4FXGC

Complement c4 in complex with masp-2
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
287
structure length
287
Chain Sequence
VVEEQESRVHYTVCIWRNGKVGLSGMAIADVTLLSGFHALRADLEKLTSLSDRYVSHFETEGPHVLLYFDSVPTSRECVGFEAVQEVPVGLVQPASATLYDYYNPERRCSVFYGAPSKSRLLATLCSAEVCQCAEGKCPRQRRALERGLQDEDGYRMKFACYYPRVEYGFQVKVLREDSRAAFRLFETKITQVLHFTKDVKAAANQMRNFLVRASCRLRLEPGKEYLIMGLDGATYDLEGHPQYLLDSNSWIEEMPSERLCRSTRQRAACAQLNDFLQEYGTQGCQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Complement C4 beta chain
publication title Structural basis for activation of the complement system by component C4 cleavage.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 55
structure length 287
sequence length 287
chains with identical sequence F
ec nomenclature
pdb deposition date 2012-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01759 NTR UNC-6/NTR/C345C module
C PF07677 A2M_recep A-macroglobulin receptor binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.120 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4fxgC02
2.60.40.690 Mainly Beta Sandwich Immunoglobulin-like Alpha-macroglobulin, receptor-binding domain 4fxgC01
2XWJB 1BQQT 1UEAB 2I07B 2A74C 3FRPB 3CU7A 5FO7B 4LNVA 1D2BA 4FXGC 4D94A 3L3OC 3I70A 1BV8A 1JB3A 1JC7A 2A73B 3CKIB 1EDYA 2TMPA 1GXDC 2XWBB 5JPNC 2QKIC 2E2DC 3HS0C 3OHXC 1BUVT 2B39A 3KLSA 4FXKC 3V96A 5JPMC 1PXUA 2WIIB 2ICEC 3HRZC 3G6JB 1AYOA 5FO8B 1BR9A 4ILWA 2J0TD 1UAPA 1OO9B 2WINB 5FOBB 2PN5A 3MA2B 3T4AC 5FO9B 1XWEA
chains in the Genus database with same CATH superfamily
4XPGH 2A1WL 4BBSH 1L7TH 4RKLA 1A8ZA 2V2XB 1CLYH 1F8TH 3T51B 3F8TA 4CBZA 1CN4A 2ADIB 2R7EB 4JGNA 5IJDC 1ZRUA 3NJJA 2A73B 1WGVA 2C35B 1OEZW 1EV2E 2B59A 2V8MA 5AW5B 3HOYG 5J6HA 3KLHD 4QAMB 3HHSB 2GG1A 3C6SA 3HRZA 2CIIB 5I6OA 3LGJA 3QISA 5G55A 4E41A 4YBQC 1IBKQ 4XQNA 2KUTA 4NENB 3GM8A 2V9QA 2XLLA 2YXFA 3AB9A 1FSKB 2E9IA 3IDXL 4O5LH 1V43A 3THMH 4WWOA 4UYPA 3N2JA 1UGKA 3UAEA 1P6AB 4FXGA 4PZ6A 4M29A 2OKMA 4AJYV 4OCYL 1R33A 5HGHA 3EJUA 1C0AA 3RX9A 1HHHB 1GS6X 4HPOH 4P5MB 5IT9L 4YHNB 5LVEA 2VXTL 4LSQH 1QFUH 4B3SL 3BAYA 2YBRB 3ZQWA 3CWGA 5F70A 1H8LA 2IALB 2XU9A 3DROB 2X2IA 3A67H 2WYTA 5HGAA 4ODHL 3ZKSD 1PKQE 1EAPA 1JSYA 1TQVA 43CAA 4P9HC 4APXA 4UOJA 1EYCA 5E2TH 5FW7A 2J8UA 3EFOA 5LGJB 1UXMA 3DXAB 3QYCA 4MD5B 5J1AB 5F3BB 3QQNA 2EC9T 2A6DA 3OAZK 4YVNA 4KRPC 3IXAB 2NCMA 4R8IA 1XGYL 2C9QA 3E6FB 4ODXB 4Y4HB 5SX4I 4IBVA 3I2CL 1G7MA 1K5NA 4M48H 3LN9A 1ZGLM 1FNLA 3DVGB 4F57H 3SGDH 1DXMA 1QSFD 5IEKB 1CVRA 4G83A 4O58L 5IP7H 3KDFA 4WKZB 2CGZA 4Y4FA 2Q3ZA 5IBUG 3DXJC 1E9QA 1BF8A 3U46A 1ZT7B 4UTBL 2ADYA 4R7DA 3RLFA 3FCUB 4WU7A 2WBJC 1XL4A 5ITBL 4N5ED 1IX2A 3S36L 4IUQA 4AQAA 4OZGE 4B3RQ 4PJ5D 3GV3A 1DQKA 4BQ9A 1GC1H 1E27A 3IDGB 3ISRA 1GOFA 4YN3A 2DMGA 1G0XA 4PJ7B 2XPYA 1NCOA 4WHTB 3VM7A 4GXUM 4BY1H 4FABH 4DKFH 1J5DA 4Z78A 3MLPA 1PVOA 1HJPA 1IC4L 3L9BA 1QO3B 1ILPA 2F53E 5MEQB 1QUPA 1RIHH 4DO4A 2BSTA 2GVBA 1A1NA 4N25A 4YLQT 4YHKH 5FK9A 4LF5Q 4YHML 2QR0B 3QYNA 3BSGA 1IILE 4CADB 3QRGL 4PFEA 5IYBH 3K6FA 4KKQA 4CVZA 4ODTL 1O7YA 5A7EA 3CG8A 1NGZB 5GS1C 5ETUB 5CEYA 5J1TC 2ZUSA 3WL9B 1T2JA 1OP4A 3CUPB 3LQAL 3MRIB 3WJMB 4PJEF 3UXFA 4P2RE 4HEMA 3HNTH 1WBXA 2VQ1A 4Y8AA 1R9FA 3S3DB 1IEHA 2BRQA 3X13B 3CVIL 3ABKB 5MEPA 3QUGA 5E6YA 4LASL 1KFAH 3H3KA 3U30C 3TFKD 1HHGA 5T1LA 3KPSB 1STBA 4HMIA 4KD4A 3V2TA 2GJPA 3TBSB 1QR1A 3RDTC 1MI5B 1N7ML 1S7VB 2HLFC 3NQTA 1N8RC 1JOQA 1KENH 2AXWA 3ZDYB 2XWBA 4A3DG 4HEPA 4NM8H 2R15A 1CWVA 3STLB 2DV6A 2DQFA 4UIKH 2A4ZA 2AXFB 1FGNH 5GGQL 1KDCA 2AW2A 3SKMA 2NZHA 3GXTA 1LQSR 2NLJB 4MQXD 4LVEA 3MYJB 1D6VL 4WF7A 3UDFA 4NQXB 4GN5A 2A4CA 2FEEL 2HT2D 3KYOA 3QEGH 5ERWB 5FECB 5LL6X 3DUHA 3LKPA 3BPCB 4U1NA 1OM3H 2HVKB 3QBTB 3K57A 3D33A 5B8CB 5MI0C 4Z0BH 1JPGB 1GZHC 2NTFB 5JJKA 2GK0A 2WP3O 2X6VA 3ARDA 4WJKB 1MVYA 3MR9A 1F77A 4DZBB 5COYA 3K0YA 4WO4D 1ZLUH 3VFPB 1PAMA 3TPKA 1QNIA 3TEUA 3NHHA 3V4PB 1WZLA 1A7QL 5FWRA 5FUCC 1HN1A 1QRNA 3NESA 2BW5A 3P4OA 3DSNB 3JWDL 3CDZA 3DARA 4IDLA 1SVBA 4L4JA 4QXWA 2E5EA 4U0RC 3Q7JA 1AE3A 3MWYW 3S24A 5CBEE 3U9OA 1MIEH 1NCTA 2JH2A 3L7EA 1UD5A 2A9AA 4LCYB 4YZFE 1BQKA 1HHJB 3IDIB 4GBXA 2F0PA 1GYWA 1X5XA 4WDIB 1T6BX 3GIVB 3MMEB 4YEFA 3KPPA 3NN8B 1D9KD 3I85A 1T20B 2HLAB 4OZIF 2D7MA 4DW2L 3RVXC 2PQEA 4GOPA 3NCYP 3CPFA 4O02A 3I3CA 5FGBA 4DPAX 4EJ1C 2BERA 5E08L 2UXDL 4G5AA 1T66D 2KZ1B 4X6FB 5HYQB 4QRBA 2ZUTA 4DV0Q 3WNJA 3FH5A 3HPJB 3K72B 4PB9L 1NEZA 1Q9LB 2ZUXA 3L4TA 2Y69B 3TYFA 5EO9A 5DHEA 3SCMC 2OLDA 2XWDA 3IRBA 3SE8L 3H4HA 3RFRA 5T3ZD 3BFQG 3UTZB 4W4NA 4DP5X 1KPUB 2YK1H 1GHFH 1PZ5A 7PCYA 2NN6H 1KV3A 5MHSD 2Y7SA 4BH8B 3CCUA 1PZCA 4LCVA 4LJZC 5CJOH 1OCWH 3OJDA 3HR5B 4PVBA 5J57B 4NT6A 3O3DA 4JM0A 3SEBA 4ODWB 4QUOA 1XB8A 3M1OA 1RXLA 4JL2A 3UI2A 5HGBA 3EJTA 1ZLDA 1MCKA 3LRGA 5HYJB 2JB5L 1E6JL 3QJXA 1AQMA 4LCIH 2B2WA 2J4WL 4TYUA 5DS8A 5GRUL 3VI4B 5J12B 3B2VH 1BIIA 3CMOH 4J1UB 1JGDA 4FI7A 2EVBA 2OJZH 4LLQA 2YQ2A 1VFMA 2XWJB 2VMCA 1WLHA 3CZEA 1U8KB 1UWFA 2F0JA 3GD7A 2OV0A 2ZOKB 2WXOA 3MX0A 4NUJB 4XCNA 1QFPA 5G5DA 2OP4H 4P49A 1OP3H 4X42A 3NZ8B 4Z76A 1BFVL 3SXHA 1DLHA 5EG6C 2FZ3B 2ZWYA 2DQUH 2AI0H 1NPNA 4PLJD 5C9KA 3Q6SA 3SDCC 3UAJD 2DYPB 3GF8A 2ZP0T 5EPLA 4ZMVA 1YNJC 4EZLA 2QQLH 2A69C 2HKAA 2IMNA 3WMQA 1MZZA 2V37A 4HKXB 1OTSD 3C5JA 3RGVB 1ITBB 4BUGA 4LHUB 2PXYA 2OYMA 2ERJC 4ZXBB 4KQ3H 3VXPB 1HINL 3DJSA 3G6JE 2EABA 5K9JL 3RWIB 1RK1A 2IGTA 3ZL4L 4P75A 3QXAA 1KGWA 1V1OA 3B6SB 3Q1SL 1N6QH 2ATKB 3VFRA 3N6RA 3EYVA 4V1DD 3O6MH 5DHVA 4GKLA 4BM7A 4FO2A 4LF3A 4GRLD 3IFPA 4J6HA 2BS71 4KJWC 2UXBL 4QIRA 1FFNB 4DN4H 4YHHL 2NTTA 1MFCH 4EI0A 5F6IB 1AP2A 4GKNA 1PHJA 4ZX6A 4OH2A 5FLVA 4XO9A 3SDXE 4OIIL 1T1XB 2WQ8A 2IPTH 3TH4T 4WW2B 4I5BB 1LM0A 1Q94B 4QY8A 2EYRB 1W2KT 1L9OA 3DPBA 4WJ5A 3BEVA 4JG1L 4U31A 3GSRA 3RB7A 2K6ZA 4NOBA 4R7NB 5IV2A 4F8LA 2X0UA 3ARBA 3CFDB 1OF0A 4DUWA 1QP1A 5IWLA 3X3FH 3O3EB 5CCKL 1UM6L 4DR7L 1JK8A 1EX0A 2Z1CA 3RLNA 1BZEA 1OE2A 1WF5A 4KKLC 4LQFL 3VWKC 3QPXL 3CRLC 4XVUC 1IT9L 3BD5A 3MUUA 4RMUA 3T0EC 3PL6A 3VXME 1BVNP 2K5WA 4KH9A 1VQAA 2W91A 2NRDA 1F6AB 3QCTL 3NACL 3D31A 1TTGA 5IJCC 4NQDD 1VQJA 3IMUA 2DB8A 1PKQB 1EANA 1YEFH 3L3OC 2R7ZG 4OQTA 4Q74A 4XBGA 4P2OC 5IUSA 3FP9A 2XQ0A 1LTXA 4RMTA 3CH1B 2ZM6Q 3V6OA 3GI8H 3NCJL 5BPPA 1K85A 1I7UA 2FHCA 1JDCA 3TO4B 4PRID 4Y1AA 3HEIB 5KWYC 3VRJA 2HG5B 4A3BG 1Z2KA 1OD9A 1L7TL 5I5RA 4QAWA 3QWRA 1CLYL 1F8TL 4EIZC 4KUCD 4U6YA 3C46A 2K1MA 4PJCE 3VFGH 1EBAA 4JCWA 3VYTA 4N2OA 3QI9C 2O5NA 4IS6A 5JOFB 4AZUA 1U92B 4CA4A 1PH6A 2X4SA 3EFFA 2JYOA 1UM5L 4IUNA 3CQZH 1DL7L 3HVNA 4HWZA 4UT6L 4Z7UA 3U6RA 5BS0A 1N3NB 5CFAA 3PIP3 2O4XA 3GJFH 3ZE1E 5F7HA 2DBJA 4JM4L 4FCHA 3F65A 3L2MA 1IYVA 3LHPH 1LK2B 4O5LL 2QKIC 1J0YA 1ZTXE 2C1PA 4ZQ3A 2UUCQ 1CGUA 1M7XA 4OZGB 7FABL 1AQ8A 3WFEL 1Q81C 2VYRE 3OKKA 3L3JB 3VXSE 1JWMD 1VMCA 3DA0A 4HPOL 1GYCA 1FIGH 1DUYB 1R34A 2WXHA 3UTQA 1GO3E 2ALYB 2CHNA 4JVWA 1HILA 3I4OA 2I69A 3BH9A 2CBPA 5EWIL 3H7BB 5E94B 4B50A 3N40F 2MNAA 3I7FA 3APNA 1BJ1H 2EIJB 4WHDA 4AYFB 4HPHA 2I46A 2JQAA 1WD8A 3MZTA 4KK5D 4EVNA 1KFGA 1CLZL 5C0IA 1ML0D 5E2TL 3VXUA 1NIEA 2WAQG 5F8RC 1WD0A 1AEXA 3H7LA 1W16A 4MLSA 4OZHF 4YWMA 4YX2L 5ACLA 3H3PL 4JFQA 2B14A 2NXZD 3FQXA 3POCA 2MPAH 3KGTA 3L4UA 4DP0X 4JGMA 2X9YA 4N90E 1D3CA 3D7PA 3IRZA 3WHE0 5A6LA 4P2RB 1I8LA 5JMRA 3NZHH 4M48L 2HJFB 4Z8FL 1UD6A 1YEIH 2PNDA 4BE5A 4F57L 1F18A 1U8CA 3RY6C 4HIQA 5LBSH 2VDLH 3RG1C 2EDWA 4QHMA 3ZE0E 3GSNA 5A2FA 1KIPA 3BEWA 3DVFA 4PRNB 5JJIA 1B4JH 4QRUB 2VSDA 3QXDA 3PWVB 1Y18A 1WFMA 3EADA 3KDMB 1AOZA 2GHWB 4PGBA 1PH5A 4L9LB 3CAMA 1GC1L 5JQ6H 3T8XB 1IKOP 4J3OG 3U4BH 2Q76A 4B95C 1K28A 1FNVA 4KK8D 4FABL 4DKFL 4OWXB 4ME3A 4Q4IA 3OJVC 5I1JH 4LKXB 1IW7C 3VGFA 4HN7A 2KBGA 1MN4A 3QJHB 5DD0H 3GB7A 1LO5A 4MXWH 5I1IH 5JUEH 5C3EH 5KEEA 3AW5A 5CZXD 5DR5H 3MYZA 2Z4QB 2WVUA 1OIOA 3IU4H 1F1AA 3ZT7A 4XMZA 2K9FB 3NPPA 4H13C 4GKKL 1VEOA 3OMZA 4HS3A 3RD4A 4FDBA 3VYOA 1NC4A 4AIXA 5LGHH 3O11B 4GRMA 1TZGL 4FFYA 2EE1A 2Y5TA 3TO2B 4ICWA 4UTAH 2JK8A 1JMXA 5H37A 4K94H 2ZOLB 3K5OA 2XJLA 3OYYA 4HJJL 1P5VA 4LF9L 5CBEB 4L8BB 3CVHH 5D2NB 3AT8A 3P20A 5J11B 3H6MA 3GTMH 1KFAL 4ATWA 1GA2A 1QJOA 4HLJA 3BGAA 3BP6A 1GRWA 4M4PA 3MRGA 3I6GB 3IJYA 3ULUC 1EUJA 3AG2B 1NC2A 3QCVL 1BBJA 3QR8A 5KBKA 1F2YA 1KENL 3LSOB 5J13B 1OPGH 4MTMA 1B0WA 1OT2A 1SFOB 2QDLA 1GAFH 3TNMA 3T2NL 3CHPA 1GGTA 3Q6GH 2ZWSA 4HUUB 3HI1B 5DYFA 4OLXL 2AK1H 4Y2DD 1XF2B 4KRLB 4UNIA 2YD8A 2X4QB 1LILA 1NANH 3I75A 4JFDD 4KKAC 3SK4A 5CILL 3AT0A 4ELKB 3NJMA 5LNEA 1UCTA 4S0SD 1II3A 4AEHL 1OM3L 1KN2H 8FABB 2C34A 5A2IH 1PZUB 3IL8A 1FVIA 3AM8A 5CV6A 3KR3H 1HR0L 2NNXA 3FAWA 2NX5A 5IGCA 3KPRB 1B53A 3QO2A 4L5RC 4HHGA 3K7UC 3NJXA 1R5VA 1I7ZB 3LKNB 2FX7L 2YA1A 2ROYA 4S0HA 1TWCB 2G3NA 3EG9B 3HZVA 3MGAA 3PDOB 1EXUA 2VAJA 3QR1A 3BPOB 4WUKL 2YPVH 2F68X 1CZWA 3X1FA 4CRPA 1U3HC 4MD4B 3ZQ9A 3HE7A 8PAZA 1NAML 3NAAL 1G6VK 3BP5A 3DRQA 1KOAA 3CE1A 4LDOB 2IAMB 2VO8A 1ND0A 4HWNA 1TWAH 5K9QG 1SDDB 3ULUE 1UFUA 2LABA 4JRXB 2Q3XA 1P84K 2O1AA 3OHXB 2RAMA 2X44D 4ZUVA 3OXRA 5I66A 5DD6A 4BV1A 1QR1B 3FPPA 5L8JB 1PLGH 1BBDL 1URLA 4JY6B 1W91A 2R56H 3WEXA 2XWBB 3B7UX 4QJFA 2BFGA 3LPOA 3NSWA 3IWVA 4X98B 4LL1A 1WTGT 4X83A 4F7MB 4MYWB 1QRKA 4JPIA 3BUQA 4FTVE 4N2MA 5IWAQ 2WTOA 3G6JB 3ULUF 3BVNB 3UC2A 2DIJA 1OXYA 5JIIA 1YITA 1B9NA 1EH9A 4PZ8A 2YK1L 4KTEL 4RISH 4ZW6A 2IL8A 4DNLA 2NUCA 2ZWNA 1RU9H 2C1OB 1MH5A 3VQMA 1HNYA 5CJOL 1OCWL 4QLWA 2OL3L 4WI9A 4N2NA 1HCVA 4NO3A 1XH1A 2VABA 1ADQH 1F4XL 2AWNA 3FN0H 5E9DD 3VXQA 2XWTB 1ZYRC 2VDMH 3FB8B 1TWFH 1X3EA 4LCIL 2ARJA 4KJPC 3B9DA 4YSPA 4L3CA 3RFZC 4RIRA 3B2VL 3CMOL 1RH8A 4P2AA 2OEOA 4NNXB 4PJXE 5JHDE 1X7QB 2ATPA 3DX6A 3EBHA 4GQZA 2XRSD 1VZHA 4LGRB 2IQAA 2O72A 5DJYB 1NMAH 4DKTA 1QE6A 2OP4L 4QYAA 1Z9MA 1UUSA 1I8IA 4GBXB 4U3CA 4OZFG 2IDFA 4NKIH 5FA4A 2PWFA 4L1LA 3QDGA 2BP3A 1S5IL 5DJ6B 1CFQA 2QQLL 4GMTH 3MFYA 5EU4B 5HTSA 1Q9KB 2PR4H 3W0WD 2YS4A 3OLEA 1VPOL 5C7XH 4PJAE 1W0VA 3BGFB 4KQ3L 2CMRL 3C2AH 1W8EA 1FV1B 2WO3B 5FW6A 1DJHA 4N0FB 4KKCC 3UTTA 4QHNA 4JBMA 5D93B 3P0VL 1PW3A 4WI2A 4DZ8B 2R93B 3JTBA 1N6QL 5GAGC 3H3VI 4FERA 1MSHA 4ZPTB 4KLKA 2EXWD 3O6ML 1ROCA 2WXIA 4Y19B 1H3WM 1CR9H 1UG9A 1X5MA 1EEID 1I50H 4FNFA 1UD8A 5IGFA 1HX0A 3DV4A 4DN4L 1T04B 2NR6C 1MFCL 2XUWA 1KLGA 3BPLB 3HB3D 4MHEA 1HNFA 3IK2A 2KEEA 4OFVA 3U83A 3SGEI 3SO5A 2BVPA 5T33L 4LHUG 4Z7OB 3RA7L 1PNDA 2Z0UA 1SJED 1QASA 4FJYA 4L8DA 3VQ2C 3HR6A 2AK4A 5D7JC 4POYA 1J0JA 1OLLA 2W9DL 5LQBL 4C3JB 4PJCB 4QYOB 4LLQB 3VJ6B 1QVGA 1AZBA 5FKPB 3L3DA 4FHBD 3QWNA 1GHKA 4ZRGA 4LK4A 4G1EA 4MNGA 3SE0A 4F8PA 1LO2L 4LSUL 4MD0A 2AQTA 3N1QC 1DLHB 3GXMA 2K5DA 4JRYD 4Q6KA 4R26H 3UP1A 3ZE1B 4PY8I 2CQOA 3MRBB 3PU7A 4XVTL 1R3LA 6PAZA 4K4KA 5AAMC 2BVOB 5E4OA 5IW1A 1UE7A 4JHUA 1STNA 4IOCA 1JPTL 4M7LT 3VXSB 3VSTA 3W81A 4BFKA 1W8OA 4A3LH 3MRPB 1WBYB 1S3RA 4WEMB 2R83A 2UZXA 1D7DA 4WWKC 4A7SA 3EGXA 2HTKC 4UQ2A 3NRPA 2BH0A 5KYWA 5FF6B 2KEDA 1F56A 2WKDA 5BQ7B 3ERSX 3TEYA 5JHMA 1ZHKA 1RK1B 3QZWG 4OGXL 5AOKA 1YNTA 2Z34A 3D34A 1YEFL 2W0FA 1PLBA 4RGND 4AIOA 3Q06A 4GLRH 4XQQA 3PABB 1XXDC 3ZHDA 3WDJA 5GIRB 2DTSA 3OB0K 3EJCA 4NWTH 5MERB 1SYEA 5F3HA 1D7FA 4DR5L 1ZE3H 1KIQB 3E8VA 1PIFA 3FPXA 5DO2D 5KTEH 2YPLB 1VQIA 5ITFA 4YHIB 3ZTJH 2OTUB 2R2EA 2WWKT 3VH8A 1MFUA 1JFQL 4PHZA 1ZV9A 4MRCA 5I71B 3LPPA 3WHXB 1XNQQ 3DPBB 3OD3A 2NY4C 5HGDA 2J1KA 4KY5A 5JPNB 3JTSB 3ZL2A 4C56D 4K3DL 3OJMB 3ABMB 1REIA 3LHPL 3QUKB 5C3IA 1HXKA 4M1DH 4LNVA 1CFSB 1AHMA 3IJHA 1DVFC 3J81j 2JKWA 4W1TA 3OX8A 2R2BA 4IGBD 1EU3A 2A9MH 3CBKB 3HS0A 5IKCA 5L9DH 1H9SA 5HXMA 5DJ0B 1EZLA 1N5YL 2XYCA 5J22A 1N0LB 1JZ6A 3MXUA 2JA5B 4LLWA 1QI5A 3H3BC 1JYNA 3NIDB 2D0GA 4NUQA 4ANWA 1IGJA 4N2AA 4RX4D 1F86A 4DA2A 2H9GB 5F7FA 1MW3A 1KYUA 3RUGF 3RWHA 1MAKA 2F19H 4J3UA 5GSVA 3S3PA 2R92B 4P2QB 3CP0A 1J5HA 1JS4A 4APQD 4G80B 1M53A 5GGUB 1AFVH 1YG9A 5ID0A 2NUPA 5JHAA 4BGLA 1XIWA 1OXSC 2X28A 2YUXA 3CZJA 2EYJA 1LJMA 3SSGA 1HR0W 5EIIA 4ZW5A 3N9GH 2P5ZX 4PBVC 3ZIMA 1KC8C 2ZONA 3DX9A 4JQIH 3LEXB 4BE6A 3HKSA 3AWGA 3ND8A 2JJQA 2BVUA 5C86A 1X3GA 5JXEC 1A4BA 1IIKA 1Y1VG 4WI3A 2BNQA 2GBVA 4TQIA 3REWA 1BMWA 1SNRA 1DQLL 1BAFL 4P4RB 2IAND 2O26U 1AQDA 5EC1A 4CVWA 4JI5L 3KBXA 1AI1H 3ZU8A 3BN9D 3KFUA 2X4SB 4PG2C 3ILPA 3DGCR 4D2NA 3R06A 4F9PA 1IKFH 2DAVA 4UQDA 5BS0B 5L0QB 1J48A 1WCMG 1VEMA 2N7AA 2XZCH 3MGOB 4FI6A 3ZDZE 4POZC 3B5HA 3O4OC 3MUHL 1SYGA 2A38A 4I18C 1A6TA 3S2DH 2XETA 3F83A 3K2MC 4XN4A 2NQCA 2IPUK 3QB7C 2C1PB 4QNPE 5BVPL 1AKJB 1E40A 2F0OA 3OKKB 3QG6A 5HGGS 4U1LB 4Q0FA 3WFCL 2Y0SA 4M1GL 4GQQA 4CGYB 4G8IA 3U9UA 3DWTA 3FUFA 4HH8A 2J72A 4UWQB 3UTQB 1HA5A 2XQBH 5C0RL 5I1IL 3ARPA 3ZDZF 2YJLA 5D1XB 5I9QC 1I53A 3MV8E 5DR5L 1CT8A 1M05B 1VRSA 5C0DB 3H8NA 3RWDB 3GZOA 4QNPF 4TNEA 1OY3B 2HMIC 1PV4A 3K6OA 1MFAH 1MJ7L 4BWWA 3WS3A 5HJ3B 3F12A 2EE9A 1QPKA 2B0SH 3FN9A 4M8QA 1CE1H 3DBXA 2Z91B 5KYYB 1TIUA 4YPGA 4YR6B 3OZKA 3WTUA 3PWJB 3HZ3A 4P46D 1LLRD 3PQYD 5EBMB 4HIKA 1TT2A 1EIGA 5E4EB 5C4XB 4JRLA 4EZKA 3QCUH 4Z7QB 4HMDA 3F2BA 5HYSA 4WV1C 4EUPH 1Z6JT 4S1QH 4HXAH 3RNKB 4RFEB 4BH7B 2H2PC 3QUYD 2BC4A 4LL4A 1IM3B 2O5YH 5F7EH 1XX8A 1BOYA 2EDRA 2AKWB 1BM3H 4U3SA 2LY7A 1GAFL 2DM2A 3QFJD 5JZ7C 4OM0L 3D6CA 1A7RL 1JGUH 1G1CA 3QIBC 3IGLA 3QZBA 2BCMA 3EO0A 5ANMA 5FO2A 3WIAA 4GP4B 1WP6A 1HH9A 2AK1L 4LL9A 2QCPX 4FTVB 3I02B 3ITPA 4NO5A 2P8MA 5IBTH 3OSOA 1LP9B 4DV5Q 3DJRA 5LBSA 4NHCL 1K73C 3BT2H 3O0RH 2GFBB 2FQGA 3KR3L 3F2DA 1G2TA 3VWJC 3FYIB 4LEXH 5JR1L 2FFKB 1MZYA 3CLEH 3HN8A 3PUWA 3A47A 3AB0B 3H2WA 1QNZL 3EHBD 4Y9FA 3UTSA 2OXHA 1WIPA 4HJIA 4P5TA 1BVKA 1WJ3A 3KK7A 1E4KC 4JM2C 2CR3A 4HW6A 4GJTB 3UABA 3B3IA 4CN4A 1WISA 5GGVH 5K9OA 5FYLH 4LFHG 2YPVL 2EYOA 3VGAB 3VR5A 2RMNA 4IUUA 1TU2A 2QADD 3B34A 4H25B 4TPRH 3PV6B 4RDBA 1OTTD 5EOCL 5JHDB 1PG7L 4TL4A 4WSGA 4WAFA 3NSXA 4XB7A 1AGCA 5BV7B 3H09A 5DZJA 4ELMF 5T1MB 3HP3A 1N70A 3B7SA 5ICUA 4BSVB 3DWAA 2QHLA 3SOBL 2J5WA 1K3IA 1SDAB 5EFIA 4C83A 4R4ND 1YNKL 3LH9A 4UQ9A 1LEIA 4D3CH 3C75A 4JS7A 2V2TA 2F54E 1PLGL 3GM0A 3I84A 1NFDE 2K6YA 3MC0A 4BQBA 4MS8D 3BKMH 3QFDB 1VQPA 1IBLQ 1BAWA 1QFWH 1C9OA 1LE9A 1MQKH 1G7HB 1XTDA 3PHQB 2HX8A 1HHKB 4MJ6B 1I6HH 1DVQA 1IBHA 2XSKA 4NKDB 4XPAL 1NGXB 3A4EA 5M5XH 1HI6A 4C4UA 1RZQA 3HFMH 4RISL 5L7XH 3CC7A 4JI7L 3US1A 4JFEA 2NW3B 1SHSA 1RU9L 1PH8A 1XYIA 3MRMA 5FYJE 1NFDF 4LRNH 4UB0H 3K71B 1EERB 3KHOA 3QG7L 1ICFB 1BD2E 3UDWA 1ZKOA 2CDFA 4AL8H 5DJZA 3FN0L 2QMKA 5BUAA 3QZOA 4EN3A 1MNUH 1MXDA 1MFEH 1RZ8A 3ZZ1A 2GTWB 5LHDA 2J71A 2TSAA 2VDML 2DQTH 1D2PA 1U58B 4EDWL 2JKIS 2R1WB 2A6KB 3GBNL 1MWAA 5IK3B 3OKLA 4O51A 1WS7A 1D5ZC 1KT2B 1FSKC 1P2CB 1XT5A 2J8OA 2QMJA 3HE6A 4AIEA 1UHVA 2BM3A 4Y7NH 1NA8A 1P7QA 4BKSC 3M3YH 1NMAL 1NAKH 4KZCA 5DUMH 1NKGA 3MNZB 2ICEA 2C9UA 2XZQL 3DRQB 4ZO8A 4JM2F 4KXBA 4MMXA 5CSBA 4MZ9A 1VCBC 4HIIA 3I56A 3V5KA 3STBA 1WAAF 3WEOA 1G7JA 3ZKMD 4GMTL 3DMMA 3X3GH 1G7IA 4IU3A 1OCCB 3BZ5A 4FE9A 1EZ8A 3QIWB 1R0AH 1OB1B 2BP8A 3P1HA 4IMLB 2J57A 1HZCA 3T1FA 3AY4A 2ODIA 2X09A 5T5FH 3C2AL 2X4NB 1IYUA 1A66A 2Y7LA 5IP9G 3UAFA 3D69A 5IG7A 4DN3L 5IT9E 1GVIA 1KB3A 1O0VA 5I8OL 1FFOA 4X8JA 2VL6A 4CBVA 3D2UD 3KPTA 4A2EA 3EUUA 3QEUB 2EO1A 2O6FA 3AABA 3LNHA 2EEAA 4Y4HC 1QSFA 2EEFA 3ARTA 3KEDA 4X7EC 4GG6A 3BI9X 1FVDB 2OX5B 3NK9A 4F7XA 4EVOA 3PUCA 2Z64C 2BSRA 3QNXA 2EIBA 4TQUS 1D5MB 4A3JH 1R3IH 3A8IE 3QNYB 2F3IA 2B2VC 2VNCA 3ZTEA 2KCCA 4K0KL 4CN1A 4OI9A 4UDTB 1U8PB 4PJ5A 1T21A 1AGFB 3ZUNC 5I0VA 1HJCA 2C9VA 5C44G 5L37A 4WI5A 3FZUD 1ZSDA 4MAZA 2EVJA 3ZYOA 3DX6B 4ZAKA 1WJJA 2IOMA 1X7SA 3QJQB 4N5UA 5GRVL 3BZDB 3GINA 4QRRD 2AITA 1WWWX 4R26L 1D8LA 3B7TA 2H26B 1DQQA 3CK0L 3M6DA 3MFGB 4PI2A 2VZTA 3QDGB 4H0HB 2A0LD 4WU5B 4TUOA 2ZJSH 5TPWH 2MKWA 4YHYB 2ZWLT 4OXPA 3EDEA 1CFBA 3ISWA 2R1XA 3N85H 3PLYA 4J3VA 5FHBL 3PYCA 4PD4J 2CRIA 1DQJA 4LF4Q 5IJVA 3CVBA 5GPRA 2ZAIA 4LSPH 4AQYQ 1DZBA 2AJXL 3QIUB 4BRVA 5CUSL 2VH5H 4G8FA 1CA6A 4N8CH 4XN7A 5HJBA 1MXGA 2DTMH 4L4VA 1NCNA 2QVKA 3T3PF 5HDBB 1WFJA 2XNAA 3K58A 2JXMB 3AREB 1IC7H 4E42B 3V6BR 3VR4A 3MRJA 1XF3B 1F97A 4CDHA 1T2XA 4NNYA 4HWBA 4S11A 1IO4C 1DBBH 1JTTA 4HK3N 1KJVA 4PWEA 1JYWA 3P3YA 1KCSL 3DUSB 5D7LD 2A6HC 1Z9LA 4OLEA 4WFN3 3PWPA 2LVCA 3KNBA 5C3TA 5K93A 1Q1EA 4ZOAA 4RHRA 2OS7A 4XXCC 2ADFH 4JDTL 3OR7A 3AU1B 3GSOA 4UP9A 2R23B 1QVCA 2GC7C 3HOVH 3FJTA 2VMEA 1HCZA 1UXSA 3MRKA 4ZUIA 1QLEH 3AU7A 2EDYA 2I60H 3JSSA 1DJRD 3INOA 2CKBA 5CINL 3T3ME 4HAKA 1NBYB 5IMKA 2AQ2B 1Z3GL 5EBWB 3WIHH 4ENZA 2OMWA 1T22A 4XXEA 5IW6B 4CSZA 2A4EA 3NUKA 5L9DL 1XB6A 1DJIA 2C26A 4WO4A 3P30H 4U6XA 2C7UA 3FFCD 3RX5A 4AV0A 5C0NC 2A2QT 4JFYA 1ZANH 2X6MA 1HEJC 4BSWB 2HQEA 1KLFB 1JFHA 3KPMB 2JEBI 4N4YB 2F61A 2R7FA 2OMTA 5KN5A 1NFIA 4HKZA 5DJ2B 4RGTA 3D12B 2VS1A 1AXSB 1BOGB 2EDDA 5DC0A 1PX8A 1D5BA 3PWNA 5J3HC 1D9KA 1TEGA 1YY9C 4NQED 5GHWH 2J4XA 2VDRH 4GAAA 3X12B 5D8JL 1Q1BA 3BZ4B 1LGVA 1C5DB 1LWRA 5ECJE 1EEQA 4JV5Q 4G70B 3NJFA 2BOBB 2HJLB 4N2CA 1AIZA 2RCFA 2VR5A 5FLUA 4PJ8D 5FHAH 2A6ED 1CSPA 1KEMH 2P5EE 4P72A 2X6CA 2X70A 1RUKH 3FPYA 2HWZL 4JREC 2MH4A 4K8JA 2EECA 4XOEA 1XTCD 3CZSA 4MDJA 3D0FA 1PG7W 3MBEA 4EBQH 2GABA 3F64A 4DKAC 3PHAA 3NFSH 3TCXA 4JFHD 4WJG3 1R4QB 2KQ3A 1A9EA 1FE8H 1ZVSB 4NCC2 1P4LA 2JF1A 5FYLD 3PWUB 1JK9A 3II1A 1C9SA 1BLNB 4ZFQA 4KD3A 3FTYA 1HXYD 3IJHB 5E56A 4AVJA 1WOCA 5D6DC 3HHMA 3SPVA 2PYED 1VSCA 3TBBA 3IKCB 4A93H 1SY6A 4F3FB 3ET9F 1ZT1B 2R4SH 5CCHE 2XQBL 1U8LB 1SPDA 3QUXC 1Y0LB 1RUAL 5KSVA 3RWHB 1AZQA 3GO1H 4KFZC 1KRSA 5GSVB 3UL4A 2KA7A 4J4PC 1NMBL 4NRYA 4WLCA 1KPVB 3CCSA 3JV5A 3H3VC 4MJ5B 4NO2B 1IEAA 3R0MA 4WK2B 5GZOD 4A7UA 4UT9A 5CD3A 3NELA 5ISZD 4JHAH 2GW5A 4LARH 1OWRM 1CE1L 1LO0H 3C5ZD 4CSTA 4LP8A 3D2TA 4PLOB 4X9YA 1HJBC 4RWHA 1W72H 4J8RB 4PGJA 1PY0A 3O45A 2I07B 4JN2B 2R2CA 1J9OA 4PGCB 4Q89A 3T0DA 3RGVC 2NTSP 4A6YB 1TVHA 1AZRA 1R4PB 1P7HL 3QJOA 4K55A 3G6AA 4Y5YB 3OMCA 3JV6B 4LVOB 4HXAL 2OMBA 2PCYA 1AQDB 4S1QL 5IVXA 5JYMA 5LWYH 3GMQA 4ZXBC 4KDVA 3RVUC 4B96A 2CALA 4PJDB 1ZD6A 4HPYH 1YEKH 3E9HA 4G5ZH 4MB1A 1E5CA 5C4JB 2VUYA 3T56B 4DXGA 3KF6A 2XCMC 1JGUL 3UCRA 1LT5D 4DR2Q 1NL0L 2WINB 1QQDB 4OFIA 4JFFD 3VMPA 2DDQH 4LIQL 4NQVB 3DOSB 2JK5B 3TBYB 1KB5A 3BW9B 2NY2D 5F6IC 2UUAQ 1OE3A 5ID1B 3U9UB 1IGYB 5IB3A 1XH0A 2BHYA 3L3HA 4LKCA 3TEZA 4GXFA 3MJ9A 1NPJA 4Q9CA 1CSQA 1OGAD 4WW2C 4OTXH 4LEXL 3CLEL 1NOFA 4UZUA 1G9NC 1K0SA 1BFOA 3G5VA 2G9KA 4GMSH 5CCJA 1SHMA 2FBJH 3Q5TA 1RUPL 1S4IA 2B8FA 1XX9C 4P57B 1A25A 2E4FA 1QUNB 5ACZA 2F52A 2HUHA 2DRUA 2D03H 4ZUWA 3IRPX 3VI4F 3SDDD 3EJSA 2FO4A 5AZEH 4EN3D 4DAGL 4BWUA 1I94L 3GDBA 1EK3A 3FTGA 4W4OC 4AY0A 1FZKA 1EIBA 1JWUB 2W0LA 4DF9A 4FQXD 4WNJA 2JA6G 1Z5LB 2XOTA 5BRZE 2GTQA 3HUJE 1S5ED 1VFAB 3EO9H 2IPKA 4HJEA 4D3CL 4NQDA 4N2LA 5CEZL 4Q6IA 2WB7A 4IW4C 1PH4A 2UX6A 5HY9A 1UA6L 4ORZC 4XN5A 3UGUA 2IY5B 5HHOE 5TF0A 5TTRA 3L5WA 5INDB 1LM8V 1MHCB 2VMFA 1QFWL 1SRDA 4HD5A 3MV7B 5M9OA 2PF6A 1IBBA 1ZLUK 2Q8AL 3HMXA 5H37G 3TO4C 1EEYA 2O93L 1WDAA 1DVZA 3HFML 1IZKA 2XQYK 4TTDC 3DHQA 2VLME 3WLWD 5IB4B 1Q12A 1PG7X 2WK2A 2ZXGA 3VXNB 3G7TA 4HSAC 2OW6A 4I2XB 1NBVL 4LRNL 3VFOB 4NQCB 2R0WH 3HAEA 1CF1A 1Z9NA 3G04B 5B4MC 4JNXA 1K0RA 1ZPLA 1MFEL 4K7PH 5DJ8B 2I27N 5F7WC 5F96L 3WFDH 1MHEA 1JV2B 1BDOA 1CPUA 1VEPA 1DCLA 1PDQA 2XRAH 3KGSA 1BZ8A 4WW2F 4DKEL 1JWMA 1RZJL 1PSKH 5EZLB 1UASA 1TU2B 1U91A 4P23D 1QVOB 4N86A 1NAKL 5IMMB 1NCAH 3ECVA 1FR3A 1FN4B 1MNNA 2XZAL 5ALBH 2Q7NA 5DQDH 2OSYA 5DJDA 5JPMA 4DV3Q 1H8NA 3X3GL 4YLBA 1LEIB 1NLBL 3C60D 2P8PB 1H15B 2OSLA 5DS1A 5HYIA 1DDHB 1A4JB 2E9WA 5H35A 4MRBA 4EI5B 3DTXA 4KVPA 3KPQB 2V7NA 4LPTA 2Z7YA 1C16B 5KOVC 3GLEA 5C3XA 3TH2T 2Y6SC 3MC0B 1PYBA 5T5FL 2CH4A 4YY3L 2BCKA 5IZ7A 3KYNB 3SGJC 1LE9B 4PRAB 3HFFA 1CCZA 5HHMD 3DECA 1XMQL 1V7NH 3MJGX 2EYSB 4G6MH 3H9SE 4M1UB 4Z7VE 1Q8KA 2P5PA 2IV8A 2EY6A 4JI0Q 1TF4A 3QRFM 4QT5B 4OLVH 2I5YL 1XD0A 3JYBA 3B9KD 1SEQL 3QJZA 4ZFZB 2UWEA 1BQLH 2Y06L 4RRPA 1OP3K 5F7YC 3TURA 2NZ9D 3GKZA 3V4VH 1IGCH 2OCJA 1R3IL 1S7QB 3APCA 2EIDA 1X54A 2Y07L 4HYTB 3HRZC 4Z9KB 4D8PB 1RL1A 4TMPA 1T5WA 2FO8A 1SUHA 2ZCLL 4WKXA 1HQMC 2XQYA 4YDIL 2BSSA 3NTCH 3LEYH 4H88H 5FO9B 1PFSA 1U8HB 1I9RH 4L9LC 5AOIA 4BHUA 4Z7WE 4CDCC 3OGCA 1PMRA 4B9GA 4LPUA 4PVLA 4N1CA 3T3MB 5MENE 1HL4A 1QX1A 2W60A 4NBXB 3CFTA 5C07A 3WYRA 1FG9C 4HCSA 1E8WA 1IL8A 4GINA 1QW9A 4GSXA 4QRTB 5D70L 1QBMH 3RTQD 4XGZA 4X5WA 3FDTA 3WDNA 2D3VA 5TPWL 4N8PA 4TNVK 4ZI8A 4JY4B 4YDLC 4ZMPA 2NVTB 4LSPL 3T1FB 3WEAA 4DGIH 4ODSL 4HZLA 2OTPA 3QA3A 2VH5L 5DMIH 2LW3A 3EZJB 4NZTH 4HDIB 2XRQD 3ICEA 3MO1A 4MVBC 4L23A 5IG7B 4KFMA 3UTPD 1ULVA 4NP4L 4PJGE 4GG8B 2KCTA 4GRWE 3SPCA 1FFOB 4JG5A 4P04A 2W07A 4OAWA 3L4ZA 4GW4A 3SIKA 4U7KA 2F3WA 1A7NH 1A3LH 3Q8CA 5D2NC 5J11C 3UACA 5D71L 5DWUH 2NY3C 5D14A 1VHPA 3GXNA 1SJVA 3IDYB 4Y4FC 2A99A 1TKWA 2X2YA 5INCB 1RKNA 1SF3A 1JV5A 1WFOA 3MLXH 2CJTA 3MOAL 3Q48A 4G9FA 4GW5A 3K80C 4KWUA 3MV9D 1X4ZA 5DU7A 5IHWA 1BA9A 2ZOUA 5J1SC 4X6CA 1XMWA 2I60L 2YD4A 4DO5A 1I9JH 5JA8B 4OCWH 3HG1D 1P16A 4FJ6A 1I8MB 3HKZE 3HBQA 4MSWA 3WIHL 3FSAA 3MVVA 3SDYH 4ZOCA 4DV7L 5TQ2H 3NTKA 2R1YA 4N20A 1OL0A 4GIPD 1W9XA 2CXGA 4TNWF 5FK9C 1HNWQ 2YFOA 3BS1A 1ET7A 4A3KH 2PTTB 3FDWA 4K3EL 3JWOH 1T1ZA 1ZANL 3P2BA 4DPBX 2OW7A 4NAQA 1B3IA 3TYGL 5IJVB 3CW2C 1KAWA 3ULVC 4IQZA 3TNNB 3K7AB 4I0CC 4FQLL 3NEMA 1J8HA 2VW6A 3D18A 4S1RL 2JKRM 4U1JA 4DR6Q 3WFBL 4GLVB 4M5YL 1IBKL 2ZJRA 3RP1A 3MXPA 4F8MA 1EYGA 1FVEA 2VAAB 2XPGA 2F7OA 4X8CA 3WY2A 4M62L 1FGUA 1FFTB 2B4CH 3RX7A 4Y8DC 3GLDA 3ROOB 4HWEH 2OAAA 3G6DL 2O6CA 5I2XA 4QOKA 5FDWA 2JJWA 3EDJA 4PV8A 5H94A 2ZXPA 5AD0A 2L4OA 2WB1B 4FG6D 2J8UF 5KNBA 1BSIA 3A4AA 2GI0A 3GJFK 1LO4L 3EYSL 3QJTB 3WMSA 4PCSA 1JJGA 3RVTD 2OMVB 2WZ6A 5ESAA 1XGQA 5FHAL 1S3KH 1KEML 3EOYG 4S1DC 1MSPA 5TDOA 1RUKL 4ABQA 1NBCA 4IJ3B 4YBHA 2F8XC 2ZTDA 5EKLA 5F93C 3WSQH 2HPOA 2VN3A 1U8MB 2F58H 3KXFA 1FNHA 4EBQL 1WTWA 2Y25A 1J5OH 1LTID 3NFSL 5ESQB 2WY3B 1FE8L 2OMWB 1EQRA 1UT1A 2MQCA 3H0GB 4L2LA 1IC1A 2HUEA 2KQMA 4L4TA 4LB8A 3S34L 5K1NA 2WD0A 1FNEA 5EU6A 4BQCA 5F7DB 2F4VQ 4PY7B 5E9DA 5FLMH 4OEMB 1ZGLA 5D7IB 4AYMC 4HIXL 5IFHH 3GRWH 1BX2A 5LHY1 3GSUA 4MJIA 1PX3A 2JELL 2R4SL 4J12A 4JK1C 3VH8G 2YKLL 3O6FD 4AQOA 2D7OA 5DUBA 3GO1L 4GO6B 5TK4A 1ZXQA 4Y5XA 5KVGH 3CSBA 2F1AA 4A2HA 2ESVD 2B63G 4B3RL 1RTNA 3K5RA 5LMNQ 1A4CA 4GBXC 2IHFA 5JHBA 3PF4A 1X5JA 3QB3A 1A3TA 2CXKA 2FEDD 3BZEA 4PLKD 4ZT1A 3Q6FA 5I1LA 3EO1A 3IAQA 3PXJA 4OLUL 1YEWA 1NGWB 1SMOA 2AZUA 2MJWA 4GOPC 2LV4A 2XYBA 4QRFA 3ZMNA 5J3BA 4U1GC 5DTFB 4IN3A 1IFHL 4LF5L 3HZYB 1E9PA 5DC2A 3MI6A 1UOKA 3JTTA 1KLUD 4XTCS 4AQ8C 3DV6B 2NVXB 3V55A 5BRZB 3KM2A 1M7DA 3QSKB 4W9HC 3GUTB 2VDQL 4HPYL 2EOTA 4EOWH 3L9YA 1YEKL 4G5ZL 2YGPA 2M8XA 1T83C 1O7VA 3OGOE 4X7TB 4XAKE 1MW2A 4XPHH 5D93C 5C09D 3U4ZA 3FQYA 4K5MA 3B2UD 3KWWA 2WZPA 2P24A 2Y2WA 4A7QA 4OLWL 5HHOB 5EIIG 4QWWC 3LRSA 1EY8A 5I9PA 1VACA 2EXYC 4AGOA 4OV6F 1X4YA 3QNZA 1INQA 1DSFH 2V17H 3L9AX 2Y7NA 1XSOA 4OGYH 3BPLC 2QTVA 1EMTH 3UDGA 1KBVA 3H0TB 5EOCJ 4A3EB 3TV8A 3GUFA 1XF4A 4FXDA 4QB4A 1YEEH 3DO7A 1VMPA 1QRNE 1ZJBA 2EINB 4G82A 1DVSA 4QI3A 1CHPD 4J3WA 3FT9A 4L3EA 4OTXL 1TS4A 3Q24A 3RHWF 3RGBA 4FQCH 4GMSL 3F00A 4XN8A 1AR1B 2LKVA 3VQ1C 2R9HC 4LW1A 4ZOBA 3ZYYX 3BWZA 2GJZB 4N0UE 1G6RL 3NRQA 5F9DC 1T6VN 2D03L 3FC8A 3HOXG 5CJXC 5I8KH 4X3SA 32C2B 3S5LA 2OJ1A 3TT1H 1J11A 3TVMD 2AMCB 3B2MA 3P4MB 5FYKU 4XCEA 4BBSB 2KH2B 1ETA1 4UM9D 2J56A 2VISB 3K74B 1KXTB 3QUMH 1K6QL 1TVHB 1NOAA 1YEZA 2EKSA 1HE7A 3EO9L 2PXYC 1AXTL 4O00A 1XGPA 1Q0XH 1OGTB 1NKRA 3IF1A 1Z6HA 2NNCA 3ZR6A 2Z31B 4GS7B 2K8MA 3SBWA 5F7UA 4V1DB 4R5TA 1E5ZA 1CUKA 4C3HG 3X3NA 3ARFA 4GRLB 1ZT4B 4HA1A 2XVLA 3RIAK 5JHLA 5DD1H 1J8IA 4PG3A 5KNDA 1ZEQX 3D0LB 1I6VC 2DD8H 4KBPA 1HTLD 5LG1A 3IWUA 1JD7A 4Z7VB 4AGMA 1YMME 3OXSB 5GSRB 2WQXA 2F5AL 1Y1WH 4A2DA 3WS6A 3ZZLA 2FJ2A 2R0WL 4L5SA 4FKEA 1AZCA 2P52A 2PKDA 4JG2A 1LDPL 5SWSD 1ZSHA 3SR1A 4Z77A 5I71C 4DV0L 3VI3A 3CXFA 5D96B 5JPNC 3PIO3 4NFCA 4Z7OF 5I8CA 1O7LA 1HTYA 3R7QA 4HVBA 2XRAL 5D65A 2FGWH 3G9AB 3X1GA 3IBOA 2NBFA 5I82A 2OTWB 3FT2A 6FABH 2AUJD 3EYFA 4PH8A 4KX8A 1NCAL 4Z7WB 4DAYB 4AIMA 3CVHA 3BJUA 1EOVA 3N6YA 4B41A 1FZKB 1W6WA 2YXVA 4BBWA 5EGTA 5E8EB 4ORGA 1AGBB 4QHLA 1C7TA 5B39B 1P8LA 2VTFA 1G9MC 3HN3A 4D9LH 4FYRA 2PO6A 5EV7A 3D48R 1X5HA 4Q6IB 2X1XR 5I6YA 4P5KA 4Y16D 3K6SA 1KBGH 4D9RE 2NTSA 25C8H 5HY9B 3Q5OA 4YK4B 5AW3B 3GHPA 1MOEA 4TUUA 2KHAA 4JKMA 1QYGL 2XX0A 3MUZ1 1CLCA 4PJBE 1O5DT 1IQWH 4X8GA 4P06A 4B3EA 4PRIB 2G5RA 4R4FL 3V6OC 4RMFA 5IROD 2Q8RE 4LEOA 4BY1B 4G6ML 3W2DL 3NIGF 5D7SL 4ALAH 1HWGB 4KITB 2BFVH 1M8AA 1P4BH 2HFFA 2RHEA 4OLVL 4HIEA 1C8CA 4HFWA 4MNHB 4GRWB 4ZDHA 2YD0A 1EO8L 5J9PA 1BQLL 4H8PA 1WWCA 2AXJA 4LCCA 2AANA 3PJSA 3IGKA 4RA3A 3IKKA 3OTOL 1NDGA 1IGCL 3CGTA 3V4VL 1BBXC 3ZRCC 3S16H 2BIIA 4DAMA 2YOCA 4LF7L 2EC8A 2X4PB 5L0QC 4OT1L 3RPIB 4AJWA 3QDMD 5KJ4A 4YO0A 3VYUA 2PZWA 3WOVA 3GPEA 3NTCL 1K8MA 4H88L 1LE5B 4F24A 4GIOA 3A6CH 4G42A 1OVZA 2JCCA 1MBYA 2MHAB 1YN6A 4QXUH 5E6SB 5BZDA 2BXZA 3KPOB 2D9QB 1HZHL 2JIXA 2L1BA 5GQOA 1FNSL 1ZAGA 1T3FB 3BQUB 3HMXL 3GZKA 4HUNB 3VO0A 1JGEA 5JEAH 1UH3A 2VSKB 1YA5A 4H8HA 1V1PA 2EH8H 4HZ1A 4A3GG 2PPFA 3TU6A 3HKZB 1ETJA 1WH0A 2WLJA 5DJDB 1MAJA 1QBML 3TH3T 1F11B 1IGTA 4P59H 3MRNA 2V33A 4N1EA 5C1MB 5D1XC 1A7PH 1PA6A 1BOSA 2OSLB 2BNRE 1NUCA 3CZFB 4RBPH 2V4DA 3NJNA 5DK3A 3L13A 2GTZB 3LTVA 5KOMC 3D08A 2R0KH 4PJFA 1PZJD 1QUQA 3QIAA 1EA9C 3UCQA 3ZJAA 2B8OT 1Q3LA 1P1ZA 2NXZB 5D5ME 3NIDF 2IGFH 4Y1AE 4P46A 5DA0B 3PQYA 3BE1L 5B7MA 2VUMG 4AIZB 5JIMA 1XBDA 1ONLA 4HH9A 2PLTA 2DY7A 2F74A 3IFNH 4R83A 3SKNA 2D7QA 4AC4A 4FLRA 1AO7E 2CDEA 4HJGB 4R9HA 5E4EC 1A7NL 4QRQB 1I8LC 5M95B 3WGVB 3LV3A 3PFUA 4P48A 2FYYB 4HFUH 1YEGH 2BRRH 2MO1A 3INUL 1ADQA 4Z7UE 4A3IG 2ZKXA 3BZFB 1S7UB 1KTKE 2NT1A 3PPEA 3RIFK 3UMNA 4OD2A 1L7IH 2CBMA 1E3PA 3WXWL 3FFDB 4NW2A 1DDTA 1CF8H 4PTUA 4W9JC 2C9XA 1KCUL 3O3BA 1GIGH 4MWFA 4S10A 3GK8H 2F15A 1LTTD 2AZAA 2K7QA 5JIKA 4ODUB 5EAYA 1A02N 4OCRH 1NAMB 2ZM6L 2GN5A 1EY6A 1MI2A 2QEXA 3T1HL 2E6QA 4GQPH 4IRZA 3TN0D 3ZE2E 5A43C 5D6CA 2E56A 1OXXK 1PFOA 2LTQB 1ZVNA 5K5YA 3DSFH 1N6VA 4NM4H 2HTLD 4GXVH 1SE2A 3TBVB 3LNGA 2XVGA 1G4MA 5MEOB 5K39A 1WA2X 2QPSA 3AB0C 1SXAA 1EQVA 4UP8A 1IGFH 1PIGA 2VR3A 4IMKA 3WJLA 1K3ZA 1F2ZA 3VXUE 3A74A 1T7VA 4UNVA 2CHDA 3ZE2F 1ACZA 3KYMA 3O9WD 4G6AD 4IKJA 5DC4B 5B3JF 4F58H 1BMGA 4N8FA 3VGAC 3C8KA 4PRDA 1F9PA 1DBJH 5DAUA 2W07B 4HWEL 2UUCL 1I82A 1GZPA 4TS6A 5BV7C 4XXDA 2EVHA 1JPST 4K7FB 1H9MA 4G6KH 4KO6A 4GW1A 2KL6A 2O4EA 5DFAA 2OL3B 3HC3L 3LKSB 4XX1G 1ACCA 3NA9L 4LOUD 4PJ9A 4UAOC 4HUWA 2L15A 1AC0A 3OMIB 5DT1L 1TKWB 3H85A 3FCSA 5M5WH 1TZHB 4B53A 1FO0L 1USZA 3IAPA 1NGPH 1U8QA 4Z7QF 1B2WH 1DR9A 5AJ3L 4H5SA 4Y2DB 4B3SQ 1JRHH 2F58L 3GJEA 4HD9A 3K2KA 4JFDB 1AMYA 3GXUB 4G1MA 3IJEB 3A5VA 5I75C 1J5OL 1S5CD 2M2LA 1INDH 2BW4A 4JKWA 1WO2A 4PUBH 5ICXA 2Q7YA 4N3TA 2PW1A 1PGRB 2YMOA 4FVMA 3RKPA 43C9B 4A66A 1UD3A 3L1OH 3L9EA 5DVNA 4KQ4L 5GAHC 4WUUD 3VFUB 5FAAA 1HXMB 4HCRH 1SNCA 3L0OA 5E24E 4NOFA 4QY7A 5F88B 4KJYA 3HOZH 1LP9F 1JPFA 3CVDA 4F8NA 1RJZA 1XXGA 4XCFL 1A6VH 3DM1A 2ZKWA 1OOWA 4RZKA 4M5SA 2CJ3A 3V0AC 1CXLA 3FO9A 3L1GA 4CJ0B 3HE7C 2ZUWA 5C0BA 4NXSA 3MEFA 1C7YA 3H0GG 3QG1A 1PPIA 4X6DA 4C4BA 5GGSB 2AJYL 3OAYH 4KXZI 4N0UB 4IRSA 5C0CD 3BFWA 1UVQB 2VOTA 4MMZB 2X1QA 3DIVA 4LMQI 3I4NG 2ZOTA 1RP8A 4YJZL 4FN0A 3ILQC 3WG7B 2K3TA 3HCVB 2IH1B 3IETB 3L16A 1KDAA 1BNZA 3LZRA 3QIWC 1RHHB 4HKBA 4MJHA 5TDOB 2ZE0A 3ZR5A 4YDKH 1I7RB 1QBLL 4ZS6D 1FL5B 3VA2C 5I6XC 3D2UA 1TIID 1AS6A 4Z7IA 4BZ1H 4XBMA 1Y6NR 3I4MG 3D4CA 1B7YB 3ESMA 1I8UA 4BFIB 4OJCA 2NX5E 3VB9A 2JI2A 2ZNXA 1DSFL 4IOAA 4RMVA 2CLZA 4M61B 1EMTL 3BKCH 1D5MC 2WCSA 3UGXA 1ZGLB 3ZN6A 1T7WA 4MB4A 4KPHL 3SK6A 1HSBA 1M9SA 1RSFA 1AD9B 1FFPA 4ECNA 5DHDA 1KYOK 4HIHA 4YMPA 4IFDG 5KVEH 3IB4A 1D5RA 3GZQA 4L6TB 1CBVH 2YLKA 5DUBB 4XQJA 4AYGA 4O42A 1HKLL 2BE5D 1MRFL 2EIMB 5BO0D 1KULA 3RWEB 3FHQA 4L1SA 4QRRA 4IFDI 1DQIA 2B3GA 3QO0A 4HXBH 2WQVA 4LLVA 4OM1H 3O0LA 4AUUA 2KDYA 1HL8A 1S5FD 3G08B 1CHQD 4PJEA 4XMXA 4N0YH 1ZPUA 1IM9D 3F85A 4JQIA 3BZEB 5EZIH 3W0WB 3NEXA 5EBDA 2H45A 3FONA 2VM9A 3EBAA 3STZB 4YHYC 1SYSB 1STEA 4MZIA 1PKOA 2QPFA 3QUML 1H3VA 1JN6B 3ELQA 3R3OA 2PPAA 1V9PA 1XMOQ 5CSZB 1K4DA 1FZOA 3SE3A 2FIKA 4JB9L 1Q0XL 4M5ZH 1NM4A 1R3HB 3IVKA 1HCYA 3DXAD 5C7ZA 3CQZB 3U36B 1S7XB 1X6NA 4ZMYA 3GJFB 2QFPA 3AT9A 1HQRD 1T1WB 3WXVH 5C2BL 5FGRA 4B9YA 3DK2A 2XDHA 3EYUH 3MQIA 3HB3B 4WI0A 5DD1L 3UG5A 5IQMA 1Q8IA 4ZK9B 3G48A 2DD8L 3CPUA 4G72B 5D7LA 5HJDA 1Z66A 1L9NA 2JJSA 4KHTL 4N28A 3VD9A 2EQDA 1HOCA 1SJEB 1PZ3A 1U6AL 1CGTA 1U8NA 4PP2B 2G75A 1BUVT 1MY5A 3KJPA 1Y7VA 2DQJL 5I76A 2Y3AA 2Z92A 3CFEB 2VC2L 2VZAA 2M2DA 2QPEB 1T2QL 1PZ2A 3CN3A 4CNIA 4P8QA 1IAOA 2J88L 5E2JA 1OSYA 3DYMA 3CFJB 3T6VA 3M7NA 1X6LA 2Y36H 2IDQA 4U3HA 2DEXX 4JRYB 2W59A 4PCTA 4A3MG 2H1PH 3DHJA 5I1GL 4R1JA 2Z6BA 1NR2A 5IWAL 2LQRA 1PZDA 3WIFB 3D8GA 1EO7A 1QATA 5F89A 2K33A 3ZGIA 4XT1C 3T08A 3VRIB 3QGVA 4ZZFA 3S5LB 5KBPA 1A7OL 1MPAH 2IGLA 1U0LA 4XCEB 5GS1A 4UBDC 5D9SA 4AM0Q 1LYLA 4GKOA 4KKTA 2EJFC 3K0XA 4OZIA 5GS3A 2FWSA 2CH4W 2VDLB 5M3MG 4M3HA 5DEFB 3SE9H 2IWFA 2YD3A 4ZODA 3UTTE 2HCIA 1KBGL 3UPRA 5FB8A 4RGNB 4NQEA 5F9OH 1DQVA 1XDTT 2XG4A 3IPEA 2E86A 2AGJL 3JUZA 1U2YA 4FNPA 4CMMA 2W80C 3HI6H 3PUYA 5I8EA 1A9BB 2FX8H 5D5MB 2CO2A 1IQDB 5A2BA 1LLAA 4XRCB 1LACA 1P4BL 1E8XA 4P9HH 2C9AA 1C1EH 1I4GA 1U8IA 5B39G 5IHZA 5C0AA 1CLOL 3GSQB 3DURB 4NIKB 1SJXA 1WFTA 5HDBF 5C3EB 1AO7B 2PYFB 2OJEA 2QGCA 3M8OH 2PI2E 2OWOA 1LNUA 5T1KD 4PYHA 1T5XB 1A6AB 2WKOF 2OMZA 3OBAA 4MNGE 4R8WL 3MN8A 3VXRA 4C56B 2HT1A 1UKTA 1DYZA 2X4RA 4YHZL 1EAOA 2YFNA 1SHWA 1GZHA 2B2TC 2VXQH 2WXGA 1HXYA 1GW6A 5C4ZA 1L9RA 2GIMA 3A6CL 4IGBB 5JHLL 3CQPA 4QXUL 5DRNB 3S8FB 2OCEA 4DR3Q 4X6BA 5CV9A 5AVXB 3DJ9A 3FT2B 4OX9L 3BKJL 5SWZD 3U7YL 1LQBC 3HS0C 5CGKA 3CVHB 3QHTC 5IQ9A 4NEHB 1WAPA 1JTOA 3GTMB 5CGYD 1J8SA 5I1EL 4OJAA 1WVZA 4LFCL 1I3RA 3HAEG 5IYBG 5BN4A 2X12A 4P59L 5F97E 1F3JA 3MNWA 4NFBA 4APQB 4LSTH 1CD9B 3D6GA 5GZOA 1T4WA 4GFTB 3BU2A 1XF5A 1EQTA 5ISZA 1E4XI 3OLDA 4OO1H 4BKTC 5FM8A 1HZ9A 3KW7A 4GH7B 2LLLA 3N50A 4UDUB 4R3SA 5LXGH 4J1MA 1KIUA 3FVQA 1DJXA 2VXVL 1MQ8A 5EB9A 2IGFL 5D4HA 4KV6A 4I0PB 1S9XA 3LS5H 1BCPD 1K8DA 3I6LD 4KI0A 1IL1B 1I1RA 3T4YA 3T2LA 4LEOB 1B70B 2F0KA 2OSXA 2WTRB 4AEFA 2QHRH 4W9DC 3MBWA 5EBCA 1SBSL 2QV4A 1T0MB 1I1FB 2ZXQA 2HFFB 2Y1YA 3IFNL 1CK0L 2IWEA 4FYQA 4IK6A 3RN2A 5DI8A 1FZMA 4HX1A 4F91B 1YNTF 2IANB 3I6KA 1S3OA 4P0DA 4W9FC 1V10A 2EYTA 3PDDA 5JVH3 5F9JA 1DQDH 2YD7A 4OFPA 2G4EA 1YEGL 2A6IA 2BRRL 1FA4A 5FOJA 1GOHA 5IYDG 1PBYA 2CK0H 2ZPKL 5DUPH 5GADC 3FU8A 1EQQA 3UPAA 4F9PC 4Z3HA 4AK2A 5JW5A 3EJYD 1CF8L 3L9RA 4PS3A 3WIIL 4JFFA 3RYMA 4AQ1A 1G5AA 2ES2A 3S88H 1VQ5A 4XC3H 4D0CA 2LAGB 4FD0A 1CYWA 2XWXA 5AAPA 3FF8A 4MAYD 3H1ZA 3GI9H 4WIQA 4XWOD 1UEYA 1A2YB 5SWQA 4RZCB 3WNLA 1TWAB 1TJGH 2OMUA 3L4WA 2MPMA 1OGAA 1KYAA 5D1ZD 1IAKA 3DSFL 2NZ1D 1JZ8A 4C1NK 4RRPG 2ZCZA 4NM4L 4GXVL 4HBQA 4Q58C 2MCAA 4DIXA 1GM5A 4G7SB 1XR8B 1TMCB 4PBDA 4TUJB 4M1CC 4RGMB 3MTSA 1MRDL 1IGFL 4YNYB 1CD1B 4QF4A 1RK0B 2JB6A 5E7NA 1IJNA 2P28B 2XQYG 3IJ8A 1QFOA 4PJFB 3K1KC 3SDDA 1FWXA 1SQ2N 4LIQE 3FN3A 3S3SA 2ENYA 4GSUA 5FUZL 3V4UL 2P5WE 3VQLA 2GAZA 1XB3A 2EXTA 3COOA 3DOHA 3ZQXA 3E9TA 3HZKB 3CFBA 4Y5VB 4YXLL 2XACC 5CLTA 4BHUI 5E0FA 4FQXA 4J8QA 1GUWA 3K6IA 3KL3A 3SKNB 1U5KA 1G6PA 3ARGD 2CDGA 5A16A 3L2PA 2DN7A 2WLIB 2VLRE 3DHPA 4P99A 3QUYB 1I3VA 1CFNB 5DQ9B 5C0EA 3DTDA 3CC4A 4Z95H 4BZ2A 4IPHA 1TO5A 3QFJB 5FGCE 2VDMB 3ECBA 1TWFB 1KIXA 4K9EH 3DRTB 3TM6A 3RWJA 4LUVA 1NGPL 3UBHA 3A24A 4ERSL 2JSFA 5CFHA 3IFOA 5HBBA 3L4CA 5HHNA 4JOIA 1ZA3A 1TS2A 2R69A 1YEJH 2APBA 2LMCB 2K14A 1T1YA 3VX0A 3L2NA 1HUMA 2Y0SE 3DHMA 4PJDF 2NN6G 1INDL 2P8LB 1S2EA 2GBAA 5EU3A 3F7LA 5D6CB 2BVQB 1SEBB 2WSDA 4ODBD 1G2SA 4Q0XH 2CCZA 3HOGA 5CEZE 4LF8L 2YN5A 3VW3L 4PRBA 1GGCH 3ZDXE 1NCBL 3N52A 3EYOB 2VUKA 5FKAB 2E8YA 1M2OA 3GNML 3EGDB 1DSYA 2VZ1A 5DEGA 5DMJB 4A1RA 3W1BA 4FNLL 1OP5H 3BVVA 4XVJH 3KYMB 2QADB 3B2XA 4P23A 1A6VL 2XWCA 3HOWH 2ZSVB 2G2RA 3VWKA 1STYA 2K1BA 3MLZH 3V5DB 4FQHB 3T0EA 4U1HB 4L5TA 2DLEA 3R2TA 4OZHA 5EF0A 4CGTA 1KIRB 2K70A 3GSWA 4V2CB 4RH4A 3KLQA 4UNTA 5F7MC 1I50B 3FKIH 2Q2EB 1BQHB 5HPOA 3EZ8A 3KLDA 1SHXA 3NQKA 3C60A 1MREH 3MCLH 3QC5X 4BUHA 1FG2A 1WTHA 2HQLA 3P3UA 5EO1A 2SOBA 4AX3A 1WTOA 1DVXA 2XKNA 3L3OA 1L3NA 1S9YA 4E0RB 2VLJA 4L0ZA 4O2FA 1VQ9A 3I74A 4EI5C 1NCVA 4X5LA 4NZFA 3J81i 3DK0A 4W93A 2BIHA 3O4LA 3BXNA 2CE6A 3F58L 4V0BA 4LNQA 2VJXA 4ACPA 1MCFA 4E9VA 4B9CA 4K5XA 1MJJA 4G1MB 4RGOS 1FL3A 1G7PA 2YTVA 2FJFB 3QI9A 4NZUH 1Q9OA 4GT7A 4ONGL 1GZQB 4AJ0A 1CXEA 3HLAB 4GKKQ 1C08A 5ICZA 2UXFA 3KLHC 3LEVL 2E7CA 1PYWD 4P3CH 2QEJC 2JJTA 3UTSE 4G7OC 5E1QA 3BKCL 1TPXC 2CHXA 2LGNA 5AYTA 3UDWC 3VFMA 1JMZA 4X5QA 4YDVA 2CCVA 4N9OB 2QKIA 3N1GC 4HGMA 5D2LB 4TSCL 3V52H 3ILEA 2VJ8A 2KVMA 2PMZB 3FRPA 2YARA 4TSBH 3RJQB 4F7CB 3FXIC 4AGPA 4AXWB 1JVOA 3LQAC 4HXBL 4OM1L 3BJ91 2CM5A 5EUOA 5T1DH 4X7DC 2CLRB 1UD4A 3W3AA 2ICEC 1GHJA 3J80c 3JV4B 3RTQA 3UJIH 4A4IA 4MMXC 2K78A 2F53D 5HI4D 2BDOA 2LS01 1S7TB 5EZIL 4C3JH 3QRBA 1PRTD 5LKNA 4KN4C 2ZYSA 4GSRA 4YS4A 5HPMB 4Q5VA 1JNNH 4LGSB 5I0XA 1U4EA 3UZVA 1E28A 5KS9E 2HYMA 1BWMA 1NUNB 2NY5H 1TR7A 1QTPA 4WK4B 3CXCA 4WEUD 4CJ2C 3C12A 3SDAB 5EA0L 1DBKH 1HC1A 1QG3A 2FJHB 3O6LH 1ZTXH 3MXWH 4N6QA 4XNYH 2AJVL 1IAIH 5EQ0A 2X05A 3VFWB 3KLSA 1NUGA 3WXVL 4F2EA 4P2RD 4HU2A 4JFEE 2ODHA 3W5MA 5CORA 2YN3A 1Z7JA 2IWHA 3S37H 3UYRH 1L0QA 2HG0A 4R4BA 5I19L 2Z4HA 4OZ4A 1HEZB 1T0NB 4ABWA 2IG2H 3VYPA 4ZMLA 5JW4M 2DEYX 2V3EA 3BAJA 4NRZB 3IDYC 1KGJA 3PGCA 4NC1E 4N5EC 1A5FL 3EDKA 3MV9A 1SNMA 4HMJA 4TLKA 4TQPA 4DPCX 3HG1A 3MRDA 2JA9A 3GSVB 4X7FC 4XB8A 1JZ3A 1B2TA 2Y36L 3B2DC 3WUZA 4BXXH 2H1PL 3EOTH 4L1TA 1K8GA 4OJFL 3IGAA 1JHTA 4MA8H 4JO2L 4F9LA 5E5MA 3UFIA 1BECA 4X5PA 4X4XA 3TZVD 2HFEB 1N5AB 3L1EA 1DFXA 1MPAL 2D8KA 1EFXB 3O8XB 4JJ5B 3K1DA 4HKJB 3DX7B 5D7KE 2G0KA 1N6UA 1GR7A 1MAMH 5I1DB 1EYAA 3ARUA 2YRLA 4KTDL 2YC1A 2PW2B 4CSPA 2Z1KA 1G8ZD 1QMUA 2DQGL 2O5ZL 4U1MA 1DFBH 3MRFA 4DCQA 4DEPC 4EO5A 3L08A 1OSZA 5H8DA 3A8KE 5F7DA 3MNDA 3I90A 4F1SA 3BKYL 3IS1X 1TXKA 5EDSA 3BAEH 3P77A 2FJGA 1QILA 4RSYA 4GG6E 1RZKH 3S2DB 2XNAC 2BY1A 3HI6L 1YYLH 3S5LG 3TFKC 4BDVB 2FX8L 3GMRA 3JC66 3EQLC 1DN0A 2J1YA 2R92H 5D7LB 4AMXA 4MNQE 5C9JB 4P9HL 5E4IA 1PX4A 3OKMA 3IMTA 3BSHA 1HOCB 1PQZA 1ZY9A 1TJHH 1ZS8A 2RACA 1NE3A 1U8NB 4MHHG 1T4KA 2YPKA 4NJAH 5T1IA 4XZUA 2MTAA 2Z92B 2XN9E 2BY2A 5EHFA 3T4AB 4ULLA 2N7SA 3D05A 2HHHQ 4MHHI 5CBAB 1RZGB 2EXSA 2VW7A 4APVA 3RVWD 3V2AR 3JZYA 3ZX1A 7PAZA 3TIDB 2HT2C 4FQQA 1H95A 2APFA 1TFHA 4RQQA 2LR4A 4K23H 2X7LA 2J6EH 1ZA6B 2XV0A 5AL0A 3SY0A 4H26B 4OV5B 4H20H 3K7UA 2FDBP 4Q9QH 2ZCKL 2D2OA 4YGVB 4DFHA 3ARRA 3FFCB 4XX1E 1CK1A 1RZIA 3S4SB 2JSOA 3F1ZA 3J80L 5BUGA 1TQCB 4JR9L 1RF2D 2D2CC 1H19A 2OR9H 4WO4C 5F9WB 3O6FA 4M6MH 5KSAD 1F3DJ 2WSPA 4IOIA 1QW8A 4EUPB 4GAGL 4OCSH 1VGKA 1FRGH 4I1PA 2ZJPA 5GGRA 2MQ0A 4JW3A 3S3BB 4LSTL 4DK6A 2ZSWA 1S40A 4FQJL 3SHSA 4E9YA 4RAHA 4L4VE 1CQKA 3P4NB 4G9DB 4JI1Q 2IAMD 3C9NA 1QZ1A 1DBAL 1D9KC 1LK3L 4OGAD 5CIPA 5B1AB 4ZBJA 2QW7A 4CMMB 1SJHD 4S3SA 1H0DA 3V0VB 2Q87A 1G7LB 2P5WB 4YFDB 4NRXA 2O5JC 2FNWA 4PJ8B 4HJ5A 3PWPE 1T66C 1X3DA 1YY8A 1KLUA 2GVYA 3EXLA 1NICA 1ZMYA 3BDYH 2H3NA 4HHAB 4ADIA 4LF4L 2FT6A 2X53A 2VLRB 2X89A 3VFTA 3D39A 3LHAA 4LCUA 4AQYL 3LIZH 5FA3A 5C09A 4P3WA 4YXKL 3SQBA 4ANKA 5DFVD 2YR3A 4FFZH 3K5NA 1KTLA 5C0JB 5KJ7E 1RIVH 1J1OL 4LMQE 2KKQA 3S88L 3KUPA 4FADA 1CG9A 2PABA 3BP7A 1JG9A 1OAUH 2PYEB 1F9RA 1N0XL 5DSCB 4MB5A 2B08A 3ULUH 3RZWA 3GI9L 2LFGA 3RFZA 5MERA 4NLHA 1TJGL 1ROWA 3MRLA 3FQUB 3AS3A 3QP3A 2F0GA 3BUYB 3L3IA 1SRUA 1EWIA 1FVCA 4WHYG 3A22A 3FQ1A 3QPQD 5IREA 4YSRA 1JWSB 3TPUB 5C6PB 4EDXB 3SYOA 4I4WA 3VFNB 2G9HD 1F41A 2WLLA 4DP2X 3PGDB 5D7IF 3C5ZB 3P73A 4PLJC 2R2HA 4WFHE 4DR5Q 4PGDB 3UAJC 4BINA 1QLFA 3TVMA 5EEUA 1I6HB 4BYHA 4D9LL 2AJUH 1T89A 5M5XB 1K8DB 2R29H 2VGLM 4OD1L 2A69D 2RR3A 2XC8A 5GRZA 3MLWH 1OCOB 1OTSC 3KF8B 3DX4A 3CDFA 3K2IA 4X99B 5CHNB 5KYUB 4UQ3A 1FZMB 4F8OA 3E3QE 4JANA 1BFTA 1E7UA 2DLFL 3V05A 5BO1L 3HNVL 4PEEA 3BUTA 5A2AA 1HH6B 3DDGA 4HC1H 3VXMD 4NNPL 3LN4B 2EDQA 2VRQA 2PZUA 2ICWA 2ID0A 2OZ4L 3MUY1 4GS7C 2B3RA 4HS8L 1EHLL 2L55A 5F3FA 2C9OA 5C2UB 4JFFB 1BIHA 3MLYH 4GRLC 2O61A 5BXFB 4AQ1B 4ZMWA 4K2KA 3EIVA 5KYXB 4Y7NB 5HI5D 1YEJL 3M3YB 1NKOA 3CU7A 1FAIH 1IGIH 2NY2B 4PJIA 4BY7G 4GFXA 3KPNA 5SWQB 1UM4H 5D7JA 4IEFA 2FQFA 2UUDH 1WUZA 1PDKB 3CSPA 3QZNA 1N8ZA 4UV7H 5CWSA 5SWSA 2OXGA 2KHJA 3HMWH 1HWHB 3D1MC 2Z9HA 2WGNB 2XVBA 5EU5B 1NIDA 2COVD 3AXLA 4MTNA 2O5XH 1OCRB 2QZQA 3BUDA 1I3GH 2JB6B 1AHWA 4J23A 2KZWA 4FFWD 5A2LH 2MP1A 4ZYSA 3QO1B 5D96C 1Z0NA 4N26A 4X9GA 2NNAB 4EN3B 5DUJA 1UQSB 4JFOA 2UZIL 1YEDB 4KK6D 5I17A 3LZFH 4QRSB 4AYSA 5F0MB 3H94A 5E8NB 1MCHA 3NIFE 1WZAA 4FQXB 4CDDC 3DIFB 4RAUB 3VXSD 4Q9RH 4PP1D 1UACL 5HVFB 5L2JA 1TYEB 3SQOH 5IVXE 2FR4B 3A8JE 4L8CB 5CAYB 1O7DE 4HULB 4AYBE 3N0AA 3O2DH 4UPAA 5IHHA 3HC0A 2VCOA 4A3JB 5SX4H 4AG4H 1FPTL 5I74B 2DQIH 3CCHB 4Q6IC 4ANVA 4EQ3A 4MDIA 2GPZA 2VR6A 3U6XS 1LD9A 4LLUB 4ETQB 2MUYA 1C8QA 4DH2A 5KS9B 1I1YA 5IROA 3NIFF 2N56A 2HKFL 1BZOA 1E9OB 2H6PB 3D25A 2Q2UA 1GC1C 1YDPB 1YYCA 4LDCA 5TH2A 2CHBD 1HNXQ 5HHNB 3JAME 4WNQB 5TQ0L 3FQNA 1XZ0B 3CX5J 4MJ2A 1BLIA 5AW1B 5LNDA 3FRUA 3QUZD 1Z5HA 1TJIL 4N90D 1MJUL 1RJLA 4NZUL 5A3ID 2GSIA 4KO5A 5C0GB 4A3FG 3V0DA 4WQOA 4P3CL 4W6WB 3ULAB 1YHQA 5IQOA 2JLLA 3QDMA 4RAVA 2GJRA 5DVPA 1DO5A 2PNRC 1SDFA 3QT2A 5E70A 1DVFA 4H0IA 3O6KL 4TSBL 1D5IL 1Q86C 1KV7A 2AABH 4LBEB 3O2WH 4OF8A 4P23B 5CV7A 3AITA 2RQXA 2QA4A 2OYLA 2APWA 1OP9A 2C3GA 2ZX9A 3HA0A 2AWOA 3LZLA 4M6NL 1LUZA 4DR2L 5T1DL 3HBGA 1TETH 1AQKH 1BM7A 4PV9A 4POFA 2D0PA 4MMYA 3CN1A 3FQWB 1Z5YD 1TWGB 3G5ZA 1G43A 4K3JL 3MAQA 3C60B 4I3RL 2UUAL 3DX1A 2I9TA 1JZEA 4PW3A 2KERA 4A3LG 1S9YB 1JNNL 3OC8A 1DTUA 3NFPA 4KK5C 2HVJB 2BP5M 4R96B 1X5LA 2NY5L 4G8EA 2SNMA 3C08L 1AGDB 4QPEA 3LVTA 4H1LB 5HHXL 3BXNB 3LQZB 2NXZC 1QLEB 3MXWL 4FXKB 4ZQKB 1IAIL 4MJJA 1R17A 2H32H 3K2UH 1IVTA 1A14L 3V0GA 3AWFA 3GQBA 1HIMH 2J25A 1FL3B 1RTOA 1R3KA 3B9KB 3N06B 1NJ9B 1II4E 1ACYL 1TJXA 2QSVA 1EIHA 4UOW1 2AQPA 4Y9GA 1TO4A 1LO3H 2RHQB 4A3DH 1UADC 3UYRL 1HQ4A 5C0FA 2CBTA 3L6FA 3H54A 5ICZB 3R2IA 5CSGA 3F7PC 3EGSB 3EROA 2IG2L 1WEJH 3GRWA 3LXCA 2W1NA 5HHQB 4YDVB 4I18A 4AKOA 4MLIA 3BH8B 4EI6B 3V9CA 4K2LA 3DVNB 1SAPA 4KUCF 4UCFA 3U0PB 5LAXB 1NDMB 4MZ3A 4U1KA 2JP1A 5FO7B 3E9IA 4KK8C 3IDNB 3P40A 2IADB 2K5NA 3TN0A 5L6YH 2OMYB 1K8IA 3WEMA 5B38A 1S7SA 1OD7A 1QEWB 3GMOB 2AQ1A 2Y4SA 1TQTA 4IBYA 3TBIB 4MS6A 2G30A 3UBFA 2Q8BL 3W39A 2FECL 3PF2A 4GLAC 2YZ8A 5DFTA 3VR3A 5E1IA 4ELMA 2LE9A 2OI9B 4FYSA 5CZXC 3IFLL 4OU3A 3WNKA 4AE0A 4NUGL 4RFOH 1L0YB 4EIGB 1MAML 5C92A 3ECQA 2J44A 2YJQA 3OKNB 3OWEA 3QAZB 4LCWE 1LMKA 1NGYA 3IT8D 4QRPE 5DLLA 4JDZB 1F4WH 1V3KA 3FBKA 4JX0A 2UVEA 3W9EA 1DFBL 3K4DA 2WBXA 1LTRD 3PQIA 5F7AA 5KG9A 3C5SA 2VDKL 3QS2A 4UANA 4QO1B 3BAEL 4JZNB 4OLYH 3TIEA 4JI4Q 4PVNA 4WV1A 4FGMA 1RZKL 3MA7B 2UWEE 4K8RC 5TFSH 2WZ0A 1F4YH 1YYLL 3UDIA 3K91A 3KCPA 5FM5O 1A4AA 5GRJL 1ES0B 1FNGB 2SEBA 1TQOA 5D3DA 1DUZA 4NPYB 4QXTB 4XP4H 3CXHK 4DV3L 3QIBA 4M4RA 4AV4A 4DK3A 1WS8A 1VQCA 1UOLA 2Z35A 3KGUA 4NJAL 1U8OB 1XAUA 1WFIA 3FCTA 3P3RA 1N59B 3MV9B 2CR0A 2PPEA 1WTXA 4OGZA 3P1VA 5I28A 4Y2DC 2H3KA 2FUQA 5E6UB 4FTVD 3QHZL 2BWIA 4OFQA 3S7GA 4MQ7B 1CXFA 4S0TD 5C07E 5JQHC 2VQTA 3PXHA 3VWJA 1BYOA 5IB5A 2A9NH 2AQQA 3QE5A 1QLRA 4JI0L 1W72B 3QULB 2ENQA 4WUUA 4MBOA 1CFMA 1CICD 1E4KA 2DQDL 2Y2TA 1OARL 2E6PA 4JM2A 3SK8A 2AV1A 4TLUA 4PG9B 2X6LA 1XEDA 1B6UA 2Z93A 3CDYA 4GKZA 4IOFD 1WAAA 2FCBA 1IBMQ 3JUYA 5GJSH 2KQNA 1E4WH 2Q3AA 2FWLB 2WXJA 2W9EH 3NWSA 4RGOH 3C6LD 1S7RB 1KY7A 2VDQB 4F37K 1RUML 1V7ML 8CGTA 5JHDD 2RFXA 2FUTA 1LEKB 3B1UA 5TE7H 3MXGA 1D6EB 1MCSA 4WJ4A 5AVRB 2C3VA 3ES6A 4UQCA 5DVMA 4JKNA 4IRJD 2BDNL 4MMZC 1BGXH 2DM3A 3RWFA 4XBEL 4GN3B 4JN1L 2WIIA 5DMGD 3FQ2A 2Z4IA 2JQZA 3GEWB 2NY7H 4HK0A 4G9FE 1LXMA 4GUPB 1MFVA 4Y9EA 4CJ1A 5I15L 2XN0A 3BDYL 1OW0A 1XCQB 2Z1PA 5E00B 3OWFA 1MRCH 5FUOH 4X6CE 4HJTA 5TE4L 1INEH 4OLZH 4B3ML 4YIQB 3ZK0A 4AVHA 1A6WL 4PRHB 1N9WA 3PAYA 4JO4H 4YSTA 5I0YA 3BDXA 3KS0J 2V2XA 5ELIA 3LWEA 3S98A 5I1CH 4Z3TA 2IOOA 1G6RB 2ADIA 3GTLB 2R7EA 1RIVL 1XTLA 3GDCA 1Y07A 2A73A 2Q9OA 2NPLX 1NCWL 1OAUL 1SNPA 2VB3X 1X3FA 2DI9A 2XFXB 3HHSA 4RBPK 5MP6H 3ULUL 2CIIA 1H5BB 2ARJQ 3BLKA 4LU5H 4YE0A 2EE2A 3VSUA 3QORD 2VRKA 4NENA 3IDUA 1MF2L 1QA9B 5C4JH 4KNUA 5GS0H 1GSKA 3O6FB 4DP4X 1J8HE 1HKFA 3VNYA 1MIMH 3L4YA 4PRPE 3VX1A 3UROR 3FO1B 1VGKB 5TF1H 4CUCA 3BSZH 2DWSA 1ONQB 4LVNB 4ZPVA 2ZSWB 1N10A 1HHHA 2ESVB 3PP3H 5K59E 4P5MA 1SXTA 2Y2YA 4YHNA 4NN6C 1KXLA 2AJSH 2EE6A 3HLKA 3QJFB 3DLLA 1PEZA 1U41A 4X4MA 3WNPA 1SFHA 4QOKE 4XI5C 3E1F1 4HAGA 3B2PA 1RHFA 2IALA 2V8LA 3DROA 4OFYD 1XJVA 5KVDE 4PJ6A 4F87A 3VR6A 1RUQH 5FYJH 4BRJA 1IGMH 4NRXB 5LO7A 4FF9A 2WLHA 3CHRA 4JI6Q 1BVSA 5LGJA 5LBGA 1HNWL 3KVDD 2EUZA 2R7ZH 4JO1L 4MD5A 3DXAA 1A15A 4G8GE 5J1AA 5GZND 3KXFE 3VRLF 5F3BA 4UZSA 3TV3H 4HC1L 2GY5A 1QEXA 3E6FA 4AYBB 3IXAA 4N6RB 4ODXA 1E1TA 4Y4HA 5E7BA 3IMWA 3RWCB 3L5XL 4DR6L 2EXWC 3DVGA 3U82B 3SY6A 4XNUH 3MLYL 3MLRH 4L4TE 5IEKA 1GL4B 2YV5A 5EU6E 4L05A 4NWUL 4WKZA 2ADGB 2YOAA 2XTJE 1FAIL 1IGIL 2RQEA 1YO4A 3B7YA 3CZGA 1ZT7A 4J2XA 3PNWB 1UZ6F 2CIKB 4MJIE 1PF3A 1DANT 4FG4A 2BSEA 2VE6B 1M6OB 4JI2L 1M3JA 4LRIC 2K4WA 4UV7L 3IDXH 4PJ7A 2WKGA 4WHTA 3HMWL 3JWNE 3BMVA 3A7LA 2AKRB 2DF3A 1QO3A 4ZKCB 1I3GL 2VXTH 3HVDA 5MEQA 2K52A 2L3BA 2DKUA 3US9A 1BEYH 3GTNA 2HN7B 1EQWA 2YGOA 2QR0A 5AVYB 3UO1L 5LUMA 4BBRH 2EXZA 4UF7C 3LZFL 3NSJA 4ODHH 3RKDD 4UM9B 3VG0L 4LFAQ 1MFNA 4PR5B 2EO7A 1NGZA 1R5IB 3FU9A 3JVGA 1ETB1 2F4VL 1IBDA 2AQNA 4KROD 4JANB 1EO5A 4JKLA 1N26A 5CNHA 3WL9A 1A6ZB 3CUPA 3MRIA 2C3XA 3WJMA 3QIUD 3AYHB 2WM0A 3O2DL 4N2DA 4P9ML 3V4VB 4AT6B 3O41B 4D94A 4ZO9A 4OD3H 5JYLA 5AW9B 4K07A 3X13A 4RGNC 1CDYA 4ZX4A