2N88A

Chromodomain 3 (cd3) of cpsrp43
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
58
structure length
58
Chain Sequence
GLEYAVAESVIGKRVGDDGKTIEYLVKWTDMSDATWEPQDNVDSTLVLLYQQQQPMNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for cpSRP43 chromodomain selectivity and dynamics in Alb3 insertase interaction.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Protein binding
molecule keywords Signal recognition particle 43 kDa protein, chloroplastic
total genus 7
structure length 58
sequence length 58
ec nomenclature
pdb deposition date 2015-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2n88A00
1M8AA 5JJZA 1AZPA 2K1BA 1AP0A 1DOKA 1DOMA 1B50A 3F2UA 1U4MA 5EPJA 2X6GA 4HCSA 3KUPA 2VXWA 3ONAB 3FPUB 1VMPA 2HDMA 2L4NA 4ZKCB 4ZKBB 1F2LA 3GV3A 2NZ1D 4HSVA 4NW2A 1MGSA 2X6LA 1CA6A 5EQ0A 1HA6A 1RHPA 2L11A 2KVMA 2SDFA 2DY7A 3TN2A 4ZLTF 5EPLA 2JYOA 2RA4A 1B3AA 2J7ZA 1O80A 1WTVA 1DOLA 1B53A 1EQTA 2B2YA 2KECA 4X3TA 1MSGA 1X3QA 4CJ0B 1WD1A 1HFGA 2K28A 4OIJA 1KNEA 1U4LA 2B2TA 2BDNA 4IUVA 5T1GA 2EE1A 4CJ2C 4X3SA 4IURA 1ILQA 2KUMA 5EKIA 1E0BA 4UAIA 2HUGA 1QE6A 1ZXTA 3G7LA 1C8CA 1X32A 2L1BA 2D9UA 1XYIA 1F9QA 4IUTA 5CORA 1BF4A 2L9HA 3FDTA 1HFNA 4X3KA 2B2YC 2K03A 3I91A 2B2WA 4IUQA 1KNAA 1CM9A 1QG7A 1EL0A 1WTQA 2EPBA 5CBEE 1TVXA 2K04A 3DM1A 4ZK9B 1LV9A 1PFNA 1RJTA 4IUPA 1EIHA 1HUNA 1WTWA 2MJ8A 1F9SA 4OIKA 1NR4A 5COYA 1ICWA 1ESRA 1F9PA 1SDFA 3N52A 5E4WC 1VMCA 4RWSC 3MTSA 5E4XA 1SSOA 1PFMA 2FMMA 2FINB 3D6WA 1U4RA 4XT3B 1NAPA 3HP3A 4HEDA 4MHEA 4RA8A 1S4ZA 2NWGA 3LWEA 2DY8A 1PFBA 2KEEA 1IL8A 4X3UA 3H91A 3UI2A 1WTOA 4IUUA 2B2UA 1RTOA 1ML0D 1SAPA 4R9WA 5T1IA 3I8ZA 3R93A 3SVMA 1HHVA 4XDXA 1IKMA 5EJWA 1O7ZA 1NR2A 3KBXA 5AFWA 2B2WC 4R8IA 1BO0A 3IFDA 2K01A 3P7JA 2Q8TA 5CMDA 2MP1A 1HUMA 2MGSA 3Q6SA 2CVRA 2HDLA 2KEDA 1G91A 1MI2A 1IKLA 4QUFA 1DONA 2MPMA 2R3ZA 1BBXC 3IL8A 2B2UC 2FFKB 1ILPA 1G2TA 2RSOA 1JE4A 1J9OA 4QUCA 2N55A 2NYZD 2X69A 3DEOA 1PDQA 2L12A 1G6ZA 2RSNA 1PLFA 1F9RA 2B2VC 2RVLA 3GV6A 1U4PA 3MWYW 2B2VA 2EOTA 2M2LA 4XT1B 5DNFA 4CJ1B 1WTXA 1MSHA 2JP1A 2HCCA 1B2TA 1WVLA 2B2TC 2KOLA 1GUWA 1HRJA 1X3PA 2FJ2A 4ZAIA 1J8IA 2XIWA 2K05A 1AZQA 3TZDA 1RODA 1WTPA 1RTNA 4MN3A 5EPKA 4HAEA 1O7YA 1Q3LA 5D14A 1A15A 2Q8RE 1DZ1A 2N88A 3QO2A 1WTRA 1G2SA 4DN4M 1QNKA 1B4OA 3DEPA 4O42A 4LMQD 3I3CA 3I90A 1CA5A 2H1EA 1BNZA 4RAUC 1WD0A 5CBAE 1JICA 1XX8A 1NCVA 5D65A 2IL8A 2FHTA 2HCIA 4U68A 1EIGA 1EOTA
chains in the Genus database with same CATH superfamily
2ICEC 5JJZA 5IGEA 1DOKA 1IHZA 2WB1G 2XSCA 3DWAA 3K81C 4V0BA 4DAPA 1D5ZC 1EWCA 4PZ8A 1TU2B 1VQFA 3PUWA 5GADC 5FJ8G 1VMPA 1SMYD 1YHQA 1B44D 2Q2UA 3T51B 3W1GA 2RA4A 3A5ZB 2PMZE 4DV1L 4OX9L 2JA8B 3C2PA 1EQTA 3X3NA 1I94Q 4HSPA 2K28A 4OIJA 2B2TA 2VQFQ 5FLXc 1SYFA 5C0XI 1Z47A 1PYSB 4DR1L 2Z6BA 3KJOA 4K5WA 1HNWQ 4DXGA 5ELCA 5C0XH 4QCLA 1YNND 3PO3H 3BZKA 1KNAA 4F8MA 4DNIA 4UDUC 2E74C 1TWGH 4OIKA 4RCNA 1NE3A 1VMCA 1SNPA 3V96A 2R6GA 3SHLA 2F0HA 3PUZA 4A3LG 3G48A 4KI0A 2R7ZH 4ILWA 3IKJA 5KGUA 1WTOA 1IL8A 2PI2E 4R1JA 1X54A 1JWUD 2VZAA 1WJJA 3K5NA 4GOPB 4YWKA 5FLMG 5DAUA 2KBNA 2VS1A 3PO3G 3BZCA 1MI2A 1TR5A 4QUFA 3LWUA 4RGMA 3VYTA 3JC66 4Y52H 1R4PB 2DN8A 4X66L 1L1OA 2WB1B 4OO1G 4IN3A 4YIJA 2L12A 1YNNC 2EXDA 1PLFA 1RIPA 3U4ZA 4FXKC 4FF2A 1RDPD 1YNJD 4AIMA 4A3LH 1MSHA 4H13C 1WVLA 3NXWA 1K8MA 5FOBB 2AQ1B 2JA7G 5C44B 2HQLA 3CMAA 2L5TA 4QB4A 2A6EC 3T1HQ 2PW7A 2Q8RE 3SK6A 4KD3A 1IBMQ 2KCCA 1I3QB 2NBFA 5CYUA 5CV9A 3NWSA 1G291 2CWAA 2TSSA 2LKVA 1EOVA 4CKCA 5M3FG 2ZXRA 2EYOA 2ZJRA 4JI5Q 1STEA 1SLJA 2F0EA 4UP8A 3CCUA 4R4QA 1HZ9A 3T16A 2KJXA 5EPJA 1Q90A 5KYIA 2B63H 1HPCA 2F4VL 2E2DC 2DY7A 3NP8A 1YNJC 1O80A 1V1PB 2MHVA 1L0WA 3H3VC 4L6TB 1WD1A 3CPWA 1N33L 5M5YB 1KNEA 2BDNA 3H6MA 1A3VA 4O2DA 5JAVA 1PH9A 2EE1A 1A0IA 2KUMA 4CKEA 5FO9B 3J7YW 2EYJA 3T1YQ 3QB3A 3I91A 2B2WA 4DR5L 5CBEE 2EJGC 1HTLD 1Y1WH 4P72A 5IOCA 4QIWE 1QVFA 1LTGD 4JI1Q 1DCZA 4XTCS 4FYDA 1SSOA 5IYCH 3GTQB 2JA5B 1LTAD 5KYLA 4A93B 3ERQA 3PGZA 3HKSA 5CV5A 3OSOA 3I70A 3I8ZA 5C4XH 4V190 1T9HA 1JB3A 1EIFA 1XXGA 4P74A 5M5WH 2CVRA 3M7GA 4C3HH 2XRQD 3SEBA 1G2TA 3BYTB 1ASYA 4QUCA 3CQZB 1I5FA 1PH1A 1PDQA 5F2DA 1XPRA 4KKSA 2QKIC 2Z0SA 4DAYA 4JI2L 1CTMA 1ENAA 2I46A 2BE5C 1A8VA 3OMGA 2IY5B 5DNFA 1YZ6A 2JP1A 4JV5Q 4JBKA 1K9MC 1TIID 1O78A 2R92G 5CV6A 4LW1A 2KHJA 4DAVA 2AMCB 1TS3A 1A15A 1STHA 4IZ8A 4JBMA 1LUZA 1WCMG 3PO2B 1IBLL 3HOXG 4LMQD 2H1EA 3HFZB 3GTOB 3KLSA 3KF8B 1KRTA 3NSWA 3J81L 4RCOA 2IL8A 1GOZA 5C3XA 2WAQB 1SYBA 2XVSA 3STBC 4JI0Q 3D4WA 4KD4A 2CWPA 1VQGA 5FLXE 1CT1D 4HCSA 1B3QA 2RHSB 3KUPA 2HD3A 4TRDA 1TWCH 1BBUA 4ZKCB 2L4NA 2IX0A 4K2LA 3D3RA 2R92H 3HOZB 1TWAB 2KCNA 3CPFA 2CW0D 3TN2A 2E5LL 5EPLA 4A3KG 3CCJA 2SNMA 4DK1A 3CF5A 3MXGA 2KECA 3OWFA 1UE7A 4KKUA 1GUOA 1U4LA 4AQYQ 3S1RB 3ULJA 1QZHA 4KHVA 5ELFA 1K8AC 1FNUA 4C3IG 4GOPC 3QIAA 3KLWA 5A35A 4X65Q 3HOVH 1PYWD 1CM9A 4KJOA 4KMUC 3DMUA 1GUTA 2NZHA 1LV9A 1RJTA 2HIXA 4IFDH 1VQMA 2FXQA 3STBD 1PZKD 4LFBQ 3I4MH 2ZTDA 3N52A 5E4WC 1B1ZA 3QOJA 3BDLA 3ER0A 1NSNS 3OMCA 1NUCA 4GN3B 1EFWA 5K36G 4QGUA 4M1UB 2M00A 4PMWA 1J6QA 2I5LX 5BN4A 5CMDA 2K01A 2PPBC 2MO0A 5LMUL 1SE2A 5M3MG 4DXFA 1Q86C 2R3ZA 4RG1A 4LF7Q 2PQEA 4HIKA 1QUQB 2H4OA 5JJIA 3BJUA 4A3EH 4NB3A 4FXDA 5M3FB 3HZXA 3NE5B 1U4PA 3J81j 4IALA 1BVSA 1SE8A 4LFBL 3K0XA 2XIWA 3L9AX 4GNXA 2ZM6Q 1PTOB 2JA6B 2R7FA 3EROA 2WFWA 1WTRA 4BS9A 4A93H 5KIXA 2F0LA 4IPHA 3NHHA 3A8JE 1VQLA 3A55A 3OIQA 5LL6X 1WD0A 1CI3M 5D65A 3BDOA 4DF7A 3K8AA 3HOWB 4JCVE 3HRZC 3BG3A 1I50B 1NNXA 1B50A 1KLGD 1VQDA 1X3EA 1Y14B 2VQEQ 2Q8IB 2UUAQ 2HQEA 5I2YA 3A8IE 3UDGA 5GAHC 1EZ8A 1UWVA 4XQQA 3K58A 1FL0A 1HCZA 4DR2L 4HSVA 4HIMA 4JK1C 3K7UC 4CKBA 2NN6G 5CR3A 2EYHA 2JQOA 2SDFA 3NEMA 2OTLA 4BA2I 2Z6KA 3CCMA 2K32A 2XWBB 1VDZA 1G8ZD 5LMNL 3J7AV 3G6JB 4FO2A 5IYBG 4B9WA 1H9JA 3NENA 2JA5G 3GO5A 3NTIA 4MZ9A 1QE6A 3S16B 4RMFA 1A63A 2D9UA 2CH4A 1I4RA 1LT4D 1YEZA 1EQVA 1STAA 2YTYA 3KBGA 5IP7H 1HNXQ 1IBLQ 2JA8G 1E2VA 3LX0A 1QG7A 1H95A 1W6JA 1H9KA 4DK0A 3FHWA 1M90C 5IY0A 4IUPA 2ES2A 1EIHA 2NVTH 4IJLA 2JJQA 3A0JA 1SDFA 5G3LF 2PZUA 4L5QA 3PIOA 1U4RA 3D6CA 4XT3B 4PZ6A 3JAME 1XMOL 5ISRA 3LWEA 4X64Q 1PFBA 2G9DA 2KEEA 2B2UA 4C3HG 2D62A 5A2QE 2Q8TA 1PMRA 5C44H 2NZOA 3LGJA 3RMHA 3K80C 5C4JH 4YWLA 2FFKB 5A2QL 1SYEA 3CXCA 1BUVT 4G7OC 3HOXB 2X69A 3DLLA 1G6PA 3AB9A 1A2UA 4A75A 4KY6A 2WIIB 1LO5D 4OHJA 4CJ1B 2EOTA 2R92B 1GUWA 4RGTA 1VQ4A 3RLFA 4UP9A 1LT6D 1DGSA 3RNUA 1SYGA 1STGA 1MIUA 3QO2A 3HKZB 3HOVB 1QNKA 2BH8A 3J7ZC 1TWHB 2R93G 3L7ZC 4XYQA 3I4NG 1BNZA 4JBJA 4WJWA 1PHJA 3CC2A 5L37A 2QCPX 1CKNA 3S1RH 1TWGB 2K1BA 4K6DA 3OYYA 4LF6L 3DUZA 2ZTCA 1Y1WG 4BXXG 1HQMC 1QILA 1Y8NB 1BDOA 5EKLA 3GV3A 2R61A 4HR7B 2L15A 1PTOF 3F1ZA 2WB1E 4GS3A 5HURA 2B29A 3TZUA 1JOOA 3I4NH 3T13A 4YHHQ 2VNUD 3SK8A 3NTHA 2GVAA 3CU7A 1YI2A 2L9HA 4N9PA 3H3VI 3PO2H 1XTCD 3GQBA 1PRTD 1JT8A 3K5OA 3SGIA 5ELDA 3FKIH 5FJ8H 3K57A 4MTNA 1XNRQ 5K36H 4FF1A 1IXRA 5KNDA 3VR4A 3T4AC 1S5BD 2R93B 3MAQA 2E2JB 4DV6L 3HKZG 3E9IA 2FMMA 2ZT9C 5EKKA 3PIP3 1KQSA 1MHWC 2KENA 1UEBA 5M3MH 1YHAA 4X66Q 1RTOA 3CRLC 4BBSB 4POGA 4OWWB 3IFDA 3VYUA 1MD2D 3WOEA 1GHJA 3PCOB 3J80i 4A3DH 5ELNA 4YHHL 2EIFA 3URYA 2MPMA 1NY4A 2PW5A 4DUZL 4R8NA 3M3YH 3KF6A 1I50H 1QB5D 4N9TA 4HJ7A 1HJPA 2UUBL 3H0GH 3GV6A 3R2IA 2SOBA 4XT1B 3UDIA 1S5FD 3OW7A 1ZYRD 1ET9A 4DAYB 4LF6Q 1CHQD 1AE3A 3CMEA 3KF6B 2HT1A 1RKNA 3S17H 3UE1A 4ULLA 1XNQQ 4QL5A 4ID6A 5JVG3 1XX8A 3H15A 3E0JA 2K5NA 2AWOA 2NTSA 5LL6S 2IX1A 2VQFL 2RF4A 2SNSA 1I94L 3RLOA 2NVYH 4DV3Q 3C3LA 4IQZA 4DV1Q 2X6GA 2UXDQ 5JJKA 2BOSA 4K8IA 3DXJC 2B63B 1H9MA 5IYBH 4OGQC 2CFMA 1NBWA 2OT2A 3AFPA 4HMJA 3E9HA 1O7IA 4JPBW 4R4TA 5CC4A 3GTKB 1FJGQ 2DJFC 1C9OA 1KIXA 1QCBD 4IURA 3SE0A 1E0BA 4DV5Q 1RF2D 3K7AB 2L1BA 1MJEA 2D0PA 4IUTA 1EY6A 4XQJA 4YCUA 1HFNA 3JAMc 5C4JB 1B8AA 1YBYA 1S5DD 5JPMC 4X64L 2Z4IA 1XMOQ 3DM1A 2E8GA 4A3JG 1WTWA 1F9SA 4OL7A 1GKHA 4M8AA 4UY8C 1JC7A 4A3EG 5BN5A 3I72A 3TSSA 4C3JB 5C4HA 4RH6A 2OQKA 4DV2L 1K28A 2BDOA 4MHEA 5C3WA 1PTOD 4JI3L 4DKAC 2EXZA 5EBCA 1NMGA 5T1IA 1LTRD 2JEAI 3NPPA 1HNXL 4XDXA 1PFSA 4HTHA 4EVOA 3RZDB 1XMQQ 3HKZE 4FF4A 1S5CD 4A93G 5JEAH 5LMNQ 1TWCB 1WTHA 3CCEA 1A3UA 1K3RA 2OCEA 1JJCB 2N55A 1D8LA 3MC0B 2R7ZB 3BVGA 2F0SA 3CQZH 1W6KA 3TP5A 4DR2Q 2HCCA 2B2TC 2UUAL 2VQEL 1FNVA 4PZ7A 4O1NA 5IT9L 5J1ZA 3CKIB 1GUGA 4QQBX 1N32L 3M85A 1LABA 4B9XA 4Y7NH 4LNQA 2DUDA 4RGNA 4O42A 3QWNA 5DM73 2ZJPA 3PV0A 2WINB 5CBAE 3G4SA 1PRTF 2Z9HA 4DA2A 4BXXH 1S72A 5IP7G 1QVCA 1QWYA 4U673 2ZM6L 2E2HH 1PH8A 2JA8H 1LTBD 4A3FB 4GKJQ 4C3JG 1I6HH 4DV0L 2EDGA 3TQYA 2EY6A 2QW7A 2C5CA 2VXWA 2JA6H 2SEBD 3A74A 2LFNA 2X6LA 1AEXA 4JOIC 1E22A 5EQ0A 5M5WB 2WKCA 1VQEA 2DNEA 2RCNA 4C2MH 3HOUG 3TBIB 3MXNA 2WACA 4CJ0B 1MJCA 4FVMA 2UU9L 1JORA 3CW2C 2YU9B 3K6OA 2C35B 4LF9Q 3HOWG 4LF8L 3CCSA 1PH4A 2A73B 3W1BA 3C1EA 4BWGB 2F0WA 1EYDA 1XJVA 1EWHA 1DJRD 1XTDA 1N36L 3Q0AA 3BZDB 2A1AA 4NMZA 2A19A 1JCKB 3BVMA 2R7ZG 1HUNA 1FGUA 5IGBA 4DV0Q 1ICWA 1ESRA 3NWTA 4ZUIA 1JE5A 4DUYL 4DR7L 5BN3A 1PFMA 2PMZB 3D6WA 3KJPA 5NUCA 4GKKQ 4RA8A 3CCQA 4HN7A 2IT1A 1YITA 1LT5D 5C3EG 4X3UA 1MBYA 4FXGC 1HR0Q 1AH9A 1IYVA 4FP5D 3CC7A 3P7JA 4Q0FA 4RKLA 2MGSA 2HDLA 3S1NH 1N32Q 1A6XA 1TWFH 5I6WA 1TS5A 1CKMA 5JJLA 4AQYL 1Q8KA 3S1MH 2RSOA 1FVIA 3QG1A 2F0VA 1EUJA 3KOJA 2E5LQ 3JAML 2F0TA 1IYUA 5DLQE 3TDQA 1O7LA 1B2TA 1X9NA 2L0CA 1CUKA 3L3OC 4NXNQ 5I6YA 2FJ2A 2MNAA 3RZDH 3TS2A 1SE4A 3HOUB 2BA1A 1RTNA 4MN3A 3UE0A 3EBEA 2O5JC 4S3SA 3GTLB 1PH5A 1XMQL 2XN9C 4GN4B 3W2DA 5JEAG 3U58A 3I4LA 1D7QA 2VUMH 1LYLA 1BCPD 2F3VA 4APVA 3EA6A 5C5LA 2B63G 4OELB 4G4KA 1PXUA 1M8AA 1JR0D 2LY7A 1FR3A 5IE8A 1KDCA 1SNDA 2OQ0A 4P73A 1S3OA 1V43A 2AUJD 1SNQA 2HDMA 3GP7A 2D5DA 2NZ1D 1N34L 3FRPB 1X55A 2AQ3B 2F0IA 5KNBA 3K7AH 5CV7A 4JYAQ 2NB0A 1AE2A 3RLNA 3A54A 4HIOA 3P75A 1YJ9A 3I56A 3M4PA 1UE5A 4QY7A 1KDAA 2IX3A 2LMCB 3IRBA 1MSGA 2I5MX 3OOCA 3ND8A 1WI5A 2B39A 1FGBD 4DV4Q 4J1MA 4RHRA 1I4QA 3MEFA 2ASBA 2XWJB 1ZXTA 1NTGA 3HOYG 1TWFB 4A3JH 3MFGA 5TSSA 3VA7A 2K4KA 3NBHB 4LUZA 2NVYB 3BDCA 4UPAA 5C4XB 3PO3B 4X62Q 2OEOA 3S24A 1N9WA 1F9PA 5LMNW 1Y8OB 1VQKA 3S2HB 2ALYB 4RGOS 4DV7Q 2Z6KC 1NAPA 1Q1BA 1X65A 5IP9H 4DR5Q 2BE5D 3DWPA 3SVMA 3MZ5A 5EJWA 3K59A 2O2LD 3AU7A 2ID0A 4P71A 4DU9A 4NP5A 4F7XA 4YY3Q 4JI8Q 1C48A 2RDGA 4GLAC 4PMBA 1QNUA 3J80L 4XXEA 1VQPA 2QDLA 3KLSX 4IPGA 2XRSD 1GO3E 3PSIA 4HJ5A 4BBSG 2F3IA 1HRJA 1K0SA 4A3FG 4OO1H 1GHKA 3DHQA 4OONA 3TZDA 1CKNB 1I6HB 3VR5A 4HAEA 1O7YA 4LWCA 5D14A 2E2HB 5JEAJ 1CZWA 4LUOA 2ZXOA 3W5OA 1H9SA 1IBML 2E2JH 3S2HH 3RR5A 2YU9H 1DM0B 3BU2A 1EIYB 1AZPA 1DOMA 4DV6Q 2KHIA 1GVPA 4C2MB 3ONAB 2NVXB 2PZTA 1V1OA 4NKLA 4HJ9A 2CCZA 2MQHA 1RCVD 3CAMA 4G7ZC 1SMXA 3HOVG 2VUMG 1Q7YC 3E3XA 4PQXA 4A3GB 4CDEC 4X3SA 2EY1A 3A7LA 5GQOA 1LLRD 4JC0A 3PF4A 3FDTA 4RHSA 4C56C 4AH6A 3FEWX 3KDFB 1E2ZA 1SEBD 2Y0SE 4XIGS 2F52A 2KHSA 4JBWA 2EYMA 2CQOA 4A3IB 1EY8A 1PFNA 1QZGA 1ENFA 2RDHA 3O13A 1YHBA 4GOPA 4RWSC 3PF5A 1TY0A 2WV6D 4JI8L 5IGFA 1QVGA 3HP3A 2K5VA 1VS0A 1L0YB 4HMIA 4KK7A 1Q8IA 1GUSA 1HNWL 1IKMA 1O7ZA 1SNOA 5J22A 3PO2G 1KLUD 3VYRA 2D2CC 4BY7G 1EY7A 1HZCA 1OXSC 2F0MA 1JE4A 3EN2A 4CDFC 4WJ3M 4X62L 2A68C 4EQ5A 3BS1A 2CQAA 4DNTB 4KHPL 3GD7A 3I2ZA 4CDCC 3M4OB 4C3JH 2N78A 5CGKA 1WTXA 4CGYB 1X3PA 1J8IA 4GLXA 5CV8A 2QILA 1JQYD 3UDFA 1ICFB 5IYDH 1BOSA 1V8QA 4DV4L 3EVQA 3E6ZX 5M5XB 3MA2B 4BY7H 3I90A 5IGDA 1VQOA 1AN8A 4RAUC 2E2IB 1D5XC 1VQAA 1VQ8A 2UXCQ 4BY1B 3NK9A 4G7HC 4FDBA 1WCMH 2P5ZX 4A3DB 3H0GG 1H9SB 3QOLA 1U4MA 4PMCA 3J80c 1KABA 1KAWA 1NJIC 4BBSH 1U9RA 4A3FH 5ELBA 3RZOH 1EY9A 3KLRA 4AYBB 3GTGH 3KFUA 1MGSA 1HA6A 4F87A 1RHPA 2NN6I 3S1QH 4JI6Q 2NTTA 5FLXL 5BR8Q 2F1MA 4B3ML 1EU3A 2IPKD 3J7A5 4MIUA 4B3RQ 1JB7A 4IOCA 4KY7A 3VDYA 3J81i 3CRKC 1T5EA 5CORA 4ME3A 1SYDA 4ALPA 4R4IA 2F0GA 5IODA 5IIFA 5LHY1 1SFOH 1EL0A 3NTKA 5KRUA 1PA6A 2O4XA 2XTIA 5M3MB 5DEHA 4C3IH 2TMPA 4ZK9B 4K8JA 3D8GA 1FYCA 4LJZC 2MJ8A 4ZCKA 2VW9A 1NR4A 4JW0A 3OTOQ 3MTSA 4H0LC 2AQ2B 2Y0SG 3PQIA 2A8VA 3EJIA 3M3YB 2GN5A 4Y7NB 1NR2A 4FF3A 4JG2A 4ZRZA 3FPPA 1Q1EA 4PV1C 2K50A 3OPOA 4DR7Q 3OWEB 4A3EB 1L2FA 2A6ED 1HZAA 5ELEA 2A68D 4P2CB 1VQ7A 1SMYC 1SXTA 4EGVA 2RSNA 3TP7A 3F2DA 5D3IB 2O5IC 4JOIA 2KA7A 3K0YA 3N6RA 1W2BA 1WOCA 3MXNB 1UNSA 4IPCA 2EQSA 4OXPA 1YNXA 5LMUQ 1S5ED 4LFCQ 3PUXA 5M9OA 2UU9Q 4I7ZC 3GTKH 2JXMB 2K6AA 3S15B 1GUNA 2A6HC 1OXTA 3E0EA 2HHHQ 1GJXA 4HJAA 2F03A 1I4HA 3A7AB 1CQVA 1SRUA 4TSSA 1Y8PB 3ZJYC 4K0KQ 2VUMB 2RBMA 2L55A 4KLKA 4DR3Q 2V1CC 3ULPA 4KTAA 2ENBA 5G3LD 4C1NK 1JMCA 2NVQH 4ZKBB 2UXBL 3TMEA 4ABNA 2Q2IA 1TS4A 2JSOA 2K14A 4ZLTF 3C46A 4X65L 3PUVA 1B3AA 3PMFA 3ULLA 3I7FA 2KCTA 2JEBI 1DOLA 4AYBE 1B53A 1PRTC 3VYSA 1Q82C 1D1KA 3GTPB 4CBVA 4KJNA 3MXPA 1EFID 3NBHA 2RQXA 3E5SA 2HUGA 1CK1A 1X32A 1XYIA 1F9QA 1Z9FA 3K5MA 3KYHC 4LF5Q 1BXTA 2B2YC 2K03A 3T53B 4IUQA 3CHBD 3VR2A 3HOYB 2EPBA 2A6HD 2F0JA 3S16H 5I9PA 4LFAL 1TQOA 4A76A 1IBKQ 4UP7A 5COYA 1R9TH 2PQAB 5FK9C 5C4XG 3PIPA 2FINB 1JJ2A 3B6YA 4PNYA 3U9OA 2NVTB 1EYGA 2DY8A 4BBRB 2HIVA 4QMGA 1U0LA 3TREA 3KK7A 3MXUA 3RD4A 3KBXA 4A3CH 2B2WC 3MVVA 4JI3Q 4H7BA 1EY5A 4DV2Q 4L5TA 1KL9A 1HA5A 2QDBA 2QEXA 4B3SQ 2K5DA 1BBXC 1IZ6A 5FLMH 1J9OA 1B7YB 1VQIA 3H0GB 5IGCA 4JV5L 2EY2A 3H3VH 1HQRD 4JI2Q 5C0XJ 4IJHA 1TXYA 1P16A 1SROA 3NQIA 5JOBA 1HXYD 5I2XA 2OWOA 5FO8B 1ENCA 2PCFB 4N8X1 1IBKL 3D4DA 1A62A 1EQQA 4LFAQ 2AWNA 4DAMA 1ONLA 3J80E 2UUCQ 5KNCA 4CDDC 1I6VC 2QEJC 2H5XA 1G2SA 2JK8A 4DN4M 1FJGL 1B4OA 3WOFA 2JA7H 3I4NB 3AQQA 2I5HA 1D2BA 1CSPA 1XPOA 2F3WA 3OHXC 2K7VA 3GTMB 3MEHA 2OF1A 1EIGA 3SR1A 2R93H 4WJ4A 3W3AA 4QJFA 1Y1WB 2UXDL 4XQNA 1VQJA 5CV4A 4HCEA 1PTOH 1SJHD 4DV3L 1G51A 1WFQA 2ZJQA 4CHTB 2EJMA 2IHFA 1D5MC 1L1OB 2N49A 4JVZA 1L1OC 1UEAB 2KCMA 3P20A 4EQNA 3BVZA 2JYOA 1OTCA 4A3KB 1XNQL 4DR3L 5M5YH 3I4MB 1EEID 1HFGA 3NUCA 2MFIA 1TWHH 1J5EL 2MO1A 1I4XA 4WFN3 4K0KL 4X6AH 4ZYSA 1HH2P 2Y0SB 3AFQA 2HHHL 2RDFA 2EYPA 4OWTB 5K5PA 1VQNA 2JA7B 4X3KA 2LXJA 3A5UA 1VF5C 4JI7Q 1UE1A 1GM5A 1YIJA 2UUBQ 2F4VQ 3IFTA 3KDFA 1PTOC 5C0XG 3BYYB 1SNMA 2I07B 4DUZQ 4JI4L 5GAGC 1JOKA 1STBA 2AHOB 4LAAA 1R9TB 4OO1I 4A3GG 1F77A 3VR6A 4UHVA 1STNA 4Z9CB 3T56B 1M1KC 1H9RA 3UI2A 2DJGC 3R93A 1YJNA 3Q8DA 3U4VA 1M4VA 3HOYH 1A3TA 3ITPA 2A74C 2F0UA 4J15A 3Q6SA 1DXMA 3T1HL 4A3IG 1D1IA 1PRTB 1Z6HA 1B9MA 1LT3D 3P1HA 2EJFC 5EBDA 1C4QA 3EQLC 3M9BA 2F0KA 1G6ZA 4OEMB 1EQRA 3CC4A 1XNRL 1SN8A 2B2VC 2F0DA 1E1OA 3MWYW 1V9PA 2B2VA 3I55A 3OTOL 3CCVA 1YVCA 1GXDC 3CCLA 4QF4A 1K0RA 2NUCA 3G71A 5IGGA 4R4CA 1QOHA 1E7ZA 4PG3A 1SYCA 1B9NA 2GA4B 4DPGA 2K52A 2FHTA 2HCIA 3EIVA 2JA6G 4B3RL 1EOTA 3NQTA 4MNOA 2F0OA 3V2TA 2IW3A 4GNXC 3HOXH 2NN6H 3M7NA 4GZYC 3SK4A 3UDXA 1Y1VH 4B3MQ 2QF7A 1LM0A 5BR8L 2ATWA 1PH3A 1EEFD 4K5XA 4NW2A 4TVAB 2L11A 2KVMA 2RCFA 2ZXPA 4LF4Q 3HOWH 2OXPA 4LK1C 2JA5H 3GTQH 1FNWA 5DM63 4KN4C 4DFAA 2Z4HA 1KD1C 5FKAC 4HJ8A 4P75A 4X3TA 4DR1Q 4H02A 2M9VA 3ND9A 4AYBG 2GVBA 1ILQA 1CSQA 4A3KH 1L0XB 1WYDA 1IYJB 5J3BA 3J81E 2A69D 2F0FA 2BCOA 1Y1VG 2Z8LA 4N8FA 2K04A 3HGBA 2J4XA 2LSSA 2RHQB 4K6LA 5D3DA 5IP9G 1II3A 5IT9c 3DWQA 2B8FA 4E6IA 1TKWB 2PO4A 4KHPQ 4IO9A 3K5LA 3ICEA 1SNCA 3H91A 4IUUA 1HHVA 2XGTA 3SDZA 4C3HB 5IYCG 2LXKA 4R8IA 3FKIB 3J7AF 5C4ZA 4K2KA 2CHBD 1KXLA 2PQAA 1DONA 1UE6A 1AFPA 4DK6C 3TS0A 3IL8A 4KN7C 4IFDJ 3EFXD 2YTXA 4FNFA 4EQPA 3CCRA 5M3FH 3AYHB 2NYZD 2WAQE 3DEOA 3FMCA 2JN4A 2R7DA 4EX5A 4LF4L 1F9RA 2RVLA 4WORA 5M5XH 4L63B 2PI2A 5IWAQ 2F0NA 4RKBA 2BA0A 1MKHA 2PZWA 4ZAIA 3F2CA 2K5QA 1EY4A 4RFBA 1ET6A 2G5DA 4A3BB 2A5HA 1BKBA 3KF8A 1SFOB 1HNZL 1Y1VB 2WP8J 3NELA 4BBRH 1IW7D 2E2IH 1EYAA 1YJWA 1NCVA 1BR9A 4BY7B 1I3QH 3L0OA 4DNRB 5E1FA 1XWEA 1AP0A 2NVQB 3RN5A 2G9HD 3U9SA 1ASZA 1ZEQX 1F2LA 2XNAC 3TP6A 3VR3A 4DR6Q 3RZOB 3U50C 3M4QA 3QR8A 2B3GA 2K5WA 1K83B 4ME5A 1TY2A 1K73C 2YV5A 3CD6A 1CQFA 1UUPA 3R8BA 1P8LA 1VQ9A 1KDBA 4CJ2C 1KC8C 5AJ3Q 4DR4Q 3FKIG 4UAIA 3G7LA 3R2TA 2PNRC 1KHIA 1BF4A 1VQBA 2DGYA 1Q12A 3A56A 3DM3A 4A4IA 5HGQA 1IW7C 3ERSX 2QA4A 2EYLA 1JWMD 1TVXA 1TT2A 5C5MA 4A3GH 5I9OA 4K14A 1E3PA 1CKOA 4L8JA 3V05A 4JI4Q 1PH7A 1F2ZA 1Q46A 1JWSD 3M4OH 4LF7L 3C1FA 2VL6A 3GTPH 4B3TL 3H09A 1HTPA 3I73A 1BCPB 4HEDA 3MFYA 1X56A 1S4ZA 4JI7L 5J39A 4A3IH 1K8OA 2PYKA 1PH6A 3HG9A 3S9WA 4R9WA 1BBWA 2ICIA 4QIWB 5I4DA 1BO0A 2MUYA 5GROA 1X6OA 1HUMA 2K33A 2KEDA 4YY3L 1G91A 2VY3A 3ZYYX 1J5EQ 4A3BG 1ILPA 3Q23A 3PUYA 5JPNC 1CZGA 5C44G 3A8KE 4J8QA 2IJ0A 1F2YA 1ESFA 3S1MB 1C7YA 1SR3A 3JAMi 4DV7L 2IWHA 1CHPD 2M2LA 4HIDA 4R4OA 3S15H 4OWXB 2EVBA 1UAPA 1C0AA 5C6AA 1SE3A 2QGQA 2YYZA 1DYQA 3TP8A 2N88A 1I4PA 1D6EC 5FO7B 5HGTA 2N3SA 3CP0A 3I3CA 4LUVA 4Q5VA 2JA9A 2I0QA 1E2WA 1JICA 3GTMH 5E3FA 4IPDA 2UUCL 1PYBA 2AKWB 1Y69U 3F2UA 3Q24A 4C3IB 2PNHA 2E76C 3OIPA 1V1QA 3TRZA 4JI0L 4JYAL 3J81c 1E1TA 1N34Q 1HZBA 1Q81C 2NVXH 3I4MG 4WRDA 4IFDI 2J7ZA 3FP9A 4NXMQ 1WTVA 1N8RC 3NBIA 1OO9B 1X3QA 1SBBB 4I7AA 1LACA 1I4GA 4B3SL 5EGTA 3D4RA 3S14H 5T1GA 2ZTEA 4DK3C 5IT9E 5H1SE 5EKIA 1V1PA 1C8CA 1U5KA 3G6EA 3S1QB 4NXML 4IOAA 2Q2HA 4J6HA 3VA5A 4A3MG 3IAYA 3GTGB 2J0TD 4KV6A 3AEVA 4ODGA 1B70B 4H44C 4K5VA 1XPUA 1KAAA 2N8NA 1R4QB 3H94A 3D31A 4NXNL 1VQ5A 4GLVB 4BY1H 2IHEA 1CFMA 3MHBA 5E4XA 4GNXB 5C3EB 4TQUS 2NWGA 4TKOB 4XYOA 3S2DH 4BA1I 1SAPA 3AMUA 4LF5L 2EZVA 5AFWA 3RN2A 2EYFA 1BCPC 4A3JB 4A3MH 4G57A 2EY5A 2WKDA 4F88A 2B2UC 4JI1L 2V4DA 1HR0L 1X3FA 4A3DG 1EWIA 4GKKL 2WAQG 1LTLA 3LNNA 5IYDG 5GAEC 2UXBQ 4YCVA 4DUYQ 1NMFA 1BCPF 1TWAH 3M4YA 3HOZH 3T1YL 4BBRG 1AZQA 4MTKA 1RODA 1PZJD 3I4OA 1OXXK 4L5SA 1DZ1A 1KRSA 1BQQT 1N36Q 2D0OA 5HY6A 1N33Q 2E75C 3DEPA 1STYA 1S40A 1PZID 2F4IA 1CA5A 1ZKOA 2AUKA 4L5RC 4LFCL 1T5XD 4U68A 1LTTD 4LF8Q 1EU4A 3GTOH 1EYCA 4LF9L 4B3TQ 1ZYRC 4A3MB 3HEJA 3GTLH 4NPSA 1GD7A 1KTKA 3HOUH 1QJOA 3FPUB 5ELOA 3GTJB 3HOZG 4JI5L 3GTJH 1CA6A 5JVH3 1VF7A 1DD2A 4GN5A 2BH2A 2YTVA 4ZQ3A 1LTSD 2B2YA 3OW2A 4GKJL 1K8GA 1A2TA 1RL2A 3F8TA 4EQOA 1LTID 1PV4A 5AJ3L 4DR4L 4IUVA 1K83H 1X3GA 3RUZA 5EAYA 2CW0C 4IUNA 2Q2TA 3S1NB 3SXHA 4O0AA 3GDEA 2F0QA 1WTQA 1VQHA 4POFA 2C9OA 4NDXA 2K75A 4DR6L 2CKZB 4B08A 5KEEA 4C1NI 1JOQA 5C3EH 3F2BA 4I65A 2KQ3A 1VQ6A 2Z1CA 3HS0C 2DNCA 4ZUJA 1IL2A 4A3CG 1TS2A 1OXUA 2CH4W 3S17B 3SK5A 1K3BC 3FVQA 1ML0D 4A3BH 3TEHB 2MP1A 2B8GA 1HNZQ 4YWMA 4KKTA 1IKLA 4DGZA 1E24A 3S2DB 4IFDG 4JI6L 3R3OA 2JE6I 3Q22A 5IWAL 1Z7TA 3X3MA 2A69C 2VB3X 4BY1G 2LS01 1EZ6A 3WDNA 1HR0W 1QUQA 4KY5A 1OXVA 2KOLA 1PVOA 1SJED 2F0PA 2K05A 1JJGA 3WWVA 3PIO3 3QJYA 2VB2X 1WTPA 5EPKA 1VCIA 1Q3LA 2FMCA 1EY0A 4KHZA 1W3SA 2UXCL 4YCWA 3L2PA 1PH2A 2OTJA 2K5HA 4OX9Q 1WCMB 1FD7D 1RD9D 1VQCA 4DV5L 1F2MA 2RKSA 5E7NA 3D0FA 3S14B 1AW7A
chains in the Genus database with same CATH topology
2ICEC 5JJZA 5IGEA 1DOKA 1IHZA 3DWAA 2XSCA 4V0BA 4DAPA 1D5ZC 1EWCA 1TU2B 3PUWA 1VMPA 1SMYD 1B44D 3T51B 2RA4A 2JA8B 3C2PA 1EQTA 3X3NA 4HSPA 2K28A 4OIJA 2B2TA 1SYFA 5C0XI 1Z47A 4K5WA 4DXGA 5ELCA 5C0XH 4QCLA 1YNND 1KNAA 4F8MA 4UDUC 2E74C 4OIKA 4RCNA 1VMCA 1SNPA 3V96A 2R6GA 3SHLA 2F0HA 3PUZA 4KI0A 4ILWA 3IKJA 5KGUA 1WTOA 1IL8A 1JWUD 3K5NA 5DAUA 1MI2A 1TR5A 4QUFA 3LWUA 4RGMA 3VYTA 1R4PB 2DN8A 2WB1B 4OO1G 4IN3A 4YIJA 2L12A 1YNNC 1PLFA 4FXKC 4FF2A 1RDPD 1YNJD 1MSHA 4H13C 1WVLA 3NXWA 1K8MA 5FOBB 2AQ1B 5C44B 2L5TA 4QB4A 2A6EC 2PW7A 2Q8RE 3SK6A 4KD3A 2KCCA 1I3QB 2NBFA 5CYUA 5CV9A 3NWSA 1G291 2TSSA 2LKVA 4CKCA 2ZXRA 2EYOA 1STEA 2F0EA 3T16A 2KJXA 5EPJA 1Q90A 5KYIA 1HPCA 2E2DC 2DY7A 3NP8A 1YNJC 1O80A 1V1PB 2MHVA 3H3VC 4L6TB 1WD1A 5M5YB 1KNEA 2BDNA 3H6MA 1A3VA 5JAVA 2EE1A 2KUMA 4CKEA 5FO9B 3J7YW 2EYJA 3QB3A 3I91A 2B2WA 5CBEE 2EJGC 1HTLD 5IOCA 1LTGD 1DCZA 4XTCS 4FYDA 1SSOA 3GTQB 2JA5B 1LTAD 5KYLA 4A93B 3ERQA 5CV5A 3OSOA 3I70A 3I8ZA 4V190 1JB3A 1XXGA 2CVRA 3M7GA 2XRQD 3SEBA 1G2TA 3BYTB 4QUCA 3CQZB 1PDQA 5F2DA 4KKSA 2QKIC 4DAYA 1CTMA 1ENAA 2I46A 2BE5C 3OMGA 5DNFA 2JP1A 1TIID 1O78A 5CV6A 4DAVA 1TS3A 1A15A 1STHA 4IZ8A 3PO2B 4LMQD 2H1EA 3GTOB 3KLSA 3J81L 3NSWA 4RCOA 2IL8A 1GOZA 5C3XA 2WAQB 1SYBA 2XVSA 3D4WA 4KD4A 5FLXE 1CT1D 4HCSA 3KUPA 4TRDA 4ZKCB 2L4NA 2IX0A 4K2LA 3D3RA 3HOZB 1TWAB 2KCNA 2CW0D 3TN2A 5EPLA 2SNMA 4DK1A 3MXGA 2KECA 3OWFA 4KKUA 1GUOA 1U4LA 3S1RB 4KHVA 5ELFA 1FNUA 4C3IG 3QIAA 5A35A 1PYWD 1CM9A 4KJOA 4KMUC 3DMUA 1GUTA 1LV9A 1RJTA 4IFDH 1PZKD 3N52A 5E4WC 1B1ZA 3QOJA 3BDLA 1NSNS 3OMCA 1NUCA 5K36G 4M1UB 2M00A 4PMWA 5BN4A 5CMDA 2K01A 2PPBC 1SE2A 4DXFA 2R3ZA 2PQEA 2H4OA 4FXDA 5M3FB 3HZXA 3NE5B 1U4PA 4IALA 3L9AX 2XIWA 1PTOB 2JA6B 3EROA 1WTRA 4BS9A 5KIXA 2F0LA 3NHHA 3A8JE 3A55A 3OIQA 5LL6X 1WD0A 1CI3M 5D65A 3BDOA 4DF7A 3HOWB 3HRZC 3BG3A 1I50B 1B50A 1KLGD 2Q8IB 2HQEA 5I2YA 3A8IE 1EZ8A 4XQQA 3K58A 1HCZA 4HSVA 4JK1C 4CKBA 2NN6G 5CR3A 2EYHA 2SDFA 4BA2I 2K32A 2XWBB 1VDZA 1G8ZD 3J7AV 3G6JB 4FO2A 4B9WA 1H9JA 3GO5A 3NTIA 1QE6A 3S16B 2D9UA 1I4RA 1LT4D 1EQVA 1STAA 3KBGA 1E2VA 3LX0A 1QG7A 1W6JA 1H9KA 4DK0A 4IUPA 1EIHA 1SDFA 5G3LF 2PZUA 1U4RA 3D6CA 4XT3B 3JAME 5ISRA 3LWEA 1PFBA 2G9DA 2KEEA 2B2UA 4C3HG 2D62A 5A2QE 2Q8TA 1PMRA 3RMHA 2FFKB 5A2QL 1SYEA 1BUVT 4G7OC 3HOXB 2X69A 3AB9A 1A2UA 4KY6A 2WIIB 1LO5D 4OHJA 4CJ1B 2EOTA 2R92B 1GUWA 4RGTA 3RLFA 1LT6D 1SYGA 1STGA 3QO2A 3HKZB 3HOVB 1QNKA 1TWHB 3L7ZC 4XYQA 1BNZA 4WJWA 2QCPX 1TWGB 2K1BA 4K6DA 3DUZA 1HQMC 1QILA 1Y8NB 1BDOA 5EKLA 3GV3A 2R61A 4HR7B 1PTOF 5HURA 3TZUA 1JOOA 3T13A 2VNUD 3SK8A 3NTHA 3CU7A 2L9HA 4N9PA 1XTCD 3GQBA 1PRTD 3K5OA 5ELDA 3K57A 5K36H 4FF1A 5KNDA 3VR4A 3T4AC 1S5BD 2R93B 3MAQA 2E2JB 2FMMA 2ZT9C 5EKKA 3PIP3 1RTOA 3CRLC 4BBSB 3IFDA 3VYUA 1MD2D 3WOEA 1GHJA 3URYA 2MPMA 2PW5A 4R8NA 1QB5D 4N9TA 3GV6A 3R2IA 2SOBA 4XT1B 1S5FD 3OW7A 1ZYRD 1ET9A 1CHQD 1RKNA 4ULLA 4ID6A 5JVG3 1XX8A 3E0JA 2AWOA 2NTSA 5LL6S 2IX1A 2SNSA 3C3LA 4IQZA 2X6GA 2BOSA 4K8IA 3DXJC 2B63B 1H9MA 4OGQC 2OT2A 4HMJA 5CC4A 3GTKB 1QCBD 4IURA 3SE0A 1E0BA 1RF2D 3K7AB 2L1BA 4IUTA 1EY6A 4XQJA 1HFNA 5C4JB 1S5DD 5JPMC 2Z4IA 3DM1A 1WTWA 1F9SA 4OL7A 4M8AA 1JC7A 5BN5A 3I72A 3TSSA 4C3JB 5C4HA 4RH6A 2BDOA 4MHEA 5C3WA 1PTOD 2EXZA 5EBCA 5T1IA 1LTRD 2JEAI 3NPPA 4XDXA 4HTHA 4EVOA 3RZDB 4FF4A 1S5CD 5JEAH 1TWCB 1A3UA 2N55A 3MC0B 2R7ZB 3BVGA 2F0SA 1W6KA 3TP5A 2HCCA 2B2TC 1FNVA 4O1NA 5IT9L 5J1ZA 3CKIB 1GUGA 3M85A 1LABA 4B9XA 4RGNA 4O42A 3QWNA 5DM73 3PV0A 2WINB 5CBAE 1PRTF 4DA2A 4U673 1QWYA 1LTBD 4A3FB 4C3JG 2EDGA 2EY6A 2C5CA 2VXWA 2SEBD 2LFNA 2X6LA 1AEXA 5EQ0A 5M5WB 2WKCA 2DNEA 3TBIB 3MXNA 2WACA 4CJ0B 4FVMA 1JORA 2YU9B 3K6OA 2A73B 3C1EA 4BWGB 2F0WA 1EYDA 1EWHA 1DJRD 3Q0AA 3BZDB 4NMZA 1JCKB 3BVMA 1HUNA 5IGBA 1ICWA 1ESRA 3NWTA 4ZUIA 5BN3A 1PFMA 2PMZB 3D6WA 5NUCA 4RA8A 4HN7A 2IT1A 1LT5D 4X3UA 1MBYA 4FXGC 1IYVA 4FP5D 3P7JA 4Q0FA 4RKLA 2MGSA 2HDLA 1A6XA 5I6WA 1TS5A 2RSOA 3QG1A 2F0VA 3JAML 2F0TA 1IYUA 3TDQA 1O7LA 1B2TA 2L0CA 3L3OC 5I6YA 2FJ2A 1SE4A 3HOUB 2BA1A 1RTNA 4MN3A 2O5JC 4S3SA 3GTLB 2XN9C 5JEAG 3W2DA 3I4LA 1BCPD 2F3VA 3EA6A 5C5LA 4G4KA 1PXUA 1M8AA 1JR0D 2LY7A 1FR3A 1KDCA 1SNDA 1V43A 2AUJD 1SNQA 2HDMA 3GP7A 2D5DA 2NZ1D 3FRPB 2AQ3B 2F0IA 5KNBA 5CV7A 2NB0A 3A54A 3P75A 2IX3A 1KDAA 2LMCB 1MSGA 3ND8A 3OOCA 2B39A 1FGBD 4J1MA 4RHRA 1I4QA 2XWJB 1ZXTA 1TWFB 3MFGA 5TSSA 3VA7A 2NVYB 3BDCA 5C4XB 3PO3B 2OEOA 1F9PA 1Y8OB 3S2HB 4RGOS 1NAPA 1Q1BA 2BE5D 3DWPA 3SVMA 3MZ5A 5EJWA 3K59A 2O2LD 3AU7A 2ID0A 4DU9A 4NP5A 4F7XA 1C48A 2RDGA 4PMBA 3J80L 1QNUA 4XXEA 3KLSX 2XRSD 1HRJA 4OO1H 1GHKA 3DHQA 3TZDA 1I6HB 3VR5A 4HAEA 1O7YA 5D14A 2E2HB 5JEAJ 1CZWA 2ZXOA 1H9SA 1DM0B 1AZPA 1DOMA 4C2MB 3ONAB 2NVXB 2PZTA 1V1OA 4NKLA 1RCVD 4G7ZC 4PQXA 4A3GB 4X3SA 2EY1A 3A7LA 1LLRD 3FDTA 4RHSA 4C56C 3FEWX 1E2ZA 1SEBD 4XIGS 2KHSA 4JBWA 2EYMA 4A3IB 1EY8A 1PFNA 1ENFA 2RDHA 3O13A 4RWSC 1TY0A 2WV6D 5IGFA 3HP3A 1L0YB 4HMIA 4KK7A 1Q8IA 1GUSA 1IKMA 1O7ZA 1SNOA 5J22A 1KLUD 3VYRA 2D2CC 1EY7A 1OXSC 2F0MA 1JE4A 2A68C 3BS1A 2CQAA 4DNTB 3GD7A 3M4OB 5CGKA 1WTXA 4CGYB 1X3PA 1J8IA 5CV8A 2QILA 1JQYD 1BOSA 1V8QA 3EVQA 3E6ZX 5M5XB 3MA2B 3I90A 5IGDA 2E2IB 1AN8A 4RAUC 1D5XC 4BY1B 3NK9A 4G7HC 4A3DB 1H9SB 3QOLA 1U4MA 4PMCA 1KABA 1U9RA 5ELBA 1EY9A 3KLRA 4AYBB 1MGSA 1HA6A 4F87A 1RHPA 2NN6I 2NTTA 5FLXL 2F1MA 1EU3A 2IPKD 4MIUA 4KY7A 3CRKC 1T5EA 5CORA 1SYDA 2F0GA 5IODA 5IIFA 5LHY1 1EL0A 3NTKA 5KRUA 2O4XA 5M3MB 5DEHA 4ZK9B 2TMPA 4K8JA 3D8GA 1FYCA 4LJZC 2MJ8A 1NR4A 3MTSA 4H0LC 2AQ2B 3EJIA 3M3YB 4Y7NB 1NR2A 4FF3A 4ZRZA 3FPPA 1Q1EA 4PV1C 3OPOA 3OWEB 4A3EB 2A6ED 5ELEA 2A68D 4P2CB 4EGVA 1SMYC 1SXTA 2RSNA 3TP7A 5D3IB 2O5IC 2KA7A 3K0YA 3N6RA 1UNSA 1S5ED 3PUXA 5M9OA 4I7ZC 2JXMB 2K6AA 3S15B 1GUNA 2A6HC 1OXTA 1GJXA 2F03A 1I4HA 3A7AB 1CQVA 4TSSA 1Y8PB 2VUMB 2RBMA 2L55A 4KTAA 2ENBA 5G3LD 4C1NK 4ZKBB 3TMEA 4ABNA 1TS4A 2JSOA 4ZLTF 3C46A 3PUVA 1B3AA 3PMFA 2JEBI 1DOLA 1B53A 1PRTC 3VYSA 1D1KA 3GTPB 4CBVA 4KJNA 3MXPA 1EFID 3NBHA 2RQXA 3E5SA 2HUGA 1CK1A 1X32A 1XYIA 1F9QA 3K5MA 1BXTA 2B2YC 2K03A 3T53B 4IUQA 3CHBD 3VR2A 3HOYB 2EPBA 2A6HD 2F0JA 5I9PA 1TQOA 5COYA 5FK9C 2FINB 4PNYA 3U9OA 2NVTB 2DY8A 4BBRB 4QMGA 3KK7A 3MXUA 3RD4A 3KBXA 2B2WC 3MVVA 4H7BA 1EY5A 1HA5A 2QDBA 2K5DA 1BBXC 1J9OA 3H0GB 5IGCA 2EY2A 1HQRD 5C0XJ 3NQIA 5JOBA 1HXYD 5I2XA 5FO8B 1ENCA 2PCFB 3D4DA 2AWNA 1ONLA 3J80E 5KNCA 1I6VC 2QEJC 1G2SA 4DN4M 1B4OA 3I4NB 3WOFA 1D2BA 2F3WA 3OHXC 2K7VA 3GTMB 3MEHA 2OF1A 1EIGA 3SR1A 3W3AA 1Y1WB 4XQNA 5CV4A 1PTOH 1SJHD 4HCEA 4CHTB 2EJMA 1D5MC 1UEAB 3P20A 4EQNA 3BVZA 2JYOA 4A3KB 3I4MB 1EEID 1HFGA 3NUCA 1I4XA 4WFN3 4ZYSA 2Y0SB 2RDFA 2EYPA 5K5PA 2JA7B 4X3KA 1VF5C 3IFTA 1PTOC 5C0XG 3BYYB 1SNMA 2I07B 1JOKA 1STBA 4LAAA 1R9TB 4OO1I 1F77A 3VR6A 1STNA 4Z9CB 3T56B 1H9RA 3UI2A 3R93A 1M4VA 1A3TA 3ITPA 2A74C 2F0UA 3Q6SA 1DXMA 1D1IA 1PRTB 1Z6HA 1B9MA 1LT3D 3P1HA 2EJFC 5EBDA 1C4QA 3EQLC 2F0KA 1G6ZA 2B2VC 2F0DA 3MWYW 2B2VA 1GXDC 4QF4A 2NUCA 5IGGA 1QOHA 1SYCA 1B9NA 2GA4B 2FHTA 2HCIA 1EOTA 3NQTA 2F0OA 3V2TA 2IW3A 2NN6H 3M7NA 4GZYC 3SK4A 2QF7A 1EEFD 4K5XA 4NW2A 2L11A 2KVMA 2ZXPA 2OXPA 4LK1C 1FNWA 5DM63 4KN4C 4DFAA 2Z4HA 5FKAC 4X3TA 2M9VA 3ND9A 1ILQA 1L0XB 3J81E 2A69D 2F0FA 2BCOA 2Z8LA 2K04A 3HGBA 2J4XA 4K6LA 5D3DA 1II3A 3DWQA 2B8FA 4E6IA 1TKWB 2PO4A 3K5LA 1SNCA 3H91A 4IUUA 1HHVA 3SDZA 4C3HB 4R8IA 3J7AF 3FKIB 5C4ZA 4K2KA 2CHBD 1DONA 1AFPA 3IL8A 4KN7C 4IFDJ 3EFXD 4FNFA 4EQPA 2NYZD 3DEOA 3FMCA 1F9RA 2RVLA 4WORA 4L63B 2F0NA 4RKBA 2BA0A 2PZWA 4ZAIA 2K5QA 1EY4A 4RFBA 1ET6A 4A3BB 2A5HA 3KF8A 1SFOB 1Y1VB 2WP8J 1IW7D 1EYAA 1NCVA 1BR9A 4BY7B 4DNRB 5E1FA 1XWEA 1AP0A 2NVQB 2G9HD 3U9SA 1ZEQX 1F2LA 2XNAC 3TP6A 3VR3A 3RZOB 2K5WA 1K83B 4ME5A 1TY2A 1CQFA 1UUPA 3R8BA 1KDBA 4CJ2C 4UAIA 3G7LA 3R2TA 2PNRC 1BF4A 1Q12A 3A56A 1IW7C 2EYLA 1JWMD 1TVXA 1TT2A 5C5MA 5I9OA 4K14A 4L8JA 3V05A 1F2ZA 1JWSD 3C1FA 3H09A 1HTPA 3I73A 1BCPB 4HEDA 3MFYA 1S4ZA 5J39A 1K8OA 2PYKA 3HG9A 3S9WA 4R9WA 2ICIA 4QIWB 5I4DA 1BO0A 2MUYA 1HUMA 2K33A 2KEDA 1G91A 3ZYYX 1ILPA 3Q23A 3PUYA 5JPNC 1CZGA 3A8KE 4J8QA 2IJ0A 1F2YA 1ESFA 3S1MB 2IWHA 1CHPD 2M2LA 2EVBA 1UAPA 5C6AA 1SE3A 2YYZA 1DYQA 3TP8A 2N88A 1I4PA 1D6EC 5FO7B 5HGTA 3I3CA 4Q5VA 1E2WA 1JICA 5E3FA 1Y69U 3F2UA 3Q24A 4C3IB 2E76C 3OIPA 4WRDA 4IFDI 2J7ZA 1WTVA 3NBIA 1OO9B 1X3QA 1SBBB 1LACA 1I4GA 5EGTA 3D4RA 5T1GA 5IT9E 5EKIA 1V1PA 1C8CA 3S1QB 4J6HA 3VA5A 3GTGB 3IAYA 2J0TD 4KV6A 4ODGA 4H44C 4K5VA 1KAAA 1R4QB 3H94A 3D31A 1CFMA 3MHBA 5E4XA 5C3EB 4TQUS 2NWGA 4TKOB 4XYOA 4BA1I 1SAPA 3AMUA 2EZVA 5AFWA 2EYFA 1BCPC 4A3JB 4G57A 2EY5A 2WKDA 4F88A 2B2UC 2V4DA 3LNNA 1BCPF 3M4YA 1AZQA 1RODA 1PZJD 1OXXK 1DZ1A 1BQQT 2E75C 3DEPA 1STYA 1PZID 2F4IA 1CA5A 1ZKOA 2AUKA 1T5XD 4U68A 1LTTD 1EU4A 1EYCA 1ZYRC 4A3MB 3HEJA 1KTKA 1QJOA 3FPUB 3GTJB 1CA6A 5JVH3 1VF7A 1DD2A 4ZQ3A 1LTSD 2B2YA 1A2TA 4EQOA 1LTID 4IUVA 3RUZA 2CW0C 4IUNA 3S1NB 3SXHA 2F0QA 1WTQA 2C9OA 4NDXA 4B08A 5KEEA 4C1NI 1JOQA 4I65A 2KQ3A 2Z1CA 3HS0C 2DNCA 4ZUJA 1TS2A 1OXUA 3S17B 3SK5A 3FVQA 1ML0D 2MP1A 2B8GA 4KKTA 1IKLA 4DGZA 3S2DB 4IFDG 3R3OA 2JE6I 3Q22A 1Z7TA 3X3MA 2A69C 2VB3X 2LS01 1EZ6A 3WDNA 4KY5A 1OXVA 2KOLA 1SJED 2F0PA 2K05A 3PIO3 3QJYA 2VB2X 1WTPA 5EPKA 1VCIA 1Q3LA 2FMCA 1EY0A 4KHZA 1WCMB 1FD7D 1RD9D 1F2MA 2RKSA 3S14B 1AW7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M8A A;  5JJZ A;  1AZP A;  2K1B A;  1AP0 A;  1DOK A;  1DOM A;  1B50 A;  3F2U A;  1U4M A;  5EPJ A;  2X6G A;  4HCS A;  3KUP A;  2VXW A;  3ONA B;  3FPU B;  1VMP A;  2HDM A;  2L4N A;  4ZKC B;  4ZKB B;  1F2L A;  3GV3 A;  2NZ1 D;  4HSV A;  4NW2 A;  1MGS A;  2X6L A;  1CA6 A;  5EQ0 A;  1HA6 A;  1RHP A;  2L11 A;  2KVM A;  2SDF A;  2DY7 A;  3TN2 A;  4ZLT F;  5EPL A;  2JYO A;  2RA4 A;  1B3A A;  2J7Z A;  1O80 A;  1WTV A;  1DOL A;  1B53 A;  1EQT A;  2B2Y A;  2KEC A;  4X3T A;  1MSG A;  1X3Q A;  4CJ0 B;  1WD1 A;  1HFG A;  2K28 A;  4OIJ A;  1KNE A;  1U4L A;  2B2T A;  2BDN A;  4IUV A;  5T1G A;  2EE1 A;  4CJ2 C;  4X3S A;  4IUR A;  1ILQ A;  2KUM A;  5EKI A;  1E0B A;  4UAI A;  2HUG A;  1QE6 A;  1ZXT A;  3G7L A;  1C8C A;  1X32 A;  2L1B A;  2D9U A;  1XYI A;  1F9Q A;  4IUT A;  5COR A;  1BF4 A;  2L9H A;  3FDT A;  1HFN A;  4X3K A;  2B2Y C;  2K03 A;  3I91 A;  2B2W A;  4IUQ A;  1KNA A;  1CM9 A;  1QG7 A;  1EL0 A;  1WTQ A;  2EPB A;  5CBE E;  1TVX A;  2K04 A;  3DM1 A;  4ZK9 B;  1LV9 A;  1PFN A;  1RJT A;  4IUP A;  1EIH A;  1HUN A;  1WTW A;  2MJ8 A;  1F9S A;  4OIK A;  1NR4 A;  5COY A;  1ICW A;  1ESR A;  1F9P A;  1SDF A;  3N52 A;  5E4W C;  1VMC A;  4RWS C;  3MTS A;  5E4X A;  1SSO A;  1PFM A;  2FMM A;  2FIN B;  3D6W A;  1U4R A;  4XT3 B;  1NAP A;  3HP3 A;  4HED A;  4MHE A;  4RA8 A;  1S4Z A;  2NWG A;  3LWE A;  2DY8 A;  1PFB A;  2KEE A;  1IL8 A;  4X3U A;  3H91 A;  3UI2 A;  1WTO A;  4IUU A;  2B2U A;  1RTO A;  1ML0 D;  1SAP A;  4R9W A;  5T1I A;  3I8Z A;  3R93 A;  3SVM A;  1HHV A;  4XDX A;  1IKM A;  5EJW A;  1O7Z A;  1NR2 A;  3KBX A;  5AFW A;  2B2W C;  4R8I A;  1BO0 A;  3IFD A;  2K01 A;  3P7J A;  2Q8T A;  5CMD A;  2MP1 A;  1HUM A;  2MGS A;  3Q6S A;  2CVR A;  2HDL A;  2KED A;  1G91 A;  1MI2 A;  1IKL A;  4QUF A;  1DON A;  2MPM A;  2R3Z A;  1BBX C;  3IL8 A;  2B2U C;  2FFK B;  1ILP A;  1G2T A;  2RSO A;  1JE4 A;  1J9O A;  4QUC A;  2N55 A;  2NYZ D;  2X69 A;  3DEO A;  1PDQ A;  2L12 A;  1G6Z A;  2RSN A;  1PLF A;  1F9R A;  2B2V C;  2RVL A;  3GV6 A;  1U4P A;  3MWY W;  2B2V A;  2EOT A;  2M2L A;  4XT1 B;  5DNF A;  4CJ1 B;  1WTX A;  1MSH A;  2JP1 A;  2HCC A;  1B2T A;  1WVL A;  2B2T C;  2KOL A;  1GUW A;  1HRJ A;  1X3P A;  2FJ2 A;  4ZAI A;  1J8I A;  2XIW A;  2K05 A;  1AZQ A;  3TZD A;  1ROD A;  1WTP A;  1RTN A;  4MN3 A;  5EPK A;  4HAE A;  1O7Y A;  1Q3L A;  5D14 A;  1A15 A;  2Q8R E;  1DZ1 A;  2N88 A;  3QO2 A;  1WTR A;  1G2S A;  4DN4 M;  1QNK A;  1B4O A;  3DEP A;  4O42 A;  4LMQ D;  3I3C A;  3I90 A;  1CA5 A;  2H1E A;  1BNZ A;  4RAU C;  1WD0 A;  5CBA E;  1JIC A;  1XX8 A;  1NCV A;  5D65 A;  2IL8 A;  2FHT A;  2HCI A;  4U68 A;  1EIG A;  1EOT A; 
#chains in the Genus database with same CATH topology
 2ICE C;  5JJZ A;  5IGE A;  1DOK A;  1IHZ A;  2WB1 G;  2XSC A;  3DWA A;  3K81 C;  4V0B A;  4DAP A;  1D5Z C;  1EWC A;  4PZ8 A;  1TU2 B;  1VQF A;  3PUW A;  5GAD C;  5FJ8 G;  1VMP A;  1SMY D;  1YHQ A;  1B44 D;  2Q2U A;  3T51 B;  3W1G A;  2RA4 A;  3A5Z B;  2PMZ E;  4DV1 L;  4OX9 L;  2JA8 B;  3C2P A;  1EQT A;  3X3N A;  1I94 Q;  4HSP A;  2K28 A;  4OIJ A;  2B2T A;  2VQF Q;  5FLX c;  1SYF A;  5C0X I;  1Z47 A;  1PYS B;  4DR1 L;  2Z6B A;  3KJO A;  4K5W A;  1HNW Q;  4DXG A;  5ELC A;  5C0X H;  4QCL A;  1YNN D;  3PO3 H;  3BZK A;  1KNA A;  4F8M A;  4DNI A;  4UDU C;  2E74 C;  1TWG H;  4OIK A;  4RCN A;  1NE3 A;  1VMC A;  1SNP A;  3V96 A;  2R6G A;  3SHL A;  2F0H A;  3PUZ A;  4A3L G;  3G48 A;  4KI0 A;  2R7Z H;  4ILW A;  3IKJ A;  5KGU A;  1WTO A;  1IL8 A;  2PI2 E;  4R1J A;  1X54 A;  1JWU D;  2VZA A;  1WJJ A;  3K5N A;  4GOP B;  4YWK A;  5FLM G;  5DAU A;  2KBN A;  2VS1 A;  3PO3 G;  3BZC A;  1MI2 A;  1TR5 A;  4QUF A;  3LWU A;  4RGM A;  3VYT A;  3JC6 6;  4Y52 H;  1R4P B;  2DN8 A;  4X66 L;  1L1O A;  2WB1 B;  4OO1 G;  4IN3 A;  4YIJ A;  2L12 A;  1YNN C;  2EXD A;  1PLF A;  1RIP A;  3U4Z A;  4FXK C;  4FF2 A;  1RDP D;  1YNJ D;  4AIM A;  4A3L H;  1MSH A;  4H13 C;  1WVL A;  3NXW A;  1K8M A;  5FOB B;  2AQ1 B;  2JA7 G;  5C44 B;  2HQL A;  3CMA A;  2L5T A;  4QB4 A;  2A6E C;  3T1H Q;  2PW7 A;  2Q8R E;  3SK6 A;  4KD3 A;  1IBM Q;  2KCC A;  1I3Q B;  2NBF A;  5CYU A;  5CV9 A;  3NWS A;  1G29 1;  2CWA A;  2TSS A;  2LKV A;  1EOV A;  4CKC A;  5M3F G;  2ZXR A;  2EYO A;  2ZJR A;  4JI5 Q;  1STE A;  1SLJ A;  2F0E A;  4UP8 A;  3CCU A;  4R4Q A;  1HZ9 A;  3T16 A;  2KJX A;  5EPJ A;  1Q90 A;  5KYI A;  2B63 H;  1HPC A;  2F4V L;  2E2D C;  2DY7 A;  3NP8 A;  1YNJ C;  1O80 A;  1V1P B;  2MHV A;  1L0W A;  3H3V C;  4L6T B;  1WD1 A;  3CPW A;  1N33 L;  5M5Y B;  1KNE A;  2BDN A;  3H6M A;  1A3V A;  4O2D A;  5JAV A;  1PH9 A;  2EE1 A;  1A0I A;  2KUM A;  4CKE A;  5FO9 B;  3J7Y W;  2EYJ A;  3T1Y Q;  3QB3 A;  3I91 A;  2B2W A;  4DR5 L;  5CBE E;  2EJG C;  1HTL D;  1Y1W H;  4P72 A;  5IOC A;  4QIW E;  1QVF A;  1LTG D;  4JI1 Q;  1DCZ A;  4XTC S;  4FYD A;  1SSO A;  5IYC H;  3GTQ B;  2JA5 B;  1LTA D;  5KYL A;  4A93 B;  3ERQ A;  3PGZ A;  3HKS A;  5CV5 A;  3OSO A;  3I70 A;  3I8Z A;  5C4X H;  4V19 0;  1T9H A;  1JB3 A;  1EIF A;  1XXG A;  4P74 A;  5M5W H;  2CVR A;  3M7G A;  4C3H H;  2XRQ D;  3SEB A;  1G2T A;  3BYT B;  1ASY A;  4QUC A;  3CQZ B;  1I5F A;  1PH1 A;  1PDQ A;  5F2D A;  1XPR A;  4KKS A;  2QKI C;  2Z0S A;  4DAY A;  4JI2 L;  1CTM A;  1ENA A;  2I46 A;  2BE5 C;  1A8V A;  3OMG A;  2IY5 B;  5DNF A;  1YZ6 A;  2JP1 A;  4JV5 Q;  4JBK A;  1K9M C;  1TII D;  1O78 A;  2R92 G;  5CV6 A;  4LW1 A;  2KHJ A;  4DAV A;  2AMC B;  1TS3 A;  1A15 A;  1STH A;  4IZ8 A;  4JBM A;  1LUZ A;  1WCM G;  3PO2 B;  1IBL L;  3HOX G;  4LMQ D;  2H1E A;  3HFZ B;  3GTO B;  3KLS A;  3KF8 B;  1KRT A;  3NSW A;  3J81 L;  4RCO A;  2IL8 A;  1GOZ A;  5C3X A;  2WAQ B;  1SYB A;  2XVS A;  3STB C;  4JI0 Q;  3D4W A;  4KD4 A;  2CWP A;  1VQG A;  5FLX E;  1CT1 D;  4HCS A;  1B3Q A;  2RHS B;  3KUP A;  2HD3 A;  4TRD A;  1TWC H;  1BBU A;  4ZKC B;  2L4N A;  2IX0 A;  4K2L A;  3D3R A;  2R92 H;  3HOZ B;  1TWA B;  2KCN A;  3CPF A;  2CW0 D;  3TN2 A;  2E5L L;  5EPL A;  4A3K G;  3CCJ A;  2SNM A;  4DK1 A;  3CF5 A;  3MXG A;  2KEC A;  3OWF A;  1UE7 A;  4KKU A;  1GUO A;  1U4L A;  4AQY Q;  3S1R B;  3ULJ A;  1QZH A;  4KHV A;  5ELF A;  1K8A C;  1FNU A;  4C3I G;  4GOP C;  3QIA A;  3KLW A;  5A35 A;  4X65 Q;  3HOV H;  1PYW D;  1CM9 A;  4KJO A;  4KMU C;  3DMU A;  1GUT A;  2NZH A;  1LV9 A;  1RJT A;  2HIX A;  4IFD H;  1VQM A;  2FXQ A;  3STB D;  1PZK D;  4LFB Q;  3I4M H;  2ZTD A;  3N52 A;  5E4W C;  1B1Z A;  3QOJ A;  3BDL A;  3ER0 A;  1NSN S;  3OMC A;  1NUC A;  4GN3 B;  1EFW A;  5K36 G;  4QGU A;  4M1U B;  2M00 A;  4PMW A;  1J6Q A;  2I5L X;  5BN4 A;  5CMD A;  2K01 A;  2PPB C;  2MO0 A;  5LMU L;  1SE2 A;  5M3M G;  4DXF A;  1Q86 C;  2R3Z A;  4RG1 A;  4LF7 Q;  2PQE A;  4HIK A;  1QUQ B;  2H4O A;  5JJI A;  3BJU A;  4A3E H;  4NB3 A;  4FXD A;  5M3F B;  3HZX A;  3NE5 B;  1U4P A;  3J81 j;  4IAL A;  1BVS A;  1SE8 A;  4LFB L;  3K0X A;  2XIW A;  3L9A X;  4GNX A;  2ZM6 Q;  1PTO B;  2JA6 B;  2R7F A;  3ERO A;  2WFW A;  1WTR A;  4BS9 A;  4A93 H;  5KIX A;  2F0L A;  4IPH A;  3NHH A;  3A8J E;  1VQL A;  3A55 A;  3OIQ A;  5LL6 X;  1WD0 A;  1CI3 M;  5D65 A;  3BDO A;  4DF7 A;  3K8A A;  3HOW B;  4JCV E;  3HRZ C;  3BG3 A;  1I50 B;  1NNX A;  1B50 A;  1KLG D;  1VQD A;  1X3E A;  1Y14 B;  2VQE Q;  2Q8I B;  2UUA Q;  2HQE A;  5I2Y A;  3A8I E;  3UDG A;  5GAH C;  1EZ8 A;  1UWV A;  4XQQ A;  3K58 A;  1FL0 A;  1HCZ A;  4DR2 L;  4HSV A;  4HIM A;  4JK1 C;  3K7U C;  4CKB A;  2NN6 G;  5CR3 A;  2EYH A;  2JQO A;  2SDF A;  3NEM A;  2OTL A;  4BA2 I;  2Z6K A;  3CCM A;  2K32 A;  2XWB B;  1VDZ A;  1G8Z D;  5LMN L;  3J7A V;  3G6J B;  4FO2 A;  5IYB G;  4B9W A;  1H9J A;  3NEN A;  2JA5 G;  3GO5 A;  3NTI A;  4MZ9 A;  1QE6 A;  3S16 B;  4RMF A;  1A63 A;  2D9U A;  2CH4 A;  1I4R A;  1LT4 D;  1YEZ A;  1EQV A;  1STA A;  2YTY A;  3KBG A;  5IP7 H;  1HNX Q;  1IBL Q;  2JA8 G;  1E2V A;  3LX0 A;  1QG7 A;  1H95 A;  1W6J A;  1H9K A;  4DK0 A;  3FHW A;  1M90 C;  5IY0 A;  4IUP A;  2ES2 A;  1EIH A;  2NVT H;  4IJL A;  2JJQ A;  3A0J A;  1SDF A;  5G3L F;  2PZU A;  4L5Q A;  3PIO A;  1U4R A;  3D6C A;  4XT3 B;  4PZ6 A;  3JAM E;  1XMO L;  5ISR A;  3LWE A;  4X64 Q;  1PFB A;  2G9D A;  2KEE A;  2B2U A;  4C3H G;  2D62 A;  5A2Q E;  2Q8T A;  1PMR A;  5C44 H;  2NZO A;  3LGJ A;  3RMH A;  3K80 C;  5C4J H;  4YWL A;  2FFK B;  5A2Q L;  1SYE A;  3CXC A;  1BUV T;  4G7O C;  3HOX B;  2X69 A;  3DLL A;  1G6P A;  3AB9 A;  1A2U A;  4A75 A;  4KY6 A;  2WII B;  1LO5 D;  4OHJ A;  4CJ1 B;  2EOT A;  2R92 B;  1GUW A;  4RGT A;  1VQ4 A;  3RLF A;  4UP9 A;  1LT6 D;  1DGS A;  3RNU A;  1SYG A;  1STG A;  1MIU A;  3QO2 A;  3HKZ B;  3HOV B;  1QNK A;  2BH8 A;  3J7Z C;  1TWH B;  2R93 G;  3L7Z C;  4XYQ A;  3I4N G;  1BNZ A;  4JBJ A;  4WJW A;  1PHJ A;  3CC2 A;  5L37 A;  2QCP X;  1CKN A;  3S1R H;  1TWG B;  2K1B A;  4K6D A;  3OYY A;  4LF6 L;  3DUZ A;  2ZTC A;  1Y1W G;  4BXX G;  1HQM C;  1QIL A;  1Y8N B;  1BDO A;  5EKL A;  3GV3 A;  2R61 A;  4HR7 B;  2L15 A;  1PTO F;  3F1Z A;  2WB1 E;  4GS3 A;  5HUR A;  2B29 A;  3TZU A;  1JOO A;  3I4N H;  3T13 A;  4YHH Q;  2VNU D;  3SK8 A;  3NTH A;  2GVA A;  3CU7 A;  1YI2 A;  2L9H A;  4N9P A;  3H3V I;  3PO2 H;  1XTC D;  3GQB A;  1PRT D;  1JT8 A;  3K5O A;  3SGI A;  5ELD A;  3FKI H;  5FJ8 H;  3K57 A;  4MTN A;  1XNR Q;  5K36 H;  4FF1 A;  1IXR A;  5KND A;  3VR4 A;  3T4A C;  1S5B D;  2R93 B;  3MAQ A;  2E2J B;  4DV6 L;  3HKZ G;  3E9I A;  2FMM A;  2ZT9 C;  5EKK A;  3PIP 3;  1KQS A;  1MHW C;  2KEN A;  1UEB A;  5M3M H;  1YHA A;  4X66 Q;  1RTO A;  3CRL C;  4BBS B;  4POG A;  4OWW B;  3IFD A;  3VYU A;  1MD2 D;  3WOE A;  1GHJ A;  3PCO B;  3J80 i;  4A3D H;  5ELN A;  4YHH L;  2EIF A;  3URY A;  2MPM A;  1NY4 A;  2PW5 A;  4DUZ L;  4R8N A;  3M3Y H;  3KF6 A;  1I50 H;  1QB5 D;  4N9T A;  4HJ7 A;  1HJP A;  2UUB L;  3H0G H;  3GV6 A;  3R2I A;  2SOB A;  4XT1 B;  3UDI A;  1S5F D;  3OW7 A;  1ZYR D;  1ET9 A;  4DAY B;  4LF6 Q;  1CHQ D;  1AE3 A;  3CME A;  3KF6 B;  2HT1 A;  1RKN A;  3S17 H;  3UE1 A;  4ULL A;  1XNQ Q;  4QL5 A;  4ID6 A;  5JVG 3;  1XX8 A;  3H15 A;  3E0J A;  2K5N A;  2AWO A;  2NTS A;  5LL6 S;  2IX1 A;  2VQF L;  2RF4 A;  2SNS A;  1I94 L;  3RLO A;  2NVY H;  4DV3 Q;  3C3L A;  4IQZ A;  4DV1 Q;  2X6G A;  2UXD Q;  5JJK A;  2BOS A;  4K8I A;  3DXJ C;  2B63 B;  1H9M A;  5IYB H;  4OGQ C;  2CFM A;  1NBW A;  2OT2 A;  3AFP A;  4HMJ A;  3E9H A;  1O7I A;  4JPB W;  4R4T A;  5CC4 A;  3GTK B;  1FJG Q;  2DJF C;  1C9O A;  1KIX A;  1QCB D;  4IUR A;  3SE0 A;  1E0B A;  4DV5 Q;  1RF2 D;  3K7A B;  2L1B A;  1MJE A;  2D0P A;  4IUT A;  1EY6 A;  4XQJ A;  4YCU A;  1HFN A;  3JAM c;  5C4J B;  1B8A A;  1YBY A;  1S5D D;  5JPM C;  4X64 L;  2Z4I A;  1XMO Q;  3DM1 A;  2E8G A;  4A3J G;  1WTW A;  1F9S A;  4OL7 A;  1GKH A;  4M8A A;  4UY8 C;  1JC7 A;  4A3E G;  5BN5 A;  3I72 A;  3TSS A;  4C3J B;  5C4H A;  4RH6 A;  2OQK A;  4DV2 L;  1K28 A;  2BDO A;  4MHE A;  5C3W A;  1PTO D;  4JI3 L;  4DKA C;  2EXZ A;  5EBC A;  1NMG A;  5T1I A;  1LTR D;  2JEA I;  3NPP A;  1HNX L;  4XDX A;  1PFS A;  4HTH A;  4EVO A;  3RZD B;  1XMQ Q;  3HKZ E;  4FF4 A;  1S5C D;  4A93 G;  5JEA H;  5LMN Q;  1TWC B;  1WTH A;  3CCE A;  1A3U A;  1K3R A;  2OCE A;  1JJC B;  2N55 A;  1D8L A;  3MC0 B;  2R7Z B;  3BVG A;  2F0S A;  3CQZ H;  1W6K A;  3TP5 A;  4DR2 Q;  2HCC A;  2B2T C;  2UUA L;  2VQE L;  1FNV A;  4PZ7 A;  4O1N A;  5IT9 L;  5J1Z A;  3CKI B;  1GUG A;  4QQB X;  1N32 L;  3M85 A;  1LAB A;  4B9X A;  4Y7N H;  4LNQ A;  2DUD A;  4RGN A;  4O42 A;  3QWN A;  5DM7 3;  2ZJP A;  3PV0 A;  2WIN B;  5CBA E;  3G4S A;  1PRT F;  2Z9H A;  4DA2 A;  4BXX H;  1S72 A;  5IP7 G;  1QVC A;  1QWY A;  4U67 3;  2ZM6 L;  2E2H H;  1PH8 A;  2JA8 H;  1LTB D;  4A3F B;  4GKJ Q;  4C3J G;  1I6H H;  4DV0 L;  2EDG A;  3TQY A;  2EY6 A;  2QW7 A;  2C5C A;  2VXW A;  2JA6 H;  2SEB D;  3A74 A;  2LFN A;  2X6L A;  1AEX A;  4JOI C;  1E22 A;  5EQ0 A;  5M5W B;  2WKC A;  1VQE A;  2DNE A;  2RCN A;  4C2M H;  3HOU G;  3TBI B;  3MXN A;  2WAC A;  4CJ0 B;  1MJC A;  4FVM A;  2UU9 L;  1JOR A;  3CW2 C;  2YU9 B;  3K6O A;  2C35 B;  4LF9 Q;  3HOW G;  4LF8 L;  3CCS A;  1PH4 A;  2A73 B;  3W1B A;  3C1E A;  4BWG B;  2F0W A;  1EYD A;  1XJV A;  1EWH A;  1DJR D;  1XTD A;  1N36 L;  3Q0A A;  3BZD B;  2A1A A;  4NMZ A;  2A19 A;  1JCK B;  3BVM A;  2R7Z G;  1HUN A;  1FGU A;  5IGB A;  4DV0 Q;  1ICW A;  1ESR A;  3NWT A;  4ZUI A;  1JE5 A;  4DUY L;  4DR7 L;  5BN3 A;  1PFM A;  2PMZ B;  3D6W A;  3KJP A;  5NUC A;  4GKK Q;  4RA8 A;  3CCQ A;  4HN7 A;  2IT1 A;  1YIT A;  1LT5 D;  5C3E G;  4X3U A;  1MBY A;  4FXG C;  1HR0 Q;  1AH9 A;  1IYV A;  4FP5 D;  3CC7 A;  3P7J A;  4Q0F A;  4RKL A;  2MGS A;  2HDL A;  3S1N H;  1N32 Q;  1A6X A;  1TWF H;  5I6W A;  1TS5 A;  1CKM A;  5JJL A;  4AQY L;  1Q8K A;  3S1M H;  2RSO A;  1FVI A;  3QG1 A;  2F0V A;  1EUJ A;  3KOJ A;  2E5L Q;  3JAM L;  2F0T A;  1IYU A;  5DLQ E;  3TDQ A;  1O7L A;  1B2T A;  1X9N A;  2L0C A;  1CUK A;  3L3O C;  4NXN Q;  5I6Y A;  2FJ2 A;  2MNA A;  3RZD H;  3TS2 A;  1SE4 A;  3HOU B;  2BA1 A;  1RTN A;  4MN3 A;  3UE0 A;  3EBE A;  2O5J C;  4S3S A;  3GTL B;  1PH5 A;  1XMQ L;  2XN9 C;  4GN4 B;  3W2D A;  5JEA G;  3U58 A;  3I4L A;  1D7Q A;  2VUM H;  1LYL A;  1BCP D;  2F3V A;  4APV A;  3EA6 A;  5C5L A;  2B63 G;  4OEL B;  4G4K A;  1PXU A;  1M8A A;  1JR0 D;  2LY7 A;  1FR3 A;  5IE8 A;  1KDC A;  1SND A;  2OQ0 A;  4P73 A;  1S3O A;  1V43 A;  2AUJ D;  1SNQ A;  2HDM A;  3GP7 A;  2D5D A;  2NZ1 D;  1N34 L;  3FRP B;  1X55 A;  2AQ3 B;  2F0I A;  5KNB A;  3K7A H;  5CV7 A;  4JYA Q;  2NB0 A;  1AE2 A;  3RLN A;  3A54 A;  4HIO A;  3P75 A;  1YJ9 A;  3I56 A;  3M4P A;  1UE5 A;  4QY7 A;  1KDA A;  2IX3 A;  2LMC B;  3IRB A;  1MSG A;  2I5M X;  3OOC A;  3ND8 A;  1WI5 A;  2B39 A;  1FGB D;  4DV4 Q;  4J1M A;  4RHR A;  1I4Q A;  3MEF A;  2ASB A;  2XWJ B;  1ZXT A;  1NTG A;  3HOY G;  1TWF B;  4A3J H;  3MFG A;  5TSS A;  3VA7 A;  2K4K A;  3NBH B;  4LUZ A;  2NVY B;  3BDC A;  4UPA A;  5C4X B;  3PO3 B;  4X62 Q;  2OEO A;  3S24 A;  1N9W A;  1F9P A;  5LMN W;  1Y8O B;  1VQK A;  3S2H B;  2ALY B;  4RGO S;  4DV7 Q;  2Z6K C;  1NAP A;  1Q1B A;  1X65 A;  5IP9 H;  4DR5 Q;  2BE5 D;  3DWP A;  3SVM A;  3MZ5 A;  5EJW A;  3K59 A;  2O2L D;  3AU7 A;  2ID0 A;  4P71 A;  4DU9 A;  4NP5 A;  4F7X A;  4YY3 Q;  4JI8 Q;  1C48 A;  2RDG A;  4GLA C;  4PMB A;  1QNU A;  3J80 L;  4XXE A;  1VQP A;  2QDL A;  3KLS X;  4IPG A;  2XRS D;  1GO3 E;  3PSI A;  4HJ5 A;  4BBS G;  2F3I A;  1HRJ A;  1K0S A;  4A3F G;  4OO1 H;  1GHK A;  3DHQ A;  4OON A;  3TZD A;  1CKN B;  1I6H B;  3VR5 A;  4HAE A;  1O7Y A;  4LWC A;  5D14 A;  2E2H B;  5JEA J;  1CZW A;  4LUO A;  2ZXO A;  3W5O A;  1H9S A;  1IBM L;  2E2J H;  3S2H H;  3RR5 A;  2YU9 H;  1DM0 B;  3BU2 A;  1EIY B;  1AZP A;  1DOM A;  4DV6 Q;  2KHI A;  1GVP A;  4C2M B;  3ONA B;  2NVX B;  2PZT A;  1V1O A;  4NKL A;  4HJ9 A;  2CCZ A;  2MQH A;  1RCV D;  3CAM A;  4G7Z C;  1SMX A;  3HOV G;  2VUM G;  1Q7Y C;  3E3X A;  4PQX A;  4A3G B;  4CDE C;  4X3S A;  2EY1 A;  3A7L A;  5GQO A;  1LLR D;  4JC0 A;  3PF4 A;  3FDT A;  4RHS A;  4C56 C;  4AH6 A;  3FEW X;  3KDF B;  1E2Z A;  1SEB D;  2Y0S E;  4XIG S;  2F52 A;  2KHS A;  4JBW A;  2EYM A;  2CQO A;  4A3I B;  1EY8 A;  1PFN A;  1QZG A;  1ENF A;  2RDH A;  3O13 A;  1YHB A;  4GOP A;  4RWS C;  3PF5 A;  1TY0 A;  2WV6 D;  4JI8 L;  5IGF A;  1QVG A;  3HP3 A;  2K5V A;  1VS0 A;  1L0Y B;  4HMI A;  4KK7 A;  1Q8I A;  1GUS A;  1HNW L;  1IKM A;  1O7Z A;  1SNO A;  5J22 A;  3PO2 G;  1KLU D;  3VYR A;  2D2C C;  4BY7 G;  1EY7 A;  1HZC A;  1OXS C;  2F0M A;  1JE4 A;  3EN2 A;  4CDF C;  4WJ3 M;  4X62 L;  2A68 C;  4EQ5 A;  3BS1 A;  2CQA A;  4DNT B;  4KHP L;  3GD7 A;  3I2Z A;  4CDC C;  3M4O B;  4C3J H;  2N78 A;  5CGK A;  1WTX A;  4CGY B;  1X3P A;  1J8I A;  4GLX A;  5CV8 A;  2QIL A;  1JQY D;  3UDF A;  1ICF B;  5IYD H;  1BOS A;  1V8Q A;  4DV4 L;  3EVQ A;  3E6Z X;  5M5X B;  3MA2 B;  4BY7 H;  3I90 A;  5IGD A;  1VQO A;  1AN8 A;  4RAU C;  2E2I B;  1D5X C;  1VQA A;  1VQ8 A;  2UXC Q;  4BY1 B;  3NK9 A;  4G7H C;  4FDB A;  1WCM H;  2P5Z X;  4A3D B;  3H0G G;  1H9S B;  3QOL A;  1U4M A;  4PMC A;  3J80 c;  1KAB A;  1KAW A;  1NJI C;  4BBS H;  1U9R A;  4A3F H;  5ELB A;  3RZO H;  1EY9 A;  3KLR A;  4AYB B;  3GTG H;  3KFU A;  1MGS A;  1HA6 A;  4F87 A;  1RHP A;  2NN6 I;  3S1Q H;  4JI6 Q;  2NTT A;  5FLX L;  5BR8 Q;  2F1M A;  4B3M L;  1EU3 A;  2IPK D;  3J7A 5;  4MIU A;  4B3R Q;  1JB7 A;  4IOC A;  4KY7 A;  3VDY A;  3J81 i;  3CRK C;  1T5E A;  5COR A;  4ME3 A;  1SYD A;  4ALP A;  4R4I A;  2F0G A;  5IOD A;  5IIF A;  5LHY 1;  1SFO H;  1EL0 A;  3NTK A;  5KRU A;  1PA6 A;  2O4X A;  2XTI A;  5M3M B;  5DEH A;  4C3I H;  2TMP A;  4ZK9 B;  4K8J A;  3D8G A;  1FYC A;  4LJZ C;  2MJ8 A;  4ZCK A;  2VW9 A;  1NR4 A;  4JW0 A;  3OTO Q;  3MTS A;  4H0L C;  2AQ2 B;  2Y0S G;  3PQI A;  2A8V A;  3EJI A;  3M3Y B;  2GN5 A;  4Y7N B;  1NR2 A;  4FF3 A;  4JG2 A;  4ZRZ A;  3FPP A;  1Q1E A;  4PV1 C;  2K50 A;  3OPO A;  4DR7 Q;  3OWE B;  4A3E B;  1L2F A;  2A6E D;  1HZA A;  5ELE A;  2A68 D;  4P2C B;  1VQ7 A;  1SMY C;  1SXT A;  4EGV A;  2RSN A;  3TP7 A;  3F2D A;  5D3I B;  2O5I C;  4JOI A;  2KA7 A;  3K0Y A;  3N6R A;  1W2B A;  1WOC A;  3MXN B;  1UNS A;  4IPC A;  2EQS A;  4OXP A;  1YNX A;  5LMU Q;  1S5E D;  4LFC Q;  3PUX A;  5M9O A;  2UU9 Q;  4I7Z C;  3GTK H;  2JXM B;  2K6A A;  3S15 B;  1GUN A;  2A6H C;  1OXT A;  3E0E A;  2HHH Q;  1GJX A;  4HJA A;  2F03 A;  1I4H A;  3A7A B;  1CQV A;  1SRU A;  4TSS A;  1Y8P B;  3ZJY C;  4K0K Q;  2VUM B;  2RBM A;  2L55 A;  4KLK A;  4DR3 Q;  2V1C C;  3ULP A;  4KTA A;  2ENB A;  5G3L D;  4C1N K;  1JMC A;  2NVQ H;  4ZKB B;  2UXB L;  3TME A;  4ABN A;  2Q2I A;  1TS4 A;  2JSO A;  2K14 A;  4ZLT F;  3C46 A;  4X65 L;  3PUV A;  1B3A A;  3PMF A;  3ULL A;  3I7F A;  2KCT A;  2JEB I;  1DOL A;  4AYB E;  1B53 A;  1PRT C;  3VYS A;  1Q82 C;  1D1K A;  3GTP B;  4CBV A;  4KJN A;  3MXP A;  1EFI D;  3NBH A;  2RQX A;  3E5S A;  2HUG A;  1CK1 A;  1X32 A;  1XYI A;  1F9Q A;  1Z9F A;  3K5M A;  3KYH C;  4LF5 Q;  1BXT A;  2B2Y C;  2K03 A;  3T53 B;  4IUQ A;  3CHB D;  3VR2 A;  3HOY B;  2EPB A;  2A6H D;  2F0J A;  3S16 H;  5I9P A;  4LFA L;  1TQO A;  4A76 A;  1IBK Q;  4UP7 A;  5COY A;  1R9T H;  2PQA B;  5FK9 C;  5C4X G;  3PIP A;  2FIN B;  1JJ2 A;  3B6Y A;  4PNY A;  3U9O A;  2NVT B;  1EYG A;  2DY8 A;  4BBR B;  2HIV A;  4QMG A;  1U0L A;  3TRE A;  3KK7 A;  3MXU A;  3RD4 A;  3KBX A;  4A3C H;  2B2W C;  3MVV A;  4JI3 Q;  4H7B A;  1EY5 A;  4DV2 Q;  4L5T A;  1KL9 A;  1HA5 A;  2QDB A;  2QEX A;  4B3S Q;  2K5D A;  1BBX C;  1IZ6 A;  5FLM H;  1J9O A;  1B7Y B;  1VQI A;  3H0G B;  5IGC A;  4JV5 L;  2EY2 A;  3H3V H;  1HQR D;  4JI2 Q;  5C0X J;  4IJH A;  1TXY A;  1P16 A;  1SRO A;  3NQI A;  5JOB A;  1HXY D;  5I2X A;  2OWO A;  5FO8 B;  1ENC A;  2PCF B;  4N8X 1;  1IBK L;  3D4D A;  1A62 A;  1EQQ A;  4LFA Q;  2AWN A;  4DAM A;  1ONL A;  3J80 E;  2UUC Q;  5KNC A;  4CDD C;  1I6V C;  2QEJ C;  2H5X A;  1G2S A;  2JK8 A;  4DN4 M;  1FJG L;  1B4O A;  3WOF A;  2JA7 H;  3I4N B;  3AQQ A;  2I5H A;  1D2B A;  1CSP A;  1XPO A;  2F3W A;  3OHX C;  2K7V A;  3GTM B;  3MEH A;  2OF1 A;  1EIG A;  3SR1 A;  2R93 H;  4WJ4 A;  3W3A A;  4QJF A;  1Y1W B;  2UXD L;  4XQN A;  1VQJ A;  5CV4 A;  4HCE A;  1PTO H;  1SJH D;  4DV3 L;  1G51 A;  1WFQ A;  2ZJQ A;  4CHT B;  2EJM A;  2IHF A;  1D5M C;  1L1O B;  2N49 A;  4JVZ A;  1L1O C;  1UEA B;  2KCM A;  3P20 A;  4EQN A;  3BVZ A;  2JYO A;  1OTC A;  4A3K B;  1XNQ L;  4DR3 L;  5M5Y H;  3I4M B;  1EEI D;  1HFG A;  3NUC A;  2MFI A;  1TWH H;  1J5E L;  2MO1 A;  1I4X A;  4WFN 3;  4K0K L;  4X6A H;  4ZYS A;  1HH2 P;  2Y0S B;  3AFQ A;  2HHH L;  2RDF A;  2EYP A;  4OWT B;  5K5P A;  1VQN A;  2JA7 B;  4X3K A;  2LXJ A;  3A5U A;  1VF5 C;  4JI7 Q;  1UE1 A;  1GM5 A;  1YIJ A;  2UUB Q;  2F4V Q;  3IFT A;  3KDF A;  1PTO C;  5C0X G;  3BYY B;  1SNM A;  2I07 B;  4DUZ Q;  4JI4 L;  5GAG C;  1JOK A;  1STB A;  2AHO B;  4LAA A;  1R9T B;  4OO1 I;  4A3G G;  1F77 A;  3VR6 A;  4UHV A;  1STN A;  4Z9C B;  3T56 B;  1M1K C;  1H9R A;  3UI2 A;  2DJG C;  3R93 A;  1YJN A;  3Q8D A;  3U4V A;  1M4V A;  3HOY H;  1A3T A;  3ITP A;  2A74 C;  2F0U A;  4J15 A;  3Q6S A;  1DXM A;  3T1H L;  4A3I G;  1D1I A;  1PRT B;  1Z6H A;  1B9M A;  1LT3 D;  3P1H A;  2EJF C;  5EBD A;  1C4Q A;  3EQL C;  3M9B A;  2F0K A;  1G6Z A;  4OEM B;  1EQR A;  3CC4 A;  1XNR L;  1SN8 A;  2B2V C;  2F0D A;  1E1O A;  3MWY W;  1V9P A;  2B2V A;  3I55 A;  3OTO L;  3CCV A;  1YVC A;  1GXD C;  3CCL A;  4QF4 A;  1K0R A;  2NUC A;  3G71 A;  5IGG A;  4R4C A;  1QOH A;  1E7Z A;  4PG3 A;  1SYC A;  1B9N A;  2GA4 B;  4DPG A;  2K52 A;  2FHT A;  2HCI A;  3EIV A;  2JA6 G;  4B3R L;  1EOT A;  3NQT A;  4MNO A;  2F0O A;  3V2T A;  2IW3 A;  4GNX C;  3HOX H;  2NN6 H;  3M7N A;  4GZY C;  3SK4 A;  3UDX A;  1Y1V H;  4B3M Q;  2QF7 A;  1LM0 A;  5BR8 L;  2ATW A;  1PH3 A;  1EEF D;  4K5X A;  4NW2 A;  4TVA B;  2L11 A;  2KVM A;  2RCF A;  2ZXP A;  4LF4 Q;  3HOW H;  2OXP A;  4LK1 C;  2JA5 H;  3GTQ H;  1FNW A;  5DM6 3;  4KN4 C;  4DFA A;  2Z4H A;  1KD1 C;  5FKA C;  4HJ8 A;  4P75 A;  4X3T A;  4DR1 Q;  4H02 A;  2M9V A;  3ND9 A;  4AYB G;  2GVB A;  1ILQ A;  1CSQ A;  4A3K H;  1L0X B;  1WYD A;  1IYJ B;  5J3B A;  3J81 E;  2A69 D;  2F0F A;  2BCO A;  1Y1V G;  2Z8L A;  4N8F A;  2K04 A;  3HGB A;  2J4X A;  2LSS A;  2RHQ B;  4K6L A;  5D3D A;  5IP9 G;  1II3 A;  5IT9 c;  3DWQ A;  2B8F A;  4E6I A;  1TKW B;  2PO4 A;  4KHP Q;  4IO9 A;  3K5L A;  3ICE A;  1SNC A;  3H91 A;  4IUU A;  1HHV A;  2XGT A;  3SDZ A;  4C3H B;  5IYC G;  2LXK A;  4R8I A;  3FKI B;  3J7A F;  5C4Z A;  4K2K A;  2CHB D;  1KXL A;  2PQA A;  1DON A;  1UE6 A;  1AFP A;  4DK6 C;  3TS0 A;  3IL8 A;  4KN7 C;  4IFD J;  3EFX D;  2YTX A;  4FNF A;  4EQP A;  3CCR A;  5M3F H;  3AYH B;  2NYZ D;  2WAQ E;  3DEO A;  3FMC A;  2JN4 A;  2R7D A;  4EX5 A;  4LF4 L;  1F9R A;  2RVL A;  4WOR A;  5M5X H;  4L63 B;  2PI2 A;  5IWA Q;  2F0N A;  4RKB A;  2BA0 A;  1MKH A;  2PZW A;  4ZAI A;  3F2C A;  2K5Q A;  1EY4 A;  4RFB A;  1ET6 A;  2G5D A;  4A3B B;  2A5H A;  1BKB A;  3KF8 A;  1SFO B;  1HNZ L;  1Y1V B;  2WP8 J;  3NEL A;  4BBR H;  1IW7 D;  2E2I H;  1EYA A;  1YJW A;  1NCV A;  1BR9 A;  4BY7 B;  1I3Q H;  3L0O A;  4DNR B;  5E1F A;  1XWE A;  1AP0 A;  2NVQ B;  3RN5 A;  2G9H D;  3U9S A;  1ASZ A;  1ZEQ X;  1F2L A;  2XNA C;  3TP6 A;  3VR3 A;  4DR6 Q;  3RZO B;  3U50 C;  3M4Q A;  3QR8 A;  2B3G A;  2K5W A;  1K83 B;  4ME5 A;  1TY2 A;  1K73 C;  2YV5 A;  3CD6 A;  1CQF A;  1UUP A;  3R8B A;  1P8L A;  1VQ9 A;  1KDB A;  4CJ2 C;  1KC8 C;  5AJ3 Q;  4DR4 Q;  3FKI G;  4UAI A;  3G7L A;  3R2T A;  2PNR C;  1KHI A;  1BF4 A;  1VQB A;  2DGY A;  1Q12 A;  3A56 A;  3DM3 A;  4A4I A;  5HGQ A;  1IW7 C;  3ERS X;  2QA4 A;  2EYL A;  1JWM D;  1TVX A;  1TT2 A;  5C5M A;  4A3G H;  5I9O A;  4K14 A;  1E3P A;  1CKO A;  4L8J A;  3V05 A;  4JI4 Q;  1PH7 A;  1F2Z A;  1Q46 A;  1JWS D;  3M4O H;  4LF7 L;  3C1F A;  2VL6 A;  3GTP H;  4B3T L;  3H09 A;  1HTP A;  3I73 A;  1BCP B;  4HED A;  3MFY A;  1X56 A;  1S4Z A;  4JI7 L;  5J39 A;  4A3I H;  1K8O A;  2PYK A;  1PH6 A;  3HG9 A;  3S9W A;  4R9W A;  1BBW A;  2ICI A;  4QIW B;  5I4D A;  1BO0 A;  2MUY A;  5GRO A;  1X6O A;  1HUM A;  2K33 A;  2KED A;  4YY3 L;  1G91 A;  2VY3 A;  3ZYY X;  1J5E Q;  4A3B G;  1ILP A;  3Q23 A;  3PUY A;  5JPN C;  1CZG A;  5C44 G;  3A8K E;  4J8Q A;  2IJ0 A;  1F2Y A;  1ESF A;  3S1M B;  1C7Y A;  1SR3 A;  3JAM i;  4DV7 L;  2IWH A;  1CHP D;  2M2L A;  4HID A;  4R4O A;  3S15 H;  4OWX B;  2EVB A;  1UAP A;  1C0A A;  5C6A A;  1SE3 A;  2QGQ A;  2YYZ A;  1DYQ A;  3TP8 A;  2N88 A;  1I4P A;  1D6E C;  5FO7 B;  5HGT A;  2N3S A;  3CP0 A;  3I3C A;  4LUV A;  4Q5V A;  2JA9 A;  2I0Q A;  1E2W A;  1JIC A;  3GTM H;  5E3F A;  4IPD A;  2UUC L;  1PYB A;  2AKW B;  1Y69 U;  3F2U A;  3Q24 A;  4C3I B;  2PNH A;  2E76 C;  3OIP A;  1V1Q A;  3TRZ A;  4JI0 L;  4JYA L;  3J81 c;  1E1T A;  1N34 Q;  1HZB A;  1Q81 C;  2NVX H;  3I4M G;  4WRD A;  4IFD I;  2J7Z A;  3FP9 A;  4NXM Q;  1WTV A;  1N8R C;  3NBI A;  1OO9 B;  1X3Q A;  1SBB B;  4I7A A;  1LAC A;  1I4G A;  4B3S L;  5EGT A;  3D4R A;  3S14 H;  5T1G A;  2ZTE A;  4DK3 C;  5IT9 E;  5H1S E;  5EKI A;  1V1P A;  1C8C A;  1U5K A;  3G6E A;  3S1Q B;  4NXM L;  4IOA A;  2Q2H A;  4J6H A;  3VA5 A;  4A3M G;  3IAY A;  3GTG B;  2J0T D;  4KV6 A;  3AEV A;  4ODG A;  1B70 B;  4H44 C;  4K5V A;  1XPU A;  1KAA A;  2N8N A;  1R4Q B;  3H94 A;  3D31 A;  4NXN L;  1VQ5 A;  4GLV B;  4BY1 H;  2IHE A;  1CFM A;  3MHB A;  5E4X A;  4GNX B;  5C3E B;  4TQU S;  2NWG A;  4TKO B;  4XYO A;  3S2D H;  4BA1 I;  1SAP A;  3AMU A;  4LF5 L;  2EZV A;  5AFW A;  3RN2 A;  2EYF A;  1BCP C;  4A3J B;  4A3M H;  4G57 A;  2EY5 A;  2WKD A;  4F88 A;  2B2U C;  4JI1 L;  2V4D A;  1HR0 L;  1X3F A;  4A3D G;  1EWI A;  4GKK L;  2WAQ G;  1LTL A;  3LNN A;  5IYD G;  5GAE C;  2UXB Q;  4YCV A;  4DUY Q;  1NMF A;  1BCP F;  1TWA H;  3M4Y A;  3HOZ H;  3T1Y L;  4BBR G;  1AZQ A;  4MTK A;  1ROD A;  1PZJ D;  3I4O A;  1OXX K;  4L5S A;  1DZ1 A;  1KRS A;  1BQQ T;  1N36 Q;  2D0O A;  5HY6 A;  1N33 Q;  2E75 C;  3DEP A;  1STY A;  1S40 A;  1PZI D;  2F4I A;  1CA5 A;  1ZKO A;  2AUK A;  4L5R C;  4LFC L;  1T5X D;  4U68 A;  1LTT D;  4LF8 Q;  1EU4 A;  3GTO H;  1EYC A;  4LF9 L;  4B3T Q;  1ZYR C;  4A3M B;  3HEJ A;  3GTL H;  4NPS A;  1GD7 A;  1KTK A;  3HOU H;  1QJO A;  3FPU B;  5ELO A;  3GTJ B;  3HOZ G;  4JI5 L;  3GTJ H;  1CA6 A;  5JVH 3;  1VF7 A;  1DD2 A;  4GN5 A;  2BH2 A;  2YTV A;  4ZQ3 A;  1LTS D;  2B2Y A;  3OW2 A;  4GKJ L;  1K8G A;  1A2T A;  1RL2 A;  3F8T A;  4EQO A;  1LTI D;  1PV4 A;  5AJ3 L;  4DR4 L;  4IUV A;  1K83 H;  1X3G A;  3RUZ A;  5EAY A;  2CW0 C;  4IUN A;  2Q2T A;  3S1N B;  3SXH A;  4O0A A;  3GDE A;  2F0Q A;  1WTQ A;  1VQH A;  4POF A;  2C9O A;  4NDX A;  2K75 A;  4DR6 L;  2CKZ B;  4B08 A;  5KEE A;  4C1N I;  1JOQ A;  5C3E H;  3F2B A;  4I65 A;  2KQ3 A;  1VQ6 A;  2Z1C A;  3HS0 C;  2DNC A;  4ZUJ A;  1IL2 A;  4A3C G;  1TS2 A;  1OXU A;  2CH4 W;  3S17 B;  3SK5 A;  1K3B C;  3FVQ A;  1ML0 D;  4A3B H;  3TEH B;  2MP1 A;  2B8G A;  1HNZ Q;  4YWM A;  4KKT A;  1IKL A;  4DGZ A;  1E24 A;  3S2D B;  4IFD G;  4JI6 L;  3R3O A;  2JE6 I;  3Q22 A;  5IWA L;  1Z7T A;  3X3M A;  2A69 C;  2VB3 X;  4BY1 G;  2LS0 1;  1EZ6 A;  3WDN A;  1HR0 W;  1QUQ A;  4KY5 A;  1OXV A;  2KOL A;  1PVO A;  1SJE D;  2F0P A;  2K05 A;  1JJG A;  3WWV A;  3PIO 3;  3QJY A;  2VB2 X;  1WTP A;  5EPK A;  1VCI A;  1Q3L A;  2FMC A;  1EY0 A;  4KHZ A;  1W3S A;  2UXC L;  4YCW A;  3L2P A;  1PH2 A;  2OTJ A;  2K5H A;  4OX9 Q;  1WCM B;  1FD7 D;  1RD9 D;  1VQC A;  4DV5 L;  1F2M A;  2RKS A;  5E7N A;  3D0F A;  3S14 B;  1AW7 A; 
#chains in the Genus database with same CATH homology
 2ICE C;  5JJZ A;  5IGE A;  1DOK A;  1IHZ A;  3DWA A;  2XSC A;  4V0B A;  4DAP A;  1D5Z C;  1EWC A;  1TU2 B;  3PUW A;  1VMP A;  1SMY D;  1B44 D;  3T51 B;  2RA4 A;  2JA8 B;  3C2P A;  1EQT A;  3X3N A;  4HSP A;  2K28 A;  4OIJ A;  2B2T A;  1SYF A;  5C0X I;  1Z47 A;  4K5W A;  4DXG A;  5ELC A;  5C0X H;  4QCL A;  1YNN D;  1KNA A;  4F8M A;  4UDU C;  2E74 C;  4OIK A;  4RCN A;  1VMC A;  1SNP A;  3V96 A;  2R6G A;  3SHL A;  2F0H A;  3PUZ A;  4KI0 A;  4ILW A;  3IKJ A;  5KGU A;  1WTO A;  1IL8 A;  1JWU D;  3K5N A;  5DAU A;  1MI2 A;  1TR5 A;  4QUF A;  3LWU A;  4RGM A;  3VYT A;  1R4P B;  2DN8 A;  2WB1 B;  4OO1 G;  4IN3 A;  4YIJ A;  2L12 A;  1YNN C;  1PLF A;  4FXK C;  4FF2 A;  1RDP D;  1YNJ D;  1MSH A;  4H13 C;  1WVL A;  3NXW A;  1K8M A;  5FOB B;  2AQ1 B;  5C44 B;  2L5T A;  4QB4 A;  2A6E C;  2PW7 A;  2Q8R E;  3SK6 A;  4KD3 A;  2KCC A;  1I3Q B;  2NBF A;  5CYU A;  5CV9 A;  3NWS A;  1G29 1;  2TSS A;  2LKV A;  4CKC A;  2ZXR A;  2EYO A;  1STE A;  2F0E A;  3T16 A;  2KJX A;  5EPJ A;  1Q90 A;  5KYI A;  1HPC A;  2E2D C;  2DY7 A;  3NP8 A;  1YNJ C;  1O80 A;  1V1P B;  2MHV A;  3H3V C;  4L6T B;  1WD1 A;  5M5Y B;  1KNE A;  2BDN A;  3H6M A;  1A3V A;  5JAV A;  2EE1 A;  2KUM A;  4CKE A;  5FO9 B;  3J7Y W;  2EYJ A;  3QB3 A;  3I91 A;  2B2W A;  5CBE E;  2EJG C;  1HTL D;  5IOC A;  1LTG D;  1DCZ A;  4XTC S;  4FYD A;  1SSO A;  3GTQ B;  2JA5 B;  1LTA D;  5KYL A;  4A93 B;  3ERQ A;  5CV5 A;  3OSO A;  3I70 A;  3I8Z A;  4V19 0;  1JB3 A;  1XXG A;  2CVR A;  3M7G A;  2XRQ D;  3SEB A;  1G2T A;  3BYT B;  4QUC A;  3CQZ B;  1PDQ A;  5F2D A;  4KKS A;  2QKI C;  4DAY A;  1CTM A;  1ENA A;  2I46 A;  2BE5 C;  3OMG A;  5DNF A;  2JP1 A;  1TII D;  1O78 A;  5CV6 A;  4DAV A;  1TS3 A;  1A15 A;  1STH A;  4IZ8 A;  3PO2 B;  4LMQ D;  2H1E A;  3GTO B;  3KLS A;  3J81 L;  3NSW A;  4RCO A;  2IL8 A;  1GOZ A;  5C3X A;  2WAQ B;  1SYB A;  2XVS A;  3D4W A;  4KD4 A;  5FLX E;  1CT1 D;  4HCS A;  3KUP A;  4TRD A;  4ZKC B;  2L4N A;  2IX0 A;  4K2L A;  3D3R A;  3HOZ B;  1TWA B;  2KCN A;  2CW0 D;  3TN2 A;  5EPL A;  2SNM A;  4DK1 A;  3MXG A;  2KEC A;  3OWF A;  4KKU A;  1GUO A;  1U4L A;  3S1R B;  4KHV A;  5ELF A;  1FNU A;  4C3I G;  3QIA A;  5A35 A;  1PYW D;  1CM9 A;  4KJO A;  4KMU C;  3DMU A;  1GUT A;  1LV9 A;  1RJT A;  4IFD H;  1PZK D;  3N52 A;  5E4W C;  1B1Z A;  3QOJ A;  3BDL A;  1NSN S;  3OMC A;  1NUC A;  5K36 G;  4M1U B;  2M00 A;  4PMW A;  5BN4 A;  5CMD A;  2K01 A;  2PPB C;  1SE2 A;  4DXF A;  2R3Z A;  2PQE A;  2H4O A;  4FXD A;  5M3F B;  3HZX A;  3NE5 B;  1U4P A;  4IAL A;  3L9A X;  2XIW A;  1PTO B;  2JA6 B;  3ERO A;  1WTR A;  4BS9 A;  5KIX A;  2F0L A;  3NHH A;  3A8J E;  3A55 A;  3OIQ A;  5LL6 X;  1WD0 A;  1CI3 M;  5D65 A;  3BDO A;  4DF7 A;  3HOW B;  3HRZ C;  3BG3 A;  1I50 B;  1B50 A;  1KLG D;  2Q8I B;  2HQE A;  5I2Y A;  3A8I E;  1EZ8 A;  4XQQ A;  3K58 A;  1HCZ A;  4HSV A;  4JK1 C;  4CKB A;  2NN6 G;  5CR3 A;  2EYH A;  2SDF A;  4BA2 I;  2K32 A;  2XWB B;  1VDZ A;  1G8Z D;  3J7A V;  3G6J B;  4FO2 A;  4B9W A;  1H9J A;  3GO5 A;  3NTI A;  1QE6 A;  3S16 B;  2D9U A;  1I4R A;  1LT4 D;  1EQV A;  1STA A;  3KBG A;  1E2V A;  3LX0 A;  1QG7 A;  1W6J A;  1H9K A;  4DK0 A;  4IUP A;  1EIH A;  1SDF A;  5G3L F;  2PZU A;  1U4R A;  3D6C A;  4XT3 B;  3JAM E;  5ISR A;  3LWE A;  1PFB A;  2G9D A;  2KEE A;  2B2U A;  4C3H G;  2D62 A;  5A2Q E;  2Q8T A;  1PMR A;  3RMH A;  2FFK B;  5A2Q L;  1SYE A;  1BUV T;  4G7O C;  3HOX B;  2X69 A;  3AB9 A;  1A2U A;  4KY6 A;  2WII B;  1LO5 D;  4OHJ A;  4CJ1 B;  2EOT A;  2R92 B;  1GUW A;  4RGT A;  3RLF A;  1LT6 D;  1SYG A;  1STG A;  3QO2 A;  3HKZ B;  3HOV B;  1QNK A;  1TWH B;  3L7Z C;  4XYQ A;  1BNZ A;  4WJW A;  2QCP X;  1TWG B;  2K1B A;  4K6D A;  3DUZ A;  1HQM C;  1QIL A;  1Y8N B;  1BDO A;  5EKL A;  3GV3 A;  2R61 A;  4HR7 B;  1PTO F;  5HUR A;  3TZU A;  1JOO A;  3T13 A;  2VNU D;  3SK8 A;  3NTH A;  3CU7 A;  2L9H A;  4N9P A;  1XTC D;  3GQB A;  1PRT D;  3K5O A;  5ELD A;  3K57 A;  5K36 H;  4FF1 A;  5KND A;  3VR4 A;  3T4A C;  1S5B D;  2R93 B;  3MAQ A;  2E2J B;  2FMM A;  2ZT9 C;  5EKK A;  3PIP 3;  1RTO A;  3CRL C;  4BBS B;  3IFD A;  3VYU A;  1MD2 D;  3WOE A;  1GHJ A;  3URY A;  2MPM A;  2PW5 A;  4R8N A;  1QB5 D;  4N9T A;  3GV6 A;  3R2I A;  2SOB A;  4XT1 B;  1S5F D;  3OW7 A;  1ZYR D;  1ET9 A;  1CHQ D;  1RKN A;  4ULL A;  4ID6 A;  5JVG 3;  1XX8 A;  3E0J A;  2AWO A;  2NTS A;  5LL6 S;  2IX1 A;  2SNS A;  3C3L A;  4IQZ A;  2X6G A;  2BOS A;  4K8I A;  3DXJ C;  2B63 B;  1H9M A;  4OGQ C;  2OT2 A;  4HMJ A;  5CC4 A;  3GTK B;  1QCB D;  4IUR A;  3SE0 A;  1E0B A;  1RF2 D;  3K7A B;  2L1B A;  4IUT A;  1EY6 A;  4XQJ A;  1HFN A;  5C4J B;  1S5D D;  5JPM C;  2Z4I A;  3DM1 A;  1WTW A;  1F9S A;  4OL7 A;  4M8A A;  1JC7 A;  5BN5 A;  3I72 A;  3TSS A;  4C3J B;  5C4H A;  4RH6 A;  2BDO A;  4MHE A;  5C3W A;  1PTO D;  2EXZ A;  5EBC A;  5T1I A;  1LTR D;  2JEA I;  3NPP A;  4XDX A;  4HTH A;  4EVO A;  3RZD B;  4FF4 A;  1S5C D;  5JEA H;  1TWC B;  1A3U A;  2N55 A;  3MC0 B;  2R7Z B;  3BVG A;  2F0S A;  1W6K A;  3TP5 A;  2HCC A;  2B2T C;  1FNV A;  4O1N A;  5IT9 L;  5J1Z A;  3CKI B;  1GUG A;  3M85 A;  1LAB A;  4B9X A;  4RGN A;  4O42 A;  3QWN A;  5DM7 3;  3PV0 A;  2WIN B;  5CBA E;  1PRT F;  4DA2 A;  4U67 3;  1QWY A;  1LTB D;  4A3F B;  4C3J G;  2EDG A;  2EY6 A;  2C5C A;  2VXW A;  2SEB D;  2LFN A;  2X6L A;  1AEX A;  5EQ0 A;  5M5W B;  2WKC A;  2DNE A;  3TBI B;  3MXN A;  2WAC A;  4CJ0 B;  4FVM A;  1JOR A;  2YU9 B;  3K6O A;  2A73 B;  3C1E A;  4BWG B;  2F0W A;  1EYD A;  1EWH A;  1DJR D;  3Q0A A;  3BZD B;  4NMZ A;  1JCK B;  3BVM A;  1HUN A;  5IGB A;  1ICW A;  1ESR A;  3NWT A;  4ZUI A;  5BN3 A;  1PFM A;  2PMZ B;  3D6W A;  5NUC A;  4RA8 A;  4HN7 A;  2IT1 A;  1LT5 D;  4X3U A;  1MBY A;  4FXG C;  1IYV A;  4FP5 D;  3P7J A;  4Q0F A;  4RKL A;  2MGS A;  2HDL A;  1A6X A;  5I6W A;  1TS5 A;  2RSO A;  3QG1 A;  2F0V A;  3JAM L;  2F0T A;  1IYU A;  3TDQ A;  1O7L A;  1B2T A;  2L0C A;  3L3O C;  5I6Y A;  2FJ2 A;  1SE4 A;  3HOU B;  2BA1 A;  1RTN A;  4MN3 A;  2O5J C;  4S3S A;  3GTL B;  2XN9 C;  5JEA G;  3W2D A;  3I4L A;  1BCP D;  2F3V A;  3EA6 A;  5C5L A;  4G4K A;  1PXU A;  1M8A A;  1JR0 D;  2LY7 A;  1FR3 A;  1KDC A;  1SND A;  1V43 A;  2AUJ D;  1SNQ A;  2HDM A;  3GP7 A;  2D5D A;  2NZ1 D;  3FRP B;  2AQ3 B;  2F0I A;  5KNB A;  5CV7 A;  2NB0 A;  3A54 A;  3P75 A;  2IX3 A;  1KDA A;  2LMC B;  1MSG A;  3ND8 A;  3OOC A;  2B39 A;  1FGB D;  4J1M A;  4RHR A;  1I4Q A;  2XWJ B;  1ZXT A;  1TWF B;  3MFG A;  5TSS A;  3VA7 A;  2NVY B;  3BDC A;  5C4X B;  3PO3 B;  2OEO A;  1F9P A;  1Y8O B;  3S2H B;  4RGO S;  1NAP A;  1Q1B A;  2BE5 D;  3DWP A;  3SVM A;  3MZ5 A;  5EJW A;  3K59 A;  2O2L D;  3AU7 A;  2ID0 A;  4DU9 A;  4NP5 A;  4F7X A;  1C48 A;  2RDG A;  4PMB A;  3J80 L;  1QNU A;  4XXE A;  3KLS X;  2XRS D;  1HRJ A;  4OO1 H;  1GHK A;  3DHQ A;  3TZD A;  1I6H B;  3VR5 A;  4HAE A;  1O7Y A;  5D14 A;  2E2H B;  5JEA J;  1CZW A;  2ZXO A;  1H9S A;  1DM0 B;  1AZP A;  1DOM A;  4C2M B;  3ONA B;  2NVX B;  2PZT A;  1V1O A;  4NKL A;  1RCV D;  4G7Z C;  4PQX A;  4A3G B;  4X3S A;  2EY1 A;  3A7L A;  1LLR D;  3FDT A;  4RHS A;  4C56 C;  3FEW X;  1E2Z A;  1SEB D;  4XIG S;  2KHS A;  4JBW A;  2EYM A;  4A3I B;  1EY8 A;  1PFN A;  1ENF A;  2RDH A;  3O13 A;  4RWS C;  1TY0 A;  2WV6 D;  5IGF A;  3HP3 A;  1L0Y B;  4HMI A;  4KK7 A;  1Q8I A;  1GUS A;  1IKM A;  1O7Z A;  1SNO A;  5J22 A;  1KLU D;  3VYR A;  2D2C C;  1EY7 A;  1OXS C;  2F0M A;  1JE4 A;  2A68 C;  3BS1 A;  2CQA A;  4DNT B;  3GD7 A;  3M4O B;  5CGK A;  1WTX A;  4CGY B;  1X3P A;  1J8I A;  5CV8 A;  2QIL A;  1JQY D;  1BOS A;  1V8Q A;  3EVQ A;  3E6Z X;  5M5X B;  3MA2 B;  3I90 A;  5IGD A;  2E2I B;  1AN8 A;  4RAU C;  1D5X C;  4BY1 B;  3NK9 A;  4G7H C;  4A3D B;  1H9S B;  3QOL A;  1U4M A;  4PMC A;  1KAB A;  1U9R A;  5ELB A;  1EY9 A;  3KLR A;  4AYB B;  1MGS A;  1HA6 A;  4F87 A;  1RHP A;  2NN6 I;  2NTT A;  5FLX L;  2F1M A;  1EU3 A;  2IPK D;  4MIU A;  4KY7 A;  3CRK C;  1T5E A;  5COR A;  1SYD A;  2F0G A;  5IOD A;  5IIF A;  5LHY 1;  1EL0 A;  3NTK A;  5KRU A;  2O4X A;  5M3M B;  5DEH A;  4ZK9 B;  2TMP A;  4K8J A;  3D8G A;  1FYC A;  4LJZ C;  2MJ8 A;  1NR4 A;  3MTS A;  4H0L C;  2AQ2 B;  3EJI A;  3M3Y B;  4Y7N B;  1NR2 A;  4FF3 A;  4ZRZ A;  3FPP A;  1Q1E A;  4PV1 C;  3OPO A;  3OWE B;  4A3E B;  2A6E D;  5ELE A;  2A68 D;  4P2C B;  4EGV A;  1SMY C;  1SXT A;  2RSN A;  3TP7 A;  5D3I B;  2O5I C;  2KA7 A;  3K0Y A;  3N6R A;  1UNS A;  1S5E D;  3PUX A;  5M9O A;  4I7Z C;  2JXM B;  2K6A A;  3S15 B;  1GUN A;  2A6H C;  1OXT A;  1GJX A;  2F03 A;  1I4H A;  3A7A B;  1CQV A;  4TSS A;  1Y8P B;  2VUM B;  2RBM A;  2L55 A;  4KTA A;  2ENB A;  5G3L D;  4C1N K;  4ZKB B;  3TME A;  4ABN A;  1TS4 A;  2JSO A;  4ZLT F;  3C46 A;  3PUV A;  1B3A A;  3PMF A;  2JEB I;  1DOL A;  1B53 A;  1PRT C;  3VYS A;  1D1K A;  3GTP B;  4CBV A;  4KJN A;  3MXP A;  1EFI D;  3NBH A;  2RQX A;  3E5S A;  2HUG A;  1CK1 A;  1X32 A;  1XYI A;  1F9Q A;  3K5M A;  1BXT A;  2B2Y C;  2K03 A;  3T53 B;  4IUQ A;  3CHB D;  3VR2 A;  3HOY B;  2EPB A;  2A6H D;  2F0J A;  5I9P A;  1TQO A;  5COY A;  5FK9 C;  2FIN B;  4PNY A;  3U9O A;  2NVT B;  2DY8 A;  4BBR B;  4QMG A;  3KK7 A;  3MXU A;  3RD4 A;  3KBX A;  2B2W C;  3MVV A;  4H7B A;  1EY5 A;  1HA5 A;  2QDB A;  2K5D A;  1BBX C;  1J9O A;  3H0G B;  5IGC A;  2EY2 A;  1HQR D;  5C0X J;  3NQI A;  5JOB A;  1HXY D;  5I2X A;  5FO8 B;  1ENC A;  2PCF B;  3D4D A;  2AWN A;  1ONL A;  3J80 E;  5KNC A;  1I6V C;  2QEJ C;  1G2S A;  4DN4 M;  1B4O A;  3I4N B;  3WOF A;  1D2B A;  2F3W A;  3OHX C;  2K7V A;  3GTM B;  3MEH A;  2OF1 A;  1EIG A;  3SR1 A;  3W3A A;  1Y1W B;  4XQN A;  5CV4 A;  1PTO H;  1SJH D;  4HCE A;  4CHT B;  2EJM A;  1D5M C;  1UEA B;  3P20 A;  4EQN A;  3BVZ A;  2JYO A;  4A3K B;  3I4M B;  1EEI D;  1HFG A;  3NUC A;  1I4X A;  4WFN 3;  4ZYS A;  2Y0S B;  2RDF A;  2EYP A;  5K5P A;  2JA7 B;  4X3K A;  1VF5 C;  3IFT A;  1PTO C;  5C0X G;  3BYY B;  1SNM A;  2I07 B;  1JOK A;  1STB A;  4LAA A;  1R9T B;  4OO1 I;  1F77 A;  3VR6 A;  1STN A;  4Z9C B;  3T56 B;  1H9R A;  3UI2 A;  3R93 A;  1M4V A;  1A3T A;  3ITP A;  2A74 C;  2F0U A;  3Q6S A;  1DXM A;  1D1I A;  1PRT B;  1Z6H A;  1B9M A;  1LT3 D;  3P1H A;  2EJF C;  5EBD A;  1C4Q A;  3EQL C;  2F0K A;  1G6Z A;  2B2V C;  2F0D A;  3MWY W;  2B2V A;  1GXD C;  4QF4 A;  2NUC A;  5IGG A;  1QOH A;  1SYC A;  1B9N A;  2GA4 B;  2FHT A;  2HCI A;  1EOT A;  3NQT A;  2F0O A;  3V2T A;  2IW3 A;  2NN6 H;  3M7N A;  4GZY C;  3SK4 A;  2QF7 A;  1EEF D;  4K5X A;  4NW2 A;  2L11 A;  2KVM A;  2ZXP A;  2OXP A;  4LK1 C;  1FNW A;  5DM6 3;  4KN4 C;  4DFA A;  2Z4H A;  5FKA C;  4X3T A;  2M9V A;  3ND9 A;  1ILQ A;  1L0X B;  3J81 E;  2A69 D;  2F0F A;  2BCO A;  2Z8L A;  2K04 A;  3HGB A;  2J4X A;  4K6L A;  5D3D A;  1II3 A;  3DWQ A;  2B8F A;  4E6I A;  1TKW B;  2PO4 A;  3K5L A;  1SNC A;  3H91 A;  4IUU A;  1HHV A;  3SDZ A;  4C3H B;  4R8I A;  3J7A F;  3FKI B;  5C4Z A;  4K2K A;  2CHB D;  1DON A;  1AFP A;  3IL8 A;  4KN7 C;  4IFD J;  3EFX D;  4FNF A;  4EQP A;  2NYZ D;  3DEO A;  3FMC A;  1F9R A;  2RVL A;  4WOR A;  4L63 B;  2F0N A;  4RKB A;  2BA0 A;  2PZW A;  4ZAI A;  2K5Q A;  1EY4 A;  4RFB A;  1ET6 A;  4A3B B;  2A5H A;  3KF8 A;  1SFO B;  1Y1V B;  2WP8 J;  1IW7 D;  1EYA A;  1NCV A;  1BR9 A;  4BY7 B;  4DNR B;  5E1F A;  1XWE A;  1AP0 A;  2NVQ B;  2G9H D;  3U9S A;  1ZEQ X;  1F2L A;  2XNA C;  3TP6 A;  3VR3 A;  3RZO B;  2K5W A;  1K83 B;  4ME5 A;  1TY2 A;  1CQF A;  1UUP A;  3R8B A;  1KDB A;  4CJ2 C;  4UAI A;  3G7L A;  3R2T A;  2PNR C;  1BF4 A;  1Q12 A;  3A56 A;  1IW7 C;  2EYL A;  1JWM D;  1TVX A;  1TT2 A;  5C5M A;  5I9O A;  4K14 A;  4L8J A;  3V05 A;  1F2Z A;  1JWS D;  3C1F A;  3H09 A;  1HTP A;  3I73 A;  1BCP B;  4HED A;  3MFY A;  1S4Z A;  5J39 A;  1K8O A;  2PYK A;  3HG9 A;  3S9W A;  4R9W A;  2ICI A;  4QIW B;  5I4D A;  1BO0 A;  2MUY A;  1HUM A;  2K33 A;  2KED A;  1G91 A;  3ZYY X;  1ILP A;  3Q23 A;  3PUY A;  5JPN C;  1CZG A;  3A8K E;  4J8Q A;  2IJ0 A;  1F2Y A;  1ESF A;  3S1M B;  2IWH A;  1CHP D;  2M2L A;  2EVB A;  1UAP A;  5C6A A;  1SE3 A;  2YYZ A;  1DYQ A;  3TP8 A;  2N88 A;  1I4P A;  1D6E C;  5FO7 B;  5HGT A;  3I3C A;  4Q5V A;  1E2W A;  1JIC A;  5E3F A;  1Y69 U;  3F2U A;  3Q24 A;  4C3I B;  2E76 C;  3OIP A;  4WRD A;  4IFD I;  2J7Z A;  1WTV A;  3NBI A;  1OO9 B;  1X3Q A;  1SBB B;  1LAC A;  1I4G A;  5EGT A;  3D4R A;  5T1G A;  5IT9 E;  5EKI A;  1V1P A;  1C8C A;  3S1Q B;  4J6H A;  3VA5 A;  3GTG B;  3IAY A;  2J0T D;  4KV6 A;  4ODG A;  4H44 C;  4K5V A;  1KAA A;  1R4Q B;  3H94 A;  3D31 A;  1CFM A;  3MHB A;  5E4X A;  5C3E B;  4TQU S;  2NWG A;  4TKO B;  4XYO A;  4BA1 I;  1SAP A;  3AMU A;  2EZV A;  5AFW A;  2EYF A;  1BCP C;  4A3J B;  4G57 A;  2EY5 A;  2WKD A;  4F88 A;  2B2U C;  2V4D A;  3LNN A;  1BCP F;  3M4Y A;  1AZQ A;  1ROD A;  1PZJ D;  1OXX K;  1DZ1 A;  1BQQ T;  2E75 C;  3DEP A;  1STY A;  1PZI D;  2F4I A;  1CA5 A;  1ZKO A;  2AUK A;  1T5X D;  4U68 A;  1LTT D;  1EU4 A;  1EYC A;  1ZYR C;  4A3M B;  3HEJ A;  1KTK A;  1QJO A;  3FPU B;  3GTJ B;  1CA6 A;  5JVH 3;  1VF7 A;  1DD2 A;  4ZQ3 A;  1LTS D;  2B2Y A;  1A2T A;  4EQO A;  1LTI D;  4IUV A;  3RUZ A;  2CW0 C;  4IUN A;  3S1N B;  3SXH A;  2F0Q A;  1WTQ A;  2C9O A;  4NDX A;  4B08 A;  5KEE A;  4C1N I;  1JOQ A;  4I65 A;  2KQ3 A;  2Z1C A;  3HS0 C;  2DNC A;  4ZUJ A;  1TS2 A;  1OXU A;  3S17 B;  3SK5 A;  3FVQ A;  1ML0 D;  2MP1 A;  2B8G A;  4KKT A;  1IKL A;  4DGZ A;  3S2D B;  4IFD G;  3R3O A;  2JE6 I;  3Q22 A;  1Z7T A;  3X3M A;  2A69 C;  2VB3 X;  2LS0 1;  1EZ6 A;  3WDN A;  4KY5 A;  1OXV A;  2KOL A;  1SJE D;  2F0P A;  2K05 A;  3PIO 3;  3QJY A;  2VB2 X;  1WTP A;  5EPK A;  1VCI A;  1Q3L A;  2FMC A;  1EY0 A;  4KHZ A;  1WCM B;  1FD7 D;  1RD9 D;  1F2M A;  2RKS A;  3S14 B;  1AW7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...