3S1MH

Rna polymerase ii initiation complex with a 5-nt rna (variant 1)
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
molecule tags Transcription/rna/dna
total genus 19
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2011-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3s1mH00
1SLJA 1XNRL 3L2PA 2VQFL 5IP7H 2JK8A 1J5EL 2E5LQ 4P71A 4X6AH 3S1QH 4DV0Q 5IWAL 2DGYA 1VQNA 4HIMA 2EXDA 4GOPC 3J81i 1OTCA 3CCSA 4YWLA 2UU9Q 1CKNA 1P16A 1VQCA 3PGZA 3PSIA 4UP7A 2E2JH 4XTCS 5LMNL 2UXCQ 2WFWA 3TS2A 4UPAA 1Q82C 3M4QA 4DR1L 4QJFA 3RLFA 1M1KC 3A0JA 5GAHC 2UUBQ 2E2IH 4GLXA 4JI0Q 4JBKA 5C44G 1PFSA 1PH4A 2R92H 4OO1G 4IPCA 2BH8A 4PZ6A 1K73C 4A3MG 1TWCH 1SRUA 3S14H 4DV3Q 3PUYA 5GQOA 2VQEQ 1YITA 1UE1A 4HJ7A 3PV0A 2K50A 3CCMA 3KOJA 2I5MX 1C7YA 4A3CG 1X55A 3K7AH 4RMFA 3Q8DA 4LUVA 1HNZQ 1PH5A 1SN8A 3GTGH 3F8TA 1HR0L 3HKSA 1Q7YC 3CAMA 1Q12A 2EIFA 2JA8H 3M4OH 5C3EH 4B3RL 5JJIA 4AQYL 4IOAA 3D31A 1XPOA 5ELOA 3GDEA 3ULPA 2JA7G 3D0FA 3EN2A 2XGTA 4DV2L 2ZM6L 1BBUA 3K80C 2CKZB 3CMEA 2D62A 4BBRH 1FJGQ 3RZOH 5ELNA 2UXBL 2K75A 3S1MH 5IYDH 1VQGA 1N33Q 4JI3L 5JEAG 1ASYA 4JI6L 2Y0SG 1Q8KA 2K52A 2B63H 4OX9Q 4YY3Q 3KF8B 4ME3A 4NXNQ 1MIUA 3BZKA 2CWAA 3GD7A 4A3FH 4JYAL 3FHWA 2XTIA 1EQRA 5K36G 1QZGA 5FLMG 3TEHB 3CCVA 4DR2Q 4R4IA 3I4NH 5LMUQ 1WOCA 1WI5A 1EOVA 1X3EA 2YTXA 4JI2L 5GROA 2NN6G 3PO2G 2ZJRA 1UWVA 4DUYQ 4NXMQ 5DLQE 3HOXH 2PI2A 1TWHH 1GO3E 2C35B 5HGQA 1VQBA 2E8GA 3CPFA 4GOPB 3S2DH 4HIDA 1PH3A 4DV5Q 2PMZE 1VQ9A 3HOWG 1BKBA 5M3FG 4O2DA 1E1OA 4BY1H 4GKKL 1HH2P 2HHHL 4JOIC 3WWVA 4X64L 4A4IA 2R93H 3HOYH 1JT8A 4LUZA 3HOUG 3I55A 3I4MH 4C3JH 2UXDL 4A3BH 4KI0A 2UUCQ 4LF5Q 4JG2A 1LYLA 5GAGC 2JJQA 1EUJA 4YHHQ 1XNRQ 1EYGA 1S3OA 4LW1A 2PI2E 4LFCL 2VQFQ 2VUMH 2PQAB 1XMOL 3RZDH 1WCMG 1J5EQ 4QL5A 2JA6G 3OTOL 3HOZG 4IPHA 1G6PA 4R4OA 5IE8A 2VZAA 4DV6L 3VDYA 5IT9c 1Z47A 1IXRA 5C4XH 4DNIA 3S2HH 1DGSA 1KRTA 4IJLA 2VY3A 3L7ZC 1VQ5A 1T9HA 3S16H 2GVBA 1U5KA 3E9IA 4NPSA 1TWFH 3U4VA 1CKMA 4L5RC 3KYHC 2VL6A 4B3ML 4L5QA 1Y1VH 4A3JH 1Q86C 2Q2TA 1HJPA 3KF6B 1I94Q 4POFA 5M3MG 4A76A 2OTJA 3PO3H 2LXKA 3PIPA 4DPGA 4A3KH 1E1TA 2QGQA 3UE1A 3LGJA 1K8AC 1NY4A 2MNAA 2KCTA 2Q2UA 1HR0Q 4LWCA 5C4JH 5AJ3L 3AFPA 3CPWA 2R7ZG 1WJJA 4DUZL 4B3RQ 1VQIA 2MO1A 1VQAA 1B70B 4Y7NH 4BY7G 4GKJL 5IP7G 1QUQB 4OXPA 2B3GA 1CSQA 1KXLA 3HKZG 4KHZA 4DV2Q 1CUKA 2KHIA 4LF4L 4A3IG 2UXBQ 1I5FA 4X62L 1YJ9A 4A3DG 3HOVH 4EX5A 1L1OC 3CC7A 4GOPA 2NVXH 4WJ3M 4GLVB 4R4TA 5IYBH 4JI6Q 2R6GA 3GTQH 1AE2A 4A3GH 4GN3B 4OONA 1N36L 1Z9FA 3CCJA 4JCVE 4JYAQ 4AH6A 1VQEA 3AEVA 4MNOA 1H95A 4FDBA 3UDXA 1VQPA 3GTOH 4YWMA 2HQLA 4P73A 4IFDJ 3T1HQ 4A93G 4GS3A 1K3RA 2A1AA 4JBMA 1IBMQ 1UE5A 4JI2Q 2K4KA 5GAEC 1NJIC 1YNXA 2D0OA 1PYBA 3J81c 2AMCB 3RR5A 1PH7A 3S1NH 1BBWA 1UE6A 1YEZA 2D0PA 1WYDA 2EQSA 1UE7A 1EWIA 3ER0A 2JA8G 2A8VA 4DV4Q 1IBLL 1WFQA 4WJ4A 2ZTDA 1V43A 4TVAB 5FJ8H 4OWWB 4JI1L 3H0GH 4C3IH 1PHJA 2WAQG 1HNWQ 4DR4Q 4P75A 3J7ZC 2AWNA 2VW9A 5M5XH 4LF9Q 4PMWA 2HHHQ 3I7FA 2QEXA 2HIXA 5LMNW 3J7A5 1FGUA 3CQZH 2Z6KC 1TWGH 4YCUA 2JA5H 5C0XJ 2GN5A 1IBKQ 2N8NA 2Z0SA 2UXDQ 2NZHA 1YHBA 4QIWE 3DLLA 3GTLH 1CKOA 1X6OA 4DK6C 3KF6A 4NB3A 3GO5A 2ASBA 1VQOA 1K0RA 1XMOQ 2I5LX 4A3LH 4IOCA 4JI8Q 4LF6L 3CCUA 4A3EH 1YJNA 4EQ5A 1VS0A 5IY0A 3OTOQ 1Y1WH 2JEBI 4YCWA 1KC8C 3U58A 1SMXA 1XJVA 1IL2A 3SGIA 1HR0W 4DV6Q 2IX1A 3HOXG 2BA0A 1RIPA 2AWOA 4B3TL 3CCQA 2UUAL 3RLOA 4X65L 3UE0A 2R7FA 3FKIH 4DKAC 1L1OB 1A62A 1KHIA 1SE8A 2PNHA 4OWTB 1SR3A 2QA4A 1N34Q 1KD1C 3G4SA 3KLWA 4MZ9A 3I2ZA 3T1YL 3HOYG 3F2DA 2ALYB 5C44H 2RHSB 4GNXA 2OQ0A 1Y14B 3H3VH 4DR5L 3J80i 3W5OA 4HJ9A 1HZAA 5BR8L 2RCNA 5AJ3Q 2Q2HA 4ALPA 4BBSG 4A3CH 1GKHA 3U50C 4DUZQ 2AKWB 4JI7L 4JV5L 1PV4A 3H3VI 1V1QA 1VQ8A 3PUWA 4DV7L 4A75A 1B7YB 1M90C 3HKZE 5IP9G 3S24A 2ATWA 2IHEA 3A74A 3G6EA 4LF4Q 4X62Q 1X56A 4PG3A 1HNXL 4UY8C 2I5HA 3BJUA 2KBNA 2F52A 1W3SA 4GLAC 1K83H 4LFBL 1NE3A 1U0LA 1E24A 3RLNA 1PH2A 1N36Q 2MFIA 3PCOB 4A3JG 2HT1A 1Q1EA 2RHQB 4BXXG 4C2MH 1OXSC 3CCEA 3FP9A 5IWAQ 3RN5A 3PO3G 1E3PA 2B29A 1W2BA 4TQUS 3I4OA 5FLMH 1ASZA 3DM3A 3M9BA 1NTGA 2ES2A 5LMNQ 2ZTCA 3M85A 5H1SE 1QVFA 3PO2H 1YZ6A 1TWAH 3TRZA 1IBLQ 4DR1Q 1YVCA 1G51A 4YWKA 1CKNB 3JC66 4JI1Q 3G71A 1YJWA 2BH2A 1LM0A 1VQJA 2LSSA 4IFDI 2WAQE 4APVA 4C3HH 2F3IA 1XTDA 3S1RH 4JI4L 1R9TH 1XMQL 3UDFA 3E9HA 4P74A 5M3FH 2E2HH 1G291 3K81C 2ZJQA 2IT1A 1PVOA 1VQ6A 3KFUA 4DV1L 4R4CA 5IYCH 1YIJA 1NMGA 4AQYQ 1VQFA 4OX9L 4DR7L 4YY3L 2JQOA 1AE3A 4X66L 1P8LA 1Q1BA 3UDGA 4LF7L 1NMFA 1GVPA 1QVGA 3PF5A 4LF6Q 4UP9A 4YCVA 2ZM6Q 5C0XI 5E7NA 2V1CC 1KIXA 2FXQA 3K7UC 1VQMA 1WCMH 1MJEA 5JEAJ 4JI3Q 2JA6H 3HOZH 1QVCA 3M3YH 2JA9A 4B3TQ 1X65A 1E22A 2CFMA 4LFAL 4JI5L 1OXXK 5IYDG 4QGUA 3TS0A 4X65Q 2UUAQ 4NXML 2R92G 1SROA 3PF4A 1X54A 2NVTH 1E7ZA 2Q2IA 1TXYA 1VQLA 2IHFA 4DV5L 4GN5A 1V9PA 4H02A 3U4ZA 4LUOA 3CXCA 1KQSA 1VQKA 3CD6A 2OTLA 2NZOA 1S72A 1NBWA 3ULJA 4DR6L 3F1ZA 1PH9A 2RF4A 5M3MH 1X9NA 1JJ2A 4HJ8A 2K5HA 5C3EG 4DR5Q 3GTKH 1C9OA 1HZCA 4OWXB 2PQAA 2K14A 3CMAA 4BA1I 4JI7Q 4IPDA 4LF5L 4JV5Q 4QQBX 5HY6A 4QY7A 1AH9A 2VNUD 1L0WA 4DV7Q 1Y1WG 4YHHL 2R7ZH 4GKKQ 1YI2A 4BBRG 1A63A 1JJCB 4BY7H 3K8AA 4X64Q 3JAMi 4PZ8A 3AYHB 1QZHA 2KCMA 3CW2C 1HNXQ 4Y52H 3JAMc 2B63G 3GTMH 2KENA 2ZTEA 5GADC 4A3IH 2NVYH 1VQ7A 4A3FG 4LFBQ 2IX0A 4A3DH 4K0KL 3FKIG 3I56A 2GVAA 3PUZA 3TQYA 1EQQA 3GTPH 4LFCQ 3ULLA 3H15A 3I4NG 2VS1A 1VCIA 4BA2I 4J15A 4HJ5A 4L5TA 3GTJH 3KDFB 4DR3L 3S15H 1XPUA 1I94L 2YYZA 3RN2A 5EAYA 4A93H 4KHPL 2WP8J 4AYBG 2WB1G 4RG1A 4POGA 1QUQA 1I6HH 2OWOA 1JB7A 3CCRA 2N49A 1VQHA 3E0EA 4BY1G 4PZ7A 1I3QH 4B3MQ 2BA1A 1YHAA 2H5XA 3AQQA 1A0IA 1K9MC 1EFWA 2R93G 1CSPA 3MEFA 4JI4Q 3UDIA 1JJGA 3I4MG 4HJAA 1XMQQ 5JJKA 3STBC 2L15A 4LF8L 4GN4B 4JOIA 4XIGS 4A3MH 2F4VL 3OYYA 4A3BG 3G48A 4DV1Q 2IY5B 1JMCA 3J80c 4OO1I 1FVIA 4GKJQ 2VUMG 4B3SL 1XNQL 5M5WH 2HIVA 4DR7Q 4LNQA 3W1BA 2CWPA 4X66Q 4LF7Q 3NEMA 3PIOA 3F2BA 1X3FA 2KHJA 3KJOA 2OCEA 2E5LL 5C4XG 4DV0L 4IJHA 1PH1A 3CP0A 2JA7H 4IFDG 3T1HL 2UU9L 3TREA 1Q81C 1IBML 3M4PA 4LFAQ 3OW2A 1IZ6A 4R1JA 4IPGA 4JI5Q 2UXCL 3A5UA 2CCZA 1Y1VG 3EBEA 4DV4L 1J6QA 3A5ZB 2UUBL 4JI0L 2YU9H 2R7DA 3CCLA 4IO9A 3IRBA 2N78A 1I50H 1OXVA 2I0QA 4L5SA 1C0AA 4DAYB 4JBJA 2K5NA 4GNXC 4A3KG 4LF9L 4DR4L 1D7QA 4DV3L 2VQEL 4DR6Q 3RNUA 1XPRA 1HNWL 2A19A 5IYCG 5J3BA 3CC4A 1HNZL 1PH6A 1FL0A 1N8RC 5C0XG 1VQ4A 1IBKL 2LXJA 1GD7A 1D8LA 3NENA 1RL2A 3KDFA 1VQDA 1LTLA 1K8GA 2NN6I 4BBSH 3W1GA 4HIOA 3NBHB 3HOWH 3HOVG 1N32L 3PUVA 4JI8L 1KRSA 4JC0A 5IYBG 1FJGL 1BVSA 1EIYB 5IP9H 3ERSX 4A3GG 1YBYA 1S40A 1N33L 1Q46A 5FLXc 3HOUH 1KAWA 1L1OA 3ZJYC 3HFZB 3ICEA 4K0KQ 4AIMA 3PUXA 1IYJB 2AHOB 1OXUA 4NXNL 2YTVA 1N9WA 3BZCA 1SFOH 2ID0A 1N32Q 1X3GA 3B6YA 4DK3C 1YHQA 1PH8A 3AFQA 2MO0A 4DR2L 4DR3Q 4KLKA 1N34L 3NELA 1EIFA 3S17H 1MJCA 4P72A 2OQKA 4BXXH 5LMUL 4HIKA 1PA6A 1O7IA 5JJLA 1GM5A 1HZ9A 2NVQH 3M7NA 3BU2A 3K0XA 4DAMA 4DUYL 1KL9A 4AYBE 2WB1E 2YV5A 4O0AA 5FJ8G 3CC2A 4KHPQ 3H0GG 2JEAI 4MTNA 4JBWA 5M5YH 3L0OA 3F2CA 2K5VA 3EIVA 3T1YQ 1PYSB 2JA5G 3KJPA 1L2FA 3J81j 4LF8Q 2MQHA 3MXNB 2YTYA 1OXTA 2F4VQ 1B8AA 2N3SA 2CQOA 2Z6KA 5BR8Q 2ZJPA 4R4QA 1UEBA 1A8VA 3STBD 4GNXB 2UUCL 2Y0SE 1LUZA 1JE5A 1HZBA 2DUDA 4UP8A 1MKHA 3CF5A 4B3SQ 1XNQQ 4A3EG 2JE6I 4A3LG
chains in the Genus database with same CATH superfamily
1SLJA 2VQFL 1MSHA 1J5EL 2SNMA 1VQNA 4GOPC 4YWLA 1TS3A 1P16A 5EQ0A 2B2TC 4XDXA 5IIFA 4UP7A 1V8QA 5HGTA 4UPAA 2B8FA 2EVBA 1Q82C 1K28A 3M4QA 2UUBQ 4JI0Q 1PRTD 5C44G 1PFSA 1K73C 1TWCH 4UHVA 3PUYA 3PV0A 4A3CG 2ZXOA 4L6TB 4RMFA 3Q8DA 4KTAA 3GTGH 1Q7YC 3M4OH 4JPBW 1ICWA 3D31A 1CTMA 4OL7A 1BDOA 2XGTA 4DV2L 1BBUA 3K80C 2CKZB 2L1BA 3RZOH 1IKLA 1DXMA 1ASYA 4OX9Q 3KF8B 4ME3A 2HCCA 5C4ZA 1MIUA 1BBXC 1HHVA 1TS5A 3MC0B 3GD7A 4JYAL 1G91A 1QZGA 3VA5A 5FLMG 3TEHB 4R4IA 2FMCA 1X3EA 1UWVA 1GO3E 4BBSB 3Q6SA 1VQBA 3CPFA 3SK5A 3HOWB 1HQMC 4HIDA 2D2CC 1BKBA 4ILWA 1EU4A 4IALA 2R93H 1KLUD 4A4IA 2KCNA 4IN3A 5EPKA 4C3JH 2O4XA 4QIWB 3VR3A 2KVMA 4H0LC 2UUCQ 5GAGC 5IGDA 2EYMA 1EYGA 2NVQB 2PI2E 2VUMH 4ZUIA 2PQAB 3A7LA 4CJ1B 2DNEA 3OTOL 2O5JC 1U4LA 2PPBC 5IE8A 2EY2A 1EL0A 4DNIA 1DGSA 1KRTA 3L7ZC 1B1ZA 1EFID 2QF7A 1U5KA 1QE6A 2VB3X 2F0TA 1NNXA 2FJ2A 1Y1VH 3KF6B 4POFA 3C46A 3K5NA 1QWYA 1I4PA 2ICIA 3KF8A 2MNAA 3C3LA 3J81E 3AMUA 3ITPA 1HR0Q 4LWCA 1MGSA 3AFPA 4DUZL 3BDOA 2MO1A 4BY7G 2F0QA 4OXPA 2B3GA 1CSQA 4DGZA 1GHKA 1A2TA 4KHZA 2KHIA 2DY7A 4A3IG 1YJ9A 4Q5VA 4EX5A 5IODA 3RUZA 1CT1D 4WJ3M 5IYBH 4R4TA 3GTQH 4A3GH 4OONA 1BR9A 1TWCB 2CW0C 2XWBB 1IL8A 3FDTA 3BG3A 5FO9B 3TBIB 4FXDA 3T1HQ 3VYUA 3GTGB 4GS3A 3VR4A 4JI2Q 3K6OA 1C8CA 3LWUA 1U4MA 3M4OB 1XWEA 3J81c 2D0PA 2EQSA 3MVVA 3QG1A 2JA8G 1WFQA 3NBHA 3M4YA 3MXGA 5FJ8H 2EYPA 3NPPA 3RZOB 1SYCA 1PHJA 4DR4Q 4ZQ3A 4B9WA 4LF9Q 3HP3A 2K5WA 1RDPD 5JPNC 5LMNW 3J7A5 3CQZH 2AQ3B 1AFPA 4FVMA 1IW7C 4HN7A 4TKOB 3GTLH 3KF6A 5KNCA 1EQTA 4QF4A 4OHJA 2EY6A 1M4VA 2RVLA 4A3LH 2FMMA 1N32Q 4IOCA 3NXWA 1H9SB 2MGSA 4YCWA 1SMXA 4DAPA 2PO4A 3HOXG 2BA0A 1NUCA 3CCQA 4K5WA 1SE3A 2C5CA 3FPPA 4HEDA 2R93B 1PDQA 3SK8A 1KD1C 4C3JB 3G4SA 4MZ9A 4K6DA 2K1BA 4OO1H 1B4OA 2OQ0A 1Y14B 1HCZA 1STEA 3BYTB 3J80i 1SYBA 2JSOA 1SYEA 2VUMB 3PQIA 1L0XB 2Q2HA 1E2WA 1KAAA 2KA7A 3HRZC 3U50C 4ALPA 2AKWB 2RSNA 1JWSD 4BBSG 1D1IA 4LJZC 3PUWA 4DV7L 1OO9B 1B2TA 2PW7A 4EQNA 3A74A 1LT3D 4UY8C 1EIGA 2KBNA 1UUPA 4GLAC 1K83H 1Y1VB 5CC4A 4DXFA 1U0LA 2MJ8A 4IUPA 4H7BA 1N36Q 3PCOB 4A3JG 1ILQA 2JXMB 2RHQB 4BXXG 4C2MH 1OXSC 2L5TA 3FP9A 3RN5A 1Q8IA 1ASZA 1NTGA 1CZWA 5G3LF 2ZTCA 3UI2A 4WFN3 1KTKA 4ZCKA 1PXUA 1IBLQ 4RCNA 1YVCA 3NQIA 3SVMA 4YWKA 3JC66 4KJNA 4CDDC 1PZJD 4IFDI 2OT2A 3SEBA 2BDOA 4CDCC 1R9TH 4P74A 5M3FH 3GTQB 4A3GB 1G291 2ZJQA 2IT1A 1D5ZC 2NUCA 5IYCH 1NMGA 2Z8LA 4YY3L 2JQOA 4X66L 3UDGA 5C6AA 2FINB 3NTIA 5KRUA 1GVPA 1SE2A 1UEAB 2F0FA 3PF5A 4LF6Q 5BN5A 1KIXA 5C0XI 1TY0A 2V1CC 3DHQA 3K59A 1WCMH 1MJEA 2F03A 3WOFA 5D3DA 1Y69U 1D5MC 2B2TA 2CFMA 4LFAL 3TS0A 4NXML 1NAPA 1Q3LA 1RTNA 3PF4A 1RCVD 2HQEA 3VYRA 3S14B 1FYCA 2MP1A 2NVTH 3V2TA 2Q2IA 1RODA 1JOKA 1TXYA 3CQZB 1ONLA 4DV5L 1TQOA 2TSSA 3BDLA 5J39A 1S72A 4OEMB 5CV4A 1SMYD 3GTLB 2A6EC 1LTGD 2N88A 4HJ8A 4QQBX 3TZUA 4LF5L 5HY6A 2PZWA 1TVXA 1YNJD 1HXYD 4PZ8A 3AYHB 2KENA 4LFBQ 1JQYD 3I56A 2B2YC 2GVAA 3HEJA 3I4NB 1EQQA 3ULLA 2O2LD 1VCIA 4JVZA 1SDFA 1EY8A 2F0OA 4NMZA 4KHPL 2WP8J 1B3AA 4AYBG 2ICEC 4POGA 1EQVA 1MSGA 2SNSA 3BYYB 3CCRA 1F2ZA 4PZ7A 1I3QH 3AQQA 1EFWA 4FYDA 2R93G 5ISRA 3MEFA 4JI4Q 2J0TD 3T51B 3A55A 4C3JG 4HJAA 1XMQQ 1K83B 3NWTA 4J6HA 2IL8A 1PLFA 2M2LA 2F4VL 3OYYA 1BUVT 2A69C 4C2MB 1DM0B 1XXGA 2P5ZX 4N9TA 2VUMG 1XNQL 2WINB 4LNQA 2K03A 3W1BA 2JN4A 4LF7Q 1AW7A 3T56B 5KNDA 4IJHA 2A5HA 3TREA 1DZ1A 1WD0A 2E76C 5CR3A 3M4PA 3KK7A 5CYUA 1PRTC 2I07B 1STAA 3A5UA 2CCZA 1Y1VG 3J80L 1R9TB 2UUBL 4JI0L 5M3FB 2YU9H 4NKLA 3IRBA 1I50H 2I0QA 4GNXC 3T53B 4DR6Q 1ML0D 1PH6A 4U673 1VQ4A 1IBKL 1I4GA 2LXJA 4F8MA 2KEEA 1WCMB 1EY6A 2NN6I 3W1GA 3A8KE 2AUKA 4KKTA 2Z4HA 4JI8L 5IYBG 4B08A 1PYWD 4A3GG 2NVTB 1S40A 4RKLA 4DA2A 1KAWA 4AIMA 1QNKA 3HG9A 2AHOB 1OXUA 2H4OA 1EY7A 2EY1A 2K32A 3BZCA 1SSOA 2IPKD 1SFOH 1X3GA 1GUSA 3B6YA 3AFQA 4DR3Q 3NHHA 2IWHA 1O7IA 1H9MA 5JJLA 5EBCA 3BU2A 3NUCA 4H44C 3Q0AA 3FEWX 5FJ8G 1I6VC 3JAME 2NTSA 2KJXA 1DCZA 4MTNA 4JBWA 3HS0C 2JA5B 2K5VA 1WTPA 3HKZB 2QCPX 3J81j 1A6XA 3MXNB 1OXTA 4LK1C 1AZPA 2CQOA 1C48A 3VYTA 2R3ZA 2ZJPA 2UUCL 4A3LG 4UP8A 4B3SQ 3CRLC 2JE6I 5I4DA 2A68D 4ABNA 3FMCA 4KJOA 2JK8A 2E5LQ 4P71A 2DGYA 5IGCA 4HIMA 2VXWA 4KHVA 5KGUA 3R2TA 1OTCA 4G7OC 3PGZA 3CKIB 1I3QB 2E2JH 4C56C 4XTCS 3P7JA 3TS2A 5GAHC 5IYDH 2R92H 1CZGA 1HTPA 4OO1G 4I65A 2BH8A 4R8NA 4A3MG 1V1PB 1SRUA 4DV3Q 5GQOA 2VQEQ 3C1FA 1E0BA 3KOJA 2XVSA 1X55A 1HNZQ 1PH5A 1BXTA 1CQVA 3F8TA 1HR0L 3HKSA 3K5MA 3CAMA 3OMCA 1Q12A 4QMGA 2JA8H 2QILA 4IOAA 1FJGQ 1O80A 1SNQA 1VQGA 1RD9D 4JI3L 2YU9B 1I50B 2RBMA 4YY3Q 1LTRD 1PFNA 1F2YA 4A3FH 4I7AA 3MXNA 3CCVA 4F88A 5LMUQ 4IURA 2G9HD 4JI2L 2AQ2B 1PTOH 4DUYQ 4NXMQ 3HOXH 5FLXE 5HGQA 1SYDA 1X3QA 2C35B 5IT9E 4G7ZC 3I91A 1W6JA 2F0EA 3S2DH 5I2YA 3GQBA 5I6YA 4DV5Q 5BN3A 1PH3A 1VQ9A 5M3FG 4O2DA 1E1OA 3F2UA 4GKKL 1HH2P 1LABA 4K5XA 4JOIC 3WWVA 1PFBA 1SYGA 2F3WA 1YNND 1AZQA 1TIID 3I55A 1JE4A 2EZVA 2EYOA 1LTSD 1SFOB 4CBVA 5DEHA 4LF5Q 1LYLA 1MHWC 3Q24A 1V1PA 4IUQA 3KUPA 1S3OA 4LW1A 4LFCL 5CV6A 3VR2A 1WCMG 4HR7B 5ELDA 2VZAA 3VDYA 5IT9c 2Z9HA 1S4ZA 2L9HA 1RKNA 4IFDH 1A2UA 4GZYC 1PFMA 2GVBA 4J8QA 4WJWA 4L5RC 4B3ML 4L5QA 4A3JH 2Q2TA 1HJPA 3GV6A 3H09A 1EOTA 2XIWA 2E74C 1E1TA 2QGQA 3LGJA 2BE5D 2KUMA 3CPWA 2KEDA 4B3RQ 1FNWA 1VQIA 4GKJL 4OGQC 3V05A 1QUQB 3I4LA 3HKZG 5JOBA 1SYFA 2BDNA 1I5FA 4FF2A 1Z7TA 2OXPA 2R92B 1DONA 4LMQD 1VMCA 2HCIA 4GN3B 3MEHA 1N36L 1QCBD 3CCJA 2B2YA 3QOJA 4JCVE 1F9QA 3PIO3 4AH6A 2L55A 4MNOA 3UDXA 1DOLA 4WRDA 1T5XD 4P73A 1K3RA 1LTAD 1E2ZA 1GHJA 1YNXA 2JA8B 1PYBA 1PH7A 1BBWA 1UE6A 1YEZA 3EA6A 3I73A 1UE7A 4RGTA 2HUGA 1IBLL 4HAEA 4WJ4A 1V43A 4F7XA 3H0GH 1WTQA 4XXEA 4C3IH 2VW9A 2NWGA 2HHHQ 1DOKA 1WTXA 3I7FA 2QEXA 3GV3A 3TP7A 4YCUA 5I6WA 1IBKQ 4A3FB 4FF3A 2OEOA 1YHBA 4QIWE 1ZYRD 3DLLA 2QDBA 4NB3A 2ASBA 3TP6A 1XMOQ 1PTOB 4JI8Q 4LF6L 3CCUA 4A3EH 4EQ5A 3HOXB 5KYLA 1IL2A 3U58A 2EYJA 4DV6Q 4KD3A 1EWHA 1RIPA 2AWOA 1NCVA 4PQXA 3UE0A 1EWCA 5I9PA 2XNAC 1KHIA 3DXJC 5CV9A 4OWTB 1SR3A 3KLWA 3T1YL 4X3KA 2IX3A 2RHSB 2EYLA 4GNXA 5JVH3 3H3VH 4N9PA 1D5XC 4EQOA 4HJ9A 5J22A 1ESFA 2RCNA 1GKHA 2B2WC 1GUGA 1YNJC 1PV4A 1V1QA 1VQ8A 1PTOD 1UAPA 1ILPA 2ATWA 3S24A 3G6EA 4CKEA 4LF4Q 4X62Q 4HSPA 3U9OA 2KCCA 1JB3A 3BVMA 1C4QA 4RWSC 4A3JB 4LFBL 1NE3A 1E24A 5JEAH 3TDQA 1Q1EA 3PO3G 2PZTA 2B29A 2D5DA 2RA4A 2OF1A 2Q8TA 3M9BA 3M85A 3TRZA 1CKNB 2CH4W 1LM0A 2LSSA 1E2VA 2WAQE 2F3IA 4JI4L 3D4DA 1XMQL 3T16A 1PVOA 2EDGA 4R4CA 1YIJA 5DM63 2NYZD 4X3TA 1WTRA 1VQFA 3EROA 1AE3A 4LF7L 1QVGA 4XT3B 3P20A 3VR6A 4UP9A 4YCVA 1X3PA 5E7NA 1QILA 2LS01 3K7UC 1VQMA 4JI3Q 2JA6H 2JA9A 3H0GB 4B3TQ 4C1NI 3NK9A 4C3IB 5IYDG 1OXXK 4QGUA 2UUAQ 2R92G 4X65Q 3DWQA 1F2MA 1J9OA 4K5VA 3KBGA 2K5QA 1V9PA 4H02A 3CXCA 3CD6A 4O1NA 4O42A 2OTLA 3QB3A 1F9PA 1EU3A 4DR6L 3F1ZA 4LAAA 1PH9A 2RF4A 3LNNA 5M3MH 5NUCA 3S9WA 1G2SA 1C9OA 2PQAA 4A3EB 4R9WA 3DMUA 4IPDA 1SNPA 1AH9A 2VNUD 2L0CA 3T4AC 1Y1WG 4YHHL 3C1EA 4GKKQ 2EOTA 3D4WA 1JJCB 4ZKBB 2ZXPA 1K8MA 4CDFC 4ZK9B 1HUNA 4IUTA 1O7YA 2DNCA 1QZHA 2MPMA 1HNXQ 4DK0A 3NBIA 3GTMH 4Y52H 4RA8A 3MTSA 5EKLA 4J1MA 4A3FG 4A3DH 1CM9A 3TQYA 3GTPH 4LFCQ 4K14A 4HJ5A 2A6HD 2XRSD 4DR3L 4QCLA 3S15H 1SNMA 1HTLD 1I94L 2YYZA 2IJ0A 4AYBB 1JORA 3RN2A 5EAYA 4A93H 1JWUD 4RG1A 3MAQA 1I6HH 1JB7A 1KABA 1EY9A 1LTID 5CV5A 1VQHA 4B3MQ 1EYDA 2X6GA 4ZYSA 1CSPA 1R4PB 3UDIA 1A3TA 4GN4B 4JOIA 4A3MH 3N6RA 2A68C 1GJXA 2Y0SB 4DV1Q 2IY5B 1A3UA 4GKJQ 3KBXA 4BWGB 4B3SL 3D4RA 2HIVA 1G8ZD 4DR7Q 1HRJA 2CWPA 5C4HA 3NEMA 5CBAE 2E5LL 3CP0A 4DFAA 4IFDG 2A73B 4RHSA 1U4PA 4RKBA 3OW2A 4JI5Q 1TU2B 3QJYA 3RD4A 3EBEA 3A5ZB 4IZ8A 2R7DA 1KDAA 3CCLA 2J7ZA 2N78A 4L5SA 2F0VA 4JBJA 2K5NA 4DAYB 5CV8A 1D7QA 4DV3L 2VQEL 1XPRA 5J3BA 1HNZL 5C0XG 1ICFB 2EJGC 1D8LA 1H9SA 2N55A 1RL2A 4DAVA 1VF7A 2KECA 1TT2A 2M9VA 3M7GA 4DF7A 2JA6B 3E3XA 3L9AX 4QUFA 1QOHA 3PUVA 3G7LA 1AP0A 1FJGL 3IFTA 5IP9H 3R93A 3ZJYC 4K0KQ 3ICEA 1CHPD 3PUXA 1IYJB 4V190 5D3IB 2YTVA 1TR5A 4DK3C 2MO0A 5M3MB 4R8IA 1EIFA 3S17H 4M8AA 5CGKA 5LMUL 2F0PA 1GM5A 1HZ9A 3M7NA 3K0XA 5DNFA 1DYQA 1KL9A 4DUYL 2WB1E 4O0AA 3H0GG 1SNCA 3K57A 3CU7A 3QWNA 4C3IG 2EE1A 1SXTA 1EIHA 1LO5D 1YNNC 3T1YQ 3GTMB 2G5DA 1L2FA 4LF8Q 4MN3A 1U9RA 2PCFB 5JAVA 1B8AA 2E2DC 2N3SA 3GTPB 3K0YA 3MXPA 3STBD 3S15B 5A35A 3CF5A 1F9RA 1TY2A 1WTHA 4A3EG 1ET6A 4FP5D 2DJFC 3J7YW 4A93B 4X6AH 4DV0Q 5IWAL 1I6HB 5E1FA 2E75C 2EXDA 3J81i 2UU9Q 3W3AA 4V0BA 5CV7A 2UXCQ 2WFWA 4L8JA 1KDBA 1I4HA 2QDLA 3RLFA 4JBKA 3KLSA 2EJMA 5IGGA 4GLXA 4A3MB 2E2IH 1PH4A 1S5DD 1T5EA 1JWMD 4FXGC 4KY7A 2BE5C 1EY5A 1YITA 1UE1A 4HJ7A 2K50A 1HNWQ 1HFNA 3K5OA 4NDXA 3OIQA 2F0JA 3HZXA 2EIFA 5JJIA 4B3RL 5C3EH 2B2WA 5C5MA 4AQYL 5IOCA 2NTTA 4RGNA 1XPOA 2JA7G 5ELOA 3ULPA 4KN4C 2ZM6L 2D62A 5ELNA 2K75A 1N33Q 5JEAG 3MHBA 2XSCA 2Y0SG 1Q8KA 2K52A 2HD3A 2ZXRA 3OSOA 5F2DA 2SEBD 5I9OA 4NXNQ 1SEBD 3BZKA 2CWAA 1SJHD 3FHWA 1EQRA 1RHPA 1TKWB 2XTIA 1WOCA 1WI5A 1EOVA 5GROA 2NN6G 2ZJRA 3TP5A 4N8X1 3O13A 1CK1A 1TWHH 2E8GA 3IAYA 2F0HA 5T1IA 4FXKC 2PMZE 5EJWA 4BY1H 2HHHL 4DNRB 1JOOA 1JT8A 1ZYRC 4LUZA 5KYIA 2RDHA 3HOUG 2B2VC 4A3BH 2PW5A 2JJQA 3A8JE 3S17B 1EUJA 4YHHQ 1XNRQ 1SE4A 1XMOL 3QO2A 3RZDH 4QL5A 4FF1A 2JA6G 4IPHA 1G6PA 4R4OA 4DV6L 1IXRA 5C4XH 3S2HH 4IJLA 2F0NA 1VQ5A 3VYSA 1LV9A 3X3MA 3TZDA 4NPSA 5M9OA 1TWFH 3U4VA 3SDZA 2WIIB 1I94Q 1CA6A 2LKVA 5M3MG 2X6LA 4A76A 1GUWA 3PO3H 3A8IE 3PIPA 3H94A 3UE1A 1K8AC 1PTOC 2KCTA 4FF4A 5C4JH 1HA5A 3BS1A 5IP7G 4ID6A 3I3CA 1CUKA 2L11A 4LF4L 2UXBQ 4X62L 4A3DG 2LMCB 2F0IA 2NVXH 2Q8IB 3TSSA 2E2IB 3NP8A 4JI6Q 1AE2A 3DWAA 3J7AF 1Z9FA 1JOQA 3CRKC 3AEVA 1VQPA 5ELBA 4A93G 1A15A 2A1AA 4KKUA 1NJIC 1QNUA 2K4KA 5D14A 2D0OA 3EVQA 5C3EB 3RR5A 4CKBA 1S5CD 1WYDA 2B2UC 1ENFA 2A8VA 3KLSX 3K58A 2CH4A 5ELCA 2ZTDA 1XYIA 4TVAB 2IW3A 2SDFA 1STGA 2A74C 4P75A 2AWNA 5M5XH 2K33A 4ZKCB 1B50A 1TWGH 1DD2A 2N8NA 4KY6A 2UXDQ 2NZHA 4K8IA 5C3WA 3J81L 1F77A 2EY5A 3GO5A 3I90A 1VQOA 1K0RA 4HMIA 1YJNA 5IY0A 3OWFA 1B9NA 5FKAC 1TWHB 1Y1WH 3OMGA 1HR0W 1EY0A 2TMPA 5BN4A 1IYUA 3WOEA 4B3TL 2UUAL 3DEPA 3RLOA 4X65L 4BY1B 1KNAA 2F0KA 2R7FA 2Z1CA 1W6KA 1VMPA 3P75A 4DKAC 1L1OB 1A62A 3HOYG 4A3BB 1ENCA 2XWJB 1O7LA 4XYQA 3W5OA 2F0DA 1JC7A 1HZAA 5AJ3Q 3RZDB 2EYHA 4IUVA 3E0JA 5AFWA 4A75A 1M90C 1STHA 5C4XB 5IP9G 3S2HB 2EXZA 4DXGA 1X56A 1HNXL 1IKMA 2R61A 4TSSA 1TWFB 1W3SA 2A6HC 4Q0FA 2L4NA 3RLNA 1PZKD 2K04A 4KN7C 2KHSA 3T13A 1WTVA 3PO3B 1EYAA 3CCEA 5IWAQ 3SR1A 2D9UA 5K36H 3I4OA 5C4JB 3DM3A 4KK7A 1BCPD 5H1SE 3PO2H 1YZ6A 1G51A 3G71A 3NTKA 4JI1Q 2ZT9C 1YJWA 5KNBA 3VA7A 4APVA 4C3HH 4CHTB 2HDMA 1VDZA 3S1RH 3UDFA 5IGBA 2F0UA 4K2LA 3H3VC 4KD4A 1VQ6A 2H1EA 3KFUA 4DV1L 1GUNA 3NSWA 3URYA 1RF2D 5C0XH 4AQYQ 4DR7L 1EZ6A 2AUJD 5LL6S 1P8LA 2LY7A 3BVGA 1NMFA 2E2JB 3ONAB 2ZM6Q 1LT4D 2FXQA 2M00A 1BQQT 3KLRA 3HOZH 1QVCA 4JI5L 1SROA 5M5XB 4JK1C 5DM73 4UAIA 2KOLA 3K5LA 1GUTA 5K5PA 1TWGB 1VQLA 2IHFA 1VF5C 3U4ZA 4LUOA 1VQKA 1KQSA 3ULJA 5LHY1 1B53A 1JJ2A 4DR5Q 2K5HA 3ND9A 5C3EG 3GTKH 1STBA 1HZCA 2MHVA 1LACA 4HSVA 1CHQD 3AU7A 2I46A 2Z4IA 4BA1I 1Y1WB 4JI7Q 4JV5Q 3QR8A 1SAPA 2A69D 3OHXC 2R7ZH 1YI2A 2XRQD 5FK9C 1H9RA 3JAMi 5FOBB 4XQJA 2KCMA 3CW2C 1F9SA 4HCSA 2ZTEA 5JVG3 5GADC 2F3VA 1Q90A 2NVYH 1VQ7A 4K0KL 2EJFC 2IX0A 3MXUA 1S5BD 3FKIG 3DM1A 3J80E 1PTOF 3EQLC 3H15A 2MUYA 4BA2I 4J15A 3OW7A 3I8ZA 3MZ5A 1XPUA 3DEOA 1FGBD 3S2DB 3GP7A 2F0MA 1QUQA 1GOZA 2N49A 4OIJA 1RJTA 4L63B 4BY1G 1SMYC 3LWEA 1K9MC 1A0IA 1LT6D 1HA6A 4EVOA 1EYCA 2RSOA 3STBC 2L15A 2GA4B 3I70A 4H13C 4XIGS 4LF8L 4A3BG 3MWYW 3G48A 2K28A 1JMCA 3J80c 2B2VA 5FO7B 5M5WH 5EGTA 3V96A 3D8GA 4G57A 3F2BA 5C4XG 4DV0L 4C1NK 3PO2B 1PH1A 2JA7H 5ELFA 1I4QA 2UU9L 3MFYA 1Q81C 2F0LA 1IBML 4RH6A 4U68A 4R1JA 3IKJA 4IPGA 4C3HB 2UXCL 3S1RB 4QUCA 4DV4L 1J6QA 3EFXD 1C0AA 4ODGA 1H9JA 1WTWA 1HNWL 2A19A 3CC4A 4N8FA 2NN6H 1N8RC 1EEFD 1LT5D 1DOMA 4I7ZC 5I2XA 3NENA 5ELEA 1LTLA 3RMHA 1K8GA 4HIOA 1NSNS 3HOZB 5COYA 3NBHB 1IYVA 2V4DA 3WDNA 1BVSA 1EIYB 1R4QB 2QW7A 3ERSX 1YBYA 3MA2B 1N33L 2WACA 3HOUH 2K5DA 4XQQA 2CVRA 4NXNL 3MFGA 3LX0A 1PH8A 3J7AV 1N34L 3NELA 3GTKB 1DJRD 1MJCA 2OQKA 1PA6A 2RDGA 2RDFA 4HCEA 4DAMA 3CC2A 4AYBE 2R7ZB 2JEAI 2B2UA 3BVZA 5M5YH 5E3FA 3P1HA 3F2CA 3EIVA 1G6ZA 1LLRD 1Z6HA 3A54A 3KJPA 3TMEA 2NVYB 1B44D 1FNVA 1L0YB 4RHRA 4NP5A 4DK1A 4ZUJA 1ZXTA 2NB0A 2Y0SE 1NR2A 3QOLA 1MKHA 1O78A 5FO8B 5J1ZA 1XNRL 3L2PA 2VB2X 5IP7H 3S1QH 2KQ3A 3QIAA 4FO2A 4ME5A 3CCSA 1CKNA 3R2IA 1VQCA 3NQTA 3PSIA 5L37A 2O5IC 1MD2D 5LMNL 4E6IA 3I72A 4DR1L 1H9KA 4QJFA 1M1KC 3A0JA 2WAQB 2QKIC 4IPCA 5IGEA 4K6LA 4PZ6A 3S14H 4CDEC 1TS4A 1GUOA 3CCMA 4JW0A 2I5MX 3JAML 5M5WB 1C7YA 3K7AH 3FPUB 2Q8RE 4LUVA 1SN8A 1QG7A 3ERQA 4ULLA 2JA7B 4RFBA 1Y8PB 3GDEA 3D0FA 1FR3A 3EN2A 1Y8NB 3HGBA 3E6ZX 3CMEA 4BBRH 2UXBL 3S1MH 3Q22A 3TP8A 2K05A 2C9OA 2PYKA 4JI6L 2B63H 1CFMA 1EEID 5JPMC 2DN8A 2F1MA 1JICA 5K36G 2F4IA 2ENBA 4DR2Q 4DN4M 3I4NH 3H91A 1BO0A 4HMJA 2YTXA 3PO2G 3L3OC 5DLQE 2PI2A 4KKSA 1STNA 1BOSA 1NR4A 4C3HG 4GOPB 3PMFA 5A2QE 3HOWG 2WKCA 1KLGD 3HOUB 5EPJA 4X64L 1ET9A 3HOYH 1IHZA 3I4MH 3VR5A 2UXDL 2DJGC 4KI0A 4M1UB 3ND8A 4JG2A 5C5LA 1S5ED 3Q23A 2L12A 5EBDA 2VQFQ 1V1OA 1J5EQ 3HOZG 2FHTA 4RAUC 1WD1A 2LFNA 1Z47A 5M5YB 3S16H 2VY3A 1T9HA 5D65A 3D6WA 3E9IA 3IFDA 3R3OA 1CKMA 3KYHC 2VL6A 4UDUC 4F87A 1Q86C 5DAUA 1Y8OB 1I4RA 2OTJA 2LXKA 4DPGA 4A3KH 1LTBD 1NY4A 5FLXL 5IT9L 2Q2UA 1ESRA 5AJ3L 2R7ZG 1WJJA 3S1QB 4Y7NH 1VQAA 1B70B 2G9DA 1KXLA 4A3DB 4DV2Q 1TS2A 3HOVH 1HUMA 1L1OC 5G3LD 3CC7A 4GOPA 4GLVB 3N52A 2R6GA 3U9SA 3NTHA 1KNEA 4DAYA 3SXHA 4JYAQ 1VQEA 1H95A 4FDBA 1PMRA 3GTOH 3K7AB 4YWMA 3DWPA 2HQLA 1BCPC 4IFDJ 4JBMA 1IBMQ 1UE5A 4RGOS 5GAEC 3S1NH 2AMCB 3A7AB 3ER0A 4X3SA 4OIKA 1EWIA 4DV4Q 1X32A 2RQXA 4OWWB 1MI2A 4IUNA 4JI1L 4BBRB 2WAQG 3S1MB 3J7ZC 4PMWA 5LL6X 2HIXA 1FGUA 1F2LA 2B63B 2Z6KC 2JA5H 5C0XJ 2GN5A 2Z0SA 3A56A 4FNFA 4MTKA 1CKOA 2B39A 1X6OA 4CJ2C 4DK6C 5HURA 1UNSA 2NBFA 2RKSA 2I5LX 2XN9C 2HDLA 3SK6A 5JJKA 1B9MA 1KC8C 1VS0A 2PQEA 3OTOQ 2JEBI 1EY4A 1XJVA 3SGIA 3R8BA 2IX1A 1XTCD 2WB1B 2B8GA 1QB5D 4EQPA 2X69A 1S5FD 4K8JA 3FKIH 3HOYB 3OWEB 3CHBD 1SE8A 2PNHA 1N34Q 1SBBB 2QA4A 3I4MB 3I2ZA 3F2DA 2ALYB 2BCOA 4BS9A 5C44H 3BDCA 3SHLA 4DR5L 2K6AA 5BR8L 1D1KA 1RTOA 4A3CH 4DUZQ 4JI7L 4JV5L 3H3VI 1M8AA 1B7YB 3HKZE 2IHEA 3S16B 2QEJC 4RCOA 4PG3A 1LTTD 1AEXA 5IGFA 1D6EC 2FFKB 2I5HA 1JR0D 3BJUA 2F52A 1PH2A 2MFIA 2HT1A 4CGYB 2EPBA 1II3A 4A3KB 1K8OA 1CI3M 1ZEQX 5KIXA 1E3PA 2CW0D 1W2BA 4TQUS 5FLMH 4Y7NB 2ES2A 3OOCA 4KY5A 5LMNQ 1K3BC 1QVFA 1TWAH 4DR1Q 2BH2A 4DNTB 3C2PA 2SOBA 1VQJA 2DY8A 2EYFA 4MIUA 3HOVB 1XTDA 1QJOA 1SNOA 3E9HA 2E2HH 1BNZA 3K81C 4RGMA 1U4RA 3GTOB 4XT1B 4OX9L 3ZYYX 4PMBA 1Q1BA 1STYA 3S1NB 1IW7D 4YIJA 1MBYA 3D6CA 2PNRC 5JEAJ 3G6JB 3M3YH 1GXDC 1E22A 1X65A 5EPLA 5E4XA 5CBEE 2AQ1B 1X54A 3AB9A 1E7ZA 2PMZB 4P2CB 1PZID 5KEEA 4GN5A 3H6MA 4XQNA 2NZOA 1NBWA 1WVLA 4K2KA 4WORA 1X9NA 2CHBD 2WKDA 2JYOA 4OWXB 2K14A 1B3QA 3CMAA 1A3VA 4QY7A 3OIPA 4TRDA 1L0WA 4DV7Q 5CORA 4ZAIA 4G4KA 4BBRG 1A63A 4B9XA 4BY7H 3K8AA 4X64Q 5CMDA 3JAMc 2B63G 3X3NA 3FKIB 1BF4A 4A3IH 4PNYA 3PUZA 5C44B 1AN8A 3I4NG 3FVQA 2F0SA 2VS1A 4L5TA 3GTJH 3KDFB 5E4WC 4XYOA 2BOSA 1G2TA 4ZLTF 1WTOA 2NZ1D 2WB1G 1FNUA 2OWOA 5T1GA 2K01A 3E0EA 2F0WA 4CJ0B 4OELB 2BA1A 1YHAA 2H5XA 1CA5A 4Z9CB 1JJGA 4PMCA 3I4MG 3PIP3 1CQFA 1KDCA 1BCPF 1BCPB 2F0GA 4OO1I 2K7VA 1FVIA 3SE0A 4IQZA 5EKKA 4X66Q 3W2DA 3PIOA 1X3FA 2KHJA 4X3UA 2OCEA 1XX8A 3KJOA 1TWAB 1FD7D 3T1HL 4EGVA 4S3SA 4G7HC 5JJZA 2JP1A 4LFAQ 1IZ6A 4KMUC 4ZRZA 1SJED 2E2HB 4IO9A 1OXVA 4KV6A 4DR4L 4A3KG 3NWSA 4MHEA 4LF9L 3RNUA 5IYCG 4IUUA 1I4XA 4QB4A 5TSSA 1GD7A 2A6ED 3KDFA 1VQDA 4NW2A 4BBSH 2NVXB 4PV1C 1K0SA 3M3YB 3OPOA 3HOWH 3HOVG 1N32L 1KRSA 4JC0A 1EZ8A 1O7ZA 1Q46A 5FLXc 1L1OA 3HFZB 3FRPB 3SK4A 1N9WA 3TN2A 2ID0A 2RCFA 2WV6D 1SNDA 1YHQA 4DR2L 3BZDB 2CQAA 4KLKA 4P72A 3NE5B 4BXXH 4HIKA 2NVQH 1ZKOA 3IL8A 4KHPQ 2YV5A 2PZUA 3E5SA 4HTHA 1D2BA 4BY7B 2Z6BA 1HQRD 3L0OA 5A2QL 1J8IA 1PRTF 1PYSB 3DUZA 1PRTB 2JA5G 4CKCA 4A3IB 1ENAA 2MQHA 2YTYA 2F4VQ 1HFGA 3D3RA 2Z6KA 5BR8Q 1HPCA 4R4QA 1UEBA 1A8VA 4GNXB 5C3XA 3GTJB 2J4XA 1LUZA 1JCKB 1JE5A 1HZBA 2DUDA 5EKIA 1XNQQ 3EJIA 1FL0A 4DU9A
chains in the Genus database with same CATH topology
1SLJA 1XNRL 3L2PA 2VQFL 5IP7H 2JK8A 1J5EL 2E5LQ 4P71A 4X6AH 3S1QH 4DV0Q 5IWAL 2DGYA 1VQNA 4HIMA 2EXDA 4GOPC 3J81i 1OTCA 3CCSA 4YWLA 2UU9Q 1CKNA 1P16A 1VQCA 3PGZA 3PSIA 4UP7A 2E2JH 4XTCS 5LMNL 2UXCQ 2WFWA 3TS2A 4UPAA 1Q82C 3M4QA 4DR1L 4QJFA 3RLFA 1M1KC 3A0JA 5GAHC 2UUBQ 2E2IH 4GLXA 4JI0Q 4JBKA 5C44G 1PFSA 1PH4A 2R92H 4OO1G 4IPCA 2BH8A 4PZ6A 1K73C 4A3MG 1TWCH 1SRUA 3S14H 4DV3Q 3PUYA 5GQOA 2VQEQ 1YITA 1UE1A 4HJ7A 3PV0A 2K50A 3CCMA 3KOJA 2I5MX 1C7YA 4A3CG 1X55A 3K7AH 4RMFA 3Q8DA 4LUVA 1HNZQ 1PH5A 1SN8A 3GTGH 3F8TA 1HR0L 3HKSA 1Q7YC 3CAMA 1Q12A 2EIFA 2JA8H 3M4OH 5C3EH 4B3RL 5JJIA 4AQYL 4IOAA 3D31A 1XPOA 5ELOA 3GDEA 3ULPA 2JA7G 3D0FA 3EN2A 2XGTA 4DV2L 2ZM6L 1BBUA 3K80C 2CKZB 3CMEA 2D62A 4BBRH 1FJGQ 3RZOH 5ELNA 2UXBL 2K75A 3S1MH 5IYDH 1VQGA 1N33Q 4JI3L 5JEAG 1ASYA 4JI6L 2Y0SG 1Q8KA 2K52A 2B63H 4OX9Q 4YY3Q 3KF8B 4ME3A 4NXNQ 1MIUA 3BZKA 2CWAA 3GD7A 4A3FH 4JYAL 3FHWA 2XTIA 1EQRA 5K36G 1QZGA 5FLMG 3TEHB 3CCVA 4DR2Q 4R4IA 3I4NH 5LMUQ 1WOCA 1WI5A 1EOVA 1X3EA 2YTXA 4JI2L 5GROA 2NN6G 3PO2G 2ZJRA 1UWVA 4DUYQ 4NXMQ 5DLQE 3HOXH 2PI2A 1TWHH 1GO3E 2C35B 5HGQA 1VQBA 2E8GA 3CPFA 4GOPB 3S2DH 4HIDA 1PH3A 4DV5Q 2PMZE 1VQ9A 3HOWG 1BKBA 5M3FG 4O2DA 1E1OA 4BY1H 4GKKL 1HH2P 2HHHL 4JOIC 3WWVA 4X64L 4A4IA 2R93H 3HOYH 1JT8A 4LUZA 3HOUG 3I55A 3I4MH 4C3JH 2UXDL 4A3BH 4KI0A 2UUCQ 4LF5Q 4JG2A 1LYLA 5GAGC 2JJQA 1EUJA 4YHHQ 1XNRQ 1EYGA 1S3OA 4LW1A 2PI2E 4LFCL 2VQFQ 2VUMH 2PQAB 1XMOL 3RZDH 1WCMG 1J5EQ 4QL5A 2JA6G 3OTOL 3HOZG 4IPHA 1G6PA 4R4OA 5IE8A 2VZAA 4DV6L 3VDYA 5IT9c 1Z47A 1IXRA 5C4XH 4DNIA 3S2HH 1DGSA 1KRTA 4IJLA 2VY3A 3L7ZC 1VQ5A 1T9HA 3S16H 2GVBA 1U5KA 3E9IA 4NPSA 1TWFH 3U4VA 1CKMA 4L5RC 3KYHC 2VL6A 4B3ML 4L5QA 1Y1VH 4A3JH 1Q86C 2Q2TA 1HJPA 3KF6B 1I94Q 4POFA 5M3MG 4A76A 2OTJA 3PO3H 2LXKA 3PIPA 4DPGA 4A3KH 1E1TA 2QGQA 3UE1A 3LGJA 1K8AC 1NY4A 2MNAA 2KCTA 2Q2UA 1HR0Q 4LWCA 5C4JH 5AJ3L 3AFPA 3CPWA 2R7ZG 1WJJA 4DUZL 4B3RQ 1VQIA 2MO1A 1VQAA 1B70B 4Y7NH 4BY7G 4GKJL 5IP7G 1QUQB 4OXPA 2B3GA 1CSQA 1KXLA 3HKZG 4KHZA 4DV2Q 1CUKA 2KHIA 4LF4L 4A3IG 2UXBQ 1I5FA 4X62L 1YJ9A 4A3DG 3HOVH 4EX5A 1L1OC 3CC7A 4GOPA 2NVXH 4WJ3M 4GLVB 4R4TA 5IYBH 4JI6Q 2R6GA 3GTQH 1AE2A 4A3GH 4GN3B 4OONA 1N36L 1Z9FA 3CCJA 4JCVE 4JYAQ 4AH6A 1VQEA 3AEVA 4MNOA 1H95A 4FDBA 3UDXA 1VQPA 3GTOH 4YWMA 2HQLA 4P73A 4IFDJ 3T1HQ 4A93G 4GS3A 1K3RA 2A1AA 4JBMA 1IBMQ 1UE5A 4JI2Q 2K4KA 5GAEC 1NJIC 1YNXA 2D0OA 1PYBA 3J81c 2AMCB 3RR5A 1PH7A 3S1NH 1BBWA 1UE6A 1YEZA 2D0PA 1WYDA 2EQSA 1UE7A 1EWIA 3ER0A 2JA8G 2A8VA 4DV4Q 1IBLL 1WFQA 4WJ4A 2ZTDA 1V43A 4TVAB 5FJ8H 4OWWB 4JI1L 3H0GH 4C3IH 1PHJA 2WAQG 1HNWQ 4DR4Q 4P75A 3J7ZC 2AWNA 2VW9A 5M5XH 4LF9Q 4PMWA 2HHHQ 3I7FA 2QEXA 2HIXA 5LMNW 3J7A5 1FGUA 3CQZH 2Z6KC 1TWGH 4YCUA 2JA5H 5C0XJ 2GN5A 1IBKQ 2N8NA 2Z0SA 2UXDQ 2NZHA 1YHBA 4QIWE 3DLLA 3GTLH 1CKOA 1X6OA 4DK6C 3KF6A 4NB3A 3GO5A 2ASBA 1VQOA 1K0RA 1XMOQ 2I5LX 4A3LH 4IOCA 4JI8Q 4LF6L 3CCUA 4A3EH 1YJNA 4EQ5A 1VS0A 5IY0A 3OTOQ 1Y1WH 2JEBI 4YCWA 1KC8C 3U58A 1SMXA 1XJVA 1IL2A 3SGIA 1HR0W 4DV6Q 2IX1A 3HOXG 2BA0A 1RIPA 2AWOA 4B3TL 3CCQA 2UUAL 3RLOA 4X65L 3UE0A 2R7FA 3FKIH 4DKAC 1L1OB 1A62A 1KHIA 1SE8A 2PNHA 4OWTB 1SR3A 2QA4A 1N34Q 1KD1C 3G4SA 3KLWA 4MZ9A 3I2ZA 3T1YL 3HOYG 3F2DA 2ALYB 5C44H 2RHSB 4GNXA 2OQ0A 1Y14B 3H3VH 4DR5L 3J80i 3W5OA 4HJ9A 1HZAA 5BR8L 2RCNA 5AJ3Q 2Q2HA 4ALPA 4BBSG 4A3CH 1GKHA 3U50C 4DUZQ 2AKWB 4JI7L 4JV5L 1PV4A 3H3VI 1V1QA 1VQ8A 3PUWA 4DV7L 4A75A 1B7YB 1M90C 3HKZE 5IP9G 3S24A 2ATWA 2IHEA 3A74A 3G6EA 4LF4Q 4X62Q 1X56A 4PG3A 1HNXL 4UY8C 2I5HA 3BJUA 2KBNA 2F52A 1W3SA 4GLAC 1K83H 4LFBL 1NE3A 1U0LA 1E24A 3RLNA 1PH2A 1N36Q 2MFIA 3PCOB 4A3JG 2HT1A 1Q1EA 2RHQB 4BXXG 4C2MH 1OXSC 3CCEA 3FP9A 5IWAQ 3RN5A 3PO3G 1E3PA 2B29A 1W2BA 4TQUS 3I4OA 5FLMH 1ASZA 3DM3A 3M9BA 1NTGA 2ES2A 5LMNQ 2ZTCA 3M85A 5H1SE 1QVFA 3PO2H 1YZ6A 1TWAH 3TRZA 1IBLQ 4DR1Q 1YVCA 1G51A 4YWKA 1CKNB 3JC66 4JI1Q 3G71A 1YJWA 2BH2A 1LM0A 1VQJA 2LSSA 4IFDI 2WAQE 4APVA 4C3HH 2F3IA 1XTDA 3S1RH 4JI4L 1R9TH 1XMQL 3UDFA 3E9HA 4P74A 5M3FH 2E2HH 1G291 3K81C 2ZJQA 2IT1A 1PVOA 1VQ6A 3KFUA 4DV1L 4R4CA 5IYCH 1YIJA 1NMGA 4AQYQ 1VQFA 4OX9L 4DR7L 4YY3L 2JQOA 1AE3A 4X66L 1P8LA 1Q1BA 3UDGA 4LF7L 1NMFA 1GVPA 1QVGA 3PF5A 4LF6Q 4UP9A 4YCVA 2ZM6Q 5C0XI 5E7NA 2V1CC 1KIXA 2FXQA 3K7UC 1VQMA 1WCMH 1MJEA 5JEAJ 4JI3Q 2JA6H 3HOZH 1QVCA 3M3YH 2JA9A 4B3TQ 1X65A 1E22A 2CFMA 4LFAL 4JI5L 1OXXK 5IYDG 4QGUA 3TS0A 4X65Q 2UUAQ 4NXML 2R92G 1SROA 3PF4A 1X54A 2NVTH 1E7ZA 2Q2IA 1TXYA 1VQLA 2IHFA 4DV5L 4GN5A 1V9PA 4H02A 3U4ZA 4LUOA 3CXCA 1KQSA 1VQKA 3CD6A 2OTLA 2NZOA 1S72A 1NBWA 3ULJA 4DR6L 3F1ZA 1PH9A 2RF4A 5M3MH 1X9NA 1JJ2A 4HJ8A 2K5HA 5C3EG 4DR5Q 3GTKH 1C9OA 1HZCA 4OWXB 2PQAA 2K14A 3CMAA 4BA1I 4JI7Q 4IPDA 4LF5L 4JV5Q 4QQBX 5HY6A 4QY7A 1AH9A 2VNUD 1L0WA 4DV7Q 1Y1WG 4YHHL 2R7ZH 4GKKQ 1YI2A 4BBRG 1A63A 1JJCB 4BY7H 3K8AA 4X64Q 3JAMi 4PZ8A 3AYHB 1QZHA 2KCMA 3CW2C 1HNXQ 4Y52H 3JAMc 2B63G 3GTMH 2KENA 2ZTEA 5GADC 4A3IH 2NVYH 1VQ7A 4A3FG 4LFBQ 2IX0A 4A3DH 4K0KL 3FKIG 3I56A 2GVAA 3PUZA 3TQYA 1EQQA 3GTPH 4LFCQ 3ULLA 3H15A 3I4NG 2VS1A 1VCIA 4BA2I 4J15A 4HJ5A 4L5TA 3GTJH 3KDFB 4DR3L 3S15H 1XPUA 1I94L 2YYZA 3RN2A 5EAYA 4A93H 4KHPL 2WP8J 4AYBG 2WB1G 4RG1A 4POGA 1QUQA 1I6HH 2OWOA 1JB7A 3CCRA 2N49A 1VQHA 3E0EA 4BY1G 4PZ7A 1I3QH 4B3MQ 2BA1A 1YHAA 2H5XA 3AQQA 1A0IA 1K9MC 1EFWA 2R93G 1CSPA 3MEFA 4JI4Q 3UDIA 1JJGA 3I4MG 4HJAA 1XMQQ 5JJKA 3STBC 2L15A 4LF8L 4GN4B 4JOIA 4XIGS 4A3MH 2F4VL 3OYYA 4A3BG 3G48A 4DV1Q 2IY5B 1JMCA 3J80c 4OO1I 1FVIA 4GKJQ 2VUMG 4B3SL 1XNQL 5M5WH 2HIVA 4DR7Q 4LNQA 3W1BA 2CWPA 4X66Q 4LF7Q 3NEMA 3PIOA 3F2BA 1X3FA 2KHJA 3KJOA 2OCEA 2E5LL 5C4XG 4DV0L 4IJHA 1PH1A 3CP0A 2JA7H 4IFDG 3T1HL 2UU9L 3TREA 1Q81C 1IBML 3M4PA 4LFAQ 3OW2A 1IZ6A 4R1JA 4IPGA 4JI5Q 2UXCL 3A5UA 2CCZA 1Y1VG 3EBEA 4DV4L 1J6QA 3A5ZB 2UUBL 4JI0L 2YU9H 2R7DA 3CCLA 4IO9A 3IRBA 2N78A 1I50H 1OXVA 2I0QA 4L5SA 1C0AA 4DAYB 4JBJA 2K5NA 4GNXC 4A3KG 4LF9L 4DR4L 1D7QA 4DV3L 2VQEL 4DR6Q 3RNUA 1XPRA 1HNWL 2A19A 5IYCG 5J3BA 3CC4A 1HNZL 1PH6A 1FL0A 1N8RC 5C0XG 1VQ4A 1IBKL 2LXJA 1GD7A 1D8LA 3NENA 1RL2A 3KDFA 1VQDA 1LTLA 1K8GA 2NN6I 4BBSH 3W1GA 4HIOA 3NBHB 3HOWH 3HOVG 1N32L 3PUVA 4JI8L 1KRSA 4JC0A 5IYBG 1FJGL 1BVSA 1EIYB 5IP9H 3ERSX 4A3GG 1YBYA 1S40A 1N33L 1Q46A 5FLXc 3HOUH 1KAWA 1L1OA 3ZJYC 3HFZB 3ICEA 4K0KQ 4AIMA 3PUXA 1IYJB 2AHOB 1OXUA 4NXNL 2YTVA 1N9WA 3BZCA 1SFOH 2ID0A 1N32Q 1X3GA 3B6YA 4DK3C 1YHQA 1PH8A 3AFQA 2MO0A 4DR2L 4DR3Q 4KLKA 1N34L 3NELA 1EIFA 3S17H 1MJCA 4P72A 2OQKA 4BXXH 5LMUL 4HIKA 1PA6A 1O7IA 5JJLA 1GM5A 1HZ9A 2NVQH 3M7NA 3BU2A 3K0XA 4DAMA 4DUYL 1KL9A 4AYBE 2WB1E 2YV5A 4O0AA 5FJ8G 3CC2A 4KHPQ 3H0GG 2JEAI 4MTNA 4JBWA 5M5YH 3L0OA 3F2CA 2K5VA 3EIVA 3T1YQ 1PYSB 2JA5G 3KJPA 1L2FA 3J81j 4LF8Q 2MQHA 3MXNB 2YTYA 1OXTA 2F4VQ 1B8AA 2N3SA 2CQOA 2Z6KA 5BR8Q 2ZJPA 4R4QA 1UEBA 1A8VA 3STBD 4GNXB 2UUCL 2Y0SE 1LUZA 1JE5A 1HZBA 2DUDA 4UP8A 1MKHA 3CF5A 4B3SQ 1XNQQ 4A3EG 2JE6I 4A3LG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SLJ A;  1XNR L;  3L2P A;  2VQF L;  5IP7 H;  2JK8 A;  1J5E L;  2E5L Q;  4P71 A;  4X6A H;  3S1Q H;  4DV0 Q;  5IWA L;  2DGY A;  1VQN A;  4HIM A;  2EXD A;  4GOP C;  3J81 i;  1OTC A;  3CCS A;  4YWL A;  2UU9 Q;  1CKN A;  1P16 A;  1VQC A;  3PGZ A;  3PSI A;  4UP7 A;  2E2J H;  4XTC S;  5LMN L;  2UXC Q;  2WFW A;  3TS2 A;  4UPA A;  1Q82 C;  3M4Q A;  4DR1 L;  4QJF A;  3RLF A;  1M1K C;  3A0J A;  5GAH C;  2UUB Q;  2E2I H;  4GLX A;  4JI0 Q;  4JBK A;  5C44 G;  1PFS A;  1PH4 A;  2R92 H;  4OO1 G;  4IPC A;  2BH8 A;  4PZ6 A;  1K73 C;  4A3M G;  1TWC H;  1SRU A;  3S14 H;  4DV3 Q;  3PUY A;  5GQO A;  2VQE Q;  1YIT A;  1UE1 A;  4HJ7 A;  3PV0 A;  2K50 A;  3CCM A;  3KOJ A;  2I5M X;  1C7Y A;  4A3C G;  1X55 A;  3K7A H;  4RMF A;  3Q8D A;  4LUV A;  1HNZ Q;  1PH5 A;  1SN8 A;  3GTG H;  3F8T A;  1HR0 L;  3HKS A;  1Q7Y C;  3CAM A;  1Q12 A;  2EIF A;  2JA8 H;  3M4O H;  5C3E H;  4B3R L;  5JJI A;  4AQY L;  4IOA A;  3D31 A;  1XPO A;  5ELO A;  3GDE A;  3ULP A;  2JA7 G;  3D0F A;  3EN2 A;  2XGT A;  4DV2 L;  2ZM6 L;  1BBU A;  3K80 C;  2CKZ B;  3CME A;  2D62 A;  4BBR H;  1FJG Q;  3RZO H;  5ELN A;  2UXB L;  2K75 A;  3S1M H;  5IYD H;  1VQG A;  1N33 Q;  4JI3 L;  5JEA G;  1ASY A;  4JI6 L;  2Y0S G;  1Q8K A;  2K52 A;  2B63 H;  4OX9 Q;  4YY3 Q;  3KF8 B;  4ME3 A;  4NXN Q;  1MIU A;  3BZK A;  2CWA A;  3GD7 A;  4A3F H;  4JYA L;  3FHW A;  2XTI A;  1EQR A;  5K36 G;  1QZG A;  5FLM G;  3TEH B;  3CCV A;  4DR2 Q;  4R4I A;  3I4N H;  5LMU Q;  1WOC A;  1WI5 A;  1EOV A;  1X3E A;  2YTX A;  4JI2 L;  5GRO A;  2NN6 G;  3PO2 G;  2ZJR A;  1UWV A;  4DUY Q;  4NXM Q;  5DLQ E;  3HOX H;  2PI2 A;  1TWH H;  1GO3 E;  2C35 B;  5HGQ A;  1VQB A;  2E8G A;  3CPF A;  4GOP B;  3S2D H;  4HID A;  1PH3 A;  4DV5 Q;  2PMZ E;  1VQ9 A;  3HOW G;  1BKB A;  5M3F G;  4O2D A;  1E1O A;  4BY1 H;  4GKK L;  1HH2 P;  2HHH L;  4JOI C;  3WWV A;  4X64 L;  4A4I A;  2R93 H;  3HOY H;  1JT8 A;  4LUZ A;  3HOU G;  3I55 A;  3I4M H;  4C3J H;  2UXD L;  4A3B H;  4KI0 A;  2UUC Q;  4LF5 Q;  4JG2 A;  1LYL A;  5GAG C;  2JJQ A;  1EUJ A;  4YHH Q;  1XNR Q;  1EYG A;  1S3O A;  4LW1 A;  2PI2 E;  4LFC L;  2VQF Q;  2VUM H;  2PQA B;  1XMO L;  3RZD H;  1WCM G;  1J5E Q;  4QL5 A;  2JA6 G;  3OTO L;  3HOZ G;  4IPH A;  1G6P A;  4R4O A;  5IE8 A;  2VZA A;  4DV6 L;  3VDY A;  5IT9 c;  1Z47 A;  1IXR A;  5C4X H;  4DNI A;  3S2H H;  1DGS A;  1KRT A;  4IJL A;  2VY3 A;  3L7Z C;  1VQ5 A;  1T9H A;  3S16 H;  2GVB A;  1U5K A;  3E9I A;  4NPS A;  1TWF H;  3U4V A;  1CKM A;  4L5R C;  3KYH C;  2VL6 A;  4B3M L;  4L5Q A;  1Y1V H;  4A3J H;  1Q86 C;  2Q2T A;  1HJP A;  3KF6 B;  1I94 Q;  4POF A;  5M3M G;  4A76 A;  2OTJ A;  3PO3 H;  2LXK A;  3PIP A;  4DPG A;  4A3K H;  1E1T A;  2QGQ A;  3UE1 A;  3LGJ A;  1K8A C;  1NY4 A;  2MNA A;  2KCT A;  2Q2U A;  1HR0 Q;  4LWC A;  5C4J H;  5AJ3 L;  3AFP A;  3CPW A;  2R7Z G;  1WJJ A;  4DUZ L;  4B3R Q;  1VQI A;  2MO1 A;  1VQA A;  1B70 B;  4Y7N H;  4BY7 G;  4GKJ L;  5IP7 G;  1QUQ B;  4OXP A;  2B3G A;  1CSQ A;  1KXL A;  3HKZ G;  4KHZ A;  4DV2 Q;  1CUK A;  2KHI A;  4LF4 L;  4A3I G;  2UXB Q;  1I5F A;  4X62 L;  1YJ9 A;  4A3D G;  3HOV H;  4EX5 A;  1L1O C;  3CC7 A;  4GOP A;  2NVX H;  4WJ3 M;  4GLV B;  4R4T A;  5IYB H;  4JI6 Q;  2R6G A;  3GTQ H;  1AE2 A;  4A3G H;  4GN3 B;  4OON A;  1N36 L;  1Z9F A;  3CCJ A;  4JCV E;  4JYA Q;  4AH6 A;  1VQE A;  3AEV A;  4MNO A;  1H95 A;  4FDB A;  3UDX A;  1VQP A;  3GTO H;  4YWM A;  2HQL A;  4P73 A;  4IFD J;  3T1H Q;  4A93 G;  4GS3 A;  1K3R A;  2A1A A;  4JBM A;  1IBM Q;  1UE5 A;  4JI2 Q;  2K4K A;  5GAE C;  1NJI C;  1YNX A;  2D0O A;  1PYB A;  3J81 c;  2AMC B;  3RR5 A;  1PH7 A;  3S1N H;  1BBW A;  1UE6 A;  1YEZ A;  2D0P A;  1WYD A;  2EQS A;  1UE7 A;  1EWI A;  3ER0 A;  2JA8 G;  2A8V A;  4DV4 Q;  1IBL L;  1WFQ A;  4WJ4 A;  2ZTD A;  1V43 A;  4TVA B;  5FJ8 H;  4OWW B;  4JI1 L;  3H0G H;  4C3I H;  1PHJ A;  2WAQ G;  1HNW Q;  4DR4 Q;  4P75 A;  3J7Z C;  2AWN A;  2VW9 A;  5M5X H;  4LF9 Q;  4PMW A;  2HHH Q;  3I7F A;  2QEX A;  2HIX A;  5LMN W;  3J7A 5;  1FGU A;  3CQZ H;  2Z6K C;  1TWG H;  4YCU A;  2JA5 H;  5C0X J;  2GN5 A;  1IBK Q;  2N8N A;  2Z0S A;  2UXD Q;  2NZH A;  1YHB A;  4QIW E;  3DLL A;  3GTL H;  1CKO A;  1X6O A;  4DK6 C;  3KF6 A;  4NB3 A;  3GO5 A;  2ASB A;  1VQO A;  1K0R A;  1XMO Q;  2I5L X;  4A3L H;  4IOC A;  4JI8 Q;  4LF6 L;  3CCU A;  4A3E H;  1YJN A;  4EQ5 A;  1VS0 A;  5IY0 A;  3OTO Q;  1Y1W H;  2JEB I;  4YCW A;  1KC8 C;  3U58 A;  1SMX A;  1XJV A;  1IL2 A;  3SGI A;  1HR0 W;  4DV6 Q;  2IX1 A;  3HOX G;  2BA0 A;  1RIP A;  2AWO A;  4B3T L;  3CCQ A;  2UUA L;  3RLO A;  4X65 L;  3UE0 A;  2R7F A;  3FKI H;  4DKA C;  1L1O B;  1A62 A;  1KHI A;  1SE8 A;  2PNH A;  4OWT B;  1SR3 A;  2QA4 A;  1N34 Q;  1KD1 C;  3G4S A;  3KLW A;  4MZ9 A;  3I2Z A;  3T1Y L;  3HOY G;  3F2D A;  2ALY B;  5C44 H;  2RHS B;  4GNX A;  2OQ0 A;  1Y14 B;  3H3V H;  4DR5 L;  3J80 i;  3W5O A;  4HJ9 A;  1HZA A;  5BR8 L;  2RCN A;  5AJ3 Q;  2Q2H A;  4ALP A;  4BBS G;  4A3C H;  1GKH A;  3U50 C;  4DUZ Q;  2AKW B;  4JI7 L;  4JV5 L;  1PV4 A;  3H3V I;  1V1Q A;  1VQ8 A;  3PUW A;  4DV7 L;  4A75 A;  1B7Y B;  1M90 C;  3HKZ E;  5IP9 G;  3S24 A;  2ATW A;  2IHE A;  3A74 A;  3G6E A;  4LF4 Q;  4X62 Q;  1X56 A;  4PG3 A;  1HNX L;  4UY8 C;  2I5H A;  3BJU A;  2KBN A;  2F52 A;  1W3S A;  4GLA C;  1K83 H;  4LFB L;  1NE3 A;  1U0L A;  1E24 A;  3RLN A;  1PH2 A;  1N36 Q;  2MFI A;  3PCO B;  4A3J G;  2HT1 A;  1Q1E A;  2RHQ B;  4BXX G;  4C2M H;  1OXS C;  3CCE A;  3FP9 A;  5IWA Q;  3RN5 A;  3PO3 G;  1E3P A;  2B29 A;  1W2B A;  4TQU S;  3I4O A;  5FLM H;  1ASZ A;  3DM3 A;  3M9B A;  1NTG A;  2ES2 A;  5LMN Q;  2ZTC A;  3M85 A;  5H1S E;  1QVF A;  3PO2 H;  1YZ6 A;  1TWA H;  3TRZ A;  1IBL Q;  4DR1 Q;  1YVC A;  1G51 A;  4YWK A;  1CKN B;  3JC6 6;  4JI1 Q;  3G71 A;  1YJW A;  2BH2 A;  1LM0 A;  1VQJ A;  2LSS A;  4IFD I;  2WAQ E;  4APV A;  4C3H H;  2F3I A;  1XTD A;  3S1R H;  4JI4 L;  1R9T H;  1XMQ L;  3UDF A;  3E9H A;  4P74 A;  5M3F H;  2E2H H;  1G29 1;  3K81 C;  2ZJQ A;  2IT1 A;  1PVO A;  1VQ6 A;  3KFU A;  4DV1 L;  4R4C A;  5IYC H;  1YIJ A;  1NMG A;  4AQY Q;  1VQF A;  4OX9 L;  4DR7 L;  4YY3 L;  2JQO A;  1AE3 A;  4X66 L;  1P8L A;  1Q1B A;  3UDG A;  4LF7 L;  1NMF A;  1GVP A;  1QVG A;  3PF5 A;  4LF6 Q;  4UP9 A;  4YCV A;  2ZM6 Q;  5C0X I;  5E7N A;  2V1C C;  1KIX A;  2FXQ A;  3K7U C;  1VQM A;  1WCM H;  1MJE A;  5JEA J;  4JI3 Q;  2JA6 H;  3HOZ H;  1QVC A;  3M3Y H;  2JA9 A;  4B3T Q;  1X65 A;  1E22 A;  2CFM A;  4LFA L;  4JI5 L;  1OXX K;  5IYD G;  4QGU A;  3TS0 A;  4X65 Q;  2UUA Q;  4NXM L;  2R92 G;  1SRO A;  3PF4 A;  1X54 A;  2NVT H;  1E7Z A;  2Q2I A;  1TXY A;  1VQL A;  2IHF A;  4DV5 L;  4GN5 A;  1V9P A;  4H02 A;  3U4Z A;  4LUO A;  3CXC A;  1KQS A;  1VQK A;  3CD6 A;  2OTL A;  2NZO A;  1S72 A;  1NBW A;  3ULJ A;  4DR6 L;  3F1Z A;  1PH9 A;  2RF4 A;  5M3M H;  1X9N A;  1JJ2 A;  4HJ8 A;  2K5H A;  5C3E G;  4DR5 Q;  3GTK H;  1C9O A;  1HZC A;  4OWX B;  2PQA A;  2K14 A;  3CMA A;  4BA1 I;  4JI7 Q;  4IPD A;  4LF5 L;  4JV5 Q;  4QQB X;  5HY6 A;  4QY7 A;  1AH9 A;  2VNU D;  1L0W A;  4DV7 Q;  1Y1W G;  4YHH L;  2R7Z H;  4GKK Q;  1YI2 A;  4BBR G;  1A63 A;  1JJC B;  4BY7 H;  3K8A A;  4X64 Q;  3JAM i;  4PZ8 A;  3AYH B;  1QZH A;  2KCM A;  3CW2 C;  1HNX Q;  4Y52 H;  3JAM c;  2B63 G;  3GTM H;  2KEN A;  2ZTE A;  5GAD C;  4A3I H;  2NVY H;  1VQ7 A;  4A3F G;  4LFB Q;  2IX0 A;  4A3D H;  4K0K L;  3FKI G;  3I56 A;  2GVA A;  3PUZ A;  3TQY A;  1EQQ A;  3GTP H;  4LFC Q;  3ULL A;  3H15 A;  3I4N G;  2VS1 A;  1VCI A;  4BA2 I;  4J15 A;  4HJ5 A;  4L5T A;  3GTJ H;  3KDF B;  4DR3 L;  3S15 H;  1XPU A;  1I94 L;  2YYZ A;  3RN2 A;  5EAY A;  4A93 H;  4KHP L;  2WP8 J;  4AYB G;  2WB1 G;  4RG1 A;  4POG A;  1QUQ A;  1I6H H;  2OWO A;  1JB7 A;  3CCR A;  2N49 A;  1VQH A;  3E0E A;  4BY1 G;  4PZ7 A;  1I3Q H;  4B3M Q;  2BA1 A;  1YHA A;  2H5X A;  3AQQ A;  1A0I A;  1K9M C;  1EFW A;  2R93 G;  1CSP A;  3MEF A;  4JI4 Q;  3UDI A;  1JJG A;  3I4M G;  4HJA A;  1XMQ Q;  5JJK A;  3STB C;  2L15 A;  4LF8 L;  4GN4 B;  4JOI A;  4XIG S;  4A3M H;  2F4V L;  3OYY A;  4A3B G;  3G48 A;  4DV1 Q;  2IY5 B;  1JMC A;  3J80 c;  4OO1 I;  1FVI A;  4GKJ Q;  2VUM G;  4B3S L;  1XNQ L;  5M5W H;  2HIV A;  4DR7 Q;  4LNQ A;  3W1B A;  2CWP A;  4X66 Q;  4LF7 Q;  3NEM A;  3PIO A;  3F2B A;  1X3F A;  2KHJ A;  3KJO A;  2OCE A;  2E5L L;  5C4X G;  4DV0 L;  4IJH A;  1PH1 A;  3CP0 A;  2JA7 H;  4IFD G;  3T1H L;  2UU9 L;  3TRE A;  1Q81 C;  1IBM L;  3M4P A;  4LFA Q;  3OW2 A;  1IZ6 A;  4R1J A;  4IPG A;  4JI5 Q;  2UXC L;  3A5U A;  2CCZ A;  1Y1V G;  3EBE A;  4DV4 L;  1J6Q A;  3A5Z B;  2UUB L;  4JI0 L;  2YU9 H;  2R7D A;  3CCL A;  4IO9 A;  3IRB A;  2N78 A;  1I50 H;  1OXV A;  2I0Q A;  4L5S A;  1C0A A;  4DAY B;  4JBJ A;  2K5N A;  4GNX C;  4A3K G;  4LF9 L;  4DR4 L;  1D7Q A;  4DV3 L;  2VQE L;  4DR6 Q;  3RNU A;  1XPR A;  1HNW L;  2A19 A;  5IYC G;  5J3B A;  3CC4 A;  1HNZ L;  1PH6 A;  1FL0 A;  1N8R C;  5C0X G;  1VQ4 A;  1IBK L;  2LXJ A;  1GD7 A;  1D8L A;  3NEN A;  1RL2 A;  3KDF A;  1VQD A;  1LTL A;  1K8G A;  2NN6 I;  4BBS H;  3W1G A;  4HIO A;  3NBH B;  3HOW H;  3HOV G;  1N32 L;  3PUV A;  4JI8 L;  1KRS A;  4JC0 A;  5IYB G;  1FJG L;  1BVS A;  1EIY B;  5IP9 H;  3ERS X;  4A3G G;  1YBY A;  1S40 A;  1N33 L;  1Q46 A;  5FLX c;  3HOU H;  1KAW A;  1L1O A;  3ZJY C;  3HFZ B;  3ICE A;  4K0K Q;  4AIM A;  3PUX A;  1IYJ B;  2AHO B;  1OXU A;  4NXN L;  2YTV A;  1N9W A;  3BZC A;  1SFO H;  2ID0 A;  1N32 Q;  1X3G A;  3B6Y A;  4DK3 C;  1YHQ A;  1PH8 A;  3AFQ A;  2MO0 A;  4DR2 L;  4DR3 Q;  4KLK A;  1N34 L;  3NEL A;  1EIF A;  3S17 H;  1MJC A;  4P72 A;  2OQK A;  4BXX H;  5LMU L;  4HIK A;  1PA6 A;  1O7I A;  5JJL A;  1GM5 A;  1HZ9 A;  2NVQ H;  3M7N A;  3BU2 A;  3K0X A;  4DAM A;  4DUY L;  1KL9 A;  4AYB E;  2WB1 E;  2YV5 A;  4O0A A;  5FJ8 G;  3CC2 A;  4KHP Q;  3H0G G;  2JEA I;  4MTN A;  4JBW A;  5M5Y H;  3L0O A;  3F2C A;  2K5V A;  3EIV A;  3T1Y Q;  1PYS B;  2JA5 G;  3KJP A;  1L2F A;  3J81 j;  4LF8 Q;  2MQH A;  3MXN B;  2YTY A;  1OXT A;  2F4V Q;  1B8A A;  2N3S A;  2CQO A;  2Z6K A;  5BR8 Q;  2ZJP A;  4R4Q A;  1UEB A;  1A8V A;  3STB D;  4GNX B;  2UUC L;  2Y0S E;  1LUZ A;  1JE5 A;  1HZB A;  2DUD A;  4UP8 A;  1MKH A;  3CF5 A;  4B3S Q;  1XNQ Q;  4A3E G;  2JE6 I;  4A3L G; 
#chains in the Genus database with same CATH topology
 1SLJ A;  2VQF L;  1MSH A;  1J5E L;  2SNM A;  1VQN A;  4GOP C;  4YWL A;  1TS3 A;  1P16 A;  5EQ0 A;  2B2T C;  4XDX A;  5IIF A;  4UP7 A;  1V8Q A;  5HGT A;  4UPA A;  2B8F A;  2EVB A;  1Q82 C;  1K28 A;  3M4Q A;  2UUB Q;  4JI0 Q;  1PRT D;  5C44 G;  1PFS A;  1K73 C;  1TWC H;  4UHV A;  3PUY A;  3PV0 A;  4A3C G;  2ZXO A;  4L6T B;  4RMF A;  3Q8D A;  4KTA A;  3GTG H;  1Q7Y C;  3M4O H;  4JPB W;  1ICW A;  3D31 A;  1CTM A;  4OL7 A;  1BDO A;  2XGT A;  4DV2 L;  1BBU A;  3K80 C;  2CKZ B;  2L1B A;  3RZO H;  1IKL A;  1DXM A;  1ASY A;  4OX9 Q;  3KF8 B;  4ME3 A;  2HCC A;  5C4Z A;  1MIU A;  1BBX C;  1HHV A;  1TS5 A;  3MC0 B;  3GD7 A;  4JYA L;  1G91 A;  1QZG A;  3VA5 A;  5FLM G;  3TEH B;  4R4I A;  2FMC A;  1X3E A;  1UWV A;  1GO3 E;  4BBS B;  3Q6S A;  1VQB A;  3CPF A;  3SK5 A;  3HOW B;  1HQM C;  4HID A;  2D2C C;  1BKB A;  4ILW A;  1EU4 A;  4IAL A;  2R93 H;  1KLU D;  4A4I A;  2KCN A;  4IN3 A;  5EPK A;  4C3J H;  2O4X A;  4QIW B;  3VR3 A;  2KVM A;  4H0L C;  2UUC Q;  5GAG C;  5IGD A;  2EYM A;  1EYG A;  2NVQ B;  2PI2 E;  2VUM H;  4ZUI A;  2PQA B;  3A7L A;  4CJ1 B;  2DNE A;  3OTO L;  2O5J C;  1U4L A;  2PPB C;  5IE8 A;  2EY2 A;  1EL0 A;  4DNI A;  1DGS A;  1KRT A;  3L7Z C;  1B1Z A;  1EFI D;  2QF7 A;  1U5K A;  1QE6 A;  2VB3 X;  2F0T A;  1NNX A;  2FJ2 A;  1Y1V H;  3KF6 B;  4POF A;  3C46 A;  3K5N A;  1QWY A;  1I4P A;  2ICI A;  3KF8 A;  2MNA A;  3C3L A;  3J81 E;  3AMU A;  3ITP A;  1HR0 Q;  4LWC A;  1MGS A;  3AFP A;  4DUZ L;  3BDO A;  2MO1 A;  4BY7 G;  2F0Q A;  4OXP A;  2B3G A;  1CSQ A;  4DGZ A;  1GHK A;  1A2T A;  4KHZ A;  2KHI A;  2DY7 A;  4A3I G;  1YJ9 A;  4Q5V A;  4EX5 A;  5IOD A;  3RUZ A;  1CT1 D;  4WJ3 M;  5IYB H;  4R4T A;  3GTQ H;  4A3G H;  4OON A;  1BR9 A;  1TWC B;  2CW0 C;  2XWB B;  1IL8 A;  3FDT A;  3BG3 A;  5FO9 B;  3TBI B;  4FXD A;  3T1H Q;  3VYU A;  3GTG B;  4GS3 A;  3VR4 A;  4JI2 Q;  3K6O A;  1C8C A;  3LWU A;  1U4M A;  3M4O B;  1XWE A;  3J81 c;  2D0P A;  2EQS A;  3MVV A;  3QG1 A;  2JA8 G;  1WFQ A;  3NBH A;  3M4Y A;  3MXG A;  5FJ8 H;  2EYP A;  3NPP A;  3RZO B;  1SYC A;  1PHJ A;  4DR4 Q;  4ZQ3 A;  4B9W A;  4LF9 Q;  3HP3 A;  2K5W A;  1RDP D;  5JPN C;  5LMN W;  3J7A 5;  3CQZ H;  2AQ3 B;  1AFP A;  4FVM A;  1IW7 C;  4HN7 A;  4TKO B;  3GTL H;  3KF6 A;  5KNC A;  1EQT A;  4QF4 A;  4OHJ A;  2EY6 A;  1M4V A;  2RVL A;  4A3L H;  2FMM A;  1N32 Q;  4IOC A;  3NXW A;  1H9S B;  2MGS A;  4YCW A;  1SMX A;  4DAP A;  2PO4 A;  3HOX G;  2BA0 A;  1NUC A;  3CCQ A;  4K5W A;  1SE3 A;  2C5C A;  3FPP A;  4HED A;  2R93 B;  1PDQ A;  3SK8 A;  1KD1 C;  4C3J B;  3G4S A;  4MZ9 A;  4K6D A;  2K1B A;  4OO1 H;  1B4O A;  2OQ0 A;  1Y14 B;  1HCZ A;  1STE A;  3BYT B;  3J80 i;  1SYB A;  2JSO A;  1SYE A;  2VUM B;  3PQI A;  1L0X B;  2Q2H A;  1E2W A;  1KAA A;  2KA7 A;  3HRZ C;  3U50 C;  4ALP A;  2AKW B;  2RSN A;  1JWS D;  4BBS G;  1D1I A;  4LJZ C;  3PUW A;  4DV7 L;  1OO9 B;  1B2T A;  2PW7 A;  4EQN A;  3A74 A;  1LT3 D;  4UY8 C;  1EIG A;  2KBN A;  1UUP A;  4GLA C;  1K83 H;  1Y1V B;  5CC4 A;  4DXF A;  1U0L A;  2MJ8 A;  4IUP A;  4H7B A;  1N36 Q;  3PCO B;  4A3J G;  1ILQ A;  2JXM B;  2RHQ B;  4BXX G;  4C2M H;  1OXS C;  2L5T A;  3FP9 A;  3RN5 A;  1Q8I A;  1ASZ A;  1NTG A;  1CZW A;  5G3L F;  2ZTC A;  3UI2 A;  4WFN 3;  1KTK A;  4ZCK A;  1PXU A;  1IBL Q;  4RCN A;  1YVC A;  3NQI A;  3SVM A;  4YWK A;  3JC6 6;  4KJN A;  4CDD C;  1PZJ D;  4IFD I;  2OT2 A;  3SEB A;  2BDO A;  4CDC C;  1R9T H;  4P74 A;  5M3F H;  3GTQ B;  4A3G B;  1G29 1;  2ZJQ A;  2IT1 A;  1D5Z C;  2NUC A;  5IYC H;  1NMG A;  2Z8L A;  4YY3 L;  2JQO A;  4X66 L;  3UDG A;  5C6A A;  2FIN B;  3NTI A;  5KRU A;  1GVP A;  1SE2 A;  1UEA B;  2F0F A;  3PF5 A;  4LF6 Q;  5BN5 A;  1KIX A;  5C0X I;  1TY0 A;  2V1C C;  3DHQ A;  3K59 A;  1WCM H;  1MJE A;  2F03 A;  3WOF A;  5D3D A;  1Y69 U;  1D5M C;  2B2T A;  2CFM A;  4LFA L;  3TS0 A;  4NXM L;  1NAP A;  1Q3L A;  1RTN A;  3PF4 A;  1RCV D;  2HQE A;  3VYR A;  3S14 B;  1FYC A;  2MP1 A;  2NVT H;  3V2T A;  2Q2I A;  1ROD A;  1JOK A;  1TXY A;  3CQZ B;  1ONL A;  4DV5 L;  1TQO A;  2TSS A;  3BDL A;  5J39 A;  1S72 A;  4OEM B;  5CV4 A;  1SMY D;  3GTL B;  2A6E C;  1LTG D;  2N88 A;  4HJ8 A;  4QQB X;  3TZU A;  4LF5 L;  5HY6 A;  2PZW A;  1TVX A;  1YNJ D;  1HXY D;  4PZ8 A;  3AYH B;  2KEN A;  4LFB Q;  1JQY D;  3I56 A;  2B2Y C;  2GVA A;  3HEJ A;  3I4N B;  1EQQ A;  3ULL A;  2O2L D;  1VCI A;  4JVZ A;  1SDF A;  1EY8 A;  2F0O A;  4NMZ A;  4KHP L;  2WP8 J;  1B3A A;  4AYB G;  2ICE C;  4POG A;  1EQV A;  1MSG A;  2SNS A;  3BYY B;  3CCR A;  1F2Z A;  4PZ7 A;  1I3Q H;  3AQQ A;  1EFW A;  4FYD A;  2R93 G;  5ISR A;  3MEF A;  4JI4 Q;  2J0T D;  3T51 B;  3A55 A;  4C3J G;  4HJA A;  1XMQ Q;  1K83 B;  3NWT A;  4J6H A;  2IL8 A;  1PLF A;  2M2L A;  2F4V L;  3OYY A;  1BUV T;  2A69 C;  4C2M B;  1DM0 B;  1XXG A;  2P5Z X;  4N9T A;  2VUM G;  1XNQ L;  2WIN B;  4LNQ A;  2K03 A;  3W1B A;  2JN4 A;  4LF7 Q;  1AW7 A;  3T56 B;  5KND A;  4IJH A;  2A5H A;  3TRE A;  1DZ1 A;  1WD0 A;  2E76 C;  5CR3 A;  3M4P A;  3KK7 A;  5CYU A;  1PRT C;  2I07 B;  1STA A;  3A5U A;  2CCZ A;  1Y1V G;  3J80 L;  1R9T B;  2UUB L;  4JI0 L;  5M3F B;  2YU9 H;  4NKL A;  3IRB A;  1I50 H;  2I0Q A;  4GNX C;  3T53 B;  4DR6 Q;  1ML0 D;  1PH6 A;  4U67 3;  1VQ4 A;  1IBK L;  1I4G A;  2LXJ A;  4F8M A;  2KEE A;  1WCM B;  1EY6 A;  2NN6 I;  3W1G A;  3A8K E;  2AUK A;  4KKT A;  2Z4H A;  4JI8 L;  5IYB G;  4B08 A;  1PYW D;  4A3G G;  2NVT B;  1S40 A;  4RKL A;  4DA2 A;  1KAW A;  4AIM A;  1QNK A;  3HG9 A;  2AHO B;  1OXU A;  2H4O A;  1EY7 A;  2EY1 A;  2K32 A;  3BZC A;  1SSO A;  2IPK D;  1SFO H;  1X3G A;  1GUS A;  3B6Y A;  3AFQ A;  4DR3 Q;  3NHH A;  2IWH A;  1O7I A;  1H9M A;  5JJL A;  5EBC A;  3BU2 A;  3NUC A;  4H44 C;  3Q0A A;  3FEW X;  5FJ8 G;  1I6V C;  3JAM E;  2NTS A;  2KJX A;  1DCZ A;  4MTN A;  4JBW A;  3HS0 C;  2JA5 B;  2K5V A;  1WTP A;  3HKZ B;  2QCP X;  3J81 j;  1A6X A;  3MXN B;  1OXT A;  4LK1 C;  1AZP A;  2CQO A;  1C48 A;  3VYT A;  2R3Z A;  2ZJP A;  2UUC L;  4A3L G;  4UP8 A;  4B3S Q;  3CRL C;  2JE6 I;  5I4D A;  2A68 D;  4ABN A;  3FMC A;  4KJO A;  2JK8 A;  2E5L Q;  4P71 A;  2DGY A;  5IGC A;  4HIM A;  2VXW A;  4KHV A;  5KGU A;  3R2T A;  1OTC A;  4G7O C;  3PGZ A;  3CKI B;  1I3Q B;  2E2J H;  4C56 C;  4XTC S;  3P7J A;  3TS2 A;  5GAH C;  5IYD H;  2R92 H;  1CZG A;  1HTP A;  4OO1 G;  4I65 A;  2BH8 A;  4R8N A;  4A3M G;  1V1P B;  1SRU A;  4DV3 Q;  5GQO A;  2VQE Q;  3C1F A;  1E0B A;  3KOJ A;  2XVS A;  1X55 A;  1HNZ Q;  1PH5 A;  1BXT A;  1CQV A;  3F8T A;  1HR0 L;  3HKS A;  3K5M A;  3CAM A;  3OMC A;  1Q12 A;  4QMG A;  2JA8 H;  2QIL A;  4IOA A;  1FJG Q;  1O80 A;  1SNQ A;  1VQG A;  1RD9 D;  4JI3 L;  2YU9 B;  1I50 B;  2RBM A;  4YY3 Q;  1LTR D;  1PFN A;  1F2Y A;  4A3F H;  4I7A A;  3MXN A;  3CCV A;  4F88 A;  5LMU Q;  4IUR A;  2G9H D;  4JI2 L;  2AQ2 B;  1PTO H;  4DUY Q;  4NXM Q;  3HOX H;  5FLX E;  5HGQ A;  1SYD A;  1X3Q A;  2C35 B;  5IT9 E;  4G7Z C;  3I91 A;  1W6J A;  2F0E A;  3S2D H;  5I2Y A;  3GQB A;  5I6Y A;  4DV5 Q;  5BN3 A;  1PH3 A;  1VQ9 A;  5M3F G;  4O2D A;  1E1O A;  3F2U A;  4GKK L;  1HH2 P;  1LAB A;  4K5X A;  4JOI C;  3WWV A;  1PFB A;  1SYG A;  2F3W A;  1YNN D;  1AZQ A;  1TII D;  3I55 A;  1JE4 A;  2EZV A;  2EYO A;  1LTS D;  1SFO B;  4CBV A;  5DEH A;  4LF5 Q;  1LYL A;  1MHW C;  3Q24 A;  1V1P A;  4IUQ A;  3KUP A;  1S3O A;  4LW1 A;  4LFC L;  5CV6 A;  3VR2 A;  1WCM G;  4HR7 B;  5ELD A;  2VZA A;  3VDY A;  5IT9 c;  2Z9H A;  1S4Z A;  2L9H A;  1RKN A;  4IFD H;  1A2U A;  4GZY C;  1PFM A;  2GVB A;  4J8Q A;  4WJW A;  4L5R C;  4B3M L;  4L5Q A;  4A3J H;  2Q2T A;  1HJP A;  3GV6 A;  3H09 A;  1EOT A;  2XIW A;  2E74 C;  1E1T A;  2QGQ A;  3LGJ A;  2BE5 D;  2KUM A;  3CPW A;  2KED A;  4B3R Q;  1FNW A;  1VQI A;  4GKJ L;  4OGQ C;  3V05 A;  1QUQ B;  3I4L A;  3HKZ G;  5JOB A;  1SYF A;  2BDN A;  1I5F A;  4FF2 A;  1Z7T A;  2OXP A;  2R92 B;  1DON A;  4LMQ D;  1VMC A;  2HCI A;  4GN3 B;  3MEH A;  1N36 L;  1QCB D;  3CCJ A;  2B2Y A;  3QOJ A;  4JCV E;  1F9Q A;  3PIO 3;  4AH6 A;  2L55 A;  4MNO A;  3UDX A;  1DOL A;  4WRD A;  1T5X D;  4P73 A;  1K3R A;  1LTA D;  1E2Z A;  1GHJ A;  1YNX A;  2JA8 B;  1PYB A;  1PH7 A;  1BBW A;  1UE6 A;  1YEZ A;  3EA6 A;  3I73 A;  1UE7 A;  4RGT A;  2HUG A;  1IBL L;  4HAE A;  4WJ4 A;  1V43 A;  4F7X A;  3H0G H;  1WTQ A;  4XXE A;  4C3I H;  2VW9 A;  2NWG A;  2HHH Q;  1DOK A;  1WTX A;  3I7F A;  2QEX A;  3GV3 A;  3TP7 A;  4YCU A;  5I6W A;  1IBK Q;  4A3F B;  4FF3 A;  2OEO A;  1YHB A;  4QIW E;  1ZYR D;  3DLL A;  2QDB A;  4NB3 A;  2ASB A;  3TP6 A;  1XMO Q;  1PTO B;  4JI8 Q;  4LF6 L;  3CCU A;  4A3E H;  4EQ5 A;  3HOX B;  5KYL A;  1IL2 A;  3U58 A;  2EYJ A;  4DV6 Q;  4KD3 A;  1EWH A;  1RIP A;  2AWO A;  1NCV A;  4PQX A;  3UE0 A;  1EWC A;  5I9P A;  2XNA C;  1KHI A;  3DXJ C;  5CV9 A;  4OWT B;  1SR3 A;  3KLW A;  3T1Y L;  4X3K A;  2IX3 A;  2RHS B;  2EYL A;  4GNX A;  5JVH 3;  3H3V H;  4N9P A;  1D5X C;  4EQO A;  4HJ9 A;  5J22 A;  1ESF A;  2RCN A;  1GKH A;  2B2W C;  1GUG A;  1YNJ C;  1PV4 A;  1V1Q A;  1VQ8 A;  1PTO D;  1UAP A;  1ILP A;  2ATW A;  3S24 A;  3G6E A;  4CKE A;  4LF4 Q;  4X62 Q;  4HSP A;  3U9O A;  2KCC A;  1JB3 A;  3BVM A;  1C4Q A;  4RWS C;  4A3J B;  4LFB L;  1NE3 A;  1E24 A;  5JEA H;  3TDQ A;  1Q1E A;  3PO3 G;  2PZT A;  2B29 A;  2D5D A;  2RA4 A;  2OF1 A;  2Q8T A;  3M9B A;  3M85 A;  3TRZ A;  1CKN B;  2CH4 W;  1LM0 A;  2LSS A;  1E2V A;  2WAQ E;  2F3I A;  4JI4 L;  3D4D A;  1XMQ L;  3T16 A;  1PVO A;  2EDG A;  4R4C A;  1YIJ A;  5DM6 3;  2NYZ D;  4X3T A;  1WTR A;  1VQF A;  3ERO A;  1AE3 A;  4LF7 L;  1QVG A;  4XT3 B;  3P20 A;  3VR6 A;  4UP9 A;  4YCV A;  1X3P A;  5E7N A;  1QIL A;  2LS0 1;  3K7U C;  1VQM A;  4JI3 Q;  2JA6 H;  2JA9 A;  3H0G B;  4B3T Q;  4C1N I;  3NK9 A;  4C3I B;  5IYD G;  1OXX K;  4QGU A;  2UUA Q;  2R92 G;  4X65 Q;  3DWQ A;  1F2M A;  1J9O A;  4K5V A;  3KBG A;  2K5Q A;  1V9P A;  4H02 A;  3CXC A;  3CD6 A;  4O1N A;  4O42 A;  2OTL A;  3QB3 A;  1F9P A;  1EU3 A;  4DR6 L;  3F1Z A;  4LAA A;  1PH9 A;  2RF4 A;  3LNN A;  5M3M H;  5NUC A;  3S9W A;  1G2S A;  1C9O A;  2PQA A;  4A3E B;  4R9W A;  3DMU A;  4IPD A;  1SNP A;  1AH9 A;  2VNU D;  2L0C A;  3T4A C;  1Y1W G;  4YHH L;  3C1E A;  4GKK Q;  2EOT A;  3D4W A;  1JJC B;  4ZKB B;  2ZXP A;  1K8M A;  4CDF C;  4ZK9 B;  1HUN A;  4IUT A;  1O7Y A;  2DNC A;  1QZH A;  2MPM A;  1HNX Q;  4DK0 A;  3NBI A;  3GTM H;  4Y52 H;  4RA8 A;  3MTS A;  5EKL A;  4J1M A;  4A3F G;  4A3D H;  1CM9 A;  3TQY A;  3GTP H;  4LFC Q;  4K14 A;  4HJ5 A;  2A6H D;  2XRS D;  4DR3 L;  4QCL A;  3S15 H;  1SNM A;  1HTL D;  1I94 L;  2YYZ A;  2IJ0 A;  4AYB B;  1JOR A;  3RN2 A;  5EAY A;  4A93 H;  1JWU D;  4RG1 A;  3MAQ A;  1I6H H;  1JB7 A;  1KAB A;  1EY9 A;  1LTI D;  5CV5 A;  1VQH A;  4B3M Q;  1EYD A;  2X6G A;  4ZYS A;  1CSP A;  1R4P B;  3UDI A;  1A3T A;  4GN4 B;  4JOI A;  4A3M H;  3N6R A;  2A68 C;  1GJX A;  2Y0S B;  4DV1 Q;  2IY5 B;  1A3U A;  4GKJ Q;  3KBX A;  4BWG B;  4B3S L;  3D4R A;  2HIV A;  1G8Z D;  4DR7 Q;  1HRJ A;  2CWP A;  5C4H A;  3NEM A;  5CBA E;  2E5L L;  3CP0 A;  4DFA A;  4IFD G;  2A73 B;  4RHS A;  1U4P A;  4RKB A;  3OW2 A;  4JI5 Q;  1TU2 B;  3QJY A;  3RD4 A;  3EBE A;  3A5Z B;  4IZ8 A;  2R7D A;  1KDA A;  3CCL A;  2J7Z A;  2N78 A;  4L5S A;  2F0V A;  4JBJ A;  2K5N A;  4DAY B;  5CV8 A;  1D7Q A;  4DV3 L;  2VQE L;  1XPR A;  5J3B A;  1HNZ L;  5C0X G;  1ICF B;  2EJG C;  1D8L A;  1H9S A;  2N55 A;  1RL2 A;  4DAV A;  1VF7 A;  2KEC A;  1TT2 A;  2M9V A;  3M7G A;  4DF7 A;  2JA6 B;  3E3X A;  3L9A X;  4QUF A;  1QOH A;  3PUV A;  3G7L A;  1AP0 A;  1FJG L;  3IFT A;  5IP9 H;  3R93 A;  3ZJY C;  4K0K Q;  3ICE A;  1CHP D;  3PUX A;  1IYJ B;  4V19 0;  5D3I B;  2YTV A;  1TR5 A;  4DK3 C;  2MO0 A;  5M3M B;  4R8I A;  1EIF A;  3S17 H;  4M8A A;  5CGK A;  5LMU L;  2F0P A;  1GM5 A;  1HZ9 A;  3M7N A;  3K0X A;  5DNF A;  1DYQ A;  1KL9 A;  4DUY L;  2WB1 E;  4O0A A;  3H0G G;  1SNC A;  3K57 A;  3CU7 A;  3QWN A;  4C3I G;  2EE1 A;  1SXT A;  1EIH A;  1LO5 D;  1YNN C;  3T1Y Q;  3GTM B;  2G5D A;  1L2F A;  4LF8 Q;  4MN3 A;  1U9R A;  2PCF B;  5JAV A;  1B8A A;  2E2D C;  2N3S A;  3GTP B;  3K0Y A;  3MXP A;  3STB D;  3S15 B;  5A35 A;  3CF5 A;  1F9R A;  1TY2 A;  1WTH A;  4A3E G;  1ET6 A;  4FP5 D;  2DJF C;  3J7Y W;  4A93 B;  4X6A H;  4DV0 Q;  5IWA L;  1I6H B;  5E1F A;  2E75 C;  2EXD A;  3J81 i;  2UU9 Q;  3W3A A;  4V0B A;  5CV7 A;  2UXC Q;  2WFW A;  4L8J A;  1KDB A;  1I4H A;  2QDL A;  3RLF A;  4JBK A;  3KLS A;  2EJM A;  5IGG A;  4GLX A;  4A3M B;  2E2I H;  1PH4 A;  1S5D D;  1T5E A;  1JWM D;  4FXG C;  4KY7 A;  2BE5 C;  1EY5 A;  1YIT A;  1UE1 A;  4HJ7 A;  2K50 A;  1HNW Q;  1HFN A;  3K5O A;  4NDX A;  3OIQ A;  2F0J A;  3HZX A;  2EIF A;  5JJI A;  4B3R L;  5C3E H;  2B2W A;  5C5M A;  4AQY L;  5IOC A;  2NTT A;  4RGN A;  1XPO A;  2JA7 G;  5ELO A;  3ULP A;  4KN4 C;  2ZM6 L;  2D62 A;  5ELN A;  2K75 A;  1N33 Q;  5JEA G;  3MHB A;  2XSC A;  2Y0S G;  1Q8K A;  2K52 A;  2HD3 A;  2ZXR A;  3OSO A;  5F2D A;  2SEB D;  5I9O A;  4NXN Q;  1SEB D;  3BZK A;  2CWA A;  1SJH D;  3FHW A;  1EQR A;  1RHP A;  1TKW B;  2XTI A;  1WOC A;  1WI5 A;  1EOV A;  5GRO A;  2NN6 G;  2ZJR A;  3TP5 A;  4N8X 1;  3O13 A;  1CK1 A;  1TWH H;  2E8G A;  3IAY A;  2F0H A;  5T1I A;  4FXK C;  2PMZ E;  5EJW A;  4BY1 H;  2HHH L;  4DNR B;  1JOO A;  1JT8 A;  1ZYR C;  4LUZ A;  5KYI A;  2RDH A;  3HOU G;  2B2V C;  4A3B H;  2PW5 A;  2JJQ A;  3A8J E;  3S17 B;  1EUJ A;  4YHH Q;  1XNR Q;  1SE4 A;  1XMO L;  3QO2 A;  3RZD H;  4QL5 A;  4FF1 A;  2JA6 G;  4IPH A;  1G6P A;  4R4O A;  4DV6 L;  1IXR A;  5C4X H;  3S2H H;  4IJL A;  2F0N A;  1VQ5 A;  3VYS A;  1LV9 A;  3X3M A;  3TZD A;  4NPS A;  5M9O A;  1TWF H;  3U4V A;  3SDZ A;  2WII B;  1I94 Q;  1CA6 A;  2LKV A;  5M3M G;  2X6L A;  4A76 A;  1GUW A;  3PO3 H;  3A8I E;  3PIP A;  3H94 A;  3UE1 A;  1K8A C;  1PTO C;  2KCT A;  4FF4 A;  5C4J H;  1HA5 A;  3BS1 A;  5IP7 G;  4ID6 A;  3I3C A;  1CUK A;  2L11 A;  4LF4 L;  2UXB Q;  4X62 L;  4A3D G;  2LMC B;  2F0I A;  2NVX H;  2Q8I B;  3TSS A;  2E2I B;  3NP8 A;  4JI6 Q;  1AE2 A;  3DWA A;  3J7A F;  1Z9F A;  1JOQ A;  3CRK C;  3AEV A;  1VQP A;  5ELB A;  4A93 G;  1A15 A;  2A1A A;  4KKU A;  1NJI C;  1QNU A;  2K4K A;  5D14 A;  2D0O A;  3EVQ A;  5C3E B;  3RR5 A;  4CKB A;  1S5C D;  1WYD A;  2B2U C;  1ENF A;  2A8V A;  3KLS X;  3K58 A;  2CH4 A;  5ELC A;  2ZTD A;  1XYI A;  4TVA B;  2IW3 A;  2SDF A;  1STG A;  2A74 C;  4P75 A;  2AWN A;  5M5X H;  2K33 A;  4ZKC B;  1B50 A;  1TWG H;  1DD2 A;  2N8N A;  4KY6 A;  2UXD Q;  2NZH A;  4K8I A;  5C3W A;  3J81 L;  1F77 A;  2EY5 A;  3GO5 A;  3I90 A;  1VQO A;  1K0R A;  4HMI A;  1YJN A;  5IY0 A;  3OWF A;  1B9N A;  5FKA C;  1TWH B;  1Y1W H;  3OMG A;  1HR0 W;  1EY0 A;  2TMP A;  5BN4 A;  1IYU A;  3WOE A;  4B3T L;  2UUA L;  3DEP A;  3RLO A;  4X65 L;  4BY1 B;  1KNA A;  2F0K A;  2R7F A;  2Z1C A;  1W6K A;  1VMP A;  3P75 A;  4DKA C;  1L1O B;  1A62 A;  3HOY G;  4A3B B;  1ENC A;  2XWJ B;  1O7L A;  4XYQ A;  3W5O A;  2F0D A;  1JC7 A;  1HZA A;  5AJ3 Q;  3RZD B;  2EYH A;  4IUV A;  3E0J A;  5AFW A;  4A75 A;  1M90 C;  1STH A;  5C4X B;  5IP9 G;  3S2H B;  2EXZ A;  4DXG A;  1X56 A;  1HNX L;  1IKM A;  2R61 A;  4TSS A;  1TWF B;  1W3S A;  2A6H C;  4Q0F A;  2L4N A;  3RLN A;  1PZK D;  2K04 A;  4KN7 C;  2KHS A;  3T13 A;  1WTV A;  3PO3 B;  1EYA A;  3CCE A;  5IWA Q;  3SR1 A;  2D9U A;  5K36 H;  3I4O A;  5C4J B;  3DM3 A;  4KK7 A;  1BCP D;  5H1S E;  3PO2 H;  1YZ6 A;  1G51 A;  3G71 A;  3NTK A;  4JI1 Q;  2ZT9 C;  1YJW A;  5KNB A;  3VA7 A;  4APV A;  4C3H H;  4CHT B;  2HDM A;  1VDZ A;  3S1R H;  3UDF A;  5IGB A;  2F0U A;  4K2L A;  3H3V C;  4KD4 A;  1VQ6 A;  2H1E A;  3KFU A;  4DV1 L;  1GUN A;  3NSW A;  3URY A;  1RF2 D;  5C0X H;  4AQY Q;  4DR7 L;  1EZ6 A;  2AUJ D;  5LL6 S;  1P8L A;  2LY7 A;  3BVG A;  1NMF A;  2E2J B;  3ONA B;  2ZM6 Q;  1LT4 D;  2FXQ A;  2M00 A;  1BQQ T;  3KLR A;  3HOZ H;  1QVC A;  4JI5 L;  1SRO A;  5M5X B;  4JK1 C;  5DM7 3;  4UAI A;  2KOL A;  3K5L A;  1GUT A;  5K5P A;  1TWG B;  1VQL A;  2IHF A;  1VF5 C;  3U4Z A;  4LUO A;  1VQK A;  1KQS A;  3ULJ A;  5LHY 1;  1B53 A;  1JJ2 A;  4DR5 Q;  2K5H A;  3ND9 A;  5C3E G;  3GTK H;  1STB A;  1HZC A;  2MHV A;  1LAC A;  4HSV A;  1CHQ D;  3AU7 A;  2I46 A;  2Z4I A;  4BA1 I;  1Y1W B;  4JI7 Q;  4JV5 Q;  3QR8 A;  1SAP A;  2A69 D;  3OHX C;  2R7Z H;  1YI2 A;  2XRQ D;  5FK9 C;  1H9R A;  3JAM i;  5FOB B;  4XQJ A;  2KCM A;  3CW2 C;  1F9S A;  4HCS A;  2ZTE A;  5JVG 3;  5GAD C;  2F3V A;  1Q90 A;  2NVY H;  1VQ7 A;  4K0K L;  2EJF C;  2IX0 A;  3MXU A;  1S5B D;  3FKI G;  3DM1 A;  3J80 E;  1PTO F;  3EQL C;  3H15 A;  2MUY A;  4BA2 I;  4J15 A;  3OW7 A;  3I8Z A;  3MZ5 A;  1XPU A;  3DEO A;  1FGB D;  3S2D B;  3GP7 A;  2F0M A;  1QUQ A;  1GOZ A;  2N49 A;  4OIJ A;  1RJT A;  4L63 B;  4BY1 G;  1SMY C;  3LWE A;  1K9M C;  1A0I A;  1LT6 D;  1HA6 A;  4EVO A;  1EYC A;  2RSO A;  3STB C;  2L15 A;  2GA4 B;  3I70 A;  4H13 C;  4XIG S;  4LF8 L;  4A3B G;  3MWY W;  3G48 A;  2K28 A;  1JMC A;  3J80 c;  2B2V A;  5FO7 B;  5M5W H;  5EGT A;  3V96 A;  3D8G A;  4G57 A;  3F2B A;  5C4X G;  4DV0 L;  4C1N K;  3PO2 B;  1PH1 A;  2JA7 H;  5ELF A;  1I4Q A;  2UU9 L;  3MFY A;  1Q81 C;  2F0L A;  1IBM L;  4RH6 A;  4U68 A;  4R1J A;  3IKJ A;  4IPG A;  4C3H B;  2UXC L;  3S1R B;  4QUC A;  4DV4 L;  1J6Q A;  3EFX D;  1C0A A;  4ODG A;  1H9J A;  1WTW A;  1HNW L;  2A19 A;  3CC4 A;  4N8F A;  2NN6 H;  1N8R C;  1EEF D;  1LT5 D;  1DOM A;  4I7Z C;  5I2X A;  3NEN A;  5ELE A;  1LTL A;  3RMH A;  1K8G A;  4HIO A;  1NSN S;  3HOZ B;  5COY A;  3NBH B;  1IYV A;  2V4D A;  3WDN A;  1BVS A;  1EIY B;  1R4Q B;  2QW7 A;  3ERS X;  1YBY A;  3MA2 B;  1N33 L;  2WAC A;  3HOU H;  2K5D A;  4XQQ A;  2CVR A;  4NXN L;  3MFG A;  3LX0 A;  1PH8 A;  3J7A V;  1N34 L;  3NEL A;  3GTK B;  1DJR D;  1MJC A;  2OQK A;  1PA6 A;  2RDG A;  2RDF A;  4HCE A;  4DAM A;  3CC2 A;  4AYB E;  2R7Z B;  2JEA I;  2B2U A;  3BVZ A;  5M5Y H;  5E3F A;  3P1H A;  3F2C A;  3EIV A;  1G6Z A;  1LLR D;  1Z6H A;  3A54 A;  3KJP A;  3TME A;  2NVY B;  1B44 D;  1FNV A;  1L0Y B;  4RHR A;  4NP5 A;  4DK1 A;  4ZUJ A;  1ZXT A;  2NB0 A;  2Y0S E;  1NR2 A;  3QOL A;  1MKH A;  1O78 A;  5FO8 B;  5J1Z A;  1XNR L;  3L2P A;  2VB2 X;  5IP7 H;  3S1Q H;  2KQ3 A;  3QIA A;  4FO2 A;  4ME5 A;  3CCS A;  1CKN A;  3R2I A;  1VQC A;  3NQT A;  3PSI A;  5L37 A;  2O5I C;  1MD2 D;  5LMN L;  4E6I A;  3I72 A;  4DR1 L;  1H9K A;  4QJF A;  1M1K C;  3A0J A;  2WAQ B;  2QKI C;  4IPC A;  5IGE A;  4K6L A;  4PZ6 A;  3S14 H;  4CDE C;  1TS4 A;  1GUO A;  3CCM A;  4JW0 A;  2I5M X;  3JAM L;  5M5W B;  1C7Y A;  3K7A H;  3FPU B;  2Q8R E;  4LUV A;  1SN8 A;  1QG7 A;  3ERQ A;  4ULL A;  2JA7 B;  4RFB A;  1Y8P B;  3GDE A;  3D0F A;  1FR3 A;  3EN2 A;  1Y8N B;  3HGB A;  3E6Z X;  3CME A;  4BBR H;  2UXB L;  3S1M H;  3Q22 A;  3TP8 A;  2K05 A;  2C9O A;  2PYK A;  4JI6 L;  2B63 H;  1CFM A;  1EEI D;  5JPM C;  2DN8 A;  2F1M A;  1JIC A;  5K36 G;  2F4I A;  2ENB A;  4DR2 Q;  4DN4 M;  3I4N H;  3H91 A;  1BO0 A;  4HMJ A;  2YTX A;  3PO2 G;  3L3O C;  5DLQ E;  2PI2 A;  4KKS A;  1STN A;  1BOS A;  1NR4 A;  4C3H G;  4GOP B;  3PMF A;  5A2Q E;  3HOW G;  2WKC A;  1KLG D;  3HOU B;  5EPJ A;  4X64 L;  1ET9 A;  3HOY H;  1IHZ A;  3I4M H;  3VR5 A;  2UXD L;  2DJG C;  4KI0 A;  4M1U B;  3ND8 A;  4JG2 A;  5C5L A;  1S5E D;  3Q23 A;  2L12 A;  5EBD A;  2VQF Q;  1V1O A;  1J5E Q;  3HOZ G;  2FHT A;  4RAU C;  1WD1 A;  2LFN A;  1Z47 A;  5M5Y B;  3S16 H;  2VY3 A;  1T9H A;  5D65 A;  3D6W A;  3E9I A;  3IFD A;  3R3O A;  1CKM A;  3KYH C;  2VL6 A;  4UDU C;  4F87 A;  1Q86 C;  5DAU A;  1Y8O B;  1I4R A;  2OTJ A;  2LXK A;  4DPG A;  4A3K H;  1LTB D;  1NY4 A;  5FLX L;  5IT9 L;  2Q2U A;  1ESR A;  5AJ3 L;  2R7Z G;  1WJJ A;  3S1Q B;  4Y7N H;  1VQA A;  1B70 B;  2G9D A;  1KXL A;  4A3D B;  4DV2 Q;  1TS2 A;  3HOV H;  1HUM A;  1L1O C;  5G3L D;  3CC7 A;  4GOP A;  4GLV B;  3N52 A;  2R6G A;  3U9S A;  3NTH A;  1KNE A;  4DAY A;  3SXH A;  4JYA Q;  1VQE A;  1H95 A;  4FDB A;  1PMR A;  3GTO H;  3K7A B;  4YWM A;  3DWP A;  2HQL A;  1BCP C;  4IFD J;  4JBM A;  1IBM Q;  1UE5 A;  4RGO S;  5GAE C;  3S1N H;  2AMC B;  3A7A B;  3ER0 A;  4X3S A;  4OIK A;  1EWI A;  4DV4 Q;  1X32 A;  2RQX A;  4OWW B;  1MI2 A;  4IUN A;  4JI1 L;  4BBR B;  2WAQ G;  3S1M B;  3J7Z C;  4PMW A;  5LL6 X;  2HIX A;  1FGU A;  1F2L A;  2B63 B;  2Z6K C;  2JA5 H;  5C0X J;  2GN5 A;  2Z0S A;  3A56 A;  4FNF A;  4MTK A;  1CKO A;  2B39 A;  1X6O A;  4CJ2 C;  4DK6 C;  5HUR A;  1UNS A;  2NBF A;  2RKS A;  2I5L X;  2XN9 C;  2HDL A;  3SK6 A;  5JJK A;  1B9M A;  1KC8 C;  1VS0 A;  2PQE A;  3OTO Q;  2JEB I;  1EY4 A;  1XJV A;  3SGI A;  3R8B A;  2IX1 A;  1XTC D;  2WB1 B;  2B8G A;  1QB5 D;  4EQP A;  2X69 A;  1S5F D;  4K8J A;  3FKI H;  3HOY B;  3OWE B;  3CHB D;  1SE8 A;  2PNH A;  1N34 Q;  1SBB B;  2QA4 A;  3I4M B;  3I2Z A;  3F2D A;  2ALY B;  2BCO A;  4BS9 A;  5C44 H;  3BDC A;  3SHL A;  4DR5 L;  2K6A A;  5BR8 L;  1D1K A;  1RTO A;  4A3C H;  4DUZ Q;  4JI7 L;  4JV5 L;  3H3V I;  1M8A A;  1B7Y B;  3HKZ E;  2IHE A;  3S16 B;  2QEJ C;  4RCO A;  4PG3 A;  1LTT D;  1AEX A;  5IGF A;  1D6E C;  2FFK B;  2I5H A;  1JR0 D;  3BJU A;  2F52 A;  1PH2 A;  2MFI A;  2HT1 A;  4CGY B;  2EPB A;  1II3 A;  4A3K B;  1K8O A;  1CI3 M;  1ZEQ X;  5KIX A;  1E3P A;  2CW0 D;  1W2B A;  4TQU S;  5FLM H;  4Y7N B;  2ES2 A;  3OOC A;  4KY5 A;  5LMN Q;  1K3B C;  1QVF A;  1TWA H;  4DR1 Q;  2BH2 A;  4DNT B;  3C2P A;  2SOB A;  1VQJ A;  2DY8 A;  2EYF A;  4MIU A;  3HOV B;  1XTD A;  1QJO A;  1SNO A;  3E9H A;  2E2H H;  1BNZ A;  3K81 C;  4RGM A;  1U4R A;  3GTO B;  4XT1 B;  4OX9 L;  3ZYY X;  4PMB A;  1Q1B A;  1STY A;  3S1N B;  1IW7 D;  4YIJ A;  1MBY A;  3D6C A;  2PNR C;  5JEA J;  3G6J B;  3M3Y H;  1GXD C;  1E22 A;  1X65 A;  5EPL A;  5E4X A;  5CBE E;  2AQ1 B;  1X54 A;  3AB9 A;  1E7Z A;  2PMZ B;  4P2C B;  1PZI D;  5KEE A;  4GN5 A;  3H6M A;  4XQN A;  2NZO A;  1NBW A;  1WVL A;  4K2K A;  4WOR A;  1X9N A;  2CHB D;  2WKD A;  2JYO A;  4OWX B;  2K14 A;  1B3Q A;  3CMA A;  1A3V A;  4QY7 A;  3OIP A;  4TRD A;  1L0W A;  4DV7 Q;  5COR A;  4ZAI A;  4G4K A;  4BBR G;  1A63 A;  4B9X A;  4BY7 H;  3K8A A;  4X64 Q;  5CMD A;  3JAM c;  2B63 G;  3X3N A;  3FKI B;  1BF4 A;  4A3I H;  4PNY A;  3PUZ A;  5C44 B;  1AN8 A;  3I4N G;  3FVQ A;  2F0S A;  2VS1 A;  4L5T A;  3GTJ H;  3KDF B;  5E4W C;  4XYO A;  2BOS A;  1G2T A;  4ZLT F;  1WTO A;  2NZ1 D;  2WB1 G;  1FNU A;  2OWO A;  5T1G A;  2K01 A;  3E0E A;  2F0W A;  4CJ0 B;  4OEL B;  2BA1 A;  1YHA A;  2H5X A;  1CA5 A;  4Z9C B;  1JJG A;  4PMC A;  3I4M G;  3PIP 3;  1CQF A;  1KDC A;  1BCP F;  1BCP B;  2F0G A;  4OO1 I;  2K7V A;  1FVI A;  3SE0 A;  4IQZ A;  5EKK A;  4X66 Q;  3W2D A;  3PIO A;  1X3F A;  2KHJ A;  4X3U A;  2OCE A;  1XX8 A;  3KJO A;  1TWA B;  1FD7 D;  3T1H L;  4EGV A;  4S3S A;  4G7H C;  5JJZ A;  2JP1 A;  4LFA Q;  1IZ6 A;  4KMU C;  4ZRZ A;  1SJE D;  2E2H B;  4IO9 A;  1OXV A;  4KV6 A;  4DR4 L;  4A3K G;  3NWS A;  4MHE A;  4LF9 L;  3RNU A;  5IYC G;  4IUU A;  1I4X A;  4QB4 A;  5TSS A;  1GD7 A;  2A6E D;  3KDF A;  1VQD A;  4NW2 A;  4BBS H;  2NVX B;  4PV1 C;  1K0S A;  3M3Y B;  3OPO A;  3HOW H;  3HOV G;  1N32 L;  1KRS A;  4JC0 A;  1EZ8 A;  1O7Z A;  1Q46 A;  5FLX c;  1L1O A;  3HFZ B;  3FRP B;  3SK4 A;  1N9W A;  3TN2 A;  2ID0 A;  2RCF A;  2WV6 D;  1SND A;  1YHQ A;  4DR2 L;  3BZD B;  2CQA A;  4KLK A;  4P72 A;  3NE5 B;  4BXX H;  4HIK A;  2NVQ H;  1ZKO A;  3IL8 A;  4KHP Q;  2YV5 A;  2PZU A;  3E5S A;  4HTH A;  1D2B A;  4BY7 B;  2Z6B A;  1HQR D;  3L0O A;  5A2Q L;  1J8I A;  1PRT F;  1PYS B;  3DUZ A;  1PRT B;  2JA5 G;  4CKC A;  4A3I B;  1ENA A;  2MQH A;  2YTY A;  2F4V Q;  1HFG A;  3D3R A;  2Z6K A;  5BR8 Q;  1HPC A;  4R4Q A;  1UEB A;  1A8V A;  4GNX B;  5C3X A;  3GTJ B;  2J4X A;  1LUZ A;  1JCK B;  1JE5 A;  1HZB A;  2DUD A;  5EKI A;  1XNQ Q;  3EJI A;  1FL0 A;  4DU9 A; 
#chains in the Genus database with same CATH homology
 1SLJ A;  1XNR L;  3L2P A;  2VQF L;  5IP7 H;  2JK8 A;  1J5E L;  2E5L Q;  4P71 A;  4X6A H;  3S1Q H;  4DV0 Q;  5IWA L;  2DGY A;  1VQN A;  4HIM A;  2EXD A;  4GOP C;  3J81 i;  1OTC A;  3CCS A;  4YWL A;  2UU9 Q;  1CKN A;  1P16 A;  1VQC A;  3PGZ A;  3PSI A;  4UP7 A;  2E2J H;  4XTC S;  5LMN L;  2UXC Q;  2WFW A;  3TS2 A;  4UPA A;  1Q82 C;  3M4Q A;  4DR1 L;  4QJF A;  3RLF A;  1M1K C;  3A0J A;  5GAH C;  2UUB Q;  2E2I H;  4GLX A;  4JI0 Q;  4JBK A;  5C44 G;  1PFS A;  1PH4 A;  2R92 H;  4OO1 G;  4IPC A;  2BH8 A;  4PZ6 A;  1K73 C;  4A3M G;  1TWC H;  1SRU A;  3S14 H;  4DV3 Q;  3PUY A;  5GQO A;  2VQE Q;  1YIT A;  1UE1 A;  4HJ7 A;  3PV0 A;  2K50 A;  3CCM A;  3KOJ A;  2I5M X;  1C7Y A;  4A3C G;  1X55 A;  3K7A H;  4RMF A;  3Q8D A;  4LUV A;  1HNZ Q;  1PH5 A;  1SN8 A;  3GTG H;  3F8T A;  1HR0 L;  3HKS A;  1Q7Y C;  3CAM A;  1Q12 A;  2EIF A;  2JA8 H;  3M4O H;  5C3E H;  4B3R L;  5JJI A;  4AQY L;  4IOA A;  3D31 A;  1XPO A;  5ELO A;  3GDE A;  3ULP A;  2JA7 G;  3D0F A;  3EN2 A;  2XGT A;  4DV2 L;  2ZM6 L;  1BBU A;  3K80 C;  2CKZ B;  3CME A;  2D62 A;  4BBR H;  1FJG Q;  3RZO H;  5ELN A;  2UXB L;  2K75 A;  3S1M H;  5IYD H;  1VQG A;  1N33 Q;  4JI3 L;  5JEA G;  1ASY A;  4JI6 L;  2Y0S G;  1Q8K A;  2K52 A;  2B63 H;  4OX9 Q;  4YY3 Q;  3KF8 B;  4ME3 A;  4NXN Q;  1MIU A;  3BZK A;  2CWA A;  3GD7 A;  4A3F H;  4JYA L;  3FHW A;  2XTI A;  1EQR A;  5K36 G;  1QZG A;  5FLM G;  3TEH B;  3CCV A;  4DR2 Q;  4R4I A;  3I4N H;  5LMU Q;  1WOC A;  1WI5 A;  1EOV A;  1X3E A;  2YTX A;  4JI2 L;  5GRO A;  2NN6 G;  3PO2 G;  2ZJR A;  1UWV A;  4DUY Q;  4NXM Q;  5DLQ E;  3HOX H;  2PI2 A;  1TWH H;  1GO3 E;  2C35 B;  5HGQ A;  1VQB A;  2E8G A;  3CPF A;  4GOP B;  3S2D H;  4HID A;  1PH3 A;  4DV5 Q;  2PMZ E;  1VQ9 A;  3HOW G;  1BKB A;  5M3F G;  4O2D A;  1E1O A;  4BY1 H;  4GKK L;  1HH2 P;  2HHH L;  4JOI C;  3WWV A;  4X64 L;  4A4I A;  2R93 H;  3HOY H;  1JT8 A;  4LUZ A;  3HOU G;  3I55 A;  3I4M H;  4C3J H;  2UXD L;  4A3B H;  4KI0 A;  2UUC Q;  4LF5 Q;  4JG2 A;  1LYL A;  5GAG C;  2JJQ A;  1EUJ A;  4YHH Q;  1XNR Q;  1EYG A;  1S3O A;  4LW1 A;  2PI2 E;  4LFC L;  2VQF Q;  2VUM H;  2PQA B;  1XMO L;  3RZD H;  1WCM G;  1J5E Q;  4QL5 A;  2JA6 G;  3OTO L;  3HOZ G;  4IPH A;  1G6P A;  4R4O A;  5IE8 A;  2VZA A;  4DV6 L;  3VDY A;  5IT9 c;  1Z47 A;  1IXR A;  5C4X H;  4DNI A;  3S2H H;  1DGS A;  1KRT A;  4IJL A;  2VY3 A;  3L7Z C;  1VQ5 A;  1T9H A;  3S16 H;  2GVB A;  1U5K A;  3E9I A;  4NPS A;  1TWF H;  3U4V A;  1CKM A;  4L5R C;  3KYH C;  2VL6 A;  4B3M L;  4L5Q A;  1Y1V H;  4A3J H;  1Q86 C;  2Q2T A;  1HJP A;  3KF6 B;  1I94 Q;  4POF A;  5M3M G;  4A76 A;  2OTJ A;  3PO3 H;  2LXK A;  3PIP A;  4DPG A;  4A3K H;  1E1T A;  2QGQ A;  3UE1 A;  3LGJ A;  1K8A C;  1NY4 A;  2MNA A;  2KCT A;  2Q2U A;  1HR0 Q;  4LWC A;  5C4J H;  5AJ3 L;  3AFP A;  3CPW A;  2R7Z G;  1WJJ A;  4DUZ L;  4B3R Q;  1VQI A;  2MO1 A;  1VQA A;  1B70 B;  4Y7N H;  4BY7 G;  4GKJ L;  5IP7 G;  1QUQ B;  4OXP A;  2B3G A;  1CSQ A;  1KXL A;  3HKZ G;  4KHZ A;  4DV2 Q;  1CUK A;  2KHI A;  4LF4 L;  4A3I G;  2UXB Q;  1I5F A;  4X62 L;  1YJ9 A;  4A3D G;  3HOV H;  4EX5 A;  1L1O C;  3CC7 A;  4GOP A;  2NVX H;  4WJ3 M;  4GLV B;  4R4T A;  5IYB H;  4JI6 Q;  2R6G A;  3GTQ H;  1AE2 A;  4A3G H;  4GN3 B;  4OON A;  1N36 L;  1Z9F A;  3CCJ A;  4JCV E;  4JYA Q;  4AH6 A;  1VQE A;  3AEV A;  4MNO A;  1H95 A;  4FDB A;  3UDX A;  1VQP A;  3GTO H;  4YWM A;  2HQL A;  4P73 A;  4IFD J;  3T1H Q;  4A93 G;  4GS3 A;  1K3R A;  2A1A A;  4JBM A;  1IBM Q;  1UE5 A;  4JI2 Q;  2K4K A;  5GAE C;  1NJI C;  1YNX A;  2D0O A;  1PYB A;  3J81 c;  2AMC B;  3RR5 A;  1PH7 A;  3S1N H;  1BBW A;  1UE6 A;  1YEZ A;  2D0P A;  1WYD A;  2EQS A;  1UE7 A;  1EWI A;  3ER0 A;  2JA8 G;  2A8V A;  4DV4 Q;  1IBL L;  1WFQ A;  4WJ4 A;  2ZTD A;  1V43 A;  4TVA B;  5FJ8 H;  4OWW B;  4JI1 L;  3H0G H;  4C3I H;  1PHJ A;  2WAQ G;  1HNW Q;  4DR4 Q;  4P75 A;  3J7Z C;  2AWN A;  2VW9 A;  5M5X H;  4LF9 Q;  4PMW A;  2HHH Q;  3I7F A;  2QEX A;  2HIX A;  5LMN W;  3J7A 5;  1FGU A;  3CQZ H;  2Z6K C;  1TWG H;  4YCU A;  2JA5 H;  5C0X J;  2GN5 A;  1IBK Q;  2N8N A;  2Z0S A;  2UXD Q;  2NZH A;  1YHB A;  4QIW E;  3DLL A;  3GTL H;  1CKO A;  1X6O A;  4DK6 C;  3KF6 A;  4NB3 A;  3GO5 A;  2ASB A;  1VQO A;  1K0R A;  1XMO Q;  2I5L X;  4A3L H;  4IOC A;  4JI8 Q;  4LF6 L;  3CCU A;  4A3E H;  1YJN A;  4EQ5 A;  1VS0 A;  5IY0 A;  3OTO Q;  1Y1W H;  2JEB I;  4YCW A;  1KC8 C;  3U58 A;  1SMX A;  1XJV A;  1IL2 A;  3SGI A;  1HR0 W;  4DV6 Q;  2IX1 A;  3HOX G;  2BA0 A;  1RIP A;  2AWO A;  4B3T L;  3CCQ A;  2UUA L;  3RLO A;  4X65 L;  3UE0 A;  2R7F A;  3FKI H;  4DKA C;  1L1O B;  1A62 A;  1KHI A;  1SE8 A;  2PNH A;  4OWT B;  1SR3 A;  2QA4 A;  1N34 Q;  1KD1 C;  3G4S A;  3KLW A;  4MZ9 A;  3I2Z A;  3T1Y L;  3HOY G;  3F2D A;  2ALY B;  5C44 H;  2RHS B;  4GNX A;  2OQ0 A;  1Y14 B;  3H3V H;  4DR5 L;  3J80 i;  3W5O A;  4HJ9 A;  1HZA A;  5BR8 L;  2RCN A;  5AJ3 Q;  2Q2H A;  4ALP A;  4BBS G;  4A3C H;  1GKH A;  3U50 C;  4DUZ Q;  2AKW B;  4JI7 L;  4JV5 L;  1PV4 A;  3H3V I;  1V1Q A;  1VQ8 A;  3PUW A;  4DV7 L;  4A75 A;  1B7Y B;  1M90 C;  3HKZ E;  5IP9 G;  3S24 A;  2ATW A;  2IHE A;  3A74 A;  3G6E A;  4LF4 Q;  4X62 Q;  1X56 A;  4PG3 A;  1HNX L;  4UY8 C;  2I5H A;  3BJU A;  2KBN A;  2F52 A;  1W3S A;  4GLA C;  1K83 H;  4LFB L;  1NE3 A;  1U0L A;  1E24 A;  3RLN A;  1PH2 A;  1N36 Q;  2MFI A;  3PCO B;  4A3J G;  2HT1 A;  1Q1E A;  2RHQ B;  4BXX G;  4C2M H;  1OXS C;  3CCE A;  3FP9 A;  5IWA Q;  3RN5 A;  3PO3 G;  1E3P A;  2B29 A;  1W2B A;  4TQU S;  3I4O A;  5FLM H;  1ASZ A;  3DM3 A;  3M9B A;  1NTG A;  2ES2 A;  5LMN Q;  2ZTC A;  3M85 A;  5H1S E;  1QVF A;  3PO2 H;  1YZ6 A;  1TWA H;  3TRZ A;  1IBL Q;  4DR1 Q;  1YVC A;  1G51 A;  4YWK A;  1CKN B;  3JC6 6;  4JI1 Q;  3G71 A;  1YJW A;  2BH2 A;  1LM0 A;  1VQJ A;  2LSS A;  4IFD I;  2WAQ E;  4APV A;  4C3H H;  2F3I A;  1XTD A;  3S1R H;  4JI4 L;  1R9T H;  1XMQ L;  3UDF A;  3E9H A;  4P74 A;  5M3F H;  2E2H H;  1G29 1;  3K81 C;  2ZJQ A;  2IT1 A;  1PVO A;  1VQ6 A;  3KFU A;  4DV1 L;  4R4C A;  5IYC H;  1YIJ A;  1NMG A;  4AQY Q;  1VQF A;  4OX9 L;  4DR7 L;  4YY3 L;  2JQO A;  1AE3 A;  4X66 L;  1P8L A;  1Q1B A;  3UDG A;  4LF7 L;  1NMF A;  1GVP A;  1QVG A;  3PF5 A;  4LF6 Q;  4UP9 A;  4YCV A;  2ZM6 Q;  5C0X I;  5E7N A;  2V1C C;  1KIX A;  2FXQ A;  3K7U C;  1VQM A;  1WCM H;  1MJE A;  5JEA J;  4JI3 Q;  2JA6 H;  3HOZ H;  1QVC A;  3M3Y H;  2JA9 A;  4B3T Q;  1X65 A;  1E22 A;  2CFM A;  4LFA L;  4JI5 L;  1OXX K;  5IYD G;  4QGU A;  3TS0 A;  4X65 Q;  2UUA Q;  4NXM L;  2R92 G;  1SRO A;  3PF4 A;  1X54 A;  2NVT H;  1E7Z A;  2Q2I A;  1TXY A;  1VQL A;  2IHF A;  4DV5 L;  4GN5 A;  1V9P A;  4H02 A;  3U4Z A;  4LUO A;  3CXC A;  1KQS A;  1VQK A;  3CD6 A;  2OTL A;  2NZO A;  1S72 A;  1NBW A;  3ULJ A;  4DR6 L;  3F1Z A;  1PH9 A;  2RF4 A;  5M3M H;  1X9N A;  1JJ2 A;  4HJ8 A;  2K5H A;  5C3E G;  4DR5 Q;  3GTK H;  1C9O A;  1HZC A;  4OWX B;  2PQA A;  2K14 A;  3CMA A;  4BA1 I;  4JI7 Q;  4IPD A;  4LF5 L;  4JV5 Q;  4QQB X;  5HY6 A;  4QY7 A;  1AH9 A;  2VNU D;  1L0W A;  4DV7 Q;  1Y1W G;  4YHH L;  2R7Z H;  4GKK Q;  1YI2 A;  4BBR G;  1A63 A;  1JJC B;  4BY7 H;  3K8A A;  4X64 Q;  3JAM i;  4PZ8 A;  3AYH B;  1QZH A;  2KCM A;  3CW2 C;  1HNX Q;  4Y52 H;  3JAM c;  2B63 G;  3GTM H;  2KEN A;  2ZTE A;  5GAD C;  4A3I H;  2NVY H;  1VQ7 A;  4A3F G;  4LFB Q;  2IX0 A;  4A3D H;  4K0K L;  3FKI G;  3I56 A;  2GVA A;  3PUZ A;  3TQY A;  1EQQ A;  3GTP H;  4LFC Q;  3ULL A;  3H15 A;  3I4N G;  2VS1 A;  1VCI A;  4BA2 I;  4J15 A;  4HJ5 A;  4L5T A;  3GTJ H;  3KDF B;  4DR3 L;  3S15 H;  1XPU A;  1I94 L;  2YYZ A;  3RN2 A;  5EAY A;  4A93 H;  4KHP L;  2WP8 J;  4AYB G;  2WB1 G;  4RG1 A;  4POG A;  1QUQ A;  1I6H H;  2OWO A;  1JB7 A;  3CCR A;  2N49 A;  1VQH A;  3E0E A;  4BY1 G;  4PZ7 A;  1I3Q H;  4B3M Q;  2BA1 A;  1YHA A;  2H5X A;  3AQQ A;  1A0I A;  1K9M C;  1EFW A;  2R93 G;  1CSP A;  3MEF A;  4JI4 Q;  3UDI A;  1JJG A;  3I4M G;  4HJA A;  1XMQ Q;  5JJK A;  3STB C;  2L15 A;  4LF8 L;  4GN4 B;  4JOI A;  4XIG S;  4A3M H;  2F4V L;  3OYY A;  4A3B G;  3G48 A;  4DV1 Q;  2IY5 B;  1JMC A;  3J80 c;  4OO1 I;  1FVI A;  4GKJ Q;  2VUM G;  4B3S L;  1XNQ L;  5M5W H;  2HIV A;  4DR7 Q;  4LNQ A;  3W1B A;  2CWP A;  4X66 Q;  4LF7 Q;  3NEM A;  3PIO A;  3F2B A;  1X3F A;  2KHJ A;  3KJO A;  2OCE A;  2E5L L;  5C4X G;  4DV0 L;  4IJH A;  1PH1 A;  3CP0 A;  2JA7 H;  4IFD G;  3T1H L;  2UU9 L;  3TRE A;  1Q81 C;  1IBM L;  3M4P A;  4LFA Q;  3OW2 A;  1IZ6 A;  4R1J A;  4IPG A;  4JI5 Q;  2UXC L;  3A5U A;  2CCZ A;  1Y1V G;  3EBE A;  4DV4 L;  1J6Q A;  3A5Z B;  2UUB L;  4JI0 L;  2YU9 H;  2R7D A;  3CCL A;  4IO9 A;  3IRB A;  2N78 A;  1I50 H;  1OXV A;  2I0Q A;  4L5S A;  1C0A A;  4DAY B;  4JBJ A;  2K5N A;  4GNX C;  4A3K G;  4LF9 L;  4DR4 L;  1D7Q A;  4DV3 L;  2VQE L;  4DR6 Q;  3RNU A;  1XPR A;  1HNW L;  2A19 A;  5IYC G;  5J3B A;  3CC4 A;  1HNZ L;  1PH6 A;  1FL0 A;  1N8R C;  5C0X G;  1VQ4 A;  1IBK L;  2LXJ A;  1GD7 A;  1D8L A;  3NEN A;  1RL2 A;  3KDF A;  1VQD A;  1LTL A;  1K8G A;  2NN6 I;  4BBS H;  3W1G A;  4HIO A;  3NBH B;  3HOW H;  3HOV G;  1N32 L;  3PUV A;  4JI8 L;  1KRS A;  4JC0 A;  5IYB G;  1FJG L;  1BVS A;  1EIY B;  5IP9 H;  3ERS X;  4A3G G;  1YBY A;  1S40 A;  1N33 L;  1Q46 A;  5FLX c;  3HOU H;  1KAW A;  1L1O A;  3ZJY C;  3HFZ B;  3ICE A;  4K0K Q;  4AIM A;  3PUX A;  1IYJ B;  2AHO B;  1OXU A;  4NXN L;  2YTV A;  1N9W A;  3BZC A;  1SFO H;  2ID0 A;  1N32 Q;  1X3G A;  3B6Y A;  4DK3 C;  1YHQ A;  1PH8 A;  3AFQ A;  2MO0 A;  4DR2 L;  4DR3 Q;  4KLK A;  1N34 L;  3NEL A;  1EIF A;  3S17 H;  1MJC A;  4P72 A;  2OQK A;  4BXX H;  5LMU L;  4HIK A;  1PA6 A;  1O7I A;  5JJL A;  1GM5 A;  1HZ9 A;  2NVQ H;  3M7N A;  3BU2 A;  3K0X A;  4DAM A;  4DUY L;  1KL9 A;  4AYB E;  2WB1 E;  2YV5 A;  4O0A A;  5FJ8 G;  3CC2 A;  4KHP Q;  3H0G G;  2JEA I;  4MTN A;  4JBW A;  5M5Y H;  3L0O A;  3F2C A;  2K5V A;  3EIV A;  3T1Y Q;  1PYS B;  2JA5 G;  3KJP A;  1L2F A;  3J81 j;  4LF8 Q;  2MQH A;  3MXN B;  2YTY A;  1OXT A;  2F4V Q;  1B8A A;  2N3S A;  2CQO A;  2Z6K A;  5BR8 Q;  2ZJP A;  4R4Q A;  1UEB A;  1A8V A;  3STB D;  4GNX B;  2UUC L;  2Y0S E;  1LUZ A;  1JE5 A;  1HZB A;  2DUD A;  4UP8 A;  1MKH A;  3CF5 A;  4B3S Q;  1XNQ Q;  4A3E G;  2JE6 I;  4A3L G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...