1SNOA

Protein stability in staphylococcal nuclease
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
136
structure length
136
Chain Sequence
KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQLLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Coupling between trans/cis proline isomerization and protein stability in staphylococcal nuclease.
pubmed rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords STAPHYLOCOCCAL NUCLEASE
total genus 38
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 1996-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1snoA00
5C4HA 2F0IA 3DMUA 1A3VA 5CV5A 5CV6A 5KGUA 3ERQA 3EVQA 2LKVA 3EJIA 1STAA 1STBA 4PMCA 5NUCA 4LAAA 3BDCA 1EY4A 1IHZA 4N9PA 5IGGA 5KYLA 1EZ6A 4DGZA 1SNQA 4K8IA 2EY2A 1SYGA 2F0OA 3NQTA 4K2KA 1SYBA 2EYHA 1EYAA 2SNSA 2RBMA 2F0LA 3MEHA 4B9WA 3T16A 3TP6A 1SYFA 4J6HA 4F8MA 1EQVA 2QDBA 1ENAA 3QOLA 4TRDA 5KIXA 3OSOA 4KY7A 1A3TA 5CR3A 3OMGA 3SK5A 4KJNA 1EY9A 5DEHA 5I9PA 5JOBA 3RUZA 2F0HA 2SNMA 5IIFA 4WRDA 2F0QA 4KV6A 3D6CA 1ENCA 1SNDA 2EYLA 5EKKA 1NSNS 1KDAA 2RDFA 2F3VA 3TMEA 1EYDA 4RKBA 1TQOA 3U9OA 3NP8A 5HURA 1KAAA 3HEJA 5DAUA 2F0UA 3C1EA 5C3XA 2F0WA 1EY8A 2F0JA 5EKLA 5IGBA 2F0KA 5K5PA 3QB3A 4ZQ3A 1STGA 5KYIA 1KDBA 1SNOA 1STYA 4HTHA 1JOQA 2F0VA 3C1FA 3QOJA 4K14A 4MIUA 4NMZA 1SYCA 1EY0A 3SK6A 3NUCA 1STNA 3MHBA 4DF7A 1RKNA 2WACA 1A2TA 4H7BA 4I65A 4K5XA 3PMFA 1EY7A 4KY5A 4ODGA 1F2MA 4K8JA 5IGEA 4RKLA 5M9OA 5CC4A 2PZWA 4K5VA 4EQPA 3MXPA 2F0GA 1SYEA 2EY1A 2RKSA 4IZ8A 3MZ5A 2PW7A 4YIJA 5C4ZA 2O4XA 5JAVA 5J1ZA 2EY5A 3TP7A 5E3FA 2EYFA 3E5SA 2M00A 2PW5A 5IGCA 2OXPA 3H6MA 4KTAA 1SNCA 3P1HA 4ZUJA 3MVVA 4J1MA 4ID6A 4EQOA 5EGTA 2OF1A 4KY6A 3SK8A 1EY6A 3LX0A 2PQEA 2SOBA 2PZTA 3NK9A 2F0EA 4KHVA 1A2UA 2EYOA 4PMBA 3NHHA 4NKLA 2NUCA 3SK4A 5C3WA 2F0MA 1KDCA 3TP5A 4WORA 4IUNA 5CV4A 3VA5A 3D4WA 5I9OA 4KD4A 1F2YA 4KJOA 4IALA 4S3SA 5CV7A 5HGTA 5ISRA 4K2LA 3SHLA 4EVOA 5I6WA 5CV9A 1JOOA 3R3OA 3NXWA 4G57A 1EZ8A 5CV8A 4NDXA 3P75A 2EYPA 5IOCA 2EY6A 4HMIA 5C5MA 5KRUA 3SXHA 4QF4A 3T13A 4K5WA 1TT2A 2ENBA 4NP5A 3TP8A 4F7XA 1TR5A 1SNPA 1F2ZA 5F2DA 2EYMA 4QB4A 5CGKA 1KABA 1A3UA 2PYKA 4ZUIA 2F0SA 4QMGA 3V2TA 2F0FA 4DU9A 4E6IA 1JORA 4EQNA 2OEOA 4N9TA 3S9WA 1EYCA 5KEEA 1EY5A 2F0PA 5IODA 3D8GA 1JOKA 3EROA 5J22A 2EXZA 3DHQA 2F0DA 3OMCA 2F0TA 4KD3A 4R8NA 4DFAA 5I6YA 5IGDA 1U9RA 4HMJA 1NUCA 4ME5A 2KHSA 4PNYA 1SNMA 2F3WA 1STHA 2HQEA 2PZUA 5C6AA 2KQ3A 1AEXA 2F0NA 3HZXA 3SR1A 3D4DA 4B9XA 2EYJA 3OWFA 5IGFA 3BDLA 4OL7A 4K6DA 5E1FA 3ITPA 1SYDA 5J39A 1II3A 5C5LA
chains in the Genus database with same CATH superfamily
3LWEA 3C3LA 1B2TA 1ZYRC 3ND9A 1X65A 3RZOH 2K7VA 4XT3B 4CDFC 5LL6S 1S5CD 4DR4Q 3M4OH 1ILQA 1PTOF 4JI1L 4QCLA 3CQZB 2R92B 3QJYA 3NBHA 1B50A 3T16A 2Z6BA 4R4TA 1MGSA 4F88A 1G6PA 4ZRZA 1O7YA 3RUZA 4DN4M 5C44B 1YITA 4R4OA 4IUPA 3HOYH 3DWPA 3AU7A 1BCPC 4J8QA 3HKSA 3NENA 1V43A 1TIID 3CRKC 2H1EA 3KLRA 5TSSA 1N34L 1SNOA 5IT9c 2OWOA 4P75A 2FINB 2HD3A 1ZKOA 1N34Q 1S5DD 3S1RH 3HOXB 1Y69U 1K28A 5EQ0A 2K5NA 3MFGA 2ZT9C 1V8QA 4LF8L 5C4ZA 4X64Q 5M5YH 3U4ZA 2D5DA 4ALPA 1TS4A 3NTIA 5E4XA 1IYUA 2BDOA 4WJ3M 1KRTA 2AHOB 4DK0A 1QUQA 1X9NA 1IXRA 2VL6A 4A3LH 4WORA 2R7DA 4IOAA 1PYSB 4ZKCB 4BXXG 1VQDA 1BCPB 1Q8KA 2FMCA 1H9JA 1QVFA 3W3AA 1LTAD 1Y8PB 2LSSA 2Z4HA 1EU4A 2F1MA 1QG7A 1F2ZA 3D3RA 3E0JA 3HS0C 4X3SA 4A3EG 2HHHL 1XMQQ 3K5LA 4OX9L 1RDPD 3J80c 1QILA 1EOTA 4JI8Q 4HIDA 1SR3A 3M7GA 4DAYA 2KQ3A 3T1HL 1TS3A 1EFID 4UP9A 4LUVA 3FMCA 2VB2X 5IGFA 4DR4L 2KVMA 1PH6A 3DUZA 4BA2I 4DV2Q 2JA7H 3N52A 1VQ8A 4C3JH 1ML0D 1EY4A 1I4HA 1VQMA 1HNXQ 1H9MA 3H0GH 3GTMB 3PCOB 3F2BA 1JJGA 4OIKA 4KHPL 5FKAC 3I7FA 1PRTF 3QG1A 5G3LF 1LM0A 2A74C 3OOCA 3KK7A 2IHEA 1KDAA 2MHVA 3HEJA 1CFMA 3BZCA 5IGBA 3TS0A 5JEAG 5C4XG 1WOCA 2RHSB 4LF6L 2B2VA 4Z9CB 1VCIA 2PMZB 1JOQA 4LFCL 2NVYH 4JG2A 2A69D 2JA9A 1RKNA 1GO3E 5IGEA 2J4XA 1M4VA 3S17B 4KKSA 2XRQD 2RKSA 4ZAIA 2PW7A 4HSVA 3A7AB 1DOKA 1RCVD 4HJ9A 3TP7A 1E0BA 2M00A 5IE8A 1L1OA 3H6MA 5HGQA 1BBWA 2JA6B 4ID6A 1HQMC 1H9SA 4DR2L 3A5UA 3CKIB 4B3SQ 2SOBA 1W6KA 4C3HG 1HZBA 5I9OA 4BA1I 2BE5D 4DV5L 1BCPF 2MQHA 2CH4W 4RGNA 3L7ZC 1S40A 2I5MX 2Q2TA 1AW7A 3A55A 1BDOA 3T13A 3K8AA 4IN3A 1PA6A 1V1PA 2VXWA 1SNPA 4JI4Q 2A8VA 3CPWA 2CQOA 1TWCB 1NMFA 1AZQA 4JI3Q 3E3XA 1OTCA 4RGOS 2BOSA 4YCWA 3VYSA 1CK1A 3ZYYX 1SE2A 3H91A 1VQ9A 5D3DA 1FJGQ 1P16A 1PRTB 2ZXPA 1CUKA 2OTJA 4DR3Q 3GD7A 4IPDA 4JV5L 4A3FG 1B70B 1XPUA 4Y7NH 1D5ZC 1LTBD 5CV5A 5ELCA 3S1RB 3CXCA 1MD2D 2L11A 4O0AA 4K8IA 1SYGA 2Z1CA 1FNWA 1MBYA 2QF7A 2JA5B 5FO8B 1PDQA 4GKJQ 1AE2A 4L5QA 1V1OA 4IFDI 2JQOA 4A3EB 5FJ8H 1WTRA 4LF9L 2E76C 3FP9A 5CR3A 2A1AA 2SNMA 1CA6A 1N9WA 1C8CA 2IX1A 4H02A 2F4VL 2RDFA 4DR1L 1Y1WG 1XPOA 5GQOA 1CQVA 2KCCA 2F0JA 1F9RA 3KOJA 3QB3A 1VQHA 4NXNQ 2UU9L 5ELDA 2K5VA 4LF7Q 4RWSC 1PH2A 4OELB 4RAUC 1FL0A 4DF7A 2RVLA 2VQFQ 4I65A 1H9RA 4HIKA 3ERSX 1PFMA 2NZ1D 4IZ8A 1BF4A 2XWBB 1TU2B 3T1YQ 2EIFA 4BBSG 3EBEA 1WTPA 1PHJA 3K59A 1HZAA 3I90A 3V96A 1CQFA 4J15A 4EX5A 3I4NG 4L63B 3NEMA 4FNFA 1O7LA 1WI5A 1D2BA 3TDQA 4N8FA 2ZTEA 2KEEA 5CV9A 4FF1A 1IZ6A 4XYQA 3GTPH 1QZGA 2EYPA 2MGSA 2XNAC 3FKIB 5EAYA 2EZVA 4IUTA 2D9UA 1PV4A 2JA5G 4O2DA 1TWAH 2A68D 4DPGA 1KNEA 2HIXA 3VYRA 1A3UA 2FXQA 2F0SA 4JI2L 4OWXB 2MO1A 4DU9A 2MJ8A 3NWTA 1T9HA 2IJ0A 3P7JA 2RDHA 4K6LA 4JI6Q 2JE6I 4L5TA 2B63G 4A93G 1EUJA 2NVYB 4JC0A 3RLOA 2NVTH 3FPUB 4L6TB 1S5BD 1ESRA 2FFKB 2EJGC 2A19A 1O80A 4UY8C 1I50H 2JA8H 1KAWA 2WAQG 4C1NI 4C3IB 2K5QA 4FF2A 1PXUA 1EEID 4ABNA 1WVLA 3BU2A 3HFZB 3KDFA 4AYBG 3ERQA 1WTQA 3TEHB 1X3FA 3DM3A 1U5KA 3TS2A 4PZ8A 3CQZH 4CJ0B 2R92H 2O5JC 4B9WA 1J9OA 5ELOA 4OEMB 1VQJA 4FDBA 2I07B 4BBRH 5A2QL 2PCFB 2WIIB 3OSOA 1PYBA 1A3TA 5M3FH 1ZEQX 4OGQC 1HFNA 2NN6G 1IL2A 3DWAA 5LHY1 1PZID 2PI2A 4OO1I 1TQOA 3S15H 4RG1A 5BN5A 5FLMG 3GV6A 2F0UA 3BG3A 3CCJA 1PH8A 1LACA 3Q22A 3BZKA 4LFCQ 2E2HB 3HKZG 2Q8TA 1NMGA 2HUGA 1SJHD 3QO2A 1YJWA 2YTXA 3MHBA 4AYBE 5M9OA 3PIO3 2PZWA 4EQPA 3K58A 2HT1A 1GUWA 4RMFA 2IW3A 2R7ZH 1RHPA 3PO2G 4IFDG 5JAVA 4A3FH 2IY5B 1EWCA 3E5SA 2PW5A 2R61A 4AIMA 1J8IA 3R93A 4X66Q 1I94L 1RIPA 3D31A 2EYOA 5M5YB 3OPOA 2B63B 1CHQD 4APVA 4BBRG 3SHLA 1B4OA 2I5HA 1TS5A 5M3FG 4B3MQ 4DR1Q 3I3CA 3MXNA 3TRZA 2G5DA 4P74A 4A3LG 2NTSA 1MSHA 5IT9L 1IYVA 3V05A 4A3IG 2LY7A 3ULJA 3CCSA 3Q6SA 1TVXA 2B29A 4C3HB 1E1TA 1VMPA 2E2HH 5J22A 4I7AA 2HHHQ 2EXZA 5COYA 2B2UC 1FGUA 1QB5D 1EWIA 4A3BG 4KHPQ 1AEXA 2ZXOA 3SR1A 3W5OA 1B3AA 4PZ7A 4GLAC 3F1ZA 4RHSA 1Q86C 5C3EG 2DJGC 3M4PA 1KQSA 4KI0A 4BY1G 2VQEL 2K03A 1B8AA 4DV2L 4P2CB 4CKBA 3U50C 4A3CG 2NWGA 1PMRA 4JBKA 4CKCA 3AFQA 3MWYW 4GLVB 4UAIA 4C3JB 3CC2A 3CCRA 1N36L 3S1NB 1B7YB 3SK5A 3OIQA 4LMQD 2Q2UA 1ENCA 3M85A 2O2LD 1LABA 4CJ2C 5KNBA 1D1KA 3J81i 1VQ7A 4O42A 2Z0SA 1E3PA 1UE7A 1PFSA 2XIWA 1VQCA 1ICFB 2UUAQ 5K36H 5AJ3Q 2RHQB 3NTKA 1PRTD 1LTSD 2R6GA 2XSCA 4MIUA 1SXTA 1EY0A 1A0IA 1DCZA 2M2LA 4FVMA 3J81E 2L9HA 2Q8RE 1K8OA 4GKKQ 3FPPA 2IL8A 5EPKA 1JMCA 2EY1A 4A75A 4C56C 1C7YA 3K81C 3KDFB 3B6YA 1CKNB 3J80L 2R93G 1HUMA 1WFQA 1S4ZA 1VF5C 4DV4Q 4IPGA 3UE1A 2E2JH 4LF4L 2F0EA 2K5WA 2AWNA 1HTPA 4GOPB 1A63A 1UEBA 3TP5A 1CZWA 1YNJD 1TXYA 1YNNC 3FKIG 4QL5A 3I8ZA 1VMCA 5HGTA 2PI2E 4JW0A 1G291 2D2CC 3W1GA 3QWNA 3I72A 5IYDG 4NP5A 3K57A 1A6XA 3VR4A 1OXUA 2EYMA 3BZDB 2XRSD 1PFBA 1X6OA 3MAQA 4EQNA 5KEEA 2ASBA 2FHTA 1X3GA 3EROA 3GQBA 4KKTA 2NTTA 1HNXL 4K0KL 1CTMA 3TZUA 4X3TA 1I4RA 4EQ5A 4JOIC 3HZXA 2XTIA 3BS1A 1HQRD 4DV0Q 1HNWL 4QGUA 1EQRA 3I4NB 1VQBA 4QIWE 1JWSD 1Y8OB 4PMCA 1MKHA 1STAA 5IGGA 3A8KE 1SFOH 1EZ6A 2O5IC 3G4SA 3KF6B 3I4MB 3KLSA 5HY6A 3H15A 4PG3A 4B3RL 4X66L 3VYTA 4OHJA 3I91A 1HR0Q 2K5DA 5IP7H 2QEJC 4Y7NB 3ULLA 3MTSA 1WTXA 1EYDA 2MO0A 2D62A 3CHBD 5C3XA 3S14B 2RQXA 2F0KA 1GOZA 1IKMA 2I46A 1T5EA 1SJED 3S1MB 2PPBC 3QOJA 3A8IE 5M5XB 4LF4Q 2X6LA 2B2YC 4LUZA 1J5EQ 1F2MA 4K8JA 3GTQH 1XMOQ 1ONLA 2BE5C 1PVOA 4ZYSA 2L4NA 4NB3A 2PNRC 4CKEA 5I2XA 1CHPD 3AYHB 1Q8IA 5EBCA 1XTDA 4DK6C 4LF8Q 2V4DA 4KTAA 1TWFH 3NQIA 5IWAQ 2OF1A 3K80C 4NXML 3M4YA 1B3QA 3NK9A 2GN5A 3SK4A 1SEBD 1A2UA 1UNSA 3VR2A 3NHHA 4BBSH 4UHVA 3I56A 2IPKD 4YHHQ 1FYCA 3HRZC 4BWGB 2EY6A 4A3DH 3LNNA 2A69C 4R8IA 4K5WA 2HCCA 3TP8A 1L0WA 4YY3L 4DAYB 5IP9G 2OT2A 2K04A 4YHHL 5IYCH 4PMWA 5K36G 1A15A 4JK1C 2JA8G 3ULPA 4QUFA 3GTPB 4JI2Q 1QVCA 4XTCS 1HH2P 4HIMA 2F0TA 2KBNA 5IGDA 2Y0SG 1MIUA 4ZK9B 5C6AA 2KCNA 2F0NA 3AB9A 3I4MG 3OWFA 4IURA 4DK3C 2NVXH 1NE3A 1SE8A 2AQ1B 5LMUQ 2CQAA 3BDCA 3UE0A 1L2FA 5KYLA 1C4QA 4JI4L 3W2DA 4HSPA 4TSSA 3HGBA 4IPHA 3Q24A 4K2KA 3DXJC 4B3TQ 3K5OA 1BVSA 2IWHA 2JA8B 4OWTB 2A73B 2EOTA 4OO1G 1BBUA 5JPMC 4TRDA 1JCKB 1F9QA 3CCUA 1U4MA 4AH6A 1KL9A 4PV1C 5JJKA 3H0GG 2E5LQ 1JICA 4POFA 1LTLA 1YEZA 2DNEA 2F0HA 1UUPA 2EYLA 2A6HC 3PUWA 2EJMA 2RF4A 1EQTA 2K50A 3AQQA 4NXMQ 4QIWB 3S15B 1I6HB 2N3SA 1ZYRD 4LWCA 1JR0D 1PZJD 3I73A 1FVIA 1GUNA 1NTGA 1T5XD 2R7ZG 3DEPA 3PO2H 3J81L 4A3KB 1HUNA 4K14A 2Q2IA 5M3FB 1STNA 4XT1B 4KY5A 3STBC 2VZAA 2K75A 5E4WC 3RN5A 5C4XH 2EVBA 3H3VI 1HCZA 4A4IA 3MC0B 3I4OA 4FO2A 1YI2A 1NR2A 5C4JH 1KD1C 3HOUH 4UP7A 4GOPC 3HOVG 3MFYA 1R4PB 1C0AA 4KN7C 4GKJL 2JA7B 5KNDA 1U4RA 4BS9A 5CORA 3GTGH 4KJOA 4EVOA 4MN3A 1Z47A 1CI3M 1QCBD 4G57A 2NZOA 4DR3L 1Z7TA 4MNOA 1BNZA 3GP7A 4CDDC 5ELEA 2VUMH 2WAQB 4DNIA 5FLXL 1KABA 2WINB 4A3BH 4CHTB 2B2TC 1WD0A 4M8AA 5C44G 3WDNA 1JC7A 4R8NA 4DV4L 5C0XI 1GD7A 3JAMc 2L5TA 3NWSA 3HOXG 3TZDA 1I6VC 2Z4IA 2EYJA 3C2PA 1IW7C 1BQQT 3LGJA 4YY3Q 3J7AF 4X62L 2ZXRA 1VF7A 3PF4A 3HOVH 5FJ8G 1DOMA 2N55A 1BUVT 3G48A 5M3MG 1SYBA 5JPNC 2EYHA 2AUKA 2UUAL 4F8MA 3RLFA 3QOLA 1W3SA 2EPBA 4LUOA 4KJNA 5I9PA 4KMUC 4FYDA 1Y1VH 1ET6A 1XWEA 3D6CA 4HR7B 3M4OB 1GHJA 3M3YH 3TMEA 1F9PA 3NBHB 2VUMG 1YZ6A 4XIGS 4CJ1B 2JEBI 1EU3A 2YTVA 4LF6Q 3ND8A 1QJOA 3UDGA 1VQ6A 4X64L 1I4XA 3J7AV 3S16B 3VDYA 2OQKA 3NUCA 2JEAI 4LK1C 4X65Q 4BBRB 1LT5D 3HP3A 3U4VA 2RSNA 5CC4A 3IL8A 3MXPA 4A3GB 1C48A 1SAPA 1SYEA 1UAPA 2B2VC 1PZKD 1QE6A 4R4QA 2ZM6Q 2EY5A 1KRSA 3HOZG 1DXMA 1VQPA 2Z8LA 1PH7A 4ZUJA 3MVVA 3P20A 3QIAA 1B9NA 2TSSA 1ASZA 1PLFA 1E2WA 1HZ9A 3VR3A 4KHVA 3W1BA 1CA5A 5KNCA 3EQLC 4EGVA 3PF5A 4B3RQ 3S2HH 2UU9Q 4IUNA 3KLSX 4BY7H 4JOIA 3P75A 4HMIA 5C5MA 4RGMA 1GUSA 2E8GA 1SDFA 5BN3A 4A3FB 3CC7A 3FVQA 1XNRQ 3NBIA 3GTJB 2D0PA 3D0FA 2PYKA 4ZUIA 2UXBL 4P71A 3UDIA 1LLRD 1HTLD 2K5HA 5IYDH 2HDMA 3ICEA 4QJFA 4V190 4KD3A 5I6YA 3J7ZC 3PIPA 4WJ4A 2JYOA 2WFWA 3R2TA 5EPLA 1R9TH 1F2LA 1JE4A 1YHAA 1FR3A 4JI7L 2N88A 2J7ZA 5E7NA 5C4HA 1FGBD 2G9DA 3PIP3 1Q90A 2K52A 2WB1E 2Q8IB 4JI0L 1BCPD 3ER0A 1K73C 1JJ2A 1XNQL 1G6ZA 4C3HH 1WTVA 1PH5A 3MEHA 4AQYL 1VQIA 4BY7G 4BXXH 1OXVA 1N33L 2HDLA 3R2IA 4KY7A 5DNFA 3OMGA 5AFWA 3SDZA 5IIFA 1NNXA 3ZJYC 1DGSA 1DJRD 3PUVA 1V1QA 1MJCA 3OTOL 3CF5A 4GS3A 4KHZA 1Q46A 2NYZD 5HURA 1S3OA 2IHFA 3A0JA 5IP7G 5EKLA 1STGA 1U4LA 3N6RA 2JN4A 1STYA 4C2MH 2D0OA 5D14A 1Y14B 2EXDA 3KLWA 4QQBX 4KLKA 3HG9A 1I4QA 1Q82C 2MP1A 4C3IG 1EYGA 5M5WH 1E2ZA 2WB1G 3GTQB 3FRPB 1L0YB 3KFUA 1TWCH 2ICEC 4R4IA 2RSOA 2AQ3B 1KC8C 3MXNB 4GNXC 3CCLA 3F2CA 2KHJA 2QEXA 3RN2A 3VA7A 3MEFA 4J1MA 2JK8A 1EY6A 1QVGA 2PQEA 4JI5Q 1XJVA 1LO5D 1DOLA 1OXTA 1WCMH 2KUMA 1IBLL 3KF8A 4X6AH 1F2YA 4IALA 4S3SA 5EJWA 2ZJQA 4K2LA 1X56A 3CCVA 2DUDA 3FHWA 1XYIA 3EN2A 1PTOH 1VQAA 3S1QB 1PRTC 4LW1A 1EOVA 1IYJB 3MXGA 5ELFA 3CCQA 1G2TA 3KBXA 2Y0SB 1Q81C 1KHIA 2LMCB 2NZHA 4FXKC 4KN4C 4RH6A 3S9WA 1BBXC 3GTOH 3S16H 1VQKA 2KOLA 1DYQA 1OXXK 4PNYA 4OIJA 5IYCG 3KF6A 1RODA 3CD6A 1D7QA 1XNRL 3NELA 3T56B 4OL7A 4JI6L 4DV1L 3ITPA 3M4QA 3A54A 2F0IA 1QWYA 5CV6A 4Q0FA 1SNQA 3D4RA 4YCVA 4U673 4GZYC 1SFOB 1KLGD 2RBMA 2VS1A 4A3GG 4DUZQ 2B39A 1EIYB 1WD1A 1HJPA 2R3ZA 1I94Q 4ZKBB 2UXCQ 5JOBA 1CSPA 1JWUD 1E7ZA 2DNCA 3OHXC 3RZDB 4A3CH 5EKKA 1WJJA 2NVQB 3GTKH 2E5LL 4X3KA 2UXBQ 1HHVA 2ATWA 4UDUC 4HIOA 1PYWD 4UPAA 5BR8L 1EY8A 4JYAQ 4V0BA 5KYIA 3FEWX 1IW7D 2B63H 5LMNW 1K3RA 2CH4A 1HA6A 4Q5VA 3Q23A 1Y1WB 1RD9D 3AFPA 3CW2C 4MHEA 3JAML 3IAYA 1JT8A 3HOWG 3HOWB 3ONAB 4NXNL 1NCVA 2EE1A 1SROA 1SNCA 2Z9HA 5H1SE 2VQEQ 2C35B 1O78A 1RL2A 1NR4A 1X3PA 1AE3A 2CVRA 2UUCQ 4GNXB 2KCTA 1LV9A 5JJZA 3S1MH 2NUCA 1KDCA 2R92G 1SN8A 1YVCA 1DD2A 1JOOA 3T4AC 5J3BA 1YNJC 1YNXA 1WYDA 3SXHA 1N8RC 5D65A 1U0LA 2ENBA 4IUUA 2A5HA 2B2WC 3A56A 4A3DB 3K5NA 2JJQA 4B08A 5JJIA 1CKOA 1JJCB 3K0XA 5L37A 1Q12A 1JORA 1O7IA 4C1NK 4JI1Q 2QKIC 3T53B 5GAEC 4B3SL 2YU9B 2IX0A 4B3ML 5I4DA 4MTKA 2N78A 2K28A 2C5CA 3STBD 3S1NH 1ILPA 1GKHA 2IX3A 1HXYD 1HNZL 1K0SA 3D4DA 3PUZA 1J6QA 2ZJPA 4DUYL 5LMNL 5M3MH 3A74A 1K3BC 1SYDA 3NSWA 2CWAA 3U9OA 3K5MA 1XMOL 1X3EA 3KBGA 2QDLA 4TQUS 3HOVB 2ZTCA 3PIOA 1K83B 2DGYA 3GDEA 3BDOA 1LUZA 3UI2A 5ELNA 4DXGA 1Y1VG 3F2UA 4DV3Q 4HJ8A 4CBVA 1XXGA 4GN3B 2WP8J 2B2WA 2QW7A 4POGA 3PO3H 3PGZA 3URYA 2N49A 1WTWA 3KJOA 4JBMA 4YWMA 1IBMQ 2B8FA 4WRDA 2CW0C 3J7YW 1CKMA 1PTOB 1HRJA 1SNDA 1NY4A 1L0XB 2WB1B 1YJ9A 4DR2Q 1ENFA 3A5ZB 3VR6A 2OTLA 5DAUA 4XQJA 4A3MH 4A3IH 2MPMA 4RA8A 3QR8A 2VQFL 3S1QH 2A68C 2BH8A 4HTHA 4NMZA 1LTGD 5GAHC 3H0GB 3GTMH 1VDZA 3HOZH 3E9HA 4ODGA 3OYYA 3RZOB 3Q8DA 3CPFA 1BKBA 1R4QB 2PQAA 2WKDA 2EQSA 4LFBL 3GTOB 4DV0L 2AUJD 2O4XA 2GVAA 2ALYB 4LFAQ 3T1HQ 5IGCA 4C3JG 2L55A 3SEBA 2K05A 1RTOA 2SEBD 2YTYA 2WAQE 1VQNA 2I0QA 4A3KH 3S2DB 1KNAA 4B3TL 3M9BA 4OX9Q 1EQQA 4RHRA 4KD4A 3PO3G 2F52A 5CBEE 4DR7L 4JBWA 4NDXA 2YV5A 3X3MA 2E2IB 2X6GA 4IUQA 3HOUB 2AKWB 3OW7A 5F2DA 3GTJH 3AEVA 1EIHA 4A3DG 4DV6L 5IY0A 4BY7B 4HEDA 3OW2A 1TWGH 1TY2A 4A3IB 3S14H 1B9MA 3KYHC 1U9RA 4XDXA 4JI3L 2VW9A 3HOZB 2MUYA 5M5XH 3HKZE 1Z9FA 4A93B 4LNQA 4IQZA 4M1UB 5C0XG 1K0RA 1XTCD 4YCUA 5C5LA 4GN5A 3DMUA 1TWHB 4AYBB 4OO1H 2R93H 5NUCA 2LKVA 4WFN3 4GKKL 2K6AA 5BR8Q 1K8AC 4JYAL 1IHZA 2DJFC 2NVTB 3EFXD 4DV5Q 3PO3B 2PMZE 2UUCL 2SNSA 1SBBB 2DY8A 2QA4A 1SSOA 3TP6A 1SMYD 4HCEA 2V1CC 1EQVA 1ENAA 5FO9B 3I70A 1V1PB 3CAMA 1VQ5A 1QNUA 2F0QA 3RMHA 3GV3A 4IPCA 1KIXA 4LF7L 1NSNS 2XWJB 2B3GA 1H95A 2AWOA 1X32A 1K8GA 1PTOC 2F0WA 3UDXA 3X3NA 2PNHA 2F4VQ 3RLNA 1CSQA 4BBSB 4DV1Q 1VS0A 2E74C 1H9SB 1XX8A 2K33A 3PUXA 1RF2D 2Z6KA 4PQXA 2FJ2A 3K0YA 2F0GA 3F8TA 1ZXTA 4OXPA 1S72A 2VUMB 4K0KQ 2HCIA 4HCSA 3Q0AA 2UXCL 3SVMA 2YYZA 1SLJA 1FD7D 2EYFA 1D6EC 3JAMi 4DUZL 4EQOA 4GOPA 4XYOA 2NVXB 3G6EA 3LX0A 4DXFA 5M3MB 3IKJA 4DAMA 4ULLA 1DZ1A 3VA5A 5CV4A 1XPRA 1CM9A 5ISRA 1VQ4A 3RD4A 1P8LA 3R3OA 1YNND 3TREA 4R4CA 1EZ8A 4XXEA 5IOCA 1STEA 1D5XC 3F2DA 1WCMB 4G7OC 1EL0A 1RTNA 4F7XA 4FXDA 3E6ZX 3DEOA 1IBML 3RNUA 3RR5A 1ET9A 3EA6A 1HR0W 1PTOD 2LXJA 4CDEC 2JA6H 1SRUA 3JC66 5FLMH 4A3MG 4DK1A 3J7A5 1HA5A 2N8NA 4JBJA 4A3JB 1TS2A 1X3QA 3V2TA 3TSSA 2UXDQ 2OEOA 4H13C 3G6JB 1EYCA 2F0PA 1PH1A 1I3QB 1AN8A 4JCVE 4FP5D 4ME5A 2KHSA 2XGTA 1WTHA 1JB7A 5IT9E 4R1JA 1NAPA 1SMYC 1CKNA 3IFDA 3BVMA 5EBDA 5C44H 5C3EB 2CKZB 5IODA 1A3VA 5AJ3L 3EVQA 1IBLQ 5ELBA 1GUOA 4GN4B 4FXGC 3KJPA 4A3KG 5G3LD 3NQTA 2WKCA 4DV7Q 4G7HC 1KXLA 4ZLTF 2JA7G 4NW2A 1EWHA 2JSOA 3TN2A 4GNXA 3T51B 1Q7YC 3PSIA 1SYFA 2QDBA 5DEHA 2KECA 1N36Q 1TKWB 1EFWA 2DY7A 2E2IH 4PZ6A 1Y8NB 2MNAA 5IP9H 1KAAA 1ICWA 5T1IA 5A2QE 4IFDJ 2JA6G 4JI0Q 1GUGA 5K5PA 3KF8B 1SE4A 1LTID 1TY0A 4DAPA 3RZDH 1KDBA 1FNVA 1GVPA 2K1BA 2OCEA 1SYCA 2E2JB 1HFGA 3CRLC 2WACA 4JI7Q 4XQQA 1EY7A 1QZHA 4RKLA 4HJ5A 1PH4A 1B53A 4JI5L 3BYTB 1LT6D 2B8GA 1TWHH 2OXPA 3P1HA 4BY1H 3BVGA 3M7NA 1E22A 3SK8A 4RCOA 5FK9C 3CCMA 1XNQQ 4PMBA 3HOWH 4C2MB 1M8AA 2E2DC 4DAVA 2KA7A 1YIJA 4LF5Q 1AP0A 3NTHA 3J80E 1QUQB 3S24A 4QY7A 1OO9B 1S5ED 3TBIB 1PH9A 2ID0A 2CCZA 1TR5A 4DR6L 3S17H 1N32Q 1EEFD 1MSGA 1LTTD 1QNKA 5CGKA 3K6OA 4QUCA 3TQYA 1VQGA 4JVZA 4G4KA 2NN6I 2F3IA 2F0DA 3G71A 1AZPA 1L1OC 2F3WA 3WOFA 2L15A 2PZUA 2C9OA 5JVG3 5FLXc 1NBWA 1Y1VB 4LJZC 4B9XA 4IFDH 1VQLA 3EIVA 5E1FA 4DV6Q 4DR5Q 3BYYB 1VQEA 4I7ZC 1STBA 4IO9A 3H09A 3U58A 2YU9H 3O13A 2F0OA 1IL8A 4JPBW 4RGTA 3PV0A 2K01A 3E0EA 1BOSA 1EYAA 4FF4A 1AFPA 4R9WA 1D8LA 3FKIH 2R7FA 5KIXA 4CGYB 1K83H 4H0LC 2VNUD 3KUPA 4L5RC 2ZM6L 2K4KA 5CYUA 1HZCA 1Q1EA 2KEDA 3IRBA 4KV6A 3U9SA 3HOYB 2HQLA 1C9OA 1RJTA 3HKZB 4RCNA 4RKBA 3NP8A 2PQAB 4X65L 2XN9C 1BXTA 1UE1A 2NVQH 4TKOB 4MZ9A 3CC4A 3GTGB 1CT1D 4IUVA 3GTLB 5IYBH 1E2VA 1Q3LA 3C1FA 5JJLA 1I3QH 2DN8A 2K32A 1I50B 1D1IA 1A2TA 1OXSC 3PMFA 2P5ZX 2QGQA 2IT1A 3I4LA 1AH9A 2TMPA 2L1BA 2LFNA 2OQ0A 4A3JH 3HOXH 2K14A 3LWUA 4K5VA 2RCFA 5FO7B 4DA2A 5BN4A 1Z6HA 5I2YA 5CBAE 5C3EH 1E24A 4O1NA 4NPSA 5E3FA 1DM0B 5JEAJ 4HJAA 2H4OA 2Y0SE 1I4PA 2X69A 3NE5B 2BA1A 5LL6X 3I2ZA 5GAGC 3G7LA 4IJLA 2ZTDA 4KKUA 5GROA 2RDGA 2RA4A 1JWMD 2B2UA 3OIPA 3D4WA 5D3IB 2BH2A 1DONA 3WWVA 2FMMA 3IFTA 5CV7A 5FOBB 4N8X1 3NXWA 2ICIA 1WCMG 1JQYD 5DM73 4QB4A 5A35A 4A76A 2EJFC 1PFNA 3MA2B 3H3VC 4G7ZC 2F0FA 4AQYQ 5IYBG 1EY5A 4DV7L 2JA5H 1WTOA 3D8GA 3OMCA 3DHQA 1KTKA 4DFAA 5C0XH 2VY3A 2WV6D 4A3EH 1STHA 4A3JG 3GTKB 3M3YB 4L5SA 1GXDC 4ZCKA 1UE6A 3JAME 4A93H 1L1OB 3PQIA 2E75C 5J39A 1X54A 4X62Q 3EJIA 3K7UC 4L8JA 4TVAB 5M5WB 1VQOA 3OWEB 2EY2A 2MFIA 2CW0D 2UXDL 1I4GA 3DLLA 2R93B 4J6HA 1GUTA 1YJNA 2GA4B 1IKLA 5T1GA 1EY9A 5JEAH 2HIVA 4LFBQ 3A7LA 5CMDA 1W2BA 2F3VA 1HPCA 2H5XA 1G91A 4FF3A 1VQFA 2NN6H 3S2HB 5JVH3 1M1KC 2A6EC 3SK6A 4H7BA 2XVSA 3L0OA 3CMAA 1H9KA 4HN7A 4DR5L 3MZ5A 1B44D 1GJXA 1LTRD 4YIJA 1UE5A 1QOHA 1GHKA 1TWAB 1FNUA 4WJWA 1G51A 3NPPA 1W6JA 1SE3A 1YHBA 4DNTB 3FDTA 4LF9Q 4KY6A 3WOEA 1YBYA 5C0XJ 3CMEA 2PZTA 3T1YL 3J80i 1MJEA 5C3WA 1R9TB 2GVBA 1XMQL 5FLXE 5C4XB 1D5MC 1SMXA 1LT4D 1U4PA 2KJXA 3CP0A 5C4JB 1MI2A 5KRUA 1G2SA 3C46A 1N32L 4CDCC 3J81c 5LMNQ 4DUYQ 2I5LX 1TT2A 2SDFA 1GM5A 1EIFA 3HOYG 4JV5Q 5EPJA 1A62A 3GO5A 5DM63 2F03A 1M90C 5IWAL 1O7ZA 1BR9A 1G8ZD 4LF5L 4E6IA 2Q2HA 1FJGL 2RCNA 3GTLH 2BA0A 1S5FD 2A6HD 3S2DH 1JOKA 4XQNA 4HMJA 4C3IH 1NUCA 2NBFA 1F77A 1SNMA 4DR7Q 2CWPA 1F9SA 2PO4A 4HAEA 1J5EL 2B2TA 4MTNA 2NB0A 2ES2A 3BDLA 1YHQA 4K6DA 1K9MC 2ZJRA 3HOUG 3K7AH 3PUYA 5KGUA 4LAAA 4N9PA 2KENA 4DGZA 3R8BA 4ME3A 2JP1A 2EDGA 1TWGB 1PH3A 2QCPX 1JE5A 3CU7A 1Q1BA 2B2YA 2F0LA 3L2PA 1E1OA 1Y1WH 2QILA 3L9AX 1ASYA 1JB3A 3AMUA 1LT3D 2CFMA 4U68A 2J0TD 1UEAB 3PO2B 2CHBD 4H44C 2M9VA 4KK7A 1I5FA 2G9HD 5GADC 4P73A 1NJIC 3C1EA 4GLXA 1K8MA 2LXKA 3H94A 4X3UA 4ZQ3A 1BO0A 2VB3X 4DNRB 3CCEA 2F0VA 4UP8A 3SE0A 4K5XA 2R7ZB 2F4IA 2JXMB 3D6WA 3I4NH 2L12A 4LFAL 2LS01 3I4MH 1EIGA 4DV3L 1LYLA 3BVZA 5J1ZA 2AQ2B 1KLUD 2BCOA 3UDFA 3DM1A 1HR0L 1B1ZA 4OWWB 3E9IA 4BY1B 4IOCA 3K7AB 5EGTA 4RFBA 1UWVA 3OTOQ 3SGIA 1I6HH 1ESFA 4NKLA 4ILWA 2F0MA 2KCMA 1A8VA 4DKAC 1HNZQ 4A3GH 3J81j 1IBKL 2UUBQ 1X55A 1N33Q 4A3BB 4YWLA 2KHIA 5I6WA 4Y52H 5CV8A 1HNWQ 4QF4A 2BDNA 4F87A 3I55A 2AMCB 4OONA 3VYUA 1TWFB 3MXUA 1IBKQ 2UUBL 4QMGA 4IJHA 3H3VH 4N9TA 3BJUA 4JI8L 4A3MB 5EKIA 1MHWC 5DLQE 5LMUL 4P72A 2Z6KC 3A8JE 3VR5A 2HQEA 2L0CA 3L3OC 1V9PA 1II3A 2A6ED 4HJ7A 4YWKA 4DR6Q 1CZGA 3DWQA
chains in the Genus database with same CATH topology
3LWEA 3C3LA 1B2TA 1ZYRC 3ND9A 2K7VA 4XT3B 5LL6S 1S5CD 1ILQA 1PTOF 4QCLA 3CQZB 2R92B 3QJYA 3NBHA 1B50A 3T16A 1MGSA 4F88A 4ZRZA 1O7YA 3RUZA 4DN4M 5C44B 4IUPA 3DWPA 3AU7A 1BCPC 4J8QA 1V43A 1TIID 3CRKC 2H1EA 3KLRA 5TSSA 1SNOA 2FINB 1ZKOA 1S5DD 3HOXB 1Y69U 5EQ0A 3MFGA 2ZT9C 1V8QA 5C4ZA 2D5DA 1TS4A 3NTIA 5E4XA 1IYUA 2BDOA 4DK0A 4WORA 4ZKCB 1BCPB 2FMCA 1H9JA 3W3AA 1LTAD 1Y8PB 2Z4HA 1EU4A 2F1MA 1QG7A 1F2ZA 3D3RA 3E0JA 3HS0C 4X3SA 3K5LA 1RDPD 1QILA 1EOTA 3M7GA 4DAYA 2KQ3A 1TS3A 1EFID 3FMCA 2VB2X 5IGFA 2KVMA 3DUZA 4BA2I 3N52A 1ML0D 1EY4A 1I4HA 1H9MA 3GTMB 4OIKA 5FKAC 1PRTF 3QG1A 5G3LF 2A74C 3OOCA 3KK7A 1KDAA 2MHVA 3HEJA 1CFMA 5IGBA 5JEAG 2B2VA 4Z9CB 1VCIA 2PMZB 1JOQA 2A69D 1RKNA 5IGEA 2J4XA 1M4VA 3S17B 4KKSA 2XRQD 2RKSA 4ZAIA 2PW7A 4HSVA 3A7AB 1DOKA 1RCVD 3TP7A 1E0BA 2M00A 3H6MA 2JA6B 1HQMC 4ID6A 1H9SA 3CKIB 2SOBA 1W6KA 4C3HG 5I9OA 4BA1I 2BE5D 1BCPF 4RGNA 3L7ZC 1AW7A 3A55A 1BDOA 3T13A 4IN3A 1V1PA 2VXWA 1SNPA 1TWCB 1AZQA 4RGOS 2BOSA 3VYSA 3ZYYX 1CK1A 1SE2A 3H91A 5D3DA 1PRTB 2ZXPA 3GD7A 1D5ZC 1LTBD 5CV5A 5ELCA 3S1RB 1MD2D 2L11A 4K8IA 1SYGA 2Z1CA 1FNWA 1MBYA 2QF7A 2JA5B 5FO8B 1PDQA 1V1OA 4IFDI 4A3EB 1WTRA 2E76C 5CR3A 2SNMA 1CA6A 1C8CA 2IX1A 2RDFA 1CQVA 2KCCA 2F0JA 1F9RA 3QB3A 5ELDA 4RWSC 4RAUC 4DF7A 2RVLA 4I65A 1H9RA 1PFMA 2NZ1D 4IZ8A 1BF4A 2XWBB 1TU2B 1WTPA 3K59A 3I90A 3V96A 1CQFA 4L63B 4FNFA 1O7LA 1D2BA 3TDQA 2KEEA 5CV9A 4FF1A 4XYQA 2EYPA 2MGSA 2XNAC 3FKIB 2EZVA 4IUTA 2D9UA 2A68D 1KNEA 3VYRA 1A3UA 2F0SA 4DU9A 2MJ8A 3NWTA 2IJ0A 3P7JA 2RDHA 4K6LA 2JE6I 2NVYB 3FPUB 4L6TB 1S5BD 1ESRA 2FFKB 2EJGC 1O80A 4C1NI 4C3IB 2K5QA 4FF2A 1PXUA 1EEID 4ABNA 1WVLA 3ERQA 1WTQA 4CJ0B 2O5JC 4B9WA 1J9OA 2I07B 5A2QL 2PCFB 2WIIB 3OSOA 1A3TA 1ZEQX 4OGQC 1HFNA 2NN6G 3DWAA 5LHY1 1PZID 4OO1I 1TQOA 5BN5A 3GV6A 2F0UA 3BG3A 1LACA 3Q22A 2E2HB 2Q8TA 2HUGA 1SJHD 3QO2A 3MHBA 5M9OA 3PIO3 2PZWA 4EQPA 3K58A 1GUWA 2IW3A 1RHPA 4IFDG 5JAVA 1EWCA 3E5SA 2PW5A 2R61A 1J8IA 3R93A 3D31A 2EYOA 5M5YB 3OPOA 2B63B 1CHQD 3SHLA 1B4OA 1TS5A 3I3CA 3MXNA 2NTSA 1MSHA 5IT9L 1IYVA 3V05A 2LY7A 3Q6SA 1TVXA 4C3HB 1VMPA 5J22A 2EXZA 5COYA 2B2UC 1QB5D 1AEXA 2ZXOA 3SR1A 1B3AA 4RHSA 4KI0A 2K03A 4P2CB 4CKBA 2NWGA 1PMRA 4CKCA 3MWYW 4UAIA 4C3JB 3S1NB 3SK5A 3OIQA 4LMQD 1ENCA 3M85A 2O2LD 1LABA 4CJ2C 5KNBA 1D1KA 4O42A 2XIWA 5K36H 3NTKA 1PRTD 1LTSD 2R6GA 2XSCA 4MIUA 1SXTA 1EY0A 1DCZA 2M2LA 4FVMA 3J81E 2L9HA 2Q8RE 1K8OA 3FPPA 2IL8A 5EPKA 2EY1A 4C56C 3J80L 1HUMA 1S4ZA 1VF5C 2F0EA 2K5WA 2AWNA 1HTPA 3TP5A 1CZWA 1YNJD 1YNNC 3I8ZA 1VMCA 5HGTA 1G291 2D2CC 3QWNA 3I72A 4NP5A 3K57A 1A6XA 3VR4A 1OXUA 2EYMA 3BZDB 2XRSD 1PFBA 3MAQA 4EQNA 5KEEA 2FHTA 3EROA 3GQBA 4KKTA 2NTTA 1CTMA 3TZUA 4X3TA 1I4RA 3HZXA 3BS1A 1HQRD 3I4NB 1JWSD 1Y8OB 4PMCA 1STAA 5IGGA 3A8KE 1EZ6A 2O5IC 3I4MB 3KLSA 3VYTA 4OHJA 3I91A 2K5DA 2QEJC 4Y7NB 3MTSA 1WTXA 1EYDA 2D62A 3CHBD 5C3XA 3S14B 2RQXA 2F0KA 1GOZA 1IKMA 2I46A 1T5EA 1SJED 3S1MB 2PPBC 3QOJA 3A8IE 5M5XB 2X6LA 2B2YC 1F2MA 4K8JA 1ONLA 2BE5C 4ZYSA 2L4NA 2PNRC 4CKEA 5I2XA 1CHPD 1Q8IA 5EBCA 2V4DA 4KTAA 3NQIA 2OF1A 3M4YA 3NK9A 3SK4A 1SEBD 1A2UA 1UNSA 3VR2A 3NHHA 2IPKD 1FYCA 3HRZC 4BWGB 2EY6A 3LNNA 2A69C 4R8IA 4K5WA 2HCCA 3TP8A 2OT2A 2K04A 4PMWA 5K36G 1A15A 4JK1C 4QUFA 3GTPB 4XTCS 2F0TA 5IGDA 4ZK9B 5C6AA 2KCNA 2F0NA 3AB9A 3OWFA 4IURA 2AQ1B 2CQAA 3BDCA 5KYLA 1C4QA 3W2DA 4HSPA 4TSSA 3HGBA 3Q24A 4K2KA 3DXJC 3K5OA 2IWHA 2JA8B 2A73B 2EOTA 4OO1G 5JPMC 4TRDA 1JCKB 1F9QA 1U4MA 4PV1C 1JICA 2DNEA 2F0HA 1UUPA 2EYLA 2A6HC 3PUWA 2EJMA 1EQTA 4QIWB 3S15B 1I6HB 1ZYRD 1JR0D 1PZJD 3I73A 1GUNA 1T5XD 3DEPA 3J81L 4A3KB 1HUNA 4K14A 5M3FB 1STNA 4XT1B 4KY5A 5E4WC 2EVBA 1HCZA 3MC0B 4FO2A 1NR2A 3MFYA 1R4PB 4KN7C 2JA7B 5KNDA 1U4RA 4BS9A 5CORA 4KJOA 4EVOA 4MN3A 1Z47A 1CI3M 1QCBD 4G57A 1Z7TA 1BNZA 3GP7A 5ELEA 2WAQB 5FLXL 1KABA 2WINB 4CHTB 2B2TC 1WD0A 4M8AA 3WDNA 1JC7A 4R8NA 5C0XI 2L5TA 3NWSA 3TZDA 1I6VC 2Z4IA 2EYJA 3C2PA 1IW7C 1BQQT 3J7AF 2ZXRA 1VF7A 1DOMA 2N55A 1BUVT 1SYBA 5JPNC 2EYHA 2AUKA 4F8MA 3RLFA 3QOLA 2EPBA 4KJNA 5I9PA 4KMUC 4FYDA 1ET6A 1XWEA 3D6CA 4HR7B 3M4OB 1GHJA 3TMEA 1F9PA 4XIGS 4CJ1B 2JEBI 1EU3A 3ND8A 1QJOA 1I4XA 3J7AV 3S16B 2JEAI 3NUCA 4LK1C 4BBRB 1LT5D 3HP3A 2RSNA 5CC4A 3IL8A 3MXPA 4A3GB 1C48A 1SAPA 1SYEA 1UAPA 2B2VC 1PZKD 1QE6A 2EY5A 1DXMA 2Z8LA 4ZUJA 3MVVA 3P20A 3QIAA 1B9NA 2TSSA 1PLFA 1E2WA 3VR3A 4KHVA 1CA5A 5KNCA 3EQLC 4EGVA 4IUNA 3KLSX 3P75A 4HMIA 5C5MA 4RGMA 1GUSA 1SDFA 5BN3A 4A3FB 3FVQA 3NBIA 3GTJB 2PYKA 4ZUIA 1LLRD 1HTLD 2HDMA 4V190 4KD3A 5I6YA 2JYOA 3R2TA 5EPLA 1F2LA 1JE4A 1FR3A 2N88A 2J7ZA 5C4HA 1FGBD 2G9DA 3PIP3 1Q90A 2Q8IB 1BCPD 1G6ZA 1WTVA 3MEHA 1OXVA 2HDLA 3R2IA 4KY7A 5DNFA 3OMGA 5AFWA 3SDZA 5IIFA 1DJRD 3PUVA 4KHZA 2NYZD 5HURA 5EKLA 1STGA 1U4LA 3N6RA 1STYA 5D14A 3HG9A 1I4QA 2MP1A 4C3IG 1E2ZA 3GTQB 3FRPB 1L0YB 2ICEC 2RSOA 2AQ3B 3VA7A 4J1MA 1EY6A 2PQEA 1LO5D 1DOLA 1OXTA 2KUMA 3KF8A 1F2YA 4IALA 4S3SA 5EJWA 4K2LA 1XYIA 1PTOH 3S1QB 1PRTC 3MXGA 5ELFA 1G2TA 2Y0SB 3KBXA 2LMCB 4FXKC 4KN4C 4RH6A 3S9WA 1BBXC 2KOLA 1DYQA 1OXXK 4PNYA 4OIJA 1RODA 3T56B 4OL7A 3ITPA 3A54A 2F0IA 1QWYA 5CV6A 4Q0FA 1SNQA 3D4RA 4U673 4GZYC 1SFOB 1KLGD 2RBMA 2B39A 1WD1A 2R3ZA 4ZKBB 5JOBA 1JWUD 2DNCA 3OHXC 3RZDB 5EKKA 2NVQB 4X3KA 1HHVA 4UDUC 1PYWD 1EY8A 4V0BA 5KYIA 3FEWX 1IW7D 1HA6A 4Q5VA 3Q23A 1Y1WB 1RD9D 4MHEA 3JAML 3IAYA 3HOWB 3ONAB 1NCVA 2EE1A 1SNCA 1O78A 1NR4A 1X3PA 2CVRA 1LV9A 5JJZA 2NUCA 1KDCA 1DD2A 1JOOA 3T4AC 1YNJC 3SXHA 5D65A 2ENBA 4IUUA 2A5HA 2B2WC 3A56A 4A3DB 3K5NA 4B08A 1Q12A 1JORA 4C1NK 2QKIC 3T53B 2YU9B 2IX0A 5I4DA 1ILPA 2K28A 2C5CA 2IX3A 1HXYD 3D4DA 3PUZA 1SYDA 3NSWA 3U9OA 3K5MA 3KBGA 4TQUS 3HOVB 1K83B 3BDOA 3UI2A 4DXGA 3F2UA 4CBVA 1XXGA 2WP8J 2B2WA 3URYA 1WTWA 2B8FA 4WRDA 2CW0C 3J7YW 1HRJA 1PTOB 1SNDA 2WB1B 1L0XB 1ENFA 3VR6A 5DAUA 4XQJA 2MPMA 4RA8A 2A68C 4HTHA 4NMZA 1LTGD 3H0GB 1VDZA 4ODGA 3RZOB 1R4QB 2WKDA 3GTOB 2AUJD 2O4XA 5IGCA 4C3JG 2L55A 3SEBA 2K05A 1RTOA 2SEBD 3S2DB 1KNAA 4RHRA 4KD4A 5CBEE 4JBWA 4NDXA 3X3MA 2E2IB 2X6GA 4IUQA 3HOUB 3OW7A 5F2DA 1EIHA 4BY7B 4HEDA 1TY2A 4A3IB 1B9MA 4XDXA 1U9RA 3HOZB 2MUYA 4A93B 4IQZA 4M1UB 5C0XG 1XTCD 5C5LA 3DMUA 1TWHB 4AYBB 4OO1H 5NUCA 2LKVA 4WFN3 2K6AA 1IHZA 2NVTB 3EFXD 3PO3B 2SNSA 1SBBB 2DY8A 1SSOA 3TP6A 1SMYD 4HCEA 1EQVA 1ENAA 5FO9B 3I70A 1V1PB 1QNUA 2F0QA 3RMHA 3GV3A 1NSNS 2XWJB 2AWOA 1X32A 1PTOC 2F0WA 3X3NA 4BBSB 2E74C 1H9SB 1XX8A 2K33A 3PUXA 1RF2D 4PQXA 2FJ2A 3K0YA 2F0GA 1ZXTA 2VUMB 2HCIA 4HCSA 3Q0AA 3SVMA 2YYZA 1FD7D 2EYFA 1D6EC 4EQOA 4XYOA 2NVXB 3LX0A 4DXFA 5M3MB 3IKJA 4ULLA 1DZ1A 3VA5A 5CV4A 1CM9A 5ISRA 3RD4A 3R3OA 1YNND 1EZ8A 4XXEA 5IOCA 1STEA 1D5XC 1WCMB 4G7OC 1EL0A 1RTNA 4F7XA 4FXDA 3E6ZX 3DEOA 1ET9A 3EA6A 1PTOD 4DK1A 1HA5A 4A3JB 1TS2A 1X3QA 3V2TA 3TSSA 2OEOA 4H13C 3G6JB 1EYCA 2F0PA 1I3QB 1AN8A 4FP5D 4ME5A 2KHSA 5IT9E 1NAPA 1SMYC 3IFDA 3BVMA 5EBDA 5C3EB 5IODA 1A3VA 3EVQA 5ELBA 1GUOA 4FXGC 5G3LD 3NQTA 2WKCA 4G7HC 4ZLTF 4NW2A 1EWHA 2JSOA 3TN2A 3T51B 1SYFA 2QDBA 5DEHA 2KECA 1TKWB 2DY7A 1Y8NB 1KAAA 1ICWA 5T1IA 5A2QE 4IFDJ 1GUGA 5K5PA 1SE4A 1LTID 1TY0A 4DAPA 1KDBA 1FNVA 2K1BA 1SYCA 2E2JB 1HFGA 3CRLC 2WACA 4XQQA 1EY7A 4RKLA 1B53A 3BYTB 1LT6D 2B8GA 2OXPA 3P1HA 3BVGA 3M7NA 3SK8A 4RCOA 5FK9C 4PMBA 4C2MB 1M8AA 2E2DC 4DAVA 2KA7A 1AP0A 3NTHA 3J80E 1OO9B 1S5ED 3TBIB 2ID0A 1TR5A 1EEFD 1MSGA 1LTTD 1QNKA 5CGKA 3K6OA 4QUCA 4G4KA 2NN6I 2F0DA 1AZPA 2F3WA 3WOFA 2PZUA 2C9OA 5JVG3 1Y1VB 4LJZC 4B9XA 4IFDH 5E1FA 3BYYB 4I7ZC 1STBA 3H09A 3O13A 2F0OA 1IL8A 4RGTA 3PV0A 2K01A 1BOSA 1EYAA 4FF4A 1AFPA 4R9WA 5KIXA 4CGYB 4H0LC 2VNUD 3KUPA 5CYUA 1Q1EA 2KEDA 3U9SA 4KV6A 3HOYB 1RJTA 3HKZB 4RCNA 4RKBA 3NP8A 2XN9C 1BXTA 4TKOB 3GTGB 1CT1D 4IUVA 3GTLB 1E2VA 1Q3LA 3C1FA 2DN8A 2K32A 1I50B 1D1IA 1A2TA 1OXSC 3PMFA 2IT1A 3I4LA 2TMPA 2L1BA 2LFNA 3LWUA 4K5VA 5FO7B 4DA2A 5BN4A 1Z6HA 5I2YA 5CBAE 4O1NA 5E3FA 1DM0B 5JEAJ 2H4OA 1I4PA 2X69A 3NE5B 2BA1A 5LL6X 3G7LA 4KKUA 2RDGA 2RA4A 1JWMD 2B2UA 3OIPA 3D4WA 5D3IB 1DONA 2FMMA 3IFTA 5CV7A 5FOBB 3NXWA 2ICIA 1JQYD 5DM73 4QB4A 5A35A 2EJFC 1PFNA 3MA2B 3H3VC 4G7ZC 2F0FA 1EY5A 1WTOA 3D8GA 3OMCA 3DHQA 1KTKA 4DFAA 5C0XH 2WV6D 1STHA 3GTKB 3M3YB 1GXDC 3JAME 2E75C 5J39A 3EJIA 4L8JA 5M5WB 3OWEB 2EY2A 2CW0D 1I4GA 2R93B 4J6HA 1GUTA 2GA4B 1IKLA 5T1GA 1EY9A 5JEAH 3A7LA 5CMDA 2F3VA 1HPCA 1G91A 4FF3A 2NN6H 3S2HB 5JVH3 2A6EC 3SK6A 4H7BA 2XVSA 1H9KA 4HN7A 3MZ5A 1B44D 1GJXA 1LTRD 4YIJA 1QOHA 1GHKA 1TWAB 1FNUA 4WJWA 3NPPA 1W6JA 1SE3A 4DNTB 3FDTA 4KY6A 3WOEA 5C0XJ 2PZTA 5C3WA 1R9TB 5FLXE 5C4XB 1D5MC 1LT4D 1U4PA 2KJXA 5C4JB 1MI2A 5KRUA 1G2SA 3C46A 1TT2A 2SDFA 5EPJA 3GO5A 5DM63 2F03A 1O7ZA 1BR9A 1G8ZD 4E6IA 2BA0A 1S5FD 2A6HD 1JOKA 4XQNA 4HMJA 1NUCA 2NBFA 1F77A 1SNMA 1F9SA 2PO4A 4HAEA 2B2TA 2NB0A 3BDLA 4K6DA 3PUYA 5KGUA 4LAAA 4N9PA 4DGZA 3R8BA 2JP1A 2EDGA 1TWGB 2QCPX 1Q1BA 2B2YA 2F0LA 3CU7A 2QILA 3AMUA 3L9AX 1JB3A 1LT3D 4U68A 2J0TD 1UEAB 3PO2B 2CHBD 4H44C 2M9VA 4KK7A 2G9HD 3C1EA 1K8MA 3H94A 4X3UA 4ZQ3A 1BO0A 2VB3X 4DNRB 2F0VA 3SE0A 4K5XA 2R7ZB 2F4IA 2JXMB 3D6WA 2L12A 2LS01 1EIGA 3BVZA 5J1ZA 2AQ2B 1KLUD 2BCOA 3DM1A 1B1ZA 4BY1B 3K7AB 5EGTA 4RFBA 1ESFA 4NKLA 4ILWA 2F0MA 4A3BB 5I6WA 5CV8A 4QF4A 2BDNA 4F87A 3VYUA 1TWFB 3MXUA 4QMGA 4N9TA 4A3MB 5EKIA 3A8JE 3VR5A 2HQEA 2L0CA 3L3OC 1II3A 2A6ED 1CZGA 3DWQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C4H A;  2F0I A;  3DMU A;  1A3V A;  5CV5 A;  5CV6 A;  5KGU A;  3ERQ A;  3EVQ A;  2LKV A;  3EJI A;  1STA A;  1STB A;  4PMC A;  5NUC A;  4LAA A;  3BDC A;  1EY4 A;  1IHZ A;  4N9P A;  5IGG A;  5KYL A;  1EZ6 A;  4DGZ A;  1SNQ A;  4K8I A;  2EY2 A;  1SYG A;  2F0O A;  3NQT A;  4K2K A;  1SYB A;  2EYH A;  1EYA A;  2SNS A;  2RBM A;  2F0L A;  3MEH A;  4B9W A;  3T16 A;  3TP6 A;  1SYF A;  4J6H A;  4F8M A;  1EQV A;  2QDB A;  1ENA A;  3QOL A;  4TRD A;  5KIX A;  3OSO A;  4KY7 A;  1A3T A;  5CR3 A;  3OMG A;  3SK5 A;  4KJN A;  1EY9 A;  5DEH A;  5I9P A;  5JOB A;  3RUZ A;  2F0H A;  2SNM A;  5IIF A;  4WRD A;  2F0Q A;  4KV6 A;  3D6C A;  1ENC A;  1SND A;  2EYL A;  5EKK A;  1NSN S;  1KDA A;  2RDF A;  2F3V A;  3TME A;  1EYD A;  4RKB A;  1TQO A;  3U9O A;  3NP8 A;  5HUR A;  1KAA A;  3HEJ A;  5DAU A;  2F0U A;  3C1E A;  5C3X A;  2F0W A;  1EY8 A;  2F0J A;  5EKL A;  5IGB A;  2F0K A;  5K5P A;  3QB3 A;  4ZQ3 A;  1STG A;  5KYI A;  1KDB A;  1SNO A;  1STY A;  4HTH A;  1JOQ A;  2F0V A;  3C1F A;  3QOJ A;  4K14 A;  4MIU A;  4NMZ A;  1SYC A;  1EY0 A;  3SK6 A;  3NUC A;  1STN A;  3MHB A;  4DF7 A;  1RKN A;  2WAC A;  1A2T A;  4H7B A;  4I65 A;  4K5X A;  3PMF A;  1EY7 A;  4KY5 A;  4ODG A;  1F2M A;  4K8J A;  5IGE A;  4RKL A;  5M9O A;  5CC4 A;  2PZW A;  4K5V A;  4EQP A;  3MXP A;  2F0G A;  1SYE A;  2EY1 A;  2RKS A;  4IZ8 A;  3MZ5 A;  2PW7 A;  4YIJ A;  5C4Z A;  2O4X A;  5JAV A;  5J1Z A;  2EY5 A;  3TP7 A;  5E3F A;  2EYF A;  3E5S A;  2M00 A;  2PW5 A;  5IGC A;  2OXP A;  3H6M A;  4KTA A;  1SNC A;  3P1H A;  4ZUJ A;  3MVV A;  4J1M A;  4ID6 A;  4EQO A;  5EGT A;  2OF1 A;  4KY6 A;  3SK8 A;  1EY6 A;  3LX0 A;  2PQE A;  2SOB A;  2PZT A;  3NK9 A;  2F0E A;  4KHV A;  1A2U A;  2EYO A;  4PMB A;  3NHH A;  4NKL A;  2NUC A;  3SK4 A;  5C3W A;  2F0M A;  1KDC A;  3TP5 A;  4WOR A;  4IUN A;  5CV4 A;  3VA5 A;  3D4W A;  5I9O A;  4KD4 A;  1F2Y A;  4KJO A;  4IAL A;  4S3S A;  5CV7 A;  5HGT A;  5ISR A;  4K2L A;  3SHL A;  4EVO A;  5I6W A;  5CV9 A;  1JOO A;  3R3O A;  3NXW A;  4G57 A;  1EZ8 A;  5CV8 A;  4NDX A;  3P75 A;  2EYP A;  5IOC A;  2EY6 A;  4HMI A;  5C5M A;  5KRU A;  3SXH A;  4QF4 A;  3T13 A;  4K5W A;  1TT2 A;  2ENB A;  4NP5 A;  3TP8 A;  4F7X A;  1TR5 A;  1SNP A;  1F2Z A;  5F2D A;  2EYM A;  4QB4 A;  5CGK A;  1KAB A;  1A3U A;  2PYK A;  4ZUI A;  2F0S A;  4QMG A;  3V2T A;  2F0F A;  4DU9 A;  4E6I A;  1JOR A;  4EQN A;  2OEO A;  4N9T A;  3S9W A;  1EYC A;  5KEE A;  1EY5 A;  2F0P A;  5IOD A;  3D8G A;  1JOK A;  3ERO A;  5J22 A;  2EXZ A;  3DHQ A;  2F0D A;  3OMC A;  2F0T A;  4KD3 A;  4R8N A;  4DFA A;  5I6Y A;  5IGD A;  1U9R A;  4HMJ A;  1NUC A;  4ME5 A;  2KHS A;  4PNY A;  1SNM A;  2F3W A;  1STH A;  2HQE A;  2PZU A;  5C6A A;  2KQ3 A;  1AEX A;  2F0N A;  3HZX A;  3SR1 A;  3D4D A;  4B9X A;  2EYJ A;  3OWF A;  5IGF A;  3BDL A;  4OL7 A;  4K6D A;  5E1F A;  3ITP A;  1SYD A;  5J39 A;  1II3 A;  5C5L A; 
#chains in the Genus database with same CATH topology
 3LWE A;  3C3L A;  1B2T A;  1ZYR C;  3ND9 A;  1X65 A;  3RZO H;  2K7V A;  4XT3 B;  4CDF C;  5LL6 S;  1S5C D;  4DR4 Q;  3M4O H;  1ILQ A;  1PTO F;  4JI1 L;  4QCL A;  3CQZ B;  2R92 B;  3QJY A;  3NBH A;  1B50 A;  3T16 A;  2Z6B A;  4R4T A;  1MGS A;  4F88 A;  1G6P A;  4ZRZ A;  1O7Y A;  3RUZ A;  4DN4 M;  5C44 B;  1YIT A;  4R4O A;  4IUP A;  3HOY H;  3DWP A;  3AU7 A;  1BCP C;  4J8Q A;  3HKS A;  3NEN A;  1V43 A;  1TII D;  3CRK C;  2H1E A;  3KLR A;  5TSS A;  1N34 L;  1SNO A;  5IT9 c;  2OWO A;  4P75 A;  2FIN B;  2HD3 A;  1ZKO A;  1N34 Q;  1S5D D;  3S1R H;  3HOX B;  1Y69 U;  1K28 A;  5EQ0 A;  2K5N A;  3MFG A;  2ZT9 C;  1V8Q A;  4LF8 L;  5C4Z A;  4X64 Q;  5M5Y H;  3U4Z A;  2D5D A;  4ALP A;  1TS4 A;  3NTI A;  5E4X A;  1IYU A;  2BDO A;  4WJ3 M;  1KRT A;  2AHO B;  4DK0 A;  1QUQ A;  1X9N A;  1IXR A;  2VL6 A;  4A3L H;  4WOR A;  2R7D A;  4IOA A;  1PYS B;  4ZKC B;  4BXX G;  1VQD A;  1BCP B;  1Q8K A;  2FMC A;  1H9J A;  1QVF A;  3W3A A;  1LTA D;  1Y8P B;  2LSS A;  2Z4H A;  1EU4 A;  2F1M A;  1QG7 A;  1F2Z A;  3D3R A;  3E0J A;  3HS0 C;  4X3S A;  4A3E G;  2HHH L;  1XMQ Q;  3K5L A;  4OX9 L;  1RDP D;  3J80 c;  1QIL A;  1EOT A;  4JI8 Q;  4HID A;  1SR3 A;  3M7G A;  4DAY A;  2KQ3 A;  3T1H L;  1TS3 A;  1EFI D;  4UP9 A;  4LUV A;  3FMC A;  2VB2 X;  5IGF A;  4DR4 L;  2KVM A;  1PH6 A;  3DUZ A;  4BA2 I;  4DV2 Q;  2JA7 H;  3N52 A;  1VQ8 A;  4C3J H;  1ML0 D;  1EY4 A;  1I4H A;  1VQM A;  1HNX Q;  1H9M A;  3H0G H;  3GTM B;  3PCO B;  3F2B A;  1JJG A;  4OIK A;  4KHP L;  5FKA C;  3I7F A;  1PRT F;  3QG1 A;  5G3L F;  1LM0 A;  2A74 C;  3OOC A;  3KK7 A;  2IHE A;  1KDA A;  2MHV A;  3HEJ A;  1CFM A;  3BZC A;  5IGB A;  3TS0 A;  5JEA G;  5C4X G;  1WOC A;  2RHS B;  4LF6 L;  2B2V A;  4Z9C B;  1VCI A;  2PMZ B;  1JOQ A;  4LFC L;  2NVY H;  4JG2 A;  2A69 D;  2JA9 A;  1RKN A;  1GO3 E;  5IGE A;  2J4X A;  1M4V A;  3S17 B;  4KKS A;  2XRQ D;  2RKS A;  4ZAI A;  2PW7 A;  4HSV A;  3A7A B;  1DOK A;  1RCV D;  4HJ9 A;  3TP7 A;  1E0B A;  2M00 A;  5IE8 A;  1L1O A;  3H6M A;  5HGQ A;  1BBW A;  2JA6 B;  4ID6 A;  1HQM C;  1H9S A;  4DR2 L;  3A5U A;  3CKI B;  4B3S Q;  2SOB A;  1W6K A;  4C3H G;  1HZB A;  5I9O A;  4BA1 I;  2BE5 D;  4DV5 L;  1BCP F;  2MQH A;  2CH4 W;  4RGN A;  3L7Z C;  1S40 A;  2I5M X;  2Q2T A;  1AW7 A;  3A55 A;  1BDO A;  3T13 A;  3K8A A;  4IN3 A;  1PA6 A;  1V1P A;  2VXW A;  1SNP A;  4JI4 Q;  2A8V A;  3CPW A;  2CQO A;  1TWC B;  1NMF A;  1AZQ A;  4JI3 Q;  3E3X A;  1OTC A;  4RGO S;  2BOS A;  4YCW A;  3VYS A;  1CK1 A;  3ZYY X;  1SE2 A;  3H91 A;  1VQ9 A;  5D3D A;  1FJG Q;  1P16 A;  1PRT B;  2ZXP A;  1CUK A;  2OTJ A;  4DR3 Q;  3GD7 A;  4IPD A;  4JV5 L;  4A3F G;  1B70 B;  1XPU A;  4Y7N H;  1D5Z C;  1LTB D;  5CV5 A;  5ELC A;  3S1R B;  3CXC A;  1MD2 D;  2L11 A;  4O0A A;  4K8I A;  1SYG A;  2Z1C A;  1FNW A;  1MBY A;  2QF7 A;  2JA5 B;  5FO8 B;  1PDQ A;  4GKJ Q;  1AE2 A;  4L5Q A;  1V1O A;  4IFD I;  2JQO A;  4A3E B;  5FJ8 H;  1WTR A;  4LF9 L;  2E76 C;  3FP9 A;  5CR3 A;  2A1A A;  2SNM A;  1CA6 A;  1N9W A;  1C8C A;  2IX1 A;  4H02 A;  2F4V L;  2RDF A;  4DR1 L;  1Y1W G;  1XPO A;  5GQO A;  1CQV A;  2KCC A;  2F0J A;  1F9R A;  3KOJ A;  3QB3 A;  1VQH A;  4NXN Q;  2UU9 L;  5ELD A;  2K5V A;  4LF7 Q;  4RWS C;  1PH2 A;  4OEL B;  4RAU C;  1FL0 A;  4DF7 A;  2RVL A;  2VQF Q;  4I65 A;  1H9R A;  4HIK A;  3ERS X;  1PFM A;  2NZ1 D;  4IZ8 A;  1BF4 A;  2XWB B;  1TU2 B;  3T1Y Q;  2EIF A;  4BBS G;  3EBE A;  1WTP A;  1PHJ A;  3K59 A;  1HZA A;  3I90 A;  3V96 A;  1CQF A;  4J15 A;  4EX5 A;  3I4N G;  4L63 B;  3NEM A;  4FNF A;  1O7L A;  1WI5 A;  1D2B A;  3TDQ A;  4N8F A;  2ZTE A;  2KEE A;  5CV9 A;  4FF1 A;  1IZ6 A;  4XYQ A;  3GTP H;  1QZG A;  2EYP A;  2MGS A;  2XNA C;  3FKI B;  5EAY A;  2EZV A;  4IUT A;  2D9U A;  1PV4 A;  2JA5 G;  4O2D A;  1TWA H;  2A68 D;  4DPG A;  1KNE A;  2HIX A;  3VYR A;  1A3U A;  2FXQ A;  2F0S A;  4JI2 L;  4OWX B;  2MO1 A;  4DU9 A;  2MJ8 A;  3NWT A;  1T9H A;  2IJ0 A;  3P7J A;  2RDH A;  4K6L A;  4JI6 Q;  2JE6 I;  4L5T A;  2B63 G;  4A93 G;  1EUJ A;  2NVY B;  4JC0 A;  3RLO A;  2NVT H;  3FPU B;  4L6T B;  1S5B D;  1ESR A;  2FFK B;  2EJG C;  2A19 A;  1O80 A;  4UY8 C;  1I50 H;  2JA8 H;  1KAW A;  2WAQ G;  4C1N I;  4C3I B;  2K5Q A;  4FF2 A;  1PXU A;  1EEI D;  4ABN A;  1WVL A;  3BU2 A;  3HFZ B;  3KDF A;  4AYB G;  3ERQ A;  1WTQ A;  3TEH B;  1X3F A;  3DM3 A;  1U5K A;  3TS2 A;  4PZ8 A;  3CQZ H;  4CJ0 B;  2R92 H;  2O5J C;  4B9W A;  1J9O A;  5ELO A;  4OEM B;  1VQJ A;  4FDB A;  2I07 B;  4BBR H;  5A2Q L;  2PCF B;  2WII B;  3OSO A;  1PYB A;  1A3T A;  5M3F H;  1ZEQ X;  4OGQ C;  1HFN A;  2NN6 G;  1IL2 A;  3DWA A;  5LHY 1;  1PZI D;  2PI2 A;  4OO1 I;  1TQO A;  3S15 H;  4RG1 A;  5BN5 A;  5FLM G;  3GV6 A;  2F0U A;  3BG3 A;  3CCJ A;  1PH8 A;  1LAC A;  3Q22 A;  3BZK A;  4LFC Q;  2E2H B;  3HKZ G;  2Q8T A;  1NMG A;  2HUG A;  1SJH D;  3QO2 A;  1YJW A;  2YTX A;  3MHB A;  4AYB E;  5M9O A;  3PIO 3;  2PZW A;  4EQP A;  3K58 A;  2HT1 A;  1GUW A;  4RMF A;  2IW3 A;  2R7Z H;  1RHP A;  3PO2 G;  4IFD G;  5JAV A;  4A3F H;  2IY5 B;  1EWC A;  3E5S A;  2PW5 A;  2R61 A;  4AIM A;  1J8I A;  3R93 A;  4X66 Q;  1I94 L;  1RIP A;  3D31 A;  2EYO A;  5M5Y B;  3OPO A;  2B63 B;  1CHQ D;  4APV A;  4BBR G;  3SHL A;  1B4O A;  2I5H A;  1TS5 A;  5M3F G;  4B3M Q;  4DR1 Q;  3I3C A;  3MXN A;  3TRZ A;  2G5D A;  4P74 A;  4A3L G;  2NTS A;  1MSH A;  5IT9 L;  1IYV A;  3V05 A;  4A3I G;  2LY7 A;  3ULJ A;  3CCS A;  3Q6S A;  1TVX A;  2B29 A;  4C3H B;  1E1T A;  1VMP A;  2E2H H;  5J22 A;  4I7A A;  2HHH Q;  2EXZ A;  5COY A;  2B2U C;  1FGU A;  1QB5 D;  1EWI A;  4A3B G;  4KHP Q;  1AEX A;  2ZXO A;  3SR1 A;  3W5O A;  1B3A A;  4PZ7 A;  4GLA C;  3F1Z A;  4RHS A;  1Q86 C;  5C3E G;  2DJG C;  3M4P A;  1KQS A;  4KI0 A;  4BY1 G;  2VQE L;  2K03 A;  1B8A A;  4DV2 L;  4P2C B;  4CKB A;  3U50 C;  4A3C G;  2NWG A;  1PMR A;  4JBK A;  4CKC A;  3AFQ A;  3MWY W;  4GLV B;  4UAI A;  4C3J B;  3CC2 A;  3CCR A;  1N36 L;  3S1N B;  1B7Y B;  3SK5 A;  3OIQ A;  4LMQ D;  2Q2U A;  1ENC A;  3M85 A;  2O2L D;  1LAB A;  4CJ2 C;  5KNB A;  1D1K A;  3J81 i;  1VQ7 A;  4O42 A;  2Z0S A;  1E3P A;  1UE7 A;  1PFS A;  2XIW A;  1VQC A;  1ICF B;  2UUA Q;  5K36 H;  5AJ3 Q;  2RHQ B;  3NTK A;  1PRT D;  1LTS D;  2R6G A;  2XSC A;  4MIU A;  1SXT A;  1EY0 A;  1A0I A;  1DCZ A;  2M2L A;  4FVM A;  3J81 E;  2L9H A;  2Q8R E;  1K8O A;  4GKK Q;  3FPP A;  2IL8 A;  5EPK A;  1JMC A;  2EY1 A;  4A75 A;  4C56 C;  1C7Y A;  3K81 C;  3KDF B;  3B6Y A;  1CKN B;  3J80 L;  2R93 G;  1HUM A;  1WFQ A;  1S4Z A;  1VF5 C;  4DV4 Q;  4IPG A;  3UE1 A;  2E2J H;  4LF4 L;  2F0E A;  2K5W A;  2AWN A;  1HTP A;  4GOP B;  1A63 A;  1UEB A;  3TP5 A;  1CZW A;  1YNJ D;  1TXY A;  1YNN C;  3FKI G;  4QL5 A;  3I8Z A;  1VMC A;  5HGT A;  2PI2 E;  4JW0 A;  1G29 1;  2D2C C;  3W1G A;  3QWN A;  3I72 A;  5IYD G;  4NP5 A;  3K57 A;  1A6X A;  3VR4 A;  1OXU A;  2EYM A;  3BZD B;  2XRS D;  1PFB A;  1X6O A;  3MAQ A;  4EQN A;  5KEE A;  2ASB A;  2FHT A;  1X3G A;  3ERO A;  3GQB A;  4KKT A;  2NTT A;  1HNX L;  4K0K L;  1CTM A;  3TZU A;  4X3T A;  1I4R A;  4EQ5 A;  4JOI C;  3HZX A;  2XTI A;  3BS1 A;  1HQR D;  4DV0 Q;  1HNW L;  4QGU A;  1EQR A;  3I4N B;  1VQB A;  4QIW E;  1JWS D;  1Y8O B;  4PMC A;  1MKH A;  1STA A;  5IGG A;  3A8K E;  1SFO H;  1EZ6 A;  2O5I C;  3G4S A;  3KF6 B;  3I4M B;  3KLS A;  5HY6 A;  3H15 A;  4PG3 A;  4B3R L;  4X66 L;  3VYT A;  4OHJ A;  3I91 A;  1HR0 Q;  2K5D A;  5IP7 H;  2QEJ C;  4Y7N B;  3ULL A;  3MTS A;  1WTX A;  1EYD A;  2MO0 A;  2D62 A;  3CHB D;  5C3X A;  3S14 B;  2RQX A;  2F0K A;  1GOZ A;  1IKM A;  2I46 A;  1T5E A;  1SJE D;  3S1M B;  2PPB C;  3QOJ A;  3A8I E;  5M5X B;  4LF4 Q;  2X6L A;  2B2Y C;  4LUZ A;  1J5E Q;  1F2M A;  4K8J A;  3GTQ H;  1XMO Q;  1ONL A;  2BE5 C;  1PVO A;  4ZYS A;  2L4N A;  4NB3 A;  2PNR C;  4CKE A;  5I2X A;  1CHP D;  3AYH B;  1Q8I A;  5EBC A;  1XTD A;  4DK6 C;  4LF8 Q;  2V4D A;  4KTA A;  1TWF H;  3NQI A;  5IWA Q;  2OF1 A;  3K80 C;  4NXM L;  3M4Y A;  1B3Q A;  3NK9 A;  2GN5 A;  3SK4 A;  1SEB D;  1A2U A;  1UNS A;  3VR2 A;  3NHH A;  4BBS H;  4UHV A;  3I56 A;  2IPK D;  4YHH Q;  1FYC A;  3HRZ C;  4BWG B;  2EY6 A;  4A3D H;  3LNN A;  2A69 C;  4R8I A;  4K5W A;  2HCC A;  3TP8 A;  1L0W A;  4YY3 L;  4DAY B;  5IP9 G;  2OT2 A;  2K04 A;  4YHH L;  5IYC H;  4PMW A;  5K36 G;  1A15 A;  4JK1 C;  2JA8 G;  3ULP A;  4QUF A;  3GTP B;  4JI2 Q;  1QVC A;  4XTC S;  1HH2 P;  4HIM A;  2F0T A;  2KBN A;  5IGD A;  2Y0S G;  1MIU A;  4ZK9 B;  5C6A A;  2KCN A;  2F0N A;  3AB9 A;  3I4M G;  3OWF A;  4IUR A;  4DK3 C;  2NVX H;  1NE3 A;  1SE8 A;  2AQ1 B;  5LMU Q;  2CQA A;  3BDC A;  3UE0 A;  1L2F A;  5KYL A;  1C4Q A;  4JI4 L;  3W2D A;  4HSP A;  4TSS A;  3HGB A;  4IPH A;  3Q24 A;  4K2K A;  3DXJ C;  4B3T Q;  3K5O A;  1BVS A;  2IWH A;  2JA8 B;  4OWT B;  2A73 B;  2EOT A;  4OO1 G;  1BBU A;  5JPM C;  4TRD A;  1JCK B;  1F9Q A;  3CCU A;  1U4M A;  4AH6 A;  1KL9 A;  4PV1 C;  5JJK A;  3H0G G;  2E5L Q;  1JIC A;  4POF A;  1LTL A;  1YEZ A;  2DNE A;  2F0H A;  1UUP A;  2EYL A;  2A6H C;  3PUW A;  2EJM A;  2RF4 A;  1EQT A;  2K50 A;  3AQQ A;  4NXM Q;  4QIW B;  3S15 B;  1I6H B;  2N3S A;  1ZYR D;  4LWC A;  1JR0 D;  1PZJ D;  3I73 A;  1FVI A;  1GUN A;  1NTG A;  1T5X D;  2R7Z G;  3DEP A;  3PO2 H;  3J81 L;  4A3K B;  1HUN A;  4K14 A;  2Q2I A;  5M3F B;  1STN A;  4XT1 B;  4KY5 A;  3STB C;  2VZA A;  2K75 A;  5E4W C;  3RN5 A;  5C4X H;  2EVB A;  3H3V I;  1HCZ A;  4A4I A;  3MC0 B;  3I4O A;  4FO2 A;  1YI2 A;  1NR2 A;  5C4J H;  1KD1 C;  3HOU H;  4UP7 A;  4GOP C;  3HOV G;  3MFY A;  1R4P B;  1C0A A;  4KN7 C;  4GKJ L;  2JA7 B;  5KND A;  1U4R A;  4BS9 A;  5COR A;  3GTG H;  4KJO A;  4EVO A;  4MN3 A;  1Z47 A;  1CI3 M;  1QCB D;  4G57 A;  2NZO A;  4DR3 L;  1Z7T A;  4MNO A;  1BNZ A;  3GP7 A;  4CDD C;  5ELE A;  2VUM H;  2WAQ B;  4DNI A;  5FLX L;  1KAB A;  2WIN B;  4A3B H;  4CHT B;  2B2T C;  1WD0 A;  4M8A A;  5C44 G;  3WDN A;  1JC7 A;  4R8N A;  4DV4 L;  5C0X I;  1GD7 A;  3JAM c;  2L5T A;  3NWS A;  3HOX G;  3TZD A;  1I6V C;  2Z4I A;  2EYJ A;  3C2P A;  1IW7 C;  1BQQ T;  3LGJ A;  4YY3 Q;  3J7A F;  4X62 L;  2ZXR A;  1VF7 A;  3PF4 A;  3HOV H;  5FJ8 G;  1DOM A;  2N55 A;  1BUV T;  3G48 A;  5M3M G;  1SYB A;  5JPN C;  2EYH A;  2AUK A;  2UUA L;  4F8M A;  3RLF A;  3QOL A;  1W3S A;  2EPB A;  4LUO A;  4KJN A;  5I9P A;  4KMU C;  4FYD A;  1Y1V H;  1ET6 A;  1XWE A;  3D6C A;  4HR7 B;  3M4O B;  1GHJ A;  3M3Y H;  3TME A;  1F9P A;  3NBH B;  2VUM G;  1YZ6 A;  4XIG S;  4CJ1 B;  2JEB I;  1EU3 A;  2YTV A;  4LF6 Q;  3ND8 A;  1QJO A;  3UDG A;  1VQ6 A;  4X64 L;  1I4X A;  3J7A V;  3S16 B;  3VDY A;  2OQK A;  3NUC A;  2JEA I;  4LK1 C;  4X65 Q;  4BBR B;  1LT5 D;  3HP3 A;  3U4V A;  2RSN A;  5CC4 A;  3IL8 A;  3MXP A;  4A3G B;  1C48 A;  1SAP A;  1SYE A;  1UAP A;  2B2V C;  1PZK D;  1QE6 A;  4R4Q A;  2ZM6 Q;  2EY5 A;  1KRS A;  3HOZ G;  1DXM A;  1VQP A;  2Z8L A;  1PH7 A;  4ZUJ A;  3MVV A;  3P20 A;  3QIA A;  1B9N A;  2TSS A;  1ASZ A;  1PLF A;  1E2W A;  1HZ9 A;  3VR3 A;  4KHV A;  3W1B A;  1CA5 A;  5KNC A;  3EQL C;  4EGV A;  3PF5 A;  4B3R Q;  3S2H H;  2UU9 Q;  4IUN A;  3KLS X;  4BY7 H;  4JOI A;  3P75 A;  4HMI A;  5C5M A;  4RGM A;  1GUS A;  2E8G A;  1SDF A;  5BN3 A;  4A3F B;  3CC7 A;  3FVQ A;  1XNR Q;  3NBI A;  3GTJ B;  2D0P A;  3D0F A;  2PYK A;  4ZUI A;  2UXB L;  4P71 A;  3UDI A;  1LLR D;  1HTL D;  2K5H A;  5IYD H;  2HDM A;  3ICE A;  4QJF A;  4V19 0;  4KD3 A;  5I6Y A;  3J7Z C;  3PIP A;  4WJ4 A;  2JYO A;  2WFW A;  3R2T A;  5EPL A;  1R9T H;  1F2L A;  1JE4 A;  1YHA A;  1FR3 A;  4JI7 L;  2N88 A;  2J7Z A;  5E7N A;  5C4H A;  1FGB D;  2G9D A;  3PIP 3;  1Q90 A;  2K52 A;  2WB1 E;  2Q8I B;  4JI0 L;  1BCP D;  3ER0 A;  1K73 C;  1JJ2 A;  1XNQ L;  1G6Z A;  4C3H H;  1WTV A;  1PH5 A;  3MEH A;  4AQY L;  1VQI A;  4BY7 G;  4BXX H;  1OXV A;  1N33 L;  2HDL A;  3R2I A;  4KY7 A;  5DNF A;  3OMG A;  5AFW A;  3SDZ A;  5IIF A;  1NNX A;  3ZJY C;  1DGS A;  1DJR D;  3PUV A;  1V1Q A;  1MJC A;  3OTO L;  3CF5 A;  4GS3 A;  4KHZ A;  1Q46 A;  2NYZ D;  5HUR A;  1S3O A;  2IHF A;  3A0J A;  5IP7 G;  5EKL A;  1STG A;  1U4L A;  3N6R A;  2JN4 A;  1STY A;  4C2M H;  2D0O A;  5D14 A;  1Y14 B;  2EXD A;  3KLW A;  4QQB X;  4KLK A;  3HG9 A;  1I4Q A;  1Q82 C;  2MP1 A;  4C3I G;  1EYG A;  5M5W H;  1E2Z A;  2WB1 G;  3GTQ B;  3FRP B;  1L0Y B;  3KFU A;  1TWC H;  2ICE C;  4R4I A;  2RSO A;  2AQ3 B;  1KC8 C;  3MXN B;  4GNX C;  3CCL A;  3F2C A;  2KHJ A;  2QEX A;  3RN2 A;  3VA7 A;  3MEF A;  4J1M A;  2JK8 A;  1EY6 A;  1QVG A;  2PQE A;  4JI5 Q;  1XJV A;  1LO5 D;  1DOL A;  1OXT A;  1WCM H;  2KUM A;  1IBL L;  3KF8 A;  4X6A H;  1F2Y A;  4IAL A;  4S3S A;  5EJW A;  2ZJQ A;  4K2L A;  1X56 A;  3CCV A;  2DUD A;  3FHW A;  1XYI A;  3EN2 A;  1PTO H;  1VQA A;  3S1Q B;  1PRT C;  4LW1 A;  1EOV A;  1IYJ B;  3MXG A;  5ELF A;  3CCQ A;  1G2T A;  3KBX A;  2Y0S B;  1Q81 C;  1KHI A;  2LMC B;  2NZH A;  4FXK C;  4KN4 C;  4RH6 A;  3S9W A;  1BBX C;  3GTO H;  3S16 H;  1VQK A;  2KOL A;  1DYQ A;  1OXX K;  4PNY A;  4OIJ A;  5IYC G;  3KF6 A;  1ROD A;  3CD6 A;  1D7Q A;  1XNR L;  3NEL A;  3T56 B;  4OL7 A;  4JI6 L;  4DV1 L;  3ITP A;  3M4Q A;  3A54 A;  2F0I A;  1QWY A;  5CV6 A;  4Q0F A;  1SNQ A;  3D4R A;  4YCV A;  4U67 3;  4GZY C;  1SFO B;  1KLG D;  2RBM A;  2VS1 A;  4A3G G;  4DUZ Q;  2B39 A;  1EIY B;  1WD1 A;  1HJP A;  2R3Z A;  1I94 Q;  4ZKB B;  2UXC Q;  5JOB A;  1CSP A;  1JWU D;  1E7Z A;  2DNC A;  3OHX C;  3RZD B;  4A3C H;  5EKK A;  1WJJ A;  2NVQ B;  3GTK H;  2E5L L;  4X3K A;  2UXB Q;  1HHV A;  2ATW A;  4UDU C;  4HIO A;  1PYW D;  4UPA A;  5BR8 L;  1EY8 A;  4JYA Q;  4V0B A;  5KYI A;  3FEW X;  1IW7 D;  2B63 H;  5LMN W;  1K3R A;  2CH4 A;  1HA6 A;  4Q5V A;  3Q23 A;  1Y1W B;  1RD9 D;  3AFP A;  3CW2 C;  4MHE A;  3JAM L;  3IAY A;  1JT8 A;  3HOW G;  3HOW B;  3ONA B;  4NXN L;  1NCV A;  2EE1 A;  1SRO A;  1SNC A;  2Z9H A;  5H1S E;  2VQE Q;  2C35 B;  1O78 A;  1RL2 A;  1NR4 A;  1X3P A;  1AE3 A;  2CVR A;  2UUC Q;  4GNX B;  2KCT A;  1LV9 A;  5JJZ A;  3S1M H;  2NUC A;  1KDC A;  2R92 G;  1SN8 A;  1YVC A;  1DD2 A;  1JOO A;  3T4A C;  5J3B A;  1YNJ C;  1YNX A;  1WYD A;  3SXH A;  1N8R C;  5D65 A;  1U0L A;  2ENB A;  4IUU A;  2A5H A;  2B2W C;  3A56 A;  4A3D B;  3K5N A;  2JJQ A;  4B08 A;  5JJI A;  1CKO A;  1JJC B;  3K0X A;  5L37 A;  1Q12 A;  1JOR A;  1O7I A;  4C1N K;  4JI1 Q;  2QKI C;  3T53 B;  5GAE C;  4B3S L;  2YU9 B;  2IX0 A;  4B3M L;  5I4D A;  4MTK A;  2N78 A;  2K28 A;  2C5C A;  3STB D;  3S1N H;  1ILP A;  1GKH A;  2IX3 A;  1HXY D;  1HNZ L;  1K0S A;  3D4D A;  3PUZ A;  1J6Q A;  2ZJP A;  4DUY L;  5LMN L;  5M3M H;  3A74 A;  1K3B C;  1SYD A;  3NSW A;  2CWA A;  3U9O A;  3K5M A;  1XMO L;  1X3E A;  3KBG A;  2QDL A;  4TQU S;  3HOV B;  2ZTC A;  3PIO A;  1K83 B;  2DGY A;  3GDE A;  3BDO A;  1LUZ A;  3UI2 A;  5ELN A;  4DXG A;  1Y1V G;  3F2U A;  4DV3 Q;  4HJ8 A;  4CBV A;  1XXG A;  4GN3 B;  2WP8 J;  2B2W A;  2QW7 A;  4POG A;  3PO3 H;  3PGZ A;  3URY A;  2N49 A;  1WTW A;  3KJO A;  4JBM A;  4YWM A;  1IBM Q;  2B8F A;  4WRD A;  2CW0 C;  3J7Y W;  1CKM A;  1PTO B;  1HRJ A;  1SND A;  1NY4 A;  1L0X B;  2WB1 B;  1YJ9 A;  4DR2 Q;  1ENF A;  3A5Z B;  3VR6 A;  2OTL A;  5DAU A;  4XQJ A;  4A3M H;  4A3I H;  2MPM A;  4RA8 A;  3QR8 A;  2VQF L;  3S1Q H;  2A68 C;  2BH8 A;  4HTH A;  4NMZ A;  1LTG D;  5GAH C;  3H0G B;  3GTM H;  1VDZ A;  3HOZ H;  3E9H A;  4ODG A;  3OYY A;  3RZO B;  3Q8D A;  3CPF A;  1BKB A;  1R4Q B;  2PQA A;  2WKD A;  2EQS A;  4LFB L;  3GTO B;  4DV0 L;  2AUJ D;  2O4X A;  2GVA A;  2ALY B;  4LFA Q;  3T1H Q;  5IGC A;  4C3J G;  2L55 A;  3SEB A;  2K05 A;  1RTO A;  2SEB D;  2YTY A;  2WAQ E;  1VQN A;  2I0Q A;  4A3K H;  3S2D B;  1KNA A;  4B3T L;  3M9B A;  4OX9 Q;  1EQQ A;  4RHR A;  4KD4 A;  3PO3 G;  2F52 A;  5CBE E;  4DR7 L;  4JBW A;  4NDX A;  2YV5 A;  3X3M A;  2E2I B;  2X6G A;  4IUQ A;  3HOU B;  2AKW B;  3OW7 A;  5F2D A;  3GTJ H;  3AEV A;  1EIH A;  4A3D G;  4DV6 L;  5IY0 A;  4BY7 B;  4HED A;  3OW2 A;  1TWG H;  1TY2 A;  4A3I B;  3S14 H;  1B9M A;  3KYH C;  1U9R A;  4XDX A;  4JI3 L;  2VW9 A;  3HOZ B;  2MUY A;  5M5X H;  3HKZ E;  1Z9F A;  4A93 B;  4LNQ A;  4IQZ A;  4M1U B;  5C0X G;  1K0R A;  1XTC D;  4YCU A;  5C5L A;  4GN5 A;  3DMU A;  1TWH B;  4AYB B;  4OO1 H;  2R93 H;  5NUC A;  2LKV A;  4WFN 3;  4GKK L;  2K6A A;  5BR8 Q;  1K8A C;  4JYA L;  1IHZ A;  2DJF C;  2NVT B;  3EFX D;  4DV5 Q;  3PO3 B;  2PMZ E;  2UUC L;  2SNS A;  1SBB B;  2DY8 A;  2QA4 A;  1SSO A;  3TP6 A;  1SMY D;  4HCE A;  2V1C C;  1EQV A;  1ENA A;  5FO9 B;  3I70 A;  1V1P B;  3CAM A;  1VQ5 A;  1QNU A;  2F0Q A;  3RMH A;  3GV3 A;  4IPC A;  1KIX A;  4LF7 L;  1NSN S;  2XWJ B;  2B3G A;  1H95 A;  2AWO A;  1X32 A;  1K8G A;  1PTO C;  2F0W A;  3UDX A;  3X3N A;  2PNH A;  2F4V Q;  3RLN A;  1CSQ A;  4BBS B;  4DV1 Q;  1VS0 A;  2E74 C;  1H9S B;  1XX8 A;  2K33 A;  3PUX A;  1RF2 D;  2Z6K A;  4PQX A;  2FJ2 A;  3K0Y A;  2F0G A;  3F8T A;  1ZXT A;  4OXP A;  1S72 A;  2VUM B;  4K0K Q;  2HCI A;  4HCS A;  3Q0A A;  2UXC L;  3SVM A;  2YYZ A;  1SLJ A;  1FD7 D;  2EYF A;  1D6E C;  3JAM i;  4DUZ L;  4EQO A;  4GOP A;  4XYO A;  2NVX B;  3G6E A;  3LX0 A;  4DXF A;  5M3M B;  3IKJ A;  4DAM A;  4ULL A;  1DZ1 A;  3VA5 A;  5CV4 A;  1XPR A;  1CM9 A;  5ISR A;  1VQ4 A;  3RD4 A;  1P8L A;  3R3O A;  1YNN D;  3TRE A;  4R4C A;  1EZ8 A;  4XXE A;  5IOC A;  1STE A;  1D5X C;  3F2D A;  1WCM B;  4G7O C;  1EL0 A;  1RTN A;  4F7X A;  4FXD A;  3E6Z X;  3DEO A;  1IBM L;  3RNU A;  3RR5 A;  1ET9 A;  3EA6 A;  1HR0 W;  1PTO D;  2LXJ A;  4CDE C;  2JA6 H;  1SRU A;  3JC6 6;  5FLM H;  4A3M G;  4DK1 A;  3J7A 5;  1HA5 A;  2N8N A;  4JBJ A;  4A3J B;  1TS2 A;  1X3Q A;  3V2T A;  3TSS A;  2UXD Q;  2OEO A;  4H13 C;  3G6J B;  1EYC A;  2F0P A;  1PH1 A;  1I3Q B;  1AN8 A;  4JCV E;  4FP5 D;  4ME5 A;  2KHS A;  2XGT A;  1WTH A;  1JB7 A;  5IT9 E;  4R1J A;  1NAP A;  1SMY C;  1CKN A;  3IFD A;  3BVM A;  5EBD A;  5C44 H;  5C3E B;  2CKZ B;  5IOD A;  1A3V A;  5AJ3 L;  3EVQ A;  1IBL Q;  5ELB A;  1GUO A;  4GN4 B;  4FXG C;  3KJP A;  4A3K G;  5G3L D;  3NQT A;  2WKC A;  4DV7 Q;  4G7H C;  1KXL A;  4ZLT F;  2JA7 G;  4NW2 A;  1EWH A;  2JSO A;  3TN2 A;  4GNX A;  3T51 B;  1Q7Y C;  3PSI A;  1SYF A;  2QDB A;  5DEH A;  2KEC A;  1N36 Q;  1TKW B;  1EFW A;  2DY7 A;  2E2I H;  4PZ6 A;  1Y8N B;  2MNA A;  5IP9 H;  1KAA A;  1ICW A;  5T1I A;  5A2Q E;  4IFD J;  2JA6 G;  4JI0 Q;  1GUG A;  5K5P A;  3KF8 B;  1SE4 A;  1LTI D;  1TY0 A;  4DAP A;  3RZD H;  1KDB A;  1FNV A;  1GVP A;  2K1B A;  2OCE A;  1SYC A;  2E2J B;  1HFG A;  3CRL C;  2WAC A;  4JI7 Q;  4XQQ A;  1EY7 A;  1QZH A;  4RKL A;  4HJ5 A;  1PH4 A;  1B53 A;  4JI5 L;  3BYT B;  1LT6 D;  2B8G A;  1TWH H;  2OXP A;  3P1H A;  4BY1 H;  3BVG A;  3M7N A;  1E22 A;  3SK8 A;  4RCO A;  5FK9 C;  3CCM A;  1XNQ Q;  4PMB A;  3HOW H;  4C2M B;  1M8A A;  2E2D C;  4DAV A;  2KA7 A;  1YIJ A;  4LF5 Q;  1AP0 A;  3NTH A;  3J80 E;  1QUQ B;  3S24 A;  4QY7 A;  1OO9 B;  1S5E D;  3TBI B;  1PH9 A;  2ID0 A;  2CCZ A;  1TR5 A;  4DR6 L;  3S17 H;  1N32 Q;  1EEF D;  1MSG A;  1LTT D;  1QNK A;  5CGK A;  3K6O A;  4QUC A;  3TQY A;  1VQG A;  4JVZ A;  4G4K A;  2NN6 I;  2F3I A;  2F0D A;  3G71 A;  1AZP A;  1L1O C;  2F3W A;  3WOF A;  2L15 A;  2PZU A;  2C9O A;  5JVG 3;  5FLX c;  1NBW A;  1Y1V B;  4LJZ C;  4B9X A;  4IFD H;  1VQL A;  3EIV A;  5E1F A;  4DV6 Q;  4DR5 Q;  3BYY B;  1VQE A;  4I7Z C;  1STB A;  4IO9 A;  3H09 A;  3U58 A;  2YU9 H;  3O13 A;  2F0O A;  1IL8 A;  4JPB W;  4RGT A;  3PV0 A;  2K01 A;  3E0E A;  1BOS A;  1EYA A;  4FF4 A;  1AFP A;  4R9W A;  1D8L A;  3FKI H;  2R7F A;  5KIX A;  4CGY B;  1K83 H;  4H0L C;  2VNU D;  3KUP A;  4L5R C;  2ZM6 L;  2K4K A;  5CYU A;  1HZC A;  1Q1E A;  2KED A;  3IRB A;  4KV6 A;  3U9S A;  3HOY B;  2HQL A;  1C9O A;  1RJT A;  3HKZ B;  4RCN A;  4RKB A;  3NP8 A;  2PQA B;  4X65 L;  2XN9 C;  1BXT A;  1UE1 A;  2NVQ H;  4TKO B;  4MZ9 A;  3CC4 A;  3GTG B;  1CT1 D;  4IUV A;  3GTL B;  5IYB H;  1E2V A;  1Q3L A;  3C1F A;  5JJL A;  1I3Q H;  2DN8 A;  2K32 A;  1I50 B;  1D1I A;  1A2T A;  1OXS C;  3PMF A;  2P5Z X;  2QGQ A;  2IT1 A;  3I4L A;  1AH9 A;  2TMP A;  2L1B A;  2LFN A;  2OQ0 A;  4A3J H;  3HOX H;  2K14 A;  3LWU A;  4K5V A;  2RCF A;  5FO7 B;  4DA2 A;  5BN4 A;  1Z6H A;  5I2Y A;  5CBA E;  5C3E H;  1E24 A;  4O1N A;  4NPS A;  5E3F A;  1DM0 B;  5JEA J;  4HJA A;  2H4O A;  2Y0S E;  1I4P A;  2X69 A;  3NE5 B;  2BA1 A;  5LL6 X;  3I2Z A;  5GAG C;  3G7L A;  4IJL A;  2ZTD A;  4KKU A;  5GRO A;  2RDG A;  2RA4 A;  1JWM D;  2B2U A;  3OIP A;  3D4W A;  5D3I B;  2BH2 A;  1DON A;  3WWV A;  2FMM A;  3IFT A;  5CV7 A;  5FOB B;  4N8X 1;  3NXW A;  2ICI A;  1WCM G;  1JQY D;  5DM7 3;  4QB4 A;  5A35 A;  4A76 A;  2EJF C;  1PFN A;  3MA2 B;  3H3V C;  4G7Z C;  2F0F A;  4AQY Q;  5IYB G;  1EY5 A;  4DV7 L;  2JA5 H;  1WTO A;  3D8G A;  3OMC A;  3DHQ A;  1KTK A;  4DFA A;  5C0X H;  2VY3 A;  2WV6 D;  4A3E H;  1STH A;  4A3J G;  3GTK B;  3M3Y B;  4L5S A;  1GXD C;  4ZCK A;  1UE6 A;  3JAM E;  4A93 H;  1L1O B;  3PQI A;  2E75 C;  5J39 A;  1X54 A;  4X62 Q;  3EJI A;  3K7U C;  4L8J A;  4TVA B;  5M5W B;  1VQO A;  3OWE B;  2EY2 A;  2MFI A;  2CW0 D;  2UXD L;  1I4G A;  3DLL A;  2R93 B;  4J6H A;  1GUT A;  1YJN A;  2GA4 B;  1IKL A;  5T1G A;  1EY9 A;  5JEA H;  2HIV A;  4LFB Q;  3A7L A;  5CMD A;  1W2B A;  2F3V A;  1HPC A;  2H5X A;  1G91 A;  4FF3 A;  1VQF A;  2NN6 H;  3S2H B;  5JVH 3;  1M1K C;  2A6E C;  3SK6 A;  4H7B A;  2XVS A;  3L0O A;  3CMA A;  1H9K A;  4HN7 A;  4DR5 L;  3MZ5 A;  1B44 D;  1GJX A;  1LTR D;  4YIJ A;  1UE5 A;  1QOH A;  1GHK A;  1TWA B;  1FNU A;  4WJW A;  1G51 A;  3NPP A;  1W6J A;  1SE3 A;  1YHB A;  4DNT B;  3FDT A;  4LF9 Q;  4KY6 A;  3WOE A;  1YBY A;  5C0X J;  3CME A;  2PZT A;  3T1Y L;  3J80 i;  1MJE A;  5C3W A;  1R9T B;  2GVB A;  1XMQ L;  5FLX E;  5C4X B;  1D5M C;  1SMX A;  1LT4 D;  1U4P A;  2KJX A;  3CP0 A;  5C4J B;  1MI2 A;  5KRU A;  1G2S A;  3C46 A;  1N32 L;  4CDC C;  3J81 c;  5LMN Q;  4DUY Q;  2I5L X;  1TT2 A;  2SDF A;  1GM5 A;  1EIF A;  3HOY G;  4JV5 Q;  5EPJ A;  1A62 A;  3GO5 A;  5DM6 3;  2F03 A;  1M90 C;  5IWA L;  1O7Z A;  1BR9 A;  1G8Z D;  4LF5 L;  4E6I A;  2Q2H A;  1FJG L;  2RCN A;  3GTL H;  2BA0 A;  1S5F D;  2A6H D;  3S2D H;  1JOK A;  4XQN A;  4HMJ A;  4C3I H;  1NUC A;  2NBF A;  1F77 A;  1SNM A;  4DR7 Q;  2CWP A;  1F9S A;  2PO4 A;  4HAE A;  1J5E L;  2B2T A;  4MTN A;  2NB0 A;  2ES2 A;  3BDL A;  1YHQ A;  4K6D A;  1K9M C;  2ZJR A;  3HOU G;  3K7A H;  3PUY A;  5KGU A;  4LAA A;  4N9P A;  2KEN A;  4DGZ A;  3R8B A;  4ME3 A;  2JP1 A;  2EDG A;  1TWG B;  1PH3 A;  2QCP X;  1JE5 A;  3CU7 A;  1Q1B A;  2B2Y A;  2F0L A;  3L2P A;  1E1O A;  1Y1W H;  2QIL A;  3L9A X;  1ASY A;  1JB3 A;  3AMU A;  1LT3 D;  2CFM A;  4U68 A;  2J0T D;  1UEA B;  3PO2 B;  2CHB D;  4H44 C;  2M9V A;  4KK7 A;  1I5F A;  2G9H D;  5GAD C;  4P73 A;  1NJI C;  3C1E A;  4GLX A;  1K8M A;  2LXK A;  3H94 A;  4X3U A;  4ZQ3 A;  1BO0 A;  2VB3 X;  4DNR B;  3CCE A;  2F0V A;  4UP8 A;  3SE0 A;  4K5X A;  2R7Z B;  2F4I A;  2JXM B;  3D6W A;  3I4N H;  2L12 A;  4LFA L;  2LS0 1;  3I4M H;  1EIG A;  4DV3 L;  1LYL A;  3BVZ A;  5J1Z A;  2AQ2 B;  1KLU D;  2BCO A;  3UDF A;  3DM1 A;  1HR0 L;  1B1Z A;  4OWW B;  3E9I A;  4BY1 B;  4IOC A;  3K7A B;  5EGT A;  4RFB A;  1UWV A;  3OTO Q;  3SGI A;  1I6H H;  1ESF A;  4NKL A;  4ILW A;  2F0M A;  2KCM A;  1A8V A;  4DKA C;  1HNZ Q;  4A3G H;  3J81 j;  1IBK L;  2UUB Q;  1X55 A;  1N33 Q;  4A3B B;  4YWL A;  2KHI A;  5I6W A;  4Y52 H;  5CV8 A;  1HNW Q;  4QF4 A;  2BDN A;  4F87 A;  3I55 A;  2AMC B;  4OON A;  3VYU A;  1TWF B;  3MXU A;  1IBK Q;  2UUB L;  4QMG A;  4IJH A;  3H3V H;  4N9T A;  3BJU A;  4JI8 L;  4A3M B;  5EKI A;  1MHW C;  5DLQ E;  5LMU L;  4P72 A;  2Z6K C;  3A8J E;  3VR5 A;  2HQE A;  2L0C A;  3L3O C;  1V9P A;  1II3 A;  2A6E D;  4HJ7 A;  4YWK A;  4DR6 Q;  1CZG A;  3DWQ A; 
#chains in the Genus database with same CATH homology
 3LWE A;  3C3L A;  1B2T A;  1ZYR C;  3ND9 A;  2K7V A;  4XT3 B;  5LL6 S;  1S5C D;  1ILQ A;  1PTO F;  4QCL A;  3CQZ B;  2R92 B;  3QJY A;  3NBH A;  1B50 A;  3T16 A;  1MGS A;  4F88 A;  4ZRZ A;  1O7Y A;  3RUZ A;  4DN4 M;  5C44 B;  4IUP A;  3DWP A;  3AU7 A;  1BCP C;  4J8Q A;  1V43 A;  1TII D;  3CRK C;  2H1E A;  3KLR A;  5TSS A;  1SNO A;  2FIN B;  1ZKO A;  1S5D D;  3HOX B;  1Y69 U;  5EQ0 A;  3MFG A;  2ZT9 C;  1V8Q A;  5C4Z A;  2D5D A;  1TS4 A;  3NTI A;  5E4X A;  1IYU A;  2BDO A;  4DK0 A;  4WOR A;  4ZKC B;  1BCP B;  2FMC A;  1H9J A;  3W3A A;  1LTA D;  1Y8P B;  2Z4H A;  1EU4 A;  2F1M A;  1QG7 A;  1F2Z A;  3D3R A;  3E0J A;  3HS0 C;  4X3S A;  3K5L A;  1RDP D;  1QIL A;  1EOT A;  3M7G A;  4DAY A;  2KQ3 A;  1TS3 A;  1EFI D;  3FMC A;  2VB2 X;  5IGF A;  2KVM A;  3DUZ A;  4BA2 I;  3N52 A;  1ML0 D;  1EY4 A;  1I4H A;  1H9M A;  3GTM B;  4OIK A;  5FKA C;  1PRT F;  3QG1 A;  5G3L F;  2A74 C;  3OOC A;  3KK7 A;  1KDA A;  2MHV A;  3HEJ A;  1CFM A;  5IGB A;  5JEA G;  2B2V A;  4Z9C B;  1VCI A;  2PMZ B;  1JOQ A;  2A69 D;  1RKN A;  5IGE A;  2J4X A;  1M4V A;  3S17 B;  4KKS A;  2XRQ D;  2RKS A;  4ZAI A;  2PW7 A;  4HSV A;  3A7A B;  1DOK A;  1RCV D;  3TP7 A;  1E0B A;  2M00 A;  3H6M A;  2JA6 B;  1HQM C;  4ID6 A;  1H9S A;  3CKI B;  2SOB A;  1W6K A;  4C3H G;  5I9O A;  4BA1 I;  2BE5 D;  1BCP F;  4RGN A;  3L7Z C;  1AW7 A;  3A55 A;  1BDO A;  3T13 A;  4IN3 A;  1V1P A;  2VXW A;  1SNP A;  1TWC B;  1AZQ A;  4RGO S;  2BOS A;  3VYS A;  3ZYY X;  1CK1 A;  1SE2 A;  3H91 A;  5D3D A;  1PRT B;  2ZXP A;  3GD7 A;  1D5Z C;  1LTB D;  5CV5 A;  5ELC A;  3S1R B;  1MD2 D;  2L11 A;  4K8I A;  1SYG A;  2Z1C A;  1FNW A;  1MBY A;  2QF7 A;  2JA5 B;  5FO8 B;  1PDQ A;  1V1O A;  4IFD I;  4A3E B;  1WTR A;  2E76 C;  5CR3 A;  2SNM A;  1CA6 A;  1C8C A;  2IX1 A;  2RDF A;  1CQV A;  2KCC A;  2F0J A;  1F9R A;  3QB3 A;  5ELD A;  4RWS C;  4RAU C;  4DF7 A;  2RVL A;  4I65 A;  1H9R A;  1PFM A;  2NZ1 D;  4IZ8 A;  1BF4 A;  2XWB B;  1TU2 B;  1WTP A;  3K59 A;  3I90 A;  3V96 A;  1CQF A;  4L63 B;  4FNF A;  1O7L A;  1D2B A;  3TDQ A;  2KEE A;  5CV9 A;  4FF1 A;  4XYQ A;  2EYP A;  2MGS A;  2XNA C;  3FKI B;  2EZV A;  4IUT A;  2D9U A;  2A68 D;  1KNE A;  3VYR A;  1A3U A;  2F0S A;  4DU9 A;  2MJ8 A;  3NWT A;  2IJ0 A;  3P7J A;  2RDH A;  4K6L A;  2JE6 I;  2NVY B;  3FPU B;  4L6T B;  1S5B D;  1ESR A;  2FFK B;  2EJG C;  1O80 A;  4C1N I;  4C3I B;  2K5Q A;  4FF2 A;  1PXU A;  1EEI D;  4ABN A;  1WVL A;  3ERQ A;  1WTQ A;  4CJ0 B;  2O5J C;  4B9W A;  1J9O A;  2I07 B;  5A2Q L;  2PCF B;  2WII B;  3OSO A;  1A3T A;  1ZEQ X;  4OGQ C;  1HFN A;  2NN6 G;  3DWA A;  5LHY 1;  1PZI D;  4OO1 I;  1TQO A;  5BN5 A;  3GV6 A;  2F0U A;  3BG3 A;  1LAC A;  3Q22 A;  2E2H B;  2Q8T A;  2HUG A;  1SJH D;  3QO2 A;  3MHB A;  5M9O A;  3PIO 3;  2PZW A;  4EQP A;  3K58 A;  1GUW A;  2IW3 A;  1RHP A;  4IFD G;  5JAV A;  1EWC A;  3E5S A;  2PW5 A;  2R61 A;  1J8I A;  3R93 A;  3D31 A;  2EYO A;  5M5Y B;  3OPO A;  2B63 B;  1CHQ D;  3SHL A;  1B4O A;  1TS5 A;  3I3C A;  3MXN A;  2NTS A;  1MSH A;  5IT9 L;  1IYV A;  3V05 A;  2LY7 A;  3Q6S A;  1TVX A;  4C3H B;  1VMP A;  5J22 A;  2EXZ A;  5COY A;  2B2U C;  1QB5 D;  1AEX A;  2ZXO A;  3SR1 A;  1B3A A;  4RHS A;  4KI0 A;  2K03 A;  4P2C B;  4CKB A;  2NWG A;  1PMR A;  4CKC A;  3MWY W;  4UAI A;  4C3J B;  3S1N B;  3SK5 A;  3OIQ A;  4LMQ D;  1ENC A;  3M85 A;  2O2L D;  1LAB A;  4CJ2 C;  5KNB A;  1D1K A;  4O42 A;  2XIW A;  5K36 H;  3NTK A;  1PRT D;  1LTS D;  2R6G A;  2XSC A;  4MIU A;  1SXT A;  1EY0 A;  1DCZ A;  2M2L A;  4FVM A;  3J81 E;  2L9H A;  2Q8R E;  1K8O A;  3FPP A;  2IL8 A;  5EPK A;  2EY1 A;  4C56 C;  3J80 L;  1HUM A;  1S4Z A;  1VF5 C;  2F0E A;  2K5W A;  2AWN A;  1HTP A;  3TP5 A;  1CZW A;  1YNJ D;  1YNN C;  3I8Z A;  1VMC A;  5HGT A;  1G29 1;  2D2C C;  3QWN A;  3I72 A;  4NP5 A;  3K57 A;  1A6X A;  3VR4 A;  1OXU A;  2EYM A;  3BZD B;  2XRS D;  1PFB A;  3MAQ A;  4EQN A;  5KEE A;  2FHT A;  3ERO A;  3GQB A;  4KKT A;  2NTT A;  1CTM A;  3TZU A;  4X3T A;  1I4R A;  3HZX A;  3BS1 A;  1HQR D;  3I4N B;  1JWS D;  1Y8O B;  4PMC A;  1STA A;  5IGG A;  3A8K E;  1EZ6 A;  2O5I C;  3I4M B;  3KLS A;  3VYT A;  4OHJ A;  3I91 A;  2K5D A;  2QEJ C;  4Y7N B;  3MTS A;  1WTX A;  1EYD A;  2D62 A;  3CHB D;  5C3X A;  3S14 B;  2RQX A;  2F0K A;  1GOZ A;  1IKM A;  2I46 A;  1T5E A;  1SJE D;  3S1M B;  2PPB C;  3QOJ A;  3A8I E;  5M5X B;  2X6L A;  2B2Y C;  1F2M A;  4K8J A;  1ONL A;  2BE5 C;  4ZYS A;  2L4N A;  2PNR C;  4CKE A;  5I2X A;  1CHP D;  1Q8I A;  5EBC A;  2V4D A;  4KTA A;  3NQI A;  2OF1 A;  3M4Y A;  3NK9 A;  3SK4 A;  1SEB D;  1A2U A;  1UNS A;  3VR2 A;  3NHH A;  2IPK D;  1FYC A;  3HRZ C;  4BWG B;  2EY6 A;  3LNN A;  2A69 C;  4R8I A;  4K5W A;  2HCC A;  3TP8 A;  2OT2 A;  2K04 A;  4PMW A;  5K36 G;  1A15 A;  4JK1 C;  4QUF A;  3GTP B;  4XTC S;  2F0T A;  5IGD A;  4ZK9 B;  5C6A A;  2KCN A;  2F0N A;  3AB9 A;  3OWF A;  4IUR A;  2AQ1 B;  2CQA A;  3BDC A;  5KYL A;  1C4Q A;  3W2D A;  4HSP A;  4TSS A;  3HGB A;  3Q24 A;  4K2K A;  3DXJ C;  3K5O A;  2IWH A;  2JA8 B;  2A73 B;  2EOT A;  4OO1 G;  5JPM C;  4TRD A;  1JCK B;  1F9Q A;  1U4M A;  4PV1 C;  1JIC A;  2DNE A;  2F0H A;  1UUP A;  2EYL A;  2A6H C;  3PUW A;  2EJM A;  1EQT A;  4QIW B;  3S15 B;  1I6H B;  1ZYR D;  1JR0 D;  1PZJ D;  3I73 A;  1GUN A;  1T5X D;  3DEP A;  3J81 L;  4A3K B;  1HUN A;  4K14 A;  5M3F B;  1STN A;  4XT1 B;  4KY5 A;  5E4W C;  2EVB A;  1HCZ A;  3MC0 B;  4FO2 A;  1NR2 A;  3MFY A;  1R4P B;  4KN7 C;  2JA7 B;  5KND A;  1U4R A;  4BS9 A;  5COR A;  4KJO A;  4EVO A;  4MN3 A;  1Z47 A;  1CI3 M;  1QCB D;  4G57 A;  1Z7T A;  1BNZ A;  3GP7 A;  5ELE A;  2WAQ B;  5FLX L;  1KAB A;  2WIN B;  4CHT B;  2B2T C;  1WD0 A;  4M8A A;  3WDN A;  1JC7 A;  4R8N A;  5C0X I;  2L5T A;  3NWS A;  3TZD A;  1I6V C;  2Z4I A;  2EYJ A;  3C2P A;  1IW7 C;  1BQQ T;  3J7A F;  2ZXR A;  1VF7 A;  1DOM A;  2N55 A;  1BUV T;  1SYB A;  5JPN C;  2EYH A;  2AUK A;  4F8M A;  3RLF A;  3QOL A;  2EPB A;  4KJN A;  5I9P A;  4KMU C;  4FYD A;  1ET6 A;  1XWE A;  3D6C A;  4HR7 B;  3M4O B;  1GHJ A;  3TME A;  1F9P A;  4XIG S;  4CJ1 B;  2JEB I;  1EU3 A;  3ND8 A;  1QJO A;  1I4X A;  3J7A V;  3S16 B;  2JEA I;  3NUC A;  4LK1 C;  4BBR B;  1LT5 D;  3HP3 A;  2RSN A;  5CC4 A;  3IL8 A;  3MXP A;  4A3G B;  1C48 A;  1SAP A;  1SYE A;  1UAP A;  2B2V C;  1PZK D;  1QE6 A;  2EY5 A;  1DXM A;  2Z8L A;  4ZUJ A;  3MVV A;  3P20 A;  3QIA A;  1B9N A;  2TSS A;  1PLF A;  1E2W A;  3VR3 A;  4KHV A;  1CA5 A;  5KNC A;  3EQL C;  4EGV A;  4IUN A;  3KLS X;  3P75 A;  4HMI A;  5C5M A;  4RGM A;  1GUS A;  1SDF A;  5BN3 A;  4A3F B;  3FVQ A;  3NBI A;  3GTJ B;  2PYK A;  4ZUI A;  1LLR D;  1HTL D;  2HDM A;  4V19 0;  4KD3 A;  5I6Y A;  2JYO A;  3R2T A;  5EPL A;  1F2L A;  1JE4 A;  1FR3 A;  2N88 A;  2J7Z A;  5C4H A;  1FGB D;  2G9D A;  3PIP 3;  1Q90 A;  2Q8I B;  1BCP D;  1G6Z A;  1WTV A;  3MEH A;  1OXV A;  2HDL A;  3R2I A;  4KY7 A;  5DNF A;  3OMG A;  5AFW A;  3SDZ A;  5IIF A;  1DJR D;  3PUV A;  4KHZ A;  2NYZ D;  5HUR A;  5EKL A;  1STG A;  1U4L A;  3N6R A;  1STY A;  5D14 A;  3HG9 A;  1I4Q A;  2MP1 A;  4C3I G;  1E2Z A;  3GTQ B;  3FRP B;  1L0Y B;  2ICE C;  2RSO A;  2AQ3 B;  3VA7 A;  4J1M A;  1EY6 A;  2PQE A;  1LO5 D;  1DOL A;  1OXT A;  2KUM A;  3KF8 A;  1F2Y A;  4IAL A;  4S3S A;  5EJW A;  4K2L A;  1XYI A;  1PTO H;  3S1Q B;  1PRT C;  3MXG A;  5ELF A;  1G2T A;  2Y0S B;  3KBX A;  2LMC B;  4FXK C;  4KN4 C;  4RH6 A;  3S9W A;  1BBX C;  2KOL A;  1DYQ A;  1OXX K;  4PNY A;  4OIJ A;  1ROD A;  3T56 B;  4OL7 A;  3ITP A;  3A54 A;  2F0I A;  1QWY A;  5CV6 A;  4Q0F A;  1SNQ A;  3D4R A;  4U67 3;  4GZY C;  1SFO B;  1KLG D;  2RBM A;  2B39 A;  1WD1 A;  2R3Z A;  4ZKB B;  5JOB A;  1JWU D;  2DNC A;  3OHX C;  3RZD B;  5EKK A;  2NVQ B;  4X3K A;  1HHV A;  4UDU C;  1PYW D;  1EY8 A;  4V0B A;  5KYI A;  3FEW X;  1IW7 D;  1HA6 A;  4Q5V A;  3Q23 A;  1Y1W B;  1RD9 D;  4MHE A;  3JAM L;  3IAY A;  3HOW B;  3ONA B;  1NCV A;  2EE1 A;  1SNC A;  1O78 A;  1NR4 A;  1X3P A;  2CVR A;  1LV9 A;  5JJZ A;  2NUC A;  1KDC A;  1DD2 A;  1JOO A;  3T4A C;  1YNJ C;  3SXH A;  5D65 A;  2ENB A;  4IUU A;  2A5H A;  2B2W C;  3A56 A;  4A3D B;  3K5N A;  4B08 A;  1Q12 A;  1JOR A;  4C1N K;  2QKI C;  3T53 B;  2YU9 B;  2IX0 A;  5I4D A;  1ILP A;  2K28 A;  2C5C A;  2IX3 A;  1HXY D;  3D4D A;  3PUZ A;  1SYD A;  3NSW A;  3U9O A;  3K5M A;  3KBG A;  4TQU S;  3HOV B;  1K83 B;  3BDO A;  3UI2 A;  4DXG A;  3F2U A;  4CBV A;  1XXG A;  2WP8 J;  2B2W A;  3URY A;  1WTW A;  2B8F A;  4WRD A;  2CW0 C;  3J7Y W;  1HRJ A;  1PTO B;  1SND A;  2WB1 B;  1L0X B;  1ENF A;  3VR6 A;  5DAU A;  4XQJ A;  2MPM A;  4RA8 A;  2A68 C;  4HTH A;  4NMZ A;  1LTG D;  3H0G B;  1VDZ A;  4ODG A;  3RZO B;  1R4Q B;  2WKD A;  3GTO B;  2AUJ D;  2O4X A;  5IGC A;  4C3J G;  2L55 A;  3SEB A;  2K05 A;  1RTO A;  2SEB D;  3S2D B;  1KNA A;  4RHR A;  4KD4 A;  5CBE E;  4JBW A;  4NDX A;  3X3M A;  2E2I B;  2X6G A;  4IUQ A;  3HOU B;  3OW7 A;  5F2D A;  1EIH A;  4BY7 B;  4HED A;  1TY2 A;  4A3I B;  1B9M A;  4XDX A;  1U9R A;  3HOZ B;  2MUY A;  4A93 B;  4IQZ A;  4M1U B;  5C0X G;  1XTC D;  5C5L A;  3DMU A;  1TWH B;  4AYB B;  4OO1 H;  5NUC A;  2LKV A;  4WFN 3;  2K6A A;  1IHZ A;  2NVT B;  3EFX D;  3PO3 B;  2SNS A;  1SBB B;  2DY8 A;  1SSO A;  3TP6 A;  1SMY D;  4HCE A;  1EQV A;  1ENA A;  5FO9 B;  3I70 A;  1V1P B;  1QNU A;  2F0Q A;  3RMH A;  3GV3 A;  1NSN S;  2XWJ B;  2AWO A;  1X32 A;  1PTO C;  2F0W A;  3X3N A;  4BBS B;  2E74 C;  1H9S B;  1XX8 A;  2K33 A;  3PUX A;  1RF2 D;  4PQX A;  2FJ2 A;  3K0Y A;  2F0G A;  1ZXT A;  2VUM B;  2HCI A;  4HCS A;  3Q0A A;  3SVM A;  2YYZ A;  1FD7 D;  2EYF A;  1D6E C;  4EQO A;  4XYO A;  2NVX B;  3LX0 A;  4DXF A;  5M3M B;  3IKJ A;  4ULL A;  1DZ1 A;  3VA5 A;  5CV4 A;  1CM9 A;  5ISR A;  3RD4 A;  3R3O A;  1YNN D;  1EZ8 A;  4XXE A;  5IOC A;  1STE A;  1D5X C;  1WCM B;  4G7O C;  1EL0 A;  1RTN A;  4F7X A;  4FXD A;  3E6Z X;  3DEO A;  1ET9 A;  3EA6 A;  1PTO D;  4DK1 A;  1HA5 A;  4A3J B;  1TS2 A;  1X3Q A;  3V2T A;  3TSS A;  2OEO A;  4H13 C;  3G6J B;  1EYC A;  2F0P A;  1I3Q B;  1AN8 A;  4FP5 D;  4ME5 A;  2KHS A;  5IT9 E;  1NAP A;  1SMY C;  3IFD A;  3BVM A;  5EBD A;  5C3E B;  5IOD A;  1A3V A;  3EVQ A;  5ELB A;  1GUO A;  4FXG C;  5G3L D;  3NQT A;  2WKC A;  4G7H C;  4ZLT F;  4NW2 A;  1EWH A;  2JSO A;  3TN2 A;  3T51 B;  1SYF A;  2QDB A;  5DEH A;  2KEC A;  1TKW B;  2DY7 A;  1Y8N B;  1KAA A;  1ICW A;  5T1I A;  5A2Q E;  4IFD J;  1GUG A;  5K5P A;  1SE4 A;  1LTI D;  1TY0 A;  4DAP A;  1KDB A;  1FNV A;  2K1B A;  1SYC A;  2E2J B;  1HFG A;  3CRL C;  2WAC A;  4XQQ A;  1EY7 A;  4RKL A;  1B53 A;  3BYT B;  1LT6 D;  2B8G A;  2OXP A;  3P1H A;  3BVG A;  3M7N A;  3SK8 A;  4RCO A;  5FK9 C;  4PMB A;  4C2M B;  1M8A A;  2E2D C;  4DAV A;  2KA7 A;  1AP0 A;  3NTH A;  3J80 E;  1OO9 B;  1S5E D;  3TBI B;  2ID0 A;  1TR5 A;  1EEF D;  1MSG A;  1LTT D;  1QNK A;  5CGK A;  3K6O A;  4QUC A;  4G4K A;  2NN6 I;  2F0D A;  1AZP A;  2F3W A;  3WOF A;  2PZU A;  2C9O A;  5JVG 3;  1Y1V B;  4LJZ C;  4B9X A;  4IFD H;  5E1F A;  3BYY B;  4I7Z C;  1STB A;  3H09 A;  3O13 A;  2F0O A;  1IL8 A;  4RGT A;  3PV0 A;  2K01 A;  1BOS A;  1EYA A;  4FF4 A;  1AFP A;  4R9W A;  5KIX A;  4CGY B;  4H0L C;  2VNU D;  3KUP A;  5CYU A;  1Q1E A;  2KED A;  3U9S A;  4KV6 A;  3HOY B;  1RJT A;  3HKZ B;  4RCN A;  4RKB A;  3NP8 A;  2XN9 C;  1BXT A;  4TKO B;  3GTG B;  1CT1 D;  4IUV A;  3GTL B;  1E2V A;  1Q3L A;  3C1F A;  2DN8 A;  2K32 A;  1I50 B;  1D1I A;  1A2T A;  1OXS C;  3PMF A;  2IT1 A;  3I4L A;  2TMP A;  2L1B A;  2LFN A;  3LWU A;  4K5V A;  5FO7 B;  4DA2 A;  5BN4 A;  1Z6H A;  5I2Y A;  5CBA E;  4O1N A;  5E3F A;  1DM0 B;  5JEA J;  2H4O A;  1I4P A;  2X69 A;  3NE5 B;  2BA1 A;  5LL6 X;  3G7L A;  4KKU A;  2RDG A;  2RA4 A;  1JWM D;  2B2U A;  3OIP A;  3D4W A;  5D3I B;  1DON A;  2FMM A;  3IFT A;  5CV7 A;  5FOB B;  3NXW A;  2ICI A;  1JQY D;  5DM7 3;  4QB4 A;  5A35 A;  2EJF C;  1PFN A;  3MA2 B;  3H3V C;  4G7Z C;  2F0F A;  1EY5 A;  1WTO A;  3D8G A;  3OMC A;  3DHQ A;  1KTK A;  4DFA A;  5C0X H;  2WV6 D;  1STH A;  3GTK B;  3M3Y B;  1GXD C;  3JAM E;  2E75 C;  5J39 A;  3EJI A;  4L8J A;  5M5W B;  3OWE B;  2EY2 A;  2CW0 D;  1I4G A;  2R93 B;  4J6H A;  1GUT A;  2GA4 B;  1IKL A;  5T1G A;  1EY9 A;  5JEA H;  3A7L A;  5CMD A;  2F3V A;  1HPC A;  1G91 A;  4FF3 A;  2NN6 H;  3S2H B;  5JVH 3;  2A6E C;  3SK6 A;  4H7B A;  2XVS A;  1H9K A;  4HN7 A;  3MZ5 A;  1B44 D;  1GJX A;  1LTR D;  4YIJ A;  1QOH A;  1GHK A;  1TWA B;  1FNU A;  4WJW A;  3NPP A;  1W6J A;  1SE3 A;  4DNT B;  3FDT A;  4KY6 A;  3WOE A;  5C0X J;  2PZT A;  5C3W A;  1R9T B;  5FLX E;  5C4X B;  1D5M C;  1LT4 D;  1U4P A;  2KJX A;  5C4J B;  1MI2 A;  5KRU A;  1G2S A;  3C46 A;  1TT2 A;  2SDF A;  5EPJ A;  3GO5 A;  5DM6 3;  2F03 A;  1O7Z A;  1BR9 A;  1G8Z D;  4E6I A;  2BA0 A;  1S5F D;  2A6H D;  1JOK A;  4XQN A;  4HMJ A;  1NUC A;  2NBF A;  1F77 A;  1SNM A;  1F9S A;  2PO4 A;  4HAE A;  2B2T A;  2NB0 A;  3BDL A;  4K6D A;  3PUY A;  5KGU A;  4LAA A;  4N9P A;  4DGZ A;  3R8B A;  2JP1 A;  2EDG A;  1TWG B;  2QCP X;  1Q1B A;  2B2Y A;  2F0L A;  3CU7 A;  2QIL A;  3AMU A;  3L9A X;  1JB3 A;  1LT3 D;  4U68 A;  2J0T D;  1UEA B;  3PO2 B;  2CHB D;  4H44 C;  2M9V A;  4KK7 A;  2G9H D;  3C1E A;  1K8M A;  3H94 A;  4X3U A;  4ZQ3 A;  1BO0 A;  2VB3 X;  4DNR B;  2F0V A;  3SE0 A;  4K5X A;  2R7Z B;  2F4I A;  2JXM B;  3D6W A;  2L12 A;  2LS0 1;  1EIG A;  3BVZ A;  5J1Z A;  2AQ2 B;  1KLU D;  2BCO A;  3DM1 A;  1B1Z A;  4BY1 B;  3K7A B;  5EGT A;  4RFB A;  1ESF A;  4NKL A;  4ILW A;  2F0M A;  4A3B B;  5I6W A;  5CV8 A;  4QF4 A;  2BDN A;  4F87 A;  3VYU A;  1TWF B;  3MXU A;  4QMG A;  4N9T A;  4A3M B;  5EKI A;  3A8J E;  3VR5 A;  2HQE A;  2L0C A;  3L3O C;  1II3 A;  2A6E D;  1CZG A;  3DWQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...