3S1MH

Rna polymerase ii initiation complex with a 5-nt rna (variant 1)
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
molecule tags Transcription/rna/dna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 19
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2011-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3s1mH00
5BR8Q 2HIXA 3J7ZC 3K8AA 3S15H 1VCIA 2IX1A 1VQ9A 1HH2P 3F2CA 1V9PA 3GTLH 4JC0A 1ASZA 3CMEA 1IBKQ 3BZKA 2GVBA 1IYJB 5C44G 4DV4L 3I4NH 3PF5A 4GLVB 1OXVA 1TWCH 3UDFA 3KFUA 5C0XI 1VQJA 1ASYA 1TWAH 4JOIA 3L0OA 4K0KL 2WB1E 2UUCQ 1K8GA 3RN5A 3PUVA 4BBRH 1X3FA 2K5VA 1E1OA 4DR3L 4HIOA 1VQHA 3E0EA 3OTOQ 1PH3A 3G4SA 2MFIA 4LFAL 3PO3G 1X3GA 1KL9A 1K83H 5JEAG 1KQSA 1NE3A 1PH1A 1VQLA 1AE2A 2NN6G 3UDGA 1X54A 4GNXB 1OXSC 4A3BG 3KDFB 1MJCA 4HIDA 4B3TQ 5AJ3L 4NXMQ 1QVGA 4GKJQ 2JA6H 2R93G 4DPGA 4BY7H 1QUQA 4DV3L 1Z47A 5GADC 3G71A 2XTIA 4YY3L 3FHWA 4JI1L 1PH4A 1J5EQ 4JI8Q 3I4MG 3RLFA 1VQ5A 1G291 4IJHA 2LXKA 1WOCA 2E5LL 2OTJA 1FJGQ 3PGZA 2KBNA 4R4IA 1OTCA 1Q8KA 4LFCL 1VQIA 1E24A 4RMFA 3W1GA 4MTNA 2VQEL 1M1KC 4BY1H 5ELOA 4AYBG 4X65L 2E2IH 2ATWA 4A3MG 4KI0A 3ZJYC 2V1CC 2OTLA 1J6QA 2RCNA 2VQFL 1VQ6A 3WWVA 2YTXA 1PH8A 2AHOB 3DM3A 1GM5A 4DR4Q 1D7QA 3S1MH 3M4PA 1QZGA 3RLNA 5HY6A 3E9IA 3AEVA 1EQRA 4EX5A 4L5QA 1LUZA 2AWOA 3STBC 4AQYQ 4A93H 1Y1WH 2ES2A 1VS0A 1XNRQ 2I0QA 4A3IH 2WFWA 4X62Q 4A3EH 4JBMA 2B29A 2DUDA 5IWAL 4DR6Q 2F4VQ 4IFDG 4JI2Q 5M3MG 3HOZG 2KHIA 2ZTEA 5IT9c 3HOXG 2UU9Q 4PZ6A 4HJAA 1XNRL 4LF6Q 1VQOA 1S72A 1Y1VH 2OQ0A 3F8TA 4R4CA 2JEBI 2E2HH 4NB3A 4OWWB 1CKNB 3U50C 4FDBA 4BA2I 1XPRA 2OWOA 1HZCA 5E7NA 4DKAC 1OXXK 3AQQA 3I2ZA 3KDFA 4PZ8A 3RNUA 3PF4A 3GTJH 1GD7A 5M3MH 3HOZH 4DR4L 2YTYA 3S1NH 1OXTA 1Z9FA 1PFSA 1JJ2A 1C9OA 2VQFQ 1KD1C 4DAYB 1XNQQ 1X65A 3CMAA 4A3LG 2JK8A 2RF4A 4DNIA 2JA7H 4LF7L 4Y7NH 4A3GG 4PZ7A 1SMXA 2R92H 2R7FA 1NMGA 4X65Q 1HR0W 3OW2A 1VQ4A 1VQFA 3CCVA 4QGUA 4A3EG 4A3IG 3CCMA 1B70B 1EYGA 1KC8C 1SE8A 1X55A 1EIYB 3HOUG 4JBWA 1FGUA 1WCMH 4OX9Q 4JV5Q 2KCTA 2BA0A 4BBSH 1FVIA 4DV7Q 2K50A 1SROA 1JJCB 3PUZA 2CFMA 4JI1Q 4AIMA 5LMNW 1M90C 4LF5Q 4A3FG 4IPGA 1H95A 1FL0A 4DV3Q 3S1RH 2ZTCA 4ME3A 4GNXC 2KENA 1X6OA 4NPSA 2HHHL 1HR0Q 2B63G 1CUKA 2EXDA 3H15A 5AJ3Q 1BKBA 1E7ZA 3CD6A 4DK6C 3S17H 4LF5L 5JJIA 1Q7YC 4A3KG 3GD7A 3GTMH 2UXCQ 4OXPA 2N49A 1N34Q 3HOWG 4JV5L 1IZ6A 4B3ML 1A8VA 1X56A 2JA8H 4RG1A 3TS2A 3CPWA 1JB7A 4APVA 2RHQB 2ID0A 1K0RA 4MNOA 4YWMA 3PUXA 3J81c 1PHJA 2FXQA 2MO0A 1VQNA 4JYAQ 2AMCB 4C3IH 2CQOA 3CCQA 2Z6KA 1PH5A 1XNQL 3RZOH 1HJPA 3B6YA 4LW1A 1Y1WG 4IFDJ 4R4OA 3LGJA 5C0XJ 2ZM6Q 2UUAL 4HJ8A 2A8VA 4IOAA 3GTQH 1YEZA 4C2MH 5LMNQ 2WAQE 3AFPA 4UP7A 3I55A 2I5LX 3D0FA 3H0GG 3TQYA 5C3EG 3HKSA 3I56A 4OO1G 5C4XG 1X3EA 4IPCA 3S2DH 1CSQA 1EWIA 2QEXA 4DR7Q 4X66Q 1N33L 3GTGH 4O0AA 1XMOQ 1UE5A 4A93G 1EFWA 4UP9A 1QVFA 4JI4L 4B3SQ 1I50H 2F4VL 3H3VH 1U5KA 2VUMG 1UE7A 4LFBL 4DR6L 1YIJA 2RHSB 4OONA 1YNXA 2DGYA 4BXXH 2VL6A 3J81j 4DV6Q 4DR1Q 1AE3A 4LF4Q 1UE1A 2UXBL 1KAWA 1E1TA 2XGTA 4UP8A 1IBML 3K7AH 4ALPA 3PSIA 1BBWA 1S40A 5IP7G 1Q81C 2UXDQ 3KJOA 1U0LA 1I94L 4L5SA 1WYDA 2BH8A 1XTDA 2K14A 4AH6A 1SFOH 2HQLA 4A3JG 2LSSA 1PH6A 3G48A 3F1ZA 4UPAA 1L0WA 1A63A 2NZHA 4X6AH 1VQEA 3A0JA 3PUYA 3UE1A 5C4XH 4BY1G 2ZJPA 3CCJA 4LUZA 4OWTB 2E8GA 2VQEQ 2ASBA 3FKIH 4JI6L 1VQAA 1P8LA 3A74A 4LFCQ 1DGSA 4LF4L 4P72A 2JA9A 4DR1L 2B63H 3FP9A 1PVOA 4PMWA 3M3YH 3CCRA 3M4OH 2VZAA 2JA5H 4JI0L 4YHHL 4GKKL 1UEBA 3BJUA 3CPFA 1J5EL 4BXXG 4B3SL 3T1HQ 1QVCA 5IE8A 4JOIC 3FKIG 1EOVA 1LM0A 2PNHA 2IT1A 4DV2L 2Q2TA 3CC4A 1I5FA 1N33Q 3HOWH 2YYZA 3STBD 1YI2A 3KF8B 2R6GA 1K3RA 4GKJL 4NXML 1L1OC 1MKHA 4B3TL 2PI2E 5LMNL 5J3BA 1A62A 4LWCA 3M4QA 1N36Q 5GAHC 2B3GA 2ZM6L 4TVAB 2MNAA 1MIUA 1HNWL 4KHPQ 3TREA 4GS3A 5M5XH 3T1YL 2EIFA 5C0XG 3CCLA 3W1BA 1K9MC 3A5UA 2N8NA 2KHJA 1YHAA 5GAGC 1Q12A 5M5YH 3K7UC 3NEMA 2LXJA 4IO9A 3RR5A 3SGIA 3GTKH 5C44H 3ERSX 1TWFH 4BBSG 3AYHB 2QGQA 4C3JH 4EQ5A 4L5TA 4B3MQ 2AKWB 4YCWA 4HJ7A 2JE6I 2D0OA 1S3OA 1N34L 4UY8C 3ER0A 4A3GH 4LUVA 3L7ZC 2C35B 4R1JA 3NELA 4BBRG 1XMQQ 1N36L 2JEAI 4P73A 1UE6A 2NZOA 3GTOH 1L2FA 2I5HA 3E9HA 3PCOB 2BH2A 1PH7A 3M7NA 2R7DA 3PO3H 2HHHQ 2K5NA 1GVPA 3HOUH 4HIMA 3ULLA 2K52A 3BZCA 2Q2IA 2PI2A 2UUBL 4QJFA 3HFZB 3JAMc 3T1HL 1VQCA 4LF9Q 2UXDL 1NTGA 4DR5Q 1NY4A 5IP7H 1N9WA 2F3IA 2F52A 2H5XA 4TQUS 3F2DA 3DLLA 4JI0Q 1JE5A 2AWNA 4OX9L 4A3CG 1L1OA 2Y0SE 1KIXA 1JJGA 2NVYH 4GKKQ 1IXRA 1KXLA 5HGQA 1QZHA 2OQKA 1QUQB 4OO1I 1NBWA 4A75A 4LNQA 4WJ4A 1XPOA 4AYBE 4IOCA 1VQGA 2BA1A 1HNZQ 4LF7Q 1O7IA 1XPUA 3PO2G 2ZJRA 2YV5A 3CCEA 3S1QH 2WAQG 1HNXQ 5LMUQ 3HOVH 3H0GH 5M3FG 1NMFA 1PH9A 1I94Q 2JA5G 4DV5Q 1I3QH 1T9HA 2GVAA 3K80C 2JA6G 3HOYG 1RL2A 1SR3A 4BY7G 2UXBQ 1YVCA 3ICEA 2R92G 2NN6I 2IHEA 4GOPC 4DUZQ 4DV0L 4DV6L 2YTVA 4LF6L 4JI5L 3I7FA 4LFBQ 4POFA 4GN3B 1P16A 5FLMH 1PYBA 3CXCA 4JI2L 4JI4Q 1AH9A 1PYSB 3PIPA 1WCMG 3CAMA 1KRTA 5C3EH 4DR2Q 1IBLQ 3I4NG 1BBUA 1Q1BA 3BU2A 4X66L 2D62A 4R4QA 4AQYL 4B3RL 5H1SE 3PO2H 4QL5A 2CKZB 1TWGH 3KJPA 3CCUA 1CKMA 4IJLA 1G6PA 4A3JH 2UUAQ 5IYCH 3U4VA 2N78A 2K75A 4LF8Q 1Y1VG 2MO1A 3HKZG 3ULJA 1L1OB 3HOYH 3HKZE 1HZ9A 2JQOA 4DUYL 1YJNA 2NVXH 1PV4A 1W3SA 3TRZA 1N32L 4DR7L 1CSPA 1SLJA 3K81C 4JYAL 3K0XA 3S24A 1N8RC 4X64Q 1K73C 4A3BH 4DK3C 4LF8L 5IYCG 4OWXB 4QY7A 2Q2UA 4J15A 5FLMG 2E5LQ 3J80i 2R93H 2PQAA 3S14H 1PH2A 3AFQA 3MXNB 1KRSA 4JI8L 3CCSA 4YWKA 3L2PA 4GNXA 4B3RQ 2UXCL 5EAYA 4H02A 1OXUA 2PQAB 4GLXA 4YY3Q 1VQMA 3PUWA 4P71A 3F2BA 2HIVA 1IBLL 5GROA 4DR2L 4P75A 4QIWE 4GOPB 2VW9A 1HR0L 3I4OA 4Y52H 4JI5Q 4O2DA 5IP9H 3S2HH 1Q86C 3KF6A 4DUZL 5IYDH 3S16H 3NENA 4DV7L 2K4KA 3TEHB 3A5ZB 4A3MH 4C3HH 3G6EA 1Q82C 1VQKA 4LUOA 1HZAA 3RLOA 2WP8J 2VUMH 4LFAQ 1HZBA 3M85A 5M3FH 4HJ5A 3EBEA 5LMUL 4QQBX 3CW2C 4DR3Q 4PG3A 4A76A 2A1AA 2D0PA 1EQQA 1VQDA 2Z0SA 1W2BA 4R4TA 3IRBA 4P74A 1C7YA 1UWVA 1V1QA 1YZ6A 3GDEA 4DV4Q 1X9NA 1NJIC 1JT8A 3GO5A 3KYHC 1WFQA 2PMZE 4BA1I 3W5OA 4XTCS 3Q8DA 1WJJA 1VQ8A 1GO3E 1GKHA 3H3VI 2EQSA 4A3KH 1RIPA 2CWPA 4YCUA 3ULPA 3I4MH 4POGA 4A3DH 5IYBH 1JMCA 4A3CH 4GLAC 1E22A 4DV1Q 1YITA 2UU9L 2QA4A 1V43A 5IWAQ 2JA8G 4X62L 2VS1A 1A0IA 2R7ZG 1XMQL 1MJEA 4A3DG 2JA7G 1VQ7A 2NVTH 1YHQA 1YJWA 4IPDA 2NVQH 4JBKA 1VQBA 1E3PA 4DAMA 3CF5A 3CC7A 1YHBA 5DLQE 4JCVE 1Q46A 4IPHA 5FJ8H 5M5WH 2Y0SG 4X64L 5C4JH 2N3SA 4JI3Q 4L5RC 4YWLA 2OCEA 4DUYQ 3T1YQ 1N32Q 4KHPL 1HNWQ 5IYBG 1SN8A 3JC66 4JI7L 2VNUD 1FJGL 4NXNQ 5JJLA 2A19A 2Q2HA 5IP9G 3EN2A 3M9BA 2WB1G 5IYDG 1KHIA 3NBHB 4GOPA 5JJKA 2GN5A 3U58A 4DV2Q 5JEAJ 3D31A 1VQPA 1BVSA 3U4ZA 3OYYA 1TXYA 2K5HA 5IY0A 3RN2A 4YHHQ 1PA6A 1XJVA 2I5MX 4GN5A 3JAMi 1LYLA 4GN4B 1R9TH 4XIGS 5FJ8G 4HIKA 1CKOA 4DV0Q 2IY5B 4NXNL 4HJ9A 2JJQA 4A3LH 4JI7Q 3J81i 4JI6Q 5GQOA 3KF6B 3KOJA 4JG2A 2IHFA 4JBJA 1YJ9A 4KHZA 1I6HH 3KLWA 2YU9H 4YCVA 4DV5L 4JI3L 3OTOL 1HNXL 3RZDH 1YBYA 4IFDI 2KCMA 1B7YB 3J80c 3UDIA 5ELNA 3TS0A 2UUCL 1EIFA 2IX0A 3PIOA 1HNZL 2ZJQA 4K0KQ 2ALYB 2HT1A 1IBMQ 3UDXA 1K8AC 1WI5A 1Q1EA 4A3FH 3MEFA 3VDYA 3CQZH 2L15A 1C0AA 3PV0A 1IBKL 2ZTDA 2CWAA 1Y14B 2E2JH 5GAEC 3UE0A 1D8LA 1EUJA 2MQHA 5FLXc 4MZ9A 3HOXH 3HOVG 4WJ3M 1TWHH 2VY3A 4KLKA 3J7A5 5K36G 4A4IA 3GTPH 4DR5L 3EIVA 4LF9L 5BR8L 4DV1L 1CKNA 1G51A 2R7ZH 1XMOL 2CCZA 2UUBQ 3CC2A 1SRUA 1B8AA 2Z6KC 1LTLA 3CP0A 1IL2A
chains in the Genus database with same CATH superfamily
3DXJC 3QR8A 1DJRD 1B1ZA 4ZYSA 2F0NA 1DXMA 4PNYA 2A73B 3CMEA 2GVBA 4C1NI 1IYJB 1SNOA 4XYOA 3TSSA 5C0XI 3L0OA 2UUCQ 1FYCA 3CRLC 3RN5A 3PUVA 4BBRH 2K5VA 5HURA 1E1OA 3NQTA 2M9VA 4M1UB 1EY0A 4LFAL 1TU2B 2AQ1B 3PO3G 1QILA 1ML0D 5JEAG 3BVMA 1QNKA 1NE3A 1PH1A 1AE2A 1X54A 4GNXB 1OXSC 3J81E 4A3BG 1I4HA 2F4IA 4NXMQ 4GKJQ 2JA6H 1EL0A 5F2DA 4BY7H 2PO4A 3TBIB 3MC0B 4YY3L 2JA6B 3U9SA 1PH4A 3P7JA 3KLSX 1VQ5A 3NWTA 1NAPA 2A68C 5I6WA 4RMFA 4BY1H 4X65L 3NBIA 4A3MG 1ZXTA 1BCPF 1B44D 2RCNA 4OELB 1VQ6A 3WWVA 3DM3A 1GM5A 4ZUJA 1ENCA 1HUMA 3S1MH 3VYRA 1QZGA 1SNDA 3AEVA 4EX5A 4L5QA 2AWOA 3STBC 4A93H 1ESRA 1Y1WH 4A3EH 4X62Q 3HP3A 2B29A 2DUDA 3HOZG 4DAVA 1TWHB 1U4LA 3OMGA 1Y1VH 2A6HD 2E2HH 3A8JE 4N8FA 4OWWB 1TS2A 1VDZA 5I9PA 3GTPB 1ICFB 1QNUA 3SHLA 5E7NA 3G6JB 2RSOA 1HQMC 3GTJH 1GD7A 2NB0A 1OXTA 1STBA 1PFSA 5A35A 2VQFQ 1KD1C 1RCVD 3CMAA 4A3LG 2JK8A 4A3IB 1LTRD 2XWJB 4DNIA 1HXYD 4LF7L 1ZKOA 4Y7NH 4UHVA 1SMXA 1HR0W 1VQ4A 3WDNA 4CJ0B 2FFKB 1SE4A 2F3WA 4A3EG 3CCMA 4H7BA 4FYDA 5EPKA 1G8ZD 4DN4M 1FGUA 3VR3A 2F0UA 4BBSH 3HGBA 1FVIA 2UXDQ 2K50A 1SROA 4JI1Q 3PUZA 1M90C 1BCPD 4IPGA 3S1RH 4ME3A 3TZUA 2F0TA 2B63G 2HHHL 1CUKA 1A3TA 5AJ3Q 4F7XA 3CD6A 2KJXA 5JJIA 3DM1A 2BE5D 1N34Q 3HOWG 5T1GA 1A8VA 3CPWA 2VB2X 2RHQB 4GZYC 3RZOB 1PH5A 3WOEA 1LABA 1TY2A 1HHVA 1EY4A 2NWGA 4LW1A 4IFDJ 1D5MC 4IOAA 3LGJA 2KEEA 2UUAL 1D6EC 1SYFA 3AFPA 3H0GG 3I56A 4OO1G 3QWNA 4EVOA 3MXGA 3BZDB 4M8AA 3S1MB 1TWGB 4DR7Q 1KAAA 4DK0A 5IGFA 4O0AA 2EZVA 1EFWA 4UP9A 1QVFA 4JI4L 1QE6A 1I50H 4B3SQ 1UE7A 5C5MA 4IUUA 3K58A 3OIQA 2RHSB 2VL6A 3BVGA 4DV6Q 3O13A 3A7LA 1AE3A 3DWQA 4LF4Q 1EIHA 2F0GA 2UXBL 3TP5A 1SYBA 2F0EA 2B2WA 4K2KA 4IALA 5IP7G 4DNTB 1I94L 2K32A 4AH6A 3I72A 2LSSA 4G7OC 3G48A 1MI2A 3EFXD 2XSCA 1S5ED 1VQEA 3PUYA 3S1NB 1BCPC 1SSOA 1DGSA 4LF4L 2JA9A 3W2DA 4MIUA 3FP9A 1PVOA 3M3YH 3M4OH 1FD7D 3MZ5A 2A5HA 1UEBA 3BJUA 3C2PA 4B3SL 2HQEA 4OIJA 1LLRD 4JOIC 1LM0A 1I5FA 2YYZA 2RBMA 1U9RA 2R6GA 4GKJL 4KY6A 4NXML 1CA6A 3E0JA 1L1OC 1MKHA 2PI2E 3VYUA 3M4QA 1N36Q 5EKLA 3TREA 4GS3A 1QOHA 1YHAA 5GAGC 3RZDB 3J7AV 2B8GA 4BBSG 3AYHB 1IHZA 2NBFA 3E5SA 5C4ZA 1MSHA 2C5CA 2D0OA 3OHXC 1N34L 4UY8C 2E75C 1XMQQ 2K5WA 2PNRC 1S4ZA 1UE6A 1Q90A 4RKLA 3GTOH 1L2FA 1PH7A 2Z8LA 2HHHQ 1GUNA 2RDFA 2K52A 1DONA 3D8GA 3SE0A 3JAMc 2HCCA 1VQCA 2UXDL 1NTGA 4TQUS 2AWNA 4I7ZC 4JK1C 1QUQB 4LNQA 4A3BB 2EYPA 3S1QB 2F0OA 4LF7Q 3D6CA 1XPUA 2ZJRA 2YV5A 5ELBA 4ZAIA 3S1QH 2WAQG 4KV6A 1B3AA 1HNXQ 3HOVH 1B50A 5NUCA 3H0GH 2B2TA 1AZPA 1HPCA 3SXHA 1I3QH 4H0LC 5IGEA 3HOYG 5G3LF 5M5YB 3LX0A 1RL2A 5IT9E 1SNPA 4BY7G 3GV6A 2K03A 2NVYB 3ICEA 4JI5L 3D4RA 1P16A 5FLMH 2ZXRA 3PIPA 1KRTA 5C3EH 1IBLQ 3GTOB 2Q8RE 3BU2A 4X66L 2NVQB 4R4QA 1CQFA 3PO2H 5M9OA 3KJPA 1CKMA 3C3LA 1XWEA 4IJLA 3HOYB 3QG1A 4H44C 3HKZG 2EYHA 1YJNA 4BY1B 3TRZA 1Y8PB 2Q8TA 1VF7A 3K81C 2NN6H 3K0XA 2J7ZA 1K73C 3A8KE 4DK3C 4LF8L 2CW0C 5A2QE 1PMRA 2Q2UA 4J15A 5FLMG 2R93H 1CQVA 2L55A 1C4QA 1H9SA 4GNXA 1H9RA 5EAYA 2UXCL 4KD4A 2PQAB 3AU7A 4YY3Q 3M7GA 5BN5A 4P71A 4OHJA 4A93B 3F2BA 2K7VA 4QIWE 2VW9A 1SBBB 3I4OA 4O2DA 3S2HH 3V96A 4DV7L 2K4KA 3T53B 2WIIB 3NP8A 3RLOA 4LFAQ 2K5DA 4KY5A 3M85A 2F0QA 4HJ5A 4QQBX 4PG3A 4A76A 2EPBA 1KLGD 1QWYA 4R4TA 1EY5A 5M5XB 1PYWD 3KBXA 1V1QA 1YZ6A 3GDEA 1I4PA 4R8IA 3KYHC 3K5OA 1SJED 1WFQA 3W5OA 3MWYW 4XTCS 1WJJA 1GKHA 3H3VI 2IX3A 4YCUA 4A3DH 1STNA 3NHHA 4GLAC 1E22A 1YITA 2VS1A 4KD3A 3A7AB 2R7ZG 4HTHA 1MGSA 2DY7A 1K8MA 3X3MA 4IPDA 2NVQH 2F0IA 1E3PA 2PW7A 3CF5A 3CC7A 5CGKA 4IPHA 5C4JH 1STAA 3H3VC 4KN7C 1JWUD 1SMYD 4L63B 4KN4C 4DNRB 1O80A 2K6AA 5CV7A 4KHPL 5AFWA 3LWEA 1FJGL 2VNUD 5CBEE 2A19A 3SVMA 2ENBA 3EN2A 4E6IA 1BO0A 5IYDG 1KHIA 1PZKD 3J80E 1L0XB 2MHVA 3D31A 4XQJA 3GTGB 1BVSA 3U4ZA 1PA6A 2I5MX 1LYLA 1AP0A 2ICIA 1EOTA 4NXNL 1TT2A 4A3LH 1NSNS 5GQOA 3PIO3 3KOJA 4XDXA 2L11A 1IYUA 3N6RA 4DV5L 4JI3L 2RA4A 1DCZA 1NCVA 4IFDI 4RAUC 2LFNA 2HD3A 1KDBA 3PIOA 1HNZL 2OF1A 1SEBD 2WKDA 1H9JA 3VDYA 2L15A 2VB3X 3PV0A 2IPKD 1IBKL 1SXTA 1CZWA 2E2JH 1D8LA 1Y1VB 4Q0FA 1JE4A 1TR5A 1TWHH 3J7A5 4A4IA 4LF9L 1I4RA 4O1NA 2TSSA 4XQNA 1EZ8A 1B8AA 3GTLH 2Z6KC 1LTLA 3CP0A 3K8AA 3S15H 2IX1A 3NE5B 5CR3A 1V9PA 4ZQ3A 2K28A 2D9UA 3EQLC 5CV4A 3PF5A 3I4NH 1LT4D 3UDFA 1ASYA 1HFNA 4K0KL 4FXKC 4IUQA 3HEJA 1TWFB 1RF2D 1S5CD 3OTOQ 3K5NA 5C44B 1PH3A 3SEBA 2EY1A 5IT9L 1KQSA 1SDFA 3Q6SA 2DNCA 2NN6G 1JORA 3KDFB 4HIDA 2F0MA 4C3IB 1PTOC 1QVGA 1F9QA 1GJXA 1QUQA 1IYVA 1T5EA 1Z47A 3MA2B 3PMFA 3G71A 3FHWA 4OL7A 1J5EQ 2NVTB 2F0VA 4K6DA 2LXKA 3IAYA 2OTJA 2KBNA 1Q8KA 5K5PA 4LFCL 1VQIA 1AW7A 3W1GA 1CHPD 2SNMA 4I65A 5ELOA 5CMDA 4A3MB 4R8NA 2V1CC 3TP8A 4CGYB 2F0DA 2AUKA 2X69A 2NZ1D 4U673 3M4PA 1KNEA 1FNUA 1LUZA 5C4JB 4AQYQ 2CHBD 2ES2A 1VS0A 1XNRQ 2BCOA 4NDXA 1E2WA 5CV5A 1Q8IA 3PQIA 5IWAL 5M3MG 1M8AA 2KHIA 5DM63 3HOXG 4Y7NB 1XNRL 1S72A 4IUVA 2OQ0A 3F8TA 3D4DA 4LJZC 3N52A 4NB3A 1CKNB 2D2CC 2EJFC 3BDOA 3U50C 4DKAC 1OXXK 3I2ZA 4PZ8A 3RNUA 3PF4A 1BNZA 2YTYA 1JWSD 1JJ2A 1C9OA 2EY5A 4DAYB 1XNQQ 1X65A 2RF4A 1D1KA 4PZ7A 2R92H 4C2MB 5JPMC 5DM73 4FF4A 1VF5C 4QGUA 2L0CA 3R2IA 2F0HA 5IODA 1EYGA 1X55A 1B9MA 4JBWA 4X3KA 1WCMH 1SE3A 4JV5Q 1JC7A 2KCTA 4N9TA 2R7ZB 2JA8B 4AIMA 4LF5Q 2DNEA 4A3FG 1JWMD 1X6OA 4NPSA 5DEHA 1NNXA 1HR0Q 4B9WA 1TVXA 2EXDA 1E7ZA 2F0KA 3HOXB 1HFGA 2N49A 3M4OB 1IZ6A 2RQXA 1T5XD 1CZGA 1M4VA 1HTPA 4RG1A 3R8BA 5C4XB 1JB7A 4APVA 2Z4HA 3JAME 4MNOA 2MO0A 1VQNA 1RTOA 1FR3A 1GUSA 4C3IH 3OMCA 4WORA 2B2WC 1UNSA 3B6YA 1MSGA 4R4OA 1TIID 4QIWB 5LMNQ 2WAQE 3I55A 5D14A 4CDEC 1H9SB 3HKSA 3CU7A 4EQOA 2LMCB 4J1MA 1CSQA 1EWIA 4LAAA 1ICWA 1AN8A 1N33L 2FMMA 2F4VL 2DJGC 3Q23A 1YIJA 4OONA 1YNXA 2DGYA 2I07B 2J0TD 3S2HB 1KNAA 3D4WA 4WRDA 1UE1A 1X32A 3KLSA 1KAWA 4UP8A 3L3OC 4KKSA 5G3LD 3GTKB 3K7AH 1EY7A 1BBWA 3W3AA 5C6AA 1WYDA 4X3UA 2MJ8A 2TMPA 4KKUA 5C4XH 4BY1G 2ZJPA 2R3ZA 3CCJA 1I50B 3NTKA 2ASBA 3FKIH 1VQAA 1P8LA 1NR4A 3NXWA 4DR1L 2B63H 1TKWB 3FVQA 4JI0L 4GKKL 1IL8A 3S16B 1WTOA 5IE8A 3NBHA 1EOVA 3NSWA 2Q2TA 1EYCA 3HOWH 5CV6A 3OSOA 1YI2A 1K3RA 3MXUA 4B3TL 3ND8A 1A62A 3IFDA 1EY6A 3V05A 2B3GA 5GAHC 2MNAA 1MIUA 4KHPQ 3K57A 3CCLA 1Z7TA 3W1BA 1K9MC 2N8NA 2KHJA 4WJWA 2FJ2A 5M5YH 4IO9A 4C3JB 1PZID 1XX8A 2SOBA 4C3JH 4EQ5A 4L5TA 5KIXA 4B3MQ 3PIP3 1DD2A 4HJ7A 2JE6I 1MHWC 5JOBA 4LUVA 2B39A 3NELA 4BBRG 5I4DA 2N88A 4DU9A 1R4QB 2I5HA 1G2TA 2BH2A 3M7NA 3TMEA 1VMCA 3PO3H 1RHPA 2K5NA 1GVPA 3HOUH 4HIMA 5KEEA 1BCPB 1STGA 3BZCA 2PI2A 1CT1D 3HFZB 1A2UA 2H5XA 2F52A 1O7ZA 4JI0Q 4GKKQ 4A3CG 4OX9L 1Y1WB 2Y0SE 4F88A 1KIXA 2NVXB 1L0YB 3LNNA 2A69C 1KXLA 3L9AX 5HGQA 2A6HC 4OO1I 1NBWA 4WJ4A 4MN3A 1X3PA 5KYIA 1XPOA 3T56B 3VYSA 1O7IA 4BWGB 1BF4A 2JN4A 3NUCA 4CJ2C 2EOTA 1LT5D 2JA5G 3NK9A 4A3KB 2GVAA 1T9HA 2B2VA 4IQZA 2F0LA 1IKMA 5FO9B 2R92G 2IHEA 4GOPC 5EKKA 3R93A 1Q3LA 2YTVA 3BVZA 3CXCA 1PYBA 4JI2L 1WCMG 3CAMA 1W6KA 2B2UA 1Q1BA 1SYDA 3KK7A 5H1SE 4QL5A 2RDHA 2EE1A 1J9OA 5E3FA 5ISRA 2CKZB 4RHSA 5ELDA 4ZKCB 3CCUA 1WVLA 2HCIA 1E0BA 4A3GB 1B4OA 5IYCH 2K05A 1IKLA 4LF8Q 1Y1VG 2MO1A 3ULJA 2F1MA 4RA8A 4DUYL 1N32L 1PV4A 4XXEA 1KDAA 4DXFA 1WTRA 1B3QA 2IJ0A 4X64Q 4CHTB 1EU3A 1BUVT 3PO2B 2L12A 1Z6HA 3S14H 4EGVA 4KK7A 4MHEA 1YNND 1BDOA 2VUMB 4DGZA 1OXUA 1KDCA 1U4PA 1VQMA 2D5DA 1A15A 2HIVA 1IBLL 2ZT9C 4GOPB 1JICA 1HR0L 1A3UA 1BQQT 5JJZA 4JI5Q 1PDQA 1Q86C 5IYDH 4BBRB 3TEHB 5D3IB 3A5ZB 4L6TB 4C3HH 1FNWA 2G5DA 3G6EA 1Q82C 4FF2A 1JOQA 1HQRD 4RGMA 1HZBA 5M3FH 5EPJA 3C46A 4C3JG 1GHJA 3H94A 1VQDA 3IRBA 5E4WC 1C7YA 1UWVA 1S5BD 2RCFA 4DV4Q 1X9NA 1JT8A 2EJGC 2PMZE 3HS0C 4BA1I 4RWSC 5T1IA 1VMPA 1VQ8A 1HCZA 2WB1B 1RIPA 4UAIA 3I4MH 4POGA 1TY0A 1DM0B 1EY8A 1V8QA 3I70A 3MHBA 5FK9C 2QA4A 1V43A 5IWAQ 4QCLA 2A68D 1HA6A 3E3XA 4TKOB 5EPLA 1B2TA 4DFAA 3QOJA 1XMQL 1MJEA 1VQ7A 4ILWA 1YJWA 2RKSA 1YHBA 2NUCA 2F03A 5JVH3 5M5WH 2Y0SG 4K8JA 1YNJC 4RH6A 1JQYD 5M3FB 1XYIA 4YWLA 1LTGD 2RVLA 5IIFA 1IL2A 1F9SA 3A54A 5JJLA 1U4MA 1EY9A 5IP9G 3M9BA 2KA7A 1HUNA 5JEAJ 4HCEA 4R9WA 3HOZB 1KABA 1TXYA 3RN2A 5EKIA 3AB9A 4GN4B 1R9TH 4XIGS 5FJ8G 4HIKA 5IOCA 4DV0Q 5C4HA 3BYYB 4JI7Q 3KF6B 3NQIA 4V190 1I6HH 1RJTA 2LKVA 2YU9H 2MUYA 3OTOL 3Q24A 4HSVA 1ZYRD 4HN7A 3J80c 2EY2A 3SK4A 2H4OA 3UDIA 4K0KQ 2MGSA 3V2TA 4A3FH 1Q1EA 1K8AC 1FNVA 1ET6A 2CWAA 1Y14B 1EUJA 4MZ9A 5K36G 1SAPA 2G9DA 4DR5L 1ONLA 4DV1L 1CKNA 2R7ZH 2UUBQ 2BE5C 4DR7L 3TDQA 5FKAC 3J7AF 2HIXA 2XVSA 1JOKA 4HCSA 3GTLB 1LV9A 3F2CA 2F0FA 5IGGA 4KJOA 1ASZA 1IBKQ 5C44G 2N55A 4CKEA 4GLVB 2KVMA 1TWCH 3KFUA 3HOUB 1VQJA 2QW7A 4OIKA 2B2VC 1EYAA 1OO9B 1K8GA 2RDGA 3I90A 1X3FA 5CV9A 2M2LA 4DR3L 1D2BA 2PZUA 4HIOA 5A2QL 5K36H 3E0EA 4HR7B 2MFIA 4ABNA 1X3GA 4G57A 1K83H 2F0PA 2WKCA 1TS4A 5C3WA 4IZ8A 4HEDA 4QF4A 1MJCA 2KHSA 5AJ3L 1K28A 2Z6BA 3E6ZX 4DPGA 1PRTF 4WFN3 4JI1L 4JI8Q 5I6YA 1G291 1WOCA 1CHQD 2WAQB 2E5LL 3NTHA 1FJGQ 4HMIA 1E24A 2F0SA 3IKJA 4MTNA 2VQEL 1M1KC 4AYBG 5I9OA 2QKIC 3VR2A 2HDMA 2ATWA 2EXZA 3EVQA 3GV3A 4RGOS 2VQFL 1A3VA 1E2VA 2YTXA 4CBVA 4BBSB 1D7QA 3FRPB 1AEXA 3E9IA 2PW5A 4OEMB 1EQRA 3I91A 2L5TA 2X6LA 5EBCA 2JYOA 2F0JA 2WFWA 4A3IH 4JBMA 4KY7A 4DR6Q 4IFDG 1ZEQX 2ZTEA 4PZ6A 4LF6Q 1VQOA 5EJWA 4CDFC 4HSPA 2JEBI 4G4KA 2NYZD 2B63B 1V1OA 4C3HB 2DN8A 2OWOA 3AQQA 3I8ZA 5M3MH 3QOLA 4B9XA 1Z9FA 4RHRA 4NKLA 4A3EB 2R7FA 5L37A 4X65Q 2QF7A 3OW2A 1SYEA 2JA7B 4A3IG 2YU9B 1LACA 3EROA 3TZDA 1KC8C 3HOUG 2AQ3B 1DOMA 2BA0A 4DV7Q 1JJCB 1S5DD 2KENA 1EQTA 4XYQA 4ID6A 2B2TC 2EYJA 3S17H 4IUNA 2AUJD 3KUPA 1Q7YC 2UXCQ 1A2TA 2K33A 1X56A 1V1PB 1X3QA 3TS2A 2E74C 3FMCA 2ID0A 4BS9A 1K0RA 5KGUA 3PUXA 1D5ZC 2AMCB 3KF8A 5J39A 4KKTA 3RZOH 2G9HD 1I6HB 1QB5D 2ZM6Q 1S5FD 2A8VA 2NTTA 3CHBD 3GTQH 1YEZA 4C2MH 4UP7A 4IURA 2I5LX 3D0FA 3TQYA 5JPNC 3S2DH 2QEXA 2PCFB 4X66Q 3H0GB 3JAML 1UE5A 4A93G 3K5LA 3H3VH 1EQVA 1IW7D 4DR6L 4BXXH 3J81j 2L1BA 3QIAA 4QMGA 2B2YA 3QO2A 1JR0D 3R2TA 1EYDA 2XGTA 4XT3B 3AMUA 1IBML 1SFOB 3PSIA 1Q81C 2AQ2B 1Y8OB 1U0LA 4L5SA 2BH8A 1XTDA 3OPOA 1SFOH 1PH6A 2HQLA 3ND9A 1SNCA 3HOWB 1L0WA 4X6AH 2BDOA 3A0JA 3LWUA 2OEOA 4LUZA 4OWTB 3A55A 1PRTC 2VQEQ 2QILA 2A74C 1C48A 3QB3A 2JA5H 3VR4A 4BXXG 2E76C 2O2LD 4CJ1B 3FKIG 2PNHA 2IT1A 4DV2L 4C3HG 3STBD 2ZXPA 3K59A 4X3TA 3KF8B 4V0BA 1PTOD 1J8IA 3SK6A 4LWCA 2ZM6L 4TVAB 1HNWL 2CVRA 5C0XG 1LO5D 5KYLA 3A5UA 1WTPA 2PYKA 3GTKH 3RR5A 3SGIA 1DZ1A 5ELEA 3VR6A 5ELCA 2P5ZX 2AKWB 4YCWA 2I46A 4DA2A 1PZJD 4A3GH 2JEAI 1N36L 4P73A 2F0WA 4C56C 4NW2A 2MPMA 1CA5A 4O42A 2Q2IA 2UUBL 4K5WA 4QJFA 3TP7A 4DR5Q 1NY4A 2F3IA 3F2DA 3DLLA 1JE5A 4QUCA 4RFBA 2LY7A 1JJGA 2EYMA 2KOLA 1IXRA 1QZHA 2OQKA 3M3YB 1G91A 3MTSA 4AYBE 4IOCA 1VQGA 4DF7A 3PO2G 2A6ED 2E2JB 4J6HA 1UEAB 5LMUQ 3I73A 3R3OA 1NMFA 5M3FG 1I94Q 2JA6G 2UXBQ 3S15B 1F2YA 2NN6I 4OGQC 5M5WB 2KCNA 4RKBA 4DV0L 4DV6L 4LF6L 5KRUA 4GN3B 4ZCKA 4JI4Q 3Q22A 4DR2Q 3I4NG 3T13A 5KNDA 1BBUA 1WCMB 4S3SA 3PO3B 3SR1A 1UAPA 1TWGH 4CDDC 1G6PA 1MD2D 2UUAQ 1L1OB 3HOYH 3HKZE 1HZ9A 2JQOA 2NVXH 1W3SA 2JA5B 1K8OA 2K01A 3S24A 1N8RC 1RODA 4NP5A 5IYCG 4QY7A 2E5LQ 3J80i 3I3CA 3U9OA 3AFQA 1PH2A 1KRSA 3QJYA 4JI8L 3L2PA 4B3RQ 4H02A 1FGBD 4HAEA 3OOCA 1PFMA 2WACA 3DWPA 5CYUA 5J22A 4DXGA 4DAPA 5IP9H 2B2UC 4FNFA 3KF6A 4ODGA 4DUZL 2Q8IB 4EQNA 3NENA 3S16H 1Y8NB 4IUPA 1HZAA 4PMBA 3IL8A 1DOLA 2J4XA 3K0YA 3BDCA 4DR3Q 2D0PA 1EQQA 1NR2A 4YIJA 5ELFA 1W2BA 2BDNA 1LT3D 5EBDA 1EIGA 1GXDC 1F2ZA 4L8JA 4TRDA 1G6ZA 3GO5A 2Y0SB 1WTXA 3Q8DA 3T51B 1F2MA 2QDLA 1ET9A 4XT1B 2EQSA 3NPPA 2CWPA 2XN9C 5IYBH 3FKIB 3GP7A 4DV1Q 1D1IA 2DY8A 1TWCB 4X62L 4A3FB 2XRSD 3S17B 1CM9A 2JA7G 2NVTH 1YHQA 3K7AB 1VQBA 5DLQE 4JCVE 3G7LA 1MBYA 4X64L 2SNSA 4PMCA 4L5RC 4DUYQ 1N32Q 4CDCC 3T1YQ 1BOSA 1R9TB 5IYBG 3J7YW 4JI7L 1A6XA 3HRZC 5IGDA 1SYCA 2WB1G 4GOPA 3MVVA 3TN2A 2GN5A 3U58A 1VQPA 5M3MB 3OYYA 2K5HA 4YHHQ 1XJVA 1D5XC 3JAMi 1PTOH 4K5VA 3K5MA 4HJ9A 2F3VA 2JJQA 2PQEA 5FLXE 1PXUA 3J81i 5FO8B 4JI6Q 5C3EB 4JG2A 4JBJA 1YJ9A 4KHZA 4YCVA 2EJMA 3X3NA 3UI2A 2Z4IA 4CKCA 3RZDH 2KCMA 2K5QA 5ELNA 3TS0A 2UUCL 2ZJQA 2IX0A 2KECA 3MFYA 3MEFA 3CQZH 2DJFC 2KQ3A 2VXWA 5GAEC 3UE0A 3HOXH 3HOVG 4ZUIA 3EIVA 1WTVA 4ULLA 1XMOL 2CCZA 3CC2A 1SRUA 3KDFA 3CC4A 1B7YB 3MFGA 3OWEB 1BXTA 5BR8Q 3J7ZC 2XWBB 1VCIA 1VQ9A 1HH2P 1O7YA 4IFDH 1TS3A 4JC0A 4KJNA 1GUWA 3BZKA 1ZYRC 3VA5A 4DV4L 1OXVA 1LTBD 2Z9HA 5IGBA 1TWAH 2RSNA 4JOIA 2WB1E 1H9KA 1JOOA 1EWHA 4A3DB 1VQHA 3GQBA 2OXPA 3G4SA 1AZQA 2EDGA 1EU4A 1ILQA 2O5IC 1EEFD 1ENFA 1KL9A 1VQLA 3S1RB 3UDGA 2KCCA 3GTQB 4B3TQ 1RD9D 1NUCA 2B8FA 1B53A 1CK1A 1Y69U 2R93G 3H91A 1GUOA 3FDTA 1XTCD 2PZWA 5GADC 4DV3L 2XTIA 3D6WA 3SK8A 1QG7A 4PQXA 3I4MG 3RLFA 1HA5A 4IJHA 5D65A 3T16A 1K83B 3S2DB 1RTNA 3PGZA 4R4IA 1OTCA 3RMHA 3DEPA 1RDPD 5CORA 3J81L 1EWCA 4J8QA 2E2IH 4ZK9B 4KI0A 3ZJYC 3FPUB 2OTLA 1C8CA 1J6QA 2NTSA 2E2HB 2L9HA 3DUZA 1PH8A 4K2LA 2AHOB 1B9NA 4DR4Q 5C5LA 3S14B 3RLNA 5HY6A 4P2CB 1STEA 4JVZA 2FMCA 2I0QA 4DAYA 1DYQA 4N9PA 2F4VQ 4JI2Q 2X6GA 5IT9c 4K14A 2UU9Q 1PTOB 4HJAA 3BG3A 4R4CA 1WD1A 2R93B 4BA2I 4FDBA 1HRJA 1XPRA 1HZCA 3S9WA 4KHVA 3HOZH 4DR4L 3S1NH 3K6OA 4RGTA 2JA7H 4A3GG 1NMGA 1VQFA 3URYA 3CCVA 1BBXC 2ICEC 5DAUA 1B70B 1K0SA 1EIYB 1SE8A 3KLRA 4OX9Q 1STHA 1O7LA 2CH4A 4ME5A 3CKIB 5DNFA 2CFMA 5LMNW 1H95A 1FL0A 4DV3Q 5CC4A 2ZTCA 4GNXC 1DOKA 2R92B 2FINB 3OW7A 2A69D 2XRQD 3H15A 1BKBA 5EQ0A 4DK6C 4LF5L 4A3KG 1SJHD 3GD7A 3GTMH 4OXPA 3HOVB 4JV5L 1H9MA 4B3ML 1TQOA 3P20A 4ZRZA 2ZXOA 4K6LA 2JA8H 1QJOA 1LTSD 1SYGA 2EYFA 1KLUD 4YWMA 3J81c 1PHJA 2FXQA 4F87A 4JYAQ 3CCQA 2CQOA 5KNBA 2Z6KA 1XNQL 1HJPA 1LTAD 1Y1WG 5FOBB 5C0XJ 4HJ8A 5D3DA 2C9OA 2IL8A 4QB4A 1I3QB 5C3EG 2HUGA 5C4XG 1X3EA 5BN3A 4IPCA 5JEAH 2MP1A 3H09A 3GTGH 1JCKB 2SDFA 1XMOQ 3I4MB 1PFBA 2O4XA 3FEWX 3Q0AA 1U5KA 2VUMG 4LFBL 3F2UA 4DR1Q 5CV8A 5HGTA 1GHKA 4C3IG 1E1TA 3IFTA 4ALPA 1U4RA 1S40A 3HG9A 3KJOA 1XXGA 2K14A 4XQQA 4A3JG 4ZLTF 4IUTA 3F1ZA 4UPAA 1A63A 2NZHA 3BYTB 1YNNC 3NTIA 3UE1A 4FP5D 2E8GA 3CQZB 4RCOA 4JI6L 2JP1A 3A74A 4LFCQ 1E2ZA 4P72A 3GTMB 4PMWA 4QUFA 3CCRA 2VZAA 1IW7C 4YHHL 4JPBW 1J5EL 3CPFA 2B2YC 1CFMA 4B08A 1QVCA 1LTTD 4EQPA 3T1HQ 2PZTA 1N33Q 1W6JA 2JXMB 5LMNL 5J3BA 4F8MA 2Z1CA 4NMZA 1PFNA 5M5XH 2EIFA 3T1YL 1CI3M 1PRTD 5COYA 3M4YA 1ILPA 1Q12A 3K7UC 3NEMA 2LXJA 2GA4B 5C44H 4K5XA 4CKBA 3ERSX 1TWFH 1UUPA 2QGQA 3BDLA 1S3OA 2LS01 3ER0A 5EGTA 3MXPA 3L7ZC 2C35B 3P75A 4R1JA 5TSSA 3C1FA 4FO2A 4FVMA 2NZOA 2QCPX 3ZYYX 3E9HA 3PCOB 4Z9CB 2R7DA 2EY6A 3ULLA 3T1HL 3OWFA 4LF9Q 5IP7H 1N9WA 1I6VC 5CBAE 1L1OA 3DEOA 5JAVA 3EJIA 1SNMA 2IW3A 2NVYH 1YNJD 1WD0A 4C1NK 4A75A 1HNZQ 2BA1A 4JW0A 3CCEA 1PRTB 2WINB 1V1PA 1PH9A 3FPPA 4DV5Q 4IN3A 4LK1C 3K80C 4FF1A 3H6MA 3ERQA 2KUMA 1SR3A 5LL6X 2H1EA 5LL6S 1ENAA 1YVCA 2IWHA 1CTMA 4DUZQ 2FHTA 3DHQA 2CW0D 3I7FA 4LFBQ 4POFA 1AH9A 1PYSB 4G7HC 2QDBA 1RKNA 4OO1H 1GOZA 1R4PB 2D62A 3HZXA 3MAQA 4AQYL 4B3RL 1I4GA 1SNQA 2A6EC 4KMUC 3VYTA 1F2LA 1GUTA 4TSSA 3GTJB 4A3JH 3U4VA 2N78A 2K75A 4A3JB 3NWSA 1EZ6A 4DK1A 1CSPA 1SLJA 2HDLA 3CRKC 1WTQA 4JYAL 1WTWA 1F9RA 4A3BH 2V4DA 3SK5A 4OWXB 2E2DC 4RGNA 2PQAA 3MXNB 4KTAA 2EYLA 3CCSA 4U68A 4YWKA 2PPBC 5FO7B 4GLXA 5JVG3 1AFPA 1SE2A 3PUWA 1JB3A 5GROA 4DR2L 4P75A 4Y52H 5E1FA 3RD4A 4A3MH 1STYA 4UDUC 2O5JC 1VQKA 4LUOA 1I4QA 4HMJA 2WP8J 2VUMH 3ITPA 3EBEA 5LMUL 2KEDA 3CW2C 2A1AA 5BN4A 3EA6A 2Z0SA 4P74A 2CQAA 3ONAB 4FF3A 1NJIC 1GO3E 4N8X1 1SMYC 2XIWA 1ESFA 1PLFA 4H13C 3KBGA 2CH4W 4A3KH 3ULPA 1TS5A 4I7AA 1JMCA 2M00A 4A3CH 2UU9L 1QCBD 2JA8G 3I4NB 5I2YA 2E2IB 1A0IA 3T4AC 4A3DG 3VR5A 2OT2A 2SEBD 2R61A 3VA7A 4JBKA 4LMQD 4DAMA 4BY7B 1I4XA 1Q46A 2EYOA 2L4NA 5FJ8H 3SDZA 5IGCA 1PTOF 2N3SA 1WTHA 4JI3Q 1EFID 3I4LA 2OCEA 1LTID 3C1EA 1HNWQ 1SN8A 3JC66 2BOSA 4MTKA 3DMUA 4NXNQ 5LHY1 4FXDA 2Q2HA 3BS1A 3NBHB 5JJKA 1EEID 4X3SA 4K8IA 4PV1C 4ZKBB 4DV2Q 5C3XA 5J1ZA 4RCNA 1K3BC 5IY0A 5E4XA 1LT6D 3P1HA 4GN5A 3OIPA 2K1BA 1CKOA 2IY5B 1G2SA 4FXGC 3DWAA 1II3A 2IHFA 3D3RA 3KLWA 1KTKA 1HTLD 2JSOA 4G7ZC 3WOFA 2WV6D 1HNXL 1GUGA 1BR9A 1YBYA 2PMZB 3J80L 5KNCA 1EIFA 3A56A 4AYBB 3MXNA 2ALYB 5I2XA 1IBMQ 5C0XH 2HT1A 3UDXA 1WI5A 3MEHA 2QEJC 3TP6A 1C0AA 2K04A 4Q5VA 2ZTDA 5FLXL 1TWAB 3HKZB 2MQHA 5FLXc 3A8IE 2VY3A 2XNAC 4KLKA 3RUZA 3GTPH 2EVBA 5BR8L 1G51A 1O78A 4WJ3M 1F77A 1F9PA
chains in the Genus database with same CATH topology
5BR8Q 2HIXA 3J7ZC 3K8AA 3S15H 1VCIA 2IX1A 1VQ9A 1HH2P 3F2CA 1V9PA 3GTLH 4JC0A 1ASZA 3CMEA 1IBKQ 3BZKA 2GVBA 1IYJB 5C44G 4DV4L 3I4NH 3PF5A 4GLVB 1OXVA 1TWCH 3UDFA 3KFUA 5C0XI 1VQJA 1ASYA 1TWAH 4JOIA 3L0OA 4K0KL 2WB1E 2UUCQ 1K8GA 3RN5A 3PUVA 4BBRH 1X3FA 2K5VA 1E1OA 4DR3L 4HIOA 1VQHA 3E0EA 3OTOQ 1PH3A 3G4SA 2MFIA 4LFAL 3PO3G 1X3GA 1KL9A 1K83H 5JEAG 1KQSA 1NE3A 1PH1A 1VQLA 1AE2A 2NN6G 3UDGA 1X54A 4GNXB 1OXSC 4A3BG 3KDFB 1MJCA 4HIDA 4B3TQ 5AJ3L 4NXMQ 1QVGA 4GKJQ 2JA6H 2R93G 4DPGA 4BY7H 1QUQA 4DV3L 1Z47A 5GADC 3G71A 2XTIA 4YY3L 3FHWA 4JI1L 1PH4A 1J5EQ 4JI8Q 3I4MG 3RLFA 1VQ5A 1G291 4IJHA 2LXKA 1WOCA 2E5LL 2OTJA 1FJGQ 3PGZA 2KBNA 4R4IA 1OTCA 1Q8KA 4LFCL 1VQIA 1E24A 4RMFA 3W1GA 4MTNA 2VQEL 1M1KC 4BY1H 5ELOA 4AYBG 4X65L 2E2IH 2ATWA 4A3MG 4KI0A 3ZJYC 2V1CC 2OTLA 1J6QA 2RCNA 2VQFL 1VQ6A 3WWVA 2YTXA 1PH8A 2AHOB 3DM3A 1GM5A 4DR4Q 1D7QA 3S1MH 3M4PA 1QZGA 3RLNA 5HY6A 3E9IA 3AEVA 1EQRA 4EX5A 4L5QA 1LUZA 2AWOA 3STBC 4AQYQ 4A93H 1Y1WH 2ES2A 1VS0A 1XNRQ 2I0QA 4A3IH 2WFWA 4X62Q 4A3EH 4JBMA 2B29A 2DUDA 5IWAL 4DR6Q 2F4VQ 4IFDG 4JI2Q 5M3MG 3HOZG 2KHIA 2ZTEA 5IT9c 3HOXG 2UU9Q 4PZ6A 4HJAA 1XNRL 4LF6Q 1VQOA 1S72A 1Y1VH 2OQ0A 3F8TA 4R4CA 2JEBI 2E2HH 4NB3A 4OWWB 1CKNB 3U50C 4FDBA 4BA2I 1XPRA 2OWOA 1HZCA 5E7NA 4DKAC 1OXXK 3AQQA 3I2ZA 3KDFA 4PZ8A 3RNUA 3PF4A 3GTJH 1GD7A 5M3MH 3HOZH 4DR4L 2YTYA 3S1NH 1OXTA 1Z9FA 1PFSA 1JJ2A 1C9OA 2VQFQ 1KD1C 4DAYB 1XNQQ 1X65A 3CMAA 4A3LG 2JK8A 2RF4A 4DNIA 2JA7H 4LF7L 4Y7NH 4A3GG 4PZ7A 1SMXA 2R92H 2R7FA 1NMGA 4X65Q 1HR0W 3OW2A 1VQ4A 1VQFA 3CCVA 4QGUA 4A3EG 4A3IG 3CCMA 1B70B 1EYGA 1KC8C 1SE8A 1X55A 1EIYB 3HOUG 4JBWA 1FGUA 1WCMH 4OX9Q 4JV5Q 2KCTA 2BA0A 4BBSH 1FVIA 4DV7Q 2K50A 1SROA 1JJCB 3PUZA 2CFMA 4JI1Q 4AIMA 5LMNW 1M90C 4LF5Q 4A3FG 4IPGA 1H95A 1FL0A 4DV3Q 3S1RH 2ZTCA 4ME3A 4GNXC 2KENA 1X6OA 4NPSA 2HHHL 1HR0Q 2B63G 1CUKA 2EXDA 3H15A 5AJ3Q 1BKBA 1E7ZA 3CD6A 4DK6C 3S17H 4LF5L 5JJIA 1Q7YC 4A3KG 3GD7A 3GTMH 2UXCQ 4OXPA 2N49A 1N34Q 3HOWG 4JV5L 1IZ6A 4B3ML 1A8VA 1X56A 2JA8H 4RG1A 3TS2A 3CPWA 1JB7A 4APVA 2RHQB 2ID0A 1K0RA 4MNOA 4YWMA 3PUXA 3J81c 1PHJA 2FXQA 2MO0A 1VQNA 4JYAQ 2AMCB 4C3IH 2CQOA 3CCQA 2Z6KA 1PH5A 1XNQL 3RZOH 1HJPA 3B6YA 4LW1A 1Y1WG 4IFDJ 4R4OA 3LGJA 5C0XJ 2ZM6Q 2UUAL 4HJ8A 2A8VA 4IOAA 3GTQH 1YEZA 4C2MH 5LMNQ 2WAQE 3AFPA 4UP7A 3I55A 2I5LX 3D0FA 3H0GG 3TQYA 5C3EG 3HKSA 3I56A 4OO1G 5C4XG 1X3EA 4IPCA 3S2DH 1CSQA 1EWIA 2QEXA 4DR7Q 4X66Q 1N33L 3GTGH 4O0AA 1XMOQ 1UE5A 4A93G 1EFWA 4UP9A 1QVFA 4JI4L 4B3SQ 1I50H 2F4VL 3H3VH 1U5KA 2VUMG 1UE7A 4LFBL 4DR6L 1YIJA 2RHSB 4OONA 1YNXA 2DGYA 4BXXH 2VL6A 3J81j 4DV6Q 4DR1Q 1AE3A 4LF4Q 1UE1A 2UXBL 1KAWA 1E1TA 2XGTA 4UP8A 1IBML 3K7AH 4ALPA 3PSIA 1BBWA 1S40A 5IP7G 1Q81C 2UXDQ 3KJOA 1U0LA 1I94L 4L5SA 1WYDA 2BH8A 1XTDA 2K14A 4AH6A 1SFOH 2HQLA 4A3JG 2LSSA 1PH6A 3G48A 3F1ZA 4UPAA 1L0WA 1A63A 2NZHA 4X6AH 1VQEA 3A0JA 3PUYA 3UE1A 5C4XH 4BY1G 2ZJPA 3CCJA 4LUZA 4OWTB 2E8GA 2VQEQ 2ASBA 3FKIH 4JI6L 1VQAA 1P8LA 3A74A 4LFCQ 1DGSA 4LF4L 4P72A 2JA9A 4DR1L 2B63H 3FP9A 1PVOA 4PMWA 3M3YH 3CCRA 3M4OH 2VZAA 2JA5H 4JI0L 4YHHL 4GKKL 1UEBA 3BJUA 3CPFA 1J5EL 4BXXG 4B3SL 3T1HQ 1QVCA 5IE8A 4JOIC 3FKIG 1EOVA 1LM0A 2PNHA 2IT1A 4DV2L 2Q2TA 3CC4A 1I5FA 1N33Q 3HOWH 2YYZA 3STBD 1YI2A 3KF8B 2R6GA 1K3RA 4GKJL 4NXML 1L1OC 1MKHA 4B3TL 2PI2E 5LMNL 5J3BA 1A62A 4LWCA 3M4QA 1N36Q 5GAHC 2B3GA 2ZM6L 4TVAB 2MNAA 1MIUA 1HNWL 4KHPQ 3TREA 4GS3A 5M5XH 3T1YL 2EIFA 5C0XG 3CCLA 3W1BA 1K9MC 3A5UA 2N8NA 2KHJA 1YHAA 5GAGC 1Q12A 5M5YH 3K7UC 3NEMA 2LXJA 4IO9A 3RR5A 3SGIA 3GTKH 5C44H 3ERSX 1TWFH 4BBSG 3AYHB 2QGQA 4C3JH 4EQ5A 4L5TA 4B3MQ 2AKWB 4YCWA 4HJ7A 2JE6I 2D0OA 1S3OA 1N34L 4UY8C 3ER0A 4A3GH 4LUVA 3L7ZC 2C35B 4R1JA 3NELA 4BBRG 1XMQQ 1N36L 2JEAI 4P73A 1UE6A 2NZOA 3GTOH 1L2FA 2I5HA 3E9HA 3PCOB 2BH2A 1PH7A 3M7NA 2R7DA 3PO3H 2HHHQ 2K5NA 1GVPA 3HOUH 4HIMA 3ULLA 2K52A 3BZCA 2Q2IA 2PI2A 2UUBL 4QJFA 3HFZB 3JAMc 3T1HL 1VQCA 4LF9Q 2UXDL 1NTGA 4DR5Q 1NY4A 5IP7H 1N9WA 2F3IA 2F52A 2H5XA 4TQUS 3F2DA 3DLLA 4JI0Q 1JE5A 2AWNA 4OX9L 4A3CG 1L1OA 2Y0SE 1KIXA 1JJGA 2NVYH 4GKKQ 1IXRA 1KXLA 5HGQA 1QZHA 2OQKA 1QUQB 4OO1I 1NBWA 4A75A 4LNQA 4WJ4A 1XPOA 4AYBE 4IOCA 1VQGA 2BA1A 1HNZQ 4LF7Q 1O7IA 1XPUA 3PO2G 2ZJRA 2YV5A 3CCEA 3S1QH 2WAQG 1HNXQ 5LMUQ 3HOVH 3H0GH 5M3FG 1NMFA 1PH9A 1I94Q 2JA5G 4DV5Q 1I3QH 1T9HA 2GVAA 3K80C 2JA6G 3HOYG 1RL2A 1SR3A 4BY7G 2UXBQ 1YVCA 3ICEA 2R92G 2NN6I 2IHEA 4GOPC 4DUZQ 4DV0L 4DV6L 2YTVA 4LF6L 4JI5L 3I7FA 4LFBQ 4POFA 4GN3B 1P16A 5FLMH 1PYBA 3CXCA 4JI2L 4JI4Q 1AH9A 1PYSB 3PIPA 1WCMG 3CAMA 1KRTA 5C3EH 4DR2Q 1IBLQ 3I4NG 1BBUA 1Q1BA 3BU2A 4X66L 2D62A 4R4QA 4AQYL 4B3RL 5H1SE 3PO2H 4QL5A 2CKZB 1TWGH 3KJPA 3CCUA 1CKMA 4IJLA 1G6PA 4A3JH 2UUAQ 5IYCH 3U4VA 2N78A 2K75A 4LF8Q 1Y1VG 2MO1A 3HKZG 3ULJA 1L1OB 3HOYH 3HKZE 1HZ9A 2JQOA 4DUYL 1YJNA 2NVXH 1PV4A 1W3SA 3TRZA 1N32L 4DR7L 1CSPA 1SLJA 3K81C 4JYAL 3K0XA 3S24A 1N8RC 4X64Q 1K73C 4A3BH 4DK3C 4LF8L 5IYCG 4OWXB 4QY7A 2Q2UA 4J15A 5FLMG 2E5LQ 3J80i 2R93H 2PQAA 3S14H 1PH2A 3AFQA 3MXNB 1KRSA 4JI8L 3CCSA 4YWKA 3L2PA 4GNXA 4B3RQ 2UXCL 5EAYA 4H02A 1OXUA 2PQAB 4GLXA 4YY3Q 1VQMA 3PUWA 4P71A 3F2BA 2HIVA 1IBLL 5GROA 4DR2L 4P75A 4QIWE 4GOPB 2VW9A 1HR0L 3I4OA 4Y52H 4JI5Q 4O2DA 5IP9H 3S2HH 1Q86C 3KF6A 4DUZL 5IYDH 3S16H 3NENA 4DV7L 2K4KA 3TEHB 3A5ZB 4A3MH 4C3HH 3G6EA 1Q82C 1VQKA 4LUOA 1HZAA 3RLOA 2WP8J 2VUMH 4LFAQ 1HZBA 3M85A 5M3FH 4HJ5A 3EBEA 5LMUL 4QQBX 3CW2C 4DR3Q 4PG3A 4A76A 2A1AA 2D0PA 1EQQA 1VQDA 2Z0SA 1W2BA 4R4TA 3IRBA 4P74A 1C7YA 1UWVA 1V1QA 1YZ6A 3GDEA 4DV4Q 1X9NA 1NJIC 1JT8A 3GO5A 3KYHC 1WFQA 2PMZE 4BA1I 3W5OA 4XTCS 3Q8DA 1WJJA 1VQ8A 1GO3E 1GKHA 3H3VI 2EQSA 4A3KH 1RIPA 2CWPA 4YCUA 3ULPA 3I4MH 4POGA 4A3DH 5IYBH 1JMCA 4A3CH 4GLAC 1E22A 4DV1Q 1YITA 2UU9L 2QA4A 1V43A 5IWAQ 2JA8G 4X62L 2VS1A 1A0IA 2R7ZG 1XMQL 1MJEA 4A3DG 2JA7G 1VQ7A 2NVTH 1YHQA 1YJWA 4IPDA 2NVQH 4JBKA 1VQBA 1E3PA 4DAMA 3CF5A 3CC7A 1YHBA 5DLQE 4JCVE 1Q46A 4IPHA 5FJ8H 5M5WH 2Y0SG 4X64L 5C4JH 2N3SA 4JI3Q 4L5RC 4YWLA 2OCEA 4DUYQ 3T1YQ 1N32Q 4KHPL 1HNWQ 5IYBG 1SN8A 3JC66 4JI7L 2VNUD 1FJGL 4NXNQ 5JJLA 2A19A 2Q2HA 5IP9G 3EN2A 3M9BA 2WB1G 5IYDG 1KHIA 3NBHB 4GOPA 5JJKA 2GN5A 3U58A 4DV2Q 5JEAJ 3D31A 1VQPA 1BVSA 3U4ZA 3OYYA 1TXYA 2K5HA 5IY0A 3RN2A 4YHHQ 1PA6A 1XJVA 2I5MX 4GN5A 3JAMi 1LYLA 4GN4B 1R9TH 4XIGS 5FJ8G 4HIKA 1CKOA 4DV0Q 2IY5B 4NXNL 4HJ9A 2JJQA 4A3LH 4JI7Q 3J81i 4JI6Q 5GQOA 3KF6B 3KOJA 4JG2A 2IHFA 4JBJA 1YJ9A 4KHZA 1I6HH 3KLWA 2YU9H 4YCVA 4DV5L 4JI3L 3OTOL 1HNXL 3RZDH 1YBYA 4IFDI 2KCMA 1B7YB 3J80c 3UDIA 5ELNA 3TS0A 2UUCL 1EIFA 2IX0A 3PIOA 1HNZL 2ZJQA 4K0KQ 2ALYB 2HT1A 1IBMQ 3UDXA 1K8AC 1WI5A 1Q1EA 4A3FH 3MEFA 3VDYA 3CQZH 2L15A 1C0AA 3PV0A 1IBKL 2ZTDA 2CWAA 1Y14B 2E2JH 5GAEC 3UE0A 1D8LA 1EUJA 2MQHA 5FLXc 4MZ9A 3HOXH 3HOVG 4WJ3M 1TWHH 2VY3A 4KLKA 3J7A5 5K36G 4A4IA 3GTPH 4DR5L 3EIVA 4LF9L 5BR8L 4DV1L 1CKNA 1G51A 2R7ZH 1XMOL 2CCZA 2UUBQ 3CC2A 1SRUA 1B8AA 2Z6KC 1LTLA 3CP0A 1IL2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BR8 Q;  2HIX A;  3J7Z C;  3K8A A;  3S15 H;  1VCI A;  2IX1 A;  1VQ9 A;  1HH2 P;  3F2C A;  1V9P A;  3GTL H;  4JC0 A;  1ASZ A;  3CME A;  1IBK Q;  3BZK A;  2GVB A;  1IYJ B;  5C44 G;  4DV4 L;  3I4N H;  3PF5 A;  4GLV B;  1OXV A;  1TWC H;  3UDF A;  3KFU A;  5C0X I;  1VQJ A;  1ASY A;  1TWA H;  4JOI A;  3L0O A;  4K0K L;  2WB1 E;  2UUC Q;  1K8G A;  3RN5 A;  3PUV A;  4BBR H;  1X3F A;  2K5V A;  1E1O A;  4DR3 L;  4HIO A;  1VQH A;  3E0E A;  3OTO Q;  1PH3 A;  3G4S A;  2MFI A;  4LFA L;  3PO3 G;  1X3G A;  1KL9 A;  1K83 H;  5JEA G;  1KQS A;  1NE3 A;  1PH1 A;  1VQL A;  1AE2 A;  2NN6 G;  3UDG A;  1X54 A;  4GNX B;  1OXS C;  4A3B G;  3KDF B;  1MJC A;  4HID A;  4B3T Q;  5AJ3 L;  4NXM Q;  1QVG A;  4GKJ Q;  2JA6 H;  2R93 G;  4DPG A;  4BY7 H;  1QUQ A;  4DV3 L;  1Z47 A;  5GAD C;  3G71 A;  2XTI A;  4YY3 L;  3FHW A;  4JI1 L;  1PH4 A;  1J5E Q;  4JI8 Q;  3I4M G;  3RLF A;  1VQ5 A;  1G29 1;  4IJH A;  2LXK A;  1WOC A;  2E5L L;  2OTJ A;  1FJG Q;  3PGZ A;  2KBN A;  4R4I A;  1OTC A;  1Q8K A;  4LFC L;  1VQI A;  1E24 A;  4RMF A;  3W1G A;  4MTN A;  2VQE L;  1M1K C;  4BY1 H;  5ELO A;  4AYB G;  4X65 L;  2E2I H;  2ATW A;  4A3M G;  4KI0 A;  3ZJY C;  2V1C C;  2OTL A;  1J6Q A;  2RCN A;  2VQF L;  1VQ6 A;  3WWV A;  2YTX A;  1PH8 A;  2AHO B;  3DM3 A;  1GM5 A;  4DR4 Q;  1D7Q A;  3S1M H;  3M4P A;  1QZG A;  3RLN A;  5HY6 A;  3E9I A;  3AEV A;  1EQR A;  4EX5 A;  4L5Q A;  1LUZ A;  2AWO A;  3STB C;  4AQY Q;  4A93 H;  1Y1W H;  2ES2 A;  1VS0 A;  1XNR Q;  2I0Q A;  4A3I H;  2WFW A;  4X62 Q;  4A3E H;  4JBM A;  2B29 A;  2DUD A;  5IWA L;  4DR6 Q;  2F4V Q;  4IFD G;  4JI2 Q;  5M3M G;  3HOZ G;  2KHI A;  2ZTE A;  5IT9 c;  3HOX G;  2UU9 Q;  4PZ6 A;  4HJA A;  1XNR L;  4LF6 Q;  1VQO A;  1S72 A;  1Y1V H;  2OQ0 A;  3F8T A;  4R4C A;  2JEB I;  2E2H H;  4NB3 A;  4OWW B;  1CKN B;  3U50 C;  4FDB A;  4BA2 I;  1XPR A;  2OWO A;  1HZC A;  5E7N A;  4DKA C;  1OXX K;  3AQQ A;  3I2Z A;  3KDF A;  4PZ8 A;  3RNU A;  3PF4 A;  3GTJ H;  1GD7 A;  5M3M H;  3HOZ H;  4DR4 L;  2YTY A;  3S1N H;  1OXT A;  1Z9F A;  1PFS A;  1JJ2 A;  1C9O A;  2VQF Q;  1KD1 C;  4DAY B;  1XNQ Q;  1X65 A;  3CMA A;  4A3L G;  2JK8 A;  2RF4 A;  4DNI A;  2JA7 H;  4LF7 L;  4Y7N H;  4A3G G;  4PZ7 A;  1SMX A;  2R92 H;  2R7F A;  1NMG A;  4X65 Q;  1HR0 W;  3OW2 A;  1VQ4 A;  1VQF A;  3CCV A;  4QGU A;  4A3E G;  4A3I G;  3CCM A;  1B70 B;  1EYG A;  1KC8 C;  1SE8 A;  1X55 A;  1EIY B;  3HOU G;  4JBW A;  1FGU A;  1WCM H;  4OX9 Q;  4JV5 Q;  2KCT A;  2BA0 A;  4BBS H;  1FVI A;  4DV7 Q;  2K50 A;  1SRO A;  1JJC B;  3PUZ A;  2CFM A;  4JI1 Q;  4AIM A;  5LMN W;  1M90 C;  4LF5 Q;  4A3F G;  4IPG A;  1H95 A;  1FL0 A;  4DV3 Q;  3S1R H;  2ZTC A;  4ME3 A;  4GNX C;  2KEN A;  1X6O A;  4NPS A;  2HHH L;  1HR0 Q;  2B63 G;  1CUK A;  2EXD A;  3H15 A;  5AJ3 Q;  1BKB A;  1E7Z A;  3CD6 A;  4DK6 C;  3S17 H;  4LF5 L;  5JJI A;  1Q7Y C;  4A3K G;  3GD7 A;  3GTM H;  2UXC Q;  4OXP A;  2N49 A;  1N34 Q;  3HOW G;  4JV5 L;  1IZ6 A;  4B3M L;  1A8V A;  1X56 A;  2JA8 H;  4RG1 A;  3TS2 A;  3CPW A;  1JB7 A;  4APV A;  2RHQ B;  2ID0 A;  1K0R A;  4MNO A;  4YWM A;  3PUX A;  3J81 c;  1PHJ A;  2FXQ A;  2MO0 A;  1VQN A;  4JYA Q;  2AMC B;  4C3I H;  2CQO A;  3CCQ A;  2Z6K A;  1PH5 A;  1XNQ L;  3RZO H;  1HJP A;  3B6Y A;  4LW1 A;  1Y1W G;  4IFD J;  4R4O A;  3LGJ A;  5C0X J;  2ZM6 Q;  2UUA L;  4HJ8 A;  2A8V A;  4IOA A;  3GTQ H;  1YEZ A;  4C2M H;  5LMN Q;  2WAQ E;  3AFP A;  4UP7 A;  3I55 A;  2I5L X;  3D0F A;  3H0G G;  3TQY A;  5C3E G;  3HKS A;  3I56 A;  4OO1 G;  5C4X G;  1X3E A;  4IPC A;  3S2D H;  1CSQ A;  1EWI A;  2QEX A;  4DR7 Q;  4X66 Q;  1N33 L;  3GTG H;  4O0A A;  1XMO Q;  1UE5 A;  4A93 G;  1EFW A;  4UP9 A;  1QVF A;  4JI4 L;  4B3S Q;  1I50 H;  2F4V L;  3H3V H;  1U5K A;  2VUM G;  1UE7 A;  4LFB L;  4DR6 L;  1YIJ A;  2RHS B;  4OON A;  1YNX A;  2DGY A;  4BXX H;  2VL6 A;  3J81 j;  4DV6 Q;  4DR1 Q;  1AE3 A;  4LF4 Q;  1UE1 A;  2UXB L;  1KAW A;  1E1T A;  2XGT A;  4UP8 A;  1IBM L;  3K7A H;  4ALP A;  3PSI A;  1BBW A;  1S40 A;  5IP7 G;  1Q81 C;  2UXD Q;  3KJO A;  1U0L A;  1I94 L;  4L5S A;  1WYD A;  2BH8 A;  1XTD A;  2K14 A;  4AH6 A;  1SFO H;  2HQL A;  4A3J G;  2LSS A;  1PH6 A;  3G48 A;  3F1Z A;  4UPA A;  1L0W A;  1A63 A;  2NZH A;  4X6A H;  1VQE A;  3A0J A;  3PUY A;  3UE1 A;  5C4X H;  4BY1 G;  2ZJP A;  3CCJ A;  4LUZ A;  4OWT B;  2E8G A;  2VQE Q;  2ASB A;  3FKI H;  4JI6 L;  1VQA A;  1P8L A;  3A74 A;  4LFC Q;  1DGS A;  4LF4 L;  4P72 A;  2JA9 A;  4DR1 L;  2B63 H;  3FP9 A;  1PVO A;  4PMW A;  3M3Y H;  3CCR A;  3M4O H;  2VZA A;  2JA5 H;  4JI0 L;  4YHH L;  4GKK L;  1UEB A;  3BJU A;  3CPF A;  1J5E L;  4BXX G;  4B3S L;  3T1H Q;  1QVC A;  5IE8 A;  4JOI C;  3FKI G;  1EOV A;  1LM0 A;  2PNH A;  2IT1 A;  4DV2 L;  2Q2T A;  3CC4 A;  1I5F A;  1N33 Q;  3HOW H;  2YYZ A;  3STB D;  1YI2 A;  3KF8 B;  2R6G A;  1K3R A;  4GKJ L;  4NXM L;  1L1O C;  1MKH A;  4B3T L;  2PI2 E;  5LMN L;  5J3B A;  1A62 A;  4LWC A;  3M4Q A;  1N36 Q;  5GAH C;  2B3G A;  2ZM6 L;  4TVA B;  2MNA A;  1MIU A;  1HNW L;  4KHP Q;  3TRE A;  4GS3 A;  5M5X H;  3T1Y L;  2EIF A;  5C0X G;  3CCL A;  3W1B A;  1K9M C;  3A5U A;  2N8N A;  2KHJ A;  1YHA A;  5GAG C;  1Q12 A;  5M5Y H;  3K7U C;  3NEM A;  2LXJ A;  4IO9 A;  3RR5 A;  3SGI A;  3GTK H;  5C44 H;  3ERS X;  1TWF H;  4BBS G;  3AYH B;  2QGQ A;  4C3J H;  4EQ5 A;  4L5T A;  4B3M Q;  2AKW B;  4YCW A;  4HJ7 A;  2JE6 I;  2D0O A;  1S3O A;  1N34 L;  4UY8 C;  3ER0 A;  4A3G H;  4LUV A;  3L7Z C;  2C35 B;  4R1J A;  3NEL A;  4BBR G;  1XMQ Q;  1N36 L;  2JEA I;  4P73 A;  1UE6 A;  2NZO A;  3GTO H;  1L2F A;  2I5H A;  3E9H A;  3PCO B;  2BH2 A;  1PH7 A;  3M7N A;  2R7D A;  3PO3 H;  2HHH Q;  2K5N A;  1GVP A;  3HOU H;  4HIM A;  3ULL A;  2K52 A;  3BZC A;  2Q2I A;  2PI2 A;  2UUB L;  4QJF A;  3HFZ B;  3JAM c;  3T1H L;  1VQC A;  4LF9 Q;  2UXD L;  1NTG A;  4DR5 Q;  1NY4 A;  5IP7 H;  1N9W A;  2F3I A;  2F52 A;  2H5X A;  4TQU S;  3F2D A;  3DLL A;  4JI0 Q;  1JE5 A;  2AWN A;  4OX9 L;  4A3C G;  1L1O A;  2Y0S E;  1KIX A;  1JJG A;  2NVY H;  4GKK Q;  1IXR A;  1KXL A;  5HGQ A;  1QZH A;  2OQK A;  1QUQ B;  4OO1 I;  1NBW A;  4A75 A;  4LNQ A;  4WJ4 A;  1XPO A;  4AYB E;  4IOC A;  1VQG A;  2BA1 A;  1HNZ Q;  4LF7 Q;  1O7I A;  1XPU A;  3PO2 G;  2ZJR A;  2YV5 A;  3CCE A;  3S1Q H;  2WAQ G;  1HNX Q;  5LMU Q;  3HOV H;  3H0G H;  5M3F G;  1NMF A;  1PH9 A;  1I94 Q;  2JA5 G;  4DV5 Q;  1I3Q H;  1T9H A;  2GVA A;  3K80 C;  2JA6 G;  3HOY G;  1RL2 A;  1SR3 A;  4BY7 G;  2UXB Q;  1YVC A;  3ICE A;  2R92 G;  2NN6 I;  2IHE A;  4GOP C;  4DUZ Q;  4DV0 L;  4DV6 L;  2YTV A;  4LF6 L;  4JI5 L;  3I7F A;  4LFB Q;  4POF A;  4GN3 B;  1P16 A;  5FLM H;  1PYB A;  3CXC A;  4JI2 L;  4JI4 Q;  1AH9 A;  1PYS B;  3PIP A;  1WCM G;  3CAM A;  1KRT A;  5C3E H;  4DR2 Q;  1IBL Q;  3I4N G;  1BBU A;  1Q1B A;  3BU2 A;  4X66 L;  2D62 A;  4R4Q A;  4AQY L;  4B3R L;  5H1S E;  3PO2 H;  4QL5 A;  2CKZ B;  1TWG H;  3KJP A;  3CCU A;  1CKM A;  4IJL A;  1G6P A;  4A3J H;  2UUA Q;  5IYC H;  3U4V A;  2N78 A;  2K75 A;  4LF8 Q;  1Y1V G;  2MO1 A;  3HKZ G;  3ULJ A;  1L1O B;  3HOY H;  3HKZ E;  1HZ9 A;  2JQO A;  4DUY L;  1YJN A;  2NVX H;  1PV4 A;  1W3S A;  3TRZ A;  1N32 L;  4DR7 L;  1CSP A;  1SLJ A;  3K81 C;  4JYA L;  3K0X A;  3S24 A;  1N8R C;  4X64 Q;  1K73 C;  4A3B H;  4DK3 C;  4LF8 L;  5IYC G;  4OWX B;  4QY7 A;  2Q2U A;  4J15 A;  5FLM G;  2E5L Q;  3J80 i;  2R93 H;  2PQA A;  3S14 H;  1PH2 A;  3AFQ A;  3MXN B;  1KRS A;  4JI8 L;  3CCS A;  4YWK A;  3L2P A;  4GNX A;  4B3R Q;  2UXC L;  5EAY A;  4H02 A;  1OXU A;  2PQA B;  4GLX A;  4YY3 Q;  1VQM A;  3PUW A;  4P71 A;  3F2B A;  2HIV A;  1IBL L;  5GRO A;  4DR2 L;  4P75 A;  4QIW E;  4GOP B;  2VW9 A;  1HR0 L;  3I4O A;  4Y52 H;  4JI5 Q;  4O2D A;  5IP9 H;  3S2H H;  1Q86 C;  3KF6 A;  4DUZ L;  5IYD H;  3S16 H;  3NEN A;  4DV7 L;  2K4K A;  3TEH B;  3A5Z B;  4A3M H;  4C3H H;  3G6E A;  1Q82 C;  1VQK A;  4LUO A;  1HZA A;  3RLO A;  2WP8 J;  2VUM H;  4LFA Q;  1HZB A;  3M85 A;  5M3F H;  4HJ5 A;  3EBE A;  5LMU L;  4QQB X;  3CW2 C;  4DR3 Q;  4PG3 A;  4A76 A;  2A1A A;  2D0P A;  1EQQ A;  1VQD A;  2Z0S A;  1W2B A;  4R4T A;  3IRB A;  4P74 A;  1C7Y A;  1UWV A;  1V1Q A;  1YZ6 A;  3GDE A;  4DV4 Q;  1X9N A;  1NJI C;  1JT8 A;  3GO5 A;  3KYH C;  1WFQ A;  2PMZ E;  4BA1 I;  3W5O A;  4XTC S;  3Q8D A;  1WJJ A;  1VQ8 A;  1GO3 E;  1GKH A;  3H3V I;  2EQS A;  4A3K H;  1RIP A;  2CWP A;  4YCU A;  3ULP A;  3I4M H;  4POG A;  4A3D H;  5IYB H;  1JMC A;  4A3C H;  4GLA C;  1E22 A;  4DV1 Q;  1YIT A;  2UU9 L;  2QA4 A;  1V43 A;  5IWA Q;  2JA8 G;  4X62 L;  2VS1 A;  1A0I A;  2R7Z G;  1XMQ L;  1MJE A;  4A3D G;  2JA7 G;  1VQ7 A;  2NVT H;  1YHQ A;  1YJW A;  4IPD A;  2NVQ H;  4JBK A;  1VQB A;  1E3P A;  4DAM A;  3CF5 A;  3CC7 A;  1YHB A;  5DLQ E;  4JCV E;  1Q46 A;  4IPH A;  5FJ8 H;  5M5W H;  2Y0S G;  4X64 L;  5C4J H;  2N3S A;  4JI3 Q;  4L5R C;  4YWL A;  2OCE A;  4DUY Q;  3T1Y Q;  1N32 Q;  4KHP L;  1HNW Q;  5IYB G;  1SN8 A;  3JC6 6;  4JI7 L;  2VNU D;  1FJG L;  4NXN Q;  5JJL A;  2A19 A;  2Q2H A;  5IP9 G;  3EN2 A;  3M9B A;  2WB1 G;  5IYD G;  1KHI A;  3NBH B;  4GOP A;  5JJK A;  2GN5 A;  3U58 A;  4DV2 Q;  5JEA J;  3D31 A;  1VQP A;  1BVS A;  3U4Z A;  3OYY A;  1TXY A;  2K5H A;  5IY0 A;  3RN2 A;  4YHH Q;  1PA6 A;  1XJV A;  2I5M X;  4GN5 A;  3JAM i;  1LYL A;  4GN4 B;  1R9T H;  4XIG S;  5FJ8 G;  4HIK A;  1CKO A;  4DV0 Q;  2IY5 B;  4NXN L;  4HJ9 A;  2JJQ A;  4A3L H;  4JI7 Q;  3J81 i;  4JI6 Q;  5GQO A;  3KF6 B;  3KOJ A;  4JG2 A;  2IHF A;  4JBJ A;  1YJ9 A;  4KHZ A;  1I6H H;  3KLW A;  2YU9 H;  4YCV A;  4DV5 L;  4JI3 L;  3OTO L;  1HNX L;  3RZD H;  1YBY A;  4IFD I;  2KCM A;  1B7Y B;  3J80 c;  3UDI A;  5ELN A;  3TS0 A;  2UUC L;  1EIF A;  2IX0 A;  3PIO A;  1HNZ L;  2ZJQ A;  4K0K Q;  2ALY B;  2HT1 A;  1IBM Q;  3UDX A;  1K8A C;  1WI5 A;  1Q1E A;  4A3F H;  3MEF A;  3VDY A;  3CQZ H;  2L15 A;  1C0A A;  3PV0 A;  1IBK L;  2ZTD A;  2CWA A;  1Y14 B;  2E2J H;  5GAE C;  3UE0 A;  1D8L A;  1EUJ A;  2MQH A;  5FLX c;  4MZ9 A;  3HOX H;  3HOV G;  4WJ3 M;  1TWH H;  2VY3 A;  4KLK A;  3J7A 5;  5K36 G;  4A4I A;  3GTP H;  4DR5 L;  3EIV A;  4LF9 L;  5BR8 L;  4DV1 L;  1CKN A;  1G51 A;  2R7Z H;  1XMO L;  2CCZ A;  2UUB Q;  3CC2 A;  1SRU A;  1B8A A;  2Z6K C;  1LTL A;  3CP0 A;  1IL2 A; 
#chains in the Genus database with same CATH topology
 3DXJ C;  3QR8 A;  1DJR D;  1B1Z A;  4ZYS A;  2F0N A;  1DXM A;  4PNY A;  2A73 B;  3CME A;  2GVB A;  4C1N I;  1IYJ B;  1SNO A;  4XYO A;  3TSS A;  5C0X I;  3L0O A;  2UUC Q;  1FYC A;  3CRL C;  3RN5 A;  3PUV A;  4BBR H;  2K5V A;  5HUR A;  1E1O A;  3NQT A;  2M9V A;  4M1U B;  1EY0 A;  4LFA L;  1TU2 B;  2AQ1 B;  3PO3 G;  1QIL A;  1ML0 D;  5JEA G;  3BVM A;  1QNK A;  1NE3 A;  1PH1 A;  1AE2 A;  1X54 A;  4GNX B;  1OXS C;  3J81 E;  4A3B G;  1I4H A;  2F4I A;  4NXM Q;  4GKJ Q;  2JA6 H;  1EL0 A;  5F2D A;  4BY7 H;  2PO4 A;  3TBI B;  3MC0 B;  4YY3 L;  2JA6 B;  3U9S A;  1PH4 A;  3P7J A;  3KLS X;  1VQ5 A;  3NWT A;  1NAP A;  2A68 C;  5I6W A;  4RMF A;  4BY1 H;  4X65 L;  3NBI A;  4A3M G;  1ZXT A;  1BCP F;  1B44 D;  2RCN A;  4OEL B;  1VQ6 A;  3WWV A;  3DM3 A;  1GM5 A;  4ZUJ A;  1ENC A;  1HUM A;  3S1M H;  3VYR A;  1QZG A;  1SND A;  3AEV A;  4EX5 A;  4L5Q A;  2AWO A;  3STB C;  4A93 H;  1ESR A;  1Y1W H;  4A3E H;  4X62 Q;  3HP3 A;  2B29 A;  2DUD A;  3HOZ G;  4DAV A;  1TWH B;  1U4L A;  3OMG A;  1Y1V H;  2A6H D;  2E2H H;  3A8J E;  4N8F A;  4OWW B;  1TS2 A;  1VDZ A;  5I9P A;  3GTP B;  1ICF B;  1QNU A;  3SHL A;  5E7N A;  3G6J B;  2RSO A;  1HQM C;  3GTJ H;  1GD7 A;  2NB0 A;  1OXT A;  1STB A;  1PFS A;  5A35 A;  2VQF Q;  1KD1 C;  1RCV D;  3CMA A;  4A3L G;  2JK8 A;  4A3I B;  1LTR D;  2XWJ B;  4DNI A;  1HXY D;  4LF7 L;  1ZKO A;  4Y7N H;  4UHV A;  1SMX A;  1HR0 W;  1VQ4 A;  3WDN A;  4CJ0 B;  2FFK B;  1SE4 A;  2F3W A;  4A3E G;  3CCM A;  4H7B A;  4FYD A;  5EPK A;  1G8Z D;  4DN4 M;  1FGU A;  3VR3 A;  2F0U A;  4BBS H;  3HGB A;  1FVI A;  2UXD Q;  2K50 A;  1SRO A;  4JI1 Q;  3PUZ A;  1M90 C;  1BCP D;  4IPG A;  3S1R H;  4ME3 A;  3TZU A;  2F0T A;  2B63 G;  2HHH L;  1CUK A;  1A3T A;  5AJ3 Q;  4F7X A;  3CD6 A;  2KJX A;  5JJI A;  3DM1 A;  2BE5 D;  1N34 Q;  3HOW G;  5T1G A;  1A8V A;  3CPW A;  2VB2 X;  2RHQ B;  4GZY C;  3RZO B;  1PH5 A;  3WOE A;  1LAB A;  1TY2 A;  1HHV A;  1EY4 A;  2NWG A;  4LW1 A;  4IFD J;  1D5M C;  4IOA A;  3LGJ A;  2KEE A;  2UUA L;  1D6E C;  1SYF A;  3AFP A;  3H0G G;  3I56 A;  4OO1 G;  3QWN A;  4EVO A;  3MXG A;  3BZD B;  4M8A A;  3S1M B;  1TWG B;  4DR7 Q;  1KAA A;  4DK0 A;  5IGF A;  4O0A A;  2EZV A;  1EFW A;  4UP9 A;  1QVF A;  4JI4 L;  1QE6 A;  1I50 H;  4B3S Q;  1UE7 A;  5C5M A;  4IUU A;  3K58 A;  3OIQ A;  2RHS B;  2VL6 A;  3BVG A;  4DV6 Q;  3O13 A;  3A7L A;  1AE3 A;  3DWQ A;  4LF4 Q;  1EIH A;  2F0G A;  2UXB L;  3TP5 A;  1SYB A;  2F0E A;  2B2W A;  4K2K A;  4IAL A;  5IP7 G;  4DNT B;  1I94 L;  2K32 A;  4AH6 A;  3I72 A;  2LSS A;  4G7O C;  3G48 A;  1MI2 A;  3EFX D;  2XSC A;  1S5E D;  1VQE A;  3PUY A;  3S1N B;  1BCP C;  1SSO A;  1DGS A;  4LF4 L;  2JA9 A;  3W2D A;  4MIU A;  3FP9 A;  1PVO A;  3M3Y H;  3M4O H;  1FD7 D;  3MZ5 A;  2A5H A;  1UEB A;  3BJU A;  3C2P A;  4B3S L;  2HQE A;  4OIJ A;  1LLR D;  4JOI C;  1LM0 A;  1I5F A;  2YYZ A;  2RBM A;  1U9R A;  2R6G A;  4GKJ L;  4KY6 A;  4NXM L;  1CA6 A;  3E0J A;  1L1O C;  1MKH A;  2PI2 E;  3VYU A;  3M4Q A;  1N36 Q;  5EKL A;  3TRE A;  4GS3 A;  1QOH A;  1YHA A;  5GAG C;  3RZD B;  3J7A V;  2B8G A;  4BBS G;  3AYH B;  1IHZ A;  2NBF A;  3E5S A;  5C4Z A;  1MSH A;  2C5C A;  2D0O A;  3OHX C;  1N34 L;  4UY8 C;  2E75 C;  1XMQ Q;  2K5W A;  2PNR C;  1S4Z A;  1UE6 A;  1Q90 A;  4RKL A;  3GTO H;  1L2F A;  1PH7 A;  2Z8L A;  2HHH Q;  1GUN A;  2RDF A;  2K52 A;  1DON A;  3D8G A;  3SE0 A;  3JAM c;  2HCC A;  1VQC A;  2UXD L;  1NTG A;  4TQU S;  2AWN A;  4I7Z C;  4JK1 C;  1QUQ B;  4LNQ A;  4A3B B;  2EYP A;  3S1Q B;  2F0O A;  4LF7 Q;  3D6C A;  1XPU A;  2ZJR A;  2YV5 A;  5ELB A;  4ZAI A;  3S1Q H;  2WAQ G;  4KV6 A;  1B3A A;  1HNX Q;  3HOV H;  1B50 A;  5NUC A;  3H0G H;  2B2T A;  1AZP A;  1HPC A;  3SXH A;  1I3Q H;  4H0L C;  5IGE A;  3HOY G;  5G3L F;  5M5Y B;  3LX0 A;  1RL2 A;  5IT9 E;  1SNP A;  4BY7 G;  3GV6 A;  2K03 A;  2NVY B;  3ICE A;  4JI5 L;  3D4R A;  1P16 A;  5FLM H;  2ZXR A;  3PIP A;  1KRT A;  5C3E H;  1IBL Q;  3GTO B;  2Q8R E;  3BU2 A;  4X66 L;  2NVQ B;  4R4Q A;  1CQF A;  3PO2 H;  5M9O A;  3KJP A;  1CKM A;  3C3L A;  1XWE A;  4IJL A;  3HOY B;  3QG1 A;  4H44 C;  3HKZ G;  2EYH A;  1YJN A;  4BY1 B;  3TRZ A;  1Y8P B;  2Q8T A;  1VF7 A;  3K81 C;  2NN6 H;  3K0X A;  2J7Z A;  1K73 C;  3A8K E;  4DK3 C;  4LF8 L;  2CW0 C;  5A2Q E;  1PMR A;  2Q2U A;  4J15 A;  5FLM G;  2R93 H;  1CQV A;  2L55 A;  1C4Q A;  1H9S A;  4GNX A;  1H9R A;  5EAY A;  2UXC L;  4KD4 A;  2PQA B;  3AU7 A;  4YY3 Q;  3M7G A;  5BN5 A;  4P71 A;  4OHJ A;  4A93 B;  3F2B A;  2K7V A;  4QIW E;  2VW9 A;  1SBB B;  3I4O A;  4O2D A;  3S2H H;  3V96 A;  4DV7 L;  2K4K A;  3T53 B;  2WII B;  3NP8 A;  3RLO A;  4LFA Q;  2K5D A;  4KY5 A;  3M85 A;  2F0Q A;  4HJ5 A;  4QQB X;  4PG3 A;  4A76 A;  2EPB A;  1KLG D;  1QWY A;  4R4T A;  1EY5 A;  5M5X B;  1PYW D;  3KBX A;  1V1Q A;  1YZ6 A;  3GDE A;  1I4P A;  4R8I A;  3KYH C;  3K5O A;  1SJE D;  1WFQ A;  3W5O A;  3MWY W;  4XTC S;  1WJJ A;  1GKH A;  3H3V I;  2IX3 A;  4YCU A;  4A3D H;  1STN A;  3NHH A;  4GLA C;  1E22 A;  1YIT A;  2VS1 A;  4KD3 A;  3A7A B;  2R7Z G;  4HTH A;  1MGS A;  2DY7 A;  1K8M A;  3X3M A;  4IPD A;  2NVQ H;  2F0I A;  1E3P A;  2PW7 A;  3CF5 A;  3CC7 A;  5CGK A;  4IPH A;  5C4J H;  1STA A;  3H3V C;  4KN7 C;  1JWU D;  1SMY D;  4L63 B;  4KN4 C;  4DNR B;  1O80 A;  2K6A A;  5CV7 A;  4KHP L;  5AFW A;  3LWE A;  1FJG L;  2VNU D;  5CBE E;  2A19 A;  3SVM A;  2ENB A;  3EN2 A;  4E6I A;  1BO0 A;  5IYD G;  1KHI A;  1PZK D;  3J80 E;  1L0X B;  2MHV A;  3D31 A;  4XQJ A;  3GTG B;  1BVS A;  3U4Z A;  1PA6 A;  2I5M X;  1LYL A;  1AP0 A;  2ICI A;  1EOT A;  4NXN L;  1TT2 A;  4A3L H;  1NSN S;  5GQO A;  3PIO 3;  3KOJ A;  4XDX A;  2L11 A;  1IYU A;  3N6R A;  4DV5 L;  4JI3 L;  2RA4 A;  1DCZ A;  1NCV A;  4IFD I;  4RAU C;  2LFN A;  2HD3 A;  1KDB A;  3PIO A;  1HNZ L;  2OF1 A;  1SEB D;  2WKD A;  1H9J A;  3VDY A;  2L15 A;  2VB3 X;  3PV0 A;  2IPK D;  1IBK L;  1SXT A;  1CZW A;  2E2J H;  1D8L A;  1Y1V B;  4Q0F A;  1JE4 A;  1TR5 A;  1TWH H;  3J7A 5;  4A4I A;  4LF9 L;  1I4R A;  4O1N A;  2TSS A;  4XQN A;  1EZ8 A;  1B8A A;  3GTL H;  2Z6K C;  1LTL A;  3CP0 A;  3K8A A;  3S15 H;  2IX1 A;  3NE5 B;  5CR3 A;  1V9P A;  4ZQ3 A;  2K28 A;  2D9U A;  3EQL C;  5CV4 A;  3PF5 A;  3I4N H;  1LT4 D;  3UDF A;  1ASY A;  1HFN A;  4K0K L;  4FXK C;  4IUQ A;  3HEJ A;  1TWF B;  1RF2 D;  1S5C D;  3OTO Q;  3K5N A;  5C44 B;  1PH3 A;  3SEB A;  2EY1 A;  5IT9 L;  1KQS A;  1SDF A;  3Q6S A;  2DNC A;  2NN6 G;  1JOR A;  3KDF B;  4HID A;  2F0M A;  4C3I B;  1PTO C;  1QVG A;  1F9Q A;  1GJX A;  1QUQ A;  1IYV A;  1T5E A;  1Z47 A;  3MA2 B;  3PMF A;  3G71 A;  3FHW A;  4OL7 A;  1J5E Q;  2NVT B;  2F0V A;  4K6D A;  2LXK A;  3IAY A;  2OTJ A;  2KBN A;  1Q8K A;  5K5P A;  4LFC L;  1VQI A;  1AW7 A;  3W1G A;  1CHP D;  2SNM A;  4I65 A;  5ELO A;  5CMD A;  4A3M B;  4R8N A;  2V1C C;  3TP8 A;  4CGY B;  2F0D A;  2AUK A;  2X69 A;  2NZ1 D;  4U67 3;  3M4P A;  1KNE A;  1FNU A;  1LUZ A;  5C4J B;  4AQY Q;  2CHB D;  2ES2 A;  1VS0 A;  1XNR Q;  2BCO A;  4NDX A;  1E2W A;  5CV5 A;  1Q8I A;  3PQI A;  5IWA L;  5M3M G;  1M8A A;  2KHI A;  5DM6 3;  3HOX G;  4Y7N B;  1XNR L;  1S72 A;  4IUV A;  2OQ0 A;  3F8T A;  3D4D A;  4LJZ C;  3N52 A;  4NB3 A;  1CKN B;  2D2C C;  2EJF C;  3BDO A;  3U50 C;  4DKA C;  1OXX K;  3I2Z A;  4PZ8 A;  3RNU A;  3PF4 A;  1BNZ A;  2YTY A;  1JWS D;  1JJ2 A;  1C9O A;  2EY5 A;  4DAY B;  1XNQ Q;  1X65 A;  2RF4 A;  1D1K A;  4PZ7 A;  2R92 H;  4C2M B;  5JPM C;  5DM7 3;  4FF4 A;  1VF5 C;  4QGU A;  2L0C A;  3R2I A;  2F0H A;  5IOD A;  1EYG A;  1X55 A;  1B9M A;  4JBW A;  4X3K A;  1WCM H;  1SE3 A;  4JV5 Q;  1JC7 A;  2KCT A;  4N9T A;  2R7Z B;  2JA8 B;  4AIM A;  4LF5 Q;  2DNE A;  4A3F G;  1JWM D;  1X6O A;  4NPS A;  5DEH A;  1NNX A;  1HR0 Q;  4B9W A;  1TVX A;  2EXD A;  1E7Z A;  2F0K A;  3HOX B;  1HFG A;  2N49 A;  3M4O B;  1IZ6 A;  2RQX A;  1T5X D;  1CZG A;  1M4V A;  1HTP A;  4RG1 A;  3R8B A;  5C4X B;  1JB7 A;  4APV A;  2Z4H A;  3JAM E;  4MNO A;  2MO0 A;  1VQN A;  1RTO A;  1FR3 A;  1GUS A;  4C3I H;  3OMC A;  4WOR A;  2B2W C;  1UNS A;  3B6Y A;  1MSG A;  4R4O A;  1TII D;  4QIW B;  5LMN Q;  2WAQ E;  3I55 A;  5D14 A;  4CDE C;  1H9S B;  3HKS A;  3CU7 A;  4EQO A;  2LMC B;  4J1M A;  1CSQ A;  1EWI A;  4LAA A;  1ICW A;  1AN8 A;  1N33 L;  2FMM A;  2F4V L;  2DJG C;  3Q23 A;  1YIJ A;  4OON A;  1YNX A;  2DGY A;  2I07 B;  2J0T D;  3S2H B;  1KNA A;  3D4W A;  4WRD A;  1UE1 A;  1X32 A;  3KLS A;  1KAW A;  4UP8 A;  3L3O C;  4KKS A;  5G3L D;  3GTK B;  3K7A H;  1EY7 A;  1BBW A;  3W3A A;  5C6A A;  1WYD A;  4X3U A;  2MJ8 A;  2TMP A;  4KKU A;  5C4X H;  4BY1 G;  2ZJP A;  2R3Z A;  3CCJ A;  1I50 B;  3NTK A;  2ASB A;  3FKI H;  1VQA A;  1P8L A;  1NR4 A;  3NXW A;  4DR1 L;  2B63 H;  1TKW B;  3FVQ A;  4JI0 L;  4GKK L;  1IL8 A;  3S16 B;  1WTO A;  5IE8 A;  3NBH A;  1EOV A;  3NSW A;  2Q2T A;  1EYC A;  3HOW H;  5CV6 A;  3OSO A;  1YI2 A;  1K3R A;  3MXU A;  4B3T L;  3ND8 A;  1A62 A;  3IFD A;  1EY6 A;  3V05 A;  2B3G A;  5GAH C;  2MNA A;  1MIU A;  4KHP Q;  3K57 A;  3CCL A;  1Z7T A;  3W1B A;  1K9M C;  2N8N A;  2KHJ A;  4WJW A;  2FJ2 A;  5M5Y H;  4IO9 A;  4C3J B;  1PZI D;  1XX8 A;  2SOB A;  4C3J H;  4EQ5 A;  4L5T A;  5KIX A;  4B3M Q;  3PIP 3;  1DD2 A;  4HJ7 A;  2JE6 I;  1MHW C;  5JOB A;  4LUV A;  2B39 A;  3NEL A;  4BBR G;  5I4D A;  2N88 A;  4DU9 A;  1R4Q B;  2I5H A;  1G2T A;  2BH2 A;  3M7N A;  3TME A;  1VMC A;  3PO3 H;  1RHP A;  2K5N A;  1GVP A;  3HOU H;  4HIM A;  5KEE A;  1BCP B;  1STG A;  3BZC A;  2PI2 A;  1CT1 D;  3HFZ B;  1A2U A;  2H5X A;  2F52 A;  1O7Z A;  4JI0 Q;  4GKK Q;  4A3C G;  4OX9 L;  1Y1W B;  2Y0S E;  4F88 A;  1KIX A;  2NVX B;  1L0Y B;  3LNN A;  2A69 C;  1KXL A;  3L9A X;  5HGQ A;  2A6H C;  4OO1 I;  1NBW A;  4WJ4 A;  4MN3 A;  1X3P A;  5KYI A;  1XPO A;  3T56 B;  3VYS A;  1O7I A;  4BWG B;  1BF4 A;  2JN4 A;  3NUC A;  4CJ2 C;  2EOT A;  1LT5 D;  2JA5 G;  3NK9 A;  4A3K B;  2GVA A;  1T9H A;  2B2V A;  4IQZ A;  2F0L A;  1IKM A;  5FO9 B;  2R92 G;  2IHE A;  4GOP C;  5EKK A;  3R93 A;  1Q3L A;  2YTV A;  3BVZ A;  3CXC A;  1PYB A;  4JI2 L;  1WCM G;  3CAM A;  1W6K A;  2B2U A;  1Q1B A;  1SYD A;  3KK7 A;  5H1S E;  4QL5 A;  2RDH A;  2EE1 A;  1J9O A;  5E3F A;  5ISR A;  2CKZ B;  4RHS A;  5ELD A;  4ZKC B;  3CCU A;  1WVL A;  2HCI A;  1E0B A;  4A3G B;  1B4O A;  5IYC H;  2K05 A;  1IKL A;  4LF8 Q;  1Y1V G;  2MO1 A;  3ULJ A;  2F1M A;  4RA8 A;  4DUY L;  1N32 L;  1PV4 A;  4XXE A;  1KDA A;  4DXF A;  1WTR A;  1B3Q A;  2IJ0 A;  4X64 Q;  4CHT B;  1EU3 A;  1BUV T;  3PO2 B;  2L12 A;  1Z6H A;  3S14 H;  4EGV A;  4KK7 A;  4MHE A;  1YNN D;  1BDO A;  2VUM B;  4DGZ A;  1OXU A;  1KDC A;  1U4P A;  1VQM A;  2D5D A;  1A15 A;  2HIV A;  1IBL L;  2ZT9 C;  4GOP B;  1JIC A;  1HR0 L;  1A3U A;  1BQQ T;  5JJZ A;  4JI5 Q;  1PDQ A;  1Q86 C;  5IYD H;  4BBR B;  3TEH B;  5D3I B;  3A5Z B;  4L6T B;  4C3H H;  1FNW A;  2G5D A;  3G6E A;  1Q82 C;  4FF2 A;  1JOQ A;  1HQR D;  4RGM A;  1HZB A;  5M3F H;  5EPJ A;  3C46 A;  4C3J G;  1GHJ A;  3H94 A;  1VQD A;  3IRB A;  5E4W C;  1C7Y A;  1UWV A;  1S5B D;  2RCF A;  4DV4 Q;  1X9N A;  1JT8 A;  2EJG C;  2PMZ E;  3HS0 C;  4BA1 I;  4RWS C;  5T1I A;  1VMP A;  1VQ8 A;  1HCZ A;  2WB1 B;  1RIP A;  4UAI A;  3I4M H;  4POG A;  1TY0 A;  1DM0 B;  1EY8 A;  1V8Q A;  3I70 A;  3MHB A;  5FK9 C;  2QA4 A;  1V43 A;  5IWA Q;  4QCL A;  2A68 D;  1HA6 A;  3E3X A;  4TKO B;  5EPL A;  1B2T A;  4DFA A;  3QOJ A;  1XMQ L;  1MJE A;  1VQ7 A;  4ILW A;  1YJW A;  2RKS A;  1YHB A;  2NUC A;  2F03 A;  5JVH 3;  5M5W H;  2Y0S G;  4K8J A;  1YNJ C;  4RH6 A;  1JQY D;  5M3F B;  1XYI A;  4YWL A;  1LTG D;  2RVL A;  5IIF A;  1IL2 A;  1F9S A;  3A54 A;  5JJL A;  1U4M A;  1EY9 A;  5IP9 G;  3M9B A;  2KA7 A;  1HUN A;  5JEA J;  4HCE A;  4R9W A;  3HOZ B;  1KAB A;  1TXY A;  3RN2 A;  5EKI A;  3AB9 A;  4GN4 B;  1R9T H;  4XIG S;  5FJ8 G;  4HIK A;  5IOC A;  4DV0 Q;  5C4H A;  3BYY B;  4JI7 Q;  3KF6 B;  3NQI A;  4V19 0;  1I6H H;  1RJT A;  2LKV A;  2YU9 H;  2MUY A;  3OTO L;  3Q24 A;  4HSV A;  1ZYR D;  4HN7 A;  3J80 c;  2EY2 A;  3SK4 A;  2H4O A;  3UDI A;  4K0K Q;  2MGS A;  3V2T A;  4A3F H;  1Q1E A;  1K8A C;  1FNV A;  1ET6 A;  2CWA A;  1Y14 B;  1EUJ A;  4MZ9 A;  5K36 G;  1SAP A;  2G9D A;  4DR5 L;  1ONL A;  4DV1 L;  1CKN A;  2R7Z H;  2UUB Q;  2BE5 C;  4DR7 L;  3TDQ A;  5FKA C;  3J7A F;  2HIX A;  2XVS A;  1JOK A;  4HCS A;  3GTL B;  1LV9 A;  3F2C A;  2F0F A;  5IGG A;  4KJO A;  1ASZ A;  1IBK Q;  5C44 G;  2N55 A;  4CKE A;  4GLV B;  2KVM A;  1TWC H;  3KFU A;  3HOU B;  1VQJ A;  2QW7 A;  4OIK A;  2B2V C;  1EYA A;  1OO9 B;  1K8G A;  2RDG A;  3I90 A;  1X3F A;  5CV9 A;  2M2L A;  4DR3 L;  1D2B A;  2PZU A;  4HIO A;  5A2Q L;  5K36 H;  3E0E A;  4HR7 B;  2MFI A;  4ABN A;  1X3G A;  4G57 A;  1K83 H;  2F0P A;  2WKC A;  1TS4 A;  5C3W A;  4IZ8 A;  4HED A;  4QF4 A;  1MJC A;  2KHS A;  5AJ3 L;  1K28 A;  2Z6B A;  3E6Z X;  4DPG A;  1PRT F;  4WFN 3;  4JI1 L;  4JI8 Q;  5I6Y A;  1G29 1;  1WOC A;  1CHQ D;  2WAQ B;  2E5L L;  3NTH A;  1FJG Q;  4HMI A;  1E24 A;  2F0S A;  3IKJ A;  4MTN A;  2VQE L;  1M1K C;  4AYB G;  5I9O A;  2QKI C;  3VR2 A;  2HDM A;  2ATW A;  2EXZ A;  3EVQ A;  3GV3 A;  4RGO S;  2VQF L;  1A3V A;  1E2V A;  2YTX A;  4CBV A;  4BBS B;  1D7Q A;  3FRP B;  1AEX A;  3E9I A;  2PW5 A;  4OEM B;  1EQR A;  3I91 A;  2L5T A;  2X6L A;  5EBC A;  2JYO A;  2F0J A;  2WFW A;  4A3I H;  4JBM A;  4KY7 A;  4DR6 Q;  4IFD G;  1ZEQ X;  2ZTE A;  4PZ6 A;  4LF6 Q;  1VQO A;  5EJW A;  4CDF C;  4HSP A;  2JEB I;  4G4K A;  2NYZ D;  2B63 B;  1V1O A;  4C3H B;  2DN8 A;  2OWO A;  3AQQ A;  3I8Z A;  5M3M H;  3QOL A;  4B9X A;  1Z9F A;  4RHR A;  4NKL A;  4A3E B;  2R7F A;  5L37 A;  4X65 Q;  2QF7 A;  3OW2 A;  1SYE A;  2JA7 B;  4A3I G;  2YU9 B;  1LAC A;  3ERO A;  3TZD A;  1KC8 C;  3HOU G;  2AQ3 B;  1DOM A;  2BA0 A;  4DV7 Q;  1JJC B;  1S5D D;  2KEN A;  1EQT A;  4XYQ A;  4ID6 A;  2B2T C;  2EYJ A;  3S17 H;  4IUN A;  2AUJ D;  3KUP A;  1Q7Y C;  2UXC Q;  1A2T A;  2K33 A;  1X56 A;  1V1P B;  1X3Q A;  3TS2 A;  2E74 C;  3FMC A;  2ID0 A;  4BS9 A;  1K0R A;  5KGU A;  3PUX A;  1D5Z C;  2AMC B;  3KF8 A;  5J39 A;  4KKT A;  3RZO H;  2G9H D;  1I6H B;  1QB5 D;  2ZM6 Q;  1S5F D;  2A8V A;  2NTT A;  3CHB D;  3GTQ H;  1YEZ A;  4C2M H;  4UP7 A;  4IUR A;  2I5L X;  3D0F A;  3TQY A;  5JPN C;  3S2D H;  2QEX A;  2PCF B;  4X66 Q;  3H0G B;  3JAM L;  1UE5 A;  4A93 G;  3K5L A;  3H3V H;  1EQV A;  1IW7 D;  4DR6 L;  4BXX H;  3J81 j;  2L1B A;  3QIA A;  4QMG A;  2B2Y A;  3QO2 A;  1JR0 D;  3R2T A;  1EYD A;  2XGT A;  4XT3 B;  3AMU A;  1IBM L;  1SFO B;  3PSI A;  1Q81 C;  2AQ2 B;  1Y8O B;  1U0L A;  4L5S A;  2BH8 A;  1XTD A;  3OPO A;  1SFO H;  1PH6 A;  2HQL A;  3ND9 A;  1SNC A;  3HOW B;  1L0W A;  4X6A H;  2BDO A;  3A0J A;  3LWU A;  2OEO A;  4LUZ A;  4OWT B;  3A55 A;  1PRT C;  2VQE Q;  2QIL A;  2A74 C;  1C48 A;  3QB3 A;  2JA5 H;  3VR4 A;  4BXX G;  2E76 C;  2O2L D;  4CJ1 B;  3FKI G;  2PNH A;  2IT1 A;  4DV2 L;  4C3H G;  3STB D;  2ZXP A;  3K59 A;  4X3T A;  3KF8 B;  4V0B A;  1PTO D;  1J8I A;  3SK6 A;  4LWC A;  2ZM6 L;  4TVA B;  1HNW L;  2CVR A;  5C0X G;  1LO5 D;  5KYL A;  3A5U A;  1WTP A;  2PYK A;  3GTK H;  3RR5 A;  3SGI A;  1DZ1 A;  5ELE A;  3VR6 A;  5ELC A;  2P5Z X;  2AKW B;  4YCW A;  2I46 A;  4DA2 A;  1PZJ D;  4A3G H;  2JEA I;  1N36 L;  4P73 A;  2F0W A;  4C56 C;  4NW2 A;  2MPM A;  1CA5 A;  4O42 A;  2Q2I A;  2UUB L;  4K5W A;  4QJF A;  3TP7 A;  4DR5 Q;  1NY4 A;  2F3I A;  3F2D A;  3DLL A;  1JE5 A;  4QUC A;  4RFB A;  2LY7 A;  1JJG A;  2EYM A;  2KOL A;  1IXR A;  1QZH A;  2OQK A;  3M3Y B;  1G91 A;  3MTS A;  4AYB E;  4IOC A;  1VQG A;  4DF7 A;  3PO2 G;  2A6E D;  2E2J B;  4J6H A;  1UEA B;  5LMU Q;  3I73 A;  3R3O A;  1NMF A;  5M3F G;  1I94 Q;  2JA6 G;  2UXB Q;  3S15 B;  1F2Y A;  2NN6 I;  4OGQ C;  5M5W B;  2KCN A;  4RKB A;  4DV0 L;  4DV6 L;  4LF6 L;  5KRU A;  4GN3 B;  4ZCK A;  4JI4 Q;  3Q22 A;  4DR2 Q;  3I4N G;  3T13 A;  5KND A;  1BBU A;  1WCM B;  4S3S A;  3PO3 B;  3SR1 A;  1UAP A;  1TWG H;  4CDD C;  1G6P A;  1MD2 D;  2UUA Q;  1L1O B;  3HOY H;  3HKZ E;  1HZ9 A;  2JQO A;  2NVX H;  1W3S A;  2JA5 B;  1K8O A;  2K01 A;  3S24 A;  1N8R C;  1ROD A;  4NP5 A;  5IYC G;  4QY7 A;  2E5L Q;  3J80 i;  3I3C A;  3U9O A;  3AFQ A;  1PH2 A;  1KRS A;  3QJY A;  4JI8 L;  3L2P A;  4B3R Q;  4H02 A;  1FGB D;  4HAE A;  3OOC A;  1PFM A;  2WAC A;  3DWP A;  5CYU A;  5J22 A;  4DXG A;  4DAP A;  5IP9 H;  2B2U C;  4FNF A;  3KF6 A;  4ODG A;  4DUZ L;  2Q8I B;  4EQN A;  3NEN A;  3S16 H;  1Y8N B;  4IUP A;  1HZA A;  4PMB A;  3IL8 A;  1DOL A;  2J4X A;  3K0Y A;  3BDC A;  4DR3 Q;  2D0P A;  1EQQ A;  1NR2 A;  4YIJ A;  5ELF A;  1W2B A;  2BDN A;  1LT3 D;  5EBD A;  1EIG A;  1GXD C;  1F2Z A;  4L8J A;  4TRD A;  1G6Z A;  3GO5 A;  2Y0S B;  1WTX A;  3Q8D A;  3T51 B;  1F2M A;  2QDL A;  1ET9 A;  4XT1 B;  2EQS A;  3NPP A;  2CWP A;  2XN9 C;  5IYB H;  3FKI B;  3GP7 A;  4DV1 Q;  1D1I A;  2DY8 A;  1TWC B;  4X62 L;  4A3F B;  2XRS D;  3S17 B;  1CM9 A;  2JA7 G;  2NVT H;  1YHQ A;  3K7A B;  1VQB A;  5DLQ E;  4JCV E;  3G7L A;  1MBY A;  4X64 L;  2SNS A;  4PMC A;  4L5R C;  4DUY Q;  1N32 Q;  4CDC C;  3T1Y Q;  1BOS A;  1R9T B;  5IYB G;  3J7Y W;  4JI7 L;  1A6X A;  3HRZ C;  5IGD A;  1SYC A;  2WB1 G;  4GOP A;  3MVV A;  3TN2 A;  2GN5 A;  3U58 A;  1VQP A;  5M3M B;  3OYY A;  2K5H A;  4YHH Q;  1XJV A;  1D5X C;  3JAM i;  1PTO H;  4K5V A;  3K5M A;  4HJ9 A;  2F3V A;  2JJQ A;  2PQE A;  5FLX E;  1PXU A;  3J81 i;  5FO8 B;  4JI6 Q;  5C3E B;  4JG2 A;  4JBJ A;  1YJ9 A;  4KHZ A;  4YCV A;  2EJM A;  3X3N A;  3UI2 A;  2Z4I A;  4CKC A;  3RZD H;  2KCM A;  2K5Q A;  5ELN A;  3TS0 A;  2UUC L;  2ZJQ A;  2IX0 A;  2KEC A;  3MFY A;  3MEF A;  3CQZ H;  2DJF C;  2KQ3 A;  2VXW A;  5GAE C;  3UE0 A;  3HOX H;  3HOV G;  4ZUI A;  3EIV A;  1WTV A;  4ULL A;  1XMO L;  2CCZ A;  3CC2 A;  1SRU A;  3KDF A;  3CC4 A;  1B7Y B;  3MFG A;  3OWE B;  1BXT A;  5BR8 Q;  3J7Z C;  2XWB B;  1VCI A;  1VQ9 A;  1HH2 P;  1O7Y A;  4IFD H;  1TS3 A;  4JC0 A;  4KJN A;  1GUW A;  3BZK A;  1ZYR C;  3VA5 A;  4DV4 L;  1OXV A;  1LTB D;  2Z9H A;  5IGB A;  1TWA H;  2RSN A;  4JOI A;  2WB1 E;  1H9K A;  1JOO A;  1EWH A;  4A3D B;  1VQH A;  3GQB A;  2OXP A;  3G4S A;  1AZQ A;  2EDG A;  1EU4 A;  1ILQ A;  2O5I C;  1EEF D;  1ENF A;  1KL9 A;  1VQL A;  3S1R B;  3UDG A;  2KCC A;  3GTQ B;  4B3T Q;  1RD9 D;  1NUC A;  2B8F A;  1B53 A;  1CK1 A;  1Y69 U;  2R93 G;  3H91 A;  1GUO A;  3FDT A;  1XTC D;  2PZW A;  5GAD C;  4DV3 L;  2XTI A;  3D6W A;  3SK8 A;  1QG7 A;  4PQX A;  3I4M G;  3RLF A;  1HA5 A;  4IJH A;  5D65 A;  3T16 A;  1K83 B;  3S2D B;  1RTN A;  3PGZ A;  4R4I A;  1OTC A;  3RMH A;  3DEP A;  1RDP D;  5COR A;  3J81 L;  1EWC A;  4J8Q A;  2E2I H;  4ZK9 B;  4KI0 A;  3ZJY C;  3FPU B;  2OTL A;  1C8C A;  1J6Q A;  2NTS A;  2E2H B;  2L9H A;  3DUZ A;  1PH8 A;  4K2L A;  2AHO B;  1B9N A;  4DR4 Q;  5C5L A;  3S14 B;  3RLN A;  5HY6 A;  4P2C B;  1STE A;  4JVZ A;  2FMC A;  2I0Q A;  4DAY A;  1DYQ A;  4N9P A;  2F4V Q;  4JI2 Q;  2X6G A;  5IT9 c;  4K14 A;  2UU9 Q;  1PTO B;  4HJA A;  3BG3 A;  4R4C A;  1WD1 A;  2R93 B;  4BA2 I;  4FDB A;  1HRJ A;  1XPR A;  1HZC A;  3S9W A;  4KHV A;  3HOZ H;  4DR4 L;  3S1N H;  3K6O A;  4RGT A;  2JA7 H;  4A3G G;  1NMG A;  1VQF A;  3URY A;  3CCV A;  1BBX C;  2ICE C;  5DAU A;  1B70 B;  1K0S A;  1EIY B;  1SE8 A;  3KLR A;  4OX9 Q;  1STH A;  1O7L A;  2CH4 A;  4ME5 A;  3CKI B;  5DNF A;  2CFM A;  5LMN W;  1H95 A;  1FL0 A;  4DV3 Q;  5CC4 A;  2ZTC A;  4GNX C;  1DOK A;  2R92 B;  2FIN B;  3OW7 A;  2A69 D;  2XRQ D;  3H15 A;  1BKB A;  5EQ0 A;  4DK6 C;  4LF5 L;  4A3K G;  1SJH D;  3GD7 A;  3GTM H;  4OXP A;  3HOV B;  4JV5 L;  1H9M A;  4B3M L;  1TQO A;  3P20 A;  4ZRZ A;  2ZXO A;  4K6L A;  2JA8 H;  1QJO A;  1LTS D;  1SYG A;  2EYF A;  1KLU D;  4YWM A;  3J81 c;  1PHJ A;  2FXQ A;  4F87 A;  4JYA Q;  3CCQ A;  2CQO A;  5KNB A;  2Z6K A;  1XNQ L;  1HJP A;  1LTA D;  1Y1W G;  5FOB B;  5C0X J;  4HJ8 A;  5D3D A;  2C9O A;  2IL8 A;  4QB4 A;  1I3Q B;  5C3E G;  2HUG A;  5C4X G;  1X3E A;  5BN3 A;  4IPC A;  5JEA H;  2MP1 A;  3H09 A;  3GTG H;  1JCK B;  2SDF A;  1XMO Q;  3I4M B;  1PFB A;  2O4X A;  3FEW X;  3Q0A A;  1U5K A;  2VUM G;  4LFB L;  3F2U A;  4DR1 Q;  5CV8 A;  5HGT A;  1GHK A;  4C3I G;  1E1T A;  3IFT A;  4ALP A;  1U4R A;  1S40 A;  3HG9 A;  3KJO A;  1XXG A;  2K14 A;  4XQQ A;  4A3J G;  4ZLT F;  4IUT A;  3F1Z A;  4UPA A;  1A63 A;  2NZH A;  3BYT B;  1YNN C;  3NTI A;  3UE1 A;  4FP5 D;  2E8G A;  3CQZ B;  4RCO A;  4JI6 L;  2JP1 A;  3A74 A;  4LFC Q;  1E2Z A;  4P72 A;  3GTM B;  4PMW A;  4QUF A;  3CCR A;  2VZA A;  1IW7 C;  4YHH L;  4JPB W;  1J5E L;  3CPF A;  2B2Y C;  1CFM A;  4B08 A;  1QVC A;  1LTT D;  4EQP A;  3T1H Q;  2PZT A;  1N33 Q;  1W6J A;  2JXM B;  5LMN L;  5J3B A;  4F8M A;  2Z1C A;  4NMZ A;  1PFN A;  5M5X H;  2EIF A;  3T1Y L;  1CI3 M;  1PRT D;  5COY A;  3M4Y A;  1ILP A;  1Q12 A;  3K7U C;  3NEM A;  2LXJ A;  2GA4 B;  5C44 H;  4K5X A;  4CKB A;  3ERS X;  1TWF H;  1UUP A;  2QGQ A;  3BDL A;  1S3O A;  2LS0 1;  3ER0 A;  5EGT A;  3MXP A;  3L7Z C;  2C35 B;  3P75 A;  4R1J A;  5TSS A;  3C1F A;  4FO2 A;  4FVM A;  2NZO A;  2QCP X;  3ZYY X;  3E9H A;  3PCO B;  4Z9C B;  2R7D A;  2EY6 A;  3ULL A;  3T1H L;  3OWF A;  4LF9 Q;  5IP7 H;  1N9W A;  1I6V C;  5CBA E;  1L1O A;  3DEO A;  5JAV A;  3EJI A;  1SNM A;  2IW3 A;  2NVY H;  1YNJ D;  1WD0 A;  4C1N K;  4A75 A;  1HNZ Q;  2BA1 A;  4JW0 A;  3CCE A;  1PRT B;  2WIN B;  1V1P A;  1PH9 A;  3FPP A;  4DV5 Q;  4IN3 A;  4LK1 C;  3K80 C;  4FF1 A;  3H6M A;  3ERQ A;  2KUM A;  1SR3 A;  5LL6 X;  2H1E A;  5LL6 S;  1ENA A;  1YVC A;  2IWH A;  1CTM A;  4DUZ Q;  2FHT A;  3DHQ A;  2CW0 D;  3I7F A;  4LFB Q;  4POF A;  1AH9 A;  1PYS B;  4G7H C;  2QDB A;  1RKN A;  4OO1 H;  1GOZ A;  1R4P B;  2D62 A;  3HZX A;  3MAQ A;  4AQY L;  4B3R L;  1I4G A;  1SNQ A;  2A6E C;  4KMU C;  3VYT A;  1F2L A;  1GUT A;  4TSS A;  3GTJ B;  4A3J H;  3U4V A;  2N78 A;  2K75 A;  4A3J B;  3NWS A;  1EZ6 A;  4DK1 A;  1CSP A;  1SLJ A;  2HDL A;  3CRK C;  1WTQ A;  4JYA L;  1WTW A;  1F9R A;  4A3B H;  2V4D A;  3SK5 A;  4OWX B;  2E2D C;  4RGN A;  2PQA A;  3MXN B;  4KTA A;  2EYL A;  3CCS A;  4U68 A;  4YWK A;  2PPB C;  5FO7 B;  4GLX A;  5JVG 3;  1AFP A;  1SE2 A;  3PUW A;  1JB3 A;  5GRO A;  4DR2 L;  4P75 A;  4Y52 H;  5E1F A;  3RD4 A;  4A3M H;  1STY A;  4UDU C;  2O5J C;  1VQK A;  4LUO A;  1I4Q A;  4HMJ A;  2WP8 J;  2VUM H;  3ITP A;  3EBE A;  5LMU L;  2KED A;  3CW2 C;  2A1A A;  5BN4 A;  3EA6 A;  2Z0S A;  4P74 A;  2CQA A;  3ONA B;  4FF3 A;  1NJI C;  1GO3 E;  4N8X 1;  1SMY C;  2XIW A;  1ESF A;  1PLF A;  4H13 C;  3KBG A;  2CH4 W;  4A3K H;  3ULP A;  1TS5 A;  4I7A A;  1JMC A;  2M00 A;  4A3C H;  2UU9 L;  1QCB D;  2JA8 G;  3I4N B;  5I2Y A;  2E2I B;  1A0I A;  3T4A C;  4A3D G;  3VR5 A;  2OT2 A;  2SEB D;  2R61 A;  3VA7 A;  4JBK A;  4LMQ D;  4DAM A;  4BY7 B;  1I4X A;  1Q46 A;  2EYO A;  2L4N A;  5FJ8 H;  3SDZ A;  5IGC A;  1PTO F;  2N3S A;  1WTH A;  4JI3 Q;  1EFI D;  3I4L A;  2OCE A;  1LTI D;  3C1E A;  1HNW Q;  1SN8 A;  3JC6 6;  2BOS A;  4MTK A;  3DMU A;  4NXN Q;  5LHY 1;  4FXD A;  2Q2H A;  3BS1 A;  3NBH B;  5JJK A;  1EEI D;  4X3S A;  4K8I A;  4PV1 C;  4ZKB B;  4DV2 Q;  5C3X A;  5J1Z A;  4RCN A;  1K3B C;  5IY0 A;  5E4X A;  1LT6 D;  3P1H A;  4GN5 A;  3OIP A;  2K1B A;  1CKO A;  2IY5 B;  1G2S A;  4FXG C;  3DWA A;  1II3 A;  2IHF A;  3D3R A;  3KLW A;  1KTK A;  1HTL D;  2JSO A;  4G7Z C;  3WOF A;  2WV6 D;  1HNX L;  1GUG A;  1BR9 A;  1YBY A;  2PMZ B;  3J80 L;  5KNC A;  1EIF A;  3A56 A;  4AYB B;  3MXN A;  2ALY B;  5I2X A;  1IBM Q;  5C0X H;  2HT1 A;  3UDX A;  1WI5 A;  3MEH A;  2QEJ C;  3TP6 A;  1C0A A;  2K04 A;  4Q5V A;  2ZTD A;  5FLX L;  1TWA B;  3HKZ B;  2MQH A;  5FLX c;  3A8I E;  2VY3 A;  2XNA C;  4KLK A;  3RUZ A;  3GTP H;  2EVB A;  5BR8 L;  1G51 A;  1O78 A;  4WJ3 M;  1F77 A;  1F9P A; 
#chains in the Genus database with same CATH homology
 5BR8 Q;  2HIX A;  3J7Z C;  3K8A A;  3S15 H;  1VCI A;  2IX1 A;  1VQ9 A;  1HH2 P;  3F2C A;  1V9P A;  3GTL H;  4JC0 A;  1ASZ A;  3CME A;  1IBK Q;  3BZK A;  2GVB A;  1IYJ B;  5C44 G;  4DV4 L;  3I4N H;  3PF5 A;  4GLV B;  1OXV A;  1TWC H;  3UDF A;  3KFU A;  5C0X I;  1VQJ A;  1ASY A;  1TWA H;  4JOI A;  3L0O A;  4K0K L;  2WB1 E;  2UUC Q;  1K8G A;  3RN5 A;  3PUV A;  4BBR H;  1X3F A;  2K5V A;  1E1O A;  4DR3 L;  4HIO A;  1VQH A;  3E0E A;  3OTO Q;  1PH3 A;  3G4S A;  2MFI A;  4LFA L;  3PO3 G;  1X3G A;  1KL9 A;  1K83 H;  5JEA G;  1KQS A;  1NE3 A;  1PH1 A;  1VQL A;  1AE2 A;  2NN6 G;  3UDG A;  1X54 A;  4GNX B;  1OXS C;  4A3B G;  3KDF B;  1MJC A;  4HID A;  4B3T Q;  5AJ3 L;  4NXM Q;  1QVG A;  4GKJ Q;  2JA6 H;  2R93 G;  4DPG A;  4BY7 H;  1QUQ A;  4DV3 L;  1Z47 A;  5GAD C;  3G71 A;  2XTI A;  4YY3 L;  3FHW A;  4JI1 L;  1PH4 A;  1J5E Q;  4JI8 Q;  3I4M G;  3RLF A;  1VQ5 A;  1G29 1;  4IJH A;  2LXK A;  1WOC A;  2E5L L;  2OTJ A;  1FJG Q;  3PGZ A;  2KBN A;  4R4I A;  1OTC A;  1Q8K A;  4LFC L;  1VQI A;  1E24 A;  4RMF A;  3W1G A;  4MTN A;  2VQE L;  1M1K C;  4BY1 H;  5ELO A;  4AYB G;  4X65 L;  2E2I H;  2ATW A;  4A3M G;  4KI0 A;  3ZJY C;  2V1C C;  2OTL A;  1J6Q A;  2RCN A;  2VQF L;  1VQ6 A;  3WWV A;  2YTX A;  1PH8 A;  2AHO B;  3DM3 A;  1GM5 A;  4DR4 Q;  1D7Q A;  3S1M H;  3M4P A;  1QZG A;  3RLN A;  5HY6 A;  3E9I A;  3AEV A;  1EQR A;  4EX5 A;  4L5Q A;  1LUZ A;  2AWO A;  3STB C;  4AQY Q;  4A93 H;  1Y1W H;  2ES2 A;  1VS0 A;  1XNR Q;  2I0Q A;  4A3I H;  2WFW A;  4X62 Q;  4A3E H;  4JBM A;  2B29 A;  2DUD A;  5IWA L;  4DR6 Q;  2F4V Q;  4IFD G;  4JI2 Q;  5M3M G;  3HOZ G;  2KHI A;  2ZTE A;  5IT9 c;  3HOX G;  2UU9 Q;  4PZ6 A;  4HJA A;  1XNR L;  4LF6 Q;  1VQO A;  1S72 A;  1Y1V H;  2OQ0 A;  3F8T A;  4R4C A;  2JEB I;  2E2H H;  4NB3 A;  4OWW B;  1CKN B;  3U50 C;  4FDB A;  4BA2 I;  1XPR A;  2OWO A;  1HZC A;  5E7N A;  4DKA C;  1OXX K;  3AQQ A;  3I2Z A;  3KDF A;  4PZ8 A;  3RNU A;  3PF4 A;  3GTJ H;  1GD7 A;  5M3M H;  3HOZ H;  4DR4 L;  2YTY A;  3S1N H;  1OXT A;  1Z9F A;  1PFS A;  1JJ2 A;  1C9O A;  2VQF Q;  1KD1 C;  4DAY B;  1XNQ Q;  1X65 A;  3CMA A;  4A3L G;  2JK8 A;  2RF4 A;  4DNI A;  2JA7 H;  4LF7 L;  4Y7N H;  4A3G G;  4PZ7 A;  1SMX A;  2R92 H;  2R7F A;  1NMG A;  4X65 Q;  1HR0 W;  3OW2 A;  1VQ4 A;  1VQF A;  3CCV A;  4QGU A;  4A3E G;  4A3I G;  3CCM A;  1B70 B;  1EYG A;  1KC8 C;  1SE8 A;  1X55 A;  1EIY B;  3HOU G;  4JBW A;  1FGU A;  1WCM H;  4OX9 Q;  4JV5 Q;  2KCT A;  2BA0 A;  4BBS H;  1FVI A;  4DV7 Q;  2K50 A;  1SRO A;  1JJC B;  3PUZ A;  2CFM A;  4JI1 Q;  4AIM A;  5LMN W;  1M90 C;  4LF5 Q;  4A3F G;  4IPG A;  1H95 A;  1FL0 A;  4DV3 Q;  3S1R H;  2ZTC A;  4ME3 A;  4GNX C;  2KEN A;  1X6O A;  4NPS A;  2HHH L;  1HR0 Q;  2B63 G;  1CUK A;  2EXD A;  3H15 A;  5AJ3 Q;  1BKB A;  1E7Z A;  3CD6 A;  4DK6 C;  3S17 H;  4LF5 L;  5JJI A;  1Q7Y C;  4A3K G;  3GD7 A;  3GTM H;  2UXC Q;  4OXP A;  2N49 A;  1N34 Q;  3HOW G;  4JV5 L;  1IZ6 A;  4B3M L;  1A8V A;  1X56 A;  2JA8 H;  4RG1 A;  3TS2 A;  3CPW A;  1JB7 A;  4APV A;  2RHQ B;  2ID0 A;  1K0R A;  4MNO A;  4YWM A;  3PUX A;  3J81 c;  1PHJ A;  2FXQ A;  2MO0 A;  1VQN A;  4JYA Q;  2AMC B;  4C3I H;  2CQO A;  3CCQ A;  2Z6K A;  1PH5 A;  1XNQ L;  3RZO H;  1HJP A;  3B6Y A;  4LW1 A;  1Y1W G;  4IFD J;  4R4O A;  3LGJ A;  5C0X J;  2ZM6 Q;  2UUA L;  4HJ8 A;  2A8V A;  4IOA A;  3GTQ H;  1YEZ A;  4C2M H;  5LMN Q;  2WAQ E;  3AFP A;  4UP7 A;  3I55 A;  2I5L X;  3D0F A;  3H0G G;  3TQY A;  5C3E G;  3HKS A;  3I56 A;  4OO1 G;  5C4X G;  1X3E A;  4IPC A;  3S2D H;  1CSQ A;  1EWI A;  2QEX A;  4DR7 Q;  4X66 Q;  1N33 L;  3GTG H;  4O0A A;  1XMO Q;  1UE5 A;  4A93 G;  1EFW A;  4UP9 A;  1QVF A;  4JI4 L;  4B3S Q;  1I50 H;  2F4V L;  3H3V H;  1U5K A;  2VUM G;  1UE7 A;  4LFB L;  4DR6 L;  1YIJ A;  2RHS B;  4OON A;  1YNX A;  2DGY A;  4BXX H;  2VL6 A;  3J81 j;  4DV6 Q;  4DR1 Q;  1AE3 A;  4LF4 Q;  1UE1 A;  2UXB L;  1KAW A;  1E1T A;  2XGT A;  4UP8 A;  1IBM L;  3K7A H;  4ALP A;  3PSI A;  1BBW A;  1S40 A;  5IP7 G;  1Q81 C;  2UXD Q;  3KJO A;  1U0L A;  1I94 L;  4L5S A;  1WYD A;  2BH8 A;  1XTD A;  2K14 A;  4AH6 A;  1SFO H;  2HQL A;  4A3J G;  2LSS A;  1PH6 A;  3G48 A;  3F1Z A;  4UPA A;  1L0W A;  1A63 A;  2NZH A;  4X6A H;  1VQE A;  3A0J A;  3PUY A;  3UE1 A;  5C4X H;  4BY1 G;  2ZJP A;  3CCJ A;  4LUZ A;  4OWT B;  2E8G A;  2VQE Q;  2ASB A;  3FKI H;  4JI6 L;  1VQA A;  1P8L A;  3A74 A;  4LFC Q;  1DGS A;  4LF4 L;  4P72 A;  2JA9 A;  4DR1 L;  2B63 H;  3FP9 A;  1PVO A;  4PMW A;  3M3Y H;  3CCR A;  3M4O H;  2VZA A;  2JA5 H;  4JI0 L;  4YHH L;  4GKK L;  1UEB A;  3BJU A;  3CPF A;  1J5E L;  4BXX G;  4B3S L;  3T1H Q;  1QVC A;  5IE8 A;  4JOI C;  3FKI G;  1EOV A;  1LM0 A;  2PNH A;  2IT1 A;  4DV2 L;  2Q2T A;  3CC4 A;  1I5F A;  1N33 Q;  3HOW H;  2YYZ A;  3STB D;  1YI2 A;  3KF8 B;  2R6G A;  1K3R A;  4GKJ L;  4NXM L;  1L1O C;  1MKH A;  4B3T L;  2PI2 E;  5LMN L;  5J3B A;  1A62 A;  4LWC A;  3M4Q A;  1N36 Q;  5GAH C;  2B3G A;  2ZM6 L;  4TVA B;  2MNA A;  1MIU A;  1HNW L;  4KHP Q;  3TRE A;  4GS3 A;  5M5X H;  3T1Y L;  2EIF A;  5C0X G;  3CCL A;  3W1B A;  1K9M C;  3A5U A;  2N8N A;  2KHJ A;  1YHA A;  5GAG C;  1Q12 A;  5M5Y H;  3K7U C;  3NEM A;  2LXJ A;  4IO9 A;  3RR5 A;  3SGI A;  3GTK H;  5C44 H;  3ERS X;  1TWF H;  4BBS G;  3AYH B;  2QGQ A;  4C3J H;  4EQ5 A;  4L5T A;  4B3M Q;  2AKW B;  4YCW A;  4HJ7 A;  2JE6 I;  2D0O A;  1S3O A;  1N34 L;  4UY8 C;  3ER0 A;  4A3G H;  4LUV A;  3L7Z C;  2C35 B;  4R1J A;  3NEL A;  4BBR G;  1XMQ Q;  1N36 L;  2JEA I;  4P73 A;  1UE6 A;  2NZO A;  3GTO H;  1L2F A;  2I5H A;  3E9H A;  3PCO B;  2BH2 A;  1PH7 A;  3M7N A;  2R7D A;  3PO3 H;  2HHH Q;  2K5N A;  1GVP A;  3HOU H;  4HIM A;  3ULL A;  2K52 A;  3BZC A;  2Q2I A;  2PI2 A;  2UUB L;  4QJF A;  3HFZ B;  3JAM c;  3T1H L;  1VQC A;  4LF9 Q;  2UXD L;  1NTG A;  4DR5 Q;  1NY4 A;  5IP7 H;  1N9W A;  2F3I A;  2F52 A;  2H5X A;  4TQU S;  3F2D A;  3DLL A;  4JI0 Q;  1JE5 A;  2AWN A;  4OX9 L;  4A3C G;  1L1O A;  2Y0S E;  1KIX A;  1JJG A;  2NVY H;  4GKK Q;  1IXR A;  1KXL A;  5HGQ A;  1QZH A;  2OQK A;  1QUQ B;  4OO1 I;  1NBW A;  4A75 A;  4LNQ A;  4WJ4 A;  1XPO A;  4AYB E;  4IOC A;  1VQG A;  2BA1 A;  1HNZ Q;  4LF7 Q;  1O7I A;  1XPU A;  3PO2 G;  2ZJR A;  2YV5 A;  3CCE A;  3S1Q H;  2WAQ G;  1HNX Q;  5LMU Q;  3HOV H;  3H0G H;  5M3F G;  1NMF A;  1PH9 A;  1I94 Q;  2JA5 G;  4DV5 Q;  1I3Q H;  1T9H A;  2GVA A;  3K80 C;  2JA6 G;  3HOY G;  1RL2 A;  1SR3 A;  4BY7 G;  2UXB Q;  1YVC A;  3ICE A;  2R92 G;  2NN6 I;  2IHE A;  4GOP C;  4DUZ Q;  4DV0 L;  4DV6 L;  2YTV A;  4LF6 L;  4JI5 L;  3I7F A;  4LFB Q;  4POF A;  4GN3 B;  1P16 A;  5FLM H;  1PYB A;  3CXC A;  4JI2 L;  4JI4 Q;  1AH9 A;  1PYS B;  3PIP A;  1WCM G;  3CAM A;  1KRT A;  5C3E H;  4DR2 Q;  1IBL Q;  3I4N G;  1BBU A;  1Q1B A;  3BU2 A;  4X66 L;  2D62 A;  4R4Q A;  4AQY L;  4B3R L;  5H1S E;  3PO2 H;  4QL5 A;  2CKZ B;  1TWG H;  3KJP A;  3CCU A;  1CKM A;  4IJL A;  1G6P A;  4A3J H;  2UUA Q;  5IYC H;  3U4V A;  2N78 A;  2K75 A;  4LF8 Q;  1Y1V G;  2MO1 A;  3HKZ G;  3ULJ A;  1L1O B;  3HOY H;  3HKZ E;  1HZ9 A;  2JQO A;  4DUY L;  1YJN A;  2NVX H;  1PV4 A;  1W3S A;  3TRZ A;  1N32 L;  4DR7 L;  1CSP A;  1SLJ A;  3K81 C;  4JYA L;  3K0X A;  3S24 A;  1N8R C;  4X64 Q;  1K73 C;  4A3B H;  4DK3 C;  4LF8 L;  5IYC G;  4OWX B;  4QY7 A;  2Q2U A;  4J15 A;  5FLM G;  2E5L Q;  3J80 i;  2R93 H;  2PQA A;  3S14 H;  1PH2 A;  3AFQ A;  3MXN B;  1KRS A;  4JI8 L;  3CCS A;  4YWK A;  3L2P A;  4GNX A;  4B3R Q;  2UXC L;  5EAY A;  4H02 A;  1OXU A;  2PQA B;  4GLX A;  4YY3 Q;  1VQM A;  3PUW A;  4P71 A;  3F2B A;  2HIV A;  1IBL L;  5GRO A;  4DR2 L;  4P75 A;  4QIW E;  4GOP B;  2VW9 A;  1HR0 L;  3I4O A;  4Y52 H;  4JI5 Q;  4O2D A;  5IP9 H;  3S2H H;  1Q86 C;  3KF6 A;  4DUZ L;  5IYD H;  3S16 H;  3NEN A;  4DV7 L;  2K4K A;  3TEH B;  3A5Z B;  4A3M H;  4C3H H;  3G6E A;  1Q82 C;  1VQK A;  4LUO A;  1HZA A;  3RLO A;  2WP8 J;  2VUM H;  4LFA Q;  1HZB A;  3M85 A;  5M3F H;  4HJ5 A;  3EBE A;  5LMU L;  4QQB X;  3CW2 C;  4DR3 Q;  4PG3 A;  4A76 A;  2A1A A;  2D0P A;  1EQQ A;  1VQD A;  2Z0S A;  1W2B A;  4R4T A;  3IRB A;  4P74 A;  1C7Y A;  1UWV A;  1V1Q A;  1YZ6 A;  3GDE A;  4DV4 Q;  1X9N A;  1NJI C;  1JT8 A;  3GO5 A;  3KYH C;  1WFQ A;  2PMZ E;  4BA1 I;  3W5O A;  4XTC S;  3Q8D A;  1WJJ A;  1VQ8 A;  1GO3 E;  1GKH A;  3H3V I;  2EQS A;  4A3K H;  1RIP A;  2CWP A;  4YCU A;  3ULP A;  3I4M H;  4POG A;  4A3D H;  5IYB H;  1JMC A;  4A3C H;  4GLA C;  1E22 A;  4DV1 Q;  1YIT A;  2UU9 L;  2QA4 A;  1V43 A;  5IWA Q;  2JA8 G;  4X62 L;  2VS1 A;  1A0I A;  2R7Z G;  1XMQ L;  1MJE A;  4A3D G;  2JA7 G;  1VQ7 A;  2NVT H;  1YHQ A;  1YJW A;  4IPD A;  2NVQ H;  4JBK A;  1VQB A;  1E3P A;  4DAM A;  3CF5 A;  3CC7 A;  1YHB A;  5DLQ E;  4JCV E;  1Q46 A;  4IPH A;  5FJ8 H;  5M5W H;  2Y0S G;  4X64 L;  5C4J H;  2N3S A;  4JI3 Q;  4L5R C;  4YWL A;  2OCE A;  4DUY Q;  3T1Y Q;  1N32 Q;  4KHP L;  1HNW Q;  5IYB G;  1SN8 A;  3JC6 6;  4JI7 L;  2VNU D;  1FJG L;  4NXN Q;  5JJL A;  2A19 A;  2Q2H A;  5IP9 G;  3EN2 A;  3M9B A;  2WB1 G;  5IYD G;  1KHI A;  3NBH B;  4GOP A;  5JJK A;  2GN5 A;  3U58 A;  4DV2 Q;  5JEA J;  3D31 A;  1VQP A;  1BVS A;  3U4Z A;  3OYY A;  1TXY A;  2K5H A;  5IY0 A;  3RN2 A;  4YHH Q;  1PA6 A;  1XJV A;  2I5M X;  4GN5 A;  3JAM i;  1LYL A;  4GN4 B;  1R9T H;  4XIG S;  5FJ8 G;  4HIK A;  1CKO A;  4DV0 Q;  2IY5 B;  4NXN L;  4HJ9 A;  2JJQ A;  4A3L H;  4JI7 Q;  3J81 i;  4JI6 Q;  5GQO A;  3KF6 B;  3KOJ A;  4JG2 A;  2IHF A;  4JBJ A;  1YJ9 A;  4KHZ A;  1I6H H;  3KLW A;  2YU9 H;  4YCV A;  4DV5 L;  4JI3 L;  3OTO L;  1HNX L;  3RZD H;  1YBY A;  4IFD I;  2KCM A;  1B7Y B;  3J80 c;  3UDI A;  5ELN A;  3TS0 A;  2UUC L;  1EIF A;  2IX0 A;  3PIO A;  1HNZ L;  2ZJQ A;  4K0K Q;  2ALY B;  2HT1 A;  1IBM Q;  3UDX A;  1K8A C;  1WI5 A;  1Q1E A;  4A3F H;  3MEF A;  3VDY A;  3CQZ H;  2L15 A;  1C0A A;  3PV0 A;  1IBK L;  2ZTD A;  2CWA A;  1Y14 B;  2E2J H;  5GAE C;  3UE0 A;  1D8L A;  1EUJ A;  2MQH A;  5FLX c;  4MZ9 A;  3HOX H;  3HOV G;  4WJ3 M;  1TWH H;  2VY3 A;  4KLK A;  3J7A 5;  5K36 G;  4A4I A;  3GTP H;  4DR5 L;  3EIV A;  4LF9 L;  5BR8 L;  4DV1 L;  1CKN A;  1G51 A;  2R7Z H;  1XMO L;  2CCZ A;  2UUB Q;  3CC2 A;  1SRU A;  1B8A A;  2Z6K C;  1LTL A;  3CP0 A;  1IL2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...