1XNRQ

Crystal structure of an inosine-cytosine wobble base pair in the context of the decoding center
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
104
structure length
104
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSKRGGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S Ribosomal RNA
publication title Structure of a purine-purine wobble base pair in the decoding center of the ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 20
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2004-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1xnrQ00
1PH2A 3PO2H 1VQNA 4A3DH 2JA8G 5K36G 1YVCA 4DKAC 3CCRA 3CCMA 2YU9H 2AHOB 1IBKL 2E8GA 2Z0SA 4HIDA 4X66Q 1OTCA 2JA5H 4EQ5A 1SR3A 4DUZL 2R93G 2MFIA 2K75A 4DV4Q 2A8VA 1XNRL 4X62Q 3CP0A 1L1OA 4P73A 1TWFH 3T1HQ 1JB7A 1Z47A 1NTGA 2JJQA 4P74A 4DV6L 5ELOA 4L5SA 5IP7G 1UE1A 1I94L 4BA1I 1IBLQ 4BY7G 4BXXH 3S14H 2F4VL 2JE6I 1HNWQ 4BBSH 4YY3Q 4B3SL 4OONA 2MNAA 3J81c 4QL5A 4OWXB 5M5YH 4A3GG 1PH3A 3K80C 1PH5A 4A3JH 4JBMA 2BA0A 3CCJA 4RMFA 1Y1WG 4LFAL 3BZKA 1QZHA 3J81i 4DR2L 4JV5Q 4GOPC 4DV2L 3G48A 4YCVA 3FKIG 3T1YL 1DGSA 1H95A 1VQ4A 1A8VA 4AH6A 1VQLA 3LGJA 1A0IA 1EFWA 1B8AA 3D31A 4LF9L 1XPUA 4OO1I 2K5VA 1NMGA 4POFA 4JBJA 1YITA 2R6GA 2RCNA 4HIKA 1K9MC 2K50A 3I4MG 5EAYA 1Q46A 3DLLA 1CKNA 1OXVA 2OWOA 3HOZG 4YHHL 4X66L 4A75A 1X65A 4DV5L 2CQOA 2RHSB 2PNHA 3F2BA 4A3IH 3TRZA 2I0QA 2R7FA 3DM3A 3I55A 3T1HL 5JEAJ 4YCUA 1X3GA 3EN2A 2JA9A 3RZDH 1AH9A 1IBLL 4GLVB 1CKMA 1Q7YC 1N36Q 5M5XH 1N8RC 4YY3L 2ZTEA 3KF6A 4HJ7A 2E5LQ 1KQSA 3PUYA 3I4NG 2HIVA 3S15H 3CC7A 1WCMH 2LXJA 3J81j 1LTLA 4IPDA 1HZCA 1CKOA 2Y0SE 4GLXA 4JV5L 1KRSA 3K81C 3E9IA 4C3HH 2PI2E 2KBNA 1GD7A 3TS0A 4FDBA 5FLMH 3GTLH 5JJIA 3TS2A 1PVOA 2UUCQ 1N9WA 1VQCA 4A3FH 2WB1E 5FJ8H 1L1OB 5IYCH 1KC8C 3PUVA 3HOVH 2K5HA 2DGYA 2UXBQ 2CFMA 1HNXQ 3F2CA 4DR3Q 4B3MQ 2UXCQ 1X3FA 4XIGS 2ID0A 5JJKA 1RIPA 3HOYG 1P16A 4JI4Q 3J7A5 2AWNA 3HOXH 4IFDJ 4JBWA 3HKZE 2R92G 3PO3H 1G6PA 4AIMA 4AQYQ 1IYJB 1A62A 1K3RA 1NBWA 1WFQA 3L7ZC 1QVGA 2YYZA 4OXPA 2WFWA 1N36L 1YBYA 5LMNW 1MKHA 4GNXC 2E5LL 2AKWB 2Z6KC 1BKBA 1JE5A 3PUZA 1QUQA 1A63A 1SN8A 4PZ7A 2K4KA 4C3IH 4DR4Q 3GTGH 1S3OA 1SRUA 2A19A 1LYLA 2KENA 1LUZA 4A3KH 4A3MG 1VQ7A 2VS1A 4A3CH 5IP9H 1E22A 5C3EG 4DPGA 2MQHA 1OXXK 2HHHQ 1IBKQ 2OTJA 2GVAA 2AMCB 3ER0A 4DUZQ 1XPRA 1E7ZA 2HT1A 2VUMG 4PMWA 1TWGH 4JI8L 3U50C 2NVYH 3VDYA 2ES2A 2R7ZH 1C9OA 4MZ9A 3PSIA 3ULPA 4LFBQ 4MTNA 4X6AH 2UXBL 2B63H 2NVXH 3KYHC 5C44G 1HNXL 4DR3L 1NMFA 5IYDG 5M3FH 3CPFA 4B3ML 1FJGQ 3GTOH 4DV0L 2UXCL 2JA6G 3UDXA 1BVSA 4BBRG 4GS3A 4BY1G 4PZ8A 3JC66 2JA7G 3GTMH 3RNUA 1JJCB 1K8AC 1VCIA 4AQYL 4LF6Q 4A4IA 4HJAA 2WAQE 1WJJA 3K0XA 1VS0A 2F3IA 1XJVA 4DR2Q 4LF4Q 3S16H 1J5EL 4JI1Q 1RL2A 2K5NA 4DR4L 3S24A 2IHFA 2ZJPA 2UXDL 2IT1A 1W2BA 4DAYB 5IT9c 1VQOA 3RLOA 4LF5Q 1PYBA 3J7ZC 4HJ9A 4L5QA 2HHHL 3GTJH 3NBHB 1D8LA 4YHHQ 3G71A 2NN6G 1NJIC 4DV5Q 3CCEA 2B29A 3M9BA 2OTLA 1CUKA 3HOWH 1X9NA 4NPSA 4R4CA 4O0AA 5M5WH 4B3TL 1TWAH 5M3MH 1S72A 2YTXA 4LFBL 1OXSC 3NEMA 2NZOA 2V1CC 1FJGL 1I3QH 4LUVA 1U5KA 4A3LG 1VQKA 2UU9L 1YHBA 1MJCA 3E0EA 4LUOA 1QUQB 2E2HH 4R4OA 4LF6L 4GKJQ 1V1QA 1KHIA 1G51A 2E2JH 2KCTA 3I2ZA 5E7NA 3RN5A 1IL2A 4PG3A 1HJPA 4LF4L 3G4SA 4JYAQ 5IY0A 3H3VI 2RF4A 4JI1L 4R4IA 3E9HA 3W1BA 3PO2G 4A3DG 1L0WA 2NN6I 2RHQB 1AE2A 2N49A 4TVAB 3I56A 2VQFQ 4A3BH 2JA5G 4LF5L 3PUXA 4POGA 4QJFA 1D7QA 2JQOA 4WJ3M 4Y52H 1PHJA 1PH9A 5C0XJ 2PMZE 3CCVA 2A1AA 1G291 3H15A 5ELNA 3UDGA 1EOVA 4BXXG 4DV1Q 1Y1VH 3HOUH 1IZ6A 3PUWA 1YNXA 3K8AA 1EQQA 4APVA 4BBSG 3GDEA 2JK8A 4LWCA 2Q2UA 2Q2IA 2NVTH 1Q12A 4A3JG 3HKSA 2JEAI 1X3EA 4KLKA 1M1KC 3GTQH 5JEAG 2KHJA 4PZ6A 1GVPA 4DAMA 4QGUA 3ICEA 4GOPB 1Q1EA 1E3PA 2Z6KA 4AYBE 1S40A 2FXQA 4GKJL 5BR8Q 1O7IA 3AYHB 1SMXA 3KFUA 1ASZA 2I5HA 4JYAL 5DLQE 3CCSA 5LMUL 3ERSX 1WOCA 2QEXA 1PYSB 2Y0SG 1HR0Q 2VY3A 2VQFL 2OCEA 1E1TA 4JI8Q 4DR5Q 4DV7L 1PV4A 1WI5A 4A3IG 4JOIA 3F1ZA 3RLNA 4DUYQ 1PA6A 2WB1G 4LFCL 1VQPA 3L0OA 1YJNA 4DV0Q 1EYGA 5HGQA 3KDFB 3A5UA 4DV1L 4C3JH 2ZJQA 4JI6Q 3CCUA 4H02A 4HIOA 2ZTCA 1OXUA 1PH8A 1YI2A 1EWIA 1M90C 4O2DA 1IXRA 3HKZG 4YWKA 3RLFA 1WCMG 2YTVA 4IFDG 1B70B 1J5EQ 2YTYA 3CMEA 4UPAA 4HJ5A 4DV3Q 3SGIA 1EUJA 5BR8L 1EIYB 1C0AA 1SFOH 2UXDQ 4KHZA 1KD1C 4GKKQ 5JJLA 4LNQA 5FLMG 3CMAA 1FL0A 4ALPA 1J6QA 1K73C 4A3FG 2D0PA 5FJ8G 5IYCG 1HR0L 1IBMQ 4MNOA 5LMNL 3HOVG 3F8TA 4QY7A 1KRTA 3RR5A 1XMOL 4LF7L 4LUZA 2C35B 1C7YA 4A3EH 4IOCA 4DR5L 4B3RL 1PH7A 2UUAQ 4B3TQ 1LM0A 4DUYL 1N34Q 3HOXG 1HZAA 5C4XH 1E24A 1XPOA 4IPGA 2PI2A 5AJ3L 3PO3G 3TEHB 3NENA 4IFDI 4X65Q 1ASYA 3GTKH 3CC2A 1B7YB 2UU9Q 4JI6L 1SROA 2VNUD 1VQ5A 4JBKA 1PFSA 1TXYA 4C2MH 2E2IH 1JJGA 3ZJYC 1GKHA 4GNXB 4P71A 3TREA 5IYBH 4IO9A 4JC0A 2HQLA 1P8LA 3H0GH 5H1SE 2GVBA 2N78A 3PIPA 3Q8DA 3K7UC 1HZBA 2WAQG 4A3KG 4DV3L 2JA8H 4L5RC 4GOPA 1Q82C 4DR6Q 1E1OA 3S1RH 5IP9G 4A3CG 3FP9A 3AQQA 4GKKL 1GM5A 1OXTA 2MO0A 1V43A 3KJPA 2IX1A 5GADC 1JJ2A 4OWWB 2R93H 4YWMA 5IWAL 3G6EA 4HJ8A 1IBML 2ZJRA 1HNZQ 2EQSA 1N33Q 2R7ZG 4DK3C 4X64L 4K0KQ 5HY6A 1CSPA 4BY7H 5IP7H 2B63G 1N32Q 2PQAB 5M3FG 2CWPA 4JI3Q 3K7AH 2UUAL 1XTDA 5FLXc 4LF9Q 3W5OA 4YCWA 2BH2A 2OQ0A 3RZOH 1AE3A 1N34L 1U0LA 4A3GH 2ATWA 2R7DA 4A93H 2GN5A 1Y1WH 1VQIA 1YJWA 2QGQA 2Q2TA 4JI5Q 3ULJA 3KDFA 4X65L 1NY4A 1YEZA 2EXDA 2K52A 1VQFA 3OTOL 3FKIH 5GAEC 3I7FA 3F2DA 4J15A 1VQ8A 3CW2C 1Q81C 3CCLA 2D62A 1PH4A 3EIVA 4JI7Q 3A5ZB 2NVQH 3CC4A 3CPWA 3KJOA 1UE5A 5LMUQ 1VQMA 3PGZA 4DR7Q 3M85A 1K83H 1UEBA 3J80c 3I4MH 3S2HH 3TQYA 1VQEA 4DR6L 4GN3B 2L15A 1XMQL 3HOZH 2VL6A 1L2FA 4IJLA 3GD7A 3PF4A 3J80i 4DV7Q 3CXCA 1Y14B 3HOWG 1HNZL 1N33L 4RG1A 1YIJA 3M3YH 4K0KL 4LFCQ 5M3MG 3KLWA 3U4VA 3CAMA 3S17H 1N32L 4P75A 1WYDA 4IOAA 3STBD 1W3SA 1QZGA 4JI3L 4A93G 3GO5A 1UWVA 3A0JA 3W1GA 3CD6A 5C0XG 4WJ4A 3I4NH 3D0FA 1PH6A 4JI5L 3S1QH 3AFPA 2VQEQ 4JI0L 4GN5A 4NXMQ 3S1MH 3U4ZA 1YJ9A 4IJHA 2K14A 4GNXA 4Y7NH 2NZHA 4IPHA 1EIFA 4KI0A 4DR1Q 4JI7L 4P72A 4AYBG 1L1OC 4A3BG 4DR7L 4DV4L 2XTIA 4JG2A 3MXNB 4NB3A 3UE0A 4X62L 5LMNQ 1XMOQ 4LF7Q 3CQZH 3UE1A 1VQBA 2WP8J 4UP7A 1VQ9A 4B3RQ 1XNQQ 4L5TA 4R4TA 3JAMc 3KF8B 3HOYH 1HNWL 5C0XI 1Y1VG 3FHWA 4JI2Q 3UDFA 2R92H 1T9HA 3HOUG 4KHPQ 3BJUA 5AJ3Q 1NE3A 4R4QA 3UDIA 3JAMi 4JCVE 2PQAA 2QA4A 4HIMA 1TWHH 4DK6C 1GO3E 4R1JA 4NXNQ 3GTPH 1K8GA 1BBWA 4OO1G 1Q1BA 4OWTB 1I50H 3IRBA 3M4QA 3BU2A 5GQOA 3PF5A 3S2DH 2VQEL 2ASBA 2KHIA 3M7NA 5IE8A 4ME3A 4NXML 5GAGC 4A3MH 1VQJA 2BA1A 5J3BA 3AEVA 4DNIA 5C3EH 1VQHA 4LF8Q 1VQAA 2IHEA 2VW9A 4OX9Q 5GAHC 1YHQA 4DR1L 2ZM6Q 3WWVA 4GLAC 1MJEA 2VUMH 1JT8A 1KL9A 4UP9A 5IWAQ 1I5FA 3STBC 4EX5A 2I5LX 4XTCS 1QVCA 1X6OA 3RN2A 4X64Q 3PIOA 2ZTDA 1SE8A 1Z9FA 5C44H 2HIXA 2ALYB 3NELA 5IYDH 4UY8C 2CWAA 4A76A 2UUBQ 2JEBI 1Q8KA 1TWCH 3BZCA 3MEFA 1SLJA 4GN4B 1JMCA 2CCZA 1XNQL 4BBRH 2JA6H 4BY1H 3CF5A 1HR0W 4JI2L 2JA7H 4KHPL 1V9PA 2B3GA 3U58A 1KIXA 3PV0A 3PCOB 4LW1A 1FVIA 2YV5A 1UE7A 1CSQA 1HH2P 1X55A 4NXNL 2H5XA 2KCMA 1QVFA 3OTOQ 2I5MX 2F52A 3A74A 2MO1A 3L2PA 1FGUA 1KXLA 3HFZB 3ULLA 1UE6A 1CKNB 1MIUA 1VQGA 4BA2I 1YHAA 2XGTA 3H3VH 4JOIC 2UUCL 3B6YA 2EIFA 3AFQA 3KOJA 2LXKA 1XNRQ 1K0RA 4LF8L 1VQ6A 1BBUA 5C4JH 4UP8A 1XMQQ 4OX9L 2CKZB 4QIWE 3S1NH 2ZM6L 3CCQA 3OYYA 2OQKA 4DV6Q 2AWOA 4TQUS 2N8NA 4A3EG 2IY5B 1I94Q 1VQDA 2F4VQ 4YWLA 2Q2HA 3KF6B 2D0OA 3M4PA 1YZ6A 1HZ9A 4B3SQ 4JI4L 5GROA 3EBEA 2UUBL 5C4XG 4LFAQ 4A3LH 4IPCA 2DUDA 1X54A 1R9TH 1PH1A 1EQRA 1X56A 1KAWA 4DV2Q 2LSSA 3T1YQ 1I6HH 2BH8A 4QQBX 3M4OH 5IYBG 2VZAA 3OW2A 4JI0Q 3H0GG 3I4OA 1Q86C 2IX0A 2N3SA
chains in the Genus database with same CATH superfamily
2M9VA 1PH2A 3NTHA 3CCRA 1T5XD 3CCMA 2AQ3B 2OXPA 4DV4Q 1XNRL 1TWFH 4ME5A 4KD4A 4DV6L 4BY7G 4BXXH 1IBLQ 2JE6I 1Y8OB 1CHQD 2Q8IB 3SXHA 4B3SL 5JVH3 4K2LA 4QL5A 1O78A 3LWEA 5M5YH 4A3GG 1PH5A 4FVMA 2BA0A 2Q8RE 1D1KA 3CCJA 4OEMB 1QZHA 4DR2L 3AMUA 3G48A 1DGSA 1FNWA 1VQLA 3GTQB 1TQOA 3LWUA 4JBJA 2A68D 2QILA 2IY5B 4EGVA 3DLLA 1CKNA 4IN3A 4X66L 1X65A 4HSVA 3VYSA 1A6XA 1IKLA 2A6ED 3CQZB 2O2LD 5IODA 1AH9A 3HOYB 1AN8A 5M5XH 4YY3L 3KF6A 3PUYA 1H9RA 2LXJA 3J81j 1CKOA 4GLXA 4JV5L 1KRSA 3CRLC 4Q0FA 4K5WA 1KNEA 1EY7A 2PI2E 1H9JA 2KBNA 3D8GA 3S2DB 1GD7A 3TS0A 5EBDA 2Z6BA 4DAYA 2WB1E 5FJ8H 1L1OB 5C3EB 1MI2A 2BOSA 2DGYA 4N8FA 2CFMA 4RWSC 3F2CA 2CQAA 1X3FA 4XIGS 5JJKA 1DCZA 3HOYG 4JI4Q 5C6AA 1CI3M 1SYDA 1IYJB 1NBWA 4OXPA 4H0LC 4BY1B 1MKHA 2E5LL 2AKWB 2QEJC 2JA7B 1JE5A 3PUZA 4PZ7A 2K4KA 4E6IA 2HUGA 2A68C 3ERQA 4HEDA 4RFBA 3PIP3 2KENA 5FO9B 2F0VA 1YNJD 2EY6A 5C3EG 4KY7A 2A6EC 5CV7A 2OTJA 1F9RA 4G4KA 1TWGH 3VDYA 3NE5B 5C4JB 3MA2B 3ULPA 3R8BA 3S1NB 3DUZA 2CH4W 5CBEE 4ABNA 5M3FH 1HNXL 3C46A 1FJGQ 3GTOH 4DV0L 2Z4HA 1PYWD 1LT5D 2K33A 4BY1G 4H7BA 2XIWA 4PZ8A 2JA7G 4CHTB 1CQVA 2NTSA 2F3IA 1MSHA 3S16H 1E2ZA 2K5NA 1PTOB 4MTKA 2KVMA 3RD4A 3ONAB 3MFYA 1LV9A 3RLOA 3J7ZC 2MUYA 3WOEA 4L5QA 2Z1CA 3GTJH 3T13A 3VR4A 2JA5B 4RA8A 3CCEA 4WORA 1FNVA 4NPSA 1GUWA 3OWFA 4FF4A 4DU9A 1I3QH 5TSSA 1NSNS 4OGQC 3H09A 2K32A 1MJCA 4ODGA 1YNJC 1SNQA 1V1QA 4GKJQ 2E2DC 2E2JH 5IT9L 1IL2A 2O4XA 2EDGA 3NBIA 1HJPA 4LF4L 3G4SA 4JYAQ 1X3PA 3PO2G 2X69A 2RHQB 3I56A 3I70A 1EQVA 2JA5G 3PUXA 3T56B 1SJED 1NR2A 2MPMA 2JQOA 4WJ3M 1EEID 3I91A 4Y52H 3NSWA 1JB3A 2PMZE 5ELCA 1Y1VH 2NBFA 3K8AA 1EQQA 2WB1B 1KABA 3GDEA 5CC4A 2NVTH 2AQ1B 1X3EA 3J80L 1C48A 4PZ6A 3ICEA 1DONA 1Q90A 4AYBE 1DZ1A 4J1MA 1AZPA 1WCMB 2RBMA 3KFUA 2F03A 5DLQE 3I3CA 1LT3D 1WOCA 1K8MA 2BCOA 2DNCA 4F7XA 5LL6S 3OIPA 2L55A 4JOIA 3F1ZA 3RLNA 2WB1G 4LFCL 1VQPA 2HCIA 1JE4A 3A5UA 4DV1L 3K0YA 2ZJQA 4H02A 3PO3B 2BE5D 4O2DA 4X3UA 1WCMG 1S5ED 1ET9A 1EUJA 3GTGB 1B1ZA 1DOKA 1C0AA 2UXDQ 4K5XA 2LS01 5FLMG 3CMAA 4IUUA 5C3XA 3KK7A 2OF1A 1KDAA 1IBMQ 3HGBA 1B50A 1C7YA 2ICEC 5KGUA 2B2VC 1WTQA 4B3RL 1PH7A 2NVYB 2R7ZB 1ILPA 2WINB 1HZAA 3NQIA 2NVXB 1E24A 3E0JA 3PO3G 2PI2A 2WIIB 3NENA 4X65Q 3GTKH 3CC2A 1B7YB 3TSSA 1SROA 4JBKA 1PFSA 1TXYA 3ZJYC 2J0TD 1P8LA 2GVBA 3V2TA 3PIPA 3Q8DA 1RODA 2BDOA 1CZGA 1JQYD 1EYDA 4CDDC 4DV3L 4L5RC 3OMCA 1Q82C 1E1OA 4A3CG 2X6GA 4FF1A 3UI2A 5CYUA 4GKKL 1G6ZA 2SNMA 2VB2X 4NP5A 1K3BC 1LTTD 3NWSA 4ZQ3A 2R7ZG 4DK3C 4X64L 1CSPA 2PW5A 4BY7H 2BE5C 1N32Q 2PQAB 3SEBA 1SNDA 3K7AH 5FLXc 3W5OA 2OQ0A 1TWAB 5M3MB 1U0LA 4A3GH 2ATWA 2R7DA 3ZYYX 1VQIA 4JI5Q 2PMZB 2KEEA 1YEZA 3OTOL 1ZEQX 3I7FA 3F2DA 4KKSA 5KEEA 4JI7Q 4CDCC 2NVQH 3CC4A 3KJOA 1VQMA 3PGZA 4DR7Q 1V1OA 1QB5D 1RKNA 3S2HH 3P75A 3IFTA 4DR6L 5JPMC 2A5HA 4OELB 1QNUA 4AYBB 4A3BB 3I4LA 2HD3A 1Y14B 1EZ6A 3HOWG 4RG1A 4RCNA 5CV5A 1U4PA 1I4PA 5M3MG 3U4VA 3S17H 1JICA 5EKIA 3STBD 4JI3L 4Q5VA 3A0JA 3HOUB 3CD6A 5FLXE 4K14A 4OIJA 1IKMA 1EIGA 1H9SB 4NXMQ 3U4ZA 3HKZB 4ILWA 5E4XA 4IPHA 2IJ0A 3OOCA 4AYBG 3AU7A 2L5TA 4A3BG 4DV4L 3J81L 4G7HC 3MXNB 5LMNQ 1XMOQ 1G2TA 3CQZH 2IPKD 1B3QA 3JAMc 1UAPA 2LMCB 3HOYH 4DAVA 3OW7A 2FMCA 3UDFA 3HOUG 4MHEA 5BN4A 3X3MA 1Z7TA 4XT1B 1HUMA 2PQAA 4OO1G 4CKEA 3SK6A 5KYLA 2J7ZA 3FPUB 1K8GA 1ICWA 5ELBA 2B2UC 3M4QA 5IGEA 3S2DH 1GUOA 2VQEL 3KLRA 2JN4A 4DNRB 5I9PA 3FEWX 5J3BA 5C3EH 1VQHA 5GAHC 4PMCA 4GLAC 1MJEA 3H3VC 1EOTA 4UP9A 5IWAQ 3STBC 2JP1A 2I5LX 1X6OA 1Z9FA 1MGSA 3F2UA 1NR4A 3MTSA 2NUCA 3DWQA 1UNSA 4UY8C 2UUBQ 2JEBI 2CCZA 1TWCH 2RDHA 3BZCA 4GN4B 4OO1I 4BY1H 2JA7H 4KHPL 3JAME 1V9PA 2RVLA 1T5EA 5C4XB 2M00A 3PV0A 1VF5C 1FVIA 2K7VA 1CSQA 1Y8PB 3OHXC 4NXNL 2KCMA 1STHA 1A3UA 2E2IB 2MO1A 2DN8A 1VQGA 1CFMA 1H9SA 2XGTA 3S16B 2NTTA 2JA8B 1UUPA 1VQ6A 5C4JH 3S1RB 1WTWA 4OX9L 2I07B 3S1NH 3HZXA 4KJOA 2RDGA 2OQKA 4YWLA 2MHVA 3HG9A 3MXNA 4JI4L 5ELFA 3CRKC 2MP1A 4ZRZA 5GROA 4CKCA 5C4XG 2L9HA 1X54A 1R9TH 4WRDA 1STNA 1VF7A 1KAWA 3VYTA 2B2TA 3T1YQ 1DM0B 2BH8A 1Q86C 2EOTA 4DAPA 3D4RA 4LF9Q 3FKIB 3PO2H 2JA8G 4DKAC 2Z0SA 2JA5H 4J6HA 1MBYA 3Q0AA 4X62Q 3CP0A 4P73A 4PMBA 4K8JA 3T1HQ 4DK1A 1JB7A 5ELOA 4L5SA 5IP7G 3CKIB 1O7YA 2F4VL 1SYEA 4H13C 2B8GA 3T51B 1GOZA 3C3LA 4OONA 2MNAA 4BWGB 2L4NA 4LMQD 1BF4A 4JBMA 3TP5A 2EY2A 4LFAL 1Y1VB 1IYUA 4GOPC 4ZKCB 2F0EA 3Q6SA 1TS3A 4YCVA 3FKIG 4IUTA 4FXKC 1A0IA 5IIFA 3S9WA 1EFWA 3BVGA 4POFA 3N6RA 4Y7NB 2F0FA 2R6GA 2RCNA 4HIKA 3L9AX 2D9UA 4UAIA 2OWOA 1SE3A 4A75A 4DF7A 4KMUC 2CQOA 3F2BA 2PNHA 1EY4A 1LABA 4TKOB 1MSGA 2H1EA 2R7FA 1KLUD 2IWHA 3DM3A 3I55A 2TMPA 4YCUA 3EN2A 2JA9A 2LKVA 1WTOA 5EKKA 1N36Q 5JOBA 2ZXOA 5I4DA 3I73A 2HIVA 3FMCA 1LT4D 1WCMH 1TWHB 4XT3B 3GTPB 2Y0SE 1PFBA 3K81C 4S3SA 3E9IA 4F88A 2ENBA 1Q8IA 3C1FA 4FDBA 5FLMH 2MGSA 1VQCA 4RAUC 4HCSA 2VUMB 5D3IB 4KV6A 1RIPA 1A2TA 1SYFA 4OIKA 4JBWA 4RHSA 3PO3H 1X3QA 2I46A 1G6PA 4BS9A 4AQYQ 2IL8A 1A62A 1EYCA 2NZ1D 1TY2A 1TIID 1DOLA 1GUNA 3DWPA 1YBYA 4GNXC 2Z6KC 4ZCKA 4DR4Q 3GTGH 2A19A 3EROA 1LYLA 3GTKB 1LUZA 4A3MG 2VS1A 4H44C 4A3CH 1E22A 2HHHQ 2MQHA 1OXXK 1XYIA 2CW0D 1IBKQ 3DMUA 3TDQA 2AMCB 5I2XA 1CZWA 4DUZQ 2VUMG 4XQJA 2ES2A 2NVYH 2R7ZH 1DJRD 3QO2A 2ZT9C 2UXBL 2NVXH 3KYHC 4DR3L 4B3ML 2UXCL 1K8OA 1G8ZD 4Z9CB 4BBRG 1D2BA 2VXWA 1JJCB 1EY0A 4HJAA 1WJJA 4KY6A 1D5ZC 1I6HB 1VMPA 2K5DA 3FRPB 2NWGA 2UXDL 1CQFA 4DAYB 1SNOA 5IT9c 3P1HA 1PYBA 5CV6A 1EY5A 4YHHQ 3G71A 2NVQB 4DXGA 4DV5Q 4ZKBB 1QNKA 2B29A 3M9BA 1HQRD 1STEA 3BYYB 2F0MA 2OTLA 4IURA 3HOWH 3S2HB 1TWAH 5M3MH 4LFBL 4EQOA 1OXSC 2TSSA 1MD2D 4FF3A 4LUVA 3S14B 1JOQA 2ZXRA 1O80A 4N9TA 1YHBA 3E0EA 3LX0A 4LUOA 2F0SA 3S17B 2EYJA 3IL8A 4R4OA 3J7YW 4LF6L 4ID6A 1KHIA 1Z6HA 2KCTA 2CW0C 3I2ZA 4JW0A 2V4DA 3NTIA 2F0WA 4JI1L 1I4RA 2Z8LA 1BCPB 4X3TA 3E9HA 2VQFQ 2N49A 4A3BH 3SDZA 5JJZA 4LF5L 2Y0SB 2FFKB 1PZID 1D7QA 5IT9E 4XYOA 1PH9A 1ZXTA 1JOKA 1PZJD 2QDLA 1EQTA 4J8QA 1IYVA 3QOJA 4X3SA 3HOUH 3PUWA 4YIJA 2Q2UA 4OO1H 1Q12A 4A3JG 3HKSA 2JEAI 5I2YA 5EKLA 4QGUA 1GVPA 4K8IA 2F0KA 2Z6KA 4WJWA 2FXQA 2I5HA 2M2LA 2PNRC 1ENAA 1B53A 2QEXA 1PYSB 2Y0SG 2VY3A 5EPJA 2OCEA 3NPPA 1E1TA 4K6LA 4DR5Q 1JWMD 4A3FB 3U9OA 1PV4A 2B2WA 4A3IG 3HOVB 2FJ2A 4JI6Q 2VB3X 1OXUA 1TWCB 1IXRA 2K5WA 3VR5A 1J5EQ 2YTYA 1FR3A 3IFDA 5BR8L 3K5LA 5JJLA 1DXMA 4B9XA 4A3KB 1HA5A 3QJYA 4HMIA 1J6QA 4A3FG 5IYCG 4EQPA 1HR0L 5LMNL 3HOVG 1XMOL 1KRTA 3RR5A 2PYKA 4KD3A 4U673 4IOCA 3IKJA 4KJNA 4DUYL 1LLRD 2LFNA 2B63B 5C4XH 1XPOA 1K0SA 1B9MA 1O7ZA 4FP5D 2UU9Q 1W6KA 2E2IH 2AUJD 3NTKA 4MIUA 3TREA 1V1PA 1I6VC 1R9TB 1Q3LA 4A3KG 2JA8H 1GUTA 2L0CA 3GP7A 5IP9G 3S1RH 3AQQA 3KJPA 1V43A 1F9SA 1JJ2A 3PO2B 5IWAL 1EWCA 2K05A 3G6EA 4FXGC 2ZJRA 1HNZQ 1BQQT 5KIXA 5CV4A 5IP7H 2B63G 1S5CD 3WOFA 1HFGA 2CWPA 3VR6A 4I7AA 2UUAL 3KBGA 4RKBA 1AE3A 2HCCA 1N34L 2PPBC 2O5JC 1YJWA 1B4OA 3CU7A 2EXDA 3K6OA 3FKIH 5IGBA 1VQ8A 4C1NK 3CCLA 1PH4A 1EU4A 1PFNA 3EIVA 2XSCA 3CPWA 1ESRA 1KLGD 3VR3A 5LMUQ 1NUCA 2FHTA 4GN3B 3EFXD 2L15A 1L2FA 4HAEA 3SK5A 2FMMA 3GD7A 1Y8NB 1ENCA 5C5MA 4KKTA 3J80i 3CXCA 2C5CA 3MFGA 2BDNA 5G3LD 1N33L 4K0KL 3KLWA 4P75A 1E2VA 3SK8A 4A93G 3GO5A 3W1GA 4WJ4A 4G7OC 3TP7A 5KNBA 4IJHA 4Y7NH 4R8IA 4IZ8A 3HP3A 2NZHA 1EIFA 4RCOA 2QF7A 2B2YC 1GHKA 2PZTA 3OPOA 2F0PA 4NB3A 4X62L 4IQZA 1VQ9A 1JWUD 4L5TA 4XDXA 3KF8B 1SXTA 5E4WC 4JI2Q 1D6EC 2HQEA 3NK9A 1T9HA 5AJ3Q 3QOLA 4FXDA 4R4QA 5G3LF 1TWHH 4R1JA 2Z4IA 3GTPH 4C3JB 1BBWA 1JCKB 1I50H 5GQOA 2KHIA 3A54A 4A3MH 1ILQA 2O5IC 1U4MA 4LF8Q 1VQAA 3BS1A 4DR1L 2ZM6Q 3TBIB 1SFOB 5CV9A 4RGMA 3QR8A 2VUMH 1JT8A 1HTPA 4UDUC 4XTCS 1QVCA 3I72A 3RN2A 1XXGA 2A6HD 5LHY1 2XWBB 3J7AV 4HMJA 1ZKOA 1I4QA 4A76A 1Q8KA 5CV8A 1XNQL 1NCVA 4BBRH 3CF5A 1HR0W 4C3JG 4KN7C 1STGA 2EXZA 4C56C 1BNZA 3VR2A 2KQ3A 2YV5A 3MHBA 1QVFA 2F0LA 3N52A 4C2MB 3ITPA 1FGUA 1KXLA 1UE6A 1MIUA 3G6JB 4BA2I 3H94A 1YHAA 3B6YA 1WTRA 2LXKA 1XNRQ 5C4HA 4UP8A 1XMQQ 4QIWE 3CCQA 1SYBA 2EY1A 3D6WA 1EU3A 2KECA 3OYYA 4O42A 5A2QE 4DV6Q 2R93B 4TQUS 2N8NA 4A3EG 1PRTC 3IAYA 2F4IA 1YZ6A 1HZ9A 4B3SQ 3BVMA 4L63B 1I4HA 4GZYC 3HOWB 5DM63 3KF8A 2DUDA 1LTRD 3OWEB 1E2WA 1I6HH 4IUQA 5IYBG 1CT1D 2F3VA 3OW2A 1BOSA 4CDEC 2IX0A 3TZUA 1VQNA 2QW7A 2A6HC 2AHOB 1IBKL 4HIDA 4X66Q 3E6ZX 2N88A 1SR3A 4HSPA 4EQ5A 4DUZL 2R93G 1ONLA 4QF4A 1K83B 5ISRA 4WFN3 3HOZB 1D5MC 1Z47A 1NTGA 4P74A 2JSOA 5I6WA 2F0TA 1I94L 4BA1I 5M9OA 1HNWQ 3S14H 2F0HA 4YY3Q 3M3YB 1F2LA 3MZ5A 4OWXB 1PH3A 4A3JH 1CA6A 4RMFA 2K03A 3J81i 1JC7A 2K1BA 4JV5Q 4DV2L 3NP8A 1ZYRD 1QCBD 3LGJA 3S1MB 3D31A 4U68A 1NMGA 1YITA 1A2UA 1K9MC 3I4MG 1W6JA 1OXVA 2XRQD 3HOZG 4YHHL 4DV5L 1OO9B 4A3IH 1HHVA 2I0QA 2RCFA 1PMRA 4L8JA 4XYQA 4EVOA 1X3GA 1STAA 1IBLL 4GLVB 2B2VA 2AQ2B 1JOOA 2R92B 4HJ7A 2E5LQ 1KQSA 4MN3A 4O1NA 3TP6A 1RTNA 1HUNA 1H9MA 3O13A 4PV1C 3VYUA 1PVOA 1N9WA 2WV6D 3EVQA 4A3FH 5IYCH 3A8IE 5EBCA 1KC8C 3PUVA 3HOVH 3PIO3 1HNXQ 1BXTA 2ID0A 2CHBD 2K04A 2L1BA 1BUVT 2R92G 3K59A 4AIMA 1ZYRC 3P20A 2JA6B 4M1UB 2WFWA 2WKCA 4QB4A 2OEOA 1QUQA 1A63A 1SN8A 4HCEA 2J4XA 3R2TA 2XWJB 5JPNC 4A3KH 4UHVA 1VQ7A 2R61A 5IP9H 1F2MA 3QG1A 5T1GA 3C1EA 2HT1A 1PFMA 4PMWA 1FNUA 1WTXA 1SEBD 3U50C 1C9OA 4MZ9A 3PSIA 4X6AH 2B63H 1HPCA 1NNXA 5D3DA 4DA2A 1NMFA 2L11A 3MC0B 3UDXA 2JA6G 4CBVA 3JC66 3RNUA 5KRUA 1TS4A 1VCIA 1K8AC 4V0BA 1U4RA 2WAQE 3OIQA 4CJ0B 1VS0A 1XJVA 4LF4Q 4FO2A 2SEBD 1J5EL 1S4ZA 5FO8B 4TSSA 3S24A 1DYQA 2IHFA 2ZJPA 3URYA 1F9PA 1SYGA 5K5PA 4A3DB 4HJ9A 2K5QA 1S5BD 2YU9B 1D8LA 2NN6G 3P7JA 1X9NA 2ICIA 1U9RA 4O0AA 1CK1A 1S72A 1QWYA 2YTXA 3NEMA 1FJGL 4JPBW 4A3LG 2C9OA 2UU9L 4BBSB 1WTVA 3J7AF 1HXYD 3HEJA 5FOBB 3H3VI 1LTGD 3W1BA 4IUPA 4A3DG 2B2UA 2NN6I 1AE2A 5IOCA 2EJMA 1ICFB 1V8QA 3CCVA 1A15A 4DV1Q 4BBSG 1SNCA 4HR7B 2JK8A 4LWCA 2Q2IA 2IW3A 3RZDB 3U9SA 4DGZA 1I4GA 5JEAG 2KHJA 4DAMA 4GOPB 1Q1EA 3K5MA 4GKJL 2RSOA 1DOMA 1J9OA 1D1IA 1ASZA 4JYAL 3I8ZA 5IGDA 5LMUL 1I50B 4C3HB 1GJXA 3VYRA 3GTLB 4A3MB 4JI8Q 4EQNA 1WI5A 3DXJC 3NXWA 1SAPA 4KKUA 2F0NA 2KJXA 1EYGA 5HGQA 3KDFB 4C3JH 3MWYW 2IX3A 3CCUA 1D5XC 4HIOA 2ZTCA 5BN3A 3BYTB 1PH8A 3GV3A 1YI2A 3V96A 1QE6A 3RLFA 4BBRB 4IFDG 1KAAA 3W2DA 1B70B 3LNNA 1ET6A 3H6MA 4HJ5A 4UPAA 4DV3Q 4C3IB 2DJFC 4C3HG 4HTHA 1SFOH 1KD1C 4GKKQ 4LNQA 3JAML 4ALPA 2D0PA 3EA6A 4QY7A 2KCNA 2C35B 4A3EH 2E75C 2EJGC 5JVG3 3Q23A 3FPPA 4B3TQ 4JVZA 2A69D 1LM0A 3HOXG 2SDFA 4XXEA 5AJ3L 4IFDI 5IGCA 2E74C 1S5DD 1ASYA 1SJHD 1JJGA 4C2MH 3GTMB 1GKHA 4GNXB 4P71A 3ND8A 5IYBH 1AEXA 4C3IG 2HQLA 1YNND 2PQEA 5H1SE 1HA6A 1WVLA 2N78A 2F0DA 3NWTA 1AFPA 2EYLA 1R4PB 2WAQG 4FNFA 3X3NA 4V190 4GOPA 4DR6Q 2RDFA 1GM5A 1I4XA 2R93H 5GADC 4OWWB 4F8MA 4HJ8A 1IBML 5HY6A 5A35A 4JI3Q 2K6AA 5M5WB 2AUKA 2NYZD 1O7LA 4OHJA 1E0BA 2GA4B 2Q2TA 2N55A 2QGQA 4X65L 3KDFA 1F9QA 1FYCA 2KOLA 1SNPA 1VQFA 5GAEC 4IALA 2E2HB 4J15A 4A3JB 3CW2C 2D62A 3HRZC 3A5ZB 1PLFA 3M85A 3BDLA 1K83H 3J80c 3I4MH 4LJZC 3TQYA 1VQEA 2A69C 2CH4A 1EFID 4F87A 1XMQL 3HOZH 2VL6A 4IJLA 1RD9D 4DV7Q 3SR1A 2KEDA 2PZUA 1YIJA 3M3YH 5C4ZA 2PO4A 1N32L 5DAUA 4A3IB 1YNNC 1A3TA 3Q24A 5C0XG 5IGGA 2EE1A 1SMYD 1V1PB 3D0FA 1GXDC 4JI5L 2MJ8A 3AFPA 2VQEQ 3S1MH 1Y69U 1YJ9A 2K14A 4GNXA 1G91A 4JI7L 2F3WA 4DXFA 4P72A 1L1OC 2RQXA 4DR7L 1PTOD 4XQNA 4JG2A 1AW7A 3UE0A 5CMDA 4LF7Q 1VQBA 3J80E 4LK1C 1KDBA 2EJFC 4R4TA 1HNWL 1MHWC 3FHWA 5C0XI 1RJTA 3H91A 2R92H 4KHPQ 3E5SA 4QCLA 2XNAC 2F0QA 3OMGA 2KHSA 3UDIA 4JCVE 4HIMA 4DK6C 4NXNQ 4I65A 4OWTB 3IRBA 5CBAE 3PF5A 3BU2A 2ASBA 3M7NA 5IE8A 4ME3A 4NXML 5GAGC 5J39A 3AEVA 4DNIA 5L37A 4OX9Q 1EL0A 3WWVA 3L3OC 1KL9A 1I5FA 4DN4M 3R3OA 2G9DA 2ZTDA 2HIXA 3A8JE 1SMYC 2ALYB 1PTOF 3GQBA 2CWAA 1JMCA 3MEFA 1SLJA 2JA6H 1XWEA 1TY0A 4ZAIA 3Q22A 2KUMA 2LY7A 2B3GA 3MXGA 3NHHA 1TU2B 4LW1A 1UE7A 1L0XB 1X55A 2H5XA 5EPLA 2QDBA 2I5MX 2NB0A 5KNCA 1PTOC 3BZDB 4DFAA 3L2PA 2F0JA 3E3XA 3H0GB 3HFZB 5KNDA 4K2KA 1HFNA 3H3VH 4JOIC 1NAPA 4DNTB 4ZUIA 3D4WA 1K28A 2CKZB 3MXUA 2NN6H 2FINB 2QKIC 1J8IA 1VQDA 3K57A 4IUNA 2F4VQ 1CHPD 1EIHA 2EY5A 1TKWB 4N9PA 1GUSA 1TS2A 2UUBL 4LFAQ 4A3LH 4IPCA 5J22A 1PXUA 3PQIA 3DWAA 3RZOB 1X56A 1HCZA 2LSSA 2XN9C 4P2CB 1Y1WB 4A93B 1F2ZA 2D2CC 4JI0Q 3H0GG 3I90A 3I4OA 3MXPA 4A3DH 2H4OA 1HRJA 5K36G 1YVCA 1AZQA 1WD1A 2YU9H 4POGA 2E8GA 1OTCA 1ML0D 2MFIA 2K75A 2SNSA 2A8VA 1L1OA 3KUPA 1R4QB 3MEHA 2JJQA 1UE1A 3VA5A 5CR3A 2PZWA 1C8CA 3EQLC 4BBSH 2DY7A 1PZKD 2E76C 3RUZA 3J81c 2EYPA 3K80C 4RGNA 4NW2A 1Y1WG 3BZKA 2SOBA 5JEAH 2X6LA 3I4NB 3T1YL 1H95A 1VQ4A 1A8VA 4AH6A 3S1QB 3KBXA 1B8AA 4LF9L 1XPUA 1G2SA 2K5VA 1XTCD 2CVRA 1LO5D 1EY6A 2K50A 5EAYA 1Q46A 3A55A 4JK1C 1SSOA 5D65A 1KNAA 3TRZA 1KTKA 2RHSB 1EY9A 1FD7D 2EYOA 3TMEA 4ZLTF 3T1HL 5JEAJ 3RZDH 5EGTA 2EVBA 1CKMA 1Q7YC 1N8RC 2ZTEA 1LTID 3I4NG 3S15H 1PRTD 3CC7A 4IFDH 3J81E 1LTLA 4IPDA 1HZCA 3PMFA 2F0OA 1BBXC 2EZVA 1QILA 4C3HH 1TT2A 2F1MA 1KDCA 3GTLH 5JJIA 3TS2A 4KY5A 3M4YA 2UUCQ 1RTOA 4ULLA 2K5HA 2DNEA 4KTAA 2UXBQ 4DR3Q 4B3MQ 2UXCQ 2G9HD 1EYAA 1P16A 3J7A5 1ESFA 2AWNA 3HOXH 4IFDJ 3HKZE 3V05A 5C44B 4R9WA 4B08A 2HDLA 4A3EB 1K3RA 1WFQA 3L7ZC 1QVGA 2YYZA 4ZK9B 1N36L 1S5FD 5LMNW 1BKBA 3K5OA 1TS5A 4C3IH 1S3OA 1SRUA 3QWNA 5HGTA 1PRTF 4DPGA 2GVAA 3ER0A 1XPRA 1E7ZA 2EPBA 4OL7A 4JI8L 4CGYB 2PCFB 2F0UA 4LFBQ 4MTNA 5C44G 2JYOA 5IYDG 3CPFA 3R2IA 2Z9HA 1BVSA 1UEAB 1RF2D 4GS3A 3GTMH 3DM1A 4AQYL 4LF6Q 5CORA 4A4IA 3K0XA 1VMCA 4CJ1B 4DR2Q 3BVZA 5NUCA 4JI1Q 1RL2A 1WTHA 3KLSX 4DR4L 3M4OB 1IL8A 3SVMA 2IT1A 5AFWA 1W2BA 2L12A 1PDQA 1SYCA 3M7GA 4DK0A 1VQOA 2RSNA 3SHLA 4LF5Q 2HHHL 3NQTA 3NBHB 5FO7B 1NJIC 5EQ0A 1QJOA 1CUKA 1L0YB 1HQMC 2B2YA 4R4CA 3I4MB 5M5WH 1PRTB 4B3TL 1TWFB 1VDZA 4CDFC 5I6YA 3ND9A 2NZOA 2V1CC 1GHJA 4NDXA 1U5KA 5C0XH 1VQKA 1QUQB 1RCVD 2E2HH 5M5YB 3C2PA 1G51A 5E7NA 1F77A 3A8KE 3RN5A 4PG3A 1B44D 1M8AA 5IY0A 2RF4A 4R4IA 4XQQA 1RHPA 3AB9A 1L0WA 5J1ZA 4TVAB 4G57A 5FK9C 1TR5A 1U4LA 4QJFA 1PHJA 5C0XJ 1JWSD 2A1AA 1G291 3H15A 1STBA 5ELNA 3UDGA 1DD2A 1EOVA 4BXXG 5HURA 1IZ6A 2B2TC 1YNXA 4APVA 2DJGC 4FF2A 2EYFA 4KLKA 5M5XB 1M1KC 3GTQH 2WACA 5ELEA 1E3PA 4RGTA 1S40A 5BR8Q 1O7IA 1SMXA 3AYHB 5CGKA 1STYA 3CCSA 1H9KA 3ERSX 1HR0Q 4CJ2C 4KN4C 2VQFL 3FDTA 4TRDA 3D6CA 4DV7L 5DM73 1M4VA 4DUYQ 4KHVA 1PA6A 3NBHA 1BO0A 3L0OA 2XRSD 3TN2A 1YJNA 1EEFD 4DV0Q 1LTSD 4B9WA 4CKBA 5FKAC 3G7LA 4QIWB 1EWIA 1M90C 4YWKA 3HKZG 3K58A 5E3FA 2YTVA 3K5NA 5C5LA 3CMEA 3SGIA 1SBBB 1EIYB 4KHZA 4X3KA 3FVQA 1FL0A 1K73C 4QUFA 5LL6X 5FJ8G 4MNOA 3F8TA 2JXMB 4LF7L 4LUZA 1C4QA 4DR5L 3DHQA 2EYMA 1TWGB 2UUAQ 1ENFA 3T53B 4I7ZC 1N34Q 5KYIA 4IPGA 3GTOB 5M3FB 2G5DA 3TEHB 5ELDA 4JI6L 2VNUD 1VQ5A 5A2QL 3D3RA 3MVVA 3GV6A 4IO9A 4JC0A 3H0GH 5DEHA 3QB3A 4RGOS 3K7UC 1LTBD 1CM9A 1HZBA 5K36H 2QCPX 5DNFA 3FP9A 2DY8A 1B2TA 1OXTA 2MO0A 2IX1A 4ZUJA 1CA5A 4YWMA 2HDMA 4C1NI 2A73B 2EQSA 5IGFA 2B39A 4K5VA 1WTPA 1N33Q 4K0KQ 3DEOA 3GTJB 3W3AA 4ZYSA 1TVXA 5M3FG 3NUCA 1XTDA 2BH2A 4YCWA 3RZOH 4FYDA 1II3A 4G7ZC 2GN5A 1Y1WH 4A93H 1PTOH 1I3QB 3ULJA 2P5ZX 2RKSA 4K6DA 1NY4A 4IUVA 2K52A 4RKLA 1EY8A 1LTAD 3R93A 4NKLA 1Q81C 2E2JB 1IHZA 1UE5A 5C3WA 1UEBA 1A3VA 4N8X1 3MAQA 5FLXL 5I9OA 3PF4A 2WKDA 4M8AA 1HNZL 4RH6A 4LFCQ 1SNMA 3CAMA 1WYDA 4NMZA 4IOAA 1W3SA 1QZGA 1UWVA 5T1IA 1JORA 4HN7A 2XVSA 5BN5A 3HS0C 3I4NH 3QIAA 2KA7A 3EJIA 1PH6A 4QUCA 5EJWA 3S1QH 1IW7D 2NVTB 4JI0L 4GN5A 2ZXPA 3S15B 1QG7A 4DR1Q 4KI0A 1EZ8A 2K01A 2B8FA 2XTIA 1B9NA 5E1FA 4RHRA 3UE1A 1QOHA 2WP8J 4UP7A 3SE0A 1FGBD 4B3RQ 1XNQQ 1BDOA 3T16A 3VA7A 5JAVA 1Y1VG 3BJUA 1GUGA 3OSOA 1WD0A 1NE3A 4R8NA 3JAMi 2QA4A 3TZDA 1GO3E 3RMHA 4PQXA 3HOXB 1Q1BA 1EWHA 3CHBD 2K28A 4PNYA 1VQJA 2BA1A 2RA4A 2IHEA 2VW9A 1CTMA 5D14A 1YHQA 3WDNA 3A56A 2WAQB 1BCPD 5F2DA 4EX5A 1F2YA 4X64Q 3PIOA 1BR9A 1SE8A 5C44H 2PW7A 3NELA 5IYDH 1SE2A 1IW7C 4KK7A 5EPKA 4JI2L 1SDFA 3U58A 1KIXA 1HTLD 3TP8A 5COYA 3PCOB 2F0IA 1HH2P 3OTOQ 3A7AB 3DEPA 2F52A 3A74A 2KCCA 4QMGA 1RDPD 3ULLA 1CKNB 2OT2A 2Q8TA 1LACA 2B2WC 2UUCL 3KOJA 2EIFA 3AFQA 1B3AA 1K0RA 4LF8L 1BBUA 1LT6D 1X32A 4LAAA 2ZM6L 1XX8A 2AWOA 3BG3A 4L6TB 1I94Q 1SE4A 2Q2HA 3SK4A 3BDOA 2D0OA 3KF6B 3M4PA 3KLSA 1BCPF 2D5DA 2EYHA 3BDCA 4BY7B 3A7LA 3EBEA 3K7AB 1PH1A 1JR0D 2F0GA 1EQRA 4DV2Q 4A3GB 4QQBX 3M4OH 3D4DA 2R3ZA 2VZAA 1AP0A 3T4AC 1BCPC 2A74C 2N3SA
chains in the Genus database with same CATH topology
1PH2A 3PO2H 1VQNA 4A3DH 2JA8G 5K36G 1YVCA 4DKAC 3CCRA 3CCMA 2YU9H 2AHOB 1IBKL 2E8GA 2Z0SA 4HIDA 4X66Q 1OTCA 2JA5H 4EQ5A 1SR3A 4DUZL 2R93G 2MFIA 2K75A 4DV4Q 2A8VA 1XNRL 4X62Q 3CP0A 1L1OA 4P73A 1TWFH 3T1HQ 1JB7A 1Z47A 1NTGA 2JJQA 4P74A 4DV6L 5ELOA 4L5SA 5IP7G 1UE1A 1I94L 4BA1I 1IBLQ 4BY7G 4BXXH 3S14H 2F4VL 2JE6I 1HNWQ 4BBSH 4YY3Q 4B3SL 4OONA 2MNAA 3J81c 4QL5A 4OWXB 5M5YH 4A3GG 1PH3A 3K80C 1PH5A 4A3JH 4JBMA 2BA0A 3CCJA 4RMFA 1Y1WG 4LFAL 3BZKA 1QZHA 3J81i 4DR2L 4JV5Q 4GOPC 4DV2L 3G48A 4YCVA 3FKIG 3T1YL 1DGSA 1H95A 1VQ4A 1A8VA 4AH6A 1VQLA 3LGJA 1A0IA 1EFWA 1B8AA 3D31A 4LF9L 1XPUA 4OO1I 2K5VA 1NMGA 4POFA 4JBJA 1YITA 2R6GA 2RCNA 4HIKA 1K9MC 2K50A 3I4MG 5EAYA 1Q46A 3DLLA 1CKNA 1OXVA 2OWOA 3HOZG 4YHHL 4X66L 4A75A 1X65A 4DV5L 2CQOA 2RHSB 2PNHA 3F2BA 4A3IH 3TRZA 2I0QA 2R7FA 3DM3A 3I55A 3T1HL 5JEAJ 4YCUA 1X3GA 3EN2A 2JA9A 3RZDH 1AH9A 1IBLL 4GLVB 1CKMA 1Q7YC 1N36Q 5M5XH 1N8RC 4YY3L 2ZTEA 3KF6A 4HJ7A 2E5LQ 1KQSA 3PUYA 3I4NG 2HIVA 3S15H 3CC7A 1WCMH 2LXJA 3J81j 1LTLA 4IPDA 1HZCA 1CKOA 2Y0SE 4GLXA 4JV5L 1KRSA 3K81C 3E9IA 4C3HH 2PI2E 2KBNA 1GD7A 3TS0A 4FDBA 5FLMH 3GTLH 5JJIA 3TS2A 1PVOA 2UUCQ 1N9WA 1VQCA 4A3FH 2WB1E 5FJ8H 1L1OB 5IYCH 1KC8C 3PUVA 3HOVH 2K5HA 2DGYA 2UXBQ 2CFMA 1HNXQ 3F2CA 4DR3Q 4B3MQ 2UXCQ 1X3FA 4XIGS 2ID0A 5JJKA 1RIPA 3HOYG 1P16A 4JI4Q 3J7A5 2AWNA 3HOXH 4IFDJ 4JBWA 3HKZE 2R92G 3PO3H 1G6PA 4AIMA 4AQYQ 1IYJB 1A62A 1K3RA 1NBWA 1WFQA 3L7ZC 1QVGA 2YYZA 4OXPA 2WFWA 1N36L 1YBYA 5LMNW 1MKHA 4GNXC 2E5LL 2AKWB 2Z6KC 1BKBA 1JE5A 3PUZA 1QUQA 1A63A 1SN8A 4PZ7A 2K4KA 4C3IH 4DR4Q 3GTGH 1S3OA 1SRUA 2A19A 1LYLA 2KENA 1LUZA 4A3KH 4A3MG 1VQ7A 2VS1A 4A3CH 5IP9H 1E22A 5C3EG 4DPGA 2MQHA 1OXXK 2HHHQ 1IBKQ 2OTJA 2GVAA 2AMCB 3ER0A 4DUZQ 1XPRA 1E7ZA 2HT1A 2VUMG 4PMWA 1TWGH 4JI8L 3U50C 2NVYH 3VDYA 2ES2A 2R7ZH 1C9OA 4MZ9A 3PSIA 3ULPA 4LFBQ 4MTNA 4X6AH 2UXBL 2B63H 2NVXH 3KYHC 5C44G 1HNXL 4DR3L 1NMFA 5IYDG 5M3FH 3CPFA 4B3ML 1FJGQ 3GTOH 4DV0L 2UXCL 2JA6G 3UDXA 1BVSA 4BBRG 4GS3A 4BY1G 4PZ8A 3JC66 2JA7G 3GTMH 3RNUA 1JJCB 1K8AC 1VCIA 4AQYL 4LF6Q 4A4IA 4HJAA 2WAQE 1WJJA 3K0XA 1VS0A 2F3IA 1XJVA 4DR2Q 4LF4Q 3S16H 1J5EL 4JI1Q 1RL2A 2K5NA 4DR4L 3S24A 2IHFA 2ZJPA 2UXDL 2IT1A 1W2BA 4DAYB 5IT9c 1VQOA 3RLOA 4LF5Q 1PYBA 3J7ZC 4HJ9A 4L5QA 2HHHL 3GTJH 3NBHB 1D8LA 4YHHQ 3G71A 2NN6G 1NJIC 4DV5Q 3CCEA 2B29A 3M9BA 2OTLA 1CUKA 3HOWH 1X9NA 4NPSA 4R4CA 4O0AA 5M5WH 4B3TL 1TWAH 5M3MH 1S72A 2YTXA 4LFBL 1OXSC 3NEMA 2NZOA 2V1CC 1FJGL 1I3QH 4LUVA 1U5KA 4A3LG 1VQKA 2UU9L 1YHBA 1MJCA 3E0EA 4LUOA 1QUQB 2E2HH 4R4OA 4LF6L 4GKJQ 1V1QA 1KHIA 1G51A 2E2JH 2KCTA 3I2ZA 5E7NA 3RN5A 1IL2A 4PG3A 1HJPA 4LF4L 3G4SA 4JYAQ 5IY0A 3H3VI 2RF4A 4JI1L 4R4IA 3E9HA 3W1BA 3PO2G 4A3DG 1L0WA 2NN6I 2RHQB 1AE2A 2N49A 4TVAB 3I56A 2VQFQ 4A3BH 2JA5G 4LF5L 3PUXA 4POGA 4QJFA 1D7QA 2JQOA 4WJ3M 4Y52H 1PHJA 1PH9A 5C0XJ 2PMZE 3CCVA 2A1AA 1G291 3H15A 5ELNA 3UDGA 1EOVA 4BXXG 4DV1Q 1Y1VH 3HOUH 1IZ6A 3PUWA 1YNXA 3K8AA 1EQQA 4APVA 4BBSG 3GDEA 2JK8A 4LWCA 2Q2UA 2Q2IA 2NVTH 1Q12A 4A3JG 3HKSA 2JEAI 1X3EA 4KLKA 1M1KC 3GTQH 5JEAG 2KHJA 4PZ6A 1GVPA 4DAMA 4QGUA 3ICEA 4GOPB 1Q1EA 1E3PA 2Z6KA 4AYBE 1S40A 2FXQA 4GKJL 5BR8Q 1O7IA 3AYHB 1SMXA 3KFUA 1ASZA 2I5HA 4JYAL 5DLQE 3CCSA 5LMUL 3ERSX 1WOCA 2QEXA 1PYSB 2Y0SG 1HR0Q 2VY3A 2VQFL 2OCEA 1E1TA 4JI8Q 4DR5Q 4DV7L 1PV4A 1WI5A 4A3IG 4JOIA 3F1ZA 3RLNA 4DUYQ 1PA6A 2WB1G 4LFCL 1VQPA 3L0OA 1YJNA 4DV0Q 1EYGA 5HGQA 3KDFB 3A5UA 4DV1L 4C3JH 2ZJQA 4JI6Q 3CCUA 4H02A 4HIOA 2ZTCA 1OXUA 1PH8A 1YI2A 1EWIA 1M90C 4O2DA 1IXRA 3HKZG 4YWKA 3RLFA 1WCMG 2YTVA 4IFDG 1B70B 1J5EQ 2YTYA 3CMEA 4UPAA 4HJ5A 4DV3Q 3SGIA 1EUJA 5BR8L 1EIYB 1C0AA 1SFOH 2UXDQ 4KHZA 1KD1C 4GKKQ 5JJLA 4LNQA 5FLMG 3CMAA 1FL0A 4ALPA 1J6QA 1K73C 4A3FG 2D0PA 5FJ8G 5IYCG 1HR0L 1IBMQ 4MNOA 5LMNL 3HOVG 3F8TA 4QY7A 1KRTA 3RR5A 1XMOL 4LF7L 4LUZA 2C35B 1C7YA 4A3EH 4IOCA 4DR5L 4B3RL 1PH7A 2UUAQ 4B3TQ 1LM0A 4DUYL 1N34Q 3HOXG 1HZAA 5C4XH 1E24A 1XPOA 4IPGA 2PI2A 5AJ3L 3PO3G 3TEHB 3NENA 4IFDI 4X65Q 1ASYA 3GTKH 3CC2A 1B7YB 2UU9Q 4JI6L 1SROA 2VNUD 1VQ5A 4JBKA 1PFSA 1TXYA 4C2MH 2E2IH 1JJGA 3ZJYC 1GKHA 4GNXB 4P71A 3TREA 5IYBH 4IO9A 4JC0A 2HQLA 1P8LA 3H0GH 5H1SE 2GVBA 2N78A 3PIPA 3Q8DA 3K7UC 1HZBA 2WAQG 4A3KG 4DV3L 2JA8H 4L5RC 4GOPA 1Q82C 4DR6Q 1E1OA 3S1RH 5IP9G 4A3CG 3FP9A 3AQQA 4GKKL 1GM5A 1OXTA 2MO0A 1V43A 3KJPA 2IX1A 5GADC 1JJ2A 4OWWB 2R93H 4YWMA 5IWAL 3G6EA 4HJ8A 1IBML 2ZJRA 1HNZQ 2EQSA 1N33Q 2R7ZG 4DK3C 4X64L 4K0KQ 5HY6A 1CSPA 4BY7H 5IP7H 2B63G 1N32Q 2PQAB 5M3FG 2CWPA 4JI3Q 3K7AH 2UUAL 1XTDA 5FLXc 4LF9Q 3W5OA 4YCWA 2BH2A 2OQ0A 3RZOH 1AE3A 1N34L 1U0LA 4A3GH 2ATWA 2R7DA 4A93H 2GN5A 1Y1WH 1VQIA 1YJWA 2QGQA 2Q2TA 4JI5Q 3ULJA 3KDFA 4X65L 1NY4A 1YEZA 2EXDA 2K52A 1VQFA 3OTOL 3FKIH 5GAEC 3I7FA 3F2DA 4J15A 1VQ8A 3CW2C 1Q81C 3CCLA 2D62A 1PH4A 3EIVA 4JI7Q 3A5ZB 2NVQH 3CC4A 3CPWA 3KJOA 1UE5A 5LMUQ 1VQMA 3PGZA 4DR7Q 3M85A 1K83H 1UEBA 3J80c 3I4MH 3S2HH 3TQYA 1VQEA 4DR6L 4GN3B 2L15A 1XMQL 3HOZH 2VL6A 1L2FA 4IJLA 3GD7A 3PF4A 3J80i 4DV7Q 3CXCA 1Y14B 3HOWG 1HNZL 1N33L 4RG1A 1YIJA 3M3YH 4K0KL 4LFCQ 5M3MG 3KLWA 3U4VA 3CAMA 3S17H 1N32L 4P75A 1WYDA 4IOAA 3STBD 1W3SA 1QZGA 4JI3L 4A93G 3GO5A 1UWVA 3A0JA 3W1GA 3CD6A 5C0XG 4WJ4A 3I4NH 3D0FA 1PH6A 4JI5L 3S1QH 3AFPA 2VQEQ 4JI0L 4GN5A 4NXMQ 3S1MH 3U4ZA 1YJ9A 4IJHA 2K14A 4GNXA 4Y7NH 2NZHA 4IPHA 1EIFA 4KI0A 4DR1Q 4JI7L 4P72A 4AYBG 1L1OC 4A3BG 4DR7L 4DV4L 2XTIA 4JG2A 3MXNB 4NB3A 3UE0A 4X62L 5LMNQ 1XMOQ 4LF7Q 3CQZH 3UE1A 1VQBA 2WP8J 4UP7A 1VQ9A 4B3RQ 1XNQQ 4L5TA 4R4TA 3JAMc 3KF8B 3HOYH 1HNWL 5C0XI 1Y1VG 3FHWA 4JI2Q 3UDFA 2R92H 1T9HA 3HOUG 4KHPQ 3BJUA 5AJ3Q 1NE3A 4R4QA 3UDIA 3JAMi 4JCVE 2PQAA 2QA4A 4HIMA 1TWHH 4DK6C 1GO3E 4R1JA 4NXNQ 3GTPH 1K8GA 1BBWA 4OO1G 1Q1BA 4OWTB 1I50H 3IRBA 3M4QA 3BU2A 5GQOA 3PF5A 3S2DH 2VQEL 2ASBA 2KHIA 3M7NA 5IE8A 4ME3A 4NXML 5GAGC 4A3MH 1VQJA 2BA1A 5J3BA 3AEVA 4DNIA 5C3EH 1VQHA 4LF8Q 1VQAA 2IHEA 2VW9A 4OX9Q 5GAHC 1YHQA 4DR1L 2ZM6Q 3WWVA 4GLAC 1MJEA 2VUMH 1JT8A 1KL9A 4UP9A 5IWAQ 1I5FA 3STBC 4EX5A 2I5LX 4XTCS 1QVCA 1X6OA 3RN2A 4X64Q 3PIOA 2ZTDA 1SE8A 1Z9FA 5C44H 2HIXA 2ALYB 3NELA 5IYDH 4UY8C 2CWAA 4A76A 2UUBQ 2JEBI 1Q8KA 1TWCH 3BZCA 3MEFA 1SLJA 4GN4B 1JMCA 2CCZA 1XNQL 4BBRH 2JA6H 4BY1H 3CF5A 1HR0W 4JI2L 2JA7H 4KHPL 1V9PA 2B3GA 3U58A 1KIXA 3PV0A 3PCOB 4LW1A 1FVIA 2YV5A 1UE7A 1CSQA 1HH2P 1X55A 4NXNL 2H5XA 2KCMA 1QVFA 3OTOQ 2I5MX 2F52A 3A74A 2MO1A 3L2PA 1FGUA 1KXLA 3HFZB 3ULLA 1UE6A 1CKNB 1MIUA 1VQGA 4BA2I 1YHAA 2XGTA 3H3VH 4JOIC 2UUCL 3B6YA 2EIFA 3AFQA 3KOJA 2LXKA 1XNRQ 1K0RA 4LF8L 1VQ6A 1BBUA 5C4JH 4UP8A 1XMQQ 4OX9L 2CKZB 4QIWE 3S1NH 2ZM6L 3CCQA 3OYYA 2OQKA 4DV6Q 2AWOA 4TQUS 2N8NA 4A3EG 2IY5B 1I94Q 1VQDA 2F4VQ 4YWLA 2Q2HA 3KF6B 2D0OA 3M4PA 1YZ6A 1HZ9A 4B3SQ 4JI4L 5GROA 3EBEA 2UUBL 5C4XG 4LFAQ 4A3LH 4IPCA 2DUDA 1X54A 1R9TH 1PH1A 1EQRA 1X56A 1KAWA 4DV2Q 2LSSA 3T1YQ 1I6HH 2BH8A 4QQBX 3M4OH 5IYBG 2VZAA 3OW2A 4JI0Q 3H0GG 3I4OA 1Q86C 2IX0A 2N3SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PH2 A;  3PO2 H;  1VQN A;  4A3D H;  2JA8 G;  5K36 G;  1YVC A;  4DKA C;  3CCR A;  3CCM A;  2YU9 H;  2AHO B;  1IBK L;  2E8G A;  2Z0S A;  4HID A;  4X66 Q;  1OTC A;  2JA5 H;  4EQ5 A;  1SR3 A;  4DUZ L;  2R93 G;  2MFI A;  2K75 A;  4DV4 Q;  2A8V A;  1XNR L;  4X62 Q;  3CP0 A;  1L1O A;  4P73 A;  1TWF H;  3T1H Q;  1JB7 A;  1Z47 A;  1NTG A;  2JJQ A;  4P74 A;  4DV6 L;  5ELO A;  4L5S A;  5IP7 G;  1UE1 A;  1I94 L;  4BA1 I;  1IBL Q;  4BY7 G;  4BXX H;  3S14 H;  2F4V L;  2JE6 I;  1HNW Q;  4BBS H;  4YY3 Q;  4B3S L;  4OON A;  2MNA A;  3J81 c;  4QL5 A;  4OWX B;  5M5Y H;  4A3G G;  1PH3 A;  3K80 C;  1PH5 A;  4A3J H;  4JBM A;  2BA0 A;  3CCJ A;  4RMF A;  1Y1W G;  4LFA L;  3BZK A;  1QZH A;  3J81 i;  4DR2 L;  4JV5 Q;  4GOP C;  4DV2 L;  3G48 A;  4YCV A;  3FKI G;  3T1Y L;  1DGS A;  1H95 A;  1VQ4 A;  1A8V A;  4AH6 A;  1VQL A;  3LGJ A;  1A0I A;  1EFW A;  1B8A A;  3D31 A;  4LF9 L;  1XPU A;  4OO1 I;  2K5V A;  1NMG A;  4POF A;  4JBJ A;  1YIT A;  2R6G A;  2RCN A;  4HIK A;  1K9M C;  2K50 A;  3I4M G;  5EAY A;  1Q46 A;  3DLL A;  1CKN A;  1OXV A;  2OWO A;  3HOZ G;  4YHH L;  4X66 L;  4A75 A;  1X65 A;  4DV5 L;  2CQO A;  2RHS B;  2PNH A;  3F2B A;  4A3I H;  3TRZ A;  2I0Q A;  2R7F A;  3DM3 A;  3I55 A;  3T1H L;  5JEA J;  4YCU A;  1X3G A;  3EN2 A;  2JA9 A;  3RZD H;  1AH9 A;  1IBL L;  4GLV B;  1CKM A;  1Q7Y C;  1N36 Q;  5M5X H;  1N8R C;  4YY3 L;  2ZTE A;  3KF6 A;  4HJ7 A;  2E5L Q;  1KQS A;  3PUY A;  3I4N G;  2HIV A;  3S15 H;  3CC7 A;  1WCM H;  2LXJ A;  3J81 j;  1LTL A;  4IPD A;  1HZC A;  1CKO A;  2Y0S E;  4GLX A;  4JV5 L;  1KRS A;  3K81 C;  3E9I A;  4C3H H;  2PI2 E;  2KBN A;  1GD7 A;  3TS0 A;  4FDB A;  5FLM H;  3GTL H;  5JJI A;  3TS2 A;  1PVO A;  2UUC Q;  1N9W A;  1VQC A;  4A3F H;  2WB1 E;  5FJ8 H;  1L1O B;  5IYC H;  1KC8 C;  3PUV A;  3HOV H;  2K5H A;  2DGY A;  2UXB Q;  2CFM A;  1HNX Q;  3F2C A;  4DR3 Q;  4B3M Q;  2UXC Q;  1X3F A;  4XIG S;  2ID0 A;  5JJK A;  1RIP A;  3HOY G;  1P16 A;  4JI4 Q;  3J7A 5;  2AWN A;  3HOX H;  4IFD J;  4JBW A;  3HKZ E;  2R92 G;  3PO3 H;  1G6P A;  4AIM A;  4AQY Q;  1IYJ B;  1A62 A;  1K3R A;  1NBW A;  1WFQ A;  3L7Z C;  1QVG A;  2YYZ A;  4OXP A;  2WFW A;  1N36 L;  1YBY A;  5LMN W;  1MKH A;  4GNX C;  2E5L L;  2AKW B;  2Z6K C;  1BKB A;  1JE5 A;  3PUZ A;  1QUQ A;  1A63 A;  1SN8 A;  4PZ7 A;  2K4K A;  4C3I H;  4DR4 Q;  3GTG H;  1S3O A;  1SRU A;  2A19 A;  1LYL A;  2KEN A;  1LUZ A;  4A3K H;  4A3M G;  1VQ7 A;  2VS1 A;  4A3C H;  5IP9 H;  1E22 A;  5C3E G;  4DPG A;  2MQH A;  1OXX K;  2HHH Q;  1IBK Q;  2OTJ A;  2GVA A;  2AMC B;  3ER0 A;  4DUZ Q;  1XPR A;  1E7Z A;  2HT1 A;  2VUM G;  4PMW A;  1TWG H;  4JI8 L;  3U50 C;  2NVY H;  3VDY A;  2ES2 A;  2R7Z H;  1C9O A;  4MZ9 A;  3PSI A;  3ULP A;  4LFB Q;  4MTN A;  4X6A H;  2UXB L;  2B63 H;  2NVX H;  3KYH C;  5C44 G;  1HNX L;  4DR3 L;  1NMF A;  5IYD G;  5M3F H;  3CPF A;  4B3M L;  1FJG Q;  3GTO H;  4DV0 L;  2UXC L;  2JA6 G;  3UDX A;  1BVS A;  4BBR G;  4GS3 A;  4BY1 G;  4PZ8 A;  3JC6 6;  2JA7 G;  3GTM H;  3RNU A;  1JJC B;  1K8A C;  1VCI A;  4AQY L;  4LF6 Q;  4A4I A;  4HJA A;  2WAQ E;  1WJJ A;  3K0X A;  1VS0 A;  2F3I A;  1XJV A;  4DR2 Q;  4LF4 Q;  3S16 H;  1J5E L;  4JI1 Q;  1RL2 A;  2K5N A;  4DR4 L;  3S24 A;  2IHF A;  2ZJP A;  2UXD L;  2IT1 A;  1W2B A;  4DAY B;  5IT9 c;  1VQO A;  3RLO A;  4LF5 Q;  1PYB A;  3J7Z C;  4HJ9 A;  4L5Q A;  2HHH L;  3GTJ H;  3NBH B;  1D8L A;  4YHH Q;  3G71 A;  2NN6 G;  1NJI C;  4DV5 Q;  3CCE A;  2B29 A;  3M9B A;  2OTL A;  1CUK A;  3HOW H;  1X9N A;  4NPS A;  4R4C A;  4O0A A;  5M5W H;  4B3T L;  1TWA H;  5M3M H;  1S72 A;  2YTX A;  4LFB L;  1OXS C;  3NEM A;  2NZO A;  2V1C C;  1FJG L;  1I3Q H;  4LUV A;  1U5K A;  4A3L G;  1VQK A;  2UU9 L;  1YHB A;  1MJC A;  3E0E A;  4LUO A;  1QUQ B;  2E2H H;  4R4O A;  4LF6 L;  4GKJ Q;  1V1Q A;  1KHI A;  1G51 A;  2E2J H;  2KCT A;  3I2Z A;  5E7N A;  3RN5 A;  1IL2 A;  4PG3 A;  1HJP A;  4LF4 L;  3G4S A;  4JYA Q;  5IY0 A;  3H3V I;  2RF4 A;  4JI1 L;  4R4I A;  3E9H A;  3W1B A;  3PO2 G;  4A3D G;  1L0W A;  2NN6 I;  2RHQ B;  1AE2 A;  2N49 A;  4TVA B;  3I56 A;  2VQF Q;  4A3B H;  2JA5 G;  4LF5 L;  3PUX A;  4POG A;  4QJF A;  1D7Q A;  2JQO A;  4WJ3 M;  4Y52 H;  1PHJ A;  1PH9 A;  5C0X J;  2PMZ E;  3CCV A;  2A1A A;  1G29 1;  3H15 A;  5ELN A;  3UDG A;  1EOV A;  4BXX G;  4DV1 Q;  1Y1V H;  3HOU H;  1IZ6 A;  3PUW A;  1YNX A;  3K8A A;  1EQQ A;  4APV A;  4BBS G;  3GDE A;  2JK8 A;  4LWC A;  2Q2U A;  2Q2I A;  2NVT H;  1Q12 A;  4A3J G;  3HKS A;  2JEA I;  1X3E A;  4KLK A;  1M1K C;  3GTQ H;  5JEA G;  2KHJ A;  4PZ6 A;  1GVP A;  4DAM A;  4QGU A;  3ICE A;  4GOP B;  1Q1E A;  1E3P A;  2Z6K A;  4AYB E;  1S40 A;  2FXQ A;  4GKJ L;  5BR8 Q;  1O7I A;  3AYH B;  1SMX A;  3KFU A;  1ASZ A;  2I5H A;  4JYA L;  5DLQ E;  3CCS A;  5LMU L;  3ERS X;  1WOC A;  2QEX A;  1PYS B;  2Y0S G;  1HR0 Q;  2VY3 A;  2VQF L;  2OCE A;  1E1T A;  4JI8 Q;  4DR5 Q;  4DV7 L;  1PV4 A;  1WI5 A;  4A3I G;  4JOI A;  3F1Z A;  3RLN A;  4DUY Q;  1PA6 A;  2WB1 G;  4LFC L;  1VQP A;  3L0O A;  1YJN A;  4DV0 Q;  1EYG A;  5HGQ A;  3KDF B;  3A5U A;  4DV1 L;  4C3J H;  2ZJQ A;  4JI6 Q;  3CCU A;  4H02 A;  4HIO A;  2ZTC A;  1OXU A;  1PH8 A;  1YI2 A;  1EWI A;  1M90 C;  4O2D A;  1IXR A;  3HKZ G;  4YWK A;  3RLF A;  1WCM G;  2YTV A;  4IFD G;  1B70 B;  1J5E Q;  2YTY A;  3CME A;  4UPA A;  4HJ5 A;  4DV3 Q;  3SGI A;  1EUJ A;  5BR8 L;  1EIY B;  1C0A A;  1SFO H;  2UXD Q;  4KHZ A;  1KD1 C;  4GKK Q;  5JJL A;  4LNQ A;  5FLM G;  3CMA A;  1FL0 A;  4ALP A;  1J6Q A;  1K73 C;  4A3F G;  2D0P A;  5FJ8 G;  5IYC G;  1HR0 L;  1IBM Q;  4MNO A;  5LMN L;  3HOV G;  3F8T A;  4QY7 A;  1KRT A;  3RR5 A;  1XMO L;  4LF7 L;  4LUZ A;  2C35 B;  1C7Y A;  4A3E H;  4IOC A;  4DR5 L;  4B3R L;  1PH7 A;  2UUA Q;  4B3T Q;  1LM0 A;  4DUY L;  1N34 Q;  3HOX G;  1HZA A;  5C4X H;  1E24 A;  1XPO A;  4IPG A;  2PI2 A;  5AJ3 L;  3PO3 G;  3TEH B;  3NEN A;  4IFD I;  4X65 Q;  1ASY A;  3GTK H;  3CC2 A;  1B7Y B;  2UU9 Q;  4JI6 L;  1SRO A;  2VNU D;  1VQ5 A;  4JBK A;  1PFS A;  1TXY A;  4C2M H;  2E2I H;  1JJG A;  3ZJY C;  1GKH A;  4GNX B;  4P71 A;  3TRE A;  5IYB H;  4IO9 A;  4JC0 A;  2HQL A;  1P8L A;  3H0G H;  5H1S E;  2GVB A;  2N78 A;  3PIP A;  3Q8D A;  3K7U C;  1HZB A;  2WAQ G;  4A3K G;  4DV3 L;  2JA8 H;  4L5R C;  4GOP A;  1Q82 C;  4DR6 Q;  1E1O A;  3S1R H;  5IP9 G;  4A3C G;  3FP9 A;  3AQQ A;  4GKK L;  1GM5 A;  1OXT A;  2MO0 A;  1V43 A;  3KJP A;  2IX1 A;  5GAD C;  1JJ2 A;  4OWW B;  2R93 H;  4YWM A;  5IWA L;  3G6E A;  4HJ8 A;  1IBM L;  2ZJR A;  1HNZ Q;  2EQS A;  1N33 Q;  2R7Z G;  4DK3 C;  4X64 L;  4K0K Q;  5HY6 A;  1CSP A;  4BY7 H;  5IP7 H;  2B63 G;  1N32 Q;  2PQA B;  5M3F G;  2CWP A;  4JI3 Q;  3K7A H;  2UUA L;  1XTD A;  5FLX c;  4LF9 Q;  3W5O A;  4YCW A;  2BH2 A;  2OQ0 A;  3RZO H;  1AE3 A;  1N34 L;  1U0L A;  4A3G H;  2ATW A;  2R7D A;  4A93 H;  2GN5 A;  1Y1W H;  1VQI A;  1YJW A;  2QGQ A;  2Q2T A;  4JI5 Q;  3ULJ A;  3KDF A;  4X65 L;  1NY4 A;  1YEZ A;  2EXD A;  2K52 A;  1VQF A;  3OTO L;  3FKI H;  5GAE C;  3I7F A;  3F2D A;  4J15 A;  1VQ8 A;  3CW2 C;  1Q81 C;  3CCL A;  2D62 A;  1PH4 A;  3EIV A;  4JI7 Q;  3A5Z B;  2NVQ H;  3CC4 A;  3CPW A;  3KJO A;  1UE5 A;  5LMU Q;  1VQM A;  3PGZ A;  4DR7 Q;  3M85 A;  1K83 H;  1UEB A;  3J80 c;  3I4M H;  3S2H H;  3TQY A;  1VQE A;  4DR6 L;  4GN3 B;  2L15 A;  1XMQ L;  3HOZ H;  2VL6 A;  1L2F A;  4IJL A;  3GD7 A;  3PF4 A;  3J80 i;  4DV7 Q;  3CXC A;  1Y14 B;  3HOW G;  1HNZ L;  1N33 L;  4RG1 A;  1YIJ A;  3M3Y H;  4K0K L;  4LFC Q;  5M3M G;  3KLW A;  3U4V A;  3CAM A;  3S17 H;  1N32 L;  4P75 A;  1WYD A;  4IOA A;  3STB D;  1W3S A;  1QZG A;  4JI3 L;  4A93 G;  3GO5 A;  1UWV A;  3A0J A;  3W1G A;  3CD6 A;  5C0X G;  4WJ4 A;  3I4N H;  3D0F A;  1PH6 A;  4JI5 L;  3S1Q H;  3AFP A;  2VQE Q;  4JI0 L;  4GN5 A;  4NXM Q;  3S1M H;  3U4Z A;  1YJ9 A;  4IJH A;  2K14 A;  4GNX A;  4Y7N H;  2NZH A;  4IPH A;  1EIF A;  4KI0 A;  4DR1 Q;  4JI7 L;  4P72 A;  4AYB G;  1L1O C;  4A3B G;  4DR7 L;  4DV4 L;  2XTI A;  4JG2 A;  3MXN B;  4NB3 A;  3UE0 A;  4X62 L;  5LMN Q;  1XMO Q;  4LF7 Q;  3CQZ H;  3UE1 A;  1VQB A;  2WP8 J;  4UP7 A;  1VQ9 A;  4B3R Q;  1XNQ Q;  4L5T A;  4R4T A;  3JAM c;  3KF8 B;  3HOY H;  1HNW L;  5C0X I;  1Y1V G;  3FHW A;  4JI2 Q;  3UDF A;  2R92 H;  1T9H A;  3HOU G;  4KHP Q;  3BJU A;  5AJ3 Q;  1NE3 A;  4R4Q A;  3UDI A;  3JAM i;  4JCV E;  2PQA A;  2QA4 A;  4HIM A;  1TWH H;  4DK6 C;  1GO3 E;  4R1J A;  4NXN Q;  3GTP H;  1K8G A;  1BBW A;  4OO1 G;  1Q1B A;  4OWT B;  1I50 H;  3IRB A;  3M4Q A;  3BU2 A;  5GQO A;  3PF5 A;  3S2D H;  2VQE L;  2ASB A;  2KHI A;  3M7N A;  5IE8 A;  4ME3 A;  4NXM L;  5GAG C;  4A3M H;  1VQJ A;  2BA1 A;  5J3B A;  3AEV A;  4DNI A;  5C3E H;  1VQH A;  4LF8 Q;  1VQA A;  2IHE A;  2VW9 A;  4OX9 Q;  5GAH C;  1YHQ A;  4DR1 L;  2ZM6 Q;  3WWV A;  4GLA C;  1MJE A;  2VUM H;  1JT8 A;  1KL9 A;  4UP9 A;  5IWA Q;  1I5F A;  3STB C;  4EX5 A;  2I5L X;  4XTC S;  1QVC A;  1X6O A;  3RN2 A;  4X64 Q;  3PIO A;  2ZTD A;  1SE8 A;  1Z9F A;  5C44 H;  2HIX A;  2ALY B;  3NEL A;  5IYD H;  4UY8 C;  2CWA A;  4A76 A;  2UUB Q;  2JEB I;  1Q8K A;  1TWC H;  3BZC A;  3MEF A;  1SLJ A;  4GN4 B;  1JMC A;  2CCZ A;  1XNQ L;  4BBR H;  2JA6 H;  4BY1 H;  3CF5 A;  1HR0 W;  4JI2 L;  2JA7 H;  4KHP L;  1V9P A;  2B3G A;  3U58 A;  1KIX A;  3PV0 A;  3PCO B;  4LW1 A;  1FVI A;  2YV5 A;  1UE7 A;  1CSQ A;  1HH2 P;  1X55 A;  4NXN L;  2H5X A;  2KCM A;  1QVF A;  3OTO Q;  2I5M X;  2F52 A;  3A74 A;  2MO1 A;  3L2P A;  1FGU A;  1KXL A;  3HFZ B;  3ULL A;  1UE6 A;  1CKN B;  1MIU A;  1VQG A;  4BA2 I;  1YHA A;  2XGT A;  3H3V H;  4JOI C;  2UUC L;  3B6Y A;  2EIF A;  3AFQ A;  3KOJ A;  2LXK A;  1XNR Q;  1K0R A;  4LF8 L;  1VQ6 A;  1BBU A;  5C4J H;  4UP8 A;  1XMQ Q;  4OX9 L;  2CKZ B;  4QIW E;  3S1N H;  2ZM6 L;  3CCQ A;  3OYY A;  2OQK A;  4DV6 Q;  2AWO A;  4TQU S;  2N8N A;  4A3E G;  2IY5 B;  1I94 Q;  1VQD A;  2F4V Q;  4YWL A;  2Q2H A;  3KF6 B;  2D0O A;  3M4P A;  1YZ6 A;  1HZ9 A;  4B3S Q;  4JI4 L;  5GRO A;  3EBE A;  2UUB L;  5C4X G;  4LFA Q;  4A3L H;  4IPC A;  2DUD A;  1X54 A;  1R9T H;  1PH1 A;  1EQR A;  1X56 A;  1KAW A;  4DV2 Q;  2LSS A;  3T1Y Q;  1I6H H;  2BH8 A;  4QQB X;  3M4O H;  5IYB G;  2VZA A;  3OW2 A;  4JI0 Q;  3H0G G;  3I4O A;  1Q86 C;  2IX0 A;  2N3S A; 
#chains in the Genus database with same CATH topology
 2M9V A;  1PH2 A;  3NTH A;  3CCR A;  1T5X D;  3CCM A;  2AQ3 B;  2OXP A;  4DV4 Q;  1XNR L;  1TWF H;  4ME5 A;  4KD4 A;  4DV6 L;  4BY7 G;  4BXX H;  1IBL Q;  2JE6 I;  1Y8O B;  1CHQ D;  2Q8I B;  3SXH A;  4B3S L;  5JVH 3;  4K2L A;  4QL5 A;  1O78 A;  3LWE A;  5M5Y H;  4A3G G;  1PH5 A;  4FVM A;  2BA0 A;  2Q8R E;  1D1K A;  3CCJ A;  4OEM B;  1QZH A;  4DR2 L;  3AMU A;  3G48 A;  1DGS A;  1FNW A;  1VQL A;  3GTQ B;  1TQO A;  3LWU A;  4JBJ A;  2A68 D;  2QIL A;  2IY5 B;  4EGV A;  3DLL A;  1CKN A;  4IN3 A;  4X66 L;  1X65 A;  4HSV A;  3VYS A;  1A6X A;  1IKL A;  2A6E D;  3CQZ B;  2O2L D;  5IOD A;  1AH9 A;  3HOY B;  1AN8 A;  5M5X H;  4YY3 L;  3KF6 A;  3PUY A;  1H9R A;  2LXJ A;  3J81 j;  1CKO A;  4GLX A;  4JV5 L;  1KRS A;  3CRL C;  4Q0F A;  4K5W A;  1KNE A;  1EY7 A;  2PI2 E;  1H9J A;  2KBN A;  3D8G A;  3S2D B;  1GD7 A;  3TS0 A;  5EBD A;  2Z6B A;  4DAY A;  2WB1 E;  5FJ8 H;  1L1O B;  5C3E B;  1MI2 A;  2BOS A;  2DGY A;  4N8F A;  2CFM A;  4RWS C;  3F2C A;  2CQA A;  1X3F A;  4XIG S;  5JJK A;  1DCZ A;  3HOY G;  4JI4 Q;  5C6A A;  1CI3 M;  1SYD A;  1IYJ B;  1NBW A;  4OXP A;  4H0L C;  4BY1 B;  1MKH A;  2E5L L;  2AKW B;  2QEJ C;  2JA7 B;  1JE5 A;  3PUZ A;  4PZ7 A;  2K4K A;  4E6I A;  2HUG A;  2A68 C;  3ERQ A;  4HED A;  4RFB A;  3PIP 3;  2KEN A;  5FO9 B;  2F0V A;  1YNJ D;  2EY6 A;  5C3E G;  4KY7 A;  2A6E C;  5CV7 A;  2OTJ A;  1F9R A;  4G4K A;  1TWG H;  3VDY A;  3NE5 B;  5C4J B;  3MA2 B;  3ULP A;  3R8B A;  3S1N B;  3DUZ A;  2CH4 W;  5CBE E;  4ABN A;  5M3F H;  1HNX L;  3C46 A;  1FJG Q;  3GTO H;  4DV0 L;  2Z4H A;  1PYW D;  1LT5 D;  2K33 A;  4BY1 G;  4H7B A;  2XIW A;  4PZ8 A;  2JA7 G;  4CHT B;  1CQV A;  2NTS A;  2F3I A;  1MSH A;  3S16 H;  1E2Z A;  2K5N A;  1PTO B;  4MTK A;  2KVM A;  3RD4 A;  3ONA B;  3MFY A;  1LV9 A;  3RLO A;  3J7Z C;  2MUY A;  3WOE A;  4L5Q A;  2Z1C A;  3GTJ H;  3T13 A;  3VR4 A;  2JA5 B;  4RA8 A;  3CCE A;  4WOR A;  1FNV A;  4NPS A;  1GUW A;  3OWF A;  4FF4 A;  4DU9 A;  1I3Q H;  5TSS A;  1NSN S;  4OGQ C;  3H09 A;  2K32 A;  1MJC A;  4ODG A;  1YNJ C;  1SNQ A;  1V1Q A;  4GKJ Q;  2E2D C;  2E2J H;  5IT9 L;  1IL2 A;  2O4X A;  2EDG A;  3NBI A;  1HJP A;  4LF4 L;  3G4S A;  4JYA Q;  1X3P A;  3PO2 G;  2X69 A;  2RHQ B;  3I56 A;  3I70 A;  1EQV A;  2JA5 G;  3PUX A;  3T56 B;  1SJE D;  1NR2 A;  2MPM A;  2JQO A;  4WJ3 M;  1EEI D;  3I91 A;  4Y52 H;  3NSW A;  1JB3 A;  2PMZ E;  5ELC A;  1Y1V H;  2NBF A;  3K8A A;  1EQQ A;  2WB1 B;  1KAB A;  3GDE A;  5CC4 A;  2NVT H;  2AQ1 B;  1X3E A;  3J80 L;  1C48 A;  4PZ6 A;  3ICE A;  1DON A;  1Q90 A;  4AYB E;  1DZ1 A;  4J1M A;  1AZP A;  1WCM B;  2RBM A;  3KFU A;  2F03 A;  5DLQ E;  3I3C A;  1LT3 D;  1WOC A;  1K8M A;  2BCO A;  2DNC A;  4F7X A;  5LL6 S;  3OIP A;  2L55 A;  4JOI A;  3F1Z A;  3RLN A;  2WB1 G;  4LFC L;  1VQP A;  2HCI A;  1JE4 A;  3A5U A;  4DV1 L;  3K0Y A;  2ZJQ A;  4H02 A;  3PO3 B;  2BE5 D;  4O2D A;  4X3U A;  1WCM G;  1S5E D;  1ET9 A;  1EUJ A;  3GTG B;  1B1Z A;  1DOK A;  1C0A A;  2UXD Q;  4K5X A;  2LS0 1;  5FLM G;  3CMA A;  4IUU A;  5C3X A;  3KK7 A;  2OF1 A;  1KDA A;  1IBM Q;  3HGB A;  1B50 A;  1C7Y A;  2ICE C;  5KGU A;  2B2V C;  1WTQ A;  4B3R L;  1PH7 A;  2NVY B;  2R7Z B;  1ILP A;  2WIN B;  1HZA A;  3NQI A;  2NVX B;  1E24 A;  3E0J A;  3PO3 G;  2PI2 A;  2WII B;  3NEN A;  4X65 Q;  3GTK H;  3CC2 A;  1B7Y B;  3TSS A;  1SRO A;  4JBK A;  1PFS A;  1TXY A;  3ZJY C;  2J0T D;  1P8L A;  2GVB A;  3V2T A;  3PIP A;  3Q8D A;  1ROD A;  2BDO A;  1CZG A;  1JQY D;  1EYD A;  4CDD C;  4DV3 L;  4L5R C;  3OMC A;  1Q82 C;  1E1O A;  4A3C G;  2X6G A;  4FF1 A;  3UI2 A;  5CYU A;  4GKK L;  1G6Z A;  2SNM A;  2VB2 X;  4NP5 A;  1K3B C;  1LTT D;  3NWS A;  4ZQ3 A;  2R7Z G;  4DK3 C;  4X64 L;  1CSP A;  2PW5 A;  4BY7 H;  2BE5 C;  1N32 Q;  2PQA B;  3SEB A;  1SND A;  3K7A H;  5FLX c;  3W5O A;  2OQ0 A;  1TWA B;  5M3M B;  1U0L A;  4A3G H;  2ATW A;  2R7D A;  3ZYY X;  1VQI A;  4JI5 Q;  2PMZ B;  2KEE A;  1YEZ A;  3OTO L;  1ZEQ X;  3I7F A;  3F2D A;  4KKS A;  5KEE A;  4JI7 Q;  4CDC C;  2NVQ H;  3CC4 A;  3KJO A;  1VQM A;  3PGZ A;  4DR7 Q;  1V1O A;  1QB5 D;  1RKN A;  3S2H H;  3P75 A;  3IFT A;  4DR6 L;  5JPM C;  2A5H A;  4OEL B;  1QNU A;  4AYB B;  4A3B B;  3I4L A;  2HD3 A;  1Y14 B;  1EZ6 A;  3HOW G;  4RG1 A;  4RCN A;  5CV5 A;  1U4P A;  1I4P A;  5M3M G;  3U4V A;  3S17 H;  1JIC A;  5EKI A;  3STB D;  4JI3 L;  4Q5V A;  3A0J A;  3HOU B;  3CD6 A;  5FLX E;  4K14 A;  4OIJ A;  1IKM A;  1EIG A;  1H9S B;  4NXM Q;  3U4Z A;  3HKZ B;  4ILW A;  5E4X A;  4IPH A;  2IJ0 A;  3OOC A;  4AYB G;  3AU7 A;  2L5T A;  4A3B G;  4DV4 L;  3J81 L;  4G7H C;  3MXN B;  5LMN Q;  1XMO Q;  1G2T A;  3CQZ H;  2IPK D;  1B3Q A;  3JAM c;  1UAP A;  2LMC B;  3HOY H;  4DAV A;  3OW7 A;  2FMC A;  3UDF A;  3HOU G;  4MHE A;  5BN4 A;  3X3M A;  1Z7T A;  4XT1 B;  1HUM A;  2PQA A;  4OO1 G;  4CKE A;  3SK6 A;  5KYL A;  2J7Z A;  3FPU B;  1K8G A;  1ICW A;  5ELB A;  2B2U C;  3M4Q A;  5IGE A;  3S2D H;  1GUO A;  2VQE L;  3KLR A;  2JN4 A;  4DNR B;  5I9P A;  3FEW X;  5J3B A;  5C3E H;  1VQH A;  5GAH C;  4PMC A;  4GLA C;  1MJE A;  3H3V C;  1EOT A;  4UP9 A;  5IWA Q;  3STB C;  2JP1 A;  2I5L X;  1X6O A;  1Z9F A;  1MGS A;  3F2U A;  1NR4 A;  3MTS A;  2NUC A;  3DWQ A;  1UNS A;  4UY8 C;  2UUB Q;  2JEB I;  2CCZ A;  1TWC H;  2RDH A;  3BZC A;  4GN4 B;  4OO1 I;  4BY1 H;  2JA7 H;  4KHP L;  3JAM E;  1V9P A;  2RVL A;  1T5E A;  5C4X B;  2M00 A;  3PV0 A;  1VF5 C;  1FVI A;  2K7V A;  1CSQ A;  1Y8P B;  3OHX C;  4NXN L;  2KCM A;  1STH A;  1A3U A;  2E2I B;  2MO1 A;  2DN8 A;  1VQG A;  1CFM A;  1H9S A;  2XGT A;  3S16 B;  2NTT A;  2JA8 B;  1UUP A;  1VQ6 A;  5C4J H;  3S1R B;  1WTW A;  4OX9 L;  2I07 B;  3S1N H;  3HZX A;  4KJO A;  2RDG A;  2OQK A;  4YWL A;  2MHV A;  3HG9 A;  3MXN A;  4JI4 L;  5ELF A;  3CRK C;  2MP1 A;  4ZRZ A;  5GRO A;  4CKC A;  5C4X G;  2L9H A;  1X54 A;  1R9T H;  4WRD A;  1STN A;  1VF7 A;  1KAW A;  3VYT A;  2B2T A;  3T1Y Q;  1DM0 B;  2BH8 A;  1Q86 C;  2EOT A;  4DAP A;  3D4R A;  4LF9 Q;  3FKI B;  3PO2 H;  2JA8 G;  4DKA C;  2Z0S A;  2JA5 H;  4J6H A;  1MBY A;  3Q0A A;  4X62 Q;  3CP0 A;  4P73 A;  4PMB A;  4K8J A;  3T1H Q;  4DK1 A;  1JB7 A;  5ELO A;  4L5S A;  5IP7 G;  3CKI B;  1O7Y A;  2F4V L;  1SYE A;  4H13 C;  2B8G A;  3T51 B;  1GOZ A;  3C3L A;  4OON A;  2MNA A;  4BWG B;  2L4N A;  4LMQ D;  1BF4 A;  4JBM A;  3TP5 A;  2EY2 A;  4LFA L;  1Y1V B;  1IYU A;  4GOP C;  4ZKC B;  2F0E A;  3Q6S A;  1TS3 A;  4YCV A;  3FKI G;  4IUT A;  4FXK C;  1A0I A;  5IIF A;  3S9W A;  1EFW A;  3BVG A;  4POF A;  3N6R A;  4Y7N B;  2F0F A;  2R6G A;  2RCN A;  4HIK A;  3L9A X;  2D9U A;  4UAI A;  2OWO A;  1SE3 A;  4A75 A;  4DF7 A;  4KMU C;  2CQO A;  3F2B A;  2PNH A;  1EY4 A;  1LAB A;  4TKO B;  1MSG A;  2H1E A;  2R7F A;  1KLU D;  2IWH A;  3DM3 A;  3I55 A;  2TMP A;  4YCU A;  3EN2 A;  2JA9 A;  2LKV A;  1WTO A;  5EKK A;  1N36 Q;  5JOB A;  2ZXO A;  5I4D A;  3I73 A;  2HIV A;  3FMC A;  1LT4 D;  1WCM H;  1TWH B;  4XT3 B;  3GTP B;  2Y0S E;  1PFB A;  3K81 C;  4S3S A;  3E9I A;  4F88 A;  2ENB A;  1Q8I A;  3C1F A;  4FDB A;  5FLM H;  2MGS A;  1VQC A;  4RAU C;  4HCS A;  2VUM B;  5D3I B;  4KV6 A;  1RIP A;  1A2T A;  1SYF A;  4OIK A;  4JBW A;  4RHS A;  3PO3 H;  1X3Q A;  2I46 A;  1G6P A;  4BS9 A;  4AQY Q;  2IL8 A;  1A62 A;  1EYC A;  2NZ1 D;  1TY2 A;  1TII D;  1DOL A;  1GUN A;  3DWP A;  1YBY A;  4GNX C;  2Z6K C;  4ZCK A;  4DR4 Q;  3GTG H;  2A19 A;  3ERO A;  1LYL A;  3GTK B;  1LUZ A;  4A3M G;  2VS1 A;  4H44 C;  4A3C H;  1E22 A;  2HHH Q;  2MQH A;  1OXX K;  1XYI A;  2CW0 D;  1IBK Q;  3DMU A;  3TDQ A;  2AMC B;  5I2X A;  1CZW A;  4DUZ Q;  2VUM G;  4XQJ A;  2ES2 A;  2NVY H;  2R7Z H;  1DJR D;  3QO2 A;  2ZT9 C;  2UXB L;  2NVX H;  3KYH C;  4DR3 L;  4B3M L;  2UXC L;  1K8O A;  1G8Z D;  4Z9C B;  4BBR G;  1D2B A;  2VXW A;  1JJC B;  1EY0 A;  4HJA A;  1WJJ A;  4KY6 A;  1D5Z C;  1I6H B;  1VMP A;  2K5D A;  3FRP B;  2NWG A;  2UXD L;  1CQF A;  4DAY B;  1SNO A;  5IT9 c;  3P1H A;  1PYB A;  5CV6 A;  1EY5 A;  4YHH Q;  3G71 A;  2NVQ B;  4DXG A;  4DV5 Q;  4ZKB B;  1QNK A;  2B29 A;  3M9B A;  1HQR D;  1STE A;  3BYY B;  2F0M A;  2OTL A;  4IUR A;  3HOW H;  3S2H B;  1TWA H;  5M3M H;  4LFB L;  4EQO A;  1OXS C;  2TSS A;  1MD2 D;  4FF3 A;  4LUV A;  3S14 B;  1JOQ A;  2ZXR A;  1O80 A;  4N9T A;  1YHB A;  3E0E A;  3LX0 A;  4LUO A;  2F0S A;  3S17 B;  2EYJ A;  3IL8 A;  4R4O A;  3J7Y W;  4LF6 L;  4ID6 A;  1KHI A;  1Z6H A;  2KCT A;  2CW0 C;  3I2Z A;  4JW0 A;  2V4D A;  3NTI A;  2F0W A;  4JI1 L;  1I4R A;  2Z8L A;  1BCP B;  4X3T A;  3E9H A;  2VQF Q;  2N49 A;  4A3B H;  3SDZ A;  5JJZ A;  4LF5 L;  2Y0S B;  2FFK B;  1PZI D;  1D7Q A;  5IT9 E;  4XYO A;  1PH9 A;  1ZXT A;  1JOK A;  1PZJ D;  2QDL A;  1EQT A;  4J8Q A;  1IYV A;  3QOJ A;  4X3S A;  3HOU H;  3PUW A;  4YIJ A;  2Q2U A;  4OO1 H;  1Q12 A;  4A3J G;  3HKS A;  2JEA I;  5I2Y A;  5EKL A;  4QGU A;  1GVP A;  4K8I A;  2F0K A;  2Z6K A;  4WJW A;  2FXQ A;  2I5H A;  2M2L A;  2PNR C;  1ENA A;  1B53 A;  2QEX A;  1PYS B;  2Y0S G;  2VY3 A;  5EPJ A;  2OCE A;  3NPP A;  1E1T A;  4K6L A;  4DR5 Q;  1JWM D;  4A3F B;  3U9O A;  1PV4 A;  2B2W A;  4A3I G;  3HOV B;  2FJ2 A;  4JI6 Q;  2VB3 X;  1OXU A;  1TWC B;  1IXR A;  2K5W A;  3VR5 A;  1J5E Q;  2YTY A;  1FR3 A;  3IFD A;  5BR8 L;  3K5L A;  5JJL A;  1DXM A;  4B9X A;  4A3K B;  1HA5 A;  3QJY A;  4HMI A;  1J6Q A;  4A3F G;  5IYC G;  4EQP A;  1HR0 L;  5LMN L;  3HOV G;  1XMO L;  1KRT A;  3RR5 A;  2PYK A;  4KD3 A;  4U67 3;  4IOC A;  3IKJ A;  4KJN A;  4DUY L;  1LLR D;  2LFN A;  2B63 B;  5C4X H;  1XPO A;  1K0S A;  1B9M A;  1O7Z A;  4FP5 D;  2UU9 Q;  1W6K A;  2E2I H;  2AUJ D;  3NTK A;  4MIU A;  3TRE A;  1V1P A;  1I6V C;  1R9T B;  1Q3L A;  4A3K G;  2JA8 H;  1GUT A;  2L0C A;  3GP7 A;  5IP9 G;  3S1R H;  3AQQ A;  3KJP A;  1V43 A;  1F9S A;  1JJ2 A;  3PO2 B;  5IWA L;  1EWC A;  2K05 A;  3G6E A;  4FXG C;  2ZJR A;  1HNZ Q;  1BQQ T;  5KIX A;  5CV4 A;  5IP7 H;  2B63 G;  1S5C D;  3WOF A;  1HFG A;  2CWP A;  3VR6 A;  4I7A A;  2UUA L;  3KBG A;  4RKB A;  1AE3 A;  2HCC A;  1N34 L;  2PPB C;  2O5J C;  1YJW A;  1B4O A;  3CU7 A;  2EXD A;  3K6O A;  3FKI H;  5IGB A;  1VQ8 A;  4C1N K;  3CCL A;  1PH4 A;  1EU4 A;  1PFN A;  3EIV A;  2XSC A;  3CPW A;  1ESR A;  1KLG D;  3VR3 A;  5LMU Q;  1NUC A;  2FHT A;  4GN3 B;  3EFX D;  2L15 A;  1L2F A;  4HAE A;  3SK5 A;  2FMM A;  3GD7 A;  1Y8N B;  1ENC A;  5C5M A;  4KKT A;  3J80 i;  3CXC A;  2C5C A;  3MFG A;  2BDN A;  5G3L D;  1N33 L;  4K0K L;  3KLW A;  4P75 A;  1E2V A;  3SK8 A;  4A93 G;  3GO5 A;  3W1G A;  4WJ4 A;  4G7O C;  3TP7 A;  5KNB A;  4IJH A;  4Y7N H;  4R8I A;  4IZ8 A;  3HP3 A;  2NZH A;  1EIF A;  4RCO A;  2QF7 A;  2B2Y C;  1GHK A;  2PZT A;  3OPO A;  2F0P A;  4NB3 A;  4X62 L;  4IQZ A;  1VQ9 A;  1JWU D;  4L5T A;  4XDX A;  3KF8 B;  1SXT A;  5E4W C;  4JI2 Q;  1D6E C;  2HQE A;  3NK9 A;  1T9H A;  5AJ3 Q;  3QOL A;  4FXD A;  4R4Q A;  5G3L F;  1TWH H;  4R1J A;  2Z4I A;  3GTP H;  4C3J B;  1BBW A;  1JCK B;  1I50 H;  5GQO A;  2KHI A;  3A54 A;  4A3M H;  1ILQ A;  2O5I C;  1U4M A;  4LF8 Q;  1VQA A;  3BS1 A;  4DR1 L;  2ZM6 Q;  3TBI B;  1SFO B;  5CV9 A;  4RGM A;  3QR8 A;  2VUM H;  1JT8 A;  1HTP A;  4UDU C;  4XTC S;  1QVC A;  3I72 A;  3RN2 A;  1XXG A;  2A6H D;  5LHY 1;  2XWB B;  3J7A V;  4HMJ A;  1ZKO A;  1I4Q A;  4A76 A;  1Q8K A;  5CV8 A;  1XNQ L;  1NCV A;  4BBR H;  3CF5 A;  1HR0 W;  4C3J G;  4KN7 C;  1STG A;  2EXZ A;  4C56 C;  1BNZ A;  3VR2 A;  2KQ3 A;  2YV5 A;  3MHB A;  1QVF A;  2F0L A;  3N52 A;  4C2M B;  3ITP A;  1FGU A;  1KXL A;  1UE6 A;  1MIU A;  3G6J B;  4BA2 I;  3H94 A;  1YHA A;  3B6Y A;  1WTR A;  2LXK A;  1XNR Q;  5C4H A;  4UP8 A;  1XMQ Q;  4QIW E;  3CCQ A;  1SYB A;  2EY1 A;  3D6W A;  1EU3 A;  2KEC A;  3OYY A;  4O42 A;  5A2Q E;  4DV6 Q;  2R93 B;  4TQU S;  2N8N A;  4A3E G;  1PRT C;  3IAY A;  2F4I A;  1YZ6 A;  1HZ9 A;  4B3S Q;  3BVM A;  4L63 B;  1I4H A;  4GZY C;  3HOW B;  5DM6 3;  3KF8 A;  2DUD A;  1LTR D;  3OWE B;  1E2W A;  1I6H H;  4IUQ A;  5IYB G;  1CT1 D;  2F3V A;  3OW2 A;  1BOS A;  4CDE C;  2IX0 A;  3TZU A;  1VQN A;  2QW7 A;  2A6H C;  2AHO B;  1IBK L;  4HID A;  4X66 Q;  3E6Z X;  2N88 A;  1SR3 A;  4HSP A;  4EQ5 A;  4DUZ L;  2R93 G;  1ONL A;  4QF4 A;  1K83 B;  5ISR A;  4WFN 3;  3HOZ B;  1D5M C;  1Z47 A;  1NTG A;  4P74 A;  2JSO A;  5I6W A;  2F0T A;  1I94 L;  4BA1 I;  5M9O A;  1HNW Q;  3S14 H;  2F0H A;  4YY3 Q;  3M3Y B;  1F2L A;  3MZ5 A;  4OWX B;  1PH3 A;  4A3J H;  1CA6 A;  4RMF A;  2K03 A;  3J81 i;  1JC7 A;  2K1B A;  4JV5 Q;  4DV2 L;  3NP8 A;  1ZYR D;  1QCB D;  3LGJ A;  3S1M B;  3D31 A;  4U68 A;  1NMG A;  1YIT A;  1A2U A;  1K9M C;  3I4M G;  1W6J A;  1OXV A;  2XRQ D;  3HOZ G;  4YHH L;  4DV5 L;  1OO9 B;  4A3I H;  1HHV A;  2I0Q A;  2RCF A;  1PMR A;  4L8J A;  4XYQ A;  4EVO A;  1X3G A;  1STA A;  1IBL L;  4GLV B;  2B2V A;  2AQ2 B;  1JOO A;  2R92 B;  4HJ7 A;  2E5L Q;  1KQS A;  4MN3 A;  4O1N A;  3TP6 A;  1RTN A;  1HUN A;  1H9M A;  3O13 A;  4PV1 C;  3VYU A;  1PVO A;  1N9W A;  2WV6 D;  3EVQ A;  4A3F H;  5IYC H;  3A8I E;  5EBC A;  1KC8 C;  3PUV A;  3HOV H;  3PIO 3;  1HNX Q;  1BXT A;  2ID0 A;  2CHB D;  2K04 A;  2L1B A;  1BUV T;  2R92 G;  3K59 A;  4AIM A;  1ZYR C;  3P20 A;  2JA6 B;  4M1U B;  2WFW A;  2WKC A;  4QB4 A;  2OEO A;  1QUQ A;  1A63 A;  1SN8 A;  4HCE A;  2J4X A;  3R2T A;  2XWJ B;  5JPN C;  4A3K H;  4UHV A;  1VQ7 A;  2R61 A;  5IP9 H;  1F2M A;  3QG1 A;  5T1G A;  3C1E A;  2HT1 A;  1PFM A;  4PMW A;  1FNU A;  1WTX A;  1SEB D;  3U50 C;  1C9O A;  4MZ9 A;  3PSI A;  4X6A H;  2B63 H;  1HPC A;  1NNX A;  5D3D A;  4DA2 A;  1NMF A;  2L11 A;  3MC0 B;  3UDX A;  2JA6 G;  4CBV A;  3JC6 6;  3RNU A;  5KRU A;  1TS4 A;  1VCI A;  1K8A C;  4V0B A;  1U4R A;  2WAQ E;  3OIQ A;  4CJ0 B;  1VS0 A;  1XJV A;  4LF4 Q;  4FO2 A;  2SEB D;  1J5E L;  1S4Z A;  5FO8 B;  4TSS A;  3S24 A;  1DYQ A;  2IHF A;  2ZJP A;  3URY A;  1F9P A;  1SYG A;  5K5P A;  4A3D B;  4HJ9 A;  2K5Q A;  1S5B D;  2YU9 B;  1D8L A;  2NN6 G;  3P7J A;  1X9N A;  2ICI A;  1U9R A;  4O0A A;  1CK1 A;  1S72 A;  1QWY A;  2YTX A;  3NEM A;  1FJG L;  4JPB W;  4A3L G;  2C9O A;  2UU9 L;  4BBS B;  1WTV A;  3J7A F;  1HXY D;  3HEJ A;  5FOB B;  3H3V I;  1LTG D;  3W1B A;  4IUP A;  4A3D G;  2B2U A;  2NN6 I;  1AE2 A;  5IOC A;  2EJM A;  1ICF B;  1V8Q A;  3CCV A;  1A15 A;  4DV1 Q;  4BBS G;  1SNC A;  4HR7 B;  2JK8 A;  4LWC A;  2Q2I A;  2IW3 A;  3RZD B;  3U9S A;  4DGZ A;  1I4G A;  5JEA G;  2KHJ A;  4DAM A;  4GOP B;  1Q1E A;  3K5M A;  4GKJ L;  2RSO A;  1DOM A;  1J9O A;  1D1I A;  1ASZ A;  4JYA L;  3I8Z A;  5IGD A;  5LMU L;  1I50 B;  4C3H B;  1GJX A;  3VYR A;  3GTL B;  4A3M B;  4JI8 Q;  4EQN A;  1WI5 A;  3DXJ C;  3NXW A;  1SAP A;  4KKU A;  2F0N A;  2KJX A;  1EYG A;  5HGQ A;  3KDF B;  4C3J H;  3MWY W;  2IX3 A;  3CCU A;  1D5X C;  4HIO A;  2ZTC A;  5BN3 A;  3BYT B;  1PH8 A;  3GV3 A;  1YI2 A;  3V96 A;  1QE6 A;  3RLF A;  4BBR B;  4IFD G;  1KAA A;  3W2D A;  1B70 B;  3LNN A;  1ET6 A;  3H6M A;  4HJ5 A;  4UPA A;  4DV3 Q;  4C3I B;  2DJF C;  4C3H G;  4HTH A;  1SFO H;  1KD1 C;  4GKK Q;  4LNQ A;  3JAM L;  4ALP A;  2D0P A;  3EA6 A;  4QY7 A;  2KCN A;  2C35 B;  4A3E H;  2E75 C;  2EJG C;  5JVG 3;  3Q23 A;  3FPP A;  4B3T Q;  4JVZ A;  2A69 D;  1LM0 A;  3HOX G;  2SDF A;  4XXE A;  5AJ3 L;  4IFD I;  5IGC A;  2E74 C;  1S5D D;  1ASY A;  1SJH D;  1JJG A;  4C2M H;  3GTM B;  1GKH A;  4GNX B;  4P71 A;  3ND8 A;  5IYB H;  1AEX A;  4C3I G;  2HQL A;  1YNN D;  2PQE A;  5H1S E;  1HA6 A;  1WVL A;  2N78 A;  2F0D A;  3NWT A;  1AFP A;  2EYL A;  1R4P B;  2WAQ G;  4FNF A;  3X3N A;  4V19 0;  4GOP A;  4DR6 Q;  2RDF A;  1GM5 A;  1I4X A;  2R93 H;  5GAD C;  4OWW B;  4F8M A;  4HJ8 A;  1IBM L;  5HY6 A;  5A35 A;  4JI3 Q;  2K6A A;  5M5W B;  2AUK A;  2NYZ D;  1O7L A;  4OHJ A;  1E0B A;  2GA4 B;  2Q2T A;  2N55 A;  2QGQ A;  4X65 L;  3KDF A;  1F9Q A;  1FYC A;  2KOL A;  1SNP A;  1VQF A;  5GAE C;  4IAL A;  2E2H B;  4J15 A;  4A3J B;  3CW2 C;  2D62 A;  3HRZ C;  3A5Z B;  1PLF A;  3M85 A;  3BDL A;  1K83 H;  3J80 c;  3I4M H;  4LJZ C;  3TQY A;  1VQE A;  2A69 C;  2CH4 A;  1EFI D;  4F87 A;  1XMQ L;  3HOZ H;  2VL6 A;  4IJL A;  1RD9 D;  4DV7 Q;  3SR1 A;  2KED A;  2PZU A;  1YIJ A;  3M3Y H;  5C4Z A;  2PO4 A;  1N32 L;  5DAU A;  4A3I B;  1YNN C;  1A3T A;  3Q24 A;  5C0X G;  5IGG A;  2EE1 A;  1SMY D;  1V1P B;  3D0F A;  1GXD C;  4JI5 L;  2MJ8 A;  3AFP A;  2VQE Q;  3S1M H;  1Y69 U;  1YJ9 A;  2K14 A;  4GNX A;  1G91 A;  4JI7 L;  2F3W A;  4DXF A;  4P72 A;  1L1O C;  2RQX A;  4DR7 L;  1PTO D;  4XQN A;  4JG2 A;  1AW7 A;  3UE0 A;  5CMD A;  4LF7 Q;  1VQB A;  3J80 E;  4LK1 C;  1KDB A;  2EJF C;  4R4T A;  1HNW L;  1MHW C;  3FHW A;  5C0X I;  1RJT A;  3H91 A;  2R92 H;  4KHP Q;  3E5S A;  4QCL A;  2XNA C;  2F0Q A;  3OMG A;  2KHS A;  3UDI A;  4JCV E;  4HIM A;  4DK6 C;  4NXN Q;  4I65 A;  4OWT B;  3IRB A;  5CBA E;  3PF5 A;  3BU2 A;  2ASB A;  3M7N A;  5IE8 A;  4ME3 A;  4NXM L;  5GAG C;  5J39 A;  3AEV A;  4DNI A;  5L37 A;  4OX9 Q;  1EL0 A;  3WWV A;  3L3O C;  1KL9 A;  1I5F A;  4DN4 M;  3R3O A;  2G9D A;  2ZTD A;  2HIX A;  3A8J E;  1SMY C;  2ALY B;  1PTO F;  3GQB A;  2CWA A;  1JMC A;  3MEF A;  1SLJ A;  2JA6 H;  1XWE A;  1TY0 A;  4ZAI A;  3Q22 A;  2KUM A;  2LY7 A;  2B3G A;  3MXG A;  3NHH A;  1TU2 B;  4LW1 A;  1UE7 A;  1L0X B;  1X55 A;  2H5X A;  5EPL A;  2QDB A;  2I5M X;  2NB0 A;  5KNC A;  1PTO C;  3BZD B;  4DFA A;  3L2P A;  2F0J A;  3E3X A;  3H0G B;  3HFZ B;  5KND A;  4K2K A;  1HFN A;  3H3V H;  4JOI C;  1NAP A;  4DNT B;  4ZUI A;  3D4W A;  1K28 A;  2CKZ B;  3MXU A;  2NN6 H;  2FIN B;  2QKI C;  1J8I A;  1VQD A;  3K57 A;  4IUN A;  2F4V Q;  1CHP D;  1EIH A;  2EY5 A;  1TKW B;  4N9P A;  1GUS A;  1TS2 A;  2UUB L;  4LFA Q;  4A3L H;  4IPC A;  5J22 A;  1PXU A;  3PQI A;  3DWA A;  3RZO B;  1X56 A;  1HCZ A;  2LSS A;  2XN9 C;  4P2C B;  1Y1W B;  4A93 B;  1F2Z A;  2D2C C;  4JI0 Q;  3H0G G;  3I90 A;  3I4O A;  3MXP A;  4A3D H;  2H4O A;  1HRJ A;  5K36 G;  1YVC A;  1AZQ A;  1WD1 A;  2YU9 H;  4POG A;  2E8G A;  1OTC A;  1ML0 D;  2MFI A;  2K75 A;  2SNS A;  2A8V A;  1L1O A;  3KUP A;  1R4Q B;  3MEH A;  2JJQ A;  1UE1 A;  3VA5 A;  5CR3 A;  2PZW A;  1C8C A;  3EQL C;  4BBS H;  2DY7 A;  1PZK D;  2E76 C;  3RUZ A;  3J81 c;  2EYP A;  3K80 C;  4RGN A;  4NW2 A;  1Y1W G;  3BZK A;  2SOB A;  5JEA H;  2X6L A;  3I4N B;  3T1Y L;  1H95 A;  1VQ4 A;  1A8V A;  4AH6 A;  3S1Q B;  3KBX A;  1B8A A;  4LF9 L;  1XPU A;  1G2S A;  2K5V A;  1XTC D;  2CVR A;  1LO5 D;  1EY6 A;  2K50 A;  5EAY A;  1Q46 A;  3A55 A;  4JK1 C;  1SSO A;  5D65 A;  1KNA A;  3TRZ A;  1KTK A;  2RHS B;  1EY9 A;  1FD7 D;  2EYO A;  3TME A;  4ZLT F;  3T1H L;  5JEA J;  3RZD H;  5EGT A;  2EVB A;  1CKM A;  1Q7Y C;  1N8R C;  2ZTE A;  1LTI D;  3I4N G;  3S15 H;  1PRT D;  3CC7 A;  4IFD H;  3J81 E;  1LTL A;  4IPD A;  1HZC A;  3PMF A;  2F0O A;  1BBX C;  2EZV A;  1QIL A;  4C3H H;  1TT2 A;  2F1M A;  1KDC A;  3GTL H;  5JJI A;  3TS2 A;  4KY5 A;  3M4Y A;  2UUC Q;  1RTO A;  4ULL A;  2K5H A;  2DNE A;  4KTA A;  2UXB Q;  4DR3 Q;  4B3M Q;  2UXC Q;  2G9H D;  1EYA A;  1P16 A;  3J7A 5;  1ESF A;  2AWN A;  3HOX H;  4IFD J;  3HKZ E;  3V05 A;  5C44 B;  4R9W A;  4B08 A;  2HDL A;  4A3E B;  1K3R A;  1WFQ A;  3L7Z C;  1QVG A;  2YYZ A;  4ZK9 B;  1N36 L;  1S5F D;  5LMN W;  1BKB A;  3K5O A;  1TS5 A;  4C3I H;  1S3O A;  1SRU A;  3QWN A;  5HGT A;  1PRT F;  4DPG A;  2GVA A;  3ER0 A;  1XPR A;  1E7Z A;  2EPB A;  4OL7 A;  4JI8 L;  4CGY B;  2PCF B;  2F0U A;  4LFB Q;  4MTN A;  5C44 G;  2JYO A;  5IYD G;  3CPF A;  3R2I A;  2Z9H A;  1BVS A;  1UEA B;  1RF2 D;  4GS3 A;  3GTM H;  3DM1 A;  4AQY L;  4LF6 Q;  5COR A;  4A4I A;  3K0X A;  1VMC A;  4CJ1 B;  4DR2 Q;  3BVZ A;  5NUC A;  4JI1 Q;  1RL2 A;  1WTH A;  3KLS X;  4DR4 L;  3M4O B;  1IL8 A;  3SVM A;  2IT1 A;  5AFW A;  1W2B A;  2L12 A;  1PDQ A;  1SYC A;  3M7G A;  4DK0 A;  1VQO A;  2RSN A;  3SHL A;  4LF5 Q;  2HHH L;  3NQT A;  3NBH B;  5FO7 B;  1NJI C;  5EQ0 A;  1QJO A;  1CUK A;  1L0Y B;  1HQM C;  2B2Y A;  4R4C A;  3I4M B;  5M5W H;  1PRT B;  4B3T L;  1TWF B;  1VDZ A;  4CDF C;  5I6Y A;  3ND9 A;  2NZO A;  2V1C C;  1GHJ A;  4NDX A;  1U5K A;  5C0X H;  1VQK A;  1QUQ B;  1RCV D;  2E2H H;  5M5Y B;  3C2P A;  1G51 A;  5E7N A;  1F77 A;  3A8K E;  3RN5 A;  4PG3 A;  1B44 D;  1M8A A;  5IY0 A;  2RF4 A;  4R4I A;  4XQQ A;  1RHP A;  3AB9 A;  1L0W A;  5J1Z A;  4TVA B;  4G57 A;  5FK9 C;  1TR5 A;  1U4L A;  4QJF A;  1PHJ A;  5C0X J;  1JWS D;  2A1A A;  1G29 1;  3H15 A;  1STB A;  5ELN A;  3UDG A;  1DD2 A;  1EOV A;  4BXX G;  5HUR A;  1IZ6 A;  2B2T C;  1YNX A;  4APV A;  2DJG C;  4FF2 A;  2EYF A;  4KLK A;  5M5X B;  1M1K C;  3GTQ H;  2WAC A;  5ELE A;  1E3P A;  4RGT A;  1S40 A;  5BR8 Q;  1O7I A;  1SMX A;  3AYH B;  5CGK A;  1STY A;  3CCS A;  1H9K A;  3ERS X;  1HR0 Q;  4CJ2 C;  4KN4 C;  2VQF L;  3FDT A;  4TRD A;  3D6C A;  4DV7 L;  5DM7 3;  1M4V A;  4DUY Q;  4KHV A;  1PA6 A;  3NBH A;  1BO0 A;  3L0O A;  2XRS D;  3TN2 A;  1YJN A;  1EEF D;  4DV0 Q;  1LTS D;  4B9W A;  4CKB A;  5FKA C;  3G7L A;  4QIW B;  1EWI A;  1M90 C;  4YWK A;  3HKZ G;  3K58 A;  5E3F A;  2YTV A;  3K5N A;  5C5L A;  3CME A;  3SGI A;  1SBB B;  1EIY B;  4KHZ A;  4X3K A;  3FVQ A;  1FL0 A;  1K73 C;  4QUF A;  5LL6 X;  5FJ8 G;  4MNO A;  3F8T A;  2JXM B;  4LF7 L;  4LUZ A;  1C4Q A;  4DR5 L;  3DHQ A;  2EYM A;  1TWG B;  2UUA Q;  1ENF A;  3T53 B;  4I7Z C;  1N34 Q;  5KYI A;  4IPG A;  3GTO B;  5M3F B;  2G5D A;  3TEH B;  5ELD A;  4JI6 L;  2VNU D;  1VQ5 A;  5A2Q L;  3D3R A;  3MVV A;  3GV6 A;  4IO9 A;  4JC0 A;  3H0G H;  5DEH A;  3QB3 A;  4RGO S;  3K7U C;  1LTB D;  1CM9 A;  1HZB A;  5K36 H;  2QCP X;  5DNF A;  3FP9 A;  2DY8 A;  1B2T A;  1OXT A;  2MO0 A;  2IX1 A;  4ZUJ A;  1CA5 A;  4YWM A;  2HDM A;  4C1N I;  2A73 B;  2EQS A;  5IGF A;  2B39 A;  4K5V A;  1WTP A;  1N33 Q;  4K0K Q;  3DEO A;  3GTJ B;  3W3A A;  4ZYS A;  1TVX A;  5M3F G;  3NUC A;  1XTD A;  2BH2 A;  4YCW A;  3RZO H;  4FYD A;  1II3 A;  4G7Z C;  2GN5 A;  1Y1W H;  4A93 H;  1PTO H;  1I3Q B;  3ULJ A;  2P5Z X;  2RKS A;  4K6D A;  1NY4 A;  4IUV A;  2K52 A;  4RKL A;  1EY8 A;  1LTA D;  3R93 A;  4NKL A;  1Q81 C;  2E2J B;  1IHZ A;  1UE5 A;  5C3W A;  1UEB A;  1A3V A;  4N8X 1;  3MAQ A;  5FLX L;  5I9O A;  3PF4 A;  2WKD A;  4M8A A;  1HNZ L;  4RH6 A;  4LFC Q;  1SNM A;  3CAM A;  1WYD A;  4NMZ A;  4IOA A;  1W3S A;  1QZG A;  1UWV A;  5T1I A;  1JOR A;  4HN7 A;  2XVS A;  5BN5 A;  3HS0 C;  3I4N H;  3QIA A;  2KA7 A;  3EJI A;  1PH6 A;  4QUC A;  5EJW A;  3S1Q H;  1IW7 D;  2NVT B;  4JI0 L;  4GN5 A;  2ZXP A;  3S15 B;  1QG7 A;  4DR1 Q;  4KI0 A;  1EZ8 A;  2K01 A;  2B8F A;  2XTI A;  1B9N A;  5E1F A;  4RHR A;  3UE1 A;  1QOH A;  2WP8 J;  4UP7 A;  3SE0 A;  1FGB D;  4B3R Q;  1XNQ Q;  1BDO A;  3T16 A;  3VA7 A;  5JAV A;  1Y1V G;  3BJU A;  1GUG A;  3OSO A;  1WD0 A;  1NE3 A;  4R8N A;  3JAM i;  2QA4 A;  3TZD A;  1GO3 E;  3RMH A;  4PQX A;  3HOX B;  1Q1B A;  1EWH A;  3CHB D;  2K28 A;  4PNY A;  1VQJ A;  2BA1 A;  2RA4 A;  2IHE A;  2VW9 A;  1CTM A;  5D14 A;  1YHQ A;  3WDN A;  3A56 A;  2WAQ B;  1BCP D;  5F2D A;  4EX5 A;  1F2Y A;  4X64 Q;  3PIO A;  1BR9 A;  1SE8 A;  5C44 H;  2PW7 A;  3NEL A;  5IYD H;  1SE2 A;  1IW7 C;  4KK7 A;  5EPK A;  4JI2 L;  1SDF A;  3U58 A;  1KIX A;  1HTL D;  3TP8 A;  5COY A;  3PCO B;  2F0I A;  1HH2 P;  3OTO Q;  3A7A B;  3DEP A;  2F52 A;  3A74 A;  2KCC A;  4QMG A;  1RDP D;  3ULL A;  1CKN B;  2OT2 A;  2Q8T A;  1LAC A;  2B2W C;  2UUC L;  3KOJ A;  2EIF A;  3AFQ A;  1B3A A;  1K0R A;  4LF8 L;  1BBU A;  1LT6 D;  1X32 A;  4LAA A;  2ZM6 L;  1XX8 A;  2AWO A;  3BG3 A;  4L6T B;  1I94 Q;  1SE4 A;  2Q2H A;  3SK4 A;  3BDO A;  2D0O A;  3KF6 B;  3M4P A;  3KLS A;  1BCP F;  2D5D A;  2EYH A;  3BDC A;  4BY7 B;  3A7L A;  3EBE A;  3K7A B;  1PH1 A;  1JR0 D;  2F0G A;  1EQR A;  4DV2 Q;  4A3G B;  4QQB X;  3M4O H;  3D4D A;  2R3Z A;  2VZA A;  1AP0 A;  3T4A C;  1BCP C;  2A74 C;  2N3S A; 
#chains in the Genus database with same CATH homology
 1PH2 A;  3PO2 H;  1VQN A;  4A3D H;  2JA8 G;  5K36 G;  1YVC A;  4DKA C;  3CCR A;  3CCM A;  2YU9 H;  2AHO B;  1IBK L;  2E8G A;  2Z0S A;  4HID A;  4X66 Q;  1OTC A;  2JA5 H;  4EQ5 A;  1SR3 A;  4DUZ L;  2R93 G;  2MFI A;  2K75 A;  4DV4 Q;  2A8V A;  1XNR L;  4X62 Q;  3CP0 A;  1L1O A;  4P73 A;  1TWF H;  3T1H Q;  1JB7 A;  1Z47 A;  1NTG A;  2JJQ A;  4P74 A;  4DV6 L;  5ELO A;  4L5S A;  5IP7 G;  1UE1 A;  1I94 L;  4BA1 I;  1IBL Q;  4BY7 G;  4BXX H;  3S14 H;  2F4V L;  2JE6 I;  1HNW Q;  4BBS H;  4YY3 Q;  4B3S L;  4OON A;  2MNA A;  3J81 c;  4QL5 A;  4OWX B;  5M5Y H;  4A3G G;  1PH3 A;  3K80 C;  1PH5 A;  4A3J H;  4JBM A;  2BA0 A;  3CCJ A;  4RMF A;  1Y1W G;  4LFA L;  3BZK A;  1QZH A;  3J81 i;  4DR2 L;  4JV5 Q;  4GOP C;  4DV2 L;  3G48 A;  4YCV A;  3FKI G;  3T1Y L;  1DGS A;  1H95 A;  1VQ4 A;  1A8V A;  4AH6 A;  1VQL A;  3LGJ A;  1A0I A;  1EFW A;  1B8A A;  3D31 A;  4LF9 L;  1XPU A;  4OO1 I;  2K5V A;  1NMG A;  4POF A;  4JBJ A;  1YIT A;  2R6G A;  2RCN A;  4HIK A;  1K9M C;  2K50 A;  3I4M G;  5EAY A;  1Q46 A;  3DLL A;  1CKN A;  1OXV A;  2OWO A;  3HOZ G;  4YHH L;  4X66 L;  4A75 A;  1X65 A;  4DV5 L;  2CQO A;  2RHS B;  2PNH A;  3F2B A;  4A3I H;  3TRZ A;  2I0Q A;  2R7F A;  3DM3 A;  3I55 A;  3T1H L;  5JEA J;  4YCU A;  1X3G A;  3EN2 A;  2JA9 A;  3RZD H;  1AH9 A;  1IBL L;  4GLV B;  1CKM A;  1Q7Y C;  1N36 Q;  5M5X H;  1N8R C;  4YY3 L;  2ZTE A;  3KF6 A;  4HJ7 A;  2E5L Q;  1KQS A;  3PUY A;  3I4N G;  2HIV A;  3S15 H;  3CC7 A;  1WCM H;  2LXJ A;  3J81 j;  1LTL A;  4IPD A;  1HZC A;  1CKO A;  2Y0S E;  4GLX A;  4JV5 L;  1KRS A;  3K81 C;  3E9I A;  4C3H H;  2PI2 E;  2KBN A;  1GD7 A;  3TS0 A;  4FDB A;  5FLM H;  3GTL H;  5JJI A;  3TS2 A;  1PVO A;  2UUC Q;  1N9W A;  1VQC A;  4A3F H;  2WB1 E;  5FJ8 H;  1L1O B;  5IYC H;  1KC8 C;  3PUV A;  3HOV H;  2K5H A;  2DGY A;  2UXB Q;  2CFM A;  1HNX Q;  3F2C A;  4DR3 Q;  4B3M Q;  2UXC Q;  1X3F A;  4XIG S;  2ID0 A;  5JJK A;  1RIP A;  3HOY G;  1P16 A;  4JI4 Q;  3J7A 5;  2AWN A;  3HOX H;  4IFD J;  4JBW A;  3HKZ E;  2R92 G;  3PO3 H;  1G6P A;  4AIM A;  4AQY Q;  1IYJ B;  1A62 A;  1K3R A;  1NBW A;  1WFQ A;  3L7Z C;  1QVG A;  2YYZ A;  4OXP A;  2WFW A;  1N36 L;  1YBY A;  5LMN W;  1MKH A;  4GNX C;  2E5L L;  2AKW B;  2Z6K C;  1BKB A;  1JE5 A;  3PUZ A;  1QUQ A;  1A63 A;  1SN8 A;  4PZ7 A;  2K4K A;  4C3I H;  4DR4 Q;  3GTG H;  1S3O A;  1SRU A;  2A19 A;  1LYL A;  2KEN A;  1LUZ A;  4A3K H;  4A3M G;  1VQ7 A;  2VS1 A;  4A3C H;  5IP9 H;  1E22 A;  5C3E G;  4DPG A;  2MQH A;  1OXX K;  2HHH Q;  1IBK Q;  2OTJ A;  2GVA A;  2AMC B;  3ER0 A;  4DUZ Q;  1XPR A;  1E7Z A;  2HT1 A;  2VUM G;  4PMW A;  1TWG H;  4JI8 L;  3U50 C;  2NVY H;  3VDY A;  2ES2 A;  2R7Z H;  1C9O A;  4MZ9 A;  3PSI A;  3ULP A;  4LFB Q;  4MTN A;  4X6A H;  2UXB L;  2B63 H;  2NVX H;  3KYH C;  5C44 G;  1HNX L;  4DR3 L;  1NMF A;  5IYD G;  5M3F H;  3CPF A;  4B3M L;  1FJG Q;  3GTO H;  4DV0 L;  2UXC L;  2JA6 G;  3UDX A;  1BVS A;  4BBR G;  4GS3 A;  4BY1 G;  4PZ8 A;  3JC6 6;  2JA7 G;  3GTM H;  3RNU A;  1JJC B;  1K8A C;  1VCI A;  4AQY L;  4LF6 Q;  4A4I A;  4HJA A;  2WAQ E;  1WJJ A;  3K0X A;  1VS0 A;  2F3I A;  1XJV A;  4DR2 Q;  4LF4 Q;  3S16 H;  1J5E L;  4JI1 Q;  1RL2 A;  2K5N A;  4DR4 L;  3S24 A;  2IHF A;  2ZJP A;  2UXD L;  2IT1 A;  1W2B A;  4DAY B;  5IT9 c;  1VQO A;  3RLO A;  4LF5 Q;  1PYB A;  3J7Z C;  4HJ9 A;  4L5Q A;  2HHH L;  3GTJ H;  3NBH B;  1D8L A;  4YHH Q;  3G71 A;  2NN6 G;  1NJI C;  4DV5 Q;  3CCE A;  2B29 A;  3M9B A;  2OTL A;  1CUK A;  3HOW H;  1X9N A;  4NPS A;  4R4C A;  4O0A A;  5M5W H;  4B3T L;  1TWA H;  5M3M H;  1S72 A;  2YTX A;  4LFB L;  1OXS C;  3NEM A;  2NZO A;  2V1C C;  1FJG L;  1I3Q H;  4LUV A;  1U5K A;  4A3L G;  1VQK A;  2UU9 L;  1YHB A;  1MJC A;  3E0E A;  4LUO A;  1QUQ B;  2E2H H;  4R4O A;  4LF6 L;  4GKJ Q;  1V1Q A;  1KHI A;  1G51 A;  2E2J H;  2KCT A;  3I2Z A;  5E7N A;  3RN5 A;  1IL2 A;  4PG3 A;  1HJP A;  4LF4 L;  3G4S A;  4JYA Q;  5IY0 A;  3H3V I;  2RF4 A;  4JI1 L;  4R4I A;  3E9H A;  3W1B A;  3PO2 G;  4A3D G;  1L0W A;  2NN6 I;  2RHQ B;  1AE2 A;  2N49 A;  4TVA B;  3I56 A;  2VQF Q;  4A3B H;  2JA5 G;  4LF5 L;  3PUX A;  4POG A;  4QJF A;  1D7Q A;  2JQO A;  4WJ3 M;  4Y52 H;  1PHJ A;  1PH9 A;  5C0X J;  2PMZ E;  3CCV A;  2A1A A;  1G29 1;  3H15 A;  5ELN A;  3UDG A;  1EOV A;  4BXX G;  4DV1 Q;  1Y1V H;  3HOU H;  1IZ6 A;  3PUW A;  1YNX A;  3K8A A;  1EQQ A;  4APV A;  4BBS G;  3GDE A;  2JK8 A;  4LWC A;  2Q2U A;  2Q2I A;  2NVT H;  1Q12 A;  4A3J G;  3HKS A;  2JEA I;  1X3E A;  4KLK A;  1M1K C;  3GTQ H;  5JEA G;  2KHJ A;  4PZ6 A;  1GVP A;  4DAM A;  4QGU A;  3ICE A;  4GOP B;  1Q1E A;  1E3P A;  2Z6K A;  4AYB E;  1S40 A;  2FXQ A;  4GKJ L;  5BR8 Q;  1O7I A;  3AYH B;  1SMX A;  3KFU A;  1ASZ A;  2I5H A;  4JYA L;  5DLQ E;  3CCS A;  5LMU L;  3ERS X;  1WOC A;  2QEX A;  1PYS B;  2Y0S G;  1HR0 Q;  2VY3 A;  2VQF L;  2OCE A;  1E1T A;  4JI8 Q;  4DR5 Q;  4DV7 L;  1PV4 A;  1WI5 A;  4A3I G;  4JOI A;  3F1Z A;  3RLN A;  4DUY Q;  1PA6 A;  2WB1 G;  4LFC L;  1VQP A;  3L0O A;  1YJN A;  4DV0 Q;  1EYG A;  5HGQ A;  3KDF B;  3A5U A;  4DV1 L;  4C3J H;  2ZJQ A;  4JI6 Q;  3CCU A;  4H02 A;  4HIO A;  2ZTC A;  1OXU A;  1PH8 A;  1YI2 A;  1EWI A;  1M90 C;  4O2D A;  1IXR A;  3HKZ G;  4YWK A;  3RLF A;  1WCM G;  2YTV A;  4IFD G;  1B70 B;  1J5E Q;  2YTY A;  3CME A;  4UPA A;  4HJ5 A;  4DV3 Q;  3SGI A;  1EUJ A;  5BR8 L;  1EIY B;  1C0A A;  1SFO H;  2UXD Q;  4KHZ A;  1KD1 C;  4GKK Q;  5JJL A;  4LNQ A;  5FLM G;  3CMA A;  1FL0 A;  4ALP A;  1J6Q A;  1K73 C;  4A3F G;  2D0P A;  5FJ8 G;  5IYC G;  1HR0 L;  1IBM Q;  4MNO A;  5LMN L;  3HOV G;  3F8T A;  4QY7 A;  1KRT A;  3RR5 A;  1XMO L;  4LF7 L;  4LUZ A;  2C35 B;  1C7Y A;  4A3E H;  4IOC A;  4DR5 L;  4B3R L;  1PH7 A;  2UUA Q;  4B3T Q;  1LM0 A;  4DUY L;  1N34 Q;  3HOX G;  1HZA A;  5C4X H;  1E24 A;  1XPO A;  4IPG A;  2PI2 A;  5AJ3 L;  3PO3 G;  3TEH B;  3NEN A;  4IFD I;  4X65 Q;  1ASY A;  3GTK H;  3CC2 A;  1B7Y B;  2UU9 Q;  4JI6 L;  1SRO A;  2VNU D;  1VQ5 A;  4JBK A;  1PFS A;  1TXY A;  4C2M H;  2E2I H;  1JJG A;  3ZJY C;  1GKH A;  4GNX B;  4P71 A;  3TRE A;  5IYB H;  4IO9 A;  4JC0 A;  2HQL A;  1P8L A;  3H0G H;  5H1S E;  2GVB A;  2N78 A;  3PIP A;  3Q8D A;  3K7U C;  1HZB A;  2WAQ G;  4A3K G;  4DV3 L;  2JA8 H;  4L5R C;  4GOP A;  1Q82 C;  4DR6 Q;  1E1O A;  3S1R H;  5IP9 G;  4A3C G;  3FP9 A;  3AQQ A;  4GKK L;  1GM5 A;  1OXT A;  2MO0 A;  1V43 A;  3KJP A;  2IX1 A;  5GAD C;  1JJ2 A;  4OWW B;  2R93 H;  4YWM A;  5IWA L;  3G6E A;  4HJ8 A;  1IBM L;  2ZJR A;  1HNZ Q;  2EQS A;  1N33 Q;  2R7Z G;  4DK3 C;  4X64 L;  4K0K Q;  5HY6 A;  1CSP A;  4BY7 H;  5IP7 H;  2B63 G;  1N32 Q;  2PQA B;  5M3F G;  2CWP A;  4JI3 Q;  3K7A H;  2UUA L;  1XTD A;  5FLX c;  4LF9 Q;  3W5O A;  4YCW A;  2BH2 A;  2OQ0 A;  3RZO H;  1AE3 A;  1N34 L;  1U0L A;  4A3G H;  2ATW A;  2R7D A;  4A93 H;  2GN5 A;  1Y1W H;  1VQI A;  1YJW A;  2QGQ A;  2Q2T A;  4JI5 Q;  3ULJ A;  3KDF A;  4X65 L;  1NY4 A;  1YEZ A;  2EXD A;  2K52 A;  1VQF A;  3OTO L;  3FKI H;  5GAE C;  3I7F A;  3F2D A;  4J15 A;  1VQ8 A;  3CW2 C;  1Q81 C;  3CCL A;  2D62 A;  1PH4 A;  3EIV A;  4JI7 Q;  3A5Z B;  2NVQ H;  3CC4 A;  3CPW A;  3KJO A;  1UE5 A;  5LMU Q;  1VQM A;  3PGZ A;  4DR7 Q;  3M85 A;  1K83 H;  1UEB A;  3J80 c;  3I4M H;  3S2H H;  3TQY A;  1VQE A;  4DR6 L;  4GN3 B;  2L15 A;  1XMQ L;  3HOZ H;  2VL6 A;  1L2F A;  4IJL A;  3GD7 A;  3PF4 A;  3J80 i;  4DV7 Q;  3CXC A;  1Y14 B;  3HOW G;  1HNZ L;  1N33 L;  4RG1 A;  1YIJ A;  3M3Y H;  4K0K L;  4LFC Q;  5M3M G;  3KLW A;  3U4V A;  3CAM A;  3S17 H;  1N32 L;  4P75 A;  1WYD A;  4IOA A;  3STB D;  1W3S A;  1QZG A;  4JI3 L;  4A93 G;  3GO5 A;  1UWV A;  3A0J A;  3W1G A;  3CD6 A;  5C0X G;  4WJ4 A;  3I4N H;  3D0F A;  1PH6 A;  4JI5 L;  3S1Q H;  3AFP A;  2VQE Q;  4JI0 L;  4GN5 A;  4NXM Q;  3S1M H;  3U4Z A;  1YJ9 A;  4IJH A;  2K14 A;  4GNX A;  4Y7N H;  2NZH A;  4IPH A;  1EIF A;  4KI0 A;  4DR1 Q;  4JI7 L;  4P72 A;  4AYB G;  1L1O C;  4A3B G;  4DR7 L;  4DV4 L;  2XTI A;  4JG2 A;  3MXN B;  4NB3 A;  3UE0 A;  4X62 L;  5LMN Q;  1XMO Q;  4LF7 Q;  3CQZ H;  3UE1 A;  1VQB A;  2WP8 J;  4UP7 A;  1VQ9 A;  4B3R Q;  1XNQ Q;  4L5T A;  4R4T A;  3JAM c;  3KF8 B;  3HOY H;  1HNW L;  5C0X I;  1Y1V G;  3FHW A;  4JI2 Q;  3UDF A;  2R92 H;  1T9H A;  3HOU G;  4KHP Q;  3BJU A;  5AJ3 Q;  1NE3 A;  4R4Q A;  3UDI A;  3JAM i;  4JCV E;  2PQA A;  2QA4 A;  4HIM A;  1TWH H;  4DK6 C;  1GO3 E;  4R1J A;  4NXN Q;  3GTP H;  1K8G A;  1BBW A;  4OO1 G;  1Q1B A;  4OWT B;  1I50 H;  3IRB A;  3M4Q A;  3BU2 A;  5GQO A;  3PF5 A;  3S2D H;  2VQE L;  2ASB A;  2KHI A;  3M7N A;  5IE8 A;  4ME3 A;  4NXM L;  5GAG C;  4A3M H;  1VQJ A;  2BA1 A;  5J3B A;  3AEV A;  4DNI A;  5C3E H;  1VQH A;  4LF8 Q;  1VQA A;  2IHE A;  2VW9 A;  4OX9 Q;  5GAH C;  1YHQ A;  4DR1 L;  2ZM6 Q;  3WWV A;  4GLA C;  1MJE A;  2VUM H;  1JT8 A;  1KL9 A;  4UP9 A;  5IWA Q;  1I5F A;  3STB C;  4EX5 A;  2I5L X;  4XTC S;  1QVC A;  1X6O A;  3RN2 A;  4X64 Q;  3PIO A;  2ZTD A;  1SE8 A;  1Z9F A;  5C44 H;  2HIX A;  2ALY B;  3NEL A;  5IYD H;  4UY8 C;  2CWA A;  4A76 A;  2UUB Q;  2JEB I;  1Q8K A;  1TWC H;  3BZC A;  3MEF A;  1SLJ A;  4GN4 B;  1JMC A;  2CCZ A;  1XNQ L;  4BBR H;  2JA6 H;  4BY1 H;  3CF5 A;  1HR0 W;  4JI2 L;  2JA7 H;  4KHP L;  1V9P A;  2B3G A;  3U58 A;  1KIX A;  3PV0 A;  3PCO B;  4LW1 A;  1FVI A;  2YV5 A;  1UE7 A;  1CSQ A;  1HH2 P;  1X55 A;  4NXN L;  2H5X A;  2KCM A;  1QVF A;  3OTO Q;  2I5M X;  2F52 A;  3A74 A;  2MO1 A;  3L2P A;  1FGU A;  1KXL A;  3HFZ B;  3ULL A;  1UE6 A;  1CKN B;  1MIU A;  1VQG A;  4BA2 I;  1YHA A;  2XGT A;  3H3V H;  4JOI C;  2UUC L;  3B6Y A;  2EIF A;  3AFQ A;  3KOJ A;  2LXK A;  1XNR Q;  1K0R A;  4LF8 L;  1VQ6 A;  1BBU A;  5C4J H;  4UP8 A;  1XMQ Q;  4OX9 L;  2CKZ B;  4QIW E;  3S1N H;  2ZM6 L;  3CCQ A;  3OYY A;  2OQK A;  4DV6 Q;  2AWO A;  4TQU S;  2N8N A;  4A3E G;  2IY5 B;  1I94 Q;  1VQD A;  2F4V Q;  4YWL A;  2Q2H A;  3KF6 B;  2D0O A;  3M4P A;  1YZ6 A;  1HZ9 A;  4B3S Q;  4JI4 L;  5GRO A;  3EBE A;  2UUB L;  5C4X G;  4LFA Q;  4A3L H;  4IPC A;  2DUD A;  1X54 A;  1R9T H;  1PH1 A;  1EQR A;  1X56 A;  1KAW A;  4DV2 Q;  2LSS A;  3T1Y Q;  1I6H H;  2BH8 A;  4QQB X;  3M4O H;  5IYB G;  2VZA A;  3OW2 A;  4JI0 Q;  3H0G G;  3I4O A;  1Q86 C;  2IX0 A;  2N3S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...