1SNOA

Protein stability in staphylococcal nuclease
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
136
structure length
136
Chain Sequence
KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQLLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords STAPHYLOCOCCAL NUCLEASE
publication title Coupling between trans/cis proline isomerization and protein stability in staphylococcal nuclease.
pubmed rcsb
source organism Staphylococcus aureus
total genus 38
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 1996-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1snoA00
4F8MA 4KHVA 4OL7A 2F0DA 5F2DA 3E5SA 3SK8A 2EYFA 3MXPA 5CGKA 5C4ZA 2PYKA 4NKLA 1KABA 1JOQA 3MEHA 2OXPA 3MVVA 4N9TA 3QOLA 4WORA 3TP5A 5KIXA 3BDCA 2F0TA 4KD4A 5I6YA 3P75A 3SR1A 5HGTA 4QF4A 4R8NA 1EYDA 4PMBA 4DF7A 4K2KA 3S9WA 1II3A 2F0OA 3D6CA 5CV9A 5JOBA 4K14A 5IGFA 3PMFA 5CV7A 2EY1A 2RBMA 2SOBA 4NDXA 3QOJA 1SNQA 5IGDA 1SNOA 2M00A 5IGGA 1SYBA 2QDBA 5KYIA 1EY8A 2SNMA 5CV4A 1KDBA 2PW7A 1F2ZA 1IHZA 2ENBA 2F0GA 5E1FA 3EROA 3SK6A 4NP5A 5I9PA 5IODA 1SNPA 4EVOA 2F0FA 5KYLA 3BDLA 5IIFA 2F0MA 1SYCA 1TR5A 1EZ6A 2RDFA 1STGA 4ID6A 3T16A 2EY2A 5EGTA 4KY6A 3T13A 1EQVA 2PZUA 1SNMA 2F3VA 4B9WA 1EYCA 5CV6A 5C3XA 5IGCA 1EYAA 1STBA 3C1FA 1EY7A 1RKNA 2EYLA 3OWFA 2F0VA 1EY4A 4PMCA 4QB4A 5ISRA 1KAAA 1EY6A 1SNCA 3EVQA 4KY7A 4RKLA 5DEHA 3NP8A 4LAAA 4N9PA 2OEOA 4ZUJA 3D4WA 2F0IA 4DGZA 2F0NA 2EYMA 4K2LA 4KY5A 3NHHA 5DAUA 3LX0A 5C5MA 3V2TA 4DU9A 1STNA 3SK4A 4ME5A 3VA5A 1TT2A 4DFAA 3DHQA 1SNDA 2EYOA 1A2TA 3ITPA 3EJIA 5C5LA 5I6WA 4PNYA 3TP8A 4EQPA 5KEEA 2EXZA 3RUZA 1A2UA 2F0WA 4ODGA 3C1EA 3D8GA 4EQOA 3DMUA 1A3UA 1SYEA 5K5PA 3MHBA 4WRDA 4ZUIA 4IUNA 4NMZA 3HEJA 3R3OA 1TQOA 3NK9A 4KJOA 2F0LA 3NQTA 2SNSA 4HMJA 5CV5A 3SHLA 1F2MA 4K8IA 1KDCA 4KTAA 3TP6A 2F3WA 5J22A 2PQEA 2KQ3A 2WACA 3NXWA 2F0HA 4K6DA 5IGBA 1STAA 3MZ5A 5CV8A 3TMEA 5IOCA 5EKKA 5J1ZA 4MIUA 3OMGA 2EYPA 1KDAA 2EYHA 2F0KA 1STHA 2F0PA 3OSOA 2EY6A 1EZ8A 4QMGA 1SYGA 3U9OA 4H7BA 4B9XA 1ENCA 1EY5A 2F0EA 2F0SA 2PW5A 5C6AA 4K5WA 2PZWA 4KV6A 3P1HA 5C4HA 4HTHA 5KGUA 1ENAA 1NSNS 5JAVA 5CR3A 4IALA 4J1MA 1F2YA 2F0JA 2NUCA 1EY0A 1JOKA 5I9OA 5HURA 3ERQA 4K5VA 4RKBA 4YIJA 5CC4A 1EY9A 1SYDA 2HQEA 1A3VA 3HZXA 2EYJA 3QB3A 1JOOA 4HMIA 2OF1A 4IZ8A 4TRDA 1JORA 3D4DA 1U9RA 4KD3A 2KHSA 5KRUA 4EQNA 2EY5A 4ZQ3A 4I65A 5EKLA 4E6IA 3H6MA 4K5XA 4S3SA 5C3WA 2O4XA 1A3TA 1SYFA 2RKSA 2F0UA 2F0QA 3TP7A 5IGEA 5E3FA 1STYA 3NUCA 2PZTA 5J39A 4K8JA 1AEXA 3OMCA 2LKVA 4J6HA 4KJNA 5NUCA 3SK5A 5M9OA 4G57A 1NUCA 3SXHA 4F7XA
chains in the Genus database with same CATH superfamily
4IURA 2R3ZA 3WOEA 1LT6D 1LTRD 3ZJYC 3A7LA 2IX3A 5D3DA 3MVVA 4ABNA 5CBAE 5GAHC 1G6ZA 1WTHA 4PZ8A 4KD4A 1PTOF 2DY7A 5IP9G 1WCMG 3R2IA 3KF8A 4JK1C 1J5EL 1Q1EA 2M00A 2N8NA 3LGJA 3CQZH 3BVGA 3JAML 1S3OA 1S4ZA 1Y1WH 5TSSA 1HZCA 1SNPA 3RN2A 1SFOH 3TEHB 1TR5A 2RDFA 1PTOH 3EQLC 4XT1B 2I46A 4RH6A 1B50A 3GTQH 4B9WA 4C2MB 1G2SA 1XMQQ 5HY6A 4O1NA 4IQZA 4H44C 1XXGA 3OWFA 2ZJPA 1QCBD 2RQXA 4DV0Q 2UU9Q 1LTID 3C3LA 1WOCA 4YWKA 1RTNA 2BA0A 3NSWA 4FXKC 4BXXH 5DAUA 3MFGA 3PUYA 1TT2A 5EJWA 1OXUA 3ZYYX 2E74C 3HP3A 3A5ZB 3HOVH 2LXKA 3TZDA 4ZAIA 3OW2A 3M85A 4C1NK 3MHBA 2R7ZB 3EBEA 1CQVA 3HKSA 2CKZB 3S2HB 3NK9A 3SHLA 4K8IA 2E5LQ 4QJFA 4K6DA 4DK0A 3F8TA 4P75A 1ESRA 4M8AA 4F87A 4C3JG 2JP1A 4MIUA 4OELB 2EYPA 4Y7NH 3PO3G 4ZYSA 3MXUA 1HNXL 3KLSX 3G48A 4CDCC 1DOMA 3S17H 1B9NA 2JA9A 2PW5A 4X66Q 1C0AA 3FEWX 4YCVA 4BXXG 4FXDA 2X6GA 4J1MA 4LWCA 4A4IA 5IT9L 2NZOA 1D5ZC 3C2PA 1PYBA 3K5MA 3M4OB 1EEID 1RDPD 1YJWA 1AZPA 1P16A 2NWGA 4K5XA 1QILA 1VQ4A 2K05A 3G7LA 1PH2A 1NJIC 4GKKL 1JT8A 1FYCA 3HGBA 2NVXH 5M9OA 2OQ0A 4HCSA 4CDFC 2UXDQ 1E2WA 1XWEA 5GAGC 3TQYA 2Z4IA 1PH1A 1F9QA 2OWOA 4R4IA 2KJXA 3J81i 4RGNA 5JJKA 4R8IA 4A3KB 4BBRG 3GV3A 4P2CB 1PV4A 5EPKA 1XNRQ 1IW7D 2ENBA 4EVOA 4YHHL 4A3CH 5I2XA 4DV2L 2DUDA 3W3AA 1E2VA 1STGA 2VZAA 4A3DG 2EPBA 4LUVA 1UE6A 2ZM6Q 1LTAD 1RKNA 1EY6A 4KY7A 1TWCH 3IRBA 3NP8A 4R4OA 2UUAQ 2FXQA 2B2VA 2GA4B 4YY3Q 2ZJRA 3NHHA 2QEJC 3I56A 2CVRA 1VQIA 2FHTA 1LT3D 2EYOA 3EJIA 1VQ9A 5M3MG 2VQFQ 3CU7A 5ELBA 3C1EA 1LT4D 1QWYA 3H94A 1D6EC 4HSVA 4YCWA 1M8AA 2JA7H 4MNOA 3L2PA 1HJPA 4IUTA 1ILQA 3TP6A 4A3FH 1BNZA 3KFUA 4BWGB 3TS0A 4UP8A 2AQ3B 3CCUA 1IYVA 2EYHA 1STHA 1V1PB 2IL8A 5C4XH 4H7BA 4PMWA 1X65A 2E2JB 2F0EA 5M3FB 5C6AA 3RLFA 3CC7A 1JICA 2UXCL 5LL6S 1IW7C 1S5FD 2GN5A 5LMUQ 4A3EB 5HURA 5JJZA 1S5ED 4XQJA 3OIPA 3QB3A 4JVZA 2EIFA 2F52A 1SSOA 5ELDA 3NBIA 2UUBQ 1JE5A 4A3FG 3FDTA 1TWFB 3J7ZC 1CZGA 3V05A 5J39A 4K8JA 3URYA 3SVMA 4J8QA 2TMPA 1GO3E 2Q8RE 1L0XB 3OOCA 4JV5L 1GKHA 3SK8A 5C4XG 3NBHA 3PF4A 5C4ZA 4R1JA 5A2QL 2Q2UA 4N9TA 2LY7A 4P71A 3GTLB 1IBKQ 1NE3A 5HGTA 3L3OC 5IYBH 4AYBB 3CRLC 2EY1A 4C3IG 1O7LA 4X65L 3J7A5 4WJ3M 4UHVA 4CDDC 1V8QA 3SE0A 2YTXA 3GTKB 1KDBA 4Q0FA 4DV7L 4UP7A 4DAYA 1E22A 1Q8KA 1PHJA 1C48A 2EY2A 5EGTA 3AFPA 4KY6A 5FKAC 4ALPA 2N88A 5FJ8G 5LHY1 2R7ZH 1D8LA 2AUJD 3S1NH 3S2HH 1N36L 5C3EB 5DEHA 5IYDH 1E24A 1BQQT 1Q81C 2FJ2A 4ILWA 4JI2L 3T1YQ 4XT3B 2C9OA 5IYBG 3J7AV 4A3JB 1JB7A 1MGSA 1EWIA 2EXZA 2QA4A 1A2UA 1BBXC 1UUPA 4IJLA 3A74A 4HIMA 4AQYQ 1NAPA 1KDCA 3KJPA 3M4OH 2H5XA 1NBWA 1YNXA 5E4WC 3G6JB 4DV5L 1ASYA 1JCKB 3MZ5A 1PH6A 1G91A 4OIKA 1RIPA 4EQ5A 3QO2A 4QMGA 2JYOA 5IYDG 2SEBD 4AYBE 4OWXB 4BY1H 2KHIA 5JAVA 4POFA 1Y8NB 2PNRC 4GNXB 4JI0L 3I4MB 2N49A 2WAQB 1I4RA 4K5VA 3UDIA 1GJXA 1KXLA 5EPJA 2CH4A 2I5HA 1QJOA 1U4MA 1RL2A 2F3IA 4HMIA 3RMHA 4NXMQ 1G8ZD 4LFBQ 1IYJB 3RLNA 3AYHB 3W1BA 4A3KH 2JK8A 1F9PA 1NR4A 4HEDA 3OW7A 4H13C 2B2UC 3GDEA 1MD2D 1SLJA 2HIXA 1A8VA 2LFNA 2PYKA 2VS1A 1GD7A 1MSGA 5M5WB 4BY1G 3S2DB 4JI2Q 4FP5D 2JQOA 4YWLA 2P5ZX 5IGFA 3PMFA 5I4DA 5IGDA 1I5FA 5IGGA 2N3SA 4DR5Q 2C5CA 3CW2C 1IHZA 4J15A 2XRQD 3S16B 1XYIA 1CT1D 1KLUD 4LMQD 4QQBX 1WCMB 3X3MA 1KRSA 3H3VC 4IN3A 4OIJA 2F4VQ 4DA2A 3EFXD 4QY7A 3LNNA 5IGCA 4QB4A 1ML0D 4PG3A 1B3QA 4U673 3E9IA 2Z4HA 1BDOA 1S5DD 2A5HA 2QKIC 2HDLA 1STEA 2EYMA 2IPKD 4B3SQ 4A3MB 2KVMA 2E2JH 4CGYB 5M3FH 3OIQA 2D2CC 3MWYW 2RVLA 3WWVA 3A8JE 2ZTEA 4A3EH 3VA7A 2KUMA 1TQOA 1EU4A 1VQEA 4HN7A 4PV1C 2MGSA 3I7FA 3DEPA 4DFAA 4XIGS 2K01A 1VMPA 4KKSA 2LMCB 1SYGA 1QVCA 1EIHA 4CJ0B 2E2DC 4LF7Q 5C4HA 3PUVA 1C7YA 4HTHA 5T1IA 1VQ5A 1SFOB 4DR3Q 3CCVA 1HFNA 1SJHD 2NUCA 1PTOB 3OTOQ 1B9MA 4C3JB 3MXNB 1A3VA 1MKHA 1PFMA 1JOOA 1KAWA 1VQBA 2YV5A 3SGIA 3PO3B 3GTLH 3J81L 5KRUA 1HFGA 4BS9A 4DV3L 4A3EG 2O4XA 4L6TB 4GOPC 3T56B 2RKSA 4FVMA 1FGBD 1HCZA 3UE1A 1CZWA 2A19A 4J6HA 4P73A 2JSOA 3G4SA 4X3SA 1PRTF 1XMOL 4A3BG 4B3ML 1LV9A 2IWHA 3MEHA 1Z6HA 2CH4W 3LWEA 5KIXA 4KI0A 2UXBL 2A6ED 1PZID 3DXJC 1K8OA 1W6KA 2F0OA 4K14A 2ASBA 4Y7NB 4IPCA 1ZXTA 4X3TA 3VR3A 1I4GA 4JI4Q 5E1FA 4ZLTF 1UEAB 2A73B 1K0RA 4DAMA 4A3JH 3TSSA 2LXJA 1GUGA 3NEMA 3BDLA 5IIFA 1B53A 5IWAL 2PCFB 3CD6A 2B2UA 4BBRB 1X3PA 1HA6A 2EVBA 2EE1A 5C3XA 1EYAA 5FLXL 2EJGC 4U68A 1GUSA 2F0VA 5AJ3L 3H15A 3RLOA 2MP1A 3GQBA 3J7YW 1EIFA 4KY5A 3PUZA 5C5MA 1XX8A 4A3DB 4ME5A 3E3XA 3VR5A 2N55A 3HOWG 1HNWL 3J80i 4DR7L 3LWUA 1A3UA 4OX9L 4HR7B 3I4MH 1GVPA 4JI1Q 1EFWA 1YHAA 3A5UA 1YITA 1KNAA 4HMJA 1HH2P 3M9BA 1EIYB 2RHSB 1V1PA 3NXWA 1DOLA 1VF5C 4X62Q 5M3MB 1TWHB 2A6EC 1PYWD 5J1ZA 1VF7A 3CRKC 2EY6A 1ONLA 3L0OA 1I94Q 4FYDA 4O42A 3FKIG 5D3IB 2KHJA 2YU9B 4IALA 1LACA 1X3FA 2B2YC 1G6PA 4RGOS 2NB0A 1DYQA 2I5LX 4IPDA 2HQEA 1IKMA 1JORA 5JPNC 1U9RA 1PTOD 3TDQA 1TWCB 2BOSA 4OWTB 4FDBA 4HJAA 3S2DH 1XMQL 1D5MC 4XQQA 1B70B 3RN5A 1FGUA 1AE2A 2O2LD 4DV0L 1X9NA 1WTWA 2BDOA 1AEXA 4L5TA 3SK5A 2UU9L 1V1OA 1E1OA 1L1OB 4JPBW 2VW9A 3S16H 3NWTA 3CC2A 1SE8A 4GN4B 4L63B 5L37A 4DKAC 4N8X1 4CJ2C 3BDCA 2Z8LA 4A3FB 3BZDB 5ELCA 1CI3M 1RD9D 1QVGA 4JI3Q 1I6VC 4KN7C 4G4KA 1JC7A 4F88A 1Q86C 3TZUA 1SNQA 1LABA 2E5LL 2UUCL 4L5QA 1BUVT 4GOPA 1Q1BA 4A3MH 1Z9FA 1HNZQ 2ZXRA 4ID6A 3VR6A 1JQYD 2DGYA 1EQVA 4X66L 4C3IB 2Q8TA 1IL8A 3CCRA 1YHQA 5EQ0A 2OTLA 3ULLA 1N32Q 2B2VC 1Q82C 4JBMA 4L5SA 1CHQD 3P7JA 1ICWA 3AB9A 1PTOC 1PZKD 5CYUA 4K2LA 1WTXA 3X3NA 3NELA 2VB3X 1WJJA 3ND8A 4EQPA 3I70A 2M2LA 4ODGA 3GTJB 2JJQA 3KBXA 2UXDL 2B3GA 3KLWA 3P20A 1V1QA 4A3MG 4KHPQ 4C3JH 2R92G 3N52A 1WD1A 3PO3H 1YJNA 2D5DA 1AE3A 5IOCA 1ICFB 3B6YA 1TU2B 3QIAA 4ME3A 4R9WA 3Q22A 4IUPA 4N8FA 1VCIA 2CWPA 5T1GA 1ENAA 4LUZA 2VQEQ 4V190 2D0OA 1T5XD 1XNRL 1I3QB 3I73A 3VYUA 1PH9A 2AQ2B 2KBNA 1K9MC 1EY9A 1F9SA 3R93A 1CSQA 3S1NB 1ZEQX 4X3KA 1QUQB 4K6LA 2AUKA 3PIOA 2UUCQ 2AWNA 2KCCA 1V43A 4NPSA 2ZM6L 3CMAA 4ZKCB 1YJ9A 2Q8IB 3IFDA 3CAMA 5BR8Q 2XSCA 1O80A 2UUAL 4DUZQ 1GHKA 4YY3L 3PIP3 3HOYG 5IP7H 1NUCA 1NMGA 3MTSA 4NXNQ 3DUZA 3CCLA 2I5MX 2D62A 4GKJQ 4BBRH 2VQFL 4XYQA 4WORA 5ELFA 1TWGH 1A62A 2B2YA 1MJEA 1LYLA 3NPPA 4LFCQ 3JAMc 2A68D 3IAYA 1EYDA 1FL0A 2R7FA 4DF7A 2BH8A 4ULLA 5JOBA 2RBMA 4KMUC 2K6AA 4ZK9B 1F2ZA 5I9PA 1SN8A 1TY0A 4BY1B 4A3DH 4LF5Q 1HR0Q 1NMFA 2Z0SA 1TXYA 2RF4A 2YTVA 1K8AC 1SJED 2RA4A 3K7AH 4DV4Q 1SNMA 5IP7G 1MHWC 3S14H 3K6OA 1YBYA 5CV6A 1BCPB 4TQUS 3F1ZA 1SMYD 3STBD 3J80E 5LMUL 2PPBC 2NVTB 1KQSA 1LTGD 2IW3A 5M3MH 1TWHH 3K7UC 1E1TA 1SMXA 4X64Q 1U5KA 2VUMG 2R61A 2UUBL 1HUMA 4UAIA 4TVAB 3FMCA 5K5PA 2YU9H 3M4PA 2RCFA 2JEAI 3L9AX 4HSPA 3R3OA 1VQJA 3D6WA 3V96A 5J22A 4YWMA 4IO9A 2KQ3A 1RCVD 3NENA 3KOJA 3K59A 1HRJA 2XRSD 1FD7D 4KK7A 1IBKL 2QEXA 2K5VA 5IT9c 2X6LA 1FR3A 3PQIA 3MXNA 2GVAA 1YVCA 3M4QA 4X3UA 3PF5A 2OF1A 2DY8A 4A3IG 3STBC 3M7NA 1SMYC 3CCQA 1UNSA 3KBGA 4XTCS 5M5YB 2EJMA 2HQLA 5J3BA 4WJ4A 3O13A 2ZT9C 4G57A 3F2DA 4B3RQ 4L5RC 1QE6A 3T1YL 4F8MA 1Y8OB 2J4XA 3MXPA 5CGKA 2BE5D 1SDFA 1KABA 2N78A 3A8KE 1Y1VG 1K8GA 4C3IH 1D7QA 4OEMB 1VQFA 2KEEA 4AQYL 1VQAA 2K4KA 1D2BA 3S15B 4A3BB 1KHIA 4TSSA 5K36H 1QG7A 5FJ8H 1S5CD 3PSIA 3J80L 5C0XJ 4LF4Q 1SYCA 1EZ6A 1AFPA 3T4AC 3RD4A 3GTJH 2JA5H 1CA6A 4G7ZC 1SNCA 4JI8Q 3T1HQ 2O5JC 3EVQA 1EFID 5LL6X 4XYOA 2HD3A 3D4WA 1SE2A 3D0FA 3K8AA 4JI5Q 4NXML 2TSSA 4LFBL 3FRPB 4IOCA 3SK4A 3U9SA 4RWSC 1RHPA 2NN6I 3G6EA 2MO1A 2RCNA 2ZTCA 1MBYA 1YNND 2PI2E 4WRDA 1I3QH 4NMZA 5K36G 5CV5A 2BE5C 2XN9C 4DV1Q 2G9DA 4A3LG 2HHHQ 1NR2A 1STAA 2ALYB 2E2IH 3HOWB 2L0CA 2YTYA 3HFZB 2JA5G 4IUVA 1PRTB 4XDXA 1GXDC 1H9RA 1SE3A 3UDXA 1N34Q 1K8MA 2IY5B 1QOHA 3KF6B 4EX5A 2NZHA 4DR5L 4GN5A 1GM5A 2BDNA 4I7ZC 2F0JA 2IT1A 1SBBB 3CCSA 3E0JA 4IZ8A 4NB3A 1O78A 3TN2A 2L11A 4HJ9A 4IUQA 2NN6G 2R6GA 1JJ2A 2F4VL 1TS3A 3FKIB 4LK1C 1TS4A 2WFWA 1BCPF 4DR2Q 1L1OA 2DJGC 2YYZA 3HOUG 4HAEA 2RDGA 2R7DA 3SXHA 1D5XC 1OXXK 2K28A 4B3SL 3E5SA 1BBUA 2XIWA 2B2TC 2AQ1B 2RHQB 3TS2A 1X56A 1ZYRD 3HOZG 4RHSA 1C8CA 4K2KA 3J81j 3ONAB 2NVTH 1DD2A 3JAMi 2HUGA 2DNEA 3IFTA 4DR6Q 4DK1A 1YZ6A 4LF8L 2JA8H 1CHPD 2EOTA 1IBMQ 2QCPX 2Q2TA 3I3CA 4GZYC 5KNBA 4CJ1B 3K80C 3H0GG 4DXFA 2LS01 4LF7L 1CKOA 4B08A 1XPRA 4LW1A 1LTBD 4DR3L 3PIPA 4PMCA 1EY4A 2K5DA 1U0LA 3OTOL 3MXGA 3QG1A 2WIIB 1N33Q 2ZXOA 3FPPA 3ERSX 1Y14B 2QGQA 1AZQA 4MN3A 1JJCB 3VA5A 3DHQA 4HJ8A 5CORA 2L9HA 4PNYA 4DNRB 4RCOA 3WOFA 3DLLA 2JA8G 2D0PA 3TREA 5IE8A 1KNEA 2X69A 1HZBA 5HGQA 2WACA 1ZYRC 4X6AH 3TMEA 1AN8A 4JBKA 1PMRA 1T5EA 1VQ6A 1R4QB 1H9KA 1K3BC 4GS3A 4UDUC 5M5YH 4PQXA 4A3GB 3P1HA 4QL5A 2R92B 4WJWA 1F2YA 1PRTD 3KLSA 3FPUB 3PIO3 4JI4L 1QUQA 1CSPA 1X54A 2J7ZA 4IFDJ 1HQMC 3UDFA 1OTCA 2WKDA 2E75C 3AEVA 2WINB 1VS0A 2NVYB 1PH5A 4LF8Q 5EKLA 4IJHA 4JOIC 1PH4A 2F0UA 1VQNA 1M1KC 3S15H 4A3BH 1K83H 1N9WA 4HJ7A 1I4HA 2K50A 3L7ZC 2VNUD 4NKLA 4DR1Q 3K81C 3DWPA 1Y8PB 1MSHA 1KTKA 4FXGC 3E9HA 2QILA 4CKEA 1II3A 1TIID 4JI1L 3TRZA 3HOYB 1Q46A 2SOBA 4A93G 2XNAC 3OPOA 1WI5A 1G51A 4X62L 2CW0D 3T53B 1WD0A 1TS5A 4BBSH 4JI7Q 2F0MA 4JBJA 1R9TH 1I94L 1PLFA 5C0XI 3KDFB 1PRTC 2F3VA 5C0XH 5D14A 5G3LF 1KD1C 4MHEA 2B2TA 1VQ8A 4EGVA 1K0SA 2EDGA 4LAAA 3WDNA 3HOWH 2XWBB 5C4JB 4V0BA 4OWWB 2EJFC 2OQKA 1HHVA 1EU3A 1SE4A 3BYTB 1MIUA 4EQOA 1FJGQ 5M5XH 4Q5VA 2MO0A 1VQDA 4KN4C 1TWGB 3BVMA 4BBSG 3GO5A 1PXUA 2VUMB 1EQTA 4NW2A 1JWMD 2DN8A 1QNUA 3HG9A 1CKNB 1S5BD 2QW7A 4GNXC 4RGMA 3FP9A 3ND9A 3PO2G 4JCVE 4K0KQ 3F2UA 3FKIH 5C0XG 1PVOA 3R2TA 3RNUA 1EZ8A 2H1EA 1X6OA 4JI3L 3Q0AA 2CWAA 3SEBA 2E76C 4CKBA 4KV6A 2A74C 4LF6L 3EA6A 1BR9A 5I9OA 3J81c 3I4NG 3VYSA 3ERQA 3K7AB 4KKUA 1QZHA 3KLRA 5ELNA 3S14B 3NBHB 2L5TA 1HNZL 2NYZD 4JYAQ 1JB3A 2PI2A 3I8ZA 3KYHC 1M90C 3HKZE 1N32L 2OT2A 2F0QA 2ES2A 1STYA 3FVQA 3BDOA 4B3TQ 1PH8A 4HIDA 1TKWB 3JAME 2B63G 4A3IB 4KHVA 5F2DA 2EYFA 4OHJA 4LF9Q 1UAPA 4DAYB 3S1MB 4A76A 1CKMA 1U4LA 4DNIA 5FO8B 1O7IA 2JA6H 1A63A 1X55A 3AFQA 3HRZC 3S9WA 1A15A 1HQRD 3D6CA 3A0JA 1I6HB 4KHPL 4GLAC 1GUWA 1CUKA 2QDBA 3S1QB 4OONA 2B2WC 1UE1A 3I2ZA 3DWQA 1B8AA 1Y1VB 4JOIA 2BCOA 5IODA 1DM0B 3BVZA 2MQHA 5I2YA 5FLXc 4DUYQ 3A54A 3NTIA 2CQAA 3T13A 4QGUA 2GVBA 3I4LA 3RZOB 1PFSA 1YNJD 2VQEL 1K73C 1I4XA 1EY7A 5ISRA 3M3YB 4G7HC 1O7YA 3GTGH 1WTRA 4ZUJA 4CDEC 3U58A 4DGZA 4FF3A 1VQHA 5FO7B 5GAEC 5D65A 2JA6G 4QIWB 4LF6Q 4FF1A 1STNA 3F2CA 3PUXA 4A75A 5C5LA 2AMCB 4LFAQ 4A3GH 5BR8L 1KLGD 1D1IA 2R92H 4BY7G 1SYEA 4DUZL 4M1UB 1NY4A 4HJ5A 3PCOB 4KJOA 3GD7A 4LJZC 1UEBA 2PQAB 4NXNL 5IT9E 5IGBA 2NVYH 4GKJL 2B8GA 2BH2A 1ZKOA 1X32A 2JEBI 3KF6A 4LFCL 1BVSA 3A8IE 3AMUA 3BG3A 2PNHA 1CFMA 2PZWA 2V4DA 4JI6Q 5IYCG 3AU7A 1F9RA 1NSNS 3U4ZA 2K5NA 3VR4A 3K0XA 1HTLD 4LF5L 1SYDA 2JA5B 4DR4Q 1DXMA 1W3SA 3HZXA 1HR0L 4A3GG 2L4NA 4IFDI 1C4QA 4IUUA 2KHSA 4KLKA 3VR2A 1JMCA 1G2TA 1YNJC 2R93H 4FO2A 2A1AA 3S24A 4E6IA 4DV4L 4DV6Q 2XWJB 4IFDH 1UE7A 3CXCA 3HOYH 2B39A 5E3FA 1WTPA 5FLMH 1EWHA 3Q8DA 4GNXA 3FHWA 4KJNA 2K75A 1AW7A 4L8JA 3DM1A 2MHVA 3TBIB 1LTTD 5JVG3 4IOAA 4X64L 4QIWE 1JJGA 3VYRA 1XNQQ 2Z6KC 4KHZA 3Q6SA 2E2IB 5JJIA 3HOUB 1WTOA 1Q3LA 5CV7A 5LMNQ 1EEFD 3UE0A 2K7VA 2Y0SG 3A56A 1PYSB 1IBLQ 3U4VA 3IKJA 1NCVA 5C4JH 1EY8A 2SNMA 2R93G 3PV0A 4IFDG 1PFBA 4RFBA 5KYLA 3HOZB 5FLMG 1XPOA 1Y1WG 1T9HA 4JBWA 4OGQC 1K28A 2A6HD 4P74A 2OCEA 1B3AA 2VUMH 2OEOA 4AIMA 2KECA 4GN3B 3HKZG 1UWVA 3HS0C 1OXTA 3H0GB 3ITPA 2XGTA 4GLVB 3G71A 1VQKA 4OXPA 5I6WA 1Q8IA 4IPGA 1OO9B 1P8LA 3VYTA 3K57A 3CCMA 3SDZA 2B2WA 1IKLA 1DOKA 4APVA 1YEZA 1ET6A 3GTMB 2MNAA 4B3RL 3HOVG 1F2MA 1X3EA 1J5EQ 1E7ZA 2F3WA 4RG1A 2PQEA 2K1BA 1E0BA 2G9HD 5DM63 4MTKA 3E0EA 2E2HB 3N6RA 1GOZA 3KUPA 5DLQE 2OTJA 1KDAA 2F0KA 2JA8B 3U9OA 1O7ZA 1ENCA 1YI2A 3MC0B 3IL8A 2B8FA 3D31A 2HCCA 1RTOA 4K5WA 3K5NA 2JN4A 1HZAA 5CR3A 5ELOA 2D9UA 4IPHA 2XTIA 1EY0A 2FINB 1E2ZA 1TS2A 4A3IH 3NTKA 1LLRD 1Q90A 1H9SB 3CKIB 2AWOA 2BA1A 3J7AF 4LF4L 3S1MH 5E4XA 3MFYA 2PMZB 5A2QE 1L1OC 2A6HC 1HPCA 1L2FA 2EQSA 3H6MA 1MI2A 5C3WA 4RMFA 4QCLA 1IYUA 2A68C 1I6HH 3K5LA 3KJOA 4JI8L 3T1HL 4Y52H 3S1QH 1WTVA 4JI5L 1Y1VH 2ICEC 3HOXH 2QDLA 2IJ0A 2JE6I 4KKTA 2F0DA 1I50H 3CCEA 3H91A 3TP5A 5I6YA 1MJCA 3SR1A 1HNXQ 1CA5A 3RZOH 5EBDA 1LO5D 3M3YH 1HUNA 1I4QA 2K52A 4H0LC 1CK1A 3F2BA 2C35B 1PH7A 1SYBA 4JW0A 4DV1L 4DK6C 4CHTB 5H1SE 2HHHL 4UPAA 3SK6A 1WFQA 4R4QA 1IXRA 1U4PA 2I07B 3KDFA 1QB5D 5FK9C 2QF7A 3A7AB 3K5OA 3M4YA 3T16A 5EAYA 1HA5A 1N34L 1X3GA 4A3CG 2PZUA 4P72A 4A93B 5E7NA 3R8BA 1STBA 3C1FA 4QUFA 3HOXG 5EKIA 1KAAA 4RKLA 4GKKQ 4JG2A 1B44D 3NWSA 3GTPB 1B4OA 2Z6KA 3DWAA 4DU9A 1K83B 2PMZE 2CQOA 4RCNA 4DR2L 1TWAB 3TP8A 1BKBA 1KRTA 5KEEA 3RUZA 1F77A 3DMUA 1A0IA 1Q12A 4QUCA 4DNTB 4A3LH 3W2DA 1ENFA 2K14A 1CKNA 2EXDA 2F0LA 2M9VA 3H09A 1BXTA 2ATWA 1V9PA 2F0HA 2JA7G 1SAPA 1I4PA 4DAPA 1DJRD 2B29A 4YHHQ 3BU2A 1BCPD 1SRUA 2F0PA 4DV2Q 3CPWA 4BBSB 4C1NI 4DR6L 5JEAJ 1R9TB 1PA6A 1X3QA 5CMDA 2NN6H 5GADC 1VQOA 2CFMA 3PO2B 1IBML 4TRDA 5ELEA 4C2MH 3D4DA 4PZ7A 4RA8A 5GROA 4ZQ3A 4UY8C 3HOUH 1H95A 3BS1A 3I4NB 4O2DA 2Q2HA 1LTLA 2K5HA 2PZTA 1IZ6A 5NUCA 3OMCA 1N33L 3MA2B 1FNWA 5KNCA 2LSSA 4F7XA 1XJVA 4OL7A 1NTGA 4GOPB 5M5XB 3VDYA 1EQRA 3EN2A 3I4OA 3HOZH 3I72A 3D3RA 1VQMA 3QOLA 2ID0A 1G291 1HXYD 4FF4A 1JWSD 4QF4A 1VDZA 5JVH3 1EUJA 2MJ8A 5LMNW 1DCZA 2IHEA 2B63B 2UXCQ 3J80c 4HCEA 2K33A 5KYIA 2KENA 2F0GA 1BCPC 3H0GH 3KF8B 3OWEB 1EOVA 2A8VA 2K32A 1W2BA 2CCZA 3UI2A 1Z47A 3QR8A 1KC8C 2KCMA 2L55A 4DXGA 5A35A 2V1CC 1JR0D 2FMCA 1YNNC 3K58A 1SEBD 2EYLA 3GTMH 4ZCKA 1VQ7A 3I90A 3S1RB 2L15A 2R7ZG 2DNCA 1GUTA 2MUYA 2E2HH 2RDHA 2HT1A 4JV5Q 2VB2X 3C46A 5EPLA 4C3HB 4I7AA 1EOTA 1HZ9A 1HR0W 2F0WA 2A69D 2PQAA 3RZDB 1A6XA 4ZUIA 5C44B 1CM9A 4X65Q 2O5IC 2WB1B 4XQNA 2JA6B 3K0YA 4KTAA 3CF5A 1QVFA 1GHJA 4DR1L 4DV7Q 4LNQA 3J81E 3KK7A 3OMGA 4R4TA 1NNXA 4BY7B 4H02A 2ICIA 2KOLA 2F0SA 3GTOB 5AFWA 2RSNA 5BN4A 2KA7A 4XXEA 2WKCA 4CBVA 4DAVA 1N36Q 4HIOA 1XPUA 3U50C 1CTMA 3OYYA 4RAUC 4JI7L 3I91A 5GQOA 1Q7YC 3D4RA 4C56C 3GTGB 2KCTA 2FMMA 4S3SA 1W6JA 4HIKA 1WTQA 2PO4A 5IGEA 3NQIA 1FNUA 5IY0A 2LKVA 2NVQB 4A3KG 4FNFA 1B1ZA 4GLXA 1GUNA 2NTSA 1S72A 2F03A 3I55A 2NZ1D 1LUZA 1E3PA 2RSOA 1AH9A 4DV5Q 2A69C 1VQPA 3CC4A 2HIVA 3A55A 4A93H 2WAQE 2NTTA 2VL6A 5G3LD 1FJGL 1RF2D 3AQQA 5FLXE 3H3VI 4OO1I 3DEOA 4NDXA 3QOJA 1U4RA 4JI0Q 2WB1E 3GTPH 3H3VH 4OO1H 1LM0A 5CV4A 3DM3A 4DK3C 1WYDA 5CBEE 4NP5A 2AKWB 4K0KL 4DN4M 3PGZA 2KCNA 2I0QA 4WFN3 1TWAH 3EIVA 3NTHA 4MZ9A 1EQQA 1UE5A 1XTCD 1KL9A 2Y0SB 1VQLA 1C9OA 4PZ6A 1IL2A 1LT5D 2K04A 2R93B 2HDMA 4N9PA 1B2TA 2G5DA 3GV6A 1VMCA 1EYGA 3ULJA 3CQZB 5BN3A 2F0NA 2ZXPA 1PH3A 4JYAL 1FNVA 3CMEA 1Y1WB 1TWFH 2FFKB 2IX0A 3BYYB 3QJYA 4CKCA 1YIJA 1J8IA 2L1BA 1BF4A 1TVXA 1XTDA 2Z6BA 4BA1I 4OO1G 5FO9B 3BZKA 3Q24A 4B3TL 3GTQB 1JE4A 5M3FG 1SR3A 4IUNA 3T51B 4DPGA 3HKZB 3BZCA 1PDQA 3HEJA 3W5OA 5KNDA 3CCJA 1QZGA 2SNSA 3PO2H 5EBCA 4TKOB 1ESFA 4LF9L 2L12A 2VY3A 3CPFA 5CV8A 4LUOA 1JWUD 1R4PB 1J6QA 1VQCA 3OSOA 2K5QA 3I4NH 3GTKH 1F2LA 2JXMB 2DJFC 3HOVB 3NE5B 5KGUA 1H9JA 1H9SA 3ICEA 1Y69U 2AHOB 4O0AA 4YIJA 5CC4A 1BO0A 1OXVA 1RJTA 5DM73 5JEAH 1EIGA 4DUYL 4FF2A 1SROA 4I65A 5C3EH 3Q23A 4RHRA 5JPMC 2Y0SE 1A3TA 2ZJQA 1SYFA 1BBWA 1K3RA 3TP7A 3S17B 2CHBD 2B63H 4R4CA 1ET9A 4AYBG 2E8GA 1EWCA 3UDGA 1HTPA 2WP8J 1TY2A 2CW0C 3W1GA 3OHXC 2VXWA 2HCIA 3E6ZX 2ZTDA 4RGTA 1B7YB 3CP0A 1JOQA 2F1MA 2OXPA 1EL0A 1DGSA 4LFAL 2NBFA 1L0YB 2F0TA 3P75A 1AP0A 4R8NA 2H4OA 4PMBA 2KEDA 2SDFA 5CV9A 2XVSA 5JJLA 3S1RH 3QWNA 4POGA 5JEAG 1SNOA 1PZJD 2NVXB 1S40A 4ZKBB 1CQFA 2PW7A 5C3EG 3EROA 2F0FA 1ILPA 3CHBD 4C3HH 1J9OA 3M7GA 1N8RC 3PUWA 4DV3Q 4JI6L 4Z9CB 4A3JG 3RZDH 5C44H 4AH6A 1EYCA 1Z7TA 5DNFA 1KIXA 4DR4L 3ULPA 2F0IA 1DZ1A 3LX0A 4UP9A 3V2TA 1XMOQ 4BY7H 4B3MQ 1SNDA 1A2TA 4DV6L 3GTOH 3HOXB 3GP7A 2Z9HA 1I50B 3D8GA 4JC0A 2UXBQ 1FVIA 1VQGA 5COYA 5M5WH 2WV6D 4YCUA 3NQTA 2F4IA 4C3HG 1H9MA 3BJUA 3I4MG 2WAQG 1LTSD 3JC66 1SXTA 5EKKA 1GUOA 5C44G 5IYCH 1DONA 1QNKA 3MAQA 1XNQL 4B9XA 5IWAQ 2WB1G 1EY5A 5LMNL 2MFIA 1YHBA 2NVQH 1IBLL 3MEFA 5IP9H 1WCMH 1JOKA 2JA7B 1OXSC 4RKBA 5AJ3Q 5BN5A 4BA2I 2EYJA 4MTNA 2K5WA 4KD3A 3ER0A 4EQNA 2EY5A 2Z1CA 1M4VA 1D1KA 4G7OC 1HNWQ 2EZVA 5C4XB 1L0WA 2J0TD 1WVLA 2IX1A 1ASZA 4DR7Q 2MPMA 3NUCA 1PFNA 4OX9Q 2K03A 2Q2IA 5FOBB 4ZRZA 3RR5A 2IHFA 1BOSA 1RODA
chains in the Genus database with same CATH topology
4IURA 2R3ZA 3WOEA 1LT6D 1LTRD 3A7LA 2IX3A 5D3DA 3MVVA 4ABNA 5CBAE 1G6ZA 4KD4A 1PTOF 2DY7A 3R2IA 3KF8A 4JK1C 1Q1EA 2M00A 3BVGA 3JAML 1S4ZA 5TSSA 1SNPA 1TR5A 2RDFA 1PTOH 3EQLC 4XT1B 2I46A 4RH6A 1B50A 4B9WA 4C2MB 1G2SA 4O1NA 4IQZA 4H44C 1XXGA 3OWFA 1QCBD 2RQXA 1LTID 3C3LA 1RTNA 2BA0A 3NSWA 4FXKC 5DAUA 3MFGA 3PUYA 1TT2A 5EJWA 1OXUA 3ZYYX 2E74C 3HP3A 3TZDA 4ZAIA 3M85A 4C1NK 3MHBA 2R7ZB 1CQVA 3S2HB 3NK9A 3SHLA 4K8IA 4K6DA 4DK0A 1ESRA 4M8AA 4F87A 4C3JG 2JP1A 4MIUA 2EYPA 4ZYSA 3MXUA 3KLSX 1DOMA 1B9NA 2PW5A 3FEWX 4FXDA 2X6GA 4J1MA 5IT9L 1D5ZC 3C2PA 3K5MA 3M4OB 1EEID 1RDPD 1AZPA 2NWGA 4K5XA 1QILA 2K05A 3G7LA 1FYCA 3HGBA 5M9OA 4HCSA 1E2WA 1XWEA 2Z4IA 1F9QA 2KJXA 4RGNA 4R8IA 4A3KB 3GV3A 4P2CB 5EPKA 1IW7D 2ENBA 4EVOA 5I2XA 3W3AA 1E2VA 1STGA 2EPBA 1LTAD 1RKNA 1EY6A 4KY7A 3NP8A 2B2VA 2GA4B 3NHHA 2QEJC 2CVRA 2FHTA 1LT3D 2EYOA 3EJIA 3CU7A 5ELBA 3C1EA 1LT4D 1QWYA 3H94A 1D6EC 4HSVA 1M8AA 4IUTA 1ILQA 3TP6A 1BNZA 4BWGB 2AQ3B 1IYVA 2EYHA 1STHA 1V1PB 2IL8A 4H7BA 4PMWA 2E2JB 2F0EA 5M3FB 5C6AA 3RLFA 1JICA 5LL6S 1IW7C 1S5FD 4A3EB 5HURA 5JJZA 1S5ED 4XQJA 3OIPA 3QB3A 1SSOA 5ELDA 3NBIA 3FDTA 1TWFB 1CZGA 3V05A 5J39A 4K8JA 3URYA 3SVMA 4J8QA 2TMPA 2Q8RE 1L0XB 3OOCA 3SK8A 3NBHA 5C4ZA 5A2QL 4N9TA 2LY7A 3GTLB 5HGTA 3L3OC 4AYBB 3CRLC 2EY1A 4C3IG 1O7LA 1V8QA 3SE0A 3GTKB 1KDBA 4Q0FA 4DAYA 1C48A 2EY2A 5EGTA 4KY6A 5FKAC 2N88A 5LHY1 2AUJD 5C3EB 5DEHA 1BQQT 2FJ2A 4ILWA 4XT3B 2C9OA 3J7AV 4A3JB 1MGSA 2EXZA 1A2UA 1BBXC 1UUPA 1NAPA 1KDCA 5E4WC 3G6JB 1JCKB 3MZ5A 1G91A 4OIKA 3QO2A 4QMGA 2JYOA 2SEBD 5JAVA 1Y8NB 2PNRC 3I4MB 2WAQB 1I4RA 4K5VA 1GJXA 5EPJA 1QJOA 1U4MA 4HMIA 3RMHA 1G8ZD 1F9PA 1NR4A 4HEDA 3OW7A 4H13C 2B2UC 1MD2D 2LFNA 2PYKA 1MSGA 5M5WB 3S2DB 4FP5D 5IGFA 3PMFA 5I4DA 5IGDA 5IGGA 2C5CA 1IHZA 2XRQD 3S16B 1XYIA 1CT1D 1KLUD 4LMQD 1WCMB 3X3MA 3H3VC 4IN3A 4OIJA 4DA2A 3EFXD 3LNNA 5IGCA 4QB4A 1ML0D 4U673 2Z4HA 1BDOA 1S5DD 2A5HA 2QKIC 2HDLA 1STEA 2EYMA 2IPKD 4A3MB 2KVMA 4CGYB 3OIQA 2D2CC 3MWYW 2RVLA 3A8JE 3VA7A 2KUMA 1TQOA 1EU4A 4HN7A 4PV1C 2MGSA 3DEPA 4DFAA 4XIGS 2K01A 1VMPA 4KKSA 2LMCB 1SYGA 1EIHA 4CJ0B 2E2DC 5C4HA 3PUVA 4HTHA 5T1IA 1SFOB 1HFNA 1SJHD 2NUCA 1PTOB 1B9MA 4C3JB 1A3VA 1PFMA 1JOOA 3PO3B 3J81L 5KRUA 1HFGA 4BS9A 2O4XA 4L6TB 3T56B 2RKSA 4FVMA 1FGBD 1HCZA 1CZWA 4J6HA 2JSOA 4X3SA 1PRTF 1LV9A 2IWHA 3MEHA 1Z6HA 3LWEA 5KIXA 4KI0A 2A6ED 1PZID 3DXJC 1K8OA 1W6KA 2F0OA 4K14A 4Y7NB 1ZXTA 4X3TA 3VR3A 1I4GA 5E1FA 4ZLTF 1UEAB 2A73B 3TSSA 1GUGA 3BDLA 5IIFA 1B53A 2PCFB 2B2UA 4BBRB 1X3PA 1HA6A 2EVBA 2EE1A 5C3XA 1EYAA 5FLXL 2EJGC 4U68A 1GUSA 2F0VA 2MP1A 3GQBA 3J7YW 4KY5A 3PUZA 5C5MA 1XX8A 4A3DB 4ME5A 3VR5A 2N55A 3LWUA 1A3UA 4HR7B 1KNAA 4HMJA 1V1PA 3NXWA 1DOLA 1VF5C 5M3MB 1TWHB 2A6EC 1PYWD 5J1ZA 1VF7A 3CRKC 2EY6A 1ONLA 4FYDA 4O42A 5D3IB 2YU9B 4IALA 1LACA 2B2YC 4RGOS 2NB0A 1DYQA 1IKMA 2HQEA 1JORA 5JPNC 1U9RA 1PTOD 3TDQA 1TWCB 2BOSA 1D5MC 4XQQA 2O2LD 1WTWA 2BDOA 1AEXA 3SK5A 1V1OA 3NWTA 4L63B 4CJ2C 3BDCA 2Z8LA 4A3FB 3BZDB 5ELCA 1CI3M 1RD9D 1I6VC 4KN7C 4G4KA 1JC7A 4F88A 3TZUA 1SNQA 1LABA 1BUVT 1Q1BA 2ZXRA 4ID6A 3VR6A 1JQYD 1EQVA 4C3IB 2Q8TA 1IL8A 5EQ0A 2B2VC 1CHQD 3P7JA 1ICWA 3AB9A 1PTOC 1PZKD 5CYUA 4K2LA 1WTXA 3X3NA 2VB3X 3ND8A 4EQPA 3I70A 2M2LA 4ODGA 3GTJB 3KBXA 3P20A 3N52A 1WD1A 2D5DA 5IOCA 1TU2B 3QIAA 4R9WA 3Q22A 4IUPA 1VCIA 5T1GA 1ENAA 4V190 1T5XD 1I3QB 3I73A 3VYUA 2AQ2B 1EY9A 1F9SA 3R93A 3S1NB 1ZEQX 4X3KA 4K6LA 2AUKA 2AWNA 2KCCA 1V43A 4ZKCB 2Q8IB 3IFDA 2XSCA 1O80A 1GHKA 3PIP3 1NUCA 3MTSA 3DUZA 2D62A 4XYQA 4WORA 5ELFA 2B2YA 3NPPA 3IAYA 2A68D 1EYDA 4DF7A 4ULLA 5JOBA 2RBMA 4KMUC 2K6AA 4ZK9B 1F2ZA 5I9PA 1TY0A 4BY1B 1SJED 2RA4A 1SNMA 3K6OA 5CV6A 3J80E 1BCPB 4TQUS 1SMYD 2PPBC 2NVTB 1LTGD 2IW3A 2R61A 1HUMA 4UAIA 3FMCA 5K5PA 2JEAI 3L9AX 4HSPA 3R3OA 3D6WA 3V96A 5J22A 2KQ3A 1RCVD 3K59A 1HRJA 2XRSD 1FD7D 4KK7A 2X6LA 1FR3A 3MXNA 4X3UA 2OF1A 2DY8A 3M7NA 1SMYC 1UNSA 3KBGA 4XTCS 5M5YB 2EJMA 3O13A 2ZT9C 4G57A 1QE6A 4F8MA 1Y8OB 2J4XA 3MXPA 5CGKA 2BE5D 1SDFA 1KABA 3A8KE 2KEEA 1D2BA 3S15B 4A3BB 4TSSA 5K36H 1QG7A 1S5CD 3J80L 5C0XJ 1SYCA 1EZ6A 1AFPA 3T4AC 3RD4A 1CA6A 4G7ZC 1SNCA 2O5JC 3EVQA 1EFID 5LL6X 4XYOA 3D4WA 1SE2A 2TSSA 3FRPB 3SK4A 3U9SA 4RWSC 1RHPA 2NN6I 1MBYA 1YNND 4WRDA 4NMZA 5K36G 5CV5A 2BE5C 2XN9C 2G9DA 1NR2A 1STAA 3HOWB 2L0CA 4IUVA 1PRTB 4XDXA 1GXDC 1H9RA 1SE3A 1K8MA 1QOHA 2BDNA 4I7ZC 2F0JA 2IT1A 1SBBB 3E0JA 4IZ8A 1O78A 3TN2A 2L11A 4IUQA 2NN6G 2R6GA 1TS3A 3FKIB 4LK1C 1TS4A 1BCPF 2YYZA 4HAEA 2RDGA 3SXHA 1D5XC 1OXXK 2K28A 3E5SA 2XIWA 2B2TC 2AQ1B 1ZYRD 4RHSA 1C8CA 4K2KA 3ONAB 1DD2A 2HUGA 2DNEA 3IFTA 4DK1A 1CHPD 2EOTA 2QCPX 3I3CA 4GZYC 5KNBA 4CJ1B 4DXFA 2LS01 4B08A 1LTBD 4PMCA 1EY4A 2K5DA 3MXGA 3QG1A 2WIIB 2ZXOA 3FPPA 1AZQA 4MN3A 3VA5A 3DHQA 5CORA 2L9HA 4PNYA 4DNRB 4RCOA 3WOFA 1KNEA 2X69A 2WACA 1ZYRC 3TMEA 1AN8A 1PMRA 1T5EA 1R4QB 1H9KA 4UDUC 4PQXA 4A3GB 3P1HA 2R92B 4WJWA 1F2YA 1PRTD 3KLSA 3FPUB 3PIO3 2J7ZA 4IFDJ 1HQMC 2WKDA 2E75C 2WINB 2NVYB 5EKLA 2F0UA 1I4HA 3L7ZC 2VNUD 4NKLA 3DWPA 1Y8PB 1MSHA 1KTKA 4FXGC 2QILA 4CKEA 1II3A 1TIID 3HOYB 2SOBA 2XNAC 3OPOA 2CW0D 3T53B 1WD0A 1TS5A 2F0MA 1PLFA 5C0XI 1PRTC 2F3VA 5C0XH 5D14A 5G3LF 4MHEA 2B2TA 4EGVA 2EDGA 4LAAA 3WDNA 2XWBB 5C4JB 4V0BA 2EJFC 1HHVA 1EU3A 1SE4A 3BYTB 4EQOA 4Q5VA 4KN4C 1TWGB 3BVMA 3GO5A 1PXUA 2VUMB 1EQTA 4NW2A 1JWMD 2DN8A 1QNUA 3HG9A 1S5BD 4RGMA 3ND9A 3F2UA 5C0XG 3R2TA 1EZ8A 2H1EA 3Q0AA 3SEBA 4CKBA 2E76C 4KV6A 2A74C 3EA6A 1BR9A 5I9OA 3VYSA 3ERQA 3K7AB 4KKUA 3KLRA 3S14B 2L5TA 2NYZD 1JB3A 3I8ZA 2OT2A 2F0QA 1STYA 3FVQA 3BDOA 1TKWB 3JAME 4A3IB 4KHVA 5F2DA 2EYFA 4OHJA 1UAPA 3S1MB 1U4LA 5FO8B 3HRZC 3S9WA 1A15A 1HQRD 3D6CA 1I6HB 1GUWA 2QDBA 3S1QB 2B2WC 3DWQA 1Y1VB 5IODA 2BCOA 1DM0B 3BVZA 5I2YA 3A54A 3NTIA 2CQAA 3T13A 3I4LA 3RZOB 1YNJD 1I4XA 1EY7A 5ISRA 3M3YB 4G7HC 1O7YA 1WTRA 4ZUJA 4DGZA 4FF3A 5FO7B 5D65A 4QIWB 4FF1A 1STNA 3PUXA 5C5LA 1KLGD 1D1IA 1SYEA 4M1UB 4KJOA 3GD7A 4LJZC 5IT9E 5IGBA 2B8GA 1ZKOA 1X32A 2JEBI 3A8IE 3AMUA 3BG3A 1CFMA 2PZWA 2V4DA 3AU7A 1F9RA 1NSNS 3VR4A 1HTLD 1SYDA 2JA5B 1DXMA 3HZXA 2L4NA 4IFDI 1C4QA 4IUUA 2KHSA 1G2TA 3VR2A 1YNJC 4FO2A 4E6IA 4IFDH 2XWJB 2B39A 5E3FA 1WTPA 1EWHA 4KJNA 1AW7A 4L8JA 3DM1A 2MHVA 3TBIB 1LTTD 5JVG3 3VYRA 4KHZA 3Q6SA 2E2IB 3HOUB 1WTOA 1Q3LA 5CV7A 1EEFD 2K7VA 3A56A 3IKJA 1NCVA 1EY8A 2SNMA 3PV0A 4IFDG 1PFBA 4RFBA 5KYLA 3HOZB 4JBWA 4OGQC 2A6HD 1B3AA 2OEOA 2KECA 3HS0C 1OXTA 3H0GB 3ITPA 5I6WA 1Q8IA 1OO9B 3K57A 3VYTA 3SDZA 2B2WA 1IKLA 1DOKA 1ET6A 3GTMB 1F2MA 2F3WA 2PQEA 2K1BA 1E0BA 2G9HD 5DM63 2E2HB 3N6RA 1GOZA 3KUPA 1KDAA 2F0KA 2JA8B 3U9OA 1O7ZA 1ENCA 3MC0B 3IL8A 2B8FA 3D31A 2HCCA 1RTOA 4K5WA 3K5NA 5CR3A 2D9UA 1EY0A 2FINB 1E2ZA 1TS2A 3NTKA 1LLRD 1Q90A 1H9SB 3CKIB 2AWOA 2BA1A 3J7AF 5E4XA 3MFYA 2PMZB 5A2QE 2A6HC 1HPCA 3H6MA 1MI2A 5C3WA 4QCLA 1IYUA 2A68C 3K5LA 1WTVA 2ICEC 2IJ0A 2JE6I 4KKTA 2F0DA 3H91A 3TP5A 5I6YA 3SR1A 1CA5A 5EBDA 1LO5D 1HUNA 1I4QA 4H0LC 1CK1A 1SYBA 4CHTB 3SK6A 1U4PA 2I07B 1QB5D 5FK9C 2QF7A 3A7AB 3K5OA 3M4YA 3T16A 1HA5A 2PZUA 4A93B 3R8BA 1STBA 3C1FA 4QUFA 5EKIA 1KAAA 4RKLA 1B44D 3NWSA 3GTPB 1B4OA 3DWAA 4DU9A 1K83B 4RCNA 1TWAB 3TP8A 5KEEA 3RUZA 1F77A 3DMUA 4QUCA 1Q12A 4DNTB 3W2DA 1ENFA 2F0LA 2M9VA 3H09A 1BXTA 2F0HA 1SAPA 1I4PA 4DAPA 1DJRD 1BCPD 2F0PA 4BBSB 4C1NI 5JEAJ 1R9TB 1X3QA 5CMDA 2NN6H 3PO2B 4TRDA 5ELEA 3D4DA 4RA8A 4ZQ3A 3BS1A 3I4NB 2PZTA 5NUCA 3OMCA 3MA2B 1FNWA 5KNCA 4F7XA 4OL7A 5M5XB 3I72A 3D3RA 3QOLA 2ID0A 1G291 1HXYD 4FF4A 1JWSD 4QF4A 1VDZA 5JVH3 2MJ8A 1DCZA 2B63B 4HCEA 2K33A 5KYIA 2F0GA 1BCPC 3OWEB 2K32A 3UI2A 1Z47A 2L55A 4DXGA 5A35A 1JR0D 2FMCA 1YNNC 3K58A 1SEBD 2EYLA 3I90A 3S1RB 2DNCA 1GUTA 2MUYA 2RDHA 2VB2X 3C46A 5EPLA 4C3HB 1EOTA 2F0WA 2A69D 3RZDB 1A6XA 4ZUIA 5C44B 1CM9A 2O5IC 2WB1B 4XQNA 2JA6B 3K0YA 4KTAA 1GHJA 3J81E 3KK7A 3OMGA 4BY7B 2ICIA 2KOLA 2F0SA 3GTOB 5AFWA 2RSNA 5BN4A 2KA7A 4XXEA 2WKCA 4CBVA 4DAVA 1CTMA 4RAUC 3I91A 3D4RA 4C56C 3GTGB 2FMMA 4S3SA 1W6JA 1WTQA 2PO4A 5IGEA 3NQIA 1FNUA 2LKVA 2NVQB 4FNFA 1B1ZA 1GUNA 2NTSA 2F03A 2NZ1D 2RSOA 2A69C 3A55A 2NTTA 5G3LD 1RF2D 5FLXE 4OO1I 3DEOA 4NDXA 3QOJA 1U4RA 4OO1H 5CV4A 5CBEE 4NP5A 4DN4M 2KCNA 4WFN3 3NTHA 1XTCD 2Y0SB 2R93B 1LT5D 2K04A 2HDMA 4N9PA 1B2TA 3GV6A 1VMCA 3CQZB 5BN3A 2F0NA 2ZXPA 1FNVA 1Y1WB 3QJYA 2FFKB 2IX0A 3BYYB 4CKCA 1J8IA 2L1BA 1BF4A 1TVXA 4BA1I 4OO1G 5FO9B 3Q24A 3GTQB 1JE4A 4IUNA 3T51B 3HKZB 3HEJA 1PDQA 5KNDA 2SNSA 5EBCA 4TKOB 1ESFA 2L12A 5CV8A 1JWUD 1R4PB 3OSOA 2K5QA 1F2LA 2JXMB 3HOVB 3NE5B 5KGUA 1H9JA 1H9SA 1Y69U 4YIJA 5CC4A 1BO0A 1OXVA 1RJTA 5DM73 5JEAH 1EIGA 4FF2A 4I65A 3Q23A 4RHRA 5JPMC 1A3TA 1SYFA 3TP7A 3S17B 2CHBD 1ET9A 1EWCA 1HTPA 2WP8J 1TY2A 2CW0C 3OHXC 2VXWA 2HCIA 3E6ZX 4RGTA 1JOQA 2F1MA 2OXPA 1EL0A 2NBFA 1L0YB 2F0TA 3P75A 1AP0A 4R8NA 2H4OA 4PMBA 2KEDA 2SDFA 5CV9A 2XVSA 3QWNA 5JEAG 1SNOA 1PZJD 2NVXB 4ZKBB 1CQFA 2PW7A 3EROA 2F0FA 1ILPA 3CHBD 1J9OA 3M7GA 3PUWA 4Z9CB 1EYCA 1Z7TA 5DNFA 2F0IA 1DZ1A 3LX0A 3V2TA 1SNDA 1A2TA 3HOXB 3GP7A 1I50B 3D8GA 5COYA 2WV6D 3NQTA 2F4IA 4C3HG 1H9MA 1LTSD 1SXTA 5EKKA 1GUOA 1DONA 1QNKA 3MAQA 4B9XA 1EY5A 1JOKA 2JA7B 1OXSC 4RKBA 5BN5A 4BA2I 2EYJA 2K5WA 4KD3A 4EQNA 2EY5A 2Z1CA 1M4VA 1D1KA 4G7OC 2EZVA 5C4XB 2J0TD 1WVLA 2IX1A 2MPMA 3NUCA 1PFNA 2K03A 5FOBB 4ZRZA 1BOSA 1RODA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F8M A;  4KHV A;  4OL7 A;  2F0D A;  5F2D A;  3E5S A;  3SK8 A;  2EYF A;  3MXP A;  5CGK A;  5C4Z A;  2PYK A;  4NKL A;  1KAB A;  1JOQ A;  3MEH A;  2OXP A;  3MVV A;  4N9T A;  3QOL A;  4WOR A;  3TP5 A;  5KIX A;  3BDC A;  2F0T A;  4KD4 A;  5I6Y A;  3P75 A;  3SR1 A;  5HGT A;  4QF4 A;  4R8N A;  1EYD A;  4PMB A;  4DF7 A;  4K2K A;  3S9W A;  1II3 A;  2F0O A;  3D6C A;  5CV9 A;  5JOB A;  4K14 A;  5IGF A;  3PMF A;  5CV7 A;  2EY1 A;  2RBM A;  2SOB A;  4NDX A;  3QOJ A;  1SNQ A;  5IGD A;  1SNO A;  2M00 A;  5IGG A;  1SYB A;  2QDB A;  5KYI A;  1EY8 A;  2SNM A;  5CV4 A;  1KDB A;  2PW7 A;  1F2Z A;  1IHZ A;  2ENB A;  2F0G A;  5E1F A;  3ERO A;  3SK6 A;  4NP5 A;  5I9P A;  5IOD A;  1SNP A;  4EVO A;  2F0F A;  5KYL A;  3BDL A;  5IIF A;  2F0M A;  1SYC A;  1TR5 A;  1EZ6 A;  2RDF A;  1STG A;  4ID6 A;  3T16 A;  2EY2 A;  5EGT A;  4KY6 A;  3T13 A;  1EQV A;  2PZU A;  1SNM A;  2F3V A;  4B9W A;  1EYC A;  5CV6 A;  5C3X A;  5IGC A;  1EYA A;  1STB A;  3C1F A;  1EY7 A;  1RKN A;  2EYL A;  3OWF A;  2F0V A;  1EY4 A;  4PMC A;  4QB4 A;  5ISR A;  1KAA A;  1EY6 A;  1SNC A;  3EVQ A;  4KY7 A;  4RKL A;  5DEH A;  3NP8 A;  4LAA A;  4N9P A;  2OEO A;  4ZUJ A;  3D4W A;  2F0I A;  4DGZ A;  2F0N A;  2EYM A;  4K2L A;  4KY5 A;  3NHH A;  5DAU A;  3LX0 A;  5C5M A;  3V2T A;  4DU9 A;  1STN A;  3SK4 A;  4ME5 A;  3VA5 A;  1TT2 A;  4DFA A;  3DHQ A;  1SND A;  2EYO A;  1A2T A;  3ITP A;  3EJI A;  5C5L A;  5I6W A;  4PNY A;  3TP8 A;  4EQP A;  5KEE A;  2EXZ A;  3RUZ A;  1A2U A;  2F0W A;  4ODG A;  3C1E A;  3D8G A;  4EQO A;  3DMU A;  1A3U A;  1SYE A;  5K5P A;  3MHB A;  4WRD A;  4ZUI A;  4IUN A;  4NMZ A;  3HEJ A;  3R3O A;  1TQO A;  3NK9 A;  4KJO A;  2F0L A;  3NQT A;  2SNS A;  4HMJ A;  5CV5 A;  3SHL A;  1F2M A;  4K8I A;  1KDC A;  4KTA A;  3TP6 A;  2F3W A;  5J22 A;  2PQE A;  2KQ3 A;  2WAC A;  3NXW A;  2F0H A;  4K6D A;  5IGB A;  1STA A;  3MZ5 A;  5CV8 A;  3TME A;  5IOC A;  5EKK A;  5J1Z A;  4MIU A;  3OMG A;  2EYP A;  1KDA A;  2EYH A;  2F0K A;  1STH A;  2F0P A;  3OSO A;  2EY6 A;  1EZ8 A;  4QMG A;  1SYG A;  3U9O A;  4H7B A;  4B9X A;  1ENC A;  1EY5 A;  2F0E A;  2F0S A;  2PW5 A;  5C6A A;  4K5W A;  2PZW A;  4KV6 A;  3P1H A;  5C4H A;  4HTH A;  5KGU A;  1ENA A;  1NSN S;  5JAV A;  5CR3 A;  4IAL A;  4J1M A;  1F2Y A;  2F0J A;  2NUC A;  1EY0 A;  1JOK A;  5I9O A;  5HUR A;  3ERQ A;  4K5V A;  4RKB A;  4YIJ A;  5CC4 A;  1EY9 A;  1SYD A;  2HQE A;  1A3V A;  3HZX A;  2EYJ A;  3QB3 A;  1JOO A;  4HMI A;  2OF1 A;  4IZ8 A;  4TRD A;  1JOR A;  3D4D A;  1U9R A;  4KD3 A;  2KHS A;  5KRU A;  4EQN A;  2EY5 A;  4ZQ3 A;  4I65 A;  5EKL A;  4E6I A;  3H6M A;  4K5X A;  4S3S A;  5C3W A;  2O4X A;  1A3T A;  1SYF A;  2RKS A;  2F0U A;  2F0Q A;  3TP7 A;  5IGE A;  5E3F A;  1STY A;  3NUC A;  2PZT A;  5J39 A;  4K8J A;  1AEX A;  3OMC A;  2LKV A;  4J6H A;  4KJN A;  5NUC A;  3SK5 A;  5M9O A;  4G57 A;  1NUC A;  3SXH A;  4F7X A; 
#chains in the Genus database with same CATH topology
 4IUR A;  2R3Z A;  3WOE A;  1LT6 D;  1LTR D;  3ZJY C;  3A7L A;  2IX3 A;  5D3D A;  3MVV A;  4ABN A;  5CBA E;  5GAH C;  1G6Z A;  1WTH A;  4PZ8 A;  4KD4 A;  1PTO F;  2DY7 A;  5IP9 G;  1WCM G;  3R2I A;  3KF8 A;  4JK1 C;  1J5E L;  1Q1E A;  2M00 A;  2N8N A;  3LGJ A;  3CQZ H;  3BVG A;  3JAM L;  1S3O A;  1S4Z A;  1Y1W H;  5TSS A;  1HZC A;  1SNP A;  3RN2 A;  1SFO H;  3TEH B;  1TR5 A;  2RDF A;  1PTO H;  3EQL C;  4XT1 B;  2I46 A;  4RH6 A;  1B50 A;  3GTQ H;  4B9W A;  4C2M B;  1G2S A;  1XMQ Q;  5HY6 A;  4O1N A;  4IQZ A;  4H44 C;  1XXG A;  3OWF A;  2ZJP A;  1QCB D;  2RQX A;  4DV0 Q;  2UU9 Q;  1LTI D;  3C3L A;  1WOC A;  4YWK A;  1RTN A;  2BA0 A;  3NSW A;  4FXK C;  4BXX H;  5DAU A;  3MFG A;  3PUY A;  1TT2 A;  5EJW A;  1OXU A;  3ZYY X;  2E74 C;  3HP3 A;  3A5Z B;  3HOV H;  2LXK A;  3TZD A;  4ZAI A;  3OW2 A;  3M85 A;  4C1N K;  3MHB A;  2R7Z B;  3EBE A;  1CQV A;  3HKS A;  2CKZ B;  3S2H B;  3NK9 A;  3SHL A;  4K8I A;  2E5L Q;  4QJF A;  4K6D A;  4DK0 A;  3F8T A;  4P75 A;  1ESR A;  4M8A A;  4F87 A;  4C3J G;  2JP1 A;  4MIU A;  4OEL B;  2EYP A;  4Y7N H;  3PO3 G;  4ZYS A;  3MXU A;  1HNX L;  3KLS X;  3G48 A;  4CDC C;  1DOM A;  3S17 H;  1B9N A;  2JA9 A;  2PW5 A;  4X66 Q;  1C0A A;  3FEW X;  4YCV A;  4BXX G;  4FXD A;  2X6G A;  4J1M A;  4LWC A;  4A4I A;  5IT9 L;  2NZO A;  1D5Z C;  3C2P A;  1PYB A;  3K5M A;  3M4O B;  1EEI D;  1RDP D;  1YJW A;  1AZP A;  1P16 A;  2NWG A;  4K5X A;  1QIL A;  1VQ4 A;  2K05 A;  3G7L A;  1PH2 A;  1NJI C;  4GKK L;  1JT8 A;  1FYC A;  3HGB A;  2NVX H;  5M9O A;  2OQ0 A;  4HCS A;  4CDF C;  2UXD Q;  1E2W A;  1XWE A;  5GAG C;  3TQY A;  2Z4I A;  1PH1 A;  1F9Q A;  2OWO A;  4R4I A;  2KJX A;  3J81 i;  4RGN A;  5JJK A;  4R8I A;  4A3K B;  4BBR G;  3GV3 A;  4P2C B;  1PV4 A;  5EPK A;  1XNR Q;  1IW7 D;  2ENB A;  4EVO A;  4YHH L;  4A3C H;  5I2X A;  4DV2 L;  2DUD A;  3W3A A;  1E2V A;  1STG A;  2VZA A;  4A3D G;  2EPB A;  4LUV A;  1UE6 A;  2ZM6 Q;  1LTA D;  1RKN A;  1EY6 A;  4KY7 A;  1TWC H;  3IRB A;  3NP8 A;  4R4O A;  2UUA Q;  2FXQ A;  2B2V A;  2GA4 B;  4YY3 Q;  2ZJR A;  3NHH A;  2QEJ C;  3I56 A;  2CVR A;  1VQI A;  2FHT A;  1LT3 D;  2EYO A;  3EJI A;  1VQ9 A;  5M3M G;  2VQF Q;  3CU7 A;  5ELB A;  3C1E A;  1LT4 D;  1QWY A;  3H94 A;  1D6E C;  4HSV A;  4YCW A;  1M8A A;  2JA7 H;  4MNO A;  3L2P A;  1HJP A;  4IUT A;  1ILQ A;  3TP6 A;  4A3F H;  1BNZ A;  3KFU A;  4BWG B;  3TS0 A;  4UP8 A;  2AQ3 B;  3CCU A;  1IYV A;  2EYH A;  1STH A;  1V1P B;  2IL8 A;  5C4X H;  4H7B A;  4PMW A;  1X65 A;  2E2J B;  2F0E A;  5M3F B;  5C6A A;  3RLF A;  3CC7 A;  1JIC A;  2UXC L;  5LL6 S;  1IW7 C;  1S5F D;  2GN5 A;  5LMU Q;  4A3E B;  5HUR A;  5JJZ A;  1S5E D;  4XQJ A;  3OIP A;  3QB3 A;  4JVZ A;  2EIF A;  2F52 A;  1SSO A;  5ELD A;  3NBI A;  2UUB Q;  1JE5 A;  4A3F G;  3FDT A;  1TWF B;  3J7Z C;  1CZG A;  3V05 A;  5J39 A;  4K8J A;  3URY A;  3SVM A;  4J8Q A;  2TMP A;  1GO3 E;  2Q8R E;  1L0X B;  3OOC A;  4JV5 L;  1GKH A;  3SK8 A;  5C4X G;  3NBH A;  3PF4 A;  5C4Z A;  4R1J A;  5A2Q L;  2Q2U A;  4N9T A;  2LY7 A;  4P71 A;  3GTL B;  1IBK Q;  1NE3 A;  5HGT A;  3L3O C;  5IYB H;  4AYB B;  3CRL C;  2EY1 A;  4C3I G;  1O7L A;  4X65 L;  3J7A 5;  4WJ3 M;  4UHV A;  4CDD C;  1V8Q A;  3SE0 A;  2YTX A;  3GTK B;  1KDB A;  4Q0F A;  4DV7 L;  4UP7 A;  4DAY A;  1E22 A;  1Q8K A;  1PHJ A;  1C48 A;  2EY2 A;  5EGT A;  3AFP A;  4KY6 A;  5FKA C;  4ALP A;  2N88 A;  5FJ8 G;  5LHY 1;  2R7Z H;  1D8L A;  2AUJ D;  3S1N H;  3S2H H;  1N36 L;  5C3E B;  5DEH A;  5IYD H;  1E24 A;  1BQQ T;  1Q81 C;  2FJ2 A;  4ILW A;  4JI2 L;  3T1Y Q;  4XT3 B;  2C9O A;  5IYB G;  3J7A V;  4A3J B;  1JB7 A;  1MGS A;  1EWI A;  2EXZ A;  2QA4 A;  1A2U A;  1BBX C;  1UUP A;  4IJL A;  3A74 A;  4HIM A;  4AQY Q;  1NAP A;  1KDC A;  3KJP A;  3M4O H;  2H5X A;  1NBW A;  1YNX A;  5E4W C;  3G6J B;  4DV5 L;  1ASY A;  1JCK B;  3MZ5 A;  1PH6 A;  1G91 A;  4OIK A;  1RIP A;  4EQ5 A;  3QO2 A;  4QMG A;  2JYO A;  5IYD G;  2SEB D;  4AYB E;  4OWX B;  4BY1 H;  2KHI A;  5JAV A;  4POF A;  1Y8N B;  2PNR C;  4GNX B;  4JI0 L;  3I4M B;  2N49 A;  2WAQ B;  1I4R A;  4K5V A;  3UDI A;  1GJX A;  1KXL A;  5EPJ A;  2CH4 A;  2I5H A;  1QJO A;  1U4M A;  1RL2 A;  2F3I A;  4HMI A;  3RMH A;  4NXM Q;  1G8Z D;  4LFB Q;  1IYJ B;  3RLN A;  3AYH B;  3W1B A;  4A3K H;  2JK8 A;  1F9P A;  1NR4 A;  4HED A;  3OW7 A;  4H13 C;  2B2U C;  3GDE A;  1MD2 D;  1SLJ A;  2HIX A;  1A8V A;  2LFN A;  2PYK A;  2VS1 A;  1GD7 A;  1MSG A;  5M5W B;  4BY1 G;  3S2D B;  4JI2 Q;  4FP5 D;  2JQO A;  4YWL A;  2P5Z X;  5IGF A;  3PMF A;  5I4D A;  5IGD A;  1I5F A;  5IGG A;  2N3S A;  4DR5 Q;  2C5C A;  3CW2 C;  1IHZ A;  4J15 A;  2XRQ D;  3S16 B;  1XYI A;  1CT1 D;  1KLU D;  4LMQ D;  4QQB X;  1WCM B;  3X3M A;  1KRS A;  3H3V C;  4IN3 A;  4OIJ A;  2F4V Q;  4DA2 A;  3EFX D;  4QY7 A;  3LNN A;  5IGC A;  4QB4 A;  1ML0 D;  4PG3 A;  1B3Q A;  4U67 3;  3E9I A;  2Z4H A;  1BDO A;  1S5D D;  2A5H A;  2QKI C;  2HDL A;  1STE A;  2EYM A;  2IPK D;  4B3S Q;  4A3M B;  2KVM A;  2E2J H;  4CGY B;  5M3F H;  3OIQ A;  2D2C C;  3MWY W;  2RVL A;  3WWV A;  3A8J E;  2ZTE A;  4A3E H;  3VA7 A;  2KUM A;  1TQO A;  1EU4 A;  1VQE A;  4HN7 A;  4PV1 C;  2MGS A;  3I7F A;  3DEP A;  4DFA A;  4XIG S;  2K01 A;  1VMP A;  4KKS A;  2LMC B;  1SYG A;  1QVC A;  1EIH A;  4CJ0 B;  2E2D C;  4LF7 Q;  5C4H A;  3PUV A;  1C7Y A;  4HTH A;  5T1I A;  1VQ5 A;  1SFO B;  4DR3 Q;  3CCV A;  1HFN A;  1SJH D;  2NUC A;  1PTO B;  3OTO Q;  1B9M A;  4C3J B;  3MXN B;  1A3V A;  1MKH A;  1PFM A;  1JOO A;  1KAW A;  1VQB A;  2YV5 A;  3SGI A;  3PO3 B;  3GTL H;  3J81 L;  5KRU A;  1HFG A;  4BS9 A;  4DV3 L;  4A3E G;  2O4X A;  4L6T B;  4GOP C;  3T56 B;  2RKS A;  4FVM A;  1FGB D;  1HCZ A;  3UE1 A;  1CZW A;  2A19 A;  4J6H A;  4P73 A;  2JSO A;  3G4S A;  4X3S A;  1PRT F;  1XMO L;  4A3B G;  4B3M L;  1LV9 A;  2IWH A;  3MEH A;  1Z6H A;  2CH4 W;  3LWE A;  5KIX A;  4KI0 A;  2UXB L;  2A6E D;  1PZI D;  3DXJ C;  1K8O A;  1W6K A;  2F0O A;  4K14 A;  2ASB A;  4Y7N B;  4IPC A;  1ZXT A;  4X3T A;  3VR3 A;  1I4G A;  4JI4 Q;  5E1F A;  4ZLT F;  1UEA B;  2A73 B;  1K0R A;  4DAM A;  4A3J H;  3TSS A;  2LXJ A;  1GUG A;  3NEM A;  3BDL A;  5IIF A;  1B53 A;  5IWA L;  2PCF B;  3CD6 A;  2B2U A;  4BBR B;  1X3P A;  1HA6 A;  2EVB A;  2EE1 A;  5C3X A;  1EYA A;  5FLX L;  2EJG C;  4U68 A;  1GUS A;  2F0V A;  5AJ3 L;  3H15 A;  3RLO A;  2MP1 A;  3GQB A;  3J7Y W;  1EIF A;  4KY5 A;  3PUZ A;  5C5M A;  1XX8 A;  4A3D B;  4ME5 A;  3E3X A;  3VR5 A;  2N55 A;  3HOW G;  1HNW L;  3J80 i;  4DR7 L;  3LWU A;  1A3U A;  4OX9 L;  4HR7 B;  3I4M H;  1GVP A;  4JI1 Q;  1EFW A;  1YHA A;  3A5U A;  1YIT A;  1KNA A;  4HMJ A;  1HH2 P;  3M9B A;  1EIY B;  2RHS B;  1V1P A;  3NXW A;  1DOL A;  1VF5 C;  4X62 Q;  5M3M B;  1TWH B;  2A6E C;  1PYW D;  5J1Z A;  1VF7 A;  3CRK C;  2EY6 A;  1ONL A;  3L0O A;  1I94 Q;  4FYD A;  4O42 A;  3FKI G;  5D3I B;  2KHJ A;  2YU9 B;  4IAL A;  1LAC A;  1X3F A;  2B2Y C;  1G6P A;  4RGO S;  2NB0 A;  1DYQ A;  2I5L X;  4IPD A;  2HQE A;  1IKM A;  1JOR A;  5JPN C;  1U9R A;  1PTO D;  3TDQ A;  1TWC B;  2BOS A;  4OWT B;  4FDB A;  4HJA A;  3S2D H;  1XMQ L;  1D5M C;  4XQQ A;  1B70 B;  3RN5 A;  1FGU A;  1AE2 A;  2O2L D;  4DV0 L;  1X9N A;  1WTW A;  2BDO A;  1AEX A;  4L5T A;  3SK5 A;  2UU9 L;  1V1O A;  1E1O A;  1L1O B;  4JPB W;  2VW9 A;  3S16 H;  3NWT A;  3CC2 A;  1SE8 A;  4GN4 B;  4L63 B;  5L37 A;  4DKA C;  4N8X 1;  4CJ2 C;  3BDC A;  2Z8L A;  4A3F B;  3BZD B;  5ELC A;  1CI3 M;  1RD9 D;  1QVG A;  4JI3 Q;  1I6V C;  4KN7 C;  4G4K A;  1JC7 A;  4F88 A;  1Q86 C;  3TZU A;  1SNQ A;  1LAB A;  2E5L L;  2UUC L;  4L5Q A;  1BUV T;  4GOP A;  1Q1B A;  4A3M H;  1Z9F A;  1HNZ Q;  2ZXR A;  4ID6 A;  3VR6 A;  1JQY D;  2DGY A;  1EQV A;  4X66 L;  4C3I B;  2Q8T A;  1IL8 A;  3CCR A;  1YHQ A;  5EQ0 A;  2OTL A;  3ULL A;  1N32 Q;  2B2V C;  1Q82 C;  4JBM A;  4L5S A;  1CHQ D;  3P7J A;  1ICW A;  3AB9 A;  1PTO C;  1PZK D;  5CYU A;  4K2L A;  1WTX A;  3X3N A;  3NEL A;  2VB3 X;  1WJJ A;  3ND8 A;  4EQP A;  3I70 A;  2M2L A;  4ODG A;  3GTJ B;  2JJQ A;  3KBX A;  2UXD L;  2B3G A;  3KLW A;  3P20 A;  1V1Q A;  4A3M G;  4KHP Q;  4C3J H;  2R92 G;  3N52 A;  1WD1 A;  3PO3 H;  1YJN A;  2D5D A;  1AE3 A;  5IOC A;  1ICF B;  3B6Y A;  1TU2 B;  3QIA A;  4ME3 A;  4R9W A;  3Q22 A;  4IUP A;  4N8F A;  1VCI A;  2CWP A;  5T1G A;  1ENA A;  4LUZ A;  2VQE Q;  4V19 0;  2D0O A;  1T5X D;  1XNR L;  1I3Q B;  3I73 A;  3VYU A;  1PH9 A;  2AQ2 B;  2KBN A;  1K9M C;  1EY9 A;  1F9S A;  3R93 A;  1CSQ A;  3S1N B;  1ZEQ X;  4X3K A;  1QUQ B;  4K6L A;  2AUK A;  3PIO A;  2UUC Q;  2AWN A;  2KCC A;  1V43 A;  4NPS A;  2ZM6 L;  3CMA A;  4ZKC B;  1YJ9 A;  2Q8I B;  3IFD A;  3CAM A;  5BR8 Q;  2XSC A;  1O80 A;  2UUA L;  4DUZ Q;  1GHK A;  4YY3 L;  3PIP 3;  3HOY G;  5IP7 H;  1NUC A;  1NMG A;  3MTS A;  4NXN Q;  3DUZ A;  3CCL A;  2I5M X;  2D62 A;  4GKJ Q;  4BBR H;  2VQF L;  4XYQ A;  4WOR A;  5ELF A;  1TWG H;  1A62 A;  2B2Y A;  1MJE A;  1LYL A;  3NPP A;  4LFC Q;  3JAM c;  2A68 D;  3IAY A;  1EYD A;  1FL0 A;  2R7F A;  4DF7 A;  2BH8 A;  4ULL A;  5JOB A;  2RBM A;  4KMU C;  2K6A A;  4ZK9 B;  1F2Z A;  5I9P A;  1SN8 A;  1TY0 A;  4BY1 B;  4A3D H;  4LF5 Q;  1HR0 Q;  1NMF A;  2Z0S A;  1TXY A;  2RF4 A;  2YTV A;  1K8A C;  1SJE D;  2RA4 A;  3K7A H;  4DV4 Q;  1SNM A;  5IP7 G;  1MHW C;  3S14 H;  3K6O A;  1YBY A;  5CV6 A;  1BCP B;  4TQU S;  3F1Z A;  1SMY D;  3STB D;  3J80 E;  5LMU L;  2PPB C;  2NVT B;  1KQS A;  1LTG D;  2IW3 A;  5M3M H;  1TWH H;  3K7U C;  1E1T A;  1SMX A;  4X64 Q;  1U5K A;  2VUM G;  2R61 A;  2UUB L;  1HUM A;  4UAI A;  4TVA B;  3FMC A;  5K5P A;  2YU9 H;  3M4P A;  2RCF A;  2JEA I;  3L9A X;  4HSP A;  3R3O A;  1VQJ A;  3D6W A;  3V96 A;  5J22 A;  4YWM A;  4IO9 A;  2KQ3 A;  1RCV D;  3NEN A;  3KOJ A;  3K59 A;  1HRJ A;  2XRS D;  1FD7 D;  4KK7 A;  1IBK L;  2QEX A;  2K5V A;  5IT9 c;  2X6L A;  1FR3 A;  3PQI A;  3MXN A;  2GVA A;  1YVC A;  3M4Q A;  4X3U A;  3PF5 A;  2OF1 A;  2DY8 A;  4A3I G;  3STB C;  3M7N A;  1SMY C;  3CCQ A;  1UNS A;  3KBG A;  4XTC S;  5M5Y B;  2EJM A;  2HQL A;  5J3B A;  4WJ4 A;  3O13 A;  2ZT9 C;  4G57 A;  3F2D A;  4B3R Q;  4L5R C;  1QE6 A;  3T1Y L;  4F8M A;  1Y8O B;  2J4X A;  3MXP A;  5CGK A;  2BE5 D;  1SDF A;  1KAB A;  2N78 A;  3A8K E;  1Y1V G;  1K8G A;  4C3I H;  1D7Q A;  4OEM B;  1VQF A;  2KEE A;  4AQY L;  1VQA A;  2K4K A;  1D2B A;  3S15 B;  4A3B B;  1KHI A;  4TSS A;  5K36 H;  1QG7 A;  5FJ8 H;  1S5C D;  3PSI A;  3J80 L;  5C0X J;  4LF4 Q;  1SYC A;  1EZ6 A;  1AFP A;  3T4A C;  3RD4 A;  3GTJ H;  2JA5 H;  1CA6 A;  4G7Z C;  1SNC A;  4JI8 Q;  3T1H Q;  2O5J C;  3EVQ A;  1EFI D;  5LL6 X;  4XYO A;  2HD3 A;  3D4W A;  1SE2 A;  3D0F A;  3K8A A;  4JI5 Q;  4NXM L;  2TSS A;  4LFB L;  3FRP B;  4IOC A;  3SK4 A;  3U9S A;  4RWS C;  1RHP A;  2NN6 I;  3G6E A;  2MO1 A;  2RCN A;  2ZTC A;  1MBY A;  1YNN D;  2PI2 E;  4WRD A;  1I3Q H;  4NMZ A;  5K36 G;  5CV5 A;  2BE5 C;  2XN9 C;  4DV1 Q;  2G9D A;  4A3L G;  2HHH Q;  1NR2 A;  1STA A;  2ALY B;  2E2I H;  3HOW B;  2L0C A;  2YTY A;  3HFZ B;  2JA5 G;  4IUV A;  1PRT B;  4XDX A;  1GXD C;  1H9R A;  1SE3 A;  3UDX A;  1N34 Q;  1K8M A;  2IY5 B;  1QOH A;  3KF6 B;  4EX5 A;  2NZH A;  4DR5 L;  4GN5 A;  1GM5 A;  2BDN A;  4I7Z C;  2F0J A;  2IT1 A;  1SBB B;  3CCS A;  3E0J A;  4IZ8 A;  4NB3 A;  1O78 A;  3TN2 A;  2L11 A;  4HJ9 A;  4IUQ A;  2NN6 G;  2R6G A;  1JJ2 A;  2F4V L;  1TS3 A;  3FKI B;  4LK1 C;  1TS4 A;  2WFW A;  1BCP F;  4DR2 Q;  1L1O A;  2DJG C;  2YYZ A;  3HOU G;  4HAE A;  2RDG A;  2R7D A;  3SXH A;  1D5X C;  1OXX K;  2K28 A;  4B3S L;  3E5S A;  1BBU A;  2XIW A;  2B2T C;  2AQ1 B;  2RHQ B;  3TS2 A;  1X56 A;  1ZYR D;  3HOZ G;  4RHS A;  1C8C A;  4K2K A;  3J81 j;  3ONA B;  2NVT H;  1DD2 A;  3JAM i;  2HUG A;  2DNE A;  3IFT A;  4DR6 Q;  4DK1 A;  1YZ6 A;  4LF8 L;  2JA8 H;  1CHP D;  2EOT A;  1IBM Q;  2QCP X;  2Q2T A;  3I3C A;  4GZY C;  5KNB A;  4CJ1 B;  3K80 C;  3H0G G;  4DXF A;  2LS0 1;  4LF7 L;  1CKO A;  4B08 A;  1XPR A;  4LW1 A;  1LTB D;  4DR3 L;  3PIP A;  4PMC A;  1EY4 A;  2K5D A;  1U0L A;  3OTO L;  3MXG A;  3QG1 A;  2WII B;  1N33 Q;  2ZXO A;  3FPP A;  3ERS X;  1Y14 B;  2QGQ A;  1AZQ A;  4MN3 A;  1JJC B;  3VA5 A;  3DHQ A;  4HJ8 A;  5COR A;  2L9H A;  4PNY A;  4DNR B;  4RCO A;  3WOF A;  3DLL A;  2JA8 G;  2D0P A;  3TRE A;  5IE8 A;  1KNE A;  2X69 A;  1HZB A;  5HGQ A;  2WAC A;  1ZYR C;  4X6A H;  3TME A;  1AN8 A;  4JBK A;  1PMR A;  1T5E A;  1VQ6 A;  1R4Q B;  1H9K A;  1K3B C;  4GS3 A;  4UDU C;  5M5Y H;  4PQX A;  4A3G B;  3P1H A;  4QL5 A;  2R92 B;  4WJW A;  1F2Y A;  1PRT D;  3KLS A;  3FPU B;  3PIO 3;  4JI4 L;  1QUQ A;  1CSP A;  1X54 A;  2J7Z A;  4IFD J;  1HQM C;  3UDF A;  1OTC A;  2WKD A;  2E75 C;  3AEV A;  2WIN B;  1VS0 A;  2NVY B;  1PH5 A;  4LF8 Q;  5EKL A;  4IJH A;  4JOI C;  1PH4 A;  2F0U A;  1VQN A;  1M1K C;  3S15 H;  4A3B H;  1K83 H;  1N9W A;  4HJ7 A;  1I4H A;  2K50 A;  3L7Z C;  2VNU D;  4NKL A;  4DR1 Q;  3K81 C;  3DWP A;  1Y8P B;  1MSH A;  1KTK A;  4FXG C;  3E9H A;  2QIL A;  4CKE A;  1II3 A;  1TII D;  4JI1 L;  3TRZ A;  3HOY B;  1Q46 A;  2SOB A;  4A93 G;  2XNA C;  3OPO A;  1WI5 A;  1G51 A;  4X62 L;  2CW0 D;  3T53 B;  1WD0 A;  1TS5 A;  4BBS H;  4JI7 Q;  2F0M A;  4JBJ A;  1R9T H;  1I94 L;  1PLF A;  5C0X I;  3KDF B;  1PRT C;  2F3V A;  5C0X H;  5D14 A;  5G3L F;  1KD1 C;  4MHE A;  2B2T A;  1VQ8 A;  4EGV A;  1K0S A;  2EDG A;  4LAA A;  3WDN A;  3HOW H;  2XWB B;  5C4J B;  4V0B A;  4OWW B;  2EJF C;  2OQK A;  1HHV A;  1EU3 A;  1SE4 A;  3BYT B;  1MIU A;  4EQO A;  1FJG Q;  5M5X H;  4Q5V A;  2MO0 A;  1VQD A;  4KN4 C;  1TWG B;  3BVM A;  4BBS G;  3GO5 A;  1PXU A;  2VUM B;  1EQT A;  4NW2 A;  1JWM D;  2DN8 A;  1QNU A;  3HG9 A;  1CKN B;  1S5B D;  2QW7 A;  4GNX C;  4RGM A;  3FP9 A;  3ND9 A;  3PO2 G;  4JCV E;  4K0K Q;  3F2U A;  3FKI H;  5C0X G;  1PVO A;  3R2T A;  3RNU A;  1EZ8 A;  2H1E A;  1X6O A;  4JI3 L;  3Q0A A;  2CWA A;  3SEB A;  2E76 C;  4CKB A;  4KV6 A;  2A74 C;  4LF6 L;  3EA6 A;  1BR9 A;  5I9O A;  3J81 c;  3I4N G;  3VYS A;  3ERQ A;  3K7A B;  4KKU A;  1QZH A;  3KLR A;  5ELN A;  3S14 B;  3NBH B;  2L5T A;  1HNZ L;  2NYZ D;  4JYA Q;  1JB3 A;  2PI2 A;  3I8Z A;  3KYH C;  1M90 C;  3HKZ E;  1N32 L;  2OT2 A;  2F0Q A;  2ES2 A;  1STY A;  3FVQ A;  3BDO A;  4B3T Q;  1PH8 A;  4HID A;  1TKW B;  3JAM E;  2B63 G;  4A3I B;  4KHV A;  5F2D A;  2EYF A;  4OHJ A;  4LF9 Q;  1UAP A;  4DAY B;  3S1M B;  4A76 A;  1CKM A;  1U4L A;  4DNI A;  5FO8 B;  1O7I A;  2JA6 H;  1A63 A;  1X55 A;  3AFQ A;  3HRZ C;  3S9W A;  1A15 A;  1HQR D;  3D6C A;  3A0J A;  1I6H B;  4KHP L;  4GLA C;  1GUW A;  1CUK A;  2QDB A;  3S1Q B;  4OON A;  2B2W C;  1UE1 A;  3I2Z A;  3DWQ A;  1B8A A;  1Y1V B;  4JOI A;  2BCO A;  5IOD A;  1DM0 B;  3BVZ A;  2MQH A;  5I2Y A;  5FLX c;  4DUY Q;  3A54 A;  3NTI A;  2CQA A;  3T13 A;  4QGU A;  2GVB A;  3I4L A;  3RZO B;  1PFS A;  1YNJ D;  2VQE L;  1K73 C;  1I4X A;  1EY7 A;  5ISR A;  3M3Y B;  4G7H C;  1O7Y A;  3GTG H;  1WTR A;  4ZUJ A;  4CDE C;  3U58 A;  4DGZ A;  4FF3 A;  1VQH A;  5FO7 B;  5GAE C;  5D65 A;  2JA6 G;  4QIW B;  4LF6 Q;  4FF1 A;  1STN A;  3F2C A;  3PUX A;  4A75 A;  5C5L A;  2AMC B;  4LFA Q;  4A3G H;  5BR8 L;  1KLG D;  1D1I A;  2R92 H;  4BY7 G;  1SYE A;  4DUZ L;  4M1U B;  1NY4 A;  4HJ5 A;  3PCO B;  4KJO A;  3GD7 A;  4LJZ C;  1UEB A;  2PQA B;  4NXN L;  5IT9 E;  5IGB A;  2NVY H;  4GKJ L;  2B8G A;  2BH2 A;  1ZKO A;  1X32 A;  2JEB I;  3KF6 A;  4LFC L;  1BVS A;  3A8I E;  3AMU A;  3BG3 A;  2PNH A;  1CFM A;  2PZW A;  2V4D A;  4JI6 Q;  5IYC G;  3AU7 A;  1F9R A;  1NSN S;  3U4Z A;  2K5N A;  3VR4 A;  3K0X A;  1HTL D;  4LF5 L;  1SYD A;  2JA5 B;  4DR4 Q;  1DXM A;  1W3S A;  3HZX A;  1HR0 L;  4A3G G;  2L4N A;  4IFD I;  1C4Q A;  4IUU A;  2KHS A;  4KLK A;  3VR2 A;  1JMC A;  1G2T A;  1YNJ C;  2R93 H;  4FO2 A;  2A1A A;  3S24 A;  4E6I A;  4DV4 L;  4DV6 Q;  2XWJ B;  4IFD H;  1UE7 A;  3CXC A;  3HOY H;  2B39 A;  5E3F A;  1WTP A;  5FLM H;  1EWH A;  3Q8D A;  4GNX A;  3FHW A;  4KJN A;  2K75 A;  1AW7 A;  4L8J A;  3DM1 A;  2MHV A;  3TBI B;  1LTT D;  5JVG 3;  4IOA A;  4X64 L;  4QIW E;  1JJG A;  3VYR A;  1XNQ Q;  2Z6K C;  4KHZ A;  3Q6S A;  2E2I B;  5JJI A;  3HOU B;  1WTO A;  1Q3L A;  5CV7 A;  5LMN Q;  1EEF D;  3UE0 A;  2K7V A;  2Y0S G;  3A56 A;  1PYS B;  1IBL Q;  3U4V A;  3IKJ A;  1NCV A;  5C4J H;  1EY8 A;  2SNM A;  2R93 G;  3PV0 A;  4IFD G;  1PFB A;  4RFB A;  5KYL A;  3HOZ B;  5FLM G;  1XPO A;  1Y1W G;  1T9H A;  4JBW A;  4OGQ C;  1K28 A;  2A6H D;  4P74 A;  2OCE A;  1B3A A;  2VUM H;  2OEO A;  4AIM A;  2KEC A;  4GN3 B;  3HKZ G;  1UWV A;  3HS0 C;  1OXT A;  3H0G B;  3ITP A;  2XGT A;  4GLV B;  3G71 A;  1VQK A;  4OXP A;  5I6W A;  1Q8I A;  4IPG A;  1OO9 B;  1P8L A;  3VYT A;  3K57 A;  3CCM A;  3SDZ A;  2B2W A;  1IKL A;  1DOK A;  4APV A;  1YEZ A;  1ET6 A;  3GTM B;  2MNA A;  4B3R L;  3HOV G;  1F2M A;  1X3E A;  1J5E Q;  1E7Z A;  2F3W A;  4RG1 A;  2PQE A;  2K1B A;  1E0B A;  2G9H D;  5DM6 3;  4MTK A;  3E0E A;  2E2H B;  3N6R A;  1GOZ A;  3KUP A;  5DLQ E;  2OTJ A;  1KDA A;  2F0K A;  2JA8 B;  3U9O A;  1O7Z A;  1ENC A;  1YI2 A;  3MC0 B;  3IL8 A;  2B8F A;  3D31 A;  2HCC A;  1RTO A;  4K5W A;  3K5N A;  2JN4 A;  1HZA A;  5CR3 A;  5ELO A;  2D9U A;  4IPH A;  2XTI A;  1EY0 A;  2FIN B;  1E2Z A;  1TS2 A;  4A3I H;  3NTK A;  1LLR D;  1Q90 A;  1H9S B;  3CKI B;  2AWO A;  2BA1 A;  3J7A F;  4LF4 L;  3S1M H;  5E4X A;  3MFY A;  2PMZ B;  5A2Q E;  1L1O C;  2A6H C;  1HPC A;  1L2F A;  2EQS A;  3H6M A;  1MI2 A;  5C3W A;  4RMF A;  4QCL A;  1IYU A;  2A68 C;  1I6H H;  3K5L A;  3KJO A;  4JI8 L;  3T1H L;  4Y52 H;  3S1Q H;  1WTV A;  4JI5 L;  1Y1V H;  2ICE C;  3HOX H;  2QDL A;  2IJ0 A;  2JE6 I;  4KKT A;  2F0D A;  1I50 H;  3CCE A;  3H91 A;  3TP5 A;  5I6Y A;  1MJC A;  3SR1 A;  1HNX Q;  1CA5 A;  3RZO H;  5EBD A;  1LO5 D;  3M3Y H;  1HUN A;  1I4Q A;  2K52 A;  4H0L C;  1CK1 A;  3F2B A;  2C35 B;  1PH7 A;  1SYB A;  4JW0 A;  4DV1 L;  4DK6 C;  4CHT B;  5H1S E;  2HHH L;  4UPA A;  3SK6 A;  1WFQ A;  4R4Q A;  1IXR A;  1U4P A;  2I07 B;  3KDF A;  1QB5 D;  5FK9 C;  2QF7 A;  3A7A B;  3K5O A;  3M4Y A;  3T16 A;  5EAY A;  1HA5 A;  1N34 L;  1X3G A;  4A3C G;  2PZU A;  4P72 A;  4A93 B;  5E7N A;  3R8B A;  1STB A;  3C1F A;  4QUF A;  3HOX G;  5EKI A;  1KAA A;  4RKL A;  4GKK Q;  4JG2 A;  1B44 D;  3NWS A;  3GTP B;  1B4O A;  2Z6K A;  3DWA A;  4DU9 A;  1K83 B;  2PMZ E;  2CQO A;  4RCN A;  4DR2 L;  1TWA B;  3TP8 A;  1BKB A;  1KRT A;  5KEE A;  3RUZ A;  1F77 A;  3DMU A;  1A0I A;  1Q12 A;  4QUC A;  4DNT B;  4A3L H;  3W2D A;  1ENF A;  2K14 A;  1CKN A;  2EXD A;  2F0L A;  2M9V A;  3H09 A;  1BXT A;  2ATW A;  1V9P A;  2F0H A;  2JA7 G;  1SAP A;  1I4P A;  4DAP A;  1DJR D;  2B29 A;  4YHH Q;  3BU2 A;  1BCP D;  1SRU A;  2F0P A;  4DV2 Q;  3CPW A;  4BBS B;  4C1N I;  4DR6 L;  5JEA J;  1R9T B;  1PA6 A;  1X3Q A;  5CMD A;  2NN6 H;  5GAD C;  1VQO A;  2CFM A;  3PO2 B;  1IBM L;  4TRD A;  5ELE A;  4C2M H;  3D4D A;  4PZ7 A;  4RA8 A;  5GRO A;  4ZQ3 A;  4UY8 C;  3HOU H;  1H95 A;  3BS1 A;  3I4N B;  4O2D A;  2Q2H A;  1LTL A;  2K5H A;  2PZT A;  1IZ6 A;  5NUC A;  3OMC A;  1N33 L;  3MA2 B;  1FNW A;  5KNC A;  2LSS A;  4F7X A;  1XJV A;  4OL7 A;  1NTG A;  4GOP B;  5M5X B;  3VDY A;  1EQR A;  3EN2 A;  3I4O A;  3HOZ H;  3I72 A;  3D3R A;  1VQM A;  3QOL A;  2ID0 A;  1G29 1;  1HXY D;  4FF4 A;  1JWS D;  4QF4 A;  1VDZ A;  5JVH 3;  1EUJ A;  2MJ8 A;  5LMN W;  1DCZ A;  2IHE A;  2B63 B;  2UXC Q;  3J80 c;  4HCE A;  2K33 A;  5KYI A;  2KEN A;  2F0G A;  1BCP C;  3H0G H;  3KF8 B;  3OWE B;  1EOV A;  2A8V A;  2K32 A;  1W2B A;  2CCZ A;  3UI2 A;  1Z47 A;  3QR8 A;  1KC8 C;  2KCM A;  2L55 A;  4DXG A;  5A35 A;  2V1C C;  1JR0 D;  2FMC A;  1YNN C;  3K58 A;  1SEB D;  2EYL A;  3GTM H;  4ZCK A;  1VQ7 A;  3I90 A;  3S1R B;  2L15 A;  2R7Z G;  2DNC A;  1GUT A;  2MUY A;  2E2H H;  2RDH A;  2HT1 A;  4JV5 Q;  2VB2 X;  3C46 A;  5EPL A;  4C3H B;  4I7A A;  1EOT A;  1HZ9 A;  1HR0 W;  2F0W A;  2A69 D;  2PQA A;  3RZD B;  1A6X A;  4ZUI A;  5C44 B;  1CM9 A;  4X65 Q;  2O5I C;  2WB1 B;  4XQN A;  2JA6 B;  3K0Y A;  4KTA A;  3CF5 A;  1QVF A;  1GHJ A;  4DR1 L;  4DV7 Q;  4LNQ A;  3J81 E;  3KK7 A;  3OMG A;  4R4T A;  1NNX A;  4BY7 B;  4H02 A;  2ICI A;  2KOL A;  2F0S A;  3GTO B;  5AFW A;  2RSN A;  5BN4 A;  2KA7 A;  4XXE A;  2WKC A;  4CBV A;  4DAV A;  1N36 Q;  4HIO A;  1XPU A;  3U50 C;  1CTM A;  3OYY A;  4RAU C;  4JI7 L;  3I91 A;  5GQO A;  1Q7Y C;  3D4R A;  4C56 C;  3GTG B;  2KCT A;  2FMM A;  4S3S A;  1W6J A;  4HIK A;  1WTQ A;  2PO4 A;  5IGE A;  3NQI A;  1FNU A;  5IY0 A;  2LKV A;  2NVQ B;  4A3K G;  4FNF A;  1B1Z A;  4GLX A;  1GUN A;  2NTS A;  1S72 A;  2F03 A;  3I55 A;  2NZ1 D;  1LUZ A;  1E3P A;  2RSO A;  1AH9 A;  4DV5 Q;  2A69 C;  1VQP A;  3CC4 A;  2HIV A;  3A55 A;  4A93 H;  2WAQ E;  2NTT A;  2VL6 A;  5G3L D;  1FJG L;  1RF2 D;  3AQQ A;  5FLX E;  3H3V I;  4OO1 I;  3DEO A;  4NDX A;  3QOJ A;  1U4R A;  4JI0 Q;  2WB1 E;  3GTP H;  3H3V H;  4OO1 H;  1LM0 A;  5CV4 A;  3DM3 A;  4DK3 C;  1WYD A;  5CBE E;  4NP5 A;  2AKW B;  4K0K L;  4DN4 M;  3PGZ A;  2KCN A;  2I0Q A;  4WFN 3;  1TWA H;  3EIV A;  3NTH A;  4MZ9 A;  1EQQ A;  1UE5 A;  1XTC D;  1KL9 A;  2Y0S B;  1VQL A;  1C9O A;  4PZ6 A;  1IL2 A;  1LT5 D;  2K04 A;  2R93 B;  2HDM A;  4N9P A;  1B2T A;  2G5D A;  3GV6 A;  1VMC A;  1EYG A;  3ULJ A;  3CQZ B;  5BN3 A;  2F0N A;  2ZXP A;  1PH3 A;  4JYA L;  1FNV A;  3CME A;  1Y1W B;  1TWF H;  2FFK B;  2IX0 A;  3BYY B;  3QJY A;  4CKC A;  1YIJ A;  1J8I A;  2L1B A;  1BF4 A;  1TVX A;  1XTD A;  2Z6B A;  4BA1 I;  4OO1 G;  5FO9 B;  3BZK A;  3Q24 A;  4B3T L;  3GTQ B;  1JE4 A;  5M3F G;  1SR3 A;  4IUN A;  3T51 B;  4DPG A;  3HKZ B;  3BZC A;  1PDQ A;  3HEJ A;  3W5O A;  5KND A;  3CCJ A;  1QZG A;  2SNS A;  3PO2 H;  5EBC A;  4TKO B;  1ESF A;  4LF9 L;  2L12 A;  2VY3 A;  3CPF A;  5CV8 A;  4LUO A;  1JWU D;  1R4P B;  1J6Q A;  1VQC A;  3OSO A;  2K5Q A;  3I4N H;  3GTK H;  1F2L A;  2JXM B;  2DJF C;  3HOV B;  3NE5 B;  5KGU A;  1H9J A;  1H9S A;  3ICE A;  1Y69 U;  2AHO B;  4O0A A;  4YIJ A;  5CC4 A;  1BO0 A;  1OXV A;  1RJT A;  5DM7 3;  5JEA H;  1EIG A;  4DUY L;  4FF2 A;  1SRO A;  4I65 A;  5C3E H;  3Q23 A;  4RHR A;  5JPM C;  2Y0S E;  1A3T A;  2ZJQ A;  1SYF A;  1BBW A;  1K3R A;  3TP7 A;  3S17 B;  2CHB D;  2B63 H;  4R4C A;  1ET9 A;  4AYB G;  2E8G A;  1EWC A;  3UDG A;  1HTP A;  2WP8 J;  1TY2 A;  2CW0 C;  3W1G A;  3OHX C;  2VXW A;  2HCI A;  3E6Z X;  2ZTD A;  4RGT A;  1B7Y B;  3CP0 A;  1JOQ A;  2F1M A;  2OXP A;  1EL0 A;  1DGS A;  4LFA L;  2NBF A;  1L0Y B;  2F0T A;  3P75 A;  1AP0 A;  4R8N A;  2H4O A;  4PMB A;  2KED A;  2SDF A;  5CV9 A;  2XVS A;  5JJL A;  3S1R H;  3QWN A;  4POG A;  5JEA G;  1SNO A;  1PZJ D;  2NVX B;  1S40 A;  4ZKB B;  1CQF A;  2PW7 A;  5C3E G;  3ERO A;  2F0F A;  1ILP A;  3CHB D;  4C3H H;  1J9O A;  3M7G A;  1N8R C;  3PUW A;  4DV3 Q;  4JI6 L;  4Z9C B;  4A3J G;  3RZD H;  5C44 H;  4AH6 A;  1EYC A;  1Z7T A;  5DNF A;  1KIX A;  4DR4 L;  3ULP A;  2F0I A;  1DZ1 A;  3LX0 A;  4UP9 A;  3V2T A;  1XMO Q;  4BY7 H;  4B3M Q;  1SND A;  1A2T A;  4DV6 L;  3GTO H;  3HOX B;  3GP7 A;  2Z9H A;  1I50 B;  3D8G A;  4JC0 A;  2UXB Q;  1FVI A;  1VQG A;  5COY A;  5M5W H;  2WV6 D;  4YCU A;  3NQT A;  2F4I A;  4C3H G;  1H9M A;  3BJU A;  3I4M G;  2WAQ G;  1LTS D;  3JC6 6;  1SXT A;  5EKK A;  1GUO A;  5C44 G;  5IYC H;  1DON A;  1QNK A;  3MAQ A;  1XNQ L;  4B9X A;  5IWA Q;  2WB1 G;  1EY5 A;  5LMN L;  2MFI A;  1YHB A;  2NVQ H;  1IBL L;  3MEF A;  5IP9 H;  1WCM H;  1JOK A;  2JA7 B;  1OXS C;  4RKB A;  5AJ3 Q;  5BN5 A;  4BA2 I;  2EYJ A;  4MTN A;  2K5W A;  4KD3 A;  3ER0 A;  4EQN A;  2EY5 A;  2Z1C A;  1M4V A;  1D1K A;  4G7O C;  1HNW Q;  2EZV A;  5C4X B;  1L0W A;  2J0T D;  1WVL A;  2IX1 A;  1ASZ A;  4DR7 Q;  2MPM A;  3NUC A;  1PFN A;  4OX9 Q;  2K03 A;  2Q2I A;  5FOB B;  4ZRZ A;  3RR5 A;  2IHF A;  1BOS A;  1ROD A; 
#chains in the Genus database with same CATH homology
 4IUR A;  2R3Z A;  3WOE A;  1LT6 D;  1LTR D;  3A7L A;  2IX3 A;  5D3D A;  3MVV A;  4ABN A;  5CBA E;  1G6Z A;  4KD4 A;  1PTO F;  2DY7 A;  3R2I A;  3KF8 A;  4JK1 C;  1Q1E A;  2M00 A;  3BVG A;  3JAM L;  1S4Z A;  5TSS A;  1SNP A;  1TR5 A;  2RDF A;  1PTO H;  3EQL C;  4XT1 B;  2I46 A;  4RH6 A;  1B50 A;  4B9W A;  4C2M B;  1G2S A;  4O1N A;  4IQZ A;  4H44 C;  1XXG A;  3OWF A;  1QCB D;  2RQX A;  1LTI D;  3C3L A;  1RTN A;  2BA0 A;  3NSW A;  4FXK C;  5DAU A;  3MFG A;  3PUY A;  1TT2 A;  5EJW A;  1OXU A;  3ZYY X;  2E74 C;  3HP3 A;  3TZD A;  4ZAI A;  3M85 A;  4C1N K;  3MHB A;  2R7Z B;  1CQV A;  3S2H B;  3NK9 A;  3SHL A;  4K8I A;  4K6D A;  4DK0 A;  1ESR A;  4M8A A;  4F87 A;  4C3J G;  2JP1 A;  4MIU A;  2EYP A;  4ZYS A;  3MXU A;  3KLS X;  1DOM A;  1B9N A;  2PW5 A;  3FEW X;  4FXD A;  2X6G A;  4J1M A;  5IT9 L;  1D5Z C;  3C2P A;  3K5M A;  3M4O B;  1EEI D;  1RDP D;  1AZP A;  2NWG A;  4K5X A;  1QIL A;  2K05 A;  3G7L A;  1FYC A;  3HGB A;  5M9O A;  4HCS A;  1E2W A;  1XWE A;  2Z4I A;  1F9Q A;  2KJX A;  4RGN A;  4R8I A;  4A3K B;  3GV3 A;  4P2C B;  5EPK A;  1IW7 D;  2ENB A;  4EVO A;  5I2X A;  3W3A A;  1E2V A;  1STG A;  2EPB A;  1LTA D;  1RKN A;  1EY6 A;  4KY7 A;  3NP8 A;  2B2V A;  2GA4 B;  3NHH A;  2QEJ C;  2CVR A;  2FHT A;  1LT3 D;  2EYO A;  3EJI A;  3CU7 A;  5ELB A;  3C1E A;  1LT4 D;  1QWY A;  3H94 A;  1D6E C;  4HSV A;  1M8A A;  4IUT A;  1ILQ A;  3TP6 A;  1BNZ A;  4BWG B;  2AQ3 B;  1IYV A;  2EYH A;  1STH A;  1V1P B;  2IL8 A;  4H7B A;  4PMW A;  2E2J B;  2F0E A;  5M3F B;  5C6A A;  3RLF A;  1JIC A;  5LL6 S;  1IW7 C;  1S5F D;  4A3E B;  5HUR A;  5JJZ A;  1S5E D;  4XQJ A;  3OIP A;  3QB3 A;  1SSO A;  5ELD A;  3NBI A;  3FDT A;  1TWF B;  1CZG A;  3V05 A;  5J39 A;  4K8J A;  3URY A;  3SVM A;  4J8Q A;  2TMP A;  2Q8R E;  1L0X B;  3OOC A;  3SK8 A;  3NBH A;  5C4Z A;  5A2Q L;  4N9T A;  2LY7 A;  3GTL B;  5HGT A;  3L3O C;  4AYB B;  3CRL C;  2EY1 A;  4C3I G;  1O7L A;  1V8Q A;  3SE0 A;  3GTK B;  1KDB A;  4Q0F A;  4DAY A;  1C48 A;  2EY2 A;  5EGT A;  4KY6 A;  5FKA C;  2N88 A;  5LHY 1;  2AUJ D;  5C3E B;  5DEH A;  1BQQ T;  2FJ2 A;  4ILW A;  4XT3 B;  2C9O A;  3J7A V;  4A3J B;  1MGS A;  2EXZ A;  1A2U A;  1BBX C;  1UUP A;  1NAP A;  1KDC A;  5E4W C;  3G6J B;  1JCK B;  3MZ5 A;  1G91 A;  4OIK A;  3QO2 A;  4QMG A;  2JYO A;  2SEB D;  5JAV A;  1Y8N B;  2PNR C;  3I4M B;  2WAQ B;  1I4R A;  4K5V A;  1GJX A;  5EPJ A;  1QJO A;  1U4M A;  4HMI A;  3RMH A;  1G8Z D;  1F9P A;  1NR4 A;  4HED A;  3OW7 A;  4H13 C;  2B2U C;  1MD2 D;  2LFN A;  2PYK A;  1MSG A;  5M5W B;  3S2D B;  4FP5 D;  5IGF A;  3PMF A;  5I4D A;  5IGD A;  5IGG A;  2C5C A;  1IHZ A;  2XRQ D;  3S16 B;  1XYI A;  1CT1 D;  1KLU D;  4LMQ D;  1WCM B;  3X3M A;  3H3V C;  4IN3 A;  4OIJ A;  4DA2 A;  3EFX D;  3LNN A;  5IGC A;  4QB4 A;  1ML0 D;  4U67 3;  2Z4H A;  1BDO A;  1S5D D;  2A5H A;  2QKI C;  2HDL A;  1STE A;  2EYM A;  2IPK D;  4A3M B;  2KVM A;  4CGY B;  3OIQ A;  2D2C C;  3MWY W;  2RVL A;  3A8J E;  3VA7 A;  2KUM A;  1TQO A;  1EU4 A;  4HN7 A;  4PV1 C;  2MGS A;  3DEP A;  4DFA A;  4XIG S;  2K01 A;  1VMP A;  4KKS A;  2LMC B;  1SYG A;  1EIH A;  4CJ0 B;  2E2D C;  5C4H A;  3PUV A;  4HTH A;  5T1I A;  1SFO B;  1HFN A;  1SJH D;  2NUC A;  1PTO B;  1B9M A;  4C3J B;  1A3V A;  1PFM A;  1JOO A;  3PO3 B;  3J81 L;  5KRU A;  1HFG A;  4BS9 A;  2O4X A;  4L6T B;  3T56 B;  2RKS A;  4FVM A;  1FGB D;  1HCZ A;  1CZW A;  4J6H A;  2JSO A;  4X3S A;  1PRT F;  1LV9 A;  2IWH A;  3MEH A;  1Z6H A;  3LWE A;  5KIX A;  4KI0 A;  2A6E D;  1PZI D;  3DXJ C;  1K8O A;  1W6K A;  2F0O A;  4K14 A;  4Y7N B;  1ZXT A;  4X3T A;  3VR3 A;  1I4G A;  5E1F A;  4ZLT F;  1UEA B;  2A73 B;  3TSS A;  1GUG A;  3BDL A;  5IIF A;  1B53 A;  2PCF B;  2B2U A;  4BBR B;  1X3P A;  1HA6 A;  2EVB A;  2EE1 A;  5C3X A;  1EYA A;  5FLX L;  2EJG C;  4U68 A;  1GUS A;  2F0V A;  2MP1 A;  3GQB A;  3J7Y W;  4KY5 A;  3PUZ A;  5C5M A;  1XX8 A;  4A3D B;  4ME5 A;  3VR5 A;  2N55 A;  3LWU A;  1A3U A;  4HR7 B;  1KNA A;  4HMJ A;  1V1P A;  3NXW A;  1DOL A;  1VF5 C;  5M3M B;  1TWH B;  2A6E C;  1PYW D;  5J1Z A;  1VF7 A;  3CRK C;  2EY6 A;  1ONL A;  4FYD A;  4O42 A;  5D3I B;  2YU9 B;  4IAL A;  1LAC A;  2B2Y C;  4RGO S;  2NB0 A;  1DYQ A;  1IKM A;  2HQE A;  1JOR A;  5JPN C;  1U9R A;  1PTO D;  3TDQ A;  1TWC B;  2BOS A;  1D5M C;  4XQQ A;  2O2L D;  1WTW A;  2BDO A;  1AEX A;  3SK5 A;  1V1O A;  3NWT A;  4L63 B;  4CJ2 C;  3BDC A;  2Z8L A;  4A3F B;  3BZD B;  5ELC A;  1CI3 M;  1RD9 D;  1I6V C;  4KN7 C;  4G4K A;  1JC7 A;  4F88 A;  3TZU A;  1SNQ A;  1LAB A;  1BUV T;  1Q1B A;  2ZXR A;  4ID6 A;  3VR6 A;  1JQY D;  1EQV A;  4C3I B;  2Q8T A;  1IL8 A;  5EQ0 A;  2B2V C;  1CHQ D;  3P7J A;  1ICW A;  3AB9 A;  1PTO C;  1PZK D;  5CYU A;  4K2L A;  1WTX A;  3X3N A;  2VB3 X;  3ND8 A;  4EQP A;  3I70 A;  2M2L A;  4ODG A;  3GTJ B;  3KBX A;  3P20 A;  3N52 A;  1WD1 A;  2D5D A;  5IOC A;  1TU2 B;  3QIA A;  4R9W A;  3Q22 A;  4IUP A;  1VCI A;  5T1G A;  1ENA A;  4V19 0;  1T5X D;  1I3Q B;  3I73 A;  3VYU A;  2AQ2 B;  1EY9 A;  1F9S A;  3R93 A;  3S1N B;  1ZEQ X;  4X3K A;  4K6L A;  2AUK A;  2AWN A;  2KCC A;  1V43 A;  4ZKC B;  2Q8I B;  3IFD A;  2XSC A;  1O80 A;  1GHK A;  3PIP 3;  1NUC A;  3MTS A;  3DUZ A;  2D62 A;  4XYQ A;  4WOR A;  5ELF A;  2B2Y A;  3NPP A;  3IAY A;  2A68 D;  1EYD A;  4DF7 A;  4ULL A;  5JOB A;  2RBM A;  4KMU C;  2K6A A;  4ZK9 B;  1F2Z A;  5I9P A;  1TY0 A;  4BY1 B;  1SJE D;  2RA4 A;  1SNM A;  3K6O A;  5CV6 A;  3J80 E;  1BCP B;  4TQU S;  1SMY D;  2PPB C;  2NVT B;  1LTG D;  2IW3 A;  2R61 A;  1HUM A;  4UAI A;  3FMC A;  5K5P A;  2JEA I;  3L9A X;  4HSP A;  3R3O A;  3D6W A;  3V96 A;  5J22 A;  2KQ3 A;  1RCV D;  3K59 A;  1HRJ A;  2XRS D;  1FD7 D;  4KK7 A;  2X6L A;  1FR3 A;  3MXN A;  4X3U A;  2OF1 A;  2DY8 A;  3M7N A;  1SMY C;  1UNS A;  3KBG A;  4XTC S;  5M5Y B;  2EJM A;  3O13 A;  2ZT9 C;  4G57 A;  1QE6 A;  4F8M A;  1Y8O B;  2J4X A;  3MXP A;  5CGK A;  2BE5 D;  1SDF A;  1KAB A;  3A8K E;  2KEE A;  1D2B A;  3S15 B;  4A3B B;  4TSS A;  5K36 H;  1QG7 A;  1S5C D;  3J80 L;  5C0X J;  1SYC A;  1EZ6 A;  1AFP A;  3T4A C;  3RD4 A;  1CA6 A;  4G7Z C;  1SNC A;  2O5J C;  3EVQ A;  1EFI D;  5LL6 X;  4XYO A;  3D4W A;  1SE2 A;  2TSS A;  3FRP B;  3SK4 A;  3U9S A;  4RWS C;  1RHP A;  2NN6 I;  1MBY A;  1YNN D;  4WRD A;  4NMZ A;  5K36 G;  5CV5 A;  2BE5 C;  2XN9 C;  2G9D A;  1NR2 A;  1STA A;  3HOW B;  2L0C A;  4IUV A;  1PRT B;  4XDX A;  1GXD C;  1H9R A;  1SE3 A;  1K8M A;  1QOH A;  2BDN A;  4I7Z C;  2F0J A;  2IT1 A;  1SBB B;  3E0J A;  4IZ8 A;  1O78 A;  3TN2 A;  2L11 A;  4IUQ A;  2NN6 G;  2R6G A;  1TS3 A;  3FKI B;  4LK1 C;  1TS4 A;  1BCP F;  2YYZ A;  4HAE A;  2RDG A;  3SXH A;  1D5X C;  1OXX K;  2K28 A;  3E5S A;  2XIW A;  2B2T C;  2AQ1 B;  1ZYR D;  4RHS A;  1C8C A;  4K2K A;  3ONA B;  1DD2 A;  2HUG A;  2DNE A;  3IFT A;  4DK1 A;  1CHP D;  2EOT A;  2QCP X;  3I3C A;  4GZY C;  5KNB A;  4CJ1 B;  4DXF A;  2LS0 1;  4B08 A;  1LTB D;  4PMC A;  1EY4 A;  2K5D A;  3MXG A;  3QG1 A;  2WII B;  2ZXO A;  3FPP A;  1AZQ A;  4MN3 A;  3VA5 A;  3DHQ A;  5COR A;  2L9H A;  4PNY A;  4DNR B;  4RCO A;  3WOF A;  1KNE A;  2X69 A;  2WAC A;  1ZYR C;  3TME A;  1AN8 A;  1PMR A;  1T5E A;  1R4Q B;  1H9K A;  4UDU C;  4PQX A;  4A3G B;  3P1H A;  2R92 B;  4WJW A;  1F2Y A;  1PRT D;  3KLS A;  3FPU B;  3PIO 3;  2J7Z A;  4IFD J;  1HQM C;  2WKD A;  2E75 C;  2WIN B;  2NVY B;  5EKL A;  2F0U A;  1I4H A;  3L7Z C;  2VNU D;  4NKL A;  3DWP A;  1Y8P B;  1MSH A;  1KTK A;  4FXG C;  2QIL A;  4CKE A;  1II3 A;  1TII D;  3HOY B;  2SOB A;  2XNA C;  3OPO A;  2CW0 D;  3T53 B;  1WD0 A;  1TS5 A;  2F0M A;  1PLF A;  5C0X I;  1PRT C;  2F3V A;  5C0X H;  5D14 A;  5G3L F;  4MHE A;  2B2T A;  4EGV A;  2EDG A;  4LAA A;  3WDN A;  2XWB B;  5C4J B;  4V0B A;  2EJF C;  1HHV A;  1EU3 A;  1SE4 A;  3BYT B;  4EQO A;  4Q5V A;  4KN4 C;  1TWG B;  3BVM A;  3GO5 A;  1PXU A;  2VUM B;  1EQT A;  4NW2 A;  1JWM D;  2DN8 A;  1QNU A;  3HG9 A;  1S5B D;  4RGM A;  3ND9 A;  3F2U A;  5C0X G;  3R2T A;  1EZ8 A;  2H1E A;  3Q0A A;  3SEB A;  4CKB A;  2E76 C;  4KV6 A;  2A74 C;  3EA6 A;  1BR9 A;  5I9O A;  3VYS A;  3ERQ A;  3K7A B;  4KKU A;  3KLR A;  3S14 B;  2L5T A;  2NYZ D;  1JB3 A;  3I8Z A;  2OT2 A;  2F0Q A;  1STY A;  3FVQ A;  3BDO A;  1TKW B;  3JAM E;  4A3I B;  4KHV A;  5F2D A;  2EYF A;  4OHJ A;  1UAP A;  3S1M B;  1U4L A;  5FO8 B;  3HRZ C;  3S9W A;  1A15 A;  1HQR D;  3D6C A;  1I6H B;  1GUW A;  2QDB A;  3S1Q B;  2B2W C;  3DWQ A;  1Y1V B;  5IOD A;  2BCO A;  1DM0 B;  3BVZ A;  5I2Y A;  3A54 A;  3NTI A;  2CQA A;  3T13 A;  3I4L A;  3RZO B;  1YNJ D;  1I4X A;  1EY7 A;  5ISR A;  3M3Y B;  4G7H C;  1O7Y A;  1WTR A;  4ZUJ A;  4DGZ A;  4FF3 A;  5FO7 B;  5D65 A;  4QIW B;  4FF1 A;  1STN A;  3PUX A;  5C5L A;  1KLG D;  1D1I A;  1SYE A;  4M1U B;  4KJO A;  3GD7 A;  4LJZ C;  5IT9 E;  5IGB A;  2B8G A;  1ZKO A;  1X32 A;  2JEB I;  3A8I E;  3AMU A;  3BG3 A;  1CFM A;  2PZW A;  2V4D A;  3AU7 A;  1F9R A;  1NSN S;  3VR4 A;  1HTL D;  1SYD A;  2JA5 B;  1DXM A;  3HZX A;  2L4N A;  4IFD I;  1C4Q A;  4IUU A;  2KHS A;  1G2T A;  3VR2 A;  1YNJ C;  4FO2 A;  4E6I A;  4IFD H;  2XWJ B;  2B39 A;  5E3F A;  1WTP A;  1EWH A;  4KJN A;  1AW7 A;  4L8J A;  3DM1 A;  2MHV A;  3TBI B;  1LTT D;  5JVG 3;  3VYR A;  4KHZ A;  3Q6S A;  2E2I B;  3HOU B;  1WTO A;  1Q3L A;  5CV7 A;  1EEF D;  2K7V A;  3A56 A;  3IKJ A;  1NCV A;  1EY8 A;  2SNM A;  3PV0 A;  4IFD G;  1PFB A;  4RFB A;  5KYL A;  3HOZ B;  4JBW A;  4OGQ C;  2A6H D;  1B3A A;  2OEO A;  2KEC A;  3HS0 C;  1OXT A;  3H0G B;  3ITP A;  5I6W A;  1Q8I A;  1OO9 B;  3K57 A;  3VYT A;  3SDZ A;  2B2W A;  1IKL A;  1DOK A;  1ET6 A;  3GTM B;  1F2M A;  2F3W A;  2PQE A;  2K1B A;  1E0B A;  2G9H D;  5DM6 3;  2E2H B;  3N6R A;  1GOZ A;  3KUP A;  1KDA A;  2F0K A;  2JA8 B;  3U9O A;  1O7Z A;  1ENC A;  3MC0 B;  3IL8 A;  2B8F A;  3D31 A;  2HCC A;  1RTO A;  4K5W A;  3K5N A;  5CR3 A;  2D9U A;  1EY0 A;  2FIN B;  1E2Z A;  1TS2 A;  3NTK A;  1LLR D;  1Q90 A;  1H9S B;  3CKI B;  2AWO A;  2BA1 A;  3J7A F;  5E4X A;  3MFY A;  2PMZ B;  5A2Q E;  2A6H C;  1HPC A;  3H6M A;  1MI2 A;  5C3W A;  4QCL A;  1IYU A;  2A68 C;  3K5L A;  1WTV A;  2ICE C;  2IJ0 A;  2JE6 I;  4KKT A;  2F0D A;  3H91 A;  3TP5 A;  5I6Y A;  3SR1 A;  1CA5 A;  5EBD A;  1LO5 D;  1HUN A;  1I4Q A;  4H0L C;  1CK1 A;  1SYB A;  4CHT B;  3SK6 A;  1U4P A;  2I07 B;  1QB5 D;  5FK9 C;  2QF7 A;  3A7A B;  3K5O A;  3M4Y A;  3T16 A;  1HA5 A;  2PZU A;  4A93 B;  3R8B A;  1STB A;  3C1F A;  4QUF A;  5EKI A;  1KAA A;  4RKL A;  1B44 D;  3NWS A;  3GTP B;  1B4O A;  3DWA A;  4DU9 A;  1K83 B;  4RCN A;  1TWA B;  3TP8 A;  5KEE A;  3RUZ A;  1F77 A;  3DMU A;  4QUC A;  1Q12 A;  4DNT B;  3W2D A;  1ENF A;  2F0L A;  2M9V A;  3H09 A;  1BXT A;  2F0H A;  1SAP A;  1I4P A;  4DAP A;  1DJR D;  1BCP D;  2F0P A;  4BBS B;  4C1N I;  5JEA J;  1R9T B;  1X3Q A;  5CMD A;  2NN6 H;  3PO2 B;  4TRD A;  5ELE A;  3D4D A;  4RA8 A;  4ZQ3 A;  3BS1 A;  3I4N B;  2PZT A;  5NUC A;  3OMC A;  3MA2 B;  1FNW A;  5KNC A;  4F7X A;  4OL7 A;  5M5X B;  3I72 A;  3D3R A;  3QOL A;  2ID0 A;  1G29 1;  1HXY D;  4FF4 A;  1JWS D;  4QF4 A;  1VDZ A;  5JVH 3;  2MJ8 A;  1DCZ A;  2B63 B;  4HCE A;  2K33 A;  5KYI A;  2F0G A;  1BCP C;  3OWE B;  2K32 A;  3UI2 A;  1Z47 A;  2L55 A;  4DXG A;  5A35 A;  1JR0 D;  2FMC A;  1YNN C;  3K58 A;  1SEB D;  2EYL A;  3I90 A;  3S1R B;  2DNC A;  1GUT A;  2MUY A;  2RDH A;  2VB2 X;  3C46 A;  5EPL A;  4C3H B;  1EOT A;  2F0W A;  2A69 D;  3RZD B;  1A6X A;  4ZUI A;  5C44 B;  1CM9 A;  2O5I C;  2WB1 B;  4XQN A;  2JA6 B;  3K0Y A;  4KTA A;  1GHJ A;  3J81 E;  3KK7 A;  3OMG A;  4BY7 B;  2ICI A;  2KOL A;  2F0S A;  3GTO B;  5AFW A;  2RSN A;  5BN4 A;  2KA7 A;  4XXE A;  2WKC A;  4CBV A;  4DAV A;  1CTM A;  4RAU C;  3I91 A;  3D4R A;  4C56 C;  3GTG B;  2FMM A;  4S3S A;  1W6J A;  1WTQ A;  2PO4 A;  5IGE A;  3NQI A;  1FNU A;  2LKV A;  2NVQ B;  4FNF A;  1B1Z A;  1GUN A;  2NTS A;  2F03 A;  2NZ1 D;  2RSO A;  2A69 C;  3A55 A;  2NTT A;  5G3L D;  1RF2 D;  5FLX E;  4OO1 I;  3DEO A;  4NDX A;  3QOJ A;  1U4R A;  4OO1 H;  5CV4 A;  5CBE E;  4NP5 A;  4DN4 M;  2KCN A;  4WFN 3;  3NTH A;  1XTC D;  2Y0S B;  2R93 B;  1LT5 D;  2K04 A;  2HDM A;  4N9P A;  1B2T A;  3GV6 A;  1VMC A;  3CQZ B;  5BN3 A;  2F0N A;  2ZXP A;  1FNV A;  1Y1W B;  3QJY A;  2FFK B;  2IX0 A;  3BYY B;  4CKC A;  1J8I A;  2L1B A;  1BF4 A;  1TVX A;  4BA1 I;  4OO1 G;  5FO9 B;  3Q24 A;  3GTQ B;  1JE4 A;  4IUN A;  3T51 B;  3HKZ B;  3HEJ A;  1PDQ A;  5KND A;  2SNS A;  5EBC A;  4TKO B;  1ESF A;  2L12 A;  5CV8 A;  1JWU D;  1R4P B;  3OSO A;  2K5Q A;  1F2L A;  2JXM B;  3HOV B;  3NE5 B;  5KGU A;  1H9J A;  1H9S A;  1Y69 U;  4YIJ A;  5CC4 A;  1BO0 A;  1OXV A;  1RJT A;  5DM7 3;  5JEA H;  1EIG A;  4FF2 A;  4I65 A;  3Q23 A;  4RHR A;  5JPM C;  1A3T A;  1SYF A;  3TP7 A;  3S17 B;  2CHB D;  1ET9 A;  1EWC A;  1HTP A;  2WP8 J;  1TY2 A;  2CW0 C;  3OHX C;  2VXW A;  2HCI A;  3E6Z X;  4RGT A;  1JOQ A;  2F1M A;  2OXP A;  1EL0 A;  2NBF A;  1L0Y B;  2F0T A;  3P75 A;  1AP0 A;  4R8N A;  2H4O A;  4PMB A;  2KED A;  2SDF A;  5CV9 A;  2XVS A;  3QWN A;  5JEA G;  1SNO A;  1PZJ D;  2NVX B;  4ZKB B;  1CQF A;  2PW7 A;  3ERO A;  2F0F A;  1ILP A;  3CHB D;  1J9O A;  3M7G A;  3PUW A;  4Z9C B;  1EYC A;  1Z7T A;  5DNF A;  2F0I A;  1DZ1 A;  3LX0 A;  3V2T A;  1SND A;  1A2T A;  3HOX B;  3GP7 A;  1I50 B;  3D8G A;  5COY A;  2WV6 D;  3NQT A;  2F4I A;  4C3H G;  1H9M A;  1LTS D;  1SXT A;  5EKK A;  1GUO A;  1DON A;  1QNK A;  3MAQ A;  4B9X A;  1EY5 A;  1JOK A;  2JA7 B;  1OXS C;  4RKB A;  5BN5 A;  4BA2 I;  2EYJ A;  2K5W A;  4KD3 A;  4EQN A;  2EY5 A;  2Z1C A;  1M4V A;  1D1K A;  4G7O C;  2EZV A;  5C4X B;  2J0T D;  1WVL A;  2IX1 A;  2MPM A;  3NUC A;  1PFN A;  2K03 A;  5FOB B;  4ZRZ A;  1BOS A;  1ROD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...