1XNRQ

Crystal structure of an inosine-cytosine wobble base pair in the context of the decoding center
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
104
structure length
104
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSKRGGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S Ribosomal RNA
publication title Structure of a purine-purine wobble base pair in the decoding center of the ribosome.
pubmed doi rcsb
total genus 20
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2004-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1xnrQ00
1A62A 2IX0A 5IYDG 2N8NA 4A3MH 2Z0SA 1K3RA 1KQSA 4BBSG 1GVPA 4JI8Q 4A3GH 1I6HH 1X65A 3GTGH 3S14H 1EQQA 4R1JA 2AWNA 2K4KA 4UP7A 5GROA 4BY1H 1Y1WG 4A3LH 2CFMA 2KCMA 5IP7H 4HJ7A 4B3SL 4LWCA 2ZM6L 1CKMA 5C44H 1MJCA 4H02A 3S1NH 1YHAA 3A74A 4C3JH 1EYGA 1I94Q 4DK3C 3M9BA 5IP9H 5HGQA 2VW9A 1HNZL 1JJCB 2RCNA 2KHJA 4LF7Q 4PZ6A 1VQNA 4J15A 4APVA 5K36G 1W3SA 1YHBA 3CCSA 2N78A 4NXML 2VS1A 2PQAB 3GO5A 1IBLQ 4UP9A 2R92G 1S3OA 1UE6A 4Y52H 4DV2Q 1E3PA 4A3JH 3M4OH 3W1GA 2I0QA 3I4OA 2VY3A 3RNUA 3ERSX 3TREA 1XMOQ 3HOXH 4DR4L 5FLMH 3EBEA 5IE8A 3GD7A 4DR3L 3AEVA 1PA6A 1L2FA 4DKAC 1N36L 2XGTA 4LF4Q 4GOPB 4BY7G 4IOCA 5IWAL 1IBMQ 1JT8A 1UEBA 3D0FA 3TEHB 5M5WH 5IYCG 5GAEC 4IFDJ 4WJ4A 1A63A 4JI4L 2Y0SE 1T9HA 5C0XI 4GOPC 2XTIA 2OQ0A 3S2HH 3CAMA 4YWMA 1IZ6A 3S24A 1QVGA 4DUYL 1Q1BA 4HJ8A 4LFCQ 4BBRG 4LNQA 4UY8C 2N3SA 1HJPA 1Y1VH 4DUZQ 3T1HQ 1HR0L 4LF6L 1VQEA 1PH4A 1B70B 2ATWA 2UUCQ 1FVIA 4A3MG 1XJVA 1X9NA 1OXUA 1BBUA 1TWHH 2D0OA 2NZOA 2JEBI 4BY1G 2PNHA 1Y14B 3H0GG 4LW1A 5GADC 3TS0A 3S1QH 4A3LG 3I56A 1ASYA 4Y7NH 1V43A 1VQCA 2BH8A 1TWCH 4QY7A 1VQ9A 1VQHA 3M85A 3K7AH 5IP7G 2Y0SG 2CCZA 2H5XA 2LXJA 3UE0A 4C3HH 5C44G 5LMNL 1E1TA 2ASBA 4JI1Q 1Q82C 1HNWL 3H3VI 3L2PA 2IT1A 5IP9G 4B3RL 1X6OA 5C4XH 4JYAL 3HOWG 1YEZA 1C0AA 4JG2A 4IO9A 4OX9L 3DLLA 3PUXA 4B3SQ 2ZM6Q 1QZHA 4X64L 3TS2A 3L7ZC 4IOAA 4JBMA 3BJUA 1I3QH 4PZ8A 2BH2A 1YVCA 2VUMH 3KFUA 2OQKA 4A3KH 2UUBL 2UXDL 1XNRQ 1HNZQ 4A3JG 1VQBA 1VQOA 2JE6I 3CC4A 1SFOH 4YCVA 2IHFA 3U4VA 1ASZA 2JA8H 3CD6A 3HOXG 4A93H 1WYDA 1PH1A 1I50H 1TWGH 1VQ6A 3PCOB 1P8LA 4NXMQ 2Q2HA 3H3VH 3PUYA 1SE8A 3RN2A 4DR7Q 3M4PA 1JJGA 4EQ5A 3GTMH 3FP9A 1LUZA 2BA0A 3PO2H 2UU9L 4IFDI 3KJOA 2F52A 3CCJA 4DV4Q 3PO3G 2KHIA 4QJFA 4TVAB 1WFQA 4DR4Q 3UE1A 3F2CA 5IYBH 4DR3Q 1O7IA 1N36Q 2VL6A 1XMQL 2R93H 1Y1VG 4POGA 4LF5L 1K83H 2KENA 1HZAA 1Q86C 4OWWB 1CUKA 4R4IA 1KIXA 1OTCA 1IXRA 4JI4Q 3CW2C 3PUVA 2VZAA 1DGSA 3CPWA 4P71A 4DUYQ 3S1MH 3BZKA 3NELA 4KLKA 4MTNA 3GDEA 1HR0Q 1N34L 4LF6Q 3A5UA 1YHQA 4QGUA 5C0XG 1XPOA 2MO1A 1MJEA 3DM3A 1QVCA 5M3MH 5GAHC 3G4SA 1NJIC 4JI7L 3ICEA 3FKIH 4O0AA 4AQYL 1G291 1QVFA 4IPCA 1P16A 1GKHA 2E2HH 1WI5A 5E7NA 1QZGA 4LUVA 1E1OA 3OTOL 1FJGL 1XNQL 4DV5L 5C4XG 1Q7YC 2K75A 4JV5L 1SN8A 2OTJA 4JI5L 2ZJPA 1SR3A 4B3TL 3CCUA 1AE2A 3KLWA 4NB3A 4DV1L 4LFBL 3JAMi 1XPUA 2NN6I 5ELNA 4UP8A 4YHHL 2V1CC 5LMNQ 2WAQE 1W2BA 2R7FA 3K80C 3PUWA 2ZTCA 3H0GH 4NXNL 1HNWQ 1N32L 2Z6KA 2VUMG 3KF6A 4A3KG 1OXXK 2DUDA 4B3RQ 2F4VQ 4JYAQ 2KCTA 2YV5A 1E7ZA 3I7FA 1KAWA 1UE1A 2B29A 4MZ9A 4OX9Q 5BR8L 2JA8G 1E22A 1B8AA 4A93G 1Q1EA 4X64Q 1FL0A 3BU2A 1OXVA 4IPDA 4TQUS 4C2MH 4DR5L 1PH5A 4JI3L 2QA4A 4A3IH 1HH2P 1X55A 1JB7A 2VNUD 3UDXA 4ME3A 1GO3E 2UUBQ 2UXDQ 3PO2G 4A3CH 2HIXA 5FJ8H 3HOWH 4DR1L 3GTKH 1XTDA 4QL5A 4DV6Q 2A19A 3B6YA 4GN5A 2QGQA 3E9IA 3UDFA 5IYBG 1VQ5A 2WAQG 4DV3L 1VQIA 4HJ9A 1PH9A 1Q12A 1KL9A 2RF4A 2JEAI 3ULLA 4YCUA 2R93G 4JI6L 1CSQA 1CSPA 1VQDA 2YYZA 2UU9Q 3GTLH 2PMZE 4BA2I 4X66L 4GLXA 1GD7A 1KHIA 5LMNW 2GVBA 2OTLA 1K8GA 4AH6A 4KHPL 2R7DA 1YIJA 2K5NA 2JJQA 1XMQQ 4DNIA 1JE5A 1VS0A 1HNXL 4IFDG 3U58A 1SRUA 4OWXB 2NVYH 2PI2E 4DK6C 4LF5Q 3RR5A 5IT9c 3SGIA 2WFWA 1RIPA 5M3MG 1HZ9A 1NE3A 5C3EH 4PZ7A 2HHHL 3RN5A 1EUJA 3FKIG 3PO3H 5C4JH 1KC8C 1VQFA 4K0KL 3EN2A 4YCWA 2MQHA 3HFZB 2E8GA 3KYHC 3FHWA 4R4CA 4OO1I 3KDFA 1N34Q 1VQKA 4JI7Q 4HJAA 1MIUA 1D8LA 4AQYQ 2DGYA 2NVXH 3OW2A 4A3DH 4GKJL 1UE7A 4L5QA 2NZHA 2JA7H 3CCVA 3U50C 1FJGQ 1XNQQ 5ELOA 4DV5Q 1TWAH 4JV5Q 1BKBA 4JBJA 2ZTDA 3KF6B 4B3TQ 4JI5Q 4LFBQ 4DV1Q 4DR6L 3PIOA 1A0IA 5M3FH 1X56A 4A3GG 4YHHQ 4WJ3M 2EQSA 3J80c 2K5VA 3KOJA 4A3IG 2FXQA 2D62A 3CP0A 3J81j 2E2JH 4NXNQ 1N32Q 1PH6A 2Z6KC 1KXLA 4JI2L 4A3CG 3PV0A 5FJ8G 4L5SA 2NN6G 1N9WA 3PIPA 1YJWA 3I4MH 1CKNA 1R9TH 5BR8Q 2PI2A 4RG1A 2ID0A 3I4NG 4DR5Q 4JI3Q 1N8RC 1K0RA 1U5KA 1JMCA 2WP8J 2NVTH 2UXCL 1B7YB 4IJHA 1YNXA 2K5HA 2YU9H 3F1ZA 1OXSC 4DR2L 3J80i 4DR1Q 1TWFH 4GNXA 4L5RC 3J7ZC 2B3GA 3CCLA 2L15A 3PUZA 1A8VA 3ULJA 4FDBA 4DV3Q 3RZOH 5AJ3L 2JA6G 1RL2A 4JI6Q 3D31A 2JA9A 1PH7A 1VQ8A 3U4ZA 2I5MX 4X66Q 4YWKA 2Q2UA 5C3EG 2A1AA 4GLVB 2ZTEA 1Q8KA 3F8TA 5DLQE 3W1BA 4LF8L 3S2DH 1PHJA 4LF9L 3W5OA 3F2DA 4KHPQ 2EXDA 2QEXA 2HT1A 2Q2TA 1HNXQ 5JJKA 1Z9FA 4R4QA 5IWAQ 4IJLA 4A3BH 1BBWA 1QUQA 3KDFB 4A4IA 1IBKL 2HHHQ 1Q46A 4K0KQ 1H95A 4A3DG 5EAYA 1PH3A 4GKKL 1PVOA 4POFA 3PF5A 2JA7G 3T1YL 2JQOA 1TXYA 2UUAL 3S16H 1NTGA 1X3GA 4PMWA 1VQLA 1NMFA 2B63H 3F2BA 3CC7A 5M3FG 4GKJQ 5H1SE 4OO1G 3EIVA 1EIYB 3LGJA 2I5LX 4C3IH 1D7QA 1YJNA 3CCRA 4HIMA 5JEAJ 3BZCA 5GQOA 3I4MG 2WB1E 4YY3L 4DR6Q 3UDGA 1HZCA 2IHEA 4X62L 3H15A 1CKNB 1KRSA 4EX5A 4DV7L 3J7A5 1M90C 2KBNA 3UDIA 4KI0A 3I4NH 1E24A 4JI2Q 1VQJA 1OXTA 2K14A 5FLXc 4X6AH 3STBD 4A3FH 1CKOA 1M1KC 5JJLA 1YI2A 4LFAL 4GNXB 1V9PA 3JC66 4A76A 1N33L 3G6EA 3G48A 3HOUH 1HR0W 3TRZA 2UXCQ 4HIOA 4JC0A 1SLJA 4DR2Q 5J3BA 3GTJH 2WB1G 4GNXC 4X65L 3STBC 4A3EH 4R4TA 1KRTA 1YJ9A 4OONA 4AYBE 5AJ3Q 3S1RH 4JI1L 3TQYA 3VDYA 4GN3B 1KD1C 4A3BG 2JA5G 1C7YA 4LF8Q 2R7ZH 5JJIA 5M5YH 4LF9Q 1QUQB 1LYLA 1VQAA 4HIKA 2E2IH 2E5LL 1C9OA 4YWLA 4DPGA 1VQMA 2JA6H 2GVAA 3G71A 3GTOH 3PF4A 3E0EA 1VQPA 1IYJB 1I5FA 1XNRL 2B63G 1WJJA 2K52A 1IBKQ 1PV4A 3I55A 1PYBA 1X3FA 3MEFA 2UXBL 2A8VA 4GKKQ 3RLOA 5M5XH 2RHSB 2AWOA 3K8AA 4AYBG 2IX1A 4DR7L 2MNAA 1J5EL 3CCQA 3K81C 3T1YQ 3HOYH 3AYHB 4JOIA 4DV0L 2UUAQ 1VQGA 1Z47A 4JBKA 3HOZH 4DV4L 4A75A 1HZBA 3HKSA 2R6GA 3ER0A 1EWIA 1V1QA 4JI0L 3HOVH 1L0WA 3CF5A 4P73A 3OTOQ 1EIFA 1YBYA 1PYSB 4P74A 2YTVA 3RZDH 2Q2IA 1VQ7A 1YZ6A 2LSSA 1L1OA 2F3IA 4YY3Q 1EQRA 4A3FG 3WWVA 5LMUL 3CXCA 3CCEA 4L5TA 4X62Q 1EFWA 4DV7Q 2YTXA 4IPHA 4NPSA 2VQFL 1G51A 3GTQH 3HOUG 2ZJRA 3M3YH 1K73C 3L0OA 4MNOA 1SROA 3K7UC 1VQ4A 1YITA 1NMGA 1U0LA 1K8AC 3CC2A 2IY5B 4LFAQ 4P72A 3RLNA 3CMAA 2VQEL 4A3EG 4QQBX 1BVSA 2HIVA 3Q8DA 4UPAA 4AIMA 1N33Q 4KHZA 2RHQB 3MXNB 4B3ML 1LTLA 1X54A 2OCEA 4X65Q 1AH9A 2R7ZG 1WCMH 2AHOB 4PG3A 1PH2A 4BXXH 1VCIA 4JI8L 3I2ZA 3NEMA 3OYYA 3RLFA 4IPGA 3E9HA 3GTPH 4OWTB 3ZJYC 3AFQA 2F4VL 2OWOA 1GM5A 3M7NA 3HKZE 3CCMA 2I5HA 5IYDH 2E5LQ 3PSIA 5IY0A 2ZJQA 4BBSH 3M4QA 4LUOA 3HOYG 3A0JA 1Y1WH 1I94L 1LM0A 4GN4B 4DAYB 3HOZG 1J6QA 2C35B 2BA1A 2JA5H 1Q81C 4LF7L 2UXBQ 4DV6L 1EOVA 5FLMG 3NENA 3HOVG 4O2DA 2GN5A 1J5EQ 3KF8B 1K9MC 1SMXA 4DV0Q 3CPFA 4JOIC 1IBLL 3IRBA 4P75A 3CQZH 4DV2L 4HJ5A 5HY6A 1XPRA 3HKZG 4R4OA 3AQQA 1WOCA 1L1OB 1G6PA 1NBWA 1XMOL 2PQAA 2CQOA 1X3EA 1S40A 4JI0Q 2AMCB 2ES2A 5JEAG 2CWAA 1IL2A 4LF4L 2LXKA 3K0XA 3S17H 2YTYA 4GS3A 4LUZA 2R92H 4RMFA 1L1OC 3J81c 1IBML 4JCVE 3AFPA 5LMUQ 2D0PA 2JK8A 4QIWE 4JBWA 2VQFQ 4GOPA 3A5ZB 1AE3A 2N49A 1PFSA 2MO0A 3KJPA 4HIDA 4XIGS 4DAMA 2MFIA 1JJ2A 2ALYB 2CKZB 4XTCS 3JAMc 4BY7H 4LFCL 4GLAC 4DUZL 2HQLA 3T1HL 2K50A 1MKHA 1UE5A 2UUCL 5IYCH 1WCMG 3PGZA 1FGUA 1NY4A 2CWPA 4BA1I 2VQEQ 1S72A 4BXXG 4ALPA 3J81i 1UWVA 5C0XJ 2EIFA 2NVQH 2AKWB 4B3MQ 3CMEA 4OXPA 5GAGC 4BBRH 1PH8A 3ULPA 3S15H 3NBHB
chains in the Genus database with same CATH superfamily
1BF4A 2IX0A 4NP5A 5JOBA 1O7LA 5A2QL 1KQSA 2CW0C 2B2VC 1BCPC 1GUOA 1DD2A 1SYFA 3DWAA 5IP7H 4HJ7A 2ZM6L 3GTOB 2B2WA 1CKMA 5C44H 1MJCA 3S1NH 5I2YA 1EYGA 5HGQA 1KLGD 2ZXOA 4PZ6A 3HOYB 5FO7B 3HS0C 4APVA 3HOZB 1EU4A 1IBLQ 2K6AA 1SXTA 3ND9A 3SR1A 1UE6A 4Y52H 4DV2Q 2IL8A 3W1GA 3HOVB 2VY3A 3ERSX 3TREA 1XMOQ 4DR4L 3A7AB 2FJ2A 3GD7A 4DR3L 3AEVA 2HCCA 4GOPB 1ZXTA 3BDOA 1IW7D 1IBMQ 1JT8A 3BZDB 5C3XA 2I07B 1ET9A 5KRUA 3S24A 4BBRG 4IUNA 2N3SA 1Y1VH 1WD1A 1PH4A 1IW7C 1B3AA 1C4QA 2CH4W 5KIXA 2UUCQ 4OGQC 1JB3A 1HTPA 5CMDA 1EQTA 2JEBI 4A3LG 3I56A 4Y7NH 1V43A 1EIGA 2BH8A 4KV6A 4QY7A 5D3IB 1DJRD 3SK6A 2N88A 3K7AH 4NW2A 2Y0SG 2CCZA 2LXJA 3UE0A 1WVLA 4X3KA 3L2PA 1JOKA 3ERQA 4RCNA 1SNMA 1X6OA 4JYAL 4BBSB 1C0AA 4CJ0B 4IOAA 4JBMA 3BJUA 4PZ8A 1QE6A 4DK1A 3KFUA 4A3KH 1HNZQ 4A3JG 1VQOA 2JE6I 4YCVA 2IHFA 2QEJC 1ASZA 4A93H 3HOXG 5ELDA 3RN2A 3GP7A 1SNOA 3FP9A 4K6DA 3KJOA 3CCJA 4DV4Q 4QJFA 3NQTA 4AYBB 3UE1A 3TP6A 4LF5L 1HZAA 4CHTB 4IUVA 2M00A 1CHQD 4CKBA 1DONA 5M9OA 2EY2A 3CW2C 4ZQ3A 1HCZA 3CPWA 4P71A 3S1MH 3CKIB 1ICWA 4MTNA 1HR0Q 1F9PA 3FRPB 1HUNA 4QGUA 4JI7L 5M3MH 3G4SA 1G291 2NBFA 2A6ED 4IPCA 1P16A 1GKHA 5E7NA 1NCVA 3S15B 2PZUA 3E5SA 1XNQL 4DV5L 2NZ1D 4JI5L 5EKLA 1SR3A 3CCUA 4DV1L 2NN6I 4UP8A 5LMNQ 2R7FA 2A6EC 3PUWA 2PPBC 1N32L 2KCCA 4B3RQ 3KF6A 1OXXK 2F0FA 2KCTA 1QNUA 5C44B 3VYTA 3S1NB 1E22A 4J1MA 4X64Q 4A3GH 3BU2A 1OXVA 4C2MH 5FO8B 2QA4A 2UUBQ 2UXDQ 2EJMA 4DR1L 5M5XB 3GTKH 2XNAC 5C5MA 4DV6Q 4QL5A 4GN5A 1DCZA 2QGQA 1HRJA 3I4NH 3DWQA 2WAQG 4KKSA 5E3FA 4ZUIA 3GTLH 1H9JA 1V1PA 1GD7A 4V0BA 5LMNW 4CKEA 1CA5A 2K5NA 2JJQA 4DNIA 1HNXL 3HKZB 4M8AA 5G3LD 4DK6C 1STEA 3RR5A 5J22A 3SGIA 3U9OA 1NE3A 3GTQB 3RN5A 3EN2A 4YCWA 1K3BC 1Y1VB 3PIP3 2TMPA 4FXKC 3QJYA 3KDFA 1N34Q 4G4KA 1MIUA 4J6HA 2A68D 4AQYQ 4Y7NB 4QMGA 3A8JE 1A2UA 1FJGQ 2J0TD 2LMCB 5ELOA 4JV5Q 3KF6B 4B3TQ 4LFBQ 4DR6L 2A68C 4OO1H 2K5VA 4A3IG 1ENFA 4NXNQ 1PH6A 2Z6KC 5EGTA 5EKIA 4A3CG 2O2LD 2NN6G 4L5SA 4ME5A 1R9TH 1LT6D 4CDCC 3I3CA 1XX8A 2F0IA 4JI3Q 3NTHA 1N8RC 1K0RA 3HGBA 2WP8J 1YNXA 2K5HA 3F1ZA 3HZXA 1YNJD 4K5WA 1OXSC 1X3QA 4L5RC 2RSOA 4HN7A 3J7ZC 2B3GA 2L15A 3PUZA 1A8VA 1V1PB 4FDBA 1I4QA 3NPPA 2JA6G 4CJ2C 3IL8A 4JI6Q 3D31A 5T1GA 1ILQA 2CQAA 1I4GA 4X66Q 4R9WA 3R2TA 1YNJC 5C3EG 2A1AA 4OELB 3W1BA 5FK9C 4LF9L 2QEXA 2Q2TA 1TVXA 1FD7D 3NTKA 2EY1A 5IWAQ 3VYSA 3TBIB 4A3BH 3KDFB 4K0KQ 1CK1A 3S1MB 2IWHA 1PVOA 2JA7G 2JQOA 3S16H 2EVBA 1VQLA 2B63H 1AFPA 3F2BA 1IHZA 1S5DD 5M3FG 3OIPA 4GKJQ 2HDLA 4BBRB 3V05A 1EIYB 1YJNA 3CCRA 4HIMA 5GQOA 3I4MG 1I6HB 3GTGB 5CGKA 5BN3A 3SK4A 4DV7L 2A5HA 2Z8LA 2KBNA 3UDIA 3OMCA 3ND8A 4ZAIA 2ENBA 4JI2Q 2F0MA 1OXTA 4A3GB 4C2MB 3STBD 4H13C 3RMHA 2DJGC 4DNRB 2V4DA 2OXPA 2B8FA 2OT2A 3TN2A 2UXCQ 1L0XB 1F9QA 5J3BA 3I4NB 2NN6H 2K1BA 3STBC 3EVQA 4DFAA 4R4TA 4C1NK 3GTLB 4AYBE 4A3JB 1NSNS 4F8MA 1RTNA 2F3WA 2O4XA 1TT2A 4ABNA 5JJIA 1VQAA 1LYLA 4HIKA 2AUKA 1C9OA 2KA7A 4DPGA 2LKVA 2JA6H 1I4RA 4PMBA 3QG1A 2K01A 1K28A 1GHKA 2L0CA 3RLOA 2RHSB 2AWOA 2SDFA 2MNAA 5J39A 3K6OA 2Q8RE 1C48A 3NE5B 4B9WA 1O78A 4DV4L 1JWSD 1HZBA 2M9VA 3ER0A 1S5CD 1EWIA 1V1QA 3G7LA 5HURA 4JI0L 3CF5A 2ZXPA 3OTOQ 3RZDH 1QJOA 4JVZA 5COYA 4L63B 3CRLC 1D1IA 4YY3Q 2IJ0A 5LMUL 3CXCA 1RHPA 2VQFL 1BBXC 1R9TB 1VF7A 4L8JA 1K8AC 2XWBB 4LFAQ 3CMAA 3RLNA 2IY5B 4A3EG 3Q8DA 2HIVA 3SDZA 2OF1A 3K59A 1LTLA 4X65Q 2Z6BA 5F2DA 1WCMH 2R7ZG 1VCIA 3NEMA 2B2VA 4BS9A 3FDTA 4OWTB 1RTOA 4RGOS 1STAA 1D6EC 3HKZE 1EEID 1DOMA 3BDLA 2ZJQA 4LUOA 3HOYG 1ESRA 1I4XA 4A3BB 4GN4B 3HOZG 1G8ZD 3NSWA 1J6QA 4RH6A 5DAUA 1Q81C 5LL6S 5ISRA 4DV6L 3HOVG 1K9MC 2B63B 4DV0Q 4JOIC 5AFWA 3IRBA 3MWYW 4EGVA 4HJ5A 5CR3A 2L55A 1PDQA 2MJ8A 3AQQA 1IKLA 2PQAA 5IGFA 1ML0D 1X3EA 1S40A 1S5FD 3C2PA 3I90A 3VA5A 4V190 2LXKA 3K0XA 4LUZA 4GS3A 1WTHA 1L1OC 1DZ1A 1M4VA 1LABA 1LTID 3A5ZB 2N49A 1AE3A 1JE4A 1PFSA 2MO0A 4HIDA 4XTCS 2CKZB 4ZK9B 4GLAC 3T1HL 2K50A 1UE5A 3PQIA 1GUWA 5HGTA 1SJED 5BN4A 1SNPA 3J81i 1UWVA 1PTOF 3N52A 2NVQH 2AKWB 4B3MQ 3C46A 4OXPA 5K36H 3QOJA 1BCPB 1FGBD 2F3VA 5IYDG 2N8NA 1K3RA 4BBSG 4JI8Q 1X65A 4HMJA 4G7ZC 3S14H 4R1JA 4UP7A 1GXDC 3MC0B 2CFMA 2JA6B 4YIJA 1SAPA 1BO0A 4CDFC 4FO2A 1YHAA 1I94Q 4DK3C 3M9BA 4XDXA 1LTRD 2VW9A 4JK1C 4QF4A 1YHBA 3CCSA 4NXML 2PQAB 3GO5A 4DAYA 4LJZC 3OWEB 3FPUB 4ZKBB 2QILA 3I4OA 3TP8A 4OHJA 3RZDB 2JA7B 2JN4A 4C1NI 1PA6A 1L2FA 4IUUA 1I4HA 1MSHA 3E6ZX 4FNFA 5IWAL 1F2MA 1AW7A 2WACA 5M5WH 5IYCG 4IFDJ 4JI4L 2Y0SE 1T9HA 4CBVA 3E3XA 2XRSD 3CAMA 1JWUD 1IZ6A 4YWMA 1QVGA 4DUYL 1Q1BA 2F0DA 4HJ8A 4UY8C 3I4MB 4DUZQ 4LF6L 5FLXL 1FVIA 3GV6A 1BBUA 1TWHH 2PNHA 1Y14B 3H0GG 1PRTD 4DA2A 5E4XA 1ASYA 1WCMB 3Q23A 1VQ9A 1VQHA 5JAVA 3RZOB 5IP7G 4XYOA 4C3HH 5C44G 1E1TA 1PRTC 1HNWL 4RFBA 2IT1A 2RBMA 4Q0FA 3KUPA 5FO9B 1KDAA 4QIWB 5I9OA 3MA2B 3DLLA 3PUXA 4B3SQ 1QZHA 2AQ2B 3MEHA 3AMUA 2J7ZA 2R61A 2VUMH 1CZWA 2OQKA 2VB3X 1VQBA 2XVSA 3CC4A 5C4ZA 1SFOH 1PZJD 4RHRA 1QB5D 1PH1A 1P8LA 3KBGA 3GTMH 2EYJA 4I7ZC 4LAAA 3MXPA 3VR5A 2UU9L 4XQNA 3U9SA 2NB0A 5DM73 5IYBH 1F77A 1N36Q 1XMQL 1BQQT 1SNQA 3NWTA 2EYFA 1ESFA 2R93H 1Y1VG 2RQXA 2Z4HA 3O13A 1OTCA 3J7AF 3R2IA 3C1EA 5IGGA 3PUVA 3ITPA 4IFDH 4HMIA 3EA6A 1A15A 4ZYSA 1ZKOA 1QVCA 1LACA 1NJIC 2F0KA 4O0AA 3T4AC 2QKIC 1QZGA 1G91A 3L9AX 3I91A 1E1OA 3BDCA 3P75A 3OTOL 2GA4B 2K75A 2NYZD 2OTJA 3S14B 3KLWA 4YHHL 2V1CC 1W2BA 2WAQE 1LT3D 2MPMA 2ZTCA 3H0GH 2FINB 2Z6KA 4A3KG 1ENAA 2DUDA 2R7ZB 3KBXA 2NWGA 3I7FA 2O5JC 1UE1A 4A93G 3VYUA 4OX9Q 3V2TA 2RCFA 1FL0A 3T53B 3UI2A 3K57A 2VNUD 2CVRA 1JB7A 1LO5D 4ME3A 3T51B 1GO3E 3K58A 4H44C 2HIXA 1II3A 3DXJC 2NTSA 1VQ5A 3OPOA 4DV3L 1PH9A 2F0WA 5EPJA 3ULLA 5JJZA 2EOTA 1VQDA 2YYZA 1WTVA 1K8GA 4AH6A 4KHPL 3DUZA 1EEFD 3U58A 4OWXB 3J81L 5IT9c 5M3MG 1TKWB 2HHHL 4K6LA 2HDMA 4HSVA 4R4CA 3JAML 4OO1I 2K7VA 2JP1A 1TWHB 2NVXH 4A3DH 4L5QA 2K33A 1EY6A 2E2DC 4G57A 3FMCA 1TS4A 3U50C 3A8IE 4JBJA 2FHTA 4FP5D 4C3HB 2EXZA 3PIOA 3IKJA 3PMFA 4A3GG 4WJ3M 2KQ3A 3J81j 1KXLA 1V1OA 1F9SA 1QOHA 4ZLTF 3QOLA 1N9WA 5KYIA 5BR8Q 2PI2A 2ID0A 3I4NG 1MGSA 4DR5Q 2VUMB 1STBA 1Q90A 1SFOB 2NVTH 1LTBD 1EYDA 4DR2L 3J80i 1RJTA 2PNRC 3P20A 4DXFA 3CCLA 3ULJA 3TZDA 1RL2A 1KNAA 4K2LA 1Q8KA 1BCPF 5DLQE 4LF8L 1SNCA 2F0NA 2F0VA 3BYTB 1CFMA 1D1KA 1G2TA 1BBWA 2J4XA 1IBKL 3C1FA 1Q46A 2F0QA 2K04A 3PF5A 1XXGA 2BDOA 2H1EA 2Z4IA 1EWCA 1NMFA 3H09A 1YNNC 4OO1G 4N8X1 2PMZB 3VR3A 2I5LX 1EL0A 4LMQD 2KJXA 1F9RA 1D5MC 4NKLA 3NXWA 1PZID 3H0GB 4X62L 4X3SA 2IW3A 5IOCA 3HG9A 1B2TA 3H6MA 4X6AH 1QG7A 5JJLA 4MIUA 3AU7A 4HR7B 1UAPA 4DGZA 3JC66 1N33L 2F0SA 2B2YC 3HOUH 1HR0W 3CU7A 4JC0A 3IAYA 3P1HA 1YJ9A 3MXNA 1CQVA 1E2VA 2D2CC 5AJ3Q 3S1RH 3TQYA 3K0YA 3SK5A 1BXTA 4GN3B 4RHSA 4A3BG 2JA5G 4QUFA 1PZKD 3QO2A 3ONAB 2E5LL 1J8IA 2GVAA 3VR2A 4OEMB 1VMPA 4GZYC 5IT9E 2B63G 2K52A 3I55A 1PYBA 2UXBL 1SEBD 4GKKQ 1J5EL 3CCQA 3T1YQ 1MSGA 3AYHB 1BUVT 4JOIA 2UUAQ 1H9SA 2RDFA 4JBKA 4A3DB 4KKUA 2NVXB 1LTTD 2X6LA 4IUTA 4HAEA 1L0WA 4P73A 4PMCA 1PYSB 2YTVA 1VQ7A 3K7AB 1L1OA 2F3IA 4HSPA 1VF5C 5FOBB 1EFWA 3Q0AA 2WKDA 3MXUA 4N8FA 2KCNA 3M3YH 1S5ED 4ZUJA 4MNOA 1ILPA 3K7UC 2C5CA 4KY6A 1EY0A 4O42A 2NVTB 1B3QA 2K05A 2VQEL 4A3KB 4ODGA 1SYEA 1FNWA 4KHZA 2CH4A 2RHQB 2EJFC 3MXNB 3W2DA 5CBAE 1WTQA 4A93B 2R3ZA 2E76C 4BXXH 1PH2A 5A2QE 1ICFB 3DEPA 3RLFA 2WB1B 3S9WA 3NBHA 3E9HA 4NMZA 3GTPH 1IL8A 3DMUA 3SEBA 2MGSA 3AFQA 3M7NA 5EKKA 1AP0A 1TY2A 2B2TC 1Y1WH 4WJWA 3URYA 1U9RA 2C35B 2JA5H 1H9SB 2EE1A 1EYCA 1IBLL 5M3MB 2KHSA 5K5PA 2RKSA 1JICA 3CQZH 4DV2L 1XPRA 5HY6A 1ZEQX 1TS2A 1JOQA 1L1OB 1G6PA 1XMOL 5C4HA 1QWYA 3K5MA 2CWAA 4PV1C 2YTYA 5I4DA 2R92H 2D9UA 3SK8A 1IBML 4JCVE 4ULLA 2JK8A 2B8GA 3KLRA 1CM9A 3J80L 1B4OA 1IYUA 1CZGA 4K2KA 2MFIA 3HRZC 4BY7H 4TSSA 5LL6X 4KJOA 2HQLA 1HTLD 1MKHA 2UUCL 1WCMG 1JOOA 5G3LF 3KK7A 4BA1I 4DAPA 5C0XJ 2WV6D 3CMEA 3GTKB 2F0PA 4RKBA 1PH8A 1D2BA 3NBHB 2Z9HA 1SNDA 3S1RB 4A3MH 2Z0SA 1ENCA 2F0GA 5CORA 1EQQA 4BY1H 4FF2A 4ZRZA 1HUMA 2NUCA 2SOBA 4LWCA 2OEOA 4I65A 1EIHA 4H02A 1H9MA 4C3JH 5IP9H 2AUJD 1HNZL 1JJCB 2K5WA 4LF7Q 1W3SA 4O1NA 2N78A 4UP9A 3NK9A 1S3OA 2N55A 1E3PA 1WTOA 1Q8IA 2I0QA 1NUCA 3RNUA 1DM0B 4BWGB 4DKAC 2XGTA 4XT1B 4LF4Q 4IN3A 3NHHA 1UEBA 5GAEC 1O7YA 1NAPA 5I9PA 1LV9A 1SBBB 2XTIA 3WOFA 4LFCQ 5E1FA 5K36G 1HJPA 2ATWA 1HR0L 1B70B 5L37A 4CKCA 2L9HA 4TRDA 3LWUA 3Q24A 1X9NA 1UEAB 4M1UB 1NR4A 2D0OA 3S1QH 5GADC 3OWFA 4LW1A 3TS0A 1TWCH 5I6WA 2WINB 1PRTB 5C0XH 1TQOA 1TR5A 1G6ZA 5KEEA 3GTPB 1IYVA 2PZWA 1TS5A 5LMNL 5JPNC 2G5DA 2ASBA 3LNNA 3FPPA 5DM63 1WTPA 2QDBA 2AQ1B 4FF4A 4B3RL 5C4XH 2KECA 4IO9A 3SVMA 1Q3LA 2ZM6Q 4KY5A 4X64L 1Y1WB 3TS2A 3EFXD 3L7ZC 3RUZA 2BH2A 2JA5B 2F03A 2UUBL 2UXDL 1Y69U 5I2XA 1JWMD 4QUCA 3U4VA 1E2ZA 2JA8H 4ILWA 1WYDA 1I50H 1TWGH 5KNCA 1BOSA 3S16B 3H3VH 3PUYA 4DR7Q 3CQZB 2BDNA 3J7YW 2BA0A 1EY5A 3PO2H 4IFDI 3PO3G 2EYPA 4DR4Q 4TVAB 4IALA 1XYIA 4ID6A 3MZ5A 3K5NA 2R92B 4DR3Q 3SE0A 1QNKA 2X69A 1Q86C 1CUKA 1KIXA 1IXRA 4KN4C 5CV7A 1DGSA 4KN7C 4FVMA 4TKOB 3BZKA 3NELA 4KLKA 2A69C 4DN4M 1N34L 3A5UA 1YHQA 1VDZA 3TP5A 1J9OA 3VR4A 3ICEA 5GAHC 4KJNA 1Z7TA 3FKIH 3WDNA 4AQYL 1QVFA 4C3HG 1WI5A 2XWJB 4G7OC 3K5OA 2PW7A 1QILA 1FJGL 1BDOA 4JV5L 4A3MB 2VXWA 2DN8A 3H94A 3VR6A 1NR2A 4B3TL 4LFBL 1AE2A 4BY1B 4NB3A 3JAMi 3NUCA 1STGA 2B2UC 4NXNL 1U4LA 2VUMG 4JYAQ 1XWEA 2EYOA 1H9KA 1B8AA 1SYDA 1Q1EA 2A6HD 4C3JB 2DY8A 1PH5A 4KD4A 4JI3L 1X55A 4JPBW 4S3SA 3A8KE 5FJ8H 1AZQA 4KHVA 2L5TA 4MTKA 5IYBG 3UDFA 2A6HC 4HJ9A 1VQIA 2JEAI 2R93G 4JI6L 5C5LA 1CSQA 1CSPA 4X66L 4RA8A 2OTLA 2R7DA 1I6VC 3QR8A 3PIO3 4IFDG 1SRUA 2NVYH 4CJ1B 4LF5Q 2WFWA 1RIPA 3PO3H 1HZ9A 3OMGA 4K0KL 5C4JH 1KC8C 1VQFA 3HFZB 2PO4A 2E8GA 3KYHC 1DXMA 3FHWA 1HHVA 3NTIA 1VQKA 4JI7Q 1V8QA 3D6WA 4HJAA 3EJIA 3S1QB 1KABA 1GUGA 1I4PA 1UE7A 2EZVA 4GKJL 1TWCB 2NZHA 1KNEA 3CCVA 1XNQQ 5FKAC 4DV5Q 1BKBA 1X3PA 2ZTDA 4JI5Q 4DV1Q 2QDLA 3M7GA 1EY4A 1EYAA 2EQSA 2TSSA 2FXQA 2XN9C 3CP0A 3NBIA 2E2JH 1N32Q 3TP7A 4JI2L 5C6AA 3PV0A 1YJWA 1CKNA 1STHA 4F88A 4RG1A 1D5XC 3SHLA 2ZXRA 3SXHA 1JMCA 3L3OC 2B2YA 1KTKA 2UXCL 4IJHA 5ELEA 1VMCA 1I50B 3TDQA 1TWGB 2EYMA 2PCFB 4DR1Q 1TWFH 4U68A 1RDPD 1CI3M 4FXDA 4IUPA 2A73B 4I7AA 1PMRA 1PH7A 1VQ8A 4YWKA 3IFTA 4WRDA 3F8TA 3S2DH 1PHJA 3W5OA 2KOLA 2EXDA 1KDBA 3FEWX 3TMEA 5JJKA 1HNXQ 4OIJA 3DM1A 5KNBA 1A6XA 4IJLA 4ZKCB 1QUQA 4A4IA 4FF3A 2F0OA 5D65A 4A3DG 2KUMA 5DEHA 4CGYB 1E2WA 2VB2X 1GJXA 2MP1A 4K14A 4POFA 1B1ZA 1TXYA 3I4LA 1A3TA 1NTGA 2G9HD 3FKIB 5BN5A 2NVQB 4DXGA 3MTSA 2BOSA 5H1SE 3KLSA 4H7BA 4F7XA 1STNA 4C3IH 1EY8A 2L12A 5JEAJ 4YY3L 3E0JA 4DR6Q 2IHEA 3H15A 1CKNB 4EX5A 4KI0A 1E24A 1RKNA 1FNVA 2K14A 3H91A 4PNYA 3D6CA 5FLXc 4A3FH 1CKOA 1M1KC 4LFAL 1K0SA 1V9PA 4A76A 3G6EA 1G2SA 3G48A 3TRZA 4DK0A 1SLJA 2RDGA 4F87A 2WB1G 4GNXC 4XXEA 4X65L 1O7ZA 2L4NA 2FMCA 2ICIA 3CRKC 2RSNA 1UNSA 3RD4A 1KD1C 1C7YA 1PRTF 1JCKB 1HFNA 5M5YH 4LF9Q 1QUQB 2NVYB 2E2IH 2B2TA 4YWLA 2KEDA 2HUGA 5M5WB 3G71A 3PO3B 3E0EA 3QIAA 2F1MA 5C4JB 1MBYA 2F0LA 1WJJA 1PV4A 3MEFA 3Q6SA 3A55A 5M5XH 2IX1A 4DR7L 3K81C 4DV0L 3C3LA 1Z47A 2F0HA 4A75A 3HKSA 2R6GA 1ET6A 1PFMA 3R8BA 1EIFA 1AZPA 4XYQA 4K5XA 4UHVA 3CCEA 3N6RA 2E2JB 4DV7Q 1HQRD 1RODA 4NPSA 5JEAH 4J8QA 3GTQH 3HOUG 3NQIA 2ZJRA 1PTOH 3L0OA 1SROA 1SYCA 1U0LA 4P72A 4QQBX 1BVSA 5J1ZA 3P7JA 5D14A 2DY7A 1SJHD 1TWFB 1XTCD 3BVZA 4R8IA 4B3ML 4RWSC 3OOCA 2OCEA 3MAQA 4PG3A 3GTMB 2HD3A 4JI8L 1JORA 4DNTB 2EPBA 1R4QB 4KMUC 4IPGA 3H3VC 3S2DB 1SDFA 3D4WA 1H9RA 4P2CB 5T1IA 1SSOA 2I5HA 4X3TA 2R93B 3M4QA 4RGMA 3MFYA 1I94L 3DHQA 2IX3A 2BA1A 5A35A 1YNND 1EOVA 5FLMG 3BS1A 2GN5A 1SMXA 3CPFA 3OIQA 4P75A 1CQFA 4R4OA 4C3IB 5EBDA 1HXYD 4CDDC 4JI0Q 2AMCB 2ES2A 1Z6HA 3GQBA 1S5BD 3ZYYX 3M4YA 1IL2A 3S17H 1LT5D 2X6GA 3J81c 2CHBD 5LMUQ 2D0PA 2G9DA 4QIWE 1B44D 2VQFQ 3KJPA 2SEBD 4DAMA 2DNCA 3JAMc 5CV8A 4A3FB 2ZT9C 4DUZL 5CV5A 5FLXE 1EY7A 1T5EA 1FGUA 1NY4A 1SYGA 4BXXG 1K8MA 4ALPA 5CC4A 4BBRH 2LY7A 4NDXA 5IE8A 4IURA 1A62A 1F2YA 1SYBA 4B9XA 1WD0A 1GVPA 4DU9A 1I6HH 5DNFA 3GTGH 3AB9A 2AWNA 2K4KA 1CT1D 5GROA 4A3LH 1Y1WG 5M5YB 1WTRA 2LFNA 2XSCA 1BR9A 1SE3A 1SMYD 2E2IB 1LLRD 2KCMA 3T56B 4B3SL 3A74A 4FF1A 1RCVD 1S4ZA 1W6JA 2EDGA 2RCNA 2KHJA 2LS01 1SMYC 1VQNA 4J15A 2RA4A 1ZYRD 2VS1A 1PFNA 2R92G 4A3JH 3M4OH 4RKLA 3CHBD 3HOXH 5FLMH 3EBEA 4N9PA 2KEEA 1N36L 4XQJA 1ZYRC 4BY7G 4HCEA 4IOCA 3QB3A 3MXGA 4OL7A 3D0FA 3TEHB 1A63A 4WJ4A 1EY9A 4N9TA 2K5QA 5C0XI 4GOPC 1PTOB 2OQ0A 3S2HH 1PYWD 4LNQA 1GHJA 3T1HQ 4C56C 1VQEA 3Q22A 4A3MG 1XJVA 3EROA 1OXUA 2NZOA 4BY1G 4RGTA 1VQCA 2QCPX 2XRQD 3M85A 1DOKA 2H5XA 2P5ZX 4JI1Q 2B2UA 4K5VA 1Q82C 4C3JG 3H3VI 1Y8NB 5IP9G 2Q8IB 4XQQA 1IKMA 3HOWG 1YEZA 5JVG3 4IQZA 4JG2A 2JYOA 4OX9L 5IGDA 2B2WC 1I3QH 1B53A 5IIFA 4KY7A 1YVCA 2EYLA 2AQ3B 5EPLA 1OO9B 3MVVA 4WFN3 1XNRQ 3CD6A 3BVMA 1PXUA 3NP8A 1EZ8A 1VQ6A 3PCOB 4NXMQ 2JXMB 2Q2HA 1LTSD 1SE8A 3M4PA 1JJGA 4EQ5A 1LUZA 1GOZA 1RF2D 2F52A 2KHIA 1WFQA 3S17B 4WORA 4EVOA 3F2CA 1EFID 1O7IA 2VL6A 2F4IA 4CDEC 4POGA 3J81E 1K83H 2KENA 4OWWB 4R4IA 1A2TA 4JI4Q 1MHWC 2K5DA 2VZAA 3JAME 4DUYQ 3HEJA 4LF6Q 1EU3A 1EQVA 3GDEA 4UDUC 5C0XG 1XPOA 2MO1A 1MJEA 3DM3A 2JSOA 2K28A 2QF7A 3HOUB 2DNEA 2Z1CA 2E2HH 1STYA 4HTHA 4LUVA 5LHY1 1JC7A 2MHVA 5C4XG 1Q7YC 1LTAD 1SN8A 4Q5VA 1AN8A 2ZJPA 1SE4A 3MHBA 5ELNA 1XPUA 2L11A 1FNUA 5IGEA 3K80C 4LK1C 2FFKB 5EBCA 1HNWQ 2F4VQ 2Y0SB 2YV5A 1E7ZA 1KAWA 2B29A 2E75C 4MZ9A 2RDHA 5BR8L 1A3UA 2JA8G 2BE5D 4FXGC 3PF4A 1HA6A 4IPDA 4TQUS 1EOTA 4KKTA 4DR5L 4A3IH 1HH2P 1Y8PB 1FYCA 3UDXA 4DAVA 4EQOA 3PO2G 4PQXA 4A3CH 4RAUC 5CV9A 3HOWH 1XTDA 2A19A 3B6YA 4ZCKA 3E9IA 1RD9D 2BE5C 1O80A 3OW7A 2QW7A 1Q12A 1KL9A 2RF4A 3M4OB 5IODA 2H4OA 4YCUA 5ELBA 2UU9Q 3HOXB 5CV6A 1EZ6A 2PMZE 2D5DA 3W3AA 4GLXA 4R8NA 1KHIA 1ONLA 2GVBA 1JR0D 1YIJA 3VA7A 1XMQQ 1JE5A 1VS0A 1GUNA 2PYKA 2PI2E 3J7AV 5JVH3 1JQYD 1PTOD 3S2HB 5C3EH 4PZ7A 1EUJA 3FKIG 3M3YB 1WTXA 2MQHA 3DEOA 3I8ZA 2F0EA 3D4RA 5KGUA 3LX0A 1CHPD 1PTOC 1D8LA 4B08A 3D3RA 2DGYA 3OW2A 1HPCA 1TY0A 1U4MA 2JA7H 1BNZA 1TWAH 5EQ0A 1A0IA 5M3FH 1X56A 4YHHQ 4K8IA 2SNSA 3J80c 3KOJA 2D62A 4IZ8A 3QWNA 1M8AA 2L1BA 1LTGD 1UUPA 5FJ8G 1MI2A 3PIPA 2Q8TA 3I4MH 2SNMA 2O5IC 4IUQA 1I3QB 4KK7A 3V96A 1U5KA 4L6TB 3BVGA 1B7YB 2YU9H 2NTTA 1X32A 4GNXA 4MHEA 1CA6A 5CBEE 4DV3Q 3OSOA 3RZOH 1GUTA 5AJ3L 3LWEA 2EY6A 2JA9A 3D8GA 3U4ZA 2I5MX 1HFGA 2Q2UA 1Y8OB 2WAQB 4GLVB 2ZTEA 4BA2I 2HCIA 3FVQA 3HP3A 3F2DA 4KHPQ 2PQEA 1W6KA 1K83B 2K32A 2HT1A 2IPKD 1KDCA 1E0BA 1Z9FA 2A69D 2RVLA 4R4QA 3WOEA 2HHHQ 1K8OA 3I72A 5IGBA 4BY7B 1H95A 5EAYA 4U673 1PH3A 4GKKL 2PZTA 2MUYA 2WIIB 3T1YL 2UUAL 1X3GA 4PMWA 2EY5A 2EYHA 3CC7A 2E2HB 5EJWA 1DOLA 2E74C 1CTMA 1SE2A 3EIVA 3R3OA 3LGJA 1D7QA 4EQPA 2ICEC 1QCBD 1TU2B 4HCSA 3BZCA 2WB1E 2I46A 3T13A 4G7HC 2A74C 3UDGA 1HZCA 2B39A 1KRSA 3A56A 3G6JB 3J7A5 3GV3A 1FR3A 1T5XD 1U4RA 1M90C 4XT3B 4X3UA 1VQJA 4A3IB 1YI2A 4GNXB 3F2UA 1GUSA 3HOWB 2KVMA 2C9OA 4HIOA 1HQMC 4DR2Q 5NUCA 3GTJH 5IGCA 4A3EH 4EQNA 3OHXC 1KRTA 4OONA 3D4DA 4JI1L 3T16A 3VDYA 3TZUA 4FYDA 4QCLA 4LF8Q 2R7ZH 4MN3A 1TS3A 5D3DA 1VQMA 5KNDA 5C3EB 3GTOH 1PFBA 1VQPA 1IYJB 1I5FA 1TIID 4H0LC 1XNRL 1IBKQ 3K5LA 1X3FA 2F0JA 2A8VA 5CYUA 3K8AA 4AYBG 4RCOA 4C3IG 3HOYH 5TSSA 2DJFC 1VQGA 3HOZH 1HA5A 3KF8A 1AEXA 1TWAB 3IFDA 3HOVH 1B9MA 1R4PB 1KLUD 1YBYA 4P74A 3X3NA 2Q2IA 5CV4A 5KYLA 1YZ6A 2LSSA 5M3FB 3KLSX 1EQRA 4A3FG 3WWVA 1B50A 4L5TA 4X62Q 3J80E 2YTXA 4IPHA 1G51A 5C4XB 3MFGA 4Z9CB 1K73C 4UAIA 1VQ4A 1YITA 1NMGA 3CC2A 2YU9B 1N33Q 4UPAA 1U4PA 4AIMA 2XIWA 3BYYB 1KAAA 2BCOA 4KD3A 5JPMC 4JW0A 5EPKA 2JA8B 5I6YA 1X54A 1AH9A 1NNXA 3DWPA 2AHOB 2K03A 3I2ZA 3OYYA 3PO2B 3NWSA 5E4WC 5C3WA 3ZJYC 2F4VL 4DF7A 2OWOA 1GM5A 2M2LA 3CCMA 2WKCA 1L0YB 5IYDH 2E5LQ 1D5ZC 1EWHA 4K8JA 3PSIA 5IY0A 4BBSH 5ELFA 3A0JA 1F2LA 3A54A 1LM0A 5IT9L 4DAYB 3X3MA 4LF7L 2UXBQ 3NENA 4O2DA 1A3VA 4E6IA 1J5EQ 3KF8B 1F2ZA 2EJGC 3A7LA 4QB4A 3HKZG 1WOCA 1NBWA 2HQEA 2CQOA 2FMMA 5JEAG 3BG3A 1WTWA 4LF4L 4HEDA 3I70A 1LT4D 4RMFA 2F0TA 4KTAA 2PW5A 3AFPA 4JBWA 4GOPA 3EQLC 1MD2D 1C8CA 4XIGS 2F0UA 3R93A 1JJ2A 2ALYB 3I73A 4LFCL 1DYQA 1B9NA 5IYCH 3PGZA 2CWPA 2VQEQ 1S72A 2CW0D 3TSSA 5ELCA 3VYRA 2EIFA 3GTJB 1BCPD 1PLFA 5GAGC 3ULPA 4OIKA 4RGNA 3S15H 4A3EB
chains in the Genus database with same CATH topology
1A62A 2IX0A 5IYDG 2N8NA 4A3MH 2Z0SA 1K3RA 1KQSA 4BBSG 1GVPA 4JI8Q 4A3GH 1I6HH 1X65A 3GTGH 3S14H 1EQQA 4R1JA 2AWNA 2K4KA 4UP7A 5GROA 4BY1H 1Y1WG 4A3LH 2CFMA 2KCMA 5IP7H 4HJ7A 4B3SL 4LWCA 2ZM6L 1CKMA 5C44H 1MJCA 4H02A 3S1NH 1YHAA 3A74A 4C3JH 1EYGA 1I94Q 4DK3C 3M9BA 5IP9H 5HGQA 2VW9A 1HNZL 1JJCB 2RCNA 2KHJA 4LF7Q 4PZ6A 1VQNA 4J15A 4APVA 5K36G 1W3SA 1YHBA 3CCSA 2N78A 4NXML 2VS1A 2PQAB 3GO5A 1IBLQ 4UP9A 2R92G 1S3OA 1UE6A 4Y52H 4DV2Q 1E3PA 4A3JH 3M4OH 3W1GA 2I0QA 3I4OA 2VY3A 3RNUA 3ERSX 3TREA 1XMOQ 3HOXH 4DR4L 5FLMH 3EBEA 5IE8A 3GD7A 4DR3L 3AEVA 1PA6A 1L2FA 4DKAC 1N36L 2XGTA 4LF4Q 4GOPB 4BY7G 4IOCA 5IWAL 1IBMQ 1JT8A 1UEBA 3D0FA 3TEHB 5M5WH 5IYCG 5GAEC 4IFDJ 4WJ4A 1A63A 4JI4L 2Y0SE 1T9HA 5C0XI 4GOPC 2XTIA 2OQ0A 3S2HH 3CAMA 4YWMA 1IZ6A 3S24A 1QVGA 4DUYL 1Q1BA 4HJ8A 4LFCQ 4BBRG 4LNQA 4UY8C 2N3SA 1HJPA 1Y1VH 4DUZQ 3T1HQ 1HR0L 4LF6L 1VQEA 1PH4A 1B70B 2ATWA 2UUCQ 1FVIA 4A3MG 1XJVA 1X9NA 1OXUA 1BBUA 1TWHH 2D0OA 2NZOA 2JEBI 4BY1G 2PNHA 1Y14B 3H0GG 4LW1A 5GADC 3TS0A 3S1QH 4A3LG 3I56A 1ASYA 4Y7NH 1V43A 1VQCA 2BH8A 1TWCH 4QY7A 1VQ9A 1VQHA 3M85A 3K7AH 5IP7G 2Y0SG 2CCZA 2H5XA 2LXJA 3UE0A 4C3HH 5C44G 5LMNL 1E1TA 2ASBA 4JI1Q 1Q82C 1HNWL 3H3VI 3L2PA 2IT1A 5IP9G 4B3RL 1X6OA 5C4XH 4JYAL 3HOWG 1YEZA 1C0AA 4JG2A 4IO9A 4OX9L 3DLLA 3PUXA 4B3SQ 2ZM6Q 1QZHA 4X64L 3TS2A 3L7ZC 4IOAA 4JBMA 3BJUA 1I3QH 4PZ8A 2BH2A 1YVCA 2VUMH 3KFUA 2OQKA 4A3KH 2UUBL 2UXDL 1XNRQ 1HNZQ 4A3JG 1VQBA 1VQOA 2JE6I 3CC4A 1SFOH 4YCVA 2IHFA 3U4VA 1ASZA 2JA8H 3CD6A 3HOXG 4A93H 1WYDA 1PH1A 1I50H 1TWGH 1VQ6A 3PCOB 1P8LA 4NXMQ 2Q2HA 3H3VH 3PUYA 1SE8A 3RN2A 4DR7Q 3M4PA 1JJGA 4EQ5A 3GTMH 3FP9A 1LUZA 2BA0A 3PO2H 2UU9L 4IFDI 3KJOA 2F52A 3CCJA 4DV4Q 3PO3G 2KHIA 4QJFA 4TVAB 1WFQA 4DR4Q 3UE1A 3F2CA 5IYBH 4DR3Q 1O7IA 1N36Q 2VL6A 1XMQL 2R93H 1Y1VG 4POGA 4LF5L 1K83H 2KENA 1HZAA 1Q86C 4OWWB 1CUKA 4R4IA 1KIXA 1OTCA 1IXRA 4JI4Q 3CW2C 3PUVA 2VZAA 1DGSA 3CPWA 4P71A 4DUYQ 3S1MH 3BZKA 3NELA 4KLKA 4MTNA 3GDEA 1HR0Q 1N34L 4LF6Q 3A5UA 1YHQA 4QGUA 5C0XG 1XPOA 2MO1A 1MJEA 3DM3A 1QVCA 5M3MH 5GAHC 3G4SA 1NJIC 4JI7L 3ICEA 3FKIH 4O0AA 4AQYL 1G291 1QVFA 4IPCA 1P16A 1GKHA 2E2HH 1WI5A 5E7NA 1QZGA 4LUVA 1E1OA 3OTOL 1FJGL 1XNQL 4DV5L 5C4XG 1Q7YC 2K75A 4JV5L 1SN8A 2OTJA 4JI5L 2ZJPA 1SR3A 4B3TL 3CCUA 1AE2A 3KLWA 4NB3A 4DV1L 4LFBL 3JAMi 1XPUA 2NN6I 5ELNA 4UP8A 4YHHL 2V1CC 5LMNQ 2WAQE 1W2BA 2R7FA 3K80C 3PUWA 2ZTCA 3H0GH 4NXNL 1HNWQ 1N32L 2Z6KA 2VUMG 3KF6A 4A3KG 1OXXK 2DUDA 4B3RQ 2F4VQ 4JYAQ 2KCTA 2YV5A 1E7ZA 3I7FA 1KAWA 1UE1A 2B29A 4MZ9A 4OX9Q 5BR8L 2JA8G 1E22A 1B8AA 4A93G 1Q1EA 4X64Q 1FL0A 3BU2A 1OXVA 4IPDA 4TQUS 4C2MH 4DR5L 1PH5A 4JI3L 2QA4A 4A3IH 1HH2P 1X55A 1JB7A 2VNUD 3UDXA 4ME3A 1GO3E 2UUBQ 2UXDQ 3PO2G 4A3CH 2HIXA 5FJ8H 3HOWH 4DR1L 3GTKH 1XTDA 4QL5A 4DV6Q 2A19A 3B6YA 4GN5A 2QGQA 3E9IA 3UDFA 5IYBG 1VQ5A 2WAQG 4DV3L 1VQIA 4HJ9A 1PH9A 1Q12A 1KL9A 2RF4A 2JEAI 3ULLA 4YCUA 2R93G 4JI6L 1CSQA 1CSPA 1VQDA 2YYZA 2UU9Q 3GTLH 2PMZE 4BA2I 4X66L 4GLXA 1GD7A 1KHIA 5LMNW 2GVBA 2OTLA 1K8GA 4AH6A 4KHPL 2R7DA 1YIJA 2K5NA 2JJQA 1XMQQ 4DNIA 1JE5A 1VS0A 1HNXL 4IFDG 3U58A 1SRUA 4OWXB 2NVYH 2PI2E 4DK6C 4LF5Q 3RR5A 5IT9c 3SGIA 2WFWA 1RIPA 5M3MG 1HZ9A 1NE3A 5C3EH 4PZ7A 2HHHL 3RN5A 1EUJA 3FKIG 3PO3H 5C4JH 1KC8C 1VQFA 4K0KL 3EN2A 4YCWA 2MQHA 3HFZB 2E8GA 3KYHC 3FHWA 4R4CA 4OO1I 3KDFA 1N34Q 1VQKA 4JI7Q 4HJAA 1MIUA 1D8LA 4AQYQ 2DGYA 2NVXH 3OW2A 4A3DH 4GKJL 1UE7A 4L5QA 2NZHA 2JA7H 3CCVA 3U50C 1FJGQ 1XNQQ 5ELOA 4DV5Q 1TWAH 4JV5Q 1BKBA 4JBJA 2ZTDA 3KF6B 4B3TQ 4JI5Q 4LFBQ 4DV1Q 4DR6L 3PIOA 1A0IA 5M3FH 1X56A 4A3GG 4YHHQ 4WJ3M 2EQSA 3J80c 2K5VA 3KOJA 4A3IG 2FXQA 2D62A 3CP0A 3J81j 2E2JH 4NXNQ 1N32Q 1PH6A 2Z6KC 1KXLA 4JI2L 4A3CG 3PV0A 5FJ8G 4L5SA 2NN6G 1N9WA 3PIPA 1YJWA 3I4MH 1CKNA 1R9TH 5BR8Q 2PI2A 4RG1A 2ID0A 3I4NG 4DR5Q 4JI3Q 1N8RC 1K0RA 1U5KA 1JMCA 2WP8J 2NVTH 2UXCL 1B7YB 4IJHA 1YNXA 2K5HA 2YU9H 3F1ZA 1OXSC 4DR2L 3J80i 4DR1Q 1TWFH 4GNXA 4L5RC 3J7ZC 2B3GA 3CCLA 2L15A 3PUZA 1A8VA 3ULJA 4FDBA 4DV3Q 3RZOH 5AJ3L 2JA6G 1RL2A 4JI6Q 3D31A 2JA9A 1PH7A 1VQ8A 3U4ZA 2I5MX 4X66Q 4YWKA 2Q2UA 5C3EG 2A1AA 4GLVB 2ZTEA 1Q8KA 3F8TA 5DLQE 3W1BA 4LF8L 3S2DH 1PHJA 4LF9L 3W5OA 3F2DA 4KHPQ 2EXDA 2QEXA 2HT1A 2Q2TA 1HNXQ 5JJKA 1Z9FA 4R4QA 5IWAQ 4IJLA 4A3BH 1BBWA 1QUQA 3KDFB 4A4IA 1IBKL 2HHHQ 1Q46A 4K0KQ 1H95A 4A3DG 5EAYA 1PH3A 4GKKL 1PVOA 4POFA 3PF5A 2JA7G 3T1YL 2JQOA 1TXYA 2UUAL 3S16H 1NTGA 1X3GA 4PMWA 1VQLA 1NMFA 2B63H 3F2BA 3CC7A 5M3FG 4GKJQ 5H1SE 4OO1G 3EIVA 1EIYB 3LGJA 2I5LX 4C3IH 1D7QA 1YJNA 3CCRA 4HIMA 5JEAJ 3BZCA 5GQOA 3I4MG 2WB1E 4YY3L 4DR6Q 3UDGA 1HZCA 2IHEA 4X62L 3H15A 1CKNB 1KRSA 4EX5A 4DV7L 3J7A5 1M90C 2KBNA 3UDIA 4KI0A 3I4NH 1E24A 4JI2Q 1VQJA 1OXTA 2K14A 5FLXc 4X6AH 3STBD 4A3FH 1CKOA 1M1KC 5JJLA 1YI2A 4LFAL 4GNXB 1V9PA 3JC66 4A76A 1N33L 3G6EA 3G48A 3HOUH 1HR0W 3TRZA 2UXCQ 4HIOA 4JC0A 1SLJA 4DR2Q 5J3BA 3GTJH 2WB1G 4GNXC 4X65L 3STBC 4A3EH 4R4TA 1KRTA 1YJ9A 4OONA 4AYBE 5AJ3Q 3S1RH 4JI1L 3TQYA 3VDYA 4GN3B 1KD1C 4A3BG 2JA5G 1C7YA 4LF8Q 2R7ZH 5JJIA 5M5YH 4LF9Q 1QUQB 1LYLA 1VQAA 4HIKA 2E2IH 2E5LL 1C9OA 4YWLA 4DPGA 1VQMA 2JA6H 2GVAA 3G71A 3GTOH 3PF4A 3E0EA 1VQPA 1IYJB 1I5FA 1XNRL 2B63G 1WJJA 2K52A 1IBKQ 1PV4A 3I55A 1PYBA 1X3FA 3MEFA 2UXBL 2A8VA 4GKKQ 3RLOA 5M5XH 2RHSB 2AWOA 3K8AA 4AYBG 2IX1A 4DR7L 2MNAA 1J5EL 3CCQA 3K81C 3T1YQ 3HOYH 3AYHB 4JOIA 4DV0L 2UUAQ 1VQGA 1Z47A 4JBKA 3HOZH 4DV4L 4A75A 1HZBA 3HKSA 2R6GA 3ER0A 1EWIA 1V1QA 4JI0L 3HOVH 1L0WA 3CF5A 4P73A 3OTOQ 1EIFA 1YBYA 1PYSB 4P74A 2YTVA 3RZDH 2Q2IA 1VQ7A 1YZ6A 2LSSA 1L1OA 2F3IA 4YY3Q 1EQRA 4A3FG 3WWVA 5LMUL 3CXCA 3CCEA 4L5TA 4X62Q 1EFWA 4DV7Q 2YTXA 4IPHA 4NPSA 2VQFL 1G51A 3GTQH 3HOUG 2ZJRA 3M3YH 1K73C 3L0OA 4MNOA 1SROA 3K7UC 1VQ4A 1YITA 1NMGA 1U0LA 1K8AC 3CC2A 2IY5B 4LFAQ 4P72A 3RLNA 3CMAA 2VQEL 4A3EG 4QQBX 1BVSA 2HIVA 3Q8DA 4UPAA 4AIMA 1N33Q 4KHZA 2RHQB 3MXNB 4B3ML 1LTLA 1X54A 2OCEA 4X65Q 1AH9A 2R7ZG 1WCMH 2AHOB 4PG3A 1PH2A 4BXXH 1VCIA 4JI8L 3I2ZA 3NEMA 3OYYA 3RLFA 4IPGA 3E9HA 3GTPH 4OWTB 3ZJYC 3AFQA 2F4VL 2OWOA 1GM5A 3M7NA 3HKZE 3CCMA 2I5HA 5IYDH 2E5LQ 3PSIA 5IY0A 2ZJQA 4BBSH 3M4QA 4LUOA 3HOYG 3A0JA 1Y1WH 1I94L 1LM0A 4GN4B 4DAYB 3HOZG 1J6QA 2C35B 2BA1A 2JA5H 1Q81C 4LF7L 2UXBQ 4DV6L 1EOVA 5FLMG 3NENA 3HOVG 4O2DA 2GN5A 1J5EQ 3KF8B 1K9MC 1SMXA 4DV0Q 3CPFA 4JOIC 1IBLL 3IRBA 4P75A 3CQZH 4DV2L 4HJ5A 5HY6A 1XPRA 3HKZG 4R4OA 3AQQA 1WOCA 1L1OB 1G6PA 1NBWA 1XMOL 2PQAA 2CQOA 1X3EA 1S40A 4JI0Q 2AMCB 2ES2A 5JEAG 2CWAA 1IL2A 4LF4L 2LXKA 3K0XA 3S17H 2YTYA 4GS3A 4LUZA 2R92H 4RMFA 1L1OC 3J81c 1IBML 4JCVE 3AFPA 5LMUQ 2D0PA 2JK8A 4QIWE 4JBWA 2VQFQ 4GOPA 3A5ZB 1AE3A 2N49A 1PFSA 2MO0A 3KJPA 4HIDA 4XIGS 4DAMA 2MFIA 1JJ2A 2ALYB 2CKZB 4XTCS 3JAMc 4BY7H 4LFCL 4GLAC 4DUZL 2HQLA 3T1HL 2K50A 1MKHA 1UE5A 2UUCL 5IYCH 1WCMG 3PGZA 1FGUA 1NY4A 2CWPA 4BA1I 2VQEQ 1S72A 4BXXG 4ALPA 3J81i 1UWVA 5C0XJ 2EIFA 2NVQH 2AKWB 4B3MQ 3CMEA 4OXPA 5GAGC 4BBRH 1PH8A 3ULPA 3S15H 3NBHB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A62 A;  2IX0 A;  5IYD G;  2N8N A;  4A3M H;  2Z0S A;  1K3R A;  1KQS A;  4BBS G;  1GVP A;  4JI8 Q;  4A3G H;  1I6H H;  1X65 A;  3GTG H;  3S14 H;  1EQQ A;  4R1J A;  2AWN A;  2K4K A;  4UP7 A;  5GRO A;  4BY1 H;  1Y1W G;  4A3L H;  2CFM A;  2KCM A;  5IP7 H;  4HJ7 A;  4B3S L;  4LWC A;  2ZM6 L;  1CKM A;  5C44 H;  1MJC A;  4H02 A;  3S1N H;  1YHA A;  3A74 A;  4C3J H;  1EYG A;  1I94 Q;  4DK3 C;  3M9B A;  5IP9 H;  5HGQ A;  2VW9 A;  1HNZ L;  1JJC B;  2RCN A;  2KHJ A;  4LF7 Q;  4PZ6 A;  1VQN A;  4J15 A;  4APV A;  5K36 G;  1W3S A;  1YHB A;  3CCS A;  2N78 A;  4NXM L;  2VS1 A;  2PQA B;  3GO5 A;  1IBL Q;  4UP9 A;  2R92 G;  1S3O A;  1UE6 A;  4Y52 H;  4DV2 Q;  1E3P A;  4A3J H;  3M4O H;  3W1G A;  2I0Q A;  3I4O A;  2VY3 A;  3RNU A;  3ERS X;  3TRE A;  1XMO Q;  3HOX H;  4DR4 L;  5FLM H;  3EBE A;  5IE8 A;  3GD7 A;  4DR3 L;  3AEV A;  1PA6 A;  1L2F A;  4DKA C;  1N36 L;  2XGT A;  4LF4 Q;  4GOP B;  4BY7 G;  4IOC A;  5IWA L;  1IBM Q;  1JT8 A;  1UEB A;  3D0F A;  3TEH B;  5M5W H;  5IYC G;  5GAE C;  4IFD J;  4WJ4 A;  1A63 A;  4JI4 L;  2Y0S E;  1T9H A;  5C0X I;  4GOP C;  2XTI A;  2OQ0 A;  3S2H H;  3CAM A;  4YWM A;  1IZ6 A;  3S24 A;  1QVG A;  4DUY L;  1Q1B A;  4HJ8 A;  4LFC Q;  4BBR G;  4LNQ A;  4UY8 C;  2N3S A;  1HJP A;  1Y1V H;  4DUZ Q;  3T1H Q;  1HR0 L;  4LF6 L;  1VQE A;  1PH4 A;  1B70 B;  2ATW A;  2UUC Q;  1FVI A;  4A3M G;  1XJV A;  1X9N A;  1OXU A;  1BBU A;  1TWH H;  2D0O A;  2NZO A;  2JEB I;  4BY1 G;  2PNH A;  1Y14 B;  3H0G G;  4LW1 A;  5GAD C;  3TS0 A;  3S1Q H;  4A3L G;  3I56 A;  1ASY A;  4Y7N H;  1V43 A;  1VQC A;  2BH8 A;  1TWC H;  4QY7 A;  1VQ9 A;  1VQH A;  3M85 A;  3K7A H;  5IP7 G;  2Y0S G;  2CCZ A;  2H5X A;  2LXJ A;  3UE0 A;  4C3H H;  5C44 G;  5LMN L;  1E1T A;  2ASB A;  4JI1 Q;  1Q82 C;  1HNW L;  3H3V I;  3L2P A;  2IT1 A;  5IP9 G;  4B3R L;  1X6O A;  5C4X H;  4JYA L;  3HOW G;  1YEZ A;  1C0A A;  4JG2 A;  4IO9 A;  4OX9 L;  3DLL A;  3PUX A;  4B3S Q;  2ZM6 Q;  1QZH A;  4X64 L;  3TS2 A;  3L7Z C;  4IOA A;  4JBM A;  3BJU A;  1I3Q H;  4PZ8 A;  2BH2 A;  1YVC A;  2VUM H;  3KFU A;  2OQK A;  4A3K H;  2UUB L;  2UXD L;  1XNR Q;  1HNZ Q;  4A3J G;  1VQB A;  1VQO A;  2JE6 I;  3CC4 A;  1SFO H;  4YCV A;  2IHF A;  3U4V A;  1ASZ A;  2JA8 H;  3CD6 A;  3HOX G;  4A93 H;  1WYD A;  1PH1 A;  1I50 H;  1TWG H;  1VQ6 A;  3PCO B;  1P8L A;  4NXM Q;  2Q2H A;  3H3V H;  3PUY A;  1SE8 A;  3RN2 A;  4DR7 Q;  3M4P A;  1JJG A;  4EQ5 A;  3GTM H;  3FP9 A;  1LUZ A;  2BA0 A;  3PO2 H;  2UU9 L;  4IFD I;  3KJO A;  2F52 A;  3CCJ A;  4DV4 Q;  3PO3 G;  2KHI A;  4QJF A;  4TVA B;  1WFQ A;  4DR4 Q;  3UE1 A;  3F2C A;  5IYB H;  4DR3 Q;  1O7I A;  1N36 Q;  2VL6 A;  1XMQ L;  2R93 H;  1Y1V G;  4POG A;  4LF5 L;  1K83 H;  2KEN A;  1HZA A;  1Q86 C;  4OWW B;  1CUK A;  4R4I A;  1KIX A;  1OTC A;  1IXR A;  4JI4 Q;  3CW2 C;  3PUV A;  2VZA A;  1DGS A;  3CPW A;  4P71 A;  4DUY Q;  3S1M H;  3BZK A;  3NEL A;  4KLK A;  4MTN A;  3GDE A;  1HR0 Q;  1N34 L;  4LF6 Q;  3A5U A;  1YHQ A;  4QGU A;  5C0X G;  1XPO A;  2MO1 A;  1MJE A;  3DM3 A;  1QVC A;  5M3M H;  5GAH C;  3G4S A;  1NJI C;  4JI7 L;  3ICE A;  3FKI H;  4O0A A;  4AQY L;  1G29 1;  1QVF A;  4IPC A;  1P16 A;  1GKH A;  2E2H H;  1WI5 A;  5E7N A;  1QZG A;  4LUV A;  1E1O A;  3OTO L;  1FJG L;  1XNQ L;  4DV5 L;  5C4X G;  1Q7Y C;  2K75 A;  4JV5 L;  1SN8 A;  2OTJ A;  4JI5 L;  2ZJP A;  1SR3 A;  4B3T L;  3CCU A;  1AE2 A;  3KLW A;  4NB3 A;  4DV1 L;  4LFB L;  3JAM i;  1XPU A;  2NN6 I;  5ELN A;  4UP8 A;  4YHH L;  2V1C C;  5LMN Q;  2WAQ E;  1W2B A;  2R7F A;  3K80 C;  3PUW A;  2ZTC A;  3H0G H;  4NXN L;  1HNW Q;  1N32 L;  2Z6K A;  2VUM G;  3KF6 A;  4A3K G;  1OXX K;  2DUD A;  4B3R Q;  2F4V Q;  4JYA Q;  2KCT A;  2YV5 A;  1E7Z A;  3I7F A;  1KAW A;  1UE1 A;  2B29 A;  4MZ9 A;  4OX9 Q;  5BR8 L;  2JA8 G;  1E22 A;  1B8A A;  4A93 G;  1Q1E A;  4X64 Q;  1FL0 A;  3BU2 A;  1OXV A;  4IPD A;  4TQU S;  4C2M H;  4DR5 L;  1PH5 A;  4JI3 L;  2QA4 A;  4A3I H;  1HH2 P;  1X55 A;  1JB7 A;  2VNU D;  3UDX A;  4ME3 A;  1GO3 E;  2UUB Q;  2UXD Q;  3PO2 G;  4A3C H;  2HIX A;  5FJ8 H;  3HOW H;  4DR1 L;  3GTK H;  1XTD A;  4QL5 A;  4DV6 Q;  2A19 A;  3B6Y A;  4GN5 A;  2QGQ A;  3E9I A;  3UDF A;  5IYB G;  1VQ5 A;  2WAQ G;  4DV3 L;  1VQI A;  4HJ9 A;  1PH9 A;  1Q12 A;  1KL9 A;  2RF4 A;  2JEA I;  3ULL A;  4YCU A;  2R93 G;  4JI6 L;  1CSQ A;  1CSP A;  1VQD A;  2YYZ A;  2UU9 Q;  3GTL H;  2PMZ E;  4BA2 I;  4X66 L;  4GLX A;  1GD7 A;  1KHI A;  5LMN W;  2GVB A;  2OTL A;  1K8G A;  4AH6 A;  4KHP L;  2R7D A;  1YIJ A;  2K5N A;  2JJQ A;  1XMQ Q;  4DNI A;  1JE5 A;  1VS0 A;  1HNX L;  4IFD G;  3U58 A;  1SRU A;  4OWX B;  2NVY H;  2PI2 E;  4DK6 C;  4LF5 Q;  3RR5 A;  5IT9 c;  3SGI A;  2WFW A;  1RIP A;  5M3M G;  1HZ9 A;  1NE3 A;  5C3E H;  4PZ7 A;  2HHH L;  3RN5 A;  1EUJ A;  3FKI G;  3PO3 H;  5C4J H;  1KC8 C;  1VQF A;  4K0K L;  3EN2 A;  4YCW A;  2MQH A;  3HFZ B;  2E8G A;  3KYH C;  3FHW A;  4R4C A;  4OO1 I;  3KDF A;  1N34 Q;  1VQK A;  4JI7 Q;  4HJA A;  1MIU A;  1D8L A;  4AQY Q;  2DGY A;  2NVX H;  3OW2 A;  4A3D H;  4GKJ L;  1UE7 A;  4L5Q A;  2NZH A;  2JA7 H;  3CCV A;  3U50 C;  1FJG Q;  1XNQ Q;  5ELO A;  4DV5 Q;  1TWA H;  4JV5 Q;  1BKB A;  4JBJ A;  2ZTD A;  3KF6 B;  4B3T Q;  4JI5 Q;  4LFB Q;  4DV1 Q;  4DR6 L;  3PIO A;  1A0I A;  5M3F H;  1X56 A;  4A3G G;  4YHH Q;  4WJ3 M;  2EQS A;  3J80 c;  2K5V A;  3KOJ A;  4A3I G;  2FXQ A;  2D62 A;  3CP0 A;  3J81 j;  2E2J H;  4NXN Q;  1N32 Q;  1PH6 A;  2Z6K C;  1KXL A;  4JI2 L;  4A3C G;  3PV0 A;  5FJ8 G;  4L5S A;  2NN6 G;  1N9W A;  3PIP A;  1YJW A;  3I4M H;  1CKN A;  1R9T H;  5BR8 Q;  2PI2 A;  4RG1 A;  2ID0 A;  3I4N G;  4DR5 Q;  4JI3 Q;  1N8R C;  1K0R A;  1U5K A;  1JMC A;  2WP8 J;  2NVT H;  2UXC L;  1B7Y B;  4IJH A;  1YNX A;  2K5H A;  2YU9 H;  3F1Z A;  1OXS C;  4DR2 L;  3J80 i;  4DR1 Q;  1TWF H;  4GNX A;  4L5R C;  3J7Z C;  2B3G A;  3CCL A;  2L15 A;  3PUZ A;  1A8V A;  3ULJ A;  4FDB A;  4DV3 Q;  3RZO H;  5AJ3 L;  2JA6 G;  1RL2 A;  4JI6 Q;  3D31 A;  2JA9 A;  1PH7 A;  1VQ8 A;  3U4Z A;  2I5M X;  4X66 Q;  4YWK A;  2Q2U A;  5C3E G;  2A1A A;  4GLV B;  2ZTE A;  1Q8K A;  3F8T A;  5DLQ E;  3W1B A;  4LF8 L;  3S2D H;  1PHJ A;  4LF9 L;  3W5O A;  3F2D A;  4KHP Q;  2EXD A;  2QEX A;  2HT1 A;  2Q2T A;  1HNX Q;  5JJK A;  1Z9F A;  4R4Q A;  5IWA Q;  4IJL A;  4A3B H;  1BBW A;  1QUQ A;  3KDF B;  4A4I A;  1IBK L;  2HHH Q;  1Q46 A;  4K0K Q;  1H95 A;  4A3D G;  5EAY A;  1PH3 A;  4GKK L;  1PVO A;  4POF A;  3PF5 A;  2JA7 G;  3T1Y L;  2JQO A;  1TXY A;  2UUA L;  3S16 H;  1NTG A;  1X3G A;  4PMW A;  1VQL A;  1NMF A;  2B63 H;  3F2B A;  3CC7 A;  5M3F G;  4GKJ Q;  5H1S E;  4OO1 G;  3EIV A;  1EIY B;  3LGJ A;  2I5L X;  4C3I H;  1D7Q A;  1YJN A;  3CCR A;  4HIM A;  5JEA J;  3BZC A;  5GQO A;  3I4M G;  2WB1 E;  4YY3 L;  4DR6 Q;  3UDG A;  1HZC A;  2IHE A;  4X62 L;  3H15 A;  1CKN B;  1KRS A;  4EX5 A;  4DV7 L;  3J7A 5;  1M90 C;  2KBN A;  3UDI A;  4KI0 A;  3I4N H;  1E24 A;  4JI2 Q;  1VQJ A;  1OXT A;  2K14 A;  5FLX c;  4X6A H;  3STB D;  4A3F H;  1CKO A;  1M1K C;  5JJL A;  1YI2 A;  4LFA L;  4GNX B;  1V9P A;  3JC6 6;  4A76 A;  1N33 L;  3G6E A;  3G48 A;  3HOU H;  1HR0 W;  3TRZ A;  2UXC Q;  4HIO A;  4JC0 A;  1SLJ A;  4DR2 Q;  5J3B A;  3GTJ H;  2WB1 G;  4GNX C;  4X65 L;  3STB C;  4A3E H;  4R4T A;  1KRT A;  1YJ9 A;  4OON A;  4AYB E;  5AJ3 Q;  3S1R H;  4JI1 L;  3TQY A;  3VDY A;  4GN3 B;  1KD1 C;  4A3B G;  2JA5 G;  1C7Y A;  4LF8 Q;  2R7Z H;  5JJI A;  5M5Y H;  4LF9 Q;  1QUQ B;  1LYL A;  1VQA A;  4HIK A;  2E2I H;  2E5L L;  1C9O A;  4YWL A;  4DPG A;  1VQM A;  2JA6 H;  2GVA A;  3G71 A;  3GTO H;  3PF4 A;  3E0E A;  1VQP A;  1IYJ B;  1I5F A;  1XNR L;  2B63 G;  1WJJ A;  2K52 A;  1IBK Q;  1PV4 A;  3I55 A;  1PYB A;  1X3F A;  3MEF A;  2UXB L;  2A8V A;  4GKK Q;  3RLO A;  5M5X H;  2RHS B;  2AWO A;  3K8A A;  4AYB G;  2IX1 A;  4DR7 L;  2MNA A;  1J5E L;  3CCQ A;  3K81 C;  3T1Y Q;  3HOY H;  3AYH B;  4JOI A;  4DV0 L;  2UUA Q;  1VQG A;  1Z47 A;  4JBK A;  3HOZ H;  4DV4 L;  4A75 A;  1HZB A;  3HKS A;  2R6G A;  3ER0 A;  1EWI A;  1V1Q A;  4JI0 L;  3HOV H;  1L0W A;  3CF5 A;  4P73 A;  3OTO Q;  1EIF A;  1YBY A;  1PYS B;  4P74 A;  2YTV A;  3RZD H;  2Q2I A;  1VQ7 A;  1YZ6 A;  2LSS A;  1L1O A;  2F3I A;  4YY3 Q;  1EQR A;  4A3F G;  3WWV A;  5LMU L;  3CXC A;  3CCE A;  4L5T A;  4X62 Q;  1EFW A;  4DV7 Q;  2YTX A;  4IPH A;  4NPS A;  2VQF L;  1G51 A;  3GTQ H;  3HOU G;  2ZJR A;  3M3Y H;  1K73 C;  3L0O A;  4MNO A;  1SRO A;  3K7U C;  1VQ4 A;  1YIT A;  1NMG A;  1U0L A;  1K8A C;  3CC2 A;  2IY5 B;  4LFA Q;  4P72 A;  3RLN A;  3CMA A;  2VQE L;  4A3E G;  4QQB X;  1BVS A;  2HIV A;  3Q8D A;  4UPA A;  4AIM A;  1N33 Q;  4KHZ A;  2RHQ B;  3MXN B;  4B3M L;  1LTL A;  1X54 A;  2OCE A;  4X65 Q;  1AH9 A;  2R7Z G;  1WCM H;  2AHO B;  4PG3 A;  1PH2 A;  4BXX H;  1VCI A;  4JI8 L;  3I2Z A;  3NEM A;  3OYY A;  3RLF A;  4IPG A;  3E9H A;  3GTP H;  4OWT B;  3ZJY C;  3AFQ A;  2F4V L;  2OWO A;  1GM5 A;  3M7N A;  3HKZ E;  3CCM A;  2I5H A;  5IYD H;  2E5L Q;  3PSI A;  5IY0 A;  2ZJQ A;  4BBS H;  3M4Q A;  4LUO A;  3HOY G;  3A0J A;  1Y1W H;  1I94 L;  1LM0 A;  4GN4 B;  4DAY B;  3HOZ G;  1J6Q A;  2C35 B;  2BA1 A;  2JA5 H;  1Q81 C;  4LF7 L;  2UXB Q;  4DV6 L;  1EOV A;  5FLM G;  3NEN A;  3HOV G;  4O2D A;  2GN5 A;  1J5E Q;  3KF8 B;  1K9M C;  1SMX A;  4DV0 Q;  3CPF A;  4JOI C;  1IBL L;  3IRB A;  4P75 A;  3CQZ H;  4DV2 L;  4HJ5 A;  5HY6 A;  1XPR A;  3HKZ G;  4R4O A;  3AQQ A;  1WOC A;  1L1O B;  1G6P A;  1NBW A;  1XMO L;  2PQA A;  2CQO A;  1X3E A;  1S40 A;  4JI0 Q;  2AMC B;  2ES2 A;  5JEA G;  2CWA A;  1IL2 A;  4LF4 L;  2LXK A;  3K0X A;  3S17 H;  2YTY A;  4GS3 A;  4LUZ A;  2R92 H;  4RMF A;  1L1O C;  3J81 c;  1IBM L;  4JCV E;  3AFP A;  5LMU Q;  2D0P A;  2JK8 A;  4QIW E;  4JBW A;  2VQF Q;  4GOP A;  3A5Z B;  1AE3 A;  2N49 A;  1PFS A;  2MO0 A;  3KJP A;  4HID A;  4XIG S;  4DAM A;  2MFI A;  1JJ2 A;  2ALY B;  2CKZ B;  4XTC S;  3JAM c;  4BY7 H;  4LFC L;  4GLA C;  4DUZ L;  2HQL A;  3T1H L;  2K50 A;  1MKH A;  1UE5 A;  2UUC L;  5IYC H;  1WCM G;  3PGZ A;  1FGU A;  1NY4 A;  2CWP A;  4BA1 I;  2VQE Q;  1S72 A;  4BXX G;  4ALP A;  3J81 i;  1UWV A;  5C0X J;  2EIF A;  2NVQ H;  2AKW B;  4B3M Q;  3CME A;  4OXP A;  5GAG C;  4BBR H;  1PH8 A;  3ULP A;  3S15 H;  3NBH B; 
#chains in the Genus database with same CATH topology
 1BF4 A;  2IX0 A;  4NP5 A;  5JOB A;  1O7L A;  5A2Q L;  1KQS A;  2CW0 C;  2B2V C;  1BCP C;  1GUO A;  1DD2 A;  1SYF A;  3DWA A;  5IP7 H;  4HJ7 A;  2ZM6 L;  3GTO B;  2B2W A;  1CKM A;  5C44 H;  1MJC A;  3S1N H;  5I2Y A;  1EYG A;  5HGQ A;  1KLG D;  2ZXO A;  4PZ6 A;  3HOY B;  5FO7 B;  3HS0 C;  4APV A;  3HOZ B;  1EU4 A;  1IBL Q;  2K6A A;  1SXT A;  3ND9 A;  3SR1 A;  1UE6 A;  4Y52 H;  4DV2 Q;  2IL8 A;  3W1G A;  3HOV B;  2VY3 A;  3ERS X;  3TRE A;  1XMO Q;  4DR4 L;  3A7A B;  2FJ2 A;  3GD7 A;  4DR3 L;  3AEV A;  2HCC A;  4GOP B;  1ZXT A;  3BDO A;  1IW7 D;  1IBM Q;  1JT8 A;  3BZD B;  5C3X A;  2I07 B;  1ET9 A;  5KRU A;  3S24 A;  4BBR G;  4IUN A;  2N3S A;  1Y1V H;  1WD1 A;  1PH4 A;  1IW7 C;  1B3A A;  1C4Q A;  2CH4 W;  5KIX A;  2UUC Q;  4OGQ C;  1JB3 A;  1HTP A;  5CMD A;  1EQT A;  2JEB I;  4A3L G;  3I56 A;  4Y7N H;  1V43 A;  1EIG A;  2BH8 A;  4KV6 A;  4QY7 A;  5D3I B;  1DJR D;  3SK6 A;  2N88 A;  3K7A H;  4NW2 A;  2Y0S G;  2CCZ A;  2LXJ A;  3UE0 A;  1WVL A;  4X3K A;  3L2P A;  1JOK A;  3ERQ A;  4RCN A;  1SNM A;  1X6O A;  4JYA L;  4BBS B;  1C0A A;  4CJ0 B;  4IOA A;  4JBM A;  3BJU A;  4PZ8 A;  1QE6 A;  4DK1 A;  3KFU A;  4A3K H;  1HNZ Q;  4A3J G;  1VQO A;  2JE6 I;  4YCV A;  2IHF A;  2QEJ C;  1ASZ A;  4A93 H;  3HOX G;  5ELD A;  3RN2 A;  3GP7 A;  1SNO A;  3FP9 A;  4K6D A;  3KJO A;  3CCJ A;  4DV4 Q;  4QJF A;  3NQT A;  4AYB B;  3UE1 A;  3TP6 A;  4LF5 L;  1HZA A;  4CHT B;  4IUV A;  2M00 A;  1CHQ D;  4CKB A;  1DON A;  5M9O A;  2EY2 A;  3CW2 C;  4ZQ3 A;  1HCZ A;  3CPW A;  4P71 A;  3S1M H;  3CKI B;  1ICW A;  4MTN A;  1HR0 Q;  1F9P A;  3FRP B;  1HUN A;  4QGU A;  4JI7 L;  5M3M H;  3G4S A;  1G29 1;  2NBF A;  2A6E D;  4IPC A;  1P16 A;  1GKH A;  5E7N A;  1NCV A;  3S15 B;  2PZU A;  3E5S A;  1XNQ L;  4DV5 L;  2NZ1 D;  4JI5 L;  5EKL A;  1SR3 A;  3CCU A;  4DV1 L;  2NN6 I;  4UP8 A;  5LMN Q;  2R7F A;  2A6E C;  3PUW A;  2PPB C;  1N32 L;  2KCC A;  4B3R Q;  3KF6 A;  1OXX K;  2F0F A;  2KCT A;  1QNU A;  5C44 B;  3VYT A;  3S1N B;  1E22 A;  4J1M A;  4X64 Q;  4A3G H;  3BU2 A;  1OXV A;  4C2M H;  5FO8 B;  2QA4 A;  2UUB Q;  2UXD Q;  2EJM A;  4DR1 L;  5M5X B;  3GTK H;  2XNA C;  5C5M A;  4DV6 Q;  4QL5 A;  4GN5 A;  1DCZ A;  2QGQ A;  1HRJ A;  3I4N H;  3DWQ A;  2WAQ G;  4KKS A;  5E3F A;  4ZUI A;  3GTL H;  1H9J A;  1V1P A;  1GD7 A;  4V0B A;  5LMN W;  4CKE A;  1CA5 A;  2K5N A;  2JJQ A;  4DNI A;  1HNX L;  3HKZ B;  4M8A A;  5G3L D;  4DK6 C;  1STE A;  3RR5 A;  5J22 A;  3SGI A;  3U9O A;  1NE3 A;  3GTQ B;  3RN5 A;  3EN2 A;  4YCW A;  1K3B C;  1Y1V B;  3PIP 3;  2TMP A;  4FXK C;  3QJY A;  3KDF A;  1N34 Q;  4G4K A;  1MIU A;  4J6H A;  2A68 D;  4AQY Q;  4Y7N B;  4QMG A;  3A8J E;  1A2U A;  1FJG Q;  2J0T D;  2LMC B;  5ELO A;  4JV5 Q;  3KF6 B;  4B3T Q;  4LFB Q;  4DR6 L;  2A68 C;  4OO1 H;  2K5V A;  4A3I G;  1ENF A;  4NXN Q;  1PH6 A;  2Z6K C;  5EGT A;  5EKI A;  4A3C G;  2O2L D;  2NN6 G;  4L5S A;  4ME5 A;  1R9T H;  1LT6 D;  4CDC C;  3I3C A;  1XX8 A;  2F0I A;  4JI3 Q;  3NTH A;  1N8R C;  1K0R A;  3HGB A;  2WP8 J;  1YNX A;  2K5H A;  3F1Z A;  3HZX A;  1YNJ D;  4K5W A;  1OXS C;  1X3Q A;  4L5R C;  2RSO A;  4HN7 A;  3J7Z C;  2B3G A;  2L15 A;  3PUZ A;  1A8V A;  1V1P B;  4FDB A;  1I4Q A;  3NPP A;  2JA6 G;  4CJ2 C;  3IL8 A;  4JI6 Q;  3D31 A;  5T1G A;  1ILQ A;  2CQA A;  1I4G A;  4X66 Q;  4R9W A;  3R2T A;  1YNJ C;  5C3E G;  2A1A A;  4OEL B;  3W1B A;  5FK9 C;  4LF9 L;  2QEX A;  2Q2T A;  1TVX A;  1FD7 D;  3NTK A;  2EY1 A;  5IWA Q;  3VYS A;  3TBI B;  4A3B H;  3KDF B;  4K0K Q;  1CK1 A;  3S1M B;  2IWH A;  1PVO A;  2JA7 G;  2JQO A;  3S16 H;  2EVB A;  1VQL A;  2B63 H;  1AFP A;  3F2B A;  1IHZ A;  1S5D D;  5M3F G;  3OIP A;  4GKJ Q;  2HDL A;  4BBR B;  3V05 A;  1EIY B;  1YJN A;  3CCR A;  4HIM A;  5GQO A;  3I4M G;  1I6H B;  3GTG B;  5CGK A;  5BN3 A;  3SK4 A;  4DV7 L;  2A5H A;  2Z8L A;  2KBN A;  3UDI A;  3OMC A;  3ND8 A;  4ZAI A;  2ENB A;  4JI2 Q;  2F0M A;  1OXT A;  4A3G B;  4C2M B;  3STB D;  4H13 C;  3RMH A;  2DJG C;  4DNR B;  2V4D A;  2OXP A;  2B8F A;  2OT2 A;  3TN2 A;  2UXC Q;  1L0X B;  1F9Q A;  5J3B A;  3I4N B;  2NN6 H;  2K1B A;  3STB C;  3EVQ A;  4DFA A;  4R4T A;  4C1N K;  3GTL B;  4AYB E;  4A3J B;  1NSN S;  4F8M A;  1RTN A;  2F3W A;  2O4X A;  1TT2 A;  4ABN A;  5JJI A;  1VQA A;  1LYL A;  4HIK A;  2AUK A;  1C9O A;  2KA7 A;  4DPG A;  2LKV A;  2JA6 H;  1I4R A;  4PMB A;  3QG1 A;  2K01 A;  1K28 A;  1GHK A;  2L0C A;  3RLO A;  2RHS B;  2AWO A;  2SDF A;  2MNA A;  5J39 A;  3K6O A;  2Q8R E;  1C48 A;  3NE5 B;  4B9W A;  1O78 A;  4DV4 L;  1JWS D;  1HZB A;  2M9V A;  3ER0 A;  1S5C D;  1EWI A;  1V1Q A;  3G7L A;  5HUR A;  4JI0 L;  3CF5 A;  2ZXP A;  3OTO Q;  3RZD H;  1QJO A;  4JVZ A;  5COY A;  4L63 B;  3CRL C;  1D1I A;  4YY3 Q;  2IJ0 A;  5LMU L;  3CXC A;  1RHP A;  2VQF L;  1BBX C;  1R9T B;  1VF7 A;  4L8J A;  1K8A C;  2XWB B;  4LFA Q;  3CMA A;  3RLN A;  2IY5 B;  4A3E G;  3Q8D A;  2HIV A;  3SDZ A;  2OF1 A;  3K59 A;  1LTL A;  4X65 Q;  2Z6B A;  5F2D A;  1WCM H;  2R7Z G;  1VCI A;  3NEM A;  2B2V A;  4BS9 A;  3FDT A;  4OWT B;  1RTO A;  4RGO S;  1STA A;  1D6E C;  3HKZ E;  1EEI D;  1DOM A;  3BDL A;  2ZJQ A;  4LUO A;  3HOY G;  1ESR A;  1I4X A;  4A3B B;  4GN4 B;  3HOZ G;  1G8Z D;  3NSW A;  1J6Q A;  4RH6 A;  5DAU A;  1Q81 C;  5LL6 S;  5ISR A;  4DV6 L;  3HOV G;  1K9M C;  2B63 B;  4DV0 Q;  4JOI C;  5AFW A;  3IRB A;  3MWY W;  4EGV A;  4HJ5 A;  5CR3 A;  2L55 A;  1PDQ A;  2MJ8 A;  3AQQ A;  1IKL A;  2PQA A;  5IGF A;  1ML0 D;  1X3E A;  1S40 A;  1S5F D;  3C2P A;  3I90 A;  3VA5 A;  4V19 0;  2LXK A;  3K0X A;  4LUZ A;  4GS3 A;  1WTH A;  1L1O C;  1DZ1 A;  1M4V A;  1LAB A;  1LTI D;  3A5Z B;  2N49 A;  1AE3 A;  1JE4 A;  1PFS A;  2MO0 A;  4HID A;  4XTC S;  2CKZ B;  4ZK9 B;  4GLA C;  3T1H L;  2K50 A;  1UE5 A;  3PQI A;  1GUW A;  5HGT A;  1SJE D;  5BN4 A;  1SNP A;  3J81 i;  1UWV A;  1PTO F;  3N52 A;  2NVQ H;  2AKW B;  4B3M Q;  3C46 A;  4OXP A;  5K36 H;  3QOJ A;  1BCP B;  1FGB D;  2F3V A;  5IYD G;  2N8N A;  1K3R A;  4BBS G;  4JI8 Q;  1X65 A;  4HMJ A;  4G7Z C;  3S14 H;  4R1J A;  4UP7 A;  1GXD C;  3MC0 B;  2CFM A;  2JA6 B;  4YIJ A;  1SAP A;  1BO0 A;  4CDF C;  4FO2 A;  1YHA A;  1I94 Q;  4DK3 C;  3M9B A;  4XDX A;  1LTR D;  2VW9 A;  4JK1 C;  4QF4 A;  1YHB A;  3CCS A;  4NXM L;  2PQA B;  3GO5 A;  4DAY A;  4LJZ C;  3OWE B;  3FPU B;  4ZKB B;  2QIL A;  3I4O A;  3TP8 A;  4OHJ A;  3RZD B;  2JA7 B;  2JN4 A;  4C1N I;  1PA6 A;  1L2F A;  4IUU A;  1I4H A;  1MSH A;  3E6Z X;  4FNF A;  5IWA L;  1F2M A;  1AW7 A;  2WAC A;  5M5W H;  5IYC G;  4IFD J;  4JI4 L;  2Y0S E;  1T9H A;  4CBV A;  3E3X A;  2XRS D;  3CAM A;  1JWU D;  1IZ6 A;  4YWM A;  1QVG A;  4DUY L;  1Q1B A;  2F0D A;  4HJ8 A;  4UY8 C;  3I4M B;  4DUZ Q;  4LF6 L;  5FLX L;  1FVI A;  3GV6 A;  1BBU A;  1TWH H;  2PNH A;  1Y14 B;  3H0G G;  1PRT D;  4DA2 A;  5E4X A;  1ASY A;  1WCM B;  3Q23 A;  1VQ9 A;  1VQH A;  5JAV A;  3RZO B;  5IP7 G;  4XYO A;  4C3H H;  5C44 G;  1E1T A;  1PRT C;  1HNW L;  4RFB A;  2IT1 A;  2RBM A;  4Q0F A;  3KUP A;  5FO9 B;  1KDA A;  4QIW B;  5I9O A;  3MA2 B;  3DLL A;  3PUX A;  4B3S Q;  1QZH A;  2AQ2 B;  3MEH A;  3AMU A;  2J7Z A;  2R61 A;  2VUM H;  1CZW A;  2OQK A;  2VB3 X;  1VQB A;  2XVS A;  3CC4 A;  5C4Z A;  1SFO H;  1PZJ D;  4RHR A;  1QB5 D;  1PH1 A;  1P8L A;  3KBG A;  3GTM H;  2EYJ A;  4I7Z C;  4LAA A;  3MXP A;  3VR5 A;  2UU9 L;  4XQN A;  3U9S A;  2NB0 A;  5DM7 3;  5IYB H;  1F77 A;  1N36 Q;  1XMQ L;  1BQQ T;  1SNQ A;  3NWT A;  2EYF A;  1ESF A;  2R93 H;  1Y1V G;  2RQX A;  2Z4H A;  3O13 A;  1OTC A;  3J7A F;  3R2I A;  3C1E A;  5IGG A;  3PUV A;  3ITP A;  4IFD H;  4HMI A;  3EA6 A;  1A15 A;  4ZYS A;  1ZKO A;  1QVC A;  1LAC A;  1NJI C;  2F0K A;  4O0A A;  3T4A C;  2QKI C;  1QZG A;  1G91 A;  3L9A X;  3I91 A;  1E1O A;  3BDC A;  3P75 A;  3OTO L;  2GA4 B;  2K75 A;  2NYZ D;  2OTJ A;  3S14 B;  3KLW A;  4YHH L;  2V1C C;  1W2B A;  2WAQ E;  1LT3 D;  2MPM A;  2ZTC A;  3H0G H;  2FIN B;  2Z6K A;  4A3K G;  1ENA A;  2DUD A;  2R7Z B;  3KBX A;  2NWG A;  3I7F A;  2O5J C;  1UE1 A;  4A93 G;  3VYU A;  4OX9 Q;  3V2T A;  2RCF A;  1FL0 A;  3T53 B;  3UI2 A;  3K57 A;  2VNU D;  2CVR A;  1JB7 A;  1LO5 D;  4ME3 A;  3T51 B;  1GO3 E;  3K58 A;  4H44 C;  2HIX A;  1II3 A;  3DXJ C;  2NTS A;  1VQ5 A;  3OPO A;  4DV3 L;  1PH9 A;  2F0W A;  5EPJ A;  3ULL A;  5JJZ A;  2EOT A;  1VQD A;  2YYZ A;  1WTV A;  1K8G A;  4AH6 A;  4KHP L;  3DUZ A;  1EEF D;  3U58 A;  4OWX B;  3J81 L;  5IT9 c;  5M3M G;  1TKW B;  2HHH L;  4K6L A;  2HDM A;  4HSV A;  4R4C A;  3JAM L;  4OO1 I;  2K7V A;  2JP1 A;  1TWH B;  2NVX H;  4A3D H;  4L5Q A;  2K33 A;  1EY6 A;  2E2D C;  4G57 A;  3FMC A;  1TS4 A;  3U50 C;  3A8I E;  4JBJ A;  2FHT A;  4FP5 D;  4C3H B;  2EXZ A;  3PIO A;  3IKJ A;  3PMF A;  4A3G G;  4WJ3 M;  2KQ3 A;  3J81 j;  1KXL A;  1V1O A;  1F9S A;  1QOH A;  4ZLT F;  3QOL A;  1N9W A;  5KYI A;  5BR8 Q;  2PI2 A;  2ID0 A;  3I4N G;  1MGS A;  4DR5 Q;  2VUM B;  1STB A;  1Q90 A;  1SFO B;  2NVT H;  1LTB D;  1EYD A;  4DR2 L;  3J80 i;  1RJT A;  2PNR C;  3P20 A;  4DXF A;  3CCL A;  3ULJ A;  3TZD A;  1RL2 A;  1KNA A;  4K2L A;  1Q8K A;  1BCP F;  5DLQ E;  4LF8 L;  1SNC A;  2F0N A;  2F0V A;  3BYT B;  1CFM A;  1D1K A;  1G2T A;  1BBW A;  2J4X A;  1IBK L;  3C1F A;  1Q46 A;  2F0Q A;  2K04 A;  3PF5 A;  1XXG A;  2BDO A;  2H1E A;  2Z4I A;  1EWC A;  1NMF A;  3H09 A;  1YNN C;  4OO1 G;  4N8X 1;  2PMZ B;  3VR3 A;  2I5L X;  1EL0 A;  4LMQ D;  2KJX A;  1F9R A;  1D5M C;  4NKL A;  3NXW A;  1PZI D;  3H0G B;  4X62 L;  4X3S A;  2IW3 A;  5IOC A;  3HG9 A;  1B2T A;  3H6M A;  4X6A H;  1QG7 A;  5JJL A;  4MIU A;  3AU7 A;  4HR7 B;  1UAP A;  4DGZ A;  3JC6 6;  1N33 L;  2F0S A;  2B2Y C;  3HOU H;  1HR0 W;  3CU7 A;  4JC0 A;  3IAY A;  3P1H A;  1YJ9 A;  3MXN A;  1CQV A;  1E2V A;  2D2C C;  5AJ3 Q;  3S1R H;  3TQY A;  3K0Y A;  3SK5 A;  1BXT A;  4GN3 B;  4RHS A;  4A3B G;  2JA5 G;  4QUF A;  1PZK D;  3QO2 A;  3ONA B;  2E5L L;  1J8I A;  2GVA A;  3VR2 A;  4OEM B;  1VMP A;  4GZY C;  5IT9 E;  2B63 G;  2K52 A;  3I55 A;  1PYB A;  2UXB L;  1SEB D;  4GKK Q;  1J5E L;  3CCQ A;  3T1Y Q;  1MSG A;  3AYH B;  1BUV T;  4JOI A;  2UUA Q;  1H9S A;  2RDF A;  4JBK A;  4A3D B;  4KKU A;  2NVX B;  1LTT D;  2X6L A;  4IUT A;  4HAE A;  1L0W A;  4P73 A;  4PMC A;  1PYS B;  2YTV A;  1VQ7 A;  3K7A B;  1L1O A;  2F3I A;  4HSP A;  1VF5 C;  5FOB B;  1EFW A;  3Q0A A;  2WKD A;  3MXU A;  4N8F A;  2KCN A;  3M3Y H;  1S5E D;  4ZUJ A;  4MNO A;  1ILP A;  3K7U C;  2C5C A;  4KY6 A;  1EY0 A;  4O42 A;  2NVT B;  1B3Q A;  2K05 A;  2VQE L;  4A3K B;  4ODG A;  1SYE A;  1FNW A;  4KHZ A;  2CH4 A;  2RHQ B;  2EJF C;  3MXN B;  3W2D A;  5CBA E;  1WTQ A;  4A93 B;  2R3Z A;  2E76 C;  4BXX H;  1PH2 A;  5A2Q E;  1ICF B;  3DEP A;  3RLF A;  2WB1 B;  3S9W A;  3NBH A;  3E9H A;  4NMZ A;  3GTP H;  1IL8 A;  3DMU A;  3SEB A;  2MGS A;  3AFQ A;  3M7N A;  5EKK A;  1AP0 A;  1TY2 A;  2B2T C;  1Y1W H;  4WJW A;  3URY A;  1U9R A;  2C35 B;  2JA5 H;  1H9S B;  2EE1 A;  1EYC A;  1IBL L;  5M3M B;  2KHS A;  5K5P A;  2RKS A;  1JIC A;  3CQZ H;  4DV2 L;  1XPR A;  5HY6 A;  1ZEQ X;  1TS2 A;  1JOQ A;  1L1O B;  1G6P A;  1XMO L;  5C4H A;  1QWY A;  3K5M A;  2CWA A;  4PV1 C;  2YTY A;  5I4D A;  2R92 H;  2D9U A;  3SK8 A;  1IBM L;  4JCV E;  4ULL A;  2JK8 A;  2B8G A;  3KLR A;  1CM9 A;  3J80 L;  1B4O A;  1IYU A;  1CZG A;  4K2K A;  2MFI A;  3HRZ C;  4BY7 H;  4TSS A;  5LL6 X;  4KJO A;  2HQL A;  1HTL D;  1MKH A;  2UUC L;  1WCM G;  1JOO A;  5G3L F;  3KK7 A;  4BA1 I;  4DAP A;  5C0X J;  2WV6 D;  3CME A;  3GTK B;  2F0P A;  4RKB A;  1PH8 A;  1D2B A;  3NBH B;  2Z9H A;  1SND A;  3S1R B;  4A3M H;  2Z0S A;  1ENC A;  2F0G A;  5COR A;  1EQQ A;  4BY1 H;  4FF2 A;  4ZRZ A;  1HUM A;  2NUC A;  2SOB A;  4LWC A;  2OEO A;  4I65 A;  1EIH A;  4H02 A;  1H9M A;  4C3J H;  5IP9 H;  2AUJ D;  1HNZ L;  1JJC B;  2K5W A;  4LF7 Q;  1W3S A;  4O1N A;  2N78 A;  4UP9 A;  3NK9 A;  1S3O A;  2N55 A;  1E3P A;  1WTO A;  1Q8I A;  2I0Q A;  1NUC A;  3RNU A;  1DM0 B;  4BWG B;  4DKA C;  2XGT A;  4XT1 B;  4LF4 Q;  4IN3 A;  3NHH A;  1UEB A;  5GAE C;  1O7Y A;  1NAP A;  5I9P A;  1LV9 A;  1SBB B;  2XTI A;  3WOF A;  4LFC Q;  5E1F A;  5K36 G;  1HJP A;  2ATW A;  1HR0 L;  1B70 B;  5L37 A;  4CKC A;  2L9H A;  4TRD A;  3LWU A;  3Q24 A;  1X9N A;  1UEA B;  4M1U B;  1NR4 A;  2D0O A;  3S1Q H;  5GAD C;  3OWF A;  4LW1 A;  3TS0 A;  1TWC H;  5I6W A;  2WIN B;  1PRT B;  5C0X H;  1TQO A;  1TR5 A;  1G6Z A;  5KEE A;  3GTP B;  1IYV A;  2PZW A;  1TS5 A;  5LMN L;  5JPN C;  2G5D A;  2ASB A;  3LNN A;  3FPP A;  5DM6 3;  1WTP A;  2QDB A;  2AQ1 B;  4FF4 A;  4B3R L;  5C4X H;  2KEC A;  4IO9 A;  3SVM A;  1Q3L A;  2ZM6 Q;  4KY5 A;  4X64 L;  1Y1W B;  3TS2 A;  3EFX D;  3L7Z C;  3RUZ A;  2BH2 A;  2JA5 B;  2F03 A;  2UUB L;  2UXD L;  1Y69 U;  5I2X A;  1JWM D;  4QUC A;  3U4V A;  1E2Z A;  2JA8 H;  4ILW A;  1WYD A;  1I50 H;  1TWG H;  5KNC A;  1BOS A;  3S16 B;  3H3V H;  3PUY A;  4DR7 Q;  3CQZ B;  2BDN A;  3J7Y W;  2BA0 A;  1EY5 A;  3PO2 H;  4IFD I;  3PO3 G;  2EYP A;  4DR4 Q;  4TVA B;  4IAL A;  1XYI A;  4ID6 A;  3MZ5 A;  3K5N A;  2R92 B;  4DR3 Q;  3SE0 A;  1QNK A;  2X69 A;  1Q86 C;  1CUK A;  1KIX A;  1IXR A;  4KN4 C;  5CV7 A;  1DGS A;  4KN7 C;  4FVM A;  4TKO B;  3BZK A;  3NEL A;  4KLK A;  2A69 C;  4DN4 M;  1N34 L;  3A5U A;  1YHQ A;  1VDZ A;  3TP5 A;  1J9O A;  3VR4 A;  3ICE A;  5GAH C;  4KJN A;  1Z7T A;  3FKI H;  3WDN A;  4AQY L;  1QVF A;  4C3H G;  1WI5 A;  2XWJ B;  4G7O C;  3K5O A;  2PW7 A;  1QIL A;  1FJG L;  1BDO A;  4JV5 L;  4A3M B;  2VXW A;  2DN8 A;  3H94 A;  3VR6 A;  1NR2 A;  4B3T L;  4LFB L;  1AE2 A;  4BY1 B;  4NB3 A;  3JAM i;  3NUC A;  1STG A;  2B2U C;  4NXN L;  1U4L A;  2VUM G;  4JYA Q;  1XWE A;  2EYO A;  1H9K A;  1B8A A;  1SYD A;  1Q1E A;  2A6H D;  4C3J B;  2DY8 A;  1PH5 A;  4KD4 A;  4JI3 L;  1X55 A;  4JPB W;  4S3S A;  3A8K E;  5FJ8 H;  1AZQ A;  4KHV A;  2L5T A;  4MTK A;  5IYB G;  3UDF A;  2A6H C;  4HJ9 A;  1VQI A;  2JEA I;  2R93 G;  4JI6 L;  5C5L A;  1CSQ A;  1CSP A;  4X66 L;  4RA8 A;  2OTL A;  2R7D A;  1I6V C;  3QR8 A;  3PIO 3;  4IFD G;  1SRU A;  2NVY H;  4CJ1 B;  4LF5 Q;  2WFW A;  1RIP A;  3PO3 H;  1HZ9 A;  3OMG A;  4K0K L;  5C4J H;  1KC8 C;  1VQF A;  3HFZ B;  2PO4 A;  2E8G A;  3KYH C;  1DXM A;  3FHW A;  1HHV A;  3NTI A;  1VQK A;  4JI7 Q;  1V8Q A;  3D6W A;  4HJA A;  3EJI A;  3S1Q B;  1KAB A;  1GUG A;  1I4P A;  1UE7 A;  2EZV A;  4GKJ L;  1TWC B;  2NZH A;  1KNE A;  3CCV A;  1XNQ Q;  5FKA C;  4DV5 Q;  1BKB A;  1X3P A;  2ZTD A;  4JI5 Q;  4DV1 Q;  2QDL A;  3M7G A;  1EY4 A;  1EYA A;  2EQS A;  2TSS A;  2FXQ A;  2XN9 C;  3CP0 A;  3NBI A;  2E2J H;  1N32 Q;  3TP7 A;  4JI2 L;  5C6A A;  3PV0 A;  1YJW A;  1CKN A;  1STH A;  4F88 A;  4RG1 A;  1D5X C;  3SHL A;  2ZXR A;  3SXH A;  1JMC A;  3L3O C;  2B2Y A;  1KTK A;  2UXC L;  4IJH A;  5ELE A;  1VMC A;  1I50 B;  3TDQ A;  1TWG B;  2EYM A;  2PCF B;  4DR1 Q;  1TWF H;  4U68 A;  1RDP D;  1CI3 M;  4FXD A;  4IUP A;  2A73 B;  4I7A A;  1PMR A;  1PH7 A;  1VQ8 A;  4YWK A;  3IFT A;  4WRD A;  3F8T A;  3S2D H;  1PHJ A;  3W5O A;  2KOL A;  2EXD A;  1KDB A;  3FEW X;  3TME A;  5JJK A;  1HNX Q;  4OIJ A;  3DM1 A;  5KNB A;  1A6X A;  4IJL A;  4ZKC B;  1QUQ A;  4A4I A;  4FF3 A;  2F0O A;  5D65 A;  4A3D G;  2KUM A;  5DEH A;  4CGY B;  1E2W A;  2VB2 X;  1GJX A;  2MP1 A;  4K14 A;  4POF A;  1B1Z A;  1TXY A;  3I4L A;  1A3T A;  1NTG A;  2G9H D;  3FKI B;  5BN5 A;  2NVQ B;  4DXG A;  3MTS A;  2BOS A;  5H1S E;  3KLS A;  4H7B A;  4F7X A;  1STN A;  4C3I H;  1EY8 A;  2L12 A;  5JEA J;  4YY3 L;  3E0J A;  4DR6 Q;  2IHE A;  3H15 A;  1CKN B;  4EX5 A;  4KI0 A;  1E24 A;  1RKN A;  1FNV A;  2K14 A;  3H91 A;  4PNY A;  3D6C A;  5FLX c;  4A3F H;  1CKO A;  1M1K C;  4LFA L;  1K0S A;  1V9P A;  4A76 A;  3G6E A;  1G2S A;  3G48 A;  3TRZ A;  4DK0 A;  1SLJ A;  2RDG A;  4F87 A;  2WB1 G;  4GNX C;  4XXE A;  4X65 L;  1O7Z A;  2L4N A;  2FMC A;  2ICI A;  3CRK C;  2RSN A;  1UNS A;  3RD4 A;  1KD1 C;  1C7Y A;  1PRT F;  1JCK B;  1HFN A;  5M5Y H;  4LF9 Q;  1QUQ B;  2NVY B;  2E2I H;  2B2T A;  4YWL A;  2KED A;  2HUG A;  5M5W B;  3G71 A;  3PO3 B;  3E0E A;  3QIA A;  2F1M A;  5C4J B;  1MBY A;  2F0L A;  1WJJ A;  1PV4 A;  3MEF A;  3Q6S A;  3A55 A;  5M5X H;  2IX1 A;  4DR7 L;  3K81 C;  4DV0 L;  3C3L A;  1Z47 A;  2F0H A;  4A75 A;  3HKS A;  2R6G A;  1ET6 A;  1PFM A;  3R8B A;  1EIF A;  1AZP A;  4XYQ A;  4K5X A;  4UHV A;  3CCE A;  3N6R A;  2E2J B;  4DV7 Q;  1HQR D;  1ROD A;  4NPS A;  5JEA H;  4J8Q A;  3GTQ H;  3HOU G;  3NQI A;  2ZJR A;  1PTO H;  3L0O A;  1SRO A;  1SYC A;  1U0L A;  4P72 A;  4QQB X;  1BVS A;  5J1Z A;  3P7J A;  5D14 A;  2DY7 A;  1SJH D;  1TWF B;  1XTC D;  3BVZ A;  4R8I A;  4B3M L;  4RWS C;  3OOC A;  2OCE A;  3MAQ A;  4PG3 A;  3GTM B;  2HD3 A;  4JI8 L;  1JOR A;  4DNT B;  2EPB A;  1R4Q B;  4KMU C;  4IPG A;  3H3V C;  3S2D B;  1SDF A;  3D4W A;  1H9R A;  4P2C B;  5T1I A;  1SSO A;  2I5H A;  4X3T A;  2R93 B;  3M4Q A;  4RGM A;  3MFY A;  1I94 L;  3DHQ A;  2IX3 A;  2BA1 A;  5A35 A;  1YNN D;  1EOV A;  5FLM G;  3BS1 A;  2GN5 A;  1SMX A;  3CPF A;  3OIQ A;  4P75 A;  1CQF A;  4R4O A;  4C3I B;  5EBD A;  1HXY D;  4CDD C;  4JI0 Q;  2AMC B;  2ES2 A;  1Z6H A;  3GQB A;  1S5B D;  3ZYY X;  3M4Y A;  1IL2 A;  3S17 H;  1LT5 D;  2X6G A;  3J81 c;  2CHB D;  5LMU Q;  2D0P A;  2G9D A;  4QIW E;  1B44 D;  2VQF Q;  3KJP A;  2SEB D;  4DAM A;  2DNC A;  3JAM c;  5CV8 A;  4A3F B;  2ZT9 C;  4DUZ L;  5CV5 A;  5FLX E;  1EY7 A;  1T5E A;  1FGU A;  1NY4 A;  1SYG A;  4BXX G;  1K8M A;  4ALP A;  5CC4 A;  4BBR H;  2LY7 A;  4NDX A;  5IE8 A;  4IUR A;  1A62 A;  1F2Y A;  1SYB A;  4B9X A;  1WD0 A;  1GVP A;  4DU9 A;  1I6H H;  5DNF A;  3GTG H;  3AB9 A;  2AWN A;  2K4K A;  1CT1 D;  5GRO A;  4A3L H;  1Y1W G;  5M5Y B;  1WTR A;  2LFN A;  2XSC A;  1BR9 A;  1SE3 A;  1SMY D;  2E2I B;  1LLR D;  2KCM A;  3T56 B;  4B3S L;  3A74 A;  4FF1 A;  1RCV D;  1S4Z A;  1W6J A;  2EDG A;  2RCN A;  2KHJ A;  2LS0 1;  1SMY C;  1VQN A;  4J15 A;  2RA4 A;  1ZYR D;  2VS1 A;  1PFN A;  2R92 G;  4A3J H;  3M4O H;  4RKL A;  3CHB D;  3HOX H;  5FLM H;  3EBE A;  4N9P A;  2KEE A;  1N36 L;  4XQJ A;  1ZYR C;  4BY7 G;  4HCE A;  4IOC A;  3QB3 A;  3MXG A;  4OL7 A;  3D0F A;  3TEH B;  1A63 A;  4WJ4 A;  1EY9 A;  4N9T A;  2K5Q A;  5C0X I;  4GOP C;  1PTO B;  2OQ0 A;  3S2H H;  1PYW D;  4LNQ A;  1GHJ A;  3T1H Q;  4C56 C;  1VQE A;  3Q22 A;  4A3M G;  1XJV A;  3ERO A;  1OXU A;  2NZO A;  4BY1 G;  4RGT A;  1VQC A;  2QCP X;  2XRQ D;  3M85 A;  1DOK A;  2H5X A;  2P5Z X;  4JI1 Q;  2B2U A;  4K5V A;  1Q82 C;  4C3J G;  3H3V I;  1Y8N B;  5IP9 G;  2Q8I B;  4XQQ A;  1IKM A;  3HOW G;  1YEZ A;  5JVG 3;  4IQZ A;  4JG2 A;  2JYO A;  4OX9 L;  5IGD A;  2B2W C;  1I3Q H;  1B53 A;  5IIF A;  4KY7 A;  1YVC A;  2EYL A;  2AQ3 B;  5EPL A;  1OO9 B;  3MVV A;  4WFN 3;  1XNR Q;  3CD6 A;  3BVM A;  1PXU A;  3NP8 A;  1EZ8 A;  1VQ6 A;  3PCO B;  4NXM Q;  2JXM B;  2Q2H A;  1LTS D;  1SE8 A;  3M4P A;  1JJG A;  4EQ5 A;  1LUZ A;  1GOZ A;  1RF2 D;  2F52 A;  2KHI A;  1WFQ A;  3S17 B;  4WOR A;  4EVO A;  3F2C A;  1EFI D;  1O7I A;  2VL6 A;  2F4I A;  4CDE C;  4POG A;  3J81 E;  1K83 H;  2KEN A;  4OWW B;  4R4I A;  1A2T A;  4JI4 Q;  1MHW C;  2K5D A;  2VZA A;  3JAM E;  4DUY Q;  3HEJ A;  4LF6 Q;  1EU3 A;  1EQV A;  3GDE A;  4UDU C;  5C0X G;  1XPO A;  2MO1 A;  1MJE A;  3DM3 A;  2JSO A;  2K28 A;  2QF7 A;  3HOU B;  2DNE A;  2Z1C A;  2E2H H;  1STY A;  4HTH A;  4LUV A;  5LHY 1;  1JC7 A;  2MHV A;  5C4X G;  1Q7Y C;  1LTA D;  1SN8 A;  4Q5V A;  1AN8 A;  2ZJP A;  1SE4 A;  3MHB A;  5ELN A;  1XPU A;  2L11 A;  1FNU A;  5IGE A;  3K80 C;  4LK1 C;  2FFK B;  5EBC A;  1HNW Q;  2F4V Q;  2Y0S B;  2YV5 A;  1E7Z A;  1KAW A;  2B29 A;  2E75 C;  4MZ9 A;  2RDH A;  5BR8 L;  1A3U A;  2JA8 G;  2BE5 D;  4FXG C;  3PF4 A;  1HA6 A;  4IPD A;  4TQU S;  1EOT A;  4KKT A;  4DR5 L;  4A3I H;  1HH2 P;  1Y8P B;  1FYC A;  3UDX A;  4DAV A;  4EQO A;  3PO2 G;  4PQX A;  4A3C H;  4RAU C;  5CV9 A;  3HOW H;  1XTD A;  2A19 A;  3B6Y A;  4ZCK A;  3E9I A;  1RD9 D;  2BE5 C;  1O80 A;  3OW7 A;  2QW7 A;  1Q12 A;  1KL9 A;  2RF4 A;  3M4O B;  5IOD A;  2H4O A;  4YCU A;  5ELB A;  2UU9 Q;  3HOX B;  5CV6 A;  1EZ6 A;  2PMZ E;  2D5D A;  3W3A A;  4GLX A;  4R8N A;  1KHI A;  1ONL A;  2GVB A;  1JR0 D;  1YIJ A;  3VA7 A;  1XMQ Q;  1JE5 A;  1VS0 A;  1GUN A;  2PYK A;  2PI2 E;  3J7A V;  5JVH 3;  1JQY D;  1PTO D;  3S2H B;  5C3E H;  4PZ7 A;  1EUJ A;  3FKI G;  3M3Y B;  1WTX A;  2MQH A;  3DEO A;  3I8Z A;  2F0E A;  3D4R A;  5KGU A;  3LX0 A;  1CHP D;  1PTO C;  1D8L A;  4B08 A;  3D3R A;  2DGY A;  3OW2 A;  1HPC A;  1TY0 A;  1U4M A;  2JA7 H;  1BNZ A;  1TWA H;  5EQ0 A;  1A0I A;  5M3F H;  1X56 A;  4YHH Q;  4K8I A;  2SNS A;  3J80 c;  3KOJ A;  2D62 A;  4IZ8 A;  3QWN A;  1M8A A;  2L1B A;  1LTG D;  1UUP A;  5FJ8 G;  1MI2 A;  3PIP A;  2Q8T A;  3I4M H;  2SNM A;  2O5I C;  4IUQ A;  1I3Q B;  4KK7 A;  3V96 A;  1U5K A;  4L6T B;  3BVG A;  1B7Y B;  2YU9 H;  2NTT A;  1X32 A;  4GNX A;  4MHE A;  1CA6 A;  5CBE E;  4DV3 Q;  3OSO A;  3RZO H;  1GUT A;  5AJ3 L;  3LWE A;  2EY6 A;  2JA9 A;  3D8G A;  3U4Z A;  2I5M X;  1HFG A;  2Q2U A;  1Y8O B;  2WAQ B;  4GLV B;  2ZTE A;  4BA2 I;  2HCI A;  3FVQ A;  3HP3 A;  3F2D A;  4KHP Q;  2PQE A;  1W6K A;  1K83 B;  2K32 A;  2HT1 A;  2IPK D;  1KDC A;  1E0B A;  1Z9F A;  2A69 D;  2RVL A;  4R4Q A;  3WOE A;  2HHH Q;  1K8O A;  3I72 A;  5IGB A;  4BY7 B;  1H95 A;  5EAY A;  4U67 3;  1PH3 A;  4GKK L;  2PZT A;  2MUY A;  2WII B;  3T1Y L;  2UUA L;  1X3G A;  4PMW A;  2EY5 A;  2EYH A;  3CC7 A;  2E2H B;  5EJW A;  1DOL A;  2E74 C;  1CTM A;  1SE2 A;  3EIV A;  3R3O A;  3LGJ A;  1D7Q A;  4EQP A;  2ICE C;  1QCB D;  1TU2 B;  4HCS A;  3BZC A;  2WB1 E;  2I46 A;  3T13 A;  4G7H C;  2A74 C;  3UDG A;  1HZC A;  2B39 A;  1KRS A;  3A56 A;  3G6J B;  3J7A 5;  3GV3 A;  1FR3 A;  1T5X D;  1U4R A;  1M90 C;  4XT3 B;  4X3U A;  1VQJ A;  4A3I B;  1YI2 A;  4GNX B;  3F2U A;  1GUS A;  3HOW B;  2KVM A;  2C9O A;  4HIO A;  1HQM C;  4DR2 Q;  5NUC A;  3GTJ H;  5IGC A;  4A3E H;  4EQN A;  3OHX C;  1KRT A;  4OON A;  3D4D A;  4JI1 L;  3T16 A;  3VDY A;  3TZU A;  4FYD A;  4QCL A;  4LF8 Q;  2R7Z H;  4MN3 A;  1TS3 A;  5D3D A;  1VQM A;  5KND A;  5C3E B;  3GTO H;  1PFB A;  1VQP A;  1IYJ B;  1I5F A;  1TII D;  4H0L C;  1XNR L;  1IBK Q;  3K5L A;  1X3F A;  2F0J A;  2A8V A;  5CYU A;  3K8A A;  4AYB G;  4RCO A;  4C3I G;  3HOY H;  5TSS A;  2DJF C;  1VQG A;  3HOZ H;  1HA5 A;  3KF8 A;  1AEX A;  1TWA B;  3IFD A;  3HOV H;  1B9M A;  1R4P B;  1KLU D;  1YBY A;  4P74 A;  3X3N A;  2Q2I A;  5CV4 A;  5KYL A;  1YZ6 A;  2LSS A;  5M3F B;  3KLS X;  1EQR A;  4A3F G;  3WWV A;  1B50 A;  4L5T A;  4X62 Q;  3J80 E;  2YTX A;  4IPH A;  1G51 A;  5C4X B;  3MFG A;  4Z9C B;  1K73 C;  4UAI A;  1VQ4 A;  1YIT A;  1NMG A;  3CC2 A;  2YU9 B;  1N33 Q;  4UPA A;  1U4P A;  4AIM A;  2XIW A;  3BYY B;  1KAA A;  2BCO A;  4KD3 A;  5JPM C;  4JW0 A;  5EPK A;  2JA8 B;  5I6Y A;  1X54 A;  1AH9 A;  1NNX A;  3DWP A;  2AHO B;  2K03 A;  3I2Z A;  3OYY A;  3PO2 B;  3NWS A;  5E4W C;  5C3W A;  3ZJY C;  2F4V L;  4DF7 A;  2OWO A;  1GM5 A;  2M2L A;  3CCM A;  2WKC A;  1L0Y B;  5IYD H;  2E5L Q;  1D5Z C;  1EWH A;  4K8J A;  3PSI A;  5IY0 A;  4BBS H;  5ELF A;  3A0J A;  1F2L A;  3A54 A;  1LM0 A;  5IT9 L;  4DAY B;  3X3M A;  4LF7 L;  2UXB Q;  3NEN A;  4O2D A;  1A3V A;  4E6I A;  1J5E Q;  3KF8 B;  1F2Z A;  2EJG C;  3A7L A;  4QB4 A;  3HKZ G;  1WOC A;  1NBW A;  2HQE A;  2CQO A;  2FMM A;  5JEA G;  3BG3 A;  1WTW A;  4LF4 L;  4HED A;  3I70 A;  1LT4 D;  4RMF A;  2F0T A;  4KTA A;  2PW5 A;  3AFP A;  4JBW A;  4GOP A;  3EQL C;  1MD2 D;  1C8C A;  4XIG S;  2F0U A;  3R93 A;  1JJ2 A;  2ALY B;  3I73 A;  4LFC L;  1DYQ A;  1B9N A;  5IYC H;  3PGZ A;  2CWP A;  2VQE Q;  1S72 A;  2CW0 D;  3TSS A;  5ELC A;  3VYR A;  2EIF A;  3GTJ B;  1BCP D;  1PLF A;  5GAG C;  3ULP A;  4OIK A;  4RGN A;  3S15 H;  4A3E B; 
#chains in the Genus database with same CATH homology
 1A62 A;  2IX0 A;  5IYD G;  2N8N A;  4A3M H;  2Z0S A;  1K3R A;  1KQS A;  4BBS G;  1GVP A;  4JI8 Q;  4A3G H;  1I6H H;  1X65 A;  3GTG H;  3S14 H;  1EQQ A;  4R1J A;  2AWN A;  2K4K A;  4UP7 A;  5GRO A;  4BY1 H;  1Y1W G;  4A3L H;  2CFM A;  2KCM A;  5IP7 H;  4HJ7 A;  4B3S L;  4LWC A;  2ZM6 L;  1CKM A;  5C44 H;  1MJC A;  4H02 A;  3S1N H;  1YHA A;  3A74 A;  4C3J H;  1EYG A;  1I94 Q;  4DK3 C;  3M9B A;  5IP9 H;  5HGQ A;  2VW9 A;  1HNZ L;  1JJC B;  2RCN A;  2KHJ A;  4LF7 Q;  4PZ6 A;  1VQN A;  4J15 A;  4APV A;  5K36 G;  1W3S A;  1YHB A;  3CCS A;  2N78 A;  4NXM L;  2VS1 A;  2PQA B;  3GO5 A;  1IBL Q;  4UP9 A;  2R92 G;  1S3O A;  1UE6 A;  4Y52 H;  4DV2 Q;  1E3P A;  4A3J H;  3M4O H;  3W1G A;  2I0Q A;  3I4O A;  2VY3 A;  3RNU A;  3ERS X;  3TRE A;  1XMO Q;  3HOX H;  4DR4 L;  5FLM H;  3EBE A;  5IE8 A;  3GD7 A;  4DR3 L;  3AEV A;  1PA6 A;  1L2F A;  4DKA C;  1N36 L;  2XGT A;  4LF4 Q;  4GOP B;  4BY7 G;  4IOC A;  5IWA L;  1IBM Q;  1JT8 A;  1UEB A;  3D0F A;  3TEH B;  5M5W H;  5IYC G;  5GAE C;  4IFD J;  4WJ4 A;  1A63 A;  4JI4 L;  2Y0S E;  1T9H A;  5C0X I;  4GOP C;  2XTI A;  2OQ0 A;  3S2H H;  3CAM A;  4YWM A;  1IZ6 A;  3S24 A;  1QVG A;  4DUY L;  1Q1B A;  4HJ8 A;  4LFC Q;  4BBR G;  4LNQ A;  4UY8 C;  2N3S A;  1HJP A;  1Y1V H;  4DUZ Q;  3T1H Q;  1HR0 L;  4LF6 L;  1VQE A;  1PH4 A;  1B70 B;  2ATW A;  2UUC Q;  1FVI A;  4A3M G;  1XJV A;  1X9N A;  1OXU A;  1BBU A;  1TWH H;  2D0O A;  2NZO A;  2JEB I;  4BY1 G;  2PNH A;  1Y14 B;  3H0G G;  4LW1 A;  5GAD C;  3TS0 A;  3S1Q H;  4A3L G;  3I56 A;  1ASY A;  4Y7N H;  1V43 A;  1VQC A;  2BH8 A;  1TWC H;  4QY7 A;  1VQ9 A;  1VQH A;  3M85 A;  3K7A H;  5IP7 G;  2Y0S G;  2CCZ A;  2H5X A;  2LXJ A;  3UE0 A;  4C3H H;  5C44 G;  5LMN L;  1E1T A;  2ASB A;  4JI1 Q;  1Q82 C;  1HNW L;  3H3V I;  3L2P A;  2IT1 A;  5IP9 G;  4B3R L;  1X6O A;  5C4X H;  4JYA L;  3HOW G;  1YEZ A;  1C0A A;  4JG2 A;  4IO9 A;  4OX9 L;  3DLL A;  3PUX A;  4B3S Q;  2ZM6 Q;  1QZH A;  4X64 L;  3TS2 A;  3L7Z C;  4IOA A;  4JBM A;  3BJU A;  1I3Q H;  4PZ8 A;  2BH2 A;  1YVC A;  2VUM H;  3KFU A;  2OQK A;  4A3K H;  2UUB L;  2UXD L;  1XNR Q;  1HNZ Q;  4A3J G;  1VQB A;  1VQO A;  2JE6 I;  3CC4 A;  1SFO H;  4YCV A;  2IHF A;  3U4V A;  1ASZ A;  2JA8 H;  3CD6 A;  3HOX G;  4A93 H;  1WYD A;  1PH1 A;  1I50 H;  1TWG H;  1VQ6 A;  3PCO B;  1P8L A;  4NXM Q;  2Q2H A;  3H3V H;  3PUY A;  1SE8 A;  3RN2 A;  4DR7 Q;  3M4P A;  1JJG A;  4EQ5 A;  3GTM H;  3FP9 A;  1LUZ A;  2BA0 A;  3PO2 H;  2UU9 L;  4IFD I;  3KJO A;  2F52 A;  3CCJ A;  4DV4 Q;  3PO3 G;  2KHI A;  4QJF A;  4TVA B;  1WFQ A;  4DR4 Q;  3UE1 A;  3F2C A;  5IYB H;  4DR3 Q;  1O7I A;  1N36 Q;  2VL6 A;  1XMQ L;  2R93 H;  1Y1V G;  4POG A;  4LF5 L;  1K83 H;  2KEN A;  1HZA A;  1Q86 C;  4OWW B;  1CUK A;  4R4I A;  1KIX A;  1OTC A;  1IXR A;  4JI4 Q;  3CW2 C;  3PUV A;  2VZA A;  1DGS A;  3CPW A;  4P71 A;  4DUY Q;  3S1M H;  3BZK A;  3NEL A;  4KLK A;  4MTN A;  3GDE A;  1HR0 Q;  1N34 L;  4LF6 Q;  3A5U A;  1YHQ A;  4QGU A;  5C0X G;  1XPO A;  2MO1 A;  1MJE A;  3DM3 A;  1QVC A;  5M3M H;  5GAH C;  3G4S A;  1NJI C;  4JI7 L;  3ICE A;  3FKI H;  4O0A A;  4AQY L;  1G29 1;  1QVF A;  4IPC A;  1P16 A;  1GKH A;  2E2H H;  1WI5 A;  5E7N A;  1QZG A;  4LUV A;  1E1O A;  3OTO L;  1FJG L;  1XNQ L;  4DV5 L;  5C4X G;  1Q7Y C;  2K75 A;  4JV5 L;  1SN8 A;  2OTJ A;  4JI5 L;  2ZJP A;  1SR3 A;  4B3T L;  3CCU A;  1AE2 A;  3KLW A;  4NB3 A;  4DV1 L;  4LFB L;  3JAM i;  1XPU A;  2NN6 I;  5ELN A;  4UP8 A;  4YHH L;  2V1C C;  5LMN Q;  2WAQ E;  1W2B A;  2R7F A;  3K80 C;  3PUW A;  2ZTC A;  3H0G H;  4NXN L;  1HNW Q;  1N32 L;  2Z6K A;  2VUM G;  3KF6 A;  4A3K G;  1OXX K;  2DUD A;  4B3R Q;  2F4V Q;  4JYA Q;  2KCT A;  2YV5 A;  1E7Z A;  3I7F A;  1KAW A;  1UE1 A;  2B29 A;  4MZ9 A;  4OX9 Q;  5BR8 L;  2JA8 G;  1E22 A;  1B8A A;  4A93 G;  1Q1E A;  4X64 Q;  1FL0 A;  3BU2 A;  1OXV A;  4IPD A;  4TQU S;  4C2M H;  4DR5 L;  1PH5 A;  4JI3 L;  2QA4 A;  4A3I H;  1HH2 P;  1X55 A;  1JB7 A;  2VNU D;  3UDX A;  4ME3 A;  1GO3 E;  2UUB Q;  2UXD Q;  3PO2 G;  4A3C H;  2HIX A;  5FJ8 H;  3HOW H;  4DR1 L;  3GTK H;  1XTD A;  4QL5 A;  4DV6 Q;  2A19 A;  3B6Y A;  4GN5 A;  2QGQ A;  3E9I A;  3UDF A;  5IYB G;  1VQ5 A;  2WAQ G;  4DV3 L;  1VQI A;  4HJ9 A;  1PH9 A;  1Q12 A;  1KL9 A;  2RF4 A;  2JEA I;  3ULL A;  4YCU A;  2R93 G;  4JI6 L;  1CSQ A;  1CSP A;  1VQD A;  2YYZ A;  2UU9 Q;  3GTL H;  2PMZ E;  4BA2 I;  4X66 L;  4GLX A;  1GD7 A;  1KHI A;  5LMN W;  2GVB A;  2OTL A;  1K8G A;  4AH6 A;  4KHP L;  2R7D A;  1YIJ A;  2K5N A;  2JJQ A;  1XMQ Q;  4DNI A;  1JE5 A;  1VS0 A;  1HNX L;  4IFD G;  3U58 A;  1SRU A;  4OWX B;  2NVY H;  2PI2 E;  4DK6 C;  4LF5 Q;  3RR5 A;  5IT9 c;  3SGI A;  2WFW A;  1RIP A;  5M3M G;  1HZ9 A;  1NE3 A;  5C3E H;  4PZ7 A;  2HHH L;  3RN5 A;  1EUJ A;  3FKI G;  3PO3 H;  5C4J H;  1KC8 C;  1VQF A;  4K0K L;  3EN2 A;  4YCW A;  2MQH A;  3HFZ B;  2E8G A;  3KYH C;  3FHW A;  4R4C A;  4OO1 I;  3KDF A;  1N34 Q;  1VQK A;  4JI7 Q;  4HJA A;  1MIU A;  1D8L A;  4AQY Q;  2DGY A;  2NVX H;  3OW2 A;  4A3D H;  4GKJ L;  1UE7 A;  4L5Q A;  2NZH A;  2JA7 H;  3CCV A;  3U50 C;  1FJG Q;  1XNQ Q;  5ELO A;  4DV5 Q;  1TWA H;  4JV5 Q;  1BKB A;  4JBJ A;  2ZTD A;  3KF6 B;  4B3T Q;  4JI5 Q;  4LFB Q;  4DV1 Q;  4DR6 L;  3PIO A;  1A0I A;  5M3F H;  1X56 A;  4A3G G;  4YHH Q;  4WJ3 M;  2EQS A;  3J80 c;  2K5V A;  3KOJ A;  4A3I G;  2FXQ A;  2D62 A;  3CP0 A;  3J81 j;  2E2J H;  4NXN Q;  1N32 Q;  1PH6 A;  2Z6K C;  1KXL A;  4JI2 L;  4A3C G;  3PV0 A;  5FJ8 G;  4L5S A;  2NN6 G;  1N9W A;  3PIP A;  1YJW A;  3I4M H;  1CKN A;  1R9T H;  5BR8 Q;  2PI2 A;  4RG1 A;  2ID0 A;  3I4N G;  4DR5 Q;  4JI3 Q;  1N8R C;  1K0R A;  1U5K A;  1JMC A;  2WP8 J;  2NVT H;  2UXC L;  1B7Y B;  4IJH A;  1YNX A;  2K5H A;  2YU9 H;  3F1Z A;  1OXS C;  4DR2 L;  3J80 i;  4DR1 Q;  1TWF H;  4GNX A;  4L5R C;  3J7Z C;  2B3G A;  3CCL A;  2L15 A;  3PUZ A;  1A8V A;  3ULJ A;  4FDB A;  4DV3 Q;  3RZO H;  5AJ3 L;  2JA6 G;  1RL2 A;  4JI6 Q;  3D31 A;  2JA9 A;  1PH7 A;  1VQ8 A;  3U4Z A;  2I5M X;  4X66 Q;  4YWK A;  2Q2U A;  5C3E G;  2A1A A;  4GLV B;  2ZTE A;  1Q8K A;  3F8T A;  5DLQ E;  3W1B A;  4LF8 L;  3S2D H;  1PHJ A;  4LF9 L;  3W5O A;  3F2D A;  4KHP Q;  2EXD A;  2QEX A;  2HT1 A;  2Q2T A;  1HNX Q;  5JJK A;  1Z9F A;  4R4Q A;  5IWA Q;  4IJL A;  4A3B H;  1BBW A;  1QUQ A;  3KDF B;  4A4I A;  1IBK L;  2HHH Q;  1Q46 A;  4K0K Q;  1H95 A;  4A3D G;  5EAY A;  1PH3 A;  4GKK L;  1PVO A;  4POF A;  3PF5 A;  2JA7 G;  3T1Y L;  2JQO A;  1TXY A;  2UUA L;  3S16 H;  1NTG A;  1X3G A;  4PMW A;  1VQL A;  1NMF A;  2B63 H;  3F2B A;  3CC7 A;  5M3F G;  4GKJ Q;  5H1S E;  4OO1 G;  3EIV A;  1EIY B;  3LGJ A;  2I5L X;  4C3I H;  1D7Q A;  1YJN A;  3CCR A;  4HIM A;  5JEA J;  3BZC A;  5GQO A;  3I4M G;  2WB1 E;  4YY3 L;  4DR6 Q;  3UDG A;  1HZC A;  2IHE A;  4X62 L;  3H15 A;  1CKN B;  1KRS A;  4EX5 A;  4DV7 L;  3J7A 5;  1M90 C;  2KBN A;  3UDI A;  4KI0 A;  3I4N H;  1E24 A;  4JI2 Q;  1VQJ A;  1OXT A;  2K14 A;  5FLX c;  4X6A H;  3STB D;  4A3F H;  1CKO A;  1M1K C;  5JJL A;  1YI2 A;  4LFA L;  4GNX B;  1V9P A;  3JC6 6;  4A76 A;  1N33 L;  3G6E A;  3G48 A;  3HOU H;  1HR0 W;  3TRZ A;  2UXC Q;  4HIO A;  4JC0 A;  1SLJ A;  4DR2 Q;  5J3B A;  3GTJ H;  2WB1 G;  4GNX C;  4X65 L;  3STB C;  4A3E H;  4R4T A;  1KRT A;  1YJ9 A;  4OON A;  4AYB E;  5AJ3 Q;  3S1R H;  4JI1 L;  3TQY A;  3VDY A;  4GN3 B;  1KD1 C;  4A3B G;  2JA5 G;  1C7Y A;  4LF8 Q;  2R7Z H;  5JJI A;  5M5Y H;  4LF9 Q;  1QUQ B;  1LYL A;  1VQA A;  4HIK A;  2E2I H;  2E5L L;  1C9O A;  4YWL A;  4DPG A;  1VQM A;  2JA6 H;  2GVA A;  3G71 A;  3GTO H;  3PF4 A;  3E0E A;  1VQP A;  1IYJ B;  1I5F A;  1XNR L;  2B63 G;  1WJJ A;  2K52 A;  1IBK Q;  1PV4 A;  3I55 A;  1PYB A;  1X3F A;  3MEF A;  2UXB L;  2A8V A;  4GKK Q;  3RLO A;  5M5X H;  2RHS B;  2AWO A;  3K8A A;  4AYB G;  2IX1 A;  4DR7 L;  2MNA A;  1J5E L;  3CCQ A;  3K81 C;  3T1Y Q;  3HOY H;  3AYH B;  4JOI A;  4DV0 L;  2UUA Q;  1VQG A;  1Z47 A;  4JBK A;  3HOZ H;  4DV4 L;  4A75 A;  1HZB A;  3HKS A;  2R6G A;  3ER0 A;  1EWI A;  1V1Q A;  4JI0 L;  3HOV H;  1L0W A;  3CF5 A;  4P73 A;  3OTO Q;  1EIF A;  1YBY A;  1PYS B;  4P74 A;  2YTV A;  3RZD H;  2Q2I A;  1VQ7 A;  1YZ6 A;  2LSS A;  1L1O A;  2F3I A;  4YY3 Q;  1EQR A;  4A3F G;  3WWV A;  5LMU L;  3CXC A;  3CCE A;  4L5T A;  4X62 Q;  1EFW A;  4DV7 Q;  2YTX A;  4IPH A;  4NPS A;  2VQF L;  1G51 A;  3GTQ H;  3HOU G;  2ZJR A;  3M3Y H;  1K73 C;  3L0O A;  4MNO A;  1SRO A;  3K7U C;  1VQ4 A;  1YIT A;  1NMG A;  1U0L A;  1K8A C;  3CC2 A;  2IY5 B;  4LFA Q;  4P72 A;  3RLN A;  3CMA A;  2VQE L;  4A3E G;  4QQB X;  1BVS A;  2HIV A;  3Q8D A;  4UPA A;  4AIM A;  1N33 Q;  4KHZ A;  2RHQ B;  3MXN B;  4B3M L;  1LTL A;  1X54 A;  2OCE A;  4X65 Q;  1AH9 A;  2R7Z G;  1WCM H;  2AHO B;  4PG3 A;  1PH2 A;  4BXX H;  1VCI A;  4JI8 L;  3I2Z A;  3NEM A;  3OYY A;  3RLF A;  4IPG A;  3E9H A;  3GTP H;  4OWT B;  3ZJY C;  3AFQ A;  2F4V L;  2OWO A;  1GM5 A;  3M7N A;  3HKZ E;  3CCM A;  2I5H A;  5IYD H;  2E5L Q;  3PSI A;  5IY0 A;  2ZJQ A;  4BBS H;  3M4Q A;  4LUO A;  3HOY G;  3A0J A;  1Y1W H;  1I94 L;  1LM0 A;  4GN4 B;  4DAY B;  3HOZ G;  1J6Q A;  2C35 B;  2BA1 A;  2JA5 H;  1Q81 C;  4LF7 L;  2UXB Q;  4DV6 L;  1EOV A;  5FLM G;  3NEN A;  3HOV G;  4O2D A;  2GN5 A;  1J5E Q;  3KF8 B;  1K9M C;  1SMX A;  4DV0 Q;  3CPF A;  4JOI C;  1IBL L;  3IRB A;  4P75 A;  3CQZ H;  4DV2 L;  4HJ5 A;  5HY6 A;  1XPR A;  3HKZ G;  4R4O A;  3AQQ A;  1WOC A;  1L1O B;  1G6P A;  1NBW A;  1XMO L;  2PQA A;  2CQO A;  1X3E A;  1S40 A;  4JI0 Q;  2AMC B;  2ES2 A;  5JEA G;  2CWA A;  1IL2 A;  4LF4 L;  2LXK A;  3K0X A;  3S17 H;  2YTY A;  4GS3 A;  4LUZ A;  2R92 H;  4RMF A;  1L1O C;  3J81 c;  1IBM L;  4JCV E;  3AFP A;  5LMU Q;  2D0P A;  2JK8 A;  4QIW E;  4JBW A;  2VQF Q;  4GOP A;  3A5Z B;  1AE3 A;  2N49 A;  1PFS A;  2MO0 A;  3KJP A;  4HID A;  4XIG S;  4DAM A;  2MFI A;  1JJ2 A;  2ALY B;  2CKZ B;  4XTC S;  3JAM c;  4BY7 H;  4LFC L;  4GLA C;  4DUZ L;  2HQL A;  3T1H L;  2K50 A;  1MKH A;  1UE5 A;  2UUC L;  5IYC H;  1WCM G;  3PGZ A;  1FGU A;  1NY4 A;  2CWP A;  4BA1 I;  2VQE Q;  1S72 A;  4BXX G;  4ALP A;  3J81 i;  1UWV A;  5C0X J;  2EIF A;  2NVQ H;  2AKW B;  4B3M Q;  3CME A;  4OXP A;  5GAG C;  4BBR H;  1PH8 A;  3ULP A;  3S15 H;  3NBH B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...