3VYSA

Crystal structure of the hypc-hypd-hype complex (form i)
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
53
structure length
53
Chain Sequence
CLAVPGKVIEVNGPVAVVDFGGVKREVRLDLMPDTKPGDWVIVHTGFAIEKLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein/transferase
molecule keywords Hydrogenase expression/formation protein HypC
publication title Crystal structures of the HypCD complex and the HypCDE ternary complex: transient intermediate complexes during [NiFe] hydrogenase maturation
pubmed doi rcsb
source organism Thermococcus kodakarensis
total genus 10
structure length 53
sequence length 53
ec nomenclature
pdb deposition date 2012-10-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.970 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3vysA00
3VYTA 2OT2A 2Z1CA 3VYUA 3D3RA 3VYSA 3VYRA
chains in the Genus database with same CATH superfamily
1PYWD 3TS0A 4DR2L 4N8FA 5JVG3 4A75A 4HSPA 1H9SB 2VQFQ 2F0NA 4DUYL 3I3CA 4JI6Q 4CKCA 1N32Q 4PV1C 3DM3A 4FO2A 3RR5A 1YHBA 5EGTA 3R8BA 1B9NA 4B3RL 1HUNA 3V96A 1CA6A 3TDQA 3ZJYC 4J6HA 4M1UB 2EY2A 1K83B 1Z7TA 4NXMQ 1G291 1B4OA 1QB5D 2I5LX 1I4HA 3NWSA 1RDPD 1ESFA 3PO2H 1TKWB 1EWIA 4A3KB 4LUVA 4EQPA 4X3SA 3A5ZB 3S1QB 1QNKA 3BJUA 1O78A 1ET6A 1CZGA 1Y8NB 2BDOA 2EY5A 3NELA 2NZHA 5GAHC 2ES2A 2GA4B 1PV4A 2AUKA 3F2UA 4JYAL 5JEAJ 1VF7A 5LMUQ 1AE2A 3KF8A 2ZTDA 2IX3A 3LNNA 4HSVA 4J1MA 2B2TA 4DR7L 1S5FD 3OMCA 1A3UA 4CGYB 1RL2A 2JA8B 5LL6S 5AJ3L 5JJKA 2X6GA 1KDAA 3NBIA 2CH4A 2L12A 2M00A 1OO9B 3MXPA 3I7FA 3MC0B 2ZTCA 1TVXA 1AH9A 3OW7A 2LFNA 1QILA 5E3FA 1JJGA 3IKJA 5CC4A 3OOCA 1UNSA 2KHSA 1NMGA 1QVCA 3PUXA 3TSSA 2NUCA 2Q2HA 1EU4A 3R2TA 3CF5A 1WCMH 2YYZA 3KLRA 5DAUA 3I8ZA 1S40A 1A6XA 1Y69U 1A0IA 1FGUA 3X3NA 2RF4A 3K7AH 4IQZA 2F03A 1TWFB 3GTMB 1SMYD 3NBHA 2F0KA 3S2DH 2QGQA 2Z1CA 4C2MH 2PMZE 2VQFL 2KBNA 1MHWC 4GNXC 1E7ZA 1SSOA 3NQTA 3QG1A 2HDMA 1EWCA 4UPAA 4DK6C 1G2TA 1GUNA 3OSOA 1G6ZA 1F9RA 3HKZG 1I50H 3M9BA 4E6IA 1UUPA 1I6HH 4GS3A 4NMZA 4LF7Q 4JI0L 3CXCA 5CMDA 4X65L 4YHHL 1E0BA 3HOXG 3ERSX 1O7IA 4ZUIA 5C3EB 5H1SE 2CCZA 4AIMA 5IIFA 3PGZA 4PZ8A 1OXTA 2J4XA 5JEAH 1WD0A 1CKMA 1Y14B 5I6YA 4JC0A 3DWQA 3MEHA 1NTGA 2I46A 2NTSA 4G7HC 1KRTA 4X64L 3MFGA 3W5OA 1N36L 2F0HA 1JE5A 3EQLC 2MHVA 1SRUA 2UU9Q 3S17B 1C0AA 1BNZA 1HPCA 5JPNC 1YNNC 4KHPQ 1EY7A 4IPDA 3SK4A 2L4NA 1SE3A 4A3BH 3P20A 3PO3B 3RN2A 1HJPA 1DOLA 1L0WA 2QKIC 3GTPB 1ESRA 5CYUA 3CU7A 2VUMG 1NR2A 1B8AA 1C48A 4B08A 3OWEB 1GUOA 2B2WC 4QQBX 2MQHA 4A76A 1IBKL 4XXEA 3A55A 1GUGA 3I91A 2JSOA 4DXGA 1PRTF 3P75A 3LWEA 4GOPC 2K01A 3MA2B 4IUVA 4ZUJA 2K5VA 2R3ZA 4LW1A 4BY7H 3MAQA 4RH6A 3JAMi 1STNA 1CA5A 5T1GA 1QZGA 1XPUA 4FNFA 2RQXA 1JWUD 4LF8L 2KJXA 2F52A 2JA5H 4PG3A 5IOCA 3CMAA 1STYA 3EBEA 4QIWE 3J81i 3SVMA 2KCTA 4X3UA 4TRDA 2K5QA 4DAYA 5J3BA 2VB2X 2F3VA 4A3IB 3CKIB 4OGQC 5KYIA 1G91A 5I9PA 2L9HA 4OO1I 5T1IA 3SDZA 1SJED 1CKOA 2G9DA 3STBC 5C5LA 3H3VC 3GQBA 3GTOB 3T13A 4A3BG 1W6JA 1SEBD 1VF5C 2RKSA 2CWAA 2R92H 4I7AA 2WIIB 1ET9A 1G51A 1QG7A 1VMCA 1UWVA 1WTHA 4R4TA 3SHLA 4C3JB 3JAML 2YTVA 4OIJA 1OXXK 2F0EA 4O0AA 3W1BA 4GNXB 1J5EL 3NSWA 3GTQB 3TQYA 2A6HC 2MJ8A 4NPSA 2WACA 4GLXA 4UHVA 3HP3A 1L0YB 1YJ9A 2UUCQ 4YWMA 4BA2I 3S1RB 3S14B 2B2YC 3PQIA 1DJRD 3BVGA 1R4PB 4BY7G 4HN7A 4DR5Q 4G57A 1K28A 4KK7A 4JOIA 2DY7A 3GTLH 3M7GA 1S4ZA 4IPCA 4DV7L 2B2UA 2FJ2A 1GOZA 2F4VQ 2R93B 3NENA 3I72A 2PPBC 3CPWA 2JA5G 4Q0FA 4DV6L 5CR3A 4DXFA 4IZ8A 1PYSB 4NB3A 4ZK9B 2FMMA 3IFTA 1CZWA 3HOYB 4LAAA 4CJ0B 4X6AH 1RCVD 4QJFA 1CQFA 3NWTA 5K5PA 2B39A 3M85A 3DM1A 2NVQH 3P7JA 2K6AA 4AYBG 1PTOD 1FJGL 1J8IA 4NW2A 3FKIH 2V1CC 2EIFA 1SNDA 2UXCQ 1D7QA 5FLXc 1CSPA 4HMJA 3M3YH 1MD2D 2EYOA 4N9PA 1PXUA 1NAPA 1SE2A 5G3LF 3VA5A 4JI3L 4A3MG 4P2CB 1EOVA 4A3FH 3VR2A 1HNXL 3A7LA 3I4NB 4K0KQ 3KOJA 4BBSB 1MIUA 1ZXTA 5DM63 1N34L 2N88A 3H0GB 5KGUA 2WV6D 3JAMc 2EY6A 4NP5A 4ZAIA 2UUBL 4JBMA 3BVMA 4GOPB 4HIKA 4R1JA 3MXNB 3K57A 1SMXA 2MO1A 4ZYSA 3F1ZA 3J81c 4IO9A 5M5WB 2ZJQA 2IL8A 1YNND 2VW9A 1BXTA 1VQAA 2FMCA 2LS01 3K59A 3OIQA 4ALPA 3D8GA 3D4WA 1YBYA 1PDQA 3J7ZC 1NUCA 1AFPA 1HR0W 5C44B 2XWBB 3S1NH 4LFAQ 4R8IA 1K3BC 1GHJA 5LMNW 1JQYD 1H95A 5IYBH 4DV5L 1QNUA 1F9SA 1PZKD 4OX9L 3NQIA 3KLWA 4JI4Q 1SNCA 5D14A 4B3TQ 1NBWA 1Y1VH 3FKIG 1SAPA 4BXXG 3G48A 3K80C 1QE6A 3S1MH 3I4MH 1FL0A 1BDOA 2I0QA 5C0XG 2HHHQ 5IGBA 5JJLA 1SNMA 2B63G 1D5MC 2H1EA 5BN5A 1EIFA 1DD2A 2HD3A 3RLNA 5GQOA 4R8NA 5CV9A 5M3MB 1NNXA 3K5NA 1TY0A 1YVCA 4DV3Q 3T1YQ 1ML0D 2IJ0A 2NYZD 2ZTEA 1NE3A 1TWHB 2N8NA 1FNWA 3K81C 5HGTA 1DM0B 2EJFC 1OTCA 2Z4HA 1DCZA 3G4SA 4XT1B 4KKTA 3STBD 4QY7A 1M1KC 3G71A 2Z8LA 1Q1BA 1UE5A 3HGBA 1EY8A 2NVYB 3BU2A 3Q6SA 4X3KA 1PTOH 4CHTB 3T16A 1BCPC 3CQZB 1JICA 4F7XA 2E2HH 2IT1A 3C1FA 2RCNA 2LY7A 2OEOA 2E5LL 4X66Q 3ICEA 4LWCA 4N8X1 4A3IG 2JK8A 4XQJA 2NVTH 2LMCB 5EAYA 1Y1VG 1IYUA 1DONA 1MJEA 3I4MG 4JPBW 2VQEQ 1T9HA 1WJJA 4C1NK 4L5SA 1FVIA 1KL9A 1ICWA 4KI0A 2F0UA 3SGIA 3L7ZC 4JBJA 3RNUA 3HOVH 3KF6B 1IBLQ 2RSNA 3PO2B 4XQQA 1B3AA 2YTXA 4CJ2C 3DWPA 2H5XA 2Y0SG 4JV5L 4DNTB 1HTPA 1OXSC 1K8AC 2F0QA 1I94Q 4KKUA 5HY6A 3EA6A 4L6TB 2K50A 2SNSA 2DY8A 3NTKA 1VQGA 3HKZE 1RTNA 2XNAC 1MSGA 3G6JB 3J80E 2N49A 2PZUA 1EYCA 4B3TL 1HR0L 1AP0A 3UDFA 1VQLA 4IJLA 5FLXE 1RF2D 3F2BA 2WFWA 1A62A 2CQOA 2WAQE 1JR0D 1MSHA 2VL6A 2K52A 4DR1L 4CDDC 1HFNA 4LFBQ 3HOYG 1AEXA 1VQ7A 4DR4L 5FO9B 1D8LA 1EQQA 1XNRQ 2J7ZA 1CTMA 3NP8A 4DNIA 3DWAA 1HNZL 3NUCA 1E2ZA 5EKLA 2DJFC 4LUZA 1SMYC 2X69A 3JAME 2HQLA 1KRSA 4TKOB 1Y8PB 1YHQA 1UEAB 3IRBA 1L1OB 4DV2L 3UDGA 1H9SA 4IPHA 3BS1A 3OPOA 2F0DA 3J81E 2QF7A 4JI7L 2QW7A 2K28A 3SK8A 4UAIA 1A8VA 2BCOA 3K7AB 1LTSD 3H0GG 3RD4A 3HS0C 4F8MA 4V0BA 5EPJA 3S2DB 4JCVE 3CHBD 1EEID 1FYCA 5NUCA 1HZBA 3J7A5 5CORA 3ULLA 1K9MC 4CKBA 3TP8A 1VQKA 2WB1G 1PH7A 1D1IA 5FO7B 3PIO3 1I50B 2BA1A 2NN6I 2Q2IA 5E1FA 1I6HB 1SR3A 1BCPB 1M90C 1BBXC 3PF4A 5JJIA 1DOKA 4LF9L 5C6AA 3C3LA 1N33L 1KNAA 2CHBD 3E0EA 3PUVA 5C44G 4K8JA 4F88A 1EY9A 3D6CA 2OF1A 2PI2A 3I4LA 1HZCA 1AZPA 1F2ZA 4CKEA 1DZ1A 1S5CD 1JWSD 1WD1A 3L3OC 2P5ZX 4ME5A 1Q8IA 1PFBA 1VQCA 4GZYC 4K2KA 1B70B 1L0XB 2XIWA 3KFUA 2F0MA 3BDCA 1XJVA 3CC7A 2MNAA 4FDBA 1BCPD 3K0XA 3MEFA 2NTTA 1NR4A 3GO5A 5M3MG 5E7NA 2OTLA 3AFPA 4BY1H 4KJOA 4X62L 1IBMQ 4A3BB 1PH1A 2XSCA 3V05A 4DV0Q 1KXLA 1JOKA 2K05A 4MNOA 3CCRA 1XMOL 1EIHA 1HRJA 3HOWH 1F77A 2UXBL 1K8MA 4IPGA 4DV4L 4NXNQ 1XNRL 1LT6D 1I4QA 5IODA 4IUPA 1SYCA 4RKBA 2E2DC 5IGDA 1YHAA 2PI2E 1U5KA 4XTCS 2PZWA 3MTSA 3U4VA 4OXPA 1TT2A 3CC4A 1W2BA 3B6YA 4BY7B 4R9WA 4MTKA 2HIVA 2IWHA 4DN4M 4HIOA 1X9NA 3BZDB 3S9WA 2N78A 4JW0A 3VA7A 2RCFA 2SDFA 2E2IH 2Q2TA 3EN2A 2JA5B 1AE3A 5C4XH 2UXDL 1K3RA 5E4XA 1EIGA 2LKVA 3QJYA 3KLSA 1STBA 2A8VA 3CPFA 4GN3B 4OO1H 3T1HQ 4KTAA 4JG2A 2D0OA 3KDFB 5J1ZA 4ODGA 5IP9H 2BOSA 2F1MA 4KY5A 3I73A 3PUYA 4B3MQ 3MXGA 4RGMA 2ALYB 1O7YA 3PO2G 4AYBB 1A2UA 3HOWG 2R92B 5JJZA 3C46A 1M8AA 2KQ3A 5K36H 3WOEA 4CDCC 3L0OA 1HCZA 1P16A 1RD9D 3A74A 4IOCA 5CV5A 4A3MB 5HURA 5CV6A 1HXYD 1LTGD 4YCWA 2ZM6Q 4H44C 4RHSA 1ASZA 4YCVA 5KEEA 4JI6L 1N32L 4KD3A 4CBVA 1CKNB 5D3IB 3JC66 2IX1A 1G8ZD 2AQ3B 4BWGB 5IWAQ 2B2VC 1B53A 4RMFA 2C9OA 3TP7A 2RBMA 4JI5Q 2NWGA 2D62A 1O7ZA 1PTOC 5M5XH 4DNRB 3LWUA 4NXML 1CHQD 1SYDA 2Q8TA 1PFNA 5ELFA 4LF4Q 4DV0L 2A74C 4AQYQ 4OWWB 3HFZB 1KABA 4KY7A 1SYGA 1CQVA 5IP9G 2RDHA 1PA6A 2B3GA 1EYDA 5TSSA 1WCMG 5D65A 1TWAH 2NVQB 1PH4A 4FF3A 5LMUL 4R4CA 1YIJA 1G6PA 3FKIB 4LK1C 5EJWA 4ABNA 3M3YB 2O5JC 5K36G 2EYFA 2F0OA 3L9AX 2JN4A 1K73C 3J80i 3GTGB 2HT1A 4JBKA 2WKDA 2B63B 4CJ1B 1TQOA 1D2BA 3VYTA 5EBCA 3KLSX 1BBUA 5C3XA 4XT3B 3CRKC 2IHFA 2CQAA 2KEEA 3DLLA 1KD1C 4HJ7A 2D5DA 1QVFA 4UY8C 3GD7A 3R2IA 1K8GA 3A54A 1TWGH 1IHZA 2FXQA 3BDLA 2MGSA 3MHBA 4IURA 3GTJH 2F4IA 1GKHA 4GNXA 5IT9c 1VQHA 5I4DA 3J7AV 4OONA 5I9OA 1Q3LA 3HOUH 4QGUA 3TRZA 5CV4A 2I5HA 2UUAQ 5FLMH 4PQXA 4RA8A 5GAEC 1Q7YC 3QR8A 3T4AC 2R7DA 5JEAG 4DGZA 2BA0A 3A5UA 2N55A 2NVXH 3S15H 4FXGC 2XRQD 4J8QA 2R61A 4LUOA 2M2LA 3S1NB 1JE4A 4RWSC 4RGTA 1YEZA 4HIMA 1C4QA 3J80L 2EE1A 5IGEA 1V1PB 5DLQE 1XNQQ 1Y1WH 1VQEA 5BR8Q 1Y1VB 5FLXL 1TXYA 2MPMA 3S1MB 3F2DA 3I4MB 1SYEA 1W6KA 4K5VA 4P75A 1W3SA 4OWXB 1NSNS 3RZDH 4LF7L 4GKKQ 1X3EA 1KDBA 5IYDH 3FVQA 2ZXOA 1A15A 2O5IC 2Q8IB 4AQYL 4FVMA 5DM73 3QWNA 1YITA 4KN4C 1GJXA 1Q82C 3KYHC 4IUNA 3C1EA 1WFQA 1JWMD 3QOJA 4A3LH 2FHTA 5CV8A 2Y0SB 1WTQA 1SROA 1UE1A 1HNWQ 3J81L 1CHPD 3SEBA 3E9HA 3HOUG 2B2WA 3ITPA 1F2YA 1C8CA 1PTOB 3S16H 4OHJA 2UU9L 2E76C 4GOPA 4QF4A 3SXHA 4ZRZA 4C3IH 3MXNA 2E2HB 2R7ZH 4KHPL 3RN5A 1HHVA 1TS5A 3P1HA 2Z4IA 3KBXA 1RODA 3TBIB 1SFOH 2R7FA 2OQKA 4LF6Q 2NVTB 1Y1WG 4K2LA 2PQAB 5ISRA 3HRZC 4K5WA 3DHQA 1Z9FA 1XTDA 2OXPA 2DN8A 3QIAA 4IFDH 1PLFA 1J6QA 2QEJC 2CH4W 1EQRA 3J80c 1CI3M 1PH9A 1QVGA 2NZOA 2JXMB 2QCPX 3CAMA 1GVPA 4PZ6A 2R92G 3HOVB 3K0YA 5ELNA 1VQPA 2JYOA 3ONAB 2VB3X 1YNJC 3AMUA 1IKMA 4GLAC 1X54A 4YIJA 4CDFC 3GV6A 4A3EH 1YJNA 2JA9A 1UE6A 4UP7A 4Y7NH 2TSSA 1ONLA 1VMPA 5C5MA 4A3LG 3HOZH 2KEDA 4HJ8A 1XYIA 3WDNA 3OW2A 2JEAI 3G6EA 4K14A 3HEJA 1PRTD 1WI5A 1VQIA 1EY0A 2SOBA 4R4OA 2PO4A 5DEHA 1A63A 2ZJPA 1JJ2A 4EQOA 1I3QH 2TMPA 1XWEA 1KQSA 1LTLA 3E6ZX 2XVSA 2E2JH 3PCOB 5M3FH 2WB1B 1EYAA 2B2YA 1PFSA 5FJ8H 1MI2A 2AMCB 5A35A 3S2HH 5J39A 1EYGA 1HQMC 2IHEA 4L5TA 4X3TA 3J7AF 1EZ6A 4ZQ3A 1D5XC 1XXGA 2AWOA 1K8OA 1SE4A 1QUQB 2IX0A 4GKJQ 5FK9C 3CW2C 3FP9A 4FXKC 2UUCL 3OWFA 1KNEA 4HMIA 1L1OC 5IT9E 4DR5L 2DNEA 1NJIC 1WTXA 1ENCA 1NY4A 3AYHB 4LNQA 4A3EG 1SNOA 4A3FG 2F4VL 1YJWA 3D3RA 2K5DA 1VQ5A 2EOTA 3QOLA 3TN2A 2OT2A 1U4LA 1WTVA 3GTKB 2K4KA 2E74C 3KF6A 3A8JE 2V4DA 3N52A 4UP9A 3GTOH 2EDGA 4R4QA 1I4XA 1UEBA 4RCNA 5M3FG 2NN6H 1E1TA 5FKAC 1RHPA 2JA6H 4P74A 4DV1Q 4FXDA 4H0LC 4KLKA 3I90A 4QCLA 2QDBA 1EZ8A 4P71A 5M5YH 1HH2P 1XMQQ 2RDFA 1EEFD 3RLOA 4LF5Q 2UXCL 4P73A 4DUZQ 4HJAA 3NTHA 3VDYA 1VQOA 5AFWA 3BG3A 5F2DA 5IYBG 4K0KL 2JA7H 4YY3Q 3H91A 2EJMA 3FPUB 4LJZC 4XYQA 2I07B 3DUZA 1CSQA 1XPRA 3I4OA 2EXZA 4QUFA 4RKLA 4IFDI 5G3LD 4JI1Q 4C1NI 4DR6Q 2MUYA 5C4ZA 4I7ZC 5LL6X 1L1OA 4BY1B 5IGCA 2Z6KC 3VR5A 3LX0A 4BBRH 2G5DA 3UDXA 4K6LA 1AZQA 3BYTB 1F2MA 3SR1A 4A3GH 3HOWB 5E4WC 4YCUA 4XIGS 2C35B 4BA1I 1Y8OB 3UDIA 2J0TD 1K0RA 2AQ1B 4LFAL 1SYBA 2A1AA 4OL7A 5GADC 3ER0A 2PW5A 1LO5D 2HUGA 2JA6G 4JI2Q 2CFMA 2CW0C 1XX8A 3I70A 1NCVA 3K6OA 2E8GA 3HZXA 4HR7B 3VR3A 3IL8A 1JMCA 3CCMA 3NE5B 3U50C 2M9VA 4JI4L 5IP7H 3AFQA 1BCPF 1HA6A 4L5RC 2YU9H 1B2TA 1BR9A 2PNRC 5C0XI 3PIPA 1YNJD 4DR2Q 2KHIA 1VDZA 2HHHL 4DUYQ 4DPGA 1TR5A 4FF1A 1RJTA 2ID0A 4MZ9A 4WRDA 2E2IB 4OWTB 3MFYA 2ENBA 2BE5C 1BUVT 1LYLA 1QWYA 1BO0A 5C4XB 1JOQA 3AEVA 3VYUA 4PNYA 1ENAA 4DV3L 3D6WA 1JT8A 2XWJB 4B9WA 3CC2A 3I56A 3T1YL 1FNVA 1R9TH 1X65A 1D6EC 4A3DH 3M4YA 1VCIA 1YI2A 4Y52H 4RGOS 2L5TA 1EY5A 1FNUA 1HTLD 3HOVG 1WCMB 2K33A 2LXKA 2F0PA 4FF2A 4ZKCB 3CCVA 1MKHA 4LFCQ 4A3GG 1VQDA 4IUUA 3A56A 4TSSA 1GXDC 3UE0A 1ZKOA 1PFMA 3RZOH 4F87A 4JYAQ 5ELBA 3TZDA 2F0TA 1KAAA 1RKNA 2KUMA 1DOMA 1L2FA 1ILPA 5EQ0A 4X66L 4C2MB 4XDXA 1VQ6A 1ZYRC 5M9OA 4ME3A 3TREA 2L11A 4DR7Q 1PHJA 5A2QE 3MXUA 1XPOA 2Q8RE 5AJ3Q 1S5BD 1STHA 3E3XA 5ELCA 3PSIA 2VQEL 1S5DD 4KY6A 1D1KA 4IUTA 2JE6I 3CD6A 5M5XB 1DXMA 3K8AA 4ILWA 3PF5A 1LTBD 4PMWA 1SYFA 4JK1C 1IBLL 1TS2A 3TS2A 3BDOA 1E24A 3K5LA 4MIUA 2A6ED 2EYMA 4KD4A 5GAGC 2D9UA 4A3DG 2B2TC 1I4GA 3R93A 3A8IE 2RA4A 1I94L 4OIKA 3J7YW 3KK7A 1PH5A 2WP8J 1STGA 3K5OA 4ZLTF 2G9HD 2AKWB 1SN8A 1TWAB 2PCFB 5COYA 3W1GA 2OCEA 2O2LD 2YTYA 3CMEA 2HDLA 1PH6A 3KDFA 3L2PA 1OXUA 4L8JA 2OWOA 3AU7A 4AH6A 4DU9A 2F0JA 5ELDA 4KHVA 1KIXA 1V43A 2ZXRA 1SBBB 4LFBL 5JVH3 5DNFA 1TS4A 4HJ9A 1JB7A 1E3PA 3VYSA 3TP5A 2MP1A 1F9PA 1GM5A 4XYOA 4JI0Q 4X65Q 1LABA 4YHHQ 4QB4A 1TWGB 2PZTA 3V2TA 4RGNA 3GTJB 1CT1D 3M4QA 5I2YA 3M4OH 2A73B 2AHOB 1STEA 4JBWA 3UE1A 4C3HH 3HOUB 1IYVA 3ND9A 1LUZA 2CWPA 3H6MA 2E75C 2QILA 2XRSD 3RMHA 1CKNA 4OEMB 4LFCL 2EZVA 4NDXA 4DK0A 3E0JA 4DKAC 2NVXB 3S15B 4LMQD 4PZ7A 4IUQA 4X64Q 1I6VC 2KHJA 3FPPA 1KHIA 5JOBA 1N36Q 4A93H 5KNBA 3ULPA 4POGA 2CW0D 3CRLC 3VYRA 2K03A 4DF7A 1CFMA 1Y1WB 1VQJA 4GN5A 4AYBE 1A3TA 4RHRA 2EXDA 2HCIA 4Z9CB 2HIXA 3FMCA 5BN4A 1EU3A 4BY1G 4KJNA 1MGSA 3HOXH 1ENFA 3RZDB 4EQ5A 4N9TA 2NB0A 1IBKQ 4R4IA 2BE5D 1X32A 1KLGD 2B8FA 3NPPA 4G4KA 3DEPA 1VQBA 4A4IA 1TS3A 1NMFA 4NKLA 2F0LA 3BZKA 1II3A 1H9RA 3CP0A 2F0GA 1BOSA 5IT9L 3H3VI 1KAWA 1WYDA 1IW7C 4TQUS 2RSOA 1HFGA 3I2ZA 1F9QA 2KCNA 4C3HG 4P72A 4KN7C 4LF8Q 4FYDA 1JJCB 2R6GA 3CCLA 3KJPA 3S16B 3GTLB 1E2VA 1VS0A 4C3IB 1EOTA 4WJWA 3TMEA 2R7ZB 2K7VA 5C4XG 1EQTA 1T5XD 1X6OA 3KF8B 2VUMH 1IBML 2K04A 4A93G 2O4XA 1IXRA 1U4MA 4WORA 4OO1G 1SFOB 2A68C 1XTCD 4NXNL 2H4OA 1ZYRD 3EIVA 2PMZB 1SNQA 4RG1A 3EROA 4IOAA 1PRTC 5C4JH 2EYPA 4DA2A 3F8TA 1VQFA 2Q2UA 4J15A 2QEXA 2K75A 4A3JH 1GUWA 3CCEA 1LTID 1FR3A 4HCSA 1BQQT 2WAQG 1V1PA 2F3IA 5KYLA 2K1BA 1EIYB 1IYJB 1TWCH 1U4RA 4V190 3LGJA 5ELEA 3ND8A 1J5EQ 1VQMA 4A3EB 3Q22A 3HKSA 4Y7NB 4A3FB 1S3OA 4UP8A 2ATWA 3HOZB 2SNMA 3TP6A 4MN3A 3NHHA 1UE7A 1LT5D 5KRUA 2WINB 5FOBB 3OTOQ 4K5XA 4DV7Q 3OHXC 3BYYB 4PMCA 3T56B 1A2TA 4WJ3M 1I3QB 5EPKA 3T1HL 1K83H 5I6WA 5JPMC 3ZYYX 4DV6Q 2E2JB 3FDTA 1AW7A 1PTOF 3NBHB 1WTOA 2EYJA 5M3FB 2N3SA 3QO2A 1KDCA 2EQSA 4HIDA 3A0JA 2XTIA 4A3KH 1PH8A 1X3QA 4B3ML 2B2VA 1E22A 3QB3A 3S1QH 4IFDJ 3S2HB 1GD7A 1I4PA 4XQNA 3D31A 1VQ8A 4GN4B 4JOIC 2L1BA 1JCKB 1U4PA 4U68A 2B2UC 1CK1A 2KOLA 4A3CH 3K7UC 5EKKA 2QA4A 1FJGQ 3H94A 3NTIA 4A3JG 2ZM6L 3KJOA 1Q81C 2ICIA 1H9MA 2PNHA 1EFWA 2JEBI 1B9MA 2L55A 5IY0A 1HZAA 2KA7A 4JI3Q 5IE8A 1K0SA 3E9IA 2ICEC 1HNXQ 2SEBD 2JA8H 4WJ4A 1PVOA 2PQAA 3FRPB 2A69C 5IWAL 4JI5L 1N34Q 2KCCA 2NBFA 3T51B 3K5MA 2ZT9C 5C0XJ 2Y0SE 2UUBQ 3D4DA 4KV6A 4QIWB 3U9SA 4LF4L 2L0CA 1E2WA 4DAMA 1G2SA 4G7ZC 1QOHA 3T53B 5C4HA 1O7LA 2WKCA 1EQVA 2KVMA 3IFDA 4CDEC 4DAPA 1T5EA 2JA6B 5LHY1 2BDNA 3I55A 1WVLA 4A3KG 3Q0AA 5FLMG 1B44D 5M5YB 4L5QA 4HJ5A 2XN9C 3D4RA 1QJOA 4TVAB 4A3MH 1TWFH 3NEMA 2GVBA 3GTMH 2RHQB 4DV5Q 4FF4A 1B3QA 5CV7A 1PYBA 3X3MA 1X3FA 4OX9Q 4A3CG 3TEHB 4EVOA 2JA7B 5KIXA 4WFN3 5A2QL 1PRTB 3MVVA 4HTHA 4EQNA 3WWVA 5IYCH 1HA5A 3DEOA 1IW7D 2PYKA 3VR4A 3OTOL 1MJCA 4ZCKA 4ID6A 2JA8G 1PH2A 3GV3A 2HCCA 3DMUA 2XGTA 4DAYB 4IJHA 2K5HA 1QUQA 5C3EH 4YWLA 1DGSA 5IYDG 3W2DA 2X6LA 1JORA 3A8KE 1P8LA 1H9JA 4BBRB 1PZID 2UUAL 1Q1EA 1LT4D 3A7AB 1FD7D 1RIPA 4H13C 4C56C 4RAUC 3OYYA 4A3GB 1X56A 3NXWA 3E5SA 2A68D 2VXWA 1EY4A 1BF4A 2KENA 5EPLA 3RLFA 2QDLA 5IGFA 1EWHA 2F0IA 2BH2A 2WB1E 3S17H 2YV5A 1N8RC 4BXXH 2GVAA 1LM0A 1XNQL 4MTNA 1KC8C 5I2XA 5BR8L 5C0XH 4O2DA 4B3SQ 2YU9B 4M8AA 4C3IG 3GTGH 3HG9A 5KNCA 2B63H 2E5LQ 3PO3H 1X55A 2JP1A 2R7ZG 1Q90A 1S5ED 1UAPA 1GUTA 3CCJA 3PUWA 1B1ZA 3GTPH 2ASBA 3U9OA 2EJGC 3MWYW 3SK6A 4GKKL 1PH3A 2C5CA 2Z6BA 2K5WA 2VZAA 1JOOA 2IPKD 1SLJA 3O13A 5IYCG 1SJHD 4JI8Q 4BS9A 1WTPA 4KMUC 5C3WA 1SDFA 4RFBA 1EL0A 1U9RA 1R9TB 4IFDG 4A3DB 2EPBA 4K8IA 5CBEE 5C3EG 2D2CC 5BN3A 1HNWL 2AQ2B 1J9OA 2IW3A 1CUKA 1PMRA 2RDGA 2DNCA 1CM9A 4B9XA 1X3PA 3S24A 3PUZA 1E1OA 2DJGC 3SK5A 4JV5Q 1GHKA 1B7YB 1WOCA 2F3WA 1VQ9A 2PQEA 3HOZG 1LT3D 2MO0A 2D0PA 3RZOB 1TIID 3PMFA 4G7OC 5GROA 4IALA 4HEDA 4A3IH 4QL5A 2VY3A 1HR0Q 2A6EC 3K58A 2MFIA 3BZCA 1B50A 4LF6L 3BVZA 2HQEA 5LMNQ 3UI2A 4KHZA 4FP5D 1Q8KA 3PO3G 3C2PA 1BBWA 2F0SA 3WOFA 4DR1Q 4DR3Q 2A69D 5FJ8G 4DR4Q 2NZ1D 4C3JH 2K5NA 4POFA 1HNZQ 3FHWA 3ULJA 1LTAD 3KBGA 2L15A 3EFXD 5D3DA 3EJIA 3GP7A 1OXVA 2KCMA 3D0FA 1Z47A 3GTQH 1V9PA 1TU2B 2Z0SA 1EY6A 3EVQA 3SE0A 2LSSA 4HCEA 4DV2Q 3S1RH 3AB9A 3S14H 1Q86C 3URYA 2K14A 4JI7Q 5ELOA 1A3VA 1EFID 4HAEA 3Q24A 2R93H 4H7BA 2RVLA 1VQ4A 5EKIA 2AUJD 4RCOA 2EYLA 4B3SL 4EGVA 5CBAE 4H02A 4QUCA 4EX5A 1ILQA 3HOYH 3FEWX 3R3OA 2A6HD 3W3AA 4QMGA 3AQQA 1VQNA 4GLVB 2EYHA 4OELB 3N6RA 5JAVA 4JI8L 1RTOA 5KNDA 4JVZA 4MHEA 5L37A 2NN6G 5HGQA 2OQ0A 1IL2A 3CCSA 1WTWA 1O80A 4LF9Q 4GKJL 1N33Q 2ZXPA 1QZHA 4C3JG 4I65A 3M4OB 1HQRD 4K6DA 1SXTA 2AWNA 3M7NA 4C3HB 2EY1A 3U58A 3PV0A 3I4NH 3GDEA 1GUSA 4ZKBB 4BBSH 3MZ5A 3M4PA 3CCQA 3H0GH 4L63B 4S3SA 2JA7G 4DK3C 4B3RQ 1HUMA 2I5MX 3TZUA 4U673 4A93B 4YWKA 2CVRA 3H15A 2R93G 1LTRD 5FO8B 1KTKA 1D5ZC 1IL8A 2PW7A 3Q23A 4IN3A 5M5WH 1ASYA 3HKZB 1C7YA 5LMNL 1H9KA 4ULLA 4X62Q 1YNXA 4DAVA 2KECA 2DGYA 1LLRD 1Z6HA 1SNPA 1YZ6A 2EVBA 1PZJD 1XMOQ 3RUZA 4DR3L 4DV1L 3CCUA 2UXBQ 4BBRG 3H09A 3VR6A 3PIP3 4DV4Q 3HOXB 1V1OA 2F0WA 5C44H 1XMQL 1BKBA 2OTJA 2WAQB 1GO3E 2JJQA 4LF5L 3ERQA 3J81j 1QCBD 3OIPA 4UDUC 4DUZL 2VS1A 1LACA 2IY5B 4DK1A 5IGGA 2Z6KA 4O1NA 3F2CA 2FFKB 3Q8DA 1N9WA 1Q12A 2JQOA 2K32A 3H3VH 1ZEQX 3OMGA 1KLUD 2B8GA 2FINB 5J22A 4APVA 1R4QB 1IKLA 3PIOA 4YY3L 2GN5A 1V8QA 5IP7G 1EUJA 1I4RA 1S72A 1JB3A 1STAA 1BVSA 3I4NG 1Q46A 1AN8A 1DYQA 4Q5VA 4DFAA 4BBSG 5M3MH 2UXDQ 5EBDA 3IAYA 1C9OA 2A19A 1TY2A 1V1QA 2B29A 2VNUD 1WTRA 4JI1L 3GTKH 2RHSB 2F0VA 4DR6L 1HZ9A 1JC7A 2CKZB 2F0FA 1FGBD 1TWHH 3KUPA 2VUMB 1LV9A 2DUDA 1SE8A 3G7LA 1ICFB 4KKSA 4O42A 1X3GA 1F2LA 1IZ6A 2A5HA 3NK9A 2LXJA 3DXJC 1M4VA 2NVYH 5C4JB 1I5FA 3U4ZA 5CGKA 2ZJRA 1LTTD 4PMBA 4JI2L 4A3JB 3CQZH 2Z9HA 1MBYA 2BH8A 1U0LA 1TWCB
chains in the Genus database with same CATH topology
1PYWD 5JVG3 4HSPA 1H9SB 2F0NA 3I3CA 4CKCA 4PV1C 4FO2A 5EGTA 3R8BA 1B9NA 1HUNA 3V96A 1CA6A 3TDQA 4J6HA 4M1UB 2EY2A 1K83B 1Z7TA 1G291 1B4OA 1QB5D 1I4HA 3NWSA 1RDPD 1ESFA 1TKWB 4A3KB 4EQPA 4X3SA 3S1QB 1QNKA 1O78A 1ET6A 1CZGA 1Y8NB 2BDOA 2EY5A 2GA4B 2AUKA 3F2UA 5JEAJ 1VF7A 3KF8A 2IX3A 3LNNA 4HSVA 4J1MA 2B2TA 1S5FD 3OMCA 1A3UA 4CGYB 2JA8B 5LL6S 1KDAA 2X6GA 3NBIA 2L12A 2M00A 1OO9B 3MXPA 3MC0B 1TVXA 3OW7A 2LFNA 1QILA 5E3FA 3IKJA 5CC4A 3OOCA 1UNSA 2KHSA 3PUXA 3TSSA 2NUCA 1EU4A 3R2TA 2YYZA 3KLRA 5DAUA 3I8ZA 1A6XA 1Y69U 3X3NA 4IQZA 2F03A 1TWFB 3GTMB 1SMYD 3NBHA 2F0KA 2Z1CA 1SSOA 3NQTA 3QG1A 2HDMA 1EWCA 1G2TA 1GUNA 3OSOA 1G6ZA 1F9RA 4E6IA 1UUPA 4NMZA 5CMDA 1E0BA 4ZUIA 5C3EB 5IIFA 5JEAH 1OXTA 2J4XA 1WD0A 5I6YA 3DWQA 3MEHA 2I46A 2NTSA 4G7HC 3MFGA 2F0HA 3EQLC 2MHVA 3S17B 1BNZA 1HPCA 5JPNC 1YNNC 1EY7A 3SK4A 2L4NA 1SE3A 3P20A 3PO3B 1DOLA 2QKIC 3GTPB 5CYUA 1ESRA 3CU7A 1NR2A 1C48A 4B08A 3OWEB 1GUOA 2B2WC 4XXEA 3A55A 1GUGA 3I91A 2JSOA 4DXGA 1PRTF 3P75A 3LWEA 2K01A 3MA2B 4IUVA 4ZUJA 2R3ZA 3MAQA 4RH6A 1STNA 1CA5A 5T1GA 4FNFA 2RQXA 1JWUD 2KJXA 5IOCA 1STYA 3SVMA 4X3UA 4TRDA 2K5QA 4DAYA 2VB2X 2F3VA 4A3IB 3CKIB 4OGQC 5KYIA 1G91A 5I9PA 2L9HA 4OO1I 5T1IA 3SDZA 1SJED 2G9DA 5C5LA 3H3VC 3GQBA 3GTOB 3T13A 1W6JA 1SEBD 1VF5C 2RKSA 2WIIB 1ET9A 1QG7A 1VMCA 3SHLA 4C3JB 3JAML 4OIJA 1OXXK 2F0EA 3GTQB 3NSWA 2A6HC 2MJ8A 2WACA 3HP3A 1L0YB 4BA2I 3S1RB 3S14B 2B2YC 1DJRD 3BVGA 1R4PB 4HN7A 4G57A 4KK7A 2DY7A 3M7GA 1S4ZA 2B2UA 2FJ2A 1GOZA 2R93B 3I72A 2PPBC 4Q0FA 5CR3A 4DXFA 4IZ8A 4ZK9B 2FMMA 3IFTA 1CZWA 3HOYB 4LAAA 4CJ0B 1RCVD 1CQFA 3NWTA 5K5PA 2B39A 3M85A 3DM1A 3P7JA 2K6AA 1PTOD 1J8IA 4NW2A 1SNDA 4HMJA 1MD2D 2EYOA 4N9PA 1PXUA 1NAPA 1SE2A 5G3LF 3VA5A 4P2CB 3VR2A 3A7LA 3I4NB 4BBSB 1ZXTA 5DM63 2N88A 3H0GB 5KGUA 2WV6D 2EY6A 4NP5A 4ZAIA 3BVMA 3K57A 4ZYSA 5M5WB 2IL8A 1YNND 1BXTA 2FMCA 2LS01 3K59A 3OIQA 3D8GA 3D4WA 1PDQA 1NUCA 1AFPA 5C44B 2XWBB 4R8IA 1GHJA 1JQYD 1QNUA 1F9SA 1PZKD 3NQIA 1SNCA 5D14A 1SAPA 1QE6A 1BDOA 5C0XG 5IGBA 1SNMA 1D5MC 2H1EA 5BN5A 1DD2A 4R8NA 5CV9A 5M3MB 3K5NA 1TY0A 1ML0D 2IJ0A 2NYZD 1TWHB 1FNWA 5HGTA 1DM0B 2EJFC 2Z4HA 1DCZA 4XT1B 4KKTA 2Z8LA 1Q1BA 3HGBA 1EY8A 2NVYB 3Q6SA 4X3KA 1PTOH 4CHTB 3T16A 1BCPC 3CQZB 1JICA 4F7XA 2IT1A 3C1FA 2LY7A 2OEOA 4XQJA 2LMCB 1IYUA 1DONA 4C1NK 1ICWA 4KI0A 2F0UA 3L7ZC 2RSNA 3PO2B 4XQQA 1B3AA 4CJ2C 3DWPA 4DNTB 1HTPA 1OXSC 2F0QA 4KKUA 3EA6A 4L6TB 2SNSA 2DY8A 3NTKA 1RTNA 2XNAC 1MSGA 3G6JB 3J80E 2PZUA 1EYCA 1AP0A 5FLXE 1RF2D 1JR0D 1MSHA 1HFNA 1AEXA 5FO9B 2J7ZA 1CTMA 3NP8A 3DWAA 3NUCA 1E2ZA 5EKLA 1SMYC 2X69A 3JAME 4TKOB 1Y8PB 1UEAB 1H9SA 3BS1A 3OPOA 2F0DA 3J81E 2QF7A 2K28A 3SK8A 4UAIA 2BCOA 3K7AB 1LTSD 3RD4A 3HS0C 4F8MA 4V0BA 5EPJA 3S2DB 3CHBD 1EEID 1FYCA 5NUCA 5CORA 4CKBA 3TP8A 1D1IA 5FO7B 3PIO3 1I50B 2BA1A 2NN6I 1I6HB 5E1FA 1BCPB 1BBXC 1DOKA 5C6AA 3C3LA 1KNAA 2CHBD 3PUVA 4K8JA 4F88A 1EY9A 3D6CA 2OF1A 3I4LA 1AZPA 1F2ZA 4CKEA 1DZ1A 1S5CD 1JWSD 1WD1A 3L3OC 4ME5A 1Q8IA 1PFBA 4GZYC 4K2KA 1L0XB 2XIWA 2F0MA 3BDCA 1BCPD 2NTTA 1NR4A 3GO5A 4KJOA 4A3BB 2XSCA 3V05A 1JOKA 2K05A 1EIHA 1HRJA 1F77A 1K8MA 1LT6D 1I4QA 5IODA 4IUPA 1SYCA 4RKBA 2E2DC 5IGDA 4XTCS 2PZWA 3MTSA 1TT2A 4BY7B 4R9WA 2IWHA 4DN4M 3BZDB 3S9WA 3VA7A 2SDFA 2JA5B 5E4XA 1EIGA 2LKVA 3QJYA 3KLSA 1STBA 4OO1H 4KTAA 5J1ZA 4ODGA 2BOSA 2F1MA 4KY5A 3I73A 3PUYA 3MXGA 4RGMA 1O7YA 4AYBB 1A2UA 2R92B 5JJZA 3C46A 1M8AA 2KQ3A 5K36H 3WOEA 1HCZA 1RD9D 5CV5A 4A3MB 5HURA 5CV6A 1HXYD 1LTGD 4H44C 4RHSA 5KEEA 4KD3A 4CBVA 5D3IB 2IX1A 1G8ZD 2AQ3B 4BWGB 2B2VC 1B53A 2C9OA 3TP7A 2RBMA 2NWGA 2D62A 1O7ZA 1PTOC 4DNRB 3LWUA 1CHQD 1SYDA 2Q8TA 1PFNA 5ELFA 2A74C 1KABA 4KY7A 1SYGA 1CQVA 2RDHA 1EYDA 5TSSA 5D65A 2NVQB 4FF3A 3FKIB 4LK1C 5EJWA 4ABNA 3M3YB 2O5JC 5K36G 2EYFA 2F0OA 3L9AX 3GTGB 2WKDA 2B63B 4CJ1B 1TQOA 1D2BA 3VYTA 5EBCA 3KLSX 5C3XA 4XT3B 3CRKC 2CQAA 2KEEA 2D5DA 3GD7A 3R2IA 3A54A 1IHZA 3BDLA 2MGSA 3MHBA 4IURA 2F4IA 5I4DA 3J7AV 5I9OA 1Q3LA 5CV4A 4PQXA 4RA8A 3T4AC 5JEAG 4DGZA 2BA0A 2N55A 4FXGC 2XRQD 4J8QA 2R61A 2M2LA 3S1NB 1JE4A 4RWSC 4RGTA 1C4QA 3J80L 2EE1A 5IGEA 1V1PB 1Y1VB 5FLXL 2MPMA 3S1MB 3I4MB 1SYEA 1W6KA 4K5VA 1NSNS 1KDBA 3FVQA 2ZXOA 1A15A 2O5IC 2Q8IB 4FVMA 5DM73 3QWNA 4KN4C 1GJXA 4IUNA 3C1EA 1JWMD 3QOJA 2FHTA 5CV8A 2Y0SB 1WTQA 3J81L 1CHPD 3SEBA 2B2WA 3ITPA 1F2YA 1C8CA 1PTOB 4OHJA 2E76C 4QF4A 3SXHA 4ZRZA 3MXNA 2E2HB 1HHVA 1TS5A 3P1HA 2Z4IA 3KBXA 1RODA 3TBIB 2NVTB 4K2LA 5ISRA 3HRZC 4K5WA 3DHQA 2OXPA 2DN8A 3QIAA 4IFDH 1PLFA 2QEJC 1CI3M 2JXMB 2QCPX 3HOVB 3K0YA 2JYOA 3ONAB 2VB3X 1YNJC 3AMUA 1IKMA 4YIJA 3GV6A 2TSSA 1ONLA 1VMPA 5C5MA 2KEDA 1XYIA 3WDNA 2JEAI 4K14A 3HEJA 1PRTD 1EY0A 2SOBA 2PO4A 5DEHA 4EQOA 2TMPA 1XWEA 3E6ZX 2XVSA 2WB1B 1EYAA 2B2YA 1MI2A 5A35A 5J39A 1HQMC 4X3TA 3J7AF 1EZ6A 4ZQ3A 1D5XC 1XXGA 2AWOA 1K8OA 1SE4A 2IX0A 5FK9C 4FXKC 3OWFA 1KNEA 4HMIA 5IT9E 2DNEA 1WTXA 1ENCA 1SNOA 3D3RA 2K5DA 2EOTA 3QOLA 3TN2A 2OT2A 1U4LA 1WTVA 3GTKB 2E74C 3A8JE 2V4DA 3N52A 2EDGA 1I4XA 4RCNA 2NN6H 5FKAC 1RHPA 4FXDA 4H0LC 3I90A 4QCLA 2QDBA 1EZ8A 2RDFA 1EEFD 3NTHA 5AFWA 3BG3A 5F2DA 3H91A 2EJMA 3FPUB 4LJZC 4XYQA 2I07B 3DUZA 2EXZA 4QUFA 4RKLA 4IFDI 5G3LD 4C1NI 2MUYA 5C4ZA 4I7ZC 5LL6X 4BY1B 5IGCA 3VR5A 3LX0A 4K6LA 1AZQA 3BYTB 1F2MA 3SR1A 3HOWB 5E4WC 4XIGS 4BA1I 1Y8OB 2J0TD 2AQ1B 1SYBA 4OL7A 2PW5A 1LO5D 2HUGA 2CW0C 1XX8A 3I70A 1NCVA 3K6OA 4HR7B 3VR3A 3HZXA 3IL8A 3NE5B 2M9VA 1BCPF 1HA6A 1B2TA 1BR9A 2PNRC 5C0XI 1YNJD 1VDZA 1TR5A 4FF1A 1RJTA 2ID0A 4WRDA 2E2IB 3MFYA 2ENBA 2BE5C 1BUVT 1QWYA 1BO0A 5C4XB 1JOQA 3VYUA 4PNYA 1ENAA 3D6WA 2XWJB 4B9WA 1FNVA 1D6EC 3M4YA 1VCIA 4RGOS 2L5TA 1EY5A 1FNUA 1HTLD 1WCMB 2K33A 2F0PA 4FF2A 4ZKCB 4IUUA 3A56A 4TSSA 1GXDC 1ZKOA 1PFMA 4F87A 5ELBA 3TZDA 2F0TA 1KAAA 1RKNA 2KUMA 1DOMA 1ILPA 5EQ0A 4C2MB 4XDXA 1ZYRC 5M9OA 2L11A 5A2QE 3MXUA 2Q8RE 1S5BD 1STHA 5ELCA 1S5DD 4KY6A 1D1KA 4IUTA 2JE6I 5M5XB 1DXMA 4ILWA 1LTBD 4PMWA 1SYFA 4JK1C 1TS2A 3BDOA 3K5LA 4MIUA 2A6ED 2EYMA 4KD4A 2D9UA 2B2TC 1I4GA 3R93A 3A8IE 2RA4A 4OIKA 3J7YW 3KK7A 2WP8J 1STGA 3K5OA 4ZLTF 2G9HD 1TWAB 2PCFB 5COYA 2O2LD 2HDLA 1OXUA 4L8JA 3AU7A 4DU9A 2F0JA 5ELDA 4KHVA 1V43A 2ZXRA 1SBBB 5JVH3 5DNFA 1TS4A 3VYSA 3TP5A 2MP1A 1F9PA 4XYOA 1LABA 4QB4A 1TWGB 2PZTA 3V2TA 4RGNA 3GTJB 1CT1D 5I2YA 2A73B 3HOUB 1STEA 4JBWA 1IYVA 3ND9A 3H6MA 2E75C 2QILA 2XRSD 3RMHA 2EZVA 4NDXA 4DK0A 3E0JA 2NVXB 3S15B 4LMQD 4IUQA 1I6VC 3FPPA 5JOBA 5KNBA 3VYRA 2CW0D 3CRLC 2K03A 4DF7A 1CFMA 1Y1WB 1A3TA 4RHRA 4Z9CB 2HCIA 3FMCA 5BN4A 1EU3A 4KJNA 1MGSA 1ENFA 3RZDB 4N9TA 2NB0A 2BE5D 1X32A 1KLGD 2B8FA 3NPPA 4G4KA 3DEPA 1TS3A 4NKLA 2F0LA 1II3A 1H9RA 2F0GA 1BOSA 5IT9L 1IW7C 4TQUS 2RSOA 1HFGA 1F9QA 2KCNA 4C3HG 4KN7C 4FYDA 2R6GA 3S16B 3GTLB 1E2VA 4C3IB 1EOTA 4WJWA 3TMEA 2R7ZB 2K7VA 1EQTA 1T5XD 2K04A 2O4XA 1U4MA 4WORA 4OO1G 1SFOB 2A68C 1XTCD 2H4OA 1ZYRD 2PMZB 1SNQA 3EROA 1PRTC 2EYPA 4DA2A 1GUWA 1LTID 1FR3A 4HCSA 1BQQT 1V1PA 5KYLA 2K1BA 1U4RA 4V190 5ELEA 3ND8A 4A3EB 3Q22A 4Y7NB 4A3FB 3HOZB 2SNMA 3TP6A 4MN3A 3NHHA 1LT5D 5KRUA 2WINB 5FOBB 4K5XA 3OHXC 3BYYB 4PMCA 3T56B 1A2TA 1I3QB 5EPKA 5I6WA 5JPMC 3ZYYX 2E2JB 3FDTA 1AW7A 1PTOF 1WTOA 2EYJA 5M3FB 3QO2A 1KDCA 1X3QA 2B2VA 3QB3A 4IFDJ 3S2HB 1I4PA 4XQNA 3D31A 2L1BA 1JCKB 1U4PA 4U68A 2B2UC 1CK1A 2KOLA 5EKKA 3H94A 3NTIA 2ICIA 1H9MA 2JEBI 1B9MA 2L55A 2KA7A 2ICEC 2SEBD 3FRPB 2A69C 2KCCA 2NBFA 3T51B 3K5MA 2ZT9C 5C0XJ 3D4DA 4KV6A 4QIWB 3U9SA 2L0CA 1E2WA 1G2SA 4G7ZC 1QOHA 3T53B 5C4HA 1O7LA 2WKCA 1EQVA 2KVMA 3IFDA 4DAPA 1T5EA 2JA6B 5LHY1 2BDNA 1WVLA 3Q0AA 1B44D 5M5YB 2XN9C 3D4RA 1QJOA 4FF4A 3X3MA 5CV7A 4EVOA 2JA7B 5KIXA 4WFN3 5A2QL 1PRTB 3MVVA 4HTHA 4EQNA 1HA5A 3DEOA 1IW7D 2PYKA 3VR4A 4ID6A 3GV3A 2HCCA 3DMUA 3W2DA 2X6LA 1JORA 3A8KE 1H9JA 4BBRB 1PZID 1Q1EA 1LT4D 3A7AB 1FD7D 4H13C 4C56C 4RAUC 4A3GB 3NXWA 3E5SA 2A68D 2VXWA 1EY4A 1BF4A 5EPLA 3RLFA 5IGFA 1EWHA 2F0IA 5I2XA 5C0XH 2YU9B 4M8AA 4C3IG 5KNCA 3HG9A 2JP1A 1Q90A 1S5ED 1UAPA 1GUTA 3PUWA 1B1ZA 3U9OA 2EJGC 3MWYW 3SK6A 2C5CA 2K5WA 1JOOA 2IPKD 3O13A 1SJHD 4BS9A 1WTPA 4KMUC 5C3WA 1SDFA 4RFBA 1EL0A 1U9RA 1R9TB 4IFDG 4A3DB 2EPBA 4K8IA 5CBEE 2D2CC 5BN3A 2AQ2B 1J9OA 2IW3A 1PMRA 2RDGA 2DNCA 1CM9A 4B9XA 1X3PA 3SK5A 3PUZA 1GHKA 2F3WA 2PQEA 1LT3D 3RZOB 1TIID 3PMFA 4G7OC 4IALA 4HEDA 2A6EC 3K58A 1B50A 3BVZA 2HQEA 3UI2A 4KHZA 4FP5D 3C2PA 2F0SA 3WOFA 2A69D 2NZ1D 1LTAD 3KBGA 3EFXD 5D3DA 3EJIA 3GP7A 1OXVA 1Z47A 1TU2B 1EY6A 3EVQA 3SE0A 4HCEA 3AB9A 3URYA 1A3VA 1EFID 4HAEA 3Q24A 4H7BA 2RVLA 5EKIA 2AUJD 4RCOA 2EYLA 4EGVA 5CBAE 4QUCA 1ILQA 3FEWX 3R3OA 2A6HD 3W3AA 4QMGA 2EYHA 3N6RA 5JAVA 1RTOA 5KNDA 4MHEA 2NN6G 1WTWA 1O80A 2ZXPA 4C3JG 4I65A 3M4OB 1HQRD 4K6DA 1SXTA 2AWNA 3M7NA 4C3HB 2EY1A 3PV0A 1GUSA 4ZKBB 3MZ5A 4L63B 4S3SA 1HUMA 3TZUA 4U673 4A93B 2CVRA 1LTRD 5FO8B 1KTKA 1D5ZC 1IL8A 2PW7A 3Q23A 4IN3A 3HKZB 4ULLA 1H9KA 4DAVA 2KECA 1Z6HA 1LLRD 1SNPA 2EVBA 1PZJD 3RUZA 3H09A 3VR6A 3PIP3 3HOXB 1V1OA 2F0WA 2WAQB 3ERQA 1QCBD 3OIPA 4UDUC 1LACA 4DK1A 5IGGA 4O1NA 2FFKB 1Q12A 2K32A 1ZEQX 1KLUD 3OMGA 2B8GA 2FINB 5J22A 1R4QB 1IKLA 1V8QA 1I4RA 1JB3A 1STAA 1AN8A 1DYQA 4Q5VA 4DFAA 5EBDA 3IAYA 2VNUD 1TY2A 1WTRA 2F0VA 1JC7A 2F0FA 1FGBD 3KUPA 2VUMB 1LV9A 3G7LA 4KKSA 4O42A 1F2LA 2A5HA 3NK9A 3DXJC 1M4VA 5C4JB 5CGKA 1LTTD 4PMBA 4A3JB 1MBYA 1TWCB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VYT A;  2OT2 A;  2Z1C A;  3VYU A;  3D3R A;  3VYS A;  3VYR A; 
#chains in the Genus database with same CATH topology
 1PYW D;  3TS0 A;  4DR2 L;  4N8F A;  5JVG 3;  4A75 A;  4HSP A;  1H9S B;  2VQF Q;  2F0N A;  4DUY L;  3I3C A;  4JI6 Q;  4CKC A;  1N32 Q;  4PV1 C;  3DM3 A;  4FO2 A;  3RR5 A;  1YHB A;  5EGT A;  3R8B A;  1B9N A;  4B3R L;  1HUN A;  3V96 A;  1CA6 A;  3TDQ A;  3ZJY C;  4J6H A;  4M1U B;  2EY2 A;  1K83 B;  1Z7T A;  4NXM Q;  1G29 1;  1B4O A;  1QB5 D;  2I5L X;  1I4H A;  3NWS A;  1RDP D;  1ESF A;  3PO2 H;  1TKW B;  1EWI A;  4A3K B;  4LUV A;  4EQP A;  4X3S A;  3A5Z B;  3S1Q B;  1QNK A;  3BJU A;  1O78 A;  1ET6 A;  1CZG A;  1Y8N B;  2BDO A;  2EY5 A;  3NEL A;  2NZH A;  5GAH C;  2ES2 A;  2GA4 B;  1PV4 A;  2AUK A;  3F2U A;  4JYA L;  5JEA J;  1VF7 A;  5LMU Q;  1AE2 A;  3KF8 A;  2ZTD A;  2IX3 A;  3LNN A;  4HSV A;  4J1M A;  2B2T A;  4DR7 L;  1S5F D;  3OMC A;  1A3U A;  4CGY B;  1RL2 A;  2JA8 B;  5LL6 S;  5AJ3 L;  5JJK A;  2X6G A;  1KDA A;  3NBI A;  2CH4 A;  2L12 A;  2M00 A;  1OO9 B;  3MXP A;  3I7F A;  3MC0 B;  2ZTC A;  1TVX A;  1AH9 A;  3OW7 A;  2LFN A;  1QIL A;  5E3F A;  1JJG A;  3IKJ A;  5CC4 A;  3OOC A;  1UNS A;  2KHS A;  1NMG A;  1QVC A;  3PUX A;  3TSS A;  2NUC A;  2Q2H A;  1EU4 A;  3R2T A;  3CF5 A;  1WCM H;  2YYZ A;  3KLR A;  5DAU A;  3I8Z A;  1S40 A;  1A6X A;  1Y69 U;  1A0I A;  1FGU A;  3X3N A;  2RF4 A;  3K7A H;  4IQZ A;  2F03 A;  1TWF B;  3GTM B;  1SMY D;  3NBH A;  2F0K A;  3S2D H;  2QGQ A;  2Z1C A;  4C2M H;  2PMZ E;  2VQF L;  2KBN A;  1MHW C;  4GNX C;  1E7Z A;  1SSO A;  3NQT A;  3QG1 A;  2HDM A;  1EWC A;  4UPA A;  4DK6 C;  1G2T A;  1GUN A;  3OSO A;  1G6Z A;  1F9R A;  3HKZ G;  1I50 H;  3M9B A;  4E6I A;  1UUP A;  1I6H H;  4GS3 A;  4NMZ A;  4LF7 Q;  4JI0 L;  3CXC A;  5CMD A;  4X65 L;  4YHH L;  1E0B A;  3HOX G;  3ERS X;  1O7I A;  4ZUI A;  5C3E B;  5H1S E;  2CCZ A;  4AIM A;  5IIF A;  3PGZ A;  4PZ8 A;  1OXT A;  2J4X A;  5JEA H;  1WD0 A;  1CKM A;  1Y14 B;  5I6Y A;  4JC0 A;  3DWQ A;  3MEH A;  1NTG A;  2I46 A;  2NTS A;  4G7H C;  1KRT A;  4X64 L;  3MFG A;  3W5O A;  1N36 L;  2F0H A;  1JE5 A;  3EQL C;  2MHV A;  1SRU A;  2UU9 Q;  3S17 B;  1C0A A;  1BNZ A;  1HPC A;  5JPN C;  1YNN C;  4KHP Q;  1EY7 A;  4IPD A;  3SK4 A;  2L4N A;  1SE3 A;  4A3B H;  3P20 A;  3PO3 B;  3RN2 A;  1HJP A;  1DOL A;  1L0W A;  2QKI C;  3GTP B;  1ESR A;  5CYU A;  3CU7 A;  2VUM G;  1NR2 A;  1B8A A;  1C48 A;  4B08 A;  3OWE B;  1GUO A;  2B2W C;  4QQB X;  2MQH A;  4A76 A;  1IBK L;  4XXE A;  3A55 A;  1GUG A;  3I91 A;  2JSO A;  4DXG A;  1PRT F;  3P75 A;  3LWE A;  4GOP C;  2K01 A;  3MA2 B;  4IUV A;  4ZUJ A;  2K5V A;  2R3Z A;  4LW1 A;  4BY7 H;  3MAQ A;  4RH6 A;  3JAM i;  1STN A;  1CA5 A;  5T1G A;  1QZG A;  1XPU A;  4FNF A;  2RQX A;  1JWU D;  4LF8 L;  2KJX A;  2F52 A;  2JA5 H;  4PG3 A;  5IOC A;  3CMA A;  1STY A;  3EBE A;  4QIW E;  3J81 i;  3SVM A;  2KCT A;  4X3U A;  4TRD A;  2K5Q A;  4DAY A;  5J3B A;  2VB2 X;  2F3V A;  4A3I B;  3CKI B;  4OGQ C;  5KYI A;  1G91 A;  5I9P A;  2L9H A;  4OO1 I;  5T1I A;  3SDZ A;  1SJE D;  1CKO A;  2G9D A;  3STB C;  5C5L A;  3H3V C;  3GQB A;  3GTO B;  3T13 A;  4A3B G;  1W6J A;  1SEB D;  1VF5 C;  2RKS A;  2CWA A;  2R92 H;  4I7A A;  2WII B;  1ET9 A;  1G51 A;  1QG7 A;  1VMC A;  1UWV A;  1WTH A;  4R4T A;  3SHL A;  4C3J B;  3JAM L;  2YTV A;  4OIJ A;  1OXX K;  2F0E A;  4O0A A;  3W1B A;  4GNX B;  1J5E L;  3NSW A;  3GTQ B;  3TQY A;  2A6H C;  2MJ8 A;  4NPS A;  2WAC A;  4GLX A;  4UHV A;  3HP3 A;  1L0Y B;  1YJ9 A;  2UUC Q;  4YWM A;  4BA2 I;  3S1R B;  3S14 B;  2B2Y C;  3PQI A;  1DJR D;  3BVG A;  1R4P B;  4BY7 G;  4HN7 A;  4DR5 Q;  4G57 A;  1K28 A;  4KK7 A;  4JOI A;  2DY7 A;  3GTL H;  3M7G A;  1S4Z A;  4IPC A;  4DV7 L;  2B2U A;  2FJ2 A;  1GOZ A;  2F4V Q;  2R93 B;  3NEN A;  3I72 A;  2PPB C;  3CPW A;  2JA5 G;  4Q0F A;  4DV6 L;  5CR3 A;  4DXF A;  4IZ8 A;  1PYS B;  4NB3 A;  4ZK9 B;  2FMM A;  3IFT A;  1CZW A;  3HOY B;  4LAA A;  4CJ0 B;  4X6A H;  1RCV D;  4QJF A;  1CQF A;  3NWT A;  5K5P A;  2B39 A;  3M85 A;  3DM1 A;  2NVQ H;  3P7J A;  2K6A A;  4AYB G;  1PTO D;  1FJG L;  1J8I A;  4NW2 A;  3FKI H;  2V1C C;  2EIF A;  1SND A;  2UXC Q;  1D7Q A;  5FLX c;  1CSP A;  4HMJ A;  3M3Y H;  1MD2 D;  2EYO A;  4N9P A;  1PXU A;  1NAP A;  1SE2 A;  5G3L F;  3VA5 A;  4JI3 L;  4A3M G;  4P2C B;  1EOV A;  4A3F H;  3VR2 A;  1HNX L;  3A7L A;  3I4N B;  4K0K Q;  3KOJ A;  4BBS B;  1MIU A;  1ZXT A;  5DM6 3;  1N34 L;  2N88 A;  3H0G B;  5KGU A;  2WV6 D;  3JAM c;  2EY6 A;  4NP5 A;  4ZAI A;  2UUB L;  4JBM A;  3BVM A;  4GOP B;  4HIK A;  4R1J A;  3MXN B;  3K57 A;  1SMX A;  2MO1 A;  4ZYS A;  3F1Z A;  3J81 c;  4IO9 A;  5M5W B;  2ZJQ A;  2IL8 A;  1YNN D;  2VW9 A;  1BXT A;  1VQA A;  2FMC A;  2LS0 1;  3K59 A;  3OIQ A;  4ALP A;  3D8G A;  3D4W A;  1YBY A;  1PDQ A;  3J7Z C;  1NUC A;  1AFP A;  1HR0 W;  5C44 B;  2XWB B;  3S1N H;  4LFA Q;  4R8I A;  1K3B C;  1GHJ A;  5LMN W;  1JQY D;  1H95 A;  5IYB H;  4DV5 L;  1QNU A;  1F9S A;  1PZK D;  4OX9 L;  3NQI A;  3KLW A;  4JI4 Q;  1SNC A;  5D14 A;  4B3T Q;  1NBW A;  1Y1V H;  3FKI G;  1SAP A;  4BXX G;  3G48 A;  3K80 C;  1QE6 A;  3S1M H;  3I4M H;  1FL0 A;  1BDO A;  2I0Q A;  5C0X G;  2HHH Q;  5IGB A;  5JJL A;  1SNM A;  2B63 G;  1D5M C;  2H1E A;  5BN5 A;  1EIF A;  1DD2 A;  2HD3 A;  3RLN A;  5GQO A;  4R8N A;  5CV9 A;  5M3M B;  1NNX A;  3K5N A;  1TY0 A;  1YVC A;  4DV3 Q;  3T1Y Q;  1ML0 D;  2IJ0 A;  2NYZ D;  2ZTE A;  1NE3 A;  1TWH B;  2N8N A;  1FNW A;  3K81 C;  5HGT A;  1DM0 B;  2EJF C;  1OTC A;  2Z4H A;  1DCZ A;  3G4S A;  4XT1 B;  4KKT A;  3STB D;  4QY7 A;  1M1K C;  3G71 A;  2Z8L A;  1Q1B A;  1UE5 A;  3HGB A;  1EY8 A;  2NVY B;  3BU2 A;  3Q6S A;  4X3K A;  1PTO H;  4CHT B;  3T16 A;  1BCP C;  3CQZ B;  1JIC A;  4F7X A;  2E2H H;  2IT1 A;  3C1F A;  2RCN A;  2LY7 A;  2OEO A;  2E5L L;  4X66 Q;  3ICE A;  4LWC A;  4N8X 1;  4A3I G;  2JK8 A;  4XQJ A;  2NVT H;  2LMC B;  5EAY A;  1Y1V G;  1IYU A;  1DON A;  1MJE A;  3I4M G;  4JPB W;  2VQE Q;  1T9H A;  1WJJ A;  4C1N K;  4L5S A;  1FVI A;  1KL9 A;  1ICW A;  4KI0 A;  2F0U A;  3SGI A;  3L7Z C;  4JBJ A;  3RNU A;  3HOV H;  3KF6 B;  1IBL Q;  2RSN A;  3PO2 B;  4XQQ A;  1B3A A;  2YTX A;  4CJ2 C;  3DWP A;  2H5X A;  2Y0S G;  4JV5 L;  4DNT B;  1HTP A;  1OXS C;  1K8A C;  2F0Q A;  1I94 Q;  4KKU A;  5HY6 A;  3EA6 A;  4L6T B;  2K50 A;  2SNS A;  2DY8 A;  3NTK A;  1VQG A;  3HKZ E;  1RTN A;  2XNA C;  1MSG A;  3G6J B;  3J80 E;  2N49 A;  2PZU A;  1EYC A;  4B3T L;  1HR0 L;  1AP0 A;  3UDF A;  1VQL A;  4IJL A;  5FLX E;  1RF2 D;  3F2B A;  2WFW A;  1A62 A;  2CQO A;  2WAQ E;  1JR0 D;  1MSH A;  2VL6 A;  2K52 A;  4DR1 L;  4CDD C;  1HFN A;  4LFB Q;  3HOY G;  1AEX A;  1VQ7 A;  4DR4 L;  5FO9 B;  1D8L A;  1EQQ A;  1XNR Q;  2J7Z A;  1CTM A;  3NP8 A;  4DNI A;  3DWA A;  1HNZ L;  3NUC A;  1E2Z A;  5EKL A;  2DJF C;  4LUZ A;  1SMY C;  2X69 A;  3JAM E;  2HQL A;  1KRS A;  4TKO B;  1Y8P B;  1YHQ A;  1UEA B;  3IRB A;  1L1O B;  4DV2 L;  3UDG A;  1H9S A;  4IPH A;  3BS1 A;  3OPO A;  2F0D A;  3J81 E;  2QF7 A;  4JI7 L;  2QW7 A;  2K28 A;  3SK8 A;  4UAI A;  1A8V A;  2BCO A;  3K7A B;  1LTS D;  3H0G G;  3RD4 A;  3HS0 C;  4F8M A;  4V0B A;  5EPJ A;  3S2D B;  4JCV E;  3CHB D;  1EEI D;  1FYC A;  5NUC A;  1HZB A;  3J7A 5;  5COR A;  3ULL A;  1K9M C;  4CKB A;  3TP8 A;  1VQK A;  2WB1 G;  1PH7 A;  1D1I A;  5FO7 B;  3PIO 3;  1I50 B;  2BA1 A;  2NN6 I;  2Q2I A;  5E1F A;  1I6H B;  1SR3 A;  1BCP B;  1M90 C;  1BBX C;  3PF4 A;  5JJI A;  1DOK A;  4LF9 L;  5C6A A;  3C3L A;  1N33 L;  1KNA A;  2CHB D;  3E0E A;  3PUV A;  5C44 G;  4K8J A;  4F88 A;  1EY9 A;  3D6C A;  2OF1 A;  2PI2 A;  3I4L A;  1HZC A;  1AZP A;  1F2Z A;  4CKE A;  1DZ1 A;  1S5C D;  1JWS D;  1WD1 A;  3L3O C;  2P5Z X;  4ME5 A;  1Q8I A;  1PFB A;  1VQC A;  4GZY C;  4K2K A;  1B70 B;  1L0X B;  2XIW A;  3KFU A;  2F0M A;  3BDC A;  1XJV A;  3CC7 A;  2MNA A;  4FDB A;  1BCP D;  3K0X A;  3MEF A;  2NTT A;  1NR4 A;  3GO5 A;  5M3M G;  5E7N A;  2OTL A;  3AFP A;  4BY1 H;  4KJO A;  4X62 L;  1IBM Q;  4A3B B;  1PH1 A;  2XSC A;  3V05 A;  4DV0 Q;  1KXL A;  1JOK A;  2K05 A;  4MNO A;  3CCR A;  1XMO L;  1EIH A;  1HRJ A;  3HOW H;  1F77 A;  2UXB L;  1K8M A;  4IPG A;  4DV4 L;  4NXN Q;  1XNR L;  1LT6 D;  1I4Q A;  5IOD A;  4IUP A;  1SYC A;  4RKB A;  2E2D C;  5IGD A;  1YHA A;  2PI2 E;  1U5K A;  4XTC S;  2PZW A;  3MTS A;  3U4V A;  4OXP A;  1TT2 A;  3CC4 A;  1W2B A;  3B6Y A;  4BY7 B;  4R9W A;  4MTK A;  2HIV A;  2IWH A;  4DN4 M;  4HIO A;  1X9N A;  3BZD B;  3S9W A;  2N78 A;  4JW0 A;  3VA7 A;  2RCF A;  2SDF A;  2E2I H;  2Q2T A;  3EN2 A;  2JA5 B;  1AE3 A;  5C4X H;  2UXD L;  1K3R A;  5E4X A;  1EIG A;  2LKV A;  3QJY A;  3KLS A;  1STB A;  2A8V A;  3CPF A;  4GN3 B;  4OO1 H;  3T1H Q;  4KTA A;  4JG2 A;  2D0O A;  3KDF B;  5J1Z A;  4ODG A;  5IP9 H;  2BOS A;  2F1M A;  4KY5 A;  3I73 A;  3PUY A;  4B3M Q;  3MXG A;  4RGM A;  2ALY B;  1O7Y A;  3PO2 G;  4AYB B;  1A2U A;  3HOW G;  2R92 B;  5JJZ A;  3C46 A;  1M8A A;  2KQ3 A;  5K36 H;  3WOE A;  4CDC C;  3L0O A;  1HCZ A;  1P16 A;  1RD9 D;  3A74 A;  4IOC A;  5CV5 A;  4A3M B;  5HUR A;  5CV6 A;  1HXY D;  1LTG D;  4YCW A;  2ZM6 Q;  4H44 C;  4RHS A;  1ASZ A;  4YCV A;  5KEE A;  4JI6 L;  1N32 L;  4KD3 A;  4CBV A;  1CKN B;  5D3I B;  3JC6 6;  2IX1 A;  1G8Z D;  2AQ3 B;  4BWG B;  5IWA Q;  2B2V C;  1B53 A;  4RMF A;  2C9O A;  3TP7 A;  2RBM A;  4JI5 Q;  2NWG A;  2D62 A;  1O7Z A;  1PTO C;  5M5X H;  4DNR B;  3LWU A;  4NXM L;  1CHQ D;  1SYD A;  2Q8T A;  1PFN A;  5ELF A;  4LF4 Q;  4DV0 L;  2A74 C;  4AQY Q;  4OWW B;  3HFZ B;  1KAB A;  4KY7 A;  1SYG A;  1CQV A;  5IP9 G;  2RDH A;  1PA6 A;  2B3G A;  1EYD A;  5TSS A;  1WCM G;  5D65 A;  1TWA H;  2NVQ B;  1PH4 A;  4FF3 A;  5LMU L;  4R4C A;  1YIJ A;  1G6P A;  3FKI B;  4LK1 C;  5EJW A;  4ABN A;  3M3Y B;  2O5J C;  5K36 G;  2EYF A;  2F0O A;  3L9A X;  2JN4 A;  1K73 C;  3J80 i;  3GTG B;  2HT1 A;  4JBK A;  2WKD A;  2B63 B;  4CJ1 B;  1TQO A;  1D2B A;  3VYT A;  5EBC A;  3KLS X;  1BBU A;  5C3X A;  4XT3 B;  3CRK C;  2IHF A;  2CQA A;  2KEE A;  3DLL A;  1KD1 C;  4HJ7 A;  2D5D A;  1QVF A;  4UY8 C;  3GD7 A;  3R2I A;  1K8G A;  3A54 A;  1TWG H;  1IHZ A;  2FXQ A;  3BDL A;  2MGS A;  3MHB A;  4IUR A;  3GTJ H;  2F4I A;  1GKH A;  4GNX A;  5IT9 c;  1VQH A;  5I4D A;  3J7A V;  4OON A;  5I9O A;  1Q3L A;  3HOU H;  4QGU A;  3TRZ A;  5CV4 A;  2I5H A;  2UUA Q;  5FLM H;  4PQX A;  4RA8 A;  5GAE C;  1Q7Y C;  3QR8 A;  3T4A C;  2R7D A;  5JEA G;  4DGZ A;  2BA0 A;  3A5U A;  2N55 A;  2NVX H;  3S15 H;  4FXG C;  2XRQ D;  4J8Q A;  2R61 A;  4LUO A;  2M2L A;  3S1N B;  1JE4 A;  4RWS C;  4RGT A;  1YEZ A;  4HIM A;  1C4Q A;  3J80 L;  2EE1 A;  5IGE A;  1V1P B;  5DLQ E;  1XNQ Q;  1Y1W H;  1VQE A;  5BR8 Q;  1Y1V B;  5FLX L;  1TXY A;  2MPM A;  3S1M B;  3F2D A;  3I4M B;  1SYE A;  1W6K A;  4K5V A;  4P75 A;  1W3S A;  4OWX B;  1NSN S;  3RZD H;  4LF7 L;  4GKK Q;  1X3E A;  1KDB A;  5IYD H;  3FVQ A;  2ZXO A;  1A15 A;  2O5I C;  2Q8I B;  4AQY L;  4FVM A;  5DM7 3;  3QWN A;  1YIT A;  4KN4 C;  1GJX A;  1Q82 C;  3KYH C;  4IUN A;  3C1E A;  1WFQ A;  1JWM D;  3QOJ A;  4A3L H;  2FHT A;  5CV8 A;  2Y0S B;  1WTQ A;  1SRO A;  1UE1 A;  1HNW Q;  3J81 L;  1CHP D;  3SEB A;  3E9H A;  3HOU G;  2B2W A;  3ITP A;  1F2Y A;  1C8C A;  1PTO B;  3S16 H;  4OHJ A;  2UU9 L;  2E76 C;  4GOP A;  4QF4 A;  3SXH A;  4ZRZ A;  4C3I H;  3MXN A;  2E2H B;  2R7Z H;  4KHP L;  3RN5 A;  1HHV A;  1TS5 A;  3P1H A;  2Z4I A;  3KBX A;  1ROD A;  3TBI B;  1SFO H;  2R7F A;  2OQK A;  4LF6 Q;  2NVT B;  1Y1W G;  4K2L A;  2PQA B;  5ISR A;  3HRZ C;  4K5W A;  3DHQ A;  1Z9F A;  1XTD A;  2OXP A;  2DN8 A;  3QIA A;  4IFD H;  1PLF A;  1J6Q A;  2QEJ C;  2CH4 W;  1EQR A;  3J80 c;  1CI3 M;  1PH9 A;  1QVG A;  2NZO A;  2JXM B;  2QCP X;  3CAM A;  1GVP A;  4PZ6 A;  2R92 G;  3HOV B;  3K0Y A;  5ELN A;  1VQP A;  2JYO A;  3ONA B;  2VB3 X;  1YNJ C;  3AMU A;  1IKM A;  4GLA C;  1X54 A;  4YIJ A;  4CDF C;  3GV6 A;  4A3E H;  1YJN A;  2JA9 A;  1UE6 A;  4UP7 A;  4Y7N H;  2TSS A;  1ONL A;  1VMP A;  5C5M A;  4A3L G;  3HOZ H;  2KED A;  4HJ8 A;  1XYI A;  3WDN A;  3OW2 A;  2JEA I;  3G6E A;  4K14 A;  3HEJ A;  1PRT D;  1WI5 A;  1VQI A;  1EY0 A;  2SOB A;  4R4O A;  2PO4 A;  5DEH A;  1A63 A;  2ZJP A;  1JJ2 A;  4EQO A;  1I3Q H;  2TMP A;  1XWE A;  1KQS A;  1LTL A;  3E6Z X;  2XVS A;  2E2J H;  3PCO B;  5M3F H;  2WB1 B;  1EYA A;  2B2Y A;  1PFS A;  5FJ8 H;  1MI2 A;  2AMC B;  5A35 A;  3S2H H;  5J39 A;  1EYG A;  1HQM C;  2IHE A;  4L5T A;  4X3T A;  3J7A F;  1EZ6 A;  4ZQ3 A;  1D5X C;  1XXG A;  2AWO A;  1K8O A;  1SE4 A;  1QUQ B;  2IX0 A;  4GKJ Q;  5FK9 C;  3CW2 C;  3FP9 A;  4FXK C;  2UUC L;  3OWF A;  1KNE A;  4HMI A;  1L1O C;  5IT9 E;  4DR5 L;  2DNE A;  1NJI C;  1WTX A;  1ENC A;  1NY4 A;  3AYH B;  4LNQ A;  4A3E G;  1SNO A;  4A3F G;  2F4V L;  1YJW A;  3D3R A;  2K5D A;  1VQ5 A;  2EOT A;  3QOL A;  3TN2 A;  2OT2 A;  1U4L A;  1WTV A;  3GTK B;  2K4K A;  2E74 C;  3KF6 A;  3A8J E;  2V4D A;  3N52 A;  4UP9 A;  3GTO H;  2EDG A;  4R4Q A;  1I4X A;  1UEB A;  4RCN A;  5M3F G;  2NN6 H;  1E1T A;  5FKA C;  1RHP A;  2JA6 H;  4P74 A;  4DV1 Q;  4FXD A;  4H0L C;  4KLK A;  3I90 A;  4QCL A;  2QDB A;  1EZ8 A;  4P71 A;  5M5Y H;  1HH2 P;  1XMQ Q;  2RDF A;  1EEF D;  3RLO A;  4LF5 Q;  2UXC L;  4P73 A;  4DUZ Q;  4HJA A;  3NTH A;  3VDY A;  1VQO A;  5AFW A;  3BG3 A;  5F2D A;  5IYB G;  4K0K L;  2JA7 H;  4YY3 Q;  3H91 A;  2EJM A;  3FPU B;  4LJZ C;  4XYQ A;  2I07 B;  3DUZ A;  1CSQ A;  1XPR A;  3I4O A;  2EXZ A;  4QUF A;  4RKL A;  4IFD I;  5G3L D;  4JI1 Q;  4C1N I;  4DR6 Q;  2MUY A;  5C4Z A;  4I7Z C;  5LL6 X;  1L1O A;  4BY1 B;  5IGC A;  2Z6K C;  3VR5 A;  3LX0 A;  4BBR H;  2G5D A;  3UDX A;  4K6L A;  1AZQ A;  3BYT B;  1F2M A;  3SR1 A;  4A3G H;  3HOW B;  5E4W C;  4YCU A;  4XIG S;  2C35 B;  4BA1 I;  1Y8O B;  3UDI A;  2J0T D;  1K0R A;  2AQ1 B;  4LFA L;  1SYB A;  2A1A A;  4OL7 A;  5GAD C;  3ER0 A;  2PW5 A;  1LO5 D;  2HUG A;  2JA6 G;  4JI2 Q;  2CFM A;  2CW0 C;  1XX8 A;  3I70 A;  1NCV A;  3K6O A;  2E8G A;  3HZX A;  4HR7 B;  3VR3 A;  3IL8 A;  1JMC A;  3CCM A;  3NE5 B;  3U50 C;  2M9V A;  4JI4 L;  5IP7 H;  3AFQ A;  1BCP F;  1HA6 A;  4L5R C;  2YU9 H;  1B2T A;  1BR9 A;  2PNR C;  5C0X I;  3PIP A;  1YNJ D;  4DR2 Q;  2KHI A;  1VDZ A;  2HHH L;  4DUY Q;  4DPG A;  1TR5 A;  4FF1 A;  1RJT A;  2ID0 A;  4MZ9 A;  4WRD A;  2E2I B;  4OWT B;  3MFY A;  2ENB A;  2BE5 C;  1BUV T;  1LYL A;  1QWY A;  1BO0 A;  5C4X B;  1JOQ A;  3AEV A;  3VYU A;  4PNY A;  1ENA A;  4DV3 L;  3D6W A;  1JT8 A;  2XWJ B;  4B9W A;  3CC2 A;  3I56 A;  3T1Y L;  1FNV A;  1R9T H;  1X65 A;  1D6E C;  4A3D H;  3M4Y A;  1VCI A;  1YI2 A;  4Y52 H;  4RGO S;  2L5T A;  1EY5 A;  1FNU A;  1HTL D;  3HOV G;  1WCM B;  2K33 A;  2LXK A;  2F0P A;  4FF2 A;  4ZKC B;  3CCV A;  1MKH A;  4LFC Q;  4A3G G;  1VQD A;  4IUU A;  3A56 A;  4TSS A;  1GXD C;  3UE0 A;  1ZKO A;  1PFM A;  3RZO H;  4F87 A;  4JYA Q;  5ELB A;  3TZD A;  2F0T A;  1KAA A;  1RKN A;  2KUM A;  1DOM A;  1L2F A;  1ILP A;  5EQ0 A;  4X66 L;  4C2M B;  4XDX A;  1VQ6 A;  1ZYR C;  5M9O A;  4ME3 A;  3TRE A;  2L11 A;  4DR7 Q;  1PHJ A;  5A2Q E;  3MXU A;  1XPO A;  2Q8R E;  5AJ3 Q;  1S5B D;  1STH A;  3E3X A;  5ELC A;  3PSI A;  2VQE L;  1S5D D;  4KY6 A;  1D1K A;  4IUT A;  2JE6 I;  3CD6 A;  5M5X B;  1DXM A;  3K8A A;  4ILW A;  3PF5 A;  1LTB D;  4PMW A;  1SYF A;  4JK1 C;  1IBL L;  1TS2 A;  3TS2 A;  3BDO A;  1E24 A;  3K5L A;  4MIU A;  2A6E D;  2EYM A;  4KD4 A;  5GAG C;  2D9U A;  4A3D G;  2B2T C;  1I4G A;  3R93 A;  3A8I E;  2RA4 A;  1I94 L;  4OIK A;  3J7Y W;  3KK7 A;  1PH5 A;  2WP8 J;  1STG A;  3K5O A;  4ZLT F;  2G9H D;  2AKW B;  1SN8 A;  1TWA B;  2PCF B;  5COY A;  3W1G A;  2OCE A;  2O2L D;  2YTY A;  3CME A;  2HDL A;  1PH6 A;  3KDF A;  3L2P A;  1OXU A;  4L8J A;  2OWO A;  3AU7 A;  4AH6 A;  4DU9 A;  2F0J A;  5ELD A;  4KHV A;  1KIX A;  1V43 A;  2ZXR A;  1SBB B;  4LFB L;  5JVH 3;  5DNF A;  1TS4 A;  4HJ9 A;  1JB7 A;  1E3P A;  3VYS A;  3TP5 A;  2MP1 A;  1F9P A;  1GM5 A;  4XYO A;  4JI0 Q;  4X65 Q;  1LAB A;  4YHH Q;  4QB4 A;  1TWG B;  2PZT A;  3V2T A;  4RGN A;  3GTJ B;  1CT1 D;  3M4Q A;  5I2Y A;  3M4O H;  2A73 B;  2AHO B;  1STE A;  4JBW A;  3UE1 A;  4C3H H;  3HOU B;  1IYV A;  3ND9 A;  1LUZ A;  2CWP A;  3H6M A;  2E75 C;  2QIL A;  2XRS D;  3RMH A;  1CKN A;  4OEM B;  4LFC L;  2EZV A;  4NDX A;  4DK0 A;  3E0J A;  4DKA C;  2NVX B;  3S15 B;  4LMQ D;  4PZ7 A;  4IUQ A;  4X64 Q;  1I6V C;  2KHJ A;  3FPP A;  1KHI A;  5JOB A;  1N36 Q;  4A93 H;  5KNB A;  3ULP A;  4POG A;  2CW0 D;  3CRL C;  3VYR A;  2K03 A;  4DF7 A;  1CFM A;  1Y1W B;  1VQJ A;  4GN5 A;  4AYB E;  1A3T A;  4RHR A;  2EXD A;  2HCI A;  4Z9C B;  2HIX A;  3FMC A;  5BN4 A;  1EU3 A;  4BY1 G;  4KJN A;  1MGS A;  3HOX H;  1ENF A;  3RZD B;  4EQ5 A;  4N9T A;  2NB0 A;  1IBK Q;  4R4I A;  2BE5 D;  1X32 A;  1KLG D;  2B8F A;  3NPP A;  4G4K A;  3DEP A;  1VQB A;  4A4I A;  1TS3 A;  1NMF A;  4NKL A;  2F0L A;  3BZK A;  1II3 A;  1H9R A;  3CP0 A;  2F0G A;  1BOS A;  5IT9 L;  3H3V I;  1KAW A;  1WYD A;  1IW7 C;  4TQU S;  2RSO A;  1HFG A;  3I2Z A;  1F9Q A;  2KCN A;  4C3H G;  4P72 A;  4KN7 C;  4LF8 Q;  4FYD A;  1JJC B;  2R6G A;  3CCL A;  3KJP A;  3S16 B;  3GTL B;  1E2V A;  1VS0 A;  4C3I B;  1EOT A;  4WJW A;  3TME A;  2R7Z B;  2K7V A;  5C4X G;  1EQT A;  1T5X D;  1X6O A;  3KF8 B;  2VUM H;  1IBM L;  2K04 A;  4A93 G;  2O4X A;  1IXR A;  1U4M A;  4WOR A;  4OO1 G;  1SFO B;  2A68 C;  1XTC D;  4NXN L;  2H4O A;  1ZYR D;  3EIV A;  2PMZ B;  1SNQ A;  4RG1 A;  3ERO A;  4IOA A;  1PRT C;  5C4J H;  2EYP A;  4DA2 A;  3F8T A;  1VQF A;  2Q2U A;  4J15 A;  2QEX A;  2K75 A;  4A3J H;  1GUW A;  3CCE A;  1LTI D;  1FR3 A;  4HCS A;  1BQQ T;  2WAQ G;  1V1P A;  2F3I A;  5KYL A;  2K1B A;  1EIY B;  1IYJ B;  1TWC H;  1U4R A;  4V19 0;  3LGJ A;  5ELE A;  3ND8 A;  1J5E Q;  1VQM A;  4A3E B;  3Q22 A;  3HKS A;  4Y7N B;  4A3F B;  1S3O A;  4UP8 A;  2ATW A;  3HOZ B;  2SNM A;  3TP6 A;  4MN3 A;  3NHH A;  1UE7 A;  1LT5 D;  5KRU A;  2WIN B;  5FOB B;  3OTO Q;  4K5X A;  4DV7 Q;  3OHX C;  3BYY B;  4PMC A;  3T56 B;  1A2T A;  4WJ3 M;  1I3Q B;  5EPK A;  3T1H L;  1K83 H;  5I6W A;  5JPM C;  3ZYY X;  4DV6 Q;  2E2J B;  3FDT A;  1AW7 A;  1PTO F;  3NBH B;  1WTO A;  2EYJ A;  5M3F B;  2N3S A;  3QO2 A;  1KDC A;  2EQS A;  4HID A;  3A0J A;  2XTI A;  4A3K H;  1PH8 A;  1X3Q A;  4B3M L;  2B2V A;  1E22 A;  3QB3 A;  3S1Q H;  4IFD J;  3S2H B;  1GD7 A;  1I4P A;  4XQN A;  3D31 A;  1VQ8 A;  4GN4 B;  4JOI C;  2L1B A;  1JCK B;  1U4P A;  4U68 A;  2B2U C;  1CK1 A;  2KOL A;  4A3C H;  3K7U C;  5EKK A;  2QA4 A;  1FJG Q;  3H94 A;  3NTI A;  4A3J G;  2ZM6 L;  3KJO A;  1Q81 C;  2ICI A;  1H9M A;  2PNH A;  1EFW A;  2JEB I;  1B9M A;  2L55 A;  5IY0 A;  1HZA A;  2KA7 A;  4JI3 Q;  5IE8 A;  1K0S A;  3E9I A;  2ICE C;  1HNX Q;  2SEB D;  2JA8 H;  4WJ4 A;  1PVO A;  2PQA A;  3FRP B;  2A69 C;  5IWA L;  4JI5 L;  1N34 Q;  2KCC A;  2NBF A;  3T51 B;  3K5M A;  2ZT9 C;  5C0X J;  2Y0S E;  2UUB Q;  3D4D A;  4KV6 A;  4QIW B;  3U9S A;  4LF4 L;  2L0C A;  1E2W A;  4DAM A;  1G2S A;  4G7Z C;  1QOH A;  3T53 B;  5C4H A;  1O7L A;  2WKC A;  1EQV A;  2KVM A;  3IFD A;  4CDE C;  4DAP A;  1T5E A;  2JA6 B;  5LHY 1;  2BDN A;  3I55 A;  1WVL A;  4A3K G;  3Q0A A;  5FLM G;  1B44 D;  5M5Y B;  4L5Q A;  4HJ5 A;  2XN9 C;  3D4R A;  1QJO A;  4TVA B;  4A3M H;  1TWF H;  3NEM A;  2GVB A;  3GTM H;  2RHQ B;  4DV5 Q;  4FF4 A;  1B3Q A;  5CV7 A;  1PYB A;  3X3M A;  1X3F A;  4OX9 Q;  4A3C G;  3TEH B;  4EVO A;  2JA7 B;  5KIX A;  4WFN 3;  5A2Q L;  1PRT B;  3MVV A;  4HTH A;  4EQN A;  3WWV A;  5IYC H;  1HA5 A;  3DEO A;  1IW7 D;  2PYK A;  3VR4 A;  3OTO L;  1MJC A;  4ZCK A;  4ID6 A;  2JA8 G;  1PH2 A;  3GV3 A;  2HCC A;  3DMU A;  2XGT A;  4DAY B;  4IJH A;  2K5H A;  1QUQ A;  5C3E H;  4YWL A;  1DGS A;  5IYD G;  3W2D A;  2X6L A;  1JOR A;  3A8K E;  1P8L A;  1H9J A;  4BBR B;  1PZI D;  2UUA L;  1Q1E A;  1LT4 D;  3A7A B;  1FD7 D;  1RIP A;  4H13 C;  4C56 C;  4RAU C;  3OYY A;  4A3G B;  1X56 A;  3NXW A;  3E5S A;  2A68 D;  2VXW A;  1EY4 A;  1BF4 A;  2KEN A;  5EPL A;  3RLF A;  2QDL A;  5IGF A;  1EWH A;  2F0I A;  2BH2 A;  2WB1 E;  3S17 H;  2YV5 A;  1N8R C;  4BXX H;  2GVA A;  1LM0 A;  1XNQ L;  4MTN A;  1KC8 C;  5I2X A;  5BR8 L;  5C0X H;  4O2D A;  4B3S Q;  2YU9 B;  4M8A A;  4C3I G;  3GTG H;  3HG9 A;  5KNC A;  2B63 H;  2E5L Q;  3PO3 H;  1X55 A;  2JP1 A;  2R7Z G;  1Q90 A;  1S5E D;  1UAP A;  1GUT A;  3CCJ A;  3PUW A;  1B1Z A;  3GTP H;  2ASB A;  3U9O A;  2EJG C;  3MWY W;  3SK6 A;  4GKK L;  1PH3 A;  2C5C A;  2Z6B A;  2K5W A;  2VZA A;  1JOO A;  2IPK D;  1SLJ A;  3O13 A;  5IYC G;  1SJH D;  4JI8 Q;  4BS9 A;  1WTP A;  4KMU C;  5C3W A;  1SDF A;  4RFB A;  1EL0 A;  1U9R A;  1R9T B;  4IFD G;  4A3D B;  2EPB A;  4K8I A;  5CBE E;  5C3E G;  2D2C C;  5BN3 A;  1HNW L;  2AQ2 B;  1J9O A;  2IW3 A;  1CUK A;  1PMR A;  2RDG A;  2DNC A;  1CM9 A;  4B9X A;  1X3P A;  3S24 A;  3PUZ A;  1E1O A;  2DJG C;  3SK5 A;  4JV5 Q;  1GHK A;  1B7Y B;  1WOC A;  2F3W A;  1VQ9 A;  2PQE A;  3HOZ G;  1LT3 D;  2MO0 A;  2D0P A;  3RZO B;  1TII D;  3PMF A;  4G7O C;  5GRO A;  4IAL A;  4HED A;  4A3I H;  4QL5 A;  2VY3 A;  1HR0 Q;  2A6E C;  3K58 A;  2MFI A;  3BZC A;  1B50 A;  4LF6 L;  3BVZ A;  2HQE A;  5LMN Q;  3UI2 A;  4KHZ A;  4FP5 D;  1Q8K A;  3PO3 G;  3C2P A;  1BBW A;  2F0S A;  3WOF A;  4DR1 Q;  4DR3 Q;  2A69 D;  5FJ8 G;  4DR4 Q;  2NZ1 D;  4C3J H;  2K5N A;  4POF A;  1HNZ Q;  3FHW A;  3ULJ A;  1LTA D;  3KBG A;  2L15 A;  3EFX D;  5D3D A;  3EJI A;  3GP7 A;  1OXV A;  2KCM A;  3D0F A;  1Z47 A;  3GTQ H;  1V9P A;  1TU2 B;  2Z0S A;  1EY6 A;  3EVQ A;  3SE0 A;  2LSS A;  4HCE A;  4DV2 Q;  3S1R H;  3AB9 A;  3S14 H;  1Q86 C;  3URY A;  2K14 A;  4JI7 Q;  5ELO A;  1A3V A;  1EFI D;  4HAE A;  3Q24 A;  2R93 H;  4H7B A;  2RVL A;  1VQ4 A;  5EKI A;  2AUJ D;  4RCO A;  2EYL A;  4B3S L;  4EGV A;  5CBA E;  4H02 A;  4QUC A;  4EX5 A;  1ILQ A;  3HOY H;  3FEW X;  3R3O A;  2A6H D;  3W3A A;  4QMG A;  3AQQ A;  1VQN A;  4GLV B;  2EYH A;  4OEL B;  3N6R A;  5JAV A;  4JI8 L;  1RTO A;  5KND A;  4JVZ A;  4MHE A;  5L37 A;  2NN6 G;  5HGQ A;  2OQ0 A;  1IL2 A;  3CCS A;  1WTW A;  1O80 A;  4LF9 Q;  4GKJ L;  1N33 Q;  2ZXP A;  1QZH A;  4C3J G;  4I65 A;  3M4O B;  1HQR D;  4K6D A;  1SXT A;  2AWN A;  3M7N A;  4C3H B;  2EY1 A;  3U58 A;  3PV0 A;  3I4N H;  3GDE A;  1GUS A;  4ZKB B;  4BBS H;  3MZ5 A;  3M4P A;  3CCQ A;  3H0G H;  4L63 B;  4S3S A;  2JA7 G;  4DK3 C;  4B3R Q;  1HUM A;  2I5M X;  3TZU A;  4U67 3;  4A93 B;  4YWK A;  2CVR A;  3H15 A;  2R93 G;  1LTR D;  5FO8 B;  1KTK A;  1D5Z C;  1IL8 A;  2PW7 A;  3Q23 A;  4IN3 A;  5M5W H;  1ASY A;  3HKZ B;  1C7Y A;  5LMN L;  1H9K A;  4ULL A;  4X62 Q;  1YNX A;  4DAV A;  2KEC A;  2DGY A;  1LLR D;  1Z6H A;  1SNP A;  1YZ6 A;  2EVB A;  1PZJ D;  1XMO Q;  3RUZ A;  4DR3 L;  4DV1 L;  3CCU A;  2UXB Q;  4BBR G;  3H09 A;  3VR6 A;  3PIP 3;  4DV4 Q;  3HOX B;  1V1O A;  2F0W A;  5C44 H;  1XMQ L;  1BKB A;  2OTJ A;  2WAQ B;  1GO3 E;  2JJQ A;  4LF5 L;  3ERQ A;  3J81 j;  1QCB D;  3OIP A;  4UDU C;  4DUZ L;  2VS1 A;  1LAC A;  2IY5 B;  4DK1 A;  5IGG A;  2Z6K A;  4O1N A;  3F2C A;  2FFK B;  3Q8D A;  1N9W A;  1Q12 A;  2JQO A;  2K32 A;  3H3V H;  1ZEQ X;  3OMG A;  1KLU D;  2B8G A;  2FIN B;  5J22 A;  4APV A;  1R4Q B;  1IKL A;  3PIO A;  4YY3 L;  2GN5 A;  1V8Q A;  5IP7 G;  1EUJ A;  1I4R A;  1S72 A;  1JB3 A;  1STA A;  1BVS A;  3I4N G;  1Q46 A;  1AN8 A;  1DYQ A;  4Q5V A;  4DFA A;  4BBS G;  5M3M H;  2UXD Q;  5EBD A;  3IAY A;  1C9O A;  2A19 A;  1TY2 A;  1V1Q A;  2B29 A;  2VNU D;  1WTR A;  4JI1 L;  3GTK H;  2RHS B;  2F0V A;  4DR6 L;  1HZ9 A;  1JC7 A;  2CKZ B;  2F0F A;  1FGB D;  1TWH H;  3KUP A;  2VUM B;  1LV9 A;  2DUD A;  1SE8 A;  3G7L A;  1ICF B;  4KKS A;  4O42 A;  1X3G A;  1F2L A;  1IZ6 A;  2A5H A;  3NK9 A;  2LXJ A;  3DXJ C;  1M4V A;  2NVY H;  5C4J B;  1I5F A;  3U4Z A;  5CGK A;  2ZJR A;  1LTT D;  4PMB A;  4JI2 L;  4A3J B;  3CQZ H;  2Z9H A;  1MBY A;  2BH8 A;  1U0L A;  1TWC B; 
#chains in the Genus database with same CATH homology
 1PYW D;  5JVG 3;  4HSP A;  1H9S B;  2F0N A;  3I3C A;  4CKC A;  4PV1 C;  4FO2 A;  5EGT A;  3R8B A;  1B9N A;  1HUN A;  3V96 A;  1CA6 A;  3TDQ A;  4J6H A;  4M1U B;  2EY2 A;  1K83 B;  1Z7T A;  1G29 1;  1B4O A;  1QB5 D;  1I4H A;  3NWS A;  1RDP D;  1ESF A;  1TKW B;  4A3K B;  4EQP A;  4X3S A;  3S1Q B;  1QNK A;  1O78 A;  1ET6 A;  1CZG A;  1Y8N B;  2BDO A;  2EY5 A;  2GA4 B;  2AUK A;  3F2U A;  5JEA J;  1VF7 A;  3KF8 A;  2IX3 A;  3LNN A;  4HSV A;  4J1M A;  2B2T A;  1S5F D;  3OMC A;  1A3U A;  4CGY B;  2JA8 B;  5LL6 S;  1KDA A;  2X6G A;  3NBI A;  2L12 A;  2M00 A;  1OO9 B;  3MXP A;  3MC0 B;  1TVX A;  3OW7 A;  2LFN A;  1QIL A;  5E3F A;  3IKJ A;  5CC4 A;  3OOC A;  1UNS A;  2KHS A;  3PUX A;  3TSS A;  2NUC A;  1EU4 A;  3R2T A;  2YYZ A;  3KLR A;  5DAU A;  3I8Z A;  1A6X A;  1Y69 U;  3X3N A;  4IQZ A;  2F03 A;  1TWF B;  3GTM B;  1SMY D;  3NBH A;  2F0K A;  2Z1C A;  1SSO A;  3NQT A;  3QG1 A;  2HDM A;  1EWC A;  1G2T A;  1GUN A;  3OSO A;  1G6Z A;  1F9R A;  4E6I A;  1UUP A;  4NMZ A;  5CMD A;  1E0B A;  4ZUI A;  5C3E B;  5IIF A;  5JEA H;  1OXT A;  2J4X A;  1WD0 A;  5I6Y A;  3DWQ A;  3MEH A;  2I46 A;  2NTS A;  4G7H C;  3MFG A;  2F0H A;  3EQL C;  2MHV A;  3S17 B;  1BNZ A;  1HPC A;  5JPN C;  1YNN C;  1EY7 A;  3SK4 A;  2L4N A;  1SE3 A;  3P20 A;  3PO3 B;  1DOL A;  2QKI C;  3GTP B;  5CYU A;  1ESR A;  3CU7 A;  1NR2 A;  1C48 A;  4B08 A;  3OWE B;  1GUO A;  2B2W C;  4XXE A;  3A55 A;  1GUG A;  3I91 A;  2JSO A;  4DXG A;  1PRT F;  3P75 A;  3LWE A;  2K01 A;  3MA2 B;  4IUV A;  4ZUJ A;  2R3Z A;  3MAQ A;  4RH6 A;  1STN A;  1CA5 A;  5T1G A;  4FNF A;  2RQX A;  1JWU D;  2KJX A;  5IOC A;  1STY A;  3SVM A;  4X3U A;  4TRD A;  2K5Q A;  4DAY A;  2VB2 X;  2F3V A;  4A3I B;  3CKI B;  4OGQ C;  5KYI A;  1G91 A;  5I9P A;  2L9H A;  4OO1 I;  5T1I A;  3SDZ A;  1SJE D;  2G9D A;  5C5L A;  3H3V C;  3GQB A;  3GTO B;  3T13 A;  1W6J A;  1SEB D;  1VF5 C;  2RKS A;  2WII B;  1ET9 A;  1QG7 A;  1VMC A;  3SHL A;  4C3J B;  3JAM L;  4OIJ A;  1OXX K;  2F0E A;  3GTQ B;  3NSW A;  2A6H C;  2MJ8 A;  2WAC A;  3HP3 A;  1L0Y B;  4BA2 I;  3S1R B;  3S14 B;  2B2Y C;  1DJR D;  3BVG A;  1R4P B;  4HN7 A;  4G57 A;  4KK7 A;  2DY7 A;  3M7G A;  1S4Z A;  2B2U A;  2FJ2 A;  1GOZ A;  2R93 B;  3I72 A;  2PPB C;  4Q0F A;  5CR3 A;  4DXF A;  4IZ8 A;  4ZK9 B;  2FMM A;  3IFT A;  1CZW A;  3HOY B;  4LAA A;  4CJ0 B;  1RCV D;  1CQF A;  3NWT A;  5K5P A;  2B39 A;  3M85 A;  3DM1 A;  3P7J A;  2K6A A;  1PTO D;  1J8I A;  4NW2 A;  1SND A;  4HMJ A;  1MD2 D;  2EYO A;  4N9P A;  1PXU A;  1NAP A;  1SE2 A;  5G3L F;  3VA5 A;  4P2C B;  3VR2 A;  3A7L A;  3I4N B;  4BBS B;  1ZXT A;  5DM6 3;  2N88 A;  3H0G B;  5KGU A;  2WV6 D;  2EY6 A;  4NP5 A;  4ZAI A;  3BVM A;  3K57 A;  4ZYS A;  5M5W B;  2IL8 A;  1YNN D;  1BXT A;  2FMC A;  2LS0 1;  3K59 A;  3OIQ A;  3D8G A;  3D4W A;  1PDQ A;  1NUC A;  1AFP A;  5C44 B;  2XWB B;  4R8I A;  1GHJ A;  1JQY D;  1QNU A;  1F9S A;  1PZK D;  3NQI A;  1SNC A;  5D14 A;  1SAP A;  1QE6 A;  1BDO A;  5C0X G;  5IGB A;  1SNM A;  1D5M C;  2H1E A;  5BN5 A;  1DD2 A;  4R8N A;  5CV9 A;  5M3M B;  3K5N A;  1TY0 A;  1ML0 D;  2IJ0 A;  2NYZ D;  1TWH B;  1FNW A;  5HGT A;  1DM0 B;  2EJF C;  2Z4H A;  1DCZ A;  4XT1 B;  4KKT A;  2Z8L A;  1Q1B A;  3HGB A;  1EY8 A;  2NVY B;  3Q6S A;  4X3K A;  1PTO H;  4CHT B;  3T16 A;  1BCP C;  3CQZ B;  1JIC A;  4F7X A;  2IT1 A;  3C1F A;  2LY7 A;  2OEO A;  4XQJ A;  2LMC B;  1IYU A;  1DON A;  4C1N K;  1ICW A;  4KI0 A;  2F0U A;  3L7Z C;  2RSN A;  3PO2 B;  4XQQ A;  1B3A A;  4CJ2 C;  3DWP A;  4DNT B;  1HTP A;  1OXS C;  2F0Q A;  4KKU A;  3EA6 A;  4L6T B;  2SNS A;  2DY8 A;  3NTK A;  1RTN A;  2XNA C;  1MSG A;  3G6J B;  3J80 E;  2PZU A;  1EYC A;  1AP0 A;  5FLX E;  1RF2 D;  1JR0 D;  1MSH A;  1HFN A;  1AEX A;  5FO9 B;  2J7Z A;  1CTM A;  3NP8 A;  3DWA A;  3NUC A;  1E2Z A;  5EKL A;  1SMY C;  2X69 A;  3JAM E;  4TKO B;  1Y8P B;  1UEA B;  1H9S A;  3BS1 A;  3OPO A;  2F0D A;  3J81 E;  2QF7 A;  2K28 A;  3SK8 A;  4UAI A;  2BCO A;  3K7A B;  1LTS D;  3RD4 A;  3HS0 C;  4F8M A;  4V0B A;  5EPJ A;  3S2D B;  3CHB D;  1EEI D;  1FYC A;  5NUC A;  5COR A;  4CKB A;  3TP8 A;  1D1I A;  5FO7 B;  3PIO 3;  1I50 B;  2BA1 A;  2NN6 I;  1I6H B;  5E1F A;  1BCP B;  1BBX C;  1DOK A;  5C6A A;  3C3L A;  1KNA A;  2CHB D;  3PUV A;  4K8J A;  4F88 A;  1EY9 A;  3D6C A;  2OF1 A;  3I4L A;  1AZP A;  1F2Z A;  4CKE A;  1DZ1 A;  1S5C D;  1JWS D;  1WD1 A;  3L3O C;  4ME5 A;  1Q8I A;  1PFB A;  4GZY C;  4K2K A;  1L0X B;  2XIW A;  2F0M A;  3BDC A;  1BCP D;  2NTT A;  1NR4 A;  3GO5 A;  4KJO A;  4A3B B;  2XSC A;  3V05 A;  1JOK A;  2K05 A;  1EIH A;  1HRJ A;  1F77 A;  1K8M A;  1LT6 D;  1I4Q A;  5IOD A;  4IUP A;  1SYC A;  4RKB A;  2E2D C;  5IGD A;  4XTC S;  2PZW A;  3MTS A;  1TT2 A;  4BY7 B;  4R9W A;  2IWH A;  4DN4 M;  3BZD B;  3S9W A;  3VA7 A;  2SDF A;  2JA5 B;  5E4X A;  1EIG A;  2LKV A;  3QJY A;  3KLS A;  1STB A;  4OO1 H;  4KTA A;  5J1Z A;  4ODG A;  2BOS A;  2F1M A;  4KY5 A;  3I73 A;  3PUY A;  3MXG A;  4RGM A;  1O7Y A;  4AYB B;  1A2U A;  2R92 B;  5JJZ A;  3C46 A;  1M8A A;  2KQ3 A;  5K36 H;  3WOE A;  1HCZ A;  1RD9 D;  5CV5 A;  4A3M B;  5HUR A;  5CV6 A;  1HXY D;  1LTG D;  4H44 C;  4RHS A;  5KEE A;  4KD3 A;  4CBV A;  5D3I B;  2IX1 A;  1G8Z D;  2AQ3 B;  4BWG B;  2B2V C;  1B53 A;  2C9O A;  3TP7 A;  2RBM A;  2NWG A;  2D62 A;  1O7Z A;  1PTO C;  4DNR B;  3LWU A;  1CHQ D;  1SYD A;  2Q8T A;  1PFN A;  5ELF A;  2A74 C;  1KAB A;  4KY7 A;  1SYG A;  1CQV A;  2RDH A;  1EYD A;  5TSS A;  5D65 A;  2NVQ B;  4FF3 A;  3FKI B;  4LK1 C;  5EJW A;  4ABN A;  3M3Y B;  2O5J C;  5K36 G;  2EYF A;  2F0O A;  3L9A X;  3GTG B;  2WKD A;  2B63 B;  4CJ1 B;  1TQO A;  1D2B A;  3VYT A;  5EBC A;  3KLS X;  5C3X A;  4XT3 B;  3CRK C;  2CQA A;  2KEE A;  2D5D A;  3GD7 A;  3R2I A;  3A54 A;  1IHZ A;  3BDL A;  2MGS A;  3MHB A;  4IUR A;  2F4I A;  5I4D A;  3J7A V;  5I9O A;  1Q3L A;  5CV4 A;  4PQX A;  4RA8 A;  3T4A C;  5JEA G;  4DGZ A;  2BA0 A;  2N55 A;  4FXG C;  2XRQ D;  4J8Q A;  2R61 A;  2M2L A;  3S1N B;  1JE4 A;  4RWS C;  4RGT A;  1C4Q A;  3J80 L;  2EE1 A;  5IGE A;  1V1P B;  1Y1V B;  5FLX L;  2MPM A;  3S1M B;  3I4M B;  1SYE A;  1W6K A;  4K5V A;  1NSN S;  1KDB A;  3FVQ A;  2ZXO A;  1A15 A;  2O5I C;  2Q8I B;  4FVM A;  5DM7 3;  3QWN A;  4KN4 C;  1GJX A;  4IUN A;  3C1E A;  1JWM D;  3QOJ A;  2FHT A;  5CV8 A;  2Y0S B;  1WTQ A;  3J81 L;  1CHP D;  3SEB A;  2B2W A;  3ITP A;  1F2Y A;  1C8C A;  1PTO B;  4OHJ A;  2E76 C;  4QF4 A;  3SXH A;  4ZRZ A;  3MXN A;  2E2H B;  1HHV A;  1TS5 A;  3P1H A;  2Z4I A;  3KBX A;  1ROD A;  3TBI B;  2NVT B;  4K2L A;  5ISR A;  3HRZ C;  4K5W A;  3DHQ A;  2OXP A;  2DN8 A;  3QIA A;  4IFD H;  1PLF A;  2QEJ C;  1CI3 M;  2JXM B;  2QCP X;  3HOV B;  3K0Y A;  2JYO A;  3ONA B;  2VB3 X;  1YNJ C;  3AMU A;  1IKM A;  4YIJ A;  3GV6 A;  2TSS A;  1ONL A;  1VMP A;  5C5M A;  2KED A;  1XYI A;  3WDN A;  2JEA I;  4K14 A;  3HEJ A;  1PRT D;  1EY0 A;  2SOB A;  2PO4 A;  5DEH A;  4EQO A;  2TMP A;  1XWE A;  3E6Z X;  2XVS A;  2WB1 B;  1EYA A;  2B2Y A;  1MI2 A;  5A35 A;  5J39 A;  1HQM C;  4X3T A;  3J7A F;  1EZ6 A;  4ZQ3 A;  1D5X C;  1XXG A;  2AWO A;  1K8O A;  1SE4 A;  2IX0 A;  5FK9 C;  4FXK C;  3OWF A;  1KNE A;  4HMI A;  5IT9 E;  2DNE A;  1WTX A;  1ENC A;  1SNO A;  3D3R A;  2K5D A;  2EOT A;  3QOL A;  3TN2 A;  2OT2 A;  1U4L A;  1WTV A;  3GTK B;  2E74 C;  3A8J E;  2V4D A;  3N52 A;  2EDG A;  1I4X A;  4RCN A;  2NN6 H;  5FKA C;  1RHP A;  4FXD A;  4H0L C;  3I90 A;  4QCL A;  2QDB A;  1EZ8 A;  2RDF A;  1EEF D;  3NTH A;  5AFW A;  3BG3 A;  5F2D A;  3H91 A;  2EJM A;  3FPU B;  4LJZ C;  4XYQ A;  2I07 B;  3DUZ A;  2EXZ A;  4QUF A;  4RKL A;  4IFD I;  5G3L D;  4C1N I;  2MUY A;  5C4Z A;  4I7Z C;  5LL6 X;  4BY1 B;  5IGC A;  3VR5 A;  3LX0 A;  4K6L A;  1AZQ A;  3BYT B;  1F2M A;  3SR1 A;  3HOW B;  5E4W C;  4XIG S;  4BA1 I;  1Y8O B;  2J0T D;  2AQ1 B;  1SYB A;  4OL7 A;  2PW5 A;  1LO5 D;  2HUG A;  2CW0 C;  1XX8 A;  3I70 A;  1NCV A;  3K6O A;  4HR7 B;  3VR3 A;  3HZX A;  3IL8 A;  3NE5 B;  2M9V A;  1BCP F;  1HA6 A;  1B2T A;  1BR9 A;  2PNR C;  5C0X I;  1YNJ D;  1VDZ A;  1TR5 A;  4FF1 A;  1RJT A;  2ID0 A;  4WRD A;  2E2I B;  3MFY A;  2ENB A;  2BE5 C;  1BUV T;  1QWY A;  1BO0 A;  5C4X B;  1JOQ A;  3VYU A;  4PNY A;  1ENA A;  3D6W A;  2XWJ B;  4B9W A;  1FNV A;  1D6E C;  3M4Y A;  1VCI A;  4RGO S;  2L5T A;  1EY5 A;  1FNU A;  1HTL D;  1WCM B;  2K33 A;  2F0P A;  4FF2 A;  4ZKC B;  4IUU A;  3A56 A;  4TSS A;  1GXD C;  1ZKO A;  1PFM A;  4F87 A;  5ELB A;  3TZD A;  2F0T A;  1KAA A;  1RKN A;  2KUM A;  1DOM A;  1ILP A;  5EQ0 A;  4C2M B;  4XDX A;  1ZYR C;  5M9O A;  2L11 A;  5A2Q E;  3MXU A;  2Q8R E;  1S5B D;  1STH A;  5ELC A;  1S5D D;  4KY6 A;  1D1K A;  4IUT A;  2JE6 I;  5M5X B;  1DXM A;  4ILW A;  1LTB D;  4PMW A;  1SYF A;  4JK1 C;  1TS2 A;  3BDO A;  3K5L A;  4MIU A;  2A6E D;  2EYM A;  4KD4 A;  2D9U A;  2B2T C;  1I4G A;  3R93 A;  3A8I E;  2RA4 A;  4OIK A;  3J7Y W;  3KK7 A;  2WP8 J;  1STG A;  3K5O A;  4ZLT F;  2G9H D;  1TWA B;  2PCF B;  5COY A;  2O2L D;  2HDL A;  1OXU A;  4L8J A;  3AU7 A;  4DU9 A;  2F0J A;  5ELD A;  4KHV A;  1V43 A;  2ZXR A;  1SBB B;  5JVH 3;  5DNF A;  1TS4 A;  3VYS A;  3TP5 A;  2MP1 A;  1F9P A;  4XYO A;  1LAB A;  4QB4 A;  1TWG B;  2PZT A;  3V2T A;  4RGN A;  3GTJ B;  1CT1 D;  5I2Y A;  2A73 B;  3HOU B;  1STE A;  4JBW A;  1IYV A;  3ND9 A;  3H6M A;  2E75 C;  2QIL A;  2XRS D;  3RMH A;  2EZV A;  4NDX A;  4DK0 A;  3E0J A;  2NVX B;  3S15 B;  4LMQ D;  4IUQ A;  1I6V C;  3FPP A;  5JOB A;  5KNB A;  3VYR A;  2CW0 D;  3CRL C;  2K03 A;  4DF7 A;  1CFM A;  1Y1W B;  1A3T A;  4RHR A;  4Z9C B;  2HCI A;  3FMC A;  5BN4 A;  1EU3 A;  4KJN A;  1MGS A;  1ENF A;  3RZD B;  4N9T A;  2NB0 A;  2BE5 D;  1X32 A;  1KLG D;  2B8F A;  3NPP A;  4G4K A;  3DEP A;  1TS3 A;  4NKL A;  2F0L A;  1II3 A;  1H9R A;  2F0G A;  1BOS A;  5IT9 L;  1IW7 C;  4TQU S;  2RSO A;  1HFG A;  1F9Q A;  2KCN A;  4C3H G;  4KN7 C;  4FYD A;  2R6G A;  3S16 B;  3GTL B;  1E2V A;  4C3I B;  1EOT A;  4WJW A;  3TME A;  2R7Z B;  2K7V A;  1EQT A;  1T5X D;  2K04 A;  2O4X A;  1U4M A;  4WOR A;  4OO1 G;  1SFO B;  2A68 C;  1XTC D;  2H4O A;  1ZYR D;  2PMZ B;  1SNQ A;  3ERO A;  1PRT C;  2EYP A;  4DA2 A;  1GUW A;  1LTI D;  1FR3 A;  4HCS A;  1BQQ T;  1V1P A;  5KYL A;  2K1B A;  1U4R A;  4V19 0;  5ELE A;  3ND8 A;  4A3E B;  3Q22 A;  4Y7N B;  4A3F B;  3HOZ B;  2SNM A;  3TP6 A;  4MN3 A;  3NHH A;  1LT5 D;  5KRU A;  2WIN B;  5FOB B;  4K5X A;  3OHX C;  3BYY B;  4PMC A;  3T56 B;  1A2T A;  1I3Q B;  5EPK A;  5I6W A;  5JPM C;  3ZYY X;  2E2J B;  3FDT A;  1AW7 A;  1PTO F;  1WTO A;  2EYJ A;  5M3F B;  3QO2 A;  1KDC A;  1X3Q A;  2B2V A;  3QB3 A;  4IFD J;  3S2H B;  1I4P A;  4XQN A;  3D31 A;  2L1B A;  1JCK B;  1U4P A;  4U68 A;  2B2U C;  1CK1 A;  2KOL A;  5EKK A;  3H94 A;  3NTI A;  2ICI A;  1H9M A;  2JEB I;  1B9M A;  2L55 A;  2KA7 A;  2ICE C;  2SEB D;  3FRP B;  2A69 C;  2KCC A;  2NBF A;  3T51 B;  3K5M A;  2ZT9 C;  5C0X J;  3D4D A;  4KV6 A;  4QIW B;  3U9S A;  2L0C A;  1E2W A;  1G2S A;  4G7Z C;  1QOH A;  3T53 B;  5C4H A;  1O7L A;  2WKC A;  1EQV A;  2KVM A;  3IFD A;  4DAP A;  1T5E A;  2JA6 B;  5LHY 1;  2BDN A;  1WVL A;  3Q0A A;  1B44 D;  5M5Y B;  2XN9 C;  3D4R A;  1QJO A;  4FF4 A;  3X3M A;  5CV7 A;  4EVO A;  2JA7 B;  5KIX A;  4WFN 3;  5A2Q L;  1PRT B;  3MVV A;  4HTH A;  4EQN A;  1HA5 A;  3DEO A;  1IW7 D;  2PYK A;  3VR4 A;  4ID6 A;  3GV3 A;  2HCC A;  3DMU A;  3W2D A;  2X6L A;  1JOR A;  3A8K E;  1H9J A;  4BBR B;  1PZI D;  1Q1E A;  1LT4 D;  3A7A B;  1FD7 D;  4H13 C;  4C56 C;  4RAU C;  4A3G B;  3NXW A;  3E5S A;  2A68 D;  2VXW A;  1EY4 A;  1BF4 A;  5EPL A;  3RLF A;  5IGF A;  1EWH A;  2F0I A;  5I2X A;  5C0X H;  2YU9 B;  4M8A A;  4C3I G;  5KNC A;  3HG9 A;  2JP1 A;  1Q90 A;  1S5E D;  1UAP A;  1GUT A;  3PUW A;  1B1Z A;  3U9O A;  2EJG C;  3MWY W;  3SK6 A;  2C5C A;  2K5W A;  1JOO A;  2IPK D;  3O13 A;  1SJH D;  4BS9 A;  1WTP A;  4KMU C;  5C3W A;  1SDF A;  4RFB A;  1EL0 A;  1U9R A;  1R9T B;  4IFD G;  4A3D B;  2EPB A;  4K8I A;  5CBE E;  2D2C C;  5BN3 A;  2AQ2 B;  1J9O A;  2IW3 A;  1PMR A;  2RDG A;  2DNC A;  1CM9 A;  4B9X A;  1X3P A;  3SK5 A;  3PUZ A;  1GHK A;  2F3W A;  2PQE A;  1LT3 D;  3RZO B;  1TII D;  3PMF A;  4G7O C;  4IAL A;  4HED A;  2A6E C;  3K58 A;  1B50 A;  3BVZ A;  2HQE A;  3UI2 A;  4KHZ A;  4FP5 D;  3C2P A;  2F0S A;  3WOF A;  2A69 D;  2NZ1 D;  1LTA D;  3KBG A;  3EFX D;  5D3D A;  3EJI A;  3GP7 A;  1OXV A;  1Z47 A;  1TU2 B;  1EY6 A;  3EVQ A;  3SE0 A;  4HCE A;  3AB9 A;  3URY A;  1A3V A;  1EFI D;  4HAE A;  3Q24 A;  4H7B A;  2RVL A;  5EKI A;  2AUJ D;  4RCO A;  2EYL A;  4EGV A;  5CBA E;  4QUC A;  1ILQ A;  3FEW X;  3R3O A;  2A6H D;  3W3A A;  4QMG A;  2EYH A;  3N6R A;  5JAV A;  1RTO A;  5KND A;  4MHE A;  2NN6 G;  1WTW A;  1O80 A;  2ZXP A;  4C3J G;  4I65 A;  3M4O B;  1HQR D;  4K6D A;  1SXT A;  2AWN A;  3M7N A;  4C3H B;  2EY1 A;  3PV0 A;  1GUS A;  4ZKB B;  3MZ5 A;  4L63 B;  4S3S A;  1HUM A;  3TZU A;  4U67 3;  4A93 B;  2CVR A;  1LTR D;  5FO8 B;  1KTK A;  1D5Z C;  1IL8 A;  2PW7 A;  3Q23 A;  4IN3 A;  3HKZ B;  4ULL A;  1H9K A;  4DAV A;  2KEC A;  1Z6H A;  1LLR D;  1SNP A;  2EVB A;  1PZJ D;  3RUZ A;  3H09 A;  3VR6 A;  3PIP 3;  3HOX B;  1V1O A;  2F0W A;  2WAQ B;  3ERQ A;  1QCB D;  3OIP A;  4UDU C;  1LAC A;  4DK1 A;  5IGG A;  4O1N A;  2FFK B;  1Q12 A;  2K32 A;  1ZEQ X;  1KLU D;  3OMG A;  2B8G A;  2FIN B;  5J22 A;  1R4Q B;  1IKL A;  1V8Q A;  1I4R A;  1JB3 A;  1STA A;  1AN8 A;  1DYQ A;  4Q5V A;  4DFA A;  5EBD A;  3IAY A;  2VNU D;  1TY2 A;  1WTR A;  2F0V A;  1JC7 A;  2F0F A;  1FGB D;  3KUP A;  2VUM B;  1LV9 A;  3G7L A;  4KKS A;  4O42 A;  1F2L A;  2A5H A;  3NK9 A;  3DXJ C;  1M4V A;  5C4J B;  5CGK A;  1LTT D;  4PMB A;  4A3J B;  1MBY A;  1TWC B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...