4FXGC

Complement c4 in complex with masp-2
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
287
structure length
287
Chain Sequence
VVEEQESRVHYTVCIWRNGKVGLSGMAIADVTLLSGFHALRADLEKLTSLSDRYVSHFETEGPHVLLYFDSVPTSRECVGFEAVQEVPVGLVQPASATLYDYYNPERRCSVFYGAPSKSRLLATLCSAEVCQCAEGKCPRQRRALERGLQDEDGYRMKFACYYPRVEYGFQVKVLREDSRAAFRLFETKITQVLHFTKDVKAAANQMRNFLVRASCRLRLEPGKEYLIMGLDGATYDLEGHPQYLLDSNSWIEEMPSERLCRSTRQRAACAQLNDFLQEYGTQGCQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Complement C4 beta chain
publication title Structural basis for activation of the complement system by component C4 cleavage.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 55
structure length 287
sequence length 287
chains with identical sequence F
ec nomenclature
pdb deposition date 2012-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01759 NTR UNC-6/NTR/C345C module
C PF07677 A2M_recep A-macroglobulin receptor binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.120 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4fxgC02
2.60.40.690 Mainly Beta Sandwich Immunoglobulin-like Alpha-macroglobulin, receptor-binding domain 4fxgC01
5JPNC 2E2DC 3V96A 5FOBB 3MA2B 3HS0C 3I70A 1GXDC 2XWBB 1JC7A 1UAPA 3CKIB 1BQQT 5FO7B 5FO9B 3CU7A 2ICEC 1D2BA 1PXUA 1BV8A 1BR9A 2J0TD 2XWJB 2TMPA 2WIIB 4D94A 2A74C 3L3OC 2A73B 4FXGC 5JPMC 4ILWA 1BUVT 3T4AC 1EDYA 2WINB 3KLSA 2B39A 1XWEA 1OO9B 2I07B 2PN5A 3OHXC 1JB3A 1UEAB 1AYOA 3G6JB 3HRZC 4FXKC 5FO8B 4LNVA 3FRPB 2QKIC
chains in the Genus database with same CATH superfamily
2AK4A 1ET8A 3SOBL 1XMOQ 4YDJA 4PJ5B 3BFQG 2A1WL 3ZKXB 1AHWB 3BAKA 3SO5A 1BZ7B 3HG1B 3ILPB 3WU1A 5AVXB 1P1ZB 1M1KC 4GKJQ 3CSPA 1LE9B 1DEEA 1DM0B 2IV8A 1C9OA 2PPEA 4GSRA 4TUUA 5D5MB 3MLUL 4B9JA 1CMOA 4MMYA 1WCQA 3DEOA 3GJEB 2XT1B 2R1XA 2O93L 5KN5A 2IGFH 1PZBA 1A1OA 2IW3A 3HOVH 4R6UA 4WEBH 3VXNA 5KYWB 1DN0B 2CRMA 1ID2A 2EECA 4G5ZL 4OIIH 1MCJA 1FDLH 2EDOA 4N9PA 3ETSA 3Q9PA 3S37L 3QRGH 2EY5A 3N1PC 1QASA 5JPNC 1BVKB 1KLFA 1Z9PA 3QUKB 1IVTA 5IEKA 1TOXA 4LSVL 5HJ3B 5IT9c 4LSQL 2EJMA 5KYUA 1P84J 3G5ZB 2LE9A 1WTPA 3LRLA 4B53A 4ELMA 3BAWA 3W3AA 1R6VA 2RFXB 4YNYA 2DIAA 5IG7B 1L0XB 4V1DE 1MVYA 1E5ZA 2BIIA 1G7IB 4XBEH 1DQLL 4MXVF 4RIRA 4C58B 3NE5B 1IAIH 4BEIA 1S3RA 5D7SH 4IU2B 5ELIA 4EI6A 2UUCQ 4FKKA 4OVVA 1UWGL 2Z8SA 1VQHA 2QGQA 3MJ9H 3TP5A 4GRWB 4JDTH 4WNSA 4HOWA 1U3HB 2CA4A 1DBKL 3GD1C 3OM3B 5HHXL 3WUWB 4BZ2H 5B21A 1DQTA 1F1GA 3I56A 4N9GA 4UU9B 3U30B 2X4UA 4PUBH 4RVBA 2IH3A 1L2FA 3CF5A 3FZUD 1RK0B 1YNND 2EUWA 4GAJH 3D3RA 3MXNB 1VQPA 2WXPA 3NFNB 4JHWL 4DV2L 3IWVA 5IQ7L 2AJYL 3GJFK 3T8VA 1NCUA 4UNUA 1VQLA 4PJ8D 3F7PC 3TEUA 3N44B 3I6LE 1E8XA 2YYZA 2NR6C 3IMTA 3AFLA 1IAMA 1ZMYA 3MDJA 2DQDL 1FYHB 4FCHA 4V1DD 1SXZA 5KTEL 4HUWB 1K5NA 2J57A 4M7JH 1NDGB 3QCVH 4YGVA 1RUQH 1HWHB 1RP9A 5GISL 4MAUL 2GT9B 2X4NA 4XP4H 3FO0L 2PWDA 4K7PX 3IDGA 3TH3T 5KYYA 3PJSA 1NTDA 1IYVA 2MNAA 5HI4C 1E3PA 3EO1B 7PCYA 3VFRB 1Y6KR 1XNQQ 2F52A 4MNGB 1SEBA 4EN3D 1I3VA 1K8IA 3C6LA 3LKOA 2CHXA 4RA0C 2ZOLB 4JG1L 2GC7C 3K71B 4M56A 1LEIA 1KLUA 5IT2H 2MQGA 3ME0A 4ONHA 4R4BB 3VQMA 3H6JA 1PH7A 1F4XH 3FSOA 5DEGA 4G6JL 1Q12A 1AFPA 2DS4A 4JBKA 1BWWA 4B9CA 4BA8A 4ZUVB 3I6LD 3EGDA 4PJ7E 2XRAH 3MLTB 4LVEA 5DFWH 3W9EA 3V8CA 5M5YH 1PSKH 1UKSA 4OLYL 4R0LB 7PAZA 2VZTA 3CDYA 3PGCB 5IROA 1LWHA 1KYFA 4RWHA 4H88L 5L37A 1ND0A 2J8UB 3ABKB 4F37K 4IEFB 4HAFA 4UT6H 2DTSA 1BM3L 1Z5YD 1MPAH 5CC4A 4FG6D 3DWPA 3G6EA 4B3TQ 3QGVA 5EOTB 1QAWA 3QPKA 1TQCB 5DRZA 5JXED 4NJ9L 1ZVSA 1NFAA 1CBVH 1CG9B 3M4OB 3H3PH 1A62A 1JJGA 1I9JL 3ZPDA 4ZW3A 2FO4A 3RE0A 3OXSA 3U7YH 4RCOA 4PJ8B 4IHOA 4AJWA 2VB3X 1QILA 3RJDA 2WBKA 4JMXA 5IVZB 1XGRA 2MOVA 3TS2A 1YVLA 3L4XA 5MP6H 1HXMA 4HCRA 5CSBA 4V1DB 4C83B 2DYPB 4XVOA 4JQVA 5C44H 3VCLB 3V4VA 4JVPA 3E6HB 5IESL 4PW3A 3QDME 5TF0A 2QZQA 3MNVA 3DROA 2A6DB 3KL3A 4FLSA 4ONGH 4RWYH 5CV5A 2QTEA 5IBTH 4S10A 4DTGH 2FB4H 5GZND 4DK5A 2DGYA 1A7RH 1GW0A 3TVMD 1QABA 5LCVH 2WXFA 4E0RB 3LD8B 1FVCB 1QEWB 1X5LA 2OTJA 4A7GA 3OZ9H 1CFMA 2BWIA 1KGXA 2Z31A 3KS0H 4J8RB 2NY5H 3MRMB 4QIWB 4OGYH 1YC7A 2DWEB 2QLYA 5BS0A 4LF5L 4HHGA 4IHBA 2YQ3A 3VFGL 4XE5B 5G4MA 3A23A 3U36A 4ZQTA 2UY7B 3BWUF 4KDTC 4I3RL 2XIDA 1UEYA 5GJTL 3GS0A 3B3IA 2XVSA 3ULLA 3PIOA 4TLUA 1LABA 4XXDB 1W16A 4FNRA 3OMIB 4I3SL 2B20A 4QXGH 3J7AV 3QDMD 2CNYA 3FUJA 4F9LA 2BCMA 5CYUA 1HFGA 2J25A 1G1OA 1QX1A 3AT0A 3KPNB 1X7SA 3VXSA 5E6IB 2QPFA 3HOVG 1D9KC 5EEYA 2OMTA 3LQAL 4ODVH 2CIKA 3W9DB 1GGTA 3QNYA 4F8NA 3L3JA 4OSUL 3PYCA 3GMPB 4L9LB 3CVHL 2Q0ZX 1K6QL 4KJYB 1R75A 5BQ7B 4U3SB 2H2SC 1WHOA 4PJFE 4JFXB 4X8CA 3OQ3B 1UASA 3HE6B 1H6UA 1L9MA 4LRIA 3WMQA 5GS3A 1NMCC 2RSNA 1LLRD 3PIQA 4G42B 1DBJH 4XNBA 2I9LA 3QPQD 5DD0H 2R7ZB 3K0WA 4WI9A 1J12A 1OTUD 1ZTXE 4UIKH 3T3MF 4OUOA 3X13A 2E7HA 4C2MB 4AH2B 2BSRB 4X6BA 5K9KA 2Q2HA 4H25A 3R0NA 1XWVA 3TVMB 1RTOA 2I07B 2YR3A 1X55A 1K83B 3SDDA 1WD1A 3MV9A 5F9DC 1CGYA 3EN2A 3PJNA 3U4EB 2MQ0A 3EFDL 3NSJA 2ENPA 3N2JA 4PB9H 1WUNT 4HK3N 4Q6YA 5DJDA 2Y6TE 4OFDA 4HIOA 1ID5I 3AWGA 3HUJE 4PD4K 3RZCB 4EIUA 2D9CA 1RCYA 2VL4A 2WXJA 5DR5L 4LCCB 3FOLB 3IE9A 2R4SH 1MIEH 4YDMA 2O5XH 3FSWA 4DV6L 2R0KH 1J1PL 2VUYA 4JAMB 4KMTL 4AYBG 1PDQA 3QDMB 4F93B 1OP5K 1KLUD 2RMNA 3QO1B 5E8DL 4EE2A 4BUHA 5J6HA 1FYTA 2XSKA 3DKHA 4KKQA 4WUUB 5K59E 5ICYA 4OZFH 1N6QH 2B14A 2WP3T 2YD8A 1NCDH 4L4TA 1STAA 5DDHB 3UC0L 4Q97A 5D4QA 2BVUA 5CBEA 3NCYS 3D8GA 3JUYA 1MW2A 3F65A 3X11B 3U9UB 3RDTD 3IRPX 3MTSA 1KBWA 4P5RA 4X80H 3VUAA 4WO4C 4DK6C 4G6FD 2YA2A 3NRQA 5ICZA 3VXTA 3PWUB 3UTQB 3VAEA 5IROD 1AD9B 1KBGH 5CCJA 1UVQA 3ND9A 1ZT7B 1GOZA 1YEWA 2X4QA 2NT1A 4X8XA 2JH2A 3C60C 1X3PA 1M2VA 3KLSA 3GTJB 1YY9C 3BKCL 1AANA 1IE4A 1JNHA 4KKUA 4ZS7H 3UI2A 2G2RB 5I1CL 4OO1H 1IGIL 3D6CA 2PPCA 2CW0C 1P5UB 5C0GA 1XXDC 1FD7D 4B6ZA 4V0BA 1KRTA 3V0EA 2JXMB 2K33A 1K9MC 3HHSB 3J7HA 2H26B 1EOVA 1PKOA 3RUZA 3CFJA 2A6HC 1TWCB 4M48H 4MJ5A 4POZC 4Y2DD 1MLCA 5E6UB 3VQLA 4AVKA 2VITB 4RHRA 1S40A 4LSSH 1GUTA 4FYRA 3KUPA 4MJ4A 2WAHA 2J6WA 2D7NA 3HBPA 2Q76B 1KCBA 4W4OC 1PD1A 2Q5BA 1WCMH 4FP8L 4F7CA 5FO8B 4MLIA 3WS3A 2PPFA 4M7ZB 2DLHA 2ADGB 3CFMA 3V6OC 2Z31D 4LEEA 3BP7B 2DQGH 3Q43A 5G2NA 1M42A 2AXHA 1QZHA 4JBJA 3CSBA 5AD0A 3Q3GB 3R18A 1KV7A 1I4GA 2UYLA 4MAZA 3WNJA 2IHEA 1IGYB 4E9YA 3VFPB 3HC0B 1M3JA 1TZIB 4Y9CA 1EZLA 3RDTB 4PWEA 3MA7B 1E4JA 2EXSA 4G6FB 1RMFH 2P8PA 2ZOWA 1STGA 3N55A 4OUUB 5CSZA 5ESVA 1WZMA 5AW2B 5KBNC 2ENBA 2OTLA 1OTTC 1P7KB 4GP5B 5CLYA 4FZ8H 5IMLB 4IJ3C 3EOBA 1PG7W 4LDLB 5ISRA 4WW1B 4Z8FL 3HUJB 2G60L 4I5BB 5FLUA 4AC2A 3APMA 4CUCA 3FPXA 5IB3A 2I27N 2Z0SA 1QRNA 3B8YA 3BKJL 4IS6B 1MWOA 3OR7A 4ZXBA 1SHSA 2IXQA 1B90A 5HYFA 4JN1H 4JI4Q 3AQDA 4XBGA 1A1MB 1G9NH 2JV6A 4PRHA 4F2FA 3FT2A 1KDCA 3G6AB 1WWAX 2CU9A 3R4DA 4NNXB 4PS8A 3VACA 3JTSB 1A9EA 3JV4A 4PWHA 4G7VL 4Y7NH 5EWIH 2BPBA 1Q1JH 2APTA 3SKNB 3N3EA 5ABZA 5JW3H 4Y2DB 4JI8L 1FYTE 4OFKA 2VDLH 3BIAX 5DJZB 3APCA 3H0GB 2ADJB 5JIIA 3HGBA 2JN4A 2VB2X 4PJHA 1EFXD 4OLWH 3DIFA 3DSNA 3EFOA 4M7LT 3I4NH 3TJHD 2AGJL 2NDFA 3KJ4B 2J0TD 2AJZB 1HNYA 1DL7L 3QXAA 4ZQKB 1UEBA 1LDPL 4B9GA 1WSST 4FFZH 3WIAA 5BVPL 3GGWB 1SXAA 4Y1AB 1L1OA 5LMUQ 2AQ3A 4H8PA 1VFBB 5HI5C 1J05B 3V5DA 1L4IA 5EIQA 4AZUA 1F58L 3VFSA 3CHBD 2VM4A 2X4PA 1RPUA 1T0OA 3QUZA 4IBTA 4LOVA 5KZCD 3TDQA 2JKRM 1FYTD 1GGCL 1OGTB 1ZOXA 3HOGA 4DNIA 4ZK8A 1NCAH 2F0EA 2ICCA 2VDMH 2W80C 3HZMB 4ZAKA 5SWZA 1XCXA 2IAMC 3QHZH 5IBLD 4KQ4L 1F4AA 1S6NA 1OW0C 4PTTB 3TA3A 4YZFF 3CMGA 3QULA 2VXUL 4OU3A 2QDWA 3DUSB 3RL1B 1KL9A 1JGEB 3X1FA 3ZDYF 5BV7L 1I6HB 4EMZA 3KLHC 4U6YA 3ZDZE 1FZOB 4UTBA 3QVAA 1Q7YC 4NUJB 5KSUA 5BRPA 1G1KA 4Q2ZA 4OZFG 5H4ZA 4FFYA 4FJZA 3AG3B 2F0VA 1U8CA 4X7TB 2QVIA 3V6ZA 1JZ3A 2C7UB 3VGHA 2ZXEB 2EXWC 4PPTA 4LMQE 2YV5A 1S7TB 4R1JA 5B4MC 1K0RA 3WEXA 4NYLA 3T0EC 2V5YA 1IARB 5K9JH 2RBLA 4JANB 1GM5A 2LU3A 1HI6A 3U0TA 1EFXB 2QQLH 1UACL 3A4FA 2CRYA 1U8QB 3NCBB 3ZZSA 2F18A 2XZAL 1SMYC 5IWAQ 1MEXH 1L0QA 1NMBH 2PNHA 3LDBB 4QXUL 5FUZL 3FTUA 2L0DA 4HLJA 1RUPH 3QXTA 2Z7ZA 3CCRA 1L7IH 5FKAA 3GUFA 3ZKNC 2HRHA 4OO1G 5DMKB 3PWLA 2XPZA 2WYIA 4J28A 2UWEF 4GOPB 4G7SB 1XVSA 3HOXB 2FE0A 3LOWA 3PFQA 5AW8B 1E42A 2TRHA 1MFNA 3O2DA 4AVJA 1NY4A 4LU5L 4QI3A 2W92A 2VZSA 4LMQD 1S78D 2CALA 1IBML 4PRHE 2CXKA 1JPSH 32C2A 5B38A 3CCJA 5CLXA 4PNYA 3QORC 4HIIB 1FNEA 3U0PB 4FQ2L 2JA6H 2IPTH 4Y88A 2HVJA 2E56A 3RY5A 3DA0A 5GGVH 1E9PA 3K0XA 3K6OA 4C3JH 1QUPA 1WCMG 5I15L 3P4OA 3BP6A 3BW9A 2J1XA 3EJPA 4HJJL 4Z23A 2E6PA 5AKRA 3LKRB 5MENA 1B9KA 5GS0D 5FOBB 1QCBD 1A6VH 4U4IA 4G43A 5BN5A 2WCGA 4YHLL 5T5FL 3STZA 3QRLA 1DBBH 1HQRA 1GY1A 5E0QA 3UABA 2V8MA 1AP2B 1SBSH 2F5AL 1ZHLB 4IBWA 3CVDA 4XNYL 1U8IA 3FONB 1GC1L 1I9IL 2V37A 1T5XD 5F97E 3RGVD 1EA9C 3C5SB 4KU1A 5H8DA 1VFMA 2VZAA 4FI8A 2M9VA 2PZWA 3O81A 4LMQI 3TJEL 4IQHA 1EU3A 3CFCH 2VDKL 2R2EB 5CCKL 1JNLH 1H3PH 4YQXL 4CL7A 4C4KT 2BP0B 3VR3A 2HFFA 3S48A 2PXYD 2NMSA 1ANUA 2UY6A 3FSAA 4YE4L 2V2WA 5C0XJ 4QRFA 5SWZE 4MBOA 1PPIA 1KABA 1SXBA 3NK9A 2ZSVB 5DO2D 3ZDZB 4F7KA 4HCIA 1XSOA 2CR3A 3TFKC 2MQCA 4Q4IA 3INOA 3MRHB 5DK0A 4DR6L 4JCWA 2EY1A 1OTSD 4Y2LA 4PSRA 5JOEA 4W9JC 3M8OL 3OSKA 2JQOA 3RA7L 2HA1A 2N7SA 3ZO0A 3WEOA 2ZTBA 3VMPA 4X4XB 3FUKA 5DUBA 1II4E 2ZT9C 1M4KA 4G1MB 4UB0L 1TWAH 4YHIB 4DO6A 3EDJA 2NTSP 3I4NG 3RIFK 4PLKC 3JV5A 5BVJA 2XWEA 3OKOA 3KPTA 4LLDB 1BMWA 4P2OA 2PO6A 1HK6A 3I73A 1A3ZA 3BFOA 4N8FA 5B8CA 1W15A 3ARDB 4LXFA 4LEOB 4U1SB 2YU9B 3L3OC 5D72H 3GUTA 2YA1A 4ZAKD 1IAKB 1ZE3C 5FV2A 2BP5M 3FSZA 4RWSC 1OAXH 1NSNL 4PCKA 5F1KC 5HHVL 3TA3D 1T5XB 2IWEA 2VXQA 1NAMB 3RGVB 3SZ6A 4JGJA 1QSED 3GDEA 4OT1H 1FR3A 2O6EA 4I65A 1FN4B 5ABAA 1E5YA 2FEEI 3OG4B 4UDUA 4WUKH 5I1AB 4M6NH 4WJ4A 2R7EA 1NEZG 1S7VB 3MLSL 4ALAH 1KENH 2GJ6E 4NRXB 4U6TA 2HCZX 3SBWC 1GCYA 3MKKA 3MX0A 1UD8A 5F3BB 2PXYB 3GSWA 2UZXB 3HNTL 3L3DB 4JY6B 3VRLF 4AMWA 1EY5A 3WXWH 1U8PA 5CEZE 1NR2A 2IANE 4N8VB 1CT8A 3NK4A 1PY0A 1TUPA 2WO4A 1YNLL 1Y1WB 1HNFA 3X14A 1JL8A 3BRDA 2XZQH 3GBDA 4Y4FD 3S4SA 5MENE 3U4VA 4J3OF 1A7PH 2QKIB 3QZWA 1FNSH 3MJ8B 4MA3A 1RZJC 3TSSA 4AXWB 1PRTC 2UUBL 2A69D 1FFOA 1HT6A 4FYTA 5D7HA 1WZ1L 3W11C 4DP7X 4Q9QH 5FIEA 1EU4A 1UCBH 4AT6A 3D4GA 4QNPF 3MZ5A 1RIPA 4GS3A 1IW7D 5IYDG 2GJ6D 2XG5B 4G8IA 2D3LA 2G75A 1J9RA 2FX7H 4PJDE 3QEGL 5D5MF 3VXMD 3N91A 3CK0H 5L8LB 1L9TA 2WXRA 2X6MA 3GMNA 2FX8H 2PMZE 3NACL 4HHAA 5DT1H 4MJJA 5A40E 1OO2A 1G43A 3B1TA 5CEZD 3MBWA 5LB1A 2GY5A 2VY3A 3VWJA 1RULH 2IAND 4GKZA 4I77L 4PY8J 5IT9L 1CLZH 2BY3A 3NOIA 3ZTNL 3JVGA 4MYWB 5GIRB 4MJ6A 2BE5C 1QSEB 2CWRA 2QMKA 5C0CA 2A83B 3NGBC 3WDIA 1FNFA 4MMXC 4KI5C 2NNXA 2IWGA 5IW3A 3DJ9A 4WWOA 2FLBT 1HQRD 3OMNB 3EHBC 4OIKA 2JA6G 1F1AA 1UM6H 2X3BA 4GRWF 2AI0H 4JZJB 4H44C 4C3JG 3ULVE 3G5VB 4FDBA 5EN2A 1J18A 1RUKL 5E94A 4I0PC 1KGWA 3T65A 2A6KA 5NUCA 4ZFFA 3JC66 1AYRA 4HCRH 4A3IH 3GLDA 2R4RL 3VFOB 2ZCLH 3MGTA 2LAGB 3V4VH 3UIZA 2BNQA 4JDZA 4JM4H 4LVNC 4YO0B 3Q8DA 3GRWA 1KPVB 2DKUA 3NIDF 2B4CH 1OLLA 1VQFA 4FABH 3GO1H 3IETB 4LRNL 2K4KA 4AIEA 4Y4FB 3AB0C 1ZEQX 2X4SB 2X2IA 4UOW1 3N44F 3BQUD 4F7MB 3L3GB 2JSOA 5IJKA 1SE8A 4KZ0A 4KX8A 1LV9A 4O2CB 3RILA 4AVIA 4DN3H 3UDXA 2VIRA 4NN5B 3O3BB 1URZA 5ANHA 1AGCB 2LMCB 3E3QC 3VWKC 1WQVT 4AGQA 5J6GA 1SYDA 2GJ6B 5FDWA 3VXMB 3ERXA 3DO7A 4KO5A 4G6KL 3FT4B 2XWCA 3IAPA 2FDBP 2ZXWB 3BDOA 5F1NB 5F9WC 3OKLB 2OI9B 1WZKA 4HOXA 2R6GA 3C8KB 4X9FA 4AQ8C 3WO3B 5I8EA 4CVZA 1G6ZA 3L7FB 1EAQA 1KYAA 3RUGF 2IANB 1U8LB 4HMCA 2IG2L 3AG1B 4P04A 4XAWH 3U6XS 3LKPB 5MEPA 4PGDA 1VCBC 3C08L 4OF0A 1QSZA 3LY6A 4OONA 3KLQA 3KVDD 4HWNA 1S2EA 4JY4A 4P2OD 3O0RH 5KNBA 4A3LH 1QPXA 5T1KD 5DSCB 2JWYA 4CKVX 3A7AB 3BIKB 3UX9B 3VB9A 3BPLB 1U8OB 3JTTB 2PW1A 2DJ4A 3T9WA 4HQQH 3FQWB 3FUHA 4LNRB 1B4LA 1MAML 4DEUA 5A7BA 4PJDB 3T6XA 1J8HE 3OAUH 1P4LA 3O6FD 3EBHA 2J8UF 5C2BH 4HUNB 1NGYA 1ADWA 2JK5A 5EBWB 4BFIA 2QQKH 2OULB 5F0JB 3LIZL 1IHZA 3APDA 3BUYB 3HHMA 3MN8A 4A3DB 4GBXA 4ZMOA 3DWTA 4ESKA 3Q8CA 2ZUVA 1E4WH 3ZGHA 2SOBA 4PLOB 3BQUB 3D39A 1NKOA 4IU3B 3ZY7A 2EKSA 2AVFA 3I74A 2R83A 3P4NB 4I3GA 1WTQA 3AEVA 2IWFA 2L7UA 3LZRA 4GXVH 4L3CA 4QR7A 4WTQA 3U46B 1Z0MA 4FNPA 5IHUL 1AE3A 3GHBL 4OAWB 3ZJAA 4S1DD 2FX9H 3IXAA 2J7LA 2M2DA 4L8JA 4JI5Q 1X5FA 4G3YH 3B7RL 4XMKL 4PGBB 4NQEE 2FBOJ 1J8HD 1IC4H 3ZLQC 2JA9A 1JD7A 1U6AL 2HCCA 4MCYA 3WTSA 1U4MA 3HOXH 2ZKYA 3HR6A 3RNKB 3KF8A 4AC4A 1JTPA 3QXDA 4GG6B 3CIQA 3OHXC 3MBXL 4MJ2A 3GK8L 2XQYA 1KB5A 1IL2A 1KT2A 2B63B 5TH2B 3RAJH 4Z5RB 5F3FA 3MOBH 5K36H 3S0PA 2LQRA 5T1KB 3NQIA 1DSYA 1JV2B 1NGZA 3HJEA 3VI4E 5IMOB 2BC4A 3PPEA 1BVZA 4FFVD 2OK0H 2F0KA 3ESPA 1WGVA 2ISDA 4XHJD 3SCMD 5E4EB 4NZRH 3HS0B 2N59A 1FVDA 4K6LA 4X98B 1MY5A 3FAXA 3LYRA 3QQNA 5DHDA 1AR1D 4LCWB 3TBSB 1KB9J 3O6FB 5F7NC 4AUYA 5CLWA 3BOVA 3KAAA 1JGVH 1PNCA 1AQKL 2NYZD 1FF5A 2HDMA 4NQED 1NBVL 1VPOH 1V05A 2AV1B 3VX1A 3NDZE 4IJTA 4PTUB 1ICFB 1LEKA 2IFGA 3WO4B 4I18C 1T22A 3ARBA 4JRXA 5IMKA 2NY4D 2ZPKH 2BLFA 4OF6A 1XBRA 4KRPC 3O0LA 4L0ZA 3KL0A 3BZEA 2EDYA 2K5WA 3BVMA 1DQML 1MHPL 1YECH 4UV7H 5CZVH 1HH6B 3KXFB 4X4ME 1W80A 4RFNC 4ZK9B 2ZIDA 3HZYA 4XPBL 1L5GB 1SY6A 1XTCD 3F2UA 2PP8A 3AWFA 3V6FB 3VFVA 3PABB 2AF2A 3BISA 4DP4X 3VRIB 4LOEA 3HNSH 4AL8H 2DWTA 5JHAA 1A1NB 2P5WE 3ZKMD 4DFAA 4HJ0D 2APSA 3TNNB 3T2NH 1J8HB 3VVVA 3P3TA 4NOBA 3BDLA 4M6AA 4C56D 4K9JA 2XCMC 5ISZB 1LE5A 4JV5L 4GEJA 4G9DB 4I9WE 4A3IG 3QOJA 1GMEA 4M4RB 1GUWA 1H9SB 4L5QA 2ZAGA 3ENEA 1CICA 1MJ8L 2NWGA 2XICA 3LIUA 4LP5A 4P2RA 1DDHB 3WN5C 1YPZA 2BIMA 1A4JB 2F15A 3BSZL 1UZGA 3FYEB 4RZCA 1HCFX 1QFPA 2AW2A 2F4VL 3PLYA 2V9TA 4IGBA 5SX5K 4DV0L 3WELA 3EYUH 2DJUA 2EE0A 2UWEA 3S88H 3F3HA 4PRNB 4WU7A 3BYTB 1T04B 3SCMB 5H1SE 3UBFA 4PIBA 2A4EA 3LB6D 2QVKA 4JHAL 4Y5YC 3K1KC 4WGKA 5I18L 2B2UC 3T0BA 3HHRB 5GS0H 3W0WB 1NL0L 4FFTA 1LP9F 1AR1B 1WAPA 2ARWA 4W6YB 4UP7A 1N59A 4RRPM 2CM5A 4OM0H 2P5WD 2XLLA 4Y7OC 1RY7B 4UTAL 1W8NA 1MCOL 4FVMA 3ECBA 2X28A 2C9OA 3MLZH 3CX5J 3KJ6H 5GGUB 5EZOH 2OCFD 4NZUL 2R7FA 5AFWA 3FFDA 1QBLL 5FA4B 3L5HA 4I9WD 5F7DB 1RIHH 2YKLH 1LK3L 2NY4B 3NA9L 2VZVA 1IZ6A 4NM8H 1TJHL 1M05B 3CFTA 4Y4HD 5HD8C 4TNEA 2JJUA 4A3LG 4J7RA 1I75A 3VI4B 2AQPA 3ARUA 4JB9L 7FABL 1R0AH 2R29L 3CC4A 3NJNA 2RAMA 1IGTB 1MH5A 5JVG3 1BLNA 2YXMA 5CZXD 3V0AC 1Q81C 1JGUH 1YN7B 2GJRA 3TJPA 4R4TA 5LAXA 5HHOB 1FIGH 4NI3A 1XYIA 4LT7A 4D3CH 3LKSB 5INCA 4JW0A 1EHLH 1DVUA 3IJEA 3JWDL 4C56B 1NH6A 4GMTL 5D3IB 5EU5A 1FHNA 3R4RA 2IALA 3GMQB 9PCYA 1WI5A 5TQ0H 4F58H 4FLQA 2E2JB 4MDJA 4BE5A 3QYCA 1N0LB 4GT0A 5KOMC 2V2TA 4KXCA 5EFIA 5ITBL 3K91A 3WNIA 5EIIB 4GIPD 2BXYA 1X3DA 1VQDA 1H8OA 1DQQA 3WFBL 2Z4IA 1ILQA 2W91A 4Y5XA 2EIBA 2Z35A 2YEQA 4Q9CA 4JJ5B 4JKMA 3TBYB 3CXHJ 4JRXE 4AQEB 5ACZA 3GKWL 2B1HL 3OTOQ 1EHNA 4F33A 2CFMA 2PWHA 3CVHB 4GI6A 1FUNA 4L05A 4MZ3A 1RVFH 3FB6A 4PYHA 5GS1C 5DS1A 3P20A 1WTLA 1A3UA 1UA7A 3QR2A 5D1QC 3EO9L 1O7LA 2QDLA 3NCJL 3N41F 2GVAA 2XFXA 5EU4B 1THCA 4IIQB 2AMUA 4JFHE 3I9GH 5CU5A 1IQWL 1DE4B 3TA4D 4CSPA 3VYRA 1OCWL 1WO2A 2VZOA 3Q13A 4A3EB 3X12B 5LKNA 2AXJA 4UTBH 4Y4HB 3K0YA 3KDMA 3BDBA 1Q9LA 4HAGA 3SJVA 1G2SA 1I7RA 4FFYH 5IGBA 5K36G 4JFQB 1OARH 1TPXB 4CDEC 5C0AE 1B3IA 4ZFZB 2CJSA 4UQEA 3L0OA 3SPCA 3CKIB 3URYA 1YPZE 2VLRE 3WWVA 2IFFH 1M6OA 1QKZL 1VLXA 2XNAA 4JRXD 2BH2A 4I0KA 4QTHB 3SKJH 4R7LA 2IQAA 3UAFA 1KNOA 1CHPD 1F2MA 4HJ8A 3VG0H 5C0RH 5ISZE 4TRDA 4L5SA 3T4YB 2L7EA 3OKMB 3VD3A 1GSMA 1NLDL 3UAAA 4HBCH 2QADD 1QVCA 3ZHKA 3ESNA 5JNYA 3HS9A 1T5WB 1U3ZA 3TPUA 1AQMA 2P8LB 1CZWA 1YZ6A 1YJWA 1IBKQ 5C0XI 4LUOA 3ECUA 4TM9A 3IK2A 3MTXA 3PUUA 4M5ZH 3SO3C 3WKPA 1YMMA 1E7VA 4OWXB 1LTXA 2HRPH 4JN2B 1TLMA 4MX7A 4HJGB 4HU8A 1EEFD 1PLFA 1GKEA 3HFML 3AM8A 4UUJA 3SE9L 1UWFA 3UE0A 3O2DH 5C0AD 3WFHA 2XN9B 4KHXH 1X5GA 1CICD 5HDOA 4DXGA 4OFQA 4D2NA 3S1MH 2VLRD 2DYSB 1E8YA 1FNLA 4JPWH 2NYYD 3GM0A 5A2KH 2BVPA 5CEZH 1AQ8A 1JHKH 4NO2B 4N2GA 3QIUA 4IGBD 1ECZA 1BZ7A 3S96B 3C8DA 2R2CA 5HGDA 5ISZD 5I30L 1JUFB 2N1TE 2K0RA 3P9LA 4DV3L 2GEEA 3OHMB 2G9HD 1YEKL 3K6NA 2B3GA 2HT3D 3QUYD 3TYFA 1H0DA 4DFIA 4DK3C 3P0VL 5B1KA 4M61B 2RKSA 4HEPG 1H95A 2DQEH 3PNWB 2J12B 2UXBQ 3MCLL 1DN0A 1S9YA 4JVWA 3GHEL 4ME3A 4IRJD 5ILTL 4GRMA 1JXJA 1W9XA 4TPRL 3SQOH 1Z9LA 2VR9A 4DO4A 1LMKA 4O4YH 1BVKA 1RI8A 2WOYA 2VN6A 4UV4H 4G1EA 1EV2E 1SOKA 4FTVA 4TQUS 1M56B 1BF2A 1J9SA 3BO8B 2LABA 3I6GB 1MHWC 4LSRL 1T7ZA 3H7BA 3SQRA 4P9HL 4EUPB 1OXYA 3DI2B 2PTTA 4PJ9B 4FG0A 4N68A 2QEJA 1KTRL 2QADB 2X0VA 1B2WH 4JI0L 2HT2C 4IIZA 4NP4H 2CO4A 3FULA 1IEHA 2GSGB 2JKNA 2E9IA 2BSCA 1ZGLM 2BP8A 4KJPC 3AG2B 2X9YA 5I5RA 6TAAA 3X1EA 5K9JL 4XR8C 5AVRB 4NKOA 4IFDI 3BT2H 1ZA6B 1SVZA 8FABB 2AEPH 4YXLH 1P5VB 3RHWF 4EVOA 5C0AB 2R0WH 5HBBA 2VWEC 4P2CG 2A3TA 5ICXB 4LP4A 4DW2L 1YEZA 4HH9A 2AQ1A 4L8CA 3K8MA 1XZWA 3LKQB 5FCSH 4DWHA 1K3BC 1Q9KB 3SE4A 2I5MX 1JWSB 3L2NA 5L9DH 4PBWD 4PR5B 1SNMA 2KCNA 4GPVA 3WD5L 1HSBB 2NY0C 3GIVB 3ABZA 2G9HB 3AAZB 3D69B 3QUYB 2GBUA 3MYJB 5CJQH 4CC1A 5GRJH 5ACLA 1JK9A 1CT1D 1Q82C 1M2OA 1AY1H 1HKLH 4P71A 5IK3A 4W9CC 1XDTT 3HNVL 2D0OA 4MNQE 1O6SB 2CJ3A 1HJPA 2NY3C 4IRJB 4PY8I 3BJUA 4KNSA 5IQOA 3RUGA 4LARL 3DX3A 3R06B 2VXQH 5EZJA 2ZOLA 3F7YA 2VAJA 1BJ8A 3GSXA 3L81A 2W07A 4IOFD 5K69A 5D2NC 1H5BA 1UOVA 1OP3K 1D5XC 3VRLE 2FUTA 1LTAD 3ARZA 1B6UA 1YMME 2SODB 3GIZH 3LQZA 4LSUL 1QLFB 1XGUA 1BIIA 4KJQC 2VDNH 5DZAA 2ZKHL 4YY3Q 5M5XH 2CM6A 4ODHH 4FQCL 5T33H 3V0VA 4R0LA 3B6SB 4WVRA 4ZMPA 1A2YB 3QQ4A 2PR9A 4HWEH 1Y7VA 2F7RA 3PXJA 4BXXH 3RTQC 5KG9B 2NQDA 1TWGH 1JGDB 3RU8L 3MRCB 3Q9QA 3DGDA 3WOVA 4HIPA 3M4QA 2J8UA 1U8JA 2AK1H 2XWXA 4UY8C 1DOMA 1F9SA 1UTDA 3DURB 2E7CA 1UKQA 5ELNA 3FO2B 4TSBH 4WK2B 4MNQD 1B0RA 3ARGC 4Y1TA 3RWEB 3GTOB 3QJHA 2KJXA 2B2TC 4M5YL 1CG9A 5CHNA 3DXJC 1G5AA 4AZ8B 2X0UA 4KK6D 1J1OH 1PLBA 1EIGA 3NYKA 4OD1H 2EDFA 4Z9CB 1NCHA 4U1NB 3WENA 4D9RE 1MSHA 2YK1L 4OF8A 3RBGA 5E3FA 5L8JB 1YMMD 3SZKC 1BCIA 1KJVB 3IJ9A 5LO7A 2I0QA 1HL5A 3K81C 4FTVE 4UDTB 3LN5A 2A8VA 4QOKB 3TEHB 1ZDSA 4OTXL 5C3TA 1ET9A 4IALA 5IEHB 2K7VA 4MRCA 5JUEL 5BV7B 5DMYA 1CFVL 3LRSB 2I32A 4J3OD 5GZOA 1IEBB 2BS9A 3EADA 3H2WA 5SV4A 1WD9A 1CK1A 5I1DA 4ZRGA 1XAKA 3LKNB 5F3HB 1SNDA 4OX9Q 3VFNB 1YLBB 4KNUA 5IHWA 1FG2B 2F0SA 1MFEL 1Z7TA 1CUKA 4A76A 1GOHA 3ATAA 3L3HA 3MRLB 2GJZA 2WAQE 2GSMB 4GMSH 1MFCL 3GXPA 4RX4D 4QLWA 1CYWA 3WY2A 3MRMA 3FFCB 1VRSA 3KVPA 2VERN 4XNXL 1E40A 4IKKA 4D9RD 5B38G 1T20A 5ERWB 3TEZA 1L6PA 3E8UH 3Q8FA 5DJ6A 2BNRE 1MKFA 4OJCA 3NIDE 1IFHH 5C08E 4JPKL 4H8UA 4NJAH 1EGJL 3ZTCC 4C83A 4E41B 1QPPA 5FXCH 1HS6A 3VGAC 1NQBA 4FTVD 4X3SA 1WVZA 1N34L 5CF3A 1BBJA 3DV6A 3CC7A 1DUZB 3GRWH 1C08A 2DY7A 3WIHA 5IOCA 1IKFH 1DFBH 4MNQB 2L3BA 3KEDA 2J5LC 3QWRD 2FJUB 3ZL2A 3FTWA 2WK2A 1ZXKA 2BP3A 1MUJA 2WOBA 3KWVA 4U4BA 4D7PA 4K8IA 1DUYA 4U3SA 1GXEA 3NQTA 1LXMA 2IDSA 3ALWA 4PRAB 4RFOH 5CJBA 1EMTL 3FQXB 4AUJA 3CQZB 2LY7A 3HKZA 4O42A 4X5XA 3PHQB 4J6RL 2IBZX 2E2JH 1D5IH 1Z3GH 3KBFA 2BNRD 4MMZC 3WI9A 5C08D 3EQLC 5F9AC 3NTCH 5DHVA 1NJ9B 5EDSA 1R4QB 2O5YL 3TV3L 2J6EL 3Q5YA 3NSFA 5D7EA 3UPAA 2BSRA 3VB8A 3ISRA 5E6YA 3SHLA 3QIWC 1TG8A 5LBSA 3F85A 3MRPA 4D8OA 1A6PA 1OPGH 3UPCA 1PY4A 1GVIA 1I3RA 2EYPA 1SOQA 3HMWL 4HIJB 2HMIC 3L2LA 2UXDL 1W0VA 1BXUA 5MEQA 2HD3A 3U4EA 1U58A 3S2HH 3AU1A 4ICWA 4KN4C 3W39A 2K78A 2ATPA 1Y6MR 1MAKA 3H09A 1JF6A 1H8LA 1AKJB 4O2FB 4P2AA 3O6KL 2PYKA 4ODBD 3SDXB 1X5AA 1UYWL 3PO2B 1C12B 3QUHA 5IBUB 3T0DA 3VU1A 4TV3A 1V10A 3EGXB 4DPBX 5JW5B 2JJSA 1RL1A 2VDKB 4NXMQ 4X99B 4S3SA 1BIHA 3FQTB 4JM2D 4Y9FA 5T8IA 3E6FB 3E0GA 3WNNA 3RN5A 1IRAY 4GW4A 1FZKA 1LP9A 2ZUXA 3B83A 5DFVD 2VUMH 3W82A 2E2HB 1NDMA 2AKRB 2IPUK 4I7ZC 3G5XB 3H56A 3TO4C 3VH8A 4K2UH 2BHFA 4DGVL 3BUIA 4FXGC 4WHYH 5TDNB 5ID0A 1TNMA 1LO2L 2FZ3B 4PJGF 1AQDB 1QLRA 1X56A 1EZUA 4BSJA 2FUQA 4H7VA 2HT1A 4QAMB 1Q0EA 4X9BA 2I5HA 5DWUL 5CIPA 3PCOB 3V9CA 4DP9X 2LKVA 2WAQB 2VSMB 2Z8VC 5JHLL 3RIKA 3CZUB 5ID1A 4M5TA 4IRZL 3D9AH 4LCIH 4F15C 5EPKA 4AQZA 3UYRH 2WD0A 1CE6A 3O9WD 2BNRB 3H9ZA 2YSTA 5I74C 3G5WA 3KGUA 4ZMLA 4C1NK 5HGAB 1UD3A 1I4PA 2PLTA 3B37A 2WIIB 2SEBA 5ADOL 2NZ1A 1K2DB 3L4WA 1E3FA 4H4NA 4LVOC 1T7VA 4ZS6D 5TE4H 4NWUL 3AGVA 1ENAA 1IYUA 3TZVA 4NB3A 2PI2E 1BQLH 3GXMA 3J2PA 3V0WH 1NIAA 3KLKA 4XVJH 1KB5H 3CSFA 3V6BR 3O11B 2PCFA 4NIKB 1TQBC 4EOWL 3S4SG 3QZWG 3HI6L 3P3UA 1WBXA 4L1BA 4IKLA 5A2CA 1CFTB 4CMHC 3GLAA 1BF5A 3HKSA 3F7VA 3GSQA 1IGFH 1M7DA 5C0XH 1I7TA 3I2CL 5DZOA 1T7YA 1NCJA 1RUML 3NP4A 5IB4A 5K39A 4R7DB 2NZ9C 4JREB 4YK4B 4YBQD 3IFTA 4QMEA 4JM2B 4C3HB 5KW9H 5HGBA 5KVDL 3CHPA 4PBDA 5ETUB 1X5XA 3HOWB 5E9AA 3AMKA 2RHSB 5ELEA 3GTPB 3IDXH 4YWGH 3UC2A 1EQVA 3HKZE 1TKWA 3FBKA 5J1TC 1PH2A 1MFUA 3PP4L 2ROXA 1FNGA 3ERSX 2A6JB 4OFYA 4Z0BH 4KKAC 3MA7A 1SDFA 4JCLA 5EUOE 4F3FB 5L0QC 2FLMA 3S1NH 3VI3B 1EEUA 3MNZB 3MR9B 2ADIB 3DUHA 1UURA 4K14A 2XA3A 3R8QA 4B60A 5I8CB 5I1GH 4ZO6A 2PQAA 1INEH 1NCWH 3P0YH 4M6ML 3S36X 1SY6H 4DNLA 3G7TA 3FT9A 1VJSA 3JV6A 5D1XA 3RVUC 3FN3A 1U92A 2DUDA 1MFBL 2BCKA 1F8TL 1KELH 3EIFA 3L9YA 3H91A 3O9WB 5LJYH 4XPAH 1PG7X 2P4AB 1K85A 1CLCA 1VF7A 4NQTA 1QG3A 4JFSA 4J15A 2F3IA 4XP5L 5DUJA 1HTYA 5CP7A 4N1EA 3EH2A 1V7ML 5KSAA 5IMMB 4N0UE 4RHSA 1WC7A 5I6NA 2JCCF 4NUGH 3SN6N 1RFDH 2FD6H 3DLLA 1CTNA 3KM2A 2X69A 4XCCL 3ESVF 4M43L 2VJ0A 3DX8A 3SKNA 1VADA 1KTCA 3CN4A 3PWJB 4LLQA 3CXFA 2AJ3B 5CMDA 4HSPA 1P16A 2K1MA 2AEQH 2EC9U 3L4ZA 4XO4A 4QUOA 5F7UA 2DJGC 2EDXA 3DJZA 3NCXA 4EQOA 4NHUB 1JRHL 2V7HB 4HJSA 1KQSA 3G5YB 4KXDA 5E0FA 4BHUA 5AG8A 4OI7A 1R3LB 4O9HH 1E9OA 2APVA 3M1CA 4BZ1A 4K7PH 3KDFA 1VQ7A 4IFDH 2HT4C 3BHBB 5ENWA 3DWAA 5IFJB 2OL3H 2AJZA 3CDGA 2HSIA 2VDOH 4XCEB 1FJGQ 3HZKB 3GBMH 2P26A 1MRCL 4QJFA 4Z77A 4BBSH 4IYKA 1O9ZA 2P24A 3NJGA 4H5SB 5AAMA 4J2QA 2DH3A 1JICA 2Z4QB 3OIPA 3TBWB 2DQIL 3V79C 4D8PA 2FO1A 1U8KB 1EUJA 1KZQA 3MBED 1P6AB 1C5CH 2R2BA 4LF8Q 2MHAA 1HEJC 4M6OH 1TXYA 2MJ8A 1IU1A 4DKTA 1W72L 3QNZA 2ZJPA 3MV11 4P5TA 4HMIA 3VA5A 1GS8A 1WG3A 3HVNA 4YHZH 2R92H 1T83A 4BY1G 3T1YL 3DGGA 5DYOB 4ALAC 3VXOA 4MQSB 5FHAH 4Z7OF 1UH4A 4K8RH 1PZAA 3S34L 1CU4L 5I1EH 1IL1A 5DM63 4FNFA 5B7FA 2CAKA 2JKTM 1MZYA 5LGJB 4PV1C 1YUKB 1MW3A 2WVVB 4GW5A 4Z9KB 4UQCA 5DJ0A 4AY0A 4I89A 5I71B 1UQSB 2YQ2A 3MLPA 2X7LA 2A5UA 2P47B 1ZT4B 3WNMA 4HPYL 3A5UA 3RGHA 3H2QA 5EOCL 3MODH 3Q1SH 1ZVNA 1TWFB 4WHYG 1WFIA 1SYEA 3HMXL 4DV4L 2JB5L 2C3VB 4RGNC 3NH7H 1CGSH 5EUOB 5JOFA 3C6LC 4OWTB 3BD3A 4WIQA 4NUMA 5AW5B 2HVKA 4HEDA 4LL9A 2NZ1D 5IGGA 1QUNA 3O45B 1OGSA 1YMHA 4M7LH 1QVFA 2BIHA 3B1UA 2I25N 1MFMA 2Z64C 4UM8A 4DP5X 3RN2A 1ZHKA 3T0XA 1SSOA 4LGSB 4WLCA 5DF0A 3QZPA 5CEXA 3F1ZA 3MRRB 1G7PA 2CHNA 3D18A 2UZYB 1YQVH 1I8AA 2L0CA 3BZ4B 5DA4A 3TNMB 1MFDL 1S7QA 4LFBL 5TDOA 4EXKA 4JFYB 2F7PA 1G7HB 4N0UB 2UVFA 4NRYA 3S3BB 3U79A 3WTYA 5CEYA 2FLRT 4U1GC 1ZT1B 3IS1X 3IAQA 2FECI 3MBEB 5HY9B 1FL0A 4OFVA 5KANI 1E2WA 4Q52A 2XQYG 5D6DA 3P30L 1INQA 5M95B 2ICWJ 1N3NB 3FXIC 2NXZD 3SDCA 5F1SA 4KTDL 2H47C 4FA8A 3BVNB 4NQVA 4CMMB 2NZIA 4AQOA 3KYOB 1XIWD 1PH1A 4Q56A 4A3JH 2GTZA 4YHOL 5ECGA 3KYAA 1NA8A 2RDGA 2EIJB 4JQVC 4J3SA 3V5HA 3NP8A 3LKRA 1BD2A 4WWPA 2WVSA 2B2WA 1ILSA 2A74B 4DR1L 1RZGB 4R7NA 4NBYB 4L23A 4Q14A 2A77H 3S5ZA 4TSAL 5I23A 4WY7H 2WQSA 3SQBA 3VW3H 2HWZL 5C2UB 5I82A 1RZ8B 3FVQA 4NGHL 3OYYA 3D52A 4HEMA 1JS4A 4GRLD 4X2UA 3MV7D 2FNBA 3QIBA 1HZBA 5E8PA 1ACZA 3QUMA 5DHYA 2PW5A 4NO0A 1MWAL 1TLKA 4G71B 1X3FA 4PJCB 2NW3B 1ZK5A 2H1XA 4UZUA 3HEJA 2JB6B 2J4XA 2D7TL 3FU7A 3QHTC 2BZCA 4J3OH 4PP1D 1KC5L 5K9OB 2JP1A 4I2XB 1I4QA 3FU8A 4PRDB 5CWSB 3NSXA 2AZUA 4B3RQ 2KHAA 1O75A 3DI3B 1WTXA 3BLKA 3FKIB 1CLVA 5EPJA 1RJLA 3OSOA 1OVZA 3ARRA 4F9LC 4BQ6A 4LFCQ 2ZSVA 2JKLA 1E90A 3GP7A 1F4HA 5D1ZB 2Z6FA 2GABA 2K5NA 1XL4A 4HPHA 1JSYA 1NICA 3BH8A 4GP4B 1I82A 3L5XH 1LO4L 1BQ5A 4BQCA 2KA7A 2DI8A 2FGWH 1S9VB 2UXVA 4JPSA 3U0WH 2XVGA 5EORL 4NFCA 4TUKL 1HTPA 1KTLB 1ZKOA 4FLHA 4X4XA 5CCGE 4U1IA 3EH5B 4CDGC 1UD4A 5KJ4A 4G1MA 3HRZA 3V10A 3A4EA 3GTQB 4L5FH 2WNGA 1XIWB 3EOAB 1KD1C 1AGDB 1NEUA 1UXSB 5AOMA 4YOKA 1OLZA 4AE0A 3BMWA 2WCSA 3S35X 2A6EC 2ATKB 5CLZA 1JZIA 4IFDG 5BMFH 5DMGC 4P5TD 3GMOA 2X9WA 4XO3A 5LG1A 4BIKA 2UXFA 3BYYB 1O7IA 3P73A 4PI0A 1ZS8B 5HYIA 4EVNB 4BBSG 5JQHC 4KHPL 2LW3A 2Q2TA 3GBEA 4KPHL 4YWMA 5FGSA 4DGYH 1KIQA 1I1YB 1CKNA 3SDDC 3SDAA 1XF3B 3A0OA 3C9NA 4GRLB 5TGBA 3MV7B 4PCSA 2DQFB 1ZYRC 2EIKB 3GI9H 1FN4A 2R92G 5TE6L 1ITBB 3VXRE 1X54A 3OZLA 3UTTA 5A2QL 4E9QA 2BSSA 3VFWA 4ZD3H 4YSRA 3SE0A 4X66Q 4FNSA 1WBZB 3PUXA 1O5PA 4X6FB 3CMAA 1GYAA 4MKMA 1NIEA 1RZ7H 3CAFA 2X4RA 5L4MA 3B9KA 3CCHB 3ARED 3QH3B 1PY9A 3ROLA 3RPKA 3MXWH 3GTMH 1F42A 2D0PA 1ZLEA 4U6XB 1JXKA 3O41B 5FB8A 1QATA 4AKQA 4H0HB 1MCWW 5DMIH 3CQQA 5JIDA 2A68D 1BD2E 4PM1A 3BLPX 2ZXRA 5CGTA 3S98A 3MJ8A 2NRDA 5DD3H 4KKLD 1TWHB 5FW8A 3S3SA 3MTRA 3H15A 3PIP3 3IDYB 3TH2T 3VXRD 5C8JA 2NVTH 2IBZY 2Y7QB 2GFBB 3MC0A 4P5MA 3LVEA 3U83A 2YS4A 5L2JB 1R3IL 4OM1L 3WL9A 4JFOB 4JO4L 4E5XA 5D93B 2KUTA 1DJIA 4LSTL 4PLJC 1YEJH 4UQ3A 2F1MA 5B39A 1CR9H 5I0VA 5J9PA 3W3BA 5CN3A 2DW5A 2WBXA 1OAKH 2FEDD 2YRLA 3SD5A 5J8OA 1KN4L 5BZDA 1ODUA 1ROWA 2OX5B 3PWNA 5KBPA 4F37F 3DK2A 1A02N 2DBLL 3P75A 2VABB 3CLEL 4WO0A 1HCVA 1RJYB 4GKNA 1OAQL 3U7WL 2H32B 5JPMB 3Q0AA 2NDGA 2ZWSA 4GT7A 5BJTA 3EYFB 2CH4W 3GSUB 2J5WA 1JHTB 4C54A 1OGAE 1QACA 3OZKA 4W70A 4PJGA 1FO0A 1A4BA 1KLGA 4KK8D 4U3CA 4OF5A 4DGIH 3HRPA 5LMNW 3MMEB 4ATWA 1U30A 4A3JG 3KLAB 3G5VA 3BDYH 4O02A 3QIBD 1DR9A 4P49A 1WH0A 3NBHA 3AREB 5IOKA 5IW6B 3WFDL 1YEIL 2OYPA 2AV7B 3TCLB 1A4KA 2SNMA 3S2DB 1A2UA 4E9RA 4J12A 3BRGC 4QUFA 1L6XA 3TS8A 2Q2LA 1P6FA 3WBDA 4PRPB 5JXAH 3ATFA 2AJXL 3KPPA 4YXKH 3U82B 1R46A 4XCYB 1LD9B 2Z1CA 2XA8H 4JI5L 1BXAA 1S7SA 1X3QA 2K1BA 1CQFA 2JLPA 3FW6A 4LKCB 4UINH 4E9WA 3CSYB 5AYTA 3EBAA 5EU6B 5I6XC 2A9NL 2BSTB 1NCBH 1EEYB 3CVBA 1XTLA 3VXRB 4BK5A 2IQ9H 1OGAD 2R23A 1ML0D 3D85A 4GAYA 3CC5B 2NX5B 5HHQB 3CPLA 4W9ZA 1AI1L 4XOCA 1CBJA 4F7PA 2IJ0C 4J3OG 1WD8A 4JI2Q 2RQXA 3SPVB 1YNXA 4HKBA 4XNUL 5B3JF 2JLLA 1AZBA 2RDFA 1ORQA 3UTTE 4X83A 3K7AB 2NVQB 2W81C 4XP9L 1SJXA 5EA0H 4DV7L 1Z66A 2O6PA 2L11A 3G6DL 5C0EA 2C3HA 5MERA 1NGQL 2OJZH 1X7TA 1OWWA 4TL5A 1WCBB 1CFBA 4OLEA 3V7MA 5JYMA 3IKKA 1OF2B 5D96B 3WIHH 3AQQA 5AZ2H 2O5ZL 1HVXA 3T3PE 1WS8A 4PJEF 2C1OB 4DCQA 5LMNL 4FADA 1KIRB 3TN0A 3BIKA 3H42L 1LO5A 3P3YA 1I1AA 3V4PL 2D7OA 3N42B 1PTOD 4G8FB 3F7LA 1U8OA 1BVNT 3JTTA 5LNEA 3PP3K 4CILA 1NCNA 3K4DA 2OMXB 2EYHA 2P5ZX 1S7RA 1J9CT 3II3A 1KXQE 2MKLC 4OZHE 3UYPB 3UZVB 1J10A 1S7WB 3PGDB 2ROYA 3KPMA 3STBC 3GMRB 4BBRB 2V5SA 2XPGB 3NEEA 2RBMA 2GIYA 4JO2L 1DCLA 1GZPB 3UTTD 3MVSA 3IMUA 4WV1A 2VXSH 2DV6A 3L4TA 2OTUB 2QGEA 3BUYA 5DHVH 4DN4M 3K6DA 2RCSL 5ESQA 5IW1B 4WCYL 4APXA 4GQ9L 4F5CA 1EYGA 4M1GH 2IPKD 2V7NA 2JKIS 2P5EE 2W65B 3SGKA 5LBSH 2AJUL 5AUMA 1HHHA 5C3WA 2CLZA 3UDWA 1E6JH 2ZG1A 2QF7A 3QUZC 4DPAX 2VERA 1DN2A 1S8DA 2JCCA 3RLSA 3J80c 1FZJB 2XTSA 5FYJE 1BAFL 5IB2B 1PX4A 1W0WA 3UCRA 4KTYA 1OGAB 1ETJA 1XZ0A 2F7QA 3EJYC 4O51A 4OAWA 5FCUL 3TCTA 4ZMYA 3T16A 3H3BC 2HX8A 1JCVA 4ECNA 2A5HA 4X4YB 3EYQC 5I6OA 2EEBA 2CXGA 5C7XL 3KYNB 1Y07A 4XNMB 5EZIH 2I9TB 1CPUA 4B27A 4QTIL 1LT5D 1QNZL 5F1OB 1F13A 1UWYA 5KYXB 1FVEA 4U3HA 2YN5A 4M7KH 5D7IE 2XWTA 3HJ0A 4HOMA 1FNUA 4O2EB 5TH2A 3HFFA 4A2EA 2P5ED 2G5DA 4QY8A 3CVIL 2IBBA 2ICEB 1XTMA 2ESVA 4XNQB 4BUGA 1EHXA 4TL4A 4DV5Q 3VXQB 2EIZA 1GHJA 1PZ2A 4NC2B 3VXPB 4BFKA 4LF9Q 1PTOB 1OO9B 1ODAA 2Y2TA 5CIPH 5CJXA 5AVZB 5E03A 1TIID 3QIAA 3AXLB 3QQ3B 5ITFB 3VSVA 5JEAG 3AUWB 2VLKA 3UAJA 3MOAL 1OAJA 3O8XB 4QXVA 1BOGB 1E1OA 5IJVB 1G7JB 2NNCA 4KKPA 5F7LB 3PGFL 2VR8A 4P4RB 5FKAC 1JOIA 2QQNH 1ZGLB 1MI2A 4DR2Q 3LTVA 3Q7JA 5F70A 3WHXB 4A3BB 4MD0B 2P8MA 4XI5C 4GINA 2ILLA 1S9WB 4IRSC 3NWTA 2IPKB 4RGOH 1J5CA 2QLVB 3N9GH 5T5NG 5TF1L 4KWUA 1Z9FA 3CG8A 1PZ5A 3OAZH 4YLQT 1A8ZA 2ZXDA 3EZ8A 3KXFA 3D30A 2WKCA 1XPUA 3OJDB 4J39A 1Y0LA 1R9TH 2CJUH 3NSYA 1SMXA 3MCKB 2QQQA 3OKKB 3ULPA 3PABA 4PP2B 5KYNA 2BVEA 1B4JL 3HE7D 3GSNL 4C55A 4OCXL 1BCPD 1URIA 1K8MA 2E9GA 5CINL 4YN3A 1D5MB 4HXAH 4KJWD 4MXQD 4OZHB 1DVYA 4W9LC 2GCYB 1QLEH 5CNHA 3TLRA 5KBKA 4RETB 2VLJA 3FQ2A 3FQNB 4Y9GA 3RMHA 1YEEH 4FULA 5D7LA 5LQBL 1HHJA 1G291 4G80A 4AEIH 4Q6KA 1TCRA 1JFQH 2Z91A 1HEZB 2QPEB 1DBAL 2P5EB 4X6DF 5CBAA 5AVQB 4MS8C 3MROA 5IYBG 3RQ3A 4W9KC 1LVEA 5IVXE 3M46A 3NN8A 3H53A 2CLRB 2FATH 2HHHQ 1T04A 2WLMA 3P4MA 1SF5A 3L3IB 5T3XL 4F5CE 1E3ZA 4PB0L 1HQ4B 4HPOH 1FORL 1GIGH 4MA7H 1MIMH 2L1BA 2IF7A 2AXGA 3O6MH 1IJNA 2YMOA 1J8SA 2FL5B 4M93B 4BBWA 2ITEA 4FERA 1SN2A 1TQWA 3LSOB 4IPHA 1T03H 4OI8A 3TN0D 5GGUA 1NDTA 1N7ML 1PX3A 5FA4A 4K9EL 4R7VA 1PYWD 1TVXA 4G5AA 5L4IA 3TT3H 4G72B 5HVWA 1BVLA 1I94L 3ESUF 4U6VL 4J1MA 3L2PA 1TVBB 4KLKA 1WBYA 2ALAA 4GJTB 1EQQA 5C0IA 1H9DA 3Q06A 2G0KA 3MV8B 4PCTA 3J81i 1ESFA 1T89C 3G3LA 3SYCA 3QO0A 4GUPB 1G84A 4I4WA 3O6LL 2F6AA 1F6AB 2NNRA 3HE7B 2V33A 2F0LA 1Q9OB 3FB7A 1BCPB 4N0RA 2YPKB 5HHOA 2CUHA 1EERB 2ESVE 1O7YA 1CL7L 4UILH 3LKSA 2XQBL 4NQCE 5J13B 4JFPA 1NIBA 2BOCB 2PO6C 4OGZA 3HKZG 1XEUA 4BZ1H 3ULUL 1P7HL 5B8CC 4GZYC 3MLRL 5F9OL 3U9PL 3VG9C 5JOBA 1CZGA 3I3DA 3KR3L 2PTUA 3BWUC 1XF4B 1AIZA 3QXWA 4DIXA 1W6KA 1XR9B 1CGXA 3AWEA 3FQRB 3LNFA 3LPWA 3TPKA 1QPKA 2XJKA 4LBEA 4BFRA 1O80A 5GGQH 4LIQE 1XL6A 2ORBL 4AQEA 4UDUC 4APQD 1B8AA 5LGHL 4JFFB 3S2CA 2CBQA 2FYYA 4XP6H 4HUXB 2D2CC 2ZZUT 3QC6X 4FXTA 3WSQL 3ZUNC 5JHBA 1I8KA 3L45A 3ZT5A 3MFGA 1G9ML 2OKMA 4L8SB 1RLBA 1QFWM 4NQCD 4Z3EA 1N5YL 3J7A5 4YHHL 3D2UA 2YFOA 1PMYA 3GXFA 3GSVB 3M1BB 3PV7A 3GPEA 2FQEA 2AJSL 2BRRH 1ACCA 1EWCA 1PYWB 3F58L 4HH8A 2Q8AH 3ARTA 4B9KC 2ZE0A 2HUHA 2ZUUA 5GGSY 2HTKC 1GKOA 1HHIB 1OM9A 4F80A 3QQDB 2UXGA 3VH8G 4KOBA 2VLJE 1DANT 5DO8A 1DQKA 2BM3A 4MA8L 3BPCA 1GW6A 1NCGA 3NSDA 5AFAA 2ICWB 3NIFE 3QDJA 5IVXB 3MKGA 1TQOA 4L3EB 4RMWA 4ODTH 3GT6A 2VXVL 4Y19E 2D8KA 2O1AA 3J80i 1QFWL 1DTUA 1TS4A 2NTTA 1AD0A 5CBAE 1NLBH 5D71H 4X0NA 1PW3A 1P6WA 5DRNA 1T4WA 1CFQA 3B2MA 2MCMA 5KANG 3UOAB 2ES2A 4PY7B 2R56L 2VR6A 3E9TA 3GJFA 3OAYH 4Q9BA 1R24A 5A1AA 4ADIA 4K0KL 3D48R 3WFCL 5HYJA 3FN9A 3IDIB 3AY2A 1I7ZB 3I84A 3VWJC 1CF8H 1PRTF 1NJIC 1GAFH 2EE9A 5J1AB 5KAQF 3UBXA 5JW4R 2NR6D 3FUFA 5KSVA 1EK3A 1U2CA 3VGGA 1ICTA 1JV5A 1Q72L 1VGKB 2IX1A 1JPEA 2JKSA 4U2ZA 3T6VA 2GSIB 5EUKA 3F01A 1KAAA 3UTZB 4N28A 3F05A 3NZHH 1SFDA 3FU3A 2CBMA 4APQB 3IFNL 4EI0A 3VDYA 2GW5A 2XN9A 2G3ZA 3A67L 2QSCH 2I5YH 2LHAA 2F53A 2WB1B 3CHQA 4Y19D 3CXCA 2G9KA 4KVPA 4IZ8A 4LLMB 3KPLB 4NSKA 1S3KH 3I70A 4DR7L 2WTRB 3TZUA 4OKVB 1JZ6A 1A7OL 5IQNA 3QBTB 3KPOA 5JPNB 4NQCB 4X6EB 4P57A 1ZWIB 2J8OA 1MLBA 3L9BA 1A6ZB 1NUFA 3MGOA 5GAHC 5H2BB 5KVGH 3IJYB 4DF9A 3BVGA 4TRPH 3K2UL 4JKLA 4KI5F 3S3PA 5FK9B 1SPDA 1U8MA 4AV0A 3ITPA 2RR3A 4KO9A 4QJ4B 3EOTH 4ZUWB 2O2LD 1AG6A 5FGBC 1LT3D 4AGOA 3QCTL 4KAQL 4G59C 4MA1C 1DVTA 2FSEB 4DK6A 4YEFA 3DIVA 3K59A 5IJKC 1YJ9A 4TNFA 5G55A 4YMPA 4XMXA 4QHLB 1EANA 4TQHA 4HIEB 5EKKA 4ZTPH 2BVTA 1PIFA 1KIPA 2EDQA 2IGLA 3QUMH 1EH9A 1V7NL 4XRCB 4XN5A 1IBFA 5EO9A 3VJ6A 2EJGC 4EUPA 1MJ7L 2I85A 2WWKT 4OHJA 1ZPLA 3P2DA 4S1QL 3ZL4H 4DUZL 1E4XL 1W6JA 1KHIA 4GKKL 3FTVA 5I76B 2AQRA 4WJ3M 3EH4B 3MHZA 4G6MH 4DP6X 5BPPA 1I8LA 2O6CA 1RPKA 4ABQA 3D33A 3IFPA 3OMZA 4PG2A 2HH0H 3MU3A 4QCIA 3S8FB 5HTSA 2PYEB 3PWVB 4JKPH 1D5ZB 1L9PA 2HPTA 1EAJA 1XH3B 2K05A 1ZGLP 1D5RA 3GSRA 3H4HA 4W9EC 4TNWK 1SN8A 3KMDA 1D7CA 3PF4A 4FQXA 3LJ3A 3NIFB 4I1NB 1RKNA 5MI0B 5GS2H 2GI0A 2BWDA 2R9HC 3KW8A 1DVFA 3ISYA 4UCFA 4R8NA 1MJUL 2E86A 4CDDC 1Q9KA 2VR5A 3IF1B 1Q1BA 3RIFF 8CGTA 3HFZB 1DO5A 3VA2C 4DGWC 2F0MA 4OX9L 4QHNB 5I17B 2WINB 2HX9A 2PCPA 3QDAA 1XTDA 4JZOB 1ZSDA 4NNYA 3OJMB 3BVTA 3QUXB 4P46B 1B9MA 4GBXC 3M7NA 1J87A 4W68A 3H3VH 1XXFC 3OLGA 1FJ1A 1OXVA 1SNRA 1E43A 1OIOA 1IAIM 2CO6B 3SR1A 2B9AA 2IGFL 5AL8A 3S5LA 3D2UD 3CU7A 43C9B 4OIIL 4K5WA 1MELA 1FDLL 3RLOA 3QRGL 3L3KA 3MNDA 4OBRA 1BFVL 2B2VC 1D9KD 5C0BE 5E5UB 1RZPA 1WDAA 3VMOA 3UJJH 4PJEA 2ZTEA 4H8WH 4YSEA 1T0NB 3M7GA 4KROC 4RMFA 3QJOA 5HDBE 2ZX5A 4WHTA 3ARFC 3B6SA 2JTYA 4LNVA 1IT9L 3SGIA 2FHFA 2H2SD 3QWOB 3AQXA 4XBEL 1E6OH 4RNRB 1C7TA 3QOLA 4QXTA 1IAIL 2IX0A 2B8OT 2UZIH 4GG8A 5E4IA 4WK4B 4HKZB 4XPTH 3C5ZC 4PGJA 5D7SL 4P2QE 3ZQ9A 5J3BA 2GTQA 4PJCF 3ZMEA 4GY4A 3MJ9L 1K5WA 5HYQB 1J1XH 1YEGH 3FO2A 4FG4A 4JDTL 3TEYA 1NGXB 4XZUA 2GI7A 3H6MA 4BZ2L 1I4FB 1L7TH 1WFJA 1JPFA 2ADYA 3MWYW 1W72B 4PUBL 5JR1H 5AG9A 1RZIB 3GLEA 5E6ZA 3LZNA 3UTOA 5I0WA 3QJYA 1NCVA 5FJ8G 4GAJL 4OJAA 4MD5B 4ANXA 5HY6A 1KGCD 4MCZA 5C0BD 5FYLE 1ZV5A 1E5CA 1N8RC 3HI1B 4POYA 3DHQA 1HNWQ 3ARYA 2EXYC 4QOKA 3TZDA 2JVUA 2F58H 1HZLA 1B9ZA 2ZD0A 2ZSWA 3CFDA 4HXBH 3ARBC 4HBQA 4IMKC 4M7JL 1E0BA 1H3VA 4WWKB 3K3QA 1S7UB 1RUQL 3QCVL 2H2PC 2R93H 4XP4L 4P2QD 5FYJH 4HG4J 4A3CH 1OAUH 3I02A 4YEEA 1EJOH 1AXTH 2P5PA 2BFVH 2QTVA 3IJ7A 2L15A 2D3VA 5DJAA 3NIGF 5I2IA 3BEWB 4YPGA 1XWEA 2QILA 4ZKCB 3RZDB 3NEXA 4PJAF 3Q24A 1D9KB 2IAMA 1C1EH 4X5PA 1F3RB 5IT2L 5LAPA 1FO0H 2EYSA 2FT8A 5CV8A 1MQKL 1F4XL 4JO5A 4WO4D 3UBXI 2F0HA 5I28A 1TEGA 2HFEB 4OF3A 2XRAL 3FTGA 4O02H 2J1ZA 4F2ME 1LEGB 1PSKL 3I75A 4U33A 4A3GH 3O2VH 1DHKA 3C60D 4YHPB 1QR1B 3BAYA 1YY9D 5GRYA 2OQ0A 2WZ0A 1A65A 3GMMB 3V6OE 3PF2A 1MOEA 3QFDA 4JFDE 4MD4B 4UT6L 2C9SA 4UAIA 2J88H 1MPAL 1M4VA 5DD6A 1F3DJ 3TP7A 1C16B 4TMPA 1BBDH 1T3FB 3QFJE 1STNA 2CW0D 5GRVL 1MAJA 1KB3A 1CBVL 3OPUA 2EO9A 5A2QE 5LXGH 3H3PL 4H26A 5CO1A 5C0BB 2KYIA 2YAHA 1EJ8A 1R3HB 2CR6A 5EPMB 4QHKJ 3JYCA 2X6VA 3FOMA 5JHDA 4N90E 2JJWA 2OAAA 5BRZE 1JZEA 3GB7B 4MDIB 1ZVHA 1ZS2A 5HDBB 5J56B 5MP6L 2BNUA 3CZSA 5JQIB 3FQYA 2WLYA 1VFUA 4G57A 3CHXA 1OT1A 2DQMA 2MPAH 2QV4A 2VW4A 1E24A 3MRBB 4LLVA 4R2GC 4HJ5A 3REVA 4EIZC 4KKRA 2N49A 4PJEE 5E1HB 1VDZA 2VZ3A 2VO5A 1CXFA 1D6VH 4ONGL 4RWYL 4GSXA 5IBTL 3HCVA 1A7RL 4MHHI 4NKDB 5LCVL 4JFDD 2H45A 3DTXB 5LNDA 3WFEH 1HZHL 3R2IA 4Z3GA 1ZXTA 4JJOA 3OZ9L 5IHZA 4DT2A 1MWAB 4X6DA 5JO5B 3QFJD 2NY5L 1CKOA 4TTGA 4OGYL 4IJLA 1CFNA 2WGXA 1N32L 4WNJA 4A3MB 3QJVB 1ACXA 1AZVA 4WO4B 4DEWA 1VERA 2FO8A 3WLBA 2CIIB 1QOHA 4NMZA 3BD5A 3PHOB 4OZGF 4UZSA 2IDUA 1UZ8B 3SKOB 3H9HB 1OTTD 5C7ZA 2XRQD 4M1UB 2CDGB 4FKHA 1NEPA 3QEQA 2COQA 3QISA 5BRZD 4Z76B 1H9RA 2YGNA 5DJXB 4DSYA 4BRVA 2ZUSA 2DKSA 2PYFA 3C60B 1I1FA 2MO1A 4FXKC 4QXGL 4H20H 3FCTA 5SWQB 4GNXC 4PWGA 3I50H 3PSIA 1J0HA 2MFIA 2FWOA 1N36L 3PIPA 1P9MA 3RKDD 1I8MA 3ROOB 2E0PA 4ODVL 4FQHB 4JZNB 2ZG2A 1GS6X 2K8MA 1X5ZA 2OW6A 3CUPB 3E2HB 4K5VA 2ZUQC 3HOZB 4OZIB 2JA5B 2ZX6A 4KRNA 3UTPE 4HWZB 3J81L 3CFIC 3ZT6A 25C8H 1JDDA 2Q3XA 1VQOA 3F5WA 2H0FA 2WBJC 4AYDC 1DBJL 3II2A 5I1HL 4OQTA 2CUIA 2DMGA 4F2MB 4U1MB 2V3DA 5DD0L 2A9AA 4ONOA 1DQJB 4UIKL 4FF3A 3V55A 3BS1A 4MSWA 2EE1A 2J43A 3FT3B 1YY8B 1IM9A 1HNXQ 3PU7A 2X89A 4XO5A 3PDGA 5IGXH 5INDA 4QF1B 4YSPA 2OMVB 4RGMB 5HVFB 4ETQA 4JLRA 2ETWA 5IE8A 5EBCA 4HJ9A 5GROA 1LWJA 2X4OA 3QFJB 4HT1H 1SJHD 4PB9L 4WRLA 5FGCB 3U4ZA 2IAAC 5HI5D 3CCSA 3GZPA 4HIHB 3QDGA 5C0NC 1VQKA 2IH9A 2AJYH 3PV6B 1NUGA 3JWNH 3N85H 4AQYQ 3T0EE 5GGSA 4BKTC 3QO2A 5HVGB 3UTPD 4G8EA 5BRZB 2R4SL 1K72A 2OEOA 1MIEL 3EDFA 3L3OA 1TZGH 2O5XL 2R0KL 4E5XG 5I6KA 4I1PA 5B39G 2Y4SA 3C09C 3IGFA 2IAMD 2EE3A 4KTEH 2P80A 1HR0Q 1K0SA 3HR5A 4LIQH 1N6QL 2HJKB 1OCCB 2R93G 3DPBA 3TN2A 4UI2A 4N9TA 4A3CG 1NCDL 3GFUA 4Z3JA 2NLJB 2YA0A 3AM8C 5HDLA 3KLHD 2F5BH 2ENQA 4K3JH 4MKTA 2QKSA 4FGMA 4QHUA 5I8CA 4X80L 4FKEA 3T08A 4N3UA 1JB3A 3TO2A 2YJQA 4MJIE 2Z7WA 2C9RA 4EDWH 4UANA 4K94C 1TEYA 1KBGL 5KYLA 3ILQC 1NWOA 5CR8A 1VEMA 3ZZ1A 2EXWD 3BLBA 1AHWC 4YAQA 1HYSC 1VQ9A 4TVPE 3EAKA 4RRPG 1FC2D 2RCNA 1MI5A 3UTSB 3MRGA 3T0ED 2R2HB 1SVBA 1T1YB 3EO0B 4ODUB 1G7LA 4X6DE 4Z7NB 1RPQA 4JI3L 3J80L 1IZKA 1AAJA 5C0FA 4OV5A 2OXHA 2XKSA 4ZS7L 2F74B 4A3GG 3MO1B 1KAWA 1N26A 3KBXA 2FNWA 2I7OA 2VS1A 4XGZB 5IR1B 2JI1A 3SODB 4NPYB 4NZ8A 3VGDA 3H0TA 4LLUA 1V1OA 1BQUA 1JDAA 3ZKND 1D8LA 2EUXA 1HKFA 3U7AA 1MCQA 4JK0D 3LAFA 1ASYA 2CKNA 4K0OA 4DV1L 2AEWA 1NPNA 1SJHB 4M48L 3KWTA 4NJ9H 5L7XH 5EZLB 2HVBA 5M5WB 3GTKB 2E5EA 1I9RH 4LSSL 4MJID 1VB9A 4HUVA 2W0LA 3IBEA 4PLNC 1SE4A 4H02A 3BHBA 1MJJB 3WKMH 3KWWA 3F12B 2QEJC 3L5WB 3QORD 5ELOA 3CH1A 4HDIB 3DM1A 1IGMH 4DKDC 4PGEB 4N0CD 4YFLF 2DQGL 2ARJQ 5IKCB 1FGVH 3ZZLA 4ENEC 1CGTA 3LHAA 4MAYA 3OWFA 4MMXA 1YHBA 1L0PA 1UWXK 2PW2A 3KF6B 5CORA 5JZ7D 3U6XA 2VISB 3OAWA 1Y1VB 4L4VA 1RMFL 1BKBA 2FJSA 1KFAH 4Q89A 3DVGB 3RX5A 1USQA 1KXVA 1MDAA 3GHPA 3QG6B 4FZ8L 5KOVC 1R3KA 3BP4B 3KWUA 1SYSA 2CHWA 4PSPA 5F89A 3SE4C 3QI9A 4X4KA 3U1SL 2EILB 1DVZA 4I0PA 2WVVA 3RWHB 4W9IC 1DGSA 3A55A 4M1DL 1KJ2A 2C9PA 4UQ2B 4QQBX 4PRIA 1EUUA 1IZJA 4RDBA 5DVNA 4ZTEA 3MLXH 1V27A 4RISH 1JTOA 1CM9A 1O78A 2MGSA 4JN1L 4DK0A 1T80A 2WBWB 5F6HI 1XF2B 2WY3B 4AJVA 1G9NL 5KYIA 5FWQA 3LRHA 3Q8BA 4ZMNA 5DC9B 1ADQA 2XPYA 1HXYD 1JGLH 3U1PA 2JIXA 5DRWA 2EYTB 5GSRA 3VYTA 1HAUA 1GPOH 3BPNC 4JGNA 4EIBA 1NGWA 2K03A 4S2SA 3UPRB 4W9FC 2CPUA 1Q1JL 4N25A 3HOUH 3VWKA 5JW3L 3TFKD 1H5BC 5IF0B 5BXFB 2DQJH 2VDLL 3P4LA 5CR3A 3V4PB 4MJIB 1ZPUA 2X53A 4XC3H 2AC0A 1NUCA 1IM9D 1WAAF 4OCYH 1HOCA 2F54E 1I8UA 3LV3B 4J8QA 4K7FA 4OLWL 1FE8H 4X50A 3VQ1C 1Y14B 2AMCB 3IJSB 3T51B 2R27A 4FQPA 4R0LC 1QTSA 3ZDWA 4PJBB 5DQJA 5C97A 2Z65C 4ORGB 2HJFB 3VE0A 2E2IH 3SK4A 1TS2A 4X6AH 4J3XA 3A6CH 1KPUB 2GUYA 1GHKA 2GVYA 2VDQH 3EYOB 4FFZL 4OQ1A 4LF7L 2VQFQ 1MI5E 3H55A 1M1SA 5E8NA 2RQ8A 1YNTF 5KSBE 2Z8WC 4Z78A 2YGVA 3TIDB 1TQCC 2LU7A 1A7QH 3FRPA 4JRYE 1P4IH 1N3NA 1IAOA 4PVLA 3NK3A 4P23A 4QRQB 3QNXB 4UT9H 3O4LD 4Z0XA 4BSWA 3BVNA 4YUEH 1JYWA 4BA0A 1BUVT 2YBGA 1B70B 3T6WA 1JZ7A 3PHAA 4IK6A 3KS0J 1NCAL 2EDRA 1XH0A 1YJDH 2VDML 3DX9B 3F64A 1BFOA 3JWNG 3IDMA 1BMGA 2F54D 3QHZL 1U8NB 2FSDA 4JHZA 1U3JA 4D0BB 4N8UA 3MRDB 2OXGB 4XODA 3GJFH 4ZPTA 2APBA 1YITA 1T21B 1EVUA 4KH2A 1CD1B 3GO5A 4WJ5A 3PJLA 5JJZA 5GZOC 5CUSH 1G7QB 1V54B 3NTKA 4LKXA 1HXYB 4NAMA 3LD8C 1MI5D 3BXNB 3NTHA 1Z5LB 4CJ1B 2HQLA 1R47A 2JF1A 4XBPB 1SR3A 2FINB 3WLWC 4JRYD 4RFEB 4EJ1C 4KD4A 3K5RA 1IL8A 5B1BB 3CDZB 4H8VA 1ZA3B 3A8KE 2YZ8A 5D2LF 1ZJBA 4ZCKA 2QQLL 4Z7VF 1H9JA 4KI5E 5EU3B 4M03A 5AVWB 5KS9E 5L2KE 1PRTD 4L4VE 1MEXL 5E56A 3W11D 3ZDXB 3FK3A 5F71A 1NMBL 3KHQA 1A6TB 2EIFA 5BOPA 2Q10A 3V0DA 4AKPA 1VACB 2H6PA 1RUPL 2HG5A 2E6JA 4AUUA 1TXKA 1L7IL 3OHXA 1F45A 1UXWA 1ZKAA 1J0JA 1JB7A 3CC1A 3LZOA 3MRFA 4NIYE 5D1ZA 5E6IC 4FG6C 2FMMA 3DBXA 1OKEA 3DK0A 4IOSD 4D0CB 1P7QB 3AS1A 1YEDB 3D0FA 5FO2A 4DQOL 4CNIB 4TLTA 1QWNA 4L9LC 3T6ZA 2CKZB 3FCSB 1X6NA 2Z92A 3O4LB 5FYLH 3BCDA 4CADB 4OD2B 3TBBA 2YPLA 2A4ZA 1JPSL 4YDVA 3HE6C 2BE5D 1WFMA 4HIXH 4IMLA 3GSNB 2IPTL 3BZCA 2WXQA 2F54B 5GGVL 5I75B 1GGYA 5L4JA 1A5FH 4L8BA 4PJAA 5CXPA 3E3QE 2AQSA 3DX7A 2B59B 4Y8DC 1G6VK 5L2KD 4QGUA 2GK0B 4L4VD 3ZHNA 3TF7C 3EHBD 1KDBA 4EVNA 1VQ4A 1MY7A 2CHDA 1KIUB 2FMCA 5M3MB 1PTZA 1MFVA 3OD3A 1A6VL 3TVMC 1UD5A 2NTFB 3FDTA 2PNDA 4Q0XH 5KSBB 1DBBL 1P2CA 1XR8B 2BHUA 2Y5TA 4LF4Q 4N22A 3D5OF 4A2DA 3F2CA 1SBSL 2ED6A 1QOKA 5ABDE 3MJWA 1TEFA 1IEAB 1MCNA 4GIAA 2OJ1A 5I2YA 3QJTB 4JRYB 4M1CC 3L9AX 3NAAH 2XN0A 2Y0SA 5J6SA 4LGPB 3FU6A 3RZCC 3D25B 3RJOA 3V2TA 3CIAA 4OLUH 4NRZA 3PUYA 4ZUUB 1G7MB 1N4XH 2X1WL 4FQLL 4WQOA 4YIQA 1N2RB 2G60H 2AQ2B 1E5BA 3CFCL 5FYKH 4KUCD 3FAWA 1JNLL 1H3PL 1U91B 2DLFH 4U1HB 1RD6A 4A4IA 3QH3A 3CN0A 3VWKD 2VNUD 5HDRA 3SE8H 3NUCA 2Z9HA 3QCUH 1RK1B 2KUMA 2YFNA 3CFBB 3R0MA 5GGRA 3WN5A 3RVTD 3RPIA 5CGMA 4HGMA 2CSPA 4A3FB 4FQIH 1BZEA 1UA3A 1FFTB 2LVCA 1FZMB 1U2HA 3V2AR 4ENZA 5IM7A 2W1NA 2A2QT 3KOJA 5M3FB 1F2XK 4Y5YA 5KIXA 3HOUG 2XY1A 1PKQA 5F7HA 1CO1A 1BMZA 2WWMC 2X9ZA 1EQTA 5G4OA 4JI7L 3C6SA 4NT6A 5EF1A 1BQHB 2GFBA 5F7FA 1I7UB 3SY6A 4JFOA 1PYBA 1BYOA 4Y16A 2K32A 1JPTH 2LLNA 3DXAA 1IIIA 5K93A 4WI0A 5KS9B 5L2KB 3T77B 1FCGA 3PIO3 2BMKA 2OCJA 4JEGB 4JS7A 2ZCHH 3I91A 2Q7NA 4KY2A 4MFHA 2KDGA 4M02A 3V0GA 3IYLW 4XNDA 4IOIA 4JDEA 5D72L 4OZGA 5ES4B 3NJLA 3TZVC 1Z3RA 3S36H 1NM4A 3BN9C 1YUHB 2Z34A 4OR1A 3DDGA 4QRSA 4ODWB 3KVQA 4QF4A 2MIZA 3GSUA 2ITCB 5CN1A 4OJDH 1PG7H 2WVTA 4X5WA 5FHBL 4GXFA 5FM8A 2BVOB 4OT1L 3VSQA 3O4OB 5C07B 3AB0B 3DRQB 4JVUA 4PW9A 1Y8PB 2CO7A 2G30A 2GC4C 4M6NL 4WUKL 4XTRC 2HPOA 1QBAA 5E2UH 2QDBA 1KENL 4XN8A 4ALAL 4AQAB 3CCLA 1REIA 3R7RA 4U1LB 5EO1A 1DZ0A 4LFAL 1OL0A 2N56A 4QHKI 3RDJA 4E42A 5LXVA 2YPLE 3DOSA 5A2FA 1QHOA 2C9QA 1M7IA 3NIGE 3WXWL 5ICUA 4B9YA 2AHOB 4PRPA 2IBGA 2ZAHA 3ELQA 1CK0H 2H4OA 1RHFA 1CDGA 3D4WA 3WGUB 1NC4B 4M8VA 2Y3AA 1AHMA 3GXUB 2OMZB 3K5NA 3RDTC 2FTAA 3UBXG 4JFEE 4ZOAA 3UACA 1MHCB 4GQPH 3D2TA 4QYOB 1JNNH 1OP5H 1GR7A 2BIOA 1RXLA 1PV4A 2BK8A 1A7PL 2CLVA 4QAWA 4HS6A 1IYJB 1FNSL 5IQ9A 3ORJA 5I9PA 1EEYA 4P4KA 4BFEA 1EWIA 3CPUA 5D1QA 3RWCA 3QS3A 1D5BB 1MHHB 5D1XC 2V3EA 5DJYB 4Q9QL 3W1GA 2NX5A 1UCBL 2X4TB 4MRBA 3TYGH 2WXIA 1OB1A 2YC1A 3I4MH 1F90H 2FX7L 1AS6A 1ECYA 2PO4A 3BU2A 5CJOH 2KKQA 3CK0L 2GIMA 2CKBH 3TL5A 3RI5F 4F7TB 2EVHA 1LTTD 2N3SA 1QO3B 2FX8L 2YPLD 5KSAC 4A2HA 2NN6G 3IN0A 5DT1L 3BH4A 4UBDC 2YTXA 5ALCH 4GQRA 3IXTA 1P84K 1RULL 2YZ1A 5DGQA 4KFMA 5EC2A 1KN2H 4GO6B 1GKHA 4YSDA 1S9XB 2HTLC 3ESMA 4JFED 4DEPC 3KEHA 3VRJB 5CAYB 3S16H 1AGEB 2Q87A 9CGTA 2C9UA 1R3JA 1VFOA 4KX9A 4RAUA 1LILA 1UE5A 3MHBA 2FIRT 4GW1B 1XT5A 3BVXA 3UZVA 2GTWB 3KJ4C 1UM6L 5FLXc 1BBXC 4X7SH 4EUPG 2AI0L 2DF3A 3JQOB 1TS5A 4AI7A 1KC8C 4WKZB 1N8ZA 3HN5A 2Q2IA 3H9SE 4ZX3A 3EFXD 5JJLA 2M83A 4HCRL 4ZDHA 1ILPA 2ZCLL 3L54A 3DO4A 3V4VL 4EDXB 4JM4L 3V7AG 1JN6B 3VFMB 1IQDA 2P46B 2B4CL 3CN2A 3RL2A 1JOQA 4FABL 1F56A 3GO1L 3T4AB 2XG4A 3N1GC 1HNGA 3I85A 4N20A 4BUQA 2X2HA 4B9IA 1T83C 2VL6A 3P9MA 2HUEA 3S3JA 1I5FA 4TVPH 4DN3L 3R8BA 1NM9A 4S1RH 1RQ5A 5BN3A 2GG1A 2Y7NA 4ODSH 1OXTA 3I4OA 3PPSA 3ZYZA 4Y4KD 4ZPVA 3I8ZA 3JUZA 4DVBB 1VSCA 4X65L 2VL5B 1NMAH 5F88A 4DZBA 3CLFH 4NOFA 4X6CB 3IPEA 1DP0A 1JZDC 2VH5L 5BZXA 2F7OA 4QWWC 4U05A 4DK3A 3ARPA 3H9SD 4WNQA 4CBZA 2JKWA 4Q9RH 2WYHA 2Y1ZA 2K7QA 4YE4H 5E1GA 4XAWL 1EAOA 1FGBD 3BWAA 1L9RA 1HHKB 4EZMA 1LLAA 3DJSA 1J5EL 4IPDA 4AMKL 3FT1A 2YD1A 4I18B 4R83A 3O0RL 4QJ5B 1QUQA 3PHSA 4PJXE 5IB1A 5ELFA 3RVWC 3S5LG 2X3AA 3E9HA 2R0LH 4LESA 5I1IH 3VFUA 1EX0A 4QO1A 1QBMH 2VLLA 3DX6A 3CCUA 1ZD6A 4A63A 5HD8D 5HVHB 4DN4H 3AXLA 4JMNA 4A2LA 1GCFA 3GV6A 4HMDA 4PGZA 4UOJA 4N85A 3VD5A 3BZFA 1KXTA 4X64L