2F0GA

Crystal structure of staphylococcal nuclease mutant v66i
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
135
structure length
135
Chain Sequence
b'LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMIENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Staphylococcal nuclease
publication title Hydrophobic core mutants of Staphylococcal nuclease
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 36
structure length 135
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2005-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2f0gA00
3MXPA 1STAA 4ME5A 4EQNA 1A3UA 5HGTA 1JOKA 3OMCA 1EQVA 2EYHA 1JOOA 3D4WA 3DHQA 5CGKA 2RBMA 3T13A 4HMIA 1KDCA 3OSOA 4I65A 4ZUIA 4B9WA 2F3VA 4K2KA 2O4XA 2RDFA 3RUZA 1EYCA 2EYFA 2EY5A 3PMFA 1EY4A 4K2LA 4PMCA 2F0VA 4OL7A 3VA5A 5IGGA 4TRDA 1EYAA 2F0DA 1A2TA 1STYA 1KAAA 4MIUA 4PNYA 2WACA 5IGBA 5IGDA 5ISRA 3TMEA 5EKLA 5KIXA 3DMUA 5M9OA 2LKVA 3D4DA 1A3VA 3HZXA 5IGFA 4QMGA 4LAAA 1EZ8A 4YIJA 5I9OA 3NXWA 4KY7A 5KYIA 5KRUA 4NP5A 5JAVA 5CV7A 3HEJA 4KY6A 1U9RA 4KV6A 4WORA 3LX0A 5CV6A 2F0UA 5CV4A 4IALA 5I6WA 4HMJA 3ITPA 5C5LA 5K5PA 1STNA 5J1ZA 1EY9A 5J39A 4DU9A 2EXZA 3OMGA 5CV9A 3MZ5A 1SYEA 1TQOA 2F0IA 5C4HA 2PZTA 1STHA 3SK6A 1ENCA 3T16A 1EY6A 1STBA 2F0LA 3EROA 2F0MA 2PW7A 4QB4A 5I6YA 4RKBA 3SK5A 2F0HA 4KJNA 5JOBA 5KEEA 5E3FA 2F0PA 1KDBA 4NDXA 1SNOA 4HTHA 4ZQ3A 1SYGA 2KHSA 3P75A 4KY5A 4F7XA 5C5MA 4EQOA 2SOBA 2PZUA 1NUCA 3EVQA 4K14A 3TP6A 4F8MA 2EYOA 5I9PA 4ID6A 1TR5A 4R8NA 4B9XA 1F2MA 5IGEA 1TT2A 3D8GA 4KTAA 1II3A 2OXPA 3EJIA 4E6IA 5C4ZA 5C6AA 1EY8A 1SYFA 2F3WA 3C1EA 3R3OA 1NSNS 2OF1A 4H7BA 2SNMA 4N9TA 5EGTA 5IGCA 2HQEA 1ENAA 2F0GA 3E5SA 5C3XA 2F0OA 4KJOA 5IIFA 2PZWA 5HURA 2F0QA 4J1MA 2EY6A 2F0JA 1KABA 3QOLA 1STGA 5DEHA 4KD3A 4ZUJA 3TP7A 5J22A 1EYDA 1SYCA 4EQPA 3NQTA 4QF4A 3SHLA 3SK4A 4DGZA 3NHHA 4RKLA 3BDCA 5IODA 1EY7A 4WRDA 2EYPA 1A2UA 1SNMA 3MEHA 3BDLA 2M00A 5CC4A 3V2TA 5DAUA 2F0SA 1SNQA 2EYMA 2F0EA 5E1FA 4K8JA 2KQ3A 3U9OA 2RKSA 1SNDA 4N9PA 4IZ8A 1EY0A 4K8IA 5CV8A 1A3TA 2F0TA 2EYLA 2F0WA 3MHBA 2EY2A 3H6MA 4NKLA 5EKKA 5KYLA 1F2ZA 3QB3A 4NMZA 3SXHA 3MVVA 3NK9A 1AEXA 5F2DA 1F2YA 5CV5A 4K6DA 1SYDA 1EY5A 2F0NA 2PYKA 3NUCA 4K5VA 4K5WA 2QDBA 3SK8A 4EVOA 4G57A 4IUNA 1JORA 3C1FA 3S9WA 2OEOA 5KGUA 1SNCA 3SR1A 2EY1A 1KDAA 4KHVA 4ODGA 4DFAA 1IHZA 5C3WA 3P1HA 2EYJA 2F0FA 1EZ6A 2ENBA 3ERQA 3TP8A 4PMBA 4K5XA 3D6CA 1SYBA 4J6HA 3TP5A 2F0KA 2NUCA 2SNSA 1JOQA 4DF7A 1SNPA 3NP8A 5CR3A 2PW5A 5NUCA 5IOCA 2PQEA 3OWFA 1RKNA 3QOJA 4KD4A 4S3SA
chains in the Genus database with same CATH superfamily
1IBMQ 1C0AA 1XTCD 4HIDA 3S1RH 1G6ZA 3RMHA 2E2HB 4DV6L 2VB3X 4CDFC 4OX9Q 4ME3A 1KAWA 4DK6C 2F3VA 4DR3Q 5JVH3 1CKNA 1PA6A 3PMFA 2D0PA 5HY6A 4HIMA 1CI3M 1MBYA 1STYA 2YTXA 4C3HH 2R92H 1Y8PB 5D65A 2B2YA 3TREA 3Q23A 3DMUA 4IFDI 3NBHA 1T5EA 2UUCL 3A56A 4A3BH 1A15A 3QIAA 1E2VA 1SRUA 4FVMA 3A55A 4JBKA 1EEFD 1FGBD 4JOIC 2F0UA 2ZM6Q 1Q90A 1YNJD 2EIFA 1SMYC 4P2CB 1CT1D 1U4MA 1CA5A 5C4HA 4Q0FA 1I4QA 2NZ1D 3B6YA 1PH6A 3S17H 1DXMA 1PV4A 4FF4A 2MHVA 5DM63 4DV4L 1GO3E 2Z6BA 3D3RA 1U4RA 3OHXC 4OXPA 3UDIA 1PH1A 1YZ6A 2IX3A 4GOPB 3HOVH 4A3DH 3S14B 2DNCA 3D8GA 2OXPA 2QILA 3KDFB 3W5OA 2UUCQ 3M3YB 3C1EA 2NZOA 5JVG3 3S2DH 4OHJA 1NMGA 1XYIA 1CTMA 1V43A 3R8BA 5HURA 4QUFA 4BBSH 1VQBA 3IKJA 4UPAA 4H44C 4HN7A 4DV3L 3J80c 4R4CA 3SK4A 4DGZA 1HRJA 4CKBA 1S40A 4DV4Q 2JA5G 1B4OA 4LK1C 2F0SA 5LHY1 2MQHA 3VR5A 4BY7G 1GUWA 3CHBD 3S15H 5EKKA 1NR2A 2Z0SA 3KF6B 4C3IG 1GUSA 3CPFA 3SXHA 4IUPA 2SDFA 5F2DA 1IYUA 4OIKA 2F0NA 2PYKA 3F1ZA 5M5WH 3BVGA 4BBRG 4NXML 3C1FA 1VQJA 2K05A 1K0RA 1EQQA 4CBVA 5C3WA 4G7OC 4DV3Q 3FKIG 1SYBA 2QF7A 3M4OB 2O5JC 5H1SE 2SNSA 1TXYA 4C1NI 3M4QA 1P8LA 2KCNA 1GD7A 1EU4A 1PH2A 4DV5L 5M3FB 1VQPA 4GKJL 3NWSA 1DD2A 2WKCA 4OO1G 3A7AB 1Q46A 2FMCA 4A3IG 1B70B 1YJNA 4NXMQ 4H02A 1XTDA 5KIXA 2LKVA 2MUYA 2JA7H 4JI5L 5I9OA 2AWNA 1AP0A 4DK3C 2R7ZH 1U9RA 4C1NK 1VQKA 3I70A 3KJPA 5CV4A 4YCWA 4HMJA 3A8JE 5J1ZA 4DV5Q 1OTCA 1V1PB 1EOVA 4K0KL 1AN8A 1O7ZA 5M3MG 3K6OA 4QJFA 5BN5A 4GKJQ 1LV9A 1BUVT 3U9SA 4ZAIA 5KEEA 1Q1EA 1QOHA 1B9MA 1L0XB 1A63A 3I90A 4JI3L 4EQOA 2YV5A 4K14A 2VUMB 3RD4A 4FXDA 1KRSA 2ATWA 4YWKA 1H9MA 4CJ1B 1ET9A 1S5DD 4H0LC 4JI5Q 3NPPA 1PZJD 4C56C 4IURA 5K36H 2AUKA 1WVLA 1QZHA 1WD0A 2C9OA 4J15A 2ZJQA 4QUCA 1HZ9A 5FJ8H 3CF5A 1BDOA 5GAEC 2D2CC 1FNWA 4ZUJA 5DLQE 3S1NB 4A3KH 4K0KQ 2RF4A 3GTLB 3PIP3 3T51B 5JPMC 3OW7A 5IYCH 5IODA 4O0AA 3K58A 1EU3A 1O80A 2B8FA 4MNOA 1X9NA 4JI3Q 2IT1A 5CV8A 4K8IA 3GTOB 3RLNA 4LF9L 4YY3L 1IL2A 4IFDG 1HFNA 1Q7YC 1LACA 1IBKL 1ZKOA 1VQ7A 3EA6A 1EY5A 3BJUA 3QR8A 1LM0A 4EVOA 1CKOA 2RA4A 4FF1A 4RGOS 2E2IB 1VQLA 1VS0A 3IFDA 1CKMA 1E7ZA 3EIVA 1MD2D 3I55A 4GNXA 1W2BA 5AJ3Q 2NVTH 2XWBB 2AWOA 4DXFA 2B63H 3H0GB 3V96A 3NENA 1QWYA 3RR5A 1LT5D 1QG7A 4LUZA 4R4IA 4LF9Q 4YY3Q 3ULPA 3T13A 1IBKQ 2B2WA 2ZTDA 2EY5A 4PMCA 2K33A 1SE4A 3S2HH 3J7A5 3BG3A 4PNYA 1EIFA 3E0JA 5EBDA 3I4MH 4B3ML 2KVMA 3W3AA 4OO1H 1PYWD 4A3IH 3RNUA 1E0BA 4PQXA 4HJ7A 3CCRA 1TY2A 4JOIA 3HKZE 2ZXRA 4A3CH 2NTSA 3CXCA 2E5LL 1ENFA 2KENA 2EVBA 3CCMA 4IALA 1STNA 2EXZA 4X62L 1CHPD 4RGMA 2BCOA 2PNHA 3AU7A 2D62A 5IT9L 3A5UA 2IX1A 2GVAA 3SK5A 3MC0B 1C48A 1UAPA 1LTRD 1JE4A 4UP9A 5M3MH 5M5XH 2JK8A 2L1BA 4RGNA 4B3MQ 2P5ZX 5C4ZA 5BN3A 3NTIA 3L2PA 1JJGA 5IY0A 2XWJB 4JI8L 3OTOL 3GTGB 4A3MH 1D2BA 2N49A 2E5LQ 5HGQA 4PG3A 2CWPA 3S1QH 1YEZA 2EY6A 3HOYG 5IYBG 3DLLA 4X62Q 1Q8IA 1RIPA 2R93B 3J81c 3BDOA 1PFMA 3PCOB 1A8VA 2X6GA 1YI2A 3MA2B 1VQEA 2EJMA 4X64L 4KKUA 4LFCL 1PHJA 3MHBA 3I4NH 5KYLA 4GN3B 5I2XA 1XWEA 3PIOA 2HT1A 2HIXA 3OOCA 3Q6SA 4JI8Q 3OTOQ 5C4JB 3QG1A 1SFOH 2QEJC 1XJVA 1SSOA 1MJCA 1IHZA 4XYQA 3MWYW 1PTOH 2RDGA 3H3VI 1O7YA 1D1IA 3K7AH 1MIUA 4M1UB 1UUPA 1I94Q 2F1MA 2I5MX 3CKIB 1Y1WG 4X64Q 3EQLC 4XQQA 4LFCQ 1EQVA 2JP1A 1KD1C 3I3CA 2E2DC 1IZ6A 3TZDA 1B44D 1I4RA 4K2LA 5C0XI 1HQRD 5M5YB 2CH4W 1WTWA 1L1OC 3G6JB 1K28A 3G71A 3BS1A 1G6PA 5JPNC 5C3EB 4JBWA 2QDLA 5KYIA 4A3FB 2MO0A 4DNIA 2UU9L 1I50H 2JE6I 2JA6B 4DU9A 3NTKA 3K5LA 2F0IA 3CRLC 3N52A 4YCUA 2PW7A 4Z9CB 4HJ8A 5I6YA 3UI2A 3JAML 5FLMG 5D3DA 4P75A 3CCLA 2K32A 2FHTA 4QIWE 4JW0A 5FO9B 1VQ8A 2SEBD 1ICWA 5IGEA 3CC2A 3CQZH 3GTPB 1EY8A 2HCIA 4CJ2C 4N9TA 1X55A 3I4OA 1EOTA 2UU9Q 1WTOA 5GADC 1JMCA 1Q3LA 1X3EA 2L55A 1XMOL 1C7YA 1ASZA 1STGA 2KECA 1RHPA 3FVQA 4TVAB 4DR2L 3T56B 4X3UA 5EPLA 1G51A 4RH6A 1I3QB 1KL9A 2JA8G 1N8RC 2AHOB 2F0TA 2G9HD 3PIO3 2R6GA 4NKLA 1Z47A 3HOXB 2MP1A 1EQTA 2ZTEA 4A75A 4CJ0B 1TVXA 3J7AF 4FXKC 2KCTA 1XMOQ 3WOEA 3G6EA 5KNBA 4IPHA 5DNFA 1SR3A 4PMBA 4B3TQ 3ERSX 1L0WA 2ICIA 1B3QA 4OWTB 4HIKA 1LO5D 3S16H 2BOSA 3OWFA 2IY5B 1ILQA 3TQYA 3DUZA 4L5QA 3RZDB 1JC7A 1KNEA 1TWFB 3GO5A 3OMCA 4RMFA 1TWCB 2K5VA 4KI0A 3KBGA 5E4WC 4XDXA 1YIJA 4JPBW 4DK1A 5FOBB 3PSIA 4Y7NB 4DV2L 4A3DB 2F0VA 3S1RB 2KCMA 2MJ8A 4DAYB 3HS0C 2XGTA 4HJ9A 2OWOA 3HOZG 1F2LA 1IXRA 1B50A 4UP8A 4TKOB 5LMUL 4YIJA 1WYDA 4A3JG 2A73B 4DV1Q 4OWWB 5IP9G 3NELA 1JCKB 2GN5A 4HIOA 2R92B 1PH8A 4NW2A 1EL0A 1AE3A 4A3LG 5C5LA 1YVCA 1DJRD 4DK0A 4BA1I 3ONAB 2JEAI 5KNCA 2F0MA 4DV2Q 5D3IB 3QJYA 1R4QB 1KDBA 5LMNQ 1Y1VG 4KY5A 3S17B 3EVQA 3TP6A 2Q8IB 5I9PA 1MSGA 2NB0A 2EE1A 1VQNA 5LMUQ 3EJIA 1JB3A 1PTOC 3L3OC 5C6AA 4FO2A 4H7BA 1WCMB 2D9UA 2PQAB 4QL5A 2IWHA 4X6AH 3HOVB 2K14A 1VQ9A 1YITA 3CW2C 2CCZA 3VYUA 2PNRC 2RVLA 2CH4A 2I46A 4ZK9B 1Y14B 4DV0L 3UDFA 2XN9C 1HNWQ 2M00A 2PI2E 3V2TA 1E2WA 5C0XG 2RKSA 1LLRD 3F2BA 3CD6A 2EXDA 2N8NA 1EFWA 2Q2UA 3QB3A 1K83H 4DN4M 1WCMG 1EUJA 3HRZC 1BCPC 4K5VA 1UEAB 3LGJA 2JEBI 2B29A 5EJWA 4WJ4A 4AYBB 1XMQL 1JORA 4A3GH 5KGUA 1SNCA 3KF8A 1MGSA 5IT9E 1KLGD 2QGQA 3G4SA 1PTOD 5GQOA 2A68C 3D6CA 3R2IA 3STBC 4DV0Q 2XRSD 1DONA 1LABA 4GN4B 4U68A 1UE5A 2GA4B 4N8FA 2VZAA 1V9PA 3NQIA 2B3GA 1OO9B 1G291 3MXPA 2ZJPA 1SBBB 3H94A 4FNFA 1GJXA 2R7DA 4F87A 4IN3A 4JI4L 4I65A 1RD9D 2FFKB 4C2MH 4X3TA 3RUZA 1HPCA 2EYFA 2K6AA 1HR0L 4BY1H 3KJOA 1L1OA 1TWGB 2A19A 5E7NA 1XMQQ 1K8GA 2Q8RE 3GTJH 1X32A 1T5XD 1N9WA 3X3NA 1X56A 2VNUD 3MXNA 4L8JA 1VDZA 1G2TA 4GNXC 3FRPB 2GVBA 2LXKA 1ICFB 1HFGA 1HTLD 1X6OA 1ONLA 1S5ED 1BCPD 1EIYB 3NE5B 2HQLA 3LX0A 4DKAC 4MTNA 3KLWA 4KHPL 2CW0C 4JI1L 1D8LA 4G7ZC 2R7ZB 4JI4Q 2E2JB 2A68D 3STBD 4CKCA 4A4IA 2B2WC 1GUOA 2F0PA 5I2YA 1KC8C 1DGSA 2A6HC 5G3LD 3J80L 3I73A 1NUCA 1SN8A 2CWAA 1TR5A 3T1HQ 1TT2A 3J7AV 1SEBD 3W1BA 1BNZA 3R3OA 3GTMB 4A3EG 4WJWA 2X6LA 1KNAA 3I8ZA 2NWGA 1PFBA 1S3OA 1VQMA 5KNDA 1SE3A 1KABA 4C3JH 5IP7G 1K8AC 4R8IA 4DV6Q 4KHPQ 3H3VH 5ELNA 4JI1Q 2AQ1B 3NHHA 2R61A 3H15A 1UWVA 2Z1CA 1W6KA 3BYTB 3AYHB 4A93B 4N9PA 4IZ8A 4A3KB 1JR0D 4IOCA 2CW0D 1SJHD 3U50C 1F2YA 5CV5A 1HUNA 4JYAL 3WDNA 1BOSA 2A6HD 3TBIB 3CMEA 2K04A 4IO9A 5ELOA 3S24A 5BR8L 1U4LA 2F0FA 4O2DA 3JAME 4AQYL 1CKNB 3PIPA 2KJXA 3NP8A 5LMNW 1SMYD 4A93G 1MKHA 3PO2H 3BZKA 4MTKA 1UNSA 3NBHB 2NVTB 1RCVD 3D4WA 1FL0A 3RZOB 2IL8A 2BH8A 3PO3H 2RDFA 5ELCA 1PZKD 1Q86C 2UUBL 4JYAQ 4IQZA 3K80C 3KFUA 2DNEA 1LUZA 5C4XH 3FMCA 1CUKA 2CHBD 2Y0SB 2Q2TA 1VQGA 2WACA 5IGBA 1E24A 5BR8Q 2DJFC 2BA1A 4AQYQ 2OT2A 1MHWC 4JVZA 3NWTA 4ZYSA 4KV6A 2IW3A 3I4MB 2HD3A 2EPBA 1UE7A 5CORA 1EY9A 2XNAC 1WJJA 1HQMC 1MSHA 1O7LA 1LT3D 1H9JA 3TDQA 4QCLA 2UUBQ 4KMUC 4NDXA 1Q8KA 3F2UA 1IKMA 1F9QA 1SE2A 2B2TA 2I07B 3P75A 3V05A 1LT6D 2XSCA 1AE2A 3E9HA 4E6IA 3ER0A 1E1OA 3PUWA 5IIFA 2OCEA 2KA7A 2LFNA 4XT3B 4MHEA 1IYJB 2Q8TA 1CHQD 3NEMA 1I6HH 4DV7L 2R7FA 1X3GA 5M3FG 4U673 4KD3A 4PV1C 3NQTA 4QF4A 1WOCA 3JAMi 2A6EC 2NTTA 4ZKBB 1LTBD 2E2HH 1K3RA 4DUZL 3I4LA 3S1QB 4B3SL 4YWMA 4TQUS 1K73C 1EY0A 1MJEA 1BKBA 2FXQA 4OEMB 1FD7D 2XIWA 2LMCB 4APVA 1CSQA 3EBEA 1B2TA 2FJ2A 1PDQA 1KXLA 4DV7Q 3I4NB 3HOUB 1C8CA 1AFPA 3HOWB 2HIVA 2WKDA 1HHVA 4CHTB 1VQFA 3M4PA 2WP8J 3FPPA 1TIID 1PH9A 4A76A 2L12A 3N6RA 1LYLA 4B3SQ 4IFDJ 1HZBA 2PQEA 2F0DA 4S3SA 3ZJYC 2VUMG 2JA5H 2NN6I 3SE0A 4BY7H 2A6ED 2RBMA 3R2TA 2EJGC 4C3IH 1EYCA 4JBMA 4OL7A 3M3YH 5A35A 1K8MA 1KAAA 3HOUG 3K59A 4OIJA 3H3VC 2A74C 3HOWG 4BBRH 2IHFA 2L0CA 2KHIA 5JEAG 3CCSA 2LXJA 4R9WA 1WTRA 2XTIA 2CVRA 3G7LA 3FKIH 1NE3A 1QUQA 3M9BA 1PLFA 4RHRA 5GAGC 1FYCA 4LMQD 1STBA 4JC0A 3CAMA 2G5DA 1STEA 1OXVA 1I50B 3MEFA 3DXJC 3C2PA 2KUMA 2ZTCA 3J81L 3MXUA 4R8NA 4BS9A 1F2MA 3FDTA 5C44B 1KIXA 3F2DA 4DR7L 2L9HA 4HJ5A 3H0GG 4O1NA 2EJFC 1M4VA 1VF7A 1GOZA 4V0BA 1J5EL 4YCVA 1T9HA 5L37A 2JN4A 4DUYL 4J1MA 1I5FA 2Q2IA 3TP7A 2RCNA 2VL6A 4RGTA 2F52A 1VQ4A 3KUPA 1BF4A 2A5HA 4WRDA 4JCVE 5EBCA 3VR4A 4IPCA 3HG9A 1DCZA 2G9DA 1YHQA 3GP7A 4GLAC 2KCCA 4P71A 1A3TA 2B2VC 2EY2A 5GROA 5C44G 4GNXB 2A1AA 2FINB 4UDUC 1IBLL 1NMFA 1ILPA 5A2QL 1HXYD 1SYDA 1ESFA 1J5EQ 3IL8A 1BQQT 1WTQA 2C5CA 4R1JA 2VQEL 3KK7A 4DNRB 3T53B 2O5IC 3PGZA 2R3ZA 1W6JA 2JJQA 4K5XA 2UXCL 1ASYA 1R4PB 3CMAA 3J80E 1JOQA 2RSOA 2EZVA 4IPGA 4UAIA 4B08A 3CC7A 1RKNA 1D7QA 3PV0A 1STAA 3D4RA 2OTJA 1VQ6A 3F2CA 5FO7B 1QVCA 1YBYA 1GM5A 1RJTA 5LL6S 4TSSA 4IFDH 1EY4A 1U4PA 4NB3A 1PH4A 3TMEA 2NVQB 5M9OA 2R93G 3Q8DA 1EYGA 2ASBA 1EZ8A 1O7IA 1LTAD 3L9AX 2UXCQ 3DWQA 5JAVA 2DUDA 3GTLH 2I5LX 2K50A 1EWCA 3ITPA 1IL8A 3A5ZB 1YHBA 4FF2A 4OGQC 3SK6A 1ENCA 4LFAL 1NY4A 3GTOH 5IYDG 3DM3A 2F4IA 2F03A 5ELDA 4HJAA 3PUZA 3URYA 4XIGS 5C5MA 2HHHL 1DOLA 2JXMB 1II3A 3VR2A 1VQCA 4CDDC 2E2IH 1K3BC 2F3WA 5IWAL 1OXTA 2MO1A 1Q12A 2F0GA 2NVXB 1R9TH 2F0OA 2F0QA 4DNTB 3H91A 4UY8C 2EDGA 2NZHA 2KOLA 4LFAQ 3I91A 4GOPC 2NN6G 1I4PA 1X3QA 4NXNL 3BZCA 1KHIA 2EYPA 3J80i 4KK7A 2JSOA 2ZXPA 1JB7A 5CC4A 3ND9A 3L0OA 3SVMA 2E75C 5EQ0A 1SNDA 2HHHQ 3GV3A 4KLKA 1GUGA 3TRZA 5C3EG 4A3FG 5IWAQ 3OWEB 4G4KA 5JJKA 1QNKA 3CU7A 3JC66 2JA6G 2LY7A 2BA0A 4RFBA 4HCSA 2EY1A 5I4DA 1CK1A 3HKZB 3L7ZC 4RG1A 4HAEA 2CQOA 3HOYH 5IYBH 3CCVA 4NXNQ 2WAQB 1WD1A 3A0JA 3E6ZX 4A3GB 5EKIA 5NUCA 4KY6A 1VQIA 2NBFA 4R4OA 4O42A 3J81j 3S1MH 4GKKL 4LNQA 1JJCB 4CGYB 2PMZB 3RLOA 3K8AA 4ZCKA 3VA5A 4CKEA 3K5OA 1EYAA 1TWAH 4OWXB 5AFWA 1GUNA 1EEID 3W2DA 1Q81C 2VW9A 1VQHA 2QA4A 4DR2Q 4LF6L 1JICA 2J4XA 4BY1B 3NXWA 2NVYH 2IPKD 2WAQG 5FKAC 3GTJB 1E2ZA 1FJGL 2RHQB 3VR6A 2R93H 1TS2A 1X54A 4GKKQ 3OIQA 3WWVA 5J39A 1SYEA 3U58A 1PRTF 3HOXG 4JI0L 4AH6A 4WJ3M 2HDMA 1Y1WH 4QB4A 3AQQA 1WTHA 5E3FA 1I4XA 2KHSA 1CQVA 4DR4L 3ULJA 4F8MA 2PZUA 2I5HA 4I7AA 1WTVA 2K7VA 2WFWA 4DPGA 4GZYC 4KTAA 1TWHH 1PXUA 1EFID 2L5TA 2OF1A 5EGTA 4C3HB 1PTOF 1VMPA 1Z6HA 2YTYA 3KLRA 1XXGA 1FJGQ 4XQNA 1PRTC 4DR1L 4BXXG 4DXGA 2L15A 4A3BB 5DEHA 5J22A 1EYDA 2WV6D 2DN8A 1AZPA 1SYCA 3VYRA 3GTKH 3SDZA 1OXSC 3RN5A 1M1KC 4A3DG 3PF5A 4X65L 4FYDA 2B2VA 1SNQA 2BH2A 4DA2A 2B2TC 2YU9H 5FLMH 3A54A 1EWHA 1TY0A 2RQXA 3BZDB 1IW7C 4C3HG 2R92G 2AMCB 3OW2A 1H9SA 5EPKA 4DR1Q 4G57A 2AQ3B 1BCPF 3W1GA 4A3FH 4ZRZA 1KQSA 2WB1B 4ODGA 3T1YL 3S2DB 1BO0A 5C0XJ 1EZ6A 3AFPA 3LNNA 2JA6H 4UP7A 1RTOA 4LFBL 3HKSA 3K0YA 3AMUA 4BBSB 2F0KA 1A0IA 3PUVA 1V1QA 4X65Q 1PRTD 4LJZC 3J81E 1J6QA 1RF2D 1LT4D 3KYHC 1PH7A 5G3LF 2JA8H 1TU2B 1ZEQX 5J3BA 3HOVG 3GTPH 3S15B 3AEVA 4TRDA 2TSSA 3TSSA 1A2TA 1YNNC 2VS1A 2WB1G 5IGDA 5CBEE 3T1YQ 1XPUA 3MXGA 3PO3B 4GN5A 5CYUA 3NSWA 5M5WB 1QE6A 1NR4A 4LFBQ 1Z7TA 1IW7D 1BBXC 4KKTA 1G8ZD 4BBSG 5C4XB 3DM1A 3VYSA 1BBWA 1BBUA 2H5XA 5K5PA 1PH3A 1JE5A 1F9SA 2AKWB 3OMGA 5CV9A 3MZ5A 1I3QH 2BDNA 2K5QA 2UUAL 1STHA 2N88A 4XTCS 1EY6A 5A2QE 1SDFA 4POGA 2YYZA 1ML0D 4KJNA 3OPOA 4AYBG 4ZQ3A 3H09A 1SYGA 2EYOA 1B53A 1QB5D 2Z4HA 1HZAA 3HOZH 2HUGA 1SLJA 1QZGA 4L63B 1B3AA 1NNXA 1O78A 3NTHA 4OX9L 4OELB 1I4HA 2BDOA 2EQSA 2JA7B 4K6LA 4A3JH 1YNND 5IP9H 4GOPA 1LTTD 3GTQH 4A3LH 3KDFA 1SXTA 3RZDH 1HR0Q 4LF8L 1TWFH 2RSNA 1KRTA 1I6HB 1VCIA 1XX8A 3OIPA 2EYMA 3J81i 4K8JA 1S5FD 4KN7C 3U9OA 5JJZA 3KF8B 4Y7NH 2EYLA 1FR3A 1Y1VH 1B9NA 2PI2A 2TMPA 3PQIA 4NMZA 4R4TA 3KOJA 3DWPA 1X3PA 1HA5A 2VQFL 4JI6L 4K5WA 1DYQA 1KTKA 2QDBA 2JA7G 1NJIC 1N34L 2I0QA 4DAMA 2KHJA 2WIIB 3D6WA 5EPJA 2X69A 1Q1BA 4Y52H 2Z8LA 1OXXK 3I7FA 2R7ZG 3KF6A 1TS4A 4LF8Q 3TP8A 2MGSA 4LW1A 4LWCA 1L0YB 1L1OB 1SNPA 5CR3A 1HTPA 3TZUA 2FMMA 4N8X1 2K1BA 5HGTA 5JJLA 1JOKA 2QKIC 1JWSD 1BR9A 1JOOA 3MXNB 5C0XH 3DHQA 5COYA 1QCBD 3A8IE 2KEEA 2VQFQ 4JI6Q 3AFQA 4POFA 3D31A 3MTSA 2JA5B 4L5TA 1N34Q 1WCMH 4JG2A 5ISRA 1XNRL 5K36G 4BY7B 3CCQA 2JA9A 3HZXA 4QMGA 4C3IB 1G91A 1N32L 4MN3A 4CDCC 4XYOA 5KRUA 5FJ8G 4X3SA 4WORA 3CPWA 4A3KG 5CBAE 5GAHC 3K5MA 4ULLA 4BBRB 5IYCG 1DM0B 1TQOA 2B63B 4OONA 1J9OA 3FKIB 2H4OA 1GXDC 3K7UC 1SNOA 1EWIA 2K52A 2SOBA 1AZQA 1XNRQ 1V1PA 1Z9FA 4RAUC 1N32Q 3S2HB 1Y8OB 1SYFA 1M90C 1N36L 2K01A 3P20A 3FPUB 3Q0AA 4A3IB 2DGYA 2ID0A 2QEXA 1JWMD 3RN2A 2B63G 1B8AA 1CSPA 3K57A 2K4KA 3DEOA 2Y0SG 2F0EA 3M7GA 2K5HA 4DR6L 2F0WA 1TWGH 4LF7L 1TS3A 3HGBA 1CQFA 1F2ZA 1BXTA 2ALYB 1AH9A 1WI5A 3FEWX 5M3MB 1E1TA 5M5XB 1N36Q 4XT1B 3NK9A 1AEXA 3A7LA 1DOKA 1ZYRC 1QVFA 3G48A 1F77A 1V1OA 2Z4IA 1GVPA 3I4MG 3GDEA 4RCOA 1CA6A 1RL2A 4A3EH 3A74A 1KDAA 2IHEA 4KHVA 4L6TB 4A3CG 4A3MB 1Q82C 1J8IA 5IP7H 4IPDA 4DF7A 1GHJA 1RTNA 2E2JH 4EQ5A 3QOJA 4K6DA 3VYTA 4DR6Q 1VQOA 2OTLA 4ALPA 3E0EA 4LF7Q 1PFNA 4HMIA 1E3PA 1FGUA 2ZXOA 4B9WA 4K2KA 1PRTB 1TS5A 4J8QA 1PH5A 5IGGA 1RDPD 1E22A 3C46A 3GTMH 4FF3A 1S72A 1HCZA 1GKHA 2N3SA 2QW7A 4HEDA 2VY3A 5IGFA 4A3MG 1HR0W 4LAAA 4YWLA 1SFOB 4DUZQ 1YHAA 2O2LD 3EN2A 1P16A 4XQJA 1ZYRD 1K0SA 2DJGC 1PYBA 5I6WA 1PTOB 2Z6KC 5FO8B 1N33L 4A93H 1WTPA 2E76C 3BU2A 3K7AB 5ELBA 3S14H 4V190 2E74C 5AJ3L 1NAPA 4JV5L 5JEAJ 3I4NG 1X3FA 3Q22A 2RCFA 5ELEA 1FVIA 1JT8A 5IGCA 2CFMA 3E5SA 2QCPX 2KEDA 3DEPA 3LWUA 4KJOA 1N33Q 3AB9A 3PF4A 1PFSA 1F9PA 4JI2L 1BCPB 4F88A 1IKLA 4RKLA 2IJ0A 1XPOA 1R9TB 1U0LA 3MEHA 5ELFA 4JV5Q 5DAUA 3RZOH 1HUMA 1HNZL 1DZ1A 1S5CD 1C4QA 3CC4A 1LTLA 5EAYA 2ICEC 3KLSA 5FLXL 1SAPA 5E4XA 1VQAA 2WINB 3M4OH 3DWAA 3C3LA 3CQZB 2HCCA 2MFIA 3SR1A 3ZYYX 4UHVA 4JI2Q 3P1HA 4ABNA 5M3FH 1M8AA 1VF5C 3ERQA 2JQOA 4PZ6A 1VQDA 5IOCA 1H95A 3CRKC 5JJIA 2Z9HA 1HNZQ 4ME5A 4EQNA 2EYHA 2WAQE 3HOYB 4DR7Q 4HSPA 4MZ9A 3OSOA 4HCEA 4XXEA 3M85A 3MAQA 4DUYQ 3S1MB 1I4GA 1QUQB 2Q2HA 4EGVA 5BN4A 2PMZE 4DAVA 2XVSA 3EFXD 4JI7L 3MFYA 1B1ZA 1CM9A 4FP5D 1TWAB 3UE0A 4RCNA 2OQKA 2BE5C 1A62A 5CV6A 5FLXc 5D14A 3Q24A 3CCEA 5TSSA 1VMCA 2NVYB 1IBLQ 3HP3A 3S16B 3T16A 2ZJRA 2VUMH 2RHSB 2EOTA 3EROA 2M2LA 3IFTA 4RKBA 3OYYA 2E8GA 2J0TD 4ZLTF 2VQEQ 3GQBA 1I94L 4B9XA 1Y1WB 4JI7Q 1LTGD 3HOUH 3S1NH 1RODA 3K0XA 3HOWH 2HQEA 1ENAA 4G7HC 5C3XA 4GS3A 3I56A 5JEAH 3X3MA 3GD7A 5IT9c 2F0JA 1TWHB 3UDXA 1BVSA 1D5XC 3UDGA 5T1GA 3M4YA 1JWUD 4KKSA 1QJOA 1YJWA 3E3XA 1A2UA 2PCFB 3BDLA 2JYOA 1X65A 2BE5D 4B3RL 2N78A 5E1FA 2KQ3A 1V8QA 3KBXA 1OXUA 3GTKB 3H6MA 1S5BD 3HFZB 3A8KE 4QY7A 1H9RA 4KHZA 4BWGB 3I2ZA 3ND8A 5DM73 2YU9B 3CP0A 3U4ZA 4QQBX 4IUNA 3H0GH 3S9WA 4LF4L 4DFAA 4GLXA 1PVOA 1HH2P 3MFGA 3VA7A 3IRBA 1DOMA 1ET6A 4IOAA 5CMDA 2WB1E 3TP5A 2B2UC 2NUCA 3SGIA 4B3RQ 1UEBA 2M9VA 3QWNA 1XPRA 1EQRA 1YNXA 3SEBA 5CGKA 1HA6A 4RWSC 3F8TA 4ZUIA 1HZCA 1FNVA 1D1KA 4I7ZC 5C44H 2V4DA 4P74A 1EIGA 1QVGA 2K75A 3R93A 1K83B 4LF4Q 2JA8B 2VB2X 2RDHA 5EKLA 5FK9C 1SE8A 3D4DA 4AYBE 2B2YC 3ICEA 3J7ZC 1ESRA 4NP5A 1S4ZA 5CV7A 4DR5L 3HEJA 2Z6KA 4IUVA 3PUYA 4IUUA 4RHSA 4DAYA 1D6EC 4DAPA 2K5WA 2ES2A 4IUQA 2F4VL 2PZTA 2L11A 1JJ2A 2F0HA 3ULLA 4B3TL 2K28A 3E9IA 2MNAA 3FHWA 3WOFA 3GTGH 4F7XA 2DY8A 3TN2A 3HKZG 4C2MB 2OQ0A 4LUOA 4IJLA 4WFN3 2CQAA 2SNMA 2DY7A 4NPSA 4DR5Q 4A3GG 4BA2I 1EIHA 3BVZA 1CZWA 1W3SA 4ILWA 3JAMc 3HOZB 3QOLA 4CDEC 2F4VQ 1MI2A 3SHLA 1D5MC 1G2SA 3CCJA 1SNMA 4A3JB 2PQAA 3D0FA 4DV1L 2C35B 2PPBC 5IYDH 2VXWA 5C4JH 3GTQB 1NBWA 4LF6Q 4BY1G 3K81C 1KLUD 1I6VC 3MVVA 3QO2A 1WTXA 1YJ9A 4IJHA 2NVQH 1FNUA 3U4VA 2K5NA 3NUCA 3RLFA 3UE1A 4P73A 4PZ7A 3BYYB 3VDYA 1Y1VB 2B39A 2OEOA 5LMNL 4JI0Q 4LUVA 3O13A 4JK1C 1Y8NB 2EYJA 2L4NA 2YTVA 4HR7B 1TKWB 4J6HA 1SMXA 3K5NA 4X66L 1H9KA 4C3JB 3CCUA 1L2FA 4DR4Q 2PW5A 2NN6H 2N55A 2A69C 4KD4A 1Y69U 2K03A 3IAYA 1IYVA 1A3UA 5M5YH 4GLVB 4RA8A 2NYZD 4L5SA 1KDCA 3BVMA 2O4XA 5LL6X 1ZXTA 5C3EH 1XNQL 2IX0A 1HNWL 3I72A 1PYSB 4A3BG 4H13C 4MIUA 5T1IA 3KLSX 2NVXH 1SJED 1HJPA 1JQYD 4KN4C 4IUTA 1A3VA 2A8VA 1SROA 1D5ZC 1B7YB 1UE6A 4KY7A 1PMRA 3TS2A 4X66Q 4Q5VA 4C3JG 2D5DA 4PMWA 2XRQD 2KBNA 4YHHL 2V1CC 1K9MC 3FP9A 2F3IA 5FLXE 1A6XA 4QIWB 2F0LA 2AUJD 3NBIA 4FXGC 3TEHB 1HNXL 3PO2B 5JOBA 4M8AA 1XNQQ 1F9RA 4HTHA 4P72A 2A69D 3GV6A 2UXDL 4ID6A 2HDLA 1AW7A 1LTID 2Y0SE 1NSNS 4OO1I 4YHHQ 2PZWA 3T4AC 3PUXA 2UXBL 2LSSA 4EQPA 1WFQA 4X3KA 1GHKA 2ZT9C 1HNXQ 3BDCA 1EY7A 4EX5A 2MPMA 3PO2G 3HOXH 1QNUA 1H9SB 1QILA 2PO4A 3P7JA 1UE1A 1VQ5A 4PZ8A 4LF5L 4QGUA 2UXDQ 4AIMA 4L5RC 1C9OA 1LTSD 4FDBA 3J7YW 1IBML 3M7NA 2H1EA 4R4QA 5IE8A 3PO3G 2AQ2B 1GUTA 1K8OA 1PZID 2B8GA 1CFMA 5C4XG 4DR3L 1NTGA 4ZKCB 3LWEA 3SK8A 2J7ZA 3TS0A 1YNJC 2CKZB 3VR3A 2UUAQ 2UXBQ 4HSVA 2LS01 4BXXH 2K5DA 3T1HL 2ENBA 2B2UA 1U5KA 1TWCH 1CZGA 4JBJA 4LF5Q 4A3EB 2D0OA 1NCVA 2ZM6L
chains in the Genus database with same CATH topology
1XTCD 1G6ZA 3RMHA 2E2HB 2VB3X 2F3VA 5JVH3 3PMFA 1CI3M 1MBYA 1STYA 1Y8PB 5D65A 2B2YA 3Q23A 3DMUA 4IFDI 3NBHA 1T5EA 3A56A 1A15A 3QIAA 1E2VA 4FVMA 3A55A 1EEFD 1FGBD 2F0UA 1Q90A 1YNJD 1SMYC 4P2CB 1CT1D 1U4MA 1CA5A 5C4HA 4Q0FA 1I4QA 2NZ1D 1DXMA 4FF4A 2MHVA 5DM63 3D3RA 1U4RA 3OHXC 2IX3A 3S14B 2DNCA 3D8GA 2OXPA 2QILA 3M3YB 3C1EA 5JVG3 4OHJA 1XYIA 1CTMA 1V43A 3R8BA 5HURA 4QUFA 3IKJA 4H44C 4HN7A 3SK4A 4DGZA 1HRJA 4CKBA 1B4OA 4LK1C 2F0SA 5LHY1 3VR5A 1GUWA 3CHBD 5EKKA 1NR2A 4C3IG 1GUSA 3SXHA 4IUPA 2SDFA 5F2DA 1IYUA 4OIKA 2F0NA 2PYKA 3BVGA 3C1FA 2K05A 4CBVA 5C3WA 4G7OC 3M4OB 1SYBA 2QF7A 2O5JC 2SNSA 4C1NI 2KCNA 1EU4A 5M3FB 3NWSA 1DD2A 2WKCA 4OO1G 3A7AB 2FMCA 5KIXA 2LKVA 2MUYA 5I9OA 1AP0A 2AWNA 1U9RA 4C1NK 3I70A 5CV4A 4HMJA 3A8JE 5J1ZA 1V1PB 1AN8A 1O7ZA 3K6OA 5BN5A 1LV9A 1BUVT 3U9SA 4ZAIA 5KEEA 1Q1EA 1QOHA 1B9MA 1L0XB 3I90A 4EQOA 4K14A 2VUMB 3RD4A 4FXDA 1H9MA 4CJ1B 1ET9A 1S5DD 4H0LC 3NPPA 1PZJD 4C56C 4IURA 5K36H 2AUKA 1WVLA 1WD0A 2C9OA 4QUCA 1BDOA 2D2CC 1FNWA 4ZUJA 3S1NB 3GTLB 3PIP3 3T51B 5JPMC 3OW7A 5IODA 3K58A 1EU3A 1O80A 2B8FA 2IT1A 5CV8A 4K8IA 3GTOB 4IFDG 1HFNA 1LACA 1ZKOA 3EA6A 1EY5A 4EVOA 2RA4A 4FF1A 4RGOS 2E2IB 3IFDA 1MD2D 2XWBB 2AWOA 4DXFA 3H0GB 3V96A 1QWYA 1LT5D 1QG7A 3T13A 2B2WA 2EY5A 4PMCA 2K33A 1SE4A 3BG3A 4PNYA 5EBDA 3E0JA 2KVMA 3W3AA 4OO1H 1PYWD 1E0BA 4PQXA 1TY2A 2ZXRA 2NTSA 1ENFA 2EVBA 4IALA 1STNA 2EXZA 1CHPD 4RGMA 2BCOA 3AU7A 2D62A 5IT9L 2IX1A 3SK5A 3MC0B 1C48A 1UAPA 1LTRD 1JE4A 2L1BA 4RGNA 5C4ZA 5BN3A 3NTIA 2XWJB 3GTGB 1D2BA 2EY6A 1Q8IA 2R93B 3BDOA 1PFMA 2X6GA 3MA2B 2EJMA 4KKUA 3MHBA 5KYLA 5I2XA 1XWEA 3OOCA 3Q6SA 5C4JB 3QG1A 2QEJC 1SSOA 1IHZA 4XYQA 3MWYW 1PTOH 2RDGA 1D1IA 1O7YA 4M1UB 1UUPA 2F1MA 3CKIB 3EQLC 4XQQA 1EQVA 2JP1A 3I3CA 2E2DC 3TZDA 1B44D 1I4RA 4K2LA 5C0XI 1HQRD 5M5YB 1WTWA 3G6JB 3BS1A 5JPNC 5C3EB 4JBWA 5KYIA 4A3FB 2JE6I 2JA6B 4DU9A 3NTKA 3K5LA 2F0IA 3CRLC 3N52A 2PW7A 4Z9CB 5I6YA 3UI2A 3JAML 5D3DA 2K32A 2FHTA 5FO9B 2SEBD 1ICWA 5IGEA 3GTPB 1EY8A 2HCIA 4CJ2C 4N9TA 1EOTA 1WTOA 1Q3LA 2L55A 1STGA 2KECA 1RHPA 3FVQA 3T56B 4X3UA 5EPLA 4RH6A 1I3QB 2F0TA 2G9HD 3PIO3 2R6GA 4NKLA 1Z47A 3HOXB 2MP1A 1EQTA 4CJ0B 1TVXA 3J7AF 4FXKC 3WOEA 5KNBA 5DNFA 4PMBA 2ICIA 1LO5D 2BOSA 3OWFA 1ILQA 3DUZA 3RZDB 1JC7A 1KNEA 1TWFB 3GO5A 3OMCA 1TWCB 5E4WC 4KI0A 3KBGA 4XDXA 4DK1A 5FOBB 4Y7NB 4A3DB 2F0VA 3S1RB 2MJ8A 3HS0C 1F2LA 1B50A 4TKOB 4YIJA 2A73B 1JCKB 2R92B 4NW2A 1EL0A 5C5LA 1DJRD 4DK0A 4BA1I 3ONAB 2JEAI 5KNCA 2F0MA 5D3IB 3QJYA 1R4QB 1KDBA 4KY5A 3S17B 3EVQA 3TP6A 2Q8IB 5I9PA 1MSGA 2NB0A 2EE1A 3EJIA 1JB3A 1PTOC 3L3OC 5C6AA 4FO2A 4H7BA 1WCMB 2D9UA 2IWHA 3HOVB 3VYUA 2PNRC 2RVLA 4ZK9B 2I46A 2XN9C 2M00A 3V2TA 1E2WA 5C0XG 2RKSA 1LLRD 3QB3A 4DN4M 3HRZC 1BCPC 4K5VA 1UEAB 2JEBI 5EJWA 4AYBB 1JORA 5KGUA 1SNCA 3KF8A 1MGSA 5IT9E 1KLGD 1PTOD 2A68C 3D6CA 3R2IA 2XRSD 1DONA 1LABA 4U68A 2GA4B 3NQIA 1OO9B 1G291 3MXPA 1SBBB 3H94A 4FNFA 1GJXA 4F87A 4IN3A 4I65A 1RD9D 2FFKB 4X3TA 3RUZA 1HPCA 2EYFA 2K6AA 1TWGB 2Q8RE 1X32A 1T5XD 3X3NA 2VNUD 3MXNA 4L8JA 1VDZA 1G2TA 3FRPB 1HFGA 1HTLD 1ONLA 1S5ED 1BCPD 3NE5B 3LX0A 2CW0C 4G7ZC 2R7ZB 2E2JB 2A68D 4CKCA 2B2WC 1GUOA 2F0PA 5I2YA 2A6HC 5G3LD 3J80L 3I73A 1NUCA 1TR5A 1TT2A 3J7AV 1SEBD 1BNZA 3R3OA 3GTMB 4WJWA 2X6LA 1KNAA 3I8ZA 2NWGA 1PFBA 5KNDA 1SE3A 1KABA 4R8IA 2AQ1B 3NHHA 2R61A 2Z1CA 1W6KA 3BYTB 4A93B 4N9PA 4IZ8A 4A3KB 1JR0D 2CW0D 1SJHD 1F2YA 5CV5A 1HUNA 3WDNA 1BOSA 2A6HD 3TBIB 2K04A 1U4LA 2F0FA 3JAME 2KJXA 3NP8A 1SMYD 1UNSA 2NVTB 1RCVD 3D4WA 3RZOB 2IL8A 2RDFA 5ELCA 1PZKD 4IQZA 2DNEA 3FMCA 2CHBD 2Y0SB 2WACA 5IGBA 2BA1A 2OT2A 3NWTA 4ZYSA 4KV6A 2IW3A 3I4MB 2EPBA 5CORA 1EY9A 2XNAC 1HQMC 1MSHA 1LT3D 1O7LA 1H9JA 3TDQA 4QCLA 4KMUC 4NDXA 3F2UA 1IKMA 1F9QA 1SE2A 2B2TA 2I07B 3P75A 3V05A 1LT6D 2XSCA 4E6IA 3PUWA 5IIFA 2KA7A 2LFNA 4XT3B 4MHEA 2Q8TA 1CHQD 4U673 4KD3A 4PV1C 3NQTA 4QF4A 2A6EC 2NTTA 4ZKBB 1LTBD 3I4LA 3S1QB 4TQUS 1EY0A 1FD7D 2XIWA 2LMCB 1B2TA 2FJ2A 1PDQA 3I4NB 3HOUB 1C8CA 1AFPA 3HOWB 2WKDA 1HHVA 4CHTB 2WP8J 3FPPA 1TIID 2L12A 3N6RA 4IFDJ 2PQEA 2F0DA 4S3SA 2NN6I 3SE0A 2A6ED 2RBMA 3R2TA 2EJGC 1EYCA 4OL7A 5A35A 1K8MA 1KAAA 3K59A 4OIJA 3H3VC 2A74C 2L0CA 5JEAG 4R9WA 1WTRA 2CVRA 3G7LA 1PLFA 4RHRA 1FYCA 4LMQD 1STBA 1STEA 1OXVA 1I50B 3DXJC 3C2PA 2KUMA 3J81L 3MXUA 4R8NA 4BS9A 1F2MA 3FDTA 5C44B 2L9HA 4O1NA 2EJFC 1M4VA 1VF7A 1GOZA 4V0BA 4J1MA 3TP7A 4RGTA 3KUPA 1BF4A 2A5HA 4WRDA 5EBCA 3VR4A 3HG9A 1DCZA 2G9DA 3GP7A 2KCCA 1A3TA 2B2VC 2EY2A 2FINB 4UDUC 1ILPA 5A2QL 1HXYD 1SYDA 1ESFA 3IL8A 1BQQT 1WTQA 2C5CA 3KK7A 4DNRB 3T53B 2O5IC 2R3ZA 1W6JA 4K5XA 1R4PB 3J80E 1JOQA 2RSOA 2EZVA 4UAIA 4B08A 1RKNA 3PV0A 1STAA 3D4RA 5FO7B 1RJTA 5LL6S 4TSSA 4IFDH 1EY4A 1U4PA 3TMEA 2NVQB 5M9OA 1EZ8A 1LTAD 3L9AX 3DWQA 5JAVA 1EWCA 3ITPA 1IL8A 4FF2A 4OGQC 3SK6A 1ENCA 2F4IA 2F03A 5ELDA 3PUZA 3URYA 4XIGS 5C5MA 1DOLA 2JXMB 1II3A 3VR2A 2F3WA 1OXTA 1Q12A 2F0GA 2NVXB 2F0OA 2F0QA 4DNTB 3H91A 2EDGA 2KOLA 3I91A 2NN6G 1I4PA 1X3QA 2EYPA 4KK7A 2JSOA 2ZXPA 5CC4A 3ND9A 3SVMA 2E75C 5EQ0A 1SNDA 3GV3A 1GUGA 3OWEB 4G4KA 1QNKA 3CU7A 2LY7A 2BA0A 4RFBA 4HCSA 2EY1A 5I4DA 1CK1A 3HKZB 3L7ZC 4HAEA 2WAQB 1WD1A 3E6ZX 4A3GB 5EKIA 5NUCA 4KY6A 2NBFA 4O42A 4CGYB 2PMZB 3VA5A 4CKEA 3K5OA 1EYAA 5AFWA 1GUNA 1EEID 3W2DA 1JICA 2J4XA 4BY1B 3NXWA 2IPKD 5FKAC 3GTJB 1E2ZA 3VR6A 1TS2A 3OIQA 5J39A 1SYEA 1PRTF 2HDMA 4QB4A 5E3FA 1I4XA 2KHSA 1CQVA 4F8MA 2PZUA 1WTVA 2K7VA 4GZYC 4KTAA 1PXUA 1EFID 2L5TA 2OF1A 5EGTA 4C3HB 1PTOF 1VMPA 1Z6HA 3KLRA 1XXGA 4XQNA 1PRTC 4DXGA 4A3BB 5DEHA 5J22A 1EYDA 2WV6D 2DN8A 1AZPA 1SYCA 3VYRA 3SDZA 1OXSC 4FYDA 2B2VA 1SNQA 4DA2A 2B2TC 3A54A 1EWHA 1TY0A 2RQXA 3BZDB 1IW7C 4C3HG 1H9SA 5EPKA 4G57A 2AQ3B 1BCPF 4ZRZA 2WB1B 4ODGA 3S2DB 1BO0A 5C0XJ 1EZ6A 3LNNA 1RTOA 3K0YA 3AMUA 4BBSB 2F0KA 3PUVA 1PRTD 4LJZC 3J81E 1RF2D 1LT4D 5G3LF 1TU2B 1ZEQX 3S15B 4TRDA 2TSSA 3TSSA 1A2TA 1YNNC 5IGDA 5CBEE 3MXGA 3PO3B 5CYUA 3NSWA 5M5WB 1QE6A 1NR4A 1Z7TA 1IW7D 1BBXC 4KKTA 1G8ZD 5C4XB 3DM1A 3VYSA 5K5PA 1F9SA 5CV9A 3OMGA 3MZ5A 2BDNA 2K5QA 1STHA 2N88A 4XTCS 1EY6A 5A2QE 1SDFA 2YYZA 1ML0D 4KJNA 3OPOA 4ZQ3A 3H09A 1SYGA 2EYOA 1B53A 1QB5D 2Z4HA 2HUGA 4L63B 1B3AA 1O78A 3NTHA 1I4HA 2BDOA 2JA7B 4K6LA 1YNND 1LTTD 1SXTA 2RSNA 1I6HB 1VCIA 1XX8A 3OIPA 2EYMA 4K8JA 1S5FD 4KN7C 3U9OA 5JJZA 2EYLA 1FR3A 1B9NA 2TMPA 4NMZA 3DWPA 1X3PA 1HA5A 4K5WA 1DYQA 1KTKA 2QDBA 2WIIB 3D6WA 5EPJA 2X69A 1Q1BA 2Z8LA 1OXXK 1TS4A 3TP8A 2MGSA 1L0YB 1SNPA 5CR3A 1HTPA 3TZUA 2FMMA 2K1BA 5HGTA 1JOKA 2QKIC 1JWSD 1BR9A 1JOOA 5C0XH 3DHQA 5COYA 1QCBD 3A8IE 2KEEA 3D31A 3MTSA 2JA5B 4BY7B 5ISRA 5K36G 3HZXA 4QMGA 4C3IB 1G91A 4MN3A 4XYOA 5KRUA 4X3SA 4WORA 5CBAE 3K5MA 4ULLA 4BBRB 1DM0B 1TQOA 2B63B 1J9OA 3FKIB 2H4OA 1GXDC 1SNOA 2SOBA 1AZQA 1V1PA 4RAUC 3S2HB 1Y8OB 1SYFA 2K01A 3P20A 3FPUB 3Q0AA 4A3IB 2ID0A 1JWMD 3K57A 3DEOA 2F0EA 3M7GA 2F0WA 1TS3A 3HGBA 1CQFA 1F2ZA 1BXTA 3FEWX 5M3MB 5M5XB 4XT1B 3NK9A 1AEXA 3A7LA 1DOKA 1ZYRC 1F77A 1V1OA 2Z4IA 4RCOA 1CA6A 1KDAA 4KHVA 4L6TB 4A3MB 1J8IA 4DF7A 1GHJA 1RTNA 3QOJA 3VYTA 4K6DA 1PFNA 4HMIA 4B9WA 2ZXOA 4K2KA 1PRTB 1TS5A 4J8QA 5IGGA 1RDPD 3C46A 4FF3A 1HCZA 4HEDA 5IGFA 4LAAA 1SFOB 2O2LD 4XQJA 1ZYRD 5I6WA 1PTOB 5FO8B 1WTPA 2E76C 3K7AB 5ELBA 4V190 2E74C 1NAPA 5JEAJ 3Q22A 5ELEA 5IGCA 3E5SA 2QCPX 2KEDA 3DEPA 3LWUA 4KJOA 3AB9A 1F9PA 1BCPB 4F88A 1IKLA 4RKLA 2IJ0A 1R9TB 3MEHA 5ELFA 5DAUA 1HUMA 1DZ1A 1S5CD 1C4QA 2ICEC 3KLSA 5FLXL 1SAPA 5E4XA 2WINB 3DWAA 3C3LA 3CQZB 2HCCA 3SR1A 3ZYYX 3P1HA 4ABNA 1M8AA 1VF5C 3ERQA 5IOCA 3CRKC 4ME5A 4EQNA 2EYHA 3HOYB 4HSPA 3OSOA 4HCEA 4XXEA 3M85A 3MAQA 3S1MB 1I4GA 4EGVA 5BN4A 4DAVA 2XVSA 3EFXD 3MFYA 1B1ZA 1CM9A 4FP5D 1TWAB 4RCNA 2BE5C 5CV6A 5D14A 3Q24A 5TSSA 1VMCA 2NVYB 3HP3A 3S16B 3T16A 2EOTA 3EROA 2M2LA 3IFTA 4RKBA 2J0TD 4ZLTF 3GQBA 4B9XA 1Y1WB 1LTGD 1RODA 2HQEA 1ENAA 4G7HC 5C3XA 5JEAH 3X3MA 3GD7A 2F0JA 1TWHB 1D5XC 5T1GA 3M4YA 1JWUD 4KKSA 1QJOA 1A2UA 2PCFB 3BDLA 2JYOA 2BE5D 5E1FA 2KQ3A 1V8QA 3KBXA 1OXUA 3GTKB 3H6MA 1S5BD 3A8KE 1H9RA 4KHZA 4BWGB 3ND8A 5DM73 2YU9B 4IUNA 3S9WA 4DFAA 3MFGA 3VA7A 1DOMA 1ET6A 5CMDA 3TP5A 2B2UC 2NUCA 2M9VA 3QWNA 3SEBA 5CGKA 1HA6A 4RWSC 4ZUIA 1FNVA 1D1KA 4I7ZC 2V4DA 1EIGA 3R93A 1K83B 2JA8B 2VB2X 2RDHA 5EKLA 5FK9C 3D4DA 2B2YC 1ESRA 4NP5A 1S4ZA 5CV7A 3HEJA 4IUVA 3PUYA 4IUUA 4RHSA 4DAYA 1D6EC 4DAPA 2K5WA 4IUQA 2PZTA 2L11A 2F0HA 2K28A 3WOFA 4F7XA 2DY8A 3TN2A 4C2MB 4WFN3 2CQAA 2SNMA 2DY7A 4BA2I 1EIHA 3BVZA 1CZWA 4ILWA 3HOZB 3QOLA 1MI2A 3SHLA 1D5MC 1G2SA 1SNMA 4A3JB 2PPBC 2VXWA 3GTQB 1KLUD 1I6VC 3MVVA 3QO2A 1WTXA 1FNUA 3NUCA 3RLFA 3BYYB 1Y1VB 2B39A 2OEOA 3O13A 4JK1C 1Y8NB 2EYJA 2L4NA 4HR7B 1TKWB 4J6HA 3K5NA 4C3JB 1H9KA 2PW5A 2NN6H 2N55A 2A69C 4KD4A 1Y69U 2K03A 3IAYA 1IYVA 1A3UA 4RA8A 2NYZD 1KDCA 3BVMA 2O4XA 5LL6X 1ZXTA 2IX0A 3I72A 4H13C 4MIUA 5T1IA 3KLSX 1SJED 1JQYD 4KN4C 4IUTA 1A3VA 1D5ZC 4KY7A 1PMRA 4Q5VA 4C3JG 2D5DA 4PMWA 2XRQD 5FLXE 1A6XA 4QIWB 2F0LA 2AUJD 3NBIA 4FXGC 3PO2B 5JOBA 4M8AA 1F9RA 4HTHA 2A69D 3GV6A 4ID6A 2HDLA 1AW7A 1LTID 1NSNS 4OO1I 2PZWA 3T4AC 3PUXA 4EQPA 4X3KA 1GHKA 2ZT9C 3BDCA 1EY7A 2MPMA 1QNUA 1H9SB 1QILA 2PO4A 3P7JA 1LTSD 3J7YW 3M7NA 2H1EA 2AQ2B 1GUTA 1K8OA 1PZID 2B8GA 1CFMA 4ZKCB 3LWEA 3SK8A 2J7ZA 1YNJC 3VR3A 4HSVA 2LS01 2K5DA 2ENBA 2B2UA 1CZGA 4A3EB 1NCVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MXP A;  1STA A;  4ME5 A;  4EQN A;  1A3U A;  5HGT A;  1JOK A;  3OMC A;  1EQV A;  2EYH A;  1JOO A;  3D4W A;  3DHQ A;  5CGK A;  2RBM A;  3T13 A;  4HMI A;  1KDC A;  3OSO A;  4I65 A;  4ZUI A;  4B9W A;  2F3V A;  4K2K A;  2O4X A;  2RDF A;  3RUZ A;  1EYC A;  2EYF A;  2EY5 A;  3PMF A;  1EY4 A;  4K2L A;  4PMC A;  2F0V A;  4OL7 A;  3VA5 A;  5IGG A;  4TRD A;  1EYA A;  2F0D A;  1A2T A;  1STY A;  1KAA A;  4MIU A;  4PNY A;  2WAC A;  5IGB A;  5IGD A;  5ISR A;  3TME A;  5EKL A;  5KIX A;  3DMU A;  5M9O A;  2LKV A;  3D4D A;  1A3V A;  3HZX A;  5IGF A;  4QMG A;  4LAA A;  1EZ8 A;  4YIJ A;  5I9O A;  3NXW A;  4KY7 A;  5KYI A;  5KRU A;  4NP5 A;  5JAV A;  5CV7 A;  3HEJ A;  4KY6 A;  1U9R A;  4KV6 A;  4WOR A;  3LX0 A;  5CV6 A;  2F0U A;  5CV4 A;  4IAL A;  5I6W A;  4HMJ A;  3ITP A;  5C5L A;  5K5P A;  1STN A;  5J1Z A;  1EY9 A;  5J39 A;  4DU9 A;  2EXZ A;  3OMG A;  5CV9 A;  3MZ5 A;  1SYE A;  1TQO A;  2F0I A;  5C4H A;  2PZT A;  1STH A;  3SK6 A;  1ENC A;  3T16 A;  1EY6 A;  1STB A;  2F0L A;  3ERO A;  2F0M A;  2PW7 A;  4QB4 A;  5I6Y A;  4RKB A;  3SK5 A;  2F0H A;  4KJN A;  5JOB A;  5KEE A;  5E3F A;  2F0P A;  1KDB A;  4NDX A;  1SNO A;  4HTH A;  4ZQ3 A;  1SYG A;  2KHS A;  3P75 A;  4KY5 A;  4F7X A;  5C5M A;  4EQO A;  2SOB A;  2PZU A;  1NUC A;  3EVQ A;  4K14 A;  3TP6 A;  4F8M A;  2EYO A;  5I9P A;  4ID6 A;  1TR5 A;  4R8N A;  4B9X A;  1F2M A;  5IGE A;  1TT2 A;  3D8G A;  4KTA A;  1II3 A;  2OXP A;  3EJI A;  4E6I A;  5C4Z A;  5C6A A;  1EY8 A;  1SYF A;  2F3W A;  3C1E A;  3R3O A;  1NSN S;  2OF1 A;  4H7B A;  2SNM A;  4N9T A;  5EGT A;  5IGC A;  2HQE A;  1ENA A;  2F0G A;  3E5S A;  5C3X A;  2F0O A;  4KJO A;  5IIF A;  2PZW A;  5HUR A;  2F0Q A;  4J1M A;  2EY6 A;  2F0J A;  1KAB A;  3QOL A;  1STG A;  5DEH A;  4KD3 A;  4ZUJ A;  3TP7 A;  5J22 A;  1EYD A;  1SYC A;  4EQP A;  3NQT A;  4QF4 A;  3SHL A;  3SK4 A;  4DGZ A;  3NHH A;  4RKL A;  3BDC A;  5IOD A;  1EY7 A;  4WRD A;  2EYP A;  1A2U A;  1SNM A;  3MEH A;  3BDL A;  2M00 A;  5CC4 A;  3V2T A;  5DAU A;  2F0S A;  1SNQ A;  2EYM A;  2F0E A;  5E1F A;  4K8J A;  2KQ3 A;  3U9O A;  2RKS A;  1SND A;  4N9P A;  4IZ8 A;  1EY0 A;  4K8I A;  5CV8 A;  1A3T A;  2F0T A;  2EYL A;  2F0W A;  3MHB A;  2EY2 A;  3H6M A;  4NKL A;  5EKK A;  5KYL A;  1F2Z A;  3QB3 A;  4NMZ A;  3SXH A;  3MVV A;  3NK9 A;  1AEX A;  5F2D A;  1F2Y A;  5CV5 A;  4K6D A;  1SYD A;  1EY5 A;  2F0N A;  2PYK A;  3NUC A;  4K5V A;  4K5W A;  2QDB A;  3SK8 A;  4EVO A;  4G57 A;  4IUN A;  1JOR A;  3C1F A;  3S9W A;  2OEO A;  5KGU A;  1SNC A;  3SR1 A;  2EY1 A;  1KDA A;  4KHV A;  4ODG A;  4DFA A;  1IHZ A;  5C3W A;  3P1H A;  2EYJ A;  2F0F A;  1EZ6 A;  2ENB A;  3ERQ A;  3TP8 A;  4PMB A;  4K5X A;  3D6C A;  1SYB A;  4J6H A;  3TP5 A;  2F0K A;  2NUC A;  2SNS A;  1JOQ A;  4DF7 A;  1SNP A;  3NP8 A;  5CR3 A;  2PW5 A;  5NUC A;  5IOC A;  2PQE A;  3OWF A;  1RKN A;  3QOJ A;  4KD4 A;  4S3S A; 
#chains in the Genus database with same CATH topology
 1IBM Q;  1C0A A;  1XTC D;  4HID A;  3S1R H;  1G6Z A;  3RMH A;  2E2H B;  4DV6 L;  2VB3 X;  4CDF C;  4OX9 Q;  4ME3 A;  1KAW A;  4DK6 C;  2F3V A;  4DR3 Q;  5JVH 3;  1CKN A;  1PA6 A;  3PMF A;  2D0P A;  5HY6 A;  4HIM A;  1CI3 M;  1MBY A;  1STY A;  2YTX A;  4C3H H;  2R92 H;  1Y8P B;  5D65 A;  2B2Y A;  3TRE A;  3Q23 A;  3DMU A;  4IFD I;  3NBH A;  1T5E A;  2UUC L;  3A56 A;  4A3B H;  1A15 A;  3QIA A;  1E2V A;  1SRU A;  4FVM A;  3A55 A;  4JBK A;  1EEF D;  1FGB D;  4JOI C;  2F0U A;  2ZM6 Q;  1Q90 A;  1YNJ D;  2EIF A;  1SMY C;  4P2C B;  1CT1 D;  1U4M A;  1CA5 A;  5C4H A;  4Q0F A;  1I4Q A;  2NZ1 D;  3B6Y A;  1PH6 A;  3S17 H;  1DXM A;  1PV4 A;  4FF4 A;  2MHV A;  5DM6 3;  4DV4 L;  1GO3 E;  2Z6B A;  3D3R A;  1U4R A;  3OHX C;  4OXP A;  3UDI A;  1PH1 A;  1YZ6 A;  2IX3 A;  4GOP B;  3HOV H;  4A3D H;  3S14 B;  2DNC A;  3D8G A;  2OXP A;  2QIL A;  3KDF B;  3W5O A;  2UUC Q;  3M3Y B;  3C1E A;  2NZO A;  5JVG 3;  3S2D H;  4OHJ A;  1NMG A;  1XYI A;  1CTM A;  1V43 A;  3R8B A;  5HUR A;  4QUF A;  4BBS H;  1VQB A;  3IKJ A;  4UPA A;  4H44 C;  4HN7 A;  4DV3 L;  3J80 c;  4R4C A;  3SK4 A;  4DGZ A;  1HRJ A;  4CKB A;  1S40 A;  4DV4 Q;  2JA5 G;  1B4O A;  4LK1 C;  2F0S A;  5LHY 1;  2MQH A;  3VR5 A;  4BY7 G;  1GUW A;  3CHB D;  3S15 H;  5EKK A;  1NR2 A;  2Z0S A;  3KF6 B;  4C3I G;  1GUS A;  3CPF A;  3SXH A;  4IUP A;  2SDF A;  5F2D A;  1IYU A;  4OIK A;  2F0N A;  2PYK A;  3F1Z A;  5M5W H;  3BVG A;  4BBR G;  4NXM L;  3C1F A;  1VQJ A;  2K05 A;  1K0R A;  1EQQ A;  4CBV A;  5C3W A;  4G7O C;  4DV3 Q;  3FKI G;  1SYB A;  2QF7 A;  3M4O B;  2O5J C;  5H1S E;  2SNS A;  1TXY A;  4C1N I;  3M4Q A;  1P8L A;  2KCN A;  1GD7 A;  1EU4 A;  1PH2 A;  4DV5 L;  5M3F B;  1VQP A;  4GKJ L;  3NWS A;  1DD2 A;  2WKC A;  4OO1 G;  3A7A B;  1Q46 A;  2FMC A;  4A3I G;  1B70 B;  1YJN A;  4NXM Q;  4H02 A;  1XTD A;  5KIX A;  2LKV A;  2MUY A;  2JA7 H;  4JI5 L;  5I9O A;  2AWN A;  1AP0 A;  4DK3 C;  2R7Z H;  1U9R A;  4C1N K;  1VQK A;  3I70 A;  3KJP A;  5CV4 A;  4YCW A;  4HMJ A;  3A8J E;  5J1Z A;  4DV5 Q;  1OTC A;  1V1P B;  1EOV A;  4K0K L;  1AN8 A;  1O7Z A;  5M3M G;  3K6O A;  4QJF A;  5BN5 A;  4GKJ Q;  1LV9 A;  1BUV T;  3U9S A;  4ZAI A;  5KEE A;  1Q1E A;  1QOH A;  1B9M A;  1L0X B;  1A63 A;  3I90 A;  4JI3 L;  4EQO A;  2YV5 A;  4K14 A;  2VUM B;  3RD4 A;  4FXD A;  1KRS A;  2ATW A;  4YWK A;  1H9M A;  4CJ1 B;  1ET9 A;  1S5D D;  4H0L C;  4JI5 Q;  3NPP A;  1PZJ D;  4C56 C;  4IUR A;  5K36 H;  2AUK A;  1WVL A;  1QZH A;  1WD0 A;  2C9O A;  4J15 A;  2ZJQ A;  4QUC A;  1HZ9 A;  5FJ8 H;  3CF5 A;  1BDO A;  5GAE C;  2D2C C;  1FNW A;  4ZUJ A;  5DLQ E;  3S1N B;  4A3K H;  4K0K Q;  2RF4 A;  3GTL B;  3PIP 3;  3T51 B;  5JPM C;  3OW7 A;  5IYC H;  5IOD A;  4O0A A;  3K58 A;  1EU3 A;  1O80 A;  2B8F A;  4MNO A;  1X9N A;  4JI3 Q;  2IT1 A;  5CV8 A;  4K8I A;  3GTO B;  3RLN A;  4LF9 L;  4YY3 L;  1IL2 A;  4IFD G;  1HFN A;  1Q7Y C;  1LAC A;  1IBK L;  1ZKO A;  1VQ7 A;  3EA6 A;  1EY5 A;  3BJU A;  3QR8 A;  1LM0 A;  4EVO A;  1CKO A;  2RA4 A;  4FF1 A;  4RGO S;  2E2I B;  1VQL A;  1VS0 A;  3IFD A;  1CKM A;  1E7Z A;  3EIV A;  1MD2 D;  3I55 A;  4GNX A;  1W2B A;  5AJ3 Q;  2NVT H;  2XWB B;  2AWO A;  4DXF A;  2B63 H;  3H0G B;  3V96 A;  3NEN A;  1QWY A;  3RR5 A;  1LT5 D;  1QG7 A;  4LUZ A;  4R4I A;  4LF9 Q;  4YY3 Q;  3ULP A;  3T13 A;  1IBK Q;  2B2W A;  2ZTD A;  2EY5 A;  4PMC A;  2K33 A;  1SE4 A;  3S2H H;  3J7A 5;  3BG3 A;  4PNY A;  1EIF A;  3E0J A;  5EBD A;  3I4M H;  4B3M L;  2KVM A;  3W3A A;  4OO1 H;  1PYW D;  4A3I H;  3RNU A;  1E0B A;  4PQX A;  4HJ7 A;  3CCR A;  1TY2 A;  4JOI A;  3HKZ E;  2ZXR A;  4A3C H;  2NTS A;  3CXC A;  2E5L L;  1ENF A;  2KEN A;  2EVB A;  3CCM A;  4IAL A;  1STN A;  2EXZ A;  4X62 L;  1CHP D;  4RGM A;  2BCO A;  2PNH A;  3AU7 A;  2D62 A;  5IT9 L;  3A5U A;  2IX1 A;  2GVA A;  3SK5 A;  3MC0 B;  1C48 A;  1UAP A;  1LTR D;  1JE4 A;  4UP9 A;  5M3M H;  5M5X H;  2JK8 A;  2L1B A;  4RGN A;  4B3M Q;  2P5Z X;  5C4Z A;  5BN3 A;  3NTI A;  3L2P A;  1JJG A;  5IY0 A;  2XWJ B;  4JI8 L;  3OTO L;  3GTG B;  4A3M H;  1D2B A;  2N49 A;  2E5L Q;  5HGQ A;  4PG3 A;  2CWP A;  3S1Q H;  1YEZ A;  2EY6 A;  3HOY G;  5IYB G;  3DLL A;  4X62 Q;  1Q8I A;  1RIP A;  2R93 B;  3J81 c;  3BDO A;  1PFM A;  3PCO B;  1A8V A;  2X6G A;  1YI2 A;  3MA2 B;  1VQE A;  2EJM A;  4X64 L;  4KKU A;  4LFC L;  1PHJ A;  3MHB A;  3I4N H;  5KYL A;  4GN3 B;  5I2X A;  1XWE A;  3PIO A;  2HT1 A;  2HIX A;  3OOC A;  3Q6S A;  4JI8 Q;  3OTO Q;  5C4J B;  3QG1 A;  1SFO H;  2QEJ C;  1XJV A;  1SSO A;  1MJC A;  1IHZ A;  4XYQ A;  3MWY W;  1PTO H;  2RDG A;  3H3V I;  1O7Y A;  1D1I A;  3K7A H;  1MIU A;  4M1U B;  1UUP A;  1I94 Q;  2F1M A;  2I5M X;  3CKI B;  1Y1W G;  4X64 Q;  3EQL C;  4XQQ A;  4LFC Q;  1EQV A;  2JP1 A;  1KD1 C;  3I3C A;  2E2D C;  1IZ6 A;  3TZD A;  1B44 D;  1I4R A;  4K2L A;  5C0X I;  1HQR D;  5M5Y B;  2CH4 W;  1WTW A;  1L1O C;  3G6J B;  1K28 A;  3G71 A;  3BS1 A;  1G6P A;  5JPN C;  5C3E B;  4JBW A;  2QDL A;  5KYI A;  4A3F B;  2MO0 A;  4DNI A;  2UU9 L;  1I50 H;  2JE6 I;  2JA6 B;  4DU9 A;  3NTK A;  3K5L A;  2F0I A;  3CRL C;  3N52 A;  4YCU A;  2PW7 A;  4Z9C B;  4HJ8 A;  5I6Y A;  3UI2 A;  3JAM L;  5FLM G;  5D3D A;  4P75 A;  3CCL A;  2K32 A;  2FHT A;  4QIW E;  4JW0 A;  5FO9 B;  1VQ8 A;  2SEB D;  1ICW A;  5IGE A;  3CC2 A;  3CQZ H;  3GTP B;  1EY8 A;  2HCI A;  4CJ2 C;  4N9T A;  1X55 A;  3I4O A;  1EOT A;  2UU9 Q;  1WTO A;  5GAD C;  1JMC A;  1Q3L A;  1X3E A;  2L55 A;  1XMO L;  1C7Y A;  1ASZ A;  1STG A;  2KEC A;  1RHP A;  3FVQ A;  4TVA B;  4DR2 L;  3T56 B;  4X3U A;  5EPL A;  1G51 A;  4RH6 A;  1I3Q B;  1KL9 A;  2JA8 G;  1N8R C;  2AHO B;  2F0T A;  2G9H D;  3PIO 3;  2R6G A;  4NKL A;  1Z47 A;  3HOX B;  2MP1 A;  1EQT A;  2ZTE A;  4A75 A;  4CJ0 B;  1TVX A;  3J7A F;  4FXK C;  2KCT A;  1XMO Q;  3WOE A;  3G6E A;  5KNB A;  4IPH A;  5DNF A;  1SR3 A;  4PMB A;  4B3T Q;  3ERS X;  1L0W A;  2ICI A;  1B3Q A;  4OWT B;  4HIK A;  1LO5 D;  3S16 H;  2BOS A;  3OWF A;  2IY5 B;  1ILQ A;  3TQY A;  3DUZ A;  4L5Q A;  3RZD B;  1JC7 A;  1KNE A;  1TWF B;  3GO5 A;  3OMC A;  4RMF A;  1TWC B;  2K5V A;  4KI0 A;  3KBG A;  5E4W C;  4XDX A;  1YIJ A;  4JPB W;  4DK1 A;  5FOB B;  3PSI A;  4Y7N B;  4DV2 L;  4A3D B;  2F0V A;  3S1R B;  2KCM A;  2MJ8 A;  4DAY B;  3HS0 C;  2XGT A;  4HJ9 A;  2OWO A;  3HOZ G;  1F2L A;  1IXR A;  1B50 A;  4UP8 A;  4TKO B;  5LMU L;  4YIJ A;  1WYD A;  4A3J G;  2A73 B;  4DV1 Q;  4OWW B;  5IP9 G;  3NEL A;  1JCK B;  2GN5 A;  4HIO A;  2R92 B;  1PH8 A;  4NW2 A;  1EL0 A;  1AE3 A;  4A3L G;  5C5L A;  1YVC A;  1DJR D;  4DK0 A;  4BA1 I;  3ONA B;  2JEA I;  5KNC A;  2F0M A;  4DV2 Q;  5D3I B;  3QJY A;  1R4Q B;  1KDB A;  5LMN Q;  1Y1V G;  4KY5 A;  3S17 B;  3EVQ A;  3TP6 A;  2Q8I B;  5I9P A;  1MSG A;  2NB0 A;  2EE1 A;  1VQN A;  5LMU Q;  3EJI A;  1JB3 A;  1PTO C;  3L3O C;  5C6A A;  4FO2 A;  4H7B A;  1WCM B;  2D9U A;  2PQA B;  4QL5 A;  2IWH A;  4X6A H;  3HOV B;  2K14 A;  1VQ9 A;  1YIT A;  3CW2 C;  2CCZ A;  3VYU A;  2PNR C;  2RVL A;  2CH4 A;  2I46 A;  4ZK9 B;  1Y14 B;  4DV0 L;  3UDF A;  2XN9 C;  1HNW Q;  2M00 A;  2PI2 E;  3V2T A;  1E2W A;  5C0X G;  2RKS A;  1LLR D;  3F2B A;  3CD6 A;  2EXD A;  2N8N A;  1EFW A;  2Q2U A;  3QB3 A;  1K83 H;  4DN4 M;  1WCM G;  1EUJ A;  3HRZ C;  1BCP C;  4K5V A;  1UEA B;  3LGJ A;  2JEB I;  2B29 A;  5EJW A;  4WJ4 A;  4AYB B;  1XMQ L;  1JOR A;  4A3G H;  5KGU A;  1SNC A;  3KF8 A;  1MGS A;  5IT9 E;  1KLG D;  2QGQ A;  3G4S A;  1PTO D;  5GQO A;  2A68 C;  3D6C A;  3R2I A;  3STB C;  4DV0 Q;  2XRS D;  1DON A;  1LAB A;  4GN4 B;  4U68 A;  1UE5 A;  2GA4 B;  4N8F A;  2VZA A;  1V9P A;  3NQI A;  2B3G A;  1OO9 B;  1G29 1;  3MXP A;  2ZJP A;  1SBB B;  3H94 A;  4FNF A;  1GJX A;  2R7D A;  4F87 A;  4IN3 A;  4JI4 L;  4I65 A;  1RD9 D;  2FFK B;  4C2M H;  4X3T A;  3RUZ A;  1HPC A;  2EYF A;  2K6A A;  1HR0 L;  4BY1 H;  3KJO A;  1L1O A;  1TWG B;  2A19 A;  5E7N A;  1XMQ Q;  1K8G A;  2Q8R E;  3GTJ H;  1X32 A;  1T5X D;  1N9W A;  3X3N A;  1X56 A;  2VNU D;  3MXN A;  4L8J A;  1VDZ A;  1G2T A;  4GNX C;  3FRP B;  2GVB A;  2LXK A;  1ICF B;  1HFG A;  1HTL D;  1X6O A;  1ONL A;  1S5E D;  1BCP D;  1EIY B;  3NE5 B;  2HQL A;  3LX0 A;  4DKA C;  4MTN A;  3KLW A;  4KHP L;  2CW0 C;  4JI1 L;  1D8L A;  4G7Z C;  2R7Z B;  4JI4 Q;  2E2J B;  2A68 D;  3STB D;  4CKC A;  4A4I A;  2B2W C;  1GUO A;  2F0P A;  5I2Y A;  1KC8 C;  1DGS A;  2A6H C;  5G3L D;  3J80 L;  3I73 A;  1NUC A;  1SN8 A;  2CWA A;  1TR5 A;  3T1H Q;  1TT2 A;  3J7A V;  1SEB D;  3W1B A;  1BNZ A;  3R3O A;  3GTM B;  4A3E G;  4WJW A;  2X6L A;  1KNA A;  3I8Z A;  2NWG A;  1PFB A;  1S3O A;  1VQM A;  5KND A;  1SE3 A;  1KAB A;  4C3J H;  5IP7 G;  1K8A C;  4R8I A;  4DV6 Q;  4KHP Q;  3H3V H;  5ELN A;  4JI1 Q;  2AQ1 B;  3NHH A;  2R61 A;  3H15 A;  1UWV A;  2Z1C A;  1W6K A;  3BYT B;  3AYH B;  4A93 B;  4N9P A;  4IZ8 A;  4A3K B;  1JR0 D;  4IOC A;  2CW0 D;  1SJH D;  3U50 C;  1F2Y A;  5CV5 A;  1HUN A;  4JYA L;  3WDN A;  1BOS A;  2A6H D;  3TBI B;  3CME A;  2K04 A;  4IO9 A;  5ELO A;  3S24 A;  5BR8 L;  1U4L A;  2F0F A;  4O2D A;  3JAM E;  4AQY L;  1CKN B;  3PIP A;  2KJX A;  3NP8 A;  5LMN W;  1SMY D;  4A93 G;  1MKH A;  3PO2 H;  3BZK A;  4MTK A;  1UNS A;  3NBH B;  2NVT B;  1RCV D;  3D4W A;  1FL0 A;  3RZO B;  2IL8 A;  2BH8 A;  3PO3 H;  2RDF A;  5ELC A;  1PZK D;  1Q86 C;  2UUB L;  4JYA Q;  4IQZ A;  3K80 C;  3KFU A;  2DNE A;  1LUZ A;  5C4X H;  3FMC A;  1CUK A;  2CHB D;  2Y0S B;  2Q2T A;  1VQG A;  2WAC A;  5IGB A;  1E24 A;  5BR8 Q;  2DJF C;  2BA1 A;  4AQY Q;  2OT2 A;  1MHW C;  4JVZ A;  3NWT A;  4ZYS A;  4KV6 A;  2IW3 A;  3I4M B;  2HD3 A;  2EPB A;  1UE7 A;  5COR A;  1EY9 A;  2XNA C;  1WJJ A;  1HQM C;  1MSH A;  1O7L A;  1LT3 D;  1H9J A;  3TDQ A;  4QCL A;  2UUB Q;  4KMU C;  4NDX A;  1Q8K A;  3F2U A;  1IKM A;  1F9Q A;  1SE2 A;  2B2T A;  2I07 B;  3P75 A;  3V05 A;  1LT6 D;  2XSC A;  1AE2 A;  3E9H A;  4E6I A;  3ER0 A;  1E1O A;  3PUW A;  5IIF A;  2OCE A;  2KA7 A;  2LFN A;  4XT3 B;  4MHE A;  1IYJ B;  2Q8T A;  1CHQ D;  3NEM A;  1I6H H;  4DV7 L;  2R7F A;  1X3G A;  5M3F G;  4U67 3;  4KD3 A;  4PV1 C;  3NQT A;  4QF4 A;  1WOC A;  3JAM i;  2A6E C;  2NTT A;  4ZKB B;  1LTB D;  2E2H H;  1K3R A;  4DUZ L;  3I4L A;  3S1Q B;  4B3S L;  4YWM A;  4TQU S;  1K73 C;  1EY0 A;  1MJE A;  1BKB A;  2FXQ A;  4OEM B;  1FD7 D;  2XIW A;  2LMC B;  4APV A;  1CSQ A;  3EBE A;  1B2T A;  2FJ2 A;  1PDQ A;  1KXL A;  4DV7 Q;  3I4N B;  3HOU B;  1C8C A;  1AFP A;  3HOW B;  2HIV A;  2WKD A;  1HHV A;  4CHT B;  1VQF A;  3M4P A;  2WP8 J;  3FPP A;  1TII D;  1PH9 A;  4A76 A;  2L12 A;  3N6R A;  1LYL A;  4B3S Q;  4IFD J;  1HZB A;  2PQE A;  2F0D A;  4S3S A;  3ZJY C;  2VUM G;  2JA5 H;  2NN6 I;  3SE0 A;  4BY7 H;  2A6E D;  2RBM A;  3R2T A;  2EJG C;  4C3I H;  1EYC A;  4JBM A;  4OL7 A;  3M3Y H;  5A35 A;  1K8M A;  1KAA A;  3HOU G;  3K59 A;  4OIJ A;  3H3V C;  2A74 C;  3HOW G;  4BBR H;  2IHF A;  2L0C A;  2KHI A;  5JEA G;  3CCS A;  2LXJ A;  4R9W A;  1WTR A;  2XTI A;  2CVR A;  3G7L A;  3FKI H;  1NE3 A;  1QUQ A;  3M9B A;  1PLF A;  4RHR A;  5GAG C;  1FYC A;  4LMQ D;  1STB A;  4JC0 A;  3CAM A;  2G5D A;  1STE A;  1OXV A;  1I50 B;  3MEF A;  3DXJ C;  3C2P A;  2KUM A;  2ZTC A;  3J81 L;  3MXU A;  4R8N A;  4BS9 A;  1F2M A;  3FDT A;  5C44 B;  1KIX A;  3F2D A;  4DR7 L;  2L9H A;  4HJ5 A;  3H0G G;  4O1N A;  2EJF C;  1M4V A;  1VF7 A;  1GOZ A;  4V0B A;  1J5E L;  4YCV A;  1T9H A;  5L37 A;  2JN4 A;  4DUY L;  4J1M A;  1I5F A;  2Q2I A;  3TP7 A;  2RCN A;  2VL6 A;  4RGT A;  2F52 A;  1VQ4 A;  3KUP A;  1BF4 A;  2A5H A;  4WRD A;  4JCV E;  5EBC A;  3VR4 A;  4IPC A;  3HG9 A;  1DCZ A;  2G9D A;  1YHQ A;  3GP7 A;  4GLA C;  2KCC A;  4P71 A;  1A3T A;  2B2V C;  2EY2 A;  5GRO A;  5C44 G;  4GNX B;  2A1A A;  2FIN B;  4UDU C;  1IBL L;  1NMF A;  1ILP A;  5A2Q L;  1HXY D;  1SYD A;  1ESF A;  1J5E Q;  3IL8 A;  1BQQ T;  1WTQ A;  2C5C A;  4R1J A;  2VQE L;  3KK7 A;  4DNR B;  3T53 B;  2O5I C;  3PGZ A;  2R3Z A;  1W6J A;  2JJQ A;  4K5X A;  2UXC L;  1ASY A;  1R4P B;  3CMA A;  3J80 E;  1JOQ A;  2RSO A;  2EZV A;  4IPG A;  4UAI A;  4B08 A;  3CC7 A;  1RKN A;  1D7Q A;  3PV0 A;  1STA A;  3D4R A;  2OTJ A;  1VQ6 A;  3F2C A;  5FO7 B;  1QVC A;  1YBY A;  1GM5 A;  1RJT A;  5LL6 S;  4TSS A;  4IFD H;  1EY4 A;  1U4P A;  4NB3 A;  1PH4 A;  3TME A;  2NVQ B;  5M9O A;  2R93 G;  3Q8D A;  1EYG A;  2ASB A;  1EZ8 A;  1O7I A;  1LTA D;  3L9A X;  2UXC Q;  3DWQ A;  5JAV A;  2DUD A;  3GTL H;  2I5L X;  2K50 A;  1EWC A;  3ITP A;  1IL8 A;  3A5Z B;  1YHB A;  4FF2 A;  4OGQ C;  3SK6 A;  1ENC A;  4LFA L;  1NY4 A;  3GTO H;  5IYD G;  3DM3 A;  2F4I A;  2F03 A;  5ELD A;  4HJA A;  3PUZ A;  3URY A;  4XIG S;  5C5M A;  2HHH L;  1DOL A;  2JXM B;  1II3 A;  3VR2 A;  1VQC A;  4CDD C;  2E2I H;  1K3B C;  2F3W A;  5IWA L;  1OXT A;  2MO1 A;  1Q12 A;  2F0G A;  2NVX B;  1R9T H;  2F0O A;  2F0Q A;  4DNT B;  3H91 A;  4UY8 C;  2EDG A;  2NZH A;  2KOL A;  4LFA Q;  3I91 A;  4GOP C;  2NN6 G;  1I4P A;  1X3Q A;  4NXN L;  3BZC A;  1KHI A;  2EYP A;  3J80 i;  4KK7 A;  2JSO A;  2ZXP A;  1JB7 A;  5CC4 A;  3ND9 A;  3L0O A;  3SVM A;  2E75 C;  5EQ0 A;  1SND A;  2HHH Q;  3GV3 A;  4KLK A;  1GUG A;  3TRZ A;  5C3E G;  4A3F G;  5IWA Q;  3OWE B;  4G4K A;  5JJK A;  1QNK A;  3CU7 A;  3JC6 6;  2JA6 G;  2LY7 A;  2BA0 A;  4RFB A;  4HCS A;  2EY1 A;  5I4D A;  1CK1 A;  3HKZ B;  3L7Z C;  4RG1 A;  4HAE A;  2CQO A;  3HOY H;  5IYB H;  3CCV A;  4NXN Q;  2WAQ B;  1WD1 A;  3A0J A;  3E6Z X;  4A3G B;  5EKI A;  5NUC A;  4KY6 A;  1VQI A;  2NBF A;  4R4O A;  4O42 A;  3J81 j;  3S1M H;  4GKK L;  4LNQ A;  1JJC B;  4CGY B;  2PMZ B;  3RLO A;  3K8A A;  4ZCK A;  3VA5 A;  4CKE A;  3K5O A;  1EYA A;  1TWA H;  4OWX B;  5AFW A;  1GUN A;  1EEI D;  3W2D A;  1Q81 C;  2VW9 A;  1VQH A;  2QA4 A;  4DR2 Q;  4LF6 L;  1JIC A;  2J4X A;  4BY1 B;  3NXW A;  2NVY H;  2IPK D;  2WAQ G;  5FKA C;  3GTJ B;  1E2Z A;  1FJG L;  2RHQ B;  3VR6 A;  2R93 H;  1TS2 A;  1X54 A;  4GKK Q;  3OIQ A;  3WWV A;  5J39 A;  1SYE A;  3U58 A;  1PRT F;  3HOX G;  4JI0 L;  4AH6 A;  4WJ3 M;  2HDM A;  1Y1W H;  4QB4 A;  3AQQ A;  1WTH A;  5E3F A;  1I4X A;  2KHS A;  1CQV A;  4DR4 L;  3ULJ A;  4F8M A;  2PZU A;  2I5H A;  4I7A A;  1WTV A;  2K7V A;  2WFW A;  4DPG A;  4GZY C;  4KTA A;  1TWH H;  1PXU A;  1EFI D;  2L5T A;  2OF1 A;  5EGT A;  4C3H B;  1PTO F;  1VMP A;  1Z6H A;  2YTY A;  3KLR A;  1XXG A;  1FJG Q;  4XQN A;  1PRT C;  4DR1 L;  4BXX G;  4DXG A;  2L15 A;  4A3B B;  5DEH A;  5J22 A;  1EYD A;  2WV6 D;  2DN8 A;  1AZP A;  1SYC A;  3VYR A;  3GTK H;  3SDZ A;  1OXS C;  3RN5 A;  1M1K C;  4A3D G;  3PF5 A;  4X65 L;  4FYD A;  2B2V A;  1SNQ A;  2BH2 A;  4DA2 A;  2B2T C;  2YU9 H;  5FLM H;  3A54 A;  1EWH A;  1TY0 A;  2RQX A;  3BZD B;  1IW7 C;  4C3H G;  2R92 G;  2AMC B;  3OW2 A;  1H9S A;  5EPK A;  4DR1 Q;  4G57 A;  2AQ3 B;  1BCP F;  3W1G A;  4A3F H;  4ZRZ A;  1KQS A;  2WB1 B;  4ODG A;  3T1Y L;  3S2D B;  1BO0 A;  5C0X J;  1EZ6 A;  3AFP A;  3LNN A;  2JA6 H;  4UP7 A;  1RTO A;  4LFB L;  3HKS A;  3K0Y A;  3AMU A;  4BBS B;  2F0K A;  1A0I A;  3PUV A;  1V1Q A;  4X65 Q;  1PRT D;  4LJZ C;  3J81 E;  1J6Q A;  1RF2 D;  1LT4 D;  3KYH C;  1PH7 A;  5G3L F;  2JA8 H;  1TU2 B;  1ZEQ X;  5J3B A;  3HOV G;  3GTP H;  3S15 B;  3AEV A;  4TRD A;  2TSS A;  3TSS A;  1A2T A;  1YNN C;  2VS1 A;  2WB1 G;  5IGD A;  5CBE E;  3T1Y Q;  1XPU A;  3MXG A;  3PO3 B;  4GN5 A;  5CYU A;  3NSW A;  5M5W B;  1QE6 A;  1NR4 A;  4LFB Q;  1Z7T A;  1IW7 D;  1BBX C;  4KKT A;  1G8Z D;  4BBS G;  5C4X B;  3DM1 A;  3VYS A;  1BBW A;  1BBU A;  2H5X A;  5K5P A;  1PH3 A;  1JE5 A;  1F9S A;  2AKW B;  3OMG A;  5CV9 A;  3MZ5 A;  1I3Q H;  2BDN A;  2K5Q A;  2UUA L;  1STH A;  2N88 A;  4XTC S;  1EY6 A;  5A2Q E;  1SDF A;  4POG A;  2YYZ A;  1ML0 D;  4KJN A;  3OPO A;  4AYB G;  4ZQ3 A;  3H09 A;  1SYG A;  2EYO A;  1B53 A;  1QB5 D;  2Z4H A;  1HZA A;  3HOZ H;  2HUG A;  1SLJ A;  1QZG A;  4L63 B;  1B3A A;  1NNX A;  1O78 A;  3NTH A;  4OX9 L;  4OEL B;  1I4H A;  2BDO A;  2EQS A;  2JA7 B;  4K6L A;  4A3J H;  1YNN D;  5IP9 H;  4GOP A;  1LTT D;  3GTQ H;  4A3L H;  3KDF A;  1SXT A;  3RZD H;  1HR0 Q;  4LF8 L;  1TWF H;  2RSN A;  1KRT A;  1I6H B;  1VCI A;  1XX8 A;  3OIP A;  2EYM A;  3J81 i;  4K8J A;  1S5F D;  4KN7 C;  3U9O A;  5JJZ A;  3KF8 B;  4Y7N H;  2EYL A;  1FR3 A;  1Y1V H;  1B9N A;  2PI2 A;  2TMP A;  3PQI A;  4NMZ A;  4R4T A;  3KOJ A;  3DWP A;  1X3P A;  1HA5 A;  2VQF L;  4JI6 L;  4K5W A;  1DYQ A;  1KTK A;  2QDB A;  2JA7 G;  1NJI C;  1N34 L;  2I0Q A;  4DAM A;  2KHJ A;  2WII B;  3D6W A;  5EPJ A;  2X69 A;  1Q1B A;  4Y52 H;  2Z8L A;  1OXX K;  3I7F A;  2R7Z G;  3KF6 A;  1TS4 A;  4LF8 Q;  3TP8 A;  2MGS A;  4LW1 A;  4LWC A;  1L0Y B;  1L1O B;  1SNP A;  5CR3 A;  1HTP A;  3TZU A;  2FMM A;  4N8X 1;  2K1B A;  5HGT A;  5JJL A;  1JOK A;  2QKI C;  1JWS D;  1BR9 A;  1JOO A;  3MXN B;  5C0X H;  3DHQ A;  5COY A;  1QCB D;  3A8I E;  2KEE A;  2VQF Q;  4JI6 Q;  3AFQ A;  4POF A;  3D31 A;  3MTS A;  2JA5 B;  4L5T A;  1N34 Q;  1WCM H;  4JG2 A;  5ISR A;  1XNR L;  5K36 G;  4BY7 B;  3CCQ A;  2JA9 A;  3HZX A;  4QMG A;  4C3I B;  1G91 A;  1N32 L;  4MN3 A;  4CDC C;  4XYO A;  5KRU A;  5FJ8 G;  4X3S A;  4WOR A;  3CPW A;  4A3K G;  5CBA E;  5GAH C;  3K5M A;  4ULL A;  4BBR B;  5IYC G;  1DM0 B;  1TQO A;  2B63 B;  4OON A;  1J9O A;  3FKI B;  2H4O A;  1GXD C;  3K7U C;  1SNO A;  1EWI A;  2K52 A;  2SOB A;  1AZQ A;  1XNR Q;  1V1P A;  1Z9F A;  4RAU C;  1N32 Q;  3S2H B;  1Y8O B;  1SYF A;  1M90 C;  1N36 L;  2K01 A;  3P20 A;  3FPU B;  3Q0A A;  4A3I B;  2DGY A;  2ID0 A;  2QEX A;  1JWM D;  3RN2 A;  2B63 G;  1B8A A;  1CSP A;  3K57 A;  2K4K A;  3DEO A;  2Y0S G;  2F0E A;  3M7G A;  2K5H A;  4DR6 L;  2F0W A;  1TWG H;  4LF7 L;  1TS3 A;  3HGB A;  1CQF A;  1F2Z A;  1BXT A;  2ALY B;  1AH9 A;  1WI5 A;  3FEW X;  5M3M B;  1E1T A;  5M5X B;  1N36 Q;  4XT1 B;  3NK9 A;  1AEX A;  3A7L A;  1DOK A;  1ZYR C;  1QVF A;  3G48 A;  1F77 A;  1V1O A;  2Z4I A;  1GVP A;  3I4M G;  3GDE A;  4RCO A;  1CA6 A;  1RL2 A;  4A3E H;  3A74 A;  1KDA A;  2IHE A;  4KHV A;  4L6T B;  4A3C G;  4A3M B;  1Q82 C;  1J8I A;  5IP7 H;  4IPD A;  4DF7 A;  1GHJ A;  1RTN A;  2E2J H;  4EQ5 A;  3QOJ A;  4K6D A;  3VYT A;  4DR6 Q;  1VQO A;  2OTL A;  4ALP A;  3E0E A;  4LF7 Q;  1PFN A;  4HMI A;  1E3P A;  1FGU A;  2ZXO A;  4B9W A;  4K2K A;  1PRT B;  1TS5 A;  4J8Q A;  1PH5 A;  5IGG A;  1RDP D;  1E22 A;  3C46 A;  3GTM H;  4FF3 A;  1S72 A;  1HCZ A;  1GKH A;  2N3S A;  2QW7 A;  4HED A;  2VY3 A;  5IGF A;  4A3M G;  1HR0 W;  4LAA A;  4YWL A;  1SFO B;  4DUZ Q;  1YHA A;  2O2L D;  3EN2 A;  1P16 A;  4XQJ A;  1ZYR D;  1K0S A;  2DJG C;  1PYB A;  5I6W A;  1PTO B;  2Z6K C;  5FO8 B;  1N33 L;  4A93 H;  1WTP A;  2E76 C;  3BU2 A;  3K7A B;  5ELB A;  3S14 H;  4V19 0;  2E74 C;  5AJ3 L;  1NAP A;  4JV5 L;  5JEA J;  3I4N G;  1X3F A;  3Q22 A;  2RCF A;  5ELE A;  1FVI A;  1JT8 A;  5IGC A;  2CFM A;  3E5S A;  2QCP X;  2KED A;  3DEP A;  3LWU A;  4KJO A;  1N33 Q;  3AB9 A;  3PF4 A;  1PFS A;  1F9P A;  4JI2 L;  1BCP B;  4F88 A;  1IKL A;  4RKL A;  2IJ0 A;  1XPO A;  1R9T B;  1U0L A;  3MEH A;  5ELF A;  4JV5 Q;  5DAU A;  3RZO H;  1HUM A;  1HNZ L;  1DZ1 A;  1S5C D;  1C4Q A;  3CC4 A;  1LTL A;  5EAY A;  2ICE C;  3KLS A;  5FLX L;  1SAP A;  5E4X A;  1VQA A;  2WIN B;  3M4O H;  3DWA A;  3C3L A;  3CQZ B;  2HCC A;  2MFI A;  3SR1 A;  3ZYY X;  4UHV A;  4JI2 Q;  3P1H A;  4ABN A;  5M3F H;  1M8A A;  1VF5 C;  3ERQ A;  2JQO A;  4PZ6 A;  1VQD A;  5IOC A;  1H95 A;  3CRK C;  5JJI A;  2Z9H A;  1HNZ Q;  4ME5 A;  4EQN A;  2EYH A;  2WAQ E;  3HOY B;  4DR7 Q;  4HSP A;  4MZ9 A;  3OSO A;  4HCE A;  4XXE A;  3M85 A;  3MAQ A;  4DUY Q;  3S1M B;  1I4G A;  1QUQ B;  2Q2H A;  4EGV A;  5BN4 A;  2PMZ E;  4DAV A;  2XVS A;  3EFX D;  4JI7 L;  3MFY A;  1B1Z A;  1CM9 A;  4FP5 D;  1TWA B;  3UE0 A;  4RCN A;  2OQK A;  2BE5 C;  1A62 A;  5CV6 A;  5FLX c;  5D14 A;  3Q24 A;  3CCE A;  5TSS A;  1VMC A;  2NVY B;  1IBL Q;  3HP3 A;  3S16 B;  3T16 A;  2ZJR A;  2VUM H;  2RHS B;  2EOT A;  3ERO A;  2M2L A;  3IFT A;  4RKB A;  3OYY A;  2E8G A;  2J0T D;  4ZLT F;  2VQE Q;  3GQB A;  1I94 L;  4B9X A;  1Y1W B;  4JI7 Q;  1LTG D;  3HOU H;  3S1N H;  1ROD A;  3K0X A;  3HOW H;  2HQE A;  1ENA A;  4G7H C;  5C3X A;  4GS3 A;  3I56 A;  5JEA H;  3X3M A;  3GD7 A;  5IT9 c;  2F0J A;  1TWH B;  3UDX A;  1BVS A;  1D5X C;  3UDG A;  5T1G A;  3M4Y A;  1JWU D;  4KKS A;  1QJO A;  1YJW A;  3E3X A;  1A2U A;  2PCF B;  3BDL A;  2JYO A;  1X65 A;  2BE5 D;  4B3R L;  2N78 A;  5E1F A;  2KQ3 A;  1V8Q A;  3KBX A;  1OXU A;  3GTK B;  3H6M A;  1S5B D;  3HFZ B;  3A8K E;  4QY7 A;  1H9R A;  4KHZ A;  4BWG B;  3I2Z A;  3ND8 A;  5DM7 3;  2YU9 B;  3CP0 A;  3U4Z A;  4QQB X;  4IUN A;  3H0G H;  3S9W A;  4LF4 L;  4DFA A;  4GLX A;  1PVO A;  1HH2 P;  3MFG A;  3VA7 A;  3IRB A;  1DOM A;  1ET6 A;  4IOA A;  5CMD A;  2WB1 E;  3TP5 A;  2B2U C;  2NUC A;  3SGI A;  4B3R Q;  1UEB A;  2M9V A;  3QWN A;  1XPR A;  1EQR A;  1YNX A;  3SEB A;  5CGK A;  1HA6 A;  4RWS C;  3F8T A;  4ZUI A;  1HZC A;  1FNV A;  1D1K A;  4I7Z C;  5C44 H;  2V4D A;  4P74 A;  1EIG A;  1QVG A;  2K75 A;  3R93 A;  1K83 B;  4LF4 Q;  2JA8 B;  2VB2 X;  2RDH A;  5EKL A;  5FK9 C;  1SE8 A;  3D4D A;  4AYB E;  2B2Y C;  3ICE A;  3J7Z C;  1ESR A;  4NP5 A;  1S4Z A;  5CV7 A;  4DR5 L;  3HEJ A;  2Z6K A;  4IUV A;  3PUY A;  4IUU A;  4RHS A;  4DAY A;  1D6E C;  4DAP A;  2K5W A;  2ES2 A;  4IUQ A;  2F4V L;  2PZT A;  2L11 A;  1JJ2 A;  2F0H A;  3ULL A;  4B3T L;  2K28 A;  3E9I A;  2MNA A;  3FHW A;  3WOF A;  3GTG H;  4F7X A;  2DY8 A;  3TN2 A;  3HKZ G;  4C2M B;  2OQ0 A;  4LUO A;  4IJL A;  4WFN 3;  2CQA A;  2SNM A;  2DY7 A;  4NPS A;  4DR5 Q;  4A3G G;  4BA2 I;  1EIH A;  3BVZ A;  1CZW A;  1W3S A;  4ILW A;  3JAM c;  3HOZ B;  3QOL A;  4CDE C;  2F4V Q;  1MI2 A;  3SHL A;  1D5M C;  1G2S A;  3CCJ A;  1SNM A;  4A3J B;  2PQA A;  3D0F A;  4DV1 L;  2C35 B;  2PPB C;  5IYD H;  2VXW A;  5C4J H;  3GTQ B;  1NBW A;  4LF6 Q;  4BY1 G;  3K81 C;  1KLU D;  1I6V C;  3MVV A;  3QO2 A;  1WTX A;  1YJ9 A;  4IJH A;  2NVQ H;  1FNU A;  3U4V A;  2K5N A;  3NUC A;  3RLF A;  3UE1 A;  4P73 A;  4PZ7 A;  3BYY B;  3VDY A;  1Y1V B;  2B39 A;  2OEO A;  5LMN L;  4JI0 Q;  4LUV A;  3O13 A;  4JK1 C;  1Y8N B;  2EYJ A;  2L4N A;  2YTV A;  4HR7 B;  1TKW B;  4J6H A;  1SMX A;  3K5N A;  4X66 L;  1H9K A;  4C3J B;  3CCU A;  1L2F A;  4DR4 Q;  2PW5 A;  2NN6 H;  2N55 A;  2A69 C;  4KD4 A;  1Y69 U;  2K03 A;  3IAY A;  1IYV A;  1A3U A;  5M5Y H;  4GLV B;  4RA8 A;  2NYZ D;  4L5S A;  1KDC A;  3BVM A;  2O4X A;  5LL6 X;  1ZXT A;  5C3E H;  1XNQ L;  2IX0 A;  1HNW L;  3I72 A;  1PYS B;  4A3B G;  4H13 C;  4MIU A;  5T1I A;  3KLS X;  2NVX H;  1SJE D;  1HJP A;  1JQY D;  4KN4 C;  4IUT A;  1A3V A;  2A8V A;  1SRO A;  1D5Z C;  1B7Y B;  1UE6 A;  4KY7 A;  1PMR A;  3TS2 A;  4X66 Q;  4Q5V A;  4C3J G;  2D5D A;  4PMW A;  2XRQ D;  2KBN A;  4YHH L;  2V1C C;  1K9M C;  3FP9 A;  2F3I A;  5FLX E;  1A6X A;  4QIW B;  2F0L A;  2AUJ D;  3NBI A;  4FXG C;  3TEH B;  1HNX L;  3PO2 B;  5JOB A;  4M8A A;  1XNQ Q;  1F9R A;  4HTH A;  4P72 A;  2A69 D;  3GV6 A;  2UXD L;  4ID6 A;  2HDL A;  1AW7 A;  1LTI D;  2Y0S E;  1NSN S;  4OO1 I;  4YHH Q;  2PZW A;  3T4A C;  3PUX A;  2UXB L;  2LSS A;  4EQP A;  1WFQ A;  4X3K A;  1GHK A;  2ZT9 C;  1HNX Q;  3BDC A;  1EY7 A;  4EX5 A;  2MPM A;  3PO2 G;  3HOX H;  1QNU A;  1H9S B;  1QIL A;  2PO4 A;  3P7J A;  1UE1 A;  1VQ5 A;  4PZ8 A;  4LF5 L;  4QGU A;  2UXD Q;  4AIM A;  4L5R C;  1C9O A;  1LTS D;  4FDB A;  3J7Y W;  1IBM L;  3M7N A;  2H1E A;  4R4Q A;  5IE8 A;  3PO3 G;  2AQ2 B;  1GUT A;  1K8O A;  1PZI D;  2B8G A;  1CFM A;  5C4X G;  4DR3 L;  1NTG A;  4ZKC B;  3LWE A;  3SK8 A;  2J7Z A;  3TS0 A;  1YNJ C;  2CKZ B;  3VR3 A;  2UUA Q;  2UXB Q;  4HSV A;  2LS0 1;  4BXX H;  2K5D A;  3T1H L;  2ENB A;  2B2U A;  1U5K A;  1TWC H;  1CZG A;  4JBJ A;  4LF5 Q;  4A3E B;  2D0O A;  1NCV A;  2ZM6 L; 
#chains in the Genus database with same CATH homology
 1XTC D;  1G6Z A;  3RMH A;  2E2H B;  2VB3 X;  2F3V A;  5JVH 3;  3PMF A;  1CI3 M;  1MBY A;  1STY A;  1Y8P B;  5D65 A;  2B2Y A;  3Q23 A;  3DMU A;  4IFD I;  3NBH A;  1T5E A;  3A56 A;  1A15 A;  3QIA A;  1E2V A;  4FVM A;  3A55 A;  1EEF D;  1FGB D;  2F0U A;  1Q90 A;  1YNJ D;  1SMY C;  4P2C B;  1CT1 D;  1U4M A;  1CA5 A;  5C4H A;  4Q0F A;  1I4Q A;  2NZ1 D;  1DXM A;  4FF4 A;  2MHV A;  5DM6 3;  3D3R A;  1U4R A;  3OHX C;  2IX3 A;  3S14 B;  2DNC A;  3D8G A;  2OXP A;  2QIL A;  3M3Y B;  3C1E A;  5JVG 3;  4OHJ A;  1XYI A;  1CTM A;  1V43 A;  3R8B A;  5HUR A;  4QUF A;  3IKJ A;  4H44 C;  4HN7 A;  3SK4 A;  4DGZ A;  1HRJ A;  4CKB A;  1B4O A;  4LK1 C;  2F0S A;  5LHY 1;  3VR5 A;  1GUW A;  3CHB D;  5EKK A;  1NR2 A;  4C3I G;  1GUS A;  3SXH A;  4IUP A;  2SDF A;  5F2D A;  1IYU A;  4OIK A;  2F0N A;  2PYK A;  3BVG A;  3C1F A;  2K05 A;  4CBV A;  5C3W A;  4G7O C;  3M4O B;  1SYB A;  2QF7 A;  2O5J C;  2SNS A;  4C1N I;  2KCN A;  1EU4 A;  5M3F B;  3NWS A;  1DD2 A;  2WKC A;  4OO1 G;  3A7A B;  2FMC A;  5KIX A;  2LKV A;  2MUY A;  5I9O A;  1AP0 A;  2AWN A;  1U9R A;  4C1N K;  3I70 A;  5CV4 A;  4HMJ A;  3A8J E;  5J1Z A;  1V1P B;  1AN8 A;  1O7Z A;  3K6O A;  5BN5 A;  1LV9 A;  1BUV T;  3U9S A;  4ZAI A;  5KEE A;  1Q1E A;  1QOH A;  1B9M A;  1L0X B;  3I90 A;  4EQO A;  4K14 A;  2VUM B;  3RD4 A;  4FXD A;  1H9M A;  4CJ1 B;  1ET9 A;  1S5D D;  4H0L C;  3NPP A;  1PZJ D;  4C56 C;  4IUR A;  5K36 H;  2AUK A;  1WVL A;  1WD0 A;  2C9O A;  4QUC A;  1BDO A;  2D2C C;  1FNW A;  4ZUJ A;  3S1N B;  3GTL B;  3PIP 3;  3T51 B;  5JPM C;  3OW7 A;  5IOD A;  3K58 A;  1EU3 A;  1O80 A;  2B8F A;  2IT1 A;  5CV8 A;  4K8I A;  3GTO B;  4IFD G;  1HFN A;  1LAC A;  1ZKO A;  3EA6 A;  1EY5 A;  4EVO A;  2RA4 A;  4FF1 A;  4RGO S;  2E2I B;  3IFD A;  1MD2 D;  2XWB B;  2AWO A;  4DXF A;  3H0G B;  3V96 A;  1QWY A;  1LT5 D;  1QG7 A;  3T13 A;  2B2W A;  2EY5 A;  4PMC A;  2K33 A;  1SE4 A;  3BG3 A;  4PNY A;  5EBD A;  3E0J A;  2KVM A;  3W3A A;  4OO1 H;  1PYW D;  1E0B A;  4PQX A;  1TY2 A;  2ZXR A;  2NTS A;  1ENF A;  2EVB A;  4IAL A;  1STN A;  2EXZ A;  1CHP D;  4RGM A;  2BCO A;  3AU7 A;  2D62 A;  5IT9 L;  2IX1 A;  3SK5 A;  3MC0 B;  1C48 A;  1UAP A;  1LTR D;  1JE4 A;  2L1B A;  4RGN A;  5C4Z A;  5BN3 A;  3NTI A;  2XWJ B;  3GTG B;  1D2B A;  2EY6 A;  1Q8I A;  2R93 B;  3BDO A;  1PFM A;  2X6G A;  3MA2 B;  2EJM A;  4KKU A;  3MHB A;  5KYL A;  5I2X A;  1XWE A;  3OOC A;  3Q6S A;  5C4J B;  3QG1 A;  2QEJ C;  1SSO A;  1IHZ A;  4XYQ A;  3MWY W;  1PTO H;  2RDG A;  1D1I A;  1O7Y A;  4M1U B;  1UUP A;  2F1M A;  3CKI B;  3EQL C;  4XQQ A;  1EQV A;  2JP1 A;  3I3C A;  2E2D C;  3TZD A;  1B44 D;  1I4R A;  4K2L A;  5C0X I;  1HQR D;  5M5Y B;  1WTW A;  3G6J B;  3BS1 A;  5JPN C;  5C3E B;  4JBW A;  5KYI A;  4A3F B;  2JE6 I;  2JA6 B;  4DU9 A;  3NTK A;  3K5L A;  2F0I A;  3CRL C;  3N52 A;  2PW7 A;  4Z9C B;  5I6Y A;  3UI2 A;  3JAM L;  5D3D A;  2K32 A;  2FHT A;  5FO9 B;  2SEB D;  1ICW A;  5IGE A;  3GTP B;  1EY8 A;  2HCI A;  4CJ2 C;  4N9T A;  1EOT A;  1WTO A;  1Q3L A;  2L55 A;  1STG A;  2KEC A;  1RHP A;  3FVQ A;  3T56 B;  4X3U A;  5EPL A;  4RH6 A;  1I3Q B;  2F0T A;  2G9H D;  3PIO 3;  2R6G A;  4NKL A;  1Z47 A;  3HOX B;  2MP1 A;  1EQT A;  4CJ0 B;  1TVX A;  3J7A F;  4FXK C;  3WOE A;  5KNB A;  5DNF A;  4PMB A;  2ICI A;  1LO5 D;  2BOS A;  3OWF A;  1ILQ A;  3DUZ A;  3RZD B;  1JC7 A;  1KNE A;  1TWF B;  3GO5 A;  3OMC A;  1TWC B;  5E4W C;  4KI0 A;  3KBG A;  4XDX A;  4DK1 A;  5FOB B;  4Y7N B;  4A3D B;  2F0V A;  3S1R B;  2MJ8 A;  3HS0 C;  1F2L A;  1B50 A;  4TKO B;  4YIJ A;  2A73 B;  1JCK B;  2R92 B;  4NW2 A;  1EL0 A;  5C5L A;  1DJR D;  4DK0 A;  4BA1 I;  3ONA B;  2JEA I;  5KNC A;  2F0M A;  5D3I B;  3QJY A;  1R4Q B;  1KDB A;  4KY5 A;  3S17 B;  3EVQ A;  3TP6 A;  2Q8I B;  5I9P A;  1MSG A;  2NB0 A;  2EE1 A;  3EJI A;  1JB3 A;  1PTO C;  3L3O C;  5C6A A;  4FO2 A;  4H7B A;  1WCM B;  2D9U A;  2IWH A;  3HOV B;  3VYU A;  2PNR C;  2RVL A;  4ZK9 B;  2I46 A;  2XN9 C;  2M00 A;  3V2T A;  1E2W A;  5C0X G;  2RKS A;  1LLR D;  3QB3 A;  4DN4 M;  3HRZ C;  1BCP C;  4K5V A;  1UEA B;  2JEB I;  5EJW A;  4AYB B;  1JOR A;  5KGU A;  1SNC A;  3KF8 A;  1MGS A;  5IT9 E;  1KLG D;  1PTO D;  2A68 C;  3D6C A;  3R2I A;  2XRS D;  1DON A;  1LAB A;  4U68 A;  2GA4 B;  3NQI A;  1OO9 B;  1G29 1;  3MXP A;  1SBB B;  3H94 A;  4FNF A;  1GJX A;  4F87 A;  4IN3 A;  4I65 A;  1RD9 D;  2FFK B;  4X3T A;  3RUZ A;  1HPC A;  2EYF A;  2K6A A;  1TWG B;  2Q8R E;  1X32 A;  1T5X D;  3X3N A;  2VNU D;  3MXN A;  4L8J A;  1VDZ A;  1G2T A;  3FRP B;  1HFG A;  1HTL D;  1ONL A;  1S5E D;  1BCP D;  3NE5 B;  3LX0 A;  2CW0 C;  4G7Z C;  2R7Z B;  2E2J B;  2A68 D;  4CKC A;  2B2W C;  1GUO A;  2F0P A;  5I2Y A;  2A6H C;  5G3L D;  3J80 L;  3I73 A;  1NUC A;  1TR5 A;  1TT2 A;  3J7A V;  1SEB D;  1BNZ A;  3R3O A;  3GTM B;  4WJW A;  2X6L A;  1KNA A;  3I8Z A;  2NWG A;  1PFB A;  5KND A;  1SE3 A;  1KAB A;  4R8I A;  2AQ1 B;  3NHH A;  2R61 A;  2Z1C A;  1W6K A;  3BYT B;  4A93 B;  4N9P A;  4IZ8 A;  4A3K B;  1JR0 D;  2CW0 D;  1SJH D;  1F2Y A;  5CV5 A;  1HUN A;  3WDN A;  1BOS A;  2A6H D;  3TBI B;  2K04 A;  1U4L A;  2F0F A;  3JAM E;  2KJX A;  3NP8 A;  1SMY D;  1UNS A;  2NVT B;  1RCV D;  3D4W A;  3RZO B;  2IL8 A;  2RDF A;  5ELC A;  1PZK D;  4IQZ A;  2DNE A;  3FMC A;  2CHB D;  2Y0S B;  2WAC A;  5IGB A;  2BA1 A;  2OT2 A;  3NWT A;  4ZYS A;  4KV6 A;  2IW3 A;  3I4M B;  2EPB A;  5COR A;  1EY9 A;  2XNA C;  1HQM C;  1MSH A;  1LT3 D;  1O7L A;  1H9J A;  3TDQ A;  4QCL A;  4KMU C;  4NDX A;  3F2U A;  1IKM A;  1F9Q A;  1SE2 A;  2B2T A;  2I07 B;  3P75 A;  3V05 A;  1LT6 D;  2XSC A;  4E6I A;  3PUW A;  5IIF A;  2KA7 A;  2LFN A;  4XT3 B;  4MHE A;  2Q8T A;  1CHQ D;  4U67 3;  4KD3 A;  4PV1 C;  3NQT A;  4QF4 A;  2A6E C;  2NTT A;  4ZKB B;  1LTB D;  3I4L A;  3S1Q B;  4TQU S;  1EY0 A;  1FD7 D;  2XIW A;  2LMC B;  1B2T A;  2FJ2 A;  1PDQ A;  3I4N B;  3HOU B;  1C8C A;  1AFP A;  3HOW B;  2WKD A;  1HHV A;  4CHT B;  2WP8 J;  3FPP A;  1TII D;  2L12 A;  3N6R A;  4IFD J;  2PQE A;  2F0D A;  4S3S A;  2NN6 I;  3SE0 A;  2A6E D;  2RBM A;  3R2T A;  2EJG C;  1EYC A;  4OL7 A;  5A35 A;  1K8M A;  1KAA A;  3K59 A;  4OIJ A;  3H3V C;  2A74 C;  2L0C A;  5JEA G;  4R9W A;  1WTR A;  2CVR A;  3G7L A;  1PLF A;  4RHR A;  1FYC A;  4LMQ D;  1STB A;  1STE A;  1OXV A;  1I50 B;  3DXJ C;  3C2P A;  2KUM A;  3J81 L;  3MXU A;  4R8N A;  4BS9 A;  1F2M A;  3FDT A;  5C44 B;  2L9H A;  4O1N A;  2EJF C;  1M4V A;  1VF7 A;  1GOZ A;  4V0B A;  4J1M A;  3TP7 A;  4RGT A;  3KUP A;  1BF4 A;  2A5H A;  4WRD A;  5EBC A;  3VR4 A;  3HG9 A;  1DCZ A;  2G9D A;  3GP7 A;  2KCC A;  1A3T A;  2B2V C;  2EY2 A;  2FIN B;  4UDU C;  1ILP A;  5A2Q L;  1HXY D;  1SYD A;  1ESF A;  3IL8 A;  1BQQ T;  1WTQ A;  2C5C A;  3KK7 A;  4DNR B;  3T53 B;  2O5I C;  2R3Z A;  1W6J A;  4K5X A;  1R4P B;  3J80 E;  1JOQ A;  2RSO A;  2EZV A;  4UAI A;  4B08 A;  1RKN A;  3PV0 A;  1STA A;  3D4R A;  5FO7 B;  1RJT A;  5LL6 S;  4TSS A;  4IFD H;  1EY4 A;  1U4P A;  3TME A;  2NVQ B;  5M9O A;  1EZ8 A;  1LTA D;  3L9A X;  3DWQ A;  5JAV A;  1EWC A;  3ITP A;  1IL8 A;  4FF2 A;  4OGQ C;  3SK6 A;  1ENC A;  2F4I A;  2F03 A;  5ELD A;  3PUZ A;  3URY A;  4XIG S;  5C5M A;  1DOL A;  2JXM B;  1II3 A;  3VR2 A;  2F3W A;  1OXT A;  1Q12 A;  2F0G A;  2NVX B;  2F0O A;  2F0Q A;  4DNT B;  3H91 A;  2EDG A;  2KOL A;  3I91 A;  2NN6 G;  1I4P A;  1X3Q A;  2EYP A;  4KK7 A;  2JSO A;  2ZXP A;  5CC4 A;  3ND9 A;  3SVM A;  2E75 C;  5EQ0 A;  1SND A;  3GV3 A;  1GUG A;  3OWE B;  4G4K A;  1QNK A;  3CU7 A;  2LY7 A;  2BA0 A;  4RFB A;  4HCS A;  2EY1 A;  5I4D A;  1CK1 A;  3HKZ B;  3L7Z C;  4HAE A;  2WAQ B;  1WD1 A;  3E6Z X;  4A3G B;  5EKI A;  5NUC A;  4KY6 A;  2NBF A;  4O42 A;  4CGY B;  2PMZ B;  3VA5 A;  4CKE A;  3K5O A;  1EYA A;  5AFW A;  1GUN A;  1EEI D;  3W2D A;  1JIC A;  2J4X A;  4BY1 B;  3NXW A;  2IPK D;  5FKA C;  3GTJ B;  1E2Z A;  3VR6 A;  1TS2 A;  3OIQ A;  5J39 A;  1SYE A;  1PRT F;  2HDM A;  4QB4 A;  5E3F A;  1I4X A;  2KHS A;  1CQV A;  4F8M A;  2PZU A;  1WTV A;  2K7V A;  4GZY C;  4KTA A;  1PXU A;  1EFI D;  2L5T A;  2OF1 A;  5EGT A;  4C3H B;  1PTO F;  1VMP A;  1Z6H A;  3KLR A;  1XXG A;  4XQN A;  1PRT C;  4DXG A;  4A3B B;  5DEH A;  5J22 A;  1EYD A;  2WV6 D;  2DN8 A;  1AZP A;  1SYC A;  3VYR A;  3SDZ A;  1OXS C;  4FYD A;  2B2V A;  1SNQ A;  4DA2 A;  2B2T C;  3A54 A;  1EWH A;  1TY0 A;  2RQX A;  3BZD B;  1IW7 C;  4C3H G;  1H9S A;  5EPK A;  4G57 A;  2AQ3 B;  1BCP F;  4ZRZ A;  2WB1 B;  4ODG A;  3S2D B;  1BO0 A;  5C0X J;  1EZ6 A;  3LNN A;  1RTO A;  3K0Y A;  3AMU A;  4BBS B;  2F0K A;  3PUV A;  1PRT D;  4LJZ C;  3J81 E;  1RF2 D;  1LT4 D;  5G3L F;  1TU2 B;  1ZEQ X;  3S15 B;  4TRD A;  2TSS A;  3TSS A;  1A2T A;  1YNN C;  5IGD A;  5CBE E;  3MXG A;  3PO3 B;  5CYU A;  3NSW A;  5M5W B;  1QE6 A;  1NR4 A;  1Z7T A;  1IW7 D;  1BBX C;  4KKT A;  1G8Z D;  5C4X B;  3DM1 A;  3VYS A;  5K5P A;  1F9S A;  5CV9 A;  3OMG A;  3MZ5 A;  2BDN A;  2K5Q A;  1STH A;  2N88 A;  4XTC S;  1EY6 A;  5A2Q E;  1SDF A;  2YYZ A;  1ML0 D;  4KJN A;  3OPO A;  4ZQ3 A;  3H09 A;  1SYG A;  2EYO A;  1B53 A;  1QB5 D;  2Z4H A;  2HUG A;  4L63 B;  1B3A A;  1O78 A;  3NTH A;  1I4H A;  2BDO A;  2JA7 B;  4K6L A;  1YNN D;  1LTT D;  1SXT A;  2RSN A;  1I6H B;  1VCI A;  1XX8 A;  3OIP A;  2EYM A;  4K8J A;  1S5F D;  4KN7 C;  3U9O A;  5JJZ A;  2EYL A;  1FR3 A;  1B9N A;  2TMP A;  4NMZ A;  3DWP A;  1X3P A;  1HA5 A;  4K5W A;  1DYQ A;  1KTK A;  2QDB A;  2WII B;  3D6W A;  5EPJ A;  2X69 A;  1Q1B A;  2Z8L A;  1OXX K;  1TS4 A;  3TP8 A;  2MGS A;  1L0Y B;  1SNP A;  5CR3 A;  1HTP A;  3TZU A;  2FMM A;  2K1B A;  5HGT A;  1JOK A;  2QKI C;  1JWS D;  1BR9 A;  1JOO A;  5C0X H;  3DHQ A;  5COY A;  1QCB D;  3A8I E;  2KEE A;  3D31 A;  3MTS A;  2JA5 B;  4BY7 B;  5ISR A;  5K36 G;  3HZX A;  4QMG A;  4C3I B;  1G91 A;  4MN3 A;  4XYO A;  5KRU A;  4X3S A;  4WOR A;  5CBA E;  3K5M A;  4ULL A;  4BBR B;  1DM0 B;  1TQO A;  2B63 B;  1J9O A;  3FKI B;  2H4O A;  1GXD C;  1SNO A;  2SOB A;  1AZQ A;  1V1P A;  4RAU C;  3S2H B;  1Y8O B;  1SYF A;  2K01 A;  3P20 A;  3FPU B;  3Q0A A;  4A3I B;  2ID0 A;  1JWM D;  3K57 A;  3DEO A;  2F0E A;  3M7G A;  2F0W A;  1TS3 A;  3HGB A;  1CQF A;  1F2Z A;  1BXT A;  3FEW X;  5M3M B;  5M5X B;  4XT1 B;  3NK9 A;  1AEX A;  3A7L A;  1DOK A;  1ZYR C;  1F77 A;  1V1O A;  2Z4I A;  4RCO A;  1CA6 A;  1KDA A;  4KHV A;  4L6T B;  4A3M B;  1J8I A;  4DF7 A;  1GHJ A;  1RTN A;  3QOJ A;  3VYT A;  4K6D A;  1PFN A;  4HMI A;  4B9W A;  2ZXO A;  4K2K A;  1PRT B;  1TS5 A;  4J8Q A;  5IGG A;  1RDP D;  3C46 A;  4FF3 A;  1HCZ A;  4HED A;  5IGF A;  4LAA A;  1SFO B;  2O2L D;  4XQJ A;  1ZYR D;  5I6W A;  1PTO B;  5FO8 B;  1WTP A;  2E76 C;  3K7A B;  5ELB A;  4V19 0;  2E74 C;  1NAP A;  5JEA J;  3Q22 A;  5ELE A;  5IGC A;  3E5S A;  2QCP X;  2KED A;  3DEP A;  3LWU A;  4KJO A;  3AB9 A;  1F9P A;  1BCP B;  4F88 A;  1IKL A;  4RKL A;  2IJ0 A;  1R9T B;  3MEH A;  5ELF A;  5DAU A;  1HUM A;  1DZ1 A;  1S5C D;  1C4Q A;  2ICE C;  3KLS A;  5FLX L;  1SAP A;  5E4X A;  2WIN B;  3DWA A;  3C3L A;  3CQZ B;  2HCC A;  3SR1 A;  3ZYY X;  3P1H A;  4ABN A;  1M8A A;  1VF5 C;  3ERQ A;  5IOC A;  3CRK C;  4ME5 A;  4EQN A;  2EYH A;  3HOY B;  4HSP A;  3OSO A;  4HCE A;  4XXE A;  3M85 A;  3MAQ A;  3S1M B;  1I4G A;  4EGV A;  5BN4 A;  4DAV A;  2XVS A;  3EFX D;  3MFY A;  1B1Z A;  1CM9 A;  4FP5 D;  1TWA B;  4RCN A;  2BE5 C;  5CV6 A;  5D14 A;  3Q24 A;  5TSS A;  1VMC A;  2NVY B;  3HP3 A;  3S16 B;  3T16 A;  2EOT A;  3ERO A;  2M2L A;  3IFT A;  4RKB A;  2J0T D;  4ZLT F;  3GQB A;  4B9X A;  1Y1W B;  1LTG D;  1ROD A;  2HQE A;  1ENA A;  4G7H C;  5C3X A;  5JEA H;  3X3M A;  3GD7 A;  2F0J A;  1TWH B;  1D5X C;  5T1G A;  3M4Y A;  1JWU D;  4KKS A;  1QJO A;  1A2U A;  2PCF B;  3BDL A;  2JYO A;  2BE5 D;  5E1F A;  2KQ3 A;  1V8Q A;  3KBX A;  1OXU A;  3GTK B;  3H6M A;  1S5B D;  3A8K E;  1H9R A;  4KHZ A;  4BWG B;  3ND8 A;  5DM7 3;  2YU9 B;  4IUN A;  3S9W A;  4DFA A;  3MFG A;  3VA7 A;  1DOM A;  1ET6 A;  5CMD A;  3TP5 A;  2B2U C;  2NUC A;  2M9V A;  3QWN A;  3SEB A;  5CGK A;  1HA6 A;  4RWS C;  4ZUI A;  1FNV A;  1D1K A;  4I7Z C;  2V4D A;  1EIG A;  3R93 A;  1K83 B;  2JA8 B;  2VB2 X;  2RDH A;  5EKL A;  5FK9 C;  3D4D A;  2B2Y C;  1ESR A;  4NP5 A;  1S4Z A;  5CV7 A;  3HEJ A;  4IUV A;  3PUY A;  4IUU A;  4RHS A;  4DAY A;  1D6E C;  4DAP A;  2K5W A;  4IUQ A;  2PZT A;  2L11 A;  2F0H A;  2K28 A;  3WOF A;  4F7X A;  2DY8 A;  3TN2 A;  4C2M B;  4WFN 3;  2CQA A;  2SNM A;  2DY7 A;  4BA2 I;  1EIH A;  3BVZ A;  1CZW A;  4ILW A;  3HOZ B;  3QOL A;  1MI2 A;  3SHL A;  1D5M C;  1G2S A;  1SNM A;  4A3J B;  2PPB C;  2VXW A;  3GTQ B;  1KLU D;  1I6V C;  3MVV A;  3QO2 A;  1WTX A;  1FNU A;  3NUC A;  3RLF A;  3BYY B;  1Y1V B;  2B39 A;  2OEO A;  3O13 A;  4JK1 C;  1Y8N B;  2EYJ A;  2L4N A;  4HR7 B;  1TKW B;  4J6H A;  3K5N A;  4C3J B;  1H9K A;  2PW5 A;  2NN6 H;  2N55 A;  2A69 C;  4KD4 A;  1Y69 U;  2K03 A;  3IAY A;  1IYV A;  1A3U A;  4RA8 A;  2NYZ D;  1KDC A;  3BVM A;  2O4X A;  5LL6 X;  1ZXT A;  2IX0 A;  3I72 A;  4H13 C;  4MIU A;  5T1I A;  3KLS X;  1SJE D;  1JQY D;  4KN4 C;  4IUT A;  1A3V A;  1D5Z C;  4KY7 A;  1PMR A;  4Q5V A;  4C3J G;  2D5D A;  4PMW A;  2XRQ D;  5FLX E;  1A6X A;  4QIW B;  2F0L A;  2AUJ D;  3NBI A;  4FXG C;  3PO2 B;  5JOB A;  4M8A A;  1F9R A;  4HTH A;  2A69 D;  3GV6 A;  4ID6 A;  2HDL A;  1AW7 A;  1LTI D;  1NSN S;  4OO1 I;  2PZW A;  3T4A C;  3PUX A;  4EQP A;  4X3K A;  1GHK A;  2ZT9 C;  3BDC A;  1EY7 A;  2MPM A;  1QNU A;  1H9S B;  1QIL A;  2PO4 A;  3P7J A;  1LTS D;  3J7Y W;  3M7N A;  2H1E A;  2AQ2 B;  1GUT A;  1K8O A;  1PZI D;  2B8G A;  1CFM A;  4ZKC B;  3LWE A;  3SK8 A;  2J7Z A;  1YNJ C;  3VR3 A;  4HSV A;  2LS0 1;  2K5D A;  2ENB A;  2B2U A;  1CZG A;  4A3E B;  1NCV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...