1SNOA

Protein stability in staphylococcal nuclease
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
136
structure length
136
Chain Sequence
KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQLLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Coupling between trans/cis proline isomerization and protein stability in staphylococcal nuclease.
pubmed rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords STAPHYLOCOCCAL NUCLEASE
total genus 38
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 1996-07-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1snoA00
1EY6A 4QF4A 4WRDA 4KV6A 2F0WA 4IUNA 2PW7A 4K5WA 1SNOA 3MHBA 5KEEA 2EYHA 2F0QA 5CR3A 4DFAA 4EVOA 1SNCA 2EYMA 4PMCA 4QB4A 1STNA 4KD3A 2OEOA 2F0GA 2RDFA 1EYAA 1A2UA 1EY5A 2EY6A 2PQEA 4KHVA 5I9OA 3QOJA 2EY2A 4F8MA 4K2KA 4ZQ3A 1NUCA 4F7XA 2F0TA 2F0DA 5CV8A 3MEHA 5J39A 2EYLA 1JORA 1EZ6A 3MXPA 3C1EA 2O4XA 2F0NA 3BDLA 5C4ZA 2WACA 1JOKA 1SYCA 1EY7A 3OMGA 3MVVA 4PNYA 1EZ8A 1SNPA 1STGA 4DU9A 4EQOA 3BDCA 5IGBA 5J22A 1STBA 5IGFA 4KD4A 2PYKA 5KYLA 2SOBA 2RKSA 2PZWA 1KDBA 4TRDA 3TP7A 5KGUA 5KIXA 3T13A 3SXHA 5EKLA 4EQPA 5C3WA 3R3OA 3NXWA 3OSOA 1EY0A 1TQOA 5HGTA 5CV9A 1TT2A 3D4WA 5E1FA 5CGKA 1F2MA 2F0LA 2F0EA 4I65A 2EXZA 4ME5A 4K14A 1KDCA 4DF7A 3DHQA 1NSNS 3TP5A 5DAUA 2F0SA 3SK5A 4WORA 4QMGA 2EYJA 2F0JA 2F0HA 5C5MA 3D8GA 4OL7A 1STHA 3MZ5A 4PMBA 3E5SA 1SYFA 4J1MA 3S9WA 3V2TA 5ISRA 2F0OA 2QDBA 4N9PA 3D4DA 2LKVA 5IGGA 1RKNA 2F0PA 2M00A 5EKKA 1EYDA 2SNSA 1EY8A 3VA5A 5IGCA 4KY6A 3OWFA 1IHZA 5C5LA 4N9TA 5CV4A 3TMEA 1SNQA 4LAAA 5CC4A 1SYDA 1EY4A 1A3VA 1EY9A 3P75A 2PW5A 3QB3A 3QOLA 3EJIA 3TP6A 3D6CA 1STAA 2F0MA 4ID6A 3NHHA 4EQNA 3T16A 1SYBA 3EROA 2SNMA 3DMUA 2F3WA 4HMIA 4J6HA 3HZXA 3C1FA 5E3FA 1SYEA 4KTAA 3HEJA 3RUZA 2F0UA 2EYPA 5I6WA 2F0FA 1AEXA 2EY1A 4NP5A 4K8IA 5CV5A 5IGEA 2OF1A 4K5VA 3NP8A 2KHSA 2EYFA 4RKLA 2HQEA 4K5XA 5NUCA 3NQTA 3TP8A 4DGZA 1ENAA 5C6AA 5HURA 5I6YA 5IOCA 5KYIA 1JOQA 1EYCA 1F2ZA 1JOOA 4B9WA 1A2TA 2EY5A 3LX0A 5JAVA 2PZUA 1F2YA 3OMCA 3PMFA 4KJOA 4KY7A 5CV6A 1U9RA 4K2LA 4NMZA 2NUCA 4IALA 5EGTA 5J1ZA 1SNDA 5DEHA 4B9XA 5C4HA 5IODA 4H7BA 4S3SA 3SK6A 3SR1A 1ENCA 2F3VA 2OXPA 3SK4A 3SK8A 4NDXA 3NK9A 3EVQA 2PZTA 5IIFA 5I9PA 1II3A 5CV7A 4ZUIA 4K6DA 1A3UA 5K5PA 4KJNA 2ENBA 3H6MA 4MIUA 2F0VA 4HTHA 3ERQA 1A3TA 2KQ3A 4ODGA 4RKBA 4YIJA 5IGDA 4IZ8A 4NKLA 5M9OA 3U9OA 1EQVA 4E6IA 5KRUA 4R8NA 5JOBA 2F0KA 4ZUJA 5F2DA 4K8JA 4G57A 3P1HA 1KABA 3ITPA 1KDAA 1KAAA 4HMJA 2RBMA 1SYGA 4KY5A 3NUCA 1STYA 3SHLA 2EYOA 1SNMA 2F0IA 5C3XA 1TR5A
chains in the Genus database with same CATH superfamily
1Y1WG 1WCMB 1VQBA 3JAML 2F0WA 4YCWA 4X3SA 5LMUQ 4BBSG 2AQ1B 2G9DA 1SJED 1S5BD 3K5LA 2JA8B 3UI2A 4A3BH 3HS0C 1NUCA 1VQKA 1QE6A 3WOEA 3MXPA 1PFSA 2N3SA 2UXCL 1Q8KA 1RODA 1CQVA 2DY7A 2HD3A 3BDCA 3AQQA 5JEAH 2X6LA 1LT5D 1R9TB 3I4LA 4FYDA 5ELNA 3TP7A 1EFWA 1VQ9A 4XT3B 3QWNA 3S2HH 3HOWB 1HFNA 3HG9A 4HCEA 2ZTEA 1JWSD 3K59A 1GD7A 5EPLA 4X6AH 5C0XH 1EWCA 3R93A 4QMGA 1D2BA 4F87A 1OXTA 1HQRD 2EQSA 3KFUA 2WFWA 3H3VI 4B3MQ 1Y1VB 1XMOL 2JA8H 4FXKC 1ICFB 2CQOA 5C4XH 1QZHA 2LMCB 3I4NG 2VUMH 3D4RA 5E3FA 1WTHA 3RUZA 5C0XI 4PMWA 1PRTB 2EYPA 4R4CA 2RSNA 4A3GG 3R2IA 4WJ3M 2LS01 3OW2A 4JBJA 2HIVA 2K01A 1GUWA 2I5LX 1B2TA 2HQLA 3OIQA 5KEEA 3PMFA 4KJOA 4EVOA 2HHHQ 1J8IA 1TY2A 4LW1A 1RTNA 2Q2IA 4BBRG 4L8JA 2H5XA 4X3UA 3M4YA 4BY1B 4LNQA 2I46A 1JICA 2Q2UA 1TKWB 2BE5D 2ENBA 5T1IA 3RNUA 3ERQA 2KQ3A 1C4QA 4BY7G 1OXUA 1X54A 3AU7A 1GUGA 2FXQA 3JC66 3L9AX 1J5EQ 5FLXE 3SGIA 3N52A 1YI2A 2WAQE 1YEZA 1RL2A 3I4OA 4FDBA 3PGZA 3VA5A 2K7VA 2NVYB 2RQXA 2E2JB 3R8BA 3K7AH 2I5MX 4FXDA 4KD3A 1L1OC 3KBXA 1EYAA 4FF3A 3F1ZA 1TWGH 5LHY1 4K2KA 4DR6Q 4QJFA 3RZDB 5IP9H 4DN4M 3VR4A 3T1YL 3P20A 4CHTB 3A54A 3E3XA 3VYSA 1EEFD 1DYQA 3HOUG 3S14H 3FP9A 5M3FG 4IQZA 3W1GA 2WB1B 4DR3L 2UXDL 1N33Q 2VL6A 4UP7A 2AUKA 5EQ0A 4DV0Q 5EKLA 1X32A 2JA5G 2BH2A 3GTGB 3R2TA 1FNUA 3M7NA 2F1MA 3NELA 2JA5B 4DPGA 3A8IE 1LLRD 4AYBB 4JI1Q 1JT8A 3TP5A 1B53A 2F0SA 3KOJA 1JCKB 5GADC 3QR8A 1A6XA 2JA6H 5GAHC 2WKCA 1WD1A 5ISRA 3NE5B 1PZID 1O7ZA 5M3MB 4DA2A 4Q5VA 4OO1H 4LF6Q 3E9IA 4IUTA 1U4LA 2B63G 3RZDH 3HOXH 1LUZA 1YNJD 4X66L 3T16A 3VR2A 3U9OA 3HEJA 1L0XB 4H44C 4WFN3 2A6HC 2B2UC 1XPUA 4K5VA 4DGZA 1I4PA 2ZM6L 4PZ8A 1YNNC 5C44G 1IXRA 2ZTCA 1IYJB 1C7YA 5JAVA 2NVYH 1VQ6A 3T1HQ 1L0WA 4DR4L 3DXJC 1LV9A 4PV1C 3H0GH 1Q82C 2XIWA 3S16H 2F3IA 4ME3A 1QG7A 2E2HB 2NZOA 2OWOA 4A3KG 2NVTB 4DR6L 2YYZA 3UDXA 4A3JH 4BA1I 1X3QA 4YIJA 4DAYB 5K36H 2RVLA 1I4RA 4CKBA 4NKLA 2VQEL 3G7LA 1JWUD 1TIID 3TREA 2VB3X 3K5OA 1S5CD 4A93B 5C4JB 1PTOH 2ZXRA 1QCBD 4QF4A 3TN2A 3VYTA 3GTKB 4WRDA 1LTLA 2MPMA 3I90A 1LT4D 2N8NA 2XSCA 3CQZH 3F2BA 1VCIA 4IJLA 4JI1L 3KLSA 1WTQA 2F4IA 2C35B 3I56A 1B70B 2DN8A 4HJ8A 1CT1D 4JI7Q 3PCOB 2R7FA 3OMGA 1ASZA 4Z9CB 1RJTA 2OQKA 1LTBD 5J22A 2XTIA 1STBA 2D5DA 5KYLA 3CU7A 1VDZA 2R93G 4LUVA 3EFXD 3OSOA 4JBMA 4OEMB 1IYVA 2IHEA 4Q0FA 5CGKA 4LFBL 1F2MA 1WTPA 5LMNQ 2C9OA 4LF4L 2JK8A 2ZT9C 3FRPB 3SK5A 2YTXA 3I2ZA 1B44D 4IFDG 3GTPH 3D4DA 3PF4A 3RLOA 3A8KE 3SE0A 1KXLA 1AZQA 1UAPA 4KN4C 2NVTH 1NMFA 2EJMA 2VS1A 3OW7A 4YY3Q 3EN2A 3CC4A 1LTTD 3EROA 2SNMA 3S15B 2CKZB 2QCPX 3HZXA 2A6EC 3BDOA 5EPKA 4KKSA 2KHIA 3CC2A 2O5JC 2EYFA 4K5XA 5IOCA 2RCFA 3TP8A 4LWCA 3DEPA 1EYCA 3NPPA 3OMCA 5COYA 1Z47A 4DK0A 4X64Q 4DNRB 1FGBD 1UE1A 1TWFB 3VR3A 5KNCA 1XMOQ 2OXPA 1B50A 1MJEA 1EQTA 5I2XA 1V1PB 3PUVA 4Y52H 3HOZH 4ZUIA 4NXML 1IBML 4N8X1 1GKHA 1PYWD 1PH3A 1W6KA 4A3MB 4BY1G 1NR4A 4Y7NH 2NVQH 3GTLH 4A3BG 1PH4A 1KABA 3ITPA 1AN8A 5CBAE 1G6ZA 1XTDA 1YBYA 2B3GA 2HHHL 3HOYB 3P7JA 3HFZB 1TWAH 4LFBQ 1B9NA 2EYMA 1D7QA 4LF4Q 1VMPA 3JAMc 2KECA 5CORA 1S4ZA 4DNIA 3QOJA 4G7HC 4A3FB 1QWYA 2WINB 1QZGA 3WWVA 1PH6A 3C1EA 1V8QA 4X3TA 2K14A 2WACA 1EZ8A 3GDEA 4A75A 4P74A 1KRTA 2K04A 1B1ZA 1HXYD 4A3BB 1EU4A 4YY3L 2SOBA 3GV3A 4GNXA 1XNRQ 5FLXc 1PZKD 1S5FD 2CQAA 1O7YA 3PO2B 1K0SA 1PV4A 1E1OA 2DUDA 2VB2X 4A3EG 3UE0A 5BR8L 2F0HA 1RTOA 1GVPA 4MN3A 2CH4W 3URYA 3HOWH 1IBLL 5FKAC 2JA9A 5LL6S 2N49A 4HIOA 4GZYC 2UUBQ 2LSSA 4DK3C 4DR1L 1SYDA 2K5NA 2NTTA 1D5MC 2KCMA 4NXMQ 4MTNA 1PLFA 3NBIA 4DV0L 1IBMQ 1XMQQ 3GP7A 2EY1A 3T4AC 4K8IA 1JMCA 4RCNA 2L12A 4V190 2MO1A 4YWLA 2DGYA 4LF5Q 2CWAA 4NW2A 3GTQH 1BUVT 3H3VC 3VDYA 4JI0L 3UDIA 4RAUC 2ZXPA 5CV6A 4KY7A 4M1UB 3OOCA 1JQYD 1SNDA 1BR9A 4J8QA 2F3VA 5IT9c 4NDXA 1H95A 5IIFA 2LXKA 1U0LA 4IOCA 1HZAA 5CV7A 1H9MA 2I0QA 4HEDA 3UDGA 1A3TA 4G7OC 4HIKA 3DLLA 3I4MH 1UE7A 2R93B 1STEA 3GTOB 5DM63 2Z6KA 4A3GH 4YHHQ 2WAQG 5JVG3 1VQLA 4XT1B 1WVLA 1KAAA 3E9HA 3K5MA 1SYGA 3A56A 1X55A 3M4PA 3G4SA 2JA8G 1ASYA 4KHZA 1C0AA 1GUTA 1WCMG 2IT1A 1NAPA 1IBLQ 4A76A 1HCZA 1JJ2A 1G291 4X65L 2K05A 3RLNA 1Q81C 1I94L 2YU9B 5KGUA 4ZRZA 3K5NA 3BVZA 1NY4A 3CQZB 5C3WA 2R3ZA 1VQPA 4RWSC 3HOYH 4JI5Q 4DF7A 3JAMi 4LF5L 4A93H 4HSVA 1TS2A 2EYJA 2K32A 2XGTA 5JPMC 2I07B 2KJXA 3MXNB 3CF5A 4YWKA 3NENA 4JI4L 1D5XC 2F0PA 1SMYD 4C3IG 4BBRB 2N88A 3P75A 2UUCQ 1YJNA 3D6CA 1STAA 5D3DA 1CSQA 4KMUC 2J7ZA 1HR0Q 4FF1A 1LTID 4ABNA 4ZAIA 4B3RL 1G51A 4IPDA 4JBKA 3NQTA 5C44H 3T56B 2VQFQ 1JOOA 5L37A 1KRSA 4A3FH 3J81L 1XJVA 1SBBB 2PI2A 2Q8RE 4LJZC 1EIFA 2ICEC 2WB1E 2B2WC 2JP1A 3SK6A 4UPAA 4UY8C 2RDGA 2NZHA 3FPPA 3IFTA 3GTQB 3EVQA 1TVXA 4R4IA 4LUZA 4AYBG 5I9PA 2IWHA 2EZVA 1H9KA 2R7ZH 2K5WA 1KNAA 4LF9L 4LF8Q 3RR5A 5KRUA 5AJ3L 3TZDA 1VF5C 5GQOA 5J3BA 4K8JA 5JPNC 1ZYRD 5FLMG 3NUCA 2KCTA 2ICIA 2F3WA 1TR5A 2NWGA 2O4XA 4KV6A 1VQCA 5I2YA 4ZLTF 3I4MB 4DFAA 3T1YQ 1ZYRC 4OONA 1X3PA 4CBVA 5I9OA 1H9JA 3CW2C 5M3FH 1N33L 4JCVE 2R7DA 3BDLA 3EQLC 4PNYA 1PA6A 2I5HA 1YITA 5IP9G 2KBNA 1F77A 2YTYA 4KD4A 5HY6A 4QUCA 1DOLA 5IYCG 1KAWA 4R4OA 2K5HA 3K7AB 1XYIA 1FR3A 2Z9HA 3PV0A 4LFAQ 3ZYYX 1HTLD 2PQAA 5ELEA 2OCEA 1SRUA 2H4OA 1LM0A 1PH9A 3GTKH 1L1OB 2B8GA 4HSPA 1B9MA 2DNEA 4RGMA 1WYDA 3A55A 1SYFA 1M4VA 3S17H 5ELOA 1TWCH 2F0OA 3STBD 1CKNB 1Q1BA 1X3FA 2SNSA 1HA5A 1SE2A 5A2QE 1IHZA 1NE3A 1EIYB 1HHVA 2AHOB 1E2WA 4JYAQ 1EY4A 3D0FA 2HT1A 2E2IB 1DONA 3NSWA 3H3VH 4LF9Q 1XNRL 3T1HL 3CRKC 4DR4Q 2Q8TA 1BCPC 1X3EA 3H94A 2JA6G 3I55A 2O2LD 2HQEA 3Q24A 4A3IG 4R1JA 1F2ZA 4JVZA 1X65A 2EY5A 1HTPA 1EOTA 1G2TA 3FDTA 3J80i 5I6YA 1HNXL 1OTCA 1BCPD 2YTVA 4A3MG 1IKLA 2E75C 1D6EC 1PYBA 3SK8A 3K57A 3BYYB 3NEMA 3SDZA 2Y0SG 1KLGD 1D8LA 2VQEQ 4A3CH 4DR1Q 3ER0A 5T1GA 1SDFA 4JPBW 3PUZA 5CBEE 1A3UA 3K0YA 4ULLA 3T51B 2XN9C 4P2CB 4HJ7A 1EQVA 4E6IA 2LY7A 3CCQA 3HKZB 4KI0A 4ZUJA 2MFIA 1MKHA 1RF2D 3FEWX 2EVBA 4IJHA 4G57A 2E5LL 1EIHA 3SHLA 2EYOA 1SNMA 5J39A 1RHPA 3N6RA 1EY6A 3MHBA 5FLMH 3KUPA 1TWFH 5IYDG 4IPGA 1SFOH 5A2QL 3BVGA 2F0TA 5CV8A 3MEHA 2EYLA 1Y1WB 2F0NA 1KIXA 1Y14B 1FNWA 1ET9A 1AE3A 4GKJQ 3TSSA 5LMNL 2NZ1D 5A35A 1CUKA 2ZJQA 4EQPA 4MZ9A 2MO0A 4IFDI 4DUZL 1QJOA 1IZ6A 2EXZA 2PCFB 4FO2A 3C2PA 1NSNS 3PO3G 3MAQA 2KEDA 3E6ZX 2BDNA 1PFNA 1VQ4A 2QW7A 3BZDB 1WJJA 5EKKA 4POFA 3HOUB 1WI5A 4X65Q 4ALPA 4L5RC 3QJYA 3CD6A 5C4XG 2JN4A 1F9SA 5LL6X 4OELB 3FMCA 4RHSA 1EY9A 4CJ2C 5M5XH 3UDFA 2H1EA 2ALYB 2ES2A 3TS2A 3FVQA 4QQBX 1SE3A 3H09A 1WTOA 1RIPA 3CPWA 4JI5L 1DZ1A 1C9OA 4ILWA 1PDQA 2PI2E 4LK1C 3CC7A 4C56C 3FKIG 4OWWB 5C6AA 4A93G 3J80L 1LT3D 4A3DB 3U9SA 5IGBA 3M3YH 4K2LA 3BVMA 5ELBA 1Q86C 1V43A 2AKWB 1BNZA 2UXBQ 2RDHA 4O0AA 1Q1EA 1AH9A 3S2DB 4YCUA 3NK9A 3KF8A 3HOVH 4C3IB 5CMDA 1CKMA 1DM0B 2K75A 2R6GA 1LYLA 3V05A 4K6DA 5JJZA 3MA2B 4KJNA 4HR7B 4MIUA 2EE1A 1Y1VH 4LMQD 2MQHA 3F2CA 4JI4Q 5IWAL 1Q3LA 5DNFA 4DV7L 3MWYW 3MTSA 1VQJA 1LTSD 4A3JB 1EY7A 2B63H 4R8IA 4A3DG 2F0QA 3CCJA 4JW0A 3BZKA 5FJ8G 1HZCA 5IP7H 4GOPB 1K83H 1STNA 3S16B 3ICEA 2JA7G 2R7ZB 2R61A 1Y69U 4F8MA 2KEEA 3PQIA 4TKOB 2IY5B 4QGUA 2B2YA 1KHIA 1JB3A 4JOIA 1L1OA 1PRTF 1JOKA 1KLUD 3KF8B 3E0JA 4N8FA 5EKIA 5C3EG 3D31A 2B2YC 3S1MB 1CHQD 3K8AA 4RGTA 3G71A 1GUSA 5BR8Q 1TQOA 4OWXB 3CCVA 3ULPA 1QVFA 4XDXA 2X69A 3L2PA 1U4MA 3I73A 1J6QA 1X6OA 1QUQA 3CAMA 3HRZC 5M5WH 3VYUA 3NBHB 1AP0A 2UXBL 4BA2I 1VF7A 1E2VA 2O5IC 2E74C 1Z6HA 4GLAC 3K0XA 4BS9A 4DV3Q 4DV6Q 3GTOH 4R4QA 3HOZG 3MC0B 5FO9B 2EPBA 4KKTA 3TP6A 3Q23A 3EJIA 2F0MA 1A63A 1ICWA 3I91A 1A15A 2WV6D 3C1FA 4JI0Q 4BXXG 1R4PB 1YIJA 2RCNA 5IWAQ 2K28A 1QNUA 4CGYB 2EXDA 3CMEA 1WTRA 1PTOC 3J81i 4JK1C 2PZUA 1WD0A 3Q8DA 4J15A 2B2UA 1FJGQ 5DEHA 4P73A 5C4HA 1CA5A 4BY7B 2ZJRA 2AQ3B 5D3IB 5IYBH 1O80A 3KF6A 3HKZG 4CDFC 1VQHA 1TU2B 5JEAJ 4YHHL 2RF4A 3NWTA 3RN5A 3S1RB 2F0VA 2B39A 1VQOA 4GLVB 1XXGA 2PNRC 1TWAB 1HUMA 1IYUA 5EAYA 5F2DA 4AIMA 1I4GA 2G9HD 4U68A 3FPUB 4BY7H 3PO3H 2IX0A 3X3MA 5C3XA 1XNQL 1K8AC 5FOBB 2NYZD 1BCPB 5JVH3 1A0IA 1ML0D 1BO0A 1EY5A 4LF7L 2NB0A 4M8AA 2EOTA 3ERSX 4DR3Q 4BY1H 2BDOA 5FO7B 4XQJA 2EIFA 4A3FG 3GTGH 1Y1VG 1D1IA 4EQOA 5DM73 2E2HH 1STGA 4DR7Q 1I6HB 1ZXTA 4OIKA 4DV3L 2HCCA 4DV6L 2QA4A 3GTMB 3M7GA 1Y8NB 1G2SA 1SMXA 2MJ8A 2PZWA 5E4XA 4C3JH 2K33A 4A3LH 4C3JG 1UE6A 1V1OA 4DV2Q 4HIDA 3KK7A 4GLXA 3NXWA 1IL2A 1VQFA 2UUAL 1PZJD 1QILA 1XX8A 4PQXA 4CDCC 3AFPA 4HJAA 3PSIA 3GQBA 4PMBA 3S9WA 4EQ5A 3HOXB 5ELCA 3A74A 1BDOA 2VNUD 2UUCL 3U50C 4DAVA 3H15A 1IL8A 2LKVA 2M00A 3GTJH 5K36G 3HKSA 4BBSH 5C5LA 3OWFA 3A5ZB 4Y7NB 1PMRA 5CC4A 1Z7TA 4TSSA 4G7ZC 1VQGA 4PZ6A 1SMYC 1Y8PB 3MXUA 4A3LG 3PUWA 1H9SA 2MHVA 5IGEA 1GHKA 2KHSA 4JV5Q 5HURA 5NUCA 1JJGA 2L11A 3PF5A 4A3IH 2MP1A 3LX0A 3EA6A 2PQAB 4XYOA 1F2YA 1NR2A 2IW3A 4I7ZC 1CSPA 4XIGS 3S1RH 3W3AA 1JC7A 3IAYA 1A8VA 1TXYA 2E2DC 1VQ8A 1CZGA 2JSOA 4OGQC 1HUNA 2ZTDA 4LF7Q 1N34Q 4OO1G 2L4NA 1HQMC 4ODGA 1HNZQ 4DUYL 1J9OA 3S24A 2FHTA 2Q2TA 5M3FB 2BE5C 2EJFC 1MHWC 1E7ZA 3J81c 5G3LF 4KLKA 2V1CC 1M90C 4O1NA 1STYA 4JI2L 1GUOA 3MFGA 2RA4A 2CCZA 4C2MH 1BVSA 3NWSA 4JI7L 4HJ5A 3C46A 1C48A 2IX1A 2A68D 2K5VA 3KBGA 4DAMA 4KHVA 1PH2A 2EY2A 2JE6I 3OYYA 4IN3A 2KHJA 4L5QA 1FYCA 2L5TA 1M1KC 4G4KA 3RD4A 1L2FA 1DOKA 1SNPA 4A4IA 1YJWA 4DV7Q 2VUMB 3L7ZC 1KDBA 2K6AA 5H1SE 1GO3E 3TBIB 1YZ6A 1T9HA 3VA7A 3TQYA 4H13C 5C3EH 4MHEA 1S5DD 4C1NK 1S3OA 1TWGB 4I65A 2R92H 4L5SA 1A62A 3J7YW 1CA6A 1RD9D 4RMFA 2F0JA 1G91A 1EYGA 3MZ5A 3E5SA 4XQNA 2CWPA 2D62A 3J80c 3PO2G 3U4ZA 1CFMA 1RKNA 3W1BA 1Y8OB 3BU2A 2E8GA 4RHRA 5FJ8H 2FFKB 3QO2A 4KY6A 4XXEA 4N9TA 4A3GB 2GA4B 4MTKA 4DAPA 2PW5A 3OWEB 3M4QA 2F03A 3NHHA 1IW7C 5D14A 3A0JA 5ELDA 4EQNA 1D5ZC 4JI8L 2Q8IB 5C4ZA 3MXNA 3TZUA 1SYEA 4KTAA 4BBRH 3KLSX 4U673 1HNXQ 3NTHA 4X64L 1V9PA 4JBWA 3RZOH 2SEBD 2BH8A 3NP8A 3A5UA 1TWCB 5M5XB 1KNEA 1EEID 3AMUA 4X62L 2OTJA 4KN7C 2NUCA 2Z6BA 1SE4A 2D9UA 1ZKOA 4H7BA 2ATWA 3I4NH 2JEAI 4X3KA 3J81j 1B4OA 1E24A 2E5LQ 4RKBA 4B08A 5GAGC 3AFQA 4QCLA 1IKMA 2KOLA 3CPFA 1Q90A 1DD2A 5JOBA 3RN2A 4O42A 2F0KA 2CW0D 4K6LA 4L63B 2QKIC 4DR5L 3G48A 1YHQA 3LNNA 1N36L 1BBXC 1ESFA 2NN6H 4BWGB 2CW0C 3X3NA 2Z6KC 4OXPA 4IURA 2PW7A 1L0YB 2WP8J 2OQ0A 2KA7A 1K3RA 1MSHA 4QB4A 1HPCA 4OX9L 3K6OA 1K28A 4AYBE 5IT9E 4B3SL 1SAPA 4F7XA 5M3MH 1MI2A 1GM5A 5IE8A 1ENFA 1VQEA 2R7ZG 2JA7B 3ULJA 2DJFC 5BN5A 3C3LA 4TVAB 4DUZQ 1HRJA 2RKSA 1TS3A 1I5FA 3E0EA 3SXHA 3S17B 4HN7A 4ZK9B 3MFYA 4C1NI 3VR6A 1O7IA 3S15H 3CXCA 4QUFA 1JJCB 1SN8A 2FJ2A 5DAUA 4I7AA 4XTCS 4DR2L 2ZXOA 3SVMA 2QDLA 3GV6A 1W6JA 3GO5A 4IFDH 4YWMA 1UNSA 2E76C 2PO4A 1XPOA 1PH7A 4DR7L 5IGCA 4DV1L 2IPKD 3S1QB 4RH6A 2NVQB 1HFGA 2JA6B 1SR3A 1TWHH 2NN6G 3SEBA 5KYIA 1AW7A 4J6HA 3Q22A 3PIPA 3BJUA 3G6EA 2LFNA 4LF6L 4NP5A 1FD7D 2Z4IA 5CV5A 3Q6SA 1WTXA 1N32Q 4DR5Q 1Q46A 5C0XG 2CHBD 3S2HB 1A2TA 2EJGC 4A3JG 1N36Q 2FMCA 3HOYG 5EBCA 1MD2D 4NB3A 5IODA 3KLWA 1EU3A 4NXNQ 5FO8B 2RHSB 3LWEA 2ZM6Q 1QNKA 3Q0AA 1N8RC 4BXXH 1BKBA 3DWPA 4RGNA 2XRSD 3H0GG 1NMGA 2OT2A 3I7FA 1SE8A 4B3SQ 1FVIA 4EGVA 1KC8C 2IHFA 3DWQA 2DNCA 4IUQA 1JE5A 2A74C 2F4VL 1EIGA 3S1NH 4GN3B 2P5ZX 1BXTA 2K52A 1VQ7A 2BA0A 3OTOQ 2LXJA 2KCNA 2L55A 2K03A 1PVOA 1P8LA 2DY8A 4POGA 1Y1WH 1H9RA 1SNOA 4ZKBB 1SNCA 1IBKQ 1U4RA 2F0GA 2ZJPA 2Y0SE 3M4OB 1EWIA 2XWBB 3PO2H 1OO9B 1PTOB 1SXTA 3PUYA 4HJ9A 1N34L 4NPSA 2F0DA 3GD7A 3I4MG 4L5TA 1E0BA 1HA6A 4P71A 2R92G 2BCOA 3KJOA 1V1PA 3FHWA 4DV1Q 2CFMA 3HOZB 3DM1A 4HAEA 4P75A 1BBWA 3AEVA 1EY0A 3CRLC 1F2LA 3HOXG 5E1FA 4P72A 1LABA 2AMCB 3V96A 5ELFA 1N32L 2GVAA 3CCMA 1I4HA 3PIO3 1K8GA 3D8GA 2AWNA 3H91A 1LACA 5BN3A 2E2JH 2NVXH 1HNWL 4NXNL 5IGGA 3G6JB 1HH2P 1EY8A 1BBUA 1HR0L 2RHQB 3K80C 2GN5A 5CV4A 4B3RQ 2QEXA 4LAAA 1R4QB 2CH4A 3ONAB 2A6HD 5C3EB 1JE4A 1TS5A 3QOLA 1BOSA 3JAME 3STBC 1VQAA 5I4DA 2PPBC 3PIP3 5IGFA 1PH1A 2B2VA 1VQ5A 2F4VQ 3IFDA 1B3AA 2UU9Q 1SJHD 2A69D 2JXMB 4KK7A 4KKUA 1YNJC 4RKLA 1NJIC 2B2VC 3A8JE 1MGSA 4OHJA 1PH8A 1CKOA 5C5MA 3CHBD 3BG3A 3MXGA 4B9XA 3F2UA 5HGQA 1CHPD 4S3SA 3VR5A 1MJCA 5M5YB 3LGJA 1PTOD 3L3OC 4IUVA 4DKAC 1X56A 1II3A 1LTRD 2N78A 2YU9H 3CKIB 5G3LD 1QVGA 3HGBA 4B3TL 3S2DH 3S1MH 1X3GA 2KCCA 1KDAA 4HMJA 2VUMG 5KNBA 1CK1A 3GTMH 2F0IA 4A3IB 4A3DH 1PTOF 5CR3A 2BA1A 2J4XA 2OEOA 4IFDJ 4JG2A 4C3HG 1A2UA 1O78A 1QVCA 1UEAB 1EL0A 2K4KA 3W2DA 1PFMA 3I3CA 1TS4A 5LMUL 1K73C 4JI3Q 1EZ6A 3ND8A 3HP3A 1I3QH 1B7YB 1CKNA 4XQQA 4DU9A 5M5YH 4RCOA 2HUGA 2PNHA 4DV2L 2UUAQ 1S72A 1PXUA 2WAQB 2PYKA 2A1AA 1DJRD 3EBEA 4CJ1B 4IOAA 2UXCQ 1AE2A 2RSOA 4FNFA 4QIWB 5M5WB 1K9MC 5HGTA 2B29A 3NBHA 4IUPA 2F52A 3D4WA 3MEFA 1EUJA 2F0EA 1FL0A 2UU9L 4AQYL 1C8CA 3RLFA 5C0XJ 3PIOA 4WORA 4C3IH 4PZ7A 2GVBA 3B6YA 4OL7A 2X6GA 3M85A 1WCMH 1VQIA 3U4VA 1P16A 4CJ0B 1NTGA 1U4PA 4GN4B 2R92B 3M3YB 1X9NA 1YJ9A 1MSGA 3KDFB 4GN5A 3IRBA 1E22A 3DMUA 4HMIA 1EOVA 1SLJA 2UUBL 1I6HH 1B8AA 2F0FA 3I70A 2WKDA 3TRZA 4UHVA 4GS3A 1AZPA 3GTPB 1H9SB 1JOQA 2L15A 2SDFA 2E2IH 2A6ED 1YVCA 4BBSB 4IALA 2MUYA 5IY0A 3SR1A 4C3HH 1OXXK 1TWHB 1HNZL 2R93H 4IPHA 3W5OA 3TEHB 4GNXB 1UUPA 4JI3L 4YCVA 4HTHA 4DV5L 4HIMA 1XTCD 5IGDA 5KNDA 2Z4HA 2HCIA 4K0KL 4IPCA 4C3JB 3I72A 1CQFA 3IKJA 1XWEA 1KD1C 3ND9A 1WTVA 1Q7YC 1ILQA 3CCSA 3DHQA 4FF2A 2QGQA 1W3SA 2NVXB 4IUNA 4EX5A 2EYHA 1T5EA 2Z0SA 4ZYSA 1HR0W 4PMCA 3J7AF 2NN6I 1KQSA 4HCSA 3QG1A 4ZQ3A 4DV4Q 2EDGA 1JORA 3DM3A 2G5DA 4A3EH 1GOZA 4RA8A 2QF7A 3MVVA 4GNXC 1MBYA 2K5DA 4RGOS 2JJQA 1DGSA 5EPJA 4A3KH 4DXFA 2FINB 3OTOL 1BF4A 4JOIC 4IO9A 3R3OA 5EJWA 1O7LA 5CYUA 4A3MH 4GKKL 2KENA 1ZEQX 1I94Q 1RDPD 3GTJB 4K14A 1SEBD 1IBKL 1KDCA 1KTKA 3BZCA 2VW9A 3HKZE 1STHA 3V2TA 1YHBA 2XWJB 4DK6C 1EWHA 1D1KA 3HOWG 3I8ZA 1ET6A 1ONLA 1EYDA 1GHJA 2D0OA 4JI8Q 2A73B 1PRTC 4FF4A 2C5CA 2XNAC 1SSOA 3A7AB 3TMEA 5C44B 1SYBA 3CMAA 1UWVA 2MGSA 4DV5Q 4O2DA 1F9PA 4X62Q 2F0UA 2HIXA 3GTLB 4FVMA 1CI3M 4R9WA 4X66Q 1HZ9A 2BOSA 2ID0A 2L9HA 4LFCQ 2B63B 2M9VA 3ULLA 3NTIA 1S40A 2K50A 2TSSA 1U9RA 2IX3A 2A69C 5J1ZA 1HNWQ 3HOVG 2JA5H 3UE1A 1I3QB 2JA7H 2VQFL 3SK4A 2IJ0A 3J81E 4RFBA 4CDEC 3S1QH 1HZBA 2WIIB 5AFWA 4ZCKA 4IUUA 3H6MA 3F2DA 2IL8A 4IZ8A 3FKIH 2ASBA 2B8FA 4H0LC 2NBFA 1FNVA 1E3PA 5JJLA 1CTMA 1PFBA 4KY5A 1JR0D 2HDLA 1XPRA 4LF8L 1UE5A 4OX9Q 3K81C 5AJ3Q 4GKKQ 1NCVA 1Q8IA 3S1NB 2K5QA 2HDMA 4F88A 1VS0A 1K8OA 5BN4A 1WTWA 1EFID 3D6WA 2RDFA 1YNXA 4GOPC 5EBDA 2Z1CA 1B3QA 2AWOA 5JEAG 3NQIA 4B3ML 5TSSA 1Z9FA 1DOMA 1DXMA 3TDQA 4GOPA 1JWMD 1E1TA 3M4OH 3DUZA 1YHAA 1PH5A 2JYOA 5GAEC 5KIXA 2AUJD 3T13A 2KUMA 3OIPA 4DR2Q 4A3EB 5GROA 5CV9A 4QL5A 1DCZA 3M9BA 3RZOB 1TT2A 4LUOA 2F0LA 2Y0SB 3K58A 4ME5A 1N9WA 4A3KB 5E4WC 4V0BA 2L0CA 4UAIA 4LFCL 4LFAL 3A7LA 4CKCA 2TMPA 3RMHA 5IYDH 2D0PA 3CCUA 3KLRA 4OIJA 1QB5D 3S14B 1T5XD 2MNAA 3O13A 4QY7A 5FK9C 3CCEA 4ID6A 4PG3A 3FKIB 5IYBG 4UDUC 1GXDC 1Q12A 1F9RA 1S5ED 1GUNA 4DK1A 3U58A 1FGUA 3AYHB 1FJGL 1UEBA 2OF1A 4JYAL 1J5EL 4AQYQ 1GJXA 2OTLA 4JI6Q 1VQDA 1F9QA 2B2WA 3EIVA 5E7NA 3I4NB 1LTAD 5LMNW 2PMZE 3AB9A 1EQQA 4H02A 5M3MG 5EGTA 1VMCA 4A3CG 4R4TA 1ENCA 1G6PA 3LWUA 3DEOA 1K0RA 2PZTA 2K1BA 1V1QA 4QIWE 3PO3B 5K5PA 1MIUA 3CP0A 1I4XA 2VY3A 2M2LA 2DJGC 5M9OA 1XNQQ 1LTGD 2WB1G 2UXDQ 1WOCA 5FLXL 2RBMA 2A68C 3J7AV 4APVA 2VXWA 1NNXA 1W2BA 3HOVB 4K5WA 3KYHC 2N55A 1CM9A 1KL9A 5JJIA 4FXGC 4UP8A 1NBWA 4UP9A 2PQEA 1BCPF 1I50B 2EY6A 5C4JH 1JB7A 1VQNA 2J0TD 4KHPL 4CKEA 3ZJYC 1CZWA 4WJ4A 4C3HB 1SYCA 2FMMA 4K0KQ 3BYTB 1ILPA 2PMZB 1SFOB 3CCLA 4TRDA 1I6VC 3BS1A 1LT6D 2D2CC 5IYCH 2XVSA 4TQUS 1I4QA 3T53B 3L0OA 4MNOA 3H0GB 2JEBI 4XYQA 4GKJL 4DXGA 5IT9L 3HOUH 1R9TH 3J7A5 4L6TB 3WOFA 4AH6A 4JI6L 2VZAA 4OO1I 1OXVA 1K3BC 4WJWA 1PRTD 4J1MA 1BQQT 4DV4L 1RCVD 2A8VA 2QDBA 4N9PA 1ESRA 4C2MB 1TY0A 1G8ZD 3F8TA 4FP5D 3OPOA 2Z8LA 2L1BA 3VYRA 5JJKA 1K8MA 5DLQE 1EQRA 3NTKA 1SNQA 1E2ZA 2B2TC 3QB3A 1A3VA 2A5HA 4OWTB 3DWAA 4JV5L 1AFPA 2NTSA 5I6WA 3KF6B 1AEXA 3OHXC 2B2TA 2CVRA 3TS0A 2AQ2B 1IW7D 4JC0A 1QOHA 3D3RA 5C4XB 1ENAA 1SROA 1HJPA 4B9WA 2QEJC 2KVMA 1XMQL 4ZKCB 1WFQA 4NMZA 4RG1A 1VQMA 1K83B 4DAYA 3J7ZC 1YNND 3J80E 1U5KA 1OXSC 3CCRA 4DUYQ 2QILA 4B3TQ 2A19A 2YV5A 2JQOA 5D65A 4KHPQ 2Q2HA 4CDDC 2XRQD 1PYSB 1PHJA 3QIAA 4JI2Q 1M8AA 4R8NA 2V4DA 3IL8A 3K7UC 3P1HA 1I50H 1LO5D 5IP7G 4DNTB 3PUXA 3KJPA 3WDNA 1QUQB 3KDFA
chains in the Genus database with same CATH topology
1WCMB 3JAML 2F0WA 4X3SA 2AQ1B 2G9DA 1SJED 1S5BD 3K5LA 2JA8B 3UI2A 3HS0C 1NUCA 1QE6A 3WOEA 3MXPA 1RODA 1CQVA 2DY7A 3BDCA 5JEAH 2X6LA 1LT5D 1R9TB 3I4LA 4FYDA 3TP7A 4XT3B 3QWNA 3HOWB 1HFNA 3HG9A 4HCEA 1JWSD 3K59A 5EPLA 5C0XH 1EWCA 3R93A 4QMGA 1D2BA 4F87A 1OXTA 1HQRD 1Y1VB 4FXKC 2LMCB 3D4RA 5E3FA 3RUZA 5C0XI 4PMWA 1PRTB 2EYPA 2RSNA 3R2IA 2LS01 2K01A 1GUWA 1B2TA 3OIQA 5KEEA 3PMFA 4KJOA 4EVOA 1J8IA 1TY2A 1RTNA 4L8JA 4X3UA 3M4YA 4BY1B 2I46A 1JICA 1TKWB 2BE5D 2ENBA 5T1IA 3ERQA 2KQ3A 1C4QA 1OXUA 3AU7A 1GUGA 3L9AX 5FLXE 3N52A 3VA5A 2K7VA 2NVYB 2RQXA 2E2JB 3R8BA 4FXDA 4KD3A 3KBXA 1EYAA 4FF3A 5LHY1 4K2KA 3RZDB 4DN4M 3VR4A 3P20A 4CHTB 3A54A 3VYSA 1EEFD 1DYQA 4IQZA 2WB1B 2AUKA 5EQ0A 5EKLA 1X32A 3GTGB 3R2TA 1FNUA 3M7NA 2F1MA 2JA5B 3A8IE 1LLRD 4AYBB 3TP5A 1B53A 2F0SA 1JCKB 1A6XA 2WKCA 1WD1A 5ISRA 3NE5B 1PZID 1O7ZA 5M3MB 4DA2A 4Q5VA 4OO1H 4IUTA 1U4LA 1YNJD 3T16A 3VR2A 3U9OA 3HEJA 1L0XB 4H44C 4WFN3 2A6HC 2B2UC 4K5VA 4DGZA 1I4PA 1YNNC 5JAVA 3DXJC 1LV9A 4PV1C 2XIWA 1QG7A 2E2HB 2NVTB 2YYZA 4BA1I 1X3QA 4YIJA 5K36H 2RVLA 1I4RA 4CKBA 4NKLA 3G7LA 1JWUD 1TIID 2VB3X 3K5OA 1S5CD 4A93B 5C4JB 1PTOH 2ZXRA 1QCBD 4QF4A 3TN2A 3VYTA 3GTKB 4WRDA 2MPMA 3I90A 1LT4D 2XSCA 1VCIA 1WTQA 3KLSA 2F4IA 2DN8A 1CT1D 3OMGA 4Z9CB 1RJTA 1LTBD 5J22A 1STBA 2D5DA 5KYLA 3CU7A 1VDZA 3EFXD 3OSOA 1IYVA 4Q0FA 5CGKA 1F2MA 1WTPA 2C9OA 2ZT9C 3FRPB 3SK5A 1B44D 4IFDG 3D4DA 3A8KE 3SE0A 1AZQA 1UAPA 4KN4C 2EJMA 3OW7A 1LTTD 3EROA 2SNMA 3S15B 2QCPX 3HZXA 2A6EC 3BDOA 5EPKA 4KKSA 2O5JC 2EYFA 4K5XA 5IOCA 3TP8A 3DEPA 1EYCA 3NPPA 3OMCA 5COYA 1Z47A 4DK0A 4DNRB 1FGBD 1TWFB 3VR3A 5KNCA 2OXPA 1B50A 1EQTA 5I2XA 1V1PB 3PUVA 4ZUIA 1PYWD 1W6KA 4A3MB 1NR4A 1KABA 3ITPA 1AN8A 5CBAE 1G6ZA 3HOYB 3P7JA 1B9NA 2EYMA 1VMPA 2KECA 5CORA 1S4ZA 4G7HC 4A3FB 3QOJA 1QWYA 2WINB 3C1EA 1V8QA 4X3TA 2WACA 1EZ8A 2K04A 1B1ZA 1HXYD 4A3BB 1EU4A 2SOBA 3GV3A 1PZKD 1S5FD 2CQAA 1O7YA 3PO2B 2VB2X 2F0HA 1RTOA 4MN3A 3URYA 5FKAC 5LL6S 4GZYC 1SYDA 2NTTA 1D5MC 1PLFA 3NBIA 3GP7A 2EY1A 3T4AC 4K8IA 4RCNA 2L12A 4V190 4NW2A 3H3VC 1BUVT 4RAUC 2ZXPA 5CV6A 4KY7A 4M1UB 3OOCA 1JQYD 1SNDA 1BR9A 4J8QA 2F3VA 4NDXA 5IIFA 5CV7A 1H9MA 4HEDA 1A3TA 4G7OC 2R93B 1STEA 3GTOB 5DM63 5JVG3 4XT1B 1WVLA 1KAAA 3K5MA 1SYGA 3A56A 4KHZA 1GUTA 2IT1A 1NAPA 1HCZA 1G291 2K05A 2YU9B 5KGUA 4ZRZA 3K5NA 3BVZA 3CQZB 5C3WA 2R3ZA 4RWSC 4DF7A 4HSVA 1TS2A 2EYJA 2K32A 5JPMC 2I07B 2KJXA 1D5XC 2F0PA 1SMYD 4C3IG 4BBRB 2N88A 3P75A 3D6CA 1STAA 5D3DA 4KMUC 2J7ZA 4FF1A 1LTID 4ABNA 4ZAIA 3NQTA 3T56B 1JOOA 3J81L 1SBBB 2Q8RE 4LJZC 2ICEC 2B2WC 2JP1A 3SK6A 2RDGA 3FPPA 3IFTA 3GTQB 3EVQA 1TVXA 5I9PA 2IWHA 2EZVA 1H9KA 2K5WA 1KNAA 5KRUA 3TZDA 1VF5C 4K8JA 5JPNC 1ZYRD 3NUCA 2ICIA 2F3WA 1TR5A 2NWGA 2O4XA 4KV6A 5I2YA 4ZLTF 3I4MB 4DFAA 1ZYRC 1X3PA 4CBVA 5I9OA 1H9JA 3BDLA 3EQLC 4PNYA 1F77A 4KD4A 4QUCA 1DOLA 3K7AB 1XYIA 1FR3A 3PV0A 3ZYYX 1HTLD 5ELEA 2H4OA 2B8GA 4HSPA 1B9MA 2DNEA 4RGMA 3A55A 1SYFA 1M4VA 2F0OA 1Q1BA 2SNSA 1HA5A 1SE2A 5A2QE 1IHZA 1HHVA 1E2WA 1EY4A 2E2IB 1DONA 3NSWA 3CRKC 2Q8TA 1BCPC 3H94A 2O2LD 2HQEA 3Q24A 1F2ZA 2EY5A 1HTPA 1EOTA 1G2TA 3FDTA 5I6YA 1BCPD 1IKLA 2E75C 1D6EC 3SK8A 3K57A 3BYYB 3SDZA 1KLGD 5T1GA 1SDFA 3PUZA 5CBEE 1A3UA 3K0YA 4ULLA 3T51B 2XN9C 4P2CB 1EQVA 4E6IA 2LY7A 3HKZB 4KI0A 4ZUJA 1RF2D 3FEWX 2EVBA 4G57A 1EIHA 3SHLA 5J39A 1SNMA 2EYOA 1RHPA 3N6RA 1EY6A 3MHBA 3KUPA 5A2QL 3BVGA 2F0TA 5CV8A 3MEHA 2EYLA 1Y1WB 2F0NA 1FNWA 1ET9A 3TSSA 2NZ1D 5A35A 4EQPA 4IFDI 1QJOA 2EXZA 2PCFB 4FO2A 3C2PA 1NSNS 3MAQA 2KEDA 3E6ZX 2BDNA 1PFNA 3BZDB 5EKKA 3HOUB 3QJYA 1F9SA 5LL6X 4RHSA 3FMCA 4CJ2C 1EY9A 2H1EA 3FVQA 1SE3A 3H09A 1WTOA 1DZ1A 4ILWA 1PDQA 4LK1C 4C56C 5C6AA 3J80L 1LT3D 4A3DB 3U9SA 5IGBA 4K2LA 3BVMA 5ELBA 1V43A 1BNZA 2RDHA 1Q1EA 3S2DB 3NK9A 3KF8A 4C3IB 5CMDA 1DM0B 2R6GA 3V05A 4K6DA 5JJZA 3MA2B 4KJNA 4HR7B 4MIUA 2EE1A 4LMQD 1Q3LA 5DNFA 3MWYW 3MTSA 4A3JB 1LTSD 1EY7A 4R8IA 2F0QA 1STNA 3S16B 2R7ZB 2R61A 1Y69U 4F8MA 2KEEA 4TKOB 2B2YA 1JB3A 1PRTF 1JOKA 1KLUD 3E0JA 5EKIA 3D31A 2B2YC 3S1MB 1CHQD 4RGTA 1GUSA 1TQOA 4XDXA 2X69A 1U4MA 3I73A 3HRZC 3VYUA 1AP0A 4BA2I 1VF7A 1E2VA 2O5IC 2E74C 1Z6HA 4BS9A 3MC0B 5FO9B 3TP6A 3Q23A 2EPBA 4KKTA 3EJIA 2F0MA 1ICWA 3I91A 1A15A 2WV6D 3C1FA 1R4PB 2K28A 1QNUA 4CGYB 1WTRA 1PTOC 4JK1C 1WD0A 2PZUA 2B2UA 5DEHA 5C4HA 1CA5A 4BY7B 2AQ3B 5D3IB 1O80A 1TU2B 5JEAJ 3NWTA 3S1RB 2F0VA 2B39A 1XXGA 2PNRC 1TWAB 1HUMA 1IYUA 5F2DA 1I4GA 2G9HD 4U68A 3FPUB 2IX0A 3X3MA 5C3XA 5FOBB 2NYZD 1BCPB 5JVH3 1ML0D 1BO0A 1EY5A 2NB0A 4M8AA 2EOTA 2BDOA 5FO7B 4XQJA 1D1IA 4EQOA 5DM73 1STGA 1I6HB 1ZXTA 4OIKA 2HCCA 3GTMB 3M7GA 1Y8NB 1G2SA 2MJ8A 2PZWA 5E4XA 2K33A 4C3JG 1V1OA 3KK7A 3NXWA 1PZJD 1QILA 1XX8A 4PQXA 3GQBA 4PMBA 3S9WA 3HOXB 5ELCA 1BDOA 2VNUD 4DAVA 1IL8A 2LKVA 2M00A 5K36G 5C5LA 3OWFA 4Y7NB 1PMRA 5CC4A 1Z7TA 4TSSA 4G7ZC 1SMYC 1Y8PB 3MXUA 3PUWA 1H9SA 2MHVA 5IGEA 1GHKA 2KHSA 5HURA 5NUCA 2L11A 2MP1A 3LX0A 3EA6A 4XYOA 1F2YA 1NR2A 2IW3A 4I7ZC 4XIGS 3W3AA 1JC7A 3IAYA 2E2DC 1CZGA 2JSOA 4OGQC 1HUNA 4OO1G 2L4NA 1HQMC 4ODGA 1J9OA 2FHTA 5M3FB 2BE5C 2EJFC 5G3LF 4O1NA 1STYA 1GUOA 3MFGA 2RA4A 3NWSA 3C46A 1C48A 2IX1A 2A68D 3KBGA 4KHVA 2EY2A 2JE6I 4IN3A 1FYCA 2L5TA 4G4KA 3RD4A 1DOKA 1SNPA 2VUMB 3L7ZC 1KDBA 2K6AA 3TBIB 3VA7A 4H13C 4MHEA 1S5DD 4C1NK 1TWGB 4I65A 3J7YW 1CA6A 1RD9D 2F0JA 1G91A 3MZ5A 3E5SA 4XQNA 2D62A 1CFMA 1RKNA 1Y8OB 4RHRA 2FFKB 3QO2A 4KY6A 4XXEA 4N9TA 4A3GB 2GA4B 4DAPA 2PW5A 3OWEB 2F03A 4EQNA 3NHHA 1IW7C 5D14A 5ELDA 1D5ZC 2Q8IB 5C4ZA 3MXNA 3TZUA 1SYEA 4KTAA 3KLSX 4U673 3NTHA 4JBWA 2SEBD 3NP8A 1TWCB 5M5XB 1KNEA 1EEID 3AMUA 4KN7C 2NUCA 1SE4A 2D9UA 1ZKOA 4H7BA 2JEAI 4X3KA 1B4OA 4RKBA 4B08A 4QCLA 1IKMA 2KOLA 1Q90A 1DD2A 5JOBA 4O42A 2F0KA 2CW0D 4K6LA 4L63B 2QKIC 3LNNA 1BBXC 1ESFA 2NN6H 4BWGB 2CW0C 3X3NA 4IURA 2PW7A 1L0YB 2WP8J 2KA7A 1MSHA 4QB4A 1HPCA 3K6OA 5IT9E 1SAPA 4F7XA 1MI2A 1ENFA 2JA7B 5BN5A 3C3LA 1HRJA 2RKSA 1TS3A 3SXHA 3S17B 4HN7A 4ZK9B 3MFYA 4C1NI 3VR6A 4QUFA 2FJ2A 5DAUA 4XTCS 2ZXOA 3SVMA 3GV6A 1W6JA 3GO5A 4IFDH 1UNSA 2E76C 2PO4A 5IGCA 2IPKD 3S1QB 4RH6A 2NVQB 1HFGA 2JA6B 2NN6G 3SEBA 5KYIA 1AW7A 4J6HA 3Q22A 2LFNA 4NP5A 1FD7D 2Z4IA 5CV5A 3Q6SA 1WTXA 5C0XG 2CHBD 3S2HB 1A2TA 2EJGC 2FMCA 5EBCA 1MD2D 5IODA 1EU3A 5FO8B 3LWEA 3Q0AA 1QNKA 3DWPA 4RGNA 2XRSD 2OT2A 4EGVA 3DWQA 2DNCA 4IUQA 2A74C 1EIGA 1BXTA 2BA0A 2KCNA 2L55A 2K03A 2DY8A 1H9RA 1SNOA 4ZKBB 1SNCA 1U4RA 2F0GA 3M4OB 2XWBB 1OO9B 1PTOB 1SXTA 3PUYA 2F0DA 3GD7A 1E0BA 1HA6A 2BCOA 1V1PA 3HOZB 3DM1A 4HAEA 1EY0A 3CRLC 1F2LA 5E1FA 1LABA 3V96A 5ELFA 1I4HA 3PIO3 3D8GA 2AWNA 3H91A 1LACA 5BN3A 5IGGA 3G6JB 1EY8A 5CV4A 4LAAA 1R4QB 2A6HD 3ONAB 5C3EB 1JE4A 1TS5A 3QOLA 1BOSA 3JAME 5I4DA 2PPBC 3PIP3 5IGFA 2B2VA 3IFDA 1B3AA 1SJHD 2A69D 2JXMB 4KK7A 4KKUA 1YNJC 4RKLA 2B2VC 3A8JE 1MGSA 4OHJA 5C5MA 3CHBD 3BG3A 3MXGA 4B9XA 3F2UA 1CHPD 4S3SA 3VR5A 5M5YB 1PTOD 3L3OC 4IUVA 1II3A 1LTRD 3CKIB 5G3LD 3HGBA 2KCCA 1KDAA 4HMJA 5KNBA 1CK1A 2F0IA 4A3IB 1PTOF 5CR3A 2BA1A 2J4XA 2OEOA 4IFDJ 4C3HG 1A2UA 1O78A 1EL0A 1UEAB 3W2DA 1PFMA 3I3CA 1TS4A 1EZ6A 3ND8A 3HP3A 4XQQA 4DU9A 4RCOA 2HUGA 1PXUA 2WAQB 2PYKA 1DJRD 4CJ1B 2RSOA 4FNFA 4QIWB 5M5WB 5HGTA 3NBHA 4IUPA 3D4WA 2F0EA 1C8CA 3RLFA 5C0XJ 4WORA 4OL7A 2X6GA 3M85A 4CJ0B 1U4PA 2R92B 3M3YB 1MSGA 3DMUA 4HMIA 2F0FA 3I70A 2WKDA 1AZPA 3GTPB 1H9SB 1JOQA 2SDFA 2A6ED 4BBSB 4IALA 2MUYA 3SR1A 1OXXK 1TWHB 1UUPA 4HTHA 1XTCD 5IGDA 5KNDA 2Z4HA 2HCIA 4C3JB 3I72A 1CQFA 3IKJA 1XWEA 3ND9A 1WTVA 1ILQA 3DHQA 4FF2A 2NVXB 4IUNA 2EYHA 1T5EA 4ZYSA 4PMCA 3J7AF 2NN6I 4HCSA 3QG1A 4ZQ3A 2EDGA 1JORA 1GOZA 4RA8A 2QF7A 3MVVA 1MBYA 2K5DA 4RGOS 5EPJA 4DXFA 2FINB 1BF4A 3R3OA 5EJWA 1O7LA 5CYUA 1ZEQX 1RDPD 3GTJB 4K14A 1SEBD 1KDCA 1KTKA 1STHA 3V2TA 2XWJB 1EWHA 1D1KA 3I8ZA 1ET6A 1ONLA 1EYDA 1GHJA 2A73B 1PRTC 4FF4A 2C5CA 2XNAC 1SSOA 3A7AB 3TMEA 5C44B 1SYBA 2MGSA 1F9PA 2F0UA 3GTLB 4FVMA 1CI3M 4R9WA 2BOSA 2ID0A 2L9HA 2B63B 2M9VA 3NTIA 2TSSA 1U9RA 2IX3A 2A69C 5J1ZA 1I3QB 3SK4A 2IJ0A 3J81E 4RFBA 2WIIB 5AFWA 4IUUA 3H6MA 2IL8A 4IZ8A 2B8FA 4H0LC 2NBFA 1FNVA 1CTMA 1PFBA 4KY5A 1JR0D 2HDLA 1NCVA 1Q8IA 3S1NB 2K5QA 2HDMA 4F88A 1K8OA 5BN4A 1WTWA 1EFID 3D6WA 2RDFA 5EBDA 2Z1CA 2AWOA 5JEAG 3NQIA 5TSSA 1DOMA 1DXMA 3TDQA 1JWMD 3DUZA 2JYOA 5KIXA 2AUJD 3T13A 2KUMA 3OIPA 4A3EB 5CV9A 1DCZA 3RZOB 1TT2A 2F0LA 2Y0SB 3K58A 4ME5A 4A3KB 5E4WC 4V0BA 2L0CA 4UAIA 3A7LA 4CKCA 2TMPA 3RMHA 3KLRA 4OIJA 1QB5D 3S14B 1T5XD 3O13A 5FK9C 4ID6A 3FKIB 4UDUC 1GXDC 1Q12A 4DK1A 1F9RA 1S5ED 1GUNA 2OF1A 1GJXA 1F9QA 2B2WA 3I4NB 1LTAD 3AB9A 5EGTA 1VMCA 1ENCA 3LWUA 3DEOA 2PZTA 2K1BA 3PO3B 5K5PA 1I4XA 2M2LA 5M9OA 1LTGD 5FLXL 2RBMA 2A68C 3J7AV 2VXWA 3HOVB 4K5WA 2N55A 1CM9A 4FXGC 2PQEA 1BCPF 1I50B 2EY6A 2J0TD 4CKEA 1CZWA 4C3HB 1SYCA 2FMMA 3BYTB 1ILPA 2PMZB 1SFOB 4TRDA 1I6VC 3BS1A 1LT6D 2D2CC 2XVSA 4TQUS 1I4QA 3T53B 3H0GB 2JEBI 4XYQA 4DXGA 5IT9L 4L6TB 3WOFA 4OO1I 1OXVA 4WJWA 1PRTD 4J1MA 1BQQT 1RCVD 2QDBA 4N9PA 1ESRA 4C2MB 1TY0A 1G8ZD 4FP5D 3OPOA 2Z8LA 2L1BA 3VYRA 1K8MA 1SNQA 3NTKA 1E2ZA 2B2TC 3QB3A 1A3VA 2A5HA 3DWAA 1AFPA 2NTSA 5I6WA 1AEXA 3OHXC 2B2TA 2CVRA 2AQ2B 1IW7D 1QOHA 3D3RA 5C4XB 1ENAA 4B9WA 2QEJC 2KVMA 4ZKCB 4NMZA 1K83B 4DAYA 1YNND 3J80E 1OXSC 2QILA 5D65A 2XRQD 3QIAA 1M8AA 4R8NA 2V4DA 3IL8A 3P1HA 1LO5D 4DNTB 3PUXA 3WDNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EY6 A;  4QF4 A;  4WRD A;  4KV6 A;  2F0W A;  4IUN A;  2PW7 A;  4K5W A;  1SNO A;  3MHB A;  5KEE A;  2EYH A;  2F0Q A;  5CR3 A;  4DFA A;  4EVO A;  1SNC A;  2EYM A;  4PMC A;  4QB4 A;  1STN A;  4KD3 A;  2OEO A;  2F0G A;  2RDF A;  1EYA A;  1A2U A;  1EY5 A;  2EY6 A;  2PQE A;  4KHV A;  5I9O A;  3QOJ A;  2EY2 A;  4F8M A;  4K2K A;  4ZQ3 A;  1NUC A;  4F7X A;  2F0T A;  2F0D A;  5CV8 A;  3MEH A;  5J39 A;  2EYL A;  1JOR A;  1EZ6 A;  3MXP A;  3C1E A;  2O4X A;  2F0N A;  3BDL A;  5C4Z A;  2WAC A;  1JOK A;  1SYC A;  1EY7 A;  3OMG A;  3MVV A;  4PNY A;  1EZ8 A;  1SNP A;  1STG A;  4DU9 A;  4EQO A;  3BDC A;  5IGB A;  5J22 A;  1STB A;  5IGF A;  4KD4 A;  2PYK A;  5KYL A;  2SOB A;  2RKS A;  2PZW A;  1KDB A;  4TRD A;  3TP7 A;  5KGU A;  5KIX A;  3T13 A;  3SXH A;  5EKL A;  4EQP A;  5C3W A;  3R3O A;  3NXW A;  3OSO A;  1EY0 A;  1TQO A;  5HGT A;  5CV9 A;  1TT2 A;  3D4W A;  5E1F A;  5CGK A;  1F2M A;  2F0L A;  2F0E A;  4I65 A;  2EXZ A;  4ME5 A;  4K14 A;  1KDC A;  4DF7 A;  3DHQ A;  1NSN S;  3TP5 A;  5DAU A;  2F0S A;  3SK5 A;  4WOR A;  4QMG A;  2EYJ A;  2F0J A;  2F0H A;  5C5M A;  3D8G A;  4OL7 A;  1STH A;  3MZ5 A;  4PMB A;  3E5S A;  1SYF A;  4J1M A;  3S9W A;  3V2T A;  5ISR A;  2F0O A;  2QDB A;  4N9P A;  3D4D A;  2LKV A;  5IGG A;  1RKN A;  2F0P A;  2M00 A;  5EKK A;  1EYD A;  2SNS A;  1EY8 A;  3VA5 A;  5IGC A;  4KY6 A;  3OWF A;  1IHZ A;  5C5L A;  4N9T A;  5CV4 A;  3TME A;  1SNQ A;  4LAA A;  5CC4 A;  1SYD A;  1EY4 A;  1A3V A;  1EY9 A;  3P75 A;  2PW5 A;  3QB3 A;  3QOL A;  3EJI A;  3TP6 A;  3D6C A;  1STA A;  2F0M A;  4ID6 A;  3NHH A;  4EQN A;  3T16 A;  1SYB A;  3ERO A;  2SNM A;  3DMU A;  2F3W A;  4HMI A;  4J6H A;  3HZX A;  3C1F A;  5E3F A;  1SYE A;  4KTA A;  3HEJ A;  3RUZ A;  2F0U A;  2EYP A;  5I6W A;  2F0F A;  1AEX A;  2EY1 A;  4NP5 A;  4K8I A;  5CV5 A;  5IGE A;  2OF1 A;  4K5V A;  3NP8 A;  2KHS A;  2EYF A;  4RKL A;  2HQE A;  4K5X A;  5NUC A;  3NQT A;  3TP8 A;  4DGZ A;  1ENA A;  5C6A A;  5HUR A;  5I6Y A;  5IOC A;  5KYI A;  1JOQ A;  1EYC A;  1F2Z A;  1JOO A;  4B9W A;  1A2T A;  2EY5 A;  3LX0 A;  5JAV A;  2PZU A;  1F2Y A;  3OMC A;  3PMF A;  4KJO A;  4KY7 A;  5CV6 A;  1U9R A;  4K2L A;  4NMZ A;  2NUC A;  4IAL A;  5EGT A;  5J1Z A;  1SND A;  5DEH A;  4B9X A;  5C4H A;  5IOD A;  4H7B A;  4S3S A;  3SK6 A;  3SR1 A;  1ENC A;  2F3V A;  2OXP A;  3SK4 A;  3SK8 A;  4NDX A;  3NK9 A;  3EVQ A;  2PZT A;  5IIF A;  5I9P A;  1II3 A;  5CV7 A;  4ZUI A;  4K6D A;  1A3U A;  5K5P A;  4KJN A;  2ENB A;  3H6M A;  4MIU A;  2F0V A;  4HTH A;  3ERQ A;  1A3T A;  2KQ3 A;  4ODG A;  4RKB A;  4YIJ A;  5IGD A;  4IZ8 A;  4NKL A;  5M9O A;  3U9O A;  1EQV A;  4E6I A;  5KRU A;  4R8N A;  5JOB A;  2F0K A;  4ZUJ A;  5F2D A;  4K8J A;  4G57 A;  3P1H A;  1KAB A;  3ITP A;  1KDA A;  1KAA A;  4HMJ A;  2RBM A;  1SYG A;  4KY5 A;  3NUC A;  1STY A;  3SHL A;  2EYO A;  1SNM A;  2F0I A;  5C3X A;  1TR5 A; 
#chains in the Genus database with same CATH topology
 1Y1W G;  1WCM B;  1VQB A;  3JAM L;  2F0W A;  4YCW A;  4X3S A;  5LMU Q;  4BBS G;  2AQ1 B;  2G9D A;  1SJE D;  1S5B D;  3K5L A;  2JA8 B;  3UI2 A;  4A3B H;  3HS0 C;  1NUC A;  1VQK A;  1QE6 A;  3WOE A;  3MXP A;  1PFS A;  2N3S A;  2UXC L;  1Q8K A;  1ROD A;  1CQV A;  2DY7 A;  2HD3 A;  3BDC A;  3AQQ A;  5JEA H;  2X6L A;  1LT5 D;  1R9T B;  3I4L A;  4FYD A;  5ELN A;  3TP7 A;  1EFW A;  1VQ9 A;  4XT3 B;  3QWN A;  3S2H H;  3HOW B;  1HFN A;  3HG9 A;  4HCE A;  2ZTE A;  1JWS D;  3K59 A;  1GD7 A;  5EPL A;  4X6A H;  5C0X H;  1EWC A;  3R93 A;  4QMG A;  1D2B A;  4F87 A;  1OXT A;  1HQR D;  2EQS A;  3KFU A;  2WFW A;  3H3V I;  4B3M Q;  1Y1V B;  1XMO L;  2JA8 H;  4FXK C;  1ICF B;  2CQO A;  5C4X H;  1QZH A;  2LMC B;  3I4N G;  2VUM H;  3D4R A;  5E3F A;  1WTH A;  3RUZ A;  5C0X I;  4PMW A;  1PRT B;  2EYP A;  4R4C A;  2RSN A;  4A3G G;  3R2I A;  4WJ3 M;  2LS0 1;  3OW2 A;  4JBJ A;  2HIV A;  2K01 A;  1GUW A;  2I5L X;  1B2T A;  2HQL A;  3OIQ A;  5KEE A;  3PMF A;  4KJO A;  4EVO A;  2HHH Q;  1J8I A;  1TY2 A;  4LW1 A;  1RTN A;  2Q2I A;  4BBR G;  4L8J A;  2H5X A;  4X3U A;  3M4Y A;  4BY1 B;  4LNQ A;  2I46 A;  1JIC A;  2Q2U A;  1TKW B;  2BE5 D;  2ENB A;  5T1I A;  3RNU A;  3ERQ A;  2KQ3 A;  1C4Q A;  4BY7 G;  1OXU A;  1X54 A;  3AU7 A;  1GUG A;  2FXQ A;  3JC6 6;  3L9A X;  1J5E Q;  5FLX E;  3SGI A;  3N52 A;  1YI2 A;  2WAQ E;  1YEZ A;  1RL2 A;  3I4O A;  4FDB A;  3PGZ A;  3VA5 A;  2K7V A;  2NVY B;  2RQX A;  2E2J B;  3R8B A;  3K7A H;  2I5M X;  4FXD A;  4KD3 A;  1L1O C;  3KBX A;  1EYA A;  4FF3 A;  3F1Z A;  1TWG H;  5LHY 1;  4K2K A;  4DR6 Q;  4QJF A;  3RZD B;  5IP9 H;  4DN4 M;  3VR4 A;  3T1Y L;  3P20 A;  4CHT B;  3A54 A;  3E3X A;  3VYS A;  1EEF D;  1DYQ A;  3HOU G;  3S14 H;  3FP9 A;  5M3F G;  4IQZ A;  3W1G A;  2WB1 B;  4DR3 L;  2UXD L;  1N33 Q;  2VL6 A;  4UP7 A;  2AUK A;  5EQ0 A;  4DV0 Q;  5EKL A;  1X32 A;  2JA5 G;  2BH2 A;  3GTG B;  3R2T A;  1FNU A;  3M7N A;  2F1M A;  3NEL A;  2JA5 B;  4DPG A;  3A8I E;  1LLR D;  4AYB B;  4JI1 Q;  1JT8 A;  3TP5 A;  1B53 A;  2F0S A;  3KOJ A;  1JCK B;  5GAD C;  3QR8 A;  1A6X A;  2JA6 H;  5GAH C;  2WKC A;  1WD1 A;  5ISR A;  3NE5 B;  1PZI D;  1O7Z A;  5M3M B;  4DA2 A;  4Q5V A;  4OO1 H;  4LF6 Q;  3E9I A;  4IUT A;  1U4L A;  2B63 G;  3RZD H;  3HOX H;  1LUZ A;  1YNJ D;  4X66 L;  3T16 A;  3VR2 A;  3U9O A;  3HEJ A;  1L0X B;  4H44 C;  4WFN 3;  2A6H C;  2B2U C;  1XPU A;  4K5V A;  4DGZ A;  1I4P A;  2ZM6 L;  4PZ8 A;  1YNN C;  5C44 G;  1IXR A;  2ZTC A;  1IYJ B;  1C7Y A;  5JAV A;  2NVY H;  1VQ6 A;  3T1H Q;  1L0W A;  4DR4 L;  3DXJ C;  1LV9 A;  4PV1 C;  3H0G H;  1Q82 C;  2XIW A;  3S16 H;  2F3I A;  4ME3 A;  1QG7 A;  2E2H B;  2NZO A;  2OWO A;  4A3K G;  2NVT B;  4DR6 L;  2YYZ A;  3UDX A;  4A3J H;  4BA1 I;  1X3Q A;  4YIJ A;  4DAY B;  5K36 H;  2RVL A;  1I4R A;  4CKB A;  4NKL A;  2VQE L;  3G7L A;  1JWU D;  1TII D;  3TRE A;  2VB3 X;  3K5O A;  1S5C D;  4A93 B;  5C4J B;  1PTO H;  2ZXR A;  1QCB D;  4QF4 A;  3TN2 A;  3VYT A;  3GTK B;  4WRD A;  1LTL A;  2MPM A;  3I90 A;  1LT4 D;  2N8N A;  2XSC A;  3CQZ H;  3F2B A;  1VCI A;  4IJL A;  4JI1 L;  3KLS A;  1WTQ A;  2F4I A;  2C35 B;  3I56 A;  1B70 B;  2DN8 A;  4HJ8 A;  1CT1 D;  4JI7 Q;  3PCO B;  2R7F A;  3OMG A;  1ASZ A;  4Z9C B;  1RJT A;  2OQK A;  1LTB D;  5J22 A;  2XTI A;  1STB A;  2D5D A;  5KYL A;  3CU7 A;  1VDZ A;  2R93 G;  4LUV A;  3EFX D;  3OSO A;  4JBM A;  4OEM B;  1IYV A;  2IHE A;  4Q0F A;  5CGK A;  4LFB L;  1F2M A;  1WTP A;  5LMN Q;  2C9O A;  4LF4 L;  2JK8 A;  2ZT9 C;  3FRP B;  3SK5 A;  2YTX A;  3I2Z A;  1B44 D;  4IFD G;  3GTP H;  3D4D A;  3PF4 A;  3RLO A;  3A8K E;  3SE0 A;  1KXL A;  1AZQ A;  1UAP A;  4KN4 C;  2NVT H;  1NMF A;  2EJM A;  2VS1 A;  3OW7 A;  4YY3 Q;  3EN2 A;  3CC4 A;  1LTT D;  3ERO A;  2SNM A;  3S15 B;  2CKZ B;  2QCP X;  3HZX A;  2A6E C;  3BDO A;  5EPK A;  4KKS A;  2KHI A;  3CC2 A;  2O5J C;  2EYF A;  4K5X A;  5IOC A;  2RCF A;  3TP8 A;  4LWC A;  3DEP A;  1EYC A;  3NPP A;  3OMC A;  5COY A;  1Z47 A;  4DK0 A;  4X64 Q;  4DNR B;  1FGB D;  1UE1 A;  1TWF B;  3VR3 A;  5KNC A;  1XMO Q;  2OXP A;  1B50 A;  1MJE A;  1EQT A;  5I2X A;  1V1P B;  3PUV A;  4Y52 H;  3HOZ H;  4ZUI A;  4NXM L;  1IBM L;  4N8X 1;  1GKH A;  1PYW D;  1PH3 A;  1W6K A;  4A3M B;  4BY1 G;  1NR4 A;  4Y7N H;  2NVQ H;  3GTL H;  4A3B G;  1PH4 A;  1KAB A;  3ITP A;  1AN8 A;  5CBA E;  1G6Z A;  1XTD A;  1YBY A;  2B3G A;  2HHH L;  3HOY B;  3P7J A;  3HFZ B;  1TWA H;  4LFB Q;  1B9N A;  2EYM A;  1D7Q A;  4LF4 Q;  1VMP A;  3JAM c;  2KEC A;  5COR A;  1S4Z A;  4DNI A;  3QOJ A;  4G7H C;  4A3F B;  1QWY A;  2WIN B;  1QZG A;  3WWV A;  1PH6 A;  3C1E A;  1V8Q A;  4X3T A;  2K14 A;  2WAC A;  1EZ8 A;  3GDE A;  4A75 A;  4P74 A;  1KRT A;  2K04 A;  1B1Z A;  1HXY D;  4A3B B;  1EU4 A;  4YY3 L;  2SOB A;  3GV3 A;  4GNX A;  1XNR Q;  5FLX c;  1PZK D;  1S5F D;  2CQA A;  1O7Y A;  3PO2 B;  1K0S A;  1PV4 A;  1E1O A;  2DUD A;  2VB2 X;  4A3E G;  3UE0 A;  5BR8 L;  2F0H A;  1RTO A;  1GVP A;  4MN3 A;  2CH4 W;  3URY A;  3HOW H;  1IBL L;  5FKA C;  2JA9 A;  5LL6 S;  2N49 A;  4HIO A;  4GZY C;  2UUB Q;  2LSS A;  4DK3 C;  4DR1 L;  1SYD A;  2K5N A;  2NTT A;  1D5M C;  2KCM A;  4NXM Q;  4MTN A;  1PLF A;  3NBI A;  4DV0 L;  1IBM Q;  1XMQ Q;  3GP7 A;  2EY1 A;  3T4A C;  4K8I A;  1JMC A;  4RCN A;  2L12 A;  4V19 0;  2MO1 A;  4YWL A;  2DGY A;  4LF5 Q;  2CWA A;  4NW2 A;  3GTQ H;  1BUV T;  3H3V C;  3VDY A;  4JI0 L;  3UDI A;  4RAU C;  2ZXP A;  5CV6 A;  4KY7 A;  4M1U B;  3OOC A;  1JQY D;  1SND A;  1BR9 A;  4J8Q A;  2F3V A;  5IT9 c;  4NDX A;  1H95 A;  5IIF A;  2LXK A;  1U0L A;  4IOC A;  1HZA A;  5CV7 A;  1H9M A;  2I0Q A;  4HED A;  3UDG A;  1A3T A;  4G7O C;  4HIK A;  3DLL A;  3I4M H;  1UE7 A;  2R93 B;  1STE A;  3GTO B;  5DM6 3;  2Z6K A;  4A3G H;  4YHH Q;  2WAQ G;  5JVG 3;  1VQL A;  4XT1 B;  1WVL A;  1KAA A;  3E9H A;  3K5M A;  1SYG A;  3A56 A;  1X55 A;  3M4P A;  3G4S A;  2JA8 G;  1ASY A;  4KHZ A;  1C0A A;  1GUT A;  1WCM G;  2IT1 A;  1NAP A;  1IBL Q;  4A76 A;  1HCZ A;  1JJ2 A;  1G29 1;  4X65 L;  2K05 A;  3RLN A;  1Q81 C;  1I94 L;  2YU9 B;  5KGU A;  4ZRZ A;  3K5N A;  3BVZ A;  1NY4 A;  3CQZ B;  5C3W A;  2R3Z A;  1VQP A;  4RWS C;  3HOY H;  4JI5 Q;  4DF7 A;  3JAM i;  4LF5 L;  4A93 H;  4HSV A;  1TS2 A;  2EYJ A;  2K32 A;  2XGT A;  5JPM C;  2I07 B;  2KJX A;  3MXN B;  3CF5 A;  4YWK A;  3NEN A;  4JI4 L;  1D5X C;  2F0P A;  1SMY D;  4C3I G;  4BBR B;  2N88 A;  3P75 A;  2UUC Q;  1YJN A;  3D6C A;  1STA A;  5D3D A;  1CSQ A;  4KMU C;  2J7Z A;  1HR0 Q;  4FF1 A;  1LTI D;  4ABN A;  4ZAI A;  4B3R L;  1G51 A;  4IPD A;  4JBK A;  3NQT A;  5C44 H;  3T56 B;  2VQF Q;  1JOO A;  5L37 A;  1KRS A;  4A3F H;  3J81 L;  1XJV A;  1SBB B;  2PI2 A;  2Q8R E;  4LJZ C;  1EIF A;  2ICE C;  2WB1 E;  2B2W C;  2JP1 A;  3SK6 A;  4UPA A;  4UY8 C;  2RDG A;  2NZH A;  3FPP A;  3IFT A;  3GTQ B;  3EVQ A;  1TVX A;  4R4I A;  4LUZ A;  4AYB G;  5I9P A;  2IWH A;  2EZV A;  1H9K A;  2R7Z H;  2K5W A;  1KNA A;  4LF9 L;  4LF8 Q;  3RR5 A;  5KRU A;  5AJ3 L;  3TZD A;  1VF5 C;  5GQO A;  5J3B A;  4K8J A;  5JPN C;  1ZYR D;  5FLM G;  3NUC A;  2KCT A;  2ICI A;  2F3W A;  1TR5 A;  2NWG A;  2O4X A;  4KV6 A;  1VQC A;  5I2Y A;  4ZLT F;  3I4M B;  4DFA A;  3T1Y Q;  1ZYR C;  4OON A;  1X3P A;  4CBV A;  5I9O A;  1H9J A;  3CW2 C;  5M3F H;  1N33 L;  4JCV E;  2R7D A;  3BDL A;  3EQL C;  4PNY A;  1PA6 A;  2I5H A;  1YIT A;  5IP9 G;  2KBN A;  1F77 A;  2YTY A;  4KD4 A;  5HY6 A;  4QUC A;  1DOL A;  5IYC G;  1KAW A;  4R4O A;  2K5H A;  3K7A B;  1XYI A;  1FR3 A;  2Z9H A;  3PV0 A;  4LFA Q;  3ZYY X;  1HTL D;  2PQA A;  5ELE A;  2OCE A;  1SRU A;  2H4O A;  1LM0 A;  1PH9 A;  3GTK H;  1L1O B;  2B8G A;  4HSP A;  1B9M A;  2DNE A;  4RGM A;  1WYD A;  3A55 A;  1SYF A;  1M4V A;  3S17 H;  5ELO A;  1TWC H;  2F0O A;  3STB D;  1CKN B;  1Q1B A;  1X3F A;  2SNS A;  1HA5 A;  1SE2 A;  5A2Q E;  1IHZ A;  1NE3 A;  1EIY B;  1HHV A;  2AHO B;  1E2W A;  4JYA Q;  1EY4 A;  3D0F A;  2HT1 A;  2E2I B;  1DON A;  3NSW A;  3H3V H;  4LF9 Q;  1XNR L;  3T1H L;  3CRK C;  4DR4 Q;  2Q8T A;  1BCP C;  1X3E A;  3H94 A;  2JA6 G;  3I55 A;  2O2L D;  2HQE A;  3Q24 A;  4A3I G;  4R1J A;  1F2Z A;  4JVZ A;  1X65 A;  2EY5 A;  1HTP A;  1EOT A;  1G2T A;  3FDT A;  3J80 i;  5I6Y A;  1HNX L;  1OTC A;  1BCP D;  2YTV A;  4A3M G;  1IKL A;  2E75 C;  1D6E C;  1PYB A;  3SK8 A;  3K57 A;  3BYY B;  3NEM A;  3SDZ A;  2Y0S G;  1KLG D;  1D8L A;  2VQE Q;  4A3C H;  4DR1 Q;  3ER0 A;  5T1G A;  1SDF A;  4JPB W;  3PUZ A;  5CBE E;  1A3U A;  3K0Y A;  4ULL A;  3T51 B;  2XN9 C;  4P2C B;  4HJ7 A;  1EQV A;  4E6I A;  2LY7 A;  3CCQ A;  3HKZ B;  4KI0 A;  4ZUJ A;  2MFI A;  1MKH A;  1RF2 D;  3FEW X;  2EVB A;  4IJH A;  4G57 A;  2E5L L;  1EIH A;  3SHL A;  2EYO A;  1SNM A;  5J39 A;  1RHP A;  3N6R A;  1EY6 A;  3MHB A;  5FLM H;  3KUP A;  1TWF H;  5IYD G;  4IPG A;  1SFO H;  5A2Q L;  3BVG A;  2F0T A;  5CV8 A;  3MEH A;  2EYL A;  1Y1W B;  2F0N A;  1KIX A;  1Y14 B;  1FNW A;  1ET9 A;  1AE3 A;  4GKJ Q;  3TSS A;  5LMN L;  2NZ1 D;  5A35 A;  1CUK A;  2ZJQ A;  4EQP A;  4MZ9 A;  2MO0 A;  4IFD I;  4DUZ L;  1QJO A;  1IZ6 A;  2EXZ A;  2PCF B;  4FO2 A;  3C2P A;  1NSN S;  3PO3 G;  3MAQ A;  2KED A;  3E6Z X;  2BDN A;  1PFN A;  1VQ4 A;  2QW7 A;  3BZD B;  1WJJ A;  5EKK A;  4POF A;  3HOU B;  1WI5 A;  4X65 Q;  4ALP A;  4L5R C;  3QJY A;  3CD6 A;  5C4X G;  2JN4 A;  1F9S A;  5LL6 X;  4OEL B;  3FMC A;  4RHS A;  1EY9 A;  4CJ2 C;  5M5X H;  3UDF A;  2H1E A;  2ALY B;  2ES2 A;  3TS2 A;  3FVQ A;  4QQB X;  1SE3 A;  3H09 A;  1WTO A;  1RIP A;  3CPW A;  4JI5 L;  1DZ1 A;  1C9O A;  4ILW A;  1PDQ A;  2PI2 E;  4LK1 C;  3CC7 A;  4C56 C;  3FKI G;  4OWW B;  5C6A A;  4A93 G;  3J80 L;  1LT3 D;  4A3D B;  3U9S A;  5IGB A;  3M3Y H;  4K2L A;  3BVM A;  5ELB A;  1Q86 C;  1V43 A;  2AKW B;  1BNZ A;  2UXB Q;  2RDH A;  4O0A A;  1Q1E A;  1AH9 A;  3S2D B;  4YCU A;  3NK9 A;  3KF8 A;  3HOV H;  4C3I B;  5CMD A;  1CKM A;  1DM0 B;  2K75 A;  2R6G A;  1LYL A;  3V05 A;  4K6D A;  5JJZ A;  3MA2 B;  4KJN A;  4HR7 B;  4MIU A;  2EE1 A;  1Y1V H;  4LMQ D;  2MQH A;  3F2C A;  4JI4 Q;  5IWA L;  1Q3L A;  5DNF A;  4DV7 L;  3MWY W;  3MTS A;  1VQJ A;  1LTS D;  4A3J B;  1EY7 A;  2B63 H;  4R8I A;  4A3D G;  2F0Q A;  3CCJ A;  4JW0 A;  3BZK A;  5FJ8 G;  1HZC A;  5IP7 H;  4GOP B;  1K83 H;  1STN A;  3S16 B;  3ICE A;  2JA7 G;  2R7Z B;  2R61 A;  1Y69 U;  4F8M A;  2KEE A;  3PQI A;  4TKO B;  2IY5 B;  4QGU A;  2B2Y A;  1KHI A;  1JB3 A;  4JOI A;  1L1O A;  1PRT F;  1JOK A;  1KLU D;  3KF8 B;  3E0J A;  4N8F A;  5EKI A;  5C3E G;  3D31 A;  2B2Y C;  3S1M B;  1CHQ D;  3K8A A;  4RGT A;  3G71 A;  1GUS A;  5BR8 Q;  1TQO A;  4OWX B;  3CCV A;  3ULP A;  1QVF A;  4XDX A;  2X69 A;  3L2P A;  1U4M A;  3I73 A;  1J6Q A;  1X6O A;  1QUQ A;  3CAM A;  3HRZ C;  5M5W H;  3VYU A;  3NBH B;  1AP0 A;  2UXB L;  4BA2 I;  1VF7 A;  1E2V A;  2O5I C;  2E74 C;  1Z6H A;  4GLA C;  3K0X A;  4BS9 A;  4DV3 Q;  4DV6 Q;  3GTO H;  4R4Q A;  3HOZ G;  3MC0 B;  5FO9 B;  2EPB A;  4KKT A;  3TP6 A;  3Q23 A;  3EJI A;  2F0M A;  1A63 A;  1ICW A;  3I91 A;  1A15 A;  2WV6 D;  3C1F A;  4JI0 Q;  4BXX G;  1R4P B;  1YIJ A;  2RCN A;  5IWA Q;  2K28 A;  1QNU A;  4CGY B;  2EXD A;  3CME A;  1WTR A;  1PTO C;  3J81 i;  4JK1 C;  2PZU A;  1WD0 A;  3Q8D A;  4J15 A;  2B2U A;  1FJG Q;  5DEH A;  4P73 A;  5C4H A;  1CA5 A;  4BY7 B;  2ZJR A;  2AQ3 B;  5D3I B;  5IYB H;  1O80 A;  3KF6 A;  3HKZ G;  4CDF C;  1VQH A;  1TU2 B;  5JEA J;  4YHH L;  2RF4 A;  3NWT A;  3RN5 A;  3S1R B;  2F0V A;  2B39 A;  1VQO A;  4GLV B;  1XXG A;  2PNR C;  1TWA B;  1HUM A;  1IYU A;  5EAY A;  5F2D A;  4AIM A;  1I4G A;  2G9H D;  4U68 A;  3FPU B;  4BY7 H;  3PO3 H;  2IX0 A;  3X3M A;  5C3X A;  1XNQ L;  1K8A C;  5FOB B;  2NYZ D;  1BCP B;  5JVH 3;  1A0I A;  1ML0 D;  1BO0 A;  1EY5 A;  4LF7 L;  2NB0 A;  4M8A A;  2EOT A;  3ERS X;  4DR3 Q;  4BY1 H;  2BDO A;  5FO7 B;  4XQJ A;  2EIF A;  4A3F G;  3GTG H;  1Y1V G;  1D1I A;  4EQO A;  5DM7 3;  2E2H H;  1STG A;  4DR7 Q;  1I6H B;  1ZXT A;  4OIK A;  4DV3 L;  2HCC A;  4DV6 L;  2QA4 A;  3GTM B;  3M7G A;  1Y8N B;  1G2S A;  1SMX A;  2MJ8 A;  2PZW A;  5E4X A;  4C3J H;  2K33 A;  4A3L H;  4C3J G;  1UE6 A;  1V1O A;  4DV2 Q;  4HID A;  3KK7 A;  4GLX A;  3NXW A;  1IL2 A;  1VQF A;  2UUA L;  1PZJ D;  1QIL A;  1XX8 A;  4PQX A;  4CDC C;  3AFP A;  4HJA A;  3PSI A;  3GQB A;  4PMB A;  3S9W A;  4EQ5 A;  3HOX B;  5ELC A;  3A74 A;  1BDO A;  2VNU D;  2UUC L;  3U50 C;  4DAV A;  3H15 A;  1IL8 A;  2LKV A;  2M00 A;  3GTJ H;  5K36 G;  3HKS A;  4BBS H;  5C5L A;  3OWF A;  3A5Z B;  4Y7N B;  1PMR A;  5CC4 A;  1Z7T A;  4TSS A;  4G7Z C;  1VQG A;  4PZ6 A;  1SMY C;  1Y8P B;  3MXU A;  4A3L G;  3PUW A;  1H9S A;  2MHV A;  5IGE A;  1GHK A;  2KHS A;  4JV5 Q;  5HUR A;  5NUC A;  1JJG A;  2L11 A;  3PF5 A;  4A3I H;  2MP1 A;  3LX0 A;  3EA6 A;  2PQA B;  4XYO A;  1F2Y A;  1NR2 A;  2IW3 A;  4I7Z C;  1CSP A;  4XIG S;  3S1R H;  3W3A A;  1JC7 A;  3IAY A;  1A8V A;  1TXY A;  2E2D C;  1VQ8 A;  1CZG A;  2JSO A;  4OGQ C;  1HUN A;  2ZTD A;  4LF7 Q;  1N34 Q;  4OO1 G;  2L4N A;  1HQM C;  4ODG A;  1HNZ Q;  4DUY L;  1J9O A;  3S24 A;  2FHT A;  2Q2T A;  5M3F B;  2BE5 C;  2EJF C;  1MHW C;  1E7Z A;  3J81 c;  5G3L F;  4KLK A;  2V1C C;  1M90 C;  4O1N A;  1STY A;  4JI2 L;  1GUO A;  3MFG A;  2RA4 A;  2CCZ A;  4C2M H;  1BVS A;  3NWS A;  4JI7 L;  4HJ5 A;  3C46 A;  1C48 A;  2IX1 A;  2A68 D;  2K5V A;  3KBG A;  4DAM A;  4KHV A;  1PH2 A;  2EY2 A;  2JE6 I;  3OYY A;  4IN3 A;  2KHJ A;  4L5Q A;  1FYC A;  2L5T A;  1M1K C;  4G4K A;  3RD4 A;  1L2F A;  1DOK A;  1SNP A;  4A4I A;  1YJW A;  4DV7 Q;  2VUM B;  3L7Z C;  1KDB A;  2K6A A;  5H1S E;  1GO3 E;  3TBI B;  1YZ6 A;  1T9H A;  3VA7 A;  3TQY A;  4H13 C;  5C3E H;  4MHE A;  1S5D D;  4C1N K;  1S3O A;  1TWG B;  4I65 A;  2R92 H;  4L5S A;  1A62 A;  3J7Y W;  1CA6 A;  1RD9 D;  4RMF A;  2F0J A;  1G91 A;  1EYG A;  3MZ5 A;  3E5S A;  4XQN A;  2CWP A;  2D62 A;  3J80 c;  3PO2 G;  3U4Z A;  1CFM A;  1RKN A;  3W1B A;  1Y8O B;  3BU2 A;  2E8G A;  4RHR A;  5FJ8 H;  2FFK B;  3QO2 A;  4KY6 A;  4XXE A;  4N9T A;  4A3G B;  2GA4 B;  4MTK A;  4DAP A;  2PW5 A;  3OWE B;  3M4Q A;  2F03 A;  3NHH A;  1IW7 C;  5D14 A;  3A0J A;  5ELD A;  4EQN A;  1D5Z C;  4JI8 L;  2Q8I B;  5C4Z A;  3MXN A;  3TZU A;  1SYE A;  4KTA A;  4BBR H;  3KLS X;  4U67 3;  1HNX Q;  3NTH A;  4X64 L;  1V9P A;  4JBW A;  3RZO H;  2SEB D;  2BH8 A;  3NP8 A;  3A5U A;  1TWC B;  5M5X B;  1KNE A;  1EEI D;  3AMU A;  4X62 L;  2OTJ A;  4KN7 C;  2NUC A;  2Z6B A;  1SE4 A;  2D9U A;  1ZKO A;  4H7B A;  2ATW A;  3I4N H;  2JEA I;  4X3K A;  3J81 j;  1B4O A;  1E24 A;  2E5L Q;  4RKB A;  4B08 A;  5GAG C;  3AFQ A;  4QCL A;  1IKM A;  2KOL A;  3CPF A;  1Q90 A;  1DD2 A;  5JOB A;  3RN2 A;  4O42 A;  2F0K A;  2CW0 D;  4K6L A;  4L63 B;  2QKI C;  4DR5 L;  3G48 A;  1YHQ A;  3LNN A;  1N36 L;  1BBX C;  1ESF A;  2NN6 H;  4BWG B;  2CW0 C;  3X3N A;  2Z6K C;  4OXP A;  4IUR A;  2PW7 A;  1L0Y B;  2WP8 J;  2OQ0 A;  2KA7 A;  1K3R A;  1MSH A;  4QB4 A;  1HPC A;  4OX9 L;  3K6O A;  1K28 A;  4AYB E;  5IT9 E;  4B3S L;  1SAP A;  4F7X A;  5M3M H;  1MI2 A;  1GM5 A;  5IE8 A;  1ENF A;  1VQE A;  2R7Z G;  2JA7 B;  3ULJ A;  2DJF C;  5BN5 A;  3C3L A;  4TVA B;  4DUZ Q;  1HRJ A;  2RKS A;  1TS3 A;  1I5F A;  3E0E A;  3SXH A;  3S17 B;  4HN7 A;  4ZK9 B;  3MFY A;  4C1N I;  3VR6 A;  1O7I A;  3S15 H;  3CXC A;  4QUF A;  1JJC B;  1SN8 A;  2FJ2 A;  5DAU A;  4I7A A;  4XTC S;  4DR2 L;  2ZXO A;  3SVM A;  2QDL A;  3GV6 A;  1W6J A;  3GO5 A;  4IFD H;  4YWM A;  1UNS A;  2E76 C;  2PO4 A;  1XPO A;  1PH7 A;  4DR7 L;  5IGC A;  4DV1 L;  2IPK D;  3S1Q B;  4RH6 A;  2NVQ B;  1HFG A;  2JA6 B;  1SR3 A;  1TWH H;  2NN6 G;  3SEB A;  5KYI A;  1AW7 A;  4J6H A;  3Q22 A;  3PIP A;  3BJU A;  3G6E A;  2LFN A;  4LF6 L;  4NP5 A;  1FD7 D;  2Z4I A;  5CV5 A;  3Q6S A;  1WTX A;  1N32 Q;  4DR5 Q;  1Q46 A;  5C0X G;  2CHB D;  3S2H B;  1A2T A;  2EJG C;  4A3J G;  1N36 Q;  2FMC A;  3HOY G;  5EBC A;  1MD2 D;  4NB3 A;  5IOD A;  3KLW A;  1EU3 A;  4NXN Q;  5FO8 B;  2RHS B;  3LWE A;  2ZM6 Q;  1QNK A;  3Q0A A;  1N8R C;  4BXX H;  1BKB A;  3DWP A;  4RGN A;  2XRS D;  3H0G G;  1NMG A;  2OT2 A;  3I7F A;  1SE8 A;  4B3S Q;  1FVI A;  4EGV A;  1KC8 C;  2IHF A;  3DWQ A;  2DNC A;  4IUQ A;  1JE5 A;  2A74 C;  2F4V L;  1EIG A;  3S1N H;  4GN3 B;  2P5Z X;  1BXT A;  2K52 A;  1VQ7 A;  2BA0 A;  3OTO Q;  2LXJ A;  2KCN A;  2L55 A;  2K03 A;  1PVO A;  1P8L A;  2DY8 A;  4POG A;  1Y1W H;  1H9R A;  1SNO A;  4ZKB B;  1SNC A;  1IBK Q;  1U4R A;  2F0G A;  2ZJP A;  2Y0S E;  3M4O B;  1EWI A;  2XWB B;  3PO2 H;  1OO9 B;  1PTO B;  1SXT A;  3PUY A;  4HJ9 A;  1N34 L;  4NPS A;  2F0D A;  3GD7 A;  3I4M G;  4L5T A;  1E0B A;  1HA6 A;  4P71 A;  2R92 G;  2BCO A;  3KJO A;  1V1P A;  3FHW A;  4DV1 Q;  2CFM A;  3HOZ B;  3DM1 A;  4HAE A;  4P75 A;  1BBW A;  3AEV A;  1EY0 A;  3CRL C;  1F2L A;  3HOX G;  5E1F A;  4P72 A;  1LAB A;  2AMC B;  3V96 A;  5ELF A;  1N32 L;  2GVA A;  3CCM A;  1I4H A;  3PIO 3;  1K8G A;  3D8G A;  2AWN A;  3H91 A;  1LAC A;  5BN3 A;  2E2J H;  2NVX H;  1HNW L;  4NXN L;  5IGG A;  3G6J B;  1HH2 P;  1EY8 A;  1BBU A;  1HR0 L;  2RHQ B;  3K80 C;  2GN5 A;  5CV4 A;  4B3R Q;  2QEX A;  4LAA A;  1R4Q B;  2CH4 A;  3ONA B;  2A6H D;  5C3E B;  1JE4 A;  1TS5 A;  3QOL A;  1BOS A;  3JAM E;  3STB C;  1VQA A;  5I4D A;  2PPB C;  3PIP 3;  5IGF A;  1PH1 A;  2B2V A;  1VQ5 A;  2F4V Q;  3IFD A;  1B3A A;  2UU9 Q;  1SJH D;  2A69 D;  2JXM B;  4KK7 A;  4KKU A;  1YNJ C;  4RKL A;  1NJI C;  2B2V C;  3A8J E;  1MGS A;  4OHJ A;  1PH8 A;  1CKO A;  5C5M A;  3CHB D;  3BG3 A;  3MXG A;  4B9X A;  3F2U A;  5HGQ A;  1CHP D;  4S3S A;  3VR5 A;  1MJC A;  5M5Y B;  3LGJ A;  1PTO D;  3L3O C;  4IUV A;  4DKA C;  1X56 A;  1II3 A;  1LTR D;  2N78 A;  2YU9 H;  3CKI B;  5G3L D;  1QVG A;  3HGB A;  4B3T L;  3S2D H;  3S1M H;  1X3G A;  2KCC A;  1KDA A;  4HMJ A;  2VUM G;  5KNB A;  1CK1 A;  3GTM H;  2F0I A;  4A3I B;  4A3D H;  1PTO F;  5CR3 A;  2BA1 A;  2J4X A;  2OEO A;  4IFD J;  4JG2 A;  4C3H G;  1A2U A;  1O78 A;  1QVC A;  1UEA B;  1EL0 A;  2K4K A;  3W2D A;  1PFM A;  3I3C A;  1TS4 A;  5LMU L;  1K73 C;  4JI3 Q;  1EZ6 A;  3ND8 A;  3HP3 A;  1I3Q H;  1B7Y B;  1CKN A;  4XQQ A;  4DU9 A;  5M5Y H;  4RCO A;  2HUG A;  2PNH A;  4DV2 L;  2UUA Q;  1S72 A;  1PXU A;  2WAQ B;  2PYK A;  2A1A A;  1DJR D;  3EBE A;  4CJ1 B;  4IOA A;  2UXC Q;  1AE2 A;  2RSO A;  4FNF A;  4QIW B;  5M5W B;  1K9M C;  5HGT A;  2B29 A;  3NBH A;  4IUP A;  2F52 A;  3D4W A;  3MEF A;  1EUJ A;  2F0E A;  1FL0 A;  2UU9 L;  4AQY L;  1C8C A;  3RLF A;  5C0X J;  3PIO A;  4WOR A;  4C3I H;  4PZ7 A;  2GVB A;  3B6Y A;  4OL7 A;  2X6G A;  3M85 A;  1WCM H;  1VQI A;  3U4V A;  1P16 A;  4CJ0 B;  1NTG A;  1U4P A;  4GN4 B;  2R92 B;  3M3Y B;  1X9N A;  1YJ9 A;  1MSG A;  3KDF B;  4GN5 A;  3IRB A;  1E22 A;  3DMU A;  4HMI A;  1EOV A;  1SLJ A;  2UUB L;  1I6H H;  1B8A A;  2F0F A;  3I70 A;  2WKD A;  3TRZ A;  4UHV A;  4GS3 A;  1AZP A;  3GTP B;  1H9S B;  1JOQ A;  2L15 A;  2SDF A;  2E2I H;  2A6E D;  1YVC A;  4BBS B;  4IAL A;  2MUY A;  5IY0 A;  3SR1 A;  4C3H H;  1OXX K;  1TWH B;  1HNZ L;  2R93 H;  4IPH A;  3W5O A;  3TEH B;  4GNX B;  1UUP A;  4JI3 L;  4YCV A;  4HTH A;  4DV5 L;  4HIM A;  1XTC D;  5IGD A;  5KND A;  2Z4H A;  2HCI A;  4K0K L;  4IPC A;  4C3J B;  3I72 A;  1CQF A;  3IKJ A;  1XWE A;  1KD1 C;  3ND9 A;  1WTV A;  1Q7Y C;  1ILQ A;  3CCS A;  3DHQ A;  4FF2 A;  2QGQ A;  1W3S A;  2NVX B;  4IUN A;  4EX5 A;  2EYH A;  1T5E A;  2Z0S A;  4ZYS A;  1HR0 W;  4PMC A;  3J7A F;  2NN6 I;  1KQS A;  4HCS A;  3QG1 A;  4ZQ3 A;  4DV4 Q;  2EDG A;  1JOR A;  3DM3 A;  2G5D A;  4A3E H;  1GOZ A;  4RA8 A;  2QF7 A;  3MVV A;  4GNX C;  1MBY A;  2K5D A;  4RGO S;  2JJQ A;  1DGS A;  5EPJ A;  4A3K H;  4DXF A;  2FIN B;  3OTO L;  1BF4 A;  4JOI C;  4IO9 A;  3R3O A;  5EJW A;  1O7L A;  5CYU A;  4A3M H;  4GKK L;  2KEN A;  1ZEQ X;  1I94 Q;  1RDP D;  3GTJ B;  4K14 A;  1SEB D;  1IBK L;  1KDC A;  1KTK A;  3BZC A;  2VW9 A;  3HKZ E;  1STH A;  3V2T A;  1YHB A;  2XWJ B;  4DK6 C;  1EWH A;  1D1K A;  3HOW G;  3I8Z A;  1ET6 A;  1ONL A;  1EYD A;  1GHJ A;  2D0O A;  4JI8 Q;  2A73 B;  1PRT C;  4FF4 A;  2C5C A;  2XNA C;  1SSO A;  3A7A B;  3TME A;  5C44 B;  1SYB A;  3CMA A;  1UWV A;  2MGS A;  4DV5 Q;  4O2D A;  1F9P A;  4X62 Q;  2F0U A;  2HIX A;  3GTL B;  4FVM A;  1CI3 M;  4R9W A;  4X66 Q;  1HZ9 A;  2BOS A;  2ID0 A;  2L9H A;  4LFC Q;  2B63 B;  2M9V A;  3ULL A;  3NTI A;  1S40 A;  2K50 A;  2TSS A;  1U9R A;  2IX3 A;  2A69 C;  5J1Z A;  1HNW Q;  3HOV G;  2JA5 H;  3UE1 A;  1I3Q B;  2JA7 H;  2VQF L;  3SK4 A;  2IJ0 A;  3J81 E;  4RFB A;  4CDE C;  3S1Q H;  1HZB A;  2WII B;  5AFW A;  4ZCK A;  4IUU A;  3H6M A;  3F2D A;  2IL8 A;  4IZ8 A;  3FKI H;  2ASB A;  2B8F A;  4H0L C;  2NBF A;  1FNV A;  1E3P A;  5JJL A;  1CTM A;  1PFB A;  4KY5 A;  1JR0 D;  2HDL A;  1XPR A;  4LF8 L;  1UE5 A;  4OX9 Q;  3K81 C;  5AJ3 Q;  4GKK Q;  1NCV A;  1Q8I A;  3S1N B;  2K5Q A;  2HDM A;  4F88 A;  1VS0 A;  1K8O A;  5BN4 A;  1WTW A;  1EFI D;  3D6W A;  2RDF A;  1YNX A;  4GOP C;  5EBD A;  2Z1C A;  1B3Q A;  2AWO A;  5JEA G;  3NQI A;  4B3M L;  5TSS A;  1Z9F A;  1DOM A;  1DXM A;  3TDQ A;  4GOP A;  1JWM D;  1E1T A;  3M4O H;  3DUZ A;  1YHA A;  1PH5 A;  2JYO A;  5GAE C;  5KIX A;  2AUJ D;  3T13 A;  2KUM A;  3OIP A;  4DR2 Q;  4A3E B;  5GRO A;  5CV9 A;  4QL5 A;  1DCZ A;  3M9B A;  3RZO B;  1TT2 A;  4LUO A;  2F0L A;  2Y0S B;  3K58 A;  4ME5 A;  1N9W A;  4A3K B;  5E4W C;  4V0B A;  2L0C A;  4UAI A;  4LFC L;  4LFA L;  3A7L A;  4CKC A;  2TMP A;  3RMH A;  5IYD H;  2D0P A;  3CCU A;  3KLR A;  4OIJ A;  1QB5 D;  3S14 B;  1T5X D;  2MNA A;  3O13 A;  4QY7 A;  5FK9 C;  3CCE A;  4ID6 A;  4PG3 A;  3FKI B;  5IYB G;  4UDU C;  1GXD C;  1Q12 A;  1F9R A;  1S5E D;  1GUN A;  4DK1 A;  3U58 A;  1FGU A;  3AYH B;  1FJG L;  1UEB A;  2OF1 A;  4JYA L;  1J5E L;  4AQY Q;  1GJX A;  2OTL A;  4JI6 Q;  1VQD A;  1F9Q A;  2B2W A;  3EIV A;  5E7N A;  3I4N B;  1LTA D;  5LMN W;  2PMZ E;  3AB9 A;  1EQQ A;  4H02 A;  5M3M G;  5EGT A;  1VMC A;  4A3C G;  4R4T A;  1ENC A;  1G6P A;  3LWU A;  3DEO A;  1K0R A;  2PZT A;  2K1B A;  1V1Q A;  4QIW E;  3PO3 B;  5K5P A;  1MIU A;  3CP0 A;  1I4X A;  2VY3 A;  2M2L A;  2DJG C;  5M9O A;  1XNQ Q;  1LTG D;  2WB1 G;  2UXD Q;  1WOC A;  5FLX L;  2RBM A;  2A68 C;  3J7A V;  4APV A;  2VXW A;  1NNX A;  1W2B A;  3HOV B;  4K5W A;  3KYH C;  2N55 A;  1CM9 A;  1KL9 A;  5JJI A;  4FXG C;  4UP8 A;  1NBW A;  4UP9 A;  2PQE A;  1BCP F;  1I50 B;  2EY6 A;  5C4J H;  1JB7 A;  1VQN A;  2J0T D;  4KHP L;  4CKE A;  3ZJY C;  1CZW A;  4WJ4 A;  4C3H B;  1SYC A;  2FMM A;  4K0K Q;  3BYT B;  1ILP A;  2PMZ B;  1SFO B;  3CCL A;  4TRD A;  1I6V C;  3BS1 A;  1LT6 D;  2D2C C;  5IYC H;  2XVS A;  4TQU S;  1I4Q A;  3T53 B;  3L0O A;  4MNO A;  3H0G B;  2JEB I;  4XYQ A;  4GKJ L;  4DXG A;  5IT9 L;  3HOU H;  1R9T H;  3J7A 5;  4L6T B;  3WOF A;  4AH6 A;  4JI6 L;  2VZA A;  4OO1 I;  1OXV A;  1K3B C;  4WJW A;  1PRT D;  4J1M A;  1BQQ T;  4DV4 L;  1RCV D;  2A8V A;  2QDB A;  4N9P A;  1ESR A;  4C2M B;  1TY0 A;  1G8Z D;  3F8T A;  4FP5 D;  3OPO A;  2Z8L A;  2L1B A;  3VYR A;  5JJK A;  1K8M A;  5DLQ E;  1EQR A;  3NTK A;  1SNQ A;  1E2Z A;  2B2T C;  3QB3 A;  1A3V A;  2A5H A;  4OWT B;  3DWA A;  4JV5 L;  1AFP A;  2NTS A;  5I6W A;  3KF6 B;  1AEX A;  3OHX C;  2B2T A;  2CVR A;  3TS0 A;  2AQ2 B;  1IW7 D;  4JC0 A;  1QOH A;  3D3R A;  5C4X B;  1ENA A;  1SRO A;  1HJP A;  4B9W A;  2QEJ C;  2KVM A;  1XMQ L;  4ZKC B;  1WFQ A;  4NMZ A;  4RG1 A;  1VQM A;  1K83 B;  4DAY A;  3J7Z C;  1YNN D;  3J80 E;  1U5K A;  1OXS C;  3CCR A;  4DUY Q;  2QIL A;  4B3T Q;  2A19 A;  2YV5 A;  2JQO A;  5D65 A;  4KHP Q;  2Q2H A;  4CDD C;  2XRQ D;  1PYS B;  1PHJ A;  3QIA A;  4JI2 Q;  1M8A A;  4R8N A;  2V4D A;  3IL8 A;  3K7U C;  3P1H A;  1I50 H;  1LO5 D;  5IP7 G;  4DNT B;  3PUX A;  3KJP A;  3WDN A;  1QUQ B;  3KDF A; 
#chains in the Genus database with same CATH homology
 1WCM B;  3JAM L;  2F0W A;  4X3S A;  2AQ1 B;  2G9D A;  1SJE D;  1S5B D;  3K5L A;  2JA8 B;  3UI2 A;  3HS0 C;  1NUC A;  1QE6 A;  3WOE A;  3MXP A;  1ROD A;  1CQV A;  2DY7 A;  3BDC A;  5JEA H;  2X6L A;  1LT5 D;  1R9T B;  3I4L A;  4FYD A;  3TP7 A;  4XT3 B;  3QWN A;  3HOW B;  1HFN A;  3HG9 A;  4HCE A;  1JWS D;  3K59 A;  5EPL A;  5C0X H;  1EWC A;  3R93 A;  4QMG A;  1D2B A;  4F87 A;  1OXT A;  1HQR D;  1Y1V B;  4FXK C;  2LMC B;  3D4R A;  5E3F A;  3RUZ A;  5C0X I;  4PMW A;  1PRT B;  2EYP A;  2RSN A;  3R2I A;  2LS0 1;  2K01 A;  1GUW A;  1B2T A;  3OIQ A;  5KEE A;  3PMF A;  4KJO A;  4EVO A;  1J8I A;  1TY2 A;  1RTN A;  4L8J A;  4X3U A;  3M4Y A;  4BY1 B;  2I46 A;  1JIC A;  1TKW B;  2BE5 D;  2ENB A;  5T1I A;  3ERQ A;  2KQ3 A;  1C4Q A;  1OXU A;  3AU7 A;  1GUG A;  3L9A X;  5FLX E;  3N52 A;  3VA5 A;  2K7V A;  2NVY B;  2RQX A;  2E2J B;  3R8B A;  4FXD A;  4KD3 A;  3KBX A;  1EYA A;  4FF3 A;  5LHY 1;  4K2K A;  3RZD B;  4DN4 M;  3VR4 A;  3P20 A;  4CHT B;  3A54 A;  3VYS A;  1EEF D;  1DYQ A;  4IQZ A;  2WB1 B;  2AUK A;  5EQ0 A;  5EKL A;  1X32 A;  3GTG B;  3R2T A;  1FNU A;  3M7N A;  2F1M A;  2JA5 B;  3A8I E;  1LLR D;  4AYB B;  3TP5 A;  1B53 A;  2F0S A;  1JCK B;  1A6X A;  2WKC A;  1WD1 A;  5ISR A;  3NE5 B;  1PZI D;  1O7Z A;  5M3M B;  4DA2 A;  4Q5V A;  4OO1 H;  4IUT A;  1U4L A;  1YNJ D;  3T16 A;  3VR2 A;  3U9O A;  3HEJ A;  1L0X B;  4H44 C;  4WFN 3;  2A6H C;  2B2U C;  4K5V A;  4DGZ A;  1I4P A;  1YNN C;  5JAV A;  3DXJ C;  1LV9 A;  4PV1 C;  2XIW A;  1QG7 A;  2E2H B;  2NVT B;  2YYZ A;  4BA1 I;  1X3Q A;  4YIJ A;  5K36 H;  2RVL A;  1I4R A;  4CKB A;  4NKL A;  3G7L A;  1JWU D;  1TII D;  2VB3 X;  3K5O A;  1S5C D;  4A93 B;  5C4J B;  1PTO H;  2ZXR A;  1QCB D;  4QF4 A;  3TN2 A;  3VYT A;  3GTK B;  4WRD A;  2MPM A;  3I90 A;  1LT4 D;  2XSC A;  1VCI A;  1WTQ A;  3KLS A;  2F4I A;  2DN8 A;  1CT1 D;  3OMG A;  4Z9C B;  1RJT A;  1LTB D;  5J22 A;  1STB A;  2D5D A;  5KYL A;  3CU7 A;  1VDZ A;  3EFX D;  3OSO A;  1IYV A;  4Q0F A;  5CGK A;  1F2M A;  1WTP A;  2C9O A;  2ZT9 C;  3FRP B;  3SK5 A;  1B44 D;  4IFD G;  3D4D A;  3A8K E;  3SE0 A;  1AZQ A;  1UAP A;  4KN4 C;  2EJM A;  3OW7 A;  1LTT D;  3ERO A;  2SNM A;  3S15 B;  2QCP X;  3HZX A;  2A6E C;  3BDO A;  5EPK A;  4KKS A;  2O5J C;  2EYF A;  4K5X A;  5IOC A;  3TP8 A;  3DEP A;  1EYC A;  3NPP A;  3OMC A;  5COY A;  1Z47 A;  4DK0 A;  4DNR B;  1FGB D;  1TWF B;  3VR3 A;  5KNC A;  2OXP A;  1B50 A;  1EQT A;  5I2X A;  1V1P B;  3PUV A;  4ZUI A;  1PYW D;  1W6K A;  4A3M B;  1NR4 A;  1KAB A;  3ITP A;  1AN8 A;  5CBA E;  1G6Z A;  3HOY B;  3P7J A;  1B9N A;  2EYM A;  1VMP A;  2KEC A;  5COR A;  1S4Z A;  4G7H C;  4A3F B;  3QOJ A;  1QWY A;  2WIN B;  3C1E A;  1V8Q A;  4X3T A;  2WAC A;  1EZ8 A;  2K04 A;  1B1Z A;  1HXY D;  4A3B B;  1EU4 A;  2SOB A;  3GV3 A;  1PZK D;  1S5F D;  2CQA A;  1O7Y A;  3PO2 B;  2VB2 X;  2F0H A;  1RTO A;  4MN3 A;  3URY A;  5FKA C;  5LL6 S;  4GZY C;  1SYD A;  2NTT A;  1D5M C;  1PLF A;  3NBI A;  3GP7 A;  2EY1 A;  3T4A C;  4K8I A;  4RCN A;  2L12 A;  4V19 0;  4NW2 A;  3H3V C;  1BUV T;  4RAU C;  2ZXP A;  5CV6 A;  4KY7 A;  4M1U B;  3OOC A;  1JQY D;  1SND A;  1BR9 A;  4J8Q A;  2F3V A;  4NDX A;  5IIF A;  5CV7 A;  1H9M A;  4HED A;  1A3T A;  4G7O C;  2R93 B;  1STE A;  3GTO B;  5DM6 3;  5JVG 3;  4XT1 B;  1WVL A;  1KAA A;  3K5M A;  1SYG A;  3A56 A;  4KHZ A;  1GUT A;  2IT1 A;  1NAP A;  1HCZ A;  1G29 1;  2K05 A;  2YU9 B;  5KGU A;  4ZRZ A;  3K5N A;  3BVZ A;  3CQZ B;  5C3W A;  2R3Z A;  4RWS C;  4DF7 A;  4HSV A;  1TS2 A;  2EYJ A;  2K32 A;  5JPM C;  2I07 B;  2KJX A;  1D5X C;  2F0P A;  1SMY D;  4C3I G;  4BBR B;  2N88 A;  3P75 A;  3D6C A;  1STA A;  5D3D A;  4KMU C;  2J7Z A;  4FF1 A;  1LTI D;  4ABN A;  4ZAI A;  3NQT A;  3T56 B;  1JOO A;  3J81 L;  1SBB B;  2Q8R E;  4LJZ C;  2ICE C;  2B2W C;  2JP1 A;  3SK6 A;  2RDG A;  3FPP A;  3IFT A;  3GTQ B;  3EVQ A;  1TVX A;  5I9P A;  2IWH A;  2EZV A;  1H9K A;  2K5W A;  1KNA A;  5KRU A;  3TZD A;  1VF5 C;  4K8J A;  5JPN C;  1ZYR D;  3NUC A;  2ICI A;  2F3W A;  1TR5 A;  2NWG A;  2O4X A;  4KV6 A;  5I2Y A;  4ZLT F;  3I4M B;  4DFA A;  1ZYR C;  1X3P A;  4CBV A;  5I9O A;  1H9J A;  3BDL A;  3EQL C;  4PNY A;  1F77 A;  4KD4 A;  4QUC A;  1DOL A;  3K7A B;  1XYI A;  1FR3 A;  3PV0 A;  3ZYY X;  1HTL D;  5ELE A;  2H4O A;  2B8G A;  4HSP A;  1B9M A;  2DNE A;  4RGM A;  3A55 A;  1SYF A;  1M4V A;  2F0O A;  1Q1B A;  2SNS A;  1HA5 A;  1SE2 A;  5A2Q E;  1IHZ A;  1HHV A;  1E2W A;  1EY4 A;  2E2I B;  1DON A;  3NSW A;  3CRK C;  2Q8T A;  1BCP C;  3H94 A;  2O2L D;  2HQE A;  3Q24 A;  1F2Z A;  2EY5 A;  1HTP A;  1EOT A;  1G2T A;  3FDT A;  5I6Y A;  1BCP D;  1IKL A;  2E75 C;  1D6E C;  3SK8 A;  3K57 A;  3BYY B;  3SDZ A;  1KLG D;  5T1G A;  1SDF A;  3PUZ A;  5CBE E;  1A3U A;  3K0Y A;  4ULL A;  3T51 B;  2XN9 C;  4P2C B;  1EQV A;  4E6I A;  2LY7 A;  3HKZ B;  4KI0 A;  4ZUJ A;  1RF2 D;  3FEW X;  2EVB A;  4G57 A;  1EIH A;  3SHL A;  5J39 A;  1SNM A;  2EYO A;  1RHP A;  3N6R A;  1EY6 A;  3MHB A;  3KUP A;  5A2Q L;  3BVG A;  2F0T A;  5CV8 A;  3MEH A;  2EYL A;  1Y1W B;  2F0N A;  1FNW A;  1ET9 A;  3TSS A;  2NZ1 D;  5A35 A;  4EQP A;  4IFD I;  1QJO A;  2EXZ A;  2PCF B;  4FO2 A;  3C2P A;  1NSN S;  3MAQ A;  2KED A;  3E6Z X;  2BDN A;  1PFN A;  3BZD B;  5EKK A;  3HOU B;  3QJY A;  1F9S A;  5LL6 X;  4RHS A;  3FMC A;  4CJ2 C;  1EY9 A;  2H1E A;  3FVQ A;  1SE3 A;  3H09 A;  1WTO A;  1DZ1 A;  4ILW A;  1PDQ A;  4LK1 C;  4C56 C;  5C6A A;  3J80 L;  1LT3 D;  4A3D B;  3U9S A;  5IGB A;  4K2L A;  3BVM A;  5ELB A;  1V43 A;  1BNZ A;  2RDH A;  1Q1E A;  3S2D B;  3NK9 A;  3KF8 A;  4C3I B;  5CMD A;  1DM0 B;  2R6G A;  3V05 A;  4K6D A;  5JJZ A;  3MA2 B;  4KJN A;  4HR7 B;  4MIU A;  2EE1 A;  4LMQ D;  1Q3L A;  5DNF A;  3MWY W;  3MTS A;  4A3J B;  1LTS D;  1EY7 A;  4R8I A;  2F0Q A;  1STN A;  3S16 B;  2R7Z B;  2R61 A;  1Y69 U;  4F8M A;  2KEE A;  4TKO B;  2B2Y A;  1JB3 A;  1PRT F;  1JOK A;  1KLU D;  3E0J A;  5EKI A;  3D31 A;  2B2Y C;  3S1M B;  1CHQ D;  4RGT A;  1GUS A;  1TQO A;  4XDX A;  2X69 A;  1U4M A;  3I73 A;  3HRZ C;  3VYU A;  1AP0 A;  4BA2 I;  1VF7 A;  1E2V A;  2O5I C;  2E74 C;  1Z6H A;  4BS9 A;  3MC0 B;  5FO9 B;  3TP6 A;  3Q23 A;  2EPB A;  4KKT A;  3EJI A;  2F0M A;  1ICW A;  3I91 A;  1A15 A;  2WV6 D;  3C1F A;  1R4P B;  2K28 A;  1QNU A;  4CGY B;  1WTR A;  1PTO C;  4JK1 C;  1WD0 A;  2PZU A;  2B2U A;  5DEH A;  5C4H A;  1CA5 A;  4BY7 B;  2AQ3 B;  5D3I B;  1O80 A;  1TU2 B;  5JEA J;  3NWT A;  3S1R B;  2F0V A;  2B39 A;  1XXG A;  2PNR C;  1TWA B;  1HUM A;  1IYU A;  5F2D A;  1I4G A;  2G9H D;  4U68 A;  3FPU B;  2IX0 A;  3X3M A;  5C3X A;  5FOB B;  2NYZ D;  1BCP B;  5JVH 3;  1ML0 D;  1BO0 A;  1EY5 A;  2NB0 A;  4M8A A;  2EOT A;  2BDO A;  5FO7 B;  4XQJ A;  1D1I A;  4EQO A;  5DM7 3;  1STG A;  1I6H B;  1ZXT A;  4OIK A;  2HCC A;  3GTM B;  3M7G A;  1Y8N B;  1G2S A;  2MJ8 A;  2PZW A;  5E4X A;  2K33 A;  4C3J G;  1V1O A;  3KK7 A;  3NXW A;  1PZJ D;  1QIL A;  1XX8 A;  4PQX A;  3GQB A;  4PMB A;  3S9W A;  3HOX B;  5ELC A;  1BDO A;  2VNU D;  4DAV A;  1IL8 A;  2LKV A;  2M00 A;  5K36 G;  5C5L A;  3OWF A;  4Y7N B;  1PMR A;  5CC4 A;  1Z7T A;  4TSS A;  4G7Z C;  1SMY C;  1Y8P B;  3MXU A;  3PUW A;  1H9S A;  2MHV A;  5IGE A;  1GHK A;  2KHS A;  5HUR A;  5NUC A;  2L11 A;  2MP1 A;  3LX0 A;  3EA6 A;  4XYO A;  1F2Y A;  1NR2 A;  2IW3 A;  4I7Z C;  4XIG S;  3W3A A;  1JC7 A;  3IAY A;  2E2D C;  1CZG A;  2JSO A;  4OGQ C;  1HUN A;  4OO1 G;  2L4N A;  1HQM C;  4ODG A;  1J9O A;  2FHT A;  5M3F B;  2BE5 C;  2EJF C;  5G3L F;  4O1N A;  1STY A;  1GUO A;  3MFG A;  2RA4 A;  3NWS A;  3C46 A;  1C48 A;  2IX1 A;  2A68 D;  3KBG A;  4KHV A;  2EY2 A;  2JE6 I;  4IN3 A;  1FYC A;  2L5T A;  4G4K A;  3RD4 A;  1DOK A;  1SNP A;  2VUM B;  3L7Z C;  1KDB A;  2K6A A;  3TBI B;  3VA7 A;  4H13 C;  4MHE A;  1S5D D;  4C1N K;  1TWG B;  4I65 A;  3J7Y W;  1CA6 A;  1RD9 D;  2F0J A;  1G91 A;  3MZ5 A;  3E5S A;  4XQN A;  2D62 A;  1CFM A;  1RKN A;  1Y8O B;  4RHR A;  2FFK B;  3QO2 A;  4KY6 A;  4XXE A;  4N9T A;  4A3G B;  2GA4 B;  4DAP A;  2PW5 A;  3OWE B;  2F03 A;  4EQN A;  3NHH A;  1IW7 C;  5D14 A;  5ELD A;  1D5Z C;  2Q8I B;  5C4Z A;  3MXN A;  3TZU A;  1SYE A;  4KTA A;  3KLS X;  4U67 3;  3NTH A;  4JBW A;  2SEB D;  3NP8 A;  1TWC B;  5M5X B;  1KNE A;  1EEI D;  3AMU A;  4KN7 C;  2NUC A;  1SE4 A;  2D9U A;  1ZKO A;  4H7B A;  2JEA I;  4X3K A;  1B4O A;  4RKB A;  4B08 A;  4QCL A;  1IKM A;  2KOL A;  1Q90 A;  1DD2 A;  5JOB A;  4O42 A;  2F0K A;  2CW0 D;  4K6L A;  4L63 B;  2QKI C;  3LNN A;  1BBX C;  1ESF A;  2NN6 H;  4BWG B;  2CW0 C;  3X3N A;  4IUR A;  2PW7 A;  1L0Y B;  2WP8 J;  2KA7 A;  1MSH A;  4QB4 A;  1HPC A;  3K6O A;  5IT9 E;  1SAP A;  4F7X A;  1MI2 A;  1ENF A;  2JA7 B;  5BN5 A;  3C3L A;  1HRJ A;  2RKS A;  1TS3 A;  3SXH A;  3S17 B;  4HN7 A;  4ZK9 B;  3MFY A;  4C1N I;  3VR6 A;  4QUF A;  2FJ2 A;  5DAU A;  4XTC S;  2ZXO A;  3SVM A;  3GV6 A;  1W6J A;  3GO5 A;  4IFD H;  1UNS A;  2E76 C;  2PO4 A;  5IGC A;  2IPK D;  3S1Q B;  4RH6 A;  2NVQ B;  1HFG A;  2JA6 B;  2NN6 G;  3SEB A;  5KYI A;  1AW7 A;  4J6H A;  3Q22 A;  2LFN A;  4NP5 A;  1FD7 D;  2Z4I A;  5CV5 A;  3Q6S A;  1WTX A;  5C0X G;  2CHB D;  3S2H B;  1A2T A;  2EJG C;  2FMC A;  5EBC A;  1MD2 D;  5IOD A;  1EU3 A;  5FO8 B;  3LWE A;  3Q0A A;  1QNK A;  3DWP A;  4RGN A;  2XRS D;  2OT2 A;  4EGV A;  3DWQ A;  2DNC A;  4IUQ A;  2A74 C;  1EIG A;  1BXT A;  2BA0 A;  2KCN A;  2L55 A;  2K03 A;  2DY8 A;  1H9R A;  1SNO A;  4ZKB B;  1SNC A;  1U4R A;  2F0G A;  3M4O B;  2XWB B;  1OO9 B;  1PTO B;  1SXT A;  3PUY A;  2F0D A;  3GD7 A;  1E0B A;  1HA6 A;  2BCO A;  1V1P A;  3HOZ B;  3DM1 A;  4HAE A;  1EY0 A;  3CRL C;  1F2L A;  5E1F A;  1LAB A;  3V96 A;  5ELF A;  1I4H A;  3PIO 3;  3D8G A;  2AWN A;  3H91 A;  1LAC A;  5BN3 A;  5IGG A;  3G6J B;  1EY8 A;  5CV4 A;  4LAA A;  1R4Q B;  2A6H D;  3ONA B;  5C3E B;  1JE4 A;  1TS5 A;  3QOL A;  1BOS A;  3JAM E;  5I4D A;  2PPB C;  3PIP 3;  5IGF A;  2B2V A;  3IFD A;  1B3A A;  1SJH D;  2A69 D;  2JXM B;  4KK7 A;  4KKU A;  1YNJ C;  4RKL A;  2B2V C;  3A8J E;  1MGS A;  4OHJ A;  5C5M A;  3CHB D;  3BG3 A;  3MXG A;  4B9X A;  3F2U A;  1CHP D;  4S3S A;  3VR5 A;  5M5Y B;  1PTO D;  3L3O C;  4IUV A;  1II3 A;  1LTR D;  3CKI B;  5G3L D;  3HGB A;  2KCC A;  1KDA A;  4HMJ A;  5KNB A;  1CK1 A;  2F0I A;  4A3I B;  1PTO F;  5CR3 A;  2BA1 A;  2J4X A;  2OEO A;  4IFD J;  4C3H G;  1A2U A;  1O78 A;  1EL0 A;  1UEA B;  3W2D A;  1PFM A;  3I3C A;  1TS4 A;  1EZ6 A;  3ND8 A;  3HP3 A;  4XQQ A;  4DU9 A;  4RCO A;  2HUG A;  1PXU A;  2WAQ B;  2PYK A;  1DJR D;  4CJ1 B;  2RSO A;  4FNF A;  4QIW B;  5M5W B;  5HGT A;  3NBH A;  4IUP A;  3D4W A;  2F0E A;  1C8C A;  3RLF A;  5C0X J;  4WOR A;  4OL7 A;  2X6G A;  3M85 A;  4CJ0 B;  1U4P A;  2R92 B;  3M3Y B;  1MSG A;  3DMU A;  4HMI A;  2F0F A;  3I70 A;  2WKD A;  1AZP A;  3GTP B;  1H9S B;  1JOQ A;  2SDF A;  2A6E D;  4BBS B;  4IAL A;  2MUY A;  3SR1 A;  1OXX K;  1TWH B;  1UUP A;  4HTH A;  1XTC D;  5IGD A;  5KND A;  2Z4H A;  2HCI A;  4C3J B;  3I72 A;  1CQF A;  3IKJ A;  1XWE A;  3ND9 A;  1WTV A;  1ILQ A;  3DHQ A;  4FF2 A;  2NVX B;  4IUN A;  2EYH A;  1T5E A;  4ZYS A;  4PMC A;  3J7A F;  2NN6 I;  4HCS A;  3QG1 A;  4ZQ3 A;  2EDG A;  1JOR A;  1GOZ A;  4RA8 A;  2QF7 A;  3MVV A;  1MBY A;  2K5D A;  4RGO S;  5EPJ A;  4DXF A;  2FIN B;  1BF4 A;  3R3O A;  5EJW A;  1O7L A;  5CYU A;  1ZEQ X;  1RDP D;  3GTJ B;  4K14 A;  1SEB D;  1KDC A;  1KTK A;  1STH A;  3V2T A;  2XWJ B;  1EWH A;  1D1K A;  3I8Z A;  1ET6 A;  1ONL A;  1EYD A;  1GHJ A;  2A73 B;  1PRT C;  4FF4 A;  2C5C A;  2XNA C;  1SSO A;  3A7A B;  3TME A;  5C44 B;  1SYB A;  2MGS A;  1F9P A;  2F0U A;  3GTL B;  4FVM A;  1CI3 M;  4R9W A;  2BOS A;  2ID0 A;  2L9H A;  2B63 B;  2M9V A;  3NTI A;  2TSS A;  1U9R A;  2IX3 A;  2A69 C;  5J1Z A;  1I3Q B;  3SK4 A;  2IJ0 A;  3J81 E;  4RFB A;  2WII B;  5AFW A;  4IUU A;  3H6M A;  2IL8 A;  4IZ8 A;  2B8F A;  4H0L C;  2NBF A;  1FNV A;  1CTM A;  1PFB A;  4KY5 A;  1JR0 D;  2HDL A;  1NCV A;  1Q8I A;  3S1N B;  2K5Q A;  2HDM A;  4F88 A;  1K8O A;  5BN4 A;  1WTW A;  1EFI D;  3D6W A;  2RDF A;  5EBD A;  2Z1C A;  2AWO A;  5JEA G;  3NQI A;  5TSS A;  1DOM A;  1DXM A;  3TDQ A;  1JWM D;  3DUZ A;  2JYO A;  5KIX A;  2AUJ D;  3T13 A;  2KUM A;  3OIP A;  4A3E B;  5CV9 A;  1DCZ A;  3RZO B;  1TT2 A;  2F0L A;  2Y0S B;  3K58 A;  4ME5 A;  4A3K B;  5E4W C;  4V0B A;  2L0C A;  4UAI A;  3A7L A;  4CKC A;  2TMP A;  3RMH A;  3KLR A;  4OIJ A;  1QB5 D;  3S14 B;  1T5X D;  3O13 A;  5FK9 C;  4ID6 A;  3FKI B;  4UDU C;  1GXD C;  1Q12 A;  4DK1 A;  1F9R A;  1S5E D;  1GUN A;  2OF1 A;  1GJX A;  1F9Q A;  2B2W A;  3I4N B;  1LTA D;  3AB9 A;  5EGT A;  1VMC A;  1ENC A;  3LWU A;  3DEO A;  2PZT A;  2K1B A;  3PO3 B;  5K5P A;  1I4X A;  2M2L A;  5M9O A;  1LTG D;  5FLX L;  2RBM A;  2A68 C;  3J7A V;  2VXW A;  3HOV B;  4K5W A;  2N55 A;  1CM9 A;  4FXG C;  2PQE A;  1BCP F;  1I50 B;  2EY6 A;  2J0T D;  4CKE A;  1CZW A;  4C3H B;  1SYC A;  2FMM A;  3BYT B;  1ILP A;  2PMZ B;  1SFO B;  4TRD A;  1I6V C;  3BS1 A;  1LT6 D;  2D2C C;  2XVS A;  4TQU S;  1I4Q A;  3T53 B;  3H0G B;  2JEB I;  4XYQ A;  4DXG A;  5IT9 L;  4L6T B;  3WOF A;  4OO1 I;  1OXV A;  4WJW A;  1PRT D;  4J1M A;  1BQQ T;  1RCV D;  2QDB A;  4N9P A;  1ESR A;  4C2M B;  1TY0 A;  1G8Z D;  4FP5 D;  3OPO A;  2Z8L A;  2L1B A;  3VYR A;  1K8M A;  1SNQ A;  3NTK A;  1E2Z A;  2B2T C;  3QB3 A;  1A3V A;  2A5H A;  3DWA A;  1AFP A;  2NTS A;  5I6W A;  1AEX A;  3OHX C;  2B2T A;  2CVR A;  2AQ2 B;  1IW7 D;  1QOH A;  3D3R A;  5C4X B;  1ENA A;  4B9W A;  2QEJ C;  2KVM A;  4ZKC B;  4NMZ A;  1K83 B;  4DAY A;  1YNN D;  3J80 E;  1OXS C;  2QIL A;  5D65 A;  2XRQ D;  3QIA A;  1M8A A;  4R8N A;  2V4D A;  3IL8 A;  3P1H A;  1LO5 D;  4DNT B;  3PUX A;  3WDN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...