3TBIB

Crystal structure of t4 gp33 bound to e. coli rnap beta-flap domain
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
228
structure length
228
Chain Sequence
MIHIQELACVSRDTKLGPEEITADIPNVGEAALSKLDESGIVYIGAEVTGGDILVGKVTPKGETQLTPEEKLLRAIFGEKASDVKDSSLRVPNGVSGTVIDVQVFTRDGVEKDKRALEIEEMQLKQAKKDLSEELQILEAGLFSRIRAVLVAGGVEAEKLDKLPRDRWLELGLTDEEKQNQLEQLAEQYDELKHEFEKKLEAKRRKITQGDDLAPGVLKIVKVYLAVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords RNA polymerase-associated protein Gp33
publication title Crystal structure of T4 gp33 bound to E. coli RNAP beta-flap domain
rcsb
source organism Enterobacteria phage t4
total genus 57
structure length 228
sequence length 228
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2011-08-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.150 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3tbiB01
3RZDB 2WAQB 4C2MB 3GTOB 4C3IB 4AYBB 5C44B 2LY7A 5C3EB 3GTMB 1YNJC 5M3FB 4KN7C 2NVYB 2NVTB 1IW7C 3TBIB 2JA5B 1I6HB 2A69C 3HOVB 4A3IB 3GTPB 3S2DB 3HOUB 4A93B 4A3DB 1HQMC 3HOZB 1TWAB 1WCMB 1ZYRC 2JA7B 3FKIB 2B63B 3S1QB 1I6VC 4BBSB 2WB1B 2E2IB 5M5WB 3K7AB 3S16B 3RZOB 3HKZB 2CW0C 3WOEA 4LK1C 3S15B 4Y7NB 3S17B 2JA8B 1TWFB 2NVXB 4QIWB 2A68C 3M3YB 2R92B 2PPBC 3I4MB 4G7OC 4A3BB 4A3FB 5M5XB 5C4JB 3PO2B 4A3KB 1TWCB 2O5JC 2PMZB 1TWHB 2E2JB 1Y1WB 4G7ZC 4BBRB 3CQZB 4GZYC 2R93B 5M5YB 3S1NB 3HOXB 3I4NB 3HOYB 2R7ZB 1I50B 3GTQB 3GTKB 4A3JB 4KMUC 3H0GB 5M3MB 4C3JB 1SFOB 3S1MB 4C3HB 2E2HB 3PO3B 4JK1C 1R9TB 3GTJB 4LJZC 1YNNC 2BE5C 3GTGB 4A3MB 4G7HC 3S2HB 2O5IC 5C4XB 3EQLC 3GTLB 2Y0SB 2NVQB 1I3QB 3DXJC 4A3GB 2YU9B 2JA6B 4BY1B 3HOWB 3H3VC 1SMYC 1TWGB 4KN4C 3S1RB 4BY7B 3M4OB 3WOFA 2A6HC 1Y1VB 2A6EC 1K83B 2VUMB 4A3EB 3S14B
chains in the Genus database with same CATH superfamily
3J80L 3MTSA 3BS1A 4R4OA 3QWNA 4CBVA 4RG1A 5C0XG 1E24A 1YZ6A 5C0XH 2LY7A 1VQEA 3D31A 1A8VA 3NPPA 2JSOA 4GN4B 2F0PA 1D7QA 5KRUA 2B2WC 2IY5B 5FO8B 4DK1A 1HZBA 4DR7Q 1WD1A 4IUVA 4PG3A 1V43A 3DUZA 5IGCA 1RKNA 4A93B 3HG9A 2Z0SA 3OWFA 1O7LA 4RGNA 4NMZA 4FF3A 2I5MX 1UE5A 1ZYRC 4RGTA 4WFN3 2AKWB 1MD2D 2QGQA 5BN5A 4NXNL 4JBWA 2ZXRA 4YWMA 5FKAC 2HT1A 2E2IB 4XXEA 4U68A 4DR1Q 4O2DA 2B2UA 3S16B 3S17B 4S3SA 3LX0A 4LFAQ 4DA2A 4QUCA 3HKZG 2MNAA 2DJGC 1HRJA 2MJ8A 4DV5Q 2OEOA 2L9HA 2FHTA 1QVCA 1O80A 5IGBA 4GOPC 3KDFA 4IUQA 1VQFA 2NUCA 1EZ8A 4A3FH 5CYUA 4JI1Q 1FJGQ 1KHIA 1SDFA 3U4VA 4C3JB 1EQTA 1Y1WG 1Y1WH 4DV7Q 5M5YH 4YWLA 1WOCA 4CJ2C 1VQ8A 4JI3L 5LHY1 2NZ1D 4K8IA 1L0XB 1JB3A 4DV1L 4K6DA 3H0GG 2NN6I 5I9OA 4N8FA 4TSSA 3N6RA 1IHZA 4HMIA 4UDUC 2JE6I 1VQIA 1F9QA 1PV4A 3AQQA 2B63H 1ONLA 1F9PA 4J1MA 5IGFA 1CQVA 1EOTA 2NZHA 4A3GB 4CHTB 1X3PA 4LF7L 1NTGA 4A3MG 4A3MH 2A8VA 1ICWA 3GTMH 4B3SQ 5LMNW 1EOVA 1TT2A 2VUMB 1WTQA 1VQLA 4NPSA 2OTJA 1Q12A 1X3EA 2Q2IA 3CC7A 1TU2B 2J0TD 1B44D 3PQIA 1LTGD 3KK7A 3M9BA 3VYTA 1CKMA 4WORA 1PH4A 1WFQA 3T53B 1DOMA 2B2YC 2OQKA 2UUBL 2MUYA 4OGQC 1IYVA 3K81C 1W6KA 4JC0A 4DGZA 1KAAA 2NVYH 3S2DB 1YHBA 4GLXA 1H9RA 3OPOA 4QL5A 4A3IG 4A3IH 4OX9L 2ZJQA 4DU9A 4X62Q 2JYOA 2K5DA 3T4AC 2HDLA 1TWCH 1AEXA 4DN4M 3K6OA 4JI0L 2E75C 2CW0C 3CCRA 3S1QH 4AYBE 1T9HA 2Z4IA 3H94A 2WV6D 2F4VL 1UNSA 2KEDA 3KLWA 3C46A 2O2LD 2ZJPA 1B50A 5CGKA 1UWVA 1X56A 2EY6A 4EVOA 1PMRA 1SYDA 2A5HA 2R6GA 1DJRD 5LL6X 2H1EA 4DK3C 5E1FA 3GTGH 5BR8L 4N9TA 1EZ6A 1IYJB 4MHEA 3NQTA 5DM63 1V1OA 3GTKH 2M00A 4JK1C 5M3MH 5M3MG 3S1RH 3OW7A 2RVLA 1SE8A 3H15A 3NENA 2F0TA 5G3LF 5KNBA 1P16A 3KLRA 1Q46A 2Z9HA 3K5MA 4LFBL 1WI5A 3W2DA 1Q8KA 4NXNQ 2OWOA 3H3VC 3RN5A 1LLRD 4JBMA 1Z7TA 2K75A 5HGQA 4OEMB 5M3FH 2PMZE 3PUZA 1HZCA 2B2UC 3DM3A 4LAAA 1K83B 1IBKQ 4A3EB 1YITA 4P74A 2KCTA 1JJGA 5EAYA 4C3IB 2K7VA 4NW2A 4ZK9B 5C3EB 1AE3A 4KJOA 2ZTEA 1I4RA 1WTXA 3J80i 2JA5B 4AYBG 2RCFA 3D6CA 5KYLA 4XYQA 2LFNA 4JI3Q 4A3DB 1SR3A 4DV1Q 2FINB 4XTCS 4ZKCB 1EWHA 1RD9D 4IPHA 1ENFA 1GUTA 1SE4A 1TS2A 3OW2A 2I5HA 1TVXA 3SK6A 2KVMA 1JE5A 1HNXQ 1N34L 2PNHA 2DGYA 4ZUIA 1VQ9A 1WCMG 1WCMH 1QE6A 3RZOB 2EDGA 1JMCA 5LMUQ 2KENA 2R61A 4HSVA 2CWAA 4LF7Q 1HHVA 4B3ML 2NB0A 2UXDL 3CAMA 4JOIA 4Q0FA 5IP7H 5IP7G 2I46A 3RLOA 1SJHD 1SFOH 1ICFB 3VA7A 3DWAA 1VQDA 4JVZA 5I2XA 2XNAC 1DOKA 1YHQA 3GQBA 4H02A 1MKHA 1LTAD 2A6HD 4N9PA 5FJ8H 5FJ8G 2EPBA 3L0OA 1WTRA 3RLFA 3D3RA 2UUCL 2UUBQ 4XQJA 3PSIA 3HOYH 2BOSA 3HOYG 4J6HA 3TP6A 4E6IA 3EFXD 1E1TA 1X55A 4ZAIA 3MA2B 1LV9A 1Y1VH 5T1IA 4OX9Q 4OWWB 5C0XI 3J80E 2NBFA 4WJ4A 5D3IB 1H9SB 2VB2X 2VY3A 1YJNA 3RD4A 1K28A 3M7NA 4TVAB 3GTJH 3MFYA 3DXJC 3ERSX 5EGTA 1U5KA 4H13C 4DAPA 3F2UA 3Q22A 2YTVA 4KY6A 1HR0L 1XX8A 1E7ZA 1UE1A 4JI0Q 1PRTC 2Z6KC 3PIPA 4RCNA 5GAHC 2F4VQ 1TWGH 1L1OB 1TS4A 4DXFA 4DUZQ 2DY8A 4FP5D 3PCOB 4JI2L 3GTOB 3HOUH 4IN3A 3W3AA 1M1KC 3DEPA 1XNRL 3CXCA 4B3TL 5KNCA 2AQ3B 1VQGA 1ML0D 1E22A 1EQQA 3U9SA 4LF5Q 3KFUA 2EXZA 1HPCA 2A69C 1XMQL 3CCVA 5CORA 4OIJA 5BR8Q 5IGGA 1EFWA 1B3AA 4DV6L 4KKUA 1RDPD 4DK6C 2K04A 3NTHA 2HQEA 2LSSA 3VR3A 1N8RC 5JPMC 1XWEA 2JA7B 1CA6A 3FKIB 1V1PA 5ELDA 1Y14B 2MO0A 2EY5A 5C4ZA 3PMFA 5DLQE 1JC7A 2PZWA 1E2VA 1TWAH 4QJFA 4JI6L 4LFBQ 2VQEL 5JEAJ 1JWSD 4BBRH 3D0FA 1HJPA 3QJYA 4K0KL 1BO0A 3HOXH 1QVFA 3R93A 3A0JA 1EEFD 1TKWB 1B1ZA 1MSGA 4LNQA 4RKLA 4APVA 3CMEA 5E3FA 3TS2A 2IJ0A 2JA8G 2JA8H 2E8GA 1R4PB 1H95A 4IPDA 4WJ3M 1U4RA 3T16A 3I4NB 1A2UA 3PO2H 3PO2G 1PZKD 1J8IA 1BCPC 4PV1C 1N32L 3G6JB 2F3IA 2SOBA 4PMBA 2Q8RE 1GKHA 2TMPA 1F2YA 3GV6A 5EPLA 5C0XJ 1PFNA 2IX3A 2BE5C 3LGJA 3TZDA 1UEBA 4CGYB 1VDZA 3AMUA 2ZTDA 3OIQA 4XDXA 3F2BA 1TS3A 5IYDG 3CPWA 2RHSB 1N34Q 4JYAL 4K5VA 1PZJD 2B39A 4IOAA 4ZKBB 3ZYYX 2GA4B 3U4ZA 1I3QH 1QUQA 2UXDQ 5HGTA 5EPKA 3CPFA 3WWVA 3OOCA 4JOIC 1J5EL 4DPGA 3K58A 5LMNL 1B9MA 5JPNC 3SK8A 4A93H 1HZAA 3CHBD 4QGUA 2DUDA 2OTLA 2NVTB 2IT1A 1WTPA 4EX5A 3CKIB 1IL2A 3E0EA 3SK4A 1EL0A 1EU4A 2D9UA 1FD7D 2AQ2B 4DR5L 1NR2A 1Q81C 4DV2Q 2E2IH 3KJOA 1JOKA 2UUCQ 1JICA 4MTNA 4BY1G 1HQMC 4GNXB 4NXML 3S17H 1OXUA 4R4IA 1HXYD 1CZWA 1QNKA 1D6EC 5IWAL 4BA1I 3ONAB 4FO2A 1KIXA 4BBSB 1EQRA 1CHQD 1D1KA 4ZRZA 1B4OA 2E74C 3URYA 3PIO3 3Q23A 2K52A 1HR0Q 4HR7B 2NVXB 3T13A 3V05A 5M5WH 5FLXL 3H3VI 1TR5A 2I0QA 2F0GA 5M5XB 5IYCG 5IYCH 2EOTA 4KD3A 3CQZB 4JI2Q 1VF7A 3TP5A 1LTTD 3NTIA 1ILPA 3GTQB 2QDBA 1XNRQ 1SNMA 1PTOB 1VQKA 2ZXOA 2EYMA 1I4PA 2XTIA 3A54A 1EU3A 3Q8DA 1VQ4A 1XMQQ 1XJVA 1OTCA 4K2KA 4A3JG 1KTKA 1WYDA 5J22A 1PXUA 4DV6Q 1JT8A 2TSSA 2UXBL 5IT9c 1F2LA 1HFNA 3AYHB 3MXUA 4IJHA 3ND9A 1NMFA 2F0UA 3HP3A 2JP1A 4I7AA 4QIWE 2UXCL 4GN5A 2K01A 3ER0A 3BZCA 1STEA 4QMGA 3R2TA 4ZYSA 4KN4C 4HIMA 2HD3A 4JI6Q 1SYCA 3S24A 4K0KQ 4YHHL 5JEAG 5JEAH 2YU9H 2VL6A 3UE0A 2DNEA 4MNOA 2WAQB 3I3CA 1RL2A 5DNFA 1G51A 2DN8A 1PLFA 2AMCB 1KRTA 1YNXA 2WACA 1HUNA 1GUNA 1BCPB 3H91A 4RGOS 3I90A 1I4GA 5C44G 3K7UC 5C44H 3J81j 1E0BA 2N49A 3GTPB 1E2ZA 1QNUA 4HEDA 4AQYL 2LS01 2EZVA 3CCMA 1N32Q 4NP5A 1XNQL 2EYJA 2WFWA 2J7ZA 2K5QA 1DZ1A 4F8MA 1H9SA 1CK1A 1E3PA 2KECA 2L5TA 5DEHA 2B29A 5IOCA 2AWNA 1EY4A 1C7YA 4GKKL 5C3XA 1PHJA 5DAUA 1K0RA 2IX0A 3OMCA 4HMJA 4RGMA 4XIGS 5JJLA 1B8AA 2FFKB 2L11A 3SXHA 4DNTB 4JYAQ 2HIVA 4IO9A 3FMCA 3EA6A 3OHXC 2A68C 2R92B 4F88A 1R4QB 3VA5A 2VQFL 4IUUA 4A3BB 2NTSA 2EQSA 5C4JB 2WP8J 1HZ9A 1BR9A 1J5EQ 3PGZA 5LMNQ 1PTOD 4G7ZC 4L6TB 3BZDB 4JI5Q 2C9OA 2OT2A 3I4MH 1EYCA 3Q24A 3CCSA 1Q8IA 2C5CA 1C8CA 2F0EA 4GS3A 2E2JH 1PH6A 1UUPA 4IFDG 4DR2L 4IFDH 2R93G 3KF8B 1XPOA 2R93H 3S1NH 2FMCA 4C3HB 1IBKL 4OIKA 1KL9A 1X65A 4DR5Q 2F0QA 2IX1A 3NK9A 1ESFA 3DMUA 1MIUA 2N88A 3QOJA 3L3OC 3MXGA 1YNJD 2K28A 3MAQA 1K83H 4NXMQ 4A3EH 2ATWA 2NTTA 3EQLC 3CCLA 2Y0SB 4DNIA 1K3BC 5IWAQ 4PZ8A 3RLNA 1AW7A 4A3FG 4BY1B 2GVBA 3G48A 3TRZA 4DK0A 1SNOA 3AB9A 4BY7B 1BDOA 1A3VA 4UP9A 2X69A 4R8NA 2JA5H 1NSNS 1BKBA 4UAIA 1D5ZC 1KRSA 3FEWX 4H0LC 5ELFA 1XMOL 1ASYA 1S3OA 4X66L 4HCEA 1AE2A 1BCPD 1NJIC 1HNXL 2B63G 1HNZL 2BH2A 2QF7A 3TS0A 3S14H 2F0HA 4G4KA 4R4TA 4C2MH 5LMUL 5CC4A 2CVRA 2F0OA 3HOVB 4CDDC 2ICIA 2BE5D 1LYLA 3RZOH 2EJMA 3A55A 3RUZA 3C1EA 2HCIA 2N78A 3I56A 5A35A 2PZUA 5IIFA 2UXBQ 1KNAA 3I70A 1PTOF 5EQ0A 2O4XA 4YIJA 1CKNB 2F0NA 2Z6BA 1UEAB 4POFA 5NUCA 2IPKD 3D4WA 2UXCQ 1BQQT 1LTBD 1V8QA 3BJUA 4O42A 2A1AA 1YVCA 2B8GA 3S9WA 1WJJA 1QG7A 1PDQA 3HGBA 2F0FA 1VCIA 3AU7A 3HEJA 2FXQA 4L8JA 4YHHQ 1X54A 1EQVA 5E7NA 1GOZA 5E4WC 4A3KB 4LFCQ 2HQLA 3BVZA 2CFMA 1SJED 2PNRC 3PUXA 4KY5A 3M3YH 5FLXc 5L37A 4JPBW 1VMPA 2VZAA 4A4IA 1BF4A 5IYBH 5IYBG 3JAMc 1GUSA 2KA7A 3JAMi 1KC8C 3NEMA 2RHQB 1G91A 2R7ZH 2R7ZG 2AHOB 1ZKOA 1I50H 1K8OA 3QOLA 4X64L 1SBBB 3D6WA 2E2HB 4AQYQ 4PZ6A 2WB1E 4DUZL 1XNQQ 1R9TB 4LJZC 3K57A 1KDCA 1S5CD 3I2ZA 4HIKA 2QKIC 2B2VA 3S2HB 2BDOA 3I4OA 1D5XC 2JA9A 3TZUA 1BCPF 5CR3A 1K9MC 1G291 3DWPA 4KHZA 1H9KA 4GKKQ 1SLJA 1N33Q 4LF5L 4P73A 2BCOA 2HIXA 4OL7A 1IL8A 5C4XH 5C4XG 1KLGD 3GTLH 4WJWA 2V4DA 2L0CA 2NVQH 1Q7YC 1GVPA 4HCSA 4JCVE 5EBDA 4ZQ3A 1PH8A 2MQHA 2VQFQ 1XPUA 2DJFC 1S4ZA 4Z9CB 2P5ZX 4FNFA 3CCQA 3FHWA 3CF5A 1SROA 1STAA 1LT6D 2A19A 4ILWA 4L5TA 4QF4A 3L7ZC 1IW7C 2Q8IB 3UE1A 4RWSC 2BDNA 3MWYW 5M3FG 4DR2Q 4RH6A 2PW7A 3OWEB 4B08A 3R2IA 1I6HH 1JJCB 1OXXK 2V1CC 3RNUA 5FLXE 4IPCA 4NDXA 4WRDA 1EY0A 1F77A 4EQOA 4GOPB 3HOZG 3HOZH 1XXGA 4OONA 4DNRB 4DR6L 3OIPA 3NWSA 1M90C 2H5XA 3HKZB 1H9MA 1FGUA 4YCWA 2L55A 5CV5A 4DAMA 4DXGA 3CU7A 4XYOA 1DCZA 2WB1G 2AQ1B 1LUZA 1YNND 4MZ9A 1IYUA 4DAYB 5IGEA 2PPBC 4A3LG 4A3LH 3U50C 2F0KA 4RMFA 4A3FB 2MFIA 2QDLA 3J7AV 1WTWA 1PYBA 4HJ9A 1Q82C 1Y1WB 2PYKA 1ENCA 5M5YB 1XMOQ 4U673 4X66Q 5D14A 1EY6A 1HNZQ 3H0GB 2ICEC 3SVMA 4A75A 1SYBA 4HSPA 1FR3A 2A6ED 2YTXA 2K5WA 2FJ2A 5CV4A 3I73A 4X3TA 4IUTA 3W5OA 1K8MA 3K0YA 2J4XA 5CBAE 1RF2D 2K5VA 3ERQA 3O13A 3TN2A 1ZXTA 1DGSA 5JAVA 4A3MB 1YIJA 1EY5A 2OQ0A 2PCFB 4KHVA 4YCVA 2G5DA 1CSQA 1SRUA 1HQRD 3P1HA 3K8AA 5K5PA 1WVLA 1LM0A 4ID6A 1MHWC 2Z8LA 5I2YA 1EYAA 3EJIA 3ULLA 3LWEA 3A74A 4K6LA 3CC2A 1OO9B 1LT3D 5IT9L 3CCEA 4DV2L 1H9JA 1TS5A 4MIUA 4LF9L 2KBNA 3UI2A 2JA6G 2JA6H 3A8KE 1F2MA 3HOWH 3HOWG 1ZYRD 5T1GA 3IAYA 1I5FA 2D0PA 4FVMA 5KGUA 2OCEA 1EWCA 4ABNA 1Y1VG 3V96A 2JEBI 4ZUJA 1EY9A 1A3TA 2WINB 3RZDH 2NVYB 3KF8A 4JV5L 1A2TA 1E2WA 1UE7A 1A0IA 1O7YA 1SAPA 4CKEA 3H6MA 4A3IB 2GN5A 1VQ6A 4BBSH 2CH4A 3I4LA 1Y8OB 3KF6B 3MC0B 5C3WA 1L2FA 3E3XA 1ENAA 1EUJA 1F9SA 2CH4W 4QY7A 1RTOA 4X64Q 2L12A 2VW9A 1RODA 1GO3E 4GLVB 1TIID 1P8LA 1YEZA 3F1ZA 3HOUG 2CQAA 4IPGA 3S1QB 4MTKA 3L2PA 4FF4A 1IXRA 1JB7A 5IODA 1I6VC 3A56A 4OXPA 2F3WA 5GAEC 4X3KA 4X65L 3BVGA 4TKOB 3MXPA 3CQZH 1CQFA 1KLUD 1N36L 5C5LA 3E0JA 3GDEA 2I07B 3FDTA 1S5BD 3R3OA 1U4MA 4JBJA 2C35B 3K7AH 3F2DA 2MGSA 4L5RC 2N8NA 1K8GA 2LXKA 2OF1A 3I8ZA 1STHA 1LTLA 4Y7NH 2QW7A 5GAGC 3NBIA 1MGSA 1D5MC 1KXLA 4L5SA 2PI2A 2M2LA 2KJXA 3GTKB 3NBHB 3CCJA 5M3MB 1TWHH 1X3GA 3BDOA 4BBRG 3VR4A 4Y52H 4IURA 5ELNA 3HOXG 2KCNA 2NN6H 2PQAB 4BS9A 1HH2P 2CCZA 3FP9A 4I7ZC 1X6OA 1B53A 1YJWA 4P2CB 2Q8TA 4G7HC 3BDLA 3T1YL 3PO3G 3HS0C 3PO3H 4H7BA 2DNCA 5CMDA 4UP7A 3AEVA 4XQNA 1VQ5A 4DR6Q 3PIP3 3LWUA 2YYZA 5JJIA 3CD6A 1CSPA 2AUJD 4EQNA 1OXVA 4HJ8A 2M9VA 3CC4A 3NTKA 1STYA 4AH6A 1KDAA 2KCCA 1V9PA 3UDGA 3M4OH 5COYA 5D3DA 4K5XA 1CUKA 4AYBB 5CV9A 4IJLA 2K4KA 3SDZA 4OELB 2NZOA 3FRPB 2CW0D 1EIGA 4KLKA 1Y8PB 3BYYB 1VQMA 2F0IA 3QIAA 2SEBD 5K36G 5K36H 4RCOA 1AZPA 3HKSA 4K8JA 1L0WA 3T1HQ 4RFBA 4C56C 1ILQA 2F03A 3EROA 2F52A 1WCMB 2MHVA 2EXDA 1NY4A 3E9HA 1FL0A 4PMCA 1GD7A 4V0BA 5KIXA 1TY2A 2EYPA 1XYIA 4JI5L 2AUKA 3TDQA 4A93G 4R4CA 2KEEA 2VS1A 4IUPA 4IFDJ 4KV6A 1A63A 3SEBA 4DV0L 2VB3X 3K0XA 1ESRA 3S16H 4LF9Q 1VQBA 2OXPA 1QB5D 3BU2A 2HHHL 4C3HH 3P20A 4JI4L 4O0AA 4QUFA 4HJAA 2PMZB 3CRLC 3NE5B 3I91A 4KK7A 3HOYB 3M4YA 1OXSC 1D8LA 2CWPA 5FO9B 5D65A 4JV5Q 1BNZA 1PRTB 1EFID 1I94L 5M9OA 5FK9C 2PQEA 2QEJC 3M4QA 3TSSA 1LT4D 3JC66 4C3JH 4C3JG 3P75A 2E5LL 3SR1A 3GTJB 4GOPA 1WTOA 4PNYA 1GHJA 1KABA 1IBML 1WTVA 2L4NA 2D5DA 1BBWA 3JAML 4FF1A 2O5IC 3L9AX 3G71A 2L15A 4J15A 2QA4A 2ALYB 2RF4A 4LWCA 1SMYC 1TWGB 4X65Q 5C4HA 1Y69U 1LT5D 3CP0A 1N36Q 4A3GG 4A3GH 1ET9A 3HOVH 4J8QA 1YHAA 4ULLA 1ET6A 1EIFA 1SNPA 4DKAC 2R7FA 2YTYA 4B3RL 1LACA 1C48A 1PH3A 1K73C 4P71A 1NBWA 1AP0A 4ODGA 3GO5A 2VUMG 2VUMH 3SGIA 4LMQD 3FPUB 4L5QA 2RDFA 1UE6A 2K03A 4JI7L 3IFDA 1WD0A 1CZGA 5FLMH 3TP7A 3E9IA 5TSSA 3MEHA 2IW3A 1LABA 4IOCA 2RSNA 1DYQA 4CJ0B 1YI2A 4LFCL 5JJKA 1GJXA 1TWAB 3GP7A 1U0LA 2R3ZA 1LO5D 5BN3A 3S2DH 3C2PA 2QCPX 2B3GA 3W1GA 2K5NA 3T1YQ 3J7AF 2F0SA 3OSOA 3VR6A 5I6YA 3AFPA 4DF7A 1J6QA 3WOEA 3S15B 3U58A 1NNXA 2JA8B 1TWFB 2G9HD 1XPRA 1SNCA 2NWGA 1QCBD 5IGDA 3PF5A 1T5XD 4HIOA 3W1BA 5GROA 3PO2B 3KYHC 4DAVA 4ZCKA 1TY0A 2KQ3A 2KHSA 4GZYC 2I5LX 4HAEA 1N33L 1BVSA 3IFTA 3OTOL 1DXMA 1PRTD 1NR4A 2CQOA 4EQ5A 2RQXA 3STBC 3DM1A 2K6AA 5JVH3 4CJ1B 3NELA 1I4QA 2EY2A 2MPMA 3K59A 2Q2UA 1L1OA 1RTNA 1C4QA 5KEEA 5IT9E 1PFSA 1K3RA 1Y8NB 2JK8A 2D2CC 1EWIA 5HY6A 4KKSA 1F9RA 1CA5A 2N55A 2E2DC 2A69D 2HUGA 3PUVA 1I3QB 1PZID 4TQUS 4HJ5A 3I4MG 1G6ZA 1TXYA 2EY1A 4HJ7A 4I65A 4AIMA 3QG1A 3V2TA 2A6HC 3PF4A 4DV0Q 3D4RA 4A3CG 4A3CH 2XSCA 1AZQA 5ELCA 4QCLA 1C9OA 1RJTA 1A3UA 4F87A 1PVOA 3MZ5A 4HN7A 4HTHA 1Z9FA 3NBHA 2HHHQ 4JI4Q 4A3EG 2EYOA 4EQPA 3HRZC 4M8AA 1G8ZD 2EYLA 1JQYD 4C3IH 4C3IG 1S5FD 4KY7A 1GUOA 5C3EG 5C3EH 2PQAA 4OHJA 3ITPA 3DWQA 1I94Q 4KD4A 1J9OA 4MN3A 1NCVA 5CBEE 3SK5A 1O7IA 2PO4A 2JA5G 3E6ZX 5BN4A 3MHBA 1VQNA 2B2TA 2IHFA 2E5LQ 3Q6SA 5IY0A 4FXDA 4RAUC 1IBMQ 3BYTB 4A3DG 4A3DH 1S5ED 4DV4L 2XIWA 1KAWA 2D62A 4RA8A 1PRTF 1STBA 3ULPA 3DHQA 5M5WB 3PUYA 2BA0A 4YY3L 1GUGA 4OO1G 4OO1H 3H0GH 2EVBA 4R1JA 1VQOA 3J81c 1JOQA 3J81i 2EYFA 1QJOA 3QR8A 4DR4L 3TMEA 1S5DD 3A7AB 2F0DA 4DV3L 2ZT9C 1T5EA 4B3RQ 1IBLQ 1FNVA 1FNUA 4X3UA 5GADC 4IALA 4K2LA 3TQYA 2ZM6Q 1EY7A 1V1PB 4A3JB 1EIYB 3ZJYC 2F3VA 3FVQA 3K80C 3NP8A 4HIDA 4JI7Q 4ME5A 3S1MB 2EIFA 3DEOA 4R9WA 4B9XA 3CRKC 5JOBA 1GUWA 3VR5A 1FVIA 4RHRA 2VNUD 4R8IA 1NE3A 1QZHA 2YV5A 4RKBA 5G3LD 4C1NI 3VYSA 3MEFA 1QILA 4V190 3BVMA 4POGA 5AFWA 2YU9B 2KUMA 1STNA 1UAPA 1SEBD 1MBYA 3H09A 4DFAA 2JXMB 1E1OA 4GNXA 1MI2A 2XWBB 3F8TA 5E4XA 1XTCD 2QEXA 2A74C 2QILA 3A5UA 1K8AC 2E76C 5C44B 1IKMA 1VQJA 3HZXA 1IZ6A 5KNDA 2Z6KA 2HDMA 1V1QA 4GLAC 3OTOQ 3GTOH 2UU9L 1PA6A 1EEID 1YJ9A 4JBKA 3A8IE 3J81E 1JWMD 3NXWA 4YCUA 1M4VA 4P72A 4UPAA 1K0SA 3A5ZB 1B2TA 1L1OC 1QUQB 1STGA 4FF2A 1SMYD 1SN8A 1A6XA 3KJPA 4XQQA 1ASZA 5I9PA 2JJQA 4UP8A 2JA7G 2JA7H 2MP1A 3FKIH 3FKIG 2F0JA 3M7GA 2H4OA 5FOBB 1N9WA 3KOJA 3TREA 4QIWB 4B9WA 3H3VH 1DONA 3I4MB 2A73B 4PQXA 1VF5C 5A2QL 2K32A 2E2JB 2XGTA 1BUVT 5C6AA 1B9NA 2R93B 5J3BA 3S1NB 5IP9G 5IP9H 3JAME 2RCNA 4KMUC 1YBYA 3NQIA 4K14A 4KJNA 1SSOA 1SNDA 4QQBX 3BG3A 3K5NA 1DOLA 2F4IA 3I4NG 3I4NH 2K5HA 1SE3A 1KQSA 5AJ3L 1S72A 2R7DA 1JCKB 3G6EA 3A7LA 1VQ7A 3VYUA 1PH5A 4L63B 2B2TC 2ID0A 1RHPA 2F0MA 1X3FA 2K05A 3J80c 5KYIA 4DV4Q 1VQAA 4DUYL 2WIIB 5CV7A 2ZXPA 2PZTA 1GXDC 3X3MA 1DM0B 3PUWA 3J7ZC 4ALPA 5IE8A 4P75A 3WOFA 1HA6A 3PV0A 3T1HL 4YY3Q 2RA4A 1SYFA 4KHPL 2B63B 3S14B 4C2MB 1Q86C 1JORA 2B8FA 1PFBA 2F0WA 3J7YW 1PH9A 3GTMB 4DR4Q 3STBD 2LMCB 4DV3Q 3TBIB 3TEHB 2K33A 2A68D 4KKTA 3LNNA 1KNEA 5FO7B 2NVTH 4LUOA 4NB3A 2X6GA 4IQZA 4XT3B 1HTPA 2EE1A 3ICEA 1G6PA 4LF4L 3A8JE 4BWGB 1TQOA 4X6AH 2SDFA 4QB4A 3MXNB 4YWKA 2BH8A 1G2TA 4FXGC 4TRDA 2X6LA 3N52A 4RHSA 4CDCC 2DY7A 1SE2A 1PH7A 4F7XA 5J39A 2SNMA 2WAQE 2EYHA 4LUVA 1C0AA 3RR5A 5ELBA 4X3SA 4BBSG 1JR0D 1QVGA 2RKSA 5HURA 4CKBA 3EN2A 1S40A 1CHPD 3M3YB 3SE0A 4OWXB 4GNXC 3EVQA 4IZ8A 4UHVA 1PYSB 1TWCB 4A76A 2NVXH 2HCCA 1JE4A 3C1FA 1JJ2A 3VR2A 1CTMA 4DR3L 3OYYA 3R8BA 2R7ZB 1I50B 3I7FA 1RIPA 3NWTA 1Q3LA 5M5XH 2B2VC 3G4SA 2F0LA 2IWHA 3MVVA 4IFDI 3ULJA 1Q1EA 2N3SA 2UU9Q 1GHKA 1NAPA 3RMHA 1QOHA 1MJCA 3GTQH 4FXKC 1PTOH 1Q90A 2EJGC 3HFZB 2KHIA 4FYDA 4ME3A 4JI8L 3EIVA 3GTGB 5CV6A 4Q5VA 3X3NA 5C4XB 3GTLB 4LF8L 1HNWL 1Z6HA 2NVQB 1EY8A 2KOLA 1PTOC 1FYCA 1WTHA 3C3LA 2ENBA 3D8GA 1W3SA 1I4HA 3CCUA 3S1RB 1VMCA 1HCZA 1JOOA 4PZ7A 1BOSA 1NUCA 2BA1A 2NN6G 3UDIA 4LF6L 3KBXA 5F2DA 1SYGA 2RDGA 1CKNA 1MSHA 1VQPA 1W6JA 2NYZD 1YNJC 5M3FB 4PMWA 1Z47A 3Q0AA 5EKIA 2WAQG 1MJEA 3IRBA 3VDYA 2CKZB 4CDEC 3QB3A 3KDFB 1I6HB 5DM73 4OO1I 4NKLA 1X9NA 5CV8A 2Y0SE 1HA5A 5AJ3Q 3HOZB 1FNWA 3GTPH 3S15H 4N8X1 1TWFH 3IL8A 4K5WA 2XRSD 1XTDA 4BXXG 4CDFC 4BXXH 3GV3A 3P7JA 1KDBA 1M8AA 2KCMA 4GKJL 2WB1B 1SYEA 4G57A 1A62A 3CMAA 4DUYQ 1SMXA 3D4DA 2WKDA 3PIOA 3FPPA 1CT1D 5EJWA 2UUAL 2XRQD 1VQHA 3NHHA 2LXJA 1I4XA 4G7OC 2RSOA 4C1NK 4KHPQ 2D0OA 5EKLA 1RCVD 2PI2E 4KTAA 2JQOA 2K14A 2R92G 4EGVA 2R92H 5J1ZA 2B2WA 4IUNA 4A3BH 4A3BG 5IYDH 2ZTCA 5C4JH 1SXTA 3U9OA 5ELEA 5I4DA 3J81L 1LTRD 1SFOB 1X32A 4DR7L 3F2CA 4LUZA 2G9DA 1W2BA 2F1MA 2K1BA 4B3MQ 1PH1A 3T51B 4O1NA 3WDNA 1JWUD 3KLSA 2GVAA 4CKCA 2K50A 1SNQA 1U4PA 4XT1B 4C3HG 2ES2A 4LF4Q 1IW7D 2LKVA 2F0VA 2FMMA 3ND8A 1O7ZA 5EPJA 4M1UB 4KI0A 4DR1L 1L0YB 2XWJB 2Z1CA 2JA6B 3HOWB 1FGBD 3IKJA 4JG2A 1EIHA 2XVSA 3G7LA 2Y0SG 3UDFA 4LFAL 1Y1VB 5LL6S 3I72A 4BY1H 1ZEQX 1DD2A 3RZDB 4DV5L 4BY7G 4BY7H 1F2ZA 1O78A 2KHJA 1EYDA 1HTLD 3M4PA 2ZJRA 1CI3M 4KN7C 4JI1L 1KD1C 1FJGL 3KBGA 4DR3Q 1A15A 3KLSX 4UY8C 2IL8A 4DV7L 3NUCA 2RBMA 2L1BA 3KUPA 3BDCA 1GM5A 5JJZA 4DAYA 2JN4A 3HOUB 4BA2I 3TP8A 2PW5A 5EBCA 3HOVG 1G2SA 3EBEA 4R4QA 1QZGA 1HFGA 1BXTA 1AFPA 4JI8Q 1IBLL 5H1SE 3T56B 1CFMA 5A2QE 2ZM6L 3M85A 4B3TQ 2ASBA 1PFMA 1IKLA 4LF8Q 1HNWQ 5C5MA 4B3SL 3K7AB 1B70B 2JEAI 1BBUA 4ZLTF 5FLMG 1Q1BA 4LK1C 1EYGA 3SHLA 4Y7NB 1D2BA 4A3JH 1II3A 3K5OA 1X3QA 5GQOA 2CHBD 3I55A 1LTSD 3S1MH 1CM9A 2Z4HA 4LF6Q 1D1IA 2SNSA 2O5JC 2Q2HA 1TWHB 4BBRB 4GN3B 1BBXC 5JVG3 2B2YA 2WKCA 3HOXB 1PYWD 1LTID 1OXTA 4A3KH 3AFQA 4A3KG 3QO2A 4H44C 3GD7A 2VQEQ 5EKKA 2RDHA 2XN9C 4FDBA 3CW2C 1PH2A 3B6YA 2MO1A 5ISRA 3PO3B 3MXNA 1U9RA 4LW1A 3MFGA 3VYRA 1YNNC 3HKZE 3K5LA 3J7A5 1AH9A 2IHEA 4X62L 1U4LA 3NSWA 1B7YB 3RN2A 1HUMA 1HR0W 2E2HH 1CKOA 1VS0A 5ELOA 3OMGA 1R9TH 4JW0A 1NMGA 1QWYA 4GKJQ 2Q2TA 3KF6A 3DLLA 1VQCA 3S2HH 5I6WA 3BZKA 3E5SA 3M4OB 1B3QA 1AN8A 2VXWA 2AWOA 3UDXA 2A6EC 2EJFC 2UUAQ 4OWTB
chains in the Genus database with same CATH topology
3J80L 3MTSA 3BS1A 3QWNA 4CBVA 5C0XG 5C0XH 2LY7A 3D31A 3NPPA 2JSOA 2F0PA 5KRUA 2B2WC 5FO8B 4DK1A 1WD1A 4IUVA 1V43A 3DUZA 5IGCA 1RKNA 4A93B 3HG9A 3OWFA 1O7LA 4RGNA 4NMZA 4FF3A 1ZYRC 4RGTA 4WFN3 1MD2D 5BN5A 4JBWA 2ZXRA 5FKAC 2E2IB 4XXEA 4U68A 2B2UA 3S16B 3S17B 4S3SA 3LX0A 4DA2A 4QUCA 1HRJA 2MJ8A 2OEOA 2L9HA 2FHTA 1O80A 5IGBA 4IUQA 2NUCA 1EZ8A 5CYUA 1SDFA 4C3JB 1EQTA 4CJ2C 5LHY1 2NZ1D 4K8IA 1L0XB 1JB3A 4K6DA 2NN6I 5I9OA 4TSSA 3N6RA 1IHZA 4HMIA 4UDUC 2JE6I 1F9QA 1ONLA 1F9PA 4J1MA 5IGFA 1CQVA 1EOTA 4A3GB 4CHTB 1X3PA 1ICWA 1TT2A 2VUMB 1WTQA 1Q12A 1TU2B 2J0TD 1B44D 1LTGD 3KK7A 3VYTA 4WORA 3T53B 1DOMA 2B2YC 2MUYA 4OGQC 1IYVA 1W6KA 4DGZA 1KAAA 3S2DB 1H9RA 3OPOA 4DU9A 2JYOA 2K5DA 3T4AC 2HDLA 1AEXA 4DN4M 3K6OA 2E75C 2CW0C 2Z4IA 3H94A 2WV6D 1UNSA 2KEDA 3C46A 2O2LD 1B50A 5CGKA 2EY6A 4EVOA 1PMRA 1SYDA 2A5HA 2R6GA 1DJRD 5LL6X 2H1EA 5E1FA 4N9TA 1EZ6A 4MHEA 3NQTA 5DM63 1V1OA 2M00A 4JK1C 3OW7A 2RVLA 2F0TA 5G3LF 5KNBA 3KLRA 3K5MA 3W2DA 3H3VC 1LLRD 1Z7TA 3PUZA 2B2UC 4LAAA 1K83B 4A3EB 4C3IB 2K7VA 4NW2A 4ZK9B 5C3EB 4KJOA 1I4RA 1WTXA 2JA5B 3D6CA 5KYLA 4XYQA 2LFNA 4A3DB 2FINB 4XTCS 4ZKCB 1EWHA 1RD9D 1ENFA 1GUTA 1SE4A 1TS2A 1TVXA 3SK6A 2KVMA 4ZUIA 1QE6A 3RZOB 2EDGA 2R61A 4HSVA 1HHVA 2NB0A 4Q0FA 2I46A 1SJHD 3VA7A 3DWAA 5I2XA 2XNAC 1DOKA 3GQBA 1LTAD 2A6HD 4N9PA 2EPBA 1WTRA 3RLFA 3D3RA 4XQJA 2BOSA 4J6HA 3TP6A 4E6IA 3EFXD 4ZAIA 3MA2B 1LV9A 5T1IA 5C0XI 3J80E 2NBFA 5D3IB 1H9SB 2VB2X 3RD4A 3M7NA 3MFYA 3DXJC 5EGTA 4H13C 4DAPA 3F2UA 3Q22A 4KY6A 1XX8A 1PRTC 4RCNA 1TS4A 4DXFA 2DY8A 4FP5D 3GTOB 4IN3A 3W3AA 3DEPA 5KNCA 2AQ3B 1ML0D 3U9SA 2EXZA 1HPCA 2A69C 5CORA 4OIJA 5IGGA 1B3AA 4KKUA 1RDPD 2K04A 3NTHA 2HQEA 3VR3A 5JPMC 1XWEA 2JA7B 1CA6A 3FKIB 1V1PA 5ELDA 2EY5A 5C4ZA 3PMFA 1JC7A 2PZWA 1E2VA 5JEAJ 1JWSD 3QJYA 1BO0A 3R93A 1EEFD 1TKWB 1B1ZA 1MSGA 4RKLA 5E3FA 2IJ0A 1R4PB 1U4RA 3T16A 3I4NB 1A2UA 1PZKD 1J8IA 1BCPC 4PV1C 3G6JB 2SOBA 4PMBA 2Q8RE 2TMPA 1F2YA 3GV6A 5EPLA 5C0XJ 1PFNA 2IX3A 2BE5C 3TZDA 4CGYB 1VDZA 3AMUA 3OIQA 4XDXA 1TS3A 4K5VA 1PZJD 2B39A 4ZKBB 3ZYYX 2GA4B 5HGTA 5EPKA 3OOCA 3K58A 1B9MA 5JPNC 3SK8A 3CHBD 2NVTB 2IT1A 1WTPA 3CKIB 3SK4A 1EL0A 1EU4A 2D9UA 1FD7D 2AQ2B 1NR2A 1JOKA 1JICA 1HQMC 1OXUA 1HXYD 1CZWA 1QNKA 1D6EC 4BA1I 3ONAB 4FO2A 4BBSB 1CHQD 1D1KA 4ZRZA 1B4OA 2E74C 3URYA 3PIO3 3Q23A 4HR7B 2NVXB 3T13A 3V05A 5FLXL 1TR5A 2F0GA 5M5XB 2EOTA 4KD3A 3CQZB 1VF7A 3TP5A 1LTTD 3NTIA 1ILPA 3GTQB 2QDBA 1SNMA 1PTOB 2ZXOA 2EYMA 1I4PA 3A54A 1EU3A 4K2KA 1KTKA 5J22A 1PXUA 2TSSA 1F2LA 1HFNA 3MXUA 3ND9A 2F0UA 3HP3A 2JP1A 2K01A 1STEA 4QMGA 3R2TA 4ZYSA 4KN4C 1SYCA 5JEAG 5JEAH 2DNEA 2WAQB 3I3CA 5DNFA 2DN8A 1PLFA 2WACA 1HUNA 1GUNA 1BCPB 3H91A 4RGOS 3I90A 1I4GA 1E0BA 3GTPB 1E2ZA 1QNUA 4HEDA 2LS01 2EZVA 4NP5A 2EYJA 2J7ZA 2K5QA 1DZ1A 4F8MA 1H9SA 1CK1A 2KECA 2L5TA 5DEHA 5IOCA 2AWNA 1EY4A 5C3XA 5DAUA 2IX0A 3OMCA 4HMJA 4RGMA 4XIGS 2FFKB 2L11A 3SXHA 4DNTB 3FMCA 3EA6A 3OHXC 2A68C 2R92B 4F88A 1R4QB 3VA5A 4IUUA 4A3BB 2NTSA 5C4JB 2WP8J 1BR9A 4G7ZC 1PTOD 4L6TB 3BZDB 2C9OA 2OT2A 1EYCA 3Q24A 1Q8IA 2C5CA 1C8CA 2F0EA 1UUPA 4IFDG 4IFDH 2FMCA 4C3HB 4OIKA 2F0QA 2IX1A 3NK9A 1ESFA 3DMUA 2N88A 3QOJA 3L3OC 3MXGA 1YNJD 2K28A 3MAQA 2NTTA 3EQLC 2Y0SB 1AW7A 4BY1B 4DK0A 1SNOA 3AB9A 4BY7B 1BDOA 1A3VA 2X69A 4R8NA 1NSNS 4UAIA 1D5ZC 3FEWX 4H0LC 5ELFA 4HCEA 1BCPD 2QF7A 2F0HA 4G4KA 5CC4A 2CVRA 2F0OA 3HOVB 2ICIA 2BE5D 2EJMA 3A55A 3RUZA 3C1EA 2HCIA 5A35A 2PZUA 5IIFA 1KNAA 3I70A 1PTOF 5EQ0A 2O4XA 4YIJA 2F0NA 1UEAB 5NUCA 2IPKD 3D4WA 1BQQT 1LTBD 1V8QA 4O42A 2B8GA 3S9WA 1QG7A 1PDQA 3HGBA 2F0FA 1VCIA 3AU7A 3HEJA 4L8JA 1EQVA 1GOZA 5E4WC 4A3KB 3BVZA 1SJED 2PNRC 3PUXA 4KY5A 1VMPA 1BF4A 1GUSA 2KA7A 1G91A 1K8OA 1ZKOA 3QOLA 1SBBB 3D6WA 2E2HB 1R9TB 4LJZC 3K57A 1KDCA 1S5CD 2QKIC 2B2VA 3S2HB 2BDOA 1D5XC 3TZUA 1BCPF 5CR3A 1G291 3DWPA 4KHZA 1H9KA 2BCOA 4OL7A 1IL8A 1KLGD 4WJWA 2V4DA 2L0CA 4HCSA 5EBDA 4ZQ3A 1S4ZA 4Z9CB 4FNFA 1STAA 1LT6D 4ILWA 4QF4A 3L7ZC 1IW7C 2Q8IB 4RWSC 2BDNA 3MWYW 4RH6A 2PW7A 3OWEB 4B08A 3R2IA 1OXXK 5FLXE 4NDXA 4WRDA 1EY0A 1F77A 4EQOA 1XXGA 4DNRB 3OIPA 3NWSA 3HKZB 1H9MA 2L55A 5CV5A 4DXGA 3CU7A 4XYOA 1DCZA 2AQ1B 1YNND 1IYUA 5IGEA 2PPBC 2F0KA 4A3FB 3J7AV 1WTWA 1Y1WB 2PYKA 1ENCA 5M5YB 4U673 5D14A 1EY6A 3H0GB 2ICEC 3SVMA 4HSPA 1SYBA 1FR3A 2A6ED 5CV4A 2K5WA 2FJ2A 3I73A 4X3TA 4IUTA 1K8MA 3K0YA 2J4XA 5CBAE 1RF2D 3ERQA 3O13A 3TN2A 1ZXTA 4A3MB 5JAVA 1EY5A 2PCFB 4KHVA 1HQRD 3P1HA 1WVLA 5K5PA 4ID6A 2Z8LA 5I2YA 1EYAA 3EJIA 3LWEA 4K6LA 1OO9B 1LT3D 5IT9L 1H9JA 1TS5A 4MIUA 3UI2A 3A8KE 1F2MA 1ZYRD 5T1GA 3IAYA 4FVMA 5KGUA 1EWCA 4ABNA 3V96A 2JEBI 4ZUJA 1EY9A 1A3TA 2WINB 2NVYB 3KF8A 1A2TA 1E2WA 1O7YA 1SAPA 4CKEA 3H6MA 4A3IB 3I4LA 1Y8OB 3MC0B 5C3WA 1ENAA 1F9SA 1RTOA 2L12A 1RODA 1TIID 2CQAA 3S1QB 4FF4A 5IODA 1I6VC 3A56A 2F3WA 4X3KA 3BVGA 4TKOB 3MXPA 1CQFA 1KLUD 5C5LA 3E0JA 2I07B 3FDTA 1S5BD 3R3OA 1U4MA 2MGSA 2OF1A 3I8ZA 1STHA 3NBIA 1MGSA 1D5MC 2M2LA 2KJXA 3GTKB 5M3MB 3BDOA 3VR4A 4IURA 2KCNA 2NN6H 4BS9A 4I7ZC 1B53A 4P2CB 2Q8TA 4G7HC 3BDLA 3HS0C 4H7BA 2DNCA 5CMDA 4XQNA 3PIP3 3LWUA 2YYZA 2AUJD 4EQNA 1OXVA 2M9VA 3NTKA 1STYA 1KDAA 2KCCA 5COYA 5D3DA 4K5XA 4AYBB 5CV9A 3SDZA 3FRPB 2CW0D 1EIGA 1Y8PB 3BYYB 2F0IA 3QIAA 2SEBD 5K36G 5K36H 4RCOA 1AZPA 4K8JA 4RFBA 4C56C 1ILQA 2F03A 3EROA 1WCMB 2MHVA 5KIXA 4PMCA 4V0BA 1TY2A 2EYPA 1XYIA 3TDQA 2AUKA 2KEEA 4IFDJ 4IUPA 4KV6A 3SEBA 2VB3X 1ESRA 2OXPA 1QB5D 3P20A 4QUFA 2PMZB 3CRLC 3NE5B 3I91A 4KK7A 3HOYB 3M4YA 1OXSC 5FO9B 5D65A 1BNZA 1PRTB 1EFID 5M9OA 5FK9C 2PQEA 2QEJC 3TSSA 1LT4D 4C3JG 3P75A 3SR1A 3GTJB 1WTOA 4PNYA 1GHJA 1KABA 1WTVA 2L4NA 2D5DA 3JAML 2O5IC 4FF1A 3L9AX 1SMYC 1TWGB 5C4HA 1Y69U 1LT5D 1ET9A 4J8QA 4ULLA 1ET6A 1SNPA 1LACA 1C48A 1AP0A 4ODGA 3GO5A 4LMQD 3FPUB 2RDFA 2K03A 3IFDA 1WD0A 1CZGA 3TP7A 5TSSA 3MEHA 2IW3A 1LABA 2RSNA 1DYQA 4CJ0B 1GJXA 1TWAB 3GP7A 2R3ZA 1LO5D 5BN3A 3C2PA 2QCPX 3J7AF 2F0SA 3OSOA 3VR6A 5I6YA 4DF7A 3WOEA 3S15B 2JA8B 1TWFB 2G9HD 1SNCA 2NWGA 1QCBD 5IGDA 1T5XD 3PO2B 4DAVA 1TY0A 2KQ3A 2KHSA 4GZYC 4HAEA 3IFTA 1DXMA 1PRTD 1NR4A 2RQXA 3DM1A 2K6AA 5JVH3 4CJ1B 1I4QA 2EY2A 2MPMA 3K59A 1RTNA 1C4QA 5KEEA 5IT9E 1Y8NB 2D2CC 4KKSA 1F9RA 1CA5A 2N55A 2E2DC 2A69D 2HUGA 3PUVA 1I3QB 1PZID 4TQUS 1G6ZA 2EY1A 4I65A 3QG1A 3V2TA 2A6HC 3D4RA 2XSCA 1AZQA 5ELCA 4QCLA 1RJTA 1A3UA 4F87A 3MZ5A 4HN7A 4HTHA 3NBHA 4EQPA 2EYOA 3HRZC 4M8AA 1G8ZD 2EYLA 1JQYD 4C3IG 1S5FD 4KY7A 1GUOA 4OHJA 3ITPA 3DWQA 4KD4A 1J9OA 4MN3A 1NCVA 5CBEE 3SK5A 2PO4A 3E6ZX 5BN4A 3MHBA 2B2TA 3Q6SA 4FXDA 4RAUC 3BYTB 1S5ED 2XIWA 2D62A 4RA8A 1PRTF 1STBA 3DHQA 5M5WB 3PUYA 2BA0A 1GUGA 4OO1G 4OO1H 2EVBA 1JOQA 2EYFA 1QJOA 3TMEA 1S5DD 3A7AB 2F0DA 2ZT9C 1T5EA 1FNVA 1FNUA 4X3UA 4IALA 4K2LA 1EY7A 1V1PB 4A3JB 2F3VA 3FVQA 3NP8A 3S1MB 4ME5A 3DEOA 4R9WA 4B9XA 3CRKC 5JOBA 1GUWA 3VR5A 4RHRA 2VNUD 4R8IA 4RKBA 5G3LD 4C1NI 3VYSA 1QILA 4V190 3BVMA 5AFWA 2YU9B 2KUMA 1STNA 1UAPA 1SEBD 1MBYA 3H09A 4DFAA 2JXMB 1MI2A 2XWBB 5E4XA 1XTCD 2A74C 2QILA 2E76C 5C44B 1IKMA 3HZXA 5KNDA 2HDMA 1EEID 3A8IE 3J81E 1JWMD 3NXWA 1M4VA 1B2TA 1STGA 4FF2A 1SMYD 1A6XA 4XQQA 5I9PA 2MP1A 2F0JA 3M7GA 2H4OA 5FOBB 4QIWB 4B9WA 1DONA 3I4MB 2A73B 4PQXA 1VF5C 5A2QL 2K32A 2E2JB 1BUVT 5C6AA 1B9NA 2R93B 3S1NB 3JAME 4KMUC 3NQIA 4K14A 4KJNA 1SSOA 1SNDA 3BG3A 3K5NA 1DOLA 2F4IA 1SE3A 1JCKB 3A7LA 3VYUA 4L63B 2B2TC 2ID0A 1RHPA 2F0MA 2K05A 5KYIA 2WIIB 5CV7A 2ZXPA 2PZTA 1GXDC 3X3MA 1DM0B 3PUWA 3WOFA 1HA6A 3PV0A 2RA4A 1SYFA 2B63B 3S14B 4C2MB 1JORA 2B8FA 1PFBA 2F0WA 3J7YW 3GTMB 2LMCB 3TBIB 2K33A 2A68D 4KKTA 3LNNA 1KNEA 5FO7B 2X6GA 4IQZA 4XT3B 1HTPA 2EE1A 3A8JE 4BWGB 1TQOA 2SDFA 4QB4A 1G2TA 4FXGC 4TRDA 2X6LA 3N52A 4RHSA 2DY7A 1SE2A 4F7XA 5J39A 2SNMA 2EYHA 5ELBA 4X3SA 1JR0D 2RKSA 5HURA 4CKBA 1CHPD 3M3YB 3SE0A 3EVQA 4IZ8A 1TWCB 2HCCA 1JE4A 3C1FA 3VR2A 1CTMA 3R8BA 2R7ZB 1I50B 3NWTA 1Q3LA 2B2VC 2F0LA 2IWHA 3MVVA 4IFDI 1Q1EA 1GHKA 1NAPA 3RMHA 1QOHA 4FXKC 1PTOH 1Q90A 2EJGC 4FYDA 3GTGB 5CV6A 4Q5VA 3X3NA 5C4XB 3GTLB 1Z6HA 2NVQB 1EY8A 2KOLA 1PTOC 1FYCA 3C3LA 2ENBA 3D8GA 1I4HA 3S1RB 1VMCA 1HCZA 1JOOA 1BOSA 1NUCA 2BA1A 2NN6G 3KBXA 5F2DA 1SYGA 2RDGA 1MSHA 1W6JA 2NYZD 1YNJC 5M3FB 4PMWA 1Z47A 3Q0AA 5EKIA 1I6HB 3QB3A 5DM73 4OO1I 4NKLA 5CV8A 1HA5A 3HOZB 1FNWA 3IL8A 4K5WA 2XRSD 3GV3A 3P7JA 1KDBA 1M8AA 2WB1B 1SYEA 4G57A 3D4DA 2WKDA 3FPPA 1CT1D 5EJWA 2XRQD 3NHHA 1I4XA 4G7OC 2RSOA 4C1NK 5EKLA 1RCVD 4KTAA 4EGVA 5J1ZA 2B2WA 4IUNA 1SXTA 3U9OA 5ELEA 5I4DA 3J81L 1LTRD 1SFOB 1X32A 2G9DA 2F1MA 2K1BA 3T51B 4O1NA 3WDNA 1JWUD 3KLSA 4CKCA 1SNQA 1U4PA 4XT1B 4C3HG 1IW7D 2LKVA 2F0VA 2FMMA 3ND8A 1O7ZA 5EPJA 4M1UB 4KI0A 1L0YB 2XWJB 2Z1CA 2JA6B 3HOWB 1FGBD 3IKJA 1EIHA 2XVSA 3G7LA 1Y1VB 5LL6S 3I72A 1ZEQX 1DD2A 3RZDB 1F2ZA 1O78A 1EYDA 1HTLD 1CI3M 4KN7C 3KBGA 1A15A 3KLSX 2IL8A 3NUCA 2RBMA 2L1BA 3KUPA 3BDCA 5JJZA 4DAYA 3HOUB 4BA2I 3TP8A 2PW5A 5EBCA 1G2SA 1HFGA 1BXTA 1AFPA 3T56B 1CFMA 5A2QE 3M85A 1PFMA 1IKLA 5C5MA 3K7AB 2JEAI 4ZLTF 1Q1BA 4LK1C 3SHLA 4Y7NB 1D2BA 1II3A 3K5OA 1X3QA 2CHBD 1LTSD 1CM9A 2Z4HA 1D1IA 2SNSA 2O5JC 1TWHB 4BBRB 1BBXC 5JVG3 2B2YA 2WKCA 3HOXB 1PYWD 1LTID 1OXTA 3QO2A 4H44C 3GD7A 5EKKA 2RDHA 2XN9C 5ISRA 3PO3B 3MXNA 1U9RA 3MFGA 3VYRA 1YNNC 3K5LA 1U4LA 3NSWA 1HUMA 3OMGA 1QWYA 5I6WA 3E5SA 3M4OB 1AN8A 2VXWA 2AWOA 2A6EC 2EJFC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RZD B;  2WAQ B;  4C2M B;  3GTO B;  4C3I B;  4AYB B;  5C44 B;  2LY7 A;  5C3E B;  3GTM B;  1YNJ C;  5M3F B;  4KN7 C;  2NVY B;  2NVT B;  1IW7 C;  3TBI B;  2JA5 B;  1I6H B;  2A69 C;  3HOV B;  4A3I B;  3GTP B;  3S2D B;  3HOU B;  4A93 B;  4A3D B;  1HQM C;  3HOZ B;  1TWA B;  1WCM B;  1ZYR C;  2JA7 B;  3FKI B;  2B63 B;  3S1Q B;  1I6V C;  4BBS B;  2WB1 B;  2E2I B;  5M5W B;  3K7A B;  3S16 B;  3RZO B;  3HKZ B;  2CW0 C;  3WOE A;  4LK1 C;  3S15 B;  4Y7N B;  3S17 B;  2JA8 B;  1TWF B;  2NVX B;  4QIW B;  2A68 C;  3M3Y B;  2R92 B;  2PPB C;  3I4M B;  4G7O C;  4A3B B;  4A3F B;  5M5X B;  5C4J B;  3PO2 B;  4A3K B;  1TWC B;  2O5J C;  2PMZ B;  1TWH B;  2E2J B;  1Y1W B;  4G7Z C;  4BBR B;  3CQZ B;  4GZY C;  2R93 B;  5M5Y B;  3S1N B;  3HOX B;  3I4N B;  3HOY B;  2R7Z B;  1I50 B;  3GTQ B;  3GTK B;  4A3J B;  4KMU C;  3H0G B;  5M3M B;  4C3J B;  1SFO B;  3S1M B;  4C3H B;  2E2H B;  3PO3 B;  4JK1 C;  1R9T B;  3GTJ B;  4LJZ C;  1YNN C;  2BE5 C;  3GTG B;  4A3M B;  4G7H C;  3S2H B;  2O5I C;  5C4X B;  3EQL C;  3GTL B;  2Y0S B;  2NVQ B;  1I3Q B;  3DXJ C;  4A3G B;  2YU9 B;  2JA6 B;  4BY1 B;  3HOW B;  3H3V C;  1SMY C;  1TWG B;  4KN4 C;  3S1R B;  4BY7 B;  3M4O B;  3WOF A;  2A6H C;  1Y1V B;  2A6E C;  1K83 B;  2VUM B;  4A3E B;  3S14 B; 
#chains in the Genus database with same CATH topology
 3J80 L;  3MTS A;  3BS1 A;  4R4O A;  3QWN A;  4CBV A;  4RG1 A;  5C0X G;  1E24 A;  1YZ6 A;  5C0X H;  2LY7 A;  1VQE A;  3D31 A;  1A8V A;  3NPP A;  2JSO A;  4GN4 B;  2F0P A;  1D7Q A;  5KRU A;  2B2W C;  2IY5 B;  5FO8 B;  4DK1 A;  1HZB A;  4DR7 Q;  1WD1 A;  4IUV A;  4PG3 A;  1V43 A;  3DUZ A;  5IGC A;  1RKN A;  4A93 B;  3HG9 A;  2Z0S A;  3OWF A;  1O7L A;  4RGN A;  4NMZ A;  4FF3 A;  2I5M X;  1UE5 A;  1ZYR C;  4RGT A;  4WFN 3;  2AKW B;  1MD2 D;  2QGQ A;  5BN5 A;  4NXN L;  4JBW A;  2ZXR A;  4YWM A;  5FKA C;  2HT1 A;  2E2I B;  4XXE A;  4U68 A;  4DR1 Q;  4O2D A;  2B2U A;  3S16 B;  3S17 B;  4S3S A;  3LX0 A;  4LFA Q;  4DA2 A;  4QUC A;  3HKZ G;  2MNA A;  2DJG C;  1HRJ A;  2MJ8 A;  4DV5 Q;  2OEO A;  2L9H A;  2FHT A;  1QVC A;  1O80 A;  5IGB A;  4GOP C;  3KDF A;  4IUQ A;  1VQF A;  2NUC A;  1EZ8 A;  4A3F H;  5CYU A;  4JI1 Q;  1FJG Q;  1KHI A;  1SDF A;  3U4V A;  4C3J B;  1EQT A;  1Y1W G;  1Y1W H;  4DV7 Q;  5M5Y H;  4YWL A;  1WOC A;  4CJ2 C;  1VQ8 A;  4JI3 L;  5LHY 1;  2NZ1 D;  4K8I A;  1L0X B;  1JB3 A;  4DV1 L;  4K6D A;  3H0G G;  2NN6 I;  5I9O A;  4N8F A;  4TSS A;  3N6R A;  1IHZ A;  4HMI A;  4UDU C;  2JE6 I;  1VQI A;  1F9Q A;  1PV4 A;  3AQQ A;  2B63 H;  1ONL A;  1F9P A;  4J1M A;  5IGF A;  1CQV A;  1EOT A;  2NZH A;  4A3G B;  4CHT B;  1X3P A;  4LF7 L;  1NTG A;  4A3M G;  4A3M H;  2A8V A;  1ICW A;  3GTM H;  4B3S Q;  5LMN W;  1EOV A;  1TT2 A;  2VUM B;  1WTQ A;  1VQL A;  4NPS A;  2OTJ A;  1Q12 A;  1X3E A;  2Q2I A;  3CC7 A;  1TU2 B;  2J0T D;  1B44 D;  3PQI A;  1LTG D;  3KK7 A;  3M9B A;  3VYT A;  1CKM A;  4WOR A;  1PH4 A;  1WFQ A;  3T53 B;  1DOM A;  2B2Y C;  2OQK A;  2UUB L;  2MUY A;  4OGQ C;  1IYV A;  3K81 C;  1W6K A;  4JC0 A;  4DGZ A;  1KAA A;  2NVY H;  3S2D B;  1YHB A;  4GLX A;  1H9R A;  3OPO A;  4QL5 A;  4A3I G;  4A3I H;  4OX9 L;  2ZJQ A;  4DU9 A;  4X62 Q;  2JYO A;  2K5D A;  3T4A C;  2HDL A;  1TWC H;  1AEX A;  4DN4 M;  3K6O A;  4JI0 L;  2E75 C;  2CW0 C;  3CCR A;  3S1Q H;  4AYB E;  1T9H A;  2Z4I A;  3H94 A;  2WV6 D;  2F4V L;  1UNS A;  2KED A;  3KLW A;  3C46 A;  2O2L D;  2ZJP A;  1B50 A;  5CGK A;  1UWV A;  1X56 A;  2EY6 A;  4EVO A;  1PMR A;  1SYD A;  2A5H A;  2R6G A;  1DJR D;  5LL6 X;  2H1E A;  4DK3 C;  5E1F A;  3GTG H;  5BR8 L;  4N9T A;  1EZ6 A;  1IYJ B;  4MHE A;  3NQT A;  5DM6 3;  1V1O A;  3GTK H;  2M00 A;  4JK1 C;  5M3M H;  5M3M G;  3S1R H;  3OW7 A;  2RVL A;  1SE8 A;  3H15 A;  3NEN A;  2F0T A;  5G3L F;  5KNB A;  1P16 A;  3KLR A;  1Q46 A;  2Z9H A;  3K5M A;  4LFB L;  1WI5 A;  3W2D A;  1Q8K A;  4NXN Q;  2OWO A;  3H3V C;  3RN5 A;  1LLR D;  4JBM A;  1Z7T A;  2K75 A;  5HGQ A;  4OEM B;  5M3F H;  2PMZ E;  3PUZ A;  1HZC A;  2B2U C;  3DM3 A;  4LAA A;  1K83 B;  1IBK Q;  4A3E B;  1YIT A;  4P74 A;  2KCT A;  1JJG A;  5EAY A;  4C3I B;  2K7V A;  4NW2 A;  4ZK9 B;  5C3E B;  1AE3 A;  4KJO A;  2ZTE A;  1I4R A;  1WTX A;  3J80 i;  2JA5 B;  4AYB G;  2RCF A;  3D6C A;  5KYL A;  4XYQ A;  2LFN A;  4JI3 Q;  4A3D B;  1SR3 A;  4DV1 Q;  2FIN B;  4XTC S;  4ZKC B;  1EWH A;  1RD9 D;  4IPH A;  1ENF A;  1GUT A;  1SE4 A;  1TS2 A;  3OW2 A;  2I5H A;  1TVX A;  3SK6 A;  2KVM A;  1JE5 A;  1HNX Q;  1N34 L;  2PNH A;  2DGY A;  4ZUI A;  1VQ9 A;  1WCM G;  1WCM H;  1QE6 A;  3RZO B;  2EDG A;  1JMC A;  5LMU Q;  2KEN A;  2R61 A;  4HSV A;  2CWA A;  4LF7 Q;  1HHV A;  4B3M L;  2NB0 A;  2UXD L;  3CAM A;  4JOI A;  4Q0F A;  5IP7 H;  5IP7 G;  2I46 A;  3RLO A;  1SJH D;  1SFO H;  1ICF B;  3VA7 A;  3DWA A;  1VQD A;  4JVZ A;  5I2X A;  2XNA C;  1DOK A;  1YHQ A;  3GQB A;  4H02 A;  1MKH A;  1LTA D;  2A6H D;  4N9P A;  5FJ8 H;  5FJ8 G;  2EPB A;  3L0O A;  1WTR A;  3RLF A;  3D3R A;  2UUC L;  2UUB Q;  4XQJ A;  3PSI A;  3HOY H;  2BOS A;  3HOY G;  4J6H A;  3TP6 A;  4E6I A;  3EFX D;  1E1T A;  1X55 A;  4ZAI A;  3MA2 B;  1LV9 A;  1Y1V H;  5T1I A;  4OX9 Q;  4OWW B;  5C0X I;  3J80 E;  2NBF A;  4WJ4 A;  5D3I B;  1H9S B;  2VB2 X;  2VY3 A;  1YJN A;  3RD4 A;  1K28 A;  3M7N A;  4TVA B;  3GTJ H;  3MFY A;  3DXJ C;  3ERS X;  5EGT A;  1U5K A;  4H13 C;  4DAP A;  3F2U A;  3Q22 A;  2YTV A;  4KY6 A;  1HR0 L;  1XX8 A;  1E7Z A;  1UE1 A;  4JI0 Q;  1PRT C;  2Z6K C;  3PIP A;  4RCN A;  5GAH C;  2F4V Q;  1TWG H;  1L1O B;  1TS4 A;  4DXF A;  4DUZ Q;  2DY8 A;  4FP5 D;  3PCO B;  4JI2 L;  3GTO B;  3HOU H;  4IN3 A;  3W3A A;  1M1K C;  3DEP A;  1XNR L;  3CXC A;  4B3T L;  5KNC A;  2AQ3 B;  1VQG A;  1ML0 D;  1E22 A;  1EQQ A;  3U9S A;  4LF5 Q;  3KFU A;  2EXZ A;  1HPC A;  2A69 C;  1XMQ L;  3CCV A;  5COR A;  4OIJ A;  5BR8 Q;  5IGG A;  1EFW A;  1B3A A;  4DV6 L;  4KKU A;  1RDP D;  4DK6 C;  2K04 A;  3NTH A;  2HQE A;  2LSS A;  3VR3 A;  1N8R C;  5JPM C;  1XWE A;  2JA7 B;  1CA6 A;  3FKI B;  1V1P A;  5ELD A;  1Y14 B;  2MO0 A;  2EY5 A;  5C4Z A;  3PMF A;  5DLQ E;  1JC7 A;  2PZW A;  1E2V A;  1TWA H;  4QJF A;  4JI6 L;  4LFB Q;  2VQE L;  5JEA J;  1JWS D;  4BBR H;  3D0F A;  1HJP A;  3QJY A;  4K0K L;  1BO0 A;  3HOX H;  1QVF A;  3R93 A;  3A0J A;  1EEF D;  1TKW B;  1B1Z A;  1MSG A;  4LNQ A;  4RKL A;  4APV A;  3CME A;  5E3F A;  3TS2 A;  2IJ0 A;  2JA8 G;  2JA8 H;  2E8G A;  1R4P B;  1H95 A;  4IPD A;  4WJ3 M;  1U4R A;  3T16 A;  3I4N B;  1A2U A;  3PO2 H;  3PO2 G;  1PZK D;  1J8I A;  1BCP C;  4PV1 C;  1N32 L;  3G6J B;  2F3I A;  2SOB A;  4PMB A;  2Q8R E;  1GKH A;  2TMP A;  1F2Y A;  3GV6 A;  5EPL A;  5C0X J;  1PFN A;  2IX3 A;  2BE5 C;  3LGJ A;  3TZD A;  1UEB A;  4CGY B;  1VDZ A;  3AMU A;  2ZTD A;  3OIQ A;  4XDX A;  3F2B A;  1TS3 A;  5IYD G;  3CPW A;  2RHS B;  1N34 Q;  4JYA L;  4K5V A;  1PZJ D;  2B39 A;  4IOA A;  4ZKB B;  3ZYY X;  2GA4 B;  3U4Z A;  1I3Q H;  1QUQ A;  2UXD Q;  5HGT A;  5EPK A;  3CPF A;  3WWV A;  3OOC A;  4JOI C;  1J5E L;  4DPG A;  3K58 A;  5LMN L;  1B9M A;  5JPN C;  3SK8 A;  4A93 H;  1HZA A;  3CHB D;  4QGU A;  2DUD A;  2OTL A;  2NVT B;  2IT1 A;  1WTP A;  4EX5 A;  3CKI B;  1IL2 A;  3E0E A;  3SK4 A;  1EL0 A;  1EU4 A;  2D9U A;  1FD7 D;  2AQ2 B;  4DR5 L;  1NR2 A;  1Q81 C;  4DV2 Q;  2E2I H;  3KJO A;  1JOK A;  2UUC Q;  1JIC A;  4MTN A;  4BY1 G;  1HQM C;  4GNX B;  4NXM L;  3S17 H;  1OXU A;  4R4I A;  1HXY D;  1CZW A;  1QNK A;  1D6E C;  5IWA L;  4BA1 I;  3ONA B;  4FO2 A;  1KIX A;  4BBS B;  1EQR A;  1CHQ D;  1D1K A;  4ZRZ A;  1B4O A;  2E74 C;  3URY A;  3PIO 3;  3Q23 A;  2K52 A;  1HR0 Q;  4HR7 B;  2NVX B;  3T13 A;  3V05 A;  5M5W H;  5FLX L;  3H3V I;  1TR5 A;  2I0Q A;  2F0G A;  5M5X B;  5IYC G;  5IYC H;  2EOT A;  4KD3 A;  3CQZ B;  4JI2 Q;  1VF7 A;  3TP5 A;  1LTT D;  3NTI A;  1ILP A;  3GTQ B;  2QDB A;  1XNR Q;  1SNM A;  1PTO B;  1VQK A;  2ZXO A;  2EYM A;  1I4P A;  2XTI A;  3A54 A;  1EU3 A;  3Q8D A;  1VQ4 A;  1XMQ Q;  1XJV A;  1OTC A;  4K2K A;  4A3J G;  1KTK A;  1WYD A;  5J22 A;  1PXU A;  4DV6 Q;  1JT8 A;  2TSS A;  2UXB L;  5IT9 c;  1F2L A;  1HFN A;  3AYH B;  3MXU A;  4IJH A;  3ND9 A;  1NMF A;  2F0U A;  3HP3 A;  2JP1 A;  4I7A A;  4QIW E;  2UXC L;  4GN5 A;  2K01 A;  3ER0 A;  3BZC A;  1STE A;  4QMG A;  3R2T A;  4ZYS A;  4KN4 C;  4HIM A;  2HD3 A;  4JI6 Q;  1SYC A;  3S24 A;  4K0K Q;  4YHH L;  5JEA G;  5JEA H;  2YU9 H;  2VL6 A;  3UE0 A;  2DNE A;  4MNO A;  2WAQ B;  3I3C A;  1RL2 A;  5DNF A;  1G51 A;  2DN8 A;  1PLF A;  2AMC B;  1KRT A;  1YNX A;  2WAC A;  1HUN A;  1GUN A;  1BCP B;  3H91 A;  4RGO S;  3I90 A;  1I4G A;  5C44 G;  3K7U C;  5C44 H;  3J81 j;  1E0B A;  2N49 A;  3GTP B;  1E2Z A;  1QNU A;  4HED A;  4AQY L;  2LS0 1;  2EZV A;  3CCM A;  1N32 Q;  4NP5 A;  1XNQ L;  2EYJ A;  2WFW A;  2J7Z A;  2K5Q A;  1DZ1 A;  4F8M A;  1H9S A;  1CK1 A;  1E3P A;  2KEC A;  2L5T A;  5DEH A;  2B29 A;  5IOC A;  2AWN A;  1EY4 A;  1C7Y A;  4GKK L;  5C3X A;  1PHJ A;  5DAU A;  1K0R A;  2IX0 A;  3OMC A;  4HMJ A;  4RGM A;  4XIG S;  5JJL A;  1B8A A;  2FFK B;  2L11 A;  3SXH A;  4DNT B;  4JYA Q;  2HIV A;  4IO9 A;  3FMC A;  3EA6 A;  3OHX C;  2A68 C;  2R92 B;  4F88 A;  1R4Q B;  3VA5 A;  2VQF L;  4IUU A;  4A3B B;  2NTS A;  2EQS A;  5C4J B;  2WP8 J;  1HZ9 A;  1BR9 A;  1J5E Q;  3PGZ A;  5LMN Q;  1PTO D;  4G7Z C;  4L6T B;  3BZD B;  4JI5 Q;  2C9O A;  2OT2 A;  3I4M H;  1EYC A;  3Q24 A;  3CCS A;  1Q8I A;  2C5C A;  1C8C A;  2F0E A;  4GS3 A;  2E2J H;  1PH6 A;  1UUP A;  4IFD G;  4DR2 L;  4IFD H;  2R93 G;  3KF8 B;  1XPO A;  2R93 H;  3S1N H;  2FMC A;  4C3H B;  1IBK L;  4OIK A;  1KL9 A;  1X65 A;  4DR5 Q;  2F0Q A;  2IX1 A;  3NK9 A;  1ESF A;  3DMU A;  1MIU A;  2N88 A;  3QOJ A;  3L3O C;  3MXG A;  1YNJ D;  2K28 A;  3MAQ A;  1K83 H;  4NXM Q;  4A3E H;  2ATW A;  2NTT A;  3EQL C;  3CCL A;  2Y0S B;  4DNI A;  1K3B C;  5IWA Q;  4PZ8 A;  3RLN A;  1AW7 A;  4A3F G;  4BY1 B;  2GVB A;  3G48 A;  3TRZ A;  4DK0 A;  1SNO A;  3AB9 A;  4BY7 B;  1BDO A;  1A3V A;  4UP9 A;  2X69 A;  4R8N A;  2JA5 H;  1NSN S;  1BKB A;  4UAI A;  1D5Z C;  1KRS A;  3FEW X;  4H0L C;  5ELF A;  1XMO L;  1ASY A;  1S3O A;  4X66 L;  4HCE A;  1AE2 A;  1BCP D;  1NJI C;  1HNX L;  2B63 G;  1HNZ L;  2BH2 A;  2QF7 A;  3TS0 A;  3S14 H;  2F0H A;  4G4K A;  4R4T A;  4C2M H;  5LMU L;  5CC4 A;  2CVR A;  2F0O A;  3HOV B;  4CDD C;  2ICI A;  2BE5 D;  1LYL A;  3RZO H;  2EJM A;  3A55 A;  3RUZ A;  3C1E A;  2HCI A;  2N78 A;  3I56 A;  5A35 A;  2PZU A;  5IIF A;  2UXB Q;  1KNA A;  3I70 A;  1PTO F;  5EQ0 A;  2O4X A;  4YIJ A;  1CKN B;  2F0N A;  2Z6B A;  1UEA B;  4POF A;  5NUC A;  2IPK D;  3D4W A;  2UXC Q;  1BQQ T;  1LTB D;  1V8Q A;  3BJU A;  4O42 A;  2A1A A;  1YVC A;  2B8G A;  3S9W A;  1WJJ A;  1QG7 A;  1PDQ A;  3HGB A;  2F0F A;  1VCI A;  3AU7 A;  3HEJ A;  2FXQ A;  4L8J A;  4YHH Q;  1X54 A;  1EQV A;  5E7N A;  1GOZ A;  5E4W C;  4A3K B;  4LFC Q;  2HQL A;  3BVZ A;  2CFM A;  1SJE D;  2PNR C;  3PUX A;  4KY5 A;  3M3Y H;  5FLX c;  5L37 A;  4JPB W;  1VMP A;  2VZA A;  4A4I A;  1BF4 A;  5IYB H;  5IYB G;  3JAM c;  1GUS A;  2KA7 A;  3JAM i;  1KC8 C;  3NEM A;  2RHQ B;  1G91 A;  2R7Z H;  2R7Z G;  2AHO B;  1ZKO A;  1I50 H;  1K8O A;  3QOL A;  4X64 L;  1SBB B;  3D6W A;  2E2H B;  4AQY Q;  4PZ6 A;  2WB1 E;  4DUZ L;  1XNQ Q;  1R9T B;  4LJZ C;  3K57 A;  1KDC A;  1S5C D;  3I2Z A;  4HIK A;  2QKI C;  2B2V A;  3S2H B;  2BDO A;  3I4O A;  1D5X C;  2JA9 A;  3TZU A;  1BCP F;  5CR3 A;  1K9M C;  1G29 1;  3DWP A;  4KHZ A;  1H9K A;  4GKK Q;  1SLJ A;  1N33 Q;  4LF5 L;  4P73 A;  2BCO A;  2HIX A;  4OL7 A;  1IL8 A;  5C4X H;  5C4X G;  1KLG D;  3GTL H;  4WJW A;  2V4D A;  2L0C A;  2NVQ H;  1Q7Y C;  1GVP A;  4HCS A;  4JCV E;  5EBD A;  4ZQ3 A;  1PH8 A;  2MQH A;  2VQF Q;  1XPU A;  2DJF C;  1S4Z A;  4Z9C B;  2P5Z X;  4FNF A;  3CCQ A;  3FHW A;  3CF5 A;  1SRO A;  1STA A;  1LT6 D;  2A19 A;  4ILW A;  4L5T A;  4QF4 A;  3L7Z C;  1IW7 C;  2Q8I B;  3UE1 A;  4RWS C;  2BDN A;  3MWY W;  5M3F G;  4DR2 Q;  4RH6 A;  2PW7 A;  3OWE B;  4B08 A;  3R2I A;  1I6H H;  1JJC B;  1OXX K;  2V1C C;  3RNU A;  5FLX E;  4IPC A;  4NDX A;  4WRD A;  1EY0 A;  1F77 A;  4EQO A;  4GOP B;  3HOZ G;  3HOZ H;  1XXG A;  4OON A;  4DNR B;  4DR6 L;  3OIP A;  3NWS A;  1M90 C;  2H5X A;  3HKZ B;  1H9M A;  1FGU A;  4YCW A;  2L55 A;  5CV5 A;  4DAM A;  4DXG A;  3CU7 A;  4XYO A;  1DCZ A;  2WB1 G;  2AQ1 B;  1LUZ A;  1YNN D;  4MZ9 A;  1IYU A;  4DAY B;  5IGE A;  2PPB C;  4A3L G;  4A3L H;  3U50 C;  2F0K A;  4RMF A;  4A3F B;  2MFI A;  2QDL A;  3J7A V;  1WTW A;  1PYB A;  4HJ9 A;  1Q82 C;  1Y1W B;  2PYK A;  1ENC A;  5M5Y B;  1XMO Q;  4U67 3;  4X66 Q;  5D14 A;  1EY6 A;  1HNZ Q;  3H0G B;  2ICE C;  3SVM A;  4A75 A;  1SYB A;  4HSP A;  1FR3 A;  2A6E D;  2YTX A;  2K5W A;  2FJ2 A;  5CV4 A;  3I73 A;  4X3T A;  4IUT A;  3W5O A;  1K8M A;  3K0Y A;  2J4X A;  5CBA E;  1RF2 D;  2K5V A;  3ERQ A;  3O13 A;  3TN2 A;  1ZXT A;  1DGS A;  5JAV A;  4A3M B;  1YIJ A;  1EY5 A;  2OQ0 A;  2PCF B;  4KHV A;  4YCV A;  2G5D A;  1CSQ A;  1SRU A;  1HQR D;  3P1H A;  3K8A A;  5K5P A;  1WVL A;  1LM0 A;  4ID6 A;  1MHW C;  2Z8L A;  5I2Y A;  1EYA A;  3EJI A;  3ULL A;  3LWE A;  3A74 A;  4K6L A;  3CC2 A;  1OO9 B;  1LT3 D;  5IT9 L;  3CCE A;  4DV2 L;  1H9J A;  1TS5 A;  4MIU A;  4LF9 L;  2KBN A;  3UI2 A;  2JA6 G;  2JA6 H;  3A8K E;  1F2M A;  3HOW H;  3HOW G;  1ZYR D;  5T1G A;  3IAY A;  1I5F A;  2D0P A;  4FVM A;  5KGU A;  2OCE A;  1EWC A;  4ABN A;  1Y1V G;  3V96 A;  2JEB I;  4ZUJ A;  1EY9 A;  1A3T A;  2WIN B;  3RZD H;  2NVY B;  3KF8 A;  4JV5 L;  1A2T A;  1E2W A;  1UE7 A;  1A0I A;  1O7Y A;  1SAP A;  4CKE A;  3H6M A;  4A3I B;  2GN5 A;  1VQ6 A;  4BBS H;  2CH4 A;  3I4L A;  1Y8O B;  3KF6 B;  3MC0 B;  5C3W A;  1L2F A;  3E3X A;  1ENA A;  1EUJ A;  1F9S A;  2CH4 W;  4QY7 A;  1RTO A;  4X64 Q;  2L12 A;  2VW9 A;  1ROD A;  1GO3 E;  4GLV B;  1TII D;  1P8L A;  1YEZ A;  3F1Z A;  3HOU G;  2CQA A;  4IPG A;  3S1Q B;  4MTK A;  3L2P A;  4FF4 A;  1IXR A;  1JB7 A;  5IOD A;  1I6V C;  3A56 A;  4OXP A;  2F3W A;  5GAE C;  4X3K A;  4X65 L;  3BVG A;  4TKO B;  3MXP A;  3CQZ H;  1CQF A;  1KLU D;  1N36 L;  5C5L A;  3E0J A;  3GDE A;  2I07 B;  3FDT A;  1S5B D;  3R3O A;  1U4M A;  4JBJ A;  2C35 B;  3K7A H;  3F2D A;  2MGS A;  4L5R C;  2N8N A;  1K8G A;  2LXK A;  2OF1 A;  3I8Z A;  1STH A;  1LTL A;  4Y7N H;  2QW7 A;  5GAG C;  3NBI A;  1MGS A;  1D5M C;  1KXL A;  4L5S A;  2PI2 A;  2M2L A;  2KJX A;  3GTK B;  3NBH B;  3CCJ A;  5M3M B;  1TWH H;  1X3G A;  3BDO A;  4BBR G;  3VR4 A;  4Y52 H;  4IUR A;  5ELN A;  3HOX G;  2KCN A;  2NN6 H;  2PQA B;  4BS9 A;  1HH2 P;  2CCZ A;  3FP9 A;  4I7Z C;  1X6O A;  1B53 A;  1YJW A;  4P2C B;  2Q8T A;  4G7H C;  3BDL A;  3T1Y L;  3PO3 G;  3HS0 C;  3PO3 H;  4H7B A;  2DNC A;  5CMD A;  4UP7 A;  3AEV A;  4XQN A;  1VQ5 A;  4DR6 Q;  3PIP 3;  3LWU A;  2YYZ A;  5JJI A;  3CD6 A;  1CSP A;  2AUJ D;  4EQN A;  1OXV A;  4HJ8 A;  2M9V A;  3CC4 A;  3NTK A;  1STY A;  4AH6 A;  1KDA A;  2KCC A;  1V9P A;  3UDG A;  3M4O H;  5COY A;  5D3D A;  4K5X A;  1CUK A;  4AYB B;  5CV9 A;  4IJL A;  2K4K A;  3SDZ A;  4OEL B;  2NZO A;  3FRP B;  2CW0 D;  1EIG A;  4KLK A;  1Y8P B;  3BYY B;  1VQM A;  2F0I A;  3QIA A;  2SEB D;  5K36 G;  5K36 H;  4RCO A;  1AZP A;  3HKS A;  4K8J A;  1L0W A;  3T1H Q;  4RFB A;  4C56 C;  1ILQ A;  2F03 A;  3ERO A;  2F52 A;  1WCM B;  2MHV A;  2EXD A;  1NY4 A;  3E9H A;  1FL0 A;  4PMC A;  1GD7 A;  4V0B A;  5KIX A;  1TY2 A;  2EYP A;  1XYI A;  4JI5 L;  2AUK A;  3TDQ A;  4A93 G;  4R4C A;  2KEE A;  2VS1 A;  4IUP A;  4IFD J;  4KV6 A;  1A63 A;  3SEB A;  4DV0 L;  2VB3 X;  3K0X A;  1ESR A;  3S16 H;  4LF9 Q;  1VQB A;  2OXP A;  1QB5 D;  3BU2 A;  2HHH L;  4C3H H;  3P20 A;  4JI4 L;  4O0A A;  4QUF A;  4HJA A;  2PMZ B;  3CRL C;  3NE5 B;  3I91 A;  4KK7 A;  3HOY B;  3M4Y A;  1OXS C;  1D8L A;  2CWP A;  5FO9 B;  5D65 A;  4JV5 Q;  1BNZ A;  1PRT B;  1EFI D;  1I94 L;  5M9O A;  5FK9 C;  2PQE A;  2QEJ C;  3M4Q A;  3TSS A;  1LT4 D;  3JC6 6;  4C3J H;  4C3J G;  3P75 A;  2E5L L;  3SR1 A;  3GTJ B;  4GOP A;  1WTO A;  4PNY A;  1GHJ A;  1KAB A;  1IBM L;  1WTV A;  2L4N A;  2D5D A;  1BBW A;  3JAM L;  4FF1 A;  2O5I C;  3L9A X;  3G71 A;  2L15 A;  4J15 A;  2QA4 A;  2ALY B;  2RF4 A;  4LWC A;  1SMY C;  1TWG B;  4X65 Q;  5C4H A;  1Y69 U;  1LT5 D;  3CP0 A;  1N36 Q;  4A3G G;  4A3G H;  1ET9 A;  3HOV H;  4J8Q A;  1YHA A;  4ULL A;  1ET6 A;  1EIF A;  1SNP A;  4DKA C;  2R7F A;  2YTY A;  4B3R L;  1LAC A;  1C48 A;  1PH3 A;  1K73 C;  4P71 A;  1NBW A;  1AP0 A;  4ODG A;  3GO5 A;  2VUM G;  2VUM H;  3SGI A;  4LMQ D;  3FPU B;  4L5Q A;  2RDF A;  1UE6 A;  2K03 A;  4JI7 L;  3IFD A;  1WD0 A;  1CZG A;  5FLM H;  3TP7 A;  3E9I A;  5TSS A;  3MEH A;  2IW3 A;  1LAB A;  4IOC A;  2RSN A;  1DYQ A;  4CJ0 B;  1YI2 A;  4LFC L;  5JJK A;  1GJX A;  1TWA B;  3GP7 A;  1U0L A;  2R3Z A;  1LO5 D;  5BN3 A;  3S2D H;  3C2P A;  2QCP X;  2B3G A;  3W1G A;  2K5N A;  3T1Y Q;  3J7A F;  2F0S A;  3OSO A;  3VR6 A;  5I6Y A;  3AFP A;  4DF7 A;  1J6Q A;  3WOE A;  3S15 B;  3U58 A;  1NNX A;  2JA8 B;  1TWF B;  2G9H D;  1XPR A;  1SNC A;  2NWG A;  1QCB D;  5IGD A;  3PF5 A;  1T5X D;  4HIO A;  3W1B A;  5GRO A;  3PO2 B;  3KYH C;  4DAV A;  4ZCK A;  1TY0 A;  2KQ3 A;  2KHS A;  4GZY C;  2I5L X;  4HAE A;  1N33 L;  1BVS A;  3IFT A;  3OTO L;  1DXM A;  1PRT D;  1NR4 A;  2CQO A;  4EQ5 A;  2RQX A;  3STB C;  3DM1 A;  2K6A A;  5JVH 3;  4CJ1 B;  3NEL A;  1I4Q A;  2EY2 A;  2MPM A;  3K59 A;  2Q2U A;  1L1O A;  1RTN A;  1C4Q A;  5KEE A;  5IT9 E;  1PFS A;  1K3R A;  1Y8N B;  2JK8 A;  2D2C C;  1EWI A;  5HY6 A;  4KKS A;  1F9R A;  1CA5 A;  2N55 A;  2E2D C;  2A69 D;  2HUG A;  3PUV A;  1I3Q B;  1PZI D;  4TQU S;  4HJ5 A;  3I4M G;  1G6Z A;  1TXY A;  2EY1 A;  4HJ7 A;  4I65 A;  4AIM A;  3QG1 A;  3V2T A;  2A6H C;  3PF4 A;  4DV0 Q;  3D4R A;  4A3C G;  4A3C H;  2XSC A;  1AZQ A;  5ELC A;  4QCL A;  1C9O A;  1RJT A;  1A3U A;  4F87 A;  1PVO A;  3MZ5 A;  4HN7 A;  4HTH A;  1Z9F A;  3NBH A;  2HHH Q;  4JI4 Q;  4A3E G;  2EYO A;  4EQP A;  3HRZ C;  4M8A A;  1G8Z D;  2EYL A;  1JQY D;  4C3I H;  4C3I G;  1S5F D;  4KY7 A;  1GUO A;  5C3E G;  5C3E H;  2PQA A;  4OHJ A;  3ITP A;  3DWQ A;  1I94 Q;  4KD4 A;  1J9O A;  4MN3 A;  1NCV A;  5CBE E;  3SK5 A;  1O7I A;  2PO4 A;  2JA5 G;  3E6Z X;  5BN4 A;  3MHB A;  1VQN A;  2B2T A;  2IHF A;  2E5L Q;  3Q6S A;  5IY0 A;  4FXD A;  4RAU C;  1IBM Q;  3BYT B;  4A3D G;  4A3D H;  1S5E D;  4DV4 L;  2XIW A;  1KAW A;  2D62 A;  4RA8 A;  1PRT F;  1STB A;  3ULP A;  3DHQ A;  5M5W B;  3PUY A;  2BA0 A;  4YY3 L;  1GUG A;  4OO1 G;  4OO1 H;  3H0G H;  2EVB A;  4R1J A;  1VQO A;  3J81 c;  1JOQ A;  3J81 i;  2EYF A;  1QJO A;  3QR8 A;  4DR4 L;  3TME A;  1S5D D;  3A7A B;  2F0D A;  4DV3 L;  2ZT9 C;  1T5E A;  4B3R Q;  1IBL Q;  1FNV A;  1FNU A;  4X3U A;  5GAD C;  4IAL A;  4K2L A;  3TQY A;  2ZM6 Q;  1EY7 A;  1V1P B;  4A3J B;  1EIY B;  3ZJY C;  2F3V A;  3FVQ A;  3K80 C;  3NP8 A;  4HID A;  4JI7 Q;  4ME5 A;  3S1M B;  2EIF A;  3DEO A;  4R9W A;  4B9X A;  3CRK C;  5JOB A;  1GUW A;  3VR5 A;  1FVI A;  4RHR A;  2VNU D;  4R8I A;  1NE3 A;  1QZH A;  2YV5 A;  4RKB A;  5G3L D;  4C1N I;  3VYS A;  3MEF A;  1QIL A;  4V19 0;  3BVM A;  4POG A;  5AFW A;  2YU9 B;  2KUM A;  1STN A;  1UAP A;  1SEB D;  1MBY A;  3H09 A;  4DFA A;  2JXM B;  1E1O A;  4GNX A;  1MI2 A;  2XWB B;  3F8T A;  5E4X A;  1XTC D;  2QEX A;  2A74 C;  2QIL A;  3A5U A;  1K8A C;  2E76 C;  5C44 B;  1IKM A;  1VQJ A;  3HZX A;  1IZ6 A;  5KND A;  2Z6K A;  2HDM A;  1V1Q A;  4GLA C;  3OTO Q;  3GTO H;  2UU9 L;  1PA6 A;  1EEI D;  1YJ9 A;  4JBK A;  3A8I E;  3J81 E;  1JWM D;  3NXW A;  4YCU A;  1M4V A;  4P72 A;  4UPA A;  1K0S A;  3A5Z B;  1B2T A;  1L1O C;  1QUQ B;  1STG A;  4FF2 A;  1SMY D;  1SN8 A;  1A6X A;  3KJP A;  4XQQ A;  1ASZ A;  5I9P A;  2JJQ A;  4UP8 A;  2JA7 G;  2JA7 H;  2MP1 A;  3FKI H;  3FKI G;  2F0J A;  3M7G A;  2H4O A;  5FOB B;  1N9W A;  3KOJ A;  3TRE A;  4QIW B;  4B9W A;  3H3V H;  1DON A;  3I4M B;  2A73 B;  4PQX A;  1VF5 C;  5A2Q L;  2K32 A;  2E2J B;  2XGT A;  1BUV T;  5C6A A;  1B9N A;  2R93 B;  5J3B A;  3S1N B;  5IP9 G;  5IP9 H;  3JAM E;  2RCN A;  4KMU C;  1YBY A;  3NQI A;  4K14 A;  4KJN A;  1SSO A;  1SND A;  4QQB X;  3BG3 A;  3K5N A;  1DOL A;  2F4I A;  3I4N G;  3I4N H;  2K5H A;  1SE3 A;  1KQS A;  5AJ3 L;  1S72 A;  2R7D A;  1JCK B;  3G6E A;  3A7L A;  1VQ7 A;  3VYU A;  1PH5 A;  4L63 B;  2B2T C;  2ID0 A;  1RHP A;  2F0M A;  1X3F A;  2K05 A;  3J80 c;  5KYI A;  4DV4 Q;  1VQA A;  4DUY L;  2WII B;  5CV7 A;  2ZXP A;  2PZT A;  1GXD C;  3X3M A;  1DM0 B;  3PUW A;  3J7Z C;  4ALP A;  5IE8 A;  4P75 A;  3WOF A;  1HA6 A;  3PV0 A;  3T1H L;  4YY3 Q;  2RA4 A;  1SYF A;  4KHP L;  2B63 B;  3S14 B;  4C2M B;  1Q86 C;  1JOR A;  2B8F A;  1PFB A;  2F0W A;  3J7Y W;  1PH9 A;  3GTM B;  4DR4 Q;  3STB D;  2LMC B;  4DV3 Q;  3TBI B;  3TEH B;  2K33 A;  2A68 D;  4KKT A;  3LNN A;  1KNE A;  5FO7 B;  2NVT H;  4LUO A;  4NB3 A;  2X6G A;  4IQZ A;  4XT3 B;  1HTP A;  2EE1 A;  3ICE A;  1G6P A;  4LF4 L;  3A8J E;  4BWG B;  1TQO A;  4X6A H;  2SDF A;  4QB4 A;  3MXN B;  4YWK A;  2BH8 A;  1G2T A;  4FXG C;  4TRD A;  2X6L A;  3N52 A;  4RHS A;  4CDC C;  2DY7 A;  1SE2 A;  1PH7 A;  4F7X A;  5J39 A;  2SNM A;  2WAQ E;  2EYH A;  4LUV A;  1C0A A;  3RR5 A;  5ELB A;  4X3S A;  4BBS G;  1JR0 D;  1QVG A;  2RKS A;  5HUR A;  4CKB A;  3EN2 A;  1S40 A;  1CHP D;  3M3Y B;  3SE0 A;  4OWX B;  4GNX C;  3EVQ A;  4IZ8 A;  4UHV A;  1PYS B;  1TWC B;  4A76 A;  2NVX H;  2HCC A;  1JE4 A;  3C1F A;  1JJ2 A;  3VR2 A;  1CTM A;  4DR3 L;  3OYY A;  3R8B A;  2R7Z B;  1I50 B;  3I7F A;  1RIP A;  3NWT A;  1Q3L A;  5M5X H;  2B2V C;  3G4S A;  2F0L A;  2IWH A;  3MVV A;  4IFD I;  3ULJ A;  1Q1E A;  2N3S A;  2UU9 Q;  1GHK A;  1NAP A;  3RMH A;  1QOH A;  1MJC A;  3GTQ H;  4FXK C;  1PTO H;  1Q90 A;  2EJG C;  3HFZ B;  2KHI A;  4FYD A;  4ME3 A;  4JI8 L;  3EIV A;  3GTG B;  5CV6 A;  4Q5V A;  3X3N A;  5C4X B;  3GTL B;  4LF8 L;  1HNW L;  1Z6H A;  2NVQ B;  1EY8 A;  2KOL A;  1PTO C;  1FYC A;  1WTH A;  3C3L A;  2ENB A;  3D8G A;  1W3S A;  1I4H A;  3CCU A;  3S1R B;  1VMC A;  1HCZ A;  1JOO A;  4PZ7 A;  1BOS A;  1NUC A;  2BA1 A;  2NN6 G;  3UDI A;  4LF6 L;  3KBX A;  5F2D A;  1SYG A;  2RDG A;  1CKN A;  1MSH A;  1VQP A;  1W6J A;  2NYZ D;  1YNJ C;  5M3F B;  4PMW A;  1Z47 A;  3Q0A A;  5EKI A;  2WAQ G;  1MJE A;  3IRB A;  3VDY A;  2CKZ B;  4CDE C;  3QB3 A;  3KDF B;  1I6H B;  5DM7 3;  4OO1 I;  4NKL A;  1X9N A;  5CV8 A;  2Y0S E;  1HA5 A;  5AJ3 Q;  3HOZ B;  1FNW A;  3GTP H;  3S15 H;  4N8X 1;  1TWF H;  3IL8 A;  4K5W A;  2XRS D;  1XTD A;  4BXX G;  4CDF C;  4BXX H;  3GV3 A;  3P7J A;  1KDB A;  1M8A A;  2KCM A;  4GKJ L;  2WB1 B;  1SYE A;  4G57 A;  1A62 A;  3CMA A;  4DUY Q;  1SMX A;  3D4D A;  2WKD A;  3PIO A;  3FPP A;  1CT1 D;  5EJW A;  2UUA L;  2XRQ D;  1VQH A;  3NHH A;  2LXJ A;  1I4X A;  4G7O C;  2RSO A;  4C1N K;  4KHP Q;  2D0O A;  5EKL A;  1RCV D;  2PI2 E;  4KTA A;  2JQO A;  2K14 A;  2R92 G;  4EGV A;  2R92 H;  5J1Z A;  2B2W A;  4IUN A;  4A3B H;  4A3B G;  5IYD H;  2ZTC A;  5C4J H;  1SXT A;  3U9O A;  5ELE A;  5I4D A;  3J81 L;  1LTR D;  1SFO B;  1X32 A;  4DR7 L;  3F2C A;  4LUZ A;  2G9D A;  1W2B A;  2F1M A;  2K1B A;  4B3M Q;  1PH1 A;  3T51 B;  4O1N A;  3WDN A;  1JWU D;  3KLS A;  2GVA A;  4CKC A;  2K50 A;  1SNQ A;  1U4P A;  4XT1 B;  4C3H G;  2ES2 A;  4LF4 Q;  1IW7 D;  2LKV A;  2F0V A;  2FMM A;  3ND8 A;  1O7Z A;  5EPJ A;  4M1U B;  4KI0 A;  4DR1 L;  1L0Y B;  2XWJ B;  2Z1C A;  2JA6 B;  3HOW B;  1FGB D;  3IKJ A;  4JG2 A;  1EIH A;  2XVS A;  3G7L A;  2Y0S G;  3UDF A;  4LFA L;  1Y1V B;  5LL6 S;  3I72 A;  4BY1 H;  1ZEQ X;  1DD2 A;  3RZD B;  4DV5 L;  4BY7 G;  4BY7 H;  1F2Z A;  1O78 A;  2KHJ A;  1EYD A;  1HTL D;  3M4P A;  2ZJR A;  1CI3 M;  4KN7 C;  4JI1 L;  1KD1 C;  1FJG L;  3KBG A;  4DR3 Q;  1A15 A;  3KLS X;  4UY8 C;  2IL8 A;  4DV7 L;  3NUC A;  2RBM A;  2L1B A;  3KUP A;  3BDC A;  1GM5 A;  5JJZ A;  4DAY A;  2JN4 A;  3HOU B;  4BA2 I;  3TP8 A;  2PW5 A;  5EBC A;  3HOV G;  1G2S A;  3EBE A;  4R4Q A;  1QZG A;  1HFG A;  1BXT A;  1AFP A;  4JI8 Q;  1IBL L;  5H1S E;  3T56 B;  1CFM A;  5A2Q E;  2ZM6 L;  3M85 A;  4B3T Q;  2ASB A;  1PFM A;  1IKL A;  4LF8 Q;  1HNW Q;  5C5M A;  4B3S L;  3K7A B;  1B70 B;  2JEA I;  1BBU A;  4ZLT F;  5FLM G;  1Q1B A;  4LK1 C;  1EYG A;  3SHL A;  4Y7N B;  1D2B A;  4A3J H;  1II3 A;  3K5O A;  1X3Q A;  5GQO A;  2CHB D;  3I55 A;  1LTS D;  3S1M H;  1CM9 A;  2Z4H A;  4LF6 Q;  1D1I A;  2SNS A;  2O5J C;  2Q2H A;  1TWH B;  4BBR B;  4GN3 B;  1BBX C;  5JVG 3;  2B2Y A;  2WKC A;  3HOX B;  1PYW D;  1LTI D;  1OXT A;  4A3K H;  3AFQ A;  4A3K G;  3QO2 A;  4H44 C;  3GD7 A;  2VQE Q;  5EKK A;  2RDH A;  2XN9 C;  4FDB A;  3CW2 C;  1PH2 A;  3B6Y A;  2MO1 A;  5ISR A;  3PO3 B;  3MXN A;  1U9R A;  4LW1 A;  3MFG A;  3VYR A;  1YNN C;  3HKZ E;  3K5L A;  3J7A 5;  1AH9 A;  2IHE A;  4X62 L;  1U4L A;  3NSW A;  1B7Y B;  3RN2 A;  1HUM A;  1HR0 W;  2E2H H;  1CKO A;  1VS0 A;  5ELO A;  3OMG A;  1R9T H;  4JW0 A;  1NMG A;  1QWY A;  4GKJ Q;  2Q2T A;  3KF6 A;  3DLL A;  1VQC A;  3S2H H;  5I6W A;  3BZK A;  3E5S A;  3M4O B;  1B3Q A;  1AN8 A;  2VXW A;  2AWO A;  3UDX A;  2A6E C;  2EJF C;  2UUA Q;  4OWT B; 
#chains in the Genus database with same CATH homology
 3J80 L;  3MTS A;  3BS1 A;  3QWN A;  4CBV A;  5C0X G;  5C0X H;  2LY7 A;  3D31 A;  3NPP A;  2JSO A;  2F0P A;  5KRU A;  2B2W C;  5FO8 B;  4DK1 A;  1WD1 A;  4IUV A;  1V43 A;  3DUZ A;  5IGC A;  1RKN A;  4A93 B;  3HG9 A;  3OWF A;  1O7L A;  4RGN A;  4NMZ A;  4FF3 A;  1ZYR C;  4RGT A;  4WFN 3;  1MD2 D;  5BN5 A;  4JBW A;  2ZXR A;  5FKA C;  2E2I B;  4XXE A;  4U68 A;  2B2U A;  3S16 B;  3S17 B;  4S3S A;  3LX0 A;  4DA2 A;  4QUC A;  1HRJ A;  2MJ8 A;  2OEO A;  2L9H A;  2FHT A;  1O80 A;  5IGB A;  4IUQ A;  2NUC A;  1EZ8 A;  5CYU A;  1SDF A;  4C3J B;  1EQT A;  4CJ2 C;  5LHY 1;  2NZ1 D;  4K8I A;  1L0X B;  1JB3 A;  4K6D A;  2NN6 I;  5I9O A;  4TSS A;  3N6R A;  1IHZ A;  4HMI A;  4UDU C;  2JE6 I;  1F9Q A;  1ONL A;  1F9P A;  4J1M A;  5IGF A;  1CQV A;  1EOT A;  4A3G B;  4CHT B;  1X3P A;  1ICW A;  1TT2 A;  2VUM B;  1WTQ A;  1Q12 A;  1TU2 B;  2J0T D;  1B44 D;  1LTG D;  3KK7 A;  3VYT A;  4WOR A;  3T53 B;  1DOM A;  2B2Y C;  2MUY A;  4OGQ C;  1IYV A;  1W6K A;  4DGZ A;  1KAA A;  3S2D B;  1H9R A;  3OPO A;  4DU9 A;  2JYO A;  2K5D A;  3T4A C;  2HDL A;  1AEX A;  4DN4 M;  3K6O A;  2E75 C;  2CW0 C;  2Z4I A;  3H94 A;  2WV6 D;  1UNS A;  2KED A;  3C46 A;  2O2L D;  1B50 A;  5CGK A;  2EY6 A;  4EVO A;  1PMR A;  1SYD A;  2A5H A;  2R6G A;  1DJR D;  5LL6 X;  2H1E A;  5E1F A;  4N9T A;  1EZ6 A;  4MHE A;  3NQT A;  5DM6 3;  1V1O A;  2M00 A;  4JK1 C;  3OW7 A;  2RVL A;  2F0T A;  5G3L F;  5KNB A;  3KLR A;  3K5M A;  3W2D A;  3H3V C;  1LLR D;  1Z7T A;  3PUZ A;  2B2U C;  4LAA A;  1K83 B;  4A3E B;  4C3I B;  2K7V A;  4NW2 A;  4ZK9 B;  5C3E B;  4KJO A;  1I4R A;  1WTX A;  2JA5 B;  3D6C A;  5KYL A;  4XYQ A;  2LFN A;  4A3D B;  2FIN B;  4XTC S;  4ZKC B;  1EWH A;  1RD9 D;  1ENF A;  1GUT A;  1SE4 A;  1TS2 A;  1TVX A;  3SK6 A;  2KVM A;  4ZUI A;  1QE6 A;  3RZO B;  2EDG A;  2R61 A;  4HSV A;  1HHV A;  2NB0 A;  4Q0F A;  2I46 A;  1SJH D;  3VA7 A;  3DWA A;  5I2X A;  2XNA C;  1DOK A;  3GQB A;  1LTA D;  2A6H D;  4N9P A;  2EPB A;  1WTR A;  3RLF A;  3D3R A;  4XQJ A;  2BOS A;  4J6H A;  3TP6 A;  4E6I A;  3EFX D;  4ZAI A;  3MA2 B;  1LV9 A;  5T1I A;  5C0X I;  3J80 E;  2NBF A;  5D3I B;  1H9S B;  2VB2 X;  3RD4 A;  3M7N A;  3MFY A;  3DXJ C;  5EGT A;  4H13 C;  4DAP A;  3F2U A;  3Q22 A;  4KY6 A;  1XX8 A;  1PRT C;  4RCN A;  1TS4 A;  4DXF A;  2DY8 A;  4FP5 D;  3GTO B;  4IN3 A;  3W3A A;  3DEP A;  5KNC A;  2AQ3 B;  1ML0 D;  3U9S A;  2EXZ A;  1HPC A;  2A69 C;  5COR A;  4OIJ A;  5IGG A;  1B3A A;  4KKU A;  1RDP D;  2K04 A;  3NTH A;  2HQE A;  3VR3 A;  5JPM C;  1XWE A;  2JA7 B;  1CA6 A;  3FKI B;  1V1P A;  5ELD A;  2EY5 A;  5C4Z A;  3PMF A;  1JC7 A;  2PZW A;  1E2V A;  5JEA J;  1JWS D;  3QJY A;  1BO0 A;  3R93 A;  1EEF D;  1TKW B;  1B1Z A;  1MSG A;  4RKL A;  5E3F A;  2IJ0 A;  1R4P B;  1U4R A;  3T16 A;  3I4N B;  1A2U A;  1PZK D;  1J8I A;  1BCP C;  4PV1 C;  3G6J B;  2SOB A;  4PMB A;  2Q8R E;  2TMP A;  1F2Y A;  3GV6 A;  5EPL A;  5C0X J;  1PFN A;  2IX3 A;  2BE5 C;  3TZD A;  4CGY B;  1VDZ A;  3AMU A;  3OIQ A;  4XDX A;  1TS3 A;  4K5V A;  1PZJ D;  2B39 A;  4ZKB B;  3ZYY X;  2GA4 B;  5HGT A;  5EPK A;  3OOC A;  3K58 A;  1B9M A;  5JPN C;  3SK8 A;  3CHB D;  2NVT B;  2IT1 A;  1WTP A;  3CKI B;  3SK4 A;  1EL0 A;  1EU4 A;  2D9U A;  1FD7 D;  2AQ2 B;  1NR2 A;  1JOK A;  1JIC A;  1HQM C;  1OXU A;  1HXY D;  1CZW A;  1QNK A;  1D6E C;  4BA1 I;  3ONA B;  4FO2 A;  4BBS B;  1CHQ D;  1D1K A;  4ZRZ A;  1B4O A;  2E74 C;  3URY A;  3PIO 3;  3Q23 A;  4HR7 B;  2NVX B;  3T13 A;  3V05 A;  5FLX L;  1TR5 A;  2F0G A;  5M5X B;  2EOT A;  4KD3 A;  3CQZ B;  1VF7 A;  3TP5 A;  1LTT D;  3NTI A;  1ILP A;  3GTQ B;  2QDB A;  1SNM A;  1PTO B;  2ZXO A;  2EYM A;  1I4P A;  3A54 A;  1EU3 A;  4K2K A;  1KTK A;  5J22 A;  1PXU A;  2TSS A;  1F2L A;  1HFN A;  3MXU A;  3ND9 A;  2F0U A;  3HP3 A;  2JP1 A;  2K01 A;  1STE A;  4QMG A;  3R2T A;  4ZYS A;  4KN4 C;  1SYC A;  5JEA G;  5JEA H;  2DNE A;  2WAQ B;  3I3C A;  5DNF A;  2DN8 A;  1PLF A;  2WAC A;  1HUN A;  1GUN A;  1BCP B;  3H91 A;  4RGO S;  3I90 A;  1I4G A;  1E0B A;  3GTP B;  1E2Z A;  1QNU A;  4HED A;  2LS0 1;  2EZV A;  4NP5 A;  2EYJ A;  2J7Z A;  2K5Q A;  1DZ1 A;  4F8M A;  1H9S A;  1CK1 A;  2KEC A;  2L5T A;  5DEH A;  5IOC A;  2AWN A;  1EY4 A;  5C3X A;  5DAU A;  2IX0 A;  3OMC A;  4HMJ A;  4RGM A;  4XIG S;  2FFK B;  2L11 A;  3SXH A;  4DNT B;  3FMC A;  3EA6 A;  3OHX C;  2A68 C;  2R92 B;  4F88 A;  1R4Q B;  3VA5 A;  4IUU A;  4A3B B;  2NTS A;  5C4J B;  2WP8 J;  1BR9 A;  4G7Z C;  1PTO D;  4L6T B;  3BZD B;  2C9O A;  2OT2 A;  1EYC A;  3Q24 A;  1Q8I A;  2C5C A;  1C8C A;  2F0E A;  1UUP A;  4IFD G;  4IFD H;  2FMC A;  4C3H B;  4OIK A;  2F0Q A;  2IX1 A;  3NK9 A;  1ESF A;  3DMU A;  2N88 A;  3QOJ A;  3L3O C;  3MXG A;  1YNJ D;  2K28 A;  3MAQ A;  2NTT A;  3EQL C;  2Y0S B;  1AW7 A;  4BY1 B;  4DK0 A;  1SNO A;  3AB9 A;  4BY7 B;  1BDO A;  1A3V A;  2X69 A;  4R8N A;  1NSN S;  4UAI A;  1D5Z C;  3FEW X;  4H0L C;  5ELF A;  4HCE A;  1BCP D;  2QF7 A;  2F0H A;  4G4K A;  5CC4 A;  2CVR A;  2F0O A;  3HOV B;  2ICI A;  2BE5 D;  2EJM A;  3A55 A;  3RUZ A;  3C1E A;  2HCI A;  5A35 A;  2PZU A;  5IIF A;  1KNA A;  3I70 A;  1PTO F;  5EQ0 A;  2O4X A;  4YIJ A;  2F0N A;  1UEA B;  5NUC A;  2IPK D;  3D4W A;  1BQQ T;  1LTB D;  1V8Q A;  4O42 A;  2B8G A;  3S9W A;  1QG7 A;  1PDQ A;  3HGB A;  2F0F A;  1VCI A;  3AU7 A;  3HEJ A;  4L8J A;  1EQV A;  1GOZ A;  5E4W C;  4A3K B;  3BVZ A;  1SJE D;  2PNR C;  3PUX A;  4KY5 A;  1VMP A;  1BF4 A;  1GUS A;  2KA7 A;  1G91 A;  1K8O A;  1ZKO A;  3QOL A;  1SBB B;  3D6W A;  2E2H B;  1R9T B;  4LJZ C;  3K57 A;  1KDC A;  1S5C D;  2QKI C;  2B2V A;  3S2H B;  2BDO A;  1D5X C;  3TZU A;  1BCP F;  5CR3 A;  1G29 1;  3DWP A;  4KHZ A;  1H9K A;  2BCO A;  4OL7 A;  1IL8 A;  1KLG D;  4WJW A;  2V4D A;  2L0C A;  4HCS A;  5EBD A;  4ZQ3 A;  1S4Z A;  4Z9C B;  4FNF A;  1STA A;  1LT6 D;  4ILW A;  4QF4 A;  3L7Z C;  1IW7 C;  2Q8I B;  4RWS C;  2BDN A;  3MWY W;  4RH6 A;  2PW7 A;  3OWE B;  4B08 A;  3R2I A;  1OXX K;  5FLX E;  4NDX A;  4WRD A;  1EY0 A;  1F77 A;  4EQO A;  1XXG A;  4DNR B;  3OIP A;  3NWS A;  3HKZ B;  1H9M A;  2L55 A;  5CV5 A;  4DXG A;  3CU7 A;  4XYO A;  1DCZ A;  2AQ1 B;  1YNN D;  1IYU A;  5IGE A;  2PPB C;  2F0K A;  4A3F B;  3J7A V;  1WTW A;  1Y1W B;  2PYK A;  1ENC A;  5M5Y B;  4U67 3;  5D14 A;  1EY6 A;  3H0G B;  2ICE C;  3SVM A;  4HSP A;  1SYB A;  1FR3 A;  2A6E D;  5CV4 A;  2K5W A;  2FJ2 A;  3I73 A;  4X3T A;  4IUT A;  1K8M A;  3K0Y A;  2J4X A;  5CBA E;  1RF2 D;  3ERQ A;  3O13 A;  3TN2 A;  1ZXT A;  4A3M B;  5JAV A;  1EY5 A;  2PCF B;  4KHV A;  1HQR D;  3P1H A;  1WVL A;  5K5P A;  4ID6 A;  2Z8L A;  5I2Y A;  1EYA A;  3EJI A;  3LWE A;  4K6L A;  1OO9 B;  1LT3 D;  5IT9 L;  1H9J A;  1TS5 A;  4MIU A;  3UI2 A;  3A8K E;  1F2M A;  1ZYR D;  5T1G A;  3IAY A;  4FVM A;  5KGU A;  1EWC A;  4ABN A;  3V96 A;  2JEB I;  4ZUJ A;  1EY9 A;  1A3T A;  2WIN B;  2NVY B;  3KF8 A;  1A2T A;  1E2W A;  1O7Y A;  1SAP A;  4CKE A;  3H6M A;  4A3I B;  3I4L A;  1Y8O B;  3MC0 B;  5C3W A;  1ENA A;  1F9S A;  1RTO A;  2L12 A;  1ROD A;  1TII D;  2CQA A;  3S1Q B;  4FF4 A;  5IOD A;  1I6V C;  3A56 A;  2F3W A;  4X3K A;  3BVG A;  4TKO B;  3MXP A;  1CQF A;  1KLU D;  5C5L A;  3E0J A;  2I07 B;  3FDT A;  1S5B D;  3R3O A;  1U4M A;  2MGS A;  2OF1 A;  3I8Z A;  1STH A;  3NBI A;  1MGS A;  1D5M C;  2M2L A;  2KJX A;  3GTK B;  5M3M B;  3BDO A;  3VR4 A;  4IUR A;  2KCN A;  2NN6 H;  4BS9 A;  4I7Z C;  1B53 A;  4P2C B;  2Q8T A;  4G7H C;  3BDL A;  3HS0 C;  4H7B A;  2DNC A;  5CMD A;  4XQN A;  3PIP 3;  3LWU A;  2YYZ A;  2AUJ D;  4EQN A;  1OXV A;  2M9V A;  3NTK A;  1STY A;  1KDA A;  2KCC A;  5COY A;  5D3D A;  4K5X A;  4AYB B;  5CV9 A;  3SDZ A;  3FRP B;  2CW0 D;  1EIG A;  1Y8P B;  3BYY B;  2F0I A;  3QIA A;  2SEB D;  5K36 G;  5K36 H;  4RCO A;  1AZP A;  4K8J A;  4RFB A;  4C56 C;  1ILQ A;  2F03 A;  3ERO A;  1WCM B;  2MHV A;  5KIX A;  4PMC A;  4V0B A;  1TY2 A;  2EYP A;  1XYI A;  3TDQ A;  2AUK A;  2KEE A;  4IFD J;  4IUP A;  4KV6 A;  3SEB A;  2VB3 X;  1ESR A;  2OXP A;  1QB5 D;  3P20 A;  4QUF A;  2PMZ B;  3CRL C;  3NE5 B;  3I91 A;  4KK7 A;  3HOY B;  3M4Y A;  1OXS C;  5FO9 B;  5D65 A;  1BNZ A;  1PRT B;  1EFI D;  5M9O A;  5FK9 C;  2PQE A;  2QEJ C;  3TSS A;  1LT4 D;  4C3J G;  3P75 A;  3SR1 A;  3GTJ B;  1WTO A;  4PNY A;  1GHJ A;  1KAB A;  1WTV A;  2L4N A;  2D5D A;  3JAM L;  2O5I C;  4FF1 A;  3L9A X;  1SMY C;  1TWG B;  5C4H A;  1Y69 U;  1LT5 D;  1ET9 A;  4J8Q A;  4ULL A;  1ET6 A;  1SNP A;  1LAC A;  1C48 A;  1AP0 A;  4ODG A;  3GO5 A;  4LMQ D;  3FPU B;  2RDF A;  2K03 A;  3IFD A;  1WD0 A;  1CZG A;  3TP7 A;  5TSS A;  3MEH A;  2IW3 A;  1LAB A;  2RSN A;  1DYQ A;  4CJ0 B;  1GJX A;  1TWA B;  3GP7 A;  2R3Z A;  1LO5 D;  5BN3 A;  3C2P A;  2QCP X;  3J7A F;  2F0S A;  3OSO A;  3VR6 A;  5I6Y A;  4DF7 A;  3WOE A;  3S15 B;  2JA8 B;  1TWF B;  2G9H D;  1SNC A;  2NWG A;  1QCB D;  5IGD A;  1T5X D;  3PO2 B;  4DAV A;  1TY0 A;  2KQ3 A;  2KHS A;  4GZY C;  4HAE A;  3IFT A;  1DXM A;  1PRT D;  1NR4 A;  2RQX A;  3DM1 A;  2K6A A;  5JVH 3;  4CJ1 B;  1I4Q A;  2EY2 A;  2MPM A;  3K59 A;  1RTN A;  1C4Q A;  5KEE A;  5IT9 E;  1Y8N B;  2D2C C;  4KKS A;  1F9R A;  1CA5 A;  2N55 A;  2E2D C;  2A69 D;  2HUG A;  3PUV A;  1I3Q B;  1PZI D;  4TQU S;  1G6Z A;  2EY1 A;  4I65 A;  3QG1 A;  3V2T A;  2A6H C;  3D4R A;  2XSC A;  1AZQ A;  5ELC A;  4QCL A;  1RJT A;  1A3U A;  4F87 A;  3MZ5 A;  4HN7 A;  4HTH A;  3NBH A;  4EQP A;  2EYO A;  3HRZ C;  4M8A A;  1G8Z D;  2EYL A;  1JQY D;  4C3I G;  1S5F D;  4KY7 A;  1GUO A;  4OHJ A;  3ITP A;  3DWQ A;  4KD4 A;  1J9O A;  4MN3 A;  1NCV A;  5CBE E;  3SK5 A;  2PO4 A;  3E6Z X;  5BN4 A;  3MHB A;  2B2T A;  3Q6S A;  4FXD A;  4RAU C;  3BYT B;  1S5E D;  2XIW A;  2D62 A;  4RA8 A;  1PRT F;  1STB A;  3DHQ A;  5M5W B;  3PUY A;  2BA0 A;  1GUG A;  4OO1 G;  4OO1 H;  2EVB A;  1JOQ A;  2EYF A;  1QJO A;  3TME A;  1S5D D;  3A7A B;  2F0D A;  2ZT9 C;  1T5E A;  1FNV A;  1FNU A;  4X3U A;  4IAL A;  4K2L A;  1EY7 A;  1V1P B;  4A3J B;  2F3V A;  3FVQ A;  3NP8 A;  3S1M B;  4ME5 A;  3DEO A;  4R9W A;  4B9X A;  3CRK C;  5JOB A;  1GUW A;  3VR5 A;  4RHR A;  2VNU D;  4R8I A;  4RKB A;  5G3L D;  4C1N I;  3VYS A;  1QIL A;  4V19 0;  3BVM A;  5AFW A;  2YU9 B;  2KUM A;  1STN A;  1UAP A;  1SEB D;  1MBY A;  3H09 A;  4DFA A;  2JXM B;  1MI2 A;  2XWB B;  5E4X A;  1XTC D;  2A74 C;  2QIL A;  2E76 C;  5C44 B;  1IKM A;  3HZX A;  5KND A;  2HDM A;  1EEI D;  3A8I E;  3J81 E;  1JWM D;  3NXW A;  1M4V A;  1B2T A;  1STG A;  4FF2 A;  1SMY D;  1A6X A;  4XQQ A;  5I9P A;  2MP1 A;  2F0J A;  3M7G A;  2H4O A;  5FOB B;  4QIW B;  4B9W A;  1DON A;  3I4M B;  2A73 B;  4PQX A;  1VF5 C;  5A2Q L;  2K32 A;  2E2J B;  1BUV T;  5C6A A;  1B9N A;  2R93 B;  3S1N B;  3JAM E;  4KMU C;  3NQI A;  4K14 A;  4KJN A;  1SSO A;  1SND A;  3BG3 A;  3K5N A;  1DOL A;  2F4I A;  1SE3 A;  1JCK B;  3A7L A;  3VYU A;  4L63 B;  2B2T C;  2ID0 A;  1RHP A;  2F0M A;  2K05 A;  5KYI A;  2WII B;  5CV7 A;  2ZXP A;  2PZT A;  1GXD C;  3X3M A;  1DM0 B;  3PUW A;  3WOF A;  1HA6 A;  3PV0 A;  2RA4 A;  1SYF A;  2B63 B;  3S14 B;  4C2M B;  1JOR A;  2B8F A;  1PFB A;  2F0W A;  3J7Y W;  3GTM B;  2LMC B;  3TBI B;  2K33 A;  2A68 D;  4KKT A;  3LNN A;  1KNE A;  5FO7 B;  2X6G A;  4IQZ A;  4XT3 B;  1HTP A;  2EE1 A;  3A8J E;  4BWG B;  1TQO A;  2SDF A;  4QB4 A;  1G2T A;  4FXG C;  4TRD A;  2X6L A;  3N52 A;  4RHS A;  2DY7 A;  1SE2 A;  4F7X A;  5J39 A;  2SNM A;  2EYH A;  5ELB A;  4X3S A;  1JR0 D;  2RKS A;  5HUR A;  4CKB A;  1CHP D;  3M3Y B;  3SE0 A;  3EVQ A;  4IZ8 A;  1TWC B;  2HCC A;  1JE4 A;  3C1F A;  3VR2 A;  1CTM A;  3R8B A;  2R7Z B;  1I50 B;  3NWT A;  1Q3L A;  2B2V C;  2F0L A;  2IWH A;  3MVV A;  4IFD I;  1Q1E A;  1GHK A;  1NAP A;  3RMH A;  1QOH A;  4FXK C;  1PTO H;  1Q90 A;  2EJG C;  4FYD A;  3GTG B;  5CV6 A;  4Q5V A;  3X3N A;  5C4X B;  3GTL B;  1Z6H A;  2NVQ B;  1EY8 A;  2KOL A;  1PTO C;  1FYC A;  3C3L A;  2ENB A;  3D8G A;  1I4H A;  3S1R B;  1VMC A;  1HCZ A;  1JOO A;  1BOS A;  1NUC A;  2BA1 A;  2NN6 G;  3KBX A;  5F2D A;  1SYG A;  2RDG A;  1MSH A;  1W6J A;  2NYZ D;  1YNJ C;  5M3F B;  4PMW A;  1Z47 A;  3Q0A A;  5EKI A;  1I6H B;  3QB3 A;  5DM7 3;  4OO1 I;  4NKL A;  5CV8 A;  1HA5 A;  3HOZ B;  1FNW A;  3IL8 A;  4K5W A;  2XRS D;  3GV3 A;  3P7J A;  1KDB A;  1M8A A;  2WB1 B;  1SYE A;  4G57 A;  3D4D A;  2WKD A;  3FPP A;  1CT1 D;  5EJW A;  2XRQ D;  3NHH A;  1I4X A;  4G7O C;  2RSO A;  4C1N K;  5EKL A;  1RCV D;  4KTA A;  4EGV A;  5J1Z A;  2B2W A;  4IUN A;  1SXT A;  3U9O A;  5ELE A;  5I4D A;  3J81 L;  1LTR D;  1SFO B;  1X32 A;  2G9D A;  2F1M A;  2K1B A;  3T51 B;  4O1N A;  3WDN A;  1JWU D;  3KLS A;  4CKC A;  1SNQ A;  1U4P A;  4XT1 B;  4C3H G;  1IW7 D;  2LKV A;  2F0V A;  2FMM A;  3ND8 A;  1O7Z A;  5EPJ A;  4M1U B;  4KI0 A;  1L0Y B;  2XWJ B;  2Z1C A;  2JA6 B;  3HOW B;  1FGB D;  3IKJ A;  1EIH A;  2XVS A;  3G7L A;  1Y1V B;  5LL6 S;  3I72 A;  1ZEQ X;  1DD2 A;  3RZD B;  1F2Z A;  1O78 A;  1EYD A;  1HTL D;  1CI3 M;  4KN7 C;  3KBG A;  1A15 A;  3KLS X;  2IL8 A;  3NUC A;  2RBM A;  2L1B A;  3KUP A;  3BDC A;  5JJZ A;  4DAY A;  3HOU B;  4BA2 I;  3TP8 A;  2PW5 A;  5EBC A;  1G2S A;  1HFG A;  1BXT A;  1AFP A;  3T56 B;  1CFM A;  5A2Q E;  3M85 A;  1PFM A;  1IKL A;  5C5M A;  3K7A B;  2JEA I;  4ZLT F;  1Q1B A;  4LK1 C;  3SHL A;  4Y7N B;  1D2B A;  1II3 A;  3K5O A;  1X3Q A;  2CHB D;  1LTS D;  1CM9 A;  2Z4H A;  1D1I A;  2SNS A;  2O5J C;  1TWH B;  4BBR B;  1BBX C;  5JVG 3;  2B2Y A;  2WKC A;  3HOX B;  1PYW D;  1LTI D;  1OXT A;  3QO2 A;  4H44 C;  3GD7 A;  5EKK A;  2RDH A;  2XN9 C;  5ISR A;  3PO3 B;  3MXN A;  1U9R A;  3MFG A;  3VYR A;  1YNN C;  3K5L A;  1U4L A;  3NSW A;  1HUM A;  3OMG A;  1QWY A;  5I6W A;  3E5S A;  3M4O B;  1AN8 A;  2VXW A;  2AWO A;  2A6E C;  2EJF C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...