3S1MH

Rna polymerase ii initiation complex with a 5-nt rna (variant 1)
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Initiation complex structure and promoter proofreading.
pubmed doi rcsb
molecule tags Transcription/rna/dna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 19
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2011-05-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3s1mH00
5FLMH 1X65A 4TVAB 1IYJB 3PO3G 3EBEA 2UUAL 2JA8G 4POGA 5E7NA 1YBYA 2YTVA 4IJHA 1XMOQ 4JI1L 2XGTA 3U58A 1X3FA 4H02A 3D31A 3I4OA 4IPCA 4K0KL 4A3KG 3TQYA 3PO2G 3ZJYC 2IX0A 2I5HA 3PF4A 1Q1BA 1N8RC 4RMFA 1AH9A 1WCMG 2R93G 5C3EG 1A0IA 2NVQH 1Z47A 3CP0A 4L5TA 3MXNB 2OTLA 1EFWA 4AQYL 1K8AC 1GVPA 4DV3Q 5M3FH 4B3RQ 1CKMA 2NN6I 2GN5A 1Q7YC 2PNHA 4WJ3M 4LF6Q 1A63A 4IFDJ 1I5FA 2VY3A 3A0JA 2PI2A 4FDBA 4R4TA 2UUCL 2AHOB 4LF8L 3NBHB 3S24A 2LXJA 4K0KQ 2NVXH 4JI6L 3FKIG 2VUMG 4OO1G 4DV5Q 1XJVA 3CQZH 4P72A 4BXXH 4P75A 3G48A 2VUMH 2MO0A 5IYCG 1OXTA 1JJGA 1HJPA 2HIVA 4PZ8A 2LXKA 4GN4B 2JA9A 3GTLH 4R1JA 4NPSA 2D62A 3HOXH 3S1RH 2ZTEA 4DV3L 4DR7Q 1HZ9A 1GKHA 1UE5A 3HKZG 4LWCA 4MNOA 1OXVA 4OX9Q 1X9NA 3RLFA 4LF5L 4LF4Q 3RLNA 1XNRQ 3M7NA 4X6AH 3F2BA 2JA5H 4APVA 3JC66 4JI3Q 1L2FA 2Q2HA 1QZGA 4DR2L 3AFPA 3LGJA 4X62L 1IBML 4JG2A 2CCZA 2KHIA 2R7DA 2KENA 2PMZE 3S1NH 4JBWA 3BU2A 4Y7NH 2WP8J 2ZM6L 4DR3L 4KHPL 2ALYB 1SR3A 1WJJA 1QUQA 2WAQE 4LFBQ 4LFCL 2UXCQ 1X54A 3CCRA 4JI4L 2JA8H 3S14H 4IFDG 1EWIA 1HZBA 3CC7A 3K7UC 1TXYA 4DV0Q 4BY7G 5C4JH 2LSSA 3G6EA 4B3SL 3KJOA 2V1CC 2JK8A 4JI7L 4A3KH 4POFA 4YHHL 4LUVA 1GO3E 1C0AA 5C44H 3S17H 2R92H 2VL6A 3ULLA 3CCQA 1E22A 1WOCA 1UWVA 1XPUA 2K5NA 5LMNQ 1X55A 3HOUH 4AIMA 4A3BH 1HR0W 2EIFA 4UY8C 4BXXG 4EX5A 4YY3Q 3KDFB 1G291 3CAMA 1RIPA 4KHZA 4JI0L 1V9PA 3CF5A 1TWFH 4C3HH 1CKNA 1QZHA 2ATWA 2R7FA 4A93G 1D8LA 4AH6A 4LFBL 1TWHH 4PZ7A 4NXNL 1KL9A 4JI1Q 4HJ7A 1EQQA 4JI4Q 1VQLA 3S2HH 2ZJQA 2VQEQ 2ZJRA 3DM3A 2K50A 4B3TL 5AJ3L 4DR6L 5IP9H 2OWOA 3ICEA 2CKZB 1ASYA 3UDIA 4A3GG 5DLQE 3UE0A 4DUZQ 1KXLA 3RZOH 1VQEA 1IL2A 3GDEA 2E2HH 4GOPC 2Y0SG 5JJIA 3HOZG 3GD7A 4DV6Q 2D0OA 3AEVA 2CWAA 4NB3A 3PIOA 2Z0SA 5GADC 1AE3A 3M85A 1L1OC 1BBWA 3OTOL 4QIWE 1PH4A 1UE1A 1C7YA 4JI0Q 4BBSG 2JJQA 1NTGA 2FXQA 4QJFA 2Q2UA 3L0OA 2VNUD 3H3VI 3I4MG 2UXDL 4IPDA 2WB1G 4C2MH 2UUAQ 3HOZH 2K4KA 4P71A 1BKBA 5AJ3Q 3CCEA 4DV5L 2DUDA 2Z6KC 3CCJA 1JB7A 1PYSB 1S3OA 3J81c 2E5LQ 3M3YH 3NEMA 2Y0SE 4WJ4A 1VQCA 2IHEA 2B63H 3F1ZA 3PV0A 2IT1A 1PHJA 3CMAA 1P16A 2JA5G 4DV7Q 2H5XA 3GO5A 3H0GH 3OTOQ 1EIFA 4GNXA 1L1OB 4A4IA 3FHWA 3CCLA 4DNIA 4A3DG 4LF5Q 4UPAA 3UE1A 1E1OA 1YHBA 1XNRL 3FKIH 4IPGA 1FVIA 4OWWB 1WFQA 1UE7A 2JQOA 3D0FA 4A3MG 5H1SE 3CC4A 2R7ZH 3K80C 4GKJL 1HNZQ 2R92G 1NJIC 4X66L 2F3IA 3CCSA 1G6PA 4DK3C 1NBWA 4JI6Q 4MTNA 2ASBA 1Q81C 2OTJA 1X6OA 1A8VA 2ID0A 1PH2A 2HHHL 2GVBA 4PG3A 1VQPA 3CC2A 3K81C 3PUVA 1X3GA 5GAEC 4PZ6A 2ES2A 1ASZA 2I0QA 1N33L 4A3LG 1HZAA 1YJNA 1V1QA 4GOPA 1N34L 1VQ8A 3EN2A 2UU9Q 1QUQB 4DR7L 2YV5A 3W1GA 4JI8Q 4OO1I 1CKOA 4JBJA 3WWVA 1EOVA 3BZKA 2VZAA 3W5OA 1W2BA 2VQFL 4LF4L 3KLWA 3I4MH 5J3BA 1Q82C 3HOWG 1YHQA 2MQHA 3K0XA 4JOIA 5M5YH 3OW2A 4A3FG 4OONA 3SGIA 2RHSB 1XNQQ 4JV5L 2PQAB 4DR1Q 3ULPA 5GAHC 1XMQL 1K0RA 5FJ8H 1NY4A 2JEBI 2UUBL 4LFAL 1PH5A 3RR5A 2NVTH 1PVOA 2QA4A 1J6QA 2AKWB 1XPRA 1IBKL 4JI5Q 5C4XH 1QVFA 5FLXc 1E7ZA 1Y1WH 2BH8A 4X64L 1PA6A 2YTYA 4LUOA 1SFOH 1U5KA 4OWXB 3GTQH 1GM5A 3HOWH 2R7ZG 1KAWA 1MKHA 1BBUA 1VQFA 2A1AA 5IP7G 4A75A 3J7A5 3PUYA 1QVGA 3AQQA 3STBD 4C3IH 2JA6H 2WB1E 4DV1L 4DAYB 3TS2A 1VQ6A 3GTKH 3M4PA 1T9HA 4DR5L 1YI2A 1PYBA 4P73A 1RL2A 1E24A 4A3MH 4HIKA 3OYYA 1X3EA 4GKKL 1XNQL 3VDYA 1XPOA 4X65Q 4HJ5A 2B3GA 1TWGH 3KF6A 5LMNL 4DV4Q 4B3RL 1O7IA 2C35B 4A3DH 4DAMA 1IBKQ 5JJKA 2N78A 2UXBQ 2F4VL 1Q46A 1MIUA 2ZTCA 1CSPA 3I2ZA 5M3MH 3U4VA 2UXDQ 4A3IG 1Y1WG 1HNWQ 3RN5A 5BR8Q 4BA2I 2IY5B 1VQOA 2KCMA 4DUYQ 1Q86C 1Q8KA 1CUKA 1WCMH 2R93H 2R6GA 3IRBA 3KF6B 3I55A 3PCOB 4O0AA 4DV1Q 4LF7Q 4DR6Q 2NVYH 2IX1A 1NMFA 5LMUL 1YJWA 1IXRA 1IBLQ 4JBKA 4UP9A 1PFSA 1M90C 1HH2P 1YNXA 1CKNB 3E9HA 3BZCA 1KQSA 2NN6G 4YWMA 3I56A 1L0WA 4GLVB 4LUZA 4LW1A 1FJGQ 1S72A 3E9IA 1VQ4A 5JEAJ 3PGZA 2YU9H 2HT1A 4AYBG 3BJUA 3M4OH 4LNQA 2AWNA 1VQAA 1N9WA 3KOJA 4YWLA 3JAMi 5M3FG 1I94Q 4GKJQ 4L5RC 2GVAA 5BR8L 4DV2Q 3HOVG 3CD6A 1J5EL 4JI3L 1VQHA 2BA0A 3HOVH 1VQ9A 3UDXA 4DPGA 5M5XH 4B3MQ 1VQNA 4BY1G 2NZOA 2PI2E 3S2DH 2PQAA 1PH7A 2MFIA 5LMUQ 1IBLL 1DGSA 3CMEA 2E5LL 1K8GA 2QEXA 4A3CH 2IHFA 3E0EA 5IYDG 1JMCA 2YTXA 1YZ6A 1TWCH 4R4IA 1G51A 2MO1A 4GN3B 3J81i 4PMWA 4LFCQ 4UP8A 1N34Q 4ALPA 3KFUA 1WYDA 1N36L 4YWKA 1FJGL 1Y1VG 3G4SA 1SLJA 3HOYG 3J81j 4JI8L 4GOPB 3GTMH 5IE8A 4BY7H 1XTDA 1KIXA 1PH3A 2QGQA 2I5LX 3G71A 2UUCQ 3PO2H 5IP9G 3U4ZA 1LTLA 3U50C 1I6HH 4DKAC 3CPFA 5C0XI 5C44G 4DR1L 4JI2L 2B63G 2OQKA 5C3EH 1VCIA 4QL5A 1UE6A 1PH8A 3I7FA 3TREA 2XTIA 1OTCA 3T1YL 2EXDA 1CSQA 4GLAC 4P74A 4JI5L 4YY3L 1SN8A 2RCNA 2JA6G 2K14A 4R4CA 4A3BG 3EIVA 5EAYA 3PIPA 3KF8B 4QQBX 1JE5A 4X64Q 3J80c 2HHHQ 1VQJA 5HGQA 4O2DA 2F52A 1I3QH 4NXNQ 2MNAA 3KYHC 4TQUS 1VQBA 1N36Q 4DR4L 4B3TQ 4IO9A 3CPWA 2ZTDA 3CXCA 1K3RA 1LM0A 4BBRH 3GTPH 1IZ6A 5IWAQ 5JEAG 2N3SA 2K52A 4IJLA 1V43A 5LMNW 1B70B 3ULJA 1TWAH 4GNXB 4DR5Q 3RZDH 1YJ9A 4R4QA 4ME3A 2HIXA 2OCEA 4XTCS 5C0XG 4HJAA 4KI0A 3PUXA 1KD1C 4DR2Q 1VQKA 1D7QA 4X65L 1SE8A 2KBNA 3K7AH 4JV5Q 1KHIA 3ERSX 4MZ9A 2UXBL 5FJ8G 3PUZA 2UUBQ 1S40A 4J15A 1HNWL 3H0GG 1U0LA 2KCTA 1QVCA 3GTGH 4LF9L 2WFWA 2EQSA 2VW9A 4QY7A 3A74A 4L5QA 3M4QA 3HKZE 2ZJPA 3FP9A 4DV0L 1UEBA 1SROA 2D0PA 1N32L 2Q2IA 5HY6A 2VS1A 3PO3H 1SMXA 1K83H 4YHHQ 3RN2A 1E3PA 1LYLA 3A5UA 4IPHA 1Y14B 4A3GH 3CW2C 4JYAL 3HKSA 4BBSH 1EQRA 4JOIC 4A3JG 3I4NG 2JE6I 4XIGS 4AYBE 3J7ZC 1EYGA 4A3IH 3MEFA 2E2JH 5C0XJ 4JCVE 4EQ5A 3GTOH 1PH1A 1BVSA 1VS0A 4GKKQ 1VQMA 3NENA 4LF6L 1Q12A 2CFMA 2N8NA 4HIOA 1R9TH 1I94L 4AQYQ 3HOYH 3DLLA 4LF8Q 1J5EQ 3HOUG 2A8VA 5IYBH 1VQ7A 5IY0A 1VQIA 3B6YA 1GD7A 3M9BA 2AWOA 4R4OA 2VQEL 4B3ML 4HJ9A 4DK6C 2I5MX 1NE3A 1HNZL 1B8AA 3KDFA 1HNXQ 3S16H 1X56A 1N32Q 4A76A 2BH2A 4A3EG 4A93H 1MJCA 1EIYB 4DUZL 1FL0A 4LF7L 2RHQB 3L7ZC 1OXSC 4JC0A 1YEZA 3TS0A 1I50H 4JBMA 4C3JH 2N49A 4IFDI 4A3JH 2JA7H 2RF4A 3CCVA 2E2IH 1B7YB 2A19A 3CCUA 4GS3A 1PV4A 5FLMG 4OX9L 5IYCH 1Z9FA 3HFZB 5ELOA 3TRZA 1OXUA 1KRSA 2AMCB 5GQOA 2CWPA 1MJEA 4L5SA 3JAMc 5GROA 2Z6KA 4BBRG 4KLKA 2L15A 1K9MC 1LUZA 3KJPA 1A62A 2B29A 3Q8DA 4JI2Q 2JA7G 2BA1A 4DV2L 3RLOA 3CCMA 5IYDH 1HNXL 2WAQG 3T1HQ 1C9OA 3A5ZB 3W1BA 3F2CA 4YCUA 4KHPQ 1KRTA 1WI5A 4YCWA 4BY1H 1YIJA 4HIDA 4NXML 4LFAQ 5IP7H 1JT8A 4HJ8A 1HR0Q 1KC8C 4Y52H 3PF5A 2NZHA 4DV7L 3I4NH 2DGYA 4IOAA 5IWAL 1VQGA 4QGUA 5M3MG 3L2PA 4IOCA 4UP7A 2YYZA 1P8LA 4YCVA 4A3EH 5IT9c 2KHJA 1YVCA 1W3SA 4A3FH 3F2DA 4GLXA 2OQ0A 5JJLA 1Q1EA 4GNXC 1HZCA 5GAGC 2HQLA 4X66Q 1VQ5A 3ER0A 3T1HL 3RNUA 5ELNA 1PH6A 2K5VA 2JEAI 4X62Q 3F8TA 1JJ2A 3UDFA 3K8AA 1AE2A 3GTJH 1IBMQ 2K75A 1M1KC 3NELA 4NXMQ 1E1TA 1OXXK 4DV4L 3H15A 3AYHB 3AFQA 1JJCB 3T1YQ 3J80i 4HIMA 1YITA 5M5WH 1HR0L 1PH9A 4LF9Q 2F4VQ 3S1MH 3HOXG 4BA1I 2ZM6Q 4DR3Q 3UDGA 3S15H 4A3LH 1N33Q 1YHAA 1XMOL 4OXPA 2UXCL 2UU9L 4DUYL 5IYBG 5C4XG 4DR4Q 1K73C 3STBC 1Y1VH 2Q2TA 4B3SQ 5K36G 4JYAQ 4JI7Q 1FGUA 2VQFQ 4DV6L 3S1QH 1L1OA 1SRUA 3PSIA 2K5HA 4OWTB 4GN5A 4RG1A 4A3CG 3PUWA 1NMGA 1XMQQ 1H95A 3TEHB 2CQOA 3H3VH 2E8GA 1EUJA 1VQDA
chains in the Genus database with same CATH superfamily
1X65A 2JYOA 4OIJA 4RGMA 2UUAL 4POGA 2QILA 3DWPA 1X3FA 4EGVA 3I4OA 1QNKA 3PO2G 3VYTA 2IX0A 1YNJD 2I5HA 3IAYA 1Q1BA 1N8RC 1EWCA 1U9RA 4XQNA 1M4VA 1TWGB 4IUTA 1QB5D 1CKMA 3V05A 4ZRZA 1IKMA 2NN6I 2GN5A 3OMCA 1PTOH 3GTQB 2VY3A 4FDBA 2UUCL 4ODGA 4K2KA 2AHOB 3S24A 3VR5A 4K0KQ 1ML0D 3DHQA 3ZYYX 1DOLA 4OO1G 2VUMH 1OXTA 4ZCKA 4DR7Q 1EFID 4LWCA 3HKZG 1FYCA 1X9NA 4LF5L 4LF4Q 5M5XB 1LTRD 2WV6D 4APVA 4JI3Q 1L2FA 1TT2A 2B2UC 2DJFC 4DR2L 4X62L 2CCZA 3S1MB 4JG2A 2R7DA 2WAQB 2KENA 4JBWA 3BU2A 4Y7NH 4Y7NB 2WP8J 2SDFA 4KHPL 2KCNA 1SMYC 2Z1CA 1QUQA 5EJWA 2NTTA 4IFDG 1HZBA 3OW7A 4IZ8A 1SNPA 1PYWD 1K8MA 2H1EA 4LJZC 4POFA 1C0AA 2R92H 4EQPA 3ULLA 3PO3B 4K8IA 2Y0SB 1UWVA 3DUZA 4G4KA 2B2YC 1X55A 1HR0W 3KDFB 1RIPA 4KHZA 4JI0L 1TWFH 4C3HH 1CKNA 1QZHA 1Y8PB 2ATWA 3A8IE 3S2HB 1I4HA 3VR4A 2O5IC 3S2HH 4K6LA 2ZJRA 3DM3A 5EPJA 3NBHA 5IP9H 2CKZB 3UDIA 3SK8A 3MWYW 2F03A 1SYGA 1HQMC 3GDEA 2C5CA 2RBMA 2Y0SG 4OEMB 4RGOS 4DV6Q 2D0OA 3PIOA 3RUZA 3MXNA 1L1OC 3OWFA 4O1NA 4JI0Q 2XWBB 4B08A 3EVQA 1X3QA 1TKWB 4QJFA 2Q2UA 3I4MG 1EY6A 1DM0B 4C2MH 3OIPA 2UUAQ 2KEEA 4FNFA 2Z6KC 3UI2A 4C3JG 3J81c 3M3YH 1H9RA 3NEMA 2IHEA 1D1KA 3F1ZA 4UHVA 2K5WA 3TP6A 5EKKA 3VA7A 1PHJA 2K33A 1P16A 3GO5A 4GNXA 1L1OB 4LF5Q 1EZ6A 4CJ2C 5I9OA 2D9UA 5J22A 1IW7D 4K5XA 3KF8A 1BF4A 5A2QL 3R93A 1C48A 3I72A 1PH2A 2HHHL 4CJ0B 4PG3A 3CC2A 1B50A 5COYA 1N33L 4X3UA 4ZKCB 1D6EC 3TBIB 4GOPA 2EE1A 3PMFA 2UU9Q 1QUQB 3GV6A 3D4DA 3C3LA 5JVH3 4JI8Q 1JR0D 3BZKA 4XYQA 2VQFL 5E1FA 1BDOA 3I4MH 3K0XA 2CH4W 2VXWA 2NTSA 4OONA 4JV5L 1XNQQ 4KKSA 4DR1Q 1XMQL 1K0RA 2UUBL 1F2YA 1PH5A 3RR5A 1WTRA 4HAEA 1XPRA 4FXGC 4IUUA 4LUOA 3NUCA 4OWXB 1ET9A 3BS1A 1BBUA 2LMCB 1BQQT 3NXWA 1QVGA 3I90A 4DV1L 2JA6B 4DNTB 3M4PA 3BVZA 5I9PA 1PYBA 2B2WA 3R2IA 4HIKA 3H3VC 1HA5A 1X3EA 1O7LA 1XNQL 1TWGH 1LTGD 3KF6A 4B3RL 2C35B 2UXBQ 2F4VL 2CW0C 5M3MH 1Y1WG 4IQZA 1EQVA 1O80A 4LAAA 1G2TA 1VQOA 4X3SA 5LL6S 1CUKA 1ZYRD 1WCMH 2VB3X 3K0YA 3PCOB 4O0AA 4DV1Q 1LV9A 4QMGA 2DY7A 2NVYH 2IX1A 2BDNA 4JBKA 1PFSA 1HH2P 2E74C 4KTAA 1KQSA 1JWMD 1K3BC 4K2LA 2NN6G 5CV8A 3ONAB 1WTVA 1SE4A 5JEAJ 4N9PA 3IFTA 2F0SA 2HT1A 3M4OH 1VQAA 4A3JB 3HOVG 1S5CD 3A56A 1VQHA 3BDCA 1VQ9A 3UDXA 1VQNA 4RAUC 2QF7A 2NZOA 1BXTA 1DGSA 1K8GA 4A3CH 3HOUB 3SK4A 3J7YW 3OHXC 5D3DA 3W3AA 4R4IA 1D2BA 4LFCQ 1ESRA 4UP8A 2I46A 1AW7A 2KUMA 3G4SA 4JI8L 1TWAB 3RZDB 1XTDA 1KIXA 5IP9G 3U50C 5JVG3 2PMZB 2K5DA 4DR1L 2B63G 1VCIA 5CMDA 2WKDA 1F9RA 4R4CA 1PMRA 1SE3A 1SYDA 1JE5A 4X64Q 3GTGB 5HGQA 4O2DA 2F52A 1I3QH 2B63B 2ZTDA 1LM0A 4BBRH 3GTPH 1IZ6A 2LY7A 5JEAG 4FF3A 1MI2A 4IJLA 5LMNW 1V43A 1B70B 2I07B 2HIXA 2OCEA 4XTCS 4HJAA 1KD1C 1AN8A 1W6JA 4DAPA 3HOWB 1BR9A 4L63B 2EVBA 2KOLA 4JV5Q 3DWQA 2UXBL 2IX3A 5FJ8G 1HNWL 3H0GG 4LF9L 1B9NA 2KECA 4QY7A 4B9WA 5CC4A 3FP9A 2D0PA 1E2ZA 5HY6A 1K83H 4YHHQ 1LYLA 3A5UA 4JYAL 1YNND 5D3IB 3HKSA 2JE6I 1EYGA 3RD4A 4A3IH 3BDOA 5C0XJ 4JCVE 1VS0A 4RA8A 4ZUJA 1XTCD 2N8NA 2K04A 4LF8Q 5T1GA 2AWOA 4JW0A 4HJ9A 1NE3A 5ELFA 1N32Q 1X56A 3DM1A 2EZVA 1G6ZA 4DUZL 1ZKOA 2AUKA 2RHQB 1OXSC 4IUPA 4JBMA 5KIXA 5I6WA 2HCCA 1PXUA 3PO2B 2A19A 1PV4A 3MFGA 1TS2A 3RMHA 1TS5A 3FMCA 2AMCB 5GQOA 3DWAA 5I2YA 5F2DA 1MJEA 2ICIA 1VF7A 4KLKA 2EYHA 3NSWA 1A62A 3Q8DA 3D8GA 4DV2L 5IYDH 1ENFA 1CZWA 2F0VA 4YCUA 4NXML 3D4RA 5IP7H 1EY7A 2HUGA 3K58A 1KC8C 4WJWA 4DK1A 4Y52H 2PZTA 3PF5A 3OSOA 4DV7L 2DGYA 3C1FA 2RSNA 5LHY1 4QGUA 3L2PA 4LMQD 1STAA 1P8LA 5IT9c 2KHJA 3QWNA 4GLXA 5ELNA 4EQNA 1Z6HA 1IBMQ 3F8TA 4IURA 3K8AA 1AE2A 2K75A 3NELA 2PO4A 1E1TA 4DV4L 4NXMQ 5EPKA 3AFQA 1JJCB 2FMCA 4LF9Q 3Q0AA 4A3LH 4DR3Q 1JWUD 1UEAB 3J7AV 1U4PA 3BYTB 1YHAA 3V2TA 4XDXA 4N8FA 4DR4Q 3K5MA 1U4MA 1BOSA 5K36G 4JI7Q 3GTOB 5AFWA 1L1OA 4A3CG 1G8ZD 4ILWA 1NMGA 1S5BD 1KAAA 2K01A 3H3VH 2RQXA 2E8GA 2HDLA 1EUJA 2WINB 3CU7A 1A3UA 2SNSA 2YTVA 4CGYB 3WOFA 3U58A 4K0KL 1NSNS 2F3WA 3TQYA 3CQZB 3IFDA 3PF4A 2RDFA 4RMFA 1WCMG 4RKBA 4IUVA 2PQEA 1TY0A 1EFWA 3DMUA 1GVPA 4U68A 1JB3A 1Q7YC 2PNHA 2EDGA 4TKOB 4LF6Q 4IFDJ 1I5FA 2F0IA 5DM73 2PI2A 5CV6A 4LF8L 2B8FA 4OHJA 2LXJA 1O7YA 2RSOA 2M00A 1F77A 1AZQA 3IKJA 4HSPA 2AUJD 3NPPA 1XJVA 4KKUA 1WTHA 4P72A 4A3EB 1SNDA 4OO1H 1TIID 5C3EB 1SJHD 1HJPA 3R8BA 1GUOA 2LXKA 1HZ9A 1MBYA 4M8AA 3SE0A 1UE5A 1OXVA 1Q90A 3RLFA 1XWEA 1XNRQ 1I4QA 2JA5H 3JC66 2LS01 1KLGD 1M8AA 5IT9E 1UAPA 4OGQC 2L9HA 3S1NH 3I91A 4FF1A 1LTTD 2WKCA 3N52A 2PPBC 2ENBA 1DYQA 2R7ZB 2ZXPA 3CCRA 4KY6A 2JA8H 1EWIA 3VYUA 3CC7A 4DV0Q 1AEXA 4BY7G 2LSSA 2JK8A 4JI7L 1STHA 3C2PA 3GP7A 5FOBB 3S17H 2F0PA 4HN7A 2VL6A 4IN3A 5BN4A 3CCQA 1CK1A 3S15B 1WOCA 5DAUA 2KJXA 2MJ8A 3EROA 2F0JA 1XPUA 4CKBA 3HOUH 3V96A 4AIMA 4CDCC 2K05A 4UY8C 4L8JA 4EX5A 4YY3Q 1G291 3CAMA 4PV1C 3KLSX 2L1BA 3CF5A 2NWGA 5ELCA 4C1NK 2R7FA 1D8LA 1ZEQX 1Z7TA 1NCVA 2DJGC 4NXNL 4FXDA 4JI4Q 4B3TL 3SR1A 5AJ3L 1ASYA 4RHRA 1KXLA 1PZKD 2JSOA 3T13A 2NYZD 2XRSD 2E2HH 1E0BA 4NB3A 4CDFC 2Z4HA 1UE1A 2NVYB 2Z6BA 4F8MA 2JJQA 3SEBA 2FXQA 2VNUD 3AB9A 2K4KA 4P71A 4NW2A 1BKBA 5AJ3Q 3CCEA 5E4WC 4KJNA 4DAYA 2DUDA 1JB7A 1PYSB 5D14A 5FLXL 2Y0SE 3H94A 3RZOB 3S9WA 1A3TA 1WCMB 2O5JC 1T5XD 2JA5G 1HTPA 1R9TB 4CJ1B 3G7LA 3FHWA 2SEBD 3LX0A 4FF2A 2G9HD 4HCSA 4PMCA 3FKIH 3VYSA 4OWWB 1WFQA 1PRTC 2NB0A 4MN3A 2E76C 3CC4A 5IGFA 1V1PA 4K8JA 2R7ZH 4GKJL 4Z9CB 1PFBA 1STEA 4KY5A 4X66L 1NBWA 2KVMA 4OELB 4AYBB 2OTJA 1A8VA 2ID0A 2GVBA 1VQPA 1Y8NB 3A55A 1ASZA 5FO9B 4A3LG 1N34L 5ELDA 3L3OC 1S5DD 4DR7L 2YV5A 3S2DB 3HS0C 1GUNA 4OO1I 4JBJA 2VZAA 4LF4L 1J9OA 4G57A 3FDTA 1A6XA 3HOWG 1SYFA 5M5YH 3OOCA 5GAHC 3MXPA 2XWJB 3NTIA 3BDLA 5FJ8H 1KDAA 4LFAL 5KGUA 2RDGA 2CH4A 3FPPA 2QA4A 2RVLA 1QVFA 3BVMA 4ZUIA 1E7ZA 2NBFA 1Y1WB 2YTYA 1ENAA 3KBGA 1U5KA 2RKSA 3GTQH 2R7ZG 1KAWA 2F0TA 1VQFA 3PUYA 3AQQA 3STBD 1Q3LA 2WB1E 3FEWX 3LNNA 1STYA 4KD4A 1G91A 4DR5L 1YI2A 1RL2A 1E24A 1PTOC 1CHPD 3JAML 1F2LA 3QR8A 1PRTF 3EJIA 1EWHA 2B3GA 1CZGA 4I7AA 1CA5A 1STNA 5JJKA 1Q46A 3NK9A 1F9QA 2F0DA 2KCMA 1NR4A 4DUYQ 1WD0A 1K28A 1JOKA 1I4GA 3IRBA 5EBCA 3D6WA 4LF7Q 2E2DC 1NMFA 1YJWA 1SNQA 1IXRA 4UP9A 4PMBA 2NUCA 3EQLC 1RJTA 1B4OA 2H4OA 3TZUA 3U9SA 1F9SA 1PRTD 3I56A 1L0WA 2EJMA 2B8GA 5IT9L 1S72A 5E4XA 1VQ4A 2YU9B 2CVRA 4AYBG 1L0XB 3BJUA 1LLRD 1B3AA 2AWNA 1N9WA 4YWLA 1I94Q 5C4ZA 4JI3L 5KYLA 3HOVH 2K03A 4B3MQ 1TWFB 2B2TA 4C3HB 2PI2E 2PQAA 1PH7A 1WTPA 3EFXD 3R3OA 5LMUQ 1TU2B 4MIUA 1H9SB 5IYDG 2G5DA 3J81i 1G51A 4GN3B 4G7ZC 4RH6A 4ALPA 1WYDA 1BCPB 1Y1VG 3J81j 3J80E 3VA5A 3GTMH 1I6VC 4BY7H 5L37A 1ONLA 1VF5C 2UUCQ 2O2LD 3MVVA 4DKAC 5C0XI 4JI2L 3K57A 1K0SA 4WRDA 4QL5A 2NVQB 2K5QA 3T51B 1OTCA 1JOQA 4XT1B 2RCNA 5JAVA 2JA6G 2K14A 3PIPA 1RCVD 3J80c 1RTOA 2B2WC 4LK1C 2HHHQ 2MNAA 1VQBA 5I4DA 1K3RA 2A6HC 3NE5B 2N3SA 2D5DA 1DONA 3Q6SA 1RF2D 1YJ9A 2FHTA 3SK6A 1VQKA 2PZWA 1SE8A 3BZDB 2KBNA 1BCPF 1YNNC 3K7AH 5A2QE 1KHIA 3ERSX 2N55A 2NVXB 2UUBQ 1S40A 2B2UA 2KCTA 3GTGH 5CV7A 2F0KA 1UEBA 1SROA 4YIJA 1KABA 3J81E 1N32L 1WTWA 3RN2A 4IPHA 1Y14B 1PZID 1WTQA 1QJOA 4BBSB 4JOIC 4XIGS 3R2TA 2LFNA 4KHVA 2RA4A 3BVGA 4Q5VA 4EQ5A 3GTOH 3T53B 3NENA 1Q12A 1R9TH 4AQYQ 3HOYH 4G7HC 3S1NB 2A8VA 3M9BA 4BBSG 2VQEL 1TY2A 4A3EG 1MSHA 3HGBA 3NHHA 1EIYB 4LF7L 5E3FA 4JC0A 1I4XA 1I50H 4QCLA 2N49A 2ZXOA 4KN7C 4A3JH 1EYAA 3M4YA 2NVTB 3CCVA 4XYOA 2E2IH 3S17B 4OX9L 3X3MA 2DNCA 2B2VC 2SNMA 5ELOA 1OXUA 2V4DA 1KRSA 4P2CB 4L5SA 2EYOA 2Z6KA 5KNBA 3NBIA 4A3BB 3NP8A 3KJPA 5HGTA 5KYIA 2JA7G 2L5TA 1PDQA 5EPLA 2WAQG 1I4PA 3T1HQ 3A5ZB 3W1BA 3F2CA 1KRTA 1YIJA 4HIDA 4F7XA 4ZYSA 1HR0Q 2NZHA 1RODA 3LWEA 2XIWA 4EQOA 5M3MG 2L12A 2OEOA 1H9JA 2Z4IA 3MZ5A 1YVCA 3HOXB 1FR3A 1D5XC 1MHWC 2IL8A 4GNXC 1B9MA 5GAGC 2BCOA 3ER0A 3T1HL 5EBDA 1PH6A 2EJFC 3GTJH 3Q23A 3H15A 1I4RA 3J80i 4HIMA 1HR0L 1PH9A 3NWTA 2ZM6Q 1EY5A 5M9OA 1B1ZA 1N33Q 1CHQD 1SYEA 1XMOL 3KUPA 2UXCL 5C0XH 2UU9L 2L11A 2A5HA 4UAIA 2EYFA 3C46A 2OT2A 4K14A 4B3SQ 1ILPA 2Q2TA 4HEDA 4JYAQ 1FGUA 2OF1A 2A68C 2VQFQ 2F0UA 1BBXC 1SRUA 4OWTB 2K5HA 4GN5A 1XMQQ 2F0WA 1VQJA 4AQYL 1VQDA 5C6AA 5FLMH 4TVAB 1IYJB 2EY1A 3CRLC 3PO3G 1SSOA 2JA8G 5BN3A 1YBYA 1XMOQ 5EKIA 4JI1L 4H02A 4IPCA 3D31A 1KNEA 1ZYRC 3QOLA 1V1OA 1GUWA 3FVQA 4XT3B 1SYBA 4L5TA 3MXNB 2OTLA 1QOHA 3FPUB 3I4LA 1K8AC 1A2UA 2B39A 5M3FH 1RTNA 5IIFA 2QKIC 1D5ZC 2O4XA 1A63A 3SVMA 3A0JA 4R4TA 1F9PA 1SNCA 1S5FD 3NBHB 4XXEA 4E6IA 2MPMA 2BE5C 4DV5Q 3CQZH 1DXMA 3M7GA 4BXXH 1IW7C 3G48A 2MO0A 5IYCG 1O78A 2MHVA 5CV9A 1BUVT 2HIVA 4Q0FA 4GN4B 2JA9A 4R1JA 1DOMA 4NPSA 2D62A 3NTHA 2ZTEA 4DV3L 2HDMA 3QIAA 1GKHA 4KY7A 4BWGB 1EY9A 3RLNA 3M7NA 4X6AH 2PW5A 3MXUA 2Q2HA 1X3PA 2B2YA 1IBML 3LGJA 4DA2A 2B2VA 5EKLA 1ICFB 4DR3L 3A8JE 1GHJA 2TMPA 2WAQE 1WTXA 2UXCQ 4DGZA 3LWUA 2A68D 4ULLA 3I73A 4JI4L 1XYIA 1IYVA 1TXYA 4JK1C 3G6EA 2V1CC 3A7AB 5G3LF 4U673 4A3KH 3WDNA 4LUVA 1GO3E 4ABNA 3CHBD 1E22A 3A8KE 3FRPB 1TR5A 3JAME 1OO9B 2K5NA 5LMNQ 2FFKB 2ZT9C 2XRQD 4DF7A 3SK5A 1JICA 4I7ZC 1TS3A 1ICWA 1V9PA 5M5YB 2EPBA 3N6RA 4AH6A 2VB2X 1TWHH 1EQQA 4LFBL 1TWHB 1VQLA 2ZJQA 1RDPD 5ELBA 4DR6L 3T4AC 2BDOA 2OWOA 3ICEA 2IW3A 5C4XB 1HUNA 5DLQE 1PTOB 3OPOA 1BCPD 3NQTA 3UE0A 4DUZQ 4BS9A 5C3XA 3RZOH 1PLFA 1IL2A 4GOPC 5JJIA 3HOZG 3GD7A 3AEVA 1SFOB 5JJZA 2Z0SA 2AQ3B 3OTOL 1BBWA 1PH4A 4QIWE 4O42A 2F0EA 5C3WA 4RCNA 2VUMB 3NWSA 2MP1A 2F4IA 4G7OC 2UXDL 2B2TC 2NZ1D 2WB1G 4A3DB 4DV5L 3CCJA 1EEID 3M3YB 4WJ4A 1IHZA 5FO8B 4A3IB 1MD2D 2AQ2B 3P75A 3CMAA 1H9MA 1XXGA 4I65A 4DV7Q 2H5XA 3TMEA 3OTOQ 1EIFA 3CCLA 4UPAA 3UE1A 1SBBB 1XNRL 1SNOA 4IPGA 3HEJA 1FVIA 2JQOA 1E2VA 4XQQA 1JCKB 1HNZQ 1NJIC 2F3IA 4CBVA 1CI3M 5G3LD 1D5MC 3GTMB 2QDBA 1Q81C 1NNXA 2MGSA 2Q8TA 3K81C 3PUVA 5GAEC 4PZ6A 2I0QA 4DFAA 3G6JB 4CDDC 1YJNA 1VQ8A 3EN2A 4RGNA 2K7VA 1CKOA 1EOVA 2DN8A 3W5OA 5JPMC 1Q82C 3HRZC 2HQEA 4QB4A 2MQHA 4MHEA 3SGIA 1LT4D 2PQAB 4KJOA 3ULPA 3S14B 4DAVA 4KD3A 2NVTH 1LO5D 2EJGC 1J6QA 2AKWB 4JI5Q 1C8CA 2BH8A 3AU7A 4ZAIA 1SFOH 1GM5A 1MKHA 3MC0B 2A1AA 4A75A 3J7A5 2IPKD 4CKEA 2JA6H 3TS2A 3PIO3 2J4XA 1T9HA 4B9XA 4P73A 1S4ZA 5KEEA 3DEPA 3OYYA 3HG9A 4X65Q 4HJ5A 5M5WB 5BN5A 4QUFA 1O7IA 3D6CA 1CTMA 2K32A 2PZUA 1MIUA 1A2TA 1CSPA 1QILA 3I2ZA 3K7AB 5KRUA 2UXDQ 1K8OA 2FJ2A 4A3IG 4BA2I 1LT6D 3HOVB 1Q8KA 2R93H 2R6GA 3PQIA 1Y69U 4DR6Q 3I70A 3QJYA 3J7AF 1YNJC 5LMUL 4X3KA 1EY0A 4NMZA 1YNXA 1TWCB 4QF4A 3D4WA 4A3MB 3E9HA 3BZCA 3HOZB 1SAPA 4YWMA 4GLVB 4LUZA 4LW1A 1FJGQ 3PGZA 1L0YB 2CQAA 2G9DA 2C9OA 3KOJA 5EQ0A 5M3FG 2E2JB 4GKJQ 2EOTA 5BR8L 1J5EL 1GOZA 2WB1B 3A7LA 5M5XH 3HOYB 1SNMA 2QW7A 1HQRD 2R3ZA 1IBLL 2QEXA 4ZQ3A 3E0EA 1ENCA 1ESFA 1YZ6A 1EU4A 4ID6A 2MO1A 4PMWA 1EYCA 1N34Q 5A35A 1R4PB 1FJGL 1SLJA 3HOYG 5EGTA 4GOPB 5JEAH 5DEHA 1EEFD 2A6HD 2QGQA 1I6HB 1LTLA 1I6HH 4C56C 3CPFA 1CA6A 1FGBD 2OQKA 4RKLA 5C3EH 1UE6A 5IOCA 2R92B 3I7FA 4L6TB 3T1YL 1STBA 2EXDA 4P74A 4CHTB 4JI5L 3CRKC 4DXGA 1SN8A 4C3IG 1HHVA 4QQBX 3EIVA 3KF8B 3VR3A 3T56B 5CV5A 4NXNQ 2RDHA 4IO9A 3CPWA 1VMPA 1NUCA 1DD2A 4JVZA 1SEBD 5IWAQ 5K36H 1KNAA 2M9VA 2K52A 4DR5Q 3DEOA 2EYLA 4ME3A 4S3SA 4DK0A 3PUXA 4DR2Q 3I4NB 1J8IA 2E75C 2JXMB 3PUZA 1II3A 4HTHA 4IFDH 2DY8A 1DJRD 2KHSA 3HKZE 2ZJPA 1GJXA 3KLRA 2VS1A 3O13A 2RCFA 3A54A 1SMXA 4C1NI 3OIQA 3CW2C 1EQRA 3I4NG 4DN4M 1PTOF 3MEFA 1PH1A 1BVSA 4C3HG 4KK7A 4HIOA 1I94L 2MUYA 1BNZA 3DLLA 1J5EQ 2IWHA 1CM9A 5IYBH 1VQIA 4R4OA 4NDXA 4L5RC 2XNAC 4TSSA 4DK6C 2I5MX 4B3ML 1HNXQ 3S16H 4A76A 2BH2A 4A93H 1MJCA 3TZDA 1FL0A 4R9WA 1YEZA 1FD7D 4K5WA 1SE2A 2X6GA 1RHPA 1HRJA 3J81L 3CCUA 2BE5D 4GS3A 5FLMG 5IYCH 3TRZA 3HFZB 4M1UB 2A6EC 5GROA 3K5LA 5FK9C 1I3QB 2R61A 4JI2Q 4ZKBB 2BA1A 2AQ1B 3RLOA 1HNXL 4RGTA 1TS4A 1XX8A 1F2MA 4R8NA 3ND8A 4KHPQ 1WI5A 4YCWA 4BY1H 2BOSA 1HPCA 5JOBA 4LFAQ 5IGBA 1JT8A 2PCFB 1GUTA 3WOEA 3I4NH 1EY8A 3FKIB 5I6YA 1VQGA 3ITPA 1U4LA 3KBXA 4A3EH 3K5OA 4A3FH 3SXHA 2OQ0A 4UDUC 5JJLA 1Q1EA 1HZCA 2WACA 2HQLA 1VQ5A 3RNUA 2K5VA 3ND9A 2JEAI 4X62Q 3UDFA 2QDLA 1M1KC 1OXXK 4KN4C 2HCIA 1SJED 3T1YQ 1YITA 5CR3A 5M5WH 3KLSA 2F4VQ 3S1MH 4HMJA 4BA1I 2F0HA 3HOXG 4EVOA 4HSVA 1ET6A 1RD9D 2A69C 5M3MB 5IYBG 5CORA 4A3GB 5C4XG 1LTSD 5IGGA 1HFNA 3STBC 1GXDC 4K5VA 4QIWB 2Q8RE 1PFNA 2PYKA 3TSSA 3S1QH 3S1QB 3PSIA 4A3KB 4H13C 4BY7B 4FYDA 1H95A 3TEHB 1BCPC 3H91A 4K6DA 2CQOA 5C4JB 1WTOA 5K5PA 3QB3A 3SDZA 2A69D 1HTLD 3EBEA 2CW0D 5E7NA 4IJHA 2XGTA 4C3JB 3GTKB 4A3KG 2KQ3A 3ZJYC 1O7ZA 2OXPA 4FVMA 1QG7A 4HCEA 1TQOA 1LACA 4PQXA 2R93G 5C3EG 1AH9A 1A0IA 2NVQH 3TN2A 2X6LA 1Z47A 3CP0A 4RCOA 5D65A 2QEJC 1EY4A 1KLUD 4RWSC 3VYRA 4DV3Q 4B3RQ 1EU3A 4WJ3M 3HKZB 4WFN3 1TVXA 4HMIA 4PNYA 1HUMA 2NVXH 2EYPA 1SDFA 4JI6L 3FKIG 2VUMG 4H44C 1IL8A 1S5ED 4P75A 2Q8IB 2F0FA 1JJGA 3DXJC 4PZ8A 2L4NA 3GTLH 3P1HA 3HOXH 3S1RH 2EY6A 3H09A 1AP0A 1EZ8A 5TSSA 1JC7A 1Q8IA 3GQBA 4MNOA 4OX9Q 1JORA 1QCBD 2NN6H 2ICEC 4BBRB 3F2BA 3GTPB 3GTJB 1B2TA 2JA5B 2J7ZA 1QZGA 3AFPA 2KHIA 2PMZE 5JPNC 1WD1A 4FF4A 2ZM6L 2ALYB 1SR3A 1WJJA 4LFBQ 4LFCL 1H9SA 1X54A 3M4OB 2JP1A 3K7UC 3MTSA 5C4JH 3TP7A 4B3SL 3I3CA 3KJOA 4FXKC 4YHHL 3H6MA 2E2IB 5C44H 3K6OA 5CBAE 1I50B 1UNSA 1R4QB 4ZLTF 2F0GA 3MEHA 5IGEA 4A3BH 2EIFA 4BXXG 3L9AX 1G2SA 2D2CC 3BYYB 4A93G 1PTOD 1X32A 4ZK9B 4JI1Q 4PZ7A 1KL9A 2ZXRA 3MXGA 4HJ7A 2Z9HA 5CBEE 2VQEQ 2K50A 4A3GG 1LT5D 1LABA 1NR2A 1JQYD 2F0MA 1VQEA 3K59A 1B44D 5FO7B 1GUSA 1MGSA 4NKLA 2CWAA 3GV3A 1A15A 1HFGA 5GADC 1AE3A 3M85A 1C7YA 1NTGA 4DU9A 3L0OA 3H3VI 3P20A 1B3QA 4IPDA 3MA2B 3HOZH 3U9OA 4JPBW 1ZXTA 1S3OA 2E5LQ 1HXYD 1F2ZA 2F0NA 2PW7A 1SXTA 1VQCA 2B63H 3PV0A 2IT1A 2R93B 1Y1VB 3H0GH 4A4IA 4A3DG 4DNIA 4DXFA 5J1ZA 1E1OA 1YHBA 3K5NA 3Q22A 1AZPA 4WORA 5LL6X 1UE7A 3D0FA 4A3MG 5H1SE 4H7BA 2L55A 3K80C 4RHSA 1LTID 2M2LA 2R92G 3CCSA 1G6PA 3EA6A 4DK3C 4JI6Q 2IJ0A 1CT1D 2KA7A 4MTNA 2ASBA 1EL0A 1X6OA 3E6ZX 4HR7B 5C5MA 1E2WA 4FP5D 4IUNA 1X3GA 2ES2A 2XVSA 1HZAA 1V1QA 2JN4A 4IALA 3W1GA 1DZ1A 2LKVA 3HZXA 2F0QA 3WWVA 1W2BA 4A93B 3KLWA 4CKCA 5J3BA 1YHQA 4JOIA 4A3FG 3OW2A 2RHSB 3QOJA 2Z8LA 1NY4A 2JEBI 1W6KA 1PVOA 1IBKL 5C4XH 1PFMA 2HD3A 5FLXc 3MHBA 1Y1WH 1PA6A 4X64L 3HOWH 5KNCA 5IP7G 5J39A 1WVLA 4C3IH 3VR6A 4DAYB 4C3IB 2CHBD 1VQ6A 2F0LA 3GTKH 3KK7A 1QWYA 4GZYC 4A3MH 3MAQA 1FNVA 3I4MB 4GKKL 3VDYA 5LMNL 4DV4Q 1Y8OB 3E3XA 3J80L 3OWEB 4A3DH 2EYMA 4DAMA 2J0TD 1IBKQ 2N78A 3QO2A 5I2XA 2ZTCA 3U4VA 2XSCA 3RN5A 1HNWQ 5BR8Q 5IGDA 2IY5B 2A74C 3TP8A 2FMMA 4X3TA 1Q86C 5KNDA 1LTBD 2PNRC 3KF6B 3I55A 1PRTB 5HURA 1IBLQ 4H0LC 3F2UA 1M90C 3NTKA 1CKNB 4C2MB 4CDEC 5T1IA 3E9IA 2GA4B 2YU9H 5IGCA 3S1RB 4LNQA 2WIIB 3JAMi 2GVAA 4DV2Q 3E0JA 4N8X1 3CD6A 2BA0A 2N88A 5CGKA 3X3NA 4DPGA 4J8QA 4BY1G 5C5LA 5IODA 3S2DH 2MFIA 4NP5A 3CMEA 2E5LL 4F88A 2IHFA 2L0CA 2X69A 3S16B 1JMCA 2K6AA 2YTXA 5ELEA 5M3FB 1TWCH 4IUQA 3KFUA 1VMCA 1N36L 4YWKA 1CQVA 1ILQA 1CQFA 1PZJD 3URYA 4BY1B 1EIHA 5IE8A 1PH3A 3PO2H 2I5LX 3G71A 3U4ZA 5C44G 2A6ED 1PH8A 1DOKA 4J6HA 1QNUA 3TREA 4XQJA 2XTIA 1QE6A 3P7JA 1IKLA 1CSQA 4GLAC 4YY3L 4A3BG 5EAYA 3OMGA 5DNFA 2F3VA 1LT3D 3BG3A 3KYHC 4KV6A 4TQUS 1V8QA 3IL8A 1N36Q 5DM63 4B3TQ 4DR4L 3CXCA 4J1MA 3HP3A 1K83B 4KKTA 4GNXB 3S14H 4OIKA 3ULJA 1TWAH 1KDCA 3RZDH 1EIGA 3C1EA 4R4QA 1HCZA 5C0XG 1D1IA 1GUGA 4KI0A 1D7QA 4X65L 1C4QA 2E2HB 4A3FB 1EOTA 1UUPA 4FO2A 4MZ9A 4MTKA 4J15A 1U0LA 5CYUA 2KCCA 1QVCA 2WFWA 2EQSA 2VW9A 1A3VA 3A74A 3ERQA 3M4QA 4L5QA 4DV0L 1FNWA 4R8IA 2Q2IA 3PO3H 1BO0A 1E3PA 1KDBA 2P5ZX 2QCPX 4A3GH 4TRDA 4BBSH 4A3JG 2K1BA 4AYBE 3J7ZC 2XN9C 3W2DA 3TDQA 3NQIA 2E2JH 4GKKQ 1VQMA 4LF6L 2CFMA 1VDZA 2K28A 1T5EA 3H0GB 3HOUG 4V190 1VQ7A 5IY0A 2SOBA 3B6YA 1GD7A 2DNEA 1LTAD 3Q24A 1HNZL 1U4RA 4QUCA 1B8AA 3KDFA 1FNUA 3AMUA 4KMUC 4N9TA 5C4HA 1B53A 3L7ZC 2KEDA 3TS0A 3QG1A 4C3JH 1JWSD 4IFDI 2JA7B 2JA7H 2RF4A 1KTKA 1B7YB 5C44B 1Z9FA 3E5SA 5FLXE 2CWPA 3JAMc 5NUCA 4BBRG 1H9KA 2L15A 1K9MC 1LUZA 3GTLB 2B29A 3VR2A 3CCMA 2EY5A 2EXZA 1C9OA 2A73B 5ISRA 4F87A 1IYUA 1STGA 4HJ8A 1GHKA 4ME5A 1JE4A 1EQTA 4IOAA 1MSGA 1JOOA 5IWAL 1CFMA 4UP7A 4IOCA 2YYZA 4YCVA 3D3RA 2EYJA 1W3SA 5FKAC 3F2DA 3PIP3 1SYCA 4X66Q 1HA6A 1RKNA 3I8ZA 4RFBA 1JJ2A 2F0OA 3TP5A 3AYHB 4OL7A 5CV4A 3UDGA 3S15H 2F1MA 4OXPA 2TSSA 4DUYL 1NAPA 1V1PB 3T16A 1EYDA 1SMYD 3CKIB 1K73C 1Y1VH 2FINB 2JA8B 4V0BA 1DCZA 2EY2A 4DV6L 3SHLA 3MFYA 4DNRB 4RG1A 3PUWA 1XPOA 1AFPA
chains in the Genus database with same CATH topology
5FLMH 1X65A 4TVAB 1IYJB 3PO3G 3EBEA 2UUAL 2JA8G 4POGA 5E7NA 1YBYA 2YTVA 4IJHA 1XMOQ 4JI1L 2XGTA 3U58A 1X3FA 4H02A 3D31A 3I4OA 4IPCA 4K0KL 4A3KG 3TQYA 3PO2G 3ZJYC 2IX0A 2I5HA 3PF4A 1Q1BA 1N8RC 4RMFA 1AH9A 1WCMG 2R93G 5C3EG 1A0IA 2NVQH 1Z47A 3CP0A 4L5TA 3MXNB 2OTLA 1EFWA 4AQYL 1K8AC 1GVPA 4DV3Q 5M3FH 4B3RQ 1CKMA 2NN6I 2GN5A 1Q7YC 2PNHA 4WJ3M 4LF6Q 1A63A 4IFDJ 1I5FA 2VY3A 3A0JA 2PI2A 4FDBA 4R4TA 2UUCL 2AHOB 4LF8L 3NBHB 3S24A 2LXJA 4K0KQ 2NVXH 4JI6L 3FKIG 2VUMG 4OO1G 4DV5Q 1XJVA 3CQZH 4P72A 4BXXH 4P75A 3G48A 2VUMH 2MO0A 5IYCG 1OXTA 1JJGA 1HJPA 2HIVA 4PZ8A 2LXKA 4GN4B 2JA9A 3GTLH 4R1JA 4NPSA 2D62A 3HOXH 3S1RH 2ZTEA 4DV3L 4DR7Q 1HZ9A 1GKHA 1UE5A 3HKZG 4LWCA 4MNOA 1OXVA 4OX9Q 1X9NA 3RLFA 4LF5L 4LF4Q 3RLNA 1XNRQ 3M7NA 4X6AH 3F2BA 2JA5H 4APVA 3JC66 4JI3Q 1L2FA 2Q2HA 1QZGA 4DR2L 3AFPA 3LGJA 4X62L 1IBML 4JG2A 2CCZA 2KHIA 2R7DA 2KENA 2PMZE 3S1NH 4JBWA 3BU2A 4Y7NH 2WP8J 2ZM6L 4DR3L 4KHPL 2ALYB 1SR3A 1WJJA 1QUQA 2WAQE 4LFBQ 4LFCL 2UXCQ 1X54A 3CCRA 4JI4L 2JA8H 3S14H 4IFDG 1EWIA 1HZBA 3CC7A 3K7UC 1TXYA 4DV0Q 4BY7G 5C4JH 2LSSA 3G6EA 4B3SL 3KJOA 2V1CC 2JK8A 4JI7L 4A3KH 4POFA 4YHHL 4LUVA 1GO3E 1C0AA 5C44H 3S17H 2R92H 2VL6A 3ULLA 3CCQA 1E22A 1WOCA 1UWVA 1XPUA 2K5NA 5LMNQ 1X55A 3HOUH 4AIMA 4A3BH 1HR0W 2EIFA 4UY8C 4BXXG 4EX5A 4YY3Q 3KDFB 1G291 3CAMA 1RIPA 4KHZA 4JI0L 1V9PA 3CF5A 1TWFH 4C3HH 1CKNA 1QZHA 2ATWA 2R7FA 4A93G 1D8LA 4AH6A 4LFBL 1TWHH 4PZ7A 4NXNL 1KL9A 4JI1Q 4HJ7A 1EQQA 4JI4Q 1VQLA 3S2HH 2ZJQA 2VQEQ 2ZJRA 3DM3A 2K50A 4B3TL 5AJ3L 4DR6L 5IP9H 2OWOA 3ICEA 2CKZB 1ASYA 3UDIA 4A3GG 5DLQE 3UE0A 4DUZQ 1KXLA 3RZOH 1VQEA 1IL2A 3GDEA 2E2HH 4GOPC 2Y0SG 5JJIA 3HOZG 3GD7A 4DV6Q 2D0OA 3AEVA 2CWAA 4NB3A 3PIOA 2Z0SA 5GADC 1AE3A 3M85A 1L1OC 1BBWA 3OTOL 4QIWE 1PH4A 1UE1A 1C7YA 4JI0Q 4BBSG 2JJQA 1NTGA 2FXQA 4QJFA 2Q2UA 3L0OA 2VNUD 3H3VI 3I4MG 2UXDL 4IPDA 2WB1G 4C2MH 2UUAQ 3HOZH 2K4KA 4P71A 1BKBA 5AJ3Q 3CCEA 4DV5L 2DUDA 2Z6KC 3CCJA 1JB7A 1PYSB 1S3OA 3J81c 2E5LQ 3M3YH 3NEMA 2Y0SE 4WJ4A 1VQCA 2IHEA 2B63H 3F1ZA 3PV0A 2IT1A 1PHJA 3CMAA 1P16A 2JA5G 4DV7Q 2H5XA 3GO5A 3H0GH 3OTOQ 1EIFA 4GNXA 1L1OB 4A4IA 3FHWA 3CCLA 4DNIA 4A3DG 4LF5Q 4UPAA 3UE1A 1E1OA 1YHBA 1XNRL 3FKIH 4IPGA 1FVIA 4OWWB 1WFQA 1UE7A 2JQOA 3D0FA 4A3MG 5H1SE 3CC4A 2R7ZH 3K80C 4GKJL 1HNZQ 2R92G 1NJIC 4X66L 2F3IA 3CCSA 1G6PA 4DK3C 1NBWA 4JI6Q 4MTNA 2ASBA 1Q81C 2OTJA 1X6OA 1A8VA 2ID0A 1PH2A 2HHHL 2GVBA 4PG3A 1VQPA 3CC2A 3K81C 3PUVA 1X3GA 5GAEC 4PZ6A 2ES2A 1ASZA 2I0QA 1N33L 4A3LG 1HZAA 1YJNA 1V1QA 4GOPA 1N34L 1VQ8A 3EN2A 2UU9Q 1QUQB 4DR7L 2YV5A 3W1GA 4JI8Q 4OO1I 1CKOA 4JBJA 3WWVA 1EOVA 3BZKA 2VZAA 3W5OA 1W2BA 2VQFL 4LF4L 3KLWA 3I4MH 5J3BA 1Q82C 3HOWG 1YHQA 2MQHA 3K0XA 4JOIA 5M5YH 3OW2A 4A3FG 4OONA 3SGIA 2RHSB 1XNQQ 4JV5L 2PQAB 4DR1Q 3ULPA 5GAHC 1XMQL 1K0RA 5FJ8H 1NY4A 2JEBI 2UUBL 4LFAL 1PH5A 3RR5A 2NVTH 1PVOA 2QA4A 1J6QA 2AKWB 1XPRA 1IBKL 4JI5Q 5C4XH 1QVFA 5FLXc 1E7ZA 1Y1WH 2BH8A 4X64L 1PA6A 2YTYA 4LUOA 1SFOH 1U5KA 4OWXB 3GTQH 1GM5A 3HOWH 2R7ZG 1KAWA 1MKHA 1BBUA 1VQFA 2A1AA 5IP7G 4A75A 3J7A5 3PUYA 1QVGA 3AQQA 3STBD 4C3IH 2JA6H 2WB1E 4DV1L 4DAYB 3TS2A 1VQ6A 3GTKH 3M4PA 1T9HA 4DR5L 1YI2A 1PYBA 4P73A 1RL2A 1E24A 4A3MH 4HIKA 3OYYA 1X3EA 4GKKL 1XNQL 3VDYA 1XPOA 4X65Q 4HJ5A 2B3GA 1TWGH 3KF6A 5LMNL 4DV4Q 4B3RL 1O7IA 2C35B 4A3DH 4DAMA 1IBKQ 5JJKA 2N78A 2UXBQ 2F4VL 1Q46A 1MIUA 2ZTCA 1CSPA 3I2ZA 5M3MH 3U4VA 2UXDQ 4A3IG 1Y1WG 1HNWQ 3RN5A 5BR8Q 4BA2I 2IY5B 1VQOA 2KCMA 4DUYQ 1Q86C 1Q8KA 1CUKA 1WCMH 2R93H 2R6GA 3IRBA 3KF6B 3I55A 3PCOB 4O0AA 4DV1Q 4LF7Q 4DR6Q 2NVYH 2IX1A 1NMFA 5LMUL 1YJWA 1IXRA 1IBLQ 4JBKA 4UP9A 1PFSA 1M90C 1HH2P 1YNXA 1CKNB 3E9HA 3BZCA 1KQSA 2NN6G 4YWMA 3I56A 1L0WA 4GLVB 4LUZA 4LW1A 1FJGQ 1S72A 3E9IA 1VQ4A 5JEAJ 3PGZA 2YU9H 2HT1A 4AYBG 3BJUA 3M4OH 4LNQA 2AWNA 1VQAA 1N9WA 3KOJA 4YWLA 3JAMi 5M3FG 1I94Q 4GKJQ 4L5RC 2GVAA 5BR8L 4DV2Q 3HOVG 3CD6A 1J5EL 4JI3L 1VQHA 2BA0A 3HOVH 1VQ9A 3UDXA 4DPGA 5M5XH 4B3MQ 1VQNA 4BY1G 2NZOA 2PI2E 3S2DH 2PQAA 1PH7A 2MFIA 5LMUQ 1IBLL 1DGSA 3CMEA 2E5LL 1K8GA 2QEXA 4A3CH 2IHFA 3E0EA 5IYDG 1JMCA 2YTXA 1YZ6A 1TWCH 4R4IA 1G51A 2MO1A 4GN3B 3J81i 4PMWA 4LFCQ 4UP8A 1N34Q 4ALPA 3KFUA 1WYDA 1N36L 4YWKA 1FJGL 1Y1VG 3G4SA 1SLJA 3HOYG 3J81j 4JI8L 4GOPB 3GTMH 5IE8A 4BY7H 1XTDA 1KIXA 1PH3A 2QGQA 2I5LX 3G71A 2UUCQ 3PO2H 5IP9G 3U4ZA 1LTLA 3U50C 1I6HH 4DKAC 3CPFA 5C0XI 5C44G 4DR1L 4JI2L 2B63G 2OQKA 5C3EH 1VCIA 4QL5A 1UE6A 1PH8A 3I7FA 3TREA 2XTIA 1OTCA 3T1YL 2EXDA 1CSQA 4GLAC 4P74A 4JI5L 4YY3L 1SN8A 2RCNA 2JA6G 2K14A 4R4CA 4A3BG 3EIVA 5EAYA 3PIPA 3KF8B 4QQBX 1JE5A 4X64Q 3J80c 2HHHQ 1VQJA 5HGQA 4O2DA 2F52A 1I3QH 4NXNQ 2MNAA 3KYHC 4TQUS 1VQBA 1N36Q 4DR4L 4B3TQ 4IO9A 3CPWA 2ZTDA 3CXCA 1K3RA 1LM0A 4BBRH 3GTPH 1IZ6A 5IWAQ 5JEAG 2N3SA 2K52A 4IJLA 1V43A 5LMNW 1B70B 3ULJA 1TWAH 4GNXB 4DR5Q 3RZDH 1YJ9A 4R4QA 4ME3A 2HIXA 2OCEA 4XTCS 5C0XG 4HJAA 4KI0A 3PUXA 1KD1C 4DR2Q 1VQKA 1D7QA 4X65L 1SE8A 2KBNA 3K7AH 4JV5Q 1KHIA 3ERSX 4MZ9A 2UXBL 5FJ8G 3PUZA 2UUBQ 1S40A 4J15A 1HNWL 3H0GG 1U0LA 2KCTA 1QVCA 3GTGH 4LF9L 2WFWA 2EQSA 2VW9A 4QY7A 3A74A 4L5QA 3M4QA 3HKZE 2ZJPA 3FP9A 4DV0L 1UEBA 1SROA 2D0PA 1N32L 2Q2IA 5HY6A 2VS1A 3PO3H 1SMXA 1K83H 4YHHQ 3RN2A 1E3PA 1LYLA 3A5UA 4IPHA 1Y14B 4A3GH 3CW2C 4JYAL 3HKSA 4BBSH 1EQRA 4JOIC 4A3JG 3I4NG 2JE6I 4XIGS 4AYBE 3J7ZC 1EYGA 4A3IH 3MEFA 2E2JH 5C0XJ 4JCVE 4EQ5A 3GTOH 1PH1A 1BVSA 1VS0A 4GKKQ 1VQMA 3NENA 4LF6L 1Q12A 2CFMA 2N8NA 4HIOA 1R9TH 1I94L 4AQYQ 3HOYH 3DLLA 4LF8Q 1J5EQ 3HOUG 2A8VA 5IYBH 1VQ7A 5IY0A 1VQIA 3B6YA 1GD7A 3M9BA 2AWOA 4R4OA 2VQEL 4B3ML 4HJ9A 4DK6C 2I5MX 1NE3A 1HNZL 1B8AA 3KDFA 1HNXQ 3S16H 1X56A 1N32Q 4A76A 2BH2A 4A3EG 4A93H 1MJCA 1EIYB 4DUZL 1FL0A 4LF7L 2RHQB 3L7ZC 1OXSC 4JC0A 1YEZA 3TS0A 1I50H 4JBMA 4C3JH 2N49A 4IFDI 4A3JH 2JA7H 2RF4A 3CCVA 2E2IH 1B7YB 2A19A 3CCUA 4GS3A 1PV4A 5FLMG 4OX9L 5IYCH 1Z9FA 3HFZB 5ELOA 3TRZA 1OXUA 1KRSA 2AMCB 5GQOA 2CWPA 1MJEA 4L5SA 3JAMc 5GROA 2Z6KA 4BBRG 4KLKA 2L15A 1K9MC 1LUZA 3KJPA 1A62A 2B29A 3Q8DA 4JI2Q 2JA7G 2BA1A 4DV2L 3RLOA 3CCMA 5IYDH 1HNXL 2WAQG 3T1HQ 1C9OA 3A5ZB 3W1BA 3F2CA 4YCUA 4KHPQ 1KRTA 1WI5A 4YCWA 4BY1H 1YIJA 4HIDA 4NXML 4LFAQ 5IP7H 1JT8A 4HJ8A 1HR0Q 1KC8C 4Y52H 3PF5A 2NZHA 4DV7L 3I4NH 2DGYA 4IOAA 5IWAL 1VQGA 4QGUA 5M3MG 3L2PA 4IOCA 4UP7A 2YYZA 1P8LA 4YCVA 4A3EH 5IT9c 2KHJA 1YVCA 1W3SA 4A3FH 3F2DA 4GLXA 2OQ0A 5JJLA 1Q1EA 4GNXC 1HZCA 5GAGC 2HQLA 4X66Q 1VQ5A 3ER0A 3T1HL 3RNUA 5ELNA 1PH6A 2K5VA 2JEAI 4X62Q 3F8TA 1JJ2A 3UDFA 3K8AA 1AE2A 3GTJH 1IBMQ 2K75A 1M1KC 3NELA 4NXMQ 1E1TA 1OXXK 4DV4L 3H15A 3AYHB 3AFQA 1JJCB 3T1YQ 3J80i 4HIMA 1YITA 5M5WH 1HR0L 1PH9A 4LF9Q 2F4VQ 3S1MH 3HOXG 4BA1I 2ZM6Q 4DR3Q 3UDGA 3S15H 4A3LH 1N33Q 1YHAA 1XMOL 4OXPA 2UXCL 2UU9L 4DUYL 5IYBG 5C4XG 4DR4Q 1K73C 3STBC 1Y1VH 2Q2TA 4B3SQ 5K36G 4JYAQ 4JI7Q 1FGUA 2VQFQ 4DV6L 3S1QH 1L1OA 1SRUA 3PSIA 2K5HA 4OWTB 4GN5A 4RG1A 4A3CG 3PUWA 1NMGA 1XMQQ 1H95A 3TEHB 2CQOA 3H3VH 2E8GA 1EUJA 1VQDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5FLM H;  1X65 A;  4TVA B;  1IYJ B;  3PO3 G;  3EBE A;  2UUA L;  2JA8 G;  4POG A;  5E7N A;  1YBY A;  2YTV A;  4IJH A;  1XMO Q;  4JI1 L;  2XGT A;  3U58 A;  1X3F A;  4H02 A;  3D31 A;  3I4O A;  4IPC A;  4K0K L;  4A3K G;  3TQY A;  3PO2 G;  3ZJY C;  2IX0 A;  2I5H A;  3PF4 A;  1Q1B A;  1N8R C;  4RMF A;  1AH9 A;  1WCM G;  2R93 G;  5C3E G;  1A0I A;  2NVQ H;  1Z47 A;  3CP0 A;  4L5T A;  3MXN B;  2OTL A;  1EFW A;  4AQY L;  1K8A C;  1GVP A;  4DV3 Q;  5M3F H;  4B3R Q;  1CKM A;  2NN6 I;  2GN5 A;  1Q7Y C;  2PNH A;  4WJ3 M;  4LF6 Q;  1A63 A;  4IFD J;  1I5F A;  2VY3 A;  3A0J A;  2PI2 A;  4FDB A;  4R4T A;  2UUC L;  2AHO B;  4LF8 L;  3NBH B;  3S24 A;  2LXJ A;  4K0K Q;  2NVX H;  4JI6 L;  3FKI G;  2VUM G;  4OO1 G;  4DV5 Q;  1XJV A;  3CQZ H;  4P72 A;  4BXX H;  4P75 A;  3G48 A;  2VUM H;  2MO0 A;  5IYC G;  1OXT A;  1JJG A;  1HJP A;  2HIV A;  4PZ8 A;  2LXK A;  4GN4 B;  2JA9 A;  3GTL H;  4R1J A;  4NPS A;  2D62 A;  3HOX H;  3S1R H;  2ZTE A;  4DV3 L;  4DR7 Q;  1HZ9 A;  1GKH A;  1UE5 A;  3HKZ G;  4LWC A;  4MNO A;  1OXV A;  4OX9 Q;  1X9N A;  3RLF A;  4LF5 L;  4LF4 Q;  3RLN A;  1XNR Q;  3M7N A;  4X6A H;  3F2B A;  2JA5 H;  4APV A;  3JC6 6;  4JI3 Q;  1L2F A;  2Q2H A;  1QZG A;  4DR2 L;  3AFP A;  3LGJ A;  4X62 L;  1IBM L;  4JG2 A;  2CCZ A;  2KHI A;  2R7D A;  2KEN A;  2PMZ E;  3S1N H;  4JBW A;  3BU2 A;  4Y7N H;  2WP8 J;  2ZM6 L;  4DR3 L;  4KHP L;  2ALY B;  1SR3 A;  1WJJ A;  1QUQ A;  2WAQ E;  4LFB Q;  4LFC L;  2UXC Q;  1X54 A;  3CCR A;  4JI4 L;  2JA8 H;  3S14 H;  4IFD G;  1EWI A;  1HZB A;  3CC7 A;  3K7U C;  1TXY A;  4DV0 Q;  4BY7 G;  5C4J H;  2LSS A;  3G6E A;  4B3S L;  3KJO A;  2V1C C;  2JK8 A;  4JI7 L;  4A3K H;  4POF A;  4YHH L;  4LUV A;  1GO3 E;  1C0A A;  5C44 H;  3S17 H;  2R92 H;  2VL6 A;  3ULL A;  3CCQ A;  1E22 A;  1WOC A;  1UWV A;  1XPU A;  2K5N A;  5LMN Q;  1X55 A;  3HOU H;  4AIM A;  4A3B H;  1HR0 W;  2EIF A;  4UY8 C;  4BXX G;  4EX5 A;  4YY3 Q;  3KDF B;  1G29 1;  3CAM A;  1RIP A;  4KHZ A;  4JI0 L;  1V9P A;  3CF5 A;  1TWF H;  4C3H H;  1CKN A;  1QZH A;  2ATW A;  2R7F A;  4A93 G;  1D8L A;  4AH6 A;  4LFB L;  1TWH H;  4PZ7 A;  4NXN L;  1KL9 A;  4JI1 Q;  4HJ7 A;  1EQQ A;  4JI4 Q;  1VQL A;  3S2H H;  2ZJQ A;  2VQE Q;  2ZJR A;  3DM3 A;  2K50 A;  4B3T L;  5AJ3 L;  4DR6 L;  5IP9 H;  2OWO A;  3ICE A;  2CKZ B;  1ASY A;  3UDI A;  4A3G G;  5DLQ E;  3UE0 A;  4DUZ Q;  1KXL A;  3RZO H;  1VQE A;  1IL2 A;  3GDE A;  2E2H H;  4GOP C;  2Y0S G;  5JJI A;  3HOZ G;  3GD7 A;  4DV6 Q;  2D0O A;  3AEV A;  2CWA A;  4NB3 A;  3PIO A;  2Z0S A;  5GAD C;  1AE3 A;  3M85 A;  1L1O C;  1BBW A;  3OTO L;  4QIW E;  1PH4 A;  1UE1 A;  1C7Y A;  4JI0 Q;  4BBS G;  2JJQ A;  1NTG A;  2FXQ A;  4QJF A;  2Q2U A;  3L0O A;  2VNU D;  3H3V I;  3I4M G;  2UXD L;  4IPD A;  2WB1 G;  4C2M H;  2UUA Q;  3HOZ H;  2K4K A;  4P71 A;  1BKB A;  5AJ3 Q;  3CCE A;  4DV5 L;  2DUD A;  2Z6K C;  3CCJ A;  1JB7 A;  1PYS B;  1S3O A;  3J81 c;  2E5L Q;  3M3Y H;  3NEM A;  2Y0S E;  4WJ4 A;  1VQC A;  2IHE A;  2B63 H;  3F1Z A;  3PV0 A;  2IT1 A;  1PHJ A;  3CMA A;  1P16 A;  2JA5 G;  4DV7 Q;  2H5X A;  3GO5 A;  3H0G H;  3OTO Q;  1EIF A;  4GNX A;  1L1O B;  4A4I A;  3FHW A;  3CCL A;  4DNI A;  4A3D G;  4LF5 Q;  4UPA A;  3UE1 A;  1E1O A;  1YHB A;  1XNR L;  3FKI H;  4IPG A;  1FVI A;  4OWW B;  1WFQ A;  1UE7 A;  2JQO A;  3D0F A;  4A3M G;  5H1S E;  3CC4 A;  2R7Z H;  3K80 C;  4GKJ L;  1HNZ Q;  2R92 G;  1NJI C;  4X66 L;  2F3I A;  3CCS A;  1G6P A;  4DK3 C;  1NBW A;  4JI6 Q;  4MTN A;  2ASB A;  1Q81 C;  2OTJ A;  1X6O A;  1A8V A;  2ID0 A;  1PH2 A;  2HHH L;  2GVB A;  4PG3 A;  1VQP A;  3CC2 A;  3K81 C;  3PUV A;  1X3G A;  5GAE C;  4PZ6 A;  2ES2 A;  1ASZ A;  2I0Q A;  1N33 L;  4A3L G;  1HZA A;  1YJN A;  1V1Q A;  4GOP A;  1N34 L;  1VQ8 A;  3EN2 A;  2UU9 Q;  1QUQ B;  4DR7 L;  2YV5 A;  3W1G A;  4JI8 Q;  4OO1 I;  1CKO A;  4JBJ A;  3WWV A;  1EOV A;  3BZK A;  2VZA A;  3W5O A;  1W2B A;  2VQF L;  4LF4 L;  3KLW A;  3I4M H;  5J3B A;  1Q82 C;  3HOW G;  1YHQ A;  2MQH A;  3K0X A;  4JOI A;  5M5Y H;  3OW2 A;  4A3F G;  4OON A;  3SGI A;  2RHS B;  1XNQ Q;  4JV5 L;  2PQA B;  4DR1 Q;  3ULP A;  5GAH C;  1XMQ L;  1K0R A;  5FJ8 H;  1NY4 A;  2JEB I;  2UUB L;  4LFA L;  1PH5 A;  3RR5 A;  2NVT H;  1PVO A;  2QA4 A;  1J6Q A;  2AKW B;  1XPR A;  1IBK L;  4JI5 Q;  5C4X H;  1QVF A;  5FLX c;  1E7Z A;  1Y1W H;  2BH8 A;  4X64 L;  1PA6 A;  2YTY A;  4LUO A;  1SFO H;  1U5K A;  4OWX B;  3GTQ H;  1GM5 A;  3HOW H;  2R7Z G;  1KAW A;  1MKH A;  1BBU A;  1VQF A;  2A1A A;  5IP7 G;  4A75 A;  3J7A 5;  3PUY A;  1QVG A;  3AQQ A;  3STB D;  4C3I H;  2JA6 H;  2WB1 E;  4DV1 L;  4DAY B;  3TS2 A;  1VQ6 A;  3GTK H;  3M4P A;  1T9H A;  4DR5 L;  1YI2 A;  1PYB A;  4P73 A;  1RL2 A;  1E24 A;  4A3M H;  4HIK A;  3OYY A;  1X3E A;  4GKK L;  1XNQ L;  3VDY A;  1XPO A;  4X65 Q;  4HJ5 A;  2B3G A;  1TWG H;  3KF6 A;  5LMN L;  4DV4 Q;  4B3R L;  1O7I A;  2C35 B;  4A3D H;  4DAM A;  1IBK Q;  5JJK A;  2N78 A;  2UXB Q;  2F4V L;  1Q46 A;  1MIU A;  2ZTC A;  1CSP A;  3I2Z A;  5M3M H;  3U4V A;  2UXD Q;  4A3I G;  1Y1W G;  1HNW Q;  3RN5 A;  5BR8 Q;  4BA2 I;  2IY5 B;  1VQO A;  2KCM A;  4DUY Q;  1Q86 C;  1Q8K A;  1CUK A;  1WCM H;  2R93 H;  2R6G A;  3IRB A;  3KF6 B;  3I55 A;  3PCO B;  4O0A A;  4DV1 Q;  4LF7 Q;  4DR6 Q;  2NVY H;  2IX1 A;  1NMF A;  5LMU L;  1YJW A;  1IXR A;  1IBL Q;  4JBK A;  4UP9 A;  1PFS A;  1M90 C;  1HH2 P;  1YNX A;  1CKN B;  3E9H A;  3BZC A;  1KQS A;  2NN6 G;  4YWM A;  3I56 A;  1L0W A;  4GLV B;  4LUZ A;  4LW1 A;  1FJG Q;  1S72 A;  3E9I A;  1VQ4 A;  5JEA J;  3PGZ A;  2YU9 H;  2HT1 A;  4AYB G;  3BJU A;  3M4O H;  4LNQ A;  2AWN A;  1VQA A;  1N9W A;  3KOJ A;  4YWL A;  3JAM i;  5M3F G;  1I94 Q;  4GKJ Q;  4L5R C;  2GVA A;  5BR8 L;  4DV2 Q;  3HOV G;  3CD6 A;  1J5E L;  4JI3 L;  1VQH A;  2BA0 A;  3HOV H;  1VQ9 A;  3UDX A;  4DPG A;  5M5X H;  4B3M Q;  1VQN A;  4BY1 G;  2NZO A;  2PI2 E;  3S2D H;  2PQA A;  1PH7 A;  2MFI A;  5LMU Q;  1IBL L;  1DGS A;  3CME A;  2E5L L;  1K8G A;  2QEX A;  4A3C H;  2IHF A;  3E0E A;  5IYD G;  1JMC A;  2YTX A;  1YZ6 A;  1TWC H;  4R4I A;  1G51 A;  2MO1 A;  4GN3 B;  3J81 i;  4PMW A;  4LFC Q;  4UP8 A;  1N34 Q;  4ALP A;  3KFU A;  1WYD A;  1N36 L;  4YWK A;  1FJG L;  1Y1V G;  3G4S A;  1SLJ A;  3HOY G;  3J81 j;  4JI8 L;  4GOP B;  3GTM H;  5IE8 A;  4BY7 H;  1XTD A;  1KIX A;  1PH3 A;  2QGQ A;  2I5L X;  3G71 A;  2UUC Q;  3PO2 H;  5IP9 G;  3U4Z A;  1LTL A;  3U50 C;  1I6H H;  4DKA C;  3CPF A;  5C0X I;  5C44 G;  4DR1 L;  4JI2 L;  2B63 G;  2OQK A;  5C3E H;  1VCI A;  4QL5 A;  1UE6 A;  1PH8 A;  3I7F A;  3TRE A;  2XTI A;  1OTC A;  3T1Y L;  2EXD A;  1CSQ A;  4GLA C;  4P74 A;  4JI5 L;  4YY3 L;  1SN8 A;  2RCN A;  2JA6 G;  2K14 A;  4R4C A;  4A3B G;  3EIV A;  5EAY A;  3PIP A;  3KF8 B;  4QQB X;  1JE5 A;  4X64 Q;  3J80 c;  2HHH Q;  1VQJ A;  5HGQ A;  4O2D A;  2F52 A;  1I3Q H;  4NXN Q;  2MNA A;  3KYH C;  4TQU S;  1VQB A;  1N36 Q;  4DR4 L;  4B3T Q;  4IO9 A;  3CPW A;  2ZTD A;  3CXC A;  1K3R A;  1LM0 A;  4BBR H;  3GTP H;  1IZ6 A;  5IWA Q;  5JEA G;  2N3S A;  2K52 A;  4IJL A;  1V43 A;  5LMN W;  1B70 B;  3ULJ A;  1TWA H;  4GNX B;  4DR5 Q;  3RZD H;  1YJ9 A;  4R4Q A;  4ME3 A;  2HIX A;  2OCE A;  4XTC S;  5C0X G;  4HJA A;  4KI0 A;  3PUX A;  1KD1 C;  4DR2 Q;  1VQK A;  1D7Q A;  4X65 L;  1SE8 A;  2KBN A;  3K7A H;  4JV5 Q;  1KHI A;  3ERS X;  4MZ9 A;  2UXB L;  5FJ8 G;  3PUZ A;  2UUB Q;  1S40 A;  4J15 A;  1HNW L;  3H0G G;  1U0L A;  2KCT A;  1QVC A;  3GTG H;  4LF9 L;  2WFW A;  2EQS A;  2VW9 A;  4QY7 A;  3A74 A;  4L5Q A;  3M4Q A;  3HKZ E;  2ZJP A;  3FP9 A;  4DV0 L;  1UEB A;  1SRO A;  2D0P A;  1N32 L;  2Q2I A;  5HY6 A;  2VS1 A;  3PO3 H;  1SMX A;  1K83 H;  4YHH Q;  3RN2 A;  1E3P A;  1LYL A;  3A5U A;  4IPH A;  1Y14 B;  4A3G H;  3CW2 C;  4JYA L;  3HKS A;  4BBS H;  1EQR A;  4JOI C;  4A3J G;  3I4N G;  2JE6 I;  4XIG S;  4AYB E;  3J7Z C;  1EYG A;  4A3I H;  3MEF A;  2E2J H;  5C0X J;  4JCV E;  4EQ5 A;  3GTO H;  1PH1 A;  1BVS A;  1VS0 A;  4GKK Q;  1VQM A;  3NEN A;  4LF6 L;  1Q12 A;  2CFM A;  2N8N A;  4HIO A;  1R9T H;  1I94 L;  4AQY Q;  3HOY H;  3DLL A;  4LF8 Q;  1J5E Q;  3HOU G;  2A8V A;  5IYB H;  1VQ7 A;  5IY0 A;  1VQI A;  3B6Y A;  1GD7 A;  3M9B A;  2AWO A;  4R4O A;  2VQE L;  4B3M L;  4HJ9 A;  4DK6 C;  2I5M X;  1NE3 A;  1HNZ L;  1B8A A;  3KDF A;  1HNX Q;  3S16 H;  1X56 A;  1N32 Q;  4A76 A;  2BH2 A;  4A3E G;  4A93 H;  1MJC A;  1EIY B;  4DUZ L;  1FL0 A;  4LF7 L;  2RHQ B;  3L7Z C;  1OXS C;  4JC0 A;  1YEZ A;  3TS0 A;  1I50 H;  4JBM A;  4C3J H;  2N49 A;  4IFD I;  4A3J H;  2JA7 H;  2RF4 A;  3CCV A;  2E2I H;  1B7Y B;  2A19 A;  3CCU A;  4GS3 A;  1PV4 A;  5FLM G;  4OX9 L;  5IYC H;  1Z9F A;  3HFZ B;  5ELO A;  3TRZ A;  1OXU A;  1KRS A;  2AMC B;  5GQO A;  2CWP A;  1MJE A;  4L5S A;  3JAM c;  5GRO A;  2Z6K A;  4BBR G;  4KLK A;  2L15 A;  1K9M C;  1LUZ A;  3KJP A;  1A62 A;  2B29 A;  3Q8D A;  4JI2 Q;  2JA7 G;  2BA1 A;  4DV2 L;  3RLO A;  3CCM A;  5IYD H;  1HNX L;  2WAQ G;  3T1H Q;  1C9O A;  3A5Z B;  3W1B A;  3F2C A;  4YCU A;  4KHP Q;  1KRT A;  1WI5 A;  4YCW A;  4BY1 H;  1YIJ A;  4HID A;  4NXM L;  4LFA Q;  5IP7 H;  1JT8 A;  4HJ8 A;  1HR0 Q;  1KC8 C;  4Y52 H;  3PF5 A;  2NZH A;  4DV7 L;  3I4N H;  2DGY A;  4IOA A;  5IWA L;  1VQG A;  4QGU A;  5M3M G;  3L2P A;  4IOC A;  4UP7 A;  2YYZ A;  1P8L A;  4YCV A;  4A3E H;  5IT9 c;  2KHJ A;  1YVC A;  1W3S A;  4A3F H;  3F2D A;  4GLX A;  2OQ0 A;  5JJL A;  1Q1E A;  4GNX C;  1HZC A;  5GAG C;  2HQL A;  4X66 Q;  1VQ5 A;  3ER0 A;  3T1H L;  3RNU A;  5ELN A;  1PH6 A;  2K5V A;  2JEA I;  4X62 Q;  3F8T A;  1JJ2 A;  3UDF A;  3K8A A;  1AE2 A;  3GTJ H;  1IBM Q;  2K75 A;  1M1K C;  3NEL A;  4NXM Q;  1E1T A;  1OXX K;  4DV4 L;  3H15 A;  3AYH B;  3AFQ A;  1JJC B;  3T1Y Q;  3J80 i;  4HIM A;  1YIT A;  5M5W H;  1HR0 L;  1PH9 A;  4LF9 Q;  2F4V Q;  3S1M H;  3HOX G;  4BA1 I;  2ZM6 Q;  4DR3 Q;  3UDG A;  3S15 H;  4A3L H;  1N33 Q;  1YHA A;  1XMO L;  4OXP A;  2UXC L;  2UU9 L;  4DUY L;  5IYB G;  5C4X G;  4DR4 Q;  1K73 C;  3STB C;  1Y1V H;  2Q2T A;  4B3S Q;  5K36 G;  4JYA Q;  4JI7 Q;  1FGU A;  2VQF Q;  4DV6 L;  3S1Q H;  1L1O A;  1SRU A;  3PSI A;  2K5H A;  4OWT B;  4GN5 A;  4RG1 A;  4A3C G;  3PUW A;  1NMG A;  1XMQ Q;  1H95 A;  3TEH B;  2CQO A;  3H3V H;  2E8G A;  1EUJ A;  1VQD A; 
#chains in the Genus database with same CATH topology
 1X65 A;  2JYO A;  4OIJ A;  4RGM A;  2UUA L;  4POG A;  2QIL A;  3DWP A;  1X3F A;  4EGV A;  3I4O A;  1QNK A;  3PO2 G;  3VYT A;  2IX0 A;  1YNJ D;  2I5H A;  3IAY A;  1Q1B A;  1N8R C;  1EWC A;  1U9R A;  4XQN A;  1M4V A;  1TWG B;  4IUT A;  1QB5 D;  1CKM A;  3V05 A;  4ZRZ A;  1IKM A;  2NN6 I;  2GN5 A;  3OMC A;  1PTO H;  3GTQ B;  2VY3 A;  4FDB A;  2UUC L;  4ODG A;  4K2K A;  2AHO B;  3S24 A;  3VR5 A;  4K0K Q;  1ML0 D;  3DHQ A;  3ZYY X;  1DOL A;  4OO1 G;  2VUM H;  1OXT A;  4ZCK A;  4DR7 Q;  1EFI D;  4LWC A;  3HKZ G;  1FYC A;  1X9N A;  4LF5 L;  4LF4 Q;  5M5X B;  1LTR D;  2WV6 D;  4APV A;  4JI3 Q;  1L2F A;  1TT2 A;  2B2U C;  2DJF C;  4DR2 L;  4X62 L;  2CCZ A;  3S1M B;  4JG2 A;  2R7D A;  2WAQ B;  2KEN A;  4JBW A;  3BU2 A;  4Y7N H;  4Y7N B;  2WP8 J;  2SDF A;  4KHP L;  2KCN A;  1SMY C;  2Z1C A;  1QUQ A;  5EJW A;  2NTT A;  4IFD G;  1HZB A;  3OW7 A;  4IZ8 A;  1SNP A;  1PYW D;  1K8M A;  2H1E A;  4LJZ C;  4POF A;  1C0A A;  2R92 H;  4EQP A;  3ULL A;  3PO3 B;  4K8I A;  2Y0S B;  1UWV A;  3DUZ A;  4G4K A;  2B2Y C;  1X55 A;  1HR0 W;  3KDF B;  1RIP A;  4KHZ A;  4JI0 L;  1TWF H;  4C3H H;  1CKN A;  1QZH A;  1Y8P B;  2ATW A;  3A8I E;  3S2H B;  1I4H A;  3VR4 A;  2O5I C;  3S2H H;  4K6L A;  2ZJR A;  3DM3 A;  5EPJ A;  3NBH A;  5IP9 H;  2CKZ B;  3UDI A;  3SK8 A;  3MWY W;  2F03 A;  1SYG A;  1HQM C;  3GDE A;  2C5C A;  2RBM A;  2Y0S G;  4OEM B;  4RGO S;  4DV6 Q;  2D0O A;  3PIO A;  3RUZ A;  3MXN A;  1L1O C;  3OWF A;  4O1N A;  4JI0 Q;  2XWB B;  4B08 A;  3EVQ A;  1X3Q A;  1TKW B;  4QJF A;  2Q2U A;  3I4M G;  1EY6 A;  1DM0 B;  4C2M H;  3OIP A;  2UUA Q;  2KEE A;  4FNF A;  2Z6K C;  3UI2 A;  4C3J G;  3J81 c;  3M3Y H;  1H9R A;  3NEM A;  2IHE A;  1D1K A;  3F1Z A;  4UHV A;  2K5W A;  3TP6 A;  5EKK A;  3VA7 A;  1PHJ A;  2K33 A;  1P16 A;  3GO5 A;  4GNX A;  1L1O B;  4LF5 Q;  1EZ6 A;  4CJ2 C;  5I9O A;  2D9U A;  5J22 A;  1IW7 D;  4K5X A;  3KF8 A;  1BF4 A;  5A2Q L;  3R93 A;  1C48 A;  3I72 A;  1PH2 A;  2HHH L;  4CJ0 B;  4PG3 A;  3CC2 A;  1B50 A;  5COY A;  1N33 L;  4X3U A;  4ZKC B;  1D6E C;  3TBI B;  4GOP A;  2EE1 A;  3PMF A;  2UU9 Q;  1QUQ B;  3GV6 A;  3D4D A;  3C3L A;  5JVH 3;  4JI8 Q;  1JR0 D;  3BZK A;  4XYQ A;  2VQF L;  5E1F A;  1BDO A;  3I4M H;  3K0X A;  2CH4 W;  2VXW A;  2NTS A;  4OON A;  4JV5 L;  1XNQ Q;  4KKS A;  4DR1 Q;  1XMQ L;  1K0R A;  2UUB L;  1F2Y A;  1PH5 A;  3RR5 A;  1WTR A;  4HAE A;  1XPR A;  4FXG C;  4IUU A;  4LUO A;  3NUC A;  4OWX B;  1ET9 A;  3BS1 A;  1BBU A;  2LMC B;  1BQQ T;  3NXW A;  1QVG A;  3I90 A;  4DV1 L;  2JA6 B;  4DNT B;  3M4P A;  3BVZ A;  5I9P A;  1PYB A;  2B2W A;  3R2I A;  4HIK A;  3H3V C;  1HA5 A;  1X3E A;  1O7L A;  1XNQ L;  1TWG H;  1LTG D;  3KF6 A;  4B3R L;  2C35 B;  2UXB Q;  2F4V L;  2CW0 C;  5M3M H;  1Y1W G;  4IQZ A;  1EQV A;  1O80 A;  4LAA A;  1G2T A;  1VQO A;  4X3S A;  5LL6 S;  1CUK A;  1ZYR D;  1WCM H;  2VB3 X;  3K0Y A;  3PCO B;  4O0A A;  4DV1 Q;  1LV9 A;  4QMG A;  2DY7 A;  2NVY H;  2IX1 A;  2BDN A;  4JBK A;  1PFS A;  1HH2 P;  2E74 C;  4KTA A;  1KQS A;  1JWM D;  1K3B C;  4K2L A;  2NN6 G;  5CV8 A;  3ONA B;  1WTV A;  1SE4 A;  5JEA J;  4N9P A;  3IFT A;  2F0S A;  2HT1 A;  3M4O H;  1VQA A;  4A3J B;  3HOV G;  1S5C D;  3A56 A;  1VQH A;  3BDC A;  1VQ9 A;  3UDX A;  1VQN A;  4RAU C;  2QF7 A;  2NZO A;  1BXT A;  1DGS A;  1K8G A;  4A3C H;  3HOU B;  3SK4 A;  3J7Y W;  3OHX C;  5D3D A;  3W3A A;  4R4I A;  1D2B A;  4LFC Q;  1ESR A;  4UP8 A;  2I46 A;  1AW7 A;  2KUM A;  3G4S A;  4JI8 L;  1TWA B;  3RZD B;  1XTD A;  1KIX A;  5IP9 G;  3U50 C;  5JVG 3;  2PMZ B;  2K5D A;  4DR1 L;  2B63 G;  1VCI A;  5CMD A;  2WKD A;  1F9R A;  4R4C A;  1PMR A;  1SE3 A;  1SYD A;  1JE5 A;  4X64 Q;  3GTG B;  5HGQ A;  4O2D A;  2F52 A;  1I3Q H;  2B63 B;  2ZTD A;  1LM0 A;  4BBR H;  3GTP H;  1IZ6 A;  2LY7 A;  5JEA G;  4FF3 A;  1MI2 A;  4IJL A;  5LMN W;  1V43 A;  1B70 B;  2I07 B;  2HIX A;  2OCE A;  4XTC S;  4HJA A;  1KD1 C;  1AN8 A;  1W6J A;  4DAP A;  3HOW B;  1BR9 A;  4L63 B;  2EVB A;  2KOL A;  4JV5 Q;  3DWQ A;  2UXB L;  2IX3 A;  5FJ8 G;  1HNW L;  3H0G G;  4LF9 L;  1B9N A;  2KEC A;  4QY7 A;  4B9W A;  5CC4 A;  3FP9 A;  2D0P A;  1E2Z A;  5HY6 A;  1K83 H;  4YHH Q;  1LYL A;  3A5U A;  4JYA L;  1YNN D;  5D3I B;  3HKS A;  2JE6 I;  1EYG A;  3RD4 A;  4A3I H;  3BDO A;  5C0X J;  4JCV E;  1VS0 A;  4RA8 A;  4ZUJ A;  1XTC D;  2N8N A;  2K04 A;  4LF8 Q;  5T1G A;  2AWO A;  4JW0 A;  4HJ9 A;  1NE3 A;  5ELF A;  1N32 Q;  1X56 A;  3DM1 A;  2EZV A;  1G6Z A;  4DUZ L;  1ZKO A;  2AUK A;  2RHQ B;  1OXS C;  4IUP A;  4JBM A;  5KIX A;  5I6W A;  2HCC A;  1PXU A;  3PO2 B;  2A19 A;  1PV4 A;  3MFG A;  1TS2 A;  3RMH A;  1TS5 A;  3FMC A;  2AMC B;  5GQO A;  3DWA A;  5I2Y A;  5F2D A;  1MJE A;  2ICI A;  1VF7 A;  4KLK A;  2EYH A;  3NSW A;  1A62 A;  3Q8D A;  3D8G A;  4DV2 L;  5IYD H;  1ENF A;  1CZW A;  2F0V A;  4YCU A;  4NXM L;  3D4R A;  5IP7 H;  1EY7 A;  2HUG A;  3K58 A;  1KC8 C;  4WJW A;  4DK1 A;  4Y52 H;  2PZT A;  3PF5 A;  3OSO A;  4DV7 L;  2DGY A;  3C1F A;  2RSN A;  5LHY 1;  4QGU A;  3L2P A;  4LMQ D;  1STA A;  1P8L A;  5IT9 c;  2KHJ A;  3QWN A;  4GLX A;  5ELN A;  4EQN A;  1Z6H A;  1IBM Q;  3F8T A;  4IUR A;  3K8A A;  1AE2 A;  2K75 A;  3NEL A;  2PO4 A;  1E1T A;  4DV4 L;  4NXM Q;  5EPK A;  3AFQ A;  1JJC B;  2FMC A;  4LF9 Q;  3Q0A A;  4A3L H;  4DR3 Q;  1JWU D;  1UEA B;  3J7A V;  1U4P A;  3BYT B;  1YHA A;  3V2T A;  4XDX A;  4N8F A;  4DR4 Q;  3K5M A;  1U4M A;  1BOS A;  5K36 G;  4JI7 Q;  3GTO B;  5AFW A;  1L1O A;  4A3C G;  1G8Z D;  4ILW A;  1NMG A;  1S5B D;  1KAA A;  2K01 A;  3H3V H;  2RQX A;  2E8G A;  2HDL A;  1EUJ A;  2WIN B;  3CU7 A;  1A3U A;  2SNS A;  2YTV A;  4CGY B;  3WOF A;  3U58 A;  4K0K L;  1NSN S;  2F3W A;  3TQY A;  3CQZ B;  3IFD A;  3PF4 A;  2RDF A;  4RMF A;  1WCM G;  4RKB A;  4IUV A;  2PQE A;  1TY0 A;  1EFW A;  3DMU A;  1GVP A;  4U68 A;  1JB3 A;  1Q7Y C;  2PNH A;  2EDG A;  4TKO B;  4LF6 Q;  4IFD J;  1I5F A;  2F0I A;  5DM7 3;  2PI2 A;  5CV6 A;  4LF8 L;  2B8F A;  4OHJ A;  2LXJ A;  1O7Y A;  2RSO A;  2M00 A;  1F77 A;  1AZQ A;  3IKJ A;  4HSP A;  2AUJ D;  3NPP A;  1XJV A;  4KKU A;  1WTH A;  4P72 A;  4A3E B;  1SND A;  4OO1 H;  1TII D;  5C3E B;  1SJH D;  1HJP A;  3R8B A;  1GUO A;  2LXK A;  1HZ9 A;  1MBY A;  4M8A A;  3SE0 A;  1UE5 A;  1OXV A;  1Q90 A;  3RLF A;  1XWE A;  1XNR Q;  1I4Q A;  2JA5 H;  3JC6 6;  2LS0 1;  1KLG D;  1M8A A;  5IT9 E;  1UAP A;  4OGQ C;  2L9H A;  3S1N H;  3I91 A;  4FF1 A;  1LTT D;  2WKC A;  3N52 A;  2PPB C;  2ENB A;  1DYQ A;  2R7Z B;  2ZXP A;  3CCR A;  4KY6 A;  2JA8 H;  1EWI A;  3VYU A;  3CC7 A;  4DV0 Q;  1AEX A;  4BY7 G;  2LSS A;  2JK8 A;  4JI7 L;  1STH A;  3C2P A;  3GP7 A;  5FOB B;  3S17 H;  2F0P A;  4HN7 A;  2VL6 A;  4IN3 A;  5BN4 A;  3CCQ A;  1CK1 A;  3S15 B;  1WOC A;  5DAU A;  2KJX A;  2MJ8 A;  3ERO A;  2F0J A;  1XPU A;  4CKB A;  3HOU H;  3V96 A;  4AIM A;  4CDC C;  2K05 A;  4UY8 C;  4L8J A;  4EX5 A;  4YY3 Q;  1G29 1;  3CAM A;  4PV1 C;  3KLS X;  2L1B A;  3CF5 A;  2NWG A;  5ELC A;  4C1N K;  2R7F A;  1D8L A;  1ZEQ X;  1Z7T A;  1NCV A;  2DJG C;  4NXN L;  4FXD A;  4JI4 Q;  4B3T L;  3SR1 A;  5AJ3 L;  1ASY A;  4RHR A;  1KXL A;  1PZK D;  2JSO A;  3T13 A;  2NYZ D;  2XRS D;  2E2H H;  1E0B A;  4NB3 A;  4CDF C;  2Z4H A;  1UE1 A;  2NVY B;  2Z6B A;  4F8M A;  2JJQ A;  3SEB A;  2FXQ A;  2VNU D;  3AB9 A;  2K4K A;  4P71 A;  4NW2 A;  1BKB A;  5AJ3 Q;  3CCE A;  5E4W C;  4KJN A;  4DAY A;  2DUD A;  1JB7 A;  1PYS B;  5D14 A;  5FLX L;  2Y0S E;  3H94 A;  3RZO B;  3S9W A;  1A3T A;  1WCM B;  2O5J C;  1T5X D;  2JA5 G;  1HTP A;  1R9T B;  4CJ1 B;  3G7L A;  3FHW A;  2SEB D;  3LX0 A;  4FF2 A;  2G9H D;  4HCS A;  4PMC A;  3FKI H;  3VYS A;  4OWW B;  1WFQ A;  1PRT C;  2NB0 A;  4MN3 A;  2E76 C;  3CC4 A;  5IGF A;  1V1P A;  4K8J A;  2R7Z H;  4GKJ L;  4Z9C B;  1PFB A;  1STE A;  4KY5 A;  4X66 L;  1NBW A;  2KVM A;  4OEL B;  4AYB B;  2OTJ A;  1A8V A;  2ID0 A;  2GVB A;  1VQP A;  1Y8N B;  3A55 A;  1ASZ A;  5FO9 B;  4A3L G;  1N34 L;  5ELD A;  3L3O C;  1S5D D;  4DR7 L;  2YV5 A;  3S2D B;  3HS0 C;  1GUN A;  4OO1 I;  4JBJ A;  2VZA A;  4LF4 L;  1J9O A;  4G57 A;  3FDT A;  1A6X A;  3HOW G;  1SYF A;  5M5Y H;  3OOC A;  5GAH C;  3MXP A;  2XWJ B;  3NTI A;  3BDL A;  5FJ8 H;  1KDA A;  4LFA L;  5KGU A;  2RDG A;  2CH4 A;  3FPP A;  2QA4 A;  2RVL A;  1QVF A;  3BVM A;  4ZUI A;  1E7Z A;  2NBF A;  1Y1W B;  2YTY A;  1ENA A;  3KBG A;  1U5K A;  2RKS A;  3GTQ H;  2R7Z G;  1KAW A;  2F0T A;  1VQF A;  3PUY A;  3AQQ A;  3STB D;  1Q3L A;  2WB1 E;  3FEW X;  3LNN A;  1STY A;  4KD4 A;  1G91 A;  4DR5 L;  1YI2 A;  1RL2 A;  1E24 A;  1PTO C;  1CHP D;  3JAM L;  1F2L A;  3QR8 A;  1PRT F;  3EJI A;  1EWH A;  2B3G A;  1CZG A;  4I7A A;  1CA5 A;  1STN A;  5JJK A;  1Q46 A;  3NK9 A;  1F9Q A;  2F0D A;  2KCM A;  1NR4 A;  4DUY Q;  1WD0 A;  1K28 A;  1JOK A;  1I4G A;  3IRB A;  5EBC A;  3D6W A;  4LF7 Q;  2E2D C;  1NMF A;  1YJW A;  1SNQ A;  1IXR A;  4UP9 A;  4PMB A;  2NUC A;  3EQL C;  1RJT A;  1B4O A;  2H4O A;  3TZU A;  3U9S A;  1F9S A;  1PRT D;  3I56 A;  1L0W A;  2EJM A;  2B8G A;  5IT9 L;  1S72 A;  5E4X A;  1VQ4 A;  2YU9 B;  2CVR A;  4AYB G;  1L0X B;  3BJU A;  1LLR D;  1B3A A;  2AWN A;  1N9W A;  4YWL A;  1I94 Q;  5C4Z A;  4JI3 L;  5KYL A;  3HOV H;  2K03 A;  4B3M Q;  1TWF B;  2B2T A;  4C3H B;  2PI2 E;  2PQA A;  1PH7 A;  1WTP A;  3EFX D;  3R3O A;  5LMU Q;  1TU2 B;  4MIU A;  1H9S B;  5IYD G;  2G5D A;  3J81 i;  1G51 A;  4GN3 B;  4G7Z C;  4RH6 A;  4ALP A;  1WYD A;  1BCP B;  1Y1V G;  3J81 j;  3J80 E;  3VA5 A;  3GTM H;  1I6V C;  4BY7 H;  5L37 A;  1ONL A;  1VF5 C;  2UUC Q;  2O2L D;  3MVV A;  4DKA C;  5C0X I;  4JI2 L;  3K57 A;  1K0S A;  4WRD A;  4QL5 A;  2NVQ B;  2K5Q A;  3T51 B;  1OTC A;  1JOQ A;  4XT1 B;  2RCN A;  5JAV A;  2JA6 G;  2K14 A;  3PIP A;  1RCV D;  3J80 c;  1RTO A;  2B2W C;  4LK1 C;  2HHH Q;  2MNA A;  1VQB A;  5I4D A;  1K3R A;  2A6H C;  3NE5 B;  2N3S A;  2D5D A;  1DON A;  3Q6S A;  1RF2 D;  1YJ9 A;  2FHT A;  3SK6 A;  1VQK A;  2PZW A;  1SE8 A;  3BZD B;  2KBN A;  1BCP F;  1YNN C;  3K7A H;  5A2Q E;  1KHI A;  3ERS X;  2N55 A;  2NVX B;  2UUB Q;  1S40 A;  2B2U A;  2KCT A;  3GTG H;  5CV7 A;  2F0K A;  1UEB A;  1SRO A;  4YIJ A;  1KAB A;  3J81 E;  1N32 L;  1WTW A;  3RN2 A;  4IPH A;  1Y14 B;  1PZI D;  1WTQ A;  1QJO A;  4BBS B;  4JOI C;  4XIG S;  3R2T A;  2LFN A;  4KHV A;  2RA4 A;  3BVG A;  4Q5V A;  4EQ5 A;  3GTO H;  3T53 B;  3NEN A;  1Q12 A;  1R9T H;  4AQY Q;  3HOY H;  4G7H C;  3S1N B;  2A8V A;  3M9B A;  4BBS G;  2VQE L;  1TY2 A;  4A3E G;  1MSH A;  3HGB A;  3NHH A;  1EIY B;  4LF7 L;  5E3F A;  4JC0 A;  1I4X A;  1I50 H;  4QCL A;  2N49 A;  2ZXO A;  4KN7 C;  4A3J H;  1EYA A;  3M4Y A;  2NVT B;  3CCV A;  4XYO A;  2E2I H;  3S17 B;  4OX9 L;  3X3M A;  2DNC A;  2B2V C;  2SNM A;  5ELO A;  1OXU A;  2V4D A;  1KRS A;  4P2C B;  4L5S A;  2EYO A;  2Z6K A;  5KNB A;  3NBI A;  4A3B B;  3NP8 A;  3KJP A;  5HGT A;  5KYI A;  2JA7 G;  2L5T A;  1PDQ A;  5EPL A;  2WAQ G;  1I4P A;  3T1H Q;  3A5Z B;  3W1B A;  3F2C A;  1KRT A;  1YIJ A;  4HID A;  4F7X A;  4ZYS A;  1HR0 Q;  2NZH A;  1ROD A;  3LWE A;  2XIW A;  4EQO A;  5M3M G;  2L12 A;  2OEO A;  1H9J A;  2Z4I A;  3MZ5 A;  1YVC A;  3HOX B;  1FR3 A;  1D5X C;  1MHW C;  2IL8 A;  4GNX C;  1B9M A;  5GAG C;  2BCO A;  3ER0 A;  3T1H L;  5EBD A;  1PH6 A;  2EJF C;  3GTJ H;  3Q23 A;  3H15 A;  1I4R A;  3J80 i;  4HIM A;  1HR0 L;  1PH9 A;  3NWT A;  2ZM6 Q;  1EY5 A;  5M9O A;  1B1Z A;  1N33 Q;  1CHQ D;  1SYE A;  1XMO L;  3KUP A;  2UXC L;  5C0X H;  2UU9 L;  2L11 A;  2A5H A;  4UAI A;  2EYF A;  3C46 A;  2OT2 A;  4K14 A;  4B3S Q;  1ILP A;  2Q2T A;  4HED A;  4JYA Q;  1FGU A;  2OF1 A;  2A68 C;  2VQF Q;  2F0U A;  1BBX C;  1SRU A;  4OWT B;  2K5H A;  4GN5 A;  1XMQ Q;  2F0W A;  1VQJ A;  4AQY L;  1VQD A;  5C6A A;  5FLM H;  4TVA B;  1IYJ B;  2EY1 A;  3CRL C;  3PO3 G;  1SSO A;  2JA8 G;  5BN3 A;  1YBY A;  1XMO Q;  5EKI A;  4JI1 L;  4H02 A;  4IPC A;  3D31 A;  1KNE A;  1ZYR C;  3QOL A;  1V1O A;  1GUW A;  3FVQ A;  4XT3 B;  1SYB A;  4L5T A;  3MXN B;  2OTL A;  1QOH A;  3FPU B;  3I4L A;  1K8A C;  1A2U A;  2B39 A;  5M3F H;  1RTN A;  5IIF A;  2QKI C;  1D5Z C;  2O4X A;  1A63 A;  3SVM A;  3A0J A;  4R4T A;  1F9P A;  1SNC A;  1S5F D;  3NBH B;  4XXE A;  4E6I A;  2MPM A;  2BE5 C;  4DV5 Q;  3CQZ H;  1DXM A;  3M7G A;  4BXX H;  1IW7 C;  3G48 A;  2MO0 A;  5IYC G;  1O78 A;  2MHV A;  5CV9 A;  1BUV T;  2HIV A;  4Q0F A;  4GN4 B;  2JA9 A;  4R1J A;  1DOM A;  4NPS A;  2D62 A;  3NTH A;  2ZTE A;  4DV3 L;  2HDM A;  3QIA A;  1GKH A;  4KY7 A;  4BWG B;  1EY9 A;  3RLN A;  3M7N A;  4X6A H;  2PW5 A;  3MXU A;  2Q2H A;  1X3P A;  2B2Y A;  1IBM L;  3LGJ A;  4DA2 A;  2B2V A;  5EKL A;  1ICF B;  4DR3 L;  3A8J E;  1GHJ A;  2TMP A;  2WAQ E;  1WTX A;  2UXC Q;  4DGZ A;  3LWU A;  2A68 D;  4ULL A;  3I73 A;  4JI4 L;  1XYI A;  1IYV A;  1TXY A;  4JK1 C;  3G6E A;  2V1C C;  3A7A B;  5G3L F;  4U67 3;  4A3K H;  3WDN A;  4LUV A;  1GO3 E;  4ABN A;  3CHB D;  1E22 A;  3A8K E;  3FRP B;  1TR5 A;  3JAM E;  1OO9 B;  2K5N A;  5LMN Q;  2FFK B;  2ZT9 C;  2XRQ D;  4DF7 A;  3SK5 A;  1JIC A;  4I7Z C;  1TS3 A;  1ICW A;  1V9P A;  5M5Y B;  2EPB A;  3N6R A;  4AH6 A;  2VB2 X;  1TWH H;  1EQQ A;  4LFB L;  1TWH B;  1VQL A;  2ZJQ A;  1RDP D;  5ELB A;  4DR6 L;  3T4A C;  2BDO A;  2OWO A;  3ICE A;  2IW3 A;  5C4X B;  1HUN A;  5DLQ E;  1PTO B;  3OPO A;  1BCP D;  3NQT A;  3UE0 A;  4DUZ Q;  4BS9 A;  5C3X A;  3RZO H;  1PLF A;  1IL2 A;  4GOP C;  5JJI A;  3HOZ G;  3GD7 A;  3AEV A;  1SFO B;  5JJZ A;  2Z0S A;  2AQ3 B;  3OTO L;  1BBW A;  1PH4 A;  4QIW E;  4O42 A;  2F0E A;  5C3W A;  4RCN A;  2VUM B;  3NWS A;  2MP1 A;  2F4I A;  4G7O C;  2UXD L;  2B2T C;  2NZ1 D;  2WB1 G;  4A3D B;  4DV5 L;  3CCJ A;  1EEI D;  3M3Y B;  4WJ4 A;  1IHZ A;  5FO8 B;  4A3I B;  1MD2 D;  2AQ2 B;  3P75 A;  3CMA A;  1H9M A;  1XXG A;  4I65 A;  4DV7 Q;  2H5X A;  3TME A;  3OTO Q;  1EIF A;  3CCL A;  4UPA A;  3UE1 A;  1SBB B;  1XNR L;  1SNO A;  4IPG A;  3HEJ A;  1FVI A;  2JQO A;  1E2V A;  4XQQ A;  1JCK B;  1HNZ Q;  1NJI C;  2F3I A;  4CBV A;  1CI3 M;  5G3L D;  1D5M C;  3GTM B;  2QDB A;  1Q81 C;  1NNX A;  2MGS A;  2Q8T A;  3K81 C;  3PUV A;  5GAE C;  4PZ6 A;  2I0Q A;  4DFA A;  3G6J B;  4CDD C;  1YJN A;  1VQ8 A;  3EN2 A;  4RGN A;  2K7V A;  1CKO A;  1EOV A;  2DN8 A;  3W5O A;  5JPM C;  1Q82 C;  3HRZ C;  2HQE A;  4QB4 A;  2MQH A;  4MHE A;  3SGI A;  1LT4 D;  2PQA B;  4KJO A;  3ULP A;  3S14 B;  4DAV A;  4KD3 A;  2NVT H;  1LO5 D;  2EJG C;  1J6Q A;  2AKW B;  4JI5 Q;  1C8C A;  2BH8 A;  3AU7 A;  4ZAI A;  1SFO H;  1GM5 A;  1MKH A;  3MC0 B;  2A1A A;  4A75 A;  3J7A 5;  2IPK D;  4CKE A;  2JA6 H;  3TS2 A;  3PIO 3;  2J4X A;  1T9H A;  4B9X A;  4P73 A;  1S4Z A;  5KEE A;  3DEP A;  3OYY A;  3HG9 A;  4X65 Q;  4HJ5 A;  5M5W B;  5BN5 A;  4QUF A;  1O7I A;  3D6C A;  1CTM A;  2K32 A;  2PZU A;  1MIU A;  1A2T A;  1CSP A;  1QIL A;  3I2Z A;  3K7A B;  5KRU A;  2UXD Q;  1K8O A;  2FJ2 A;  4A3I G;  4BA2 I;  1LT6 D;  3HOV B;  1Q8K A;  2R93 H;  2R6G A;  3PQI A;  1Y69 U;  4DR6 Q;  3I70 A;  3QJY A;  3J7A F;  1YNJ C;  5LMU L;  4X3K A;  1EY0 A;  4NMZ A;  1YNX A;  1TWC B;  4QF4 A;  3D4W A;  4A3M B;  3E9H A;  3BZC A;  3HOZ B;  1SAP A;  4YWM A;  4GLV B;  4LUZ A;  4LW1 A;  1FJG Q;  3PGZ A;  1L0Y B;  2CQA A;  2G9D A;  2C9O A;  3KOJ A;  5EQ0 A;  5M3F G;  2E2J B;  4GKJ Q;  2EOT A;  5BR8 L;  1J5E L;  1GOZ A;  2WB1 B;  3A7L A;  5M5X H;  3HOY B;  1SNM A;  2QW7 A;  1HQR D;  2R3Z A;  1IBL L;  2QEX A;  4ZQ3 A;  3E0E A;  1ENC A;  1ESF A;  1YZ6 A;  1EU4 A;  4ID6 A;  2MO1 A;  4PMW A;  1EYC A;  1N34 Q;  5A35 A;  1R4P B;  1FJG L;  1SLJ A;  3HOY G;  5EGT A;  4GOP B;  5JEA H;  5DEH A;  1EEF D;  2A6H D;  2QGQ A;  1I6H B;  1LTL A;  1I6H H;  4C56 C;  3CPF A;  1CA6 A;  1FGB D;  2OQK A;  4RKL A;  5C3E H;  1UE6 A;  5IOC A;  2R92 B;  3I7F A;  4L6T B;  3T1Y L;  1STB A;  2EXD A;  4P74 A;  4CHT B;  4JI5 L;  3CRK C;  4DXG A;  1SN8 A;  4C3I G;  1HHV A;  4QQB X;  3EIV A;  3KF8 B;  3VR3 A;  3T56 B;  5CV5 A;  4NXN Q;  2RDH A;  4IO9 A;  3CPW A;  1VMP A;  1NUC A;  1DD2 A;  4JVZ A;  1SEB D;  5IWA Q;  5K36 H;  1KNA A;  2M9V A;  2K52 A;  4DR5 Q;  3DEO A;  2EYL A;  4ME3 A;  4S3S A;  4DK0 A;  3PUX A;  4DR2 Q;  3I4N B;  1J8I A;  2E75 C;  2JXM B;  3PUZ A;  1II3 A;  4HTH A;  4IFD H;  2DY8 A;  1DJR D;  2KHS A;  3HKZ E;  2ZJP A;  1GJX A;  3KLR A;  2VS1 A;  3O13 A;  2RCF A;  3A54 A;  1SMX A;  4C1N I;  3OIQ A;  3CW2 C;  1EQR A;  3I4N G;  4DN4 M;  1PTO F;  3MEF A;  1PH1 A;  1BVS A;  4C3H G;  4KK7 A;  4HIO A;  1I94 L;  2MUY A;  1BNZ A;  3DLL A;  1J5E Q;  2IWH A;  1CM9 A;  5IYB H;  1VQI A;  4R4O A;  4NDX A;  4L5R C;  2XNA C;  4TSS A;  4DK6 C;  2I5M X;  4B3M L;  1HNX Q;  3S16 H;  4A76 A;  2BH2 A;  4A93 H;  1MJC A;  3TZD A;  1FL0 A;  4R9W A;  1YEZ A;  1FD7 D;  4K5W A;  1SE2 A;  2X6G A;  1RHP A;  1HRJ A;  3J81 L;  3CCU A;  2BE5 D;  4GS3 A;  5FLM G;  5IYC H;  3TRZ A;  3HFZ B;  4M1U B;  2A6E C;  5GRO A;  3K5L A;  5FK9 C;  1I3Q B;  2R61 A;  4JI2 Q;  4ZKB B;  2BA1 A;  2AQ1 B;  3RLO A;  1HNX L;  4RGT A;  1TS4 A;  1XX8 A;  1F2M A;  4R8N A;  3ND8 A;  4KHP Q;  1WI5 A;  4YCW A;  4BY1 H;  2BOS A;  1HPC A;  5JOB A;  4LFA Q;  5IGB A;  1JT8 A;  2PCF B;  1GUT A;  3WOE A;  3I4N H;  1EY8 A;  3FKI B;  5I6Y A;  1VQG A;  3ITP A;  1U4L A;  3KBX A;  4A3E H;  3K5O A;  4A3F H;  3SXH A;  2OQ0 A;  4UDU C;  5JJL A;  1Q1E A;  1HZC A;  2WAC A;  2HQL A;  1VQ5 A;  3RNU A;  2K5V A;  3ND9 A;  2JEA I;  4X62 Q;  3UDF A;  2QDL A;  1M1K C;  1OXX K;  4KN4 C;  2HCI A;  1SJE D;  3T1Y Q;  1YIT A;  5CR3 A;  5M5W H;  3KLS A;  2F4V Q;  3S1M H;  4HMJ A;  4BA1 I;  2F0H A;  3HOX G;  4EVO A;  4HSV A;  1ET6 A;  1RD9 D;  2A69 C;  5M3M B;  5IYB G;  5COR A;  4A3G B;  5C4X G;  1LTS D;  5IGG A;  1HFN A;  3STB C;  1GXD C;  4K5V A;  4QIW B;  2Q8R E;  1PFN A;  2PYK A;  3TSS A;  3S1Q H;  3S1Q B;  3PSI A;  4A3K B;  4H13 C;  4BY7 B;  4FYD A;  1H95 A;  3TEH B;  1BCP C;  3H91 A;  4K6D A;  2CQO A;  5C4J B;  1WTO A;  5K5P A;  3QB3 A;  3SDZ A;  2A69 D;  1HTL D;  3EBE A;  2CW0 D;  5E7N A;  4IJH A;  2XGT A;  4C3J B;  3GTK B;  4A3K G;  2KQ3 A;  3ZJY C;  1O7Z A;  2OXP A;  4FVM A;  1QG7 A;  4HCE A;  1TQO A;  1LAC A;  4PQX A;  2R93 G;  5C3E G;  1AH9 A;  1A0I A;  2NVQ H;  3TN2 A;  2X6L A;  1Z47 A;  3CP0 A;  4RCO A;  5D65 A;  2QEJ C;  1EY4 A;  1KLU D;  4RWS C;  3VYR A;  4DV3 Q;  4B3R Q;  1EU3 A;  4WJ3 M;  3HKZ B;  4WFN 3;  1TVX A;  4HMI A;  4PNY A;  1HUM A;  2NVX H;  2EYP A;  1SDF A;  4JI6 L;  3FKI G;  2VUM G;  4H44 C;  1IL8 A;  1S5E D;  4P75 A;  2Q8I B;  2F0F A;  1JJG A;  3DXJ C;  4PZ8 A;  2L4N A;  3GTL H;  3P1H A;  3HOX H;  3S1R H;  2EY6 A;  3H09 A;  1AP0 A;  1EZ8 A;  5TSS A;  1JC7 A;  1Q8I A;  3GQB A;  4MNO A;  4OX9 Q;  1JOR A;  1QCB D;  2NN6 H;  2ICE C;  4BBR B;  3F2B A;  3GTP B;  3GTJ B;  1B2T A;  2JA5 B;  2J7Z A;  1QZG A;  3AFP A;  2KHI A;  2PMZ E;  5JPN C;  1WD1 A;  4FF4 A;  2ZM6 L;  2ALY B;  1SR3 A;  1WJJ A;  4LFB Q;  4LFC L;  1H9S A;  1X54 A;  3M4O B;  2JP1 A;  3K7U C;  3MTS A;  5C4J H;  3TP7 A;  4B3S L;  3I3C A;  3KJO A;  4FXK C;  4YHH L;  3H6M A;  2E2I B;  5C44 H;  3K6O A;  5CBA E;  1I50 B;  1UNS A;  1R4Q B;  4ZLT F;  2F0G A;  3MEH A;  5IGE A;  4A3B H;  2EIF A;  4BXX G;  3L9A X;  1G2S A;  2D2C C;  3BYY B;  4A93 G;  1PTO D;  1X32 A;  4ZK9 B;  4JI1 Q;  4PZ7 A;  1KL9 A;  2ZXR A;  3MXG A;  4HJ7 A;  2Z9H A;  5CBE E;  2VQE Q;  2K50 A;  4A3G G;  1LT5 D;  1LAB A;  1NR2 A;  1JQY D;  2F0M A;  1VQE A;  3K59 A;  1B44 D;  5FO7 B;  1GUS A;  1MGS A;  4NKL A;  2CWA A;  3GV3 A;  1A15 A;  1HFG A;  5GAD C;  1AE3 A;  3M85 A;  1C7Y A;  1NTG A;  4DU9 A;  3L0O A;  3H3V I;  3P20 A;  1B3Q A;  4IPD A;  3MA2 B;  3HOZ H;  3U9O A;  4JPB W;  1ZXT A;  1S3O A;  2E5L Q;  1HXY D;  1F2Z A;  2F0N A;  2PW7 A;  1SXT A;  1VQC A;  2B63 H;  3PV0 A;  2IT1 A;  2R93 B;  1Y1V B;  3H0G H;  4A4I A;  4A3D G;  4DNI A;  4DXF A;  5J1Z A;  1E1O A;  1YHB A;  3K5N A;  3Q22 A;  1AZP A;  4WOR A;  5LL6 X;  1UE7 A;  3D0F A;  4A3M G;  5H1S E;  4H7B A;  2L55 A;  3K80 C;  4RHS A;  1LTI D;  2M2L A;  2R92 G;  3CCS A;  1G6P A;  3EA6 A;  4DK3 C;  4JI6 Q;  2IJ0 A;  1CT1 D;  2KA7 A;  4MTN A;  2ASB A;  1EL0 A;  1X6O A;  3E6Z X;  4HR7 B;  5C5M A;  1E2W A;  4FP5 D;  4IUN A;  1X3G A;  2ES2 A;  2XVS A;  1HZA A;  1V1Q A;  2JN4 A;  4IAL A;  3W1G A;  1DZ1 A;  2LKV A;  3HZX A;  2F0Q A;  3WWV A;  1W2B A;  4A93 B;  3KLW A;  4CKC A;  5J3B A;  1YHQ A;  4JOI A;  4A3F G;  3OW2 A;  2RHS B;  3QOJ A;  2Z8L A;  1NY4 A;  2JEB I;  1W6K A;  1PVO A;  1IBK L;  5C4X H;  1PFM A;  2HD3 A;  5FLX c;  3MHB A;  1Y1W H;  1PA6 A;  4X64 L;  3HOW H;  5KNC A;  5IP7 G;  5J39 A;  1WVL A;  4C3I H;  3VR6 A;  4DAY B;  4C3I B;  2CHB D;  1VQ6 A;  2F0L A;  3GTK H;  3KK7 A;  1QWY A;  4GZY C;  4A3M H;  3MAQ A;  1FNV A;  3I4M B;  4GKK L;  3VDY A;  5LMN L;  4DV4 Q;  1Y8O B;  3E3X A;  3J80 L;  3OWE B;  4A3D H;  2EYM A;  4DAM A;  2J0T D;  1IBK Q;  2N78 A;  3QO2 A;  5I2X A;  2ZTC A;  3U4V A;  2XSC A;  3RN5 A;  1HNW Q;  5BR8 Q;  5IGD A;  2IY5 B;  2A74 C;  3TP8 A;  2FMM A;  4X3T A;  1Q86 C;  5KND A;  1LTB D;  2PNR C;  3KF6 B;  3I55 A;  1PRT B;  5HUR A;  1IBL Q;  4H0L C;  3F2U A;  1M90 C;  3NTK A;  1CKN B;  4C2M B;  4CDE C;  5T1I A;  3E9I A;  2GA4 B;  2YU9 H;  5IGC A;  3S1R B;  4LNQ A;  2WII B;  3JAM i;  2GVA A;  4DV2 Q;  3E0J A;  4N8X 1;  3CD6 A;  2BA0 A;  2N88 A;  5CGK A;  3X3N A;  4DPG A;  4J8Q A;  4BY1 G;  5C5L A;  5IOD A;  3S2D H;  2MFI A;  4NP5 A;  3CME A;  2E5L L;  4F88 A;  2IHF A;  2L0C A;  2X69 A;  3S16 B;  1JMC A;  2K6A A;  2YTX A;  5ELE A;  5M3F B;  1TWC H;  4IUQ A;  3KFU A;  1VMC A;  1N36 L;  4YWK A;  1CQV A;  1ILQ A;  1CQF A;  1PZJ D;  3URY A;  4BY1 B;  1EIH A;  5IE8 A;  1PH3 A;  3PO2 H;  2I5L X;  3G71 A;  3U4Z A;  5C44 G;  2A6E D;  1PH8 A;  1DOK A;  4J6H A;  1QNU A;  3TRE A;  4XQJ A;  2XTI A;  1QE6 A;  3P7J A;  1IKL A;  1CSQ A;  4GLA C;  4YY3 L;  4A3B G;  5EAY A;  3OMG A;  5DNF A;  2F3V A;  1LT3 D;  3BG3 A;  3KYH C;  4KV6 A;  4TQU S;  1V8Q A;  3IL8 A;  1N36 Q;  5DM6 3;  4B3T Q;  4DR4 L;  3CXC A;  4J1M A;  3HP3 A;  1K83 B;  4KKT A;  4GNX B;  3S14 H;  4OIK A;  3ULJ A;  1TWA H;  1KDC A;  3RZD H;  1EIG A;  3C1E A;  4R4Q A;  1HCZ A;  5C0X G;  1D1I A;  1GUG A;  4KI0 A;  1D7Q A;  4X65 L;  1C4Q A;  2E2H B;  4A3F B;  1EOT A;  1UUP A;  4FO2 A;  4MZ9 A;  4MTK A;  4J15 A;  1U0L A;  5CYU A;  2KCC A;  1QVC A;  2WFW A;  2EQS A;  2VW9 A;  1A3V A;  3A74 A;  3ERQ A;  3M4Q A;  4L5Q A;  4DV0 L;  1FNW A;  4R8I A;  2Q2I A;  3PO3 H;  1BO0 A;  1E3P A;  1KDB A;  2P5Z X;  2QCP X;  4A3G H;  4TRD A;  4BBS H;  4A3J G;  2K1B A;  4AYB E;  3J7Z C;  2XN9 C;  3W2D A;  3TDQ A;  3NQI A;  2E2J H;  4GKK Q;  1VQM A;  4LF6 L;  2CFM A;  1VDZ A;  2K28 A;  1T5E A;  3H0G B;  3HOU G;  4V19 0;  1VQ7 A;  5IY0 A;  2SOB A;  3B6Y A;  1GD7 A;  2DNE A;  1LTA D;  3Q24 A;  1HNZ L;  1U4R A;  4QUC A;  1B8A A;  3KDF A;  1FNU A;  3AMU A;  4KMU C;  4N9T A;  5C4H A;  1B53 A;  3L7Z C;  2KED A;  3TS0 A;  3QG1 A;  4C3J H;  1JWS D;  4IFD I;  2JA7 B;  2JA7 H;  2RF4 A;  1KTK A;  1B7Y B;  5C44 B;  1Z9F A;  3E5S A;  5FLX E;  2CWP A;  3JAM c;  5NUC A;  4BBR G;  1H9K A;  2L15 A;  1K9M C;  1LUZ A;  3GTL B;  2B29 A;  3VR2 A;  3CCM A;  2EY5 A;  2EXZ A;  1C9O A;  2A73 B;  5ISR A;  4F87 A;  1IYU A;  1STG A;  4HJ8 A;  1GHK A;  4ME5 A;  1JE4 A;  1EQT A;  4IOA A;  1MSG A;  1JOO A;  5IWA L;  1CFM A;  4UP7 A;  4IOC A;  2YYZ A;  4YCV A;  3D3R A;  2EYJ A;  1W3S A;  5FKA C;  3F2D A;  3PIP 3;  1SYC A;  4X66 Q;  1HA6 A;  1RKN A;  3I8Z A;  4RFB A;  1JJ2 A;  2F0O A;  3TP5 A;  3AYH B;  4OL7 A;  5CV4 A;  3UDG A;  3S15 H;  2F1M A;  4OXP A;  2TSS A;  4DUY L;  1NAP A;  1V1P B;  3T16 A;  1EYD A;  1SMY D;  3CKI B;  1K73 C;  1Y1V H;  2FIN B;  2JA8 B;  4V0B A;  1DCZ A;  2EY2 A;  4DV6 L;  3SHL A;  3MFY A;  4DNR B;  4RG1 A;  3PUW A;  1XPO A;  1AFP A; 
#chains in the Genus database with same CATH homology
 5FLM H;  1X65 A;  4TVA B;  1IYJ B;  3PO3 G;  3EBE A;  2UUA L;  2JA8 G;  4POG A;  5E7N A;  1YBY A;  2YTV A;  4IJH A;  1XMO Q;  4JI1 L;  2XGT A;  3U58 A;  1X3F A;  4H02 A;  3D31 A;  3I4O A;  4IPC A;  4K0K L;  4A3K G;  3TQY A;  3PO2 G;  3ZJY C;  2IX0 A;  2I5H A;  3PF4 A;  1Q1B A;  1N8R C;  4RMF A;  1AH9 A;  1WCM G;  2R93 G;  5C3E G;  1A0I A;  2NVQ H;  1Z47 A;  3CP0 A;  4L5T A;  3MXN B;  2OTL A;  1EFW A;  4AQY L;  1K8A C;  1GVP A;  4DV3 Q;  5M3F H;  4B3R Q;  1CKM A;  2NN6 I;  2GN5 A;  1Q7Y C;  2PNH A;  4WJ3 M;  4LF6 Q;  1A63 A;  4IFD J;  1I5F A;  2VY3 A;  3A0J A;  2PI2 A;  4FDB A;  4R4T A;  2UUC L;  2AHO B;  4LF8 L;  3NBH B;  3S24 A;  2LXJ A;  4K0K Q;  2NVX H;  4JI6 L;  3FKI G;  2VUM G;  4OO1 G;  4DV5 Q;  1XJV A;  3CQZ H;  4P72 A;  4BXX H;  4P75 A;  3G48 A;  2VUM H;  2MO0 A;  5IYC G;  1OXT A;  1JJG A;  1HJP A;  2HIV A;  4PZ8 A;  2LXK A;  4GN4 B;  2JA9 A;  3GTL H;  4R1J A;  4NPS A;  2D62 A;  3HOX H;  3S1R H;  2ZTE A;  4DV3 L;  4DR7 Q;  1HZ9 A;  1GKH A;  1UE5 A;  3HKZ G;  4LWC A;  4MNO A;  1OXV A;  4OX9 Q;  1X9N A;  3RLF A;  4LF5 L;  4LF4 Q;  3RLN A;  1XNR Q;  3M7N A;  4X6A H;  3F2B A;  2JA5 H;  4APV A;  3JC6 6;  4JI3 Q;  1L2F A;  2Q2H A;  1QZG A;  4DR2 L;  3AFP A;  3LGJ A;  4X62 L;  1IBM L;  4JG2 A;  2CCZ A;  2KHI A;  2R7D A;  2KEN A;  2PMZ E;  3S1N H;  4JBW A;  3BU2 A;  4Y7N H;  2WP8 J;  2ZM6 L;  4DR3 L;  4KHP L;  2ALY B;  1SR3 A;  1WJJ A;  1QUQ A;  2WAQ E;  4LFB Q;  4LFC L;  2UXC Q;  1X54 A;  3CCR A;  4JI4 L;  2JA8 H;  3S14 H;  4IFD G;  1EWI A;  1HZB A;  3CC7 A;  3K7U C;  1TXY A;  4DV0 Q;  4BY7 G;  5C4J H;  2LSS A;  3G6E A;  4B3S L;  3KJO A;  2V1C C;  2JK8 A;  4JI7 L;  4A3K H;  4POF A;  4YHH L;  4LUV A;  1GO3 E;  1C0A A;  5C44 H;  3S17 H;  2R92 H;  2VL6 A;  3ULL A;  3CCQ A;  1E22 A;  1WOC A;  1UWV A;  1XPU A;  2K5N A;  5LMN Q;  1X55 A;  3HOU H;  4AIM A;  4A3B H;  1HR0 W;  2EIF A;  4UY8 C;  4BXX G;  4EX5 A;  4YY3 Q;  3KDF B;  1G29 1;  3CAM A;  1RIP A;  4KHZ A;  4JI0 L;  1V9P A;  3CF5 A;  1TWF H;  4C3H H;  1CKN A;  1QZH A;  2ATW A;  2R7F A;  4A93 G;  1D8L A;  4AH6 A;  4LFB L;  1TWH H;  4PZ7 A;  4NXN L;  1KL9 A;  4JI1 Q;  4HJ7 A;  1EQQ A;  4JI4 Q;  1VQL A;  3S2H H;  2ZJQ A;  2VQE Q;  2ZJR A;  3DM3 A;  2K50 A;  4B3T L;  5AJ3 L;  4DR6 L;  5IP9 H;  2OWO A;  3ICE A;  2CKZ B;  1ASY A;  3UDI A;  4A3G G;  5DLQ E;  3UE0 A;  4DUZ Q;  1KXL A;  3RZO H;  1VQE A;  1IL2 A;  3GDE A;  2E2H H;  4GOP C;  2Y0S G;  5JJI A;  3HOZ G;  3GD7 A;  4DV6 Q;  2D0O A;  3AEV A;  2CWA A;  4NB3 A;  3PIO A;  2Z0S A;  5GAD C;  1AE3 A;  3M85 A;  1L1O C;  1BBW A;  3OTO L;  4QIW E;  1PH4 A;  1UE1 A;  1C7Y A;  4JI0 Q;  4BBS G;  2JJQ A;  1NTG A;  2FXQ A;  4QJF A;  2Q2U A;  3L0O A;  2VNU D;  3H3V I;  3I4M G;  2UXD L;  4IPD A;  2WB1 G;  4C2M H;  2UUA Q;  3HOZ H;  2K4K A;  4P71 A;  1BKB A;  5AJ3 Q;  3CCE A;  4DV5 L;  2DUD A;  2Z6K C;  3CCJ A;  1JB7 A;  1PYS B;  1S3O A;  3J81 c;  2E5L Q;  3M3Y H;  3NEM A;  2Y0S E;  4WJ4 A;  1VQC A;  2IHE A;  2B63 H;  3F1Z A;  3PV0 A;  2IT1 A;  1PHJ A;  3CMA A;  1P16 A;  2JA5 G;  4DV7 Q;  2H5X A;  3GO5 A;  3H0G H;  3OTO Q;  1EIF A;  4GNX A;  1L1O B;  4A4I A;  3FHW A;  3CCL A;  4DNI A;  4A3D G;  4LF5 Q;  4UPA A;  3UE1 A;  1E1O A;  1YHB A;  1XNR L;  3FKI H;  4IPG A;  1FVI A;  4OWW B;  1WFQ A;  1UE7 A;  2JQO A;  3D0F A;  4A3M G;  5H1S E;  3CC4 A;  2R7Z H;  3K80 C;  4GKJ L;  1HNZ Q;  2R92 G;  1NJI C;  4X66 L;  2F3I A;  3CCS A;  1G6P A;  4DK3 C;  1NBW A;  4JI6 Q;  4MTN A;  2ASB A;  1Q81 C;  2OTJ A;  1X6O A;  1A8V A;  2ID0 A;  1PH2 A;  2HHH L;  2GVB A;  4PG3 A;  1VQP A;  3CC2 A;  3K81 C;  3PUV A;  1X3G A;  5GAE C;  4PZ6 A;  2ES2 A;  1ASZ A;  2I0Q A;  1N33 L;  4A3L G;  1HZA A;  1YJN A;  1V1Q A;  4GOP A;  1N34 L;  1VQ8 A;  3EN2 A;  2UU9 Q;  1QUQ B;  4DR7 L;  2YV5 A;  3W1G A;  4JI8 Q;  4OO1 I;  1CKO A;  4JBJ A;  3WWV A;  1EOV A;  3BZK A;  2VZA A;  3W5O A;  1W2B A;  2VQF L;  4LF4 L;  3KLW A;  3I4M H;  5J3B A;  1Q82 C;  3HOW G;  1YHQ A;  2MQH A;  3K0X A;  4JOI A;  5M5Y H;  3OW2 A;  4A3F G;  4OON A;  3SGI A;  2RHS B;  1XNQ Q;  4JV5 L;  2PQA B;  4DR1 Q;  3ULP A;  5GAH C;  1XMQ L;  1K0R A;  5FJ8 H;  1NY4 A;  2JEB I;  2UUB L;  4LFA L;  1PH5 A;  3RR5 A;  2NVT H;  1PVO A;  2QA4 A;  1J6Q A;  2AKW B;  1XPR A;  1IBK L;  4JI5 Q;  5C4X H;  1QVF A;  5FLX c;  1E7Z A;  1Y1W H;  2BH8 A;  4X64 L;  1PA6 A;  2YTY A;  4LUO A;  1SFO H;  1U5K A;  4OWX B;  3GTQ H;  1GM5 A;  3HOW H;  2R7Z G;  1KAW A;  1MKH A;  1BBU A;  1VQF A;  2A1A A;  5IP7 G;  4A75 A;  3J7A 5;  3PUY A;  1QVG A;  3AQQ A;  3STB D;  4C3I H;  2JA6 H;  2WB1 E;  4DV1 L;  4DAY B;  3TS2 A;  1VQ6 A;  3GTK H;  3M4P A;  1T9H A;  4DR5 L;  1YI2 A;  1PYB A;  4P73 A;  1RL2 A;  1E24 A;  4A3M H;  4HIK A;  3OYY A;  1X3E A;  4GKK L;  1XNQ L;  3VDY A;  1XPO A;  4X65 Q;  4HJ5 A;  2B3G A;  1TWG H;  3KF6 A;  5LMN L;  4DV4 Q;  4B3R L;  1O7I A;  2C35 B;  4A3D H;  4DAM A;  1IBK Q;  5JJK A;  2N78 A;  2UXB Q;  2F4V L;  1Q46 A;  1MIU A;  2ZTC A;  1CSP A;  3I2Z A;  5M3M H;  3U4V A;  2UXD Q;  4A3I G;  1Y1W G;  1HNW Q;  3RN5 A;  5BR8 Q;  4BA2 I;  2IY5 B;  1VQO A;  2KCM A;  4DUY Q;  1Q86 C;  1Q8K A;  1CUK A;  1WCM H;  2R93 H;  2R6G A;  3IRB A;  3KF6 B;  3I55 A;  3PCO B;  4O0A A;  4DV1 Q;  4LF7 Q;  4DR6 Q;  2NVY H;  2IX1 A;  1NMF A;  5LMU L;  1YJW A;  1IXR A;  1IBL Q;  4JBK A;  4UP9 A;  1PFS A;  1M90 C;  1HH2 P;  1YNX A;  1CKN B;  3E9H A;  3BZC A;  1KQS A;  2NN6 G;  4YWM A;  3I56 A;  1L0W A;  4GLV B;  4LUZ A;  4LW1 A;  1FJG Q;  1S72 A;  3E9I A;  1VQ4 A;  5JEA J;  3PGZ A;  2YU9 H;  2HT1 A;  4AYB G;  3BJU A;  3M4O H;  4LNQ A;  2AWN A;  1VQA A;  1N9W A;  3KOJ A;  4YWL A;  3JAM i;  5M3F G;  1I94 Q;  4GKJ Q;  4L5R C;  2GVA A;  5BR8 L;  4DV2 Q;  3HOV G;  3CD6 A;  1J5E L;  4JI3 L;  1VQH A;  2BA0 A;  3HOV H;  1VQ9 A;  3UDX A;  4DPG A;  5M5X H;  4B3M Q;  1VQN A;  4BY1 G;  2NZO A;  2PI2 E;  3S2D H;  2PQA A;  1PH7 A;  2MFI A;  5LMU Q;  1IBL L;  1DGS A;  3CME A;  2E5L L;  1K8G A;  2QEX A;  4A3C H;  2IHF A;  3E0E A;  5IYD G;  1JMC A;  2YTX A;  1YZ6 A;  1TWC H;  4R4I A;  1G51 A;  2MO1 A;  4GN3 B;  3J81 i;  4PMW A;  4LFC Q;  4UP8 A;  1N34 Q;  4ALP A;  3KFU A;  1WYD A;  1N36 L;  4YWK A;  1FJG L;  1Y1V G;  3G4S A;  1SLJ A;  3HOY G;  3J81 j;  4JI8 L;  4GOP B;  3GTM H;  5IE8 A;  4BY7 H;  1XTD A;  1KIX A;  1PH3 A;  2QGQ A;  2I5L X;  3G71 A;  2UUC Q;  3PO2 H;  5IP9 G;  3U4Z A;  1LTL A;  3U50 C;  1I6H H;  4DKA C;  3CPF A;  5C0X I;  5C44 G;  4DR1 L;  4JI2 L;  2B63 G;  2OQK A;  5C3E H;  1VCI A;  4QL5 A;  1UE6 A;  1PH8 A;  3I7F A;  3TRE A;  2XTI A;  1OTC A;  3T1Y L;  2EXD A;  1CSQ A;  4GLA C;  4P74 A;  4JI5 L;  4YY3 L;  1SN8 A;  2RCN A;  2JA6 G;  2K14 A;  4R4C A;  4A3B G;  3EIV A;  5EAY A;  3PIP A;  3KF8 B;  4QQB X;  1JE5 A;  4X64 Q;  3J80 c;  2HHH Q;  1VQJ A;  5HGQ A;  4O2D A;  2F52 A;  1I3Q H;  4NXN Q;  2MNA A;  3KYH C;  4TQU S;  1VQB A;  1N36 Q;  4DR4 L;  4B3T Q;  4IO9 A;  3CPW A;  2ZTD A;  3CXC A;  1K3R A;  1LM0 A;  4BBR H;  3GTP H;  1IZ6 A;  5IWA Q;  5JEA G;  2N3S A;  2K52 A;  4IJL A;  1V43 A;  5LMN W;  1B70 B;  3ULJ A;  1TWA H;  4GNX B;  4DR5 Q;  3RZD H;  1YJ9 A;  4R4Q A;  4ME3 A;  2HIX A;  2OCE A;  4XTC S;  5C0X G;  4HJA A;  4KI0 A;  3PUX A;  1KD1 C;  4DR2 Q;  1VQK A;  1D7Q A;  4X65 L;  1SE8 A;  2KBN A;  3K7A H;  4JV5 Q;  1KHI A;  3ERS X;  4MZ9 A;  2UXB L;  5FJ8 G;  3PUZ A;  2UUB Q;  1S40 A;  4J15 A;  1HNW L;  3H0G G;  1U0L A;  2KCT A;  1QVC A;  3GTG H;  4LF9 L;  2WFW A;  2EQS A;  2VW9 A;  4QY7 A;  3A74 A;  4L5Q A;  3M4Q A;  3HKZ E;  2ZJP A;  3FP9 A;  4DV0 L;  1UEB A;  1SRO A;  2D0P A;  1N32 L;  2Q2I A;  5HY6 A;  2VS1 A;  3PO3 H;  1SMX A;  1K83 H;  4YHH Q;  3RN2 A;  1E3P A;  1LYL A;  3A5U A;  4IPH A;  1Y14 B;  4A3G H;  3CW2 C;  4JYA L;  3HKS A;  4BBS H;  1EQR A;  4JOI C;  4A3J G;  3I4N G;  2JE6 I;  4XIG S;  4AYB E;  3J7Z C;  1EYG A;  4A3I H;  3MEF A;  2E2J H;  5C0X J;  4JCV E;  4EQ5 A;  3GTO H;  1PH1 A;  1BVS A;  1VS0 A;  4GKK Q;  1VQM A;  3NEN A;  4LF6 L;  1Q12 A;  2CFM A;  2N8N A;  4HIO A;  1R9T H;  1I94 L;  4AQY Q;  3HOY H;  3DLL A;  4LF8 Q;  1J5E Q;  3HOU G;  2A8V A;  5IYB H;  1VQ7 A;  5IY0 A;  1VQI A;  3B6Y A;  1GD7 A;  3M9B A;  2AWO A;  4R4O A;  2VQE L;  4B3M L;  4HJ9 A;  4DK6 C;  2I5M X;  1NE3 A;  1HNZ L;  1B8A A;  3KDF A;  1HNX Q;  3S16 H;  1X56 A;  1N32 Q;  4A76 A;  2BH2 A;  4A3E G;  4A93 H;  1MJC A;  1EIY B;  4DUZ L;  1FL0 A;  4LF7 L;  2RHQ B;  3L7Z C;  1OXS C;  4JC0 A;  1YEZ A;  3TS0 A;  1I50 H;  4JBM A;  4C3J H;  2N49 A;  4IFD I;  4A3J H;  2JA7 H;  2RF4 A;  3CCV A;  2E2I H;  1B7Y B;  2A19 A;  3CCU A;  4GS3 A;  1PV4 A;  5FLM G;  4OX9 L;  5IYC H;  1Z9F A;  3HFZ B;  5ELO A;  3TRZ A;  1OXU A;  1KRS A;  2AMC B;  5GQO A;  2CWP A;  1MJE A;  4L5S A;  3JAM c;  5GRO A;  2Z6K A;  4BBR G;  4KLK A;  2L15 A;  1K9M C;  1LUZ A;  3KJP A;  1A62 A;  2B29 A;  3Q8D A;  4JI2 Q;  2JA7 G;  2BA1 A;  4DV2 L;  3RLO A;  3CCM A;  5IYD H;  1HNX L;  2WAQ G;  3T1H Q;  1C9O A;  3A5Z B;  3W1B A;  3F2C A;  4YCU A;  4KHP Q;  1KRT A;  1WI5 A;  4YCW A;  4BY1 H;  1YIJ A;  4HID A;  4NXM L;  4LFA Q;  5IP7 H;  1JT8 A;  4HJ8 A;  1HR0 Q;  1KC8 C;  4Y52 H;  3PF5 A;  2NZH A;  4DV7 L;  3I4N H;  2DGY A;  4IOA A;  5IWA L;  1VQG A;  4QGU A;  5M3M G;  3L2P A;  4IOC A;  4UP7 A;  2YYZ A;  1P8L A;  4YCV A;  4A3E H;  5IT9 c;  2KHJ A;  1YVC A;  1W3S A;  4A3F H;  3F2D A;  4GLX A;  2OQ0 A;  5JJL A;  1Q1E A;  4GNX C;  1HZC A;  5GAG C;  2HQL A;  4X66 Q;  1VQ5 A;  3ER0 A;  3T1H L;  3RNU A;  5ELN A;  1PH6 A;  2K5V A;  2JEA I;  4X62 Q;  3F8T A;  1JJ2 A;  3UDF A;  3K8A A;  1AE2 A;  3GTJ H;  1IBM Q;  2K75 A;  1M1K C;  3NEL A;  4NXM Q;  1E1T A;  1OXX K;  4DV4 L;  3H15 A;  3AYH B;  3AFQ A;  1JJC B;  3T1Y Q;  3J80 i;  4HIM A;  1YIT A;  5M5W H;  1HR0 L;  1PH9 A;  4LF9 Q;  2F4V Q;  3S1M H;  3HOX G;  4BA1 I;  2ZM6 Q;  4DR3 Q;  3UDG A;  3S15 H;  4A3L H;  1N33 Q;  1YHA A;  1XMO L;  4OXP A;  2UXC L;  2UU9 L;  4DUY L;  5IYB G;  5C4X G;  4DR4 Q;  1K73 C;  3STB C;  1Y1V H;  2Q2T A;  4B3S Q;  5K36 G;  4JYA Q;  4JI7 Q;  1FGU A;  2VQF Q;  4DV6 L;  3S1Q H;  1L1O A;  1SRU A;  3PSI A;  2K5H A;  4OWT B;  4GN5 A;  4RG1 A;  4A3C G;  3PUW A;  1NMG A;  1XMQ Q;  1H95 A;  3TEH B;  2CQO A;  3H3V H;  2E8G A;  1EUJ A;  1VQD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...