3MZ5A

Crystal structure of staphylococcal nuclease variant delta+phs l103a at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEAAVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Cavities determine the pressure unfolding of proteins.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2010-05-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3mz5A00
5KRUA 3SK8A 2KHSA 3MVVA 5CV6A 2EYHA 1SNMA 3DMUA 2RBMA 4R8NA 2F0DA 1JORA 4HMJA 2F0PA 3LX0A 4EQOA 1SYEA 4IZ8A 3SK6A 1SNCA 3QOJA 5I6YA 4KTAA 1JOKA 3BDCA 2RDFA 4N9PA 2PQEA 3EVQA 1AEXA 4HMIA 4KV6A 1A3TA 2PZUA 3NP8A 2EYPA 1STGA 2F0EA 2PW5A 1SNPA 3OMCA 4ID6A 3SK5A 5C3XA 5J22A 1F2MA 4K5VA 4IALA 5NUCA 5C4HA 1IHZA 1A3UA 1SNDA 2ENBA 2OXPA 3S9WA 1EZ6A 2WACA 2F0QA 1ENAA 1TT2A 1A3VA 5J39A 4RKLA 3C1EA 2F0SA 5I9PA 5C3WA 4NKLA 3VA5A 5IGFA 3P1HA 5JAVA 4MIUA 3NUCA 3NXWA 5IGCA 5KYLA 4ZUJA 4K2LA 1TR5A 2EY2A 1EQVA 3OWFA 2HQEA 3TP7A 2F0WA 5IOCA 4EVOA 2F0LA 5KIXA 4KY5A 1KDCA 5IGBA 5KYIA 2NUCA 2EXZA 1STNA 4PMBA 1F2YA 4S3SA 3MXPA 1U9RA 4K14A 4YIJA 4LAAA 5EKKA 4K2KA 5C5LA 4NDXA 5EGTA 5I9OA 4ZUIA 1TQOA 4F8MA 1SNOA 2F0JA 1A2TA 2F0OA 2PW7A 3SXHA 4DGZA 3TP5A 2EYMA 4OL7A 2EY6A 5IGEA 1F2ZA 5HURA 3E5SA 3C1FA 2EYFA 5JOBA 5M9OA 2PZTA 1STHA 2F0UA 3QOLA 4KD3A 3SHLA 3T13A 4ODGA 3T16A 1SYGA 5K5PA 3OMGA 5J1ZA 1KDAA 3SK4A 3V2TA 4WRDA 4H7BA 5IGGA 5KEEA 3MZ5A 4DFAA 1KDBA 4J6HA 3TP8A 4KHVA 4NP5A 5I6WA 3TP6A 2SOBA 5CV7A 3PMFA 2F0IA 4WORA 4EQPA 1EYAA 1NSNS 4ZQ3A 5C5MA 3NK9A 1EY0A 3NQTA 2SNSA 1II3A 5KGUA 2LKVA 5CV8A 2RKSA 4QF4A 4KJNA 3NHHA 2F0VA 1SYDA 3DHQA 1SYBA 5IGDA 1EY6A 1RKNA 2F3WA 4KY6A 4B9XA 4I65A 4K8IA 4PMCA 2F0NA 2PZWA 1EY4A 4IUNA 2F0FA 3OSOA 4K5XA 5EKLA 3RUZA 3P75A 5CR3A 1EY8A 1SNQA 2PYKA 3ERQA 4J1MA 3D4WA 2EY5A 2QDBA 5F2DA 5IIFA 2OEOA 2EYOA 4NMZA 5C4ZA 1STYA 4PNYA 5CV9A 4TRDA 2OF1A 4EQNA 3U9OA 2O4XA 1EY9A 2M00A 3HEJA 3MEHA 3HZXA 2F0GA 2F0MA 4HTHA 4K8JA 4QMGA 2KQ3A 2SNMA 4RKBA 2F0TA 1JOOA 1STBA 1KAAA 5ISRA 3EROA 3SR1A 1STAA 4KY7A 5DAUA 1NUCA 3QB3A 1KABA 2F0KA 1EY5A 4KD4A 3BDLA 4QB4A 2F0HA 3D4DA 5DEHA 4F7XA 3D8GA 5CC4A 4N9TA 4K6DA 5CV5A 5CGKA 1ENCA 2EY1A 5HGTA 5CV4A 1SYCA 4KJOA 5IODA 3D6CA 2F3VA 2EYJA 4DF7A 3ITPA 4G57A 1A2UA 4DU9A 4B9WA 3TMEA 2EYLA 5E1FA 5E3FA 4ME5A 3R3OA 3EJIA 5C6AA 1JOQA 1EYCA 4K5WA 1EY7A 1EYDA 4E6IA 3MHBA 1SYFA 1EZ8A 3H6MA
chains in the Genus database with same CATH superfamily
2R7ZH 3SK8A 3E0EA 1ET9A 1TWHB 1EU4A 2UUCQ 5H1SE 2XTIA 3HOVB 2H1EA 4A3IB 4DNRB 1JOKA 4G4KA 4M8AA 3K59A 2B8FA 5M5YB 2WKCA 1Y8NB 3NBHB 5JPNC 1SNPA 2K6AA 5A2QE 4IOAA 4UHVA 4J15A 1EFID 2OXPA 3OIQA 4RG1A 4A3JB 1VQOA 4DKAC 3I90A 5C3WA 1ICFB 2IHEA 1K3RA 2ICEC 2VQEL 3KK7A 4ZUJA 1GXDC 4JI5Q 2IX1A 4H44C 1PH1A 5IGBA 3S16B 3Q8DA 2EXZA 4RCNA 2TSSA 2K03A 2MNAA 1WFQA 2CW0D 5EKKA 3L2PA 3MAQA 4BBSH 1TS2A 3K6OA 2E75C 2NYZD 3C3LA 2ZTDA 2YU9H 1A2TA 2PW7A 4CJ0B 2E74C 1Q12A 5LL6X 3S1QH 5HGQA 4LFCL 5BR8L 5I4DA 3NWSA 1SMYD 2SNSA 2B63B 2LKVA 3SVMA 3CMAA 1N32L 1IKMA 3FPUB 1LT4D 1LTLA 1ILPA 2EJFC 1SAPA 3G71A 2Q2UA 4B9XA 3H91A 2JA5G 4KI0A 3D4WA 4JVZA 4A3LG 5KNBA 4KLKA 3CAMA 2KHIA 2RCFA 1K3BC 1RODA 4H13C 2K04A 3S1MB 4B3ML 1MI2A 2LXKA 4HTHA 2KQ3A 2L15A 1ZYRD 2ZXPA 3EROA 4RAUC 1G91A 4A4IA 3ICEA 1U5KA 4R4CA 3M4OB 2IY5B 2CH4W 1FNWA 2H5XA 2Q2TA 2QCPX 1O7ZA 4GKJL 2K7VA 2K5WA 4JI2Q 1EL0A 2RSNA 1BCPF 1EEFD 3FKIG 2K01A 1BUVT 3GTMH 4LF9L 3WWVA 4DR3Q 2K5NA 2B2TC 3ULJA 1JB3A 1A62A 3LX0A 2B2UC 1SDFA 3W2DA 1WTVA 4C56C 1M90C 3HOZH 4XYQA 1H9KA 4UP7A 3QOJA 1HUMA 4FO2A 4GN5A 2RDFA 1Q1BA 1A3TA 4GLXA 1F9QA 3FVQA 1X3EA 4A3MH 3S17B 3T53B 2VQFL 4A3KH 1I6HB 2A6HC 1YNNC 3A54A 4A93H 4J8QA 4EGVA 2HHHQ 3MEFA 1D6EC 3I4MH 2AUJD 2TMPA 1TR5A 1DD2A 1EQVA 1XTDA 1BBXC 2VUMG 2F0WA 2E2IH 3J7AV 1SE8A 4R4IA 4LF8Q 3FPPA 4LUZA 2F0JA 3J7ZC 2NVQH 2NZHA 3I4LA 1D7QA 3H09A 3G48A 2EYMA 4A3EG 4JK1C 2XN9C 1YZ6A 1XMQQ 2O2LD 1GUWA 4YCWA 3PIPA 4OONA 3NEMA 1XNRL 5C4XG 3GTLH 3MXNA 1MJCA 4KMUC 2CQAA 1HNZL 3KF8B 2Z0SA 1RKNA 3J7YW 1PFSA 2UXBL 3TZDA 1XX8A 5F2DA 2VB2X 1Q3LA 4CGYB 2K4KA 5IT9L 3NELA 3TQYA 1ILQA 1CZWA 2VY3A 3HGBA 1TWAB 3HOXH 1HQRD 2J4XA 4A3FG 1HA5A 2AWNA 3RN2A 3RNUA 3CPWA 5AJ3Q 1RL2A 3FHWA 3GTPB 4PQXA 4AQYL 1I5FA 4CKCA 5IE8A 1KABA 4POGA 5FO8B 1N34L 1WTWA 4DR4L 3D4DA 2QILA 1S5CD 2SDFA 4ABNA 4QGUA 5M3FG 1BF4A 2UXDQ 5HGTA 5CV4A 1BDOA 1A0IA 4H0LC 2QA4A 1G2SA 3FKIB 1VQ5A 3KF6A 2K1BA 3G7LA 1LTAD 4JI1Q 3OOCA 4IN3A 4DUYL 4LF7L 1HJPA 1SE3A 1W3SA 2VZAA 4LF4Q 4WJ3M 5ELEA 1NY4A 4QUCA 2PZUA 2IT1A 3FRPB 1TWGB 3VR4A 3NENA 2J0TD 1XMOL 3OWEB 2BH8A 5C4HA 4RHRA 2BH2A 4JYAQ 2IX3A 2H4OA 5IYDG 4CDFC 1HPCA 2DJFC 3NE5B 3NSWA 1D1IA 1WTPA 2VUMB 2JA9A 4DAVA 5COYA 4QCLA 3OWFA 2HQEA 2ZJQA 2Y0SG 5IOCA 3I70A 2NUCA 2Q8IB 4PMBA 5EBCA 4K14A 2NVTB 3CRLC 4NDXA 4JG2A 4IUTA 4B3TL 4CDCC 2RCNA 1LLRD 4QY7A 3NBHA 5DM73 2EY6A 5ELFA 2Q8TA 1I4GA 4P72A 2FFKB 4OWXB 1MD2D 4DR1L 1JE5A 3OMGA 5J1ZA 1GM5A 3PIOA 5C4XB 1Y1WH 1KIXA 3Q23A 2KCMA 3J80L 1U4MA 1HNXQ 1OXVA 4X66Q 3R2IA 4FXKC 1FGBD 1VQIA 5E4XA 2R92G 1AH9A 4YWKA 2F0VA 2WIIB 1SYDA 4ILWA 1LACA 4A3GG 3T1HQ 3LGJA 4TVAB 4GKKQ 5JJIA 2BDOA 4K5XA 3J81j 2F0FA 5EKLA 4M1UB 1SNQA 4OEMB 3L3OC 4LFBQ 4A3FB 1LO5D 2BCOA 1M4VA 5A2QL 1CKNB 1K0SA 3W1BA 1W6JA 4X65Q 5DAUA 5M3FB 5ELCA 2A6ED 3AFQA 1EY5A 1XPRA 3TS0A 3BDLA 2R93G 3FEWX 4LUVA 4HN7A 4DV0Q 1HRJA 3MFGA 4DV6L 2NN6I 3ZJYC 1E2VA 4OO1G 3N52A 3A8JE 1B7YB 4C3JG 1WTRA 1SR3A 1J5EQ 4UY8C 1K83H 1HXYD 3KLSX 4IUUA 4BWGB 3EN2A 1I94Q 3C2PA 2EIFA 1EY7A 4N8X1 4BS9A 4DV4L 3S2DB 1Z9FA 3OYYA 2YV5A 3G6JB 4B3RQ 2KBNA 3U4ZA 1PHJA 1JORA 2B8GA 3PUZA 4X3SA 1HA6A 3M4YA 3TS2A 4A3CH 3HOYG 5GAHC 3H0GG 1PFMA 1PXUA 3ZYYX 1STGA 4NXNL 1X3PA 4F88A 1LT5D 2RDGA 2B2YA 1SJHD 2Z1CA 2A8VA 4JI8L 1OO9B 1XYIA 1UE7A 5IYCH 4RKLA 1F9RA 4KN4C 5KYLA 4QUFA 4YWMA 2FMMA 3K7AB 1PTOD 2JA8H 1JQYD 4JV5Q 4K0KQ 1IXRA 1B70B 3MXPA 3MFYA 4FF3A 2XNAC 1W2BA 1UWVA 1FYCA 2VW9A 1YIJA 2FMCA 1SNOA 4HEDA 1JT8A 5IP7H 3IFTA 3TN2A 1WYDA 5CMDA 3EFXD 3AB9A 1L1OC 2NTTA 5IGGA 4CDDC 5KEEA 3PQIA 4BA1I 1WTQA 1IKLA 4HJ9A 1VQAA 3T56B 3TP6A 2R92B 1I3QH 3S15B 1LT6D 1VQGA 4A3GB 1N33L 5IY0A 5GADC 4C3HH 1I4XA 4LF6Q 1NJIC 1ASZA 3BVGA 2UUBQ 1B9MA 4DF7A 2JJQA 1NCVA 2NVYB 4IUQA 3TSSA 4NMZA 5C4ZA 3ULPA 3VDYA 3L9AX 1EIYB 4DR5L 1JC7A 2M00A 3URYA 2F0GA 1OXSC 1WTXA 1CM9A 2R93B 1YEZA 4DR2L 3F2BA 5JEAH 2KEEA 1CA5A 4C3JB 2D62A 4BBRH 3KF8A 2B2YC 1SYCA 3HFZB 2G5DA 2PNRC 4KHPL 3HOWG 2GA4B 5C44G 2WFWA 1LABA 3NBIA 3EJIA 5ELOA 2F0DA 1YNXA 1P16A 1GUGA 4A3BB 1V8QA 1Z6HA 2M9VA 4JPBW 1R9TH 5CV6A 1UNSA 1IBMQ 3HOYB 4WFN3 4BY1H 1F9SA 1SYEA 1CTMA 4IUVA 2E5LQ 3CCRA 3EVQA 3J7A5 4LNQA 2K5QA 2R7ZG 2ASBA 1J6QA 5FLMG 2GN5A 1TWCH 2ZTCA 4HIOA 1IBKQ 1E1TA 3GTJH 5EPJA 2K33A 1RIPA 3K81C 3PUXA 4N8FA 3KBGA 2C9OA 2NBFA 4CJ2C 4RHSA 3W5OA 2D9UA 5C4JB 3BG3A 3DUZA 1QUQB 3OTOQ 4WJ4A 5KIXA 2GVAA 1HNWL 5KYIA 2JSOA 3PO3B 4DV7Q 1MIUA 1HH2P 4Y7NH 3K80C 4FDBA 3CD6A 3CC4A 4CDEC 4F8MA 3SDZA 4IO9A 3S1RH 1F9PA 5FO7B 1CT1D 2B39A 2VNUD 4KD3A 1Q7YC 3BZDB 4BBSG 4WRDA 4H7BA 4LFAQ 1GHKA 2HIVA 1K8OA 1IYUA 3CC7A 1VF5C 1FJGQ 3FP9A 3A5UA 3NQTA 1XWEA 4TSSA 2MFIA 1I4RA 2QGQA 1SYBA 1WTHA 2ZJRA 5IGDA 3DLLA 1PH8A 3HOUH 2BOSA 4DUZL 1KLUD 1I4HA 4AH6A 5IT9c 2UU9L 2EY5A 2QDBA 4JI0L 2CFMA 4G7HC 1S4ZA 1STYA 1X3GA 1K0RA 4I7AA 4FF4A 2BE5D 1QOHA 5FJ8H 5BN4A 2HT1A 2O4XA 1XTCD 1EY9A 2AQ3B 2F0MA 5D3IB 4L5TA 2UUAL 4R4TA 1QVCA 1IBLQ 2NZ1D 2PI2E 3UE1A 1ESRA 1PZID 4IPHA 1U4LA 3D6WA 2LS01 2CWAA 5CC4A 2F52A 2X69A 3MWYW 3D6CA 1RJTA 1VMCA 1PH3A 4KKSA 3C46A 3S1NB 2HDMA 5E1FA 3NTIA 4L63B 4UPAA 5C3EH 1SYFA 4C2MH 2KHSA 2NVXH 1KC8C 2RSOA 1CKNA 4F87A 3CP0A 1I4QA 3D4RA 1IZ6A 1SMYC 4R9WA 1PYSB 5M3MH 1LM0A 4HAEA 1EEID 1NBWA 1GUNA 2O5IC 5J22A 4IURA 5NUCA 1PYBA 3U4VA 1HQMC 1UE6A 2WINB 1A8VA 3HOZG 5JJZA 5KNCA 2AKWB 2CQOA 3BVZA 5M5WH 3BS1A 3PSIA 1G8ZD 2LFNA 2K14A 5LMNQ 1VQKA 3IFDA 4MZ9A 2A74C 3K5OA 4A3MG 5K36H 1BBUA 2QW7A 3GP7A 3I2ZA 4GN4B 2ZXRA 4A93G 1ZYRC 1PH4A 1C48A 3P20A 3SXHA 3TP5A 3L0OA 1HZBA 1HR0W 1B44D 3GTQH 1X32A 3J80c 4J6HA 2JE6I 3ONAB 2Z4HA 2JQOA 5T1GA 1PH5A 1V1PB 4GNXC 1PH2A 2IJ0A 3VYTA 1EQTA 3S1QB 2Q2HA 3J80i 4B08A 2B2TA 5CV8A 2B2UA 2SEBD 1X3QA 2JP1A 1EIFA 3TEHB 4IUPA 2PCFB 2KVMA 4P71A 1Y8OB 3NTHA 3F2CA 3WDNA 3V05A 1K8AC 2C5CA 1TWHH 4L5QA 3T1YQ 1RCVD 1L1OB 2QDLA 5CBEE 4RH6A 2QKIC 2L9HA 3CPFA 3HOVH 4A3IH 3WOFA 4GOPB 5IP9G 1H9RA 3B6YA 4HSPA 5M5YH 4OX9L 2EDGA 4JI1L 3KFUA 1U4PA 5C0XI 1DONA 2L55A 4JI4L 4IFDG 1KAWA 2F0KA 2K05A 4A3JH 2F0HA 3ULLA 4DA2A 4GS3A 5CV5A 2N78A 4EX5A 2F3VA 2YTYA 2E2JB 2FINB 2KENA 1UE1A 1Y1VB 1K8GA 3S16H 1N8RC 5FOBB 1BOSA 1KL9A 3RLFA 4DV2L 4Q5VA 1SNCA 2OT2A 1RTOA 3CHBD 3OMCA 1FNUA 2E2HB 4MTNA 4NXMQ 1IYJB 5JPMC 3RD4A 3GDEA 3VR5A 1Q1EA 2CH4A 4MHEA 3AEVA 4CJ1B 1WD1A 1YVCA 2B63H 4OGQC 4JW0A 4MN3A 3GTKB 5IGCA 1D8LA 1WI5A 1VQ4A 3CCUA 4XQNA 4RGTA 1X6OA 1YJWA 4A93B 4YHHL 1T5EA 2K50A 1E1OA 1PA6A 4LAAA 1HR0L 4ZLTF 2CCZA 1LTBD 3VYRA 2E2IB 4JI6Q 4A3DG 1PZJD 3STBD 3HKZG 3QOLA 4PMWA 5K5PA 1VMPA 1Y14B 3LNNA 4U673 1KDBA 1RF2D 3TP8A 3VR2A 3A55A 4HJ7A 3CRKC 3M4OH 5CV7A 1SRUA 2PI2A 5GAGC 1G6ZA 1NSNS 2ID0A 2Z6KA 2JN4A 3NK9A 1QUQA 1S72A 4DNTB 1SXTA 3DWAA 5LMUQ 5G3LD 1GJXA 1D1KA 4I65A 4KKUA 5D14A 2F0NA 1KQSA 3GTLB 1WCMH 1Q81C 5CR3A 1D5XC 4J1MA 5CV9A 2K32A 1X55A 1CHQD 4C1NI 4TRDA 4KHZA 2KJXA 2WKDA 3EIVA 3E0JA 4GN3B 3I55A 2SNMA 4DV1Q 3IRBA 1STBA 2HCIA 2I07B 4IFDJ 2OCEA 1PH6A 4PZ6A 4JI3Q 1S5BD 5FLXE 3CXCA 2JA5B 1GVPA 1OXTA 3CCQA 4QQBX 2Z9HA 1VS0A 1Y69U 1FD7D 2GVBA 4X62L 3IAYA 2MO1A 2KCNA 3GTOB 4LJZC 4BY7H 3GV6A 2B2VA 2ZTEA 5EPLA 4DV3L 3K5NA 3MVVA 4C3IH 4DK0A 1MSGA 2F4IA 2R7FA 1Z7TA 2RDHA 4RGNA 2N49A 3BDCA 3HP3A 2ES2A 3BZKA 1VQBA 3VYUA 4TQUS 5I2YA 1SLJA 4IALA 2VQEQ 1QZHA 3AU7A 3BJUA 1TT2A 2I5MX 1BCPD 1AE3A 2KCTA 3M7GA 5JAVA 4MIUA 1KRSA 1UUPA 2NB0A 4P2CB 2Z6KC 4A3LH 1S3OA 3PGZA 1EFWA 4KY5A 1S40A 2L12A 4DR6L 1R4PB 4A3DB 1CKMA 5IYCG 1XPUA 2XRQD 5M5XH 3PO2G 2A6HD 1PDQA 4WJWA 3K0YA 2A6EC 1GUTA 1TY0A 5IGEA 1LTID 4LFCQ 5BR8Q 3H3VC 2JA8G 3GTPH 4RWSC 1FR3A 1I50H 2F0UA 1E2ZA 1PYWD 4OIJA 3F1ZA 4NW2A 1F77A 2SOBA 1N32Q 1AFPA 5IP7G 1EUJA 1F2LA 3DXJC 2NN6H 3F8TA 3TREA 1UAPA 2Q8RE 3J81E 3FKIH 1B9NA 1DYQA 3DHQA 4IJHA 4KY6A 4A3EB 3VR6A 1PVOA 1DZ1A 1CSQA 5JVH3 2UXCL 2L1BA 4B3MQ 1VQ6A 1C7YA 2B2VC 1R4QB 4C3HG 2JA6H 4POFA 5KNDA 2ZM6L 4RKBA 2F0TA 4GNXB 2MJ8A 1TWGH 1V1PA 1LYLA 3KLWA 3IL8A 4YY3L 1I4PA 4GKJQ 1O78A 2MUYA 1TS4A 2F4VL 1PTOC 2KA7A 4N9TA 1E7ZA 1Y8PB 3J81c 4YWLA 2VUMH 2LSSA 1KHIA 4ALPA 1NMFA 4LF9Q 4GLAC 2A68D 1EIHA 1UEBA 3PUVA 3I91A 4MNOA 1L2FA 5JEAG 1L1OA 2DJGC 1ET6A 2OTJA 3KYHC 4BBRG 1EIGA 1ENFA 4IPCA 3QG1A 2XSCA 4X64L 1VQNA 1KD1C 1YHQA 2XVSA 2A69C 2PQEA 2VQFQ 2OQ0A 4DV5L 5C4XH 4X3KA 3CC2A 2D2CC 4K5VA 4AYBG 5LMNW 2L4NA 1TS5A 4BY1G 2PQAB 1ENAA 1A3VA 2NZOA 4B3SL 5I9PA 1YNJD 4ME3A 2N55A 2WAQG 1C8CA 3GTGB 3MXUA 2AQ1B 3NXWA 1VQDA 5D3DA 2FJ2A 4L6TB 2EY2A 4EVOA 4I7ZC 4DAPA 1C0AA 1KDCA 2ZJPA 1SEBD 3IKJA 1E3PA 3PO2B 3DM1A 1JWSD 4S3SA 5JVG3 2JYOA 2NWGA 2QEJC 4A3FH 1FNVA 2JA8B 2A19A 1XNRQ 1QCBD 3LWUA 2AWOA 2EZVA 1ICWA 2CKZB 4ODGA 2G9DA 3V2TA 1FGUA 3ER0A 3NPPA 3T4AC 2X6LA 4NP5A 2Y0SB 1K8MA 4WORA 1HNZQ 4ZQ3A 5C5MA 2XWBB 4LF5L 2UXBQ 5IYBH 1I3QB 2EVBA 2YTXA 3TDQA 4QIWB 2IX0A 5EPKA 3S2DH 3RZOH 4DR7L 1B1ZA 2MGSA 1SFOB 2OWOA 1JR0D 1CZGA 4AQYQ 4R4OA 4BXXG 3KJOA 1V9PA 1YJ9A 2N8NA 1N9WA 4XT3B 4GOPC 1N34Q 4DR4Q 5ISRA 4CBVA 4JI7L 1VQEA 2KUMA 1JJCB 4GZYC 1NUCA 2ZXOA 4KD4A 5IWAL 1P8LA 2B2WA 5FJ8G 1EYGA 3DEPA 4K6DA 1BXTA 4GLVB 1S5ED 1ZEQX 1N36L 1AE2A 3E9HA 4HCSA 2JEAI 4O42A 5JEAJ 4BBRB 4DUYQ 4LF7Q 2E8GA 1RHPA 1WOCA 4JCVE 3CU7A 1TWFB 5DLQE 1XNQL 1C4QA 2Y0SE 1AP0A 4EQOA 4A76A 1JJ2A 4A75A 2F1MA 4IZ8A 1XMOQ 1AW7A 4XYOA 2UUCL 1QB5D 4HJ8A 5C3EG 3WOEA 3J7AF 3NP8A 4BY1B 2JEBI 1PZKD 3CF5A 3RZDB 1IHZA 2R92H 3TZUA 1B2TA 1SNDA 4QIWE 1NAPA 2WACA 3M4PA 3S15H 1Z47A 3A8KE 3M3YH 1L0YB 1O80A 2PNHA 1PMRA 2QF7A 3D3RA 2JA7G 1EQRA 2RF4A 3NUCA 1SBBB 2R6GA 3RR5A 1GO3E 4B3TQ 2LY7A 3H0GB 2BE5C 3BDOA 2A5HA 2NVYH 4JI5L 4K2KA 5AFWA 4O2DA 1VQ7A 4OIKA 3JAME 3DWQA 1JE4A 4DR1Q 2F0OA 4Y7NB 4ZRZA 5FLXL 1KRTA 4JBWA 2L5TA 4ZK9B 3H15A 3FMCA 1EYAA 2E2DC 1TS3A 3U9SA 1D5MC 2B2WC 2PPBC 4IOCA 1SE2A 2HUGA 3ERSX 1EY6A 2EE1A 2F3WA 4A3BH 5FKAC 1EY8A 3E6ZX 3VA7A 1EWHA 1ASYA 4OXPA 2WV6D 3HOYH 1XXGA 3EA6A 5I2XA 3S14B 3PUYA 1NTGA 4JBMA 3I4NH 2DUDA 4RFBA 4LMQD 4Y52H 4DV6Q 1LTGD 1JMCA 4L5SA 3HOVG 4F7XA 3S2HB 2KEDA 1B3AA 1KLGD 5CGKA 4DV4Q 1YBYA 2MQHA 5EJWA 4DU9A 2EYLA 1H9JA 4ME5A 3V96A 4A3JG 3NTKA 1EYDA 3PO3H 3RLNA 2EOTA 3K58A 4JI2L 4P75A 1UE5A 2DN8A 1TU2B 2B29A 4HMJA 4NXNQ 3I8ZA 3TBIB 4GNXA 1SSOA 3SK6A 3ND8A 1B8AA 4P73A 4DR3L 4JI8Q 5A35A 1LTRD 1PTOB 4OO1I 2PW5A 1PLFA 3HOWB 3MC0B 2R61A 5C44B 2IHFA 3W1GA 3M4QA 2CW0C 1VQ9A 3J81L 2JA7B 5GQOA 1PRTD 5ELBA 2F0SA 3GV3A 4FF1A 3QJYA 4K2LA 5ELNA 4DK6C 2HHHL 1QWYA 3A7AB 2RHQB 4DPGA 1ML0D 1JOQA 1K73C 5C5LA 1X54A 2R7ZB 3CQZH 1K9MC 1H9SB 4OHJA 2B63G 1QNUA 4MTKA 1DJRD 3M9BA 1V1QA 3E5SA 3C1FA 4LF8L 1VQ8A 3SHLA 3K8AA 5C0XH 2PQAA 1NMGA 1ZKOA 1ZXTA 2I5LX 1DM0B 1N33Q 4HIDA 1G2TA 1PFNA 3GTQB 1XMQL 5ELDA 3VR3A 5KGUA 2RKSA 3QIAA 3NHHA 3S1NH 1EWIA 2CVRA 4A3KG 4FF2A 3R8BA 2Q2IA 1NNXA 3I4MG 3RUZA 4DR5Q 3P75A 4LW1A 2J7ZA 3H3VI 2PO4A 4BBSB 2V1CC 4PNYA 5DM63 4DR2Q 2YU9B 2OF1A 1WVLA 2FHTA 3HEJA 5FLMH 1CQFA 2MO0A 1K28A 4QMGA 1WCMG 1ONLA 1JJGA 3SGIA 3RN5A 3QB3A 1IYVA 3A56A 3GO5A 5AJ3L 4PZ8A 4KHPQ 2HQLA 1E22A 4FP5D 2MP1A 3G6EA 2M2LA 4LUOA 2EY1A 2EXDA 1HFGA 5GROA 1SN8A 3KUPA 1YHBA 1A2UA 3BVMA 3TMEA 2VL6A 3MA2B 5C6AA 2UXDL 4XIGS 3STBC 2A1AA 1Q8IA 4XT1B 3Q24A 1M8AA 1EZ8A 1GHJA 2D0OA 2ZT9C 1HZAA 4PV1C 1EOTA 4G7ZC 2EYHA 3DMUA 3PCOB 4QL5A 3MXGA 2Z6BA 1X9NA 1CSPA 2K28A 3QR8A 1JWMD 2N88A 4DN4M 4BY7G 5G3LF 2OTLA 5HY6A 4HMIA 2IW3A 4NPSA 3HOXG 3A7LA 4ZKBB 4C3IG 1S5FD 2LXJA 4LF4L 1O7LA 3X3NA 1J8IA 2ENBA 4X3TA 2F0QA 1IW7D 1HZCA 1HNWQ 3VA5A 1PH9A 5IGFA 4JYAL 1T9HA 1WD0A 1J9OA 2B3GA 1GUSA 2KHJA 4NB3A 1E2WA 2HD3A 3AQQA 5JJKA 2HDLA 3GTMB 4DXFA 4KKTA 3HRZC 1IL2A 1PH7A 4DGZA 4XTCS 4OL7A 3HOZB 1Q8KA 1B4OA 1EOVA 3K5MA 3T16A 2VS1A 1KDAA 1VF7A 5BN5A 4A3MB 1GOZA 1HCZA 2FXQA 3PMFA 3T51B 4A3KB 4DUZQ 4KK7A 3I4MB 2UU9Q 2E2JH 4JI0Q 1NR4A 1HNXL 4X66L 4YCVA 5E7NA 2HCCA 3Q0AA 1Y1VH 1LTTD 1DGSA 4IUNA 1YHAA 2EPBA 3S1MH 2NN6G 3T1HL 2UUAQ 4GKKL 1YI2A 4LWCA 1CKOA 3A0JA 4Q0FA 4HJAA 2NVQB 1WCMB 3D0FA 1PRTB 4LFBL 3NWTA 3HZXA 1MJEA 1DOLA 3I3CA 4HJ5A 1BCPC 2E2HH 1TVXA 1VQCA 2KECA 1MKHA 5LL6S 3PF4A 4DXGA 1UEAB 4OWWB 1Q46A 2JA6G 1Y1WG 4X65L 4JOIA 4KJOA 5IODA 2CHBD 2DY8A 3GTKH 1JB7A 1GKHA 3A5ZB 5T1IA 2V4DA 4B9WA 4DV0L 3UDGA 2R3ZA 3JAML 4HR7B 1J5EL 4EQ5A 4FYDA 1G291 1HHVA 1SROA 3OW2A 4BY7B 4DAMA 1V43A 1I94L 2WB1G 3KLRA 1OXUA 3HOXB 1XJVA 3Q6SA 1LV9A 3S17H 4C3IB 4B3RL 2F0EA 4ZCKA 3SK5A 1OXXK 1VQJA 1I6HH 4KN7C 5J3BA 3F2UA 3K57A 1EZ6A 1M1KC 1BR9A 5EBDA 1E24A 2RA4A 3C1EA 3U58A 4OELB 3CCEA 4IPDA 3JC66 3M7NA 3DWPA 2I46A 1F2YA 2A73B 1VCIA 3A74A 1TQOA 5IP9H 4JV5L 4K0KL 2D5DA 4DAYB 5FLXc 1KTKA 1VQHA 1BBWA 4YCUA 4QJFA 4IFDH 1D5ZC 1O7IA 1STHA 4XDXA 3T13A 5M5XB 4A3CG 2KCCA 4RGMA 4DFAA 4KHVA 2JA5H 2ICIA 2A68C 1I50B 3O13A 4P74A 4DK3C 1JICA 3M85A 5EQ0A 4JBKA 4FXDA 5D65A 1QVGA 3EBEA 2HIXA 1A6XA 3E9IA 1VQFA 5L37A 3GTOH 3U50C 1QVFA 4R8IA 1H9SA 4JOIC 1CUKA 5EAYA 1EY4A 3HKZB 1YNND 1TWAH 2K5VA 3SE0A 3I72A 1Q86C 2OEOA 4LF6L 4OX9Q 3OHXC 5IYBG 2OQKA 1L0XB 3RMHA 4CHTB 3KJPA 2UUBL 4JI4Q 3I56A 3CCJA 4K8JA 1T5XD 4HIMA 1YNJC 3DM3A 4KY7A 2JA6B 3PF5A 1Y1WB 3CCVA 2YYZA 4QB4A 4IPGA 1G51A 4FNFA 5GAEC 4DV2Q 3MHBA 4A3DH 5KRUA 2WB1B 4L8JA 4IFDI 1X56A 1PTOF 1QG7A 4UP9A 2G9HD 1FVIA 1QE6A 3L7ZC 4KTAA 1IBML 4FXGC 1AEXA 4KV6A 4HIKA 3BYTB 5C3XA 2KOLA 3OW7A 1C9OA 2E5LL 1A3UA 3HKZE 1RTNA 5TSSA 3J81i 1EQQA 4IQZA 4YHHQ 5EKIA 2PMZB 3N6RA 2NVTH 1HR0Q 1IBKL 2BDNA 1K83B 2F03A 4A3EH 2D0PA 3TP7A 4ZAIA 1LTSD 3HKSA 4GOPA 3EQLC 5CORA 1BNZA 1BO0A 1QNKA 3CCSA 3F2DA 3KDFB 5EGTA 3OTOL 3UDIA 1JWUD 4RCOA 4X6AH 1NR2A 2XRSD 5CYUA 2Z8LA 4DV7L 1DCZA 1F2ZA 4O1NA 2PZTA 1VQLA 2QEXA 3I73A 3MZ5A 3BZCA 5I6WA 3CMEA 2F0IA 2WB1E 3KOJA 1DXMA 3VYSA 1MHWC 4LFAL 1I6VC 2LMCB 4R1JA 4KJNA 2DY7A 3I4OA 2EJMA 1HUNA 5LHY1 1FJGL 4PMCA 1X3FA 2PZWA 3PUWA 2PYKA 1X65A 4OWTB 3R2TA 1CFMA 2VXWA 1VDZA 4LK1C 5FO9B 2K5DA 2R7DA 3RZOB 1EU3A 3D31A 2IWHA 3UDXA 5M3FH 3MEHA 1HFNA 2PMZE 1V1OA 4XQQA 4A3BG 4V190 4JC0A 1GD7A 1KAAA 2XWJB 1HTPA 3A8IE 1YITA 4RGOS 4X62Q 3GQBA 1TKWB 4IJLA 3D8GA 3MTSA 1IBLL 2DGYA 2WP8J 3GTGH 2ATWA 3UDFA 2EYJA 4CKBA 4DV3Q 3I4NG 4G57A 4RMFA 4C3HB 4DK1A 1LUZA 5E3FA 5JJLA 1HZ9A 4K5WA 4E6IA 1PFBA 1AN8A 5I9OA 3PO2H 3QWNA 1BKBA 2VB3X 3HOUG 2RBMA 1BCPB 1Q82C 4DNIA 1QZGA 1KNAA 3H94A 5IYDH 3ND9A 3Q22A 3E3XA 4N9PA 3PO3G 4ID6A 2EYPA 1BVSA 2X6GA 1AZQA 1KNEA 3S9WA 3K7AH 1GUOA 1CQVA 2ALYB 1ESFA 4DR6Q 2A69D 3CW2C 3M3YB 4U68A 1B3QA 3RLOA 1STEA 3S24A 1B50A 1STNA 1SFOH 5LMNL 1R9TB 1TXYA 1BQQT 4O0AA 4ZUIA 4XXEA 3GD7A 4AYBB 2YTVA 4TKOB 4G7OC 5HURA 1W6KA 1TIID 3OIPA 2EYFA 3W3AA 4L5RC 2JXMB 1H95A 2MHVA 2WAQB 1SYGA 2MPMA 3SK4A 3AMUA 4A3GH 5M3MG 4XQJA 1TWCB 3K0XA 5DNFA 3GTJB 1DOMA 1LT3D 1NE3A 1II3A 2L11A 4R4QA 4PZ7A 1U4RA 4QF4A 5C0XG 2UXCQ 2I5HA 3AFPA 5CBAE 3PIP3 2AUKA 3P7JA 2I0QA 4K8IA 3G4SA 3CCLA 2IL8A 1CHPD 5K36G 1PRTF 2L0CA 4DAYA 5IIFA 1TWFH 2ZM6Q 3PV0A 4ZKCB 2R93H 3S1RB 4EQNA 4YY3Q 4HSVA 1PRTC 3T1YL 3TRZA 3DEOA 3UI2A 2F4VQ 1JOOA 4OO1H 4C3JH 1G6PA 1L0WA 3K7UC 3R93A 3RZDH 4K6LA 1SE4A 1AZPA 2C35B 3I4NB 4X3UA 1A15A 2AHOB 4UAIA 1SJED 1FL0A 4AYBE 4APVA 2F3IA 4H02A 2O5JC 4PG3A 1S5DD 2BA0A 3JAMc 1MBYA 1O7YA 3H0GH 3R3OA 3HOUB 1EYCA 3KLSA 4X64Q 1A63A 1MSHA 2EQSA 2WAQE 1D2BA 3H6MA 3SEBA 2XIWA 3JAMi 3KBXA 1YJNA 1SNMA 4HCEA 4R8NA 2F0PA 4DV5Q 4ULLA 2XGTA 5I6YA 1CA6A 3I7FA 5IT9E 1HTLD 2K75A 4A3IG 2JK8A 4B3SQ 3OPOA 1WTOA 1F2MA 2AQ2B 2Z4IA 5C4JH 4CKEA 5J39A 4FVMA 4NXML 3X3MA 3HS0C 4NKLA 4JBJA 3P1HA 1B53A 1VQPA 4V0BA 1QJOA 2RVLA 2F0LA 3MXNB 5C3EB 4C2MB 4BXXH 1WJJA 1RDPD 2IPKD 1U9RA 2N3SA 4YIJA 3H3VH 2NVXB 2K5HA 3CKIB 2EJGC 4Z9CB 3S14H 3CQZB 2DNEA 5JOBA 5M9OA 5M3MB 5BN3A 4JI6L 3CCMA 1EWCA 4LF5Q 1KXLA 1DOKA 3QO2A 1RD9D 1CI3M 1TY2A 4UP8A 3S2HH 2BA1A 4EQPA 4ZYSA 2CWPA 1EY0A 1CK1A 5M5WB 5C0XJ 1QILA 1IL8A 4AIMA 4DR7Q 3PIO3 1SMXA 3KDFA 4UDUC 3OSOA 4C1NK 3ERQA 5LMUL 3KF6B 4RA8A 2EYOA 3AYHB 4JI7Q 1H9MA 1U0LA 3NQIA 2NTSA 3U9OA 2DNCA 1E0BA 1Y1VG 2RHSB 5IWAQ 1PTOH 1IW7C 2RQXA 3SR1A 1PV4A 2AMCB 1STAA 2K52A 3HOWH 2E76C 5C44H 1N36Q 2P5ZX 3UE0A 2JA7H 5DEHA 1MGSA 3FDTA 4DV1L 1XPOA 3BU2A 1OTCA 1JCKB 1ENCA 1VQMA 4JI3L 3J80E 4BA2I 3BYYB 3ITPA 3LWEA 3K5LA 1Q90A 1XNQQ 3HG9A 5FK9C 5E4WC
chains in the Genus database with same CATH topology
3SK8A 1ET9A 1TWHB 1EU4A 3HOVB 2H1EA 4A3IB 4DNRB 1JOKA 4G4KA 4M8AA 3K59A 2B8FA 5M5YB 2WKCA 1Y8NB 5JPNC 1SNPA 2K6AA 5A2QE 4A3JB 1EFID 2OXPA 3OIQA 3I90A 5C3WA 2ICEC 3KK7A 4ZUJA 1GXDC 2IX1A 4H44C 5IGBA 3S16B 2EXZA 4RCNA 2TSSA 2K03A 2CW0D 5EKKA 3MAQA 1TS2A 3K6OA 2E75C 2NYZD 3C3LA 1A2TA 2PW7A 4CJ0B 2E74C 1Q12A 5LL6X 5I4DA 3NWSA 1SMYD 2SNSA 2B63B 2LKVA 3SVMA 1IKMA 3FPUB 1LT4D 1ILPA 2EJFC 1SAPA 4B9XA 3H91A 4KI0A 3D4WA 5KNBA 1RODA 4H13C 2K04A 3S1MB 1MI2A 4HTHA 2KQ3A 2ZXPA 1ZYRD 3EROA 4RAUC 1G91A 3M4OB 1FNWA 2QCPX 1O7ZA 2K7VA 2K5WA 1EL0A 2RSNA 1BCPF 1EEFD 2K01A 1BUVT 2B2TC 1JB3A 3W2DA 2B2UC 3LX0A 1SDFA 1WTVA 4C56C 4XYQA 1H9KA 3QOJA 1HUMA 4FO2A 2RDFA 1Q1BA 1A3TA 1F9QA 3FVQA 3S17B 3T53B 1I6HB 2A6HC 1YNNC 3A54A 4J8QA 4EGVA 1D6EC 2AUJD 2TMPA 1TR5A 1DD2A 1EQVA 1BBXC 2F0WA 3J7AV 3FPPA 2F0JA 3I4LA 3H09A 2EYMA 4JK1C 2XN9C 2O2LD 1GUWA 3MXNA 4KMUC 2CQAA 1RKNA 3J7YW 3TZDA 1XX8A 5F2DA 2VB2X 1Q3LA 4CGYB 5IT9L 1ILQA 1CZWA 3HGBA 1TWAB 1HQRD 2J4XA 1HA5A 2AWNA 3GTPB 4PQXA 4CKCA 1KABA 5FO8B 1WTWA 3D4DA 2QILA 1S5CD 2SDFA 4ABNA 1BF4A 5HGTA 5CV4A 1BDOA 4H0LC 1G2SA 3FKIB 2K1BA 3G7LA 1LTAD 3OOCA 4IN3A 1SE3A 5ELEA 4QUCA 2PZUA 2IT1A 3FRPB 1TWGB 3VR4A 2J0TD 3OWEB 5C4HA 4RHRA 2IX3A 2H4OA 1HPCA 3NE5B 3NSWA 1D1IA 1WTPA 2VUMB 4DAVA 5COYA 4QCLA 3OWFA 2HQEA 5IOCA 3I70A 2NUCA 2Q8IB 4PMBA 5EBCA 4K14A 2NVTB 3CRLC 4NDXA 4IUTA 1LLRD 3NBHA 5DM73 2EY6A 5ELFA 2Q8TA 1I4GA 2FFKB 1MD2D 3OMGA 5J1ZA 5C4XB 3Q23A 3J80L 1U4MA 1OXVA 3R2IA 4FXKC 1FGBD 5E4XA 2F0VA 2WIIB 1SYDA 4ILWA 1LACA 2BDOA 4K5XA 2F0FA 5EKLA 4M1UB 1SNQA 3L3OC 4A3FB 1LO5D 2BCOA 1M4VA 5A2QL 1W6JA 5DAUA 5M3FB 5ELCA 2A6ED 1EY5A 3BDLA 3FEWX 4HN7A 1HRJA 3MFGA 2NN6I 1E2VA 4OO1G 3N52A 3A8JE 4C3JG 1WTRA 1HXYD 3KLSX 4IUUA 4BWGB 3C2PA 1EY7A 4BS9A 3S2DB 3G6JB 1JORA 2B8GA 3PUZA 4X3SA 1HA6A 3M4YA 1PFMA 1PXUA 3ZYYX 1STGA 1X3PA 4F88A 1LT5D 2RDGA 2B2YA 1SJHD 2Z1CA 1OO9B 1XYIA 4RKLA 1F9RA 4KN4C 5KYLA 4QUFA 2FMMA 3K7AB 1PTOD 1JQYD 3MXPA 3MFYA 4FF3A 2XNAC 1FYCA 2FMCA 1SNOA 4HEDA 3IFTA 3TN2A 5CMDA 3EFXD 3AB9A 2NTTA 5IGGA 5KEEA 4BA1I 1WTQA 1IKLA 3T56B 3TP6A 2R92B 3S15B 1LT6D 4A3GB 1I4XA 3BVGA 1B9MA 4DF7A 1NCVA 2NVYB 4IUQA 3TSSA 4NMZA 5C4ZA 3L9AX 1JC7A 2M00A 3URYA 2F0GA 1OXSC 1WTXA 1CM9A 2R93B 5JEAH 2KEEA 1CA5A 4C3JB 2D62A 3KF8A 2B2YC 1SYCA 2PNRC 2GA4B 3NBIA 1LABA 3EJIA 2F0DA 1GUGA 4A3BB 1V8QA 1Z6HA 2M9VA 5CV6A 1UNSA 3HOYB 4WFN3 1F9SA 1SYEA 1CTMA 4IUVA 3EVQA 2K5QA 5EPJA 2K33A 3PUXA 3KBGA 2C9OA 2NBFA 4CJ2C 4RHSA 2D9UA 5C4JB 3BG3A 3DUZA 5KIXA 5KYIA 2JSOA 3PO3B 4F8MA 3SDZA 1F9PA 5FO7B 1CT1D 2B39A 2VNUD 4KD3A 3BZDB 4WRDA 4H7BA 1GHKA 1K8OA 1IYUA 1VF5C 3NQTA 1XWEA 4TSSA 1I4RA 1SYBA 5IGDA 2BOSA 1KLUD 1I4HA 2EY5A 2QDBA 4G7HC 1S4ZA 1STYA 4FF4A 2BE5D 1QOHA 5BN4A 2O4XA 1XTCD 1EY9A 2AQ3B 2F0MA 5D3IB 2NZ1D 1ESRA 1PZID 1U4LA 3D6WA 2LS01 5CC4A 2X69A 3MWYW 3D6CA 1RJTA 1VMCA 4KKSA 3C46A 3S1NB 2HDMA 5E1FA 3NTIA 4L63B 1SYFA 2KHSA 2RSOA 4F87A 1I4QA 3D4RA 1SMYC 4R9WA 4HAEA 1EEID 1GUNA 2O5IC 5J22A 4IURA 5NUCA 1HQMC 2WINB 5JJZA 5KNCA 3BVZA 3BS1A 1G8ZD 2LFNA 3IFDA 2A74C 3K5OA 5K36H 3GP7A 2ZXRA 1ZYRC 1C48A 3P20A 3SXHA 3TP5A 1B44D 1X32A 4J6HA 2JE6I 3ONAB 2Z4HA 5T1GA 1V1PB 2IJ0A 3VYTA 1EQTA 3S1QB 4B08A 2B2TA 5CV8A 2B2UA 2SEBD 1X3QA 2JP1A 4IUPA 2PCFB 2KVMA 1Y8OB 3NTHA 3WDNA 3V05A 2C5CA 1RCVD 5CBEE 4RH6A 2QKIC 2L9HA 3WOFA 1H9RA 4HSPA 2EDGA 1U4PA 5C0XI 1DONA 2L55A 4IFDG 2K05A 2F0KA 2F0HA 4DA2A 5CV5A 2F3VA 2E2JB 2FINB 1Y1VB 5FOBB 1BOSA 3RLFA 4Q5VA 1SNCA 2OT2A 1RTOA 3CHBD 3OMCA 1FNUA 2E2HB 5JPMC 3RD4A 3VR5A 1Q1EA 4MHEA 4CJ1B 1WD1A 4OGQC 4MN3A 3GTKB 5IGCA 4XQNA 4RGTA 4A93B 1T5EA 4LAAA 4ZLTF 1LTBD 3VYRA 2E2IB 1PZJD 3QOLA 4PMWA 5K5PA 1VMPA 3LNNA 4U673 1KDBA 1RF2D 3TP8A 3VR2A 3A55A 3CRKC 5CV7A 1G6ZA 1NSNS 2ID0A 3NK9A 4DNTB 1SXTA 3DWAA 5G3LD 1GJXA 1D1KA 4I65A 4KKUA 5D14A 2F0NA 3GTLB 5CR3A 1D5XC 4J1MA 5CV9A 2K32A 1CHQD 4C1NI 4TRDA 4KHZA 2KJXA 2WKDA 3E0JA 2SNMA 1STBA 2HCIA 2I07B 4IFDJ 1S5BD 5FLXE 2JA5B 1OXTA 1Y69U 1FD7D 3IAYA 2KCNA 3GTOB 4LJZC 3GV6A 2B2VA 5EPLA 3K5NA 3MVVA 4DK0A 1MSGA 2F4IA 1Z7TA 2RDHA 4RGNA 3BDCA 3HP3A 3VYUA 4TQUS 5I2YA 4IALA 3AU7A 1TT2A 1BCPD 3M7GA 5JAVA 4MIUA 1UUPA 2NB0A 4P2CB 4KY5A 2L12A 1R4PB 4A3DB 2XRQD 2A6HD 1PDQA 4WJWA 5IGEA 3K0YA 2A6EC 1GUTA 1TY0A 1LTID 3H3VC 4RWSC 1FR3A 2F0UA 1E2ZA 1PYWD 4OIJA 4NW2A 1F77A 2SOBA 1AFPA 1F2LA 3DXJC 2NN6H 1UAPA 2Q8RE 3J81E 1B9NA 1DYQA 3DHQA 4KY6A 4A3EB 3VR6A 1DZ1A 5JVH3 2L1BA 2B2VC 1R4QB 4C3HG 5KNDA 4RKBA 2F0TA 2MJ8A 1V1PA 3IL8A 1I4PA 1O78A 2MUYA 1TS4A 1PTOC 2KA7A 4N9TA 1Y8PB 2A68D 1EIHA 3PUVA 3I91A 5JEAG 1ET6A 1EIGA 1ENFA 3QG1A 2XSCA 2XVSA 2A69C 2PQEA 4X3KA 2D2CC 4K5VA 2L4NA 1TS5A 1ENAA 1A3VA 5I9PA 1YNJD 2N55A 3GTGB 1C8CA 3MXUA 2AQ1B 3NXWA 5D3DA 2FJ2A 4L6TB 2EY2A 4EVOA 4I7ZC 4DAPA 1KDCA 1SEBD 3IKJA 3PO2B 3DM1A 1JWSD 4S3SA 5JVG3 2JYOA 2NWGA 2QEJC 1FNVA 2JA8B 1QCBD 3LWUA 2AWOA 2EZVA 1ICWA 4ODGA 2G9DA 3V2TA 3NPPA 3T4AC 2X6LA 4NP5A 2Y0SB 1K8MA 4WORA 4ZQ3A 5C5MA 2XWBB 1I3QB 2EVBA 3TDQA 4QIWB 2IX0A 5EPKA 1B1ZA 2MGSA 1SFOB 1JR0D 1CZGA 4XT3B 5ISRA 4CBVA 2KUMA 4GZYC 1NUCA 2ZXOA 4KD4A 2B2WA 3DEPA 4K6DA 1BXTA 1S5ED 1ZEQX 4HCSA 2JEAI 4O42A 5JEAJ 4BBRB 1RHPA 3CU7A 1TWFB 1AP0A 1C4QA 4EQOA 2F1MA 4IZ8A 1AW7A 4XYOA 1QB5D 3WOEA 3J7AF 3NP8A 4BY1B 2JEBI 1PZKD 3RZDB 1IHZA 1B2TA 3TZUA 1SNDA 1NAPA 2WACA 1Z47A 3A8KE 1L0YB 1O80A 1PMRA 2QF7A 3D3RA 3NUCA 1SBBB 2R6GA 2LY7A 3H0GB 2BE5C 3BDOA 2A5HA 4K2KA 5AFWA 4OIKA 3JAME 3DWQA 1JE4A 2F0OA 4Y7NB 4ZRZA 5FLXL 4JBWA 2L5TA 4ZK9B 3FMCA 1EYAA 2E2DC 1TS3A 3U9SA 1D5MC 2B2WC 2PPBC 1SE2A 2HUGA 1EY6A 2EE1A 2F3WA 5FKAC 1EY8A 3E6ZX 3VA7A 1EWHA 2WV6D 1XXGA 3EA6A 5I2XA 3S14B 3PUYA 4RFBA 4LMQD 1LTGD 4F7XA 3S2HB 2KEDA 1B3AA 1KLGD 5CGKA 5EJWA 4DU9A 2EYLA 1H9JA 4ME5A 3V96A 3NTKA 1EYDA 3K58A 2EOTA 2DN8A 1TU2B 4HMJA 3I8ZA 3TBIB 1SSOA 3SK6A 3ND8A 5A35A 1LTRD 1PTOB 4OO1I 2PW5A 1PLFA 3HOWB 3MC0B 2R61A 5C44B 2CW0C 3J81L 2JA7B 1PRTD 5ELBA 2F0SA 3GV3A 4FF1A 3QJYA 4K2LA 1QWYA 3A7AB 1ML0D 1JOQA 5C5LA 2R7ZB 1H9SB 4OHJA 1QNUA 1DJRD 3E5SA 3C1FA 3SHLA 5C0XH 1ZKOA 1ZXTA 1DM0B 1G2TA 1PFNA 3GTQB 5ELDA 3VR3A 5KGUA 2RKSA 3QIAA 3NHHA 2CVRA 4FF2A 3R8BA 3RUZA 3P75A 2J7ZA 2PO4A 4BBSB 4PNYA 5DM63 2YU9B 2OF1A 1WVLA 2FHTA 3HEJA 1CQFA 4QMGA 1ONLA 3QB3A 1IYVA 3A56A 3GO5A 4FP5D 2MP1A 2M2LA 2EY1A 1HFGA 3KUPA 1A2UA 3BVMA 3TMEA 3MA2B 5C6AA 4XIGS 1Q8IA 4XT1B 3Q24A 1M8AA 1EZ8A 1GHJA 2ZT9C 4PV1C 4G7ZC 1EOTA 2EYHA 3DMUA 3MXGA 2K28A 1JWMD 2N88A 4DN4M 5G3LF 4HMIA 2IW3A 3A7LA 4ZKBB 4C3IG 1S5FD 1O7LA 3X3NA 1J8IA 2ENBA 4X3TA 2F0QA 1IW7D 3VA5A 5IGFA 1WD0A 1J9OA 1GUSA 1E2WA 2HDLA 3GTMB 4DXFA 4KKTA 3HRZC 4DGZA 4XTCS 4OL7A 3HOZB 1B4OA 3K5MA 3T16A 1KDAA 1VF7A 5BN5A 4A3MB 1GOZA 1HCZA 3PMFA 3T51B 4A3KB 4KK7A 3I4MB 1NR4A 2HCCA 3Q0AA 1LTTD 4IUNA 2EPBA 2NN6G 4Q0FA 2NVQB 1WCMB 1PRTB 3NWTA 3HZXA 1DOLA 3I3CA 1BCPC 1TVXA 2KECA 5LL6S 4DXGA 1UEAB 4KJOA 5IODA 2CHBD 2DY8A 5T1IA 2V4DA 4B9WA 2R3ZA 3JAML 4HR7B 4FYDA 1G291 1HHVA 4BY7B 1V43A 3KLRA 1OXUA 3HOXB 3Q6SA 1LV9A 4C3IB 2F0EA 3SK5A 1OXXK 4KN7C 3F2UA 3K57A 1EZ6A 1BR9A 5EBDA 2RA4A 3C1EA 3M7NA 3DWPA 2I46A 1F2YA 2A73B 1VCIA 1TQOA 2D5DA 1KTKA 4IFDH 1D5ZC 1STHA 4XDXA 3T13A 5M5XB 2KCCA 4RGMA 4DFAA 4KHVA 2ICIA 2A68C 1I50B 3O13A 3M85A 1JICA 5EQ0A 4FXDA 5D65A 1A6XA 4R8IA 1H9SA 1EY4A 3HKZB 1YNND 3SE0A 3I72A 2OEOA 3OHXC 4CHTB 1L0XB 3RMHA 4K8JA 1T5XD 1YNJC 4KY7A 2JA6B 1Y1WB 2YYZA 4QB4A 4FNFA 3MHBA 5KRUA 2WB1B 4L8JA 4IFDI 1PTOF 1QG7A 2G9HD 1QE6A 3L7ZC 4KTAA 4FXGC 1AEXA 4KV6A 3BYTB 5C3XA 2KOLA 3OW7A 1A3UA 1RTNA 5TSSA 4IQZA 5EKIA 2PMZB 3N6RA 2BDNA 1K83B 2F03A 3TP7A 4ZAIA 1LTSD 1BNZA 3EQLC 5CORA 1BO0A 1QNKA 5EGTA 1JWUD 4RCOA 1NR2A 2XRSD 5CYUA 2Z8LA 1DCZA 1F2ZA 4O1NA 2PZTA 3I73A 3MZ5A 5I6WA 2F0IA 1DXMA 3VYSA 1I6VC 2LMCB 4KJNA 2DY7A 2EJMA 1HUNA 5LHY1 4PMCA 2PZWA 3PUWA 2PYKA 3R2TA 1CFMA 2VXWA 1VDZA 4LK1C 5FO9B 2K5DA 3RZOB 1EU3A 3D31A 2IWHA 3MEHA 1HFNA 4XQQA 1V1OA 4V190 1KAAA 2XWJB 1HTPA 3A8IE 4RGOS 3GQBA 1TKWB 3D8GA 3MTSA 2WP8J 2EYJA 4CKBA 4G57A 4C3HB 4DK1A 5E3FA 4K5WA 4E6IA 1PFBA 1AN8A 5I9OA 3QWNA 2VB3X 2RBMA 1BCPB 1KNAA 3H94A 3ND9A 3Q22A 4N9PA 4ID6A 2EYPA 2X6GA 1AZQA 1KNEA 3S9WA 1GUOA 1CQVA 1ESFA 2A69D 3M3YB 4U68A 1STEA 1B50A 1STNA 1R9TB 1BQQT 4ZUIA 4XXEA 4AYBB 3GD7A 4TKOB 4G7OC 5HURA 1W6KA 1TIID 3OIPA 2EYFA 3W3AA 2JXMB 2MHVA 2WAQB 1SYGA 2MPMA 3SK4A 3AMUA 4XQJA 1TWCB 5DNFA 3GTJB 1DOMA 1LT3D 1II3A 2L11A 4QF4A 1U4RA 5C0XG 5CBAE 3PIP3 2AUKA 3P7JA 4K8IA 2IL8A 1CHPD 5K36G 1PRTF 2L0CA 4DAYA 5IIFA 3PV0A 4ZKCB 3S1RB 4EQNA 4HSVA 1PRTC 3DEOA 3UI2A 1JOOA 4OO1H 3R93A 4K6LA 1SE4A 1AZPA 3I4NB 4X3UA 1A15A 4UAIA 1SJED 2O5JC 1S5DD 2BA0A 1MBYA 1O7YA 3R3OA 3HOUB 1EYCA 3KLSA 1MSHA 1D2BA 3H6MA 3SEBA 2XIWA 3KBXA 1SNMA 4HCEA 4R8NA 2F0PA 4ULLA 5I6YA 1CA6A 5IT9E 1HTLD 3OPOA 1WTOA 1F2MA 2AQ2B 2Z4IA 4CKEA 5J39A 4FVMA 3X3MA 3HS0C 4NKLA 3P1HA 1B53A 4V0BA 1QJOA 2RVLA 2F0LA 5C3EB 4C2MB 1RDPD 2IPKD 1U9RA 4YIJA 2NVXB 3CKIB 2EJGC 4Z9CB 3CQZB 2DNEA 5JOBA 5M9OA 5M3MB 5BN3A 1EWCA 1DOKA 3QO2A 1RD9D 1CI3M 1TY2A 2BA1A 4EQPA 4ZYSA 1EY0A 1CK1A 5M5WB 5C0XJ 1QILA 1IL8A 3PIO3 4UDUC 3OSOA 4C1NK 3ERQA 4RA8A 2EYOA 1H9MA 3NQIA 2NTSA 3U9OA 2DNCA 1E0BA 1PTOH 1IW7C 2RQXA 3SR1A 1STAA 2E76C 5DEHA 1MGSA 3FDTA 1JCKB 1ENCA 3J80E 4BA2I 3BYYB 3ITPA 3LWEA 3K5LA 1Q90A 3HG9A 5FK9C 5E4WC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KRU A;  3SK8 A;  2KHS A;  3MVV A;  5CV6 A;  2EYH A;  1SNM A;  3DMU A;  2RBM A;  4R8N A;  2F0D A;  1JOR A;  4HMJ A;  2F0P A;  3LX0 A;  4EQO A;  1SYE A;  4IZ8 A;  3SK6 A;  1SNC A;  3QOJ A;  5I6Y A;  4KTA A;  1JOK A;  3BDC A;  2RDF A;  4N9P A;  2PQE A;  3EVQ A;  1AEX A;  4HMI A;  4KV6 A;  1A3T A;  2PZU A;  3NP8 A;  2EYP A;  1STG A;  2F0E A;  2PW5 A;  1SNP A;  3OMC A;  4ID6 A;  3SK5 A;  5C3X A;  5J22 A;  1F2M A;  4K5V A;  4IAL A;  5NUC A;  5C4H A;  1IHZ A;  1A3U A;  1SND A;  2ENB A;  2OXP A;  3S9W A;  1EZ6 A;  2WAC A;  2F0Q A;  1ENA A;  1TT2 A;  1A3V A;  5J39 A;  4RKL A;  3C1E A;  2F0S A;  5I9P A;  5C3W A;  4NKL A;  3VA5 A;  5IGF A;  3P1H A;  5JAV A;  4MIU A;  3NUC A;  3NXW A;  5IGC A;  5KYL A;  4ZUJ A;  4K2L A;  1TR5 A;  2EY2 A;  1EQV A;  3OWF A;  2HQE A;  3TP7 A;  2F0W A;  5IOC A;  4EVO A;  2F0L A;  5KIX A;  4KY5 A;  1KDC A;  5IGB A;  5KYI A;  2NUC A;  2EXZ A;  1STN A;  4PMB A;  1F2Y A;  4S3S A;  3MXP A;  1U9R A;  4K14 A;  4YIJ A;  4LAA A;  5EKK A;  4K2K A;  5C5L A;  4NDX A;  5EGT A;  5I9O A;  4ZUI A;  1TQO A;  4F8M A;  1SNO A;  2F0J A;  1A2T A;  2F0O A;  2PW7 A;  3SXH A;  4DGZ A;  3TP5 A;  2EYM A;  4OL7 A;  2EY6 A;  5IGE A;  1F2Z A;  5HUR A;  3E5S A;  3C1F A;  2EYF A;  5JOB A;  5M9O A;  2PZT A;  1STH A;  2F0U A;  3QOL A;  4KD3 A;  3SHL A;  3T13 A;  4ODG A;  3T16 A;  1SYG A;  5K5P A;  3OMG A;  5J1Z A;  1KDA A;  3SK4 A;  3V2T A;  4WRD A;  4H7B A;  5IGG A;  5KEE A;  3MZ5 A;  4DFA A;  1KDB A;  4J6H A;  3TP8 A;  4KHV A;  4NP5 A;  5I6W A;  3TP6 A;  2SOB A;  5CV7 A;  3PMF A;  2F0I A;  4WOR A;  4EQP A;  1EYA A;  1NSN S;  4ZQ3 A;  5C5M A;  3NK9 A;  1EY0 A;  3NQT A;  2SNS A;  1II3 A;  5KGU A;  2LKV A;  5CV8 A;  2RKS A;  4QF4 A;  4KJN A;  3NHH A;  2F0V A;  1SYD A;  3DHQ A;  1SYB A;  5IGD A;  1EY6 A;  1RKN A;  2F3W A;  4KY6 A;  4B9X A;  4I65 A;  4K8I A;  4PMC A;  2F0N A;  2PZW A;  1EY4 A;  4IUN A;  2F0F A;  3OSO A;  4K5X A;  5EKL A;  3RUZ A;  3P75 A;  5CR3 A;  1EY8 A;  1SNQ A;  2PYK A;  3ERQ A;  4J1M A;  3D4W A;  2EY5 A;  2QDB A;  5F2D A;  5IIF A;  2OEO A;  2EYO A;  4NMZ A;  5C4Z A;  1STY A;  4PNY A;  5CV9 A;  4TRD A;  2OF1 A;  4EQN A;  3U9O A;  2O4X A;  1EY9 A;  2M00 A;  3HEJ A;  3MEH A;  3HZX A;  2F0G A;  2F0M A;  4HTH A;  4K8J A;  4QMG A;  2KQ3 A;  2SNM A;  4RKB A;  2F0T A;  1JOO A;  1STB A;  1KAA A;  5ISR A;  3ERO A;  3SR1 A;  1STA A;  4KY7 A;  5DAU A;  1NUC A;  3QB3 A;  1KAB A;  2F0K A;  1EY5 A;  4KD4 A;  3BDL A;  4QB4 A;  2F0H A;  3D4D A;  5DEH A;  4F7X A;  3D8G A;  5CC4 A;  4N9T A;  4K6D A;  5CV5 A;  5CGK A;  1ENC A;  2EY1 A;  5HGT A;  5CV4 A;  1SYC A;  4KJO A;  5IOD A;  3D6C A;  2F3V A;  2EYJ A;  4DF7 A;  3ITP A;  4G57 A;  1A2U A;  4DU9 A;  4B9W A;  3TME A;  2EYL A;  5E1F A;  5E3F A;  4ME5 A;  3R3O A;  3EJI A;  5C6A A;  1JOQ A;  1EYC A;  4K5W A;  1EY7 A;  1EYD A;  4E6I A;  3MHB A;  1SYF A;  1EZ8 A;  3H6M A; 
#chains in the Genus database with same CATH topology
 2R7Z H;  3SK8 A;  3E0E A;  1ET9 A;  1TWH B;  1EU4 A;  2UUC Q;  5H1S E;  2XTI A;  3HOV B;  2H1E A;  4A3I B;  4DNR B;  1JOK A;  4G4K A;  4M8A A;  3K59 A;  2B8F A;  5M5Y B;  2WKC A;  1Y8N B;  3NBH B;  5JPN C;  1SNP A;  2K6A A;  5A2Q E;  4IOA A;  4UHV A;  4J15 A;  1EFI D;  2OXP A;  3OIQ A;  4RG1 A;  4A3J B;  1VQO A;  4DKA C;  3I90 A;  5C3W A;  1ICF B;  2IHE A;  1K3R A;  2ICE C;  2VQE L;  3KK7 A;  4ZUJ A;  1GXD C;  4JI5 Q;  2IX1 A;  4H44 C;  1PH1 A;  5IGB A;  3S16 B;  3Q8D A;  2EXZ A;  4RCN A;  2TSS A;  2K03 A;  2MNA A;  1WFQ A;  2CW0 D;  5EKK A;  3L2P A;  3MAQ A;  4BBS H;  1TS2 A;  3K6O A;  2E75 C;  2NYZ D;  3C3L A;  2ZTD A;  2YU9 H;  1A2T A;  2PW7 A;  4CJ0 B;  2E74 C;  1Q12 A;  5LL6 X;  3S1Q H;  5HGQ A;  4LFC L;  5BR8 L;  5I4D A;  3NWS A;  1SMY D;  2SNS A;  2B63 B;  2LKV A;  3SVM A;  3CMA A;  1N32 L;  1IKM A;  3FPU B;  1LT4 D;  1LTL A;  1ILP A;  2EJF C;  1SAP A;  3G71 A;  2Q2U A;  4B9X A;  3H91 A;  2JA5 G;  4KI0 A;  3D4W A;  4JVZ A;  4A3L G;  5KNB A;  4KLK A;  3CAM A;  2KHI A;  2RCF A;  1K3B C;  1ROD A;  4H13 C;  2K04 A;  3S1M B;  4B3M L;  1MI2 A;  2LXK A;  4HTH A;  2KQ3 A;  2L15 A;  1ZYR D;  2ZXP A;  3ERO A;  4RAU C;  1G91 A;  4A4I A;  3ICE A;  1U5K A;  4R4C A;  3M4O B;  2IY5 B;  2CH4 W;  1FNW A;  2H5X A;  2Q2T A;  2QCP X;  1O7Z A;  4GKJ L;  2K7V A;  2K5W A;  4JI2 Q;  1EL0 A;  2RSN A;  1BCP F;  1EEF D;  3FKI G;  2K01 A;  1BUV T;  3GTM H;  4LF9 L;  3WWV A;  4DR3 Q;  2K5N A;  2B2T C;  3ULJ A;  1JB3 A;  1A62 A;  3LX0 A;  2B2U C;  1SDF A;  3W2D A;  1WTV A;  4C56 C;  1M90 C;  3HOZ H;  4XYQ A;  1H9K A;  4UP7 A;  3QOJ A;  1HUM A;  4FO2 A;  4GN5 A;  2RDF A;  1Q1B A;  1A3T A;  4GLX A;  1F9Q A;  3FVQ A;  1X3E A;  4A3M H;  3S17 B;  3T53 B;  2VQF L;  4A3K H;  1I6H B;  2A6H C;  1YNN C;  3A54 A;  4A93 H;  4J8Q A;  4EGV A;  2HHH Q;  3MEF A;  1D6E C;  3I4M H;  2AUJ D;  2TMP A;  1TR5 A;  1DD2 A;  1EQV A;  1XTD A;  1BBX C;  2VUM G;  2F0W A;  2E2I H;  3J7A V;  1SE8 A;  4R4I A;  4LF8 Q;  3FPP A;  4LUZ A;  2F0J A;  3J7Z C;  2NVQ H;  2NZH A;  3I4L A;  1D7Q A;  3H09 A;  3G48 A;  2EYM A;  4A3E G;  4JK1 C;  2XN9 C;  1YZ6 A;  1XMQ Q;  2O2L D;  1GUW A;  4YCW A;  3PIP A;  4OON A;  3NEM A;  1XNR L;  5C4X G;  3GTL H;  3MXN A;  1MJC A;  4KMU C;  2CQA A;  1HNZ L;  3KF8 B;  2Z0S A;  1RKN A;  3J7Y W;  1PFS A;  2UXB L;  3TZD A;  1XX8 A;  5F2D A;  2VB2 X;  1Q3L A;  4CGY B;  2K4K A;  5IT9 L;  3NEL A;  3TQY A;  1ILQ A;  1CZW A;  2VY3 A;  3HGB A;  1TWA B;  3HOX H;  1HQR D;  2J4X A;  4A3F G;  1HA5 A;  2AWN A;  3RN2 A;  3RNU A;  3CPW A;  5AJ3 Q;  1RL2 A;  3FHW A;  3GTP B;  4PQX A;  4AQY L;  1I5F A;  4CKC A;  5IE8 A;  1KAB A;  4POG A;  5FO8 B;  1N34 L;  1WTW A;  4DR4 L;  3D4D A;  2QIL A;  1S5C D;  2SDF A;  4ABN A;  4QGU A;  5M3F G;  1BF4 A;  2UXD Q;  5HGT A;  5CV4 A;  1BDO A;  1A0I A;  4H0L C;  2QA4 A;  1G2S A;  3FKI B;  1VQ5 A;  3KF6 A;  2K1B A;  3G7L A;  1LTA D;  4JI1 Q;  3OOC A;  4IN3 A;  4DUY L;  4LF7 L;  1HJP A;  1SE3 A;  1W3S A;  2VZA A;  4LF4 Q;  4WJ3 M;  5ELE A;  1NY4 A;  4QUC A;  2PZU A;  2IT1 A;  3FRP B;  1TWG B;  3VR4 A;  3NEN A;  2J0T D;  1XMO L;  3OWE B;  2BH8 A;  5C4H A;  4RHR A;  2BH2 A;  4JYA Q;  2IX3 A;  2H4O A;  5IYD G;  4CDF C;  1HPC A;  2DJF C;  3NE5 B;  3NSW A;  1D1I A;  1WTP A;  2VUM B;  2JA9 A;  4DAV A;  5COY A;  4QCL A;  3OWF A;  2HQE A;  2ZJQ A;  2Y0S G;  5IOC A;  3I70 A;  2NUC A;  2Q8I B;  4PMB A;  5EBC A;  4K14 A;  2NVT B;  3CRL C;  4NDX A;  4JG2 A;  4IUT A;  4B3T L;  4CDC C;  2RCN A;  1LLR D;  4QY7 A;  3NBH A;  5DM7 3;  2EY6 A;  5ELF A;  2Q8T A;  1I4G A;  4P72 A;  2FFK B;  4OWX B;  1MD2 D;  4DR1 L;  1JE5 A;  3OMG A;  5J1Z A;  1GM5 A;  3PIO A;  5C4X B;  1Y1W H;  1KIX A;  3Q23 A;  2KCM A;  3J80 L;  1U4M A;  1HNX Q;  1OXV A;  4X66 Q;  3R2I A;  4FXK C;  1FGB D;  1VQI A;  5E4X A;  2R92 G;  1AH9 A;  4YWK A;  2F0V A;  2WII B;  1SYD A;  4ILW A;  1LAC A;  4A3G G;  3T1H Q;  3LGJ A;  4TVA B;  4GKK Q;  5JJI A;  2BDO A;  4K5X A;  3J81 j;  2F0F A;  5EKL A;  4M1U B;  1SNQ A;  4OEM B;  3L3O C;  4LFB Q;  4A3F B;  1LO5 D;  2BCO A;  1M4V A;  5A2Q L;  1CKN B;  1K0S A;  3W1B A;  1W6J A;  4X65 Q;  5DAU A;  5M3F B;  5ELC A;  2A6E D;  3AFQ A;  1EY5 A;  1XPR A;  3TS0 A;  3BDL A;  2R93 G;  3FEW X;  4LUV A;  4HN7 A;  4DV0 Q;  1HRJ A;  3MFG A;  4DV6 L;  2NN6 I;  3ZJY C;  1E2V A;  4OO1 G;  3N52 A;  3A8J E;  1B7Y B;  4C3J G;  1WTR A;  1SR3 A;  1J5E Q;  4UY8 C;  1K83 H;  1HXY D;  3KLS X;  4IUU A;  4BWG B;  3EN2 A;  1I94 Q;  3C2P A;  2EIF A;  1EY7 A;  4N8X 1;  4BS9 A;  4DV4 L;  3S2D B;  1Z9F A;  3OYY A;  2YV5 A;  3G6J B;  4B3R Q;  2KBN A;  3U4Z A;  1PHJ A;  1JOR A;  2B8G A;  3PUZ A;  4X3S A;  1HA6 A;  3M4Y A;  3TS2 A;  4A3C H;  3HOY G;  5GAH C;  3H0G G;  1PFM A;  1PXU A;  3ZYY X;  1STG A;  4NXN L;  1X3P A;  4F88 A;  1LT5 D;  2RDG A;  2B2Y A;  1SJH D;  2Z1C A;  2A8V A;  4JI8 L;  1OO9 B;  1XYI A;  1UE7 A;  5IYC H;  4RKL A;  1F9R A;  4KN4 C;  5KYL A;  4QUF A;  4YWM A;  2FMM A;  3K7A B;  1PTO D;  2JA8 H;  1JQY D;  4JV5 Q;  4K0K Q;  1IXR A;  1B70 B;  3MXP A;  3MFY A;  4FF3 A;  2XNA C;  1W2B A;  1UWV A;  1FYC A;  2VW9 A;  1YIJ A;  2FMC A;  1SNO A;  4HED A;  1JT8 A;  5IP7 H;  3IFT A;  3TN2 A;  1WYD A;  5CMD A;  3EFX D;  3AB9 A;  1L1O C;  2NTT A;  5IGG A;  4CDD C;  5KEE A;  3PQI A;  4BA1 I;  1WTQ A;  1IKL A;  4HJ9 A;  1VQA A;  3T56 B;  3TP6 A;  2R92 B;  1I3Q H;  3S15 B;  1LT6 D;  1VQG A;  4A3G B;  1N33 L;  5IY0 A;  5GAD C;  4C3H H;  1I4X A;  4LF6 Q;  1NJI C;  1ASZ A;  3BVG A;  2UUB Q;  1B9M A;  4DF7 A;  2JJQ A;  1NCV A;  2NVY B;  4IUQ A;  3TSS A;  4NMZ A;  5C4Z A;  3ULP A;  3VDY A;  3L9A X;  1EIY B;  4DR5 L;  1JC7 A;  2M00 A;  3URY A;  2F0G A;  1OXS C;  1WTX A;  1CM9 A;  2R93 B;  1YEZ A;  4DR2 L;  3F2B A;  5JEA H;  2KEE A;  1CA5 A;  4C3J B;  2D62 A;  4BBR H;  3KF8 A;  2B2Y C;  1SYC A;  3HFZ B;  2G5D A;  2PNR C;  4KHP L;  3HOW G;  2GA4 B;  5C44 G;  2WFW A;  1LAB A;  3NBI A;  3EJI A;  5ELO A;  2F0D A;  1YNX A;  1P16 A;  1GUG A;  4A3B B;  1V8Q A;  1Z6H A;  2M9V A;  4JPB W;  1R9T H;  5CV6 A;  1UNS A;  1IBM Q;  3HOY B;  4WFN 3;  4BY1 H;  1F9S A;  1SYE A;  1CTM A;  4IUV A;  2E5L Q;  3CCR A;  3EVQ A;  3J7A 5;  4LNQ A;  2K5Q A;  2R7Z G;  2ASB A;  1J6Q A;  5FLM G;  2GN5 A;  1TWC H;  2ZTC A;  4HIO A;  1IBK Q;  1E1T A;  3GTJ H;  5EPJ A;  2K33 A;  1RIP A;  3K81 C;  3PUX A;  4N8F A;  3KBG A;  2C9O A;  2NBF A;  4CJ2 C;  4RHS A;  3W5O A;  2D9U A;  5C4J B;  3BG3 A;  3DUZ A;  1QUQ B;  3OTO Q;  4WJ4 A;  5KIX A;  2GVA A;  1HNW L;  5KYI A;  2JSO A;  3PO3 B;  4DV7 Q;  1MIU A;  1HH2 P;  4Y7N H;  3K80 C;  4FDB A;  3CD6 A;  3CC4 A;  4CDE C;  4F8M A;  3SDZ A;  4IO9 A;  3S1R H;  1F9P A;  5FO7 B;  1CT1 D;  2B39 A;  2VNU D;  4KD3 A;  1Q7Y C;  3BZD B;  4BBS G;  4WRD A;  4H7B A;  4LFA Q;  1GHK A;  2HIV A;  1K8O A;  1IYU A;  3CC7 A;  1VF5 C;  1FJG Q;  3FP9 A;  3A5U A;  3NQT A;  1XWE A;  4TSS A;  2MFI A;  1I4R A;  2QGQ A;  1SYB A;  1WTH A;  2ZJR A;  5IGD A;  3DLL A;  1PH8 A;  3HOU H;  2BOS A;  4DUZ L;  1KLU D;  1I4H A;  4AH6 A;  5IT9 c;  2UU9 L;  2EY5 A;  2QDB A;  4JI0 L;  2CFM A;  4G7H C;  1S4Z A;  1STY A;  1X3G A;  1K0R A;  4I7A A;  4FF4 A;  2BE5 D;  1QOH A;  5FJ8 H;  5BN4 A;  2HT1 A;  2O4X A;  1XTC D;  1EY9 A;  2AQ3 B;  2F0M A;  5D3I B;  4L5T A;  2UUA L;  4R4T A;  1QVC A;  1IBL Q;  2NZ1 D;  2PI2 E;  3UE1 A;  1ESR A;  1PZI D;  4IPH A;  1U4L A;  3D6W A;  2LS0 1;  2CWA A;  5CC4 A;  2F52 A;  2X69 A;  3MWY W;  3D6C A;  1RJT A;  1VMC A;  1PH3 A;  4KKS A;  3C46 A;  3S1N B;  2HDM A;  5E1F A;  3NTI A;  4L63 B;  4UPA A;  5C3E H;  1SYF A;  4C2M H;  2KHS A;  2NVX H;  1KC8 C;  2RSO A;  1CKN A;  4F87 A;  3CP0 A;  1I4Q A;  3D4R A;  1IZ6 A;  1SMY C;  4R9W A;  1PYS B;  5M3M H;  1LM0 A;  4HAE A;  1EEI D;  1NBW A;  1GUN A;  2O5I C;  5J22 A;  4IUR A;  5NUC A;  1PYB A;  3U4V A;  1HQM C;  1UE6 A;  2WIN B;  1A8V A;  3HOZ G;  5JJZ A;  5KNC A;  2AKW B;  2CQO A;  3BVZ A;  5M5W H;  3BS1 A;  3PSI A;  1G8Z D;  2LFN A;  2K14 A;  5LMN Q;  1VQK A;  3IFD A;  4MZ9 A;  2A74 C;  3K5O A;  4A3M G;  5K36 H;  1BBU A;  2QW7 A;  3GP7 A;  3I2Z A;  4GN4 B;  2ZXR A;  4A93 G;  1ZYR C;  1PH4 A;  1C48 A;  3P20 A;  3SXH A;  3TP5 A;  3L0O A;  1HZB A;  1HR0 W;  1B44 D;  3GTQ H;  1X32 A;  3J80 c;  4J6H A;  2JE6 I;  3ONA B;  2Z4H A;  2JQO A;  5T1G A;  1PH5 A;  1V1P B;  4GNX C;  1PH2 A;  2IJ0 A;  3VYT A;  1EQT A;  3S1Q B;  2Q2H A;  3J80 i;  4B08 A;  2B2T A;  5CV8 A;  2B2U A;  2SEB D;  1X3Q A;  2JP1 A;  1EIF A;  3TEH B;  4IUP A;  2PCF B;  2KVM A;  4P71 A;  1Y8O B;  3NTH A;  3F2C A;  3WDN A;  3V05 A;  1K8A C;  2C5C A;  1TWH H;  4L5Q A;  3T1Y Q;  1RCV D;  1L1O B;  2QDL A;  5CBE E;  4RH6 A;  2QKI C;  2L9H A;  3CPF A;  3HOV H;  4A3I H;  3WOF A;  4GOP B;  5IP9 G;  1H9R A;  3B6Y A;  4HSP A;  5M5Y H;  4OX9 L;  2EDG A;  4JI1 L;  3KFU A;  1U4P A;  5C0X I;  1DON A;  2L55 A;  4JI4 L;  4IFD G;  1KAW A;  2F0K A;  2K05 A;  4A3J H;  2F0H A;  3ULL A;  4DA2 A;  4GS3 A;  5CV5 A;  2N78 A;  4EX5 A;  2F3V A;  2YTY A;  2E2J B;  2FIN B;  2KEN A;  1UE1 A;  1Y1V B;  1K8G A;  3S16 H;  1N8R C;  5FOB B;  1BOS A;  1KL9 A;  3RLF A;  4DV2 L;  4Q5V A;  1SNC A;  2OT2 A;  1RTO A;  3CHB D;  3OMC A;  1FNU A;  2E2H B;  4MTN A;  4NXM Q;  1IYJ B;  5JPM C;  3RD4 A;  3GDE A;  3VR5 A;  1Q1E A;  2CH4 A;  4MHE A;  3AEV A;  4CJ1 B;  1WD1 A;  1YVC A;  2B63 H;  4OGQ C;  4JW0 A;  4MN3 A;  3GTK B;  5IGC A;  1D8L A;  1WI5 A;  1VQ4 A;  3CCU A;  4XQN A;  4RGT A;  1X6O A;  1YJW A;  4A93 B;  4YHH L;  1T5E A;  2K50 A;  1E1O A;  1PA6 A;  4LAA A;  1HR0 L;  4ZLT F;  2CCZ A;  1LTB D;  3VYR A;  2E2I B;  4JI6 Q;  4A3D G;  1PZJ D;  3STB D;  3HKZ G;  3QOL A;  4PMW A;  5K5P A;  1VMP A;  1Y14 B;  3LNN A;  4U67 3;  1KDB A;  1RF2 D;  3TP8 A;  3VR2 A;  3A55 A;  4HJ7 A;  3CRK C;  3M4O H;  5CV7 A;  1SRU A;  2PI2 A;  5GAG C;  1G6Z A;  1NSN S;  2ID0 A;  2Z6K A;  2JN4 A;  3NK9 A;  1QUQ A;  1S72 A;  4DNT B;  1SXT A;  3DWA A;  5LMU Q;  5G3L D;  1GJX A;  1D1K A;  4I65 A;  4KKU A;  5D14 A;  2F0N A;  1KQS A;  3GTL B;  1WCM H;  1Q81 C;  5CR3 A;  1D5X C;  4J1M A;  5CV9 A;  2K32 A;  1X55 A;  1CHQ D;  4C1N I;  4TRD A;  4KHZ A;  2KJX A;  2WKD A;  3EIV A;  3E0J A;  4GN3 B;  3I55 A;  2SNM A;  4DV1 Q;  3IRB A;  1STB A;  2HCI A;  2I07 B;  4IFD J;  2OCE A;  1PH6 A;  4PZ6 A;  4JI3 Q;  1S5B D;  5FLX E;  3CXC A;  2JA5 B;  1GVP A;  1OXT A;  3CCQ A;  4QQB X;  2Z9H A;  1VS0 A;  1Y69 U;  1FD7 D;  2GVB A;  4X62 L;  3IAY A;  2MO1 A;  2KCN A;  3GTO B;  4LJZ C;  4BY7 H;  3GV6 A;  2B2V A;  2ZTE A;  5EPL A;  4DV3 L;  3K5N A;  3MVV A;  4C3I H;  4DK0 A;  1MSG A;  2F4I A;  2R7F A;  1Z7T A;  2RDH A;  4RGN A;  2N49 A;  3BDC A;  3HP3 A;  2ES2 A;  3BZK A;  1VQB A;  3VYU A;  4TQU S;  5I2Y A;  1SLJ A;  4IAL A;  2VQE Q;  1QZH A;  3AU7 A;  3BJU A;  1TT2 A;  2I5M X;  1BCP D;  1AE3 A;  2KCT A;  3M7G A;  5JAV A;  4MIU A;  1KRS A;  1UUP A;  2NB0 A;  4P2C B;  2Z6K C;  4A3L H;  1S3O A;  3PGZ A;  1EFW A;  4KY5 A;  1S40 A;  2L12 A;  4DR6 L;  1R4P B;  4A3D B;  1CKM A;  5IYC G;  1XPU A;  2XRQ D;  5M5X H;  3PO2 G;  2A6H D;  1PDQ A;  4WJW A;  3K0Y A;  2A6E C;  1GUT A;  1TY0 A;  5IGE A;  1LTI D;  4LFC Q;  5BR8 Q;  3H3V C;  2JA8 G;  3GTP H;  4RWS C;  1FR3 A;  1I50 H;  2F0U A;  1E2Z A;  1PYW D;  4OIJ A;  3F1Z A;  4NW2 A;  1F77 A;  2SOB A;  1N32 Q;  1AFP A;  5IP7 G;  1EUJ A;  1F2L A;  3DXJ C;  2NN6 H;  3F8T A;  3TRE A;  1UAP A;  2Q8R E;  3J81 E;  3FKI H;  1B9N A;  1DYQ A;  3DHQ A;  4IJH A;  4KY6 A;  4A3E B;  3VR6 A;  1PVO A;  1DZ1 A;  1CSQ A;  5JVH 3;  2UXC L;  2L1B A;  4B3M Q;  1VQ6 A;  1C7Y A;  2B2V C;  1R4Q B;  4C3H G;  2JA6 H;  4POF A;  5KND A;  2ZM6 L;  4RKB A;  2F0T A;  4GNX B;  2MJ8 A;  1TWG H;  1V1P A;  1LYL A;  3KLW A;  3IL8 A;  4YY3 L;  1I4P A;  4GKJ Q;  1O78 A;  2MUY A;  1TS4 A;  2F4V L;  1PTO C;  2KA7 A;  4N9T A;  1E7Z A;  1Y8P B;  3J81 c;  4YWL A;  2VUM H;  2LSS A;  1KHI A;  4ALP A;  1NMF A;  4LF9 Q;  4GLA C;  2A68 D;  1EIH A;  1UEB A;  3PUV A;  3I91 A;  4MNO A;  1L2F A;  5JEA G;  1L1O A;  2DJG C;  1ET6 A;  2OTJ A;  3KYH C;  4BBR G;  1EIG A;  1ENF A;  4IPC A;  3QG1 A;  2XSC A;  4X64 L;  1VQN A;  1KD1 C;  1YHQ A;  2XVS A;  2A69 C;  2PQE A;  2VQF Q;  2OQ0 A;  4DV5 L;  5C4X H;  4X3K A;  3CC2 A;  2D2C C;  4K5V A;  4AYB G;  5LMN W;  2L4N A;  1TS5 A;  4BY1 G;  2PQA B;  1ENA A;  1A3V A;  2NZO A;  4B3S L;  5I9P A;  1YNJ D;  4ME3 A;  2N55 A;  2WAQ G;  1C8C A;  3GTG B;  3MXU A;  2AQ1 B;  3NXW A;  1VQD A;  5D3D A;  2FJ2 A;  4L6T B;  2EY2 A;  4EVO A;  4I7Z C;  4DAP A;  1C0A A;  1KDC A;  2ZJP A;  1SEB D;  3IKJ A;  1E3P A;  3PO2 B;  3DM1 A;  1JWS D;  4S3S A;  5JVG 3;  2JYO A;  2NWG A;  2QEJ C;  4A3F H;  1FNV A;  2JA8 B;  2A19 A;  1XNR Q;  1QCB D;  3LWU A;  2AWO A;  2EZV A;  1ICW A;  2CKZ B;  4ODG A;  2G9D A;  3V2T A;  1FGU A;  3ER0 A;  3NPP A;  3T4A C;  2X6L A;  4NP5 A;  2Y0S B;  1K8M A;  4WOR A;  1HNZ Q;  4ZQ3 A;  5C5M A;  2XWB B;  4LF5 L;  2UXB Q;  5IYB H;  1I3Q B;  2EVB A;  2YTX A;  3TDQ A;  4QIW B;  2IX0 A;  5EPK A;  3S2D H;  3RZO H;  4DR7 L;  1B1Z A;  2MGS A;  1SFO B;  2OWO A;  1JR0 D;  1CZG A;  4AQY Q;  4R4O A;  4BXX G;  3KJO A;  1V9P A;  1YJ9 A;  2N8N A;  1N9W A;  4XT3 B;  4GOP C;  1N34 Q;  4DR4 Q;  5ISR A;  4CBV A;  4JI7 L;  1VQE A;  2KUM A;  1JJC B;  4GZY C;  1NUC A;  2ZXO A;  4KD4 A;  5IWA L;  1P8L A;  2B2W A;  5FJ8 G;  1EYG A;  3DEP A;  4K6D A;  1BXT A;  4GLV B;  1S5E D;  1ZEQ X;  1N36 L;  1AE2 A;  3E9H A;  4HCS A;  2JEA I;  4O42 A;  5JEA J;  4BBR B;  4DUY Q;  4LF7 Q;  2E8G A;  1RHP A;  1WOC A;  4JCV E;  3CU7 A;  1TWF B;  5DLQ E;  1XNQ L;  1C4Q A;  2Y0S E;  1AP0 A;  4EQO A;  4A76 A;  1JJ2 A;  4A75 A;  2F1M A;  4IZ8 A;  1XMO Q;  1AW7 A;  4XYO A;  2UUC L;  1QB5 D;  4HJ8 A;  5C3E G;  3WOE A;  3J7A F;  3NP8 A;  4BY1 B;  2JEB I;  1PZK D;  3CF5 A;  3RZD B;  1IHZ A;  2R92 H;  3TZU A;  1B2T A;  1SND A;  4QIW E;  1NAP A;  2WAC A;  3M4P A;  3S15 H;  1Z47 A;  3A8K E;  3M3Y H;  1L0Y B;  1O80 A;  2PNH A;  1PMR A;  2QF7 A;  3D3R A;  2JA7 G;  1EQR A;  2RF4 A;  3NUC A;  1SBB B;  2R6G A;  3RR5 A;  1GO3 E;  4B3T Q;  2LY7 A;  3H0G B;  2BE5 C;  3BDO A;  2A5H A;  2NVY H;  4JI5 L;  4K2K A;  5AFW A;  4O2D A;  1VQ7 A;  4OIK A;  3JAM E;  3DWQ A;  1JE4 A;  4DR1 Q;  2F0O A;  4Y7N B;  4ZRZ A;  5FLX L;  1KRT A;  4JBW A;  2L5T A;  4ZK9 B;  3H15 A;  3FMC A;  1EYA A;  2E2D C;  1TS3 A;  3U9S A;  1D5M C;  2B2W C;  2PPB C;  4IOC A;  1SE2 A;  2HUG A;  3ERS X;  1EY6 A;  2EE1 A;  2F3W A;  4A3B H;  5FKA C;  1EY8 A;  3E6Z X;  3VA7 A;  1EWH A;  1ASY A;  4OXP A;  2WV6 D;  3HOY H;  1XXG A;  3EA6 A;  5I2X A;  3S14 B;  3PUY A;  1NTG A;  4JBM A;  3I4N H;  2DUD A;  4RFB A;  4LMQ D;  4Y52 H;  4DV6 Q;  1LTG D;  1JMC A;  4L5S A;  3HOV G;  4F7X A;  3S2H B;  2KED A;  1B3A A;  1KLG D;  5CGK A;  4DV4 Q;  1YBY A;  2MQH A;  5EJW A;  4DU9 A;  2EYL A;  1H9J A;  4ME5 A;  3V96 A;  4A3J G;  3NTK A;  1EYD A;  3PO3 H;  3RLN A;  2EOT A;  3K58 A;  4JI2 L;  4P75 A;  1UE5 A;  2DN8 A;  1TU2 B;  2B29 A;  4HMJ A;  4NXN Q;  3I8Z A;  3TBI B;  4GNX A;  1SSO A;  3SK6 A;  3ND8 A;  1B8A A;  4P73 A;  4DR3 L;  4JI8 Q;  5A35 A;  1LTR D;  1PTO B;  4OO1 I;  2PW5 A;  1PLF A;  3HOW B;  3MC0 B;  2R61 A;  5C44 B;  2IHF A;  3W1G A;  3M4Q A;  2CW0 C;  1VQ9 A;  3J81 L;  2JA7 B;  5GQO A;  1PRT D;  5ELB A;  2F0S A;  3GV3 A;  4FF1 A;  3QJY A;  4K2L A;  5ELN A;  4DK6 C;  2HHH L;  1QWY A;  3A7A B;  2RHQ B;  4DPG A;  1ML0 D;  1JOQ A;  1K73 C;  5C5L A;  1X54 A;  2R7Z B;  3CQZ H;  1K9M C;  1H9S B;  4OHJ A;  2B63 G;  1QNU A;  4MTK A;  1DJR D;  3M9B A;  1V1Q A;  3E5S A;  3C1F A;  4LF8 L;  1VQ8 A;  3SHL A;  3K8A A;  5C0X H;  2PQA A;  1NMG A;  1ZKO A;  1ZXT A;  2I5L X;  1DM0 B;  1N33 Q;  4HID A;  1G2T A;  1PFN A;  3GTQ B;  1XMQ L;  5ELD A;  3VR3 A;  5KGU A;  2RKS A;  3QIA A;  3NHH A;  3S1N H;  1EWI A;  2CVR A;  4A3K G;  4FF2 A;  3R8B A;  2Q2I A;  1NNX A;  3I4M G;  3RUZ A;  4DR5 Q;  3P75 A;  4LW1 A;  2J7Z A;  3H3V I;  2PO4 A;  4BBS B;  2V1C C;  4PNY A;  5DM6 3;  4DR2 Q;  2YU9 B;  2OF1 A;  1WVL A;  2FHT A;  3HEJ A;  5FLM H;  1CQF A;  2MO0 A;  1K28 A;  4QMG A;  1WCM G;  1ONL A;  1JJG A;  3SGI A;  3RN5 A;  3QB3 A;  1IYV A;  3A56 A;  3GO5 A;  5AJ3 L;  4PZ8 A;  4KHP Q;  2HQL A;  1E22 A;  4FP5 D;  2MP1 A;  3G6E A;  2M2L A;  4LUO A;  2EY1 A;  2EXD A;  1HFG A;  5GRO A;  1SN8 A;  3KUP A;  1YHB A;  1A2U A;  3BVM A;  3TME A;  2VL6 A;  3MA2 B;  5C6A A;  2UXD L;  4XIG S;  3STB C;  2A1A A;  1Q8I A;  4XT1 B;  3Q24 A;  1M8A A;  1EZ8 A;  1GHJ A;  2D0O A;  2ZT9 C;  1HZA A;  4PV1 C;  1EOT A;  4G7Z C;  2EYH A;  3DMU A;  3PCO B;  4QL5 A;  3MXG A;  2Z6B A;  1X9N A;  1CSP A;  2K28 A;  3QR8 A;  1JWM D;  2N88 A;  4DN4 M;  4BY7 G;  5G3L F;  2OTL A;  5HY6 A;  4HMI A;  2IW3 A;  4NPS A;  3HOX G;  3A7L A;  4ZKB B;  4C3I G;  1S5F D;  2LXJ A;  4LF4 L;  1O7L A;  3X3N A;  1J8I A;  2ENB A;  4X3T A;  2F0Q A;  1IW7 D;  1HZC A;  1HNW Q;  3VA5 A;  1PH9 A;  5IGF A;  4JYA L;  1T9H A;  1WD0 A;  1J9O A;  2B3G A;  1GUS A;  2KHJ A;  4NB3 A;  1E2W A;  2HD3 A;  3AQQ A;  5JJK A;  2HDL A;  3GTM B;  4DXF A;  4KKT A;  3HRZ C;  1IL2 A;  1PH7 A;  4DGZ A;  4XTC S;  4OL7 A;  3HOZ B;  1Q8K A;  1B4O A;  1EOV A;  3K5M A;  3T16 A;  2VS1 A;  1KDA A;  1VF7 A;  5BN5 A;  4A3M B;  1GOZ A;  1HCZ A;  2FXQ A;  3PMF A;  3T51 B;  4A3K B;  4DUZ Q;  4KK7 A;  3I4M B;  2UU9 Q;  2E2J H;  4JI0 Q;  1NR4 A;  1HNX L;  4X66 L;  4YCV A;  5E7N A;  2HCC A;  3Q0A A;  1Y1V H;  1LTT D;  1DGS A;  4IUN A;  1YHA A;  2EPB A;  3S1M H;  2NN6 G;  3T1H L;  2UUA Q;  4GKK L;  1YI2 A;  4LWC A;  1CKO A;  3A0J A;  4Q0F A;  4HJA A;  2NVQ B;  1WCM B;  3D0F A;  1PRT B;  4LFB L;  3NWT A;  3HZX A;  1MJE A;  1DOL A;  3I3C A;  4HJ5 A;  1BCP C;  2E2H H;  1TVX A;  1VQC A;  2KEC A;  1MKH A;  5LL6 S;  3PF4 A;  4DXG A;  1UEA B;  4OWW B;  1Q46 A;  2JA6 G;  1Y1W G;  4X65 L;  4JOI A;  4KJO A;  5IOD A;  2CHB D;  2DY8 A;  3GTK H;  1JB7 A;  1GKH A;  3A5Z B;  5T1I A;  2V4D A;  4B9W A;  4DV0 L;  3UDG A;  2R3Z A;  3JAM L;  4HR7 B;  1J5E L;  4EQ5 A;  4FYD A;  1G29 1;  1HHV A;  1SRO A;  3OW2 A;  4BY7 B;  4DAM A;  1V43 A;  1I94 L;  2WB1 G;  3KLR A;  1OXU A;  3HOX B;  1XJV A;  3Q6S A;  1LV9 A;  3S17 H;  4C3I B;  4B3R L;  2F0E A;  4ZCK A;  3SK5 A;  1OXX K;  1VQJ A;  1I6H H;  4KN7 C;  5J3B A;  3F2U A;  3K57 A;  1EZ6 A;  1M1K C;  1BR9 A;  5EBD A;  1E24 A;  2RA4 A;  3C1E A;  3U58 A;  4OEL B;  3CCE A;  4IPD A;  3JC6 6;  3M7N A;  3DWP A;  2I46 A;  1F2Y A;  2A73 B;  1VCI A;  3A74 A;  1TQO A;  5IP9 H;  4JV5 L;  4K0K L;  2D5D A;  4DAY B;  5FLX c;  1KTK A;  1VQH A;  1BBW A;  4YCU A;  4QJF A;  4IFD H;  1D5Z C;  1O7I A;  1STH A;  4XDX A;  3T13 A;  5M5X B;  4A3C G;  2KCC A;  4RGM A;  4DFA A;  4KHV A;  2JA5 H;  2ICI A;  2A68 C;  1I50 B;  3O13 A;  4P74 A;  4DK3 C;  1JIC A;  3M85 A;  5EQ0 A;  4JBK A;  4FXD A;  5D65 A;  1QVG A;  3EBE A;  2HIX A;  1A6X A;  3E9I A;  1VQF A;  5L37 A;  3GTO H;  3U50 C;  1QVF A;  4R8I A;  1H9S A;  4JOI C;  1CUK A;  5EAY A;  1EY4 A;  3HKZ B;  1YNN D;  1TWA H;  2K5V A;  3SE0 A;  3I72 A;  1Q86 C;  2OEO A;  4LF6 L;  4OX9 Q;  3OHX C;  5IYB G;  2OQK A;  1L0X B;  3RMH A;  4CHT B;  3KJP A;  2UUB L;  4JI4 Q;  3I56 A;  3CCJ A;  4K8J A;  1T5X D;  4HIM A;  1YNJ C;  3DM3 A;  4KY7 A;  2JA6 B;  3PF5 A;  1Y1W B;  3CCV A;  2YYZ A;  4QB4 A;  4IPG A;  1G51 A;  4FNF A;  5GAE C;  4DV2 Q;  3MHB A;  4A3D H;  5KRU A;  2WB1 B;  4L8J A;  4IFD I;  1X56 A;  1PTO F;  1QG7 A;  4UP9 A;  2G9H D;  1FVI A;  1QE6 A;  3L7Z C;  4KTA A;  1IBM L;  4FXG C;  1AEX A;  4KV6 A;  4HIK A;  3BYT B;  5C3X A;  2KOL A;  3OW7 A;  1C9O A;  2E5L L;  1A3U A;  3HKZ E;  1RTN A;  5TSS A;  3J81 i;  1EQQ A;  4IQZ A;  4YHH Q;  5EKI A;  2PMZ B;  3N6R A;  2NVT H;  1HR0 Q;  1IBK L;  2BDN A;  1K83 B;  2F03 A;  4A3E H;  2D0P A;  3TP7 A;  4ZAI A;  1LTS D;  3HKS A;  4GOP A;  3EQL C;  5COR A;  1BNZ A;  1BO0 A;  1QNK A;  3CCS A;  3F2D A;  3KDF B;  5EGT A;  3OTO L;  3UDI A;  1JWU D;  4RCO A;  4X6A H;  1NR2 A;  2XRS D;  5CYU A;  2Z8L A;  4DV7 L;  1DCZ A;  1F2Z A;  4O1N A;  2PZT A;  1VQL A;  2QEX A;  3I73 A;  3MZ5 A;  3BZC A;  5I6W A;  3CME A;  2F0I A;  2WB1 E;  3KOJ A;  1DXM A;  3VYS A;  1MHW C;  4LFA L;  1I6V C;  2LMC B;  4R1J A;  4KJN A;  2DY7 A;  3I4O A;  2EJM A;  1HUN A;  5LHY 1;  1FJG L;  4PMC A;  1X3F A;  2PZW A;  3PUW A;  2PYK A;  1X65 A;  4OWT B;  3R2T A;  1CFM A;  2VXW A;  1VDZ A;  4LK1 C;  5FO9 B;  2K5D A;  2R7D A;  3RZO B;  1EU3 A;  3D31 A;  2IWH A;  3UDX A;  5M3F H;  3MEH A;  1HFN A;  2PMZ E;  1V1O A;  4XQQ A;  4A3B G;  4V19 0;  4JC0 A;  1GD7 A;  1KAA A;  2XWJ B;  1HTP A;  3A8I E;  1YIT A;  4RGO S;  4X62 Q;  3GQB A;  1TKW B;  4IJL A;  3D8G A;  3MTS A;  1IBL L;  2DGY A;  2WP8 J;  3GTG H;  2ATW A;  3UDF A;  2EYJ A;  4CKB A;  4DV3 Q;  3I4N G;  4G57 A;  4RMF A;  4C3H B;  4DK1 A;  1LUZ A;  5E3F A;  5JJL A;  1HZ9 A;  4K5W A;  4E6I A;  1PFB A;  1AN8 A;  5I9O A;  3PO2 H;  3QWN A;  1BKB A;  2VB3 X;  3HOU G;  2RBM A;  1BCP B;  1Q82 C;  4DNI A;  1QZG A;  1KNA A;  3H94 A;  5IYD H;  3ND9 A;  3Q22 A;  3E3X A;  4N9P A;  3PO3 G;  4ID6 A;  2EYP A;  1BVS A;  2X6G A;  1AZQ A;  1KNE A;  3S9W A;  3K7A H;  1GUO A;  1CQV A;  2ALY B;  1ESF A;  4DR6 Q;  2A69 D;  3CW2 C;  3M3Y B;  4U68 A;  1B3Q A;  3RLO A;  1STE A;  3S24 A;  1B50 A;  1STN A;  1SFO H;  5LMN L;  1R9T B;  1TXY A;  1BQQ T;  4O0A A;  4ZUI A;  4XXE A;  3GD7 A;  4AYB B;  2YTV A;  4TKO B;  4G7O C;  5HUR A;  1W6K A;  1TII D;  3OIP A;  2EYF A;  3W3A A;  4L5R C;  2JXM B;  1H95 A;  2MHV A;  2WAQ B;  1SYG A;  2MPM A;  3SK4 A;  3AMU A;  4A3G H;  5M3M G;  4XQJ A;  1TWC B;  3K0X A;  5DNF A;  3GTJ B;  1DOM A;  1LT3 D;  1NE3 A;  1II3 A;  2L11 A;  4R4Q A;  4PZ7 A;  1U4R A;  4QF4 A;  5C0X G;  2UXC Q;  2I5H A;  3AFP A;  5CBA E;  3PIP 3;  2AUK A;  3P7J A;  2I0Q A;  4K8I A;  3G4S A;  3CCL A;  2IL8 A;  1CHP D;  5K36 G;  1PRT F;  2L0C A;  4DAY A;  5IIF A;  1TWF H;  2ZM6 Q;  3PV0 A;  4ZKC B;  2R93 H;  3S1R B;  4EQN A;  4YY3 Q;  4HSV A;  1PRT C;  3T1Y L;  3TRZ A;  3DEO A;  3UI2 A;  2F4V Q;  1JOO A;  4OO1 H;  4C3J H;  1G6P A;  1L0W A;  3K7U C;  3R93 A;  3RZD H;  4K6L A;  1SE4 A;  1AZP A;  2C35 B;  3I4N B;  4X3U A;  1A15 A;  2AHO B;  4UAI A;  1SJE D;  1FL0 A;  4AYB E;  4APV A;  2F3I A;  4H02 A;  2O5J C;  4PG3 A;  1S5D D;  2BA0 A;  3JAM c;  1MBY A;  1O7Y A;  3H0G H;  3R3O A;  3HOU B;  1EYC A;  3KLS A;  4X64 Q;  1A63 A;  1MSH A;  2EQS A;  2WAQ E;  1D2B A;  3H6M A;  3SEB A;  2XIW A;  3JAM i;  3KBX A;  1YJN A;  1SNM A;  4HCE A;  4R8N A;  2F0P A;  4DV5 Q;  4ULL A;  2XGT A;  5I6Y A;  1CA6 A;  3I7F A;  5IT9 E;  1HTL D;  2K75 A;  4A3I G;  2JK8 A;  4B3S Q;  3OPO A;  1WTO A;  1F2M A;  2AQ2 B;  2Z4I A;  5C4J H;  4CKE A;  5J39 A;  4FVM A;  4NXM L;  3X3M A;  3HS0 C;  4NKL A;  4JBJ A;  3P1H A;  1B53 A;  1VQP A;  4V0B A;  1QJO A;  2RVL A;  2F0L A;  3MXN B;  5C3E B;  4C2M B;  4BXX H;  1WJJ A;  1RDP D;  2IPK D;  1U9R A;  2N3S A;  4YIJ A;  3H3V H;  2NVX B;  2K5H A;  3CKI B;  2EJG C;  4Z9C B;  3S14 H;  3CQZ B;  2DNE A;  5JOB A;  5M9O A;  5M3M B;  5BN3 A;  4JI6 L;  3CCM A;  1EWC A;  4LF5 Q;  1KXL A;  1DOK A;  3QO2 A;  1RD9 D;  1CI3 M;  1TY2 A;  4UP8 A;  3S2H H;  2BA1 A;  4EQP A;  4ZYS A;  2CWP A;  1EY0 A;  1CK1 A;  5M5W B;  5C0X J;  1QIL A;  1IL8 A;  4AIM A;  4DR7 Q;  3PIO 3;  1SMX A;  3KDF A;  4UDU C;  3OSO A;  4C1N K;  3ERQ A;  5LMU L;  3KF6 B;  4RA8 A;  2EYO A;  3AYH B;  4JI7 Q;  1H9M A;  1U0L A;  3NQI A;  2NTS A;  3U9O A;  2DNC A;  1E0B A;  1Y1V G;  2RHS B;  5IWA Q;  1PTO H;  1IW7 C;  2RQX A;  3SR1 A;  1PV4 A;  2AMC B;  1STA A;  2K52 A;  3HOW H;  2E76 C;  5C44 H;  1N36 Q;  2P5Z X;  3UE0 A;  2JA7 H;  5DEH A;  1MGS A;  3FDT A;  4DV1 L;  1XPO A;  3BU2 A;  1OTC A;  1JCK B;  1ENC A;  1VQM A;  4JI3 L;  3J80 E;  4BA2 I;  3BYY B;  3ITP A;  3LWE A;  3K5L A;  1Q90 A;  1XNQ Q;  3HG9 A;  5FK9 C;  5E4W C; 
#chains in the Genus database with same CATH homology
 3SK8 A;  1ET9 A;  1TWH B;  1EU4 A;  3HOV B;  2H1E A;  4A3I B;  4DNR B;  1JOK A;  4G4K A;  4M8A A;  3K59 A;  2B8F A;  5M5Y B;  2WKC A;  1Y8N B;  5JPN C;  1SNP A;  2K6A A;  5A2Q E;  4A3J B;  1EFI D;  2OXP A;  3OIQ A;  3I90 A;  5C3W A;  2ICE C;  3KK7 A;  4ZUJ A;  1GXD C;  2IX1 A;  4H44 C;  5IGB A;  3S16 B;  2EXZ A;  4RCN A;  2TSS A;  2K03 A;  2CW0 D;  5EKK A;  3MAQ A;  1TS2 A;  3K6O A;  2E75 C;  2NYZ D;  3C3L A;  1A2T A;  2PW7 A;  4CJ0 B;  2E74 C;  1Q12 A;  5LL6 X;  5I4D A;  3NWS A;  1SMY D;  2SNS A;  2B63 B;  2LKV A;  3SVM A;  1IKM A;  3FPU B;  1LT4 D;  1ILP A;  2EJF C;  1SAP A;  4B9X A;  3H91 A;  4KI0 A;  3D4W A;  5KNB A;  1ROD A;  4H13 C;  2K04 A;  3S1M B;  1MI2 A;  4HTH A;  2KQ3 A;  2ZXP A;  1ZYR D;  3ERO A;  4RAU C;  1G91 A;  3M4O B;  1FNW A;  2QCP X;  1O7Z A;  2K7V A;  2K5W A;  1EL0 A;  2RSN A;  1BCP F;  1EEF D;  2K01 A;  1BUV T;  2B2T C;  1JB3 A;  3W2D A;  2B2U C;  3LX0 A;  1SDF A;  1WTV A;  4C56 C;  4XYQ A;  1H9K A;  3QOJ A;  1HUM A;  4FO2 A;  2RDF A;  1Q1B A;  1A3T A;  1F9Q A;  3FVQ A;  3S17 B;  3T53 B;  1I6H B;  2A6H C;  1YNN C;  3A54 A;  4J8Q A;  4EGV A;  1D6E C;  2AUJ D;  2TMP A;  1TR5 A;  1DD2 A;  1EQV A;  1BBX C;  2F0W A;  3J7A V;  3FPP A;  2F0J A;  3I4L A;  3H09 A;  2EYM A;  4JK1 C;  2XN9 C;  2O2L D;  1GUW A;  3MXN A;  4KMU C;  2CQA A;  1RKN A;  3J7Y W;  3TZD A;  1XX8 A;  5F2D A;  2VB2 X;  1Q3L A;  4CGY B;  5IT9 L;  1ILQ A;  1CZW A;  3HGB A;  1TWA B;  1HQR D;  2J4X A;  1HA5 A;  2AWN A;  3GTP B;  4PQX A;  4CKC A;  1KAB A;  5FO8 B;  1WTW A;  3D4D A;  2QIL A;  1S5C D;  2SDF A;  4ABN A;  1BF4 A;  5HGT A;  5CV4 A;  1BDO A;  4H0L C;  1G2S A;  3FKI B;  2K1B A;  3G7L A;  1LTA D;  3OOC A;  4IN3 A;  1SE3 A;  5ELE A;  4QUC A;  2PZU A;  2IT1 A;  3FRP B;  1TWG B;  3VR4 A;  2J0T D;  3OWE B;  5C4H A;  4RHR A;  2IX3 A;  2H4O A;  1HPC A;  3NE5 B;  3NSW A;  1D1I A;  1WTP A;  2VUM B;  4DAV A;  5COY A;  4QCL A;  3OWF A;  2HQE A;  5IOC A;  3I70 A;  2NUC A;  2Q8I B;  4PMB A;  5EBC A;  4K14 A;  2NVT B;  3CRL C;  4NDX A;  4IUT A;  1LLR D;  3NBH A;  5DM7 3;  2EY6 A;  5ELF A;  2Q8T A;  1I4G A;  2FFK B;  1MD2 D;  3OMG A;  5J1Z A;  5C4X B;  3Q23 A;  3J80 L;  1U4M A;  1OXV A;  3R2I A;  4FXK C;  1FGB D;  5E4X A;  2F0V A;  2WII B;  1SYD A;  4ILW A;  1LAC A;  2BDO A;  4K5X A;  2F0F A;  5EKL A;  4M1U B;  1SNQ A;  3L3O C;  4A3F B;  1LO5 D;  2BCO A;  1M4V A;  5A2Q L;  1W6J A;  5DAU A;  5M3F B;  5ELC A;  2A6E D;  1EY5 A;  3BDL A;  3FEW X;  4HN7 A;  1HRJ A;  3MFG A;  2NN6 I;  1E2V A;  4OO1 G;  3N52 A;  3A8J E;  4C3J G;  1WTR A;  1HXY D;  3KLS X;  4IUU A;  4BWG B;  3C2P A;  1EY7 A;  4BS9 A;  3S2D B;  3G6J B;  1JOR A;  2B8G A;  3PUZ A;  4X3S A;  1HA6 A;  3M4Y A;  1PFM A;  1PXU A;  3ZYY X;  1STG A;  1X3P A;  4F88 A;  1LT5 D;  2RDG A;  2B2Y A;  1SJH D;  2Z1C A;  1OO9 B;  1XYI A;  4RKL A;  1F9R A;  4KN4 C;  5KYL A;  4QUF A;  2FMM A;  3K7A B;  1PTO D;  1JQY D;  3MXP A;  3MFY A;  4FF3 A;  2XNA C;  1FYC A;  2FMC A;  1SNO A;  4HED A;  3IFT A;  3TN2 A;  5CMD A;  3EFX D;  3AB9 A;  2NTT A;  5IGG A;  5KEE A;  4BA1 I;  1WTQ A;  1IKL A;  3T56 B;  3TP6 A;  2R92 B;  3S15 B;  1LT6 D;  4A3G B;  1I4X A;  3BVG A;  1B9M A;  4DF7 A;  1NCV A;  2NVY B;  4IUQ A;  3TSS A;  4NMZ A;  5C4Z A;  3L9A X;  1JC7 A;  2M00 A;  3URY A;  2F0G A;  1OXS C;  1WTX A;  1CM9 A;  2R93 B;  5JEA H;  2KEE A;  1CA5 A;  4C3J B;  2D62 A;  3KF8 A;  2B2Y C;  1SYC A;  2PNR C;  2GA4 B;  3NBI A;  1LAB A;  3EJI A;  2F0D A;  1GUG A;  4A3B B;  1V8Q A;  1Z6H A;  2M9V A;  5CV6 A;  1UNS A;  3HOY B;  4WFN 3;  1F9S A;  1SYE A;  1CTM A;  4IUV A;  3EVQ A;  2K5Q A;  5EPJ A;  2K33 A;  3PUX A;  3KBG A;  2C9O A;  2NBF A;  4CJ2 C;  4RHS A;  2D9U A;  5C4J B;  3BG3 A;  3DUZ A;  5KIX A;  5KYI A;  2JSO A;  3PO3 B;  4F8M A;  3SDZ A;  1F9P A;  5FO7 B;  1CT1 D;  2B39 A;  2VNU D;  4KD3 A;  3BZD B;  4WRD A;  4H7B A;  1GHK A;  1K8O A;  1IYU A;  1VF5 C;  3NQT A;  1XWE A;  4TSS A;  1I4R A;  1SYB A;  5IGD A;  2BOS A;  1KLU D;  1I4H A;  2EY5 A;  2QDB A;  4G7H C;  1S4Z A;  1STY A;  4FF4 A;  2BE5 D;  1QOH A;  5BN4 A;  2O4X A;  1XTC D;  1EY9 A;  2AQ3 B;  2F0M A;  5D3I B;  2NZ1 D;  1ESR A;  1PZI D;  1U4L A;  3D6W A;  2LS0 1;  5CC4 A;  2X69 A;  3MWY W;  3D6C A;  1RJT A;  1VMC A;  4KKS A;  3C46 A;  3S1N B;  2HDM A;  5E1F A;  3NTI A;  4L63 B;  1SYF A;  2KHS A;  2RSO A;  4F87 A;  1I4Q A;  3D4R A;  1SMY C;  4R9W A;  4HAE A;  1EEI D;  1GUN A;  2O5I C;  5J22 A;  4IUR A;  5NUC A;  1HQM C;  2WIN B;  5JJZ A;  5KNC A;  3BVZ A;  3BS1 A;  1G8Z D;  2LFN A;  3IFD A;  2A74 C;  3K5O A;  5K36 H;  3GP7 A;  2ZXR A;  1ZYR C;  1C48 A;  3P20 A;  3SXH A;  3TP5 A;  1B44 D;  1X32 A;  4J6H A;  2JE6 I;  3ONA B;  2Z4H A;  5T1G A;  1V1P B;  2IJ0 A;  3VYT A;  1EQT A;  3S1Q B;  4B08 A;  2B2T A;  5CV8 A;  2B2U A;  2SEB D;  1X3Q A;  2JP1 A;  4IUP A;  2PCF B;  2KVM A;  1Y8O B;  3NTH A;  3WDN A;  3V05 A;  2C5C A;  1RCV D;  5CBE E;  4RH6 A;  2QKI C;  2L9H A;  3WOF A;  1H9R A;  4HSP A;  2EDG A;  1U4P A;  5C0X I;  1DON A;  2L55 A;  4IFD G;  2K05 A;  2F0K A;  2F0H A;  4DA2 A;  5CV5 A;  2F3V A;  2E2J B;  2FIN B;  1Y1V B;  5FOB B;  1BOS A;  3RLF A;  4Q5V A;  1SNC A;  2OT2 A;  1RTO A;  3CHB D;  3OMC A;  1FNU A;  2E2H B;  5JPM C;  3RD4 A;  3VR5 A;  1Q1E A;  4MHE A;  4CJ1 B;  1WD1 A;  4OGQ C;  4MN3 A;  3GTK B;  5IGC A;  4XQN A;  4RGT A;  4A93 B;  1T5E A;  4LAA A;  4ZLT F;  1LTB D;  3VYR A;  2E2I B;  1PZJ D;  3QOL A;  4PMW A;  5K5P A;  1VMP A;  3LNN A;  4U67 3;  1KDB A;  1RF2 D;  3TP8 A;  3VR2 A;  3A55 A;  3CRK C;  5CV7 A;  1G6Z A;  1NSN S;  2ID0 A;  3NK9 A;  4DNT B;  1SXT A;  3DWA A;  5G3L D;  1GJX A;  1D1K A;  4I65 A;  4KKU A;  5D14 A;  2F0N A;  3GTL B;  5CR3 A;  1D5X C;  4J1M A;  5CV9 A;  2K32 A;  1CHQ D;  4C1N I;  4TRD A;  4KHZ A;  2KJX A;  2WKD A;  3E0J A;  2SNM A;  1STB A;  2HCI A;  2I07 B;  4IFD J;  1S5B D;  5FLX E;  2JA5 B;  1OXT A;  1Y69 U;  1FD7 D;  3IAY A;  2KCN A;  3GTO B;  4LJZ C;  3GV6 A;  2B2V A;  5EPL A;  3K5N A;  3MVV A;  4DK0 A;  1MSG A;  2F4I A;  1Z7T A;  2RDH A;  4RGN A;  3BDC A;  3HP3 A;  3VYU A;  4TQU S;  5I2Y A;  4IAL A;  3AU7 A;  1TT2 A;  1BCP D;  3M7G A;  5JAV A;  4MIU A;  1UUP A;  2NB0 A;  4P2C B;  4KY5 A;  2L12 A;  1R4P B;  4A3D B;  2XRQ D;  2A6H D;  1PDQ A;  4WJW A;  5IGE A;  3K0Y A;  2A6E C;  1GUT A;  1TY0 A;  1LTI D;  3H3V C;  4RWS C;  1FR3 A;  2F0U A;  1E2Z A;  1PYW D;  4OIJ A;  4NW2 A;  1F77 A;  2SOB A;  1AFP A;  1F2L A;  3DXJ C;  2NN6 H;  1UAP A;  2Q8R E;  3J81 E;  1B9N A;  1DYQ A;  3DHQ A;  4KY6 A;  4A3E B;  3VR6 A;  1DZ1 A;  5JVH 3;  2L1B A;  2B2V C;  1R4Q B;  4C3H G;  5KND A;  4RKB A;  2F0T A;  2MJ8 A;  1V1P A;  3IL8 A;  1I4P A;  1O78 A;  2MUY A;  1TS4 A;  1PTO C;  2KA7 A;  4N9T A;  1Y8P B;  2A68 D;  1EIH A;  3PUV A;  3I91 A;  5JEA G;  1ET6 A;  1EIG A;  1ENF A;  3QG1 A;  2XSC A;  2XVS A;  2A69 C;  2PQE A;  4X3K A;  2D2C C;  4K5V A;  2L4N A;  1TS5 A;  1ENA A;  1A3V A;  5I9P A;  1YNJ D;  2N55 A;  3GTG B;  1C8C A;  3MXU A;  2AQ1 B;  3NXW A;  5D3D A;  2FJ2 A;  4L6T B;  2EY2 A;  4EVO A;  4I7Z C;  4DAP A;  1KDC A;  1SEB D;  3IKJ A;  3PO2 B;  3DM1 A;  1JWS D;  4S3S A;  5JVG 3;  2JYO A;  2NWG A;  2QEJ C;  1FNV A;  2JA8 B;  1QCB D;  3LWU A;  2AWO A;  2EZV A;  1ICW A;  4ODG A;  2G9D A;  3V2T A;  3NPP A;  3T4A C;  2X6L A;  4NP5 A;  2Y0S B;  1K8M A;  4WOR A;  4ZQ3 A;  5C5M A;  2XWB B;  1I3Q B;  2EVB A;  3TDQ A;  4QIW B;  2IX0 A;  5EPK A;  1B1Z A;  2MGS A;  1SFO B;  1JR0 D;  1CZG A;  4XT3 B;  5ISR A;  4CBV A;  2KUM A;  4GZY C;  1NUC A;  2ZXO A;  4KD4 A;  2B2W A;  3DEP A;  4K6D A;  1BXT A;  1S5E D;  1ZEQ X;  4HCS A;  2JEA I;  4O42 A;  5JEA J;  4BBR B;  1RHP A;  3CU7 A;  1TWF B;  1AP0 A;  1C4Q A;  4EQO A;  2F1M A;  4IZ8 A;  1AW7 A;  4XYO A;  1QB5 D;  3WOE A;  3J7A F;  3NP8 A;  4BY1 B;  2JEB I;  1PZK D;  3RZD B;  1IHZ A;  1B2T A;  3TZU A;  1SND A;  1NAP A;  2WAC A;  1Z47 A;  3A8K E;  1L0Y B;  1O80 A;  1PMR A;  2QF7 A;  3D3R A;  3NUC A;  1SBB B;  2R6G A;  2LY7 A;  3H0G B;  2BE5 C;  3BDO A;  2A5H A;  4K2K A;  5AFW A;  4OIK A;  3JAM E;  3DWQ A;  1JE4 A;  2F0O A;  4Y7N B;  4ZRZ A;  5FLX L;  4JBW A;  2L5T A;  4ZK9 B;  3FMC A;  1EYA A;  2E2D C;  1TS3 A;  3U9S A;  1D5M C;  2B2W C;  2PPB C;  1SE2 A;  2HUG A;  1EY6 A;  2EE1 A;  2F3W A;  5FKA C;  1EY8 A;  3E6Z X;  3VA7 A;  1EWH A;  2WV6 D;  1XXG A;  3EA6 A;  5I2X A;  3S14 B;  3PUY A;  4RFB A;  4LMQ D;  1LTG D;  4F7X A;  3S2H B;  2KED A;  1B3A A;  1KLG D;  5CGK A;  5EJW A;  4DU9 A;  2EYL A;  1H9J A;  4ME5 A;  3V96 A;  3NTK A;  1EYD A;  3K58 A;  2EOT A;  2DN8 A;  1TU2 B;  4HMJ A;  3I8Z A;  3TBI B;  1SSO A;  3SK6 A;  3ND8 A;  5A35 A;  1LTR D;  1PTO B;  4OO1 I;  2PW5 A;  1PLF A;  3HOW B;  3MC0 B;  2R61 A;  5C44 B;  2CW0 C;  3J81 L;  2JA7 B;  1PRT D;  5ELB A;  2F0S A;  3GV3 A;  4FF1 A;  3QJY A;  4K2L A;  1QWY A;  3A7A B;  1ML0 D;  1JOQ A;  5C5L A;  2R7Z B;  1H9S B;  4OHJ A;  1QNU A;  1DJR D;  3E5S A;  3C1F A;  3SHL A;  5C0X H;  1ZKO A;  1ZXT A;  1DM0 B;  1G2T A;  1PFN A;  3GTQ B;  5ELD A;  3VR3 A;  5KGU A;  2RKS A;  3QIA A;  3NHH A;  2CVR A;  4FF2 A;  3R8B A;  3RUZ A;  3P75 A;  2J7Z A;  2PO4 A;  4BBS B;  4PNY A;  5DM6 3;  2YU9 B;  2OF1 A;  1WVL A;  2FHT A;  3HEJ A;  1CQF A;  4QMG A;  1ONL A;  3QB3 A;  1IYV A;  3A56 A;  3GO5 A;  4FP5 D;  2MP1 A;  2M2L A;  2EY1 A;  1HFG A;  3KUP A;  1A2U A;  3BVM A;  3TME A;  3MA2 B;  5C6A A;  4XIG S;  1Q8I A;  4XT1 B;  3Q24 A;  1M8A A;  1EZ8 A;  1GHJ A;  2ZT9 C;  4PV1 C;  4G7Z C;  1EOT A;  2EYH A;  3DMU A;  3MXG A;  2K28 A;  1JWM D;  2N88 A;  4DN4 M;  5G3L F;  4HMI A;  2IW3 A;  3A7L A;  4ZKB B;  4C3I G;  1S5F D;  1O7L A;  3X3N A;  1J8I A;  2ENB A;  4X3T A;  2F0Q A;  1IW7 D;  3VA5 A;  5IGF A;  1WD0 A;  1J9O A;  1GUS A;  1E2W A;  2HDL A;  3GTM B;  4DXF A;  4KKT A;  3HRZ C;  4DGZ A;  4XTC S;  4OL7 A;  3HOZ B;  1B4O A;  3K5M A;  3T16 A;  1KDA A;  1VF7 A;  5BN5 A;  4A3M B;  1GOZ A;  1HCZ A;  3PMF A;  3T51 B;  4A3K B;  4KK7 A;  3I4M B;  1NR4 A;  2HCC A;  3Q0A A;  1LTT D;  4IUN A;  2EPB A;  2NN6 G;  4Q0F A;  2NVQ B;  1WCM B;  1PRT B;  3NWT A;  3HZX A;  1DOL A;  3I3C A;  1BCP C;  1TVX A;  2KEC A;  5LL6 S;  4DXG A;  1UEA B;  4KJO A;  5IOD A;  2CHB D;  2DY8 A;  5T1I A;  2V4D A;  4B9W A;  2R3Z A;  3JAM L;  4HR7 B;  4FYD A;  1G29 1;  1HHV A;  4BY7 B;  1V43 A;  3KLR A;  1OXU A;  3HOX B;  3Q6S A;  1LV9 A;  4C3I B;  2F0E A;  3SK5 A;  1OXX K;  4KN7 C;  3F2U A;  3K57 A;  1EZ6 A;  1BR9 A;  5EBD A;  2RA4 A;  3C1E A;  3M7N A;  3DWP A;  2I46 A;  1F2Y A;  2A73 B;  1VCI A;  1TQO A;  2D5D A;  1KTK A;  4IFD H;  1D5Z C;  1STH A;  4XDX A;  3T13 A;  5M5X B;  2KCC A;  4RGM A;  4DFA A;  4KHV A;  2ICI A;  2A68 C;  1I50 B;  3O13 A;  3M85 A;  1JIC A;  5EQ0 A;  4FXD A;  5D65 A;  1A6X A;  4R8I A;  1H9S A;  1EY4 A;  3HKZ B;  1YNN D;  3SE0 A;  3I72 A;  2OEO A;  3OHX C;  4CHT B;  1L0X B;  3RMH A;  4K8J A;  1T5X D;  1YNJ C;  4KY7 A;  2JA6 B;  1Y1W B;  2YYZ A;  4QB4 A;  4FNF A;  3MHB A;  5KRU A;  2WB1 B;  4L8J A;  4IFD I;  1PTO F;  1QG7 A;  2G9H D;  1QE6 A;  3L7Z C;  4KTA A;  4FXG C;  1AEX A;  4KV6 A;  3BYT B;  5C3X A;  2KOL A;  3OW7 A;  1A3U A;  1RTN A;  5TSS A;  4IQZ A;  5EKI A;  2PMZ B;  3N6R A;  2BDN A;  1K83 B;  2F03 A;  3TP7 A;  4ZAI A;  1LTS D;  1BNZ A;  3EQL C;  5COR A;  1BO0 A;  1QNK A;  5EGT A;  1JWU D;  4RCO A;  1NR2 A;  2XRS D;  5CYU A;  2Z8L A;  1DCZ A;  1F2Z A;  4O1N A;  2PZT A;  3I73 A;  3MZ5 A;  5I6W A;  2F0I A;  1DXM A;  3VYS A;  1I6V C;  2LMC B;  4KJN A;  2DY7 A;  2EJM A;  1HUN A;  5LHY 1;  4PMC A;  2PZW A;  3PUW A;  2PYK A;  3R2T A;  1CFM A;  2VXW A;  1VDZ A;  4LK1 C;  5FO9 B;  2K5D A;  3RZO B;  1EU3 A;  3D31 A;  2IWH A;  3MEH A;  1HFN A;  4XQQ A;  1V1O A;  4V19 0;  1KAA A;  2XWJ B;  1HTP A;  3A8I E;  4RGO S;  3GQB A;  1TKW B;  3D8G A;  3MTS A;  2WP8 J;  2EYJ A;  4CKB A;  4G57 A;  4C3H B;  4DK1 A;  5E3F A;  4K5W A;  4E6I A;  1PFB A;  1AN8 A;  5I9O A;  3QWN A;  2VB3 X;  2RBM A;  1BCP B;  1KNA A;  3H94 A;  3ND9 A;  3Q22 A;  4N9P A;  4ID6 A;  2EYP A;  2X6G A;  1AZQ A;  1KNE A;  3S9W A;  1GUO A;  1CQV A;  1ESF A;  2A69 D;  3M3Y B;  4U68 A;  1STE A;  1B50 A;  1STN A;  1R9T B;  1BQQ T;  4ZUI A;  4XXE A;  4AYB B;  3GD7 A;  4TKO B;  4G7O C;  5HUR A;  1W6K A;  1TII D;  3OIP A;  2EYF A;  3W3A A;  2JXM B;  2MHV A;  2WAQ B;  1SYG A;  2MPM A;  3SK4 A;  3AMU A;  4XQJ A;  1TWC B;  5DNF A;  3GTJ B;  1DOM A;  1LT3 D;  1II3 A;  2L11 A;  4QF4 A;  1U4R A;  5C0X G;  5CBA E;  3PIP 3;  2AUK A;  3P7J A;  4K8I A;  2IL8 A;  1CHP D;  5K36 G;  1PRT F;  2L0C A;  4DAY A;  5IIF A;  3PV0 A;  4ZKC B;  3S1R B;  4EQN A;  4HSV A;  1PRT C;  3DEO A;  3UI2 A;  1JOO A;  4OO1 H;  3R93 A;  4K6L A;  1SE4 A;  1AZP A;  3I4N B;  4X3U A;  1A15 A;  4UAI A;  1SJE D;  2O5J C;  1S5D D;  2BA0 A;  1MBY A;  1O7Y A;  3R3O A;  3HOU B;  1EYC A;  3KLS A;  1MSH A;  1D2B A;  3H6M A;  3SEB A;  2XIW A;  3KBX A;  1SNM A;  4HCE A;  4R8N A;  2F0P A;  4ULL A;  5I6Y A;  1CA6 A;  5IT9 E;  1HTL D;  3OPO A;  1WTO A;  1F2M A;  2AQ2 B;  2Z4I A;  4CKE A;  5J39 A;  4FVM A;  3X3M A;  3HS0 C;  4NKL A;  3P1H A;  1B53 A;  4V0B A;  1QJO A;  2RVL A;  2F0L A;  5C3E B;  4C2M B;  1RDP D;  2IPK D;  1U9R A;  4YIJ A;  2NVX B;  3CKI B;  2EJG C;  4Z9C B;  3CQZ B;  2DNE A;  5JOB A;  5M9O A;  5M3M B;  5BN3 A;  1EWC A;  1DOK A;  3QO2 A;  1RD9 D;  1CI3 M;  1TY2 A;  2BA1 A;  4EQP A;  4ZYS A;  1EY0 A;  1CK1 A;  5M5W B;  5C0X J;  1QIL A;  1IL8 A;  3PIO 3;  4UDU C;  3OSO A;  4C1N K;  3ERQ A;  4RA8 A;  2EYO A;  1H9M A;  3NQI A;  2NTS A;  3U9O A;  2DNC A;  1E0B A;  1PTO H;  1IW7 C;  2RQX A;  3SR1 A;  1STA A;  2E76 C;  5DEH A;  1MGS A;  3FDT A;  1JCK B;  1ENC A;  3J80 E;  4BA2 I;  3BYY B;  3ITP A;  3LWE A;  3K5L A;  1Q90 A;  3HG9 A;  5FK9 C;  5E4W C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...