1SNOA

Protein stability in staphylococcal nuclease
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
136
structure length
136
Chain Sequence
KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQLLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STAPHYLOCOCCAL NUCLEASE
publication title Coupling between trans/cis proline isomerization and protein stability in staphylococcal nuclease.
pubmed rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 38
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 1996-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1snoA00
2F0FA 5CV6A 1STGA 3OWFA 5M9OA 4K8JA 4K5VA 4WORA 5CV5A 2SNSA 4IUNA 3OMCA 4R8NA 3NP8A 4RKLA 4KY7A 5IGFA 5KYIA 1SNCA 1EZ8A 5C5MA 2EYLA 3C1FA 5EGTA 1F2YA 1SNQA 2SOBA 5I6WA 4H7BA 5C4HA 3S9WA 4QF4A 4EQNA 1IHZA 4ODGA 3T13A 5IGGA 2F0SA 1SYDA 5E3FA 4NDXA 1EY6A 2ENBA 4K14A 4LAAA 4OL7A 2F0HA 2F0OA 3HEJA 5DEHA 4K2LA 4ZUJA 1F2MA 2LKVA 3TP8A 4B9XA 2F0QA 2F0TA 5IOCA 1A2TA 4HTHA 4NMZA 4B9WA 4KY6A 4EQPA 1EYCA 1SYEA 5ISRA 5KGUA 4S3SA 3DHQA 5CC4A 3NQTA 2F0VA 2RKSA 3MHBA 5CV7A 5C3XA 3P1HA 4KHVA 1RKNA 1JOOA 1U9RA 2F0NA 4NKLA 2OEOA 5I6YA 3BDLA 2F0WA 2O4XA 4J6HA 4J1MA 4HMJA 5E1FA 3EVQA 3LX0A 3OMGA 4IALA 4ME5A 5IGBA 5KYLA 1STAA 1STNA 2PZTA 5CV4A 3BDCA 3NK9A 2EY1A 2NUCA 2F0GA 3D8GA 3QB3A 3R3OA 3D4WA 5JAVA 4E6IA 1A3VA 1EYAA 2F3VA 3MVVA 2OF1A 4K8IA 4KJOA 2EYJA 2F0LA 1JOQA 3TP6A 3HZXA 5C5LA 4KY5A 5C3WA 1EY0A 3VA5A 2KHSA 4KD4A 4N9TA 2F0UA 2F0IA 4QMGA 1EZ6A 2EXZA 1EY4A 2EYMA 1TR5A 2EY5A 2EYPA 1AEXA 2WACA 4K5XA 5DAUA 5HGTA 4F8MA 1II3A 1JOKA 3SHLA 5CGKA 5K5PA 1EY5A 1SYBA 2SNMA 5J22A 1KABA 5HURA 3SR1A 4ID6A 2HQEA 2RBMA 2EYHA 4K6DA 5KEEA 5CR3A 5KIXA 3ITPA 3NUCA 1SYCA 3C1EA 5J1ZA 3TMEA 5I9OA 4KTAA 1NUCA 3MEHA 3MXPA 3SK5A 4PMBA 3TP7A 4K5WA 4N9PA 4WRDA 5EKKA 1TT2A 5C6AA 4DU9A 2QDBA 2RDFA 3QOLA 3SK4A 3U9OA 1STBA 1A3TA 1STYA 2F0PA 5IODA 1SNDA 1SNPA 1EY8A 5CV8A 2PYKA 5I9PA 5IGDA 4TRDA 3T16A 1KDAA 3ERQA 4MIUA 2EY2A 1EQVA 1EY7A 3D6CA 4EQOA 3EJIA 3MZ5A 3NHHA 4IZ8A 3P75A 4EVOA 4K2KA 2F0KA 1A2UA 2F3WA 3EROA 4QB4A 1TQOA 2F0MA 3SK6A 1EY9A 5CV9A 3PMFA 2F0EA 2PQEA 3QOJA 1KAAA 1SYFA 4G57A 2EY6A 5EKLA 1JORA 3OSOA 3RUZA 2KQ3A 4KV6A 2PZUA 4PMCA 5J39A 1A3UA 1ENCA 4KJNA 4ZUIA 4DF7A 2OXPA 5C4ZA 2PW5A 4F7XA 3SK8A 3D4DA 5IGEA 4DGZA 2EYOA 2PW7A 5IGCA 3NXWA 1SNOA 1SNMA 4ZQ3A 3TP5A 2M00A 5JOBA 1KDBA 2F0JA 3E5SA 4DFAA 1ENAA 2PZWA 5F2DA 5NUCA 1KDCA 4PNYA 4NP5A 4YIJA 2EYFA 1SYGA 1EYDA 1STHA 5IIFA 3V2TA 1NSNS 3DMUA 4HMIA 4KD3A 3SXHA 3H6MA 4I65A 5KRUA 4RKBA 2F0DA 1F2ZA
chains in the Genus database with same CATH superfamily
2F0FA 3F8TA 2UUBQ 4TSSA 3PO2B 1DXMA 4OO1I 2B39A 4M8AA 2AQ2B 1LV9A 2UU9Q 3HOXB 1F2YA 1SNQA 4IPHA 3G71A 4I7AA 1IHZA 3T13A 1K8GA 5A35A 3LWUA 1VQ7A 4JV5L 4LF8L 1IXRA 3H3VC 3K0XA 3MFGA 2CW0C 1XPUA 3PO3H 2HUGA 3FPUB 3UDXA 2QKIC 4IJHA 4FP5D 3T1HQ 1U9RA 5FLXE 4A3DB 2WINB 2AWNA 1S4ZA 5M5YB 5KNDA 4K0KQ 1BBXC 5EAYA 2UUAQ 4HIDA 2K03A 4LF9L 3PO3G 2ZTEA 2XIWA 3D4WA 1QVGA 3I56A 1J5EQ 2OF1A 1ICFB 3TP6A 5C5LA 2TSSA 3FMCA 3HOVB 4DUYL 2K75A 3HOUH 1LTRD 4N9TA 2F0UA 2ASBA 1PH9A 2EXZA 3RLNA 3KJPA 3PUVA 1XPRA 1K8MA 1AFPA 4F8MA 3SHLA 4JPBW 1N36Q 2PNRC 5ELOA 4YWMA 4L5TA 1HNZQ 1FGBD 3TMEA 2K5DA 3EN2A 3KFUA 3HGBA 1Y8OB 1E24A 3HKZG 1F9QA 2DGYA 5FLXc 3QIAA 4C3JH 4TRDA 2IWHA 1I4HA 2NVYB 1U4RA 1W3SA 4IPCA 4X66L 4P71A 2EZVA 1WCMB 4DN4M 1AE2A 2LFNA 2R7ZB 1ENCA 1LYLA 3SK8A 1NNXA 1UE6A 2EYOA 3Q0AA 1BDOA 1SMXA 3J81c 3Q24A 1SXTA 1KDBA 3GTGB 1WTQA 2DNEA 1ENAA 3FVQA 4JBWA 3GTJB 4NP5A 1FR3A 1EYDA 2VW9A 3V2TA 2RCFA 4HMIA 1O7YA 3SXHA 3H6MA 3I4NB 3HOZH 2XGTA 3PSIA 1K8AC 3CPFA 3A5UA 4IUVA 1SE2A 3C1FA 1PMRA 5I6WA 2K28A 1VCIA 2WAQB 3HOZG 1YNXA 3NTHA 2NTTA 4ZUJA 1WYDA 5DM73 2F0TA 1X9NA 4JI3L 4NMZA 3S2DB 5ELFA 1L1OB 2KHJA 5I2YA 1AN8A 1B8AA 1XXGA 2FHTA 2K01A 1DOKA 4L6TB 1Y1WB 4R4CA 1O7IA 4A93G 1MSHA 4C2MB 1YIJA 1EOVA 4HMJA 2OQ0A 4OX9L 4OXPA 4BY1H 2H1EA 3CW2C 3T51B 2I0QA 1YJWA 3FKIB 1PH7A 4GLVB 2E74C 1C7YA 3JAMc 1IYJB 2J0TD 3DM1A 2IX1A 1S5ED 1X54A 2WV6D 2E75C 3VYRA 3Q22A 4O42A 5M5XB 2LY7A 4K5XA 5HGTA 1JQYD 3PUWA 5ELEA 4NW2A 1PFBA 4CKEA 2V4DA 3O13A 4GN3B 3RNUA 1KHIA 3A8IE 3M7GA 2VUMH 1IBMQ 2RQXA 1TWAH 3PUYA 1SFOH 3Q8DA 2EDGA 1KRSA 3MXPA 1L0XB 4PMBA 1QOHA 1WTVA 3PO2H 4JOIC 1D8LA 5EKKA 5G3LD 2WKCA 4YCVA 3HOXH 2JA6B 2OTJA 3H91A 4KK7A 3BU2A 2VUMG 2RCNA 2NN6G 2VXWA 4EVOA 1PH2A 4OIJA 1AZQA 1B7YB 1FNUA 4R4IA 2F0EA 2PQEA 5AJ3L 1A15A 2EY6A 2K32A 3HOXG 1BCPC 2XTIA 2JK8A 3NXWA 4BWGB 1YEZA 4A3DH 1TKWB 5M5YH 3NELA 5F2DA 1K9MC 1BQQT 2VQEQ 2Z1CA 4X62Q 2XWJB 1RTNA 1J6QA 3GD7A 2JN4A 3JC66 2PQAA 3CHBD 1N33L 4A3DG 4L8JA 3E0JA 1RJTA 2EYLA 3HOVH 1CA6A 1DJRD 1V43A 2GVBA 2L0CA 4LFAQ 4C3HB 1MJCA 2KVMA 3L2PA 1U4MA 3M85A 3S1RB 2RSNA 1X55A 1L0YB 1F9SA 3VYUA 2BOSA 3BZDB 5IOCA 4JI6Q 4HSPA 2L12A 2JA5B 1JB7A 1B4OA 4KY6A 3T56B 3UE0A 3J7AV 3VDYA 4FF1A 2LSSA 1HR0L 3NTKA 3RD4A 1GVPA 3QG1A 3WOFA 2L9HA 1AW7A 4POFA 3IRBA 3QWNA 4R1JA 2JA8B 3SDZA 1X3QA 3NWSA 2UUBL 5E1FA 4I7ZC 2ZJRA 1H9JA 1HH2P 2NVYH 3I91A 5CV4A 2EY1A 1YHAA 1WTPA 1GM5A 2IY5B 3F2BA 4A3BB 1WCMH 3S15B 1JOQA 3F1ZA 3I7FA 3NE5B 5C3WA 1ASZA 1FD7D 4V0BA 4QQBX 2HHHQ 1Q46A 2K4KA 1PZKD 4DR7L 4V190 3GTGH 3T1HL 1WCMG 2X6GA 3J7YW 5CR3A 3I4NH 2R7ZG 4OGQC 5JJZA 4K0KL 4KHPQ 3MXGA 1EYGA 1NJIC 3R93A 1YNND 4CDEC 1I4XA 2RDFA 4FXKC 4DAYA 1SNDA 2CWAA 2EPBA 5CV8A 5BR8L 4HN7A 1J5EL 3G7LA 1HUMA 1CKOA 1TWCH 1FL0A 1F77A 2ALYB 5EPKA 1PHJA 3I4NG 1HNWQ 3DWPA 3DEPA 3NWTA 5CMDA 3SK6A 3GV3A 1GJXA 3OSOA 1D1IA 1NMFA 1WTWA 1QE6A 1HNZL 4FXDA 1Y1WH 5IGCA 1TS5A 4C2MH 1PRTD 4DFAA 5T1GA 1HXYD 1SYGA 1PTOD 3A56A 4R4OA 1EU4A 3QJYA 3GDEA 4GLAC 1D5XC 5EBCA 1EIGA 3FKIH 3M3YB 2F0DA 2FMMA 1Y1WG 2CCZA 3HOYB 5J3BA 1Y8PB 4R8NA 1QWYA 1KAWA 2R92B 3E3XA 5BN3A 3J81i 1I94Q 4LW1A 1LUZA 1E7ZA 1SYDA 5M5XH 2ENBA 3FKIG 5EKIA 1A63A 1F2MA 2CKZB 3CC2A 1S3OA 1SYEA 1IW7C 1F2LA 5CC4A 3MXNB 2JP1A 2XRQD 4JBMA 4JI4L 1EWHA 1Q90A 3AB9A 5IYDG 4N8X1 2B2VC 2JA6H 2O4XA 1Q82C 2PZTA 2NVXB 1JE4A 1VQ4A 3TQYA 1CSQA 3PV0A 4DNRB 4LF6Q 2SEBD 1VQNA 4HJAA 1C8CA 1K8OA 4KJOA 4MTKA 3S14B 3TS0A 2JA6G 3IFDA 4IFDG 4QMGA 1O7LA 4C56C 5IT9E 4Y52H 1WVLA 1AEXA 1PH8A 2A74C 1HCZA 4X3UA 1GUSA 1K73C 3P20A 4L5QA 1PYSB 1SE3A 5KIXA 1WD1A 2VNUD 2VB3X 1NUCA 4CDDC 1DD2A 4N9PA 5GAEC 3K5LA 3K59A 4CHTB 1Q8KA 1YZ6A 2A73B 1G2TA 1VQ8A 5I9PA 4F87A 4C3HH 1DCZA 3T16A 3S1RH 2NVQB 1AE3A 2BH8A 5GADC 2JA5H 3PMFA 1HR0W 2B8FA 1HZ9A 1WJJA 2KQ3A 4XQJA 2AKWB 4ZUIA 3H3VI 1WFQA 4LMQD 4IUPA 2QGQA 5FK9C 1IBML 3HOWG 2JA8H 5NUCA 2JA5G 1YI2A 4C1NK 3DMUA 1XNRQ 1EQTA 5IGGA 4TVAB 2BE5D 5IP9H 2IJ0A 4BXXH 5A2QL 4A3BH 4APVA 3S15H 2B2YC 1LTLA 1EWIA 4DR3Q 2SOBA 2YTXA 5C4HA 2UUCQ 4DAYB 2WB1E 2BH2A 2HCCA 3L9AX 2F0OA 4JI7Q 1W6KA 1JR0D 4A3BG 4Y7NB 2G9DA 1VS0A 1WTXA 5LL6S 3K7AB 3VR4A 4F88A 3PIP3 2ZXOA 2RKSA 2MPMA 2VQEL 4LF5L 4KHVA 1XMQQ 3KBXA 1V1QA 3KF6A 4X62L 4POGA 4XYOA 5COYA 2R3ZA 4J6HA 2JQOA 2XNAC 3M4PA 3VR3A 3W2DA 5D14A 3BDCA 2RF4A 1RCVD 3I90A 5FLMH 3S24A 1WI5A 4LFAL 2C9OA 4OIKA 4N8FA 4ME3A 1A62A 5GAHC 3ICEA 2UXBQ 3RZDB 4JI6L 3OW2A 2EQSA 4DNTB 3A8JE 2K52A 2K05A 2E2DC 2NN6I 3HRZC 5JEAG 5LMNL 5M3MG 2QEXA 5KEEA 3GTQB 4FXGC 1TWGB 1Q1EA 3X3MA 3M3YH 1EU3A 4JOIA 3MEHA 3KYHC 3HOYH 1UE1A 1DOMA 1QVCA 3TP7A 1MD2D 2RVLA 4WRDA 4DV0Q 3TRZA 4IOCA 2R92H 1HZAA 5IGDA 2K33A 1N32Q 3ZJYC 2OT2A 1ONLA 2MNAA 4MIUA 5IGBA 4BY7G 2A69D 3T4AC 2HIXA 3G6EA 2AQ3B 3BVGA 3G48A 4A93B 1KRTA 2HHHL 1T9HA 3IFTA 1H9MA 3CPWA 1ILQA 4PMCA 4DV1Q 4GKJQ 1LT5D 4B3RQ 3K5NA 1FJGQ 4A3EG 2M00A 4KHPL 2F0JA 2PZWA 2ZXPA 2K5NA 4RGTA 2ES2A 2D9UA 1MIUA 2M9VA 3RN2A 2NVXH 2ZM6L 3CQZH 1VQPA 1R9TB 1V1PA 2CW0D 3VR5A 3A8KE 3OPOA 5C0XJ 5FLXL 2DJFC 5FO8B 2I07B 1CHQD 1HNWL 4IUNA 3S14H 5C4XG 5GQOA 1RIPA 2MUYA 1ICWA 3OTOL 1JCKB 4QF4A 4EQNA 2HDLA 4RCNA 2HD3A 3HS0C 1G8ZD 2NWGA 5DEHA 5FOBB 2HDMA 2A5HA 4B9WA 2A69C 5ISRA 1KNAA 4L5RC 1STEA 5ELCA 1Z7TA 3MHBA 4DA2A 3A5ZB 4JCVE 3F2DA 4CJ2C 4FO2A 1EWCA 3CCEA 2Q2IA 4A3GB 1X3GA 2VQFQ 2B63B 1XMOQ 4RHRA 1EQQA 1CSPA 2NVQH 1OXVA 2CQOA 2I5HA 4DAVA 4U68A 1I94L 5IWAQ 2JA7B 3NBHA 4E6IA 1LTID 4BS9A 3CXCA 1LABA 4A75A 2NB0A 4HEDA 2CH4W 4LFBQ 4FVMA 4LWCA 1PDQA 1HQRD 2NTSA 2WB1B 4PZ8A 1CQFA 4JI5Q 3PQIA 3AYHB 1GO3E 2N3SA 3K7UC 3HKSA 5JJLA 4G7OC 1F9PA 1XJVA 3R2IA 2K6AA 4A3IB 4IFDJ 5EJWA 1TWFB 3C3LA 1KQSA 1LO5D 2D0OA 3ITPA 4BA2I 5JPNC 3NPPA 2H4OA 3DM3A 4K5WA 2B2UC 1TXYA 4UAIA 1VQFA 1BBUA 4LF6L 1NR4A 1VQEA 3KF6B 2N55A 4RGOS 1O7ZA 4R4TA 5CBEE 3SVMA 1VQDA 2C35B 2Z4IA 2EJMA 3I3CA 5CYUA 4DXGA 2JYOA 3JAML 1LTAD 4Y7NH 1PA6A 1JORA 1KAAA 3RUZA 4A3MG 1JJCB 1Z9FA 3LGJA 4DAPA 3KF8A 1BVSA 3D4DA 3OIPA 5JJIA 5EPJA 4AQYQ 1TS4A 1YJNA 2EIFA 1I4GA 1Z47A 3FP9A 4X65Q 4KD3A 4RKBA 5IP7H 1F2ZA 2RHSB 3KOJA 2EOTA 3I55A 3NENA 4ZKCB 2Z6KC 4NB3A 1EL0A 5JJKA 5EGTA 3RZDH 4H7BA 1GXDC 4LF7Q 3RZOB 4QL5A 4DXFA 5GAGC 4LAAA 5IP7G 5LMNW 3I4LA 2QDLA 1TY2A 3H3VH 1Q7YC 4P72A 3STBD 3AMUA 3D3RA 3GTQH 1TWGH 1CI3M 3DHQA 3FDTA 1SR3A 2PI2A 5C3XA 1UEAB 1ESFA 5ELBA 1XNRL 2B2VA 1JOOA 4WJ4A 2PI2E 4FF2A 4IFDI 1BF4A 3A54A 1HNXQ 1HTLD 2F0WA 3J81j 3K57A 4J1MA 1B1ZA 1I4RA 4ILWA 4ME5A 1STNA 3K81C 4DR3L 2F0GA 5IYBG 4XDXA 2UUCL 2IX3A 3BG3A 4A93H 1V1PB 3J7ZC 4JI7L 1B3AA 2SDFA 1YHBA 4A3FB 4LNQA 5M3FG 4FF3A 1KC8C 4X64L 4YHHQ 1CZGA 4QCLA 2L1BA 4AH6A 1C0AA 1UE7A 2MO1A 3KUPA 1XMQL 3VR2A 1SROA 3GO5A 3KK7A 3S2HB 3A7LA 3U58A 1AP0A 4IO9A 1R4QB 1SMYD 1R9TH 1XTCD 3BVZA 5I9OA 4KTAA 1G6ZA 3CCLA 3STBC 4IPGA 1BCPD 2RA4A 3SGIA 5JEAJ 1TU2B 3U9OA 4P74A 1STYA 4QGUA 5M5WB 1VQLA 4AIMA 1M1KC 4L5SA 1GUWA 1I6HB 2NBFA 2E2IH 4CKCA 2K5HA 2EJFC 3WOEA 4EQ5A 3NBHB 3I4OA 3N6RA 4KV6A 3K0YA 2K5QA 3K8AA 2ZTDA 2NN6H 1X3PA 4C3IG 1D5MC 1E2WA 1K0RA 4GKKQ 1JICA 1SNMA 4ZQ3A 3WWVA 5ELNA 5FO9B 3RR5A 1VMCA 4XT1B 4IJLA 4XTCS 4A3GH 1T5XD 1D2BA 1ET6A 4DV0L 4XIGS 2MGSA 3W3AA 3M7NA 3OIQA 3M4OB 1K28A 2EXDA 4AYBG 2B2YA 2JA7H 3T1YQ 3OWFA 1N32L 4DK3C 4DK0A 2MQHA 4K8JA 3UE1A 3OMCA 4DR4Q 3NP8A 5IGFA 1SMYC 4KI0A 1H9KA 5C5MA 4A3GG 4DV3Q 2B2WC 1HA5A 2B63G 1ZYRC 1VQOA 1H9RA 4DV1L 2ZXRA 4A3LG 3V05A 2JA7G 2NVTB 1U5KA 4GKJL 4B3RL 4BBSG 4A3IH 1FJGL 1QB5D 1VDZA 2R7DA 3IAYA 1PFMA 4LFCQ 1GHJA 3S1QB 5HGQA 3ULPA 2F0VA 2WB1G 1OXUA 2F4VQ 3GTLB 1VF7A 3KF8B 5I6YA 2RDGA 4Z9CB 1CUKA 4A3IG 2KA7A 3LX0A 5KYLA 4DV7Q 5H1SE 1I50B 3L7ZC 2NZOA 3HOWB 1E22A 3AEVA 2OWOA 2X6LA 1JWSD 3VA5A 4KD4A 4YY3Q 2EYMA 2EYPA 1JOKA 1XTDA 4OEMB 3CCJA 3ER0A 3J80E 3BVMA 3CCMA 2L55A 2F03A 3K58A 3C1EA 3CF5A 1VQHA 1Q86C 2UU9L 5FJ8H 2VQFL 1A8VA 1HHVA 3QO2A 1XMOL 1TY0A 1QZHA 5IWAL 1X6OA 5L37A 1XYIA 3MEFA 2R7ZH 1PRTB 4PZ6A 2ZTCA 4H13C 2D0PA 2EY2A 1HFNA 4LFBL 3MZ5A 3DXJC 1OXSC 1PTOB 5FJ8G 1IKMA 1B2TA 1EY9A 4K6LA 3AFPA 1C9OA 2JXMB 3GTJH 4JI5L 4DAMA 4DPGA 3M9BA 2Z0SA 4CJ1B 4A3KG 5C44G 1RD9D 2PW7A 4JI2Q 2UUAL 4WJWA 1H9SA 4UDUC 1QZGA 1HZCA 1KDCA 3J80c 4I65A 2D5DA 2UXDQ 1STGA 4DKAC 2R61A 3VA7A 1IW7D 5CV5A 2YU9B 5C0XH 1D1KA 3EA6A 4LUOA 4FYDA 1CZWA 1KXLA 4A3FH 3S2DH 5M3MB 1N36L 2KCMA 3PCOB 1VQ9A 2N49A 3HEJA 1V9PA 1W6JA 2LKVA 1MI2A 1A2TA 2AQ1B 5C0XG 2WFWA 4IUTA 5IYCG 4AQYL 3S2HH 3TEHB 4A3FG 1J8IA 2A1AA 3RN5A 1UAPA 1VQIA 5IT9L 1KD1C 4BY7B 2G9HD 3W1BA 4X65L 1K0SA 3H09A 3M4YA 5M5WH 3RMHA 4DNIA 1I6HH 1XWEA 3AQQA 3AFQA 4LF7L 3I4MG 4NXNQ 4A3EB 1D7QA 2ZJQA 5IYDH 1CFMA 5E4XA 1Y14B 2VY3A 3TZUA 5DAUA 2FXQA 4JI1Q 1II3A 1KNEA 2UXCQ 5C4XB 1M4VA 3Q6SA 5BN4A 3EIVA 2WKDA 2EYHA 3CCQA 3FEWX 1EIYB 4IFDH 1NE3A 2XWBB 3M4OH 4MTNA 2PNHA 2A6EC 3NEMA 1WTOA 4JBJA 3S16B 1V1OA 4WJ3M 3HP3A 4QY7A 1FVIA 1OXXK 3N52A 2PQAB 4GLXA 3DUZA 2PPBC 3D6CA 5JPMC 1ILPA 3D4RA 2N8NA 2LS01 2NVTH 3EROA 1CK1A 3DLLA 3KJOA 4YHHL 1SJED 2CVRA 4HCEA 1MJEA 2CFMA 1TIID 3S1QH 1BO0A 5C4ZA 2ICEC 4F7XA 1LT3D 3JAMi 3GTLH 3AU7A 2IHFA 1CA5A 1RL2A 1LTTD 4RMFA 1WD0A 1VQ6A 1GD7A 4IN3A 1TS2A 4YWLA 1YJ9A 5I2XA 5JVH3 2IW3A 1VQBA 1I50H 2K04A 2MO0A 1Y8NB 3PUXA 1ASYA 3HOWH 4CJ0B 3I72A 3P7JA 2Z6KA 4TKOB 2Z9HA 3ONAB 3TS2A 4GN5A 2KOLA 3E9HA 1G91A 4KY7A 3I8ZA 3L3OC 3ZYYX 2KUMA 1GKHA 3PIO3 3BS1A 2F0SA 1PH1A 4AYBE 2F0HA 1SJHD 5IT9c 4GKKL 1IYUA 4HTHA 2C5CA 2L11A 2B29A 4G7HC 5C3EB 1EYCA 1QUQA 1CQVA 3W5OA 3OWEB 1BBWA 4IQZA 2HIVA 4GS3A 1JB3A 3CP0A 1PVOA 1BXTA 1HFGA 4BA1I 2F52A 2MP1A 4ZAIA 1X32A 4A3MB 4IALA 4DR4L 4KKSA 2Q2UA 3BDOA 2K5WA 1B50A 4DV3L 3VYSA 1PTOH 5T1IA 2QCPX 4GOPC 2VL6A 4DV6Q 2IL8A 3HG9A 4KKUA 1WTRA 1UE5A 3NSWA 3U50C 2KHSA 1EZ6A 4NXMQ 4LFCL 2JEAI 3D6WA 3DWQA 2KHIA 5DM63 2F4VL 3TBIB 1GUTA 4ID6A 2XSCA 1VQKA 3HOUB 4FF4A 1AH9A 1H95A 1O78A 1IZ6A 4DV7L 2YTYA 2YU9H 4C1NI 5K36H 2A6HD 2K5VA 3SK4A 5IODA 5JEAH 1SNPA 5M3MH 3C46A 2BA1A 1J9OA 2CHBD 2KEEA 5TSSA 5LHY1 5HY6A 1SEBD 4HSVA 4YY3L 5CV9A 5K36G 2GA4B 4G57A 2PMZE 2HCIA 2A19A 1HJPA 4C3JB 1A3UA 1CM9A 2LXKA 3PF5A 3ND8A 4BY7H 2O5JC 1X3EA 1SNOA 3TP5A 1IBLQ 1K3RA 3EQLC 3H94A 2AUKA 3H15A 2IHEA 2F1MA 5M3FB 2Y0SE 1PH6A 3U9SA 1EIFA 1MBYA 1WOCA 4K5VA 4A3EH 1E3PA 1NR2A 1Q3LA 2A6HC 1EY6A 5E7NA 3DWAA 3CKIB 2F0QA 2TMPA 4FDBA 3TSSA 1B3QA 1JWUD 5C4XH 4JI2L 2FJ2A 2DUDA 4KLKA 4EQPA 4DV4Q 3NTIA 5KGUA 4UP7A 3NQTA 2O5IC 3NBIA 3S16H 3SEBA 1MSGA 2OEOA 3CC7A 1UUPA 1PZJD 4BBRG 2UXDL 4IOAA 1NY4A 2DJGC 1XNQQ 4RGNA 1UEBA 3PIPA 4O2DA 1ET9A 4C3IB 3QB3A 3WDNA 4M1UB 1S5DD 1NMGA 1A3VA 2H5XA 4G4KA 1DYQA 3UDGA 1IBKQ 4K8IA 4Q0FA 2EYJA 4B3TQ 1SE4A 2Q8IB 1KIXA 2R93G 1LTBD 5LMUQ 1S5BD 4AYBB 3MTSA 1U4LA 1EY5A 3ULLA 1BKBA 1MHWC 1V8QA 3D0FA 4J15A 5KNBA 5D3DA 3NQIA 4OWWB 3EFXD 1SYCA 4HAEA 1I3QB 2WIIB 2XVSA 4H44C 3E6ZX 1PRTF 3U4VA 4A3JG 2L4NA 4ALPA 1L2FA 4GNXC 4DUZQ 4IURA 3RLOA 4BBSB 4JG2A 2B8GA 4RAUC 1EY8A 1S5FD 4PV1C 4NXNL 4DV5Q 2AMCB 1YHQA 1SFOB 1M90C 1KDAA 3MFYA 3ERQA 5EBDA 2OCEA 3OW7A 4EQOA 1EY7A 4Q5VA 4JYAQ 4DR2Q 2JSOA 4DV2Q 2KBNA 5EKLA 5C3EH 4JI1L 2L15A 2AHOB 3BYTB 2UXCL 2PW5A 2OQKA 1DGSA 2E2HB 4B3MQ 1LT6D 1UNSA 3CCVA 3TDQA 4A3MH 4ABNA 1SSOA 1EQRA 2VS1A 5E4WC 5IIFA 5C3EG 4DR7Q 1NSNS 3Q23A 4QIWE 5C0XI 3GTOB 3KLRA 1VQMA 3K7AH 2Z8LA 1C4QA 1EIHA 5E3FA 4LUZA 4K14A 4DR1Q 2NYZD 4B9XA 5BR8Q 3TP8A 4K2LA 4CDFC 3J7A5 3S17B 3BZKA 2QEJC 2PMZB 2KECA 4HR7B 3TZDA 1W2BA 4FNFA 4R4QA 3J81E 5CV7A 2PO4A 4ULLA 1RKNA 5FO7B 2D2CC 1GUOA 3KDFA 1A0IA 1L0WA 1IL2A 1IKLA 1STAA 3HOUG 2GVAA 2Y0SB 4A3KB 3R3OA 1FGUA 5C44B 4HJ7A 1Q12A 2F3VA 2BCOA 1CKNA 3HZXA 4KY5A 3BJUA 3GV6A 4RCOA 1EY0A 1UWVA 1BCPB 1LLRD 5IYBH 3IL8A 2EY5A 4UP8A 1BUVT 4IUQA 1SLJA 1KABA 3G4SA 3RLFA 1TVXA 4C3JG 5M3FH 4UY8C 3NUCA 3FRPB 1PYBA 2AUJD 1E2VA 2BDNA 3BYYB 3I70A 3K80C 2CWPA 4WFN3 4DU9A 4KKTA 1VF5C 3FPPA 1QNKA 1STBA 1A3TA 4CDCC 2PYKA 1CHPD 3CMAA 4DV6L 4JI4Q 4DR6Q 1G6PA 1EQVA 3S9WA 1PH5A 2IT1A 4X6AH 3P75A 2F0KA 1A2UA 3JAME 2E2JB 1N34Q 1TQOA 1JJ2A 3V96A 4NXML 4HJ8A 1Z6HA 1I5FA 2E5LQ 4JI8Q 1TWCB 5J39A 2CQAA 4DF7A 1G51A 2Z6BA 5I4DA 2R6GA 2JEBI 4XQQA 3I4MB 4KMUC 1ZYRD 2G5DA 4PG3A 1C48A 1JJGA 1B44D 1YNJD 2Q8RE 2RHQB 1LM0A 4TQUS 1LACA 3A74A 3PF4A 4C3IH 1PH3A 1NAPA 1Q8IA 3VYTA 5M9OA 2UXBL 1PV4A 1N8RC 3K5OA 1DZ1A 3U4ZA 4IPDA 1O80A 2JJQA 2I46A 2XRSD 2X69A 4A76A 2ATWA 4ODGA 4QUCA 3CU7A 1HPCA 4IUUA 2J4XA 3UI2A 4ZK9B 3ND9A 1IBLL 4LF4Q 4DK6C 4BY1G 2B63H 1I3QH 3S1NB 4R8IA 1K83B 4A3LH 4BBSH 4QJFA 3J80L 3GTPB 2V1CC 1FNWA 4OELB 3A7AB 2AWOA 3FHWA 3GTMB 4CBVA 4QIWB 4GOPA 1YNJC 2EE1A 1S40A 1EYAA 4H02A 2KCCA 3F2CA 3KLWA 2XN9C 1TWFH 2EVBA 4G7ZC 4OWTB 1EY4A 1E0BA 3T53B 1ZKOA 4P73A 4DV4L 2E2HH 5D65A 2ICIA 3PO2G 1DM0B 4JI0Q 2K7VA 1XX8A 3MXNA 1HA6A 2ZT9C 4HIOA 1I4PA 1YITA 3ULJA 1XNQL 3SK5A 4J8QA 3GTOH 1K3BC 1B53A 1EOTA 2D62A 2HT1A 5C6AA 3H0GB 1KTKA 4MNOA 4LF5Q 1LTGD 4OHJA 1IBKL 1M8AA 2IPKD 3KDFB 4B3TL 4RA8A 3NHHA 2J7ZA 3S17H 3OYYA 2F3WA 1QILA 3VR6A 4QB4A 5LMUL 2F0MA 4O1NA 4O0AA 1CT1D 5GROA 1L1OC 1WTHA 1CKNB 4MN3A 1I6VC 4KJNA 1JC7A 4KN7C 5DNFA 2B2TC 1B70B 3B6YA 4RHSA 4ZLTF 4DK1A 4PNYA 3HOVG 3X3NA 4DUZL 1GUGA 4A3KH 3RZOH 1ML0D 1LTSD 5C44H 1ZXTA 2B3GA 2HQLA 5LMNQ 1D6EC 4DV5L 1EUJA 4X3SA 1NBWA 1EEID 4JYAL 2Q2HA 3S1MB 4DR2L 1DOLA 2ID0A 3K6OA 4B08A 4DV2L 4OO1H 3TREA 4HJ5A 4JVZA 1RTOA 4R9WA 4CKBA 2Y0SG 1QJOA 4A4IA 3I2ZA 3F2UA 4B3ML 5C4JB 5IY0A 2YYZA 1U0LA 3OOCA 4OO1G 1RDPD 4S3SA 1QG7A 2K14A 1SAPA 5EQ0A 1HZBA 3D31A 1VQ5A 1S5CD 4H0LC 4ZYSA 3BDLA 4DR5Q 3G6JB 5IYCH 1HQMC 1JWMD 2RSOA 3BZCA 4JK1C 4XQNA 3D8GA 2KENA 2E2JH 2NZHA 1QNUA 3MVVA 4JW0A 1PYWD 2ZM6Q 2F4IA 4DR1L 2FINB 1ESRA 2A6ED 1B9MA 4B3SQ 1Y1VB 1CTMA 1TR5A 2WACA 4L63B 3CD6A 3HKZE 3OTOQ 4YWKA 3I4MH 4RH6A 1N9WA 3SR1A 4K6DA 2WAQG 1CKMA 2KEDA 2O2LD 1AZPA 4GNXA 2LMCB 2DY7A 4PZ7A 1TT2A 1OO9B 2QDBA 5DLQE 1TWHB 2L5TA 5AFWA 2DN8A 4P2CB 1VQJA 3R8BA 4YCUA 1QVFA 2OTLA 1T5EA 4K2KA 2N78A 4GOPB 1Y69U 3CC4A 1ENFA 1JMCA 4ZCKA 4EX5A 3QOJA 3LNNA 1YVCA 4BBRB 2JE6I 4JV5Q 1YNNC 4LF8Q 3DEOA 1JE5A 2OXPA 3GTKB 3S1NH 1BR9A 1HNXL 3MA2B 2QW7A 2B2UA 2ZJPA 1K83H 4PMWA 2A68D 4CGYB 3GTPH 3E5SA 1Q81C 5LL6X 4YIJA 3C2PA 2VB2X 3SE0A 3GTMH 2R93B 3MXUA 5KRUA 2K1BA 4NPSA 3GP7A 5CV6A 2SNSA 4DR6L 4RKLA 5KYIA 1SNCA 1PFNA 4UHVA 4LF9Q 1E1TA 2E8GA 3CRKC 1D5ZC 5EPLA 1N34L 1PRTC 3CQZB 1U4PA 3OHXC 4GZYC 2E5LL 3EBEA 4JI8L 1PTOC 4A3JB 4LUVA 4DUYQ 2EJGC 2JA9A 2BDOA 2QILA 1X65A 2K50A 5FKAC 1YBYA 1RHPA 2E76C 4NKLA 4MHEA 3TN2A 3H0GH 1SRUA 1R4PB 3EVQA 3OMGA 4RG1A 2MFIA 5IE8A 2A68C 4HIMA 3CMEA 2NUCA 3CRLC 4A3CH 1BCPF 2F0LA 3H0GG 1PXUA 3KLSX 2BA0A 2GN5A 4HIKA 1ZEQX 3LWEA 4X66Q 3QR8A 4LF4L 1VQCA 4A3CG 2A8VA 4ZKBB 1XPOA 2NZ1D 1PFSA 3CCUA 1A6XA 1SYBA 2SNMA 5J22A 3MAQA 5HURA 2QF7A 3L0OA 1H9SB 2RBMA 3T1YL 4C3HG 4QUFA 3PO3B 4XT3B 3PUZA 4GN4B 3E9IA 5CBAE 1EFWA 2MJ8A 3QOLA 5G3LF 3S1MH 2F3IA 1OXTA 1S72A 2R7FA 1SN8A 1FYCA 2DY8A 2PCFB 1PLFA 5KNCA 5D3IB 3EJIA 4IZ8A 1F9RA 1P16A 2I5MX 2JA8G 1IYVA 3I73A 5C4JH 4JI0L 2IX0A 1HTPA 2PZUA 4ZRZA 3MC0B 4P75A 1HUNA 1OTCA 5IGEA 3MWYW 4DGZA 4JI3Q 5IP9G 3HKZB 4BXXG 1G291 1KLUD 4X64Q 5ELDA 3URYA 4YCWA 4PQXA 2I5LX 4WORA 2M2LA 4OX9Q 4GNXB 2KJXA 1EZ8A 1VQGA 1JT8A 4RWSC 3J7AF 1NCVA 2CH4A 1Q1BA 1Y1VH 4NDXA 3GQBA 4OL7A 4UP9A 1HRJA 2QA4A 1NTGA 1BNZA 1I4QA 1TS3A 3KBGA 3PGZA 2BE5C 3UDFA 4JC0A 4EGVA 1KLGD 3PIOA 1VQAA 1FNVA 3CCSA 5FLMG 4HCSA 1Y1VG 1EFID 3P1HA 1SDFA 2LXJA 4OWXB 2F0NA 3A0JA 4UPAA 1MGSA 2YV5A 5CORA 5A2QE 1TWHH 3W1GA 3R2TA 1BOSA 1SE8A 2B2WA 2P5ZX 3K5MA 1GHKA 3KLSA 3A55A 3NK9A 2WP8J 2RDHA 1RODA 4OONA 1E2ZA 3HOZB 4RFBA 5JAVA 3J80i 1EEFD 3CCRA 4BBRH 3HFZB 1PZID 1X3FA 5JVG3 2Q8TA 3UDIA 3GTKH 4LK1C 2F0IA 4U673 3HOYG 5AJ3Q 1GUNA 1GOZA 5K5PA 5CGKA 2R92G 2Q2TA 4RGMA 2HQEA 4KHZA 4XXEA 4DR5L 2R93H 4HJ9A 4X3KA 1LT4D 5J1ZA 2KCTA 4KN4C 2F0PA 1PH4A 2FMCA 2YTVA 2WAQE 4BY1B 1X56A 1N33Q 2Z4HA 4MZ9A 4A3JH 1SBBB 4B3SL 1L1OA 4X3TA 2VZAA 1SYFA 3ERSX 4XYQA 1VMPA 3E0EA 1IL8A 3CAMA 1P8LA 1RF2D 4JBKA 2B2TA 2N88A 1KL9A 2E2IB 1QUQB 1G2SA 2MHVA 3IKJA 5JOBA 4LJZC 2FFKB 1QCBD 2DNCA 1E1OA 1PTOF 5BN5A 2EYFA 1HR0Q 3M4QA 1MKHA 1STHA 2VUMB 3J81L 1TWAB 2KCNA 1DONA 1B9NA
chains in the Genus database with same CATH topology
2F0FA 4TSSA 3PO2B 1DXMA 4OO1I 2B39A 4M8AA 2AQ2B 1LV9A 3HOXB 1F2YA 1SNQA 1IHZA 3T13A 5A35A 3LWUA 3H3VC 3MFGA 2CW0C 2HUGA 3FPUB 2QKIC 4FP5D 1U9RA 5FLXE 4A3DB 2WINB 2AWNA 1S4ZA 5M5YB 5KNDA 1BBXC 2K03A 2XIWA 3D4WA 2OF1A 3TP6A 5C5LA 2TSSA 3FMCA 3HOVB 1LTRD 4N9TA 2F0UA 2EXZA 3PUVA 1K8MA 1AFPA 4F8MA 3SHLA 2PNRC 1FGBD 3TMEA 2K5DA 3HGBA 1Y8OB 1F9QA 3QIAA 4TRDA 2IWHA 1I4HA 2NVYB 1U4RA 2EZVA 1WCMB 4DN4M 2LFNA 2R7ZB 1ENCA 3SK8A 2EYOA 3Q0AA 1BDOA 3Q24A 1SXTA 1KDBA 3GTGB 1WTQA 2DNEA 1ENAA 3FVQA 4JBWA 3GTJB 4NP5A 1FR3A 1EYDA 3V2TA 3SXHA 4HMIA 1O7YA 3I4NB 3H6MA 4IUVA 1SE2A 3C1FA 1PMRA 5I6WA 2K28A 1VCIA 2WAQB 3NTHA 2NTTA 4ZUJA 5DM73 2F0TA 4NMZA 3S2DB 5ELFA 5I2YA 1AN8A 1XXGA 2FHTA 2K01A 1DOKA 4L6TB 1Y1WB 1MSHA 4C2MB 4HMJA 2H1EA 3T51B 3FKIB 2E74C 2J0TD 3DM1A 2IX1A 1S5ED 2WV6D 2E75C 3VYRA 3Q22A 4O42A 5M5XB 2LY7A 4K5XA 5HGTA 1JQYD 3PUWA 5ELEA 4NW2A 1PFBA 4CKEA 2V4DA 3O13A 3A8IE 3M7GA 2RQXA 3PUYA 2EDGA 3MXPA 1L0XB 4PMBA 1QOHA 1WTVA 5EKKA 5G3LD 2WKCA 2JA6B 3H91A 4KK7A 2NN6G 2VXWA 4EVOA 4OIJA 1AZQA 1FNUA 2F0EA 2PQEA 1A15A 2EY6A 2K32A 1BCPC 3NXWA 4BWGB 1TKWB 5F2DA 1BQQT 2Z1CA 2XWJB 1RTNA 3GD7A 3CHBD 4L8JA 3E0JA 1RJTA 2EYLA 1CA6A 1DJRD 1V43A 2L0CA 4C3HB 3M85A 2KVMA 1U4MA 3S1RB 2RSNA 1L0YB 1F9SA 3VYUA 2BOSA 3BZDB 5IOCA 4HSPA 2L12A 2JA5B 1B4OA 4KY6A 3T56B 3J7AV 4FF1A 3NTKA 3RD4A 3QG1A 3WOFA 2L9HA 1AW7A 3QWNA 2JA8B 3SDZA 1X3QA 3NWSA 5E1FA 4I7ZC 1H9JA 3I91A 5CV4A 2EY1A 1WTPA 4A3BB 3S15B 1JOQA 3NE5B 5C3WA 1FD7D 4V0BA 1PZKD 4V190 2X6GA 3J7YW 5CR3A 4OGQC 5JJZA 3MXGA 3R93A 1YNND 1I4XA 2RDFA 4FXKC 4DAYA 1SNDA 2EPBA 5CV8A 4HN7A 3G7LA 1HUMA 1F77A 5EPKA 3DWPA 3DEPA 3NWTA 5CMDA 3SK6A 3GV3A 1GJXA 3OSOA 1D1IA 1WTWA 1QE6A 4FXDA 5IGCA 1TS5A 1PRTD 4DFAA 5T1GA 1HXYD 1SYGA 1PTOD 3A56A 1EU4A 3QJYA 1D5XC 5EBCA 1EIGA 3M3YB 2F0DA 2FMMA 3HOYB 1Y8PB 4R8NA 1QWYA 2R92B 5BN3A 1SYDA 2ENBA 5EKIA 1F2MA 1SYEA 1IW7C 1F2LA 5CC4A 2JP1A 2XRQD 1EWHA 1Q90A 3AB9A 2B2VC 2O4XA 2PZTA 2NVXB 1JE4A 3PV0A 4DNRB 2SEBD 1C8CA 1K8OA 4KJOA 3S14B 3IFDA 4IFDG 4QMGA 1O7LA 4C56C 5IT9E 1WVLA 1AEXA 2A74C 1HCZA 4X3UA 1GUSA 3P20A 1SE3A 5KIXA 1WD1A 2VNUD 2VB3X 1NUCA 1DD2A 4N9PA 3K5LA 3K59A 4CHTB 1G2TA 2A73B 5I9PA 4F87A 1DCZA 3T16A 2NVQB 3PMFA 2B8FA 2KQ3A 4XQJA 4ZUIA 4LMQD 4IUPA 5FK9C 5NUCA 4C1NK 3DMUA 1EQTA 5IGGA 2BE5D 2IJ0A 5A2QL 2B2YC 2SOBA 5C4HA 2HCCA 3L9AX 2F0OA 1W6KA 1JR0D 4Y7NB 2G9DA 1WTXA 5LL6S 3K7AB 3VR4A 4F88A 3PIP3 2ZXOA 2RKSA 2MPMA 4KHVA 3KBXA 4XYOA 5COYA 2R3ZA 4J6HA 2XNAC 3VR3A 3W2DA 5D14A 3BDCA 1RCVD 3I90A 2C9OA 4OIKA 3RZDB 4DNTB 3A8JE 2K05A 2E2DC 2NN6I 3HRZC 5JEAG 5KEEA 3GTQB 4FXGC 1TWGB 1Q1EA 3X3MA 1EU3A 3MEHA 1DOMA 3TP7A 1MD2D 2RVLA 4WRDA 5IGDA 2K33A 2OT2A 1ONLA 4MIUA 5IGBA 2A69D 3T4AC 2AQ3B 3BVGA 4A93B 3IFTA 1H9MA 1ILQA 4PMCA 1LT5D 3K5NA 2M00A 2F0JA 2PZWA 2ZXPA 4RGTA 2D9UA 2M9VA 1R9TB 1V1PA 2CW0D 3VR5A 3A8KE 3OPOA 5C0XJ 5FLXL 5FO8B 2I07B 1CHQD 4IUNA 2MUYA 1ICWA 1JCKB 4QF4A 4EQNA 2HDLA 4RCNA 3HS0C 1G8ZD 2NWGA 5DEHA 5FOBB 2HDMA 2A5HA 4B9WA 2A69C 5ISRA 1KNAA 1STEA 5ELCA 1Z7TA 3MHBA 4DA2A 4CJ2C 4FO2A 1EWCA 4A3GB 2B63B 4RHRA 1OXVA 4DAVA 4U68A 2JA7B 3NBHA 4E6IA 1LTID 4BS9A 1LABA 2NB0A 4HEDA 4FVMA 1PDQA 1HQRD 2NTSA 2WB1B 1CQFA 4G7OC 1F9PA 3R2IA 2K6AA 4A3IB 4IFDJ 5EJWA 1TWFB 3C3LA 1LO5D 3ITPA 4BA2I 5JPNC 3NPPA 2H4OA 4K5WA 2B2UC 4UAIA 1NR4A 2N55A 4RGOS 1O7ZA 5CBEE 3SVMA 2Z4IA 2EJMA 3I3CA 5CYUA 4DXGA 2JYOA 3JAML 1LTAD 1JORA 1KAAA 3RUZA 4DAPA 3KF8A 3D4DA 3OIPA 5EPJA 1TS4A 1I4GA 1Z47A 4KD3A 4RKBA 1F2ZA 2EOTA 4ZKCB 1EL0A 5EGTA 4H7BA 1GXDC 3RZOB 4DXFA 4LAAA 3I4LA 1TY2A 3AMUA 3D3RA 1CI3M 3DHQA 3FDTA 5C3XA 1UEAB 1ESFA 5ELBA 2B2VA 1JOOA 4FF2A 4IFDI 1BF4A 3A54A 1HTLD 2F0WA 3K57A 4J1MA 1B1ZA 1I4RA 4ILWA 4ME5A 1STNA 2F0GA 4XDXA 2IX3A 3BG3A 1V1PB 1B3AA 2SDFA 4A3FB 4FF3A 1CZGA 4QCLA 2L1BA 3KUPA 3VR2A 3GO5A 3KK7A 3S2HB 3A7LA 1AP0A 1R4QB 1SMYD 1XTCD 3BVZA 5I9OA 4KTAA 1G6ZA 1BCPD 2RA4A 5JEAJ 1TU2B 3U9OA 1STYA 5M5WB 1GUWA 1I6HB 2NBFA 4CKCA 2EJFC 3WOEA 3N6RA 4KV6A 3K0YA 2K5QA 2NN6H 1X3PA 4C3IG 1D5MC 1E2WA 1JICA 1SNMA 4ZQ3A 5FO9B 1VMCA 4XT1B 4XTCS 1T5XD 1D2BA 1ET6A 4XIGS 2MGSA 3W3AA 3M7NA 3OIQA 3M4OB 2B2YA 3OWFA 4DK0A 4K8JA 3OMCA 3NP8A 5IGFA 1SMYC 4KI0A 1H9KA 5C5MA 2B2WC 1HA5A 1ZYRC 1H9RA 2ZXRA 2NVTB 3V05A 1QB5D 1VDZA 3IAYA 1PFMA 1GHJA 3S1QB 2F0VA 1OXUA 3GTLB 1VF7A 5I6YA 2RDGA 4Z9CB 2KA7A 3LX0A 5KYLA 1I50B 3L7ZC 3HOWB 2X6LA 1JWSD 3VA5A 4KD4A 2EYMA 2EYPA 1JOKA 3J80E 3BVMA 2L55A 2F03A 3K58A 3C1EA 1HHVA 3QO2A 1TY0A 1XYIA 1PRTB 4H13C 1HFNA 2EY2A 3MZ5A 3DXJC 1OXSC 1PTOB 1IKMA 1B2TA 1EY9A 4K6LA 2JXMB 4CJ1B 1RD9D 2PW7A 4WJWA 1H9SA 4UDUC 1KDCA 4I65A 2D5DA 1STGA 2R61A 3VA7A 1IW7D 5CV5A 2YU9B 5C0XH 1D1KA 3EA6A 4FYDA 1CZWA 5M3MB 3HEJA 1W6JA 2LKVA 1MI2A 1A2TA 2AQ1B 5C0XG 4IUTA 1J8IA 1UAPA 5IT9L 4BY7B 2G9HD 3H09A 3M4YA 3RMHA 1XWEA 4A3EB 1CFMA 5E4XA 3TZUA 5DAUA 1II3A 1KNEA 5C4XB 1M4VA 3Q6SA 5BN4A 2WKDA 2EYHA 3FEWX 4IFDH 2XWBB 2A6EC 3S16B 1WTOA 1V1OA 3HP3A 1OXXK 3N52A 3DUZA 2PPBC 3D6CA 5JPMC 1ILPA 3D4RA 2LS01 3EROA 1CK1A 1SJED 2CVRA 4HCEA 1TIID 1BO0A 5C4ZA 2ICEC 4F7XA 1LT3D 3AU7A 1CA5A 1LTTD 1WD0A 4IN3A 1TS2A 5I2XA 5JVH3 2IW3A 2K04A 1Y8NB 3PUXA 4CJ0B 3I72A 3P7JA 4TKOB 3ONAB 2KOLA 1G91A 4KY7A 3I8ZA 3L3OC 3ZYYX 2KUMA 3PIO3 3BS1A 2F0SA 2F0HA 1SJHD 1IYUA 4HTHA 2C5CA 2L11A 4G7HC 5C3EB 1EYCA 1CQVA 3OWEB 4IQZA 1JB3A 1BXTA 1HFGA 4BA1I 2MP1A 4ZAIA 1X32A 4A3MB 4IALA 4KKSA 3BDOA 2K5WA 1B50A 3VYSA 1PTOH 5T1IA 2QCPX 2IL8A 3HG9A 4KKUA 1WTRA 3NSWA 2KHSA 1EZ6A 2JEAI 3D6WA 3DWQA 5DM63 3TBIB 1GUTA 4ID6A 2XSCA 3HOUB 4FF4A 1O78A 4C1NI 5K36H 2A6HD 3SK4A 5IODA 5JEAH 1SNPA 3C46A 2BA1A 1J9OA 2CHBD 2KEEA 5TSSA 5LHY1 1SEBD 4HSVA 5CV9A 5K36G 2GA4B 4G57A 2HCIA 4C3JB 1A3UA 1CM9A 3ND8A 2O5JC 1SNOA 3TP5A 3EQLC 3H94A 2AUKA 2F1MA 5M3FB 3U9SA 1MBYA 4K5VA 1NR2A 1Q3LA 2A6HC 1EY6A 3DWAA 3CKIB 2F0QA 2TMPA 3TSSA 1JWUD 2FJ2A 4EQPA 3NTIA 5KGUA 3NQTA 2O5IC 3NBIA 3SEBA 1MSGA 2OEOA 1UUPA 1PZJD 4RGNA 1ET9A 4C3IB 3QB3A 3WDNA 4M1UB 1S5DD 1A3VA 4G4KA 1DYQA 4K8IA 4Q0FA 2EYJA 1SE4A 2Q8IB 1LTBD 1S5BD 4AYBB 3MTSA 1U4LA 1EY5A 1V8QA 5KNBA 5D3DA 3NQIA 3EFXD 1SYCA 4HAEA 1I3QB 2WIIB 2XVSA 4H44C 3E6ZX 1PRTF 2L4NA 4IURA 4BBSB 2B8GA 4RAUC 1EY8A 1S5FD 4PV1C 1SFOB 1KDAA 3MFYA 3ERQA 5EBDA 4EQOA 3OW7A 4Q5VA 1EY7A 2JSOA 5EKLA 3BYTB 2PW5A 2E2HB 1LT6D 1UNSA 3TDQA 4ABNA 1SSOA 5E4WC 5IIFA 1NSNS 3Q23A 5C0XI 3GTOB 3KLRA 2Z8LA 1C4QA 1EIHA 5E3FA 4K14A 2NYZD 4B9XA 3TP8A 4K2LA 3S17B 2QEJC 2PMZB 2KECA 4HR7B 3TZDA 4FNFA 3J81E 5CV7A 2PO4A 4ULLA 1RKNA 5FO7B 2D2CC 1GUOA 1IKLA 1STAA 2Y0SB 4A3KB 3R3OA 5C44B 1Q12A 2F3VA 2BCOA 3HZXA 4KY5A 3GV6A 4RCOA 1EY0A 1BCPB 1LLRD 3IL8A 2EY5A 1BUVT 4IUQA 1KABA 3RLFA 1TVXA 4C3JG 3NUCA 3FRPB 2AUJD 1E2VA 2BDNA 3BYYB 3I70A 4WFN3 4DU9A 4KKTA 1VF5C 3FPPA 1QNKA 1STBA 1A3TA 2PYKA 1CHPD 1EQVA 3S9WA 2IT1A 3P75A 2F0KA 1A2UA 3JAME 2E2JB 1TQOA 3V96A 1Z6HA 1TWCB 5J39A 2CQAA 4DF7A 5I4DA 2R6GA 2JEBI 4XQQA 3I4MB 4KMUC 1ZYRD 1C48A 1B44D 1YNJD 2Q8RE 4TQUS 1LACA 1NAPA 1Q8IA 3VYTA 5M9OA 3K5OA 1DZ1A 1O80A 2XRSD 2I46A 2X69A 4ODGA 4QUCA 3CU7A 1HPCA 4IUUA 2J4XA 3UI2A 4ZK9B 3ND9A 3S1NB 4R8IA 1K83B 3J80L 3GTPB 1FNWA 3A7AB 2AWOA 3GTMB 4CBVA 4QIWB 1YNJC 2EE1A 1EYAA 2KCCA 2XN9C 2EVBA 4G7ZC 1EY4A 1E0BA 3T53B 1ZKOA 5D65A 2ICIA 1DM0B 2K7VA 1XX8A 3MXNA 1HA6A 2ZT9C 1I4PA 3SK5A 4J8QA 1B53A 1EOTA 2D62A 5C6AA 3H0GB 1KTKA 1LTGD 4OHJA 1M8AA 2IPKD 4RA8A 3NHHA 2J7ZA 2F3WA 1QILA 3VR6A 4QB4A 2F0MA 4O1NA 1CT1D 4MN3A 1I6VC 4KJNA 1JC7A 4KN7C 5DNFA 2B2TC 4RHSA 4ZLTF 4DK1A 4PNYA 3X3NA 1GUGA 1ML0D 1LTSD 1ZXTA 1D6EC 4X3SA 1EEID 3S1MB 1DOLA 2ID0A 3K6OA 4B08A 4OO1H 1RTOA 4R9WA 4CKBA 1QJOA 3F2UA 5C4JB 2YYZA 3OOCA 4OO1G 1RDPD 4S3SA 1QG7A 1SAPA 5EQ0A 3D31A 1S5CD 4H0LC 4ZYSA 3BDLA 3G6JB 1HQMC 1JWMD 2RSOA 4JK1C 4XQNA 3D8GA 1QNUA 3MVVA 1PYWD 2F4IA 2FINB 1ESRA 2A6ED 1B9MA 1Y1VB 1CTMA 1TR5A 2WACA 4L63B 4RH6A 3SR1A 4K6DA 2KEDA 2O2LD 1AZPA 2LMCB 2DY7A 1TT2A 1OO9B 2QDBA 1TWHB 2L5TA 5AFWA 2DN8A 4P2CB 3R8BA 1T5EA 4K2KA 1Y69U 1ENFA 3QOJA 3LNNA 4BBRB 2JE6I 1YNNC 3DEOA 3GTKB 2OXPA 1BR9A 3MA2B 2B2UA 4PMWA 2A68D 4CGYB 3E5SA 5LL6X 4YIJA 3C2PA 2VB2X 3SE0A 2R93B 3MXUA 5KRUA 2K1BA 3GP7A 5CV6A 2SNSA 4RKLA 5KYIA 1SNCA 1PFNA 3CRKC 1D5ZC 5EPLA 1PRTC 3CQZB 1U4PA 3OHXC 4GZYC 1PTOC 4A3JB 2EJGC 2BDOA 2QILA 5FKAC 1RHPA 2E76C 4NKLA 4MHEA 3TN2A 1R4PB 3EVQA 3OMGA 2A68C 2NUCA 3CRLC 1BCPF 2F0LA 1PXUA 3KLSX 2BA0A 1ZEQX 3LWEA 4ZKBB 1A6XA 2NZ1D 1SYBA 2SNMA 5J22A 3MAQA 5HURA 2QF7A 1H9SB 2RBMA 4C3HG 4QUFA 3PO3B 4XT3B 3PUZA 5CBAE 2MJ8A 3QOLA 5G3LF 1OXTA 1FYCA 2DY8A 2PCFB 1PLFA 5KNCA 5D3IB 3EJIA 4IZ8A 1F9RA 1IYVA 3I73A 2IX0A 1HTPA 2PZUA 4ZRZA 3MC0B 1HUNA 5IGEA 3MWYW 4DGZA 3HKZB 1G291 1KLUD 5ELDA 3URYA 4PQXA 4WORA 2M2LA 2KJXA 1EZ8A 4RWSC 3J7AF 1NCVA 1Q1BA 4NDXA 3GQBA 4OL7A 1HRJA 1BNZA 1I4QA 1TS3A 3KBGA 2BE5C 4EGVA 1KLGD 1FNVA 4HCSA 1EFID 3P1HA 1SDFA 2F0NA 1MGSA 5CORA 5A2QE 3R2TA 1BOSA 2B2WA 3K5MA 1GHKA 3KLSA 3A55A 3NK9A 2WP8J 2RDHA 1RODA 3HOZB 1E2ZA 4RFBA 5JAVA 1EEFD 1PZID 5JVG3 2Q8TA 4LK1C 2F0IA 4U673 1GUNA 1GOZA 5K5PA 5CGKA 4RGMA 2HQEA 4KHZA 4XXEA 4X3KA 1LT4D 5J1ZA 4KN4C 2F0PA 2FMCA 4BY1B 2Z4HA 1SBBB 4X3TA 1SYFA 4XYQA 1VMPA 1IL8A 1RF2D 2B2TA 2N88A 2E2IB 1G2SA 2MHVA 3IKJA 5JOBA 4LJZC 2FFKB 1QCBD 2DNCA 5BN5A 1PTOF 2EYFA 1STHA 2VUMB 3J81L 1TWAB 2KCNA 1DONA 1B9NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F0F A;  5CV6 A;  1STG A;  3OWF A;  5M9O A;  4K8J A;  4K5V A;  4WOR A;  5CV5 A;  2SNS A;  4IUN A;  3OMC A;  4R8N A;  3NP8 A;  4RKL A;  4KY7 A;  5IGF A;  5KYI A;  1SNC A;  1EZ8 A;  5C5M A;  2EYL A;  3C1F A;  5EGT A;  1F2Y A;  1SNQ A;  2SOB A;  5I6W A;  4H7B A;  5C4H A;  3S9W A;  4QF4 A;  4EQN A;  1IHZ A;  4ODG A;  3T13 A;  5IGG A;  2F0S A;  1SYD A;  5E3F A;  4NDX A;  1EY6 A;  2ENB A;  4K14 A;  4LAA A;  4OL7 A;  2F0H A;  2F0O A;  3HEJ A;  5DEH A;  4K2L A;  4ZUJ A;  1F2M A;  2LKV A;  3TP8 A;  4B9X A;  2F0Q A;  2F0T A;  5IOC A;  1A2T A;  4HTH A;  4NMZ A;  4B9W A;  4KY6 A;  4EQP A;  1EYC A;  1SYE A;  5ISR A;  5KGU A;  4S3S A;  3DHQ A;  5CC4 A;  3NQT A;  2F0V A;  2RKS A;  3MHB A;  5CV7 A;  5C3X A;  3P1H A;  4KHV A;  1RKN A;  1JOO A;  1U9R A;  2F0N A;  4NKL A;  2OEO A;  5I6Y A;  3BDL A;  2F0W A;  2O4X A;  4J6H A;  4J1M A;  4HMJ A;  5E1F A;  3EVQ A;  3LX0 A;  3OMG A;  4IAL A;  4ME5 A;  5IGB A;  5KYL A;  1STA A;  1STN A;  2PZT A;  5CV4 A;  3BDC A;  3NK9 A;  2EY1 A;  2NUC A;  2F0G A;  3D8G A;  3QB3 A;  3R3O A;  3D4W A;  5JAV A;  4E6I A;  1A3V A;  1EYA A;  2F3V A;  3MVV A;  2OF1 A;  4K8I A;  4KJO A;  2EYJ A;  2F0L A;  1JOQ A;  3TP6 A;  3HZX A;  5C5L A;  4KY5 A;  5C3W A;  1EY0 A;  3VA5 A;  2KHS A;  4KD4 A;  4N9T A;  2F0U A;  2F0I A;  4QMG A;  1EZ6 A;  2EXZ A;  1EY4 A;  2EYM A;  1TR5 A;  2EY5 A;  2EYP A;  1AEX A;  2WAC A;  4K5X A;  5DAU A;  5HGT A;  4F8M A;  1II3 A;  1JOK A;  3SHL A;  5CGK A;  5K5P A;  1EY5 A;  1SYB A;  2SNM A;  5J22 A;  1KAB A;  5HUR A;  3SR1 A;  4ID6 A;  2HQE A;  2RBM A;  2EYH A;  4K6D A;  5KEE A;  5CR3 A;  5KIX A;  3ITP A;  3NUC A;  1SYC A;  3C1E A;  5J1Z A;  3TME A;  5I9O A;  4KTA A;  1NUC A;  3MEH A;  3MXP A;  3SK5 A;  4PMB A;  3TP7 A;  4K5W A;  4N9P A;  4WRD A;  5EKK A;  1TT2 A;  5C6A A;  4DU9 A;  2QDB A;  2RDF A;  3QOL A;  3SK4 A;  3U9O A;  1STB A;  1A3T A;  1STY A;  2F0P A;  5IOD A;  1SND A;  1SNP A;  1EY8 A;  5CV8 A;  2PYK A;  5I9P A;  5IGD A;  4TRD A;  3T16 A;  1KDA A;  3ERQ A;  4MIU A;  2EY2 A;  1EQV A;  1EY7 A;  3D6C A;  4EQO A;  3EJI A;  3MZ5 A;  3NHH A;  4IZ8 A;  3P75 A;  4EVO A;  4K2K A;  2F0K A;  1A2U A;  2F3W A;  3ERO A;  4QB4 A;  1TQO A;  2F0M A;  3SK6 A;  1EY9 A;  5CV9 A;  3PMF A;  2F0E A;  2PQE A;  3QOJ A;  1KAA A;  1SYF A;  4G57 A;  2EY6 A;  5EKL A;  1JOR A;  3OSO A;  3RUZ A;  2KQ3 A;  4KV6 A;  2PZU A;  4PMC A;  5J39 A;  1A3U A;  1ENC A;  4KJN A;  4ZUI A;  4DF7 A;  2OXP A;  5C4Z A;  2PW5 A;  4F7X A;  3SK8 A;  3D4D A;  5IGE A;  4DGZ A;  2EYO A;  2PW7 A;  5IGC A;  3NXW A;  1SNO A;  1SNM A;  4ZQ3 A;  3TP5 A;  2M00 A;  5JOB A;  1KDB A;  2F0J A;  3E5S A;  4DFA A;  1ENA A;  2PZW A;  5F2D A;  5NUC A;  1KDC A;  4PNY A;  4NP5 A;  4YIJ A;  2EYF A;  1SYG A;  1EYD A;  1STH A;  5IIF A;  3V2T A;  1NSN S;  3DMU A;  4HMI A;  4KD3 A;  3SXH A;  3H6M A;  4I65 A;  5KRU A;  4RKB A;  2F0D A;  1F2Z A; 
#chains in the Genus database with same CATH topology
 2F0F A;  3F8T A;  2UUB Q;  4TSS A;  3PO2 B;  1DXM A;  4OO1 I;  2B39 A;  4M8A A;  2AQ2 B;  1LV9 A;  2UU9 Q;  3HOX B;  1F2Y A;  1SNQ A;  4IPH A;  3G71 A;  4I7A A;  1IHZ A;  3T13 A;  1K8G A;  5A35 A;  3LWU A;  1VQ7 A;  4JV5 L;  4LF8 L;  1IXR A;  3H3V C;  3K0X A;  3MFG A;  2CW0 C;  1XPU A;  3PO3 H;  2HUG A;  3FPU B;  3UDX A;  2QKI C;  4IJH A;  4FP5 D;  3T1H Q;  1U9R A;  5FLX E;  4A3D B;  2WIN B;  2AWN A;  1S4Z A;  5M5Y B;  5KND A;  4K0K Q;  1BBX C;  5EAY A;  2UUA Q;  4HID A;  2K03 A;  4LF9 L;  3PO3 G;  2ZTE A;  2XIW A;  3D4W A;  1QVG A;  3I56 A;  1J5E Q;  2OF1 A;  1ICF B;  3TP6 A;  5C5L A;  2TSS A;  3FMC A;  3HOV B;  4DUY L;  2K75 A;  3HOU H;  1LTR D;  4N9T A;  2F0U A;  2ASB A;  1PH9 A;  2EXZ A;  3RLN A;  3KJP A;  3PUV A;  1XPR A;  1K8M A;  1AFP A;  4F8M A;  3SHL A;  4JPB W;  1N36 Q;  2PNR C;  5ELO A;  4YWM A;  4L5T A;  1HNZ Q;  1FGB D;  3TME A;  2K5D A;  3EN2 A;  3KFU A;  3HGB A;  1Y8O B;  1E24 A;  3HKZ G;  1F9Q A;  2DGY A;  5FLX c;  3QIA A;  4C3J H;  4TRD A;  2IWH A;  1I4H A;  2NVY B;  1U4R A;  1W3S A;  4IPC A;  4X66 L;  4P71 A;  2EZV A;  1WCM B;  4DN4 M;  1AE2 A;  2LFN A;  2R7Z B;  1ENC A;  1LYL A;  3SK8 A;  1NNX A;  1UE6 A;  2EYO A;  3Q0A A;  1BDO A;  1SMX A;  3J81 c;  3Q24 A;  1SXT A;  1KDB A;  3GTG B;  1WTQ A;  2DNE A;  1ENA A;  3FVQ A;  4JBW A;  3GTJ B;  4NP5 A;  1FR3 A;  1EYD A;  2VW9 A;  3V2T A;  2RCF A;  4HMI A;  1O7Y A;  3SXH A;  3H6M A;  3I4N B;  3HOZ H;  2XGT A;  3PSI A;  1K8A C;  3CPF A;  3A5U A;  4IUV A;  1SE2 A;  3C1F A;  1PMR A;  5I6W A;  2K28 A;  1VCI A;  2WAQ B;  3HOZ G;  1YNX A;  3NTH A;  2NTT A;  4ZUJ A;  1WYD A;  5DM7 3;  2F0T A;  1X9N A;  4JI3 L;  4NMZ A;  3S2D B;  5ELF A;  1L1O B;  2KHJ A;  5I2Y A;  1AN8 A;  1B8A A;  1XXG A;  2FHT A;  2K01 A;  1DOK A;  4L6T B;  1Y1W B;  4R4C A;  1O7I A;  4A93 G;  1MSH A;  4C2M B;  1YIJ A;  1EOV A;  4HMJ A;  2OQ0 A;  4OX9 L;  4OXP A;  4BY1 H;  2H1E A;  3CW2 C;  3T51 B;  2I0Q A;  1YJW A;  3FKI B;  1PH7 A;  4GLV B;  2E74 C;  1C7Y A;  3JAM c;  1IYJ B;  2J0T D;  3DM1 A;  2IX1 A;  1S5E D;  1X54 A;  2WV6 D;  2E75 C;  3VYR A;  3Q22 A;  4O42 A;  5M5X B;  2LY7 A;  4K5X A;  5HGT A;  1JQY D;  3PUW A;  5ELE A;  4NW2 A;  1PFB A;  4CKE A;  2V4D A;  3O13 A;  4GN3 B;  3RNU A;  1KHI A;  3A8I E;  3M7G A;  2VUM H;  1IBM Q;  2RQX A;  1TWA H;  3PUY A;  1SFO H;  3Q8D A;  2EDG A;  1KRS A;  3MXP A;  1L0X B;  4PMB A;  1QOH A;  1WTV A;  3PO2 H;  4JOI C;  1D8L A;  5EKK A;  5G3L D;  2WKC A;  4YCV A;  3HOX H;  2JA6 B;  2OTJ A;  3H91 A;  4KK7 A;  3BU2 A;  2VUM G;  2RCN A;  2NN6 G;  2VXW A;  4EVO A;  1PH2 A;  4OIJ A;  1AZQ A;  1B7Y B;  1FNU A;  4R4I A;  2F0E A;  2PQE A;  5AJ3 L;  1A15 A;  2EY6 A;  2K32 A;  3HOX G;  1BCP C;  2XTI A;  2JK8 A;  3NXW A;  4BWG B;  1YEZ A;  4A3D H;  1TKW B;  5M5Y H;  3NEL A;  5F2D A;  1K9M C;  1BQQ T;  2VQE Q;  2Z1C A;  4X62 Q;  2XWJ B;  1RTN A;  1J6Q A;  3GD7 A;  2JN4 A;  3JC6 6;  2PQA A;  3CHB D;  1N33 L;  4A3D G;  4L8J A;  3E0J A;  1RJT A;  2EYL A;  3HOV H;  1CA6 A;  1DJR D;  1V43 A;  2GVB A;  2L0C A;  4LFA Q;  4C3H B;  1MJC A;  2KVM A;  3L2P A;  1U4M A;  3M85 A;  3S1R B;  2RSN A;  1X55 A;  1L0Y B;  1F9S A;  3VYU A;  2BOS A;  3BZD B;  5IOC A;  4JI6 Q;  4HSP A;  2L12 A;  2JA5 B;  1JB7 A;  1B4O A;  4KY6 A;  3T56 B;  3UE0 A;  3J7A V;  3VDY A;  4FF1 A;  2LSS A;  1HR0 L;  3NTK A;  3RD4 A;  1GVP A;  3QG1 A;  3WOF A;  2L9H A;  1AW7 A;  4POF A;  3IRB A;  3QWN A;  4R1J A;  2JA8 B;  3SDZ A;  1X3Q A;  3NWS A;  2UUB L;  5E1F A;  4I7Z C;  2ZJR A;  1H9J A;  1HH2 P;  2NVY H;  3I91 A;  5CV4 A;  2EY1 A;  1YHA A;  1WTP A;  1GM5 A;  2IY5 B;  3F2B A;  4A3B B;  1WCM H;  3S15 B;  1JOQ A;  3F1Z A;  3I7F A;  3NE5 B;  5C3W A;  1ASZ A;  1FD7 D;  4V0B A;  4QQB X;  2HHH Q;  1Q46 A;  2K4K A;  1PZK D;  4DR7 L;  4V19 0;  3GTG H;  3T1H L;  1WCM G;  2X6G A;  3J7Y W;  5CR3 A;  3I4N H;  2R7Z G;  4OGQ C;  5JJZ A;  4K0K L;  4KHP Q;  3MXG A;  1EYG A;  1NJI C;  3R93 A;  1YNN D;  4CDE C;  1I4X A;  2RDF A;  4FXK C;  4DAY A;  1SND A;  2CWA A;  2EPB A;  5CV8 A;  5BR8 L;  4HN7 A;  1J5E L;  3G7L A;  1HUM A;  1CKO A;  1TWC H;  1FL0 A;  1F77 A;  2ALY B;  5EPK A;  1PHJ A;  3I4N G;  1HNW Q;  3DWP A;  3DEP A;  3NWT A;  5CMD A;  3SK6 A;  3GV3 A;  1GJX A;  3OSO A;  1D1I A;  1NMF A;  1WTW A;  1QE6 A;  1HNZ L;  4FXD A;  1Y1W H;  5IGC A;  1TS5 A;  4C2M H;  1PRT D;  4DFA A;  5T1G A;  1HXY D;  1SYG A;  1PTO D;  3A56 A;  4R4O A;  1EU4 A;  3QJY A;  3GDE A;  4GLA C;  1D5X C;  5EBC A;  1EIG A;  3FKI H;  3M3Y B;  2F0D A;  2FMM A;  1Y1W G;  2CCZ A;  3HOY B;  5J3B A;  1Y8P B;  4R8N A;  1QWY A;  1KAW A;  2R92 B;  3E3X A;  5BN3 A;  3J81 i;  1I94 Q;  4LW1 A;  1LUZ A;  1E7Z A;  1SYD A;  5M5X H;  2ENB A;  3FKI G;  5EKI A;  1A63 A;  1F2M A;  2CKZ B;  3CC2 A;  1S3O A;  1SYE A;  1IW7 C;  1F2L A;  5CC4 A;  3MXN B;  2JP1 A;  2XRQ D;  4JBM A;  4JI4 L;  1EWH A;  1Q90 A;  3AB9 A;  5IYD G;  4N8X 1;  2B2V C;  2JA6 H;  2O4X A;  1Q82 C;  2PZT A;  2NVX B;  1JE4 A;  1VQ4 A;  3TQY A;  1CSQ A;  3PV0 A;  4DNR B;  4LF6 Q;  2SEB D;  1VQN A;  4HJA A;  1C8C A;  1K8O A;  4KJO A;  4MTK A;  3S14 B;  3TS0 A;  2JA6 G;  3IFD A;  4IFD G;  4QMG A;  1O7L A;  4C56 C;  5IT9 E;  4Y52 H;  1WVL A;  1AEX A;  1PH8 A;  2A74 C;  1HCZ A;  4X3U A;  1GUS A;  1K73 C;  3P20 A;  4L5Q A;  1PYS B;  1SE3 A;  5KIX A;  1WD1 A;  2VNU D;  2VB3 X;  1NUC A;  4CDD C;  1DD2 A;  4N9P A;  5GAE C;  3K5L A;  3K59 A;  4CHT B;  1Q8K A;  1YZ6 A;  2A73 B;  1G2T A;  1VQ8 A;  5I9P A;  4F87 A;  4C3H H;  1DCZ A;  3T16 A;  3S1R H;  2NVQ B;  1AE3 A;  2BH8 A;  5GAD C;  2JA5 H;  3PMF A;  1HR0 W;  2B8F A;  1HZ9 A;  1WJJ A;  2KQ3 A;  4XQJ A;  2AKW B;  4ZUI A;  3H3V I;  1WFQ A;  4LMQ D;  4IUP A;  2QGQ A;  5FK9 C;  1IBM L;  3HOW G;  2JA8 H;  5NUC A;  2JA5 G;  1YI2 A;  4C1N K;  3DMU A;  1XNR Q;  1EQT A;  5IGG A;  4TVA B;  2BE5 D;  5IP9 H;  2IJ0 A;  4BXX H;  5A2Q L;  4A3B H;  4APV A;  3S15 H;  2B2Y C;  1LTL A;  1EWI A;  4DR3 Q;  2SOB A;  2YTX A;  5C4H A;  2UUC Q;  4DAY B;  2WB1 E;  2BH2 A;  2HCC A;  3L9A X;  2F0O A;  4JI7 Q;  1W6K A;  1JR0 D;  4A3B G;  4Y7N B;  2G9D A;  1VS0 A;  1WTX A;  5LL6 S;  3K7A B;  3VR4 A;  4F88 A;  3PIP 3;  2ZXO A;  2RKS A;  2MPM A;  2VQE L;  4LF5 L;  4KHV A;  1XMQ Q;  3KBX A;  1V1Q A;  3KF6 A;  4X62 L;  4POG A;  4XYO A;  5COY A;  2R3Z A;  4J6H A;  2JQO A;  2XNA C;  3M4P A;  3VR3 A;  3W2D A;  5D14 A;  3BDC A;  2RF4 A;  1RCV D;  3I90 A;  5FLM H;  3S24 A;  1WI5 A;  4LFA L;  2C9O A;  4OIK A;  4N8F A;  4ME3 A;  1A62 A;  5GAH C;  3ICE A;  2UXB Q;  3RZD B;  4JI6 L;  3OW2 A;  2EQS A;  4DNT B;  3A8J E;  2K52 A;  2K05 A;  2E2D C;  2NN6 I;  3HRZ C;  5JEA G;  5LMN L;  5M3M G;  2QEX A;  5KEE A;  3GTQ B;  4FXG C;  1TWG B;  1Q1E A;  3X3M A;  3M3Y H;  1EU3 A;  4JOI A;  3MEH A;  3KYH C;  3HOY H;  1UE1 A;  1DOM A;  1QVC A;  3TP7 A;  1MD2 D;  2RVL A;  4WRD A;  4DV0 Q;  3TRZ A;  4IOC A;  2R92 H;  1HZA A;  5IGD A;  2K33 A;  1N32 Q;  3ZJY C;  2OT2 A;  1ONL A;  2MNA A;  4MIU A;  5IGB A;  4BY7 G;  2A69 D;  3T4A C;  2HIX A;  3G6E A;  2AQ3 B;  3BVG A;  3G48 A;  4A93 B;  1KRT A;  2HHH L;  1T9H A;  3IFT A;  1H9M A;  3CPW A;  1ILQ A;  4PMC A;  4DV1 Q;  4GKJ Q;  1LT5 D;  4B3R Q;  3K5N A;  1FJG Q;  4A3E G;  2M00 A;  4KHP L;  2F0J A;  2PZW A;  2ZXP A;  2K5N A;  4RGT A;  2ES2 A;  2D9U A;  1MIU A;  2M9V A;  3RN2 A;  2NVX H;  2ZM6 L;  3CQZ H;  1VQP A;  1R9T B;  1V1P A;  2CW0 D;  3VR5 A;  3A8K E;  3OPO A;  5C0X J;  5FLX L;  2DJF C;  5FO8 B;  2I07 B;  1CHQ D;  1HNW L;  4IUN A;  3S14 H;  5C4X G;  5GQO A;  1RIP A;  2MUY A;  1ICW A;  3OTO L;  1JCK B;  4QF4 A;  4EQN A;  2HDL A;  4RCN A;  2HD3 A;  3HS0 C;  1G8Z D;  2NWG A;  5DEH A;  5FOB B;  2HDM A;  2A5H A;  4B9W A;  2A69 C;  5ISR A;  1KNA A;  4L5R C;  1STE A;  5ELC A;  1Z7T A;  3MHB A;  4DA2 A;  3A5Z B;  4JCV E;  3F2D A;  4CJ2 C;  4FO2 A;  1EWC A;  3CCE A;  2Q2I A;  4A3G B;  1X3G A;  2VQF Q;  2B63 B;  1XMO Q;  4RHR A;  1EQQ A;  1CSP A;  2NVQ H;  1OXV A;  2CQO A;  2I5H A;  4DAV A;  4U68 A;  1I94 L;  5IWA Q;  2JA7 B;  3NBH A;  4E6I A;  1LTI D;  4BS9 A;  3CXC A;  1LAB A;  4A75 A;  2NB0 A;  4HED A;  2CH4 W;  4LFB Q;  4FVM A;  4LWC A;  1PDQ A;  1HQR D;  2NTS A;  2WB1 B;  4PZ8 A;  1CQF A;  4JI5 Q;  3PQI A;  3AYH B;  1GO3 E;  2N3S A;  3K7U C;  3HKS A;  5JJL A;  4G7O C;  1F9P A;  1XJV A;  3R2I A;  2K6A A;  4A3I B;  4IFD J;  5EJW A;  1TWF B;  3C3L A;  1KQS A;  1LO5 D;  2D0O A;  3ITP A;  4BA2 I;  5JPN C;  3NPP A;  2H4O A;  3DM3 A;  4K5W A;  2B2U C;  1TXY A;  4UAI A;  1VQF A;  1BBU A;  4LF6 L;  1NR4 A;  1VQE A;  3KF6 B;  2N55 A;  4RGO S;  1O7Z A;  4R4T A;  5CBE E;  3SVM A;  1VQD A;  2C35 B;  2Z4I A;  2EJM A;  3I3C A;  5CYU A;  4DXG A;  2JYO A;  3JAM L;  1LTA D;  4Y7N H;  1PA6 A;  1JOR A;  1KAA A;  3RUZ A;  4A3M G;  1JJC B;  1Z9F A;  3LGJ A;  4DAP A;  3KF8 A;  1BVS A;  3D4D A;  3OIP A;  5JJI A;  5EPJ A;  4AQY Q;  1TS4 A;  1YJN A;  2EIF A;  1I4G A;  1Z47 A;  3FP9 A;  4X65 Q;  4KD3 A;  4RKB A;  5IP7 H;  1F2Z A;  2RHS B;  3KOJ A;  2EOT A;  3I55 A;  3NEN A;  4ZKC B;  2Z6K C;  4NB3 A;  1EL0 A;  5JJK A;  5EGT A;  3RZD H;  4H7B A;  1GXD C;  4LF7 Q;  3RZO B;  4QL5 A;  4DXF A;  5GAG C;  4LAA A;  5IP7 G;  5LMN W;  3I4L A;  2QDL A;  1TY2 A;  3H3V H;  1Q7Y C;  4P72 A;  3STB D;  3AMU A;  3D3R A;  3GTQ H;  1TWG H;  1CI3 M;  3DHQ A;  3FDT A;  1SR3 A;  2PI2 A;  5C3X A;  1UEA B;  1ESF A;  5ELB A;  1XNR L;  2B2V A;  1JOO A;  4WJ4 A;  2PI2 E;  4FF2 A;  4IFD I;  1BF4 A;  3A54 A;  1HNX Q;  1HTL D;  2F0W A;  3J81 j;  3K57 A;  4J1M A;  1B1Z A;  1I4R A;  4ILW A;  4ME5 A;  1STN A;  3K81 C;  4DR3 L;  2F0G A;  5IYB G;  4XDX A;  2UUC L;  2IX3 A;  3BG3 A;  4A93 H;  1V1P B;  3J7Z C;  4JI7 L;  1B3A A;  2SDF A;  1YHB A;  4A3F B;  4LNQ A;  5M3F G;  4FF3 A;  1KC8 C;  4X64 L;  4YHH Q;  1CZG A;  4QCL A;  2L1B A;  4AH6 A;  1C0A A;  1UE7 A;  2MO1 A;  3KUP A;  1XMQ L;  3VR2 A;  1SRO A;  3GO5 A;  3KK7 A;  3S2H B;  3A7L A;  3U58 A;  1AP0 A;  4IO9 A;  1R4Q B;  1SMY D;  1R9T H;  1XTC D;  3BVZ A;  5I9O A;  4KTA A;  1G6Z A;  3CCL A;  3STB C;  4IPG A;  1BCP D;  2RA4 A;  3SGI A;  5JEA J;  1TU2 B;  3U9O A;  4P74 A;  1STY A;  4QGU A;  5M5W B;  1VQL A;  4AIM A;  1M1K C;  4L5S A;  1GUW A;  1I6H B;  2NBF A;  2E2I H;  4CKC A;  2K5H A;  2EJF C;  3WOE A;  4EQ5 A;  3NBH B;  3I4O A;  3N6R A;  4KV6 A;  3K0Y A;  2K5Q A;  3K8A A;  2ZTD A;  2NN6 H;  1X3P A;  4C3I G;  1D5M C;  1E2W A;  1K0R A;  4GKK Q;  1JIC A;  1SNM A;  4ZQ3 A;  3WWV A;  5ELN A;  5FO9 B;  3RR5 A;  1VMC A;  4XT1 B;  4IJL A;  4XTC S;  4A3G H;  1T5X D;  1D2B A;  1ET6 A;  4DV0 L;  4XIG S;  2MGS A;  3W3A A;  3M7N A;  3OIQ A;  3M4O B;  1K28 A;  2EXD A;  4AYB G;  2B2Y A;  2JA7 H;  3T1Y Q;  3OWF A;  1N32 L;  4DK3 C;  4DK0 A;  2MQH A;  4K8J A;  3UE1 A;  3OMC A;  4DR4 Q;  3NP8 A;  5IGF A;  1SMY C;  4KI0 A;  1H9K A;  5C5M A;  4A3G G;  4DV3 Q;  2B2W C;  1HA5 A;  2B63 G;  1ZYR C;  1VQO A;  1H9R A;  4DV1 L;  2ZXR A;  4A3L G;  3V05 A;  2JA7 G;  2NVT B;  1U5K A;  4GKJ L;  4B3R L;  4BBS G;  4A3I H;  1FJG L;  1QB5 D;  1VDZ A;  2R7D A;  3IAY A;  1PFM A;  4LFC Q;  1GHJ A;  3S1Q B;  5HGQ A;  3ULP A;  2F0V A;  2WB1 G;  1OXU A;  2F4V Q;  3GTL B;  1VF7 A;  3KF8 B;  5I6Y A;  2RDG A;  4Z9C B;  1CUK A;  4A3I G;  2KA7 A;  3LX0 A;  5KYL A;  4DV7 Q;  5H1S E;  1I50 B;  3L7Z C;  2NZO A;  3HOW B;  1E22 A;  3AEV A;  2OWO A;  2X6L A;  1JWS D;  3VA5 A;  4KD4 A;  4YY3 Q;  2EYM A;  2EYP A;  1JOK A;  1XTD A;  4OEM B;  3CCJ A;  3ER0 A;  3J80 E;  3BVM A;  3CCM A;  2L55 A;  2F03 A;  3K58 A;  3C1E A;  3CF5 A;  1VQH A;  1Q86 C;  2UU9 L;  5FJ8 H;  2VQF L;  1A8V A;  1HHV A;  3QO2 A;  1XMO L;  1TY0 A;  1QZH A;  5IWA L;  1X6O A;  5L37 A;  1XYI A;  3MEF A;  2R7Z H;  1PRT B;  4PZ6 A;  2ZTC A;  4H13 C;  2D0P A;  2EY2 A;  1HFN A;  4LFB L;  3MZ5 A;  3DXJ C;  1OXS C;  1PTO B;  5FJ8 G;  1IKM A;  1B2T A;  1EY9 A;  4K6L A;  3AFP A;  1C9O A;  2JXM B;  3GTJ H;  4JI5 L;  4DAM A;  4DPG A;  3M9B A;  2Z0S A;  4CJ1 B;  4A3K G;  5C44 G;  1RD9 D;  2PW7 A;  4JI2 Q;  2UUA L;  4WJW A;  1H9S A;  4UDU C;  1QZG A;  1HZC A;  1KDC A;  3J80 c;  4I65 A;  2D5D A;  2UXD Q;  1STG A;  4DKA C;  2R61 A;  3VA7 A;  1IW7 D;  5CV5 A;  2YU9 B;  5C0X H;  1D1K A;  3EA6 A;  4LUO A;  4FYD A;  1CZW A;  1KXL A;  4A3F H;  3S2D H;  5M3M B;  1N36 L;  2KCM A;  3PCO B;  1VQ9 A;  2N49 A;  3HEJ A;  1V9P A;  1W6J A;  2LKV A;  1MI2 A;  1A2T A;  2AQ1 B;  5C0X G;  2WFW A;  4IUT A;  5IYC G;  4AQY L;  3S2H H;  3TEH B;  4A3F G;  1J8I A;  2A1A A;  3RN5 A;  1UAP A;  1VQI A;  5IT9 L;  1KD1 C;  4BY7 B;  2G9H D;  3W1B A;  4X65 L;  1K0S A;  3H09 A;  3M4Y A;  5M5W H;  3RMH A;  4DNI A;  1I6H H;  1XWE A;  3AQQ A;  3AFQ A;  4LF7 L;  3I4M G;  4NXN Q;  4A3E B;  1D7Q A;  2ZJQ A;  5IYD H;  1CFM A;  5E4X A;  1Y14 B;  2VY3 A;  3TZU A;  5DAU A;  2FXQ A;  4JI1 Q;  1II3 A;  1KNE A;  2UXC Q;  5C4X B;  1M4V A;  3Q6S A;  5BN4 A;  3EIV A;  2WKD A;  2EYH A;  3CCQ A;  3FEW X;  1EIY B;  4IFD H;  1NE3 A;  2XWB B;  3M4O H;  4MTN A;  2PNH A;  2A6E C;  3NEM A;  1WTO A;  4JBJ A;  3S16 B;  1V1O A;  4WJ3 M;  3HP3 A;  4QY7 A;  1FVI A;  1OXX K;  3N52 A;  2PQA B;  4GLX A;  3DUZ A;  2PPB C;  3D6C A;  5JPM C;  1ILP A;  3D4R A;  2N8N A;  2LS0 1;  2NVT H;  3ERO A;  1CK1 A;  3DLL A;  3KJO A;  4YHH L;  1SJE D;  2CVR A;  4HCE A;  1MJE A;  2CFM A;  1TII D;  3S1Q H;  1BO0 A;  5C4Z A;  2ICE C;  4F7X A;  1LT3 D;  3JAM i;  3GTL H;  3AU7 A;  2IHF A;  1CA5 A;  1RL2 A;  1LTT D;  4RMF A;  1WD0 A;  1VQ6 A;  1GD7 A;  4IN3 A;  1TS2 A;  4YWL A;  1YJ9 A;  5I2X A;  5JVH 3;  2IW3 A;  1VQB A;  1I50 H;  2K04 A;  2MO0 A;  1Y8N B;  3PUX A;  1ASY A;  3HOW H;  4CJ0 B;  3I72 A;  3P7J A;  2Z6K A;  4TKO B;  2Z9H A;  3ONA B;  3TS2 A;  4GN5 A;  2KOL A;  3E9H A;  1G91 A;  4KY7 A;  3I8Z A;  3L3O C;  3ZYY X;  2KUM A;  1GKH A;  3PIO 3;  3BS1 A;  2F0S A;  1PH1 A;  4AYB E;  2F0H A;  1SJH D;  5IT9 c;  4GKK L;  1IYU A;  4HTH A;  2C5C A;  2L11 A;  2B29 A;  4G7H C;  5C3E B;  1EYC A;  1QUQ A;  1CQV A;  3W5O A;  3OWE B;  1BBW A;  4IQZ A;  2HIV A;  4GS3 A;  1JB3 A;  3CP0 A;  1PVO A;  1BXT A;  1HFG A;  4BA1 I;  2F52 A;  2MP1 A;  4ZAI A;  1X32 A;  4A3M B;  4IAL A;  4DR4 L;  4KKS A;  2Q2U A;  3BDO A;  2K5W A;  1B50 A;  4DV3 L;  3VYS A;  1PTO H;  5T1I A;  2QCP X;  4GOP C;  2VL6 A;  4DV6 Q;  2IL8 A;  3HG9 A;  4KKU A;  1WTR A;  1UE5 A;  3NSW A;  3U50 C;  2KHS A;  1EZ6 A;  4NXM Q;  4LFC L;  2JEA I;  3D6W A;  3DWQ A;  2KHI A;  5DM6 3;  2F4V L;  3TBI B;  1GUT A;  4ID6 A;  2XSC A;  1VQK A;  3HOU B;  4FF4 A;  1AH9 A;  1H95 A;  1O78 A;  1IZ6 A;  4DV7 L;  2YTY A;  2YU9 H;  4C1N I;  5K36 H;  2A6H D;  2K5V A;  3SK4 A;  5IOD A;  5JEA H;  1SNP A;  5M3M H;  3C46 A;  2BA1 A;  1J9O A;  2CHB D;  2KEE A;  5TSS A;  5LHY 1;  5HY6 A;  1SEB D;  4HSV A;  4YY3 L;  5CV9 A;  5K36 G;  2GA4 B;  4G57 A;  2PMZ E;  2HCI A;  2A19 A;  1HJP A;  4C3J B;  1A3U A;  1CM9 A;  2LXK A;  3PF5 A;  3ND8 A;  4BY7 H;  2O5J C;  1X3E A;  1SNO A;  3TP5 A;  1IBL Q;  1K3R A;  3EQL C;  3H94 A;  2AUK A;  3H15 A;  2IHE A;  2F1M A;  5M3F B;  2Y0S E;  1PH6 A;  3U9S A;  1EIF A;  1MBY A;  1WOC A;  4K5V A;  4A3E H;  1E3P A;  1NR2 A;  1Q3L A;  2A6H C;  1EY6 A;  5E7N A;  3DWA A;  3CKI B;  2F0Q A;  2TMP A;  4FDB A;  3TSS A;  1B3Q A;  1JWU D;  5C4X H;  4JI2 L;  2FJ2 A;  2DUD A;  4KLK A;  4EQP A;  4DV4 Q;  3NTI A;  5KGU A;  4UP7 A;  3NQT A;  2O5I C;  3NBI A;  3S16 H;  3SEB A;  1MSG A;  2OEO A;  3CC7 A;  1UUP A;  1PZJ D;  4BBR G;  2UXD L;  4IOA A;  1NY4 A;  2DJG C;  1XNQ Q;  4RGN A;  1UEB A;  3PIP A;  4O2D A;  1ET9 A;  4C3I B;  3QB3 A;  3WDN A;  4M1U B;  1S5D D;  1NMG A;  1A3V A;  2H5X A;  4G4K A;  1DYQ A;  3UDG A;  1IBK Q;  4K8I A;  4Q0F A;  2EYJ A;  4B3T Q;  1SE4 A;  2Q8I B;  1KIX A;  2R93 G;  1LTB D;  5LMU Q;  1S5B D;  4AYB B;  3MTS A;  1U4L A;  1EY5 A;  3ULL A;  1BKB A;  1MHW C;  1V8Q A;  3D0F A;  4J15 A;  5KNB A;  5D3D A;  3NQI A;  4OWW B;  3EFX D;  1SYC A;  4HAE A;  1I3Q B;  2WII B;  2XVS A;  4H44 C;  3E6Z X;  1PRT F;  3U4V A;  4A3J G;  2L4N A;  4ALP A;  1L2F A;  4GNX C;  4DUZ Q;  4IUR A;  3RLO A;  4BBS B;  4JG2 A;  2B8G A;  4RAU C;  1EY8 A;  1S5F D;  4PV1 C;  4NXN L;  4DV5 Q;  2AMC B;  1YHQ A;  1SFO B;  1M90 C;  1KDA A;  3MFY A;  3ERQ A;  5EBD A;  2OCE A;  3OW7 A;  4EQO A;  1EY7 A;  4Q5V A;  4JYA Q;  4DR2 Q;  2JSO A;  4DV2 Q;  2KBN A;  5EKL A;  5C3E H;  4JI1 L;  2L15 A;  2AHO B;  3BYT B;  2UXC L;  2PW5 A;  2OQK A;  1DGS A;  2E2H B;  4B3M Q;  1LT6 D;  1UNS A;  3CCV A;  3TDQ A;  4A3M H;  4ABN A;  1SSO A;  1EQR A;  2VS1 A;  5E4W C;  5IIF A;  5C3E G;  4DR7 Q;  1NSN S;  3Q23 A;  4QIW E;  5C0X I;  3GTO B;  3KLR A;  1VQM A;  3K7A H;  2Z8L A;  1C4Q A;  1EIH A;  5E3F A;  4LUZ A;  4K14 A;  4DR1 Q;  2NYZ D;  4B9X A;  5BR8 Q;  3TP8 A;  4K2L A;  4CDF C;  3J7A 5;  3S17 B;  3BZK A;  2QEJ C;  2PMZ B;  2KEC A;  4HR7 B;  3TZD A;  1W2B A;  4FNF A;  4R4Q A;  3J81 E;  5CV7 A;  2PO4 A;  4ULL A;  1RKN A;  5FO7 B;  2D2C C;  1GUO A;  3KDF A;  1A0I A;  1L0W A;  1IL2 A;  1IKL A;  1STA A;  3HOU G;  2GVA A;  2Y0S B;  4A3K B;  3R3O A;  1FGU A;  5C44 B;  4HJ7 A;  1Q12 A;  2F3V A;  2BCO A;  1CKN A;  3HZX A;  4KY5 A;  3BJU A;  3GV6 A;  4RCO A;  1EY0 A;  1UWV A;  1BCP B;  1LLR D;  5IYB H;  3IL8 A;  2EY5 A;  4UP8 A;  1BUV T;  4IUQ A;  1SLJ A;  1KAB A;  3G4S A;  3RLF A;  1TVX A;  4C3J G;  5M3F H;  4UY8 C;  3NUC A;  3FRP B;  1PYB A;  2AUJ D;  1E2V A;  2BDN A;  3BYY B;  3I70 A;  3K80 C;  2CWP A;  4WFN 3;  4DU9 A;  4KKT A;  1VF5 C;  3FPP A;  1QNK A;  1STB A;  1A3T A;  4CDC C;  2PYK A;  1CHP D;  3CMA A;  4DV6 L;  4JI4 Q;  4DR6 Q;  1G6P A;  1EQV A;  3S9W A;  1PH5 A;  2IT1 A;  4X6A H;  3P75 A;  2F0K A;  1A2U A;  3JAM E;  2E2J B;  1N34 Q;  1TQO A;  1JJ2 A;  3V96 A;  4NXM L;  4HJ8 A;  1Z6H A;  1I5F A;  2E5L Q;  4JI8 Q;  1TWC B;  5J39 A;  2CQA A;  4DF7 A;  1G51 A;  2Z6B A;  5I4D A;  2R6G A;  2JEB I;  4XQQ A;  3I4M B;  4KMU C;  1ZYR D;  2G5D A;  4PG3 A;  1C48 A;  1JJG A;  1B44 D;  1YNJ D;  2Q8R E;  2RHQ B;  1LM0 A;  4TQU S;  1LAC A;  3A74 A;  3PF4 A;  4C3I H;  1PH3 A;  1NAP A;  1Q8I A;  3VYT A;  5M9O A;  2UXB L;  1PV4 A;  1N8R C;  3K5O A;  1DZ1 A;  3U4Z A;  4IPD A;  1O80 A;  2JJQ A;  2I46 A;  2XRS D;  2X69 A;  4A76 A;  2ATW A;  4ODG A;  4QUC A;  3CU7 A;  1HPC A;  4IUU A;  2J4X A;  3UI2 A;  4ZK9 B;  3ND9 A;  1IBL L;  4LF4 Q;  4DK6 C;  4BY1 G;  2B63 H;  1I3Q H;  3S1N B;  4R8I A;  1K83 B;  4A3L H;  4BBS H;  4QJF A;  3J80 L;  3GTP B;  2V1C C;  1FNW A;  4OEL B;  3A7A B;  2AWO A;  3FHW A;  3GTM B;  4CBV A;  4QIW B;  4GOP A;  1YNJ C;  2EE1 A;  1S40 A;  1EYA A;  4H02 A;  2KCC A;  3F2C A;  3KLW A;  2XN9 C;  1TWF H;  2EVB A;  4G7Z C;  4OWT B;  1EY4 A;  1E0B A;  3T53 B;  1ZKO A;  4P73 A;  4DV4 L;  2E2H H;  5D65 A;  2ICI A;  3PO2 G;  1DM0 B;  4JI0 Q;  2K7V A;  1XX8 A;  3MXN A;  1HA6 A;  2ZT9 C;  4HIO A;  1I4P A;  1YIT A;  3ULJ A;  1XNQ L;  3SK5 A;  4J8Q A;  3GTO H;  1K3B C;  1B53 A;  1EOT A;  2D62 A;  2HT1 A;  5C6A A;  3H0G B;  1KTK A;  4MNO A;  4LF5 Q;  1LTG D;  4OHJ A;  1IBK L;  1M8A A;  2IPK D;  3KDF B;  4B3T L;  4RA8 A;  3NHH A;  2J7Z A;  3S17 H;  3OYY A;  2F3W A;  1QIL A;  3VR6 A;  4QB4 A;  5LMU L;  2F0M A;  4O1N A;  4O0A A;  1CT1 D;  5GRO A;  1L1O C;  1WTH A;  1CKN B;  4MN3 A;  1I6V C;  4KJN A;  1JC7 A;  4KN7 C;  5DNF A;  2B2T C;  1B70 B;  3B6Y A;  4RHS A;  4ZLT F;  4DK1 A;  4PNY A;  3HOV G;  3X3N A;  4DUZ L;  1GUG A;  4A3K H;  3RZO H;  1ML0 D;  1LTS D;  5C44 H;  1ZXT A;  2B3G A;  2HQL A;  5LMN Q;  1D6E C;  4DV5 L;  1EUJ A;  4X3S A;  1NBW A;  1EEI D;  4JYA L;  2Q2H A;  3S1M B;  4DR2 L;  1DOL A;  2ID0 A;  3K6O A;  4B08 A;  4DV2 L;  4OO1 H;  3TRE A;  4HJ5 A;  4JVZ A;  1RTO A;  4R9W A;  4CKB A;  2Y0S G;  1QJO A;  4A4I A;  3I2Z A;  3F2U A;  4B3M L;  5C4J B;  5IY0 A;  2YYZ A;  1U0L A;  3OOC A;  4OO1 G;  1RDP D;  4S3S A;  1QG7 A;  2K14 A;  1SAP A;  5EQ0 A;  1HZB A;  3D31 A;  1VQ5 A;  1S5C D;  4H0L C;  4ZYS A;  3BDL A;  4DR5 Q;  3G6J B;  5IYC H;  1HQM C;  1JWM D;  2RSO A;  3BZC A;  4JK1 C;  4XQN A;  3D8G A;  2KEN A;  2E2J H;  2NZH A;  1QNU A;  3MVV A;  4JW0 A;  1PYW D;  2ZM6 Q;  2F4I A;  4DR1 L;  2FIN B;  1ESR A;  2A6E D;  1B9M A;  4B3S Q;  1Y1V B;  1CTM A;  1TR5 A;  2WAC A;  4L63 B;  3CD6 A;  3HKZ E;  3OTO Q;  4YWK A;  3I4M H;  4RH6 A;  1N9W A;  3SR1 A;  4K6D A;  2WAQ G;  1CKM A;  2KED A;  2O2L D;  1AZP A;  4GNX A;  2LMC B;  2DY7 A;  4PZ7 A;  1TT2 A;  1OO9 B;  2QDB A;  5DLQ E;  1TWH B;  2L5T A;  5AFW A;  2DN8 A;  4P2C B;  1VQJ A;  3R8B A;  4YCU A;  1QVF A;  2OTL A;  1T5E A;  4K2K A;  2N78 A;  4GOP B;  1Y69 U;  3CC4 A;  1ENF A;  1JMC A;  4ZCK A;  4EX5 A;  3QOJ A;  3LNN A;  1YVC A;  4BBR B;  2JE6 I;  4JV5 Q;  1YNN C;  4LF8 Q;  3DEO A;  1JE5 A;  2OXP A;  3GTK B;  3S1N H;  1BR9 A;  1HNX L;  3MA2 B;  2QW7 A;  2B2U A;  2ZJP A;  1K83 H;  4PMW A;  2A68 D;  4CGY B;  3GTP H;  3E5S A;  1Q81 C;  5LL6 X;  4YIJ A;  3C2P A;  2VB2 X;  3SE0 A;  3GTM H;  2R93 B;  3MXU A;  5KRU A;  2K1B A;  4NPS A;  3GP7 A;  5CV6 A;  2SNS A;  4DR6 L;  4RKL A;  5KYI A;  1SNC A;  1PFN A;  4UHV A;  4LF9 Q;  1E1T A;  2E8G A;  3CRK C;  1D5Z C;  5EPL A;  1N34 L;  1PRT C;  3CQZ B;  1U4P A;  3OHX C;  4GZY C;  2E5L L;  3EBE A;  4JI8 L;  1PTO C;  4A3J B;  4LUV A;  4DUY Q;  2EJG C;  2JA9 A;  2BDO A;  2QIL A;  1X65 A;  2K50 A;  5FKA C;  1YBY A;  1RHP A;  2E76 C;  4NKL A;  4MHE A;  3TN2 A;  3H0G H;  1SRU A;  1R4P B;  3EVQ A;  3OMG A;  4RG1 A;  2MFI A;  5IE8 A;  2A68 C;  4HIM A;  3CME A;  2NUC A;  3CRL C;  4A3C H;  1BCP F;  2F0L A;  3H0G G;  1PXU A;  3KLS X;  2BA0 A;  2GN5 A;  4HIK A;  1ZEQ X;  3LWE A;  4X66 Q;  3QR8 A;  4LF4 L;  1VQC A;  4A3C G;  2A8V A;  4ZKB B;  1XPO A;  2NZ1 D;  1PFS A;  3CCU A;  1A6X A;  1SYB A;  2SNM A;  5J22 A;  3MAQ A;  5HUR A;  2QF7 A;  3L0O A;  1H9S B;  2RBM A;  3T1Y L;  4C3H G;  4QUF A;  3PO3 B;  4XT3 B;  3PUZ A;  4GN4 B;  3E9I A;  5CBA E;  1EFW A;  2MJ8 A;  3QOL A;  5G3L F;  3S1M H;  2F3I A;  1OXT A;  1S72 A;  2R7F A;  1SN8 A;  1FYC A;  2DY8 A;  2PCF B;  1PLF A;  5KNC A;  5D3I B;  3EJI A;  4IZ8 A;  1F9R A;  1P16 A;  2I5M X;  2JA8 G;  1IYV A;  3I73 A;  5C4J H;  4JI0 L;  2IX0 A;  1HTP A;  2PZU A;  4ZRZ A;  3MC0 B;  4P75 A;  1HUN A;  1OTC A;  5IGE A;  3MWY W;  4DGZ A;  4JI3 Q;  5IP9 G;  3HKZ B;  4BXX G;  1G29 1;  1KLU D;  4X64 Q;  5ELD A;  3URY A;  4YCW A;  4PQX A;  2I5L X;  4WOR A;  2M2L A;  4OX9 Q;  4GNX B;  2KJX A;  1EZ8 A;  1VQG A;  1JT8 A;  4RWS C;  3J7A F;  1NCV A;  2CH4 A;  1Q1B A;  1Y1V H;  4NDX A;  3GQB A;  4OL7 A;  4UP9 A;  1HRJ A;  2QA4 A;  1NTG A;  1BNZ A;  1I4Q A;  1TS3 A;  3KBG A;  3PGZ A;  2BE5 C;  3UDF A;  4JC0 A;  4EGV A;  1KLG D;  3PIO A;  1VQA A;  1FNV A;  3CCS A;  5FLM G;  4HCS A;  1Y1V G;  1EFI D;  3P1H A;  1SDF A;  2LXJ A;  4OWX B;  2F0N A;  3A0J A;  4UPA A;  1MGS A;  2YV5 A;  5COR A;  5A2Q E;  1TWH H;  3W1G A;  3R2T A;  1BOS A;  1SE8 A;  2B2W A;  2P5Z X;  3K5M A;  1GHK A;  3KLS A;  3A55 A;  3NK9 A;  2WP8 J;  2RDH A;  1ROD A;  4OON A;  1E2Z A;  3HOZ B;  4RFB A;  5JAV A;  3J80 i;  1EEF D;  3CCR A;  4BBR H;  3HFZ B;  1PZI D;  1X3F A;  5JVG 3;  2Q8T A;  3UDI A;  3GTK H;  4LK1 C;  2F0I A;  4U67 3;  3HOY G;  5AJ3 Q;  1GUN A;  1GOZ A;  5K5P A;  5CGK A;  2R92 G;  2Q2T A;  4RGM A;  2HQE A;  4KHZ A;  4XXE A;  4DR5 L;  2R93 H;  4HJ9 A;  4X3K A;  1LT4 D;  5J1Z A;  2KCT A;  4KN4 C;  2F0P A;  1PH4 A;  2FMC A;  2YTV A;  2WAQ E;  4BY1 B;  1X56 A;  1N33 Q;  2Z4H A;  4MZ9 A;  4A3J H;  1SBB B;  4B3S L;  1L1O A;  4X3T A;  2VZA A;  1SYF A;  3ERS X;  4XYQ A;  1VMP A;  3E0E A;  1IL8 A;  3CAM A;  1P8L A;  1RF2 D;  4JBK A;  2B2T A;  2N88 A;  1KL9 A;  2E2I B;  1QUQ B;  1G2S A;  2MHV A;  3IKJ A;  5JOB A;  4LJZ C;  2FFK B;  1QCB D;  2DNC A;  1E1O A;  1PTO F;  5BN5 A;  2EYF A;  1HR0 Q;  3M4Q A;  1MKH A;  1STH A;  2VUM B;  3J81 L;  1TWA B;  2KCN A;  1DON A;  1B9N A; 
#chains in the Genus database with same CATH homology
 2F0F A;  4TSS A;  3PO2 B;  1DXM A;  4OO1 I;  2B39 A;  4M8A A;  2AQ2 B;  1LV9 A;  3HOX B;  1F2Y A;  1SNQ A;  1IHZ A;  3T13 A;  5A35 A;  3LWU A;  3H3V C;  3MFG A;  2CW0 C;  2HUG A;  3FPU B;  2QKI C;  4FP5 D;  1U9R A;  5FLX E;  4A3D B;  2WIN B;  2AWN A;  1S4Z A;  5M5Y B;  5KND A;  1BBX C;  2K03 A;  2XIW A;  3D4W A;  2OF1 A;  3TP6 A;  5C5L A;  2TSS A;  3FMC A;  3HOV B;  1LTR D;  4N9T A;  2F0U A;  2EXZ A;  3PUV A;  1K8M A;  1AFP A;  4F8M A;  3SHL A;  2PNR C;  1FGB D;  3TME A;  2K5D A;  3HGB A;  1Y8O B;  1F9Q A;  3QIA A;  4TRD A;  2IWH A;  1I4H A;  2NVY B;  1U4R A;  2EZV A;  1WCM B;  4DN4 M;  2LFN A;  2R7Z B;  1ENC A;  3SK8 A;  2EYO A;  3Q0A A;  1BDO A;  3Q24 A;  1SXT A;  1KDB A;  3GTG B;  1WTQ A;  2DNE A;  1ENA A;  3FVQ A;  4JBW A;  3GTJ B;  4NP5 A;  1FR3 A;  1EYD A;  3V2T A;  3SXH A;  4HMI A;  1O7Y A;  3I4N B;  3H6M A;  4IUV A;  1SE2 A;  3C1F A;  1PMR A;  5I6W A;  2K28 A;  1VCI A;  2WAQ B;  3NTH A;  2NTT A;  4ZUJ A;  5DM7 3;  2F0T A;  4NMZ A;  3S2D B;  5ELF A;  5I2Y A;  1AN8 A;  1XXG A;  2FHT A;  2K01 A;  1DOK A;  4L6T B;  1Y1W B;  1MSH A;  4C2M B;  4HMJ A;  2H1E A;  3T51 B;  3FKI B;  2E74 C;  2J0T D;  3DM1 A;  2IX1 A;  1S5E D;  2WV6 D;  2E75 C;  3VYR A;  3Q22 A;  4O42 A;  5M5X B;  2LY7 A;  4K5X A;  5HGT A;  1JQY D;  3PUW A;  5ELE A;  4NW2 A;  1PFB A;  4CKE A;  2V4D A;  3O13 A;  3A8I E;  3M7G A;  2RQX A;  3PUY A;  2EDG A;  3MXP A;  1L0X B;  4PMB A;  1QOH A;  1WTV A;  5EKK A;  5G3L D;  2WKC A;  2JA6 B;  3H91 A;  4KK7 A;  2NN6 G;  2VXW A;  4EVO A;  4OIJ A;  1AZQ A;  1FNU A;  2F0E A;  2PQE A;  1A15 A;  2EY6 A;  2K32 A;  1BCP C;  3NXW A;  4BWG B;  1TKW B;  5F2D A;  1BQQ T;  2Z1C A;  2XWJ B;  1RTN A;  3GD7 A;  3CHB D;  4L8J A;  3E0J A;  1RJT A;  2EYL A;  1CA6 A;  1DJR D;  1V43 A;  2L0C A;  4C3H B;  3M85 A;  2KVM A;  1U4M A;  3S1R B;  2RSN A;  1L0Y B;  1F9S A;  3VYU A;  2BOS A;  3BZD B;  5IOC A;  4HSP A;  2L12 A;  2JA5 B;  1B4O A;  4KY6 A;  3T56 B;  3J7A V;  4FF1 A;  3NTK A;  3RD4 A;  3QG1 A;  3WOF A;  2L9H A;  1AW7 A;  3QWN A;  2JA8 B;  3SDZ A;  1X3Q A;  3NWS A;  5E1F A;  4I7Z C;  1H9J A;  3I91 A;  5CV4 A;  2EY1 A;  1WTP A;  4A3B B;  3S15 B;  1JOQ A;  3NE5 B;  5C3W A;  1FD7 D;  4V0B A;  1PZK D;  4V19 0;  2X6G A;  3J7Y W;  5CR3 A;  4OGQ C;  5JJZ A;  3MXG A;  3R93 A;  1YNN D;  1I4X A;  2RDF A;  4FXK C;  4DAY A;  1SND A;  2EPB A;  5CV8 A;  4HN7 A;  3G7L A;  1HUM A;  1F77 A;  5EPK A;  3DWP A;  3DEP A;  3NWT A;  5CMD A;  3SK6 A;  3GV3 A;  1GJX A;  3OSO A;  1D1I A;  1WTW A;  1QE6 A;  4FXD A;  5IGC A;  1TS5 A;  1PRT D;  4DFA A;  5T1G A;  1HXY D;  1SYG A;  1PTO D;  3A56 A;  1EU4 A;  3QJY A;  1D5X C;  5EBC A;  1EIG A;  3M3Y B;  2F0D A;  2FMM A;  3HOY B;  1Y8P B;  4R8N A;  1QWY A;  2R92 B;  5BN3 A;  1SYD A;  2ENB A;  5EKI A;  1F2M A;  1SYE A;  1IW7 C;  1F2L A;  5CC4 A;  2JP1 A;  2XRQ D;  1EWH A;  1Q90 A;  3AB9 A;  2B2V C;  2O4X A;  2PZT A;  2NVX B;  1JE4 A;  3PV0 A;  4DNR B;  2SEB D;  1C8C A;  1K8O A;  4KJO A;  3S14 B;  3IFD A;  4IFD G;  4QMG A;  1O7L A;  4C56 C;  5IT9 E;  1WVL A;  1AEX A;  2A74 C;  1HCZ A;  4X3U A;  1GUS A;  3P20 A;  1SE3 A;  5KIX A;  1WD1 A;  2VNU D;  2VB3 X;  1NUC A;  1DD2 A;  4N9P A;  3K5L A;  3K59 A;  4CHT B;  1G2T A;  2A73 B;  5I9P A;  4F87 A;  1DCZ A;  3T16 A;  2NVQ B;  3PMF A;  2B8F A;  2KQ3 A;  4XQJ A;  4ZUI A;  4LMQ D;  4IUP A;  5FK9 C;  5NUC A;  4C1N K;  3DMU A;  1EQT A;  5IGG A;  2BE5 D;  2IJ0 A;  5A2Q L;  2B2Y C;  2SOB A;  5C4H A;  2HCC A;  3L9A X;  2F0O A;  1W6K A;  1JR0 D;  4Y7N B;  2G9D A;  1WTX A;  5LL6 S;  3K7A B;  3VR4 A;  4F88 A;  3PIP 3;  2ZXO A;  2RKS A;  2MPM A;  4KHV A;  3KBX A;  4XYO A;  5COY A;  2R3Z A;  4J6H A;  2XNA C;  3VR3 A;  3W2D A;  5D14 A;  3BDC A;  1RCV D;  3I90 A;  2C9O A;  4OIK A;  3RZD B;  4DNT B;  3A8J E;  2K05 A;  2E2D C;  2NN6 I;  3HRZ C;  5JEA G;  5KEE A;  3GTQ B;  4FXG C;  1TWG B;  1Q1E A;  3X3M A;  1EU3 A;  3MEH A;  1DOM A;  3TP7 A;  1MD2 D;  2RVL A;  4WRD A;  5IGD A;  2K33 A;  2OT2 A;  1ONL A;  4MIU A;  5IGB A;  2A69 D;  3T4A C;  2AQ3 B;  3BVG A;  4A93 B;  3IFT A;  1H9M A;  1ILQ A;  4PMC A;  1LT5 D;  3K5N A;  2M00 A;  2F0J A;  2PZW A;  2ZXP A;  4RGT A;  2D9U A;  2M9V A;  1R9T B;  1V1P A;  2CW0 D;  3VR5 A;  3A8K E;  3OPO A;  5C0X J;  5FLX L;  5FO8 B;  2I07 B;  1CHQ D;  4IUN A;  2MUY A;  1ICW A;  1JCK B;  4QF4 A;  4EQN A;  2HDL A;  4RCN A;  3HS0 C;  1G8Z D;  2NWG A;  5DEH A;  5FOB B;  2HDM A;  2A5H A;  4B9W A;  2A69 C;  5ISR A;  1KNA A;  1STE A;  5ELC A;  1Z7T A;  3MHB A;  4DA2 A;  4CJ2 C;  4FO2 A;  1EWC A;  4A3G B;  2B63 B;  4RHR A;  1OXV A;  4DAV A;  4U68 A;  2JA7 B;  3NBH A;  4E6I A;  1LTI D;  4BS9 A;  1LAB A;  2NB0 A;  4HED A;  4FVM A;  1PDQ A;  1HQR D;  2NTS A;  2WB1 B;  1CQF A;  4G7O C;  1F9P A;  3R2I A;  2K6A A;  4A3I B;  4IFD J;  5EJW A;  1TWF B;  3C3L A;  1LO5 D;  3ITP A;  4BA2 I;  5JPN C;  3NPP A;  2H4O A;  4K5W A;  2B2U C;  4UAI A;  1NR4 A;  2N55 A;  4RGO S;  1O7Z A;  5CBE E;  3SVM A;  2Z4I A;  2EJM A;  3I3C A;  5CYU A;  4DXG A;  2JYO A;  3JAM L;  1LTA D;  1JOR A;  1KAA A;  3RUZ A;  4DAP A;  3KF8 A;  3D4D A;  3OIP A;  5EPJ A;  1TS4 A;  1I4G A;  1Z47 A;  4KD3 A;  4RKB A;  1F2Z A;  2EOT A;  4ZKC B;  1EL0 A;  5EGT A;  4H7B A;  1GXD C;  3RZO B;  4DXF A;  4LAA A;  3I4L A;  1TY2 A;  3AMU A;  3D3R A;  1CI3 M;  3DHQ A;  3FDT A;  5C3X A;  1UEA B;  1ESF A;  5ELB A;  2B2V A;  1JOO A;  4FF2 A;  4IFD I;  1BF4 A;  3A54 A;  1HTL D;  2F0W A;  3K57 A;  4J1M A;  1B1Z A;  1I4R A;  4ILW A;  4ME5 A;  1STN A;  2F0G A;  4XDX A;  2IX3 A;  3BG3 A;  1V1P B;  1B3A A;  2SDF A;  4A3F B;  4FF3 A;  1CZG A;  4QCL A;  2L1B A;  3KUP A;  3VR2 A;  3GO5 A;  3KK7 A;  3S2H B;  3A7L A;  1AP0 A;  1R4Q B;  1SMY D;  1XTC D;  3BVZ A;  5I9O A;  4KTA A;  1G6Z A;  1BCP D;  2RA4 A;  5JEA J;  1TU2 B;  3U9O A;  1STY A;  5M5W B;  1GUW A;  1I6H B;  2NBF A;  4CKC A;  2EJF C;  3WOE A;  3N6R A;  4KV6 A;  3K0Y A;  2K5Q A;  2NN6 H;  1X3P A;  4C3I G;  1D5M C;  1E2W A;  1JIC A;  1SNM A;  4ZQ3 A;  5FO9 B;  1VMC A;  4XT1 B;  4XTC S;  1T5X D;  1D2B A;  1ET6 A;  4XIG S;  2MGS A;  3W3A A;  3M7N A;  3OIQ A;  3M4O B;  2B2Y A;  3OWF A;  4DK0 A;  4K8J A;  3OMC A;  3NP8 A;  5IGF A;  1SMY C;  4KI0 A;  1H9K A;  5C5M A;  2B2W C;  1HA5 A;  1ZYR C;  1H9R A;  2ZXR A;  2NVT B;  3V05 A;  1QB5 D;  1VDZ A;  3IAY A;  1PFM A;  1GHJ A;  3S1Q B;  2F0V A;  1OXU A;  3GTL B;  1VF7 A;  5I6Y A;  2RDG A;  4Z9C B;  2KA7 A;  3LX0 A;  5KYL A;  1I50 B;  3L7Z C;  3HOW B;  2X6L A;  1JWS D;  3VA5 A;  4KD4 A;  2EYM A;  2EYP A;  1JOK A;  3J80 E;  3BVM A;  2L55 A;  2F03 A;  3K58 A;  3C1E A;  1HHV A;  3QO2 A;  1TY0 A;  1XYI A;  1PRT B;  4H13 C;  1HFN A;  2EY2 A;  3MZ5 A;  3DXJ C;  1OXS C;  1PTO B;  1IKM A;  1B2T A;  1EY9 A;  4K6L A;  2JXM B;  4CJ1 B;  1RD9 D;  2PW7 A;  4WJW A;  1H9S A;  4UDU C;  1KDC A;  4I65 A;  2D5D A;  1STG A;  2R61 A;  3VA7 A;  1IW7 D;  5CV5 A;  2YU9 B;  5C0X H;  1D1K A;  3EA6 A;  4FYD A;  1CZW A;  5M3M B;  3HEJ A;  1W6J A;  2LKV A;  1MI2 A;  1A2T A;  2AQ1 B;  5C0X G;  4IUT A;  1J8I A;  1UAP A;  5IT9 L;  4BY7 B;  2G9H D;  3H09 A;  3M4Y A;  3RMH A;  1XWE A;  4A3E B;  1CFM A;  5E4X A;  3TZU A;  5DAU A;  1II3 A;  1KNE A;  5C4X B;  1M4V A;  3Q6S A;  5BN4 A;  2WKD A;  2EYH A;  3FEW X;  4IFD H;  2XWB B;  2A6E C;  3S16 B;  1WTO A;  1V1O A;  3HP3 A;  1OXX K;  3N52 A;  3DUZ A;  2PPB C;  3D6C A;  5JPM C;  1ILP A;  3D4R A;  2LS0 1;  3ERO A;  1CK1 A;  1SJE D;  2CVR A;  4HCE A;  1TII D;  1BO0 A;  5C4Z A;  2ICE C;  4F7X A;  1LT3 D;  3AU7 A;  1CA5 A;  1LTT D;  1WD0 A;  4IN3 A;  1TS2 A;  5I2X A;  5JVH 3;  2IW3 A;  2K04 A;  1Y8N B;  3PUX A;  4CJ0 B;  3I72 A;  3P7J A;  4TKO B;  3ONA B;  2KOL A;  1G91 A;  4KY7 A;  3I8Z A;  3L3O C;  3ZYY X;  2KUM A;  3PIO 3;  3BS1 A;  2F0S A;  2F0H A;  1SJH D;  1IYU A;  4HTH A;  2C5C A;  2L11 A;  4G7H C;  5C3E B;  1EYC A;  1CQV A;  3OWE B;  4IQZ A;  1JB3 A;  1BXT A;  1HFG A;  4BA1 I;  2MP1 A;  4ZAI A;  1X32 A;  4A3M B;  4IAL A;  4KKS A;  3BDO A;  2K5W A;  1B50 A;  3VYS A;  1PTO H;  5T1I A;  2QCP X;  2IL8 A;  3HG9 A;  4KKU A;  1WTR A;  3NSW A;  2KHS A;  1EZ6 A;  2JEA I;  3D6W A;  3DWQ A;  5DM6 3;  3TBI B;  1GUT A;  4ID6 A;  2XSC A;  3HOU B;  4FF4 A;  1O78 A;  4C1N I;  5K36 H;  2A6H D;  3SK4 A;  5IOD A;  5JEA H;  1SNP A;  3C46 A;  2BA1 A;  1J9O A;  2CHB D;  2KEE A;  5TSS A;  5LHY 1;  1SEB D;  4HSV A;  5CV9 A;  5K36 G;  2GA4 B;  4G57 A;  2HCI A;  4C3J B;  1A3U A;  1CM9 A;  3ND8 A;  2O5J C;  1SNO A;  3TP5 A;  3EQL C;  3H94 A;  2AUK A;  2F1M A;  5M3F B;  3U9S A;  1MBY A;  4K5V A;  1NR2 A;  1Q3L A;  2A6H C;  1EY6 A;  3DWA A;  3CKI B;  2F0Q A;  2TMP A;  3TSS A;  1JWU D;  2FJ2 A;  4EQP A;  3NTI A;  5KGU A;  3NQT A;  2O5I C;  3NBI A;  3SEB A;  1MSG A;  2OEO A;  1UUP A;  1PZJ D;  4RGN A;  1ET9 A;  4C3I B;  3QB3 A;  3WDN A;  4M1U B;  1S5D D;  1A3V A;  4G4K A;  1DYQ A;  4K8I A;  4Q0F A;  2EYJ A;  1SE4 A;  2Q8I B;  1LTB D;  1S5B D;  4AYB B;  3MTS A;  1U4L A;  1EY5 A;  1V8Q A;  5KNB A;  5D3D A;  3NQI A;  3EFX D;  1SYC A;  4HAE A;  1I3Q B;  2WII B;  2XVS A;  4H44 C;  3E6Z X;  1PRT F;  2L4N A;  4IUR A;  4BBS B;  2B8G A;  4RAU C;  1EY8 A;  1S5F D;  4PV1 C;  1SFO B;  1KDA A;  3MFY A;  3ERQ A;  5EBD A;  4EQO A;  3OW7 A;  4Q5V A;  1EY7 A;  2JSO A;  5EKL A;  3BYT B;  2PW5 A;  2E2H B;  1LT6 D;  1UNS A;  3TDQ A;  4ABN A;  1SSO A;  5E4W C;  5IIF A;  1NSN S;  3Q23 A;  5C0X I;  3GTO B;  3KLR A;  2Z8L A;  1C4Q A;  1EIH A;  5E3F A;  4K14 A;  2NYZ D;  4B9X A;  3TP8 A;  4K2L A;  3S17 B;  2QEJ C;  2PMZ B;  2KEC A;  4HR7 B;  3TZD A;  4FNF A;  3J81 E;  5CV7 A;  2PO4 A;  4ULL A;  1RKN A;  5FO7 B;  2D2C C;  1GUO A;  1IKL A;  1STA A;  2Y0S B;  4A3K B;  3R3O A;  5C44 B;  1Q12 A;  2F3V A;  2BCO A;  3HZX A;  4KY5 A;  3GV6 A;  4RCO A;  1EY0 A;  1BCP B;  1LLR D;  3IL8 A;  2EY5 A;  1BUV T;  4IUQ A;  1KAB A;  3RLF A;  1TVX A;  4C3J G;  3NUC A;  3FRP B;  2AUJ D;  1E2V A;  2BDN A;  3BYY B;  3I70 A;  4WFN 3;  4DU9 A;  4KKT A;  1VF5 C;  3FPP A;  1QNK A;  1STB A;  1A3T A;  2PYK A;  1CHP D;  1EQV A;  3S9W A;  2IT1 A;  3P75 A;  2F0K A;  1A2U A;  3JAM E;  2E2J B;  1TQO A;  3V96 A;  1Z6H A;  1TWC B;  5J39 A;  2CQA A;  4DF7 A;  5I4D A;  2R6G A;  2JEB I;  4XQQ A;  3I4M B;  4KMU C;  1ZYR D;  1C48 A;  1B44 D;  1YNJ D;  2Q8R E;  4TQU S;  1LAC A;  1NAP A;  1Q8I A;  3VYT A;  5M9O A;  3K5O A;  1DZ1 A;  1O80 A;  2XRS D;  2I46 A;  2X69 A;  4ODG A;  4QUC A;  3CU7 A;  1HPC A;  4IUU A;  2J4X A;  3UI2 A;  4ZK9 B;  3ND9 A;  3S1N B;  4R8I A;  1K83 B;  3J80 L;  3GTP B;  1FNW A;  3A7A B;  2AWO A;  3GTM B;  4CBV A;  4QIW B;  1YNJ C;  2EE1 A;  1EYA A;  2KCC A;  2XN9 C;  2EVB A;  4G7Z C;  1EY4 A;  1E0B A;  3T53 B;  1ZKO A;  5D65 A;  2ICI A;  1DM0 B;  2K7V A;  1XX8 A;  3MXN A;  1HA6 A;  2ZT9 C;  1I4P A;  3SK5 A;  4J8Q A;  1B53 A;  1EOT A;  2D62 A;  5C6A A;  3H0G B;  1KTK A;  1LTG D;  4OHJ A;  1M8A A;  2IPK D;  4RA8 A;  3NHH A;  2J7Z A;  2F3W A;  1QIL A;  3VR6 A;  4QB4 A;  2F0M A;  4O1N A;  1CT1 D;  4MN3 A;  1I6V C;  4KJN A;  1JC7 A;  4KN7 C;  5DNF A;  2B2T C;  4RHS A;  4ZLT F;  4DK1 A;  4PNY A;  3X3N A;  1GUG A;  1ML0 D;  1LTS D;  1ZXT A;  1D6E C;  4X3S A;  1EEI D;  3S1M B;  1DOL A;  2ID0 A;  3K6O A;  4B08 A;  4OO1 H;  1RTO A;  4R9W A;  4CKB A;  1QJO A;  3F2U A;  5C4J B;  2YYZ A;  3OOC A;  4OO1 G;  1RDP D;  4S3S A;  1QG7 A;  1SAP A;  5EQ0 A;  3D31 A;  1S5C D;  4H0L C;  4ZYS A;  3BDL A;  3G6J B;  1HQM C;  1JWM D;  2RSO A;  4JK1 C;  4XQN A;  3D8G A;  1QNU A;  3MVV A;  1PYW D;  2F4I A;  2FIN B;  1ESR A;  2A6E D;  1B9M A;  1Y1V B;  1CTM A;  1TR5 A;  2WAC A;  4L63 B;  4RH6 A;  3SR1 A;  4K6D A;  2KED A;  2O2L D;  1AZP A;  2LMC B;  2DY7 A;  1TT2 A;  1OO9 B;  2QDB A;  1TWH B;  2L5T A;  5AFW A;  2DN8 A;  4P2C B;  3R8B A;  1T5E A;  4K2K A;  1Y69 U;  1ENF A;  3QOJ A;  3LNN A;  4BBR B;  2JE6 I;  1YNN C;  3DEO A;  3GTK B;  2OXP A;  1BR9 A;  3MA2 B;  2B2U A;  4PMW A;  2A68 D;  4CGY B;  3E5S A;  5LL6 X;  4YIJ A;  3C2P A;  2VB2 X;  3SE0 A;  2R93 B;  3MXU A;  5KRU A;  2K1B A;  3GP7 A;  5CV6 A;  2SNS A;  4RKL A;  5KYI A;  1SNC A;  1PFN A;  3CRK C;  1D5Z C;  5EPL A;  1PRT C;  3CQZ B;  1U4P A;  3OHX C;  4GZY C;  1PTO C;  4A3J B;  2EJG C;  2BDO A;  2QIL A;  5FKA C;  1RHP A;  2E76 C;  4NKL A;  4MHE A;  3TN2 A;  1R4P B;  3EVQ A;  3OMG A;  2A68 C;  2NUC A;  3CRL C;  1BCP F;  2F0L A;  1PXU A;  3KLS X;  2BA0 A;  1ZEQ X;  3LWE A;  4ZKB B;  1A6X A;  2NZ1 D;  1SYB A;  2SNM A;  5J22 A;  3MAQ A;  5HUR A;  2QF7 A;  1H9S B;  2RBM A;  4C3H G;  4QUF A;  3PO3 B;  4XT3 B;  3PUZ A;  5CBA E;  2MJ8 A;  3QOL A;  5G3L F;  1OXT A;  1FYC A;  2DY8 A;  2PCF B;  1PLF A;  5KNC A;  5D3I B;  3EJI A;  4IZ8 A;  1F9R A;  1IYV A;  3I73 A;  2IX0 A;  1HTP A;  2PZU A;  4ZRZ A;  3MC0 B;  1HUN A;  5IGE A;  3MWY W;  4DGZ A;  3HKZ B;  1G29 1;  1KLU D;  5ELD A;  3URY A;  4PQX A;  4WOR A;  2M2L A;  2KJX A;  1EZ8 A;  4RWS C;  3J7A F;  1NCV A;  1Q1B A;  4NDX A;  3GQB A;  4OL7 A;  1HRJ A;  1BNZ A;  1I4Q A;  1TS3 A;  3KBG A;  2BE5 C;  4EGV A;  1KLG D;  1FNV A;  4HCS A;  1EFI D;  3P1H A;  1SDF A;  2F0N A;  1MGS A;  5COR A;  5A2Q E;  3R2T A;  1BOS A;  2B2W A;  3K5M A;  1GHK A;  3KLS A;  3A55 A;  3NK9 A;  2WP8 J;  2RDH A;  1ROD A;  3HOZ B;  1E2Z A;  4RFB A;  5JAV A;  1EEF D;  1PZI D;  5JVG 3;  2Q8T A;  4LK1 C;  2F0I A;  4U67 3;  1GUN A;  1GOZ A;  5K5P A;  5CGK A;  4RGM A;  2HQE A;  4KHZ A;  4XXE A;  4X3K A;  1LT4 D;  5J1Z A;  4KN4 C;  2F0P A;  2FMC A;  4BY1 B;  2Z4H A;  1SBB B;  4X3T A;  1SYF A;  4XYQ A;  1VMP A;  1IL8 A;  1RF2 D;  2B2T A;  2N88 A;  2E2I B;  1G2S A;  2MHV A;  3IKJ A;  5JOB A;  4LJZ C;  2FFK B;  1QCB D;  2DNC A;  5BN5 A;  1PTO F;  2EYF A;  1STH A;  2VUM B;  3J81 L;  1TWA B;  2KCN A;  1DON A;  1B9N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...