2F0GA

Crystal structure of staphylococcal nuclease mutant v66i
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
135
structure length
135
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMIENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Staphylococcal nuclease
publication title Hydrophobic core mutants of Staphylococcal nuclease
rcsb
source organism Staphylococcus aureus
total genus 36
structure length 135
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2005-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2f0gA00
2WACA 1STBA 3QOJA 3QOLA 4N9PA 4NDXA 1STHA 1TT2A 3MEHA 3NQTA 3MXPA 2F0WA 3C1EA 3BDLA 1EYAA 2OEOA 4K2LA 4TRDA 3SK4A 2LKVA 4EQPA 2SOBA 4ZQ3A 4ID6A 4IUNA 4K5XA 5ISRA 1NSNS 2KQ3A 3HZXA 1SNQA 4S3SA 2HQEA 1II3A 4RKBA 4B9WA 4H7BA 4HMJA 5C3XA 1JORA 1TR5A 3V2TA 3U9OA 2RDFA 5I6WA 1A3TA 2QDBA 1JOKA 5J22A 1A3UA 5JOBA 2F0QA 2F3WA 3QB3A 2O4XA 2PYKA 4HMIA 3D8GA 3T16A 3C1FA 1SNMA 3ERQA 4KD3A 1TQOA 3D4DA 2F0KA 3MVVA 3E5SA 3SK8A 1KAAA 3D4WA 1EYDA 4G57A 5DEHA 3SK6A 3TP5A 2F0PA 1EY0A 2SNMA 4KJNA 1EY8A 2F0FA 3HEJA 4K5WA 1EY9A 1KDBA 2ENBA 3EROA 4QB4A 1ENAA 3TP6A 3EJIA 5KYLA 1A3VA 1KABA 4J6HA 1A2UA 1AEXA 2EY1A 4KTAA 5CR3A 2PZTA 2PW5A 4DGZA 1EZ6A 4B9XA 2F0JA 1F2ZA 4K8JA 5KGUA 5KIXA 4J1MA 2F0OA 2EYMA 2EXZA 3MZ5A 3EVQA 5KYIA 1STAA 1SYDA 4K6DA 4QMGA 1SNDA 2EY6A 3TP7A 5CC4A 3NXWA 1IHZA 5KRUA 2EY5A 2EYOA 4K8IA 1STGA 5CV5A 5C4ZA 2SNSA 3OWFA 4K14A 5C4HA 1EY5A 5IGGA 2F0TA 5CV4A 1A2TA 5IIFA 2EYLA 4NMZA 4RKLA 5K5PA 1SYCA 2OF1A 1EYCA 4IZ8A 3ITPA 1SYBA 3R3OA 4PMBA 3D6CA 4LAAA 4R8NA 2PQEA 3SK5A 1F2MA 3SXHA 5IGCA 2EYJA 2F0EA 1ENCA 4DF7A 4ZUIA 1NUCA 4ME5A 2RBMA 4ODGA 5CGKA 4NKLA 3SHLA 5DAUA 1SNCA 5NUCA 3TP8A 5IGFA 1STNA 3T13A 1SYFA 3DMUA 4K5VA 5E3FA 5F2DA 3VA5A 5CV9A 2OXPA 2RKSA 2F0SA 5IOCA 3H6MA 5C3WA 5E1FA 1EY4A 1SYGA 2F0HA 5EGTA 3NK9A 3NP8A 5CV7A 2PW7A 4N9TA 4KV6A 3OSOA 5C5LA 3MHBA 4HTHA 5IGEA 3P1HA 4WRDA 2EYPA 1JOOA 3SR1A 4KY5A 4EQNA 1JOQA 2F0VA 4E6IA 1KDCA 3P75A 5EKLA 4EQOA 4K2KA 4KJOA 3LX0A 4KY6A 2F0IA 4ZUJA 4F8MA 5HGTA 3TMEA 1SNOA 1SYEA 5KEEA 3S9WA 2F0LA 1KDAA 4IALA 5JAVA 2EYHA 2M00A 5I9PA 4KHVA 4NP5A 4KY7A 4F7XA 5C6AA 4DU9A 2F3VA 1EY6A 4WORA 5J1ZA 1F2YA 4KD4A 1EZ8A 3OMCA 4QF4A 5J39A 5CV8A 2F0MA 2NUCA 2PZUA 5IGBA 2KHSA 5IODA 4EVOA 5IGDA 5M9OA 4MIUA 4PMCA 4DFAA 1EQVA 1EY7A 5I6YA 2EYFA 1U9RA 5C5MA 2F0NA 3PMFA 2F0UA 4OL7A 4YIJA 3NUCA 1STYA 2F0DA 3BDCA 4I65A 1RKNA 3DHQA 5EKKA 3RUZA 2EY2A 3OMGA 5CV6A 4PNYA 5HURA 2PZWA 5I9OA 3NHHA 1SNPA 2F0GA
chains in the Genus database with same CATH superfamily
2B2VC 3FMCA 3QOLA 4IPCA 4B3RQ 1IKMA 1UEAB 2F0WA 3H3VI 2IPKD 4DR3L 1SNQA 3OOCA 1FVIA 4YWLA 4A93G 3ND8A 2AWOA 3QJYA 2B2TC 3CW2C 4M1UB 5IP7G 3J80i 4ZCKA 1JICA 1XPRA 1HHVA 3BYYB 3DEPA 1WTVA 4RH6A 2NBFA 2ZXOA 1J8IA 4LMQD 2Z6KC 1DONA 4AIMA 2DNEA 2H1EA 2D2CC 5BN3A 2A6HD 3DLLA 3W1GA 1Q3LA 4BY7B 5C4XG 1AN8A 4L5QA 3F1ZA 1KABA 3CU7A 3LGJA 5IP9H 2XGTA 4FVMA 2V4DA 2BOSA 3DUZA 5KGUA 3E3XA 1PRTC 4IQZA 1OXUA 2DY8A 2KVMA 2NN6H 4DV4L 3L9AX 4BXXG 2FFKB 1V8QA 2EIFA 3BYTB 5A35A 2NZHA 1SE8A 1EEFD 3ITPA 2X69A 4R8NA 1YNJD 1XMOL 1E2VA 3SK5A 3SXHA 2UXCQ 1PYWD 5IGCA 4FF3A 4JI7Q 1U4PA 4JI5L 5M5YH 4JV5L 2XTIA 5I4DA 1NUCA 2KJXA 2IT1A 1A0IA 1Y1VH 4BY1G 4CHTB 2JEAI 3FP9A 2QCPX 5IOCA 3RD4A 5A2QE 4IUVA 4X64Q 5ELNA 3NP8A 5G3LF 3M7NA 3PO3B 1VF7A 1CM9A 2K5HA 1SBBB 2F0VA 3FDTA 4F8MA 1IBMQ 4ALPA 1DZ1A 4GS3A 1RODA 1RJTA 3S14H 2F0LA 4BBRH 1EY6A 2UUAQ 1JJCB 3A74A 1TKWB 4DR7Q 5J39A 2PNHA 4BY1B 2ZTDA 2R92H 4EVOA 4A3GG 5IT9L 4LF7L 1F2LA 4RA8A 1LV9A 2RA4A 2FINB 1VQ5A 1SSOA 3EIVA 3RN2A 2A69C 1S5CD 3WOFA 1U4LA 4XT3B 1B9NA 3HOXH 5M3MB 3X3MA 2WB1G 3CCMA 1LM0A 3MXNA 2YU9H 2FMCA 4OEMB 1SJED 3GTPH 1IBKQ 2EJFC 1DOLA 3BDLA 4XQNA 5ISRA 1LTTD 2UU9Q 2Q2UA 3CD6A 4G7OC 3GDEA 3PSIA 2WAQB 1VQGA 4BBSH 3AU7A 1IYUA 1TWGB 1J6QA 1RTNA 4A3BB 2QEJC 4MTKA 5DM63 1S5FD 1SFOH 3D8GA 4XYQA 2L55A 4A93H 3C1FA 1SNMA 3HP3A 3GQBA 1BXTA 1HTPA 1S3OA 3OTOL 2JYOA 3IRBA 1KAWA 3H94A 4APVA 2WB1B 3PUYA 1EQQA 4IUPA 2GVBA 3NEMA 3D4RA 2F4VQ 2JQOA 2PZTA 4HJAA 2ES2A 1F2ZA 4C3HG 2RHQB 2EXZA 1Z47A 2EOTA 4AYBB 5CC4A 4QMGA 1NMFA 4DV0L 4K8IA 5I2XA 3TSSA 2A19A 4K14A 3KFUA 3S15B 2EYLA 4NMZA 5CORA 4H0LC 3X3NA 3D6CA 2UXDQ 1AZPA 4BXXH 2EYJA 3KK7A 4YCUA 3KDFB 1G291 4B3SQ 5ELCA 1HCZA 4NKLA 1Y8OB 4NW2A 2E75C 1EWIA 1ZKOA 2MHVA 1F77A 1FGBD 4IN3A 1H9SA 4PMWA 4A3CG 5EPLA 3GTJH 5IYBG 4DV1L 4GNXA 3HFZB 3K7AB 3D31A 5FO8B 3HOVH 2ID0A 1OTCA 1K83H 3EA6A 1I4PA 2NYZD 4GOPB 1TWCH 3PIO3 1KDAA 4BA1I 2NTTA 2HIVA 1QZHA 1HPCA 3NBHA 4OGQC 4LF8L 3SE0A 1X3EA 3OMCA 1F9SA 1VQ7A 2PZUA 5IGBA 2KHSA 2VQEL 1UE7A 4FXDA 1X3PA 3PGZA 1S4ZA 2B63G 2BE5C 4LF9Q 3CCEA 4GN5A 1T9HA 1D8LA 5LMUQ 3KBGA 1YEZA 3TBIB 3TDQA 1RKNA 3QG1A 2GVAA 5LMNQ 1A6XA 1FNVA 2E76C 2P5ZX 2JA7H 3K7UC 3MEHA 4RCOA 1AH9A 2ZJRA 1R9TH 3AMUA 4MHEA 1VQPA 1FD7D 2XN9C 4DK3C 3U9OA 2HIXA 4P75A 1B7YB 1N33L 1W2BA 1PTOD 1V9PA 1WCMB 4HSPA 4JBWA 3G71A 2F52A 2LY7A 1GUTA 2AHOB 1U5KA 4A3FG 4IUQA 4TQUS 1EY8A 3O13A 1K8GA 5GAGC 3GV6A 1ONLA 2RDGA 4JI6Q 1RHPA 4ILWA 3HOZH 4XQQA 1CT1D 2F03A 1C7YA 1AE2A 4YY3Q 2NVXB 1WD0A 2MO0A 4HSVA 1YNND 4A3MG 4C3HH 1AFPA 2QDLA 2B2VA 4RKLA 1I94L 1EU4A 2QEXA 2B2UC 1K9MC 3S1NB 1Q90A 4DAPA 1B8AA 2JA5B 4KI0A 2YTYA 2F0EA 5JEAJ 1CHQD 4A3FB 2RBMA 4FNFA 2B2TA 4CJ2C 3C2PA 3S24A 3CCJA 5CBEE 1STNA 2R7ZG 1D7QA 4JI8L 2Q2TA 3U4ZA 2OCEA 1V1PB 1VMCA 1PYBA 3TN2A 4POGA 5AJ3L 4KHPL 1TY0A 2Z6KA 3BG3A 3K57A 4DUYL 1PTOH 1HNZL 1O7YA 4ZLTF 3G7LA 4WRDA 1E2WA 4JI3L 3W2DA 1KDCA 4EQOA 2PNRC 3G4SA 4LNQA 3BZDB 1SYEA 1HZ9A 1PZJD 5FOBB 5JPNC 4R4OA 1YVCA 1PH4A 3HOYB 4DR5Q 1W6KA 1VQJA 4KN4C 1ESRA 4DAYB 2B29A 1NBWA 5JPMC 4OELB 4DFAA 1ICFB 1I50H 4A3IG 1FR3A 3T1HL 4C3IG 3PMFA 2OTLA 3JAMc 3CC7A 2IX0A 1Y8PB 4A3EB 3DHQA 4K0KQ 3OMGA 4RGNA 1UE6A 5EKIA 1SNPA 2KUMA 3OYYA 5NUCA 5C3EH 1VQ9A 3J7AF 2A6HC 2F1MA 1TT2A 2XSCA 2CH4W 3GTMB 1PH6A 3Q23A 2JEBI 1HUMA 4ZQ3A 4B9WA 3GO5A 4DV3L 1C4QA 4DAYA 4JYAL 2NVYB 3OPOA 1SLJA 4DK6C 4V190 1GUNA 1T5EA 3T16A 1GUOA 1H9JA 3CMEA 4KJNA 3HEJA 4NXML 1EY9A 2JA6H 1YNJC 2DGYA 1H95A 3CCRA 3AB9A 1PH1A 4LFBQ 1I6HH 5CR3A 1QVFA 2PW5A 1K8OA 1ICWA 4XQJA 3PIOA 4X65L 4GN4B 4LF6Q 3V05A 5C4ZA 1OXVA 4PG3A 1A63A 1X54A 2PQEA 1EWHA 1NMGA 2F3IA 2HT1A 1BDOA 4B08A 3CP0A 1I5FA 1TWFB 2KHIA 1DM0B 1U4RA 2HHHQ 1PMRA 4HJ5A 2ZJQA 1X55A 1VQNA 2DUDA 1CZWA 1EU3A 1XYIA 1E0BA 1MI2A 2G5DA 4IURA 4DKAC 3M85A 1WTXA 2R61A 2EYPA 4U68A 4FP5D 2YTVA 1V1OA 1WD1A 2BA1A 3EQLC 1DD2A 2K75A 1Z9FA 3KUPA 2B8FA 1G91A 3HOWG 1IW7D 3IAYA 4O1NA 2NWGA 1J5EQ 4JG2A 1UAPA 1K0SA 4JBMA 2O2LD 4NXNQ 1O7ZA 2RQXA 4KD4A 3S1MB 5M3FG 1IBLQ 4A3LG 3GV3A 5LHY1 2O5JC 5JVG3 1XWEA 1L1OC 1BF4A 4IJHA 3KF6B 4RCNA 3J80E 4I65A 2IW3A 1TS4A 2ASBA 4XDXA 3S16H 1XJVA 4A3IH 4IFDJ 4JI1L 3W3AA 5CV9A 2HDLA 3HOWB 1W3SA 2OEOA 4C2MH 1VQLA 1C48A 1CKOA 1STEA 4LJZC 3AEVA 4ZKBB 1I3QB 4C3JG 3V2TA 5M3FB 3UE1A 1HZAA 3S1QB 3M4QA 4L63B 2VUMH 1A3UA 3H15A 3H3VH 2R3ZA 2KEDA 2H4OA 4RFBA 3KF6A 3DWAA 1KAAA 5DEHA 2QF7A 2EJMA 3HKZB 1E22A 4LFCL 5EJWA 3SVMA 4GLXA 5C0XI 1HRJA 2DN8A 4A3DB 2XWJB 4LUVA 1D5XC 4QIWB 3FEWX 4IUUA 3HKSA 2D0OA 5D3DA 3GTGB 1HR0Q 2EJGC 3F8TA 2IJ0A 3DWQA 4C3JB 1IHZA 3VYUA 3PUWA 3H91A 5C4HA 1YITA 1EQRA 5IGGA 1G2TA 1E7ZA 1HR0L 4IPDA 5ELEA 1EYCA 2RCFA 1WYDA 4X3SA 5IP9G 1N36L 1GM5A 4LF5L 5DNFA 1QE6A 3NTHA 1ENCA 2IY5B 4ZUIA 2JA8G 1CQFA 1F9QA 4CKCA 4F88A 5FLMH 1SNCA 1ASZA 2Z1CA 4UPAA 1SYFA 4L6TB 3T13A 4X62L 3S2DB 4FXGC 2L1BA 2K32A 1D5ZC 3UDFA 5BN4A 3FKIB 1DCZA 4EQNA 4RG1A 1Y1VG 2B3GA 1EIGA 2FMMA 3GD7A 5JEAG 2A6ED 1H9RA 4A3KB 4QL5A 5FLXE 2M2LA 1I4HA 3QO2A 4PZ8A 4DR6Q 5KEEA 2L11A 5JAVA 2QILA 4F7XA 1VQEA 1RCVD 2K5DA 4DU9A 4DR1Q 2BDNA 3WOEA 3ICEA 2WV6D 3GTOH 5ELDA 1KLUD 2EZVA 3GTKH 1VQ6A 1MSHA 3WWVA 3PO2B 1Q81C 2B2UA 2C5CA 4EGVA 3BDCA 4BBRG 4GZYC 1BR9A 4JCVE 1PTOC 5M5YB 2VB2X 1M1KC 2F0GA 3IFTA 2E74C 4UY8C 1STBA 2IHEA 2R92G 1KRSA 4JI2L 3SK4A 1LUZA 2MQHA 4K2LA 1EL0A 3J81j 3TZDA 1LTRD 1A8VA 4DXFA 3I90A 4ZRZA 1XMQQ 3HOXG 1A3TA 2N88A 4LWCA 1JOKA 3A7AB 2J4XA 1LT3D 2C9OA 4RHSA 1YNNC 1C0AA 1O7IA 1IKLA 1LTGD 4ZK9B 3A5UA 2HD3A 3A54A 3MVVA 1JMCA 3E5SA 3NWSA 5FO7B 1TWHB 3GTQH 4GKKL 5CBAE 5FKAC 3K8AA 4DR3Q 1LTAD 5ELBA 3I73A 3V96A 5BN5A 4BBSG 3DXJC 2R92B 4CJ0B 1FL0A 3BJUA 2PMZE 3S1RB 4R9WA 3VA7A 1SEBD 4FDBA 2K5QA 2LSSA 1Q46A 4HIMA 5IYDH 2HDMA 2MUYA 1F2MA 3K5OA 3CCLA 4CDDC 2XNAC 4ME3A 2L5TA 3KLSA 1BCPF 2E2DC 2Q8IB 4KLKA 4DV4Q 2B39A 2OXPA 3BZKA 1L0XB 2F0HA 2JA8H 3RZOB 2DNCA 3N6RA 1B3QA 4A93B 4FF4A 2EE1A 4LF4L 1XMOQ 1WFQA 1JWMD 1QB5D 1PFNA 4JI5Q 3I4MG 1E1TA 3P75A 4JV5Q 3LX0A 4DR2L 5IYCH 1M4VA 4NP5A 4X3KA 2MGSA 1X3QA 4QF4A 5JEAH 3HOVG 5C4XB 4GLAC 2IX1A 3S17B 1GUGA 1SN8A 2K6AA 1ET9A 5I6YA 2EYFA 3P20A 1EIYB 4OHJA 5EKKA 3MXNB 3T56B 2XIWA 2BH8A 5EBDA 3MXPA 2ICIA 1X32A 4TRDA 4YWKA 2SOBA 4LF7Q 3J81c 5IWAL 1Q86C 1KQSA 5LMNW 2HQEA 3GTJB 4WJ4A 4JBKA 3SGIA 3HOVB 3HS0C 4N8X1 4UDUC 1DOMA 2IX3A 4R8IA 4CJ1B 2I07B 2K50A 3ONAB 3JAML 2JA7G 1LT4D 1B4OA 3GTLH 1XNQL 2E2JH 3A8KE 3BDOA 5DLQE 2CW0D 3VR2A 3EJIA 5KYLA 4J6HA 5D14A 1F9RA 4AQYL 3UI2A 3CCQA 1IL2A 5BR8Q 1L1OA 1ENFA 1PRTF 1GKHA 2EVBA 5FK9C 3CQZB 1NY4A 4Z9CB 4HJ7A 2EYMA 2HCCA 1LT6D 1CUKA 2Q8TA 4AH6A 1JT8A 1VQAA 4K6DA 4POFA 5BR8L 4DV5L 4A3GB 3OTOQ 4OWXB 1EY5A 2AWNA 4DXGA 2MO1A 1QJOA 3H3VC 3HOZG 2K01A 4BY7H 1IW7C 4WJ3M 5IGFA 1H9SB 3N52A 4DV0Q 4K5VA 2Z4HA 4GNXB 2QKIC 1K3BC 1GUSA 3OIPA 4OXPA 4B3TL 3PV0A 1PV4A 4HTHA 3P1HA 4L8JA 3LWUA 1X65A 2C35B 3I4NH 3JAMi 5EKLA 4KJOA 3F2BA 1QCBD 1HFGA 1PH9A 5CYUA 4CDEC 5LL6X 1UE1A 3NBHB 5I9PA 4KHVA 4WORA 3I4MH 4R4QA 3FHWA 4BA2I 4ULLA 4DV1Q 1QVGA 4DN4M 5IODA 1VQFA 1EY7A 3CC4A 4C3HB 4GKJL 2LS01 2WKDA 1BO0A 1JB3A 1HH2P 2I5LX 2FJ2A 3PO3H 1PVOA 1BCPB 5A2QL 4LF8Q 2NN6I 4DAMA 2I5MX 4NDXA 4OO1I 2E2HB 3AFQA 5KNCA 2VXWA 1LT5D 2VQEQ 1WTHA 3MEFA 4NPSA 2NB0A 5JVH3 4H7BA 3CCSA 2NTSA 3SEBA 3J80c 1PXUA 2XRSD 2QDBA 3FPPA 3KLRA 2LMCB 5C3EG 4C1NI 4X6AH 2NVQH 4OIJA 2BH2A 5M3MH 1LTBD 1TY2A 3EROA 3PUZA 4HCEA 3KLWA 1S5BD 4IFDH 1MSGA 2KCTA 1ILPA 4IPHA 1N33Q 1TS3A 2MP1A 3CC2A 1U0LA 3T51B 1EUJA 2JK8A 1K8MA 2EYOA 1X3GA 1TWGH 4A3BH 3OWFA 1VQ4A 2HCIA 4P72A 2JA6G 5CV4A 1LTSD 5C3EB 2B63B 1AW7A 1I4RA 3Q6SA 3A8IE 2WAQE 3CMAA 2TSSA 2A1AA 2A6EC 4ME5A 3R93A 2NVTB 1QNUA 5CGKA 5I2YA 3E9HA 5D3IB 1SYGA 3KJPA 1BKBA 1I94Q 4KV6A 2WB1E 4A76A 2OWOA 5IGEA 1Q8IA 1WTOA 2AUKA 2EPBA 1HUNA 2A5HA 4CKBA 3G48A 4ZUJA 4IO9A 3TMEA 1YJNA 4AYBE 5M5XB 3S9WA 5KNDA 4PV1C 1I6HB 1PRTB 5GAEC 4JI8Q 5M5WH 3ZJYC 3AYHB 3T1YL 2WFWA 1JQYD 5AJ3Q 2K5VA 4KHPQ 1VQMA 1HNWL 3NTKA 1R4PB 1NE3A 4DUYQ 1YBYA 1HNZQ 4HIDA 4JI3Q 1CZGA 1AP0A 3QWNA 1EIHA 4IUTA 5G3LD 3H0GH 5FLXc 1WTQA 4LUOA 2F0NA 3K7AH 5LL6S 4OL7A 5EPJA 3NBIA 4X3TA 4UP9A 4UP8A 3NUCA 1STYA 5AFWA 3TS0A 3CPFA 1O80A 4UHVA 2CH4A 4A3MB 1YNXA 1P8LA 3VYSA 5JJKA 1KLGD 1FJGL 2WP8J 1VQ8A 2A73B 4MTNA 5D65A 1CSQA 4S3SA 1BOSA 1TS2A 1UUPA 3T1HQ 1QUQB 2YV5A 2R7ZB 3CF5A 2Y0SG 1EEID 2K1BA 2K5WA 3J81E 2O4XA 1OXXK 1UWVA 4UP7A 1VQOA 1PZID 1QILA 4KMUC 2NZOA 2F0PA 2F0FA 2RDHA 2VL6A 4F87A 2A8VA 3M4OB 1VQKA 4DV3Q 3C3LA 1GXDC 2Z0SA 4JYAQ 2VUMG 1B1ZA 2KEEA 3A8JE 5KIXA 1B2TA 3DM3A 4XTCS 2CKZB 2F4IA 2NZ1D 1QUQA 4ABNA 5C0XH 4LFAL 3S16B 1A2TA 4A3IB 2Y0SB 4NXMQ 1WCMH 3PIP3 4C3IB 1Y1WG 3SDZA 1RTOA 1GVPA 2ZTCA 3CCVA 2K52A 5JJZA 1PHJA 4X65Q 1V1QA 4RGTA 1N32L 3TP8A 1JWSD 1UE5A 3C46A 3UDGA 4CDCC 2VQFL 1MKHA 4B3ML 2X6GA 4HCSA 4OX9L 4LUZA 2KCNA 4BS9A 2WINB 3K0YA 3SR1A 1HFNA 4E6IA 3Q24A 4JBJA 4K2KA 1VDZA 5FLMG 2J0TD 1TWAB 2Q2HA 2PQAA 4RAUC 1KNEA 5C6AA 3HOUH 2R6GA 1UNSA 1Q12A 2UUCL 1YI2A 3H09A 3K5MA 2WKCA 2DJFC 4JOIC 1H9KA 4RMFA 1EQVA 5C4JB 2ICEC 2K14A 1CHPD 5CV6A 2K5NA 4N9PA 3G6EA 4DV2L 5IY0A 2CW0C 4XXEA 2R93H 2YYZA 3G6JB 1EFWA 3HZXA 4A3JG 4HMJA 1M8AA 5I6WA 1TU2B 1XPOA 4Y52H 2AQ1B 5JOBA 1I4XA 4CBVA 5HY6A 4TVAB 1HXYD 2L9HA 2L15A 4JI1Q 1P16A 3ERQA 2F0KA 2O5IC 2Z6BA 3VR6A 3TP5A 2KOLA 3RZDH 1VS0A 3PUXA 1YJ9A 1KDBA 2ZJPA 3GTOB 3HG9A 1PFMA 3GTMH 3I70A 1LABA 1EZ6A 4B9XA 1CFMA 1XXGA 4A75A 4JI4L 4JI0L 4R4TA 4BWGB 2ZM6L 1K28A 1EWCA 2EY6A 2NVYH 4YHHL 3UDIA 1NJIC 2OF1A 1HNXL 1S40A 4LFCQ 3ER0A 2A68D 1SMYD 3F2CA 2VB3X 3AQQA 3NENA 4XYOA 3K5LA 2PI2A 2UXBL 1Y1WH 3DMUA 1FGUA 5T1IA 1M90C 3BS1A 4R4CA 4DV7L 2GA4B 5EGTA 5IYDG 4DNRB 4L5TA 3OSOA 1N9WA 3A7LA 3KF8B 3LWEA 1N36Q 4LF5Q 1S5DD 4KY5A 1C9OA 1WTWA 3TEHB 1TVXA 1Q1BA 3VR4A 1PYSB 5IE8A 3ND9A 4A4IA 1Q82C 2Z4IA 2SEBD 4X62Q 4QQBX 2AMCB 5J1ZA 1K0RA 1TWFH 1VMPA 4DK1A 1XNRL 2NUCA 5COYA 1PH8A 2E5LL 5IYCG 1MGSA 1U9RA 3TZUA 4K6LA 4P73A 2Z9HA 1GHJA 2YTXA 4HIOA 3KF8A 1I4QA 1ZXTA 3STBD 2K04A 5KNBA 5C44H 4PNYA 5HURA 5K36G 4ZKCB 5I9OA 3U9SA 1J9OA 3PIPA 4ID6A 4X66L 2OQKA 2KQ3A 2Q8RE 1II3A 2JA8B 4ZYSA 4FF1A 3EBEA 1N34L 4IOAA 4H44C 1DJRD 3D6WA 4A3JH 1B3AA 1K8AC 2JN4A 4JI2Q 1X9NA 3PUVA 3T4AC 5E4WC 1Y1VB 4X3UA 3QR8A 3M4YA 2QGQA 3KJOA 1AEXA 4KTAA 4GOPC 4DGZA 3J80L 2R7FA 1MIUA 2JJQA 2MFIA 2ZXRA 4CDFC 1QOHA 2F0OA 3MZ5A 4TSSA 5C0XJ 4Y7NH 1B53A 1I3QH 1SYDA 2X6LA 4KKUA 3RNUA 1VQCA 1BQQT 1STGA 3S1QH 4CGYB 1SROA 4I7ZC 2JSOA 4GKKQ 2RHSB 3S14B 3R3OA 5IT9E 5ELFA 1HQMC 1D1IA 4BBRB 4DF7A 2MNAA 5GADC 2LXJA 2I5HA 1ZYRD 3K58A 4P71A 5E3FA 2BDOA 4EQ5A 2F0SA 4MZ9A 1ML0D 4YCVA 3HKZE 1NR4A 1SE2A 2V1CC 1BBXC 1E24A 5C5LA 4DUZL 3GTLB 1B44D 3HOXB 2E2JB 1JJ2A 4BY7G 4QIWE 2TMPA 2JP1A 4DR4L 2L0CA 2YU9B 2OTJA 2F0IA 3K5NA 4DV6L 3GTPB 1NTGA 4IALA 2UUBL 4KY7A 2JA9A 2VW9A 1YHAA 3L7ZC 1KTKA 2EXDA 5CMDA 4B3RL 4HAEA 5T1GA 4BBSB 1MHWC 3BZCA 3D3RA 4H02A 3I4NG 4LF4Q 3S2DH 1X56A 1IYJB 2KA7A 1D2BA 1SFOB 4DR2Q 2F0UA 2KCMA 1PDQA 3ZYYX 2E2IH 1PTOF 3FKIH 4FXKC 2PZWA 3S2HH 1Q1EA 4R1JA 1ZEQX 3QOJA 2WACA 4A3KH 4DK0A 2CCZA 4JVZA 4EQPA 1LLRD 2OT2A 4IUNA 4K5XA 4HJ8A 1RD9D 1JC7A 5K36H 1Y8NB 3M3YH 1YJWA 4H13C 5FLXL 3PO3G 4OO1H 3F2UA 1GO3E 1SMXA 3I4NB 5EQ0A 1GOZA 2PYKA 3PO2H 4RGOS 1PZKD 3PF5A 3D4DA 2D5DA 3D4WA 1D1KA 1WTRA 3NTIA 4TKOB 5IWAQ 2BCOA 3I4MB 4EX5A 1XTCD 1L1OB 4JOIA 2UXCL 1CI3M 4JI7L 4L5RC 3ERSX 3MFGA 3NELA 4J1MA 2E8GA 3QIAA 1KNAA 1QZGA 3R8BA 1K83B 3NXWA 3A55A 1XNQQ 1X6OA 5M3MG 3HRZC 4X64L 3MC0B 4IFDG 1TWCB 4IZ8A 4AQYQ 1GUWA 1TWHH 1IBML 4DPGA 1BUVT 3SHLA 2BA0A 3MAQA 1B9MA 2WAQG 2B2WC 3NE5B 2QA4A 3NSWA 4A3BG 3W1BA 1FYCA 2UUAL 1XX8A 4DV5Q 3A0JA 4DR7L 2FXQA 1SJHD 3S1RH 2NVQB 1JOOA 1GHKA 2KENA 1ASYA 3CKIB 5HGTA 2JA7B 3PF4A 1SNOA 3J7A5 2AQ3B 2WIIB 1JE5A 3I7FA 1R9TB 4V0BA 2F3VA 4KN7C 2ZXPA 2B2YC 3U50C 4AYBG 4L5SA 3I2ZA 2RVLA 3VR3A 4B3TQ 1IBKL 5CV8A 5DM73 5IGDA 2UU9L 1KL9A 3WDNA 1EFID 3J7AV 4YWMA 1L0YB 1EQTA 3RZOH 4C56C 1DOKA 3J7YW 3HGBA 5GQOA 5IP7H 3VR5A 4RWSC 2I0QA 3L3OC 1NR2A 4JW0A 2N55A 1QVCA 3NQTA 3C1EA 1EOVA 5L37A 3HOZB 3H0GG 1JCKB 3CHBD 1EIFA 1NSNS 2RSNA 4XT1B 3Q8DA 4GKJQ 2RSOA 1Z7TA 1KRTA 1TR5A 4FO2A 3TQYA 5C4XH 2F4VL 1VQIA 3MA2B 3S17H 2IWHA 2Z8LA 2PPBC 3RMHA 5J22A 1RIPA 3E9IA 3OW7A 1JJGA 3SK8A 2LXKA 1EYDA 2AQ2B 5M5WB 1EY0A 4K5WA 4QB4A 2ENBA 1ILQA 2A68C 2UXDL 1G8ZD 1SMYC 3URYA 4K8JA 1CQVA 1PH3A 4B3SL 3H0GB 1RF2D 3IL8A 1PTOB 4BY1H 4QUCA 3TP7A 1FNUA 5KRUA 3OHXC 4O2DA 4P2CB 2Q2IA 5K5PA 1SYCA 1WOCA 3CAMA 2ALYB 4PMBA 4LAAA 4OWTB 1WTPA 3BVZA 3PCOB 1PFSA 1B70B 1D5MC 3KDFA 5DAUA 2DJGC 3D0FA 5C0XG 2MJ8A 3VA5A 1I50B 2RKSA 3IKJA 3H6MA 1IZ6A 5E1FA 2KHJA 1EYGA 2VNUD 1T5XD 3CQZH 1WCMG 1G2SA 4RGMA 2PO4A 2QW7A 4HR7B 1H9MA 4JC0A 1HA5A 2J7ZA 3K59A 4A3GH 1K73C 4LF9L 3NQIA 4LK1C 3CRKC 1NAPA 4M8AA 5LMUL 1G6PA 3STBC 4Q5VA 5LMNL 4GOPA 2M00A 1N8RC 1BCPD 3R2TA 1S5ED 3I8ZA 5FO9B 1OXSC 1PA6A 1AE3A 1WVLA 3BU2A 1U4MA 4I7AA 2AKWB 4G7HC 2HQLA 4KKTA 4MIUA 2N3SA 3RLFA 1Q8KA 1F9PA 1HZCA 1ESFA 2JA5G 2K05A 3HOUG 1SE4A 1SXTA 2AUJD 4KHZA 3S15H 3Q22A 4GLVB 3T1YQ 2JA6B 2EQSA 3VYRA 1HNWQ 3P7JA 1E1OA 2VS1A 2RCNA 4P74A 1W6JA 1JORA 3CXCA 2RDFA 4JPBW 1EOTA 4JI6L 3KBXA 1PH7A 3Q0AA 1VF5C 1BBUA 2D9UA 3W5OA 4YY3L 1HJPA 1DYQA 4KD3A 1KXLA 1TQOA 2R93G 1FJGQ 4G57A 3DWPA 1NNXA 3HOYG 3HOUB 4G7ZC 1LO5D 2M9VA 3I4LA 1VQBA 3LNNA 5H1SE 3TP6A 4CKEA 4QJFA 1A2UA 1HQRD 2A74C 4ZAIA 4QY7A 2E2HH 1DGSA 3E0JA 1HTLD 1PFBA 1ZYRC 1UEBA 4DAVA 1SR3A 1OXTA 1GD7A 1STAA 4MNOA 5KYIA 1NCVA 1RL2A 4A3EG 4J15A 3I3CA 1XPUA 5IIFA 2F0TA 4A3CH 1WI5A 4C1NK 5TSSA 3DM1A 1YZ6A 5IYBH 3TREA 1SYBA 4QGUA 3A56A 2R93B 5HGQA 1VQDA 3I72A 4ODGA 1R4QB 1PRTD 1I4GA 1BBWA 2VY3A 1LTID 3K0XA 4DR5L 4LFAQ 2SDFA 1SE3A 1V1PA 5EPKA 5IT9c 4N9TA 3I55A 3NWTA 1JOQA 3RZDB 2D62A 3M7GA 2PQAB 3PQIA 4KK7A 3FRPB 3RN5A 2B63H 3U4VA 1N32Q 4O42A 1B50A 4OONA 4K0KL 2CWPA 4C2MB 1HR0W 2KBNA 2G9HD 1F2YA 1EZ8A 1MBYA 2NVTH 4R4IA 2VQFQ 1SDFA 3UDXA 4B3MQ 4HN7A 1A62A 4OX9Q 5M9OA 4GN3B 1KD1C 3B6YA 3KLSX 2VUMB 2MPMA 2G9DA 2NVXH 4IFDI 1JE4A 3CCUA 1Z6HA 1CA6A 3RUZA 1CKNB 4HJ9A 1KC8C 1D6EC 2JE6I 5GAHC 2B2WA 2RF4A 1Y14B 3MXGA 2UUCQ 3S1NH 1STHA 4IJLA 5M5XH 1Y1WB 3M4PA 1DXMA 2JA5H 1EYAA 1G6ZA 2LKVA 3E0EA 1BVSA 1QNKA 4A3FH 5EAYA 4RKBA 4YCWA 1I6VC 4LFBL 3UE0A 1LYLA 4PZ7A 5C44G 4DNTB 1IYVA 2A69D 2GN5A 2F0QA 2F3WA 3QB3A 4MN3A 3I56A 3R2IA 1O7LA 1TIID 4LF6L 3FPUB 1KHIA 4DV2Q 2B2YA 2SNMA 1VCIA 3GP7A 1CKNA 4A3MH 1CTMA 2I46A 2D0PA 2N49A 3OWEB 1ENAA 1CSPA 2IL8A 4G4KA 2CHBD 1JB7A 3K6OA 3ULPA 3HOYH 4DNIA 1SRUA 2HHHL 3EVQA 2L4NA 1HZBA 3EFXD 3F2DA 1SNDA 2EY5A 2R7ZH 2XWBB 2SNSA 3FVQA 5C44B 2IHFA 5ELOA 2HUGA 3L2PA 4JK1C 2DY7A 1Q7YC 1SAPA 2XVSA 2H5XA 3EN2A 1O78A 1E3PA 1G51A 4A3EH 2R7DA 1YIJA 4JI4Q 4JI0Q 3MXUA 3J81L 2ZM6Q 3M4OH 1J5EL 1IL8A 3OW2A 2B8GA 4NXNL 3GTKB 3JC66 3ULLA 5C3WA 4YHHQ 1BNZA 1EY4A 1FNWA 3T53B 1IBLL 5CV7A 2PW7A 4A3JB 4XIGS 1HNXQ 2L12A 3MHBA 2LFNA 4KKSA 3RLNA 1KIXA 3HKZG 2CWAA 3M9BA 1PH5A 1LACA 4KY6A 1XTDA 4DA2A 3AFPA 1QG7A 2KCCA 1X3FA 4QCLA 4C3IH 3J7ZC 4IOCA 4A3DG 2UXBQ 5EBCA 3K80C 5JJIA 4DV7Q 3MTSA 1IXRA 3TRZA 4HIKA 3VYTA 2Y0SE 4Y7NB 1ET6A 3OIQA 1MJCA 5JJLA 3RLOA 5FJ8G 5C5MA 5J3BA 3IFDA 4OIKA 2ATWA 2JXMB 4O0AA 2F0DA 1K3RA 3GTQB 3CPWA 2EDGA 2PMZB 3DEOA 4WJWA 3K81C 3L0OA 1TWAH 1XNRQ 2N8NA 1L2FA 5GROA 4PQXA 1PH2A 2E5LQ 5C3XA 3NPPA 3MWYW 3J81i 3I91A 1Y69U 1OO9B 2BE5D 1YHBA 3FKIG 2ZTEA 2K03A 3ULJA 4U673 2KECA 4RHRA 4A3KG 1PLFA 4HMIA 2K4KA 4PZ6A 4GNXC 1CA5A 3TS2A 1RDPD 5C4JH 2K7VA 3SK6A 2FHTA 1AZQA 1JR0D 4X66Q 3KOJA 2NN6G 2K33A 1QWYA 1A3VA 2EY1A 4OO1G 1N34Q 2XRQD 2N78A 2ZT9C 4N8FA 2F0JA 1MD2D 1VQHA 3U58A 5E4XA 3S1MH 3PO2G 3MFYA 2OQ0A 3A5ZB 2E2IB 4Q0FA 1L0WA 5CV5A 4QUFA 1E2ZA 3CRLC 3S2HB 1WJJA 1C8CA 1S72A 1TXYA 3VDYA 1JWUD 3BVGA 3M3YB 2CFMA 4DR6L 1BCPC 3HOWH 5F2DA 4DR1L 3KYHC 2K28A 4OWWB 3NK9A 2PI2E 4LW1A 4FYDA 5M3FH 2CQOA 1LTLA 3BVMA 4A3LH 4IPGA 1CKMA 4J8QA 4HEDA 1TS5A 2CVRA 1MJEA 2EYHA 4UAIA 1CK1A 3RR5A 3JAME 2CQAA 2VZAA 1A15A 3E6ZX 1YHQA 1V43A 2F0MA 4DUZQ 4A3DH 4PMCA 2PCFB 4WFN3 3I4OA 4NB3A 4DR4Q 4FF2A 3GTGH 4DV6Q 4YIJA 1XMQL 4C3JH 2UUBQ 1HA6A 2EY2A 5FJ8H 3NHHA 1GJXA 5E7NA
chains in the Genus database with same CATH topology
2B2VC 3FMCA 3QOLA 1IKMA 1UEAB 2F0WA 2IPKD 1SNQA 3OOCA 3ND8A 2AWOA 3QJYA 2B2TC 4M1UB 1JICA 1HHVA 3BYYB 3DEPA 1WTVA 4RH6A 2NBFA 2ZXOA 1J8IA 4LMQD 1DONA 2DNEA 2H1EA 2D2CC 5BN3A 2A6HD 1Q3LA 4BY7B 1AN8A 1KABA 3CU7A 4FVMA 2V4DA 2BOSA 3DUZA 5KGUA 1PRTC 4IQZA 1OXUA 2DY8A 2KVMA 2NN6H 3L9AX 2FFKB 1V8QA 3BYTB 5A35A 1EEFD 3ITPA 2X69A 4R8NA 1YNJD 1E2VA 3SK5A 3SXHA 1PYWD 5IGCA 4FF3A 1U4PA 5I4DA 1NUCA 2KJXA 2IT1A 4CHTB 2JEAI 2QCPX 5IOCA 3RD4A 5A2QE 4IUVA 3NP8A 5G3LF 3M7NA 3PO3B 1VF7A 1CM9A 1SBBB 2F0VA 3FDTA 4F8MA 1DZ1A 1RODA 1RJTA 2F0LA 1EY6A 1TKWB 5J39A 4BY1B 4EVOA 5IT9L 1F2LA 4RA8A 1LV9A 2RA4A 2FINB 1SSOA 2A69C 1S5CD 3WOFA 1U4LA 4XT3B 1B9NA 5M3MB 3X3MA 3MXNA 2FMCA 1SJED 2EJFC 1DOLA 3BDLA 4XQNA 5ISRA 1LTTD 4G7OC 2WAQB 3AU7A 1IYUA 1TWGB 4A3BB 1RTNA 2QEJC 5DM63 1S5FD 3D8GA 4XYQA 2L55A 3C1FA 1SNMA 3HP3A 3GQBA 1BXTA 1HTPA 2JYOA 3H94A 2WB1B 3PUYA 4IUPA 3D4RA 2PZTA 1F2ZA 4C3HG 2EXZA 1Z47A 2EOTA 4AYBB 5CC4A 4QMGA 4K8IA 5I2XA 3TSSA 4K14A 3S15B 2EYLA 4NMZA 5CORA 4H0LC 3X3NA 3D6CA 1AZPA 2EYJA 3KK7A 1G291 5ELCA 1HCZA 4NKLA 1Y8OB 4NW2A 2E75C 1ZKOA 2MHVA 1F77A 1FGBD 4IN3A 1H9SA 4PMWA 5EPLA 3K7AB 3D31A 5FO8B 2ID0A 3EA6A 1I4PA 2NYZD 3PIO3 1KDAA 4BA1I 2NTTA 1HPCA 3NBHA 4OGQC 3SE0A 3OMCA 1F9SA 2PZUA 5IGBA 2KHSA 4FXDA 1X3PA 1S4ZA 2BE5C 3KBGA 3TBIB 3TDQA 1RKNA 3QG1A 1A6XA 1FNVA 2E76C 3MEHA 4RCOA 3AMUA 4MHEA 1FD7D 2XN9C 3U9OA 1PTOD 1WCMB 4HSPA 4JBWA 2LY7A 1GUTA 4IUQA 4TQUS 1EY8A 3O13A 3GV6A 1ONLA 2RDGA 1RHPA 4ILWA 4XQQA 1CT1D 2F03A 2NVXB 1WD0A 4HSVA 1YNND 1AFPA 2B2VA 4RKLA 1EU4A 2B2UC 3S1NB 1Q90A 4DAPA 2JA5B 4KI0A 5JEAJ 2F0EA 1CHQD 4A3FB 2RBMA 4FNFA 2B2TA 4CJ2C 3C2PA 5CBEE 1STNA 1V1PB 1VMCA 3TN2A 1TY0A 3BG3A 3K57A 1PTOH 1O7YA 4ZLTF 3G7LA 4WRDA 1E2WA 3W2DA 4EQOA 1KDCA 2PNRC 3BZDB 1SYEA 1PZJD 5FOBB 5JPNC 3HOYB 1W6KA 4KN4C 1ESRA 5JPMC 4DFAA 1FR3A 4C3IG 3PMFA 2IX0A 1Y8PB 4A3EB 3DHQA 3OMGA 4RGNA 5EKIA 1SNPA 2KUMA 5NUCA 3J7AF 2A6HC 2F1MA 1TT2A 2XSCA 3GTMB 3Q23A 2JEBI 1HUMA 4ZQ3A 4B9WA 3GO5A 1C4QA 4DAYA 2NVYB 3OPOA 4V190 1GUNA 1T5EA 3T16A 1GUOA 1H9JA 4KJNA 3HEJA 1EY9A 1YNJC 3AB9A 5CR3A 2PW5A 1K8OA 1ICWA 4XQJA 3V05A 5C4ZA 1OXVA 2PQEA 1EWHA 1BDOA 4B08A 1TWFB 1DM0B 1U4RA 1PMRA 1CZWA 1EU3A 1XYIA 1E0BA 1MI2A 4IURA 3M85A 1WTXA 2R61A 2EYPA 4U68A 4FP5D 1V1OA 1WD1A 2BA1A 3EQLC 1DD2A 3KUPA 2B8FA 1G91A 1IW7D 3IAYA 4O1NA 2NWGA 1UAPA 2O2LD 1O7ZA 2RQXA 4KD4A 3S1MB 3GV3A 5LHY1 2O5JC 5JVG3 1XWEA 1BF4A 4RCNA 3J80E 4I65A 2IW3A 1TS4A 4XDXA 4IFDJ 5CV9A 3W3AA 2HDLA 3HOWB 2OEOA 1C48A 1STEA 4LJZC 4ZKBB 1I3QB 4C3JG 3V2TA 5M3FB 3S1QB 4L63B 1A3UA 2R3ZA 2KEDA 2H4OA 4RFBA 3DWAA 1KAAA 5DEHA 2QF7A 2EJMA 3HKZB 5EJWA 3SVMA 5C0XI 1HRJA 2DN8A 4A3DB 2XWJB 4QIWB 1D5XC 3FEWX 4IUUA 5D3DA 3GTGB 2EJGC 2IJ0A 3DWQA 4C3JB 1IHZA 3VYUA 3PUWA 3H91A 5C4HA 1G2TA 5IGGA 5ELEA 1EYCA 4X3SA 5DNFA 1QE6A 3NTHA 1ENCA 4ZUIA 1CQFA 1F9QA 4CKCA 4F88A 1SNCA 2Z1CA 3T13A 1SYFA 4L6TB 3S2DB 4FXGC 2L1BA 2K32A 1D5ZC 5BN4A 3FKIB 1DCZA 4EQNA 1EIGA 2FMMA 3GD7A 5JEAG 2A6ED 1H9RA 4A3KB 5FLXE 2M2LA 1I4HA 3QO2A 5KEEA 2L11A 5JAVA 2QILA 4F7XA 1RCVD 2K5DA 4DU9A 2BDNA 3WOEA 2WV6D 5ELDA 1KLUD 2EZVA 1MSHA 3PO2B 2B2UA 2C5CA 4EGVA 3BDCA 4GZYC 1BR9A 1PTOC 5M5YB 2VB2X 2F0GA 3IFTA 2E74C 1STBA 3SK4A 4K2LA 1EL0A 3TZDA 1LTRD 4DXFA 3I90A 4ZRZA 1A3TA 2N88A 1JOKA 3A7AB 2J4XA 1LT3D 2C9OA 4RHSA 1YNNC 1IKLA 1LTGD 4ZK9B 3A54A 3MVVA 3E5SA 3NWSA 5FO7B 1TWHB 5CBAE 5FKAC 1LTAD 5ELBA 3I73A 3V96A 5BN5A 3DXJC 2R92B 4CJ0B 3S1RB 4R9WA 3VA7A 1SEBD 2K5QA 2HDMA 2MUYA 1F2MA 3K5OA 2XNAC 2L5TA 3KLSA 1BCPF 2E2DC 2Q8IB 2B39A 2OXPA 1L0XB 2F0HA 3RZOB 2DNCA 3N6RA 4A93B 4FF4A 2EE1A 1JWMD 1QB5D 1PFNA 3P75A 3LX0A 1M4VA 4NP5A 4X3KA 2MGSA 1X3QA 4QF4A 5JEAH 5C4XB 2IX1A 3S17B 1GUGA 2K6AA 1ET9A 5I6YA 2EYFA 3P20A 4OHJA 5EKKA 3T56B 2XIWA 5EBDA 3MXPA 2ICIA 1X32A 4TRDA 2SOBA 2HQEA 3GTJB 3HOVB 3HS0C 4UDUC 1DOMA 2IX3A 4R8IA 4CJ1B 2I07B 3ONAB 3JAML 1LT4D 1B4OA 3A8KE 3BDOA 2CW0D 3VR2A 3EJIA 5KYLA 4J6HA 5D14A 1F9RA 3UI2A 1ENFA 1PRTF 2EVBA 5FK9C 3CQZB 4Z9CB 2EYMA 2HCCA 1LT6D 2Q8TA 4K6DA 4A3GB 1EY5A 2AWNA 4DXGA 1QJOA 3H3VC 2K01A 1IW7C 5IGFA 1H9SB 3N52A 4K5VA 2Z4HA 2QKIC 1GUSA 3OIPA 3PV0A 4HTHA 3P1HA 4L8JA 3LWUA 5EKLA 4KJOA 1QCBD 1HFGA 5CYUA 5LL6X 5I9PA 4KHVA 4WORA 4BA2I 4ULLA 4DN4M 5IODA 1EY7A 4C3HB 2LS01 2WKDA 1BO0A 1JB3A 2FJ2A 1BCPB 5A2QL 2NN6I 4NDXA 4OO1I 2E2HB 5KNCA 2VXWA 1LT5D 2NB0A 5JVH3 4H7BA 2NTSA 3SEBA 1PXUA 2XRSD 2QDBA 3FPPA 3KLRA 2LMCB 4C1NI 4OIJA 1LTBD 1TY2A 3EROA 3PUZA 4HCEA 1S5BD 4IFDH 1MSGA 1ILPA 1TS3A 2MP1A 3T51B 1K8MA 2EYOA 3OWFA 2HCIA 5CV4A 1LTSD 5C3EB 2B63B 1AW7A 1I4RA 3Q6SA 3A8IE 2TSSA 2A6EC 4ME5A 3R93A 2NVTB 5CGKA 1QNUA 5I2YA 5D3IB 1SYGA 4KV6A 5IGEA 1Q8IA 1WTOA 2AUKA 2EPBA 1HUNA 2A5HA 4CKBA 4ZUJA 3TMEA 5M5XB 3S9WA 5KNDA 4PV1C 1I6HB 1PRTB 1JQYD 3NTKA 1R4PB 1CZGA 1AP0A 3QWNA 1EIHA 4IUTA 5G3LD 1WTQA 2F0NA 5LL6S 4OL7A 5EPJA 3NBIA 4X3TA 3NUCA 1STYA 5AFWA 1O80A 4A3MB 3VYSA 1KLGD 2WP8J 2A73B 5D65A 4S3SA 1BOSA 1TS2A 1UUPA 2R7ZB 1EEID 2K1BA 2K5WA 3J81E 2O4XA 1OXXK 1PZID 1QILA 4KMUC 2F0PA 2F0FA 2RDHA 4F87A 3M4OB 3C3LA 1GXDC 1B1ZA 2KEEA 3A8JE 5KIXA 1B2TA 4XTCS 2F4IA 2NZ1D 4ABNA 5C0XH 3S16B 1A2TA 4A3IB 2Y0SB 3PIP3 4C3IB 3SDZA 1RTOA 5JJZA 4RGTA 3TP8A 1JWSD 3C46A 2X6GA 4HCSA 2KCNA 4BS9A 2WINB 3K0YA 3SR1A 1HFNA 4E6IA 3Q24A 4K2KA 1VDZA 2J0TD 1TWAB 4RAUC 1KNEA 5C6AA 2R6GA 1UNSA 1Q12A 3H09A 3K5MA 2WKCA 1H9KA 1EQVA 5C4JB 2ICEC 1CHPD 5CV6A 4N9PA 2CW0C 4XXEA 2YYZA 3G6JB 3HZXA 4HMJA 1M8AA 5I6WA 1TU2B 2AQ1B 5JOBA 1I4XA 4CBVA 1HXYD 2L9HA 3ERQA 2F0KA 2O5IC 3VR6A 3TP5A 2KOLA 3PUXA 1KDBA 3GTOB 3HG9A 1PFMA 3I70A 1LABA 1EZ6A 4B9XA 1CFMA 1XXGA 4BWGB 1EWCA 2EY6A 2OF1A 2A68D 1SMYD 2VB3X 4XYOA 3K5LA 3DMUA 5T1IA 3BS1A 2GA4B 5EGTA 4DNRB 3OSOA 3A7LA 3LWEA 1S5DD 4KY5A 1WTWA 1TVXA 1Q1BA 3VR4A 3ND9A 2Z4IA 2SEBD 5J1ZA 1VMPA 4DK1A 2NUCA 5COYA 1MGSA 1U9RA 3TZUA 4K6LA 1GHJA 3KF8A 1I4QA 1ZXTA 5KNBA 2K04A 5K36G 4PNYA 5HURA 4ZKCB 5I9OA 3U9SA 1J9OA 4ID6A 2KQ3A 2Q8RE 1II3A 2JA8B 4ZYSA 4FF1A 4H44C 1DJRD 3D6WA 1B3AA 3PUVA 3T4AC 5E4WC 1Y1VB 4X3UA 3M4YA 1AEXA 4KTAA 4DGZA 3J80L 2ZXRA 1QOHA 2F0OA 3MZ5A 4TSSA 5C0XJ 1B53A 1SYDA 2X6LA 4KKUA 1BQQT 1STGA 4CGYB 4I7ZC 2JSOA 3S14B 3R3OA 5IT9E 5ELFA 1HQMC 1D1IA 4BBRB 4DF7A 1ZYRD 3K58A 5E3FA 2BDOA 2F0SA 1ML0D 1NR4A 1SE2A 1BBXC 5C5LA 3GTLB 1B44D 3HOXB 2E2JB 2TMPA 2JP1A 2L0CA 2YU9B 2F0IA 3K5NA 3GTPB 4IALA 4KY7A 3L7ZC 1KTKA 5CMDA 4HAEA 5T1GA 4BBSB 3D3RA 2KA7A 1D2BA 1SFOB 2F0UA 1PDQA 3ZYYX 1PTOF 4FXKC 2PZWA 1Q1EA 1ZEQX 2WACA 3QOJA 4DK0A 4EQPA 1LLRD 2OT2A 4IUNA 4K5XA 5K36H 1RD9D 1JC7A 1Y8NB 4H13C 5FLXL 4OO1H 3F2UA 3I4NB 5EQ0A 1GOZA 2PYKA 4RGOS 1PZKD 3D4DA 2D5DA 3D4WA 1D1KA 1WTRA 3NTIA 4TKOB 3I4MB 2BCOA 1XTCD 1CI3M 3MFGA 4J1MA 3QIAA 1KNAA 3R8BA 1K83B 3NXWA 3A55A 3HRZC 3MC0B 4IFDG 1TWCB 4IZ8A 1GUWA 1BUVT 3SHLA 2BA0A 3MAQA 1B9MA 2B2WC 3NE5B 3NSWA 1FYCA 1XX8A 1SJHD 2NVQB 1JOOA 1GHKA 3CKIB 5HGTA 2JA7B 1SNOA 2AQ3B 2WIIB 1R9TB 4V0BA 2F3VA 4KN7C 2ZXPA 2B2YC 2RVLA 3VR3A 5CV8A 5DM73 5IGDA 3WDNA 1EFID 3J7AV 1L0YB 1EQTA 4C56C 1DOKA 3J7YW 3HGBA 3VR5A 4RWSC 3L3OC 1NR2A 2N55A 3NQTA 3C1EA 3HOZB 1JCKB 3CHBD 1NSNS 2RSNA 4XT1B 2RSOA 1Z7TA 1TR5A 4FO2A 3MA2B 2IWHA 2Z8LA 2PPBC 3RMHA 5J22A 3OW7A 3SK8A 1EYDA 2AQ2B 5M5WB 1EY0A 4K5WA 4QB4A 2ENBA 1ILQA 2A68C 1G8ZD 1SMYC 3URYA 4K8JA 1CQVA 3H0GB 1RF2D 3IL8A 1PTOB 4QUCA 3TP7A 1FNUA 5KRUA 3OHXC 4P2CB 5K5PA 1SYCA 4PMBA 4LAAA 1WTPA 3BVZA 1D5MC 5DAUA 5C0XG 2MJ8A 3VA5A 1I50B 2RKSA 3IKJA 3H6MA 2VNUD 5E1FA 1T5XD 4RGMA 1G2SA 2PO4A 4HR7B 1H9MA 1HA5A 2J7ZA 3K59A 3NQIA 4LK1C 3CRKC 1NAPA 4M8AA 4Q5VA 2M00A 1BCPD 3R2TA 1S5ED 3I8ZA 5FO9B 1OXSC 1WVLA 1U4MA 4G7HC 4KKTA 4MIUA 3RLFA 1F9PA 1ESFA 2K05A 1SE4A 1SXTA 2AUJD 4KHZA 3Q22A 2JA6B 3VYRA 3P7JA 1JORA 1W6JA 2RDFA 1EOTA 3KBXA 3Q0AA 1VF5C 2D9UA 1DYQA 4KD3A 1TQOA 4G57A 3DWPA 3HOUB 4G7ZC 1LO5D 2M9VA 3I4LA 3LNNA 3TP6A 4CKEA 1A2UA 1HQRD 2A74C 4ZAIA 3E0JA 1HTLD 1PFBA 1ZYRC 4DAVA 1OXTA 5KYIA 1STAA 1NCVA 3I3CA 5IIFA 2F0TA 4C1NK 5TSSA 3DM1A 1SYBA 3A56A 2R93B 3I72A 4ODGA 1R4QB 1PRTD 1I4GA 1LTID 2SDFA 1SE3A 1V1PA 5EPKA 4N9TA 3NWTA 1JOQA 3RZDB 2D62A 3M7GA 4KK7A 3FRPB 4O42A 1B50A 4C2MB 2G9HD 1F2YA 1EZ8A 1MBYA 1SDFA 4HN7A 5M9OA 3KLSX 2VUMB 2MPMA 2G9DA 4IFDI 1JE4A 1Z6HA 1CA6A 3RUZA 1D6EC 2JE6I 2B2WA 3MXGA 1STHA 1Y1WB 1DXMA 1G6ZA 1EYAA 2LKVA 1QNKA 4RKBA 1I6VC 4DNTB 1IYVA 2A69D 2F0QA 2F3WA 3QB3A 4MN3A 3R2IA 1O7LA 1TIID 3FPUB 2B2YA 2SNMA 1VCIA 3GP7A 1CTMA 2I46A 3OWEB 1ENAA 2IL8A 4G4KA 2CHBD 3K6OA 3EVQA 2L4NA 3EFXD 1SNDA 2EY5A 2XWBB 2SNSA 3FVQA 5C44B 2HUGA 4JK1C 2DY7A 1SAPA 2XVSA 1O78A 3MXUA 3J81L 1IL8A 2B8GA 3GTKB 5C3WA 1BNZA 1EY4A 1FNWA 3T53B 5CV7A 2PW7A 4A3JB 4XIGS 2L12A 3MHBA 2LFNA 4KKSA 1LACA 4KY6A 4DA2A 1QG7A 2KCCA 4QCLA 5EBCA 3MTSA 3VYTA 4Y7NB 1ET6A 3OIQA 5C5MA 3IFDA 4OIKA 2JXMB 2F0DA 3GTQB 2EDGA 2PMZB 3DEOA 4WJWA 4PQXA 5C3XA 3NPPA 3MWYW 1Y69U 3I91A 1OO9B 2BE5D 2K03A 4U673 2KECA 4RHRA 1PLFA 4HMIA 1CA5A 1RDPD 2K7VA 3SK6A 2FHTA 1AZQA 1JR0D 2NN6G 2K33A 1QWYA 1A3VA 2EY1A 4OO1G 2XRQD 2ZT9C 2F0JA 1MD2D 5E4XA 3MFYA 2E2IB 4Q0FA 5CV5A 4QUFA 1E2ZA 3CRLC 3S2HB 1C8CA 1JWUD 3BVGA 3M3YB 1BCPC 5F2DA 2K28A 3NK9A 4FYDA 3BVMA 4J8QA 4HEDA 1TS5A 2CVRA 2EYHA 4UAIA 1CK1A 3JAME 2CQAA 1A15A 3E6ZX 1V43A 2F0MA 4PMCA 2PCFB 4WFN3 4FF2A 4YIJA 1HA6A 2EY2A 3NHHA 1GJXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WAC A;  1STB A;  3QOJ A;  3QOL A;  4N9P A;  4NDX A;  1STH A;  1TT2 A;  3MEH A;  3NQT A;  3MXP A;  2F0W A;  3C1E A;  3BDL A;  1EYA A;  2OEO A;  4K2L A;  4TRD A;  3SK4 A;  2LKV A;  4EQP A;  2SOB A;  4ZQ3 A;  4ID6 A;  4IUN A;  4K5X A;  5ISR A;  1NSN S;  2KQ3 A;  3HZX A;  1SNQ A;  4S3S A;  2HQE A;  1II3 A;  4RKB A;  4B9W A;  4H7B A;  4HMJ A;  5C3X A;  1JOR A;  1TR5 A;  3V2T A;  3U9O A;  2RDF A;  5I6W A;  1A3T A;  2QDB A;  1JOK A;  5J22 A;  1A3U A;  5JOB A;  2F0Q A;  2F3W A;  3QB3 A;  2O4X A;  2PYK A;  4HMI A;  3D8G A;  3T16 A;  3C1F A;  1SNM A;  3ERQ A;  4KD3 A;  1TQO A;  3D4D A;  2F0K A;  3MVV A;  3E5S A;  3SK8 A;  1KAA A;  3D4W A;  1EYD A;  4G57 A;  5DEH A;  3SK6 A;  3TP5 A;  2F0P A;  1EY0 A;  2SNM A;  4KJN A;  1EY8 A;  2F0F A;  3HEJ A;  4K5W A;  1EY9 A;  1KDB A;  2ENB A;  3ERO A;  4QB4 A;  1ENA A;  3TP6 A;  3EJI A;  5KYL A;  1A3V A;  1KAB A;  4J6H A;  1A2U A;  1AEX A;  2EY1 A;  4KTA A;  5CR3 A;  2PZT A;  2PW5 A;  4DGZ A;  1EZ6 A;  4B9X A;  2F0J A;  1F2Z A;  4K8J A;  5KGU A;  5KIX A;  4J1M A;  2F0O A;  2EYM A;  2EXZ A;  3MZ5 A;  3EVQ A;  5KYI A;  1STA A;  1SYD A;  4K6D A;  4QMG A;  1SND A;  2EY6 A;  3TP7 A;  5CC4 A;  3NXW A;  1IHZ A;  5KRU A;  2EY5 A;  2EYO A;  4K8I A;  1STG A;  5CV5 A;  5C4Z A;  2SNS A;  3OWF A;  4K14 A;  5C4H A;  1EY5 A;  5IGG A;  2F0T A;  5CV4 A;  1A2T A;  5IIF A;  2EYL A;  4NMZ A;  4RKL A;  5K5P A;  1SYC A;  2OF1 A;  1EYC A;  4IZ8 A;  3ITP A;  1SYB A;  3R3O A;  4PMB A;  3D6C A;  4LAA A;  4R8N A;  2PQE A;  3SK5 A;  1F2M A;  3SXH A;  5IGC A;  2EYJ A;  2F0E A;  1ENC A;  4DF7 A;  4ZUI A;  1NUC A;  4ME5 A;  2RBM A;  4ODG A;  5CGK A;  4NKL A;  3SHL A;  5DAU A;  1SNC A;  5NUC A;  3TP8 A;  5IGF A;  1STN A;  3T13 A;  1SYF A;  3DMU A;  4K5V A;  5E3F A;  5F2D A;  3VA5 A;  5CV9 A;  2OXP A;  2RKS A;  2F0S A;  5IOC A;  3H6M A;  5C3W A;  5E1F A;  1EY4 A;  1SYG A;  2F0H A;  5EGT A;  3NK9 A;  3NP8 A;  5CV7 A;  2PW7 A;  4N9T A;  4KV6 A;  3OSO A;  5C5L A;  3MHB A;  4HTH A;  5IGE A;  3P1H A;  4WRD A;  2EYP A;  1JOO A;  3SR1 A;  4KY5 A;  4EQN A;  1JOQ A;  2F0V A;  4E6I A;  1KDC A;  3P75 A;  5EKL A;  4EQO A;  4K2K A;  4KJO A;  3LX0 A;  4KY6 A;  2F0I A;  4ZUJ A;  4F8M A;  5HGT A;  3TME A;  1SNO A;  1SYE A;  5KEE A;  3S9W A;  2F0L A;  1KDA A;  4IAL A;  5JAV A;  2EYH A;  2M00 A;  5I9P A;  4KHV A;  4NP5 A;  4KY7 A;  4F7X A;  5C6A A;  4DU9 A;  2F3V A;  1EY6 A;  4WOR A;  5J1Z A;  1F2Y A;  4KD4 A;  1EZ8 A;  3OMC A;  4QF4 A;  5J39 A;  5CV8 A;  2F0M A;  2NUC A;  2PZU A;  5IGB A;  2KHS A;  5IOD A;  4EVO A;  5IGD A;  5M9O A;  4MIU A;  4PMC A;  4DFA A;  1EQV A;  1EY7 A;  5I6Y A;  2EYF A;  1U9R A;  5C5M A;  2F0N A;  3PMF A;  2F0U A;  4OL7 A;  4YIJ A;  3NUC A;  1STY A;  2F0D A;  3BDC A;  4I65 A;  1RKN A;  3DHQ A;  5EKK A;  3RUZ A;  2EY2 A;  3OMG A;  5CV6 A;  4PNY A;  5HUR A;  2PZW A;  5I9O A;  3NHH A;  1SNP A;  2F0G A; 
#chains in the Genus database with same CATH topology
 2B2V C;  3FMC A;  3QOL A;  4IPC A;  4B3R Q;  1IKM A;  1UEA B;  2F0W A;  3H3V I;  2IPK D;  4DR3 L;  1SNQ A;  3OOC A;  1FVI A;  4YWL A;  4A93 G;  3ND8 A;  2AWO A;  3QJY A;  2B2T C;  3CW2 C;  4M1U B;  5IP7 G;  3J80 i;  4ZCK A;  1JIC A;  1XPR A;  1HHV A;  3BYY B;  3DEP A;  1WTV A;  4RH6 A;  2NBF A;  2ZXO A;  1J8I A;  4LMQ D;  2Z6K C;  1DON A;  4AIM A;  2DNE A;  2H1E A;  2D2C C;  5BN3 A;  2A6H D;  3DLL A;  3W1G A;  1Q3L A;  4BY7 B;  5C4X G;  1AN8 A;  4L5Q A;  3F1Z A;  1KAB A;  3CU7 A;  3LGJ A;  5IP9 H;  2XGT A;  4FVM A;  2V4D A;  2BOS A;  3DUZ A;  5KGU A;  3E3X A;  1PRT C;  4IQZ A;  1OXU A;  2DY8 A;  2KVM A;  2NN6 H;  4DV4 L;  3L9A X;  4BXX G;  2FFK B;  1V8Q A;  2EIF A;  3BYT B;  5A35 A;  2NZH A;  1SE8 A;  1EEF D;  3ITP A;  2X69 A;  4R8N A;  1YNJ D;  1XMO L;  1E2V A;  3SK5 A;  3SXH A;  2UXC Q;  1PYW D;  5IGC A;  4FF3 A;  4JI7 Q;  1U4P A;  4JI5 L;  5M5Y H;  4JV5 L;  2XTI A;  5I4D A;  1NUC A;  2KJX A;  2IT1 A;  1A0I A;  1Y1V H;  4BY1 G;  4CHT B;  2JEA I;  3FP9 A;  2QCP X;  5IOC A;  3RD4 A;  5A2Q E;  4IUV A;  4X64 Q;  5ELN A;  3NP8 A;  5G3L F;  3M7N A;  3PO3 B;  1VF7 A;  1CM9 A;  2K5H A;  1SBB B;  2F0V A;  3FDT A;  4F8M A;  1IBM Q;  4ALP A;  1DZ1 A;  4GS3 A;  1ROD A;  1RJT A;  3S14 H;  2F0L A;  4BBR H;  1EY6 A;  2UUA Q;  1JJC B;  3A74 A;  1TKW B;  4DR7 Q;  5J39 A;  2PNH A;  4BY1 B;  2ZTD A;  2R92 H;  4EVO A;  4A3G G;  5IT9 L;  4LF7 L;  1F2L A;  4RA8 A;  1LV9 A;  2RA4 A;  2FIN B;  1VQ5 A;  1SSO A;  3EIV A;  3RN2 A;  2A69 C;  1S5C D;  3WOF A;  1U4L A;  4XT3 B;  1B9N A;  3HOX H;  5M3M B;  3X3M A;  2WB1 G;  3CCM A;  1LM0 A;  3MXN A;  2YU9 H;  2FMC A;  4OEM B;  1SJE D;  3GTP H;  1IBK Q;  2EJF C;  1DOL A;  3BDL A;  4XQN A;  5ISR A;  1LTT D;  2UU9 Q;  2Q2U A;  3CD6 A;  4G7O C;  3GDE A;  3PSI A;  2WAQ B;  1VQG A;  4BBS H;  3AU7 A;  1IYU A;  1TWG B;  1J6Q A;  1RTN A;  4A3B B;  2QEJ C;  4MTK A;  5DM6 3;  1S5F D;  1SFO H;  3D8G A;  4XYQ A;  2L55 A;  4A93 H;  3C1F A;  1SNM A;  3HP3 A;  3GQB A;  1BXT A;  1HTP A;  1S3O A;  3OTO L;  2JYO A;  3IRB A;  1KAW A;  3H94 A;  4APV A;  2WB1 B;  3PUY A;  1EQQ A;  4IUP A;  2GVB A;  3NEM A;  3D4R A;  2F4V Q;  2JQO A;  2PZT A;  4HJA A;  2ES2 A;  1F2Z A;  4C3H G;  2RHQ B;  2EXZ A;  1Z47 A;  2EOT A;  4AYB B;  5CC4 A;  4QMG A;  1NMF A;  4DV0 L;  4K8I A;  5I2X A;  3TSS A;  2A19 A;  4K14 A;  3KFU A;  3S15 B;  2EYL A;  4NMZ A;  5COR A;  4H0L C;  3X3N A;  3D6C A;  2UXD Q;  1AZP A;  4BXX H;  2EYJ A;  3KK7 A;  4YCU A;  3KDF B;  1G29 1;  4B3S Q;  5ELC A;  1HCZ A;  4NKL A;  1Y8O B;  4NW2 A;  2E75 C;  1EWI A;  1ZKO A;  2MHV A;  1F77 A;  1FGB D;  4IN3 A;  1H9S A;  4PMW A;  4A3C G;  5EPL A;  3GTJ H;  5IYB G;  4DV1 L;  4GNX A;  3HFZ B;  3K7A B;  3D31 A;  5FO8 B;  3HOV H;  2ID0 A;  1OTC A;  1K83 H;  3EA6 A;  1I4P A;  2NYZ D;  4GOP B;  1TWC H;  3PIO 3;  1KDA A;  4BA1 I;  2NTT A;  2HIV A;  1QZH A;  1HPC A;  3NBH A;  4OGQ C;  4LF8 L;  3SE0 A;  1X3E A;  3OMC A;  1F9S A;  1VQ7 A;  2PZU A;  5IGB A;  2KHS A;  2VQE L;  1UE7 A;  4FXD A;  1X3P A;  3PGZ A;  1S4Z A;  2B63 G;  2BE5 C;  4LF9 Q;  3CCE A;  4GN5 A;  1T9H A;  1D8L A;  5LMU Q;  3KBG A;  1YEZ A;  3TBI B;  3TDQ A;  1RKN A;  3QG1 A;  2GVA A;  5LMN Q;  1A6X A;  1FNV A;  2E76 C;  2P5Z X;  2JA7 H;  3K7U C;  3MEH A;  4RCO A;  1AH9 A;  2ZJR A;  1R9T H;  3AMU A;  4MHE A;  1VQP A;  1FD7 D;  2XN9 C;  4DK3 C;  3U9O A;  2HIX A;  4P75 A;  1B7Y B;  1N33 L;  1W2B A;  1PTO D;  1V9P A;  1WCM B;  4HSP A;  4JBW A;  3G71 A;  2F52 A;  2LY7 A;  1GUT A;  2AHO B;  1U5K A;  4A3F G;  4IUQ A;  4TQU S;  1EY8 A;  3O13 A;  1K8G A;  5GAG C;  3GV6 A;  1ONL A;  2RDG A;  4JI6 Q;  1RHP A;  4ILW A;  3HOZ H;  4XQQ A;  1CT1 D;  2F03 A;  1C7Y A;  1AE2 A;  4YY3 Q;  2NVX B;  1WD0 A;  2MO0 A;  4HSV A;  1YNN D;  4A3M G;  4C3H H;  1AFP A;  2QDL A;  2B2V A;  4RKL A;  1I94 L;  1EU4 A;  2QEX A;  2B2U C;  1K9M C;  3S1N B;  1Q90 A;  4DAP A;  1B8A A;  2JA5 B;  4KI0 A;  2YTY A;  2F0E A;  5JEA J;  1CHQ D;  4A3F B;  2RBM A;  4FNF A;  2B2T A;  4CJ2 C;  3C2P A;  3S24 A;  3CCJ A;  5CBE E;  1STN A;  2R7Z G;  1D7Q A;  4JI8 L;  2Q2T A;  3U4Z A;  2OCE A;  1V1P B;  1VMC A;  1PYB A;  3TN2 A;  4POG A;  5AJ3 L;  4KHP L;  1TY0 A;  2Z6K A;  3BG3 A;  3K57 A;  4DUY L;  1PTO H;  1HNZ L;  1O7Y A;  4ZLT F;  3G7L A;  4WRD A;  1E2W A;  4JI3 L;  3W2D A;  1KDC A;  4EQO A;  2PNR C;  3G4S A;  4LNQ A;  3BZD B;  1SYE A;  1HZ9 A;  1PZJ D;  5FOB B;  5JPN C;  4R4O A;  1YVC A;  1PH4 A;  3HOY B;  4DR5 Q;  1W6K A;  1VQJ A;  4KN4 C;  1ESR A;  4DAY B;  2B29 A;  1NBW A;  5JPM C;  4OEL B;  4DFA A;  1ICF B;  1I50 H;  4A3I G;  1FR3 A;  3T1H L;  4C3I G;  3PMF A;  2OTL A;  3JAM c;  3CC7 A;  2IX0 A;  1Y8P B;  4A3E B;  3DHQ A;  4K0K Q;  3OMG A;  4RGN A;  1UE6 A;  5EKI A;  1SNP A;  2KUM A;  3OYY A;  5NUC A;  5C3E H;  1VQ9 A;  3J7A F;  2A6H C;  2F1M A;  1TT2 A;  2XSC A;  2CH4 W;  3GTM B;  1PH6 A;  3Q23 A;  2JEB I;  1HUM A;  4ZQ3 A;  4B9W A;  3GO5 A;  4DV3 L;  1C4Q A;  4DAY A;  4JYA L;  2NVY B;  3OPO A;  1SLJ A;  4DK6 C;  4V19 0;  1GUN A;  1T5E A;  3T16 A;  1GUO A;  1H9J A;  3CME A;  4KJN A;  3HEJ A;  4NXM L;  1EY9 A;  2JA6 H;  1YNJ C;  2DGY A;  1H95 A;  3CCR A;  3AB9 A;  1PH1 A;  4LFB Q;  1I6H H;  5CR3 A;  1QVF A;  2PW5 A;  1K8O A;  1ICW A;  4XQJ A;  3PIO A;  4X65 L;  4GN4 B;  4LF6 Q;  3V05 A;  5C4Z A;  1OXV A;  4PG3 A;  1A63 A;  1X54 A;  2PQE A;  1EWH A;  1NMG A;  2F3I A;  2HT1 A;  1BDO A;  4B08 A;  3CP0 A;  1I5F A;  1TWF B;  2KHI A;  1DM0 B;  1U4R A;  2HHH Q;  1PMR A;  4HJ5 A;  2ZJQ A;  1X55 A;  1VQN A;  2DUD A;  1CZW A;  1EU3 A;  1XYI A;  1E0B A;  1MI2 A;  2G5D A;  4IUR A;  4DKA C;  3M85 A;  1WTX A;  2R61 A;  2EYP A;  4U68 A;  4FP5 D;  2YTV A;  1V1O A;  1WD1 A;  2BA1 A;  3EQL C;  1DD2 A;  2K75 A;  1Z9F A;  3KUP A;  2B8F A;  1G91 A;  3HOW G;  1IW7 D;  3IAY A;  4O1N A;  2NWG A;  1J5E Q;  4JG2 A;  1UAP A;  1K0S A;  4JBM A;  2O2L D;  4NXN Q;  1O7Z A;  2RQX A;  4KD4 A;  3S1M B;  5M3F G;  1IBL Q;  4A3L G;  3GV3 A;  5LHY 1;  2O5J C;  5JVG 3;  1XWE A;  1L1O C;  1BF4 A;  4IJH A;  3KF6 B;  4RCN A;  3J80 E;  4I65 A;  2IW3 A;  1TS4 A;  2ASB A;  4XDX A;  3S16 H;  1XJV A;  4A3I H;  4IFD J;  4JI1 L;  3W3A A;  5CV9 A;  2HDL A;  3HOW B;  1W3S A;  2OEO A;  4C2M H;  1VQL A;  1C48 A;  1CKO A;  1STE A;  4LJZ C;  3AEV A;  4ZKB B;  1I3Q B;  4C3J G;  3V2T A;  5M3F B;  3UE1 A;  1HZA A;  3S1Q B;  3M4Q A;  4L63 B;  2VUM H;  1A3U A;  3H15 A;  3H3V H;  2R3Z A;  2KED A;  2H4O A;  4RFB A;  3KF6 A;  3DWA A;  1KAA A;  5DEH A;  2QF7 A;  2EJM A;  3HKZ B;  1E22 A;  4LFC L;  5EJW A;  3SVM A;  4GLX A;  5C0X I;  1HRJ A;  2DN8 A;  4A3D B;  2XWJ B;  4LUV A;  1D5X C;  4QIW B;  3FEW X;  4IUU A;  3HKS A;  2D0O A;  5D3D A;  3GTG B;  1HR0 Q;  2EJG C;  3F8T A;  2IJ0 A;  3DWQ A;  4C3J B;  1IHZ A;  3VYU A;  3PUW A;  3H91 A;  5C4H A;  1YIT A;  1EQR A;  5IGG A;  1G2T A;  1E7Z A;  1HR0 L;  4IPD A;  5ELE A;  1EYC A;  2RCF A;  1WYD A;  4X3S A;  5IP9 G;  1N36 L;  1GM5 A;  4LF5 L;  5DNF A;  1QE6 A;  3NTH A;  1ENC A;  2IY5 B;  4ZUI A;  2JA8 G;  1CQF A;  1F9Q A;  4CKC A;  4F88 A;  5FLM H;  1SNC A;  1ASZ A;  2Z1C A;  4UPA A;  1SYF A;  4L6T B;  3T13 A;  4X62 L;  3S2D B;  4FXG C;  2L1B A;  2K32 A;  1D5Z C;  3UDF A;  5BN4 A;  3FKI B;  1DCZ A;  4EQN A;  4RG1 A;  1Y1V G;  2B3G A;  1EIG A;  2FMM A;  3GD7 A;  5JEA G;  2A6E D;  1H9R A;  4A3K B;  4QL5 A;  5FLX E;  2M2L A;  1I4H A;  3QO2 A;  4PZ8 A;  4DR6 Q;  5KEE A;  2L11 A;  5JAV A;  2QIL A;  4F7X A;  1VQE A;  1RCV D;  2K5D A;  4DU9 A;  4DR1 Q;  2BDN A;  3WOE A;  3ICE A;  2WV6 D;  3GTO H;  5ELD A;  1KLU D;  2EZV A;  3GTK H;  1VQ6 A;  1MSH A;  3WWV A;  3PO2 B;  1Q81 C;  2B2U A;  2C5C A;  4EGV A;  3BDC A;  4BBR G;  4GZY C;  1BR9 A;  4JCV E;  1PTO C;  5M5Y B;  2VB2 X;  1M1K C;  2F0G A;  3IFT A;  2E74 C;  4UY8 C;  1STB A;  2IHE A;  2R92 G;  1KRS A;  4JI2 L;  3SK4 A;  1LUZ A;  2MQH A;  4K2L A;  1EL0 A;  3J81 j;  3TZD A;  1LTR D;  1A8V A;  4DXF A;  3I90 A;  4ZRZ A;  1XMQ Q;  3HOX G;  1A3T A;  2N88 A;  4LWC A;  1JOK A;  3A7A B;  2J4X A;  1LT3 D;  2C9O A;  4RHS A;  1YNN C;  1C0A A;  1O7I A;  1IKL A;  1LTG D;  4ZK9 B;  3A5U A;  2HD3 A;  3A54 A;  3MVV A;  1JMC A;  3E5S A;  3NWS A;  5FO7 B;  1TWH B;  3GTQ H;  4GKK L;  5CBA E;  5FKA C;  3K8A A;  4DR3 Q;  1LTA D;  5ELB A;  3I73 A;  3V96 A;  5BN5 A;  4BBS G;  3DXJ C;  2R92 B;  4CJ0 B;  1FL0 A;  3BJU A;  2PMZ E;  3S1R B;  4R9W A;  3VA7 A;  1SEB D;  4FDB A;  2K5Q A;  2LSS A;  1Q46 A;  4HIM A;  5IYD H;  2HDM A;  2MUY A;  1F2M A;  3K5O A;  3CCL A;  4CDD C;  2XNA C;  4ME3 A;  2L5T A;  3KLS A;  1BCP F;  2E2D C;  2Q8I B;  4KLK A;  4DV4 Q;  2B39 A;  2OXP A;  3BZK A;  1L0X B;  2F0H A;  2JA8 H;  3RZO B;  2DNC A;  3N6R A;  1B3Q A;  4A93 B;  4FF4 A;  2EE1 A;  4LF4 L;  1XMO Q;  1WFQ A;  1JWM D;  1QB5 D;  1PFN A;  4JI5 Q;  3I4M G;  1E1T A;  3P75 A;  4JV5 Q;  3LX0 A;  4DR2 L;  5IYC H;  1M4V A;  4NP5 A;  4X3K A;  2MGS A;  1X3Q A;  4QF4 A;  5JEA H;  3HOV G;  5C4X B;  4GLA C;  2IX1 A;  3S17 B;  1GUG A;  1SN8 A;  2K6A A;  1ET9 A;  5I6Y A;  2EYF A;  3P20 A;  1EIY B;  4OHJ A;  5EKK A;  3MXN B;  3T56 B;  2XIW A;  2BH8 A;  5EBD A;  3MXP A;  2ICI A;  1X32 A;  4TRD A;  4YWK A;  2SOB A;  4LF7 Q;  3J81 c;  5IWA L;  1Q86 C;  1KQS A;  5LMN W;  2HQE A;  3GTJ B;  4WJ4 A;  4JBK A;  3SGI A;  3HOV B;  3HS0 C;  4N8X 1;  4UDU C;  1DOM A;  2IX3 A;  4R8I A;  4CJ1 B;  2I07 B;  2K50 A;  3ONA B;  3JAM L;  2JA7 G;  1LT4 D;  1B4O A;  3GTL H;  1XNQ L;  2E2J H;  3A8K E;  3BDO A;  5DLQ E;  2CW0 D;  3VR2 A;  3EJI A;  5KYL A;  4J6H A;  5D14 A;  1F9R A;  4AQY L;  3UI2 A;  3CCQ A;  1IL2 A;  5BR8 Q;  1L1O A;  1ENF A;  1PRT F;  1GKH A;  2EVB A;  5FK9 C;  3CQZ B;  1NY4 A;  4Z9C B;  4HJ7 A;  2EYM A;  2HCC A;  1LT6 D;  1CUK A;  2Q8T A;  4AH6 A;  1JT8 A;  1VQA A;  4K6D A;  4POF A;  5BR8 L;  4DV5 L;  4A3G B;  3OTO Q;  4OWX B;  1EY5 A;  2AWN A;  4DXG A;  2MO1 A;  1QJO A;  3H3V C;  3HOZ G;  2K01 A;  4BY7 H;  1IW7 C;  4WJ3 M;  5IGF A;  1H9S B;  3N52 A;  4DV0 Q;  4K5V A;  2Z4H A;  4GNX B;  2QKI C;  1K3B C;  1GUS A;  3OIP A;  4OXP A;  4B3T L;  3PV0 A;  1PV4 A;  4HTH A;  3P1H A;  4L8J A;  3LWU A;  1X65 A;  2C35 B;  3I4N H;  3JAM i;  5EKL A;  4KJO A;  3F2B A;  1QCB D;  1HFG A;  1PH9 A;  5CYU A;  4CDE C;  5LL6 X;  1UE1 A;  3NBH B;  5I9P A;  4KHV A;  4WOR A;  3I4M H;  4R4Q A;  3FHW A;  4BA2 I;  4ULL A;  4DV1 Q;  1QVG A;  4DN4 M;  5IOD A;  1VQF A;  1EY7 A;  3CC4 A;  4C3H B;  4GKJ L;  2LS0 1;  2WKD A;  1BO0 A;  1JB3 A;  1HH2 P;  2I5L X;  2FJ2 A;  3PO3 H;  1PVO A;  1BCP B;  5A2Q L;  4LF8 Q;  2NN6 I;  4DAM A;  2I5M X;  4NDX A;  4OO1 I;  2E2H B;  3AFQ A;  5KNC A;  2VXW A;  1LT5 D;  2VQE Q;  1WTH A;  3MEF A;  4NPS A;  2NB0 A;  5JVH 3;  4H7B A;  3CCS A;  2NTS A;  3SEB A;  3J80 c;  1PXU A;  2XRS D;  2QDB A;  3FPP A;  3KLR A;  2LMC B;  5C3E G;  4C1N I;  4X6A H;  2NVQ H;  4OIJ A;  2BH2 A;  5M3M H;  1LTB D;  1TY2 A;  3ERO A;  3PUZ A;  4HCE A;  3KLW A;  1S5B D;  4IFD H;  1MSG A;  2KCT A;  1ILP A;  4IPH A;  1N33 Q;  1TS3 A;  2MP1 A;  3CC2 A;  1U0L A;  3T51 B;  1EUJ A;  2JK8 A;  1K8M A;  2EYO A;  1X3G A;  1TWG H;  4A3B H;  3OWF A;  1VQ4 A;  2HCI A;  4P72 A;  2JA6 G;  5CV4 A;  1LTS D;  5C3E B;  2B63 B;  1AW7 A;  1I4R A;  3Q6S A;  3A8I E;  2WAQ E;  3CMA A;  2TSS A;  2A1A A;  2A6E C;  4ME5 A;  3R93 A;  2NVT B;  1QNU A;  5CGK A;  5I2Y A;  3E9H A;  5D3I B;  1SYG A;  3KJP A;  1BKB A;  1I94 Q;  4KV6 A;  2WB1 E;  4A76 A;  2OWO A;  5IGE A;  1Q8I A;  1WTO A;  2AUK A;  2EPB A;  1HUN A;  2A5H A;  4CKB A;  3G48 A;  4ZUJ A;  4IO9 A;  3TME A;  1YJN A;  4AYB E;  5M5X B;  3S9W A;  5KND A;  4PV1 C;  1I6H B;  1PRT B;  5GAE C;  4JI8 Q;  5M5W H;  3ZJY C;  3AYH B;  3T1Y L;  2WFW A;  1JQY D;  5AJ3 Q;  2K5V A;  4KHP Q;  1VQM A;  1HNW L;  3NTK A;  1R4P B;  1NE3 A;  4DUY Q;  1YBY A;  1HNZ Q;  4HID A;  4JI3 Q;  1CZG A;  1AP0 A;  3QWN A;  1EIH A;  4IUT A;  5G3L D;  3H0G H;  5FLX c;  1WTQ A;  4LUO A;  2F0N A;  3K7A H;  5LL6 S;  4OL7 A;  5EPJ A;  3NBI A;  4X3T A;  4UP9 A;  4UP8 A;  3NUC A;  1STY A;  5AFW A;  3TS0 A;  3CPF A;  1O80 A;  4UHV A;  2CH4 A;  4A3M B;  1YNX A;  1P8L A;  3VYS A;  5JJK A;  1KLG D;  1FJG L;  2WP8 J;  1VQ8 A;  2A73 B;  4MTN A;  5D65 A;  1CSQ A;  4S3S A;  1BOS A;  1TS2 A;  1UUP A;  3T1H Q;  1QUQ B;  2YV5 A;  2R7Z B;  3CF5 A;  2Y0S G;  1EEI D;  2K1B A;  2K5W A;  3J81 E;  2O4X A;  1OXX K;  1UWV A;  4UP7 A;  1VQO A;  1PZI D;  1QIL A;  4KMU C;  2NZO A;  2F0P A;  2F0F A;  2RDH A;  2VL6 A;  4F87 A;  2A8V A;  3M4O B;  1VQK A;  4DV3 Q;  3C3L A;  1GXD C;  2Z0S A;  4JYA Q;  2VUM G;  1B1Z A;  2KEE A;  3A8J E;  5KIX A;  1B2T A;  3DM3 A;  4XTC S;  2CKZ B;  2F4I A;  2NZ1 D;  1QUQ A;  4ABN A;  5C0X H;  4LFA L;  3S16 B;  1A2T A;  4A3I B;  2Y0S B;  4NXM Q;  1WCM H;  3PIP 3;  4C3I B;  1Y1W G;  3SDZ A;  1RTO A;  1GVP A;  2ZTC A;  3CCV A;  2K52 A;  5JJZ A;  1PHJ A;  4X65 Q;  1V1Q A;  4RGT A;  1N32 L;  3TP8 A;  1JWS D;  1UE5 A;  3C46 A;  3UDG A;  4CDC C;  2VQF L;  1MKH A;  4B3M L;  2X6G A;  4HCS A;  4OX9 L;  4LUZ A;  2KCN A;  4BS9 A;  2WIN B;  3K0Y A;  3SR1 A;  1HFN A;  4E6I A;  3Q24 A;  4JBJ A;  4K2K A;  1VDZ A;  5FLM G;  2J0T D;  1TWA B;  2Q2H A;  2PQA A;  4RAU C;  1KNE A;  5C6A A;  3HOU H;  2R6G A;  1UNS A;  1Q12 A;  2UUC L;  1YI2 A;  3H09 A;  3K5M A;  2WKC A;  2DJF C;  4JOI C;  1H9K A;  4RMF A;  1EQV A;  5C4J B;  2ICE C;  2K14 A;  1CHP D;  5CV6 A;  2K5N A;  4N9P A;  3G6E A;  4DV2 L;  5IY0 A;  2CW0 C;  4XXE A;  2R93 H;  2YYZ A;  3G6J B;  1EFW A;  3HZX A;  4A3J G;  4HMJ A;  1M8A A;  5I6W A;  1TU2 B;  1XPO A;  4Y52 H;  2AQ1 B;  5JOB A;  1I4X A;  4CBV A;  5HY6 A;  4TVA B;  1HXY D;  2L9H A;  2L15 A;  4JI1 Q;  1P16 A;  3ERQ A;  2F0K A;  2O5I C;  2Z6B A;  3VR6 A;  3TP5 A;  2KOL A;  3RZD H;  1VS0 A;  3PUX A;  1YJ9 A;  1KDB A;  2ZJP A;  3GTO B;  3HG9 A;  1PFM A;  3GTM H;  3I70 A;  1LAB A;  1EZ6 A;  4B9X A;  1CFM A;  1XXG A;  4A75 A;  4JI4 L;  4JI0 L;  4R4T A;  4BWG B;  2ZM6 L;  1K28 A;  1EWC A;  2EY6 A;  2NVY H;  4YHH L;  3UDI A;  1NJI C;  2OF1 A;  1HNX L;  1S40 A;  4LFC Q;  3ER0 A;  2A68 D;  1SMY D;  3F2C A;  2VB3 X;  3AQQ A;  3NEN A;  4XYO A;  3K5L A;  2PI2 A;  2UXB L;  1Y1W H;  3DMU A;  1FGU A;  5T1I A;  1M90 C;  3BS1 A;  4R4C A;  4DV7 L;  2GA4 B;  5EGT A;  5IYD G;  4DNR B;  4L5T A;  3OSO A;  1N9W A;  3A7L A;  3KF8 B;  3LWE A;  1N36 Q;  4LF5 Q;  1S5D D;  4KY5 A;  1C9O A;  1WTW A;  3TEH B;  1TVX A;  1Q1B A;  3VR4 A;  1PYS B;  5IE8 A;  3ND9 A;  4A4I A;  1Q82 C;  2Z4I A;  2SEB D;  4X62 Q;  4QQB X;  2AMC B;  5J1Z A;  1K0R A;  1TWF H;  1VMP A;  4DK1 A;  1XNR L;  2NUC A;  5COY A;  1PH8 A;  2E5L L;  5IYC G;  1MGS A;  1U9R A;  3TZU A;  4K6L A;  4P73 A;  2Z9H A;  1GHJ A;  2YTX A;  4HIO A;  3KF8 A;  1I4Q A;  1ZXT A;  3STB D;  2K04 A;  5KNB A;  5C44 H;  4PNY A;  5HUR A;  5K36 G;  4ZKC B;  5I9O A;  3U9S A;  1J9O A;  3PIP A;  4ID6 A;  4X66 L;  2OQK A;  2KQ3 A;  2Q8R E;  1II3 A;  2JA8 B;  4ZYS A;  4FF1 A;  3EBE A;  1N34 L;  4IOA A;  4H44 C;  1DJR D;  3D6W A;  4A3J H;  1B3A A;  1K8A C;  2JN4 A;  4JI2 Q;  1X9N A;  3PUV A;  3T4A C;  5E4W C;  1Y1V B;  4X3U A;  3QR8 A;  3M4Y A;  2QGQ A;  3KJO A;  1AEX A;  4KTA A;  4GOP C;  4DGZ A;  3J80 L;  2R7F A;  1MIU A;  2JJQ A;  2MFI A;  2ZXR A;  4CDF C;  1QOH A;  2F0O A;  3MZ5 A;  4TSS A;  5C0X J;  4Y7N H;  1B53 A;  1I3Q H;  1SYD A;  2X6L A;  4KKU A;  3RNU A;  1VQC A;  1BQQ T;  1STG A;  3S1Q H;  4CGY B;  1SRO A;  4I7Z C;  2JSO A;  4GKK Q;  2RHS B;  3S14 B;  3R3O A;  5IT9 E;  5ELF A;  1HQM C;  1D1I A;  4BBR B;  4DF7 A;  2MNA A;  5GAD C;  2LXJ A;  2I5H A;  1ZYR D;  3K58 A;  4P71 A;  5E3F A;  2BDO A;  4EQ5 A;  2F0S A;  4MZ9 A;  1ML0 D;  4YCV A;  3HKZ E;  1NR4 A;  1SE2 A;  2V1C C;  1BBX C;  1E24 A;  5C5L A;  4DUZ L;  3GTL B;  1B44 D;  3HOX B;  2E2J B;  1JJ2 A;  4BY7 G;  4QIW E;  2TMP A;  2JP1 A;  4DR4 L;  2L0C A;  2YU9 B;  2OTJ A;  2F0I A;  3K5N A;  4DV6 L;  3GTP B;  1NTG A;  4IAL A;  2UUB L;  4KY7 A;  2JA9 A;  2VW9 A;  1YHA A;  3L7Z C;  1KTK A;  2EXD A;  5CMD A;  4B3R L;  4HAE A;  5T1G A;  4BBS B;  1MHW C;  3BZC A;  3D3R A;  4H02 A;  3I4N G;  4LF4 Q;  3S2D H;  1X56 A;  1IYJ B;  2KA7 A;  1D2B A;  1SFO B;  4DR2 Q;  2F0U A;  2KCM A;  1PDQ A;  3ZYY X;  2E2I H;  1PTO F;  3FKI H;  4FXK C;  2PZW A;  3S2H H;  1Q1E A;  4R1J A;  1ZEQ X;  3QOJ A;  2WAC A;  4A3K H;  4DK0 A;  2CCZ A;  4JVZ A;  4EQP A;  1LLR D;  2OT2 A;  4IUN A;  4K5X A;  4HJ8 A;  1RD9 D;  1JC7 A;  5K36 H;  1Y8N B;  3M3Y H;  1YJW A;  4H13 C;  5FLX L;  3PO3 G;  4OO1 H;  3F2U A;  1GO3 E;  1SMX A;  3I4N B;  5EQ0 A;  1GOZ A;  2PYK A;  3PO2 H;  4RGO S;  1PZK D;  3PF5 A;  3D4D A;  2D5D A;  3D4W A;  1D1K A;  1WTR A;  3NTI A;  4TKO B;  5IWA Q;  2BCO A;  3I4M B;  4EX5 A;  1XTC D;  1L1O B;  4JOI A;  2UXC L;  1CI3 M;  4JI7 L;  4L5R C;  3ERS X;  3MFG A;  3NEL A;  4J1M A;  2E8G A;  3QIA A;  1KNA A;  1QZG A;  3R8B A;  1K83 B;  3NXW A;  3A55 A;  1XNQ Q;  1X6O A;  5M3M G;  3HRZ C;  4X64 L;  3MC0 B;  4IFD G;  1TWC B;  4IZ8 A;  4AQY Q;  1GUW A;  1TWH H;  1IBM L;  4DPG A;  1BUV T;  3SHL A;  2BA0 A;  3MAQ A;  1B9M A;  2WAQ G;  2B2W C;  3NE5 B;  2QA4 A;  3NSW A;  4A3B G;  3W1B A;  1FYC A;  2UUA L;  1XX8 A;  4DV5 Q;  3A0J A;  4DR7 L;  2FXQ A;  1SJH D;  3S1R H;  2NVQ B;  1JOO A;  1GHK A;  2KEN A;  1ASY A;  3CKI B;  5HGT A;  2JA7 B;  3PF4 A;  1SNO A;  3J7A 5;  2AQ3 B;  2WII B;  1JE5 A;  3I7F A;  1R9T B;  4V0B A;  2F3V A;  4KN7 C;  2ZXP A;  2B2Y C;  3U50 C;  4AYB G;  4L5S A;  3I2Z A;  2RVL A;  3VR3 A;  4B3T Q;  1IBK L;  5CV8 A;  5DM7 3;  5IGD A;  2UU9 L;  1KL9 A;  3WDN A;  1EFI D;  3J7A V;  4YWM A;  1L0Y B;  1EQT A;  3RZO H;  4C56 C;  1DOK A;  3J7Y W;  3HGB A;  5GQO A;  5IP7 H;  3VR5 A;  4RWS C;  2I0Q A;  3L3O C;  1NR2 A;  4JW0 A;  2N55 A;  1QVC A;  3NQT A;  3C1E A;  1EOV A;  5L37 A;  3HOZ B;  3H0G G;  1JCK B;  3CHB D;  1EIF A;  1NSN S;  2RSN A;  4XT1 B;  3Q8D A;  4GKJ Q;  2RSO A;  1Z7T A;  1KRT A;  1TR5 A;  4FO2 A;  3TQY A;  5C4X H;  2F4V L;  1VQI A;  3MA2 B;  3S17 H;  2IWH A;  2Z8L A;  2PPB C;  3RMH A;  5J22 A;  1RIP A;  3E9I A;  3OW7 A;  1JJG A;  3SK8 A;  2LXK A;  1EYD A;  2AQ2 B;  5M5W B;  1EY0 A;  4K5W A;  4QB4 A;  2ENB A;  1ILQ A;  2A68 C;  2UXD L;  1G8Z D;  1SMY C;  3URY A;  4K8J A;  1CQV A;  1PH3 A;  4B3S L;  3H0G B;  1RF2 D;  3IL8 A;  1PTO B;  4BY1 H;  4QUC A;  3TP7 A;  1FNU A;  5KRU A;  3OHX C;  4O2D A;  4P2C B;  2Q2I A;  5K5P A;  1SYC A;  1WOC A;  3CAM A;  2ALY B;  4PMB A;  4LAA A;  4OWT B;  1WTP A;  3BVZ A;  3PCO B;  1PFS A;  1B70 B;  1D5M C;  3KDF A;  5DAU A;  2DJG C;  3D0F A;  5C0X G;  2MJ8 A;  3VA5 A;  1I50 B;  2RKS A;  3IKJ A;  3H6M A;  1IZ6 A;  5E1F A;  2KHJ A;  1EYG A;  2VNU D;  1T5X D;  3CQZ H;  1WCM G;  1G2S A;  4RGM A;  2PO4 A;  2QW7 A;  4HR7 B;  1H9M A;  4JC0 A;  1HA5 A;  2J7Z A;  3K59 A;  4A3G H;  1K73 C;  4LF9 L;  3NQI A;  4LK1 C;  3CRK C;  1NAP A;  4M8A A;  5LMU L;  1G6P A;  3STB C;  4Q5V A;  5LMN L;  4GOP A;  2M00 A;  1N8R C;  1BCP D;  3R2T A;  1S5E D;  3I8Z A;  5FO9 B;  1OXS C;  1PA6 A;  1AE3 A;  1WVL A;  3BU2 A;  1U4M A;  4I7A A;  2AKW B;  4G7H C;  2HQL A;  4KKT A;  4MIU A;  2N3S A;  3RLF A;  1Q8K A;  1F9P A;  1HZC A;  1ESF A;  2JA5 G;  2K05 A;  3HOU G;  1SE4 A;  1SXT A;  2AUJ D;  4KHZ A;  3S15 H;  3Q22 A;  4GLV B;  3T1Y Q;  2JA6 B;  2EQS A;  3VYR A;  1HNW Q;  3P7J A;  1E1O A;  2VS1 A;  2RCN A;  4P74 A;  1W6J A;  1JOR A;  3CXC A;  2RDF A;  4JPB W;  1EOT A;  4JI6 L;  3KBX A;  1PH7 A;  3Q0A A;  1VF5 C;  1BBU A;  2D9U A;  3W5O A;  4YY3 L;  1HJP A;  1DYQ A;  4KD3 A;  1KXL A;  1TQO A;  2R93 G;  1FJG Q;  4G57 A;  3DWP A;  1NNX A;  3HOY G;  3HOU B;  4G7Z C;  1LO5 D;  2M9V A;  3I4L A;  1VQB A;  3LNN A;  5H1S E;  3TP6 A;  4CKE A;  4QJF A;  1A2U A;  1HQR D;  2A74 C;  4ZAI A;  4QY7 A;  2E2H H;  1DGS A;  3E0J A;  1HTL D;  1PFB A;  1ZYR C;  1UEB A;  4DAV A;  1SR3 A;  1OXT A;  1GD7 A;  1STA A;  4MNO A;  5KYI A;  1NCV A;  1RL2 A;  4A3E G;  4J15 A;  3I3C A;  1XPU A;  5IIF A;  2F0T A;  4A3C H;  1WI5 A;  4C1N K;  5TSS A;  3DM1 A;  1YZ6 A;  5IYB H;  3TRE A;  1SYB A;  4QGU A;  3A56 A;  2R93 B;  5HGQ A;  1VQD A;  3I72 A;  4ODG A;  1R4Q B;  1PRT D;  1I4G A;  1BBW A;  2VY3 A;  1LTI D;  3K0X A;  4DR5 L;  4LFA Q;  2SDF A;  1SE3 A;  1V1P A;  5EPK A;  5IT9 c;  4N9T A;  3I55 A;  3NWT A;  1JOQ A;  3RZD B;  2D62 A;  3M7G A;  2PQA B;  3PQI A;  4KK7 A;  3FRP B;  3RN5 A;  2B63 H;  3U4V A;  1N32 Q;  4O42 A;  1B50 A;  4OON A;  4K0K L;  2CWP A;  4C2M B;  1HR0 W;  2KBN A;  2G9H D;  1F2Y A;  1EZ8 A;  1MBY A;  2NVT H;  4R4I A;  2VQF Q;  1SDF A;  3UDX A;  4B3M Q;  4HN7 A;  1A62 A;  4OX9 Q;  5M9O A;  4GN3 B;  1KD1 C;  3B6Y A;  3KLS X;  2VUM B;  2MPM A;  2G9D A;  2NVX H;  4IFD I;  1JE4 A;  3CCU A;  1Z6H A;  1CA6 A;  3RUZ A;  1CKN B;  4HJ9 A;  1KC8 C;  1D6E C;  2JE6 I;  5GAH C;  2B2W A;  2RF4 A;  1Y14 B;  3MXG A;  2UUC Q;  3S1N H;  1STH A;  4IJL A;  5M5X H;  1Y1W B;  3M4P A;  1DXM A;  2JA5 H;  1EYA A;  1G6Z A;  2LKV A;  3E0E A;  1BVS A;  1QNK A;  4A3F H;  5EAY A;  4RKB A;  4YCW A;  1I6V C;  4LFB L;  3UE0 A;  1LYL A;  4PZ7 A;  5C44 G;  4DNT B;  1IYV A;  2A69 D;  2GN5 A;  2F0Q A;  2F3W A;  3QB3 A;  4MN3 A;  3I56 A;  3R2I A;  1O7L A;  1TII D;  4LF6 L;  3FPU B;  1KHI A;  4DV2 Q;  2B2Y A;  2SNM A;  1VCI A;  3GP7 A;  1CKN A;  4A3M H;  1CTM A;  2I46 A;  2D0P A;  2N49 A;  3OWE B;  1ENA A;  1CSP A;  2IL8 A;  4G4K A;  2CHB D;  1JB7 A;  3K6O A;  3ULP A;  3HOY H;  4DNI A;  1SRU A;  2HHH L;  3EVQ A;  2L4N A;  1HZB A;  3EFX D;  3F2D A;  1SND A;  2EY5 A;  2R7Z H;  2XWB B;  2SNS A;  3FVQ A;  5C44 B;  2IHF A;  5ELO A;  2HUG A;  3L2P A;  4JK1 C;  2DY7 A;  1Q7Y C;  1SAP A;  2XVS A;  2H5X A;  3EN2 A;  1O78 A;  1E3P A;  1G51 A;  4A3E H;  2R7D A;  1YIJ A;  4JI4 Q;  4JI0 Q;  3MXU A;  3J81 L;  2ZM6 Q;  3M4O H;  1J5E L;  1IL8 A;  3OW2 A;  2B8G A;  4NXN L;  3GTK B;  3JC6 6;  3ULL A;  5C3W A;  4YHH Q;  1BNZ A;  1EY4 A;  1FNW A;  3T53 B;  1IBL L;  5CV7 A;  2PW7 A;  4A3J B;  4XIG S;  1HNX Q;  2L12 A;  3MHB A;  2LFN A;  4KKS A;  3RLN A;  1KIX A;  3HKZ G;  2CWA A;  3M9B A;  1PH5 A;  1LAC A;  4KY6 A;  1XTD A;  4DA2 A;  3AFP A;  1QG7 A;  2KCC A;  1X3F A;  4QCL A;  4C3I H;  3J7Z C;  4IOC A;  4A3D G;  2UXB Q;  5EBC A;  3K80 C;  5JJI A;  4DV7 Q;  3MTS A;  1IXR A;  3TRZ A;  4HIK A;  3VYT A;  2Y0S E;  4Y7N B;  1ET6 A;  3OIQ A;  1MJC A;  5JJL A;  3RLO A;  5FJ8 G;  5C5M A;  5J3B A;  3IFD A;  4OIK A;  2ATW A;  2JXM B;  4O0A A;  2F0D A;  1K3R A;  3GTQ B;  3CPW A;  2EDG A;  2PMZ B;  3DEO A;  4WJW A;  3K81 C;  3L0O A;  1TWA H;  1XNR Q;  2N8N A;  1L2F A;  5GRO A;  4PQX A;  1PH2 A;  2E5L Q;  5C3X A;  3NPP A;  3MWY W;  3J81 i;  3I91 A;  1Y69 U;  1OO9 B;  2BE5 D;  1YHB A;  3FKI G;  2ZTE A;  2K03 A;  3ULJ A;  4U67 3;  2KEC A;  4RHR A;  4A3K G;  1PLF A;  4HMI A;  2K4K A;  4PZ6 A;  4GNX C;  1CA5 A;  3TS2 A;  1RDP D;  5C4J H;  2K7V A;  3SK6 A;  2FHT A;  1AZQ A;  1JR0 D;  4X66 Q;  3KOJ A;  2NN6 G;  2K33 A;  1QWY A;  1A3V A;  2EY1 A;  4OO1 G;  1N34 Q;  2XRQ D;  2N78 A;  2ZT9 C;  4N8F A;  2F0J A;  1MD2 D;  1VQH A;  3U58 A;  5E4X A;  3S1M H;  3PO2 G;  3MFY A;  2OQ0 A;  3A5Z B;  2E2I B;  4Q0F A;  1L0W A;  5CV5 A;  4QUF A;  1E2Z A;  3CRL C;  3S2H B;  1WJJ A;  1C8C A;  1S72 A;  1TXY A;  3VDY A;  1JWU D;  3BVG A;  3M3Y B;  2CFM A;  4DR6 L;  1BCP C;  3HOW H;  5F2D A;  4DR1 L;  3KYH C;  2K28 A;  4OWW B;  3NK9 A;  2PI2 E;  4LW1 A;  4FYD A;  5M3F H;  2CQO A;  1LTL A;  3BVM A;  4A3L H;  4IPG A;  1CKM A;  4J8Q A;  4HED A;  1TS5 A;  2CVR A;  1MJE A;  2EYH A;  4UAI A;  1CK1 A;  3RR5 A;  3JAM E;  2CQA A;  2VZA A;  1A15 A;  3E6Z X;  1YHQ A;  1V43 A;  2F0M A;  4DUZ Q;  4A3D H;  4PMC A;  2PCF B;  4WFN 3;  3I4O A;  4NB3 A;  4DR4 Q;  4FF2 A;  3GTG H;  4DV6 Q;  4YIJ A;  1XMQ L;  4C3J H;  2UUB Q;  1HA6 A;  2EY2 A;  5FJ8 H;  3NHH A;  1GJX A;  5E7N A; 
#chains in the Genus database with same CATH homology
 2B2V C;  3FMC A;  3QOL A;  1IKM A;  1UEA B;  2F0W A;  2IPK D;  1SNQ A;  3OOC A;  3ND8 A;  2AWO A;  3QJY A;  2B2T C;  4M1U B;  1JIC A;  1HHV A;  3BYY B;  3DEP A;  1WTV A;  4RH6 A;  2NBF A;  2ZXO A;  1J8I A;  4LMQ D;  1DON A;  2DNE A;  2H1E A;  2D2C C;  5BN3 A;  2A6H D;  1Q3L A;  4BY7 B;  1AN8 A;  1KAB A;  3CU7 A;  4FVM A;  2V4D A;  2BOS A;  3DUZ A;  5KGU A;  1PRT C;  4IQZ A;  1OXU A;  2DY8 A;  2KVM A;  2NN6 H;  3L9A X;  2FFK B;  1V8Q A;  3BYT B;  5A35 A;  1EEF D;  3ITP A;  2X69 A;  4R8N A;  1YNJ D;  1E2V A;  3SK5 A;  3SXH A;  1PYW D;  5IGC A;  4FF3 A;  1U4P A;  5I4D A;  1NUC A;  2KJX A;  2IT1 A;  4CHT B;  2JEA I;  2QCP X;  5IOC A;  3RD4 A;  5A2Q E;  4IUV A;  3NP8 A;  5G3L F;  3M7N A;  3PO3 B;  1VF7 A;  1CM9 A;  1SBB B;  2F0V A;  3FDT A;  4F8M A;  1DZ1 A;  1ROD A;  1RJT A;  2F0L A;  1EY6 A;  1TKW B;  5J39 A;  4BY1 B;  4EVO A;  5IT9 L;  1F2L A;  4RA8 A;  1LV9 A;  2RA4 A;  2FIN B;  1SSO A;  2A69 C;  1S5C D;  3WOF A;  1U4L A;  4XT3 B;  1B9N A;  5M3M B;  3X3M A;  3MXN A;  2FMC A;  1SJE D;  2EJF C;  1DOL A;  3BDL A;  4XQN A;  5ISR A;  1LTT D;  4G7O C;  2WAQ B;  3AU7 A;  1IYU A;  1TWG B;  4A3B B;  1RTN A;  2QEJ C;  5DM6 3;  1S5F D;  3D8G A;  4XYQ A;  2L55 A;  3C1F A;  1SNM A;  3HP3 A;  3GQB A;  1BXT A;  1HTP A;  2JYO A;  3H94 A;  2WB1 B;  3PUY A;  4IUP A;  3D4R A;  2PZT A;  1F2Z A;  4C3H G;  2EXZ A;  1Z47 A;  2EOT A;  4AYB B;  5CC4 A;  4QMG A;  4K8I A;  5I2X A;  3TSS A;  4K14 A;  3S15 B;  2EYL A;  4NMZ A;  5COR A;  4H0L C;  3X3N A;  3D6C A;  1AZP A;  2EYJ A;  3KK7 A;  1G29 1;  5ELC A;  1HCZ A;  4NKL A;  1Y8O B;  4NW2 A;  2E75 C;  1ZKO A;  2MHV A;  1F77 A;  1FGB D;  4IN3 A;  1H9S A;  4PMW A;  5EPL A;  3K7A B;  3D31 A;  5FO8 B;  2ID0 A;  3EA6 A;  1I4P A;  2NYZ D;  3PIO 3;  1KDA A;  4BA1 I;  2NTT A;  1HPC A;  3NBH A;  4OGQ C;  3SE0 A;  3OMC A;  1F9S A;  2PZU A;  5IGB A;  2KHS A;  4FXD A;  1X3P A;  1S4Z A;  2BE5 C;  3KBG A;  3TBI B;  3TDQ A;  1RKN A;  3QG1 A;  1A6X A;  1FNV A;  2E76 C;  3MEH A;  4RCO A;  3AMU A;  4MHE A;  1FD7 D;  2XN9 C;  3U9O A;  1PTO D;  1WCM B;  4HSP A;  4JBW A;  2LY7 A;  1GUT A;  4IUQ A;  4TQU S;  1EY8 A;  3O13 A;  3GV6 A;  1ONL A;  2RDG A;  1RHP A;  4ILW A;  4XQQ A;  1CT1 D;  2F03 A;  2NVX B;  1WD0 A;  4HSV A;  1YNN D;  1AFP A;  2B2V A;  4RKL A;  1EU4 A;  2B2U C;  3S1N B;  1Q90 A;  4DAP A;  2JA5 B;  4KI0 A;  5JEA J;  2F0E A;  1CHQ D;  4A3F B;  2RBM A;  4FNF A;  2B2T A;  4CJ2 C;  3C2P A;  5CBE E;  1STN A;  1V1P B;  1VMC A;  3TN2 A;  1TY0 A;  3BG3 A;  3K57 A;  1PTO H;  1O7Y A;  4ZLT F;  3G7L A;  4WRD A;  1E2W A;  3W2D A;  4EQO A;  1KDC A;  2PNR C;  3BZD B;  1SYE A;  1PZJ D;  5FOB B;  5JPN C;  3HOY B;  1W6K A;  4KN4 C;  1ESR A;  5JPM C;  4DFA A;  1FR3 A;  4C3I G;  3PMF A;  2IX0 A;  1Y8P B;  4A3E B;  3DHQ A;  3OMG A;  4RGN A;  5EKI A;  1SNP A;  2KUM A;  5NUC A;  3J7A F;  2A6H C;  2F1M A;  1TT2 A;  2XSC A;  3GTM B;  3Q23 A;  2JEB I;  1HUM A;  4ZQ3 A;  4B9W A;  3GO5 A;  1C4Q A;  4DAY A;  2NVY B;  3OPO A;  4V19 0;  1GUN A;  1T5E A;  3T16 A;  1GUO A;  1H9J A;  4KJN A;  3HEJ A;  1EY9 A;  1YNJ C;  3AB9 A;  5CR3 A;  2PW5 A;  1K8O A;  1ICW A;  4XQJ A;  3V05 A;  5C4Z A;  1OXV A;  2PQE A;  1EWH A;  1BDO A;  4B08 A;  1TWF B;  1DM0 B;  1U4R A;  1PMR A;  1CZW A;  1EU3 A;  1XYI A;  1E0B A;  1MI2 A;  4IUR A;  3M85 A;  1WTX A;  2R61 A;  2EYP A;  4U68 A;  4FP5 D;  1V1O A;  1WD1 A;  2BA1 A;  3EQL C;  1DD2 A;  3KUP A;  2B8F A;  1G91 A;  1IW7 D;  3IAY A;  4O1N A;  2NWG A;  1UAP A;  2O2L D;  1O7Z A;  2RQX A;  4KD4 A;  3S1M B;  3GV3 A;  5LHY 1;  2O5J C;  5JVG 3;  1XWE A;  1BF4 A;  4RCN A;  3J80 E;  4I65 A;  2IW3 A;  1TS4 A;  4XDX A;  4IFD J;  5CV9 A;  3W3A A;  2HDL A;  3HOW B;  2OEO A;  1C48 A;  1STE A;  4LJZ C;  4ZKB B;  1I3Q B;  4C3J G;  3V2T A;  5M3F B;  3S1Q B;  4L63 B;  1A3U A;  2R3Z A;  2KED A;  2H4O A;  4RFB A;  3DWA A;  1KAA A;  5DEH A;  2QF7 A;  2EJM A;  3HKZ B;  5EJW A;  3SVM A;  5C0X I;  1HRJ A;  2DN8 A;  4A3D B;  2XWJ B;  4QIW B;  1D5X C;  3FEW X;  4IUU A;  5D3D A;  3GTG B;  2EJG C;  2IJ0 A;  3DWQ A;  4C3J B;  1IHZ A;  3VYU A;  3PUW A;  3H91 A;  5C4H A;  1G2T A;  5IGG A;  5ELE A;  1EYC A;  4X3S A;  5DNF A;  1QE6 A;  3NTH A;  1ENC A;  4ZUI A;  1CQF A;  1F9Q A;  4CKC A;  4F88 A;  1SNC A;  2Z1C A;  3T13 A;  1SYF A;  4L6T B;  3S2D B;  4FXG C;  2L1B A;  2K32 A;  1D5Z C;  5BN4 A;  3FKI B;  1DCZ A;  4EQN A;  1EIG A;  2FMM A;  3GD7 A;  5JEA G;  2A6E D;  1H9R A;  4A3K B;  5FLX E;  2M2L A;  1I4H A;  3QO2 A;  5KEE A;  2L11 A;  5JAV A;  2QIL A;  4F7X A;  1RCV D;  2K5D A;  4DU9 A;  2BDN A;  3WOE A;  2WV6 D;  5ELD A;  1KLU D;  2EZV A;  1MSH A;  3PO2 B;  2B2U A;  2C5C A;  4EGV A;  3BDC A;  4GZY C;  1BR9 A;  1PTO C;  5M5Y B;  2VB2 X;  2F0G A;  3IFT A;  2E74 C;  1STB A;  3SK4 A;  4K2L A;  1EL0 A;  3TZD A;  1LTR D;  4DXF A;  3I90 A;  4ZRZ A;  1A3T A;  2N88 A;  1JOK A;  3A7A B;  2J4X A;  1LT3 D;  2C9O A;  4RHS A;  1YNN C;  1IKL A;  1LTG D;  4ZK9 B;  3A54 A;  3MVV A;  3E5S A;  3NWS A;  5FO7 B;  1TWH B;  5CBA E;  5FKA C;  1LTA D;  5ELB A;  3I73 A;  3V96 A;  5BN5 A;  3DXJ C;  2R92 B;  4CJ0 B;  3S1R B;  4R9W A;  3VA7 A;  1SEB D;  2K5Q A;  2HDM A;  2MUY A;  1F2M A;  3K5O A;  2XNA C;  2L5T A;  3KLS A;  1BCP F;  2E2D C;  2Q8I B;  2B39 A;  2OXP A;  1L0X B;  2F0H A;  3RZO B;  2DNC A;  3N6R A;  4A93 B;  4FF4 A;  2EE1 A;  1JWM D;  1QB5 D;  1PFN A;  3P75 A;  3LX0 A;  1M4V A;  4NP5 A;  4X3K A;  2MGS A;  1X3Q A;  4QF4 A;  5JEA H;  5C4X B;  2IX1 A;  3S17 B;  1GUG A;  2K6A A;  1ET9 A;  5I6Y A;  2EYF A;  3P20 A;  4OHJ A;  5EKK A;  3T56 B;  2XIW A;  5EBD A;  3MXP A;  2ICI A;  1X32 A;  4TRD A;  2SOB A;  2HQE A;  3GTJ B;  3HOV B;  3HS0 C;  4UDU C;  1DOM A;  2IX3 A;  4R8I A;  4CJ1 B;  2I07 B;  3ONA B;  3JAM L;  1LT4 D;  1B4O A;  3A8K E;  3BDO A;  2CW0 D;  3VR2 A;  3EJI A;  5KYL A;  4J6H A;  5D14 A;  1F9R A;  3UI2 A;  1ENF A;  1PRT F;  2EVB A;  5FK9 C;  3CQZ B;  4Z9C B;  2EYM A;  2HCC A;  1LT6 D;  2Q8T A;  4K6D A;  4A3G B;  1EY5 A;  2AWN A;  4DXG A;  1QJO A;  3H3V C;  2K01 A;  1IW7 C;  5IGF A;  1H9S B;  3N52 A;  4K5V A;  2Z4H A;  2QKI C;  1GUS A;  3OIP A;  3PV0 A;  4HTH A;  3P1H A;  4L8J A;  3LWU A;  5EKL A;  4KJO A;  1QCB D;  1HFG A;  5CYU A;  5LL6 X;  5I9P A;  4KHV A;  4WOR A;  4BA2 I;  4ULL A;  4DN4 M;  5IOD A;  1EY7 A;  4C3H B;  2LS0 1;  2WKD A;  1BO0 A;  1JB3 A;  2FJ2 A;  1BCP B;  5A2Q L;  2NN6 I;  4NDX A;  4OO1 I;  2E2H B;  5KNC A;  2VXW A;  1LT5 D;  2NB0 A;  5JVH 3;  4H7B A;  2NTS A;  3SEB A;  1PXU A;  2XRS D;  2QDB A;  3FPP A;  3KLR A;  2LMC B;  4C1N I;  4OIJ A;  1LTB D;  1TY2 A;  3ERO A;  3PUZ A;  4HCE A;  1S5B D;  4IFD H;  1MSG A;  1ILP A;  1TS3 A;  2MP1 A;  3T51 B;  1K8M A;  2EYO A;  3OWF A;  2HCI A;  5CV4 A;  1LTS D;  5C3E B;  2B63 B;  1AW7 A;  1I4R A;  3Q6S A;  3A8I E;  2TSS A;  2A6E C;  4ME5 A;  3R93 A;  2NVT B;  5CGK A;  1QNU A;  5I2Y A;  5D3I B;  1SYG A;  4KV6 A;  5IGE A;  1Q8I A;  1WTO A;  2AUK A;  2EPB A;  1HUN A;  2A5H A;  4CKB A;  4ZUJ A;  3TME A;  5M5X B;  3S9W A;  5KND A;  4PV1 C;  1I6H B;  1PRT B;  1JQY D;  3NTK A;  1R4P B;  1CZG A;  1AP0 A;  3QWN A;  1EIH A;  4IUT A;  5G3L D;  1WTQ A;  2F0N A;  5LL6 S;  4OL7 A;  5EPJ A;  3NBI A;  4X3T A;  3NUC A;  1STY A;  5AFW A;  1O80 A;  4A3M B;  3VYS A;  1KLG D;  2WP8 J;  2A73 B;  5D65 A;  4S3S A;  1BOS A;  1TS2 A;  1UUP A;  2R7Z B;  1EEI D;  2K1B A;  2K5W A;  3J81 E;  2O4X A;  1OXX K;  1PZI D;  1QIL A;  4KMU C;  2F0P A;  2F0F A;  2RDH A;  4F87 A;  3M4O B;  3C3L A;  1GXD C;  1B1Z A;  2KEE A;  3A8J E;  5KIX A;  1B2T A;  4XTC S;  2F4I A;  2NZ1 D;  4ABN A;  5C0X H;  3S16 B;  1A2T A;  4A3I B;  2Y0S B;  3PIP 3;  4C3I B;  3SDZ A;  1RTO A;  5JJZ A;  4RGT A;  3TP8 A;  1JWS D;  3C46 A;  2X6G A;  4HCS A;  2KCN A;  4BS9 A;  2WIN B;  3K0Y A;  3SR1 A;  1HFN A;  4E6I A;  3Q24 A;  4K2K A;  1VDZ A;  2J0T D;  1TWA B;  4RAU C;  1KNE A;  5C6A A;  2R6G A;  1UNS A;  1Q12 A;  3H09 A;  3K5M A;  2WKC A;  1H9K A;  1EQV A;  5C4J B;  2ICE C;  1CHP D;  5CV6 A;  4N9P A;  2CW0 C;  4XXE A;  2YYZ A;  3G6J B;  3HZX A;  4HMJ A;  1M8A A;  5I6W A;  1TU2 B;  2AQ1 B;  5JOB A;  1I4X A;  4CBV A;  1HXY D;  2L9H A;  3ERQ A;  2F0K A;  2O5I C;  3VR6 A;  3TP5 A;  2KOL A;  3PUX A;  1KDB A;  3GTO B;  3HG9 A;  1PFM A;  3I70 A;  1LAB A;  1EZ6 A;  4B9X A;  1CFM A;  1XXG A;  4BWG B;  1EWC A;  2EY6 A;  2OF1 A;  2A68 D;  1SMY D;  2VB3 X;  4XYO A;  3K5L A;  3DMU A;  5T1I A;  3BS1 A;  2GA4 B;  5EGT A;  4DNR B;  3OSO A;  3A7L A;  3LWE A;  1S5D D;  4KY5 A;  1WTW A;  1TVX A;  1Q1B A;  3VR4 A;  3ND9 A;  2Z4I A;  2SEB D;  5J1Z A;  1VMP A;  4DK1 A;  2NUC A;  5COY A;  1MGS A;  1U9R A;  3TZU A;  4K6L A;  1GHJ A;  3KF8 A;  1I4Q A;  1ZXT A;  5KNB A;  2K04 A;  5K36 G;  4PNY A;  5HUR A;  4ZKC B;  5I9O A;  3U9S A;  1J9O A;  4ID6 A;  2KQ3 A;  2Q8R E;  1II3 A;  2JA8 B;  4ZYS A;  4FF1 A;  4H44 C;  1DJR D;  3D6W A;  1B3A A;  3PUV A;  3T4A C;  5E4W C;  1Y1V B;  4X3U A;  3M4Y A;  1AEX A;  4KTA A;  4DGZ A;  3J80 L;  2ZXR A;  1QOH A;  2F0O A;  3MZ5 A;  4TSS A;  5C0X J;  1B53 A;  1SYD A;  2X6L A;  4KKU A;  1BQQ T;  1STG A;  4CGY B;  4I7Z C;  2JSO A;  3S14 B;  3R3O A;  5IT9 E;  5ELF A;  1HQM C;  1D1I A;  4BBR B;  4DF7 A;  1ZYR D;  3K58 A;  5E3F A;  2BDO A;  2F0S A;  1ML0 D;  1NR4 A;  1SE2 A;  1BBX C;  5C5L A;  3GTL B;  1B44 D;  3HOX B;  2E2J B;  2TMP A;  2JP1 A;  2L0C A;  2YU9 B;  2F0I A;  3K5N A;  3GTP B;  4IAL A;  4KY7 A;  3L7Z C;  1KTK A;  5CMD A;  4HAE A;  5T1G A;  4BBS B;  3D3R A;  2KA7 A;  1D2B A;  1SFO B;  2F0U A;  1PDQ A;  3ZYY X;  1PTO F;  4FXK C;  2PZW A;  1Q1E A;  1ZEQ X;  2WAC A;  3QOJ A;  4DK0 A;  4EQP A;  1LLR D;  2OT2 A;  4IUN A;  4K5X A;  5K36 H;  1RD9 D;  1JC7 A;  1Y8N B;  4H13 C;  5FLX L;  4OO1 H;  3F2U A;  3I4N B;  5EQ0 A;  1GOZ A;  2PYK A;  4RGO S;  1PZK D;  3D4D A;  2D5D A;  3D4W A;  1D1K A;  1WTR A;  3NTI A;  4TKO B;  3I4M B;  2BCO A;  1XTC D;  1CI3 M;  3MFG A;  4J1M A;  3QIA A;  1KNA A;  3R8B A;  1K83 B;  3NXW A;  3A55 A;  3HRZ C;  3MC0 B;  4IFD G;  1TWC B;  4IZ8 A;  1GUW A;  1BUV T;  3SHL A;  2BA0 A;  3MAQ A;  1B9M A;  2B2W C;  3NE5 B;  3NSW A;  1FYC A;  1XX8 A;  1SJH D;  2NVQ B;  1JOO A;  1GHK A;  3CKI B;  5HGT A;  2JA7 B;  1SNO A;  2AQ3 B;  2WII B;  1R9T B;  4V0B A;  2F3V A;  4KN7 C;  2ZXP A;  2B2Y C;  2RVL A;  3VR3 A;  5CV8 A;  5DM7 3;  5IGD A;  3WDN A;  1EFI D;  3J7A V;  1L0Y B;  1EQT A;  4C56 C;  1DOK A;  3J7Y W;  3HGB A;  3VR5 A;  4RWS C;  3L3O C;  1NR2 A;  2N55 A;  3NQT A;  3C1E A;  3HOZ B;  1JCK B;  3CHB D;  1NSN S;  2RSN A;  4XT1 B;  2RSO A;  1Z7T A;  1TR5 A;  4FO2 A;  3MA2 B;  2IWH A;  2Z8L A;  2PPB C;  3RMH A;  5J22 A;  3OW7 A;  3SK8 A;  1EYD A;  2AQ2 B;  5M5W B;  1EY0 A;  4K5W A;  4QB4 A;  2ENB A;  1ILQ A;  2A68 C;  1G8Z D;  1SMY C;  3URY A;  4K8J A;  1CQV A;  3H0G B;  1RF2 D;  3IL8 A;  1PTO B;  4QUC A;  3TP7 A;  1FNU A;  5KRU A;  3OHX C;  4P2C B;  5K5P A;  1SYC A;  4PMB A;  4LAA A;  1WTP A;  3BVZ A;  1D5M C;  5DAU A;  5C0X G;  2MJ8 A;  3VA5 A;  1I50 B;  2RKS A;  3IKJ A;  3H6M A;  2VNU D;  5E1F A;  1T5X D;  4RGM A;  1G2S A;  2PO4 A;  4HR7 B;  1H9M A;  1HA5 A;  2J7Z A;  3K59 A;  3NQI A;  4LK1 C;  3CRK C;  1NAP A;  4M8A A;  4Q5V A;  2M00 A;  1BCP D;  3R2T A;  1S5E D;  3I8Z A;  5FO9 B;  1OXS C;  1WVL A;  1U4M A;  4G7H C;  4KKT A;  4MIU A;  3RLF A;  1F9P A;  1ESF A;  2K05 A;  1SE4 A;  1SXT A;  2AUJ D;  4KHZ A;  3Q22 A;  2JA6 B;  3VYR A;  3P7J A;  1JOR A;  1W6J A;  2RDF A;  1EOT A;  3KBX A;  3Q0A A;  1VF5 C;  2D9U A;  1DYQ A;  4KD3 A;  1TQO A;  4G57 A;  3DWP A;  3HOU B;  4G7Z C;  1LO5 D;  2M9V A;  3I4L A;  3LNN A;  3TP6 A;  4CKE A;  1A2U A;  1HQR D;  2A74 C;  4ZAI A;  3E0J A;  1HTL D;  1PFB A;  1ZYR C;  4DAV A;  1OXT A;  5KYI A;  1STA A;  1NCV A;  3I3C A;  5IIF A;  2F0T A;  4C1N K;  5TSS A;  3DM1 A;  1SYB A;  3A56 A;  2R93 B;  3I72 A;  4ODG A;  1R4Q B;  1PRT D;  1I4G A;  1LTI D;  2SDF A;  1SE3 A;  1V1P A;  5EPK A;  4N9T A;  3NWT A;  1JOQ A;  3RZD B;  2D62 A;  3M7G A;  4KK7 A;  3FRP B;  4O42 A;  1B50 A;  4C2M B;  2G9H D;  1F2Y A;  1EZ8 A;  1MBY A;  1SDF A;  4HN7 A;  5M9O A;  3KLS X;  2VUM B;  2MPM A;  2G9D A;  4IFD I;  1JE4 A;  1Z6H A;  1CA6 A;  3RUZ A;  1D6E C;  2JE6 I;  2B2W A;  3MXG A;  1STH A;  1Y1W B;  1DXM A;  1G6Z A;  1EYA A;  2LKV A;  1QNK A;  4RKB A;  1I6V C;  4DNT B;  1IYV A;  2A69 D;  2F0Q A;  2F3W A;  3QB3 A;  4MN3 A;  3R2I A;  1O7L A;  1TII D;  3FPU B;  2B2Y A;  2SNM A;  1VCI A;  3GP7 A;  1CTM A;  2I46 A;  3OWE B;  1ENA A;  2IL8 A;  4G4K A;  2CHB D;  3K6O A;  3EVQ A;  2L4N A;  3EFX D;  1SND A;  2EY5 A;  2XWB B;  2SNS A;  3FVQ A;  5C44 B;  2HUG A;  4JK1 C;  2DY7 A;  1SAP A;  2XVS A;  1O78 A;  3MXU A;  3J81 L;  1IL8 A;  2B8G A;  3GTK B;  5C3W A;  1BNZ A;  1EY4 A;  1FNW A;  3T53 B;  5CV7 A;  2PW7 A;  4A3J B;  4XIG S;  2L12 A;  3MHB A;  2LFN A;  4KKS A;  1LAC A;  4KY6 A;  4DA2 A;  1QG7 A;  2KCC A;  4QCL A;  5EBC A;  3MTS A;  3VYT A;  4Y7N B;  1ET6 A;  3OIQ A;  5C5M A;  3IFD A;  4OIK A;  2JXM B;  2F0D A;  3GTQ B;  2EDG A;  2PMZ B;  3DEO A;  4WJW A;  4PQX A;  5C3X A;  3NPP A;  3MWY W;  1Y69 U;  3I91 A;  1OO9 B;  2BE5 D;  2K03 A;  4U67 3;  2KEC A;  4RHR A;  1PLF A;  4HMI A;  1CA5 A;  1RDP D;  2K7V A;  3SK6 A;  2FHT A;  1AZQ A;  1JR0 D;  2NN6 G;  2K33 A;  1QWY A;  1A3V A;  2EY1 A;  4OO1 G;  2XRQ D;  2ZT9 C;  2F0J A;  1MD2 D;  5E4X A;  3MFY A;  2E2I B;  4Q0F A;  5CV5 A;  4QUF A;  1E2Z A;  3CRL C;  3S2H B;  1C8C A;  1JWU D;  3BVG A;  3M3Y B;  1BCP C;  5F2D A;  2K28 A;  3NK9 A;  4FYD A;  3BVM A;  4J8Q A;  4HED A;  1TS5 A;  2CVR A;  2EYH A;  4UAI A;  1CK1 A;  3JAM E;  2CQA A;  1A15 A;  3E6Z X;  1V43 A;  2F0M A;  4PMC A;  2PCF B;  4WFN 3;  4FF2 A;  4YIJ A;  1HA6 A;  2EY2 A;  3NHH A;  1GJX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...