3S1MH

Rna polymerase ii initiation complex with a 5-nt rna (variant 1)
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
molecule tags Transcription/rna/dna
total genus 19
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2011-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3s1mH00
4LF9Q 5AJ3Q 1HNXL 1HZ9A 1FL0A 2QEXA 4A3KG 4JI5Q 4KI0A 2JJQA 4A3DG 4YWMA 4AYBE 2E5LQ 1X3EA 3BJUA 2NVXH 1N32L 4YY3L 1R9TH 1HZAA 3GO5A 5LMNW 3GTOH 1I94L 2JA7G 3M3YH 3PSIA 1T9HA 4A3DH 1A0IA 2YTVA 4PZ7A 5ELOA 2UXCL 4LF7Q 1XMOQ 2L15A 4A3CH 4DV3Q 3F8TA 3GD7A 3HOUH 1L2FA 4LW1A 4JBKA 2PMZE 1X3GA 3F2DA 3CCRA 3W1GA 4B3SQ 4X66Q 2F4VQ 3HKSA 2LXJA 4A3JG 4BBSH 1NY4A 5M3FH 3SGIA 1SR3A 3T1YQ 4HJ8A 5IYCH 3L2PA 1A8VA 2UU9L 4A3JH 4GNXB 5GAHC 4X65L 2HHHQ 4HJ7A 4IO9A 1PH9A 1IYJB 1SMXA 4DKAC 5IYBH 4BY7H 1G6PA 1WYDA 4LF5L 2A1AA 3PO3H 3CAMA 3I7FA 1C7YA 1VQ7A 1V9PA 1WCMG 4AH6A 4OX9L 3KFUA 3A0JA 2F3IA 5IP7G 4B3MQ 1G291 2B3GA 1SRUA 3S2DH 3A5ZB 1XJVA 1TWHH 4P73A 3AYHB 5IP7H 2VQEQ 1QUQB 3JC66 5E7NA 3LGJA 2R7ZG 4BA2I 4YWKA 1HZCA 2R92H 5HGQA 2ZJPA 4DR7L 3H15A 1QZGA 3E0EA 1LM0A 3J81i 3Q8DA 1YITA 2VW9A 1TWGH 1HNXQ 4JI7L 1NMGA 2MQHA 2DUDA 1S3OA 1V1QA 2VL6A 4P72A 3CCUA 1XPRA 1E22A 5H1SE 3PUWA 4YY3Q 4NPSA 1XPUA 4QGUA 5JJLA 2Q2IA 4APVA 2YYZA 4HJAA 4X6AH 2UXCQ 5IT9c 1E1TA 2IT1A 1JMCA 2JEAI 3I4NG 4XIGS 1YNXA 2KCMA 1YBYA 1VQJA 3VDYA 4GS3A 4HJ5A 3CCQA 3CCEA 4JI6Q 5GQOA 1UEBA 1O7IA 5M5WH 4LWCA 2E2IH 1CKNB 4LF6L 1B8AA 2D62A 2Y0SE 4GLVB 1N8RC 3CC2A 2JA8G 4DV2L 2R7DA 4DPGA 3RNUA 1XNQL 1PH1A 3S1NH 2K50A 1S40A 4LF9L 3J7ZC 4DUZL 3STBC 3I4MG 2Q2TA 1P8LA 4MTNA 4JI5L 3PGZA 5GROA 4GN3B 4GKJL 3PV0A 4LFBL 3KDFA 4GN5A 4POFA 3CXCA 4OX9Q 2PQAA 1L1OC 2VS1A 4NXNL 1Q7YC 2WAQE 1HR0W 2ES2A 4BBRG 4GKKQ 3UE0A 2D0PA 1Y1WH 1Q12A 3GTKH 1AE3A 5JEAJ 3UDXA 3GTLH 3W1BA 5IP9G 2OWOA 4A3LH 1GD7A 3RZOH 2R93G 3ULPA 4B3SL 3L7ZC 2FXQA 3U50C 4EX5A 4QY7A 3ERSX 2LXKA 1YHQA 1P16A 1JJ2A 5IYDH 4JI7Q 1KIXA 2VUMH 4L5QA 1KQSA 3T1YL 4C3JH 4POGA 2NZHA 2ASBA 1GVPA 3HOYG 3U4VA 2EXDA 5C0XG 3AQQA 2ALYB 1X65A 3PF5A 2XGTA 3HOWG 3PO2H 4K0KL 4IOAA 3J81c 5FLMH 3ULJA 3JAMi 3CCSA 4PZ8A 2UUAL 4DK3C 1PYSB 3HOXG 1I50H 3W5OA 4IPGA 4DUYL 4HIDA 5LMUL 1KL9A 1KHIA 1EOVA 1VQMA 1PHJA 1Y1VG 3K8AA 3T1HL 1Q86C 2CQOA 2Y0SG 2A19A 1YJ9A 3ICEA 1XNQQ 2JK8A 3CCJA 1HH2P 5EAYA 2D0OA 1BBUA 4IFDJ 2VZAA 2R7FA 4DUZQ 1V43A 4ME3A 4BXXH 3AEVA 5M5YH 4GKJQ 1LYLA 4A3BH 4LFBQ 1X54A 1PFSA 5DLQE 4KHPL 2IHEA 3NBHB 1N34L 2KENA 2OCEA 4A3KH 1PV4A 1M1KC 4NXNQ 1BKBA 2K5HA 1X3FA 3J7A5 4DNIA 4DV4L 4HIMA 2WAQG 4LUVA 3ER0A 2JA7H 1IBLQ 3E9IA 4A3FG 2ID0A 3HKZE 4JI6L 4JCVE 4X64L 1KAWA 1TXYA 2Z6KC 4UPAA 1HNWL 4LFCL 4JI8Q 5GAGC 4JYAQ 4LUZA 4PG3A 1Q81C 4WJ4A 3GTPH 3I55A 1VQ9A 3M4QA 2CWPA 2JA9A 4DK6C 3IRBA 3MXNB 4QQBX 3K81C 1XTDA 1VQLA 5C0XI 3CPWA 2I5LX 1MJEA 2N8NA 1VQGA 3CC7A 3TS0A 4LFAQ 4K0KQ 5C44G 1N9WA 3K7UC 4UP7A 1YJWA 4RMFA 1VQIA 3CCLA 1RL2A 4KLKA 1EWIA 2UUAQ 3HOZG 1K83H 2UUCL 1BVSA 3TS2A 4DUYQ 3KYHC 1RIPA 1W3SA 1WOCA 3FP9A 4P71A 1K8GA 5LMUQ 4A93G 1WFQA 1YHBA 4MNOA 1PH5A 1EYGA 4GKKL 1C0AA 3H3VI 1VQFA 3KDFB 1WCMH 1EQQA 2PI2A 4A76A 2B29A 2PQAB 1KD1C 3CQZH 3T1HQ 3J81j 1FVIA 4DR6L 4DV7Q 2HIVA 3BZKA 1UE1A 3G6EA 1EUJA 5C3EG 4RG1A 2CFMA 3I4OA 1PH8A 1K3RA 5GADC 3TRZA 2R7ZH 4IFDI 1VQ4A 2HT1A 1IL2A 4DAYB 1AE2A 2GVBA 3A5UA 4KHPQ 1VQOA 2BH8A 3U58A 1N34Q 1VQ8A 2MNAA 1IXRA 4R4CA 4YCUA 2IHFA 3D31A 3J80i 4JC0A 1CKMA 4X62Q 4DV4Q 3EN2A 3EIVA 1N36L 1JJGA 2Q2UA 2GN5A 2WFWA 3PUVA 4YCWA 3M85A 4IJHA 4X64Q 3HKZG 3I4NH 4A75A 2N3SA 1HNWQ 4JI4Q 4LFCQ 2UXDQ 3UDIA 1Q8KA 1UE7A 3RN2A 4Y52H 1U0LA 1JJCB 2JA5G 3S1QH 2NZOA 1PH7A 2ZM6L 2JE6I 1PH3A 3PCOB 1Z9FA 4J15A 5JJIA 4DV0L 4Y7NH 4GN4B 1CKOA 2RHQB 4HJ9A 1HNZL 2B63G 5JJKA 3M4OH 1XPOA 1QVFA 4EQ5A 4DV1L 1VQAA 3E9HA 2JA8H 5LMNL 5HY6A 1XMQQ 2JA6G 1LUZA 3FKIG 3KF8B 2AKWB 2KBNA 2OTJA 4QIWE 3S24A 2UUCQ 1XNRL 3I4MH 4R4QA 4IJLA 2BA1A 4TQUS 4UY8C 1D7QA 1GM5A 4A3EG 1E3PA 5IYDG 2K5NA 3D0FA 1IBLL 1Q82C 4DR6Q 3PIOA 4C2MH 3K80C 1FGUA 4BBRH 2NVQH 5JEAG 1QVCA 2ZTCA 3NELA 4A3EH 3RLFA 3F2CA 2CWAA 3OTOQ 1YEZA 1DGSA 2JEBI 4NB3A 4JI8L 3S14H 4JYAL 3STBD 1GO3E 5IP9H 1MKHA 3KF6A 4HIKA 2R93H 4O2DA 1YHAA 5BR8Q 3CF5A 3AFPA 1VQHA 4KHZA 4OXPA 1VCIA 4ALPA 3CP0A 1TWAH 1TWCH 1Q1EA 4LFAL 1D8LA 3F2BA 1N36Q 4O0AA 4LF4L 4QL5A 3HOYH 3GTJH 2I0QA 2WB1G 1N33L 1SN8A 1QZHA 3CCVA 2LSSA 1MIUA 3ZJYC 5M3MG 3HOWH 1NBWA 4XTCS 1J5EQ 4NXML 4R1JA 4DR3L 5M5XH 2K52A 3HOXH 4R4OA 1X9NA 3J80c 2OQKA 1NMFA 2ZM6Q 4DV7L 2MFIA 4DV0Q 4BA1I 4L5SA 1IBKQ 4A3IG 3UDGA 1I6HH 3H3VH 1HNZQ 2KCTA 1Y1VH 1UE5A 1X6OA 4BY1G 4DV1Q 1VQNA 3S15H 1I3QH 4DR2L 5LMNQ 4IFDG 4QJFA 5GAEC 4GOPA 1UE6A 2UUBQ 2AHOB 2IX0A 2WP8J 4JI3L 1E1OA 1XNRQ 5ELNA 4YHHL 2YU9H 4YCVA 4LF8Q 3ULLA 1E24A 1Y14B 3PUZA 1WJJA 4X62L 3KJPA 4A3GG 2IY5B 4LUOA 1WI5A 4DR5Q 4YWLA 3K0XA 4PMWA 1AH9A 3OYYA 3OW2A 1NE3A 1CUKA 1VQBA 2I5MX 4A3GH 2RF4A 3AFQA 2Z0SA 2NVYH 1KXLA 4JI4L 2N78A 2UXDL 3CPFA 4B3TL 4A3FH 1A63A 3F1ZA 2H5XA 1LTLA 1PA6A 4OWWB 4L5RC 1NJIC 1KC8C 3G48A 4OONA 1KRSA 3RN5A 2QGQA 2I5HA 3CMAA 2RHSB 2ZTDA 2VQFL 4A3CG 2VY3A 3HOUG 2HIXA 3UDFA 4HIOA 3UE1A 3GTMH 4JV5L 4LF4Q 3M9BA 3S16H 4UP8A 1OXVA 1XMQL 1HZBA 1OXUA 1VQCA 1N33Q 4JI1L 1EIFA 2K75A 4DAMA 1HR0L 3L0OA 3M4PA 3RLOA 1IBMQ 5M3FG 3FHWA 2AWOA 1OXSC 2ZTEA 4JOIA 1SE8A 5C44H 1W2BA 1PH6A 4NXMQ 3MEFA 4DR3Q 1Q1BA 5IYCG 2A8VA 2N49A 2AWNA 2V1CC 4JI2Q 3HOZH 4B3RL 3H0GG 4A93H 5FLXc 1OXTA 3G4SA 3JAMc 4R4TA 4UP9A 5IYBG 4DV6Q 4BY7G 3G71A 1IZ6A 1CSPA 3I2ZA 3PO3G 4FDBA 3OTOL 2NN6G 3RZDH 3H0GH 3TREA 5IWAQ 2E2HH 1L1OA 4DR2Q 1ASYA 1UWVA 3TQYA 5C3EH 5BR8L 4IOCA 1VQ6A 4AIMA 4JI3Q 2E8GA 2F52A 1JT8A 4AQYL 4IPHA 4YHHQ 3KF6B 1GKHA 3PUYA 3PF4A 4L5TA 4GOPC 2WB1E 4P74A 2R92G 1S72A 3GTQH 1FJGQ 1TWFH 4LNQA 1A62A 2MO1A 1Q46A 2R6GA 1J5EL 4JI0Q 3HFZB 2BH2A 2CKZB 4DV5Q 3S1RH 1YVCA 3CC4A 1QVGA 3PUXA 4B3TQ 1VQEA 5C4JH 2YTYA 1H95A 2OQ0A 1YIJA 1M90C 1SLJA 1PH4A 1EQRA 1Z47A 2KHIA 4A3MG 3CD6A 1IBKL 4AYBG 3KJOA 1N32Q 2VQFQ 2JA5H 4WJ3M 3B6YA 1B7YB 1YI2A 1I94Q 4A3BG 1PVOA 2UXBL 3RLNA 1EFWA 4JV5Q 2JQOA 4A3MH 4JBMA 1VQ5A 4JI1Q 1SFOH 1HR0Q 2UUBL 2B63H 4BBSG 2VNUD 3NENA 4DR4L 4DR1L 4OO1I 3DM3A 4LF8L 4JBWA 3PIPA 2KHJA 1JB7A 2JA6H 4GOPB 3FKIH 2K5VA 4GNXA 4OWXB 4B3RQ 2BA0A 4JOIC 1J6QA 4DR5L 5C4XG 4IPCA 1OTCA 1L0WA 3A74A 3KOJA 2DGYA 2OTLA 2UU9Q 3BU2A 4X65Q 2NN6I 1G51A 2YV5A 2PI2E 5C4XH 4TVAB 1KRTA 3TEHB 5AJ3L 3RR5A 1U5KA 3GDEA 4LF5Q 1K0RA 2E5LL 4P75A 1JE5A 1OXXK 1MJCA 4AQYQ 3BZCA 1Y1WG 1C9OA 4A4IA 5FJ8G 1VQKA 1QUQA 2AMCB 2E2JH 2Z6KA 3U4ZA 4A3LG 1K73C 4LF7L 1XMOL 1YJNA 1BBWA 5J3BA 2Q2HA 1PYBA 3HOVG 2ZJRA 4DV3L 3M7NA 5FJ8H 4IPDA 1IBML 2EIFA 4R4IA 2VUMG 4OO1G 2MO0A 1EIYB 4DR7Q 2F4VL 4X66L 1NTGA 3DLLA 3HOVH 4JI2L 5M3MH 2NVTH 4JG2A 1X56A 5IE8A 2C35B 2GVAA 5IY0A 3PO2G 4DV6L 3WWVA 2ATWA 3S17H 5C0XJ 1CSQA 4C3HH 5FLMG 2HHHL 4OWTB 3CCMA 2ZJQA 5IWAL 2UXBQ 3S2HH 3GTGH 3CW2C 3NEMA 4A3IH 2EQSA 2QA4A 3EBEA 1E7ZA 3KLWA 1B70B 2RCNA 4BY1H 1CKNA 2K14A 4DR4Q 4DR1Q 1L1OB 1K8AC 1PH2A 2CCZA 4B3ML 1X55A 1ASZA 2YTXA 4H02A 1HJPA 3S1MH 2HQLA 1FJGL 3K7AH 1SROA 3CMEA 1K9MC 4LF6Q 2XTIA 3I56A 1I5FA 2VQEL 1VQDA 4DV2Q 1YZ6A 4C3IH 4BXXG 4JBJA 4MZ9A 4JI0L 4DV5L 2PNHA 1VS0A 4GNXC 4GLAC 4PZ6A 4GLXA 1VQPA 2IX1A 5K36G 2K4KA
chains in the Genus database with same CATH superfamily
1HNXL 5BN4A 4JI5Q 4KI0A 1RODA 2JJQA 4A3DG 3AB9A 3BG3A 4YY3L 1EYDA 1HZAA 3GO5A 5C44B 1I94L 3GTOH 3M3YH 4PZ7A 4FYDA 3TSSA 2B2WA 3GD7A 3HOUH 3T56B 2PMZE 1X3GA 3W1GA 1Y69U 4MN3A 2LXJA 5M9OA 3HZXA 1I4QA 5CV5A 2PZWA 3DMUA 1SYEA 2HHHQ 2SNMA 4IO9A 1RTNA 1IYJB 2L9HA 1SMXA 3MEHA 1Y8OB 5IYBH 4BY7H 4XYOA 3GTQB 3CAMA 3HG9A 3I7FA 1C7YA 1NR2A 1AW7A 5BN5A 4B3MQ 1EOTA 3S2DH 3R93A 3AYHB 5IP7H 2VQEQ 1QUQB 3A7LA 3JC66 2ZT9C 3D3RA 4BA2I 1HZCA 1SMYD 3H15A 3J81i 2VW9A 1TWGH 1W6KA 2X6LA 3CCUA 2MQHA 1XPRA 2QDLA 2VL6A 4V0BA 3EFXD 3RUZA 2K28A 2Q2IA 3MC0B 4HJAA 3K6OA 4KD4A 1BXTA 2F0LA 2UXCQ 4P2CB 4XIGS 1YNXA 1TY0A 5CV4A 2FINB 4C2MB 2NVQB 4HJ5A 3CCQA 1WTXA 1EY9A 2FMMA 5GQOA 1UEBA 5M5WH 5D3IB 2BOSA 2F0GA 3K5OA 3MXNA 1G8ZD 3GP7A 5FO9B 2K6AA 4TRDA 1B8AA 4J6HA 2JA8G 4KN4C 3VR4A 2R7DA 1PH1A 3VR6A 3S1NH 3F2UA 1S40A 4DUZL 4MTNA 1U9RA 1LO5D 4GN3B 4GKJL 1V1PA 4GN5A 4OX9Q 4K5WA 3J7AV 1NSNS 1Q7YC 2F1MA 2EDGA 4BBRG 3C2PA 4Q5VA 3QB3A 5I2YA 2Z8LA 5M3MB 1PYWD 1STNA 5EPKA 3UDXA 1STGA 1EEFD 2R93G 1ZYRD 3ULPA 3L7ZC 2B2VC 1SYBA 2D2CC 4QY7A 3ERSX 1JJ2A 2EJGC 1D5XC 1KIXA 2VUMH 1KQSA 3T1YL 1LTTD 5LL6X 4POGA 2NZHA 4BY1B 3AU7A 4JVZA 4IUNA 2FFKB 1B1ZA 1CFMA 4IZ8A 5FK9C 2PCFB 3HRZC 2L5TA 3ULJA 5FLMH 4PZ8A 3CCSA 1PYSB 4G4KA 3HOXG 4QCLA 3W5OA 4KMUC 4DUYL 4HIDA 5LMUL 1EOVA 1EWCA 1Y1VG 3T1HL 1Q86C 2CQOA 1IHZA 1YJ9A 2NVXB 2JK8A 3K57A 2RCFA 2D0OA 4I65A 2VXWA 4IUPA 1B53A 1FD7D 2K01A 3AEVA 4BS9A 2L11A 1B50A 1BF4A 2QCPX 2KENA 3QOLA 1HUNA 2OCEA 4A3KH 1PV4A 1X3FA 4FNFA 1HTLD 4PMBA 1QILA 2WAQG 4QB4A 1KABA 1Q90A 2F0MA 2NZ1D 1KAWA 2Z6KC 3BZDB 2KJXA 4JYAQ 3GTPH 2B2UA 2CWPA 3PO3B 3MXNB 2K05A 4LFAQ 4K0KQ 2SEBD 4B08A 3CCLA 1RL2A 4KLKA 1K83H 4DNRB 3NQTA 1RIPA 1W3SA 4X3TA 1WFQA 1V1PB 1C0AA 3NTHA 1VQFA 5CMDA 4HCSA 1FVIA 4DV7Q 3ND9A 1UE1A 4XYQA 4OIJA 5C3EG 3TRZA 2EYFA 5GADC 2MP1A 4IUUA 1VQ4A 3D4RA 1SE3A 4AYBB 1G91A 1AE2A 3U58A 5IGEA 1VQ8A 2MNAA 4R4CA 4YCUA 2IHFA 1JR0D 2PNRC 2L4NA 2E2IB 3EIVA 3PUVA 3C3LA 1HXYD 4Z9CB 1ICFB 4NW2A 4X64Q 3HKZG 3I4NH 4A75A 1IL8A 3NXWA 1UE7A 4U673 3EVQA 3CRKC 3S1QH 2JE6I 3PCOB 4UHVA 4Y7NH 2KECA 2B63G 1VQAA 3E9HA 5E1FA 2KOLA 2M9VA 5IGGA 1Y1WB 3FKIG 2UUCQ 1NNXA 1XNRL 4R4QA 4IJLA 4UY8C 1D7QA 1SNOA 1GM5A 4A3EG 5IYDG 2K5NA 3D0FA 1IBLL 2SOBA 3PIOA 4C2MH 2NVQH 1FGUA 2CWAA 3OTOQ 2JEBI 3NK9A 3STBD 2PZTA 3PO2B 3KF6A 4HIKA 3J7AF 1EY7A 3URYA 1VCIA 1TWAH 1A3UA 1TWCH 2MJ8A 5KGUA 3S1MB 4DFAA 3GTJH 2I0QA 1QZHA 5C0XH 1MIUA 2DN8A 1U4LA 3J80L 4DR3L 1W6JA 1LTAD 2K52A 4PV1C 1G2TA 2EY1A 4C3HG 2OQKA 1NMFA 4KD3A 1CTMA 5IIFA 1MGSA 4A3BB 4DV0Q 1JWSD 1IBKQ 2WKDA 1CHQD 1O7YA 1HNZQ 1X6OA 4DV1Q 3S15H 4IFDG 1KAAA 1B44D 4GOPA 4EGVA 2JA7B 2UUBQ 2AHOB 4RGTA 1MI2A 4LF8Q 3ULLA 1DXMA 4C3IG 2IY5B 4A3GG 1ZEQX 1H9KA 4LUOA 4QMGA 1FNVA 4PMWA 5KYIA 1NE3A 1VQBA 4ZUIA 4H13C 3K58A 4JI4L 3BS1A 3F1ZA 4DXFA 1TS3A 3KLSX 3DWQA 4CJ2C 1KC8C 2M00A 1NJIC 2QGQA 2ZTDA 2VQFL 5DAUA 1QOHA 2VY3A 3HOUG 3NP8A 2HIXA 2D9UA 1PFMA 4JV5L 4OGQC 4LF4Q 1QNKA 3S16H 1OXVA 1WCMB 4MIUA 1OXUA 1N33Q 1GUOA 4QUFA 3CQZB 1GUSA 1PH6A 4NXMQ 1DOKA 2N49A 2AWNA 3HOZH 3QO2A 1PTOH 1BCPF 1PRTC 3H0GG 5FLXc 1OXTA 3X3MA 3JAMc 4FF3A 2PYKA 1O7LA 5IYBG 1KNAA 3SK6A 3G71A 1IZ6A 5G3LD 4WJWA 4BY7G 4FDBA 4NKLA 2E2HH 5ELFA 4IOCA 5BR8L 4EQOA 2L12A 5ISRA 4IPHA 3KF6B 2B2TC 3D6CA 3PF4A 1FJGQ 2RQXA 1TWFH 2L55A 2QW7A 2JXMB 1J5EL 2BH2A 3HFZB 4DV5Q 3S1RH 1C48A 3CC4A 4KTAA 4B3TQ 2WV6D 3LWEA 1YIJA 4U68A 5C4HA 3P7JA 5EGTA 4EVOA 3CD6A 4RAUC 4WJ3M 3I4MB 1I94Q 5J22A 2UXBL 1EZ8A 2JQOA 3P20A 5KNCA 1SFOH 2HUGA 2VNUD 1VF7A 3DM3A 1JOKA 1F2ZA 4JBWA 3PIPA 3RZOB 1JB7A 1ZXTA 2F0VA 4GOPB 2JA6H 2I07B 3H3VC 3S14B 2LY7A 4GNXA 3ITPA 5C4XG 1J6QA 4QUCA 1YNND 4IPCA 2HDLA 1STBA 2DGYA 3R2TA 4TVAB 1KRTA 3PIO3 1RCVD 1K8OA 1RDPD 3QOJA 3GDEA 3NSWA 1EY8A 1K0SA 4AQYQ 3N52A 1C9OA 3C46A 1B3QA 2AMCB 2E2JH 3U4ZA 1HFGA 1XMOL 1YJNA 3EA6A 4FO2A 3T51B 3HOVG 3M7NA 2F0WA 1IBML 3KBXA 2VUMG 4OO1G 4KKSA 4HAEA 1I3QB 2Y0SB 1EWHA 2Q8RE 2C35B 3WWVA 1TS5A 1BCPC 3FVQA 2ZJQA 5FLMG 2YU9B 2DY7A 1HPCA 1BNZA 2PW7A 4F8MA 2QA4A 4E6IA 1E7ZA 1M4VA 1B70B 2XIWA 2NB0A 2K14A 1K8AC 4CHTB 4KV6A 3S1MH 1K9MC 3I70A 5IGDA 2XTIA 3I56A 1Y8PB 1G6ZA 4JI0L 2PNHA 4GLAC 4PZ6A 1XXGA 5EKIA 5AJ3Q 1FL0A 2QEXA 1EL0A 4A3KG 5DM63 2E5LQ 3A8IE 3BJUA 5LMNW 3PSIA 4LF7Q 2RDFA 2EYPA 4CGYB 3FPPA 3F8TA 4A93B 4JBKA 3MHBA 2MGSA 5D14A 2F4VQ 4X66Q 4M8AA 3RZDB 4OL7A 4A3JG 1NY4A 1AEXA 2JN4A 2F0EA 5FLXE 3T1YQ 3JAME 3C1EA 3L2PA 4IQZA 3HS0C 4LJZC 4GNXB 2K5QA 4X65L 1PXUA 2BCOA 1PH9A 2K5DA 4DKAC 5C3XA 4LF5L 2A1AA 1MD2D 2K1BA 3MFYA 2NN6H 3K0YA 5CGKA 1BBXC 1DONA 1SRUA 1TWHH 4CDCC 4ZKCB 4NMZA 2JA5B 4XQNA 3E0EA 3Q8DA 4JI7L 2WKCA 1S3OA 2Z4HA 1E22A 4F87A 1JOOA 1U4RA 4FF2A 4APVA 4CDFC 1CI3M 5IT9c 3AMUA 1T5EA 2JEAI 3I4NG 4CKEA 1A3TA 2KCMA 1CA6A 1RJTA 1U4PA 2FHTA 1DCZA 2B2WC 1FNUA 1TT2A 1V8QA 5EBCA 2DJGC 2Y0SE 2D62A 3PIP3 3CC2A 1SSOA 4DPGA 1XX8A 1XNQL 2EXZA 3VYTA 2K03A 1Z7TA 2J0TD 2K7VA 4WORA 1L1OC 4NXNL 1HR0W 3UE0A 1D2BA 2BE5C 3V96A 4RHSA 5KRUA 2D5DA 4K14A 3OIPA 1ICWA 5JEAJ 1F9PA 4DAYA 4A3LH 1GD7A 3RZOH 4B3SL 3MAQA 3U50C 1I6HB 3S2HB 3TMEA 4L5QA 4C3JH 4A3IB 4CDDC 3X3NA 3U9SA 2FMCA 1GVPA 2OEOA 1F2LA 5T1GA 5C0XG 2ALYB 3PF5A 2XGTA 2PW5A 1C8CA 3J81c 1E2WA 3OOCA 4QIWB 1B9NA 3A8KE 5C5LA 2F0HA 1KL9A 1KHIA 1TU2B 3K8AA 2L1BA 4KKTA 3VR2A 3VYUA 4RKBA 1R9TB 1HH2P 1BBUA 2VZAA 2HDMA 2J4XA 5JVG3 4ME3A 3SK5A 4LFBQ 4KHPL 5DLQE 1N34L 1CK1A 4ZK9B 4DNIA 4DV4L 4LUVA 4BBSB 3ER0A 5M3FB 1IBLQ 1D1KA 1ML0D 4JI6L 3VYSA 5CV8A 4K6LA 2E2DC 3N6RA 2O4XA 4PG3A 4WJ4A 1A15A 2EY6A 2A6EC 3OWEB 3IRBA 5JAVA 4FXGC 5A35A 1XTDA 2HQEA 5C0XI 3TS0A 1JWMD 2NBFA 3W2DA 1N9WA 3K7UC 1RD9D 4RMFA 1VQIA 5E3FA 2UUAQ 4OEMB 3HOZG 1BVSA 2R92B 1VF5C 1PH5A 4MNOA 1JWUD 1EYGA 3K5LA 1IW7D 2HCIA 4XQQA 1F77A 1VDZA 2R7ZH 5C6AA 2A68C 4DAYB 4A3MB 3DM1A 2CH4A 2GVBA 4ZCKA 4RWSC 3NTIA 5IT9E 1EIGA 3J80i 1JJGA 1CKMA 2XSCA 5LHY1 5IGCA 2WFWA 2X6GA 2JP1A 2N3SA 5I6WA 1HNWQ 4JI4Q 4LFCQ 4TSSA 1Q8KA 5EQ0A 4Y52H 3L9AX 4ABNA 1JJCB 1I4RA 1NCVA 2A6HD 2A69C 3KLRA 4HEDA 2NZOA 1PH3A 4J15A 1MSHA 1CKOA 2RHQB 1S5DD 4EQ5A 2OXPA 5LMNL 1RHPA 2JA6G 1LUZA 2KBNA 3DWAA 4QIWE 3GTKB 3GTLB 1A2UA 1WTRA 4ILWA 1EFID 4K2KA 2EPBA 5FO8B 1E3PA 4S3SA 3U9OA 4NDXA 4DR6Q 3K80C 3S17B 3NELA 3EROA 3RLFA 4JI8L 1E2VA 4DNTB 1EU3A 3DEOA 4O2DA 5BR8Q 1J8IA 4KHZA 2ICEC 3CP0A 4M1UB 1D8LA 3J81E 1N36Q 3HOYH 1SN8A 3BDCA 4N9TA 3CCVA 3LX0A 5FO7B 1LT3D 3HOWH 2O5IC 1J5EQ 1GHKA 4R1JA 1KTKA 2ZM6Q 5M5YB 2C5CA 4L5SA 1I6HH 3H3VH 1UE5A 4A3DB 1VQNA 1BDOA 4DR2L 4QJFA 5GAEC 4X3SA 4FVMA 1I4HA 4X3UA 3DUZA 3NBIA 4YHHL 4ME5A 2G9DA 1E24A 1Y14B 3PQIA 4X62L 1X3PA 1HCZA 3CU7A 4GZYC 4XDXA 3OYYA 1FR3A 3OW2A 3QJYA 2RF4A 2KEDA 4NP5A 2NVYH 1KXLA 2N78A 4A3FH 5CBAE 1B3AA 3VYRA 4OONA 4K8IA 1STEA 3RN5A 3CMAA 2RHSB 2NTTA 1C4QA 2KUMA 3M9BA 4UP8A 1TY2A 1XMQL 4DAMA 1HR0L 2K75A 1OO9B 3L0OA 3RLOA 1IBMQ 3FHWA 5C44H 1OXSC 1SE8A 4RHRA 1ILPA 2F0QA 4ID6A 3E6ZX 3MXPA 4B3RL 1II3A 3NQIA 3G4SA 4UP9A 4DK0A 1CSPA 4IN3A 4C56C 2NN6G 2O5JC 1ASYA 5JPNC 2FJ2A 1VQ6A 5A2QE 3DEPA 2F52A 4JI3Q 1JT8A 1WTQA 2WACA 2R3ZA 2AQ2B 2PPBC 3PUYA 2A73B 3CRLC 4L5TA 4GOPC 3GTQH 4JK1C 1LT5D 1A62A 3HEJA 3IAYA 4JI0Q 5EJWA 4HTHA 1QVGA 5KYLA 1S5BD 2YTYA 2JA8B 4G7HC 1TQOA 4K2LA 4HMJA 1Z47A 2KHIA 3A55A 1B7YB 1G2SA 3GV3A 2X69A 4A3MH 4JBMA 1PMRA 4JI1Q 2Q8TA 2MHVA 3NENA 4DR4L 4BBRB 3SEBA 1K28A 2K5VA 3RD4A 1LTBD 4OWXB 1AZPA 4DR5L 2R93B 2B8FA 3A74A 2OTLA 3BU2A 1ZYRC 4X65Q 2NN6I 1G51A 1DD2A 1HFNA 1FNWA 1RF2D 3TEHB 3T53B 4LF5Q 1JE5A 4RGNA 1OXXK 1I50B 4A4IA 1VQKA 1UAPA 5M5XB 5C4ZA 2Z6KA 3A56A 4A3LG 3KLSA 3HOXB 1PYBA 5FJ8H 2M2LA 2EIFA 2F0FA 2MO0A 4C3JG 5COYA 1Y1VB 1JICA 4JI2L 5M3MH 1X56A 4DAVA 1AZQA 3GQBA 5IE8A 1D5ZC 3Q22A 2ATWA 3S17H 1CSQA 2HHHL 4K6DA 4OWTB 2LMCB 3D8GA 3J7YW 4K5XA 3NEMA 2L0CA 2EQSA 5ELBA 4O42A 4BY1H 1CKNA 3QR8A 1EU4A 4DR1Q 1WTVA 2WAQB 3FEWX 1LLRD 1NUCA 4B9WA 4B3ML 4R9WA 1ASZA 1HJPA 2EYMA 4HN7A 1SNMA 1I5FA 4PMCA 2VQEL 1QG7A 2A74C 2QEJC 5C3WA 4GNXC 1VS0A 4GLXA 4KK7A 2K4KA 3GTMB 3OMCA 2CVRA 4AYBE 2NVXH 1N32L 2ZXRA 5K36H 3K5NA 4A3DH 2Z1CA 3TZDA 2UXCL 4H0LC 2DY8A 2L15A 1YNJC 4DV3Q 3K59A 3BVGA 1FYCA 4KY6A 5CR3A 3CCRA 4B3SQ 3HKSA 3P75A 4IUVA 1TR5A 2N88A 4CKBA 2E74C 3SGIA 1ENFA 5IYCH 5C3EB 1ESFA 3H91A 2UU9L 1ESRA 2I46A 3SVMA 3I8ZA 1LABA 2BDNA 3MVVA 4HJ7A 3E3XA 1G6PA 1WYDA 3PO3H 3H09A 4MHEA 5KEEA 1VQ7A 4OX9L 3KFUA 4FP5D 4L63B 2F3IA 5IP7G 1EY0A 4RKLA 2IJ0A 1EQVA 3A5ZB 1XJVA 4P73A 3HKZB 1DOLA 2R7ZG 5E7NA 3LGJA 1LTSD 4YWKA 3FDTA 5HGQA 4B9XA 1QZGA 1UNSA 1YITA 3NBHA 1D6EC 2VB3X 5C5MA 5A2QL 1HNXQ 2CHBD 1CA5A 1GXDC 2DUDA 1H9SA 1V1QA 2RKSA 3TZUA 3PUWA 2B63B 2F0TA 4YY3Q 4NPSA 1XPUA 1F9QA 4X6AH 2XWJB 1SYGA 3FKIB 4HSPA 4DU9A 3IKJA 1WTWA 1YBYA 1VQJA 4C1NK 4GS3A 4JI6Q 3CCEA 4A3EB 2SDFA 4LWCA 2E2IH 3FPUB 1CKNB 5G3LF 3I90A 4HSVA 1N8RC 1JQYD 4DV2L 4IALA 2K50A 4LF9L 2EE1A 3J7ZC 3STBC 4YIJA 1P8LA 5GROA 3KDFA 4C1NI 4POFA 4RH6A 2VS1A 2WAQE 3MTSA 2D0PA 1Y1WH 2ZXPA 2NVTB 4V190 5KNBA 5I9PA 1VMPA 4EX5A 4C3HB 1P16A 2ASBA 3HOYG 3U4VA 4FF4A 3BVMA 2EXDA 1L0XB 1X65A 2B2YA 1SJED 3HOWG 3PO2H 4K0KL 3JAMi 3A8JE 3K7AB 3M4YA 4F88A 1ENCA 1KDCA 4DK3C 1I50H 1WVLA 4C3IB 1EQTA 4A3GB 1JOQA 4K8JA 5JOBA 1PHJA 5FOBB 2A19A 1UEAB 3SDZA 1CHPD 3ICEA 5EAYA 4CBVA 4IFDJ 4DUZQ 1V43A 4GKJQ 1LYLA 1PTOD 4A3BH 1HQMC 1SXTA 1X54A 3HOUB 3VR5A 3NBHB 3I73A 1M1KC 1H9SB 2J7ZA 1QB5D 2K5HA 3J7A5 1GUGA 1IKMA 2JA7H 2CW0D 4A3FG 2ID0A 3HKZE 4X64L 3T13A 1EZ6A 1TXYA 1XYIA 4UPAA 3IFDA 4HR7B 4JI8Q 3H0GB 1XTCD 4LUZA 1RTOA 1Z6HA 1Q81C 4BY7B 1VQ9A 4G7ZC 3D4DA 2JA9A 4QQBX 2WIIB 1VQLA 1SBBB 3LNNA 2NYZD 1D5MC 2N8NA 1VQGA 2WINB 3CC7A 1RKNA 5C44G 5EKKA 3S2DB 2K33A 1LV9A 2UUCL 3TS2A 4DUYQ 3KYHC 1WOCA 3FP9A 5J1ZA 2CQAA 1L0YB 3ONAB 4P71A 5LMUQ 4PQXA 1LTID 4GKKL 3H3VI 3KDFB 1WCMH 1EQQA 1TWGB 2PI2A 3DHQA 3CQZH 3T1HQ 3J81j 1PZKD 2HIVA 5EKLA 3BZKA 1PH8A 2CFMA 5EBDA 1IL2A 1ET9A 1KLUD 4ZKBB 1VQOA 2BH8A 3MXUA 5M5WB 4X62Q 1KLGD 2QF7A 2GN5A 2RDGA 4YCWA 4XQJA 4IJHA 2ZXOA 1CZGA 3LWUA 1KDAA 2ICIA 2PMZB 1IYVA 3S1NB 5C4XB 3UDIA 3DWPA 4WRDA 4ZUJA 1PRTB 1U0LA 2RVLA 1YNNC 1PH7A 2Z4IA 1O80A 5JJIA 5D65A 1Z9FA 5IGBA 4DV0L 4GN4B 1JB3A 4HJ9A 1HNZL 5JJKA 4DV1L 5HY6A 2DNEA 1XMQQ 3S24A 3I4MH 4CDEC 2BA1A 1I6VC 1EY5A 2WB1B 3FRPB 3HOVB 1LTGD 1F2MA 2VUMB 4KN7C 1B4OA 4QF4A 4X3KA 1SYFA 3QWNA 4A3EH 3OSOA 3S14H 5IYDH 1DGSA 4NB3A 1TS4A 5I9OA 1MKHA 4KJNA 5IP9H 3A54A 3CF5A 1GOZA 2EYLA 3AFPA 2NWGA 3FMCA 1LACA 2DNCA 2KA7A 4N9PA 1A6XA 1EY6A 3F2BA 4O0AA 4RCNA 4LF4L 3VR3A 1N33L 4HMIA 2LSSA 3ZJYC 2OT2A 5M3MG 5AFWA 1CM9A 1H9JA 1NBWA 4NXML 1Q3LA 2JSOA 2TSSA 4R4OA 1X9NA 1BR9A 3J80c 2HCCA 3E5SA 5ELCA 2MFIA 4BA1I 4A3KB 1E2ZA 4BY1G 1I3QH 3NE5B 3MFGA 2KEEA 2F03A 1ONLA 1SJHD 2IX0A 1XNRQ 1E1OA 2YU9H 4YCVA 4IFDH 1F2YA 1TIID 3GTPB 1WI5A 3Q23A 4YWLA 4DR5Q 1EIHA 1AH9A 4H44C 5D3DA 2I5MX 4A3GH 2AUKA 3AFQA 4A3JB 3ND8A 2UXDL 3CPFA 5NUCA 4B3TL 1A63A 2H5XA 1PFBA 5CV9A 4DN4M 2F0PA 1KRSA 2EYHA 1BCPB 1K83B 4FXKC 3UDFA 4HIOA 1F9SA 1DJRD 1HZBA 1VQCA 5CV7A 3M4PA 3ERQA 4JOIA 1W2BA 4IURA 1M8AA 4DR3Q 5IYCG 2KCCA 5FLXL 3JAML 4JI2Q 2AQ3B 1TKWB 3WOFA 3OMGA 4A93H 3I2ZA 3PO3G 3RZDH 3H0GH 3TREA 1DYQA 1L1OA 5IGFA 1HUMA 3OIQA 4AIMA 1ET6A 4AQYL 1PFNA 3I4NB 1GKHA 1MHWC 2WB1E 1K3BC 3BDOA 4P74A 1S72A 1WD1A 4LNQA 3S1QB 1S5CD 3L3OC 4Y7NB 4RA8A 1YVCA 4CJ1B 3PUXA 1H95A 4Q0FA 4ODGA 1M90C 1Y8NB 1N32Q 4AYBG 2F3WA 2VQFQ 2JA5H 1YI2A 1PVOA 3RLNA 2XWBB 2B2UC 4R8IA 4JV5Q 4DAPA 1GJXA 3C1FA 1VQ5A 2QKIC 5JVH3 1TS2A 2EJFC 3UI2A 2H4OA 1I4GA 3PMFA 1DOMA 2G9HD 4ZLTF 3I72A 3KOJA 2UU9Q 1CZWA 2YV5A 2PI2E 5C4XH 1TWAB 1TWCB 4N8FA 5AJ3L 5CC4A 5IODA 5JEAH 1U5KA 1K0RA 2E5LL 4P75A 3GTJB 1MJCA 1Y1WG 3BZCA 3P1HA 4LF7L 1BBWA 1SNPA 2Q2HA 2ZJRA 3T4AC 1AN8A 1GUTA 5EPLA 2F4VL 4X66L 1NTGA 3HOVH 4ZQ3A 3S15B 3J80E 4OHJA 4OO1H 2EYOA 3H6MA 2GVAA 5IY0A 3PO2G 4DV6L 4F7XA 3BYTB 3BVZA 3CHBD 5C0XJ 1JE4A 3CCMA 5IWAL 2UXBQ 3S2HH 1HTPA 2F0UA 2EY2A 4A3IH 2OF1A 2DJFC 2RSOA 1L1OB 1NAPA 1PH2A 2P5ZX 2CCZA 3SK4A 1X55A 2YTXA 1SROA 1PZID 4ULLA 1KDBA 1BUVT 1X3QA 4DV2Q 4MZ9A 4A3BG 4LF9Q 4JW0A 1HZ9A 4ZRZA 3S16B 4YWMA 1X3EA 3GV6A 3MWYW 1QNUA 4LAAA 1R9TH 4UDUC 2JA7G 1S5ED 1T9HA 2F0JA 1A0IA 4XT1B 2YTVA 5ELOA 1XMOQ 3HOZB 1PTOB 2JYOA 4A3CH 4R8NA 4KKUA 1L2FA 3K5MA 4LW1A 3NPPA 3F2DA 1EEID 3NWSA 2K5WA 2E76C 1IW7C 4BBSH 5M3FH 2KVMA 2E2HB 4DA2A 1SR3A 4HJ8A 2RDHA 1A8VA 1SMYC 5TSSA 5GAHC 4A3JH 2IX3A 2CH4W 2EY5A 5CYUA 1YNJD 1QWYA 1TWFB 4RGOS 1V9PA 1WCMG 4AH6A 5I6YA 4G7OC 3A0JA 2TMPA 4OELB 1PLFA 3S1RB 1G291 2B3GA 2QILA 4KHVA 4XT3B 2B2VA 1JORA 1PRTD 4LMQD 2R92H 2ZJPA 4DR7L 3EJIA 1LM0A 2PZUA 3M4OB 1NMGA 2A6HC 4P72A 3VA5A 5KNDA 1HRJA 2EYJA 5IT9L 5H1SE 1SFOB 1ZKOA 3NHHA 4IUTA 4QGUA 5JJLA 3T16A 2YYZA 2K04A 2JA6B 3DXJC 1E1TA 2IT1A 4EQPA 1JMCA 5KIXA 3VDYA 2A5HA 1O7IA 5DNFA 1STAA 4LF6L 4GLVB 1S4ZA 5EPJA 3RNUA 2F0KA 3I4MG 1GHJA 2Q2TA 2E2JB 4J1MA 4JI5L 3PGZA 3G7LA 3PV0A 5T1IA 4LFBL 1A3VA 1I4PA 3CXCA 2PQAA 1PRTF 1Q8IA 3OW7A 2ES2A 4GKKQ 3S9WA 4FXDA 1Q12A 3I4LA 1LTRD 3GTKH 1AE3A 3GTLH 3W1BA 5IP9G 1CQVA 2OWOA 4XXEA 1MSGA 2FXQA 2VB2X 5E4WC 2LXKA 1YHQA 4JI7Q 2V4DA 1ILQA 1K8MA 4OIKA 2HD3A 4N8X1 3J81L 1BQQT 3AQQA 5IOCA 4IOAA 2MPMA 5CV6A 2UUAL 4IPGA 3TN2A 1T5XD 2GA4B 1VQMA 4KY5A 1FGBD 2K32A 2Y0SG 2AUJD 1PDQA 4I7ZC 2PO4A 1BCPD 1V1OA 1XNQQ 4RFBA 3KF8A 3CCJA 2R7FA 5ELEA 4BXXH 5M5YH 1PFSA 4JPBW 2IHEA 4NXNQ 1BKBA 1KNEA 3KUPA 4O1NA 4HIMA 3HGBA 2XNAC 3E9IA 4L8JA 5I4DA 3E0JA 1GUNA 4JCVE 2XVSA 1NR4A 3SK8A 1HNWL 4LFCL 1UUPA 1X32A 5GAGC 5CBEE 2EOTA 3I55A 1BO0A 1HA5A 3M4QA 4DK6C 4CJ0B 3WOEA 3K81C 3CPWA 1GUWA 2I5LX 1MJEA 3V2TA 1WTOA 4UP7A 1YJWA 1F9RA 3R3OA 1I4XA 1EWIA 1TWHB 1BOSA 1E0BA 1QCBD 2B2YC 2H1EA 1K8GA 4A93G 1YHBA 3Q24A 5C4JB 5F2DA 3IFTA 4A76A 2IL8A 1WD0A 2B29A 1JC7A 2PQAB 1KD1C 1AP0A 4DR6L 3G6EA 3W3AA 2IW3A 1EUJA 4RG1A 3I4OA 1K3RA 4IFDI 2HT1A 3BYYB 1XWEA 5HURA 3O13A 2B8GA 2F0SA 3A5UA 4KHPQ 1N34Q 4WFN3 1IXRA 4TKOB 3D31A 4DV4Q 4JC0A 1N36L 1B2TA 2RSNA 3EN2A 2Q2UA 3M85A 1R4PB 3KK7A 1WTHA 1ENAA 3HP3A 2UXDQ 3RN2A 3R2IA 2JA5G 2AQ1B 2XRSD 3V05A 4L6TB 2ZM6L 1STHA 5FKAC 4H7BA 3M4OH 1XPOA 1QVFA 3OHXC 2JA8H 1H9MA 3TP7A 3NTKA 3KF8B 2AKWB 2OTJA 2LS01 4TQUS 2LKVA 2NUCA 2F0IA 2QDBA 4EQNA 1CT1D 2R61A 1Q82C 4C3JB 4BBRH 5JEAG 1QVCA 2ZTCA 4BWGB 3F2CA 2G5DA 1YEZA 4I7AA 4JYAL 1GO3E 3GTGB 1SDFA 2R93H 3SE0A 1S5FD 1YHAA 1WTPA 1H9RA 1VQHA 4OXPA 4KJOA 4ALPA 4ZYSA 1Q1EA 5ELDA 4LFAL 5K5PA 4RCOA 1MBYA 2BE5D 3G6JB 4QL5A 2WB1G 1QJOA 1HQRD 2RA4A 4XTCS 3NWTA 3WDNA 5DEHA 5M5XH 3HOXH 1SAPA 4DV7L 1IYUA 2B39A 4A3IG 3UDGA 3EQLC 3GTOB 2KCTA 1Y1VH 3M3YB 2B2TA 5LMNQ 5LL6S 2Q8IB 1UE6A 3TP5A 1LT4D 2WP8J 4JI3L 5ELNA 3MA2B 1O78A 2C9OA 1DZ1A 3PUZA 1WJJA 3KJPA 2IPKD 3K0XA 3TDQA 1CUKA 1STYA 2Z0SA 2XRQD 3OWFA 2O2LD 3RMHA 1LTLA 5E4XA 1TVXA 1PA6A 4OWWB 4L5RC 3G48A 1SYCA 4CKCA 2I5HA 1U4MA 4A3CG 2RBMA 3GTMH 3UE1A 3TP6A 2N55A 4PNYA 1EIFA 4JI1L 4BBSG 5M3FG 4OO1I 2AWOA 2ZTEA 1B9MA 1JCKB 3MEFA 2A8VA 1Q1BA 1HA6A 5BN3A 2V1CC 2R7ZB 5JJZA 3M7GA 2EVBA 1A2TA 2A6ED 4DF7A 2IX1A 4R4TA 3SR1A 4DV6Q 1HHVA 2PQEA 4MTKA 3SXHA 2E75C 3OTOL 4IUQA 1PTOF 5IWAQ 2XN9C 3D4WA 4DR2Q 1UWVA 3TQYA 5C3EH 4FF1A 3Q6SA 2Z6BA 2E8GA 4YHHQ 3VA7A 5J39A 3D6WA 2R92G 1SNDA 3SHLA 1CQFA 1D1IA 2ENBA 2MO1A 1Q46A 3IL8A 2IWHA 2R6GA 2CKZB 1SYDA 1VQEA 4HCEA 5C4JH 1R4QB 2A68D 2OQ0A 1SLJA 3BDLA 3NUCA 1PH4A 1EQRA 4A3MG 1IBKL 3KJOA 2F4IA 4DXGA 2KQ3A 3B6YA 2KCNA 1EFWA 4ZAIA 1PZJD 3QIAA 1EYAA 1HR0Q 2B63H 2UUBL 1SNCA 5I2XA 3TP8A 4DR1L 4LF8L 2KHJA 2EJMA 1DM0B 3FKIH 4UAIA 4B3RQ 3ZYYX 1SNQA 4DK1A 2BA0A 4KY7A 2BDOA 2A69D 2F0OA 3KBGA 3MXGA 4JOIC 1L0WA 1OTCA 3A7AB 3H94A 3Q0AA 4LK1C 2MUYA 3RR5A 3R8BA 3HOYB 5DM73 3I3CA 3HOWB 3TBIB 5FJ8G 1SE4A 1QUQA 2F3VA 4DGZA 5CORA 1K73C 5J3BA 4DV3L 5L37A 4IPDA 1EYCA 4R4IA 1EIYB 4DR7Q 4K5VA 3DLLA 1VMCA 2NVTH 4JG2A 2NTSA 1SEBD 2EZVA 2F0NA 2LFNA 4C3HH 3CKIB 1SE2A 3MZ5A 1EY4A 3GTGH 3CW2C 4G57A 3QG1A 3OPOA 4J8QA 1PTOC 3EBEA 5HGTA 3KLWA 2RCNA 2Z9HA 2F0DA 4DR4Q 4RGMA 2NVYB 3I91A 4A3FB 4H02A 1IKLA 2HQLA 3K7AH 1FJGL 1LT6D 3CMEA 4LF6Q 1AFPA 1QE6A 2CW0C 1VQDA 2SNSA 5JPMC 1YZ6A 4C3IH 4BXXG 4JBJA 4DV5L 1VQPA 1O7ZA 2KHSA 5K36G 1J9OA
chains in the Genus database with same CATH topology
4LF9Q 5AJ3Q 1HNXL 1HZ9A 1FL0A 2QEXA 4A3KG 4JI5Q 4KI0A 2JJQA 4A3DG 4YWMA 4AYBE 2E5LQ 1X3EA 3BJUA 2NVXH 1N32L 4YY3L 1R9TH 1HZAA 3GO5A 5LMNW 3GTOH 1I94L 2JA7G 3M3YH 3PSIA 1T9HA 4A3DH 1A0IA 2YTVA 4PZ7A 5ELOA 2UXCL 4LF7Q 1XMOQ 2L15A 4A3CH 4DV3Q 3F8TA 3GD7A 3HOUH 1L2FA 4LW1A 4JBKA 2PMZE 1X3GA 3F2DA 3CCRA 3W1GA 4B3SQ 4X66Q 2F4VQ 3HKSA 2LXJA 4A3JG 4BBSH 1NY4A 5M3FH 3SGIA 1SR3A 3T1YQ 4HJ8A 5IYCH 3L2PA 1A8VA 2UU9L 4A3JH 4GNXB 5GAHC 4X65L 2HHHQ 4HJ7A 4IO9A 1PH9A 1IYJB 1SMXA 4DKAC 5IYBH 4BY7H 1G6PA 1WYDA 4LF5L 2A1AA 3PO3H 3CAMA 3I7FA 1C7YA 1VQ7A 1V9PA 1WCMG 4AH6A 4OX9L 3KFUA 3A0JA 2F3IA 5IP7G 4B3MQ 1G291 2B3GA 1SRUA 3S2DH 3A5ZB 1XJVA 1TWHH 4P73A 3AYHB 5IP7H 2VQEQ 1QUQB 3JC66 5E7NA 3LGJA 2R7ZG 4BA2I 4YWKA 1HZCA 2R92H 5HGQA 2ZJPA 4DR7L 3H15A 1QZGA 3E0EA 1LM0A 3J81i 3Q8DA 1YITA 2VW9A 1TWGH 1HNXQ 4JI7L 1NMGA 2MQHA 2DUDA 1S3OA 1V1QA 2VL6A 4P72A 3CCUA 1XPRA 1E22A 5H1SE 3PUWA 4YY3Q 4NPSA 1XPUA 4QGUA 5JJLA 2Q2IA 4APVA 2YYZA 4HJAA 4X6AH 2UXCQ 5IT9c 1E1TA 2IT1A 1JMCA 2JEAI 3I4NG 4XIGS 1YNXA 2KCMA 1YBYA 1VQJA 3VDYA 4GS3A 4HJ5A 3CCQA 3CCEA 4JI6Q 5GQOA 1UEBA 1O7IA 5M5WH 4LWCA 2E2IH 1CKNB 4LF6L 1B8AA 2D62A 2Y0SE 4GLVB 1N8RC 3CC2A 2JA8G 4DV2L 2R7DA 4DPGA 3RNUA 1XNQL 1PH1A 3S1NH 2K50A 1S40A 4LF9L 3J7ZC 4DUZL 3STBC 3I4MG 2Q2TA 1P8LA 4MTNA 4JI5L 3PGZA 5GROA 4GN3B 4GKJL 3PV0A 4LFBL 3KDFA 4GN5A 4POFA 3CXCA 4OX9Q 2PQAA 1L1OC 2VS1A 4NXNL 1Q7YC 2WAQE 1HR0W 2ES2A 4BBRG 4GKKQ 3UE0A 2D0PA 1Y1WH 1Q12A 3GTKH 1AE3A 5JEAJ 3UDXA 3GTLH 3W1BA 5IP9G 2OWOA 4A3LH 1GD7A 3RZOH 2R93G 3ULPA 4B3SL 3L7ZC 2FXQA 3U50C 4EX5A 4QY7A 3ERSX 2LXKA 1YHQA 1P16A 1JJ2A 5IYDH 4JI7Q 1KIXA 2VUMH 4L5QA 1KQSA 3T1YL 4C3JH 4POGA 2NZHA 2ASBA 1GVPA 3HOYG 3U4VA 2EXDA 5C0XG 3AQQA 2ALYB 1X65A 3PF5A 2XGTA 3HOWG 3PO2H 4K0KL 4IOAA 3J81c 5FLMH 3ULJA 3JAMi 3CCSA 4PZ8A 2UUAL 4DK3C 1PYSB 3HOXG 1I50H 3W5OA 4IPGA 4DUYL 4HIDA 5LMUL 1KL9A 1KHIA 1EOVA 1VQMA 1PHJA 1Y1VG 3K8AA 3T1HL 1Q86C 2CQOA 2Y0SG 2A19A 1YJ9A 3ICEA 1XNQQ 2JK8A 3CCJA 1HH2P 5EAYA 2D0OA 1BBUA 4IFDJ 2VZAA 2R7FA 4DUZQ 1V43A 4ME3A 4BXXH 3AEVA 5M5YH 4GKJQ 1LYLA 4A3BH 4LFBQ 1X54A 1PFSA 5DLQE 4KHPL 2IHEA 3NBHB 1N34L 2KENA 2OCEA 4A3KH 1PV4A 1M1KC 4NXNQ 1BKBA 2K5HA 1X3FA 3J7A5 4DNIA 4DV4L 4HIMA 2WAQG 4LUVA 3ER0A 2JA7H 1IBLQ 3E9IA 4A3FG 2ID0A 3HKZE 4JI6L 4JCVE 4X64L 1KAWA 1TXYA 2Z6KC 4UPAA 1HNWL 4LFCL 4JI8Q 5GAGC 4JYAQ 4LUZA 4PG3A 1Q81C 4WJ4A 3GTPH 3I55A 1VQ9A 3M4QA 2CWPA 2JA9A 4DK6C 3IRBA 3MXNB 4QQBX 3K81C 1XTDA 1VQLA 5C0XI 3CPWA 2I5LX 1MJEA 2N8NA 1VQGA 3CC7A 3TS0A 4LFAQ 4K0KQ 5C44G 1N9WA 3K7UC 4UP7A 1YJWA 4RMFA 1VQIA 3CCLA 1RL2A 4KLKA 1EWIA 2UUAQ 3HOZG 1K83H 2UUCL 1BVSA 3TS2A 4DUYQ 3KYHC 1RIPA 1W3SA 1WOCA 3FP9A 4P71A 1K8GA 5LMUQ 4A93G 1WFQA 1YHBA 4MNOA 1PH5A 1EYGA 4GKKL 1C0AA 3H3VI 1VQFA 3KDFB 1WCMH 1EQQA 2PI2A 4A76A 2B29A 2PQAB 1KD1C 3CQZH 3T1HQ 3J81j 1FVIA 4DR6L 4DV7Q 2HIVA 3BZKA 1UE1A 3G6EA 1EUJA 5C3EG 4RG1A 2CFMA 3I4OA 1PH8A 1K3RA 5GADC 3TRZA 2R7ZH 4IFDI 1VQ4A 2HT1A 1IL2A 4DAYB 1AE2A 2GVBA 3A5UA 4KHPQ 1VQOA 2BH8A 3U58A 1N34Q 1VQ8A 2MNAA 1IXRA 4R4CA 4YCUA 2IHFA 3D31A 3J80i 4JC0A 1CKMA 4X62Q 4DV4Q 3EN2A 3EIVA 1N36L 1JJGA 2Q2UA 2GN5A 2WFWA 3PUVA 4YCWA 3M85A 4IJHA 4X64Q 3HKZG 3I4NH 4A75A 2N3SA 1HNWQ 4JI4Q 4LFCQ 2UXDQ 3UDIA 1Q8KA 1UE7A 3RN2A 4Y52H 1U0LA 1JJCB 2JA5G 3S1QH 2NZOA 1PH7A 2ZM6L 2JE6I 1PH3A 3PCOB 1Z9FA 4J15A 5JJIA 4DV0L 4Y7NH 4GN4B 1CKOA 2RHQB 4HJ9A 1HNZL 2B63G 5JJKA 3M4OH 1XPOA 1QVFA 4EQ5A 4DV1L 1VQAA 3E9HA 2JA8H 5LMNL 5HY6A 1XMQQ 2JA6G 1LUZA 3FKIG 3KF8B 2AKWB 2KBNA 2OTJA 4QIWE 3S24A 2UUCQ 1XNRL 3I4MH 4R4QA 4IJLA 2BA1A 4TQUS 4UY8C 1D7QA 1GM5A 4A3EG 1E3PA 5IYDG 2K5NA 3D0FA 1IBLL 1Q82C 4DR6Q 3PIOA 4C2MH 3K80C 1FGUA 4BBRH 2NVQH 5JEAG 1QVCA 2ZTCA 3NELA 4A3EH 3RLFA 3F2CA 2CWAA 3OTOQ 1YEZA 1DGSA 2JEBI 4NB3A 4JI8L 3S14H 4JYAL 3STBD 1GO3E 5IP9H 1MKHA 3KF6A 4HIKA 2R93H 4O2DA 1YHAA 5BR8Q 3CF5A 3AFPA 1VQHA 4KHZA 4OXPA 1VCIA 4ALPA 3CP0A 1TWAH 1TWCH 1Q1EA 4LFAL 1D8LA 3F2BA 1N36Q 4O0AA 4LF4L 4QL5A 3HOYH 3GTJH 2I0QA 2WB1G 1N33L 1SN8A 1QZHA 3CCVA 2LSSA 1MIUA 3ZJYC 5M3MG 3HOWH 1NBWA 4XTCS 1J5EQ 4NXML 4R1JA 4DR3L 5M5XH 2K52A 3HOXH 4R4OA 1X9NA 3J80c 2OQKA 1NMFA 2ZM6Q 4DV7L 2MFIA 4DV0Q 4BA1I 4L5SA 1IBKQ 4A3IG 3UDGA 1I6HH 3H3VH 1HNZQ 2KCTA 1Y1VH 1UE5A 1X6OA 4BY1G 4DV1Q 1VQNA 3S15H 1I3QH 4DR2L 5LMNQ 4IFDG 4QJFA 5GAEC 4GOPA 1UE6A 2UUBQ 2AHOB 2IX0A 2WP8J 4JI3L 1E1OA 1XNRQ 5ELNA 4YHHL 2YU9H 4YCVA 4LF8Q 3ULLA 1E24A 1Y14B 3PUZA 1WJJA 4X62L 3KJPA 4A3GG 2IY5B 4LUOA 1WI5A 4DR5Q 4YWLA 3K0XA 4PMWA 1AH9A 3OYYA 3OW2A 1NE3A 1CUKA 1VQBA 2I5MX 4A3GH 2RF4A 3AFQA 2Z0SA 2NVYH 1KXLA 4JI4L 2N78A 2UXDL 3CPFA 4B3TL 4A3FH 1A63A 3F1ZA 2H5XA 1LTLA 1PA6A 4OWWB 4L5RC 1NJIC 1KC8C 3G48A 4OONA 1KRSA 3RN5A 2QGQA 2I5HA 3CMAA 2RHSB 2ZTDA 2VQFL 4A3CG 2VY3A 3HOUG 2HIXA 3UDFA 4HIOA 3UE1A 3GTMH 4JV5L 4LF4Q 3M9BA 3S16H 4UP8A 1OXVA 1XMQL 1HZBA 1OXUA 1VQCA 1N33Q 4JI1L 1EIFA 2K75A 4DAMA 1HR0L 3L0OA 3M4PA 3RLOA 1IBMQ 5M3FG 3FHWA 2AWOA 1OXSC 2ZTEA 4JOIA 1SE8A 5C44H 1W2BA 1PH6A 4NXMQ 3MEFA 4DR3Q 1Q1BA 5IYCG 2A8VA 2N49A 2AWNA 2V1CC 4JI2Q 3HOZH 4B3RL 3H0GG 4A93H 5FLXc 1OXTA 3G4SA 3JAMc 4R4TA 4UP9A 5IYBG 4DV6Q 4BY7G 3G71A 1IZ6A 1CSPA 3I2ZA 3PO3G 4FDBA 3OTOL 2NN6G 3RZDH 3H0GH 3TREA 5IWAQ 2E2HH 1L1OA 4DR2Q 1ASYA 1UWVA 3TQYA 5C3EH 5BR8L 4IOCA 1VQ6A 4AIMA 4JI3Q 2E8GA 2F52A 1JT8A 4AQYL 4IPHA 4YHHQ 3KF6B 1GKHA 3PUYA 3PF4A 4L5TA 4GOPC 2WB1E 4P74A 2R92G 1S72A 3GTQH 1FJGQ 1TWFH 4LNQA 1A62A 2MO1A 1Q46A 2R6GA 1J5EL 4JI0Q 3HFZB 2BH2A 2CKZB 4DV5Q 3S1RH 1YVCA 3CC4A 1QVGA 3PUXA 4B3TQ 1VQEA 5C4JH 2YTYA 1H95A 2OQ0A 1YIJA 1M90C 1SLJA 1PH4A 1EQRA 1Z47A 2KHIA 4A3MG 3CD6A 1IBKL 4AYBG 3KJOA 1N32Q 2VQFQ 2JA5H 4WJ3M 3B6YA 1B7YB 1YI2A 1I94Q 4A3BG 1PVOA 2UXBL 3RLNA 1EFWA 4JV5Q 2JQOA 4A3MH 4JBMA 1VQ5A 4JI1Q 1SFOH 1HR0Q 2UUBL 2B63H 4BBSG 2VNUD 3NENA 4DR4L 4DR1L 4OO1I 3DM3A 4LF8L 4JBWA 3PIPA 2KHJA 1JB7A 2JA6H 4GOPB 3FKIH 2K5VA 4GNXA 4OWXB 4B3RQ 2BA0A 4JOIC 1J6QA 4DR5L 5C4XG 4IPCA 1OTCA 1L0WA 3A74A 3KOJA 2DGYA 2OTLA 2UU9Q 3BU2A 4X65Q 2NN6I 1G51A 2YV5A 2PI2E 5C4XH 4TVAB 1KRTA 3TEHB 5AJ3L 3RR5A 1U5KA 3GDEA 4LF5Q 1K0RA 2E5LL 4P75A 1JE5A 1OXXK 1MJCA 4AQYQ 3BZCA 1Y1WG 1C9OA 4A4IA 5FJ8G 1VQKA 1QUQA 2AMCB 2E2JH 2Z6KA 3U4ZA 4A3LG 1K73C 4LF7L 1XMOL 1YJNA 1BBWA 5J3BA 2Q2HA 1PYBA 3HOVG 2ZJRA 4DV3L 3M7NA 5FJ8H 4IPDA 1IBML 2EIFA 4R4IA 2VUMG 4OO1G 2MO0A 1EIYB 4DR7Q 2F4VL 4X66L 1NTGA 3DLLA 3HOVH 4JI2L 5M3MH 2NVTH 4JG2A 1X56A 5IE8A 2C35B 2GVAA 5IY0A 3PO2G 4DV6L 3WWVA 2ATWA 3S17H 5C0XJ 1CSQA 4C3HH 5FLMG 2HHHL 4OWTB 3CCMA 2ZJQA 5IWAL 2UXBQ 3S2HH 3GTGH 3CW2C 3NEMA 4A3IH 2EQSA 2QA4A 3EBEA 1E7ZA 3KLWA 1B70B 2RCNA 4BY1H 1CKNA 2K14A 4DR4Q 4DR1Q 1L1OB 1K8AC 1PH2A 2CCZA 4B3ML 1X55A 1ASZA 2YTXA 4H02A 1HJPA 3S1MH 2HQLA 1FJGL 3K7AH 1SROA 3CMEA 1K9MC 4LF6Q 2XTIA 3I56A 1I5FA 2VQEL 1VQDA 4DV2Q 1YZ6A 4C3IH 4BXXG 4JBJA 4MZ9A 4JI0L 4DV5L 2PNHA 1VS0A 4GNXC 4GLAC 4PZ6A 4GLXA 1VQPA 2IX1A 5K36G 2K4KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF9 Q;  5AJ3 Q;  1HNX L;  1HZ9 A;  1FL0 A;  2QEX A;  4A3K G;  4JI5 Q;  4KI0 A;  2JJQ A;  4A3D G;  4YWM A;  4AYB E;  2E5L Q;  1X3E A;  3BJU A;  2NVX H;  1N32 L;  4YY3 L;  1R9T H;  1HZA A;  3GO5 A;  5LMN W;  3GTO H;  1I94 L;  2JA7 G;  3M3Y H;  3PSI A;  1T9H A;  4A3D H;  1A0I A;  2YTV A;  4PZ7 A;  5ELO A;  2UXC L;  4LF7 Q;  1XMO Q;  2L15 A;  4A3C H;  4DV3 Q;  3F8T A;  3GD7 A;  3HOU H;  1L2F A;  4LW1 A;  4JBK A;  2PMZ E;  1X3G A;  3F2D A;  3CCR A;  3W1G A;  4B3S Q;  4X66 Q;  2F4V Q;  3HKS A;  2LXJ A;  4A3J G;  4BBS H;  1NY4 A;  5M3F H;  3SGI A;  1SR3 A;  3T1Y Q;  4HJ8 A;  5IYC H;  3L2P A;  1A8V A;  2UU9 L;  4A3J H;  4GNX B;  5GAH C;  4X65 L;  2HHH Q;  4HJ7 A;  4IO9 A;  1PH9 A;  1IYJ B;  1SMX A;  4DKA C;  5IYB H;  4BY7 H;  1G6P A;  1WYD A;  4LF5 L;  2A1A A;  3PO3 H;  3CAM A;  3I7F A;  1C7Y A;  1VQ7 A;  1V9P A;  1WCM G;  4AH6 A;  4OX9 L;  3KFU A;  3A0J A;  2F3I A;  5IP7 G;  4B3M Q;  1G29 1;  2B3G A;  1SRU A;  3S2D H;  3A5Z B;  1XJV A;  1TWH H;  4P73 A;  3AYH B;  5IP7 H;  2VQE Q;  1QUQ B;  3JC6 6;  5E7N A;  3LGJ A;  2R7Z G;  4BA2 I;  4YWK A;  1HZC A;  2R92 H;  5HGQ A;  2ZJP A;  4DR7 L;  3H15 A;  1QZG A;  3E0E A;  1LM0 A;  3J81 i;  3Q8D A;  1YIT A;  2VW9 A;  1TWG H;  1HNX Q;  4JI7 L;  1NMG A;  2MQH A;  2DUD A;  1S3O A;  1V1Q A;  2VL6 A;  4P72 A;  3CCU A;  1XPR A;  1E22 A;  5H1S E;  3PUW A;  4YY3 Q;  4NPS A;  1XPU A;  4QGU A;  5JJL A;  2Q2I A;  4APV A;  2YYZ A;  4HJA A;  4X6A H;  2UXC Q;  5IT9 c;  1E1T A;  2IT1 A;  1JMC A;  2JEA I;  3I4N G;  4XIG S;  1YNX A;  2KCM A;  1YBY A;  1VQJ A;  3VDY A;  4GS3 A;  4HJ5 A;  3CCQ A;  3CCE A;  4JI6 Q;  5GQO A;  1UEB A;  1O7I A;  5M5W H;  4LWC A;  2E2I H;  1CKN B;  4LF6 L;  1B8A A;  2D62 A;  2Y0S E;  4GLV B;  1N8R C;  3CC2 A;  2JA8 G;  4DV2 L;  2R7D A;  4DPG A;  3RNU A;  1XNQ L;  1PH1 A;  3S1N H;  2K50 A;  1S40 A;  4LF9 L;  3J7Z C;  4DUZ L;  3STB C;  3I4M G;  2Q2T A;  1P8L A;  4MTN A;  4JI5 L;  3PGZ A;  5GRO A;  4GN3 B;  4GKJ L;  3PV0 A;  4LFB L;  3KDF A;  4GN5 A;  4POF A;  3CXC A;  4OX9 Q;  2PQA A;  1L1O C;  2VS1 A;  4NXN L;  1Q7Y C;  2WAQ E;  1HR0 W;  2ES2 A;  4BBR G;  4GKK Q;  3UE0 A;  2D0P A;  1Y1W H;  1Q12 A;  3GTK H;  1AE3 A;  5JEA J;  3UDX A;  3GTL H;  3W1B A;  5IP9 G;  2OWO A;  4A3L H;  1GD7 A;  3RZO H;  2R93 G;  3ULP A;  4B3S L;  3L7Z C;  2FXQ A;  3U50 C;  4EX5 A;  4QY7 A;  3ERS X;  2LXK A;  1YHQ A;  1P16 A;  1JJ2 A;  5IYD H;  4JI7 Q;  1KIX A;  2VUM H;  4L5Q A;  1KQS A;  3T1Y L;  4C3J H;  4POG A;  2NZH A;  2ASB A;  1GVP A;  3HOY G;  3U4V A;  2EXD A;  5C0X G;  3AQQ A;  2ALY B;  1X65 A;  3PF5 A;  2XGT A;  3HOW G;  3PO2 H;  4K0K L;  4IOA A;  3J81 c;  5FLM H;  3ULJ A;  3JAM i;  3CCS A;  4PZ8 A;  2UUA L;  4DK3 C;  1PYS B;  3HOX G;  1I50 H;  3W5O A;  4IPG A;  4DUY L;  4HID A;  5LMU L;  1KL9 A;  1KHI A;  1EOV A;  1VQM A;  1PHJ A;  1Y1V G;  3K8A A;  3T1H L;  1Q86 C;  2CQO A;  2Y0S G;  2A19 A;  1YJ9 A;  3ICE A;  1XNQ Q;  2JK8 A;  3CCJ A;  1HH2 P;  5EAY A;  2D0O A;  1BBU A;  4IFD J;  2VZA A;  2R7F A;  4DUZ Q;  1V43 A;  4ME3 A;  4BXX H;  3AEV A;  5M5Y H;  4GKJ Q;  1LYL A;  4A3B H;  4LFB Q;  1X54 A;  1PFS A;  5DLQ E;  4KHP L;  2IHE A;  3NBH B;  1N34 L;  2KEN A;  2OCE A;  4A3K H;  1PV4 A;  1M1K C;  4NXN Q;  1BKB A;  2K5H A;  1X3F A;  3J7A 5;  4DNI A;  4DV4 L;  4HIM A;  2WAQ G;  4LUV A;  3ER0 A;  2JA7 H;  1IBL Q;  3E9I A;  4A3F G;  2ID0 A;  3HKZ E;  4JI6 L;  4JCV E;  4X64 L;  1KAW A;  1TXY A;  2Z6K C;  4UPA A;  1HNW L;  4LFC L;  4JI8 Q;  5GAG C;  4JYA Q;  4LUZ A;  4PG3 A;  1Q81 C;  4WJ4 A;  3GTP H;  3I55 A;  1VQ9 A;  3M4Q A;  2CWP A;  2JA9 A;  4DK6 C;  3IRB A;  3MXN B;  4QQB X;  3K81 C;  1XTD A;  1VQL A;  5C0X I;  3CPW A;  2I5L X;  1MJE A;  2N8N A;  1VQG A;  3CC7 A;  3TS0 A;  4LFA Q;  4K0K Q;  5C44 G;  1N9W A;  3K7U C;  4UP7 A;  1YJW A;  4RMF A;  1VQI A;  3CCL A;  1RL2 A;  4KLK A;  1EWI A;  2UUA Q;  3HOZ G;  1K83 H;  2UUC L;  1BVS A;  3TS2 A;  4DUY Q;  3KYH C;  1RIP A;  1W3S A;  1WOC A;  3FP9 A;  4P71 A;  1K8G A;  5LMU Q;  4A93 G;  1WFQ A;  1YHB A;  4MNO A;  1PH5 A;  1EYG A;  4GKK L;  1C0A A;  3H3V I;  1VQF A;  3KDF B;  1WCM H;  1EQQ A;  2PI2 A;  4A76 A;  2B29 A;  2PQA B;  1KD1 C;  3CQZ H;  3T1H Q;  3J81 j;  1FVI A;  4DR6 L;  4DV7 Q;  2HIV A;  3BZK A;  1UE1 A;  3G6E A;  1EUJ A;  5C3E G;  4RG1 A;  2CFM A;  3I4O A;  1PH8 A;  1K3R A;  5GAD C;  3TRZ A;  2R7Z H;  4IFD I;  1VQ4 A;  2HT1 A;  1IL2 A;  4DAY B;  1AE2 A;  2GVB A;  3A5U A;  4KHP Q;  1VQO A;  2BH8 A;  3U58 A;  1N34 Q;  1VQ8 A;  2MNA A;  1IXR A;  4R4C A;  4YCU A;  2IHF A;  3D31 A;  3J80 i;  4JC0 A;  1CKM A;  4X62 Q;  4DV4 Q;  3EN2 A;  3EIV A;  1N36 L;  1JJG A;  2Q2U A;  2GN5 A;  2WFW A;  3PUV A;  4YCW A;  3M85 A;  4IJH A;  4X64 Q;  3HKZ G;  3I4N H;  4A75 A;  2N3S A;  1HNW Q;  4JI4 Q;  4LFC Q;  2UXD Q;  3UDI A;  1Q8K A;  1UE7 A;  3RN2 A;  4Y52 H;  1U0L A;  1JJC B;  2JA5 G;  3S1Q H;  2NZO A;  1PH7 A;  2ZM6 L;  2JE6 I;  1PH3 A;  3PCO B;  1Z9F A;  4J15 A;  5JJI A;  4DV0 L;  4Y7N H;  4GN4 B;  1CKO A;  2RHQ B;  4HJ9 A;  1HNZ L;  2B63 G;  5JJK A;  3M4O H;  1XPO A;  1QVF A;  4EQ5 A;  4DV1 L;  1VQA A;  3E9H A;  2JA8 H;  5LMN L;  5HY6 A;  1XMQ Q;  2JA6 G;  1LUZ A;  3FKI G;  3KF8 B;  2AKW B;  2KBN A;  2OTJ A;  4QIW E;  3S24 A;  2UUC Q;  1XNR L;  3I4M H;  4R4Q A;  4IJL A;  2BA1 A;  4TQU S;  4UY8 C;  1D7Q A;  1GM5 A;  4A3E G;  1E3P A;  5IYD G;  2K5N A;  3D0F A;  1IBL L;  1Q82 C;  4DR6 Q;  3PIO A;  4C2M H;  3K80 C;  1FGU A;  4BBR H;  2NVQ H;  5JEA G;  1QVC A;  2ZTC A;  3NEL A;  4A3E H;  3RLF A;  3F2C A;  2CWA A;  3OTO Q;  1YEZ A;  1DGS A;  2JEB I;  4NB3 A;  4JI8 L;  3S14 H;  4JYA L;  3STB D;  1GO3 E;  5IP9 H;  1MKH A;  3KF6 A;  4HIK A;  2R93 H;  4O2D A;  1YHA A;  5BR8 Q;  3CF5 A;  3AFP A;  1VQH A;  4KHZ A;  4OXP A;  1VCI A;  4ALP A;  3CP0 A;  1TWA H;  1TWC H;  1Q1E A;  4LFA L;  1D8L A;  3F2B A;  1N36 Q;  4O0A A;  4LF4 L;  4QL5 A;  3HOY H;  3GTJ H;  2I0Q A;  2WB1 G;  1N33 L;  1SN8 A;  1QZH A;  3CCV A;  2LSS A;  1MIU A;  3ZJY C;  5M3M G;  3HOW H;  1NBW A;  4XTC S;  1J5E Q;  4NXM L;  4R1J A;  4DR3 L;  5M5X H;  2K52 A;  3HOX H;  4R4O A;  1X9N A;  3J80 c;  2OQK A;  1NMF A;  2ZM6 Q;  4DV7 L;  2MFI A;  4DV0 Q;  4BA1 I;  4L5S A;  1IBK Q;  4A3I G;  3UDG A;  1I6H H;  3H3V H;  1HNZ Q;  2KCT A;  1Y1V H;  1UE5 A;  1X6O A;  4BY1 G;  4DV1 Q;  1VQN A;  3S15 H;  1I3Q H;  4DR2 L;  5LMN Q;  4IFD G;  4QJF A;  5GAE C;  4GOP A;  1UE6 A;  2UUB Q;  2AHO B;  2IX0 A;  2WP8 J;  4JI3 L;  1E1O A;  1XNR Q;  5ELN A;  4YHH L;  2YU9 H;  4YCV A;  4LF8 Q;  3ULL A;  1E24 A;  1Y14 B;  3PUZ A;  1WJJ A;  4X62 L;  3KJP A;  4A3G G;  2IY5 B;  4LUO A;  1WI5 A;  4DR5 Q;  4YWL A;  3K0X A;  4PMW A;  1AH9 A;  3OYY A;  3OW2 A;  1NE3 A;  1CUK A;  1VQB A;  2I5M X;  4A3G H;  2RF4 A;  3AFQ A;  2Z0S A;  2NVY H;  1KXL A;  4JI4 L;  2N78 A;  2UXD L;  3CPF A;  4B3T L;  4A3F H;  1A63 A;  3F1Z A;  2H5X A;  1LTL A;  1PA6 A;  4OWW B;  4L5R C;  1NJI C;  1KC8 C;  3G48 A;  4OON A;  1KRS A;  3RN5 A;  2QGQ A;  2I5H A;  3CMA A;  2RHS B;  2ZTD A;  2VQF L;  4A3C G;  2VY3 A;  3HOU G;  2HIX A;  3UDF A;  4HIO A;  3UE1 A;  3GTM H;  4JV5 L;  4LF4 Q;  3M9B A;  3S16 H;  4UP8 A;  1OXV A;  1XMQ L;  1HZB A;  1OXU A;  1VQC A;  1N33 Q;  4JI1 L;  1EIF A;  2K75 A;  4DAM A;  1HR0 L;  3L0O A;  3M4P A;  3RLO A;  1IBM Q;  5M3F G;  3FHW A;  2AWO A;  1OXS C;  2ZTE A;  4JOI A;  1SE8 A;  5C44 H;  1W2B A;  1PH6 A;  4NXM Q;  3MEF A;  4DR3 Q;  1Q1B A;  5IYC G;  2A8V A;  2N49 A;  2AWN A;  2V1C C;  4JI2 Q;  3HOZ H;  4B3R L;  3H0G G;  4A93 H;  5FLX c;  1OXT A;  3G4S A;  3JAM c;  4R4T A;  4UP9 A;  5IYB G;  4DV6 Q;  4BY7 G;  3G71 A;  1IZ6 A;  1CSP A;  3I2Z A;  3PO3 G;  4FDB A;  3OTO L;  2NN6 G;  3RZD H;  3H0G H;  3TRE A;  5IWA Q;  2E2H H;  1L1O A;  4DR2 Q;  1ASY A;  1UWV A;  3TQY A;  5C3E H;  5BR8 L;  4IOC A;  1VQ6 A;  4AIM A;  4JI3 Q;  2E8G A;  2F52 A;  1JT8 A;  4AQY L;  4IPH A;  4YHH Q;  3KF6 B;  1GKH A;  3PUY A;  3PF4 A;  4L5T A;  4GOP C;  2WB1 E;  4P74 A;  2R92 G;  1S72 A;  3GTQ H;  1FJG Q;  1TWF H;  4LNQ A;  1A62 A;  2MO1 A;  1Q46 A;  2R6G A;  1J5E L;  4JI0 Q;  3HFZ B;  2BH2 A;  2CKZ B;  4DV5 Q;  3S1R H;  1YVC A;  3CC4 A;  1QVG A;  3PUX A;  4B3T Q;  1VQE A;  5C4J H;  2YTY A;  1H95 A;  2OQ0 A;  1YIJ A;  1M90 C;  1SLJ A;  1PH4 A;  1EQR A;  1Z47 A;  2KHI A;  4A3M G;  3CD6 A;  1IBK L;  4AYB G;  3KJO A;  1N32 Q;  2VQF Q;  2JA5 H;  4WJ3 M;  3B6Y A;  1B7Y B;  1YI2 A;  1I94 Q;  4A3B G;  1PVO A;  2UXB L;  3RLN A;  1EFW A;  4JV5 Q;  2JQO A;  4A3M H;  4JBM A;  1VQ5 A;  4JI1 Q;  1SFO H;  1HR0 Q;  2UUB L;  2B63 H;  4BBS G;  2VNU D;  3NEN A;  4DR4 L;  4DR1 L;  4OO1 I;  3DM3 A;  4LF8 L;  4JBW A;  3PIP A;  2KHJ A;  1JB7 A;  2JA6 H;  4GOP B;  3FKI H;  2K5V A;  4GNX A;  4OWX B;  4B3R Q;  2BA0 A;  4JOI C;  1J6Q A;  4DR5 L;  5C4X G;  4IPC A;  1OTC A;  1L0W A;  3A74 A;  3KOJ A;  2DGY A;  2OTL A;  2UU9 Q;  3BU2 A;  4X65 Q;  2NN6 I;  1G51 A;  2YV5 A;  2PI2 E;  5C4X H;  4TVA B;  1KRT A;  3TEH B;  5AJ3 L;  3RR5 A;  1U5K A;  3GDE A;  4LF5 Q;  1K0R A;  2E5L L;  4P75 A;  1JE5 A;  1OXX K;  1MJC A;  4AQY Q;  3BZC A;  1Y1W G;  1C9O A;  4A4I A;  5FJ8 G;  1VQK A;  1QUQ A;  2AMC B;  2E2J H;  2Z6K A;  3U4Z A;  4A3L G;  1K73 C;  4LF7 L;  1XMO L;  1YJN A;  1BBW A;  5J3B A;  2Q2H A;  1PYB A;  3HOV G;  2ZJR A;  4DV3 L;  3M7N A;  5FJ8 H;  4IPD A;  1IBM L;  2EIF A;  4R4I A;  2VUM G;  4OO1 G;  2MO0 A;  1EIY B;  4DR7 Q;  2F4V L;  4X66 L;  1NTG A;  3DLL A;  3HOV H;  4JI2 L;  5M3M H;  2NVT H;  4JG2 A;  1X56 A;  5IE8 A;  2C35 B;  2GVA A;  5IY0 A;  3PO2 G;  4DV6 L;  3WWV A;  2ATW A;  3S17 H;  5C0X J;  1CSQ A;  4C3H H;  5FLM G;  2HHH L;  4OWT B;  3CCM A;  2ZJQ A;  5IWA L;  2UXB Q;  3S2H H;  3GTG H;  3CW2 C;  3NEM A;  4A3I H;  2EQS A;  2QA4 A;  3EBE A;  1E7Z A;  3KLW A;  1B70 B;  2RCN A;  4BY1 H;  1CKN A;  2K14 A;  4DR4 Q;  4DR1 Q;  1L1O B;  1K8A C;  1PH2 A;  2CCZ A;  4B3M L;  1X55 A;  1ASZ A;  2YTX A;  4H02 A;  1HJP A;  3S1M H;  2HQL A;  1FJG L;  3K7A H;  1SRO A;  3CME A;  1K9M C;  4LF6 Q;  2XTI A;  3I56 A;  1I5F A;  2VQE L;  1VQD A;  4DV2 Q;  1YZ6 A;  4C3I H;  4BXX G;  4JBJ A;  4MZ9 A;  4JI0 L;  4DV5 L;  2PNH A;  1VS0 A;  4GNX C;  4GLA C;  4PZ6 A;  4GLX A;  1VQP A;  2IX1 A;  5K36 G;  2K4K A; 
#chains in the Genus database with same CATH topology
 1HNX L;  5BN4 A;  4JI5 Q;  4KI0 A;  1ROD A;  2JJQ A;  4A3D G;  3AB9 A;  3BG3 A;  4YY3 L;  1EYD A;  1HZA A;  3GO5 A;  5C44 B;  1I94 L;  3GTO H;  3M3Y H;  4PZ7 A;  4FYD A;  3TSS A;  2B2W A;  3GD7 A;  3HOU H;  3T56 B;  2PMZ E;  1X3G A;  3W1G A;  1Y69 U;  4MN3 A;  2LXJ A;  5M9O A;  3HZX A;  1I4Q A;  5CV5 A;  2PZW A;  3DMU A;  1SYE A;  2HHH Q;  2SNM A;  4IO9 A;  1RTN A;  1IYJ B;  2L9H A;  1SMX A;  3MEH A;  1Y8O B;  5IYB H;  4BY7 H;  4XYO A;  3GTQ B;  3CAM A;  3HG9 A;  3I7F A;  1C7Y A;  1NR2 A;  1AW7 A;  5BN5 A;  4B3M Q;  1EOT A;  3S2D H;  3R93 A;  3AYH B;  5IP7 H;  2VQE Q;  1QUQ B;  3A7L A;  3JC6 6;  2ZT9 C;  3D3R A;  4BA2 I;  1HZC A;  1SMY D;  3H15 A;  3J81 i;  2VW9 A;  1TWG H;  1W6K A;  2X6L A;  3CCU A;  2MQH A;  1XPR A;  2QDL A;  2VL6 A;  4V0B A;  3EFX D;  3RUZ A;  2K28 A;  2Q2I A;  3MC0 B;  4HJA A;  3K6O A;  4KD4 A;  1BXT A;  2F0L A;  2UXC Q;  4P2C B;  4XIG S;  1YNX A;  1TY0 A;  5CV4 A;  2FIN B;  4C2M B;  2NVQ B;  4HJ5 A;  3CCQ A;  1WTX A;  1EY9 A;  2FMM A;  5GQO A;  1UEB A;  5M5W H;  5D3I B;  2BOS A;  2F0G A;  3K5O A;  3MXN A;  1G8Z D;  3GP7 A;  5FO9 B;  2K6A A;  4TRD A;  1B8A A;  4J6H A;  2JA8 G;  4KN4 C;  3VR4 A;  2R7D A;  1PH1 A;  3VR6 A;  3S1N H;  3F2U A;  1S40 A;  4DUZ L;  4MTN A;  1U9R A;  1LO5 D;  4GN3 B;  4GKJ L;  1V1P A;  4GN5 A;  4OX9 Q;  4K5W A;  3J7A V;  1NSN S;  1Q7Y C;  2F1M A;  2EDG A;  4BBR G;  3C2P A;  4Q5V A;  3QB3 A;  5I2Y A;  2Z8L A;  5M3M B;  1PYW D;  1STN A;  5EPK A;  3UDX A;  1STG A;  1EEF D;  2R93 G;  1ZYR D;  3ULP A;  3L7Z C;  2B2V C;  1SYB A;  2D2C C;  4QY7 A;  3ERS X;  1JJ2 A;  2EJG C;  1D5X C;  1KIX A;  2VUM H;  1KQS A;  3T1Y L;  1LTT D;  5LL6 X;  4POG A;  2NZH A;  4BY1 B;  3AU7 A;  4JVZ A;  4IUN A;  2FFK B;  1B1Z A;  1CFM A;  4IZ8 A;  5FK9 C;  2PCF B;  3HRZ C;  2L5T A;  3ULJ A;  5FLM H;  4PZ8 A;  3CCS A;  1PYS B;  4G4K A;  3HOX G;  4QCL A;  3W5O A;  4KMU C;  4DUY L;  4HID A;  5LMU L;  1EOV A;  1EWC A;  1Y1V G;  3T1H L;  1Q86 C;  2CQO A;  1IHZ A;  1YJ9 A;  2NVX B;  2JK8 A;  3K57 A;  2RCF A;  2D0O A;  4I65 A;  2VXW A;  4IUP A;  1B53 A;  1FD7 D;  2K01 A;  3AEV A;  4BS9 A;  2L11 A;  1B50 A;  1BF4 A;  2QCP X;  2KEN A;  3QOL A;  1HUN A;  2OCE A;  4A3K H;  1PV4 A;  1X3F A;  4FNF A;  1HTL D;  4PMB A;  1QIL A;  2WAQ G;  4QB4 A;  1KAB A;  1Q90 A;  2F0M A;  2NZ1 D;  1KAW A;  2Z6K C;  3BZD B;  2KJX A;  4JYA Q;  3GTP H;  2B2U A;  2CWP A;  3PO3 B;  3MXN B;  2K05 A;  4LFA Q;  4K0K Q;  2SEB D;  4B08 A;  3CCL A;  1RL2 A;  4KLK A;  1K83 H;  4DNR B;  3NQT A;  1RIP A;  1W3S A;  4X3T A;  1WFQ A;  1V1P B;  1C0A A;  3NTH A;  1VQF A;  5CMD A;  4HCS A;  1FVI A;  4DV7 Q;  3ND9 A;  1UE1 A;  4XYQ A;  4OIJ A;  5C3E G;  3TRZ A;  2EYF A;  5GAD C;  2MP1 A;  4IUU A;  1VQ4 A;  3D4R A;  1SE3 A;  4AYB B;  1G91 A;  1AE2 A;  3U58 A;  5IGE A;  1VQ8 A;  2MNA A;  4R4C A;  4YCU A;  2IHF A;  1JR0 D;  2PNR C;  2L4N A;  2E2I B;  3EIV A;  3PUV A;  3C3L A;  1HXY D;  4Z9C B;  1ICF B;  4NW2 A;  4X64 Q;  3HKZ G;  3I4N H;  4A75 A;  1IL8 A;  3NXW A;  1UE7 A;  4U67 3;  3EVQ A;  3CRK C;  3S1Q H;  2JE6 I;  3PCO B;  4UHV A;  4Y7N H;  2KEC A;  2B63 G;  1VQA A;  3E9H A;  5E1F A;  2KOL A;  2M9V A;  5IGG A;  1Y1W B;  3FKI G;  2UUC Q;  1NNX A;  1XNR L;  4R4Q A;  4IJL A;  4UY8 C;  1D7Q A;  1SNO A;  1GM5 A;  4A3E G;  5IYD G;  2K5N A;  3D0F A;  1IBL L;  2SOB A;  3PIO A;  4C2M H;  2NVQ H;  1FGU A;  2CWA A;  3OTO Q;  2JEB I;  3NK9 A;  3STB D;  2PZT A;  3PO2 B;  3KF6 A;  4HIK A;  3J7A F;  1EY7 A;  3URY A;  1VCI A;  1TWA H;  1A3U A;  1TWC H;  2MJ8 A;  5KGU A;  3S1M B;  4DFA A;  3GTJ H;  2I0Q A;  1QZH A;  5C0X H;  1MIU A;  2DN8 A;  1U4L A;  3J80 L;  4DR3 L;  1W6J A;  1LTA D;  2K52 A;  4PV1 C;  1G2T A;  2EY1 A;  4C3H G;  2OQK A;  1NMF A;  4KD3 A;  1CTM A;  5IIF A;  1MGS A;  4A3B B;  4DV0 Q;  1JWS D;  1IBK Q;  2WKD A;  1CHQ D;  1O7Y A;  1HNZ Q;  1X6O A;  4DV1 Q;  3S15 H;  4IFD G;  1KAA A;  1B44 D;  4GOP A;  4EGV A;  2JA7 B;  2UUB Q;  2AHO B;  4RGT A;  1MI2 A;  4LF8 Q;  3ULL A;  1DXM A;  4C3I G;  2IY5 B;  4A3G G;  1ZEQ X;  1H9K A;  4LUO A;  4QMG A;  1FNV A;  4PMW A;  5KYI A;  1NE3 A;  1VQB A;  4ZUI A;  4H13 C;  3K58 A;  4JI4 L;  3BS1 A;  3F1Z A;  4DXF A;  1TS3 A;  3KLS X;  3DWQ A;  4CJ2 C;  1KC8 C;  2M00 A;  1NJI C;  2QGQ A;  2ZTD A;  2VQF L;  5DAU A;  1QOH A;  2VY3 A;  3HOU G;  3NP8 A;  2HIX A;  2D9U A;  1PFM A;  4JV5 L;  4OGQ C;  4LF4 Q;  1QNK A;  3S16 H;  1OXV A;  1WCM B;  4MIU A;  1OXU A;  1N33 Q;  1GUO A;  4QUF A;  3CQZ B;  1GUS A;  1PH6 A;  4NXM Q;  1DOK A;  2N49 A;  2AWN A;  3HOZ H;  3QO2 A;  1PTO H;  1BCP F;  1PRT C;  3H0G G;  5FLX c;  1OXT A;  3X3M A;  3JAM c;  4FF3 A;  2PYK A;  1O7L A;  5IYB G;  1KNA A;  3SK6 A;  3G71 A;  1IZ6 A;  5G3L D;  4WJW A;  4BY7 G;  4FDB A;  4NKL A;  2E2H H;  5ELF A;  4IOC A;  5BR8 L;  4EQO A;  2L12 A;  5ISR A;  4IPH A;  3KF6 B;  2B2T C;  3D6C A;  3PF4 A;  1FJG Q;  2RQX A;  1TWF H;  2L55 A;  2QW7 A;  2JXM B;  1J5E L;  2BH2 A;  3HFZ B;  4DV5 Q;  3S1R H;  1C48 A;  3CC4 A;  4KTA A;  4B3T Q;  2WV6 D;  3LWE A;  1YIJ A;  4U68 A;  5C4H A;  3P7J A;  5EGT A;  4EVO A;  3CD6 A;  4RAU C;  4WJ3 M;  3I4M B;  1I94 Q;  5J22 A;  2UXB L;  1EZ8 A;  2JQO A;  3P20 A;  5KNC A;  1SFO H;  2HUG A;  2VNU D;  1VF7 A;  3DM3 A;  1JOK A;  1F2Z A;  4JBW A;  3PIP A;  3RZO B;  1JB7 A;  1ZXT A;  2F0V A;  4GOP B;  2JA6 H;  2I07 B;  3H3V C;  3S14 B;  2LY7 A;  4GNX A;  3ITP A;  5C4X G;  1J6Q A;  4QUC A;  1YNN D;  4IPC A;  2HDL A;  1STB A;  2DGY A;  3R2T A;  4TVA B;  1KRT A;  3PIO 3;  1RCV D;  1K8O A;  1RDP D;  3QOJ A;  3GDE A;  3NSW A;  1EY8 A;  1K0S A;  4AQY Q;  3N52 A;  1C9O A;  3C46 A;  1B3Q A;  2AMC B;  2E2J H;  3U4Z A;  1HFG A;  1XMO L;  1YJN A;  3EA6 A;  4FO2 A;  3T51 B;  3HOV G;  3M7N A;  2F0W A;  1IBM L;  3KBX A;  2VUM G;  4OO1 G;  4KKS A;  4HAE A;  1I3Q B;  2Y0S B;  1EWH A;  2Q8R E;  2C35 B;  3WWV A;  1TS5 A;  1BCP C;  3FVQ A;  2ZJQ A;  5FLM G;  2YU9 B;  2DY7 A;  1HPC A;  1BNZ A;  2PW7 A;  4F8M A;  2QA4 A;  4E6I A;  1E7Z A;  1M4V A;  1B70 B;  2XIW A;  2NB0 A;  2K14 A;  1K8A C;  4CHT B;  4KV6 A;  3S1M H;  1K9M C;  3I70 A;  5IGD A;  2XTI A;  3I56 A;  1Y8P B;  1G6Z A;  4JI0 L;  2PNH A;  4GLA C;  4PZ6 A;  1XXG A;  5EKI A;  5AJ3 Q;  1FL0 A;  2QEX A;  1EL0 A;  4A3K G;  5DM6 3;  2E5L Q;  3A8I E;  3BJU A;  5LMN W;  3PSI A;  4LF7 Q;  2RDF A;  2EYP A;  4CGY B;  3FPP A;  3F8T A;  4A93 B;  4JBK A;  3MHB A;  2MGS A;  5D14 A;  2F4V Q;  4X66 Q;  4M8A A;  3RZD B;  4OL7 A;  4A3J G;  1NY4 A;  1AEX A;  2JN4 A;  2F0E A;  5FLX E;  3T1Y Q;  3JAM E;  3C1E A;  3L2P A;  4IQZ A;  3HS0 C;  4LJZ C;  4GNX B;  2K5Q A;  4X65 L;  1PXU A;  2BCO A;  1PH9 A;  2K5D A;  4DKA C;  5C3X A;  4LF5 L;  2A1A A;  1MD2 D;  2K1B A;  3MFY A;  2NN6 H;  3K0Y A;  5CGK A;  1BBX C;  1DON A;  1SRU A;  1TWH H;  4CDC C;  4ZKC B;  4NMZ A;  2JA5 B;  4XQN A;  3E0E A;  3Q8D A;  4JI7 L;  2WKC A;  1S3O A;  2Z4H A;  1E22 A;  4F87 A;  1JOO A;  1U4R A;  4FF2 A;  4APV A;  4CDF C;  1CI3 M;  5IT9 c;  3AMU A;  1T5E A;  2JEA I;  3I4N G;  4CKE A;  1A3T A;  2KCM A;  1CA6 A;  1RJT A;  1U4P A;  2FHT A;  1DCZ A;  2B2W C;  1FNU A;  1TT2 A;  1V8Q A;  5EBC A;  2DJG C;  2Y0S E;  2D62 A;  3PIP 3;  3CC2 A;  1SSO A;  4DPG A;  1XX8 A;  1XNQ L;  2EXZ A;  3VYT A;  2K03 A;  1Z7T A;  2J0T D;  2K7V A;  4WOR A;  1L1O C;  4NXN L;  1HR0 W;  3UE0 A;  1D2B A;  2BE5 C;  3V96 A;  4RHS A;  5KRU A;  2D5D A;  4K14 A;  3OIP A;  1ICW A;  5JEA J;  1F9P A;  4DAY A;  4A3L H;  1GD7 A;  3RZO H;  4B3S L;  3MAQ A;  3U50 C;  1I6H B;  3S2H B;  3TME A;  4L5Q A;  4C3J H;  4A3I B;  4CDD C;  3X3N A;  3U9S A;  2FMC A;  1GVP A;  2OEO A;  1F2L A;  5T1G A;  5C0X G;  2ALY B;  3PF5 A;  2XGT A;  2PW5 A;  1C8C A;  3J81 c;  1E2W A;  3OOC A;  4QIW B;  1B9N A;  3A8K E;  5C5L A;  2F0H A;  1KL9 A;  1KHI A;  1TU2 B;  3K8A A;  2L1B A;  4KKT A;  3VR2 A;  3VYU A;  4RKB A;  1R9T B;  1HH2 P;  1BBU A;  2VZA A;  2HDM A;  2J4X A;  5JVG 3;  4ME3 A;  3SK5 A;  4LFB Q;  4KHP L;  5DLQ E;  1N34 L;  1CK1 A;  4ZK9 B;  4DNI A;  4DV4 L;  4LUV A;  4BBS B;  3ER0 A;  5M3F B;  1IBL Q;  1D1K A;  1ML0 D;  4JI6 L;  3VYS A;  5CV8 A;  4K6L A;  2E2D C;  3N6R A;  2O4X A;  4PG3 A;  4WJ4 A;  1A15 A;  2EY6 A;  2A6E C;  3OWE B;  3IRB A;  5JAV A;  4FXG C;  5A35 A;  1XTD A;  2HQE A;  5C0X I;  3TS0 A;  1JWM D;  2NBF A;  3W2D A;  1N9W A;  3K7U C;  1RD9 D;  4RMF A;  1VQI A;  5E3F A;  2UUA Q;  4OEM B;  3HOZ G;  1BVS A;  2R92 B;  1VF5 C;  1PH5 A;  4MNO A;  1JWU D;  1EYG A;  3K5L A;  1IW7 D;  2HCI A;  4XQQ A;  1F77 A;  1VDZ A;  2R7Z H;  5C6A A;  2A68 C;  4DAY B;  4A3M B;  3DM1 A;  2CH4 A;  2GVB A;  4ZCK A;  4RWS C;  3NTI A;  5IT9 E;  1EIG A;  3J80 i;  1JJG A;  1CKM A;  2XSC A;  5LHY 1;  5IGC A;  2WFW A;  2X6G A;  2JP1 A;  2N3S A;  5I6W A;  1HNW Q;  4JI4 Q;  4LFC Q;  4TSS A;  1Q8K A;  5EQ0 A;  4Y52 H;  3L9A X;  4ABN A;  1JJC B;  1I4R A;  1NCV A;  2A6H D;  2A69 C;  3KLR A;  4HED A;  2NZO A;  1PH3 A;  4J15 A;  1MSH A;  1CKO A;  2RHQ B;  1S5D D;  4EQ5 A;  2OXP A;  5LMN L;  1RHP A;  2JA6 G;  1LUZ A;  2KBN A;  3DWA A;  4QIW E;  3GTK B;  3GTL B;  1A2U A;  1WTR A;  4ILW A;  1EFI D;  4K2K A;  2EPB A;  5FO8 B;  1E3P A;  4S3S A;  3U9O A;  4NDX A;  4DR6 Q;  3K80 C;  3S17 B;  3NEL A;  3ERO A;  3RLF A;  4JI8 L;  1E2V A;  4DNT B;  1EU3 A;  3DEO A;  4O2D A;  5BR8 Q;  1J8I A;  4KHZ A;  2ICE C;  3CP0 A;  4M1U B;  1D8L A;  3J81 E;  1N36 Q;  3HOY H;  1SN8 A;  3BDC A;  4N9T A;  3CCV A;  3LX0 A;  5FO7 B;  1LT3 D;  3HOW H;  2O5I C;  1J5E Q;  1GHK A;  4R1J A;  1KTK A;  2ZM6 Q;  5M5Y B;  2C5C A;  4L5S A;  1I6H H;  3H3V H;  1UE5 A;  4A3D B;  1VQN A;  1BDO A;  4DR2 L;  4QJF A;  5GAE C;  4X3S A;  4FVM A;  1I4H A;  4X3U A;  3DUZ A;  3NBI A;  4YHH L;  4ME5 A;  2G9D A;  1E24 A;  1Y14 B;  3PQI A;  4X62 L;  1X3P A;  1HCZ A;  3CU7 A;  4GZY C;  4XDX A;  3OYY A;  1FR3 A;  3OW2 A;  3QJY A;  2RF4 A;  2KED A;  4NP5 A;  2NVY H;  1KXL A;  2N78 A;  4A3F H;  5CBA E;  1B3A A;  3VYR A;  4OON A;  4K8I A;  1STE A;  3RN5 A;  3CMA A;  2RHS B;  2NTT A;  1C4Q A;  2KUM A;  3M9B A;  4UP8 A;  1TY2 A;  1XMQ L;  4DAM A;  1HR0 L;  2K75 A;  1OO9 B;  3L0O A;  3RLO A;  1IBM Q;  3FHW A;  5C44 H;  1OXS C;  1SE8 A;  4RHR A;  1ILP A;  2F0Q A;  4ID6 A;  3E6Z X;  3MXP A;  4B3R L;  1II3 A;  3NQI A;  3G4S A;  4UP9 A;  4DK0 A;  1CSP A;  4IN3 A;  4C56 C;  2NN6 G;  2O5J C;  1ASY A;  5JPN C;  2FJ2 A;  1VQ6 A;  5A2Q E;  3DEP A;  2F52 A;  4JI3 Q;  1JT8 A;  1WTQ A;  2WAC A;  2R3Z A;  2AQ2 B;  2PPB C;  3PUY A;  2A73 B;  3CRL C;  4L5T A;  4GOP C;  3GTQ H;  4JK1 C;  1LT5 D;  1A62 A;  3HEJ A;  3IAY A;  4JI0 Q;  5EJW A;  4HTH A;  1QVG A;  5KYL A;  1S5B D;  2YTY A;  2JA8 B;  4G7H C;  1TQO A;  4K2L A;  4HMJ A;  1Z47 A;  2KHI A;  3A55 A;  1B7Y B;  1G2S A;  3GV3 A;  2X69 A;  4A3M H;  4JBM A;  1PMR A;  4JI1 Q;  2Q8T A;  2MHV A;  3NEN A;  4DR4 L;  4BBR B;  3SEB A;  1K28 A;  2K5V A;  3RD4 A;  1LTB D;  4OWX B;  1AZP A;  4DR5 L;  2R93 B;  2B8F A;  3A74 A;  2OTL A;  3BU2 A;  1ZYR C;  4X65 Q;  2NN6 I;  1G51 A;  1DD2 A;  1HFN A;  1FNW A;  1RF2 D;  3TEH B;  3T53 B;  4LF5 Q;  1JE5 A;  4RGN A;  1OXX K;  1I50 B;  4A4I A;  1VQK A;  1UAP A;  5M5X B;  5C4Z A;  2Z6K A;  3A56 A;  4A3L G;  3KLS A;  3HOX B;  1PYB A;  5FJ8 H;  2M2L A;  2EIF A;  2F0F A;  2MO0 A;  4C3J G;  5COY A;  1Y1V B;  1JIC A;  4JI2 L;  5M3M H;  1X56 A;  4DAV A;  1AZQ A;  3GQB A;  5IE8 A;  1D5Z C;  3Q22 A;  2ATW A;  3S17 H;  1CSQ A;  2HHH L;  4K6D A;  4OWT B;  2LMC B;  3D8G A;  3J7Y W;  4K5X A;  3NEM A;  2L0C A;  2EQS A;  5ELB A;  4O42 A;  4BY1 H;  1CKN A;  3QR8 A;  1EU4 A;  4DR1 Q;  1WTV A;  2WAQ B;  3FEW X;  1LLR D;  1NUC A;  4B9W A;  4B3M L;  4R9W A;  1ASZ A;  1HJP A;  2EYM A;  4HN7 A;  1SNM A;  1I5F A;  4PMC A;  2VQE L;  1QG7 A;  2A74 C;  2QEJ C;  5C3W A;  4GNX C;  1VS0 A;  4GLX A;  4KK7 A;  2K4K A;  3GTM B;  3OMC A;  2CVR A;  4AYB E;  2NVX H;  1N32 L;  2ZXR A;  5K36 H;  3K5N A;  4A3D H;  2Z1C A;  3TZD A;  2UXC L;  4H0L C;  2DY8 A;  2L15 A;  1YNJ C;  4DV3 Q;  3K59 A;  3BVG A;  1FYC A;  4KY6 A;  5CR3 A;  3CCR A;  4B3S Q;  3HKS A;  3P75 A;  4IUV A;  1TR5 A;  2N88 A;  4CKB A;  2E74 C;  3SGI A;  1ENF A;  5IYC H;  5C3E B;  1ESF A;  3H91 A;  2UU9 L;  1ESR A;  2I46 A;  3SVM A;  3I8Z A;  1LAB A;  2BDN A;  3MVV A;  4HJ7 A;  3E3X A;  1G6P A;  1WYD A;  3PO3 H;  3H09 A;  4MHE A;  5KEE A;  1VQ7 A;  4OX9 L;  3KFU A;  4FP5 D;  4L63 B;  2F3I A;  5IP7 G;  1EY0 A;  4RKL A;  2IJ0 A;  1EQV A;  3A5Z B;  1XJV A;  4P73 A;  3HKZ B;  1DOL A;  2R7Z G;  5E7N A;  3LGJ A;  1LTS D;  4YWK A;  3FDT A;  5HGQ A;  4B9X A;  1QZG A;  1UNS A;  1YIT A;  3NBH A;  1D6E C;  2VB3 X;  5C5M A;  5A2Q L;  1HNX Q;  2CHB D;  1CA5 A;  1GXD C;  2DUD A;  1H9S A;  1V1Q A;  2RKS A;  3TZU A;  3PUW A;  2B63 B;  2F0T A;  4YY3 Q;  4NPS A;  1XPU A;  1F9Q A;  4X6A H;  2XWJ B;  1SYG A;  3FKI B;  4HSP A;  4DU9 A;  3IKJ A;  1WTW A;  1YBY A;  1VQJ A;  4C1N K;  4GS3 A;  4JI6 Q;  3CCE A;  4A3E B;  2SDF A;  4LWC A;  2E2I H;  3FPU B;  1CKN B;  5G3L F;  3I90 A;  4HSV A;  1N8R C;  1JQY D;  4DV2 L;  4IAL A;  2K50 A;  4LF9 L;  2EE1 A;  3J7Z C;  3STB C;  4YIJ A;  1P8L A;  5GRO A;  3KDF A;  4C1N I;  4POF A;  4RH6 A;  2VS1 A;  2WAQ E;  3MTS A;  2D0P A;  1Y1W H;  2ZXP A;  2NVT B;  4V19 0;  5KNB A;  5I9P A;  1VMP A;  4EX5 A;  4C3H B;  1P16 A;  2ASB A;  3HOY G;  3U4V A;  4FF4 A;  3BVM A;  2EXD A;  1L0X B;  1X65 A;  2B2Y A;  1SJE D;  3HOW G;  3PO2 H;  4K0K L;  3JAM i;  3A8J E;  3K7A B;  3M4Y A;  4F88 A;  1ENC A;  1KDC A;  4DK3 C;  1I50 H;  1WVL A;  4C3I B;  1EQT A;  4A3G B;  1JOQ A;  4K8J A;  5JOB A;  1PHJ A;  5FOB B;  2A19 A;  1UEA B;  3SDZ A;  1CHP D;  3ICE A;  5EAY A;  4CBV A;  4IFD J;  4DUZ Q;  1V43 A;  4GKJ Q;  1LYL A;  1PTO D;  4A3B H;  1HQM C;  1SXT A;  1X54 A;  3HOU B;  3VR5 A;  3NBH B;  3I73 A;  1M1K C;  1H9S B;  2J7Z A;  1QB5 D;  2K5H A;  3J7A 5;  1GUG A;  1IKM A;  2JA7 H;  2CW0 D;  4A3F G;  2ID0 A;  3HKZ E;  4X64 L;  3T13 A;  1EZ6 A;  1TXY A;  1XYI A;  4UPA A;  3IFD A;  4HR7 B;  4JI8 Q;  3H0G B;  1XTC D;  4LUZ A;  1RTO A;  1Z6H A;  1Q81 C;  4BY7 B;  1VQ9 A;  4G7Z C;  3D4D A;  2JA9 A;  4QQB X;  2WII B;  1VQL A;  1SBB B;  3LNN A;  2NYZ D;  1D5M C;  2N8N A;  1VQG A;  2WIN B;  3CC7 A;  1RKN A;  5C44 G;  5EKK A;  3S2D B;  2K33 A;  1LV9 A;  2UUC L;  3TS2 A;  4DUY Q;  3KYH C;  1WOC A;  3FP9 A;  5J1Z A;  2CQA A;  1L0Y B;  3ONA B;  4P71 A;  5LMU Q;  4PQX A;  1LTI D;  4GKK L;  3H3V I;  3KDF B;  1WCM H;  1EQQ A;  1TWG B;  2PI2 A;  3DHQ A;  3CQZ H;  3T1H Q;  3J81 j;  1PZK D;  2HIV A;  5EKL A;  3BZK A;  1PH8 A;  2CFM A;  5EBD A;  1IL2 A;  1ET9 A;  1KLU D;  4ZKB B;  1VQO A;  2BH8 A;  3MXU A;  5M5W B;  4X62 Q;  1KLG D;  2QF7 A;  2GN5 A;  2RDG A;  4YCW A;  4XQJ A;  4IJH A;  2ZXO A;  1CZG A;  3LWU A;  1KDA A;  2ICI A;  2PMZ B;  1IYV A;  3S1N B;  5C4X B;  3UDI A;  3DWP A;  4WRD A;  4ZUJ A;  1PRT B;  1U0L A;  2RVL A;  1YNN C;  1PH7 A;  2Z4I A;  1O80 A;  5JJI A;  5D65 A;  1Z9F A;  5IGB A;  4DV0 L;  4GN4 B;  1JB3 A;  4HJ9 A;  1HNZ L;  5JJK A;  4DV1 L;  5HY6 A;  2DNE A;  1XMQ Q;  3S24 A;  3I4M H;  4CDE C;  2BA1 A;  1I6V C;  1EY5 A;  2WB1 B;  3FRP B;  3HOV B;  1LTG D;  1F2M A;  2VUM B;  4KN7 C;  1B4O A;  4QF4 A;  4X3K A;  1SYF A;  3QWN A;  4A3E H;  3OSO A;  3S14 H;  5IYD H;  1DGS A;  4NB3 A;  1TS4 A;  5I9O A;  1MKH A;  4KJN A;  5IP9 H;  3A54 A;  3CF5 A;  1GOZ A;  2EYL A;  3AFP A;  2NWG A;  3FMC A;  1LAC A;  2DNC A;  2KA7 A;  4N9P A;  1A6X A;  1EY6 A;  3F2B A;  4O0A A;  4RCN A;  4LF4 L;  3VR3 A;  1N33 L;  4HMI A;  2LSS A;  3ZJY C;  2OT2 A;  5M3M G;  5AFW A;  1CM9 A;  1H9J A;  1NBW A;  4NXM L;  1Q3L A;  2JSO A;  2TSS A;  4R4O A;  1X9N A;  1BR9 A;  3J80 c;  2HCC A;  3E5S A;  5ELC A;  2MFI A;  4BA1 I;  4A3K B;  1E2Z A;  4BY1 G;  1I3Q H;  3NE5 B;  3MFG A;  2KEE A;  2F03 A;  1ONL A;  1SJH D;  2IX0 A;  1XNR Q;  1E1O A;  2YU9 H;  4YCV A;  4IFD H;  1F2Y A;  1TII D;  3GTP B;  1WI5 A;  3Q23 A;  4YWL A;  4DR5 Q;  1EIH A;  1AH9 A;  4H44 C;  5D3D A;  2I5M X;  4A3G H;  2AUK A;  3AFQ A;  4A3J B;  3ND8 A;  2UXD L;  3CPF A;  5NUC A;  4B3T L;  1A63 A;  2H5X A;  1PFB A;  5CV9 A;  4DN4 M;  2F0P A;  1KRS A;  2EYH A;  1BCP B;  1K83 B;  4FXK C;  3UDF A;  4HIO A;  1F9S A;  1DJR D;  1HZB A;  1VQC A;  5CV7 A;  3M4P A;  3ERQ A;  4JOI A;  1W2B A;  4IUR A;  1M8A A;  4DR3 Q;  5IYC G;  2KCC A;  5FLX L;  3JAM L;  4JI2 Q;  2AQ3 B;  1TKW B;  3WOF A;  3OMG A;  4A93 H;  3I2Z A;  3PO3 G;  3RZD H;  3H0G H;  3TRE A;  1DYQ A;  1L1O A;  5IGF A;  1HUM A;  3OIQ A;  4AIM A;  1ET6 A;  4AQY L;  1PFN A;  3I4N B;  1GKH A;  1MHW C;  2WB1 E;  1K3B C;  3BDO A;  4P74 A;  1S72 A;  1WD1 A;  4LNQ A;  3S1Q B;  1S5C D;  3L3O C;  4Y7N B;  4RA8 A;  1YVC A;  4CJ1 B;  3PUX A;  1H95 A;  4Q0F A;  4ODG A;  1M90 C;  1Y8N B;  1N32 Q;  4AYB G;  2F3W A;  2VQF Q;  2JA5 H;  1YI2 A;  1PVO A;  3RLN A;  2XWB B;  2B2U C;  4R8I A;  4JV5 Q;  4DAP A;  1GJX A;  3C1F A;  1VQ5 A;  2QKI C;  5JVH 3;  1TS2 A;  2EJF C;  3UI2 A;  2H4O A;  1I4G A;  3PMF A;  1DOM A;  2G9H D;  4ZLT F;  3I72 A;  3KOJ A;  2UU9 Q;  1CZW A;  2YV5 A;  2PI2 E;  5C4X H;  1TWA B;  1TWC B;  4N8F A;  5AJ3 L;  5CC4 A;  5IOD A;  5JEA H;  1U5K A;  1K0R A;  2E5L L;  4P75 A;  3GTJ B;  1MJC A;  1Y1W G;  3BZC A;  3P1H A;  4LF7 L;  1BBW A;  1SNP A;  2Q2H A;  2ZJR A;  3T4A C;  1AN8 A;  1GUT A;  5EPL A;  2F4V L;  4X66 L;  1NTG A;  3HOV H;  4ZQ3 A;  3S15 B;  3J80 E;  4OHJ A;  4OO1 H;  2EYO A;  3H6M A;  2GVA A;  5IY0 A;  3PO2 G;  4DV6 L;  4F7X A;  3BYT B;  3BVZ A;  3CHB D;  5C0X J;  1JE4 A;  3CCM A;  5IWA L;  2UXB Q;  3S2H H;  1HTP A;  2F0U A;  2EY2 A;  4A3I H;  2OF1 A;  2DJF C;  2RSO A;  1L1O B;  1NAP A;  1PH2 A;  2P5Z X;  2CCZ A;  3SK4 A;  1X55 A;  2YTX A;  1SRO A;  1PZI D;  4ULL A;  1KDB A;  1BUV T;  1X3Q A;  4DV2 Q;  4MZ9 A;  4A3B G;  4LF9 Q;  4JW0 A;  1HZ9 A;  4ZRZ A;  3S16 B;  4YWM A;  1X3E A;  3GV6 A;  3MWY W;  1QNU A;  4LAA A;  1R9T H;  4UDU C;  2JA7 G;  1S5E D;  1T9H A;  2F0J A;  1A0I A;  4XT1 B;  2YTV A;  5ELO A;  1XMO Q;  3HOZ B;  1PTO B;  2JYO A;  4A3C H;  4R8N A;  4KKU A;  1L2F A;  3K5M A;  4LW1 A;  3NPP A;  3F2D A;  1EEI D;  3NWS A;  2K5W A;  2E76 C;  1IW7 C;  4BBS H;  5M3F H;  2KVM A;  2E2H B;  4DA2 A;  1SR3 A;  4HJ8 A;  2RDH A;  1A8V A;  1SMY C;  5TSS A;  5GAH C;  4A3J H;  2IX3 A;  2CH4 W;  2EY5 A;  5CYU A;  1YNJ D;  1QWY A;  1TWF B;  4RGO S;  1V9P A;  1WCM G;  4AH6 A;  5I6Y A;  4G7O C;  3A0J A;  2TMP A;  4OEL B;  1PLF A;  3S1R B;  1G29 1;  2B3G A;  2QIL A;  4KHV A;  4XT3 B;  2B2V A;  1JOR A;  1PRT D;  4LMQ D;  2R92 H;  2ZJP A;  4DR7 L;  3EJI A;  1LM0 A;  2PZU A;  3M4O B;  1NMG A;  2A6H C;  4P72 A;  3VA5 A;  5KND A;  1HRJ A;  2EYJ A;  5IT9 L;  5H1S E;  1SFO B;  1ZKO A;  3NHH A;  4IUT A;  4QGU A;  5JJL A;  3T16 A;  2YYZ A;  2K04 A;  2JA6 B;  3DXJ C;  1E1T A;  2IT1 A;  4EQP A;  1JMC A;  5KIX A;  3VDY A;  2A5H A;  1O7I A;  5DNF A;  1STA A;  4LF6 L;  4GLV B;  1S4Z A;  5EPJ A;  3RNU A;  2F0K A;  3I4M G;  1GHJ A;  2Q2T A;  2E2J B;  4J1M A;  4JI5 L;  3PGZ A;  3G7L A;  3PV0 A;  5T1I A;  4LFB L;  1A3V A;  1I4P A;  3CXC A;  2PQA A;  1PRT F;  1Q8I A;  3OW7 A;  2ES2 A;  4GKK Q;  3S9W A;  4FXD A;  1Q12 A;  3I4L A;  1LTR D;  3GTK H;  1AE3 A;  3GTL H;  3W1B A;  5IP9 G;  1CQV A;  2OWO A;  4XXE A;  1MSG A;  2FXQ A;  2VB2 X;  5E4W C;  2LXK A;  1YHQ A;  4JI7 Q;  2V4D A;  1ILQ A;  1K8M A;  4OIK A;  2HD3 A;  4N8X 1;  3J81 L;  1BQQ T;  3AQQ A;  5IOC A;  4IOA A;  2MPM A;  5CV6 A;  2UUA L;  4IPG A;  3TN2 A;  1T5X D;  2GA4 B;  1VQM A;  4KY5 A;  1FGB D;  2K32 A;  2Y0S G;  2AUJ D;  1PDQ A;  4I7Z C;  2PO4 A;  1BCP D;  1V1O A;  1XNQ Q;  4RFB A;  3KF8 A;  3CCJ A;  2R7F A;  5ELE A;  4BXX H;  5M5Y H;  1PFS A;  4JPB W;  2IHE A;  4NXN Q;  1BKB A;  1KNE A;  3KUP A;  4O1N A;  4HIM A;  3HGB A;  2XNA C;  3E9I A;  4L8J A;  5I4D A;  3E0J A;  1GUN A;  4JCV E;  2XVS A;  1NR4 A;  3SK8 A;  1HNW L;  4LFC L;  1UUP A;  1X32 A;  5GAG C;  5CBE E;  2EOT A;  3I55 A;  1BO0 A;  1HA5 A;  3M4Q A;  4DK6 C;  4CJ0 B;  3WOE A;  3K81 C;  3CPW A;  1GUW A;  2I5L X;  1MJE A;  3V2T A;  1WTO A;  4UP7 A;  1YJW A;  1F9R A;  3R3O A;  1I4X A;  1EWI A;  1TWH B;  1BOS A;  1E0B A;  1QCB D;  2B2Y C;  2H1E A;  1K8G A;  4A93 G;  1YHB A;  3Q24 A;  5C4J B;  5F2D A;  3IFT A;  4A76 A;  2IL8 A;  1WD0 A;  2B29 A;  1JC7 A;  2PQA B;  1KD1 C;  1AP0 A;  4DR6 L;  3G6E A;  3W3A A;  2IW3 A;  1EUJ A;  4RG1 A;  3I4O A;  1K3R A;  4IFD I;  2HT1 A;  3BYY B;  1XWE A;  5HUR A;  3O13 A;  2B8G A;  2F0S A;  3A5U A;  4KHP Q;  1N34 Q;  4WFN 3;  1IXR A;  4TKO B;  3D31 A;  4DV4 Q;  4JC0 A;  1N36 L;  1B2T A;  2RSN A;  3EN2 A;  2Q2U A;  3M85 A;  1R4P B;  3KK7 A;  1WTH A;  1ENA A;  3HP3 A;  2UXD Q;  3RN2 A;  3R2I A;  2JA5 G;  2AQ1 B;  2XRS D;  3V05 A;  4L6T B;  2ZM6 L;  1STH A;  5FKA C;  4H7B A;  3M4O H;  1XPO A;  1QVF A;  3OHX C;  2JA8 H;  1H9M A;  3TP7 A;  3NTK A;  3KF8 B;  2AKW B;  2OTJ A;  2LS0 1;  4TQU S;  2LKV A;  2NUC A;  2F0I A;  2QDB A;  4EQN A;  1CT1 D;  2R61 A;  1Q82 C;  4C3J B;  4BBR H;  5JEA G;  1QVC A;  2ZTC A;  4BWG B;  3F2C A;  2G5D A;  1YEZ A;  4I7A A;  4JYA L;  1GO3 E;  3GTG B;  1SDF A;  2R93 H;  3SE0 A;  1S5F D;  1YHA A;  1WTP A;  1H9R A;  1VQH A;  4OXP A;  4KJO A;  4ALP A;  4ZYS A;  1Q1E A;  5ELD A;  4LFA L;  5K5P A;  4RCO A;  1MBY A;  2BE5 D;  3G6J B;  4QL5 A;  2WB1 G;  1QJO A;  1HQR D;  2RA4 A;  4XTC S;  3NWT A;  3WDN A;  5DEH A;  5M5X H;  3HOX H;  1SAP A;  4DV7 L;  1IYU A;  2B39 A;  4A3I G;  3UDG A;  3EQL C;  3GTO B;  2KCT A;  1Y1V H;  3M3Y B;  2B2T A;  5LMN Q;  5LL6 S;  2Q8I B;  1UE6 A;  3TP5 A;  1LT4 D;  2WP8 J;  4JI3 L;  5ELN A;  3MA2 B;  1O78 A;  2C9O A;  1DZ1 A;  3PUZ A;  1WJJ A;  3KJP A;  2IPK D;  3K0X A;  3TDQ A;  1CUK A;  1STY A;  2Z0S A;  2XRQ D;  3OWF A;  2O2L D;  3RMH A;  1LTL A;  5E4X A;  1TVX A;  1PA6 A;  4OWW B;  4L5R C;  3G48 A;  1SYC A;  4CKC A;  2I5H A;  1U4M A;  4A3C G;  2RBM A;  3GTM H;  3UE1 A;  3TP6 A;  2N55 A;  4PNY A;  1EIF A;  4JI1 L;  4BBS G;  5M3F G;  4OO1 I;  2AWO A;  2ZTE A;  1B9M A;  1JCK B;  3MEF A;  2A8V A;  1Q1B A;  1HA6 A;  5BN3 A;  2V1C C;  2R7Z B;  5JJZ A;  3M7G A;  2EVB A;  1A2T A;  2A6E D;  4DF7 A;  2IX1 A;  4R4T A;  3SR1 A;  4DV6 Q;  1HHV A;  2PQE A;  4MTK A;  3SXH A;  2E75 C;  3OTO L;  4IUQ A;  1PTO F;  5IWA Q;  2XN9 C;  3D4W A;  4DR2 Q;  1UWV A;  3TQY A;  5C3E H;  4FF1 A;  3Q6S A;  2Z6B A;  2E8G A;  4YHH Q;  3VA7 A;  5J39 A;  3D6W A;  2R92 G;  1SND A;  3SHL A;  1CQF A;  1D1I A;  2ENB A;  2MO1 A;  1Q46 A;  3IL8 A;  2IWH A;  2R6G A;  2CKZ B;  1SYD A;  1VQE A;  4HCE A;  5C4J H;  1R4Q B;  2A68 D;  2OQ0 A;  1SLJ A;  3BDL A;  3NUC A;  1PH4 A;  1EQR A;  4A3M G;  1IBK L;  3KJO A;  2F4I A;  4DXG A;  2KQ3 A;  3B6Y A;  2KCN A;  1EFW A;  4ZAI A;  1PZJ D;  3QIA A;  1EYA A;  1HR0 Q;  2B63 H;  2UUB L;  1SNC A;  5I2X A;  3TP8 A;  4DR1 L;  4LF8 L;  2KHJ A;  2EJM A;  1DM0 B;  3FKI H;  4UAI A;  4B3R Q;  3ZYY X;  1SNQ A;  4DK1 A;  2BA0 A;  4KY7 A;  2BDO A;  2A69 D;  2F0O A;  3KBG A;  3MXG A;  4JOI C;  1L0W A;  1OTC A;  3A7A B;  3H94 A;  3Q0A A;  4LK1 C;  2MUY A;  3RR5 A;  3R8B A;  3HOY B;  5DM7 3;  3I3C A;  3HOW B;  3TBI B;  5FJ8 G;  1SE4 A;  1QUQ A;  2F3V A;  4DGZ A;  5COR A;  1K73 C;  5J3B A;  4DV3 L;  5L37 A;  4IPD A;  1EYC A;  4R4I A;  1EIY B;  4DR7 Q;  4K5V A;  3DLL A;  1VMC A;  2NVT H;  4JG2 A;  2NTS A;  1SEB D;  2EZV A;  2F0N A;  2LFN A;  4C3H H;  3CKI B;  1SE2 A;  3MZ5 A;  1EY4 A;  3GTG H;  3CW2 C;  4G57 A;  3QG1 A;  3OPO A;  4J8Q A;  1PTO C;  3EBE A;  5HGT A;  3KLW A;  2RCN A;  2Z9H A;  2F0D A;  4DR4 Q;  4RGM A;  2NVY B;  3I91 A;  4A3F B;  4H02 A;  1IKL A;  2HQL A;  3K7A H;  1FJG L;  1LT6 D;  3CME A;  4LF6 Q;  1AFP A;  1QE6 A;  2CW0 C;  1VQD A;  2SNS A;  5JPM C;  1YZ6 A;  4C3I H;  4BXX G;  4JBJ A;  4DV5 L;  1VQP A;  1O7Z A;  2KHS A;  5K36 G;  1J9O A; 
#chains in the Genus database with same CATH homology
 4LF9 Q;  5AJ3 Q;  1HNX L;  1HZ9 A;  1FL0 A;  2QEX A;  4A3K G;  4JI5 Q;  4KI0 A;  2JJQ A;  4A3D G;  4YWM A;  4AYB E;  2E5L Q;  1X3E A;  3BJU A;  2NVX H;  1N32 L;  4YY3 L;  1R9T H;  1HZA A;  3GO5 A;  5LMN W;  3GTO H;  1I94 L;  2JA7 G;  3M3Y H;  3PSI A;  1T9H A;  4A3D H;  1A0I A;  2YTV A;  4PZ7 A;  5ELO A;  2UXC L;  4LF7 Q;  1XMO Q;  2L15 A;  4A3C H;  4DV3 Q;  3F8T A;  3GD7 A;  3HOU H;  1L2F A;  4LW1 A;  4JBK A;  2PMZ E;  1X3G A;  3F2D A;  3CCR A;  3W1G A;  4B3S Q;  4X66 Q;  2F4V Q;  3HKS A;  2LXJ A;  4A3J G;  4BBS H;  1NY4 A;  5M3F H;  3SGI A;  1SR3 A;  3T1Y Q;  4HJ8 A;  5IYC H;  3L2P A;  1A8V A;  2UU9 L;  4A3J H;  4GNX B;  5GAH C;  4X65 L;  2HHH Q;  4HJ7 A;  4IO9 A;  1PH9 A;  1IYJ B;  1SMX A;  4DKA C;  5IYB H;  4BY7 H;  1G6P A;  1WYD A;  4LF5 L;  2A1A A;  3PO3 H;  3CAM A;  3I7F A;  1C7Y A;  1VQ7 A;  1V9P A;  1WCM G;  4AH6 A;  4OX9 L;  3KFU A;  3A0J A;  2F3I A;  5IP7 G;  4B3M Q;  1G29 1;  2B3G A;  1SRU A;  3S2D H;  3A5Z B;  1XJV A;  1TWH H;  4P73 A;  3AYH B;  5IP7 H;  2VQE Q;  1QUQ B;  3JC6 6;  5E7N A;  3LGJ A;  2R7Z G;  4BA2 I;  4YWK A;  1HZC A;  2R92 H;  5HGQ A;  2ZJP A;  4DR7 L;  3H15 A;  1QZG A;  3E0E A;  1LM0 A;  3J81 i;  3Q8D A;  1YIT A;  2VW9 A;  1TWG H;  1HNX Q;  4JI7 L;  1NMG A;  2MQH A;  2DUD A;  1S3O A;  1V1Q A;  2VL6 A;  4P72 A;  3CCU A;  1XPR A;  1E22 A;  5H1S E;  3PUW A;  4YY3 Q;  4NPS A;  1XPU A;  4QGU A;  5JJL A;  2Q2I A;  4APV A;  2YYZ A;  4HJA A;  4X6A H;  2UXC Q;  5IT9 c;  1E1T A;  2IT1 A;  1JMC A;  2JEA I;  3I4N G;  4XIG S;  1YNX A;  2KCM A;  1YBY A;  1VQJ A;  3VDY A;  4GS3 A;  4HJ5 A;  3CCQ A;  3CCE A;  4JI6 Q;  5GQO A;  1UEB A;  1O7I A;  5M5W H;  4LWC A;  2E2I H;  1CKN B;  4LF6 L;  1B8A A;  2D62 A;  2Y0S E;  4GLV B;  1N8R C;  3CC2 A;  2JA8 G;  4DV2 L;  2R7D A;  4DPG A;  3RNU A;  1XNQ L;  1PH1 A;  3S1N H;  2K50 A;  1S40 A;  4LF9 L;  3J7Z C;  4DUZ L;  3STB C;  3I4M G;  2Q2T A;  1P8L A;  4MTN A;  4JI5 L;  3PGZ A;  5GRO A;  4GN3 B;  4GKJ L;  3PV0 A;  4LFB L;  3KDF A;  4GN5 A;  4POF A;  3CXC A;  4OX9 Q;  2PQA A;  1L1O C;  2VS1 A;  4NXN L;  1Q7Y C;  2WAQ E;  1HR0 W;  2ES2 A;  4BBR G;  4GKK Q;  3UE0 A;  2D0P A;  1Y1W H;  1Q12 A;  3GTK H;  1AE3 A;  5JEA J;  3UDX A;  3GTL H;  3W1B A;  5IP9 G;  2OWO A;  4A3L H;  1GD7 A;  3RZO H;  2R93 G;  3ULP A;  4B3S L;  3L7Z C;  2FXQ A;  3U50 C;  4EX5 A;  4QY7 A;  3ERS X;  2LXK A;  1YHQ A;  1P16 A;  1JJ2 A;  5IYD H;  4JI7 Q;  1KIX A;  2VUM H;  4L5Q A;  1KQS A;  3T1Y L;  4C3J H;  4POG A;  2NZH A;  2ASB A;  1GVP A;  3HOY G;  3U4V A;  2EXD A;  5C0X G;  3AQQ A;  2ALY B;  1X65 A;  3PF5 A;  2XGT A;  3HOW G;  3PO2 H;  4K0K L;  4IOA A;  3J81 c;  5FLM H;  3ULJ A;  3JAM i;  3CCS A;  4PZ8 A;  2UUA L;  4DK3 C;  1PYS B;  3HOX G;  1I50 H;  3W5O A;  4IPG A;  4DUY L;  4HID A;  5LMU L;  1KL9 A;  1KHI A;  1EOV A;  1VQM A;  1PHJ A;  1Y1V G;  3K8A A;  3T1H L;  1Q86 C;  2CQO A;  2Y0S G;  2A19 A;  1YJ9 A;  3ICE A;  1XNQ Q;  2JK8 A;  3CCJ A;  1HH2 P;  5EAY A;  2D0O A;  1BBU A;  4IFD J;  2VZA A;  2R7F A;  4DUZ Q;  1V43 A;  4ME3 A;  4BXX H;  3AEV A;  5M5Y H;  4GKJ Q;  1LYL A;  4A3B H;  4LFB Q;  1X54 A;  1PFS A;  5DLQ E;  4KHP L;  2IHE A;  3NBH B;  1N34 L;  2KEN A;  2OCE A;  4A3K H;  1PV4 A;  1M1K C;  4NXN Q;  1BKB A;  2K5H A;  1X3F A;  3J7A 5;  4DNI A;  4DV4 L;  4HIM A;  2WAQ G;  4LUV A;  3ER0 A;  2JA7 H;  1IBL Q;  3E9I A;  4A3F G;  2ID0 A;  3HKZ E;  4JI6 L;  4JCV E;  4X64 L;  1KAW A;  1TXY A;  2Z6K C;  4UPA A;  1HNW L;  4LFC L;  4JI8 Q;  5GAG C;  4JYA Q;  4LUZ A;  4PG3 A;  1Q81 C;  4WJ4 A;  3GTP H;  3I55 A;  1VQ9 A;  3M4Q A;  2CWP A;  2JA9 A;  4DK6 C;  3IRB A;  3MXN B;  4QQB X;  3K81 C;  1XTD A;  1VQL A;  5C0X I;  3CPW A;  2I5L X;  1MJE A;  2N8N A;  1VQG A;  3CC7 A;  3TS0 A;  4LFA Q;  4K0K Q;  5C44 G;  1N9W A;  3K7U C;  4UP7 A;  1YJW A;  4RMF A;  1VQI A;  3CCL A;  1RL2 A;  4KLK A;  1EWI A;  2UUA Q;  3HOZ G;  1K83 H;  2UUC L;  1BVS A;  3TS2 A;  4DUY Q;  3KYH C;  1RIP A;  1W3S A;  1WOC A;  3FP9 A;  4P71 A;  1K8G A;  5LMU Q;  4A93 G;  1WFQ A;  1YHB A;  4MNO A;  1PH5 A;  1EYG A;  4GKK L;  1C0A A;  3H3V I;  1VQF A;  3KDF B;  1WCM H;  1EQQ A;  2PI2 A;  4A76 A;  2B29 A;  2PQA B;  1KD1 C;  3CQZ H;  3T1H Q;  3J81 j;  1FVI A;  4DR6 L;  4DV7 Q;  2HIV A;  3BZK A;  1UE1 A;  3G6E A;  1EUJ A;  5C3E G;  4RG1 A;  2CFM A;  3I4O A;  1PH8 A;  1K3R A;  5GAD C;  3TRZ A;  2R7Z H;  4IFD I;  1VQ4 A;  2HT1 A;  1IL2 A;  4DAY B;  1AE2 A;  2GVB A;  3A5U A;  4KHP Q;  1VQO A;  2BH8 A;  3U58 A;  1N34 Q;  1VQ8 A;  2MNA A;  1IXR A;  4R4C A;  4YCU A;  2IHF A;  3D31 A;  3J80 i;  4JC0 A;  1CKM A;  4X62 Q;  4DV4 Q;  3EN2 A;  3EIV A;  1N36 L;  1JJG A;  2Q2U A;  2GN5 A;  2WFW A;  3PUV A;  4YCW A;  3M85 A;  4IJH A;  4X64 Q;  3HKZ G;  3I4N H;  4A75 A;  2N3S A;  1HNW Q;  4JI4 Q;  4LFC Q;  2UXD Q;  3UDI A;  1Q8K A;  1UE7 A;  3RN2 A;  4Y52 H;  1U0L A;  1JJC B;  2JA5 G;  3S1Q H;  2NZO A;  1PH7 A;  2ZM6 L;  2JE6 I;  1PH3 A;  3PCO B;  1Z9F A;  4J15 A;  5JJI A;  4DV0 L;  4Y7N H;  4GN4 B;  1CKO A;  2RHQ B;  4HJ9 A;  1HNZ L;  2B63 G;  5JJK A;  3M4O H;  1XPO A;  1QVF A;  4EQ5 A;  4DV1 L;  1VQA A;  3E9H A;  2JA8 H;  5LMN L;  5HY6 A;  1XMQ Q;  2JA6 G;  1LUZ A;  3FKI G;  3KF8 B;  2AKW B;  2KBN A;  2OTJ A;  4QIW E;  3S24 A;  2UUC Q;  1XNR L;  3I4M H;  4R4Q A;  4IJL A;  2BA1 A;  4TQU S;  4UY8 C;  1D7Q A;  1GM5 A;  4A3E G;  1E3P A;  5IYD G;  2K5N A;  3D0F A;  1IBL L;  1Q82 C;  4DR6 Q;  3PIO A;  4C2M H;  3K80 C;  1FGU A;  4BBR H;  2NVQ H;  5JEA G;  1QVC A;  2ZTC A;  3NEL A;  4A3E H;  3RLF A;  3F2C A;  2CWA A;  3OTO Q;  1YEZ A;  1DGS A;  2JEB I;  4NB3 A;  4JI8 L;  3S14 H;  4JYA L;  3STB D;  1GO3 E;  5IP9 H;  1MKH A;  3KF6 A;  4HIK A;  2R93 H;  4O2D A;  1YHA A;  5BR8 Q;  3CF5 A;  3AFP A;  1VQH A;  4KHZ A;  4OXP A;  1VCI A;  4ALP A;  3CP0 A;  1TWA H;  1TWC H;  1Q1E A;  4LFA L;  1D8L A;  3F2B A;  1N36 Q;  4O0A A;  4LF4 L;  4QL5 A;  3HOY H;  3GTJ H;  2I0Q A;  2WB1 G;  1N33 L;  1SN8 A;  1QZH A;  3CCV A;  2LSS A;  1MIU A;  3ZJY C;  5M3M G;  3HOW H;  1NBW A;  4XTC S;  1J5E Q;  4NXM L;  4R1J A;  4DR3 L;  5M5X H;  2K52 A;  3HOX H;  4R4O A;  1X9N A;  3J80 c;  2OQK A;  1NMF A;  2ZM6 Q;  4DV7 L;  2MFI A;  4DV0 Q;  4BA1 I;  4L5S A;  1IBK Q;  4A3I G;  3UDG A;  1I6H H;  3H3V H;  1HNZ Q;  2KCT A;  1Y1V H;  1UE5 A;  1X6O A;  4BY1 G;  4DV1 Q;  1VQN A;  3S15 H;  1I3Q H;  4DR2 L;  5LMN Q;  4IFD G;  4QJF A;  5GAE C;  4GOP A;  1UE6 A;  2UUB Q;  2AHO B;  2IX0 A;  2WP8 J;  4JI3 L;  1E1O A;  1XNR Q;  5ELN A;  4YHH L;  2YU9 H;  4YCV A;  4LF8 Q;  3ULL A;  1E24 A;  1Y14 B;  3PUZ A;  1WJJ A;  4X62 L;  3KJP A;  4A3G G;  2IY5 B;  4LUO A;  1WI5 A;  4DR5 Q;  4YWL A;  3K0X A;  4PMW A;  1AH9 A;  3OYY A;  3OW2 A;  1NE3 A;  1CUK A;  1VQB A;  2I5M X;  4A3G H;  2RF4 A;  3AFQ A;  2Z0S A;  2NVY H;  1KXL A;  4JI4 L;  2N78 A;  2UXD L;  3CPF A;  4B3T L;  4A3F H;  1A63 A;  3F1Z A;  2H5X A;  1LTL A;  1PA6 A;  4OWW B;  4L5R C;  1NJI C;  1KC8 C;  3G48 A;  4OON A;  1KRS A;  3RN5 A;  2QGQ A;  2I5H A;  3CMA A;  2RHS B;  2ZTD A;  2VQF L;  4A3C G;  2VY3 A;  3HOU G;  2HIX A;  3UDF A;  4HIO A;  3UE1 A;  3GTM H;  4JV5 L;  4LF4 Q;  3M9B A;  3S16 H;  4UP8 A;  1OXV A;  1XMQ L;  1HZB A;  1OXU A;  1VQC A;  1N33 Q;  4JI1 L;  1EIF A;  2K75 A;  4DAM A;  1HR0 L;  3L0O A;  3M4P A;  3RLO A;  1IBM Q;  5M3F G;  3FHW A;  2AWO A;  1OXS C;  2ZTE A;  4JOI A;  1SE8 A;  5C44 H;  1W2B A;  1PH6 A;  4NXM Q;  3MEF A;  4DR3 Q;  1Q1B A;  5IYC G;  2A8V A;  2N49 A;  2AWN A;  2V1C C;  4JI2 Q;  3HOZ H;  4B3R L;  3H0G G;  4A93 H;  5FLX c;  1OXT A;  3G4S A;  3JAM c;  4R4T A;  4UP9 A;  5IYB G;  4DV6 Q;  4BY7 G;  3G71 A;  1IZ6 A;  1CSP A;  3I2Z A;  3PO3 G;  4FDB A;  3OTO L;  2NN6 G;  3RZD H;  3H0G H;  3TRE A;  5IWA Q;  2E2H H;  1L1O A;  4DR2 Q;  1ASY A;  1UWV A;  3TQY A;  5C3E H;  5BR8 L;  4IOC A;  1VQ6 A;  4AIM A;  4JI3 Q;  2E8G A;  2F52 A;  1JT8 A;  4AQY L;  4IPH A;  4YHH Q;  3KF6 B;  1GKH A;  3PUY A;  3PF4 A;  4L5T A;  4GOP C;  2WB1 E;  4P74 A;  2R92 G;  1S72 A;  3GTQ H;  1FJG Q;  1TWF H;  4LNQ A;  1A62 A;  2MO1 A;  1Q46 A;  2R6G A;  1J5E L;  4JI0 Q;  3HFZ B;  2BH2 A;  2CKZ B;  4DV5 Q;  3S1R H;  1YVC A;  3CC4 A;  1QVG A;  3PUX A;  4B3T Q;  1VQE A;  5C4J H;  2YTY A;  1H95 A;  2OQ0 A;  1YIJ A;  1M90 C;  1SLJ A;  1PH4 A;  1EQR A;  1Z47 A;  2KHI A;  4A3M G;  3CD6 A;  1IBK L;  4AYB G;  3KJO A;  1N32 Q;  2VQF Q;  2JA5 H;  4WJ3 M;  3B6Y A;  1B7Y B;  1YI2 A;  1I94 Q;  4A3B G;  1PVO A;  2UXB L;  3RLN A;  1EFW A;  4JV5 Q;  2JQO A;  4A3M H;  4JBM A;  1VQ5 A;  4JI1 Q;  1SFO H;  1HR0 Q;  2UUB L;  2B63 H;  4BBS G;  2VNU D;  3NEN A;  4DR4 L;  4DR1 L;  4OO1 I;  3DM3 A;  4LF8 L;  4JBW A;  3PIP A;  2KHJ A;  1JB7 A;  2JA6 H;  4GOP B;  3FKI H;  2K5V A;  4GNX A;  4OWX B;  4B3R Q;  2BA0 A;  4JOI C;  1J6Q A;  4DR5 L;  5C4X G;  4IPC A;  1OTC A;  1L0W A;  3A74 A;  3KOJ A;  2DGY A;  2OTL A;  2UU9 Q;  3BU2 A;  4X65 Q;  2NN6 I;  1G51 A;  2YV5 A;  2PI2 E;  5C4X H;  4TVA B;  1KRT A;  3TEH B;  5AJ3 L;  3RR5 A;  1U5K A;  3GDE A;  4LF5 Q;  1K0R A;  2E5L L;  4P75 A;  1JE5 A;  1OXX K;  1MJC A;  4AQY Q;  3BZC A;  1Y1W G;  1C9O A;  4A4I A;  5FJ8 G;  1VQK A;  1QUQ A;  2AMC B;  2E2J H;  2Z6K A;  3U4Z A;  4A3L G;  1K73 C;  4LF7 L;  1XMO L;  1YJN A;  1BBW A;  5J3B A;  2Q2H A;  1PYB A;  3HOV G;  2ZJR A;  4DV3 L;  3M7N A;  5FJ8 H;  4IPD A;  1IBM L;  2EIF A;  4R4I A;  2VUM G;  4OO1 G;  2MO0 A;  1EIY B;  4DR7 Q;  2F4V L;  4X66 L;  1NTG A;  3DLL A;  3HOV H;  4JI2 L;  5M3M H;  2NVT H;  4JG2 A;  1X56 A;  5IE8 A;  2C35 B;  2GVA A;  5IY0 A;  3PO2 G;  4DV6 L;  3WWV A;  2ATW A;  3S17 H;  5C0X J;  1CSQ A;  4C3H H;  5FLM G;  2HHH L;  4OWT B;  3CCM A;  2ZJQ A;  5IWA L;  2UXB Q;  3S2H H;  3GTG H;  3CW2 C;  3NEM A;  4A3I H;  2EQS A;  2QA4 A;  3EBE A;  1E7Z A;  3KLW A;  1B70 B;  2RCN A;  4BY1 H;  1CKN A;  2K14 A;  4DR4 Q;  4DR1 Q;  1L1O B;  1K8A C;  1PH2 A;  2CCZ A;  4B3M L;  1X55 A;  1ASZ A;  2YTX A;  4H02 A;  1HJP A;  3S1M H;  2HQL A;  1FJG L;  3K7A H;  1SRO A;  3CME A;  1K9M C;  4LF6 Q;  2XTI A;  3I56 A;  1I5F A;  2VQE L;  1VQD A;  4DV2 Q;  1YZ6 A;  4C3I H;  4BXX G;  4JBJ A;  4MZ9 A;  4JI0 L;  4DV5 L;  2PNH A;  1VS0 A;  4GNX C;  4GLA C;  4PZ6 A;  4GLX A;  1VQP A;  2IX1 A;  5K36 G;  2K4K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...