3TBIB

Crystal structure of t4 gp33 bound to e. coli rnap beta-flap domain
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
228
structure length
228
Chain Sequence
MIHIQELACVSRDTKLGPEEITADIPNVGEAALSKLDESGIVYIGAEVTGGDILVGKVTPKGETQLTPEEKLLRAIFGEKASDVKDSSLRVPNGVSGTVIDVQVFTRDGVEKDKRALEIEEMQLKQAKKDLSEELQILEAGLFSRIRAVLVAGGVEAEKLDKLPRDRWLELGLTDEEKQNQLEQLAEQYDELKHEFEKKLEAKRRKITQGDDLAPGVLKIVKVYLAVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords RNA polymerase-associated protein Gp33
publication title Crystal structure of T4 gp33 bound to E. coli RNAP beta-flap domain
rcsb
source organism Enterobacteria phage t4
molecule tags Transcription
total genus 57
structure length 228
sequence length 228
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2011-08-06
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.150 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3tbiB01
4A3KB 1SFOB 5M5XB 3S2DB 4G7OC 2R92B 2E2JB 5C4JB 3GTLB 2PPBC 2BE5C 3CQZB 3RZOB 3HOYB 5M3MB 4A3EB 2JA8B 3GTPB 4BY7B 3HOXB 4KN4C 4LK1C 2JA5B 1HQMC 4G7HC 3I4MB 4A3BB 3HOZB 3HOWB 3K7AB 2A68C 4G7ZC 3S1NB 4C2MB 1K83B 3TBIB 3PO2B 4A3DB 4A3IB 3FKIB 3EQLC 3GTOB 2R93B 4C3JB 2A69C 4AYBB 5C4XB 2WB1B 4BY1B 2NVYB 2B63B 1WCMB 2PMZB 4A3FB 2O5JC 4LJZC 2E2HB 1I50B 1TWGB 3RZDB 5M5YB 1ZYRC 2E2IB 1TWFB 3S15B 4A93B 2A6HC 3HOUB 4A3JB 1I6HB 1YNJC 1I3QB 1IW7C 5M5WB 4JK1C 4C3IB 2NVXB 1R9TB 1TWCB 3WOEA 1YNNC 3PO3B 2JA7B 3S17B 3HKZB 4A3MB 3H3VC 3S1MB 2WAQB 5C3EB 2NVTB 4KMUC 1TWAB 3S1RB 3H0GB 2LY7A 3GTJB 1SMYC 4GZYC 2CW0C 2A6EC 2YU9B 2NVQB 3DXJC 4QIWB 3GTQB 4KN7C 3GTKB 3S2HB 1Y1WB 1I6VC 3M3YB 3M4OB 3I4NB 1TWHB 4BBSB 2R7ZB 2JA6B 3S1QB 2O5IC 3S16B 3WOFA 3HOVB 3S14B 4Y7NB 4A3GB 3GTMB 1Y1VB 4BBRB 2Y0SB 5C44B 2VUMB 5M3FB 3GTGB 4C3HB
chains in the Genus database with same CATH superfamily
4PQXA 2KEEA 2LS01 4HIOA 3RLNA 3OSOA 3C2PA 1BR9A 1KLUD 4EQPA 4DK6C 3M4QA 4LAAA 4DU9A 5M3MH 4DV2L 2R92B 5FLXL 4EVOA 5C4JB 2VS1A 1E2ZA 5IIFA 3BG3A 4ID6A 1S3OA 5A2QL 3ZJYC 5JPNC 4JCVE 1EQQA 5JJLA 2DGYA 1JB7A 1EYGA 2R92G 3I7FA 2M2LA 5DNFA 3OMGA 3GTOH 1SJHD 1XX8A 2O4XA 4BXXH 5C0XI 1PRTF 1B4OA 5HY6A 1UE7A 1ENAA 3MXPA 4CHTB 2QF7A 2JA8H 1PDQA 1NR2A 1Y1VG 2R93B 1LTAD 1JT8A 1LTGD 4EGVA 2VB3X 1H9SA 4AYBB 3CPWA 2SNMA 4CKBA 2EQSA 1XXGA 5FO7B 1JE4A 1WTHA 4BY1B 3OIPA 4DPGA 2F0IA 3TP7A 1VQ7A 2ZXOA 1N33L 2R93G 1X3FA 4AYBE 1WTVA 4AYBG 3A7AB 4C3JH 1PZJD 2B2TC 3ER0A 2NN6H 1T5EA 3S17H 3MXNA 4BY1G 4IO9A 4A93B 2F0VA 1JE5A 1EIGA 3JAME 1DYQA 2F0OA 1TS4A 5DEHA 1RKNA 4X64Q 2PI2E 1HUNA 4K2KA 1O78A 2D0PA 4GOPB 5KIXA 2F0HA 1SYBA 2EY6A 4HIKA 1F2MA 1W6KA 2F4VL 3S2HH 1PTOF 4N8FA 4LUVA 2PZUA 4BBSH 4OX9L 4KJOA 4GN5A 4NW2A 3T56B 2NVXH 4LF9L 4TSSA 3MAQA 2B8GA 3K81C 1TIID 3O13A 2GVAA 4DF7A 2UUAQ 1ILPA 4X3UA 4GLAC 2PO4A 1ET6A 3BYYB 1PYWD 3PMFA 1VQFA 4ODGA 4B3ML 3DM1A 3A7LA 2YTYA 2NVQH 3KDFB 3S14B 1KC8C 4NMZA 3AQQA 2R92H 1WTXA 3VR6A 5C4JH 4L5TA 2CQAA 2F4IA 2KVMA 4QMGA 4JI8L 1ONLA 3MFGA 3S1QH 1SEBD 2L55A 1VQAA 1HCZA 1S72A 5IGFA 2DJGC 1VQKA 2EYOA 4OELB 1Y1VH 3CCUA 3CCSA 1PTOC 2KQ3A 3NK9A 4QIWE 3RZOB 2HHHQ 2Z4HA 3GTPB 3HOXB 2ENBA 1A62A 2EJMA 3FPUB 1Y14B 3K5OA 3GTLH 2R93H 1YEZA 4HSPA 2KOLA 4JPBW 2MNAA 2ZTEA 2XWBB 3S1NB 3V2TA 4BY1H 3HG9A 4A4IA 3M7NA 3NE5B 4MHEA 4NPSA 1ICWA 2KHIA 1S5BD 4M1UB 1RF2D 3M85A 1EEFD 1LTRD 4KHVA 1N9WA 2ZJRA 3EVQA 1SROA 3MEHA 3D4WA 1VQ6A 4TRDA 5GAHC 4DV4Q 3IAYA 1CZGA 4LFAQ 1XNQQ 5CYUA 3W3AA 3TN2A 3HOYG 3J81E 2H1EA 2ZXRA 3I2ZA 1XPOA 4ZCKA 1STEA 1V8QA 1BUVT 1YNJC 4GKJL 2N88A 1EU4A 4PZ8A 4C3IB 3T16A 3NUCA 1MBYA 1KAWA 4QB4A 2NVTB 4CKEA 1X3PA 2AUJD 4K8IA 4JI4Q 1W3SA 2K5NA 4KD3A 1AEXA 4FF3A 1E2WA 3CCLA 1BBUA 1I4PA 1TY0A 4WORA 3J7AF 1YJ9A 1IXRA 5C4XG 2HD3A 1YJWA 3S14H 2MFIA 1HH2P 4P75A 4DV1Q 2MPMA 3BS1A 1L1OA 3BU2A 3TREA 1PH5A 4FO2A 2M9VA 4DV7Q 2D62A 2KEDA 5CV5A 2FXQA 1ASYA 4A3GB 1SLJA 2GA4B 1K3RA 2AWOA 1B9MA 1CKNA 5EPJA 3HFZB 4IOCA 5IT9E 2J0TD 3TQYA 1SFOB 3RZOH 4MN3A 1Q1BA 2PCFB 5M5XB 3GTPH 1E22A 2IX0A 3NPPA 3NEMA 4IJLA 1HZ9A 2DY8A 1LABA 2BE5C 3A8JE 3KF8A 2F0KA 2YTVA 4XQQA 3U9OA 3S1NH 3CC7A 1C48A 1QVFA 2F0SA 4JI5Q 4P2CB 4KV6A 3CKIB 2RCNA 2R3ZA 2QCPX 3HOZB 2K03A 4A3BB 3MC0B 4KKUA 2VQEQ 3CCRA 4QCLA 5J3BA 4GLXA 1VDZA 2NZ1D 3AU7A 3E6ZX 4LUOA 1C4QA 1PZID 2L11A 3HOYH 4K5VA 2EIFA 4YCWA 1U4MA 4RA8A 2QEJC 4L8JA 4DUZL 2LXKA 4A3BG 3HOZG 4DNRB 4JI2Q 4RMFA 1JJ2A 1B2TA 1BVSA 2EYJA 5CV4A 3EIVA 5FKAC 2Z1CA 3K5LA 3T1YL 1BCPF 2AMCB 3BVGA 1K83H 1S5CD 3AFQA 4DGZA 1N8RC 3FMCA 3NTIA 5EPLA 4GKKL 1CA6A 4X65L 2EPBA 4OIJA 4V0BA 5IGBA 4MNOA 5C4XH 1ESFA 3KLRA 4JBWA 1E24A 2NVTH 3KYHC 2JA9A 1N32L 1HNWQ 2K28A 4A3JB 5IGDA 2QKIC 1I3QB 2IHEA 1SBBB 4R4QA 3K59A 2PZTA 1YNNC 1QZHA 1YZ6A 3OIQA 5M5YH 2WAQB 1U9RA 2NB0A 4MIUA 4IUUA 1G6ZA 3D3RA 2PQAB 2I0QA 3SGIA 3F2BA 3GTJB 3M4YA 1VQCA 2A6EC 4IPHA 3I73A 4ILWA 1HNZQ 4DR7L 5EJWA 2WAQE 3BVMA 2WAQG 3I8ZA 2PZWA 1FD7D 4LWCA 1TWHB 1KRSA 4A3FG 2UUBL 4V190 1BCPC 1Q8KA 4JI7L 4HJ8A 4OONA 2K4KA 1J9OA 1HR0Q 1MD2D 2EY1A 1NR4A 4B3TQ 1JWUD 3CCMA 1E3PA 2IT1A 3KJOA 5CMDA 1F9SA 2UXDL 4IURA 5KYIA 1IBLQ 4DR2Q 4C1NK 1EOTA 3PV0A 3HKZE 3K7UC 1D6EC 1Q8IA 3HKZG 4A3MG 2KUMA 4B3RQ 2JYOA 1LM0A 1CA5A 5IYCG 2BCOA 3MA2B 3X3NA 5GADC 4XT1B 3CC2A 1VS0A 2DUDA 4A3BH 1EWCA 2LXJA 3HOZH 1HQRD 1STBA 2N55A 4FVMA 1FGBD 1J6QA 1N36L 1B3AA 2BH8A 4E6IA 4KY5A 4JOIA 1DCZA 2KJXA 1PRTB 3TSSA 3NTKA 1HHVA 3NWSA 3SEBA 4YCUA 4PMWA 2JA6G 1OXUA 2FMMA 2I46A 4ZK9B 3RN5A 1HJPA 2BOSA 1PH7A 3CQZH 3N6RA 4C2MB 1CT1D 1PH4A 4A3IB 5EGTA 2OTJA 3HS0C 1SSOA 4CJ0B 3N52A 1QUQA 2QW7A 1I94Q 3KLSA 3E9HA 4AQYQ 1LUZA 4C3HG 4DR3L 4DAYA 2TSSA 4LFBL 5JVH3 4Y52H 4A3IG 3VR5A 2CQOA 1CHPD 1RHPA 1I3QH 2AHOB 2HUGA 4B9XA 1IZ6A 1SYGA 3I91A 4HN7A 2UUAL 4OWWB 4MZ9A 5ELCA 3EN2A 3KF6B 4C1NI 3J7A5 3DUZA 1B1ZA 3M7GA 5LMUQ 1A3UA 5LL6X 3GTJH 4A3FH 2IHFA 1FL0A 2I07B 2BH2A 2K33A 3H3VI 2RA4A 1XTDA 4G57A 1Q12A 3W1GA 2UUCQ 1Z6HA 4OXPA 4OEMB 1SNQA 2K50A 3H0GB 1RIPA 3OHXC 3VYTA 5IGGA 2QEXA 1UEAB 1CFMA 4DNTB 4HR7B 1TWHH 2ZTDA 4GZYC 1K8AC 3CPFA 3NXWA 5GAEC 1AN8A 1TWCH 4KN7C 3MVVA 1G2SA 3H0GG 4RWSC 4A3MH 1JOKA 5C4HA 1XPRA 4ZAIA 1PH9A 5IYCH 4LF5L 4XXEA 3DLLA 1V1PA 1X3QA 4APVA 2HHHL 1F2ZA 1X54A 1NCVA 5IGCA 2O5IC 1K0RA 4UHVA 3NSWA 4H0LC 1CKMA 1WTPA 4FP5D 1EY7A 1RTOA 2QGQA 1S5FD 3G7LA 2LFNA 1ZYRD 5JVG3 3M3YH 3K8AA 1YVCA 4CKCA 4A3KB 2JA6H 2EXDA 4GS3A 1EZ8A 1CZWA 1XMOL 1IW7D 2DJFC 4CDCC 1VQLA 4QGUA 1MGSA 4NKLA 4Y7NH 2VXWA 1AZPA 1Q86C 4B3SQ 3EROA 3B6YA 4C3HH 4BY7B 4C2MH 1NMFA 1W6JA 3K0YA 2E76C 4OWXB 5DM73 4A3IH 4X66L 3I4NG 2LSSA 5DM63 3PUYA 1JWMD 3C3LA 2K52A 3IRBA 4BY7G 3T13A 3NBHA 4UDUC 4JOIC 1OXTA 2D9UA 5C6AA 2NWGA 1HA6A 1GUNA 4JI4L 1R4QB 3ZYYX 1MI2A 2IWHA 2N3SA 2FFKB 1IL8A 2RHSB 2I5LX 4JI6Q 4H44C 5E4WC 1N34L 3PF5A 3RR5A 3L7ZC 1I50B 2N8NA 3SR1A 3UDIA 3RZDB 1BBXC 5JOBA 3U9SA 4RKLA 5ELDA 1TWFB 3H0GH 2A6HC 2MP1A 4POFA 4N9TA 3RLFA 1H9MA 1C8CA 1O7YA 3U4VA 3E9IA 1E7ZA 1Y8PB 4DK0A 1EFID 5JEAG 3I56A 4DR6L 1SE4A 3URYA 1SNMA 4KTAA 2L9HA 4ME3A 3J81j 2VQFQ 3KOJA 1BQQT 4L5SA 2N78A 1II3A 5CBAE 4H7BA 5G3LD 3GTKB 3NP8A 2ALYB 4BA1I 1WTWA 3MXUA 2L12A 3KUPA 3LX0A 1PRTD 1PH6A 1A3TA 1WJJA 1X3EA 1P8LA 3BZKA 4JI5L 3OTOQ 1QNKA 2JEBI 2HDMA 1A63A 3A74A 2HCCA 3K58A 2VUMB 2RVLA 2OQ0A 2WP8J 1O80A 2Z4IA 4JI1L 5FO9B 3I4NH 2E2JB 3U4ZA 1J5EL 2J7ZA 4JI0Q 4IQZA 3RD4A 2JA7G 4KHZA 1S5ED 2UU9Q 4BY7H 3Q23A 3VA5A 2KCCA 4BS9A 2VUMG 2B2UA 1VQMA 2B2WA 3CAMA 4JW0A 4UY8C 1PH2A 4DR4L 3CCJA 4X6AH 3OWEB 2X69A 1QJOA 4LF8Q 4ZRZA 1DJRD 4FXKC 2NBFA 1SE8A 1B9NA 3A54A 1DOMA 4A76A 1SRUA 4CDEC 4Z9CB 1KDCA 3IKJA 4JG2A 1L0XB 2Q2HA 1TS3A 5ELFA 3G71A 3RZDH 4YIJA 5JEAH 4P74A 1BCPB 3ULJA 1TWFH 4UP7A 2GVBA 4RCNA 5A35A 4DUYQ 2PMZB 4LJZC 3P1HA 1U4PA 5JAVA 5D65A 4RKBA 3ITPA 4HIMA 3J80L 1MJEA 4MTNA 4BWGB 5CC4A 3UDXA 2PMZE 4POGA 3KFUA 3HOUB 1SDFA 4DV6Q 4LF6Q 4B9WA 2AQ2B 4JK1C 5JEAJ 2VZAA 1I4RA 1K8OA 4X3SA 4DA2A 5C3EB 4DAPA 1TWAB 2Z9HA 1IBKQ 3QWNA 5CBEE 2LY7A 2PW7A 5HURA 1TS2A 1VQOA 2ICEC 4A3CG 4B3RL 3DXJC 5GQOA 1QE6A 2HT1A 4J6HA 2JA7H 3I4LA 1YBYA 2RQXA 4IFDJ 1VF5C 3TZDA 5BR8Q 5BN5A 1SXTA 1X9NA 3M4OB 2R7ZB 1F77A 1LT4D 2VUMH 1DONA 2E2JH 4DV3L 2V4DA 2HIXA 4K5WA 1PFBA 5BN3A 1B53A 4A93G 4HIDA 3GO5A 4K2LA 4JI3L 4AIMA 2OWOA 2R7ZG 1MJCA 3GTGB 1HPCA 1IYVA 2L1BA 1MHWC 1HNXL 4CJ2C 2KHSA 1SYCA 4AQYL 3S2DB 4DV0L 1W2BA 3CMAA 3UE1A 2I5MX 1IYUA 3I55A 2Q2IA 2VY3A 3K5MA 5EKKA 2G5DA 2BA1A 2CH4W 3H6MA 3T1HL 4NB3A 2ICIA 2RDHA 3PCOB 1EY0A 1SE2A 2B2UC 4R4TA 1YHBA 3K7AB 2CKZB 2B39A 2B2WC 2RHQB 1SYFA 2MO1A 2JQOA 4R8IA 3KBXA 2XRQD 3EQLC 3H3VH 2QA4A 3FHWA 4FXGC 5GAGC 2Q8TA 3FPPA 3HZXA 3F2DA 1EOVA 1ML0D 3Q6SA 5FLXc 4K0KQ 2ZT9C 1D7QA 2RDFA 2ZM6Q 4A3LG 2VNUD 2AQ1B 2ZJQA 4G4KA 5ELEA 4GNXB 4A3CH 3TP8A 1G6PA 1TWAH 1EY9A 3M9BA 3HOXG 4HJAA 3J80i 1K3BC 3DWQA 3J80c 3K57A 1JICA 3S1MB 2EE1A 2L15A 1AP0A 4KMUC 2NZOA 2RKSA 4DN4M 1YNXA 4A93H 1Z7TA 2OEOA 3NTHA 2R7ZH 3CCVA 4ZUJA 2P5ZX 3NHHA 2BA0A 5C5MA 5IYDG 3A5UA 1NY4A 5AJ3L 2IW3A 1BKBA 3TEHB 4LW1A 4QUCA 1STGA 3OWFA 3J7ZC 1Y1WB 2VB2X 1FJGQ 3DEOA 1SAPA 2F0NA 4YHHQ 4O1NA 4I7AA 2MJ8A 3GTGH 5KYLA 1GUTA 1KDAA 2E74C 2VL6A 1D8LA 3FRPB 1VQ4A 1Y1WG 3A0JA 3NENA 5J1ZA 1QVCA 2JP1A 4QY7A 3S2DH 2SEBD 2Y0SB 1VQEA 3CW2C 4HMIA 2Q2UA 4C3IG 3T51B 5IY0A 5EPKA 1F9PA 2MQHA 3SXHA 1IL2A 1HZAA 2Y0SE 1D5MC 2Y0SG 1CQVA 3VYRA 3Q0AA 1EY5A 3ULPA 4KHPL 3NELA 2E8GA 3K7AH 3RLOA 1AE2A 1O7LA 2CW0D 3DMUA 2A5HA 2DY7A 3FP9A 3T53B 1FNUA 3SDZA 2K04A 4X62Q 2HQEA 3TP6A 2X6LA 1JCKB 2XNAC 1JB3A 3PIPA 4A3GG 3K0XA 1STYA 4H02A 2UXCL 3HOXH 3AMUA 1JOQA 1VQNA 1LTBD 1CK1A 4YWLA 3AB9A 2QILA 2UXBQ 1EWIA 1JQYD 2YV5A 4R4IA 3DWPA 1ET9A 3OW2A 4Q5VA 4KY7A 2O5JC 1CHQD 2R61A 2WV6D 4PZ7A 2E2HB 1XNRQ 2F3WA 3QOLA 4H13C 4PV1C 5IYDH 5I2XA 1DOLA 2K5HA 3P75A 5I9OA 5J39A 2K7VA 3BJUA 5TSSA 5IWAQ 2AUKA 2OCEA 3HKSA 2G9HD 2PI2A 1BBWA 2JSOA 5E4XA 2EY2A 4ZQ3A 3OTOL 1X56A 2A73B 5M5WB 3RN2A 2AKWB 5IYBG 4KLKA 4R8NA 4IOAA 1OXXK 1HTPA 4JV5Q 2A68D 4GOPA 4JI0L 5CV8A 5D14A 2A1AA 4U673 3C46A 1JR0D 1MSGA 2UU9L 1G291 5FJ8G 4C3IH 2E5LQ 2BDOA 2ASBA 2QDLA 2X6GA 3QOJA 1SJED 1G8ZD 1EYAA 1EQRA 1LT3D 1B70B 3FDTA 3BZDB 3ICEA 2L4NA 3A5ZB 4DR5Q 4F87A 1YHQA 1KNAA 2H5XA 1LO5D 2PYKA 2RBMA 1WTOA 2J4XA 4NXML 4GLVB 4U68A 4LF8L 3A55A 1OO9B 1GOZA 2EYLA 4LF4Q 1RJTA 4A3JG 3KDFA 1S4ZA 3NBIA 5M3FB 4DFAA 3AEVA 2B2VA 4O42A 2OTLA 3SK4A 4PZ6A 2EYPA 3U50C 2WKDA 4A3GH 1STNA 5M3FG 1SE3A 4IFDI 4DV2Q 4FNFA 2C5CA 1I4HA 1SNDA 1QILA 2I5HA 4DUYL 2NTSA 3D0FA 1SMYD 3J81L 1SFOH 5E1FA 1EUJA 2K6AA 3H15A 1UE5A 1S40A 5M5XH 1JOOA 1NTGA 1YIJA 2F0PA 1SMXA 5I6WA 4NP5A 1L1OC 2IX1A 1RDPD 2DN8A 2C9OA 4LF6L 4ZYSA 1V1QA 4CBVA 3FKIB 2MHVA 1YITA 3UE0A 2M00A 2E2HH 2H4OA 1IBKL 2NUCA 1OXVA 3H91A 5T1GA 4L5RC 4M8AA 5IYBH 3STBD 2ZJPA 4J15A 3J7AV 4XYOA 2Q8RE 2B63B 1ENCA 4X3KA 1ZEQX 1TWGB 2KCNA 5M5WH 3ONAB 3C1FA 1N33Q 5FJ8H 5BR8L 2E2IB 4KKSA 1SN8A 2Q2TA 1EIYB 4X64L 2B63G 3I90A 5IT9L 2B3GA 2EOTA 3GD7A 1AE3A 3WOEA 3PO3B 1EY4A 5K36G 2K5WA 1KQSA 3S1RB 4R4CA 4DK3C 4FF2A 2F4VQ 3L0OA 4GN4B 4F8MA 4A3JH 2FINB 2YU9B 3PO3G 2HCIA 4KD4A 2SOBA 2D2CC 1VQIA 2A69D 4LF9Q 3LWEA 1CUKA 5KGUA 4LFCQ 4GOPC 3PGZA 2JJQA 4J8QA 4QJFA 2XSCA 5M3FH 2FMCA 3SVMA 1TY2A 3VDYA 3DM3A 4L6TB 3HOVB 1PFSA 1PTOB 2K5QA 5C44B 2RCFA 5KNDA 3PIOA 3EBEA 1F2YA 3HOVG 2EDGA 4QL5A 5CV7A 5C44G 2CHBD 1WTRA 1KRTA 1HXYD 2WFWA 3G48A 1EEID 2ZTCA 3QO2A 3TRZA 4FXDA 2F52A 2ZM6L 2R7DA 1PHJA 3EA6A 4KN4C 4LK1C 4XT3B 3G6EA 4DAMA 5CR3A 1HQMC 1RODA 4K8JA 1WFQA 3J81i 5JPMC 2KENA 1HTLD 1UNSA 4ALPA 3V96A 4QQBX 4ZKCB 3U58A 1OTCA 1UUPA 1H9SB 4JC0A 2B63H 1WVLA 2CCZA 4HAEA 4CGYB 3EFXD 4A3KG 2E2IH 5K36H 3E5SA 4XTCS 1GJXA 1NNXA 5EAYA 4DV4L 4XYQA 2CFMA 5FLXE 3MXNB 4X3TA 4LFAL 1BO0A 1XNQL 4PMCA 1CI3M 2K01A 3PO3H 1LTLA 5A2QE 1V1OA 1SNCA 1EWHA 3S1RH 2OQKA 1R4PB 2F3IA 1E0BA 2YU9H 4GKJQ 5EBCA 2F0TA 4DNIA 3J80E 3MHBA 1DXMA 3MWYW 5LMNQ 1G2TA 1D5XC 2GN5A 2IPKD 3NQIA 1QVGA 4IUVA 2O2LD 2ATWA 4F88A 5CGKA 3L3OC 1KLGD 2EJGC 4RGTA 1KTKA 5IP7G 2PQAA 4UP9A 4XQJA 2F0EA 1D5ZC 1SNOA 4DV1L 1PTOH 4XDXA 1STAA 1GUGA 4DV7L 4HMJA 4RAUC 1CKOA 5C44H 1M8AA 1HUMA 3UI2A 1PA6A 5C4ZA 5ELOA 5CORA 4IPDA 1X55A 1J8IA 3VA7A 4X62L 4Q0FA 4RHSA 4BBRB 1I4XA 4JVZA 1PVOA 1SYEA 1UAPA 1X3GA 4MTKA 4IFDG 4BBRG 3PF4A 1EIFA 3L2PA 3IL8A 4DV5Q 2F0MA 2IJ0A 3R8BA 4CJ1B 4A3KH 4A3EB 3DWAA 1KD1C 2JA8B 3E0JA 2ZXPA 4YY3Q 2VQEL 1PV4A 3C1EA 4UP8A 3KLSX 1KDBA 3W2DA 4N9PA 2IX3A 5IWAL 3PSIA 3MEFA 4A3EG 2JA8G 2K14A 2PW5A 1K9MC 3M4PA 4CDDC 4JI2L 2K5VA 5IODA 3DHQA 4C3JB 3R2IA 4RH6A 5HGQA 3JC66 1QNUA 2XN9C 4YWKA 2WB1B 4JYAQ 4HCSA 1ILQA 1JJCB 3T1YQ 1IKMA 3RUZA 2KECA 5FOBB 4C3JG 1QCBD 1DD2A 4UPAA 3QIAA 4GKKQ 1PFNA 1ZYRC 4X65Q 1HNWL 5IP7H 4OWTB 1PTOD 1EIHA 5NUCA 2F0WA 1GUSA 2SNSA 2TMPA 3F8TA 1A0IA 1IW7C 1N32Q 3KF6A 3Q8DA 3P20A 1D1IA 4IJHA 2NVXB 2F0JA 1I50H 1D1KA 1VF7A 3TP5A 5LHY1 3D8GA 1Y69U 3TDQA 1GM5A 3HGBA 1HNZL 2KA7A 1U4LA 2KCMA 3IFDA 2NVQB 1IYJB 1JC7A 1XPUA 1TT2A 1VMCA 4DR7Q 4OHJA 1L1OB 1UWVA 1QZGA 3KLWA 1I6VC 5D3DA 4ZKBB 3HEJA 1JJGA 4EQNA 4IFDH 3WWVA 4BBRH 1M1KC 1HR0L 4B3TL 2UUBQ 3S1QB 5G3LF 1CKNB 4JI7Q 1JMCA 4KI0A 1A6XA 3TS2A 1EZ6A 1RD9D 4N8X1 3GTKH 3G4SA 4P73A 1IBLL 3HOUG 1Y1VB 4DR2L 5C3WA 4B08A 1PH8A 1TKWB 1FVIA 5JJKA 2UXDQ 3KJPA 3F1ZA 1YNJD 3W5OA 4CDFC 5C3EG 4A3EH 3NQTA 4LMQD 3D4RA 1CSPA 1V43A 3GTLB 3KF8B 1VQ8A 3G6JB 1HZBA 3VR2A 1XMQQ 5DLQE 4WJ4A 4XIGS 1C0AA 3KBGA 3BYTB 1UE1A 4F7XA 1NJIC 2XGTA 2SDFA 3GP7A 1H9KA 3BVZA 5HGTA 1N36Q 2CVRA 4P72A 1VQJA 1I4GA 4NXNQ 5KEEA 1IHZA 1QOHA 3V05A 4WJWA 2MUYA 4TKOB 2EZVA 3PO2B 4OO1G 4XQNA 1I94L 1LTID 4O2DA 1VQGA 4RHRA 2RF4A 3J7YW 2YTXA 1BDOA 3SK6A 3A8IE 1FYCA 1PRTC 4WRDA 1YHAA 4DR3Q 3PO2G 2XVSA 4LFBQ 1HRJA 1WCMB 4DR1Q 4FYDA 2V1CC 2F0QA 4IPCA 4DXFA 1GXDC 1YJNA 3F2UA 4HJ5A 3CC4A 4LFCL 5LMUL 4FF4A 3S15B 5COYA 3H09A 1WCMG 2BE5D 1TQOA 2UUCL 4JBMA 1Z9FA 2Z6BA 3IFTA 1R9TB 1PXUA 4IN3A 3RNUA 3CP0A 2K32A 1LYLA 5ELNA 3HOUH 1ENFA 3GV6A 1ZKOA 3TMEA 4QIWB 1LLRD 5H1SE 2F0FA 2Q8IB 5C3EH 1GO3E 2A8VA 1U5KA 1F2LA 4PNYA 5K5PA 5I9PA 5I6YA 1LACA 2F0LA 4LF5Q 1KXLA 4ME5A 3VYUA 1H9JA 2OF1A 4FDBA 1LT5D 5JJZA 1GVPA 3HRZC 2JEAI 1PYBA 3M4OH 5EQ0A 4J1MA 1EYCA 1Q46A 2K1BA 4HJ9A 4ZUIA 4B3SL 4OO1H 4G7OC 1YNND 1XMOQ 2A74C 2L5TA 3GQBA 1KAAA 3CRKC 2F0GA 2K5DA 3GDEA 5E7NA 1BF4A 3HOYB 4BA2I 3CXCA 1QWYA 2KHJA 2A6ED 2D5DA 3PO2H 1SR3A 2YYZA 2FJ2A 3GV3A 4RCOA 2HIVA 4KY6A 1IBMQ 2JA5B 4HEDA 5FO8B 1Q7YC 2K05A 4X66Q 5EKLA 3HOWB 3OPOA 3R3OA 1A2UA 5C5LA 2ES2A 1HFGA 1QUQB 1K83B 4OIKA 1BCPD 4A3DB 5F2DA 1QB5D 3D31A 4DAYB 2JA5G 1WCMH 1NUCA 3SK5A 1VQ5A 1VMPA 1HR0W 5LMNL 3PIP3 3HOWG 5C4XB 2B2YA 1U4RA 1Z47A 4JI6L 5L37A 1PH3A 4A3DG 2EYFA 2NVYB 3S15H 3JAML 3S24A 1K8MA 2WINB 3VR4A 1B7YB 1LT6D 3L9AX 1H9RA 2Z0SA 3CD6A 5M5YB 1N34Q 1R9TH 4A3LH 4LF7Q 3SE0A 4C56C 1RCVD 2PNRC 2XWJB 1EFWA 1I6HB 1A2TA 2PQEA 3QR8A 3PUVA 2WIIB 3H94A 2VQFL 2CWAA 4DR6Q 2NTTA 1MKHA 3QG1A 2LMCB 3CCQA 4UAIA 3PQIA 4IUTA 3I4OA 5E3FA 1V1PB 1K0SA 4L5QA 3S1MH 4DV5L 4K6DA 1MSHA 1TR5A 1O7IA 2Z6KA 3QB3A 1CM9A 4WJ3M 1ICFB 1B50A 4YY3L 1WTQA 5EKIA 2EYHA 1LTSD 5C0XG 1PH1A 2ID0A 2XIWA 1Y1WH 1AH9A 1Y8NB 1ASZA 3T4AC 4KJNA 2NZHA 1PLFA 4JI1Q 3ND8A 1WI5A 1J5EQ 2MGSA 1Y8OB 5KNBA 1E2VA 1PZKD 3PUWA 5KRUA 1E1OA 1T5XD 2JA5H 4JBJA 3D4DA 4ZLTF 1C9OA 2RDGA 3A8KE 2EJFC 4JYAL 3HOWH 1FNVA 3CQZB 1XWEA 3I70A 3CCEA 3EJIA 1CTMA 2RSOA 5IGEA 4A3DH 1UE6A 1X6OA 4DR4Q 3KK7A 3I4MB 3NBHB 1VQ9A 3S9WA 4PMBA 4G7ZC 3DEPA 1T9HA 1V9PA 4IALA 5EBDA 3TBIB 2A19A 2E75C 1LTTD 2F0UA 2NVYH 2R6GA 2EXZA 3I4MG 1VQHA 1AW7A 5DAUA 1AZQA 2IL8A 2LKVA 5T1IA 1CQFA 1BXTA 3CRLC 2JN4A 1F9RA 3K5NA 2C35B 1P16A 3SK8A 4A3FB 1A15A 4YCVA 5BN4A 1I6HH 4IUQA 3I3CA 1NE3A 3ULLA 4OL7A 3OYYA 1B44D 3JAMi 2OT2A 1Q1EA 1JORA 3JAMc 3D6CA 2B2YC 3NWTA 4DV6L 1I4QA 2Z8LA 3CU7A 4GNXA 4RFBA 4AH6A 5ISRA 2WKCA 3LNNA 1FR3A 1TWCB 3K6OA 4EQ5A 1GD7A 4P71A 4QUFA 1LV9A 3HKZB 4A3MB 3H3VC 3SHLA 1XTCD 1BOSA 4RGNA 1E1TA 3ERSX 4ABNA 3FKIG 5C0XH 4K14A 4RG1A 2HDLA 5ELBA 2F03A 5I4DA 2CW0C 1X32A 1YI2A 1G51A 1EQTA 3GTQB 1TVXA 2NN6I 2NYZD 1EU3A 1KL9A 3MFYA 1XMQL 2QDBA 2KCTA 1ZXTA 3M3YB 3E0EA 4PG3A 3LWUA 3PUZA 4L63B 1RTNA 1GKHA 5LMNW 2AQ3B 2JA6B 1A3VA 3ERQA 3S16B 4IUPA 4YWMA 5KNCA 4DV3Q 1NMGA 2CWPA 4Y7NB 5C0XJ 3GTMB 4NXNL 1DM0B 4JI3Q 4C3HB 2Z6KC 2A6HD 3K80C 4OX9Q 1BNZA 4DAVA 4K6LA 1K28A 4IPGA 3FEWX 3PIO3 1HNXQ 1UEBA 4DV0Q 1SNPA 3I4MH 4R9WA 1CSQA 2PPBC 3W1BA 1STHA 3R93A 4DR1L 2EYMA 4B3MQ 4HJ7A 1DZ1A 3T1HQ 2R7FA 3X3MA 3TS0A 3LGJA 2F0DA 3CF5A 2A68C 2E2DC 3HP3A 2WACA 5IP9G 1Q3LA 1Q81C 1K73C 2XRSD 5AFWA 3FVQA 1WYDA 1L0YB 2L0CA 4JI8Q 2EVBA 4DKAC 4K5XA 1D2BA 4FF1A 3TZUA 1MIUA 2JK8A 4K0KL 3MZ5A 2B2VC 2MO0A 2K75A 3VR3A 1EYDA 2DNEA 3P7JA 2F1MA 3FKIH 4EX5A 5IOCA 1M90C 1GHKA 1NBWA 1B3QA 5CV6A 3J81c 3OOCA 2AWNA 1WD1A 3AYHB 1EQVA 4KKTA 1GUOA 4A75A 5IE8A 4OO1I 1QG7A 2F3VA 3BDCA 5I2YA 1M4VA 1TWGH 1Q90A 3GTQH 1TS5A 1PYSB 1I5FA 2B8FA 4GNXC 1C7YA 1SMYC 2B29A 2XTIA 3CMEA 1EY6A 3S16H 1FJGL 5AJ3Q 3CHBD 4RGOS 4YHHL 3R2TA 3GTMH 3I4NB 1F9QA 4O0AA 1PMRA 3ND9A 1HZCA 1KNEA 1NAPA 1IBML 1KHIA 1HFNA 1U0LA 4I7ZC 2N49A 5IT9c 5J22A 3STBC 2HQLA 1XYIA 4IUNA 4S3SA 1JWSD 5IP9H 1S5DD 3PUXA 3HOVH 1ESRA 3MTSA 1DGSA 2OXPA 5C3XA 4LUZA 4RGMA 4KHPQ 3MXGA 2JXMB 1EL0A 4ULLA 5M3MB 4R1JA 5FLMG 1L0WA 5GROA 2VW9A 4WFN3 3F2CA 4LF7L 4G7HC 4HCEA 3BDLA 3VYSA 1OXSC 5M3MG 1O7ZA 4OGQC 3BZCA 1KABA 5M9OA 3GTOB 3Q24A 2UXBL 4HTHA 2A69C 1AFPA 2UXCQ 2B2TA 4JBKA 1HA5A 3AFPA 1XJVA 3Q22A 2FHTA 1RL2A 1XNRL 3OW7A 1KIXA 4BXXG 3RMHA 1GHJA 3E3XA 3D6WA 4IZ8A 1K8GA 1SYDA 4EQOA 5FK9C 2IY5B 4LNQA 1X65A 1TU2B 1B8AA 1PFMA 3A56A 4DUZQ 1DOKA 2JA7B 3WDNA 2G9DA 3S17B 1GUWA 1FNWA 4JV5L 1L2FA 4KK7A 4R4OA 1WD0A 2PNHA 1WOCA 2E5LL 5CV9A 1H95A 2NN6G 2CH4A 1A8VA 1G91A 4QF4A 2WB1E 3OMCA 2EY5A 4HSVA 2WB1G 4I65A 2RSNA 4DR5L 1VQPA 3S2HB 2D0OA 5JJIA 2DNCA 2JE6I 5LL6S 3UDFA 4BBSB 1FGUA 4TQUS 3BDOA 2BDNA 4GN3B 2KBNA 3WOFA 1NSNS 3I72A 5D3IB 1VCIA 1EY8A 4LF4L 1VQDA 4TVAB 5FLMH 4BBSG 3UDGA 4NDXA 4NXMQ 1Q82C 4DXGA 4DK1A 1TXYA 1VQBA 3QJYA 1IKLA
chains in the Genus database with same CATH topology
4PQXA 2KEEA 2LS01 3OSOA 3C2PA 1BR9A 1KLUD 4EQPA 4LAAA 4DU9A 2R92B 5FLXL 4EVOA 5C4JB 1E2ZA 5IIFA 3BG3A 4ID6A 5A2QL 5JPNC 2M2LA 5DNFA 3OMGA 1SJHD 1XX8A 2O4XA 5C0XI 1PRTF 1B4OA 1ENAA 3MXPA 4CHTB 2QF7A 1PDQA 1NR2A 2R93B 1LTAD 1LTGD 4EGVA 2VB3X 1H9SA 4AYBB 2SNMA 4CKBA 1XXGA 5FO7B 1JE4A 4BY1B 3OIPA 2F0IA 3TP7A 2ZXOA 1WTVA 3A7AB 1PZJD 2B2TC 2NN6H 1T5EA 3MXNA 4A93B 2F0VA 1EIGA 3JAME 1DYQA 2F0OA 1TS4A 5DEHA 1RKNA 1HUNA 4K2KA 1O78A 5KIXA 2F0HA 1SYBA 2EY6A 1F2MA 1W6KA 1PTOF 2PZUA 4KJOA 4NW2A 3T56B 4TSSA 3MAQA 2B8GA 1TIID 3O13A 4DF7A 1ILPA 4X3UA 2PO4A 1ET6A 3BYYB 1PYWD 3PMFA 4ODGA 3DM1A 3A7LA 3S14B 4NMZA 1WTXA 3VR6A 2CQAA 2F4IA 2KVMA 4QMGA 1ONLA 3MFGA 1SEBD 2L55A 1HCZA 5IGFA 2EYOA 1PTOC 2KQ3A 3NK9A 3RZOB 2Z4HA 3GTPB 3HOXB 2ENBA 2EJMA 3FPUB 3K5OA 4HSPA 2KOLA 3S1NB 2XWBB 3V2TA 3HG9A 3M7NA 3NE5B 4MHEA 1ICWA 1S5BD 4M1UB 1RF2D 3M85A 1EEFD 1LTRD 4KHVA 3EVQA 3MEHA 3D4WA 4TRDA 3IAYA 1CZGA 5CYUA 3W3AA 3TN2A 3J81E 2H1EA 2ZXRA 1STEA 1V8QA 1BUVT 1YNJC 2N88A 1EU4A 4C3IB 3T16A 3NUCA 1MBYA 4QB4A 2NVTB 4CKEA 1X3PA 2AUJD 4K8IA 4KD3A 1AEXA 4FF3A 1E2WA 1I4PA 1TY0A 4WORA 3J7AF 2MPMA 3BS1A 4FO2A 2M9VA 2D62A 2KEDA 5CV5A 4A3GB 2GA4B 2AWOA 1B9MA 5EPJA 5IT9E 2J0TD 1SFOB 4MN3A 1Q1BA 2PCFB 5M5XB 2IX0A 3NPPA 2DY8A 1LABA 2BE5C 3A8JE 3KF8A 2F0KA 4XQQA 3U9OA 1C48A 2F0SA 4P2CB 4KV6A 3CKIB 2R3ZA 2QCPX 3HOZB 2K03A 4A3BB 3MC0B 4KKUA 4QCLA 1VDZA 2NZ1D 3AU7A 3E6ZX 1C4QA 1PZID 2L11A 4K5VA 1U4MA 4RA8A 2QEJC 4L8JA 4DNRB 1B2TA 2EYJA 5CV4A 5FKAC 2Z1CA 3K5LA 1BCPF 3BVGA 4DGZA 1S5CD 3FMCA 3NTIA 5EPLA 1CA6A 2EPBA 4OIJA 4V0BA 5IGBA 1ESFA 3KLRA 4JBWA 2K28A 4A3JB 5IGDA 2QKIC 1I3QB 1SBBB 3K59A 2PZTA 1YNNC 3OIQA 2WAQB 1U9RA 2NB0A 4MIUA 4IUUA 1G6ZA 3D3RA 3GTJB 3M4YA 2A6EC 3I73A 4ILWA 5EJWA 3BVMA 3I8ZA 2PZWA 1FD7D 1TWHB 4V190 1BCPC 1J9OA 1MD2D 2EY1A 1NR4A 1JWUD 2IT1A 5CMDA 1F9SA 4IURA 5KYIA 4C1NK 1EOTA 3PV0A 1D6EC 1Q8IA 2KUMA 2JYOA 1CA5A 2BCOA 3MA2B 3X3NA 4XT1B 1EWCA 1HQRD 1STBA 2N55A 4FVMA 1FGBD 1B3AA 4E6IA 4KY5A 1DCZA 2KJXA 1PRTB 3TSSA 3NTKA 1HHVA 3NWSA 3SEBA 4PMWA 1OXUA 2FMMA 2I46A 4ZK9B 2BOSA 3N6RA 4C2MB 1CT1D 4A3IB 5EGTA 3HS0C 1SSOA 4CJ0B 3N52A 3KLSA 4C3HG 4DAYA 2TSSA 5JVH3 3VR5A 1CHPD 1RHPA 2HUGA 4B9XA 1SYGA 3I91A 4HN7A 5ELCA 4C1NI 3DUZA 1B1ZA 3M7GA 1A3UA 5LL6X 2I07B 2K33A 2RA4A 4G57A 1Q12A 1Z6HA 1SNQA 3H0GB 3OHXC 3VYTA 5IGGA 1UEAB 1CFMA 4DNTB 4HR7B 4GZYC 3NXWA 1AN8A 4KN7C 1G2SA 3MVVA 4RWSC 1JOKA 5C4HA 4ZAIA 4XXEA 1V1PA 1X3QA 1F2ZA 1NCVA 5IGCA 2O5IC 3NSWA 4H0LC 1WTPA 4FP5D 1EY7A 1RTOA 1S5FD 3G7LA 2LFNA 1ZYRD 5JVG3 4CKCA 4A3KB 1EZ8A 1CZWA 1IW7D 1MGSA 4NKLA 2VXWA 1AZPA 3EROA 4BY7B 1W6JA 3K0YA 2E76C 5DM73 5DM63 3PUYA 1JWMD 3C3LA 3T13A 3NBHA 4UDUC 1OXTA 2D9UA 5C6AA 2NWGA 1HA6A 1GUNA 1R4QB 3ZYYX 1MI2A 2IWHA 2FFKB 1IL8A 4H44C 5E4WC 3L7ZC 1I50B 3SR1A 3RZDB 1BBXC 5JOBA 3U9SA 4RKLA 5ELDA 1TWFB 2A6HC 2MP1A 4N9TA 3RLFA 1H9MA 1C8CA 1O7YA 1Y8PB 4DK0A 1EFID 5JEAG 1SE4A 3URYA 1SNMA 4KTAA 2L9HA 1BQQT 1II3A 5CBAE 4H7BA 5G3LD 3GTKB 3NP8A 4BA1I 1WTWA 3MXUA 2L12A 3KUPA 3LX0A 1PRTD 1A3TA 1QNKA 2JEBI 2HDMA 2HCCA 3K58A 2VUMB 2RVLA 2Z4IA 2WP8J 1O80A 5FO9B 2E2JB 2J7ZA 4IQZA 3RD4A 4KHZA 1S5ED 3Q23A 3VA5A 2KCCA 4BS9A 2B2UA 2B2WA 3OWEB 2X69A 1QJOA 4ZRZA 1DJRD 4FXKC 2NBFA 1B9NA 3A54A 1DOMA 4Z9CB 1KDCA 3IKJA 1L0XB 1TS3A 5ELFA 4YIJA 5JEAH 1BCPB 5A35A 4RCNA 2PMZB 4LJZC 3P1HA 1U4PA 5JAVA 5D65A 4RKBA 3ITPA 3J80L 4BWGB 5CC4A 3HOUB 1SDFA 4B9WA 2AQ2B 4JK1C 5JEAJ 1I4RA 1K8OA 4X3SA 4DA2A 5C3EB 4DAPA 1TWAB 3QWNA 5CBEE 2LY7A 2PW7A 5HURA 1TS2A 2ICEC 3DXJC 1QE6A 4J6HA 3I4LA 2RQXA 4IFDJ 1VF5C 3TZDA 3M4OB 5BN5A 1SXTA 2R7ZB 1F77A 1LT4D 1DONA 2V4DA 4K5WA 1PFBA 5BN3A 1B53A 3GO5A 4K2LA 3GTGB 1HPCA 1IYVA 2L1BA 4CJ2C 2KHSA 1SYCA 3S2DB 1IYUA 3K5MA 5EKKA 2BA1A 3H6MA 2ICIA 2RDHA 1EY0A 1SE2A 2B2UC 3K7AB 2B39A 2B2WC 1SYFA 4R8IA 3KBXA 2XRQD 3EQLC 4FXGC 2Q8TA 3FPPA 3HZXA 1ML0D 3Q6SA 2ZT9C 2RDFA 2VNUD 2AQ1B 4G4KA 5ELEA 3TP8A 1EY9A 3DWQA 3K57A 1JICA 3S1MB 2EE1A 1AP0A 4KMUC 2RKSA 4DN4M 1Z7TA 2OEOA 3NTHA 4ZUJA 3NHHA 2BA0A 5C5MA 2IW3A 4QUCA 1STGA 3OWFA 1Y1WB 2VB2X 3DEOA 1SAPA 2F0NA 4O1NA 2MJ8A 5KYLA 1GUTA 1KDAA 2E74C 3FRPB 5J1ZA 2JP1A 2SEBD 2Y0SB 4HMIA 4C3IG 3T51B 5EPKA 1F9PA 3SXHA 1D5MC 1CQVA 3VYRA 3Q0AA 1EY5A 1O7LA 2CW0D 3DMUA 2A5HA 2DY7A 3T53B 1FNUA 3SDZA 2K04A 2HQEA 3TP6A 2X6LA 1JCKB 2XNAC 1JB3A 1STYA 3AMUA 1JOQA 1LTBD 1CK1A 3AB9A 2QILA 1JQYD 3DWPA 1ET9A 4Q5VA 4KY7A 2O5JC 1CHQD 2R61A 2WV6D 2E2HB 2F3WA 3QOLA 4H13C 4PV1C 5I2XA 1DOLA 3P75A 5I9OA 5J39A 2K7VA 5TSSA 2AUKA 2G9HD 2JSOA 5E4XA 2EY2A 4ZQ3A 2A73B 5M5WB 4R8NA 1OXXK 1HTPA 2A68D 5CV8A 5D14A 4U673 3C46A 1JR0D 1MSGA 1G291 2BDOA 1SJED 2X6GA 1G8ZD 1EYAA 3QOJA 1LT3D 3FDTA 3BZDB 2L4NA 4F87A 1KNAA 1LO5D 2PYKA 2RBMA 1WTOA 2J4XA 4U68A 3A55A 1OO9B 1GOZA 2EYLA 1RJTA 1S4ZA 3NBIA 5M3FB 4DFAA 2B2VA 4O42A 3SK4A 2EYPA 2WKDA 1STNA 1SE3A 4IFDI 4FNFA 2C5CA 1I4HA 1SNDA 1QILA 2NTSA 1SMYD 3J81L 5E1FA 2K6AA 1JOOA 2F0PA 5I6WA 4NP5A 2IX1A 1RDPD 2DN8A 2C9OA 4ZYSA 4CBVA 3FKIB 2MHVA 2M00A 2H4OA 2NUCA 1OXVA 3H91A 5T1GA 4M8AA 3J7AV 4XYOA 2Q8RE 2B63B 1ENCA 4X3KA 1ZEQX 1TWGB 2KCNA 3ONAB 3C1FA 2E2IB 4KKSA 3I90A 5IT9L 2EOTA 3GD7A 3WOEA 3PO3B 1EY4A 5K36G 2K5WA 3S1RB 4FF2A 4F8MA 2FINB 2YU9B 2HCIA 4KD4A 2SOBA 2D2CC 2A69D 3LWEA 5KGUA 4J8QA 2XSCA 2FMCA 3SVMA 1TY2A 3HOVB 4L6TB 1PTOB 2K5QA 5C44B 5KNDA 1F2YA 2EDGA 5CV7A 2CHBD 1WTRA 1HXYD 1EEID 3QO2A 4FXDA 3EA6A 4KN4C 4LK1C 4XT3B 5CR3A 1HQMC 1RODA 4K8JA 5JPMC 1HTLD 1UNSA 3V96A 4ZKCB 1UUPA 1H9SB 1WVLA 4HAEA 4CGYB 3EFXD 5K36H 3E5SA 4XTCS 1GJXA 4XYQA 5FLXE 4X3TA 1BO0A 4PMCA 1CI3M 2K01A 5A2QE 1V1OA 1SNCA 1EWHA 1R4PB 1E0BA 5EBCA 2F0TA 3J80E 3MHBA 1DXMA 3MWYW 1G2TA 1D5XC 2IPKD 3NQIA 4IUVA 2O2LD 4F88A 5CGKA 3L3OC 1KLGD 2EJGC 4RGTA 1KTKA 4XQJA 2F0EA 1D5ZC 1SNOA 1PTOH 4XDXA 1STAA 1GUGA 4HMJA 4RAUC 1M8AA 1HUMA 3UI2A 5C4ZA 5CORA 1J8IA 3VA7A 4Q0FA 4RHSA 4BBRB 1I4XA 1SYEA 1UAPA 4IFDG 3IL8A 2F0MA 2IJ0A 3R8BA 4CJ1B 4A3EB 2JA8B 3DWAA 3E0JA 2ZXPA 3C1EA 3KLSX 1KDBA 3W2DA 4N9PA 2IX3A 2PW5A 5IODA 3DHQA 4C3JB 3R2IA 4RH6A 1QNUA 2XN9C 2WB1B 4HCSA 1ILQA 1IKMA 5FOBB 2KECA 3RUZA 4C3JG 1QCBD 1DD2A 3QIAA 1PFNA 1ZYRC 1PTOD 1EIHA 5NUCA 2F0WA 1GUSA 2SNSA 2TMPA 1IW7C 3P20A 1D1IA 2NVXB 2F0JA 1D1KA 1VF7A 3TP5A 5LHY1 3D8GA 1Y69U 3TDQA 3HGBA 2KA7A 1U4LA 3IFDA 2NVQB 1JC7A 1TT2A 1VMCA 4OHJA 1I6VC 5D3DA 4ZKBB 3HEJA 4EQNA 4IFDH 3S1QB 5G3LF 4KI0A 1A6XA 1EZ6A 1RD9D 1Y1VB 5C3WA 4B08A 1TKWB 1YNJD 3NQTA 4LMQD 3D4RA 1V43A 3GTLB 3G6JB 3VR2A 4XIGS 3KBGA 3BYTB 4F7XA 2SDFA 3GP7A 1H9KA 3BVZA 5HGTA 2CVRA 1I4GA 5KEEA 1IHZA 3V05A 1QOHA 4WJWA 2MUYA 4TKOB 2EZVA 3PO2B 4OO1G 4XQNA 1LTID 4RHRA 3J7YW 1BDOA 3SK6A 3A8IE 1FYCA 1PRTC 4WRDA 2XVSA 1HRJA 1WCMB 4FYDA 2F0QA 4DXFA 1GXDC 3F2UA 4FF4A 3S15B 5COYA 3H09A 2BE5D 1TQOA 3IFTA 1R9TB 1PXUA 4IN3A 2K32A 1ENFA 3GV6A 1ZKOA 3TMEA 4QIWB 1LLRD 2F0FA 2Q8IB 1F2LA 4PNYA 5K5PA 5I9PA 5I6YA 1LACA 2F0LA 4ME5A 3VYUA 1H9JA 2OF1A 5JJZA 1LT5D 3HRZC 2JEAI 5EQ0A 4J1MA 1EYCA 2K1BA 4ZUIA 4G7OC 4OO1H 1YNND 2A74C 2L5TA 3GQBA 1KAAA 3CRKC 2F0GA 2K5DA 1BF4A 3HOYB 4BA2I 1QWYA 2A6ED 2D5DA 2YYZA 2FJ2A 3GV3A 4RCOA 2JA5B 4KY6A 4HEDA 5FO8B 2K05A 5EKLA 3HOWB 3OPOA 3R3OA 1A2UA 5C5LA 1HFGA 1K83B 4OIKA 1BCPD 4A3DB 5F2DA 1QB5D 3D31A 1NUCA 3SK5A 1VMPA 3PIP3 5C4XB 2B2YA 1U4RA 1Z47A 2EYFA 2NVYB 3JAML 1K8MA 2WINB 3VR4A 1LT6D 3L9AX 1H9RA 5M5YB 3SE0A 4C56C 1RCVD 2PNRC 2XWJB 1I6HB 1A2TA 2PQEA 3PUVA 2WIIB 3H94A 2NTTA 3QG1A 2LMCB 4UAIA 4IUTA 5E3FA 1V1PB 4K6DA 1MSHA 1TR5A 3QB3A 1CM9A 1B50A 1WTQA 5EKIA 2EYHA 1LTSD 5C0XG 2ID0A 2XIWA 1Y8NB 3T4AC 4KJNA 1PLFA 3ND8A 2MGSA 1Y8OB 5KNBA 1E2VA 1PZKD 3PUWA 5KRUA 1T5XD 3D4DA 4ZLTF 2RDGA 3A8KE 2EJFC 1FNVA 3CQZB 1XWEA 3I70A 3EJIA 1CTMA 2RSOA 5IGEA 3KK7A 3I4MB 3S9WA 4PMBA 4G7ZC 3DEPA 4IALA 5EBDA 3TBIB 2E75C 1LTTD 2F0UA 2R6GA 2EXZA 5DAUA 1AW7A 1AZQA 2IL8A 2LKVA 5T1IA 1CQFA 1BXTA 3CRLC 1F9RA 3K5NA 3SK8A 4A3FB 1A15A 5BN4A 4IUQA 3I3CA 4OL7A 1B44D 2OT2A 1Q1EA 1JORA 3D6CA 2B2YC 3NWTA 1I4QA 2Z8LA 3CU7A 4RFBA 5ISRA 2WKCA 3LNNA 1FR3A 1TWCB 3K6OA 4QUFA 1LV9A 3HKZB 4A3MB 3H3VC 3SHLA 1XTCD 1BOSA 4RGNA 4ABNA 5C0XH 4K14A 2HDLA 5ELBA 2F03A 5I4DA 2CW0C 1X32A 1EQTA 3GTQB 1TVXA 2NN6I 2NYZD 1EU3A 3MFYA 2QDBA 1ZXTA 3M3YB 3LWUA 3PUZA 4L63B 1RTNA 2AQ3B 2JA6B 1A3VA 3ERQA 3S16B 4IUPA 5KNCA 4Y7NB 5C0XJ 3GTMB 1DM0B 4C3HB 2A6HD 1BNZA 4DAVA 4K6LA 3FEWX 3PIO3 1SNPA 4R9WA 2PPBC 1STHA 3R93A 2EYMA 1DZ1A 3X3MA 2F0DA 2A68C 2E2DC 3HP3A 2WACA 1Q3LA 2XRSD 5AFWA 3FVQA 1L0YB 2L0CA 2EVBA 4K5XA 1D2BA 4FF1A 3TZUA 3MZ5A 2B2VC 3VR3A 1EYDA 2DNEA 3P7JA 2F1MA 5IOCA 1GHKA 5CV6A 3OOCA 2AWNA 1WD1A 1EQVA 4KKTA 1GUOA 4OO1I 1QG7A 2F3VA 3BDCA 5I2YA 1M4VA 1Q90A 1TS5A 2B8FA 1SMYC 1EY6A 3CHBD 4RGOS 3R2TA 3I4NB 1F9QA 1PMRA 3ND9A 1KNEA 1NAPA 1HFNA 4I7ZC 5J22A 1XYIA 4IUNA 4S3SA 1JWSD 1S5DD 3PUXA 1ESRA 3MTSA 2OXPA 5C3XA 4RGMA 3MXGA 2JXMB 1EL0A 4ULLA 5M3MB 4WFN3 4G7HC 4HCEA 3BDLA 3VYSA 1OXSC 1O7ZA 4OGQC 3GTOB 1KABA 5M9OA 3Q24A 4HTHA 2A69C 1AFPA 2B2TA 1HA5A 3Q22A 2FHTA 3OW7A 3RMHA 1GHJA 3D6WA 4IZ8A 1SYDA 4EQOA 5FK9C 1TU2B 1PFMA 3A56A 1DOKA 2JA7B 3WDNA 2G9DA 3S17B 1GUWA 1FNWA 4KK7A 1WD0A 5CV9A 2NN6G 1G91A 4QF4A 2EY5A 4I65A 3OMCA 4HSVA 3S2HB 2RSNA 2DNCA 2JE6I 5LL6S 4BBSB 4TQUS 3BDOA 2BDNA 3WOFA 1NSNS 3I72A 5D3IB 1VCIA 1EY8A 4NDXA 4DXGA 4DK1A 3QJYA 1IKLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3K B;  1SFO B;  5M5X B;  3S2D B;  4G7O C;  2R92 B;  2E2J B;  5C4J B;  3GTL B;  2PPB C;  2BE5 C;  3CQZ B;  3RZO B;  3HOY B;  5M3M B;  4A3E B;  2JA8 B;  3GTP B;  4BY7 B;  3HOX B;  4KN4 C;  4LK1 C;  2JA5 B;  1HQM C;  4G7H C;  3I4M B;  4A3B B;  3HOZ B;  3HOW B;  3K7A B;  2A68 C;  4G7Z C;  3S1N B;  4C2M B;  1K83 B;  3TBI B;  3PO2 B;  4A3D B;  4A3I B;  3FKI B;  3EQL C;  3GTO B;  2R93 B;  4C3J B;  2A69 C;  4AYB B;  5C4X B;  2WB1 B;  4BY1 B;  2NVY B;  2B63 B;  1WCM B;  2PMZ B;  4A3F B;  2O5J C;  4LJZ C;  2E2H B;  1I50 B;  1TWG B;  3RZD B;  5M5Y B;  1ZYR C;  2E2I B;  1TWF B;  3S15 B;  4A93 B;  2A6H C;  3HOU B;  4A3J B;  1I6H B;  1YNJ C;  1I3Q B;  1IW7 C;  5M5W B;  4JK1 C;  4C3I B;  2NVX B;  1R9T B;  1TWC B;  3WOE A;  1YNN C;  3PO3 B;  2JA7 B;  3S17 B;  3HKZ B;  4A3M B;  3H3V C;  3S1M B;  2WAQ B;  5C3E B;  2NVT B;  4KMU C;  1TWA B;  3S1R B;  3H0G B;  2LY7 A;  3GTJ B;  1SMY C;  4GZY C;  2CW0 C;  2A6E C;  2YU9 B;  2NVQ B;  3DXJ C;  4QIW B;  3GTQ B;  4KN7 C;  3GTK B;  3S2H B;  1Y1W B;  1I6V C;  3M3Y B;  3M4O B;  3I4N B;  1TWH B;  4BBS B;  2R7Z B;  2JA6 B;  3S1Q B;  2O5I C;  3S16 B;  3WOF A;  3HOV B;  3S14 B;  4Y7N B;  4A3G B;  3GTM B;  1Y1V B;  4BBR B;  2Y0S B;  5C44 B;  2VUM B;  5M3F B;  3GTG B;  4C3H B; 
#chains in the Genus database with same CATH topology
 4PQX A;  2KEE A;  2LS0 1;  4HIO A;  3RLN A;  3OSO A;  3C2P A;  1BR9 A;  1KLU D;  4EQP A;  4DK6 C;  3M4Q A;  4LAA A;  4DU9 A;  5M3M H;  4DV2 L;  2R92 B;  5FLX L;  4EVO A;  5C4J B;  2VS1 A;  1E2Z A;  5IIF A;  3BG3 A;  4ID6 A;  1S3O A;  5A2Q L;  3ZJY C;  5JPN C;  4JCV E;  1EQQ A;  5JJL A;  2DGY A;  1JB7 A;  1EYG A;  2R92 G;  3I7F A;  2M2L A;  5DNF A;  3OMG A;  3GTO H;  1SJH D;  1XX8 A;  2O4X A;  4BXX H;  5C0X I;  1PRT F;  1B4O A;  5HY6 A;  1UE7 A;  1ENA A;  3MXP A;  4CHT B;  2QF7 A;  2JA8 H;  1PDQ A;  1NR2 A;  1Y1V G;  2R93 B;  1LTA D;  1JT8 A;  1LTG D;  4EGV A;  2VB3 X;  1H9S A;  4AYB B;  3CPW A;  2SNM A;  4CKB A;  2EQS A;  1XXG A;  5FO7 B;  1JE4 A;  1WTH A;  4BY1 B;  3OIP A;  4DPG A;  2F0I A;  3TP7 A;  1VQ7 A;  2ZXO A;  1N33 L;  2R93 G;  1X3F A;  4AYB E;  1WTV A;  4AYB G;  3A7A B;  4C3J H;  1PZJ D;  2B2T C;  3ER0 A;  2NN6 H;  1T5E A;  3S17 H;  3MXN A;  4BY1 G;  4IO9 A;  4A93 B;  2F0V A;  1JE5 A;  1EIG A;  3JAM E;  1DYQ A;  2F0O A;  1TS4 A;  5DEH A;  1RKN A;  4X64 Q;  2PI2 E;  1HUN A;  4K2K A;  1O78 A;  2D0P A;  4GOP B;  5KIX A;  2F0H A;  1SYB A;  2EY6 A;  4HIK A;  1F2M A;  1W6K A;  2F4V L;  3S2H H;  1PTO F;  4N8F A;  4LUV A;  2PZU A;  4BBS H;  4OX9 L;  4KJO A;  4GN5 A;  4NW2 A;  3T56 B;  2NVX H;  4LF9 L;  4TSS A;  3MAQ A;  2B8G A;  3K81 C;  1TII D;  3O13 A;  2GVA A;  4DF7 A;  2UUA Q;  1ILP A;  4X3U A;  4GLA C;  2PO4 A;  1ET6 A;  3BYY B;  1PYW D;  3PMF A;  1VQF A;  4ODG A;  4B3M L;  3DM1 A;  3A7L A;  2YTY A;  2NVQ H;  3KDF B;  3S14 B;  1KC8 C;  4NMZ A;  3AQQ A;  2R92 H;  1WTX A;  3VR6 A;  5C4J H;  4L5T A;  2CQA A;  2F4I A;  2KVM A;  4QMG A;  4JI8 L;  1ONL A;  3MFG A;  3S1Q H;  1SEB D;  2L55 A;  1VQA A;  1HCZ A;  1S72 A;  5IGF A;  2DJG C;  1VQK A;  2EYO A;  4OEL B;  1Y1V H;  3CCU A;  3CCS A;  1PTO C;  2KQ3 A;  3NK9 A;  4QIW E;  3RZO B;  2HHH Q;  2Z4H A;  3GTP B;  3HOX B;  2ENB A;  1A62 A;  2EJM A;  3FPU B;  1Y14 B;  3K5O A;  3GTL H;  2R93 H;  1YEZ A;  4HSP A;  2KOL A;  4JPB W;  2MNA A;  2ZTE A;  2XWB B;  3S1N B;  3V2T A;  4BY1 H;  3HG9 A;  4A4I A;  3M7N A;  3NE5 B;  4MHE A;  4NPS A;  1ICW A;  2KHI A;  1S5B D;  4M1U B;  1RF2 D;  3M85 A;  1EEF D;  1LTR D;  4KHV A;  1N9W A;  2ZJR A;  3EVQ A;  1SRO A;  3MEH A;  3D4W A;  1VQ6 A;  4TRD A;  5GAH C;  4DV4 Q;  3IAY A;  1CZG A;  4LFA Q;  1XNQ Q;  5CYU A;  3W3A A;  3TN2 A;  3HOY G;  3J81 E;  2H1E A;  2ZXR A;  3I2Z A;  1XPO A;  4ZCK A;  1STE A;  1V8Q A;  1BUV T;  1YNJ C;  4GKJ L;  2N88 A;  1EU4 A;  4PZ8 A;  4C3I B;  3T16 A;  3NUC A;  1MBY A;  1KAW A;  4QB4 A;  2NVT B;  4CKE A;  1X3P A;  2AUJ D;  4K8I A;  4JI4 Q;  1W3S A;  2K5N A;  4KD3 A;  1AEX A;  4FF3 A;  1E2W A;  3CCL A;  1BBU A;  1I4P A;  1TY0 A;  4WOR A;  3J7A F;  1YJ9 A;  1IXR A;  5C4X G;  2HD3 A;  1YJW A;  3S14 H;  2MFI A;  1HH2 P;  4P75 A;  4DV1 Q;  2MPM A;  3BS1 A;  1L1O A;  3BU2 A;  3TRE A;  1PH5 A;  4FO2 A;  2M9V A;  4DV7 Q;  2D62 A;  2KED A;  5CV5 A;  2FXQ A;  1ASY A;  4A3G B;  1SLJ A;  2GA4 B;  1K3R A;  2AWO A;  1B9M A;  1CKN A;  5EPJ A;  3HFZ B;  4IOC A;  5IT9 E;  2J0T D;  3TQY A;  1SFO B;  3RZO H;  4MN3 A;  1Q1B A;  2PCF B;  5M5X B;  3GTP H;  1E22 A;  2IX0 A;  3NPP A;  3NEM A;  4IJL A;  1HZ9 A;  2DY8 A;  1LAB A;  2BE5 C;  3A8J E;  3KF8 A;  2F0K A;  2YTV A;  4XQQ A;  3U9O A;  3S1N H;  3CC7 A;  1C48 A;  1QVF A;  2F0S A;  4JI5 Q;  4P2C B;  4KV6 A;  3CKI B;  2RCN A;  2R3Z A;  2QCP X;  3HOZ B;  2K03 A;  4A3B B;  3MC0 B;  4KKU A;  2VQE Q;  3CCR A;  4QCL A;  5J3B A;  4GLX A;  1VDZ A;  2NZ1 D;  3AU7 A;  3E6Z X;  4LUO A;  1C4Q A;  1PZI D;  2L11 A;  3HOY H;  4K5V A;  2EIF A;  4YCW A;  1U4M A;  4RA8 A;  2QEJ C;  4L8J A;  4DUZ L;  2LXK A;  4A3B G;  3HOZ G;  4DNR B;  4JI2 Q;  4RMF A;  1JJ2 A;  1B2T A;  1BVS A;  2EYJ A;  5CV4 A;  3EIV A;  5FKA C;  2Z1C A;  3K5L A;  3T1Y L;  1BCP F;  2AMC B;  3BVG A;  1K83 H;  1S5C D;  3AFQ A;  4DGZ A;  1N8R C;  3FMC A;  3NTI A;  5EPL A;  4GKK L;  1CA6 A;  4X65 L;  2EPB A;  4OIJ A;  4V0B A;  5IGB A;  4MNO A;  5C4X H;  1ESF A;  3KLR A;  4JBW A;  1E24 A;  2NVT H;  3KYH C;  2JA9 A;  1N32 L;  1HNW Q;  2K28 A;  4A3J B;  5IGD A;  2QKI C;  1I3Q B;  2IHE A;  1SBB B;  4R4Q A;  3K59 A;  2PZT A;  1YNN C;  1QZH A;  1YZ6 A;  3OIQ A;  5M5Y H;  2WAQ B;  1U9R A;  2NB0 A;  4MIU A;  4IUU A;  1G6Z A;  3D3R A;  2PQA B;  2I0Q A;  3SGI A;  3F2B A;  3GTJ B;  3M4Y A;  1VQC A;  2A6E C;  4IPH A;  3I73 A;  4ILW A;  1HNZ Q;  4DR7 L;  5EJW A;  2WAQ E;  3BVM A;  2WAQ G;  3I8Z A;  2PZW A;  1FD7 D;  4LWC A;  1TWH B;  1KRS A;  4A3F G;  2UUB L;  4V19 0;  1BCP C;  1Q8K A;  4JI7 L;  4HJ8 A;  4OON A;  2K4K A;  1J9O A;  1HR0 Q;  1MD2 D;  2EY1 A;  1NR4 A;  4B3T Q;  1JWU D;  3CCM A;  1E3P A;  2IT1 A;  3KJO A;  5CMD A;  1F9S A;  2UXD L;  4IUR A;  5KYI A;  1IBL Q;  4DR2 Q;  4C1N K;  1EOT A;  3PV0 A;  3HKZ E;  3K7U C;  1D6E C;  1Q8I A;  3HKZ G;  4A3M G;  2KUM A;  4B3R Q;  2JYO A;  1LM0 A;  1CA5 A;  5IYC G;  2BCO A;  3MA2 B;  3X3N A;  5GAD C;  4XT1 B;  3CC2 A;  1VS0 A;  2DUD A;  4A3B H;  1EWC A;  2LXJ A;  3HOZ H;  1HQR D;  1STB A;  2N55 A;  4FVM A;  1FGB D;  1J6Q A;  1N36 L;  1B3A A;  2BH8 A;  4E6I A;  4KY5 A;  4JOI A;  1DCZ A;  2KJX A;  1PRT B;  3TSS A;  3NTK A;  1HHV A;  3NWS A;  3SEB A;  4YCU A;  4PMW A;  2JA6 G;  1OXU A;  2FMM A;  2I46 A;  4ZK9 B;  3RN5 A;  1HJP A;  2BOS A;  1PH7 A;  3CQZ H;  3N6R A;  4C2M B;  1CT1 D;  1PH4 A;  4A3I B;  5EGT A;  2OTJ A;  3HS0 C;  1SSO A;  4CJ0 B;  3N52 A;  1QUQ A;  2QW7 A;  1I94 Q;  3KLS A;  3E9H A;  4AQY Q;  1LUZ A;  4C3H G;  4DR3 L;  4DAY A;  2TSS A;  4LFB L;  5JVH 3;  4Y52 H;  4A3I G;  3VR5 A;  2CQO A;  1CHP D;  1RHP A;  1I3Q H;  2AHO B;  2HUG A;  4B9X A;  1IZ6 A;  1SYG A;  3I91 A;  4HN7 A;  2UUA L;  4OWW B;  4MZ9 A;  5ELC A;  3EN2 A;  3KF6 B;  4C1N I;  3J7A 5;  3DUZ A;  1B1Z A;  3M7G A;  5LMU Q;  1A3U A;  5LL6 X;  3GTJ H;  4A3F H;  2IHF A;  1FL0 A;  2I07 B;  2BH2 A;  2K33 A;  3H3V I;  2RA4 A;  1XTD A;  4G57 A;  1Q12 A;  3W1G A;  2UUC Q;  1Z6H A;  4OXP A;  4OEM B;  1SNQ A;  2K50 A;  3H0G B;  1RIP A;  3OHX C;  3VYT A;  5IGG A;  2QEX A;  1UEA B;  1CFM A;  4DNT B;  4HR7 B;  1TWH H;  2ZTD A;  4GZY C;  1K8A C;  3CPF A;  3NXW A;  5GAE C;  1AN8 A;  1TWC H;  4KN7 C;  3MVV A;  1G2S A;  3H0G G;  4RWS C;  4A3M H;  1JOK A;  5C4H A;  1XPR A;  4ZAI A;  1PH9 A;  5IYC H;  4LF5 L;  4XXE A;  3DLL A;  1V1P A;  1X3Q A;  4APV A;  2HHH L;  1F2Z A;  1X54 A;  1NCV A;  5IGC A;  2O5I C;  1K0R A;  4UHV A;  3NSW A;  4H0L C;  1CKM A;  1WTP A;  4FP5 D;  1EY7 A;  1RTO A;  2QGQ A;  1S5F D;  3G7L A;  2LFN A;  1ZYR D;  5JVG 3;  3M3Y H;  3K8A A;  1YVC A;  4CKC A;  4A3K B;  2JA6 H;  2EXD A;  4GS3 A;  1EZ8 A;  1CZW A;  1XMO L;  1IW7 D;  2DJF C;  4CDC C;  1VQL A;  4QGU A;  1MGS A;  4NKL A;  4Y7N H;  2VXW A;  1AZP A;  1Q86 C;  4B3S Q;  3ERO A;  3B6Y A;  4C3H H;  4BY7 B;  4C2M H;  1NMF A;  1W6J A;  3K0Y A;  2E76 C;  4OWX B;  5DM7 3;  4A3I H;  4X66 L;  3I4N G;  2LSS A;  5DM6 3;  3PUY A;  1JWM D;  3C3L A;  2K52 A;  3IRB A;  4BY7 G;  3T13 A;  3NBH A;  4UDU C;  4JOI C;  1OXT A;  2D9U A;  5C6A A;  2NWG A;  1HA6 A;  1GUN A;  4JI4 L;  1R4Q B;  3ZYY X;  1MI2 A;  2IWH A;  2N3S A;  2FFK B;  1IL8 A;  2RHS B;  2I5L X;  4JI6 Q;  4H44 C;  5E4W C;  1N34 L;  3PF5 A;  3RR5 A;  3L7Z C;  1I50 B;  2N8N A;  3SR1 A;  3UDI A;  3RZD B;  1BBX C;  5JOB A;  3U9S A;  4RKL A;  5ELD A;  1TWF B;  3H0G H;  2A6H C;  2MP1 A;  4POF A;  4N9T A;  3RLF A;  1H9M A;  1C8C A;  1O7Y A;  3U4V A;  3E9I A;  1E7Z A;  1Y8P B;  4DK0 A;  1EFI D;  5JEA G;  3I56 A;  4DR6 L;  1SE4 A;  3URY A;  1SNM A;  4KTA A;  2L9H A;  4ME3 A;  3J81 j;  2VQF Q;  3KOJ A;  1BQQ T;  4L5S A;  2N78 A;  1II3 A;  5CBA E;  4H7B A;  5G3L D;  3GTK B;  3NP8 A;  2ALY B;  4BA1 I;  1WTW A;  3MXU A;  2L12 A;  3KUP A;  3LX0 A;  1PRT D;  1PH6 A;  1A3T A;  1WJJ A;  1X3E A;  1P8L A;  3BZK A;  4JI5 L;  3OTO Q;  1QNK A;  2JEB I;  2HDM A;  1A63 A;  3A74 A;  2HCC A;  3K58 A;  2VUM B;  2RVL A;  2OQ0 A;  2WP8 J;  1O80 A;  2Z4I A;  4JI1 L;  5FO9 B;  3I4N H;  2E2J B;  3U4Z A;  1J5E L;  2J7Z A;  4JI0 Q;  4IQZ A;  3RD4 A;  2JA7 G;  4KHZ A;  1S5E D;  2UU9 Q;  4BY7 H;  3Q23 A;  3VA5 A;  2KCC A;  4BS9 A;  2VUM G;  2B2U A;  1VQM A;  2B2W A;  3CAM A;  4JW0 A;  4UY8 C;  1PH2 A;  4DR4 L;  3CCJ A;  4X6A H;  3OWE B;  2X69 A;  1QJO A;  4LF8 Q;  4ZRZ A;  1DJR D;  4FXK C;  2NBF A;  1SE8 A;  1B9N A;  3A54 A;  1DOM A;  4A76 A;  1SRU A;  4CDE C;  4Z9C B;  1KDC A;  3IKJ A;  4JG2 A;  1L0X B;  2Q2H A;  1TS3 A;  5ELF A;  3G71 A;  3RZD H;  4YIJ A;  5JEA H;  4P74 A;  1BCP B;  3ULJ A;  1TWF H;  4UP7 A;  2GVB A;  4RCN A;  5A35 A;  4DUY Q;  2PMZ B;  4LJZ C;  3P1H A;  1U4P A;  5JAV A;  5D65 A;  4RKB A;  3ITP A;  4HIM A;  3J80 L;  1MJE A;  4MTN A;  4BWG B;  5CC4 A;  3UDX A;  2PMZ E;  4POG A;  3KFU A;  3HOU B;  1SDF A;  4DV6 Q;  4LF6 Q;  4B9W A;  2AQ2 B;  4JK1 C;  5JEA J;  2VZA A;  1I4R A;  1K8O A;  4X3S A;  4DA2 A;  5C3E B;  4DAP A;  1TWA B;  2Z9H A;  1IBK Q;  3QWN A;  5CBE E;  2LY7 A;  2PW7 A;  5HUR A;  1TS2 A;  1VQO A;  2ICE C;  4A3C G;  4B3R L;  3DXJ C;  5GQO A;  1QE6 A;  2HT1 A;  4J6H A;  2JA7 H;  3I4L A;  1YBY A;  2RQX A;  4IFD J;  1VF5 C;  3TZD A;  5BR8 Q;  5BN5 A;  1SXT A;  1X9N A;  3M4O B;  2R7Z B;  1F77 A;  1LT4 D;  2VUM H;  1DON A;  2E2J H;  4DV3 L;  2V4D A;  2HIX A;  4K5W A;  1PFB A;  5BN3 A;  1B53 A;  4A93 G;  4HID A;  3GO5 A;  4K2L A;  4JI3 L;  4AIM A;  2OWO A;  2R7Z G;  1MJC A;  3GTG B;  1HPC A;  1IYV A;  2L1B A;  1MHW C;  1HNX L;  4CJ2 C;  2KHS A;  1SYC A;  4AQY L;  3S2D B;  4DV0 L;  1W2B A;  3CMA A;  3UE1 A;  2I5M X;  1IYU A;  3I55 A;  2Q2I A;  2VY3 A;  3K5M A;  5EKK A;  2G5D A;  2BA1 A;  2CH4 W;  3H6M A;  3T1H L;  4NB3 A;  2ICI A;  2RDH A;  3PCO B;  1EY0 A;  1SE2 A;  2B2U C;  4R4T A;  1YHB A;  3K7A B;  2CKZ B;  2B39 A;  2B2W C;  2RHQ B;  1SYF A;  2MO1 A;  2JQO A;  4R8I A;  3KBX A;  2XRQ D;  3EQL C;  3H3V H;  2QA4 A;  3FHW A;  4FXG C;  5GAG C;  2Q8T A;  3FPP A;  3HZX A;  3F2D A;  1EOV A;  1ML0 D;  3Q6S A;  5FLX c;  4K0K Q;  2ZT9 C;  1D7Q A;  2RDF A;  2ZM6 Q;  4A3L G;  2VNU D;  2AQ1 B;  2ZJQ A;  4G4K A;  5ELE A;  4GNX B;  4A3C H;  3TP8 A;  1G6P A;  1TWA H;  1EY9 A;  3M9B A;  3HOX G;  4HJA A;  3J80 i;  1K3B C;  3DWQ A;  3J80 c;  3K57 A;  1JIC A;  3S1M B;  2EE1 A;  2L15 A;  1AP0 A;  4KMU C;  2NZO A;  2RKS A;  4DN4 M;  1YNX A;  4A93 H;  1Z7T A;  2OEO A;  3NTH A;  2R7Z H;  3CCV A;  4ZUJ A;  2P5Z X;  3NHH A;  2BA0 A;  5C5M A;  5IYD G;  3A5U A;  1NY4 A;  5AJ3 L;  2IW3 A;  1BKB A;  3TEH B;  4LW1 A;  4QUC A;  1STG A;  3OWF A;  3J7Z C;  1Y1W B;  2VB2 X;  1FJG Q;  3DEO A;  1SAP A;  2F0N A;  4YHH Q;  4O1N A;  4I7A A;  2MJ8 A;  3GTG H;  5KYL A;  1GUT A;  1KDA A;  2E74 C;  2VL6 A;  1D8L A;  3FRP B;  1VQ4 A;  1Y1W G;  3A0J A;  3NEN A;  5J1Z A;  1QVC A;  2JP1 A;  4QY7 A;  3S2D H;  2SEB D;  2Y0S B;  1VQE A;  3CW2 C;  4HMI A;  2Q2U A;  4C3I G;  3T51 B;  5IY0 A;  5EPK A;  1F9P A;  2MQH A;  3SXH A;  1IL2 A;  1HZA A;  2Y0S E;  1D5M C;  2Y0S G;  1CQV A;  3VYR A;  3Q0A A;  1EY5 A;  3ULP A;  4KHP L;  3NEL A;  2E8G A;  3K7A H;  3RLO A;  1AE2 A;  1O7L A;  2CW0 D;  3DMU A;  2A5H A;  2DY7 A;  3FP9 A;  3T53 B;  1FNU A;  3SDZ A;  2K04 A;  4X62 Q;  2HQE A;  3TP6 A;  2X6L A;  1JCK B;  2XNA C;  1JB3 A;  3PIP A;  4A3G G;  3K0X A;  1STY A;  4H02 A;  2UXC L;  3HOX H;  3AMU A;  1JOQ A;  1VQN A;  1LTB D;  1CK1 A;  4YWL A;  3AB9 A;  2QIL A;  2UXB Q;  1EWI A;  1JQY D;  2YV5 A;  4R4I A;  3DWP A;  1ET9 A;  3OW2 A;  4Q5V A;  4KY7 A;  2O5J C;  1CHQ D;  2R61 A;  2WV6 D;  4PZ7 A;  2E2H B;  1XNR Q;  2F3W A;  3QOL A;  4H13 C;  4PV1 C;  5IYD H;  5I2X A;  1DOL A;  2K5H A;  3P75 A;  5I9O A;  5J39 A;  2K7V A;  3BJU A;  5TSS A;  5IWA Q;  2AUK A;  2OCE A;  3HKS A;  2G9H D;  2PI2 A;  1BBW A;  2JSO A;  5E4X A;  2EY2 A;  4ZQ3 A;  3OTO L;  1X56 A;  2A73 B;  5M5W B;  3RN2 A;  2AKW B;  5IYB G;  4KLK A;  4R8N A;  4IOA A;  1OXX K;  1HTP A;  4JV5 Q;  2A68 D;  4GOP A;  4JI0 L;  5CV8 A;  5D14 A;  2A1A A;  4U67 3;  3C46 A;  1JR0 D;  1MSG A;  2UU9 L;  1G29 1;  5FJ8 G;  4C3I H;  2E5L Q;  2BDO A;  2ASB A;  2QDL A;  2X6G A;  3QOJ A;  1SJE D;  1G8Z D;  1EYA A;  1EQR A;  1LT3 D;  1B70 B;  3FDT A;  3BZD B;  3ICE A;  2L4N A;  3A5Z B;  4DR5 Q;  4F87 A;  1YHQ A;  1KNA A;  2H5X A;  1LO5 D;  2PYK A;  2RBM A;  1WTO A;  2J4X A;  4NXM L;  4GLV B;  4U68 A;  4LF8 L;  3A55 A;  1OO9 B;  1GOZ A;  2EYL A;  4LF4 Q;  1RJT A;  4A3J G;  3KDF A;  1S4Z A;  3NBI A;  5M3F B;  4DFA A;  3AEV A;  2B2V A;  4O42 A;  2OTL A;  3SK4 A;  4PZ6 A;  2EYP A;  3U50 C;  2WKD A;  4A3G H;  1STN A;  5M3F G;  1SE3 A;  4IFD I;  4DV2 Q;  4FNF A;  2C5C A;  1I4H A;  1SND A;  1QIL A;  2I5H A;  4DUY L;  2NTS A;  3D0F A;  1SMY D;  3J81 L;  1SFO H;  5E1F A;  1EUJ A;  2K6A A;  3H15 A;  1UE5 A;  1S40 A;  5M5X H;  1JOO A;  1NTG A;  1YIJ A;  2F0P A;  1SMX A;  5I6W A;  4NP5 A;  1L1O C;  2IX1 A;  1RDP D;  2DN8 A;  2C9O A;  4LF6 L;  4ZYS A;  1V1Q A;  4CBV A;  3FKI B;  2MHV A;  1YIT A;  3UE0 A;  2M00 A;  2E2H H;  2H4O A;  1IBK L;  2NUC A;  1OXV A;  3H91 A;  5T1G A;  4L5R C;  4M8A A;  5IYB H;  3STB D;  2ZJP A;  4J15 A;  3J7A V;  4XYO A;  2Q8R E;  2B63 B;  1ENC A;  4X3K A;  1ZEQ X;  1TWG B;  2KCN A;  5M5W H;  3ONA B;  3C1F A;  1N33 Q;  5FJ8 H;  5BR8 L;  2E2I B;  4KKS A;  1SN8 A;  2Q2T A;  1EIY B;  4X64 L;  2B63 G;  3I90 A;  5IT9 L;  2B3G A;  2EOT A;  3GD7 A;  1AE3 A;  3WOE A;  3PO3 B;  1EY4 A;  5K36 G;  2K5W A;  1KQS A;  3S1R B;  4R4C A;  4DK3 C;  4FF2 A;  2F4V Q;  3L0O A;  4GN4 B;  4F8M A;  4A3J H;  2FIN B;  2YU9 B;  3PO3 G;  2HCI A;  4KD4 A;  2SOB A;  2D2C C;  1VQI A;  2A69 D;  4LF9 Q;  3LWE A;  1CUK A;  5KGU A;  4LFC Q;  4GOP C;  3PGZ A;  2JJQ A;  4J8Q A;  4QJF A;  2XSC A;  5M3F H;  2FMC A;  3SVM A;  1TY2 A;  3VDY A;  3DM3 A;  4L6T B;  3HOV B;  1PFS A;  1PTO B;  2K5Q A;  5C44 B;  2RCF A;  5KND A;  3PIO A;  3EBE A;  1F2Y A;  3HOV G;  2EDG A;  4QL5 A;  5CV7 A;  5C44 G;  2CHB D;  1WTR A;  1KRT A;  1HXY D;  2WFW A;  3G48 A;  1EEI D;  2ZTC A;  3QO2 A;  3TRZ A;  4FXD A;  2F52 A;  2ZM6 L;  2R7D A;  1PHJ A;  3EA6 A;  4KN4 C;  4LK1 C;  4XT3 B;  3G6E A;  4DAM A;  5CR3 A;  1HQM C;  1ROD A;  4K8J A;  1WFQ A;  3J81 i;  5JPM C;  2KEN A;  1HTL D;  1UNS A;  4ALP A;  3V96 A;  4QQB X;  4ZKC B;  3U58 A;  1OTC A;  1UUP A;  1H9S B;  4JC0 A;  2B63 H;  1WVL A;  2CCZ A;  4HAE A;  4CGY B;  3EFX D;  4A3K G;  2E2I H;  5K36 H;  3E5S A;  4XTC S;  1GJX A;  1NNX A;  5EAY A;  4DV4 L;  4XYQ A;  2CFM A;  5FLX E;  3MXN B;  4X3T A;  4LFA L;  1BO0 A;  1XNQ L;  4PMC A;  1CI3 M;  2K01 A;  3PO3 H;  1LTL A;  5A2Q E;  1V1O A;  1SNC A;  1EWH A;  3S1R H;  2OQK A;  1R4P B;  2F3I A;  1E0B A;  2YU9 H;  4GKJ Q;  5EBC A;  2F0T A;  4DNI A;  3J80 E;  3MHB A;  1DXM A;  3MWY W;  5LMN Q;  1G2T A;  1D5X C;  2GN5 A;  2IPK D;  3NQI A;  1QVG A;  4IUV A;  2O2L D;  2ATW A;  4F88 A;  5CGK A;  3L3O C;  1KLG D;  2EJG C;  4RGT A;  1KTK A;  5IP7 G;  2PQA A;  4UP9 A;  4XQJ A;  2F0E A;  1D5Z C;  1SNO A;  4DV1 L;  1PTO H;  4XDX A;  1STA A;  1GUG A;  4DV7 L;  4HMJ A;  4RAU C;  1CKO A;  5C44 H;  1M8A A;  1HUM A;  3UI2 A;  1PA6 A;  5C4Z A;  5ELO A;  5COR A;  4IPD A;  1X55 A;  1J8I A;  3VA7 A;  4X62 L;  4Q0F A;  4RHS A;  4BBR B;  1I4X A;  4JVZ A;  1PVO A;  1SYE A;  1UAP A;  1X3G A;  4MTK A;  4IFD G;  4BBR G;  3PF4 A;  1EIF A;  3L2P A;  3IL8 A;  4DV5 Q;  2F0M A;  2IJ0 A;  3R8B A;  4CJ1 B;  4A3K H;  4A3E B;  3DWA A;  1KD1 C;  2JA8 B;  3E0J A;  2ZXP A;  4YY3 Q;  2VQE L;  1PV4 A;  3C1E A;  4UP8 A;  3KLS X;  1KDB A;  3W2D A;  4N9P A;  2IX3 A;  5IWA L;  3PSI A;  3MEF A;  4A3E G;  2JA8 G;  2K14 A;  2PW5 A;  1K9M C;  3M4P A;  4CDD C;  4JI2 L;  2K5V A;  5IOD A;  3DHQ A;  4C3J B;  3R2I A;  4RH6 A;  5HGQ A;  3JC6 6;  1QNU A;  2XN9 C;  4YWK A;  2WB1 B;  4JYA Q;  4HCS A;  1ILQ A;  1JJC B;  3T1Y Q;  1IKM A;  3RUZ A;  2KEC A;  5FOB B;  4C3J G;  1QCB D;  1DD2 A;  4UPA A;  3QIA A;  4GKK Q;  1PFN A;  1ZYR C;  4X65 Q;  1HNW L;  5IP7 H;  4OWT B;  1PTO D;  1EIH A;  5NUC A;  2F0W A;  1GUS A;  2SNS A;  2TMP A;  3F8T A;  1A0I A;  1IW7 C;  1N32 Q;  3KF6 A;  3Q8D A;  3P20 A;  1D1I A;  4IJH A;  2NVX B;  2F0J A;  1I50 H;  1D1K A;  1VF7 A;  3TP5 A;  5LHY 1;  3D8G A;  1Y69 U;  3TDQ A;  1GM5 A;  3HGB A;  1HNZ L;  2KA7 A;  1U4L A;  2KCM A;  3IFD A;  2NVQ B;  1IYJ B;  1JC7 A;  1XPU A;  1TT2 A;  1VMC A;  4DR7 Q;  4OHJ A;  1L1O B;  1UWV A;  1QZG A;  3KLW A;  1I6V C;  5D3D A;  4ZKB B;  3HEJ A;  1JJG A;  4EQN A;  4IFD H;  3WWV A;  4BBR H;  1M1K C;  1HR0 L;  4B3T L;  2UUB Q;  3S1Q B;  5G3L F;  1CKN B;  4JI7 Q;  1JMC A;  4KI0 A;  1A6X A;  3TS2 A;  1EZ6 A;  1RD9 D;  4N8X 1;  3GTK H;  3G4S A;  4P73 A;  1IBL L;  3HOU G;  1Y1V B;  4DR2 L;  5C3W A;  4B08 A;  1PH8 A;  1TKW B;  1FVI A;  5JJK A;  2UXD Q;  3KJP A;  3F1Z A;  1YNJ D;  3W5O A;  4CDF C;  5C3E G;  4A3E H;  3NQT A;  4LMQ D;  3D4R A;  1CSP A;  1V43 A;  3GTL B;  3KF8 B;  1VQ8 A;  3G6J B;  1HZB A;  3VR2 A;  1XMQ Q;  5DLQ E;  4WJ4 A;  4XIG S;  1C0A A;  3KBG A;  3BYT B;  1UE1 A;  4F7X A;  1NJI C;  2XGT A;  2SDF A;  3GP7 A;  1H9K A;  3BVZ A;  5HGT A;  1N36 Q;  2CVR A;  4P72 A;  1VQJ A;  1I4G A;  4NXN Q;  5KEE A;  1IHZ A;  1QOH A;  3V05 A;  4WJW A;  2MUY A;  4TKO B;  2EZV A;  3PO2 B;  4OO1 G;  4XQN A;  1I94 L;  1LTI D;  4O2D A;  1VQG A;  4RHR A;  2RF4 A;  3J7Y W;  2YTX A;  1BDO A;  3SK6 A;  3A8I E;  1FYC A;  1PRT C;  4WRD A;  1YHA A;  4DR3 Q;  3PO2 G;  2XVS A;  4LFB Q;  1HRJ A;  1WCM B;  4DR1 Q;  4FYD A;  2V1C C;  2F0Q A;  4IPC A;  4DXF A;  1GXD C;  1YJN A;  3F2U A;  4HJ5 A;  3CC4 A;  4LFC L;  5LMU L;  4FF4 A;  3S15 B;  5COY A;  3H09 A;  1WCM G;  2BE5 D;  1TQO A;  2UUC L;  4JBM A;  1Z9F A;  2Z6B A;  3IFT A;  1R9T B;  1PXU A;  4IN3 A;  3RNU A;  3CP0 A;  2K32 A;  1LYL A;  5ELN A;  3HOU H;  1ENF A;  3GV6 A;  1ZKO A;  3TME A;  4QIW B;  1LLR D;  5H1S E;  2F0F A;  2Q8I B;  5C3E H;  1GO3 E;  2A8V A;  1U5K A;  1F2L A;  4PNY A;  5K5P A;  5I9P A;  5I6Y A;  1LAC A;  2F0L A;  4LF5 Q;  1KXL A;  4ME5 A;  3VYU A;  1H9J A;  2OF1 A;  4FDB A;  1LT5 D;  5JJZ A;  1GVP A;  3HRZ C;  2JEA I;  1PYB A;  3M4O H;  5EQ0 A;  4J1M A;  1EYC A;  1Q46 A;  2K1B A;  4HJ9 A;  4ZUI A;  4B3S L;  4OO1 H;  4G7O C;  1YNN D;  1XMO Q;  2A74 C;  2L5T A;  3GQB A;  1KAA A;  3CRK C;  2F0G A;  2K5D A;  3GDE A;  5E7N A;  1BF4 A;  3HOY B;  4BA2 I;  3CXC A;  1QWY A;  2KHJ A;  2A6E D;  2D5D A;  3PO2 H;  1SR3 A;  2YYZ A;  2FJ2 A;  3GV3 A;  4RCO A;  2HIV A;  4KY6 A;  1IBM Q;  2JA5 B;  4HED A;  5FO8 B;  1Q7Y C;  2K05 A;  4X66 Q;  5EKL A;  3HOW B;  3OPO A;  3R3O A;  1A2U A;  5C5L A;  2ES2 A;  1HFG A;  1QUQ B;  1K83 B;  4OIK A;  1BCP D;  4A3D B;  5F2D A;  1QB5 D;  3D31 A;  4DAY B;  2JA5 G;  1WCM H;  1NUC A;  3SK5 A;  1VQ5 A;  1VMP A;  1HR0 W;  5LMN L;  3PIP 3;  3HOW G;  5C4X B;  2B2Y A;  1U4R A;  1Z47 A;  4JI6 L;  5L37 A;  1PH3 A;  4A3D G;  2EYF A;  2NVY B;  3S15 H;  3JAM L;  3S24 A;  1K8M A;  2WIN B;  3VR4 A;  1B7Y B;  1LT6 D;  3L9A X;  1H9R A;  2Z0S A;  3CD6 A;  5M5Y B;  1N34 Q;  1R9T H;  4A3L H;  4LF7 Q;  3SE0 A;  4C56 C;  1RCV D;  2PNR C;  2XWJ B;  1EFW A;  1I6H B;  1A2T A;  2PQE A;  3QR8 A;  3PUV A;  2WII B;  3H94 A;  2VQF L;  2CWA A;  4DR6 Q;  2NTT A;  1MKH A;  3QG1 A;  2LMC B;  3CCQ A;  4UAI A;  3PQI A;  4IUT A;  3I4O A;  5E3F A;  1V1P B;  1K0S A;  4L5Q A;  3S1M H;  4DV5 L;  4K6D A;  1MSH A;  1TR5 A;  1O7I A;  2Z6K A;  3QB3 A;  1CM9 A;  4WJ3 M;  1ICF B;  1B50 A;  4YY3 L;  1WTQ A;  5EKI A;  2EYH A;  1LTS D;  5C0X G;  1PH1 A;  2ID0 A;  2XIW A;  1Y1W H;  1AH9 A;  1Y8N B;  1ASZ A;  3T4A C;  4KJN A;  2NZH A;  1PLF A;  4JI1 Q;  3ND8 A;  1WI5 A;  1J5E Q;  2MGS A;  1Y8O B;  5KNB A;  1E2V A;  1PZK D;  3PUW A;  5KRU A;  1E1O A;  1T5X D;  2JA5 H;  4JBJ A;  3D4D A;  4ZLT F;  1C9O A;  2RDG A;  3A8K E;  2EJF C;  4JYA L;  3HOW H;  1FNV A;  3CQZ B;  1XWE A;  3I70 A;  3CCE A;  3EJI A;  1CTM A;  2RSO A;  5IGE A;  4A3D H;  1UE6 A;  1X6O A;  4DR4 Q;  3KK7 A;  3I4M B;  3NBH B;  1VQ9 A;  3S9W A;  4PMB A;  4G7Z C;  3DEP A;  1T9H A;  1V9P A;  4IAL A;  5EBD A;  3TBI B;  2A19 A;  2E75 C;  1LTT D;  2F0U A;  2NVY H;  2R6G A;  2EXZ A;  3I4M G;  1VQH A;  1AW7 A;  5DAU A;  1AZQ A;  2IL8 A;  2LKV A;  5T1I A;  1CQF A;  1BXT A;  3CRL C;  2JN4 A;  1F9R A;  3K5N A;  2C35 B;  1P16 A;  3SK8 A;  4A3F B;  1A15 A;  4YCV A;  5BN4 A;  1I6H H;  4IUQ A;  3I3C A;  1NE3 A;  3ULL A;  4OL7 A;  3OYY A;  1B44 D;  3JAM i;  2OT2 A;  1Q1E A;  1JOR A;  3JAM c;  3D6C A;  2B2Y C;  3NWT A;  4DV6 L;  1I4Q A;  2Z8L A;  3CU7 A;  4GNX A;  4RFB A;  4AH6 A;  5ISR A;  2WKC A;  3LNN A;  1FR3 A;  1TWC B;  3K6O A;  4EQ5 A;  1GD7 A;  4P71 A;  4QUF A;  1LV9 A;  3HKZ B;  4A3M B;  3H3V C;  3SHL A;  1XTC D;  1BOS A;  4RGN A;  1E1T A;  3ERS X;  4ABN A;  3FKI G;  5C0X H;  4K14 A;  4RG1 A;  2HDL A;  5ELB A;  2F03 A;  5I4D A;  2CW0 C;  1X32 A;  1YI2 A;  1G51 A;  1EQT A;  3GTQ B;  1TVX A;  2NN6 I;  2NYZ D;  1EU3 A;  1KL9 A;  3MFY A;  1XMQ L;  2QDB A;  2KCT A;  1ZXT A;  3M3Y B;  3E0E A;  4PG3 A;  3LWU A;  3PUZ A;  4L63 B;  1RTN A;  1GKH A;  5LMN W;  2AQ3 B;  2JA6 B;  1A3V A;  3ERQ A;  3S16 B;  4IUP A;  4YWM A;  5KNC A;  4DV3 Q;  1NMG A;  2CWP A;  4Y7N B;  5C0X J;  3GTM B;  4NXN L;  1DM0 B;  4JI3 Q;  4C3H B;  2Z6K C;  2A6H D;  3K80 C;  4OX9 Q;  1BNZ A;  4DAV A;  4K6L A;  1K28 A;  4IPG A;  3FEW X;  3PIO 3;  1HNX Q;  1UEB A;  4DV0 Q;  1SNP A;  3I4M H;  4R9W A;  1CSQ A;  2PPB C;  3W1B A;  1STH A;  3R93 A;  4DR1 L;  2EYM A;  4B3M Q;  4HJ7 A;  1DZ1 A;  3T1H Q;  2R7F A;  3X3M A;  3TS0 A;  3LGJ A;  2F0D A;  3CF5 A;  2A68 C;  2E2D C;  3HP3 A;  2WAC A;  5IP9 G;  1Q3L A;  1Q81 C;  1K73 C;  2XRS D;  5AFW A;  3FVQ A;  1WYD A;  1L0Y B;  2L0C A;  4JI8 Q;  2EVB A;  4DKA C;  4K5X A;  1D2B A;  4FF1 A;  3TZU A;  1MIU A;  2JK8 A;  4K0K L;  3MZ5 A;  2B2V C;  2MO0 A;  2K75 A;  3VR3 A;  1EYD A;  2DNE A;  3P7J A;  2F1M A;  3FKI H;  4EX5 A;  5IOC A;  1M90 C;  1GHK A;  1NBW A;  1B3Q A;  5CV6 A;  3J81 c;  3OOC A;  2AWN A;  1WD1 A;  3AYH B;  1EQV A;  4KKT A;  1GUO A;  4A75 A;  5IE8 A;  4OO1 I;  1QG7 A;  2F3V A;  3BDC A;  5I2Y A;  1M4V A;  1TWG H;  1Q90 A;  3GTQ H;  1TS5 A;  1PYS B;  1I5F A;  2B8F A;  4GNX C;  1C7Y A;  1SMY C;  2B29 A;  2XTI A;  3CME A;  1EY6 A;  3S16 H;  1FJG L;  5AJ3 Q;  3CHB D;  4RGO S;  4YHH L;  3R2T A;  3GTM H;  3I4N B;  1F9Q A;  4O0A A;  1PMR A;  3ND9 A;  1HZC A;  1KNE A;  1NAP A;  1IBM L;  1KHI A;  1HFN A;  1U0L A;  4I7Z C;  2N49 A;  5IT9 c;  5J22 A;  3STB C;  2HQL A;  1XYI A;  4IUN A;  4S3S A;  1JWS D;  5IP9 H;  1S5D D;  3PUX A;  3HOV H;  1ESR A;  3MTS A;  1DGS A;  2OXP A;  5C3X A;  4LUZ A;  4RGM A;  4KHP Q;  3MXG A;  2JXM B;  1EL0 A;  4ULL A;  5M3M B;  4R1J A;  5FLM G;  1L0W A;  5GRO A;  2VW9 A;  4WFN 3;  3F2C A;  4LF7 L;  4G7H C;  4HCE A;  3BDL A;  3VYS A;  1OXS C;  5M3M G;  1O7Z A;  4OGQ C;  3BZC A;  1KAB A;  5M9O A;  3GTO B;  3Q24 A;  2UXB L;  4HTH A;  2A69 C;  1AFP A;  2UXC Q;  2B2T A;  4JBK A;  1HA5 A;  3AFP A;  1XJV A;  3Q22 A;  2FHT A;  1RL2 A;  1XNR L;  3OW7 A;  1KIX A;  4BXX G;  3RMH A;  1GHJ A;  3E3X A;  3D6W A;  4IZ8 A;  1K8G A;  1SYD A;  4EQO A;  5FK9 C;  2IY5 B;  4LNQ A;  1X65 A;  1TU2 B;  1B8A A;  1PFM A;  3A56 A;  4DUZ Q;  1DOK A;  2JA7 B;  3WDN A;  2G9D A;  3S17 B;  1GUW A;  1FNW A;  4JV5 L;  1L2F A;  4KK7 A;  4R4O A;  1WD0 A;  2PNH A;  1WOC A;  2E5L L;  5CV9 A;  1H95 A;  2NN6 G;  2CH4 A;  1A8V A;  1G91 A;  4QF4 A;  2WB1 E;  3OMC A;  2EY5 A;  4HSV A;  2WB1 G;  4I65 A;  2RSN A;  4DR5 L;  1VQP A;  3S2H B;  2D0O A;  5JJI A;  2DNC A;  2JE6 I;  5LL6 S;  3UDF A;  4BBS B;  1FGU A;  4TQU S;  3BDO A;  2BDN A;  4GN3 B;  2KBN A;  3WOF A;  1NSN S;  3I72 A;  5D3I B;  1VCI A;  1EY8 A;  4LF4 L;  1VQD A;  4TVA B;  5FLM H;  4BBS G;  3UDG A;  4NDX A;  4NXM Q;  1Q82 C;  4DXG A;  4DK1 A;  1TXY A;  1VQB A;  3QJY A;  1IKL A; 
#chains in the Genus database with same CATH homology
 4PQX A;  2KEE A;  2LS0 1;  3OSO A;  3C2P A;  1BR9 A;  1KLU D;  4EQP A;  4LAA A;  4DU9 A;  2R92 B;  5FLX L;  4EVO A;  5C4J B;  1E2Z A;  5IIF A;  3BG3 A;  4ID6 A;  5A2Q L;  5JPN C;  2M2L A;  5DNF A;  3OMG A;  1SJH D;  1XX8 A;  2O4X A;  5C0X I;  1PRT F;  1B4O A;  1ENA A;  3MXP A;  4CHT B;  2QF7 A;  1PDQ A;  1NR2 A;  2R93 B;  1LTA D;  1LTG D;  4EGV A;  2VB3 X;  1H9S A;  4AYB B;  2SNM A;  4CKB A;  1XXG A;  5FO7 B;  1JE4 A;  4BY1 B;  3OIP A;  2F0I A;  3TP7 A;  2ZXO A;  1WTV A;  3A7A B;  1PZJ D;  2B2T C;  2NN6 H;  1T5E A;  3MXN A;  4A93 B;  2F0V A;  1EIG A;  3JAM E;  1DYQ A;  2F0O A;  1TS4 A;  5DEH A;  1RKN A;  1HUN A;  4K2K A;  1O78 A;  5KIX A;  2F0H A;  1SYB A;  2EY6 A;  1F2M A;  1W6K A;  1PTO F;  2PZU A;  4KJO A;  4NW2 A;  3T56 B;  4TSS A;  3MAQ A;  2B8G A;  1TII D;  3O13 A;  4DF7 A;  1ILP A;  4X3U A;  2PO4 A;  1ET6 A;  3BYY B;  1PYW D;  3PMF A;  4ODG A;  3DM1 A;  3A7L A;  3S14 B;  4NMZ A;  1WTX A;  3VR6 A;  2CQA A;  2F4I A;  2KVM A;  4QMG A;  1ONL A;  3MFG A;  1SEB D;  2L55 A;  1HCZ A;  5IGF A;  2EYO A;  1PTO C;  2KQ3 A;  3NK9 A;  3RZO B;  2Z4H A;  3GTP B;  3HOX B;  2ENB A;  2EJM A;  3FPU B;  3K5O A;  4HSP A;  2KOL A;  3S1N B;  2XWB B;  3V2T A;  3HG9 A;  3M7N A;  3NE5 B;  4MHE A;  1ICW A;  1S5B D;  4M1U B;  1RF2 D;  3M85 A;  1EEF D;  1LTR D;  4KHV A;  3EVQ A;  3MEH A;  3D4W A;  4TRD A;  3IAY A;  1CZG A;  5CYU A;  3W3A A;  3TN2 A;  3J81 E;  2H1E A;  2ZXR A;  1STE A;  1V8Q A;  1BUV T;  1YNJ C;  2N88 A;  1EU4 A;  4C3I B;  3T16 A;  3NUC A;  1MBY A;  4QB4 A;  2NVT B;  4CKE A;  1X3P A;  2AUJ D;  4K8I A;  4KD3 A;  1AEX A;  4FF3 A;  1E2W A;  1I4P A;  1TY0 A;  4WOR A;  3J7A F;  2MPM A;  3BS1 A;  4FO2 A;  2M9V A;  2D62 A;  2KED A;  5CV5 A;  4A3G B;  2GA4 B;  2AWO A;  1B9M A;  5EPJ A;  5IT9 E;  2J0T D;  1SFO B;  4MN3 A;  1Q1B A;  2PCF B;  5M5X B;  2IX0 A;  3NPP A;  2DY8 A;  1LAB A;  2BE5 C;  3A8J E;  3KF8 A;  2F0K A;  4XQQ A;  3U9O A;  1C48 A;  2F0S A;  4P2C B;  4KV6 A;  3CKI B;  2R3Z A;  2QCP X;  3HOZ B;  2K03 A;  4A3B B;  3MC0 B;  4KKU A;  4QCL A;  1VDZ A;  2NZ1 D;  3AU7 A;  3E6Z X;  1C4Q A;  1PZI D;  2L11 A;  4K5V A;  1U4M A;  4RA8 A;  2QEJ C;  4L8J A;  4DNR B;  1B2T A;  2EYJ A;  5CV4 A;  5FKA C;  2Z1C A;  3K5L A;  1BCP F;  3BVG A;  4DGZ A;  1S5C D;  3FMC A;  3NTI A;  5EPL A;  1CA6 A;  2EPB A;  4OIJ A;  4V0B A;  5IGB A;  1ESF A;  3KLR A;  4JBW A;  2K28 A;  4A3J B;  5IGD A;  2QKI C;  1I3Q B;  1SBB B;  3K59 A;  2PZT A;  1YNN C;  3OIQ A;  2WAQ B;  1U9R A;  2NB0 A;  4MIU A;  4IUU A;  1G6Z A;  3D3R A;  3GTJ B;  3M4Y A;  2A6E C;  3I73 A;  4ILW A;  5EJW A;  3BVM A;  3I8Z A;  2PZW A;  1FD7 D;  1TWH B;  4V19 0;  1BCP C;  1J9O A;  1MD2 D;  2EY1 A;  1NR4 A;  1JWU D;  2IT1 A;  5CMD A;  1F9S A;  4IUR A;  5KYI A;  4C1N K;  1EOT A;  3PV0 A;  1D6E C;  1Q8I A;  2KUM A;  2JYO A;  1CA5 A;  2BCO A;  3MA2 B;  3X3N A;  4XT1 B;  1EWC A;  1HQR D;  1STB A;  2N55 A;  4FVM A;  1FGB D;  1B3A A;  4E6I A;  4KY5 A;  1DCZ A;  2KJX A;  1PRT B;  3TSS A;  3NTK A;  1HHV A;  3NWS A;  3SEB A;  4PMW A;  1OXU A;  2FMM A;  2I46 A;  4ZK9 B;  2BOS A;  3N6R A;  4C2M B;  1CT1 D;  4A3I B;  5EGT A;  3HS0 C;  1SSO A;  4CJ0 B;  3N52 A;  3KLS A;  4C3H G;  4DAY A;  2TSS A;  5JVH 3;  3VR5 A;  1CHP D;  1RHP A;  2HUG A;  4B9X A;  1SYG A;  3I91 A;  4HN7 A;  5ELC A;  4C1N I;  3DUZ A;  1B1Z A;  3M7G A;  1A3U A;  5LL6 X;  2I07 B;  2K33 A;  2RA4 A;  4G57 A;  1Q12 A;  1Z6H A;  1SNQ A;  3H0G B;  3OHX C;  3VYT A;  5IGG A;  1UEA B;  1CFM A;  4DNT B;  4HR7 B;  4GZY C;  3NXW A;  1AN8 A;  4KN7 C;  1G2S A;  3MVV A;  4RWS C;  1JOK A;  5C4H A;  4ZAI A;  4XXE A;  1V1P A;  1X3Q A;  1F2Z A;  1NCV A;  5IGC A;  2O5I C;  3NSW A;  4H0L C;  1WTP A;  4FP5 D;  1EY7 A;  1RTO A;  1S5F D;  3G7L A;  2LFN A;  1ZYR D;  5JVG 3;  4CKC A;  4A3K B;  1EZ8 A;  1CZW A;  1IW7 D;  1MGS A;  4NKL A;  2VXW A;  1AZP A;  3ERO A;  4BY7 B;  1W6J A;  3K0Y A;  2E76 C;  5DM7 3;  5DM6 3;  3PUY A;  1JWM D;  3C3L A;  3T13 A;  3NBH A;  4UDU C;  1OXT A;  2D9U A;  5C6A A;  2NWG A;  1HA6 A;  1GUN A;  1R4Q B;  3ZYY X;  1MI2 A;  2IWH A;  2FFK B;  1IL8 A;  4H44 C;  5E4W C;  3L7Z C;  1I50 B;  3SR1 A;  3RZD B;  1BBX C;  5JOB A;  3U9S A;  4RKL A;  5ELD A;  1TWF B;  2A6H C;  2MP1 A;  4N9T A;  3RLF A;  1H9M A;  1C8C A;  1O7Y A;  1Y8P B;  4DK0 A;  1EFI D;  5JEA G;  1SE4 A;  3URY A;  1SNM A;  4KTA A;  2L9H A;  1BQQ T;  1II3 A;  5CBA E;  4H7B A;  5G3L D;  3GTK B;  3NP8 A;  4BA1 I;  1WTW A;  3MXU A;  2L12 A;  3KUP A;  3LX0 A;  1PRT D;  1A3T A;  1QNK A;  2JEB I;  2HDM A;  2HCC A;  3K58 A;  2VUM B;  2RVL A;  2Z4I A;  2WP8 J;  1O80 A;  5FO9 B;  2E2J B;  2J7Z A;  4IQZ A;  3RD4 A;  4KHZ A;  1S5E D;  3Q23 A;  3VA5 A;  2KCC A;  4BS9 A;  2B2U A;  2B2W A;  3OWE B;  2X69 A;  1QJO A;  4ZRZ A;  1DJR D;  4FXK C;  2NBF A;  1B9N A;  3A54 A;  1DOM A;  4Z9C B;  1KDC A;  3IKJ A;  1L0X B;  1TS3 A;  5ELF A;  4YIJ A;  5JEA H;  1BCP B;  5A35 A;  4RCN A;  2PMZ B;  4LJZ C;  3P1H A;  1U4P A;  5JAV A;  5D65 A;  4RKB A;  3ITP A;  3J80 L;  4BWG B;  5CC4 A;  3HOU B;  1SDF A;  4B9W A;  2AQ2 B;  4JK1 C;  5JEA J;  1I4R A;  1K8O A;  4X3S A;  4DA2 A;  5C3E B;  4DAP A;  1TWA B;  3QWN A;  5CBE E;  2LY7 A;  2PW7 A;  5HUR A;  1TS2 A;  2ICE C;  3DXJ C;  1QE6 A;  4J6H A;  3I4L A;  2RQX A;  4IFD J;  1VF5 C;  3TZD A;  3M4O B;  5BN5 A;  1SXT A;  2R7Z B;  1F77 A;  1LT4 D;  1DON A;  2V4D A;  4K5W A;  1PFB A;  5BN3 A;  1B53 A;  3GO5 A;  4K2L A;  3GTG B;  1HPC A;  1IYV A;  2L1B A;  4CJ2 C;  2KHS A;  1SYC A;  3S2D B;  1IYU A;  3K5M A;  5EKK A;  2BA1 A;  3H6M A;  2ICI A;  2RDH A;  1EY0 A;  1SE2 A;  2B2U C;  3K7A B;  2B39 A;  2B2W C;  1SYF A;  4R8I A;  3KBX A;  2XRQ D;  3EQL C;  4FXG C;  2Q8T A;  3FPP A;  3HZX A;  1ML0 D;  3Q6S A;  2ZT9 C;  2RDF A;  2VNU D;  2AQ1 B;  4G4K A;  5ELE A;  3TP8 A;  1EY9 A;  3DWQ A;  3K57 A;  1JIC A;  3S1M B;  2EE1 A;  1AP0 A;  4KMU C;  2RKS A;  4DN4 M;  1Z7T A;  2OEO A;  3NTH A;  4ZUJ A;  3NHH A;  2BA0 A;  5C5M A;  2IW3 A;  4QUC A;  1STG A;  3OWF A;  1Y1W B;  2VB2 X;  3DEO A;  1SAP A;  2F0N A;  4O1N A;  2MJ8 A;  5KYL A;  1GUT A;  1KDA A;  2E74 C;  3FRP B;  5J1Z A;  2JP1 A;  2SEB D;  2Y0S B;  4HMI A;  4C3I G;  3T51 B;  5EPK A;  1F9P A;  3SXH A;  1D5M C;  1CQV A;  3VYR A;  3Q0A A;  1EY5 A;  1O7L A;  2CW0 D;  3DMU A;  2A5H A;  2DY7 A;  3T53 B;  1FNU A;  3SDZ A;  2K04 A;  2HQE A;  3TP6 A;  2X6L A;  1JCK B;  2XNA C;  1JB3 A;  1STY A;  3AMU A;  1JOQ A;  1LTB D;  1CK1 A;  3AB9 A;  2QIL A;  1JQY D;  3DWP A;  1ET9 A;  4Q5V A;  4KY7 A;  2O5J C;  1CHQ D;  2R61 A;  2WV6 D;  2E2H B;  2F3W A;  3QOL A;  4H13 C;  4PV1 C;  5I2X A;  1DOL A;  3P75 A;  5I9O A;  5J39 A;  2K7V A;  5TSS A;  2AUK A;  2G9H D;  2JSO A;  5E4X A;  2EY2 A;  4ZQ3 A;  2A73 B;  5M5W B;  4R8N A;  1OXX K;  1HTP A;  2A68 D;  5CV8 A;  5D14 A;  4U67 3;  3C46 A;  1JR0 D;  1MSG A;  1G29 1;  2BDO A;  1SJE D;  2X6G A;  1G8Z D;  1EYA A;  3QOJ A;  1LT3 D;  3FDT A;  3BZD B;  2L4N A;  4F87 A;  1KNA A;  1LO5 D;  2PYK A;  2RBM A;  1WTO A;  2J4X A;  4U68 A;  3A55 A;  1OO9 B;  1GOZ A;  2EYL A;  1RJT A;  1S4Z A;  3NBI A;  5M3F B;  4DFA A;  2B2V A;  4O42 A;  3SK4 A;  2EYP A;  2WKD A;  1STN A;  1SE3 A;  4IFD I;  4FNF A;  2C5C A;  1I4H A;  1SND A;  1QIL A;  2NTS A;  1SMY D;  3J81 L;  5E1F A;  2K6A A;  1JOO A;  2F0P A;  5I6W A;  4NP5 A;  2IX1 A;  1RDP D;  2DN8 A;  2C9O A;  4ZYS A;  4CBV A;  3FKI B;  2MHV A;  2M00 A;  2H4O A;  2NUC A;  1OXV A;  3H91 A;  5T1G A;  4M8A A;  3J7A V;  4XYO A;  2Q8R E;  2B63 B;  1ENC A;  4X3K A;  1ZEQ X;  1TWG B;  2KCN A;  3ONA B;  3C1F A;  2E2I B;  4KKS A;  3I90 A;  5IT9 L;  2EOT A;  3GD7 A;  3WOE A;  3PO3 B;  1EY4 A;  5K36 G;  2K5W A;  3S1R B;  4FF2 A;  4F8M A;  2FIN B;  2YU9 B;  2HCI A;  4KD4 A;  2SOB A;  2D2C C;  2A69 D;  3LWE A;  5KGU A;  4J8Q A;  2XSC A;  2FMC A;  3SVM A;  1TY2 A;  3HOV B;  4L6T B;  1PTO B;  2K5Q A;  5C44 B;  5KND A;  1F2Y A;  2EDG A;  5CV7 A;  2CHB D;  1WTR A;  1HXY D;  1EEI D;  3QO2 A;  4FXD A;  3EA6 A;  4KN4 C;  4LK1 C;  4XT3 B;  5CR3 A;  1HQM C;  1ROD A;  4K8J A;  5JPM C;  1HTL D;  1UNS A;  3V96 A;  4ZKC B;  1UUP A;  1H9S B;  1WVL A;  4HAE A;  4CGY B;  3EFX D;  5K36 H;  3E5S A;  4XTC S;  1GJX A;  4XYQ A;  5FLX E;  4X3T A;  1BO0 A;  4PMC A;  1CI3 M;  2K01 A;  5A2Q E;  1V1O A;  1SNC A;  1EWH A;  1R4P B;  1E0B A;  5EBC A;  2F0T A;  3J80 E;  3MHB A;  1DXM A;  3MWY W;  1G2T A;  1D5X C;  2IPK D;  3NQI A;  4IUV A;  2O2L D;  4F88 A;  5CGK A;  3L3O C;  1KLG D;  2EJG C;  4RGT A;  1KTK A;  4XQJ A;  2F0E A;  1D5Z C;  1SNO A;  1PTO H;  4XDX A;  1STA A;  1GUG A;  4HMJ A;  4RAU C;  1M8A A;  1HUM A;  3UI2 A;  5C4Z A;  5COR A;  1J8I A;  3VA7 A;  4Q0F A;  4RHS A;  4BBR B;  1I4X A;  1SYE A;  1UAP A;  4IFD G;  3IL8 A;  2F0M A;  2IJ0 A;  3R8B A;  4CJ1 B;  4A3E B;  2JA8 B;  3DWA A;  3E0J A;  2ZXP A;  3C1E A;  3KLS X;  1KDB A;  3W2D A;  4N9P A;  2IX3 A;  2PW5 A;  5IOD A;  3DHQ A;  4C3J B;  3R2I A;  4RH6 A;  1QNU A;  2XN9 C;  2WB1 B;  4HCS A;  1ILQ A;  1IKM A;  5FOB B;  2KEC A;  3RUZ A;  4C3J G;  1QCB D;  1DD2 A;  3QIA A;  1PFN A;  1ZYR C;  1PTO D;  1EIH A;  5NUC A;  2F0W A;  1GUS A;  2SNS A;  2TMP A;  1IW7 C;  3P20 A;  1D1I A;  2NVX B;  2F0J A;  1D1K A;  1VF7 A;  3TP5 A;  5LHY 1;  3D8G A;  1Y69 U;  3TDQ A;  3HGB A;  2KA7 A;  1U4L A;  3IFD A;  2NVQ B;  1JC7 A;  1TT2 A;  1VMC A;  4OHJ A;  1I6V C;  5D3D A;  4ZKB B;  3HEJ A;  4EQN A;  4IFD H;  3S1Q B;  5G3L F;  4KI0 A;  1A6X A;  1EZ6 A;  1RD9 D;  1Y1V B;  5C3W A;  4B08 A;  1TKW B;  1YNJ D;  3NQT A;  4LMQ D;  3D4R A;  1V43 A;  3GTL B;  3G6J B;  3VR2 A;  4XIG S;  3KBG A;  3BYT B;  4F7X A;  2SDF A;  3GP7 A;  1H9K A;  3BVZ A;  5HGT A;  2CVR A;  1I4G A;  5KEE A;  1IHZ A;  3V05 A;  1QOH A;  4WJW A;  2MUY A;  4TKO B;  2EZV A;  3PO2 B;  4OO1 G;  4XQN A;  1LTI D;  4RHR A;  3J7Y W;  1BDO A;  3SK6 A;  3A8I E;  1FYC A;  1PRT C;  4WRD A;  2XVS A;  1HRJ A;  1WCM B;  4FYD A;  2F0Q A;  4DXF A;  1GXD C;  3F2U A;  4FF4 A;  3S15 B;  5COY A;  3H09 A;  2BE5 D;  1TQO A;  3IFT A;  1R9T B;  1PXU A;  4IN3 A;  2K32 A;  1ENF A;  3GV6 A;  1ZKO A;  3TME A;  4QIW B;  1LLR D;  2F0F A;  2Q8I B;  1F2L A;  4PNY A;  5K5P A;  5I9P A;  5I6Y A;  1LAC A;  2F0L A;  4ME5 A;  3VYU A;  1H9J A;  2OF1 A;  5JJZ A;  1LT5 D;  3HRZ C;  2JEA I;  5EQ0 A;  4J1M A;  1EYC A;  2K1B A;  4ZUI A;  4G7O C;  4OO1 H;  1YNN D;  2A74 C;  2L5T A;  3GQB A;  1KAA A;  3CRK C;  2F0G A;  2K5D A;  1BF4 A;  3HOY B;  4BA2 I;  1QWY A;  2A6E D;  2D5D A;  2YYZ A;  2FJ2 A;  3GV3 A;  4RCO A;  2JA5 B;  4KY6 A;  4HED A;  5FO8 B;  2K05 A;  5EKL A;  3HOW B;  3OPO A;  3R3O A;  1A2U A;  5C5L A;  1HFG A;  1K83 B;  4OIK A;  1BCP D;  4A3D B;  5F2D A;  1QB5 D;  3D31 A;  1NUC A;  3SK5 A;  1VMP A;  3PIP 3;  5C4X B;  2B2Y A;  1U4R A;  1Z47 A;  2EYF A;  2NVY B;  3JAM L;  1K8M A;  2WIN B;  3VR4 A;  1LT6 D;  3L9A X;  1H9R A;  5M5Y B;  3SE0 A;  4C56 C;  1RCV D;  2PNR C;  2XWJ B;  1I6H B;  1A2T A;  2PQE A;  3PUV A;  2WII B;  3H94 A;  2NTT A;  3QG1 A;  2LMC B;  4UAI A;  4IUT A;  5E3F A;  1V1P B;  4K6D A;  1MSH A;  1TR5 A;  3QB3 A;  1CM9 A;  1B50 A;  1WTQ A;  5EKI A;  2EYH A;  1LTS D;  5C0X G;  2ID0 A;  2XIW A;  1Y8N B;  3T4A C;  4KJN A;  1PLF A;  3ND8 A;  2MGS A;  1Y8O B;  5KNB A;  1E2V A;  1PZK D;  3PUW A;  5KRU A;  1T5X D;  3D4D A;  4ZLT F;  2RDG A;  3A8K E;  2EJF C;  1FNV A;  3CQZ B;  1XWE A;  3I70 A;  3EJI A;  1CTM A;  2RSO A;  5IGE A;  3KK7 A;  3I4M B;  3S9W A;  4PMB A;  4G7Z C;  3DEP A;  4IAL A;  5EBD A;  3TBI B;  2E75 C;  1LTT D;  2F0U A;  2R6G A;  2EXZ A;  5DAU A;  1AW7 A;  1AZQ A;  2IL8 A;  2LKV A;  5T1I A;  1CQF A;  1BXT A;  3CRL C;  1F9R A;  3K5N A;  3SK8 A;  4A3F B;  1A15 A;  5BN4 A;  4IUQ A;  3I3C A;  4OL7 A;  1B44 D;  2OT2 A;  1Q1E A;  1JOR A;  3D6C A;  2B2Y C;  3NWT A;  1I4Q A;  2Z8L A;  3CU7 A;  4RFB A;  5ISR A;  2WKC A;  3LNN A;  1FR3 A;  1TWC B;  3K6O A;  4QUF A;  1LV9 A;  3HKZ B;  4A3M B;  3H3V C;  3SHL A;  1XTC D;  1BOS A;  4RGN A;  4ABN A;  5C0X H;  4K14 A;  2HDL A;  5ELB A;  2F03 A;  5I4D A;  2CW0 C;  1X32 A;  1EQT A;  3GTQ B;  1TVX A;  2NN6 I;  2NYZ D;  1EU3 A;  3MFY A;  2QDB A;  1ZXT A;  3M3Y B;  3LWU A;  3PUZ A;  4L63 B;  1RTN A;  2AQ3 B;  2JA6 B;  1A3V A;  3ERQ A;  3S16 B;  4IUP A;  5KNC A;  4Y7N B;  5C0X J;  3GTM B;  1DM0 B;  4C3H B;  2A6H D;  1BNZ A;  4DAV A;  4K6L A;  3FEW X;  3PIO 3;  1SNP A;  4R9W A;  2PPB C;  1STH A;  3R93 A;  2EYM A;  1DZ1 A;  3X3M A;  2F0D A;  2A68 C;  2E2D C;  3HP3 A;  2WAC A;  1Q3L A;  2XRS D;  5AFW A;  3FVQ A;  1L0Y B;  2L0C A;  2EVB A;  4K5X A;  1D2B A;  4FF1 A;  3TZU A;  3MZ5 A;  2B2V C;  3VR3 A;  1EYD A;  2DNE A;  3P7J A;  2F1M A;  5IOC A;  1GHK A;  5CV6 A;  3OOC A;  2AWN A;  1WD1 A;  1EQV A;  4KKT A;  1GUO A;  4OO1 I;  1QG7 A;  2F3V A;  3BDC A;  5I2Y A;  1M4V A;  1Q90 A;  1TS5 A;  2B8F A;  1SMY C;  1EY6 A;  3CHB D;  4RGO S;  3R2T A;  3I4N B;  1F9Q A;  1PMR A;  3ND9 A;  1KNE A;  1NAP A;  1HFN A;  4I7Z C;  5J22 A;  1XYI A;  4IUN A;  4S3S A;  1JWS D;  1S5D D;  3PUX A;  1ESR A;  3MTS A;  2OXP A;  5C3X A;  4RGM A;  3MXG A;  2JXM B;  1EL0 A;  4ULL A;  5M3M B;  4WFN 3;  4G7H C;  4HCE A;  3BDL A;  3VYS A;  1OXS C;  1O7Z A;  4OGQ C;  3GTO B;  1KAB A;  5M9O A;  3Q24 A;  4HTH A;  2A69 C;  1AFP A;  2B2T A;  1HA5 A;  3Q22 A;  2FHT A;  3OW7 A;  3RMH A;  1GHJ A;  3D6W A;  4IZ8 A;  1SYD A;  4EQO A;  5FK9 C;  1TU2 B;  1PFM A;  3A56 A;  1DOK A;  2JA7 B;  3WDN A;  2G9D A;  3S17 B;  1GUW A;  1FNW A;  4KK7 A;  1WD0 A;  5CV9 A;  2NN6 G;  1G91 A;  4QF4 A;  2EY5 A;  4I65 A;  3OMC A;  4HSV A;  3S2H B;  2RSN A;  2DNC A;  2JE6 I;  5LL6 S;  4BBS B;  4TQU S;  3BDO A;  2BDN A;  3WOF A;  1NSN S;  3I72 A;  5D3I B;  1VCI A;  1EY8 A;  4NDX A;  4DXG A;  4DK1 A;  3QJY A;  1IKL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...