1G8ZD

His57ala mutant of cholera toxin b-penatmer
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
103
structure length
103
Chain Sequence
b'TPQNITDLCAEYHNTQIHTLNDKIFSYTESLAGKREMAIITFKNGATFQVEVPGSQAIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAISMAN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHOLERA TOXIN B PROTEIN
publication title A mutant cholera toxin B subunit that binds GM1- ganglioside but lacks immunomodulatory or toxic activity.
pubmed doi rcsb
source organism Vibrio cholerae
molecule tags Toxin
total genus 26
structure length 103
sequence length 103
chains with identical sequence E, F, G, H
ec nomenclature
pdb deposition date 2000-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01376 Enterotoxin_b Heat-labile enterotoxin beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1g8zD00
1LTAD 1QILA 4OHJA 5ELBA 1JQYD 1FNWA 2R61A 1PZID 2CHBD 4O1NA 1PTOH 3BVZA 1S5CD 3TSSA 2AQ2B 1PTOC 4ZYSA 1LO5D 3BYYB 1PZKD 3BVMA 5D3IB 3R2TA 1ET6A 1BCPC 1I4QA 3BZDB 1TS4A 1PTOB 1HTLD 1RDPD 5ELEA 4DXFA 1D5ZC 1S5DD 1FNUA 1KTKA 1BCPB 5FK9C 1PYWD 1EEFD 1TY0A 1PRTD 2G9HD 3O13A 1CT1D 1JWSD 1EU4A 1UNSA 1LTSD 3R2IA 1PZJD 4K6LA 1TY2A 1CHPD 2AQ3B 4TSSA 1CQVA 1CHQD 4RH6A 1EWCA 1BXTA 4UDUC 1JR0D 1SBBB 2XN9C 3CHBD 3EA6A 3SEBA 1LTBD 3BVGA 4RGNA 4BWGB 1SEBD 1RD9D 2IPKD 5ELCA 1LTID 2O2LD 4L6TB 2J4XA 1MD2D 2IJ0A 1LTTD 4DXGA 1ESFA 1GOZA 1SJED 1KLUD 1LT3D 4RFBA 1I4XA 3MC0B 1B44D 2SEBD 1PRTC 4RHRA 1DYQA 4RGTA 4Z9CB 2RDHA 1PTOF 1FNVA 1LT4D 1V1OA 4RGMA 1L0YB 2AQ1B 3KLSX 3BYTB 1PRTB 4C56C 1BCPF 2ICIA 1G8ZD 3OWEB 1B1ZA 1SXTA 1RF2D 2WV6D 2RDGA 1SE3A 1LT6D 1S5BD 1TS3A 3V05A 4L63B 1HXYD 1SE4A 1TS5A 1D5MC 2XRQD 2Z8LA 1LT5D 5TSSA 3MFGA 1T5XD 1LTGD 5ELDA 4RHSA 3URYA 1V1PA 1S5FD 2QILA 1I4RA 1KLGD 1V1PB 1S5ED 2XRSD 2QEJC 5ELFA 1PTOD 1D6EC 5I4DA 1SE2A 1FGBD 1EEID 1ET9A 1LTRD 4RCOA 1ENFA 1HA5A 1LLRD 1UUPA 1TS2A 1BCPD 1DJRD 3R8BA 2XNAC 1I4GA 3DWQA 1EU3A 1I4PA 1STEA 1JCKB 1XXGA 3EFXD 5D3DA 1M4VA 1D5XC 1AW7A 3DWAA 1EFID 1AN8A 1JWUD 1JWMD 2TSSA 1RCVD 3GP7A 1XTCD 1L0XB 1PRTF 2NTSA 3W2DA 1I4HA 5FKAC 1HQRD 3DWPA 2NTTA 4RGOS 1SJHD 1FD7D 1CK1A 1F77A
chains in the Genus database with same CATH superfamily
4G57A 3J80c 1BVSA 4AQYQ 2F0KA 1QZHA 2R61A 5FLXE 4X65L 4V0BA 1ZYRC 1RKNA 2JEBI 1N32L 3U9OA 2CW0D 4YHHL 2L4NA 3J81i 1PTOC 5C4ZA 4QUCA 2ZXOA 1TWAB 5D3IB 1CZWA 1S4ZA 3DEOA 4B3RQ 3G71A 2R92G 2D62A 5EBDA 2R7DA 3S1RH 2IT1A 3SDZA 1B53A 4Q5VA 3HP3A 1G2TA 1WVLA 5LL6X 2HCCA 1K3BC 4UP8A 5GADC 1J9OA 3W5OA 2MFIA 1QZGA 3RR5A 1K0RA 4DK1A 2A6HD 4KK7A 2PZTA 2Z9HA 5COYA 1X6OA 1FR3A 4E6IA 1LTBD 2EJGC 1XPUA 3TQYA 4C3JB 1GHKA 2N78A 4LF9Q 2OXPA 4JI7Q 2EPBA 2O2LD 3K57A 2YU9B 1LTTD 4KV6A 4QJFA 1CA5A 3GTOB 4BY7G 2PW5A 4DK6C 1PYSB 4IPDA 2R7ZG 4RHRA 3B6YA 4Z9CB 2RDHA 4LF5L 2SDFA 4RWSC 5KNCA 4AIMA 4OL7A 1KNEA 2C35B 1O7YA 3P1HA 1S5BD 4DR7L 1TWHB 5LMUQ 1NNXA 4HJ8A 4UAIA 4A3JG 5ELDA 4DV6Q 4FXKC 4A3KG 1G2SA 3CCUA 5G3LD 1W6KA 1PH6A 3MWYW 3OMCA 2G5DA 4AQYL 3D3RA 4KTAA 4DUYQ 4LFCQ 3NSWA 1A62A 2Q8TA 2F0UA 2YYZA 3F8TA 1LM0A 1NSNS 3QWNA 1QE6A 1JT8A 4A3BH 4QL5A 4YCUA 5CV4A 4KY7A 1MBYA 3TP7A 4B3RL 2R92H 5D3DA 5M3FB 3PF4A 3KOJA 1VQPA 2K5VA 1EFID 2PW7A 3K8AA 1SDFA 1SNPA 1JJGA 4B3ML 2RF4A 1LTAD 3UDIA 5ELBA 1IKMA 1FNWA 1E2VA 2KBNA 1I3QH 2CHBD 4R4CA 4ZYSA 2OQ0A 5CV6A 3BVMA 1HUNA 5IGBA 1XPOA 4LF9L 2KJXA 2F0DA 5IOCA 4JI7L 1JORA 2Q2UA 3OW7A 4BY7H 1HJPA 3L0OA 1QG7A 5JAVA 3FPPA 2IL8A 1UE6A 4CDDC 3J81L 4JI2Q 4FO2A 4A93B 2R7ZH 5DLQE 1STYA 4DV7Q 1EIGA 5EAYA 4HJ9A 3H09A 4KMUC 3K7UC 1HA6A 3M9BA 5M3MB 2YTXA 1EY0A 3W1BA 5C3WA 2A6EC 2D0OA 4ZAIA 3GV6A 5IY0A 4GOPB 4LWCA 3KLRA 2IW3A 2WKCA 2NVYB 4X3UA 4K2LA 4A3JH 5M5XB 1OXTA 1SN8A 5LMUL 4A3KH 1TWCB 5G3LF 4DV6L 2UXCQ 5IGCA 1NMFA 4LFCL 1JE4A 3CW2C 4DUYL 2QA4A 3OWFA 1FJGQ 3SHLA 1TXYA 3MHBA 1B1ZA 1X56A 3SK5A 3I2ZA 1SYGA 3GTQH 4FNFA 5C3EH 3BZCA 3S15B 5LMNQ 2BOSA 4EQNA 2HCIA 3E9IA 4C3HB 1SE4A 1UE1A 5CC4A 1VQ8A 3N6RA 4KJOA 4HEDA 5HGTA 3URYA 1E7ZA 4OWWB 1QB5D 2Z0SA 2QILA 1Z47A 3J7A5 5C4XB 1I4RA 4BBSG 5I4DA 5CGKA 1LTRD 5BN3A 4LK1C 3GTPH 4JOIA 5CBEE 1DONA 3M4OB 2N3SA 5IP9G 3S2DB 3JC66 3QOLA 4IALA 4BBRB 5I9PA 3RN5A 1OXXK 3F2CA 3L7ZC 3A0JA 2EQSA 1EY5A 3G7LA 1K8OA 1KRSA 1OO9B 1TWGB 1YNJC 3S16B 1DGSA 4JI2L 4JI6Q 2EY5A 1FD7D 1U0LA 2H1EA 4KHPQ 3HG9A 3CQZB 2JQOA 1SNMA 4I7ZC 1PTOH 1HUMA 2Y0SB 1ASZA 3GTKH 3TZDA 1D1KA 1PFNA 3I4OA 1TIID 4OIKA 3BZDB 1EOVA 2BH8A 4M8AA 1GVPA 2DY7A 4A4IA 3HOVG 1RJTA 4GKKL 1TY0A 4BA2I 1SYBA 3A74A 4DUZQ 5C0XJ 3H91A 2UXCL 1A3VA 1TU2B 1GUSA 2F0MA 2RA4A 2JA7G 4JI3Q 4X64Q 3G6JB 1FJGL 2IHFA 2YV5A 3K59A 4JK1C 2PYKA 1PH3A 3PV0A 2JN4A 5LMNL 1C8CA 3STBD 2O5JC 1OTCA 4PMWA 1ICFB 1A0IA 4I65A 2B2TC 2ZJQA 4WJ4A 1E22A 4R8NA 1SE8A 2CFMA 4V190 4BBSH 4N9TA 4FXGC 4OWXB 2I0QA 5DM63 3HGBA 4A3MG 3H94A 4AYBE 1HQMC 3PO2B 5IP9H 3FKIG 2ZXPA 2A68C 3PUZA 1CA6A 3E6ZX 1X32A 3WOEA 4DGZA 3HOUB 3RZDH 5LMNW 4KHPL 3IFTA 1B8AA 1MJEA 4QCLA 5D65A 3KYHC 3QG1A 5AJ3Q 2QDLA 1TS2A 2H4OA 3I73A 2JEAI 3LX0A 2SNSA 2XSCA 3A54A 1STEA 3QR8A 4MZ9A 2JA6G 3CKIB 5FLXL 3HOVH 1ILQA 4GKJQ 1K83H 1H9RA 2CVRA 4DV1Q 1AW7A 5I6YA 4LF8Q 3D4DA 2AWOA 3E9HA 4CGYB 1XTCD 2IHEA 3C1FA 2F0FA 4XQNA 1CTMA 2B63B 4DUZL 2HDMA 1TQOA 1LUZA 3MXUA 1IYVA 3K6OA 1SFOH 1QOHA 4PG3A 2UXDQ 2PZUA 4JI3L 3JAMi 3E3XA 3GDEA 1VQHA 2V1CC 1TS4A 4A3FB 4UPAA 4X6AH 3CC2A 5IGFA 5CV5A 3L3OC 3RUZA 2ES2A 2WP8J 1YJWA 3EROA 1Y1VG 3KF8A 4Y52H 1PRTD 2E2IH 1GXDC 5CBAE 3HOYG 3DHQA 1EOTA 1X3GA 4A3MH 1MGSA 4TQUS 3WDNA 1HR0Q 1EIHA 1CQVA 3PIP3 1WCMG 4RH6A 1BXTA 1HPCA 3NPPA 4KY5A 5IGEA 3NWSA 4LFBQ 2K5NA 3GTLH 1SR3A 2J4XA 3GTGH 4DXGA 1FYCA 1SJED 4A3EG 3D4WA 2KHSA 4J6HA 4DV5Q 3H0GB 4N9PA 2ASBA 2MPMA 3QJYA 3TREA 3BYTB 4LJZC 3U4ZA 1PRTB 4I7AA 2ICIA 1PH2A 1BR9A 1IXRA 1VQLA 3H15A 3U9SA 1N34Q 1PA6A 3EN2A 2JA6H 1ENCA 4JPBW 2ZM6Q 1KDBA 4GKJL 3PO3H 4DV1L 2PI2A 3IFDA 4LF8L 4AYBB 1BKBA 1YITA 1VS0A 3VR6A 4RHSA 3FRPB 4DR4L 1EZ6A 2R93B 5M5WH 4K5XA 4ZCKA 1TKWB 1VMCA 2UXDL 3M3YB 4HAEA 3J81j 1E1TA 3BG3A 4H0LC 2EXZA 3TS2A 2MNAA 1KL9A 1G51A 3L9AX 3FP9A 2NVQH 2KCMA 1Y1VH 1AN8A 4ZLTF 1EIFA 3L2PA 4DU9A 4NP5A 1I94Q 1PRTF 1G6PA 2K52A 2KENA 1SJHD 3P75A 1SROA 1WCMH 5JJLA 1P16A 1H9JA 4WORA 1EY8A 3VR3A 3BVZA 1BOSA 4B3SQ 3TEHB 1DOLA 1HHVA 2VB3X 3I7FA 4A3DB 3A55A 4MIUA 1HFNA 4Y7NB 5KNDA 1IW7C 1ET6A 4R1JA 3OTOL 5ELEA 1PYBA 4LFBL 1S5DD 1FNUA 2KHIA 1U4RA 4A3EH 5IGDA 1OXUA 1Y8PB 4DFAA 1WTHA 2F52A 2RCFA 4DV5L 4DA2A 3SK6A 3KLWA 4OX9Q 1TR5A 4R4OA 1EWCA 4IOCA 1AZPA 1HZAA 5IWAQ 4YCWA 3U4VA 1N34L 1VQ5A 4ME3A 1NUCA 4DV0Q 1B2TA 2A74C 4CJ1B 2ZM6L 3S1QB 1PFSA 2Z6BA 1V9PA 4G7OC 4K2KA 3K58A 2B2VA 3MC0B 2JJQA 1HRJA 1PH5A 4QIWE 1SNCA 3KF8B 3ERQA 4DAMA 1DYQA 4N8FA 5E1FA 1V1OA 3RZOB 2E2HB 2GN5A 3GTJH 1EZ8A 2EYFA 2D5DA 1H9KA 4WRDA 3PCOB 1VQGA 4EQ5A 3CCSA 1F2ZA 5CORA 1R9TH 2X69A 1CM9A 3K5OA 1X65A 2I5MX 1I94L 2YTYA 2EZVA 4EVOA 5NUCA 3KFUA 5DEHA 2HQLA 3DMUA 2F0JA 2HQEA 3PGZA 3M4PA 1JCKB 1U5KA 2I46A 2NVTB 3HOXG 3I4MH 1D5XC 5HGQA 1E0BA 2XTIA 1QCBD 3D8GA 1ILPA 4RMFA 5IT9L 2NVXH 2ZTDA 1E3PA 4C2MB 4DXFA 4KHVA 3S1NH 2JA5G 1QILA 1NY4A 1SYDA 3T51B 2XWBB 3SK8A 3ZYYX 5EPJA 4OX9L 2VXWA 1PLFA 4B08A 3I55A 5IWAL 3AB9A 5E4WC 4DV0L 3FPUB 2DNCA 5EBCA 1IZ6A 4CJ0B 1SMXA 3VYSA 2E2JB 4DR5Q 5GAEC 4IFDI 4XQQA 3T4AC 4B9XA 1KD1C 2QKIC 5M3MG 1YJ9A 4HJ5A 2VUMB 2A5HA 1R4QB 3F2UA 4ZKBB 2B8GA 2JYOA 3HOZB 1D8LA 1HNXQ 5C0XI 1YIJA 3I70A 5H1SE 1L1OB 4GOPA 3T1HQ 2Q2HA 3ND9A 3J80E 4LUVA 1B70B 1KRTA 4F88A 3N52A 1O7ZA 2HHHQ 4QY7A 3NQIA 1C0AA 2L15A 3NTKA 3STBC 2A69D 5D14A 4ZRZA 2HT1A 4DNIA 1GUNA 5IE8A 3CP0A 1Q12A 1T5EA 2L12A 4UHVA 5C44B 1L2FA 1EYGA 1F9QA 4YCVA 3MXPA 3I91A 4X62Q 3TMEA 4C3IB 2B29A 4QIWB 3HOXH 4EQPA 3VR4A 3HRZC 3I4MB 3BDOA 3MFGA 4A3GG 1H95A 2PCFB 2L9HA 5C6AA 2EYMA 4DR1Q 1UAPA 3NELA 3PIPA 1WTRA 1Q8KA 1TWFB 4JOIC 3H3VH 1UUPA 1VQCA 2DY8A 3R8BA 3PUXA 3K0YA 2N49A 3SK4A 3S1MB 3D0FA 5HY6A 2WKDA 1IYJB 3P7JA 1ASYA 2LKVA 4TVAB 3BZKA 2VQEQ 4CKEA 3I4NH 3TBIB 5EQ0A 4R8IA 4IUQA 5EJWA 5M5YH 4ZUJA 4DR5L 1MHWC 4A3IB 1H9SB 3KF6B 2Z6KA 2TMPA 1EFWA 2J0TD 1J6QA 3WWVA 2L1BA 4FP5D 4JG2A 2CWPA 2NN6I 4LAAA 1U4LA 1LO5D 1HNXL 2O5IC 2RKSA 2IY5B 3T1HL 3VA7A 2QF7A 2GVAA 4KKTA 3CCVA 3Q23A 1KAAA 2HHHL 4PMCA 1GUGA 3GTMH 4APVA 1GUOA 2ZTEA 1EY6A 1EYCA 4DK0A 2ZJPA 1CQFA 2F0OA 2K5WA 4RA8A 2F03A 4DV4Q 4HIMA 1TY2A 5IIFA 3S1RB 5L37A 1HNZQ 4DKAC 2FFKB 3KBXA 5CV7A 4IJLA 2CWAA 1SNOA 3S14H 5A2QL 1I6HH 4IN3A 3D4RA 1NCVA 4X62L 2MP1A 4JBMA 1M1KC 5E7NA 1AE2A 5ELCA 4HIKA 2KCNA 4JCVE 5FO7B 3MEHA 2KCCA 4DR1L 1D2BA 3PO2G 2DN8A 4IPGA 2F0HA 2DUDA 1QVFA 3J7AF 2OWOA 1K73C 4CDCC 4HCEA 2KEDA 4A75A 1FL0A 1NMGA 4K8JA 1RF2D 1M90C 4KY6A 4O2DA 4J15A 2VQEL 4GLXA 1BNZA 4L63B 1LACA 2K4KA 2M00A 4TKOB 4YY3Q 1E1OA 3BDCA 5IP7G 3DLLA 3JAMc 4HIDA 3S17H 4LF7Q 3SE0A 1V1PB 2L0CA 1CSQA 4POGA 4PNYA 1R4PB 2OCEA 2K01A 4CDFC 2VNUD 1BCPD 3NUCA 3NQTA 4UP9A 3I4LA 1VQIA 3J7AV 1SRUA 2L11A 3A7AB 1TT2A 1XXGA 4IPCA 3UI2A 2L55A 1PH9A 4A3BB 2B63G 3TRZA 3HKSA 2DJFC 1VQJA 4JBWA 1NR4A 2D9UA 4QGUA 4OO1I 1XNRQ 1L0XB 3CC7A 2R92B 3W2DA 4RGOS 1VQ7A 4HMJA 4FF3A 3A5ZB 4DV4L 1DXMA 1HNZL 1VQ6A 3TSSA 1GD7A 2NWGA 3J80i 3R2TA 1SSOA 4O0AA 1I3QB 2UUAQ 1LTLA 2PNRC 1RHPA 2MQHA 4BA1I 1I50H 1BCPB 1B4OA 2LS01 1K8MA 2M2LA 1G91A 3M7GA 1STAA 3VYTA 2VL6A 2K7VA 1Q86C 4BY7B 5DNFA 4DV7L 3EQLC 1WYDA 5EGTA 2K03A 1CHQD 1GKHA 1PH4A 2MUYA 2R7ZB 2EY2A 4YWLA 1C7YA 3OIQA 1RL2A 2QGQA 4NKLA 4XQJA 1V1QA 4K5WA 4GN4B 4RG1A 2XWJB 1SYFA 5C3XA 4IFDG 5IT9E 3MZ5A 3F2BA 5IP7H 1ESRA 4YY3L 1EIYB 3H0GG 2F0SA 5IODA 1KLUD 4ODGA 2LMCB 2VW9A 5T1IA 5C0XG 4LF7L 1S72A 1A2TA 1LT4D 4ILWA 3ULPA 4A3JB 3KLSX 4A3KB 2QDBA 1EY9A 1BCPF 1G8ZD 3UDGA 4DAYB 1BF4A 5JPNC 3I90A 4WJWA 4X3TA 1TS5A 2R93G 4OXPA 3GTQB 5C3EB 3K7AH 1XNRL 3NXWA 1WTVA 1T5XD 1DOMA 1KDCA 3F1ZA 2K5HA 1KHIA 1ZYRD 4YWMA 2X6LA 4EQOA 3CRKC 1PTOD 4IURA 4LW1A 3CCRA 1LLRD 1VCIA 2B2UA 2XNAC 1X3FA 1ICWA 3HKZG 1EU3A 1OXSC 2UUAL 1A2UA 3LGJA 3GTPB 4BY1G 1VQMA 3H6MA 1SMYC 2QW7A 5BN5A 3GP7A 2F0QA 1QWYA 3D6WA 4HIOA 4K0KQ 2JA9A 2J7ZA 4BS9A 4JI6L 1QNKA 2RBMA 5JVG3 3I72A 2F0VA 3QB3A 4MNOA 2EE1A 2KECA 3I8ZA 2C5CA 4ZK9B 2ENBA 2CKZB 4BXXG 4IFDH 1PTOB 3A7LA 1YNNC 1LV9A 1EYAA 4DR2Q 3GTKB 4FF2A 2EJMA 3CCQA 2F0GA 3CMEA 4DNRB 1BO0A 4XDXA 1A63A 3J80L 5AFWA 3UDXA 2NN6G 1RODA 3Q0AA 4DV3Q 3HKZE 2JA7H 2WINB 2E5LQ 2PQEA 1QJOA 3D6CA 4LF4Q 1JR0D 1S3OA 1H9MA 2F3VA 4PZ8A 4X64L 3BVGA 3RMHA 2VZAA 2CW0C 2R3ZA 3PIO3 4N8X1 1SEBD 3VR5A 2HDLA 2ALYB 2B3GA 4L6TB 2OT2A 4LUZA 2F4IA 2B2VC 1O7LA 1BBXC 3ER0A 2A69C 3G4SA 5JJKA 2F3WA 5CR3A 2EVBA 2WACA 2SEBD 2ZT9C 4C1NK 3MXNB 1PTOF 4RGMA 3KDFA 4YWKA 2QEXA 2BA0A 2A6HC 1MIUA 4BBSB 3S9WA 4JI0Q 1Y1WG 3HOWG 3FKIH 2K05A 2RVLA 2WV6D 4BY1H 3EBEA 3RLOA 2N8NA 5JJIA 1KXLA 2IWHA 2CH4W 1IBKQ 1V8QA 2EYOA 1X54A 2MHVA 3G48A 5KRUA 5J39A 4K0KL 1JOOA 4F87A 2WAQG 5A2QE 1LYLA 4MHEA 1YI2A 4KJNA 1AP0A 3RZDB 2A8VA 4L8JA 1SNQA 5KYLA 3K5NA 5AJ3L 2JXMB 4BXXH 4HN7A 1I4PA 4DPGA 2ATWA 3EFXD 3NTIA 3T56B 4DR2L 1VQ4A 4O42A 5EPLA 4RKBA 4FYDA 5I6WA 1EYDA 3HOVB 2NN6H 1K28A 1K83B 1O78A 2PQAB 3I56A 1N9WA 3J81c 3DUZA 3R3OA 4DV3L 2KEEA 2JA8G 2MO0A 1BBWA 1EUJA 4H13C 4HJ7A 3PF5A 2E5LL 4GZYC 3FHWA 2A6ED 4L5TA 4LF4L 2AHOB 1VQKA 2JA7B 2NZ1D 2DGYA 5BN4A 1SFOB 2WB1G 2RQXA 2VQFQ 4OO1G 1IKLA 2B39A 1D5ZC 1NTGA 5JVH3 3RD4A 3EIVA 5FK9C 1EEFD 2B2YA 1X9NA 5C4JH 3O13A 3T13A 1PFBA 1BBUA 1MI2A 3HOYH 2ID0A 3S2HH 2F0PA 4WFN3 1BUVT 2AQ3B 2I5HA 2E2IB 1HR0L 4UDUC 4HJAA 3NHHA 1L1OA 1BQQT 4GOPC 1Y1WH 4Q0FA 2Q2TA 3HOWH 4RGNA 4BWGB 1IYUA 5JEAG 4A3MB 4JI0L 3EVQA 1PH8A 1Z6HA 1HNWQ 4HSVA 2IJ0A 1XMQQ 3FKIB 1EL0A 1VQEA 4ZQ3A 4IJHA 1IBKL 4R4IA 1LT3D 4B9WA 3IKJA 4ME5A 4FF1A 4L5RC 3GTLB 1HZCA 2EYPA 1XYIA 3GTGB 1QUQB 4FVMA 1MSGA 5JOBA 4X3SA 4RGTA 4KN7C 3TN2A 2KVMA 2WB1E 4C3JG 2BH2A 5I9OA 1IBLQ 3A5UA 1NBWA 3K80C 2K28A 1HZ9A 1HTPA 1IHZA 3PUYA 1HR0W 2Q8RE 3A8KE 2BDNA 1YNJD 4KKUA 1JOQA 4R9WA 2JA6B 1GO3E 2KOLA 3PO3B 1WD1A 4AH6A 2JA8H 1X55A 2MJ8A 2AUJD 3HS0C 3ITPA 1ENFA 1HA5A 2JE6I 4A76A 1DJRD 5M5WB 3DWQA 4P71A 3KDFB 1STHA 3Q8DA 4JVZA 4OO1H 1DOKA 4DAPA 2VQFL 1HZBA 3NENA 1ONLA 2OF1A 2EXDA 1JB3A 1C9OA 4DV2Q 2EY1A 1A3TA 1RCVD 1EY4A 1H9SA 3KF6A 5F2DA 4ZUIA 2Z6KC 1QNUA 1JOKA 2NVQB 1Y1VB 3VR2A 4H44C 1TWAH 3J7YW 3MVVA 3U58A 5I2XA 4QB4A 4B3TQ 4B3SL 1O80A 3EJIA 5JEAH 5M3FG 1AFPA 3NWTA 1WCMB 4XTCS 3HFZB 1Q1EA 2F0LA 1KTKA 2OEOA 2PPBC 1HNWL 3A8IE 2LY7A 4MTKA 3K81C 2LFNA 4JC0A 1WI5A 3UE0A 1Z9FA 4U673 2RSOA 1RTOA 2FMCA 1CKOA 1PV4A 4A3EB 1DZ1A 1PH1A 5EKKA 1ZKOA 5E4XA 1CUKA 4C3JH 3S24A 3MEFA 3C2PA 3RN2A 1IBLL 3KK7A 1P8LA 3ERSX 2YU9H 3SVMA 2A68D 2RHQB 3GTOH 3TP8A 5LL6S 5FJ8G 3MTSA 2E74C 1MD2D 4A93G 3GQBA 3KLSA 2XGTA 2RCNA 1STBA 2R6GA 3MAQA 4RFBA 4P73A 1B44D 1NJIC 3P20A 3DXJC 1A3UA 5GAGC 1VF5C 1FNVA 1L0YB 2E75C 1II3A 4G7HC 3QIAA 4IOAA 3IRBA 3GTJB 5LHY1 1U4PA 1TWHH 2RSNA 2KCTA 4JBKA 1TS3A 3V05A 1JE5A 2K14A 5FLXc 2M9VA 4DV2L 1XPRA 1N33Q 4DR7Q 4JI5Q 3ICEA 5TSSA 3SXHA 3M85A 2FMMA 2XVSA 4PV1C 1R9TB 1V1PA 4GLVB 1VQBA 5T1GA 1KLGD 1DCZA 1FGBD 1CKNB 2Z1CA 3DM1A 1YVCA 5GAHC 5M3FH 4G7ZC 4B3TL 4LNQA 4A3BG 1G291 1K8GA 3PIOA 4C3HG 2UUCQ 3CPFA 1WOCA 2B2WA 2F0TA 3CCJA 1B3QA 3TP6A 3VYRA 2D2CC 2JSOA 3BS1A 5FO9B 1O7IA 3PUWA 4IPHA 4R4TA 5FOBB 5C4XG 3W1GA 4B3MQ 3OYYA 2F4VQ 3C46A 2XN9C 2JA5H 4OHJA 1JQYD 2YTVA 5EKLA 3OPOA 2NVXB 3S1NB 1X3EA 3V96A 1IBMQ 3BYYB 4BBRG 1XNQQ 2FHTA 2CQOA 4IUUA 3Q24A 4FXDA 1E24A 4C1NI 3K5MA 5FJ8H 1C4QA 3MFYA 3W3AA 1E2WA 1V43A 4A93H 3NE5B 2NB0A 2DJGC 4GNXA 2G9DA 1KDAA 2F0WA 1UNSA 5M3MH 1EU4A 1Q1BA 2Y0SG 1VDZA 3C3LA 2BA1A 2Q2IA 3DM3A 5KIXA 2HIVA 1WTQA 4IUPA 2NVYH 4GS3A 4IUTA 4IUVA 1VQNA 1CFMA 5M5XH 2ZTCA 2A1AA 1KABA 3KUPA 1TWCH 3CPWA 1JJCB 1B50A 4U68A 1N33L 4JI5L 3OSOA 4PMBA 1W6JA 1MSHA 3PQIA 1PRTC 4JI1Q 5K5PA 3OMGA 1WTXA 2ICEC 2LSSA 4DAYA 2HD3A 3S15H 2HIXA 5GROA 4C3HH 1FGUA 1Y14B 1YBYA 3OOCA 2UUCL 5C3EG 1WTWA 4NMZA 2IX0A 1D1IA 1LT6D 4CHTB 4JV5Q 4QUFA 1K0SA 3PUVA 3TP5A 1GJXA 5BR8Q 2KA7A 1Q90A 2Y0SE 4DK3C 4RKLA 5C4XH 3HOXB 4A3GH 4MN3A 3KBGA 1PXUA 2F4VL 1PDQA 5KNBA 3F2DA 4HTHA 2JP1A 1B9NA 1RTNA 5ELFA 3TS0A 3IAYA 3M4OH 2B2UC 1ET9A 4GLAC 3S2DH 2JA5B 4BBRH 1IW7D 4DR3Q 1Q3LA 1IBML 1XNQL 1TWGH 3S16H 1EQTA 5K36G 4XIGS 3HOUG 3AU7A 4DAVA 2A19A 1X3PA 3DWAA 3CQZH 4OGQC 5I2YA 3CXCA 2TSSA 4JI4Q 1Q81C 1I5FA 2F0IA 3SGIA 3DWPA 2N55A 4XT3B 1K3RA 3IL8A 5C5MA 3I4NB 2AMCB 1VF7A 5M5YB 1L0WA 1EWHA 1N36Q 2GVBA 1CSPA 2AQ2B 4A3CG 1NR2A 2H5XA 3JAME 5C4HA 1FVIA 2OTLA 2K5QA 4PZ6A 1I4QA 4KLKA 4QQBX 3GO5A 1A15A 1RDPD 1KC8C 4GKKQ 2EDGA 2DNEA 1KIXA 2PO4A 4M1UB 1XJVA 4NXMQ 2QCPX 3T1YQ 3GTMB 3R2IA 3ONAB 2FINB 4X3KA 1VQFA 3AMUA 1PZJD 2O4XA 1PH7A 4JI1L 2K6AA 4XYQA 2WIIB 4NXNQ 5JJZA 2VS1A 3K0XA 3OW2A 1SBBB 4A3FG 4FF4A 4K14A 2R7FA 4DN4M 5JPMC 1RD9D 3E0JA 5FLMG 1S40A 4HR7B 3M4QA 4TRDA 1TVXA 3CMAA 3S14B 2K5DA 4JV5L 1I6HB 1ESFA 3BDLA 5BR8L 5ELOA 4KN4C 2EYLA 1SAPA 4HSPA 4ABNA 4P72A 2BE5D 3MXNA 4GNXB 3AEVA 1UE7A 5ELNA 3PO2H 4A3GB 3DEPA 5KYIA 3ULLA 1F2YA 4KI0A 4C56C 4DR3L 4ID6A 3VA5A 5K36H 2OQKA 1T9HA 3HOUH 1ZEQX 2RDGA 1HXYD 3KJOA 4MTNA 4JI4L 1QVGA 4NW2A 5IYCG 5EPKA 1UEBA 1VMPA 3T53B 5DAUA 3X3NA 5IT9c 2ZJRA 1AZQA 1D6EC 4OWTB 1N36L 2PMZE 4A3CH 2LXJA 3S17B 2V4DA 2AWNA 2CCZA 4IFDJ 4KD3A 4X66Q 1A6XA 2SNMA 4AYBG 2IX3A 4P74A 1M4VA 2B63H 4POFA 1AH9A 3BU2A 3TZUA 2PQAA 3UE1A 1EQVA 1YHAA 2NTSA 5FKAC 5J1ZA 4KKSA 4G4KA 1CKMA 2MGSA 4J1MA 4NXML 3T1YL 4LUOA 4S3SA 1STNA 1ENAA 1EQRA 1PVOA 4NXNL 4O1NA 4WJ3M 1NAPA 4A3FH 1S5CD 3K5LA 3CRLC 3NK9A 1PZKD 1JICA 5FLMH 4YIJA 2K32A 1HTLD 5E3FA 4IZ8A 1PYWD 2FXQA 2B2YC 1I6VC 3OHXC 2GA4B 5IGGA 1I50B 2G9HD 2FJ2A 3E0EA 1CT1D 3VYUA 1F2LA 1LTSD 4J8QA 4OELB 1VQDA 5IYDG 4NPSA 4K6LA 3CF5A 1MJCA 4A3DG 1GHJA 3Q22A 1L1OC 4JYAQ 3SR1A 1Z7TA 3I3CA 4H02A 2Q8IB 1D7QA 1J5EQ 1HCZA 4DR6Q 3V2TA 3H0GH 1J8IA 4JI8Q 2VY3A 3RLNA 3WOFA 5IYCH 1QUQA 4CDEC 2B8FA 2EYJA 1CZGA 2JK8A 5C0XH 4IQZA 1A8VA 2X6GA 3GD7A 3ND8A 3MXGA 2AQ1B 3J7ZC 4NB3A 4LFAQ 2BDOA 2F0NA 4XXEA 2F1MA 1ML0D 3Q6SA 1C48A 3AYHB 4X66L 3ULJA 4L5QA 1SE3A 3H3VI 3CD6A 1JC7A 3PO3G 3M7NA 1D5MC 3CU7A 1RIPA 2R93H 1K8AC 2Z8LA 1LT5D 1WTOA 3CCMA 3BJUA 2E8GA 1ZXTA 1SLJA 2RDFA 4DR4Q 4DNTB 4OIJA 3M3YH 1U9RA 3K7AB 2XRSD 1VQ9A 1SE2A 1JB7A 1Y8OB 1XMOQ 1EY7A 5M9OA 1Q46A 1I4GA 1B9MA 2D0PA 1G6ZA 3GV3A 4QMGA 3HEJA 1JMCA 3NBHA 4DF7A 4NDXA 4EGVA 5IYBG 2PMZB 2RHSB 2K1BA 1BDOA 4ZKCB 5GQOA 3FVQA 2NTTA 5IYDH 2OTJA 1CK1A 1PFMA 3RLFA 1XTDA 2EY6A 4A3DH 4Y7NH 1KAWA 3CC4A 4JYAL 4RCNA 4ALPA 4P2CB 3OTOQ 1XWEA 1GUTA 1W2BA 3QO2A 4F7XA 4XYOA 1E2ZA 5ISRA 1YNXA 1J5EL 2BCOA 2LXKA 1GUWA 3RNUA 4DR6L 4OEMB 1GM5A 1PHJA 2AKWB 3MA2B 4K8IA 4LMQD 4JI8L 5KGUA 3U50C 1UWVA 5CYUA 3A56A 3FDTA 4UP7A 5CV8A 2PNHA 2EYHA 4A3LG 3CHBD 4LFAL 3SEBA 1VQOA 3S1QH 2A73B 1Y69U 3J81E 3AQQA 2MO1A 1KNAA 1UE5A 1EQQA 3PSIA 4H7BA 2WAQE 3C1EA 4ULLA 3X3MA 2PZWA 2VUMG 5DM73 1WJJA 2B2TA 3RZOH 2E2HH 1IL8A 1I4XA 5EKIA 1DM0B 3A8JE 4HMIA 3HOZG 2P5ZX 1N8RC 2AUKA 4UY8C 3H3VC 3OWEB 1K9MC 1X3QA 4GN5A 2PI2E 1XMOL 2UUBQ 2HUGA 1SXTA 2NUCA 3AFPA 4JW0A 1WFQA 1YJNA 5KEEA 4CKBA 3T16A 5CMDA 2L5TA 2UU9Q 5IYBH 3HKZB 3G6EA 5FO8B 4K5VA 4BY1B 1W3SA 5C44G 1LTGD 1S5FD 1STGA 1MKHA 1CKNA 2KQ3A 5J22A 2K04A 2QEJC 4C3IG 2NVTH 2E76C 5JEAJ 1B3AA 2Z4HA 2B2WC 2NYZD 3ZJYC 1M8AA 2XIWA 2UXBQ 3CCLA 3CCEA 3I4MG 2NBFA 2CQAA 4C2MH 3JAML 1JWUD 1JWMD 4XT1B 2EJFC 1I4HA 4CKCA 5HURA 2F0EA 1F77A 3FEWX 2K33A 2EIFA 1PZID 1QVCA 1Q82C 4A3LH 1Q8IA 2Z4IA 5A35A 1EWIA 1AEXA 3AFQA 3NBIA 1SYCA 2E2JH 2WFWA 1BCPC 4CJ2C 4GN3B 2K75A 4LF6Q 4A3IG 1LABA 2VUMH 5J3BA 3NBHB 4GNXC 4L5SA 2SOBA 1WD0A 1YZ6A 4QF4A 4KD4A 1JWSD 1AE3A 3HOZH 1U4MA 2E2DC 3M4YA 4OONA 2NZHA 2C9OA 4JBJA 5CV9A 4X65Q 1CHPD 5C4JB 3E5SA 4TSSA 1N32Q 4YHHQ 3HOYB 1B7YB 3S2HB 4IUNA 3EA6A 4PZ7A 3D31A 2UUBL 2KUMA 2K50A 1HH2P 2KHJA 4PQXA 1YHQA 2IPKD 3FMCA 1LTID 2UU9L 1Y1WB 3HOWB 1F9SA 1GOZA 1XMQL 3TDQA 5C44H 3CAMA 1PMRA 3LNNA 2NZOA 1SYEA 1XX8A 2VB2X 2BE5C 4K6DA 3LWUA 4C3IH 3R93A 2WAQB 4KHZA 3NP8A 1YEZA 4IO9A 3HZXA 2F3IA 1SMYD 2ZXRA 2UXBL 1Q7YC 1F2MA 5C5LA 1Y8NB 4EX5A 3VDYA 2XRQD 4RAUC 1JJ2A 3UDFA 1UEAB 4R4QA 1TWFH 1OXVA 3NEMA 1YHBA 2I07B 4LF5Q 1S5ED 4F8MA 1HFGA 1NE3A 3KJPA 3S1MH 4FDBA 1EEID 4RCOA 1WTPA 2EOTA 3QOJA 2JA8B 1VQAA 1YNND 2CH4A 3OIPA 3NTHA 2I5LX 1CI3M 3LWEA 4A3IH 4P75A 1F9PA 1IL2A 3I4NG 4LF6L 2WB1B 4HCSA 1KQSA 2IX1A 3PMFA 1SNDA 2N88A 4CBVA 1HQRD 1F9RA 1DD2A
chains in the Genus database with same CATH topology
4G57A 2F0KA 2R61A 5FLXE 4V0BA 1ZYRC 1RKNA 2JEBI 3U9OA 2CW0D 2L4NA 1PTOC 5C4ZA 4QUCA 2ZXOA 1TWAB 5D3IB 1CZWA 1S4ZA 3DEOA 2D62A 5EBDA 2IT1A 3SDZA 1B53A 4Q5VA 3HP3A 1G2TA 1WVLA 5LL6X 2HCCA 1J9OA 4DK1A 2A6HD 4KK7A 2PZTA 5COYA 1FR3A 4E6IA 1LTBD 2EJGC 4C3JB 1GHKA 2OXPA 2EPBA 2O2LD 3K57A 2YU9B 1LTTD 4KV6A 1CA5A 3GTOB 2PW5A 4RHRA 4Z9CB 2RDHA 2SDFA 4RWSC 5KNCA 4OL7A 1KNEA 1O7YA 3P1HA 1S5BD 1TWHB 4UAIA 5ELDA 4FXKC 1G2SA 5G3LD 1W6KA 3MWYW 3OMCA 3D3RA 4KTAA 3NSWA 2Q8TA 2F0UA 2YYZA 1NSNS 3QWNA 1QE6A 5CV4A 4KY7A 1MBYA 3TP7A 5D3DA 5M3FB 1EFID 2PW7A 1SDFA 1SNPA 1LTAD 1IKMA 5ELBA 1FNWA 1E2VA 2CHBD 4ZYSA 5CV6A 3BVMA 1HUNA 5IGBA 2KJXA 2F0DA 5IOCA 1JORA 3OW7A 1QG7A 5JAVA 3FPPA 2IL8A 3J81L 4FO2A 4A93B 1STYA 1EIGA 3H09A 4KMUC 1HA6A 5M3MB 1EY0A 5C3WA 2A6EC 4ZAIA 3GV6A 3KLRA 2IW3A 2WKCA 2NVYB 4X3UA 4K2LA 5M5XB 1OXTA 1TWCB 5G3LF 5IGCA 1JE4A 3OWFA 3SHLA 3MHBA 1B1ZA 3SK5A 1SYGA 4FNFA 3S15B 2BOSA 4EQNA 2HCIA 4C3HB 1SE4A 5CC4A 3N6RA 4KJOA 4HEDA 5HGTA 3URYA 1QB5D 2QILA 1Z47A 5C4XB 1I4RA 5I4DA 5CGKA 1LTRD 5BN3A 4LK1C 5CBEE 1DONA 3M4OB 3S2DB 3QOLA 4IALA 4BBRB 5I9PA 1OXXK 3L7ZC 1EY5A 3G7LA 1K8OA 1TWGB 1OO9B 1YNJC 3S16B 2EY5A 1FD7D 2H1EA 3HG9A 3CQZB 1SNMA 4I7ZC 1PTOH 1HUMA 2Y0SB 3TZDA 1D1KA 1PFNA 1TIID 4OIKA 3BZDB 4M8AA 2DY7A 1RJTA 1TY0A 4BA2I 1SYBA 5C0XJ 3H91A 1A3VA 1TU2B 1GUSA 2F0MA 2RA4A 3G6JB 3K59A 4JK1C 2PYKA 3PV0A 1C8CA 2O5JC 4PMWA 4I65A 2B2TC 4R8NA 4V190 4N9TA 4FXGC 5DM63 3HGBA 3H94A 1HQMC 3PO2B 2ZXPA 2A68C 3PUZA 1CA6A 3E6ZX 1X32A 3WOEA 4DGZA 3HOUB 3IFTA 4QCLA 5D65A 3QG1A 1TS2A 2H4OA 3I73A 2JEAI 3LX0A 2SNSA 2XSCA 3A54A 1STEA 3CKIB 5FLXL 1ILQA 1H9RA 2CVRA 1AW7A 5I6YA 3D4DA 2AWOA 4CGYB 1XTCD 3C1FA 2F0FA 4XQNA 1CTMA 2B63B 2HDMA 1TQOA 3MXUA 1IYVA 3K6OA 1QOHA 2PZUA 1TS4A 4A3FB 5IGFA 5CV5A 3L3OC 3RUZA 2WP8J 3EROA 3KF8A 1PRTD 1GXDC 5CBAE 3DHQA 1EOTA 1MGSA 4TQUS 3WDNA 1EIHA 1CQVA 3PIP3 4RH6A 1BXTA 1HPCA 3NPPA 4KY5A 5IGEA 3NWSA 2J4XA 4DXGA 1FYCA 1SJED 3D4WA 2KHSA 4J6HA 3H0GB 4N9PA 2MPMA 3QJYA 3BYTB 4LJZC 1PRTB 2ICIA 1BR9A 3U9SA 1ENCA 1KDBA 3IFDA 4AYBB 3VR6A 4RHSA 3FRPB 1EZ6A 2R93B 4K5XA 1TKWB 1VMCA 3M3YB 4HAEA 3BG3A 4H0LC 2EXZA 3L9AX 1AN8A 4ZLTF 4DU9A 4NP5A 1PRTF 1SJHD 3P75A 4WORA 1H9JA 1EY8A 3VR3A 3BVZA 1BOSA 1DOLA 1HHVA 2VB3X 4A3DB 3A55A 4MIUA 1HFNA 4Y7NB 5KNDA 1IW7C 1ET6A 5ELEA 1S5DD 1FNUA 1U4RA 5IGDA 1OXUA 1Y8PB 4DFAA 4DA2A 3SK6A 1TR5A 1EWCA 1AZPA 1NUCA 1B2TA 2A74C 4CJ1B 3S1QB 4G7OC 4K2KA 3K58A 2B2VA 3MC0B 1HRJA 1SNCA 3ERQA 1DYQA 5E1FA 1V1OA 3RZOB 2E2HB 1EZ8A 2EYFA 2D5DA 1H9KA 4WRDA 1F2ZA 5CORA 2X69A 1CM9A 3K5OA 2EZVA 4EVOA 5NUCA 5DEHA 3DMUA 2F0JA 2HQEA 1JCKB 2I46A 2NVTB 1D5XC 1E0BA 1QCBD 3D8GA 1ILPA 5IT9L 4C2MB 4DXFA 4KHVA 1QILA 1SYDA 3T51B 2XWBB 3SK8A 3ZYYX 5EPJA 2VXWA 1PLFA 4B08A 3AB9A 5E4WC 3FPUB 2DNCA 5EBCA 4CJ0B 2E2JB 3VYSA 4IFDI 4XQQA 3T4AC 4B9XA 2QKIC 2VUMB 2A5HA 1R4QB 3F2UA 4ZKBB 2B8GA 2JYOA 3HOZB 5C0XI 3I70A 3ND9A 3J80E 4F88A 3N52A 1O7ZA 3NQIA 3NTKA 2A69D 5D14A 4ZRZA 1GUNA 1Q12A 1T5EA 2L12A 5C44B 1F9QA 3MXPA 3I91A 3TMEA 4C3IB 4QIWB 4EQPA 3VR4A 3HRZC 3I4MB 3BDOA 3MFGA 2PCFB 2L9HA 5C6AA 2EYMA 1UAPA 1WTRA 1TWFB 1UUPA 2DY8A 3R8BA 3PUXA 3K0YA 3SK4A 3S1MB 2WKDA 3P7JA 2LKVA 4CKEA 3TBIB 5EQ0A 4R8IA 4IUQA 5EJWA 4ZUJA 4A3IB 1H9SB 2TMPA 2J0TD 2L1BA 4FP5D 2NN6I 4LAAA 1U4LA 1LO5D 2O5IC 2RKSA 3VA7A 2QF7A 4KKTA 3Q23A 1KAAA 4PMCA 1GUGA 1GUOA 1EY6A 1EYCA 4DK0A 1CQFA 2F0OA 2K5WA 4RA8A 2F03A 1TY2A 5IIFA 3S1RB 2FFKB 3KBXA 5CV7A 1SNOA 5A2QL 4IN3A 3D4RA 1NCVA 2MP1A 5ELCA 2KCNA 5FO7B 3MEHA 2KCCA 1D2BA 2DN8A 2F0HA 3J7AF 4HCEA 2KEDA 4K8JA 1RF2D 4KY6A 1BNZA 4L63B 1LACA 2M00A 4TKOB 3BDCA 3SE0A 1V1PB 2L0CA 4PNYA 1R4PB 2K01A 2VNUD 1BCPD 3NUCA 3NQTA 3I4LA 3J7AV 2L11A 3A7AB 1TT2A 1XXGA 3UI2A 2L55A 4A3BB 4JBWA 1NR4A 2D9UA 4OO1I 1L0XB 2R92B 3W2DA 4RGOS 4HMJA 4FF3A 1DXMA 3TSSA 2NWGA 3R2TA 1SSOA 1I3QB 2PNRC 1RHPA 4BA1I 1BCPB 1B4OA 2LS01 1K8MA 2M2LA 1G91A 3M7GA 1STAA 3VYTA 2K7VA 4BY7B 5DNFA 3EQLC 5EGTA 2K03A 1CHQD 2R7ZB 2MUYA 2EY2A 3OIQA 4XQJA 4NKLA 4K5WA 2XWJB 1SYFA 5C3XA 4IFDG 5IT9E 3MZ5A 1ESRA 2F0SA 5IODA 1KLUD 4ODGA 2LMCB 5T1IA 5C0XG 1A2TA 1LT4D 4ILWA 4A3JB 3KLSX 4A3KB 2QDBA 1EY9A 1BCPF 1G8ZD 1BF4A 5JPNC 3I90A 4WJWA 4X3TA 1TS5A 3GTQB 5C3EB 3NXWA 1WTVA 1T5XD 1DOMA 1KDCA 1ZYRD 2X6LA 4EQOA 3CRKC 1PTOD 4IURA 1LLRD 1VCIA 2B2UA 2XNAC 1ICWA 1EU3A 1OXSC 1A2UA 3GTPB 3H6MA 1SMYC 5BN5A 3GP7A 2F0QA 1QWYA 3D6WA 2J7ZA 4BS9A 1QNKA 2RBMA 5JVG3 3I72A 2F0VA 3QB3A 2EE1A 2KECA 3I8ZA 2C5CA 4ZK9B 2ENBA 4IFDH 1PTOB 3A7LA 1YNNC 1LV9A 1EYAA 3GTKB 4FF2A 2EJMA 2F0GA 4DNRB 1BO0A 4XDXA 3J80L 5AFWA 2NN6G 1RODA 3Q0AA 2WINB 2PQEA 1QJOA 3D6CA 1JR0D 1H9MA 2F3VA 3BVGA 3RMHA 2CW0C 2R3ZA 3PIO3 1SEBD 3VR5A 2HDLA 4L6TB 2OT2A 2F4IA 2B2VC 1O7LA 1BBXC 2A69C 2F3WA 5CR3A 2EVBA 2WACA 2SEBD 2ZT9C 4C1NK 1PTOF 4RGMA 2BA0A 2A6HC 4BBSB 3S9WA 2K05A 2RVLA 2WV6D 2IWHA 1V8QA 2EYOA 2MHVA 5KRUA 5J39A 1JOOA 4F87A 5A2QE 4MHEA 4KJNA 1AP0A 3RZDB 4L8JA 1SNQA 5KYLA 3K5NA 2JXMB 4HN7A 1I4PA 3EFXD 3NTIA 3T56B 4O42A 5EPLA 4RKBA 4FYDA 5I6WA 1EYDA 3HOVB 2NN6H 1K83B 1O78A 3DUZA 3R3OA 2KEEA 4H13C 4GZYC 2A6ED 2JA7B 2NZ1D 5BN4A 1SFOB 4OO1G 2RQXA 1IKLA 2B39A 1D5ZC 5JVH3 3RD4A 5FK9C 1EEFD 2B2YA 3O13A 3T13A 1PFBA 1MI2A 2ID0A 2F0PA 4WFN3 1BUVT 2AQ3B 2E2IB 4UDUC 3NHHA 1BQQT 4Q0FA 4RGNA 4BWGB 1IYUA 5JEAG 4A3MB 3EVQA 1Z6HA 4HSVA 2IJ0A 1EL0A 3FKIB 4ZQ3A 1LT3D 4B9WA 3IKJA 4ME5A 4FF1A 3GTLB 2EYPA 1XYIA 3GTGB 4FVMA 1MSGA 5JOBA 4X3SA 4RGTA 4KN7C 3TN2A 2KVMA 4C3JG 5I9OA 2K28A 1HTPA 1IHZA 3PUYA 2Q8RE 3A8KE 2BDNA 1YNJD 4KKUA 1JOQA 4R9WA 2JA6B 2KOLA 3PO3B 1WD1A 2MJ8A 2AUJD 3HS0C 3ITPA 1ENFA 1HA5A 2JE6I 1DJRD 5M5WB 3DWQA 1STHA 4OO1H 1DOKA 4DAPA 1ONLA 2OF1A 1JB3A 2EY1A 1A3TA 1RCVD 1EY4A 1H9SA 5F2DA 4ZUIA 1QNUA 1JOKA 2NVQB 1Y1VB 3VR2A 4H44C 3J7YW 3MVVA 5I2XA 4QB4A 1O80A 3EJIA 5JEAH 1AFPA 3NWTA 1WCMB 4XTCS 1Q1EA 2F0LA 1KTKA 2OEOA 2PPBC 3A8IE 2LY7A 2LFNA 4U673 2RSOA 1RTOA 2FMCA 4A3EB 1DZ1A 5EKKA 1ZKOA 5E4XA 3C2PA 3KK7A 3SVMA 2A68D 3TP8A 5LL6S 3MTSA 2E74C 1MD2D 3GQBA 3KLSA 1STBA 2R6GA 3MAQA 4RFBA 1B44D 3P20A 3DXJC 1A3UA 1VF5C 1FNVA 1L0YB 2E75C 1II3A 4G7HC 3QIAA 3GTJB 5LHY1 1U4PA 2RSNA 1TS3A 3V05A 2M9VA 5TSSA 3SXHA 3M85A 2FMMA 2XVSA 4PV1C 1R9TB 1V1PA 5T1GA 1KLGD 1DCZA 1FGBD 2Z1CA 3DM1A 4G7ZC 1G291 4C3HG 2B2WA 2F0TA 3TP6A 3VYRA 2D2CC 2JSOA 3BS1A 5FO9B 3PUWA 5FOBB 3C46A 2XN9C 4OHJA 1JQYD 5EKLA 3OPOA 2NVXB 3S1NB 3V96A 3BYYB 2FHTA 3Q24A 4IUUA 4FXDA 4C1NI 3K5MA 1C4QA 3MFYA 3W3AA 1E2WA 1V43A 3NE5B 2NB0A 2G9DA 1KDAA 2F0WA 1UNSA 1EU4A 1Q1BA 1VDZA 3C3LA 2BA1A 5KIXA 1WTQA 4IUPA 4IUTA 4IUVA 1CFMA 1KABA 3KUPA 1B50A 4U68A 3OSOA 4PMBA 1W6JA 1MSHA 1PRTC 5K5PA 3OMGA 1WTXA 2ICEC 4DAYA 3OOCA 1WTWA 4NMZA 2IX0A 1D1IA 1LT6D 4CHTB 4QUFA 3PUVA 3TP5A 1GJXA 2KA7A 1Q90A 4RKLA 3HOXB 4MN3A 3KBGA 1PXUA 1PDQA 5KNBA 4HTHA 2JP1A 1B9NA 1RTNA 5ELFA 3IAYA 2B2UC 1ET9A 2JA5B 1IW7D 1Q3LA 1EQTA 5K36G 4XIGS 3AU7A 4DAVA 1X3PA 3DWAA 5I2YA 4OGQC 2TSSA 2F0IA 3DWPA 2N55A 4XT3B 3I4NB 3IL8A 5C5MA 1VF7A 5M5YB 1EWHA 2AQ2B 1NR2A 3JAME 5C4HA 2K5QA 1I4QA 3GO5A 1A15A 1RDPD 2EDGA 2DNEA 2PO4A 4M1UB 2QCPX 3GTMB 3R2IA 3ONAB 2FINB 4X3KA 3AMUA 1PZJD 2O4XA 2K6AA 4XYQA 2WIIB 5JJZA 1SBBB 4FF4A 4K14A 4DN4M 5JPMC 1RD9D 3E0JA 4HR7B 4TRDA 1TVXA 3S14B 2K5DA 1I6HB 1ESFA 3BDLA 4KN4C 2EYLA 1SAPA 4HSPA 4ABNA 2BE5D 3MXNA 4A3GB 3DEPA 5KYIA 1F2YA 4KI0A 4C56C 4ID6A 3VA5A 5K36H 1ZEQX 2RDGA 1HXYD 4NW2A 5EPKA 1VMPA 3T53B 5DAUA 3X3NA 1AZQA 1D6EC 3S17B 2V4DA 2AWNA 4IFDJ 4KD3A 1A6XA 2SNMA 2IX3A 1M4VA 3TZUA 1EQVA 2NTSA 5FKAC 5J1ZA 4KKSA 4G4KA 2MGSA 4J1MA 4S3SA 1STNA 1ENAA 4O1NA 1NAPA 1S5CD 3K5LA 3CRLC 3NK9A 1PZKD 1JICA 4YIJA 2K32A 1HTLD 5E3FA 4IZ8A 1PYWD 2B2YC 1I6VC 3OHXC 2GA4B 5IGGA 1I50B 2G9HD 2FJ2A 1CT1D 3VYUA 1F2LA 1LTSD 4J8QA 4K6LA 1GHJA 3Q22A 3SR1A 1Z7TA 3I3CA 2Q8IB 1HCZA 3V2TA 1J8IA 3WOFA 2B8FA 2EYJA 1CZGA 5C0XH 4IQZA 2X6GA 3GD7A 3ND8A 3MXGA 2AQ1B 2BDOA 2F0NA 4XXEA 2F1MA 1ML0D 3Q6SA 1C48A 1SE3A 1JC7A 3M7NA 1D5MC 3CU7A 2Z8LA 1LT5D 1WTOA 1ZXTA 2RDFA 4DNTB 4OIJA 1U9RA 3K7AB 2XRSD 1SE2A 1Y8OB 1EY7A 5M9OA 1I4GA 1B9MA 1G6ZA 3GV3A 4QMGA 3HEJA 3NBHA 4DF7A 4NDXA 4EGVA 2PMZB 2K1BA 1BDOA 4ZKCB 3FVQA 2NTTA 1CK1A 1PFMA 3RLFA 2EY6A 4RCNA 4P2CB 1XWEA 1GUTA 3QO2A 4F7XA 4XYOA 1E2ZA 5ISRA 2BCOA 1GUWA 4LMQD 3MA2B 4K8IA 5KGUA 5CYUA 3A56A 3FDTA 5CV8A 2EYHA 3CHBD 3SEBA 2A73B 1Y69U 3J81E 1KNAA 4H7BA 4ULLA 3C1EA 3X3MA 2PZWA 5DM73 2B2TA 1IL8A 1I4XA 5EKIA 1DM0B 3A8JE 4HMIA 2AUKA 3H3VC 3OWEB 1X3QA 2HUGA 1SXTA 2NUCA 5KEEA 4CKBA 3T16A 5CMDA 2L5TA 3HKZB 5FO8B 4K5VA 4BY1B 1LTGD 1S5FD 1STGA 2KQ3A 5J22A 2K04A 2QEJC 4C3IG 2E76C 5JEAJ 1B3AA 2Z4HA 2B2WC 2NYZD 1M8AA 2XIWA 2NBFA 2CQAA 3JAML 1JWUD 1JWMD 4XT1B 2EJFC 1I4HA 4CKCA 5HURA 2F0EA 1F77A 3FEWX 2K33A 1PZID 1Q8IA 2Z4IA 5A35A 1AEXA 3NBIA 1SYCA 1BCPC 4CJ2C 1LABA 2SOBA 1WD0A 4QF4A 4KD4A 1JWSD 1U4MA 2E2DC 3M4YA 2C9OA 5CV9A 5C4JB 1CHPD 3E5SA 4TSSA 3HOYB 3S2HB 4IUNA 3EA6A 3D31A 2KUMA 4PQXA 2IPKD 3FMCA 1LTID 1Y1WB 3HOWB 1F9SA 1GOZA 3TDQA 3LNNA 1PMRA 1SYEA 1XX8A 2VB2X 2BE5C 4K6DA 3LWUA 3R93A 2WAQB 4KHZA 3NP8A 3HZXA 1SMYD 2ZXRA 1F2MA 5C5LA 1Y8NB 2XRQD 4RAUC 1UEAB 1OXVA 2I07B 1S5ED 4F8MA 1HFGA 1EEID 4RCOA 1WTPA 2EOTA 3QOJA 2JA8B 1YNND 3OIPA 3NTHA 1CI3M 3LWEA 1F9PA 2WB1B 4HCSA 2IX1A 3PMFA 1SNDA 4CBVA 2N88A 1HQRD 1F9RA 1DD2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LTA D;  1QIL A;  4OHJ A;  5ELB A;  1JQY D;  1FNW A;  2R61 A;  1PZI D;  2CHB D;  4O1N A;  1PTO H;  3BVZ A;  1S5C D;  3TSS A;  2AQ2 B;  1PTO C;  4ZYS A;  1LO5 D;  3BYY B;  1PZK D;  3BVM A;  5D3I B;  3R2T A;  1ET6 A;  1BCP C;  1I4Q A;  3BZD B;  1TS4 A;  1PTO B;  1HTL D;  1RDP D;  5ELE A;  4DXF A;  1D5Z C;  1S5D D;  1FNU A;  1KTK A;  1BCP B;  5FK9 C;  1PYW D;  1EEF D;  1TY0 A;  1PRT D;  2G9H D;  3O13 A;  1CT1 D;  1JWS D;  1EU4 A;  1UNS A;  1LTS D;  3R2I A;  1PZJ D;  4K6L A;  1TY2 A;  1CHP D;  2AQ3 B;  4TSS A;  1CQV A;  1CHQ D;  4RH6 A;  1EWC A;  1BXT A;  4UDU C;  1JR0 D;  1SBB B;  2XN9 C;  3CHB D;  3EA6 A;  3SEB A;  1LTB D;  3BVG A;  4RGN A;  4BWG B;  1SEB D;  1RD9 D;  2IPK D;  5ELC A;  1LTI D;  2O2L D;  4L6T B;  2J4X A;  1MD2 D;  2IJ0 A;  1LTT D;  4DXG A;  1ESF A;  1GOZ A;  1SJE D;  1KLU D;  1LT3 D;  4RFB A;  1I4X A;  3MC0 B;  1B44 D;  2SEB D;  1PRT C;  4RHR A;  1DYQ A;  4RGT A;  4Z9C B;  2RDH A;  1PTO F;  1FNV A;  1LT4 D;  1V1O A;  4RGM A;  1L0Y B;  2AQ1 B;  3KLS X;  3BYT B;  1PRT B;  4C56 C;  1BCP F;  2ICI A;  1G8Z D;  3OWE B;  1B1Z A;  1SXT A;  1RF2 D;  2WV6 D;  2RDG A;  1SE3 A;  1LT6 D;  1S5B D;  1TS3 A;  3V05 A;  4L63 B;  1HXY D;  1SE4 A;  1TS5 A;  1D5M C;  2XRQ D;  2Z8L A;  1LT5 D;  5TSS A;  3MFG A;  1T5X D;  1LTG D;  5ELD A;  4RHS A;  3URY A;  1V1P A;  1S5F D;  2QIL A;  1I4R A;  1KLG D;  1V1P B;  1S5E D;  2XRS D;  2QEJ C;  5ELF A;  1PTO D;  1D6E C;  5I4D A;  1SE2 A;  1FGB D;  1EEI D;  1ET9 A;  1LTR D;  4RCO A;  1ENF A;  1HA5 A;  1LLR D;  1UUP A;  1TS2 A;  1BCP D;  1DJR D;  3R8B A;  2XNA C;  1I4G A;  3DWQ A;  1EU3 A;  1I4P A;  1STE A;  1JCK B;  1XXG A;  3EFX D;  5D3D A;  1M4V A;  1D5X C;  1AW7 A;  3DWA A;  1EFI D;  1AN8 A;  1JWU D;  1JWM D;  2TSS A;  1RCV D;  3GP7 A;  1XTC D;  1L0X B;  1PRT F;  2NTS A;  3W2D A;  1I4H A;  5FKA C;  1HQR D;  3DWP A;  2NTT A;  4RGO S;  1SJH D;  1FD7 D;  1CK1 A;  1F77 A; 
#chains in the Genus database with same CATH topology
 4G57 A;  3J80 c;  1BVS A;  4AQY Q;  2F0K A;  1QZH A;  2R61 A;  5FLX E;  4X65 L;  4V0B A;  1ZYR C;  1RKN A;  2JEB I;  1N32 L;  3U9O A;  2CW0 D;  4YHH L;  2L4N A;  3J81 i;  1PTO C;  5C4Z A;  4QUC A;  2ZXO A;  1TWA B;  5D3I B;  1CZW A;  1S4Z A;  3DEO A;  4B3R Q;  3G71 A;  2R92 G;  2D62 A;  5EBD A;  2R7D A;  3S1R H;  2IT1 A;  3SDZ A;  1B53 A;  4Q5V A;  3HP3 A;  1G2T A;  1WVL A;  5LL6 X;  2HCC A;  1K3B C;  4UP8 A;  5GAD C;  1J9O A;  3W5O A;  2MFI A;  1QZG A;  3RR5 A;  1K0R A;  4DK1 A;  2A6H D;  4KK7 A;  2PZT A;  2Z9H A;  5COY A;  1X6O A;  1FR3 A;  4E6I A;  1LTB D;  2EJG C;  1XPU A;  3TQY A;  4C3J B;  1GHK A;  2N78 A;  4LF9 Q;  2OXP A;  4JI7 Q;  2EPB A;  2O2L D;  3K57 A;  2YU9 B;  1LTT D;  4KV6 A;  4QJF A;  1CA5 A;  3GTO B;  4BY7 G;  2PW5 A;  4DK6 C;  1PYS B;  4IPD A;  2R7Z G;  4RHR A;  3B6Y A;  4Z9C B;  2RDH A;  4LF5 L;  2SDF A;  4RWS C;  5KNC A;  4AIM A;  4OL7 A;  1KNE A;  2C35 B;  1O7Y A;  3P1H A;  1S5B D;  4DR7 L;  1TWH B;  5LMU Q;  1NNX A;  4HJ8 A;  4UAI A;  4A3J G;  5ELD A;  4DV6 Q;  4FXK C;  4A3K G;  1G2S A;  3CCU A;  5G3L D;  1W6K A;  1PH6 A;  3MWY W;  3OMC A;  2G5D A;  4AQY L;  3D3R A;  4KTA A;  4DUY Q;  4LFC Q;  3NSW A;  1A62 A;  2Q8T A;  2F0U A;  2YYZ A;  3F8T A;  1LM0 A;  1NSN S;  3QWN A;  1QE6 A;  1JT8 A;  4A3B H;  4QL5 A;  4YCU A;  5CV4 A;  4KY7 A;  1MBY A;  3TP7 A;  4B3R L;  2R92 H;  5D3D A;  5M3F B;  3PF4 A;  3KOJ A;  1VQP A;  2K5V A;  1EFI D;  2PW7 A;  3K8A A;  1SDF A;  1SNP A;  1JJG A;  4B3M L;  2RF4 A;  1LTA D;  3UDI A;  5ELB A;  1IKM A;  1FNW A;  1E2V A;  2KBN A;  1I3Q H;  2CHB D;  4R4C A;  4ZYS A;  2OQ0 A;  5CV6 A;  3BVM A;  1HUN A;  5IGB A;  1XPO A;  4LF9 L;  2KJX A;  2F0D A;  5IOC A;  4JI7 L;  1JOR A;  2Q2U A;  3OW7 A;  4BY7 H;  1HJP A;  3L0O A;  1QG7 A;  5JAV A;  3FPP A;  2IL8 A;  1UE6 A;  4CDD C;  3J81 L;  4JI2 Q;  4FO2 A;  4A93 B;  2R7Z H;  5DLQ E;  1STY A;  4DV7 Q;  1EIG A;  5EAY A;  4HJ9 A;  3H09 A;  4KMU C;  3K7U C;  1HA6 A;  3M9B A;  5M3M B;  2YTX A;  1EY0 A;  3W1B A;  5C3W A;  2A6E C;  2D0O A;  4ZAI A;  3GV6 A;  5IY0 A;  4GOP B;  4LWC A;  3KLR A;  2IW3 A;  2WKC A;  2NVY B;  4X3U A;  4K2L A;  4A3J H;  5M5X B;  1OXT A;  1SN8 A;  5LMU L;  4A3K H;  1TWC B;  5G3L F;  4DV6 L;  2UXC Q;  5IGC A;  1NMF A;  4LFC L;  1JE4 A;  3CW2 C;  4DUY L;  2QA4 A;  3OWF A;  1FJG Q;  3SHL A;  1TXY A;  3MHB A;  1B1Z A;  1X56 A;  3SK5 A;  3I2Z A;  1SYG A;  3GTQ H;  4FNF A;  5C3E H;  3BZC A;  3S15 B;  5LMN Q;  2BOS A;  4EQN A;  2HCI A;  3E9I A;  4C3H B;  1SE4 A;  1UE1 A;  5CC4 A;  1VQ8 A;  3N6R A;  4KJO A;  4HED A;  5HGT A;  3URY A;  1E7Z A;  4OWW B;  1QB5 D;  2Z0S A;  2QIL A;  1Z47 A;  3J7A 5;  5C4X B;  1I4R A;  4BBS G;  5I4D A;  5CGK A;  1LTR D;  5BN3 A;  4LK1 C;  3GTP H;  4JOI A;  5CBE E;  1DON A;  3M4O B;  2N3S A;  5IP9 G;  3S2D B;  3JC6 6;  3QOL A;  4IAL A;  4BBR B;  5I9P A;  3RN5 A;  1OXX K;  3F2C A;  3L7Z C;  3A0J A;  2EQS A;  1EY5 A;  3G7L A;  1K8O A;  1KRS A;  1OO9 B;  1TWG B;  1YNJ C;  3S16 B;  1DGS A;  4JI2 L;  4JI6 Q;  2EY5 A;  1FD7 D;  1U0L A;  2H1E A;  4KHP Q;  3HG9 A;  3CQZ B;  2JQO A;  1SNM A;  4I7Z C;  1PTO H;  1HUM A;  2Y0S B;  1ASZ A;  3GTK H;  3TZD A;  1D1K A;  1PFN A;  3I4O A;  1TII D;  4OIK A;  3BZD B;  1EOV A;  2BH8 A;  4M8A A;  1GVP A;  2DY7 A;  4A4I A;  3HOV G;  1RJT A;  4GKK L;  1TY0 A;  4BA2 I;  1SYB A;  3A74 A;  4DUZ Q;  5C0X J;  3H91 A;  2UXC L;  1A3V A;  1TU2 B;  1GUS A;  2F0M A;  2RA4 A;  2JA7 G;  4JI3 Q;  4X64 Q;  3G6J B;  1FJG L;  2IHF A;  2YV5 A;  3K59 A;  4JK1 C;  2PYK A;  1PH3 A;  3PV0 A;  2JN4 A;  5LMN L;  1C8C A;  3STB D;  2O5J C;  1OTC A;  4PMW A;  1ICF B;  1A0I A;  4I65 A;  2B2T C;  2ZJQ A;  4WJ4 A;  1E22 A;  4R8N A;  1SE8 A;  2CFM A;  4V19 0;  4BBS H;  4N9T A;  4FXG C;  4OWX B;  2I0Q A;  5DM6 3;  3HGB A;  4A3M G;  3H94 A;  4AYB E;  1HQM C;  3PO2 B;  5IP9 H;  3FKI G;  2ZXP A;  2A68 C;  3PUZ A;  1CA6 A;  3E6Z X;  1X32 A;  3WOE A;  4DGZ A;  3HOU B;  3RZD H;  5LMN W;  4KHP L;  3IFT A;  1B8A A;  1MJE A;  4QCL A;  5D65 A;  3KYH C;  3QG1 A;  5AJ3 Q;  2QDL A;  1TS2 A;  2H4O A;  3I73 A;  2JEA I;  3LX0 A;  2SNS A;  2XSC A;  3A54 A;  1STE A;  3QR8 A;  4MZ9 A;  2JA6 G;  3CKI B;  5FLX L;  3HOV H;  1ILQ A;  4GKJ Q;  1K83 H;  1H9R A;  2CVR A;  4DV1 Q;  1AW7 A;  5I6Y A;  4LF8 Q;  3D4D A;  2AWO A;  3E9H A;  4CGY B;  1XTC D;  2IHE A;  3C1F A;  2F0F A;  4XQN A;  1CTM A;  2B63 B;  4DUZ L;  2HDM A;  1TQO A;  1LUZ A;  3MXU A;  1IYV A;  3K6O A;  1SFO H;  1QOH A;  4PG3 A;  2UXD Q;  2PZU A;  4JI3 L;  3JAM i;  3E3X A;  3GDE A;  1VQH A;  2V1C C;  1TS4 A;  4A3F B;  4UPA A;  4X6A H;  3CC2 A;  5IGF A;  5CV5 A;  3L3O C;  3RUZ A;  2ES2 A;  2WP8 J;  1YJW A;  3ERO A;  1Y1V G;  3KF8 A;  4Y52 H;  1PRT D;  2E2I H;  1GXD C;  5CBA E;  3HOY G;  3DHQ A;  1EOT A;  1X3G A;  4A3M H;  1MGS A;  4TQU S;  3WDN A;  1HR0 Q;  1EIH A;  1CQV A;  3PIP 3;  1WCM G;  4RH6 A;  1BXT A;  1HPC A;  3NPP A;  4KY5 A;  5IGE A;  3NWS A;  4LFB Q;  2K5N A;  3GTL H;  1SR3 A;  2J4X A;  3GTG H;  4DXG A;  1FYC A;  1SJE D;  4A3E G;  3D4W A;  2KHS A;  4J6H A;  4DV5 Q;  3H0G B;  4N9P A;  2ASB A;  2MPM A;  3QJY A;  3TRE A;  3BYT B;  4LJZ C;  3U4Z A;  1PRT B;  4I7A A;  2ICI A;  1PH2 A;  1BR9 A;  1IXR A;  1VQL A;  3H15 A;  3U9S A;  1N34 Q;  1PA6 A;  3EN2 A;  2JA6 H;  1ENC A;  4JPB W;  2ZM6 Q;  1KDB A;  4GKJ L;  3PO3 H;  4DV1 L;  2PI2 A;  3IFD A;  4LF8 L;  4AYB B;  1BKB A;  1YIT A;  1VS0 A;  3VR6 A;  4RHS A;  3FRP B;  4DR4 L;  1EZ6 A;  2R93 B;  5M5W H;  4K5X A;  4ZCK A;  1TKW B;  1VMC A;  2UXD L;  3M3Y B;  4HAE A;  3J81 j;  1E1T A;  3BG3 A;  4H0L C;  2EXZ A;  3TS2 A;  2MNA A;  1KL9 A;  1G51 A;  3L9A X;  3FP9 A;  2NVQ H;  2KCM A;  1Y1V H;  1AN8 A;  4ZLT F;  1EIF A;  3L2P A;  4DU9 A;  4NP5 A;  1I94 Q;  1PRT F;  1G6P A;  2K52 A;  2KEN A;  1SJH D;  3P75 A;  1SRO A;  1WCM H;  5JJL A;  1P16 A;  1H9J A;  4WOR A;  1EY8 A;  3VR3 A;  3BVZ A;  1BOS A;  4B3S Q;  3TEH B;  1DOL A;  1HHV A;  2VB3 X;  3I7F A;  4A3D B;  3A55 A;  4MIU A;  1HFN A;  4Y7N B;  5KND A;  1IW7 C;  1ET6 A;  4R1J A;  3OTO L;  5ELE A;  1PYB A;  4LFB L;  1S5D D;  1FNU A;  2KHI A;  1U4R A;  4A3E H;  5IGD A;  1OXU A;  1Y8P B;  4DFA A;  1WTH A;  2F52 A;  2RCF A;  4DV5 L;  4DA2 A;  3SK6 A;  3KLW A;  4OX9 Q;  1TR5 A;  4R4O A;  1EWC A;  4IOC A;  1AZP A;  1HZA A;  5IWA Q;  4YCW A;  3U4V A;  1N34 L;  1VQ5 A;  4ME3 A;  1NUC A;  4DV0 Q;  1B2T A;  2A74 C;  4CJ1 B;  2ZM6 L;  3S1Q B;  1PFS A;  2Z6B A;  1V9P A;  4G7O C;  4K2K A;  3K58 A;  2B2V A;  3MC0 B;  2JJQ A;  1HRJ A;  1PH5 A;  4QIW E;  1SNC A;  3KF8 B;  3ERQ A;  4DAM A;  1DYQ A;  4N8F A;  5E1F A;  1V1O A;  3RZO B;  2E2H B;  2GN5 A;  3GTJ H;  1EZ8 A;  2EYF A;  2D5D A;  1H9K A;  4WRD A;  3PCO B;  1VQG A;  4EQ5 A;  3CCS A;  1F2Z A;  5COR A;  1R9T H;  2X69 A;  1CM9 A;  3K5O A;  1X65 A;  2I5M X;  1I94 L;  2YTY A;  2EZV A;  4EVO A;  5NUC A;  3KFU A;  5DEH A;  2HQL A;  3DMU A;  2F0J A;  2HQE A;  3PGZ A;  3M4P A;  1JCK B;  1U5K A;  2I46 A;  2NVT B;  3HOX G;  3I4M H;  1D5X C;  5HGQ A;  1E0B A;  2XTI A;  1QCB D;  3D8G A;  1ILP A;  4RMF A;  5IT9 L;  2NVX H;  2ZTD A;  1E3P A;  4C2M B;  4DXF A;  4KHV A;  3S1N H;  2JA5 G;  1QIL A;  1NY4 A;  1SYD A;  3T51 B;  2XWB B;  3SK8 A;  3ZYY X;  5EPJ A;  4OX9 L;  2VXW A;  1PLF A;  4B08 A;  3I55 A;  5IWA L;  3AB9 A;  5E4W C;  4DV0 L;  3FPU B;  2DNC A;  5EBC A;  1IZ6 A;  4CJ0 B;  1SMX A;  3VYS A;  2E2J B;  4DR5 Q;  5GAE C;  4IFD I;  4XQQ A;  3T4A C;  4B9X A;  1KD1 C;  2QKI C;  5M3M G;  1YJ9 A;  4HJ5 A;  2VUM B;  2A5H A;  1R4Q B;  3F2U A;  4ZKB B;  2B8G A;  2JYO A;  3HOZ B;  1D8L A;  1HNX Q;  5C0X I;  1YIJ A;  3I70 A;  5H1S E;  1L1O B;  4GOP A;  3T1H Q;  2Q2H A;  3ND9 A;  3J80 E;  4LUV A;  1B70 B;  1KRT A;  4F88 A;  3N52 A;  1O7Z A;  2HHH Q;  4QY7 A;  3NQI A;  1C0A A;  2L15 A;  3NTK A;  3STB C;  2A69 D;  5D14 A;  4ZRZ A;  2HT1 A;  4DNI A;  1GUN A;  5IE8 A;  3CP0 A;  1Q12 A;  1T5E A;  2L12 A;  4UHV A;  5C44 B;  1L2F A;  1EYG A;  1F9Q A;  4YCV A;  3MXP A;  3I91 A;  4X62 Q;  3TME A;  4C3I B;  2B29 A;  4QIW B;  3HOX H;  4EQP A;  3VR4 A;  3HRZ C;  3I4M B;  3BDO A;  3MFG A;  4A3G G;  1H95 A;  2PCF B;  2L9H A;  5C6A A;  2EYM A;  4DR1 Q;  1UAP A;  3NEL A;  3PIP A;  1WTR A;  1Q8K A;  1TWF B;  4JOI C;  3H3V H;  1UUP A;  1VQC A;  2DY8 A;  3R8B A;  3PUX A;  3K0Y A;  2N49 A;  3SK4 A;  3S1M B;  3D0F A;  5HY6 A;  2WKD A;  1IYJ B;  3P7J A;  1ASY A;  2LKV A;  4TVA B;  3BZK A;  2VQE Q;  4CKE A;  3I4N H;  3TBI B;  5EQ0 A;  4R8I A;  4IUQ A;  5EJW A;  5M5Y H;  4ZUJ A;  4DR5 L;  1MHW C;  4A3I B;  1H9S B;  3KF6 B;  2Z6K A;  2TMP A;  1EFW A;  2J0T D;  1J6Q A;  3WWV A;  2L1B A;  4FP5 D;  4JG2 A;  2CWP A;  2NN6 I;  4LAA A;  1U4L A;  1LO5 D;  1HNX L;  2O5I C;  2RKS A;  2IY5 B;  3T1H L;  3VA7 A;  2QF7 A;  2GVA A;  4KKT A;  3CCV A;  3Q23 A;  1KAA A;  2HHH L;  4PMC A;  1GUG A;  3GTM H;  4APV A;  1GUO A;  2ZTE A;  1EY6 A;  1EYC A;  4DK0 A;  2ZJP A;  1CQF A;  2F0O A;  2K5W A;  4RA8 A;  2F03 A;  4DV4 Q;  4HIM A;  1TY2 A;  5IIF A;  3S1R B;  5L37 A;  1HNZ Q;  4DKA C;  2FFK B;  3KBX A;  5CV7 A;  4IJL A;  2CWA A;  1SNO A;  3S14 H;  5A2Q L;  1I6H H;  4IN3 A;  3D4R A;  1NCV A;  4X62 L;  2MP1 A;  4JBM A;  1M1K C;  5E7N A;  1AE2 A;  5ELC A;  4HIK A;  2KCN A;  4JCV E;  5FO7 B;  3MEH A;  2KCC A;  4DR1 L;  1D2B A;  3PO2 G;  2DN8 A;  4IPG A;  2F0H A;  2DUD A;  1QVF A;  3J7A F;  2OWO A;  1K73 C;  4CDC C;  4HCE A;  2KED A;  4A75 A;  1FL0 A;  1NMG A;  4K8J A;  1RF2 D;  1M90 C;  4KY6 A;  4O2D A;  4J15 A;  2VQE L;  4GLX A;  1BNZ A;  4L63 B;  1LAC A;  2K4K A;  2M00 A;  4TKO B;  4YY3 Q;  1E1O A;  3BDC A;  5IP7 G;  3DLL A;  3JAM c;  4HID A;  3S17 H;  4LF7 Q;  3SE0 A;  1V1P B;  2L0C A;  1CSQ A;  4POG A;  4PNY A;  1R4P B;  2OCE A;  2K01 A;  4CDF C;  2VNU D;  1BCP D;  3NUC A;  3NQT A;  4UP9 A;  3I4L A;  1VQI A;  3J7A V;  1SRU A;  2L11 A;  3A7A B;  1TT2 A;  1XXG A;  4IPC A;  3UI2 A;  2L55 A;  1PH9 A;  4A3B B;  2B63 G;  3TRZ A;  3HKS A;  2DJF C;  1VQJ A;  4JBW A;  1NR4 A;  2D9U A;  4QGU A;  4OO1 I;  1XNR Q;  1L0X B;  3CC7 A;  2R92 B;  3W2D A;  4RGO S;  1VQ7 A;  4HMJ A;  4FF3 A;  3A5Z B;  4DV4 L;  1DXM A;  1HNZ L;  1VQ6 A;  3TSS A;  1GD7 A;  2NWG A;  3J80 i;  3R2T A;  1SSO A;  4O0A A;  1I3Q B;  2UUA Q;  1LTL A;  2PNR C;  1RHP A;  2MQH A;  4BA1 I;  1I50 H;  1BCP B;  1B4O A;  2LS0 1;  1K8M A;  2M2L A;  1G91 A;  3M7G A;  1STA A;  3VYT A;  2VL6 A;  2K7V A;  1Q86 C;  4BY7 B;  5DNF A;  4DV7 L;  3EQL C;  1WYD A;  5EGT A;  2K03 A;  1CHQ D;  1GKH A;  1PH4 A;  2MUY A;  2R7Z B;  2EY2 A;  4YWL A;  1C7Y A;  3OIQ A;  1RL2 A;  2QGQ A;  4NKL A;  4XQJ A;  1V1Q A;  4K5W A;  4GN4 B;  4RG1 A;  2XWJ B;  1SYF A;  5C3X A;  4IFD G;  5IT9 E;  3MZ5 A;  3F2B A;  5IP7 H;  1ESR A;  4YY3 L;  1EIY B;  3H0G G;  2F0S A;  5IOD A;  1KLU D;  4ODG A;  2LMC B;  2VW9 A;  5T1I A;  5C0X G;  4LF7 L;  1S72 A;  1A2T A;  1LT4 D;  4ILW A;  3ULP A;  4A3J B;  3KLS X;  4A3K B;  2QDB A;  1EY9 A;  1BCP F;  1G8Z D;  3UDG A;  4DAY B;  1BF4 A;  5JPN C;  3I90 A;  4WJW A;  4X3T A;  1TS5 A;  2R93 G;  4OXP A;  3GTQ B;  5C3E B;  3K7A H;  1XNR L;  3NXW A;  1WTV A;  1T5X D;  1DOM A;  1KDC A;  3F1Z A;  2K5H A;  1KHI A;  1ZYR D;  4YWM A;  2X6L A;  4EQO A;  3CRK C;  1PTO D;  4IUR A;  4LW1 A;  3CCR A;  1LLR D;  1VCI A;  2B2U A;  2XNA C;  1X3F A;  1ICW A;  3HKZ G;  1EU3 A;  1OXS C;  2UUA L;  1A2U A;  3LGJ A;  3GTP B;  4BY1 G;  1VQM A;  3H6M A;  1SMY C;  2QW7 A;  5BN5 A;  3GP7 A;  2F0Q A;  1QWY A;  3D6W A;  4HIO A;  4K0K Q;  2JA9 A;  2J7Z A;  4BS9 A;  4JI6 L;  1QNK A;  2RBM A;  5JVG 3;  3I72 A;  2F0V A;  3QB3 A;  4MNO A;  2EE1 A;  2KEC A;  3I8Z A;  2C5C A;  4ZK9 B;  2ENB A;  2CKZ B;  4BXX G;  4IFD H;  1PTO B;  3A7L A;  1YNN C;  1LV9 A;  1EYA A;  4DR2 Q;  3GTK B;  4FF2 A;  2EJM A;  3CCQ A;  2F0G A;  3CME A;  4DNR B;  1BO0 A;  4XDX A;  1A63 A;  3J80 L;  5AFW A;  3UDX A;  2NN6 G;  1ROD A;  3Q0A A;  4DV3 Q;  3HKZ E;  2JA7 H;  2WIN B;  2E5L Q;  2PQE A;  1QJO A;  3D6C A;  4LF4 Q;  1JR0 D;  1S3O A;  1H9M A;  2F3V A;  4PZ8 A;  4X64 L;  3BVG A;  3RMH A;  2VZA A;  2CW0 C;  2R3Z A;  3PIO 3;  4N8X 1;  1SEB D;  3VR5 A;  2HDL A;  2ALY B;  2B3G A;  4L6T B;  2OT2 A;  4LUZ A;  2F4I A;  2B2V C;  1O7L A;  1BBX C;  3ER0 A;  2A69 C;  3G4S A;  5JJK A;  2F3W A;  5CR3 A;  2EVB A;  2WAC A;  2SEB D;  2ZT9 C;  4C1N K;  3MXN B;  1PTO F;  4RGM A;  3KDF A;  4YWK A;  2QEX A;  2BA0 A;  2A6H C;  1MIU A;  4BBS B;  3S9W A;  4JI0 Q;  1Y1W G;  3HOW G;  3FKI H;  2K05 A;  2RVL A;  2WV6 D;  4BY1 H;  3EBE A;  3RLO A;  2N8N A;  5JJI A;  1KXL A;  2IWH A;  2CH4 W;  1IBK Q;  1V8Q A;  2EYO A;  1X54 A;  2MHV A;  3G48 A;  5KRU A;  5J39 A;  4K0K L;  1JOO A;  4F87 A;  2WAQ G;  5A2Q E;  1LYL A;  4MHE A;  1YI2 A;  4KJN A;  1AP0 A;  3RZD B;  2A8V A;  4L8J A;  1SNQ A;  5KYL A;  3K5N A;  5AJ3 L;  2JXM B;  4BXX H;  4HN7 A;  1I4P A;  4DPG A;  2ATW A;  3EFX D;  3NTI A;  3T56 B;  4DR2 L;  1VQ4 A;  4O42 A;  5EPL A;  4RKB A;  4FYD A;  5I6W A;  1EYD A;  3HOV B;  2NN6 H;  1K28 A;  1K83 B;  1O78 A;  2PQA B;  3I56 A;  1N9W A;  3J81 c;  3DUZ A;  3R3O A;  4DV3 L;  2KEE A;  2JA8 G;  2MO0 A;  1BBW A;  1EUJ A;  4H13 C;  4HJ7 A;  3PF5 A;  2E5L L;  4GZY C;  3FHW A;  2A6E D;  4L5T A;  4LF4 L;  2AHO B;  1VQK A;  2JA7 B;  2NZ1 D;  2DGY A;  5BN4 A;  1SFO B;  2WB1 G;  2RQX A;  2VQF Q;  4OO1 G;  1IKL A;  2B39 A;  1D5Z C;  1NTG A;  5JVH 3;  3RD4 A;  3EIV A;  5FK9 C;  1EEF D;  2B2Y A;  1X9N A;  5C4J H;  3O13 A;  3T13 A;  1PFB A;  1BBU A;  1MI2 A;  3HOY H;  2ID0 A;  3S2H H;  2F0P A;  4WFN 3;  1BUV T;  2AQ3 B;  2I5H A;  2E2I B;  1HR0 L;  4UDU C;  4HJA A;  3NHH A;  1L1O A;  1BQQ T;  4GOP C;  1Y1W H;  4Q0F A;  2Q2T A;  3HOW H;  4RGN A;  4BWG B;  1IYU A;  5JEA G;  4A3M B;  4JI0 L;  3EVQ A;  1PH8 A;  1Z6H A;  1HNW Q;  4HSV A;  2IJ0 A;  1XMQ Q;  3FKI B;  1EL0 A;  1VQE A;  4ZQ3 A;  4IJH A;  1IBK L;  4R4I A;  1LT3 D;  4B9W A;  3IKJ A;  4ME5 A;  4FF1 A;  4L5R C;  3GTL B;  1HZC A;  2EYP A;  1XYI A;  3GTG B;  1QUQ B;  4FVM A;  1MSG A;  5JOB A;  4X3S A;  4RGT A;  4KN7 C;  3TN2 A;  2KVM A;  2WB1 E;  4C3J G;  2BH2 A;  5I9O A;  1IBL Q;  3A5U A;  1NBW A;  3K80 C;  2K28 A;  1HZ9 A;  1HTP A;  1IHZ A;  3PUY A;  1HR0 W;  2Q8R E;  3A8K E;  2BDN A;  1YNJ D;  4KKU A;  1JOQ A;  4R9W A;  2JA6 B;  1GO3 E;  2KOL A;  3PO3 B;  1WD1 A;  4AH6 A;  2JA8 H;  1X55 A;  2MJ8 A;  2AUJ D;  3HS0 C;  3ITP A;  1ENF A;  1HA5 A;  2JE6 I;  4A76 A;  1DJR D;  5M5W B;  3DWQ A;  4P71 A;  3KDF B;  1STH A;  3Q8D A;  4JVZ A;  4OO1 H;  1DOK A;  4DAP A;  2VQF L;  1HZB A;  3NEN A;  1ONL A;  2OF1 A;  2EXD A;  1JB3 A;  1C9O A;  4DV2 Q;  2EY1 A;  1A3T A;  1RCV D;  1EY4 A;  1H9S A;  3KF6 A;  5F2D A;  4ZUI A;  2Z6K C;  1QNU A;  1JOK A;  2NVQ B;  1Y1V B;  3VR2 A;  4H44 C;  1TWA H;  3J7Y W;  3MVV A;  3U58 A;  5I2X A;  4QB4 A;  4B3T Q;  4B3S L;  1O80 A;  3EJI A;  5JEA H;  5M3F G;  1AFP A;  3NWT A;  1WCM B;  4XTC S;  3HFZ B;  1Q1E A;  2F0L A;  1KTK A;  2OEO A;  2PPB C;  1HNW L;  3A8I E;  2LY7 A;  4MTK A;  3K81 C;  2LFN A;  4JC0 A;  1WI5 A;  3UE0 A;  1Z9F A;  4U67 3;  2RSO A;  1RTO A;  2FMC A;  1CKO A;  1PV4 A;  4A3E B;  1DZ1 A;  1PH1 A;  5EKK A;  1ZKO A;  5E4X A;  1CUK A;  4C3J H;  3S24 A;  3MEF A;  3C2P A;  3RN2 A;  1IBL L;  3KK7 A;  1P8L A;  3ERS X;  2YU9 H;  3SVM A;  2A68 D;  2RHQ B;  3GTO H;  3TP8 A;  5LL6 S;  5FJ8 G;  3MTS A;  2E74 C;  1MD2 D;  4A93 G;  3GQB A;  3KLS A;  2XGT A;  2RCN A;  1STB A;  2R6G A;  3MAQ A;  4RFB A;  4P73 A;  1B44 D;  1NJI C;  3P20 A;  3DXJ C;  1A3U A;  5GAG C;  1VF5 C;  1FNV A;  1L0Y B;  2E75 C;  1II3 A;  4G7H C;  3QIA A;  4IOA A;  3IRB A;  3GTJ B;  5LHY 1;  1U4P A;  1TWH H;  2RSN A;  2KCT A;  4JBK A;  1TS3 A;  3V05 A;  1JE5 A;  2K14 A;  5FLX c;  2M9V A;  4DV2 L;  1XPR A;  1N33 Q;  4DR7 Q;  4JI5 Q;  3ICE A;  5TSS A;  3SXH A;  3M85 A;  2FMM A;  2XVS A;  4PV1 C;  1R9T B;  1V1P A;  4GLV B;  1VQB A;  5T1G A;  1KLG D;  1DCZ A;  1FGB D;  1CKN B;  2Z1C A;  3DM1 A;  1YVC A;  5GAH C;  5M3F H;  4G7Z C;  4B3T L;  4LNQ A;  4A3B G;  1G29 1;  1K8G A;  3PIO A;  4C3H G;  2UUC Q;  3CPF A;  1WOC A;  2B2W A;  2F0T A;  3CCJ A;  1B3Q A;  3TP6 A;  3VYR A;  2D2C C;  2JSO A;  3BS1 A;  5FO9 B;  1O7I A;  3PUW A;  4IPH A;  4R4T A;  5FOB B;  5C4X G;  3W1G A;  4B3M Q;  3OYY A;  2F4V Q;  3C46 A;  2XN9 C;  2JA5 H;  4OHJ A;  1JQY D;  2YTV A;  5EKL A;  3OPO A;  2NVX B;  3S1N B;  1X3E A;  3V96 A;  1IBM Q;  3BYY B;  4BBR G;  1XNQ Q;  2FHT A;  2CQO A;  4IUU A;  3Q24 A;  4FXD A;  1E24 A;  4C1N I;  3K5M A;  5FJ8 H;  1C4Q A;  3MFY A;  3W3A A;  1E2W A;  1V43 A;  4A93 H;  3NE5 B;  2NB0 A;  2DJG C;  4GNX A;  2G9D A;  1KDA A;  2F0W A;  1UNS A;  5M3M H;  1EU4 A;  1Q1B A;  2Y0S G;  1VDZ A;  3C3L A;  2BA1 A;  2Q2I A;  3DM3 A;  5KIX A;  2HIV A;  1WTQ A;  4IUP A;  2NVY H;  4GS3 A;  4IUT A;  4IUV A;  1VQN A;  1CFM A;  5M5X H;  2ZTC A;  2A1A A;  1KAB A;  3KUP A;  1TWC H;  3CPW A;  1JJC B;  1B50 A;  4U68 A;  1N33 L;  4JI5 L;  3OSO A;  4PMB A;  1W6J A;  1MSH A;  3PQI A;  1PRT C;  4JI1 Q;  5K5P A;  3OMG A;  1WTX A;  2ICE C;  2LSS A;  4DAY A;  2HD3 A;  3S15 H;  2HIX A;  5GRO A;  4C3H H;  1FGU A;  1Y14 B;  1YBY A;  3OOC A;  2UUC L;  5C3E G;  1WTW A;  4NMZ A;  2IX0 A;  1D1I A;  1LT6 D;  4CHT B;  4JV5 Q;  4QUF A;  1K0S A;  3PUV A;  3TP5 A;  1GJX A;  5BR8 Q;  2KA7 A;  1Q90 A;  2Y0S E;  4DK3 C;  4RKL A;  5C4X H;  3HOX B;  4A3G H;  4MN3 A;  3KBG A;  1PXU A;  2F4V L;  1PDQ A;  5KNB A;  3F2D A;  4HTH A;  2JP1 A;  1B9N A;  1RTN A;  5ELF A;  3TS0 A;  3IAY A;  3M4O H;  2B2U C;  1ET9 A;  4GLA C;  3S2D H;  2JA5 B;  4BBR H;  1IW7 D;  4DR3 Q;  1Q3L A;  1IBM L;  1XNQ L;  1TWG H;  3S16 H;  1EQT A;  5K36 G;  4XIG S;  3HOU G;  3AU7 A;  4DAV A;  2A19 A;  1X3P A;  3DWA A;  3CQZ H;  4OGQ C;  5I2Y A;  3CXC A;  2TSS A;  4JI4 Q;  1Q81 C;  1I5F A;  2F0I A;  3SGI A;  3DWP A;  2N55 A;  4XT3 B;  1K3R A;  3IL8 A;  5C5M A;  3I4N B;  2AMC B;  1VF7 A;  5M5Y B;  1L0W A;  1EWH A;  1N36 Q;  2GVB A;  1CSP A;  2AQ2 B;  4A3C G;  1NR2 A;  2H5X A;  3JAM E;  5C4H A;  1FVI A;  2OTL A;  2K5Q A;  4PZ6 A;  1I4Q A;  4KLK A;  4QQB X;  3GO5 A;  1A15 A;  1RDP D;  1KC8 C;  4GKK Q;  2EDG A;  2DNE A;  1KIX A;  2PO4 A;  4M1U B;  1XJV A;  4NXM Q;  2QCP X;  3T1Y Q;  3GTM B;  3R2I A;  3ONA B;  2FIN B;  4X3K A;  1VQF A;  3AMU A;  1PZJ D;  2O4X A;  1PH7 A;  4JI1 L;  2K6A A;  4XYQ A;  2WII B;  4NXN Q;  5JJZ A;  2VS1 A;  3K0X A;  3OW2 A;  1SBB B;  4A3F G;  4FF4 A;  4K14 A;  2R7F A;  4DN4 M;  5JPM C;  1RD9 D;  3E0J A;  5FLM G;  1S40 A;  4HR7 B;  3M4Q A;  4TRD A;  1TVX A;  3CMA A;  3S14 B;  2K5D A;  4JV5 L;  1I6H B;  1ESF A;  3BDL A;  5BR8 L;  5ELO A;  4KN4 C;  2EYL A;  1SAP A;  4HSP A;  4ABN A;  4P72 A;  2BE5 D;  3MXN A;  4GNX B;  3AEV A;  1UE7 A;  5ELN A;  3PO2 H;  4A3G B;  3DEP A;  5KYI A;  3ULL A;  1F2Y A;  4KI0 A;  4C56 C;  4DR3 L;  4ID6 A;  3VA5 A;  5K36 H;  2OQK A;  1T9H A;  3HOU H;  1ZEQ X;  2RDG A;  1HXY D;  3KJO A;  4MTN A;  4JI4 L;  1QVG A;  4NW2 A;  5IYC G;  5EPK A;  1UEB A;  1VMP A;  3T53 B;  5DAU A;  3X3N A;  5IT9 c;  2ZJR A;  1AZQ A;  1D6E C;  4OWT B;  1N36 L;  2PMZ E;  4A3C H;  2LXJ A;  3S17 B;  2V4D A;  2AWN A;  2CCZ A;  4IFD J;  4KD3 A;  4X66 Q;  1A6X A;  2SNM A;  4AYB G;  2IX3 A;  4P74 A;  1M4V A;  2B63 H;  4POF A;  1AH9 A;  3BU2 A;  3TZU A;  2PQA A;  3UE1 A;  1EQV A;  1YHA A;  2NTS A;  5FKA C;  5J1Z A;  4KKS A;  4G4K A;  1CKM A;  2MGS A;  4J1M A;  4NXM L;  3T1Y L;  4LUO A;  4S3S A;  1STN A;  1ENA A;  1EQR A;  1PVO A;  4NXN L;  4O1N A;  4WJ3 M;  1NAP A;  4A3F H;  1S5C D;  3K5L A;  3CRL C;  3NK9 A;  1PZK D;  1JIC A;  5FLM H;  4YIJ A;  2K32 A;  1HTL D;  5E3F A;  4IZ8 A;  1PYW D;  2FXQ A;  2B2Y C;  1I6V C;  3OHX C;  2GA4 B;  5IGG A;  1I50 B;  2G9H D;  2FJ2 A;  3E0E A;  1CT1 D;  3VYU A;  1F2L A;  1LTS D;  4J8Q A;  4OEL B;  1VQD A;  5IYD G;  4NPS A;  4K6L A;  3CF5 A;  1MJC A;  4A3D G;  1GHJ A;  3Q22 A;  1L1O C;  4JYA Q;  3SR1 A;  1Z7T A;  3I3C A;  4H02 A;  2Q8I B;  1D7Q A;  1J5E Q;  1HCZ A;  4DR6 Q;  3V2T A;  3H0G H;  1J8I A;  4JI8 Q;  2VY3 A;  3RLN A;  3WOF A;  5IYC H;  1QUQ A;  4CDE C;  2B8F A;  2EYJ A;  1CZG A;  2JK8 A;  5C0X H;  4IQZ A;  1A8V A;  2X6G A;  3GD7 A;  3ND8 A;  3MXG A;  2AQ1 B;  3J7Z C;  4NB3 A;  4LFA Q;  2BDO A;  2F0N A;  4XXE A;  2F1M A;  1ML0 D;  3Q6S A;  1C48 A;  3AYH B;  4X66 L;  3ULJ A;  4L5Q A;  1SE3 A;  3H3V I;  3CD6 A;  1JC7 A;  3PO3 G;  3M7N A;  1D5M C;  3CU7 A;  1RIP A;  2R93 H;  1K8A C;  2Z8L A;  1LT5 D;  1WTO A;  3CCM A;  3BJU A;  2E8G A;  1ZXT A;  1SLJ A;  2RDF A;  4DR4 Q;  4DNT B;  4OIJ A;  3M3Y H;  1U9R A;  3K7A B;  2XRS D;  1VQ9 A;  1SE2 A;  1JB7 A;  1Y8O B;  1XMO Q;  1EY7 A;  5M9O A;  1Q46 A;  1I4G A;  1B9M A;  2D0P A;  1G6Z A;  3GV3 A;  4QMG A;  3HEJ A;  1JMC A;  3NBH A;  4DF7 A;  4NDX A;  4EGV A;  5IYB G;  2PMZ B;  2RHS B;  2K1B A;  1BDO A;  4ZKC B;  5GQO A;  3FVQ A;  2NTT A;  5IYD H;  2OTJ A;  1CK1 A;  1PFM A;  3RLF A;  1XTD A;  2EY6 A;  4A3D H;  4Y7N H;  1KAW A;  3CC4 A;  4JYA L;  4RCN A;  4ALP A;  4P2C B;  3OTO Q;  1XWE A;  1GUT A;  1W2B A;  3QO2 A;  4F7X A;  4XYO A;  1E2Z A;  5ISR A;  1YNX A;  1J5E L;  2BCO A;  2LXK A;  1GUW A;  3RNU A;  4DR6 L;  4OEM B;  1GM5 A;  1PHJ A;  2AKW B;  3MA2 B;  4K8I A;  4LMQ D;  4JI8 L;  5KGU A;  3U50 C;  1UWV A;  5CYU A;  3A56 A;  3FDT A;  4UP7 A;  5CV8 A;  2PNH A;  2EYH A;  4A3L G;  3CHB D;  4LFA L;  3SEB A;  1VQO A;  3S1Q H;  2A73 B;  1Y69 U;  3J81 E;  3AQQ A;  2MO1 A;  1KNA A;  1UE5 A;  1EQQ A;  3PSI A;  4H7B A;  2WAQ E;  3C1E A;  4ULL A;  3X3M A;  2PZW A;  2VUM G;  5DM7 3;  1WJJ A;  2B2T A;  3RZO H;  2E2H H;  1IL8 A;  1I4X A;  5EKI A;  1DM0 B;  3A8J E;  4HMI A;  3HOZ G;  2P5Z X;  1N8R C;  2AUK A;  4UY8 C;  3H3V C;  3OWE B;  1K9M C;  1X3Q A;  4GN5 A;  2PI2 E;  1XMO L;  2UUB Q;  2HUG A;  1SXT A;  2NUC A;  3AFP A;  4JW0 A;  1WFQ A;  1YJN A;  5KEE A;  4CKB A;  3T16 A;  5CMD A;  2L5T A;  2UU9 Q;  5IYB H;  3HKZ B;  3G6E A;  5FO8 B;  4K5V A;  4BY1 B;  1W3S A;  5C44 G;  1LTG D;  1S5F D;  1STG A;  1MKH A;  1CKN A;  2KQ3 A;  5J22 A;  2K04 A;  2QEJ C;  4C3I G;  2NVT H;  2E76 C;  5JEA J;  1B3A A;  2Z4H A;  2B2W C;  2NYZ D;  3ZJY C;  1M8A A;  2XIW A;  2UXB Q;  3CCL A;  3CCE A;  3I4M G;  2NBF A;  2CQA A;  4C2M H;  3JAM L;  1JWU D;  1JWM D;  4XT1 B;  2EJF C;  1I4H A;  4CKC A;  5HUR A;  2F0E A;  1F77 A;  3FEW X;  2K33 A;  2EIF A;  1PZI D;  1QVC A;  1Q82 C;  4A3L H;  1Q8I A;  2Z4I A;  5A35 A;  1EWI A;  1AEX A;  3AFQ A;  3NBI A;  1SYC A;  2E2J H;  2WFW A;  1BCP C;  4CJ2 C;  4GN3 B;  2K75 A;  4LF6 Q;  4A3I G;  1LAB A;  2VUM H;  5J3B A;  3NBH B;  4GNX C;  4L5S A;  2SOB A;  1WD0 A;  1YZ6 A;  4QF4 A;  4KD4 A;  1JWS D;  1AE3 A;  3HOZ H;  1U4M A;  2E2D C;  3M4Y A;  4OON A;  2NZH A;  2C9O A;  4JBJ A;  5CV9 A;  4X65 Q;  1CHP D;  5C4J B;  3E5S A;  4TSS A;  1N32 Q;  4YHH Q;  3HOY B;  1B7Y B;  3S2H B;  4IUN A;  3EA6 A;  4PZ7 A;  3D31 A;  2UUB L;  2KUM A;  2K50 A;  1HH2 P;  2KHJ A;  4PQX A;  1YHQ A;  2IPK D;  3FMC A;  1LTI D;  2UU9 L;  1Y1W B;  3HOW B;  1F9S A;  1GOZ A;  1XMQ L;  3TDQ A;  5C44 H;  3CAM A;  1PMR A;  3LNN A;  2NZO A;  1SYE A;  1XX8 A;  2VB2 X;  2BE5 C;  4K6D A;  3LWU A;  4C3I H;  3R93 A;  2WAQ B;  4KHZ A;  3NP8 A;  1YEZ A;  4IO9 A;  3HZX A;  2F3I A;  1SMY D;  2ZXR A;  2UXB L;  1Q7Y C;  1F2M A;  5C5L A;  1Y8N B;  4EX5 A;  3VDY A;  2XRQ D;  4RAU C;  1JJ2 A;  3UDF A;  1UEA B;  4R4Q A;  1TWF H;  1OXV A;  3NEM A;  1YHB A;  2I07 B;  4LF5 Q;  1S5E D;  4F8M A;  1HFG A;  1NE3 A;  3KJP A;  3S1M H;  4FDB A;  1EEI D;  4RCO A;  1WTP A;  2EOT A;  3QOJ A;  2JA8 B;  1VQA A;  1YNN D;  2CH4 A;  3OIP A;  3NTH A;  2I5L X;  1CI3 M;  3LWE A;  4A3I H;  4P75 A;  1F9P A;  1IL2 A;  3I4N G;  4LF6 L;  2WB1 B;  4HCS A;  1KQS A;  2IX1 A;  3PMF A;  1SND A;  2N88 A;  4CBV A;  1HQR D;  1F9R A;  1DD2 A; 
#chains in the Genus database with same CATH homology
 4G57 A;  2F0K A;  2R61 A;  5FLX E;  4V0B A;  1ZYR C;  1RKN A;  2JEB I;  3U9O A;  2CW0 D;  2L4N A;  1PTO C;  5C4Z A;  4QUC A;  2ZXO A;  1TWA B;  5D3I B;  1CZW A;  1S4Z A;  3DEO A;  2D62 A;  5EBD A;  2IT1 A;  3SDZ A;  1B53 A;  4Q5V A;  3HP3 A;  1G2T A;  1WVL A;  5LL6 X;  2HCC A;  1J9O A;  4DK1 A;  2A6H D;  4KK7 A;  2PZT A;  5COY A;  1FR3 A;  4E6I A;  1LTB D;  2EJG C;  4C3J B;  1GHK A;  2OXP A;  2EPB A;  2O2L D;  3K57 A;  2YU9 B;  1LTT D;  4KV6 A;  1CA5 A;  3GTO B;  2PW5 A;  4RHR A;  4Z9C B;  2RDH A;  2SDF A;  4RWS C;  5KNC A;  4OL7 A;  1KNE A;  1O7Y A;  3P1H A;  1S5B D;  1TWH B;  4UAI A;  5ELD A;  4FXK C;  1G2S A;  5G3L D;  1W6K A;  3MWY W;  3OMC A;  3D3R A;  4KTA A;  3NSW A;  2Q8T A;  2F0U A;  2YYZ A;  1NSN S;  3QWN A;  1QE6 A;  5CV4 A;  4KY7 A;  1MBY A;  3TP7 A;  5D3D A;  5M3F B;  1EFI D;  2PW7 A;  1SDF A;  1SNP A;  1LTA D;  1IKM A;  5ELB A;  1FNW A;  1E2V A;  2CHB D;  4ZYS A;  5CV6 A;  3BVM A;  1HUN A;  5IGB A;  2KJX A;  2F0D A;  5IOC A;  1JOR A;  3OW7 A;  1QG7 A;  5JAV A;  3FPP A;  2IL8 A;  3J81 L;  4FO2 A;  4A93 B;  1STY A;  1EIG A;  3H09 A;  4KMU C;  1HA6 A;  5M3M B;  1EY0 A;  5C3W A;  2A6E C;  4ZAI A;  3GV6 A;  3KLR A;  2IW3 A;  2WKC A;  2NVY B;  4X3U A;  4K2L A;  5M5X B;  1OXT A;  1TWC B;  5G3L F;  5IGC A;  1JE4 A;  3OWF A;  3SHL A;  3MHB A;  1B1Z A;  3SK5 A;  1SYG A;  4FNF A;  3S15 B;  2BOS A;  4EQN A;  2HCI A;  4C3H B;  1SE4 A;  5CC4 A;  3N6R A;  4KJO A;  4HED A;  5HGT A;  3URY A;  1QB5 D;  2QIL A;  1Z47 A;  5C4X B;  1I4R A;  5I4D A;  5CGK A;  1LTR D;  5BN3 A;  4LK1 C;  5CBE E;  1DON A;  3M4O B;  3S2D B;  3QOL A;  4IAL A;  4BBR B;  5I9P A;  1OXX K;  3L7Z C;  1EY5 A;  3G7L A;  1K8O A;  1TWG B;  1OO9 B;  1YNJ C;  3S16 B;  2EY5 A;  1FD7 D;  2H1E A;  3HG9 A;  3CQZ B;  1SNM A;  4I7Z C;  1PTO H;  1HUM A;  2Y0S B;  3TZD A;  1D1K A;  1PFN A;  1TII D;  4OIK A;  3BZD B;  4M8A A;  2DY7 A;  1RJT A;  1TY0 A;  4BA2 I;  1SYB A;  5C0X J;  3H91 A;  1A3V A;  1TU2 B;  1GUS A;  2F0M A;  2RA4 A;  3G6J B;  3K59 A;  4JK1 C;  2PYK A;  3PV0 A;  1C8C A;  2O5J C;  4PMW A;  4I65 A;  2B2T C;  4R8N A;  4V19 0;  4N9T A;  4FXG C;  5DM6 3;  3HGB A;  3H94 A;  1HQM C;  3PO2 B;  2ZXP A;  2A68 C;  3PUZ A;  1CA6 A;  3E6Z X;  1X32 A;  3WOE A;  4DGZ A;  3HOU B;  3IFT A;  4QCL A;  5D65 A;  3QG1 A;  1TS2 A;  2H4O A;  3I73 A;  2JEA I;  3LX0 A;  2SNS A;  2XSC A;  3A54 A;  1STE A;  3CKI B;  5FLX L;  1ILQ A;  1H9R A;  2CVR A;  1AW7 A;  5I6Y A;  3D4D A;  2AWO A;  4CGY B;  1XTC D;  3C1F A;  2F0F A;  4XQN A;  1CTM A;  2B63 B;  2HDM A;  1TQO A;  3MXU A;  1IYV A;  3K6O A;  1QOH A;  2PZU A;  1TS4 A;  4A3F B;  5IGF A;  5CV5 A;  3L3O C;  3RUZ A;  2WP8 J;  3ERO A;  3KF8 A;  1PRT D;  1GXD C;  5CBA E;  3DHQ A;  1EOT A;  1MGS A;  4TQU S;  3WDN A;  1EIH A;  1CQV A;  3PIP 3;  4RH6 A;  1BXT A;  1HPC A;  3NPP A;  4KY5 A;  5IGE A;  3NWS A;  2J4X A;  4DXG A;  1FYC A;  1SJE D;  3D4W A;  2KHS A;  4J6H A;  3H0G B;  4N9P A;  2MPM A;  3QJY A;  3BYT B;  4LJZ C;  1PRT B;  2ICI A;  1BR9 A;  3U9S A;  1ENC A;  1KDB A;  3IFD A;  4AYB B;  3VR6 A;  4RHS A;  3FRP B;  1EZ6 A;  2R93 B;  4K5X A;  1TKW B;  1VMC A;  3M3Y B;  4HAE A;  3BG3 A;  4H0L C;  2EXZ A;  3L9A X;  1AN8 A;  4ZLT F;  4DU9 A;  4NP5 A;  1PRT F;  1SJH D;  3P75 A;  4WOR A;  1H9J A;  1EY8 A;  3VR3 A;  3BVZ A;  1BOS A;  1DOL A;  1HHV A;  2VB3 X;  4A3D B;  3A55 A;  4MIU A;  1HFN A;  4Y7N B;  5KND A;  1IW7 C;  1ET6 A;  5ELE A;  1S5D D;  1FNU A;  1U4R A;  5IGD A;  1OXU A;  1Y8P B;  4DFA A;  4DA2 A;  3SK6 A;  1TR5 A;  1EWC A;  1AZP A;  1NUC A;  1B2T A;  2A74 C;  4CJ1 B;  3S1Q B;  4G7O C;  4K2K A;  3K58 A;  2B2V A;  3MC0 B;  1HRJ A;  1SNC A;  3ERQ A;  1DYQ A;  5E1F A;  1V1O A;  3RZO B;  2E2H B;  1EZ8 A;  2EYF A;  2D5D A;  1H9K A;  4WRD A;  1F2Z A;  5COR A;  2X69 A;  1CM9 A;  3K5O A;  2EZV A;  4EVO A;  5NUC A;  5DEH A;  3DMU A;  2F0J A;  2HQE A;  1JCK B;  2I46 A;  2NVT B;  1D5X C;  1E0B A;  1QCB D;  3D8G A;  1ILP A;  5IT9 L;  4C2M B;  4DXF A;  4KHV A;  1QIL A;  1SYD A;  3T51 B;  2XWB B;  3SK8 A;  3ZYY X;  5EPJ A;  2VXW A;  1PLF A;  4B08 A;  3AB9 A;  5E4W C;  3FPU B;  2DNC A;  5EBC A;  4CJ0 B;  2E2J B;  3VYS A;  4IFD I;  4XQQ A;  3T4A C;  4B9X A;  2QKI C;  2VUM B;  2A5H A;  1R4Q B;  3F2U A;  4ZKB B;  2B8G A;  2JYO A;  3HOZ B;  5C0X I;  3I70 A;  3ND9 A;  3J80 E;  4F88 A;  3N52 A;  1O7Z A;  3NQI A;  3NTK A;  2A69 D;  5D14 A;  4ZRZ A;  1GUN A;  1Q12 A;  1T5E A;  2L12 A;  5C44 B;  1F9Q A;  3MXP A;  3I91 A;  3TME A;  4C3I B;  4QIW B;  4EQP A;  3VR4 A;  3HRZ C;  3I4M B;  3BDO A;  3MFG A;  2PCF B;  2L9H A;  5C6A A;  2EYM A;  1UAP A;  1WTR A;  1TWF B;  1UUP A;  2DY8 A;  3R8B A;  3PUX A;  3K0Y A;  3SK4 A;  3S1M B;  2WKD A;  3P7J A;  2LKV A;  4CKE A;  3TBI B;  5EQ0 A;  4R8I A;  4IUQ A;  5EJW A;  4ZUJ A;  4A3I B;  1H9S B;  2TMP A;  2J0T D;  2L1B A;  4FP5 D;  2NN6 I;  4LAA A;  1U4L A;  1LO5 D;  2O5I C;  2RKS A;  3VA7 A;  2QF7 A;  4KKT A;  3Q23 A;  1KAA A;  4PMC A;  1GUG A;  1GUO A;  1EY6 A;  1EYC A;  4DK0 A;  1CQF A;  2F0O A;  2K5W A;  4RA8 A;  2F03 A;  1TY2 A;  5IIF A;  3S1R B;  2FFK B;  3KBX A;  5CV7 A;  1SNO A;  5A2Q L;  4IN3 A;  3D4R A;  1NCV A;  2MP1 A;  5ELC A;  2KCN A;  5FO7 B;  3MEH A;  2KCC A;  1D2B A;  2DN8 A;  2F0H A;  3J7A F;  4HCE A;  2KED A;  4K8J A;  1RF2 D;  4KY6 A;  1BNZ A;  4L63 B;  1LAC A;  2M00 A;  4TKO B;  3BDC A;  3SE0 A;  1V1P B;  2L0C A;  4PNY A;  1R4P B;  2K01 A;  2VNU D;  1BCP D;  3NUC A;  3NQT A;  3I4L A;  3J7A V;  2L11 A;  3A7A B;  1TT2 A;  1XXG A;  3UI2 A;  2L55 A;  4A3B B;  4JBW A;  1NR4 A;  2D9U A;  4OO1 I;  1L0X B;  2R92 B;  3W2D A;  4RGO S;  4HMJ A;  4FF3 A;  1DXM A;  3TSS A;  2NWG A;  3R2T A;  1SSO A;  1I3Q B;  2PNR C;  1RHP A;  4BA1 I;  1BCP B;  1B4O A;  2LS0 1;  1K8M A;  2M2L A;  1G91 A;  3M7G A;  1STA A;  3VYT A;  2K7V A;  4BY7 B;  5DNF A;  3EQL C;  5EGT A;  2K03 A;  1CHQ D;  2R7Z B;  2MUY A;  2EY2 A;  3OIQ A;  4XQJ A;  4NKL A;  4K5W A;  2XWJ B;  1SYF A;  5C3X A;  4IFD G;  5IT9 E;  3MZ5 A;  1ESR A;  2F0S A;  5IOD A;  1KLU D;  4ODG A;  2LMC B;  5T1I A;  5C0X G;  1A2T A;  1LT4 D;  4ILW A;  4A3J B;  3KLS X;  4A3K B;  2QDB A;  1EY9 A;  1BCP F;  1G8Z D;  1BF4 A;  5JPN C;  3I90 A;  4WJW A;  4X3T A;  1TS5 A;  3GTQ B;  5C3E B;  3NXW A;  1WTV A;  1T5X D;  1DOM A;  1KDC A;  1ZYR D;  2X6L A;  4EQO A;  3CRK C;  1PTO D;  4IUR A;  1LLR D;  1VCI A;  2B2U A;  2XNA C;  1ICW A;  1EU3 A;  1OXS C;  1A2U A;  3GTP B;  3H6M A;  1SMY C;  5BN5 A;  3GP7 A;  2F0Q A;  1QWY A;  3D6W A;  2J7Z A;  4BS9 A;  1QNK A;  2RBM A;  5JVG 3;  3I72 A;  2F0V A;  3QB3 A;  2EE1 A;  2KEC A;  3I8Z A;  2C5C A;  4ZK9 B;  2ENB A;  4IFD H;  1PTO B;  3A7L A;  1YNN C;  1LV9 A;  1EYA A;  3GTK B;  4FF2 A;  2EJM A;  2F0G A;  4DNR B;  1BO0 A;  4XDX A;  3J80 L;  5AFW A;  2NN6 G;  1ROD A;  3Q0A A;  2WIN B;  2PQE A;  1QJO A;  3D6C A;  1JR0 D;  1H9M A;  2F3V A;  3BVG A;  3RMH A;  2CW0 C;  2R3Z A;  3PIO 3;  1SEB D;  3VR5 A;  2HDL A;  4L6T B;  2OT2 A;  2F4I A;  2B2V C;  1O7L A;  1BBX C;  2A69 C;  2F3W A;  5CR3 A;  2EVB A;  2WAC A;  2SEB D;  2ZT9 C;  4C1N K;  1PTO F;  4RGM A;  2BA0 A;  2A6H C;  4BBS B;  3S9W A;  2K05 A;  2RVL A;  2WV6 D;  2IWH A;  1V8Q A;  2EYO A;  2MHV A;  5KRU A;  5J39 A;  1JOO A;  4F87 A;  5A2Q E;  4MHE A;  4KJN A;  1AP0 A;  3RZD B;  4L8J A;  1SNQ A;  5KYL A;  3K5N A;  2JXM B;  4HN7 A;  1I4P A;  3EFX D;  3NTI A;  3T56 B;  4O42 A;  5EPL A;  4RKB A;  4FYD A;  5I6W A;  1EYD A;  3HOV B;  2NN6 H;  1K83 B;  1O78 A;  3DUZ A;  3R3O A;  2KEE A;  4H13 C;  4GZY C;  2A6E D;  2JA7 B;  2NZ1 D;  5BN4 A;  1SFO B;  4OO1 G;  2RQX A;  1IKL A;  2B39 A;  1D5Z C;  5JVH 3;  3RD4 A;  5FK9 C;  1EEF D;  2B2Y A;  3O13 A;  3T13 A;  1PFB A;  1MI2 A;  2ID0 A;  2F0P A;  4WFN 3;  1BUV T;  2AQ3 B;  2E2I B;  4UDU C;  3NHH A;  1BQQ T;  4Q0F A;  4RGN A;  4BWG B;  1IYU A;  5JEA G;  4A3M B;  3EVQ A;  1Z6H A;  4HSV A;  2IJ0 A;  1EL0 A;  3FKI B;  4ZQ3 A;  1LT3 D;  4B9W A;  3IKJ A;  4ME5 A;  4FF1 A;  3GTL B;  2EYP A;  1XYI A;  3GTG B;  4FVM A;  1MSG A;  5JOB A;  4X3S A;  4RGT A;  4KN7 C;  3TN2 A;  2KVM A;  4C3J G;  5I9O A;  2K28 A;  1HTP A;  1IHZ A;  3PUY A;  2Q8R E;  3A8K E;  2BDN A;  1YNJ D;  4KKU A;  1JOQ A;  4R9W A;  2JA6 B;  2KOL A;  3PO3 B;  1WD1 A;  2MJ8 A;  2AUJ D;  3HS0 C;  3ITP A;  1ENF A;  1HA5 A;  2JE6 I;  1DJR D;  5M5W B;  3DWQ A;  1STH A;  4OO1 H;  1DOK A;  4DAP A;  1ONL A;  2OF1 A;  1JB3 A;  2EY1 A;  1A3T A;  1RCV D;  1EY4 A;  1H9S A;  5F2D A;  4ZUI A;  1QNU A;  1JOK A;  2NVQ B;  1Y1V B;  3VR2 A;  4H44 C;  3J7Y W;  3MVV A;  5I2X A;  4QB4 A;  1O80 A;  3EJI A;  5JEA H;  1AFP A;  3NWT A;  1WCM B;  4XTC S;  1Q1E A;  2F0L A;  1KTK A;  2OEO A;  2PPB C;  3A8I E;  2LY7 A;  2LFN A;  4U67 3;  2RSO A;  1RTO A;  2FMC A;  4A3E B;  1DZ1 A;  5EKK A;  1ZKO A;  5E4X A;  3C2P A;  3KK7 A;  3SVM A;  2A68 D;  3TP8 A;  5LL6 S;  3MTS A;  2E74 C;  1MD2 D;  3GQB A;  3KLS A;  1STB A;  2R6G A;  3MAQ A;  4RFB A;  1B44 D;  3P20 A;  3DXJ C;  1A3U A;  1VF5 C;  1FNV A;  1L0Y B;  2E75 C;  1II3 A;  4G7H C;  3QIA A;  3GTJ B;  5LHY 1;  1U4P A;  2RSN A;  1TS3 A;  3V05 A;  2M9V A;  5TSS A;  3SXH A;  3M85 A;  2FMM A;  2XVS A;  4PV1 C;  1R9T B;  1V1P A;  5T1G A;  1KLG D;  1DCZ A;  1FGB D;  2Z1C A;  3DM1 A;  4G7Z C;  1G29 1;  4C3H G;  2B2W A;  2F0T A;  3TP6 A;  3VYR A;  2D2C C;  2JSO A;  3BS1 A;  5FO9 B;  3PUW A;  5FOB B;  3C46 A;  2XN9 C;  4OHJ A;  1JQY D;  5EKL A;  3OPO A;  2NVX B;  3S1N B;  3V96 A;  3BYY B;  2FHT A;  3Q24 A;  4IUU A;  4FXD A;  4C1N I;  3K5M A;  1C4Q A;  3MFY A;  3W3A A;  1E2W A;  1V43 A;  3NE5 B;  2NB0 A;  2G9D A;  1KDA A;  2F0W A;  1UNS A;  1EU4 A;  1Q1B A;  1VDZ A;  3C3L A;  2BA1 A;  5KIX A;  1WTQ A;  4IUP A;  4IUT A;  4IUV A;  1CFM A;  1KAB A;  3KUP A;  1B50 A;  4U68 A;  3OSO A;  4PMB A;  1W6J A;  1MSH A;  1PRT C;  5K5P A;  3OMG A;  1WTX A;  2ICE C;  4DAY A;  3OOC A;  1WTW A;  4NMZ A;  2IX0 A;  1D1I A;  1LT6 D;  4CHT B;  4QUF A;  3PUV A;  3TP5 A;  1GJX A;  2KA7 A;  1Q90 A;  4RKL A;  3HOX B;  4MN3 A;  3KBG A;  1PXU A;  1PDQ A;  5KNB A;  4HTH A;  2JP1 A;  1B9N A;  1RTN A;  5ELF A;  3IAY A;  2B2U C;  1ET9 A;  2JA5 B;  1IW7 D;  1Q3L A;  1EQT A;  5K36 G;  4XIG S;  3AU7 A;  4DAV A;  1X3P A;  3DWA A;  5I2Y A;  4OGQ C;  2TSS A;  2F0I A;  3DWP A;  2N55 A;  4XT3 B;  3I4N B;  3IL8 A;  5C5M A;  1VF7 A;  5M5Y B;  1EWH A;  2AQ2 B;  1NR2 A;  3JAM E;  5C4H A;  2K5Q A;  1I4Q A;  3GO5 A;  1A15 A;  1RDP D;  2EDG A;  2DNE A;  2PO4 A;  4M1U B;  2QCP X;  3GTM B;  3R2I A;  3ONA B;  2FIN B;  4X3K A;  3AMU A;  1PZJ D;  2O4X A;  2K6A A;  4XYQ A;  2WII B;  5JJZ A;  1SBB B;  4FF4 A;  4K14 A;  4DN4 M;  5JPM C;  1RD9 D;  3E0J A;  4HR7 B;  4TRD A;  1TVX A;  3S14 B;  2K5D A;  1I6H B;  1ESF A;  3BDL A;  4KN4 C;  2EYL A;  1SAP A;  4HSP A;  4ABN A;  2BE5 D;  3MXN A;  4A3G B;  3DEP A;  5KYI A;  1F2Y A;  4KI0 A;  4C56 C;  4ID6 A;  3VA5 A;  5K36 H;  1ZEQ X;  2RDG A;  1HXY D;  4NW2 A;  5EPK A;  1VMP A;  3T53 B;  5DAU A;  3X3N A;  1AZQ A;  1D6E C;  3S17 B;  2V4D A;  2AWN A;  4IFD J;  4KD3 A;  1A6X A;  2SNM A;  2IX3 A;  1M4V A;  3TZU A;  1EQV A;  2NTS A;  5FKA C;  5J1Z A;  4KKS A;  4G4K A;  2MGS A;  4J1M A;  4S3S A;  1STN A;  1ENA A;  4O1N A;  1NAP A;  1S5C D;  3K5L A;  3CRL C;  3NK9 A;  1PZK D;  1JIC A;  4YIJ A;  2K32 A;  1HTL D;  5E3F A;  4IZ8 A;  1PYW D;  2B2Y C;  1I6V C;  3OHX C;  2GA4 B;  5IGG A;  1I50 B;  2G9H D;  2FJ2 A;  1CT1 D;  3VYU A;  1F2L A;  1LTS D;  4J8Q A;  4K6L A;  1GHJ A;  3Q22 A;  3SR1 A;  1Z7T A;  3I3C A;  2Q8I B;  1HCZ A;  3V2T A;  1J8I A;  3WOF A;  2B8F A;  2EYJ A;  1CZG A;  5C0X H;  4IQZ A;  2X6G A;  3GD7 A;  3ND8 A;  3MXG A;  2AQ1 B;  2BDO A;  2F0N A;  4XXE A;  2F1M A;  1ML0 D;  3Q6S A;  1C48 A;  1SE3 A;  1JC7 A;  3M7N A;  1D5M C;  3CU7 A;  2Z8L A;  1LT5 D;  1WTO A;  1ZXT A;  2RDF A;  4DNT B;  4OIJ A;  1U9R A;  3K7A B;  2XRS D;  1SE2 A;  1Y8O B;  1EY7 A;  5M9O A;  1I4G A;  1B9M A;  1G6Z A;  3GV3 A;  4QMG A;  3HEJ A;  3NBH A;  4DF7 A;  4NDX A;  4EGV A;  2PMZ B;  2K1B A;  1BDO A;  4ZKC B;  3FVQ A;  2NTT A;  1CK1 A;  1PFM A;  3RLF A;  2EY6 A;  4RCN A;  4P2C B;  1XWE A;  1GUT A;  3QO2 A;  4F7X A;  4XYO A;  1E2Z A;  5ISR A;  2BCO A;  1GUW A;  4LMQ D;  3MA2 B;  4K8I A;  5KGU A;  5CYU A;  3A56 A;  3FDT A;  5CV8 A;  2EYH A;  3CHB D;  3SEB A;  2A73 B;  1Y69 U;  3J81 E;  1KNA A;  4H7B A;  4ULL A;  3C1E A;  3X3M A;  2PZW A;  5DM7 3;  2B2T A;  1IL8 A;  1I4X A;  5EKI A;  1DM0 B;  3A8J E;  4HMI A;  2AUK A;  3H3V C;  3OWE B;  1X3Q A;  2HUG A;  1SXT A;  2NUC A;  5KEE A;  4CKB A;  3T16 A;  5CMD A;  2L5T A;  3HKZ B;  5FO8 B;  4K5V A;  4BY1 B;  1LTG D;  1S5F D;  1STG A;  2KQ3 A;  5J22 A;  2K04 A;  2QEJ C;  4C3I G;  2E76 C;  5JEA J;  1B3A A;  2Z4H A;  2B2W C;  2NYZ D;  1M8A A;  2XIW A;  2NBF A;  2CQA A;  3JAM L;  1JWU D;  1JWM D;  4XT1 B;  2EJF C;  1I4H A;  4CKC A;  5HUR A;  2F0E A;  1F77 A;  3FEW X;  2K33 A;  1PZI D;  1Q8I A;  2Z4I A;  5A35 A;  1AEX A;  3NBI A;  1SYC A;  1BCP C;  4CJ2 C;  1LAB A;  2SOB A;  1WD0 A;  4QF4 A;  4KD4 A;  1JWS D;  1U4M A;  2E2D C;  3M4Y A;  2C9O A;  5CV9 A;  5C4J B;  1CHP D;  3E5S A;  4TSS A;  3HOY B;  3S2H B;  4IUN A;  3EA6 A;  3D31 A;  2KUM A;  4PQX A;  2IPK D;  3FMC A;  1LTI D;  1Y1W B;  3HOW B;  1F9S A;  1GOZ A;  3TDQ A;  3LNN A;  1PMR A;  1SYE A;  1XX8 A;  2VB2 X;  2BE5 C;  4K6D A;  3LWU A;  3R93 A;  2WAQ B;  4KHZ A;  3NP8 A;  3HZX A;  1SMY D;  2ZXR A;  1F2M A;  5C5L A;  1Y8N B;  2XRQ D;  4RAU C;  1UEA B;  1OXV A;  2I07 B;  1S5E D;  4F8M A;  1HFG A;  1EEI D;  4RCO A;  1WTP A;  2EOT A;  3QOJ A;  2JA8 B;  1YNN D;  3OIP A;  3NTH A;  1CI3 M;  3LWE A;  1F9P A;  2WB1 B;  4HCS A;  2IX1 A;  3PMF A;  1SND A;  4CBV A;  2N88 A;  1HQR D;  1F9R A;  1DD2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...