1G8ZD

His57ala mutant of cholera toxin b-penatmer
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
103
structure length
103
Chain Sequence
TPQNITDLCAEYHNTQIHTLNDKIFSYTESLAGKREMAIITFKNGATFQVEVPGSQAIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAISMAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHOLERA TOXIN B PROTEIN
publication title A mutant cholera toxin B subunit that binds GM1- ganglioside but lacks immunomodulatory or toxic activity.
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Toxin
total genus 26
structure length 103
sequence length 103
chains with identical sequence E, F, G, H
ec nomenclature
pdb deposition date 2000-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01376 Enterotoxin_b Heat-labile enterotoxin beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1g8zD00
2J4XA 2AQ2B 4L6TB 1AW7A 1LTSD 5ELBA 1XTCD 1LO5D 1V1PA 1D5MC 3R2TA 1LT4D 1EWCA 1D6EC 1FNUA 1QILA 3DWPA 3MFGA 5I4DA 1SBBB 2CHBD 1F77A 3MC0B 1HXYD 1JWUD 1JCKB 2IPKD 1TY2A 2QILA 5ELFA 4ZYSA 1JQYD 1I4QA 1PRTB 5D3IB 2AQ3B 1PRTD 1PRTC 1PTOB 1PTOD 1PTOC 1LTRD 1RCVD 4RHSA 4RGOS 2RDHA 1EEFD 2G9HD 5ELDA 1PZJD 2AQ1B 1S5ED 1CHPD 1I4GA 1ESFA 5TSSA 4UDUC 1JWSD 1L0YB 1LLRD 1UNSA 1LT3D 4RCOA 1BCPB 1STEA 1BCPC 1BCPD 1SE2A 1FNVA 1SE3A 4RGTA 2O2LD 1PZKD 1FNWA 1ET6A 1S5BD 4RH6A 1LTTD 1TS3A 1KLGD 1LTID 3KLSX 3GP7A 1PYWD 1LTGD 1ET9A 1EU3A 3R2IA 3CHBD 4O1NA 1PTOH 1EU4A 1MD2D 1BXTA 2SEBD 2XRSD 2TSSA 1D5ZC 1V1PB 2NTTA 4RGMA 1G8ZD 1I4RA 3V05A 3BYYB 1S5CD 5FK9C 1I4HA 1EEID 1DJRD 1PRTF 1CQVA 1TS4A 3BVZA 2ICIA 1PTOF 1DYQA 1M4VA 1FGBD 1LT6D 3BVMA 4OHJA 1CK1A 1AN8A 3SEBA 1HA5A 1T5XD 1HQRD 1SE4A 1UUPA 3OWEB 2XN9C 1CHQD 4L63B 1HTLD 5ELCA 1BCPF 3EFXD 5FKAC 2NTSA 1PZID 2XRQD 1LT5D 2R61A 4RHRA 2XNAC 4TSSA 1V1OA 1S5FD 3DWQA 1RDPD 3BZDB 2Z8LA 4Z9CB 1JWMD 1KTKA 1SJED 4BWGB 1JR0D 1CT1D 1KLUD 2RDGA 4RFBA 1TY0A 1TS2A 1GOZA 3DWAA 1L0XB 1SXTA 2QEJC 1LTAD 1D5XC 4C56C 1TS5A 1S5DD 5ELEA 1RF2D 3EA6A 1I4XA 3BYTB 1FD7D 1I4PA 1ENFA 1XXGA 4RGNA 1LTBD 1SJHD 4K6LA 2WV6D 3W2DA 3O13A 1B1ZA 5D3DA 3TSSA 1RD9D 1SEBD 3BVGA 1B44D 4DXFA 3URYA 2IJ0A 4DXGA 3R8BA 1EFID
chains in the Genus database with same CATH superfamily
4OX9Q 2JA8B 1IBMQ 4JW0A 4DPGA 4GKKQ 1CM9A 5BN5A 4WJWA 4GOPA 3KF8B 3K5NA 4H0LC 1VQAA 3CCQA 1LUZA 2N49A 3EROA 1WFQA 1DD2A 1SAPA 5C4JB 2QILA 1IBKQ 1OTCA 5D3IB 1PRTC 5K36G 4O0AA 5LHY1 2J0TD 4IN3A 3PUYA 2HIXA 3H0GG 1PLFA 2BOSA 1YNXA 1U5KA 3UDXA 5GAGC 4GN4B 4DKAC 4HIMA 1K0SA 4UDUC 5IGDA 2HHHL 3PGZA 2JA7G 1GUTA 1D7QA 1AEXA 4JI3Q 4QL5A 3HOZG 1PYWD 3CCEA 1EU3A 3R2IA 1BF4A 1PH8A 1EU4A 1UE6A 3GTKB 1D5ZC 2HUGA 4X64Q 1VQLA 3I73A 1TS4A 3BVZA 2VS1A 3G6EA 1FGBD 1IXRA 3CCVA 4DV0L 2XTIA 2A6HC 3D0FA 1YZ6A 2IW3A 3KF6B 1CHQD 2UU9L 3T51B 3R3OA 4A3KB 2OQ0A 4JBKA 2RF4A 4JVZA 5ELNA 4OELB 1TWFH 5JAVA 3FRPB 3BS1A 2F52A 4NMZA 1KAWA 4DV1Q 1KQSA 4BXXG 2K14A 2PNRC 1CZGA 5JJZA 3BZCA 2DUDA 1WTWA 1D5XC 1CA6A 4CKEA 2JA6B 3KDFB 2NBFA 4NPSA 5ISRA 5IGFA 2EZVA 3BDLA 3G6JB 4DR1Q 2IHFA 2L55A 3F8TA 3J7YW 1SYDA 3HKSA 2WV6D 1IL8A 3UE0A 3S1RB 2DJGC 1RD9D 1VF7A 1A3VA 5C0XJ 2JJQA 4YHHL 2A8VA 3TP5A 2OEOA 5HURA 3OYYA 4DV7L 3C2PA 1LO5D 2I5LX 2XGTA 1B50A 1QCBD 4UPAA 4XDXA 4OGQC 1K28A 1LT4D 3TBIB 3KJPA 2VQEQ 3W3AA 3V2TA 2EIFA 4NXMQ 2CHBD 2D9UA 2KENA 1AZPA 2JEAI 3GTQH 4NW2A 3KUPA 1QVFA 1VQFA 1Q12A 5EPKA 1UE1A 1VQ5A 4A3DG 4KJNA 2B39A 1K73C 1C4QA 2RDHA 5M5YB 2NZOA 2B2UA 3G48A 4RCOA 2B2YC 5CORA 2XIWA 2P5ZX 3A7AB 4HCSA 5I6WA 2HD3A 2IHEA 1IKLA 2O5IC 4GS3A 3W1BA 2A6ED 1MJEA 1VQKA 4LF5Q 3T1HQ 4M1UB 2QA4A 3DXJC 4LF6Q 3BDCA 3CC4A 4DR2L 2MUYA 4CDCC 1BBUA 1ML0D 5JPMC 4P71A 1EY4A 1CTMA 3IRBA 3UDFA 1BBWA 1I4HA 1LACA 3I8ZA 4DV2L 3LWEA 3OOCA 1ENCA 3HOYH 1PYBA 2F0EA 1LT6D 4ID6A 1STAA 4UP7A 1JOOA 1BQQT 4A3IH 1SMXA 3PO2B 1Y8OB 4PQXA 1HQRD 1AE3A 1SE4A 1DOLA 1STNA 2NVYB 4POFA 1PZID 2OTLA 1YBYA 4KY6A 4TSSA 4EVOA 3U58A 3KF8A 4DV5L 3I72A 4O42A 1CKNA 1X3EA 5JEAG 1RL2A 3SDZA 4LF4Q 1M8AA 2VZAA 1GUGA 4B3MQ 1YEZA 1CKOA 3DWAA 1HNXL 3RR5A 4X62Q 1CI3M 3ERSX 5E3FA 1TS5A 4MTNA 4NP5A 4O2DA 2KOLA 3J80L 3VR5A 5C5LA 1NAPA 3HKZG 4KHPQ 4KKUA 5C0XI 2CCZA 4YIJA 5CGKA 1V43A 3ZYYX 3M4OH 2VL6A 1D1KA 1HR0Q 2KJXA 2B2WC 1VQ4A 4DXGA 2VQFQ 2K5HA 2CQOA 3MTSA 2PW7A 2VUMB 3CKIB 1L1OB 1EQVA 3NK9A 1G51A 4DU9A 1V9PA 4JOIA 1SFOH 1A0IA 5FO9B 3A74A 4HJ9A 3JAMc 1JWUD 3ICEA 4AYBB 1JQYD 2ZXRA 1PRTB 2RCFA 3DEPA 1X56A 1H9RA 4JI7L 1Y1VB 4I65A 1X55A 2NUCA 2JN4A 2F3WA 5IYDH 3FKIB 5GROA 3C1FA 5BN4A 1E2WA 1CHPD 1J6QA 1N36L 2ZTEA 3SXHA 2F0VA 3TZDA 3HOWG 3J81j 4KY7A 4DR7L 1SSOA 4IFDH 1XMQQ 3J7A5 4F8MA 3KDFA 4P74A 5CR3A 1TWFB 1V1PB 1JB7A 1I4RA 3E0JA 3J80i 1Y69U 2XSCA 4CJ0B 3BG3A 4A3EB 1XNQL 1HA5A 1STBA 4EQNA 2UUAL 1EY5A 1MGSA 3CCRA 1VQGA 1YITA 1HNWQ 3DEOA 4C2MH 1YNJC 4DV0Q 2HQLA 3WOEA 1EYAA 2B8GA 1L0WA 3E0EA 1FJGL 2PCFB 5C3EH 3P1HA 3U4VA 1JE5A 1Y14B 3VA5A 5I6YA 3MHBA 3NTHA 3I4MG 2LY7A 3I91A 2F0PA 2Q2IA 1XJVA 2BH8A 3CRKC 4R8NA 2EYMA 5GADC 2B63B 3GTMB 2EJMA 2B29A 4JG2A 4TRDA 1XXGA 3NTIA 4PZ7A 3SK6A 1IYUA 2RVLA 4QGUA 5KNCA 5D14A 3GTQB 4BBRB 3AEVA 1UEBA 1Z47A 3F2BA 1E24A 4L8JA 4OL7A 5EBDA 3HOXH 3Q0AA 4PZ6A 2F0SA 4ZCKA 4CJ1B 4P75A 3NQTA 4X3KA 4C3IH 2K1BA 3I70A 4APVA 1NMFA 5J22A 3NENA 1Q82C 1JJ2A 1G2SA 3CF5A 2N78A 3HFZB 4P72A 2H1EA 4ZYSA 4OX9L 2F03A 1IBML 4GKKL 3M4YA 4CKCA 1B9NA 1VQ8A 5C4XG 2YTXA 2K32A 1EL0A 1O80A 5IGCA 3Q24A 2K52A 1EFWA 2B2VC 3R93A 4DR5Q 4DR4Q 3TS0A 3OPOA 3HOYB 1UNSA 5JEAJ 3NQIA 4A3IB 1WTXA 4B3SQ 1IKMA 2CH4W 1R4PB 3ULPA 1KLGD 3GO5A 3GP7A 3S1MH 1BXTA 1Q1BA 1SLJA 1SMYC 1M90C 4POGA 1ENAA 2ID0A 2EXZA 1K9MC 1DOMA 4L5QA 4JI3L 5KEEA 1UUPA 1TWHH 4HSVA 3PCOB 3VYUA 5HGTA 4YCVA 5C4JH 2JA5H 5C44G 2NTSA 4KD3A 2XRQD 3TDQA 3BDOA 1L1OA 2QDBA 2XNAC 4IURA 4X64L 2ES2A 1IW7D 1E1TA 4EQPA 2KUMA 1NNXA 4G57A 1GKHA 1SJED 3E3XA 2YYZA 1KD1C 2RDGA 3EQLC 4K0KQ 3KK7A 1GOZA 2C5CA 3CAMA 3RZOH 4IZ8A 5FLXL 4ZLTF 2M00A 3EA6A 1CSQA 3K5LA 4BY7B 3VR4A 1XPUA 5EQ0A 1EWIA 5AJ3Q 4DV1L 4A3KG 2K75A 1EIYB 2WB1B 3PSIA 3RN5A 1SFOB 3D8GA 4NXNL 4TKOB 4B9WA 1B44D 2BE5D 5IGBA 4A3JG 4A3LG 1P8LA 1PFNA 3HOVG 5IE8A 3JAME 2F3VA 5M3FG 4KJOA 2IX1A 4DR1L 1V1PA 1S40A 4I7AA 1SR3A 1XPRA 5I4DA 1NY4A 2E2HB 5IODA 1A62A 1B8AA 3MC0B 4ALPA 1J5EL 2I46A 3K57A 1TY2A 4R4QA 5IT9c 3TS2A 2Q2UA 1YNND 1VQPA 4WJ4A 3EN2A 2NN6I 1CFMA 5A2QL 1Z7TA 4GN5A 2VQEL 3HRZC 1PZJD 2AQ1B 1S5ED 4HJ8A 3H15A 1HR0W 3FHWA 1LLRD 3A54A 3QO2A 4IUPA 4N8FA 1DOKA 2D0OA 4X3UA 4IOCA 2YV5A 3X3MA 1O7LA 4C2MB 1Q81C 4WJ3M 4IPHA 1X54A 4IALA 3KYHC 2XRSD 4DR7Q 5H1SE 2TSSA 1Y1WH 4GLAC 4DUZQ 1EEID 2HT1A 2EYFA 2R92H 2PO4A 2MHVA 2ICIA 2AWOA 3ULLA 5M5XB 3PV0A 4EX5A 3GV6A 4KD4A 1HZCA 2EJGC 2I5MX 2I0QA 2KECA 2N3SA 5C5MA 3M9BA 1F2MA 4LF6L 2WINB 4EQ5A 1B9MA 5FKAC 5JJLA 2F0MA 3AB9A 4JYAL 1H9JA 4C3JH 1RDPD 3E5SA 3D31A 4ODGA 2PZTA 5I2YA 1TY0A 1EYDA 1JE4A 2M9VA 3HOXB 2HCIA 1KABA 1D1IA 1I6VC 5IOCA 2JXMB 2L5TA 4DAVA 3DLLA 4C3IB 3QJYA 2B2YA 2WAQB 4RGNA 2OTJA 1U4PA 4LF4L 1PYSB 4B3ML 3NWTA 5D3DA 3I2ZA 1SEBD 1ZYRD 1F2YA 2K01A 4K14A 3V96A 1KDAA 4X62L 4IJHA 2QDLA 1ZKOA 1IL2A 2R7ZG 1EQQA 4LUZA 1UE5A 1BDOA 4XYQA 4OO1G 4K6DA 3EIVA 2IX3A 2KQ3A 1CKMA 3J81i 3VR2A 4KHPL 5C0XH 3EBEA 2IL8A 4JBJA 1D6EC 4F7XA 2CVRA 4XQJA 4QQBX 1XTDA 3D4DA 4A3FB 4F87A 4IUQA 1NTGA 2Q8IB 5IYBG 5IYCG 2VQFL 4DR3Q 1I4QA 1CSPA 2KHJA 4R8IA 4V190 2ZTDA 2IWHA 1HZ9A 4G7OC 3GTJB 5IY0A 1SYFA 3QIAA 2UXBL 3K7AH 4QJFA 1TWHB 4RH6A 3PO3H 1LTTD 1VCIA 1KAAA 1TS3A 1T9HA 1GUNA 2JA5B 3C46A 1WCMG 4FVMA 2VUMH 1VMPA 3L9AX 3U9SA 1C7YA 3JC66 4IPGA 1XMQL 2B2WA 3K80C 1HNZQ 5CV9A 4XQNA 3RZOB 1BCPF 5M9OA 2BA1A 3M4PA 1YIJA 1N32L 3GV3A 1KDCA 1W2BA 4MIUA 4AYBE 1Y1VH 3TMEA 1B3QA 2E2IB 4DAMA 1EY0A 4ZQ3A 3FKIH 2QCPX 3L0OA 3I55A 3HOUG 2ZTCA 3LWUA 5EKKA 1HNWL 1GJXA 1D2BA 1LABA 3N6RA 1SXTA 4NDXA 1EIGA 3NP8A 2DNEA 3NEMA 4QF4A 3NBHB 5EGTA 3KBXA 1PH5A 1JB3A 4QIWB 2CW0C 4DF7A 5K36H 2M2LA 1HZBA 3Q23A 3CCJA 3O13A 1A63A 3I90A 3A8IE 5FLXc 1FGUA 3P7JA 3BVGA 1E22A 2K5NA 3DMUA 3URYA 1HZAA 1O7ZA 1HFGA 4A3EH 1HFNA 1TWGH 2JA7H 3I56A 4CGYB 4NXNQ 4JI6L 4GN3B 2LS01 5EPLA 3S17H 1JOQA 1VQDA 5CC4A 2IX0A 5IT9E 5LMUQ 3NUCA 2MO0A 1EWCA 3HOZH 4LUVA 4JI1Q 2OT2A 2AKWB 2I07B 1E7ZA 2MQHA 2A6EC 2R93B 2ZXPA 2HQEA 4Y52H 3A0JA 3G71A 4GKJQ 1R9TB 2VXWA 2D0PA 1PRTD 2R3ZA 3MVVA 4KV6A 1G6PA 3K8AA 2QGQA 3MXNB 1J5EQ 3EVQA 5D65A 1Y1WB 3IFDA 2CH4A 2R92B 3FVQA 4HAEA 2B63H 3GTMH 5FJ8H 1SE2A 2EYLA 3VR3A 1S5BD 2BH2A 5M3MG 1KC8C 1LTLA 2F3IA 1CQFA 4U673 3CHBD 4K8JA 4BBRH 3TN2A 3D4WA 3P20A 1HTPA 4DR5L 5JVH3 4DR4L 1F9PA 4JBMA 2QF7A 4C3JB 3PUZA 4B3SL 1PTOF 1VQCA 1EQRA 1KNAA 2L4NA 1BOSA 4R1JA 4A93G 4RWSC 4K2LA 2A6HD 1PH4A 2K05A 1PFMA 1VQEA 1QE6A 2A69D 3CP0A 3SK8A 4A3GG 4S3SA 4ZKCB 1HUMA 1JMCA 1STGA 3TP7A 1W3SA 1HCZA 5IP7G 4A75A 5JJIA 2MFIA 2E5LQ 4A3BH 2Z8LA 1KTKA 4B3TQ 4KKSA 1TXYA 4YWKA 2N55A 3SHLA 4JBWA 4LF7L 4JYAQ 1TWCH 2Y0SE 4DK0A 1EY8A 2VY3A 3CPFA 4OXPA 3S15B 5ELEA 1A6XA 5DM73 2DGYA 2F0NA 1KHIA 4C1NI 2B2VA 2K4KA 4HJ5A 4L5RC 5C6AA 4HR7B 1U9RA 2JYOA 3I4NB 2KCMA 1N34Q 5CV6A 4K0KL 1OXUA 5J39A 2NN6G 2YTYA 2IJ0A 1K3RA 2CWAA 3M4QA 4LK1C 3PUWA 5AJ3L 3CD6A 4DR6Q 4BBSB 1RTOA 1SN8A 1LYLA 4C3HH 1FNUA 4DK6C 1HJPA 1SNQA 1KXLA 1NE3A 3NWSA 5G3LF 4GNXC 3K7AB 3STBC 5GAHC 4RKBA 1U0LA 2ENBA 3OW7A 3PO3B 3TRZA 2HDMA 4ME3A 4BY1G 3RZDH 4R9WA 4DUYQ 4A4IA 4RHSA 4BA1I 2ICEC 4XTCS 3T56B 4QUFA 1X3QA 3OMGA 1STHA 1L0YB 4BY7H 1BCPC 2PI2A 1F9SA 3NXWA 2O2LD 1K3BC 4N9PA 4HMJA 3ULJA 4C1NK 4R4OA 3CC2A 4KLKA 3MEFA 5I9PA 5J1ZA 5JEAH 3M7NA 3FPPA 2EY1A 2WB1E 3T1YL 3KF6A 2UXBQ 3NBHA 5CBEE 5IP9G 5KNDA 3VA7A 1KIXA 1G8ZD 3V05A 4L5SA 5E7NA 2KA7A 3PUVA 1SYGA 1PHJA 1F9RA 2NZHA 4PMBA 3BVMA 2V1CC 1P16A 4OO1I 3IAYA 2E2HH 1KDBA 1OXTA 4KKTA 4JI0Q 1AE2A 1SDFA 1SYBA 5T1IA 4A3CH 1EOVA 1S72A 2EDGA 4RHRA 4G4KA 4DUZL 5LMNQ 1Q86C 3LX0A 3CQZB 2UXDQ 1QUQB 3T4AC 3S16H 2A19A 2GN5A 2JEBI 2K5DA 4DGZA 5C3EG 4BWGB 2K6AA 1K8AC 1CT1D 1N32Q 4DK1A 3NBIA 4FNFA 3NTKA 1A3UA 1ESRA 2VNUD 3VYTA 4YWLA 1TWGB 5FLXE 3H09A 5KYLA 2JA7B 3MXNA 3S17B 2PQAB 1F2LA 2GVAA 1FD7D 3DM1A 2H5XA 3F2CA 3HOZB 4CHTB 1RKNA 5FLMG 4BS9A 4P2CB 3D6WA 1UWVA 2EVBA 3RNUA 3CMAA 4U68A 2F0QA 3WOFA 3ND9A 3BU2A 1KRTA 5M5XH 5C3WA 2RSOA 1NMGA 2SOBA 4IUVA 5ELBA 1D5MC 3HOXG 2E8GA 1ZEQX 1XWEA 1SYCA 5GAEC 1H9MA 1GXDC 1V1QA 4JI6Q 1RIPA 1KNEA 2XVSA 1FVIA 1HXYD 4KK7A 2K50A 2A73B 1VQMA 3X3NA 2AQ3B 1B70B 1IHZA 5A35A 1PTOC 4IJLA 3KFUA 5ELDA 2LFNA 1I4GA 3CCMA 2PYKA 3CXCA 2HCCA 3E6ZX 3CRLC 1N33Q 1PA6A 4DR3L 1IYVA 2UXCL 3BJUA 1QVGA 1ET9A 4JI4Q 2WAQE 1PTOH 4MHEA 2L12A 1DXMA 1MD2D 4B3RL 1YHAA 3KJOA 4JPBW 2Z4IA 3I4MH 1U4RA 4DAYB 1DJRD 1I5FA 1EOTA 4LJZC 1KRSA 4A3BB 1II3A 3A8KE 2Y0SB 4OHJA 2JA8G 4IOAA 3PIO3 3MEHA 2DY7A 1TWCB 4LFAQ 2EY2A 2HIVA 4PZ8A 4A3FH 4FXDA 3PQIA 2XWBB 1YNJD 5CBAE 4CDEC 4WRDA 2E74C 1STYA 4A3DB 3AQQA 4HSPA 4Z9CB 4ZK9B 1HNZL 1EIFA 4V0BA 2EJFC 1BR9A 2MJ8A 4RAUC 3TQYA 4UHVA 3GTJH 5CYUA 4ILWA 4RKLA 2Z6KA 1WTOA 2VB2X 1LTAD 2F4IA 2ALYB 4B9XA 4HMIA 4DV3Q 1X3GA 4LF7Q 4FYDA 1DM0B 3IKJA 2X6LA 4C3HB 4KTAA 1SJHD 2RQXA 1BVSA 1B1ZA 3TEHB 2R7DA 2XWJB 4MN3A 2QW7A 4XQQA 3GTLH 4LAAA 3WWVA 3OTOQ 3RZDB 1AW7A 3K59A 2WP8J 4DNTB 2EYOA 4L5TA 2G5DA 2RSNA 3CU7A 1PMRA 2A5HA 2D62A 1RTNA 1E0BA 1VQIA 3G7LA 3NE5B 3H6MA 4GNXB 1KL9A 4PMWA 1WOCA 2K7VA 2ASBA 1CZWA 2E2IH 4KHVA 2E2JB 2L11A 2OCEA 3M7GA 3J80c 3MXUA 2D2CC 5LMUL 1QZGA 1LTRD 3UI2A 2PI2E 4JI1L 1QUQA 3J7ZC 3CC7A 1JWSD 5CV8A 1TVXA 5IIFA 5C44H 1BCPB 4HIOA 4GKJL 4JI2Q 2L15A 5CMDA 2JA6G 4RGTA 1J9OA 1FNWA 4FF3A 2LXKA 5JJKA 4QIWE 1EZ8A 3GTPH 2PZUA 2QEXA 1UEAB 1EWHA 2SEBD 1XMOQ 2PQAA 3A55A 1ILQA 3A8JE 2NVTH 1SMYD 3KLRA 3S16B 1O78A 1Y1WG 2EE1A 1VQ7A 1HPCA 3T1YQ 5L37A 2G9DA 1DZ1A 1X3FA 2H4OA 3KBGA 4KI0A 1YJWA 1PH2A 1TIID 2PNHA 5DEHA 1WTPA 4L63B 2R93H 1B4OA 4JV5L 1HUNA 4DNIA 4AQYQ 1VQ9A 2F0GA 1R9TH 1ZYRC 3J81L 4A3JH 3OIPA 4OIJA 2F0TA 2RDFA 5M3FH 2SNMA 4C3JG 5DLQE 4OEMB 1KLUD 3MFYA 1VQ6A 3KLSA 4HTHA 4LFBL 4FDBA 3ITPA 2A68D 2KBNA 1S5DD 2CWPA 1WI5A 4FO2A 1JICA 4FXGC 1IBLL 1E2ZA 1OO9B 3GTGB 1AP0A 1DCZA 1QWYA 4EGVA 2E5LL 4B3TL 5BN3A 5C3XA 1TU2B 3VYRA 3UDIA 1GHJA 2TMPA 2HDLA 2Q8TA 2IT1A 1NR2A 1W6JA 3Q6SA 5DM63 1NJIC 3PO2G 3A5ZB 3CCSA 4DAYA 2ZJQA 3U9OA 4N9TA 1I94L 2R7FA 2B2TC 3MFGA 1VQHA 1N34L 3K0XA 4XT1B 4PNYA 2JK8A 2ZT9C 3K6OA 4FXKC 2B8FA 1BNZA 3MWYW 2EYPA 3HGBA 2EOTA 4H02A 2V4DA 4H13C 3RLOA 1PTOB 1G6ZA 1IYJB 3AMUA 4DR6L 3CCUA 1BO0A 2UUCQ 3I4MB 2QKIC 1ZXTA 3SK5A 5EAYA 1U4LA 3OW2A 3S15H 3GDEA 1Y8NB 4ULLA 2EPBA 4LWCA 4A76A 2DJFC 1FNVA 3S1NH 3ND8A 1PZKD 3L3OC 4IUNA 1Q1EA 1GUWA 4FF4A 5CV5A 3PIP3 1TWAH 3I4NH 3S2DH 1WD0A 4DFAA 3RN2A 1ICFB 5HGQA 4DUYL 5I2XA 1C8CA 1UAPA 1B3AA 1SNCA 4FF2A 1HA6A 2FMCA 4RGMA 1BUVT 2WIIB 3QOJA 4JK1C 4XT3B 4BA2I 2UXCQ 1MIUA 1I3QH 2F1MA 3B6YA 3RLFA 3F2DA 3IL8A 4CDDC 1CK1A 2SNSA 4UAIA 4BBSH 4QMGA 4B3RQ 3J7AF 2OQKA 2VUMG 3QR8A 2PMZE 1EY6A 3HG9A 4XIGS 3UDGA 4OIKA 4GZYC 1PFBA 3EJIA 3K7UC 4G7HC 2R61A 4K5WA 3Q22A 3VYSA 2JSOA 4AYBG 2R7ZH 3DWQA 2O5JC 5C4XB 3F1ZA 1WTRA 1AZQA 1T5EA 4OO1H 1SNMA 5COYA 5LL6X 4GNXA 1NR4A 1Y1VG 4J15A 1JR0D 2F0OA 5I9OA 2B3GA 3JAML 3FKIG 1PH6A 4JI0L 3GTLB 2LXJA 1L1OC 3OMCA 2C9OA 4C56C 5LMNL 4IPCA 1CKNB 2UXDL 1I4XA 5IYBH 5IYCH 3M3YH 5EBCA 2GVBA 4Q5VA 1RODA 1Q90A 3D6CA 3K5MA 4K6LA 3W2DA 4A3MH 3K58A 3TSSA 5K5PA 3P75A 3K5OA 1QOHA 1H9SB 1QNUA 4OWTB 5KNBA 4ZUJA 2NZ1D 3VDYA 2Q2HA 2BCOA 2F0IA 1LTSD 1FL0A 1O7YA 4ABNA 4LF9Q 2L1BA 1EZ6A 4A3EG 2I5HA 1B53A 3FDTA 5LL6S 1VDZA 3RUZA 1H95A 3DUZA 3J80E 1QILA 5C44B 1G91A 5E4WC 4MTKA 1VS0A 4LFCQ 1WCMH 1XYIA 4XYOA 5EJWA 3CQZH 5CV4A 4HN7A 2IPKD 3HS0C 2FHTA 2KCTA 3H0GH 3RMHA 1E3PA 1SE8A 2F4VL 3GTPB 1QVCA 2DY8A 3QB3A 1MI2A 5HY6A 1Q7YC 1RCVD 4R4TA 1EEFD 2G9HD 2NVTB 3ER0A 3TZUA 4RCNA 1XPOA 1TT2A 1A15A 4YCUA 1GHKA 5J3BA 2PZWA 4K5VA 3PMFA 1GO3E 2A69C 4K2KA 4K5XA 3L7ZC 2B63G 5JOBA 3IFTA 5FJ8G 2DN8A 3AYHB 5GQOA 2JE6I 2JA9A 2Q8RE 3JAMi 2Z1CA 3HOUH 2RHSB 4BBRG 1N8RC 5FK9C 4A3JB 3HOVB 2K5WA 4DV4Q 5M3FB 3DHQA 1N33L 1DYQA 5BR8Q 3SK4A 1OXVA 1GD7A 5NUCA 1WTQA 4JI5Q 1IZ6A 1YVCA 1HQMC 2ATWA 2NYZD 3GTOB 4TQUS 5AFWA 4JI4L 1SNOA 3S1QB 2R6GA 4HEDA 4R4CA 1ILPA 4BXXH 2CKZB 4GLVB 3BZKA 1CUKA 1EYCA 4JV5Q 2KHSA 2NVXH 2Z9HA 4LFAL 1VQNA 4A3BG 3NELA 3KOJA 3MZ5A 1TS2A 1NBWA 2Y0SG 3J81c 4QB4A 3HOYG 2BDNA 4GLXA 1RF2D 4PV1C 1BBXC 4KMUC 4A3IG 3BYTB 3S2HH 2F0DA 3T13A 4XXEA 1MJCA 4LFBQ 2CW0D 2AUKA 3HZXA 1U4MA 4JCVE 5KGUA 1IBLQ 4DXFA 2A74C 3MXPA 4DV3L 2F0JA 3QWNA 1PH3A 4L6TB 4E6IA 3PIPA 4RG1A 1G2TA 1WTHA 1X32A 2F0LA 5M3MH 1SNPA 4PG3A 1YHBA 4HIKA 3S9WA 4YY3Q 4I7ZC 3CCLA 3S1NB 4C3HG 1C48A 4QCLA 3OTOL 5IWAL 3FP9A 1I94Q 1TWAB 4A3DH 2FINB 3MA2B 3S2DB 2GA4B 1XNRQ 2CQAA 4H44C 4FF1A 1MBYA 2FFKB 3E9HA 3F2UA 2E75C 4A93H 1VQBA 2Q2TA 1EQTA 2LKVA 1K83H 3SR1A 1GM5A 1I3QB 4KN7C 4HIDA 4A3GH 1LT3D 2PMZB 2K04A 2C35B 4LUOA 4CKBA 5KRUA 1JOKA 2MGSA 1PH1A 3S14H 2ZXOA 2F0WA 4BY7G 2K28A 5IP7H 4JI8Q 4RMFA 1I50B 3CPWA 2WB1G 3I3CA 4LNQA 2D5DA 3H91A 1I6HB 2RCNA 1ICWA 2YU9H 4X65Q 4GOPC 2R7ZB 4LF8Q 4JI2L 1GVPA 1M4VA 1PV4A 1Q46A 3SEBA 4B08A 1T5XD 2K5QA 4KN4C 2UUBQ 4X66Q 1H9SA 1C0AA 3A56A 5IYDG 1MHWC 4YWMA 3OWEB 1EIHA 3H3VI 2F0HA 1AH9A 2Z0SA 1XMOL 4G7ZC 1VF5C 3SE0A 3M3YB 4ZAIA 2NN6H 2E2JH 5IGGA 5CV7A 4A3CG 1MSHA 2Z4HA 4IFDG 1QNKA 1AFPA 3BZDB 5KIXA 4A3MB 1JWMD 3PF4A 3GQBA 1XX8A 4LW1A 3AFPA 4FP5D 4AQYL 3C3LA 5IT9L 2QEJC 5ELOA 2F0UA 2F0FA 1JJCB 4R4IA 1A2TA 1I4PA 1ENFA 2ZJRA 3HKZE 4QUCA 4BY1H 3UE1A 4Y7NH 1WCMB 2LSSA 1B2TA 4ZKBB 1DGSA 3H0GB 4MZ9A 3WDNA 3Q8DA 1S4ZA 2YTVA 5C4ZA 2MPMA 4DV6L 3SGIA 1Q8KA 2CFMA 1J8IA 3DWPA 3AU7A 3KLWA 3RD4A 5IP9H 2HHHQ 1WVLA 3STBD 3AFQA 5ELFA 3VR6A 1TQOA 4AH6A 3SVMA 1SRUA 4ZRZA 1QB5D 2N8NA 3RLNA 3QG1A 3HOUB 3W1GA 1A3TA 4NKLA 1MKHA 2A1AA 3HOWH 1JC7A 2F4VQ 3GTGH 1BCPD 1LM0A 3J7AV 2RHQB 4C3IG 3M85A 3KLSX 1CA5A 4O1NA 2WAQG 2UUCL 2UU9Q 2EXDA 2LMCB 1Z6HA 1S5CD 4DN4M 5A2QE 2NVXB 2EYJA 3CMEA 3L2PA 1EUJA 2BDOA 2L0CA 2EYHA 4WFN3 3MAQA 4HJAA 2XN9C 5DNFA 5FLMH 3K81C 2ZM6L 2KVMA 1F2ZA 4P73A 2VW9A 3OWFA 1Y8PB 4A3FG 3S2HB 1LT5D 1SNDA 2NWGA 1IW7C 3J81E 2B2TA 2NVQH 2IY5B 3D4RA 2KHIA 2B2UC 3CW2C 2ZJPA 2OF1A 2RBMA 3W5OA 2E2DC 2KCCA 5FO8B 1PH9A 1MSGA 1H9KA 4YHHQ 2RA4A 4DAPA 1JT8A 4DV7Q 5M3MB 2AMCB 2DNCA 1EY9A 3FEWX 5F2DA 2JA5G 3C1EA 1WYDA 2BE5C 3HP3A 2AWNA 2WKCA 2JQOA 1R4QB 3U4ZA 4UY8C 1DONA 1EY7A 3T53B 4A93B 1XTCD 2Z6BA 2WACA 1ASZA 1FR3A 1K83B 1IBKL 1B7YB 1FYCA 4A3GB 2AUJD 5M5WH 1F77A 3I7FA 3S14B 4KY5A 3S24A 1E2VA 5C4XH 3GD7A 1YNNC 4X6AH 4LF9L 4LMQD 4J8QA 2JA8H 4WORA 1PTOD 2AHOB 1X6OA 1G291 4TVAB 4RGOS 1K8OA 4IFDJ 4DR2Q 2PW5A 5IWAQ 2YU9B 1K0RA 2KEEA 4IPDA 4LFCL 1ESFA 1PFSA 2MNAA 1PVOA 1STEA 5FO7B 5JVG3 3ERQA 4DV2Q 1SE3A 1A2UA 4K8IA 5T1GA 4IUTA 1TR5A 5EKIA 1NSNS 1Z9FA 1LTGD 4IQZA 1PDQA 2SDFA 2NTTA 4GOPB 3BYYB 3M4OB 1PRTF 1CQVA 3QOLA 4DV5Q 4J1MA 1W6KA 4JOIC 4DA2A 2A68C 2EQSA 2J7ZA 3MXGA 4RA8A 4IO9A 4X3SA 2VB3X 1HNXQ 1QJOA 4QY7A 3HKZB 2BA0A 1JORA 1Q3LA 2R93G 3GTKH 2PPBC 3TP6A 4DNRB 2OXPA 3HEJA 1V1OA 4HCEA 3I4OA 4DV4L 1S5FD 3OIQA 3FPUB 1PH7A 5BR8L 4BY1B 4Y7NB 4UP8A 4JI5L 4HJ7A 1JJGA 1SYEA 4CDFC 2EY6A 3E9IA 1QZHA 2R92G 4A3KH 1O7IA 5G3LD 4YCWA 1K8MA 1F9QA 4JC0A 4J6HA 3TREA 1LV9A 2WFWA 1BKBA 2PQEA 4A3LH 2NB0A 2X6GA 3HOVH 4Q0FA 1X65A 1YJ9A 5C4HA 1EFID 2WKDA 3T16A 2J4XA 2KEDA 2RKSA 2AQ2B 5EPJA 5FOBB 4NXML 1ASYA 2JA6H 3GTOH 3FMCA 4JI7Q 4ME5A 3R2TA 1RHPA 3HOWB 3S1QH 1TKWB 1SROA 3NHHA 1SBBB 4CBVA 4OONA 1N36Q 4DV6Q 3S1RH 1YJNA 1VQJA 1OXSC 4UP9A 1JCKB 1X3PA 2E76C 5C3EB 4OWWB 4IFDI 3NSWA 2F0KA 2K03A 5LMNW 4NB3A 1OXXK 1V8QA 3U50C 4YY3L 5TSSA 3D3RA 4LF5L 3T1HL 3I4LA 5E1FA 3OHXC 2KCNA 1ONLA 1ET6A 1XNQQ 2FMMA 5C0XG 1XNRL 1N9WA 5EKLA 2K5VA 1LTID 4IUUA 2UUAQ 4AIMA 4H7BA 5KYIA 2O4XA 4DK3C 3PF5A 1EYGA 3I4NG 1GUSA 1YI2A 4X3TA 1X9NA 2EY5A 2NVQB 5M5YH 1FJGQ 3H94A 3PUXA 1WJJA 3PIOA 3LNNA 2K33A 2N88A 4OWXB 1GUOA 5E4XA 1QG7A 1AN8A 1VQOA 3ZJYC 4EQOA 4JI8L 1NUCA 1HRJA 1WTVA 3H3VC 3A7LA 4BBSG 1HTLD 5ELCA 3EFXD 1HH2P 4M8AA 3K0YA 3A5UA 3OSOA 4X65L 3ONAB 4MNOA 4F88A 4LF8L 1UE7A 4PMCA 2L9HA 4KHZA 3PO3G 5DAUA 2JP1A 2ZM6Q 1K8GA 1WD1A 3G4SA 2UUBL 1E1OA 2FJ2A 1RJTA 3LGJA 3N52A 4X66L 3PO2H 1A8VA 1M1KC 3H3VH 1YHQA 1Q8IA 4N8X1 1S3OA 4RFBA 3TP8A 3NPPA 1L0XB 2FXQA 2NVYH 2OWOA 4ZUIA 1HHVA 2MO1A 4CJ2C 1C9OA 1I50H 1HR0L 1PXUA 5IGEA 5JPNC 5M5WB 1LTBD 1NCVA 3DM3A 1D8LA 1I6HH 3S1MB 2Z6KC 1L2FA 2MP1A 4A3MG 2X69A 1VMCA 3R8BA
chains in the Genus database with same CATH topology
2JA8B 1CM9A 5BN5A 4WJWA 3K5NA 4H0LC 3EROA 1DD2A 1SAPA 5C4JB 2QILA 5D3IB 1PRTC 5K36G 5LHY1 2J0TD 4IN3A 3PUYA 1PLFA 2BOSA 4UDUC 5IGDA 1GUTA 1AEXA 1PYWD 1EU3A 3R2IA 1BF4A 1EU4A 3GTKB 1D5ZC 2HUGA 3I73A 1TS4A 3BVZA 1FGBD 2A6HC 2IW3A 1CHQD 3T51B 3R3OA 4A3KB 5JAVA 3FRPB 3BS1A 4NMZA 2PNRC 1CZGA 5JJZA 1WTWA 1D5XC 1CA6A 4CKEA 2JA6B 2NBFA 5ISRA 5IGFA 2EZVA 3BDLA 3G6JB 2L55A 3J7YW 1SYDA 2WV6D 1IL8A 3S1RB 1RD9D 1VF7A 1A3VA 5C0XJ 3TP5A 2OEOA 5HURA 3C2PA 1LO5D 1B50A 1QCBD 4XDXA 4OGQC 1LT4D 3TBIB 3W3AA 3V2TA 2CHBD 2D9UA 1AZPA 2JEAI 4NW2A 3KUPA 1Q12A 5EPKA 4KJNA 2B39A 1C4QA 2RDHA 5M5YB 2B2UA 4RCOA 2B2YC 5CORA 2XIWA 3A7AB 4HCSA 5I6WA 1IKLA 2O5IC 2A6ED 4M1UB 3DXJC 3BDCA 2MUYA 1ML0D 5JPMC 1EY4A 1CTMA 1I4HA 1LACA 3I8ZA 3LWEA 3OOCA 1ENCA 2F0EA 1LT6D 4ID6A 1STAA 1JOOA 1BQQT 3PO2B 1Y8OB 4PQXA 1HQRD 1SE4A 1DOLA 1STNA 2NVYB 1PZID 4KY6A 4TSSA 4EVOA 3KF8A 3I72A 4O42A 5JEAG 3SDZA 1M8AA 1GUGA 3DWAA 1CI3M 5E3FA 1TS5A 4NP5A 2KOLA 3J80L 3VR5A 5C5LA 1NAPA 4KKUA 5C0XI 4YIJA 5CGKA 1V43A 3ZYYX 1D1KA 2KJXA 2B2WC 4DXGA 3MTSA 2PW7A 2VUMB 3CKIB 1EQVA 3NK9A 4DU9A 5FO9B 1JWUD 4AYBB 1JQYD 2ZXRA 1PRTB 3DEPA 1H9RA 1Y1VB 4I65A 2NUCA 2F3WA 3FKIB 3C1FA 5BN4A 1E2WA 1CHPD 3SXHA 2F0VA 3TZDA 4KY7A 1SSOA 4IFDH 4F8MA 5CR3A 1TWFB 1V1PB 1I4RA 3E0JA 1Y69U 2XSCA 4CJ0B 3BG3A 4A3EB 1HA5A 1STBA 4EQNA 1EY5A 1MGSA 3DEOA 1YNJC 3WOEA 1EYAA 2B8GA 2PCFB 3P1HA 3VA5A 5I6YA 3MHBA 3NTHA 2LY7A 3I91A 2F0PA 3CRKC 4R8NA 2EYMA 2B63B 3GTMB 2EJMA 4TRDA 1XXGA 3NTIA 3SK6A 1IYUA 2RVLA 5KNCA 5D14A 3GTQB 4BBRB 1Z47A 4L8JA 4OL7A 5EBDA 3Q0AA 2F0SA 4CJ1B 3NQTA 4X3KA 2K1BA 3I70A 5J22A 1G2SA 2H1EA 4ZYSA 2F03A 3M4YA 4CKCA 1B9NA 2K32A 1EL0A 1O80A 5IGCA 3Q24A 2B2VC 3R93A 3OPOA 3HOYB 1UNSA 5JEAJ 3NQIA 4A3IB 1WTXA 1IKMA 1R4PB 1KLGD 3GO5A 3GP7A 1BXTA 1Q1BA 1SMYC 1ENAA 2ID0A 2EXZA 1DOMA 5KEEA 1UUPA 4HSVA 3VYUA 5HGTA 2NTSA 4KD3A 2XRQD 3TDQA 3BDOA 2QDBA 4IURA 2XNAC 1IW7D 4EQPA 2KUMA 4G57A 1SJED 2YYZA 2RDGA 3EQLC 3KK7A 1GOZA 2C5CA 4IZ8A 5FLXL 4ZLTF 2M00A 3EA6A 3K5LA 4BY7B 3VR4A 5EQ0A 2WB1B 1SFOB 3D8GA 4TKOB 4B9WA 1B44D 2BE5D 5IGBA 1PFNA 3JAME 2F3VA 4KJOA 2IX1A 1V1PA 5I4DA 2E2HB 5IODA 3MC0B 2I46A 3K57A 1TY2A 1YNND 2NN6I 1CFMA 5A2QL 1Z7TA 3HRZC 1PZJD 2AQ1B 1S5ED 1LLRD 3A54A 3QO2A 4IUPA 1DOKA 4X3UA 3X3MA 1O7LA 4C2MB 4IALA 2XRSD 2TSSA 1EEID 2EYFA 2PO4A 2MHVA 2ICIA 2AWOA 5M5XB 3PV0A 3GV6A 4KD4A 2EJGC 2KECA 5C5MA 1F2MA 2WINB 1B9MA 5FKAC 2F0MA 3AB9A 1H9JA 1RDPD 3E5SA 3D31A 4ODGA 2PZTA 5I2YA 1TY0A 1EYDA 1JE4A 2M9VA 3HOXB 2HCIA 1KABA 1D1IA 1I6VC 5IOCA 2JXMB 2L5TA 4DAVA 4C3IB 3QJYA 2B2YA 2WAQB 4RGNA 1U4PA 3NWTA 5D3DA 1SEBD 1ZYRD 1F2YA 2K01A 4K14A 3V96A 1KDAA 1ZKOA 1BDOA 4XYQA 4OO1G 4K6DA 2IX3A 2KQ3A 3VR2A 5C0XH 2IL8A 1D6EC 4F7XA 2CVRA 4XQJA 3D4DA 4A3FB 4F87A 4IUQA 2Q8IB 1I4QA 4R8IA 4V190 2IWHA 4G7OC 3GTJB 1SYFA 3QIAA 1TWHB 4RH6A 1LTTD 1VCIA 1KAAA 1TS3A 1GUNA 2JA5B 3C46A 4FVMA 1VMPA 3L9AX 3U9SA 2B2WA 5CV9A 4XQNA 3RZOB 1BCPF 5M9OA 2BA1A 3GV3A 1KDCA 4MIUA 3TMEA 2E2IB 1EY0A 4ZQ3A 2QCPX 3LWUA 5EKKA 1GJXA 1D2BA 1LABA 3N6RA 1SXTA 4NDXA 1EIGA 3NP8A 2DNEA 4QF4A 5EGTA 3KBXA 1JB3A 4QIWB 2CW0C 4DF7A 5K36H 2M2LA 3Q23A 3O13A 3I90A 3A8IE 3P7JA 3BVGA 3DMUA 3URYA 1O7ZA 1HFGA 1HFNA 4CGYB 2LS01 5EPLA 1JOQA 5CC4A 2IX0A 5IT9E 3NUCA 1EWCA 2OT2A 2I07B 2A6EC 2R93B 2ZXPA 2HQEA 1R9TB 2VXWA 1PRTD 2R3ZA 3MVVA 4KV6A 3EVQA 5D65A 1Y1WB 3IFDA 2R92B 3FVQA 4HAEA 1SE2A 2EYLA 3VR3A 1S5BD 4U673 1CQFA 3CHBD 4K8JA 3TN2A 3D4WA 3P20A 1HTPA 5JVH3 1F9PA 2QF7A 4C3JB 3PUZA 1PTOF 1KNAA 2L4NA 1BOSA 4RWSC 4K2LA 2A6HD 2K05A 1PFMA 2A69D 1QE6A 3SK8A 4S3SA 4ZKCB 1HUMA 1STGA 3TP7A 1HCZA 2Z8LA 1KTKA 4KKSA 2N55A 3SHLA 4JBWA 4DK0A 1EY8A 3S15B 5ELEA 1A6XA 5DM73 2F0NA 4C1NI 2B2VA 5C6AA 4HR7B 1U9RA 2JYOA 3I4NB 5CV6A 1OXUA 5J39A 2NN6G 2IJ0A 4LK1C 3PUWA 4BBSB 1RTOA 1FNUA 1SNQA 3NWSA 5G3LF 3K7AB 4RKBA 2ENBA 3OW7A 3PO3B 2HDMA 4R9WA 4RHSA 4BA1I 2ICEC 4XTCS 3T56B 4QUFA 1X3QA 3OMGA 1STHA 1L0YB 1BCPC 1F9SA 3NXWA 2O2LD 4N9PA 4HMJA 4C1NK 5I9PA 5J1ZA 5JEAH 3M7NA 3FPPA 2EY1A 3NBHA 5CBEE 5KNDA 3VA7A 1G8ZD 3V05A 2KA7A 3PUVA 1SYGA 1F9RA 4PMBA 3BVMA 4OO1I 3IAYA 1KDBA 1OXTA 4KKTA 1SDFA 1SYBA 5T1IA 2EDGA 4RHRA 4G4KA 3LX0A 3CQZB 3T4AC 2JEBI 4DGZA 2K5DA 4BWGB 2K6AA 1CT1D 4DK1A 3NBIA 4FNFA 3NTKA 1A3UA 1ESRA 2VNUD 3VYTA 1TWGB 5FLXE 3H09A 5KYLA 2JA7B 3MXNA 3S17B 1F2LA 1FD7D 3DM1A 3HOZB 4CHTB 1RKNA 4BS9A 4P2CB 3D6WA 2EVBA 4U68A 2F0QA 3WOFA 3ND9A 5C3WA 2RSOA 2SOBA 4IUVA 5ELBA 1D5MC 1ZEQX 1XWEA 1SYCA 1H9MA 1GXDC 1KNEA 2XVSA 1HXYD 4KK7A 2A73B 3X3NA 2AQ3B 1IHZA 5A35A 1PTOC 5ELDA 2LFNA 1I4GA 2PYKA 2HCCA 3E6ZX 3CRLC 1IYVA 1ET9A 1PTOH 4MHEA 2L12A 1DXMA 1MD2D 2Z4IA 1U4RA 1DJRD 1EOTA 4LJZC 4A3BB 1II3A 3A8KE 2Y0SB 4OHJA 3PIO3 3MEHA 2DY7A 1TWCB 2EY2A 4FXDA 2XWBB 1YNJD 5CBAE 4WRDA 2E74C 1STYA 4A3DB 4HSPA 4Z9CB 4ZK9B 4V0BA 2EJFC 1BR9A 2MJ8A 4RAUC 5CYUA 4ILWA 4RKLA 1WTOA 2VB2X 1LTAD 2F4IA 4B9XA 4HMIA 4FYDA 1DM0B 3IKJA 2X6LA 4C3HB 4KTAA 1SJHD 2RQXA 1B1ZA 2XWJB 4MN3A 4XQQA 4LAAA 3RZDB 1AW7A 3K59A 2WP8J 4DNTB 2EYOA 2RSNA 3CU7A 1PMRA 2A5HA 2D62A 1RTNA 1E0BA 3G7LA 3NE5B 3H6MA 4PMWA 2K7VA 1CZWA 4KHVA 2E2JB 2L11A 3M7GA 3MXUA 2D2CC 1LTRD 3UI2A 1JWSD 5CV8A 1TVXA 5IIFA 1BCPB 5CMDA 4RGTA 1J9OA 1FNWA 4FF3A 1EZ8A 2PZUA 1UEAB 1EWHA 2SEBD 3A55A 1ILQA 3A8JE 1SMYD 3KLRA 3S16B 1O78A 2EE1A 1HPCA 2G9DA 1DZ1A 2H4OA 3KBGA 4KI0A 1TIID 5DEHA 1WTPA 4L63B 1B4OA 1HUNA 2F0GA 1ZYRC 3J81L 3OIPA 4OIJA 2F0TA 2RDFA 2SNMA 4C3JG 1KLUD 3MFYA 3KLSA 4HTHA 3ITPA 2A68D 1S5DD 4FO2A 1JICA 4FXGC 1E2ZA 1OO9B 3GTGB 1AP0A 1DCZA 1QWYA 4EGVA 5BN3A 5C3XA 1TU2B 3VYRA 1GHJA 2TMPA 2HDLA 2Q8TA 2IT1A 1NR2A 1W6JA 3Q6SA 5DM63 4DAYA 3U9OA 4N9TA 2B2TC 3MFGA 4XT1B 4PNYA 2ZT9C 3K6OA 2B8FA 4FXKC 1BNZA 3MWYW 2EYPA 3HGBA 2EOTA 2V4DA 4H13C 1PTOB 1G6ZA 3AMUA 1BO0A 3I4MB 2QKIC 1ZXTA 3SK5A 1U4LA 1Y8NB 4ULLA 2EPBA 1FNVA 3ND8A 1PZKD 3L3OC 4IUNA 1Q1EA 1GUWA 4FF4A 5CV5A 3PIP3 1WD0A 4DFAA 1C8CA 5I2XA 1UAPA 1B3AA 1SNCA 4FF2A 1HA6A 2FMCA 4RGMA 1BUVT 2WIIB 3QOJA 4JK1C 4XT3B 4BA2I 2F1MA 3RLFA 3IL8A 1CK1A 2SNSA 4UAIA 4QMGA 3J7AF 1EY6A 3HG9A 4XIGS 4OIKA 4GZYC 1PFBA 3EJIA 4G7HC 2R61A 4K5WA 3Q22A 3VYSA 2JSOA 3DWQA 2O5JC 5C4XB 1WTRA 1AZQA 1T5EA 4OO1H 1SNMA 5COYA 5LL6X 1NR4A 1JR0D 2F0OA 5I9OA 3JAML 3GTLB 3OMCA 2C9OA 4C56C 1I4XA 5EBCA 4Q5VA 1RODA 1Q90A 3D6CA 3K5MA 4K6LA 3W2DA 3K58A 3TSSA 5K5PA 3P75A 3K5OA 1QOHA 1H9SB 1QNUA 5KNBA 4ZUJA 2NZ1D 2BCOA 2F0IA 1LTSD 1O7YA 4ABNA 2L1BA 1EZ6A 3FDTA 1B53A 5LL6S 1VDZA 3RUZA 3DUZA 3J80E 1QILA 5C44B 1G91A 5E4WC 1XYIA 4XYOA 5EJWA 5CV4A 4HN7A 2IPKD 3HS0C 2FHTA 3RMHA 3GTPB 2DY8A 3QB3A 1MI2A 1RCVD 1EEFD 2G9HD 2NVTB 3TZUA 4RCNA 1TT2A 1A15A 1GHKA 2PZWA 4K5VA 3PMFA 2A69C 4K2KA 4K5XA 3L7ZC 5JOBA 3IFTA 2DN8A 2JE6I 2Q8RE 2Z1CA 5FK9C 4A3JB 3HOVB 2K5WA 5M3FB 3DHQA 1DYQA 3SK4A 1OXVA 5NUCA 1WTQA 1HQMC 2NYZD 3GTOB 4TQUS 5AFWA 1SNOA 3S1QB 2R6GA 4HEDA 1ILPA 1EYCA 2KHSA 3MZ5A 1TS2A 4QB4A 2BDNA 1RF2D 4PV1C 1BBXC 4KMUC 3BYTB 2F0DA 3T13A 4XXEA 2CW0D 2AUKA 3HZXA 1U4MA 5KGUA 4DXFA 2A74C 3MXPA 2F0JA 3QWNA 4L6TB 4E6IA 1G2TA 1X32A 2F0LA 1SNPA 3S9WA 4I7ZC 3S1NB 4C3HG 1C48A 4QCLA 1TWAB 3S2DB 2FINB 3MA2B 2GA4B 2CQAA 4H44C 4FF1A 1MBYA 2FFKB 3F2UA 2E75C 1EQTA 2LKVA 3SR1A 1I3QB 4KN7C 1LT3D 2PMZB 2K04A 4CKBA 5KRUA 1JOKA 2MGSA 2ZXOA 2F0WA 2K28A 1I50B 3I3CA 2D5DA 3H91A 1I6HB 1ICWA 2R7ZB 1M4VA 3SEBA 4B08A 1T5XD 2K5QA 4KN4C 1H9SA 3A56A 3OWEB 1EIHA 2F0HA 4G7ZC 1VF5C 3SE0A 3M3YB 4ZAIA 2NN6H 5IGGA 5CV7A 1MSHA 2Z4HA 4IFDG 1QNKA 1AFPA 3BZDB 5KIXA 4A3MB 1JWMD 3GQBA 1XX8A 4FP5D 3C3LA 5IT9L 2QEJC 2F0UA 2F0FA 1A2TA 1I4PA 1ENFA 4QUCA 1WCMB 1B2TA 4ZKBB 3H0GB 3WDNA 1S4ZA 5C4ZA 2MPMA 1J8IA 3DWPA 3AU7A 3RD4A 1WVLA 5ELFA 3VR6A 1TQOA 3SVMA 4ZRZA 1QB5D 3QG1A 3HOUB 1A3TA 4NKLA 1JC7A 1BCPD 3J7AV 4C3IG 3M85A 3KLSX 1CA5A 4O1NA 2LMCB 1Z6HA 1S5CD 4DN4M 5A2QE 2NVXB 2EYJA 2BDOA 2L0CA 2EYHA 4WFN3 3MAQA 2XN9C 5DNFA 2KVMA 1F2ZA 3OWFA 1Y8PB 3S2HB 1LT5D 1SNDA 2NWGA 1IW7C 3J81E 2B2TA 3D4RA 2B2UC 2OF1A 2RBMA 2E2DC 2KCCA 5FO8B 1MSGA 1H9KA 2RA4A 4DAPA 5M3MB 2DNCA 1EY9A 3FEWX 5F2DA 3C1EA 2BE5C 3HP3A 2AWNA 2WKCA 1R4QB 1DONA 1EY7A 3T53B 4A93B 1XTCD 2WACA 1FR3A 1K83B 1FYCA 4A3GB 2AUJD 1F77A 3S14B 4KY5A 1E2VA 3GD7A 1YNNC 4LMQD 4J8QA 4WORA 1PTOD 1K8OA 1G291 4RGOS 4IFDJ 2PW5A 2YU9B 2KEEA 1ESFA 1STEA 5FO7B 5JVG3 3ERQA 1SE3A 1A2UA 4K8IA 5T1GA 4IUTA 1TR5A 5EKIA 1NSNS 1LTGD 4IQZA 1PDQA 2SDFA 2NTTA 3BYYB 3M4OB 1PRTF 1CQVA 3QOLA 4J1MA 1W6KA 4DA2A 2A68C 2J7ZA 3MXGA 4RA8A 4X3SA 2VB3X 1QJOA 3HKZB 2BA0A 1JORA 1Q3LA 2PPBC 3TP6A 4DNRB 2OXPA 3HEJA 1V1OA 4HCEA 1S5FD 3OIQA 3FPUB 4BY1B 4Y7NB 1SYEA 2EY6A 5G3LD 1K8MA 1F9QA 4J6HA 1LV9A 2PQEA 2NB0A 2X6GA 4Q0FA 5C4HA 1EFID 2WKDA 3T16A 2J4XA 2KEDA 2RKSA 2AQ2B 5EPJA 5FOBB 3FMCA 4ME5A 3R2TA 1RHPA 3HOWB 1TKWB 3NHHA 1SBBB 4CBVA 1OXSC 1JCKB 1X3PA 2E76C 5C3EB 4IFDI 3NSWA 2F0KA 2K03A 1OXXK 1V8QA 5TSSA 3D3RA 3I4LA 5E1FA 3OHXC 2KCNA 1ONLA 1ET6A 2FMMA 5C0XG 5EKLA 1LTID 4IUUA 4H7BA 5KYIA 2O4XA 1GUSA 4X3TA 2EY5A 2NVQB 3H94A 3PUXA 3LNNA 2K33A 2N88A 1GUOA 5E4XA 1QG7A 1AN8A 4EQOA 1NUCA 1HRJA 1WTVA 3H3VC 3A7LA 1HTLD 5ELCA 3EFXD 4M8AA 3K0YA 3OSOA 3ONAB 4F88A 4PMCA 2L9HA 4KHZA 5DAUA 2JP1A 1WD1A 2FJ2A 1RJTA 3N52A 1Q8IA 4RFBA 3TP8A 3NPPA 1L0XB 4ZUIA 1HHVA 4CJ2C 1PXUA 5IGEA 5JPNC 5M5WB 1LTBD 1NCVA 3S1MB 2MP1A 2X69A 1VMCA 3R8BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J4X A;  2AQ2 B;  4L6T B;  1AW7 A;  1LTS D;  5ELB A;  1XTC D;  1LO5 D;  1V1P A;  1D5M C;  3R2T A;  1LT4 D;  1EWC A;  1D6E C;  1FNU A;  1QIL A;  3DWP A;  3MFG A;  5I4D A;  1SBB B;  2CHB D;  1F77 A;  3MC0 B;  1HXY D;  1JWU D;  1JCK B;  2IPK D;  1TY2 A;  2QIL A;  5ELF A;  4ZYS A;  1JQY D;  1I4Q A;  1PRT B;  5D3I B;  2AQ3 B;  1PRT D;  1PRT C;  1PTO B;  1PTO D;  1PTO C;  1LTR D;  1RCV D;  4RHS A;  4RGO S;  2RDH A;  1EEF D;  2G9H D;  5ELD A;  1PZJ D;  2AQ1 B;  1S5E D;  1CHP D;  1I4G A;  1ESF A;  5TSS A;  4UDU C;  1JWS D;  1L0Y B;  1LLR D;  1UNS A;  1LT3 D;  4RCO A;  1BCP B;  1STE A;  1BCP C;  1BCP D;  1SE2 A;  1FNV A;  1SE3 A;  4RGT A;  2O2L D;  1PZK D;  1FNW A;  1ET6 A;  1S5B D;  4RH6 A;  1LTT D;  1TS3 A;  1KLG D;  1LTI D;  3KLS X;  3GP7 A;  1PYW D;  1LTG D;  1ET9 A;  1EU3 A;  3R2I A;  3CHB D;  4O1N A;  1PTO H;  1EU4 A;  1MD2 D;  1BXT A;  2SEB D;  2XRS D;  2TSS A;  1D5Z C;  1V1P B;  2NTT A;  4RGM A;  1G8Z D;  1I4R A;  3V05 A;  3BYY B;  1S5C D;  5FK9 C;  1I4H A;  1EEI D;  1DJR D;  1PRT F;  1CQV A;  1TS4 A;  3BVZ A;  2ICI A;  1PTO F;  1DYQ A;  1M4V A;  1FGB D;  1LT6 D;  3BVM A;  4OHJ A;  1CK1 A;  1AN8 A;  3SEB A;  1HA5 A;  1T5X D;  1HQR D;  1SE4 A;  1UUP A;  3OWE B;  2XN9 C;  1CHQ D;  4L63 B;  1HTL D;  5ELC A;  1BCP F;  3EFX D;  5FKA C;  2NTS A;  1PZI D;  2XRQ D;  1LT5 D;  2R61 A;  4RHR A;  2XNA C;  4TSS A;  1V1O A;  1S5F D;  3DWQ A;  1RDP D;  3BZD B;  2Z8L A;  4Z9C B;  1JWM D;  1KTK A;  1SJE D;  4BWG B;  1JR0 D;  1CT1 D;  1KLU D;  2RDG A;  4RFB A;  1TY0 A;  1TS2 A;  1GOZ A;  3DWA A;  1L0X B;  1SXT A;  2QEJ C;  1LTA D;  1D5X C;  4C56 C;  1TS5 A;  1S5D D;  5ELE A;  1RF2 D;  3EA6 A;  1I4X A;  3BYT B;  1FD7 D;  1I4P A;  1ENF A;  1XXG A;  4RGN A;  1LTB D;  1SJH D;  4K6L A;  2WV6 D;  3W2D A;  3O13 A;  1B1Z A;  5D3D A;  3TSS A;  1RD9 D;  1SEB D;  3BVG A;  1B44 D;  4DXF A;  3URY A;  2IJ0 A;  4DXG A;  3R8B A;  1EFI D; 
#chains in the Genus database with same CATH topology
 4OX9 Q;  2JA8 B;  1IBM Q;  4JW0 A;  4DPG A;  4GKK Q;  1CM9 A;  5BN5 A;  4WJW A;  4GOP A;  3KF8 B;  3K5N A;  4H0L C;  1VQA A;  3CCQ A;  1LUZ A;  2N49 A;  3ERO A;  1WFQ A;  1DD2 A;  1SAP A;  5C4J B;  2QIL A;  1IBK Q;  1OTC A;  5D3I B;  1PRT C;  5K36 G;  4O0A A;  5LHY 1;  2J0T D;  4IN3 A;  3PUY A;  2HIX A;  3H0G G;  1PLF A;  2BOS A;  1YNX A;  1U5K A;  3UDX A;  5GAG C;  4GN4 B;  4DKA C;  4HIM A;  1K0S A;  4UDU C;  5IGD A;  2HHH L;  3PGZ A;  2JA7 G;  1GUT A;  1D7Q A;  1AEX A;  4JI3 Q;  4QL5 A;  3HOZ G;  1PYW D;  3CCE A;  1EU3 A;  3R2I A;  1BF4 A;  1PH8 A;  1EU4 A;  1UE6 A;  3GTK B;  1D5Z C;  2HUG A;  4X64 Q;  1VQL A;  3I73 A;  1TS4 A;  3BVZ A;  2VS1 A;  3G6E A;  1FGB D;  1IXR A;  3CCV A;  4DV0 L;  2XTI A;  2A6H C;  3D0F A;  1YZ6 A;  2IW3 A;  3KF6 B;  1CHQ D;  2UU9 L;  3T51 B;  3R3O A;  4A3K B;  2OQ0 A;  4JBK A;  2RF4 A;  4JVZ A;  5ELN A;  4OEL B;  1TWF H;  5JAV A;  3FRP B;  3BS1 A;  2F52 A;  4NMZ A;  1KAW A;  4DV1 Q;  1KQS A;  4BXX G;  2K14 A;  2PNR C;  1CZG A;  5JJZ A;  3BZC A;  2DUD A;  1WTW A;  1D5X C;  1CA6 A;  4CKE A;  2JA6 B;  3KDF B;  2NBF A;  4NPS A;  5ISR A;  5IGF A;  2EZV A;  3BDL A;  3G6J B;  4DR1 Q;  2IHF A;  2L55 A;  3F8T A;  3J7Y W;  1SYD A;  3HKS A;  2WV6 D;  1IL8 A;  3UE0 A;  3S1R B;  2DJG C;  1RD9 D;  1VF7 A;  1A3V A;  5C0X J;  2JJQ A;  4YHH L;  2A8V A;  3TP5 A;  2OEO A;  5HUR A;  3OYY A;  4DV7 L;  3C2P A;  1LO5 D;  2I5L X;  2XGT A;  1B50 A;  1QCB D;  4UPA A;  4XDX A;  4OGQ C;  1K28 A;  1LT4 D;  3TBI B;  3KJP A;  2VQE Q;  3W3A A;  3V2T A;  2EIF A;  4NXM Q;  2CHB D;  2D9U A;  2KEN A;  1AZP A;  2JEA I;  3GTQ H;  4NW2 A;  3KUP A;  1QVF A;  1VQF A;  1Q12 A;  5EPK A;  1UE1 A;  1VQ5 A;  4A3D G;  4KJN A;  2B39 A;  1K73 C;  1C4Q A;  2RDH A;  5M5Y B;  2NZO A;  2B2U A;  3G48 A;  4RCO A;  2B2Y C;  5COR A;  2XIW A;  2P5Z X;  3A7A B;  4HCS A;  5I6W A;  2HD3 A;  2IHE A;  1IKL A;  2O5I C;  4GS3 A;  3W1B A;  2A6E D;  1MJE A;  1VQK A;  4LF5 Q;  3T1H Q;  4M1U B;  2QA4 A;  3DXJ C;  4LF6 Q;  3BDC A;  3CC4 A;  4DR2 L;  2MUY A;  4CDC C;  1BBU A;  1ML0 D;  5JPM C;  4P71 A;  1EY4 A;  1CTM A;  3IRB A;  3UDF A;  1BBW A;  1I4H A;  1LAC A;  3I8Z A;  4DV2 L;  3LWE A;  3OOC A;  1ENC A;  3HOY H;  1PYB A;  2F0E A;  1LT6 D;  4ID6 A;  1STA A;  4UP7 A;  1JOO A;  1BQQ T;  4A3I H;  1SMX A;  3PO2 B;  1Y8O B;  4PQX A;  1HQR D;  1AE3 A;  1SE4 A;  1DOL A;  1STN A;  2NVY B;  4POF A;  1PZI D;  2OTL A;  1YBY A;  4KY6 A;  4TSS A;  4EVO A;  3U58 A;  3KF8 A;  4DV5 L;  3I72 A;  4O42 A;  1CKN A;  1X3E A;  5JEA G;  1RL2 A;  3SDZ A;  4LF4 Q;  1M8A A;  2VZA A;  1GUG A;  4B3M Q;  1YEZ A;  1CKO A;  3DWA A;  1HNX L;  3RR5 A;  4X62 Q;  1CI3 M;  3ERS X;  5E3F A;  1TS5 A;  4MTN A;  4NP5 A;  4O2D A;  2KOL A;  3J80 L;  3VR5 A;  5C5L A;  1NAP A;  3HKZ G;  4KHP Q;  4KKU A;  5C0X I;  2CCZ A;  4YIJ A;  5CGK A;  1V43 A;  3ZYY X;  3M4O H;  2VL6 A;  1D1K A;  1HR0 Q;  2KJX A;  2B2W C;  1VQ4 A;  4DXG A;  2VQF Q;  2K5H A;  2CQO A;  3MTS A;  2PW7 A;  2VUM B;  3CKI B;  1L1O B;  1EQV A;  3NK9 A;  1G51 A;  4DU9 A;  1V9P A;  4JOI A;  1SFO H;  1A0I A;  5FO9 B;  3A74 A;  4HJ9 A;  3JAM c;  1JWU D;  3ICE A;  4AYB B;  1JQY D;  2ZXR A;  1PRT B;  2RCF A;  3DEP A;  1X56 A;  1H9R A;  4JI7 L;  1Y1V B;  4I65 A;  1X55 A;  2NUC A;  2JN4 A;  2F3W A;  5IYD H;  3FKI B;  5GRO A;  3C1F A;  5BN4 A;  1E2W A;  1CHP D;  1J6Q A;  1N36 L;  2ZTE A;  3SXH A;  2F0V A;  3TZD A;  3HOW G;  3J81 j;  4KY7 A;  4DR7 L;  1SSO A;  4IFD H;  1XMQ Q;  3J7A 5;  4F8M A;  3KDF A;  4P74 A;  5CR3 A;  1TWF B;  1V1P B;  1JB7 A;  1I4R A;  3E0J A;  3J80 i;  1Y69 U;  2XSC A;  4CJ0 B;  3BG3 A;  4A3E B;  1XNQ L;  1HA5 A;  1STB A;  4EQN A;  2UUA L;  1EY5 A;  1MGS A;  3CCR A;  1VQG A;  1YIT A;  1HNW Q;  3DEO A;  4C2M H;  1YNJ C;  4DV0 Q;  2HQL A;  3WOE A;  1EYA A;  2B8G A;  1L0W A;  3E0E A;  1FJG L;  2PCF B;  5C3E H;  3P1H A;  3U4V A;  1JE5 A;  1Y14 B;  3VA5 A;  5I6Y A;  3MHB A;  3NTH A;  3I4M G;  2LY7 A;  3I91 A;  2F0P A;  2Q2I A;  1XJV A;  2BH8 A;  3CRK C;  4R8N A;  2EYM A;  5GAD C;  2B63 B;  3GTM B;  2EJM A;  2B29 A;  4JG2 A;  4TRD A;  1XXG A;  3NTI A;  4PZ7 A;  3SK6 A;  1IYU A;  2RVL A;  4QGU A;  5KNC A;  5D14 A;  3GTQ B;  4BBR B;  3AEV A;  1UEB A;  1Z47 A;  3F2B A;  1E24 A;  4L8J A;  4OL7 A;  5EBD A;  3HOX H;  3Q0A A;  4PZ6 A;  2F0S A;  4ZCK A;  4CJ1 B;  4P75 A;  3NQT A;  4X3K A;  4C3I H;  2K1B A;  3I70 A;  4APV A;  1NMF A;  5J22 A;  3NEN A;  1Q82 C;  1JJ2 A;  1G2S A;  3CF5 A;  2N78 A;  3HFZ B;  4P72 A;  2H1E A;  4ZYS A;  4OX9 L;  2F03 A;  1IBM L;  4GKK L;  3M4Y A;  4CKC A;  1B9N A;  1VQ8 A;  5C4X G;  2YTX A;  2K32 A;  1EL0 A;  1O80 A;  5IGC A;  3Q24 A;  2K52 A;  1EFW A;  2B2V C;  3R93 A;  4DR5 Q;  4DR4 Q;  3TS0 A;  3OPO A;  3HOY B;  1UNS A;  5JEA J;  3NQI A;  4A3I B;  1WTX A;  4B3S Q;  1IKM A;  2CH4 W;  1R4P B;  3ULP A;  1KLG D;  3GO5 A;  3GP7 A;  3S1M H;  1BXT A;  1Q1B A;  1SLJ A;  1SMY C;  1M90 C;  4POG A;  1ENA A;  2ID0 A;  2EXZ A;  1K9M C;  1DOM A;  4L5Q A;  4JI3 L;  5KEE A;  1UUP A;  1TWH H;  4HSV A;  3PCO B;  3VYU A;  5HGT A;  4YCV A;  5C4J H;  2JA5 H;  5C44 G;  2NTS A;  4KD3 A;  2XRQ D;  3TDQ A;  3BDO A;  1L1O A;  2QDB A;  2XNA C;  4IUR A;  4X64 L;  2ES2 A;  1IW7 D;  1E1T A;  4EQP A;  2KUM A;  1NNX A;  4G57 A;  1GKH A;  1SJE D;  3E3X A;  2YYZ A;  1KD1 C;  2RDG A;  3EQL C;  4K0K Q;  3KK7 A;  1GOZ A;  2C5C A;  3CAM A;  3RZO H;  4IZ8 A;  5FLX L;  4ZLT F;  2M00 A;  3EA6 A;  1CSQ A;  3K5L A;  4BY7 B;  3VR4 A;  1XPU A;  5EQ0 A;  1EWI A;  5AJ3 Q;  4DV1 L;  4A3K G;  2K75 A;  1EIY B;  2WB1 B;  3PSI A;  3RN5 A;  1SFO B;  3D8G A;  4NXN L;  4TKO B;  4B9W A;  1B44 D;  2BE5 D;  5IGB A;  4A3J G;  4A3L G;  1P8L A;  1PFN A;  3HOV G;  5IE8 A;  3JAM E;  2F3V A;  5M3F G;  4KJO A;  2IX1 A;  4DR1 L;  1V1P A;  1S40 A;  4I7A A;  1SR3 A;  1XPR A;  5I4D A;  1NY4 A;  2E2H B;  5IOD A;  1A62 A;  1B8A A;  3MC0 B;  4ALP A;  1J5E L;  2I46 A;  3K57 A;  1TY2 A;  4R4Q A;  5IT9 c;  3TS2 A;  2Q2U A;  1YNN D;  1VQP A;  4WJ4 A;  3EN2 A;  2NN6 I;  1CFM A;  5A2Q L;  1Z7T A;  4GN5 A;  2VQE L;  3HRZ C;  1PZJ D;  2AQ1 B;  1S5E D;  4HJ8 A;  3H15 A;  1HR0 W;  3FHW A;  1LLR D;  3A54 A;  3QO2 A;  4IUP A;  4N8F A;  1DOK A;  2D0O A;  4X3U A;  4IOC A;  2YV5 A;  3X3M A;  1O7L A;  4C2M B;  1Q81 C;  4WJ3 M;  4IPH A;  1X54 A;  4IAL A;  3KYH C;  2XRS D;  4DR7 Q;  5H1S E;  2TSS A;  1Y1W H;  4GLA C;  4DUZ Q;  1EEI D;  2HT1 A;  2EYF A;  2R92 H;  2PO4 A;  2MHV A;  2ICI A;  2AWO A;  3ULL A;  5M5X B;  3PV0 A;  4EX5 A;  3GV6 A;  4KD4 A;  1HZC A;  2EJG C;  2I5M X;  2I0Q A;  2KEC A;  2N3S A;  5C5M A;  3M9B A;  1F2M A;  4LF6 L;  2WIN B;  4EQ5 A;  1B9M A;  5FKA C;  5JJL A;  2F0M A;  3AB9 A;  4JYA L;  1H9J A;  4C3J H;  1RDP D;  3E5S A;  3D31 A;  4ODG A;  2PZT A;  5I2Y A;  1TY0 A;  1EYD A;  1JE4 A;  2M9V A;  3HOX B;  2HCI A;  1KAB A;  1D1I A;  1I6V C;  5IOC A;  2JXM B;  2L5T A;  4DAV A;  3DLL A;  4C3I B;  3QJY A;  2B2Y A;  2WAQ B;  4RGN A;  2OTJ A;  1U4P A;  4LF4 L;  1PYS B;  4B3M L;  3NWT A;  5D3D A;  3I2Z A;  1SEB D;  1ZYR D;  1F2Y A;  2K01 A;  4K14 A;  3V96 A;  1KDA A;  4X62 L;  4IJH A;  2QDL A;  1ZKO A;  1IL2 A;  2R7Z G;  1EQQ A;  4LUZ A;  1UE5 A;  1BDO A;  4XYQ A;  4OO1 G;  4K6D A;  3EIV A;  2IX3 A;  2KQ3 A;  1CKM A;  3J81 i;  3VR2 A;  4KHP L;  5C0X H;  3EBE A;  2IL8 A;  4JBJ A;  1D6E C;  4F7X A;  2CVR A;  4XQJ A;  4QQB X;  1XTD A;  3D4D A;  4A3F B;  4F87 A;  4IUQ A;  1NTG A;  2Q8I B;  5IYB G;  5IYC G;  2VQF L;  4DR3 Q;  1I4Q A;  1CSP A;  2KHJ A;  4R8I A;  4V19 0;  2ZTD A;  2IWH A;  1HZ9 A;  4G7O C;  3GTJ B;  5IY0 A;  1SYF A;  3QIA A;  2UXB L;  3K7A H;  4QJF A;  1TWH B;  4RH6 A;  3PO3 H;  1LTT D;  1VCI A;  1KAA A;  1TS3 A;  1T9H A;  1GUN A;  2JA5 B;  3C46 A;  1WCM G;  4FVM A;  2VUM H;  1VMP A;  3L9A X;  3U9S A;  1C7Y A;  3JC6 6;  4IPG A;  1XMQ L;  2B2W A;  3K80 C;  1HNZ Q;  5CV9 A;  4XQN A;  3RZO B;  1BCP F;  5M9O A;  2BA1 A;  3M4P A;  1YIJ A;  1N32 L;  3GV3 A;  1KDC A;  1W2B A;  4MIU A;  4AYB E;  1Y1V H;  3TME A;  1B3Q A;  2E2I B;  4DAM A;  1EY0 A;  4ZQ3 A;  3FKI H;  2QCP X;  3L0O A;  3I55 A;  3HOU G;  2ZTC A;  3LWU A;  5EKK A;  1HNW L;  1GJX A;  1D2B A;  1LAB A;  3N6R A;  1SXT A;  4NDX A;  1EIG A;  3NP8 A;  2DNE A;  3NEM A;  4QF4 A;  3NBH B;  5EGT A;  3KBX A;  1PH5 A;  1JB3 A;  4QIW B;  2CW0 C;  4DF7 A;  5K36 H;  2M2L A;  1HZB A;  3Q23 A;  3CCJ A;  3O13 A;  1A63 A;  3I90 A;  3A8I E;  5FLX c;  1FGU A;  3P7J A;  3BVG A;  1E22 A;  2K5N A;  3DMU A;  3URY A;  1HZA A;  1O7Z A;  1HFG A;  4A3E H;  1HFN A;  1TWG H;  2JA7 H;  3I56 A;  4CGY B;  4NXN Q;  4JI6 L;  4GN3 B;  2LS0 1;  5EPL A;  3S17 H;  1JOQ A;  1VQD A;  5CC4 A;  2IX0 A;  5IT9 E;  5LMU Q;  3NUC A;  2MO0 A;  1EWC A;  3HOZ H;  4LUV A;  4JI1 Q;  2OT2 A;  2AKW B;  2I07 B;  1E7Z A;  2MQH A;  2A6E C;  2R93 B;  2ZXP A;  2HQE A;  4Y52 H;  3A0J A;  3G71 A;  4GKJ Q;  1R9T B;  2VXW A;  2D0P A;  1PRT D;  2R3Z A;  3MVV A;  4KV6 A;  1G6P A;  3K8A A;  2QGQ A;  3MXN B;  1J5E Q;  3EVQ A;  5D65 A;  1Y1W B;  3IFD A;  2CH4 A;  2R92 B;  3FVQ A;  4HAE A;  2B63 H;  3GTM H;  5FJ8 H;  1SE2 A;  2EYL A;  3VR3 A;  1S5B D;  2BH2 A;  5M3M G;  1KC8 C;  1LTL A;  2F3I A;  1CQF A;  4U67 3;  3CHB D;  4K8J A;  4BBR H;  3TN2 A;  3D4W A;  3P20 A;  1HTP A;  4DR5 L;  5JVH 3;  4DR4 L;  1F9P A;  4JBM A;  2QF7 A;  4C3J B;  3PUZ A;  4B3S L;  1PTO F;  1VQC A;  1EQR A;  1KNA A;  2L4N A;  1BOS A;  4R1J A;  4A93 G;  4RWS C;  4K2L A;  2A6H D;  1PH4 A;  2K05 A;  1PFM A;  1VQE A;  1QE6 A;  2A69 D;  3CP0 A;  3SK8 A;  4A3G G;  4S3S A;  4ZKC B;  1HUM A;  1JMC A;  1STG A;  3TP7 A;  1W3S A;  1HCZ A;  5IP7 G;  4A75 A;  5JJI A;  2MFI A;  2E5L Q;  4A3B H;  2Z8L A;  1KTK A;  4B3T Q;  4KKS A;  1TXY A;  4YWK A;  2N55 A;  3SHL A;  4JBW A;  4LF7 L;  4JYA Q;  1TWC H;  2Y0S E;  4DK0 A;  1EY8 A;  2VY3 A;  3CPF A;  4OXP A;  3S15 B;  5ELE A;  1A6X A;  5DM7 3;  2DGY A;  2F0N A;  1KHI A;  4C1N I;  2B2V A;  2K4K A;  4HJ5 A;  4L5R C;  5C6A A;  4HR7 B;  1U9R A;  2JYO A;  3I4N B;  2KCM A;  1N34 Q;  5CV6 A;  4K0K L;  1OXU A;  5J39 A;  2NN6 G;  2YTY A;  2IJ0 A;  1K3R A;  2CWA A;  3M4Q A;  4LK1 C;  3PUW A;  5AJ3 L;  3CD6 A;  4DR6 Q;  4BBS B;  1RTO A;  1SN8 A;  1LYL A;  4C3H H;  1FNU A;  4DK6 C;  1HJP A;  1SNQ A;  1KXL A;  1NE3 A;  3NWS A;  5G3L F;  4GNX C;  3K7A B;  3STB C;  5GAH C;  4RKB A;  1U0L A;  2ENB A;  3OW7 A;  3PO3 B;  3TRZ A;  2HDM A;  4ME3 A;  4BY1 G;  3RZD H;  4R9W A;  4DUY Q;  4A4I A;  4RHS A;  4BA1 I;  2ICE C;  4XTC S;  3T56 B;  4QUF A;  1X3Q A;  3OMG A;  1STH A;  1L0Y B;  4BY7 H;  1BCP C;  2PI2 A;  1F9S A;  3NXW A;  2O2L D;  1K3B C;  4N9P A;  4HMJ A;  3ULJ A;  4C1N K;  4R4O A;  3CC2 A;  4KLK A;  3MEF A;  5I9P A;  5J1Z A;  5JEA H;  3M7N A;  3FPP A;  2EY1 A;  2WB1 E;  3T1Y L;  3KF6 A;  2UXB Q;  3NBH A;  5CBE E;  5IP9 G;  5KND A;  3VA7 A;  1KIX A;  1G8Z D;  3V05 A;  4L5S A;  5E7N A;  2KA7 A;  3PUV A;  1SYG A;  1PHJ A;  1F9R A;  2NZH A;  4PMB A;  3BVM A;  2V1C C;  1P16 A;  4OO1 I;  3IAY A;  2E2H H;  1KDB A;  1OXT A;  4KKT A;  4JI0 Q;  1AE2 A;  1SDF A;  1SYB A;  5T1I A;  4A3C H;  1EOV A;  1S72 A;  2EDG A;  4RHR A;  4G4K A;  4DUZ L;  5LMN Q;  1Q86 C;  3LX0 A;  3CQZ B;  2UXD Q;  1QUQ B;  3T4A C;  3S16 H;  2A19 A;  2GN5 A;  2JEB I;  2K5D A;  4DGZ A;  5C3E G;  4BWG B;  2K6A A;  1K8A C;  1CT1 D;  1N32 Q;  4DK1 A;  3NBI A;  4FNF A;  3NTK A;  1A3U A;  1ESR A;  2VNU D;  3VYT A;  4YWL A;  1TWG B;  5FLX E;  3H09 A;  5KYL A;  2JA7 B;  3MXN A;  3S17 B;  2PQA B;  1F2L A;  2GVA A;  1FD7 D;  3DM1 A;  2H5X A;  3F2C A;  3HOZ B;  4CHT B;  1RKN A;  5FLM G;  4BS9 A;  4P2C B;  3D6W A;  1UWV A;  2EVB A;  3RNU A;  3CMA A;  4U68 A;  2F0Q A;  3WOF A;  3ND9 A;  3BU2 A;  1KRT A;  5M5X H;  5C3W A;  2RSO A;  1NMG A;  2SOB A;  4IUV A;  5ELB A;  1D5M C;  3HOX G;  2E8G A;  1ZEQ X;  1XWE A;  1SYC A;  5GAE C;  1H9M A;  1GXD C;  1V1Q A;  4JI6 Q;  1RIP A;  1KNE A;  2XVS A;  1FVI A;  1HXY D;  4KK7 A;  2K50 A;  2A73 B;  1VQM A;  3X3N A;  2AQ3 B;  1B70 B;  1IHZ A;  5A35 A;  1PTO C;  4IJL A;  3KFU A;  5ELD A;  2LFN A;  1I4G A;  3CCM A;  2PYK A;  3CXC A;  2HCC A;  3E6Z X;  3CRL C;  1N33 Q;  1PA6 A;  4DR3 L;  1IYV A;  2UXC L;  3BJU A;  1QVG A;  1ET9 A;  4JI4 Q;  2WAQ E;  1PTO H;  4MHE A;  2L12 A;  1DXM A;  1MD2 D;  4B3R L;  1YHA A;  3KJO A;  4JPB W;  2Z4I A;  3I4M H;  1U4R A;  4DAY B;  1DJR D;  1I5F A;  1EOT A;  4LJZ C;  1KRS A;  4A3B B;  1II3 A;  3A8K E;  2Y0S B;  4OHJ A;  2JA8 G;  4IOA A;  3PIO 3;  3MEH A;  2DY7 A;  1TWC B;  4LFA Q;  2EY2 A;  2HIV A;  4PZ8 A;  4A3F H;  4FXD A;  3PQI A;  2XWB B;  1YNJ D;  5CBA E;  4CDE C;  4WRD A;  2E74 C;  1STY A;  4A3D B;  3AQQ A;  4HSP A;  4Z9C B;  4ZK9 B;  1HNZ L;  1EIF A;  4V0B A;  2EJF C;  1BR9 A;  2MJ8 A;  4RAU C;  3TQY A;  4UHV A;  3GTJ H;  5CYU A;  4ILW A;  4RKL A;  2Z6K A;  1WTO A;  2VB2 X;  1LTA D;  2F4I A;  2ALY B;  4B9X A;  4HMI A;  4DV3 Q;  1X3G A;  4LF7 Q;  4FYD A;  1DM0 B;  3IKJ A;  2X6L A;  4C3H B;  4KTA A;  1SJH D;  2RQX A;  1BVS A;  1B1Z A;  3TEH B;  2R7D A;  2XWJ B;  4MN3 A;  2QW7 A;  4XQQ A;  3GTL H;  4LAA A;  3WWV A;  3OTO Q;  3RZD B;  1AW7 A;  3K59 A;  2WP8 J;  4DNT B;  2EYO A;  4L5T A;  2G5D A;  2RSN A;  3CU7 A;  1PMR A;  2A5H A;  2D62 A;  1RTN A;  1E0B A;  1VQI A;  3G7L A;  3NE5 B;  3H6M A;  4GNX B;  1KL9 A;  4PMW A;  1WOC A;  2K7V A;  2ASB A;  1CZW A;  2E2I H;  4KHV A;  2E2J B;  2L11 A;  2OCE A;  3M7G A;  3J80 c;  3MXU A;  2D2C C;  5LMU L;  1QZG A;  1LTR D;  3UI2 A;  2PI2 E;  4JI1 L;  1QUQ A;  3J7Z C;  3CC7 A;  1JWS D;  5CV8 A;  1TVX A;  5IIF A;  5C44 H;  1BCP B;  4HIO A;  4GKJ L;  4JI2 Q;  2L15 A;  5CMD A;  2JA6 G;  4RGT A;  1J9O A;  1FNW A;  4FF3 A;  2LXK A;  5JJK A;  4QIW E;  1EZ8 A;  3GTP H;  2PZU A;  2QEX A;  1UEA B;  1EWH A;  2SEB D;  1XMO Q;  2PQA A;  3A55 A;  1ILQ A;  3A8J E;  2NVT H;  1SMY D;  3KLR A;  3S16 B;  1O78 A;  1Y1W G;  2EE1 A;  1VQ7 A;  1HPC A;  3T1Y Q;  5L37 A;  2G9D A;  1DZ1 A;  1X3F A;  2H4O A;  3KBG A;  4KI0 A;  1YJW A;  1PH2 A;  1TII D;  2PNH A;  5DEH A;  1WTP A;  4L63 B;  2R93 H;  1B4O A;  4JV5 L;  1HUN A;  4DNI A;  4AQY Q;  1VQ9 A;  2F0G A;  1R9T H;  1ZYR C;  3J81 L;  4A3J H;  3OIP A;  4OIJ A;  2F0T A;  2RDF A;  5M3F H;  2SNM A;  4C3J G;  5DLQ E;  4OEM B;  1KLU D;  3MFY A;  1VQ6 A;  3KLS A;  4HTH A;  4LFB L;  4FDB A;  3ITP A;  2A68 D;  2KBN A;  1S5D D;  2CWP A;  1WI5 A;  4FO2 A;  1JIC A;  4FXG C;  1IBL L;  1E2Z A;  1OO9 B;  3GTG B;  1AP0 A;  1DCZ A;  1QWY A;  4EGV A;  2E5L L;  4B3T L;  5BN3 A;  5C3X A;  1TU2 B;  3VYR A;  3UDI A;  1GHJ A;  2TMP A;  2HDL A;  2Q8T A;  2IT1 A;  1NR2 A;  1W6J A;  3Q6S A;  5DM6 3;  1NJI C;  3PO2 G;  3A5Z B;  3CCS A;  4DAY A;  2ZJQ A;  3U9O A;  4N9T A;  1I94 L;  2R7F A;  2B2T C;  3MFG A;  1VQH A;  1N34 L;  3K0X A;  4XT1 B;  4PNY A;  2JK8 A;  2ZT9 C;  3K6O A;  4FXK C;  2B8F A;  1BNZ A;  3MWY W;  2EYP A;  3HGB A;  2EOT A;  4H02 A;  2V4D A;  4H13 C;  3RLO A;  1PTO B;  1G6Z A;  1IYJ B;  3AMU A;  4DR6 L;  3CCU A;  1BO0 A;  2UUC Q;  3I4M B;  2QKI C;  1ZXT A;  3SK5 A;  5EAY A;  1U4L A;  3OW2 A;  3S15 H;  3GDE A;  1Y8N B;  4ULL A;  2EPB A;  4LWC A;  4A76 A;  2DJF C;  1FNV A;  3S1N H;  3ND8 A;  1PZK D;  3L3O C;  4IUN A;  1Q1E A;  1GUW A;  4FF4 A;  5CV5 A;  3PIP 3;  1TWA H;  3I4N H;  3S2D H;  1WD0 A;  4DFA A;  3RN2 A;  1ICF B;  5HGQ A;  4DUY L;  5I2X A;  1C8C A;  1UAP A;  1B3A A;  1SNC A;  4FF2 A;  1HA6 A;  2FMC A;  4RGM A;  1BUV T;  2WII B;  3QOJ A;  4JK1 C;  4XT3 B;  4BA2 I;  2UXC Q;  1MIU A;  1I3Q H;  2F1M A;  3B6Y A;  3RLF A;  3F2D A;  3IL8 A;  4CDD C;  1CK1 A;  2SNS A;  4UAI A;  4BBS H;  4QMG A;  4B3R Q;  3J7A F;  2OQK A;  2VUM G;  3QR8 A;  2PMZ E;  1EY6 A;  3HG9 A;  4XIG S;  3UDG A;  4OIK A;  4GZY C;  1PFB A;  3EJI A;  3K7U C;  4G7H C;  2R61 A;  4K5W A;  3Q22 A;  3VYS A;  2JSO A;  4AYB G;  2R7Z H;  3DWQ A;  2O5J C;  5C4X B;  3F1Z A;  1WTR A;  1AZQ A;  1T5E A;  4OO1 H;  1SNM A;  5COY A;  5LL6 X;  4GNX A;  1NR4 A;  1Y1V G;  4J15 A;  1JR0 D;  2F0O A;  5I9O A;  2B3G A;  3JAM L;  3FKI G;  1PH6 A;  4JI0 L;  3GTL B;  2LXJ A;  1L1O C;  3OMC A;  2C9O A;  4C56 C;  5LMN L;  4IPC A;  1CKN B;  2UXD L;  1I4X A;  5IYB H;  5IYC H;  3M3Y H;  5EBC A;  2GVB A;  4Q5V A;  1ROD A;  1Q90 A;  3D6C A;  3K5M A;  4K6L A;  3W2D A;  4A3M H;  3K58 A;  3TSS A;  5K5P A;  3P75 A;  3K5O A;  1QOH A;  1H9S B;  1QNU A;  4OWT B;  5KNB A;  4ZUJ A;  2NZ1 D;  3VDY A;  2Q2H A;  2BCO A;  2F0I A;  1LTS D;  1FL0 A;  1O7Y A;  4ABN A;  4LF9 Q;  2L1B A;  1EZ6 A;  4A3E G;  2I5H A;  1B53 A;  3FDT A;  5LL6 S;  1VDZ A;  3RUZ A;  1H95 A;  3DUZ A;  3J80 E;  1QIL A;  5C44 B;  1G91 A;  5E4W C;  4MTK A;  1VS0 A;  4LFC Q;  1WCM H;  1XYI A;  4XYO A;  5EJW A;  3CQZ H;  5CV4 A;  4HN7 A;  2IPK D;  3HS0 C;  2FHT A;  2KCT A;  3H0G H;  3RMH A;  1E3P A;  1SE8 A;  2F4V L;  3GTP B;  1QVC A;  2DY8 A;  3QB3 A;  1MI2 A;  5HY6 A;  1Q7Y C;  1RCV D;  4R4T A;  1EEF D;  2G9H D;  2NVT B;  3ER0 A;  3TZU A;  4RCN A;  1XPO A;  1TT2 A;  1A15 A;  4YCU A;  1GHK A;  5J3B A;  2PZW A;  4K5V A;  3PMF A;  1GO3 E;  2A69 C;  4K2K A;  4K5X A;  3L7Z C;  2B63 G;  5JOB A;  3IFT A;  5FJ8 G;  2DN8 A;  3AYH B;  5GQO A;  2JE6 I;  2JA9 A;  2Q8R E;  3JAM i;  2Z1C A;  3HOU H;  2RHS B;  4BBR G;  1N8R C;  5FK9 C;  4A3J B;  3HOV B;  2K5W A;  4DV4 Q;  5M3F B;  3DHQ A;  1N33 L;  1DYQ A;  5BR8 Q;  3SK4 A;  1OXV A;  1GD7 A;  5NUC A;  1WTQ A;  4JI5 Q;  1IZ6 A;  1YVC A;  1HQM C;  2ATW A;  2NYZ D;  3GTO B;  4TQU S;  5AFW A;  4JI4 L;  1SNO A;  3S1Q B;  2R6G A;  4HED A;  4R4C A;  1ILP A;  4BXX H;  2CKZ B;  4GLV B;  3BZK A;  1CUK A;  1EYC A;  4JV5 Q;  2KHS A;  2NVX H;  2Z9H A;  4LFA L;  1VQN A;  4A3B G;  3NEL A;  3KOJ A;  3MZ5 A;  1TS2 A;  1NBW A;  2Y0S G;  3J81 c;  4QB4 A;  3HOY G;  2BDN A;  4GLX A;  1RF2 D;  4PV1 C;  1BBX C;  4KMU C;  4A3I G;  3BYT B;  3S2H H;  2F0D A;  3T13 A;  4XXE A;  1MJC A;  4LFB Q;  2CW0 D;  2AUK A;  3HZX A;  1U4M A;  4JCV E;  5KGU A;  1IBL Q;  4DXF A;  2A74 C;  3MXP A;  4DV3 L;  2F0J A;  3QWN A;  1PH3 A;  4L6T B;  4E6I A;  3PIP A;  4RG1 A;  1G2T A;  1WTH A;  1X32 A;  2F0L A;  5M3M H;  1SNP A;  4PG3 A;  1YHB A;  4HIK A;  3S9W A;  4YY3 Q;  4I7Z C;  3CCL A;  3S1N B;  4C3H G;  1C48 A;  4QCL A;  3OTO L;  5IWA L;  3FP9 A;  1I94 Q;  1TWA B;  4A3D H;  2FIN B;  3MA2 B;  3S2D B;  2GA4 B;  1XNR Q;  2CQA A;  4H44 C;  4FF1 A;  1MBY A;  2FFK B;  3E9H A;  3F2U A;  2E75 C;  4A93 H;  1VQB A;  2Q2T A;  1EQT A;  2LKV A;  1K83 H;  3SR1 A;  1GM5 A;  1I3Q B;  4KN7 C;  4HID A;  4A3G H;  1LT3 D;  2PMZ B;  2K04 A;  2C35 B;  4LUO A;  4CKB A;  5KRU A;  1JOK A;  2MGS A;  1PH1 A;  3S14 H;  2ZXO A;  2F0W A;  4BY7 G;  2K28 A;  5IP7 H;  4JI8 Q;  4RMF A;  1I50 B;  3CPW A;  2WB1 G;  3I3C A;  4LNQ A;  2D5D A;  3H91 A;  1I6H B;  2RCN A;  1ICW A;  2YU9 H;  4X65 Q;  4GOP C;  2R7Z B;  4LF8 Q;  4JI2 L;  1GVP A;  1M4V A;  1PV4 A;  1Q46 A;  3SEB A;  4B08 A;  1T5X D;  2K5Q A;  4KN4 C;  2UUB Q;  4X66 Q;  1H9S A;  1C0A A;  3A56 A;  5IYD G;  1MHW C;  4YWM A;  3OWE B;  1EIH A;  3H3V I;  2F0H A;  1AH9 A;  2Z0S A;  1XMO L;  4G7Z C;  1VF5 C;  3SE0 A;  3M3Y B;  4ZAI A;  2NN6 H;  2E2J H;  5IGG A;  5CV7 A;  4A3C G;  1MSH A;  2Z4H A;  4IFD G;  1QNK A;  1AFP A;  3BZD B;  5KIX A;  4A3M B;  1JWM D;  3PF4 A;  3GQB A;  1XX8 A;  4LW1 A;  3AFP A;  4FP5 D;  4AQY L;  3C3L A;  5IT9 L;  2QEJ C;  5ELO A;  2F0U A;  2F0F A;  1JJC B;  4R4I A;  1A2T A;  1I4P A;  1ENF A;  2ZJR A;  3HKZ E;  4QUC A;  4BY1 H;  3UE1 A;  4Y7N H;  1WCM B;  2LSS A;  1B2T A;  4ZKB B;  1DGS A;  3H0G B;  4MZ9 A;  3WDN A;  3Q8D A;  1S4Z A;  2YTV A;  5C4Z A;  2MPM A;  4DV6 L;  3SGI A;  1Q8K A;  2CFM A;  1J8I A;  3DWP A;  3AU7 A;  3KLW A;  3RD4 A;  5IP9 H;  2HHH Q;  1WVL A;  3STB D;  3AFQ A;  5ELF A;  3VR6 A;  1TQO A;  4AH6 A;  3SVM A;  1SRU A;  4ZRZ A;  1QB5 D;  2N8N A;  3RLN A;  3QG1 A;  3HOU B;  3W1G A;  1A3T A;  4NKL A;  1MKH A;  2A1A A;  3HOW H;  1JC7 A;  2F4V Q;  3GTG H;  1BCP D;  1LM0 A;  3J7A V;  2RHQ B;  4C3I G;  3M85 A;  3KLS X;  1CA5 A;  4O1N A;  2WAQ G;  2UUC L;  2UU9 Q;  2EXD A;  2LMC B;  1Z6H A;  1S5C D;  4DN4 M;  5A2Q E;  2NVX B;  2EYJ A;  3CME A;  3L2P A;  1EUJ A;  2BDO A;  2L0C A;  2EYH A;  4WFN 3;  3MAQ A;  4HJA A;  2XN9 C;  5DNF A;  5FLM H;  3K81 C;  2ZM6 L;  2KVM A;  1F2Z A;  4P73 A;  2VW9 A;  3OWF A;  1Y8P B;  4A3F G;  3S2H B;  1LT5 D;  1SND A;  2NWG A;  1IW7 C;  3J81 E;  2B2T A;  2NVQ H;  2IY5 B;  3D4R A;  2KHI A;  2B2U C;  3CW2 C;  2ZJP A;  2OF1 A;  2RBM A;  3W5O A;  2E2D C;  2KCC A;  5FO8 B;  1PH9 A;  1MSG A;  1H9K A;  4YHH Q;  2RA4 A;  4DAP A;  1JT8 A;  4DV7 Q;  5M3M B;  2AMC B;  2DNC A;  1EY9 A;  3FEW X;  5F2D A;  2JA5 G;  3C1E A;  1WYD A;  2BE5 C;  3HP3 A;  2AWN A;  2WKC A;  2JQO A;  1R4Q B;  3U4Z A;  4UY8 C;  1DON A;  1EY7 A;  3T53 B;  4A93 B;  1XTC D;  2Z6B A;  2WAC A;  1ASZ A;  1FR3 A;  1K83 B;  1IBK L;  1B7Y B;  1FYC A;  4A3G B;  2AUJ D;  5M5W H;  1F77 A;  3I7F A;  3S14 B;  4KY5 A;  3S24 A;  1E2V A;  5C4X H;  3GD7 A;  1YNN C;  4X6A H;  4LF9 L;  4LMQ D;  4J8Q A;  2JA8 H;  4WOR A;  1PTO D;  2AHO B;  1X6O A;  1G29 1;  4TVA B;  4RGO S;  1K8O A;  4IFD J;  4DR2 Q;  2PW5 A;  5IWA Q;  2YU9 B;  1K0R A;  2KEE A;  4IPD A;  4LFC L;  1ESF A;  1PFS A;  2MNA A;  1PVO A;  1STE A;  5FO7 B;  5JVG 3;  3ERQ A;  4DV2 Q;  1SE3 A;  1A2U A;  4K8I A;  5T1G A;  4IUT A;  1TR5 A;  5EKI A;  1NSN S;  1Z9F A;  1LTG D;  4IQZ A;  1PDQ A;  2SDF A;  2NTT A;  4GOP B;  3BYY B;  3M4O B;  1PRT F;  1CQV A;  3QOL A;  4DV5 Q;  4J1M A;  1W6K A;  4JOI C;  4DA2 A;  2A68 C;  2EQS A;  2J7Z A;  3MXG A;  4RA8 A;  4IO9 A;  4X3S A;  2VB3 X;  1HNX Q;  1QJO A;  4QY7 A;  3HKZ B;  2BA0 A;  1JOR A;  1Q3L A;  2R93 G;  3GTK H;  2PPB C;  3TP6 A;  4DNR B;  2OXP A;  3HEJ A;  1V1O A;  4HCE A;  3I4O A;  4DV4 L;  1S5F D;  3OIQ A;  3FPU B;  1PH7 A;  5BR8 L;  4BY1 B;  4Y7N B;  4UP8 A;  4JI5 L;  4HJ7 A;  1JJG A;  1SYE A;  4CDF C;  2EY6 A;  3E9I A;  1QZH A;  2R92 G;  4A3K H;  1O7I A;  5G3L D;  4YCW A;  1K8M A;  1F9Q A;  4JC0 A;  4J6H A;  3TRE A;  1LV9 A;  2WFW A;  1BKB A;  2PQE A;  4A3L H;  2NB0 A;  2X6G A;  3HOV H;  4Q0F A;  1X65 A;  1YJ9 A;  5C4H A;  1EFI D;  2WKD A;  3T16 A;  2J4X A;  2KED A;  2RKS A;  2AQ2 B;  5EPJ A;  5FOB B;  4NXM L;  1ASY A;  2JA6 H;  3GTO H;  3FMC A;  4JI7 Q;  4ME5 A;  3R2T A;  1RHP A;  3HOW B;  3S1Q H;  1TKW B;  1SRO A;  3NHH A;  1SBB B;  4CBV A;  4OON A;  1N36 Q;  4DV6 Q;  3S1R H;  1YJN A;  1VQJ A;  1OXS C;  4UP9 A;  1JCK B;  1X3P A;  2E76 C;  5C3E B;  4OWW B;  4IFD I;  3NSW A;  2F0K A;  2K03 A;  5LMN W;  4NB3 A;  1OXX K;  1V8Q A;  3U50 C;  4YY3 L;  5TSS A;  3D3R A;  4LF5 L;  3T1H L;  3I4L A;  5E1F A;  3OHX C;  2KCN A;  1ONL A;  1ET6 A;  1XNQ Q;  2FMM A;  5C0X G;  1XNR L;  1N9W A;  5EKL A;  2K5V A;  1LTI D;  4IUU A;  2UUA Q;  4AIM A;  4H7B A;  5KYI A;  2O4X A;  4DK3 C;  3PF5 A;  1EYG A;  3I4N G;  1GUS A;  1YI2 A;  4X3T A;  1X9N A;  2EY5 A;  2NVQ B;  5M5Y H;  1FJG Q;  3H94 A;  3PUX A;  1WJJ A;  3PIO A;  3LNN A;  2K33 A;  2N88 A;  4OWX B;  1GUO A;  5E4X A;  1QG7 A;  1AN8 A;  1VQO A;  3ZJY C;  4EQO A;  4JI8 L;  1NUC A;  1HRJ A;  1WTV A;  3H3V C;  3A7L A;  4BBS G;  1HTL D;  5ELC A;  3EFX D;  1HH2 P;  4M8A A;  3K0Y A;  3A5U A;  3OSO A;  4X65 L;  3ONA B;  4MNO A;  4F88 A;  4LF8 L;  1UE7 A;  4PMC A;  2L9H A;  4KHZ A;  3PO3 G;  5DAU A;  2JP1 A;  2ZM6 Q;  1K8G A;  1WD1 A;  3G4S A;  2UUB L;  1E1O A;  2FJ2 A;  1RJT A;  3LGJ A;  3N52 A;  4X66 L;  3PO2 H;  1A8V A;  1M1K C;  3H3V H;  1YHQ A;  1Q8I A;  4N8X 1;  1S3O A;  4RFB A;  3TP8 A;  3NPP A;  1L0X B;  2FXQ A;  2NVY H;  2OWO A;  4ZUI A;  1HHV A;  2MO1 A;  4CJ2 C;  1C9O A;  1I50 H;  1HR0 L;  1PXU A;  5IGE A;  5JPN C;  5M5W B;  1LTB D;  1NCV A;  3DM3 A;  1D8L A;  1I6H H;  3S1M B;  2Z6K C;  1L2F A;  2MP1 A;  4A3M G;  2X69 A;  1VMC A;  3R8B A; 
#chains in the Genus database with same CATH homology
 2JA8 B;  1CM9 A;  5BN5 A;  4WJW A;  3K5N A;  4H0L C;  3ERO A;  1DD2 A;  1SAP A;  5C4J B;  2QIL A;  5D3I B;  1PRT C;  5K36 G;  5LHY 1;  2J0T D;  4IN3 A;  3PUY A;  1PLF A;  2BOS A;  4UDU C;  5IGD A;  1GUT A;  1AEX A;  1PYW D;  1EU3 A;  3R2I A;  1BF4 A;  1EU4 A;  3GTK B;  1D5Z C;  2HUG A;  3I73 A;  1TS4 A;  3BVZ A;  1FGB D;  2A6H C;  2IW3 A;  1CHQ D;  3T51 B;  3R3O A;  4A3K B;  5JAV A;  3FRP B;  3BS1 A;  4NMZ A;  2PNR C;  1CZG A;  5JJZ A;  1WTW A;  1D5X C;  1CA6 A;  4CKE A;  2JA6 B;  2NBF A;  5ISR A;  5IGF A;  2EZV A;  3BDL A;  3G6J B;  2L55 A;  3J7Y W;  1SYD A;  2WV6 D;  1IL8 A;  3S1R B;  1RD9 D;  1VF7 A;  1A3V A;  5C0X J;  3TP5 A;  2OEO A;  5HUR A;  3C2P A;  1LO5 D;  1B50 A;  1QCB D;  4XDX A;  4OGQ C;  1LT4 D;  3TBI B;  3W3A A;  3V2T A;  2CHB D;  2D9U A;  1AZP A;  2JEA I;  4NW2 A;  3KUP A;  1Q12 A;  5EPK A;  4KJN A;  2B39 A;  1C4Q A;  2RDH A;  5M5Y B;  2B2U A;  4RCO A;  2B2Y C;  5COR A;  2XIW A;  3A7A B;  4HCS A;  5I6W A;  1IKL A;  2O5I C;  2A6E D;  4M1U B;  3DXJ C;  3BDC A;  2MUY A;  1ML0 D;  5JPM C;  1EY4 A;  1CTM A;  1I4H A;  1LAC A;  3I8Z A;  3LWE A;  3OOC A;  1ENC A;  2F0E A;  1LT6 D;  4ID6 A;  1STA A;  1JOO A;  1BQQ T;  3PO2 B;  1Y8O B;  4PQX A;  1HQR D;  1SE4 A;  1DOL A;  1STN A;  2NVY B;  1PZI D;  4KY6 A;  4TSS A;  4EVO A;  3KF8 A;  3I72 A;  4O42 A;  5JEA G;  3SDZ A;  1M8A A;  1GUG A;  3DWA A;  1CI3 M;  5E3F A;  1TS5 A;  4NP5 A;  2KOL A;  3J80 L;  3VR5 A;  5C5L A;  1NAP A;  4KKU A;  5C0X I;  4YIJ A;  5CGK A;  1V43 A;  3ZYY X;  1D1K A;  2KJX A;  2B2W C;  4DXG A;  3MTS A;  2PW7 A;  2VUM B;  3CKI B;  1EQV A;  3NK9 A;  4DU9 A;  5FO9 B;  1JWU D;  4AYB B;  1JQY D;  2ZXR A;  1PRT B;  3DEP A;  1H9R A;  1Y1V B;  4I65 A;  2NUC A;  2F3W A;  3FKI B;  3C1F A;  5BN4 A;  1E2W A;  1CHP D;  3SXH A;  2F0V A;  3TZD A;  4KY7 A;  1SSO A;  4IFD H;  4F8M A;  5CR3 A;  1TWF B;  1V1P B;  1I4R A;  3E0J A;  1Y69 U;  2XSC A;  4CJ0 B;  3BG3 A;  4A3E B;  1HA5 A;  1STB A;  4EQN A;  1EY5 A;  1MGS A;  3DEO A;  1YNJ C;  3WOE A;  1EYA A;  2B8G A;  2PCF B;  3P1H A;  3VA5 A;  5I6Y A;  3MHB A;  3NTH A;  2LY7 A;  3I91 A;  2F0P A;  3CRK C;  4R8N A;  2EYM A;  2B63 B;  3GTM B;  2EJM A;  4TRD A;  1XXG A;  3NTI A;  3SK6 A;  1IYU A;  2RVL A;  5KNC A;  5D14 A;  3GTQ B;  4BBR B;  1Z47 A;  4L8J A;  4OL7 A;  5EBD A;  3Q0A A;  2F0S A;  4CJ1 B;  3NQT A;  4X3K A;  2K1B A;  3I70 A;  5J22 A;  1G2S A;  2H1E A;  4ZYS A;  2F03 A;  3M4Y A;  4CKC A;  1B9N A;  2K32 A;  1EL0 A;  1O80 A;  5IGC A;  3Q24 A;  2B2V C;  3R93 A;  3OPO A;  3HOY B;  1UNS A;  5JEA J;  3NQI A;  4A3I B;  1WTX A;  1IKM A;  1R4P B;  1KLG D;  3GO5 A;  3GP7 A;  1BXT A;  1Q1B A;  1SMY C;  1ENA A;  2ID0 A;  2EXZ A;  1DOM A;  5KEE A;  1UUP A;  4HSV A;  3VYU A;  5HGT A;  2NTS A;  4KD3 A;  2XRQ D;  3TDQ A;  3BDO A;  2QDB A;  4IUR A;  2XNA C;  1IW7 D;  4EQP A;  2KUM A;  4G57 A;  1SJE D;  2YYZ A;  2RDG A;  3EQL C;  3KK7 A;  1GOZ A;  2C5C A;  4IZ8 A;  5FLX L;  4ZLT F;  2M00 A;  3EA6 A;  3K5L A;  4BY7 B;  3VR4 A;  5EQ0 A;  2WB1 B;  1SFO B;  3D8G A;  4TKO B;  4B9W A;  1B44 D;  2BE5 D;  5IGB A;  1PFN A;  3JAM E;  2F3V A;  4KJO A;  2IX1 A;  1V1P A;  5I4D A;  2E2H B;  5IOD A;  3MC0 B;  2I46 A;  3K57 A;  1TY2 A;  1YNN D;  2NN6 I;  1CFM A;  5A2Q L;  1Z7T A;  3HRZ C;  1PZJ D;  2AQ1 B;  1S5E D;  1LLR D;  3A54 A;  3QO2 A;  4IUP A;  1DOK A;  4X3U A;  3X3M A;  1O7L A;  4C2M B;  4IAL A;  2XRS D;  2TSS A;  1EEI D;  2EYF A;  2PO4 A;  2MHV A;  2ICI A;  2AWO A;  5M5X B;  3PV0 A;  3GV6 A;  4KD4 A;  2EJG C;  2KEC A;  5C5M A;  1F2M A;  2WIN B;  1B9M A;  5FKA C;  2F0M A;  3AB9 A;  1H9J A;  1RDP D;  3E5S A;  3D31 A;  4ODG A;  2PZT A;  5I2Y A;  1TY0 A;  1EYD A;  1JE4 A;  2M9V A;  3HOX B;  2HCI A;  1KAB A;  1D1I A;  1I6V C;  5IOC A;  2JXM B;  2L5T A;  4DAV A;  4C3I B;  3QJY A;  2B2Y A;  2WAQ B;  4RGN A;  1U4P A;  3NWT A;  5D3D A;  1SEB D;  1ZYR D;  1F2Y A;  2K01 A;  4K14 A;  3V96 A;  1KDA A;  1ZKO A;  1BDO A;  4XYQ A;  4OO1 G;  4K6D A;  2IX3 A;  2KQ3 A;  3VR2 A;  5C0X H;  2IL8 A;  1D6E C;  4F7X A;  2CVR A;  4XQJ A;  3D4D A;  4A3F B;  4F87 A;  4IUQ A;  2Q8I B;  1I4Q A;  4R8I A;  4V19 0;  2IWH A;  4G7O C;  3GTJ B;  1SYF A;  3QIA A;  1TWH B;  4RH6 A;  1LTT D;  1VCI A;  1KAA A;  1TS3 A;  1GUN A;  2JA5 B;  3C46 A;  4FVM A;  1VMP A;  3L9A X;  3U9S A;  2B2W A;  5CV9 A;  4XQN A;  3RZO B;  1BCP F;  5M9O A;  2BA1 A;  3GV3 A;  1KDC A;  4MIU A;  3TME A;  2E2I B;  1EY0 A;  4ZQ3 A;  2QCP X;  3LWU A;  5EKK A;  1GJX A;  1D2B A;  1LAB A;  3N6R A;  1SXT A;  4NDX A;  1EIG A;  3NP8 A;  2DNE A;  4QF4 A;  5EGT A;  3KBX A;  1JB3 A;  4QIW B;  2CW0 C;  4DF7 A;  5K36 H;  2M2L A;  3Q23 A;  3O13 A;  3I90 A;  3A8I E;  3P7J A;  3BVG A;  3DMU A;  3URY A;  1O7Z A;  1HFG A;  1HFN A;  4CGY B;  2LS0 1;  5EPL A;  1JOQ A;  5CC4 A;  2IX0 A;  5IT9 E;  3NUC A;  1EWC A;  2OT2 A;  2I07 B;  2A6E C;  2R93 B;  2ZXP A;  2HQE A;  1R9T B;  2VXW A;  1PRT D;  2R3Z A;  3MVV A;  4KV6 A;  3EVQ A;  5D65 A;  1Y1W B;  3IFD A;  2R92 B;  3FVQ A;  4HAE A;  1SE2 A;  2EYL A;  3VR3 A;  1S5B D;  4U67 3;  1CQF A;  3CHB D;  4K8J A;  3TN2 A;  3D4W A;  3P20 A;  1HTP A;  5JVH 3;  1F9P A;  2QF7 A;  4C3J B;  3PUZ A;  1PTO F;  1KNA A;  2L4N A;  1BOS A;  4RWS C;  4K2L A;  2A6H D;  2K05 A;  1PFM A;  2A69 D;  1QE6 A;  3SK8 A;  4S3S A;  4ZKC B;  1HUM A;  1STG A;  3TP7 A;  1HCZ A;  2Z8L A;  1KTK A;  4KKS A;  2N55 A;  3SHL A;  4JBW A;  4DK0 A;  1EY8 A;  3S15 B;  5ELE A;  1A6X A;  5DM7 3;  2F0N A;  4C1N I;  2B2V A;  5C6A A;  4HR7 B;  1U9R A;  2JYO A;  3I4N B;  5CV6 A;  1OXU A;  5J39 A;  2NN6 G;  2IJ0 A;  4LK1 C;  3PUW A;  4BBS B;  1RTO A;  1FNU A;  1SNQ A;  3NWS A;  5G3L F;  3K7A B;  4RKB A;  2ENB A;  3OW7 A;  3PO3 B;  2HDM A;  4R9W A;  4RHS A;  4BA1 I;  2ICE C;  4XTC S;  3T56 B;  4QUF A;  1X3Q A;  3OMG A;  1STH A;  1L0Y B;  1BCP C;  1F9S A;  3NXW A;  2O2L D;  4N9P A;  4HMJ A;  4C1N K;  5I9P A;  5J1Z A;  5JEA H;  3M7N A;  3FPP A;  2EY1 A;  3NBH A;  5CBE E;  5KND A;  3VA7 A;  1G8Z D;  3V05 A;  2KA7 A;  3PUV A;  1SYG A;  1F9R A;  4PMB A;  3BVM A;  4OO1 I;  3IAY A;  1KDB A;  1OXT A;  4KKT A;  1SDF A;  1SYB A;  5T1I A;  2EDG A;  4RHR A;  4G4K A;  3LX0 A;  3CQZ B;  3T4A C;  2JEB I;  4DGZ A;  2K5D A;  4BWG B;  2K6A A;  1CT1 D;  4DK1 A;  3NBI A;  4FNF A;  3NTK A;  1A3U A;  1ESR A;  2VNU D;  3VYT A;  1TWG B;  5FLX E;  3H09 A;  5KYL A;  2JA7 B;  3MXN A;  3S17 B;  1F2L A;  1FD7 D;  3DM1 A;  3HOZ B;  4CHT B;  1RKN A;  4BS9 A;  4P2C B;  3D6W A;  2EVB A;  4U68 A;  2F0Q A;  3WOF A;  3ND9 A;  5C3W A;  2RSO A;  2SOB A;  4IUV A;  5ELB A;  1D5M C;  1ZEQ X;  1XWE A;  1SYC A;  1H9M A;  1GXD C;  1KNE A;  2XVS A;  1HXY D;  4KK7 A;  2A73 B;  3X3N A;  2AQ3 B;  1IHZ A;  5A35 A;  1PTO C;  5ELD A;  2LFN A;  1I4G A;  2PYK A;  2HCC A;  3E6Z X;  3CRL C;  1IYV A;  1ET9 A;  1PTO H;  4MHE A;  2L12 A;  1DXM A;  1MD2 D;  2Z4I A;  1U4R A;  1DJR D;  1EOT A;  4LJZ C;  4A3B B;  1II3 A;  3A8K E;  2Y0S B;  4OHJ A;  3PIO 3;  3MEH A;  2DY7 A;  1TWC B;  2EY2 A;  4FXD A;  2XWB B;  1YNJ D;  5CBA E;  4WRD A;  2E74 C;  1STY A;  4A3D B;  4HSP A;  4Z9C B;  4ZK9 B;  4V0B A;  2EJF C;  1BR9 A;  2MJ8 A;  4RAU C;  5CYU A;  4ILW A;  4RKL A;  1WTO A;  2VB2 X;  1LTA D;  2F4I A;  4B9X A;  4HMI A;  4FYD A;  1DM0 B;  3IKJ A;  2X6L A;  4C3H B;  4KTA A;  1SJH D;  2RQX A;  1B1Z A;  2XWJ B;  4MN3 A;  4XQQ A;  4LAA A;  3RZD B;  1AW7 A;  3K59 A;  2WP8 J;  4DNT B;  2EYO A;  2RSN A;  3CU7 A;  1PMR A;  2A5H A;  2D62 A;  1RTN A;  1E0B A;  3G7L A;  3NE5 B;  3H6M A;  4PMW A;  2K7V A;  1CZW A;  4KHV A;  2E2J B;  2L11 A;  3M7G A;  3MXU A;  2D2C C;  1LTR D;  3UI2 A;  1JWS D;  5CV8 A;  1TVX A;  5IIF A;  1BCP B;  5CMD A;  4RGT A;  1J9O A;  1FNW A;  4FF3 A;  1EZ8 A;  2PZU A;  1UEA B;  1EWH A;  2SEB D;  3A55 A;  1ILQ A;  3A8J E;  1SMY D;  3KLR A;  3S16 B;  1O78 A;  2EE1 A;  1HPC A;  2G9D A;  1DZ1 A;  2H4O A;  3KBG A;  4KI0 A;  1TII D;  5DEH A;  1WTP A;  4L63 B;  1B4O A;  1HUN A;  2F0G A;  1ZYR C;  3J81 L;  3OIP A;  4OIJ A;  2F0T A;  2RDF A;  2SNM A;  4C3J G;  1KLU D;  3MFY A;  3KLS A;  4HTH A;  3ITP A;  2A68 D;  1S5D D;  4FO2 A;  1JIC A;  4FXG C;  1E2Z A;  1OO9 B;  3GTG B;  1AP0 A;  1DCZ A;  1QWY A;  4EGV A;  5BN3 A;  5C3X A;  1TU2 B;  3VYR A;  1GHJ A;  2TMP A;  2HDL A;  2Q8T A;  2IT1 A;  1NR2 A;  1W6J A;  3Q6S A;  5DM6 3;  4DAY A;  3U9O A;  4N9T A;  2B2T C;  3MFG A;  4XT1 B;  4PNY A;  2ZT9 C;  3K6O A;  2B8F A;  4FXK C;  1BNZ A;  3MWY W;  2EYP A;  3HGB A;  2EOT A;  2V4D A;  4H13 C;  1PTO B;  1G6Z A;  3AMU A;  1BO0 A;  3I4M B;  2QKI C;  1ZXT A;  3SK5 A;  1U4L A;  1Y8N B;  4ULL A;  2EPB A;  1FNV A;  3ND8 A;  1PZK D;  3L3O C;  4IUN A;  1Q1E A;  1GUW A;  4FF4 A;  5CV5 A;  3PIP 3;  1WD0 A;  4DFA A;  1C8C A;  5I2X A;  1UAP A;  1B3A A;  1SNC A;  4FF2 A;  1HA6 A;  2FMC A;  4RGM A;  1BUV T;  2WII B;  3QOJ A;  4JK1 C;  4XT3 B;  4BA2 I;  2F1M A;  3RLF A;  3IL8 A;  1CK1 A;  2SNS A;  4UAI A;  4QMG A;  3J7A F;  1EY6 A;  3HG9 A;  4XIG S;  4OIK A;  4GZY C;  1PFB A;  3EJI A;  4G7H C;  2R61 A;  4K5W A;  3Q22 A;  3VYS A;  2JSO A;  3DWQ A;  2O5J C;  5C4X B;  1WTR A;  1AZQ A;  1T5E A;  4OO1 H;  1SNM A;  5COY A;  5LL6 X;  1NR4 A;  1JR0 D;  2F0O A;  5I9O A;  3JAM L;  3GTL B;  3OMC A;  2C9O A;  4C56 C;  1I4X A;  5EBC A;  4Q5V A;  1ROD A;  1Q90 A;  3D6C A;  3K5M A;  4K6L A;  3W2D A;  3K58 A;  3TSS A;  5K5P A;  3P75 A;  3K5O A;  1QOH A;  1H9S B;  1QNU A;  5KNB A;  4ZUJ A;  2NZ1 D;  2BCO A;  2F0I A;  1LTS D;  1O7Y A;  4ABN A;  2L1B A;  1EZ6 A;  3FDT A;  1B53 A;  5LL6 S;  1VDZ A;  3RUZ A;  3DUZ A;  3J80 E;  1QIL A;  5C44 B;  1G91 A;  5E4W C;  1XYI A;  4XYO A;  5EJW A;  5CV4 A;  4HN7 A;  2IPK D;  3HS0 C;  2FHT A;  3RMH A;  3GTP B;  2DY8 A;  3QB3 A;  1MI2 A;  1RCV D;  1EEF D;  2G9H D;  2NVT B;  3TZU A;  4RCN A;  1TT2 A;  1A15 A;  1GHK A;  2PZW A;  4K5V A;  3PMF A;  2A69 C;  4K2K A;  4K5X A;  3L7Z C;  5JOB A;  3IFT A;  2DN8 A;  2JE6 I;  2Q8R E;  2Z1C A;  5FK9 C;  4A3J B;  3HOV B;  2K5W A;  5M3F B;  3DHQ A;  1DYQ A;  3SK4 A;  1OXV A;  5NUC A;  1WTQ A;  1HQM C;  2NYZ D;  3GTO B;  4TQU S;  5AFW A;  1SNO A;  3S1Q B;  2R6G A;  4HED A;  1ILP A;  1EYC A;  2KHS A;  3MZ5 A;  1TS2 A;  4QB4 A;  2BDN A;  1RF2 D;  4PV1 C;  1BBX C;  4KMU C;  3BYT B;  2F0D A;  3T13 A;  4XXE A;  2CW0 D;  2AUK A;  3HZX A;  1U4M A;  5KGU A;  4DXF A;  2A74 C;  3MXP A;  2F0J A;  3QWN A;  4L6T B;  4E6I A;  1G2T A;  1X32 A;  2F0L A;  1SNP A;  3S9W A;  4I7Z C;  3S1N B;  4C3H G;  1C48 A;  4QCL A;  1TWA B;  3S2D B;  2FIN B;  3MA2 B;  2GA4 B;  2CQA A;  4H44 C;  4FF1 A;  1MBY A;  2FFK B;  3F2U A;  2E75 C;  1EQT A;  2LKV A;  3SR1 A;  1I3Q B;  4KN7 C;  1LT3 D;  2PMZ B;  2K04 A;  4CKB A;  5KRU A;  1JOK A;  2MGS A;  2ZXO A;  2F0W A;  2K28 A;  1I50 B;  3I3C A;  2D5D A;  3H91 A;  1I6H B;  1ICW A;  2R7Z B;  1M4V A;  3SEB A;  4B08 A;  1T5X D;  2K5Q A;  4KN4 C;  1H9S A;  3A56 A;  3OWE B;  1EIH A;  2F0H A;  4G7Z C;  1VF5 C;  3SE0 A;  3M3Y B;  4ZAI A;  2NN6 H;  5IGG A;  5CV7 A;  1MSH A;  2Z4H A;  4IFD G;  1QNK A;  1AFP A;  3BZD B;  5KIX A;  4A3M B;  1JWM D;  3GQB A;  1XX8 A;  4FP5 D;  3C3L A;  5IT9 L;  2QEJ C;  2F0U A;  2F0F A;  1A2T A;  1I4P A;  1ENF A;  4QUC A;  1WCM B;  1B2T A;  4ZKB B;  3H0G B;  3WDN A;  1S4Z A;  5C4Z A;  2MPM A;  1J8I A;  3DWP A;  3AU7 A;  3RD4 A;  1WVL A;  5ELF A;  3VR6 A;  1TQO A;  3SVM A;  4ZRZ A;  1QB5 D;  3QG1 A;  3HOU B;  1A3T A;  4NKL A;  1JC7 A;  1BCP D;  3J7A V;  4C3I G;  3M85 A;  3KLS X;  1CA5 A;  4O1N A;  2LMC B;  1Z6H A;  1S5C D;  4DN4 M;  5A2Q E;  2NVX B;  2EYJ A;  2BDO A;  2L0C A;  2EYH A;  4WFN 3;  3MAQ A;  2XN9 C;  5DNF A;  2KVM A;  1F2Z A;  3OWF A;  1Y8P B;  3S2H B;  1LT5 D;  1SND A;  2NWG A;  1IW7 C;  3J81 E;  2B2T A;  3D4R A;  2B2U C;  2OF1 A;  2RBM A;  2E2D C;  2KCC A;  5FO8 B;  1MSG A;  1H9K A;  2RA4 A;  4DAP A;  5M3M B;  2DNC A;  1EY9 A;  3FEW X;  5F2D A;  3C1E A;  2BE5 C;  3HP3 A;  2AWN A;  2WKC A;  1R4Q B;  1DON A;  1EY7 A;  3T53 B;  4A93 B;  1XTC D;  2WAC A;  1FR3 A;  1K83 B;  1FYC A;  4A3G B;  2AUJ D;  1F77 A;  3S14 B;  4KY5 A;  1E2V A;  3GD7 A;  1YNN C;  4LMQ D;  4J8Q A;  4WOR A;  1PTO D;  1K8O A;  1G29 1;  4RGO S;  4IFD J;  2PW5 A;  2YU9 B;  2KEE A;  1ESF A;  1STE A;  5FO7 B;  5JVG 3;  3ERQ A;  1SE3 A;  1A2U A;  4K8I A;  5T1G A;  4IUT A;  1TR5 A;  5EKI A;  1NSN S;  1LTG D;  4IQZ A;  1PDQ A;  2SDF A;  2NTT A;  3BYY B;  3M4O B;  1PRT F;  1CQV A;  3QOL A;  4J1M A;  1W6K A;  4DA2 A;  2A68 C;  2J7Z A;  3MXG A;  4RA8 A;  4X3S A;  2VB3 X;  1QJO A;  3HKZ B;  2BA0 A;  1JOR A;  1Q3L A;  2PPB C;  3TP6 A;  4DNR B;  2OXP A;  3HEJ A;  1V1O A;  4HCE A;  1S5F D;  3OIQ A;  3FPU B;  4BY1 B;  4Y7N B;  1SYE A;  2EY6 A;  5G3L D;  1K8M A;  1F9Q A;  4J6H A;  1LV9 A;  2PQE A;  2NB0 A;  2X6G A;  4Q0F A;  5C4H A;  1EFI D;  2WKD A;  3T16 A;  2J4X A;  2KED A;  2RKS A;  2AQ2 B;  5EPJ A;  5FOB B;  3FMC A;  4ME5 A;  3R2T A;  1RHP A;  3HOW B;  1TKW B;  3NHH A;  1SBB B;  4CBV A;  1OXS C;  1JCK B;  1X3P A;  2E76 C;  5C3E B;  4IFD I;  3NSW A;  2F0K A;  2K03 A;  1OXX K;  1V8Q A;  5TSS A;  3D3R A;  3I4L A;  5E1F A;  3OHX C;  2KCN A;  1ONL A;  1ET6 A;  2FMM A;  5C0X G;  5EKL A;  1LTI D;  4IUU A;  4H7B A;  5KYI A;  2O4X A;  1GUS A;  4X3T A;  2EY5 A;  2NVQ B;  3H94 A;  3PUX A;  3LNN A;  2K33 A;  2N88 A;  1GUO A;  5E4X A;  1QG7 A;  1AN8 A;  4EQO A;  1NUC A;  1HRJ A;  1WTV A;  3H3V C;  3A7L A;  1HTL D;  5ELC A;  3EFX D;  4M8A A;  3K0Y A;  3OSO A;  3ONA B;  4F88 A;  4PMC A;  2L9H A;  4KHZ A;  5DAU A;  2JP1 A;  1WD1 A;  2FJ2 A;  1RJT A;  3N52 A;  1Q8I A;  4RFB A;  3TP8 A;  3NPP A;  1L0X B;  4ZUI A;  1HHV A;  4CJ2 C;  1PXU A;  5IGE A;  5JPN C;  5M5W B;  1LTB D;  1NCV A;  3S1M B;  2MP1 A;  2X69 A;  1VMC A;  3R8B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...