1EQQA

Single stranded dna binding protein and ssdna complex
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
114
structure length
114
Chain Sequence
ASRGVNKVILVGNLGQDPEVRYMPNGGAVANITLATSESWRDKATGEMKEQTEWHRVVLFGKLAEVASEYLRKGSQVYIEGQLRTRKWTDQSGQDRYTTEVVVNVGGTMQMLGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-R(*(5MU)P*(5MU)P*(5MU))-3'
publication title Roles of functional loops and the C-terminal segment of a single-stranded DNA binding protein elucidated by X-Ray structure analysis
pubmed rcsb
source organism Escherichia coli
molecule tags Replication/rna
total genus 14
structure length 114
sequence length 114
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2000-04-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00436 SSB Single-strand binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1eqqA00
4X65Q 4DK6C 1HR0Q 1OXVA 2QGQA 3KDFB 2YYZA 4YHHQ 3J81i 4LF6L 4A3FG 2R93H 1Y1VH 4GLXA 1FJGQ 2ZTDA 1UE7A 2QEXA 1LM0A 4LWCA 4MNOA 5IWAQ 5C44H 2KHIA 3B6YA 3A0JA 1A62A 1V43A 4JI2Q 3JAMi 5IYDG 4A3IG 4PMWA 1JJCB 1N34L 1KD1C 1D8LA 3EBEA 3ER0A 3PUXA 2I5MX 4JI1Q 2YTYA 3E9HA 4GS3A 3I55A 1Q1EA 1KC8C 2RHSB 5GAHC 2JQOA 2OQKA 1PH9A 1HZBA 4JI5L 4HIDA 1UEBA 3WWVA 1VQMA 2UXBQ 5BR8Q 3J7ZC 2Q2TA 1PH3A 4A93G 5M5XH 3F2CA 4BBRH 2OQ0A 3HOZH 3ERSX 1A63A 3D0FA 3CQZH 2F3IA 3KDFA 3RN2A 1N36L 4JI8L 1VQ9A 4R1JA 4MZ9A 1YEZA 1IBLL 2JA8G 4NXMQ 2VL6A 3ZJYC 4X66Q 4A3JH 4B3SQ 5GADC 1KL9A 4LUVA 5IP7G 1XNQQ 4UP8A 4AQYL 2GVAA 5LMUQ 2E2HH 4OWXB 4ALPA 4KLKA 3TQYA 1XNRL 3KLWA 2NVTH 4IOAA 1EFWA 3J7A5 4QL5A 4X62Q 2ZM6Q 3PCOB 4DAYB 1Q12A 1X3GA 2BA0A 3G48A 1JT8A 1SROA 1XPOA 3ICEA 1JJ2A 4DR5L 2HHHL 4A3LH 3CD6A 1SMXA 1OXSC 3U4ZA 2D0PA 2ASBA 2WFWA 1E3PA 1S3OA 5AJ3L 1WCMG 4GLAC 2R7DA 1VQ4A 4LF9L 3L2PA 4JV5Q 2JEBI 5IY0A 3CCUA 3KJPA 1HZ9A 1PH7A 1QUQA 1T9HA 3I2ZA 1P16A 4PZ6A 1HNZL 1NE3A 2UUAL 3H3VI 3I4MG 4R4TA 1Y1WG 5FJ8H 1I6HH 5FLMG 1FL0A 3K80C 3NEMA 3PGZA 1LYLA 3G4SA 3M4OH 1IYJB 2CKZB 2VUMH 2PI2A 4JI0Q 4LF8Q 3I4NH 1SR3A 4A3MH 3AYHB 2CWPA 1Q86C 1I94L 3HOWG 3CC7A 4HIMA 1M1KC 1HR0W 3PUWA 2YV5A 2F4VL 4DUYQ 4A3FH 4DV7L 3J81c 3CCLA 4LUOA 2K50A 2L15A 3S24A 4Y7NH 4TQUS 1YJWA 4KHPQ 1CKOA 4DUZL 3K8AA 2R7FA 4C2MH 1I5FA 4DR4Q 2BA1A 4DV0Q 4QQBX 2WAQG 3CMAA 4A3IH 5IYDH 2K4KA 3I4OA 4JG2A 2BH2A 3JAMc 1YBYA 2RHQB 4A3CH 1VQHA 4GOPB 2JA7H 2JA9A 2IX1A 2DGYA 1W3SA 1PH8A 4OXPA 1E24A 3STBC 5GROA 3LGJA 1Q8KA 1ASZA 2N3SA 4C3HH 3KF6A 3GO5A 1AE2A 4BY1G 4P73A 4EX5A 3CCRA 4IO9A 2ZJPA 4A93H 2MNAA 1Q82C 2NVQH 3HFZB 4POFA 3RNUA 1XMOQ 2AKWB 1JMCA 4DR7Q 4A3JG 1D7QA 3FP9A 3CC4A 3TREA 1OXUA 4JYAQ 1WFQA 3JC66 3KOJA 2K5NA 4A3EG 2NN6I 2JA8H 1GO3E 4JI3L 4A3DG 4QJFA 3RLNA 5IP7H 3J81j 1XMQL 1OTCA 2ALYB 1G6PA 1X56A 4JBWA 4XIGS 2BH8A 3PUVA 1HZAA 4JBKA 3PF5A 1G51A 5JJLA 1BBWA 1BKBA 2RCNA 4GOPC 4IJHA 4GOPA 3CCEA 1HNXQ 4A3LG 1NMGA 1PV4A 4DV1Q 1VQNA 4LFBL 1WYDA 1MJCA 4DKAC 2KCMA 3T1YL 3CCJA 3S17H 5JJKA 3EIVA 1AH9A 3H15A 2KHJA 2VQFL 4LF5Q 4OWTB 2UXDQ 5HGQA 1GD7A 4DV2Q 4L5TA 1N33Q 4RMFA 3ULJA 2ZJRA 3PO3G 5DLQE 1P8LA 4EQ5A 1KAWA 2UUBL 1PVOA 3OYYA 2IT1A 5C0XI 4GLVB 3I4MH 1N9WA 2A19A 4JI7Q 2WAQE 4LF7L 2PMZE 1UE6A 4H02A 4DV4L 1Y1WH 5FLMH 2JK8A 3KFUA 3HOUG 2LSSA 3F2BA 1XJVA 4HIKA 1TXYA 2K52A 4DV3Q 1KRTA 5C4JH 2E2IH 1BBUA 3M85A 1TWAH 2EQSA 3AQQA 4X65L 1NBWA 1HR0L 3HOWH 1HH2P 3DM3A 4YHHL 4OX9Q 4DV6Q 1R9TH 2R7ZH 1FJGL 4BY7G 2AWOA 4APVA 3S1MH 2GVBA 4DR6Q 1WI5A 1Q7YC 2JA7G 2UU9Q 5IWAL 2Q2HA 4DNIA 4JI2L 4JBJA 3GTJH 3BZCA 2B3GA 3PUYA 2UXCQ 4BBSG 1X9NA 4JI1L 3HOYH 4GN5A 3RN5A 5IP9G 1E7ZA 2Q2IA 4XTCS 5H1SE 2PNHA 3NENA 2CWAA 4DR3Q 5LMNQ 4GN3B 2KBNA 2NN6G 1G291 1U5KA 3S2HH 4BY1H 2UXBL 5BR8L 3Q8DA 1QUQB 1VQPA 4Y52H 2A1AA 3CCSA 4A3GG 4LF4Q 1KHIA 3W1GA 3GTPH 3F1ZA 3A5UA 4WJ3M 1TWGH 2D62A 1L0WA 1J5EQ 1C7YA 3ULLA 4A3EH 3GTOH 4KHZA 1XPRA 3PIOA 4A3DH 4NPSA 4RG1A 4NXML 4B3SL 4X66L 1A8VA 3KJOA 2IHEA 1XNQL 4X64Q 3S16H 1YHBA 4DK3C 2DUDA 5LMUL 4A3BG 3EN2A 2C35B 1WJJA 1VQCA 2Y0SG 3RZDH 4X62L 2ZM6L 4P74A 3HOXG 4HJ7A 5FLXc 1SLJA 3CMEA 3TRZA 1YIJA 1EYGA 2AWNA 5C0XG 3H3VH 5K36G 1YHQA 2N49A 2HIVA 2VS1A 3W1BA 4GNXC 4GNXA 5C0XJ 1K8AC 2UUCQ 4YCVA 4UP9A 2K5VA 5M3FG 1MJEA 3PO3H 4YY3Q 1OXTA 3HOVG 4JV5L 1EIYB 1IBKQ 3F2DA 1FGUA 2JA6G 1QVFA 4PZ8A 4A75A 4POGA 3KF6B 4PZ7A 1GM5A 5HY6A 1PHJA 1V9PA 4WJ4A 3K7UC 1IZ6A 1NMFA 1Q1BA 4J15A 4P71A 2ZJQA 3HOUH 4YWMA 3PF4A 1VQLA 4B3RQ 3CAMA 5J3BA 4YCWA 3T1HQ 2CCZA 1E1TA 4JI0L 1YNXA 4LF8L 5IT9c 3A74A 2RF4A 3STBD 2R7ZG 4A3KH 1VCIA 4IPHA 4LUZA 1IXRA 1YITA 2IHFA 3GTMH 1Z9FA 4ME3A 4DUYL 1B7YB 3AFPA 4DV5Q 4KHPL 4BY7H 1YVCA 2VQEQ 2B63G 4DR1Q 2NVXH 4B3TQ 1CKMA 4LFAQ 4KI0A 3D31A 3RLOA 4DR4L 1B70B 2ZTCA 4DV0L 1IBMQ 4NXNQ 1HNWQ 5C4XG 3HOYG 3ULPA 4JOIC 4A4IA 3H0GG 4JOIA 3CCMA 2D0OA 4BBSH 3M4QA 5IYBH 3G71A 1VQKA 4GKJL 3MXNB 2JE6I 5IP9H 1Q46A 2Y0SE 3E9IA 5IE8A 3MEFA 1RIPA 4IPDA 3PIPA 3HKZG 3BZKA 4UP7A 1I3QH 5LMNW 2JA5G 3U4VA 2Q2UA 1B8AA 1NTGA 4HJAA 3RZOH 4C3JH 1V1QA 3OW2A 4K0KQ 1HZCA 4A3GH 1DGSA 1ASYA 2CQOA 1XMOL 2E5LQ 4DR7L 2IY5B 3OTOQ 2ATWA 2GN5A 4JYAL 4A3BH 4TVAB 1OXXK 1TWFH 3GTQH 1EIFA 4AIMA 4JI6Q 2WB1G 2R6GA 3FHWA 3HOXH 4JI4Q 1SRUA 2B29A 1SFOH 2I5LX 1HNXL 4B3MQ 3CXCA 1VQ8A 4DV1L 1TWHH 3FKIH 2PQAA 3PSIA 1PH2A 4X6AH 3S1NH 4LF5L 4LFCQ 4YWLA 2UXDL 1VQGA 2AHOB 4DV2L 1L1OC 1N33L 1L1OA 3CPWA 5M3FH 2NZOA 2VZAA 3HOVH 1VQ6A 2N78A 5JEAG 3U58A 1XTDA 2JA6H 1PH5A 3CCQA 4DR2Q 2HT1A 4O0AA 4JI7L 5GAEC 5JEAJ 1CSPA 5M5WH 3CCVA 4HIOA 1K3RA 3PO2G 3DLLA 1EQQA 1S40A 2ES2A 3F8TA 4A3KG 4JC0A 2ID0A 1UE5A 2K14A 4QY7A 4DV3L 1M90C 1N32Q 4FDBA 4QGUA 4R4IA 4HJ8A 1VQ5A 1LTLA 2XTIA 5M5YH 1JE5A 2EXDA 1FVIA 3HKZE 3M4PA 1HJPA 4OX9L 1C9OA 4DV6L 1EWIA 3PUZA 2QA4A 2I0QA 4LF6Q 2B63H 4NB3A 3KYHC 1XPUA 1LUZA 3G6EA 5EAYA 2VW9A 4DR6L 1E22A 5C4XH 3W5OA 5E7NA 3UE0A 5IYBG 3UDFA 1VQOA 4DAMA 2UU9L 3H0GH 1TWCH 3GD7A 2F52A 1CKNB 4BXXG 1W2BA 2UXCL 1VQDA 1N34Q 4GNXB 2WB1E 3L7ZC 3TS0A 3L0OA 1PA6A 4DR3L 4BA1I 2JA5H 5LMNL 2JEAI 2NZHA 1H95A 2MO0A 2OTLA 1PFSA 4JI5Q 3SGIA 3CW2C 3K0XA 4UY8C 2YTXA 4R4OA 4LF4L 3KF8B 4IJLA 1J5EL 1KRSA 4IPCA 3M7NA 1N36Q 4JI8Q 3BU2A 4LNQA 1X54A 2CFMA 4A76A 2VY3A 4GKKL 3NELA 4X64L 1IBLQ 1PYSB 4LW1A 1K9MC 4AQYQ 2OTJA 3GTKH 3FKIG 1CKNA 1Q81C 1XNRQ 1VQIA 5GAGC 4O2DA 3J80i 1VQBA 2LXJA 2WP8J 2XGTA 5JJIA 1YJ9A 3NBHB 4GN4B 4DR5Q 1PH1A 2K75A 1X65A 2HHHQ 1VQ7A 4OO1I 2UUCL 1JJGA 3UDIA 3BJUA 3AEVA 4YY3L 1X6OA 5AJ3Q 1IBKL 4LF9Q 1X55A 1K73C 2VNUD 2V1CC 4L5SA 1O7IA 4AYBG 1J6QA 3UE1A 2UUAQ 1HNZQ 3PO2H 5IYCG 4IOCA 5M3MG 3M3YH 4B3RL 3GDEA 4L5QA 1I50H 4JCVE 3T1HL 3TS2A 5C3EG 1EQRA 1U0LA 3GTGH 3S1RH 3AFQA 4HJ9A 4IFDI 1QVGA 3S2DH 1S72A 1MKHA 1I94Q 4GKKQ 4DV5L 1EUJA 2E2JH 2F4VQ 2EIFA 1VS0A 4DV7Q 2VQEL 2R92H 4PG3A 4DR1L 2R93G 1Y1VG 1JB7A 4B3TL 4LFAL 4DUZQ 3HKSA 1YHAA 4C3IH 3S15H 1HNWL 2NVYH 4NXNL 2PI2E 3M9BA 1IBML 1EOVA 2OWOA 2A8VA 2PQAB 4BXXH 4R4QA 5C44G 4QIWE 3CC2A 1K0RA 2OCEA 3A5ZB 1PYBA 4OONA 4JBMA 1L1OB 2MQHA 3IRBA 2AMCB 2KCTA 1UWVA 1YI2A 3S1QH 3E0EA 3VDYA 4AH6A 3TEHB 3UDGA 1N8RC 4GKJQ 3CPFA 1YJNA 4K0KL 3CP0A 1GKHA 5ELOA 3S14H 4YWKA 2E5LL 2IX0A 1VQJA 2K5HA 2JJQA 2E8GA 4BBRG 1SN8A 3OTOL 3CF5A 3HOZG 4MTNA 1K8GA 1QZGA 4P72A 3UDXA 2ZTEA 4IPGA 1X3FA 1WOCA 3RLFA 1NY4A 1Y14B 4JI3Q 1CSQA 1KXLA 3K81C 1XMQQ 4JI6L 4AYBE 4A3CG 2KENA 4P75A 1L2FA 4OO1G 4JI4L 2YTVA 4DPGA 1KQSA 1SE8A 4B3ML 1X3EA 5GQOA 4L5RC 1Z47A 1VQAA 3J80c 4HJ5A 3PV0A 3GTLH 1QVCA 4LFBQ 1PH4A 4LFCL 3T1YQ 2MFIA 1IL2A 1MIUA 1KIXA 3K7AH 1UE1A 2LXKA 2VQFQ 4OWWB 5ELNA 2H5XA 2HIXA 1YZ6A 4YCUA 1QZHA 2Z0SA 3RR5A 2HQLA 2N8NA 2UUBQ 4DR2L 1PH6A 1RL2A 2YU9H 4IFDG 4BA2I 4UPAA 5IYCH 3I56A 1WCMH 1AE3A 5M3MH 1C0AA 3I7FA 1E1OA 4LF7Q 4DV4Q 1VQEA 2FXQA 1NJIC 5FJ8G 4R4CA 2MO1A 5C3EH 2Z6KC 4IFDJ 2Z6KA 1N32L 1BVSA 1CUKA 1K83H 3U50C 1VQFA 1A0IA 2I5HA 2R92G 2VUMG 3I4NG 1GVPA 4A3MG
chains in the Genus database with same CATH superfamily
1B53A 1OXVA 3VR4A 4YHHQ 4KJOA 3BVZA 3PIP3 1Y1VH 2B2UC 2I46A 4NW2A 1FJGQ 4BY7B 2ZTDA 3C1FA 3ND9A 4MNOA 5LL6X 5C44H 1A62A 5IYDG 1KD1C 3EBEA 1LABA 2JXMB 4TKOB 5AFWA 1QB5D 3VA7A 2OQKA 5GAHC 3BG3A 2A68C 4YIJA 4JI5L 1LTGD 1GUOA 2UXBQ 5BR8Q 2EDGA 5KNDA 5I2XA 4UHVA 1HTLD 4KY6A 3RZOB 3F2CA 3HOZH 3ERSX 4A3GB 2JA8B 1A63A 3GV6A 1RHPA 4R1JA 4MZ9A 4J1MA 3NTIA 1YEZA 5T1GA 2JA8G 2O5JC 5CV7A 1TWFB 3T16A 2GVAA 4AQYL 3GTQB 4IOAA 2A69D 1EYCA 1XWEA 1EFWA 1ONLA 2L9HA 1MGSA 3EFXD 3PCOB 4DAYB 3MWYW 1JOQA 5JPMC 1SFOB 1EY6A 3G48A 1JT8A 3ICEA 1JJ2A 1K0SA 1CZWA 1SMXA 2D0PA 1E3PA 1S3OA 3IKJA 5AJ3L 4GLAC 2OF1A 1WD0A 2KJXA 3CCUA 3KJPA 2JA6B 1PH7A 3H3VI 4DK1A 5FO8B 5FLMG 3K80C 3NEMA 1C48A 1IYJB 4IALA 4JI0Q 3I4NH 4A3MH 1Q86C 1I94L 3P75A 4OGQC 4HIMA 3PUWA 4DN4M 2F4VL 3BYTB 4R8NA 5F2DA 3CCLA 3S24A 2K50A 4KHPQ 1JORA 1CKOA 2DNCA 5DAUA 3ITPA 4DR4Q 2EY1A 3CMAA 5C4XB 1WTQA 3HOYB 5IYDH 2BH2A 1VQHA 3PMFA 3AU7A 2F0QA 1PH8A 1NAPA 2EYLA 3HKZB 3CCRA 3GO5A 4IO9A 2ZJPA 3I4LA 1Q82C 4G57A 3SK5A 4MTKA 5DM63 2FMCA 4A3JG 4NDXA 3CC4A 3NQIA 4HMJA 5E4XA 3QOLA 1OXUA 4JYAQ 1WFQA 2JA8H 4JVZA 1GO3E 2K32A 1OTCA 1ZKOA 2TSSA 2B2WC 4JBWA 3OMGA 1PTOH 5FO9B 1HZAA 5D3IB 1SAPA 4HMIA 2F0HA 1BF4A 1DOKA 5I6YA 2Z9HA 4DV1Q 4LFBL 1STHA 4DKAC 2QF7A 3CCJA 3EIVA 3KLRA 4OWTB 2KEDA 1BQQT 3MXNA 1EWHA 1N33Q 5E4WC 3NQTA 3TZDA 3I3CA 3VR3A 3MXPA 2L12A 4FVMA 1N9WA 2A19A 4R8IA 4JI7Q 4H02A 4JK1C 4HAEA 5FLMH 1V1OA 2LSSA 2K6AA 4HIKA 1XX8A 1KRTA 2E2IH 1BBUA 3M85A 2MUYA 2X69A 2V4DA 3IAYA 2C9OA 1HR0L 3SK8A 1HH2P 1II3A 1LT4D 3HGBA 4QUFA 1EEID 2SEBD 1RTNA 5ISRA 4NP5A 2E2JB 3QO2A 1MSHA 1TKWB 1T5XD 2JA7G 3Q0AA 2IPKD 3JAML 3GTJH 3G6JB 3PUYA 5C5MA 4JI1L 3HOYH 4GN5A 3RN5A 1EU4A 4XTCS 2CWAA 5LMNQ 4C1NI 3S2HH 1NR4A 4KN4C 3Q8DA 4WJWA 1BR9A 1KHIA 4LAAA 3KLSA 4WJ3M 4KHZA 4RHRA 5I6WA 3PIOA 1XPRA 3FVQA 4NXML 3SK6A 1A8VA 4GKKQ 2IHEA 2RQXA 5G3LD 4DK3C 5LMUL 1E0BA 5DEHA 3HP3A 1WJJA 2WACA 3HOXG 3FKIB 5FLXc 1G6ZA 1E2ZA 4RKBA 5EGTA 4Q0FA 2RDFA 2NWGA 1K8AC 4UP9A 1OXTA 3HOVG 4ZAIA 3V2TA 2Z4HA 1FGUA 3Q24A 2EY2A 3KF6B 4PZ7A 1GM5A 3K7UC 1IZ6A 3PF4A 4YWMA 1PMRA 1VQLA 1D1IA 3T1HQ 2DJGC 3VYSA 1S5ED 2FFKB 2A69C 5CC4A 1K83B 2GA4B 3STBD 2R7ZG 1VCIA 1ESFA 1IXRA 3AFPA 1YVCA 2VQEQ 4DR1Q 4XQNA 1ICFB 2R93B 1DONA 3D31A 1AEXA 3RLOA 1B70B 1HNWQ 2ZXPA 4A4IA 4JOIA 2CH4W 3NBHA 1TS5A 4IQZA 1VQKA 3E9IA 1J9OA 5T1IA 1G2TA 2K5WA 5BN4A 5CV9A 1NTGA 1TQOA 3J80E 4HJAA 2LY7A 4K0KQ 2PNRC 1DGSA 2E5LQ 4DR7L 3BDCA 2IY5B 4BBRB 2GN5A 5C5LA 4EQOA 3HG9A 1B1ZA 4KN7C 4AIMA 3R8BA 1A3TA 1O7ZA 3S1NB 1D5XC 3HOXH 2NVTB 2I5LX 1HNXL 1ICWA 1BCPD 3CXCA 3FKIH 1WD1A 2OT2A 1PH2A 4LF5L 1VQGA 2D2CC 3HOVH 3U58A 1YNND 2DY7A 2G5DA 3CCQA 4DR2Q 4O0AA 4P2CB 5KNBA 5IGCA 1GJXA 3F8TA 1EQTA 4KK7A 4QY7A 2E2DC 5IT9L 4R4IA 3NPPA 2XTIA 3M4OB 1FVIA 2XNAC 3HKZE 1HJPA 4DV6L 3PUZA 1EWIA 2B2TC 4DNRB 4A3FB 1XPUA 2F0NA 1E22A 2OEOA 5E7NA 3UE0A 4C3IG 3UDFA 3PQIA 1EWCA 4C2MB 4IUPA 2RSOA 2F52A 3H3VC 5EPLA 4GNXB 3L0OA 3M7GA 4V0BA 5COYA 3I70A 1PFSA 3CW2C 3K0XA 4UY8C 4C3HB 2DNEA 1STYA 1EY4A 1MD2D 2NVQB 4JI8Q 3BU2A 2KCCA 1X54A 2CFMA 4PQXA 3NELA 2EYPA 3BZDB 3C1EA 4PMCA 1LTTD 1XNRQ 1CKNA 1LV9A 1Q8IA 4DXFA 2SDFA 4O2DA 2LXJA 2EPBA 2WP8J 1TY0A 5JJIA 3NP8A 2A5HA 1UUPA 4DR5Q 2K75A 1X65A 1WTVA 3UDIA 1DZ1A 1X6OA 2RA4A 4H7BA 1ILQA 1B3QA 1CQFA 4CGYB 2V1CC 1SNCA 4L5SA 1O7IA 4WRDA 2UUAQ 4OL7A 1F2YA 2I07B 1JOKA 4JCVE 1GHJA 1EQRA 1F9PA 3BYYB 1LTBD 3QG1A 1MHWC 3CRLC 3QIAA 1R9TB 4DUZQ 4C3IH 3S15H 2NVYH 4NXNL 4DF7A 1EOVA 3V96A 1L1OB 3IRBA 4K5WA 2AMCB 2KCTA 1YI2A 1NNXA 1H9MA 4MHEA 3SR1A 3CPFA 1YJNA 5ELOA 4BY1B 1QWYA 2F0WA 1LACA 2K5HA 2QDLA 2BOSA 2F0KA 1BNZA 1I6VC 4U673 5I9OA 3BS1A 2IL8A 4IPGA 1WOCA 4J8QA 1Y14B 4JI3Q 5A2QE 1CSQA 3K81C 1XMQQ 4JI6L 4A3CG 4FF3A 1L2FA 1A3UA 4DPGA 1SE8A 4B3ML 4K8JA 5JVG3 2ZXRA 1ML0D 3T51B 1IYUA 4YCUA 1QZHA 2Z0SA 2Z6BA 2Q8IB 2HQLA 1GUTA 3R2IA 2F4IA 3RUZA 1VDZA 4IFDG 3DUZA 5KEEA 1VMPA 1C0AA 2HD3A 1E1OA 3I7FA 4IUNA 3FMCA 4LF7Q 5NUCA 1NJIC 1N32L 3HOUB 3NSWA 4Q5VA 3U50C 2I5HA 3OPOA 2R92G 4QF4A 1UNSA 4DK6C 1BCPC 4ME5A 2YYZA 5ELDA 2A73B 3NBIA 4N9PA 2XWJB 3GTMB 4GLXA 2CW0D 2EOTA 1HUNA 5IWAQ 3DHQA 3B6YA 1YNNC 3A0JA 4JI2Q 1JJCB 3ER0A 3PUXA 1SYCA 4BBSB 2YTYA 3R93A 2XIWA 5FLXE 1PH9A 1HZBA 5KNCA 4HIDA 1UEBA 1VQMA 1HHVA 2WINB 3J7ZC 1PH3A 3CRKC 4A93G 5CV5A 4X3UA 1ZYRD 2F3IA 3KDFA 3RN2A 1N36L 3EQLC 1AW7A 1GUWA 3QWNA 2E76C 2F1MA 4B3SQ 4X66Q 1CHQD 1XNQQ 1LTRD 5GADC 5IP7G 4A3CH 4A3BB 1QILA 3TQYA 3MZ5A 2EXZA 1CK1A 1DCZA 4RFBA 3J7A5 4X62Q 2Y0SB 2ZM6Q 4I65A 1I4PA 1X3GA 3J81E 1SROA 2JN4A 1PTOD 1TWHB 2EZVA 1HPCA 3HZXA 2ASBA 1SNMA 3K5OA 5CR3A 5G3LF 4JV5Q 1QUQA 1T9HA 2F0LA 1HNZL 2Q8RE 2K03A 5A2QL 1YNJC 4R4TA 1Y1WG 2VB3X 3PGZA 3G4SA 1LYLA 2CKZB 2PI2A 4LF8Q 1SR3A 2L55A 2PYKA 1HR0W 4DUYQ 4LUOA 1YJWA 1I5FA 4KKUA 2BA1A 2B39A 4U68A 2K4KA 4JG2A 2RHQB 3G7LA 1W3SA 1AE2A 3GTPB 4A93H 1SMYD 3MFYA 4POFA 2B8FA 1XMOQ 2AKWB 2N88A 1D7QA 4TSSA 3FP9A 1A2TA 3TREA 3KK7A 3S16B 4MN3A 1K28A 4QJFA 5IP7H 4RGTA 3J81j 1JOOA 2ALYB 4X3KA 1X56A 5EQ0A 5IGFA 3PUVA 2WB1B 4JBKA 1G51A 1BKBA 4GOPA 4ZLTF 1NMGA 2G9HD 1PV4A 5BN5A 3DWPA 3NK9A 5JJKA 1AH9A 2EYMA 3H15A 4DV2Q 4RMFA 3ULJA 2ZJRA 3PO3G 1HRJA 1P8LA 2UUBL 1PVOA 3OYYA 2IT1A 1STEA 1C8CA 4DAVA 1B2TA 1Y1WH 1UE6A 4DV4L 1BCPF 2JK8A 3KFUA 2XWBB 3NWSA 1TXYA 2K52A 3AMUA 5C4JH 2EQSA 3AQQA 4X65L 3D4DA 3J81L 4FXDA 3S2DB 4Z9CB 4BY7G 1WTHA 4DR6Q 3KUPA 2Q2HA 1F2LA 2B3GA 1ZEQX 1X9NA 3TDQA 2DJFC 4C3JB 4DR3Q 5K5PA 1G291 1U5KA 3LX0A 3S1QB 1GUGA 1VQPA 3NTHA 5KYIA 4A3GG 3GTPH 4CKEA 2D62A 1L0WA 3ULLA 4FYDA 1F9SA 4RA8A 3S16H 1B3AA 1KAAA 3OSOA 2CW0C 3FDTA 3SK4A 3RZDH 3I90A 1SLJA 1Z7TA 1EYGA 2AWNA 4FF4A 1YHQA 3TP5A 4F7XA 2VS1A 3GTLB 3K7AB 3PO3H 2K5VA 3OWFA 4YY3Q 3DMUA 1EIYB 1KLGD 2JA6G 1EY5A 1ZYRC 4POGA 3SHLA 4PMBA 3A54A 5FK9C 5M5YB 1SNDA 3BVMA 5J3BA 3T4AC 4KTAA 1YNXA 4L8JA 2B63B 4LUZA 4XQQA 1YITA 1XTCD 4BY7H 2B63G 1PTOC 1CKMA 4LFAQ 1BDOA 2ZTCA 4DV0L 5C4XG 3HOYG 1GUNA 4JOIC 3CCMA 1B50A 2D0OA 3C46A 2EY5A 2LKVA 2JE6I 1Q46A 2Y0SE 2M00A 5IGDA 5IE8A 1EFID 1RKNA 1SBBB 3HKZG 3BZKA 4EGVA 4IURA 4DK0A 3T53B 3RZOH 4C3JH 1V1QA 4A3GH 2CQOA 4RGMA 2XSCA 1GHKA 3OTOQ 2ATWA 1A15A 1S4ZA 4GZYC 1WTXA 2F0DA 4TVAB 1TWFH 1U4RA 3GTQH 2H4OA 1SJED 3SVMA 3FHWA 3CKIB 1SFOH 2B29A 4OEMB 4I7ZC 1VQ8A 2X6GA 4EQNA 2PQAA 2KA7A 4LFCQ 1D5MC 3MXUA 2UXDL 3TP8A 1SYFA 3ONAB 2JA6H 3GP7A 5EPJA 1XXGA 4I7AA 2IWHA 2F03A 5C3WA 5GAEC 1K3RA 4RH6A 4G7OC 2ES2A 4JC0A 1M90C 1UE5A 2PQEA 4DV3L 4FF2A 1I6HB 4FDBA 1LTLA 5M5YH 1JE5A 1AP0A 2VUMB 4OX9L 1C9OA 1R4QB 1AFPA 1CQVA 2B63H 3NWTA 4Y7NB 5D65A 1VQOA 5C4XH 3W5OA 2UU9L 4OIKA 2MJ8A 1CKNB 4BXXG 2MPMA 2UXCL 4A3IB 1VQDA 1F9RA 4KKTA 2WB1E 3TS0A 1PA6A 4BA1I 4R9WA 2NZHA 1TU2B 4JI5Q 3SGIA 1UAPA 4LF4L 2EYOA 3MFGA 5CBEE 3KF8B 1J5EL 4XYQA 1KRSA 4IPCA 3EVQA 3GV3A 2VY3A 4ODGA 4X64L 1EL0A 1PYSB 3D4WA 4ZK9B 4AQYQ 3FKIG 1VQIA 1W6JA 3OIQA 4QCLA 4IUQA 2XGTA 3ND8A 5IOCA 1H9KA 4GN4B 3F2UA 1PH1A 3S17B 2LS01 2UUCL 4KD4A 5AJ3Q 1IBKL 1SYDA 1WCMB 2EJGC 1J6QA 1M4VA 3I4MB 3MTSA 4IOCA 4B3RL 2AUJD 2LFNA 3GDEA 4L5QA 3RMHA 3C2PA 1PTOF 1HXYD 2EE1A 1WTRA 4HJ9A 4ID6A 2A6ED 5EBCA 4IFDI 1I94Q 2ENBA 1SYBA 4RKLA 3HOWB 4DV5L 1EUJA 2E2JH 2KOLA 2F4VQ 1A6XA 2R93G 4B08A 1JB7A 4B3TL 1ESRA 3HKSA 1IBML 1J8IA 2OWOA 4N8FA 3S1MB 4BXXH 2WAQB 1K0RA 3PIO3 4OONA 5LHY1 2O5IC 4OELB 1UWVA 1V1PA 3VDYA 2EVBA 2RKSA 1GKHA 4BBRG 2E8GA 3CF5A 1QZGA 1TWGB 3DM1A 3RLFA 4K5VA 2B2VA 4A3EB 1NY4A 2EYFA 4A3DB 1JQYD 4XT3B 1I4XA 4JI4L 4CKBA 4EVOA 5TSSA 4HJ5A 5KRUA 4LFBQ 2F0TA 1MIUA 1KIXA 2K28A 1UE1A 4XDXA 4CJ2C 4XT1B 1TR5A 1YZ6A 3P1HA 5CORA 3RR5A 3AB9A 1PH6A 1RL2A 3VYRA 3TSSA 1MI2A 1WCMH 1EIHA 4IUUA 4HSVA 1VQEA 5DM73 2MO1A 4IFDJ 1I4QA 1CHPD 2Z6KA 1BVSA 1K83H 2P5ZX 1VQFA 1A0IA 1SYEA 5DNFA 4RHSA 2NTSA 2SOBA 2QW7A 2PW5A 1HR0Q 3KDFB 1EZ6A 4LF6L 4A3FG 2R3ZA 2R93H 1LLRD 4DNTB 5J39A 2KHIA 3A8IE 3JAMi 2KEEA 4PMWA 1N34L 2I5MX 4JI1Q 4OHJA 4GS3A 1Q1EA 1QNUA 1JC7A 2JQOA 2K33A 2NYZD 4C3HG 1I3QB 2J0TD 1RTOA 4IUVA 4BBRH 2L5TA 2OQ0A 3D0FA 3K57A 1VQ9A 1Z6HA 3ERQA 1JCKB 4B9WA 1IBLL 5CGKA 2VB2X 2VL6A 3ZJYC 4NXMQ 4WJ4A 3S1NH 1KL9A 5LMUQ 4OWXB 1PYWD 4ALPA 2NVTH 2NTTA 1QE6A 4QL5A 4CJ1B 1A3VA 3J80L 3HRZC 1CTMA 1JWMD 4QIWB 2J7ZA 2BA0A 2BE5D 4N8X1 1XPOA 1K3BC 2HHHL 4A3LH 3CD6A 4K2KA 1O7LA 3U4ZA 4B9XA 1PFMA 1VQ4A 4LF9L 3VYTA 3L2PA 5FO7B 2JEBI 3KBGA 4IN3A 3I2ZA 1NE3A 1EOTA 2D5DA 5M5WB 1FL0A 3M4OH 2RSNA 1PRTD 2HCIA 2OXPA 3P20A 5FKAC 3CC7A 1M1KC 1G91A 1Y8PB 2YV5A 4A3FH 4DV7L 2L15A 3A7LA 3K8AA 2RVLA 4C2MH 1ET9A 1FNUA 2XRSD 3K0YA 4QQBX 4ILWA 3I4OA 3JAMc 1YBYA 1IYVA 3QJYA 4GOPB 2JA9A 2KHSA 2DY8A 3LWUA 4OXPA 5D3DA 1E24A 3STBC 5GROA 5C4ZA 1Q8KA 1ASZA 2N3SA 4C3HH 3KF6A 4EX5A 1KTKA 4BY1G 4P73A 2JA5B 4RGOS 2MNAA 2NVQH 3IL8A 1JMCA 4DR7Q 4KMUC 4KV6A 1VMCA 1G2SA 3KOJA 3JC66 1KDCA 3QOJA 5FOBB 3E6ZX 3IFTA 1G6PA 1BCPB 4LK1C 4XIGS 3OWEB 2BH8A 1IKMA 4IZ8A 3PF5A 1BBWA 1ENAA 3GTKB 1U4PA 4GOPC 1HNXQ 1FGBD 3CCEA 4FNFA 2AQ1B 1MJCA 3T1YL 1WTOA 2PW7A 3FPUB 4LF5Q 2VQFL 4JW0A 2AQ2B 4LJZC 5HGQA 3J7AV 1R4PB 4L5TA 1CA5A 3KBXA 1JE4A 1IW7D 5DLQE 1KAWA 1SSOA 4L6TB 1JWUD 1WTPA 1DOMA 4MIUA 2F0VA 2WAQE 5JVH3 4H44C 1XJVA 3HOUG 3PO2B 3M3YB 2KCNA 4A3KB 5IGGA 1X3PA 1I50B 5HURA 4PNYA 3X3NA 2A68D 3S1RB 3LNNA 2NVXB 4YHHL 2F0FA 4C1NK 4DV6Q 1KDAA 3U9SA 1R9TH 1FJGL 4KKSA 4BS9A 5C6AA 5IGBA 1WI5A 1JICA 2BDOA 4HN7A 4DNIA 4QB4A 2F0MA 3BZCA 4BBSG 1UEAB 1K8MA 1E7ZA 4ZKCB 5IP9G 5H1SE 2PNHA 3NENA 4BA2I 2O2LD 2KBNA 2NN6G 4BY1H 2UXBL 5BR8L 2FMMA 2EJFC 3H6MA 2L1BA 1X32A 4RG1A 1EY0A 2MHVA 3KJOA 4A3BG 2DUDA 1LT5D 3EN2A 3L3OC 3U9OA 2C35B 1VQCA 1CFMA 2Y0SG 4K6DA 1ILPA 5J22A 3CMEA 4RWSC 4N9TA 1RODA 3NTKA 5C0XG 3CHBD 2N49A 5M3FB 3W1BA 1F77A 4GNXA 4YCVA 5M3FG 1B9MA 1ENFA 5D14A 4AYBB 4DGZA 2YU9B 4J15A 4P71A 3HOUH 1SE3A 3VA5A 5M3MB 1WTWA 3T13A 3CAMA 4E6IA 4YCWA 4JI0L 5IT9c 3A74A 2RF4A 4A3KH 2K04A 1S5DD 3J7AF 3GTMH 2IHFA 1Z9FA 1B7YB 4KHPL 4UDUC 3K58A 1TWCB 2NVXH 1Y1VB 4DR4L 2KQ3A 2PPBC 4NXNQ 2F0SA 2K7VA 4L63B 5EJWA 5C44B 2F0PA 4BBSH 3M4QA 4PV1C 5IYBH 3MXNB 1EYAA 4K8IA 3RD4A 3W2DA 5IP9H 2NN6H 4HTHA 4IPDA 4QMGA 3PIPA 1U4MA 3U4VA 1B8AA 2CQAA 2IJ0A 1HZCA 1ASYA 5I4DA 4S3SA 1PRTC 2QKIC 1PDQA 3HOZB 1K8OA 3WDNA 4JYAL 4FO2A 4A3BH 1OXXK 4KY5A 1EIFA 2K01A 4JI6Q 2WB1G 3VYUA 5FLXL 3BDOA 4CKCA 4B3MQ 2K5QA 5C0XH 2PCFB 1TWHH 4ZRZA 4DV1L 1ET6A 3PSIA 4X6AH 4YWLA 2AHOB 1N33L 1L1OA 3CPWA 5M3FH 2NZOA 2VZAA 1VQ6A 5JEAG 2DN8A 4WORA 4JI7L 4HIOA 3M4YA 3CCVA 1XYIA 3DLLA 2ID0A 1JB3A 1N32Q 4HJ8A 1VQ5A 1IHZA 1NCVA 3I73A 3M4PA 3I4NB 4A3MB 1H9SA 2C5CA 2QA4A 2I0QA 1G8ZD 2WV6D 3KYHC 2JYOA 2PZWA 1EU3A 2VW9A 2F3VA 4DAMA 1LT3D 1TWCH 3GD7A 3Q22A 1IW7C 3NUCA 5E3FA 2A6HD 3NXWA 4C3JG 5LMNL 3DEPA 4DXGA 2OTLA 1Q3LA 1S5CD 4R4OA 4LMQD 1DD2A 2Q8TA 4M8AA 1MSGA 1TT2A 4IJLA 3M7NA 1N36Q 4LNQA 4CDCC 1O78A 4GKKL 2HUGA 4LW1A 1TIID 4O42A 2BCOA 3QR8A 3D4RA 2OTJA 4EQPA 1PTOB 1HA5A 1VQBA 5CYUA 2IX3A 3EROA 5ELFA 1FNWA 1YJ9A 1GOZA 3NBHB 3UI2A 1VQ7A 2IW3A 5JEAH 3DXJC 3BJUA 1Q90A 2VNUD 2G9DA 4FP5D 3UE1A 2EJMA 3TP6A 1HNZQ 5IYCG 1V1PB 2F0UA 3JAME 3T1HL 4NKLA 1U0LA 4ZUIA 3BDLA 3K5LA 1O7YA 3O13A 1EQVA 4V190 1QVGA 2E2IB 3S2DH 4OIJA 1MKHA 2Z1CA 2EY6A 2EIFA 1VS0A 1X3QA 2VQEL 2NUCA 4PG3A 4DR1L 4F88A 2MGSA 2E75C 1PFBA 1HNWL 3M9BA 3A8KE 4G4KA 2PMZB 3A5ZB 1PYBA 2EYHA 3GTJB 3URYA 5J1ZA 2MQHA 1EIGA 1PRTF 3S1QH 3E0EA 5M5XB 2WIIB 4AH6A 3UDGA 3S2HB 1E2VA 4K0KL 1NR2A 1RDPD 3CQZB 2ICIA 2E5LL 1FR3A 2FHTA 3LWEA 1SN8A 5IGEA 5EKIA 2F0GA 5KYLA 4KY7A 3TMEA 4A3JB 1IL8A 1KDBA 5EKLA 4P72A 3UDXA 2E2HB 1X3FA 2B2VC 4AYBE 4P75A 4OO1G 4HSPA 2SNSA 2AQ3B 2JP1A 1X3EA 4L5RC 1CM9A 1Z47A 1VQAA 3EA6A 3GTLH 1SMYC 2MFIA 1IL2A 3K7AH 2LXKA 1BBXC 2D9UA 5ELNA 1GXDC 3A7AB 1B44D 2N8NA 2UUBQ 4DR2L 5IYCH 4K5XA 5EPKA 1AE3A 4DV4Q 1ENCA 5KIXA 3MC0B 4R4CA 5FJ8G 4FF1A 2Z6KC 1CUKA 4X3TA 2VUMG 1TS3A 4O1NA 4X65Q 1SNQA 2QGQA 3J81i 3A8JE 2QILA 2B2UA 4HR7B 1H9RA 4BWGB 1U4LA 1UE7A 4ZUJA 2QEXA 2O4XA 1LM0A 2ZT9C 4LWCA 2JA7B 4KJNA 1V43A 3OW7A 4A3IG 2X6LA 1D8LA 2M2LA 3E9HA 3I55A 1KC8C 1DM0B 1S5FD 2RHSB 2FINB 2QCPX 3WWVA 3NE5B 2KVMA 2Q2TA 2PZTA 5M5XH 3ZYYX 2XVSA 3CQZH 1HQMC 4DFAA 4JI8L 1RCVD 4A3JH 4LUVA 4UP8A 4OO1H 2E2HH 4KLKA 1XNRL 3KLWA 1EY9A 1LO5D 2K05A 1B4OA 3HOXB 1Q12A 2L4NA 2E74C 1TVXA 1I4HA 3K6OA 1OO9B 2A6HC 3KLSX 5IT9E 4DR5L 1OXSC 1FNVA 5CV6A 1D2BA 3H94A 4DU9A 4IUTA 2WFWA 1WCMG 2R7DA 2M9VA 2F0IA 3HOVB 5IY0A 3SE0A 1HZ9A 2Z4IA 2UUAL 3I4MG 1Y8OB 1JJGA 1P16A 4PZ6A 3J7YW 4XXEA 5FJ8H 5JAVA 1I6HH 2F0OA 1HFGA 1TWAB 3Q23A 4JPBW 2VUMH 3EJIA 4CJ0B 3AYHB 4DAYA 1EY7A 1RF2D 2CWPA 2R7ZB 4ZKBB 3HOWG 3J81c 4Y7NH 4TQUS 4DUZL 2R7FA 1C4QA 4DV0Q 2WAQG 4A3IH 1CT1D 5CBAE 1EY8A 3D3RA 1NSNS 1SNOA 2J4XA 2JA7H 2IX1A 2DGYA 3E5SA 4ZYSA 1U9RA 4DA2A 3LGJA 5HGTA 3OHXC 3QB3A 1PH4A 1W6KA 3H09A 3GTOB 1D6EC 3FEWX 3HFZB 1PZID 3RNUA 1NUCA 4HEDA 4A3EG 2K5NA 3S9WA 2NN6I 4A3DG 4JI3L 2NBFA 3RLNA 4CDEC 1XMQL 2B2WA 2A74C 5ELBA 1LTSD 5JJLA 2RCNA 1SJHD 4IJHA 4A3LG 1PFNA 4ZQ3A 1VQNA 1S5BD 1WYDA 3C3LA 2KCMA 5JPNC 3S17H 2KHJA 5ELCA 2UXDQ 3E0JA 1F2ZA 1GD7A 3OOCA 1QG7A 2L11A 1SNPA 4EQ5A 1CA6A 3OMCA 5C0XI 4GLVB 3I4MH 1D1KA 5IIFA 4XYOA 1QCBD 3I8ZA 4LF7L 2PMZE 1SXTA 3I91A 3F2BA 4DV3Q 3OIPA 1AZPA 1JR0D 4ULLA 1TWAH 4H0LC 3HOWH 1NBWA 2RDGA 3DM3A 4OX9Q 1V8QA 1H9JA 2R7ZH 1F9QA 3TBIB 2AWOA 4APVA 3S1MH 2GVBA 4K2LA 1Q7YC 4F87A 2UU9Q 5IWAL 1D5ZC 4C3IB 3S15B 2NVYB 5A35A 4JBJA 4JI2L 1M8AA 3K5MA 2F0EA 2UXCQ 1HUMA 1HQRD 3P7JA 1AZQA 4F8MA 2Q2IA 1RD9D 4GN3B 1VF5C 4Y52H 1QUQB 2A1AA 1STGA 3A56A 3CCSA 2NB0A 4LF4Q 1F2MA 3W1GA 1EEFD 3F1ZA 3A5UA 1TWGH 1J5EQ 1C7YA 1KLUD 2ICEC 4A3EH 3GTOH 4A3DH 2PZUA 4NPSA 1DXMA 4H13C 4X66L 4B3SL 1XNQL 1BUVT 4X64Q 1KNEA 1YHBA 3TP7A 4ABNA 2FJ2A 5CV4A 2JSOA 1SEBD 1YNJD 4X62L 4P74A 2ZM6L 4HJ7A 4FXGC 3TRZA 3MVVA 1EYDA 1YIJA 1TS4A 5K36G 3H3VH 1L0XB 2XN9C 3X3MA 2HIVA 4X3SA 1PXUA 2CH4A 4GNXC 1HA6A 5C0XJ 2UUCQ 1L0YB 3Q6SA 1KNAA 1MJEA 4JV5L 1IBKQ 3F2DA 5I2YA 4PZ8A 1QVFA 4A75A 4M1UB 5HY6A 1PHJA 1V9PA 4XQJA 1Q1BA 1NMFA 2H1EA 2ZJQA 4B3RQ 4NMZA 3KF8A 1EZ8A 2CCZA 1E1TA 5C4HA 4LF8L 5CV8A 4IPHA 1SDFA 4ME3A 4DUYL 5E1FA 2Z8LA 1PZKD 4DV5Q 4UAIA 3H0GB 2VXWA 4B3TQ 4KI0A 1IBMQ 3ULPA 3H0GG 3A55A 3TZUA 3G71A 4GKJL 1B9NA 1WVLA 3MEFA 1RIPA 3VR6A 1AN8A 2A6EC 5LMNW 4UP7A 2JA5G 1I3QH 2Q2UA 1LT6D 3VR2A 3L9AX 5L37A 3OW2A 1XMOL 1FD7D 3GQBA 3FRPB 3E3XA 5JOBA 1SYGA 3BVGA 3V05A 2SNMA 3N6RA 4K6LA 2R6GA 2MP1A 4JI4Q 1SRUA 1ZXTA 2HDLA 5K36H 1H9SB 3MAQA 1JWSD 3FPPA 3MEHA 4DV2L 1L1OC 3HS0C 2N78A 3K5NA 1CI3M 1XTDA 1PH5A 2HT1A 3WOEA 3DWQA 5JEAJ 1CSPA 5M5WH 2PO4A 1LTAD 3PO2G 1EQQA 1KABA 1S40A 3GTGB 4A3KG 2K14A 4RGNA 4QGUA 4TRDA 1GUSA 2EXDA 2R92B 2KECA 2B2YC 3R3OA 1FYCA 5ELEA 1O80A 3IFDA 4LF6Q 4NB3A 2B2TA 3H91A 1STAA 1LUZA 2ZXOA 4ZCKA 3G6EA 4HCEA 5EAYA 4WFN3 4DR6L 5IYBG 3K59A 1RJTA 3H0GH 3SXHA 1Y69U 1W2BA 4KD3A 1N34Q 1T5EA 2AUKA 3L7ZC 3VR5A 4DR3L 3N52A 5EKKA 4C56C 2JA5H 2CVRA 3S14B 2EYJA 2JEAI 1H95A 2MO0A 4RCNA 1PLFA 2YTXA 2N55A 4A93B 5EBDA 3MA2B 4A76A 2LMCB 4CDFC 1IBLQ 2WKCA 5IODA 1SE2A 1K9MC 3GTKH 3CU7A 1Q81C 1BOSA 5C3XA 5KGUA 5BN3A 5GAGC 3J80i 2K5DA 4HCSA 3HEJA 2HHHQ 3R2TA 1IKLA 4OO1I 1DYQA 1LTID 3AEVA 3WOFA 4YY3L 1CZGA 4J6HA 4LF9Q 1X55A 1K73C 4CHTB 4AYBG 1HTPA 5C3EB 3PO2H 1SE4A 2BDNA 5M3MG 3M3YH 1PRTB 2NZ1D 1I50H 3MXGA 4CDDC 1Y1WB 4IFDH 3TS2A 2F3WA 5C3EG 5JJZA 3T56B 2BE5C 5CMDA 5M9OA 4FXKC 3GTGH 1VF7A 3AFQA 3S1RH 5C4JB 2RCFA 2TMPA 1S72A 1PZJD 1I4RA 4DV7Q 2R92H 2B8GA 2R61A 4RCOA 1Y1VG 2K1BA 1DOLA 4LFAL 1YHAA 2L0CA 1HFNA 2PI2E 1QOHA 2F0JA 3DEOA 2PQAB 2A8VA 2QDBA 3MHBA 4R4QA 5C44G 4QIWE 3CC2A 2OCEA 4JBMA 5LL6S 5I9PA 4RAUC 1TS2A 3TN2A 1HCZA 1STBA 3TEHB 1N8RC 4K14A 4GKJQ 1QNKA 2HDMA 3CP0A 3S14H 3SDZA 4YWKA 4G7HC 2IX0A 1VQJA 3OTOL 2JJQA 2CHBD 3HOZG 4QUCA 1Y8NB 4MTNA 1K8GA 2ZTEA 3I72A 1BO0A 2KUMA 1STNA 1KXLA 2RDHA 1TY2A 1E2WA 2KENA 2QEJC 1MBYA 2YTVA 1KQSA 3D8GA 1I4GA 5GQOA 3RZDB 3J80c 3PV0A 2XRQD 4CBVA 1QVCA 1DJRD 1BXTA 1QJOA 4LFCL 4DAPA 2WKDA 3T1YQ 3D6WA 4OWWB 2VQFQ 2H5XA 2HIXA 1A2UA 3DWAA 3PO3B 3SEBA 2YU9H 2HQEA 4UPAA 3I56A 5M3MH 3W3AA 2FXQA 3NHHA 4KHVA 2HCCA 2RBMA 5C3EH 4G7ZC 2B2YA 3D6CA 3I4NG 1GVPA 4A3MG
chains in the Genus database with same CATH topology
4X65Q 4DK6C 1HR0Q 1OXVA 2QGQA 3KDFB 2YYZA 4YHHQ 3J81i 4LF6L 4A3FG 2R93H 1Y1VH 4GLXA 1FJGQ 2ZTDA 1UE7A 2QEXA 1LM0A 4LWCA 4MNOA 5IWAQ 5C44H 2KHIA 3B6YA 3A0JA 1A62A 1V43A 4JI2Q 3JAMi 5IYDG 4A3IG 4PMWA 1JJCB 1N34L 1KD1C 1D8LA 3EBEA 3ER0A 3PUXA 2I5MX 4JI1Q 2YTYA 3E9HA 4GS3A 3I55A 1Q1EA 1KC8C 2RHSB 5GAHC 2JQOA 2OQKA 1PH9A 1HZBA 4JI5L 4HIDA 1UEBA 3WWVA 1VQMA 2UXBQ 5BR8Q 3J7ZC 2Q2TA 1PH3A 4A93G 5M5XH 3F2CA 4BBRH 2OQ0A 3HOZH 3ERSX 1A63A 3D0FA 3CQZH 2F3IA 3KDFA 3RN2A 1N36L 4JI8L 1VQ9A 4R1JA 4MZ9A 1YEZA 1IBLL 2JA8G 4NXMQ 2VL6A 3ZJYC 4X66Q 4A3JH 4B3SQ 5GADC 1KL9A 4LUVA 5IP7G 1XNQQ 4UP8A 4AQYL 2GVAA 5LMUQ 2E2HH 4OWXB 4ALPA 4KLKA 3TQYA 1XNRL 3KLWA 2NVTH 4IOAA 1EFWA 3J7A5 4QL5A 4X62Q 2ZM6Q 3PCOB 4DAYB 1Q12A 1X3GA 2BA0A 3G48A 1JT8A 1SROA 1XPOA 3ICEA 1JJ2A 4DR5L 2HHHL 4A3LH 3CD6A 1SMXA 1OXSC 3U4ZA 2D0PA 2ASBA 2WFWA 1E3PA 1S3OA 5AJ3L 1WCMG 4GLAC 2R7DA 1VQ4A 4LF9L 3L2PA 4JV5Q 2JEBI 5IY0A 3CCUA 3KJPA 1HZ9A 1PH7A 1QUQA 1T9HA 3I2ZA 1P16A 4PZ6A 1HNZL 1NE3A 2UUAL 3H3VI 3I4MG 4R4TA 1Y1WG 5FJ8H 1I6HH 5FLMG 1FL0A 3K80C 3NEMA 3PGZA 1LYLA 3G4SA 3M4OH 1IYJB 2CKZB 2VUMH 2PI2A 4JI0Q 4LF8Q 3I4NH 1SR3A 4A3MH 3AYHB 2CWPA 1Q86C 1I94L 3HOWG 3CC7A 4HIMA 1M1KC 1HR0W 3PUWA 2YV5A 2F4VL 4DUYQ 4A3FH 4DV7L 3J81c 3CCLA 4LUOA 2K50A 2L15A 3S24A 4Y7NH 4TQUS 1YJWA 4KHPQ 1CKOA 4DUZL 3K8AA 2R7FA 4C2MH 1I5FA 4DR4Q 2BA1A 4DV0Q 4QQBX 2WAQG 3CMAA 4A3IH 5IYDH 2K4KA 3I4OA 4JG2A 2BH2A 3JAMc 1YBYA 2RHQB 4A3CH 1VQHA 4GOPB 2JA7H 2JA9A 2IX1A 2DGYA 1W3SA 1PH8A 4OXPA 1E24A 3STBC 5GROA 3LGJA 1Q8KA 1ASZA 2N3SA 4C3HH 3KF6A 3GO5A 1AE2A 4BY1G 4P73A 4EX5A 3CCRA 4IO9A 2ZJPA 4A93H 2MNAA 1Q82C 2NVQH 3HFZB 4POFA 3RNUA 1XMOQ 2AKWB 1JMCA 4DR7Q 4A3JG 1D7QA 3FP9A 3CC4A 3TREA 1OXUA 4JYAQ 1WFQA 3JC66 3KOJA 2K5NA 4A3EG 2NN6I 2JA8H 1GO3E 4JI3L 4A3DG 4QJFA 3RLNA 5IP7H 3J81j 1XMQL 1OTCA 2ALYB 1G6PA 1X56A 4JBWA 4XIGS 2BH8A 3PUVA 1HZAA 4JBKA 3PF5A 1G51A 5JJLA 1BBWA 1BKBA 2RCNA 4GOPC 4IJHA 4GOPA 3CCEA 1HNXQ 4A3LG 1NMGA 1PV4A 4DV1Q 1VQNA 4LFBL 1WYDA 1MJCA 4DKAC 2KCMA 3T1YL 3CCJA 3S17H 5JJKA 3EIVA 1AH9A 3H15A 2KHJA 2VQFL 4LF5Q 4OWTB 2UXDQ 5HGQA 1GD7A 4DV2Q 4L5TA 1N33Q 4RMFA 3ULJA 2ZJRA 3PO3G 5DLQE 1P8LA 4EQ5A 1KAWA 2UUBL 1PVOA 3OYYA 2IT1A 5C0XI 4GLVB 3I4MH 1N9WA 2A19A 4JI7Q 2WAQE 4LF7L 2PMZE 1UE6A 4H02A 4DV4L 1Y1WH 5FLMH 2JK8A 3KFUA 3HOUG 2LSSA 3F2BA 1XJVA 4HIKA 1TXYA 2K52A 4DV3Q 1KRTA 5C4JH 2E2IH 1BBUA 3M85A 1TWAH 2EQSA 3AQQA 4X65L 1NBWA 1HR0L 3HOWH 1HH2P 3DM3A 4YHHL 4OX9Q 4DV6Q 1R9TH 2R7ZH 1FJGL 4BY7G 2AWOA 4APVA 3S1MH 2GVBA 4DR6Q 1WI5A 1Q7YC 2JA7G 2UU9Q 5IWAL 2Q2HA 4DNIA 4JI2L 4JBJA 3GTJH 3BZCA 2B3GA 3PUYA 2UXCQ 4BBSG 1X9NA 4JI1L 3HOYH 4GN5A 3RN5A 5IP9G 1E7ZA 2Q2IA 4XTCS 5H1SE 2PNHA 3NENA 2CWAA 4DR3Q 5LMNQ 4GN3B 2KBNA 2NN6G 1G291 1U5KA 3S2HH 4BY1H 2UXBL 5BR8L 3Q8DA 1QUQB 1VQPA 4Y52H 2A1AA 3CCSA 4A3GG 4LF4Q 1KHIA 3W1GA 3GTPH 3F1ZA 3A5UA 4WJ3M 1TWGH 2D62A 1L0WA 1J5EQ 1C7YA 3ULLA 4A3EH 3GTOH 4KHZA 1XPRA 3PIOA 4A3DH 4NPSA 4RG1A 4NXML 4B3SL 4X66L 1A8VA 3KJOA 2IHEA 1XNQL 4X64Q 3S16H 1YHBA 4DK3C 2DUDA 5LMUL 4A3BG 3EN2A 2C35B 1WJJA 1VQCA 2Y0SG 3RZDH 4X62L 2ZM6L 4P74A 3HOXG 4HJ7A 5FLXc 1SLJA 3CMEA 3TRZA 1YIJA 1EYGA 2AWNA 5C0XG 3H3VH 5K36G 1YHQA 2N49A 2HIVA 2VS1A 3W1BA 4GNXC 4GNXA 5C0XJ 1K8AC 2UUCQ 4YCVA 4UP9A 2K5VA 5M3FG 1MJEA 3PO3H 4YY3Q 1OXTA 3HOVG 4JV5L 1EIYB 1IBKQ 3F2DA 1FGUA 2JA6G 1QVFA 4PZ8A 4A75A 4POGA 3KF6B 4PZ7A 1GM5A 5HY6A 1PHJA 1V9PA 4WJ4A 3K7UC 1IZ6A 1NMFA 1Q1BA 4J15A 4P71A 2ZJQA 3HOUH 4YWMA 3PF4A 1VQLA 4B3RQ 3CAMA 5J3BA 4YCWA 3T1HQ 2CCZA 1E1TA 4JI0L 1YNXA 4LF8L 5IT9c 3A74A 2RF4A 3STBD 2R7ZG 4A3KH 1VCIA 4IPHA 4LUZA 1IXRA 1YITA 2IHFA 3GTMH 1Z9FA 4ME3A 4DUYL 1B7YB 3AFPA 4DV5Q 4KHPL 4BY7H 1YVCA 2VQEQ 2B63G 4DR1Q 2NVXH 4B3TQ 1CKMA 4LFAQ 4KI0A 3D31A 3RLOA 4DR4L 1B70B 2ZTCA 4DV0L 1IBMQ 4NXNQ 1HNWQ 5C4XG 3HOYG 3ULPA 4JOIC 4A4IA 3H0GG 4JOIA 3CCMA 2D0OA 4BBSH 3M4QA 5IYBH 3G71A 1VQKA 4GKJL 3MXNB 2JE6I 5IP9H 1Q46A 2Y0SE 3E9IA 5IE8A 3MEFA 1RIPA 4IPDA 3PIPA 3HKZG 3BZKA 4UP7A 1I3QH 5LMNW 2JA5G 3U4VA 2Q2UA 1B8AA 1NTGA 4HJAA 3RZOH 4C3JH 1V1QA 3OW2A 4K0KQ 1HZCA 4A3GH 1DGSA 1ASYA 2CQOA 1XMOL 2E5LQ 4DR7L 2IY5B 3OTOQ 2ATWA 2GN5A 4JYAL 4A3BH 4TVAB 1OXXK 1TWFH 3GTQH 1EIFA 4AIMA 4JI6Q 2WB1G 2R6GA 3FHWA 3HOXH 4JI4Q 1SRUA 2B29A 1SFOH 2I5LX 1HNXL 4B3MQ 3CXCA 1VQ8A 4DV1L 1TWHH 3FKIH 2PQAA 3PSIA 1PH2A 4X6AH 3S1NH 4LF5L 4LFCQ 4YWLA 2UXDL 1VQGA 2AHOB 4DV2L 1L1OC 1N33L 1L1OA 3CPWA 5M3FH 2NZOA 2VZAA 3HOVH 1VQ6A 2N78A 5JEAG 3U58A 1XTDA 2JA6H 1PH5A 3CCQA 4DR2Q 2HT1A 4O0AA 4JI7L 5GAEC 5JEAJ 1CSPA 5M5WH 3CCVA 4HIOA 1K3RA 3PO2G 3DLLA 1EQQA 1S40A 2ES2A 3F8TA 4A3KG 4JC0A 2ID0A 1UE5A 2K14A 4QY7A 4DV3L 1M90C 1N32Q 4FDBA 4QGUA 4R4IA 4HJ8A 1VQ5A 1LTLA 2XTIA 5M5YH 1JE5A 2EXDA 1FVIA 3HKZE 3M4PA 1HJPA 4OX9L 1C9OA 4DV6L 1EWIA 3PUZA 2QA4A 2I0QA 4LF6Q 2B63H 4NB3A 3KYHC 1XPUA 1LUZA 3G6EA 5EAYA 2VW9A 4DR6L 1E22A 5C4XH 3W5OA 5E7NA 3UE0A 5IYBG 3UDFA 1VQOA 4DAMA 2UU9L 3H0GH 1TWCH 3GD7A 2F52A 1CKNB 4BXXG 1W2BA 2UXCL 1VQDA 1N34Q 4GNXB 2WB1E 3L7ZC 3TS0A 3L0OA 1PA6A 4DR3L 4BA1I 2JA5H 5LMNL 2JEAI 2NZHA 1H95A 2MO0A 2OTLA 1PFSA 4JI5Q 3SGIA 3CW2C 3K0XA 4UY8C 2YTXA 4R4OA 4LF4L 3KF8B 4IJLA 1J5EL 1KRSA 4IPCA 3M7NA 1N36Q 4JI8Q 3BU2A 4LNQA 1X54A 2CFMA 4A76A 2VY3A 4GKKL 3NELA 4X64L 1IBLQ 1PYSB 4LW1A 1K9MC 4AQYQ 2OTJA 3GTKH 3FKIG 1CKNA 1Q81C 1XNRQ 1VQIA 5GAGC 4O2DA 3J80i 1VQBA 2LXJA 2WP8J 2XGTA 5JJIA 1YJ9A 3NBHB 4GN4B 4DR5Q 1PH1A 2K75A 1X65A 2HHHQ 1VQ7A 4OO1I 2UUCL 1JJGA 3UDIA 3BJUA 3AEVA 4YY3L 1X6OA 5AJ3Q 1IBKL 4LF9Q 1X55A 1K73C 2VNUD 2V1CC 4L5SA 1O7IA 4AYBG 1J6QA 3UE1A 2UUAQ 1HNZQ 3PO2H 5IYCG 4IOCA 5M3MG 3M3YH 4B3RL 3GDEA 4L5QA 1I50H 4JCVE 3T1HL 3TS2A 5C3EG 1EQRA 1U0LA 3GTGH 3S1RH 3AFQA 4HJ9A 4IFDI 1QVGA 3S2DH 1S72A 1MKHA 1I94Q 4GKKQ 4DV5L 1EUJA 2E2JH 2F4VQ 2EIFA 1VS0A 4DV7Q 2VQEL 2R92H 4PG3A 4DR1L 2R93G 1Y1VG 1JB7A 4B3TL 4LFAL 4DUZQ 3HKSA 1YHAA 4C3IH 3S15H 1HNWL 2NVYH 4NXNL 2PI2E 3M9BA 1IBML 1EOVA 2OWOA 2A8VA 2PQAB 4BXXH 4R4QA 5C44G 4QIWE 3CC2A 1K0RA 2OCEA 3A5ZB 1PYBA 4OONA 4JBMA 1L1OB 2MQHA 3IRBA 2AMCB 2KCTA 1UWVA 1YI2A 3S1QH 3E0EA 3VDYA 4AH6A 3TEHB 3UDGA 1N8RC 4GKJQ 3CPFA 1YJNA 4K0KL 3CP0A 1GKHA 5ELOA 3S14H 4YWKA 2E5LL 2IX0A 1VQJA 2K5HA 2JJQA 2E8GA 4BBRG 1SN8A 3OTOL 3CF5A 3HOZG 4MTNA 1K8GA 1QZGA 4P72A 3UDXA 2ZTEA 4IPGA 1X3FA 1WOCA 3RLFA 1NY4A 1Y14B 4JI3Q 1CSQA 1KXLA 3K81C 1XMQQ 4JI6L 4AYBE 4A3CG 2KENA 4P75A 1L2FA 4OO1G 4JI4L 2YTVA 4DPGA 1KQSA 1SE8A 4B3ML 1X3EA 5GQOA 4L5RC 1Z47A 1VQAA 3J80c 4HJ5A 3PV0A 3GTLH 1QVCA 4LFBQ 1PH4A 4LFCL 3T1YQ 2MFIA 1IL2A 1MIUA 1KIXA 3K7AH 1UE1A 2LXKA 2VQFQ 4OWWB 5ELNA 2H5XA 2HIXA 1YZ6A 4YCUA 1QZHA 2Z0SA 3RR5A 2HQLA 2N8NA 2UUBQ 4DR2L 1PH6A 1RL2A 2YU9H 4IFDG 4BA2I 4UPAA 5IYCH 3I56A 1WCMH 1AE3A 5M3MH 1C0AA 3I7FA 1E1OA 4LF7Q 4DV4Q 1VQEA 2FXQA 1NJIC 5FJ8G 4R4CA 2MO1A 5C3EH 2Z6KC 4IFDJ 2Z6KA 1N32L 1BVSA 1CUKA 1K83H 3U50C 1VQFA 1A0IA 2I5HA 2R92G 2VUMG 3I4NG 1GVPA 4A3MG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X65 Q;  4DK6 C;  1HR0 Q;  1OXV A;  2QGQ A;  3KDF B;  2YYZ A;  4YHH Q;  3J81 i;  4LF6 L;  4A3F G;  2R93 H;  1Y1V H;  4GLX A;  1FJG Q;  2ZTD A;  1UE7 A;  2QEX A;  1LM0 A;  4LWC A;  4MNO A;  5IWA Q;  5C44 H;  2KHI A;  3B6Y A;  3A0J A;  1A62 A;  1V43 A;  4JI2 Q;  3JAM i;  5IYD G;  4A3I G;  4PMW A;  1JJC B;  1N34 L;  1KD1 C;  1D8L A;  3EBE A;  3ER0 A;  3PUX A;  2I5M X;  4JI1 Q;  2YTY A;  3E9H A;  4GS3 A;  3I55 A;  1Q1E A;  1KC8 C;  2RHS B;  5GAH C;  2JQO A;  2OQK A;  1PH9 A;  1HZB A;  4JI5 L;  4HID A;  1UEB A;  3WWV A;  1VQM A;  2UXB Q;  5BR8 Q;  3J7Z C;  2Q2T A;  1PH3 A;  4A93 G;  5M5X H;  3F2C A;  4BBR H;  2OQ0 A;  3HOZ H;  3ERS X;  1A63 A;  3D0F A;  3CQZ H;  2F3I A;  3KDF A;  3RN2 A;  1N36 L;  4JI8 L;  1VQ9 A;  4R1J A;  4MZ9 A;  1YEZ A;  1IBL L;  2JA8 G;  4NXM Q;  2VL6 A;  3ZJY C;  4X66 Q;  4A3J H;  4B3S Q;  5GAD C;  1KL9 A;  4LUV A;  5IP7 G;  1XNQ Q;  4UP8 A;  4AQY L;  2GVA A;  5LMU Q;  2E2H H;  4OWX B;  4ALP A;  4KLK A;  3TQY A;  1XNR L;  3KLW A;  2NVT H;  4IOA A;  1EFW A;  3J7A 5;  4QL5 A;  4X62 Q;  2ZM6 Q;  3PCO B;  4DAY B;  1Q12 A;  1X3G A;  2BA0 A;  3G48 A;  1JT8 A;  1SRO A;  1XPO A;  3ICE A;  1JJ2 A;  4DR5 L;  2HHH L;  4A3L H;  3CD6 A;  1SMX A;  1OXS C;  3U4Z A;  2D0P A;  2ASB A;  2WFW A;  1E3P A;  1S3O A;  5AJ3 L;  1WCM G;  4GLA C;  2R7D A;  1VQ4 A;  4LF9 L;  3L2P A;  4JV5 Q;  2JEB I;  5IY0 A;  3CCU A;  3KJP A;  1HZ9 A;  1PH7 A;  1QUQ A;  1T9H A;  3I2Z A;  1P16 A;  4PZ6 A;  1HNZ L;  1NE3 A;  2UUA L;  3H3V I;  3I4M G;  4R4T A;  1Y1W G;  5FJ8 H;  1I6H H;  5FLM G;  1FL0 A;  3K80 C;  3NEM A;  3PGZ A;  1LYL A;  3G4S A;  3M4O H;  1IYJ B;  2CKZ B;  2VUM H;  2PI2 A;  4JI0 Q;  4LF8 Q;  3I4N H;  1SR3 A;  4A3M H;  3AYH B;  2CWP A;  1Q86 C;  1I94 L;  3HOW G;  3CC7 A;  4HIM A;  1M1K C;  1HR0 W;  3PUW A;  2YV5 A;  2F4V L;  4DUY Q;  4A3F H;  4DV7 L;  3J81 c;  3CCL A;  4LUO A;  2K50 A;  2L15 A;  3S24 A;  4Y7N H;  4TQU S;  1YJW A;  4KHP Q;  1CKO A;  4DUZ L;  3K8A A;  2R7F A;  4C2M H;  1I5F A;  4DR4 Q;  2BA1 A;  4DV0 Q;  4QQB X;  2WAQ G;  3CMA A;  4A3I H;  5IYD H;  2K4K A;  3I4O A;  4JG2 A;  2BH2 A;  3JAM c;  1YBY A;  2RHQ B;  4A3C H;  1VQH A;  4GOP B;  2JA7 H;  2JA9 A;  2IX1 A;  2DGY A;  1W3S A;  1PH8 A;  4OXP A;  1E24 A;  3STB C;  5GRO A;  3LGJ A;  1Q8K A;  1ASZ A;  2N3S A;  4C3H H;  3KF6 A;  3GO5 A;  1AE2 A;  4BY1 G;  4P73 A;  4EX5 A;  3CCR A;  4IO9 A;  2ZJP A;  4A93 H;  2MNA A;  1Q82 C;  2NVQ H;  3HFZ B;  4POF A;  3RNU A;  1XMO Q;  2AKW B;  1JMC A;  4DR7 Q;  4A3J G;  1D7Q A;  3FP9 A;  3CC4 A;  3TRE A;  1OXU A;  4JYA Q;  1WFQ A;  3JC6 6;  3KOJ A;  2K5N A;  4A3E G;  2NN6 I;  2JA8 H;  1GO3 E;  4JI3 L;  4A3D G;  4QJF A;  3RLN A;  5IP7 H;  3J81 j;  1XMQ L;  1OTC A;  2ALY B;  1G6P A;  1X56 A;  4JBW A;  4XIG S;  2BH8 A;  3PUV A;  1HZA A;  4JBK A;  3PF5 A;  1G51 A;  5JJL A;  1BBW A;  1BKB A;  2RCN A;  4GOP C;  4IJH A;  4GOP A;  3CCE A;  1HNX Q;  4A3L G;  1NMG A;  1PV4 A;  4DV1 Q;  1VQN A;  4LFB L;  1WYD A;  1MJC A;  4DKA C;  2KCM A;  3T1Y L;  3CCJ A;  3S17 H;  5JJK A;  3EIV A;  1AH9 A;  3H15 A;  2KHJ A;  2VQF L;  4LF5 Q;  4OWT B;  2UXD Q;  5HGQ A;  1GD7 A;  4DV2 Q;  4L5T A;  1N33 Q;  4RMF A;  3ULJ A;  2ZJR A;  3PO3 G;  5DLQ E;  1P8L A;  4EQ5 A;  1KAW A;  2UUB L;  1PVO A;  3OYY A;  2IT1 A;  5C0X I;  4GLV B;  3I4M H;  1N9W A;  2A19 A;  4JI7 Q;  2WAQ E;  4LF7 L;  2PMZ E;  1UE6 A;  4H02 A;  4DV4 L;  1Y1W H;  5FLM H;  2JK8 A;  3KFU A;  3HOU G;  2LSS A;  3F2B A;  1XJV A;  4HIK A;  1TXY A;  2K52 A;  4DV3 Q;  1KRT A;  5C4J H;  2E2I H;  1BBU A;  3M85 A;  1TWA H;  2EQS A;  3AQQ A;  4X65 L;  1NBW A;  1HR0 L;  3HOW H;  1HH2 P;  3DM3 A;  4YHH L;  4OX9 Q;  4DV6 Q;  1R9T H;  2R7Z H;  1FJG L;  4BY7 G;  2AWO A;  4APV A;  3S1M H;  2GVB A;  4DR6 Q;  1WI5 A;  1Q7Y C;  2JA7 G;  2UU9 Q;  5IWA L;  2Q2H A;  4DNI A;  4JI2 L;  4JBJ A;  3GTJ H;  3BZC A;  2B3G A;  3PUY A;  2UXC Q;  4BBS G;  1X9N A;  4JI1 L;  3HOY H;  4GN5 A;  3RN5 A;  5IP9 G;  1E7Z A;  2Q2I A;  4XTC S;  5H1S E;  2PNH A;  3NEN A;  2CWA A;  4DR3 Q;  5LMN Q;  4GN3 B;  2KBN A;  2NN6 G;  1G29 1;  1U5K A;  3S2H H;  4BY1 H;  2UXB L;  5BR8 L;  3Q8D A;  1QUQ B;  1VQP A;  4Y52 H;  2A1A A;  3CCS A;  4A3G G;  4LF4 Q;  1KHI A;  3W1G A;  3GTP H;  3F1Z A;  3A5U A;  4WJ3 M;  1TWG H;  2D62 A;  1L0W A;  1J5E Q;  1C7Y A;  3ULL A;  4A3E H;  3GTO H;  4KHZ A;  1XPR A;  3PIO A;  4A3D H;  4NPS A;  4RG1 A;  4NXM L;  4B3S L;  4X66 L;  1A8V A;  3KJO A;  2IHE A;  1XNQ L;  4X64 Q;  3S16 H;  1YHB A;  4DK3 C;  2DUD A;  5LMU L;  4A3B G;  3EN2 A;  2C35 B;  1WJJ A;  1VQC A;  2Y0S G;  3RZD H;  4X62 L;  2ZM6 L;  4P74 A;  3HOX G;  4HJ7 A;  5FLX c;  1SLJ A;  3CME A;  3TRZ A;  1YIJ A;  1EYG A;  2AWN A;  5C0X G;  3H3V H;  5K36 G;  1YHQ A;  2N49 A;  2HIV A;  2VS1 A;  3W1B A;  4GNX C;  4GNX A;  5C0X J;  1K8A C;  2UUC Q;  4YCV A;  4UP9 A;  2K5V A;  5M3F G;  1MJE A;  3PO3 H;  4YY3 Q;  1OXT A;  3HOV G;  4JV5 L;  1EIY B;  1IBK Q;  3F2D A;  1FGU A;  2JA6 G;  1QVF A;  4PZ8 A;  4A75 A;  4POG A;  3KF6 B;  4PZ7 A;  1GM5 A;  5HY6 A;  1PHJ A;  1V9P A;  4WJ4 A;  3K7U C;  1IZ6 A;  1NMF A;  1Q1B A;  4J15 A;  4P71 A;  2ZJQ A;  3HOU H;  4YWM A;  3PF4 A;  1VQL A;  4B3R Q;  3CAM A;  5J3B A;  4YCW A;  3T1H Q;  2CCZ A;  1E1T A;  4JI0 L;  1YNX A;  4LF8 L;  5IT9 c;  3A74 A;  2RF4 A;  3STB D;  2R7Z G;  4A3K H;  1VCI A;  4IPH A;  4LUZ A;  1IXR A;  1YIT A;  2IHF A;  3GTM H;  1Z9F A;  4ME3 A;  4DUY L;  1B7Y B;  3AFP A;  4DV5 Q;  4KHP L;  4BY7 H;  1YVC A;  2VQE Q;  2B63 G;  4DR1 Q;  2NVX H;  4B3T Q;  1CKM A;  4LFA Q;  4KI0 A;  3D31 A;  3RLO A;  4DR4 L;  1B70 B;  2ZTC A;  4DV0 L;  1IBM Q;  4NXN Q;  1HNW Q;  5C4X G;  3HOY G;  3ULP A;  4JOI C;  4A4I A;  3H0G G;  4JOI A;  3CCM A;  2D0O A;  4BBS H;  3M4Q A;  5IYB H;  3G71 A;  1VQK A;  4GKJ L;  3MXN B;  2JE6 I;  5IP9 H;  1Q46 A;  2Y0S E;  3E9I A;  5IE8 A;  3MEF A;  1RIP A;  4IPD A;  3PIP A;  3HKZ G;  3BZK A;  4UP7 A;  1I3Q H;  5LMN W;  2JA5 G;  3U4V A;  2Q2U A;  1B8A A;  1NTG A;  4HJA A;  3RZO H;  4C3J H;  1V1Q A;  3OW2 A;  4K0K Q;  1HZC A;  4A3G H;  1DGS A;  1ASY A;  2CQO A;  1XMO L;  2E5L Q;  4DR7 L;  2IY5 B;  3OTO Q;  2ATW A;  2GN5 A;  4JYA L;  4A3B H;  4TVA B;  1OXX K;  1TWF H;  3GTQ H;  1EIF A;  4AIM A;  4JI6 Q;  2WB1 G;  2R6G A;  3FHW A;  3HOX H;  4JI4 Q;  1SRU A;  2B29 A;  1SFO H;  2I5L X;  1HNX L;  4B3M Q;  3CXC A;  1VQ8 A;  4DV1 L;  1TWH H;  3FKI H;  2PQA A;  3PSI A;  1PH2 A;  4X6A H;  3S1N H;  4LF5 L;  4LFC Q;  4YWL A;  2UXD L;  1VQG A;  2AHO B;  4DV2 L;  1L1O C;  1N33 L;  1L1O A;  3CPW A;  5M3F H;  2NZO A;  2VZA A;  3HOV H;  1VQ6 A;  2N78 A;  5JEA G;  3U58 A;  1XTD A;  2JA6 H;  1PH5 A;  3CCQ A;  4DR2 Q;  2HT1 A;  4O0A A;  4JI7 L;  5GAE C;  5JEA J;  1CSP A;  5M5W H;  3CCV A;  4HIO A;  1K3R A;  3PO2 G;  3DLL A;  1EQQ A;  1S40 A;  2ES2 A;  3F8T A;  4A3K G;  4JC0 A;  2ID0 A;  1UE5 A;  2K14 A;  4QY7 A;  4DV3 L;  1M90 C;  1N32 Q;  4FDB A;  4QGU A;  4R4I A;  4HJ8 A;  1VQ5 A;  1LTL A;  2XTI A;  5M5Y H;  1JE5 A;  2EXD A;  1FVI A;  3HKZ E;  3M4P A;  1HJP A;  4OX9 L;  1C9O A;  4DV6 L;  1EWI A;  3PUZ A;  2QA4 A;  2I0Q A;  4LF6 Q;  2B63 H;  4NB3 A;  3KYH C;  1XPU A;  1LUZ A;  3G6E A;  5EAY A;  2VW9 A;  4DR6 L;  1E22 A;  5C4X H;  3W5O A;  5E7N A;  3UE0 A;  5IYB G;  3UDF A;  1VQO A;  4DAM A;  2UU9 L;  3H0G H;  1TWC H;  3GD7 A;  2F52 A;  1CKN B;  4BXX G;  1W2B A;  2UXC L;  1VQD A;  1N34 Q;  4GNX B;  2WB1 E;  3L7Z C;  3TS0 A;  3L0O A;  1PA6 A;  4DR3 L;  4BA1 I;  2JA5 H;  5LMN L;  2JEA I;  2NZH A;  1H95 A;  2MO0 A;  2OTL A;  1PFS A;  4JI5 Q;  3SGI A;  3CW2 C;  3K0X A;  4UY8 C;  2YTX A;  4R4O A;  4LF4 L;  3KF8 B;  4IJL A;  1J5E L;  1KRS A;  4IPC A;  3M7N A;  1N36 Q;  4JI8 Q;  3BU2 A;  4LNQ A;  1X54 A;  2CFM A;  4A76 A;  2VY3 A;  4GKK L;  3NEL A;  4X64 L;  1IBL Q;  1PYS B;  4LW1 A;  1K9M C;  4AQY Q;  2OTJ A;  3GTK H;  3FKI G;  1CKN A;  1Q81 C;  1XNR Q;  1VQI A;  5GAG C;  4O2D A;  3J80 i;  1VQB A;  2LXJ A;  2WP8 J;  2XGT A;  5JJI A;  1YJ9 A;  3NBH B;  4GN4 B;  4DR5 Q;  1PH1 A;  2K75 A;  1X65 A;  2HHH Q;  1VQ7 A;  4OO1 I;  2UUC L;  1JJG A;  3UDI A;  3BJU A;  3AEV A;  4YY3 L;  1X6O A;  5AJ3 Q;  1IBK L;  4LF9 Q;  1X55 A;  1K73 C;  2VNU D;  2V1C C;  4L5S A;  1O7I A;  4AYB G;  1J6Q A;  3UE1 A;  2UUA Q;  1HNZ Q;  3PO2 H;  5IYC G;  4IOC A;  5M3M G;  3M3Y H;  4B3R L;  3GDE A;  4L5Q A;  1I50 H;  4JCV E;  3T1H L;  3TS2 A;  5C3E G;  1EQR A;  1U0L A;  3GTG H;  3S1R H;  3AFQ A;  4HJ9 A;  4IFD I;  1QVG A;  3S2D H;  1S72 A;  1MKH A;  1I94 Q;  4GKK Q;  4DV5 L;  1EUJ A;  2E2J H;  2F4V Q;  2EIF A;  1VS0 A;  4DV7 Q;  2VQE L;  2R92 H;  4PG3 A;  4DR1 L;  2R93 G;  1Y1V G;  1JB7 A;  4B3T L;  4LFA L;  4DUZ Q;  3HKS A;  1YHA A;  4C3I H;  3S15 H;  1HNW L;  2NVY H;  4NXN L;  2PI2 E;  3M9B A;  1IBM L;  1EOV A;  2OWO A;  2A8V A;  2PQA B;  4BXX H;  4R4Q A;  5C44 G;  4QIW E;  3CC2 A;  1K0R A;  2OCE A;  3A5Z B;  1PYB A;  4OON A;  4JBM A;  1L1O B;  2MQH A;  3IRB A;  2AMC B;  2KCT A;  1UWV A;  1YI2 A;  3S1Q H;  3E0E A;  3VDY A;  4AH6 A;  3TEH B;  3UDG A;  1N8R C;  4GKJ Q;  3CPF A;  1YJN A;  4K0K L;  3CP0 A;  1GKH A;  5ELO A;  3S14 H;  4YWK A;  2E5L L;  2IX0 A;  1VQJ A;  2K5H A;  2JJQ A;  2E8G A;  4BBR G;  1SN8 A;  3OTO L;  3CF5 A;  3HOZ G;  4MTN A;  1K8G A;  1QZG A;  4P72 A;  3UDX A;  2ZTE A;  4IPG A;  1X3F A;  1WOC A;  3RLF A;  1NY4 A;  1Y14 B;  4JI3 Q;  1CSQ A;  1KXL A;  3K81 C;  1XMQ Q;  4JI6 L;  4AYB E;  4A3C G;  2KEN A;  4P75 A;  1L2F A;  4OO1 G;  4JI4 L;  2YTV A;  4DPG A;  1KQS A;  1SE8 A;  4B3M L;  1X3E A;  5GQO A;  4L5R C;  1Z47 A;  1VQA A;  3J80 c;  4HJ5 A;  3PV0 A;  3GTL H;  1QVC A;  4LFB Q;  1PH4 A;  4LFC L;  3T1Y Q;  2MFI A;  1IL2 A;  1MIU A;  1KIX A;  3K7A H;  1UE1 A;  2LXK A;  2VQF Q;  4OWW B;  5ELN A;  2H5X A;  2HIX A;  1YZ6 A;  4YCU A;  1QZH A;  2Z0S A;  3RR5 A;  2HQL A;  2N8N A;  2UUB Q;  4DR2 L;  1PH6 A;  1RL2 A;  2YU9 H;  4IFD G;  4BA2 I;  4UPA A;  5IYC H;  3I56 A;  1WCM H;  1AE3 A;  5M3M H;  1C0A A;  3I7F A;  1E1O A;  4LF7 Q;  4DV4 Q;  1VQE A;  2FXQ A;  1NJI C;  5FJ8 G;  4R4C A;  2MO1 A;  5C3E H;  2Z6K C;  4IFD J;  2Z6K A;  1N32 L;  1BVS A;  1CUK A;  1K83 H;  3U50 C;  1VQF A;  1A0I A;  2I5H A;  2R92 G;  2VUM G;  3I4N G;  1GVP A;  4A3M G; 
#chains in the Genus database with same CATH topology
 1B53 A;  1OXV A;  3VR4 A;  4YHH Q;  4KJO A;  3BVZ A;  3PIP 3;  1Y1V H;  2B2U C;  2I46 A;  4NW2 A;  1FJG Q;  4BY7 B;  2ZTD A;  3C1F A;  3ND9 A;  4MNO A;  5LL6 X;  5C44 H;  1A62 A;  5IYD G;  1KD1 C;  3EBE A;  1LAB A;  2JXM B;  4TKO B;  5AFW A;  1QB5 D;  3VA7 A;  2OQK A;  5GAH C;  3BG3 A;  2A68 C;  4YIJ A;  4JI5 L;  1LTG D;  1GUO A;  2UXB Q;  5BR8 Q;  2EDG A;  5KND A;  5I2X A;  4UHV A;  1HTL D;  4KY6 A;  3RZO B;  3F2C A;  3HOZ H;  3ERS X;  4A3G B;  2JA8 B;  1A63 A;  3GV6 A;  1RHP A;  4R1J A;  4MZ9 A;  4J1M A;  3NTI A;  1YEZ A;  5T1G A;  2JA8 G;  2O5J C;  5CV7 A;  1TWF B;  3T16 A;  2GVA A;  4AQY L;  3GTQ B;  4IOA A;  2A69 D;  1EYC A;  1XWE A;  1EFW A;  1ONL A;  2L9H A;  1MGS A;  3EFX D;  3PCO B;  4DAY B;  3MWY W;  1JOQ A;  5JPM C;  1SFO B;  1EY6 A;  3G48 A;  1JT8 A;  3ICE A;  1JJ2 A;  1K0S A;  1CZW A;  1SMX A;  2D0P A;  1E3P A;  1S3O A;  3IKJ A;  5AJ3 L;  4GLA C;  2OF1 A;  1WD0 A;  2KJX A;  3CCU A;  3KJP A;  2JA6 B;  1PH7 A;  3H3V I;  4DK1 A;  5FO8 B;  5FLM G;  3K80 C;  3NEM A;  1C48 A;  1IYJ B;  4IAL A;  4JI0 Q;  3I4N H;  4A3M H;  1Q86 C;  1I94 L;  3P75 A;  4OGQ C;  4HIM A;  3PUW A;  4DN4 M;  2F4V L;  3BYT B;  4R8N A;  5F2D A;  3CCL A;  3S24 A;  2K50 A;  4KHP Q;  1JOR A;  1CKO A;  2DNC A;  5DAU A;  3ITP A;  4DR4 Q;  2EY1 A;  3CMA A;  5C4X B;  1WTQ A;  3HOY B;  5IYD H;  2BH2 A;  1VQH A;  3PMF A;  3AU7 A;  2F0Q A;  1PH8 A;  1NAP A;  2EYL A;  3HKZ B;  3CCR A;  3GO5 A;  4IO9 A;  2ZJP A;  3I4L A;  1Q82 C;  4G57 A;  3SK5 A;  4MTK A;  5DM6 3;  2FMC A;  4A3J G;  4NDX A;  3CC4 A;  3NQI A;  4HMJ A;  5E4X A;  3QOL A;  1OXU A;  4JYA Q;  1WFQ A;  2JA8 H;  4JVZ A;  1GO3 E;  2K32 A;  1OTC A;  1ZKO A;  2TSS A;  2B2W C;  4JBW A;  3OMG A;  1PTO H;  5FO9 B;  1HZA A;  5D3I B;  1SAP A;  4HMI A;  2F0H A;  1BF4 A;  1DOK A;  5I6Y A;  2Z9H A;  4DV1 Q;  4LFB L;  1STH A;  4DKA C;  2QF7 A;  3CCJ A;  3EIV A;  3KLR A;  4OWT B;  2KED A;  1BQQ T;  3MXN A;  1EWH A;  1N33 Q;  5E4W C;  3NQT A;  3TZD A;  3I3C A;  3VR3 A;  3MXP A;  2L12 A;  4FVM A;  1N9W A;  2A19 A;  4R8I A;  4JI7 Q;  4H02 A;  4JK1 C;  4HAE A;  5FLM H;  1V1O A;  2LSS A;  2K6A A;  4HIK A;  1XX8 A;  1KRT A;  2E2I H;  1BBU A;  3M85 A;  2MUY A;  2X69 A;  2V4D A;  3IAY A;  2C9O A;  1HR0 L;  3SK8 A;  1HH2 P;  1II3 A;  1LT4 D;  3HGB A;  4QUF A;  1EEI D;  2SEB D;  1RTN A;  5ISR A;  4NP5 A;  2E2J B;  3QO2 A;  1MSH A;  1TKW B;  1T5X D;  2JA7 G;  3Q0A A;  2IPK D;  3JAM L;  3GTJ H;  3G6J B;  3PUY A;  5C5M A;  4JI1 L;  3HOY H;  4GN5 A;  3RN5 A;  1EU4 A;  4XTC S;  2CWA A;  5LMN Q;  4C1N I;  3S2H H;  1NR4 A;  4KN4 C;  3Q8D A;  4WJW A;  1BR9 A;  1KHI A;  4LAA A;  3KLS A;  4WJ3 M;  4KHZ A;  4RHR A;  5I6W A;  3PIO A;  1XPR A;  3FVQ A;  4NXM L;  3SK6 A;  1A8V A;  4GKK Q;  2IHE A;  2RQX A;  5G3L D;  4DK3 C;  5LMU L;  1E0B A;  5DEH A;  3HP3 A;  1WJJ A;  2WAC A;  3HOX G;  3FKI B;  5FLX c;  1G6Z A;  1E2Z A;  4RKB A;  5EGT A;  4Q0F A;  2RDF A;  2NWG A;  1K8A C;  4UP9 A;  1OXT A;  3HOV G;  4ZAI A;  3V2T A;  2Z4H A;  1FGU A;  3Q24 A;  2EY2 A;  3KF6 B;  4PZ7 A;  1GM5 A;  3K7U C;  1IZ6 A;  3PF4 A;  4YWM A;  1PMR A;  1VQL A;  1D1I A;  3T1H Q;  2DJG C;  3VYS A;  1S5E D;  2FFK B;  2A69 C;  5CC4 A;  1K83 B;  2GA4 B;  3STB D;  2R7Z G;  1VCI A;  1ESF A;  1IXR A;  3AFP A;  1YVC A;  2VQE Q;  4DR1 Q;  4XQN A;  1ICF B;  2R93 B;  1DON A;  3D31 A;  1AEX A;  3RLO A;  1B70 B;  1HNW Q;  2ZXP A;  4A4I A;  4JOI A;  2CH4 W;  3NBH A;  1TS5 A;  4IQZ A;  1VQK A;  3E9I A;  1J9O A;  5T1I A;  1G2T A;  2K5W A;  5BN4 A;  5CV9 A;  1NTG A;  1TQO A;  3J80 E;  4HJA A;  2LY7 A;  4K0K Q;  2PNR C;  1DGS A;  2E5L Q;  4DR7 L;  3BDC A;  2IY5 B;  4BBR B;  2GN5 A;  5C5L A;  4EQO A;  3HG9 A;  1B1Z A;  4KN7 C;  4AIM A;  3R8B A;  1A3T A;  1O7Z A;  3S1N B;  1D5X C;  3HOX H;  2NVT B;  2I5L X;  1HNX L;  1ICW A;  1BCP D;  3CXC A;  3FKI H;  1WD1 A;  2OT2 A;  1PH2 A;  4LF5 L;  1VQG A;  2D2C C;  3HOV H;  3U58 A;  1YNN D;  2DY7 A;  2G5D A;  3CCQ A;  4DR2 Q;  4O0A A;  4P2C B;  5KNB A;  5IGC A;  1GJX A;  3F8T A;  1EQT A;  4KK7 A;  4QY7 A;  2E2D C;  5IT9 L;  4R4I A;  3NPP A;  2XTI A;  3M4O B;  1FVI A;  2XNA C;  3HKZ E;  1HJP A;  4DV6 L;  3PUZ A;  1EWI A;  2B2T C;  4DNR B;  4A3F B;  1XPU A;  2F0N A;  1E22 A;  2OEO A;  5E7N A;  3UE0 A;  4C3I G;  3UDF A;  3PQI A;  1EWC A;  4C2M B;  4IUP A;  2RSO A;  2F52 A;  3H3V C;  5EPL A;  4GNX B;  3L0O A;  3M7G A;  4V0B A;  5COY A;  3I70 A;  1PFS A;  3CW2 C;  3K0X A;  4UY8 C;  4C3H B;  2DNE A;  1STY A;  1EY4 A;  1MD2 D;  2NVQ B;  4JI8 Q;  3BU2 A;  2KCC A;  1X54 A;  2CFM A;  4PQX A;  3NEL A;  2EYP A;  3BZD B;  3C1E A;  4PMC A;  1LTT D;  1XNR Q;  1CKN A;  1LV9 A;  1Q8I A;  4DXF A;  2SDF A;  4O2D A;  2LXJ A;  2EPB A;  2WP8 J;  1TY0 A;  5JJI A;  3NP8 A;  2A5H A;  1UUP A;  4DR5 Q;  2K75 A;  1X65 A;  1WTV A;  3UDI A;  1DZ1 A;  1X6O A;  2RA4 A;  4H7B A;  1ILQ A;  1B3Q A;  1CQF A;  4CGY B;  2V1C C;  1SNC A;  4L5S A;  1O7I A;  4WRD A;  2UUA Q;  4OL7 A;  1F2Y A;  2I07 B;  1JOK A;  4JCV E;  1GHJ A;  1EQR A;  1F9P A;  3BYY B;  1LTB D;  3QG1 A;  1MHW C;  3CRL C;  3QIA A;  1R9T B;  4DUZ Q;  4C3I H;  3S15 H;  2NVY H;  4NXN L;  4DF7 A;  1EOV A;  3V96 A;  1L1O B;  3IRB A;  4K5W A;  2AMC B;  2KCT A;  1YI2 A;  1NNX A;  1H9M A;  4MHE A;  3SR1 A;  3CPF A;  1YJN A;  5ELO A;  4BY1 B;  1QWY A;  2F0W A;  1LAC A;  2K5H A;  2QDL A;  2BOS A;  2F0K A;  1BNZ A;  1I6V C;  4U67 3;  5I9O A;  3BS1 A;  2IL8 A;  4IPG A;  1WOC A;  4J8Q A;  1Y14 B;  4JI3 Q;  5A2Q E;  1CSQ A;  3K81 C;  1XMQ Q;  4JI6 L;  4A3C G;  4FF3 A;  1L2F A;  1A3U A;  4DPG A;  1SE8 A;  4B3M L;  4K8J A;  5JVG 3;  2ZXR A;  1ML0 D;  3T51 B;  1IYU A;  4YCU A;  1QZH A;  2Z0S A;  2Z6B A;  2Q8I B;  2HQL A;  1GUT A;  3R2I A;  2F4I A;  3RUZ A;  1VDZ A;  4IFD G;  3DUZ A;  5KEE A;  1VMP A;  1C0A A;  2HD3 A;  1E1O A;  3I7F A;  4IUN A;  3FMC A;  4LF7 Q;  5NUC A;  1NJI C;  1N32 L;  3HOU B;  3NSW A;  4Q5V A;  3U50 C;  2I5H A;  3OPO A;  2R92 G;  4QF4 A;  1UNS A;  4DK6 C;  1BCP C;  4ME5 A;  2YYZ A;  5ELD A;  2A73 B;  3NBI A;  4N9P A;  2XWJ B;  3GTM B;  4GLX A;  2CW0 D;  2EOT A;  1HUN A;  5IWA Q;  3DHQ A;  3B6Y A;  1YNN C;  3A0J A;  4JI2 Q;  1JJC B;  3ER0 A;  3PUX A;  1SYC A;  4BBS B;  2YTY A;  3R93 A;  2XIW A;  5FLX E;  1PH9 A;  1HZB A;  5KNC A;  4HID A;  1UEB A;  1VQM A;  1HHV A;  2WIN B;  3J7Z C;  1PH3 A;  3CRK C;  4A93 G;  5CV5 A;  4X3U A;  1ZYR D;  2F3I A;  3KDF A;  3RN2 A;  1N36 L;  3EQL C;  1AW7 A;  1GUW A;  3QWN A;  2E76 C;  2F1M A;  4B3S Q;  4X66 Q;  1CHQ D;  1XNQ Q;  1LTR D;  5GAD C;  5IP7 G;  4A3C H;  4A3B B;  1QIL A;  3TQY A;  3MZ5 A;  2EXZ A;  1CK1 A;  1DCZ A;  4RFB A;  3J7A 5;  4X62 Q;  2Y0S B;  2ZM6 Q;  4I65 A;  1I4P A;  1X3G A;  3J81 E;  1SRO A;  2JN4 A;  1PTO D;  1TWH B;  2EZV A;  1HPC A;  3HZX A;  2ASB A;  1SNM A;  3K5O A;  5CR3 A;  5G3L F;  4JV5 Q;  1QUQ A;  1T9H A;  2F0L A;  1HNZ L;  2Q8R E;  2K03 A;  5A2Q L;  1YNJ C;  4R4T A;  1Y1W G;  2VB3 X;  3PGZ A;  3G4S A;  1LYL A;  2CKZ B;  2PI2 A;  4LF8 Q;  1SR3 A;  2L55 A;  2PYK A;  1HR0 W;  4DUY Q;  4LUO A;  1YJW A;  1I5F A;  4KKU A;  2BA1 A;  2B39 A;  4U68 A;  2K4K A;  4JG2 A;  2RHQ B;  3G7L A;  1W3S A;  1AE2 A;  3GTP B;  4A93 H;  1SMY D;  3MFY A;  4POF A;  2B8F A;  1XMO Q;  2AKW B;  2N88 A;  1D7Q A;  4TSS A;  3FP9 A;  1A2T A;  3TRE A;  3KK7 A;  3S16 B;  4MN3 A;  1K28 A;  4QJF A;  5IP7 H;  4RGT A;  3J81 j;  1JOO A;  2ALY B;  4X3K A;  1X56 A;  5EQ0 A;  5IGF A;  3PUV A;  2WB1 B;  4JBK A;  1G51 A;  1BKB A;  4GOP A;  4ZLT F;  1NMG A;  2G9H D;  1PV4 A;  5BN5 A;  3DWP A;  3NK9 A;  5JJK A;  1AH9 A;  2EYM A;  3H15 A;  4DV2 Q;  4RMF A;  3ULJ A;  2ZJR A;  3PO3 G;  1HRJ A;  1P8L A;  2UUB L;  1PVO A;  3OYY A;  2IT1 A;  1STE A;  1C8C A;  4DAV A;  1B2T A;  1Y1W H;  1UE6 A;  4DV4 L;  1BCP F;  2JK8 A;  3KFU A;  2XWB B;  3NWS A;  1TXY A;  2K52 A;  3AMU A;  5C4J H;  2EQS A;  3AQQ A;  4X65 L;  3D4D A;  3J81 L;  4FXD A;  3S2D B;  4Z9C B;  4BY7 G;  1WTH A;  4DR6 Q;  3KUP A;  2Q2H A;  1F2L A;  2B3G A;  1ZEQ X;  1X9N A;  3TDQ A;  2DJF C;  4C3J B;  4DR3 Q;  5K5P A;  1G29 1;  1U5K A;  3LX0 A;  3S1Q B;  1GUG A;  1VQP A;  3NTH A;  5KYI A;  4A3G G;  3GTP H;  4CKE A;  2D62 A;  1L0W A;  3ULL A;  4FYD A;  1F9S A;  4RA8 A;  3S16 H;  1B3A A;  1KAA A;  3OSO A;  2CW0 C;  3FDT A;  3SK4 A;  3RZD H;  3I90 A;  1SLJ A;  1Z7T A;  1EYG A;  2AWN A;  4FF4 A;  1YHQ A;  3TP5 A;  4F7X A;  2VS1 A;  3GTL B;  3K7A B;  3PO3 H;  2K5V A;  3OWF A;  4YY3 Q;  3DMU A;  1EIY B;  1KLG D;  2JA6 G;  1EY5 A;  1ZYR C;  4POG A;  3SHL A;  4PMB A;  3A54 A;  5FK9 C;  5M5Y B;  1SND A;  3BVM A;  5J3B A;  3T4A C;  4KTA A;  1YNX A;  4L8J A;  2B63 B;  4LUZ A;  4XQQ A;  1YIT A;  1XTC D;  4BY7 H;  2B63 G;  1PTO C;  1CKM A;  4LFA Q;  1BDO A;  2ZTC A;  4DV0 L;  5C4X G;  3HOY G;  1GUN A;  4JOI C;  3CCM A;  1B50 A;  2D0O A;  3C46 A;  2EY5 A;  2LKV A;  2JE6 I;  1Q46 A;  2Y0S E;  2M00 A;  5IGD A;  5IE8 A;  1EFI D;  1RKN A;  1SBB B;  3HKZ G;  3BZK A;  4EGV A;  4IUR A;  4DK0 A;  3T53 B;  3RZO H;  4C3J H;  1V1Q A;  4A3G H;  2CQO A;  4RGM A;  2XSC A;  1GHK A;  3OTO Q;  2ATW A;  1A15 A;  1S4Z A;  4GZY C;  1WTX A;  2F0D A;  4TVA B;  1TWF H;  1U4R A;  3GTQ H;  2H4O A;  1SJE D;  3SVM A;  3FHW A;  3CKI B;  1SFO H;  2B29 A;  4OEM B;  4I7Z C;  1VQ8 A;  2X6G A;  4EQN A;  2PQA A;  2KA7 A;  4LFC Q;  1D5M C;  3MXU A;  2UXD L;  3TP8 A;  1SYF A;  3ONA B;  2JA6 H;  3GP7 A;  5EPJ A;  1XXG A;  4I7A A;  2IWH A;  2F03 A;  5C3W A;  5GAE C;  1K3R A;  4RH6 A;  4G7O C;  2ES2 A;  4JC0 A;  1M90 C;  1UE5 A;  2PQE A;  4DV3 L;  4FF2 A;  1I6H B;  4FDB A;  1LTL A;  5M5Y H;  1JE5 A;  1AP0 A;  2VUM B;  4OX9 L;  1C9O A;  1R4Q B;  1AFP A;  1CQV A;  2B63 H;  3NWT A;  4Y7N B;  5D65 A;  1VQO A;  5C4X H;  3W5O A;  2UU9 L;  4OIK A;  2MJ8 A;  1CKN B;  4BXX G;  2MPM A;  2UXC L;  4A3I B;  1VQD A;  1F9R A;  4KKT A;  2WB1 E;  3TS0 A;  1PA6 A;  4BA1 I;  4R9W A;  2NZH A;  1TU2 B;  4JI5 Q;  3SGI A;  1UAP A;  4LF4 L;  2EYO A;  3MFG A;  5CBE E;  3KF8 B;  1J5E L;  4XYQ A;  1KRS A;  4IPC A;  3EVQ A;  3GV3 A;  2VY3 A;  4ODG A;  4X64 L;  1EL0 A;  1PYS B;  3D4W A;  4ZK9 B;  4AQY Q;  3FKI G;  1VQI A;  1W6J A;  3OIQ A;  4QCL A;  4IUQ A;  2XGT A;  3ND8 A;  5IOC A;  1H9K A;  4GN4 B;  3F2U A;  1PH1 A;  3S17 B;  2LS0 1;  2UUC L;  4KD4 A;  5AJ3 Q;  1IBK L;  1SYD A;  1WCM B;  2EJG C;  1J6Q A;  1M4V A;  3I4M B;  3MTS A;  4IOC A;  4B3R L;  2AUJ D;  2LFN A;  3GDE A;  4L5Q A;  3RMH A;  3C2P A;  1PTO F;  1HXY D;  2EE1 A;  1WTR A;  4HJ9 A;  4ID6 A;  2A6E D;  5EBC A;  4IFD I;  1I94 Q;  2ENB A;  1SYB A;  4RKL A;  3HOW B;  4DV5 L;  1EUJ A;  2E2J H;  2KOL A;  2F4V Q;  1A6X A;  2R93 G;  4B08 A;  1JB7 A;  4B3T L;  1ESR A;  3HKS A;  1IBM L;  1J8I A;  2OWO A;  4N8F A;  3S1M B;  4BXX H;  2WAQ B;  1K0R A;  3PIO 3;  4OON A;  5LHY 1;  2O5I C;  4OEL B;  1UWV A;  1V1P A;  3VDY A;  2EVB A;  2RKS A;  1GKH A;  4BBR G;  2E8G A;  3CF5 A;  1QZG A;  1TWG B;  3DM1 A;  3RLF A;  4K5V A;  2B2V A;  4A3E B;  1NY4 A;  2EYF A;  4A3D B;  1JQY D;  4XT3 B;  1I4X A;  4JI4 L;  4CKB A;  4EVO A;  5TSS A;  4HJ5 A;  5KRU A;  4LFB Q;  2F0T A;  1MIU A;  1KIX A;  2K28 A;  1UE1 A;  4XDX A;  4CJ2 C;  4XT1 B;  1TR5 A;  1YZ6 A;  3P1H A;  5COR A;  3RR5 A;  3AB9 A;  1PH6 A;  1RL2 A;  3VYR A;  3TSS A;  1MI2 A;  1WCM H;  1EIH A;  4IUU A;  4HSV A;  1VQE A;  5DM7 3;  2MO1 A;  4IFD J;  1I4Q A;  1CHP D;  2Z6K A;  1BVS A;  1K83 H;  2P5Z X;  1VQF A;  1A0I A;  1SYE A;  5DNF A;  4RHS A;  2NTS A;  2SOB A;  2QW7 A;  2PW5 A;  1HR0 Q;  3KDF B;  1EZ6 A;  4LF6 L;  4A3F G;  2R3Z A;  2R93 H;  1LLR D;  4DNT B;  5J39 A;  2KHI A;  3A8I E;  3JAM i;  2KEE A;  4PMW A;  1N34 L;  2I5M X;  4JI1 Q;  4OHJ A;  4GS3 A;  1Q1E A;  1QNU A;  1JC7 A;  2JQO A;  2K33 A;  2NYZ D;  4C3H G;  1I3Q B;  2J0T D;  1RTO A;  4IUV A;  4BBR H;  2L5T A;  2OQ0 A;  3D0F A;  3K57 A;  1VQ9 A;  1Z6H A;  3ERQ A;  1JCK B;  4B9W A;  1IBL L;  5CGK A;  2VB2 X;  2VL6 A;  3ZJY C;  4NXM Q;  4WJ4 A;  3S1N H;  1KL9 A;  5LMU Q;  4OWX B;  1PYW D;  4ALP A;  2NVT H;  2NTT A;  1QE6 A;  4QL5 A;  4CJ1 B;  1A3V A;  3J80 L;  3HRZ C;  1CTM A;  1JWM D;  4QIW B;  2J7Z A;  2BA0 A;  2BE5 D;  4N8X 1;  1XPO A;  1K3B C;  2HHH L;  4A3L H;  3CD6 A;  4K2K A;  1O7L A;  3U4Z A;  4B9X A;  1PFM A;  1VQ4 A;  4LF9 L;  3VYT A;  3L2P A;  5FO7 B;  2JEB I;  3KBG A;  4IN3 A;  3I2Z A;  1NE3 A;  1EOT A;  2D5D A;  5M5W B;  1FL0 A;  3M4O H;  2RSN A;  1PRT D;  2HCI A;  2OXP A;  3P20 A;  5FKA C;  3CC7 A;  1M1K C;  1G91 A;  1Y8P B;  2YV5 A;  4A3F H;  4DV7 L;  2L15 A;  3A7L A;  3K8A A;  2RVL A;  4C2M H;  1ET9 A;  1FNU A;  2XRS D;  3K0Y A;  4QQB X;  4ILW A;  3I4O A;  3JAM c;  1YBY A;  1IYV A;  3QJY A;  4GOP B;  2JA9 A;  2KHS A;  2DY8 A;  3LWU A;  4OXP A;  5D3D A;  1E24 A;  3STB C;  5GRO A;  5C4Z A;  1Q8K A;  1ASZ A;  2N3S A;  4C3H H;  3KF6 A;  4EX5 A;  1KTK A;  4BY1 G;  4P73 A;  2JA5 B;  4RGO S;  2MNA A;  2NVQ H;  3IL8 A;  1JMC A;  4DR7 Q;  4KMU C;  4KV6 A;  1VMC A;  1G2S A;  3KOJ A;  3JC6 6;  1KDC A;  3QOJ A;  5FOB B;  3E6Z X;  3IFT A;  1G6P A;  1BCP B;  4LK1 C;  4XIG S;  3OWE B;  2BH8 A;  1IKM A;  4IZ8 A;  3PF5 A;  1BBW A;  1ENA A;  3GTK B;  1U4P A;  4GOP C;  1HNX Q;  1FGB D;  3CCE A;  4FNF A;  2AQ1 B;  1MJC A;  3T1Y L;  1WTO A;  2PW7 A;  3FPU B;  4LF5 Q;  2VQF L;  4JW0 A;  2AQ2 B;  4LJZ C;  5HGQ A;  3J7A V;  1R4P B;  4L5T A;  1CA5 A;  3KBX A;  1JE4 A;  1IW7 D;  5DLQ E;  1KAW A;  1SSO A;  4L6T B;  1JWU D;  1WTP A;  1DOM A;  4MIU A;  2F0V A;  2WAQ E;  5JVH 3;  4H44 C;  1XJV A;  3HOU G;  3PO2 B;  3M3Y B;  2KCN A;  4A3K B;  5IGG A;  1X3P A;  1I50 B;  5HUR A;  4PNY A;  3X3N A;  2A68 D;  3S1R B;  3LNN A;  2NVX B;  4YHH L;  2F0F A;  4C1N K;  4DV6 Q;  1KDA A;  3U9S A;  1R9T H;  1FJG L;  4KKS A;  4BS9 A;  5C6A A;  5IGB A;  1WI5 A;  1JIC A;  2BDO A;  4HN7 A;  4DNI A;  4QB4 A;  2F0M A;  3BZC A;  4BBS G;  1UEA B;  1K8M A;  1E7Z A;  4ZKC B;  5IP9 G;  5H1S E;  2PNH A;  3NEN A;  4BA2 I;  2O2L D;  2KBN A;  2NN6 G;  4BY1 H;  2UXB L;  5BR8 L;  2FMM A;  2EJF C;  3H6M A;  2L1B A;  1X32 A;  4RG1 A;  1EY0 A;  2MHV A;  3KJO A;  4A3B G;  2DUD A;  1LT5 D;  3EN2 A;  3L3O C;  3U9O A;  2C35 B;  1VQC A;  1CFM A;  2Y0S G;  4K6D A;  1ILP A;  5J22 A;  3CME A;  4RWS C;  4N9T A;  1ROD A;  3NTK A;  5C0X G;  3CHB D;  2N49 A;  5M3F B;  3W1B A;  1F77 A;  4GNX A;  4YCV A;  5M3F G;  1B9M A;  1ENF A;  5D14 A;  4AYB B;  4DGZ A;  2YU9 B;  4J15 A;  4P71 A;  3HOU H;  1SE3 A;  3VA5 A;  5M3M B;  1WTW A;  3T13 A;  3CAM A;  4E6I A;  4YCW A;  4JI0 L;  5IT9 c;  3A74 A;  2RF4 A;  4A3K H;  2K04 A;  1S5D D;  3J7A F;  3GTM H;  2IHF A;  1Z9F A;  1B7Y B;  4KHP L;  4UDU C;  3K58 A;  1TWC B;  2NVX H;  1Y1V B;  4DR4 L;  2KQ3 A;  2PPB C;  4NXN Q;  2F0S A;  2K7V A;  4L63 B;  5EJW A;  5C44 B;  2F0P A;  4BBS H;  3M4Q A;  4PV1 C;  5IYB H;  3MXN B;  1EYA A;  4K8I A;  3RD4 A;  3W2D A;  5IP9 H;  2NN6 H;  4HTH A;  4IPD A;  4QMG A;  3PIP A;  1U4M A;  3U4V A;  1B8A A;  2CQA A;  2IJ0 A;  1HZC A;  1ASY A;  5I4D A;  4S3S A;  1PRT C;  2QKI C;  1PDQ A;  3HOZ B;  1K8O A;  3WDN A;  4JYA L;  4FO2 A;  4A3B H;  1OXX K;  4KY5 A;  1EIF A;  2K01 A;  4JI6 Q;  2WB1 G;  3VYU A;  5FLX L;  3BDO A;  4CKC A;  4B3M Q;  2K5Q A;  5C0X H;  2PCF B;  1TWH H;  4ZRZ A;  4DV1 L;  1ET6 A;  3PSI A;  4X6A H;  4YWL A;  2AHO B;  1N33 L;  1L1O A;  3CPW A;  5M3F H;  2NZO A;  2VZA A;  1VQ6 A;  5JEA G;  2DN8 A;  4WOR A;  4JI7 L;  4HIO A;  3M4Y A;  3CCV A;  1XYI A;  3DLL A;  2ID0 A;  1JB3 A;  1N32 Q;  4HJ8 A;  1VQ5 A;  1IHZ A;  1NCV A;  3I73 A;  3M4P A;  3I4N B;  4A3M B;  1H9S A;  2C5C A;  2QA4 A;  2I0Q A;  1G8Z D;  2WV6 D;  3KYH C;  2JYO A;  2PZW A;  1EU3 A;  2VW9 A;  2F3V A;  4DAM A;  1LT3 D;  1TWC H;  3GD7 A;  3Q22 A;  1IW7 C;  3NUC A;  5E3F A;  2A6H D;  3NXW A;  4C3J G;  5LMN L;  3DEP A;  4DXG A;  2OTL A;  1Q3L A;  1S5C D;  4R4O A;  4LMQ D;  1DD2 A;  2Q8T A;  4M8A A;  1MSG A;  1TT2 A;  4IJL A;  3M7N A;  1N36 Q;  4LNQ A;  4CDC C;  1O78 A;  4GKK L;  2HUG A;  4LW1 A;  1TII D;  4O42 A;  2BCO A;  3QR8 A;  3D4R A;  2OTJ A;  4EQP A;  1PTO B;  1HA5 A;  1VQB A;  5CYU A;  2IX3 A;  3ERO A;  5ELF A;  1FNW A;  1YJ9 A;  1GOZ A;  3NBH B;  3UI2 A;  1VQ7 A;  2IW3 A;  5JEA H;  3DXJ C;  3BJU A;  1Q90 A;  2VNU D;  2G9D A;  4FP5 D;  3UE1 A;  2EJM A;  3TP6 A;  1HNZ Q;  5IYC G;  1V1P B;  2F0U A;  3JAM E;  3T1H L;  4NKL A;  1U0L A;  4ZUI A;  3BDL A;  3K5L A;  1O7Y A;  3O13 A;  1EQV A;  4V19 0;  1QVG A;  2E2I B;  3S2D H;  4OIJ A;  1MKH A;  2Z1C A;  2EY6 A;  2EIF A;  1VS0 A;  1X3Q A;  2VQE L;  2NUC A;  4PG3 A;  4DR1 L;  4F88 A;  2MGS A;  2E75 C;  1PFB A;  1HNW L;  3M9B A;  3A8K E;  4G4K A;  2PMZ B;  3A5Z B;  1PYB A;  2EYH A;  3GTJ B;  3URY A;  5J1Z A;  2MQH A;  1EIG A;  1PRT F;  3S1Q H;  3E0E A;  5M5X B;  2WII B;  4AH6 A;  3UDG A;  3S2H B;  1E2V A;  4K0K L;  1NR2 A;  1RDP D;  3CQZ B;  2ICI A;  2E5L L;  1FR3 A;  2FHT A;  3LWE A;  1SN8 A;  5IGE A;  5EKI A;  2F0G A;  5KYL A;  4KY7 A;  3TME A;  4A3J B;  1IL8 A;  1KDB A;  5EKL A;  4P72 A;  3UDX A;  2E2H B;  1X3F A;  2B2V C;  4AYB E;  4P75 A;  4OO1 G;  4HSP A;  2SNS A;  2AQ3 B;  2JP1 A;  1X3E A;  4L5R C;  1CM9 A;  1Z47 A;  1VQA A;  3EA6 A;  3GTL H;  1SMY C;  2MFI A;  1IL2 A;  3K7A H;  2LXK A;  1BBX C;  2D9U A;  5ELN A;  1GXD C;  3A7A B;  1B44 D;  2N8N A;  2UUB Q;  4DR2 L;  5IYC H;  4K5X A;  5EPK A;  1AE3 A;  4DV4 Q;  1ENC A;  5KIX A;  3MC0 B;  4R4C A;  5FJ8 G;  4FF1 A;  2Z6K C;  1CUK A;  4X3T A;  2VUM G;  1TS3 A;  4O1N A;  4X65 Q;  1SNQ A;  2QGQ A;  3J81 i;  3A8J E;  2QIL A;  2B2U A;  4HR7 B;  1H9R A;  4BWG B;  1U4L A;  1UE7 A;  4ZUJ A;  2QEX A;  2O4X A;  1LM0 A;  2ZT9 C;  4LWC A;  2JA7 B;  4KJN A;  1V43 A;  3OW7 A;  4A3I G;  2X6L A;  1D8L A;  2M2L A;  3E9H A;  3I55 A;  1KC8 C;  1DM0 B;  1S5F D;  2RHS B;  2FIN B;  2QCP X;  3WWV A;  3NE5 B;  2KVM A;  2Q2T A;  2PZT A;  5M5X H;  3ZYY X;  2XVS A;  3CQZ H;  1HQM C;  4DFA A;  4JI8 L;  1RCV D;  4A3J H;  4LUV A;  4UP8 A;  4OO1 H;  2E2H H;  4KLK A;  1XNR L;  3KLW A;  1EY9 A;  1LO5 D;  2K05 A;  1B4O A;  3HOX B;  1Q12 A;  2L4N A;  2E74 C;  1TVX A;  1I4H A;  3K6O A;  1OO9 B;  2A6H C;  3KLS X;  5IT9 E;  4DR5 L;  1OXS C;  1FNV A;  5CV6 A;  1D2B A;  3H94 A;  4DU9 A;  4IUT A;  2WFW A;  1WCM G;  2R7D A;  2M9V A;  2F0I A;  3HOV B;  5IY0 A;  3SE0 A;  1HZ9 A;  2Z4I A;  2UUA L;  3I4M G;  1Y8O B;  1JJG A;  1P16 A;  4PZ6 A;  3J7Y W;  4XXE A;  5FJ8 H;  5JAV A;  1I6H H;  2F0O A;  1HFG A;  1TWA B;  3Q23 A;  4JPB W;  2VUM H;  3EJI A;  4CJ0 B;  3AYH B;  4DAY A;  1EY7 A;  1RF2 D;  2CWP A;  2R7Z B;  4ZKB B;  3HOW G;  3J81 c;  4Y7N H;  4TQU S;  4DUZ L;  2R7F A;  1C4Q A;  4DV0 Q;  2WAQ G;  4A3I H;  1CT1 D;  5CBA E;  1EY8 A;  3D3R A;  1NSN S;  1SNO A;  2J4X A;  2JA7 H;  2IX1 A;  2DGY A;  3E5S A;  4ZYS A;  1U9R A;  4DA2 A;  3LGJ A;  5HGT A;  3OHX C;  3QB3 A;  1PH4 A;  1W6K A;  3H09 A;  3GTO B;  1D6E C;  3FEW X;  3HFZ B;  1PZI D;  3RNU A;  1NUC A;  4HED A;  4A3E G;  2K5N A;  3S9W A;  2NN6 I;  4A3D G;  4JI3 L;  2NBF A;  3RLN A;  4CDE C;  1XMQ L;  2B2W A;  2A74 C;  5ELB A;  1LTS D;  5JJL A;  2RCN A;  1SJH D;  4IJH A;  4A3L G;  1PFN A;  4ZQ3 A;  1VQN A;  1S5B D;  1WYD A;  3C3L A;  2KCM A;  5JPN C;  3S17 H;  2KHJ A;  5ELC A;  2UXD Q;  3E0J A;  1F2Z A;  1GD7 A;  3OOC A;  1QG7 A;  2L11 A;  1SNP A;  4EQ5 A;  1CA6 A;  3OMC A;  5C0X I;  4GLV B;  3I4M H;  1D1K A;  5IIF A;  4XYO A;  1QCB D;  3I8Z A;  4LF7 L;  2PMZ E;  1SXT A;  3I91 A;  3F2B A;  4DV3 Q;  3OIP A;  1AZP A;  1JR0 D;  4ULL A;  1TWA H;  4H0L C;  3HOW H;  1NBW A;  2RDG A;  3DM3 A;  4OX9 Q;  1V8Q A;  1H9J A;  2R7Z H;  1F9Q A;  3TBI B;  2AWO A;  4APV A;  3S1M H;  2GVB A;  4K2L A;  1Q7Y C;  4F87 A;  2UU9 Q;  5IWA L;  1D5Z C;  4C3I B;  3S15 B;  2NVY B;  5A35 A;  4JBJ A;  4JI2 L;  1M8A A;  3K5M A;  2F0E A;  2UXC Q;  1HUM A;  1HQR D;  3P7J A;  1AZQ A;  4F8M A;  2Q2I A;  1RD9 D;  4GN3 B;  1VF5 C;  4Y52 H;  1QUQ B;  2A1A A;  1STG A;  3A56 A;  3CCS A;  2NB0 A;  4LF4 Q;  1F2M A;  3W1G A;  1EEF D;  3F1Z A;  3A5U A;  1TWG H;  1J5E Q;  1C7Y A;  1KLU D;  2ICE C;  4A3E H;  3GTO H;  4A3D H;  2PZU A;  4NPS A;  1DXM A;  4H13 C;  4X66 L;  4B3S L;  1XNQ L;  1BUV T;  4X64 Q;  1KNE A;  1YHB A;  3TP7 A;  4ABN A;  2FJ2 A;  5CV4 A;  2JSO A;  1SEB D;  1YNJ D;  4X62 L;  4P74 A;  2ZM6 L;  4HJ7 A;  4FXG C;  3TRZ A;  3MVV A;  1EYD A;  1YIJ A;  1TS4 A;  5K36 G;  3H3V H;  1L0X B;  2XN9 C;  3X3M A;  2HIV A;  4X3S A;  1PXU A;  2CH4 A;  4GNX C;  1HA6 A;  5C0X J;  2UUC Q;  1L0Y B;  3Q6S A;  1KNA A;  1MJE A;  4JV5 L;  1IBK Q;  3F2D A;  5I2Y A;  4PZ8 A;  1QVF A;  4A75 A;  4M1U B;  5HY6 A;  1PHJ A;  1V9P A;  4XQJ A;  1Q1B A;  1NMF A;  2H1E A;  2ZJQ A;  4B3R Q;  4NMZ A;  3KF8 A;  1EZ8 A;  2CCZ A;  1E1T A;  5C4H A;  4LF8 L;  5CV8 A;  4IPH A;  1SDF A;  4ME3 A;  4DUY L;  5E1F A;  2Z8L A;  1PZK D;  4DV5 Q;  4UAI A;  3H0G B;  2VXW A;  4B3T Q;  4KI0 A;  1IBM Q;  3ULP A;  3H0G G;  3A55 A;  3TZU A;  3G71 A;  4GKJ L;  1B9N A;  1WVL A;  3MEF A;  1RIP A;  3VR6 A;  1AN8 A;  2A6E C;  5LMN W;  4UP7 A;  2JA5 G;  1I3Q H;  2Q2U A;  1LT6 D;  3VR2 A;  3L9A X;  5L37 A;  3OW2 A;  1XMO L;  1FD7 D;  3GQB A;  3FRP B;  3E3X A;  5JOB A;  1SYG A;  3BVG A;  3V05 A;  2SNM A;  3N6R A;  4K6L A;  2R6G A;  2MP1 A;  4JI4 Q;  1SRU A;  1ZXT A;  2HDL A;  5K36 H;  1H9S B;  3MAQ A;  1JWS D;  3FPP A;  3MEH A;  4DV2 L;  1L1O C;  3HS0 C;  2N78 A;  3K5N A;  1CI3 M;  1XTD A;  1PH5 A;  2HT1 A;  3WOE A;  3DWQ A;  5JEA J;  1CSP A;  5M5W H;  2PO4 A;  1LTA D;  3PO2 G;  1EQQ A;  1KAB A;  1S40 A;  3GTG B;  4A3K G;  2K14 A;  4RGN A;  4QGU A;  4TRD A;  1GUS A;  2EXD A;  2R92 B;  2KEC A;  2B2Y C;  3R3O A;  1FYC A;  5ELE A;  1O80 A;  3IFD A;  4LF6 Q;  4NB3 A;  2B2T A;  3H91 A;  1STA A;  1LUZ A;  2ZXO A;  4ZCK A;  3G6E A;  4HCE A;  5EAY A;  4WFN 3;  4DR6 L;  5IYB G;  3K59 A;  1RJT A;  3H0G H;  3SXH A;  1Y69 U;  1W2B A;  4KD3 A;  1N34 Q;  1T5E A;  2AUK A;  3L7Z C;  3VR5 A;  4DR3 L;  3N52 A;  5EKK A;  4C56 C;  2JA5 H;  2CVR A;  3S14 B;  2EYJ A;  2JEA I;  1H95 A;  2MO0 A;  4RCN A;  1PLF A;  2YTX A;  2N55 A;  4A93 B;  5EBD A;  3MA2 B;  4A76 A;  2LMC B;  4CDF C;  1IBL Q;  2WKC A;  5IOD A;  1SE2 A;  1K9M C;  3GTK H;  3CU7 A;  1Q81 C;  1BOS A;  5C3X A;  5KGU A;  5BN3 A;  5GAG C;  3J80 i;  2K5D A;  4HCS A;  3HEJ A;  2HHH Q;  3R2T A;  1IKL A;  4OO1 I;  1DYQ A;  1LTI D;  3AEV A;  3WOF A;  4YY3 L;  1CZG A;  4J6H A;  4LF9 Q;  1X55 A;  1K73 C;  4CHT B;  4AYB G;  1HTP A;  5C3E B;  3PO2 H;  1SE4 A;  2BDN A;  5M3M G;  3M3Y H;  1PRT B;  2NZ1 D;  1I50 H;  3MXG A;  4CDD C;  1Y1W B;  4IFD H;  3TS2 A;  2F3W A;  5C3E G;  5JJZ A;  3T56 B;  2BE5 C;  5CMD A;  5M9O A;  4FXK C;  3GTG H;  1VF7 A;  3AFQ A;  3S1R H;  5C4J B;  2RCF A;  2TMP A;  1S72 A;  1PZJ D;  1I4R A;  4DV7 Q;  2R92 H;  2B8G A;  2R61 A;  4RCO A;  1Y1V G;  2K1B A;  1DOL A;  4LFA L;  1YHA A;  2L0C A;  1HFN A;  2PI2 E;  1QOH A;  2F0J A;  3DEO A;  2PQA B;  2A8V A;  2QDB A;  3MHB A;  4R4Q A;  5C44 G;  4QIW E;  3CC2 A;  2OCE A;  4JBM A;  5LL6 S;  5I9P A;  4RAU C;  1TS2 A;  3TN2 A;  1HCZ A;  1STB A;  3TEH B;  1N8R C;  4K14 A;  4GKJ Q;  1QNK A;  2HDM A;  3CP0 A;  3S14 H;  3SDZ A;  4YWK A;  4G7H C;  2IX0 A;  1VQJ A;  3OTO L;  2JJQ A;  2CHB D;  3HOZ G;  4QUC A;  1Y8N B;  4MTN A;  1K8G A;  2ZTE A;  3I72 A;  1BO0 A;  2KUM A;  1STN A;  1KXL A;  2RDH A;  1TY2 A;  1E2W A;  2KEN A;  2QEJ C;  1MBY A;  2YTV A;  1KQS A;  3D8G A;  1I4G A;  5GQO A;  3RZD B;  3J80 c;  3PV0 A;  2XRQ D;  4CBV A;  1QVC A;  1DJR D;  1BXT A;  1QJO A;  4LFC L;  4DAP A;  2WKD A;  3T1Y Q;  3D6W A;  4OWW B;  2VQF Q;  2H5X A;  2HIX A;  1A2U A;  3DWA A;  3PO3 B;  3SEB A;  2YU9 H;  2HQE A;  4UPA A;  3I56 A;  5M3M H;  3W3A A;  2FXQ A;  3NHH A;  4KHV A;  2HCC A;  2RBM A;  5C3E H;  4G7Z C;  2B2Y A;  3D6C A;  3I4N G;  1GVP A;  4A3M G; 
#chains in the Genus database with same CATH homology
 4X65 Q;  4DK6 C;  1HR0 Q;  1OXV A;  2QGQ A;  3KDF B;  2YYZ A;  4YHH Q;  3J81 i;  4LF6 L;  4A3F G;  2R93 H;  1Y1V H;  4GLX A;  1FJG Q;  2ZTD A;  1UE7 A;  2QEX A;  1LM0 A;  4LWC A;  4MNO A;  5IWA Q;  5C44 H;  2KHI A;  3B6Y A;  3A0J A;  1A62 A;  1V43 A;  4JI2 Q;  3JAM i;  5IYD G;  4A3I G;  4PMW A;  1JJC B;  1N34 L;  1KD1 C;  1D8L A;  3EBE A;  3ER0 A;  3PUX A;  2I5M X;  4JI1 Q;  2YTY A;  3E9H A;  4GS3 A;  3I55 A;  1Q1E A;  1KC8 C;  2RHS B;  5GAH C;  2JQO A;  2OQK A;  1PH9 A;  1HZB A;  4JI5 L;  4HID A;  1UEB A;  3WWV A;  1VQM A;  2UXB Q;  5BR8 Q;  3J7Z C;  2Q2T A;  1PH3 A;  4A93 G;  5M5X H;  3F2C A;  4BBR H;  2OQ0 A;  3HOZ H;  3ERS X;  1A63 A;  3D0F A;  3CQZ H;  2F3I A;  3KDF A;  3RN2 A;  1N36 L;  4JI8 L;  1VQ9 A;  4R1J A;  4MZ9 A;  1YEZ A;  1IBL L;  2JA8 G;  4NXM Q;  2VL6 A;  3ZJY C;  4X66 Q;  4A3J H;  4B3S Q;  5GAD C;  1KL9 A;  4LUV A;  5IP7 G;  1XNQ Q;  4UP8 A;  4AQY L;  2GVA A;  5LMU Q;  2E2H H;  4OWX B;  4ALP A;  4KLK A;  3TQY A;  1XNR L;  3KLW A;  2NVT H;  4IOA A;  1EFW A;  3J7A 5;  4QL5 A;  4X62 Q;  2ZM6 Q;  3PCO B;  4DAY B;  1Q12 A;  1X3G A;  2BA0 A;  3G48 A;  1JT8 A;  1SRO A;  1XPO A;  3ICE A;  1JJ2 A;  4DR5 L;  2HHH L;  4A3L H;  3CD6 A;  1SMX A;  1OXS C;  3U4Z A;  2D0P A;  2ASB A;  2WFW A;  1E3P A;  1S3O A;  5AJ3 L;  1WCM G;  4GLA C;  2R7D A;  1VQ4 A;  4LF9 L;  3L2P A;  4JV5 Q;  2JEB I;  5IY0 A;  3CCU A;  3KJP A;  1HZ9 A;  1PH7 A;  1QUQ A;  1T9H A;  3I2Z A;  1P16 A;  4PZ6 A;  1HNZ L;  1NE3 A;  2UUA L;  3H3V I;  3I4M G;  4R4T A;  1Y1W G;  5FJ8 H;  1I6H H;  5FLM G;  1FL0 A;  3K80 C;  3NEM A;  3PGZ A;  1LYL A;  3G4S A;  3M4O H;  1IYJ B;  2CKZ B;  2VUM H;  2PI2 A;  4JI0 Q;  4LF8 Q;  3I4N H;  1SR3 A;  4A3M H;  3AYH B;  2CWP A;  1Q86 C;  1I94 L;  3HOW G;  3CC7 A;  4HIM A;  1M1K C;  1HR0 W;  3PUW A;  2YV5 A;  2F4V L;  4DUY Q;  4A3F H;  4DV7 L;  3J81 c;  3CCL A;  4LUO A;  2K50 A;  2L15 A;  3S24 A;  4Y7N H;  4TQU S;  1YJW A;  4KHP Q;  1CKO A;  4DUZ L;  3K8A A;  2R7F A;  4C2M H;  1I5F A;  4DR4 Q;  2BA1 A;  4DV0 Q;  4QQB X;  2WAQ G;  3CMA A;  4A3I H;  5IYD H;  2K4K A;  3I4O A;  4JG2 A;  2BH2 A;  3JAM c;  1YBY A;  2RHQ B;  4A3C H;  1VQH A;  4GOP B;  2JA7 H;  2JA9 A;  2IX1 A;  2DGY A;  1W3S A;  1PH8 A;  4OXP A;  1E24 A;  3STB C;  5GRO A;  3LGJ A;  1Q8K A;  1ASZ A;  2N3S A;  4C3H H;  3KF6 A;  3GO5 A;  1AE2 A;  4BY1 G;  4P73 A;  4EX5 A;  3CCR A;  4IO9 A;  2ZJP A;  4A93 H;  2MNA A;  1Q82 C;  2NVQ H;  3HFZ B;  4POF A;  3RNU A;  1XMO Q;  2AKW B;  1JMC A;  4DR7 Q;  4A3J G;  1D7Q A;  3FP9 A;  3CC4 A;  3TRE A;  1OXU A;  4JYA Q;  1WFQ A;  3JC6 6;  3KOJ A;  2K5N A;  4A3E G;  2NN6 I;  2JA8 H;  1GO3 E;  4JI3 L;  4A3D G;  4QJF A;  3RLN A;  5IP7 H;  3J81 j;  1XMQ L;  1OTC A;  2ALY B;  1G6P A;  1X56 A;  4JBW A;  4XIG S;  2BH8 A;  3PUV A;  1HZA A;  4JBK A;  3PF5 A;  1G51 A;  5JJL A;  1BBW A;  1BKB A;  2RCN A;  4GOP C;  4IJH A;  4GOP A;  3CCE A;  1HNX Q;  4A3L G;  1NMG A;  1PV4 A;  4DV1 Q;  1VQN A;  4LFB L;  1WYD A;  1MJC A;  4DKA C;  2KCM A;  3T1Y L;  3CCJ A;  3S17 H;  5JJK A;  3EIV A;  1AH9 A;  3H15 A;  2KHJ A;  2VQF L;  4LF5 Q;  4OWT B;  2UXD Q;  5HGQ A;  1GD7 A;  4DV2 Q;  4L5T A;  1N33 Q;  4RMF A;  3ULJ A;  2ZJR A;  3PO3 G;  5DLQ E;  1P8L A;  4EQ5 A;  1KAW A;  2UUB L;  1PVO A;  3OYY A;  2IT1 A;  5C0X I;  4GLV B;  3I4M H;  1N9W A;  2A19 A;  4JI7 Q;  2WAQ E;  4LF7 L;  2PMZ E;  1UE6 A;  4H02 A;  4DV4 L;  1Y1W H;  5FLM H;  2JK8 A;  3KFU A;  3HOU G;  2LSS A;  3F2B A;  1XJV A;  4HIK A;  1TXY A;  2K52 A;  4DV3 Q;  1KRT A;  5C4J H;  2E2I H;  1BBU A;  3M85 A;  1TWA H;  2EQS A;  3AQQ A;  4X65 L;  1NBW A;  1HR0 L;  3HOW H;  1HH2 P;  3DM3 A;  4YHH L;  4OX9 Q;  4DV6 Q;  1R9T H;  2R7Z H;  1FJG L;  4BY7 G;  2AWO A;  4APV A;  3S1M H;  2GVB A;  4DR6 Q;  1WI5 A;  1Q7Y C;  2JA7 G;  2UU9 Q;  5IWA L;  2Q2H A;  4DNI A;  4JI2 L;  4JBJ A;  3GTJ H;  3BZC A;  2B3G A;  3PUY A;  2UXC Q;  4BBS G;  1X9N A;  4JI1 L;  3HOY H;  4GN5 A;  3RN5 A;  5IP9 G;  1E7Z A;  2Q2I A;  4XTC S;  5H1S E;  2PNH A;  3NEN A;  2CWA A;  4DR3 Q;  5LMN Q;  4GN3 B;  2KBN A;  2NN6 G;  1G29 1;  1U5K A;  3S2H H;  4BY1 H;  2UXB L;  5BR8 L;  3Q8D A;  1QUQ B;  1VQP A;  4Y52 H;  2A1A A;  3CCS A;  4A3G G;  4LF4 Q;  1KHI A;  3W1G A;  3GTP H;  3F1Z A;  3A5U A;  4WJ3 M;  1TWG H;  2D62 A;  1L0W A;  1J5E Q;  1C7Y A;  3ULL A;  4A3E H;  3GTO H;  4KHZ A;  1XPR A;  3PIO A;  4A3D H;  4NPS A;  4RG1 A;  4NXM L;  4B3S L;  4X66 L;  1A8V A;  3KJO A;  2IHE A;  1XNQ L;  4X64 Q;  3S16 H;  1YHB A;  4DK3 C;  2DUD A;  5LMU L;  4A3B G;  3EN2 A;  2C35 B;  1WJJ A;  1VQC A;  2Y0S G;  3RZD H;  4X62 L;  2ZM6 L;  4P74 A;  3HOX G;  4HJ7 A;  5FLX c;  1SLJ A;  3CME A;  3TRZ A;  1YIJ A;  1EYG A;  2AWN A;  5C0X G;  3H3V H;  5K36 G;  1YHQ A;  2N49 A;  2HIV A;  2VS1 A;  3W1B A;  4GNX C;  4GNX A;  5C0X J;  1K8A C;  2UUC Q;  4YCV A;  4UP9 A;  2K5V A;  5M3F G;  1MJE A;  3PO3 H;  4YY3 Q;  1OXT A;  3HOV G;  4JV5 L;  1EIY B;  1IBK Q;  3F2D A;  1FGU A;  2JA6 G;  1QVF A;  4PZ8 A;  4A75 A;  4POG A;  3KF6 B;  4PZ7 A;  1GM5 A;  5HY6 A;  1PHJ A;  1V9P A;  4WJ4 A;  3K7U C;  1IZ6 A;  1NMF A;  1Q1B A;  4J15 A;  4P71 A;  2ZJQ A;  3HOU H;  4YWM A;  3PF4 A;  1VQL A;  4B3R Q;  3CAM A;  5J3B A;  4YCW A;  3T1H Q;  2CCZ A;  1E1T A;  4JI0 L;  1YNX A;  4LF8 L;  5IT9 c;  3A74 A;  2RF4 A;  3STB D;  2R7Z G;  4A3K H;  1VCI A;  4IPH A;  4LUZ A;  1IXR A;  1YIT A;  2IHF A;  3GTM H;  1Z9F A;  4ME3 A;  4DUY L;  1B7Y B;  3AFP A;  4DV5 Q;  4KHP L;  4BY7 H;  1YVC A;  2VQE Q;  2B63 G;  4DR1 Q;  2NVX H;  4B3T Q;  1CKM A;  4LFA Q;  4KI0 A;  3D31 A;  3RLO A;  4DR4 L;  1B70 B;  2ZTC A;  4DV0 L;  1IBM Q;  4NXN Q;  1HNW Q;  5C4X G;  3HOY G;  3ULP A;  4JOI C;  4A4I A;  3H0G G;  4JOI A;  3CCM A;  2D0O A;  4BBS H;  3M4Q A;  5IYB H;  3G71 A;  1VQK A;  4GKJ L;  3MXN B;  2JE6 I;  5IP9 H;  1Q46 A;  2Y0S E;  3E9I A;  5IE8 A;  3MEF A;  1RIP A;  4IPD A;  3PIP A;  3HKZ G;  3BZK A;  4UP7 A;  1I3Q H;  5LMN W;  2JA5 G;  3U4V A;  2Q2U A;  1B8A A;  1NTG A;  4HJA A;  3RZO H;  4C3J H;  1V1Q A;  3OW2 A;  4K0K Q;  1HZC A;  4A3G H;  1DGS A;  1ASY A;  2CQO A;  1XMO L;  2E5L Q;  4DR7 L;  2IY5 B;  3OTO Q;  2ATW A;  2GN5 A;  4JYA L;  4A3B H;  4TVA B;  1OXX K;  1TWF H;  3GTQ H;  1EIF A;  4AIM A;  4JI6 Q;  2WB1 G;  2R6G A;  3FHW A;  3HOX H;  4JI4 Q;  1SRU A;  2B29 A;  1SFO H;  2I5L X;  1HNX L;  4B3M Q;  3CXC A;  1VQ8 A;  4DV1 L;  1TWH H;  3FKI H;  2PQA A;  3PSI A;  1PH2 A;  4X6A H;  3S1N H;  4LF5 L;  4LFC Q;  4YWL A;  2UXD L;  1VQG A;  2AHO B;  4DV2 L;  1L1O C;  1N33 L;  1L1O A;  3CPW A;  5M3F H;  2NZO A;  2VZA A;  3HOV H;  1VQ6 A;  2N78 A;  5JEA G;  3U58 A;  1XTD A;  2JA6 H;  1PH5 A;  3CCQ A;  4DR2 Q;  2HT1 A;  4O0A A;  4JI7 L;  5GAE C;  5JEA J;  1CSP A;  5M5W H;  3CCV A;  4HIO A;  1K3R A;  3PO2 G;  3DLL A;  1EQQ A;  1S40 A;  2ES2 A;  3F8T A;  4A3K G;  4JC0 A;  2ID0 A;  1UE5 A;  2K14 A;  4QY7 A;  4DV3 L;  1M90 C;  1N32 Q;  4FDB A;  4QGU A;  4R4I A;  4HJ8 A;  1VQ5 A;  1LTL A;  2XTI A;  5M5Y H;  1JE5 A;  2EXD A;  1FVI A;  3HKZ E;  3M4P A;  1HJP A;  4OX9 L;  1C9O A;  4DV6 L;  1EWI A;  3PUZ A;  2QA4 A;  2I0Q A;  4LF6 Q;  2B63 H;  4NB3 A;  3KYH C;  1XPU A;  1LUZ A;  3G6E A;  5EAY A;  2VW9 A;  4DR6 L;  1E22 A;  5C4X H;  3W5O A;  5E7N A;  3UE0 A;  5IYB G;  3UDF A;  1VQO A;  4DAM A;  2UU9 L;  3H0G H;  1TWC H;  3GD7 A;  2F52 A;  1CKN B;  4BXX G;  1W2B A;  2UXC L;  1VQD A;  1N34 Q;  4GNX B;  2WB1 E;  3L7Z C;  3TS0 A;  3L0O A;  1PA6 A;  4DR3 L;  4BA1 I;  2JA5 H;  5LMN L;  2JEA I;  2NZH A;  1H95 A;  2MO0 A;  2OTL A;  1PFS A;  4JI5 Q;  3SGI A;  3CW2 C;  3K0X A;  4UY8 C;  2YTX A;  4R4O A;  4LF4 L;  3KF8 B;  4IJL A;  1J5E L;  1KRS A;  4IPC A;  3M7N A;  1N36 Q;  4JI8 Q;  3BU2 A;  4LNQ A;  1X54 A;  2CFM A;  4A76 A;  2VY3 A;  4GKK L;  3NEL A;  4X64 L;  1IBL Q;  1PYS B;  4LW1 A;  1K9M C;  4AQY Q;  2OTJ A;  3GTK H;  3FKI G;  1CKN A;  1Q81 C;  1XNR Q;  1VQI A;  5GAG C;  4O2D A;  3J80 i;  1VQB A;  2LXJ A;  2WP8 J;  2XGT A;  5JJI A;  1YJ9 A;  3NBH B;  4GN4 B;  4DR5 Q;  1PH1 A;  2K75 A;  1X65 A;  2HHH Q;  1VQ7 A;  4OO1 I;  2UUC L;  1JJG A;  3UDI A;  3BJU A;  3AEV A;  4YY3 L;  1X6O A;  5AJ3 Q;  1IBK L;  4LF9 Q;  1X55 A;  1K73 C;  2VNU D;  2V1C C;  4L5S A;  1O7I A;  4AYB G;  1J6Q A;  3UE1 A;  2UUA Q;  1HNZ Q;  3PO2 H;  5IYC G;  4IOC A;  5M3M G;  3M3Y H;  4B3R L;  3GDE A;  4L5Q A;  1I50 H;  4JCV E;  3T1H L;  3TS2 A;  5C3E G;  1EQR A;  1U0L A;  3GTG H;  3S1R H;  3AFQ A;  4HJ9 A;  4IFD I;  1QVG A;  3S2D H;  1S72 A;  1MKH A;  1I94 Q;  4GKK Q;  4DV5 L;  1EUJ A;  2E2J H;  2F4V Q;  2EIF A;  1VS0 A;  4DV7 Q;  2VQE L;  2R92 H;  4PG3 A;  4DR1 L;  2R93 G;  1Y1V G;  1JB7 A;  4B3T L;  4LFA L;  4DUZ Q;  3HKS A;  1YHA A;  4C3I H;  3S15 H;  1HNW L;  2NVY H;  4NXN L;  2PI2 E;  3M9B A;  1IBM L;  1EOV A;  2OWO A;  2A8V A;  2PQA B;  4BXX H;  4R4Q A;  5C44 G;  4QIW E;  3CC2 A;  1K0R A;  2OCE A;  3A5Z B;  1PYB A;  4OON A;  4JBM A;  1L1O B;  2MQH A;  3IRB A;  2AMC B;  2KCT A;  1UWV A;  1YI2 A;  3S1Q H;  3E0E A;  3VDY A;  4AH6 A;  3TEH B;  3UDG A;  1N8R C;  4GKJ Q;  3CPF A;  1YJN A;  4K0K L;  3CP0 A;  1GKH A;  5ELO A;  3S14 H;  4YWK A;  2E5L L;  2IX0 A;  1VQJ A;  2K5H A;  2JJQ A;  2E8G A;  4BBR G;  1SN8 A;  3OTO L;  3CF5 A;  3HOZ G;  4MTN A;  1K8G A;  1QZG A;  4P72 A;  3UDX A;  2ZTE A;  4IPG A;  1X3F A;  1WOC A;  3RLF A;  1NY4 A;  1Y14 B;  4JI3 Q;  1CSQ A;  1KXL A;  3K81 C;  1XMQ Q;  4JI6 L;  4AYB E;  4A3C G;  2KEN A;  4P75 A;  1L2F A;  4OO1 G;  4JI4 L;  2YTV A;  4DPG A;  1KQS A;  1SE8 A;  4B3M L;  1X3E A;  5GQO A;  4L5R C;  1Z47 A;  1VQA A;  3J80 c;  4HJ5 A;  3PV0 A;  3GTL H;  1QVC A;  4LFB Q;  1PH4 A;  4LFC L;  3T1Y Q;  2MFI A;  1IL2 A;  1MIU A;  1KIX A;  3K7A H;  1UE1 A;  2LXK A;  2VQF Q;  4OWW B;  5ELN A;  2H5X A;  2HIX A;  1YZ6 A;  4YCU A;  1QZH A;  2Z0S A;  3RR5 A;  2HQL A;  2N8N A;  2UUB Q;  4DR2 L;  1PH6 A;  1RL2 A;  2YU9 H;  4IFD G;  4BA2 I;  4UPA A;  5IYC H;  3I56 A;  1WCM H;  1AE3 A;  5M3M H;  1C0A A;  3I7F A;  1E1O A;  4LF7 Q;  4DV4 Q;  1VQE A;  2FXQ A;  1NJI C;  5FJ8 G;  4R4C A;  2MO1 A;  5C3E H;  2Z6K C;  4IFD J;  2Z6K A;  1N32 L;  1BVS A;  1CUK A;  1K83 H;  3U50 C;  1VQF A;  1A0I A;  2I5H A;  2R92 G;  2VUM G;  3I4N G;  1GVP A;  4A3M G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...