3S1MH

Rna polymerase ii initiation complex with a 5-nt rna (variant 1)
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
145
structure length
133
Chain Sequence
b'SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
molecule tags Transcription/rna/dna
total genus 19
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2011-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3s1mH00
2NN6I 4KLKA 4A4IA 1KHIA 3EBEA 3H0GH 4HJ8A 1JMCA 2KHJA 2JA7G 5C0XJ 2AMCB 2K5HA 2NN6G 1LUZA 2N49A 3T1YL 3FHWA 4TVAB 3D31A 4AQYQ 2VUMG 3PO3H 1HNWL 3OTOQ 3MXNB 2Q2TA 1YNXA 5FLMH 5LMUL 3TRZA 3G6EA 1KC8C 4FDBA 2N8NA 1L0WA 3M85A 1TWFH 2VY3A 5C44H 1YEZA 4JI4L 2LXKA 2QA4A 1YI2A 1IBKL 4BY1G 4GLXA 1UE6A 1ASZA 3JAMi 3HOWH 1VQDA 4X65L 2Q2IA 2K4KA 3HOVH 1SN8A 3CF5A 1E7ZA 1PH9A 4DR2Q 1CUKA 2IHEA 3I55A 2MO0A 3S1NH 1XTDA 4A3EH 4LNQA 1NMGA 4DR4Q 5M3MG 3FP9A 4A3IG 4PMWA 1KRTA 3M9BA 3HOXG 1VQHA 5IYCH 1WJJA 1YIJA 4GLAC 1NJIC 3PSIA 3W1GA 5C4XH 2UUCQ 1SE8A 5M5XH 4O2DA 1GKHA 1G291 4IO9A 3HOZH 3M4QA 2A1AA 1RIPA 1XPRA 3FKIH 4BBRG 2ALYB 1QVGA 4JI5Q 1PH1A 1CKMA 2R92G 1VQJA 1M90C 2YTXA 4PZ7A 5C3EH 3CD6A 2R7ZG 1Y1VG 2R93G 3STBD 4HJ9A 3GTPH 4JBWA 4NXNQ 4GN3B 1Q12A 3PCOB 1YHBA 4GLVB 4JG2A 4RMFA 2QEXA 3RZOH 2R6GA 3F8TA 4JI6Q 5IYDH 2Y0SG 4GS3A 1EQQA 1N32L 1YHAA 3E9HA 3HKSA 1HR0W 1VQCA 1VQ7A 2ZM6Q 3F1ZA 2BH8A 4JI2Q 1FVIA 3OYYA 4AYBG 4KI0A 1XNRL 3M4OH 2UXDL 5J3BA 3DM3A 1XMQL 2WAQE 4WJ4A 1L1OA 1VCIA 4HIDA 4KHZA 2E5LQ 2BA1A 3UDGA 2F3IA 1DGSA 3CCRA 4C3JH 2UUBQ 4LFBQ 3K0XA 1L1OB 1ASYA 1TWHH 4GKJQ 5M5YH 5HY6A 4P71A 1E22A 4B3SL 1LM0A 2VUMH 3U4VA 3CP0A 3EIVA 1EIYB 4K0KL 4BXXH 2ZJRA 1SRUA 1GVPA 2JJQA 4LF6L 3HOUH 2WFWA 4JI1L 5H1SE 4L5SA 1X56A 4DV5L 1YZ6A 1O7IA 4GKKL 1YJNA 5IP7G 1J5EQ 1B7YB 1KAWA 3KF8B 1HNXQ 3I4MG 1KXLA 1EIFA 4LF8Q 4OWXB 3B6YA 3S1QH 5GAHC 2ZTEA 4YY3Q 2A8VA 3U50C 1OXTA 3CCUA 3G4SA 1VQBA 4LFCL 1OXXK 5M3MH 5LMNW 4DV7Q 2UU9L 4B3RQ 4A93G 5GAGC 4DPGA 1K73C 2HIXA 2KENA 3EN2A 2WAQG 3RN2A 4JI8Q 2Z6KA 2BH2A 4X62Q 2IHFA 3GTOH 1C7YA 1LYLA 4QQBX 3I4NH 1OXVA 1VQKA 1WOCA 4JBMA 3PV0A 2MNAA 4DR7L 4NPSA 2NVTH 1WCMH 4PZ8A 2CWPA 1CSPA 2YTVA 4KHPL 1CKNA 2Z6KC 5AJ3Q 1Q1BA 3CW2C 4OO1G 3KJPA 3PUWA 4BBSG 5JEAJ 1KIXA 1PA6A 2NVXH 5HGQA 2K75A 1PYSB 1VQNA 1NE3A 3RLNA 3J80c 1EQRA 4DR3L 3PUZA 1CKNB 2IX0A 3IRBA 2UUAL 1Y1VH 4R4IA 4MNOA 4DK6C 4HIMA 3K7AH 2ZJQA 3CC2A 3S14H 1UEBA 4DV4Q 3RN5A 2F4VL 2ZTDA 2JA6H 4LFAQ 2VZAA 3CCSA 3CCVA 1FL0A 1PV4A 3DLLA 1QZGA 2JEBI 4JYAQ 1XNQQ 4DUZL 2CKZB 2ZJPA 1S3OA 5IY0A 2JA5G 4DR6Q 2JA8G 5IP9G 3ERSX 5FJ8H 1B8AA 3F2BA 5M3FG 1OXUA 1PH4A 3S16H 3S2DH 1IBLL 4JBKA 2NZOA 4A3MG 4LUVA 2NVQH 4DV6Q 3U4ZA 2GVAA 4IOCA 4YCWA 4AQYL 3OTOL 1Q8KA 4A76A 4JI0Q 4X6AH 2I0QA 3GDEA 1VQ6A 4YCVA 3AYHB 2RHQB 2ID0A 3CPFA 3CQZH 4A3KG 3SGIA 4ALPA 1HZ9A 2CQOA 2UXCQ 4HIOA 5IWAQ 1EOVA 4QIWE 1I5FA 2CWAA 4L5RC 2MFIA 1OTCA 1G51A 3NELA 4YHHQ 5FLXc 4DR2L 5IP7H 3HKZG 3M4PA 4QGUA 4JOIA 4UPAA 1HH2P 3I4MH 4DR4L 1JB7A 2IT1A 1I3QH 2Y0SE 2ATWA 4DV2Q 4Y52H 1N36Q 2PI2E 4DV0L 1EWIA 3OW2A 1HNZQ 2AHOB 2ZTCA 4JOIC 4OX9Q 4A93H 3UDIA 4AYBE 4OONA 4LUZA 4H02A 1VQAA 1IYJB 1KQSA 5E7NA 2YYZA 1X3FA 3KYHC 1HR0Q 2VS1A 2I5LX 2AWOA 4JCVE 4YWMA 4BA1I 1CKOA 1UE5A 4GNXA 4JI5L 5IYBH 4DV1Q 5GAEC 2LSSA 3RR5A 1E1OA 1NBWA 1SROA 1VQIA 1EFWA 1JE5A 3BJUA 4GN5A 4BBSH 4GNXB 1QVCA 1T9HA 4GNXC 4NXNL 3PO2G 2VQFQ 1K0RA 1XPOA 2K5VA 3L0OA 1R9TH 4UP8A 1M1KC 4NXMQ 3ZJYC 1TXYA 4JI6L 2B63H 1VQ9A 1RL2A 3A0JA 4JC0A 2DGYA 1Q86C 4WJ3M 3I2ZA 2ZM6L 2OWOA 3PUXA 4JI2L 3GTGH 1S72A 1LTLA 1IZ6A 4JI3Q 2IY5B 5K36G 1HZBA 3GTKH 2E2HH 4JV5Q 2N3SA 2OQKA 4OWTB 2E5LL 4IOAA 2MO1A 2E8GA 1G6PA 2B29A 1SLJA 1N33Q 1NMFA 4LFBL 4GKJL 1Y1WG 4IFDI 3TS0A 2JA7H 1NTGA 5LMNQ 1Z47A 1X3GA 1Q81C 3BU2A 5IT9c 3GTJH 4LF7Q 1JT8A 4IFDG 1L1OC 1Q1EA 4X66Q 3HOYG 2D0OA 1VQLA 1QVFA 2MQHA 4HJ7A 1PH2A 5JJKA 4X64Q 1P16A 3KJOA 4A3DG 4DR5Q 3G71A 1J5EL 2E2IH 2HIVA 4PG3A 1CSQA 2KCTA 4P74A 1MJEA 4A3GG 4BY7G 1EUJA 1X55A 1HNXL 3J81c 1XJVA 3H3VI 1N32Q 3U58A 4LF8L 4LF4Q 4BY1H 1YVCA 1A62A 4YWLA 4YY3L 1JJGA 2PQAA 2QGQA 3BZKA 4B3MQ 1K83H 2JQOA 3GO5A 2A19A 4DV7L 4B3RL 1P8LA 3KDFB 3TEHB 1BBWA 3Q8DA 1A63A 3E9IA 3J80i 4XIGS 3TREA 4A3IH 2EIFA 2PQAB 3PIOA 4JI8L 4HIKA 1Q82C 3A5UA 3HOXH 1VQ5A 4X62L 3PO3G 2V1CC 4IPDA 5FLMG 4POGA 4DR1Q 3PUYA 2UXBQ 3CC7A 2JA9A 3CC4A 1K3RA 1KD1C 3I7FA 5ELNA 4DAYB 5AJ3L 3F2CA 2ASBA 1C0AA 4OO1I 1EYGA 1GM5A 2EQSA 4JI7Q 3HOWG 2R92H 4B3TQ 2OQ0A 4BBRH 3HOVG 1IBMQ 1Y14B 1TWCH 2BA0A 3M7NA 1I6HH 2R7ZH 1E1TA 1NY4A 1PH5A 3CMEA 3CCMA 4DV4L 1X6OA 2R93H 3GD7A 5ELOA 4DAMA 4LF5Q 4LFAL 1PH3A 3HKZE 4XTCS 3KOJA 2GVBA 1MIUA 3PIPA 4IFDJ 1XNQL 1VQPA 3UE0A 3KF6A 5C4XG 4DR6L 2OTJA 3TS2A 2B3GA 4MTNA 3T1HQ 1S40A 1I94Q 4A3FG 3KF6B 4A3BG 2KHIA 2AKWB 1H95A 1HZAA 4BA2I 2VQEQ 4QJFA 4DKAC 4DUYQ 4DV6L 4DR7Q 4HJ5A 4APVA 1SR3A 2RCNA 4JI0L 1HJPA 1Q7YC 5BR8Q 1Z9FA 2FXQA 1TWGH 2UXCL 1PH7A 5IWAL 3S1RH 4R4OA 3K8AA 1N34Q 4A3CG 5IYDG 5GROA 1YJWA 2ES2A 1KL9A 4A3DH 3I56A 2PNHA 4YHHL 3RNUA 1FJGQ 3WWVA 1PH8A 1QUQA 4A3GH 4LF9Q 3M3YH 4QL5A 3CCEA 4DV3Q 3PGZA 4DV2L 2R7FA 1N36L 4LWCA 1L2FA 3CCQA 4UY8C 1HNZL 1HZCA 1MKHA 4IJLA 3ULJA 1QUQB 2I5HA 2HHHQ 4OX9L 3H3VH 2DUDA 1XMOQ 5EAYA 1IBLQ 1AE2A 2NVYH 2N78A 1U5KA 2OCEA 4A3JG 1WFQA 2UUCL 4A3LG 1MJCA 3ULPA 1GD7A 1PFSA 1HR0L 4BXXG 5JJLA 1WI5A 3T1YQ 3HOUG 4POFA 2WB1G 2JK8A 4DV1L 1HNWQ 4YCUA 5LMUQ 3AQQA 3S24A 4NB3A 5JJIA 2KBNA 5C4JH 4RG1A 3W5OA 4DNIA 4Y7NH 1IL2A 4L5TA 4IPHA 3S2HH 2Z0SA 1Q46A 3G48A 4R4QA 1K8AC 2VQFL 2PI2A 4IPCA 4JI4Q 4NXML 1YITA 2KCMA 1IBKQ 3ICEA 3KLWA 1E24A 4YWKA 4X65Q 2OTLA 3AFQA 1X65A 1GO3E 3PF5A 3GTQH 2XTIA 4DV0Q 5DLQE 1PYBA 1VQ8A 1KRSA 3NBHB 4R4TA 1YBYA 4ME3A 2K14A 4JI3L 2CFMA 2YTYA 3I4NG 4JV5L 2YV5A 4QY7A 3H15A 3CPWA 4O0AA 1AE3A 1W2BA 3NEMA 1WCMG 1TWAH 4A3FH 3JAMc 2JA5H 1N33L 5IP9H 3J81i 2JA8H 4A3BH 4L5QA 5M3FH 3A5ZB 1BBUA 2VL6A 1XPUA 4MZ9A 5LMNL 4A3MH 2UUBL 2YU9H 4DK3C 4LF7L 3RZDH 4X66L 3ULLA 1J6QA 1A0IA 3NENA 3UDFA 4C3IH 4AH6A 4X64L 1D7QA 2F52A 4DR5L 2HT1A 4A3CH 3VDYA 3LGJA 2EXDA 4A3KH 2JA6G 2K50A 4C3HH 4HJAA 2H5XA 2K52A 2K5NA 2RF4A 3CAMA 4LF4L 1PH6A 3HFZB 4B3ML 3KDFA 4GN4B 1OXSC 5FJ8G 2D0PA 3S1MH 3RLFA 2HQLA 2WP8J 4OXPA 5JEAG 4EQ5A 1JJ2A 2UXDQ 1XNRQ 2L15A 3D0FA 2Q2HA 3H0GG 4TQUS 1U0LA 3I4OA 4GOPA 1X3EA 4P73A 3UE1A 1XMQQ 2CCZA 4DR1L 1VQMA 2UXBL 1AH9A 4EX5A 4A3JH 3RLOA 3CMAA 4GOPB 3CCLA 4A3LH 2I5MX 1IXRA 4IPGA 3L2PA 4GOPC 2Q2UA 4B3SQ 1FGUA 5C44G 3S17H 4K0KQ 5GQOA 4R4CA 4JI7L 2VNUD 4LUOA 4B3TL 2XGTA 1IBML 4LF6Q 1WYDA 3AFPA 4JI1Q 4DV5Q 3A74A 3CXCA 5IE8A 1QZHA 1PVOA 2IX1A 1I50H 1YJ9A 2LXJA 5C0XI 3S15H 1W3SA 4UP7A 4GKKQ 1SMXA 4A3EG 3BZCA 4LF5L 3PO2H 5C0XG 2JE6I 1D8LA 1X54A 3KFUA 4J15A 1VQGA 3K81C 5IYCG 2AWNA 2UU9Q 4LFCQ 4JYAL 2NZHA 1UE1A 4JBJA 3T1HL 2RHSB 2PMZE 5M5WH 1I94L 1YHQA 1K9MC 2E2JH 3GTMH 4P75A 4PZ6A 3E0EA 3F2DA 1VQEA 3CCJA 2VQEL 4DUYL 3HOZG 5IYBG 3JC66 3W1BA 4A75A 3FKIG 1X9NA 1N8RC 1JJCB 2C35B 4AIMA 3UDXA 3J7ZC 1N9WA 5BR8L 3J7A5 4KHPQ 3ER0A 5C3EG 1UE7A 4IJHA 2WB1E 3GTLH 1Y1WH 1BVSA 1PHJA 1N34L 1V43A 1VQOA 1E3PA 2D62A 3MEFA 3PF4A 2B63G 1V9PA 3K80C 4DR3Q 4C2MH 2UUAQ 3AEVA 3HOYH 1V1QA 1A8VA 1UWVA 1FJGL 2JEAI 4UP9A 1VQ4A 3J81j 1K8GA 4LF9L 4OWWB 2F4VQ 4DV3L 1VS0A 3K7UC 5GADC 2VW9A 4LW1A 1B70B 2GN5A 4P72A 4R1JA 4BY7H 3PUVA 3STBC 1VQFA 2HHHL 1C9OA 2R7DA 4DUZQ 3TQYA 1BKBA 1XMOL 1SFOH 3L7ZC
chains in the Genus database with same CATH superfamily
4A4IA 4OEMB 3QOJA 3EBEA 3H0GH 2JA7G 1S5FD 5C0XJ 3D31A 5CC4A 2EDGA 2Q2TA 5FLMH 1UUPA 1L0WA 4X3UA 1TWFH 5JAVA 1I50B 5CORA 2H1EA 4JI4L 1PTOF 1IBKL 4BY1G 4GLXA 1UE6A 4BS9A 1X3PA 2B8FA 3HOWH 2EOTA 2KEEA 2Q2IA 3HOVH 1SN8A 2MO0A 4LNQA 1HRJA 1EZ6A 4PMWA 5M5WB 3M9BA 2E2JB 3GTMB 2BE5D 1ILQA 4G7ZC 1VQHA 1F2LA 5IGFA 1WCMB 1PYWD 3PSIA 2UUCQ 1AP0A 2NBFA 3V2TA 2A5HA 4YIJA 3OWEB 4ME5A 5AFWA 4FF3A 4JI5Q 1WTXA 1JCKB 2R92G 1C8CA 2R7ZG 4WJWA 3EFXD 3J81L 3U9SA 1EL0A 1FNVA 4N9PA 1YHBA 4JG2A 3H09A 2QEXA 5I6YA 1IW7D 4IQZA 1J9OA 1BR9A 3DEOA 5FO9B 3F1ZA 2BH8A 1XYIA 1I6VC 4DK1A 1MHWC 1L1OA 1Y8PB 2BA1A 2B2UA 2VB3X 1TQOA 2QKIC 5G3LD 5C4ZA 4LFBQ 5C44B 1L1OB 1F77A 3I8ZA 1JE4A 1EIHA 1E22A 1LM0A 5EGTA 3EIVA 4K0KL 1SMYC 5CMDA 3K59A 1SRUA 3D4RA 1KABA 4G57A 3P20A 3KF8A 1YZ6A 3I90A 1Q8IA 1YJNA 5IP7G 1KAWA 4M1UB 2PCFB 3KF8B 1KXLA 2ENBA 1II3A 4OWXB 2ZTEA 4YY3Q 2A8VA 4CDEC 4KKTA 3G4SA 2I46A 3BG3A 1DM0B 1XTCD 3EN2A 3WDNA 2EJFC 2Z6KA 3FKIB 3GTOH 1C7YA 1LYLA 2ICIA 1BDOA 5FLXE 4JBMA 3PV0A 4DR7L 5C3EB 2CWPA 1CSPA 2YTVA 2B39A 5DM63 1S5ED 4RCNA 5AJ3Q 3CW2C 2EYHA 4OO1G 1FGBD 1I4PA 2R92H 3RZOB 5HGQA 4HCSA 1ZEQX 3J80c 2UUAL 3KLSX 1V1PA 3K7AH 4RGNA 4MIUA 2RVLA 2X6LA 3S14H 3RN5A 4PV1C 2SNSA 4LFAQ 5IGDA 1FL0A 3QOLA 1V1PB 3VR2A 3DLLA 1PV4A 1QZGA 3MFYA 3EA6A 5C3XA 2M9VA 3ERSX 1WVLA 3F2BA 1PH4A 3BYYB 3GTJB 4A3MG 5IGGA 1PTOH 4KN7C 3SDZA 2F0PA 3OTOL 3NQTA 4JI0Q 3NTHA 2KECA 4C56C 1KAAA 1HPCA 4A3KG 3SGIA 1PLFA 2QF7A 2EYFA 1MSGA 3NELA 4YHHQ 2AQ2B 5COYA 5IP7H 4DR2L 4TRDA 4DR4L 2ATWA 2K05A 4RH6A 1N36Q 2PI2E 1NNXA 2K01A 5IT9E 3ITPA 3UDIA 4LUZA 1VQAA 2KA7A 2DY8A 4K5VA 4DXGA 5E7NA 2L55A 3DUZA 2R93B 3ZYYX 1EFWA 2QW7A 1X3QA 1QVCA 4NXNL 3PO2G 2VQFQ 1XPOA 4NXMQ 3MAQA 1XXGA 5F2DA 5DM73 4WJ3M 1TIID 1O78A 4FXKC 4ID6A 1JOKA 3GTGH 1IZ6A 5D14A 1YNND 1I4GA 4O42A 2IY5B 3H6MA 2E5LL 4OWTB 4KHVA 1MSHA 2E8GA 5JVH3 2EPBA 2HDMA 5A2QL 1EZ8A 1NMFA 3NWTA 1Z47A 1X3GA 4LF7Q 3BU2A 4IFDG 1L1OC 4XXEA 1VQLA 1HTLD 2H4OA 3AMUA 3EVQA 1P16A 3QB3A 4A3DG 1GUGA 2HIVA 4XT3B 5TSSA 4A3GG 3MTSA 2F0IA 3MXPA 5D65A 4EQOA 3H3VI 1YVCA 5HGTA 2PQAA 2QGQA 4B3MQ 3Q6SA 3TEHB 3KDFB 3VR5A 1BBWA 3E9IA 4DA2A 4XIGS 3TREA 2PQAB 4QF4A 3PIOA 3A5UA 1T5XD 3FPPA 1VQ5A 3V05A 1B9NA 4ZUJA 1EYDA 1BBXC 4BBSB 1GM5A 3A55A 2EQSA 1R9TB 3FDTA 4JI7Q 4B3TQ 3D4DA 5HURA 3C3LA 1Y14B 4QUCA 3D3RA 1BO0A 1NY4A 2AQ3B 3CMEA 3GD7A 4CJ2C 4LF5Q 3NXWA 1PH3A 1R4QB 1MIUA 2DN8A 3GTKB 2JA5B 3UE0A 2JA8B 5C4XG 1WTRA 2J7ZA 1JOQA 2SOBA 1K3BC 4C3IB 1KLGD 4DR7Q 1GOZA 3FMCA 4HJ5A 1CK1A 1GJXA 4G7HC 1HCZA 4C3HB 1TWGH 2BDOA 5FLXL 2E2IB 4L8JA 1J8IA 4IFDH 1O80A 1N34Q 3LWUA 4A3CG 4G7OC 3QWNA 2JN4A 5EPJA 3HKZB 4BY1B 4A3DH 3I56A 3KBGA 1D5ZC 1MD2D 1FJGQ 2A6ED 4K6LA 3JAME 3Q23A 4A3GH 3PGZA 1H9SA 3A8KE 1HZCA 2HHHQ 2F0GA 2DUDA 1XMOQ 1H9SB 1DYQA 2NVYH 4C3JG 3VR4A 3S17B 3FRPB 4NKLA 2E76C 1WFQA 1MJCA 5CV6A 5E4XA 2WB1G 4DV1L 1HNWQ 4R8IA 3S24A 4DNIA 4Y7NH 3S2HH 2Z0SA 1K8AC 2PI2A 5IGCA 2KCMA 3VYSA 4YWKA 1PMRA 2K28A 3GTQH 2DY7A 4FF4A 4R9WA 1AW7A 4EGVA 2PW5A 3SK5A 4CKEA 4JI3L 3WOFA 2YTYA 4J8QA 2YV5A 1SBBB 2HQEA 4ZLTF 1AE3A 1T5EA 1VDZA 4DK0A 1WCMG 3T53B 5IT9L 2PYKA 1DXMA 1TWAH 1Y1WB 1N33L 1CHQD 3J81i 5JVG3 5KYLA 5M3FH 1XPUA 4MZ9A 5LMNL 3S1RB 2UUBL 3DMUA 5J39A 3ULLA 3UDFA 4IUUA 4X64L 4DR5L 4BY7B 3I4LA 4A3CH 3VDYA 2H5XA 2K5NA 1D1IA 3H3VC 3HFZB 4IUTA 5JEAG 2N55A 1JJ2A 3SXHA 3PO3B 2Q2HA 3RUZA 1XMQQ 3EQLC 5E1FA 4DR1L 3DEPA 3K58A 4EX5A 3RLOA 5ELCA 2F0KA 3SHLA 2XN9C 5DNFA 4ZUIA 3J80L 4B3SQ 5C44G 1D6EC 1NSNS 1CTMA 2VNUD 4LF6Q 4JI1Q 4DV5Q 1QZHA 4B08A 5JPNC 4XQNA 1I50H 1K28A 4GKKQ 4J1MA 1SYCA 3QIAA 5C0XG 5ELBA 1PRTC 2PPBC 1SEBD 1VQGA 2UU9Q 2Q8IB 4A3BB 1UE1A 3K5OA 5M5WH 2RCFA 1YHQA 2E2JH 3GTMH 3VYTA 3F2DA 1VQEA 1H9JA 2VQEL 5K36H 1DD2A 1LT3D 4A75A 2PZTA 1D5MC 3FKIG 1JQYD 2C35B 1N9WA 3J7A5 4KHPQ 5C3EG 1EYCA 2EXZA 4IJHA 1STEA 2WB1E 1STBA 1V43A 4K2LA 2M2LA 2B63G 2F0TA 4DR3Q 4K5WA 1HQMC 1A8VA 4MTKA 3L9AX 1BQQT 2EY1A 3J81j 4OWWB 2F4VQ 3K7UC 4LW1A 4P72A 4R1JA 1BCPB 3PUVA 1VQFA 2DJGC 3TQYA 3ND8A 2ZXOA 1TR5A 4A3JB 3L3OC 1AN8A 2F3VA 4N8FA 4HJ8A 3AB9A 3TP6A 1JMCA 2MUYA 1TY0A 2AMCB 2NN6G 3CRLC 5KRUA 2F1MA 4AQYQ 2Z6BA 3G6EA 1KC8C 3M85A 2VY3A 3S15B 5C44H 4J6HA 2ICEC 2F0NA 3SVMA 3PO2B 1ASZA 1U4RA 5BN4A 2A74C 2K4KA 1QNKA 2HD3A 4RGTA 1CUKA 4H44C 3S1NH 2PZWA 1NMGA 5KGUA 4HMJA 5C0XH 3FP9A 3T56B 5BN3A 1KRTA 4OIJA 3HOXG 3D4WA 1HA6A 4ZKBB 2NVTB 1DJRD 2A69C 1EU4A 1NJIC 1SJED 3IL8A 3V96A 1SE8A 5C3WA 4U68A 1G291 1EYAA 3GTLB 3NBIA 1NCVA 1B50A 3FKIH 1QVGA 2ALYB 1EY9A 3E3XA 1ET6A 1PH1A 3VR6A 3DM1A 4B9WA 2YTXA 4NW2A 5C3EH 3URYA 1ICWA 2O5JC 3PMFA 5IIFA 1JICA 4KMUC 2R93G 3STBD 1TS2A 4GLVB 3RZOH 3TN2A 2R6GA 2RKSA 3F8TA 4JI6Q 5IYDH 2IL8A 1N32L 1SFOB 1U4MA 1VQCA 3GV3A 2L1BA 2UXDL 1QE6A 3OYYA 5J3BA 2LY7A 3CKIB 3QO2A 2LFNA 1WTOA 1DOLA 2UUBQ 2NN6H 1ASYA 1JWMD 5M5YH 1ZYRD 2L0CA 2L5TA 4BXXH 4HSVA 5CV9A 3LWEA 3TZDA 3HOUH 5H1SE 4Q5VA 4L5SA 3I91A 2ZT9C 1DCZA 1KDAA 1J5EQ 4XQJA 1IHZA 3MC0B 2QILA 4HCEA 4DNTB 4ZAIA 2QDBA 4UAIA 3S1QH 5GAHC 1C48A 3GP7A 4JK1C 5LMNW 4QCLA 5GAGC 2F0HA 4DPGA 4WRDA 2HIXA 5M5XB 1K73C 3HOZB 1SNOA 4LAAA 1Z7TA 4X62Q 4RA8A 4QQBX 3I4NH 1OXVA 1I4QA 1WOCA 2N88A 3HRZC 5JOBA 2MNAA 1CKNA 5DEHA 1JWUD 1WTQA 1HFGA 4RFBA 1VF7A 4BBSG 5JEAJ 1PA6A 1GHJA 2K75A 1NE3A 3PUZA 1CKNB 2EY2A 4DK6C 1A3UA 3IFDA 2IWHA 1SXTA 2IJ0A 3CCSA 2VZAA 4OL7A 3CCVA 4DUZL 5IY0A 2JA5G 4DR6Q 2JA8G 1ONLA 1BCPC 1B8AA 4C3JB 3D8GA 1IBLL 1TWHB 1SDFA 1EY4A 2C5CA 2VUMB 4IOCA 2B2WA 1CA6A 2G5DA 3MXGA 4C3IG 4A76A 4X6AH 2WB1B 4YCVA 5I6WA 1RCVD 4ALPA 1HZ9A 3TZUA 4C3HG 5IWAQ 4L5RC 1G51A 3BVGA 5FLXc 2O5IC 3HKZG 4R8NA 1EY7A 2OEOA 1I3QH 4Y52H 2JP1A 2ZTCA 1W6JA 3PIO3 2HUGA 3EJIA 5ELEA 5CR3A 1PZID 2L11A 4H02A 1HQRD 4ABNA 1IYJB 1H9RA 4BBRB 1KQSA 1LTSD 1X3FA 5I4DA 1G2TA 1LT5D 1TWCB 2I5LX 2AWOA 4JCVE 5CV7A 1CKOA 4BA1I 1NUCA 3RR5A 1E1OA 1Y1VB 5ELDA 4GN5A 4BBSH 4GNXC 1NR4A 2P5ZX 2BDNA 1K0RA 5KNBA 2Y0SB 3L0OA 4KKSA 1R9TH 1M1KC 1TXYA 2F0FA 1VQ9A 4JC0A 4M8AA 3G7LA 3I2ZA 2ZM6L 3S2DB 4JI2L 3S16B 3R2TA 2KUMA 1LTLA 1DOMA 2NVQB 3MEHA 3GTKH 1UAPA 2MP1A 2B29A 1SLJA 2D5DA 5C5LA 4GKJL 1LT6D 1Y1WG 2JA7H 3N52A 1Q81C 5IT9c 4X66Q 2D0OA 5JJKA 2KCNA 2E2IH 3I4MB 3J7AF 4BY7G 1N32Q 1EUJA 1X55A 3NTIA 1HNXL 1XJVA 3U58A 4LF8L 4QB4A 4BY1H 1JJGA 3O13A 4DV7L 4B3RL 3Q8DA 3J80i 2VB2X 4JI8L 1EFID 4KY6A 5DAUA 1HHVA 3TSSA 3PO3G 2FHTA 1YNJD 1IYUA 4DN4M 2UXBQ 5C5MA 1QJOA 1K3RA 1KD1C 3F2CA 2ASBA 1PFBA 4GZYC 1BCPF 1F9PA 2F0UA 2OQ0A 2B63B 1MGSA 1O7YA 2R7ZH 3A8IE 4I65A 3X3NA 4DV4L 4G4KA 5ELOA 5CYUA 2A68D 3HKZE 4XTCS 2L9HA 3PIPA 2E2HB 1XNQL 3KF6A 1LTID 2C9OA 3TS2A 2TMPA 4MTNA 3T1HQ 1LV9A 1S40A 4A3BG 3KF6B 2AKWB 4PNYA 4X3KA 1H95A 4BA2I 4DUYQ 4DKAC 4DV6L 4I7AA 5K5PA 5BR8Q 4KY7A 4NP5A 4N8X1 4OGQC 2UXCL 1PH7A 1EEFD 3S1RH 3K8AA 1JORA 5GROA 2B2WC 4FF2A 4FXDA 2VXWA 3RNUA 3WWVA 4LF9Q 4DV3Q 4DV2L 2MJ8A 1L2FA 3DHQA 1HNZL 1MKHA 2LKVA 3QR8A 4IJLA 3ULJA 4BWGB 3HOXB 1LTAD 1QWYA 4OX9L 1IBLQ 1AE2A 2TSSA 1F9RA 2NWGA 1HA5A 4A3JG 5FO7B 1GD7A 1FNWA 1HR0L 5T1IA 3HP3A 2K1BA 3AQQA 4LMQD 2EVBA 3R93A 4CGYB 4DGZA 1I6HB 5JJIA 2KBNA 2IW3A 3MHBA 3W5OA 1IL2A 4L5TA 4IZ8A 4IURA 3K57A 1JB3A 4JI4Q 4IPCA 4OO1H 3ICEA 1IBKQ 3KK7A 2OTLA 3PF5A 4OELB 1ML0D 1O7ZA 2M00A 2SDFA 4KD3A 1QG7A 1IYVA 1KRSA 2XRQD 1YBYA 5E3FA 2K14A 4ZKCB 2CFMA 4JV5L 1LABA 1IL8A 3S9WA 1ZKOA 4O0AA 1W2BA 4A3BH 3JAMc 4XQQA 2NB0A 3W2DA 1AEXA 2A6HD 4L5QA 1AFPA 3A5ZB 2VL6A 3M7GA 2Z1CA 3I73A 4A3MH 4ZCKA 4DK3C 4IUQA 3HOYB 3BVZA 1J6QA 1A0IA 2F0MA 1D7QA 2F52A 1A3VA 1S5CD 2HT1A 3QJYA 2EXDA 4A3KH 2JA6G 3M3YB 2K50A 2K52A 2L4NA 1KDCA 4LF4L 2NTSA 3KDFA 5FJ8G 2HQLA 2WP8J 3QG1A 4EQ5A 1DONA 2B2VA 1GUTA 4TQUS 1U0LA 3I4OA 2RDHA 3M4YA 4P73A 2NYZD 1TWFB 1M8AA 1G2SA 1AH9A 3RMHA 4A3JH 1KTKA 3CCLA 1LTBD 3LX0A 2Q2UA 4GOPC 3T13A 2KOLA 1I4HA 3HOVB 4K0KQ 4LUOA 2ZXPA 1IBML 2B2YC 3CXCA 2IX1A 1SE2A 3S15H 1W3SA 2QCPX 3T4AC 3PO2H 2CW0D 1EY8A 1PRTB 1U9RA 1X54A 1E0BA 3MXUA 1PTOD 3Q0AA 3K81C 3DWPA 2Z4IA 2RHSB 2HCCA 1I94L 4PZ6A 3HOZG 5IYBG 3JC66 1F2MA 2EY6A 3W1BA 5CV4A 5KNCA 2BE5C 5T1GA 4AIMA 1N8RC 5IGBA 3J7ZC 1TS4A 3GTLH 2WACA 1D1KA 1H9KA 3PF4A 3SEBA 1QB5D 1SNMA 1MBYA 2UUAQ 1LO5D 1A6XA 1UWVA 2K03A 2RBMA 2JEAI 4IUVA 1JR0D 4V0BA 1H9MA 1VS0A 5GADC 2VW9A 3CRKC 3C1EA 3WOEA 1BKBA 3A8JE 1SFOH 1IW7C 1KHIA 2EYMA 1RDPD 4CDFC 2KHJA 2OT2A 2IPKD 2K5HA 2XWBB 2FMMA 2N49A 3T1YL 3BYTB 4TVAB 2VUMG 4F88A 3OTOQ 2RSOA 1F2YA 5LMUL 2BCOA 1YEZA 1PZKD 4H13C 4XT1B 2LXKA 2F3WA 1VQDA 4X65L 3CF5A 1E7ZA 1G91A 4HSPA 4DR2Q 1NAPA 2IHEA 3I55A 4K6DA 4DR4Q 4A3IG 1ESRA 1WTHA 3NWSA 1F9QA 1WJJA 3BVMA 3W3AA 4RGMA 5C4XH 3TMEA 5M5XH 4O2DA 1GKHA 4IO9A 3HOZH 3BDCA 2AUJD 2A1AA 3DXJC 3TP5A 1RIPA 4BBRG 3MFGA 1RF2D 4C2MB 1M90C 3CD6A 1SSOA 1Y1VG 4HJ9A 3OHXC 3GTPH 4NXNQ 1Q12A 5CV5A 2WKDA 2Y0SG 3HKSA 1HR0W 1Q3LA 4PMCA 4C1NI 1CZWA 1FVIA 1XNRL 4KI0A 3M4OH 2K5QA 3DM3A 2NTTA 2WAQE 5KYIA 4WJ4A 1G8ZD 1CM9A 1VCIA 2E5LQ 3BZDB 3KLRA 2F3IA 2KCCA 3CCRA 4C3JH 5J1ZA 3OIPA 1TWHH 3E5SA 4ZYSA 5HY6A 1VMCA 2VUMH 4FVMA 2B2VC 2ZJRA 2WFWA 2K33A 4A3EB 3VA5A 1B7YB 3NTKA 3I4MG 3ERQA 1E2VA 4K5XA 1OXTA 2QEJC 4DF7A 3CCUA 1VQBA 4LFCL 4ZQ3A 2JSOA 2F0QA 2KEDA 3RN2A 3X3MA 2EYOA 1ZXTA 1B9MA 2FINB 3SK6A 1SYEA 2MPMA 1TY2A 3D6WA 4NPSA 1WCMH 4ULLA 4QUFA 5IODA 1CZGA 3TP8A 1Q1BA 3MWYW 1HXYD 3PUWA 1KIXA 1M4VA 1PYSB 1EQRA 3IRBA 1Y1VH 4MNOA 4HIMA 5D3IB 2ZJQA 2F0WA 2L12A 1RODA 2D9UA 2DNEA 2XVSA 3LNNA 2JEBI 2CKZB 5G3LF 5IP9G 2FFKB 1U4LA 1FYCA 1SMYD 3S2DH 1OXUA 5JEAH 2RQXA 3S16H 1PXUA 3I3CA 2NVQH 3U4ZA 2GVAA 2XWJB 4YCWA 5JPMC 1Q8KA 1EEID 2I0QA 1YNNC 1VQ6A 3AYHB 2RHQB 1AZQA 2ID0A 2B2TC 3CPFA 2F0LA 4HTHA 5EPLA 2CQOA 4HIOA 1BXTA 1EOVA 4ZK9B 2OF1A 2CWAA 2MFIA 1OTCA 3IKJA 1ENAA 1V1OA 4RGOS 3M4PA 3A56A 4QGUA 5M3MB 3HGBA 2EE1A 1HH2P 3I4MH 1JB7A 2Y0SE 5FOBB 1KNAA 3R2IA 3SK8A 1LTGD 2AHOB 4K2KA 4JOIC 1SE3A 3JAML 1STNA 1Y8OB 2JXMB 4OONA 3P7JA 4CKCA 5FO8B 3CHBD 3J81E 2NVXB 4GNXA 4JI5L 4QIWB 4DV1Q 3SK4A 4ILWA 1QILA 5IGEA 3DWQA 1SROA 5CGKA 1JE5A 3BJUA 4GNXB 2JA6B 2K5VA 4UP8A 3BDOA 3K5LA 2B63H 1B4OA 1CFMA 3A0JA 2DGYA 2SNMA 3PIP3 1Q86C 2CVRA 1F9SA 2HCIA 4AYBB 4V190 2OWOA 3PUXA 4JI3Q 4X3SA 5EPKA 3OWFA 5EKLA 2E2HH 2WKCA 2N3SA 4IOAA 2MO1A 4X3TA 1N33Q 1ET9A 4LFBL 3CQZB 2F0DA 5CV8A 4IFDI 4CDCC 3CU7A 1PRTF 5LMNQ 3GTJH 2XNAC 3HOYG 1QVFA 4DNRB 2MQHA 3J7AV 4X64Q 1X32A 1STGA 4DR5Q 4PG3A 3Q22A 2KCTA 1JWSD 3NK9A 2I07B 5JJZA 3UI2A 1A62A 4YWLA 4YY3L 4A93B 2JQOA 3GO5A 2WAQB 4FYDA 2A6EC 4HIKA 3HOXH 1B1ZA 4DAYA 4IPDA 5FLMG 4POGA 1A3TA 3MA2B 4DR1Q 3CC4A 5ELNA 4DAYB 5AJ3L 1EYGA 2Q8RE 1RTNA 3GTQB 2K6AA 3HOWG 5LL6X 3HOVG 2F0OA 2K5DA 5J22A 1GHKA 2BA0A 1I6HH 4HEDA 1PFNA 3CCMA 2R93H 1RJTA 4C1NK 4DAMA 4LFAL 4LK1C 2NUCA 2GVBA 1S5BD 1TWAB 1VQPA 1FD7D 5LL6S 3OSOA 5M3FB 2OTJA 1SJHD 2B3GA 4LJZC 1DOKA 4XYQA 1HZAA 2VQEQ 2PW7A 4JI0L 1Q7YC 1LTRD 5D3DA 1LT4D 4CJ1B 2IX3A 5E4WC 4WFN3 2ES2A 4YHHL 4Q0FA 4KTAA 1K83B 1RHPA 1PH8A 1SNPA 3M3YH 2R7FA 4A3IB 4LWCA 3CCQA 1N36L 1EWCA 3H3VH 2K7VA 2O2LD 2RDGA 3K6OA 2OCEA 1LACA 2EJMA 3ULPA 1PFSA 2JK8A 4YCUA 4RHSA 4L63B 4NB3A 1SYFA 4RG1A 4IPHA 3G48A 1Q46A 2VQFL 4NXML 4H7BA 1YITA 3KLWA 3NBHA 2XTIA 5EQ0A 1B3QA 1A15A 1NR2A 3NBHB 2SEBD 5A2QE 4ME3A 1SNDA 4KV6A 2B8GA 3TDQA 1KLUD 3H15A 2R61A 3CPWA 1HFNA 1SE4A 3C2PA 2JA5H 2JA8H 1L0XB 4L6TB 4OHJA 4LF7L 1L0YB 4KY5A 2E75C 4QMGA 3NENA 1EQTA 1EY0A 4MHEA 4C3IH 1STYA 4AH6A 1B3AA 3U9OA 4KJOA 4HN7A 2D2CC 4C3HH 4XDXA 4HJAA 2RF4A 1PH6A 4B3ML 1OXSC 5EKIA 3RLFA 2UXDQ 1TVXA 3OMGA 2L15A 3D0FA 1RKNA 4GOPA 1JC7A 1X3EA 4KKUA 3UE1A 2CCZA 1FNUA 1VQMA 3CMAA 4GOPB 5C4JB 2I5MX 2B2YA 5EBDA 1SYGA 1CQVA 3S17H 5GQOA 3HEJA 4JI7L 2J0TD 4B3TL 3S1NB 1WYDA 3AFPA 5C0XI 4UP7A 2F0SA 4A3EG 3BZCA 4LF5L 5EKKA 2JE6I 2Z8LA 1D8LA 1I4XA 1K8OA 3KFUA 4J15A 5IYCG 2AWNA 1ILPA 1QNUA 4JYAL 4A3FB 4JBJA 4UDUC 1F2ZA 2PMZE 2Z4HA 3E0EA 3CCJA 2YU9B 3RZDB 2F0EA 3UDXA 3FEWX 1GUSA 1UE7A 1AZPA 1Y1WH 1BVSA 1N34L 1E2ZA 4K8IA 3HS0C 2F0JA 2CQAA 2XIWA 3K80C 4N9TA 4C2MH 3AEVA 1EQVA 1V1QA 1FJGL 2EYPA 3S1MB 5C6AA 1STHA 3A7LA 4OIKA 1B70B 4BY7H 5ELFA 3STBC 3AU7A 3VYUA 2HHHL 1C9OA 2R7DA 4DUZQ 1SYDA 1XMOL 4IUPA 3BDLA 3L7ZC 2NN6I 2QDLA 4KLKA 4EQPA 5I9PA 5M5YB 4FO2A 1DZ1A 3MXNA 1O7LA 3HOUB 1LUZA 2NZ1D 3FHWA 3J7YW 3PO3H 1HNWL 3MXNB 4CKBA 1YNXA 4K8JA 3TRZA 4FDBA 2N8NA 2DNCA 4KK7A 1PRTD 3R3OA 3G6JB 4DXFA 1GUNA 3S1QB 1RTOA 2QA4A 1YI2A 3BS1A 3JAMi 1D2BA 4KJNA 4JPBW 1ZYRC 1PH9A 1S5DD 3TP7A 1XTDA 4A3EH 5M3MG 5I9OA 4EQNA 4TSSA 3I4NB 5IYCH 1CQFA 4F7XA 1YIJA 4GLAC 3E6ZX 3W1GA 2F0VA 4FNFA 4WORA 3Q24A 4JVZA 3RD4A 3M4QA 3PQIA 4S3SA 1XPRA 3N6RA 1CKMA 1CA5A 1VQJA 4PZ7A 4IUNA 2FJ2A 3P1HA 5I2XA 4JBWA 4GN3B 3PCOB 4RMFA 4GS3A 1EQQA 1YHAA 3E9HA 2HDLA 1VQ7A 2ZM6Q 2EYJA 4JI2Q 3H0GB 1IKLA 3H91A 4AYBG 1GXDC 1XMQL 5BN5A 5L37A 1C4QA 3C46A 3J80E 4HIDA 4KHZA 3UDGA 1DGSA 3K0XA 4GKJQ 4B3SL 4P71A 4RWSC 3U4VA 3CP0A 2B2UC 1EIYB 2R3ZA 1GVPA 2JJQA 4LF6L 3HOWB 4JI1L 1X56A 4DV5L 1O7IA 1I3QB 4F87A 4GKKL 4ZRZA 2A69D 1XX8A 3MZ5A 1HNXQ 1EIFA 4LF8Q 3B6YA 3TBIB 1WD1A 3U50C 4IALA 5M3MH 1OXXK 4DV7Q 2UU9L 1A2TA 1V8QA 4B3RQ 4A93G 2KJXA 2V4DA 2KENA 2WAQG 4JI8Q 2BH2A 2IHFA 3OOCA 1CI3M 1VQKA 2PZUA 1HUMA 2G9HD 2G9DA 4PZ8A 2NVTH 2XSCA 4KHPL 2Z6KC 1Q90A 3KJPA 2NVXH 1VQNA 3RLNA 4DR3L 1E2WA 4RKLA 2IX0A 1BF4A 4R4IA 3CC2A 4Z9CB 1UEBA 4DV4Q 2F4VL 2O4XA 2RSNA 2ZTDA 2JA6H 1D5XC 2F03A 2MHVA 3OMCA 5KEEA 4JYAQ 1XNQQ 1SNCA 2E2DC 2PMZB 2ZJPA 1S3OA 1I4RA 5FJ8H 2WV6D 2JA7B 3NP8A 5M3FG 5NUCA 2JYOA 2WINB 2PQEA 2NZOA 4UHVA 4JBKA 2B2TA 4LUVA 5ISRA 1Y8NB 5FKAC 4DV6Q 3DWAA 4XYOA 4AQYL 3GDEA 2RA4A 4F8MA 1PDQA 3CQZH 2UXCQ 3VA7A 4QIWE 1I5FA 3NSWA 2K5WA 1QCBD 2BOSA 3VYRA 4JOIA 4UPAA 2CH4A 2IT1A 2X69A 1EOTA 4DV2Q 4DV0L 1EWIA 2Q8TA 1S4ZA 3P75A 4O1NA 3OW2A 1Z6HA 1HNZQ 1FR3A 4OX9Q 3GTOB 4A93H 4AYBE 1K0SA 1HTPA 5FK9C 5KIXA 2YYZA 3KYHC 4FXGC 1HR0Q 2VS1A 2R92B 4YWMA 3ONAB 1UE5A 3VR3A 5IYBH 2R7ZB 5GAEC 2LSSA 4CHTB 1CHPD 1NBWA 1VQIA 3K7AB 1WTVA 1YNJC 3S14B 1TS3A 1T9HA 2KQ3A 1HUNA 3I70A 2A73B 4KN4C 3ZJYC 2J4XA 4JI6L 1BCPD 3KUPA 1RL2A 4DAVA 1B2TA 5EBCA 1EY5A 1SYBA 4KD4A 1S72A 5K36G 4HAEA 5I2YA 1HZBA 1GUWA 4PQXA 4JV5Q 3F2UA 1PTOB 2ZXRA 2OQKA 2A68C 1G6PA 1TKWB 3TS0A 4PMBA 2K32A 1NTGA 3ND9A 2AUKA 4CDDC 1JT8A 1Q1EA 4RCOA 4TKOB 1PH2A 4HJ7A 3KJOA 2LMCB 3G71A 1J5EL 1VMPA 1CSQA 4P74A 1MJEA 3J81c 4LF4Q 3I72A 3K0YA 1TU2B 1A2UA 3BZKA 1K83H 2A19A 3FPUB 1P8LA 1A63A 2KHSA 3MVVA 4A3IH 2EIFA 1LLRD 1Q82C 1LTTD 4X62L 2V1CC 1WD0A 3PUYA 4RHRA 3CC7A 2JA9A 3A54A 5CBAE 3NHHA 3I7FA 1C0AA 1BNZA 4OO1I 1UEAB 4BBRH 1IBMQ 1BOSA 3HG9A 1TWCH 2LS01 3M7NA 1Y69U 1GUOA 1E1TA 1PH5A 1X6OA 4ODGA 1STAA 1IKMA 3GTGB 3KOJA 2PNRC 4IFDJ 4DR6L 4A3MB 4U673 1I94Q 4A3FG 2KHIA 4QJFA 1QOHA 2F4IA 4APVA 1VF5C 1SR3A 2RCNA 2X6GA 1HJPA 4RAUC 4A3KB 1Z9FA 3E0JA 2FXQA 1MI2A 2CHBD 1U4PA 3SR1A 5IWAL 4R4OA 5IYDG 2A6HC 1ESFA 4DU9A 1YJWA 3HZXA 1KL9A 2PNHA 1W6KA 1OO9B 2EJGC 1TT2A 3GV6A 3GQBA 1QUQA 2EY5A 4I7ZC 4QL5A 3CCEA 4UY8C 3IFTA 1QUQB 2I5HA 5C4HA 1SNQA 2EYLA 4DFAA 4MN3A 5EAYA 1ENCA 4RKBA 1EY6A 2N78A 3K5MA 1U5KA 4HMIA 3KBXA 1B44D 4EVOA 1WTWA 2UUCL 4A3LG 1B53A 4BXXG 5JJLA 1WI5A 4H0LC 3T1YQ 3HOUG 4POFA 1TS5A 5LMUQ 2K04A 2OXPA 5C4JH 2FMCA 1EWHA 1PFMA 4NMZA 1JOOA 4R4QA 3NUCA 4P2CB 1E24A 1ENFA 3H94A 4CJ0B 3AFQA 1X65A 1GO3E 1UNSA 4X65Q 2RDFA 1EIGA 4DV0Q 3K5NA 5DLQE 1PYBA 1VQ8A 3C1FA 4R4TA 3KLSA 3I4NG 3T51B 2MGSA 4QY7A 5IOCA 2CW0C 3NEMA 4A3FH 5IP9H 1PTOC 1TWGB 1BBUA 3OPOA 2YU9H 4JW0A 3RZDH 1XWEA 5A35A 4X66L 4A3DB 5LHY1 4A3GB 3LGJA 1PZJD 1KDBA 3CAMA 3NE5B 4E6IA 3EROA 3NQIA 3FVQA 2CH4W 3NPPA 4GN4B 2D0PA 3S1MH 2NVYB 4OXPA 4CBVA 1XNRQ 2PO4A 1ICFB 1SAPA 3H0GG 3D6CA 2Z9HA 4FF1A 1BUVT 1K8MA 2UXBL 5M9OA 4A3LH 4IPGA 1IXRA 3L2PA 4IN3A 4Y7NB 3S2HB 1FGUA 1CT1D 4HR7B 4R4CA 1R4PB 5EJWA 2XGTA 3T16A 3A74A 5IE8A 1PVOA 2DJFC 1YJ9A 2LXJA 5CBEE 1SMXA 3A7AB 4B9XA 5C4XB 4LFCQ 2NZHA 3T1HL 1K9MC 4P75A 4K14A 4DUYL 1G6ZA 3SE0A 1X9NA 1JJCB 5BR8L 3GTPB 3OW7A 1RD9D 3ER0A 1WTPA 1KNEA 4DAPA 1PHJA 3IAYA 1VQOA 1E3PA 3MEFA 2D62A 1V9PA 4NDXA 3R8BA 2XRSD 3HOYH 2EZVA 3M4OB 4UP9A 3OIQA 1VQ4A 4FP5D 1K8GA 4LF9L 4DV3L 2E74C 1EU3A 2GN5A 2KVMA 2AQ1B 2WIIB 5KNDA 2GA4B
chains in the Genus database with same CATH topology
2NN6I 4KLKA 4A4IA 1KHIA 3EBEA 3H0GH 4HJ8A 1JMCA 2KHJA 2JA7G 5C0XJ 2AMCB 2K5HA 2NN6G 1LUZA 2N49A 3T1YL 3FHWA 4TVAB 3D31A 4AQYQ 2VUMG 3PO3H 1HNWL 3OTOQ 3MXNB 2Q2TA 1YNXA 5FLMH 5LMUL 3TRZA 3G6EA 1KC8C 4FDBA 2N8NA 1L0WA 3M85A 1TWFH 2VY3A 5C44H 1YEZA 4JI4L 2LXKA 2QA4A 1YI2A 1IBKL 4BY1G 4GLXA 1UE6A 1ASZA 3JAMi 3HOWH 1VQDA 4X65L 2Q2IA 2K4KA 3HOVH 1SN8A 3CF5A 1E7ZA 1PH9A 4DR2Q 1CUKA 2IHEA 3I55A 2MO0A 3S1NH 1XTDA 4A3EH 4LNQA 1NMGA 4DR4Q 5M3MG 3FP9A 4A3IG 4PMWA 1KRTA 3M9BA 3HOXG 1VQHA 5IYCH 1WJJA 1YIJA 4GLAC 1NJIC 3PSIA 3W1GA 5C4XH 2UUCQ 1SE8A 5M5XH 4O2DA 1GKHA 1G291 4IO9A 3HOZH 3M4QA 2A1AA 1RIPA 1XPRA 3FKIH 4BBRG 2ALYB 1QVGA 4JI5Q 1PH1A 1CKMA 2R92G 1VQJA 1M90C 2YTXA 4PZ7A 5C3EH 3CD6A 2R7ZG 1Y1VG 2R93G 3STBD 4HJ9A 3GTPH 4JBWA 4NXNQ 4GN3B 1Q12A 3PCOB 1YHBA 4GLVB 4JG2A 4RMFA 2QEXA 3RZOH 2R6GA 3F8TA 4JI6Q 5IYDH 2Y0SG 4GS3A 1EQQA 1N32L 1YHAA 3E9HA 3HKSA 1HR0W 1VQCA 1VQ7A 2ZM6Q 3F1ZA 2BH8A 4JI2Q 1FVIA 3OYYA 4AYBG 4KI0A 1XNRL 3M4OH 2UXDL 5J3BA 3DM3A 1XMQL 2WAQE 4WJ4A 1L1OA 1VCIA 4HIDA 4KHZA 2E5LQ 2BA1A 3UDGA 2F3IA 1DGSA 3CCRA 4C3JH 2UUBQ 4LFBQ 3K0XA 1L1OB 1ASYA 1TWHH 4GKJQ 5M5YH 5HY6A 4P71A 1E22A 4B3SL 1LM0A 2VUMH 3U4VA 3CP0A 3EIVA 1EIYB 4K0KL 4BXXH 2ZJRA 1SRUA 1GVPA 2JJQA 4LF6L 3HOUH 2WFWA 4JI1L 5H1SE 4L5SA 1X56A 4DV5L 1YZ6A 1O7IA 4GKKL 1YJNA 5IP7G 1J5EQ 1B7YB 1KAWA 3KF8B 1HNXQ 3I4MG 1KXLA 1EIFA 4LF8Q 4OWXB 3B6YA 3S1QH 5GAHC 2ZTEA 4YY3Q 2A8VA 3U50C 1OXTA 3CCUA 3G4SA 1VQBA 4LFCL 1OXXK 5M3MH 5LMNW 4DV7Q 2UU9L 4B3RQ 4A93G 5GAGC 4DPGA 1K73C 2HIXA 2KENA 3EN2A 2WAQG 3RN2A 4JI8Q 2Z6KA 2BH2A 4X62Q 2IHFA 3GTOH 1C7YA 1LYLA 4QQBX 3I4NH 1OXVA 1VQKA 1WOCA 4JBMA 3PV0A 2MNAA 4DR7L 4NPSA 2NVTH 1WCMH 4PZ8A 2CWPA 1CSPA 2YTVA 4KHPL 1CKNA 2Z6KC 5AJ3Q 1Q1BA 3CW2C 4OO1G 3KJPA 3PUWA 4BBSG 5JEAJ 1KIXA 1PA6A 2NVXH 5HGQA 2K75A 1PYSB 1VQNA 1NE3A 3RLNA 3J80c 1EQRA 4DR3L 3PUZA 1CKNB 2IX0A 3IRBA 2UUAL 1Y1VH 4R4IA 4MNOA 4DK6C 4HIMA 3K7AH 2ZJQA 3CC2A 3S14H 1UEBA 4DV4Q 3RN5A 2F4VL 2ZTDA 2JA6H 4LFAQ 2VZAA 3CCSA 3CCVA 1FL0A 1PV4A 3DLLA 1QZGA 2JEBI 4JYAQ 1XNQQ 4DUZL 2CKZB 2ZJPA 1S3OA 5IY0A 2JA5G 4DR6Q 2JA8G 5IP9G 3ERSX 5FJ8H 1B8AA 3F2BA 5M3FG 1OXUA 1PH4A 3S16H 3S2DH 1IBLL 4JBKA 2NZOA 4A3MG 4LUVA 2NVQH 4DV6Q 3U4ZA 2GVAA 4IOCA 4YCWA 4AQYL 3OTOL 1Q8KA 4A76A 4JI0Q 4X6AH 2I0QA 3GDEA 1VQ6A 4YCVA 3AYHB 2RHQB 2ID0A 3CPFA 3CQZH 4A3KG 3SGIA 4ALPA 1HZ9A 2CQOA 2UXCQ 4HIOA 5IWAQ 1EOVA 4QIWE 1I5FA 2CWAA 4L5RC 2MFIA 1OTCA 1G51A 3NELA 4YHHQ 5FLXc 4DR2L 5IP7H 3HKZG 3M4PA 4QGUA 4JOIA 4UPAA 1HH2P 3I4MH 4DR4L 1JB7A 2IT1A 1I3QH 2Y0SE 2ATWA 4DV2Q 4Y52H 1N36Q 2PI2E 4DV0L 1EWIA 3OW2A 1HNZQ 2AHOB 2ZTCA 4JOIC 4OX9Q 4A93H 3UDIA 4AYBE 4OONA 4LUZA 4H02A 1VQAA 1IYJB 1KQSA 5E7NA 2YYZA 1X3FA 3KYHC 1HR0Q 2VS1A 2I5LX 2AWOA 4JCVE 4YWMA 4BA1I 1CKOA 1UE5A 4GNXA 4JI5L 5IYBH 4DV1Q 5GAEC 2LSSA 3RR5A 1E1OA 1NBWA 1SROA 1VQIA 1EFWA 1JE5A 3BJUA 4GN5A 4BBSH 4GNXB 1QVCA 1T9HA 4GNXC 4NXNL 3PO2G 2VQFQ 1K0RA 1XPOA 2K5VA 3L0OA 1R9TH 4UP8A 1M1KC 4NXMQ 3ZJYC 1TXYA 4JI6L 2B63H 1VQ9A 1RL2A 3A0JA 4JC0A 2DGYA 1Q86C 4WJ3M 3I2ZA 2ZM6L 2OWOA 3PUXA 4JI2L 3GTGH 1S72A 1LTLA 1IZ6A 4JI3Q 2IY5B 5K36G 1HZBA 3GTKH 2E2HH 4JV5Q 2N3SA 2OQKA 4OWTB 2E5LL 4IOAA 2MO1A 2E8GA 1G6PA 2B29A 1SLJA 1N33Q 1NMFA 4LFBL 4GKJL 1Y1WG 4IFDI 3TS0A 2JA7H 1NTGA 5LMNQ 1Z47A 1X3GA 1Q81C 3BU2A 5IT9c 3GTJH 4LF7Q 1JT8A 4IFDG 1L1OC 1Q1EA 4X66Q 3HOYG 2D0OA 1VQLA 1QVFA 2MQHA 4HJ7A 1PH2A 5JJKA 4X64Q 1P16A 3KJOA 4A3DG 4DR5Q 3G71A 1J5EL 2E2IH 2HIVA 4PG3A 1CSQA 2KCTA 4P74A 1MJEA 4A3GG 4BY7G 1EUJA 1X55A 1HNXL 3J81c 1XJVA 3H3VI 1N32Q 3U58A 4LF8L 4LF4Q 4BY1H 1YVCA 1A62A 4YWLA 4YY3L 1JJGA 2PQAA 2QGQA 3BZKA 4B3MQ 1K83H 2JQOA 3GO5A 2A19A 4DV7L 4B3RL 1P8LA 3KDFB 3TEHB 1BBWA 3Q8DA 1A63A 3E9IA 3J80i 4XIGS 3TREA 4A3IH 2EIFA 2PQAB 3PIOA 4JI8L 4HIKA 1Q82C 3A5UA 3HOXH 1VQ5A 4X62L 3PO3G 2V1CC 4IPDA 5FLMG 4POGA 4DR1Q 3PUYA 2UXBQ 3CC7A 2JA9A 3CC4A 1K3RA 1KD1C 3I7FA 5ELNA 4DAYB 5AJ3L 3F2CA 2ASBA 1C0AA 4OO1I 1EYGA 1GM5A 2EQSA 4JI7Q 3HOWG 2R92H 4B3TQ 2OQ0A 4BBRH 3HOVG 1IBMQ 1Y14B 1TWCH 2BA0A 3M7NA 1I6HH 2R7ZH 1E1TA 1NY4A 1PH5A 3CMEA 3CCMA 4DV4L 1X6OA 2R93H 3GD7A 5ELOA 4DAMA 4LF5Q 4LFAL 1PH3A 3HKZE 4XTCS 3KOJA 2GVBA 1MIUA 3PIPA 4IFDJ 1XNQL 1VQPA 3UE0A 3KF6A 5C4XG 4DR6L 2OTJA 3TS2A 2B3GA 4MTNA 3T1HQ 1S40A 1I94Q 4A3FG 3KF6B 4A3BG 2KHIA 2AKWB 1H95A 1HZAA 4BA2I 2VQEQ 4QJFA 4DKAC 4DUYQ 4DV6L 4DR7Q 4HJ5A 4APVA 1SR3A 2RCNA 4JI0L 1HJPA 1Q7YC 5BR8Q 1Z9FA 2FXQA 1TWGH 2UXCL 1PH7A 5IWAL 3S1RH 4R4OA 3K8AA 1N34Q 4A3CG 5IYDG 5GROA 1YJWA 2ES2A 1KL9A 4A3DH 3I56A 2PNHA 4YHHL 3RNUA 1FJGQ 3WWVA 1PH8A 1QUQA 4A3GH 4LF9Q 3M3YH 4QL5A 3CCEA 4DV3Q 3PGZA 4DV2L 2R7FA 1N36L 4LWCA 1L2FA 3CCQA 4UY8C 1HNZL 1HZCA 1MKHA 4IJLA 3ULJA 1QUQB 2I5HA 2HHHQ 4OX9L 3H3VH 2DUDA 1XMOQ 5EAYA 1IBLQ 1AE2A 2NVYH 2N78A 1U5KA 2OCEA 4A3JG 1WFQA 2UUCL 4A3LG 1MJCA 3ULPA 1GD7A 1PFSA 1HR0L 4BXXG 5JJLA 1WI5A 3T1YQ 3HOUG 4POFA 2WB1G 2JK8A 4DV1L 1HNWQ 4YCUA 5LMUQ 3AQQA 3S24A 4NB3A 5JJIA 2KBNA 5C4JH 4RG1A 3W5OA 4DNIA 4Y7NH 1IL2A 4L5TA 4IPHA 3S2HH 2Z0SA 1Q46A 3G48A 4R4QA 1K8AC 2VQFL 2PI2A 4IPCA 4JI4Q 4NXML 1YITA 2KCMA 1IBKQ 3ICEA 3KLWA 1E24A 4YWKA 4X65Q 2OTLA 3AFQA 1X65A 1GO3E 3PF5A 3GTQH 2XTIA 4DV0Q 5DLQE 1PYBA 1VQ8A 1KRSA 3NBHB 4R4TA 1YBYA 4ME3A 2K14A 4JI3L 2CFMA 2YTYA 3I4NG 4JV5L 2YV5A 4QY7A 3H15A 3CPWA 4O0AA 1AE3A 1W2BA 3NEMA 1WCMG 1TWAH 4A3FH 3JAMc 2JA5H 1N33L 5IP9H 3J81i 2JA8H 4A3BH 4L5QA 5M3FH 3A5ZB 1BBUA 2VL6A 1XPUA 4MZ9A 5LMNL 4A3MH 2UUBL 2YU9H 4DK3C 4LF7L 3RZDH 4X66L 3ULLA 1J6QA 1A0IA 3NENA 3UDFA 4C3IH 4AH6A 4X64L 1D7QA 2F52A 4DR5L 2HT1A 4A3CH 3VDYA 3LGJA 2EXDA 4A3KH 2JA6G 2K50A 4C3HH 4HJAA 2H5XA 2K52A 2K5NA 2RF4A 3CAMA 4LF4L 1PH6A 3HFZB 4B3ML 3KDFA 4GN4B 1OXSC 5FJ8G 2D0PA 3S1MH 3RLFA 2HQLA 2WP8J 4OXPA 5JEAG 4EQ5A 1JJ2A 2UXDQ 1XNRQ 2L15A 3D0FA 2Q2HA 3H0GG 4TQUS 1U0LA 3I4OA 4GOPA 1X3EA 4P73A 3UE1A 1XMQQ 2CCZA 4DR1L 1VQMA 2UXBL 1AH9A 4EX5A 4A3JH 3RLOA 3CMAA 4GOPB 3CCLA 4A3LH 2I5MX 1IXRA 4IPGA 3L2PA 4GOPC 2Q2UA 4B3SQ 1FGUA 5C44G 3S17H 4K0KQ 5GQOA 4R4CA 4JI7L 2VNUD 4LUOA 4B3TL 2XGTA 1IBML 4LF6Q 1WYDA 3AFPA 4JI1Q 4DV5Q 3A74A 3CXCA 5IE8A 1QZHA 1PVOA 2IX1A 1I50H 1YJ9A 2LXJA 5C0XI 3S15H 1W3SA 4UP7A 4GKKQ 1SMXA 4A3EG 3BZCA 4LF5L 3PO2H 5C0XG 2JE6I 1D8LA 1X54A 3KFUA 4J15A 1VQGA 3K81C 5IYCG 2AWNA 2UU9Q 4LFCQ 4JYAL 2NZHA 1UE1A 4JBJA 3T1HL 2RHSB 2PMZE 5M5WH 1I94L 1YHQA 1K9MC 2E2JH 3GTMH 4P75A 4PZ6A 3E0EA 3F2DA 1VQEA 3CCJA 2VQEL 4DUYL 3HOZG 5IYBG 3JC66 3W1BA 4A75A 3FKIG 1X9NA 1N8RC 1JJCB 2C35B 4AIMA 3UDXA 3J7ZC 1N9WA 5BR8L 3J7A5 4KHPQ 3ER0A 5C3EG 1UE7A 4IJHA 2WB1E 3GTLH 1Y1WH 1BVSA 1PHJA 1N34L 1V43A 1VQOA 1E3PA 2D62A 3MEFA 3PF4A 2B63G 1V9PA 3K80C 4DR3Q 4C2MH 2UUAQ 3AEVA 3HOYH 1V1QA 1A8VA 1UWVA 1FJGL 2JEAI 4UP9A 1VQ4A 3J81j 1K8GA 4LF9L 4OWWB 2F4VQ 4DV3L 1VS0A 3K7UC 5GADC 2VW9A 4LW1A 1B70B 2GN5A 4P72A 4R1JA 4BY7H 3PUVA 3STBC 1VQFA 2HHHL 1C9OA 2R7DA 4DUZQ 3TQYA 1BKBA 1XMOL 1SFOH 3L7ZC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NN6 I;  4KLK A;  4A4I A;  1KHI A;  3EBE A;  3H0G H;  4HJ8 A;  1JMC A;  2KHJ A;  2JA7 G;  5C0X J;  2AMC B;  2K5H A;  2NN6 G;  1LUZ A;  2N49 A;  3T1Y L;  3FHW A;  4TVA B;  3D31 A;  4AQY Q;  2VUM G;  3PO3 H;  1HNW L;  3OTO Q;  3MXN B;  2Q2T A;  1YNX A;  5FLM H;  5LMU L;  3TRZ A;  3G6E A;  1KC8 C;  4FDB A;  2N8N A;  1L0W A;  3M85 A;  1TWF H;  2VY3 A;  5C44 H;  1YEZ A;  4JI4 L;  2LXK A;  2QA4 A;  1YI2 A;  1IBK L;  4BY1 G;  4GLX A;  1UE6 A;  1ASZ A;  3JAM i;  3HOW H;  1VQD A;  4X65 L;  2Q2I A;  2K4K A;  3HOV H;  1SN8 A;  3CF5 A;  1E7Z A;  1PH9 A;  4DR2 Q;  1CUK A;  2IHE A;  3I55 A;  2MO0 A;  3S1N H;  1XTD A;  4A3E H;  4LNQ A;  1NMG A;  4DR4 Q;  5M3M G;  3FP9 A;  4A3I G;  4PMW A;  1KRT A;  3M9B A;  3HOX G;  1VQH A;  5IYC H;  1WJJ A;  1YIJ A;  4GLA C;  1NJI C;  3PSI A;  3W1G A;  5C4X H;  2UUC Q;  1SE8 A;  5M5X H;  4O2D A;  1GKH A;  1G29 1;  4IO9 A;  3HOZ H;  3M4Q A;  2A1A A;  1RIP A;  1XPR A;  3FKI H;  4BBR G;  2ALY B;  1QVG A;  4JI5 Q;  1PH1 A;  1CKM A;  2R92 G;  1VQJ A;  1M90 C;  2YTX A;  4PZ7 A;  5C3E H;  3CD6 A;  2R7Z G;  1Y1V G;  2R93 G;  3STB D;  4HJ9 A;  3GTP H;  4JBW A;  4NXN Q;  4GN3 B;  1Q12 A;  3PCO B;  1YHB A;  4GLV B;  4JG2 A;  4RMF A;  2QEX A;  3RZO H;  2R6G A;  3F8T A;  4JI6 Q;  5IYD H;  2Y0S G;  4GS3 A;  1EQQ A;  1N32 L;  1YHA A;  3E9H A;  3HKS A;  1HR0 W;  1VQC A;  1VQ7 A;  2ZM6 Q;  3F1Z A;  2BH8 A;  4JI2 Q;  1FVI A;  3OYY A;  4AYB G;  4KI0 A;  1XNR L;  3M4O H;  2UXD L;  5J3B A;  3DM3 A;  1XMQ L;  2WAQ E;  4WJ4 A;  1L1O A;  1VCI A;  4HID A;  4KHZ A;  2E5L Q;  2BA1 A;  3UDG A;  2F3I A;  1DGS A;  3CCR A;  4C3J H;  2UUB Q;  4LFB Q;  3K0X A;  1L1O B;  1ASY A;  1TWH H;  4GKJ Q;  5M5Y H;  5HY6 A;  4P71 A;  1E22 A;  4B3S L;  1LM0 A;  2VUM H;  3U4V A;  3CP0 A;  3EIV A;  1EIY B;  4K0K L;  4BXX H;  2ZJR A;  1SRU A;  1GVP A;  2JJQ A;  4LF6 L;  3HOU H;  2WFW A;  4JI1 L;  5H1S E;  4L5S A;  1X56 A;  4DV5 L;  1YZ6 A;  1O7I A;  4GKK L;  1YJN A;  5IP7 G;  1J5E Q;  1B7Y B;  1KAW A;  3KF8 B;  1HNX Q;  3I4M G;  1KXL A;  1EIF A;  4LF8 Q;  4OWX B;  3B6Y A;  3S1Q H;  5GAH C;  2ZTE A;  4YY3 Q;  2A8V A;  3U50 C;  1OXT A;  3CCU A;  3G4S A;  1VQB A;  4LFC L;  1OXX K;  5M3M H;  5LMN W;  4DV7 Q;  2UU9 L;  4B3R Q;  4A93 G;  5GAG C;  4DPG A;  1K73 C;  2HIX A;  2KEN A;  3EN2 A;  2WAQ G;  3RN2 A;  4JI8 Q;  2Z6K A;  2BH2 A;  4X62 Q;  2IHF A;  3GTO H;  1C7Y A;  1LYL A;  4QQB X;  3I4N H;  1OXV A;  1VQK A;  1WOC A;  4JBM A;  3PV0 A;  2MNA A;  4DR7 L;  4NPS A;  2NVT H;  1WCM H;  4PZ8 A;  2CWP A;  1CSP A;  2YTV A;  4KHP L;  1CKN A;  2Z6K C;  5AJ3 Q;  1Q1B A;  3CW2 C;  4OO1 G;  3KJP A;  3PUW A;  4BBS G;  5JEA J;  1KIX A;  1PA6 A;  2NVX H;  5HGQ A;  2K75 A;  1PYS B;  1VQN A;  1NE3 A;  3RLN A;  3J80 c;  1EQR A;  4DR3 L;  3PUZ A;  1CKN B;  2IX0 A;  3IRB A;  2UUA L;  1Y1V H;  4R4I A;  4MNO A;  4DK6 C;  4HIM A;  3K7A H;  2ZJQ A;  3CC2 A;  3S14 H;  1UEB A;  4DV4 Q;  3RN5 A;  2F4V L;  2ZTD A;  2JA6 H;  4LFA Q;  2VZA A;  3CCS A;  3CCV A;  1FL0 A;  1PV4 A;  3DLL A;  1QZG A;  2JEB I;  4JYA Q;  1XNQ Q;  4DUZ L;  2CKZ B;  2ZJP A;  1S3O A;  5IY0 A;  2JA5 G;  4DR6 Q;  2JA8 G;  5IP9 G;  3ERS X;  5FJ8 H;  1B8A A;  3F2B A;  5M3F G;  1OXU A;  1PH4 A;  3S16 H;  3S2D H;  1IBL L;  4JBK A;  2NZO A;  4A3M G;  4LUV A;  2NVQ H;  4DV6 Q;  3U4Z A;  2GVA A;  4IOC A;  4YCW A;  4AQY L;  3OTO L;  1Q8K A;  4A76 A;  4JI0 Q;  4X6A H;  2I0Q A;  3GDE A;  1VQ6 A;  4YCV A;  3AYH B;  2RHQ B;  2ID0 A;  3CPF A;  3CQZ H;  4A3K G;  3SGI A;  4ALP A;  1HZ9 A;  2CQO A;  2UXC Q;  4HIO A;  5IWA Q;  1EOV A;  4QIW E;  1I5F A;  2CWA A;  4L5R C;  2MFI A;  1OTC A;  1G51 A;  3NEL A;  4YHH Q;  5FLX c;  4DR2 L;  5IP7 H;  3HKZ G;  3M4P A;  4QGU A;  4JOI A;  4UPA A;  1HH2 P;  3I4M H;  4DR4 L;  1JB7 A;  2IT1 A;  1I3Q H;  2Y0S E;  2ATW A;  4DV2 Q;  4Y52 H;  1N36 Q;  2PI2 E;  4DV0 L;  1EWI A;  3OW2 A;  1HNZ Q;  2AHO B;  2ZTC A;  4JOI C;  4OX9 Q;  4A93 H;  3UDI A;  4AYB E;  4OON A;  4LUZ A;  4H02 A;  1VQA A;  1IYJ B;  1KQS A;  5E7N A;  2YYZ A;  1X3F A;  3KYH C;  1HR0 Q;  2VS1 A;  2I5L X;  2AWO A;  4JCV E;  4YWM A;  4BA1 I;  1CKO A;  1UE5 A;  4GNX A;  4JI5 L;  5IYB H;  4DV1 Q;  5GAE C;  2LSS A;  3RR5 A;  1E1O A;  1NBW A;  1SRO A;  1VQI A;  1EFW A;  1JE5 A;  3BJU A;  4GN5 A;  4BBS H;  4GNX B;  1QVC A;  1T9H A;  4GNX C;  4NXN L;  3PO2 G;  2VQF Q;  1K0R A;  1XPO A;  2K5V A;  3L0O A;  1R9T H;  4UP8 A;  1M1K C;  4NXM Q;  3ZJY C;  1TXY A;  4JI6 L;  2B63 H;  1VQ9 A;  1RL2 A;  3A0J A;  4JC0 A;  2DGY A;  1Q86 C;  4WJ3 M;  3I2Z A;  2ZM6 L;  2OWO A;  3PUX A;  4JI2 L;  3GTG H;  1S72 A;  1LTL A;  1IZ6 A;  4JI3 Q;  2IY5 B;  5K36 G;  1HZB A;  3GTK H;  2E2H H;  4JV5 Q;  2N3S A;  2OQK A;  4OWT B;  2E5L L;  4IOA A;  2MO1 A;  2E8G A;  1G6P A;  2B29 A;  1SLJ A;  1N33 Q;  1NMF A;  4LFB L;  4GKJ L;  1Y1W G;  4IFD I;  3TS0 A;  2JA7 H;  1NTG A;  5LMN Q;  1Z47 A;  1X3G A;  1Q81 C;  3BU2 A;  5IT9 c;  3GTJ H;  4LF7 Q;  1JT8 A;  4IFD G;  1L1O C;  1Q1E A;  4X66 Q;  3HOY G;  2D0O A;  1VQL A;  1QVF A;  2MQH A;  4HJ7 A;  1PH2 A;  5JJK A;  4X64 Q;  1P16 A;  3KJO A;  4A3D G;  4DR5 Q;  3G71 A;  1J5E L;  2E2I H;  2HIV A;  4PG3 A;  1CSQ A;  2KCT A;  4P74 A;  1MJE A;  4A3G G;  4BY7 G;  1EUJ A;  1X55 A;  1HNX L;  3J81 c;  1XJV A;  3H3V I;  1N32 Q;  3U58 A;  4LF8 L;  4LF4 Q;  4BY1 H;  1YVC A;  1A62 A;  4YWL A;  4YY3 L;  1JJG A;  2PQA A;  2QGQ A;  3BZK A;  4B3M Q;  1K83 H;  2JQO A;  3GO5 A;  2A19 A;  4DV7 L;  4B3R L;  1P8L A;  3KDF B;  3TEH B;  1BBW A;  3Q8D A;  1A63 A;  3E9I A;  3J80 i;  4XIG S;  3TRE A;  4A3I H;  2EIF A;  2PQA B;  3PIO A;  4JI8 L;  4HIK A;  1Q82 C;  3A5U A;  3HOX H;  1VQ5 A;  4X62 L;  3PO3 G;  2V1C C;  4IPD A;  5FLM G;  4POG A;  4DR1 Q;  3PUY A;  2UXB Q;  3CC7 A;  2JA9 A;  3CC4 A;  1K3R A;  1KD1 C;  3I7F A;  5ELN A;  4DAY B;  5AJ3 L;  3F2C A;  2ASB A;  1C0A A;  4OO1 I;  1EYG A;  1GM5 A;  2EQS A;  4JI7 Q;  3HOW G;  2R92 H;  4B3T Q;  2OQ0 A;  4BBR H;  3HOV G;  1IBM Q;  1Y14 B;  1TWC H;  2BA0 A;  3M7N A;  1I6H H;  2R7Z H;  1E1T A;  1NY4 A;  1PH5 A;  3CME A;  3CCM A;  4DV4 L;  1X6O A;  2R93 H;  3GD7 A;  5ELO A;  4DAM A;  4LF5 Q;  4LFA L;  1PH3 A;  3HKZ E;  4XTC S;  3KOJ A;  2GVB A;  1MIU A;  3PIP A;  4IFD J;  1XNQ L;  1VQP A;  3UE0 A;  3KF6 A;  5C4X G;  4DR6 L;  2OTJ A;  3TS2 A;  2B3G A;  4MTN A;  3T1H Q;  1S40 A;  1I94 Q;  4A3F G;  3KF6 B;  4A3B G;  2KHI A;  2AKW B;  1H95 A;  1HZA A;  4BA2 I;  2VQE Q;  4QJF A;  4DKA C;  4DUY Q;  4DV6 L;  4DR7 Q;  4HJ5 A;  4APV A;  1SR3 A;  2RCN A;  4JI0 L;  1HJP A;  1Q7Y C;  5BR8 Q;  1Z9F A;  2FXQ A;  1TWG H;  2UXC L;  1PH7 A;  5IWA L;  3S1R H;  4R4O A;  3K8A A;  1N34 Q;  4A3C G;  5IYD G;  5GRO A;  1YJW A;  2ES2 A;  1KL9 A;  4A3D H;  3I56 A;  2PNH A;  4YHH L;  3RNU A;  1FJG Q;  3WWV A;  1PH8 A;  1QUQ A;  4A3G H;  4LF9 Q;  3M3Y H;  4QL5 A;  3CCE A;  4DV3 Q;  3PGZ A;  4DV2 L;  2R7F A;  1N36 L;  4LWC A;  1L2F A;  3CCQ A;  4UY8 C;  1HNZ L;  1HZC A;  1MKH A;  4IJL A;  3ULJ A;  1QUQ B;  2I5H A;  2HHH Q;  4OX9 L;  3H3V H;  2DUD A;  1XMO Q;  5EAY A;  1IBL Q;  1AE2 A;  2NVY H;  2N78 A;  1U5K A;  2OCE A;  4A3J G;  1WFQ A;  2UUC L;  4A3L G;  1MJC A;  3ULP A;  1GD7 A;  1PFS A;  1HR0 L;  4BXX G;  5JJL A;  1WI5 A;  3T1Y Q;  3HOU G;  4POF A;  2WB1 G;  2JK8 A;  4DV1 L;  1HNW Q;  4YCU A;  5LMU Q;  3AQQ A;  3S24 A;  4NB3 A;  5JJI A;  2KBN A;  5C4J H;  4RG1 A;  3W5O A;  4DNI A;  4Y7N H;  1IL2 A;  4L5T A;  4IPH A;  3S2H H;  2Z0S A;  1Q46 A;  3G48 A;  4R4Q A;  1K8A C;  2VQF L;  2PI2 A;  4IPC A;  4JI4 Q;  4NXM L;  1YIT A;  2KCM A;  1IBK Q;  3ICE A;  3KLW A;  1E24 A;  4YWK A;  4X65 Q;  2OTL A;  3AFQ A;  1X65 A;  1GO3 E;  3PF5 A;  3GTQ H;  2XTI A;  4DV0 Q;  5DLQ E;  1PYB A;  1VQ8 A;  1KRS A;  3NBH B;  4R4T A;  1YBY A;  4ME3 A;  2K14 A;  4JI3 L;  2CFM A;  2YTY A;  3I4N G;  4JV5 L;  2YV5 A;  4QY7 A;  3H15 A;  3CPW A;  4O0A A;  1AE3 A;  1W2B A;  3NEM A;  1WCM G;  1TWA H;  4A3F H;  3JAM c;  2JA5 H;  1N33 L;  5IP9 H;  3J81 i;  2JA8 H;  4A3B H;  4L5Q A;  5M3F H;  3A5Z B;  1BBU A;  2VL6 A;  1XPU A;  4MZ9 A;  5LMN L;  4A3M H;  2UUB L;  2YU9 H;  4DK3 C;  4LF7 L;  3RZD H;  4X66 L;  3ULL A;  1J6Q A;  1A0I A;  3NEN A;  3UDF A;  4C3I H;  4AH6 A;  4X64 L;  1D7Q A;  2F52 A;  4DR5 L;  2HT1 A;  4A3C H;  3VDY A;  3LGJ A;  2EXD A;  4A3K H;  2JA6 G;  2K50 A;  4C3H H;  4HJA A;  2H5X A;  2K52 A;  2K5N A;  2RF4 A;  3CAM A;  4LF4 L;  1PH6 A;  3HFZ B;  4B3M L;  3KDF A;  4GN4 B;  1OXS C;  5FJ8 G;  2D0P A;  3S1M H;  3RLF A;  2HQL A;  2WP8 J;  4OXP A;  5JEA G;  4EQ5 A;  1JJ2 A;  2UXD Q;  1XNR Q;  2L15 A;  3D0F A;  2Q2H A;  3H0G G;  4TQU S;  1U0L A;  3I4O A;  4GOP A;  1X3E A;  4P73 A;  3UE1 A;  1XMQ Q;  2CCZ A;  4DR1 L;  1VQM A;  2UXB L;  1AH9 A;  4EX5 A;  4A3J H;  3RLO A;  3CMA A;  4GOP B;  3CCL A;  4A3L H;  2I5M X;  1IXR A;  4IPG A;  3L2P A;  4GOP C;  2Q2U A;  4B3S Q;  1FGU A;  5C44 G;  3S17 H;  4K0K Q;  5GQO A;  4R4C A;  4JI7 L;  2VNU D;  4LUO A;  4B3T L;  2XGT A;  1IBM L;  4LF6 Q;  1WYD A;  3AFP A;  4JI1 Q;  4DV5 Q;  3A74 A;  3CXC A;  5IE8 A;  1QZH A;  1PVO A;  2IX1 A;  1I50 H;  1YJ9 A;  2LXJ A;  5C0X I;  3S15 H;  1W3S A;  4UP7 A;  4GKK Q;  1SMX A;  4A3E G;  3BZC A;  4LF5 L;  3PO2 H;  5C0X G;  2JE6 I;  1D8L A;  1X54 A;  3KFU A;  4J15 A;  1VQG A;  3K81 C;  5IYC G;  2AWN A;  2UU9 Q;  4LFC Q;  4JYA L;  2NZH A;  1UE1 A;  4JBJ A;  3T1H L;  2RHS B;  2PMZ E;  5M5W H;  1I94 L;  1YHQ A;  1K9M C;  2E2J H;  3GTM H;  4P75 A;  4PZ6 A;  3E0E A;  3F2D A;  1VQE A;  3CCJ A;  2VQE L;  4DUY L;  3HOZ G;  5IYB G;  3JC6 6;  3W1B A;  4A75 A;  3FKI G;  1X9N A;  1N8R C;  1JJC B;  2C35 B;  4AIM A;  3UDX A;  3J7Z C;  1N9W A;  5BR8 L;  3J7A 5;  4KHP Q;  3ER0 A;  5C3E G;  1UE7 A;  4IJH A;  2WB1 E;  3GTL H;  1Y1W H;  1BVS A;  1PHJ A;  1N34 L;  1V43 A;  1VQO A;  1E3P A;  2D62 A;  3MEF A;  3PF4 A;  2B63 G;  1V9P A;  3K80 C;  4DR3 Q;  4C2M H;  2UUA Q;  3AEV A;  3HOY H;  1V1Q A;  1A8V A;  1UWV A;  1FJG L;  2JEA I;  4UP9 A;  1VQ4 A;  3J81 j;  1K8G A;  4LF9 L;  4OWW B;  2F4V Q;  4DV3 L;  1VS0 A;  3K7U C;  5GAD C;  2VW9 A;  4LW1 A;  1B70 B;  2GN5 A;  4P72 A;  4R1J A;  4BY7 H;  3PUV A;  3STB C;  1VQF A;  2HHH L;  1C9O A;  2R7D A;  4DUZ Q;  3TQY A;  1BKB A;  1XMO L;  1SFO H;  3L7Z C; 
#chains in the Genus database with same CATH topology
 4A4I A;  4OEM B;  3QOJ A;  3EBE A;  3H0G H;  2JA7 G;  1S5F D;  5C0X J;  3D31 A;  5CC4 A;  2EDG A;  2Q2T A;  5FLM H;  1UUP A;  1L0W A;  4X3U A;  1TWF H;  5JAV A;  1I50 B;  5COR A;  2H1E A;  4JI4 L;  1PTO F;  1IBK L;  4BY1 G;  4GLX A;  1UE6 A;  4BS9 A;  1X3P A;  2B8F A;  3HOW H;  2EOT A;  2KEE A;  2Q2I A;  3HOV H;  1SN8 A;  2MO0 A;  4LNQ A;  1HRJ A;  1EZ6 A;  4PMW A;  5M5W B;  3M9B A;  2E2J B;  3GTM B;  2BE5 D;  1ILQ A;  4G7Z C;  1VQH A;  1F2L A;  5IGF A;  1WCM B;  1PYW D;  3PSI A;  2UUC Q;  1AP0 A;  2NBF A;  3V2T A;  2A5H A;  4YIJ A;  3OWE B;  4ME5 A;  5AFW A;  4FF3 A;  4JI5 Q;  1WTX A;  1JCK B;  2R92 G;  1C8C A;  2R7Z G;  4WJW A;  3EFX D;  3J81 L;  3U9S A;  1EL0 A;  1FNV A;  4N9P A;  1YHB A;  4JG2 A;  3H09 A;  2QEX A;  5I6Y A;  1IW7 D;  4IQZ A;  1J9O A;  1BR9 A;  3DEO A;  5FO9 B;  3F1Z A;  2BH8 A;  1XYI A;  1I6V C;  4DK1 A;  1MHW C;  1L1O A;  1Y8P B;  2BA1 A;  2B2U A;  2VB3 X;  1TQO A;  2QKI C;  5G3L D;  5C4Z A;  4LFB Q;  5C44 B;  1L1O B;  1F77 A;  3I8Z A;  1JE4 A;  1EIH A;  1E22 A;  1LM0 A;  5EGT A;  3EIV A;  4K0K L;  1SMY C;  5CMD A;  3K59 A;  1SRU A;  3D4R A;  1KAB A;  4G57 A;  3P20 A;  3KF8 A;  1YZ6 A;  3I90 A;  1Q8I A;  1YJN A;  5IP7 G;  1KAW A;  4M1U B;  2PCF B;  3KF8 B;  1KXL A;  2ENB A;  1II3 A;  4OWX B;  2ZTE A;  4YY3 Q;  2A8V A;  4CDE C;  4KKT A;  3G4S A;  2I46 A;  3BG3 A;  1DM0 B;  1XTC D;  3EN2 A;  3WDN A;  2EJF C;  2Z6K A;  3FKI B;  3GTO H;  1C7Y A;  1LYL A;  2ICI A;  1BDO A;  5FLX E;  4JBM A;  3PV0 A;  4DR7 L;  5C3E B;  2CWP A;  1CSP A;  2YTV A;  2B39 A;  5DM6 3;  1S5E D;  4RCN A;  5AJ3 Q;  3CW2 C;  2EYH A;  4OO1 G;  1FGB D;  1I4P A;  2R92 H;  3RZO B;  5HGQ A;  4HCS A;  1ZEQ X;  3J80 c;  2UUA L;  3KLS X;  1V1P A;  3K7A H;  4RGN A;  4MIU A;  2RVL A;  2X6L A;  3S14 H;  3RN5 A;  4PV1 C;  2SNS A;  4LFA Q;  5IGD A;  1FL0 A;  3QOL A;  1V1P B;  3VR2 A;  3DLL A;  1PV4 A;  1QZG A;  3MFY A;  3EA6 A;  5C3X A;  2M9V A;  3ERS X;  1WVL A;  3F2B A;  1PH4 A;  3BYY B;  3GTJ B;  4A3M G;  5IGG A;  1PTO H;  4KN7 C;  3SDZ A;  2F0P A;  3OTO L;  3NQT A;  4JI0 Q;  3NTH A;  2KEC A;  4C56 C;  1KAA A;  1HPC A;  4A3K G;  3SGI A;  1PLF A;  2QF7 A;  2EYF A;  1MSG A;  3NEL A;  4YHH Q;  2AQ2 B;  5COY A;  5IP7 H;  4DR2 L;  4TRD A;  4DR4 L;  2ATW A;  2K05 A;  4RH6 A;  1N36 Q;  2PI2 E;  1NNX A;  2K01 A;  5IT9 E;  3ITP A;  3UDI A;  4LUZ A;  1VQA A;  2KA7 A;  2DY8 A;  4K5V A;  4DXG A;  5E7N A;  2L55 A;  3DUZ A;  2R93 B;  3ZYY X;  1EFW A;  2QW7 A;  1X3Q A;  1QVC A;  4NXN L;  3PO2 G;  2VQF Q;  1XPO A;  4NXM Q;  3MAQ A;  1XXG A;  5F2D A;  5DM7 3;  4WJ3 M;  1TII D;  1O78 A;  4FXK C;  4ID6 A;  1JOK A;  3GTG H;  1IZ6 A;  5D14 A;  1YNN D;  1I4G A;  4O42 A;  2IY5 B;  3H6M A;  2E5L L;  4OWT B;  4KHV A;  1MSH A;  2E8G A;  5JVH 3;  2EPB A;  2HDM A;  5A2Q L;  1EZ8 A;  1NMF A;  3NWT A;  1Z47 A;  1X3G A;  4LF7 Q;  3BU2 A;  4IFD G;  1L1O C;  4XXE A;  1VQL A;  1HTL D;  2H4O A;  3AMU A;  3EVQ A;  1P16 A;  3QB3 A;  4A3D G;  1GUG A;  2HIV A;  4XT3 B;  5TSS A;  4A3G G;  3MTS A;  2F0I A;  3MXP A;  5D65 A;  4EQO A;  3H3V I;  1YVC A;  5HGT A;  2PQA A;  2QGQ A;  4B3M Q;  3Q6S A;  3TEH B;  3KDF B;  3VR5 A;  1BBW A;  3E9I A;  4DA2 A;  4XIG S;  3TRE A;  2PQA B;  4QF4 A;  3PIO A;  3A5U A;  1T5X D;  3FPP A;  1VQ5 A;  3V05 A;  1B9N A;  4ZUJ A;  1EYD A;  1BBX C;  4BBS B;  1GM5 A;  3A55 A;  2EQS A;  1R9T B;  3FDT A;  4JI7 Q;  4B3T Q;  3D4D A;  5HUR A;  3C3L A;  1Y14 B;  4QUC A;  3D3R A;  1BO0 A;  1NY4 A;  2AQ3 B;  3CME A;  3GD7 A;  4CJ2 C;  4LF5 Q;  3NXW A;  1PH3 A;  1R4Q B;  1MIU A;  2DN8 A;  3GTK B;  2JA5 B;  3UE0 A;  2JA8 B;  5C4X G;  1WTR A;  2J7Z A;  1JOQ A;  2SOB A;  1K3B C;  4C3I B;  1KLG D;  4DR7 Q;  1GOZ A;  3FMC A;  4HJ5 A;  1CK1 A;  1GJX A;  4G7H C;  1HCZ A;  4C3H B;  1TWG H;  2BDO A;  5FLX L;  2E2I B;  4L8J A;  1J8I A;  4IFD H;  1O80 A;  1N34 Q;  3LWU A;  4A3C G;  4G7O C;  3QWN A;  2JN4 A;  5EPJ A;  3HKZ B;  4BY1 B;  4A3D H;  3I56 A;  3KBG A;  1D5Z C;  1MD2 D;  1FJG Q;  2A6E D;  4K6L A;  3JAM E;  3Q23 A;  4A3G H;  3PGZ A;  1H9S A;  3A8K E;  1HZC A;  2HHH Q;  2F0G A;  2DUD A;  1XMO Q;  1H9S B;  1DYQ A;  2NVY H;  4C3J G;  3VR4 A;  3S17 B;  3FRP B;  4NKL A;  2E76 C;  1WFQ A;  1MJC A;  5CV6 A;  5E4X A;  2WB1 G;  4DV1 L;  1HNW Q;  4R8I A;  3S24 A;  4DNI A;  4Y7N H;  3S2H H;  2Z0S A;  1K8A C;  2PI2 A;  5IGC A;  2KCM A;  3VYS A;  4YWK A;  1PMR A;  2K28 A;  3GTQ H;  2DY7 A;  4FF4 A;  4R9W A;  1AW7 A;  4EGV A;  2PW5 A;  3SK5 A;  4CKE A;  4JI3 L;  3WOF A;  2YTY A;  4J8Q A;  2YV5 A;  1SBB B;  2HQE A;  4ZLT F;  1AE3 A;  1T5E A;  1VDZ A;  4DK0 A;  1WCM G;  3T53 B;  5IT9 L;  2PYK A;  1DXM A;  1TWA H;  1Y1W B;  1N33 L;  1CHQ D;  3J81 i;  5JVG 3;  5KYL A;  5M3F H;  1XPU A;  4MZ9 A;  5LMN L;  3S1R B;  2UUB L;  3DMU A;  5J39 A;  3ULL A;  3UDF A;  4IUU A;  4X64 L;  4DR5 L;  4BY7 B;  3I4L A;  4A3C H;  3VDY A;  2H5X A;  2K5N A;  1D1I A;  3H3V C;  3HFZ B;  4IUT A;  5JEA G;  2N55 A;  1JJ2 A;  3SXH A;  3PO3 B;  2Q2H A;  3RUZ A;  1XMQ Q;  3EQL C;  5E1F A;  4DR1 L;  3DEP A;  3K58 A;  4EX5 A;  3RLO A;  5ELC A;  2F0K A;  3SHL A;  2XN9 C;  5DNF A;  4ZUI A;  3J80 L;  4B3S Q;  5C44 G;  1D6E C;  1NSN S;  1CTM A;  2VNU D;  4LF6 Q;  4JI1 Q;  4DV5 Q;  1QZH A;  4B08 A;  5JPN C;  4XQN A;  1I50 H;  1K28 A;  4GKK Q;  4J1M A;  1SYC A;  3QIA A;  5C0X G;  5ELB A;  1PRT C;  2PPB C;  1SEB D;  1VQG A;  2UU9 Q;  2Q8I B;  4A3B B;  1UE1 A;  3K5O A;  5M5W H;  2RCF A;  1YHQ A;  2E2J H;  3GTM H;  3VYT A;  3F2D A;  1VQE A;  1H9J A;  2VQE L;  5K36 H;  1DD2 A;  1LT3 D;  4A75 A;  2PZT A;  1D5M C;  3FKI G;  1JQY D;  2C35 B;  1N9W A;  3J7A 5;  4KHP Q;  5C3E G;  1EYC A;  2EXZ A;  4IJH A;  1STE A;  2WB1 E;  1STB A;  1V43 A;  4K2L A;  2M2L A;  2B63 G;  2F0T A;  4DR3 Q;  4K5W A;  1HQM C;  1A8V A;  4MTK A;  3L9A X;  1BQQ T;  2EY1 A;  3J81 j;  4OWW B;  2F4V Q;  3K7U C;  4LW1 A;  4P72 A;  4R1J A;  1BCP B;  3PUV A;  1VQF A;  2DJG C;  3TQY A;  3ND8 A;  2ZXO A;  1TR5 A;  4A3J B;  3L3O C;  1AN8 A;  2F3V A;  4N8F A;  4HJ8 A;  3AB9 A;  3TP6 A;  1JMC A;  2MUY A;  1TY0 A;  2AMC B;  2NN6 G;  3CRL C;  5KRU A;  2F1M A;  4AQY Q;  2Z6B A;  3G6E A;  1KC8 C;  3M85 A;  2VY3 A;  3S15 B;  5C44 H;  4J6H A;  2ICE C;  2F0N A;  3SVM A;  3PO2 B;  1ASZ A;  1U4R A;  5BN4 A;  2A74 C;  2K4K A;  1QNK A;  2HD3 A;  4RGT A;  1CUK A;  4H44 C;  3S1N H;  2PZW A;  1NMG A;  5KGU A;  4HMJ A;  5C0X H;  3FP9 A;  3T56 B;  5BN3 A;  1KRT A;  4OIJ A;  3HOX G;  3D4W A;  1HA6 A;  4ZKB B;  2NVT B;  1DJR D;  2A69 C;  1EU4 A;  1NJI C;  1SJE D;  3IL8 A;  3V96 A;  1SE8 A;  5C3W A;  4U68 A;  1G29 1;  1EYA A;  3GTL B;  3NBI A;  1NCV A;  1B50 A;  3FKI H;  1QVG A;  2ALY B;  1EY9 A;  3E3X A;  1ET6 A;  1PH1 A;  3VR6 A;  3DM1 A;  4B9W A;  2YTX A;  4NW2 A;  5C3E H;  3URY A;  1ICW A;  2O5J C;  3PMF A;  5IIF A;  1JIC A;  4KMU C;  2R93 G;  3STB D;  1TS2 A;  4GLV B;  3RZO H;  3TN2 A;  2R6G A;  2RKS A;  3F8T A;  4JI6 Q;  5IYD H;  2IL8 A;  1N32 L;  1SFO B;  1U4M A;  1VQC A;  3GV3 A;  2L1B A;  2UXD L;  1QE6 A;  3OYY A;  5J3B A;  2LY7 A;  3CKI B;  3QO2 A;  2LFN A;  1WTO A;  1DOL A;  2UUB Q;  2NN6 H;  1ASY A;  1JWM D;  5M5Y H;  1ZYR D;  2L0C A;  2L5T A;  4BXX H;  4HSV A;  5CV9 A;  3LWE A;  3TZD A;  3HOU H;  5H1S E;  4Q5V A;  4L5S A;  3I91 A;  2ZT9 C;  1DCZ A;  1KDA A;  1J5E Q;  4XQJ A;  1IHZ A;  3MC0 B;  2QIL A;  4HCE A;  4DNT B;  4ZAI A;  2QDB A;  4UAI A;  3S1Q H;  5GAH C;  1C48 A;  3GP7 A;  4JK1 C;  5LMN W;  4QCL A;  5GAG C;  2F0H A;  4DPG A;  4WRD A;  2HIX A;  5M5X B;  1K73 C;  3HOZ B;  1SNO A;  4LAA A;  1Z7T A;  4X62 Q;  4RA8 A;  4QQB X;  3I4N H;  1OXV A;  1I4Q A;  1WOC A;  2N88 A;  3HRZ C;  5JOB A;  2MNA A;  1CKN A;  5DEH A;  1JWU D;  1WTQ A;  1HFG A;  4RFB A;  1VF7 A;  4BBS G;  5JEA J;  1PA6 A;  1GHJ A;  2K75 A;  1NE3 A;  3PUZ A;  1CKN B;  2EY2 A;  4DK6 C;  1A3U A;  3IFD A;  2IWH A;  1SXT A;  2IJ0 A;  3CCS A;  2VZA A;  4OL7 A;  3CCV A;  4DUZ L;  5IY0 A;  2JA5 G;  4DR6 Q;  2JA8 G;  1ONL A;  1BCP C;  1B8A A;  4C3J B;  3D8G A;  1IBL L;  1TWH B;  1SDF A;  1EY4 A;  2C5C A;  2VUM B;  4IOC A;  2B2W A;  1CA6 A;  2G5D A;  3MXG A;  4C3I G;  4A76 A;  4X6A H;  2WB1 B;  4YCV A;  5I6W A;  1RCV D;  4ALP A;  1HZ9 A;  3TZU A;  4C3H G;  5IWA Q;  4L5R C;  1G51 A;  3BVG A;  5FLX c;  2O5I C;  3HKZ G;  4R8N A;  1EY7 A;  2OEO A;  1I3Q H;  4Y52 H;  2JP1 A;  2ZTC A;  1W6J A;  3PIO 3;  2HUG A;  3EJI A;  5ELE A;  5CR3 A;  1PZI D;  2L11 A;  4H02 A;  1HQR D;  4ABN A;  1IYJ B;  1H9R A;  4BBR B;  1KQS A;  1LTS D;  1X3F A;  5I4D A;  1G2T A;  1LT5 D;  1TWC B;  2I5L X;  2AWO A;  4JCV E;  5CV7 A;  1CKO A;  4BA1 I;  1NUC A;  3RR5 A;  1E1O A;  1Y1V B;  5ELD A;  4GN5 A;  4BBS H;  4GNX C;  1NR4 A;  2P5Z X;  2BDN A;  1K0R A;  5KNB A;  2Y0S B;  3L0O A;  4KKS A;  1R9T H;  1M1K C;  1TXY A;  2F0F A;  1VQ9 A;  4JC0 A;  4M8A A;  3G7L A;  3I2Z A;  2ZM6 L;  3S2D B;  4JI2 L;  3S16 B;  3R2T A;  2KUM A;  1LTL A;  1DOM A;  2NVQ B;  3MEH A;  3GTK H;  1UAP A;  2MP1 A;  2B29 A;  1SLJ A;  2D5D A;  5C5L A;  4GKJ L;  1LT6 D;  1Y1W G;  2JA7 H;  3N52 A;  1Q81 C;  5IT9 c;  4X66 Q;  2D0O A;  5JJK A;  2KCN A;  2E2I H;  3I4M B;  3J7A F;  4BY7 G;  1N32 Q;  1EUJ A;  1X55 A;  3NTI A;  1HNX L;  1XJV A;  3U58 A;  4LF8 L;  4QB4 A;  4BY1 H;  1JJG A;  3O13 A;  4DV7 L;  4B3R L;  3Q8D A;  3J80 i;  2VB2 X;  4JI8 L;  1EFI D;  4KY6 A;  5DAU A;  1HHV A;  3TSS A;  3PO3 G;  2FHT A;  1YNJ D;  1IYU A;  4DN4 M;  2UXB Q;  5C5M A;  1QJO A;  1K3R A;  1KD1 C;  3F2C A;  2ASB A;  1PFB A;  4GZY C;  1BCP F;  1F9P A;  2F0U A;  2OQ0 A;  2B63 B;  1MGS A;  1O7Y A;  2R7Z H;  3A8I E;  4I65 A;  3X3N A;  4DV4 L;  4G4K A;  5ELO A;  5CYU A;  2A68 D;  3HKZ E;  4XTC S;  2L9H A;  3PIP A;  2E2H B;  1XNQ L;  3KF6 A;  1LTI D;  2C9O A;  3TS2 A;  2TMP A;  4MTN A;  3T1H Q;  1LV9 A;  1S40 A;  4A3B G;  3KF6 B;  2AKW B;  4PNY A;  4X3K A;  1H95 A;  4BA2 I;  4DUY Q;  4DKA C;  4DV6 L;  4I7A A;  5K5P A;  5BR8 Q;  4KY7 A;  4NP5 A;  4N8X 1;  4OGQ C;  2UXC L;  1PH7 A;  1EEF D;  3S1R H;  3K8A A;  1JOR A;  5GRO A;  2B2W C;  4FF2 A;  4FXD A;  2VXW A;  3RNU A;  3WWV A;  4LF9 Q;  4DV3 Q;  4DV2 L;  2MJ8 A;  1L2F A;  3DHQ A;  1HNZ L;  1MKH A;  2LKV A;  3QR8 A;  4IJL A;  3ULJ A;  4BWG B;  3HOX B;  1LTA D;  1QWY A;  4OX9 L;  1IBL Q;  1AE2 A;  2TSS A;  1F9R A;  2NWG A;  1HA5 A;  4A3J G;  5FO7 B;  1GD7 A;  1FNW A;  1HR0 L;  5T1I A;  3HP3 A;  2K1B A;  3AQQ A;  4LMQ D;  2EVB A;  3R93 A;  4CGY B;  4DGZ A;  1I6H B;  5JJI A;  2KBN A;  2IW3 A;  3MHB A;  3W5O A;  1IL2 A;  4L5T A;  4IZ8 A;  4IUR A;  3K57 A;  1JB3 A;  4JI4 Q;  4IPC A;  4OO1 H;  3ICE A;  1IBK Q;  3KK7 A;  2OTL A;  3PF5 A;  4OEL B;  1ML0 D;  1O7Z A;  2M00 A;  2SDF A;  4KD3 A;  1QG7 A;  1IYV A;  1KRS A;  2XRQ D;  1YBY A;  5E3F A;  2K14 A;  4ZKC B;  2CFM A;  4JV5 L;  1LAB A;  1IL8 A;  3S9W A;  1ZKO A;  4O0A A;  1W2B A;  4A3B H;  3JAM c;  4XQQ A;  2NB0 A;  3W2D A;  1AEX A;  2A6H D;  4L5Q A;  1AFP A;  3A5Z B;  2VL6 A;  3M7G A;  2Z1C A;  3I73 A;  4A3M H;  4ZCK A;  4DK3 C;  4IUQ A;  3HOY B;  3BVZ A;  1J6Q A;  1A0I A;  2F0M A;  1D7Q A;  2F52 A;  1A3V A;  1S5C D;  2HT1 A;  3QJY A;  2EXD A;  4A3K H;  2JA6 G;  3M3Y B;  2K50 A;  2K52 A;  2L4N A;  1KDC A;  4LF4 L;  2NTS A;  3KDF A;  5FJ8 G;  2HQL A;  2WP8 J;  3QG1 A;  4EQ5 A;  1DON A;  2B2V A;  1GUT A;  4TQU S;  1U0L A;  3I4O A;  2RDH A;  3M4Y A;  4P73 A;  2NYZ D;  1TWF B;  1M8A A;  1G2S A;  1AH9 A;  3RMH A;  4A3J H;  1KTK A;  3CCL A;  1LTB D;  3LX0 A;  2Q2U A;  4GOP C;  3T13 A;  2KOL A;  1I4H A;  3HOV B;  4K0K Q;  4LUO A;  2ZXP A;  1IBM L;  2B2Y C;  3CXC A;  2IX1 A;  1SE2 A;  3S15 H;  1W3S A;  2QCP X;  3T4A C;  3PO2 H;  2CW0 D;  1EY8 A;  1PRT B;  1U9R A;  1X54 A;  1E0B A;  3MXU A;  1PTO D;  3Q0A A;  3K81 C;  3DWP A;  2Z4I A;  2RHS B;  2HCC A;  1I94 L;  4PZ6 A;  3HOZ G;  5IYB G;  3JC6 6;  1F2M A;  2EY6 A;  3W1B A;  5CV4 A;  5KNC A;  2BE5 C;  5T1G A;  4AIM A;  1N8R C;  5IGB A;  3J7Z C;  1TS4 A;  3GTL H;  2WAC A;  1D1K A;  1H9K A;  3PF4 A;  3SEB A;  1QB5 D;  1SNM A;  1MBY A;  2UUA Q;  1LO5 D;  1A6X A;  1UWV A;  2K03 A;  2RBM A;  2JEA I;  4IUV A;  1JR0 D;  4V0B A;  1H9M A;  1VS0 A;  5GAD C;  2VW9 A;  3CRK C;  3C1E A;  3WOE A;  1BKB A;  3A8J E;  1SFO H;  1IW7 C;  1KHI A;  2EYM A;  1RDP D;  4CDF C;  2KHJ A;  2OT2 A;  2IPK D;  2K5H A;  2XWB B;  2FMM A;  2N49 A;  3T1Y L;  3BYT B;  4TVA B;  2VUM G;  4F88 A;  3OTO Q;  2RSO A;  1F2Y A;  5LMU L;  2BCO A;  1YEZ A;  1PZK D;  4H13 C;  4XT1 B;  2LXK A;  2F3W A;  1VQD A;  4X65 L;  3CF5 A;  1E7Z A;  1G91 A;  4HSP A;  4DR2 Q;  1NAP A;  2IHE A;  3I55 A;  4K6D A;  4DR4 Q;  4A3I G;  1ESR A;  1WTH A;  3NWS A;  1F9Q A;  1WJJ A;  3BVM A;  3W3A A;  4RGM A;  5C4X H;  3TME A;  5M5X H;  4O2D A;  1GKH A;  4IO9 A;  3HOZ H;  3BDC A;  2AUJ D;  2A1A A;  3DXJ C;  3TP5 A;  1RIP A;  4BBR G;  3MFG A;  1RF2 D;  4C2M B;  1M90 C;  3CD6 A;  1SSO A;  1Y1V G;  4HJ9 A;  3OHX C;  3GTP H;  4NXN Q;  1Q12 A;  5CV5 A;  2WKD A;  2Y0S G;  3HKS A;  1HR0 W;  1Q3L A;  4PMC A;  4C1N I;  1CZW A;  1FVI A;  1XNR L;  4KI0 A;  3M4O H;  2K5Q A;  3DM3 A;  2NTT A;  2WAQ E;  5KYI A;  4WJ4 A;  1G8Z D;  1CM9 A;  1VCI A;  2E5L Q;  3BZD B;  3KLR A;  2F3I A;  2KCC A;  3CCR A;  4C3J H;  5J1Z A;  3OIP A;  1TWH H;  3E5S A;  4ZYS A;  5HY6 A;  1VMC A;  2VUM H;  4FVM A;  2B2V C;  2ZJR A;  2WFW A;  2K33 A;  4A3E B;  3VA5 A;  1B7Y B;  3NTK A;  3I4M G;  3ERQ A;  1E2V A;  4K5X A;  1OXT A;  2QEJ C;  4DF7 A;  3CCU A;  1VQB A;  4LFC L;  4ZQ3 A;  2JSO A;  2F0Q A;  2KED A;  3RN2 A;  3X3M A;  2EYO A;  1ZXT A;  1B9M A;  2FIN B;  3SK6 A;  1SYE A;  2MPM A;  1TY2 A;  3D6W A;  4NPS A;  1WCM H;  4ULL A;  4QUF A;  5IOD A;  1CZG A;  3TP8 A;  1Q1B A;  3MWY W;  1HXY D;  3PUW A;  1KIX A;  1M4V A;  1PYS B;  1EQR A;  3IRB A;  1Y1V H;  4MNO A;  4HIM A;  5D3I B;  2ZJQ A;  2F0W A;  2L12 A;  1ROD A;  2D9U A;  2DNE A;  2XVS A;  3LNN A;  2JEB I;  2CKZ B;  5G3L F;  5IP9 G;  2FFK B;  1U4L A;  1FYC A;  1SMY D;  3S2D H;  1OXU A;  5JEA H;  2RQX A;  3S16 H;  1PXU A;  3I3C A;  2NVQ H;  3U4Z A;  2GVA A;  2XWJ B;  4YCW A;  5JPM C;  1Q8K A;  1EEI D;  2I0Q A;  1YNN C;  1VQ6 A;  3AYH B;  2RHQ B;  1AZQ A;  2ID0 A;  2B2T C;  3CPF A;  2F0L A;  4HTH A;  5EPL A;  2CQO A;  4HIO A;  1BXT A;  1EOV A;  4ZK9 B;  2OF1 A;  2CWA A;  2MFI A;  1OTC A;  3IKJ A;  1ENA A;  1V1O A;  4RGO S;  3M4P A;  3A56 A;  4QGU A;  5M3M B;  3HGB A;  2EE1 A;  1HH2 P;  3I4M H;  1JB7 A;  2Y0S E;  5FOB B;  1KNA A;  3R2I A;  3SK8 A;  1LTG D;  2AHO B;  4K2K A;  4JOI C;  1SE3 A;  3JAM L;  1STN A;  1Y8O B;  2JXM B;  4OON A;  3P7J A;  4CKC A;  5FO8 B;  3CHB D;  3J81 E;  2NVX B;  4GNX A;  4JI5 L;  4QIW B;  4DV1 Q;  3SK4 A;  4ILW A;  1QIL A;  5IGE A;  3DWQ A;  1SRO A;  5CGK A;  1JE5 A;  3BJU A;  4GNX B;  2JA6 B;  2K5V A;  4UP8 A;  3BDO A;  3K5L A;  2B63 H;  1B4O A;  1CFM A;  3A0J A;  2DGY A;  2SNM A;  3PIP 3;  1Q86 C;  2CVR A;  1F9S A;  2HCI A;  4AYB B;  4V19 0;  2OWO A;  3PUX A;  4JI3 Q;  4X3S A;  5EPK A;  3OWF A;  5EKL A;  2E2H H;  2WKC A;  2N3S A;  4IOA A;  2MO1 A;  4X3T A;  1N33 Q;  1ET9 A;  4LFB L;  3CQZ B;  2F0D A;  5CV8 A;  4IFD I;  4CDC C;  3CU7 A;  1PRT F;  5LMN Q;  3GTJ H;  2XNA C;  3HOY G;  1QVF A;  4DNR B;  2MQH A;  3J7A V;  4X64 Q;  1X32 A;  1STG A;  4DR5 Q;  4PG3 A;  3Q22 A;  2KCT A;  1JWS D;  3NK9 A;  2I07 B;  5JJZ A;  3UI2 A;  1A62 A;  4YWL A;  4YY3 L;  4A93 B;  2JQO A;  3GO5 A;  2WAQ B;  4FYD A;  2A6E C;  4HIK A;  3HOX H;  1B1Z A;  4DAY A;  4IPD A;  5FLM G;  4POG A;  1A3T A;  3MA2 B;  4DR1 Q;  3CC4 A;  5ELN A;  4DAY B;  5AJ3 L;  1EYG A;  2Q8R E;  1RTN A;  3GTQ B;  2K6A A;  3HOW G;  5LL6 X;  3HOV G;  2F0O A;  2K5D A;  5J22 A;  1GHK A;  2BA0 A;  1I6H H;  4HED A;  1PFN A;  3CCM A;  2R93 H;  1RJT A;  4C1N K;  4DAM A;  4LFA L;  4LK1 C;  2NUC A;  2GVB A;  1S5B D;  1TWA B;  1VQP A;  1FD7 D;  5LL6 S;  3OSO A;  5M3F B;  2OTJ A;  1SJH D;  2B3G A;  4LJZ C;  1DOK A;  4XYQ A;  1HZA A;  2VQE Q;  2PW7 A;  4JI0 L;  1Q7Y C;  1LTR D;  5D3D A;  1LT4 D;  4CJ1 B;  2IX3 A;  5E4W C;  4WFN 3;  2ES2 A;  4YHH L;  4Q0F A;  4KTA A;  1K83 B;  1RHP A;  1PH8 A;  1SNP A;  3M3Y H;  2R7F A;  4A3I B;  4LWC A;  3CCQ A;  1N36 L;  1EWC A;  3H3V H;  2K7V A;  2O2L D;  2RDG A;  3K6O A;  2OCE A;  1LAC A;  2EJM A;  3ULP A;  1PFS A;  2JK8 A;  4YCU A;  4RHS A;  4L63 B;  4NB3 A;  1SYF A;  4RG1 A;  4IPH A;  3G48 A;  1Q46 A;  2VQF L;  4NXM L;  4H7B A;  1YIT A;  3KLW A;  3NBH A;  2XTI A;  5EQ0 A;  1B3Q A;  1A15 A;  1NR2 A;  3NBH B;  2SEB D;  5A2Q E;  4ME3 A;  1SND A;  4KV6 A;  2B8G A;  3TDQ A;  1KLU D;  3H15 A;  2R61 A;  3CPW A;  1HFN A;  1SE4 A;  3C2P A;  2JA5 H;  2JA8 H;  1L0X B;  4L6T B;  4OHJ A;  4LF7 L;  1L0Y B;  4KY5 A;  2E75 C;  4QMG A;  3NEN A;  1EQT A;  1EY0 A;  4MHE A;  4C3I H;  1STY A;  4AH6 A;  1B3A A;  3U9O A;  4KJO A;  4HN7 A;  2D2C C;  4C3H H;  4XDX A;  4HJA A;  2RF4 A;  1PH6 A;  4B3M L;  1OXS C;  5EKI A;  3RLF A;  2UXD Q;  1TVX A;  3OMG A;  2L15 A;  3D0F A;  1RKN A;  4GOP A;  1JC7 A;  1X3E A;  4KKU A;  3UE1 A;  2CCZ A;  1FNU A;  1VQM A;  3CMA A;  4GOP B;  5C4J B;  2I5M X;  2B2Y A;  5EBD A;  1SYG A;  1CQV A;  3S17 H;  5GQO A;  3HEJ A;  4JI7 L;  2J0T D;  4B3T L;  3S1N B;  1WYD A;  3AFP A;  5C0X I;  4UP7 A;  2F0S A;  4A3E G;  3BZC A;  4LF5 L;  5EKK A;  2JE6 I;  2Z8L A;  1D8L A;  1I4X A;  1K8O A;  3KFU A;  4J15 A;  5IYC G;  2AWN A;  1ILP A;  1QNU A;  4JYA L;  4A3F B;  4JBJ A;  4UDU C;  1F2Z A;  2PMZ E;  2Z4H A;  3E0E A;  3CCJ A;  2YU9 B;  3RZD B;  2F0E A;  3UDX A;  3FEW X;  1GUS A;  1UE7 A;  1AZP A;  1Y1W H;  1BVS A;  1N34 L;  1E2Z A;  4K8I A;  3HS0 C;  2F0J A;  2CQA A;  2XIW A;  3K80 C;  4N9T A;  4C2M H;  3AEV A;  1EQV A;  1V1Q A;  1FJG L;  2EYP A;  3S1M B;  5C6A A;  1STH A;  3A7L A;  4OIK A;  1B70 B;  4BY7 H;  5ELF A;  3STB C;  3AU7 A;  3VYU A;  2HHH L;  1C9O A;  2R7D A;  4DUZ Q;  1SYD A;  1XMO L;  4IUP A;  3BDL A;  3L7Z C;  2NN6 I;  2QDL A;  4KLK A;  4EQP A;  5I9P A;  5M5Y B;  4FO2 A;  1DZ1 A;  3MXN A;  1O7L A;  3HOU B;  1LUZ A;  2NZ1 D;  3FHW A;  3J7Y W;  3PO3 H;  1HNW L;  3MXN B;  4CKB A;  1YNX A;  4K8J A;  3TRZ A;  4FDB A;  2N8N A;  2DNC A;  4KK7 A;  1PRT D;  3R3O A;  3G6J B;  4DXF A;  1GUN A;  3S1Q B;  1RTO A;  2QA4 A;  1YI2 A;  3BS1 A;  3JAM i;  1D2B A;  4KJN A;  4JPB W;  1ZYR C;  1PH9 A;  1S5D D;  3TP7 A;  1XTD A;  4A3E H;  5M3M G;  5I9O A;  4EQN A;  4TSS A;  3I4N B;  5IYC H;  1CQF A;  4F7X A;  1YIJ A;  4GLA C;  3E6Z X;  3W1G A;  2F0V A;  4FNF A;  4WOR A;  3Q24 A;  4JVZ A;  3RD4 A;  3M4Q A;  3PQI A;  4S3S A;  1XPR A;  3N6R A;  1CKM A;  1CA5 A;  1VQJ A;  4PZ7 A;  4IUN A;  2FJ2 A;  3P1H A;  5I2X A;  4JBW A;  4GN3 B;  3PCO B;  4RMF A;  4GS3 A;  1EQQ A;  1YHA A;  3E9H A;  2HDL A;  1VQ7 A;  2ZM6 Q;  2EYJ A;  4JI2 Q;  3H0G B;  1IKL A;  3H91 A;  4AYB G;  1GXD C;  1XMQ L;  5BN5 A;  5L37 A;  1C4Q A;  3C46 A;  3J80 E;  4HID A;  4KHZ A;  3UDG A;  1DGS A;  3K0X A;  4GKJ Q;  4B3S L;  4P71 A;  4RWS C;  3U4V A;  3CP0 A;  2B2U C;  1EIY B;  2R3Z A;  1GVP A;  2JJQ A;  4LF6 L;  3HOW B;  4JI1 L;  1X56 A;  4DV5 L;  1O7I A;  1I3Q B;  4F87 A;  4GKK L;  4ZRZ A;  2A69 D;  1XX8 A;  3MZ5 A;  1HNX Q;  1EIF A;  4LF8 Q;  3B6Y A;  3TBI B;  1WD1 A;  3U50 C;  4IAL A;  5M3M H;  1OXX K;  4DV7 Q;  2UU9 L;  1A2T A;  1V8Q A;  4B3R Q;  4A93 G;  2KJX A;  2V4D A;  2KEN A;  2WAQ G;  4JI8 Q;  2BH2 A;  2IHF A;  3OOC A;  1CI3 M;  1VQK A;  2PZU A;  1HUM A;  2G9H D;  2G9D A;  4PZ8 A;  2NVT H;  2XSC A;  4KHP L;  2Z6K C;  1Q90 A;  3KJP A;  2NVX H;  1VQN A;  3RLN A;  4DR3 L;  1E2W A;  4RKL A;  2IX0 A;  1BF4 A;  4R4I A;  3CC2 A;  4Z9C B;  1UEB A;  4DV4 Q;  2F4V L;  2O4X A;  2RSN A;  2ZTD A;  2JA6 H;  1D5X C;  2F03 A;  2MHV A;  3OMC A;  5KEE A;  4JYA Q;  1XNQ Q;  1SNC A;  2E2D C;  2PMZ B;  2ZJP A;  1S3O A;  1I4R A;  5FJ8 H;  2WV6 D;  2JA7 B;  3NP8 A;  5M3F G;  5NUC A;  2JYO A;  2WIN B;  2PQE A;  2NZO A;  4UHV A;  4JBK A;  2B2T A;  4LUV A;  5ISR A;  1Y8N B;  5FKA C;  4DV6 Q;  3DWA A;  4XYO A;  4AQY L;  3GDE A;  2RA4 A;  4F8M A;  1PDQ A;  3CQZ H;  2UXC Q;  3VA7 A;  4QIW E;  1I5F A;  3NSW A;  2K5W A;  1QCB D;  2BOS A;  3VYR A;  4JOI A;  4UPA A;  2CH4 A;  2IT1 A;  2X69 A;  1EOT A;  4DV2 Q;  4DV0 L;  1EWI A;  2Q8T A;  1S4Z A;  3P75 A;  4O1N A;  3OW2 A;  1Z6H A;  1HNZ Q;  1FR3 A;  4OX9 Q;  3GTO B;  4A93 H;  4AYB E;  1K0S A;  1HTP A;  5FK9 C;  5KIX A;  2YYZ A;  3KYH C;  4FXG C;  1HR0 Q;  2VS1 A;  2R92 B;  4YWM A;  3ONA B;  1UE5 A;  3VR3 A;  5IYB H;  2R7Z B;  5GAE C;  2LSS A;  4CHT B;  1CHP D;  1NBW A;  1VQI A;  3K7A B;  1WTV A;  1YNJ C;  3S14 B;  1TS3 A;  1T9H A;  2KQ3 A;  1HUN A;  3I70 A;  2A73 B;  4KN4 C;  3ZJY C;  2J4X A;  4JI6 L;  1BCP D;  3KUP A;  1RL2 A;  4DAV A;  1B2T A;  5EBC A;  1EY5 A;  1SYB A;  4KD4 A;  1S72 A;  5K36 G;  4HAE A;  5I2Y A;  1HZB A;  1GUW A;  4PQX A;  4JV5 Q;  3F2U A;  1PTO B;  2ZXR A;  2OQK A;  2A68 C;  1G6P A;  1TKW B;  3TS0 A;  4PMB A;  2K32 A;  1NTG A;  3ND9 A;  2AUK A;  4CDD C;  1JT8 A;  1Q1E A;  4RCO A;  4TKO B;  1PH2 A;  4HJ7 A;  3KJO A;  2LMC B;  3G71 A;  1J5E L;  1VMP A;  1CSQ A;  4P74 A;  1MJE A;  3J81 c;  4LF4 Q;  3I72 A;  3K0Y A;  1TU2 B;  1A2U A;  3BZK A;  1K83 H;  2A19 A;  3FPU B;  1P8L A;  1A63 A;  2KHS A;  3MVV A;  4A3I H;  2EIF A;  1LLR D;  1Q82 C;  1LTT D;  4X62 L;  2V1C C;  1WD0 A;  3PUY A;  4RHR A;  3CC7 A;  2JA9 A;  3A54 A;  5CBA E;  3NHH A;  3I7F A;  1C0A A;  1BNZ A;  4OO1 I;  1UEA B;  4BBR H;  1IBM Q;  1BOS A;  3HG9 A;  1TWC H;  2LS0 1;  3M7N A;  1Y69 U;  1GUO A;  1E1T A;  1PH5 A;  1X6O A;  4ODG A;  1STA A;  1IKM A;  3GTG B;  3KOJ A;  2PNR C;  4IFD J;  4DR6 L;  4A3M B;  4U67 3;  1I94 Q;  4A3F G;  2KHI A;  4QJF A;  1QOH A;  2F4I A;  4APV A;  1VF5 C;  1SR3 A;  2RCN A;  2X6G A;  1HJP A;  4RAU C;  4A3K B;  1Z9F A;  3E0J A;  2FXQ A;  1MI2 A;  2CHB D;  1U4P A;  3SR1 A;  5IWA L;  4R4O A;  5IYD G;  2A6H C;  1ESF A;  4DU9 A;  1YJW A;  3HZX A;  1KL9 A;  2PNH A;  1W6K A;  1OO9 B;  2EJG C;  1TT2 A;  3GV6 A;  3GQB A;  1QUQ A;  2EY5 A;  4I7Z C;  4QL5 A;  3CCE A;  4UY8 C;  3IFT A;  1QUQ B;  2I5H A;  5C4H A;  1SNQ A;  2EYL A;  4DFA A;  4MN3 A;  5EAY A;  1ENC A;  4RKB A;  1EY6 A;  2N78 A;  3K5M A;  1U5K A;  4HMI A;  3KBX A;  1B44 D;  4EVO A;  1WTW A;  2UUC L;  4A3L G;  1B53 A;  4BXX G;  5JJL A;  1WI5 A;  4H0L C;  3T1Y Q;  3HOU G;  4POF A;  1TS5 A;  5LMU Q;  2K04 A;  2OXP A;  5C4J H;  2FMC A;  1EWH A;  1PFM A;  4NMZ A;  1JOO A;  4R4Q A;  3NUC A;  4P2C B;  1E24 A;  1ENF A;  3H94 A;  4CJ0 B;  3AFQ A;  1X65 A;  1GO3 E;  1UNS A;  4X65 Q;  2RDF A;  1EIG A;  4DV0 Q;  3K5N A;  5DLQ E;  1PYB A;  1VQ8 A;  3C1F A;  4R4T A;  3KLS A;  3I4N G;  3T51 B;  2MGS A;  4QY7 A;  5IOC A;  2CW0 C;  3NEM A;  4A3F H;  5IP9 H;  1PTO C;  1TWG B;  1BBU A;  3OPO A;  2YU9 H;  4JW0 A;  3RZD H;  1XWE A;  5A35 A;  4X66 L;  4A3D B;  5LHY 1;  4A3G B;  3LGJ A;  1PZJ D;  1KDB A;  3CAM A;  3NE5 B;  4E6I A;  3ERO A;  3NQI A;  3FVQ A;  2CH4 W;  3NPP A;  4GN4 B;  2D0P A;  3S1M H;  2NVY B;  4OXP A;  4CBV A;  1XNR Q;  2PO4 A;  1ICF B;  1SAP A;  3H0G G;  3D6C A;  2Z9H A;  4FF1 A;  1BUV T;  1K8M A;  2UXB L;  5M9O A;  4A3L H;  4IPG A;  1IXR A;  3L2P A;  4IN3 A;  4Y7N B;  3S2H B;  1FGU A;  1CT1 D;  4HR7 B;  4R4C A;  1R4P B;  5EJW A;  2XGT A;  3T16 A;  3A74 A;  5IE8 A;  1PVO A;  2DJF C;  1YJ9 A;  2LXJ A;  5CBE E;  1SMX A;  3A7A B;  4B9X A;  5C4X B;  4LFC Q;  2NZH A;  3T1H L;  1K9M C;  4P75 A;  4K14 A;  4DUY L;  1G6Z A;  3SE0 A;  1X9N A;  1JJC B;  5BR8 L;  3GTP B;  3OW7 A;  1RD9 D;  3ER0 A;  1WTP A;  1KNE A;  4DAP A;  1PHJ A;  3IAY A;  1VQO A;  1E3P A;  3MEF A;  2D62 A;  1V9P A;  4NDX A;  3R8B A;  2XRS D;  3HOY H;  2EZV A;  3M4O B;  4UP9 A;  3OIQ A;  1VQ4 A;  4FP5 D;  1K8G A;  4LF9 L;  4DV3 L;  2E74 C;  1EU3 A;  2GN5 A;  2KVM A;  2AQ1 B;  2WII B;  5KND A;  2GA4 B; 
#chains in the Genus database with same CATH homology
 2NN6 I;  4KLK A;  4A4I A;  1KHI A;  3EBE A;  3H0G H;  4HJ8 A;  1JMC A;  2KHJ A;  2JA7 G;  5C0X J;  2AMC B;  2K5H A;  2NN6 G;  1LUZ A;  2N49 A;  3T1Y L;  3FHW A;  4TVA B;  3D31 A;  4AQY Q;  2VUM G;  3PO3 H;  1HNW L;  3OTO Q;  3MXN B;  2Q2T A;  1YNX A;  5FLM H;  5LMU L;  3TRZ A;  3G6E A;  1KC8 C;  4FDB A;  2N8N A;  1L0W A;  3M85 A;  1TWF H;  2VY3 A;  5C44 H;  1YEZ A;  4JI4 L;  2LXK A;  2QA4 A;  1YI2 A;  1IBK L;  4BY1 G;  4GLX A;  1UE6 A;  1ASZ A;  3JAM i;  3HOW H;  1VQD A;  4X65 L;  2Q2I A;  2K4K A;  3HOV H;  1SN8 A;  3CF5 A;  1E7Z A;  1PH9 A;  4DR2 Q;  1CUK A;  2IHE A;  3I55 A;  2MO0 A;  3S1N H;  1XTD A;  4A3E H;  4LNQ A;  1NMG A;  4DR4 Q;  5M3M G;  3FP9 A;  4A3I G;  4PMW A;  1KRT A;  3M9B A;  3HOX G;  1VQH A;  5IYC H;  1WJJ A;  1YIJ A;  4GLA C;  1NJI C;  3PSI A;  3W1G A;  5C4X H;  2UUC Q;  1SE8 A;  5M5X H;  4O2D A;  1GKH A;  1G29 1;  4IO9 A;  3HOZ H;  3M4Q A;  2A1A A;  1RIP A;  1XPR A;  3FKI H;  4BBR G;  2ALY B;  1QVG A;  4JI5 Q;  1PH1 A;  1CKM A;  2R92 G;  1VQJ A;  1M90 C;  2YTX A;  4PZ7 A;  5C3E H;  3CD6 A;  2R7Z G;  1Y1V G;  2R93 G;  3STB D;  4HJ9 A;  3GTP H;  4JBW A;  4NXN Q;  4GN3 B;  1Q12 A;  3PCO B;  1YHB A;  4GLV B;  4JG2 A;  4RMF A;  2QEX A;  3RZO H;  2R6G A;  3F8T A;  4JI6 Q;  5IYD H;  2Y0S G;  4GS3 A;  1EQQ A;  1N32 L;  1YHA A;  3E9H A;  3HKS A;  1HR0 W;  1VQC A;  1VQ7 A;  2ZM6 Q;  3F1Z A;  2BH8 A;  4JI2 Q;  1FVI A;  3OYY A;  4AYB G;  4KI0 A;  1XNR L;  3M4O H;  2UXD L;  5J3B A;  3DM3 A;  1XMQ L;  2WAQ E;  4WJ4 A;  1L1O A;  1VCI A;  4HID A;  4KHZ A;  2E5L Q;  2BA1 A;  3UDG A;  2F3I A;  1DGS A;  3CCR A;  4C3J H;  2UUB Q;  4LFB Q;  3K0X A;  1L1O B;  1ASY A;  1TWH H;  4GKJ Q;  5M5Y H;  5HY6 A;  4P71 A;  1E22 A;  4B3S L;  1LM0 A;  2VUM H;  3U4V A;  3CP0 A;  3EIV A;  1EIY B;  4K0K L;  4BXX H;  2ZJR A;  1SRU A;  1GVP A;  2JJQ A;  4LF6 L;  3HOU H;  2WFW A;  4JI1 L;  5H1S E;  4L5S A;  1X56 A;  4DV5 L;  1YZ6 A;  1O7I A;  4GKK L;  1YJN A;  5IP7 G;  1J5E Q;  1B7Y B;  1KAW A;  3KF8 B;  1HNX Q;  3I4M G;  1KXL A;  1EIF A;  4LF8 Q;  4OWX B;  3B6Y A;  3S1Q H;  5GAH C;  2ZTE A;  4YY3 Q;  2A8V A;  3U50 C;  1OXT A;  3CCU A;  3G4S A;  1VQB A;  4LFC L;  1OXX K;  5M3M H;  5LMN W;  4DV7 Q;  2UU9 L;  4B3R Q;  4A93 G;  5GAG C;  4DPG A;  1K73 C;  2HIX A;  2KEN A;  3EN2 A;  2WAQ G;  3RN2 A;  4JI8 Q;  2Z6K A;  2BH2 A;  4X62 Q;  2IHF A;  3GTO H;  1C7Y A;  1LYL A;  4QQB X;  3I4N H;  1OXV A;  1VQK A;  1WOC A;  4JBM A;  3PV0 A;  2MNA A;  4DR7 L;  4NPS A;  2NVT H;  1WCM H;  4PZ8 A;  2CWP A;  1CSP A;  2YTV A;  4KHP L;  1CKN A;  2Z6K C;  5AJ3 Q;  1Q1B A;  3CW2 C;  4OO1 G;  3KJP A;  3PUW A;  4BBS G;  5JEA J;  1KIX A;  1PA6 A;  2NVX H;  5HGQ A;  2K75 A;  1PYS B;  1VQN A;  1NE3 A;  3RLN A;  3J80 c;  1EQR A;  4DR3 L;  3PUZ A;  1CKN B;  2IX0 A;  3IRB A;  2UUA L;  1Y1V H;  4R4I A;  4MNO A;  4DK6 C;  4HIM A;  3K7A H;  2ZJQ A;  3CC2 A;  3S14 H;  1UEB A;  4DV4 Q;  3RN5 A;  2F4V L;  2ZTD A;  2JA6 H;  4LFA Q;  2VZA A;  3CCS A;  3CCV A;  1FL0 A;  1PV4 A;  3DLL A;  1QZG A;  2JEB I;  4JYA Q;  1XNQ Q;  4DUZ L;  2CKZ B;  2ZJP A;  1S3O A;  5IY0 A;  2JA5 G;  4DR6 Q;  2JA8 G;  5IP9 G;  3ERS X;  5FJ8 H;  1B8A A;  3F2B A;  5M3F G;  1OXU A;  1PH4 A;  3S16 H;  3S2D H;  1IBL L;  4JBK A;  2NZO A;  4A3M G;  4LUV A;  2NVQ H;  4DV6 Q;  3U4Z A;  2GVA A;  4IOC A;  4YCW A;  4AQY L;  3OTO L;  1Q8K A;  4A76 A;  4JI0 Q;  4X6A H;  2I0Q A;  3GDE A;  1VQ6 A;  4YCV A;  3AYH B;  2RHQ B;  2ID0 A;  3CPF A;  3CQZ H;  4A3K G;  3SGI A;  4ALP A;  1HZ9 A;  2CQO A;  2UXC Q;  4HIO A;  5IWA Q;  1EOV A;  4QIW E;  1I5F A;  2CWA A;  4L5R C;  2MFI A;  1OTC A;  1G51 A;  3NEL A;  4YHH Q;  5FLX c;  4DR2 L;  5IP7 H;  3HKZ G;  3M4P A;  4QGU A;  4JOI A;  4UPA A;  1HH2 P;  3I4M H;  4DR4 L;  1JB7 A;  2IT1 A;  1I3Q H;  2Y0S E;  2ATW A;  4DV2 Q;  4Y52 H;  1N36 Q;  2PI2 E;  4DV0 L;  1EWI A;  3OW2 A;  1HNZ Q;  2AHO B;  2ZTC A;  4JOI C;  4OX9 Q;  4A93 H;  3UDI A;  4AYB E;  4OON A;  4LUZ A;  4H02 A;  1VQA A;  1IYJ B;  1KQS A;  5E7N A;  2YYZ A;  1X3F A;  3KYH C;  1HR0 Q;  2VS1 A;  2I5L X;  2AWO A;  4JCV E;  4YWM A;  4BA1 I;  1CKO A;  1UE5 A;  4GNX A;  4JI5 L;  5IYB H;  4DV1 Q;  5GAE C;  2LSS A;  3RR5 A;  1E1O A;  1NBW A;  1SRO A;  1VQI A;  1EFW A;  1JE5 A;  3BJU A;  4GN5 A;  4BBS H;  4GNX B;  1QVC A;  1T9H A;  4GNX C;  4NXN L;  3PO2 G;  2VQF Q;  1K0R A;  1XPO A;  2K5V A;  3L0O A;  1R9T H;  4UP8 A;  1M1K C;  4NXM Q;  3ZJY C;  1TXY A;  4JI6 L;  2B63 H;  1VQ9 A;  1RL2 A;  3A0J A;  4JC0 A;  2DGY A;  1Q86 C;  4WJ3 M;  3I2Z A;  2ZM6 L;  2OWO A;  3PUX A;  4JI2 L;  3GTG H;  1S72 A;  1LTL A;  1IZ6 A;  4JI3 Q;  2IY5 B;  5K36 G;  1HZB A;  3GTK H;  2E2H H;  4JV5 Q;  2N3S A;  2OQK A;  4OWT B;  2E5L L;  4IOA A;  2MO1 A;  2E8G A;  1G6P A;  2B29 A;  1SLJ A;  1N33 Q;  1NMF A;  4LFB L;  4GKJ L;  1Y1W G;  4IFD I;  3TS0 A;  2JA7 H;  1NTG A;  5LMN Q;  1Z47 A;  1X3G A;  1Q81 C;  3BU2 A;  5IT9 c;  3GTJ H;  4LF7 Q;  1JT8 A;  4IFD G;  1L1O C;  1Q1E A;  4X66 Q;  3HOY G;  2D0O A;  1VQL A;  1QVF A;  2MQH A;  4HJ7 A;  1PH2 A;  5JJK A;  4X64 Q;  1P16 A;  3KJO A;  4A3D G;  4DR5 Q;  3G71 A;  1J5E L;  2E2I H;  2HIV A;  4PG3 A;  1CSQ A;  2KCT A;  4P74 A;  1MJE A;  4A3G G;  4BY7 G;  1EUJ A;  1X55 A;  1HNX L;  3J81 c;  1XJV A;  3H3V I;  1N32 Q;  3U58 A;  4LF8 L;  4LF4 Q;  4BY1 H;  1YVC A;  1A62 A;  4YWL A;  4YY3 L;  1JJG A;  2PQA A;  2QGQ A;  3BZK A;  4B3M Q;  1K83 H;  2JQO A;  3GO5 A;  2A19 A;  4DV7 L;  4B3R L;  1P8L A;  3KDF B;  3TEH B;  1BBW A;  3Q8D A;  1A63 A;  3E9I A;  3J80 i;  4XIG S;  3TRE A;  4A3I H;  2EIF A;  2PQA B;  3PIO A;  4JI8 L;  4HIK A;  1Q82 C;  3A5U A;  3HOX H;  1VQ5 A;  4X62 L;  3PO3 G;  2V1C C;  4IPD A;  5FLM G;  4POG A;  4DR1 Q;  3PUY A;  2UXB Q;  3CC7 A;  2JA9 A;  3CC4 A;  1K3R A;  1KD1 C;  3I7F A;  5ELN A;  4DAY B;  5AJ3 L;  3F2C A;  2ASB A;  1C0A A;  4OO1 I;  1EYG A;  1GM5 A;  2EQS A;  4JI7 Q;  3HOW G;  2R92 H;  4B3T Q;  2OQ0 A;  4BBR H;  3HOV G;  1IBM Q;  1Y14 B;  1TWC H;  2BA0 A;  3M7N A;  1I6H H;  2R7Z H;  1E1T A;  1NY4 A;  1PH5 A;  3CME A;  3CCM A;  4DV4 L;  1X6O A;  2R93 H;  3GD7 A;  5ELO A;  4DAM A;  4LF5 Q;  4LFA L;  1PH3 A;  3HKZ E;  4XTC S;  3KOJ A;  2GVB A;  1MIU A;  3PIP A;  4IFD J;  1XNQ L;  1VQP A;  3UE0 A;  3KF6 A;  5C4X G;  4DR6 L;  2OTJ A;  3TS2 A;  2B3G A;  4MTN A;  3T1H Q;  1S40 A;  1I94 Q;  4A3F G;  3KF6 B;  4A3B G;  2KHI A;  2AKW B;  1H95 A;  1HZA A;  4BA2 I;  2VQE Q;  4QJF A;  4DKA C;  4DUY Q;  4DV6 L;  4DR7 Q;  4HJ5 A;  4APV A;  1SR3 A;  2RCN A;  4JI0 L;  1HJP A;  1Q7Y C;  5BR8 Q;  1Z9F A;  2FXQ A;  1TWG H;  2UXC L;  1PH7 A;  5IWA L;  3S1R H;  4R4O A;  3K8A A;  1N34 Q;  4A3C G;  5IYD G;  5GRO A;  1YJW A;  2ES2 A;  1KL9 A;  4A3D H;  3I56 A;  2PNH A;  4YHH L;  3RNU A;  1FJG Q;  3WWV A;  1PH8 A;  1QUQ A;  4A3G H;  4LF9 Q;  3M3Y H;  4QL5 A;  3CCE A;  4DV3 Q;  3PGZ A;  4DV2 L;  2R7F A;  1N36 L;  4LWC A;  1L2F A;  3CCQ A;  4UY8 C;  1HNZ L;  1HZC A;  1MKH A;  4IJL A;  3ULJ A;  1QUQ B;  2I5H A;  2HHH Q;  4OX9 L;  3H3V H;  2DUD A;  1XMO Q;  5EAY A;  1IBL Q;  1AE2 A;  2NVY H;  2N78 A;  1U5K A;  2OCE A;  4A3J G;  1WFQ A;  2UUC L;  4A3L G;  1MJC A;  3ULP A;  1GD7 A;  1PFS A;  1HR0 L;  4BXX G;  5JJL A;  1WI5 A;  3T1Y Q;  3HOU G;  4POF A;  2WB1 G;  2JK8 A;  4DV1 L;  1HNW Q;  4YCU A;  5LMU Q;  3AQQ A;  3S24 A;  4NB3 A;  5JJI A;  2KBN A;  5C4J H;  4RG1 A;  3W5O A;  4DNI A;  4Y7N H;  1IL2 A;  4L5T A;  4IPH A;  3S2H H;  2Z0S A;  1Q46 A;  3G48 A;  4R4Q A;  1K8A C;  2VQF L;  2PI2 A;  4IPC A;  4JI4 Q;  4NXM L;  1YIT A;  2KCM A;  1IBK Q;  3ICE A;  3KLW A;  1E24 A;  4YWK A;  4X65 Q;  2OTL A;  3AFQ A;  1X65 A;  1GO3 E;  3PF5 A;  3GTQ H;  2XTI A;  4DV0 Q;  5DLQ E;  1PYB A;  1VQ8 A;  1KRS A;  3NBH B;  4R4T A;  1YBY A;  4ME3 A;  2K14 A;  4JI3 L;  2CFM A;  2YTY A;  3I4N G;  4JV5 L;  2YV5 A;  4QY7 A;  3H15 A;  3CPW A;  4O0A A;  1AE3 A;  1W2B A;  3NEM A;  1WCM G;  1TWA H;  4A3F H;  3JAM c;  2JA5 H;  1N33 L;  5IP9 H;  3J81 i;  2JA8 H;  4A3B H;  4L5Q A;  5M3F H;  3A5Z B;  1BBU A;  2VL6 A;  1XPU A;  4MZ9 A;  5LMN L;  4A3M H;  2UUB L;  2YU9 H;  4DK3 C;  4LF7 L;  3RZD H;  4X66 L;  3ULL A;  1J6Q A;  1A0I A;  3NEN A;  3UDF A;  4C3I H;  4AH6 A;  4X64 L;  1D7Q A;  2F52 A;  4DR5 L;  2HT1 A;  4A3C H;  3VDY A;  3LGJ A;  2EXD A;  4A3K H;  2JA6 G;  2K50 A;  4C3H H;  4HJA A;  2H5X A;  2K52 A;  2K5N A;  2RF4 A;  3CAM A;  4LF4 L;  1PH6 A;  3HFZ B;  4B3M L;  3KDF A;  4GN4 B;  1OXS C;  5FJ8 G;  2D0P A;  3S1M H;  3RLF A;  2HQL A;  2WP8 J;  4OXP A;  5JEA G;  4EQ5 A;  1JJ2 A;  2UXD Q;  1XNR Q;  2L15 A;  3D0F A;  2Q2H A;  3H0G G;  4TQU S;  1U0L A;  3I4O A;  4GOP A;  1X3E A;  4P73 A;  3UE1 A;  1XMQ Q;  2CCZ A;  4DR1 L;  1VQM A;  2UXB L;  1AH9 A;  4EX5 A;  4A3J H;  3RLO A;  3CMA A;  4GOP B;  3CCL A;  4A3L H;  2I5M X;  1IXR A;  4IPG A;  3L2P A;  4GOP C;  2Q2U A;  4B3S Q;  1FGU A;  5C44 G;  3S17 H;  4K0K Q;  5GQO A;  4R4C A;  4JI7 L;  2VNU D;  4LUO A;  4B3T L;  2XGT A;  1IBM L;  4LF6 Q;  1WYD A;  3AFP A;  4JI1 Q;  4DV5 Q;  3A74 A;  3CXC A;  5IE8 A;  1QZH A;  1PVO A;  2IX1 A;  1I50 H;  1YJ9 A;  2LXJ A;  5C0X I;  3S15 H;  1W3S A;  4UP7 A;  4GKK Q;  1SMX A;  4A3E G;  3BZC A;  4LF5 L;  3PO2 H;  5C0X G;  2JE6 I;  1D8L A;  1X54 A;  3KFU A;  4J15 A;  1VQG A;  3K81 C;  5IYC G;  2AWN A;  2UU9 Q;  4LFC Q;  4JYA L;  2NZH A;  1UE1 A;  4JBJ A;  3T1H L;  2RHS B;  2PMZ E;  5M5W H;  1I94 L;  1YHQ A;  1K9M C;  2E2J H;  3GTM H;  4P75 A;  4PZ6 A;  3E0E A;  3F2D A;  1VQE A;  3CCJ A;  2VQE L;  4DUY L;  3HOZ G;  5IYB G;  3JC6 6;  3W1B A;  4A75 A;  3FKI G;  1X9N A;  1N8R C;  1JJC B;  2C35 B;  4AIM A;  3UDX A;  3J7Z C;  1N9W A;  5BR8 L;  3J7A 5;  4KHP Q;  3ER0 A;  5C3E G;  1UE7 A;  4IJH A;  2WB1 E;  3GTL H;  1Y1W H;  1BVS A;  1PHJ A;  1N34 L;  1V43 A;  1VQO A;  1E3P A;  2D62 A;  3MEF A;  3PF4 A;  2B63 G;  1V9P A;  3K80 C;  4DR3 Q;  4C2M H;  2UUA Q;  3AEV A;  3HOY H;  1V1Q A;  1A8V A;  1UWV A;  1FJG L;  2JEA I;  4UP9 A;  1VQ4 A;  3J81 j;  1K8G A;  4LF9 L;  4OWW B;  2F4V Q;  4DV3 L;  1VS0 A;  3K7U C;  5GAD C;  2VW9 A;  4LW1 A;  1B70 B;  2GN5 A;  4P72 A;  4R1J A;  4BY7 H;  3PUV A;  3STB C;  1VQF A;  2HHH L;  1C9O A;  2R7D A;  4DUZ Q;  3TQY A;  1BKB A;  1XMO L;  1SFO H;  3L7Z C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...