4FXGC

Complement c4 in complex with masp-2
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
287
structure length
287
Chain Sequence
VVEEQESRVHYTVCIWRNGKVGLSGMAIADVTLLSGFHALRADLEKLTSLSDRYVSHFETEGPHVLLYFDSVPTSRECVGFEAVQEVPVGLVQPASATLYDYYNPERRCSVFYGAPSKSRLLATLCSAEVCQCAEGKCPRQRRALERGLQDEDGYRMKFACYYPRVEYGFQVKVLREDSRAAFRLFETKITQVLHFTKDVKAAANQMRNFLVRASCRLRLEPGKEYLIMGLDGATYDLEGHPQYLLDSNSWIEEMPSERLCRSTRQRAACAQLNDFLQEYGTQGCQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis for activation of the complement system by component C4 cleavage.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Complement C4 beta chain
total genus 55
structure length 287
sequence length 287
chains with identical sequence F
ec nomenclature
pdb deposition date 2012-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01759 NTR UNC-6/NTR/C345C module
C PF07677 A2M_recep A-macroglobulin receptor binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.120 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4fxgC02
2.60.40.690 Mainly Beta Sandwich Immunoglobulin-like Alpha-macroglobulin, receptor-binding domain 4fxgC01
2ICEC 2TMPA 3I70A 2I07B 3KLSA 2PN5A 1BUVT 4ILWA 1UEAB 5FOBB 2WIIB 1BR9A 1PXUA 3OHXC 4FXKC 5JPMC 1GXDC 2E2DC 2B39A 1BV8A 2A73B 1BQQT 3G6JB 4FXGC 3MA2B 1JC7A 3L3OC 3V96A 3CKIB 3FRPB 4LNVA 5FO9B 1JB3A 5FO7B 2A74C 5JPNC 3HS0C 1AYOA 3T4AC 2QKIC 2XWBB 2WINB 1XWEA 2XWJB 1D2BA 2J0TD 1UAPA 5FO8B 3HRZC 3CU7A 4D94A 1EDYA 1OO9B
chains in the Genus database with same CATH superfamily
3DTUB 5F7LB 1B0RB 1DXMA 3E38A 4Z7VB 4EEEA 3RZWA 3VI4A 2AQ2A 1P7KA 1TS2A 1SNOA 4F80A 2V5YA 5D5MA 1NKOA 4LAQL 3UCQA 5J1SC 2ITDB 3NZ8A 5ISZD 5CN1A 3DBXA 2B5IB 2E2DC 1YQ2A 4JQXA 4DGUA 5D7IB 1NUDA 5GGVY 1NAKH 1OM3H 2XBZA 2AWOA 1YYML 4AYEC 5FF6A 1TJXA 2FO8A 1HNZL 1AO7D 3NGBB 5FLMG 1BFVL 3TP5A 2XC8A 3PQYE 7PAZA 2OQ0A 4KDVA 1SJEB 1NBYA 3AREC 5DZ9A 1EEFD 5DK3A 4KJNA 2XU9A 4XX1G 5CJQH 1F77A 2W07A 2XOTA 3ULUF 2K6AA 1I1AB 4R5XA 1DBKL 4HHGA 3X3FL 2VWEC 3S1RH 5BR8L 4L3EA 4KRMB 4PG9A 4QHMB 4XO9A 5ADOH 1LE9B 1X9QA 4XVJL 1IJ9A 4DN4H 3D4RA 4H8HA 4R4IA 2GI7A 4MCZB 1HPCA 4XNQA 1Q72H 3D3VB 4JRWA 5DJ8A 1A7QL 3QOJA 4FFVC 2VLMD 5E99H 3RWFB 2IAMA 4OGXH 2CJ3A 1X6OA 1UM5L 3HJ0A 3VM5A 3MZGB 3VFRB 1FV1A 2FO4A 4A7UA 5L2KE 5AW4B 1LK3L 5HDOA 2XY2A 4EQ5A 2JE8A 2OTWA 3AMLA 1PZUB 5LHY1 3U4VA 3C60C 5BV7L 3FRPA 1FGVH 2CBPA 1M8AA 3BWSA 4XXDB 3SBQA 2QVIA 3EADA 1PX3A 1TXYA 1AVAA 2EEFA 4R3SB 3WJLA 1C12A 1HNZQ 5F96L 5F1NB 1N33Q 5C3IA 2LW3A 4LIQH 4APQB 4ODXA 3E9IA 4NM8H 2AQNA 1CD9B 1BM3L 1G0XA 2C9SA 3MUGA 1OPOA 4MZ3A 2BRQA 3QJHA 3S34H 3VXRD 2L4OA 5IOPB 5K9OA 3FUHA 1PFCA 1J5HA 1E4XH 1FORH 4FTVA 3GTGH 2E5EA 3Q8AA 2X7LB 4ZXBC 1X5ZA 1AYOA 3MJ6A 4KKTA 1EHAA 4E9XA 1FL6A 1G1YA 1ET8A 1XIWD 4EQOA 2WCSA 5C6TL 1V8QA 1RIUL 2Q7YA 2W95A 1G291 1RFDL 1L0WA 3GO1L 1SEQH 4NNXA 4PLKC 1PVHA 3P0VH 1B88A 3NK4A 5T33H 1M2VA 2D0OA 4PJ5D 4UQ9A 3LQAC 5ELCA 4KJPC 3CQZB 3NZSA 3ZDYE 1I85C 3MJ7B 1G9NH 3U46B 3JUYA 1KIUB 3SDAB 5C4XG 1KNOB 2J7LA 3EDEA 3II2A 5EJWA 2YD2A 3O6FD 1WTHA 2Z93A 3PWVA 4KPHH 4PS4H 4KXCA 4TNVK 3BUDA 3HE6A 4AKPA 1GH7A 4YY3Q 3IT8D 5FLXL 4PJBB 3AGVA 3TOPA 4JL1A 2F74A 4OWTB 3MBEA 1S9VA 4Q9RL 4R4OA 1H9MA 1GZHC 5DQDL 4Z95L 5CD3B 4NUMA 5JTWA 5AG9A 4TPRL 1XNRL 5EZLA 1N68A 4DGVH 2AXGB 2VQUA 3I2CH 5D7JC 1E65A 5I16A 3WTTA 3RNUA 1X3PA 3CVHH 4KVCL 4RAVB 1NCCH 3BDLA 3CCRA 2J6WA 4P59L 4ZFFB 1B0GA 1I3RA 1B70B 2GUYA 4ZUWA 4RQQB 4FQHB 3OWEA 1QP1A 3TBSB 3QC6X 2O6EA 3AXHA 4N0RA 3UBXA 1CKMA 3LVTA 3ZZ1A 3F12A 3J7ZC 4B3TL 2ILLA 3B37A 1U8HA 5I1LB 1ZKOA 3DX8A 4LEOB 3VXMA 4JFDE 2HX7A 4N90D 5JHAA 3UGXA 1USQA 3MLWL 5CCKL 1MXGA 1UB5B 2NMSA 3D25A 4NJ9L 1G7QB 3ZQWA 1WTWA 2OMYA 1F1DA 3FTGA 4HPYH 2A6IA 4OQTA 5D2LF 2YUVA 3ZL4H 5CBAE 1T89C 5D6DC 5E5MB 1XWEA 4ZCKA 1Y0LB 3OVUB 4YDIL 2CRMA 1UAPA 1W9XA 3QIAA 3BVTA 3NIFF 2NY0D 4HSCX 4YHNB 2PUQT 4LSSH 2C3XA 4S0HA 1FBIL 4Y4HA 5BVPH 4R2GD 2X4PA 2H4EA 2XN1A 2IJ0A 1KY6A 1DFBL 4MKMA 2KLRA 4KQ3L 4M43L 3B3BA 2YHGA 4XP5H 3ZKMD 4RSYA 3M45A 3ARFA 4BCYA 1BX2B 4UQ3A 3ML8A 3SGIA 2MNUA 1QTYT 2EE3A 3MCKB 2FJHA 1BFOB 3HVDA 4DAGL 2G9HA 4KK5D 3I4OA 4DV3Q 4X80H 3U58A 3O6FB 4L05A 2KUTA 2NLJB 2EKJA 3QXTA 4NQCA 4BHUA 2DWSA 4JNXA 3P77A 1JWMB 1QW9A 2PYEA 1F8TH 3BP4A 2XI9A 4RAHA 5TE6H 2P42B 2O72A 1FVDB 1NBCA 4HKJA 2BP8B 1SQMA 3H53A 3Q23A 3K5MA 3OTOQ 1HNXL 2VQ1B 4CGTA 2MHVA 4HK3N 4A3EB 1IGYB 3Q8EA 2MIZA 1WWWX 4NYLB 3IDYC 5IK3B 4LNRB 5IFJA 5CKGA 3TVMB 2VLRE 5KSBB 3D6CA 4C55A 2NDFA 2OPCA 3A5VA 3IJSB 3VSVA 2V2WB 2Q3ZA 4BXXH 2FCBA 1CGTA 3QUZB 4FZEH 4OLEA 4JRXB 4KY6A 4Y1SA 3V4LA 1MKFA 2C26A 4OFDA 4Y2DB 1J5OL 4AW4A 4QTIL 4YHOL 3DO7A 15C8H 2WLJA 1SNPA 3P3YA 5KVDL 1YEIL 3UTQB 4P2QB 4X7SL 4L29B 4U31A 1TWAB 2XPZA 1MJCA 4FZ8H 1E9PA 1SYFA 2XIIA 1HR0L 2RACA 4O0AA 1FR3A 1T22A 3OKNB 3SD5A 3MX0B 2DYRB 3ARBA 3SK8A 3WS3A 4QJ4B 4Z7NF 1NOFA 2CXKA 3ZE1B 1OP3H 4ETQA 4BBRG 4ERSL 1X7QB 1NMBL 5LQBH 4DUWA 4PGCB 2EIZB 2YGQA 1GUSA 1ACYH 4XP9H 5T1DH 2ATPB 5LCVH 2AABL 4DPBX 3M3YB 1YN7A 3FB7A 1B1ZA 2L4NA 2WINB 3QXAB 3NA4A 4PGZA 2RIKA 4NN5C 3L4YA 4Q0XL 1F6FB 4BA8A 1EO8H 5JW3L 2PCFA 2ZSVB 1N19A 3SPVA 1QLFB 5DDHB 3PUXA 3LHAA 3CV5A 2MH4A 2Q3XA 4TNWF 3SY6A 3J7AF 1I75A 3T0WA 2IIJA 2QGBA 3BAKA 2JJQA 3SKJH 4I0PB 3DUUA 3PUVA 1MI5D 1QUQB 5DO8A 1SVBA 4JFVA 3TVMD 3HZXA 1HILA 1A3TA 5DEHA 2EDDA 4BY1G 3LN4A 1FFPB 4PJGB 3WL9A 3RZDB 1EIGA 4ONHA 3QNYB 3LKQA 3ZTEA 4AG4L 5H37G 1CGYA 3O4LE 4FLQA 3TA3B 5BW7A 3KCPB 4PWKA 5CR3A 1O7IA 3FU3A 4GO6B 3BG3A 4JBKA 1F11B 1E30A 1HXMB 2J56A 2EYPA 1BOGB 3MUZ1 3J81E 1GS7A 1PX4A 4PJ7B 1UB5A 3FB7B 1AXTL 2I7SA 3SDCB 5EIIG 4UI2A 4OLVL 3NMEA 4XNMB 4WY7L 3BEVB 2UXBQ 3VFGH 5K5YA 5L88L 5AKTA 1TWFH 3D85D 3QZWA 3FPUB 5JA9A 2F0NA 4YVNA 1YJDL 2IANE 2R0LL 4UP8A 4NWUH 3IS0X 5DYOB 2F1EA 5E6UB 2P80A 2WZAA 1PTOD 3QJTB 1BCIA 4NUGL 1PYWD 5IFHH 4OIJA 1L5GA 1RQ5A 3J7AV 3OSVA 2ZM6Q 2FJGB 4RMUA 4XTCS 3N55A 2P1YA 4AH2A 1XZWA 1KD1C 1EGJL 1OT4A 2VSDA 1BLNA 2OMVA 3CFUA 3PNRB 4HMEA 3JAME 1CFVL 2QQNL 4CVUA 3APMA 4PJGA 5AOJA 3WL9B 1DEEB 1BEXA 2J5LC 2FAUA 3DXAD 2QR0B 4FL4C 2HH0H 1E5AA 1MJ7L 2QTEA 1PLCA 2X42A 4AQ1B 4NLHA 2WV3A 1BMWA 3CAMA 1STYA 5J11C 1NEPA 2WOYA 3B56A 2H3KA 1DSFH 1IL8A 1L0QA 2A74A 3CCUA 5LBGA 4JM2B 3HOXH 4Q9QL 2H6UA 4Y1AB 2VMDA 1GOFA 3RZCD 3FVQA 5FM5M 4U4IA 2QPEB 5EIIB 1C8PA 2X7LA 1WK0A 4PVLA 1E7VA 1NH6A 1KENH 4KK9D 1VACB 2P5WB 1M42A 1U8CB 4GI9A 4MDRA 4K5MA 4K94H 5F88B 4F2ME 1ML0A 1M7IB 1RIPA 2G75A 4KZDH 1LO5B 1FNEB 1XGUA 4GOSA 1G5GA 1K6QH 3G08A 1OGAA 1UXLA 5F0JB 2OCEA 3WTVA 4G8FB 5IJKA 4LOFA 2NRDA 5E00A 2VQFL 4RDQF 3PNWA 4XVSH 1D5MA 1J6QA 4XAWL 3CLFL 3DDFA 1SJHD 3D05A 4POGA 4X6DF 1SXTA 2YUWA 4NKOB 5C3LD 5HHOB 2P26A 1CLYL 2OCCB 3PIQB 1JCKB 3L9EA 5BR8Q 3RFZB 4OGZA 4P48A 3N44B 1DYZA 3PGDA 1JYXA 3LQZA 4LRIC 4QRRB 2C1OA 3KYHC 2HT4D 4A2HA 2BVTA 4TSBH 3RURA 1OQOA 1INEH 2OMYB 3FTGB 5IMKA 1G4RA 1RZ7H 1BGXH 1L9NA 4MAUH 3U30B 2QSCL 2VZSA 3WSQH 1RAMA 4AZUA 4CW1A 1GOZA 3KMDA 1J12A 4KHXH 3S9DB 3MYJA 1YHQA 2I5YH 4PG9B 3CCEA 1CG9A 1KG0A 1IL1B 1RU9H 2VW7A 3FQRA 1E4JA 4WTXA 4PEEA 1WT5C 5J7CC 3AQXA 3HZKB 4GKZB 2B3RA 2HJLB 4G5ZH 4RMRA 3UABA 2BOCA 4XMPL 3GB7B 4DR5Q 2HX8A 3IRBA 4BK5C 5E00B 5M5WH 2AEQL 5E5UB 1C1EH 2NW3B 4WI8A 1JWSB 3FQTA 3MACH 4MXVE 4WWKC 3IMWA 1GY1A 2VL5B 2Z4QB 1WTOA 4OLXH 2QEXA 4XPHL 3FTWA 1T5XA 2BX5A 2W91A 2EXWC 2IGFH 5JDSB 4OF5A 3CMAA 1PLAA 2XNAA 4ZMPA 4LEXL 4D9QD 1ASOA 4XZUA 4P2YA 2X4SA 4D0DA 5B3JF 2H1EA 5JJKA 4TLTA 1MSHA 1BYPA 5I76B 1A3LL 3DIVA 3QDME 3HP3A 4HH8A 4NKDA 5DVMA 5F2FA 1DDHB 3PO2G 1NLBL 2YGPA 3ARFB 1XXGA 3IJYA 5D4IA 1OP3K 4A3EH 4IKLA 3UDXA 3UMNA 3R8BA 3WN5A 3DMUA 2IEPA 3HLAB 1M9WA 1FCCA 4HXAH 3U6RA 3DO4A 4IRSA 2QQLL 4TLUA 4E9QA 1FL6B 4KKPA 4F3FB 3OZ9L 5I5JA 4ZW6A 2PQAA 1SY6A 1VQNA 3GZQA 2HSIA 3GLAA 3NCJH 3CHOA 1UWXH 3NESA 5LBVA 2RALA 3REWB 5BQ7B 5LGKA 1CD1B 1T1WB 2A7BA 1TS4A 2MPAL 4TV3A 2EY1A 1P4BL 3BH4A 3HB3B 3M8OL 1Y18A 3AMKA 2H3NB 1IFRA 3V5DA 1EDQA 3W2DH 1THAA 4MD5B 1ZY9A 3HE7B 2FR4A 3R3OA 5LL6S 1HHHB 2D8KA 1JZEA 3BS1A 5ELFA 4NQEB 2AXGA 3Q5YA 2R7ZH 2YPVL 4M4PA 3DSNA 1IT9L 2K0RA 4L8SA 3WS6C 3K0YA 3RKPA 5DXWA 4MJ2A 4NPYA 1FLRL 5D7KD 3UZQA 5HVHC 2CM5A 5D6CA 5TQ0L 5B39A 3NBHB 5KBLA 3TWCH 2N3SA 1JK8A 1P4LA 2BIIA 3MX0A 3MRCA 4HWZB 4FYSA 4ZO8A 4ELMF 2CKBL 4OEMB 3MHBA 1O75A 1SN0A 2YQGA 3J07A 3UTSE 4OFYD 1O6SB 1ZPLA 2WKCA 3M85A 1U58A 2V8LA 4M02A 4JL2A 3QBTB 4EOWH 2DQJH 2M8XA 3AG4B 4OONA 3VSTA 3CX5J 2QHLA 1KN2L 3RZOB 4QY8A 3K6SA 4X6DB 3PWPD 2BZCA 2FYYB 1N3NA 4NZTL 1PVOA 2X6VA 3C1FA 1VQAA 1NGXB 3NUKA 3RIAK 1KYOK 2ODHA 3NT0A 3QRGH 4A3DB 4Z76B 2XIDA 4NKOA 1UWYA 2VDRL 5INDB 3HZMA 3S17H 2JXMA 2EO7A 3MV9A 4MHHG 4QRBA 4DUYQ 2ZP0T 1T4WA 2K33A 3IMTA 4FEMA 4K7PY 3DSNB 1GSKA 3ECQA 2VB5A 3VA6A 5C4XB 2O5YL 2IPKA 1CTNA 2CK2A 3TT1H 3P77B 4HCGA 4BSJA 5AAMC 4C56E 2IX0A 2COQA 4E41D 2KEDA 1IL1A 1AACA 3FQRB 3Q1EA 4LOVA 3P4MA 3CFNA 4L1SA 1KV7A 4MMXC 4NIKB 2OW7A 4P57B 4R9HA 2F5AL 2CJUL 4PJCF 4YCVA 4HJ0D 1GIGH 1OAQL 2JKRM 3HC2A 1RZGB 3QQXA 3G6JB 3WFBL 4Z9CB 2EXDA 1OF2A 3RTQB 1BZ8A 2VISA 5BRPA 4R0LB 4YAQA 1BDYA 2WTRB 5JQ6H 1ZTXE 5F6HI 5TQ2L 3HG4A 1R5IA 4L9LB 4OGQC 1N64L 3REVB 1MI2A 1P6FA 1PKQB 3K6FA 5AL8A 1OP5H 3RY4A 5B7FA 5EU6A 1KBWA 3VFPB 5JQHC 1H8LA 4MD4B 4CSSA 1HHIA 3P3SA 3GMQB 2R92B 1JL8A 5DLLA 4DSYA 3IWUA 4QXGL 3MV7E 1LMKA 2X6GA 2XUWA 3BAEL 2EKSB 3NTKA 4MX7B 5E2UH 4YXKL 4ACTA 2B7DT 1GUWA 3PUUA 1MHHA 1V9PA 3A74A 3IDYB 5I1AA 1SXSA 1RK1A 3ULUH 4P8QA 2N0KA 3VYPA 2NNXA 4OUUB 2NYYC 2F7QA 4I85A 4PGDA 4Y19E 3C6EA 4BFJA 2A5HA 2IH9A 1LXMA 3L13A 1CFTA 2IDSA 1P1ZB 3CSPA 2CKNA 4CDEC 1R47A 3FQNB 3S5LB 4BFEA 3JV5A 1ZJAA 2X0VA 3WIHL 2IL8A 1RUAL 3MRQA 3VWKA 1NCVA 4JJ5A 4HIMA 1DJIA 1OGAB 4LVOC 1LT6D 4G2AA 2VUMB 4ODVL 5AW0B 1I8IA 4QRQA 4ANXA 4Z7QB 3VXTA 3SK5A 4HCFA 4Y16C 4LLDA 4PJ5B 2H5XA 3S15B 3HAEA 3ULPA 2VJXA 3WN6A 5D72L 4P0DA 5ICYA 3K71A 2PYEE 3VQ2C 2B14A 4EE2A 3EYFB 3NCYS 5SWSE 2DMBA 2XLLA 4MD4A 5E2WH 3K5SA 4PJFA 3GHBH 1WVZA 2F0IA 3HHSB 3OC8A 1RDPD 1IBKQ 1UUNA 2VN4A 4JQVC 1FNHA 1KPRB 1AG0A 2MMXA 1GGIL 2KERA 1DLFH 3CLEH 1Z5YD 4DR7Q 3A6CH 1XCQA 3CQPA 3H9SA 3GRWH 5I9QB 5IBLC 1QUQA 4F7PB 1YVCA 2AQ1A 3B7UX 3BSHA 1G9MH 2XG5A 4M7JH 5F7NC 3S48A 1T1XA 1Q94A 1W80A 4MDJA 5H1SE 3LZRA 2A6DB 2XQ0A 3KYAA 1X3QA 5HHPB 5LBSA 3OJMB 3VH8A 2E7HA 3VXNA 4AYSA 3O8XB 1CYGA 3GGWA 3QIWB 4FNLH 1U8LB 3DSFH 3GDEA 1EJFA 4KUCF 4MA8L 2HDMA 4FFYA 3VXUA 2P7TA 3GLZA 1VAHA 4QLRA 5T3XE 2HIVA 5BVJB 4JO3H 1LLRD 1JPGA 3H3BC 1BAFH 4NUJB 1ASPA 4B9YA 4EAEA 1FJGQ 2X2YA 5FYLH 1D2BA 2UZXB 1NAPA 3IDXH 3WIIH 1Q9LA 5DM73 1WIOA 3HMXH 3WV0A 2OR9H 1JF5A 4BGDA 3J81L 3QDMA 5DJ0A 3IAPA 2K1BA 4Z7WE 2E3VA 1PLGL 1MCSA 4FRWA 4I2XB 4N9GA 5HGDA 1LO0L 3EIFA 4K7FA 4OCLC 4DA2A 4WSKA 2WGNB 1MFMA 2DD8H 5DJ6A 4F7PA 3WIFB 3KF6A 1PAZA 4R4FH 2BS9A 2CUAA 1XCQB 2I24N 3H9SB 4JY6A 3ZDXB 2JNZA 4FYDA 1KCRL 2VC2L 1S7TA 4L29A 3WN5B 1LO5D 3RUZA 4JG5A 3NE5B 3S14H 1ZPUA 3BIKA 4N5ED 3TV8A 3NJLA 1R3HA 1SEBA 2ZWLT 3O3DA 4Q6IC 2PI2E 1SYVA 3H6AA 4BFOA 3T65A 3FEWX 2CVRA 1RJZA 1XSIA 2ZCKL 3CD6A 3KPOB 2H6PB 3O3EA 3P9LB 1F4HA 1ZT1B 1P4IL 3KWUA 2E4TA 1KYUA 3N5AA 2MQCA 2CHWA 1KCUH 4J3WA 4JOIC 4AH6A 1QE6A 3CG8A 2X1XR 4OVVA 4AIOA 1IC5L 4F27A 3QQDA 5IWLC 2PCFB 2XQBL 3TO4D 4YDZA 2HKFH 2WBJA 1VS0A 2JKTM 3LRLA 4KH2A 2BK8A 4MJJA 4W1TA 1LTID 3P3RA 4TL4A 3WKNA 2J1WA 1J0YA 3S4SA 2GTWA 4M7ZC 2Q8AH 1IYVA 4LU5L 4P49A 2IPTL 3UFIA 3MA9H 5A35A 1E4WL 2VDPB 3PDOB 1UE1A 1YYLH 2ZD0A 3ZE2F 2JIXB 3Q0HA 5GS1C 3WTUA 1BQHA 4EPSA 1PEWA 1A9EB 2DQFA 3WY4A 2XRQD 1A5FL 2Y22A 2ZM6L 4FFYH 1C5BL 4HJEA 2BNQA 3FBQA 4AXWA 2BIHA 5ABZA 3C8KB 4LCYA 4XTRC 3BVNA 4KD3A 2DLFH 1GGBL 2HYMA 1YNLH 1CL7L 3UTSD 4KV5E 4H1LB 3GQBA 3QSKB 2JLPA 4WHCA 4IKKA 1TSHA 4WZ9A 2J8UA 3W3BA 4URTB 4C56D 1YMHB 4NPKA 2Z1CA 4C2MH 2C3VA 1BJMA 1NBQA 4OCYL 4MJHA 4XBEH 4PBWD 2ALAA 1YJ9A 1SXBA 4KOBA 3W82A 1WRFA 1MEXH 2RQEA 1ORSB 1JN6A 3P0YL 2DL9A 4Q89A 3W0WE 1D7DA 1IAIM 1VQ6A 2CO7A 4A93G 3UJIL 2K9FB 3BAJA 5G55A 2KHAA 1IBMQ 2D0HA 4MSWB 4TQ8A 4OZ4A 1GJWA 4ZUVB 1TEFA 5JHDE 4DFIA 5EC1B 4E9SA 2NW3A 4I4WB 3ZHNA 5IGEA 4EDWL 4OO1I 3MRLA 3STBA 2I9LB 2UU9Q 3S36L 1NPNA 3GTPB 5D1ZI 2NX5B 1GHFH 4QD2E 3I9GL 4JY4A 3SKOB 3VYUA 1MHPH 3PV6A 4KY1H 3HOUB 3ARBB 2GB2A 1HKLH 1MCEA 3O4LB 4KO5A 4WORA 3IDNB 1RD6A 5BOZG 3T6WA 5JMOC 1HI6A 3MREA 1IXRA 2B3IA 2WJ7A 4AQEB 4JLRA 5BV7B 3V9EA 3MCYA 1OF0A 4KO6A 3IXTA 2BSED 2FZ3B 4KVNL 4NQED 4MLIA 2NY5H 1C7SA 5AG8A 2H26B 5CCJA 3MRNB 3SDCD 1AXSB 1UKQA 2Z3FA 4GAJH 3TONA 3KJOA 2D7NA 43CAB 2NXYC 3ZJAA 2R29L 3G5VB 3MCG1 3ATAA 2BNRE 4NP5A 1OAKL 2ZJSL 1HTPA 3VI4F 4AM0Q 1SFDA 1S9XB 1GYVA 3FRUB 4LPUA 4F8OA 5IHZA 1JGVH 4X8JA 1FH5H 2WTRA 1ZEQX 2Y0SA 5CV6A 3X17A 3JV6A 5DI8B 3J8F7 3WGUB 4BE6A 3H4HA 3DGGB 3VFOA 2Y1YA 3NN8B 1NDGA 2NR6A 5SV3A 3H9ZA 2RVLA 1QKZL 1UT1A 1WIUA 3V4PH 4OJDH 5K1NA 2RTTA 3T09A 2IAAC 4GAGL 2I32A 3WHXB 2DM2A 4EI6A 5IR1B 3EO9H 4DOHB 3X1NA 1MRFL 2QEJA 1ADQA 4P4KC 5FUOL 3UZVB 3HS0C 3KPPB 4XNMA 4JFWA 4IOFD 4QRPB 5HDBE 3HN3A 2OTUB 1PW3A 3TCXA 3BKCL 4JDTL 1G9HA 4BBWA 1J48A 3TNMB 4I9WD 2W9LA 1BDOA 2E9JA 4N5UA 3V5KA 1G6RA 3IMRA 5BW7C 4KKSA 2NR6C 3BKJH 1E40A 1EEZB 2FX7H 4PJFB 4HLJA 3O4LD 2LLGA 4PYGA 5B38B 4J2QA 4JK1C 1B9ZA 1WCBB 4E41B 2ZONA 4NC2B 4H8WL 4QDGA 4JRYD 4PRDB 1YHAA 4DP1X 3NTCH 4UTAL 1NUNB 4QXWA 1FL0A 3URYA 4QKXB 4D8OA 3H54A 5AVQB 4LHUA 2A8VA 4KZ0A 4DUVA 4M93B 4BS9A 2XNAB 1MCHA 3I50H 1TWFB 5B7EA 3QHZL 4RFEA 3WHXA 4Y9FA 4ZSOE 1A7BA 1PIGA 5D2NB 2VXQA 2YUXA 3HI5L 2BSRB 3TEYA 5FCUL 2F9BT 5AKRA 1LD9A 4W9CC 5DMIH 3VXQA 2EDNA 2PETA 5KBDA 4QRRD 3L48A 4X3KA 4C3IH 2V17H 2VM9A 4AE1A 1RIHL 4XC1H 2VCOA 1LQSR 1YNTB 2WXRA 3V0IA 4UILH 3VH8B 1ZT7A 2WXLA 3DVFA 3SBWA 2P44B 3S15H 1WBXA 2NVQH 1J87A 1UA6H 5AOLA 3UTTB 1MFBH 1M7XA 2OR8A 1FRGL 5CWSA 1N7ML 3FB5A 4LCWA 1PF3A 3HOYB 3BYTA 1DONA 2DQHH 2LFEA 1SMXA 5C0EB 4RISL 2WXFA 4FN0A 4J7RA 1SOQA 2HRHA 2L7QA 1YCSA 3AROA 3MRHB 1L6ZA 1MHCB 4I0KA 2YTXA 1HWGB 4HC1H 2QSTA 2D7OA 5AOZA 3AY2A 1I94Q 4PN6A 2FX8H 3I2ZA 5D1QE 2EDXA 2CCWA 2NY7L 2HXAA 3PMFA 1ZOXA 1J8HE 3H9SD 4OD1L 1UATA 1FC1A 5EZJB 1PGRB 4GQPH 2ZKXA 3ERXA 4F58H 1BG1A 3FAWA 5E24E 2AHIA 2H0JA 4NMZA 3K1KC 5J12B 1F56A 2VQEL 1FGNH 4B3SL 3QFJA 3V0HA 3IXAA 4ZW5A 4YSUA 4X7TB 3S9WA 2RSNA 3K57A 3FQNA 5EUOE 2VZ3A 3TEHB 3QZLA 4GKZA 3X3MA 3S8WA 2BY2A 1XR9B 3GKWH 1J1OH 2NVYH 1JOOA 1SUJA 4FVMA 2FIKB 1FFQA 3FU7A 2R7ZG 3W0WD 4UINH 5GS1A 2BC4B 2X6AA 4JPSA 1CQFA 4AZ8A 3BGFC 2G2NA 1D5BA 1UE6A 1NGXA 2EUXA 3BYTB 4LPCA 2ZYRA 5J9PA 2W8CA 3G6DL 2X1PA 3EUUA 3POCA 5ILTH 5TD4A 1MQKH 3GXMA 3RL2B 1J10A 2FBJL 3D3RA 4FEIA 5HI4D 4LBAA 2KBNA 5TDNA 4DUZL 2EDEA 4PRBA 4AL8H 3LV3A 4MB1A 3ROLB 1SBSL 3M4YA 2DMGA 2YV5A 3B9VA 3NCYP 4G80A 4POUB 5E4OA 4J1UA 1PPIA 2Z64C 4LARH 4UU9B 2NOYA 3V4VH 3HC3H 4ILDA 4V1DA 3T3PF 4OLUL 4MD0B 3FT9A 4WW2A 1NBYB 2JKXA 3HOVG 1V3KA 1QMUA 3R06A 2AQQA 4BRJA 4C3JG 2PQEA 2O5ZL 2HFGL 3LRHA 1M6OA 5CZKA 3U9UB 1WGOA 5T1KA 1RUMH 3F12B 3A4AA 1AHKA 3HJEA 1XFPA 2HPOA 4AWJC 4XPGL 5IFAL 5EF0A 4PJAF 4ICXA 4R2GB 6TAAA 1YUHA 4MVBC 5EPLA 4OZ4B 2QILA 3IU4L 4K5PA 2ZF8A 3D08A 4IKIA 1PRTD 4YEEA 1KB9J 3QHFL 2WMPB 4JFHD 4GQQA 4PRDA 1GY2A 5A6MA 3PIPA 3FU8A 1L9SA 3LB6C 3MNWB 3R4RA 4D9RD 3NBNA 1J9RA 4KX9A 1JZGA 1N5AA 1PTOC 1OB1B 4L4VB 3ZPDA 3TA3A 1KBBA 2Z8WC 1DQDH 3MA2B 4OGYL 2V3FA 2VXVH 3MLRL 2AV7A 2VH5H 3RDTC 5KAQG 2JA6H 3KLWA 1N12A 3U7YH 2ENQA 2W60A 2AXWA 3F64A 3K81A 3NOIA 4H25A 2LU3A 2XN0A 5DJDB 4AT6A 4NXMQ 1SZNA 1MJ8L 4YBQC 5DHVH 3QAQA 5ALBH 4QF1B 1RZ8B 3EOYG 5IOPA 1XF2B 4LAQH 4ZPVA 4Z0XA 3C12A 4QNPF 2XHNA 1I4HA 5H35B 1GJIA 2IWFA 4YBLB 3N6RA 3I84A 4AEIH 1I9RL 5DURB 3VWJD 3MRCB 4HWZA 3CBKB 4LHQB 2FWUA 2V37A 1OEZW 3R0MA 4BCXA 3KDMB 1OHZA 3JQOB 3NSDA 3PRZA 5DWUH 5A16B 2IG2H 2JTDA 2KLTA 1BVLB 2YD6A 3JWDC 2GSGA 3MRMB 3EGDA 5AALA 4A6YL 3TBVA 4FFZL 4DO6A 4JQVA 1UZ8A 4M7KL 5EFIA 3QNXA 1I4RA 2G9HD 4NI6A 1NMFA 5F7WC 3MVVA 3FQUA 4ZBJA 3K59A 1NCBH 1QZGA 3QE5A 4PJBA 5L0QC 1CK0L 3BW9B 5GS2D 1CCZA 3LZFH 4F37F 1NM4A 1NL0H 2F74B 4Y16A 3VD0A 3HOWB 1QBMH 3FQXA 4QJ3B 4MDIA 1G6ZA 5E99L 1S5DD 1UM5H 3HS9A 4RGNA 3UAEA 1ODUA 2WM0A 3US1A 5D2LA 4N2IA 4MNGE 4JV5Q 1QSEA 3LZPA 3CCMA 4DV4Q 3D4YA 4ZAKA 4L8BB 4P2RE 3U9PL 1ZJBA 2F61A 4YC2C 3HNTH 5IROD 5ICUA 1TWGH 3APDA 5F70A 2YXMA 2OCJA 3DECA 1BCPB 5F96H 1DE4B 3QI9A 3KXFA 4LIQL 4I0PD 4OCXH 1R3IH 4PU2A 6PCYA 1I9JH 5LNEA 3S34L 3DROB 4YJZL 4I3SH 1Q9LB 4B08A 1GS6X 3GT6A 4D0CB 4IFDG 3BMVA 2Z92B 3JWDH 3LD8C 3P40A 4BZ1H 4N8CH 1WA0X 5DDHA 1QFWH 3FRPB 4UMSA 4AENB 1RIUH 3NK3A 1U8CA 1RFDH 5IWLA 1LDPL 3EUDA 3KBEA 5GJTL 1E4HA 5T33L 4GRMA 4IM8A 5EO1B 3H9HB 1KWKA 2BP0B 1T5EA 3KD4A 4FYQA 4O2DA 2PWDA 4RVBA 4PGDB 1BX2A 4UQ3B 3RGHA 5MENE 5DRZA 1T1ZA 4AYDC 1IGIH 3LHPL 5HYIA 4F8QA 2NR6D 1LEKA 1E6JL 2C3GA 4Q2ZB 5A2LH 3HCVB 1PEZA 2X10A 1ZVHA 2E56A 3GINA 2YGOA 4K5VA 3TASA 4OIIH 4XWGL 1F2QA 4AGOA 4TPRH 3L5IA 5JO5B 5IHHA 4FAAB 4MNHB 4ZQ3A 1HR0W 2BDNA 4Y9GA 1TZIA 1I7TB 1VZIA 4WHYG 4YHPB 1SE2A 2BS8A 3KJPA 1JF1B 5GRYA 1MJJB 3OMNB 4UBDD 3UTZB 3EA6A 3RNQB 2J6EL 3CH8A 4UAIA 4OL7A 1G43A 4IDJL 2X6BA 2ZUSA 1L9PA 3RAJH 1MW2A 4PRHD 4G6ML 5TTRA 4LL9A 4O2FB 4JO2H 1LYLA 4FOMA 2CU9A 4JRYA 1QTSA 1WF5A 2FJUB 4E9WA 1G7LB 2DWDB 3ZL4L 4LUZA 4HJ7A 5AYUL 5B1AB 4KKQA 1RK0B 3QIBB 3D39D 4A3GG 4NQDE 1AP0A 2UZIL 3LKPB 3C5SB 4AVIA 4HIJB 6CGTA 1FBIH 1AAJA 1OCRB 3VX1A 4PUBL 3B2DC 1ZGLA 3HBQA 4M43H 3DYPA 1CR9H 4H1LA 4OSUL 3QCTH 4DKFH 5HYJB 1P84K 1S4IA 2NUPB 2VUMG 5JO5A 3PHAA 2WIMA 4LSQL 3MFYA 3V9CA 5IBLD 2A6IB 2P5EA 2LTQC 5C0CA 4WI3A 5FO8A 1CZ8H 1EZVY 5DWPA 2R93B 3BE1H 2J44A 2G3MA 3QRLA 2F0LA 1TZOA 3B2UD 4P4KD 1T03L 1HHHA 3UYPB 1JZ5A 3T6VA 2IGTA 1JPEA 3V4UH 3BD5A 1EQRA 1JE4A 4JFXB 3NDYE 1WAAA 5ESAB 1TTAA 4ZW7A 2D3NA 2DEYX 2E6QA 3UTPD 4DVRL 4NPYB 3GSUB 5EBMB 4NKIL 1IAKA 4YIQA 2Q10A 5CEZL 1P5VA 5MERB 4NDMA 1KJVA 2WPGA 1I1CA 1C16B 1Q0XL 4KTAA 4I18C 4ZAKC 4CMHC 3KPNB 1FO0A 2AW2A 3VRJA 3ZN6A 1HHGB 1ETJA 2WNGA 3PY9A 2BSDA 2FR4B 2ZX8A 4XCEA 4WWNA 5L4JA 3KPOA 2DLIA 5F6IB 1DE4A 1FZOA 4F2EA 5AUMA 2YBGA 1OGAD 1FVCA 4PJ7A 2WCPA 3AS2A 3MRNA 1SLWA 1NCHA 2OL3A 4YLCA 3QJXA 4XIGS 4R26H 3D9AH 5KYXA 5EZOL 5CMAA 3SKJL 3TN0A 4I77L 4GLVB 3HC0B 3NEXA 3LDBB 4QCIB 5FYJU 1V1PB 3ZUNC 1J8IA 3MBWB 3F7KA 2VABA 1U58B 3FN9A 5LQBL 1AHWA 4TRPH 4H44C 4ID6A 2BW5A 4XP9L 2XFXA 1ZIAA 2WWMD 2IHEA 5LCVL 1AEXA 3I85A 3MAWA 1TQSA 4LOUC 4NAJA 5HBBA 2R69L 3FTUA 2VOTA 5I8KL 3TBTB 5GRUH 1S5IL 2L7UA 3O6MH 5ESQB 7PCYA 3GSQB 4M6NL 2A0LD 2GEEA 1A7RH 2CRYA 4MJ6B 5I2IB 4GO8A 4G5AA 1RZIB 2C7UA 4Q6YA 3WU1A 5AOIA 4ZT1A 1FQ9C 2NY2D 2GBAA 3ECUA 4C4KT 3JSSA 1DVTA 4Z3FA 4IBWA 3APNA 2P7TB 3B2XA 5GGQH 3ZQXA 4CBPA 2B2XH 3ZHLA 4KHZA 5M3MH 2QDWA 4A3DH 1Y8OB 1BW8A 4X65L 2MTPA 4PD4J 2FD6L 4YN3A 1SHSA 1AOZA 4DUXA 5E2VH 3I91A 4HUUA 5FGCB 4JFFD 3AS0A 1ZANL 2EE0A 1JV2A 2AS5M 1OGTA 3DI3B 3W11D 5TGBA 3FPPA 1LP9E 2O61B 2R1XB 3TCLB 4KHTL 5BS0A 1GUTA 5C09E 3NEEA 3T2LA 3SJVD 4IBYA 4WRLA 1FPTH 3RVUD 2FGWL 1AXTH 1GW6A 2ZUQB 5D65A 1YSOA 4EN3B 4BBSG 3AITA 1UQSB 2PPDA 1A21A 2YRLA 1GM5A 3HVNA 4FNQA 3EGSA 4C2MB 1QNUA 3PNWB 2NQCA 2WKLA 3UEZA 1G7MB 5IHUL 1X5JA 1LYQA 2HHHL 2PTVA 2VLKD 3RTQD 2VLKE 5I73B 4Y1TA 1W72A 4IBQA 4D2NA 3LSOA 3FSVA 1IW7D 1XR8B 1TXKA 3SIKA 4LJZC 4PJEE 1FE8H 4ORGB 3F7RA 1BA9A 2JK5A 3HG2A 4AGLA 3TBWB 4G11A 3DOIA 1TTBA 3INUH 1YY8B 4XMWA 1OCWH 5FLUA 4PZ6A 5I8EB 1EGJH 4DGYL 4Z7OF 5CD5D 2XXMB 1AKJA 1OARH 2BHYA 1N0XH 4XMLH 3BCFA 4C1NK 4J8RB 1QSED 1RZPA 1F90L 4HGMA 2WOBA 4PG2C 2EEDA 3K4AA 3MBEB 2G4EA 2HH0L 3FRUA 4ETYA 4FI6A 1Q9WA 3CFCL 4X66L 2CH8A 5SX5H 4J3VA 4XCFL 4XNBA 1A6AB 4ZD3L 3ND8A 1IU1A 3FPXA 4L5TA 1S7RA 4Z7VA 3PO2B 3QUMB 3JV6B 1W16A 3FONB 2AUJD 3UH8A 3KXFD 3GD7A 1AMXA 4DV5L 3O11A 3V6BR 1N9PA 1LJMA 1Z66A 4PB9L 3MGTA 3CRKC 3LN9A 4B3RQ 4LK1C 2GITA 3K91A 1KGCE 1XTMA 4HT1H 1YNTF 1JPST 1UWEH 1CLVA 4PGBB 4NWTL 1EY4A 3DPBA 4A1RA 2QDBA 3RJOA 4TQPA 1J88A 1VHPA 3Q9QA 3D1MC 4IZ8A 4M9PA 4XOAA 2XYBA 3DBSA 4HJIA 3T2OA 1JK9A 3I4NH 5DEFB 4WSGA 3TP8A 1MJUH 4LVHB 3PG2A 1SYDA 4OCWL 4LQ1A 1MCQA 1E2WA 1MLBB 3CU1A 3V05A 2AEIT 5EKLA 1EIYB 1CA5A 4QMEA 4MCYA 3U1PA 2UXDL 1SNQA 4KN7C 3S17B 1OD7A 3IJHA 1HQMC 4P46A 4U1LB 4X6CA 5CLZA 3AG3B 2BVPA 2JKNA 2XTJB 3E3QE 3D33A 4FQ2H 1M7IA 4C4BA 2FIKA 3RVVD 4TSBL 4UOJA 1IM9B 3IGAA 5AB9A 1INEL 1IC4L 4FJZA 1OZUA 4KKNA 5GZOD 1P8LA 1X5MA 1B90A 3PQYA 1RZKC 4HGWA 5I0XA 5J1TC 1HQRB 4IBTA 3FN0H 4BELD 1E1TA 3OXRA 5CBAA 4BQBA 3PF2A 3QQ9D 4EX5A 4HX1B 2BDNH 4K15A 2Y1VA 2YEZB 1HCVA 3ULUE 2X4PB 3N0AA 3UPRA 1C7YA 4G5ZL 2Y6TE 4ZQTA 2H32H 4M5YH 5HYJA 1R9TB 3BX7C 5FKAA 1BP3B 3G5ZB 2J73A 4AI7A 2AEQH 2L0DA 1TTUA 2VW9A 3P30H 4RAUB 1KACB 4DPRA 1TU2B 1CXKA 2R0KH 4LCUA 2F3WA 3RL1A 4F7MB 1IM3D 4OT1L 2RHQB 1BJ1J 1K0SA 3JWOC 2PLTA 3BUIA 3G48A 5CV5A 1A3RL 2HT3C 1BZEA 2PMZE 1KXVC 1U93B 1R0AH 5FOBB 3QO2A 3I73A 2FHTA 1A3LH 1IKLA 1LTRD 2B2WC 2AANA 2X0UA 1QQDB 1D5ZB 3OKOB 2VE6B 3MRKA 4ZI8A 4PV8A 5TDPB 2JJWA 4U6YB 1JWUA 2WO3B 2A9MH 4E0RB 1LK2A 4G6JL 3EOBA 3KYMB 3PGFH 4W9DC 2MFNA 2C5CA 2WZ6A 4HD9A 4OI8A 2PNRC 3RVTD 4QIWE 1A6PA 4N4YB 1S5BD 3T2NL 4GOPA 1S9VB 3K58A 3QDJE 4GRLB 3QFGA 1PYWB 4Y2DA 5EH1A 3QWOB 3Q44A 3X1FA 2Y06L 1AQKL 3GHEL 1MDTA 4F9LC 5IVXB 1MCWM 2HT2C 1AR1D 3QZMA 3U6RB 5T1JA 2QJDA 5C3XA 4ZPVB 4Z0XB 1Q1PA 1U41A 4ZUJA 2OBGA 4BY7G 4KK5C 4QHMA 3T1WA 1LE9A 3WLBA 2C9OA 4P2RB 1ZAGA 5FJ8H 3PP3H 5T1MB 4JDZB 1KCSL 5AVZB 3SY0B 2PPAA 1MHEB 3KLQA 2PW2B 3CFKA 3Q9PA 2BVOA 4KO7A 3RVXD 1QOHA 1P1VA 3NZHH 2BH8A 3GMPA 4QXVA 4N86A 1HNXQ 5I24A 2VUOA 1FLRH 4DR5L 5FAAA 2HUHA 2YKLL 3WMQA 4QEGA 2FIRT 5CNHA 3TS2A 1I1FB 2OMUB 1FNLA 3FFCE 1NJ9A 1MY5A 2XIBA 3CIAA 5C0DB 5KVFH 2GSIA 3DTDA 3L1OH 3K6NA 1JGDB 3GXDA 2AJXH 2B2TA 2MCMA 1AFVL 5L9DH 3U30C 3VXUD 2Q1EA 1D1KA 3OAWA 5FPIA 2CHXA 3MUGB 1BAWA 3K2KA 1F6AB 1XNRQ 3ZTNH 4PVNA 5C3TA 4APQA 5IGFA 2ED7A 4A2FA 3PP4L 4KKCD 4E9TA 3JWNH 3RDTA 1EZ8A 1NSNL 1SJXA 2VRKA 2XWRA 3S35H 2FX9H 1GXEA 4OUUA 3GTNA 1NC4B 4XRCA 2DQCH 3TS0A 1BVKA 4OZHB 3RTLA 3NCBB 2VO8A 3TO4C 2OP4L 4N0UE 4GLAC 1O6SA 3SJVE 1H9RA 4BY7B 1BBWA 1CZGA 3BQVA 3AQDA 4LLWB 2CGYA 1HAWA 5F7UA 4M7LT 5CGKA 1QUPA 4NS0A 2CKZB 5FYJH 3IMSA 2ZUTA 2IMMA 2PO6D 2AQ3A 3L8QA 3WOFA 2H26A 1ZVSB 3TT1L 4PJ5A 1KCLA 2YBRA 5ELIA 2F18A 4ZMZA 4ODSH 4G8GA 4KKLD 1NBVL 2P9RA 3HOWG 3HHSA 1OY3B 2WZPA 2CJUH 3W3AA 5C0IA 2Y1ZA 4PJ8C 2VR7A 4GSXA 1WPCA 1I7RB 2X38A 5FA4B 4ABVA 1JWSD 2K6YA 3QS2A 5GS0C 4XT1B 1UE5A 2AV1B 4RAVA 4U1HA 5GRWA 3U7WL 2GJPA 3ABLB 2YN5A 4WK0B 1ROCA 4YXHH 2M1KA 1W3SA 4PWHA 3NCFB 3H42H 4LQFL 4U1IB 1TQUA 1HZBA 2JQOA 3HOWH 3OR7B 1YECH 1U3NA 3PJSB 4ZO6A 1PQZA 1HUMA 3BAEH 3HZVA 4PWGA 5E2UL 5I82A 2R83A 1ULVA 3VD9A 1H0DB 4IMKC 2KS0A 4GY4A 3L16A 4NSKB 1M1XB 5DTFB 3SGEI 1SYEA 4UYPA 4L8CA 5F6HJ 4NERA 4M4RA 3DV6B 4BH8A 4F93B 2QZQA 3ME0A 3N42B 5E8DH 4J3OH 2K4KA 4NPJA 5EU6B 3VFPA 5LMNW 4Z7NE 3ILPB 4JM4L 2R4SH 1I1RA 2UXFA 1L2FA 1N34Q 2YBRB 1JC7A 1VFUA 1B2WL 1P84J 3RX9A 2CCZA 3IDJA 3WIHH 2RDGA 1Z3GH 1XXDC 4XGZB 4R3SA 1XMQQ 2H47C 3OJDA 3U1SH 2VR8A 2JI2A 5CJ5A 1KCBA 3KDFA 2A73A 4XI5D 1ZT4B 2DY2A 4GAFB 4ZFZB 3GMRB 2A2QT 1UH2A 3ULVC 1DBMH 4QHLB 1FAIH 2XWDA 1UD6A 2MQGA 5HHOE 4Q6IA 2ZNWA 3CUPA 5J22A 3CDGB 1L4IA 1U8OB 4K3EH 4DR7L 4LCIH 2PTTB 3S3BB 3UCRA 4AIZA 5CEZD 2CHZA 2SNMA 5I2IA 5DJZB 1AS8A 3C5JA 4LEBA 3DK2A 2X4UB 4E9VA 3BOVA 1TDQA 3APCA 1HSBB 3DMMB 3TH4T 4WU5B 1IKNC 2EDHA 3Q8CA 4CC4A 3EJIA 1M9SA 2D7TL 2IOOA 1ZT1A 4X4ME 4F91B 4I9XA 4RFOH 3U4AA 1T1YA 4L2YA 3FCGA 5FYKL 1G9ML 4FCAA 4FQ1H 3HE6B 3EGXB 3RMHA 3MV7A 3T13A 5A2QE 4JPVH 4CW1B 2P5EB 3ESOA 5C0CB 2YPLB 3EXJA 5ALCL 2X2HA 2BFVL 3LEVH 4LF8L 2AK4B 4JQXC 5NUCA 3A4FA 2RJMA 2EPBA 4JRXA 5I1HH 32C2A 2GVBA 4LB8A 1Y1DA 4MJID 5E8NB 5FF6B 2CIIB 3PWNA 5F7YC 2X4TB 3L5WB 4PLOB 1WEJH 3QC5X 1NCWL 4RIRB 4TNWK 1ONLA 5MENA 1CIDA 3QDJD 1E7ZA 2AQTA 2OI9B 3UZEA 2ERJC 2BNRB 3IS1X 3OAUH 3IDXL 4Q0FA 4E6IA 1U8JB 4HWEH 1C16A 3T3PE 1JHTB 1OAYL 2H1PH 3PJNA 2UUCL 1ZWIA 5IIEB 1HWWA 4NKDB 1NGPH 4JQIH 3TURA 1M05B 2DD8L 3VG0L 3S97C 3GRWA 3QXDB 3QVAA 4PREA 2TRYA 2DQEH 1KCRH 3QXAA 4ZMWA 2IQAA 3T3ME 4HU8A 2IQ9H 1CURA 4Y7NB 4CDDC 4IRZH 4XVTH 5GGRA 4GYBA 3UTZA 1CKNB 2XVGA 4M6OL 5DUML 1FNWA 3QUXA 4GUPA 3KL0A 4A3IG 2V7NB 4WFGE 5DJYB 2LV4A 4JDVA 5C07B 5KANG 3S37X 3VFNA 5MHSD 2F19H 2VDLH 1EY9A 4U1NA 5F9WC 1Y8NB 1XV8A 2AEPL 4DIXA 5FOJA 1H3GA 1P4IH 2JYOA 1CB4A 4K8RH 4U1MA 5M95B 3P9WB 1EUTA 3OZLA 5EUOA 3FFCD 2BNUA 3NJKA 4KFZC 4WQOA 5BZWB 3N1QC 1NFDE 1MF2H 1XF5A 3L3HB 3ZW3A 4G70B 3I70A 4BBSB 4GRWF 3W0WB 1JAEA 4ZAIA 2PCXA 4YZWA 3BSZH 3TGXA 3HHRB 1WCMH 3PIQA 2WXQA 4AQOA 2F0QA 1E6OH 4P3WA 4F57H 1PCSA 4WV1C 2BH0A 1NLDH 1EAJA 3MA9L 5FGBC 3SCMC 2EUWA 1TQCB 1E4WH 3O4LA 4PZ8A 1ACCA 1HEZA 3JYBA 5DTFA 1T04B 2YA2A 3EJJX 3UBFA 4I65A 3ESVF 1ZSDA 1BYNA 5E2TL 5KOVC 5E1AB 3QR2A 5I5MA 2O1AA 5IFJB 2GSMB 4M8UA 1NAMA 1YYCA 1TZGL 2GUOA 3FHAA 3P3UA 5FFGA 1H9SB 5ELDA 3FF8A 3T6ZA 3DLQR 1CL7H 5C8JB 4JKMA 1P16A 3D6GA 1I8LC 5INDA 1C9OA 4QQBX 1YUHB 5IYBH 4AM0B 3OWRA 4RSVA 5JHDD 3GDBA 2MPMA 5SWZB 1KXQE 2ZJRA 1WG3A 2OQJB 4LVOB 4XHJD 4NKMA 2IPKD 3MV8E 1FZJB 1KGWA 2VL5A 2YRZA 5DCCA 5C44H 1RJLB 2XWZA 1SXCA 2WBXA 4LWCA 3R1GH 3DXJC 4PVMA 3MRHA 5D1ZA 1A6WH 4P75A 2XBTA 1I4GA 2J0TD 2JA8G 1DANT 1C5DA 1DN0A 3QR0A 1BKBA 4NO3B 3UJIH 4Z77B 2TAAA 1XEDA 3QJFA 3S1QB 7FABH 2HLFC 2X4OA 3H1ZA 3ZHFA 2OMNA 4Y2OB 4DAYA 2TSBA 3QP3A 2BSTA 4K9EC 1KY7A 3CFQA 4KGJA 4BSWA 1SE8A 3GTLB 2BRRH 3AREA 3FCTA 4KMTH 1VESA 3M6DA 3LIZH 4H7VA 1TITA 4GNKB 5CP3H 4MB3A 5LDSA 1U8KB 3BU2A 1GHFL 4BY1H 3GI9L 3H0GB 4DK1A 1MUJA 3GPSA 3G9VA 1MHPL 4KY1L 4A3CH 3KJ4C 1AS6A 3TMEA 3R0NA 2F7OA 1BVLA 3VA5A 1U9KA 4R96B 4PG3A 1FZJA 1DR9A 1KELH 4Z1PA 1JJUA 2HHHQ 4LVEA 1VQCA 5JIIA 3GSQA 4JVZA 1Y6MR 3IU3A 3QARA 2E2HB 3MUHL 5HHME 2LGNA 2RBLA 2R7DA 4R8WH 3CC5A 3HPJB 3QO1B 1GSMA 1VZGA 1YDPA 3EHBB 3EJZD 4PJGF 4WKZA 3O3EB 1YO4A 2E9BA 5F2DA 1L7TL 4HV8B 3ATEA 3IRZA 2R8SH 4RGNB 3CVIH 3MNZB 1UM6L 3WTWA 1WAPA 2J43A 5M5XH 3O3BB 2O5JC 1JK8B 1P4LB 3OAYK 4L8BA 5CINH 1QKZH 4ONGL 2MKWA 3JZ7A 1ZS2A 1MNUL 2AERT 2UXVA 3LWEA 2V0AA 2WAQE 2VAAA 5CMDA 2DI9A 4PCKA 1A6XA 1TVDA 1BIIA 1EAPA 2HTLD 1G5AA 4UNUA 3CW2C 3MXNA 3L3OB 5MI0B 2BNUB 2UUBQ 1MSGA 1P7KB 2FE0A 5D96C 2R2EB 5E03A 1CF8L 3BKCH 4AH2B 5FFLA 3CDYA 3K8LA 3M7OA 4X7EC 1SY6H 4NZRL 5COYA 1CGVA 2EIFA 3TWYA 3R93A 2ZYSA 4DR2Q 2QELA 1UACH 5KG9A 4MA7H 1WWAX 4RCOA 4UTBL 1QNKA 5AVUB 2Q6WA 2Q76B 3TNNB 5IESL 5IW6A 4LNQA 5IQOA 2DQTH 3NA9H 4NQVA 5DRXB 3EYOA 4NXSA 3BAXA 1OTSC 4CVZB 5M9OA 1M1KC 4H8WH 4KKRA 4P9HC 2J1YA 1ZT4A 3NGBC 5IQ9B 1PXUA 3D6WA 1NEUA 3I6LD 3F2DA 5T3ZL 1WCQA 1DVQA 4QHKJ 4KKBC 2P47B 4DV6L 1XPOA 1O6VA 3DETC 3Q1SL 3IDGA 3HOYH 2LKVA 2Y5QA 4L48A 4OFQA 1E0OB 3VDYA 1RXLA 5EO0A 5C4JH 4UUJB 4LEOA 1GYAA 5E4AA 3L3OA 4RG1A 2WYIA 2GBTA 2DNCA 2B63H 3FU7B 4OF0A 2EE2A 4PY8I 1NCUA 1B9NA 2PP7A 1CFSB 3B1TA 3H9YA 4FI8A 1SEBD 4BFBD 4U0RB 4DR1L 5A2BA 1R3JB 1IZJA 5DEGB 3VCLB 1AW7A 1ILSA 5EN2A 5ANMA 1QLEH 2UY7B 3WUWB 1K3IA 2ZCHL 3GBML 1BOSA 1FZMB 1YZZA 1ZXTA 4CU8A 2I27N 3P3TA 3IGLA 5E08H 3SE4C 5H94B 4M6ML 4MD0A 5KVEL 2QHRL 1U92B 3MROB 1ONQA 4PJXA 5ICZB 3E8UH 4ABWA 5DUPH 3KOJA 4W70A 3TBWA 3UE1A 3WJJA 4Q97A 4MFHA 1MLBA 5DHVA 1NIDA 4U1KA 3F05A 5TFSH 3NIFB 4UM9A 3M4OB 2WP3O 3GB7A 4DQOL 1EIHA 3L54A 2R4RH 3ZRSA 5IJKC 4AGQA 5ESVA 1OXYA 3T2PA 1V05A 4JHAH 4IUVA 3LS5H 3V6OC 1AGCB 2YZ8A 2ZUQC 3C2SA 4JEGB 3S3SA 5LAPA 1MCCA 4NGHH 4D9LH 3EJTA 5EF3A 3DOHA 5FR3A 3C8KA 4XN1A 3ZTJG 5BXFA 1F4XH 1KZYA 4WK4B 1VKXB 2VZVA 2XN2A 5I1EL 2ID5A 3GKWL 2EYRA 5E6SB 4YSDA 4QXUL 4FMFA 1VB9A 5E0QA 3QIUC 3H9HA 1EQTA 1IAII 1BBDL 4ZRGA 4Y7OC 2ADFH 1IUZA 2ZXWB 3D4ZA 4N85A 4UDTA 5GJSH 5KS9A 2ICWI 1A4JA 1XCTB 3HHMA 3RFZC 5J8OA 4Z78B 1OLZA 1I50H 5GRVK 3MV9D 5LNDA 1NM9A 1AKJB 2FBJH 5ETUA 2ZXBA 3QFJB 3H0GG 5C2BH 4JRFA 4QTHB 3GNMH 2RA4A 1N8RC 2BNRD 3BDYH 3WFEH 4X9IA 3IF1A 3SPCA 4XNQB 4M1GH 2NX5D 3GXUB 2G75B 1FYTB 3ESPA 1S6NA 4CKCA 4JHWL 4A3BG 4R9WA 3GZPA 4M62H 3V4VL 4E41A 4X4YA 1FN4B 4PJHA 3UO1L 1RZQA 4K94C 3KBHE 3MRPB 3S3DB 4PTTA 4LASL 2A6KA 1B4TA 2DQGH 1XL6A 5D7EA 4TSSA 3WBDA 2XVSA 2HFGH 4HJ0C 3D39B 3MN8A 1SDDB 2YPKA 3CFIC 3TN0B 3W9DA 2JV6A 1RLWA 1FVEB 3S5ZA 2ZXEB 1S5FD 2FATH 1ZLVH 1OAJA 4DUYL 1GR7A 2CWRA 3OLDA 4ABQA 4MDIB 4JI0L 1GYCA 2KCCA 1BF2A 5K9OB 4JK0D 5JHDA 3NBHA 4FXLA 5I2YA 4D9QE 5B38G 1AXSA 2HT3D 4MB4A 3OF6A 2TMPA 4R4ND 1KAWA 3DV4B 3MXWH 3O0RH 3SQBB 4LRNH 3C08L 5FGCE 3S1NB 2X4NB 4Z77A 1YEZA 3D4DA 2LQRA 4OZGB 5D1XB 2G60H 1WVLA 4KDTA 1PDKB 1WZKA 5ISZA 3D8GA 5CM1A 5D93B 5EZPA 1PY9A 5IP9G 4G9DA 3VWKD 4WI6A 3WXWH 3FCTB 3DX0A 1Q0YH 2EH7H 2NY2B 2W65A 4QKTA 1BZ7A 3ETSA 2XPGA 1KIUA 3SDAA 5I8CA 1X3GA 4GRWB 4NO0B 4AEIL 3A6BH 3KWTA 2ZAIA 5FKPA 1TO5A 3ULVL 3PHOB 1MD2D 4N2GA 4XPAH 5CUSL 3A0OA 2YQ2A 1E27B 3EO1A 3OPZL 4DKAA 5AFAA 1FF5A 1EERB 4JI3Q 2W60B 4H25B 4KJYB 4F37K 3RVVC 2LLLA 5JYLA 4L3ED 1EWCA 2NUCA 1MI5E 3GTKH 3RVTC 4EI5A 2Y7QB 1LABA 3HLAA 4P2RD 4A2DA 5TSSA 1NCBL 4PMCA 1O9VA 2IPKB 3NSJA 4DAVA 3HOUH 4GLXA 3IYLW 4FP8L 2Q9OA 1RL2A 3WNPA 2WNKA 2J8UB 1CO1A 4KV6A 1CMOA 1HDMB 3ZR5A 3OJ2C 2VERA 3FW6A 1FGBD 4I0PC 1HOCB 2X1WL 2W65B 1X5IA 3VFUB 2OTWB 3DYOA 3CSTA 2VDKH 3KJ6L 4DK3A 4DEPC 1EX0A 3D85A 5EA0L 3KBGA 1F2XK 2N7AA 1JN6B 3HOUG 3TBBA 3U9PH 3PWJB 4C4KO 3ONAB 2VXTH 1PRTF 5IROC 5FEBA 1MJEA 4IGBD 1JZHA 1VGEL 3MFFA 4E41E 4XXDA 1STBA 1CLOL 1S7XA 3MLYL 4YH6A 1EZ6A 2IXQB 3WEMA 3IDUA 3T4AC 1RK1B 2V4DA 2E8YA 4DHLA 5JIMA 4UU9A 1A4KA 4S1DC 1NCNA 4Z7OE 1BVZA 3I6LE 3NBIA 2VSCA 5C4XH 4O2CB 1EY6A 3DUZA 2V1CC 5EKKA 5FW6A 4CL7A 1CFBA 1J8HD 2JJUA 4QRSB 1ICWA 3KWVA 4HPHA 3AM8C 43C9A 1QVGA 1N4XL 3JWDL 1DP0A 4GW5B 3U2JA 3I3DA 1D5XC 1UXMA 2APBA 3QZPA 1WCMB 2ARJB 1JXFA 3L17A 1H9JA 3PXHA 4A3JG 2QVKA 2P3YA 1DQVA 3AB0B 5I9QC 1CFSA 1U8NA 3SYAA 2CO4A 4CDHA 3AQQA 3HI6H 2Z0SA 5ICYB 4WNSA 4JAMA 3VB9A 2V2WA 3HE7D 5PCYA 5BUAA 3DM1A 3RJQB 2LFGA 2WBJB 2VLJD 1C5CL 4ZOEA 4CADA 2UWEB 2EEAA 3A3YB 3GMLA 2XWEA 3KLDA 4PJXF 4Z8FH 4MWFA 4U6XB 2PPBC 4L1BA 3ESUF 1JVKA 2WQSA 5DMYA 1E7UA 2N3JA 5TK2A 4YX2H 2OL3H 5D2LE 2VIRA 3OKMB 3U36B 1DDHA 3V9FA 4HJSA 5IVZA 5DRNB 3W39B 5HP5A 1WZ1L 1NMCC 3AB0C 3G5YA 5F6IC 5I1DA 1N59A 3B9KC 3O3AA 3GXTA 1SJVA 5FW7A 5ELNA 1OP5K 1IC7L 2R39A 4DH2A 5C4JB 3GMMA 2XTJD 3P02A 1A1MA 1RTNA 1H3PH 2CXGA 2HJFA 4TQEH 1M71A 2FJFB 3MYZA 4XPFH 4YY3L 1MCRA 1GCFA 1OAUH 3AFQA 4NDMB 4M7LL 1JGLL 2QADC 5CSGA 4AIZB 3L3JA 3O13A 1P7BA 3AT9A 5BVJA 1KIRB 4HW6A 3KPRD 1G7QA 4MTMA 3GXIA 4G6MH 5EOQH 5BS0D 2X6LA 1NMCB 1G7HB 2ENSA 4U3XA 1W6LA 1J9SA 5EZIH 4GKNB 2D7QA 2PCPA 4PNYA 5HHMD 4J3SA 3R2IA 2K78A 4IBZA 2PO6B 2W81C 2Z8VC 2JKSA 1JUFB 5CILL 3U2IA 1FFOB 2WUCL 4IPDA 4LCCB 4O5LH 3RVWD 3AFPA 2HRLA 3T77A 3BD4A 1YNNC 1CR9L 1QI3A 2FTAA 2N8NA 3K5OA 2CDGB 3U50C 3SD2A 5HDLA 3MJGX 4C3HH 3J7A5 3H4FA 3HG1D 1EFID 3IFLL 5SWZA 1GHKA 2XG4B 3BGMA 4MA1C 1N70A 1XJVA 1AZNA 2WCGA 3GSNB 3O2VH 3MJ9L 3T9WA 4DPAX 2AC0A 1E9QB 4U49A 1A66A 3D06A 1YAIA 2VZ1A 2X2JA 2WY3B 2WHVA 3QZWG 4MCNA 3BE1L 5C09A 1JDAA 1ZWIB 5PAZA 1SMAA 3QT2A 3OWFA 3O4OB 4XI5C 5BZDB 4AKOA 2ICEA 4DTGL 1P9MA 2HLEB 3L5HA 4DZBB 2FSEA 4LCVA 2D62A 4XCNB 1FZKB 1KPVA 4KKZA 1MZYA 3EROA 1GGCL 2ENPA 4BJLA 1TJIH 2Q5BA 3BHBB 3GXPA 3KL5A 4TQHA 4U673 3UJTL 3IKJA 2IWHA 4U6HA 5E4EC 4O51A 1FNGA 5CEZE 3TBCA 3I6KA 4OJFH 3PWVB 3NSFA 1TCRA 1DBAH 1JDDA 2MCAA 5A1AA 4W9EC 3EAKA 1M56B 1S3RA 2B1OA 3GBNH 3KS0H 3ARUA 4PWFA 2W0KA 4WJ5A 4Q14A 2A9BA 2DQMA 2X3CA 2JWYA 5KVMC 2JA8B 3UYRL 2CSPA 4YDLB 3CZSA 5F3HB 5A43C 2HTLC 3VRIB 5CEYA 4EN3A 3GTJB 3HEJA 4KK9C 4GSDL 3AABA 3T4YB 1N18A 1XH3A 3OX8B 4N0UA 1LHZA 2VY3A 2WVUA 4Q2ZA 1KBPA 1FG2A 2DDQL 1W0WB 4PRPE 3PWLA 3VXNB 3ZMNA 5GHWH 4WGVB 2OK0H 3WNMA 2QQKL 1XWVA 3L3KB 3GMOB 3FO0H 1EBPA 4UCFA 4TRPL 2A3TA 5DS1A 4D3CL 4A3BH 4EXPX 2Z91B 1K3ZA 3BWUF 3DUSA 4GKOA 4KXDA 1DQQB 5C71A 1TEYA 3HG1B 2Q3AA 1PTOF 2WN2A 2OZNA 3H7BB 3AU0A 1LL1A 5I8KH 3ZX1A 4DKEH 1NJIC 3KWWB 3S5LG 3UOAB 2JI1A 2K6WA 2MTAA 2EYHA 1GOHA 1YMMD 4CKVX 2H41A 1J5DA 3L3GA 3DO3A 2AJSH 1SHMA 1CI3M 4UP9A 2B59B 4WJWA 5GGQL 1S9WA 1HTLD 2WWKO 3RG1C 3TQYA 4U6VH 2MCG1 5FLXc 1Q4NX 2FEDD 3UJJH 1RJLA 3EO0A 2XFXB 2F0HA 5LGHH 4NP4H 3BISA 2HCZX 1NUFA 4Q4EA 3J81j 4ZMXA 1H3TA 4WFGD 1KMGA 4RETB 5CV4A 2R0WH 4KXBA 2AXJA 1VQ9A 5KSAA 1GZPB 2LHAA 2KPNA 2AMCB 1G87A 4S1RH 3GSRA 2WNXA 2GT9B 1JDCA 2W59A 2G2RA 3DVNA 1CK1A 1F11A 5BOJA 3FQXB 1HFUA 1QWHA 5EUKB 1BF5A 2HFEA 2CWAA 2XICA 5AWNH 4X4XA 3TDQA 1R33A 4ZS7L 5LNGA 1UEYA 2X88A 2EYJA 1HFNA 1FL3B 4KH9A 1IAOA 3QO0A 4DP2X 2OA9A 3NIGF 5ACZB 3DVIA 4U1LA 3MC0A 4RGOH 3ZBMA 3FCBA 3FTZA 2V6HA 2FT7A 4P2RA 1G51A 1VCBC 1DANU 5F7EH 1FA4A 1YY9D 1ZEAH 3A6OA 4ONFH 4XHJC 3O2DL 3RIFF 2R2CA 2AGJL 3HZKA 3U79A 2CQOA 1FSKC 2IV9A 3WIAA 1P7QB 3CFDB 4ELMB 3N1FC 3WFHB 4KN4C 1A22B 4ODHH 1W0VA 1X5LA 4S1SH 2G5BA 3INUL 1JFHA 4QRSA 5J1ZA 3DXAA 4UOW0 3DI2B 4IOAA 1D9KA 2A6JB 2CLZA 3OKEA 3OLIA 1OANA 3S1MH 2NSQA 3FOMB 1D2PA 1CL7I 4Y4KA 1QVOA 3D0AA 3GSNL 4LLVA 5BO1H 2HX9A 3DX1A 3GSVB 3WFDH 1ENAA 4AYMC 3CFCH 4FQQB 4AIXA 1DJYA 1DCZA 2W0FA 1PU0A 1G9MC 2NY1C 2PN5A 3SKMB 3OGCA 1BQLL 2VDPL 1SMYC 3ZIYA 5JPNB 5C6AA 5ELEA 5FGBA 1LO2H 1TY2A 3QIUA 5T5FH 5DURD 3VWJB 4Y4HC 3IXAB 2Z31D 3L0OA 1XTDA 4U1KB 4MTKA 1UWEL 2CIKB 3VYOA 4G72B 2EDRA 5FOBA 2EDOA 4WI7A 1FNEA 1XGUB 3QFJE 2KHSA 5F1OB 4QRTA 2QKIA 2JCCA 5F88A 3LKRB 3SZKC 1OOWA 4WJ3M 4HIDA 1JPSL 1LE5A 1DBBL 1FYTE 4GMTH 3F2UA 4PJDA 3D50A 2ZX9A 3NH7L 2K8MA 5HI3D 1KSRA 2HAZA 1SEBB 5C0JA 1CD8A 4N2EA 1PL3A 2Y4SA 2CUMA 5AVVB 4RZCA 3J80L 3RVWC 1H95A 2K75A 4NZUL 3KLRA 3QCVH 5GROA 3EW3B 3MOAL 5GIRA 3V52H 1T2QH 4KK8D 1F42A 3KPLA 4Q9BA 5EC2A 4P3CL 4I7AA 3HS0B 1CDJA 1LNUA 2KBGA 3L2LA 4RX4A 4UQEA 5J11B 1S3KL 2IAMD 4GKNA 1DQMH 3AADB 1QWYA 2BMKA 1HS6A 2HT4C 2XN9E 3QYNA 1NIBA 4X99A 2ZX6A 1PTZA 4LT7A 1G6PA 4OB5H 5JAVA 3L9RA 2BVPB 2Z6BA 1AZPA 4JI4Q 4WCYH 3IJHB 5I19H 1TVHA 3CCHB 3BYYA 3BZFB 3FB8A 3H94A 5IQLA 5T1KD 3FH7A 5I0DA 4YHYB 5IB1B 3NCWA 1T80A 2BOCB 4G7YH 5CN2A 4XN5A 2F3IA 4IRJD 3ZUCA 3D69A 3PXJA 1PH6A 3NACL 2KECA 1MWAB 4ZSOA 2ATAA 5C7ZA 3VFUA 1IEAB 2XZAH 4NLAA 3LQMA 3U1QA 5EQ0A 2VLJA 5I4DA 3HNVH 4TVPL 3T6QC 5I0VA 3WKPA 4HXBL 4OV6F 4JI7L 1KEGH 4WEMB 4AENA 5C0BE 5EORL 4TRDA 2J88H 4QRFA 2XKSA 4BWUA 1FZMA 2YD0A 3AS3A 1XIWA 4Z7NB 1PLFA 2CGZA 4FJYA 2WXJA 4L23A 5G4OA 1TS3A 3CF5A 3UTQA 4ELME 1AGEB 4G7OC 5I6NA 4H4NA 4KFMA 3RL1B 3SOTA 4G6JH 3W5NA 1XB6A 2AQPA 3MNZA 2OMXA 1AANA 3PGFL 2HUGA 4ORZC 4X6CE 3MRJA 3LH2L 3M17B 2AQRA 4UB0L 2EXWD 4XC3H 4YDVB 4AQ1C 2V9QA 4XN2A 1NCJA 1W15A 3QQNA 4GXVH 4YHLH 4ALAL 4PW3A 2ZAGA 5TJWK 1UWGH 2IH3A 2XXCB 4GW1B 4WWKD 1INDH 2NVXH 4C8XA 2B15A 2HUEA 4HYTB 2XWJB 2XRAH 2K7QA 5C09D 1RHHB 1XVSA 4HBCH 2IBZX 4BZ1A 5CGYD 3CQZH 3TZVB 5H8DA 4MAZA 1G4MA 5CSZA 1HZHL 1ZV5A 2Z8RA 3DARA 3DGDA 4MKTA 5AUMB 4HUVB 4HF5H 4LOUD 5L37A 5E6IA 2KJXA 4HZLB 1MG3C 3QDJB 2RSOA 3BAYA 4S0SD 4NFDA 3RJDA 5I8CB 2HIXA 3MGOB 3V0AC 3VFMA 5HI4C 4H8QA 4NKLA 1KN4L 5K36H 1RUQL 4GOPB 5CMAB 3UC0H 3KBPA 4OLYH 3T8MA 4ZMQA 1MFEL 2YYZA 2CMRH 1YLBB 2BSSA 3L3IA 4BBRH 1QABA 1SDAB 4G6FB 1MHHB 1KCSH 4OM0H 5C6PB 7TAAA 3N06B 1KYAA 2CA4A 5IMKB 2GBVA 1HUNA 2VM3A 3NZHL 2VXQH 4V1DB 4Z78A 2AQSA 3I6GA 5LGJB 3WAJA 1XIWC 2H0EA 4Y16D 4UDTB 5L4MA 4P5KB 3SGEH 1RSYA 1OWWA 2IH1A 2F0PA 1XH3B 3UE0A 4GXFA 4EN3D 3CMGA 3V0VB 1N34L 2BWDA 2F0DA 4MJ6A 2ZKYA 2F3VA 1EH9A 3PWPA 1YEDA 2YKKA 4J3UA 4IOSA 4WEUD 3UBHA 4GUQA 2X40A 4P23B 4ZAKD 5IG7B 3MREB 4ZFOA 2YSSB 2YEVB 2VDQL 3GMPB 5DVLA 2VDOH 4NJAH 4UQ2A 3CFKB 4CUCA 3TCTA 5IMLB 4CSPA 1ORQB 4PJ8A 4WNQA 3U4ZA 3PP4H 1VDZA 5LHDA 1ID5I 3K2UL 5FM5O 5FW8A 3QZWB 4PH8A 1N32Q 2DQCL 2AV7B 3K71B 4K23L 1Z9FA 4GN3B 3MCLL 4XNDA 4S2SA 1ENCA 1YDPB 3BRDA 1DO5A 1Q72L 3QFDB 2BSSB 3L3IB 1BQUA 3PQIA 3KPPA 2CBOA 3LKSB 3ZE0E 2HT2D 3V79C 1JQYD 4FG6D 4OV5A 2VJ8A 3STLA 1AKJD 3CH1B 3FO9A 3GFUA 3WD5L 5IJVA 4WW1B 4Y5VB 2NZIA 3MRBB 4L3EB 3P73A 2GN5A 1YHBA 2OXGA 3BAIA 3UTTD 1I1AA 1CC3A 5I74B 4N24A 1FFRA 2CK0L 3HMWH 3MRGA 1TTFA 1DEEA 4XNYH 2HQEA 5LG6A 2R2HB 5TH2A 5F97E 5EEWA 3NJFA 4AITA 1TETL 1YMHA 1E24A 1JPFB 1MLCA 1A25A 3B9KB 1I7TA 1IGFH 2VYRE 5HDQL 2YARA 1Y1WB 4P9HL 4U6YA 1A8JH 4YE0A 1G7PA 3Q6GL 4DK6A 4JFZH 5GSRB 2BY0A 5HD8D 3EJZC 3CCLA 4I13B 2QPDB 4N0CC 3QW9A 4N0YH 4NQEE 3T1HL 4F24A 3HRZA 4HOXA 3ZYOA 4J4PA 4X50A 35C8L 1YQVL 3RIFK 5AVXB 2XKNB 3BESR 4BY1B 3GO1H 4JANB 4C59B 1Z0MA 3KYNB 3KLLA 4JFYA 1SGKA 5D4JA 4ODXB 3KW7A 2F52A 3SPHA 5LWYH 3ALPA 2PXYA 2J7ZA 1U3HC 1SMYD 1G6RH 1S7RB 4J6IA 4AGPA 4TUOB 1I3VA 2ZWSA 3STZA 2WXHA 2G5BB 2OXGB 4KPHL 4PS4L 1M71B 2FJFA 2R4SL 4XX1E 4OVUA 5IGDA 3RLOA 1I4QA 3RQ3A 5EPKA 3C2PA 1PY0A 4YHKL 4H8WC 4I3RL 5E7BA 5LBSH 1AJ7H 4BKTC 4NN7C 1Z3GL 3GJFA 1WIPA 1UTDA 5CEXA 2ESVD 4F9LA 4X3TA 5EUOF 3FKUS 1IQDB 4RNRA 2C9XA 2C7FA 4GKLA 1YEHL 2WQRA 4ZUTB 1T20A 2NT1A 1NCCL 5LVEA 2YSTA 1JFQL 2D03L 1AC6A 4IHBA 3VCLA 1KNOA 3EDJA 5AEAA 2XDHA 4A3FH 5JIHA 5L4IA 2Z92A 1RKNA 3QIUD 1Q3LA 2CHBD 5LN8A 2ZZUT 3T3PB 5EOTB 2YEZA 2ALYB 3EDFA 4JFSA 5CCHE 1TNMA 3E6FB 3MLZL 5GIRB 4AYGA 3PLYA 4HIIB 1OWRM 1MAJA 3MJ8B 4KTEL 3HZYA 2FHCA 4F7CB 4CBVA 1W0YT 1MNNA 4RFOL 1BAGA 4KGLA 3PQYB 2Z0UA 1ZHLA 4GAYA 1WTPA 2FVNA 3K2MC 3NFSL 4BKSC 2RA1A 5ALCH 2K7VA 1BXUA 1RP8A 1OALA 2WIIA 5KZCD 1U4MA 2X4UA 4BQ9A 1PH9A 5D70H 2ZUXA 4Y5VC 1HHGA 1DFBH 3RKDC 2DY8A 1LVEA 3FO1B 3QEHB 4J1MA 4KX7A 4XP5L 2RDFA 1GYUA 1LT3D 4ZTPH 3VXMB 5FDWA 1C7TA 1PZSA 2DOCA 2FWSA 1URIA 4WTWA 4J8QA 1EY0A 1HEJC 4XP1H 4LF5Q 5JA8B 4X80L 4P2OA 2XN9A 1W91A 4L5FE 4ISVB 2OTPA 5LO7A 4JRXE 4MHHI 3BXNB 1F00I 3GK8L 4BFGA 1EAQA 3UAAA 2GK0A 4HEME 4PW4A 3JBG7 4QHKI 5JW4Q 3PO2H 3QUMH 1BFSA 1WS8A 1E2ZA 3BVXA 2ADIB 4RA3A 5C4HA 5H37A 3P1HA 1KDBA 3F6IA 2FQGA 4Y7MA 3FB6B 3QEUB 4LFBL 2WAQB 1AC0A 5CEYB 1M7DA 3FN3A 4MXVF 4YHHL 4P46C 3V7AG 3WEOA 5SWSB 1VQHA 2EIDA 1UEAB 1R3HB 2WVVB 3AC0A 4A2MA 5KYYA 1OGSA 1IBFA 4JFDB 3SKOA 4U1JB 1OCOB 2X4OB 1PQZB 5AW1B 4NENA 5CV8A 3NELA 3CVHA 1RTOA 1DL7L 1XIWB 3QDAA 2Q8BH 3MKGA 2WBJD 1DSWA 3FFOA 1NDMA 2YZ1A 4M4RB 4ZFGL 4YGVA 3ARDD 5TDOA 1HESA 2Q87A 1CU4H 3D0LA 3CZFB 3Q2NA 3RU8H 4M1CD 3GTTA 1BZ9B 5HD8C 3BSZL 3ELQA 4GNXA 1S7UB 4DP5X 3C60B 2XT1B 5DHYB 5KW9L 1MH5A 3QYMA 4WU7B 1B8AA 4YDNA 2LE9A 4HSPA 3FO2B 1RHFA 4JFFA 1E9OB 1XGTA 2JQZA 1S9WB 3G6AA 3CHPA 3GYRA 1QNZL 3KH4A 3F2BA 3N9GL 1HWHB 2NN6H 4LDCA 1XF3B 4JKKA 4YHZH 5F9OL 4QY8B 4P3DA 2AABH 3K6SB 2CALA 2VDRB 3NCMA 5IJCC 5JW5A 4I48B 1M7DB 5D1XC 4AIMA 2FQFA 4WDIA 3L3HA 2JK8A 5KJ4A 4ZX5A 1PZJD 2X9WA 3F84A 5HHPA 5JW3H 2OMTB 2OZ4L 1VEPA 1A7NL 2R7EB 3JTSB 4H26B 4PD4K 4HR7B 4PJBF 5KOMC 3CVBA 2E2JH 5ITBH 3AXIA 5KS9F 3D3VA 5I2XA 2V5TA 3PV0A 4ZYSA 3FQ2A 2QPSA 1KBGH 3G5WA 4I8DA 4LOEA 5FK9A 5ELOA 4V1DD 1KGYE 1KJ2H 2BERA 1LGVA 3GSXA 3U0TB 3VI3F 1CDGA 4G7HC 2NY5C 1DGSA 4JRLA 4UT9A 2CDEA 3HG9A 2OX5A 3TF4A 1RZFL 3LY6A 4GO9A 3P75A 1SXZA 2KOLA 1Q1BA 1T3FA 1IC1A 1KLUB 2RKSA 4UT9L 4BFIB 1IAOB 2WBWB 3QO0B 4LFHG 4DR3L 2QA4A 2TRHA 3PU7A 4ZO9A 3OHMB 2N1TE 4JI7Q 1KEMH 3N0PB 3KZ8A 4X42A 4HSVA 1BXVA 1KFAL 1OKEA 3T0VA 1LLAA 2BRRL 4JE0A 2MEJB 1I4PA 1BQRA 3EH5B 5D4HA 4WY7H 3HOVH 4B9WA 1TMCB 5EEZA 2XV6B 3SEPA 2YPLD 1CGWA 3T4YA 4K0KL 2OS7A 1NDTA 2CHNA 5FO7A 5IOKA 1GGTA 2J20A 2WIIB 1IBBA 2Z1KA 4MQSB 2CE6A 1A7OH 1SYVB 2B39A 5C3EB 1TIID 4J6RH 3GMNB 4JCVE 1JWMD 3WG7B 1JHTA 3GIZL 1H6EA 1OE2A 1E43A 3HR6A 4LF4L 4IO9A 1YEJL 4HIEA 1G84A 4IK7A 1O7DC 2E47A 2A4EA 2J1ZA 1XB8A 3CGTA 2V2TB 1LTXA 4EN2A 4NZFA 3CHRA 1Y8PB 3CPWA 2W1NA 3JV4B 3ZO9A 5ID1B 1U42A 2FQDA 4XNXH 3BXNA 3BSGA 3VDCA 3B2UC 2FWLB 4HOZA 4IBLT 1ZT7B 2LT9A 3EJRA 1MRDH 2CD0A 1TT2A 3HUJB 2C3HA 3MSPA 2HLFD 4UUJA 2Z34A 3UG3A 3ZDZF 4CJ1A 5EO0B 2WWMC 2IXQA 4F7TB 2V3EA 4DN4M 5IB5B 2FJGA 1PFOA 2IADA 3RPIA 3SQOH 2V3DA 4F9PC 3L4CA 1CE6A 4IJ3B 1QI5A 4HH9A 2LVCA 4A3GB 4PJ8D 4IRZA 3LXAA 4GSUA 1P7QD 2QVFB 4PLJC 4YPJA 3B8SA 4KKLC 4JG2A 4OFVA 2F53B 2XPYA 3MLUL 3JTTA 3UIZA 1KLGB 3WOEA 2ZUUA 2GSIB 1SJHB 2RQ8A 3MFFB 2Y23A 4IPHA 5B22A 4ENED 4A3KG 4NO5B 4XGZA 3V0WH 2ESVE 2ZOOA 4MQTB 4X5WA 5CFAA 2V2TA 4ZLTF 2AKWB 1TMQA 2JMRA 4KROC 3OAYH 3GKZA 4H88H 4Z5RA 2CPUA 4ZJ9A 4BXSV 4RMBA 2X2IA 1THCA 4XVSL 3D2UB 1X9RA 1LWRA 4S1QL 1W72H 5KANI 1JZ8A 2IC2A 1ESFA 1DJRD 5IROA 2PNHA 4GT0A 2XRSD 4K14A 4I18A 1M7UA 3O9WD 3SSGA 3VGGA 5FXCH 1CLYH 1SOKA 3FOLB 4UTBH 3MLXH 4PRID 1B53A 1PD0A 4NQTA 1I7ZB 3QG7H 2VW6A 5FUCC 2DQTL 3V6OA 4QHPA 2EUZA 5DRNA 3W39A 4I0PA 4OWXB 1CLZH 2K3HA 4WI4A 4M61B 4GBXC 1KZQA 4OI7A 4C3IG 1TZIB 1G7LA 3KYKL 1KIPA 3B6SA 2WAQG 2Z35B 4O00A 1HZKA 3WAKA 3UAFA 2WLHA 4V11A 3BW9A 1CGSL 3F01A 3QDMB 5DJ0B 5AAPA 4N2BA 3QDGB 4HQQL 2ITFA 4PJ6A 4OY9A 4YZFE 5BRZE 5IGCA 3RWEA 2VIRB 3GMOA 3OGCB 3OKMA 4N26A 4RMWA 2Q2LA 5BRZD 3U36A 4GKJL 1NNXA 2YEQA 5GGTA 2JJTC 2YFNA 1O78A 2EYTB 3OB8A 1LD9B 3R06B 4L1TA 1QRKA 2HWZH 1QSFA 2D2OA 3RLFA 3ABMB 5I1GH 2P8LB 2XA8H 3LZLA 4XQQA 3NEOA 1D6VH 4LEXH 1IRAY 1SMDA 1U91A 4KQ4L 1F3DH 4OCSH 5TF1L 4XCYA 2ZXDA 3D5OF 1P4UA 4S10A 4YHHQ 3MODL 3FFCA 1VQKA 1EQWA 5IF0B 4QJ5B 2CDFA 1PG7L 2IVFC 2XQYA 1JPFA 4P2QA 5IHZB 2E0PA 3L3OC 3TM6A 5KVEH 4QHNB 4YHMH 2EDQA 3L7FA 3OSKA 2VXSL 1ASZA 1OP4A 1OW0C 3RWGA 4R8NA 3A21A 3U9WA 4NAMA 4V190 3FKIG 3CMEA 1HRJA 1AD0A 1I7UA 3Q6FA 3SCMD 1JHLH 3PWJA 5GXBB 3Q22A 1T7ZA 3UDIA 3FUFA 5JXEA 4WTZA 4L4VA 5GGRY 2AZAA 3EG9B 4GQRA 4XR8C 4DZBA 4PJAB 3PUCA 3A7LA 5EZLB 3TIDA 4POYA 4YHIA 3LS5L 1SNCA 1UT2A 3UP6A 2M2LA 3VYRA 5K9QG 1J0HA 3IMBA 4YCUA 1X5XA 1F6AA 3IMUA 1F9QA 3ZT7A 5EU3B 1IIKA 3DX6B 2X1QA 3P4OA 4AE0A 5I73C 1AHMA 1TKWA 3KPQA 1INQB 2V33A 2CO7B 5GAHC 1YPZB 4J8RA 3T71A 3NABH 3V0GA 4AGNA 4G82A 1L1OB 3F58H 5FUCE 1K72A 3TEZA 2GW5A 1RIVL 4PRAB 3G6EA 2YSSA 1FL5A 2YTVA 5FYLE 4HKZB 1WSST 4L0PB 3NJIA 4QHNA 2X4RA 4IDLA 1A6TB 1XGQA 4G8AC 5E1AA 1UD5A 2CFMA 2CJSA 5TPWH 4JG0H 2AQ3B 2EDJA 2YD1A 3CX2A 4X7DC 2HLAB 1OTTC 1AP2A 2F0TA 2MWCA 3F7VA 2JELH 2LABA 3MEHA 3TN2A 3DPBB 3M07A 3QWOA 4BHUI 1H8SA 2ODIA 2PZTA 4L6TB 3AXLB 5AVSB 1HJPA 4DAYB 5SWZE 2K4WA 4EOWL 1AGEA 3PHOA 4NN6C 4X5WB 2RCSH 3I4MH 4JPBW 4JO1H 2C5DC 4KUCD 1B4LA 2WZPD 3SDDB 1NPJA 4KV5F 4PZ7A