3VYSA

Crystal structure of the hypc-hypd-hype complex (form i)
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
53
structure length
53
Chain Sequence
CLAVPGKVIEVNGPVAVVDFGGVKREVRLDLMPDTKPGDWVIVHTGFAIEKLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hydrogenase expression/formation protein HypC
publication title Crystal structures of the HypCD complex and the HypCDE ternary complex: transient intermediate complexes during [NiFe] hydrogenase maturation
pubmed doi rcsb
source organism Thermococcus kodakarensis
molecule tags Metal binding protein/transferase
total genus 10
structure length 53
sequence length 53
ec nomenclature
pdb deposition date 2012-10-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.970 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3vysA00
3D3RA 2OT2A 3VYTA 3VYSA 3VYUA 2Z1CA 3VYRA
chains in the Genus database with same CATH superfamily
5C6AA 5C5LA 4A3MH 5CV5A 5HURA 3W5OA 3VR4A 3GTGB 2OWOA 4LF8L 2EJMA 3CKIB 2CW0D 1EOVA 5IT9E 4QY7A 1WD1A 2UUBQ 3BZDB 3QR8A 1ZEQX 1PTOC 4KN4C 2NVYH 4IALA 4RGMA 2XWBB 5IYCH 4C3HB 2K5DA 2F0EA 3HOVG 2JA7G 1PVOA 2A74C 4X64Q 3TZDA 3PQIA 1PH3A 1N36L 4J6HA 4GN3B 1EIFA 3SK4A 4RH6A 4WFN3 2D2CC 1N34Q 2K32A 2KJXA 1PXUA 4C2MB 1FYCA 2IHEA 4ZUJA 2IT1A 4K5XA 1OO9B 2HCIA 2CWAA 4JYAL 5CBAE 1KIXA 4LUOA 2QCPX 4JI0L 2I0QA 5C4XG 3HOYH 3VA7A 3T13A 1LTSD 2E2DC 3S1MB 5LHY1 3H0GG 3FP9A 2B63B 1WJJA 1FNUA 4BY7H 1DZ1A 1BVSA 4GLXA 4MIUA 4A3LG 4DR6Q 5M5YB 4YIJA 2Q2HA 1IBKQ 2DGYA 1AZQA 4OX9L 3BDCA 2P5ZX 1EEID 3CPFA 1U5KA 2EE1A 2E76C 3M85A 4JI5L 1I4GA 4DV0L 3IRBA 2LXJA 2D0OA 1KRSA 3TREA 1KQSA 5EJWA 1D1IA 2RHSB 5F2DA 1I6VC 3GV3A 4KJOA 4QIWE 3ONAB 1EY8A 4X3KA 2H1EA 5A2QL 3TP7A 4L5TA 1ZXTA 5KEEA 3S17H 4UY8C 2PZTA 3K58A 5I2XA 4LFBL 3Q8DA 3G71A 3RMHA 2EVBA 5E4XA 2B8FA 3E6ZX 1G6PA 1TWGB 1QE6A 3KJPA 4B3MQ 3NWSA 4XT3B 1H9JA 2QGQA 4DA2A 1B1ZA 2HDMA 1YI2A 2F3WA 1EY5A 4KK7A 3KDFA 2Q2TA 2YTVA 3K57A 4K8IA 1VMPA 1Z9FA 1V1OA 3K7UC 3TSSA 3E0EA 4GLAC 5CORA 4CBVA 4X64L 3W3AA 3A56A 2RHQB 3CCEA 1SYFA 1N34L 1TR5A 2JA8H 3KJOA 2PPBC 1HH2P 4F7XA 1P16A 1IW7C 1E7ZA 2V1CC 2L11A 3M3YH 1SSOA 3GTOB 2EPBA 1VDZA 4C3IB 3I4NH 1NSNS 2JN4A 4FXKC 1EIYB 3HOWH 2RDHA 1PFBA 5C0XH 4A3BH 5C3WA 4A3EG 3PIPA 1NR2A 4G7ZC 4DR6L 1K83B 2F3VA 4UP9A 1F9PA 3I72A 1QWYA 1S3OA 4ZLTF 1SMYC 1K9MC 1TS4A 2NVXH 4POGA 4DR1Q 4E6IA 2K01A 5M3FG 4AYBE 5K36G 1SE4A 1B3AA 1CZGA 3MA2B 1PV4A 3I70A 1GHJA 5I9PA 4JOIC 1C8CA 2XN9C 4A3MB 5DLQE 1TS3A 2JQOA 3ULJA 2ID0A 5G3LD 1CT1D 2XVSA 2UXBL 1LM0A 5J22A 4NDXA 3S1NH 3FVQA 1J5EQ 2RF4A 4HN7A 3PV0A 4ODGA 1BR9A 1N8RC 4ZCKA 1RL2A 1TU2B 4F87A 4DAYA 4RMFA 1RDPD 1N33Q 1I4XA 4A3JB 1CUKA 3PSIA 3OMGA 2NVYB 1DGSA 1AFPA 3NEMA 1MIUA 1N9WA 5IGEA 4B3ML 2FXQA 3L9AX 2JP1A 2F0IA 2B2VC 1SDFA 1NNXA 3K5NA 3I73A 2NZHA 1L2FA 3D31A 1STAA 5JJLA 1PFSA 3N52A 2NN6I 2VQEL 2IY5B 4GKKQ 2F0VA 3M4QA 4HSPA 3DM1A 5FO9B 4A3FG 3DWQA 2ZJQA 4F88A 3N6RA 2D62A 5ELDA 3PUYA 1WCMG 4OIKA 3K5OA 3GDEA 4BA2I 2L1BA 4BY7B 2IX1A 1EYGA 4DK1A 2MHVA 3NENA 1H9KA 3HZXA 4K0KQ 1VQFA 5M3MH 1HNXQ 3BJUA 1EU4A 1I6HH 1RTNA 2HQLA 2EQSA 3SEBA 1ILPA 1EY6A 5GROA 3O13A 1AEXA 4IUQA 3HOXH 2HHHL 5EGTA 4DR1L 1TWFH 2YV5A 2IHFA 2WKDA 5M5WH 2K52A 1MI2A 1Y1VH 3P1HA 4TKOB 2YU9H 1EZ8A 2CH4A 2AQ1B 2RDGA 1EU3A 4EQNA 1STHA 4J15A 1PH5A 1C4QA 1VQIA 2K28A 2PO4A 1CTMA 5DEHA 4CHTB 1NAPA 1LUZA 1VQ8A 4FF3A 4A3KB 3BDOA 3S2HH 1P8LA 4QUCA 3K5LA 3HOVH 2KVMA 4PMWA 1WTWA 2JA7H 4IJLA 1PH6A 3I7FA 5JJKA 5FK9C 1EWCA 3RNUA 1AN8A 2E8GA 1UUPA 2N8NA 4R8NA 3NQIA 3HOUG 2F1MA 5C4XH 4HMIA 2JA8B 1JT8A 4C1NK 5E1FA 1HZAA 3J7AF 5CBEE 3H0GH 4JG2A 4JOIA 2JA5G 3PCOB 3M3YB 1AE2A 2PI2E 1STBA 4H44C 2E2HH 2LS01 3VYTA 4HIOA 3I4NB 4G57A 3U4ZA 1EQVA 1IBLL 1LTLA 3V05A 4XYQA 2QILA 1S5FD 1QUQB 1CK1A 1IXRA 4IPDA 5M5XB 3TP6A 1M90C 2OF1A 3CC7A 3TS2A 1Y8OB 3RN5A 2VY3A 3CCQA 2NVXB 2L55A 5CYUA 1GVPA 3CMAA 2BE5C 4IUNA 3AEVA 1YNND 3MXNB 3S9WA 3I4OA 4J1MA 1E22A 4LMQD 2HD3A 4PMCA 3Q22A 1JWSD 4GZYC 1FD7D 2EJFC 2XTIA 1ML0D 1LT3D 2A1AA 1V9PA 3U58A 4JW0A 1F9SA 4YY3L 2AHOB 2KA7A 1TT2A 2K6AA 2NWGA 1EFID 1WTQA 2WB1B 3MZ5A 1I94L 1JMCA 3A5ZB 2UXCL 5IYDG 2EZVA 4QMGA 1DCZA 1WFQA 5C0XJ 3L3OC 3Q0AA 4P75A 2SEBD 4AIMA 4IFDH 4RFBA 3HEJA 2HIVA 1HNWQ 4DR2Q 1LABA 1Q86C 4A93G 4O2DA 3CMEA 5C3EG 4DUYL 1WTRA 3BVMA 5I6WA 1IYJB 3SHLA 3BVZA 1V1PB 2Z6KC 4KLKA 2Q8TA 1JOQA 3M9BA 1SMXA 1N32Q 2UUAQ 2DJFC 1E3PA 2DY8A 1E24A 1U4MA 1KLGD 3KBGA 5M3MB 3HP3A 4B08A 4XTCS 3R93A 1I6HB 3G6JB 2HDLA 2SOBA 4QUFA 1FGBD 3NPPA 1VQEA 5C3XA 3Q24A 4HCSA 1PYSB 3GTJH 1C48A 4KTAA 3HOXB 4PMBA 1HA5A 4DKAC 1TWFB 3CCVA 2F4VQ 5M5WB 4GN4B 1Y1VB 3TP8A 4LNQA 4A3GG 4JI4Q 3STBD 1SYCA 2YU9B 3ICEA 4KY5A 1EY9A 2Q8RE 1EQQA 2PW5A 2Z4HA 4RHRA 3S2HB 3HOVB 2JA7B 4QL5A 3S15H 4AYBG 2CW0C 3I91A 3CHBD 3BS1A 1RTOA 3HG9A 4LFCL 3EA6A 5A2QE 1MGSA 3CCJA 5C4XB 4CDDC 1ESRA 3ERQA 3ND9A 2A8VA 4A3FH 2WP8J 4DN4M 1X65A 1HNWL 3H0GB 3A7LA 1UEBA 1A2TA 3U9SA 1H9SB 2F0PA 1BXTA 2WFWA 5EKKA 3A8IE 1ICWA 4DAYB 4ALPA 4JI6Q 2A6ED 2B2UC 1SFOH 2UUAL 1JC7A 1QJOA 2KENA 2XGTA 3C3LA 3ZJYC 2VB2X 1K0SA 4HTHA 3VR2A 5IODA 1KD1C 1KAWA 1SJED 3QOLA 4DR5L 1G6ZA 2KEDA 3C1FA 3AB9A 2NBFA 2RSOA 1VQJA 4JI7Q 4KV6A 1EOTA 4OEMB 1CKNB 4IUTA 4NPSA 4IURA 3LGJA 3L7ZC 1HNZQ 2AMCB 3M4PA 5EQ0A 3OOCA 2F4VL 3EJIA 2EDGA 3S1MH 1AH9A 4H13C 3BU2A 5IP7H 1TKWB 3HFZB 4JI4L 1W3SA 1PYWD 4L6TB 2R93G 3R8BA 1TS2A 3CC2A 1B70B 3J80i 4BXXG 2HCCA 1U4PA 4ME3A 4JK1C 2EY5A 5CV6A 4LF9Q 2OXPA 1VQ6A 3HOUH 5IGBA 4JCVE 2QEJC 1CZWA 1S5CD 4G4KA 1LTID 1HXYD 3HOZG 3MEFA 3RZOB 3U4VA 4JI1L 3QJYA 1LT5D 3DWPA 3QG1A 2O4XA 2Y0SE 1VQDA 4KHZA 3PIOA 1J8IA 3MVVA 4GNXA 4GOPC 1D6EC 4BS9A 1EWHA 2RQXA 1D5ZC 1SNCA 3QOJA 2BCOA 1VF7A 4JI6L 2R92G 2L15A 1I50H 2B2YC 3W2DA 4HIDA 3KF8A 3CP0A 4CDEC 5M3FB 2F0UA 3GTJB 2M9VA 2EYLA 2JK8A 4KKTA 5HY6A 4JYAQ 3E3XA 3CU7A 2PNRC 4LAAA 3J80c 4JI7L 4IFDJ 2XIWA 1OXUA 2AUKA 3V96A 1VS0A 3C1EA 5IYBG 2PQAB 2EYMA 3LX0A 4F8MA 1K3BC 3UE1A 1AW7A 1B8AA 1VQGA 2B29A 3GTPH 1GM5A 1JB3A 1ZKOA 2OT2A 1GO3E 1LT4D 4B9XA 1X3FA 4OX9Q 1MSGA 5COYA 4OXPA 4PG3A 5IYDH 4CKEA 2VQFL 3QO2A 4QB4A 1JWMD 4JI5Q 2YYZA 5I9OA 2MUYA 3PIP3 1EL0A 2OTLA 4GN5A 4LF9L 1JCKB 2NB0A 5C3EH 3KLSA 4A3FB 4IO9A 3S2DH 4LFBQ 1WCMB 3FHWA 2XNAC 3CAMA 4DV7L 1HZCA 1SFOB 1BDOA 1WTHA 2N78A 2IJ0A 2K33A 4P74A 3JAMi 1BBWA 4A3JH 1TS5A 4I65A 2JXMB 3BG3A 1A6XA 1L1OB 4NMZA 3KLWA 4FF4A 3KLSX 1QG7A 2PMZB 1STYA 3I90A 4CKBA 1VQLA 3VYRA 3RZDH 2J4XA 2A19A 3D8GA 3IAYA 4A3GH 1NE3A 4Y52H 3FPUB 2F0OA 1IYUA 3M4YA 3J7A5 3AQQA 2MP1A 3EIVA 4XQNA 1GUOA 5CV7A 3CD6A 2N3SA 4GOPA 4QGUA 4LF6Q 1YBYA 4DFAA 4R8IA 4A3IG 5G3LF 4PZ6A 2NTTA 2BDNA 3RLOA 1A3TA 2B2YA 2BA0A 3HOUB 4DUZL 1J6QA 2A68D 2RSNA 1QNUA 5BN4A 2EY2A 2PI2A 2RCFA 3MEHA 4I7AA 4Z9CB 2CKZB 3A54A 3ER0A 5JEAJ 2QW7A 2JA5B 1AZPA 3GV6A 3JAMc 4U673 3M4OH 5J39A 1SYEA 1KC8C 1PRTB 2UXBQ 4K14A 2C5CA 1T5XD 3T16A 1SN8A 1W2BA 4FF2A 5JVH3 3E0JA 4ZKCB 1CI3M 4Y7NH 4WJ3M 1S5BD 4A3KH 4KD4A 3KF6B 4C56C 2VZAA 1I50B 1PTOF 2JYOA 3TP5A 1FGUA 2FJ2A 2V4DA 5FLMG 1B50A 2JA6H 2AWOA 5C0XI 5CV9A 2VQEQ 3VA5A 1BCPB 3K8AA 4CDCC 3J80L 2VW9A 2SDFA 1EY7A 5FO7B 1A63A 2RDFA 4YWMA 1WVLA 4CDFC 3D6WA 3FKIG 1Q46A 2ICEC 5ELOA 1OXVA 4DK0A 1I4HA 1YNNC 1JJCB 3GTPB 1VQ9A 2BOSA 2I07B 1OXXK 3SK8A 1G51A 2XRSD 1F2ZA 1V1QA 1DOLA 3MXPA 1OXSC 4A75A 1YHAA 1PZJD 5M5XH 1PH7A 4DNTB 4LF6L 2RVLA 1I4QA 2K50A 3MTSA 3I56A 2HHHQ 1VQCA 1KL9A 1GOZA 4DV3Q 4EQ5A 3GTLH 5C3EB 1IHZA 2QEXA 1VQMA 3D4WA 2PYKA 2RCNA 4AQYL 3S2DB 5M9OA 2QKIC 4LW1A 1LO5D 4HJ5A 5L37A 4PNYA 3CCLA 2AQ2B 1QZHA 4B3RL 4OO1G 1LTTD 3U9OA 2CFMA 1T5EA 1Q90A 1ONLA 2MNAA 3J7YW 4B3TL 1ENCA 2M00A 1PH8A 2FINB 2EYHA 1HJPA 2RBMA 2GVBA 3W1GA 2A5HA 5K5PA 3CC4A 4A3DG 5CC4A 3RZDB 2R7DA 2DNCA 2Y0SG 4N8FA 1TWHH 4NXML 4A3GB 5IYBH 1Y1WG 1YJ9A 3TMEA 2KCMA 1QVFA 2MJ8A 1IBLQ 3K5MA 4HJ8A 4GNXB 1KXLA 1S5DD 3OIPA 5H1SE 3G6EA 3DEOA 4FO2A 3H3VH 2KQ3A 1C7YA 3STBC 4AYBB 2MFIA 4IOCA 4EVOA 4ABNA 3KF8B 2F52A 4BY1G 4YHHQ 3BZCA 1WTOA 2F0SA 2DUDA 4HR7B 2R7ZG 4B3SQ 5CMDA 3CQZB 3GD7A 4ZAIA 3ULLA 1LV9A 2I46A 4ZKBB 3JAML 4QQBX 1WTPA 1B4OA 1PHJA 4DV3L 4TQUS 3M4OB 2O5IC 3CF5A 4RG1A 1VQBA 3J7ZC 5C4ZA 3CRLC 2UU9Q 3G7LA 3IFDA 4OGQC 4YY3Q 4L5SA 2K7VA 4Y7NB 1GJXA 4C3HG 5LL6X 3DXJC 3AFPA 1M4VA 3UDXA 1I94Q 2UXCQ 4RCOA 2CCZA 1HA6A 1PTOH 1SNPA 3OSOA 2N55A 4IPGA 1SNQA 4P2CB 3GTKB 4JBWA 2K5VA 2A6EC 4QCLA 2JA6B 1HTPA 2KCNA 3UDIA 1L0XB 1X55A 5T1GA 3FEWX 4LFAL 4OHJA 4DUYQ 1YNJD 2AWNA 3F2CA 1Q8IA 1YNXA 3F8TA 3M7GA 5FLXc 1L0YB 1C0AA 5KIXA 4RA8A 1SJHD 2JEAI 1CHPD 3PF5A 3DM3A 2F0TA 4KMUC 1JB7A 4A3LH 1VQHA 1X3GA 4GKJL 1KDAA 5GADC 2BDOA 3R2IA 2I5HA 4A3IH 4IN3A 5LMUQ 1BO0A 1Q1EA 4LF5Q 1UE7A 3NBHA 3V2TA 1CA5A 1K8AC 1SE2A 3H09A 4CKCA 2UUCQ 2B2TC 4YHHL 1ZYRD 2B2VA 5IGDA 5IGGA 4LF4Q 3GTLB 4WJ4A 3SDZA 3HOZB 4LUVA 2K05A 1GXDC 4B3SL 1NMGA 1I3QH 1VMCA 3RD4A 2F0MA 1T9HA 4LF7L 4BBRG 2VB3X 3OW7A 1UE1A 4UP8A 4IFDI 1X54A 2WKCA 5FOBB 1Z6HA 1A2UA 2Z0SA 1LTAD 2N88A 4RKLA 2UU9L 1HQRD 2R92B 3ZYYX 4DXGA 3G4SA 3I4MG 4O0AA 2Z4IA 4RAUC 5FLMH 5DM73 1SLJA 1XPOA 1Y8PB 2IL8A 2XWJB 1A3UA 3KUPA 4LFCQ 2CHBD 2MO1A 4JI8Q 1VQPA 4DR4Q 2EXZA 3CXCA 4AH6A 4X3UA 3BYTB 1IL8A 3GP7A 1BF4A 1B9NA 4CJ1B 4DU9A 3FKIH 1K28A 1EWIA 1TWHB 3MXUA 2ASBA 1SE3A 2MGSA 1FNWA 5KNDA 3RZOH 3FDTA 1CM9A 4ZUIA 4DV5Q 3K80C 2QA4A 3A74A 3S24A 2SNMA 3VR5A 1GUTA 2CQOA 2JE6I 4TVAB 4A3EH 2E5LQ 4HJ7A 5DM63 4G7OC 1JJ2A 1U4LA 2E75C 2OEOA 4QF4A 4ZQ3A 3PIO3 3TRZA 3X3MA 2QDBA 1XNQQ 4L5RC 3KDFB 4DR5Q 5LMUL 3NTKA 5D65A 3K6OA 4LF5L 3S16B 5M3FH 2KUMA 1LTGD 5K36H 2FMMA 4C3JG 1UE6A 5JAVA 1K3RA 3SK5A 1JR0D 2ZJRA 2UUCL 3HKZE 3PO2G 1B2TA 4LF4L 2Z8LA 2ZXRA 2RKSA 3TDQA 4FXGC 4OO1H 3CCUA 2K4KA 1Z47A 4WJWA 4DV4Q 1XJVA 4LUZA 4MHEA 2K5NA 2VNUD 4DV1Q 1CQVA 2AUJD 2NVTH 1HHVA 1PTOB 4H02A 5JVG3 4OIJA 2G9DA 4K6LA 1JWUD 3EFXD 1FL0A 4A3DH 1RHPA 1EYCA 2DJGC 1CSQA 1Z7TA 3HOYG 4JI8L 4DR4L 1U9RA 1Y1WH 1QILA 4JI1Q 2QF7A 1ASZA 5FLXL 2DN8A 4U68A 4JBJA 3NELA 3MXGA 1QCBD 2L5TA 3NE5B 1WCMH 4J8QA 4LK1C 5JPNC 5D3IB 2F0FA 3I55A 2WAQE 4DV5L 2SNSA 2Z1CA 4KHVA 5AFWA 4A3IB 3DUZA 5EBDA 1HZ9A 3T53B 1KAAA 4BY1H 5FO8B 2E5LL 3RLNA 3J81j 1C9OA 1SNDA 1EIHA 1IKLA 1LTBD 3J80E 3T56B 3H6MA 4IUVA 4MN3A 2A6HD 3U50C 4FXDA 1DM0B 3MC0B 2MO0A 3F1ZA 4IUPA 4IPHA 5E7NA 1A0IA 1XNQL 3I8ZA 2F0KA 2ZXPA 1LYLA 1FJGQ 3R3OA 1I3QB 1H95A 3OHXC 2K03A 2A68C 3VYUA 3A8JE 4HJAA 5BN5A 5I4DA 1RCVD 2Z6KA 1I4RA 1CA6A 1F9RA 2B39A 4X62L 3CPWA 3DEPA 5IGFA 4DV4L 2VQFQ 1IBMQ 1EY0A 4JI2Q 1PRTD 2UXDQ 4DV1L 4KY6A 3A5UA 2PQEA 3PO3G 5BR8Q 2JA9A 3D6CA 1PH2A 5IIFA 4XIGS 2YTYA 3FKIB 2ZJPA 2FFKB 4H0LC 5J1ZA 1HRJA 1F2MA 1HUMA 1STGA 1SYDA 1TVXA 4X3TA 2JA5H 1JQYD 3NQTA 4MNOA 3HOWG 4DV7Q 2DNEA 5C0XG 4A3BG 2NZ1D 1LT6D 1BCPD 4B9WA 5EAYA 2KHIA 3KLRA 1DXMA 4BBSG 4DNIA 4A3EB 2Z6BA 3UDGA 1S72A 4A4IA 2YTXA 1YZ6A 5ELBA 2L4NA 5C4HA 3BYYB 1ENFA 3K81C 4O42A 2MPMA 1XX8A 5EBCA 3TN2A 1E2WA 2H5XA 4RKBA 4BBRH 3OTOQ 2VUMG 1CQFA 2L9HA 1R4QB 3S1RH 3NUCA 3DLLA 2G9HD 4RGOS 1PH1A 1FJGL 3RLFA 4LJZC 1ICFB 4DGZA 1R9TH 2OQ0A 1HPCA 4DAVA 1HR0W 2F3IA 3TQYA 4MTKA 4KN7C 2F0NA 4K2KA 2E2IH 2E2JH 3I4MH 1UNSA 1TWCH 3TZUA 2NVTB 1Q3LA 3A0JA 1RKNA 4K6DA 2KEEA 3NHHA 2B2UA 3NK9A 1IBML 5ISRA 4DUZQ 3T4AC 2HUGA 4YWKA 4JI2L 5J3BA 2UXDL 4A3DB 3JAME 3NTHA 5GAEC 2Y0SB 5BR8L 5JJIA 4A93H 4R4CA 3VR6A 1Y1WB 5JJZA 2IWHA 3T1YQ 3WDNA 1QZGA 4UHVA 2XRQD 2E74C 2N49A 3B6YA 1KDCA 5T1IA 3NWTA 1O78A 4DV2Q 3HS0C 4DK3C 2NN6G 4YCUA 3NSWA 1TWAB 1PYBA 2ZT9C 1IKMA 2ATWA 1NTGA 1NR4A 4BY1B 3BVGA 2BA1A 2LXKA 3S1QH 3KOJA 1STEA 2R7ZB 1EY4A 1JOOA 2O2LD 1H9MA 1ILQA 4C3JH 3EQLC 4OONA 4YCWA 1SXTA 1WD0A 3PO2H 3MAQA 1Y1VG 1KABA 4ID6A 3UI2A 1EQTA 4Q5VA 4JV5L 3BDLA 3ND8A 4DAMA 1K8MA 4N9PA 1FNVA 1FR3A 3E9HA 4R4IA 3OTOL 1XWEA 2K5HA 3EVQA 4C1NI 2ALYB 1MHWC 3H91A 1Q1BA 1QUQA 1WYDA 1MJCA 3I4LA 4XYOA 4JBKA 5DAUA 3J7AV 2HQEA 4O1NA 1PZKD 1F77A 1X6OA 1V43A 2JSOA 4DK6C 3HKZG 4X65Q 3MXNA 4ZK9B 1EFWA 4IOAA 1KLUD 3NTIA 3QWNA 2EYPA 2EOTA 4AQYQ 3CQZH 2BH8A 1GD7A 2PNHA 1PFMA 1NUCA 1AP0A 2L0CA 1WI5A 2NYZD 2X6GA 1B53A 2IX3A 3TS0A 3T1YL 3S14H 2EYOA 4IQZA 4B3RQ 5IY0A 1YNJC 1JOKA 3AYHB 2Q8IB 1SRUA 3A7AB 4DV2L 5TSSA 1VQNA 4B3TQ 5IWAL 2OTJA 4R4QA 1W6JA 1G8ZD 4FVMA 2LMCB 1M8AA 4OL7A 1TIID 5IOCA 2R7FA 1IYVA 3GTKH 1CSPA 2PZWA 2LKVA 1IZ6A 1GKHA 4N8X1 1B3QA 3GTQH 3HKSA 5GAGC 4NXMQ 2D5DA 3I3CA 2AKWB 2H4OA 1V1PA 4APVA 2KHSA 4BBRB 1HUNA 4UDUC 4KY7A 4PZ8A 3S1RB 3J81E 3SK6A 2LY7A 1ZYRC 2WAQG 4H7BA 3PUVA 4FDBA 4XQJA 1R9TB 1D8LA 5NUCA 4DPGA 2UUBL 1DOKA 2R93H 5IT9c 3M7NA 4M1UB 5LMNQ 3VYSA 1TQOA 3BZKA 4BXXH 2E2IB 3I4MB 2E2JB 2EYFA 3H15A 4DR3Q 3ULPA 1TWCB 1BUVT 4UPAA 4IFDG 3PO3H 3MFYA 1JICA 4QIWB 3SE0A 1WOCA 3SVMA 4GS3A 1SE8A 4Q0FA 3PUXA 4NKLA 1KHIA 1RD9D 3LNNA 4X65L 3CCSA 3J81i 1BOSA 1ET9A 1G291 1PH4A 4A93B 1NBWA 5KYLA 3HOZH 2IPKD 1IL2A 1DD2A 5I6YA 3TEHB 4X6AH 4YWLA 1L0WA 3C46A 4R1JA 5C5MA 4BBSH 4K5VA 1QVCA 2F0JA 2PZUA 1IBKL 2CQAA 1MD2D 1PLFA 4KKUA 4P73A 3FPPA 1MJEA 3F2BA 2FMCA 2KECA 3URYA 2R92H 2K75A 1O7IA 1HZBA 1A62A 1YVCA 3S1QB 2K5QA 4NB3A 5JOBA 2HT1A 3GTMH 1HR0Q 3OYYA 3D3RA 4C3JB 2GA4B 2NTSA 3H3VI 2A69D 2J7ZA 4LFAQ 4EQOA 3PO2B 2KOLA 5FLXE 1XPRA 2VUMH 2ZTEA 3VR3A 1H9SA 1VQAA 4K5WA 1K73C 1HCZA 1I4PA 1OXTA 5KNBA 4FNFA 2K1BA 3P7JA 1ET6A 2J0TD 4RWSC 4UP7A 1XXGA 2C35B 4GKJQ 4KJNA 4KD3A 4K2LA 1D7QA 1Y69U 5C44G 1EQRA 3J81c 4EX5A 1SR3A 5EPKA 5LMNL 1G2TA 1F9QA 3T1HQ 3IL8A 4DR3L 4A3CG 4POFA 3MFGA 1CKNA 2EXDA 2PCFB 1EEFD 4TSSA 1B44D 3P75A 5IP9G 4DF7A 4OWWB 4HIMA 4PZ7A 3HOYB 3LWEA 3S16H 3OWFA 1XMOQ 4HCEA 1PTOD 1HFNA 1II3A 1Y8NB 4LF7Q 5A35A 3C2PA 2VL6A 1RF2D 5FJ8G 3F2UA 3KYHC 1EUJA 3SXHA 1Q12A 3A55A 3S14B 2F0HA 4RGTA 3K7AH 4HEDA 2KBNA 2NN6H 1KTKA 3K0YA 1L1OC 3WOFA 4XXEA 4TRDA 4OWTB 1S5ED 1VCIA 1PFNA 4KI0A 2VXWA 1XPUA 5JEAG 3JC66 3D0FA 3KK7A 2R6GA 1SNMA 1JJGA 1HR0L 3GTQB 3S17B 2TMPA 1XTCD 3DWAA 4CJ2C 3NP8A 1ENAA 1AE3A 3QB3A 2B2WC 1KRTA 2ICIA 3PGZA 1S4ZA 1K8OA 1CHQD 4LWCA 3PF4A 2A6HC 5IP7G 2KCCA 5KRUA 2B63G 3UDFA 5ELEA 5IT9L 3GQBA 1J5EL 1DYQA 1SYBA 3L0OA 2B3GA 2R93B 3F2DA 1N33L 1CFMA 3AU7A 1E2VA 4HSVA 2D9UA 3G48A 3PO3B 3MHBA 3HGBA 2WB1E 3DHQA 3T1HL 4KKSA 4GKKL 4DAPA 2EJGC 1GUWA 2EY1A 1I5FA 4HMJA 5EPJA 1PRTC 3NXWA 2PQAA 5ELNA 5EPLA 2NVQH 2LSSA 1XMOL 3K0XA 3HOWB 4X66Q 5KGUA 2XSCA 1YEZA 4A3BB 4XDXA 1O80A 3P20A 2OCEA 1E2ZA 5CR3A 4A76A 4BBSB 1G2SA 4K0KL 1SAPA 1GUNA 1GUSA 1HNXL 3MWYW 3UE0A 4GOPB 2WINB 3I2ZA 1DONA 1BCPC 1IW7D 1D5XC 1ASYA 5C4JH 3GTMB 2VS1A 1DJRD 3OPOA 5CV4A 4R4OA 4CGYB 2X6LA 2ENBA 1SEBD 1VQKA 4IJHA 1EYAA 2VUMB 3CRKC 1BBXC 1F2YA 5D3DA 1HFGA 1UWVA 1QNKA 4MTNA 3S1NB 5E4WC 4C3IG 1SMYD 1VF5C 2F4IA 3E5SA 3R2TA 1M1KC 2BH2A 2K04A 2IW3A 5BN3A 3J81L 4RCNA 1Q8KA 5HGQA 1RODA 2F0LA 1D1KA 3A8KE 1U4RA 1F2LA 1L1OA 1PMRA 3PUZA 3OMCA 2ZM6Q 3RN2A 4OO1I 2K14A 1VQ4A 1LLRD 1Y14B 4PV1C 4QJFA 4JI3Q 1D2BA 5I2YA 1A15A 4ZRZA 3ERSX 1H9RA 2ZTCA 3LWUA 4HJ9A 3HRZC 2G5DA 3KFUA 4JC0A 4A3MG 4DR7Q 1XTDA 2F0GA 1PRTF 1B9MA 2EY6A 2B2WA 1KDBA 5EKIA 5AJ3Q 2CWPA 3ITPA 1TY2A 5KYIA 5KNCA 3K7AB 4X66L 1KNAA 1X32A 4X62Q 4XQQA 4FYDA 1RJTA 2EIFA 3EBEA 4A3JG 1LTRD 3RUZA 5IYCG 4FF1A 1VQ5A 2JJQA 4DV6Q 2X69A 4P71A 3KBXA 1YJWA 3T51B 5ELCA 3WOEA 3QIAA 1BCPF 1QVGA 1X56A 1A3VA 1UE5A 1R4PB 4JVZA 1JORA 3W1BA 2NUCA 1O7YA 2F03A 1CKOA 1ESFA 1VQ7A 1BQQT 2B2TA 5CGKA 2WV6D 3OIQA 1EZ6A 2ZXOA 1A8VA 1SROA 1UAPA 4XT1B 4GNXC 4V190 1VQOA 2GN5A 2WACA 4KHPQ 2CH4W 2MQHA 4ULLA 2HIXA 1WTVA 3VDYA 1D5MC 4BY7G 2L12A 1X3PA 4X3SA 4DNRB 5C44H 1K8GA 1XNRQ 3AMUA 1Q82C 4L5QA 1MBYA 1EIGA 1SNOA 3KF6A 1XMQQ 1STNA 3Q6SA 4L8JA 4DXFA 4V0BA 4RHSA 1TWAH 4BA1I 4A3CH 4FP5D 3HKZB 4NW2A 5CV8A 3H94A 1EYDA 1SYGA 5IP9H 2ZM6L 4N9TA 2R7ZH 4DR2L 1S40A 1NY4A 2QDLA 3X3NA 4JI3L 3PUWA 1PDQA 3IKJA 3GTGH 2E2HB 3E9IA 1PH9A 3WWVA 2NVQB 5FJ8H 4IZ8A 2I5MX 1E1OA 2RA4A 4DR7L 1N32L 2KHJA 1QB5D 4NXNQ 2Z9HA 4JPBW 5AJ3L 3CW2C 2OQKA 4A3KG 4IUUA 4K8JA 4C3HH 4OELB 1JE4A 1J9OA 1YHQA 5JEAH 3FRPB 1XYIA 4YCVA 5JPMC 4L63B 4UAIA 3FMCA 1TY0A 1OTCA 2JA6G 4C2MH 5C4JB 3EN2A 3L2PA 4DV6L 3OW2A 2B8GA 1KNEA 3SR1A 2KCTA 4ILWA 4HAEA 1QOHA 2F0QA 1O7ZA 2JA8G 1YHBA 4S3SA 5GAHC 1W6KA 1JE5A 4GLVB 1BNZA 1X3EA 3RR5A 2GVAA 2WAQB 3D4RA 2D0PA 2B63H 2A73B 5LMNW 2K5WA 3I4NG 4R9WA 5M5YH 4ZYSA 1MKHA 2LFNA 5EKLA 4KHPL 2BE5D 1PA6A 5IGCA 3CCMA 4PQXA 4ME5A 1DOMA 2O5JC 1WTXA 1LACA 1G91A 5IE8A 1XNRL 2M2LA 2R3ZA 4EQPA 1XMQL 3OWEB 5DNFA 1PZID 4LF8Q 3D4DA 2F0DA 2Q2IA 1B7YB 4I7ZC 4JV5Q 1GUGA 4P72A 4BWGB 4OWXB 2JEBI 4NP5A 1NMFA 1NJIC 4M8AA 5GQOA 2DY7A 1TWGH 2PW7A 3DMUA 1BKBA 3GO5A 3IFTA 1YITA 2AQ3B 1TXYA 4R4TA 1N36Q 1Q81C 3K59A 4NXNL 2WB1G 1CKMA 3NBIA 3CCRA 1V8QA 4CJ0B 1K0RA 3AFQA 3SGIA 2CVRA 3EROA 1YJNA 3NBHB 2NZOA 4MZ9A 5ELFA 4JI0Q 2WIIB 1GHKA 1FVIA 2ZTDA 1E1TA 1MSHA 1U0LA 4G7HC 3PMFA 3TBIB 1HNZL 2PMZE 1X9NA 1HTLD 3GTOH 4C3IH 4HIKA 2ES2A 3H3VC 2A69C 4IPCA 2I5LX 5FKAC 2R61A 1RIPA 5LL6S 1UEAB 2FHTA 1SBBB 2EYJA 3S15B 1NCVA 2C9OA 4WORA 5C44B 1O7LA 1K83H 5M3MG 4DV0Q 5IWAQ 2TSSA 2Q2UA 4EGVA 2IX0A 3Q23A 1X3QA 1Q7YC 5HGTA 5D14A 1BBUA 1YIJA 4RGNA 1E0BA 5E3FA 4JBMA 2F0WA 1HQMC 4WRDA 3HOXG
chains in the Genus database with same CATH topology
5C6AA 5C5LA 5CV5A 5HURA 3VR4A 3GTGB 2EJMA 3CKIB 2CW0D 5IT9E 1WD1A 3BZDB 1ZEQX 1PTOC 4KN4C 4IALA 4RGMA 2XWBB 4C3HB 2K5DA 2F0EA 2A74C 3TZDA 4J6HA 4WFN3 3SK4A 4RH6A 2D2CC 2K32A 2KJXA 1PXUA 4C2MB 1FYCA 4ZUJA 2IT1A 4K5XA 1OO9B 2HCIA 5CBAE 2QCPX 3VA7A 3T13A 1LTSD 2E2DC 3S1MB 5LHY1 2B63B 1FNUA 1DZ1A 5M5YB 4MIUA 4YIJA 1AZQA 3BDCA 1EEID 2EE1A 2E76C 3M85A 1I4GA 5EJWA 1D1IA 5F2DA 1I6VC 3GV3A 4KJOA 3ONAB 1EY8A 4X3KA 2H1EA 5A2QL 3TP7A 1ZXTA 5KEEA 2PZTA 3K58A 5I2XA 3RMHA 2EVBA 5E4XA 2B8FA 3E6ZX 1TWGB 1QE6A 3NWSA 4XT3B 1H9JA 4DA2A 1B1ZA 2HDMA 2F3WA 1EY5A 4KK7A 3K57A 4K8IA 1VMPA 1V1OA 3TSSA 5CORA 4CBVA 3W3AA 3A56A 1SYFA 1TR5A 2PPBC 4F7XA 1IW7C 2L11A 1SSOA 3GTOB 2EPBA 1VDZA 4C3IB 1NSNS 4FXKC 2RDHA 1PFBA 5C0XH 5C3WA 1NR2A 4G7ZC 1K83B 2F3VA 1F9PA 3I72A 1QWYA 4ZLTF 1SMYC 1TS4A 4E6IA 2K01A 5K36G 1SE4A 1B3AA 1CZGA 3MA2B 3I70A 1GHJA 5I9PA 1C8CA 2XN9C 4A3MB 1TS3A 2ID0A 5G3LD 1CT1D 2XVSA 5J22A 4NDXA 3FVQA 4HN7A 3PV0A 4ODGA 1BR9A 1TU2B 4F87A 4DAYA 1RDPD 1I4XA 4A3JB 3OMGA 2NVYB 1AFPA 5IGEA 3L9AX 2JP1A 2F0IA 2B2VC 1SDFA 3K5NA 3I73A 3D31A 1STAA 3N52A 2NN6I 2F0VA 4HSPA 3DM1A 5FO9B 3DWQA 4F88A 3N6RA 2D62A 5ELDA 3PUYA 4OIKA 3K5OA 4BA2I 2L1BA 4BY7B 2IX1A 4DK1A 2MHVA 1H9KA 3HZXA 1EU4A 1RTNA 1ILPA 3SEBA 1EY6A 3O13A 1AEXA 4IUQA 5EGTA 2WKDA 1MI2A 3P1HA 4TKOB 1EZ8A 2AQ1B 2RDGA 1EU3A 4EQNA 1STHA 1C4QA 2K28A 2PO4A 1CTMA 5DEHA 4CHTB 1NAPA 4FF3A 4A3KB 3BDOA 4QUCA 3K5LA 2KVMA 4PMWA 1WTWA 5FK9C 1EWCA 1AN8A 1UUPA 4R8NA 3NQIA 2F1MA 4HMIA 2JA8B 4C1NK 5E1FA 3J7AF 5CBEE 3M3YB 1STBA 4H44C 2LS01 3VYTA 3I4NB 4G57A 1EQVA 3V05A 4XYQA 2QILA 1S5FD 1CK1A 5M5XB 3TP6A 2OF1A 1Y8OB 2NVXB 2L55A 5CYUA 2BE5C 4IUNA 1YNND 3S9WA 4J1MA 4LMQD 4PMCA 3Q22A 1JWSD 4GZYC 1FD7D 2EJFC 1ML0D 1LT3D 1F9SA 2KA7A 1TT2A 2K6AA 2NWGA 1EFID 1WTQA 2WB1B 3MZ5A 2EZVA 4QMGA 1DCZA 5C0XJ 3L3OC 3Q0AA 2SEBD 4IFDH 4RFBA 3HEJA 1LABA 1WTRA 3BVMA 5I6WA 3SHLA 3BVZA 1V1PB 2Q8TA 1JOQA 2DY8A 1U4MA 1KLGD 3KBGA 5M3MB 3HP3A 4B08A 4XTCS 3R93A 1I6HB 3G6JB 2HDLA 2SOBA 4QUFA 1FGBD 3NPPA 5C3XA 3Q24A 4HCSA 1C48A 4KTAA 3HOXB 4PMBA 1HA5A 1TWFB 5M5WB 1Y1VB 3TP8A 2YU9B 1SYCA 4KY5A 1EY9A 2Q8RE 2PW5A 2Z4HA 4RHRA 3S2HB 3HOVB 2JA7B 2CW0C 3I91A 3CHBD 3BS1A 1RTOA 3HG9A 3EA6A 5A2QE 1MGSA 5C4XB 1ESRA 3ERQA 3ND9A 2WP8J 4DN4M 3H0GB 3A7LA 1A2TA 3U9SA 1H9SB 2F0PA 1BXTA 5EKKA 3A8IE 1ICWA 2A6ED 2B2UC 1JC7A 1QJOA 3C3LA 2VB2X 4HTHA 3VR2A 5IODA 1SJED 3QOLA 1G6ZA 2KEDA 3C1FA 3AB9A 2NBFA 2RSOA 4KV6A 1EOTA 4IUTA 4IURA 3L7ZC 5EQ0A 3OOCA 3EJIA 2EDGA 4H13C 1TKWB 1PYWD 4L6TB 3R8BA 1TS2A 2HCCA 1U4PA 4JK1C 2EY5A 5CV6A 2OXPA 5IGBA 2QEJC 1CZWA 1S5CD 4G4KA 1LTID 1HXYD 3RZOB 3QJYA 1LT5D 3DWPA 3QG1A 2O4XA 4KHZA 1J8IA 3MVVA 1D6EC 4BS9A 1EWHA 2RQXA 1D5ZC 1SNCA 3QOJA 2BCOA 1VF7A 2B2YC 3W2DA 3KF8A 5M3FB 2F0UA 3GTJB 2M9VA 2EYLA 4KKTA 3CU7A 2PNRC 4LAAA 4IFDJ 2XIWA 1OXUA 2AUKA 3V96A 3C1EA 2EYMA 3LX0A 4F8MA 1AW7A 1JB3A 1ZKOA 2OT2A 1LT4D 4B9XA 1MSGA 5COYA 4CKEA 3QO2A 4QB4A 1JWMD 2YYZA 5I9OA 2MUYA 3PIP3 1EL0A 1JCKB 2NB0A 3KLSA 4A3FB 1WCMB 2XNAC 1SFOB 1BDOA 2IJ0A 2K33A 1TS5A 4I65A 2JXMB 3BG3A 1A6XA 4NMZA 4FF4A 3KLSX 1QG7A 2PMZB 1STYA 3I90A 4CKBA 3VYRA 2J4XA 3D8GA 3IAYA 3FPUB 2F0OA 1IYUA 3M4YA 2MP1A 4XQNA 1GUOA 5CV7A 4DFAA 4R8IA 5G3LF 2NTTA 2BDNA 1A3TA 2B2YA 2BA0A 3HOUB 2A68D 2RSNA 1QNUA 5BN4A 2EY2A 4Z9CB 3MEHA 3A54A 5JEAJ 2JA5B 1AZPA 3GV6A 4U673 5J39A 1SYEA 1PRTB 4K14A 2C5CA 1T5XD 3T16A 4FF2A 5JVH3 3E0JA 4ZKCB 1CI3M 1S5BD 4KD4A 4C56C 1I50B 1PTOF 2JYOA 3TP5A 2FJ2A 2V4DA 1B50A 2AWOA 5C0XI 5CV9A 3VA5A 1BCPB 3J80L 2SDFA 1EY7A 5FO7B 2RDFA 1WVLA 3D6WA 2ICEC 4DK0A 1OXVA 1I4HA 1YNNC 3GTPB 2BOSA 2I07B 1OXXK 3SK8A 2XRSD 1F2ZA 1DOLA 3MXPA 1OXSC 1PZJD 4DNTB 2RVLA 1I4QA 3MTSA 1GOZA 5C3EB 1IHZA 3D4WA 2PYKA 3S2DB 5M9OA 2QKIC 1LO5D 4PNYA 2AQ2B 4OO1G 1LTTD 3U9OA 1T5EA 1Q90A 1ONLA 3J7YW 1ENCA 2M00A 2FINB 2EYHA 2RBMA 5K5PA 2A5HA 5CC4A 3RZDB 2DNCA 4A3GB 3TMEA 2MJ8A 3K5MA 1S5DD 3OIPA 3DEOA 4FO2A 2KQ3A 4AYBB 4EVOA 4ABNA 1WTOA 2F0SA 4HR7B 5CMDA 3CQZB 3GD7A 4ZAIA 1LV9A 2I46A 4ZKBB 3JAML 1WTPA 1B4OA 4TQUS 3M4OB 2O5IC 5C4ZA 3CRLC 3G7LA 3IFDA 4OGQC 2K7VA 4Y7NB 1GJXA 4C3HG 5LL6X 3DXJC 1M4VA 4RCOA 1HA6A 1PTOH 1SNPA 3OSOA 2N55A 1SNQA 4P2CB 3GTKB 4JBWA 2A6EC 4QCLA 2JA6B 1HTPA 2KCNA 1L0XB 5T1GA 3FEWX 4OHJA 1YNJD 2AWNA 1Q8IA 3M7GA 1L0YB 5KIXA 4RA8A 1SJHD 2JEAI 1CHPD 2F0TA 4KMUC 1KDAA 2BDOA 3R2IA 4IN3A 1BO0A 1Q1EA 3NBHA 3V2TA 1CA5A 1SE2A 3H09A 4CKCA 2B2TC 1ZYRD 2B2VA 5IGDA 5IGGA 3GTLB 3SDZA 3HOZB 2K05A 1GXDC 1VMCA 3RD4A 2F0MA 2VB3X 3OW7A 4IFDI 2WKCA 5FOBB 1Z6HA 1A2UA 1LTAD 2N88A 4RKLA 1HQRD 2R92B 3ZYYX 4DXGA 2Z4IA 4RAUC 5DM73 1Y8PB 2IL8A 2XWJB 1A3UA 3KUPA 2CHBD 2EXZA 4X3UA 3BYTB 1IL8A 3GP7A 1BF4A 1B9NA 4CJ1B 4DU9A 1TWHB 3MXUA 1SE3A 2MGSA 1FNWA 5KNDA 3FDTA 1CM9A 4ZUIA 2SNMA 3VR5A 1GUTA 2JE6I 5DM63 4G7OC 1U4LA 2E75C 2OEOA 4QF4A 4ZQ3A 3PIO3 3X3MA 2QDBA 3NTKA 5D65A 3K6OA 3S16B 2KUMA 1LTGD 5K36H 2FMMA 4C3JG 5JAVA 3SK5A 1JR0D 1B2TA 2Z8LA 2ZXRA 2RKSA 3TDQA 4FXGC 4OO1H 1Z47A 4WJWA 4MHEA 2VNUD 1CQVA 2AUJD 1HHVA 1PTOB 5JVG3 4OIJA 2G9DA 4K6LA 1JWUD 3EFXD 1RHPA 1EYCA 1Z7TA 1U9RA 1QILA 2QF7A 5FLXL 2DN8A 4U68A 3MXGA 1QCBD 2L5TA 3NE5B 4J8QA 4LK1C 5JPNC 5D3IB 2F0FA 2SNSA 2Z1CA 4KHVA 5AFWA 4A3IB 3DUZA 5EBDA 3T53B 1KAAA 5FO8B 1SNDA 1EIHA 1IKLA 1LTBD 3J80E 3T56B 3H6MA 4MN3A 4IUVA 2A6HD 4FXDA 1DM0B 3MC0B 4IUPA 3I8ZA 2F0KA 2ZXPA 3R3OA 1I3QB 3OHXC 2K03A 2A68C 3VYUA 3A8JE 5BN5A 5I4DA 1RCVD 1I4RA 1CA6A 1F9RA 2B39A 3DEPA 5IGFA 1EY0A 1PRTD 4KY6A 2PQEA 3D6CA 5IIFA 4XIGS 3FKIB 2FFKB 4H0LC 5J1ZA 1HRJA 1F2MA 1HUMA 1STGA 1SYDA 1TVXA 4X3TA 1JQYD 3NQTA 2DNEA 5C0XG 2NZ1D 1LT6D 1BCPD 4B9WA 3KLRA 1DXMA 4A3EB 5ELBA 2L4NA 5C4HA 3BYYB 1ENFA 4O42A 2MPMA 1XX8A 5EBCA 3TN2A 1E2WA 4RKBA 1CQFA 2L9HA 1R4QB 3NUCA 2G9HD 4RGOS 3RLFA 4LJZC 4DGZA 1HPCA 4DAVA 4KN7C 2F0NA 4K2KA 1UNSA 3TZUA 2NVTB 1Q3LA 4K6DA 1RKNA 2KEEA 3NHHA 2B2UA 3NK9A 5ISRA 3T4AC 2HUGA 4A3DB 3JAME 3NTHA 2Y0SB 3VR6A 1Y1WB 5JJZA 2IWHA 3WDNA 2XRQD 2E74C 1KDCA 5T1IA 3NWTA 1O78A 3HS0C 2NN6G 3NSWA 1TWAB 2ZT9C 1IKMA 1NR4A 4BY1B 3BVGA 2BA1A 1STEA 2R7ZB 1EY4A 1JOOA 2O2LD 1H9MA 1ILQA 3EQLC 1SXTA 1WD0A 3MAQA 1KABA 4ID6A 3UI2A 1EQTA 4Q5VA 3BDLA 3ND8A 1K8MA 4N9PA 1FNVA 1FR3A 1XWEA 4C1NI 3EVQA 3H91A 1Q1BA 3I4LA 4XYOA 5DAUA 3J7AV 2HQEA 4O1NA 1PZKD 1F77A 1V43A 2JSOA 3MXNA 4ZK9B 1KLUD 3NTIA 3QWNA 2EYPA 2EOTA 1PFMA 1NUCA 1AP0A 2L0CA 2NYZD 2X6GA 1B53A 2IX3A 2EYOA 4IQZA 1YNJC 1JOKA 2Q8IB 3A7AB 5TSSA 1W6JA 1G8ZD 4FVMA 2LMCB 1M8AA 4OL7A 1TIID 5IOCA 1IYVA 2PZWA 2LKVA 2D5DA 3I3CA 2H4OA 1V1PA 2KHSA 4BBRB 1HUNA 4UDUC 4KY7A 3S1RB 3J81E 3SK6A 2LY7A 1ZYRC 4H7BA 3PUVA 4XQJA 1R9TB 5NUCA 1DOKA 3M7NA 4M1UB 3VYSA 1TQOA 2E2JB 2E2IB 3I4MB 2EYFA 1TWCB 1BUVT 4IFDG 3MFYA 1JICA 4QIWB 3SE0A 3SVMA 4Q0FA 3PUXA 4NKLA 3LNNA 1RD9D 1BOSA 1ET9A 1G291 4A93B 5KYLA 2IPKD 1DD2A 5I6YA 3C46A 5C5MA 4K5VA 2F0JA 2PZUA 2CQAA 1MD2D 1PLFA 4KKUA 3FPPA 2FMCA 2KECA 3URYA 3S1QB 2K5QA 5JOBA 3D3RA 4C3JB 2GA4B 2NTSA 2A69D 2J7ZA 4EQOA 3PO2B 2KOLA 5FLXE 3VR3A 1H9SA 4K5WA 1HCZA 1I4PA 1OXTA 5KNBA 4FNFA 2K1BA 3P7JA 1ET6A 2J0TD 4RWSC 1XXGA 4KJNA 4KD3A 4K2LA 1Y69U 5EPKA 1G2TA 1F9QA 3IL8A 3MFGA 2PCFB 1EEFD 4TSSA 1B44D 3P75A 4DF7A 3HOYB 3LWEA 3OWFA 4HCEA 1PTOD 1HFNA 1II3A 1Y8NB 5A35A 3C2PA 1RF2D 3F2UA 3SXHA 1Q12A 3A55A 3S14B 2F0HA 4RGTA 4HEDA 2NN6H 1KTKA 3K0YA 3WOFA 4XXEA 4TRDA 1S5ED 1VCIA 1PFNA 4KI0A 2VXWA 5JEAG 3KK7A 2R6GA 1SNMA 3GTQB 3S17B 2TMPA 1XTCD 3DWAA 4CJ2C 3NP8A 1ENAA 3QB3A 2B2WC 2ICIA 1S4ZA 1K8OA 1CHQD 2A6HC 2KCCA 5KRUA 5ELEA 5IT9L 3GQBA 1DYQA 1SYBA 2R93B 1CFMA 3AU7A 1E2VA 4HSVA 2D9UA 3PO3B 3MHBA 3HGBA 3DHQA 4KKSA 4DAPA 2EJGC 1GUWA 2EY1A 4HMJA 5EPJA 1PRTC 3NXWA 5EPLA 3HOWB 5KGUA 2XSCA 4A3BB 4XDXA 1O80A 3P20A 1E2ZA 5CR3A 4BBSB 1G2SA 1SAPA 1GUNA 1GUSA 3MWYW 2WINB 1DONA 1BCPC 1IW7D 1D5XC 3GTMB 1DJRD 3OPOA 5CV4A 4CGYB 2X6LA 2ENBA 1SEBD 1EYAA 2VUMB 3CRKC 1BBXC 1F2YA 5D3DA 1HFGA 1QNKA 3S1NB 5E4WC 4C3IG 1SMYD 1VF5C 2F4IA 3E5SA 3R2TA 2K04A 2IW3A 5BN3A 3J81L 4RCNA 1RODA 2F0LA 1D1KA 3A8KE 1U4RA 1F2LA 1PMRA 3PUZA 3OMCA 4OO1I 1LLRD 4PV1C 1D2BA 5I2YA 1A15A 4ZRZA 1H9RA 3LWUA 3HRZC 2F0GA 1PRTF 1B9MA 2EY6A 2B2WA 1KDBA 5EKIA 3ITPA 1TY2A 5KYIA 5KNCA 3K7AB 1KNAA 1X32A 4XQQA 4FYDA 1RJTA 1LTRD 3RUZA 4FF1A 2X69A 3KBXA 3T51B 5ELCA 3WOEA 3QIAA 1BCPF 1A3VA 1R4PB 1JORA 2NUCA 1O7YA 2F03A 1ESFA 1BQQT 2B2TA 5CGKA 2WV6D 3OIQA 1EZ6A 2ZXOA 1UAPA 4XT1B 4V190 2WACA 4ULLA 1WTVA 1D5MC 2L12A 1X3PA 4X3SA 4DNRB 3AMUA 1MBYA 1EIGA 1SNOA 1STNA 3Q6SA 4L8JA 4DXFA 4V0BA 4RHSA 4BA1I 4FP5D 3HKZB 4NW2A 5CV8A 3H94A 1EYDA 1SYGA 4N9TA 3X3NA 3PUWA 1PDQA 3IKJA 2E2HB 2NVQB 4IZ8A 2RA4A 1QB5D 4IUUA 4K8JA 1JE4A 1J9OA 5JEAH 3FRPB 1XYIA 5JPMC 4L63B 4UAIA 3FMCA 1TY0A 5C4JB 2B8GA 1KNEA 3SR1A 4ILWA 4HAEA 1QOHA 2F0QA 1O7ZA 4S3SA 1W6KA 1BNZA 2WAQB 3D4RA 2A73B 2K5WA 4R9WA 4ZYSA 2LFNA 5EKLA 2BE5D 5IGCA 4PQXA 4ME5A 1DOMA 2O5JC 1WTXA 1LACA 1G91A 2M2LA 2R3ZA 4EQPA 3OWEB 5DNFA 1PZID 3D4DA 2F0DA 4I7ZC 1GUGA 4BWGB 2JEBI 4NP5A 4M8AA 2DY7A 2PW7A 3DMUA 3GO5A 3IFTA 2AQ3B 3K59A 3NBIA 1V8QA 4CJ0B 2CVRA 3EROA 5ELFA 2WIIB 1GHKA 1MSHA 4G7HC 3PMFA 3TBIB 1HTLD 3H3VC 2A69C 5FKAC 2R61A 5LL6S 1UEAB 2FHTA 1SBBB 2EYJA 3S15B 1NCVA 2C9OA 4WORA 5C44B 1O7LA 2TSSA 4EGVA 2IX0A 3Q23A 1X3QA 5HGTA 5D14A 4RGNA 1E0BA 5E3FA 2F0WA 1HQMC 4WRDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D3R A;  2OT2 A;  3VYT A;  3VYS A;  3VYU A;  2Z1C A;  3VYR A; 
#chains in the Genus database with same CATH topology
 5C6A A;  5C5L A;  4A3M H;  5CV5 A;  5HUR A;  3W5O A;  3VR4 A;  3GTG B;  2OWO A;  4LF8 L;  2EJM A;  3CKI B;  2CW0 D;  1EOV A;  5IT9 E;  4QY7 A;  1WD1 A;  2UUB Q;  3BZD B;  3QR8 A;  1ZEQ X;  1PTO C;  4KN4 C;  2NVY H;  4IAL A;  4RGM A;  2XWB B;  5IYC H;  4C3H B;  2K5D A;  2F0E A;  3HOV G;  2JA7 G;  1PVO A;  2A74 C;  4X64 Q;  3TZD A;  3PQI A;  1PH3 A;  1N36 L;  4J6H A;  4GN3 B;  1EIF A;  3SK4 A;  4RH6 A;  4WFN 3;  2D2C C;  1N34 Q;  2K32 A;  2KJX A;  1PXU A;  4C2M B;  1FYC A;  2IHE A;  4ZUJ A;  2IT1 A;  4K5X A;  1OO9 B;  2HCI A;  2CWA A;  4JYA L;  5CBA E;  1KIX A;  4LUO A;  2QCP X;  4JI0 L;  2I0Q A;  5C4X G;  3HOY H;  3VA7 A;  3T13 A;  1LTS D;  2E2D C;  3S1M B;  5LHY 1;  3H0G G;  3FP9 A;  2B63 B;  1WJJ A;  1FNU A;  4BY7 H;  1DZ1 A;  1BVS A;  4GLX A;  4MIU A;  4A3L G;  4DR6 Q;  5M5Y B;  4YIJ A;  2Q2H A;  1IBK Q;  2DGY A;  1AZQ A;  4OX9 L;  3BDC A;  2P5Z X;  1EEI D;  3CPF A;  1U5K A;  2EE1 A;  2E76 C;  3M85 A;  4JI5 L;  1I4G A;  4DV0 L;  3IRB A;  2LXJ A;  2D0O A;  1KRS A;  3TRE A;  1KQS A;  5EJW A;  1D1I A;  2RHS B;  5F2D A;  1I6V C;  3GV3 A;  4KJO A;  4QIW E;  3ONA B;  1EY8 A;  4X3K A;  2H1E A;  5A2Q L;  3TP7 A;  4L5T A;  1ZXT A;  5KEE A;  3S17 H;  4UY8 C;  2PZT A;  3K58 A;  5I2X A;  4LFB L;  3Q8D A;  3G71 A;  3RMH A;  2EVB A;  5E4X A;  2B8F A;  3E6Z X;  1G6P A;  1TWG B;  1QE6 A;  3KJP A;  4B3M Q;  3NWS A;  4XT3 B;  1H9J A;  2QGQ A;  4DA2 A;  1B1Z A;  2HDM A;  1YI2 A;  2F3W A;  1EY5 A;  4KK7 A;  3KDF A;  2Q2T A;  2YTV A;  3K57 A;  4K8I A;  1VMP A;  1Z9F A;  1V1O A;  3K7U C;  3TSS A;  3E0E A;  4GLA C;  5COR A;  4CBV A;  4X64 L;  3W3A A;  3A56 A;  2RHQ B;  3CCE A;  1SYF A;  1N34 L;  1TR5 A;  2JA8 H;  3KJO A;  2PPB C;  1HH2 P;  4F7X A;  1P16 A;  1IW7 C;  1E7Z A;  2V1C C;  2L11 A;  3M3Y H;  1SSO A;  3GTO B;  2EPB A;  1VDZ A;  4C3I B;  3I4N H;  1NSN S;  2JN4 A;  4FXK C;  1EIY B;  3HOW H;  2RDH A;  1PFB A;  5C0X H;  4A3B H;  5C3W A;  4A3E G;  3PIP A;  1NR2 A;  4G7Z C;  4DR6 L;  1K83 B;  2F3V A;  4UP9 A;  1F9P A;  3I72 A;  1QWY A;  1S3O A;  4ZLT F;  1SMY C;  1K9M C;  1TS4 A;  2NVX H;  4POG A;  4DR1 Q;  4E6I A;  2K01 A;  5M3F G;  4AYB E;  5K36 G;  1SE4 A;  1B3A A;  1CZG A;  3MA2 B;  1PV4 A;  3I70 A;  1GHJ A;  5I9P A;  4JOI C;  1C8C A;  2XN9 C;  4A3M B;  5DLQ E;  1TS3 A;  2JQO A;  3ULJ A;  2ID0 A;  5G3L D;  1CT1 D;  2XVS A;  2UXB L;  1LM0 A;  5J22 A;  4NDX A;  3S1N H;  3FVQ A;  1J5E Q;  2RF4 A;  4HN7 A;  3PV0 A;  4ODG A;  1BR9 A;  1N8R C;  4ZCK A;  1RL2 A;  1TU2 B;  4F87 A;  4DAY A;  4RMF A;  1RDP D;  1N33 Q;  1I4X A;  4A3J B;  1CUK A;  3PSI A;  3OMG A;  2NVY B;  1DGS A;  1AFP A;  3NEM A;  1MIU A;  1N9W A;  5IGE A;  4B3M L;  2FXQ A;  3L9A X;  2JP1 A;  2F0I A;  2B2V C;  1SDF A;  1NNX A;  3K5N A;  3I73 A;  2NZH A;  1L2F A;  3D31 A;  1STA A;  5JJL A;  1PFS A;  3N52 A;  2NN6 I;  2VQE L;  2IY5 B;  4GKK Q;  2F0V A;  3M4Q A;  4HSP A;  3DM1 A;  5FO9 B;  4A3F G;  3DWQ A;  2ZJQ A;  4F88 A;  3N6R A;  2D62 A;  5ELD A;  3PUY A;  1WCM G;  4OIK A;  3K5O A;  3GDE A;  4BA2 I;  2L1B A;  4BY7 B;  2IX1 A;  1EYG A;  4DK1 A;  2MHV A;  3NEN A;  1H9K A;  3HZX A;  4K0K Q;  1VQF A;  5M3M H;  1HNX Q;  3BJU A;  1EU4 A;  1I6H H;  1RTN A;  2HQL A;  2EQS A;  3SEB A;  1ILP A;  1EY6 A;  5GRO A;  3O13 A;  1AEX A;  4IUQ A;  3HOX H;  2HHH L;  5EGT A;  4DR1 L;  1TWF H;  2YV5 A;  2IHF A;  2WKD A;  5M5W H;  2K52 A;  1MI2 A;  1Y1V H;  3P1H A;  4TKO B;  2YU9 H;  1EZ8 A;  2CH4 A;  2AQ1 B;  2RDG A;  1EU3 A;  4EQN A;  1STH A;  4J15 A;  1PH5 A;  1C4Q A;  1VQI A;  2K28 A;  2PO4 A;  1CTM A;  5DEH A;  4CHT B;  1NAP A;  1LUZ A;  1VQ8 A;  4FF3 A;  4A3K B;  3BDO A;  3S2H H;  1P8L A;  4QUC A;  3K5L A;  3HOV H;  2KVM A;  4PMW A;  1WTW A;  2JA7 H;  4IJL A;  1PH6 A;  3I7F A;  5JJK A;  5FK9 C;  1EWC A;  3RNU A;  1AN8 A;  2E8G A;  1UUP A;  2N8N A;  4R8N A;  3NQI A;  3HOU G;  2F1M A;  5C4X H;  4HMI A;  2JA8 B;  1JT8 A;  4C1N K;  5E1F A;  1HZA A;  3J7A F;  5CBE E;  3H0G H;  4JG2 A;  4JOI A;  2JA5 G;  3PCO B;  3M3Y B;  1AE2 A;  2PI2 E;  1STB A;  4H44 C;  2E2H H;  2LS0 1;  3VYT A;  4HIO A;  3I4N B;  4G57 A;  3U4Z A;  1EQV A;  1IBL L;  1LTL A;  3V05 A;  4XYQ A;  2QIL A;  1S5F D;  1QUQ B;  1CK1 A;  1IXR A;  4IPD A;  5M5X B;  3TP6 A;  1M90 C;  2OF1 A;  3CC7 A;  3TS2 A;  1Y8O B;  3RN5 A;  2VY3 A;  3CCQ A;  2NVX B;  2L55 A;  5CYU A;  1GVP A;  3CMA A;  2BE5 C;  4IUN A;  3AEV A;  1YNN D;  3MXN B;  3S9W A;  3I4O A;  4J1M A;  1E22 A;  4LMQ D;  2HD3 A;  4PMC A;  3Q22 A;  1JWS D;  4GZY C;  1FD7 D;  2EJF C;  2XTI A;  1ML0 D;  1LT3 D;  2A1A A;  1V9P A;  3U58 A;  4JW0 A;  1F9S A;  4YY3 L;  2AHO B;  2KA7 A;  1TT2 A;  2K6A A;  2NWG A;  1EFI D;  1WTQ A;  2WB1 B;  3MZ5 A;  1I94 L;  1JMC A;  3A5Z B;  2UXC L;  5IYD G;  2EZV A;  4QMG A;  1DCZ A;  1WFQ A;  5C0X J;  3L3O C;  3Q0A A;  4P75 A;  2SEB D;  4AIM A;  4IFD H;  4RFB A;  3HEJ A;  2HIV A;  1HNW Q;  4DR2 Q;  1LAB A;  1Q86 C;  4A93 G;  4O2D A;  3CME A;  5C3E G;  4DUY L;  1WTR A;  3BVM A;  5I6W A;  1IYJ B;  3SHL A;  3BVZ A;  1V1P B;  2Z6K C;  4KLK A;  2Q8T A;  1JOQ A;  3M9B A;  1SMX A;  1N32 Q;  2UUA Q;  2DJF C;  1E3P A;  2DY8 A;  1E24 A;  1U4M A;  1KLG D;  3KBG A;  5M3M B;  3HP3 A;  4B08 A;  4XTC S;  3R93 A;  1I6H B;  3G6J B;  2HDL A;  2SOB A;  4QUF A;  1FGB D;  3NPP A;  1VQE A;  5C3X A;  3Q24 A;  4HCS A;  1PYS B;  3GTJ H;  1C48 A;  4KTA A;  3HOX B;  4PMB A;  1HA5 A;  4DKA C;  1TWF B;  3CCV A;  2F4V Q;  5M5W B;  4GN4 B;  1Y1V B;  3TP8 A;  4LNQ A;  4A3G G;  4JI4 Q;  3STB D;  1SYC A;  2YU9 B;  3ICE A;  4KY5 A;  1EY9 A;  2Q8R E;  1EQQ A;  2PW5 A;  2Z4H A;  4RHR A;  3S2H B;  3HOV B;  2JA7 B;  4QL5 A;  3S15 H;  4AYB G;  2CW0 C;  3I91 A;  3CHB D;  3BS1 A;  1RTO A;  3HG9 A;  4LFC L;  3EA6 A;  5A2Q E;  1MGS A;  3CCJ A;  5C4X B;  4CDD C;  1ESR A;  3ERQ A;  3ND9 A;  2A8V A;  4A3F H;  2WP8 J;  4DN4 M;  1X65 A;  1HNW L;  3H0G B;  3A7L A;  1UEB A;  1A2T A;  3U9S A;  1H9S B;  2F0P A;  1BXT A;  2WFW A;  5EKK A;  3A8I E;  1ICW A;  4DAY B;  4ALP A;  4JI6 Q;  2A6E D;  2B2U C;  1SFO H;  2UUA L;  1JC7 A;  1QJO A;  2KEN A;  2XGT A;  3C3L A;  3ZJY C;  2VB2 X;  1K0S A;  4HTH A;  3VR2 A;  5IOD A;  1KD1 C;  1KAW A;  1SJE D;  3QOL A;  4DR5 L;  1G6Z A;  2KED A;  3C1F A;  3AB9 A;  2NBF A;  2RSO A;  1VQJ A;  4JI7 Q;  4KV6 A;  1EOT A;  4OEM B;  1CKN B;  4IUT A;  4NPS A;  4IUR A;  3LGJ A;  3L7Z C;  1HNZ Q;  2AMC B;  3M4P A;  5EQ0 A;  3OOC A;  2F4V L;  3EJI A;  2EDG A;  3S1M H;  1AH9 A;  4H13 C;  3BU2 A;  5IP7 H;  1TKW B;  3HFZ B;  4JI4 L;  1W3S A;  1PYW D;  4L6T B;  2R93 G;  3R8B A;  1TS2 A;  3CC2 A;  1B70 B;  3J80 i;  4BXX G;  2HCC A;  1U4P A;  4ME3 A;  4JK1 C;  2EY5 A;  5CV6 A;  4LF9 Q;  2OXP A;  1VQ6 A;  3HOU H;  5IGB A;  4JCV E;  2QEJ C;  1CZW A;  1S5C D;  4G4K A;  1LTI D;  1HXY D;  3HOZ G;  3MEF A;  3RZO B;  3U4V A;  4JI1 L;  3QJY A;  1LT5 D;  3DWP A;  3QG1 A;  2O4X A;  2Y0S E;  1VQD A;  4KHZ A;  3PIO A;  1J8I A;  3MVV A;  4GNX A;  4GOP C;  1D6E C;  4BS9 A;  1EWH A;  2RQX A;  1D5Z C;  1SNC A;  3QOJ A;  2BCO A;  1VF7 A;  4JI6 L;  2R92 G;  2L15 A;  1I50 H;  2B2Y C;  3W2D A;  4HID A;  3KF8 A;  3CP0 A;  4CDE C;  5M3F B;  2F0U A;  3GTJ B;  2M9V A;  2EYL A;  2JK8 A;  4KKT A;  5HY6 A;  4JYA Q;  3E3X A;  3CU7 A;  2PNR C;  4LAA A;  3J80 c;  4JI7 L;  4IFD J;  2XIW A;  1OXU A;  2AUK A;  3V96 A;  1VS0 A;  3C1E A;  5IYB G;  2PQA B;  2EYM A;  3LX0 A;  4F8M A;  1K3B C;  3UE1 A;  1AW7 A;  1B8A A;  1VQG A;  2B29 A;  3GTP H;  1GM5 A;  1JB3 A;  1ZKO A;  2OT2 A;  1GO3 E;  1LT4 D;  4B9X A;  1X3F A;  4OX9 Q;  1MSG A;  5COY A;  4OXP A;  4PG3 A;  5IYD H;  4CKE A;  2VQF L;  3QO2 A;  4QB4 A;  1JWM D;  4JI5 Q;  2YYZ A;  5I9O A;  2MUY A;  3PIP 3;  1EL0 A;  2OTL A;  4GN5 A;  4LF9 L;  1JCK B;  2NB0 A;  5C3E H;  3KLS A;  4A3F B;  4IO9 A;  3S2D H;  4LFB Q;  1WCM B;  3FHW A;  2XNA C;  3CAM A;  4DV7 L;  1HZC A;  1SFO B;  1BDO A;  1WTH A;  2N78 A;  2IJ0 A;  2K33 A;  4P74 A;  3JAM i;  1BBW A;  4A3J H;  1TS5 A;  4I65 A;  2JXM B;  3BG3 A;  1A6X A;  1L1O B;  4NMZ A;  3KLW A;  4FF4 A;  3KLS X;  1QG7 A;  2PMZ B;  1STY A;  3I90 A;  4CKB A;  1VQL A;  3VYR A;  3RZD H;  2J4X A;  2A19 A;  3D8G A;  3IAY A;  4A3G H;  1NE3 A;  4Y52 H;  3FPU B;  2F0O A;  1IYU A;  3M4Y A;  3J7A 5;  3AQQ A;  2MP1 A;  3EIV A;  4XQN A;  1GUO A;  5CV7 A;  3CD6 A;  2N3S A;  4GOP A;  4QGU A;  4LF6 Q;  1YBY A;  4DFA A;  4R8I A;  4A3I G;  5G3L F;  4PZ6 A;  2NTT A;  2BDN A;  3RLO A;  1A3T A;  2B2Y A;  2BA0 A;  3HOU B;  4DUZ L;  1J6Q A;  2A68 D;  2RSN A;  1QNU A;  5BN4 A;  2EY2 A;  2PI2 A;  2RCF A;  3MEH A;  4I7A A;  4Z9C B;  2CKZ B;  3A54 A;  3ER0 A;  5JEA J;  2QW7 A;  2JA5 B;  1AZP A;  3GV6 A;  3JAM c;  4U67 3;  3M4O H;  5J39 A;  1SYE A;  1KC8 C;  1PRT B;  2UXB Q;  4K14 A;  2C5C A;  1T5X D;  3T16 A;  1SN8 A;  1W2B A;  4FF2 A;  5JVH 3;  3E0J A;  4ZKC B;  1CI3 M;  4Y7N H;  4WJ3 M;  1S5B D;  4A3K H;  4KD4 A;  3KF6 B;  4C56 C;  2VZA A;  1I50 B;  1PTO F;  2JYO A;  3TP5 A;  1FGU A;  2FJ2 A;  2V4D A;  5FLM G;  1B50 A;  2JA6 H;  2AWO A;  5C0X I;  5CV9 A;  2VQE Q;  3VA5 A;  1BCP B;  3K8A A;  4CDC C;  3J80 L;  2VW9 A;  2SDF A;  1EY7 A;  5FO7 B;  1A63 A;  2RDF A;  4YWM A;  1WVL A;  4CDF C;  3D6W A;  3FKI G;  1Q46 A;  2ICE C;  5ELO A;  1OXV A;  4DK0 A;  1I4H A;  1YNN C;  1JJC B;  3GTP B;  1VQ9 A;  2BOS A;  2I07 B;  1OXX K;  3SK8 A;  1G51 A;  2XRS D;  1F2Z A;  1V1Q A;  1DOL A;  3MXP A;  1OXS C;  4A75 A;  1YHA A;  1PZJ D;  5M5X H;  1PH7 A;  4DNT B;  4LF6 L;  2RVL A;  1I4Q A;  2K50 A;  3MTS A;  3I56 A;  2HHH Q;  1VQC A;  1KL9 A;  1GOZ A;  4DV3 Q;  4EQ5 A;  3GTL H;  5C3E B;  1IHZ A;  2QEX A;  1VQM A;  3D4W A;  2PYK A;  2RCN A;  4AQY L;  3S2D B;  5M9O A;  2QKI C;  4LW1 A;  1LO5 D;  4HJ5 A;  5L37 A;  4PNY A;  3CCL A;  2AQ2 B;  1QZH A;  4B3R L;  4OO1 G;  1LTT D;  3U9O A;  2CFM A;  1T5E A;  1Q90 A;  1ONL A;  2MNA A;  3J7Y W;  4B3T L;  1ENC A;  2M00 A;  1PH8 A;  2FIN B;  2EYH A;  1HJP A;  2RBM A;  2GVB A;  3W1G A;  2A5H A;  5K5P A;  3CC4 A;  4A3D G;  5CC4 A;  3RZD B;  2R7D A;  2DNC A;  2Y0S G;  4N8F A;  1TWH H;  4NXM L;  4A3G B;  5IYB H;  1Y1W G;  1YJ9 A;  3TME A;  2KCM A;  1QVF A;  2MJ8 A;  1IBL Q;  3K5M A;  4HJ8 A;  4GNX B;  1KXL A;  1S5D D;  3OIP A;  5H1S E;  3G6E A;  3DEO A;  4FO2 A;  3H3V H;  2KQ3 A;  1C7Y A;  3STB C;  4AYB B;  2MFI A;  4IOC A;  4EVO A;  4ABN A;  3KF8 B;  2F52 A;  4BY1 G;  4YHH Q;  3BZC A;  1WTO A;  2F0S A;  2DUD A;  4HR7 B;  2R7Z G;  4B3S Q;  5CMD A;  3CQZ B;  3GD7 A;  4ZAI A;  3ULL A;  1LV9 A;  2I46 A;  4ZKB B;  3JAM L;  4QQB X;  1WTP A;  1B4O A;  1PHJ A;  4DV3 L;  4TQU S;  3M4O B;  2O5I C;  3CF5 A;  4RG1 A;  1VQB A;  3J7Z C;  5C4Z A;  3CRL C;  2UU9 Q;  3G7L A;  3IFD A;  4OGQ C;  4YY3 Q;  4L5S A;  2K7V A;  4Y7N B;  1GJX A;  4C3H G;  5LL6 X;  3DXJ C;  3AFP A;  1M4V A;  3UDX A;  1I94 Q;  2UXC Q;  4RCO A;  2CCZ A;  1HA6 A;  1PTO H;  1SNP A;  3OSO A;  2N55 A;  4IPG A;  1SNQ A;  4P2C B;  3GTK B;  4JBW A;  2K5V A;  2A6E C;  4QCL A;  2JA6 B;  1HTP A;  2KCN A;  3UDI A;  1L0X B;  1X55 A;  5T1G A;  3FEW X;  4LFA L;  4OHJ A;  4DUY Q;  1YNJ D;  2AWN A;  3F2C A;  1Q8I A;  1YNX A;  3F8T A;  3M7G A;  5FLX c;  1L0Y B;  1C0A A;  5KIX A;  4RA8 A;  1SJH D;  2JEA I;  1CHP D;  3PF5 A;  3DM3 A;  2F0T A;  4KMU C;  1JB7 A;  4A3L H;  1VQH A;  1X3G A;  4GKJ L;  1KDA A;  5GAD C;  2BDO A;  3R2I A;  2I5H A;  4A3I H;  4IN3 A;  5LMU Q;  1BO0 A;  1Q1E A;  4LF5 Q;  1UE7 A;  3NBH A;  3V2T A;  1CA5 A;  1K8A C;  1SE2 A;  3H09 A;  4CKC A;  2UUC Q;  2B2T C;  4YHH L;  1ZYR D;  2B2V A;  5IGD A;  5IGG A;  4LF4 Q;  3GTL B;  4WJ4 A;  3SDZ A;  3HOZ B;  4LUV A;  2K05 A;  1GXD C;  4B3S L;  1NMG A;  1I3Q H;  1VMC A;  3RD4 A;  2F0M A;  1T9H A;  4LF7 L;  4BBR G;  2VB3 X;  3OW7 A;  1UE1 A;  4UP8 A;  4IFD I;  1X54 A;  2WKC A;  5FOB B;  1Z6H A;  1A2U A;  2Z0S A;  1LTA D;  2N88 A;  4RKL A;  2UU9 L;  1HQR D;  2R92 B;  3ZYY X;  4DXG A;  3G4S A;  3I4M G;  4O0A A;  2Z4I A;  4RAU C;  5FLM H;  5DM7 3;  1SLJ A;  1XPO A;  1Y8P B;  2IL8 A;  2XWJ B;  1A3U A;  3KUP A;  4LFC Q;  2CHB D;  2MO1 A;  4JI8 Q;  1VQP A;  4DR4 Q;  2EXZ A;  3CXC A;  4AH6 A;  4X3U A;  3BYT B;  1IL8 A;  3GP7 A;  1BF4 A;  1B9N A;  4CJ1 B;  4DU9 A;  3FKI H;  1K28 A;  1EWI A;  1TWH B;  3MXU A;  2ASB A;  1SE3 A;  2MGS A;  1FNW A;  5KND A;  3RZO H;  3FDT A;  1CM9 A;  4ZUI A;  4DV5 Q;  3K80 C;  2QA4 A;  3A74 A;  3S24 A;  2SNM A;  3VR5 A;  1GUT A;  2CQO A;  2JE6 I;  4TVA B;  4A3E H;  2E5L Q;  4HJ7 A;  5DM6 3;  4G7O C;  1JJ2 A;  1U4L A;  2E75 C;  2OEO A;  4QF4 A;  4ZQ3 A;  3PIO 3;  3TRZ A;  3X3M A;  2QDB A;  1XNQ Q;  4L5R C;  3KDF B;  4DR5 Q;  5LMU L;  3NTK A;  5D65 A;  3K6O A;  4LF5 L;  3S16 B;  5M3F H;  2KUM A;  1LTG D;  5K36 H;  2FMM A;  4C3J G;  1UE6 A;  5JAV A;  1K3R A;  3SK5 A;  1JR0 D;  2ZJR A;  2UUC L;  3HKZ E;  3PO2 G;  1B2T A;  4LF4 L;  2Z8L A;  2ZXR A;  2RKS A;  3TDQ A;  4FXG C;  4OO1 H;  3CCU A;  2K4K A;  1Z47 A;  4WJW A;  4DV4 Q;  1XJV A;  4LUZ A;  4MHE A;  2K5N A;  2VNU D;  4DV1 Q;  1CQV A;  2AUJ D;  2NVT H;  1HHV A;  1PTO B;  4H02 A;  5JVG 3;  4OIJ A;  2G9D A;  4K6L A;  1JWU D;  3EFX D;  1FL0 A;  4A3D H;  1RHP A;  1EYC A;  2DJG C;  1CSQ A;  1Z7T A;  3HOY G;  4JI8 L;  4DR4 L;  1U9R A;  1Y1W H;  1QIL A;  4JI1 Q;  2QF7 A;  1ASZ A;  5FLX L;  2DN8 A;  4U68 A;  4JBJ A;  3NEL A;  3MXG A;  1QCB D;  2L5T A;  3NE5 B;  1WCM H;  4J8Q A;  4LK1 C;  5JPN C;  5D3I B;  2F0F A;  3I55 A;  2WAQ E;  4DV5 L;  2SNS A;  2Z1C A;  4KHV A;  5AFW A;  4A3I B;  3DUZ A;  5EBD A;  1HZ9 A;  3T53 B;  1KAA A;  4BY1 H;  5FO8 B;  2E5L L;  3RLN A;  3J81 j;  1C9O A;  1SND A;  1EIH A;  1IKL A;  1LTB D;  3J80 E;  3T56 B;  3H6M A;  4IUV A;  4MN3 A;  2A6H D;  3U50 C;  4FXD A;  1DM0 B;  3MC0 B;  2MO0 A;  3F1Z A;  4IUP A;  4IPH A;  5E7N A;  1A0I A;  1XNQ L;  3I8Z A;  2F0K A;  2ZXP A;  1LYL A;  1FJG Q;  3R3O A;  1I3Q B;  1H95 A;  3OHX C;  2K03 A;  2A68 C;  3VYU A;  3A8J E;  4HJA A;  5BN5 A;  5I4D A;  1RCV D;  2Z6K A;  1I4R A;  1CA6 A;  1F9R A;  2B39 A;  4X62 L;  3CPW A;  3DEP A;  5IGF A;  4DV4 L;  2VQF Q;  1IBM Q;  1EY0 A;  4JI2 Q;  1PRT D;  2UXD Q;  4DV1 L;  4KY6 A;  3A5U A;  2PQE A;  3PO3 G;  5BR8 Q;  2JA9 A;  3D6C A;  1PH2 A;  5IIF A;  4XIG S;  2YTY A;  3FKI B;  2ZJP A;  2FFK B;  4H0L C;  5J1Z A;  1HRJ A;  1F2M A;  1HUM A;  1STG A;  1SYD A;  1TVX A;  4X3T A;  2JA5 H;  1JQY D;  3NQT A;  4MNO A;  3HOW G;  4DV7 Q;  2DNE A;  5C0X G;  4A3B G;  2NZ1 D;  1LT6 D;  1BCP D;  4B9W A;  5EAY A;  2KHI A;  3KLR A;  1DXM A;  4BBS G;  4DNI A;  4A3E B;  2Z6B A;  3UDG A;  1S72 A;  4A4I A;  2YTX A;  1YZ6 A;  5ELB A;  2L4N A;  5C4H A;  3BYY B;  1ENF A;  3K81 C;  4O42 A;  2MPM A;  1XX8 A;  5EBC A;  3TN2 A;  1E2W A;  2H5X A;  4RKB A;  4BBR H;  3OTO Q;  2VUM G;  1CQF A;  2L9H A;  1R4Q B;  3S1R H;  3NUC A;  3DLL A;  2G9H D;  4RGO S;  1PH1 A;  1FJG L;  3RLF A;  4LJZ C;  1ICF B;  4DGZ A;  1R9T H;  2OQ0 A;  1HPC A;  4DAV A;  1HR0 W;  2F3I A;  3TQY A;  4MTK A;  4KN7 C;  2F0N A;  4K2K A;  2E2I H;  2E2J H;  3I4M H;  1UNS A;  1TWC H;  3TZU A;  2NVT B;  1Q3L A;  3A0J A;  1RKN A;  4K6D A;  2KEE A;  3NHH A;  2B2U A;  3NK9 A;  1IBM L;  5ISR A;  4DUZ Q;  3T4A C;  2HUG A;  4YWK A;  4JI2 L;  5J3B A;  2UXD L;  4A3D B;  3JAM E;  3NTH A;  5GAE C;  2Y0S B;  5BR8 L;  5JJI A;  4A93 H;  4R4C A;  3VR6 A;  1Y1W B;  5JJZ A;  2IWH A;  3T1Y Q;  3WDN A;  1QZG A;  4UHV A;  2XRQ D;  2E74 C;  2N49 A;  3B6Y A;  1KDC A;  5T1I A;  3NWT A;  1O78 A;  4DV2 Q;  3HS0 C;  4DK3 C;  2NN6 G;  4YCU A;  3NSW A;  1TWA B;  1PYB A;  2ZT9 C;  1IKM A;  2ATW A;  1NTG A;  1NR4 A;  4BY1 B;  3BVG A;  2BA1 A;  2LXK A;  3S1Q H;  3KOJ A;  1STE A;  2R7Z B;  1EY4 A;  1JOO A;  2O2L D;  1H9M A;  1ILQ A;  4C3J H;  3EQL C;  4OON A;  4YCW A;  1SXT A;  1WD0 A;  3PO2 H;  3MAQ A;  1Y1V G;  1KAB A;  4ID6 A;  3UI2 A;  1EQT A;  4Q5V A;  4JV5 L;  3BDL A;  3ND8 A;  4DAM A;  1K8M A;  4N9P A;  1FNV A;  1FR3 A;  3E9H A;  4R4I A;  3OTO L;  1XWE A;  2K5H A;  3EVQ A;  4C1N I;  2ALY B;  1MHW C;  3H91 A;  1Q1B A;  1QUQ A;  1WYD A;  1MJC A;  3I4L A;  4XYO A;  4JBK A;  5DAU A;  3J7A V;  2HQE A;  4O1N A;  1PZK D;  1F77 A;  1X6O A;  1V43 A;  2JSO A;  4DK6 C;  3HKZ G;  4X65 Q;  3MXN A;  4ZK9 B;  1EFW A;  4IOA A;  1KLU D;  3NTI A;  3QWN A;  2EYP A;  2EOT A;  4AQY Q;  3CQZ H;  2BH8 A;  1GD7 A;  2PNH A;  1PFM A;  1NUC A;  1AP0 A;  2L0C A;  1WI5 A;  2NYZ D;  2X6G A;  1B53 A;  2IX3 A;  3TS0 A;  3T1Y L;  3S14 H;  2EYO A;  4IQZ A;  4B3R Q;  5IY0 A;  1YNJ C;  1JOK A;  3AYH B;  2Q8I B;  1SRU A;  3A7A B;  4DV2 L;  5TSS A;  1VQN A;  4B3T Q;  5IWA L;  2OTJ A;  4R4Q A;  1W6J A;  1G8Z D;  4FVM A;  2LMC B;  1M8A A;  4OL7 A;  1TII D;  5IOC A;  2R7F A;  1IYV A;  3GTK H;  1CSP A;  2PZW A;  2LKV A;  1IZ6 A;  1GKH A;  4N8X 1;  1B3Q A;  3GTQ H;  3HKS A;  5GAG C;  4NXM Q;  2D5D A;  3I3C A;  2AKW B;  2H4O A;  1V1P A;  4APV A;  2KHS A;  4BBR B;  1HUN A;  4UDU C;  4KY7 A;  4PZ8 A;  3S1R B;  3J81 E;  3SK6 A;  2LY7 A;  1ZYR C;  2WAQ G;  4H7B A;  3PUV A;  4FDB A;  4XQJ A;  1R9T B;  1D8L A;  5NUC A;  4DPG A;  2UUB L;  1DOK A;  2R93 H;  5IT9 c;  3M7N A;  4M1U B;  5LMN Q;  3VYS A;  1TQO A;  3BZK A;  4BXX H;  2E2I B;  3I4M B;  2E2J B;  2EYF A;  3H15 A;  4DR3 Q;  3ULP A;  1TWC B;  1BUV T;  4UPA A;  4IFD G;  3PO3 H;  3MFY A;  1JIC A;  4QIW B;  3SE0 A;  1WOC A;  3SVM A;  4GS3 A;  1SE8 A;  4Q0F A;  3PUX A;  4NKL A;  1KHI A;  1RD9 D;  3LNN A;  4X65 L;  3CCS A;  3J81 i;  1BOS A;  1ET9 A;  1G29 1;  1PH4 A;  4A93 B;  1NBW A;  5KYL A;  3HOZ H;  2IPK D;  1IL2 A;  1DD2 A;  5I6Y A;  3TEH B;  4X6A H;  4YWL A;  1L0W A;  3C46 A;  4R1J A;  5C5M A;  4BBS H;  4K5V A;  1QVC A;  2F0J A;  2PZU A;  1IBK L;  2CQA A;  1MD2 D;  1PLF A;  4KKU A;  4P73 A;  3FPP A;  1MJE A;  3F2B A;  2FMC A;  2KEC A;  3URY A;  2R92 H;  2K75 A;  1O7I A;  1HZB A;  1A62 A;  1YVC A;  3S1Q B;  2K5Q A;  4NB3 A;  5JOB A;  2HT1 A;  3GTM H;  1HR0 Q;  3OYY A;  3D3R A;  4C3J B;  2GA4 B;  2NTS A;  3H3V I;  2A69 D;  2J7Z A;  4LFA Q;  4EQO A;  3PO2 B;  2KOL A;  5FLX E;  1XPR A;  2VUM H;  2ZTE A;  3VR3 A;  1H9S A;  1VQA A;  4K5W A;  1K73 C;  1HCZ A;  1I4P A;  1OXT A;  5KNB A;  4FNF A;  2K1B A;  3P7J A;  1ET6 A;  2J0T D;  4RWS C;  4UP7 A;  1XXG A;  2C35 B;  4GKJ Q;  4KJN A;  4KD3 A;  4K2L A;  1D7Q A;  1Y69 U;  5C44 G;  1EQR A;  3J81 c;  4EX5 A;  1SR3 A;  5EPK A;  5LMN L;  1G2T A;  1F9Q A;  3T1H Q;  3IL8 A;  4DR3 L;  4A3C G;  4POF A;  3MFG A;  1CKN A;  2EXD A;  2PCF B;  1EEF D;  4TSS A;  1B44 D;  3P75 A;  5IP9 G;  4DF7 A;  4OWW B;  4HIM A;  4PZ7 A;  3HOY B;  3LWE A;  3S16 H;  3OWF A;  1XMO Q;  4HCE A;  1PTO D;  1HFN A;  1II3 A;  1Y8N B;  4LF7 Q;  5A35 A;  3C2P A;  2VL6 A;  1RF2 D;  5FJ8 G;  3F2U A;  3KYH C;  1EUJ A;  3SXH A;  1Q12 A;  3A55 A;  3S14 B;  2F0H A;  4RGT A;  3K7A H;  4HED A;  2KBN A;  2NN6 H;  1KTK A;  3K0Y A;  1L1O C;  3WOF A;  4XXE A;  4TRD A;  4OWT B;  1S5E D;  1VCI A;  1PFN A;  4KI0 A;  2VXW A;  1XPU A;  5JEA G;  3JC6 6;  3D0F A;  3KK7 A;  2R6G A;  1SNM A;  1JJG A;  1HR0 L;  3GTQ B;  3S17 B;  2TMP A;  1XTC D;  3DWA A;  4CJ2 C;  3NP8 A;  1ENA A;  1AE3 A;  3QB3 A;  2B2W C;  1KRT A;  2ICI A;  3PGZ A;  1S4Z A;  1K8O A;  1CHQ D;  4LWC A;  3PF4 A;  2A6H C;  5IP7 G;  2KCC A;  5KRU A;  2B63 G;  3UDF A;  5ELE A;  5IT9 L;  3GQB A;  1J5E L;  1DYQ A;  1SYB A;  3L0O A;  2B3G A;  2R93 B;  3F2D A;  1N33 L;  1CFM A;  3AU7 A;  1E2V A;  4HSV A;  2D9U A;  3G48 A;  3PO3 B;  3MHB A;  3HGB A;  2WB1 E;  3DHQ A;  3T1H L;  4KKS A;  4GKK L;  4DAP A;  2EJG C;  1GUW A;  2EY1 A;  1I5F A;  4HMJ A;  5EPJ A;  1PRT C;  3NXW A;  2PQA A;  5ELN A;  5EPL A;  2NVQ H;  2LSS A;  1XMO L;  3K0X A;  3HOW B;  4X66 Q;  5KGU A;  2XSC A;  1YEZ A;  4A3B B;  4XDX A;  1O80 A;  3P20 A;  2OCE A;  1E2Z A;  5CR3 A;  4A76 A;  4BBS B;  1G2S A;  4K0K L;  1SAP A;  1GUN A;  1GUS A;  1HNX L;  3MWY W;  3UE0 A;  4GOP B;  2WIN B;  3I2Z A;  1DON A;  1BCP C;  1IW7 D;  1D5X C;  1ASY A;  5C4J H;  3GTM B;  2VS1 A;  1DJR D;  3OPO A;  5CV4 A;  4R4O A;  4CGY B;  2X6L A;  2ENB A;  1SEB D;  1VQK A;  4IJH A;  1EYA A;  2VUM B;  3CRK C;  1BBX C;  1F2Y A;  5D3D A;  1HFG A;  1UWV A;  1QNK A;  4MTN A;  3S1N B;  5E4W C;  4C3I G;  1SMY D;  1VF5 C;  2F4I A;  3E5S A;  3R2T A;  1M1K C;  2BH2 A;  2K04 A;  2IW3 A;  5BN3 A;  3J81 L;  4RCN A;  1Q8K A;  5HGQ A;  1ROD A;  2F0L A;  1D1K A;  3A8K E;  1U4R A;  1F2L A;  1L1O A;  1PMR A;  3PUZ A;  3OMC A;  2ZM6 Q;  3RN2 A;  4OO1 I;  2K14 A;  1VQ4 A;  1LLR D;  1Y14 B;  4PV1 C;  4QJF A;  4JI3 Q;  1D2B A;  5I2Y A;  1A15 A;  4ZRZ A;  3ERS X;  1H9R A;  2ZTC A;  3LWU A;  4HJ9 A;  3HRZ C;  2G5D A;  3KFU A;  4JC0 A;  4A3M G;  4DR7 Q;  1XTD A;  2F0G A;  1PRT F;  1B9M A;  2EY6 A;  2B2W A;  1KDB A;  5EKI A;  5AJ3 Q;  2CWP A;  3ITP A;  1TY2 A;  5KYI A;  5KNC A;  3K7A B;  4X66 L;  1KNA A;  1X32 A;  4X62 Q;  4XQQ A;  4FYD A;  1RJT A;  2EIF A;  3EBE A;  4A3J G;  1LTR D;  3RUZ A;  5IYC G;  4FF1 A;  1VQ5 A;  2JJQ A;  4DV6 Q;  2X69 A;  4P71 A;  3KBX A;  1YJW A;  3T51 B;  5ELC A;  3WOE A;  3QIA A;  1BCP F;  1QVG A;  1X56 A;  1A3V A;  1UE5 A;  1R4P B;  4JVZ A;  1JOR A;  3W1B A;  2NUC A;  1O7Y A;  2F03 A;  1CKO A;  1ESF A;  1VQ7 A;  1BQQ T;  2B2T A;  5CGK A;  2WV6 D;  3OIQ A;  1EZ6 A;  2ZXO A;  1A8V A;  1SRO A;  1UAP A;  4XT1 B;  4GNX C;  4V19 0;  1VQO A;  2GN5 A;  2WAC A;  4KHP Q;  2CH4 W;  2MQH A;  4ULL A;  2HIX A;  1WTV A;  3VDY A;  1D5M C;  4BY7 G;  2L12 A;  1X3P A;  4X3S A;  4DNR B;  5C44 H;  1K8G A;  1XNR Q;  3AMU A;  1Q82 C;  4L5Q A;  1MBY A;  1EIG A;  1SNO A;  3KF6 A;  1XMQ Q;  1STN A;  3Q6S A;  4L8J A;  4DXF A;  4V0B A;  4RHS A;  1TWA H;  4BA1 I;  4A3C H;  4FP5 D;  3HKZ B;  4NW2 A;  5CV8 A;  3H94 A;  1EYD A;  1SYG A;  5IP9 H;  2ZM6 L;  4N9T A;  2R7Z H;  4DR2 L;  1S40 A;  1NY4 A;  2QDL A;  3X3N A;  4JI3 L;  3PUW A;  1PDQ A;  3IKJ A;  3GTG H;  2E2H B;  3E9I A;  1PH9 A;  3WWV A;  2NVQ B;  5FJ8 H;  4IZ8 A;  2I5M X;  1E1O A;  2RA4 A;  4DR7 L;  1N32 L;  2KHJ A;  1QB5 D;  4NXN Q;  2Z9H A;  4JPB W;  5AJ3 L;  3CW2 C;  2OQK A;  4A3K G;  4IUU A;  4K8J A;  4C3H H;  4OEL B;  1JE4 A;  1J9O A;  1YHQ A;  5JEA H;  3FRP B;  1XYI A;  4YCV A;  5JPM C;  4L63 B;  4UAI A;  3FMC A;  1TY0 A;  1OTC A;  2JA6 G;  4C2M H;  5C4J B;  3EN2 A;  3L2P A;  4DV6 L;  3OW2 A;  2B8G A;  1KNE A;  3SR1 A;  2KCT A;  4ILW A;  4HAE A;  1QOH A;  2F0Q A;  1O7Z A;  2JA8 G;  1YHB A;  4S3S A;  5GAH C;  1W6K A;  1JE5 A;  4GLV B;  1BNZ A;  1X3E A;  3RR5 A;  2GVA A;  2WAQ B;  3D4R A;  2D0P A;  2B63 H;  2A73 B;  5LMN W;  2K5W A;  3I4N G;  4R9W A;  5M5Y H;  4ZYS A;  1MKH A;  2LFN A;  5EKL A;  4KHP L;  2BE5 D;  1PA6 A;  5IGC A;  3CCM A;  4PQX A;  4ME5 A;  1DOM A;  2O5J C;  1WTX A;  1LAC A;  1G91 A;  5IE8 A;  1XNR L;  2M2L A;  2R3Z A;  4EQP A;  1XMQ L;  3OWE B;  5DNF A;  1PZI D;  4LF8 Q;  3D4D A;  2F0D A;  2Q2I A;  1B7Y B;  4I7Z C;  4JV5 Q;  1GUG A;  4P72 A;  4BWG B;  4OWX B;  2JEB I;  4NP5 A;  1NMF A;  1NJI C;  4M8A A;  5GQO A;  2DY7 A;  1TWG H;  2PW7 A;  3DMU A;  1BKB A;  3GO5 A;  3IFT A;  1YIT A;  2AQ3 B;  1TXY A;  4R4T A;  1N36 Q;  1Q81 C;  3K59 A;  4NXN L;  2WB1 G;  1CKM A;  3NBI A;  3CCR A;  1V8Q A;  4CJ0 B;  1K0R A;  3AFQ A;  3SGI A;  2CVR A;  3ERO A;  1YJN A;  3NBH B;  2NZO A;  4MZ9 A;  5ELF A;  4JI0 Q;  2WII B;  1GHK A;  1FVI A;  2ZTD A;  1E1T A;  1MSH A;  1U0L A;  4G7H C;  3PMF A;  3TBI B;  1HNZ L;  2PMZ E;  1X9N A;  1HTL D;  3GTO H;  4C3I H;  4HIK A;  2ES2 A;  3H3V C;  2A69 C;  4IPC A;  2I5L X;  5FKA C;  2R61 A;  1RIP A;  5LL6 S;  1UEA B;  2FHT A;  1SBB B;  2EYJ A;  3S15 B;  1NCV A;  2C9O A;  4WOR A;  5C44 B;  1O7L A;  1K83 H;  5M3M G;  4DV0 Q;  5IWA Q;  2TSS A;  2Q2U A;  4EGV A;  2IX0 A;  3Q23 A;  1X3Q A;  1Q7Y C;  5HGT A;  5D14 A;  1BBU A;  1YIJ A;  4RGN A;  1E0B A;  5E3F A;  4JBM A;  2F0W A;  1HQM C;  4WRD A;  3HOX G; 
#chains in the Genus database with same CATH homology
 5C6A A;  5C5L A;  5CV5 A;  5HUR A;  3VR4 A;  3GTG B;  2EJM A;  3CKI B;  2CW0 D;  5IT9 E;  1WD1 A;  3BZD B;  1ZEQ X;  1PTO C;  4KN4 C;  4IAL A;  4RGM A;  2XWB B;  4C3H B;  2K5D A;  2F0E A;  2A74 C;  3TZD A;  4J6H A;  4WFN 3;  3SK4 A;  4RH6 A;  2D2C C;  2K32 A;  2KJX A;  1PXU A;  4C2M B;  1FYC A;  4ZUJ A;  2IT1 A;  4K5X A;  1OO9 B;  2HCI A;  5CBA E;  2QCP X;  3VA7 A;  3T13 A;  1LTS D;  2E2D C;  3S1M B;  5LHY 1;  2B63 B;  1FNU A;  1DZ1 A;  5M5Y B;  4MIU A;  4YIJ A;  1AZQ A;  3BDC A;  1EEI D;  2EE1 A;  2E76 C;  3M85 A;  1I4G A;  5EJW A;  1D1I A;  5F2D A;  1I6V C;  3GV3 A;  4KJO A;  3ONA B;  1EY8 A;  4X3K A;  2H1E A;  5A2Q L;  3TP7 A;  1ZXT A;  5KEE A;  2PZT A;  3K58 A;  5I2X A;  3RMH A;  2EVB A;  5E4X A;  2B8F A;  3E6Z X;  1TWG B;  1QE6 A;  3NWS A;  4XT3 B;  1H9J A;  4DA2 A;  1B1Z A;  2HDM A;  2F3W A;  1EY5 A;  4KK7 A;  3K57 A;  4K8I A;  1VMP A;  1V1O A;  3TSS A;  5COR A;  4CBV A;  3W3A A;  3A56 A;  1SYF A;  1TR5 A;  2PPB C;  4F7X A;  1IW7 C;  2L11 A;  1SSO A;  3GTO B;  2EPB A;  1VDZ A;  4C3I B;  1NSN S;  4FXK C;  2RDH A;  1PFB A;  5C0X H;  5C3W A;  1NR2 A;  4G7Z C;  1K83 B;  2F3V A;  1F9P A;  3I72 A;  1QWY A;  4ZLT F;  1SMY C;  1TS4 A;  4E6I A;  2K01 A;  5K36 G;  1SE4 A;  1B3A A;  1CZG A;  3MA2 B;  3I70 A;  1GHJ A;  5I9P A;  1C8C A;  2XN9 C;  4A3M B;  1TS3 A;  2ID0 A;  5G3L D;  1CT1 D;  2XVS A;  5J22 A;  4NDX A;  3FVQ A;  4HN7 A;  3PV0 A;  4ODG A;  1BR9 A;  1TU2 B;  4F87 A;  4DAY A;  1RDP D;  1I4X A;  4A3J B;  3OMG A;  2NVY B;  1AFP A;  5IGE A;  3L9A X;  2JP1 A;  2F0I A;  2B2V C;  1SDF A;  3K5N A;  3I73 A;  3D31 A;  1STA A;  3N52 A;  2NN6 I;  2F0V A;  4HSP A;  3DM1 A;  5FO9 B;  3DWQ A;  4F88 A;  3N6R A;  2D62 A;  5ELD A;  3PUY A;  4OIK A;  3K5O A;  4BA2 I;  2L1B A;  4BY7 B;  2IX1 A;  4DK1 A;  2MHV A;  1H9K A;  3HZX A;  1EU4 A;  1RTN A;  1ILP A;  3SEB A;  1EY6 A;  3O13 A;  1AEX A;  4IUQ A;  5EGT A;  2WKD A;  1MI2 A;  3P1H A;  4TKO B;  1EZ8 A;  2AQ1 B;  2RDG A;  1EU3 A;  4EQN A;  1STH A;  1C4Q A;  2K28 A;  2PO4 A;  1CTM A;  5DEH A;  4CHT B;  1NAP A;  4FF3 A;  4A3K B;  3BDO A;  4QUC A;  3K5L A;  2KVM A;  4PMW A;  1WTW A;  5FK9 C;  1EWC A;  1AN8 A;  1UUP A;  4R8N A;  3NQI A;  2F1M A;  4HMI A;  2JA8 B;  4C1N K;  5E1F A;  3J7A F;  5CBE E;  3M3Y B;  1STB A;  4H44 C;  2LS0 1;  3VYT A;  3I4N B;  4G57 A;  1EQV A;  3V05 A;  4XYQ A;  2QIL A;  1S5F D;  1CK1 A;  5M5X B;  3TP6 A;  2OF1 A;  1Y8O B;  2NVX B;  2L55 A;  5CYU A;  2BE5 C;  4IUN A;  1YNN D;  3S9W A;  4J1M A;  4LMQ D;  4PMC A;  3Q22 A;  1JWS D;  4GZY C;  1FD7 D;  2EJF C;  1ML0 D;  1LT3 D;  1F9S A;  2KA7 A;  1TT2 A;  2K6A A;  2NWG A;  1EFI D;  1WTQ A;  2WB1 B;  3MZ5 A;  2EZV A;  4QMG A;  1DCZ A;  5C0X J;  3L3O C;  3Q0A A;  2SEB D;  4IFD H;  4RFB A;  3HEJ A;  1LAB A;  1WTR A;  3BVM A;  5I6W A;  3SHL A;  3BVZ A;  1V1P B;  2Q8T A;  1JOQ A;  2DY8 A;  1U4M A;  1KLG D;  3KBG A;  5M3M B;  3HP3 A;  4B08 A;  4XTC S;  3R93 A;  1I6H B;  3G6J B;  2HDL A;  2SOB A;  4QUF A;  1FGB D;  3NPP A;  5C3X A;  3Q24 A;  4HCS A;  1C48 A;  4KTA A;  3HOX B;  4PMB A;  1HA5 A;  1TWF B;  5M5W B;  1Y1V B;  3TP8 A;  2YU9 B;  1SYC A;  4KY5 A;  1EY9 A;  2Q8R E;  2PW5 A;  2Z4H A;  4RHR A;  3S2H B;  3HOV B;  2JA7 B;  2CW0 C;  3I91 A;  3CHB D;  3BS1 A;  1RTO A;  3HG9 A;  3EA6 A;  5A2Q E;  1MGS A;  5C4X B;  1ESR A;  3ERQ A;  3ND9 A;  2WP8 J;  4DN4 M;  3H0G B;  3A7L A;  1A2T A;  3U9S A;  1H9S B;  2F0P A;  1BXT A;  5EKK A;  3A8I E;  1ICW A;  2A6E D;  2B2U C;  1JC7 A;  1QJO A;  3C3L A;  2VB2 X;  4HTH A;  3VR2 A;  5IOD A;  1SJE D;  3QOL A;  1G6Z A;  2KED A;  3C1F A;  3AB9 A;  2NBF A;  2RSO A;  4KV6 A;  1EOT A;  4IUT A;  4IUR A;  3L7Z C;  5EQ0 A;  3OOC A;  3EJI A;  2EDG A;  4H13 C;  1TKW B;  1PYW D;  4L6T B;  3R8B A;  1TS2 A;  2HCC A;  1U4P A;  4JK1 C;  2EY5 A;  5CV6 A;  2OXP A;  5IGB A;  2QEJ C;  1CZW A;  1S5C D;  4G4K A;  1LTI D;  1HXY D;  3RZO B;  3QJY A;  1LT5 D;  3DWP A;  3QG1 A;  2O4X A;  4KHZ A;  1J8I A;  3MVV A;  1D6E C;  4BS9 A;  1EWH A;  2RQX A;  1D5Z C;  1SNC A;  3QOJ A;  2BCO A;  1VF7 A;  2B2Y C;  3W2D A;  3KF8 A;  5M3F B;  2F0U A;  3GTJ B;  2M9V A;  2EYL A;  4KKT A;  3CU7 A;  2PNR C;  4LAA A;  4IFD J;  2XIW A;  1OXU A;  2AUK A;  3V96 A;  3C1E A;  2EYM A;  3LX0 A;  4F8M A;  1AW7 A;  1JB3 A;  1ZKO A;  2OT2 A;  1LT4 D;  4B9X A;  1MSG A;  5COY A;  4CKE A;  3QO2 A;  4QB4 A;  1JWM D;  2YYZ A;  5I9O A;  2MUY A;  3PIP 3;  1EL0 A;  1JCK B;  2NB0 A;  3KLS A;  4A3F B;  1WCM B;  2XNA C;  1SFO B;  1BDO A;  2IJ0 A;  2K33 A;  1TS5 A;  4I65 A;  2JXM B;  3BG3 A;  1A6X A;  4NMZ A;  4FF4 A;  3KLS X;  1QG7 A;  2PMZ B;  1STY A;  3I90 A;  4CKB A;  3VYR A;  2J4X A;  3D8G A;  3IAY A;  3FPU B;  2F0O A;  1IYU A;  3M4Y A;  2MP1 A;  4XQN A;  1GUO A;  5CV7 A;  4DFA A;  4R8I A;  5G3L F;  2NTT A;  2BDN A;  1A3T A;  2B2Y A;  2BA0 A;  3HOU B;  2A68 D;  2RSN A;  1QNU A;  5BN4 A;  2EY2 A;  4Z9C B;  3MEH A;  3A54 A;  5JEA J;  2JA5 B;  1AZP A;  3GV6 A;  4U67 3;  5J39 A;  1SYE A;  1PRT B;  4K14 A;  2C5C A;  1T5X D;  3T16 A;  4FF2 A;  5JVH 3;  3E0J A;  4ZKC B;  1CI3 M;  1S5B D;  4KD4 A;  4C56 C;  1I50 B;  1PTO F;  2JYO A;  3TP5 A;  2FJ2 A;  2V4D A;  1B50 A;  2AWO A;  5C0X I;  5CV9 A;  3VA5 A;  1BCP B;  3J80 L;  2SDF A;  1EY7 A;  5FO7 B;  2RDF A;  1WVL A;  3D6W A;  2ICE C;  4DK0 A;  1OXV A;  1I4H A;  1YNN C;  3GTP B;  2BOS A;  2I07 B;  1OXX K;  3SK8 A;  2XRS D;  1F2Z A;  1DOL A;  3MXP A;  1OXS C;  1PZJ D;  4DNT B;  2RVL A;  1I4Q A;  3MTS A;  1GOZ A;  5C3E B;  1IHZ A;  3D4W A;  2PYK A;  3S2D B;  5M9O A;  2QKI C;  1LO5 D;  4PNY A;  2AQ2 B;  4OO1 G;  1LTT D;  3U9O A;  1T5E A;  1Q90 A;  1ONL A;  3J7Y W;  1ENC A;  2M00 A;  2FIN B;  2EYH A;  2RBM A;  5K5P A;  2A5H A;  5CC4 A;  3RZD B;  2DNC A;  4A3G B;  3TME A;  2MJ8 A;  3K5M A;  1S5D D;  3OIP A;  3DEO A;  4FO2 A;  2KQ3 A;  4AYB B;  4EVO A;  4ABN A;  1WTO A;  2F0S A;  4HR7 B;  5CMD A;  3CQZ B;  3GD7 A;  4ZAI A;  1LV9 A;  2I46 A;  4ZKB B;  3JAM L;  1WTP A;  1B4O A;  4TQU S;  3M4O B;  2O5I C;  5C4Z A;  3CRL C;  3G7L A;  3IFD A;  4OGQ C;  2K7V A;  4Y7N B;  1GJX A;  4C3H G;  5LL6 X;  3DXJ C;  1M4V A;  4RCO A;  1HA6 A;  1PTO H;  1SNP A;  3OSO A;  2N55 A;  1SNQ A;  4P2C B;  3GTK B;  4JBW A;  2A6E C;  4QCL A;  2JA6 B;  1HTP A;  2KCN A;  1L0X B;  5T1G A;  3FEW X;  4OHJ A;  1YNJ D;  2AWN A;  1Q8I A;  3M7G A;  1L0Y B;  5KIX A;  4RA8 A;  1SJH D;  2JEA I;  1CHP D;  2F0T A;  4KMU C;  1KDA A;  2BDO A;  3R2I A;  4IN3 A;  1BO0 A;  1Q1E A;  3NBH A;  3V2T A;  1CA5 A;  1SE2 A;  3H09 A;  4CKC A;  2B2T C;  1ZYR D;  2B2V A;  5IGD A;  5IGG A;  3GTL B;  3SDZ A;  3HOZ B;  2K05 A;  1GXD C;  1VMC A;  3RD4 A;  2F0M A;  2VB3 X;  3OW7 A;  4IFD I;  2WKC A;  5FOB B;  1Z6H A;  1A2U A;  1LTA D;  2N88 A;  4RKL A;  1HQR D;  2R92 B;  3ZYY X;  4DXG A;  2Z4I A;  4RAU C;  5DM7 3;  1Y8P B;  2IL8 A;  2XWJ B;  1A3U A;  3KUP A;  2CHB D;  2EXZ A;  4X3U A;  3BYT B;  1IL8 A;  3GP7 A;  1BF4 A;  1B9N A;  4CJ1 B;  4DU9 A;  1TWH B;  3MXU A;  1SE3 A;  2MGS A;  1FNW A;  5KND A;  3FDT A;  1CM9 A;  4ZUI A;  2SNM A;  3VR5 A;  1GUT A;  2JE6 I;  5DM6 3;  4G7O C;  1U4L A;  2E75 C;  2OEO A;  4QF4 A;  4ZQ3 A;  3PIO 3;  3X3M A;  2QDB A;  3NTK A;  5D65 A;  3K6O A;  3S16 B;  2KUM A;  1LTG D;  5K36 H;  2FMM A;  4C3J G;  5JAV A;  3SK5 A;  1JR0 D;  1B2T A;  2Z8L A;  2ZXR A;  2RKS A;  3TDQ A;  4FXG C;  4OO1 H;  1Z47 A;  4WJW A;  4MHE A;  2VNU D;  1CQV A;  2AUJ D;  1HHV A;  1PTO B;  5JVG 3;  4OIJ A;  2G9D A;  4K6L A;  1JWU D;  3EFX D;  1RHP A;  1EYC A;  1Z7T A;  1U9R A;  1QIL A;  2QF7 A;  5FLX L;  2DN8 A;  4U68 A;  3MXG A;  1QCB D;  2L5T A;  3NE5 B;  4J8Q A;  4LK1 C;  5JPN C;  5D3I B;  2F0F A;  2SNS A;  2Z1C A;  4KHV A;  5AFW A;  4A3I B;  3DUZ A;  5EBD A;  3T53 B;  1KAA A;  5FO8 B;  1SND A;  1EIH A;  1IKL A;  1LTB D;  3J80 E;  3T56 B;  3H6M A;  4MN3 A;  4IUV A;  2A6H D;  4FXD A;  1DM0 B;  3MC0 B;  4IUP A;  3I8Z A;  2F0K A;  2ZXP A;  3R3O A;  1I3Q B;  3OHX C;  2K03 A;  2A68 C;  3VYU A;  3A8J E;  5BN5 A;  5I4D A;  1RCV D;  1I4R A;  1CA6 A;  1F9R A;  2B39 A;  3DEP A;  5IGF A;  1EY0 A;  1PRT D;  4KY6 A;  2PQE A;  3D6C A;  5IIF A;  4XIG S;  3FKI B;  2FFK B;  4H0L C;  5J1Z A;  1HRJ A;  1F2M A;  1HUM A;  1STG A;  1SYD A;  1TVX A;  4X3T A;  1JQY D;  3NQT A;  2DNE A;  5C0X G;  2NZ1 D;  1LT6 D;  1BCP D;  4B9W A;  3KLR A;  1DXM A;  4A3E B;  5ELB A;  2L4N A;  5C4H A;  3BYY B;  1ENF A;  4O42 A;  2MPM A;  1XX8 A;  5EBC A;  3TN2 A;  1E2W A;  4RKB A;  1CQF A;  2L9H A;  1R4Q B;  3NUC A;  2G9H D;  4RGO S;  3RLF A;  4LJZ C;  4DGZ A;  1HPC A;  4DAV A;  4KN7 C;  2F0N A;  4K2K A;  1UNS A;  3TZU A;  2NVT B;  1Q3L A;  4K6D A;  1RKN A;  2KEE A;  3NHH A;  2B2U A;  3NK9 A;  5ISR A;  3T4A C;  2HUG A;  4A3D B;  3JAM E;  3NTH A;  2Y0S B;  3VR6 A;  1Y1W B;  5JJZ A;  2IWH A;  3WDN A;  2XRQ D;  2E74 C;  1KDC A;  5T1I A;  3NWT A;  1O78 A;  3HS0 C;  2NN6 G;  3NSW A;  1TWA B;  2ZT9 C;  1IKM A;  1NR4 A;  4BY1 B;  3BVG A;  2BA1 A;  1STE A;  2R7Z B;  1EY4 A;  1JOO A;  2O2L D;  1H9M A;  1ILQ A;  3EQL C;  1SXT A;  1WD0 A;  3MAQ A;  1KAB A;  4ID6 A;  3UI2 A;  1EQT A;  4Q5V A;  3BDL A;  3ND8 A;  1K8M A;  4N9P A;  1FNV A;  1FR3 A;  1XWE A;  4C1N I;  3EVQ A;  3H91 A;  1Q1B A;  3I4L A;  4XYO A;  5DAU A;  3J7A V;  2HQE A;  4O1N A;  1PZK D;  1F77 A;  1V43 A;  2JSO A;  3MXN A;  4ZK9 B;  1KLU D;  3NTI A;  3QWN A;  2EYP A;  2EOT A;  1PFM A;  1NUC A;  1AP0 A;  2L0C A;  2NYZ D;  2X6G A;  1B53 A;  2IX3 A;  2EYO A;  4IQZ A;  1YNJ C;  1JOK A;  2Q8I B;  3A7A B;  5TSS A;  1W6J A;  1G8Z D;  4FVM A;  2LMC B;  1M8A A;  4OL7 A;  1TII D;  5IOC A;  1IYV A;  2PZW A;  2LKV A;  2D5D A;  3I3C A;  2H4O A;  1V1P A;  2KHS A;  4BBR B;  1HUN A;  4UDU C;  4KY7 A;  3S1R B;  3J81 E;  3SK6 A;  2LY7 A;  1ZYR C;  4H7B A;  3PUV A;  4XQJ A;  1R9T B;  5NUC A;  1DOK A;  3M7N A;  4M1U B;  3VYS A;  1TQO A;  2E2J B;  2E2I B;  3I4M B;  2EYF A;  1TWC B;  1BUV T;  4IFD G;  3MFY A;  1JIC A;  4QIW B;  3SE0 A;  3SVM A;  4Q0F A;  3PUX A;  4NKL A;  3LNN A;  1RD9 D;  1BOS A;  1ET9 A;  1G29 1;  4A93 B;  5KYL A;  2IPK D;  1DD2 A;  5I6Y A;  3C46 A;  5C5M A;  4K5V A;  2F0J A;  2PZU A;  2CQA A;  1MD2 D;  1PLF A;  4KKU A;  3FPP A;  2FMC A;  2KEC A;  3URY A;  3S1Q B;  2K5Q A;  5JOB A;  3D3R A;  4C3J B;  2GA4 B;  2NTS A;  2A69 D;  2J7Z A;  4EQO A;  3PO2 B;  2KOL A;  5FLX E;  3VR3 A;  1H9S A;  4K5W A;  1HCZ A;  1I4P A;  1OXT A;  5KNB A;  4FNF A;  2K1B A;  3P7J A;  1ET6 A;  2J0T D;  4RWS C;  1XXG A;  4KJN A;  4KD3 A;  4K2L A;  1Y69 U;  5EPK A;  1G2T A;  1F9Q A;  3IL8 A;  3MFG A;  2PCF B;  1EEF D;  4TSS A;  1B44 D;  3P75 A;  4DF7 A;  3HOY B;  3LWE A;  3OWF A;  4HCE A;  1PTO D;  1HFN A;  1II3 A;  1Y8N B;  5A35 A;  3C2P A;  1RF2 D;  3F2U A;  3SXH A;  1Q12 A;  3A55 A;  3S14 B;  2F0H A;  4RGT A;  4HED A;  2NN6 H;  1KTK A;  3K0Y A;  3WOF A;  4XXE A;  4TRD A;  1S5E D;  1VCI A;  1PFN A;  4KI0 A;  2VXW A;  5JEA G;  3KK7 A;  2R6G A;  1SNM A;  3GTQ B;  3S17 B;  2TMP A;  1XTC D;  3DWA A;  4CJ2 C;  3NP8 A;  1ENA A;  3QB3 A;  2B2W C;  2ICI A;  1S4Z A;  1K8O A;  1CHQ D;  2A6H C;  2KCC A;  5KRU A;  5ELE A;  5IT9 L;  3GQB A;  1DYQ A;  1SYB A;  2R93 B;  1CFM A;  3AU7 A;  1E2V A;  4HSV A;  2D9U A;  3PO3 B;  3MHB A;  3HGB A;  3DHQ A;  4KKS A;  4DAP A;  2EJG C;  1GUW A;  2EY1 A;  4HMJ A;  5EPJ A;  1PRT C;  3NXW A;  5EPL A;  3HOW B;  5KGU A;  2XSC A;  4A3B B;  4XDX A;  1O80 A;  3P20 A;  1E2Z A;  5CR3 A;  4BBS B;  1G2S A;  1SAP A;  1GUN A;  1GUS A;  3MWY W;  2WIN B;  1DON A;  1BCP C;  1IW7 D;  1D5X C;  3GTM B;  1DJR D;  3OPO A;  5CV4 A;  4CGY B;  2X6L A;  2ENB A;  1SEB D;  1EYA A;  2VUM B;  3CRK C;  1BBX C;  1F2Y A;  5D3D A;  1HFG A;  1QNK A;  3S1N B;  5E4W C;  4C3I G;  1SMY D;  1VF5 C;  2F4I A;  3E5S A;  3R2T A;  2K04 A;  2IW3 A;  5BN3 A;  3J81 L;  4RCN A;  1ROD A;  2F0L A;  1D1K A;  3A8K E;  1U4R A;  1F2L A;  1PMR A;  3PUZ A;  3OMC A;  4OO1 I;  1LLR D;  4PV1 C;  1D2B A;  5I2Y A;  1A15 A;  4ZRZ A;  1H9R A;  3LWU A;  3HRZ C;  2F0G A;  1PRT F;  1B9M A;  2EY6 A;  2B2W A;  1KDB A;  5EKI A;  3ITP A;  1TY2 A;  5KYI A;  5KNC A;  3K7A B;  1KNA A;  1X32 A;  4XQQ A;  4FYD A;  1RJT A;  1LTR D;  3RUZ A;  4FF1 A;  2X69 A;  3KBX A;  3T51 B;  5ELC A;  3WOE A;  3QIA A;  1BCP F;  1A3V A;  1R4P B;  1JOR A;  2NUC A;  1O7Y A;  2F03 A;  1ESF A;  1BQQ T;  2B2T A;  5CGK A;  2WV6 D;  3OIQ A;  1EZ6 A;  2ZXO A;  1UAP A;  4XT1 B;  4V19 0;  2WAC A;  4ULL A;  1WTV A;  1D5M C;  2L12 A;  1X3P A;  4X3S A;  4DNR B;  3AMU A;  1MBY A;  1EIG A;  1SNO A;  1STN A;  3Q6S A;  4L8J A;  4DXF A;  4V0B A;  4RHS A;  4BA1 I;  4FP5 D;  3HKZ B;  4NW2 A;  5CV8 A;  3H94 A;  1EYD A;  1SYG A;  4N9T A;  3X3N A;  3PUW A;  1PDQ A;  3IKJ A;  2E2H B;  2NVQ B;  4IZ8 A;  2RA4 A;  1QB5 D;  4IUU A;  4K8J A;  1JE4 A;  1J9O A;  5JEA H;  3FRP B;  1XYI A;  5JPM C;  4L63 B;  4UAI A;  3FMC A;  1TY0 A;  5C4J B;  2B8G A;  1KNE A;  3SR1 A;  4ILW A;  4HAE A;  1QOH A;  2F0Q A;  1O7Z A;  4S3S A;  1W6K A;  1BNZ A;  2WAQ B;  3D4R A;  2A73 B;  2K5W A;  4R9W A;  4ZYS A;  2LFN A;  5EKL A;  2BE5 D;  5IGC A;  4PQX A;  4ME5 A;  1DOM A;  2O5J C;  1WTX A;  1LAC A;  1G91 A;  2M2L A;  2R3Z A;  4EQP A;  3OWE B;  5DNF A;  1PZI D;  3D4D A;  2F0D A;  4I7Z C;  1GUG A;  4BWG B;  2JEB I;  4NP5 A;  4M8A A;  2DY7 A;  2PW7 A;  3DMU A;  3GO5 A;  3IFT A;  2AQ3 B;  3K59 A;  3NBI A;  1V8Q A;  4CJ0 B;  2CVR A;  3ERO A;  5ELF A;  2WII B;  1GHK A;  1MSH A;  4G7H C;  3PMF A;  3TBI B;  1HTL D;  3H3V C;  2A69 C;  5FKA C;  2R61 A;  5LL6 S;  1UEA B;  2FHT A;  1SBB B;  2EYJ A;  3S15 B;  1NCV A;  2C9O A;  4WOR A;  5C44 B;  1O7L A;  2TSS A;  4EGV A;  2IX0 A;  3Q23 A;  1X3Q A;  5HGT A;  5D14 A;  4RGN A;  1E0B A;  5E3F A;  2F0W A;  1HQM C;  4WRD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...