2N88A

Chromodomain 3 (cd3) of cpsrp43
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
58
structure length
58
Chain Sequence
GLEYAVAESVIGKRVGDDGKTIEYLVKWTDMSDATWEPQDNVDSTLVLLYQQQQPMNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Signal recognition particle 43 kDa protein, chloroplastic
publication title Structural basis for cpSRP43 chromodomain selectivity and dynamics in Alb3 insertase interaction.
pubmed doi rcsb
source organism Arabidopsis thaliana
total genus 7
structure length 58
sequence length 58
ec nomenclature
pdb deposition date 2015-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2n88A00
2X6LA 3GV6A 1EIHA 1WVLA 1DZ1A 4IUQA 3UI2A 1O80A 2K01A 4XDXA 1G6ZA 1A15A 1B53A 2VXWA 2J7ZA 1WD0A 2MJ8A 4IUTA 2K03A 1WD1A 1BO0A 1HFGA 4MN3A 1C8CA 1MSGA 3QO2A 1XYIA 1G2TA 2RA4A 1CA5A 2K04A 1B4OA 2K28A 4ZKBB 1HRJA 2L4NA 1X32A 4HAEA 2MPMA 5JJZA 2L11A 5E4XA 1B3AA 1AZQA 2RSNA 4ZAIA 4RWSC 4R9WA 1BNZA 2H1EA 2HDLA 1ML0D 3TN2A 1KNEA 4O42A 4ZK9B 1PFMA 4ZLTF 3FPUB 2FINB 1SSOA 3MTSA 1RTNA 4X3KA 2NYZD 3KBXA 2B2TA 2EOTA 4QUFA 3HP3A 1J8IA 1EOTA 1F9QA 2KEDA 3I3CA 2JYOA 3MWYW 4CJ2C 2RSOA 3DEOA 1MI2A 2EE1A 2BDNA 5DNFA 1E0BA 3IL8A 3SVMA 1WTRA 1QG7A 1X3QA 1S4ZA 2B2TC 5COYA 3IFDA 4OIKA 1BF4A 1DONA 2KOLA 1WTQA 1G91A 1DOKA 2MP1A 1IKMA 1WTOA 1WTWA 1EIGA 4U68A 2KVMA 4MHEA 2MGSA 4CJ1B 1HA6A 3DM1A 1QE6A 2KEEA 1O7ZA 4OIJA 2RVLA 5CBEE 1F9PA 1O7YA 2HDMA 4ZKCB 1ESRA 2SDFA 3ONAB 5E4WC 3F2UA 1PDQA 1RHPA 3G7LA 1CM9A 1PLFA 3Q6SA 1WTPA 2R3ZA 1U4LA 4CJ0B 2L9HA 3I91A 4X3UA 4RA8A 5CMDA 1ILPA 1KNAA 1RODA 1NCVA 1NR4A 2B2WA 2NWGA 2X6GA 1AZPA 1ILQA 3KUPA 4HSVA 1SAPA 2DY7A 2HCCA 1VMPA 2HUGA 2XIWA 5CORA 5D14A 5AFWA 5EJWA 1ZXTA 3I90A 3LWEA 4QUCA 1DOLA 4IUPA 2K1BA 1B50A 1NR2A 1RJTA 4NW2A 3DEPA 2B2WC 1G2SA 2FFKB 1U4MA 3GV3A 4X3TA 1CA6A 4UAIA 1PFBA 2X69A 1TVXA 4R8IA 1LV9A 1GUWA 3P7JA 1JICA 1HFNA 3D6WA 1AP0A 1HHVA 2FMMA 2KUMA 2Q8RE 1XX8A 2B2YA 2CVRA 3I8ZA 5CBAE 1M8AA 1F9SA 2B2VA 1J9OA 1QNKA 1MGSA 1F9RA 2IL8A 2KECA 4IUUA 5T1IA 2HCIA 2Q8TA 4IURA 1IL8A 2DY8A 1MSHA 4HCSA 4XT1B 1F2LA 5EPJA 3R93A 2FJ2A 2B2UA 1U4RA 1Q3LA 2D9UA 2K05A 2B2YC 2NZ1D 3H91A 4HEDA 4XT3B 1IKLA 5EKIA 3TZDA 4LMQD 2B2VC 2FHTA 2N55A 2N88A 4X3SA 1EQTA 3N52A 2JP1A 4DN4M 1JE4A 1X3PA 1HUMA 1WTVA 1ICWA 2B2UC 1DOMA 2EPBA 1RTOA 1BBXC 4IUVA 1NAPA 1SDFA 5D65A 5EPLA 5EPKA 1VMCA 2L1BA 1EL0A 2M2LA 1HUNA 4RAUC 1WTXA 2L12A 1B2TA 1U4PA 1PFNA 5T1GA 5EQ0A 3FDTA
chains in the Genus database with same CATH superfamily
1H9SB 1EWCA 5BN5A 1R9TB 3FEWX 1TKWB 3G71A 1Y8OB 3HEJA 1HFGA 3B6YA 5JAVA 1YEZA 1G6PA 1B70B 1CA5A 4EQOA 4A3FG 2B39A 1B3AA 5M3MH 1KXLA 1EYCA 4GN5A 2TSSA 4JI4L 1CKNB 4JI1L 1B1ZA 5C4JH 1HNXQ 2E74C 2WB1B 3A8KE 1U5KA 1I4HA 2JQOA 2AQ1B 2H5XA 4Z9CB 2OF1A 3HG9A 1SNOA 1Y69U 3HOZG 4FVMA 1BF4A 4KD3A 5IT9E 4G57A 3TQYA 3JAMi 3CP0A 1IKMA 4A3CG 4JW0A 5FO9B 4RMFA 2F0IA 1ZKOA 2K14A 5LMNW 3OW7A 1EY6A 1GUTA 3AU7A 4A3KH 1I6VC 1SROA 3SK6A 1A0IA 2Y0SG 1XTCD 3UDFA 2B63G 1D5MC 2EQSA 1HQRD 2NWGA 2ZT9C 2YTXA 4AQYL 3X3NA 2YU9B 5C5LA 3MFYA 2O4XA 3RZOH 5C44H 1PXUA 3MEFA 1VCIA 2OWOA 4GKKL 3AB9A 2EJFC 5C6AA 2WB1E 1ET9A 1PFBA 2X69A 2NZHA 4H13C 4K8IA 2G9HD 4R4OA 2KUMA 4KLKA 4ME3A 1MBYA 1YNXA 3GD7A 3I4MH 1YZ6A 3MC0B 1QNKA 2N78A 1L1OA 4R4IA 1IL8A 1STGA 1KD1C 1EY0A 4N8X1 1ONLA 4CBVA 1HNZQ 2QF7A 4EGVA 1VF7A 2K05A 3T56B 2UUAQ 4ZYSA 4F8MA 3F8TA 1LT4D 1EQTA 2JA6G 1UWVA 2PI2A 1WTVA 5IGDA 4LF6L 3S17H 4IUVA 1NAPA 2C35B 4ULLA 1YBYA 2F52A 5IYDG 3I55A 2OQKA 1A8VA 4K14A 5LMNL 1EIHA 2OEOA 3FRPB 4B3RL 1K73C 3KF8A 4C3IH 4BBSH 4MN3A 5J39A 1VQOA 5JPMC 4X65Q 2DJFC 3KYHC 1TS2A 4UP7A 2GN5A 3ZYYX 1B4OA 3NP8A 4HAEA 1FNUA 2VUMH 1JMCA 3NWSA 4RWSC 4PMBA 4K5WA 2H1EA 3FKIH 3TN2A 5FLXE 2NVXB 3BZKA 5BR8L 1E1TA 5D3IB 1B9NA 2B2TA 4MNOA 2BA1A 2PYKA 3NELA 3I4NH 4F88A 2K5NA 1F77A 2WKCA 2LMCB 4MIUA 3IFTA 1S5FD 4OIKA 4A3MB 2E2HH 4K8JA 1U9RA 1ZYRC 2Z6KA 3W3AA 3J81j 3DM1A 1Z6HA 3I70A 4MTNA 2R61A 3H0GH 3HOXB 1RHPA 4KY7A 3C1FA 2ASBA 1CUKA 1NBWA 5CV6A 1MKHA 1H9KA 3J81E 1HZAA 2DY7A 2EJGC 2V4DA 1CTMA 4RKLA 1KIXA 2EYMA 2A74C 1VQ6A 4NW2A 5IWAL 4CHTB 3E9IA 3P7JA 1W6JA 1SEBD 1LABA 2EYPA 2A69C 3MFGA 5IIFA 1PYWD 2CWPA 4HJAA 2AQ2B 1C7YA 3BJUA 4HTHA 1UNSA 3JC66 3OIPA 3IKJA 5C4XB 3S15B 3CCSA 3URYA 3S1MH 3I4LA 3MVVA 3TS2A 2WACA 2NVQB 1YNNC 1EIYB 1E2ZA 1BXTA 2F4VL 3NTIA 5KNCA 3BVZA 2K5QA 4OX9L 4IPGA 3MXGA 3EJIA 3NPPA 4DA2A 4DAMA 3FDTA 5EGTA 2VQEQ 1EOVA 1PVOA 5FOBB 2K01A 1VQBA 4CGYB 1K83H 4RHRA 1WCMH 1OXSC 3U4VA 3GTGB 1BVSA 4LJZC 1LTAD 1X54A 1HRJA 4DV2Q 4ZUJA 3KF8B 4C3HG 1EYAA 3CC2A 5EKLA 3CMEA 1IBKQ 1N34L 1QUQA 4L5RC 3GTQH 3UDIA 1Q8KA 2F0DA 4DK6C 5JEAG 3CC4A 3FPPA 2F3IA 2R92H 2CKZB 3A55A 5DNFA 2UXCL 1E0BA 2VY3A 1X3QA 4MTKA 5GADC 4BY7H 1FD7D 5CV7A 4KHPL 1TS5A 1EIGA 3K5NA 4DR3L 1OO9B 4DV4Q 4A3EB 3ZJYC 2EY6A 3HOWB 3S1QB 1SYDA 4P2CB 4BBRH 4EVOA 5JJLA 2WFWA 3JAME 1CFMA 2EYJA 4M8AA 2KJXA 3X3MA 2YTYA 3G4SA 3Q22A 1HZCA 2B2WA 4C1NI 2F0LA 1IL2A 1QVCA 1W3SA 3CF5A 1PRTD 5I9PA 1TWGB 3RLFA 3U4ZA 1VQGA 1EY7A 2F0UA 1K3BC 4A3DH 3H3VH 4BS9A 2F0PA 2TMPA 1WFQA 3HOUH 2B2YA 1G51A 4DUZL 4R4QA 1CK1A 5EKKA 1JB7A 2KHJA 1KDAA 3T1HL 1GVPA 1X65A 2BA0A 3MZ5A 1QZHA 2WAQB 4G7ZC 3QR8A 1HR0Q 2F0WA 4JI0Q 2RDHA 2ICEC 1LTTD 4RH6A 1EQQA 1KAWA 1VQMA 3T1YQ 1VQJA 4EX5A 4A3GB 4HJ5A 3K0XA 3WDNA 1EWHA 1A62A 3K80C 2AUKA 3M4PA 5JEAJ 3TSSA 1JWUD 2O5JC 4RCNA 3GTLH 4DXFA 2F0TA 4QL5A 4DR4L 4A3BB 4DR7L 5C3EB 5J3BA 2E8GA 4NMZA 3LX0A 5C3XA 1G6ZA 2V1CC 4JK1C 1GUOA 3SGIA 3M3YB 4DV0Q 4L5QA 1AE2A 4JYAL 1Q1EA 4KTAA 2L4NA 4TKOB 1KL9A 4A3IG 2NVYH 2IJ0A 2VL6A 1E24A 5M5YB 1WI5A 3TREA 1IW7D 2WKDA 2ALYB 4ZK9B 1XJVA 4LFCL 1HQMC 3MTSA 5JVH3 1RTNA 2FMCA 4DAYA 2CW0D 4ODGA 3AMUA 1NTGA 4ALPA 2VQFQ 1E3PA 3QIAA 3SE0A 5DEHA 3P75A 2UXBL 1QUQB 4MHEA 4DK0A 4A3JH 4DV7L 1N36Q 4K0KQ 2QEJC 1XMQL 2EJMA 4FP5D 1EYGA 2D62A 2PO4A 3HOYB 4BXXG 1CM9A 4JV5Q 4YHHQ 4LF8Q 3EA6A 3L7ZC 4WFN3 2F0KA 3OTOL 1RDPD 5D14A 4J6HA 1SMYC 4GOPA 3VYTA 2KA7A 4QUCA 1EU3A 2A19A 3FHWA 5FLXc 3QWNA 1D7QA 3IRBA 1K8GA 3BU2A 3CRLC 2F0VA 3TBIB 2K5DA 1VQEA 3U58A 2L55A 4GLXA 1XX8A 1PV4A 3CU7A 1I4XA 1PH2A 3GTPH 1M8AA 3V96A 5T1IA 2Q8TA 5M3MB 3WOFA 2NZOA 5ISRA 1WTHA 5EPJA 4HCSA 4A3EG 4JC0A 5C4JB 2XRSD 4QY7A 1K8AC 2EIFA 3CCUA 4LMQD 2B2VC 1JJ2A 1VQAA 2BDOA 2QILA 4LFAQ 3SHLA 1A3TA 4IUNA 2ZJRA 2K5VA 2MFIA 3K5OA 2DNCA 5IYBG 3J7A5 4A3FB 3KDFA 2E2JH 3BDCA 4A3KB 1PHJA 1UUPA 1QWYA 1YJ9A 1NSNS 4CDDC 5CV5A 3TEHB 1V1QA 2BH8A 4FF2A 2GVAA 4NXNL 3WOEA 1XYIA 1KABA 1YNJD 3GTJH 4OHJA 1CKOA 1X32A 5F2DA 1R4PB 2OCEA 3MHBA 2UU9L 2WAQG 3RZOB 1LTBD 5C44B 3CCEA 4A4IA 3F2DA 3A74A 1PMRA 1SYBA 4A3LH 1H95A 4A3GG 1EY9A 4DUYL 2CFMA 4JBKA 4CJ2C 1VF5C 3TRZA 2EXZA 3DEOA 3HKZE 2FXQA 4C2MH 4L8JA 5FLMH 3MEHA 1YHQA 1LTGD 4A3BG 3CXCA 5C3EG 3FVQA 1PH3A 2BOSA 3D4WA 1DCZA 4U68A 2B63B 1A3UA 3M4OH 4DAYB 3M4YA 5IY0A 1WOCA 4FDBA 2M00A 5C0XH 1J5EL 2R3ZA 5ELCA 5A35A 1U4LA 3GTKH 2QDLA 4B3SQ 3NHHA 4LAAA 1FGBD 1ILQA 4RGMA 4DV1L 3EFXD 3K5LA 4JVZA 5C4ZA 5AFWA 1ZXTA 2B8FA 1B8AA 4OXPA 4OL7A 1NR2A 1RJTA 2ZJPA 1JWSD 3QOJA 3A8JE 4B3TQ 4UAIA 1AFPA 1CQVA 1TWFH 4QCLA 2YV5A 2J4XA 2JA7H 4PG3A 1D6EC 2FMMA 5H1SE 1HPCA 2VUMB 1S5DD 3SK5A 4GOPB 2IX3A 4YCUA 2JA6B 4A75A 3KLSX 4DNIA 2Y0SE 4R4TA 1RF2D 1EFWA 3HRZC 3HOYG 2FHTA 3I4NB 4JI6L 2JP1A 3S24A 1SE2A 4L5TA 3K57A 3SK4A 4FXKC 1Z7TA 4XIGS 2EPBA 1L0WA 4JI2Q 5IYCH 4B3ML 2E2HB 2PNRC 2K5HA 3GTOH 2F0QA 3J7ZC 4F87A 3RR5A 2O5IC 1PZID 1AE3A 3A7LA 1C48A 2X6LA 5TSSA 3AEVA 4DR6Q 4UHVA 3H0GB 5NUCA 3DXJC 3PGZA 3RMHA 1BO0A 1SYGA 3J80L 2OT2A 1HA5A 4H44C 5AJ3L 5M3MG 1EY4A 4IQZA 1JOQA 5LMUQ 1JWMD 2L11A 1N33L 3KDFB 4JCVE 3VYRA 3VYUA 3I2ZA 3NTKA 4DR5L 2DJGC 3OOCA 4KN7C 3RLOA 1EYDA 3GP7A 2JYOA 2LXKA 4FF1A 1K3RA 1LACA 2BDNA 4P73A 2HT1A 1D5XC 2K6AA 3BVMA 5M5XH 1K9MC 2B2TC 2Z6BA 4XYOA 1XNQL 1G91A 1ENFA 4A3KG 1V43A 2KCMA 3DUZA 3BDLA 3S1MB 2KEEA 1XPUA 1SNPA 1HTPA 1GXDC 3OHXC 3ONAB 5E4WC 2AQ3B 1TWHH 2Z6KC 4G7OC 3GO5A 3TZUA 1UE1A 4YY3L 4LNQA 4CJ0B 1X3GA 4K6LA 2KHSA 2JXMB 5C44G 3V05A 3ULLA 2KCTA 3RZDH 3T13A 1NJIC 4JI4Q 4J1MA 5CV8A 2RCNA 4R4CA 1GHJA 3TP7A 4YWKA 4HMIA 1K83B 1WCMB 3W1BA 4YIJA 3GV3A 1CA6A 1FVIA 4JI7L 3I4MG 1G8ZD 2ENBA 2D0OA 2JN4A 1TXYA 3CCVA 2Q2IA 2ICIA 1FR3A 4IUUA 2IL8A 5K36H 2KECA 2DY8A 3W2DA 4NB3A 1QOHA 2HQLA 4CDEC 2ES2A 3HGBA 3GTQB 1U4RA 4XT3B 4X66L 4BY1H 4DN4M 2KCCA 3D4DA 4GNXA 2BCOA 1LLRD 1R4QB 2MO0A 4PV1C 5EPKA 3SR1A 4RAUC 3U9OA 4C3IG 2MO1A 4GKKQ 4BBSG 1EFID 4QB4A 5CV4A 2YYZA 4BBRB 3QJYA 3I7FA 4IUQA 1O80A 2CCZA 1GO3E 1TY2A 5J22A 4X64L 1FGUA 3OW2A 1Y8PB 1YJNA 4IFDH 4C3HB 2VUMG 3QO2A 1E1OA 1EY5A 2F0FA 3OYYA 4HIDA 4MZ9A 2K28A 4QGUA 4FO2A 2MPMA 1VDZA 3FKIG 2LFNA 1Z47A 1HNZL 1QCBD 1S3OA 5DM73 4UPAA 2IW3A 2HQEA 2ZM6L 1ML0D 2WIIB 3T53B 1XMOQ 3I4NG 1VQPA 1UEAB 4X3KA 3KBXA 1XWEA 4IPDA 2MQHA 4TQUS 4LF6Q 3HOUB 5K5PA 3F2CA 4A93H 1J6QA 2EE1A 4CKCA 3GQBA 1RKNA 5LMNQ 4OO1H 1DONA 4YCVA 4B3RQ 4J8QA 2R93H 2YTVA 3K8AA 1LM0A 4IZ8A 4Q0FA 5CYUA 2LS01 3H0GG 2KVMA 1X55A 1HA6A 3NUCA 2E2DC 2A1AA 1CT1D 2AUJD 2EXDA 4YCWA 2NTTA 2PPBC 3F2UA 4X65L 3KLRA 5M5WB 4FNFA 3GTMH 3S16H 3OSOA 4NXMQ 4QQBX 2A6HC 1RCVD 4KKSA 3GTLB 4KHVA 2HUGA 5CC4A 3LWEA 5BR8Q 1HZBA 3KFUA 4JPBW 1PH4A 2B2WC 2PQAA 3C46A 3S2HB 1TVXA 2ZXOA 4DGZA 2VB2X 1V9PA 1VQ8A 4DXGA 4NDXA 1K8MA 1KDCA 2NVYB 1F9SA 1J9OA 1I4PA 1VQNA 2NUCA 2ZXPA 1STAA 4KY5A 4CDCC 1PTOH 2A6ED 4LUVA 1F2MA 2B2YC 3DWAA 4DV5Q 2F0HA 2F0MA 1JE4A 3ICEA 4Y52H 5I6WA 1LTRD 2A69D 5ELEA 5D65A 1MJCA 3PIO3 4K5VA 4NKLA 4OWTB 5IWAQ 2UXDQ 4A3JB 2I07B 1WCMG 4DKAC 1VQ4A 1BOSA 5HY6A 2HIXA 3U50C 3PUXA 4H02A 2R7FA 4A3IB 4GNXB 2EY5A 2E2IH 1C8CA 4GS3A 5IGFA 3R2TA 3T4AC 3I56A 4QF4A 1EQVA 2RDGA 3PF4A 2RSNA 4ZAIA 4HSPA 1JOKA 1XNRL 1L1OB 1I3QH 4PMCA 2R92G 1STHA 1SSOA 1STNA 1K0RA 2DN8A 1F9QA 2KEDA 2RF4A 1PH6A 2IPKD 3M7GA 3MWYW 4LF7L 2F4VQ 4BY7G 3GTPB 1LT6D 2RDFA 3IL8A 4ID6A 2VS1A 4FF3A 4R1JA 1KQSA 4C3JH 2VZAA 4XQJA 4BBRG 2DGYA 4DK3C 1A2UA 4Y7NH 5I9OA 1STBA 2D2CC 2L5TA 2SDFA 3G7LA 1PLFA 5GQOA 1WTPA 1MJEA 3M4QA 3ND8A 2OXPA 2UUCQ 1Y1WH 2RHQB 1D5ZC 4S3SA 3D31A 2E2JB 2F0OA 3S1NH 3VR6A 3AFPA 4A3DG 1CI3M 1HR0W 3NQTA 3E3XA 5ELNA 1U4MA 1S40A 1OXUA 4LF4L 3HOUG 4JI5L 1EIFA 4GOPC 3GTJB 2QDBA 1HFNA 5LHY1 2Q8RE 2ZTCA 2I5HA 2PI2E 4PZ6A 1YHAA 3CMAA 4KHPQ 4DR3Q 3S14B 2JE6I 1IBLL 4OWXB 1F2LA 1PTOD 1Q8IA 3PQIA 4UP9A 1LT5D 2B2UA 1ESFA 4DV4L 2PQAB 3HS0C 3R3OA 1GHKA 5IP7H 1QNUA 2N55A 2E5LQ 3CCRA 3C1EA 3OWFA 2ZTEA 4C2MB 1HUMA 3W1GA 4HIKA 2F4IA 2JEAI 4P72A 4N9TA 1V8QA 2L1BA 2VB3X 1CKMA 1SJED 2F3VA 1WTXA 3TS0A 1UE6A 2SNSA 2LXJA 2RCFA 1PFNA 5E7NA 4FYDA 1CSQA 3M4OB 1BCPD 1Q1BA 3T16A 1PRTF 2AHOB 2GA4B 1WD0A 4DK1A 2G5DA 3VA5A 3GTKB 4DUZQ 1MSGA 5EBDA 4LF9L 5DM63 2Z9HA 1EWIA 1HTLD 4AYBB 1AZQA 1I94L 3E0JA 5I2XA 4HCEA 2QKIC 1E2WA 1F2ZA 1HR0L 4JI0L 3PIOA 1HH2P 4R8NA 4O42A 3FPUB 5J1ZA 3T1YL 4WJWA 1KTKA 4RGTA 1J8IA 3I3CA 3S2DH 2NTSA 3NE5B 3IAYA 4IFDI 4C1NK 1JT8A 3G6JB 4OGQC 4DR4Q 1T5XD 5COYA 4DR7Q 1QILA 3ERSX 4PZ7A 4A3JG 1HNWQ 2KOLA 1WTOA 2I5LX 2NVXH 1C9OA 1VQ9A 3CHBD 2NBFA 1G291 1QE6A 3CC7A 1IBML 4IALA 4ZKCB 4N9PA 2WAQE 4DV0L 2L0CA 5KYLA 2KQ3A 1VQLA 1TWAH 5CV9A 1V1OA 4JOIA 1DXMA 4RA8A 3HOVH 4A3MH 4ZQ3A 4AYBE 3K59A 4HSVA 4FXDA 1L2FA 1BBWA 2H4OA 2DNEA 5EJWA 3EN2A 3M85A 1X6OA 4LFCQ 4OO1I 1PFSA 1DGSA 2M9VA 4PZ8A 3HOXH 3NSWA 2XVSA 1U0LA 1BQQT 2XSCA 4L6TB 1AP0A 1M1KC 3EQLC 4LF5L 4POFA 1I50B 3ULPA 3C2PA 5LL6S 5KNBA 2UUBL 4DV7Q 1XMQQ 2A68D 2VNUD 3H6MA 2NVTH 1N36L 2CW0C 1D1KA 1IKLA 1GUNA 4DR1Q 3AYHB 4YHHL 4LUZA 3WWVA 2R6GA 1X3EA 3OTOQ 5E3FA 2F1MA 1EL0A 3SK8A 2JSOA 3TP6A 1SJHD 1OXTA 5A2QE 3PUZA 1Y8NB 1TWHB 3NBHA 5KYIA 4ZUIA 4DR2L 2XTIA 4B9XA 2NVQH 3K7AH 4FXGC 4HIMA 1PH1A 4KKUA 3RZDB 5G3LD 3NBIA 4A3LG 2HDLA 4OELB 1GUSA 4X62L 4EQPA 4I65A 4QUFA 5FLMG 3GTGH 3EIVA 3HP3A 2VW9A 2O2LD 1TWCH 2Z4IA 3UDXA 5M3FH 1SE3A 2F0SA 3P20A 2PCFB 1Q81C 4HJ9A 1EY8A 3HZXA 1WTQA 1QZGA 2ATWA 1FJGQ 2HHHL 2J0TD 5C0XG 4BY1B 4HMJA 5IP9H 4DV6L 4NXNQ 1PH7A 3A8IE 2OTJA 2ZJQA 4KD4A 3DWQA 4XXEA 1FL0A 4AYBG 2L9HA 1KLGD 5BN4A 5L37A 1AZPA 4K5XA 3TP5A 3I4MB 2BH2A 2EZVA 2IT1A 1JB3A 3HOWH 2IX0A 2K1BA 1B50A 1F2YA 2JA5H 2EYFA 1IHZA 4DUYQ 4DV3L 3K6OA 3DEPA 2JA7G 1S5BD 1H9JA 4DAVA 1YNJC 2ZXRA 5DLQE 1TS4A 5C4HA 4R8IA 1UEBA 2N3SA 3S1RH 1I6HH 1E2VA 3PMFA 1A6XA 3S17B 4GN3B 1PA6A 2EDGA 4IPHA 4XT1B 2EYHA 1EU4A 4XQQA 1E22A 1K0SA 1N32L 2LSSA 3TZDA 1M4VA 4HR7B 1J5EQ 1GUGA 4C3IB 5IYCG 3UE1A 4JI3L 2MNAA 4A93B 4BBSB 1YIJA 1X3PA 4LFBQ 4EQNA 5FJ8H 5IGCA 3CCMA 5ELBA 5EPLA 2R93B 1GM5A 4P75A 5T1GA 5EQ0A 4GNXC 1P8LA 4OWWB 4KY6A 3UDGA 1DZ1A 3DHQA 4B3TL 3VR5A 3FKIB 1II3A 2K03A 2QEXA 4IJLA 1ZEQX 3GTMB 2KBNA 3PO2H 4GKJQ 1WJJA 1ASYA 2SNMA 1L1OC 3STBD 4B9WA 1OTCA 5JJZA 4CDFC 3H3VI 3C3LA 4B08A 1IXRA 3BYTB 5DAUA 4BWGB 1KNEA 2LY7A 2IX1A 2EOTA 1RIPA 4JI8L 3K5MA 4B3MQ 2R7ZH 1X56A 2F03A 2IHFA 1OXXK 1PTOB 1SNQA 2MP1A 3KK7A 1SFOH 4DR6L 4I7ZC 3CAMA 5HGQA 1O7ZA 5CBEE 1EQRA 4TSSA 2HDMA 1PRTB 2F0JA 4PNYA 1ESRA 5AJ3Q 2SOBA 1PDQA 1Y1VH 1AN8A 4WORA 1JJCB 3OMGA 1SNDA 1N33Q 2JJQA 3NENA 2BE5C 4LUOA 5KNDA 4IOAA 1B44D 4G4KA 4GN4B 4DR5Q 2HCCA 1VMPA 4UDUC 3CKIB 4RCOA 5CR3A 1BCPB 1FNWA 1SNCA 2K75A 3LGJA 2AWOA 2NN6H 2MHVA 1VS0A 2ID0A 5M9OA 1LV9A 1JICA 5K36G 4WJ4A 4XTCS 3D3RA 1Q86C 4PMWA 3L0OA 4L5SA 3TDQA 1F9RA 1I3QB 3R93A 2XWBB 4KJNA 4BY1G 4UY8C 2D9UA 2NZ1D 2AMCB 5EKIA 4JI1Q 4YY3Q 5JOBA 2JA8H 3PSIA 2N88A 1MD2D 3NQIA 1JE5A 3R8BA 1XTDA 4PQXA 2IWHA 1TY0A 3HFZB 3RLNA 1HNXL 2F0GA 1BBXC 1BKBA 4C3JB 3PO3H 3Q24A 1UE7A 4Y7NB 5D3DA 3NXWA 4JI7Q 5IT9L 2QA4A 3K0YA 4IFDG 1FYCA 4XDXA 1VQIA 4RGOS 2B8GA 3H15A 1Q7YC 3K81C 1Y1WB 3BVGA 2R92B 4C56C 5C5MA 1W2BA 3A5UA 3W5OA 3E0EA 3PUVA 5I6YA 1SLJA 2JA9A 3S1NB 4A3FH 1PZJD 1SBBB 5IGGA 1C4QA 4AQYQ 4X66Q 1SYFA 4BY7B 1BNZA 2LKVA 4ZLTF 4A93G 1I4QA 4L63B 1YVCA 4OO1G 3G48A 4AH6A 3DMUA 2RSOA 3PUWA 1LUZA 2HD3A 2R93G 2K7VA 4EQ5A 1NUCA 1SN8A 4OEMB 2F0EA 4DFAA 3HOZH 3VR4A 1IZ6A 2WINB 4X64Q 4LK1C 2AKWB 1EZ6A 1A63A 3BYYB 1PH8A 4ABNA 4BA2I 4A3CH 1JOOA 5FO8B 3KJOA 2EYOA 1BBUA 1LTID 2UUAL 2XRQD 4DU9A 4A3DB 4X3UA 1T5EA 1PH9A 4AIMA 1NR4A 5JVG3 3KUPA 3RUZA 3RN2A 2PW7A 2ZM6Q 5JJIA 2B63H 4KHZA 2B3GA 3I90A 4IUPA 2Z8LA 3CQZH 4G7HC 1XMOL 3ND9A 3KF6A 1JC7A 3I4OA 1KRTA 1G2SA 2FFKB 2MUYA 5IODA 3K7UC 5GAGC 1LYLA 1SE8A 1QJOA 2ZTDA 4IFDJ 1QB5D 3KOJA 2A6HD 5E1FA 5IE8A 1Q82C 1MGSA 4DAPA 2Q2HA 1ICFB 1Q46A 2FJ2A 5IGBA 1TQOA 1Q3LA 3H09A 1STYA 3MXNA 2RHSB 3S2DB 1ZYRD 1BUVT 4K2KA 5ELFA 5FLXL 2OTLA 2B2UC 4NXML 3RD4A 1S72A 3T51B 2JA6H 1O7IA 2QW7A 1X9NA 2Z0SA 1MIUA 2PNHA 3DLLA 5C0XI 1JQYD 4K2LA 5IYDH 5HGTA 1WYDA 4WJ3M 5GAEC 1A15A 2MJ8A 3KBGA 3FP9A 1PYBA 1TWAB 3DWPA 2A73B 2WP8J 1SXTA 3HOVB 1G2TA 4BA1I 1MHWC 2AWNA 4ZKBB 1H9RA 3BG3A 1IYVA 2JK8A 4R9WA 3J81L 2A5HA 2CQOA 3E9HA 4DV5L 3D6CA 3ULJA 4RFBA 4C3JG 1MI2A 1XXGA 1ASZA 3J7AV 1UE5A 1KLUD 2A6EC 3TMEA 2WB1G 1CHPD 3CCLA 1DOKA 2UXDL 1YNND 2NVTB 2IHEA 1Z9FA 3TP8A 4CJ1B 1RD9D 4JG2A 1ENAA 2D0PA 1F9PA 1O7YA 2I0QA 3EBEA 1TT2A 1R9TH 1Y1WG 1TIID 2PZUA 3CPFA 3I91A 5CMDA 1XNRQ 1KNAA 3V2TA 4P71A 3NEMA 5FKAC 1SAPA 3J7YW 4OX9Q 2K5WA 1YHBA 4JBJA 1LTSD 4JOIC 1HZ9A 4RHSA 4LF7Q 2XGTA 4X3TA 3K7AB 2VQEL 5GAHC 2I46A 5EAYA 4DPGA 1EUJA 3CCJA 1NY4A 3PCOB 5GROA 3FMCA 3Q23A 1VQ5A 1GKHA 1BR9A 4IURA 5IP7G 1MSHA 3KF6B 3N6RA 2F3WA 1PH5A 4DV2L 1W6KA 3SDZA 1QVGA 4M1UB 1N34Q 3J80c 2KENA 4YWMA 4X3SA 1TWCB 2I5MX 2CWAA 2NN6I 1IBKL 5JJKA 1B9MA 1P16A 2K4KA 3VR3A 5M3FB 4QJFA 2UUCL 2UXCQ 1SDFA 4GZYC 2F0NA 4NPSA 3MXNB 1SYEA 2YU9H 4LF4Q 3S9WA 4JI5Q 1WVLA 3UI2A 3A0JA 1D2BA 1B53A 3KLWA 3MXPA 1SNMA 2N8NA 2RA4A 2SEBD 3JAML 1IBLQ 4IN3A 1JR0D 4KJOA 5E4XA 2Z4HA 3G6EA 2JA5B 3OMCA 2K52A 2GVBA 4HIOA 3Q8DA 3NTHA 1PTOF 2EY2A 1PFMA 2E5LL 2FINB 1ET6A 4C3HH 1T9HA 1AH9A 5LL6X 3S1RB 1I6HB 1V1PA 4I7AA 1PTOC 1N9WA 5JEAH 3I72A 5JPNC 1TS3A 1PRTC 1WTWA 3T1HQ 3CPWA 3EROA 3J7AF 1JORA 4DF7A 1BCPF 1I5FA 4LF9Q 3A54A 4HJ8A 1JCKB 1PYSB 4CKEA 3HOVG 4A3MG 3EVQA 1TWFB 5IT9c 4KV6A 1L0XB 2WV6D 3P1HA 1NNXA 1I94Q 1BCPC 2JA7B 2X6GA 1NCVA 3PIP3 2CHBD 2Q8IB 5KRUA 3HOXG 1DOLA 3L2PA 1KRSA 3J80i 3QG1A 2NB0A 1JJGA 5M5WH 3PO2B 4KK7A 2G9DA 3H94A 1HXYD 2L15A 1C0AA 1GUWA 4P74A 3D6WA 2Q2UA 3LWUA 4JYAQ 4NP5A 4F7XA 5KGUA 3Q0AA 1CZGA 1Q90A 3BDOA 3VDYA 1HNWL 2XNAC 4Q5VA 2PZWA 1IBMQ 3GTOB 1EZ8A 3RN5A 3S2HH 2D5DA 2R7ZB 1S5CD 3QOLA 1VQ7A 4V0BA 1TU2B 5IOCA 3PF5A 2PMZB 5KIXA 1VMCA 5C4XG 1HUNA 2M2LA 1SFOB 4HJ7A 2EYLA 2VQFL 1DJRD 3KJPA 2PZTA 1IW7C 3GV6A 2UXBQ 4WRDA 4GLVB 3AQQA 4J15A 2CH4A 2VXWA 1Y1VB 2J7ZA 1SMYD 4IUTA 4IPCA 1WD1A 1HCZA 1AW7A 3BZCA 4LF5Q 3VA7A 4K0KL 1O78A 1PZKD 1X3FA 2K04A 2UUBQ 4JV5L 1FNVA 4LF8L 3MA2B 5M5XB 4APVA 2N49A 1M90C 1K8OA 3PV0A 2JEBI 3RNUA 1SMXA 2K32A 1RL2A 4A3IH 4DR1L 2NYZD 1NE3A 3GDEA 5C4XH 5M3FG 3S15H 1EOTA 1SR3A 3OWEB 4DNTB 5BN3A 4ZCKA 1GJXA 2A68C 2PQEA 2RKSA 2PMZE 1WTRA 1GOZA 1S4ZA 3IFDA 3A56A 2P5ZX 4FF4A 2EVBA 5IP9G 3R2IA 1BDOA 4DR2Q 2OQ0A 5A2QL 2MGSA 5IGEA 2JA8B 1E7ZA 1SRUA 1NMFA 4OIJA 5EBCA 2RVLA 1GD7A 3H3VC 1YI2A 3ERQA 3L9AX 1Q12A 1V1PB 4CKBA 2RBMA 1ILPA 3PO3B 3HOWG 1RODA 4BXXH 1YITA 2JA5G 2K33A 4TVAB 3CRKC 5CORA 1IYUA 3D8GA 5G3LF 4X62Q 4LFAL 5ELDA 3NK9A 1SE4A 3E5SA 4KN4C 3HKZB 3KLSA 4KMUC 3J81c 4N8FA 4GLAC 1YJWA 3A5ZB 1LO5D 4KI0A 3CW2C 1DD2A 4QMGA 3E6ZX 1I4RA 2CVRA 2KCNA 5CBAE 1A3VA 4U673 1HJPA 1EEFD 1KDBA 2HHHQ 3LNNA 2UU9Q 3U9SA 4DV6Q 1XPOA 2HIVA 1FJGL 3PIPA 3HKSA 1VQDA 4DNRB 4IJHA 1B7YB 1K28A 3H91A 4HEDA 4RKBA 5FJ8G 4A3EH 3S1QH 1H9SA 3F1ZA 3UE0A 1CZWA 1H9MA 1IYJB 3K58A 1ICWA 1XPRA 4V190 1DOMA 1RTOA 1VQHA 3DM3A 3D0FA 3S14H 1OXVA 4JBWA 4O0AA 2CH4W 4UP8A 3HOZB 4KKTA 4QIWB 2K50A 2L12A 4DV3Q 4A76A 1B2TA 1U4PA 3ER0A 3MXUA 5FO7B 4RG1A 1SYCA 5FK9C 3CCQA 3PO2G 1LT3D 1TWGH 2C5CA 5I4DA 1CKNA 5IYBH 1KHIA 2B29A 1ENCA 3VR2A 4E6IA 1UAPA 4POGA 4H0LC 4OONA 2Y0SB 3L3OC 4LW1A 2QCPX 5I2YA 4XYQA 4DV1Q 3CQZB 1D1IA 4B3SL 1N32Q 4O1NA 3O13A 1VQFA 2EY1A 4JI3Q 1TR5A 3I73A 1CSPA 3OPOA 2R7ZG 4ILWA 2IY5B 4H7BA 3F2BA 1DYQA 2KHIA 2C9OA 3QB3A 4LFBL 1N8RC 1Y14B 1AEXA 4A3GH 2A8VA 3SVMA 1B3QA 3S16B 1NMGA 1QG7A 4QIWE 1VQCA 5C0XJ 1Y1VG 1D8LA 2R7DA 1EEID 4A3BH 1STEA 5C3EH 3BZDB 1L0YB 3J81i 2DUDA 4JI6Q 3NBHB 3ITPA 1A2TA 2XWJB 3Q6SA 4GKJL 4ZRZA 3M3YH 1QVFA 4LWCA 4ME5A 2PW5A 2Q2TA 2XIWA 5HURA 3AFQA 4JI2L 2NN6G 3JAMc 3M7NA 2QGQA 4JI8Q 1CHQD 5M5YH 1DM0B 3STBC 2XN9C 3MAQA 4JBMA 1O7LA 4XQNA 2CQAA 3J80E 1HHVA 4RGNA 3I8ZA 1KC8C 2E76C 4X6AH 2B2VA 2BE5D 1LTLA 2HCIA 4IOCA 4K6DA 2E75C 3A7AB 5C3WA 3VYSA 5CGKA 5LMUL 2JA8G 4IO9A 1I4GA 4O2DA 4YWLA 4TRDA 3NWTA 1CQFA 3CD6A 3N52A 3SEBA 3M9BA 3BS1A 3PO3G 3HOYH 2E2IB 1I50H 5ELOA 3OIQA 5KEEA 2Z1CA 3PUYA 3SXHA 3D4RA 1XNQQ 2RQXA 1KAAA 4HN7A 1S5ED 1VQKA 3HKZG
chains in the Genus database with same CATH topology
1H9SB 1EWCA 5BN5A 1R9TB 3FEWX 1TKWB 1Y8OB 3HEJA 1HFGA 5JAVA 1CA5A 4EQOA 2B39A 1B3AA 1EYCA 2TSSA 1B1ZA 2E74C 2WB1B 3A8KE 1I4HA 2AQ1B 4Z9CB 2OF1A 3HG9A 1SNOA 1Y69U 4FVMA 1BF4A 4KD3A 5IT9E 4G57A 1IKMA 5FO9B 2F0IA 1ZKOA 3OW7A 1EY6A 1GUTA 3AU7A 1I6VC 3SK6A 1XTCD 1D5MC 1HQRD 2NWGA 2ZT9C 3X3NA 2YU9B 5C5LA 3MFYA 2O4XA 1PXUA 1VCIA 3AB9A 2EJFC 5C6AA 1ET9A 1PFBA 2X69A 4H13C 4K8IA 2G9HD 2KUMA 1MBYA 3GD7A 3MC0B 1QNKA 1IL8A 1STGA 1EY0A 1ONLA 4CBVA 2QF7A 4EGVA 1VF7A 2K05A 3T56B 4ZYSA 4F8MA 1LT4D 1EQTA 1WTVA 5IGDA 4IUVA 1NAPA 4ULLA 4K14A 1EIHA 2OEOA 3FRPB 3KF8A 4MN3A 5J39A 5JPMC 1TS2A 3ZYYX 1B4OA 3NP8A 4HAEA 1FNUA 3NWSA 4RWSC 4PMBA 4K5WA 2H1EA 3TN2A 5FLXE 2NVXB 5D3IB 1B9NA 2B2TA 2BA1A 2PYKA 4F88A 1F77A 2WKCA 2LMCB 4MIUA 3IFTA 1S5FD 4OIKA 4A3MB 4K8JA 1U9RA 1ZYRC 3W3AA 3DM1A 1Z6HA 3I70A 2R61A 3HOXB 1RHPA 4KY7A 3C1FA 5CV6A 1H9KA 3J81E 2EJGC 2DY7A 2V4DA 1CTMA 4RKLA 2EYMA 2A74C 4NW2A 4CHTB 3P7JA 1W6JA 1SEBD 1LABA 2EYPA 2A69C 3MFGA 5IIFA 1PYWD 2AQ2B 4HTHA 1UNSA 3OIPA 3IKJA 5C4XB 3S15B 3URYA 3I4LA 3MVVA 2WACA 2NVQB 1YNNC 1E2ZA 1BXTA 3NTIA 5KNCA 3BVZA 2K5QA 3MXGA 3EJIA 3NPPA 4DA2A 3FDTA 5EGTA 5FOBB 2K01A 4CGYB 4RHRA 1OXSC 3GTGB 4LJZC 1LTAD 1HRJA 4ZUJA 4C3HG 1EYAA 5EKLA 2F0DA 5JEAG 3FPPA 3A55A 5DNFA 1E0BA 1X3QA 1FD7D 5CV7A 1TS5A 1EIGA 3K5NA 1OO9B 4A3EB 3HOWB 2EY6A 3S1QB 1SYDA 4P2CB 4EVOA 3JAME 1CFMA 2EYJA 4M8AA 2KJXA 3X3MA 3Q22A 2B2WA 4C1NI 2F0LA 1PRTD 5I9PA 1TWGB 3RLFA 1EY7A 2F0UA 4BS9A 2F0PA 2TMPA 2B2YA 1CK1A 5EKKA 1KDAA 2BA0A 3MZ5A 2WAQB 4G7ZC 2F0WA 2RDHA 2ICEC 1LTTD 4RH6A 4A3GB 3WDNA 1EWHA 2AUKA 5JEAJ 3TSSA 1JWUD 2O5JC 4RCNA 4DXFA 2F0TA 4A3BB 5C3EB 4NMZA 3LX0A 5C3XA 1G6ZA 4JK1C 1GUOA 3M3YB 1Q1EA 4KTAA 2L4NA 4TKOB 2IJ0A 5M5YB 1IW7D 2WKDA 4ZK9B 1HQMC 3MTSA 5JVH3 1RTNA 2FMCA 4DAYA 2CW0D 4ODGA 3AMUA 3QIAA 3SE0A 5DEHA 3P75A 4MHEA 4DK0A 2QEJC 2EJMA 4FP5D 2D62A 2PO4A 3HOYB 1CM9A 3EA6A 3L7ZC 4WFN3 2F0KA 1RDPD 5D14A 4J6HA 1SMYC 3VYTA 2KA7A 4QUCA 1EU3A 3QWNA 3CRLC 2F0VA 3TBIB 2K5DA 2L55A 1XX8A 3CU7A 1I4XA 1M8AA 3V96A 5T1IA 2Q8TA 5M3MB 3WOFA 5ISRA 5EPJA 4HCSA 5C4JB 2XRSD 4LMQD 2B2VC 2BDOA 2QILA 3SHLA 1A3TA 4IUNA 3K5OA 2DNCA 4A3FB 3BDCA 4A3KB 1UUPA 1QWYA 1NSNS 5CV5A 4FF2A 1XYIA 3WOEA 1KABA 1YNJD 4OHJA 1X32A 5F2DA 1R4PB 3MHBA 3RZOB 1LTBD 5C44B 1PMRA 1SYBA 1EY9A 4CJ2C 1VF5C 2EXZA 3DEOA 4L8JA 3MEHA 1LTGD 3FVQA 2BOSA 3D4WA 1DCZA 4U68A 2B63B 1A3UA 3M4YA 2M00A 5C0XH 2R3ZA 5ELCA 5A35A 1U4LA 3NHHA 4LAAA 1FGBD 1ILQA 4RGMA 3EFXD 3K5LA 5C4ZA 5AFWA 1ZXTA 2B8FA 4OL7A 1NR2A 1RJTA 1JWSD 3QOJA 3A8JE 4UAIA 1AFPA 1CQVA 4QCLA 2J4XA 1D6EC 2FMMA 1HPCA 2VUMB 1S5DD 3SK5A 2IX3A 2JA6B 3KLSX 1RF2D 3HRZC 2FHTA 3I4NB 2JP1A 1SE2A 3K57A 3SK4A 4FXKC 1Z7TA 4XIGS 2EPBA 2E2HB 2PNRC 2F0QA 4F87A 2O5IC 1PZID 3A7LA 1C48A 2X6LA 5TSSA 3H0GB 5NUCA 3DXJC 3RMHA 1BO0A 1SYGA 3J80L 2OT2A 1HA5A 4H44C 1EY4A 4IQZA 1JOQA 1JWMD 2L11A 3VYRA 3VYUA 3NTKA 3OOCA 4KN7C 1EYDA 3GP7A 2JYOA 4FF1A 1LACA 2BDNA 1D5XC 2K6AA 3BVMA 2B2TC 4XYOA 1G91A 1ENFA 1V43A 3DUZA 3BDLA 3S1MB 2KEEA 1SNPA 1HTPA 1GXDC 3OHXC 3ONAB 5E4WC 2AQ3B 4G7OC 3GO5A 3TZUA 4CJ0B 4K6LA 2KHSA 2JXMB 3V05A 3T13A 4J1MA 5CV8A 1GHJA 3TP7A 4HMIA 1K83B 1WCMB 4YIJA 3GV3A 1CA6A 1G8ZD 2ENBA 2ICIA 1FR3A 4IUUA 2IL8A 5K36H 2KECA 2DY8A 3W2DA 1QOHA 3HGBA 3GTQB 1U4RA 4XT3B 4DN4M 2KCCA 3D4DA 2BCOA 1LLRD 1R4QB 4PV1C 5EPKA 3SR1A 4RAUC 3U9OA 4C3IG 1EFID 4QB4A 5CV4A 2YYZA 4BBRB 3QJYA 4IUQA 1O80A 1TY2A 5J22A 1Y8PB 4IFDH 4C3HB 3QO2A 1EY5A 2F0FA 2K28A 4FO2A 2MPMA 1VDZA 2LFNA 1Z47A 1QCBD 5DM73 2IW3A 2HQEA 1ML0D 2WIIB 3T53B 1UEAB 4X3KA 3KBXA 1XWEA 4TQUS 3HOUB 5K5PA 2EE1A 4CKCA 3GQBA 1RKNA 4OO1H 1DONA 4J8QA 4IZ8A 4Q0FA 5CYUA 2LS01 2KVMA 1HA6A 3NUCA 2E2DC 2AUJD 1CT1D 2NTTA 2PPBC 3F2UA 3KLRA 5M5WB 4FNFA 3OSOA 2A6HC 1RCVD 4KKSA 3GTLB 4KHVA 2HUGA 5CC4A 3LWEA 2B2WC 3C46A 3S2HB 1TVXA 2ZXOA 4DGZA 2VB2X 4DXGA 4NDXA 1K8MA 1KDCA 2NVYB 1F9SA 1J9OA 1I4PA 2NUCA 2ZXPA 1STAA 4KY5A 1PTOH 2A6ED 1F2MA 2B2YC 3DWAA 2F0HA 2F0MA 1JE4A 5I6WA 1LTRD 2A69D 5ELEA 5D65A 3PIO3 4K5VA 4NKLA 4A3JB 2I07B 1BOSA 3PUXA 4A3IB 2EY5A 1C8CA 5IGFA 3R2TA 3T4AC 4QF4A 1EQVA 2RDGA 2RSNA 4ZAIA 4HSPA 1JOKA 4PMCA 1STHA 1SSOA 1STNA 2DN8A 1F9QA 2KEDA 2IPKD 3M7GA 3MWYW 3GTPB 1LT6D 2RDFA 3IL8A 4ID6A 4FF3A 4XQJA 1A2UA 5I9OA 1STBA 2D2CC 2L5TA 2SDFA 3G7LA 1PLFA 1WTPA 3ND8A 2OXPA 1D5ZC 4S3SA 3D31A 2E2JB 2F0OA 3VR6A 1CI3M 3NQTA 1U4MA 1OXUA 3GTJB 2QDBA 1HFNA 5LHY1 2Q8RE 3S14B 2JE6I 1F2LA 1PTOD 1Q8IA 1LT5D 2B2UA 1ESFA 3HS0C 3R3OA 1GHKA 1QNUA 2N55A 3C1EA 3OWFA 4C2MB 1HUMA 2F4IA 2JEAI 4N9TA 1V8QA 2L1BA 2VB3X 1SJED 2F3VA 1WTXA 2SNSA 4FYDA 1PFNA 3M4OB 1BCPD 1Q1BA 3T16A 1PRTF 2GA4B 1WD0A 4DK1A 3VA5A 3GTKB 1MSGA 5EBDA 5DM63 1HTLD 4AYBB 1AZQA 3E0JA 5I2XA 4HCEA 2QKIC 1E2WA 1F2ZA 4R8NA 4O42A 3FPUB 5J1ZA 4WJWA 1KTKA 4RGTA 1J8IA 3I3CA 2NTSA 3NE5B 3IAYA 4IFDI 4C1NK 3G6JB 4OGQC 1T5XD 5COYA 1QILA 2KOLA 1WTOA 3CHBD 2NBFA 1G291 1QE6A 4IALA 4ZKCB 4N9PA 2L0CA 5KYLA 2KQ3A 5CV9A 1V1OA 4RA8A 1DXMA 4ZQ3A 3K59A 4HSVA 4FXDA 2H4OA 2DNEA 5EJWA 3M85A 4OO1I 2M9VA 3NSWA 2XVSA 1BQQT 2XSCA 4L6TB 1AP0A 3EQLC 1I50B 3C2PA 5LL6S 5KNBA 2A68D 2VNUD 3H6MA 2CW0C 1D1KA 1IKLA 1GUNA 2R6GA 5E3FA 2F1MA 1EL0A 3SK8A 2JSOA 3TP6A 1SJHD 1OXTA 5A2QE 3PUZA 1Y8NB 1TWHB 3NBHA 5KYIA 4ZUIA 4B9XA 4FXGC 4KKUA 3RZDB 5G3LD 3NBIA 2HDLA 1GUSA 4EQPA 4I65A 4QUFA 3HP3A 2O2LD 2Z4IA 1SE3A 2F0SA 3P20A 2PCFB 1EY8A 3HZXA 1WTQA 2J0TD 5C0XG 4BY1B 4HMJA 3A8IE 4KD4A 3DWQA 4XXEA 2L9HA 1KLGD 5BN4A 1AZPA 4K5XA 3TP5A 3I4MB 2EZVA 2IT1A 1JB3A 2IX0A 2K1BA 1B50A 1F2YA 2EYFA 1IHZA 3K6OA 3DEPA 1S5BD 1H9JA 4DAVA 1YNJC 2ZXRA 1TS4A 5C4HA 4R8IA 1E2VA 3PMFA 1A6XA 3S17B 2EDGA 4XT1B 2EYHA 1EU4A 4XQQA 3TZDA 1M4VA 4HR7B 1GUGA 4C3IB 4A93B 4BBSB 1X3PA 4EQNA 5IGCA 5ELBA 5EPLA 2R93B 5T1GA 5EQ0A 4KY6A 1DZ1A 3DHQA 3VR5A 3FKIB 1II3A 2K03A 3GTMB 1ZEQX 2SNMA 4B9WA 5JJZA 3C3LA 4B08A 3BYTB 5DAUA 4BWGB 1KNEA 2LY7A 2IX1A 2EOTA 3K5MA 2F03A 1OXXK 1PTOB 1SNQA 2MP1A 3KK7A 4I7ZC 1O7ZA 5CBEE 4TSSA 2HDMA 4PNYA 1PRTB 2F0JA 1ESRA 2SOBA 1PDQA 1AN8A 4WORA 3OMGA 1SNDA 2BE5C 5KNDA 1B44D 4G4KA 2HCCA 1VMPA 4UDUC 3CKIB 4RCOA 5CR3A 1BCPB 1FNWA 1SNCA 2AWOA 2NN6H 2MHVA 2ID0A 5M9OA 1LV9A 1JICA 5K36G 4XTCS 3D3RA 4PMWA 3TDQA 1F9RA 1I3QB 3R93A 2XWBB 4KJNA 2D9UA 2NZ1D 5EKIA 5JOBA 2N88A 1MD2D 3NQIA 3R8BA 4PQXA 2IWHA 1TY0A 2F0GA 1BBXC 4C3JB 3Q24A 4Y7NB 5D3DA 3NXWA 5IT9L 3K0YA 4IFDG 1FYCA 4XDXA 4RGOS 2B8GA 1Y1WB 3BVGA 2R92B 4C56C 5C5MA 3PUVA 5I6YA 3S1NB 1PZJD 1SBBB 5IGGA 1C4QA 1SYFA 4BY7B 1BNZA 2LKVA 4ZLTF 1I4QA 4L63B 4OO1G 3DMUA 2RSOA 3PUWA 2K7VA 1NUCA 2F0EA 4DFAA 3VR4A 2WINB 4LK1C 1EZ6A 3BYYB 4ABNA 4BA2I 1JOOA 5FO8B 2EYOA 1LTID 2XRQD 4DU9A 4A3DB 4X3UA 1T5EA 1NR4A 5JVG3 3KUPA 3RUZA 2PW7A 4KHZA 3I90A 4IUPA 2Z8LA 4G7HC 3ND9A 1JC7A 1G2SA 2FFKB 2MUYA 5IODA 1QJOA 4IFDJ 1QB5D 2A6HD 5E1FA 1MGSA 4DAPA 2FJ2A 5IGBA 1TQOA 1Q3LA 3H09A 1STYA 3MXNA 3S2DB 1ZYRD 1BUVT 4K2KA 5ELFA 5FLXL 2B2UC 3RD4A 3T51B 5C0XI 1JQYD 4K2LA 5HGTA 1A15A 2MJ8A 3KBGA 1TWAB 3DWPA 2A73B 2WP8J 1SXTA 3HOVB 1G2TA 4BA1I 2AWNA 4ZKBB 1H9RA 3BG3A 1IYVA 4R9WA 3J81L 2A5HA 3D6CA 4RFBA 4C3JG 1MI2A 1XXGA 3J7AV 1KLUD 2A6EC 3TMEA 1CHPD 1DOKA 1YNND 2NVTB 3TP8A 4CJ1B 1RD9D 1ENAA 1F9PA 1O7YA 1TT2A 1TIID 2PZUA 3I91A 5CMDA 1KNAA 3V2TA 5FKAC 1SAPA 3J7YW 2K5WA 1LTSD 4RHSA 4X3TA 3K7AB 2I46A 3FMCA 3Q23A 1BR9A 4IURA 1MSHA 3N6RA 2F3WA 1W6KA 3SDZA 4M1UB 4X3SA 1TWCB 2NN6I 1B9MA 3VR3A 5M3FB 1SDFA 4GZYC 2F0NA 1SYEA 3S9WA 1WVLA 3UI2A 1D2BA 1B53A 3MXPA 1SNMA 2RA4A 2SEBD 3JAML 4IN3A 1JR0D 4KJOA 5E4XA 2Z4HA 2JA5B 3OMCA 3NTHA 1PTOF 2EY2A 1PFMA 2FINB 1ET6A 5LL6X 3S1RB 1I6HB 1V1PA 1PTOC 5JEAH 3I72A 5JPNC 1TS3A 1PRTC 1WTWA 3EROA 3J7AF 1JORA 4DF7A 1BCPF 3A54A 1JCKB 4CKEA 3EVQA 1TWFB 4KV6A 1L0XB 2WV6D 3P1HA 2JA7B 1BCPC 2X6GA 1NCVA 3PIP3 2CHBD 2Q8IB 5KRUA 1DOLA 3QG1A 2NB0A 3PO2B 4KK7A 2G9DA 3H94A 1HXYD 1GUWA 3D6WA 3LWUA 4NP5A 4F7XA 5KGUA 3Q0AA 1Q90A 1CZGA 3BDOA 2XNAC 4Q5VA 2PZWA 3GTOB 1EZ8A 2D5DA 2R7ZB 1S5CD 3QOLA 4V0BA 1TU2B 5IOCA 2PMZB 5KIXA 1VMCA 1HUNA 2M2LA 1SFOB 2EYLA 1DJRD 2PZTA 1IW7C 3GV6A 4WRDA 2VXWA 1Y1VB 2J7ZA 1SMYD 4IUTA 1WD1A 1HCZA 1AW7A 3VA7A 1O78A 1PZKD 2K04A 1FNVA 3MA2B 5M5XB 1K8OA 3PV0A 2JEBI 2K32A 2NYZD 1EOTA 3OWEB 4DNTB 5BN3A 1GJXA 2A68C 2PQEA 2RKSA 1WTRA 1GOZA 1S4ZA 3IFDA 3A56A 4FF4A 2EVBA 3R2IA 1BDOA 5A2QL 2MGSA 5IGEA 2JA8B 5EBCA 4OIJA 2RVLA 3H3VC 3ERQA 3L9AX 1Q12A 1V1PB 4CKBA 2RBMA 1ILPA 3PO3B 1RODA 2K33A 3CRKC 5CORA 1IYUA 3D8GA 5G3LF 5ELDA 3NK9A 1SE4A 3E5SA 4KN4C 3HKZB 3KLSA 4KMUC 1LO5D 4KI0A 1DD2A 4QMGA 3E6ZX 1I4RA 2CVRA 2KCNA 5CBAE 1A3VA 4U673 1EEFD 1KDBA 3LNNA 3U9SA 4DNRB 4RKBA 3H91A 4HEDA 1H9SA 1CZWA 1H9MA 3K58A 4V190 1ICWA 1DOMA 1RTOA 1OXVA 4JBWA 3HOZB 4KKTA 4QIWB 2L12A 1B2TA 1U4PA 3MXUA 5FO7B 1SYCA 5FK9C 1LT3D 2C5CA 5I4DA 1ENCA 3VR2A 4E6IA 1UAPA 4H0LC 2Y0SB 3L3OC 2QCPX 5I2YA 4XYQA 3CQZB 1D1IA 4O1NA 3O13A 2EY1A 1TR5A 3I73A 3OPOA 4ILWA 4H7BA 1DYQA 2C9OA 3QB3A 1AEXA 3SVMA 3S16B 1QG7A 5C0XJ 1EEID 1STEA 3BZDB 1L0YB 3ITPA 1A2TA 2XWJB 3Q6SA 4ZRZA 4ME5A 2PW5A 2XIWA 5HURA 2NN6G 3M7NA 1CHQD 1DM0B 2XN9C 3MAQA 1O7LA 4XQNA 2CQAA 3J80E 1HHVA 4RGNA 3I8ZA 2E76C 2B2VA 2BE5D 2HCIA 4K6DA 2E75C 3A7AB 5C3WA 3VYSA 5CGKA 1I4GA 4TRDA 3NWTA 1CQFA 3N52A 3SEBA 3BS1A 2E2IB 3OIQA 5KEEA 2Z1CA 3PUYA 3SXHA 3D4RA 2RQXA 4HN7A 1S5ED 1KAAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2X6L A;  3GV6 A;  1EIH A;  1WVL A;  1DZ1 A;  4IUQ A;  3UI2 A;  1O80 A;  2K01 A;  4XDX A;  1G6Z A;  1A15 A;  1B53 A;  2VXW A;  2J7Z A;  1WD0 A;  2MJ8 A;  4IUT A;  2K03 A;  1WD1 A;  1BO0 A;  1HFG A;  4MN3 A;  1C8C A;  1MSG A;  3QO2 A;  1XYI A;  1G2T A;  2RA4 A;  1CA5 A;  2K04 A;  1B4O A;  2K28 A;  4ZKB B;  1HRJ A;  2L4N A;  1X32 A;  4HAE A;  2MPM A;  5JJZ A;  2L11 A;  5E4X A;  1B3A A;  1AZQ A;  2RSN A;  4ZAI A;  4RWS C;  4R9W A;  1BNZ A;  2H1E A;  2HDL A;  1ML0 D;  3TN2 A;  1KNE A;  4O42 A;  4ZK9 B;  1PFM A;  4ZLT F;  3FPU B;  2FIN B;  1SSO A;  3MTS A;  1RTN A;  4X3K A;  2NYZ D;  3KBX A;  2B2T A;  2EOT A;  4QUF A;  3HP3 A;  1J8I A;  1EOT A;  1F9Q A;  2KED A;  3I3C A;  2JYO A;  3MWY W;  4CJ2 C;  2RSO A;  3DEO A;  1MI2 A;  2EE1 A;  2BDN A;  5DNF A;  1E0B A;  3IL8 A;  3SVM A;  1WTR A;  1QG7 A;  1X3Q A;  1S4Z A;  2B2T C;  5COY A;  3IFD A;  4OIK A;  1BF4 A;  1DON A;  2KOL A;  1WTQ A;  1G91 A;  1DOK A;  2MP1 A;  1IKM A;  1WTO A;  1WTW A;  1EIG A;  4U68 A;  2KVM A;  4MHE A;  2MGS A;  4CJ1 B;  1HA6 A;  3DM1 A;  1QE6 A;  2KEE A;  1O7Z A;  4OIJ A;  2RVL A;  5CBE E;  1F9P A;  1O7Y A;  2HDM A;  4ZKC B;  1ESR A;  2SDF A;  3ONA B;  5E4W C;  3F2U A;  1PDQ A;  1RHP A;  3G7L A;  1CM9 A;  1PLF A;  3Q6S A;  1WTP A;  2R3Z A;  1U4L A;  4CJ0 B;  2L9H A;  3I91 A;  4X3U A;  4RA8 A;  5CMD A;  1ILP A;  1KNA A;  1ROD A;  1NCV A;  1NR4 A;  2B2W A;  2NWG A;  2X6G A;  1AZP A;  1ILQ A;  3KUP A;  4HSV A;  1SAP A;  2DY7 A;  2HCC A;  1VMP A;  2HUG A;  2XIW A;  5COR A;  5D14 A;  5AFW A;  5EJW A;  1ZXT A;  3I90 A;  3LWE A;  4QUC A;  1DOL A;  4IUP A;  2K1B A;  1B50 A;  1NR2 A;  1RJT A;  4NW2 A;  3DEP A;  2B2W C;  1G2S A;  2FFK B;  1U4M A;  3GV3 A;  4X3T A;  1CA6 A;  4UAI A;  1PFB A;  2X69 A;  1TVX A;  4R8I A;  1LV9 A;  1GUW A;  3P7J A;  1JIC A;  1HFN A;  3D6W A;  1AP0 A;  1HHV A;  2FMM A;  2KUM A;  2Q8R E;  1XX8 A;  2B2Y A;  2CVR A;  3I8Z A;  5CBA E;  1M8A A;  1F9S A;  2B2V A;  1J9O A;  1QNK A;  1MGS A;  1F9R A;  2IL8 A;  2KEC A;  4IUU A;  5T1I A;  2HCI A;  2Q8T A;  4IUR A;  1IL8 A;  2DY8 A;  1MSH A;  4HCS A;  4XT1 B;  1F2L A;  5EPJ A;  3R93 A;  2FJ2 A;  2B2U A;  1U4R A;  1Q3L A;  2D9U A;  2K05 A;  2B2Y C;  2NZ1 D;  3H91 A;  4HED A;  4XT3 B;  1IKL A;  5EKI A;  3TZD A;  4LMQ D;  2B2V C;  2FHT A;  2N55 A;  2N88 A;  4X3S A;  1EQT A;  3N52 A;  2JP1 A;  4DN4 M;  1JE4 A;  1X3P A;  1HUM A;  1WTV A;  1ICW A;  2B2U C;  1DOM A;  2EPB A;  1RTO A;  1BBX C;  4IUV A;  1NAP A;  1SDF A;  5D65 A;  5EPL A;  5EPK A;  1VMC A;  2L1B A;  1EL0 A;  2M2L A;  1HUN A;  4RAU C;  1WTX A;  2L12 A;  1B2T A;  1U4P A;  1PFN A;  5T1G A;  5EQ0 A;  3FDT A; 
#chains in the Genus database with same CATH topology
 1H9S B;  1EWC A;  5BN5 A;  1R9T B;  3FEW X;  1TKW B;  3G71 A;  1Y8O B;  3HEJ A;  1HFG A;  3B6Y A;  5JAV A;  1YEZ A;  1G6P A;  1B70 B;  1CA5 A;  4EQO A;  4A3F G;  2B39 A;  1B3A A;  5M3M H;  1KXL A;  1EYC A;  4GN5 A;  2TSS A;  4JI4 L;  1CKN B;  4JI1 L;  1B1Z A;  5C4J H;  1HNX Q;  2E74 C;  2WB1 B;  3A8K E;  1U5K A;  1I4H A;  2JQO A;  2AQ1 B;  2H5X A;  4Z9C B;  2OF1 A;  3HG9 A;  1SNO A;  1Y69 U;  3HOZ G;  4FVM A;  1BF4 A;  4KD3 A;  5IT9 E;  4G57 A;  3TQY A;  3JAM i;  3CP0 A;  1IKM A;  4A3C G;  4JW0 A;  5FO9 B;  4RMF A;  2F0I A;  1ZKO A;  2K14 A;  5LMN W;  3OW7 A;  1EY6 A;  1GUT A;  3AU7 A;  4A3K H;  1I6V C;  1SRO A;  3SK6 A;  1A0I A;  2Y0S G;  1XTC D;  3UDF A;  2B63 G;  1D5M C;  2EQS A;  1HQR D;  2NWG A;  2ZT9 C;  2YTX A;  4AQY L;  3X3N A;  2YU9 B;  5C5L A;  3MFY A;  2O4X A;  3RZO H;  5C44 H;  1PXU A;  3MEF A;  1VCI A;  2OWO A;  4GKK L;  3AB9 A;  2EJF C;  5C6A A;  2WB1 E;  1ET9 A;  1PFB A;  2X69 A;  2NZH A;  4H13 C;  4K8I A;  2G9H D;  4R4O A;  2KUM A;  4KLK A;  4ME3 A;  1MBY A;  1YNX A;  3GD7 A;  3I4M H;  1YZ6 A;  3MC0 B;  1QNK A;  2N78 A;  1L1O A;  4R4I A;  1IL8 A;  1STG A;  1KD1 C;  1EY0 A;  4N8X 1;  1ONL A;  4CBV A;  1HNZ Q;  2QF7 A;  4EGV A;  1VF7 A;  2K05 A;  3T56 B;  2UUA Q;  4ZYS A;  4F8M A;  3F8T A;  1LT4 D;  1EQT A;  2JA6 G;  1UWV A;  2PI2 A;  1WTV A;  5IGD A;  4LF6 L;  3S17 H;  4IUV A;  1NAP A;  2C35 B;  4ULL A;  1YBY A;  2F52 A;  5IYD G;  3I55 A;  2OQK A;  1A8V A;  4K14 A;  5LMN L;  1EIH A;  2OEO A;  3FRP B;  4B3R L;  1K73 C;  3KF8 A;  4C3I H;  4BBS H;  4MN3 A;  5J39 A;  1VQO A;  5JPM C;  4X65 Q;  2DJF C;  3KYH C;  1TS2 A;  4UP7 A;  2GN5 A;  3ZYY X;  1B4O A;  3NP8 A;  4HAE A;  1FNU A;  2VUM H;  1JMC A;  3NWS A;  4RWS C;  4PMB A;  4K5W A;  2H1E A;  3FKI H;  3TN2 A;  5FLX E;  2NVX B;  3BZK A;  5BR8 L;  1E1T A;  5D3I B;  1B9N A;  2B2T A;  4MNO A;  2BA1 A;  2PYK A;  3NEL A;  3I4N H;  4F88 A;  2K5N A;  1F77 A;  2WKC A;  2LMC B;  4MIU A;  3IFT A;  1S5F D;  4OIK A;  4A3M B;  2E2H H;  4K8J A;  1U9R A;  1ZYR C;  2Z6K A;  3W3A A;  3J81 j;  3DM1 A;  1Z6H A;  3I70 A;  4MTN A;  2R61 A;  3H0G H;  3HOX B;  1RHP A;  4KY7 A;  3C1F A;  2ASB A;  1CUK A;  1NBW A;  5CV6 A;  1MKH A;  1H9K A;  3J81 E;  1HZA A;  2DY7 A;  2EJG C;  2V4D A;  1CTM A;  4RKL A;  1KIX A;  2EYM A;  2A74 C;  1VQ6 A;  4NW2 A;  5IWA L;  4CHT B;  3E9I A;  3P7J A;  1W6J A;  1SEB D;  1LAB A;  2EYP A;  2A69 C;  3MFG A;  5IIF A;  1PYW D;  2CWP A;  4HJA A;  2AQ2 B;  1C7Y A;  3BJU A;  4HTH A;  1UNS A;  3JC6 6;  3OIP A;  3IKJ A;  5C4X B;  3S15 B;  3CCS A;  3URY A;  3S1M H;  3I4L A;  3MVV A;  3TS2 A;  2WAC A;  2NVQ B;  1YNN C;  1EIY B;  1E2Z A;  1BXT A;  2F4V L;  3NTI A;  5KNC A;  3BVZ A;  2K5Q A;  4OX9 L;  4IPG A;  3MXG A;  3EJI A;  3NPP A;  4DA2 A;  4DAM A;  3FDT A;  5EGT A;  2VQE Q;  1EOV A;  1PVO A;  5FOB B;  2K01 A;  1VQB A;  4CGY B;  1K83 H;  4RHR A;  1WCM H;  1OXS C;  3U4V A;  3GTG B;  1BVS A;  4LJZ C;  1LTA D;  1X54 A;  1HRJ A;  4DV2 Q;  4ZUJ A;  3KF8 B;  4C3H G;  1EYA A;  3CC2 A;  5EKL A;  3CME A;  1IBK Q;  1N34 L;  1QUQ A;  4L5R C;  3GTQ H;  3UDI A;  1Q8K A;  2F0D A;  4DK6 C;  5JEA G;  3CC4 A;  3FPP A;  2F3I A;  2R92 H;  2CKZ B;  3A55 A;  5DNF A;  2UXC L;  1E0B A;  2VY3 A;  1X3Q A;  4MTK A;  5GAD C;  4BY7 H;  1FD7 D;  5CV7 A;  4KHP L;  1TS5 A;  1EIG A;  3K5N A;  4DR3 L;  1OO9 B;  4DV4 Q;  4A3E B;  3ZJY C;  2EY6 A;  3HOW B;  3S1Q B;  1SYD A;  4P2C B;  4BBR H;  4EVO A;  5JJL A;  2WFW A;  3JAM E;  1CFM A;  2EYJ A;  4M8A A;  2KJX A;  3X3M A;  2YTY A;  3G4S A;  3Q22 A;  1HZC A;  2B2W A;  4C1N I;  2F0L A;  1IL2 A;  1QVC A;  1W3S A;  3CF5 A;  1PRT D;  5I9P A;  1TWG B;  3RLF A;  3U4Z A;  1VQG A;  1EY7 A;  2F0U A;  1K3B C;  4A3D H;  3H3V H;  4BS9 A;  2F0P A;  2TMP A;  1WFQ A;  3HOU H;  2B2Y A;  1G51 A;  4DUZ L;  4R4Q A;  1CK1 A;  5EKK A;  1JB7 A;  2KHJ A;  1KDA A;  3T1H L;  1GVP A;  1X65 A;  2BA0 A;  3MZ5 A;  1QZH A;  2WAQ B;  4G7Z C;  3QR8 A;  1HR0 Q;  2F0W A;  4JI0 Q;  2RDH A;  2ICE C;  1LTT D;  4RH6 A;  1EQQ A;  1KAW A;  1VQM A;  3T1Y Q;  1VQJ A;  4EX5 A;  4A3G B;  4HJ5 A;  3K0X A;  3WDN A;  1EWH A;  1A62 A;  3K80 C;  2AUK A;  3M4P A;  5JEA J;  3TSS A;  1JWU D;  2O5J C;  4RCN A;  3GTL H;  4DXF A;  2F0T A;  4QL5 A;  4DR4 L;  4A3B B;  4DR7 L;  5C3E B;  5J3B A;  2E8G A;  4NMZ A;  3LX0 A;  5C3X A;  1G6Z A;  2V1C C;  4JK1 C;  1GUO A;  3SGI A;  3M3Y B;  4DV0 Q;  4L5Q A;  1AE2 A;  4JYA L;  1Q1E A;  4KTA A;  2L4N A;  4TKO B;  1KL9 A;  4A3I G;  2NVY H;  2IJ0 A;  2VL6 A;  1E24 A;  5M5Y B;  1WI5 A;  3TRE A;  1IW7 D;  2WKD A;  2ALY B;  4ZK9 B;  1XJV A;  4LFC L;  1HQM C;  3MTS A;  5JVH 3;  1RTN A;  2FMC A;  4DAY A;  2CW0 D;  4ODG A;  3AMU A;  1NTG A;  4ALP A;  2VQF Q;  1E3P A;  3QIA A;  3SE0 A;  5DEH A;  3P75 A;  2UXB L;  1QUQ B;  4MHE A;  4DK0 A;  4A3J H;  4DV7 L;  1N36 Q;  4K0K Q;  2QEJ C;  1XMQ L;  2EJM A;  4FP5 D;  1EYG A;  2D62 A;  2PO4 A;  3HOY B;  4BXX G;  1CM9 A;  4JV5 Q;  4YHH Q;  4LF8 Q;  3EA6 A;  3L7Z C;  4WFN 3;  2F0K A;  3OTO L;  1RDP D;  5D14 A;  4J6H A;  1SMY C;  4GOP A;  3VYT A;  2KA7 A;  4QUC A;  1EU3 A;  2A19 A;  3FHW A;  5FLX c;  3QWN A;  1D7Q A;  3IRB A;  1K8G A;  3BU2 A;  3CRL C;  2F0V A;  3TBI B;  2K5D A;  1VQE A;  3U58 A;  2L55 A;  4GLX A;  1XX8 A;  1PV4 A;  3CU7 A;  1I4X A;  1PH2 A;  3GTP H;  1M8A A;  3V96 A;  5T1I A;  2Q8T A;  5M3M B;  3WOF A;  2NZO A;  5ISR A;  1WTH A;  5EPJ A;  4HCS A;  4A3E G;  4JC0 A;  5C4J B;  2XRS D;  4QY7 A;  1K8A C;  2EIF A;  3CCU A;  4LMQ D;  2B2V C;  1JJ2 A;  1VQA A;  2BDO A;  2QIL A;  4LFA Q;  3SHL A;  1A3T A;  4IUN A;  2ZJR A;  2K5V A;  2MFI A;  3K5O A;  2DNC A;  5IYB G;  3J7A 5;  4A3F B;  3KDF A;  2E2J H;  3BDC A;  4A3K B;  1PHJ A;  1UUP A;  1QWY A;  1YJ9 A;  1NSN S;  4CDD C;  5CV5 A;  3TEH B;  1V1Q A;  2BH8 A;  4FF2 A;  2GVA A;  4NXN L;  3WOE A;  1XYI A;  1KAB A;  1YNJ D;  3GTJ H;  4OHJ A;  1CKO A;  1X32 A;  5F2D A;  1R4P B;  2OCE A;  3MHB A;  2UU9 L;  2WAQ G;  3RZO B;  1LTB D;  5C44 B;  3CCE A;  4A4I A;  3F2D A;  3A74 A;  1PMR A;  1SYB A;  4A3L H;  1H95 A;  4A3G G;  1EY9 A;  4DUY L;  2CFM A;  4JBK A;  4CJ2 C;  1VF5 C;  3TRZ A;  2EXZ A;  3DEO A;  3HKZ E;  2FXQ A;  4C2M H;  4L8J A;  5FLM H;  3MEH A;  1YHQ A;  1LTG D;  4A3B G;  3CXC A;  5C3E G;  3FVQ A;  1PH3 A;  2BOS A;  3D4W A;  1DCZ A;  4U68 A;  2B63 B;  1A3U A;  3M4O H;  4DAY B;  3M4Y A;  5IY0 A;  1WOC A;  4FDB A;  2M00 A;  5C0X H;  1J5E L;  2R3Z A;  5ELC A;  5A35 A;  1U4L A;  3GTK H;  2QDL A;  4B3S Q;  3NHH A;  4LAA A;  1FGB D;  1ILQ A;  4RGM A;  4DV1 L;  3EFX D;  3K5L A;  4JVZ A;  5C4Z A;  5AFW A;  1ZXT A;  2B8F A;  1B8A A;  4OXP A;  4OL7 A;  1NR2 A;  1RJT A;  2ZJP A;  1JWS D;  3QOJ A;  3A8J E;  4B3T Q;  4UAI A;  1AFP A;  1CQV A;  1TWF H;  4QCL A;  2YV5 A;  2J4X A;  2JA7 H;  4PG3 A;  1D6E C;  2FMM A;  5H1S E;  1HPC A;  2VUM B;  1S5D D;  3SK5 A;  4GOP B;  2IX3 A;  4YCU A;  2JA6 B;  4A75 A;  3KLS X;  4DNI A;  2Y0S E;  4R4T A;  1RF2 D;  1EFW A;  3HRZ C;  3HOY G;  2FHT A;  3I4N B;  4JI6 L;  2JP1 A;  3S24 A;  1SE2 A;  4L5T A;  3K57 A;  3SK4 A;  4FXK C;  1Z7T A;  4XIG S;  2EPB A;  1L0W A;  4JI2 Q;  5IYC H;  4B3M L;  2E2H B;  2PNR C;  2K5H A;  3GTO H;  2F0Q A;  3J7Z C;  4F87 A;  3RR5 A;  2O5I C;  1PZI D;  1AE3 A;  3A7L A;  1C48 A;  2X6L A;  5TSS A;  3AEV A;  4DR6 Q;  4UHV A;  3H0G B;  5NUC A;  3DXJ C;  3PGZ A;  3RMH A;  1BO0 A;  1SYG A;  3J80 L;  2OT2 A;  1HA5 A;  4H44 C;  5AJ3 L;  5M3M G;  1EY4 A;  4IQZ A;  1JOQ A;  5LMU Q;  1JWM D;  2L11 A;  1N33 L;  3KDF B;  4JCV E;  3VYR A;  3VYU A;  3I2Z A;  3NTK A;  4DR5 L;  2DJG C;  3OOC A;  4KN7 C;  3RLO A;  1EYD A;  3GP7 A;  2JYO A;  2LXK A;  4FF1 A;  1K3R A;  1LAC A;  2BDN A;  4P73 A;  2HT1 A;  1D5X C;  2K6A A;  3BVM A;  5M5X H;  1K9M C;  2B2T C;  2Z6B A;  4XYO A;  1XNQ L;  1G91 A;  1ENF A;  4A3K G;  1V43 A;  2KCM A;  3DUZ A;  3BDL A;  3S1M B;  2KEE A;  1XPU A;  1SNP A;  1HTP A;  1GXD C;  3OHX C;  3ONA B;  5E4W C;  2AQ3 B;  1TWH H;  2Z6K C;  4G7O C;  3GO5 A;  3TZU A;  1UE1 A;  4YY3 L;  4LNQ A;  4CJ0 B;  1X3G A;  4K6L A;  2KHS A;  2JXM B;  5C44 G;  3V05 A;  3ULL A;  2KCT A;  3RZD H;  3T13 A;  1NJI C;  4JI4 Q;  4J1M A;  5CV8 A;  2RCN A;  4R4C A;  1GHJ A;  3TP7 A;  4YWK A;  4HMI A;  1K83 B;  1WCM B;  3W1B A;  4YIJ A;  3GV3 A;  1CA6 A;  1FVI A;  4JI7 L;  3I4M G;  1G8Z D;  2ENB A;  2D0O A;  2JN4 A;  1TXY A;  3CCV A;  2Q2I A;  2ICI A;  1FR3 A;  4IUU A;  2IL8 A;  5K36 H;  2KEC A;  2DY8 A;  3W2D A;  4NB3 A;  1QOH A;  2HQL A;  4CDE C;  2ES2 A;  3HGB A;  3GTQ B;  1U4R A;  4XT3 B;  4X66 L;  4BY1 H;  4DN4 M;  2KCC A;  3D4D A;  4GNX A;  2BCO A;  1LLR D;  1R4Q B;  2MO0 A;  4PV1 C;  5EPK A;  3SR1 A;  4RAU C;  3U9O A;  4C3I G;  2MO1 A;  4GKK Q;  4BBS G;  1EFI D;  4QB4 A;  5CV4 A;  2YYZ A;  4BBR B;  3QJY A;  3I7F A;  4IUQ A;  1O80 A;  2CCZ A;  1GO3 E;  1TY2 A;  5J22 A;  4X64 L;  1FGU A;  3OW2 A;  1Y8P B;  1YJN A;  4IFD H;  4C3H B;  2VUM G;  3QO2 A;  1E1O A;  1EY5 A;  2F0F A;  3OYY A;  4HID A;  4MZ9 A;  2K28 A;  4QGU A;  4FO2 A;  2MPM A;  1VDZ A;  3FKI G;  2LFN A;  1Z47 A;  1HNZ L;  1QCB D;  1S3O A;  5DM7 3;  4UPA A;  2IW3 A;  2HQE A;  2ZM6 L;  1ML0 D;  2WII B;  3T53 B;  1XMO Q;  3I4N G;  1VQP A;  1UEA B;  4X3K A;  3KBX A;  1XWE A;  4IPD A;  2MQH A;  4TQU S;  4LF6 Q;  3HOU B;  5K5P A;  3F2C A;  4A93 H;  1J6Q A;  2EE1 A;  4CKC A;  3GQB A;  1RKN A;  5LMN Q;  4OO1 H;  1DON A;  4YCV A;  4B3R Q;  4J8Q A;  2R93 H;  2YTV A;  3K8A A;  1LM0 A;  4IZ8 A;  4Q0F A;  5CYU A;  2LS0 1;  3H0G G;  2KVM A;  1X55 A;  1HA6 A;  3NUC A;  2E2D C;  2A1A A;  1CT1 D;  2AUJ D;  2EXD A;  4YCW A;  2NTT A;  2PPB C;  3F2U A;  4X65 L;  3KLR A;  5M5W B;  4FNF A;  3GTM H;  3S16 H;  3OSO A;  4NXM Q;  4QQB X;  2A6H C;  1RCV D;  4KKS A;  3GTL B;  4KHV A;  2HUG A;  5CC4 A;  3LWE A;  5BR8 Q;  1HZB A;  3KFU A;  4JPB W;  1PH4 A;  2B2W C;  2PQA A;  3C46 A;  3S2H B;  1TVX A;  2ZXO A;  4DGZ A;  2VB2 X;  1V9P A;  1VQ8 A;  4DXG A;  4NDX A;  1K8M A;  1KDC A;  2NVY B;  1F9S A;  1J9O A;  1I4P A;  1VQN A;  2NUC A;  2ZXP A;  1STA A;  4KY5 A;  4CDC C;  1PTO H;  2A6E D;  4LUV A;  1F2M A;  2B2Y C;  3DWA A;  4DV5 Q;  2F0H A;  2F0M A;  1JE4 A;  3ICE A;  4Y52 H;  5I6W A;  1LTR D;  2A69 D;  5ELE A;  5D65 A;  1MJC A;  3PIO 3;  4K5V A;  4NKL A;  4OWT B;  5IWA Q;  2UXD Q;  4A3J B;  2I07 B;  1WCM G;  4DKA C;  1VQ4 A;  1BOS A;  5HY6 A;  2HIX A;  3U50 C;  3PUX A;  4H02 A;  2R7F A;  4A3I B;  4GNX B;  2EY5 A;  2E2I H;  1C8C A;  4GS3 A;  5IGF A;  3R2T A;  3T4A C;  3I56 A;  4QF4 A;  1EQV A;  2RDG A;  3PF4 A;  2RSN A;  4ZAI A;  4HSP A;  1JOK A;  1XNR L;  1L1O B;  1I3Q H;  4PMC A;  2R92 G;  1STH A;  1SSO A;  1STN A;  1K0R A;  2DN8 A;  1F9Q A;  2KED A;  2RF4 A;  1PH6 A;  2IPK D;  3M7G A;  3MWY W;  4LF7 L;  2F4V Q;  4BY7 G;  3GTP B;  1LT6 D;  2RDF A;  3IL8 A;  4ID6 A;  2VS1 A;  4FF3 A;  4R1J A;  1KQS A;  4C3J H;  2VZA A;  4XQJ A;  4BBR G;  2DGY A;  4DK3 C;  1A2U A;  4Y7N H;  5I9O A;  1STB A;  2D2C C;  2L5T A;  2SDF A;  3G7L A;  1PLF A;  5GQO A;  1WTP A;  1MJE A;  3M4Q A;  3ND8 A;  2OXP A;  2UUC Q;  1Y1W H;  2RHQ B;  1D5Z C;  4S3S A;  3D31 A;  2E2J B;  2F0O A;  3S1N H;  3VR6 A;  3AFP A;  4A3D G;  1CI3 M;  1HR0 W;  3NQT A;  3E3X A;  5ELN A;  1U4M A;  1S40 A;  1OXU A;  4LF4 L;  3HOU G;  4JI5 L;  1EIF A;  4GOP C;  3GTJ B;  2QDB A;  1HFN A;  5LHY 1;  2Q8R E;  2ZTC A;  2I5H A;  2PI2 E;  4PZ6 A;  1YHA A;  3CMA A;  4KHP Q;  4DR3 Q;  3S14 B;  2JE6 I;  1IBL L;  4OWX B;  1F2L A;  1PTO D;  1Q8I A;  3PQI A;  4UP9 A;  1LT5 D;  2B2U A;  1ESF A;  4DV4 L;  2PQA B;  3HS0 C;  3R3O A;  1GHK A;  5IP7 H;  1QNU A;  2N55 A;  2E5L Q;  3CCR A;  3C1E A;  3OWF A;  2ZTE A;  4C2M B;  1HUM A;  3W1G A;  4HIK A;  2F4I A;  2JEA I;  4P72 A;  4N9T A;  1V8Q A;  2L1B A;  2VB3 X;  1CKM A;  1SJE D;  2F3V A;  1WTX A;  3TS0 A;  1UE6 A;  2SNS A;  2LXJ A;  2RCF A;  1PFN A;  5E7N A;  4FYD A;  1CSQ A;  3M4O B;  1BCP D;  1Q1B A;  3T16 A;  1PRT F;  2AHO B;  2GA4 B;  1WD0 A;  4DK1 A;  2G5D A;  3VA5 A;  3GTK B;  4DUZ Q;  1MSG A;  5EBD A;  4LF9 L;  5DM6 3;  2Z9H A;  1EWI A;  1HTL D;  4AYB B;  1AZQ A;  1I94 L;  3E0J A;  5I2X A;  4HCE A;  2QKI C;  1E2W A;  1F2Z A;  1HR0 L;  4JI0 L;  3PIO A;  1HH2 P;  4R8N A;  4O42 A;  3FPU B;  5J1Z A;  3T1Y L;  4WJW A;  1KTK A;  4RGT A;  1J8I A;  3I3C A;  3S2D H;  2NTS A;  3NE5 B;  3IAY A;  4IFD I;  4C1N K;  1JT8 A;  3G6J B;  4OGQ C;  4DR4 Q;  1T5X D;  5COY A;  4DR7 Q;  1QIL A;  3ERS X;  4PZ7 A;  4A3J G;  1HNW Q;  2KOL A;  1WTO A;  2I5L X;  2NVX H;  1C9O A;  1VQ9 A;  3CHB D;  2NBF A;  1G29 1;  1QE6 A;  3CC7 A;  1IBM L;  4IAL A;  4ZKC B;  4N9P A;  2WAQ E;  4DV0 L;  2L0C A;  5KYL A;  2KQ3 A;  1VQL A;  1TWA H;  5CV9 A;  1V1O A;  4JOI A;  1DXM A;  4RA8 A;  3HOV H;  4A3M H;  4ZQ3 A;  4AYB E;  3K59 A;  4HSV A;  4FXD A;  1L2F A;  1BBW A;  2H4O A;  2DNE A;  5EJW A;  3EN2 A;  3M85 A;  1X6O A;  4LFC Q;  4OO1 I;  1PFS A;  1DGS A;  2M9V A;  4PZ8 A;  3HOX H;  3NSW A;  2XVS A;  1U0L A;  1BQQ T;  2XSC A;  4L6T B;  1AP0 A;  1M1K C;  3EQL C;  4LF5 L;  4POF A;  1I50 B;  3ULP A;  3C2P A;  5LL6 S;  5KNB A;  2UUB L;  4DV7 Q;  1XMQ Q;  2A68 D;  2VNU D;  3H6M A;  2NVT H;  1N36 L;  2CW0 C;  1D1K A;  1IKL A;  1GUN A;  4DR1 Q;  3AYH B;  4YHH L;  4LUZ A;  3WWV A;  2R6G A;  1X3E A;  3OTO Q;  5E3F A;  2F1M A;  1EL0 A;  3SK8 A;  2JSO A;  3TP6 A;  1SJH D;  1OXT A;  5A2Q E;  3PUZ A;  1Y8N B;  1TWH B;  3NBH A;  5KYI A;  4ZUI A;  4DR2 L;  2XTI A;  4B9X A;  2NVQ H;  3K7A H;  4FXG C;  4HIM A;  1PH1 A;  4KKU A;  3RZD B;  5G3L D;  3NBI A;  4A3L G;  2HDL A;  4OEL B;  1GUS A;  4X62 L;  4EQP A;  4I65 A;  4QUF A;  5FLM G;  3GTG H;  3EIV A;  3HP3 A;  2VW9 A;  2O2L D;  1TWC H;  2Z4I A;  3UDX A;  5M3F H;  1SE3 A;  2F0S A;  3P20 A;  2PCF B;  1Q81 C;  4HJ9 A;  1EY8 A;  3HZX A;  1WTQ A;  1QZG A;  2ATW A;  1FJG Q;  2HHH L;  2J0T D;  5C0X G;  4BY1 B;  4HMJ A;  5IP9 H;  4DV6 L;  4NXN Q;  1PH7 A;  3A8I E;  2OTJ A;  2ZJQ A;  4KD4 A;  3DWQ A;  4XXE A;  1FL0 A;  4AYB G;  2L9H A;  1KLG D;  5BN4 A;  5L37 A;  1AZP A;  4K5X A;  3TP5 A;  3I4M B;  2BH2 A;  2EZV A;  2IT1 A;  1JB3 A;  3HOW H;  2IX0 A;  2K1B A;  1B50 A;  1F2Y A;  2JA5 H;  2EYF A;  1IHZ A;  4DUY Q;  4DV3 L;  3K6O A;  3DEP A;  2JA7 G;  1S5B D;  1H9J A;  4DAV A;  1YNJ C;  2ZXR A;  5DLQ E;  1TS4 A;  5C4H A;  4R8I A;  1UEB A;  2N3S A;  3S1R H;  1I6H H;  1E2V A;  3PMF A;  1A6X A;  3S17 B;  4GN3 B;  1PA6 A;  2EDG A;  4IPH A;  4XT1 B;  2EYH A;  1EU4 A;  4XQQ A;  1E22 A;  1K0S A;  1N32 L;  2LSS A;  3TZD A;  1M4V A;  4HR7 B;  1J5E Q;  1GUG A;  4C3I B;  5IYC G;  3UE1 A;  4JI3 L;  2MNA A;  4A93 B;  4BBS B;  1YIJ A;  1X3P A;  4LFB Q;  4EQN A;  5FJ8 H;  5IGC A;  3CCM A;  5ELB A;  5EPL A;  2R93 B;  1GM5 A;  4P75 A;  5T1G A;  5EQ0 A;  4GNX C;  1P8L A;  4OWW B;  4KY6 A;  3UDG A;  1DZ1 A;  3DHQ A;  4B3T L;  3VR5 A;  3FKI B;  1II3 A;  2K03 A;  2QEX A;  4IJL A;  1ZEQ X;  3GTM B;  2KBN A;  3PO2 H;  4GKJ Q;  1WJJ A;  1ASY A;  2SNM A;  1L1O C;  3STB D;  4B9W A;  1OTC A;  5JJZ A;  4CDF C;  3H3V I;  3C3L A;  4B08 A;  1IXR A;  3BYT B;  5DAU A;  4BWG B;  1KNE A;  2LY7 A;  2IX1 A;  2EOT A;  1RIP A;  4JI8 L;  3K5M A;  4B3M Q;  2R7Z H;  1X56 A;  2F03 A;  2IHF A;  1OXX K;  1PTO B;  1SNQ A;  2MP1 A;  3KK7 A;  1SFO H;  4DR6 L;  4I7Z C;  3CAM A;  5HGQ A;  1O7Z A;  5CBE E;  1EQR A;  4TSS A;  2HDM A;  1PRT B;  2F0J A;  4PNY A;  1ESR A;  5AJ3 Q;  2SOB A;  1PDQ A;  1Y1V H;  1AN8 A;  4WOR A;  1JJC B;  3OMG A;  1SND A;  1N33 Q;  2JJQ A;  3NEN A;  2BE5 C;  4LUO A;  5KND A;  4IOA A;  1B44 D;  4G4K A;  4GN4 B;  4DR5 Q;  2HCC A;  1VMP A;  4UDU C;  3CKI B;  4RCO A;  5CR3 A;  1BCP B;  1FNW A;  1SNC A;  2K75 A;  3LGJ A;  2AWO A;  2NN6 H;  2MHV A;  1VS0 A;  2ID0 A;  5M9O A;  1LV9 A;  1JIC A;  5K36 G;  4WJ4 A;  4XTC S;  3D3R A;  1Q86 C;  4PMW A;  3L0O A;  4L5S A;  3TDQ A;  1F9R A;  1I3Q B;  3R93 A;  2XWB B;  4KJN A;  4BY1 G;  4UY8 C;  2D9U A;  2NZ1 D;  2AMC B;  5EKI A;  4JI1 Q;  4YY3 Q;  5JOB A;  2JA8 H;  3PSI A;  2N88 A;  1MD2 D;  3NQI A;  1JE5 A;  3R8B A;  1XTD A;  4PQX A;  2IWH A;  1TY0 A;  3HFZ B;  3RLN A;  1HNX L;  2F0G A;  1BBX C;  1BKB A;  4C3J B;  3PO3 H;  3Q24 A;  1UE7 A;  4Y7N B;  5D3D A;  3NXW A;  4JI7 Q;  5IT9 L;  2QA4 A;  3K0Y A;  4IFD G;  1FYC A;  4XDX A;  1VQI A;  4RGO S;  2B8G A;  3H15 A;  1Q7Y C;  3K81 C;  1Y1W B;  3BVG A;  2R92 B;  4C56 C;  5C5M A;  1W2B A;  3A5U A;  3W5O A;  3E0E A;  3PUV A;  5I6Y A;  1SLJ A;  2JA9 A;  3S1N B;  4A3F H;  1PZJ D;  1SBB B;  5IGG A;  1C4Q A;  4AQY Q;  4X66 Q;  1SYF A;  4BY7 B;  1BNZ A;  2LKV A;  4ZLT F;  4A93 G;  1I4Q A;  4L63 B;  1YVC A;  4OO1 G;  3G48 A;  4AH6 A;  3DMU A;  2RSO A;  3PUW A;  1LUZ A;  2HD3 A;  2R93 G;  2K7V A;  4EQ5 A;  1NUC A;  1SN8 A;  4OEM B;  2F0E A;  4DFA A;  3HOZ H;  3VR4 A;  1IZ6 A;  2WIN B;  4X64 Q;  4LK1 C;  2AKW B;  1EZ6 A;  1A63 A;  3BYY B;  1PH8 A;  4ABN A;  4BA2 I;  4A3C H;  1JOO A;  5FO8 B;  3KJO A;  2EYO A;  1BBU A;  1LTI D;  2UUA L;  2XRQ D;  4DU9 A;  4A3D B;  4X3U A;  1T5E A;  1PH9 A;  4AIM A;  1NR4 A;  5JVG 3;  3KUP A;  3RUZ A;  3RN2 A;  2PW7 A;  2ZM6 Q;  5JJI A;  2B63 H;  4KHZ A;  2B3G A;  3I90 A;  4IUP A;  2Z8L A;  3CQZ H;  4G7H C;  1XMO L;  3ND9 A;  3KF6 A;  1JC7 A;  3I4O A;  1KRT A;  1G2S A;  2FFK B;  2MUY A;  5IOD A;  3K7U C;  5GAG C;  1LYL A;  1SE8 A;  1QJO A;  2ZTD A;  4IFD J;  1QB5 D;  3KOJ A;  2A6H D;  5E1F A;  5IE8 A;  1Q82 C;  1MGS A;  4DAP A;  2Q2H A;  1ICF B;  1Q46 A;  2FJ2 A;  5IGB A;  1TQO A;  1Q3L A;  3H09 A;  1STY A;  3MXN A;  2RHS B;  3S2D B;  1ZYR D;  1BUV T;  4K2K A;  5ELF A;  5FLX L;  2OTL A;  2B2U C;  4NXM L;  3RD4 A;  1S72 A;  3T51 B;  2JA6 H;  1O7I A;  2QW7 A;  1X9N A;  2Z0S A;  1MIU A;  2PNH A;  3DLL A;  5C0X I;  1JQY D;  4K2L A;  5IYD H;  5HGT A;  1WYD A;  4WJ3 M;  5GAE C;  1A15 A;  2MJ8 A;  3KBG A;  3FP9 A;  1PYB A;  1TWA B;  3DWP A;  2A73 B;  2WP8 J;  1SXT A;  3HOV B;  1G2T A;  4BA1 I;  1MHW C;  2AWN A;  4ZKB B;  1H9R A;  3BG3 A;  1IYV A;  2JK8 A;  4R9W A;  3J81 L;  2A5H A;  2CQO A;  3E9H A;  4DV5 L;  3D6C A;  3ULJ A;  4RFB A;  4C3J G;  1MI2 A;  1XXG A;  1ASZ A;  3J7A V;  1UE5 A;  1KLU D;  2A6E C;  3TME A;  2WB1 G;  1CHP D;  3CCL A;  1DOK A;  2UXD L;  1YNN D;  2NVT B;  2IHE A;  1Z9F A;  3TP8 A;  4CJ1 B;  1RD9 D;  4JG2 A;  1ENA A;  2D0P A;  1F9P A;  1O7Y A;  2I0Q A;  3EBE A;  1TT2 A;  1R9T H;  1Y1W G;  1TII D;  2PZU A;  3CPF A;  3I91 A;  5CMD A;  1XNR Q;  1KNA A;  3V2T A;  4P71 A;  3NEM A;  5FKA C;  1SAP A;  3J7Y W;  4OX9 Q;  2K5W A;  1YHB A;  4JBJ A;  1LTS D;  4JOI C;  1HZ9 A;  4RHS A;  4LF7 Q;  2XGT A;  4X3T A;  3K7A B;  2VQE L;  5GAH C;  2I46 A;  5EAY A;  4DPG A;  1EUJ A;  3CCJ A;  1NY4 A;  3PCO B;  5GRO A;  3FMC A;  3Q23 A;  1VQ5 A;  1GKH A;  1BR9 A;  4IUR A;  5IP7 G;  1MSH A;  3KF6 B;  3N6R A;  2F3W A;  1PH5 A;  4DV2 L;  1W6K A;  3SDZ A;  1QVG A;  4M1U B;  1N34 Q;  3J80 c;  2KEN A;  4YWM A;  4X3S A;  1TWC B;  2I5M X;  2CWA A;  2NN6 I;  1IBK L;  5JJK A;  1B9M A;  1P16 A;  2K4K A;  3VR3 A;  5M3F B;  4QJF A;  2UUC L;  2UXC Q;  1SDF A;  4GZY C;  2F0N A;  4NPS A;  3MXN B;  1SYE A;  2YU9 H;  4LF4 Q;  3S9W A;  4JI5 Q;  1WVL A;  3UI2 A;  3A0J A;  1D2B A;  1B53 A;  3KLW A;  3MXP A;  1SNM A;  2N8N A;  2RA4 A;  2SEB D;  3JAM L;  1IBL Q;  4IN3 A;  1JR0 D;  4KJO A;  5E4X A;  2Z4H A;  3G6E A;  2JA5 B;  3OMC A;  2K52 A;  2GVB A;  4HIO A;  3Q8D A;  3NTH A;  1PTO F;  2EY2 A;  1PFM A;  2E5L L;  2FIN B;  1ET6 A;  4C3H H;  1T9H A;  1AH9 A;  5LL6 X;  3S1R B;  1I6H B;  1V1P A;  4I7A A;  1PTO C;  1N9W A;  5JEA H;  3I72 A;  5JPN C;  1TS3 A;  1PRT C;  1WTW A;  3T1H Q;  3CPW A;  3ERO A;  3J7A F;  1JOR A;  4DF7 A;  1BCP F;  1I5F A;  4LF9 Q;  3A54 A;  4HJ8 A;  1JCK B;  1PYS B;  4CKE A;  3HOV G;  4A3M G;  3EVQ A;  1TWF B;  5IT9 c;  4KV6 A;  1L0X B;  2WV6 D;  3P1H A;  1NNX A;  1I94 Q;  1BCP C;  2JA7 B;  2X6G A;  1NCV A;  3PIP 3;  2CHB D;  2Q8I B;  5KRU A;  3HOX G;  1DOL A;  3L2P A;  1KRS A;  3J80 i;  3QG1 A;  2NB0 A;  1JJG A;  5M5W H;  3PO2 B;  4KK7 A;  2G9D A;  3H94 A;  1HXY D;  2L15 A;  1C0A A;  1GUW A;  4P74 A;  3D6W A;  2Q2U A;  3LWU A;  4JYA Q;  4NP5 A;  4F7X A;  5KGU A;  3Q0A A;  1CZG A;  1Q90 A;  3BDO A;  3VDY A;  1HNW L;  2XNA C;  4Q5V A;  2PZW A;  1IBM Q;  3GTO B;  1EZ8 A;  3RN5 A;  3S2H H;  2D5D A;  2R7Z B;  1S5C D;  3QOL A;  1VQ7 A;  4V0B A;  1TU2 B;  5IOC A;  3PF5 A;  2PMZ B;  5KIX A;  1VMC A;  5C4X G;  1HUN A;  2M2L A;  1SFO B;  4HJ7 A;  2EYL A;  2VQF L;  1DJR D;  3KJP A;  2PZT A;  1IW7 C;  3GV6 A;  2UXB Q;  4WRD A;  4GLV B;  3AQQ A;  4J15 A;  2CH4 A;  2VXW A;  1Y1V B;  2J7Z A;  1SMY D;  4IUT A;  4IPC A;  1WD1 A;  1HCZ A;  1AW7 A;  3BZC A;  4LF5 Q;  3VA7 A;  4K0K L;  1O78 A;  1PZK D;  1X3F A;  2K04 A;  2UUB Q;  4JV5 L;  1FNV A;  4LF8 L;  3MA2 B;  5M5X B;  4APV A;  2N49 A;  1M90 C;  1K8O A;  3PV0 A;  2JEB I;  3RNU A;  1SMX A;  2K32 A;  1RL2 A;  4A3I H;  4DR1 L;  2NYZ D;  1NE3 A;  3GDE A;  5C4X H;  5M3F G;  3S15 H;  1EOT A;  1SR3 A;  3OWE B;  4DNT B;  5BN3 A;  4ZCK A;  1GJX A;  2A68 C;  2PQE A;  2RKS A;  2PMZ E;  1WTR A;  1GOZ A;  1S4Z A;  3IFD A;  3A56 A;  2P5Z X;  4FF4 A;  2EVB A;  5IP9 G;  3R2I A;  1BDO A;  4DR2 Q;  2OQ0 A;  5A2Q L;  2MGS A;  5IGE A;  2JA8 B;  1E7Z A;  1SRU A;  1NMF A;  4OIJ A;  5EBC A;  2RVL A;  1GD7 A;  3H3V C;  1YI2 A;  3ERQ A;  3L9A X;  1Q12 A;  1V1P B;  4CKB A;  2RBM A;  1ILP A;  3PO3 B;  3HOW G;  1ROD A;  4BXX H;  1YIT A;  2JA5 G;  2K33 A;  4TVA B;  3CRK C;  5COR A;  1IYU A;  3D8G A;  5G3L F;  4X62 Q;  4LFA L;  5ELD A;  3NK9 A;  1SE4 A;  3E5S A;  4KN4 C;  3HKZ B;  3KLS A;  4KMU C;  3J81 c;  4N8F A;  4GLA C;  1YJW A;  3A5Z B;  1LO5 D;  4KI0 A;  3CW2 C;  1DD2 A;  4QMG A;  3E6Z X;  1I4R A;  2CVR A;  2KCN A;  5CBA E;  1A3V A;  4U67 3;  1HJP A;  1EEF D;  1KDB A;  2HHH Q;  3LNN A;  2UU9 Q;  3U9S A;  4DV6 Q;  1XPO A;  2HIV A;  1FJG L;  3PIP A;  3HKS A;  1VQD A;  4DNR B;  4IJH A;  1B7Y B;  1K28 A;  3H91 A;  4HED A;  4RKB A;  5FJ8 G;  4A3E H;  3S1Q H;  1H9S A;  3F1Z A;  3UE0 A;  1CZW A;  1H9M A;  1IYJ B;  3K58 A;  1ICW A;  1XPR A;  4V19 0;  1DOM A;  1RTO A;  1VQH A;  3DM3 A;  3D0F A;  3S14 H;  1OXV A;  4JBW A;  4O0A A;  2CH4 W;  4UP8 A;  3HOZ B;  4KKT A;  4QIW B;  2K50 A;  2L12 A;  4DV3 Q;  4A76 A;  1B2T A;  1U4P A;  3ER0 A;  3MXU A;  5FO7 B;  4RG1 A;  1SYC A;  5FK9 C;  3CCQ A;  3PO2 G;  1LT3 D;  1TWG H;  2C5C A;  5I4D A;  1CKN A;  5IYB H;  1KHI A;  2B29 A;  1ENC A;  3VR2 A;  4E6I A;  1UAP A;  4POG A;  4H0L C;  4OON A;  2Y0S B;  3L3O C;  4LW1 A;  2QCP X;  5I2Y A;  4XYQ A;  4DV1 Q;  3CQZ B;  1D1I A;  4B3S L;  1N32 Q;  4O1N A;  3O13 A;  1VQF A;  2EY1 A;  4JI3 Q;  1TR5 A;  3I73 A;  1CSP A;  3OPO A;  2R7Z G;  4ILW A;  2IY5 B;  4H7B A;  3F2B A;  1DYQ A;  2KHI A;  2C9O A;  3QB3 A;  4LFB L;  1N8R C;  1Y14 B;  1AEX A;  4A3G H;  2A8V A;  3SVM A;  1B3Q A;  3S16 B;  1NMG A;  1QG7 A;  4QIW E;  1VQC A;  5C0X J;  1Y1V G;  1D8L A;  2R7D A;  1EEI D;  4A3B H;  1STE A;  5C3E H;  3BZD B;  1L0Y B;  3J81 i;  2DUD A;  4JI6 Q;  3NBH B;  3ITP A;  1A2T A;  2XWJ B;  3Q6S A;  4GKJ L;  4ZRZ A;  3M3Y H;  1QVF A;  4LWC A;  4ME5 A;  2PW5 A;  2Q2T A;  2XIW A;  5HUR A;  3AFQ A;  4JI2 L;  2NN6 G;  3JAM c;  3M7N A;  2QGQ A;  4JI8 Q;  1CHQ D;  5M5Y H;  1DM0 B;  3STB C;  2XN9 C;  3MAQ A;  4JBM A;  1O7L A;  4XQN A;  2CQA A;  3J80 E;  1HHV A;  4RGN A;  3I8Z A;  1KC8 C;  2E76 C;  4X6A H;  2B2V A;  2BE5 D;  1LTL A;  2HCI A;  4IOC A;  4K6D A;  2E75 C;  3A7A B;  5C3W A;  3VYS A;  5CGK A;  5LMU L;  2JA8 G;  4IO9 A;  1I4G A;  4O2D A;  4YWL A;  4TRD A;  3NWT A;  1CQF A;  3CD6 A;  3N52 A;  3SEB A;  3M9B A;  3BS1 A;  3PO3 G;  3HOY H;  2E2I B;  1I50 H;  5ELO A;  3OIQ A;  5KEE A;  2Z1C A;  3PUY A;  3SXH A;  3D4R A;  1XNQ Q;  2RQX A;  1KAA A;  4HN7 A;  1S5E D;  1VQK A;  3HKZ G; 
#chains in the Genus database with same CATH homology
 1H9S B;  1EWC A;  5BN5 A;  1R9T B;  3FEW X;  1TKW B;  1Y8O B;  3HEJ A;  1HFG A;  5JAV A;  1CA5 A;  4EQO A;  2B39 A;  1B3A A;  1EYC A;  2TSS A;  1B1Z A;  2E74 C;  2WB1 B;  3A8K E;  1I4H A;  2AQ1 B;  4Z9C B;  2OF1 A;  3HG9 A;  1SNO A;  1Y69 U;  4FVM A;  1BF4 A;  4KD3 A;  5IT9 E;  4G57 A;  1IKM A;  5FO9 B;  2F0I A;  1ZKO A;  3OW7 A;  1EY6 A;  1GUT A;  3AU7 A;  1I6V C;  3SK6 A;  1XTC D;  1D5M C;  1HQR D;  2NWG A;  2ZT9 C;  3X3N A;  2YU9 B;  5C5L A;  3MFY A;  2O4X A;  1PXU A;  1VCI A;  3AB9 A;  2EJF C;  5C6A A;  1ET9 A;  1PFB A;  2X69 A;  4H13 C;  4K8I A;  2G9H D;  2KUM A;  1MBY A;  3GD7 A;  3MC0 B;  1QNK A;  1IL8 A;  1STG A;  1EY0 A;  1ONL A;  4CBV A;  2QF7 A;  4EGV A;  1VF7 A;  2K05 A;  3T56 B;  4ZYS A;  4F8M A;  1LT4 D;  1EQT A;  1WTV A;  5IGD A;  4IUV A;  1NAP A;  4ULL A;  4K14 A;  1EIH A;  2OEO A;  3FRP B;  3KF8 A;  4MN3 A;  5J39 A;  5JPM C;  1TS2 A;  3ZYY X;  1B4O A;  3NP8 A;  4HAE A;  1FNU A;  3NWS A;  4RWS C;  4PMB A;  4K5W A;  2H1E A;  3TN2 A;  5FLX E;  2NVX B;  5D3I B;  1B9N A;  2B2T A;  2BA1 A;  2PYK A;  4F88 A;  1F77 A;  2WKC A;  2LMC B;  4MIU A;  3IFT A;  1S5F D;  4OIK A;  4A3M B;  4K8J A;  1U9R A;  1ZYR C;  3W3A A;  3DM1 A;  1Z6H A;  3I70 A;  2R61 A;  3HOX B;  1RHP A;  4KY7 A;  3C1F A;  5CV6 A;  1H9K A;  3J81 E;  2EJG C;  2DY7 A;  2V4D A;  1CTM A;  4RKL A;  2EYM A;  2A74 C;  4NW2 A;  4CHT B;  3P7J A;  1W6J A;  1SEB D;  1LAB A;  2EYP A;  2A69 C;  3MFG A;  5IIF A;  1PYW D;  2AQ2 B;  4HTH A;  1UNS A;  3OIP A;  3IKJ A;  5C4X B;  3S15 B;  3URY A;  3I4L A;  3MVV A;  2WAC A;  2NVQ B;  1YNN C;  1E2Z A;  1BXT A;  3NTI A;  5KNC A;  3BVZ A;  2K5Q A;  3MXG A;  3EJI A;  3NPP A;  4DA2 A;  3FDT A;  5EGT A;  5FOB B;  2K01 A;  4CGY B;  4RHR A;  1OXS C;  3GTG B;  4LJZ C;  1LTA D;  1HRJ A;  4ZUJ A;  4C3H G;  1EYA A;  5EKL A;  2F0D A;  5JEA G;  3FPP A;  3A55 A;  5DNF A;  1E0B A;  1X3Q A;  1FD7 D;  5CV7 A;  1TS5 A;  1EIG A;  3K5N A;  1OO9 B;  4A3E B;  3HOW B;  2EY6 A;  3S1Q B;  1SYD A;  4P2C B;  4EVO A;  3JAM E;  1CFM A;  2EYJ A;  4M8A A;  2KJX A;  3X3M A;  3Q22 A;  2B2W A;  4C1N I;  2F0L A;  1PRT D;  5I9P A;  1TWG B;  3RLF A;  1EY7 A;  2F0U A;  4BS9 A;  2F0P A;  2TMP A;  2B2Y A;  1CK1 A;  5EKK A;  1KDA A;  2BA0 A;  3MZ5 A;  2WAQ B;  4G7Z C;  2F0W A;  2RDH A;  2ICE C;  1LTT D;  4RH6 A;  4A3G B;  3WDN A;  1EWH A;  2AUK A;  5JEA J;  3TSS A;  1JWU D;  2O5J C;  4RCN A;  4DXF A;  2F0T A;  4A3B B;  5C3E B;  4NMZ A;  3LX0 A;  5C3X A;  1G6Z A;  4JK1 C;  1GUO A;  3M3Y B;  1Q1E A;  4KTA A;  2L4N A;  4TKO B;  2IJ0 A;  5M5Y B;  1IW7 D;  2WKD A;  4ZK9 B;  1HQM C;  3MTS A;  5JVH 3;  1RTN A;  2FMC A;  4DAY A;  2CW0 D;  4ODG A;  3AMU A;  3QIA A;  3SE0 A;  5DEH A;  3P75 A;  4MHE A;  4DK0 A;  2QEJ C;  2EJM A;  4FP5 D;  2D62 A;  2PO4 A;  3HOY B;  1CM9 A;  3EA6 A;  3L7Z C;  4WFN 3;  2F0K A;  1RDP D;  5D14 A;  4J6H A;  1SMY C;  3VYT A;  2KA7 A;  4QUC A;  1EU3 A;  3QWN A;  3CRL C;  2F0V A;  3TBI B;  2K5D A;  2L55 A;  1XX8 A;  3CU7 A;  1I4X A;  1M8A A;  3V96 A;  5T1I A;  2Q8T A;  5M3M B;  3WOF A;  5ISR A;  5EPJ A;  4HCS A;  5C4J B;  2XRS D;  4LMQ D;  2B2V C;  2BDO A;  2QIL A;  3SHL A;  1A3T A;  4IUN A;  3K5O A;  2DNC A;  4A3F B;  3BDC A;  4A3K B;  1UUP A;  1QWY A;  1NSN S;  5CV5 A;  4FF2 A;  1XYI A;  3WOE A;  1KAB A;  1YNJ D;  4OHJ A;  1X32 A;  5F2D A;  1R4P B;  3MHB A;  3RZO B;  1LTB D;  5C44 B;  1PMR A;  1SYB A;  1EY9 A;  4CJ2 C;  1VF5 C;  2EXZ A;  3DEO A;  4L8J A;  3MEH A;  1LTG D;  3FVQ A;  2BOS A;  3D4W A;  1DCZ A;  4U68 A;  2B63 B;  1A3U A;  3M4Y A;  2M00 A;  5C0X H;  2R3Z A;  5ELC A;  5A35 A;  1U4L A;  3NHH A;  4LAA A;  1FGB D;  1ILQ A;  4RGM A;  3EFX D;  3K5L A;  5C4Z A;  5AFW A;  1ZXT A;  2B8F A;  4OL7 A;  1NR2 A;  1RJT A;  1JWS D;  3QOJ A;  3A8J E;  4UAI A;  1AFP A;  1CQV A;  4QCL A;  2J4X A;  1D6E C;  2FMM A;  1HPC A;  2VUM B;  1S5D D;  3SK5 A;  2IX3 A;  2JA6 B;  3KLS X;  1RF2 D;  3HRZ C;  2FHT A;  3I4N B;  2JP1 A;  1SE2 A;  3K57 A;  3SK4 A;  4FXK C;  1Z7T A;  4XIG S;  2EPB A;  2E2H B;  2PNR C;  2F0Q A;  4F87 A;  2O5I C;  1PZI D;  3A7L A;  1C48 A;  2X6L A;  5TSS A;  3H0G B;  5NUC A;  3DXJ C;  3RMH A;  1BO0 A;  1SYG A;  3J80 L;  2OT2 A;  1HA5 A;  4H44 C;  1EY4 A;  4IQZ A;  1JOQ A;  1JWM D;  2L11 A;  3VYR A;  3VYU A;  3NTK A;  3OOC A;  4KN7 C;  1EYD A;  3GP7 A;  2JYO A;  4FF1 A;  1LAC A;  2BDN A;  1D5X C;  2K6A A;  3BVM A;  2B2T C;  4XYO A;  1G91 A;  1ENF A;  1V43 A;  3DUZ A;  3BDL A;  3S1M B;  2KEE A;  1SNP A;  1HTP A;  1GXD C;  3OHX C;  3ONA B;  5E4W C;  2AQ3 B;  4G7O C;  3GO5 A;  3TZU A;  4CJ0 B;  4K6L A;  2KHS A;  2JXM B;  3V05 A;  3T13 A;  4J1M A;  5CV8 A;  1GHJ A;  3TP7 A;  4HMI A;  1K83 B;  1WCM B;  4YIJ A;  3GV3 A;  1CA6 A;  1G8Z D;  2ENB A;  2ICI A;  1FR3 A;  4IUU A;  2IL8 A;  5K36 H;  2KEC A;  2DY8 A;  3W2D A;  1QOH A;  3HGB A;  3GTQ B;  1U4R A;  4XT3 B;  4DN4 M;  2KCC A;  3D4D A;  2BCO A;  1LLR D;  1R4Q B;  4PV1 C;  5EPK A;  3SR1 A;  4RAU C;  3U9O A;  4C3I G;  1EFI D;  4QB4 A;  5CV4 A;  2YYZ A;  4BBR B;  3QJY A;  4IUQ A;  1O80 A;  1TY2 A;  5J22 A;  1Y8P B;  4IFD H;  4C3H B;  3QO2 A;  1EY5 A;  2F0F A;  2K28 A;  4FO2 A;  2MPM A;  1VDZ A;  2LFN A;  1Z47 A;  1QCB D;  5DM7 3;  2IW3 A;  2HQE A;  1ML0 D;  2WII B;  3T53 B;  1UEA B;  4X3K A;  3KBX A;  1XWE A;  4TQU S;  3HOU B;  5K5P A;  2EE1 A;  4CKC A;  3GQB A;  1RKN A;  4OO1 H;  1DON A;  4J8Q A;  4IZ8 A;  4Q0F A;  5CYU A;  2LS0 1;  2KVM A;  1HA6 A;  3NUC A;  2E2D C;  2AUJ D;  1CT1 D;  2NTT A;  2PPB C;  3F2U A;  3KLR A;  5M5W B;  4FNF A;  3OSO A;  2A6H C;  1RCV D;  4KKS A;  3GTL B;  4KHV A;  2HUG A;  5CC4 A;  3LWE A;  2B2W C;  3C46 A;  3S2H B;  1TVX A;  2ZXO A;  4DGZ A;  2VB2 X;  4DXG A;  4NDX A;  1K8M A;  1KDC A;  2NVY B;  1F9S A;  1J9O A;  1I4P A;  2NUC A;  2ZXP A;  1STA A;  4KY5 A;  1PTO H;  2A6E D;  1F2M A;  2B2Y C;  3DWA A;  2F0H A;  2F0M A;  1JE4 A;  5I6W A;  1LTR D;  2A69 D;  5ELE A;  5D65 A;  3PIO 3;  4K5V A;  4NKL A;  4A3J B;  2I07 B;  1BOS A;  3PUX A;  4A3I B;  2EY5 A;  1C8C A;  5IGF A;  3R2T A;  3T4A C;  4QF4 A;  1EQV A;  2RDG A;  2RSN A;  4ZAI A;  4HSP A;  1JOK A;  4PMC A;  1STH A;  1SSO A;  1STN A;  2DN8 A;  1F9Q A;  2KED A;  2IPK D;  3M7G A;  3MWY W;  3GTP B;  1LT6 D;  2RDF A;  3IL8 A;  4ID6 A;  4FF3 A;  4XQJ A;  1A2U A;  5I9O A;  1STB A;  2D2C C;  2L5T A;  2SDF A;  3G7L A;  1PLF A;  1WTP A;  3ND8 A;  2OXP A;  1D5Z C;  4S3S A;  3D31 A;  2E2J B;  2F0O A;  3VR6 A;  1CI3 M;  3NQT A;  1U4M A;  1OXU A;  3GTJ B;  2QDB A;  1HFN A;  5LHY 1;  2Q8R E;  3S14 B;  2JE6 I;  1F2L A;  1PTO D;  1Q8I A;  1LT5 D;  2B2U A;  1ESF A;  3HS0 C;  3R3O A;  1GHK A;  1QNU A;  2N55 A;  3C1E A;  3OWF A;  4C2M B;  1HUM A;  2F4I A;  2JEA I;  4N9T A;  1V8Q A;  2L1B A;  2VB3 X;  1SJE D;  2F3V A;  1WTX A;  2SNS A;  4FYD A;  1PFN A;  3M4O B;  1BCP D;  1Q1B A;  3T16 A;  1PRT F;  2GA4 B;  1WD0 A;  4DK1 A;  3VA5 A;  3GTK B;  1MSG A;  5EBD A;  5DM6 3;  1HTL D;  4AYB B;  1AZQ A;  3E0J A;  5I2X A;  4HCE A;  2QKI C;  1E2W A;  1F2Z A;  4R8N A;  4O42 A;  3FPU B;  5J1Z A;  4WJW A;  1KTK A;  4RGT A;  1J8I A;  3I3C A;  2NTS A;  3NE5 B;  3IAY A;  4IFD I;  4C1N K;  3G6J B;  4OGQ C;  1T5X D;  5COY A;  1QIL A;  2KOL A;  1WTO A;  3CHB D;  2NBF A;  1G29 1;  1QE6 A;  4IAL A;  4ZKC B;  4N9P A;  2L0C A;  5KYL A;  2KQ3 A;  5CV9 A;  1V1O A;  4RA8 A;  1DXM A;  4ZQ3 A;  3K59 A;  4HSV A;  4FXD A;  2H4O A;  2DNE A;  5EJW A;  3M85 A;  4OO1 I;  2M9V A;  3NSW A;  2XVS A;  1BQQ T;  2XSC A;  4L6T B;  1AP0 A;  3EQL C;  1I50 B;  3C2P A;  5LL6 S;  5KNB A;  2A68 D;  2VNU D;  3H6M A;  2CW0 C;  1D1K A;  1IKL A;  1GUN A;  2R6G A;  5E3F A;  2F1M A;  1EL0 A;  3SK8 A;  2JSO A;  3TP6 A;  1SJH D;  1OXT A;  5A2Q E;  3PUZ A;  1Y8N B;  1TWH B;  3NBH A;  5KYI A;  4ZUI A;  4B9X A;  4FXG C;  4KKU A;  3RZD B;  5G3L D;  3NBI A;  2HDL A;  1GUS A;  4EQP A;  4I65 A;  4QUF A;  3HP3 A;  2O2L D;  2Z4I A;  1SE3 A;  2F0S A;  3P20 A;  2PCF B;  1EY8 A;  3HZX A;  1WTQ A;  2J0T D;  5C0X G;  4BY1 B;  4HMJ A;  3A8I E;  4KD4 A;  3DWQ A;  4XXE A;  2L9H A;  1KLG D;  5BN4 A;  1AZP A;  4K5X A;  3TP5 A;  3I4M B;  2EZV A;  2IT1 A;  1JB3 A;  2IX0 A;  2K1B A;  1B50 A;  1F2Y A;  2EYF A;  1IHZ A;  3K6O A;  3DEP A;  1S5B D;  1H9J A;  4DAV A;  1YNJ C;  2ZXR A;  1TS4 A;  5C4H A;  4R8I A;  1E2V A;  3PMF A;  1A6X A;  3S17 B;  2EDG A;  4XT1 B;  2EYH A;  1EU4 A;  4XQQ A;  3TZD A;  1M4V A;  4HR7 B;  1GUG A;  4C3I B;  4A93 B;  4BBS B;  1X3P A;  4EQN A;  5IGC A;  5ELB A;  5EPL A;  2R93 B;  5T1G A;  5EQ0 A;  4KY6 A;  1DZ1 A;  3DHQ A;  3VR5 A;  3FKI B;  1II3 A;  2K03 A;  3GTM B;  1ZEQ X;  2SNM A;  4B9W A;  5JJZ A;  3C3L A;  4B08 A;  3BYT B;  5DAU A;  4BWG B;  1KNE A;  2LY7 A;  2IX1 A;  2EOT A;  3K5M A;  2F03 A;  1OXX K;  1PTO B;  1SNQ A;  2MP1 A;  3KK7 A;  4I7Z C;  1O7Z A;  5CBE E;  4TSS A;  2HDM A;  4PNY A;  1PRT B;  2F0J A;  1ESR A;  2SOB A;  1PDQ A;  1AN8 A;  4WOR A;  3OMG A;  1SND A;  2BE5 C;  5KND A;  1B44 D;  4G4K A;  2HCC A;  1VMP A;  4UDU C;  3CKI B;  4RCO A;  5CR3 A;  1BCP B;  1FNW A;  1SNC A;  2AWO A;  2NN6 H;  2MHV A;  2ID0 A;  5M9O A;  1LV9 A;  1JIC A;  5K36 G;  4XTC S;  3D3R A;  4PMW A;  3TDQ A;  1F9R A;  1I3Q B;  3R93 A;  2XWB B;  4KJN A;  2D9U A;  2NZ1 D;  5EKI A;  5JOB A;  2N88 A;  1MD2 D;  3NQI A;  3R8B A;  4PQX A;  2IWH A;  1TY0 A;  2F0G A;  1BBX C;  4C3J B;  3Q24 A;  4Y7N B;  5D3D A;  3NXW A;  5IT9 L;  3K0Y A;  4IFD G;  1FYC A;  4XDX A;  4RGO S;  2B8G A;  1Y1W B;  3BVG A;  2R92 B;  4C56 C;  5C5M A;  3PUV A;  5I6Y A;  3S1N B;  1PZJ D;  1SBB B;  5IGG A;  1C4Q A;  1SYF A;  4BY7 B;  1BNZ A;  2LKV A;  4ZLT F;  1I4Q A;  4L63 B;  4OO1 G;  3DMU A;  2RSO A;  3PUW A;  2K7V A;  1NUC A;  2F0E A;  4DFA A;  3VR4 A;  2WIN B;  4LK1 C;  1EZ6 A;  3BYY B;  4ABN A;  4BA2 I;  1JOO A;  5FO8 B;  2EYO A;  1LTI D;  2XRQ D;  4DU9 A;  4A3D B;  4X3U A;  1T5E A;  1NR4 A;  5JVG 3;  3KUP A;  3RUZ A;  2PW7 A;  4KHZ A;  3I90 A;  4IUP A;  2Z8L A;  4G7H C;  3ND9 A;  1JC7 A;  1G2S A;  2FFK B;  2MUY A;  5IOD A;  1QJO A;  4IFD J;  1QB5 D;  2A6H D;  5E1F A;  1MGS A;  4DAP A;  2FJ2 A;  5IGB A;  1TQO A;  1Q3L A;  3H09 A;  1STY A;  3MXN A;  3S2D B;  1ZYR D;  1BUV T;  4K2K A;  5ELF A;  5FLX L;  2B2U C;  3RD4 A;  3T51 B;  5C0X I;  1JQY D;  4K2L A;  5HGT A;  1A15 A;  2MJ8 A;  3KBG A;  1TWA B;  3DWP A;  2A73 B;  2WP8 J;  1SXT A;  3HOV B;  1G2T A;  4BA1 I;  2AWN A;  4ZKB B;  1H9R A;  3BG3 A;  1IYV A;  4R9W A;  3J81 L;  2A5H A;  3D6C A;  4RFB A;  4C3J G;  1MI2 A;  1XXG A;  3J7A V;  1KLU D;  2A6E C;  3TME A;  1CHP D;  1DOK A;  1YNN D;  2NVT B;  3TP8 A;  4CJ1 B;  1RD9 D;  1ENA A;  1F9P A;  1O7Y A;  1TT2 A;  1TII D;  2PZU A;  3I91 A;  5CMD A;  1KNA A;  3V2T A;  5FKA C;  1SAP A;  3J7Y W;  2K5W A;  1LTS D;  4RHS A;  4X3T A;  3K7A B;  2I46 A;  3FMC A;  3Q23 A;  1BR9 A;  4IUR A;  1MSH A;  3N6R A;  2F3W A;  1W6K A;  3SDZ A;  4M1U B;  4X3S A;  1TWC B;  2NN6 I;  1B9M A;  3VR3 A;  5M3F B;  1SDF A;  4GZY C;  2F0N A;  1SYE A;  3S9W A;  1WVL A;  3UI2 A;  1D2B A;  1B53 A;  3MXP A;  1SNM A;  2RA4 A;  2SEB D;  3JAM L;  4IN3 A;  1JR0 D;  4KJO A;  5E4X A;  2Z4H A;  2JA5 B;  3OMC A;  3NTH A;  1PTO F;  2EY2 A;  1PFM A;  2FIN B;  1ET6 A;  5LL6 X;  3S1R B;  1I6H B;  1V1P A;  1PTO C;  5JEA H;  3I72 A;  5JPN C;  1TS3 A;  1PRT C;  1WTW A;  3ERO A;  3J7A F;  1JOR A;  4DF7 A;  1BCP F;  3A54 A;  1JCK B;  4CKE A;  3EVQ A;  1TWF B;  4KV6 A;  1L0X B;  2WV6 D;  3P1H A;  2JA7 B;  1BCP C;  2X6G A;  1NCV A;  3PIP 3;  2CHB D;  2Q8I B;  5KRU A;  1DOL A;  3QG1 A;  2NB0 A;  3PO2 B;  4KK7 A;  2G9D A;  3H94 A;  1HXY D;  1GUW A;  3D6W A;  3LWU A;  4NP5 A;  4F7X A;  5KGU A;  3Q0A A;  1Q90 A;  1CZG A;  3BDO A;  2XNA C;  4Q5V A;  2PZW A;  3GTO B;  1EZ8 A;  2D5D A;  2R7Z B;  1S5C D;  3QOL A;  4V0B A;  1TU2 B;  5IOC A;  2PMZ B;  5KIX A;  1VMC A;  1HUN A;  2M2L A;  1SFO B;  2EYL A;  1DJR D;  2PZT A;  1IW7 C;  3GV6 A;  4WRD A;  2VXW A;  1Y1V B;  2J7Z A;  1SMY D;  4IUT A;  1WD1 A;  1HCZ A;  1AW7 A;  3VA7 A;  1O78 A;  1PZK D;  2K04 A;  1FNV A;  3MA2 B;  5M5X B;  1K8O A;  3PV0 A;  2JEB I;  2K32 A;  2NYZ D;  1EOT A;  3OWE B;  4DNT B;  5BN3 A;  1GJX A;  2A68 C;  2PQE A;  2RKS A;  1WTR A;  1GOZ A;  1S4Z A;  3IFD A;  3A56 A;  4FF4 A;  2EVB A;  3R2I A;  1BDO A;  5A2Q L;  2MGS A;  5IGE A;  2JA8 B;  5EBC A;  4OIJ A;  2RVL A;  3H3V C;  3ERQ A;  3L9A X;  1Q12 A;  1V1P B;  4CKB A;  2RBM A;  1ILP A;  3PO3 B;  1ROD A;  2K33 A;  3CRK C;  5COR A;  1IYU A;  3D8G A;  5G3L F;  5ELD A;  3NK9 A;  1SE4 A;  3E5S A;  4KN4 C;  3HKZ B;  3KLS A;  4KMU C;  1LO5 D;  4KI0 A;  1DD2 A;  4QMG A;  3E6Z X;  1I4R A;  2CVR A;  2KCN A;  5CBA E;  1A3V A;  4U67 3;  1EEF D;  1KDB A;  3LNN A;  3U9S A;  4DNR B;  4RKB A;  3H91 A;  4HED A;  1H9S A;  1CZW A;  1H9M A;  3K58 A;  4V19 0;  1ICW A;  1DOM A;  1RTO A;  1OXV A;  4JBW A;  3HOZ B;  4KKT A;  4QIW B;  2L12 A;  1B2T A;  1U4P A;  3MXU A;  5FO7 B;  1SYC A;  5FK9 C;  1LT3 D;  2C5C A;  5I4D A;  1ENC A;  3VR2 A;  4E6I A;  1UAP A;  4H0L C;  2Y0S B;  3L3O C;  2QCP X;  5I2Y A;  4XYQ A;  3CQZ B;  1D1I A;  4O1N A;  3O13 A;  2EY1 A;  1TR5 A;  3I73 A;  3OPO A;  4ILW A;  4H7B A;  1DYQ A;  2C9O A;  3QB3 A;  1AEX A;  3SVM A;  3S16 B;  1QG7 A;  5C0X J;  1EEI D;  1STE A;  3BZD B;  1L0Y B;  3ITP A;  1A2T A;  2XWJ B;  3Q6S A;  4ZRZ A;  4ME5 A;  2PW5 A;  2XIW A;  5HUR A;  2NN6 G;  3M7N A;  1CHQ D;  1DM0 B;  2XN9 C;  3MAQ A;  1O7L A;  4XQN A;  2CQA A;  3J80 E;  1HHV A;  4RGN A;  3I8Z A;  2E76 C;  2B2V A;  2BE5 D;  2HCI A;  4K6D A;  2E75 C;  3A7A B;  5C3W A;  3VYS A;  5CGK A;  1I4G A;  4TRD A;  3NWT A;  1CQF A;  3N52 A;  3SEB A;  3BS1 A;  2E2I B;  3OIQ A;  5KEE A;  2Z1C A;  3PUY A;  3SXH A;  3D4R A;  2RQX A;  4HN7 A;  1S5E D;  1KAA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...