4FXGC

Complement c4 in complex with masp-2
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
287
structure length
287
Chain Sequence
b'VVEEQESRVHYTVCIWRNGKVGLSGMAIADVTLLSGFHALRADLEKLTSLSDRYVSHFETEGPHVLLYFDSVPTSRECVGFEAVQEVPVGLVQPASATLYDYYNPERRCSVFYGAPSKSRLLATLCSAEVCQCAEGKCPRQRRALERGLQDEDGYRMKFACYYPRVEYGFQVKVLREDSRAAFRLFETKITQVLHFTKDVKAAANQMRNFLVRASCRLRLEPGKEYLIMGLDGATYDLEGHPQYLLDSNSWIEEMPSERLCRSTRQRAACAQLNDFLQEYGTQGCQV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Complement C4 beta chain
publication title Structural basis for activation of the complement system by component C4 cleavage.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 55
structure length 287
sequence length 287
chains with identical sequence F
ec nomenclature
pdb deposition date 2012-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01759 NTR UNC-6/NTR/C345C module
C PF07677 A2M_recep A-macroglobulin receptor binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.120 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4fxgC02
2.60.40.690 Mainly Beta Sandwich Immunoglobulin-like Alpha-macroglobulin, receptor-binding domain 4fxgC01
1XWEA 5FO9B 1GXDC 2A73B 5FO8B 1JC7A 5JPMC 1EDYA 2I07B 1BR9A 3FRPB 2E2DC 2A74C 1UAPA 2TMPA 2ICEC 1AYOA 2QKIC 2B39A 3HS0C 4FXKC 1UEAB 4ILWA 1D2BA 3L3OC 3HRZC 1BUVT 5FO7B 2PN5A 1OO9B 1PXUA 2J0TD 3CU7A 3MA2B 4D94A 3OHXC 5JPNC 3CKIB 4LNVA 3I70A 1BQQT 3KLSA 2XWJB 3T4AC 3G6JB 2XWBB 3V96A 5FOBB 4FXGC 1BV8A 2WINB 2WIIB 1JB3A
chains in the Genus database with same CATH superfamily
1N12A 4Z6AT 3VWJA 4JG9A 4BIKA 2A6IB 3Q44A 3T8VA 3BZEB 4MJIA 1FFPB 4FKKA 4GPVA 1F00I 3NSXA 1PYWB 3EOYG 2ZKYA 1TZHB 1DTUA 1IKMA 2XXCB 2K1MA 1IJ9A 2VDKB 5I0ZA 3SCMB 2XBZA 3ZBMA 3O3AA 5BS0B 2R9HC 3OMGA 4M3KB 3MFFA 4YDLB 4OD1L 4MFHA 4XNXH 3IRBA 4NCC1 1B4RA 1QFWH 2JCCF 2X2YA 2A19A 1YYML 3ND8A 3KCPA 1MKFA 3BW9B 3S35H 1R3IL 2X4QB 4GUQA 5T1LD 4ZOCA 1RZ7H 3WN5A 1MW1A 3V6OC 1B7YB 4YWMA 2R1WA 6FABH 1DVTA 1IC5L 2HLFC 4HKBB 1H15B 3RKPA 4L29B 2ODIA 3QZMA 3F58L 1KGCD 3UOAB 1AQKH 2PWDA 2C1PB 3T2NH 3EW3B 2Z4HA 1DO5A 2I60L 3EH2A 4HIHA 4ZOAA 1V43A 4RGOH 3SY0A 4AIXA 3OIPA 2ILLA 1PFNA 3C60B 4PJCF 5LAPA 2ZSVB 1N64H 4B97A 1K2DB 4JANA 4M1GL 1CDYA 4U3SB 3WUZA 2R1XB 2BIIA 2AWNA 1B4LA 2EE3A 4J3UA 3QNZB 4O2CB 4B96A 3MGTB 3KPPB 3PABB 4RNRB 1OSYA 3P3SA 1ZDQA 2HLAB 1EY6A 3KGSA 1T21B 1U91B 4R9HA 1INQB 5TPWL 3ETSA 1N18A 5IQ9B 4S1DD 2Z7UA 4QRQA 1UQSA 1WBXA 4IGBA 1JAEA 1F77A 3HI6H 4IFDH 1A22B 2IDTA 2WLMA 3A7AB 4J3SA 4U3XA 4F88A 4OJDH 5JO5A 2V8LA 4P49A 4K94H 1DBMH 2C4XA 3JTTB 1A3RL 3BGFC 3WFEH 3VFGL 2L5TA 4HS3B 4HUCA 1V8QA 1LWRA 1WAAA 3TBCA 3RGVC 2ZE0A 2OR8A 1K0SA 3UZVB 5ILTH 1PCXA 2H9GA 5DSCA 2WVSA 4WENB 4L23A 3QNYA 4ONFL 4PGDA 1S9KC 3CK0H 1JD9A 2CIIB 3II1A 4KZ0A 5DJAA 1WCMB 1A6VL 2E9BA 3VRIB 3GQFA 3FKIG 3VXSD 2APXA 2VDLB 1MFMA 4PJBB 2ZTEA 4G7OC 1EK3A 1NE3A 2CKBA 1D1KA 4IDJH 1V7NH 4PS7A 3HI5L 4LVNB 2XFXB 4TLSA 4HCGA 1RPUA 4MMXA 1HTPA 4ZTPL 1FG2A 3LIZH 3R4RA 4AMWA 4N85A 2W5PA 4R7VA 1M57B 2W94A 4HUWB 4E41B 5I5IA 1SPDA 2Z31D 2ZUYA 3DPBB 3HMWL 4NO0A 5E8PB 3VGFA 3VFNA 3I4NH 1MUJB 2O6EA 2EH8L 1VQ5A 1O9ZA 2PMZB 3H6AA 3T4AC 4DR3L 1PJWA 2Q8BL 2WXFA 2KDYA 3WJLC 3VW3L 1BV8A 2EP6A 2UU9L 3VM7A 2AJZA 3PCOB 1CK0H 1HILB 1KGCE 2IH9A 4NS0A 3EJYC 5DU7A 1C1EL 3HBZA 3RU8L 4Y4FB 1EIHA 5TE7L 4Z76B 4ZFGH 3ETBF 5IFHH 2I07B 1MKHA 4Z7UB 1R19A 3Q05A 5L4FA 1XHHA 4J4PC 2VAAA 4L5FE 1MF2L 1CXEA 4S0SD 4GSQA 3LKSA 4I85A 3ZU8A 2EEDA 1AGBB 2IANA 1B6UA 4UI2A 5C9JB 3CX2A 4OZGF 3CLFH 4JN2B 4BA1I 4H88H 5DK3A 1CA5A 3GZOA 2BP0A 3G3LA 3OIQA 3K1KC 1PEZA 3S5LG 4AYFB 4XTRC 5DD3L 2ZF9A 3A6CL 4AYBB 4M1CD 1DOMA 2QSTA 4ERSL 2ZCHL 1AZNA 3ZRSA 4M8UA 2FT7A 5IT9c 4UIKL 4ELMA 1TMQA 4I87A 4E6IA 3RQ3A 5IMLB 4Y2DC 4APQA 2G5BA 1A4KB 4FHKA 2NY3D 3VFTB 1YYLL 3BS1A 1YRKA 2A6IA 1HFUA 4TV3A 4WI2A 3BZEA 3O6KL 4ZPTA 1ICTA 3IBOA 1CG9A 3N0AA 3HCVA 3KPNB 1GY2A 1Z9MA 3M8OH 5CBEE 3L4ZA 4PR5B 4XPAL 2WAQE 5C3IA 5KYWB 3VI3A 3HHMA 1INDL 3VXSE 5BS0A 3D9AH 3SQRA 4L3AA 1UA6H 1EUUA 2XRQD 1WVLA 1U33A 3O13A 1BQ5A 1EIYB 3DBXB 1Y14B 3OKYA 3KPMB 4P23C 3LQAL 2CCWA 4PHXA 3SDYL 4ANXA 3OR7B 2O61B 4H0GA 1KJVB 3THMH 2OAAA 2X4QA 2ZG3A 4JRXD 4PJIA 5ANMB 1MNNA 3DLLA 3HG4A 3MJ7B 4HKBA 4A1RA 4OJYA 3IM1A 2P80D 4D8OA 3WOEA 1J5IA 1B0RB 4N6RB 3V7AG 2C1PA 2ZAGA 4XX1G 1RHPA 5B7FA 4F9LC 2LT9A 1XB6A 2R39A 3OAYH 2IX3A 1JFHA 3ZSTA 3AG4B 5DF0A 1IKFL 1A8JH 2A38A 1Y8PB 1RZQA 2PYED 4PTUB 4U3SA 4U31A 3RG1C 2R1XA 3Q2VA 1UB6A 4O2CA 1IM3B 2ZJPA 1GGBH 3MGTA 1JPSL 3KPPA 1SRDA 5B4MC 4U0RB 4F37K 1F4XH 1T1XB 1OPOA 1HHHB 1U91A 4HIXH 4XVUD 4JJHA 5IQ9A 2A74C 2BSSA 3TO2B 3CW2C 4Z7WB 3HS9A 1XAUA 3B9KC 3QULB 1Z6HA 1J10A 3S37X 3CCLA 4NNPH 4MD5A 4OI9A 4YHPB 2IGFH 4BRVA 4JO1L 4F27A 2XQYA 3JTTA 3AROA 1FL0A 5EFIB 5IFJB 2CR3A 1ZV5A 3BVNB 2FMCA 2WUCL 3PL6C 3UZVA 4FHJA 1WFUA 2C26A 1QUNB 4GUCA 1X5IA 2HTKC 2EVBA 1EFXB 2VDPB 4HOXA 1X7QB 1I3GH 3OBAA 3F2UA 1FP5A 1F2XK 3GRWL 4I0KA 5I74B 1B6DA 1CFSB 5IESH 3VRIA 3II2A 2EXSA 3AREA 3OPZH 1YECH 4D3CH 1J5CA 5LCVA 1FC2D 4PJBA 4OM0L 1FYHB 1H9RA 3ZGIA 4WHDA 1BFTA 5B1KA 1ACXA 1VERA 2XVLA 2HWZL 3V0IA 1JZHA 2XFXA 5I76A 2N56A 4P46D 1MXGA 2VDOL 2XN2A 3RLNA 5ELCA 4KWUA 1TQOA 4OIFA 5IFAL 3MKKA 5TE4H 3T0EC 3MLRH 3MRJB 4NNYB 1BBDL 3IGAB 5GRYA 2NYKA 2NY6B 3ARGB 4GUPB 4JRXE 4O2EA 1NBVH 5BJTA 3FTYA 3C6LD 2E2HB 4OZHA 1CM9A 4F24A 1EMTH 2R1YB 2CQAA 3CQFA 3MRQB 5CZRA 3RLOA 2EIFA 4UDUB 4YHZH 5IQOA 2JKTM 4WCYH 2Y36H 5KYLA 5FLMG 3HOVG 3BSZL 5BVPH 5M95B 4PJXE 2E27H 4Y4FA 3UZQB 4CDFC 4KC3B 4ZS6C 4AEFA 4Z76A 2J25A 3SDDB 2I07A 2Z7WA 1I1CA 2PYEE 3ESMA 1LO5D 1HOEA 2F08A 2WJ5A 3R2IA 5KOVC 3QEQA 4AJVA 2PO6A 4JDTL 5E6IC 3SE0A 5JEAH 4R97B 5KBLA 4HIOA 1HOCB 3Q2NA 1LTTD 5KSVB 5MEQB 1JOIA 2IH3B 2N7SA 4ZT1A 3GNML 2QFPA 3L9RB 1IIKA 4I18C 2EYJA 4KUCD 4P59L 2V6HA 3VJ6A 4AYBA 3BVZA 2DBLH 2DM2A 4NJAL 3HN5A 2K1BA 3SDAC 4Y4HD 4XNZB 1KPUA 4KKQA 4AMKH 2R69L 3W3AA 1MIEL 3JWOH 4HMDA 4A3KG 1ZIAA 4YK4B 4DCQA 4ZMYA 3CKIB 5J56B 5J8OA 1CLOH 3SSGA 4TSCH 3MLZH 3PAYA 2OW6A 3KPNA 3SOBL 5FR3A 4HMIA 4PR5A 1YA5A 4W4NA 2APVA 5KYWA 3CV5A 4C4KO 1Q46A 2WMPB 2NSQA 1BYPA 3X1GA 5D5MF 2ICWI 1FYTA 4KK8D 2O61A 3QVAA 4XVTH 2P5EB 4FQJH 5IBUG 1KJVA 2Y1YA 4WWKC 1BECA 3O9WA 4ORZC 1QNKA 1VRSA 3ZRCC 3WHXA 1RSYA 4C3JG 4W9LC 3MJ7A 4G80B 1Z1WA 1N8RC 3BDYL 2PR4L 3FFDB 4N6RA 2HN7A 2DLGA 43CAB 3HPJA 2L3BA 4XMLL 2YRPA 1YCSA 1QNZH 4YQXH 4KNQA 3TO4C 2QHRL 1DL7H 2HG5B 1C16A 1WYJA 1ZTXL 4PTUA 4WTZA 5JDJA 3U4BH 4LCWD 4A7GF 5HHQA 3BZFA 3CE1A 2OL3H 3V5KB 2J72A 1HK6A 5ABDE 5F7EH 4OR1A 1KDAA 2R0LL 1GAFL 2TSSA 4WI0A 1CT1D 2PYFB 3NABH 5I6OA 2CDFB 1BF4A 2VN5A 3QS3A 1HHHA 4B9YA 3LXCA 1TWFH 4G8EB 5DTFB 4G7ZC 2OCEA 3D6WA 3F8UB 2IQ9H 4OF8A 3MV11 2F0OA 3AUWB 1U95A 1R5WA 2NY7H 1U8LB 1XH0A 4IIZA 4R96B 3DX4A 1DQTA 3NCCB 4YHPA 2AEQL 3V4PL 3GTPB 5DYFA 1T2JA 2HFEB 1Y1VB 3BVDB 4KK5C 4MTKA 1U8HA 4M03A 4P57B 5HHVL 1LO3L 3BVNA 5TK4A 3VA6A 4DR7Q 1MJ7H 1OOWA 1A4CA 4KDTC 3PIOA 2J21A 5CEYB 4N0CC 4X4ZA 2Q2TA 3LEYL 5JW4R 2M83A 3HMXA 2EE2A 3E6FB 2GVYA 2CHNA 4PWGA 1IE4A 2BZCA 4LF3B 4TULH 43C9B 4D9LH 2V9UA 4XCFL 1LDPL 1R0AL 1OO9B 3VYSA 1RZJH 1YPZE 1D9KD 1PZ2A 4YHYB 4ODXA 2XVSA 3DVGA 2EYSB 3LS5H 1NBZA 4AG4L 1IGTB 5KANG 4BQCA 3K5NA 3O2VL 1YEHH 4BFOA 4PWHA 1D7QA 1A3LH 4J12A 3TN0C 2CXKA 3L13A 2QVMA 3CX5J 5DS1A 1T0NA 1ZHNA 3WENA 5EZJB 3LX9A 1HXYD 3MRJA 3O6FC 4NQUA 1J86A 5DMKA 4WHTB 4NNYA 3ER0A 3Q8CA 4CHTB 2XPYA 4GMTL 5J6HA 3HOZH 5IP9H 3C5SA 2X4OA 4HSAC 4YXKH 1AD9B 4FCAA 4TQEH 1JYVA 4B5ZA 4UDUA 4IOFC 4EXKA 4FQ2H 3NXWA 3RIKA 5FLVA 2A5HA 3DX8A 3DX2A 4YSTA 3IFDA 5E4AA 3SDDA 3HNTL 5I75B 4HWEH 3AWEA 4F57H 2KCTA 1ORQB 1DOKA 4LCWE 5J13B 3E6ZX 3QORB 1ZXQA 3TBTB 1JNLH 3SQOL 4NYLB 2M8XA 1L0YA 5E1AB 1PZSA 2DYSB 2ZKHH 5TDPB 1GTNA 1AVAA 3IFTA 4MXQC 1HOCA 4GT0A 4X9IA 4MLIA 4XMVA 5DR5H 7CGTA 2A8VA 1OF0A 3L1OH 2JKRM 4G11A 4LUZA 4XQNA 2IH3A 3CVHL 4P5TD 3GYRA 5CJQL 3D33A 1EXUA 3L9RA 1S78D 2DI7A 1RJCA 4IKLA 5IBLC 3IETA 3U48A 5HI5C 3O8XB 3NUCA 3H3BC 5B38B 5INDB 3T9WA 5M3MH 2C9XA 3BQVA 1T0MB 1T83A 3K0XA 3D4CA 4KKUA 3WJMB 3L3JA 5E2VL 3VFVB 4MYPA 3FCGA 3QG6A 2N55A 5CJXC 2AUJD 4XN2A 2O5ZL 1TXKA 2F0IA 1KJ2H 1XH3B 3FU7B 2LW3A 1D5ZC 1UB5A 3UJTL 3GMMB 4XP6L 1UYWH 4N0UA 4L3EE 1B44D 1QBLL 3U46A 4CBPA 1T5KA 2WMPA 2DN8A 1OPGL 5LBSL 4OTXH 2ES2A 4ZO6A 3TONA 1XF1A 1ORSB 4GW4B 2EIBA 1OAUL 4AM0B 1EO7A 2P5EA 5DQDL 3QO2A 1MNUH 5B8CC 1QSFB 4UM9D 4BBWA 2KPNA 4CKEA 3N41F 4G80A 1KENH 1RUAL 2EVGA 1FVDB 5ELFA 2GQHA 3VXRD 3FFDA 1CFVL 2AGJH 3BAYA 2XWJA 3ZHKA 3JV6A 3ZTJG 2NY0C 43CAA 2UXDQ 3IJSA 4HWBH 4LIQE 2VRKA 5D6CB 3D2UD 3E8UH 4WFN3 1BIIB 2G2PA 2FBRA 4C3HB 4FX5A 5E6SB 4DFAA 4KOBA 2XN9D 1WT5A 1RQ5A 1OT2A 4NHCH 4P73A 1TTCA 4ABQA 4I4WB 2J57A 2F7QA 3FBKA 1UM6H 3HZYB 3NZSA 3AGWA 3F01A 5GGQH 4HPHA 2K32A 2PYFA 2SDFA 1PF3A 4TRPL 1UT2A 3FQNA 2TRHA 4G8EA 3RZDH 1H6TA 4I77H 5HI3D 5C0CB 2IG2H 5DK2B 2WAQA 3IB4A 1M1XB 1FGNL 3MUGB 1STEA 2DW5A 4KQ0A 4GKOA 4EZKA 4NQTA 3RGBA 3HOXH 1U8LA 4NZFA 1CD1B 3BISA 3OSOA 4BY7B 1BLNB 3MMEB 5KVEH 1OXUA 2FX9L 3L5WB 4C56A 4DPAX 2NY1B 2Y7LA 1P7BA 3VWKB 5AW9B 2APFA 4BSVA 3GF8A 4MWFB 1RVFL 5CEYA 3NBNA 4AKPA 2SEBB 4N2BA 1IGYB 4OM1H 1HE7A 4QR7A 2GJJA 3SQBA 3E6FA 4JJ5A 1D6EB 1AS8A 4QHNA 1S7RB 3M6DA 4NAJA 4UAOB 5F6IC 3NCJH 1GKEA 1TQCB 5KGUA 5F7LB 1S5DD 1ETJA 2EYSA 1DJSA 3KDFA 1IGTA 1S9WB 4NWUH 4YXHL 2F54B 5FO8B 5GROA 2Z93B 2UXCQ 4EJ1C 4JN1H 2ENQA 2P5WB 3GBML 5KOMC 5SWSB 4B9CA 1QKZH 1DQDH 1FZJA 4LRIA 3ZGHA 1SYVB 3RILA 1YEDA 5ADPH 3KUPA 4YVNA 1ETB1 4KVCL 2F58H 2XUWA 3QPXH 3IDJB 1RIUL 3APMA 3ECBB 3VXRE 3WNKA 1ZSDA 2UXFA 1IM9B 3AG1B 5HYQA 2I5YH 3VXPB 5E8NB 1VFAA 4A3CH 3PUYA 3A4FA 5DFAA 3IJHB 1DVZA 2DQCH 3O41A 5EU5B 4HJJH 4GQRA 3IMUA 1F58H 5C0GB 3ZR5A 4DSYA 1A7NL 1TZIB 1ZS2A 1DQML 4XPFL 2BIOA 2J1KA 4XQQA 2XN9E 3IMBA 1ORQA 4M9PA 5LB1A 1MVUB 2I7OA 4R9WA 2GIMA 4LU5H 5CJ8A 2HPOA 5FYLD 1B4OA 2CW0D 2ZOKA 4UILH 1OTUC 3LVEA 5TDPA 4QLWA 3UC2A 2IDUA 4N8VB 3ZKSD 1IBYA 3SK8A 2A4CA 3K3QA 3P9WB 4K23H 4DUZL 5M5WB 4F7MB 3I4MG 2N7AA 2CNZA 3HZMA 5ELEA 4ZUVB 3FN0L 4M7ZB 3BVWA 1QILA 1KYOJ 5C92A 3O8XA 1CDJA 2ZM6Q 2Z7ZA 4I1PA 2F4IA 1IUZA 5INDA 4HF5L 1IBGL 3IJ9A 4UWQB 4G7SB 2GBAA 1FL6B 3AMUA 1CDCA 2K7QA 1JFQL 1G7JA 3L3DB 4JRXA 2XNAA 3L0OA 1I8MB 1A1OA 4A7SA 2FX7L 3VFVA 1N8ZB 4X2UA 1KOAA 2Y7MA 1IL2A 1CYXA 1HQ4B 5I0WA 1X5MA 4FFWD 5CBAE 5DJCB 4LF9L 5DO2D 2W81C 4K7PY 5D9SB 4R3SA 1XH3A 3NSJA 4PJXA 1A02N 2MCG1 1QRND 3GMMA 1W15A 4YX2L 4BUQA 2L7UA 6PCYA 1CGUA 3KPQA 1LGVA 4MMYA 3F85A 2IDQA 3SE9H 4KLKA 1ORSA 3L3KA 4XAWH 3JAML 4AM0A 5JXED 5ALCH 2WHVA 5IV2B 2D31A 4R4TA 4KK9C 5FWQA 2XRAL 3WDHA 1EWIA 2UUCQ 1QSFA 3KG5A 4KVPA 1SAPA 5C4JB 4DUXA 4ODHH 1S3KL 2AJUH 4JRYB 2QADB 3DRQB 3OKEB 1FVDA 4IRSC 2ZX5A 1QFWM 3U83A 4APXA 4H8QA 3QQ3A 5DZOA 2BP3A 5HP5A 1MFBH 1BIIA 3AAZB 4KD3A 3NEOA 5I1JL 5AOZA 3BCDA 2C3VB 4JI3Q 5D1XC 2R4SL 1TJHH 3UTTB 4EI5C 4I4WA 5CN2A 5I1EL 1CR9H 1XGUB 1BZ9B 5BOPA 4JBWA 4WU5A 1NGXB 1OP3H 3QO1B 5HVHC 5HYIA 1G6RA 2KZ1B 4O02L 5DK2A 5E4EB 3U9PH 1M1XA 3MUGA 2CGRL 1V3LA 2KUTA 2EXWD 5IROA 4GT7A 3QEGH 1CD1A 4E9WA 3NK4A 3BX7C 4GNXC 3L5WA 4L0ZA 1NCCL 5JPNC 4GN4B 3VWKA 2JJWA 2F0SA 2BSBA 1M90C 1N5AA 1TZOA 2HCZX 4AUJA 4ZX4A 4HSCX 3HE7C 4NN7B 1D6EA 1S7RA 3C6LA 1Y8OB 3EG9B 3RTQC 4U6YA 4J5VA 4KV6A 3RDTD 1U92B 5EZPA 3VXOA 1RIPA 4FG6D 1P2CA 3OMZA 4FNLH 1TCMA 3KVPA 1CU4H 3A22A 3FKIB 1S9WA 9CGTA 2EAEA 2KOLA 1QRNE 4F7XA 2Y4SA 3AXLB 4K8RC 1OM3L 2P46B 4YLBA 1JZ3A 3S97C 2A6DA 2X12A 3PWUB 1Q82C 1SDDB 4Q9CA 3UO1L 1YBYA 1JTPA 4LLDB 5SWSA 3GMQA 2YD3A 4K0OA 2EY5A 4OO1H 2RALA 3HUJF 4IU3A 2KDGA 4N0YH 4MXVE 4QIRA 4YHKL 5FYJH 3V0EA 4Y19D 4E2OA 4ZUJA 1SYVA 2XI9A 4Q9RL 4PVBA 2XCMC 1PDKB 4B0MM 4MA7H 4V190 1HC1A 4XP4H 4NFDA 3ECBA 4H5SB 1QFHA 4V2CB 2H32B 2TAAA 2VLKD 3VXPA 4DV6Q 4JM4L 4L05A 4PB9H 3IJHA 5EU5A 5IBTL 1ACYH 4AZ8A 4ECNA 4XNBA 2YD5A 1IBLQ 3NJGA 1BVSA 2NVXB 1SQMA 4HAGA 5AQ0A 4F91B 1VFMA 1NTGA 4JDZB 4YHML 2EDGA 3GSXB 4HT1L 4UT6L 3UTSA 2VZTA 5GHWL 5BOJA 1YPZA 4K9EL 4C2MB 1YLBB 5HDBB 1Z7JA 2F8IA 4DPCX 4N8VA 2LR4A 4F7MA 5FV1L 1YEZA 3S16B 4KHTL 1KXTB 2P43B 1XIWB 2JH2A 2XVBA 3S5LB 1UKTA 4JKWA 1R5IB 1KGUA 2OMTA 3GRGA 1JWMD 1FH5L 5HD8D 1RK1B 4HUKB 4J3TA 2V37A 5K93A 1FL6A 1UM5L 3TM6A 3L3DA 1EJOL 1TJIH 1OL0A 4NBYB 5DC2A 2DQHL 1I8MA 2VXSL 1O78A 1XX8A 3W1BA 4HS8H 5LDSA 4IOAA 2NVTH 1UWXK 1CCZA 1HQ4A 3HE6C 4XCCH 4YFDB 2EXYC 2ARJB 1LYQA 2YD1A 3RA7L 1YQVH 3C2AH 5T5FA 2DAVA 2UUBL 3GSNL 3VFWA 2XWEA 3C8DA 4AV0A 1JZ8A 4N3UA 4RSYA 3BFWA 4ONHB 5IT2L 3QUML 4HIIB 3NACL 2Y5QA 1U9RA 4PJ9C 1R24B 1LLRD 2FO4B 3H9SD 3HA0A 1PIFA 3HZVB 4AT6A 3BN3B 3J81E 4HMCA 4LFCL 3SDXB 2FEDD 1A7OH 1GCYA 3DRQA 3OKEA 3CMEA 3LY6A 4Y19E 3RPIB 4AI7A 2XSKA 8PAZA 1N9WA 3CG8A 1LTID 4Z7VB 1PFSA 2N3JA 4JPBW 2Z8WC 1MDAA 4HZ1A 3F05A 4HTHA 1JV5A 3TX4A 3VXUB 5IB3A 1DBBH 2DUDA 3B83A 1RSFA 3AAZA 4PVMA 2Z4QB 2VLKE 1CZGA 4PRHD 5GS0D 5EEVA 3MLYL 5SWZD 2ID5A 4WUUD 2C3VA 1J1PH 1L7TH 4J3BA 4EDXB 2A6KB 3MUJA 3OMIB 2YRBA 3UTTA 4G8GB 1J9TA 4OQTL 1ZHBB 3OWRA 2WY3B 4JI2L 2VW7A 2OJEA 1RFDH 1NGXA 3FL7A 1IFRA 4TMPA 4JW3A 5F8QC 3UAAA 3WIFB 2R29L 3AU1B 3VQ2C 1E7UA 5IG7A 1H9KA 4L3EA 3ENEA 4IKJA 3N42B 5C0BD 4CDCC 3TV3L 2BNRB 1NEPA 5KZCB 2YJQA 3ECUA 1IKNC 4JDEB 4HPYL 3CUPB 1AZVA 1NLDL 4NCC2 1BGXL 3V4VB 3SPVB 3MR9A 2LV4A 3UTQB 3LRLA 2PQAA 3M7NA 2BY0A 2F5AH 4JPKH 4GO9A 1JBJA 2B2XL 3POCA 2BSDA 1J8HB 3QI9A 5JIPA 1DCLA 1WQVT 4D8PA 3D0FA 4C55A 2BC4A 1NCDH 4LQ1A 1RCVD 4DAGL 1U92A 1L0WA 2FUTA 5TQ0L 1X6LA 1HHKB 4Z95H 3TA3B 1HXKA 2BVQB 2DMGA 3BRGC 3MV9D 2B0SH 3AXLA 1OE3A 1Y6MR 2FLRT 2B1HL 3HOWG 1UD6A 3PWUA 3UGUA 4EQ2A 1FFNB 1SDDA 1VZHA 4DN3H 2BWQA 1PH1A 3RZCB 2KCCA 2X4PB 1TVXA 2DTMH 3N44F 1PLGL 1N36Q 3EAKA 4K2UL 4KI5C 3TT3H 3H9SE 1I9JH 4QRRD 5AOIA 1PDKA 3U7WH 4Y1SA 1K5WA 1K8IB 1JRHH 2CHZA 4NKDB 4X8GA 3SGKA 4B9JA 3ULLA 5IT9E 2H32A 1KFAL 4NUPA 1KXQE 3MREB 1UASA 2HRHA 3K59A 4GIPD 2A5UA 1K3IA 2YPVH 3JQOB 3NOIA 2PTUA 3HOVB 3VD0A 5A3IC 3GTLH 1RUPH 4WUUE 4JDZA 2CHWA 1SYBA 2WO2B 4X7SH 5AKSA 2V5TA 35C8H 4QO1B 5EPMA 4PJDB 5J22A 2YBGA 1FN4B 4UT7H 1QZNA 2OPCA 4LSTH 1BZ7B 2NXYB 2EICA 2B2UC 3P77B 1IB5A 4ZKBB 5TF1L 5HXMA 5GRUH 5DUPH 4PG9B 5IJDC 4K8RL 2DDQH 5C0BE 4GLAC 4HIEB 1R5IA 4RH4A 2UX6A 4GIAA 1LTLA 3LEVH 3SEBA 4JOIC 1RK1A 3HMXH 1Z9FA 5M3FH 1F4WL 2NY4B 4GQ9L 5GIRB 3V6FB 3NAAL 5GS3A 5KBPA 3TJEL 3MRLB 3NH7L 4UM9A 1J1XL 3FTWA 1G9EA 4LCUA 4NWTH 4LCCC 4BY1G 4A3KB 1T5XB 3NCXA 1XF5B 2QQNH 4XN9A 2D9QB 4N8CL 3L1GA 4PWJA 4KKAC 2ADGB 1NAKH 2ARJA 4ODVL 2DLFL 4DKFH 3APDA 3D2UA 2DQDL 4HHGA 1I6VC 3WLBB 2FMMA 2HKAA 1R3LB 2BXYA 5EBLB 3V0JA 2AHOB 3LDBC 3BWSA 4OU3A 5GJTH 1F9RA 1UOKA 3MV9E 4WK0B 5E2TH 2PABA 3R0NA 3K2MC 3W57A 1TQWA 3DHQA 2AJSH 3K5RA 4FZ8H 4KTEL 5LGKA 3RAJH 1SE2A 1HQRB 1NDMB 3ATBA 3B43A 3IPBA 1RV6X 2J88H 5D8JL 1R24A 2E2HH 3PV0A 1I7TB 2DMCA 3DJ9A 3FQTA 5CMAB 2MNUA 5IBUB 2K52A 1M3IA 5E1FA 3I4OA 3FOMB 3HZVA 12E8L 3SDXA 4ATWA 3JWNE 4O0AA 4C3JB 3CZJA 5CIPB 2F0KA 3PP4H 2XACC 4U1JA 2JE8A 4WVRA 4QRRE 3SCMD 1ZLSH 2BCKB 4Z7VA 4NXNL 3SPIA 3LX0A 5DM73 2QZQA 3NTCL 2NNXA 2RHQB 1LACA 1CO1A 5FOBA 3C6SB 4MCZB 2Z4QA 4M4RB 1SYEA 4M8RA 4Q0XH 1LDSA 1UJ3A 3SGDH 2WIMA 3AMLA 4RQQA 2KHSA 3QCVL 3ZXAC 4CDHA 1NCGA 1TQVA 4G8GA 2XDHA 5JPMB 2YU9B 1WZ1L 5JJIA 1ZHBA 4U6VL 4PJGE 4CGUB 2R83A 1E30A 3FPXA 3ZDYE 4DGYH 4P8QA 5CBAA 5JHDD 2C34A 2FQFA 1ET6A 3C2PA 4GAFB 3M9BA 1BPVA 1FZKB 5EIIG 4J6HA 2ESVB 3CZGA 1NGPL 2QVTA 3C60D 1U8MA 2HG0A 2QQKL 2WVTA 4JPWH 4LW1A 3K80C 4PSRA 1OSZB 3CZKA 3DDFA 3NTKA 3H6JA 3Q6FA 1VQHA 1VSCA 4ZNEE 2D62A 3CUPA 2YYZA 3D6GA 1MH5A 4GW1B 3NESA 3DETC 3SPVA 3UTQA 3Q3GA 5EKKA 3QS2A 2JA9A 1BBUA 3KEHA 1BBJA 1A15A 2HH0L 3ILDA 1ZVSA 1RTNA 1MFNA 3LPOA 4UQ3B 4EDWL 5CR1A 2R7EB 3N1QC 3L48A 3C09B 4OLXH 4LEXH 2VMEA 4QXGL 4TOYL 1KZYA 1OIOA 3B6SA 2NW3B 4PREA 5E99H 1OW0A 3OKOB 3QRLA 4JFQB 1BM3H 4JY4A 4UV4L 3IYLW 1UZGA 4FMKA 1GGTA 3PV6B 3U0TA 3TA3A 2BVQA 4BCZA 1PG7W 4NQED 1H8LA 2PZUA 3V0GA 4GAGH 3T56B 5CLXA 1T1YB 4Q7DA 3VGAB 4EI0A 1TZAA 3EXLA 2JQOA 4XWOD 1WBYB 5C0XI 2VITB 1BCIA 1ZLEA 2DWDB 1PKQE 3EYOB 2J8UF 3RZCA 2BA0A 3M7GA 2ADIA 3INUH 3QZWG 3L3OC 2JCCE 4F7PB 2ZCLH 1N4XL 3CCHB 1YYCA 5D14A 3PFQA 4A7VA 4DR3Q 3FCBA 2Y9RT 4AV4A 2UU9Q 1A7BA 4XC3L 3QFGA 4Y2OB 4DV7L 3B1TA 3GXDA 4U1IB 5IY5B 1JXJA 3GXUB 4M6OL 3MREA 2K28A 1NZRA 1T22B 4BQ9A 4M61B 4DU9A 2Y7QA 1KBWA 4WO4D 5IVZB 4MKTA 2NZ1D 2VZUA 3EDJA 3GEFA 1GUSA 3GIZH 5I82A 1C7YA 4PJCE 4Y8AA 5FUZL 3W11D 1H9SA 3RZOH 2R7DA 3KK7A 4PJDA 4G6KL 4EQOA 2Y3NA 3NZUA 4DP2X 1FN4A 4PGJA 3RPBA 1QBBA 2YC1B 3U82B 5E6ZA 5AVUB 3P77A 2HB0A 5JHDE 1MI5B 1BQHG 5BQ7B 1EAPB 3GSOB 3W0WB 4NQXB 4R7LA 5C6TL 5KS9F 3ORJA 2XV0A 5KRUA 3KJOA 5E4OA 2GJ6B 4U673 4Y2LA 4HIEA 3T0AA 2AXHA 1S7WA 1BJMA 3KPOB 4Z7NB 1DR9A 1S7QB 4ZO8A 5GIRA 1Z0NA 5JHBA 4PH8A 4BKTC 2ZOLB 3FQXB 2P5ZX 4HJ0C 3MODH 1I4RA 2KA7A 3LN5A 4H0IA 5EOTA 3H3VC 1E7ZA 1UENA 5DZVA 4QGYA 3U2SB 2EYTB 5DCCA 4ENEC 5E23A 2G9KA 5EZIL 1XF5A 3UCQA 2UZIH 3OR6A 1MJ8L 4Q5VA 2FIRT 4ZMWA 1G94A 4XN7A 2DLIA 3PJLA 4GIOA 3MAWA 2L55A 5F7FA 3BXNB 4MMZB 4A67A 1UKSA 5A16B 4HWNA 1AP2A 5EBLA 1NAPA 3JUZA 3WFBL 4NQEE 4P72A 4BBSH 5DZPA 5L7XH 5AAWC 1A8ZA 5FF6A 3IAPA 5DJXA 3RIAK 3L3GB 4CSPA 4KNSA 2V17L 3I50H 3GPEA 3O3BB 3ALXA 1HQRA 1E9PA 5CMAA 5T33L 2EDOA 4XCNB 4P9MH 3GSUA 1SEBB 5C09D 4HWZB 3F7KA 4GLVB 4PJHE 5CIPA 4XPTL 1Z32X 5ADOL 3IGLA 2OK0L 3VU2A 2BCKA 1AI1L 5TH2A 2UUDH 1J87A 2FYVA 3B2VH 4YN3A 2WBWB 4ODUB 4JG1L 1PSKH 3BAKA 2NNCA 2ED6A 1YMMB 2ZPKH 4H7VA 3O0RH 4PJ7F 1EXHA 1FA4A 4N2AA 3FO0H 1FRGL 4DKTA 5CLWA 1OHQA 2E8ZA 2JTDA 2XWRA 3ALPA 1XGQB 4FD0A 4PCTA 5D4HA 1QOHA 3FHWA 2VXTH 3CC1A 4CC4C 1JE5A 5K9OA 2NNFA 3D12B 5HJ3B 4AEHL 1BYNA 2R56H 1L9PA 2AKRB 2Y23A 4OZGE 3IAQA 4XWGH 1OSZA 2BIHA 2KCMA 3TEZA 1R3KB 1Q8MA 3MC0B 2BXZA 2DEWX 3NJHA 4NSKB 1V27A 4M6AA 2CK0L 5I73C 2YN5A 5EHFA 5D72L 1KCRH 2ADFL 2J2ZB 4DR1L 4POYA 3SGJA 2FEEL 1CICD 1E4HA 4Y19A 3VI4E 1XO8A 5JLZB 4KH9A 3UYRL 2ZAHA 3S36L 1OWWA 2WTRB 4LEOB 2NW3A 3J7YW 1AGCB 2F53A 3IDYB 2ZXOA 3CHSA 3ZL4L 3FQ4A 2F0TA 1Z7TA 3DRTA 1IHZA 2WVVB 2DQGH 2VLKA 4ANWA 3OKNA 5J11C 1WTPA 1LQSR 4POZD 3DUSB 3NJLA 3HI1B 4OLYL 4R4NC 1XNRL 1BAFL 1AJ7H 1T1YA 3G6JF 5KYXA 3E5SA 2Y1VA 1IL1B 4NN5B 2VITA 1PZJD 2DV6A 2BOBB 2DWDA 4HYTB 4N20A 4WK4B 1S2EA 4Y1AB 1TWAB 4F2ME 1PLAA 3BGMB 2F3WA 2VN4A 4CBZA 3FS9A 3ALWA 4F7PA 3WTWA 5INCB 3ILEA 5F1IB 2ZXBA 2AJXH 3EADA 3PMFA 2NTFB 4FNQA 5C09E 1JTOA 1OK8A 4AEIH 2Q2IA 2VMFA 5B3JE 4P2RB 5EUOF 5D4QA 1QSVA 5DT1H 5IYBG 2BS71 4MS8D 1FO0L 1T22A 1WIOA 3AM8C 4A3EH 2WACA 1RXLA 4DPBX 3FSZA 4WU7B 4PAZA 3HKSA 2IMNA 5CCHE 2NY6D 3O6MH 2DIAA 2Y2YA 5ANME 3SDCC 1WTVA 1G6RH 2EEFA 2G5DA 3GWJA 4FE9A 4UQEA 2QLVB 4XN1A 1QA9B 4XBGB 4CU6A 1K5NB 1THCA 5EIVA 4OIIH 5G3LD 1E4XL 4L8DB 3W0WA 1QPPA 4DFHA 3CHBD 5F1KC 4DP4X 1AMYA 4KKBC 3GTJH 3EJRA 4G71B 2K03A 3KS0H 4NJ9L 4MHHI 4RESB 4YDMA 3VXNB 1HKLH 1Q72L 2MQGA 3CDZA 1B3JA 1G7LB 2VUOA 4HJGA 2Z0BA 2E6PA 1HH2P 1IGIH 1S7QA 3TZDA 4W9ZA 2EH7L 3BO8B 3MV8B 3SKOB 4K8IA 4X4KA 5CU5A 1AXTL 4AVKA 5J6GA 3H9SA 1FLRL 4B3ML 2WTPA 5D7JD 2X9XA 1HCZA 4S1QL 4L4VD 1KXQA 1I31A 4PD4J 4WI8A 4LOUC 2RQXA 4DKEH 3BXNA 1KZQA 3ZE1F 3ZYOA 5A16A 5E6RB 1ZLVH 1FBIH 2A68C 1DFBL 4WUUA 2R0WL 1T1WB 5DHVB 3SJVD 4KRPC 4I8DA 4GAAA 4N6QA 2WOYA 3L3GA 2RCFA 2YEVB 4Q74A 5A1AA 5I1CL 1MEXH 4M3HA 4F7KA 4NKMB 1OWRM 1LT3D 2GW5A 3EJUA 5I8OH 1HZ9A 1L6PA 3NIFE 5LVEA 4XCNA 1QR1B 4NM4H 2FUQA 1TWHB 1OAXH 2H1PL 3PCYA 2VM9A 4IOSD 4UCFA 2K4KA 5FYKD 2W95A 5MEPA 5C0BA 1KXHA 1C5CH 2YD7A 1MFDH 3LQZA 5C0RL 2B2TA 1HCFX 4YWGH 1GA2A 1EPFA 4JM2B 2VKWA 2WZ6A 3P4OA 2CBMA 2X6AA 5D1ZC 3HG1B 1U3HC 3QT2A 2E4FA 5GS1B 5JJLA 4A3FH 2MNWA 3HZKB 4LAQL 5C3TA 3UAFA 4HG4J 3OX8B 3X17A 4ULLA 2K50A 3TZVB 3V95A 4KMTL 5FCUH 3J80i 5M5WH 2VDMH 2YS4A 2AZUA 5HJ3A 4W4OC 3WE6B 1WICA 4ZAKC 4EIUA 3HG5A 4X99B 2CQOA 3MV9A 3SE4A 1HHVA 5CSGA 4A2GA 3I74A 4FYSA 3TEHB 1DXMA 5H37H 4FN0A 1TJXA 4G1MA 3QIBC 2H7WA 1JWUD 4Y5XB 5ITBL 5J3HD 4H2AA 2E5LL 1HSBB 1RZ8B 1MJJA 3X2QB 2J2ZA 4X4ME 4LGRB 3BQUD 3LWUA 5L0QC 2ID0A 5JLZA 3A23A 4BH7B 3UMNA 3QIUC 4M8VA 4XVJH 1GKHA 4X7TB 2G30A 5EZOL 4QRRA 4DAVA 1AO7B 1A3TA 1NGYB 1AGCA 1XGYH 3LNFA 4HP5A 4S1SH 1YAZA 4J3OD 1NFIB 1CK1A 3A8JE 4TKOB 4KJQD 4L4VE 5IMOA 4ZMNA 3LTVA 1HSAB 3BPLB 3EYSL 4GKSA 4IRJC 4L1SA 3F5WB 3IXTB 4NT6B 4KHPL 4RMUA 1YJDL 4UTAA 4OUOA 3RX8A 3WS6C 2Y7OA 3DUSA 3HI1A 3MXVH 1SM3H 2IAMC 2GY5A 1SMDA 5DHYB 2WXHA 5K69A 1PH7A 32C2B 3G5VB 4KDVA 3SJVE 4BK5C 4PJGA 3ILQC 4DAPA 4ABNA 4JI7L 5IGGA 4F8QA 4LLUB 3MLWH 4LSUL 3BGMA 3LHPL 2L1BA 3U9UB 4EBQH 5EBCA 3R1GH 5D5ME 5A40E 3UEQA 3A67L 1YZZA 5F0LB 3TWCL 3MA7B 5INCA 1F90H 4ZFZA 5C8JB 5F1IA 5JQ6L 1RH8A 2NTFA 5MHSD 3WFDH 3ABLB 1SN5A 4BWTA 1VFUA 3BT0A 1DVFC 3NFNB 3M4QA 1TETL 1IFHH 5FYKE 4PRDB 2QQQA 4ZNEA 2ICEC 2P45B 2WQSA 3NYKA 4JGNA 4Y4KB 1NUDA 4FEMA 4NZDA 4P4KD 3L9AX 2JK8A 1IGCH 4WU7A 3IKKA 4RCAA 1E6OL 1KV3A 2BSTB 3LZFL 3OAUL 4P9HC 2V5MA 5D6DA 5I18H 3FCUB 4XH2B 2GA4B 3S9DB 4YXLH 1ZT7A 4QGUA 4LLMB 1N6QL 4FQCL 3WIIH 4XBGA 2GEQA 4HGKC 2QVIA 3KF6B 3FSWA 1R17A 1PTOH 4L8DA 1V8HA 4B3TL 3DA0A 4QRTB 3SZ6A 1ZV2A 2BPBA 1UATA 1NGWA 2XFGB 4WWID 3DSFH 4CDEC 3QDMB 4JHAH 1KWKA 4ZSOB 4NO3B 3MN8A 2WZAA 3IGKA 3I2CH 3QORD 3WMQA 4Y89A 1G9MH 1ZJAA 4F1ZA 1YG9A 3SKOA 3EGDA 4CAGA 2JCCA 5L2KE 5GGSY 1PZKD 4XO8A 4H1LA 4U6XB 3DTXA 3WY3A 5GQBA 1I1YA 3FB7A 3UPCA 2R23A 4P07A 2DN7A 3EZJB 2YN3A 1OCZB 1PMYA 1BOGB 2WKCA 2QEJC 4IOCA 5KVMC 3ZK0A 2B8GA 5C0NC 3E3QE 2ZTCA 1IEHA 2DY7A 1KG0B 3RWJB 1E4KC 5DHVA 5T3XD 2HDMA 2UUAL 1YZ6A 2J6EH 1XCXA 1FNAA 4GLRI 4U1NB 4LQFH 4ZW6A 3P30H 4HCRA 4IO9A 2X70B 3VUAA 1GJUA 3B9EA 3BP4B 2WWMC 1SBSH 3GHEL 5C08D 3T2PA 4U1SB 5JDSA 3EDFA 5JHDA 4DZ8A 4KROB 4N2MA 3KW7A 3L2NA 3CIAA 3T3MF 5G4OA 5B1JC 1D5MC 4XN5A 4DGUA 5BZDA 2YKLH 5MHSE 1NMBH 2C3GA 1OK0A 1FE8L 5FHBH 1T66C 4JM2A 1FD7D 4W9CC 1KD1C 2DRUA 3TBYB 2X41A 1WFJA 3JAMc 3D4ZA 1YNNC 4HK0B 5MEOB 3B3IB 3KJ6L 3HG1A 1ZT4B 1MFCL 4PJFF 4A39A 5D7IF 5GGVY 4P5KA 5GS1A 3ZTCC 3STZB 1FDLH 3HRZC 1IFGA 4ZS7L 1MIML 1P5UC 2B4CH 3OX8A 4PJAB 3SYOA 3TZVA 1R4PB 4LL4A 1CL7L 2F8OA 4WY7L 2PUQT 3DNKA 4HEPG 5HBBA 1J6QA 1Z5HA 2YPLB 3PGFH 4HC1A 4RFOH 5GISH 2J43A 4JKMA 3HNSH 2AC0A 4X99A 1O0VA 2VJXA 3CCEA 5CUSH 4FQ1L 4FQIH 4JHVA 4FLRA 2NY2C 4UQ2B 2BFGA 1JUFB 1MRCH 3EGXA 2R61A 4Y5XA 1E27B 4KKLD 4QY7A 2XVKA 5AW1B 2IDSA 1R3JB 3X3NA 3KL3A 3FP9A 1HSBA 4L9LC 4Q97A 2EDBA 1YDPA 2O4EA 2LFGA 4W9EC 3TOPA 5DA4A 4X8JB 4BH7A 1DSFH 3KYOB 2RR3A 2AEWA 3FH7A 4X7TA 4ACTA 1NGYA 1AO7A 3RL2B 5HHNB 2H5XA 1JK8B 1NFIA 3UZEA 1F2LA 2ADJA 3BVUA 5D4JA 5K5YA 1HEHC 2MOQA 4NT6A 1ZMYA 2X38A 1CZ8L 4F20A 1UKQA 3VG0H 2NQCA 2HJLB 2OXGB 3PE9A 4M8QA 3AC0A 2NZ1A 2SEBD 5DHYA 4DP5X 4NQQA 5AVXB 5T3XE 3UAJD 5IQMA 3UBHA 4JFTA 1DBKL 3KCWA 3BWAB 5F7DA 2YLKA 2A73B 1NC2D 2YMXL 3HOWB 4GQPH 4XE0A 2ZKWA 4K71B 1WFQA 4KMQA 5C08E 1BQKA 3S88H 1KDJA 3U9UA 5CHNB 2QT6A 1F11B 3Q0AA 4XHQA 4Y9FA 2A69D 3MA7A 4WRDA 1WG3A 3HB3D 4M62L 3ARDB 1T5WB 4KOCA 4MSWA 4AQEB 5B39A 5E4XA 2BMKA 4PRDA 1E8ZA 4X9BA 2XRSD 3V0WH 1PG7X 2JJSA 3FO1B 4PB0L 1M7IA 4Z0BH 2P5WD 3AWFA 4EN3B 1P53A 1K3BC 1KPVA 1L1OC 5BW7C 3DYPA 2AUKA 5I1IL 4DGIH 4XH2A 1K4DA 2Z4TA 5DJ8B 1SJHD 1BZEA 4S1DC 1Z9PA 2VR9A 4U2YA 5AG9A 2V9RA 1ZEQX 4N9GB 1MRFH 1QZ1A 3L7EB 4ZMVA 1OTSD 1I3VA 4AYGA 4YL9A 3VCLA 2XTJC 1M9WA 4LPUA 4DUZQ 1YC7A 3X12A 5KYUB 5T3ZL 1V10A 1H9MA 1UFUA 2VMJA 1QW8A 1SYSB 4HPOH 4YC2C 4FABL 3QCTL 2G60H 1INEH 1EOTA 5GRWA 1BO0A 4F2MA 3OHMB 3U4VA 2BP5M 1KLFB 3NP8A 2ZUUA 2PLTA 1KYDA 1YEGH 1TNMA 1MJUL 1ERNA 2DJSA 2FHFA 4U6XA 4XOBA 3BIAX 4YO0B 5C09A 5TFSH 1BF2A 1RODA 1EIBA 3CFQA 4N2GA 1N33L 4BY1B 3QIWB 4YSEA 3I6KB 1NMCC 4LF9Q 3G5ZB 3G6DL 1VQ8A 1KGXA 3QJSB 2C35B 2AAVA 4X83A 1KG0A 2QHLA 1YJWA 1E9OA 4P9HL 4DGVL 1HR0L 3C5XA 4U1NA 2XQBL 1JL8A 4GNKB 3BP4A 4N2IA 2Z31C 3SHSA 1C9SA 2G3NA 4HJ9A 1IC0A 1WYDA 1K6QH 4U1SA 3RWGB 3MLXH 2JB6B 1ETA1 1T6BX 1JB3A 3RVUD 1L9TA 1S8DB 2YUWA 1JZGA 4LVOB 3JYCA 2CLVA 1MRDH 1N26A 4X50A 1U8IB 3NCYS 5E0QA 3QFJD 3ZDXF 4NZJA 1CDGA 4FOMA 3PYCA 1YEEL 1BP3B 3MFYA 3BYYA 1NCBL 2X4NA 4YDNA 2VUKA 3EJZD 2EE0A 3NIDF 4JFWA 5JXAL 1A5FH 1H5BC 4QHUA 1J0IA 1RZIB 3S35X 2WBJB 3B3IA 1C08A 1CT8B 1TYRA 3P69A 1PH2A 1KGIA 1NKRA 2NZIA 2P5WE 1WTRA 2EYHA 3ZHLA 3TREA 1CF8H 1MPAH 3TVMC 3IMTA 3STZA 2BVOA 3GTMH 1R1CA 4J6RH 3B2PA 1EX0A 5EF1A 3CF5A 3PG2A 2WB1G 2GJZB 4BEIA 2UWEB 2B2VC 3MXPA 2AEIT 4URTB 2VUMG 3AFLA 1W6KA 1BX2B 5E4IA 4GS3A 5SX5H 3V9EA 1EGJA 3KMDA 1NJ9A 4M1CC 5EIIB 4KQ3L 1AANA 4X3KA 5F1OB 1ZWIB 1AP0A 2FJFB 1UE1A 3H55A 2ZXAA 3UP6A 5D7LD 4ZMPA 3GI8L 1STHA 2VUYA 4JPQA 1K8OA 2YLHA 2MQHA 1SFOB 1E27A 3UBXB 1R3JA 1CKNB 2F0CA 3O45B 1WZMA 4L8JA 3MBWB 4JCMA 4UYPA 2IADA 2WLNA 3MRHA 4FRWA 5HGGS 5SX4H 3RI5K 5CO1A 3FB5B 4GRLC 2NN6H 4HIJA 3RWDA 4X8JA 3WLWC 1T4KA 2OQ0A 2JMRA 4BFBD 1VEMA 1KY7A 2E7LC 3RL2A 1N19A 2NDGA 3ZYZA 1U30A 2Y0SG 4TNFA 3DI3B 4N8FA 3CSTA 3V52H 4ZUIA 1ZLUK 1PH6A 1KC5L 3FFOA 4EOWL 3CXFA 4LFAL 1AE3A 1GSMA 1R9TH 2C1OB 3ZQWA 2CKNA 4LFHG 2HJLA 3NHHA 4H8WL 3JV5A 2F0QA 1OGAD 3V9FA 2LTQC 3UYPA 1WITA 3KZ8A 3BWAA 1KN4L 4HKZB 4W81A 1ZXKA 3HFFA 4KO9A 2CQVA 5J89A 1LT6D 2PETA 1GUOA 1X5GA 2QTEA 1F11A 4JFPB 4RBPK 3QZWB 2AXFB 4XB3A 3I84A 3U30B 2YPKB 3ARDA 1X4XA 4PS3A 1ZVYA 4Z7IA 2E2JB 3QFJE 2X6LA 4WWOA 5FGBC 3M17B 3LD8B 1GL4B 1U4EA 5BCAA 2K8QA 3KE0A 4MJ5B 3FXIC 3AU7A 4MIUA 1BJ1H 4KJWD 1GMIA 2J7LA 2XU9A 5MI0B 1KIUA 5D7JA 1IAIL 4MZ9A 4LL1A 4NO5B 5KNBA 2EVJA 4HD5A 4JKKA 2CJUH 1Q9WB 1FYCA 5IVXF 3S48A 3HC4H 4ZFOB 1BQHB 3SE3A 4PGEB 4OCLC 3EHBB 4KRLB 4N8UA 4MNGB 3SJVA 3ROOA 3C5JB 4AUYA 2K6WA 5D7LE 4WNQB 3S2DH 4KDWA 1GPOH 1TENA 1KLFA 4MNHB 4KY6A 4WWPA 2GB2A 4YDKL 3LH9A 2EJFC 2VR6A 1I6HH 1EY5A 2X2JA 3C9NA 3HFMH 5C5LA 1JGDB 2DS4A 4TVPL 3NQTA 2X1XR 3H2WA 1JZDC 2F0JA 2AV7A 4JGUA 3G5ZA 1JYWA 3ESVF 2UUBQ 4JLRB 3C08L 3DOSB 1IAKA 3EUUA 5TE6L 3TH3T 2H3KA 4YDJB 1FNEA 4P46C 2IV9A 1X44A 4UU9B 4X6CB 2WKOF 4XPGH 3ROLA 3TBVB 3MBEB 5ETUB 4YGAB 1JHKL 2BM3A 1BIHA 2DWEB 5FO9B 2VDNB 2XYCA 1OGAE 5IP7H 3IJEB 2A9NH 3RB7A 3RWGA 2UV3A 1OALA 3KM1A 1L5GA 3MTSA 1HT6A 3K6OA 1S8DA 2ZP0T 4LFCQ 3JVGC 1Q0EA 5EG6C 1T2QL 1U8IA 3HUJE 4HZLA 1BUVT 1MWAL 2XQ0A 1KY6A 3K8LA 1LT4D 4YUEH 4MKMA 4X6EA 2AQ1B 3DO7A 3L08A 4GKNA 4GXFA 2VL4A 5KYYB 2BRRL 1F6AB 2QKIB 3V0FA 1MHWC 4FF9A 1PFOA 4BA2I 5BRPA 5L2KA 1RZIA 1K3RA 2WBJA 4GLXA 2FB4H 1ZKAA 3F6JA 3TNMB 1RERA 1E6JH 2PNDA 3C8HA 4FFZH 5FLXc 3I02B 4UQIM 4JI2Q 2YQ2A 4R4QA 3OPUA 2V4LA 5CSZB 5FFOA 3RVXD 1A25A 3BUBA 2K9UA 1QBAA 4JR9L 4IW4C 1BX2A 3Q5TA 2N0KA 5ISZB 2P28B 1A7PL 4S1RH 1GOFA 3BKMH 4KPHL 4M5YH 1VQAA 4V1DB 3FOLB 4XR8C 1I4QA 2FJFA 2HCCA 1K4CB 3L5HA 5CV6A 1EQTA 3G5XB 3TBSA 4Y4HC 3S37H 3KGRA 3M4YA 3UBXA 5I6XB 4LKXB 1XR9B 3T2LA 4BCXA 3MBWA 2EDLA 1CVSC 2RSNA 1FVCB 3SN6N 3FB5A 2DF3A 1WA0X 3NPSC 5IEHB 3QYMA 3ETTA 5KNDA 2KKQA 1RF2D 1VF7A 3CDGA 3UPRA 2BSCA 1TLMA 4OGXL 1DQIA 3QDGB 4XNQA 5BQDA 4NUQA 4BBRG 4EX5A 4K5NA 5HHOD 2FH6A 2A9AA 2RCSH 3O4LD 3PUVA 5BN5A 3RFZB 4OLWL 1DBAH 4KK8C 1KCBA 4XTRD 5SX5K 1TPXC 1BLIA 2QPFA 4MX7A 5GZND 4MNQB 2CCZA 5EU3A 3NRQA 3UE0A 2EO9A 2YQGA 4HKZA 4MAUH 3A6BL 2MCPL 1GUNA 3STBA 3A56A 2BSRB 1YI2A 2N49A 1I1AB 3DUZA 4Y2DD 2WWKT 2Y07L 2YPKA 3ZTJH 2LSSA 4R2GB 3FCTA 3N40P 3VTAA 2UYLA 1CE1H 1RCYA 2DJMA 4FQXB 3F12A 3VFRB 1JWSA 2OMZB 1SN2A 2M2LA 2Y2WA 4HJTA 3HS0C 3PIQA 2O5JC 2E9GA 3S6CA 4CW1B 4JKPH 4MJ5A 2OCFD 5A7EA 4XBMA 3ZE2B 1KB5L 4FDBA 2E5EA 1XPRA 4MAYB 1FL3B 1H95A 5C0JB 2EVFA 1X9RA 2Z91A 3IEAA 2C9VA 4P23D 4MASA 3COOA 3MRDA 4NO5A 4XP9H 1JPST 4KZDL 2YTVA 2TRYA 3LNIA 2B5IB 1F4HA 2BVUA 4JFYA 2YGQA 5EO0B 1XZ0B 1NMAL 4XXDB 5C7XL 2K3HA 2CM5A 4ZFOA 5FA3B 1BQHA 4IKNA 1I4FB 1KIRB 4PGEA 4F7EB 4XYOA 2FBJH 3H53A 1CGTA 1B3QA 4MNGA 3C5JA 3BD3A 3ZKQD 1S5CD 5I2YA 4OB5H 3TH2T 4WNQA 2RCNA 4X9FA 1Y8NB 2AI0H 3K7UC 4NN6C 1ZY9A 3S4SG 4CADB 1Q9OB 2NTTA 1MHEA 1D9KC 3BLBA 4UTAH 3EYFA 2A83B 2EDDA 3TZUA 5DVLA 3F64A 3EN2A 5F6HJ 5B4MD 1XH2A 4MCMA 4AKQA 5JW4Q 1WTXA 4P3CL 4PJ8B 4R0LB 1EZUA 1F9PA 3GSRB 4N2NA 4KVNL 5EBWB 5HHOE 4HJ8A 3O4LE 2DJGC 4IFDG 4LSVH 1QLRA 4UU9A 4DTGL 1OEZW 1OXYA 2N59A 1JYXA 4JK1C 1ROWA 2CJ3A 5D93C 3MBEA 1NSNS 5ETUA 5FKAB 3TBVA 4FJZA 5HDQL 9PCYA 3VYPA 4G7RB 1KN2H 2VM4A 3K81A 2AS5M 1JDDA 1BNZA 3HOUH 4GKLA 1MCSA 4I88A 3G9VA 4WV1A 1N5YH 5C44H 4LL9A 4W9JC 1ZTXE 3EA6A 2IOOA 1KGYE 4NXNQ 4K15A 5F7MC 4O51B 5KYYA 4GG6B 1LE5B 2C9OA 3KJPA 1KNOA 2Q7YB 3O4OC 4OHJA 3PRZA 2VJ8A 3TNMA 1T4WA 4G6ML 2F5BL 5K1NA 1ICWA 4R26L 1NUCA 2K7VA 1SJEB 2G4GA 1JVLA 1ZIBA 4GRWE 3HFZB 2V7NB 4AQ1A 5E94B 4JW0A 2FGWL 3C12A 5JVG3 1NFDB 4PRID 1TS4A 1VS0A 1KL9A 1X4YA 4OJFL 2OBGA 4P5TC 3TC9A 1A4BA 3IBEA 1PIGA 4PS4L 3MHBA 2JXMB 1HAUA 1S78C 5FW6A 1KEML 5LMNL 2HKFH 1T03H 4NQCD 5EOCH 3GJFB 4V1DA 3FOLA 3BD4A 5J39A 5CWSB 5AW3B 3OQRA 3WHE0 1FGUA 1MFUA 1O5DT 5KTEH 1WEJL 2GEEA 3QYCA 2IH8A 2EYRB 2XWXA 3G5XA 4PYGA 4BFFA 4H1LH 1E3XA 3K5LA 4JZJB 3ECWA 1KELH 1F18A 1XR9A 2GFBB 4C8XA 5GGRB 2GSGB 4XMPL 4XP5H 2OSYA 4EO5A 3IJYA 5IEHA 3UDWC 1RZKH 2EKSA 3NP3A 4PTTB 2B4CC 5FK9C 5HDRA 4Y88A 3R19A 4OCYH 5E6ID 5ABZA 1G7PB 1YMHB 4XX5A 4HCRH 4M43L 2X1OA 1AIFB 4MHEA 2EIZB 1A6UH 2GBTA 4DNLA 1RZ7L 5D71H 4NP5A 5KANI 1JXFA 1FGVL 1D5XB 4DKAC 5T1KD 1TWHH 2IOMA 2A1WL 3FUMA 4L4TD 4BHUI 2YUVA 1AQKL 4AXWA 5LWYH 1Z5LB 4P4RA 3HGBA 2K5VA 3NJIA 3T1YL 2BSRA 4U7KA 3T2NL 1I1AA 3MRBB 3VD4A 3MRCA 3PY9A 3K71B 3MRIA 4AITA 2X3AA 4DV7Q 4IBUA 4WW2B 4YIJA 3GTOH 4HX1A 1PZAA 1QNUA 1DVXA 2XN9C 2X4TA 1HCYA 3DIDA 4WEMB 4DR4L 3UJJH 3LRKA 3VDYA 1U4FA 2HVBA 4KO6A 4G6FD 4WJ5A 5IIEB 5EU6B 1EOVA 1ECZA 4Z0XA 4ME3A 2ZG2A 3GO1L 4MAYA 3VFSB 3ULSB 5IMKB 4X5XA 3LKPB 4HC1H 5C0JA 3HI6L 4U6HB 1JHLL 2BP8A 2D7NA 1S7SB 1BEYH 2OZ4L 1L0XA 4PRIE 2ZWLT 1SMOA 4K94L 4WWKD 1DBML 2B29A 5BRZB 1FLTX 5EO0A 1LQBC 5FA3A 4DO6A 3JWDH 1T7ZA 4NQCE 4OJCA 5ILTL 4LKCB 5C6PB 3DLQR 2R15A 5ICXB 2ZYRA 1MCOH 4OD2B 3CK0L 3P0YL 3JV0A 3VQMA 4MS6A 4YDVA 3G5WA 2BDNA 1MCHA 5KVFL 1WTHA 2OTPA 3MLVL 3L54A 4O58H 4XN8A 1JCKA 4XZUA 2AQTA 3CD4A 4CGTA 4IBZA 4MA3B 3TF7C 1LVEA 3LS4H 3LVTA 3RD4A 3HN3A 2A83A 4IDJL 1X65A 1YSOA 2F7IA 4NUGH 5FM5M 1TQSA 3CDCA 2A9ML 2GIYA 3V0HA 4R0LA 1DJHA 3GSRA 1BQUA 3LRSA 1Z66A 2KZKA 4I0PB 5EBWA 3FQYA 3HKZE 1I7ZB 3IGFA 1XR8A 5EIQA 3FQRB 2YD0A 5I1HL 1ZHKB 3H3PH 5EAYA 5DMIL 4DZBB 2YA1A 4XBEL 3T1FB 5CZKA 1P7KB 4RGTA 3O3EB 3WFZA 1J0JA 1TG8A 3NQIA 2OR9H 4L4TE 5IB5A 3QUHA 2P26A 1TS5A 4JQXA 2J8UE 1LILA 1VCBC 3BKCH 3OJDA 3VMNA 3ASWA 5IFHL 3T4AB 5L4IA 4O51A 1I8UA 2DMKA 2Z92A 3APNA 4MCNA 4OQ1A 3W37A 1LE5A 1FVEB 2B3GA 3TPKA 1QI4A 1QUPA 5E00B 1UD2A 1LO4H 5EN2B 3CLFL 2O6PA 2AJYH 2P1YA 4H88L 2QQLL 1GYAA 5ACZB 2AABL 4G7VL 2CW0C 4GI6A 3DMMD 5E94A 3ARSA 3W1ZA 3KLSX 5DMGD 2WNKA 4ZQTA 3EBIA 1RK7A 1O6VA 1AW7A 4PRNB 5FM4A 1AZQA 2X88A 4QHLB 1L9QA 2H1EA 2EACA 3PLYA 4RMTA 5ESAB 1U8PB 2XZZA 2WQRA 4CDDC 3GJFA 1RJYB 1T20A 5CWSA 1AY1L 1WK0A 3EIFA 2P3YA 3FO9A 4M7JL 3OKDB 4X0NA 3MJGX 4A3BH 4F9PC 4ELDA 1E9QA 1K28A 3H2PA 1A9VA 1I4HA 1JZEA 4DR1Q 2R92H 5GGRA 5DURD 3QR0A 1WZLA 4HK3N 3RPKA 3IWUA 4PTTA 5TDNB 5DO2C 2QVFB 5MP6L 5DJZB 1UA6L 2Z4IA 1RIHL 1YEIH 5HGAB 5JEAG 2RKSA 1G7PA 1PH5A 1XNRQ 3CWGA 4R4FH 4YHNB 2EIZA 5JXEC 5IEKB 3D0LB 4Y16B 1WTOA 2OA9A 3CD6A 4OEMB 2H47C 4GXUM 3CLWA 1O6SA 3OXSB 1UG9A 3DXAB 3B9DA 1A9EB 2HRPL 4YHLL 1W0VB 4PV1C 2NX5B 1VACA 5I0YA 4XIGS 5K39B 1J12A 2V4DA 3JTBA 3MRBA 3MRGB 3AT8A 3GM8A 3WUWG 3U25A 3V6OA 4CVUA 1FV1B 1HN1A 2VLMD 3UTZB 4DFIA 5E4WC 1X9QA 4JCWA 1VEPA 3BAEH 4JFFB 4ADGA 1NIDA 4IJLA 2CLZB 3HZ3A 4JI1L 3JZYA 5EO9B 4ZFQA 3RL1B 5F7KC 5BV7H 3RIAF 3PUWA 3NPZB 1MCWM 4HIXL 5EU6A 2IPKD 3FUEA 4B27A 1NCWH 2JJTC 2P8PB 4UM8B 5AG8A 1DD2A 1YNXA 3ULSA 1EGJH 4U6HA 1HCVA 4OFYD 4JY5L 4NNPL 5JOFA 4BSJA 2IGFL 3GINA 3QJYA 1A3ZA 4ZO7A 2EXWC 1QWYA 5AVWB 5K1JA 2Q86A 3I85A 4H20L 2A74B 3B9KB 5HHMB 3GD1C 3KPRB 4YE4H 1B8AA 3D3VE 4LKCA 1M6OA 1WFMA 3MCKB 1Z9SB 5DC4B 4Z23A 3QHTC 2NY0D 1I3GL 1T89C 1QLEB 2AHIA 2V8MA 4ALPA 3FHEA 1XXDC 2IH1A 1CWVA 4ZTEA 4J8RB 2WUBL 5IESL 1ICFB 3PL6B 3BSZA 3RGVA 1BFVL 1YECL 4B3MQ 1PV4A 2AK4D 3RDTC 4KXDA 1DDTA 4A7QA 3CVDA 3NEXA 1RZFL 3W38A 2HFGL 2WP3T 1AZUA 2YXMA 3JAME 1T7VA 1NC4D 2ITFA 2VDRH 1MCIA 3LCYA 4P2YA 5FO2A 4FXKB 1EUJA 2E3VA 1G9NH 3MLRL 1ECYA 3FQUB 3BUQA 3N1FC 4M7LL 5KAQF 3D09A 1ZHKA 3JV4A 4DZBA 1NBVL 1P7KA 2GHWB 3G6JE 3O3EA 4DR2L 2OYMA 1H3XA 4JCLA 1OCOB 4AIMA 3FTUA 4QGTA 4QMEA 2H4OA 2ZZUT 3T0EB 3W56A 4MDIA 2Y36L 4G5ZH 2BVEA 2GC7C 1QEXA 5KBNC 3BN9D 1IT9L 3NFSH 3AT0A 2L7JA 4JFXB 5F9AC 3T4AA 5FKPA 3WJLA 5I1AB 3T6QC 2XN0A 2GTZA 1BVLA 2VLME 4IIQB 1IQDA 1KGJA 5CMDA 3U7YH 3IL8A 5E2WH 3GUTB 3N43B 4WKZB 1J9SA 3U1QA 2MO1A 3P20A 4A7TA 4PQXA 1MHPH 1UUSA 5AZ2H 4RGNB 4A6YB 1KJ3H 3RY4A 2N3SA 3BAWA 4IN3A 4J4PA 3H42L 1THAA 5C6AA 3B9VA 1WC7B 1RUQH 1N10A 5DFWH 2CUHA 2VXVH 1JMZA 1BFOB 2WB1B 2JQAA 4NO2A 1L6XA 2DBLL 4HEPA 4WAFA 3GSQB 5F96H 3UDGA 1D7FA 5GRZA 3HOZG 2XYBA 3O4LA 3ITPA 5IP9G 1U2HA 1UE5A 1K72A 5CV8A 5HD8C 4KV5F 3WJJC 4ABWA 3ARFC 4I18B 4MJ4A 3JWOL 3N0PB 3OKDA 4GKKL 1CLOL 3B7TA 5FYKH 5I16B 4QIWE 2FE0A 2R8SL 1XL4A 3SDAB 3A5ZB 3MLZL 1F1AA 1GRWA 1Q1BA 1MWAB 2XC8A 1ML0D 3DHPA 5TDNA 2AK4E 5BPPA 2NUCA 3KYKH 1U6AL 4XMXA 2D03H 5DJZA 4K55A 4Y8DC 2Y0SB 2OI9C 5HGAA 3O3UN 4KHXH 1OTUD 3K4ZA 5BO1L 5CKGA 4KHPQ 5C0IB 2Q6WA 5KSAC 5D1QD 1BOSA 3MTRA 4XVTL 2JNZA 5FM8A 2OMVB 5IREA 4LUVA 1IJNA 1QAWA 2FGZA 4RMBA 1ASOA 1W6JA 3ZE1E 3D0LA 3FFCB 5FYLL 1HINH 3MRPB 1G84A 4QNPF 5DRZB 4JI7Q 4DQOH 1WE5A 2CJTA 2CIKA 2F0FA 3TP7A 1W0VA 2VISB 4P23A 4B7LA 2FEDC 3P11H 1PX8A 1M4VA 5M3MG 1WUNT 3QUYC 2I32A 5AWNH 3CHOA 3VH8G 3ZDZF 2R4RH 3ISYA 3KR3L 2R0KH 3DIFB 2VLRD 1B0GB 3KPSE 5JR1L 1FV1A 4M29A 4J3XA 3VFUB 1HJPA 1DL7L 3BIBX 3Q2WA 5KS9B 2N1TE 5GS0C 4F7TB 4BXXH 3ZTEA 4KN7C 5D7HA 1AHWC 3TTYA 1A64A 2EUVA 2VC2L 2XWDA 4PJ6A 5EO9A 3J81j 3CQZB 1C8QA 3RL1A 2ZAIA 4F9LA 2CO7B 3EF4A 4LMQI 4PI2A 4XT3B 1AZZC 1QG3A 4HUUA 4PJ5B 3WEBA 4BFJA 1YHBA 3GXMA 4U1HA 2RGSA 3C87A 5E24E 1X7TA 4HA1A 1BW8A 1KTBA 4HU2A 3A24A 3MXGA 4YAQA 4KK9D 3AABA 2ZOOA 5I19H 4PRBB 3U1SL 1O7ZA 1V9PA 4LMQD 4ALAC 2EC8A 4B3TQ 1LJMA 2A74A 4NRZA 3PWPD 3D85D 4O2FB 5J12C 1OD9A 3PWVB 3B9KA 1TCRA 4IRSD 4PIBA 3N6RA 1Z9SA 1SE4A 2FSEB 4NXML 5F0PB 3MUHL 4GBXC 4PLOB 3KVQA 4WGVB 1IBKL 3MNVB 3K7AH 4J8RA 3KDMA 4OIBA 1CC3A 1RZJL 3KYNB 3PL6A 5FUOL 1TXYA 3RP1A 5HVWA 2FJSA 3MACH 3QJOA 1EYDA 5IGXH 2XZAH 4IFDJ 2Q3XA 2IX1A 4HJ1A 4FLQA 4JFED 4MXWH 3OGCB 1A3LL 3QDMD 3WCYA 3PIO3 4HULB 4FXGC 1GC1H 1ZLDA 3IGUA 1FNSH 2GCYB 4NOFA 2FJGA 4F2FA 1ROCA 1Q1EA 5D1QE 3RVWD 2FJ2A 2UUAQ 2G9HD 4KAQL 2NXZB 3CFIC 4PJ7B 3FQUA 3NGBC 3HOXG 2EJ1A 3PJSA 5HJBA 3T2QA 1A9BB 2CMRL 2EC9U 2EECA 4AJ0A 5KUKA 5G5DB 3UC0H 2Z64C 3JWNC 4PRIA 1REIA 1EHAA 1JPGA 2Y06H 2E2JH 3T0EA 3O6FB 4LSQH 1URIA 4FQ2L 1RU9H 4PVNA 1WFOA 3MRKB 3CCQA 1PKOA 2IBZX 4AK1A 3WAJA 1BWWA 3MRNB 3OM3B 4K3JL 2V9TA 2VLRE 2VR7A 3S15B 2ZD0A 4UNUA 5E56A 2BE5C 2BFVL 4JFXA 4F57L 3Q5YA 1WD0A 2WSPA 4NNXA 1BG9A 3QWRA 2MIZA 1WTLA 4WKZA 3AUVA 4M4PA 1W6LA 2QCPX 2KUMA 2ZJSH 3IK2A 5I28A 1PRTC 4K8RD 4A6YA 5DM63 4JREB 1W8NA 2DWYA 2DQIH 2CAKA 2ERJC 1CFMA 1HEZB 2VDQL 3EOAB 4FQLL 4KUZH 4NP4H 5ACMA 4Z7AA 1BFOA 1KAAA 4OLZL 5E6IA 5T3XH 2MUYA 5AVTB 2ROXA 1N3NA 2OMUA 4OAWB 1XBRA 3MLSH 1NDGB 1TWCB 2XTIA 4PRPB 2MCAA 4WNJA 1S7XB 1SOKA 2H1XA 3PWPE 4JPVL 2DB8A 2L11A 1DE4A 4I18A 3K4AA 2F8XC 3PPEA 2K33A 3HTLX 3S5ZA 5ID1B 4A3CG 3S8GB 3MBXH 4ZI8A 3QUXD 4L4TA 3JUYA 2B3IA 4LBEB 5I16A 4OIAA 2BSED 2J8UA 3SDAA 3WIAA 2YPLD 2BOSA 1S7UA 1ENFA 5KVGH 3US0A 1KDBA 1HZAA 4CBVA 2WB7A 3GB7B 3WD5H 1UACH 1VIWA 1YJNA 1UYWL 1YEKH 1OT1A 3P4NB 3FT2B 4TUKL 3KLHC 4JFEE 4X8CA 5BNXD 5C0IA 4QF1B 1M2OA 1F56A 5EUOB 4MJ2A 3FO2B 1LWJA 1IYVA 4QRPA 2CVRA 2R2CA 3BVMA 2OMVA 5IB2A 4JHWL 2Z9TA 5FM5O 4DOHE 3EJSA 5I1DB 3MRPA 3BSHA 3G7LA 4Y2NA 3DTUB 5DRZA 4RA8A 4ELKA 1KENL 4E9QA 5EEUA 4FJ6A 2DQJL 2VISA 1RUMH 2Q8AH 5IVOA 1JZJA 1A0QH 1SHMA 5FCSH 5KW9L 1FJGL 2HT4C 1FR3A 4HWBL 4WWKA 3SCMC 4HBCL 1SR3A 2IIJA 2Y72A 2JN4A 1AD0B 1T0OA 1YQ2A 2EKJA 2VJ0A 1B0GA 1TTAA 1VQ7A 3DIFA 2V3DA 3G7TA 3EFDH 1RZKC 4YDLC 3VFUA 5KS9A 2JV6A 3T3ME 3E6HB 1OXVA 5FHAL 3K6IA 2EXYD 3HBGA 3RJQB 1NGQL 2YFNA 4JFHD 3VGBA 3EYQC 2AJ3A 4PJ5A 1QRKA 4HGWB 1T2XA 1SVZA 3MOAL 5IOCA 3F2DA 2DY8A 3TO4A 3WNPA 4D2NA 5E7FA 4AGQA 4I77L 2OTJA 2GBVA 1LTSD 4YY3L 2IG2L 1XF2B 3H7BA 4WSJA 1YEFH 4PJFE 1GVIA 3MJWA 3E8VA 3AT9A 1NUGA 3WHE1 3KF8B 3V6ZA 2F0VA 2QSQA 2G9DA 1CJYA 2VR8A 2Z6BA 2LU7A 3C60C 1IC5H 1YNTF 2X9ZA 3BOVA 4DP9X 5DLQE 3QNXA 4NW2A 4O2FA 5KJRH 3F58H 2IXQB 1U3YA 4DR6L 1J05B 4EN3D 1JZ6A 4GYBA 1Q8KA 2F1MA 2I60H 4G8AC 4OFQA 4PY7B 4OM1L 5E95B 3X3FL 3GSWA 2FSEA 3BUYA 3DYOA 1QW9A 3WKML 1MSGA 5JHLL 3MNVA 3Q8FA 4M1GH 1ADQL 3IDNB 3KYMB 2PPEA 4KDTA 3K72B 5AUMB 4GFTB 4JPSA 3S4SB 4G42A 2A6JB 2BIPA 3L2MA 3Q2LA 5HI4C 5GS0L 1J1OL 4LF6L 3G04B 5TPWH 1U58A 1GOHA 3OGCA 2J4XA 1N0XL 1WJJA 2P4AB 3BE1H 3U4KA 5F6IB 2GCYA 1JZ7A 3HR5B 2PTVA 4XWOC 2K45A 1KDCA 3ZUCA 4U7SA 1HR0Q 4PJ7A 2VQEL 1DQDL 3VFGH 1Q8IA 1MZYA 1A9BA 4E42B 1RAMA 4IS6A 5G5DA 3NPPA 1WS8A 3TN0A 4UHVA 2XTLA 2P5PA 3P75A 5LXGL 3ISRA 3M86A 1NKOA 5FO7A 3O6FA 2O5NA 3UADA 1IIIA 1V7ML 2DQCL 1F58L 3D3VA 1UXMA 3MRNA 1A6VH 5GPRA 5D65A 3U36B 4YL4A 3UTPD 1NOLA 4UANA 4ZPVB 1WHOA 3OL2A 4WO4C 3SR1A 5CFAA 1P7QB 1FQ9C 2CSPA 5DC0A 4PV8B 4LU5L 3TBWB 3W11C 4F8LA 4JFHE 2DLEA 1GVPA 3I3CA 2YD9A 2O5YL 3HI5H 3IFLL 1URLA 3LQMA 4UILL 1QFPA 3AZUA 4DK3C 3BYTB 2J0TD 3PO3H 2CK2A 1JORA 3DI2B 3L3IA 5DC9B 4HIMA 4JO2L 3CCSA 3RWHB 1ZA3A 1HEZA 3EOAA 3HMWH 3WTYA 4OO1G 4AJWA 2EH8H 1B1ZA 1BXUA 3VMOA 3VW3H 3IVKB 4OAWA 4UY8C 1NDGA 4I65A 3CPWA 2ZWZA 4QOKB 1S7XA 2PXYB 2BDNH 4NM8L 1MCPL 3DMUA 1Z3GH 3G6JA 3GZKA 3TP8A 4GEIA 1Q90A 1EYAA 1AKJB 3CXCA 1MVFA 1C5DB 4LBEA 4DO5A 2CKBL 2B9BA 3MX0B 2N0MA 5A3ID 5KBDA 1MF2H 3OSKA 2EE9A 1KCKA 4B50A 3ZTDC 2NRDA 3GB7A 3D87B 4XVSH 5AVZB 1XPOA 4GB9A 4K5LA 5F93C 1ND0B 3E38A 4H7BA 3FT2A 4QCIB 5CZVH 6TAAA 4QF1A 2BS9A 4LFAQ 5CJXA 2Y69B 2XQYG 5ALCL 5EUOA 4GMSL 4NZUL 3BH8A 1D5ZA 4K3DL 4ERSH 2ZCHH 2X44D 2AW2A 4BFNA 1TEGA 3VXTB 1PDQA 4ODHL 5C0AD 2OFQA 1KTCA 4K8JA 4RH6A 1MCWW 2C9QA 1EHLH 3BWZA 4FMVA 4NPSA 4G8FA 3BP6B 2YOAA 5CS7A 3S1RH 2MQCA 3Q01A 5B8CA 2YSTA 1OQOA 5FA4A 2DNEA 4X98B 1FPTL 1HNGA 2EUXA 4L5RC 1JPEA 3IF1B 1TOXA 2Q8IB 1XTDA 1XH1A 3E6HA 1TJHL 4JO3L 3ZDXE 1CR9L 2JIXA 3UTPE 1ID2A 5BZXA 3VAEA 3VG9B 1INDH 2NUPA 5T5NF 3AFQA 2EDRA 4ODBD 3SKJH 3ZO9A 4CGYB 2J56A 2FEEI 3FH8A 3NIDE 2X1QA 1SMYD 3N1MC 4ZYKB 3ARXA 3SDYH 3LQAH 1XF2A 1I75A 3U9PL 2AK4A 3PNRB 4GEJA 4DR5Q 4EI5B 3GJFH 3KLQA 1D3CA 1I8IA 3QEGL 2I9TB 2D2CC 2AQ3A 2NTSP 3F7VA 3PQYD 4NBZB 4AC4A 4WWNA 4CNIB 2EDWA 1AQDB 1J05A 1ACCA 4V2BA 3DWTA 1CS6A 2DQTH 1JNHA 1QNIA 4FQHB 2FT8A 1IKFH 1WWBX 4U0RC 1TQBB 2CPCA 2HFFB 5F3BB 3O3DB 4ORGA 3K74B 3VACA 3ZYIA 4GNXB 3X1BA 4G9DB 4HS6A 4N2DA 2VDKL 3MXUA 1L3WA 1JOOA 1QBMH 2ITDB 4P06A 3IMWA 2OTLA 3PF4A 3KPSA 3A4DA 4GXUN 5AUMA 2UWEE 1JPSH 4L9DA 3SIKA 4FNLL 1M7DA 1CU4L 1L9RA 3HE7B 4YPJA 5H94B 1HH6B 4N5ED 3G04A 5I8EB 4RIRB 5K9KB 4POZC 2BY1A 2X7LB 4LF8L 1P16A 2VL5B 3FK3A 4AYBG 2DQFA 1BF5A 3DGGB 3GBLA 4LZKA 4BKLA 3MCYA 4JO1H 1KF9B 1RLWA 4Q6YA 4AL8C 3D7PA 4HAFA 1OTCA 4CDGC 4E42A 5D7IB 2H26B 2X5PA 5C0AE 4JBSA 5DWUL 3GS4A 3I7FA 3HR6A 5HHPB 3ULAB 1QSZA 5AJ3L 1JI2A 2KYIA 2Z6KC 3TYGH 4X80L 1AR1D 5KSBB 3TIDB 1ACYL 4BUHA 3JC66 1Q86C 1H6UA 3GRWH 3HNVL 5LO7A 5DD5L 2WQXA 1NMFA 1WUZA 3K0WA 4MS8C 3U36A 3BLPX 2FWOB 4GY4A 4WHCA 4DP0X 1EQVA 3MA9H 4U49A 5D2LF 3TEXA 4E9SA 1OOAA 1P7QA 1AG0A 4W6YB 3S2HH 2NY6C 1NCTA 3ARGC 3TBWA 3QXAB 5AFAA 5ELOA 1G9NC 4OKVB 3QXDA 2Q5BA 3GSNA 2VDOH 3K57A 2DMHA 5T1DL 3RUGB 3RWHA 5IFAH 3AG2B 1ML0A 3SKMB 1SNOA 1UADC 2IY5B 4CKQA 1BBDH 3CX5K 5EN3A 4XO3A 5F1NB 3HKFA 4Y7MA 5I6NA 3WTUA 1HL5A 1S9VA 2IJ0C 3DSNB 3VYTA 3PQYE 3IVKA 5IF0B 1ED3B 3M3YB 1NEUA 3BZKA 1E4JA 2FWSA 2EDYA 2L0DA 4XYQA 2WWNA 4JHUA 1SEQH 3BD5A 2IPUK 1TJIL 4MB5A 3BSZH 4WTZG 4QWWC 3BZ4A 4LASL 1AKJA 5LCVL 2PW2A 2VDLL 3UXFA 4F3FB 4ICWA 1YIJA 1C5DA 5FDWA 5HY9A 4OFKA 4XCCL 1S5IL 3MGAA 3RBSA 1D6VL 1X5HA 3WL9A 3U6RB 2VLRA 1RMFH 1ZV9A 4FI7A 2HVKB 4JDTH 1G43A 1VQDA 1P4LB 4FXDA 4YS4A 1ND0A 1UJTA 2V5YA 2JA7G 4OQTA 1GO3E 1CFTA 3CMGA 4QCIA 3HE6B 3KBFA 3GNMH 3H3VI 4MCYA 4IEFB 1GGCL 3EO1B 4OJEH 4WEBL 3VXTA 3WNNA 3L2LA 4NJAH 3R06B 1A7OL 2B1AL 3FQWA 2YAFA 3PNWB 5JUEH 1HTYA 3EYVB 4IOIB 3BP6A 5M3FG 2R69H 4ATTA 1OARH 4HSQA 2F8VA 4PJ9B 5TQ2H 3QQXA 2PPBC 3HN8A 3VYNA 5DQ9A 5JNYA 1DBBL 5J9PA 4MDJB 4X98A 2B20A 3D85A 3PWPA 3PDOA 3IF1A 3ERQA 3WUWB 1P9MC 3OJMB 4IRSA 3SOBH 3IWVA 3WN6A 1XQ4A 3GKWH 1HWHB 3FU5A 5DUBB 1EIFA 4X6CE 3AG3B 3WEXB 5DD6B 1PH4A 1USZA 5CEZL 2H41A 4D0BB 4ZYKA 1ODAA 5D1XA 2VQFL 4DV2L 1TTFA 5M5YH 4YSAA 4EI5A 3U9WA 4R2GD 1HZBA 3T08A 1M9SA 25C8L 4GJTB 3F2CA 3QDJE 4DEUA 4FQXD 3QRFM 4Z3IA 4A7UA 5I9QC 2PR4H 1ZYRC 1OGSA 3CRLC 1A6ZB 3EO9H 4CNIA 2F5AL 3A0JA 4JPKL 2JK5A 1MXDA 4IPGA 1CQVA 4HQQL 5J3HC 4QRUB 4FQHA 4XMLH 1E2WA 5I30H 3RNUA 1TDQA 2HFFA 2HMID 4RAUC 1HI6A 4MVBD 5EU4B 5B3NA 3BQUC 1BXXA 4GNXA 1ZTXH 3ME0B 1SUJA 4G9DA 5JPNA 4QY8B 3LKOB 2OMBA 1LP9F 2DL9A 3PUCA 2G2NA 4J3OC 2R0LH 2CBOA 3HE7A 4KJQC 3EFXD 3E3QC 1HH6A 2OL3B 5H94A 3W9EA 2H2PD 4BSWA 4EVNB 2VRQA 4W6XB 3RTQA 4A3GH 3KLLA 4ZUTB 1ZGLA 2VL5A 1NCJA 1AGEB 3OKLB 1TWFB 4DN3L 3CN4A 5A2LH 4WFGD 3V4PH 4P2OD 2GVBA 1S5HB 1SXSA 4MB3A 5HHVH 1LO3H 5D7IA 3TT3L 4R8NA 4XP1L 1I9JL 1ES0A 2WNWA 4PGBB 4P99A 5D2NE 2H26A 3U7WL 4Z3HA 2VLJD 4P2QD 1NIEA 2YK1L 4OZ4A 1Q94B 3RWCA 2IWGA 5HHPA 4PJEF 3JVFC 1XMEB 4H26A 5KSBA 5IUCA 4CJ1B 1TVHB 2YD8A 3EUDA 3KXFB 4JZNB 4XCFH 1M05B 3TIDA 4BUGA 3S1NH 2QPSA 1R0AH 2WYHA 3UGEA 4M48L 4P4KC 4X7SL 4BZ2L 4Y7OC 3LGJA 4AG4H 3ZE0F 4APVA 3RURA 3OLDA 3FMGH 3U1PA 2MP1A 2VB2X 3O2VH 4K5XA 3QJHB 4UDTB 1IBBA 4WORA 5C1MB 1RK0A 3LSOB 4OKVA 3TPUA 4HJ7A 1IAOB 3CSYB 3SK6A 1EHNA 1UZ8B 3KOJA 2GTWB 2WAHA 3NIGF 5A43C 1RY7B 3SKMA 2LU3A 4EVOA 2CO1A 3G6AA 2X0VA 2VLLA 4FFVD 4HSVA 3IJ8A 3F7PC 5LMNQ 1CFBA 4LHUD 1QSEB 2BY3A 3BEVB 3OWEB 2VDPL 4L37B 4L1DA 5I71B 4WJ4A 3HOZB 1DLHA 4BS9A 1ED3A 2NYZA 2YMTA 3QORC 3S5YA 4AL8L