1G8ZD

His57ala mutant of cholera toxin b-penatmer
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
103
structure length
103
Chain Sequence
TPQNITDLCAEYHNTQIHTLNDKIFSYTESLAGKREMAIITFKNGATFQVEVPGSQAIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAISMAN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords CHOLERA TOXIN B PROTEIN
publication title A mutant cholera toxin B subunit that binds GM1- ganglioside but lacks immunomodulatory or toxic activity.
pubmed doi rcsb
source organism Vibrio cholerae
total genus 26
structure length 103
sequence length 103
chains with identical sequence E, F, G, H
ec nomenclature
pdb deposition date 2000-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF01376 Enterotoxin_b Heat-labile enterotoxin beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1g8zD00
3OWEB 1I4XA 4RGMA 1TY2A 1LO5D 1BCPF 1TS2A 3W2DA 4OHJA 1L0YB 5D3IB 1PRTD 3MC0B 1BCPB 1LT4D 5TSSA 1FNVA 1LTSD 1RDPD 4RCOA 1JCKB 1EU4A 1PTOH 1S5CD 4DXFA 2NTTA 1PTOF 4RFBA 1PYWD 1SE4A 1XTCD 2TSSA 1AW7A 1FNUA 1HTLD 2XNAC 5ELEA 1EWCA 1PTOB 3R2TA 1FNWA 2QEJC 1KLUD 1I4GA 1S5DD 2XRQD 2QILA 3BVZA 3BZDB 1EFID 1HA5A 1TS4A 3GP7A 3MFGA 1JWSD 1G8ZD 1TY0A 3TSSA 1SEBD 1LTBD 1RCVD 3BYYB 5I4DA 1S5FD 3BVGA 1S5BD 1S5ED 3DWAA 2CHBD 1V1OA 1BCPC 4RH6A 4UDUC 1DYQA 4O1NA 1L0XB 3DWQA 3SEBA 2RDGA 1FD7D 2ICIA 1F77A 2RDHA 3CHBD 4K6LA 1PZJD 5ELBA 1I4PA 2O2LD 1PTOC 1DJRD 1T5XD 1PRTB 4TSSA 1I4QA 1SBBB 1EEFD 1TS5A 5FKAC 4RHRA 1BXTA 3R8BA 1JWMD 2XRSD 1ET6A 1PTOD 1QILA 1ENFA 1ET9A 1HQRD 1V1PB 4ZYSA 3EA6A 2WV6D 4BWGB 5FK9C 1CQVA 1LT3D 1JQYD 1MD2D 4RGOS 1LTAD 1CHQD 1HXYD 1LTID 1UUPA 2AQ1B 3BYTB 2Z8LA 1AN8A 1SXTA 2G9HD 1LTTD 1RD9D 1M4VA 2NTSA 1PZID 4L63B 1CT1D 1BCPD 4Z9CB 1TS3A 1PRTF 3URYA 3BVMA 1FGBD 1CHPD 1PRTC 1SJHD 1KTKA 2IPKD 1LLRD 2XN9C 5ELCA 2AQ3B 1STEA 1ESFA 5ELFA 1D5ZC 1D6EC 2AQ2B 3O13A 3R2IA 1I4RA 3V05A 1SE3A 3DWPA 1GOZA 1JWUD 1PZKD 2IJ0A 4RGTA 2SEBD 3EFXD 2R61A 5D3DA 1UNSA 4RHSA 1LTRD 1V1PA 4RGNA 1KLGD 1B1ZA 1LTGD 1B44D 1SJED 4DXGA 1XXGA 1I4HA 2J4XA 3KLSX 1D5MC 1EU3A 1SE2A 1D5XC 1JR0D 1EEID 1LT6D 1CK1A 1LT5D 1RF2D 4C56C 4L6TB 5ELDA
chains in the Genus database with same CATH superfamily
2HHHL 3KF6B 2R92B 2EY6A 3AEVA 3MXUA 3S16B 4G7OC 1SN8A 3S17H 1A8VA 4EQPA 1LTSD 4WRDA 1STAA 2YTYA 1Z7TA 1SNOA 2MHVA 4P75A 1QVGA 4BXXH 2F0NA 4DR2L 2A74C 3H0GB 1EWCA 2RSOA 3T16A 3F2BA 4JI3L 2UUCL 4B3MQ 1I4GA 3AU7A 5JVH3 1VQFA 1S5DD 5HURA 3EVQA 3BZDB 1VQAA 3TMEA 1QZHA 5CORA 3IFDA 1TY0A 2O5IC 1GXDC 3G4SA 3H3VC 3HOUB 1KAWA 3J7A5 3GTMH 5NUCA 2CHBD 2IL8A 2VW9A 2F0KA 2PMZB 3TZDA 1I5FA 1Y8OB 1VQNA 1PZJD 2EPBA 4NW2A 3HOVH 4DV1Q 1WFQA 1KIXA 4PMWA 1PRTB 4DV3Q 1EEFD 2JN4A 2DGYA 2YTXA 2E2HB 4BY7B 3NQTA 3J81c 1G6ZA 1PH9A 4DV0Q 5CMDA 2EYJA 3Q23A 2K33A 3KF8B 3I4NB 3HP3A 4A3MH 3GTJB 1U0LA 5M5XH 3JAMi 4DUYQ 2K5QA 1WTOA 5KEEA 3SK5A 4CDFC 4MHEA 5BN4A 1PZID 2NB0A 1HNXL 3PSIA 2EYLA 2JJQA 4DR5L 4XXEA 4GN4B 1PRTC 2IPKD 3WWVA 1VQ5A 4LFCQ 4IPDA 1HPCA 1STEA 1HNWL 1D5ZC 1ASYA 1CKMA 1EUJA 1JJGA 3FPUB 4A93H 1GUNA 2JXMB 3CCUA 2K28A 3Q22A 1DXMA 4IOCA 4KD3A 4JOIC 4TRDA 4QUFA 1PH4A 2QDBA 1GUOA 2KVMA 4HIKA 3K5OA 3HOXG 4C3HG 1I4HA 4DAPA 3NP8A 5IGGA 4X64L 1K8OA 2IX3A 1PYSB 4XYQA 4CKBA 4C3IB 1W6JA 4CDEC 3TBIB 2SOBA 1I94Q 4PV1C 1RL2A 4OIKA 2K5HA 2N3SA 3CW2C 1Y69U 3DMUA 3ZJYC 4Y7NH 1EYAA 3FDTA 4U68A 3D4DA 1VCIA 4YY3L 5IT9c 1STBA 4G7ZC 1HA6A 3PF4A 1NR2A 1VS0A 1HZ9A 5IYBG 1EFID 3NSWA 3MFGA 4HJAA 4CDDC 4DK6C 4A3JB 4WORA 2N88A 3E9HA 4LK1C 2F0DA 1OXVA 2R6GA 2N55A 4GNXB 4IALA 1X55A 4JI6L 1PH6A 1CSQA 2WAQB 1V43A 2D62A 4R4TA 1A2UA 3SEBA 2JQOA 3FKIH 4IPHA 4BY1B 4R4QA 3GTLB 4DNRB 4DR4Q 1VQKA 1ILQA 1IKLA 4ZLTF 1BBXC 2A6HD 1SDFA 2KOLA 2YYZA 1S3OA 1UWVA 5FJ8H 3T56B 3P20A 1YNNC 3PUYA 4KMUC 4GNXC 4A3LH 2JA7B 3M4PA 2WP8J 3GDEA 3GTKB 1VQCA 4X3TA 3S15H 5IYCG 4A3EH 1VMPA 1PH5A 2NUCA 2RKSA 4J1MA 2KQ3A 4X65L 5FJ8G 1CSPA 3S1MH 4A3LG 2VQEL 4OL7A 4E6IA 1EIYB 5CR3A 1N32L 1H9RA 5E1FA 5ELCA 4IFDH 1D6EC 1RHPA 3KBXA 3MEFA 2K50A 3BDCA 1E0BA 2RDFA 2B2WA 5J39A 4OWXB 1SE3A 5COYA 3U4ZA 3IRBA 3SE0A 2WB1G 1ASZA 5D14A 2BH8A 4FXDA 1O7ZA 2HD3A 3KDFB 2MUYA 4IFDG 4NP5A 3PUVA 3PUWA 4DK1A 1D5XC 4B9XA 4ALPA 2IW3A 1HFNA 1O7LA 1NNXA 5I2YA 2F3IA 1CQFA 5CV4A 4LFBQ 5M3MH 4DV4L 3VA5A 2UUBQ 4FF4A 3M4OB 1G291 1EY4A 3IL8A 3TS0A 2K4KA 4LF8Q 4FVMA 1HH2P 4MNOA 1PH3A 1AFPA 1B8AA 4WJ3M 1DZ1A 4B9WA 1Q3LA 3K8AA 4JBWA 1XNQQ 1FR3A 3TP6A 2FMMA 4LWCA 5FOBB 2F1MA 2K05A 3L2PA 4B3RQ 4FDBA 2WFWA 2NVTB 4X3UA 5C0XI 3CCJA 4A3IH 2E8GA 4A3KB 2B63H 3MFYA 3PGZA 1FL0A 4MZ9A 4JI2L 4HSVA 1J6QA 1GJXA 3U9SA 3K5NA 4A3IG 2B2VC 1MBYA 2DUDA 3TEHB 3A7LA 1JT8A 1U5KA 3M3YB 3HZXA 1QILA 2LKVA 3AFPA 2F4VQ 3A56A 2LSSA 4LF9Q 3CCVA 1I3QH 5KYIA 4K8IA 1HXYD 2G9DA 5EAYA 2X6GA 5IGEA 1QJOA 2V1CC 1YZ6A 2PZTA 4JV5L 5C4ZA 3DM1A 2VUMB 3K80C 4A4IA 3HOWB 1BOSA 4GZYC 3J81j 4LF6L 2O5JC 4YHHQ 2JA8H 1Y1VB 4PMBA 5A35A 4BBRH 3R2IA 2I5MX 1BQQT 3SK8A 3K57A 1Q1BA 1N34L 1EQRA 4DR6L 3QG1A 1WTRA 2SEBD 2R61A 5D3DA 1EY0A 2NN6H 2L12A 2TMPA 4BA1I 3ITPA 2JA8G 1B7YB 1B9NA 5C4XH 3HOZG 3KLSX 4BBRG 4R1JA 3CPWA 1D5MC 4A3GH 4IOAA 1DOMA 1B50A 5JJLA 1LT5D 1RF2D 1PFMA 2F03A 3HOYB 4KJOA 2NN6G 5EKKA 4QIWE 3ZYYX 5ELNA 5DM73 4CDCC 1BCPB 5C4XG 2HIVA 1XMQQ 1KHIA 5E3FA 3U9OA 4DR1L 2OTJA 2B8GA 2F0QA 1VQJA 2KENA 4A3GG 3W3AA 4HJ8A 1OXXK 2JA5H 2K5VA 5IOCA 1GUGA 4YIJA 2XWJB 3MZ5A 2N78A 4CKEA 3ND9A 2XWBB 5FLMH 1H9SA 1RCVD 2SNMA 3KJPA 4GOPA 2JA5G 4LF4Q 5CV6A 1N33L 1BCPC 4JI1Q 2AUJD 5C3WA 2A6EC 3Q24A 2KEEA 1D8LA 1PHJA 3KOJA 3KLWA 2EYMA 2RDHA 1TWAH 3I7FA 2ZT9C 2P5ZX 2ZTCA 2PZUA 1TWGH 2DY8A 4XTCS 1BO0A 4B3SQ 1KRTA 4PNYA 3NELA 1RTOA 1KAAA 1Z9FA 5FO7B 3T51B 4DR7Q 1WTQA 4KKUA 4V190 2NVYB 5BR8Q 1HQRD 1L0WA 3RZDB 2JA6H 1N36L 1ZEQX 3J7ZC 1BUVT 2AHOB 1WI5A 3E3XA 5FK9C 5AJ3Q 4GKKQ 2KHIA 2MNAA 2PYKA 3CCRA 1QB5D 2NZHA 1M4VA 3J81E 1YBYA 2EY5A 2UUAQ 3MVVA 3QR8A 3S1NB 2ZXOA 3OPOA 3BVMA 2B2YC 1ZYRC 4KN7C 1OXSC 1IYVA 1MSHA 3A54A 3I2ZA 1SNQA 2C5CA 4RG1A 4ZRZA 3A8JE 4K14A 1K0SA 2EOTA 2CW0C 3KYHC 1JB7A 5JAVA 4OX9Q 1SRUA 1XPUA 3EFXD 4EQOA 1JJCB 3C3LA 1LTRD 2EXDA 4JI8Q 1SJED 1O7YA 2CFMA 3I90A 2EJFC 4MTKA 1YNJD 5IE8A 1M1KC 1H9SB 3CCQA 4A75A 3K0YA 3CCMA 4KHZA 2KUMA 2FJ2A 2WB1E 1XMOQ 1F2YA 2HT1A 1NSNS 1L0YB 2HDMA 2ES2A 2BE5D 5C6AA 1V8QA 5E4XA 3PO2H 3KLSA 5I9PA 3W5OA 4DV2Q 5IY0A 2EIFA 2NVXB 4NXMQ 3CF5A 2Z6KC 4QGUA 4DV1L 1IYUA 3T1HL 4JBKA 1KDCA 4DV3L 3M9BA 2UU9Q 1Q12A 1R9TB 3JAML 3BU2A 1E24A 1QVCA 2AWOA 3GP7A 3K59A 3D3RA 2CCZA 4DV0L 3PO2G 1DOKA 1AP0A 1JOOA 1PYBA 3BYYB 2AKWB 1S5FD 4G57A 3NBHA 5IT9E 4A3FH 1TXYA 3F8TA 1PH2A 1GD7A 1RKNA 1G2SA 2Z1CA 5K5PA 1U4LA 1JJ2A 4K8JA 3RD4A 2Q2IA 4DUYL 3HS0C 2XIWA 3W1BA 3DLLA 1IXRA 1U9RA 5M5XB 4I7AA 1NCVA 5EKLA 4HMJA 1CZWA 4DN4M 2K03A 1HHVA 1CI3M 4FO2A 2EVBA 4QIWB 3J81i 1K8AC 3F2UA 3NHHA 5JEAJ 3HOXB 4C3HB 5M3FH 3K7AH 2Y0SG 2V4DA 5M5YB 1Q81C 1A0IA 4AIMA 1HTPA 1O78A 4C3JH 2NVQB 5BN5A 3CQZH 4HCEA 1CT1D 3H09A 1GUTA 2VXWA 4R9WA 5M3FG 3CPFA 2QW7A 1FGBD 1L1OA 3QB3A 1HCZA 1SYFA 2RF4A 1CTMA 1EY8A 2DJFC 5EPLA 5G3LD 4A3BH 2PNHA 1WCMH 4A76A 2EZVA 2EYFA 3S1RB 4OO1I 5DLQE 1V1PA 1ICWA 2JEAI 1QCBD 3S2DB 4Y7NB 1PDQA 2YTVA 4A3DH 1STYA 5EPKA 4DR3Q 2ZTEA 4A3BG 1WCMG 1RJTA 1YHQA 4C1NK 4OWWB 3I4MH 4IJLA 1X56A 2WKCA 2PQEA 1RODA 1BCPF 2E2IB 1VQBA 2FXQA 3RR5A 2K5DA 4FF2A 5JVG3 1FNVA 4HIOA 1PH8A 5C4JH 4HIDA 2E2DC 2ZXRA 3T13A 5J3BA 2MGSA 5LMUL 2UXCL 4DV5Q 2LS01 3NTKA 4EX5A 3I4MG 2TSSA 4X62Q 3NUCA 1NBWA 1VQPA 2EYPA 1YNXA 2ZTDA 3R2TA 3OTOQ 2EYOA 4PQXA 3PV0A 2LFNA 4DGZA 4JBMA 3QOLA 3TDQA 1HA5A 2Q8IB 3J7YW 1IW7D 2F0OA 3CKIB 2ZJPA 3A8IE 3BVGA 1S5BD 3CC7A 5E7NA 3PF5A 5GAGC 5C5MA 3NBIA 1B9MA 3QOJA 4DUZQ 2L0CA 4NDXA 3RNUA 2B2TC 1L1OB 2RCFA 4OEMB 3DUZA 5ELBA 2UXDL 4H7BA 4AQYQ 1K83H 1BBWA 4KN4C 1T5XD 2FINB 3AB9A 5KNDA 2WB1B 1A3VA 5FKAC 1YITA 1HNZL 3D0FA 3K81C 4LF7L 1Q82C 1V1PB 2ICEC 4WJ4A 3STBC 1OXTA 4HAEA 4BXXG 3QJYA 2E2JB 4IO9A 1K9MC 3S14H 1LTLA 3NWSA 1LTID 1G91A 1P8LA 1AE3A 1R4PB 2X69A 2F4IA 1L1OC 2Z6BA 3TREA 2O4XA 2EE1A 1HQMC 5CC4A 2R93H 4LFAQ 1V1QA 2E75C 2J7ZA 1K8GA 2CWAA 4LNQA 4LFBL 2F0JA 1B53A 1KQSA 2UUBL 3HGBA 3DWPA 3UI2A 2KA7A 4RGTA 1PZKD 5GAEC 2R93G 1X65A 4LF8L 3HOVG 4RGNA 4TQUS 1B1ZA 3M4QA 1HZAA 3A8KE 4U673 1STHA 2BCOA 3SGIA 1XNQL 3E9IA 2C9OA 5C0XH 1XYIA 2B3GA 5HGQA 1P16A 2NYZD 1D7QA 2GVAA 3KFUA 2K7VA 4ZQ3A 3GTOH 4EVOA 4A3MG 4RGMA 1TY2A 1KNEA 2BH2A 1XX8A 3FPPA 3OHXC 4FXGC 4F7XA 4A3IB 4LUOA 5C0XG 1HRJA 3L7ZC 3VR3A 4FP5D 3K5MA 2KECA 3G48A 3PUXA 2WKDA 1EZ6A 1I50H 4C1NI 4GLAC 1PTOB 1EYDA 3ULJA 1SNMA 4PMCA 4X3KA 3SDZA 2NBFA 2XRQD 4DAYA 4A93G 4CKCA 2A68D 5FO8B 1AZPA 3BG3A 5IWAQ 2F4VL 2OXPA 4LF9L 1UE1A 1SFOH 4KLKA 2FMCA 1DYQA 2XSCA 4N9PA 1L0XB 3NXWA 2A69D 3J7AV 1Q86C 2Q2TA 3MAQA 1WTPA 4XT1B 2K75A 4FF1A 2M00A 5IP9H 3J80i 4IUUA 5IGBA 1E3PA 4I65A 1PTOC 2XTIA 4YHHL 4JI7L 2VL6A 3CMAA 2EY1A 1BXTA 1X3QA 3C1FA 3IFTA 1XWEA 2HCIA 3U50C 1CUKA 4BBRB 5KNBA 3M85A 3HOZB 1TQOA 3E6ZX 1H9JA 4DV7Q 5IP9G 1SSOA 1LT3D 4OGQC 4HMIA 1LV9A 1JQYD 1MD2D 1WVLA 3C46A 4K0KQ 2EDGA 3ONAB 2K52A 3OYYA 3PIP3 1YNND 2G9HD 1SMYC 1VQHA 3NTHA 1VQDA 5GQOA 3FVQA 3CCLA 4AYBG 5C4XB 3CP0A 5HGTA 4JI4Q 1IHZA 2Y0SE 3D4WA 4A3GB 2IT1A 3DEOA 3OIQA 4IN3A 5LMNQ 2X6LA 2ATWA 1IYJB 2KBNA 3TP8A 1MJEA 2Z4HA 3FKIG 2BA0A 1JC7A 1XMQL 4JYAQ 1B4OA 4G7HC 5DAUA 3HG9A 1F9RA 1EYCA 3ERQA 1NMFA 3H94A 1G2TA 1JMCA 1QOHA 2JA5B 1Q8IA 1DONA 3OIPA 1QWYA 5D65A 4XDXA 1A3TA 2R92H 3S16H 1D1IA 4A3EG 4LF4L 2MO1A 1ML0D 4JI1L 1Z6HA 5T1IA 4UAIA 1TWFB 2B8FA 2IWHA 2A6HC 4R4CA 3PO3H 3H0GH 4LW1A 2B2UA 2EY2A 4FNFA 2NTTA 1RIPA 3D8GA 4DR2Q 4B3SL 1SLJA 2K01A 2YV5A 1NJIC 2UUCQ 4JI3Q 3TP7A 4DR7L 5CYUA 1WJJA 2IHFA 3HOUH 3BVZA 1IL2A 4N9TA 3KK7A 1TWCB 3CC4A 4HIMA 3EQLC 3PO3G 5I4DA 5J22A 4HJ5A 2F0UA 3DWAA 4GKKL 2PPBC 3HFZB 3OWFA 3LNNA 5LMNW 5E4WC 4HJ9A 3LX0A 2E2HH 4IURA 1S4ZA 2GN5A 2D0OA 5M3MG 2N8NA 1TVXA 4P2CB 4ZCKA 4DNTB 3QWNA 3TN2A 4NKLA 3LWEA 2HCCA 1YEZA 1HFGA 1WD1A 3I4NH 4OX9L 4BWGB 5GAHC 1WD0A 1ESRA 4FF3A 3NQIA 4JI8L 1XTDA 5A2QE 4GLXA 4P73A 4LF5Q 1QG7A 1E22A 2NTSA 3IAYA 4LUVA 4C2MH 1TWHH 1TS3A 1HNXQ 4ODGA 1X3FA 3A7AB 1PRTF 2PO4A 4FYDA 3UDXA 3J80c 4JI5L 2KHSA 1E1TA 2A8VA 2B63G 1PLFA 5M5WB 2AQ3B 1XMOL 5GROA 4J15A 4GS3A 2RHQB 2QEXA 2KHJA 1WYDA 3PO2B 1EFWA 4NXML 1NR4A 4DAMA 4CJ1B 2K04A 1STGA 1IKMA 1UE5A 1TR5A 1IBMQ 3I4OA 2JSOA 2H1EA 1WOCA 2B2WC 3VYUA 4ZKCB 1F2LA 4J6HA 2Z0SA 4OHJA 4APVA 4IPCA 1PH1A 5IODA 3ND8A 3J81L 1UE6A 2MJ8A 4I7ZC 1EU4A 4L5TA 1WTHA 1SYEA 1PTOF 2A73B 3EROA 1J5EQ 4JI0Q 2XNAC 1SMXA 3T4AC 2Y0SB 3Q8DA 4A3JH 1I6VC 1A6XA 1SNDA 1G51A 4Q0FA 3NENA 4IUNA 5FLXc 5M3FB 2IHEA 3K7AB 4NB3A 4B3TQ 3HKZG 4BY1H 3GQBA 2EJGC 3S2HB 3GTLH 4YWMA 1YIJA 1E1OA 1ONLA 1SYGA 5LL6S 1A62A 1F2MA 2K14A 5LHY1 4P72A 1VQ9A 2AMCB 2F52A 3CQZB 3BS1A 1I4PA 1IBLL 4RAUC 1DJRD 4HN7A 1NMGA 4R4IA 3I3CA 2AUKA 5AFWA 4OO1H 3OMCA 2JA7H 1BDOA 2XRSD 1ET6A 3A5ZB 1A2TA 1FGUA 1K3BC 4ZYSA 4HEDA 1N9WA 3ULPA 4BBSH 4DV6Q 1FVIA 3VR2A 3H3VI 3U58A 1WCMB 1IBKL 1Y1WH 1LUZA 3S9WA 3FHWA 4H13C 2KCMA 4OO1G 2JA7G 4DR3L 4LJZC 1JOQA 5DM63 5FLMG 4QF4A 1MGSA 1TKWB 1AZQA 2F3WA 4BBSG 4DU9A 5IT9L 4K5VA 2JP1A 3GTQH 2XN9C 1Y1WG 5CBAE 4ID6A 2DJGC 2PQAA 3I4MB 5BN3A 4JVZA 2VQFL 3D31A 4UP7A 1E7ZA 1JWUD 3WOEA 4DK3C 5CV7A 3MTSA 3H91A 4DV5L 1U4PA 5KRUA 1LTGD 4AYBE 5C4JB 2HQLA 1ICFB 3EJIA 1GHJA 1EY7A 2M9VA 4EGVA 3OTOL 4QL5A 1EU3A 2JA6G 1I6HB 5KIXA 1CK1A 1MJCA 4IUVA 2L11A 4XQNA 1B70B 3M4OH 2XGTA 5M9OA 2E5LQ 5TSSA 1LT4D 1C9OA 4M8AA 4KJNA 3S17B 5IGFA 4DF7A 1CKOA 1LACA 1IL8A 1TT2A 4RFBA 1PYWD 4AQYL 1V9PA 1FNUA 5I9OA 4ULLA 1M90C 4B3ML 4B08A 4KHPQ 3FEWX 1OTCA 5F2DA 3C2PA 1K83B 4GOPB 1G8ZD 4ZUIA 4A3KH 3MXGA 3WOFA 3I73A 2D0PA 4X6AH 1VQ8A 2A1AA 1Y8PB 1B3AA 2G5DA 3GTMB 4PZ8A 2YU9H 4O1NA 3DWQA 4CJ2C 2IY5B 1FD7D 3D4RA 2EXZA 2RQXA 3EN2A 3CHBD 1LM0A 1QNUA 2E76C 3MA2B 3AQQA 4LFAL 3M3YH 3F2DA 1I4QA 4POFA 4GKJQ 2R93B 3HOVB 4RHRA 4GOPC 1Y8NB 3RN2A 4X3SA 2QA4A 3AYHB 2OQ0A 3EA6A 2WV6D 5IP7H 3K58A 1EIHA 1YNJC 1CQVA 2F0GA 5CV9A 1XPRA 3K7UC 1PA6A 1EIGA 4K2LA 4OWTB 3BYTB 1AN8A 2EJMA 1LTTD 3VR4A 3HOWH 4A3MB 2WINB 3PUZA 1HR0Q 4Z9CB 2DNEA 4KV6A 1AH9A 5IP7G 4A3FG 2BE5C 1E2ZA 3GTGH 2CWPA 4LFCL 4QQBX 3RZOH 3OW2A 4X66Q 1N34Q 4DR6Q 1GOZA 1H95A 3D6CA 3I8ZA 1II3A 4A93B 3TP5A 2VY3A 2A19A 3MXNA 4JC0A 1JOKA 2F0HA 3S1QH 1VDZA 1JE4A 4H0LC 1SROA 5CGKA 1C48A 4RA8A 1SE2A 1JICA 3HOYH 3PQIA 2F3VA 5EBDA 2J0TD 3GD7A 5IWAL 4L6TB 3CMEA 1VF7A 1CKNA 2F0MA 3J80L 2K32A 1I94L 4C3JG 2R7FA 4DR1Q 1DGSA 1GUSA 1VQLA 2M2LA 1D2BA 3EIVA 5ISRA 4DXFA 4NMZA 1EOVA 4P74A 5T1GA 4ABNA 4CJ0B 1HJPA 2PI2A 1R4QB 3NBHB 4L5QA 4BY7H 2B29A 1KC8C 4ILWA 3OW7A 4IJHA 1HR0W 1XNRQ 4QY7A 2Q8RE 1V1OA 4AYBB 1S40A 4A3DG 3QIAA 5KNCA 4K0KL 4MN3A 3UE0A 4IZ8A 3CD6A 3VYSA 3F1ZA 4KY6A 1U4RA 3A5UA 4RMFA 4BY7G 4ME5A 4K6LA 2ZJQA 3FKIB 4DR4L 4JI4L 3E0JA 5LMNL 3PMFA 4QB4A 1SNPA 3HKZE 4PZ7A 4XT3B 2QDLA 3CAMA 4JYAL 4XQQA 1ENCA 3MXNB 4KKTA 3NPPA 5IYDH 2HUGA 3R93A 2DNCA 1JB3A 2OTLA 2AQ1B 3PCOB 3S1NH 3KF8A 3S15B 4A3EB 3GTPH 5JEAH 1CA5A 1BBUA 2SDFA 1WTVA 5IYDG 2R7ZH 1TIID 3PIO3 1KTKA 3S1MB 5H1SE 4N8X1 3KLRA 3G6EA 1UEAB 4YWKA 1PXUA 2H4OA 1KRSA 1X6OA 3ER0A 1KDAA 4K2KA 2R7DA 1FJGQ 5JEAG 3D6WA 1D1KA 3J80E 2RHSB 4RHSA 5IIFA 2R7ZG 2BOSA 1A15A 4O0AA 3PO3B 1IW7C 2R3ZA 4YCWA 1E2WA 2CQAA 3A0JA 3G71A 4P71A 3SHLA 3I91A 4RWSC 4WFN3 1LO5D 4DPGA 5JOBA 3W2DA 4UY8C 4BA2I 1Q90A 1PRTD 1Q1EA 2NVXH 2ZM6Q 5M3MB 2F0PA 2B39A 5EJWA 1PFBA 3T1YQ 1X32A 1S5CD 1S72A 3Q6SA 3CXCA 1F9SA 1EQQA 2C35B 1R9TH 1EY9A 5ELEA 2L1BA 3T1HQ 2SNSA 5K36H 2F0FA 3CC2A 1QUQA 4B3RL 1NY4A 2ALYB 1HZCA 4V0BA 3CRKC 5JJZA 3W1GA 2L4NA 2HQEA 4UP8A 4YCUA 3BZKA 5C44H 3A55A 2OQKA 5K36G 4GNXA 4DFAA 2B63B 4LF5L 3RLNA 4LMQD 1F77A 4DK0A 5JJKA 4KTAA 1KDBA 5FLXE 4C2MB 1TWHB 1SYDA 3DEPA 3HOXH 3S24A 4C3HH 5C44G 5C3EH 1JWMD 3FRPB 4RKBA 3PIPA 1PTOD 1ENFA 5M5YH 1X3GA 5EGTA 2PW7A 2NVQH 4RGOS 4IFDJ 1UUPA 4Q5VA 1ZXTA 1I3QB 1SXTA 5IGDA 1RTNA 5C3EG 3L0OA 1IBML 1PMRA 3KJOA 3KBGA 1LYLA 3AFQA 4AH6A 1SMYD 1SJHD 4NXNQ 4HR7B 4OIJA 1PVOA 1K3RA 2MQHA 4EQNA 1WTXA 2AQ2B 2RBMA 3P1HA 2ZJRA 3J7AF 1F9PA 4K6DA 2JA8B 3S1RH 2IX0A 5IYBH 2EQSA 2ASBA 2FHTA 2GA4B 3S2DH 1UNSA 1KLGD 5DNFA 3HKSA 5KGUA 1J5EL 3L3OC 4JI0L 3EBEA 1XXGA 1DD2A 3VR5A 2A68C 1QUQB 2J4XA 2MFIA 2K5WA 4ZK9B 1QNKA 1K73C 3HKZB 2I5HA 2UXBQ 3I4LA 3KDFA 3X3NA 4LUZA 3TQYA 2E2IH 4BS9A 3KUPA 2K5NA 2A69C 2F0EA 4B3TL 2QF7A 4J8QA 4XYOA 3ULLA 5HY6A 5A2QL 3TRZA 4HCSA 4S3SA 4JBJA 4RCOA 1PFSA 5LMUQ 2UXCQ 2Q2HA 1BNZA 5G3LF 1SE4A 4DAYB 3RN5A 1HTLD 3ERSX 5IYCH 1QVFA 3H3VH 1VQIA 5C4HA 1C7YA 4EQ5A 4RKLA 3TSSA 1SEBD 2B2VA 1GVPA 2F0LA 4DV6L 1XPOA 4KY5A 1C8CA 2CH4A 1VQ7A 2HHHQ 1OXUA 4UDUC 4BBSB 3NWTA 2NWGA 5JPNC 1JORA 4F8MA 3GV3A 2RDGA 3K0XA 3RMHA 1Y1WB 2R92G 4H44C 2Q2UA 5IGCA 3NTIA 2UXDQ 3CRLC 1TWAB 3L9AX 5C3XA 4DKAC 1VF5C 1TWGB 3JC66 1W6KA 4A3CH 3R8BA 1HNZQ 5BR8L 3I55A 3GTQB 2E2JH 1ET9A 4LF7Q 3H0GG 1CZGA 5EPJA 3VYTA 5AJ3L 4GN3B 2JA6B 1J9OA 2CVRA 3I70A 1RD9D 3VR6A 3V96A 3HOUG 3JAMc 1VQGA 2RVLA 4CHTB 4A3CG 4HJ7A 2UUAL 3U4VA 3URYA 2Z9HA 1CHPD 3N6RA 4QJFA 1STNA 1LLRD 1J8IA 5ELFA 1NUCA 3O13A 2D5DA 1FYCA 1SAPA 3V05A 2E5LL 2MP1A 3GTJH 1DOLA 3DM3A 4F88A 2ENBA 2CH4W 3SXHA 1BF4A 1K8MA 4CGYB 1KD1C 1MHWC 3F2CA 1YVCA 4ZAIA 4KHPL 2JEBI 1JR0D 2L5TA 2PW5A 4DNIA 4ME3A 1KXLA 3I4NG 1KABA 3I56A 4DR5Q 1O7IA 4C56C 3BZCA 4POGA 3M7NA 2I07B 1W3SA 4JK1C 3OWEB 1HNWQ 1B3QA 2PCFB 1SYCA 5D3IB 3MC0B 4WJWA 3A74A 2OEOA 3E5SA 4IUQA 4OONA 2IX1A 4RCNA 5EQ0A 1Q7YC 2LXJA 5I6WA 1ZKOA 4DV2L 2YU9B 1T9HA 1JCKB 2F0SA 1PTOH 3P75A 3VA7A 1GUWA 3CU7A 4G4KA 3CCEA 1MIUA 1NTGA 1FNWA 1GKHA 2QEJC 3B6YA 3BDOA 2UU9L 4GKJL 2N49A 2QILA 2GVBA 4C3IH 2VZAA 4IQZA 2FFKB 5C5LA 4X64Q 1TS4A 1YJNA 4IUPA 4UP9A 2VS1A 1T5EA 5EKIA 2OWOA 1SE8A 3G7LA 4QMGA 4R4OA 2B2UC 4A3FB 1X3PA 3M4YA 3MEHA 4K5WA 3UDFA 4C3IG 1KL9A 1HR0L 1X54A 1SYBA 4KHVA 4YY3Q 4TSSA 1L2FA 5J1ZA 1TS5A 4JI7Q 3SVMA 2OT2A 3HOZH 3GTGB 1M8AA 2B2YA 4X66L 2CQOA 1O80A 1SR3A 3RZOB 5ELOA 1F2ZA 1EZ8A 4JI6Q 2I0QA 1LTAD 1CHQD 2HIXA 2PNRC 4A3JG 1G6PA 1EY6A 2Z8LA 2LY7A 4K5XA 1IZ6A 1E2VA 1BCPD 3TS2A 2A6ED 1VQEA 4C3JB 3S1QB 2WAQG 3I72A 1X9NA 4HSPA 2JE6I 1C4QA 4BY1G 3DXJC 1ESFA 2A5HA 2KJXA 3N52A 1BKBA 1I4RA 4KY7A 4IPGA 3GTKH 3ICEA 3Q0AA 4A3BB 2L9HA 3VYRA 4XQJA 3X3MA 2OF1A 1EYGA 1B44D 4R8NA 1EL0A 4DXGA 4LAAA 4X65Q 1UEBA 3GV6A 1QE6A 2Z6KA 5I6YA 4A3DB 1ILPA 1KNAA 4N8FA 3RUZA 2VQEQ 1N32Q 2F0WA 1I4XA 3TZUA 4MTNA 4YCVA 3RLFA 3LGJA 4L5RC 1XNRL 1CFMA 1EQTA 4PZ6A 3DHQA 1TS2A 4DA2A 1TWFH 1ZYRD 4NPSA 2Q8TA 2ID0A 2RSNA 5JJIA 4L5SA 4IFDI 2F0TA 2JYOA 5JPMC 2XVSA 4CBVA 2CW0D 2WIIB 4X62L 3MWYW 1GM5A 1AW7A 5CV8A 2I46A 1TWCH 3LWUA 1KLUD 1A63A 2F0IA 4O42A 1YHBA 4M1UB 1JWSD 1EY5A 4TVAB 2KCCA 1S5ED 4JG2A 3UDIA 4RH6A 2BA1A 4DV4Q 1YI2A 4F87A 5CV5A 4DUZL 4H02A 3UE1A 1DM0B 5EBCA 2BDNA 2L55A 5KYLA 1VQ4A 1CM9A 1UAPA 1HZBA 2O2LD 3GTPB 2MO0A 4OXPA 1SBBB 3UDGA 1EQVA 3P7JA 1A3UA 2NVTH 2R7ZB 2RA4A 1FJGL 2MPMA 5L37A 3HRZC 2RCNA 1MI2A 4JCVE 2KCNA 2EYHA 2VB2X 1HUMA 2KEDA 3S14B 4JI2Q 4L63B 3NE5B 4KI0A 3FMCA 4A3KG 4GLVB 2PI2E 1K28A 5M5WH 3VDYA 1VQ6A 4KKSA 4YWLA 3NK9A 3SK4A 2PQAB 4JI5Q 1X3EA 1VQMA 3MHBA 1K0RA 1VMCA 4QUCA 1BVSA 1U4MA 2JA9A 4IUTA 2ZM6L 2IJ0A 2F0VA 3T1YL 2HDLA 2LMCB 1Z47A 2K6AA 2QCPX 4O2DA 1AE2A 4ZKBB 3C1EA 1UE7A 3V2TA 2VUMH 2PMZE 1YHAA 4JV5Q 1H9KA 2NZOA 1OO9B 4ZUJA 3H6MA 1ENAA 5GADC 1Y1VH 1EWIA 4HTHA 2DY7A 4LF6Q 5ELDA 4DAVA 3HEJA 2VUMG 5LL6X 2AWNA 1SNCA 3HOWG 3OMGA 3GTOB 1DCZA 4JPBW 2WACA 1PV4A 1Q8KA 1RDPD 3G6JB 5C44B 1Y1VG 2QKIC 1W2BA 4JW0A 1HUNA 1Q46A 1YJWA 1BR9A 3GO5A 1XTCD 4L8JA 1JE5A 2B2TA 1QZGA 1I50B 2KCTA 2NN6I 1H9MA 3FP9A 2VB3X 3M7GA 1WTWA 1AEXA 4PG3A 3OOCA 1LTBD 3RLOA 5C3EB 4Y52H 1N8RC 3S2HH 1C0AA 5I2XA 1CA6A 4GN5A 1EWHA 2JK8A 4UPAA 1YJ9A 2BDOA 1SFOB 1PFNA 3KF6A 2ZXPA 2ICIA 3BJUA 3HOYG 4FXKC 3E0EA 4OELB 4XIGS 3K6OA 2H5XA 3QO2A 1IBLQ 1B2TA 4NXNL 4UHVA 2DN8A 1NAPA 1Y14B 3SR1A 1GO3E 1VQOA 1GHKA 4DV7L 1N33Q 1IBKQ 3MXPA 3PIOA 2I5LX 2L15A 3AMUA 1XJVA 3CCSA 4KD4A 2D2CC 2QGQA 1F9QA 2NZ1D 3SK6A 2UXBL 1NE3A 1PH7A 2PZWA 2OCEA 1MSGA 1TU2B 2NVYH 4QCLA 3IKJA 3RZDH 2CKZB 2LXKA 4R8IA 1EOTA 3JAME 3WDNA 4MIUA 5C0XJ 2VQFQ 3BDLA 1N36Q 3R3OA 1LABA 5FO9B 3NEMA 2D9UA 2E74C 2WAQE 5FLXL 1MKHA 3T53B 4KK7A 3H15A 3STBD 4JOIA 1I6HH 5CBEE 2Z4IA 2VNUD 3K5LA 1CKNB 1EEID 1EIFA 3OSOA 5DEHA 1LT6D 2K1BA 4TKOB
chains in the Genus database with same CATH topology
2R92B 2EY6A 3MXUA 3S16B 4G7OC 4EQPA 1LTSD 4WRDA 1STAA 1Z7TA 1SNOA 2MHVA 2F0NA 2A74C 3H0GB 1EWCA 2RSOA 3T16A 1I4GA 3AU7A 5JVH3 1S5DD 5HURA 3EVQA 3BZDB 3TMEA 5CORA 3IFDA 1TY0A 2O5IC 1GXDC 3H3VC 3HOUB 5NUCA 2CHBD 2IL8A 2F0KA 2PMZB 3TZDA 1Y8OB 1PZJD 2EPBA 4NW2A 4PMWA 1PRTB 1EEFD 2E2HB 3NQTA 1G6ZA 5CMDA 2EYJA 3Q23A 2K33A 3I4NB 3HP3A 3GTJB 2K5QA 1WTOA 5KEEA 3SK5A 4MHEA 5BN4A 1PZID 2NB0A 2EYLA 4XXEA 1PRTC 2IPKD 1HPCA 1STEA 1D5ZC 3FPUB 1GUNA 2JXMB 2K28A 3Q22A 1DXMA 4KD3A 4TRDA 4QUFA 2QDBA 1GUOA 2KVMA 3K5OA 4C3HG 1I4HA 4DAPA 3NP8A 5IGGA 1K8OA 2IX3A 4XYQA 4CKBA 4C3IB 1W6JA 3TBIB 2SOBA 4PV1C 4OIKA 1Y69U 3DMUA 1EYAA 3FDTA 4U68A 3D4DA 1VCIA 1STBA 4G7ZC 1HA6A 1NR2A 4A3JB 1EFID 3NSWA 3MFGA 4WORA 2N88A 4LK1C 2F0DA 1OXVA 2R6GA 2N55A 4IALA 2WAQB 1V43A 2D62A 1A2UA 3SEBA 4BY1B 3GTLB 4DNRB 1ILQA 1IKLA 4ZLTF 1BBXC 2A6HD 1SDFA 2KOLA 2YYZA 3T56B 3P20A 1YNNC 3PUYA 4KMUC 2JA7B 2WP8J 3GTKB 4X3TA 1VMPA 2NUCA 2RKSA 4J1MA 2KQ3A 4OL7A 4E6IA 5CR3A 1H9RA 5E1FA 5ELCA 4IFDH 1D6EC 1RHPA 3KBXA 3BDCA 1E0BA 2RDFA 2B2WA 5J39A 1SE3A 5COYA 3SE0A 5D14A 4FXDA 1O7ZA 4IFDG 2MUYA 4NP5A 3PUVA 3PUWA 4DK1A 1D5XC 4B9XA 2IW3A 1HFNA 1O7LA 5I2YA 1CQFA 5CV4A 3VA5A 4FF4A 3M4OB 1G291 1EY4A 3IL8A 4FVMA 1AFPA 1DZ1A 4B9WA 1Q3LA 4JBWA 1FR3A 3TP6A 2FMMA 5FOBB 2F1MA 2K05A 2NVTB 4X3UA 5C0XI 4A3KB 3MFYA 4HSVA 1GJXA 3U9SA 3K5NA 2B2VC 1MBYA 3A7LA 3M3YB 3HZXA 1QILA 2LKVA 3A56A 5KYIA 4K8IA 1HXYD 2G9DA 2X6GA 5IGEA 1QJOA 2PZTA 5C4ZA 3DM1A 2VUMB 3HOWB 1BOSA 4GZYC 2O5JC 1Y1VB 4PMBA 5A35A 3R2IA 1BQQT 3SK8A 3K57A 1Q1BA 3QG1A 1WTRA 2SEBD 2R61A 5D3DA 1EY0A 2NN6H 2L12A 2TMPA 4BA1I 3ITPA 1B9NA 3KLSX 1D5MC 1DOMA 1B50A 1LT5D 1RF2D 1PFMA 2F03A 3HOYB 4KJOA 2NN6G 5EKKA 3ZYYX 5DM73 1BCPB 5E3FA 3U9OA 2B8GA 2F0QA 3W3AA 1OXXK 5IOCA 1GUGA 4YIJA 2XWJB 3MZ5A 4CKEA 3ND9A 2XWBB 1H9SA 1RCVD 2SNMA 5CV6A 1BCPC 5C3WA 2AUJD 2A6EC 3Q24A 2KEEA 2EYMA 2RDHA 2ZT9C 2PZUA 2DY8A 4XTCS 1BO0A 4PNYA 1RTOA 1KAAA 5FO7B 3T51B 1WTQA 4KKUA 4V190 2NVYB 1HQRD 3RZDB 1ZEQX 1BUVT 5FK9C 2PYKA 1QB5D 1M4VA 3J81E 2EY5A 3MVVA 3S1NB 2ZXOA 3BVMA 3OPOA 2B2YC 1ZYRC 4KN7C 1OXSC 1IYVA 1MSHA 3A54A 1SNQA 2C5CA 4ZRZA 3A8JE 4K14A 2EOTA 2CW0C 5JAVA 3EFXD 4EQOA 3C3LA 1LTRD 1SJED 1O7YA 3I90A 2EJFC 1YNJD 1H9SB 3K0YA 4KHZA 2KUMA 2FJ2A 1F2YA 1NSNS 1L0YB 2HDMA 2BE5D 5C6AA 1V8QA 5E4XA 3KLSA 5I9PA 2NVXB 1IYUA 1KDCA 1Q12A 1R9TB 3JAML 3K59A 2AWOA 3GP7A 3D3RA 1DOKA 1AP0A 1JOOA 3BYYB 1S5FD 4G57A 3NBHA 5IT9E 1RKNA 1G2SA 2Z1CA 5K5PA 1U4LA 4K8JA 3RD4A 3HS0C 2XIWA 5M5XB 1U9RA 1NCVA 5EKLA 4HMJA 1CZWA 4DN4M 2K03A 1HHVA 1CI3M 4FO2A 2EVBA 4QIWB 3F2UA 3NHHA 5JEAJ 3HOXB 4C3HB 2V4DA 5M5YB 1HTPA 1O78A 2NVQB 5BN5A 4HCEA 1CT1D 3H09A 1GUTA 2VXWA 4R9WA 1FGBD 3QB3A 1HCZA 1SYFA 1CTMA 1EY8A 5EPLA 5G3LD 2EZVA 2EYFA 3S1RB 4OO1I 1V1PA 1ICWA 2JEAI 1QCBD 3S2DB 4Y7NB 1PDQA 1STYA 5EPKA 1RJTA 4C1NK 2WKCA 2PQEA 1RODA 1BCPF 2E2IB 2K5DA 4FF2A 5JVG3 1FNVA 2E2DC 2ZXRA 3T13A 2MGSA 2LS01 3NTKA 2TSSA 3NUCA 2EYPA 3R2TA 2EYOA 4PQXA 3PV0A 2LFNA 4DGZA 3QOLA 3TDQA 1HA5A 2Q8IB 3J7YW 1IW7D 2F0OA 3CKIB 3A8IE 3BVGA 1S5BD 5C5MA 3NBIA 1B9MA 3QOJA 2L0CA 4NDXA 2B2TC 3DUZA 5ELBA 4H7BA 4KN4C 1T5XD 2FINB 3AB9A 5KNDA 2WB1B 1A3VA 5FKAC 1V1PB 2ICEC 1OXTA 4HAEA 3QJYA 2E2JB 3NWSA 1LTID 1G91A 1R4PB 2X69A 2F4IA 2O4XA 2EE1A 1HQMC 5CC4A 2E75C 2J7ZA 2F0JA 1B53A 3HGBA 3DWPA 3UI2A 2KA7A 4RGTA 1PZKD 4RGNA 4TQUS 1B1ZA 3A8KE 4U673 1STHA 2BCOA 2C9OA 5C0XH 1XYIA 2NYZD 2K7VA 4ZQ3A 4EVOA 4RGMA 1TY2A 1KNEA 1XX8A 3FPPA 3OHXC 4FXGC 4F7XA 4A3IB 5C0XG 1HRJA 3L7ZC 3VR3A 4FP5D 3K5MA 2KECA 3PUXA 2WKDA 1EZ6A 4C1NI 1PTOB 1EYDA 1SNMA 4PMCA 4X3KA 3SDZA 2NBFA 2XRQD 4DAYA 4CKCA 2A68D 5FO8B 1AZPA 3BG3A 2OXPA 2FMCA 1DYQA 2XSCA 4N9PA 1L0XB 3NXWA 2A69D 3J7AV 3MAQA 1WTPA 4XT1B 4FF1A 2M00A 4IUUA 5IGBA 4I65A 1PTOC 2EY1A 1BXTA 1X3QA 3C1FA 3IFTA 1XWEA 2HCIA 5KNBA 4BBRB 3M85A 3HOZB 1TQOA 3E6ZX 1H9JA 4OGQC 1SSOA 1LT3D 4HMIA 1LV9A 1JQYD 1MD2D 1WVLA 3C46A 2EDGA 3ONAB 3PIP3 1YNND 2G9HD 1SMYC 3NTHA 3FVQA 5C4XB 5HGTA 1IHZA 4A3GB 3D4WA 2IT1A 3DEOA 3OIQA 4IN3A 2X6LA 3TP8A 2Z4HA 2BA0A 1JC7A 1B4OA 4G7HC 5DAUA 3HG9A 1F9RA 1EYCA 3ERQA 3H94A 1G2TA 1QOHA 2JA5B 1Q8IA 1DONA 3OIPA 1QWYA 5D65A 4XDXA 1A3TA 1D1IA 1ML0D 1Z6HA 5T1IA 4UAIA 1TWFB 2B8FA 2IWHA 2A6HC 2B2UA 2EY2A 4FNFA 2NTTA 3D8GA 2K01A 3TP7A 5CYUA 3BVZA 4N9TA 3KK7A 1TWCB 3EQLC 5I4DA 5J22A 2F0UA 3DWAA 2PPBC 3OWFA 3LNNA 5E4WC 3LX0A 4IURA 1S4ZA 1TVXA 4P2CB 4DNTB 3QWNA 3TN2A 4NKLA 3LWEA 2HCCA 1HFGA 1WD1A 4BWGB 1WD0A 1ESRA 4FF3A 3NQIA 5A2QE 1QG7A 2NTSA 3IAYA 1TS3A 4ODGA 3A7AB 1PRTF 2PO4A 4FYDA 2KHSA 1PLFA 5M5WB 2AQ3B 3PO2B 1NR4A 4CJ1B 2K04A 1STGA 1IKMA 1TR5A 2JSOA 2H1EA 2B2WC 3VYUA 4ZKCB 1F2LA 4J6HA 4OHJA 5IODA 3ND8A 3J81L 2MJ8A 4I7ZC 1EU4A 1SYEA 1PTOF 2A73B 3EROA 2XNAC 3T4AC 2Y0SB 1I6VC 1A6XA 1SNDA 4Q0FA 4IUNA 5M3FB 3K7AB 3GQBA 2EJGC 3S2HB 1ONLA 1SYGA 5LL6S 1F2MA 5LHY1 3CQZB 3BS1A 1I4PA 4RAUC 1DJRD 4HN7A 3I3CA 2AUKA 5AFWA 4OO1H 3OMCA 1BDOA 2XRSD 1ET6A 1A2TA 4ZYSA 4HEDA 3VR2A 1WCMB 3S9WA 4H13C 4OO1G 4LJZC 1JOQA 5DM63 4QF4A 1MGSA 1TKWB 1AZQA 2F3WA 4DU9A 5IT9L 4K5VA 2JP1A 2XN9C 5CBAE 4ID6A 3I4MB 5BN3A 3D31A 1JWUD 3WOEA 5CV7A 3MTSA 3H91A 1U4PA 5KRUA 1LTGD 5C4JB 3EJIA 1GHJA 1EY7A 2M9VA 4EGVA 1EU3A 1I6HB 5KIXA 1CK1A 4IUVA 2L11A 4XQNA 5M9OA 5TSSA 1LT4D 4M8AA 4KJNA 3S17B 5IGFA 4DF7A 1LACA 1IL8A 1TT2A 4RFBA 1PYWD 5I9OA 1FNUA 4ULLA 4B08A 3FEWX 5F2DA 3C2PA 1K83B 1G8ZD 4ZUIA 3MXGA 3WOFA 3I73A 1Y8PB 1B3AA 3GTMB 4O1NA 3DWQA 4CJ2C 1FD7D 3D4RA 2EXZA 2RQXA 3CHBD 1QNUA 2E76C 3MA2B 1I4QA 2R93B 3HOVB 4RHRA 1Y8NB 4X3SA 3EA6A 2WV6D 3K58A 1EIHA 1YNJC 1CQVA 2F0GA 5CV9A 1EIGA 4K2LA 3BYTB 1AN8A 2EJMA 1LTTD 3VR4A 4A3MB 2WINB 3PUZA 4Z9CB 2DNEA 4KV6A 2BE5C 1E2ZA 1GOZA 3D6CA 3I8ZA 1II3A 4A93B 3TP5A 3MXNA 1JOKA 2F0HA 1VDZA 1JE4A 4H0LC 5CGKA 1C48A 4RA8A 1SE2A 1JICA 2F3VA 5EBDA 2J0TD 3GD7A 4L6TB 1VF7A 2F0MA 3J80L 2K32A 4C3JG 1GUSA 2M2LA 1D2BA 5ISRA 4DXFA 4NMZA 5T1GA 4ABNA 4CJ0B 1R4QB 4ILWA 3OW7A 2Q8RE 1V1OA 4AYBB 3QIAA 5KNCA 4MN3A 4IZ8A 3VYSA 4KY6A 1U4RA 4ME5A 4K6LA 3FKIB 3E0JA 3PMFA 4QB4A 1SNPA 4XT3B 4XQQA 1ENCA 4KKTA 3NPPA 2HUGA 3R93A 2DNCA 1JB3A 2AQ1B 3KF8A 3S15B 4A3EB 5JEAH 1CA5A 2SDFA 1WTVA 1TIID 3PIO3 1KTKA 3S1MB 3KLRA 1UEAB 1PXUA 2H4OA 4K2KA 1KDAA 5JEAG 3D6WA 1D1KA 3J80E 4RHSA 5IIFA 2BOSA 1A15A 3PO3B 1IW7C 2R3ZA 1E2WA 2CQAA 3SHLA 3I91A 4RWSC 4WFN3 1LO5D 5JOBA 3W2DA 4BA2I 1Q90A 1PRTD 1Q1EA 5M3MB 2F0PA 2B39A 5EJWA 1PFBA 1X32A 1S5CD 3Q6SA 1F9SA 1EY9A 5ELEA 2L1BA 2SNSA 5K36H 2F0FA 4V0BA 3CRKC 5JJZA 2L4NA 2HQEA 3A55A 5K36G 4DFAA 2B63B 4LMQD 1F77A 4DK0A 4KTAA 1KDBA 5FLXE 4C2MB 1TWHB 1SYDA 3DEPA 1JWMD 3FRPB 4RKBA 1PTOD 1ENFA 5EGTA 2PW7A 4RGOS 4IFDJ 1UUPA 4Q5VA 1ZXTA 1I3QB 1SXTA 5IGDA 1RTNA 1PMRA 3KBGA 1SMYD 1SJHD 4HR7B 4OIJA 4EQNA 1WTXA 2AQ2B 2RBMA 3P1HA 3J7AF 1F9PA 4K6DA 2JA8B 2IX0A 2FHTA 2GA4B 1UNSA 1KLGD 5DNFA 5KGUA 3L3OC 1XXGA 1DD2A 3VR5A 2A68C 2J4XA 2K5WA 4ZK9B 1QNKA 3HKZB 3I4LA 3X3NA 4BS9A 3KUPA 2A69C 2F0EA 2QF7A 4J8QA 4XYOA 5A2QL 4HCSA 4S3SA 4RCOA 1BNZA 5G3LF 1SE4A 1HTLD 5C4HA 4RKLA 3TSSA 1SEBD 2B2VA 2F0LA 1C8CA 4KY5A 1OXUA 4UDUC 4BBSB 3NWTA 2NWGA 5JPNC 1JORA 4F8MA 3GV3A 2RDGA 3RMHA 1Y1WB 4H44C 5IGCA 3NTIA 3CRLC 1TWAB 3L9AX 5C3XA 1VF5C 1TWGB 1W6KA 3R8BA 3GTQB 1ET9A 1CZGA 5EPJA 3VYTA 2JA6B 1J9OA 2CVRA 3I70A 1RD9D 3VR6A 3V96A 4CHTB 2RVLA 3URYA 1CHPD 3N6RA 1STNA 1LLRD 1J8IA 5ELFA 1NUCA 3O13A 2D5DA 1FYCA 1SAPA 3V05A 2MP1A 1DOLA 4F88A 2ENBA 3SXHA 1BF4A 1K8MA 4CGYB 4ZAIA 2JEBI 1JR0D 2L5TA 2PW5A 1KABA 4C56C 3M7NA 2I07B 4JK1C 3OWEB 2PCFB 1SYCA 5D3IB 3MC0B 4WJWA 3E5SA 2OEOA 4IUQA 2IX1A 4RCNA 5EQ0A 5I6WA 1ZKOA 2YU9B 1JCKB 2F0SA 1PTOH 3P75A 3VA7A 1GUWA 3CU7A 4G4KA 1FNWA 2QEJC 3BDOA 2QILA 4IQZA 5C5LA 2FFKB 1TS4A 4IUPA 1T5EA 5EKIA 3G7LA 4QMGA 2B2UC 4A3FB 1X3PA 3M4YA 3MEHA 4K5WA 4C3IG 1SYBA 4KHVA 4TSSA 5J1ZA 1TS5A 3SVMA 2OT2A 3GTGB 1M8AA 2B2YA 1O80A 3RZOB 1F2ZA 1EZ8A 1LTAD 1CHQD 2PNRC 1EY6A 2Z8LA 2LY7A 4K5XA 1E2VA 1BCPD 2A6ED 4C3JB 3S1QB 3I72A 4HSPA 2JE6I 1C4QA 3DXJC 1ESFA 2A5HA 2KJXA 3N52A 1I4RA 4KY7A 3Q0AA 4A3BB 2L9HA 3VYRA 4XQJA 3X3MA 2OF1A 1B44D 4R8NA 1EL0A 4DXGA 4LAAA 3GV6A 1QE6A 5I6YA 4A3DB 1ILPA 1KNAA 3RUZA 2F0WA 1I4XA 3TZUA 4BY7B 3RLFA 1CFMA 1EQTA 3DHQA 1TS2A 4DA2A 1ZYRD 2Q8TA 2ID0A 2RSNA 4IFDI 2F0TA 2JYOA 5JPMC 2XVSA 4CBVA 2CW0D 2WIIB 3MWYW 1AW7A 5CV8A 2I46A 3LWUA 1KLUD 2F0IA 4O42A 4M1UB 1JWSD 1EY5A 2KCCA 1S5ED 4RH6A 2BA1A 4F87A 5CV5A 1DM0B 5EBCA 2BDNA 2L55A 5KYLA 1CM9A 1UAPA 2O2LD 3GTPB 1SBBB 1EQVA 3P7JA 1A3UA 2R7ZB 2RA4A 2MPMA 3HRZC 1MI2A 2KCNA 2EYHA 2VB2X 1HUMA 2KEDA 3S14B 4L63B 3NE5B 4KI0A 3FMCA 4KKSA 3NK9A 3SK4A 3MHBA 1VMCA 4QUCA 1U4MA 4IUTA 2IJ0A 2F0VA 2HDLA 2LMCB 1Z47A 2K6AA 2QCPX 4ZKBB 3C1EA 3V2TA 1H9KA 1OO9B 4ZUJA 3H6MA 1ENAA 4HTHA 2DY7A 5ELDA 4DAVA 3HEJA 5LL6X 2AWNA 1SNCA 3OMGA 3GTOB 1DCZA 2WACA 1RDPD 3G6JB 5C44B 2QKIC 1HUNA 1BR9A 3GO5A 1XTCD 4L8JA 2B2TA 1I50B 2NN6I 1H9MA 2VB3X 3M7GA 1WTWA 1AEXA 3OOCA 1LTBD 5C3EB 5I2XA 1CA6A 1EWHA 2BDOA 1SFOB 1PFNA 2ZXPA 2ICIA 4FXKC 4XIGS 3K6OA 3QO2A 1B2TA 2DN8A 1NAPA 3SR1A 1GHKA 3MXPA 3AMUA 4KD4A 2D2CC 1F9QA 2NZ1D 3SK6A 2PZWA 1MSGA 1TU2B 4QCLA 3IKJA 4R8IA 1EOTA 3JAME 3WDNA 4MIUA 5C0XJ 3BDLA 3R3OA 1LABA 5FO9B 2D9UA 2E74C 5FLXL 3T53B 4KK7A 5CBEE 2Z4IA 2VNUD 3K5LA 1EEID 3OSOA 5DEHA 1LT6D 2K1BA 4TKOB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OWE B;  1I4X A;  4RGM A;  1TY2 A;  1LO5 D;  1BCP F;  1TS2 A;  3W2D A;  4OHJ A;  1L0Y B;  5D3I B;  1PRT D;  3MC0 B;  1BCP B;  1LT4 D;  5TSS A;  1FNV A;  1LTS D;  1RDP D;  4RCO A;  1JCK B;  1EU4 A;  1PTO H;  1S5C D;  4DXF A;  2NTT A;  1PTO F;  4RFB A;  1PYW D;  1SE4 A;  1XTC D;  2TSS A;  1AW7 A;  1FNU A;  1HTL D;  2XNA C;  5ELE A;  1EWC A;  1PTO B;  3R2T A;  1FNW A;  2QEJ C;  1KLU D;  1I4G A;  1S5D D;  2XRQ D;  2QIL A;  3BVZ A;  3BZD B;  1EFI D;  1HA5 A;  1TS4 A;  3GP7 A;  3MFG A;  1JWS D;  1G8Z D;  1TY0 A;  3TSS A;  1SEB D;  1LTB D;  1RCV D;  3BYY B;  5I4D A;  1S5F D;  3BVG A;  1S5B D;  1S5E D;  3DWA A;  2CHB D;  1V1O A;  1BCP C;  4RH6 A;  4UDU C;  1DYQ A;  4O1N A;  1L0X B;  3DWQ A;  3SEB A;  2RDG A;  1FD7 D;  2ICI A;  1F77 A;  2RDH A;  3CHB D;  4K6L A;  1PZJ D;  5ELB A;  1I4P A;  2O2L D;  1PTO C;  1DJR D;  1T5X D;  1PRT B;  4TSS A;  1I4Q A;  1SBB B;  1EEF D;  1TS5 A;  5FKA C;  4RHR A;  1BXT A;  3R8B A;  1JWM D;  2XRS D;  1ET6 A;  1PTO D;  1QIL A;  1ENF A;  1ET9 A;  1HQR D;  1V1P B;  4ZYS A;  3EA6 A;  2WV6 D;  4BWG B;  5FK9 C;  1CQV A;  1LT3 D;  1JQY D;  1MD2 D;  4RGO S;  1LTA D;  1CHQ D;  1HXY D;  1LTI D;  1UUP A;  2AQ1 B;  3BYT B;  2Z8L A;  1AN8 A;  1SXT A;  2G9H D;  1LTT D;  1RD9 D;  1M4V A;  2NTS A;  1PZI D;  4L63 B;  1CT1 D;  1BCP D;  4Z9C B;  1TS3 A;  1PRT F;  3URY A;  3BVM A;  1FGB D;  1CHP D;  1PRT C;  1SJH D;  1KTK A;  2IPK D;  1LLR D;  2XN9 C;  5ELC A;  2AQ3 B;  1STE A;  1ESF A;  5ELF A;  1D5Z C;  1D6E C;  2AQ2 B;  3O13 A;  3R2I A;  1I4R A;  3V05 A;  1SE3 A;  3DWP A;  1GOZ A;  1JWU D;  1PZK D;  2IJ0 A;  4RGT A;  2SEB D;  3EFX D;  2R61 A;  5D3D A;  1UNS A;  4RHS A;  1LTR D;  1V1P A;  4RGN A;  1KLG D;  1B1Z A;  1LTG D;  1B44 D;  1SJE D;  4DXG A;  1XXG A;  1I4H A;  2J4X A;  3KLS X;  1D5M C;  1EU3 A;  1SE2 A;  1D5X C;  1JR0 D;  1EEI D;  1LT6 D;  1CK1 A;  1LT5 D;  1RF2 D;  4C56 C;  4L6T B;  5ELD A; 
#chains in the Genus database with same CATH topology
 2HHH L;  3KF6 B;  2R92 B;  2EY6 A;  3AEV A;  3MXU A;  3S16 B;  4G7O C;  1SN8 A;  3S17 H;  1A8V A;  4EQP A;  1LTS D;  4WRD A;  1STA A;  2YTY A;  1Z7T A;  1SNO A;  2MHV A;  4P75 A;  1QVG A;  4BXX H;  2F0N A;  4DR2 L;  2A74 C;  3H0G B;  1EWC A;  2RSO A;  3T16 A;  3F2B A;  4JI3 L;  2UUC L;  4B3M Q;  1I4G A;  3AU7 A;  5JVH 3;  1VQF A;  1S5D D;  5HUR A;  3EVQ A;  3BZD B;  1VQA A;  3TME A;  1QZH A;  5COR A;  3IFD A;  1TY0 A;  2O5I C;  1GXD C;  3G4S A;  3H3V C;  3HOU B;  1KAW A;  3J7A 5;  3GTM H;  5NUC A;  2CHB D;  2IL8 A;  2VW9 A;  2F0K A;  2PMZ B;  3TZD A;  1I5F A;  1Y8O B;  1VQN A;  1PZJ D;  2EPB A;  4NW2 A;  3HOV H;  4DV1 Q;  1WFQ A;  1KIX A;  4PMW A;  1PRT B;  4DV3 Q;  1EEF D;  2JN4 A;  2DGY A;  2YTX A;  2E2H B;  4BY7 B;  3NQT A;  3J81 c;  1G6Z A;  1PH9 A;  4DV0 Q;  5CMD A;  2EYJ A;  3Q23 A;  2K33 A;  3KF8 B;  3I4N B;  3HP3 A;  4A3M H;  3GTJ B;  1U0L A;  5M5X H;  3JAM i;  4DUY Q;  2K5Q A;  1WTO A;  5KEE A;  3SK5 A;  4CDF C;  4MHE A;  5BN4 A;  1PZI D;  2NB0 A;  1HNX L;  3PSI A;  2EYL A;  2JJQ A;  4DR5 L;  4XXE A;  4GN4 B;  1PRT C;  2IPK D;  3WWV A;  1VQ5 A;  4LFC Q;  4IPD A;  1HPC A;  1STE A;  1HNW L;  1D5Z C;  1ASY A;  1CKM A;  1EUJ A;  1JJG A;  3FPU B;  4A93 H;  1GUN A;  2JXM B;  3CCU A;  2K28 A;  3Q22 A;  1DXM A;  4IOC A;  4KD3 A;  4JOI C;  4TRD A;  4QUF A;  1PH4 A;  2QDB A;  1GUO A;  2KVM A;  4HIK A;  3K5O A;  3HOX G;  4C3H G;  1I4H A;  4DAP A;  3NP8 A;  5IGG A;  4X64 L;  1K8O A;  2IX3 A;  1PYS B;  4XYQ A;  4CKB A;  4C3I B;  1W6J A;  4CDE C;  3TBI B;  2SOB A;  1I94 Q;  4PV1 C;  1RL2 A;  4OIK A;  2K5H A;  2N3S A;  3CW2 C;  1Y69 U;  3DMU A;  3ZJY C;  4Y7N H;  1EYA A;  3FDT A;  4U68 A;  3D4D A;  1VCI A;  4YY3 L;  5IT9 c;  1STB A;  4G7Z C;  1HA6 A;  3PF4 A;  1NR2 A;  1VS0 A;  1HZ9 A;  5IYB G;  1EFI D;  3NSW A;  3MFG A;  4HJA A;  4CDD C;  4DK6 C;  4A3J B;  4WOR A;  2N88 A;  3E9H A;  4LK1 C;  2F0D A;  1OXV A;  2R6G A;  2N55 A;  4GNX B;  4IAL A;  1X55 A;  4JI6 L;  1PH6 A;  1CSQ A;  2WAQ B;  1V43 A;  2D62 A;  4R4T A;  1A2U A;  3SEB A;  2JQO A;  3FKI H;  4IPH A;  4BY1 B;  4R4Q A;  3GTL B;  4DNR B;  4DR4 Q;  1VQK A;  1ILQ A;  1IKL A;  4ZLT F;  1BBX C;  2A6H D;  1SDF A;  2KOL A;  2YYZ A;  1S3O A;  1UWV A;  5FJ8 H;  3T56 B;  3P20 A;  1YNN C;  3PUY A;  4KMU C;  4GNX C;  4A3L H;  2JA7 B;  3M4P A;  2WP8 J;  3GDE A;  3GTK B;  1VQC A;  4X3T A;  3S15 H;  5IYC G;  4A3E H;  1VMP A;  1PH5 A;  2NUC A;  2RKS A;  4J1M A;  2KQ3 A;  4X65 L;  5FJ8 G;  1CSP A;  3S1M H;  4A3L G;  2VQE L;  4OL7 A;  4E6I A;  1EIY B;  5CR3 A;  1N32 L;  1H9R A;  5E1F A;  5ELC A;  4IFD H;  1D6E C;  1RHP A;  3KBX A;  3MEF A;  2K50 A;  3BDC A;  1E0B A;  2RDF A;  2B2W A;  5J39 A;  4OWX B;  1SE3 A;  5COY A;  3U4Z A;  3IRB A;  3SE0 A;  2WB1 G;  1ASZ A;  5D14 A;  2BH8 A;  4FXD A;  1O7Z A;  2HD3 A;  3KDF B;  2MUY A;  4IFD G;  4NP5 A;  3PUV A;  3PUW A;  4DK1 A;  1D5X C;  4B9X A;  4ALP A;  2IW3 A;  1HFN A;  1O7L A;  1NNX A;  5I2Y A;  2F3I A;  1CQF A;  5CV4 A;  4LFB Q;  5M3M H;  4DV4 L;  3VA5 A;  2UUB Q;  4FF4 A;  3M4O B;  1G29 1;  1EY4 A;  3IL8 A;  3TS0 A;  2K4K A;  4LF8 Q;  4FVM A;  1HH2 P;  4MNO A;  1PH3 A;  1AFP A;  1B8A A;  4WJ3 M;  1DZ1 A;  4B9W A;  1Q3L A;  3K8A A;  4JBW A;  1XNQ Q;  1FR3 A;  3TP6 A;  2FMM A;  4LWC A;  5FOB B;  2F1M A;  2K05 A;  3L2P A;  4B3R Q;  4FDB A;  2WFW A;  2NVT B;  4X3U A;  5C0X I;  3CCJ A;  4A3I H;  2E8G A;  4A3K B;  2B63 H;  3MFY A;  3PGZ A;  1FL0 A;  4MZ9 A;  4JI2 L;  4HSV A;  1J6Q A;  1GJX A;  3U9S A;  3K5N A;  4A3I G;  2B2V C;  1MBY A;  2DUD A;  3TEH B;  3A7L A;  1JT8 A;  1U5K A;  3M3Y B;  3HZX A;  1QIL A;  2LKV A;  3AFP A;  2F4V Q;  3A56 A;  2LSS A;  4LF9 Q;  3CCV A;  1I3Q H;  5KYI A;  4K8I A;  1HXY D;  2G9D A;  5EAY A;  2X6G A;  5IGE A;  1QJO A;  2V1C C;  1YZ6 A;  2PZT A;  4JV5 L;  5C4Z A;  3DM1 A;  2VUM B;  3K80 C;  4A4I A;  3HOW B;  1BOS A;  4GZY C;  3J81 j;  4LF6 L;  2O5J C;  4YHH Q;  2JA8 H;  1Y1V B;  4PMB A;  5A35 A;  4BBR H;  3R2I A;  2I5M X;  1BQQ T;  3SK8 A;  3K57 A;  1Q1B A;  1N34 L;  1EQR A;  4DR6 L;  3QG1 A;  1WTR A;  2SEB D;  2R61 A;  5D3D A;  1EY0 A;  2NN6 H;  2L12 A;  2TMP A;  4BA1 I;  3ITP A;  2JA8 G;  1B7Y B;  1B9N A;  5C4X H;  3HOZ G;  3KLS X;  4BBR G;  4R1J A;  3CPW A;  1D5M C;  4A3G H;  4IOA A;  1DOM A;  1B50 A;  5JJL A;  1LT5 D;  1RF2 D;  1PFM A;  2F03 A;  3HOY B;  4KJO A;  2NN6 G;  5EKK A;  4QIW E;  3ZYY X;  5ELN A;  5DM7 3;  4CDC C;  1BCP B;  5C4X G;  2HIV A;  1XMQ Q;  1KHI A;  5E3F A;  3U9O A;  4DR1 L;  2OTJ A;  2B8G A;  2F0Q A;  1VQJ A;  2KEN A;  4A3G G;  3W3A A;  4HJ8 A;  1OXX K;  2JA5 H;  2K5V A;  5IOC A;  1GUG A;  4YIJ A;  2XWJ B;  3MZ5 A;  2N78 A;  4CKE A;  3ND9 A;  2XWB B;  5FLM H;  1H9S A;  1RCV D;  2SNM A;  3KJP A;  4GOP A;  2JA5 G;  4LF4 Q;  5CV6 A;  1N33 L;  1BCP C;  4JI1 Q;  2AUJ D;  5C3W A;  2A6E C;  3Q24 A;  2KEE A;  1D8L A;  1PHJ A;  3KOJ A;  3KLW A;  2EYM A;  2RDH A;  1TWA H;  3I7F A;  2ZT9 C;  2P5Z X;  2ZTC A;  2PZU A;  1TWG H;  2DY8 A;  4XTC S;  1BO0 A;  4B3S Q;  1KRT A;  4PNY A;  3NEL A;  1RTO A;  1KAA A;  1Z9F A;  5FO7 B;  3T51 B;  4DR7 Q;  1WTQ A;  4KKU A;  4V19 0;  2NVY B;  5BR8 Q;  1HQR D;  1L0W A;  3RZD B;  2JA6 H;  1N36 L;  1ZEQ X;  3J7Z C;  1BUV T;  2AHO B;  1WI5 A;  3E3X A;  5FK9 C;  5AJ3 Q;  4GKK Q;  2KHI A;  2MNA A;  2PYK A;  3CCR A;  1QB5 D;  2NZH A;  1M4V A;  3J81 E;  1YBY A;  2EY5 A;  2UUA Q;  3MVV A;  3QR8 A;  3S1N B;  2ZXO A;  3OPO A;  3BVM A;  2B2Y C;  1ZYR C;  4KN7 C;  1OXS C;  1IYV A;  1MSH A;  3A54 A;  3I2Z A;  1SNQ A;  2C5C A;  4RG1 A;  4ZRZ A;  3A8J E;  4K14 A;  1K0S A;  2EOT A;  2CW0 C;  3KYH C;  1JB7 A;  5JAV A;  4OX9 Q;  1SRU A;  1XPU A;  3EFX D;  4EQO A;  1JJC B;  3C3L A;  1LTR D;  2EXD A;  4JI8 Q;  1SJE D;  1O7Y A;  2CFM A;  3I90 A;  2EJF C;  4MTK A;  1YNJ D;  5IE8 A;  1M1K C;  1H9S B;  3CCQ A;  4A75 A;  3K0Y A;  3CCM A;  4KHZ A;  2KUM A;  2FJ2 A;  2WB1 E;  1XMO Q;  1F2Y A;  2HT1 A;  1NSN S;  1L0Y B;  2HDM A;  2ES2 A;  2BE5 D;  5C6A A;  1V8Q A;  5E4X A;  3PO2 H;  3KLS A;  5I9P A;  3W5O A;  4DV2 Q;  5IY0 A;  2EIF A;  2NVX B;  4NXM Q;  3CF5 A;  2Z6K C;  4QGU A;  4DV1 L;  1IYU A;  3T1H L;  4JBK A;  1KDC A;  4DV3 L;  3M9B A;  2UU9 Q;  1Q12 A;  1R9T B;  3JAM L;  3BU2 A;  1E24 A;  1QVC A;  2AWO A;  3GP7 A;  3K59 A;  3D3R A;  2CCZ A;  4DV0 L;  3PO2 G;  1DOK A;  1AP0 A;  1JOO A;  1PYB A;  3BYY B;  2AKW B;  1S5F D;  4G57 A;  3NBH A;  5IT9 E;  4A3F H;  1TXY A;  3F8T A;  1PH2 A;  1GD7 A;  1RKN A;  1G2S A;  2Z1C A;  5K5P A;  1U4L A;  1JJ2 A;  4K8J A;  3RD4 A;  2Q2I A;  4DUY L;  3HS0 C;  2XIW A;  3W1B A;  3DLL A;  1IXR A;  1U9R A;  5M5X B;  4I7A A;  1NCV A;  5EKL A;  4HMJ A;  1CZW A;  4DN4 M;  2K03 A;  1HHV A;  1CI3 M;  4FO2 A;  2EVB A;  4QIW B;  3J81 i;  1K8A C;  3F2U A;  3NHH A;  5JEA J;  3HOX B;  4C3H B;  5M3F H;  3K7A H;  2Y0S G;  2V4D A;  5M5Y B;  1Q81 C;  1A0I A;  4AIM A;  1HTP A;  1O78 A;  4C3J H;  2NVQ B;  5BN5 A;  3CQZ H;  4HCE A;  1CT1 D;  3H09 A;  1GUT A;  2VXW A;  4R9W A;  5M3F G;  3CPF A;  2QW7 A;  1FGB D;  1L1O A;  3QB3 A;  1HCZ A;  1SYF A;  2RF4 A;  1CTM A;  1EY8 A;  2DJF C;  5EPL A;  5G3L D;  4A3B H;  2PNH A;  1WCM H;  4A76 A;  2EZV A;  2EYF A;  3S1R B;  4OO1 I;  5DLQ E;  1V1P A;  1ICW A;  2JEA I;  1QCB D;  3S2D B;  4Y7N B;  1PDQ A;  2YTV A;  4A3D H;  1STY A;  5EPK A;  4DR3 Q;  2ZTE A;  4A3B G;  1WCM G;  1RJT A;  1YHQ A;  4C1N K;  4OWW B;  3I4M H;  4IJL A;  1X56 A;  2WKC A;  2PQE A;  1ROD A;  1BCP F;  2E2I B;  1VQB A;  2FXQ A;  3RR5 A;  2K5D A;  4FF2 A;  5JVG 3;  1FNV A;  4HIO A;  1PH8 A;  5C4J H;  4HID A;  2E2D C;  2ZXR A;  3T13 A;  5J3B A;  2MGS A;  5LMU L;  2UXC L;  4DV5 Q;  2LS0 1;  3NTK A;  4EX5 A;  3I4M G;  2TSS A;  4X62 Q;  3NUC A;  1NBW A;  1VQP A;  2EYP A;  1YNX A;  2ZTD A;  3R2T A;  3OTO Q;  2EYO A;  4PQX A;  3PV0 A;  2LFN A;  4DGZ A;  4JBM A;  3QOL A;  3TDQ A;  1HA5 A;  2Q8I B;  3J7Y W;  1IW7 D;  2F0O A;  3CKI B;  2ZJP A;  3A8I E;  3BVG A;  1S5B D;  3CC7 A;  5E7N A;  3PF5 A;  5GAG C;  5C5M A;  3NBI A;  1B9M A;  3QOJ A;  4DUZ Q;  2L0C A;  4NDX A;  3RNU A;  2B2T C;  1L1O B;  2RCF A;  4OEM B;  3DUZ A;  5ELB A;  2UXD L;  4H7B A;  4AQY Q;  1K83 H;  1BBW A;  4KN4 C;  1T5X D;  2FIN B;  3AB9 A;  5KND A;  2WB1 B;  1A3V A;  5FKA C;  1YIT A;  1HNZ L;  3D0F A;  3K81 C;  4LF7 L;  1Q82 C;  1V1P B;  2ICE C;  4WJ4 A;  3STB C;  1OXT A;  4HAE A;  4BXX G;  3QJY A;  2E2J B;  4IO9 A;  1K9M C;  3S14 H;  1LTL A;  3NWS A;  1LTI D;  1G91 A;  1P8L A;  1AE3 A;  1R4P B;  2X69 A;  2F4I A;  1L1O C;  2Z6B A;  3TRE A;  2O4X A;  2EE1 A;  1HQM C;  5CC4 A;  2R93 H;  4LFA Q;  1V1Q A;  2E75 C;  2J7Z A;  1K8G A;  2CWA A;  4LNQ A;  4LFB L;  2F0J A;  1B53 A;  1KQS A;  2UUB L;  3HGB A;  3DWP A;  3UI2 A;  2KA7 A;  4RGT A;  1PZK D;  5GAE C;  2R93 G;  1X65 A;  4LF8 L;  3HOV G;  4RGN A;  4TQU S;  1B1Z A;  3M4Q A;  1HZA A;  3A8K E;  4U67 3;  1STH A;  2BCO A;  3SGI A;  1XNQ L;  3E9I A;  2C9O A;  5C0X H;  1XYI A;  2B3G A;  5HGQ A;  1P16 A;  2NYZ D;  1D7Q A;  2GVA A;  3KFU A;  2K7V A;  4ZQ3 A;  3GTO H;  4EVO A;  4A3M G;  4RGM A;  1TY2 A;  1KNE A;  2BH2 A;  1XX8 A;  3FPP A;  3OHX C;  4FXG C;  4F7X A;  4A3I B;  4LUO A;  5C0X G;  1HRJ A;  3L7Z C;  3VR3 A;  4FP5 D;  3K5M A;  2KEC A;  3G48 A;  3PUX A;  2WKD A;  1EZ6 A;  1I50 H;  4C1N I;  4GLA C;  1PTO B;  1EYD A;  3ULJ A;  1SNM A;  4PMC A;  4X3K A;  3SDZ A;  2NBF A;  2XRQ D;  4DAY A;  4A93 G;  4CKC A;  2A68 D;  5FO8 B;  1AZP A;  3BG3 A;  5IWA Q;  2F4V L;  2OXP A;  4LF9 L;  1UE1 A;  1SFO H;  4KLK A;  2FMC A;  1DYQ A;  2XSC A;  4N9P A;  1L0X B;  3NXW A;  2A69 D;  3J7A V;  1Q86 C;  2Q2T A;  3MAQ A;  1WTP A;  4XT1 B;  2K75 A;  4FF1 A;  2M00 A;  5IP9 H;  3J80 i;  4IUU A;  5IGB A;  1E3P A;  4I65 A;  1PTO C;  2XTI A;  4YHH L;  4JI7 L;  2VL6 A;  3CMA A;  2EY1 A;  1BXT A;  1X3Q A;  3C1F A;  3IFT A;  1XWE A;  2HCI A;  3U50 C;  1CUK A;  4BBR B;  5KNB A;  3M85 A;  3HOZ B;  1TQO A;  3E6Z X;  1H9J A;  4DV7 Q;  5IP9 G;  1SSO A;  1LT3 D;  4OGQ C;  4HMI A;  1LV9 A;  1JQY D;  1MD2 D;  1WVL A;  3C46 A;  4K0K Q;  2EDG A;  3ONA B;  2K52 A;  3OYY A;  3PIP 3;  1YNN D;  2G9H D;  1SMY C;  1VQH A;  3NTH A;  1VQD A;  5GQO A;  3FVQ A;  3CCL A;  4AYB G;  5C4X B;  3CP0 A;  5HGT A;  4JI4 Q;  1IHZ A;  2Y0S E;  3D4W A;  4A3G B;  2IT1 A;  3DEO A;  3OIQ A;  4IN3 A;  5LMN Q;  2X6L A;  2ATW A;  1IYJ B;  2KBN A;  3TP8 A;  1MJE A;  2Z4H A;  3FKI G;  2BA0 A;  1JC7 A;  1XMQ L;  4JYA Q;  1B4O A;  4G7H C;  5DAU A;  3HG9 A;  1F9R A;  1EYC A;  3ERQ A;  1NMF A;  3H94 A;  1G2T A;  1JMC A;  1QOH A;  2JA5 B;  1Q8I A;  1DON A;  3OIP A;  1QWY A;  5D65 A;  4XDX A;  1A3T A;  2R92 H;  3S16 H;  1D1I A;  4A3E G;  4LF4 L;  2MO1 A;  1ML0 D;  4JI1 L;  1Z6H A;  5T1I A;  4UAI A;  1TWF B;  2B8F A;  2IWH A;  2A6H C;  4R4C A;  3PO3 H;  3H0G H;  4LW1 A;  2B2U A;  2EY2 A;  4FNF A;  2NTT A;  1RIP A;  3D8G A;  4DR2 Q;  4B3S L;  1SLJ A;  2K01 A;  2YV5 A;  1NJI C;  2UUC Q;  4JI3 Q;  3TP7 A;  4DR7 L;  5CYU A;  1WJJ A;  2IHF A;  3HOU H;  3BVZ A;  1IL2 A;  4N9T A;  3KK7 A;  1TWC B;  3CC4 A;  4HIM A;  3EQL C;  3PO3 G;  5I4D A;  5J22 A;  4HJ5 A;  2F0U A;  3DWA A;  4GKK L;  2PPB C;  3HFZ B;  3OWF A;  3LNN A;  5LMN W;  5E4W C;  4HJ9 A;  3LX0 A;  2E2H H;  4IUR A;  1S4Z A;  2GN5 A;  2D0O A;  5M3M G;  2N8N A;  1TVX A;  4P2C B;  4ZCK A;  4DNT B;  3QWN A;  3TN2 A;  4NKL A;  3LWE A;  2HCC A;  1YEZ A;  1HFG A;  1WD1 A;  3I4N H;  4OX9 L;  4BWG B;  5GAH C;  1WD0 A;  1ESR A;  4FF3 A;  3NQI A;  4JI8 L;  1XTD A;  5A2Q E;  4GLX A;  4P73 A;  4LF5 Q;  1QG7 A;  1E22 A;  2NTS A;  3IAY A;  4LUV A;  4C2M H;  1TWH H;  1TS3 A;  1HNX Q;  4ODG A;  1X3F A;  3A7A B;  1PRT F;  2PO4 A;  4FYD A;  3UDX A;  3J80 c;  4JI5 L;  2KHS A;  1E1T A;  2A8V A;  2B63 G;  1PLF A;  5M5W B;  2AQ3 B;  1XMO L;  5GRO A;  4J15 A;  4GS3 A;  2RHQ B;  2QEX A;  2KHJ A;  1WYD A;  3PO2 B;  1EFW A;  4NXM L;  1NR4 A;  4DAM A;  4CJ1 B;  2K04 A;  1STG A;  1IKM A;  1UE5 A;  1TR5 A;  1IBM Q;  3I4O A;  2JSO A;  2H1E A;  1WOC A;  2B2W C;  3VYU A;  4ZKC B;  1F2L A;  4J6H A;  2Z0S A;  4OHJ A;  4APV A;  4IPC A;  1PH1 A;  5IOD A;  3ND8 A;  3J81 L;  1UE6 A;  2MJ8 A;  4I7Z C;  1EU4 A;  4L5T A;  1WTH A;  1SYE A;  1PTO F;  2A73 B;  3ERO A;  1J5E Q;  4JI0 Q;  2XNA C;  1SMX A;  3T4A C;  2Y0S B;  3Q8D A;  4A3J H;  1I6V C;  1A6X A;  1SND A;  1G51 A;  4Q0F A;  3NEN A;  4IUN A;  5FLX c;  5M3F B;  2IHE A;  3K7A B;  4NB3 A;  4B3T Q;  3HKZ G;  4BY1 H;  3GQB A;  2EJG C;  3S2H B;  3GTL H;  4YWM A;  1YIJ A;  1E1O A;  1ONL A;  1SYG A;  5LL6 S;  1A62 A;  1F2M A;  2K14 A;  5LHY 1;  4P72 A;  1VQ9 A;  2AMC B;  2F52 A;  3CQZ B;  3BS1 A;  1I4P A;  1IBL L;  4RAU C;  1DJR D;  4HN7 A;  1NMG A;  4R4I A;  3I3C A;  2AUK A;  5AFW A;  4OO1 H;  3OMC A;  2JA7 H;  1BDO A;  2XRS D;  1ET6 A;  3A5Z B;  1A2T A;  1FGU A;  1K3B C;  4ZYS A;  4HED A;  1N9W A;  3ULP A;  4BBS H;  4DV6 Q;  1FVI A;  3VR2 A;  3H3V I;  3U58 A;  1WCM B;  1IBK L;  1Y1W H;  1LUZ A;  3S9W A;  3FHW A;  4H13 C;  2KCM A;  4OO1 G;  2JA7 G;  4DR3 L;  4LJZ C;  1JOQ A;  5DM6 3;  5FLM G;  4QF4 A;  1MGS A;  1TKW B;  1AZQ A;  2F3W A;  4BBS G;  4DU9 A;  5IT9 L;  4K5V A;  2JP1 A;  3GTQ H;  2XN9 C;  1Y1W G;  5CBA E;  4ID6 A;  2DJG C;  2PQA A;  3I4M B;  5BN3 A;  4JVZ A;  2VQF L;  3D31 A;  4UP7 A;  1E7Z A;  1JWU D;  3WOE A;  4DK3 C;  5CV7 A;  3MTS A;  3H91 A;  4DV5 L;  1U4P A;  5KRU A;  1LTG D;  4AYB E;  5C4J B;  2HQL A;  1ICF B;  3EJI A;  1GHJ A;  1EY7 A;  2M9V A;  4EGV A;  3OTO L;  4QL5 A;  1EU3 A;  2JA6 G;  1I6H B;  5KIX A;  1CK1 A;  1MJC A;  4IUV A;  2L11 A;  4XQN A;  1B70 B;  3M4O H;  2XGT A;  5M9O A;  2E5L Q;  5TSS A;  1LT4 D;  1C9O A;  4M8A A;  4KJN A;  3S17 B;  5IGF A;  4DF7 A;  1CKO A;  1LAC A;  1IL8 A;  1TT2 A;  4RFB A;  1PYW D;  4AQY L;  1V9P A;  1FNU A;  5I9O A;  4ULL A;  1M90 C;  4B3M L;  4B08 A;  4KHP Q;  3FEW X;  1OTC A;  5F2D A;  3C2P A;  1K83 B;  4GOP B;  1G8Z D;  4ZUI A;  4A3K H;  3MXG A;  3WOF A;  3I73 A;  2D0P A;  4X6A H;  1VQ8 A;  2A1A A;  1Y8P B;  1B3A A;  2G5D A;  3GTM B;  4PZ8 A;  2YU9 H;  4O1N A;  3DWQ A;  4CJ2 C;  2IY5 B;  1FD7 D;  3D4R A;  2EXZ A;  2RQX A;  3EN2 A;  3CHB D;  1LM0 A;  1QNU A;  2E76 C;  3MA2 B;  3AQQ A;  4LFA L;  3M3Y H;  3F2D A;  1I4Q A;  4POF A;  4GKJ Q;  2R93 B;  3HOV B;  4RHR A;  4GOP C;  1Y8N B;  3RN2 A;  4X3S A;  2QA4 A;  3AYH B;  2OQ0 A;  3EA6 A;  2WV6 D;  5IP7 H;  3K58 A;  1EIH A;  1YNJ C;  1CQV A;  2F0G A;  5CV9 A;  1XPR A;  3K7U C;  1PA6 A;  1EIG A;  4K2L A;  4OWT B;  3BYT B;  1AN8 A;  2EJM A;  1LTT D;  3VR4 A;  3HOW H;  4A3M B;  2WIN B;  3PUZ A;  1HR0 Q;  4Z9C B;  2DNE A;  4KV6 A;  1AH9 A;  5IP7 G;  4A3F G;  2BE5 C;  1E2Z A;  3GTG H;  2CWP A;  4LFC L;  4QQB X;  3RZO H;  3OW2 A;  4X66 Q;  1N34 Q;  4DR6 Q;  1GOZ A;  1H95 A;  3D6C A;  3I8Z A;  1II3 A;  4A93 B;  3TP5 A;  2VY3 A;  2A19 A;  3MXN A;  4JC0 A;  1JOK A;  2F0H A;  3S1Q H;  1VDZ A;  1JE4 A;  4H0L C;  1SRO A;  5CGK A;  1C48 A;  4RA8 A;  1SE2 A;  1JIC A;  3HOY H;  3PQI A;  2F3V A;  5EBD A;  2J0T D;  3GD7 A;  5IWA L;  4L6T B;  3CME A;  1VF7 A;  1CKN A;  2F0M A;  3J80 L;  2K32 A;  1I94 L;  4C3J G;  2R7F A;  4DR1 Q;  1DGS A;  1GUS A;  1VQL A;  2M2L A;  1D2B A;  3EIV A;  5ISR A;  4DXF A;  4NMZ A;  1EOV A;  4P74 A;  5T1G A;  4ABN A;  4CJ0 B;  1HJP A;  2PI2 A;  1R4Q B;  3NBH B;  4L5Q A;  4BY7 H;  2B29 A;  1KC8 C;  4ILW A;  3OW7 A;  4IJH A;  1HR0 W;  1XNR Q;  4QY7 A;  2Q8R E;  1V1O A;  4AYB B;  1S40 A;  4A3D G;  3QIA A;  5KNC A;  4K0K L;  4MN3 A;  3UE0 A;  4IZ8 A;  3CD6 A;  3VYS A;  3F1Z A;  4KY6 A;  1U4R A;  3A5U A;  4RMF A;  4BY7 G;  4ME5 A;  4K6L A;  2ZJQ A;  3FKI B;  4DR4 L;  4JI4 L;  3E0J A;  5LMN L;  3PMF A;  4QB4 A;  1SNP A;  3HKZ E;  4PZ7 A;  4XT3 B;  2QDL A;  3CAM A;  4JYA L;  4XQQ A;  1ENC A;  3MXN B;  4KKT A;  3NPP A;  5IYD H;  2HUG A;  3R93 A;  2DNC A;  1JB3 A;  2OTL A;  2AQ1 B;  3PCO B;  3S1N H;  3KF8 A;  3S15 B;  4A3E B;  3GTP H;  5JEA H;  1CA5 A;  1BBU A;  2SDF A;  1WTV A;  5IYD G;  2R7Z H;  1TII D;  3PIO 3;  1KTK A;  3S1M B;  5H1S E;  4N8X 1;  3KLR A;  3G6E A;  1UEA B;  4YWK A;  1PXU A;  2H4O A;  1KRS A;  1X6O A;  3ER0 A;  1KDA A;  4K2K A;  2R7D A;  1FJG Q;  5JEA G;  3D6W A;  1D1K A;  3J80 E;  2RHS B;  4RHS A;  5IIF A;  2R7Z G;  2BOS A;  1A15 A;  4O0A A;  3PO3 B;  1IW7 C;  2R3Z A;  4YCW A;  1E2W A;  2CQA A;  3A0J A;  3G71 A;  4P71 A;  3SHL A;  3I91 A;  4RWS C;  4WFN 3;  1LO5 D;  4DPG A;  5JOB A;  3W2D A;  4UY8 C;  4BA2 I;  1Q90 A;  1PRT D;  1Q1E A;  2NVX H;  2ZM6 Q;  5M3M B;  2F0P A;  2B39 A;  5EJW A;  1PFB A;  3T1Y Q;  1X32 A;  1S5C D;  1S72 A;  3Q6S A;  3CXC A;  1F9S A;  1EQQ A;  2C35 B;  1R9T H;  1EY9 A;  5ELE A;  2L1B A;  3T1H Q;  2SNS A;  5K36 H;  2F0F A;  3CC2 A;  1QUQ A;  4B3R L;  1NY4 A;  2ALY B;  1HZC A;  4V0B A;  3CRK C;  5JJZ A;  3W1G A;  2L4N A;  2HQE A;  4UP8 A;  4YCU A;  3BZK A;  5C44 H;  3A55 A;  2OQK A;  5K36 G;  4GNX A;  4DFA A;  2B63 B;  4LF5 L;  3RLN A;  4LMQ D;  1F77 A;  4DK0 A;  5JJK A;  4KTA A;  1KDB A;  5FLX E;  4C2M B;  1TWH B;  1SYD A;  3DEP A;  3HOX H;  3S24 A;  4C3H H;  5C44 G;  5C3E H;  1JWM D;  3FRP B;  4RKB A;  3PIP A;  1PTO D;  1ENF A;  5M5Y H;  1X3G A;  5EGT A;  2PW7 A;  2NVQ H;  4RGO S;  4IFD J;  1UUP A;  4Q5V A;  1ZXT A;  1I3Q B;  1SXT A;  5IGD A;  1RTN A;  5C3E G;  3L0O A;  1IBM L;  1PMR A;  3KJO A;  3KBG A;  1LYL A;  3AFQ A;  4AH6 A;  1SMY D;  1SJH D;  4NXN Q;  4HR7 B;  4OIJ A;  1PVO A;  1K3R A;  2MQH A;  4EQN A;  1WTX A;  2AQ2 B;  2RBM A;  3P1H A;  2ZJR A;  3J7A F;  1F9P A;  4K6D A;  2JA8 B;  3S1R H;  2IX0 A;  5IYB H;  2EQS A;  2ASB A;  2FHT A;  2GA4 B;  3S2D H;  1UNS A;  1KLG D;  5DNF A;  3HKS A;  5KGU A;  1J5E L;  3L3O C;  4JI0 L;  3EBE A;  1XXG A;  1DD2 A;  3VR5 A;  2A68 C;  1QUQ B;  2J4X A;  2MFI A;  2K5W A;  4ZK9 B;  1QNK A;  1K73 C;  3HKZ B;  2I5H A;  2UXB Q;  3I4L A;  3KDF A;  3X3N A;  4LUZ A;  3TQY A;  2E2I H;  4BS9 A;  3KUP A;  2K5N A;  2A69 C;  2F0E A;  4B3T L;  2QF7 A;  4J8Q A;  4XYO A;  3ULL A;  5HY6 A;  5A2Q L;  3TRZ A;  4HCS A;  4S3S A;  4JBJ A;  4RCO A;  1PFS A;  5LMU Q;  2UXC Q;  2Q2H A;  1BNZ A;  5G3L F;  1SE4 A;  4DAY B;  3RN5 A;  1HTL D;  3ERS X;  5IYC H;  1QVF A;  3H3V H;  1VQI A;  5C4H A;  1C7Y A;  4EQ5 A;  4RKL A;  3TSS A;  1SEB D;  2B2V A;  1GVP A;  2F0L A;  4DV6 L;  1XPO A;  4KY5 A;  1C8C A;  2CH4 A;  1VQ7 A;  2HHH Q;  1OXU A;  4UDU C;  4BBS B;  3NWT A;  2NWG A;  5JPN C;  1JOR A;  4F8M A;  3GV3 A;  2RDG A;  3K0X A;  3RMH A;  1Y1W B;  2R92 G;  4H44 C;  2Q2U A;  5IGC A;  3NTI A;  2UXD Q;  3CRL C;  1TWA B;  3L9A X;  5C3X A;  4DKA C;  1VF5 C;  1TWG B;  3JC6 6;  1W6K A;  4A3C H;  3R8B A;  1HNZ Q;  5BR8 L;  3I55 A;  3GTQ B;  2E2J H;  1ET9 A;  4LF7 Q;  3H0G G;  1CZG A;  5EPJ A;  3VYT A;  5AJ3 L;  4GN3 B;  2JA6 B;  1J9O A;  2CVR A;  3I70 A;  1RD9 D;  3VR6 A;  3V96 A;  3HOU G;  3JAM c;  1VQG A;  2RVL A;  4CHT B;  4A3C G;  4HJ7 A;  2UUA L;  3U4V A;  3URY A;  2Z9H A;  1CHP D;  3N6R A;  4QJF A;  1STN A;  1LLR D;  1J8I A;  5ELF A;  1NUC A;  3O13 A;  2D5D A;  1FYC A;  1SAP A;  3V05 A;  2E5L L;  2MP1 A;  3GTJ H;  1DOL A;  3DM3 A;  4F88 A;  2ENB A;  2CH4 W;  3SXH A;  1BF4 A;  1K8M A;  4CGY B;  1KD1 C;  1MHW C;  3F2C A;  1YVC A;  4ZAI A;  4KHP L;  2JEB I;  1JR0 D;  2L5T A;  2PW5 A;  4DNI A;  4ME3 A;  1KXL A;  3I4N G;  1KAB A;  3I56 A;  4DR5 Q;  1O7I A;  4C56 C;  3BZC A;  4POG A;  3M7N A;  2I07 B;  1W3S A;  4JK1 C;  3OWE B;  1HNW Q;  1B3Q A;  2PCF B;  1SYC A;  5D3I B;  3MC0 B;  4WJW A;  3A74 A;  2OEO A;  3E5S A;  4IUQ A;  4OON A;  2IX1 A;  4RCN A;  5EQ0 A;  1Q7Y C;  2LXJ A;  5I6W A;  1ZKO A;  4DV2 L;  2YU9 B;  1T9H A;  1JCK B;  2F0S A;  1PTO H;  3P75 A;  3VA7 A;  1GUW A;  3CU7 A;  4G4K A;  3CCE A;  1MIU A;  1NTG A;  1FNW A;  1GKH A;  2QEJ C;  3B6Y A;  3BDO A;  2UU9 L;  4GKJ L;  2N49 A;  2QIL A;  2GVB A;  4C3I H;  2VZA A;  4IQZ A;  2FFK B;  5C5L A;  4X64 Q;  1TS4 A;  1YJN A;  4IUP A;  4UP9 A;  2VS1 A;  1T5E A;  5EKI A;  2OWO A;  1SE8 A;  3G7L A;  4QMG A;  4R4O A;  2B2U C;  4A3F B;  1X3P A;  3M4Y A;  3MEH A;  4K5W A;  3UDF A;  4C3I G;  1KL9 A;  1HR0 L;  1X54 A;  1SYB A;  4KHV A;  4YY3 Q;  4TSS A;  1L2F A;  5J1Z A;  1TS5 A;  4JI7 Q;  3SVM A;  2OT2 A;  3HOZ H;  3GTG B;  1M8A A;  2B2Y A;  4X66 L;  2CQO A;  1O80 A;  1SR3 A;  3RZO B;  5ELO A;  1F2Z A;  1EZ8 A;  4JI6 Q;  2I0Q A;  1LTA D;  1CHQ D;  2HIX A;  2PNR C;  4A3J G;  1G6P A;  1EY6 A;  2Z8L A;  2LY7 A;  4K5X A;  1IZ6 A;  1E2V A;  1BCP D;  3TS2 A;  2A6E D;  1VQE A;  4C3J B;  3S1Q B;  2WAQ G;  3I72 A;  1X9N A;  4HSP A;  2JE6 I;  1C4Q A;  4BY1 G;  3DXJ C;  1ESF A;  2A5H A;  2KJX A;  3N52 A;  1BKB A;  1I4R A;  4KY7 A;  4IPG A;  3GTK H;  3ICE A;  3Q0A A;  4A3B B;  2L9H A;  3VYR A;  4XQJ A;  3X3M A;  2OF1 A;  1EYG A;  1B44 D;  4R8N A;  1EL0 A;  4DXG A;  4LAA A;  4X65 Q;  1UEB A;  3GV6 A;  1QE6 A;  2Z6K A;  5I6Y A;  4A3D B;  1ILP A;  1KNA A;  4N8F A;  3RUZ A;  2VQE Q;  1N32 Q;  2F0W A;  1I4X A;  3TZU A;  4MTN A;  4YCV A;  3RLF A;  3LGJ A;  4L5R C;  1XNR L;  1CFM A;  1EQT A;  4PZ6 A;  3DHQ A;  1TS2 A;  4DA2 A;  1TWF H;  1ZYR D;  4NPS A;  2Q8T A;  2ID0 A;  2RSN A;  5JJI A;  4L5S A;  4IFD I;  2F0T A;  2JYO A;  5JPM C;  2XVS A;  4CBV A;  2CW0 D;  2WII B;  4X62 L;  3MWY W;  1GM5 A;  1AW7 A;  5CV8 A;  2I46 A;  1TWC H;  3LWU A;  1KLU D;  1A63 A;  2F0I A;  4O42 A;  1YHB A;  4M1U B;  1JWS D;  1EY5 A;  4TVA B;  2KCC A;  1S5E D;  4JG2 A;  3UDI A;  4RH6 A;  2BA1 A;  4DV4 Q;  1YI2 A;  4F87 A;  5CV5 A;  4DUZ L;  4H02 A;  3UE1 A;  1DM0 B;  5EBC A;  2BDN A;  2L55 A;  5KYL A;  1VQ4 A;  1CM9 A;  1UAP A;  1HZB A;  2O2L D;  3GTP B;  2MO0 A;  4OXP A;  1SBB B;  3UDG A;  1EQV A;  3P7J A;  1A3U A;  2NVT H;  2R7Z B;  2RA4 A;  1FJG L;  2MPM A;  5L37 A;  3HRZ C;  2RCN A;  1MI2 A;  4JCV E;  2KCN A;  2EYH A;  2VB2 X;  1HUM A;  2KED A;  3S14 B;  4JI2 Q;  4L63 B;  3NE5 B;  4KI0 A;  3FMC A;  4A3K G;  4GLV B;  2PI2 E;  1K28 A;  5M5W H;  3VDY A;  1VQ6 A;  4KKS A;  4YWL A;  3NK9 A;  3SK4 A;  2PQA B;  4JI5 Q;  1X3E A;  1VQM A;  3MHB A;  1K0R A;  1VMC A;  4QUC A;  1BVS A;  1U4M A;  2JA9 A;  4IUT A;  2ZM6 L;  2IJ0 A;  2F0V A;  3T1Y L;  2HDL A;  2LMC B;  1Z47 A;  2K6A A;  2QCP X;  4O2D A;  1AE2 A;  4ZKB B;  3C1E A;  1UE7 A;  3V2T A;  2VUM H;  2PMZ E;  1YHA A;  4JV5 Q;  1H9K A;  2NZO A;  1OO9 B;  4ZUJ A;  3H6M A;  1ENA A;  5GAD C;  1Y1V H;  1EWI A;  4HTH A;  2DY7 A;  4LF6 Q;  5ELD A;  4DAV A;  3HEJ A;  2VUM G;  5LL6 X;  2AWN A;  1SNC A;  3HOW G;  3OMG A;  3GTO B;  1DCZ A;  4JPB W;  2WAC A;  1PV4 A;  1Q8K A;  1RDP D;  3G6J B;  5C44 B;  1Y1V G;  2QKI C;  1W2B A;  4JW0 A;  1HUN A;  1Q46 A;  1YJW A;  1BR9 A;  3GO5 A;  1XTC D;  4L8J A;  1JE5 A;  2B2T A;  1QZG A;  1I50 B;  2KCT A;  2NN6 I;  1H9M A;  3FP9 A;  2VB3 X;  3M7G A;  1WTW A;  1AEX A;  4PG3 A;  3OOC A;  1LTB D;  3RLO A;  5C3E B;  4Y52 H;  1N8R C;  3S2H H;  1C0A A;  5I2X A;  1CA6 A;  4GN5 A;  1EWH A;  2JK8 A;  4UPA A;  1YJ9 A;  2BDO A;  1SFO B;  1PFN A;  3KF6 A;  2ZXP A;  2ICI A;  3BJU A;  3HOY G;  4FXK C;  3E0E A;  4OEL B;  4XIG S;  3K6O A;  2H5X A;  3QO2 A;  1IBL Q;  1B2T A;  4NXN L;  4UHV A;  2DN8 A;  1NAP A;  1Y14 B;  3SR1 A;  1GO3 E;  1VQO A;  1GHK A;  4DV7 L;  1N33 Q;  1IBK Q;  3MXP A;  3PIO A;  2I5L X;  2L15 A;  3AMU A;  1XJV A;  3CCS A;  4KD4 A;  2D2C C;  2QGQ A;  1F9Q A;  2NZ1 D;  3SK6 A;  2UXB L;  1NE3 A;  1PH7 A;  2PZW A;  2OCE A;  1MSG A;  1TU2 B;  2NVY H;  4QCL A;  3IKJ A;  3RZD H;  2CKZ B;  2LXK A;  4R8I A;  1EOT A;  3JAM E;  3WDN A;  4MIU A;  5C0X J;  2VQF Q;  3BDL A;  1N36 Q;  3R3O A;  1LAB A;  5FO9 B;  3NEM A;  2D9U A;  2E74 C;  2WAQ E;  5FLX L;  1MKH A;  3T53 B;  4KK7 A;  3H15 A;  3STB D;  4JOI A;  1I6H H;  5CBE E;  2Z4I A;  2VNU D;  3K5L A;  1CKN B;  1EEI D;  1EIF A;  3OSO A;  5DEH A;  1LT6 D;  2K1B A;  4TKO B; 
#chains in the Genus database with same CATH homology
 2R92 B;  2EY6 A;  3MXU A;  3S16 B;  4G7O C;  4EQP A;  1LTS D;  4WRD A;  1STA A;  1Z7T A;  1SNO A;  2MHV A;  2F0N A;  2A74 C;  3H0G B;  1EWC A;  2RSO A;  3T16 A;  1I4G A;  3AU7 A;  5JVH 3;  1S5D D;  5HUR A;  3EVQ A;  3BZD B;  3TME A;  5COR A;  3IFD A;  1TY0 A;  2O5I C;  1GXD C;  3H3V C;  3HOU B;  5NUC A;  2CHB D;  2IL8 A;  2F0K A;  2PMZ B;  3TZD A;  1Y8O B;  1PZJ D;  2EPB A;  4NW2 A;  4PMW A;  1PRT B;  1EEF D;  2E2H B;  3NQT A;  1G6Z A;  5CMD A;  2EYJ A;  3Q23 A;  2K33 A;  3I4N B;  3HP3 A;  3GTJ B;  2K5Q A;  1WTO A;  5KEE A;  3SK5 A;  4MHE A;  5BN4 A;  1PZI D;  2NB0 A;  2EYL A;  4XXE A;  1PRT C;  2IPK D;  1HPC A;  1STE A;  1D5Z C;  3FPU B;  1GUN A;  2JXM B;  2K28 A;  3Q22 A;  1DXM A;  4KD3 A;  4TRD A;  4QUF A;  2QDB A;  1GUO A;  2KVM A;  3K5O A;  4C3H G;  1I4H A;  4DAP A;  3NP8 A;  5IGG A;  1K8O A;  2IX3 A;  4XYQ A;  4CKB A;  4C3I B;  1W6J A;  3TBI B;  2SOB A;  4PV1 C;  4OIK A;  1Y69 U;  3DMU A;  1EYA A;  3FDT A;  4U68 A;  3D4D A;  1VCI A;  1STB A;  4G7Z C;  1HA6 A;  1NR2 A;  4A3J B;  1EFI D;  3NSW A;  3MFG A;  4WOR A;  2N88 A;  4LK1 C;  2F0D A;  1OXV A;  2R6G A;  2N55 A;  4IAL A;  2WAQ B;  1V43 A;  2D62 A;  1A2U A;  3SEB A;  4BY1 B;  3GTL B;  4DNR B;  1ILQ A;  1IKL A;  4ZLT F;  1BBX C;  2A6H D;  1SDF A;  2KOL A;  2YYZ A;  3T56 B;  3P20 A;  1YNN C;  3PUY A;  4KMU C;  2JA7 B;  2WP8 J;  3GTK B;  4X3T A;  1VMP A;  2NUC A;  2RKS A;  4J1M A;  2KQ3 A;  4OL7 A;  4E6I A;  5CR3 A;  1H9R A;  5E1F A;  5ELC A;  4IFD H;  1D6E C;  1RHP A;  3KBX A;  3BDC A;  1E0B A;  2RDF A;  2B2W A;  5J39 A;  1SE3 A;  5COY A;  3SE0 A;  5D14 A;  4FXD A;  1O7Z A;  4IFD G;  2MUY A;  4NP5 A;  3PUV A;  3PUW A;  4DK1 A;  1D5X C;  4B9X A;  2IW3 A;  1HFN A;  1O7L A;  5I2Y A;  1CQF A;  5CV4 A;  3VA5 A;  4FF4 A;  3M4O B;  1G29 1;  1EY4 A;  3IL8 A;  4FVM A;  1AFP A;  1DZ1 A;  4B9W A;  1Q3L A;  4JBW A;  1FR3 A;  3TP6 A;  2FMM A;  5FOB B;  2F1M A;  2K05 A;  2NVT B;  4X3U A;  5C0X I;  4A3K B;  3MFY A;  4HSV A;  1GJX A;  3U9S A;  3K5N A;  2B2V C;  1MBY A;  3A7L A;  3M3Y B;  3HZX A;  1QIL A;  2LKV A;  3A56 A;  5KYI A;  4K8I A;  1HXY D;  2G9D A;  2X6G A;  5IGE A;  1QJO A;  2PZT A;  5C4Z A;  3DM1 A;  2VUM B;  3HOW B;  1BOS A;  4GZY C;  2O5J C;  1Y1V B;  4PMB A;  5A35 A;  3R2I A;  1BQQ T;  3SK8 A;  3K57 A;  1Q1B A;  3QG1 A;  1WTR A;  2SEB D;  2R61 A;  5D3D A;  1EY0 A;  2NN6 H;  2L12 A;  2TMP A;  4BA1 I;  3ITP A;  1B9N A;  3KLS X;  1D5M C;  1DOM A;  1B50 A;  1LT5 D;  1RF2 D;  1PFM A;  2F03 A;  3HOY B;  4KJO A;  2NN6 G;  5EKK A;  3ZYY X;  5DM7 3;  1BCP B;  5E3F A;  3U9O A;  2B8G A;  2F0Q A;  3W3A A;  1OXX K;  5IOC A;  1GUG A;  4YIJ A;  2XWJ B;  3MZ5 A;  4CKE A;  3ND9 A;  2XWB B;  1H9S A;  1RCV D;  2SNM A;  5CV6 A;  1BCP C;  5C3W A;  2AUJ D;  2A6E C;  3Q24 A;  2KEE A;  2EYM A;  2RDH A;  2ZT9 C;  2PZU A;  2DY8 A;  4XTC S;  1BO0 A;  4PNY A;  1RTO A;  1KAA A;  5FO7 B;  3T51 B;  1WTQ A;  4KKU A;  4V19 0;  2NVY B;  1HQR D;  3RZD B;  1ZEQ X;  1BUV T;  5FK9 C;  2PYK A;  1QB5 D;  1M4V A;  3J81 E;  2EY5 A;  3MVV A;  3S1N B;  2ZXO A;  3BVM A;  3OPO A;  2B2Y C;  1ZYR C;  4KN7 C;  1OXS C;  1IYV A;  1MSH A;  3A54 A;  1SNQ A;  2C5C A;  4ZRZ A;  3A8J E;  4K14 A;  2EOT A;  2CW0 C;  5JAV A;  3EFX D;  4EQO A;  3C3L A;  1LTR D;  1SJE D;  1O7Y A;  3I90 A;  2EJF C;  1YNJ D;  1H9S B;  3K0Y A;  4KHZ A;  2KUM A;  2FJ2 A;  1F2Y A;  1NSN S;  1L0Y B;  2HDM A;  2BE5 D;  5C6A A;  1V8Q A;  5E4X A;  3KLS A;  5I9P A;  2NVX B;  1IYU A;  1KDC A;  1Q12 A;  1R9T B;  3JAM L;  3K59 A;  2AWO A;  3GP7 A;  3D3R A;  1DOK A;  1AP0 A;  1JOO A;  3BYY B;  1S5F D;  4G57 A;  3NBH A;  5IT9 E;  1RKN A;  1G2S A;  2Z1C A;  5K5P A;  1U4L A;  4K8J A;  3RD4 A;  3HS0 C;  2XIW A;  5M5X B;  1U9R A;  1NCV A;  5EKL A;  4HMJ A;  1CZW A;  4DN4 M;  2K03 A;  1HHV A;  1CI3 M;  4FO2 A;  2EVB A;  4QIW B;  3F2U A;  3NHH A;  5JEA J;  3HOX B;  4C3H B;  2V4D A;  5M5Y B;  1HTP A;  1O78 A;  2NVQ B;  5BN5 A;  4HCE A;  1CT1 D;  3H09 A;  1GUT A;  2VXW A;  4R9W A;  1FGB D;  3QB3 A;  1HCZ A;  1SYF A;  1CTM A;  1EY8 A;  5EPL A;  5G3L D;  2EZV A;  2EYF A;  3S1R B;  4OO1 I;  1V1P A;  1ICW A;  2JEA I;  1QCB D;  3S2D B;  4Y7N B;  1PDQ A;  1STY A;  5EPK A;  1RJT A;  4C1N K;  2WKC A;  2PQE A;  1ROD A;  1BCP F;  2E2I B;  2K5D A;  4FF2 A;  5JVG 3;  1FNV A;  2E2D C;  2ZXR A;  3T13 A;  2MGS A;  2LS0 1;  3NTK A;  2TSS A;  3NUC A;  2EYP A;  3R2T A;  2EYO A;  4PQX A;  3PV0 A;  2LFN A;  4DGZ A;  3QOL A;  3TDQ A;  1HA5 A;  2Q8I B;  3J7Y W;  1IW7 D;  2F0O A;  3CKI B;  3A8I E;  3BVG A;  1S5B D;  5C5M A;  3NBI A;  1B9M A;  3QOJ A;  2L0C A;  4NDX A;  2B2T C;  3DUZ A;  5ELB A;  4H7B A;  4KN4 C;  1T5X D;  2FIN B;  3AB9 A;  5KND A;  2WB1 B;  1A3V A;  5FKA C;  1V1P B;  2ICE C;  1OXT A;  4HAE A;  3QJY A;  2E2J B;  3NWS A;  1LTI D;  1G91 A;  1R4P B;  2X69 A;  2F4I A;  2O4X A;  2EE1 A;  1HQM C;  5CC4 A;  2E75 C;  2J7Z A;  2F0J A;  1B53 A;  3HGB A;  3DWP A;  3UI2 A;  2KA7 A;  4RGT A;  1PZK D;  4RGN A;  4TQU S;  1B1Z A;  3A8K E;  4U67 3;  1STH A;  2BCO A;  2C9O A;  5C0X H;  1XYI A;  2NYZ D;  2K7V A;  4ZQ3 A;  4EVO A;  4RGM A;  1TY2 A;  1KNE A;  1XX8 A;  3FPP A;  3OHX C;  4FXG C;  4F7X A;  4A3I B;  5C0X G;  1HRJ A;  3L7Z C;  3VR3 A;  4FP5 D;  3K5M A;  2KEC A;  3PUX A;  2WKD A;  1EZ6 A;  4C1N I;  1PTO B;  1EYD A;  1SNM A;  4PMC A;  4X3K A;  3SDZ A;  2NBF A;  2XRQ D;  4DAY A;  4CKC A;  2A68 D;  5FO8 B;  1AZP A;  3BG3 A;  2OXP A;  2FMC A;  1DYQ A;  2XSC A;  4N9P A;  1L0X B;  3NXW A;  2A69 D;  3J7A V;  3MAQ A;  1WTP A;  4XT1 B;  4FF1 A;  2M00 A;  4IUU A;  5IGB A;  4I65 A;  1PTO C;  2EY1 A;  1BXT A;  1X3Q A;  3C1F A;  3IFT A;  1XWE A;  2HCI A;  5KNB A;  4BBR B;  3M85 A;  3HOZ B;  1TQO A;  3E6Z X;  1H9J A;  4OGQ C;  1SSO A;  1LT3 D;  4HMI A;  1LV9 A;  1JQY D;  1MD2 D;  1WVL A;  3C46 A;  2EDG A;  3ONA B;  3PIP 3;  1YNN D;  2G9H D;  1SMY C;  3NTH A;  3FVQ A;  5C4X B;  5HGT A;  1IHZ A;  4A3G B;  3D4W A;  2IT1 A;  3DEO A;  3OIQ A;  4IN3 A;  2X6L A;  3TP8 A;  2Z4H A;  2BA0 A;  1JC7 A;  1B4O A;  4G7H C;  5DAU A;  3HG9 A;  1F9R A;  1EYC A;  3ERQ A;  3H94 A;  1G2T A;  1QOH A;  2JA5 B;  1Q8I A;  1DON A;  3OIP A;  1QWY A;  5D65 A;  4XDX A;  1A3T A;  1D1I A;  1ML0 D;  1Z6H A;  5T1I A;  4UAI A;  1TWF B;  2B8F A;  2IWH A;  2A6H C;  2B2U A;  2EY2 A;  4FNF A;  2NTT A;  3D8G A;  2K01 A;  3TP7 A;  5CYU A;  3BVZ A;  4N9T A;  3KK7 A;  1TWC B;  3EQL C;  5I4D A;  5J22 A;  2F0U A;  3DWA A;  2PPB C;  3OWF A;  3LNN A;  5E4W C;  3LX0 A;  4IUR A;  1S4Z A;  1TVX A;  4P2C B;  4DNT B;  3QWN A;  3TN2 A;  4NKL A;  3LWE A;  2HCC A;  1HFG A;  1WD1 A;  4BWG B;  1WD0 A;  1ESR A;  4FF3 A;  3NQI A;  5A2Q E;  1QG7 A;  2NTS A;  3IAY A;  1TS3 A;  4ODG A;  3A7A B;  1PRT F;  2PO4 A;  4FYD A;  2KHS A;  1PLF A;  5M5W B;  2AQ3 B;  3PO2 B;  1NR4 A;  4CJ1 B;  2K04 A;  1STG A;  1IKM A;  1TR5 A;  2JSO A;  2H1E A;  2B2W C;  3VYU A;  4ZKC B;  1F2L A;  4J6H A;  4OHJ A;  5IOD A;  3ND8 A;  3J81 L;  2MJ8 A;  4I7Z C;  1EU4 A;  1SYE A;  1PTO F;  2A73 B;  3ERO A;  2XNA C;  3T4A C;  2Y0S B;  1I6V C;  1A6X A;  1SND A;  4Q0F A;  4IUN A;  5M3F B;  3K7A B;  3GQB A;  2EJG C;  3S2H B;  1ONL A;  1SYG A;  5LL6 S;  1F2M A;  5LHY 1;  3CQZ B;  3BS1 A;  1I4P A;  4RAU C;  1DJR D;  4HN7 A;  3I3C A;  2AUK A;  5AFW A;  4OO1 H;  3OMC A;  1BDO A;  2XRS D;  1ET6 A;  1A2T A;  4ZYS A;  4HED A;  3VR2 A;  1WCM B;  3S9W A;  4H13 C;  4OO1 G;  4LJZ C;  1JOQ A;  5DM6 3;  4QF4 A;  1MGS A;  1TKW B;  1AZQ A;  2F3W A;  4DU9 A;  5IT9 L;  4K5V A;  2JP1 A;  2XN9 C;  5CBA E;  4ID6 A;  3I4M B;  5BN3 A;  3D31 A;  1JWU D;  3WOE A;  5CV7 A;  3MTS A;  3H91 A;  1U4P A;  5KRU A;  1LTG D;  5C4J B;  3EJI A;  1GHJ A;  1EY7 A;  2M9V A;  4EGV A;  1EU3 A;  1I6H B;  5KIX A;  1CK1 A;  4IUV A;  2L11 A;  4XQN A;  5M9O A;  5TSS A;  1LT4 D;  4M8A A;  4KJN A;  3S17 B;  5IGF A;  4DF7 A;  1LAC A;  1IL8 A;  1TT2 A;  4RFB A;  1PYW D;  5I9O A;  1FNU A;  4ULL A;  4B08 A;  3FEW X;  5F2D A;  3C2P A;  1K83 B;  1G8Z D;  4ZUI A;  3MXG A;  3WOF A;  3I73 A;  1Y8P B;  1B3A A;  3GTM B;  4O1N A;  3DWQ A;  4CJ2 C;  1FD7 D;  3D4R A;  2EXZ A;  2RQX A;  3CHB D;  1QNU A;  2E76 C;  3MA2 B;  1I4Q A;  2R93 B;  3HOV B;  4RHR A;  1Y8N B;  4X3S A;  3EA6 A;  2WV6 D;  3K58 A;  1EIH A;  1YNJ C;  1CQV A;  2F0G A;  5CV9 A;  1EIG A;  4K2L A;  3BYT B;  1AN8 A;  2EJM A;  1LTT D;  3VR4 A;  4A3M B;  2WIN B;  3PUZ A;  4Z9C B;  2DNE A;  4KV6 A;  2BE5 C;  1E2Z A;  1GOZ A;  3D6C A;  3I8Z A;  1II3 A;  4A93 B;  3TP5 A;  3MXN A;  1JOK A;  2F0H A;  1VDZ A;  1JE4 A;  4H0L C;  5CGK A;  1C48 A;  4RA8 A;  1SE2 A;  1JIC A;  2F3V A;  5EBD A;  2J0T D;  3GD7 A;  4L6T B;  1VF7 A;  2F0M A;  3J80 L;  2K32 A;  4C3J G;  1GUS A;  2M2L A;  1D2B A;  5ISR A;  4DXF A;  4NMZ A;  5T1G A;  4ABN A;  4CJ0 B;  1R4Q B;  4ILW A;  3OW7 A;  2Q8R E;  1V1O A;  4AYB B;  3QIA A;  5KNC A;  4MN3 A;  4IZ8 A;  3VYS A;  4KY6 A;  1U4R A;  4ME5 A;  4K6L A;  3FKI B;  3E0J A;  3PMF A;  4QB4 A;  1SNP A;  4XT3 B;  4XQQ A;  1ENC A;  4KKT A;  3NPP A;  2HUG A;  3R93 A;  2DNC A;  1JB3 A;  2AQ1 B;  3KF8 A;  3S15 B;  4A3E B;  5JEA H;  1CA5 A;  2SDF A;  1WTV A;  1TII D;  3PIO 3;  1KTK A;  3S1M B;  3KLR A;  1UEA B;  1PXU A;  2H4O A;  4K2K A;  1KDA A;  5JEA G;  3D6W A;  1D1K A;  3J80 E;  4RHS A;  5IIF A;  2BOS A;  1A15 A;  3PO3 B;  1IW7 C;  2R3Z A;  1E2W A;  2CQA A;  3SHL A;  3I91 A;  4RWS C;  4WFN 3;  1LO5 D;  5JOB A;  3W2D A;  4BA2 I;  1Q90 A;  1PRT D;  1Q1E A;  5M3M B;  2F0P A;  2B39 A;  5EJW A;  1PFB A;  1X32 A;  1S5C D;  3Q6S A;  1F9S A;  1EY9 A;  5ELE A;  2L1B A;  2SNS A;  5K36 H;  2F0F A;  4V0B A;  3CRK C;  5JJZ A;  2L4N A;  2HQE A;  3A55 A;  5K36 G;  4DFA A;  2B63 B;  4LMQ D;  1F77 A;  4DK0 A;  4KTA A;  1KDB A;  5FLX E;  4C2M B;  1TWH B;  1SYD A;  3DEP A;  1JWM D;  3FRP B;  4RKB A;  1PTO D;  1ENF A;  5EGT A;  2PW7 A;  4RGO S;  4IFD J;  1UUP A;  4Q5V A;  1ZXT A;  1I3Q B;  1SXT A;  5IGD A;  1RTN A;  1PMR A;  3KBG A;  1SMY D;  1SJH D;  4HR7 B;  4OIJ A;  4EQN A;  1WTX A;  2AQ2 B;  2RBM A;  3P1H A;  3J7A F;  1F9P A;  4K6D A;  2JA8 B;  2IX0 A;  2FHT A;  2GA4 B;  1UNS A;  1KLG D;  5DNF A;  5KGU A;  3L3O C;  1XXG A;  1DD2 A;  3VR5 A;  2A68 C;  2J4X A;  2K5W A;  4ZK9 B;  1QNK A;  3HKZ B;  3I4L A;  3X3N A;  4BS9 A;  3KUP A;  2A69 C;  2F0E A;  2QF7 A;  4J8Q A;  4XYO A;  5A2Q L;  4HCS A;  4S3S A;  4RCO A;  1BNZ A;  5G3L F;  1SE4 A;  1HTL D;  5C4H A;  4RKL A;  3TSS A;  1SEB D;  2B2V A;  2F0L A;  1C8C A;  4KY5 A;  1OXU A;  4UDU C;  4BBS B;  3NWT A;  2NWG A;  5JPN C;  1JOR A;  4F8M A;  3GV3 A;  2RDG A;  3RMH A;  1Y1W B;  4H44 C;  5IGC A;  3NTI A;  3CRL C;  1TWA B;  3L9A X;  5C3X A;  1VF5 C;  1TWG B;  1W6K A;  3R8B A;  3GTQ B;  1ET9 A;  1CZG A;  5EPJ A;  3VYT A;  2JA6 B;  1J9O A;  2CVR A;  3I70 A;  1RD9 D;  3VR6 A;  3V96 A;  4CHT B;  2RVL A;  3URY A;  1CHP D;  3N6R A;  1STN A;  1LLR D;  1J8I A;  5ELF A;  1NUC A;  3O13 A;  2D5D A;  1FYC A;  1SAP A;  3V05 A;  2MP1 A;  1DOL A;  4F88 A;  2ENB A;  3SXH A;  1BF4 A;  1K8M A;  4CGY B;  4ZAI A;  2JEB I;  1JR0 D;  2L5T A;  2PW5 A;  1KAB A;  4C56 C;  3M7N A;  2I07 B;  4JK1 C;  3OWE B;  2PCF B;  1SYC A;  5D3I B;  3MC0 B;  4WJW A;  3E5S A;  2OEO A;  4IUQ A;  2IX1 A;  4RCN A;  5EQ0 A;  5I6W A;  1ZKO A;  2YU9 B;  1JCK B;  2F0S A;  1PTO H;  3P75 A;  3VA7 A;  1GUW A;  3CU7 A;  4G4K A;  1FNW A;  2QEJ C;  3BDO A;  2QIL A;  4IQZ A;  5C5L A;  2FFK B;  1TS4 A;  4IUP A;  1T5E A;  5EKI A;  3G7L A;  4QMG A;  2B2U C;  4A3F B;  1X3P A;  3M4Y A;  3MEH A;  4K5W A;  4C3I G;  1SYB A;  4KHV A;  4TSS A;  5J1Z A;  1TS5 A;  3SVM A;  2OT2 A;  3GTG B;  1M8A A;  2B2Y A;  1O80 A;  3RZO B;  1F2Z A;  1EZ8 A;  1LTA D;  1CHQ D;  2PNR C;  1EY6 A;  2Z8L A;  2LY7 A;  4K5X A;  1E2V A;  1BCP D;  2A6E D;  4C3J B;  3S1Q B;  3I72 A;  4HSP A;  2JE6 I;  1C4Q A;  3DXJ C;  1ESF A;  2A5H A;  2KJX A;  3N52 A;  1I4R A;  4KY7 A;  3Q0A A;  4A3B B;  2L9H A;  3VYR A;  4XQJ A;  3X3M A;  2OF1 A;  1B44 D;  4R8N A;  1EL0 A;  4DXG A;  4LAA A;  3GV6 A;  1QE6 A;  5I6Y A;  4A3D B;  1ILP A;  1KNA A;  3RUZ A;  2F0W A;  1I4X A;  3TZU A;  4BY7 B;  3RLF A;  1CFM A;  1EQT A;  3DHQ A;  1TS2 A;  4DA2 A;  1ZYR D;  2Q8T A;  2ID0 A;  2RSN A;  4IFD I;  2F0T A;  2JYO A;  5JPM C;  2XVS A;  4CBV A;  2CW0 D;  2WII B;  3MWY W;  1AW7 A;  5CV8 A;  2I46 A;  3LWU A;  1KLU D;  2F0I A;  4O42 A;  4M1U B;  1JWS D;  1EY5 A;  2KCC A;  1S5E D;  4RH6 A;  2BA1 A;  4F87 A;  5CV5 A;  1DM0 B;  5EBC A;  2BDN A;  2L55 A;  5KYL A;  1CM9 A;  1UAP A;  2O2L D;  3GTP B;  1SBB B;  1EQV A;  3P7J A;  1A3U A;  2R7Z B;  2RA4 A;  2MPM A;  3HRZ C;  1MI2 A;  2KCN A;  2EYH A;  2VB2 X;  1HUM A;  2KED A;  3S14 B;  4L63 B;  3NE5 B;  4KI0 A;  3FMC A;  4KKS A;  3NK9 A;  3SK4 A;  3MHB A;  1VMC A;  4QUC A;  1U4M A;  4IUT A;  2IJ0 A;  2F0V A;  2HDL A;  2LMC B;  1Z47 A;  2K6A A;  2QCP X;  4ZKB B;  3C1E A;  3V2T A;  1H9K A;  1OO9 B;  4ZUJ A;  3H6M A;  1ENA A;  4HTH A;  2DY7 A;  5ELD A;  4DAV A;  3HEJ A;  5LL6 X;  2AWN A;  1SNC A;  3OMG A;  3GTO B;  1DCZ A;  2WAC A;  1RDP D;  3G6J B;  5C44 B;  2QKI C;  1HUN A;  1BR9 A;  3GO5 A;  1XTC D;  4L8J A;  2B2T A;  1I50 B;  2NN6 I;  1H9M A;  2VB3 X;  3M7G A;  1WTW A;  1AEX A;  3OOC A;  1LTB D;  5C3E B;  5I2X A;  1CA6 A;  1EWH A;  2BDO A;  1SFO B;  1PFN A;  2ZXP A;  2ICI A;  4FXK C;  4XIG S;  3K6O A;  3QO2 A;  1B2T A;  2DN8 A;  1NAP A;  3SR1 A;  1GHK A;  3MXP A;  3AMU A;  4KD4 A;  2D2C C;  1F9Q A;  2NZ1 D;  3SK6 A;  2PZW A;  1MSG A;  1TU2 B;  4QCL A;  3IKJ A;  4R8I A;  1EOT A;  3JAM E;  3WDN A;  4MIU A;  5C0X J;  3BDL A;  3R3O A;  1LAB A;  5FO9 B;  2D9U A;  2E74 C;  5FLX L;  3T53 B;  4KK7 A;  5CBE E;  2Z4I A;  2VNU D;  3K5L A;  1EEI D;  3OSO A;  5DEH A;  1LT6 D;  2K1B A;  4TKO B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...