4FXGC

Complement c4 in complex with masp-2
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
287
structure length
287
Chain Sequence
VVEEQESRVHYTVCIWRNGKVGLSGMAIADVTLLSGFHALRADLEKLTSLSDRYVSHFETEGPHVLLYFDSVPTSRECVGFEAVQEVPVGLVQPASATLYDYYNPERRCSVFYGAPSKSRLLATLCSAEVCQCAEGKCPRQRRALERGLQDEDGYRMKFACYYPRVEYGFQVKVLREDSRAAFRLFETKITQVLHFTKDVKAAANQMRNFLVRASCRLRLEPGKEYLIMGLDGATYDLEGHPQYLLDSNSWIEEMPSERLCRSTRQRAACAQLNDFLQEYGTQGCQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Complement C4 beta chain
publication title Structural basis for activation of the complement system by component C4 cleavage.
pubmed doi rcsb
source organism Homo sapiens
total genus 55
structure length 287
sequence length 287
chains with identical sequence F
ec nomenclature
pdb deposition date 2012-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01759 NTR UNC-6/NTR/C345C module
C PF07677 A2M_recep A-macroglobulin receptor binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.120 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4fxgC02
2.60.40.690 Mainly Beta Sandwich Immunoglobulin-like Alpha-macroglobulin, receptor-binding domain 4fxgC01
5FO9B 3CU7A 1XWEA 2ICEC 5FO8B 3FRPB 2QKIC 3HRZC 3L3OC 1GXDC 3MA2B 2J0TD 3OHXC 2I07B 3CKIB 2B39A 5FO7B 2WIIB 2WINB 3HS0C 1BV8A 4LNVA 2E2DC 1PXUA 3I70A 4D94A 1EDYA 1OO9B 3G6JB 2XWBB 3T4AC 5FOBB 4ILWA 2A74C 3KLSA 5JPMC 4FXGC 1UEAB 2A73B 4FXKC 1BR9A 3V96A 1AYOA 2PN5A 5JPNC 2XWJB 1D2BA 1UAPA 1JB3A 2TMPA 1JC7A 1BQQT 1BUVT
chains in the Genus database with same CATH superfamily
5AYTA 2EZ0D 3WNIA 4FKEA 3Q13A 3DIVA 1D5ZC 2CSPA 4ZX5A 5IGDA 3UAJC 1EYAA 1PRTB 1OGAA 3F12B 1WA1X 1XO8A 3BT2H 4Q0XH 5HI3D 4XH2A 3V0JA 1INEH 3KWUA 2B39A 4Q2ZB 4FP5D 4IALA 5M95B 2AJUH 1LYLA 3GTQH 4PS8A 4NZTH 4RDQG 5JHLA 3QQ3B 3MUGA 1E9PA 5KTEH 3PGZA 1E43A 1NH6A 1T0MB 5KVDH 2J20A 4EF3A 4P46C 3OR6A 3QIUD 3TA4D 3X3NA 3GSRA 5AJ3Q 2MCPL 2K5NA 3CC5A 1X3DA 4JGMA 5GRYA 4JKNA 1A6WL 4H25B 4Z5RB 4B3TQ 1S7SA 1U33A 2V6HA 3EYFA 4QHLB 3O6KL 3MRQB 3P3SA 1G6PA 2NN6G 2Z93A 1HXKA 1CGXA 3S1NB 1W6LA 1FUNA 4U31A 1YN7A 5GRJL 3LKPB 5AL0A 3ZTNH 1HZLA 2PWEA 1D7QA 4L3FA 2VY3A 1E42A 4LSSL 4K73A 5D2LF 2EIEA 1MLCA 1NWOA 1ETB1 4GW5A 5CGMA 4FYRA 5HDQL 4TQIA 5JQ6H 1EFWA 1T7YA 3O3EA 2R0ZL 4TL5A 2MH4A 4I2XB 4XZUA 5FLMG 1ZE3C 5DJ6A 4MCNA 4YZWA 2RACA 1YNJC 2OA9A 4XQJA 1VS0A 1J5EL 2UWEB 4RFEA 1BD2A 3UERA 5HHQA 5C0FA 1HZKA 1CIDA 1Q0YH 4LARH 4QHNA 3OAWA 5GIRA 1KCSH 3BFOA 2Y06L 5C92A 4N8CH 5CLYA 3E6ZX 4M43H 4XVUC 2L1BA 3ARGD 5AVRB 1BAWA 2BCMA 3SDCD 1HHKA 1Y14B 1PVHA 2V2XA 1HC1A 2JFCA 3CF5A 5FF6B 4L05A 3CFMA 5I30H 1U3HA 4HIXH 4K7FB 2OT2A 4M6OH 2QHRL 1FGVL 4S10A 4ZDHA 5ICXA 3E7JA 2JI1A 5IJDC 4F15C 3V6FA 2NZOA 3TP8A 1FIGH 1ZHKB 2ZWZA 4KKLD 4QOKE 3T04D 5FW8A 3DOSB 5AZ2L 4N9PA 4LVNB 4OCMC 5DA0B 4XNUL 3RN2A 1MY5A 5D7EA 4XHJD 4OZIE 3GXDA 2CMRL 1U92B 2C9VA 4PJGF 5A2KH 5AKTA 3WO4B 5BZWB 5KYWA 3I3CA 2UZYB 4M1GL 4KZEL 4PBDA 4B60A 1G4RA 1U8JB 1IL1B 3PLYA 2H32H 2YZ8A 3QRLA 1S5HB 1YEHL 3D6CA 3Q5YA 1LTXA 4LSVH 4IQHA 2DMCA 2CIIA 3N55A 4M6NL 4L3CA 3NJJA 4JPSA 5GHWL 1YNXA 3M8OL 4YX2L 6CGTA 1J0ZA 5F70A 1CF1A 3QH3B 1DCLA 3L54A 1TETL 4QLRA 4MMZC 1QLRB 4NRXA 4LFBL 3T0AA 4GH7B 2FEJA 2ZWNA 3O2DH 1PNDA 1FCGA 1NAMH 2YV5A 1QMUA 2F0SA 2NXZD 3M4QA 2BDNA 2NWGA 4C3IG 4KI1A 4RESB 2NX5D 4H13C 5DCCA 3NELA 2EYMA 4PJHF 1LO4H 4KI5C 1ZV5A 1JGUL 5HP5A 4KVCL 1BXAA 2F68X 3V7MA 2FTAA 3LTVA 4C83B 2WV3A 5HVGB 1CYXA 1VJSA 4IURA 4DV4Q 4MJ5A 2VDNH 5T1IA 4HKXA 1GM5A 5CEXA 1MCPH 4O9HH 5DXWA 2DB8A 5FYKD 3S5LB 2BSSB 3B9KA 3FU7B 3WJMA 5B7MA 2LS01 2EDNA 4ZOBA 1UXSB 4OKDA 5H94B 5LCVH 1Z47A 3PGFH 5KNBA 2WBXA 3I4NG 4Z9KB 4K3EH 4ES8A 3KS0H 5AVUB 4XAKD 2F7IA 1FAIL 2DQCL 5G4OA 1RSYA 3F2UA 3Q2WA 2P5PA 2WXGA 3PAYA 2XSCA 2E5LQ 1MI5A 3S96A 4AM0B 4EI6A 3WNLA 1GHKA 4MNGE 4JW0A 2VQEQ 1F6LL 1UG9A 4HIOA 2EP6A 3IFOA 4X8XA 4MBOA 4XNZB 2MHAB 3IS1X 4CKQA 1RD9D 4XBMA 2NQDA 4P05A 3D2UB 1LO3L 3I9AA 5CJ5A 4LASL 1L6PA 1SJED 1B9ZA 4QIWB 1VIWA 3KPRB 5C4XB 1S78C 3CVBA 5J1ZA 3HOVH 1DLFH 5DJ2B 2FQGA 4ANKA 3O9WB 1SHXA 4ENZA 2EYJA 3GTGB 3MMEA 4U6HA 3UAEA 3ZDZB 3S0PA 2RA4A 1E30A 4S2SA 3P4MA 2RR3A 1SE4A 2J88L 5C0IA 4G83A 4IPHA 2EXYD 4PH8A 4BXXG 3SDXF 2K6YA 4BK5A 3SPJA 5M5WB 4YHYB 1X5KA 3L4CA 4N8X1 3C5ZA 2JA6G 1ZT1A 2Y2WA 3ITPA 3LVTA 1BOSA 5DWUH 3SZKC 2EDEA 3IGFA 3HFZB 5LMNL 1DBKH 4RGMA 1GSMA 1KB5L 3MCYA 1QWUA 1P4IH 2F08A 4K3DL 3T6ZA 1JGEA 2IAMC 1GOGA 2YKLH 4AW4A 1QVGA 1A2UA 3P7JA 1NGPH 3EKCA 4ZYKA 1RL1A 1PAMA 4A3JB 4U6XA 5CP7B 5J5EA 4DZBB 5KUMA 2XN1A 1O7SA 3L3HA 3EJIA 3LH2L 1VPOL 4JI7Q 5E0QA 4BZ1H 4WNSA 1BDYA 5INCA 2W91A 4DKAC 2UY7A 2WB1B 4YSPA 4ZAKB 1OD9A 2FAUA 2NVQH 3VXRA 5CGKA 3TN0A 4K5WA 3TCLA 3WKQA 1CK0L 1FC1A 4LCYA 4Y1TA 4ZO8A 3HUJE 2ICCA 4X66L 4AYBA 4G9DA 4ZZFA 3AUWB 1NFIA 3I9IA 3WFHA 4OWWB 1D9KD 4X4MA 5GS0D 2B0SL 5MP6L 4DUWA 1GOFA 3S37H 3FB6A 4OJFH 5ECJE 3PRZA 4KUZH 4YAQB 4PEEA 4RGND 2YD8A 2OSLB 2CDGB 3RFZB 5DVLA 4MAZA 1V27A 4HW6A 3SCMC 4JNXA 4IHOB 2G75A 2W60A 2YPVA 1V5JA 5E6IC 2ILLA 1FVEA 1S9YA 5HHNB 4F2EA 2P7TA 4TF4A 3AACA 2APXA 4MLIA 4XBGB 5T1JA 3CDYA 4L6TB 4GIAA 2ICWA 4UP9A 4JRXB 4M9OA 1FNUA 5TFSL 2DQTL 3GBML 3SGEH 2NZ1D 4LLQA 3DJTA 5DUBB 4ZMWA 2HFGH 2OMVB 3S17B 3K6NA 4H0GA 4KMUC 4TKWA 5E03A 2ADIA 2GJPA 3UYPA 3LPGA 3KXFB 1YYMH 5G3LD 5T5FH 4DGIL 3NCCB 2V4LA 5B39B 3GMMB 3DIFA 3KPQA 3LZFL 5IP4A 2VSMB 3X13A 2DI9A 1BVNT 2QPDB 1JRHI 1BAFL 2CLVA 3PCYA 1STNA 2NVTH 2DY2A 3AU1B 3RZOH 5KJRL 5I1EH 1I82A 2JKSA 1URZA 3ULLA 4YNYA 2OMXB 4IMLB 4ODSH 3DSFH 3SE4A 1EO8L 1G5AA 4IJ3C 4Y2DC 1R5VA 3WY2A 5I9QC 4XMKL 2X6AA 1EUUA 2XNAB 3NRQA 4WI5A 3HEIB 1SNCA 1TWHH 2CRZA 1Y18A 5I1CL 4A2LA 1UD2A 4ZUTB 1FI8C 4BSVB 5AQ0A 1IYUA 3P4NA 2MTAA 2HUHA 3I56A 3H56A 2DPKA 2HCZX 2IH3B 4X6CB 1A22B 5JJLA 1R4QB 1DANT 3I55A 2EH8L 4I5BB 4J3VA 3A5ZB 1RODA 2ZZUT 4B96A 4JAMA 3RN5A 1ACYL 4IHBA 3TV3H 5IFHL 2XFXA 2IPKA 4AVHA 2Y25A 3GV6A 5GGVY 3RWGA 1X7TA 3SD5A 2H2SC 2QJDA 1AGCB 1OAQH 2B77A 3BE1L 2UUBQ 3HR5A 2FH8A 5LG1A 5F3HA 2IWGA 4GAGL 1RLWA 3S2AA 4XODA 4W9FC 4OCSL 2O5XH 2ZTDA 4N2GA 2CJSA 2VR3A 5CLZA 1T7ZA 2OL3A 2ZP0T 2BY1A 4A7TA 3O2WL 3VGBA 4YWKA 3QJFA 5EN2B 5DMKB 1OGAD 2DQUH 1U4MA 1UENA 3MPCA 2RF4A 4O0AA 1A7QL 3QJOA 5K59F 3CHBD 5KVEE 4A76A 2AK4A 3HPJA 3U36A 4AYDC 1CK1A 4FFZH 3GTOB 2BW4A 2I9LA 5AYUL 2A38A 5A2JH 4RMQA 1G1KA 2QSCH 3ALPA 4LRNL 1YNLL 1MJUH 1WBXB 5FM8A 1T7VA 2FR4B 1O80A 3D39E 1HZCA 1SVCP 3DK2A 1MRDL 4LXFA 4KQ0A 2HKFL 4JBJA 1NEUA 4U7KA 5F7EH 2JJSC 5AVWB 3BX7C 2YTVA 3MFGA 4UPAA 1BWWA 4HPOH 3UG3A 1UH4A 3DV4A 1I8KB 3IAYA 1I5FA 3IKKA 1J88A 4WUUE 1X5LA 4BFKA 4P72A 4YL4A 5JUEL 3SODB 5C6TH 4AUUA 4CSPA 2GIYA 1YBYA 1HINL 5C4JB 1NMAH 3N44F 1MCOL 4UDUB 5GROA 1WDAA 1NBWA 3N41B 4RKLA 2JB6A 4YZFE 5FK9B 1NFKA 4M7LH 1EIGA 3K0WA 4Z7OE 1XSIA 1M6OA 1RIUH 1HL4A 5DD5H 2R0LH 2N0MA 1ECZA 3VYNA 5KS9B 1G7HA 1S7RA 2X9YA 1F45A 1N6QH 1JXKA 1HFUA 1DL7H 1LO2H 1FNGA 2L5TA 2FIRT 1LV9A 4MX7A 2E3VA 3QEUB 3RQ3A 5CBAB 5HYJB 5C2BL 3BVTA 1CPUA 3U9UA 2CHWA 1BD2D 4U1LA 4KJOA 4ODGA 3EFOA 4UINH 4RMBA 2O4EA 2XIWA 1QSEB 4L5RC 2IG2L 3PO2H 4U1MB 1DFXA 3MNMA 2VXQA 4Z7VB 5DMYA 1SOXA 4PJXE 1S7TB 3FTVA 2XUWA 1CCZA 3KJOA 4GO6B 4CJ0A 1CMOA 2ZXQA 5EKLA 2PO6A 1D6EB 1X7QB 3CH1B 5IVNA 1U3HD 3NT0A 1CYGA 3OJDB 4PW3A 4P2QE 2Q86B 1PXUA 1JERA 3MLSL 4MQ7A 2Y5QA 3MO1A 3O6FB 5EORH 1OAYL 1EJOL 2UYLA 4R4BA 4R8WH 1XGYL 5IWLC 1PY9A 3QSKB 5K9QI 1PFBA 5JJKA 1XD0A 2F54A 4GPVA 3BU2A 4HWUA 1S9XA 4OGXH 4PJFB 4A3DH 3LEVL 5D6CA 1BO0A 1E5YA 3LKRB 1AOZA 4KI0A 4UB0L 4I1NB 1TCMA 3FTUA 1ZLDA 3RY6C 3UL4A 4AIZA 5GZNC 3OKNB 2VLKE 2WWNA 3BQUA 1LL1A 3MRLA 4AQAB 2Z34A 5DFTA 1M56B 2WGXA 3PGDA 5I8KL 5DRWA 1FBIL 2N78A 3CC2A 4YIQA 4XN1A 5HGHB 5D2NB 1B50A 1L9TA 1EFQA 4N68A 4TSBL 1G7JB 1OTUD 4PREA 1STYA 4PV8B 1SN2A 5KVEL 5CR8A 4B9PA 1EWCA 4FCHA 4ID6A 1XJVA 3TGXA 4DXGA 1XNRL 3BPNC 3VTTA 1BQHG 1CZ8L 4ZQ3A 2XWJB 1TY0A 1N3NB 2C4FU 3FUJA 1PY0A 5E5RB 4AY0A 3IMBA 2NY2C 3HC0B 1RUQL 3RY4A 3ZUCA 5I5MA 5GAGC 5J11B 4F2MB 2F0UA 1DZ0A 3F01A 3UTTE 4AZ8A 2NTFA 1JZ7A 4DR6L 4GNXB 3CPLA 2OCJA 1EX0A 2DTSA 4PRHB 3N3EA 2X0VA 3D87B 1HR0L 3PMFA 3QJZA 1HE8A 1T66D 2Y36H 5EU4A 5H2BB 3SKMA 3NCFB 1DJYA 1DJXA 1YAIA 4LVEA 5ESQA 2UZIL 2DQIH 3KLKA 1WEJH 1SNMA 1IGYB 1IW7C 3DM3A 4GBXC 2DUDA 4HIKA 2WLKA 3F8TA 4Y5XC 2LFGA 4HKJA 4F2FA 3DHJA 1XB6A 1YEIH 3OLDA 2CHNA 4LCCA 4NYLB 3B9KD 5F9DC 3VI3B 4LZKA 2Z35A 1KGCE 3QWRA 2VIRB 2VZ3A 2WXFA 1OL0A 2E27L 2HUEA 2YRPA 3BUDA 3HS8A 4HC1H 2RALA 3AAZA 3FTSA 2E2IH 5DMGD 4JR9H 2OTWA 4ABNA 5C2UB 1L5GA 1PLCA 2YPLB 3ETBF 3S37X 3BD5A 4KTEL 1EVUA 1VMPA 1ZANL 4LCIL 1MI5D 1CKOA 1PSKH 2KQNA 4GOSA 4FABL 3LKNA 2VR4A 2A73B 3OVUB 3HFFA 2RBLA 3HE6B 4PRIA 5C3IA 2F7QA 5TPWL 4AQEA 5D1XB 3O3AA 4X80L 2EE3A 1X7SA 1WHOA 4JQVA 1EERB 1QUNA 2QVMA 4NMZA 2ZKWA 1DXMA 4BE6A 3MRDB 3V7AG 4WK2B 5CLWA 1IL8A 4IRJC 4Q8BA 4JM0A 1NOFA 2XQBH 2FO1A 1FLRL 1XBRA 2CRIA 1JOOA 4JB9L 2F53A 3PQYB 3B3IB 3QDMA 5KSUB 3ZKQD 1RUKH 1SNRA 3RIFF 5IP7H 2VXWA 4HUXA 3NWTA 4KO9A 4P2RE 3KWXA 3OC5A 1MGSA 1CU4L 4LCWE 1YY8A 1EZVX 5JPMC 2AKRA 1YPZA 4BBWA 5DZPA 4AWJC 1CIUA 4MAUL 5JEAG 4KK8C 3C5ZD 4EI5B 2DQHH 4OW6A 2VDLL 3BO8A 3O41B 4NJAH 1VGEL 4OIFA 4UQIM 4OM0L 2QELA 1ZLUH 2C3VB 4NCDA 2Q8TA 1F2LA 2BWQA 2H32A 2XZCL 5ECGA 3TTYA 3V0WL 4Y7NB 1A7RL 3MYZA 4RQQA 3VXUA 1NSNS 1IAKA 3QZWA 4Y5VB 4PUBL 4QY8A 5AG9A 1Z6JT 4WW1B 4A93H 3DC0A 4U2ZA 4ZW3A 1BVSA 2ZNWA 3JV6B 1T3FB 4FXKB 2DKUA 3CDCA 3PDDA 4UT9H 4A66A 5ERWA 1JS4A 5A2FA 3BZFA 1QBLL 1MAJA 2KUMA 4CU6A 4NKMA 4DK1A 4C1NK 1N8OE 2BVEA 4WW2F 1HEZB 1A65A 1NCCL 3O2DA 1A6UL 1OP5H 5A2AA 3FQNB 1NAMA 4WWKB 4TRPH 1FZOA 5DJXB 5D1QC 3TN0D 3VXRD 2MQ0A 4M7KL 3MLUH 4FXGB 4ONHB 4RWHA 3H3VH 4KZ0A 4GEJA 1HTPA 1BQQT 1A14H 2PWFA 3KPPA 1EZ8A 3E0GA 3ZYZA 1TQBB 2WQAA 2BNQE 2BINA 2R29H 2Z92B 5DD6B 3O6MH 2P45B 2JB5H 1LJMA 5IYDG 2X4NB 1KYAA 5I1IL 4BS9A 3B1TA 2CM5A 4UT7L 1ZGLB 4TQ8A 4PJ8A 3RB7A 2Q76A 4O2DA 1X65A 1U8MA 1EY8A 4LJZC 5F96H 4P9MH 2FYYA 2BX5A 1DBAL 3REVA 3E8UH 1G0XA 1BVLB 3VVVA 1R24B 1TCRB 4Y4KD 1TWAH 3TBSA 5HYSA 4IPDA 2WSKA 1EDHA 3K80C 4NNYB 2RCFA 3NTCL 4UU9A 3NCWA 4PB9L 2YAHA 4XTRD 3TURA 1B9NA 4UNVA 1HQRB 1QFWL 2K50A 2VDPH 2ZWLT 4ZPTB 1UD5A 2FVNA 1BECA 3H2PA 3OXRB 2ADYA 4CVWA 3BG3A 4HETA 2FX9L 5DYFA 4RCOA 3FPPA 2AVFA 3P77A 3FCSB 1AEXA 1OWRM 3U9SA 3OMCA 1NCIA 4JFFB 1DQIA 3SK5A 5CSBA 3S1RB 3K8MA 2QQNL 1N5YL 2WXJA 3WY3A 2JKJA 5C09E 1VFOA 1K3RA 2AQ2A 2EYTA 3QPKA 4KMTH 2APFA 2EYHA 4P2CB 2YFNA 2B9BA 1I94Q 4LLWB 2F0CA 4BSWA 2HIVA 1I4FA 3E6HB 2WIIA 4A6YH 4O5LL 2AXJA 3EZ8A 3KCWA 3VGFA 3ZSSA 4JUTA 1T0PB 4MA7H 4Y9GA 4C8XA 1LT3D 1IGMH 4J3OF 1AHMA 1V7MH 1IBYA 2W0FB 1I7TB 2P8MB 3EHBD 2B2XL 4Y1AB 2EABA 2Y7QA 1YNKH 2QGQA 1GGBL 4L5FL 3TEZA 2PW7A 2BDOA 2P80A 3BDOA 1HK6A 2F0IA 1YZ6A 4YDMA 2DMKA 4JFEE 3AM8C 5IROC 1KNEA 2UUDH 3FNKA 1NMCC 4M8RA 1V1PA 3F65A 2JTDA 1Z6HA 1KEMH 3TLRA 1XTLA 4J2XA 4F7TB 1KJ2H 4R2GB 2DKMA 3UPCA 3VSVA 2VQFL 4AGMA 4XMPL 4BZ1A 4ONGL 2FL5B 3X1EA 1A9EA 3G5YB 5IR1A 4FN0A 5AZEL 4AENA 3Q22A 3HI5H 2LFEA 2NXYC 4F3FB 2HVJA 4YSAA 4HT1L 1ADWA 1SUJA 3V5DA 5ICZA 1BOGA 4G11A 4Y9CA 3APCA 4QJ3B 3QK0A 4JL1A 3RDTA 4P5SA 2R93H 2CHZA 2XG5B 1XF5A 2Z6KC 2K9FB 2NY0C 4HAEA 2CO4A 3ES6A 1EGJA 1JMZA 1EHLL 1WOCA 3R1GL 1U2HA 1IBFA 5EC1A 4B3MQ 3HS0B 1GW6A 2D0HA 5C08E 3MNVA 2W9LA 4I3SL 4IBUA 2AK4D 1TQOA 4AEIL 3D31A 1K6QH 2G9KA 3DX6B 1HWHB 1TPXC 3WEOA 3SKOA 1EUJA 1GIGL 3LRSB 5HYQA 2Z4QB 1UA3A 3RZCD 2KHJA 2XZQL 4RAVA 4S1SL 4OGAD 5JDSA 1PZUB 4IGBC 3U9PH 2Y7LA 2AQTA 4XQQA 2AP2A 4ADIA 2DWYA 3O4OB 4BQ9A 5B3JF 5J56B 1IL2A 1KOAA 1EY0A 2DQDL 3FQRB 4TLSA 2BOBA 3RGBA 5JHDD 3ZDXF 4ETYA 2I85A 2BP8B 4P23A 4PJHA 1L2FA 1WGOA 3MJ9H 1G51A 4UM8B 4K9EL 5D7HA 1NIDA 2C3HA 5KNDA 1CLOH 3EGDA 3GLDA 5EZLB 1U0QA 5IHBA 3BJLA 2I32A 1MJEA 4DEPB 3MA7B 3Q6GL 4RWYL 1Z9MA 2D0OA 1I3VA 2WVSA 2R56H 1V3LA 2NYZA 3CLFH 2GCYB 4TQPA 5C0ND 4YO0B 4PWFA 1IBGH 2AABH 4ONOA 5KSAD 5J12C 2CPCA 4PWGA 3HR6A 4GZYC 2K8MA 4BY1B 3MWYW 3MJ7B 4MB3A 3TA3C 3BVGA 3IKJA 4Q58C 4PVLA 1UE5A 4M6ML 3KWWA 3A4DA 2KVMA 4FHKA 1TJMA 3LKOB 3C1FA 4TN9A 3RX9A 3SDCB 5EBMA 3R19A 3OD3A 1Y07A 5AW6B 1IE4A 5EKIA 1XCTB 1LTID 3Q06A 2ICES 4P5MB 2H2PC 4XO8A 2V0AA 1HEHC 3OMIB 4N0UB 4W6WB 3OV6A 3VH8A 2PMZA 3VYTA 3S2HH 2WNXA 2ICIA 4I77H 3QUXC 4OCLC 1BF5A 2VB5A 3GB7B 2E2HH 1TTBA 2SNMA 2HN7B 1HSBA 3QISA 4MBRA 5EEYA 2PO6D 1A0QH 3BRDA 4I0CC 2IGFL 1XNQQ 4W9DC 2N88A 5I8EB 2XFGB 1KJVB 3I02A 3KEDA 1K28A 2VQTA 3VR6A 4PVMA 3IBEA 3QEGL 4HIJA 3NJMA 1OB1B 4RETB 3FRPA 4RSYA 2NUCA 1G7PB 2J6EL 1B2YA 1FFQA 2DM4A 2F54D 3GD1C 4X9BA 3S35L 3SDXA 4WWPA 1U8CA 1BM3L 2JKTM 2OCCB 2QV4A 5HGGS 4JRYE 2YAEA 2KC0A 3QS3A 4OFKA 3UDWA 4WUKH 1RZIB 1YEKH 5I15H 4PP2A 3BQUD 3K7AH 1AQKL 1G7MB 2ADJA 4JPBW 1O6TA 2ADFH 4OLUL 4WKZB 1QFWM 5GSRB 1CI3M 3LWUA 5I28A 3BAEH 3NCBB 3OZKA 1OF0A 4JO4H 1CQFA 2Y5TA 3BDYH 5D1ZB 4FFZA 5E4AA 4WHTA 5DJZA 1UOWA 3DM1A 1C5DB 1RJLA 3EXLA 5HPOA 4QYOB 2J1YA 3RPIA 4QRPA 4KAQH 4DUZL 1MQKL 5FHBH 3LXBA 4L1SA 2Z31D 4ODBD 2Y2YA 3HOUG 3WCYA 1I8MB 2ZKHL 4ZMNA 3URYA 4HK3J 3DTXA 3P2DA 1FNSL 3ME0A 3QNZA 3QQ4A 5D5MB 1A8JH 3CK0L 4IS6B 5A2IH 2LU5A 3ZL4L 2XWBA 5D6DA 4LKXB 3QUKB 3AMKA 1MJ8L 4NSKA 1E8XA 4P5TA 3L16A 3VD1A 1IX2A 1HOCB 4LDEB 5JW4N 3L3IA 4IOFC 4UQ9A 2RFXA 5CILH 2G0KA 4MCZB 1D5MB 4A1RA 2OJZL 5K9JL 1ASOA 1LEGB 3ERQA 2O6CA 2ZUWA 1W6KA 1PD0A 1A4CA 4N24A 4J4PA 1AZPA 2ARJA 1UJ3A 2IOMA 1EY7A 3DWPA 3QWRD 4FI7A 4Z0XB 4M5TA 4R9HA 2WMPA 3N43B 4PPTA 3E3QE 2VB2X 4OBRA 3ECWA 3VI4F 3CCEA 5KSBB 2YXMA 3UJTL 4RMFA 2JEBI 1JXJA 2VSCA 2JQOA 3MRNB 1IUZA 3NCJL 4KJYA 2I69A 1I8LA 5EWIH 5A6LA 5C0AA 2M26A 1JK8B 4OZGB 3KGRA 1ZWIA 1B1ZA 2P5EB 5CV8A 2VZTA 4N8VA 3MZ5A 1RIHL 2YTXA 4PRID 3QNYA 3FSAA 2KQMA 4GKNB 1FDLH 1GYVA 4NQCB 3SDDA 4Q6YA 4XCFH 4E41B 1V3JA 2K75A 4K5XA 5E3FA 5LHDA 4LVHC 3MJ8A 4PLJC 1M7XA 4Q4IA 3EYSL 3E1ZA 4JYAL 3HB3C 4PTTB 1UH2A 3U50C 1X3FA 5BR8Q 2QSVA 3U7YH 4BKLA 4WK0B 4Y19E 3CN1A 4ZS6C 2NY4D 1A7OH 1PG7W 5JO5A 4QUCA 2F53D 3QDMD 4JO2H 1J9QA 4KGJA 4N2BA 4Z7UB 5K9QG 4KKCD 4YHIA 4HJ8A 3P9MA 3WFDH 4U1SB 2KI6A 2N7AA 3LNIA 4P4RB 2YYZA 5FLXc 3A55A 4BBSG 3T0WA 1SBSL 4L8SA 2CH4A 5F88B 2H26B 3J81E 4OLXL 3RNQA 3QWNA 2GABA 4BY7G 1HILA 3EFDL 5FYJU 4E9SA 2PCPB 2Y0SE 4JPQA 1OK8A 3VXUD 2ITDA 1NUDA 5FUCC 4L37A 5TGBA 4EN3A 3ISWA 3UXFA 1X6OA 4HIMA 4PW9A 3NJNA 4FYTA 5CAYB 5SV4A 4ODHL 3BP7B 4MD5A 3WHE1 4AQYQ 1H15A 2K5VA 4ZRZA 3CD6A 5FGBC 4L9LC 1ZLWH 3A54A 4QY7A 4Z3TA 3F6IA 2KZBA 3QWOA 1XGUB 3FT1A 4BFIB 1BXTA 3B83A 3CDGA 3PG2A 5JW5B 1JZ4A 2CLZA 2HH0H 4XC1H 2HB0A 4I18A 5FW7A 2K4KA 1GTNA 4G42B 1JZJA 1EIFA 4XX1E 4LAJH 4GS7C 2N49A 1SNQA 1B0RB 1TMCB 2D3JA 3VR3A 4GXUM 5ESAA 5IK3B 3SE3C 4OJDH 3FVQA 4AXWA 3NFNB 4PQXA 1H3WM 3HI6H 3QO0B 1JGDB 1F18A 1IZ6A 4X9YA 3FB8B 4AH6A 5DJDA 1HT6A 4F7MB 4JRLA 1A47A 4PJ8D 4CBPA 4CKCA 4LF7L 3KBFA 4P5KB 2B08A 5IGFA 3SHLA 2AEPH 1G6RL 4IW4C 4FQHA 4Q6IA 1O7ZA 3EJJX 4Z0BH 5HDLA 2IFFH 3NUKA 3HRZB 3JBG7 4GRLB 1QFUH 2J8HA 5BRZB 4HC1A 1IYJB 2WP8J 4ZD3H 4YDKL 2Q2LA 3R93A 4XMLH 3TP7A 2J1KA 3RUGB 3GUTA 5EGTA 4ZLTF 3QCTL 3M3YH 3WOVA 3RZCA 4XP5H 2YK1H 5TQ2L 2BSBA 3GTPB 3D4GA 4FX5A 3C6SB 3HG5A 4KHPL 4HMIA 4NNPL 2EJGC 1KYDA 3WTVA 4FC3E 4MXWH 4I2XE 3KVDD 4DV7Q 4DFIA 4LMQI 4FA6A 4G43A 4PIBA 5BV7C 1UCBH 3V9EA 1BOYA 4PYGA 3OKOA 2WKOF 3UTSA 4G6MH 35C8L 3Q8CA 2UWEE 2CBPA 4FMFA 4U6VL 3O9WC 4RX4A 3WL9A 1NIEA 4OCNC 1BF2A 1QSFB 4L8DB 3VW3L 2QT6A 1PZ5A 4J1UA 4F58L 1GZPB 3FO9A 2OP4L 3OWEA 3P54A 4ONFH 5I16B 1FFOA 2E59A 3P73B 2OK0H 3PP4H 4LW1A 1NCOA 1EJFA 3IEAA 1F4AA 1UA6H 3O3BA 4PJCF 2DMGA 4LRIA 1LVEA 5AOIA 5GISL 3BSHA 2GB2A 4GT0A 1U6AL 1M8AA 2VDOL 3NZUA 4X3KA 1JN6B 2A6IA 3Q3GA 3TH2T 3Q8FA 3VA2C 3X1GA 2E47A 1J5OH 2EVHA 3J81L 3A4EA 4XPHL 1OPOA 4DP2X 5BVJB 2P80D 3DVGA 2CQAA 5EIIA 4BY7B 1VACA 4ANVA 4JFSA 2DM2A 2C5CA 3NJVA 3E9TA 1RHHA 3FONB 4HJAA 4KO6A 4LLMB 4NZUL 4OIIL 4RNRA 5FO9A 3D07A 4UT9A 3ALXA 2H8PA 4OT1L 1VMCA 4NAQA 2IL8A 1ESFA 1JOIA 4U7SA 4HEME 3F58L 3TP5A 2AV7A 3GJFH 3IJEB 1DN0B 3NBHB 3VFWB 3G04A 3AY4C 3ZW3A 1NGXB 2VISA 4TTDD 2FNWA 4WFGD 1E3XA 5GSVA 1N8ZB 2R7EA 1YI2A 3AXLA 3VRJB 2J5LC 1CFVH 2VLLA 1C9SA 1HZ9A 3IE9A 3AS1A 5GGQH 4A3KG 1R33A 3RDTD 1I9IH 4DEUA 3CP0A 3MBWA 3QFJA 3RWDB 1ZHLB 3NRFA 5GGUA 1J8RA 4OD2A 1WD9A 2V2WA 4LL9A 2R29A 1H5BB 1JPGA 2BIPA 4KJQD 1QOKA 5AG8A 3FDTA 1XMQL 4NQSB 4XO3A 1VKXB 1AXTH 2R9HD 2WAQA 2DEWX 1ETZB 3L1EA 4YCVA 1T1YB 3C09C 1EFID 4JFQB 5C3TA 1YY9D 1YMHB 1SN8A 4L2LA 1I75A 1KENL 4XX5A 4M48L 4F8PA 4GKZB 1K5NA 2XLLA 5IMKB 5DK0B 3A6CH 3EYQC 1GTFA 2JJVA 3H0TA 4JJ5B 2KZ1B 4QXGH 3MXWH 2OQKA 1SROA 1RERA 4JVWA 4P23D 3VXNA 2CG9X 3FKIG 4IUQA 3F04A 4OJYA 4HMJA 1FGUA 2VQUA 3TEYA 2PO4A 1ZS8B 4YHOL 5E00B 4DK3C 3BKMH 3BWZA 2DIBA 4NM8L 3WSQH 2AAAA 2NYZD 1R3KA 4H44C 4KXZI 1QTYT 3KYKH 4O4YH 5DSCB 3MBEB 4TUKL 1ID5I 1V7NL 3GC3A 5B1AB 1NJIC 1P53A 1X5XA 2KZWA 3UTZB 3TEUA 4IFDG 5IT9L 2X4OA 2FCBA 3VWJA 4N9TA 3VD7A 3IDJB 4JO5A 1UM6L 4A6YA 1BLNB 4MZ2A 5CJXC 3UPRA 2F8IA 3US0A 1IKOP 1PVOA 1PEWA 3MLRH 1F41A 5C9JA 2Y4SA 1TS2A 3RNKA 5ICYB 5ITBL 4OX9L 3GMOA 3QHTC 1MW2A 5F1IA 2DYSB 3K6DA 4QIWE 3KPRE 1Q72L 1KNOA 1Q1JH 2FH6A 3PO3H 1RTOA 4ZK8A 2AZUA 3TH3T 1JPFA 2GQHA 4MCYB 3S3JA 3ZDZE 3W5OA 5CZXD 2A74B 2FX8L 5CBEB 2Y22A 2EXZA 5J3HD 3ECBA 4F33A 2HRPH 2P49B 2GIMA 5JA8B 4U2YA 3NN8B 1WZLA 1JDCA 1TVDA 2VJ8A 4JHWH 3LKQA 1GKHA 4QOKD 5I8CB 4YDJA 3SHSA 1KJ2A 2HIXA 3A8KE 2V5SA 4OF8A 4FQLL 4B9FA 3UJJH 5FUOH 2Z1CA 4UM9D 3DMMB 4JQIH 5CR3A 2R51A 2WCPA 2NUTA 3BHBB 2BE5C 1INQB 2ZXDA 3TPUB 3WENA 4X5WB 3B2XA 5COYA 5FA3A 3E0JA 4CSTA 4DO6A 5JOFB 1I1CA 1UYWL 3DBSA 2NNAB 3W57A 5K9OA 3QZBA 2JKLA 4GLRH 4AJYV 1RJYB 1FNWA 1VQPA 4OH2A 2LXKA 4OJAA 4H5SA 5T8IA 1L9OA 1TQVA 2VXTL 3MV7B 3PAVA 4MTMA 1C12B 1KCUL 4N0RA 3GDEA 1GOZA 3KDFA 1CHPD 4YQXL 2WB1E 1DVFA 1EBAA 3R8BA 1OW0C 2Q7NA 3D51A 1XCQA 5LGJB 25C8L 2IW3A 1AMYA 2XG4A 1L0YB 2CJ3A 4P2AA 2FEEI 2OYLA 5LMNQ 4XDXA 1SLUA 2FIKA 4ZI8A 4FQQB 3WNNA 2F58H 4EIUA 1EZSA 4LFAQ 3DV6A 4HUWB 1JGLH 1XGZA 2XPGA 4KRLB 1IGIH 5DC4B 1HL8A 2VH5L 4I85A 1AZCA 1H3UA 2ZOLA 1FA4A 3DUUB 5B38G 3MJ9A 4X5XB 4P73A 4A3IG 3N2JA 3DI3B 4YBLC 1MHEA 4FI8A 4P5TD 3T8MA 3IMRA 1AO7B 4LAAA 4I8DA 3SQOH 5C7XL 3BUBA 5J06A 3O0RL 3AEVA 1AS6A 3WUWB 4QKXB 3I6KA 4CHTB 3TS8A 2QMKA 3M17B 4X66Q 3PDOA 3CVHB 3CGTA 4JRXE 1DJIA 4Y52H 4LHUA 3S1NH 4JY5H 1U8OA 2K9UA 5GRUH 4YHNA 1XD1A 4EN2A 1AGEA 2D4DA 1C08A 5B4MC 4J6RH 4UTBA 1FVDA 4J4PD 3ZX1A 1KJMB 4OR1A 2C9RA 3W81A 3A74A 5HI4C 2OYKA 4AL8C 1U21A 3LRKA 4FMKA 2HLAA 3U9WA 1PW3A 5IWAQ 2AEQL 5IP9H 5E6YA 1B8AA 1EOTA 3CN3A 4K8RC 5IREA 3CWGA 2R92H 2ZKYA 4R4QA 3K1DA 1A4JA 1A1OA 5BV7L 5C0AD 4N86A 2YGOA 2Z4IA 3Q6FB 3FHEA 2RCSL 1KLGB 2XPZA 1I1RA 5CSZB 1VZHA 3BUQA 3O6FC 3SDDD 1QBML 1FNFA 1EY6A 4DV2L 3UMNA 1UGNA 3QORA 4XN8A 5A3ID 3V4PB 2UVFA 4GOPA 3QIUB 5HPMB 2D7QA 3RU8H 4NRZA 2RIKA 2XTJD 3U4KA 1KZQA 1EFXB 3ZL2A 1LABA 1FVIA 3ARXA 4R7NB 4P2RA 3EO9L 1LDPL 3HZKB 1U4EA 3STBC 4X6CE 3FFDA 4LCWA 1PH5A 3CD4A 3MRPA 5TE6H 1YEWA 1WBYA 2HT4C 3HZVA 2H6PB 5SX5H 3AB9A 1WGVA 2VWEE 1IE5A 3UABA 5F6IB 3IMSA 2VL5A 4OAWB 4FQJL 2YJLA 4LK1C 4IKNA 2AJVH 3J80L 5D2NC 3EIVA 4OB5H 3M45A 4J8RB 5E8OA 3AGWA 5KSVA 2CKZB 3GSQB 3M4OB 4LEOA 3EO1B 4ADGA 4FZEL 1BIHA 5GJSL 3I50L 2LXJA 5G4MA 4XT3B 4ME3A 4IPCA 3T4AC 1F4WH 1G7QB 3IDNB 3JXAA 4EN3D 2YKKA 1NGZA 4N2AA 4FDWA 4AVJA 2Q8AL 5GGSA 4P8QA 1MEXH 2R2BA 1Y1VG 3HG3A 5CGBA 3VX0A 2JF1A 3CFCH 2X05A 3V5HA 4GN3B 1N32L 4FVMA 4ZRGA 3WNOA 4CVXA 2JEAI 2VAJA 2Z0SA 1PBYA 1IBBA 1LWHA 3N42F 1SFHA 3A23A 1F8TL 2GBTA 3MNZB 4J3UA 4K2KA 1IAOB 3CZNA 4UV4H 2EAEA 3SEPA 4DKEL 1XGTB 3M86A 5KEEA 1TS3A 4XP9H 4LEXL 3EOBA 4Y88A 5LBVA 1GJUA 2ORBL 1DVTA 3HNTL 1F86A 5DHVH 2Q87A 2AJYH 1Q1BA 2XN9A 5J7CC 2L55A 4RMWA 4HCSA 5IF0B 1J9OA 1RZQA 3DYMA 1I3QB 1IQDA 2C9AA 5K1JA 1EEFD 1MRFL 4BHUI 3S4SA 4JI4Q 4Y5YC 1J9CT 2K5QA 2D03L 4EO5A 3RHWK 2OJEA 3AITA 3COOA 4HOXA 5LKNA 3QQNA 3KK7A 5T1GA 3UTPE 4ZMAT 5I1DB 2IH8A 2AK1L 2GITB 2ZSWB 3IKCB 3RJDA 1MFDH 2NY7L 4CNIB 1VFAA 1T83A 3CMOH 4ABQA 2LFNA 2IMMA 2X70A 1LTTD 1C5BL 2NR6A 1YRKA 2QADD 3LS4H 4JO3L 4ZOAA 3W9EA 2H1PH 4I3RH 4ZMVA 3I4MB 3EUUA 4NZ8A 3V8CA 1EYDA 3VSUA 4ZX4A 4TNEA 4ZTPH 4XVSH 2OMTB 5D1XC 2FINB 3P2TA 3RVTC 4FA7B 5KS9E 2VN7A 5KBKA 3ZMNA 3SXHA 5E70A 4UQDA 1MPAH 2C9PA 1OCWH 4BXVA 1DSWA 2FRGP 4L48A 1DTUA 3BSZL 4KITB 2GIXA 5CBAE 3RVWC 3I6GB 2GTWA 3UTSD 5DYOB 5HYJE 1TMQA 5IW1A 3L4VA 3QUMB 3BPLB 3LHPH 2KCTA 4RX4D 2GFBB 3GTKB 4XP1L 1WAAE 3L6FA 3SPGA 2D0FA 4JREC 1UZ6E 2WUCL 2O4XA 1SMYD 1QSEE 2NXZB 1S7UB 4Z7VE 3RWJA 3S5YA 4LBAA 4NBYB 3N0AA 2F4IA 4Z23A 3H3KA 2RHEA 3EYVB 2K3HA 2E6PA 4JZJB 5EG6C 2X4SA 1DDTA 1S3OA 3WJLC 1RJZB 4X50A 3HG1B 3DURB 4GAFB 1EQWA 4PJEB 5CJBA 1I9RL 4KNUA 4DR1L 1SEQL 4G80A 4KY5A 4JZOA 5AVVB 1GYAA 1SJXA 4Y5VC 2ZPKL 1MCFA 1FHNA 3Q6SA 1UM4H 2ARWA 3HPLB 5M3FG 5M5WH 3IJYA 5GS1B 4C56C 3PJNA 4UOW1 3BYYB 3LS5L 2IFGA 5EU3B 4PJFE 5FFOA 4UIMB 2F0TA 1E4WL 3BIKB 5GGTL 3ECVA 3UBGA 5J0BA 1DJZA 4X3UA 3CFIC 4LSTL 3P1VA 3WDHA 5EEWA 5FUZH 4U1NA 1UUNA 1F58H 1W0YT 5IQNA 1NAKL 1SN0A 5E4XA 1QBAA 5DEGB 4BZYA 3QNFA 2UX6A 4MYWB 4I0PC 1L9MA 1W0WB 2ZX8A 5B3NA 1Y1VB 5HVWA 3GTJB 1MSPA 4U6YB 4A3JH 1ZA3A 2AV1A 1RDPD 3QZOA 5FR3A 3KBPA 4FXGC 2MCG1 4J3SA 4QWWC 2IQ9H 2E7LA 3FT4A 3L7FB 5DAUA 4MD0B 5CV9A 3PQIA 3KGUA 5C70A 1EU4A 1CE1L 4ODTL 1O7LA 1KHIA 3QG7H 3LCYA 4WY7L 4G6JL 1SJEB 1E6JH 4F2ME 3VGDA 3EJYC 1KD1C 1N6UA 1KL9A 2OW7A 3CRLC 3DJZA 4CADB 1RJTA 4OTXH 5F7NC 4UNIA 3DRQA 2C9UA 4M29A 3TYGH 4PRHE 3SKJH 3F05A 3TT1H 3SEBA 4ELKB 1JNLL 3E9UA 2FQFA 1NA8A 2IGTA 2O5YH 2L7UA 3TZDA 3NAAL 4CKVX 4Z7WB 1ZDQA 5IEKB 3F7RA 1FJGL 3PJLA 1S3RA 4R4FH 5IIEB 1TZGL 1FPTL 3BISA 5JLZA 3AT8A 3VXPA 5L6YL 1JHKH 1R19A 4GMTL 2C3GA 2MOGA 1G9HA 3U9OA 1XNRQ 1VQCA 4XXEA 4LSSH 2D7TL 4XB7A 1JJUA 2HT3D 1PLGH 1RP8A 2ENQA 2KL6A 4XOCA 3VE0B 3B1UA 4APQA 5HDQH 3BKYL 3ZLQC 1BVKA 3T3PB 1E9OA 2R0ZH 2A6KB 1UEBA 2QDLA 1J48A 1BKBA 2VM3A 1NMBL 4FFWD 5FYJL 1HR0Q 2E9IA 3DRTB 2AGJH 3CHSA 1GAFH 3I2CL 3OAYK 2YPLE 1QNKA 5FFLA 1ZT7A 1V3KA 4AL8L 1HXMB 2BOCA 2F61A 3GSVB 2Y06H 4KOBA 4XPFL 2WBJA 4GRMA 3TBYA 3P0VL 3VWJD 4ZTOL 1LNUA 4HAFA 3FW6A 4K8RL 3VI4A 4ZW8A 5EU7C 7PAZA 5I75B 1MBYA 5B1JC 2HCIA 2OXPA 1UEYA 2QGDA 2VDMB 1I4PA 3AXIA 4PHXA 4U1KB 4XCCL 1D9KB 5D1XE 1QZNA 5TSSA 1ID2A 3V6OC 1FGVH 1I85C 1T5WA 4KZCA 2Q1EA 4LAQH 4HOMA 1SNOA 1UOLA 2BW5A 3HBZA 4HULB 3RKDC 2PXYD 3CUPB 3CQFA 4RGNB 2O5ZH 3C5JB 4K7PL 1PFCA 1NGYA 4K94C 5J8OA 1HA5A 3PQYE 1VFBB 1FFNB 1LTRD 3L2MA 4JFHE 1JXDA 6FABL 4XNUH 5HVHB 5IB4A 1UD6A 4WEBL 5HHOA 5CWSB 2X3AA 3QG6A 2F0QA 3EGSA 3MXNA 5CGYD 3GMPA 3DHQA 4M1UB 1NSNH 3TM6A 4KWUA 3SKNA 3QI9B 5LMUL 2J4XA 2V7HA 5HBBA 4IBTA 4I0KA 4Y0GA 3GJFA 4TSCL 1DBBL 5I5RA 2BMKA 2EIZA 4LSRL 4ISVB 4KH9A 2E46A 2CKBB 1XR8B 3DI2B 4HDIB 4O2CA 2CBMA 4W9ZA 5DQDL 2NT0A 1Q9KB 4KTDL 3B4NA 3N9GH 5GRVL 1OGSA 3FO2A 1CZWA 1BIIA 2ROYA 2W9EL 1I4RA 2AHOB 3MUZ1 4FNTA 3HKZG 5E2UL 1VADB 3GLAA 3T0XA 1JNJA 1PEZA 4OQ1A 4UDTA 3NDYE 2GK0B 3K57A 2ZTCA 2EC9T 3CC7A 3KPLA 1JBJA 2WSPA 3S16B 1DVFD 4PRAB 1Y6KR 4Y7MA 1NFDF 3HN5A 4WFFD 3GM8A 2V2TA 4BA2I 3NFPB 2APWA 1RZFL 3VWKA 2K6WA 3QIBC 5CD5C 1HWWA 3O3DB 1FNAA 5L37A 4RCAA 4KVCH 3GTOH 1JGVL 2VAAA 1NOLA 3BCFA 4PGDB 2HTKC 2OX5A 4A3EG 3O2VL 1QWYA 1ZMYA 3SYPA 4IDJL 1CM9A 2VRAA 2KMWA 2QVTA 4HJTA 5F72S 3L0OA 3DETD 4DEPC 3TBVB 1NJ9B 2EYPA 3UGEA 1IC7L 2RDGA 1YJDL 1C8CA 3K2IA 1E27A 2CO7A 2CBOA 2GY5A 3TWCH 4ALAH 4R4NC 4U3SA 1K8OA 3L4XA 1QUPA 3L95A 1BFVH 4C1NI 4YFDB 4ACPA 3C3LA 4CC0A 1FZMB 2DQCH 4B9CA 4LHUD 4K5NA 1RJCA 2B7DT 2XKNA 5A16A 4NKDB 1OTSC 2P8LB 5C4JH 1AQ8A 1K85A 5L8JB 1XF3B 1P7KB 2DMBA 4MJIA 3VB9A 4BHUA 5SWQB 4FZ8H 1H0DA 5FWRA 2J12B 1PL3A 4AGOA 2EE9A 3U7AA 4XNAA 2EY1A 4DESA 2E6JA 3NGBB 1OGAB 3LX0A 4KH2A 1LO3H 3NPPA 4HUUA 1QRKA 4FNUA 4XH2B 4UQEA 3EJZD 1COBA 1S9WA 2ZOKB 2B14A 4JPWL 3CHXA 5DZAA 2QQLL 4BRVA 4Q4EA 1F97A 2AQPA 1F13A 2HG0A 4EUPH 3AUVA 3MUGB 4FQXC 5F7WC 4YK4C 1E9PB 4NERA 3L4YA 3PF5A 3WYRA 3QORD 3CC1A 2VYRE 3UBXG 4C58B 1X44A 5FFGA 5FCUL 3OR6B 3HFMH 5FLUA 3GSRB 3V6OE 3CC5B 1XBDA 1FRGL 4GUCA 4Y1AE 1BBUA 1EAPA 4L4JA 1S7SB 4P2RD 5IHHA 3F7QA 4LCWD 1L9NA 4QAMB 1ESRA 3WKNA 2DN7A 4J3OD 4PY8I 4FNLL 2E8ZA 2W07A 3MNDA 2D3VA 4K3DH 2HMIC 3WY4A 1N70A 1OGTA 1XZWA 3VACA 4YS4A 1AQHA 3T77B 2WNGA 4A7VA 3ULAB 1YN7B 1D7BA 4FADA 1ETJA 4FKKA 1U5KA 4YHLH 1EAOA 2Q7YA 1MLCB 2ADGA 2X38A 2OR7A 3ESOA 2DY8A 2GSIA 4P3DA 3L9RA 1JIBA 2N0KA 3NFSH 2XVGA 3NJKA 3UG4A 1QLEB 1PHJA 2JQZA 3O3EB 4FLRA 1HZAA 3FUEA 5L8LB 4PMCA 5DHMC 1FG2A 1BQSA 2EVIA 4RFOH 3PWNA 2ZYIA 1XPOA 4LUOA 1OSYA 3OR7B 4N9OB 5DJ6B 3BDXA 2YPKA 5D93B 4N90E 2DQGL 4DR3Q 5KYIA 3MC0A 3MUHL 2NCEA 4KI5F 1AR1C 1JTPA 1MRCL 1AZVA 3FFCA 4RFEB 5A7BA 1BD2B 1SJHA 5C0FB 4QHNB 5GIRB 4MWFA 2XVKA 4JFPA 1SJMA 4QQBX 3D30A 4F27A 1L1OC 2V2XB 2WLIA 3B2PA 3QARA 2BNQD 3CNKA 2VQFQ 4E9VA 1CFTA 1S5IH 1U3HB 3WAKA 4ZDHB 1I3GL 1FG9C 2J0TD 2VMDA 3BZ5A 1D5MC 2XN9D 3V6FB 3L5XH 4YHZL 4RISL 2ZXOA 1SYCA 4YY3L 1NBVH 4Z1PA 1EMTL 1QZGA 3RGHA 1M4VA 4K6DA 3Q0AA 2ZJSH 2D0PA 3IF1A 1W6JA 2WKCA 5B21A 4RMVA 5MI0B 3K81C 3GBMH 2WZ5A 4NUJA 1UWGL 5DRZA 4UOZA 1E6OH 3H6JA 1FZJA 4JEGB 2WN3A 1KBGH 4YE4L 4Z78A 5KYWB 4XCYA 5D4QA 5T5NF 4A2GA 5JXAH 3RMHA 2KUTA 3VGAB 1UWFA 1FNEB 1F0LA 2NR6D 3T0DA 4FNQA 4M5SA 3LZFH 4NQVA 5LDUA 3T1YQ 1JK9A 5FDYA 1ZXTA 1ZE3H 3GRWL 2F9BT 3UOAB 4BFGA 4HLEA 2CIIB 3JTTA 3ZTJH 1W8NA 5M9OA 1J1OL 2VZVA 1PJWA 2BJMH 3B2VL 4R96A 4TPRL 5E2VH 3ZO0A 5B8CA 5C09D 3J7AF 1EO8H 1KGXA 1MXGA 2CHDA 5KAQF 2JJTC 5IHWA 4NRXB 4HOZA 3WKMH 2EY2A 4LOUC 3RWIA 4EVNA 1SEBA 1I1FA 2I60L 1RMFL 4APVA 4N0UE 4OM1L 2CNZA 4FOMA 1R34A 2FK9A 2LHAA 4H1LH 4K7FA 4X7EC 4HHWA 2AJXL 5DO2C 1U93A 4HBCH 1ILQA 4WCYL 4G57A 1XX9C 4HWBL 1EYCA 2DRUA 4PLKD 2H6OA 2EH8H 4C2MB 5LXVA 2Q2HA 1LTLA 5EEVA 5D7SH 3QYMA 1CG9A 2A6HC 1NDMA 4G8FA 3W11D 1DOKA 4MJ5B 3A47A 1QRNA 4NHCH 4DQOH 4DUXA 2O6FA 1OAUL 2HT2D 4HKXB 4I7ZC 2CCLA 5CEXB 1FSKB 3VYSA 3C87A 1RAMA 4DT2A 3SE8H 1YECL 3B9KB 4DU9A 3WJMB 4P4KA 1OZUA 2B20A 2WZ6A 5L4IA 4LOVA 5EBGA 4TQEL 5DHYA 5EIQA 2X6CA 3MJGX 1UVQB 1CF8L 4Y7NH 2WGNB 4XE0A 4FG6C 3H9HA 1B2WL 2IJ0C 5IM7B 1YYLL 1MI5B 2BNRA 3S96B 4EI6B 3RE0A 5BUPA 5DZJA 5I6KA 1VQNA 3IFOB 1BJ1J 4ULLA 4A2DA 1N26A 4LGSB 2Q2IA 3FU8A 4B9JA 3OHMB 5CEZE 4FF4A 3FUFA 1T6VN 3IFLL 4LRNH 4B7IA 3O11A 1ASZA 1NCDL 1LEKA 3H15A 1XIWA 3VXTB 5KYUA 2ZCKH 4YHKH 5GRZA 4R90L 2NVYB 5DHVA 5ADPL 4UTAL 2CD0A 1TTGA 3CFDA 1N5AA 5L7XL 1G0DA 3D48R 4U6HB 5D5ME 4M1CD 1FO0A 1BQ5A 4GRLC 3HRZC 5IGCA 5HD8D 5ENWA 3CQQA 3P4MB 4LF5Q 4NZRH 4DN3L 5CJOH 5C0IB 4ME5A 1B6DA 4X0KA 1B4RA 2ZOUA 4WHCA 2EDKA 3BZKA 5HHPA 5JUEH 2WWKO 3C5ZB 5DDHA 4MKTA 1ZT1B 2I5YL 3QUYC 4X7SL 2X0UA 4XWOC 4ATTA 4RGMB 1AKJA 3GPSA 4DUZQ 4APQD 5CKAA 1JGEB 1U41A 3N40P 4XMTA 4G6AC 4XXWC 4ZYKB 3V9CA 3M1BA 4PVNA 1QACA 4U6XB 4ZS7L 1BYOA 4U0RC 2Z7WA 1J0KA 2XKUA 3L3HB 3MRGA 3KDMA 5KSBE 3SJVA 5INCB 3BAJA 2UY7B 2ZWKA 2AFNA 4MAYC 4GSRA 1EY9A 1SM3L 4KKBC 4D0CB 4IBVA 4IBZA 4Y8AA 5E95B 3VXRB 3V05A 3TN0B 4OZGE 3TCLB 2CA3A 2EJFC 1DANU 2WBJD 3J07A 3U4BL 5BW7A 3ELQA 4LCYB 4F57L 4AYBB 3TFKC 4G9DB 1IIIA 3VG0H 5MERA 1NFIB 5I1JH 3CMEA 3KPRA 3WFHB 2R7ZB 5C44H 4NQCE 3UFIA 1FN4A 3NABH 2ID5A 1U2YA 2Q8BH 4IOAA 1OT1A 3FB6B 4F8LA 6PCYA 2PI2A 1AE3A 3WEXB 4P3CL 1WVLA 1OAYH 4C4KO 1ZGLM 4ODUA 1YNNC 4KN4C 4OI9A 4F87A 4Z95H 3UC2A 1TTRA 2P46B 2G75B 4Z7UE 2W60B 1MW3A 1FVEB 1S9YB 5HHOD 3LEVH 2P7TB 4OSUL 3CTTA 3ZK0A 3Q8DA 3NQIA 4UB0H 3IMWA 1DSFL 4I9WD 1IEHA 2D4FA 2ICWB 3CE1A 4UP8A 1UXMA 3B2MA 3U0WL 1E3FA 5DZVA 2NY1D 5HDBB 2RQXA 5HVFB 1P4LB 1TZ8A 4LLQB 4JRYD 4OCYL 3KR3H 4EVOA 4RG1A 4MSWA 1J1PH 3CQPA 4OZFG 4JYAQ 1GGUA 3KLAA 2ADIB 1T2QL 2EXDA 4IJTA 4ZUWA 5L9DH 1LE9A 1CZ8H 3A6BL 3BPOB 5JIIA 3BGAA 5DJ8A 3DIFB 3KPQB 3BD4A 3OZ9L 2PW1A 4KHTH 3X13B 5C5MA 2CLVB 1SRDA 5EUOF 4D9QE 3M07A 3KYNA 3IJ7A 2DIAA 4ZMTA 2H4OA 1M2OA 2F0MA 2GUOA 4YNYB 2QDVA 3VYRA 4F80A 4LGPB 4F7CA 1U58A 3JAML 4YSTA 1R5VB 1U91A 3EOYG 3DKHA 3ARQA 1FORL 1R3HA 1XXFC 4OJCA 3VWKD 2QKIA 4K3JL 3QIWA 3SO3C 4GEIA 5SWZB 5L88L 4FLSA 1Y18B 2BXYA 2C7FA 3ALWA 4IKJA 5I1GL 3EHBB 1Q12A 5AKSA 2I26N 2Z7ZA 3P4NB 1U42A 4HK3N 3NTKA 1WITA 3AG4B 2DAVA 2ZTEA 1ZJAA 1HYSD 2X10A 2YSTA 4XBGA 2MKWA 3E0EA 4JAMB 5FPIA 4HJ0C 2L9HA 5FXCH 4N1HB 1KIPA 2XFXB 2IPKB 4QXTA 5BRZE 1OE1A 1Y7VA 3BCDA 3RWGB 2VB3X 3ZPDA 4QGYA 1TEGA 3HI1A 4GUPA 5T3ZL 3RUGE 4NUMA 4OCWL 1I9JH 2GJZB 1GGIL 1MFEH 2X42A 3S2DB 4LU5L 4E5XA 3HR5B 1YG9A 4FD0A 5F3HB 2ISDA 1J86A 4KTEH 3SDYL 1DCEA 1ZANH 1DBJH 4LCIH 2R0KL 4FQ2L 4MNQA 3FFOA 3GMMA 1QQDB 2IH1B 3ZT7A 3ZYJA 1HPCA 2OL3B 2VW7A 4K5LA 1UOKA 3DSNA 5FGRA 5J39A 1RIVL 5IJKA 4Q7DA 3QJFB 3MRRA 1WIUA 2R0WL 2R1YA 1RPUA 4PZ8A 4IN3A 3CCRA 1A4AA 3TO4A 2AK4B 1JZEA 3HPJB 1YVLA 3LN4A 3S9WA 1XPUA 3F84A 1QSFE 3JV4B 3MV11 4NXKA 2A74C 2RSOA 2I9LB 3D0AA 4M5YH 1BZDA 4GG6F 4HFWA 3VU2A 2O61A 3C6LA 2E2JH 2DBLL 4H8QA 2H3XC 4ZUTA 3HOYB 4Q89A 4BSVA 5IB5A 4HCRH 4URKA 1SNDA 1IBKL 3AFQA 4JVZA 4KHPQ 3GGWA 2ZUYA 4ES9A 3A0JA 3MFGB 3ZZ1A 2Y07L 3BEVA 3L1FA 3QC5X 5F1KC 4PJ9D 3DV4B 4GXVL 4QF1B 4UNTA 4XPGH 1IGCL 4WHYH 3LWEA 2JSFA 3HOWB 4D0BA 1PH2A 3WTUA 4KK5C 2ODIA 4IIQC 2X6BA 5T1KA 1E4KA 1D1KA 2P28B 1UWEL 1U4LA 3TEHB 3J81c 1R1CA 2JB6B 3ARBA 4OZHF 4NQXA 1A9BA 1JORA 2KCCA 4WO0A 5JXEC 2XA8H 1M6OB 1UFUA 1G7HB 4Q14A 2CO3A 1S7RB 4PTUA 5DRXA 4CN1A 2CKNA 4C3HH 2F15A 2ZG1A 1NANI 3VFMA 4W4OA 1MFCH 3UIZA 2WYTA 5EN2A 4MX7B 1FNGB 1TJIL 4MXVF 4O00A 4ZXBA 3K6OA 4NI6A 3FFCD 3U9UB 1X3EA 4C59B 4U1LB 4DKDC 2WLHA 3EFOB 4KO7A 5EBLA 1J9RA 2YD7A 1V8QA 1SY6H 4KMQA 4BUGA 4A3GB 3T0EA 1D5XC 3UYRL 2L7JA 4G2AA 4Y16A 2F0KA 1FR3A 1K8DB 2B8FA 4CJ0B 1U8HA 2PO6B 4JJOA 4X6FA 4M02A 4RGTA 4EGVA 4KOCA 4MQ7B 3WXWH 3NPSB 1B3IA 2V7NA 3MO1B 4MMXA 5CN3A 3OTOL 5F7BA 2ZXRA 4ZJ9A 3GTTA 1BEYH 4R4BB 4XN2A 2UYLB 5ELBA 3WKYA 3G6JF 3WNKA 5C0GB 4HWZA 3PCOB 5LWYH 4XNBA 3OJMB 4YWLA 2F54B 3Q44A 4XVJH 3ROLA 2WXPA 2QFRA 1S9XB 4AMWA 4OF0A 5D6CB 2DDQL 5I5JA 3T1FA 2QSTA 3AQDA 4PHZA 1JVKA 4FLHA 1H6EA 2YD1A 5E4OA 4GG8A 2BFGA 1I4HA 4AIZB 3KL0A 4F1ZA 7FABL 2L4NA 2VDRB 4XYQA 5D8JH 3BQUB 3MRLB 1IGFL 3QBTB 3SYCA 1CICC 1XMQQ 3HOZB 2UXCQ 1E4HA 2EXWD 3PGDB 5HI3C 5DRWB 4QRUA 5SX4H 3WHXA 4PJIB 1UHVA 4YIQB 2QQNH 5KS9A 1D3CA 2IBBA 3OB0H 3WEBA 1W0VA 4PREB 3MUJA 3U25A 2EXTA 5DTFA 2DM3A 4XP6L 4JHBA 4A3FH 3QEUA 1QG3A 5HYJA 3GTQB 1C1EH 4Y7OC 1JHTA 3HOGA 4EUPA 1KXQE 5EO1A 5I8OH 4AZ8B 12E8H 1F5WA 2NTFB 2B2WA 1TYJA 4Z7VA 3CPLB 2FT8A 4HJJL 5FB8A 2B1HH 1SEBD 1MHHA 4QNPF 5I24A 3EDJA 1ZPUA 2B2XH 3DOIA 2ZXEB 5DZNA 5EU4B 2I9TA 4L5FH 4UMSA 3SKMB 4PV9A 3QWQB 4JCLA 4KX8A 5F6IC 4DAVA 2EY5A 1J1XH 5CBEE 1IAIL 3AG3B 3D34A 1DJRD 2CJUH 1E2ZA 4HJSA 3KPSE 3UGXA 3GXIA 2VOTA 5DJCA 4L8BB 4DPGA 4HX1A 3QXWA 4HKJB 5CZRA 2ZXWB 2UU9L 2SOBA 2DLFL 2O6DA 4LCCB 4N2IA 2L04A 4YOKA 5GJTL 4P4KD 4OX9Q 2OMNA 2RB8A 3QJHA 2F0HA 5KVGE 4FO2A 1AYRA 1NKRA 1D5ZA 3UAJA 3Q1SL 3H4HA 1TFHA 2LAGB 3GI9L 1YQ2A 2OTWB 1BMGA 1EHLH 1H9KA 1HQMC 3BDCA 1L5GB 1NLDH 3ARGC 4TLTA 2A3TA 3MV7E 1N7MH 4P3WA 5AOJA 4NBZB 5JW3L 4DTGH 3CCJA 4ZG1A 2EICA 2W0LA 3HTLX 1G7LA 5ABZA 4XI5D 1QUQA 4M7ZB 1WWBX 2QFPA 5I74C 5I4DA 2M2DA 3ZE2F 2AQNA 3JWNC 4PRIB 4JKLA 4PWHA 4AQEB 3QR2A 1E7UA 3O3AB 1BAGA 1RZPA 2XZQH 4LSQL 2L7EA 5M5XH 4P46A 1QUNB 3FQXA 1SHWA 1XIWD 2LABA 4ABUA 1YNTF 4TMPA 4BBRB 3SGJC 5IVXA 3T2QA 1VZGA 2WYZA 2XWTB 1V05A 1DQDH 2XXCB 1NFDA 2PCXA 3L48A 4NLAA 4XHJC 2DWTA 4JKPL 4NXSA 1AHKA 2F53B 1AJ7H 3QDMB 5LLIC 5GRVK 1EDQA 3N1MC 4HUXB 1Z9FA 4H88L 3VCLA 4MJ2A 1KBKA 3NK4A 1AO7E 1OAZH 4N0CC 1AQDA 1R5IA 4RWYH 2AKRB 3Q6GH 1YPZB 1V55B 1PAZA 3VXSA 4LB8A 1UXLA 3B7UX 1BW8A 3BO8B 3JUYA 1G1CA 4KROD 5F7DA 3SQRA 2H32B 3T1HL 1AKJD 2ATPA 2VIRA 3QRGL 4RQQB 3TVMB 3VRLF 3VXUB 1IAKB 4BFEA 3QZWB 1QNZL 4QY8B 5C0XH 3SY0A 4S1QL 1CDYA 3CBRA 3DVIA 3FBQA 2ICEA 5A2BA 2W0PA 3I73A 2D9UA 1A3LH 4PWIA 5ERWB 1AC6A 3U6XA 5IFAL 5E4EC 3BZFB 4YFEA 1Y6MR 5JW4R 4NP4L 1HXYA 3STLA 4LCUA 4YC2B 2GJ6A 2CBTA 1NUFA 4KK9D 5FM4A 2RGSA 3UYOD 1NAMB 2AQRA 3QPXH 3KFUA 1ASQA 1FZOB 4V11A 4A7QA 2JA8H 1U8IB 4H1LA 4IUVA 3V2AR 3KPPB 2QQQA 4JHAL 1VEMA 3KPRD 2DJUA 1MNUH 1E22A 2G9DA 2N8NA 1Z9PA 4ZKBB 2EY6A 1WRFA 4OLWL 3RY5A 2B2VA 2AJ3A 1MCLA 1YQVL 4MDJA 3PQYA 4QJ4B 4EBQL 1SDYA 1LWJA 3D4RA 2NZIA 4PJ8B 2Q76B 1U8MB 3S3SA 4GQQA 4ENED 4PJBF 3KL5A 3N6YA 2FYYB 1E2WA 3REVB 2LQRA 4F9PC 1WC7B 1GYWA 4DFAA 5LL6S 1ZTXE 3SKUD 4PJ6A 4TUKH 4HPYL 4WNJA 3TBSB 5LG6A 5FHAL 3B7RL 3MCKA 3I2ZA 3L81A 1RQ5A 3HOXH 4UU9B 4G5ZH 2WVVA 1CGSL 4WGWB 3P69A 4QYAA 1O7VA 4OLUH 4DETA 1OXXK 4DV2Q 4R4OA 1PYWA 1GHJA 4MB5A 4LF3A 2HTLD 1AY1L 3A7AB 3LN5A 3P77B 1HESA 4L3EA 4NUQA 5D2LB 2B3GA 4MMZA 2G60L 2BVOA 3GXTA 4PCKA 3G6DL 3OOCA 1HEZA 3GWJA 5EZIH 1EXHA 3ZE0B 5KRUA 4LQFH 3OKEB 3QQ9D 3HW7A 3KZ8A 1MQKH 3PPSA 4JG2A 2YHGA 4KXBA 4ZAKD 5DJXA 5ABAA 2AQ2B 1NGQH 2KBGA 3BP6A 3HOVB 4PRPA 1QFWI 3JYCA 4ZTEA 4BSWB 1I4FB 1NCWL 3D50A 2WIIB 2EXYC 3LZPA 3CK0H 3Q01A 2JXMA 1CDIA 5D7LD 1S7VA 2JNZA 1MJ8H 3B37A 2FB4L 2CO2A 2Z91A 3VFTA 3QIWD 3JWNE 3WBDA 3V4VH 2P5WA 4M8QA 4M5ZH 4OFIA 1K72A 4RKBA 2MQ3A 3F2CA 2Y7QB 3ZSTA 3RNUA 1E5AA 3S88L 1CGTA 3CU7A 4ELDA 2W80C 4AQ8C 3CVHL 1IAIM 2H47C 3MRFA 2PR4H 4C4BA 1N32Q 1V1PB 5KVMC 3VXMA 5DUML 5L2JB 3GIZL 3CX5K 3FRPG 4JRXD 3NESA 4JC0A 5DR5L 2X4QA 5IMOA 1MELA 2Y24A 2Z0BA 3MUY1 3P4OA 1JOKA 5AW7B 3G6EA 2Y23A 1NZRA 4CKEA 1RU9L 3GS0A 5A2QE 2HWZL 1A9EB 5JW4M 3J7A5 5IR1B 4GQZA 4ZT1A 3NCJH 1XGRA 3TZVC 2RVLA 2L8AA 2EYSA 2HVJB 4RHRA 4LIQL 4MVBD 3VQLA 2NVQB 3V5DB 5ICZB 3OXSA 1BOGB 1K9MC 3GHPA 3GLEA 5GS0C 4MNQD 5JHBA 3RDTB 1UUSA 1KN2L 2APVA 3O81A 1DEEA 3ATEA 2ERJB 1XF5B 4YSOA 3ES6B 4BH8A 2GEQA 2OW6A 2OULB 5EC1B 4JI3Q 3P3TA 4IK7A 4F5CA 1NPJA 2VXVL 3MNVB 1NCGA 3TO4D 3E6HA 4F20A 3EYSH 3V4PL 1BGXL 4IMKC 1EY5A 3K5OA 5GRWA 5HVHC 3Q05A 3N52A 1E9QA 1M90C 3SKOB 5HYQB 1A7PL 2J57A 4OGYH 4RAVB 4TKOB 2WQWA 5JDSB 2A6JA 3BP5B 2P8MA 5NUCA 1GHFL 1NY4A 3HG1E 5ACZA 1DBML 1FD7D 4PJEE 3LZLA 2JVUA 2YAPA 4UT6L 3FOMA 1EAJA 2I5LX 4UV7L 2IAMA 2MJWA 2OMWA 4PJHB 5AFAA 5FYKE 1PCXA 2WN2A 1IKMA 3BRGC 3EGDB 1HU8A 4W6YB 4XOAA 3H0GH 4N25A 1X3PA 3PE9A 4P5RA 2WSDA 3W82A 2H1LM 3QCVH 5AVXB 5JR1H 2Q6WB 5T1KD 4DW2L 1NCAL 2F3IA 2GBVA 3FF7A 4ODHH 1WCMG 4DKAA 1XPRA 2H41A 4DO4A 3IDYC 2ZUTA 5AD0A 2XHNA 1XGPB 4XAKE 3ARBD 4L5SA 4M8UA 4F3FA 4KV6A 3ECUA 2KJXA 2JCCA 2NNXA 3GNML 4WFEE 1QJOA 2WLNA 3RZOB 4TL4A 3KWWB 1ET8A 3UH8A 4PRNB 2HUGA 3NIGF 4DR1Q 5JOPE 1GCYA 5EBMB 3O8XC 3GHEL 3TCXA 2EE0A 1TWHB 4AQOA 2BM3A 3NIDF 1KG0A 5LBGA 3RIKA 4B3SL 3VH8B 2PMZB 1B4JL 1ZLVK 3NSCA 3T0ED 3SCMA 1A15A 4Y16D 3CLWA 3MV8A 4H0HB 4LL1A 1R4PB 3RWEA 1GUGA 1I1AC 2B3RA 1B90A 4Z7WE 2H3KA 3US9A 4BINA 2X09A 1HNGA 1HL5A 4W4NA 2CGRL 3I02B 4WEUD 4WDIA 5D72L 5E8DH 1MFBL 4H8PA 1THCA 3OB8A 4NKOA 5BZXA 4YDKH 3OPOA 4JFDA 4GSDL 1SYSA 2K78A 4HIJB 4YVUA 3WGUB 2QZQA 3QCTH 2ZXBA 3ATAA 3QPQD 4A3DG 5FOBA 3UTPD 1X6NA 1Z3GL 3SDXB 2EUZA 4G7YL 1KJ3H 3L13A 1U8CB 4RFNB 3O4LA 3T3PE 2JA9A 3ZHFA 4Y4FB 2IQAA 5EA0L 4OF5A 5AOZA 4DP4X 1NEZA 5GZOA 4PP2B 1UWVA 4Y4HA 2OI9B 1KCBA 2X1XR 2ADJB 3A3YB 3I75A 4DR5L 5DS8A 4M03A 4G7QB 1FJGQ 4CGUB 1G291 2P26A 3FQ4A 4NN7B 1EANA 4C55A 5IYBH 1VQ9A 3J7AV 1XWVA 3LZNA 4WHTB 1UWXK 2OP4H 5E1QA 5HYJD 3ARPA 2ALWA 2W95A 1PIFA 3RPIB 3SB3A 1BYPA 1YEJL 4QRPB 1FYTA 3GQFA 4LLYA 4ZO7A 4LLUB 4N2HA 4MB1A 3L7EA 3N04A 4Z77A 4M1DL 4UCFA 1MJCA 1WFJA 1F00I 4DN4L 4XN7A 5A1AA 2FT6A 3DTXB 1OAXH 1HHGA 2DH2A 3QQ4B 3ME0B 4N2FA 5I9OA 4RGNE 3ASOB 1A7NH 4XPHH 4YCWA 4NSKB 5LXGL 5ANMA 1ZHBA 2Z3FA 4P5TB 5IY5B 1YMMA 4BH7A 4HEPA 5BN3A 4B0MB 1KMGA 2MNAA 1RHFA 2EH7L 4RDQF 2AJSL 4OIIH 3L3IB 3ZYYX 3LDBC 2RFXB 4OLVL 1JV5A 1A6PA 4GSQA 3MOAH 4GKSA 3ILQD 1RKRA 4XMZA 3OG6B 3U4EA 1UJTA 1ZTXH 2CNYA 5I8KH 4Q0FA 4JZNA 4KUCF 4NP5A 1A64A 2A9ML 2FUQA 1XB8A 2ARJB 2GEEA 3NCYS 1UJ3B 3ISRA 1AE2A 1MY7A 4Z18A 2WMPB 1AIFB 1S5DD 3PIQA 5LJYH 2HT1A 3P20A 3VXQB 1BREA 1IFHL 4M7JH 1D8LA 1CT8A 1U8NA 2VDQH 3MTRA 1X5JA 3F6LA 5D1ZA 4QHKJ 1SY6A 2D8KA 5C0AB 3NSJA 4DOHB 3PO2B 1ZWIB 1IQWL 3BUTA 4N8VB 1U3HC 2YO3A 1TYRA 4GLAC 3AREA 1JI2A 4BYHA 3P40A 3QNYB 1MOEA 4A3BH 2NUPA 4KNQA 5FS5A 2JJSA 1DP0A 2E9JA 5AVTB 1B7YB 3E2HB 2XTJB 4AKPA 4BKLB 5INDB 5CCKH 3BD3A 4NOBA 3X3GH 3D0FA 3AQQA 2JA5H 5DQJB 1ZEAL 5JO5B 5IP7G 2Y1ZA 1PFMA 2XIDA 5ALBH 3JWOC 4YHIB 3V0IA 1BVOA 2BIHA 3P9MB 4HS8L 1NIBA 3VA6A 4H26A 3S14H 3VGAC 3DHUA 3EH3B 3RTQC 5EAYA 2WXMA 3AC0A 4L8SB 3VXSD 1HWGB 3KOJA 3BAIA 3WHE0 4D8OA 3RNQB 1VQ5A 1XAKA 1OTUC 1VB9A 1BBXC 3MRKA 2HPTA 1HILB 3MODL 4JQXC 1P69B 3ULUC 1N64L 4RIRA 3MXVL 2H7WA 5JIDA 5JOBA 4L37B 5TGBB 4EN3B 3RLOA 4UILL 1I4XA 1K3ZA 4JFWA 1ADQH 3NQKA 3K72A 4MD5B 4JFOA 1H15B 5IY0A 2NNCA 2CUMA 3EOTL 2VDML 3A5VA 3BAKA 3MA9L 1HXYD 3UROR 4M62L 1E4JA 5GS0L 2GJ6D 4XVUD 3CDGB 1T66C 4P9HH 3B9VA 4JN1L 2W5PA 1TEFA 2CLZB 3CZKA 5BN5A 4TQUS 3GZOA 1T1XA 3G6AA 3IU4H 4I18B 4MQXD 5PCYA 4G72B 5D7LA 3AU0A 3WS3A 2VN3A 4LFCL 1MUJA 1P5UC 3RL2A 1Y69U 2FX8H 3CZEA 5EV7A 4AXWB 4M3JA 5CV6A 3KBHE 3LV3B 5IWLA 1TNNA 3T8XA 2GKIA 3PUXA 3SGIA 3OX8A 3D52A 1GUWA 3CVIL 3CJJA 4GG6A 5DJDB 3PQYD 3D4ZA 5M3MG 3B9KC 4J3BA 4JFHD 4CVZA 5ELNA 3LN9A 3IDUA 2EEXA 3IETA 4FQLH 3OMGA 4P4RA 4FQHB 4Q6IB 1UE6A 2A99A 1ZY9A 2PTTA 3RY6A 1F6AA 2A9NH 1ZIBA 1PTZA 3E9IA 5DMGC 5GZNA 3TEXA 1O7DE 2H26A 2YLKA 2GTQA 3U30B 4EI5D 2CKBL 3IS0X 1JWSA 3Q5OA 1PZDA 2E2IB 3FPXA 5EOCL 3GUTB 1WIOA 4WU5A 5DWPA 2QADB 3RZCB 1YHQA 3CX5J 2ZUQC 3MX0A 2VXTH 4IBLT 2WTOA 1KCUH 1A5FL 4BRJA 3MLXH 1PYWD 6PAZA 1VQOA 4AYID 1MNNA 4JFXA 1IBLL 3N44B 4YQXH 3NH7H 4R0LC 3P3RA 5KG9A 3INUH 1UASA 4GINA 4OZHA 3QCUH 3UTSB 1W6WA 2W9DL 3NCMA 4KV5F 4JDTL 2WO2B 5AW0B 1BD2E 4GKKL 4A63A 4R26H 3WL9B 3BESR 3MTXA 4M93B 1ROCA 2JJQA 2JKWA 2NW2A 2ZCHL 5DD1L 2OR9H 3VR4A 1AW7A 1PZ5B 4J1UB 3FO9B 1KDBA 3EYUL 4PRPD 4X5PA 5I1HL 3CAMA 1FFOB 2NTTA 5BO0D 2IANA 3HZXA 4BK5C 2A8VA 2K1MA 4EX5A 3TC9A 2Q8IB 3GF8A 4I9XA 3DLQR 2FATL 2FE0A 3C5ZC 4U1JA 1IT9L 1HZHL 1B9MA 4DN4M 2FX7L 2Y7OA 3OAUL 4FI6A 5AB9A 5IQOA 2JA7H 2A6IB 3Q3GB 1GMIA 2A0LD 4GUOA 4MTNA 2OPCA 4XPBL 4E9XA 5EKKA 3DVGB 3L17A 5EIIB 1VACB 5FLMH 4Z7NF 3ABZA 2MGSA 1JNNL 2H1XA 4AZUA 2QBWA 2D3LA 1RHHB 4A93B 5EC2A 5FO9B 4RNRB 4KVNL 4I3GA 3VXMD 3G6JA 3NIFE 4H4NA 2H8PB 3WFEL 1FL3A 3D5OF 4G9FA 3EJRA 1QABA 3WXVL 1HQRD 3GRBA 3ESNA 3FU5A 2AV7B 4H2AA 4G1EA 3HZYA 5F1OB 4POYA 3G04B 3D4CA 5IT2H 1FF5A 1T6BX 2VISB 2XACC 5GSVB 2R93G 1OSPH 2R7EB 4G6FB 3AXLB 4YY3Q 2VLLB 1VQJA 5JEAJ 4KKRA 3L5JA 4IRZL 3N1PC 1IC4L 3NTHA 3MBWB 3QFJB 5GGUB 1F2QA 4OD2B 2V2WB 4AYSA 4KY1H 3ZHKA 4BK4A 1JPGB 3ORJA 3ARFB 2GBUA 1ZS2A 4FP8L 4HH9A 4RZCA 4U1IA 3ZL1A 1JZIA 1CFNA 3LD8C 3EROA 3GO1H 2WAQB 2LTQC 5E94A 3EO9H 3L9AX 4Y4KC 5BUGA 5IZ7A 4ANUA 4JFUA 3QDHA 3GI8L 5EU6A 1Q9WA 1HN1A 1TQCB 1K5NB 3WE1A 3HCVA 1AFPA 1BVNP 5ISZA 5TH2A 2IDUA 4FQJH 3FBKA 3H0TB 3V4UL 3W0WE 3QUHA 1CKNA 2F1BA 4ZFGH 2IAMD 3VXNB 2EYFA 4XMWA 3WNPA 1STHA 3BVVA 1KELL 1F2MA 1RL2A 2A9CA 4YXHL 5D96B 1ZSDA 2DI8A 2E7HA 3BPOC 4IOCA 4X4ZA 2R2HA 3CVDA 2IALA 4QD2E 3GKZA 5BO1H 1R3KB 4NXNQ 4X6EA 4N3TA 5D4JA 4WLCA 4KK7A 4D9LH 4NEHB 2FO4A 2FZ3A 4TVPE 4JFVA 5D1QA 4C3IH 3W56A 2XIIA 1RUPL 2X4OB 4LO9A 4N90D 4ZO9A 4ZW7A 3VWJB 5B7FA 3BJ91 5JZ7C 4EKJA 4MA1B 2Z4TA 3UPRB 1S4ZA 1AC0A 4DGYL 1TJHL 2IV9A 3H7BB 3ZR6A 5DFVC 4YSQA 5C9JB 3WG7B 3RNKB 4Y9FA 1T5KA 3S16H 1HTYA 3GMOB 2XQYA 2DJFC 1PKQA 5F1IB 3V4VA 4XT1B 1KNOB 4NQSA 1KIQB 4ORGB 2O6PA 1KSRA 1ZPLA 2BXZA 1GGYA 2WBWB 2MMXA 3SCMD 3TFBA 1P8LA 3ZDYF 3MV8D 2DQJH 2XX1A 1YNTA 5I5IA 4XNMA 2F6AA 3KDPB 3ECBB 2G3NA 3I4NH 5T33H 3VRIA 4F33B 1LQBC 1WIPA 3QRFM 3K80A 1WFTA 2JLPA 3IWUA 3N40F 4LDLB 5IKCB 4YDJB 3FCUB 1Q94A 1WAAF 1KJ2B 3JWOL 4N8PA 4NC0B 5IG7A 5I6OA 3T13A 4FQCH 4DPBX 5AW4B 4H2CA 1JE4A 4WFN3 3KLLA 1DOLA 3BZEA 3MHBA 4LSUL 4RGOL 1UACL 3GDCA 2Z8WC 5FA3B 3FU6A 5LBSH 3QEQA 5K9OB 3QUZA 5E08L 2JE8A 4DUYL 3ULUL 2X2JA 3TS2A 1SMXA 5GZOD 2LT9A 4Y4HD 4H5SB 3BSZH 4FJ6A 4X7DC 2F8VA 3IGKA 3A4AA 3IDJA 3KDFB 1C0AA 1I3RA 3TIEA 4XP1H 1DVFB 3IFNL 3R8BB 4OGAC 4HXBL 1XCQB 4N5ED 1M42A 3VXRE 5MEPA 4TV3A 4BXXH 2XG4B 3X1FA 2NY6B 4AYBE 3PP3K 1I6HB 1GR7A 2FIKB 1FYTD 2WXIA 2JA6H 1JB7A 4DK6C 2XU9A 4X4ME 4XCEA 1CBVH 5ELEA 3ZKXC 3TH4T 4PJ5A 1T7WA 4I13B 4IKLA 3DV6B 5C0CA 4O42A 3QDGA 3HBPA 5AZUA 4MCYA 4K8JA 2XPGB 1SXTA 5CUSL 3FN9A 2QGBA 2ZOLB 4GRWF 2C4XA 4PMWA 5F7MC 2H9GA 2GI7A 3KPSA 4I89A 1IKLA 4B3EA 1KTKA 1YMMD 3KF6A 4HJGA 3BKCH 5C0NC 2B5IC 3ARVA 1E4WH 1ORSA 1VQHA 2R59A 5KSAC 4GIPD 3MLPA 1UEAB 4O02L 3I6KB 3AABA 3RX8A 2G5UA 3QXDA 4PJBA 3PUUA 3BHBA 2QQKH 3PDOB 4W9GC 3RA7L 2NN6I 2R2CA 5F89A 4AQ1A 4LHUB 4BELD 5HDBE 3BVNB 3GXUB 1U8OB 1JVLA 4ZMPA 4YHNB 1AGEB 3HMXL 1C08B 4K71B 2OWOA 1FVDB 2WLZA 4E36A 3EO0A 2YA1A 4H8WC 2B2UC 1KWGA 1QLEH 4ODTH 5C4ZA 1WE5A 4KHXL 3LRLA 5FKAA 1EYGA 4G6JH 4NWUL 2DLTA 2YQ2A 5DO8A 1A4JB 3G5VA 5D1ZD 3D9AL 3S36H 2IX3A 4YWGH 1OE2A 2PO6C 3FT2A 3HE7C 3KH4A 3U6RA 3VI3F 3RKPA 3ER0A 2CFMA 3E80A 3MAQA 3ARED 3LEXA 3SSGA 1HNXL 2E2HB 3NPSC 1KYOJ 2ZOWA 1D7FA 1P0SE 1OK0A 1SXAA 4U1HA 3QORB 2EE1A 5SWZE 5EPKA 3L5HA 1TZGH 3FCTA 3WN5A 4GOPB 3PXHA 4NRZB 4YPJA 2R15A 1CS6A 2FLBT 4RHSA 3KJ4B 1JD9A 4K7PY 4P2RB 2M00A 3FQ1A 4RBPK 1A6AA 3FFDB 4LCWB 4HLZG 3MRPB 5DC0A 5IEHA 3CPWA 1WBYB 1GPOL 3HZVB 2J8UF 4XPAL 1RPKA 2Z7UA 3QFGA 1S4IA 3IRCA 2W81C 1J05A 2VL5B 3M17A 1ZD6A 4FDBA 1DJHA 2I07A 5E8OB 3FH8A 5HJ3A 2X4UA 5KSVB 3TA3A 2BY3A 4FL4C 1X5HA 4LEOB 4WJG3 1G9MH 3MXGA 1OAKL 2WY3B 2WYIA 2YUXA 1DM0B 2QW7A 3BI9X 1NCHA 3MLYH 4FYQA 4U1GC 3PAUA 4FYSA 2ALYB 3UAAA 3MACH 3ULVC 1NGZB 4XPFH 1BFOA 1A3QA 4WEMB 4K8RH 4ZOCA 4GN4B 1K3BC 3CCVA 1XX8A 2EO7A 1TR7A 2Z31C 5GGSB 2R2BB 3UEZA 3T65A 3UCRA 3D6WA 2OM5A 2MIZA 3C2AL 1GS8A 4E42A 1N8RC 2AK4E 1JT8A 2PTUA 4CMHC 4RH6A 2YOAA 5SWSA 1JWMA 1LP9F 3EOBB 1ENCA 1RUAH 2CK2A 2Z9TA 3IDXH 3RUZA 3FSOA 4PM1A 2YAOA 3WIIH 1Q81C 1SMAA 5C8JA 3FUIA 1JGIA 1WD0A 2V4DA 3LY6A 5I66A 2XN9B 1EFXA 3AFLA 4TSSA 2ITCA 3MSPA 2BDNH 1GVIA 5EU5A 4NN5B 5JMRA 1I50H 1HIMH 4JM2C 4PS7A 3RURA 1IQDB 4OV5A 1OPGL 5ID0A 2K8QA 1JCKA 4C2MH 3S4SB 5C6WH 4BSJA 1EQRA 3JVGA 4H0LC 4R7LA 1NC4A 1PTOC 2VT0A 1X6LA 1TKWA 4HXAL 5AOLA 2RKSA