1ENA A;  2OEO A;  5IGD A;  1E2W A;  2F0M A;  1YNN C;  1CZW A;  1XX8 A;  4IUU A;  2F0G A;  3A8I E;  5KNB A;  4J1M A;  1EU3 A;  1C48 A;  4KJO A;  2IJ0 A;  1BF4 A;  1D5Z C;  3F2U A;  3GTP B;  5I6Y A;  1X32 A;  4OIJ A;  2EDG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...