4JI1L

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
124
structure length
123
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKLLGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 14
structure length 123
sequence length 124
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4ji1L00
2FXQA 2IT1A 3A74A 4YCWA 3M9BA 4GNXB 4UP8A 4KI0A 2YYZA 5E7NA 4A3DG 1VCIA 4JI1L 3RZDH 1HNWL 1Q86C 1E22A 1PH6A 5GADC 2UU9Q 4LF7L 3CMAA 1C9OA 3U4ZA 3OTOL 4LF6Q 2PQAB 4EX5A 1PVOA 1YITA 4AYBG 2B63G 1K3RA 5HGQA 1K83H 4YHHQ 3HKSA 1OTCA 2B3GA 3STBD 3KJOA 1YJWA 2JA5G 1QUQA 1TWGH 1SRUA 4DV6L 3ER0A 4A3GH 3HOYH 3W1GA 3TQYA 3CCQA 5ELNA 3PUZA 4KLKA 3KF6A 4JI0L 3T1YL 4DUZQ 4A3FH 2ASBA 3PGZA 1HJPA 5M5WH 2NVQH 4DR4L 2D62A 2NZHA 4OXPA 5IYBH 4ALPA 3PIPA 2A8VA 3PO3G 1P16A 2YTVA 4JI8L 4GOPA 1WJJA 1E1TA 3MEFA 4GN3B 2KBNA 3HOXH 3STBC 4AYBE 2D0PA 1G291 1EYGA 4POGA 1VQIA 1AH9A 4LF5L 1KRSA 4A4IA 3DM3A 1HZBA 1TXYA 1GKHA 4LFCL 3HOVH 4LF9L 3OW2A 1X3GA 5GAHC 4R4QA 2UXBQ 4R4TA 2CCZA 3MXNB 1UEBA 1VQGA 3ULJA 5FLMH 3F2BA 1UE7A 3J81i 2KENA 1PH1A 2WP8J 3EN2A 3HFZB 1QZGA 4OWTB 2E2HH 1LYLA 3CPFA 4DR6L 1N32Q 4DR3Q 3U58A 4B3ML 1KQSA 2LSSA 4P75A 1VQLA 2JE6I 4FDBA 5C3EH 3HOXG 4A93H 1S3OA 3FP9A 3EIVA 3CCEA 4DK3C 1W2BA 3A5UA 2VL6A 1JJCB 1C7YA 3I4OA 4MTNA 1PHJA 2YTYA 4IFDG 4JCVE 4BBRH 4YY3L 1X9NA 3S15H 4X64L 1IBMQ 2GVAA 3CPWA 4OONA 4EQ5A 3NENA 2CWPA 2F52A 1XMOQ 4X62Q 1A0IA 1XNRL 2HT1A 2JA8G 2YTXA 3M3YH 3F1ZA 1HZ9A 2Z6KA 2RHSB 1YHAA 4L5QA 1X3FA 1K0RA 2K5HA 3CF5A 3AQQA 4BBSH 4B3TL 2UXCL 4X64Q 2PI2E 1Y1WG 2K5VA 2VS1A 1SROA 4X65L 2R93H 1CUKA 4IJLA 1N34Q 2JA7G 5ELOA 3KF8B 1KD1C 1L1OB 4IJHA 4HJ8A 1S40A 1VQ6A 2A19A 1B7YB 2HIVA 2CWAA 1FJGQ 2R7ZG 2KCMA 4C3JH 1XJVA 1EIYB 1I50H 1G6PA 4C3IH 1I5FA 3M7NA 3TREA 5BR8Q 2R7FA 5IP7H 4AQYQ 2B63H 3I4NH 4B3RQ 4KHPQ 1BVSA 3CCLA 4R1JA 3S17H 4OWWB 5M3FG 2R6GA 1Z47A 2I0QA 1N34L 2UXDQ 3EBEA 3FKIH 1QVGA 4DR7L 2Y0SE 4Y7NH 2R93G 4IPGA 2VNUD 1VQDA 1KIXA 4LFBQ 4A3FG 4LUZA 1XPOA 4TVAB 4A3BG 5GQOA 1Q8KA 3E9HA 2CKZB 3J81c 2YU9H 4H02A 2IHFA 5HY6A 1IXRA 3UDXA 4BA2I 3L0OA 4BXXG 4A3MH 1KC8C 5IP7G 3L7ZC 2ES2A 4QY7A 1MJEA 2ZTDA 1HNZL 4X66Q 1S72A 1JJ2A 2JA6G 4DV7Q 1IBKQ 1IBLL 3KDFA 3UE1A 3I4MG 1UWVA 2RCNA 1PH4A 1NBWA 1JE5A 4YY3Q 3I7FA 4DV2L 1I6HH 1HZAA 3ULPA 4A3JH 3S1NH 3TS0A 3W5OA 2H5XA 3PUWA 3J7ZC 4JI0Q 3K0XA 5C44H 1EIFA 1BBWA 1WCMH 1CSPA 3RN2A 1QVCA 1RL2A 4JV5L 4AIMA 3GTOH 5C4XH 4JI6L 2IY5B 4NXMQ 2D0OA 2E5LQ 3DLLA 1Q46A 4IFDI 2RF4A 2AHOB 1OXXK 2VY3A 3CCSA 3KYHC 4HJAA 3ICEA 1YZ6A 1B70B 4PG3A 2Q2TA 4QL5A 3I4MH 2I5HA 2UXBL 3NELA 1HR0L 4LFAL 1WOCA 4JI3L 4AH6A 1XTDA 5IP9H 1K9MC 2GVBA 3UE0A 4A3DH 4X6AH 2ZJQA 1XPRA 5EAYA 3CCUA 1WCMG 4GLAC 1Y1WH 4BY1H 4JOIC 3JAMc 1PH3A 1SE8A 3AFPA 1L1OA 4WJ3M 3BU2A 3S1MH 1GD7A 5C4XG 2R92H 1PH2A 2AKWB 1K8GA 2PQAA 4DR1Q 4QIWE 2UUBQ 4DAMA 2JA5H 4C3HH 4DV1Q 4Y52H 3PIOA 5IE8A 1XNQQ 1PYSB 3HOZH 3T1YQ 4UY8C 3I4NG 1MKHA 1NMFA 1EOVA 2E2JH 1KXLA 5M3MG 1N36Q 2Z6KC 4DR7Q 4GLVB 1Q7YC 3NEMA 2WAQE 2R7DA 2K50A 1VQCA 4PZ6A 5LMNL 1U5KA 1JB7A 2OTLA 4IFDJ 1T9HA 2EIFA 4GN5A 4IPHA 4DV5Q 1B8AA 1KAWA 3CCMA 1GVPA 5FJ8H 1V9PA 4B3RL 1U0LA 1L2FA 2LXKA 1PH8A 1VQKA 2WFWA 3U50C 4LF8L 2Z0SA 1PYBA 2ZM6Q 3CCRA 2I5LX 3RR5A 4L5RC 1R9TH 4HIOA 3OTOQ 4LF6L 1V1QA 5AJ3Q 3HOZG 3PO3H 1IZ6A 1ASYA 4DR3L 4A3IH 4TQUS 3PV0A 3KFUA 4KHPL 1X55A 4HIDA 4XIGS 4DV5L 2E2IH 1X56A 4GN4B 3RZOH 3HOUH 5H1SE 4MZ9A 2AWOA 4A3JG 1PH5A 4DV4L 4X66L 3G6EA 4HIMA 5J3BA 1QUQB 1KRTA 1VQBA 3S16H 1XMOL 2ZJRA 1HNZQ 2EQSA 3Q8DA 4A3KG 2E8GA 1Y14B 4B3SQ 4GKKL 4OO1G 4GS3A 2N3SA 4BY7G 5IYDH 3AFQA 4DK6C 4DV3Q 4A3LH 4DUZL 3T1HL 2NZOA 3KJPA 2Q2UA 4JI4L 3GTMH 2BA1A 4JI7L 2E5LL 3HOUG 2VZAA 2VW9A 1XPUA 3K7UC 2PMZE 3I2ZA 1TWFH 3PSIA 1YEZA 2NN6G 1X3EA 1OXVA 2OCEA 1A8VA 2Q2HA 4P74A 2QA4A 2UUAL 5FLXc 1SMXA 4JV5Q 4B3MQ 4QQBX 1FJGL 4A93G 1JJGA 1PH7A 4NXML 2R7ZH 2PI2A 3K7AH 4DUYQ 3J7A5 2NVTH 3WWVA 1VQ5A 4DV3L 5IY0A 1Q81C 4QJFA 4GNXA 4DKAC 2JK8A 1PH9A 2UUAQ 3W1BA 2EXDA 2K5NA 4A76A 2R92G 4JI2L 2V1CC 4O2DA 2MQHA 5LMNW 3H3VH 4JI5Q 2MFIA 5FLMG 4GKJQ 4JI4Q 1XNRQ 2CQOA 5K36G 4JBWA 3PF5A 1SN8A 1AE2A 1LM0A 4PZ7A 1FVIA 3BZKA 5M3MH 1QZHA 4OX9Q 4JYAQ 4JI5L 3UDFA 4DR1L 4LFAQ 3KDFB 2F3IA 2N78A 3AYHB 1YI2A 1J5EQ 1VQNA 4RMFA 2ATWA 3ERSX 3ZJYC 3G71A 4JOIA 2VQEL 2XGTA 4DV0L 3JC66 3SGIA 1WFQA 3BZCA 3K80C 3GD7A 1NJIC 1OXSC 3S2HH 4LFBL 2WAQG 4K0KL 1VQEA 1M90C 2JA6H 1N9WA 4NB3A 1HNWQ 4BBRG 3GTGH 3VDYA 2UXDL 4XTCS 1WI5A 3K81C 1Q1EA 1YBYA 4IOCA 3RNUA 4LF4Q 2F4VQ 1FL0A 1HNXL 4A75A 3JAMi 5C44G 1N32L 1JT8A 3S1QH 5AJ3L 1FGUA 2L15A 2QEXA 4C2MH 5LMNQ 2N8NA 3HKZG 4UP7A 1X54A 3CW2C 1YHBA 3M4OH 3RN5A 1Q82C 4R4CA 2IX1A 1HZCA 4JI8Q 5IYCG 1EFWA 4L5TA 2JJQA 2NVXH 1L1OC 3OYYA 4DR4Q 2N49A 2ALYB 1E3PA 1VQPA 4LF5Q 4X62L 1IBKL 4YWKA 5IT9c 3CC4A 3CCVA 4DV4Q 3T1HQ 1IBML 3HOWG 3G4SA 3CCJA 1W3SA 1YHQA 5C0XI 4DPGA 2CFMA 4POFA 5GAEC 5M3FH 2XTIA 4NPSA 2NN6I 4JI2Q 3FKIG 3H15A 1IYJB 2OQKA 4OWXB 1VQFA 1Q1BA 3I56A 4PMWA 3A5ZB 1K73C 1I3QH 5GAGC 4DV7L 1VQHA 1MIUA 2PNHA 3B6YA 5C0XG 1L0WA 4YWMA 1I94L 1VQJA 3RLOA 4DV6Q 1YIJA 2AMCB 2JEAI 1AE3A 1TWAH 2K75A 4JG2A 1Z9FA 3PCOB 4YCVA 2VQFQ 2Q2IA 1OXTA 1HR0W 4LNQA 4BXXH 3S14H 1E1OA 4WJ4A 3KOJA 2JA8H 1XMQQ 1VQAA 2JA9A 1UE1A 1DGSA 2Y0SG 3RLFA 1I94Q 1CSQA 5BR8L 4BBSG 1E7ZA 3TS2A 1TWHH 4IPDA 1X6OA 4APVA 4LW1A 1ASZA 4K0KQ 4A3GG 3G48A 2BH8A 3GO5A 5LMUQ 2IX0A 4JI7Q 1SLJA 4MNOA 5FJ8G 4DR6Q 4YCUA 1A62A 3CP0A 3HOWH 1GM5A 4RG1A 5GROA 1D8LA 2BA0A 2VQEQ 1NY4A 1CKOA 1N8RC 1CKMA 1EQRA 3UDIA 4GOPB 2K14A 1LTLA 2WB1E 2UXCQ 4JBKA 4DR2Q 2UUCQ 4IO9A 4BA1I 4UP9A 2IHEA 3KF6B 2UUBL 2HQLA 2YV5A 3HOVG 3L2PA 1J5EL 4P71A 1TWCH 1XNQL 4OX9L 1IBLQ 4DR2L 4X65Q 1VQOA 5IP9G 1YJNA 2VUMG 4R4IA 3GDEA 3H0GG 4IPCA 3ULLA 4DAYB 3AEVA 3GTPH 1VQ7A 1PA6A 4R4OA 4KHZA 3CMEA 1BBUA 2MNAA 4A3BH 1EUJA 1Y1VG 2AWNA 2MO0A 3M4QA 4YWLA 5C4JH 2GN5A 2UU9L 5DLQE 2K4KA 2ZJPA 5IWAQ 2MO1A 4JI1Q 3NBHB 3HKZE 4A3MG 2WB1G 5IYDG 4BY7H 3D31A 3E9IA 4LUVA 2RHQB 1N33L 3CC2A 4A3LG 5IYCH 1YJ9A 3GTLH 3PUXA 4HJ7A 4GNXC 3A0JA 1N36L 1EWIA 4DV0Q 5IWAL 4AQYL 1X65A 3CC7A 1KL9A 3E0EA 2VQFL 3CQZH 2VUMH 3H0GH 1N33Q 3I55A 3U4VA 3J80c 3F2CA 4L5SA 4HJ5A 2C35B 4LF4L 2F4VL 1V43A 1VQ8A 4LF9Q 1NE3A 1SFOH 4A3CH 5JJLA 3S2DH 1MJCA 1NMGA 2A1AA 3UDGA 2JA7H 1YVCA 5JEAJ 4IOAA 4GKKQ 2K52A 3KLWA 4J15A 4LUOA 4GKJL 2I5MX 3F8TA 3CAMA 3HOYG 2HHHQ 1HH2P 2OTJA 3TRZA 3LGJA 4A3IG 4NXNQ 1WYDA 3CXCA 5M5XH 1PV4A 2LXJA 3PUYA 5JJIA 5LMUL 5IYBG 4ME3A 4JBJA 4HJ9A 4OO1I 4DR5L 4DNIA 1VQMA 4LF7Q 3GTKH 4A3CG 1YNXA 4BY1G 4DUYL 1Q12A 2OQ0A 1EQQA 1CKNA 3BJUA 1BKBA 1HR0Q 1UE6A 4DR5Q 1XMQL 1OXUA 1O7IA 3D0FA 3J81j 4JI6Q 3PO2H 4A3KH 2KHJA 5JJKA 2JQOA 4DV2Q 2HHHL 1HNXQ 1GO3E 1P8LA 4GOPC 4JC0A 3CD6A 3H3VI 1G51A 2KHIA 4NXNL 3GTJH 2BH2A 1E24A 2ID0A 3PF4A 3IRBA 3S1RH 4A3EH 5C3EG 1K8AC 4JYAL 2ZTEA 1SR3A 4LWCA 4LFCQ 4DV1L 4GLXA 4JBMA 2DUDA 1VQ9A 3K8AA 2HIXA 4B3TQ 4P73A 1PFSA 2B29A 2JEBI 4P72A 4HIKA 3GTQH 1NTGA 3M4PA 3PUVA 2DGYA 1Y1VH 4QGUA 1D7QA 4B3SL 3PO2G 1A63A 3J80i 5C0XJ 3FHWA 4UPAA 1UE5A 3S24A 4YHHL 4JI3Q 3TEHB 1QVFA 1JMCA 2NVYH 1LUZA 2QGQA 4PZ8A 1VQ4A 2UUCL 2OWOA 1M1KC 4LF8Q 1IL2A 5JEAG 1J6QA 1CKNB 4O0AA 3F2DA 1RIPA 1H95A 2KCTA 1C0AA 3RLNA 3M85A 1KHIA 4A3EG 1VS0A 5M5YH 2ZTCA 2ZM6L
chains in the Genus database with same CATH superfamily
2FXQA 1II3A 4GNXB 5C3EB 3GTKB 4A3DG 2B2VC 1VCIA 2FFKB 3RZDH 1HNWL 1E22A 5GADC 3OTOL 1G8ZD 3TP6A 4BBRB 4AYBG 2M00A 1OTCA 3PO2B 2B2YC 3KJOA 1TWGH 1SRUA 4ZUIA 4DA2A 2L5TA 3TQYA 2DNCA 3CCQA 1GOZA 1O78A 3T1YL 3K59A 3S1RB 4FF2A 3Q6SA 1HJPA 3FMCA 3PIPA 3PO3G 2YTVA 1E1TA 3A54A 3K6OA 1WTXA 1KRSA 1HZBA 1D2BA 4LFCL 4V190 2DY8A 3ULJA 4HTHA 3EN2A 3TMEA 1N32Q 4OWTB 5LL6S 1S4ZA 2XSCA 3U58A 1KQSA 2LSSA 2E75C 4FDBA 1B44D 4HMJA 3KLSX 3CCEA 2E74C 5HURA 1XYIA 3W3AA 3Q24A 2YTYA 4OELB 4ZKBB 4IFDG 4YY3L 1X9NA 1SYBA 4ZKCB 3BVGA 3M3YH 2EDGA 2Z6KA 4A3GB 1K0RA 2K5HA 3AQQA 3MZ5A 1AEXA 2PI2E 4A3FB 1Y1WG 4LAAA 2R93H 4IJLA 2JA7G 1AFPA 1KD1C 4IJHA 4HJ8A 1I6VC 5C4ZA 1GUGA 1VMPA 5E1FA 2R7ZG 1NR2A 1C8CA 1EIYB 1WTPA 3LWUA 1MHWC 3M7NA 1BVSA 4DF7A 5JPNC 5KYIA 2M9VA 2IX3A 3EBEA 1HFGA 4DR7L 4Y7NH 4IPGA 1VQDA 1FYCA 4FP5D 4K6DA 2I46A 2PZWA 5M9OA 3MVVA 1PTOD 5CR3A 1AZQA 1Q8KA 4G7HC 2QEJC 1MD2D 3UDXA 4BA2I 4A3MH 1KC8C 2ES2A 4R8IA 4G4KA 4X66Q 4G7ZC 1WTWA 1IBKQ 1STYA 2PW5A 1QE6A 1IBLL 3I4MG 2Y0SB 1UWVA 1PH4A 1A3VA 5KNDA 3NTHA 4YY3Q 3J81E 2F0FA 2K7VA 3NE5B 3NXWA 1HZAA 3ULPA 4A3JH 3J7ZC 3K0XA 1NCVA 2R93B 1SNOA 5C44H 1EIFA 2A74C 1BXTA 2JN4A 3DUZA 3TP7A 1D1KA 1PTOF 2IY5B 5IODA 1STEA 2JSOA 2B2TA 5BN5A 2AHOB 4RCNA 1OXXK 2VY3A 3KYHC 4HJAA 1YZ6A 5DM63 4LFAL 2NBFA 3UE0A 4FNFA 4X6AH 2H1EA 2ZJQA 1PZJD 2BOSA 3A8JE 3OMGA 4BY1H 3JAMc 1PH3A 3BU2A 1K8GA 2K04A 2PQAA 2YU9B 2X69A 3TP5A 1ENAA 3G6JB 4P2CB 1LTRD 1Z6HA 4K2KA 5M3MG 2F0UA 4DR7Q 5C4JB 4GLVB 1Q7YC 1JB7A 1I6HB 2R7DA 2K50A 4A3JB 4PZ6A 1PRTC 3SK4A 4DV5Q 4RKBA 3S9WA 1SSOA 1GVPA 5FJ8H 1V9PA 3K7AB 4I7AA 4PV1C 2ZM6Q 1HUNA 2ENBA 2I5LX 3MFYA 1GHKA 5T1GA 4LF6L 1QNUA 4TQUS 4KHPL 2Q8RE 5LL6X 1X55A 2E2IH 4XIGS 2KCNA 2RSNA 4EQNA 4PMBA 4HAEA 4JK1C 4XQQA 1ZXTA 1PLFA 4A3DB 4A3JG 2EXZA 4DFAA 3NP8A 1EFID 1KRTA 5J22A 1U4PA 4GKKL 4K8IA 4C3HB 1R4QB 4DK6C 1G6ZA 4A3LH 3KJPA 2Q2UA 2A68D 1MSGA 2VXWA 4JI7L 5K36H 3K7UC 3I2ZA 1VQPA 1YEZA 2OCEA 3PO3B 2BE5D 1JJGA 1CZWA 1FJGL 3FRPB 2PI2A 3K7AH 3WWVA 1A2TA 4QJFA 1PH9A 1TIID 2K5NA 1O7YA 1H9SA 2D2CC 2EYOA 5LMNW 3H3VH 1SYCA 3WDNA 4JI5Q 4FO2A 2CQOA 4JBWA 1IHZA 3HOUB 2RBMA 4JYAQ 1I3QB 3KDFB 2N88A 2N78A 3P75A 5CGKA 3ERSX 3IFDA 4RHSA 4JOIA 5CV4A 4DV0L 1F9SA 2EY2A 3K5MA 1HNWQ 2SNSA 2IPKD 3BDLA 2M2LA 1IKMA 3K81C 3EJIA 2F3WA 2F4VQ 4A75A 5C4HA 2F0MA 5AJ3L 1FGUA 2QEXA 5LMNQ 5J39A 1X54A 2R7ZB 1RJTA 1Q82C 3TN2A 1TKWB 5IYCG 3HG9A 2N55A 3VR5A 2N49A 5E4XA 2WAQB 3CC4A 2R3ZA 3BDOA 4DV4Q 2LY7A 3T1HQ 1CA5A 1YHQA 3VR3A 5GAEC 5M3FH 3TZUA 1BOSA 3FKIG 1VQFA 1GUTA 3I56A 2OXPA 3A5ZB 1ESFA 3D4WA 1C48A 2G9HD 2PZTA 3B6YA 1I94L 4QB4A 1JOKA 5DNFA 2AMCB 5ELBA 3MWYW 3S2HB 3PCOB 2AQ2B 2PZUA 2Q2IA 2QCPX 5CV5A 3KOJA 2JA8H 3RMHA 1I94Q 4LK1C 4DK0A 1LT4D 3HOWB 4IPDA 3TS2A 4K0KQ 1ASZA 3G48A 3GO5A 4JI7Q 4MNOA 3NPPA 3WOEA 1B1ZA 3S1QB 1EY0A 1SFOB 4Q5VA 1RTOA 1TS5A 3K0YA 1D5MC 2VQEQ 2F0DA 5FKAC 4GOPB 1LT3D 4KV6A 5BN3A 2KA7A 3N6RA 4JBKA 4BA1I 4UP9A 4DNRB 4LJZC 3DHQA 5JAVA 3HOVG 1J5EL 1TWCH 1XNQL 2F0IA 5M3FB 1VQOA 5IP9G 5D14A 1D6EC 2DJFC 3CMEA 3OIQA 2MO0A 1Y1VG 2AWNA 2TSSA 2UU9L 1ICWA 2QW7A 2K4KA 2ZXRA 2PMZB 4N9TA 4V0BA 4ZUJA 3J80E 1YNJD 3CC2A 1TVXA 1YJ9A 3GTLH 1Q3LA 4GNXC 4DV0Q 1IYUA 3MFGA 1KL9A 3E0EA 1KDBA 3I55A 3U4VA 1CQVA 2C35B 5IT9E 4ZK9B 1EY6A 5JJLA 4OIKA 3S2DH 1PFBA 1S5BD 4KN4C 1NMGA 2F0QA 2VB2X 2JA7H 5JEAJ 4GZYC 4EQPA 1Y1VB 1ICFB 3I73A 3OWFA 4Q0FA 2K52A 2NVYB 3A55A 2I5MX 3F8TA 3CAMA 5F2DA 5DM73 4KKSA 1QILA 3PUYA 1WD1A 4B08A 5JJIA 1DOKA 1ILPA 1G91A 1QCBD 2G5DA 2PQEA 4DNIA 1VQMA 4LF7Q 3PIO3 4DUYL 5CYUA 1Q12A 3RZDB 4ABNA 1EQQA 3BS1A 4IUTA 4DR5Q 1XMQL 2Z8LA 3J81j 2EPBA 2MPMA 3PO2H 2O5IC 1KABA 1BCPB 1FGBD 4RGNA 3CD6A 2AUJD 5C3XA 1E24A 3IRBA 4A3EH 2ZTEA 4RAUC 4LWCA 4LFCQ 1KLUD 1ZYRC 2JYOA 3H6MA 3K8AA 2B2WA 4B9XA 1EY4A 4P73A 1PFSA 4P72A 3PUVA 3OHXC 1Y1VH 4QGUA 1KDCA 1ML0D 5JOBA 1LO5D 3J80i 4UPAA 1KNAA 4YHHL 2RDGA 4PZ8A 2UUCL 5JEAG 1CKNB 3F2DA 1X3PA 1EYDA 1C0AA 3RLNA 3M85A 1XTCD 1HPCA 3A74A 4YCWA 3M9BA 1Y8NB 1PYWD 2KHSA 1EY8A 2OT2A 2QF7A 2WINB 1GUNA 1IKLA 2G9DA 1PH6A 2UU9Q 1U4MA 1PVOA 4EX5A 1K3RA 1K83H 4YHHQ 3HKSA 1PMRA 2JA5G 1QUQA 2ZT9C 5E4WC 4DV6L 4A3GH 3E0JA 1TY0A 3W1GA 1JB3A 3PUZA 4KLKA 2WIIB 4JI0L 4A3EB 5C6AA 2NVQH 5M5WH 4DR4L 4ZQ3A 4OXPA 1XXGA 4DK1A 1WJJA 4GN3B 4A93G 1AH9A 1EYGA 2D0PA 3DM3A 3HEJA 4I65A 3G7LA 4J8QA 3OW2A 2GA4B 2B2WC 5GAHC 1SNCA 4R4QA 1K3BC 3IAYA 1UE7A 4CKEA 3J81i 2WP8J 4P75A 1VQLA 1OO9B 1HHVA 1RD9D 4RCOA 4KY6A 1S3OA 3FP9A 2CVRA 4DK3C 1W2BA 1F2YA 2VL6A 1JJCB 1ONLA 2JP1A 3I4OA 4MTNA 1I4PA 1C7YA 1NSNS 1L0YB 1E0BA 3D6CA 4X62Q 1A0IA 2HT1A 2JA8G 3F1ZA 1HZ9A 1YHAA 1O7LA 4NKLA 1SROA 4X65L 1CUKA 4DAYA 3ND9A 3HOXB 2A69D 1B7YB 5CV7A 1F9QA 4ME5A 1XJVA 1G6PA 4C3IH 1I5FA 5BR8Q 2R7FA 1HTPA 4AQYQ 2B63H 4KHPQ 4KMUC 3CCLA 4YIJA 4OWWB 5M3FG 2R6GA 3FKIH 1A15A 2K1BA 1ENCA 1I4RA 2LFNA 3CRLC 2IHFA 1IXRA 3L0OA 3R8BA 4K6LA 5IP7G 3L7ZC 4ZRZA 4QY7A 3IFTA 2ZTDA 1S72A 2J0TD 3M3YB 1H9MA 1STAA 2E2JB 3A7LA 4IALA 3S1NH 1I6HH 2H5XA 5LHY1 1Y69U 1BR9A 1BBWA 1WCMH 3RN2A 1FD7D 4JV5L 2E5LQ 4IFDI 1Q46A 4C3JB 2RF4A 2C5CA 5CV9A 1V1PB 4PG3A 4A3IB 2Q2TA 4QL5A 3I4NB 1WTHA 1S5ED 3RZOB 1HR0L 5IP9H 2GVBA 3I3CA 3SK5A 2A6EC 3QB3A 4JOIC 3AFPA 3KF8A 1SNMA 1VF7A 3MTSA 2UUBQ 4C3HH 2LMCB 2IW3A 3PIOA 2F3VA 5KYLA 1EOVA 1PTOH 1TWFB 3NEMA 5LMNL 2KEEA 5CV6A 3HP3A 2EIFA 2FJ2A 4UHVA 2MJ8A 1KNEA 1W6JA 1U0LA 1I4QA 1L2FA 1PH8A 1VQKA 2WFWA 1S5FD 4LF8L 4FVMA 4HIOA 2A69C 2DN8A 1V1QA 2Z4IA 3NWTA 3HOZG 1TS2A 4OEMB 1IZ6A 3BDCA 4RKLA 4DU9A 4RA8A 3SK6A 4H13C 4XXEA 3AU7A 3P7JA 4DV5L 4KY7A 5FLXL 3HOUH 5H1SE 2AWOA 4DV4L 4BY1B 1DM0B 1QUQB 5G3LD 1VQBA 2A5HA 3AB9A 2E8GA 4ZCKA 1EL0A 1Y14B 4OO1G 1LTBD 2N3SA 4DNTB 3Q0AA 4JI4L 1D5XC 2NZ1D 2EYJA 2XNAC 1XPUA 5C4JH 1R9TH 2K03A 1X3EA 2RKSA 1A8VA 1LTGD 4KY5A 1PH7A 3M4OB 2EOTA 2PO4A 3J7A5 1BO0A 1B50A 5J1ZA 5G3LF 4DKAC 4QCLA 5KIXA 2K28A 1EYCA 1V1OA 1CK1A 4GKJQ 4JI4Q 1XNRQ 5K36G 3PF5A 1AE2A 3M7GA 1IYVA 2F0PA 1DZ1A 4UAIA 4OX9Q 4JI5L 4DR1L 1F77A 4EGVA 3AYHB 3VYTA 4RMFA 4C1NK 1GJXA 1B53A 1WFQA 3K80C 3GD7A 2WKDA 3S2HH 4K0KL 1F2MA 1VQEA 1M90C 2JA6H 1N9WA 4NB3A 3GTGH 3VDYA 3NHHA 4XTCS 1Q1EA 1YBYA 2RA4A 3RNUA 1EEFD 1JT8A 2HD3A 1R9TB 2IWHA 1TT2A 4C2MH 3I4LA 4LMQD 1D1IA 2N8NA 3HKZG 2FMCA 4JI8Q 1EY5A 4L5TA 1SXTA 1V1PA 1E3PA 4O1NA 2IJ0A 4C3IG 4JVZA 1IBML 2L11A 1SNPA 2BDOA 5CORA 2JXMB 3DEOA 2F0KA 4JI2Q 4C1NI 1IYJB 4FXGC 1TY2A 1B2TA 4A3BB 1I3QH 5GAGC 1DOMA 4DV7L 1K8OA 1VQJA 2B2TC 3KLRA 2JEAI 1AE3A 1TWAH 4JG2A 3Q22A 2VQFQ 3E6ZX 1ESRA 4LNQA 2JA6B 4WJ4A 1XMQQ 1UE1A 1DGSA 3I72A 4RGOS 1CSQA 5BR8L 4DAVA 4APVA 5NUCA 4A3GG 5LMUQ 2KECA 4EVOA 2K33A 4NDXA 2F0JA 4C2MB 4RG1A 4RWSC 5GROA 2BA0A 2JA7B 1CFMA 2WB1B 4C3JG 2K14A 2L55A 5FOBB 1LTLA 2WB1E 2NVXB 4IO9A 1PFNA 1F2ZA 3KF6B 1CQFA 2YV5A 4PMCA 3L2PA 4OX9L 1HTLD 3DM1A 5EKKA 3KUPA 2SNMA 3BZDB 1PA6A 4QF4A 4YWLA 5DLQE 2BCOA 2WB1G 5IYDG 4BY7H 1TWAB 5FO7B 1ET6A 2RHQB 4KJNA 1N36L 3A0JA 1EWIA 5KNCA 2VQFL 3CQZH 3H0GH 4L5SA 2NB0A 2F4VL 1NAPA 3H91A 1SFOH 4A3CH 1MJCA 4HSPA 3MXGA 1EU4A 4NMZA 3UDGA 1YVCA 2PNRC 4RHRA 2IL8A 3DEPA 1RTNA 3KLWA 4FYDA 2KOLA 1TU2B 3HOYG 2HHHQ 2F0HA 3NWSA 4DN4M 1KAAA 1WYDA 3I8ZA 2PCFB 2LXJA 5IYBG 2X6LA 4JBJA 4HJ9A 5L37A 3E5SA 4CJ1B 1CHPD 4B9WA 3BJUA 1BKBA 1HR0Q 4TSSA 1UE6A 1XWEA 3EQLC 1O7IA 3D0FA 1K83B 3R93A 1DONA 4JW0A 2JQOA 1BNZA 1CHQD 2HHHL 1TWGB 1HNXQ 1GO3E 1G51A 3D4DA 2EVBA 4NXNL 2BH2A 3CQZB 1O7ZA 5M5WB 1IW7C 1SR3A 1UAPA 3J80L 4DV1L 1BF4A 1STGA 3O13A 4XDXA 4B3TQ 1QWYA 3URYA 2SOBA 1NTGA 3M4PA 1H9JA 4X3TA 3I91A 1ZYRD 1JC7A 4AYBB 3KBGA 3PO2G 3FHWA 3S24A 3I90A 4KJOA 1C4QA 2QGQA 3ITPA 1VQ4A 3D3RA 3QOLA 2OWOA 4H0LC 4O0AA 1ZKOA 5IGCA 1VS0A 3RR5A 3H3VC 2IT1A 4UP8A 4KI0A 1EOTA 2YYZA 4ZLTF 4QUFA 4JI1L 1JICA 1SE3A 3X3NA 4IQZA 1Q86C 4LF7L 3CMAA 1C9OA 3U4ZA 4LF6Q 2PQAB 1HCZA 1YITA 3V96A 5IGFA 2B63G 2PYKA 1O80A 3STBD 1SMYD 1YJWA 4C3HG 1QJOA 1SJHD 2F0SA 4FF4A 3HOYH 3L9AX 3P1HA 4DUZQ 2XWBB 1EY7A 1EU3A 5IYBH 4ALPA 1P16A 4JI8L 4GOPA 3MEFA 3HOXH 4AYBE 1G291 3GTQB 1VQIA 4K8JA 2O5JC 4A4IA 1LABA 1HFNA 4LF9L 4C3IB 1JWMD 2B63B 2UXBQ 1PRTF 2K5WA 3MXNB 1VQGA 1UEAB 3S17B 2KENA 1QZGA 3HFZB 3FDTA 1LYLA 3CPFA 4DR3Q 2JE6I 3A8KE 4KD3A 1SE2A 2AUKA 3R2IA 5EGTA 4A93H 3EIVA 4FXKC 2XRSD 2NWGA 1PHJA 4DGZA 4JCVE 4X64L 1MI2A 2L4NA 2GVAA 1IBMQ 4S3SA 4OONA 1RCVD 2WKCA 3NENA 2CWPA 2F52A 4EQ5A 1XNRL 1W6KA 2RHSB 3QO2A 3WOFA 4L5QA 3CF5A 4B3TL 4X64Q 1BCPD 4TKOB 2K5VA 2VS1A 2DNEA 5C44B 1N34Q 5ELOA 1L1OB 1S40A 5JVG3 4L63B 2HCIA 3GTOB 1PTOC 1BUVT 2KCMA 4C3JH 1I50H 1QB5D 1YNJC 3TREA 3I4MB 3V05A 5KNBA 4B3RQ 1BQQT 4R1JA 4HCEA 3L3OC 4PNYA 1PFMA 2EYHA 3K5OA 1QVGA 1RKNA 2Y0SE 1SAPA 2AQ1B 2R93G 1AW7A 3PIP3 4A3FG 1Y1WB 4LUZA 3SR1A 4TVAB 2E2DC 1JR0D 3MAQA 3E9HA 2CKZB 3J81c 2YU9H 3VA7A 5HY6A 4ODGA 4DXFA 1NR4A 1MJEA 1HNZL 3T51B 4DV7Q 2EY5A 3KDFA 2RCNA 4HCSA 4ZAIA 1NBWA 1KLGD 4BBSB 2RQXA 4DV2L 3JAML 3W5OA 3PUWA 3TS0A 4JI0Q 2Z9HA 5EPJA 3TP8A 1PDQA 1CSPA 1RL2A 2KCCA 2EYPA 5C4XH 4JI6L 4NXMQ 2CW0D 2CW0C 5I4DA 1CA6A 2MHVA 1I50B 3CCSA 1Q8IA 3I4MH 2UXBL 3NELA 3LX0A 1K9MC 2F0VA 5EJWA 2B2VA 3ONAB 1JORA 1XPRA 4IUNA 5EAYA 5I9OA 3EA6A 1L1OA 1H9RA 5A2QE 3S1MH 1SBBB 1DOLA 2AKWB 2LS01 2OF1A 4QIWE 4DV1Q 1LT6D 4Y52H 1UUPA 1EZ6A 1PYSB 3T1YQ 1VF5C 5EPKA 1MKHA 2XVSA 2E2JH 1KXLA 1A3UA 1IL8A 2SDFA 1VQCA 4DAPA 2Z6BA 1MBYA 3CCMA 4B3RL 3BVMA 2VB3X 5T1IA 1ILQA 3LNNA 2LXKA 3X3MA 3VR4A 3U50C 2Z0SA 1PYBA 3CCRA 3TDQA 1K8MA 3K57A 3SDZA 3OTOQ 5AJ3Q 1M8AA 1NUCA 4A3IH 3DWAA 5IIFA 3KFUA 1QOHA 1K28A 4RGMA 4HIDA 2EJFC 4GN4B 5D3IB 3TSSA 2F0WA 2RVLA 1DXMA 5M3MB 1ET9A 4IUQA 3RUZA 3R2TA 4X66L 3G6EA 2QDLA 5J3BA 3J7YW 3S1MB 2R92B 3S16H 1STNA 1R4PB 1HNZQ 1B9MA 1GUWA 3FVQA 3DMUA 5EQ0A 1B3QA 1I4XA 3SXHA 1GUOA 1GXDC 1STHA 1EY9A 2BA1A 4Z9CB 3GTMH 2E5LL 3HOUG 2NUCA 2VZAA 2VW9A 2QA4A 2NN6G 2UUAL 1OXVA 4JV5Q 2Q2HA 3FPPA 5IOCA 5C0XH 4QQBX 1DJRD 1YNNC 2R7ZH 5IGDA 2NVTH 4XYOA 1VQ5A 1D5ZC 4DV3L 5IY0A 1Q81C 2UUAQ 4X3KA 1PZID 2JK8A 4GNXA 1WVLA 4OO1H 3C1FA 3W1BA 2R92G 4IURA 1HA6A 2V1CC 2CH4W 2MQHA 5EBDA 1I4GA 4KN7C 5ELCA 3KK7A 5FLMG 2XRQD 3NK9A 3PMFA 4RFBA 3U9SA 2E2IB 1SN8A 4G57A 1LM0A 2CQAA 4PZ7A 3VYRA 1SYDA 3BZKA 4IUVA 1IW7D 3UDFA 2QILA 1JE4A 4LFAQ 1J5EQ 2F3IA 1MSHA 3G71A 4XQNA 3T13A 2XGTA 1PRTB 3BZCA 4LFBL 4WJWA 2F0OA 2WAQG 3A56A 3S14B 5HGTA 4F87A 3OMCA 4F8MA 2UXDL 3QJYA 1ENFA 5AFWA 4XQJA 3GTMB 4IOCA 4LF4Q 3A8IE 4G7OC 3JAMi 5C44G 1N32L 3S1QH 2PPBC 4XT3B 4UP7A 3M4OH 3RN5A 4R4CA 1PXUA 1SYFA 2EJGC 1EFWA 2JJQA 1L1OC 4DR4Q 2ALYB 2WACA 4X62L 1IBKL 5IT9c 3J7AV 3CCVA 3Q23A 4MIUA 3HOWG 4CGYB 4FXDA 4JPBW 4XYQA 1J8IA 2CFMA 4ILWA 4NPSA 2NN6I 1TS4A 2O4XA 1Q1BA 4I7ZC 4QIWB 5IGEA 2RDFA 1I4HA 5C0XG 1MIUA 2PNHA 4YWMA 1WTOA 3RLOA 1YIJA 4K5WA 4KHVA 5FLXE 1Z9FA 1HR0W 1CT1D 2MP1A 3S14H 1E1OA 3GTGB 1VQAA 2JA9A 2Y0SG 3K58A 1SJED 4BBSG 1E7ZA 1WTRA 5I6WA 2VUMB 1X6OA 5C5LA 2I07B 2L0CA 1SLJA 5FJ8G 1WTVA 4DR6Q 2HDMA 4CDFC 1GM5A 1Q90A 5D65A 1D8LA 3NTIA 2OEOA 1NY4A 3MXNA 1N8RC 1EQRA 1EWCA 1FNWA 5I2XA 4M1UB 1EIGA 5D3DA 2UUBL 2HQLA 3JAME 1B9NA 1AZPA 5M5XB 4PQXA 1IBLQ 4X65Q 1EWHA 5I9PA 2VUMG 4IPCA 3GTPH 2B2UA 1SYGA 2EYLA 4R4OA 4KHZA 1BBUA 4A3BH 3GQBA 4WRDA 1CI3M 2GN5A 1A2UA 2ZJPA 5IWAQ 4H7BA 3D31A 2EJMA 2F0GA 1N33L 4A3LG 3IL8A 2J4XA 4CDDC 4XT1B 3PUXA 1WD0A 3HZXA 3GTJB 1X65A 1VDZA 3CC7A 1DYQA 1TWHB 3HOWH 1N33Q 2F0EA 2K6AA 1K0SA 3QIAA 4CKCA 1V43A 3TZDA 4LF9Q 1NE3A 3NBHA 4K2LA 2A1AA 3NSWA 4GKKQ 2L12A 1A3TA 3N52A 3DXJC 4J15A 4LUOA 3NQTA 4GKJL 3SE0A 3SVMA 5ELFA 2OTJA 3TRZA 1HRJA 4A3IG 3CXCA 5M5YB 5LMUL 4MN3A 4ME3A 4OO1I 4DR5L 4OGQC 3ND8A 3GTPB 1YNXA 1JCKB 3ZYYX 3OIPA 2Z4HA 2OQ0A 1CKNA 2XWJB 1FR3A 1AP0A 3FEWX 3U9OA 4JI6Q 5JJKA 2KHJA 4DV2Q 1RHPA 1S5DD 2HUGA 3QOJA 4JC0A 5JEAH 2KHIA 2ID0A 4X3UA 5ELEA 3S1RH 1EZ8A 3CKIB 4JYAL 4GLXA 3MHBA 4JBMA 2DUDA 2NN6H 1VQ9A 2HIXA 1HA5A 2B29A 2JEBI 4HIKA 4ULLA 2NTSA 1T5EA 2DGYA 1D7QA 4B3SL 4OIJA 5C0XJ 1CM9A 3FPUB 4JI3Q 1QVFA 3VYSA 2H4OA 3TEHB 4OHJA 1JMCA 1LUZA 2HDLA 1M1KC 3D8GA 1J6QA 1V8QA 2KCTA 1T5XD 2E2HB 4A3EG 1TR5A 2ZTCA 2V4DA 4MTKA 5KEEA 4A93B 4IUPA 1E2VA 5E7NA 1PZKD 2K5DA 1X32A 4NP5A 3M4YA 1FNUA 3AMUA 1SE4A 5HGQA 3VA5A 5A35A 1UNSA 1Z7TA 2B3GA 3BG3A 4U673 4A3KB 1Y8PB 4EQOA 3PQIA 5I2YA 3ER0A 1GUSA 1JOOA 5DAUA 4OL7A 2RSOA 5ELNA 3KF6A 5C3WA 4HSVA 4A3FH 3T16A 2L1BA 3PGZA 2ASBA 1F2LA 2J7ZA 2D62A 2NZHA 2A8VA 3BYYB 1RODA 4N8X1 2KBNA 3STBC 4POGA 4LF5L 3R3OA 1TXYA 1GKHA 5JVH3 2FMMA 3HOVH 5CV8A 2Z1CA 1X3GA 3CHBD 4R4TA 2CCZA 1UEBA 5FLMH 4WORA 3F2BA 2XN9C 2KEDA 1PH1A 3EROA 3FKIB 2B2UC 2E2HH 2ICEC 4DR6L 1EEID 4ZYSA 4Y7NB 4B3ML 2KUMA 3D4RA 3MXPA 5C3EH 3HOXG 2R61A 1HXYD 1YNND 2NTTA 3J81L 3A5UA 4QUCA 1HQMC 3OPOA 5CMDA 1BDOA 4H44C 4KTAA 4BBRH 2LKVA 3S15H 3CPWA 1XMOQ 3LWEA 2YTXA 1QNKA 3DWQA 1X3FA 4BBSH 3ERQA 2D9UA 4E6IA 3S1NB 2UXCL 5EPLA 2NVQB 4QMGA 1BBXC 1XX8A 3KF8B 1SNDA 1VQ6A 5IGGA 3QG1A 2K5QA 2A19A 2HIVA 2CWAA 1FJGQ 2HCCA 1LACA 1SEBD 2ZXOA 5IGBA 3HOVB 2XIWA 2RCFA 4R8NA 3GV3A 1EIHA 1E2WA 3NBIA 5IP7H 4KKUA 5IT9L 3I4NH 3S17H 1Z47A 2CH4A 1N34L 2I0QA 2UXDQ 5EKIA 5CBEE 2EE1A 2VNUD 1KIXA 4LFBQ 1JWSD 1XPOA 1LTAD 4A3BG 5GQOA 3T4AC 5KGUA 4H02A 4KK7A 4BXXG 4BWGB 1B4OA 3S15B 2E76C 3C1EA 2B2YA 1JJ2A 1KDAA 2JA6G 1LTTD 3UE1A 1JE5A 2KJXA 1PTOB 3I7FA 1LLRD 3BYTB 3NQIA 1X3QA 1U9RA 1SNQA 1GHJA 2FHTA 3A7AB 1B3AA 1QVCA 4AIMA 3GTOH 2D0OA 3DLLA 2B8FA 3ICEA 3V2TA 1B70B 2PW7A 4FF1A 4IFDH 2A6HD 2A6HC 2I5HA 2MGSA 1MGSA 1NNXA 4CJ2C 1WOCA 4JI3L 2F1MA 4AH6A 1XTDA 1VMCA 1QG7A 4J1MA 4L6TB 1LTID 4A3DH 2A68C 4J6HA 3W2DA 3CCUA 1WCMG 1SDFA 4GLAC 1Y1WH 1SE8A 1ZEQX 4WJ3M 5C4XG 1GD7A 4HR7B 2R92H 3S16B 1PH2A 4KKTA 1EQTA 4DR1Q 4DAMA 2JA5H 2O2LD 4CHTB 4A3MB 1CTMA 5IE8A 1XNQQ 3HOZH 3RD4A 4UY8C 2MUYA 3I4NG 1NMFA 1N36Q 2Z6KC 4CJ0B 3MC0B 4DXGA 2WAQE 3CRKC 3PO3H 4IFDJ 2OTLA 1U5KA 2F0LA 2Q8TA 1T9HA 4GN5A 4IPHA 4M8AA 4X3SA 1B8AA 4F88A 1KAWA 3GV6A 4K5XA 2HQEA 1WCMB 5C4XB 4RH6A 4L5RC 1HUMA 1ASYA 4DR3L 3IKJA 3PV0A 3TBIB 2FINB 4IZ8A 3RZOH 1X56A 5ELDA 2Q8IB 1CZGA 3EVQA 4MZ9A 1PH5A 1SYEA 3VYUA 4HIMA 5JPMC 2A73B 3H09A 2P5ZX 2SEBD 1XMOL 2ZJRA 5EBCA 2EQSA 3Q8DA 4A3KG 2QDBA 1LT5D 2K32A 4B3SQ 4GS3A 2JA5B 1AN8A 4BY7G 5IYDH 3AFQA 4DV3Q 4DUZL 3HOZB 3T1HL 2NZOA 2L9HA 5I6YA 2NYZD 4F7XA 2EY1A 2PMZE 3PSIA 1TWFH 4UDUC 4P74A 5FLXc 1SMXA 4B3MQ 4NXML 2EZVA 4DUYQ 2RDHA 1HQRD 4NW2A 4N9PA 5ISRA 2EXDA 3MEHA 4A76A 3OOCA 4JI2L 4N8FA 2EYMA 4O2DA 1G2TA 2MFIA 1EYAA 2DY7A 3SEBA 1FVIA 5M3MH 1QZHA 3OSOA 4CKBA 1YI2A 1VQNA 2ATWA 3KLSA 3ZJYC 2VQEL 3I70A 3BVZA 3JC66 3SGIA 3SK8A 1NJIC 1OXSC 1U4RA 2QKIC 4BBRG 2JA8B 5TSSA 2F03A 1WI5A 4IUUA 5A2QL 4CDEC 1FL0A 1HNXL 2KVMA 4CDCC 1PRTD 2L15A 4L8JA 4TRDA 1RDPD 3MXUA 1DD2A 4MHEA 3CW2C 1YHBA 2IX1A 1HZCA 2NVTB 2NVXH 1M4VA 3OYYA 4LF5Q 1S5CD 3D6WA 4YWKA 5KRUA 1BCPF 1WTQA 3G4SA 1TWCB 3CCJA 1W3SA 4C56C 5C0XI 2EY6A 4DPGA 4POFA 2K01A 1LTSD 2XTIA 3UI2A 3H15A 3C46A 2OQKA 4OWXB 4PMWA 1K73C 1VQHA 3C2PA 1L0WA 3HKZB 2WV6D 4DV6Q 2EYFA 1G2SA 2K75A 4YCVA 1OXTA 3GTLB 4BXXH 4HN7A 2KQ3A 3RLFA 1F9PA 3QR8A 3J7AF 1TWHH 4WFN3 2ICIA 3H0GB 4LW1A 2BH8A 1TQOA 2IX0A 3H94A 4HEDA 4YCUA 2BE5C 1A62A 3CP0A 1Y8OB 3P20A 2F4IA 3S2DB 2B39A 1CKOA 1CKMA 1BCPC 3UDIA 5FO8B 2UXCQ 1LV9A 4ID6A 4DR2Q 2UUCQ 1STBA 2IHEA 5K5PA 1TS3A 1JOQA 3HRZC 3KBXA 4P71A 3QWNA 1F9RA 3NUCA 4O42A 4DR2L 4RGTA 4CBVA 1YJNA 4R4IA 3GDEA 3H0GG 3ULLA 4DAYB 3AEVA 1DCZA 1RF2D 1VQ7A 3NTKA 4K5VA 2MNAA 1EUJA 3M4QA 2A6ED 3T56B 4FF3A 4HMIA 2MO1A 4JI1Q 3NBHB 3HKZE 4A3MG 5CC4A 1H9SB 3E9IA 4LUVA 2K05A 5IYCH 4HJ7A 5FO9B 5IWAL 4AQYL 2VUMH 3F2CA 3J80c 4HJ5A 4LF4L 1VQ8A 2C9OA 2F0NA 2ZXPA 4KD4A 3SHLA 4IOAA 3DWPA 5C5MA 2D5DA 4U68A 3VR6A 3C3LA 3E3XA 2CHBD 1JWUD 1HH2P 2AQ3B 3HS0C 3LGJA 1SMYC 1L0XB 4NXNQ 5M5XH 1PV4A 5JJZA 3K5LA 5COYA 2DJGC 4K14A 3GTKH 3OWEB 4A3CG 5DEHA 4BY1G 1J9OA 1U4LA 1OXUA 4BY7B 2X6GA 4BS9A 4A3KH 3T53B 1JQYD 1P8LA 4GOPC 1E2ZA 3H3VI 2F0TA 3HOYB 1FNVA 3GTJH 5BN4A 3CU7A 2B8GA 3PF4A 4IN3A 1K8AC 5C3EG 2TMPA 3MA2B 3EFXD 5FK9C 5CBAE 1A6XA 1H9KA 3OW7A 3GP7A 3F2UA 3GTQH 2BDNA 1A63A 4R9WA 1UE5A 5EKLA 2NVYH 1IL2A 1EQVA 1KTKA 4LF8Q 5E3FA 1RIPA 3VR2A 1H95A 3K5NA 1KHIA 5M5YH 3HGBA 2ZM6L
chains in the Genus database with same CATH topology
2FXQA 2IT1A 3A74A 4YCWA 3M9BA 4GNXB 4UP8A 4KI0A 2YYZA 5E7NA 4A3DG 1VCIA 4JI1L 3RZDH 1HNWL 1Q86C 1E22A 1PH6A 5GADC 2UU9Q 4LF7L 3CMAA 1C9OA 3U4ZA 3OTOL 4LF6Q 2PQAB 4EX5A 1PVOA 1YITA 4AYBG 2B63G 1K3RA 5HGQA 1K83H 4YHHQ 3HKSA 1OTCA 2B3GA 3STBD 3KJOA 1YJWA 2JA5G 1QUQA 1TWGH 1SRUA 4DV6L 3ER0A 4A3GH 3HOYH 3W1GA 3TQYA 3CCQA 5ELNA 3PUZA 4KLKA 3KF6A 4JI0L 3T1YL 4DUZQ 4A3FH 2ASBA 3PGZA 1HJPA 5M5WH 2NVQH 4DR4L 2D62A 2NZHA 4OXPA 5IYBH 4ALPA 3PIPA 2A8VA 3PO3G 1P16A 2YTVA 4JI8L 4GOPA 1WJJA 1E1TA 3MEFA 4GN3B 2KBNA 3HOXH 3STBC 4AYBE 2D0PA 1G291 1EYGA 4POGA 1VQIA 1AH9A 4LF5L 1KRSA 4A4IA 3DM3A 1HZBA 1TXYA 1GKHA 4LFCL 3HOVH 4LF9L 3OW2A 1X3GA 5GAHC 4R4QA 2UXBQ 4R4TA 2CCZA 3MXNB 1UEBA 1VQGA 3ULJA 5FLMH 3F2BA 1UE7A 3J81i 2KENA 1PH1A 2WP8J 3EN2A 3HFZB 1QZGA 4OWTB 2E2HH 1LYLA 3CPFA 4DR6L 1N32Q 4DR3Q 3U58A 4B3ML 1KQSA 2LSSA 4P75A 1VQLA 2JE6I 4FDBA 5C3EH 3HOXG 4A93H 1S3OA 3FP9A 3EIVA 3CCEA 4DK3C 1W2BA 3A5UA 2VL6A 1JJCB 1C7YA 3I4OA 4MTNA 1PHJA 2YTYA 4IFDG 4JCVE 4BBRH 4YY3L 1X9NA 3S15H 4X64L 1IBMQ 2GVAA 3CPWA 4OONA 4EQ5A 3NENA 2CWPA 2F52A 1XMOQ 4X62Q 1A0IA 1XNRL 2HT1A 2JA8G 2YTXA 3M3YH 3F1ZA 1HZ9A 2Z6KA 2RHSB 1YHAA 4L5QA 1X3FA 1K0RA 2K5HA 3CF5A 3AQQA 4BBSH 4B3TL 2UXCL 4X64Q 2PI2E 1Y1WG 2K5VA 2VS1A 1SROA 4X65L 2R93H 1CUKA 4IJLA 1N34Q 2JA7G 5ELOA 3KF8B 1KD1C 1L1OB 4IJHA 4HJ8A 1S40A 1VQ6A 2A19A 1B7YB 2HIVA 2CWAA 1FJGQ 2R7ZG 2KCMA 4C3JH 1XJVA 1EIYB 1I50H 1G6PA 4C3IH 1I5FA 3M7NA 3TREA 5BR8Q 2R7FA 5IP7H 4AQYQ 2B63H 3I4NH 4B3RQ 4KHPQ 1BVSA 3CCLA 4R1JA 3S17H 4OWWB 5M3FG 2R6GA 1Z47A 2I0QA 1N34L 2UXDQ 3EBEA 3FKIH 1QVGA 4DR7L 2Y0SE 4Y7NH 2R93G 4IPGA 2VNUD 1VQDA 1KIXA 4LFBQ 4A3FG 4LUZA 1XPOA 4TVAB 4A3BG 5GQOA 1Q8KA 3E9HA 2CKZB 3J81c 2YU9H 4H02A 2IHFA 5HY6A 1IXRA 3UDXA 4BA2I 3L0OA 4BXXG 4A3MH 1KC8C 5IP7G 3L7ZC 2ES2A 4QY7A 1MJEA 2ZTDA 1HNZL 4X66Q 1S72A 1JJ2A 2JA6G 4DV7Q 1IBKQ 1IBLL 3KDFA 3UE1A 3I4MG 1UWVA 2RCNA 1PH4A 1NBWA 1JE5A 4YY3Q 3I7FA 4DV2L 1I6HH 1HZAA 3ULPA 4A3JH 3S1NH 3TS0A 3W5OA 2H5XA 3PUWA 3J7ZC 4JI0Q 3K0XA 5C44H 1EIFA 1BBWA 1WCMH 1CSPA 3RN2A 1QVCA 1RL2A 4JV5L 4AIMA 3GTOH 5C4XH 4JI6L 2IY5B 4NXMQ 2D0OA 2E5LQ 3DLLA 1Q46A 4IFDI 2RF4A 2AHOB 1OXXK 2VY3A 3CCSA 3KYHC 4HJAA 3ICEA 1YZ6A 1B70B 4PG3A 2Q2TA 4QL5A 3I4MH 2I5HA 2UXBL 3NELA 1HR0L 4LFAL 1WOCA 4JI3L 4AH6A 1XTDA 5IP9H 1K9MC 2GVBA 3UE0A 4A3DH 4X6AH 2ZJQA 1XPRA 5EAYA 3CCUA 1WCMG 4GLAC 1Y1WH 4BY1H 4JOIC 3JAMc 1PH3A 1SE8A 3AFPA 1L1OA 4WJ3M 3BU2A 3S1MH 1GD7A 5C4XG 2R92H 1PH2A 2AKWB 1K8GA 2PQAA 4DR1Q 4QIWE 2UUBQ 4DAMA 2JA5H 4C3HH 4DV1Q 4Y52H 3PIOA 5IE8A 1XNQQ 1PYSB 3HOZH 3T1YQ 4UY8C 3I4NG 1MKHA 1NMFA 1EOVA 2E2JH 1KXLA 5M3MG 1N36Q 2Z6KC 4DR7Q 4GLVB 1Q7YC 3NEMA 2WAQE 2R7DA 2K50A 1VQCA 4PZ6A 5LMNL 1U5KA 1JB7A 2OTLA 4IFDJ 1T9HA 2EIFA 4GN5A 4IPHA 4DV5Q 1B8AA 1KAWA 3CCMA 1GVPA 5FJ8H 1V9PA 4B3RL 1U0LA 1L2FA 2LXKA 1PH8A 1VQKA 2WFWA 3U50C 4LF8L 2Z0SA 1PYBA 2ZM6Q 3CCRA 2I5LX 3RR5A 4L5RC 1R9TH 4HIOA 3OTOQ 4LF6L 1V1QA 5AJ3Q 3HOZG 3PO3H 1IZ6A 1ASYA 4DR3L 4A3IH 4TQUS 3PV0A 3KFUA 4KHPL 1X55A 4HIDA 4XIGS 4DV5L 2E2IH 1X56A 4GN4B 3RZOH 3HOUH 5H1SE 4MZ9A 2AWOA 4A3JG 1PH5A 4DV4L 4X66L 3G6EA 4HIMA 5J3BA 1QUQB 1KRTA 1VQBA 3S16H 1XMOL 2ZJRA 1HNZQ 2EQSA 3Q8DA 4A3KG 2E8GA 1Y14B 4B3SQ 4GKKL 4OO1G 4GS3A 2N3SA 4BY7G 5IYDH 3AFQA 4DK6C 4DV3Q 4A3LH 4DUZL 3T1HL 2NZOA 3KJPA 2Q2UA 4JI4L 3GTMH 2BA1A 4JI7L 2E5LL 3HOUG 2VZAA 2VW9A 1XPUA 3K7UC 2PMZE 3I2ZA 1TWFH 3PSIA 1YEZA 2NN6G 1X3EA 1OXVA 2OCEA 1A8VA 2Q2HA 4P74A 2QA4A 2UUAL 5FLXc 1SMXA 4JV5Q 4B3MQ 4QQBX 1FJGL 4A93G 1JJGA 1PH7A 4NXML 2R7ZH 2PI2A 3K7AH 4DUYQ 3J7A5 2NVTH 3WWVA 1VQ5A 4DV3L 5IY0A 1Q81C 4QJFA 4GNXA 4DKAC 2JK8A 1PH9A 2UUAQ 3W1BA 2EXDA 2K5NA 4A76A 2R92G 4JI2L 2V1CC 4O2DA 2MQHA 5LMNW 3H3VH 4JI5Q 2MFIA 5FLMG 4GKJQ 4JI4Q 1XNRQ 2CQOA 5K36G 4JBWA 3PF5A 1SN8A 1AE2A 1LM0A 4PZ7A 1FVIA 3BZKA 5M3MH 1QZHA 4OX9Q 4JYAQ 4JI5L 3UDFA 4DR1L 4LFAQ 3KDFB 2F3IA 2N78A 3AYHB 1YI2A 1J5EQ 1VQNA 4RMFA 2ATWA 3ERSX 3ZJYC 3G71A 4JOIA 2VQEL 2XGTA 4DV0L 3JC66 3SGIA 1WFQA 3BZCA 3K80C 3GD7A 1NJIC 1OXSC 3S2HH 4LFBL 2WAQG 4K0KL 1VQEA 1M90C 2JA6H 1N9WA 4NB3A 1HNWQ 4BBRG 3GTGH 3VDYA 2UXDL 4XTCS 1WI5A 3K81C 1Q1EA 1YBYA 4IOCA 3RNUA 4LF4Q 2F4VQ 1FL0A 1HNXL 4A75A 3JAMi 5C44G 1N32L 1JT8A 3S1QH 5AJ3L 1FGUA 2L15A 2QEXA 4C2MH 5LMNQ 2N8NA 3HKZG 4UP7A 1X54A 3CW2C 1YHBA 3M4OH 3RN5A 1Q82C 4R4CA 2IX1A 1HZCA 4JI8Q 5IYCG 1EFWA 4L5TA 2JJQA 2NVXH 1L1OC 3OYYA 4DR4Q 2N49A 2ALYB 1E3PA 1VQPA 4LF5Q 4X62L 1IBKL 4YWKA 5IT9c 3CC4A 3CCVA 4DV4Q 3T1HQ 1IBML 3HOWG 3G4SA 3CCJA 1W3SA 1YHQA 5C0XI 4DPGA 2CFMA 4POFA 5GAEC 5M3FH 2XTIA 4NPSA 2NN6I 4JI2Q 3FKIG 3H15A 1IYJB 2OQKA 4OWXB 1VQFA 1Q1BA 3I56A 4PMWA 3A5ZB 1K73C 1I3QH 5GAGC 4DV7L 1VQHA 1MIUA 2PNHA 3B6YA 5C0XG 1L0WA 4YWMA 1I94L 1VQJA 3RLOA 4DV6Q 1YIJA 2AMCB 2JEAI 1AE3A 1TWAH 2K75A 4JG2A 1Z9FA 3PCOB 4YCVA 2VQFQ 2Q2IA 1OXTA 1HR0W 4LNQA 4BXXH 3S14H 1E1OA 4WJ4A 3KOJA 2JA8H 1XMQQ 1VQAA 2JA9A 1UE1A 1DGSA 2Y0SG 3RLFA 1I94Q 1CSQA 5BR8L 4BBSG 1E7ZA 3TS2A 1TWHH 4IPDA 1X6OA 4APVA 4LW1A 1ASZA 4K0KQ 4A3GG 3G48A 2BH8A 3GO5A 5LMUQ 2IX0A 4JI7Q 1SLJA 4MNOA 5FJ8G 4DR6Q 4YCUA 1A62A 3CP0A 3HOWH 1GM5A 4RG1A 5GROA 1D8LA 2BA0A 2VQEQ 1NY4A 1CKOA 1N8RC 1CKMA 1EQRA 3UDIA 4GOPB 2K14A 1LTLA 2WB1E 2UXCQ 4JBKA 4DR2Q 2UUCQ 4IO9A 4BA1I 4UP9A 2IHEA 3KF6B 2UUBL 2HQLA 2YV5A 3HOVG 3L2PA 1J5EL 4P71A 1TWCH 1XNQL 4OX9L 1IBLQ 4DR2L 4X65Q 1VQOA 5IP9G 1YJNA 2VUMG 4R4IA 3GDEA 3H0GG 4IPCA 3ULLA 4DAYB 3AEVA 3GTPH 1VQ7A 1PA6A 4R4OA 4KHZA 3CMEA 1BBUA 2MNAA 4A3BH 1EUJA 1Y1VG 2AWNA 2MO0A 3M4QA 4YWLA 5C4JH 2GN5A 2UU9L 5DLQE 2K4KA 2ZJPA 5IWAQ 2MO1A 4JI1Q 3NBHB 3HKZE 4A3MG 2WB1G 5IYDG 4BY7H 3D31A 3E9IA 4LUVA 2RHQB 1N33L 3CC2A 4A3LG 5IYCH 1YJ9A 3GTLH 3PUXA 4HJ7A 4GNXC 3A0JA 1N36L 1EWIA 4DV0Q 5IWAL 4AQYL 1X65A 3CC7A 1KL9A 3E0EA 2VQFL 3CQZH 2VUMH 3H0GH 1N33Q 3I55A 3U4VA 3J80c 3F2CA 4L5SA 4HJ5A 2C35B 4LF4L 2F4VL 1V43A 1VQ8A 4LF9Q 1NE3A 1SFOH 4A3CH 5JJLA 3S2DH 1MJCA 1NMGA 2A1AA 3UDGA 2JA7H 1YVCA 5JEAJ 4IOAA 4GKKQ 2K52A 3KLWA 4J15A 4LUOA 4GKJL 2I5MX 3F8TA 3CAMA 3HOYG 2HHHQ 1HH2P 2OTJA 3TRZA 3LGJA 4A3IG 4NXNQ 1WYDA 3CXCA 5M5XH 1PV4A 2LXJA 3PUYA 5JJIA 5LMUL 5IYBG 4ME3A 4JBJA 4HJ9A 4OO1I 4DR5L 4DNIA 1VQMA 4LF7Q 3GTKH 4A3CG 1YNXA 4BY1G 4DUYL 1Q12A 2OQ0A 1EQQA 1CKNA 3BJUA 1BKBA 1HR0Q 1UE6A 4DR5Q 1XMQL 1OXUA 1O7IA 3D0FA 3J81j 4JI6Q 3PO2H 4A3KH 2KHJA 5JJKA 2JQOA 4DV2Q 2HHHL 1HNXQ 1GO3E 1P8LA 4GOPC 4JC0A 3CD6A 3H3VI 1G51A 2KHIA 4NXNL 3GTJH 2BH2A 1E24A 2ID0A 3PF4A 3IRBA 3S1RH 4A3EH 5C3EG 1K8AC 4JYAL 2ZTEA 1SR3A 4LWCA 4LFCQ 4DV1L 4GLXA 4JBMA 2DUDA 1VQ9A 3K8AA 2HIXA 4B3TQ 4P73A 1PFSA 2B29A 2JEBI 4P72A 4HIKA 3GTQH 1NTGA 3M4PA 3PUVA 2DGYA 1Y1VH 4QGUA 1D7QA 4B3SL 3PO2G 1A63A 3J80i 5C0XJ 3FHWA 4UPAA 1UE5A 3S24A 4YHHL 4JI3Q 3TEHB 1QVFA 1JMCA 2NVYH 1LUZA 2QGQA 4PZ8A 1VQ4A 2UUCL 2OWOA 1M1KC 4LF8Q 1IL2A 5JEAG 1J6QA 1CKNB 4O0AA 3F2DA 1RIPA 1H95A 2KCTA 1C0AA 3RLNA 3M85A 1KHIA 4A3EG 1VS0A 5M5YH 2ZTCA 2ZM6L
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FXQ A;  2IT1 A;  3A74 A;  4YCW A;  3M9B A;  4GNX B;  4UP8 A;  4KI0 A;  2YYZ A;  5E7N A;  4A3D G;  1VCI A;  4JI1 L;  3RZD H;  1HNW L;  1Q86 C;  1E22 A;  1PH6 A;  5GAD C;  2UU9 Q;  4LF7 L;  3CMA A;  1C9O A;  3U4Z A;  3OTO L;  4LF6 Q;  2PQA B;  4EX5 A;  1PVO A;  1YIT A;  4AYB G;  2B63 G;  1K3R A;  5HGQ A;  1K83 H;  4YHH Q;  3HKS A;  1OTC A;  2B3G A;  3STB D;  3KJO A;  1YJW A;  2JA5 G;  1QUQ A;  1TWG H;  1SRU A;  4DV6 L;  3ER0 A;  4A3G H;  3HOY H;  3W1G A;  3TQY A;  3CCQ A;  5ELN A;  3PUZ A;  4KLK A;  3KF6 A;  4JI0 L;  3T1Y L;  4DUZ Q;  4A3F H;  2ASB A;  3PGZ A;  1HJP A;  5M5W H;  2NVQ H;  4DR4 L;  2D62 A;  2NZH A;  4OXP A;  5IYB H;  4ALP A;  3PIP A;  2A8V A;  3PO3 G;  1P16 A;  2YTV A;  4JI8 L;  4GOP A;  1WJJ A;  1E1T A;  3MEF A;  4GN3 B;  2KBN A;  3HOX H;  3STB C;  4AYB E;  2D0P A;  1G29 1;  1EYG A;  4POG A;  1VQI A;  1AH9 A;  4LF5 L;  1KRS A;  4A4I A;  3DM3 A;  1HZB A;  1TXY A;  1GKH A;  4LFC L;  3HOV H;  4LF9 L;  3OW2 A;  1X3G A;  5GAH C;  4R4Q A;  2UXB Q;  4R4T A;  2CCZ A;  3MXN B;  1UEB A;  1VQG A;  3ULJ A;  5FLM H;  3F2B A;  1UE7 A;  3J81 i;  2KEN A;  1PH1 A;  2WP8 J;  3EN2 A;  3HFZ B;  1QZG A;  4OWT B;  2E2H H;  1LYL A;  3CPF A;  4DR6 L;  1N32 Q;  4DR3 Q;  3U58 A;  4B3M L;  1KQS A;  2LSS A;  4P75 A;  1VQL A;  2JE6 I;  4FDB A;  5C3E H;  3HOX G;  4A93 H;  1S3O A;  3FP9 A;  3EIV A;  3CCE A;  4DK3 C;  1W2B A;  3A5U A;  2VL6 A;  1JJC B;  1C7Y A;  3I4O A;  4MTN A;  1PHJ A;  2YTY A;  4IFD G;  4JCV E;  4BBR H;  4YY3 L;  1X9N A;  3S15 H;  4X64 L;  1IBM Q;  2GVA A;  3CPW A;  4OON A;  4EQ5 A;  3NEN A;  2CWP A;  2F52 A;  1XMO Q;  4X62 Q;  1A0I A;  1XNR L;  2HT1 A;  2JA8 G;  2YTX A;  3M3Y H;  3F1Z A;  1HZ9 A;  2Z6K A;  2RHS B;  1YHA A;  4L5Q A;  1X3F A;  1K0R A;  2K5H A;  3CF5 A;  3AQQ A;  4BBS H;  4B3T L;  2UXC L;  4X64 Q;  2PI2 E;  1Y1W G;  2K5V A;  2VS1 A;  1SRO A;  4X65 L;  2R93 H;  1CUK A;  4IJL A;  1N34 Q;  2JA7 G;  5ELO A;  3KF8 B;  1KD1 C;  1L1O B;  4IJH A;  4HJ8 A;  1S40 A;  1VQ6 A;  2A19 A;  1B7Y B;  2HIV A;  2CWA A;  1FJG Q;  2R7Z G;  2KCM A;  4C3J H;  1XJV A;  1EIY B;  1I50 H;  1G6P A;  4C3I H;  1I5F A;  3M7N A;  3TRE A;  5BR8 Q;  2R7F A;  5IP7 H;  4AQY Q;  2B63 H;  3I4N H;  4B3R Q;  4KHP Q;  1BVS A;  3CCL A;  4R1J A;  3S17 H;  4OWW B;  5M3F G;  2R6G A;  1Z47 A;  2I0Q A;  1N34 L;  2UXD Q;  3EBE A;  3FKI H;  1QVG A;  4DR7 L;  2Y0S E;  4Y7N H;  2R93 G;  4IPG A;  2VNU D;  1VQD A;  1KIX A;  4LFB Q;  4A3F G;  4LUZ A;  1XPO A;  4TVA B;  4A3B G;  5GQO A;  1Q8K A;  3E9H A;  2CKZ B;  3J81 c;  2YU9 H;  4H02 A;  2IHF A;  5HY6 A;  1IXR A;  3UDX A;  4BA2 I;  3L0O A;  4BXX G;  4A3M H;  1KC8 C;  5IP7 G;  3L7Z C;  2ES2 A;  4QY7 A;  1MJE A;  2ZTD A;  1HNZ L;  4X66 Q;  1S72 A;  1JJ2 A;  2JA6 G;  4DV7 Q;  1IBK Q;  1IBL L;  3KDF A;  3UE1 A;  3I4M G;  1UWV A;  2RCN A;  1PH4 A;  1NBW A;  1JE5 A;  4YY3 Q;  3I7F A;  4DV2 L;  1I6H H;  1HZA A;  3ULP A;  4A3J H;  3S1N H;  3TS0 A;  3W5O A;  2H5X A;  3PUW A;  3J7Z C;  4JI0 Q;  3K0X A;  5C44 H;  1EIF A;  1BBW A;  1WCM H;  1CSP A;  3RN2 A;  1QVC A;  1RL2 A;  4JV5 L;  4AIM A;  3GTO H;  5C4X H;  4JI6 L;  2IY5 B;  4NXM Q;  2D0O A;  2E5L Q;  3DLL A;  1Q46 A;  4IFD I;  2RF4 A;  2AHO B;  1OXX K;  2VY3 A;  3CCS A;  3KYH C;  4HJA A;  3ICE A;  1YZ6 A;  1B70 B;  4PG3 A;  2Q2T A;  4QL5 A;  3I4M H;  2I5H A;  2UXB L;  3NEL A;  1HR0 L;  4LFA L;  1WOC A;  4JI3 L;  4AH6 A;  1XTD A;  5IP9 H;  1K9M C;  2GVB A;  3UE0 A;  4A3D H;  4X6A H;  2ZJQ A;  1XPR A;  5EAY A;  3CCU A;  1WCM G;  4GLA C;  1Y1W H;  4BY1 H;  4JOI C;  3JAM c;  1PH3 A;  1SE8 A;  3AFP A;  1L1O A;  4WJ3 M;  3BU2 A;  3S1M H;  1GD7 A;  5C4X G;  2R92 H;  1PH2 A;  2AKW B;  1K8G A;  2PQA A;  4DR1 Q;  4QIW E;  2UUB Q;  4DAM A;  2JA5 H;  4C3H H;  4DV1 Q;  4Y52 H;  3PIO A;  5IE8 A;  1XNQ Q;  1PYS B;  3HOZ H;  3T1Y Q;  4UY8 C;  3I4N G;  1MKH A;  1NMF A;  1EOV A;  2E2J H;  1KXL A;  5M3M G;  1N36 Q;  2Z6K C;  4DR7 Q;  4GLV B;  1Q7Y C;  3NEM A;  2WAQ E;  2R7D A;  2K50 A;  1VQC A;  4PZ6 A;  5LMN L;  1U5K A;  1JB7 A;  2OTL A;  4IFD J;  1T9H A;  2EIF A;  4GN5 A;  4IPH A;  4DV5 Q;  1B8A A;  1KAW A;  3CCM A;  1GVP A;  5FJ8 H;  1V9P A;  4B3R L;  1U0L A;  1L2F A;  2LXK A;  1PH8 A;  1VQK A;  2WFW A;  3U50 C;  4LF8 L;  2Z0S A;  1PYB A;  2ZM6 Q;  3CCR A;  2I5L X;  3RR5 A;  4L5R C;  1R9T H;  4HIO A;  3OTO Q;  4LF6 L;  1V1Q A;  5AJ3 Q;  3HOZ G;  3PO3 H;  1IZ6 A;  1ASY A;  4DR3 L;  4A3I H;  4TQU S;  3PV0 A;  3KFU A;  4KHP L;  1X55 A;  4HID A;  4XIG S;  4DV5 L;  2E2I H;  1X56 A;  4GN4 B;  3RZO H;  3HOU H;  5H1S E;  4MZ9 A;  2AWO A;  4A3J G;  1PH5 A;  4DV4 L;  4X66 L;  3G6E A;  4HIM A;  5J3B A;  1QUQ B;  1KRT A;  1VQB A;  3S16 H;  1XMO L;  2ZJR A;  1HNZ Q;  2EQS A;  3Q8D A;  4A3K G;  2E8G A;  1Y14 B;  4B3S Q;  4GKK L;  4OO1 G;  4GS3 A;  2N3S A;  4BY7 G;  5IYD H;  3AFQ A;  4DK6 C;  4DV3 Q;  4A3L H;  4DUZ L;  3T1H L;  2NZO A;  3KJP A;  2Q2U A;  4JI4 L;  3GTM H;  2BA1 A;  4JI7 L;  2E5L L;  3HOU G;  2VZA A;  2VW9 A;  1XPU A;  3K7U C;  2PMZ E;  3I2Z A;  1TWF H;  3PSI A;  1YEZ A;  2NN6 G;  1X3E A;  1OXV A;  2OCE A;  1A8V A;  2Q2H A;  4P74 A;  2QA4 A;  2UUA L;  5FLX c;  1SMX A;  4JV5 Q;  4B3M Q;  4QQB X;  1FJG L;  4A93 G;  1JJG A;  1PH7 A;  4NXM L;  2R7Z H;  2PI2 A;  3K7A H;  4DUY Q;  3J7A 5;  2NVT H;  3WWV A;  1VQ5 A;  4DV3 L;  5IY0 A;  1Q81 C;  4QJF A;  4GNX A;  4DKA C;  2JK8 A;  1PH9 A;  2UUA Q;  3W1B A;  2EXD A;  2K5N A;  4A76 A;  2R92 G;  4JI2 L;  2V1C C;  4O2D A;  2MQH A;  5LMN W;  3H3V H;  4JI5 Q;  2MFI A;  5FLM G;  4GKJ Q;  4JI4 Q;  1XNR Q;  2CQO A;  5K36 G;  4JBW A;  3PF5 A;  1SN8 A;  1AE2 A;  1LM0 A;  4PZ7 A;  1FVI A;  3BZK A;  5M3M H;  1QZH A;  4OX9 Q;  4JYA Q;  4JI5 L;  3UDF A;  4DR1 L;  4LFA Q;  3KDF B;  2F3I A;  2N78 A;  3AYH B;  1YI2 A;  1J5E Q;  1VQN A;  4RMF A;  2ATW A;  3ERS X;  3ZJY C;  3G71 A;  4JOI A;  2VQE L;  2XGT A;  4DV0 L;  3JC6 6;  3SGI A;  1WFQ A;  3BZC A;  3K80 C;  3GD7 A;  1NJI C;  1OXS C;  3S2H H;  4LFB L;  2WAQ G;  4K0K L;  1VQE A;  1M90 C;  2JA6 H;  1N9W A;  4NB3 A;  1HNW Q;  4BBR G;  3GTG H;  3VDY A;  2UXD L;  4XTC S;  1WI5 A;  3K81 C;  1Q1E A;  1YBY A;  4IOC A;  3RNU A;  4LF4 Q;  2F4V Q;  1FL0 A;  1HNX L;  4A75 A;  3JAM i;  5C44 G;  1N32 L;  1JT8 A;  3S1Q H;  5AJ3 L;  1FGU A;  2L15 A;  2QEX A;  4C2M H;  5LMN Q;  2N8N A;  3HKZ G;  4UP7 A;  1X54 A;  3CW2 C;  1YHB A;  3M4O H;  3RN5 A;  1Q82 C;  4R4C A;  2IX1 A;  1HZC A;  4JI8 Q;  5IYC G;  1EFW A;  4L5T A;  2JJQ A;  2NVX H;  1L1O C;  3OYY A;  4DR4 Q;  2N49 A;  2ALY B;  1E3P A;  1VQP A;  4LF5 Q;  4X62 L;  1IBK L;  4YWK A;  5IT9 c;  3CC4 A;  3CCV A;  4DV4 Q;  3T1H Q;  1IBM L;  3HOW G;  3G4S A;  3CCJ A;  1W3S A;  1YHQ A;  5C0X I;  4DPG A;  2CFM A;  4POF A;  5GAE C;  5M3F H;  2XTI A;  4NPS A;  2NN6 I;  4JI2 Q;  3FKI G;  3H15 A;  1IYJ B;  2OQK A;  4OWX B;  1VQF A;  1Q1B A;  3I56 A;  4PMW A;  3A5Z B;  1K73 C;  1I3Q H;  5GAG C;  4DV7 L;  1VQH A;  1MIU A;  2PNH A;  3B6Y A;  5C0X G;  1L0W A;  4YWM A;  1I94 L;  1VQJ A;  3RLO A;  4DV6 Q;  1YIJ A;  2AMC B;  2JEA I;  1AE3 A;  1TWA H;  2K75 A;  4JG2 A;  1Z9F A;  3PCO B;  4YCV A;  2VQF Q;  2Q2I A;  1OXT A;  1HR0 W;  4LNQ A;  4BXX H;  3S14 H;  1E1O A;  4WJ4 A;  3KOJ A;  2JA8 H;  1XMQ Q;  1VQA A;  2JA9 A;  1UE1 A;  1DGS A;  2Y0S G;  3RLF A;  1I94 Q;  1CSQ A;  5BR8 L;  4BBS G;  1E7Z A;  3TS2 A;  1TWH H;  4IPD A;  1X6O A;  4APV A;  4LW1 A;  1ASZ A;  4K0K Q;  4A3G G;  3G48 A;  2BH8 A;  3GO5 A;  5LMU Q;  2IX0 A;  4JI7 Q;  1SLJ A;  4MNO A;  5FJ8 G;  4DR6 Q;  4YCU A;  1A62 A;  3CP0 A;  3HOW H;  1GM5 A;  4RG1 A;  5GRO A;  1D8L A;  2BA0 A;  2VQE Q;  1NY4 A;  1CKO A;  1N8R C;  1CKM A;  1EQR A;  3UDI A;  4GOP B;  2K14 A;  1LTL A;  2WB1 E;  2UXC Q;  4JBK A;  4DR2 Q;  2UUC Q;  4IO9 A;  4BA1 I;  4UP9 A;  2IHE A;  3KF6 B;  2UUB L;  2HQL A;  2YV5 A;  3HOV G;  3L2P A;  1J5E L;  4P71 A;  1TWC H;  1XNQ L;  4OX9 L;  1IBL Q;  4DR2 L;  4X65 Q;  1VQO A;  5IP9 G;  1YJN A;  2VUM G;  4R4I A;  3GDE A;  3H0G G;  4IPC A;  3ULL A;  4DAY B;  3AEV A;  3GTP H;  1VQ7 A;  1PA6 A;  4R4O A;  4KHZ A;  3CME A;  1BBU A;  2MNA A;  4A3B H;  1EUJ A;  1Y1V G;  2AWN A;  2MO0 A;  3M4Q A;  4YWL A;  5C4J H;  2GN5 A;  2UU9 L;  5DLQ E;  2K4K A;  2ZJP A;  5IWA Q;  2MO1 A;  4JI1 Q;  3NBH B;  3HKZ E;  4A3M G;  2WB1 G;  5IYD G;  4BY7 H;  3D31 A;  3E9I A;  4LUV A;  2RHQ B;  1N33 L;  3CC2 A;  4A3L G;  5IYC H;  1YJ9 A;  3GTL H;  3PUX A;  4HJ7 A;  4GNX C;  3A0J A;  1N36 L;  1EWI A;  4DV0 Q;  5IWA L;  4AQY L;  1X65 A;  3CC7 A;  1KL9 A;  3E0E A;  2VQF L;  3CQZ H;  2VUM H;  3H0G H;  1N33 Q;  3I55 A;  3U4V A;  3J80 c;  3F2C A;  4L5S A;  4HJ5 A;  2C35 B;  4LF4 L;  2F4V L;  1V43 A;  1VQ8 A;  4LF9 Q;  1NE3 A;  1SFO H;  4A3C H;  5JJL A;  3S2D H;  1MJC A;  1NMG A;  2A1A A;  3UDG A;  2JA7 H;  1YVC A;  5JEA J;  4IOA A;  4GKK Q;  2K52 A;  3KLW A;  4J15 A;  4LUO A;  4GKJ L;  2I5M X;  3F8T A;  3CAM A;  3HOY G;  2HHH Q;  1HH2 P;  2OTJ A;  3TRZ A;  3LGJ A;  4A3I G;  4NXN Q;  1WYD A;  3CXC A;  5M5X H;  1PV4 A;  2LXJ A;  3PUY A;  5JJI A;  5LMU L;  5IYB G;  4ME3 A;  4JBJ A;  4HJ9 A;  4OO1 I;  4DR5 L;  4DNI A;  1VQM A;  4LF7 Q;  3GTK H;  4A3C G;  1YNX A;  4BY1 G;  4DUY L;  1Q12 A;  2OQ0 A;  1EQQ A;  1CKN A;  3BJU A;  1BKB A;  1HR0 Q;  1UE6 A;  4DR5 Q;  1XMQ L;  1OXU A;  1O7I A;  3D0F A;  3J81 j;  4JI6 Q;  3PO2 H;  4A3K H;  2KHJ A;  5JJK A;  2JQO A;  4DV2 Q;  2HHH L;  1HNX Q;  1GO3 E;  1P8L A;  4GOP C;  4JC0 A;  3CD6 A;  3H3V I;  1G51 A;  2KHI A;  4NXN L;  3GTJ H;  2BH2 A;  1E24 A;  2ID0 A;  3PF4 A;  3IRB A;  3S1R H;  4A3E H;  5C3E G;  1K8A C;  4JYA L;  2ZTE A;  1SR3 A;  4LWC A;  4LFC Q;  4DV1 L;  4GLX A;  4JBM A;  2DUD A;  1VQ9 A;  3K8A A;  2HIX A;  4B3T Q;  4P73 A;  1PFS A;  2B29 A;  2JEB I;  4P72 A;  4HIK A;  3GTQ H;  1NTG A;  3M4P A;  3PUV A;  2DGY A;  1Y1V H;  4QGU A;  1D7Q A;  4B3S L;  3PO2 G;  1A63 A;  3J80 i;  5C0X J;  3FHW A;  4UPA A;  1UE5 A;  3S24 A;  4YHH L;  4JI3 Q;  3TEH B;  1QVF A;  1JMC A;  2NVY H;  1LUZ A;  2QGQ A;  4PZ8 A;  1VQ4 A;  2UUC L;  2OWO A;  1M1K C;  4LF8 Q;  1IL2 A;  5JEA G;  1J6Q A;  1CKN B;  4O0A A;  3F2D A;  1RIP A;  1H95 A;  2KCT A;  1C0A A;  3RLN A;  3M85 A;  1KHI A;  4A3E G;  1VS0 A;  5M5Y H;  2ZTC A;  2ZM6 L; 
#chains in the Genus database with same CATH topology
 2FXQ A;  1II3 A;  4GNX B;  5C3E B;  3GTK B;  4A3D G;  2B2V C;  1VCI A;  2FFK B;  3RZD H;  1HNW L;  1E22 A;  5GAD C;  3OTO L;  1G8Z D;  3TP6 A;  4BBR B;  4AYB G;  2M00 A;  1OTC A;  3PO2 B;  2B2Y C;  3KJO A;  1TWG H;  1SRU A;  4ZUI A;  4DA2 A;  2L5T A;  3TQY A;  2DNC A;  3CCQ A;  1GOZ A;  1O78 A;  3T1Y L;  3K59 A;  3S1R B;  4FF2 A;  3Q6S A;  1HJP A;  3FMC A;  3PIP A;  3PO3 G;  2YTV A;  1E1T A;  3A54 A;  3K6O A;  1WTX A;  1KRS A;  1HZB A;  1D2B A;  4LFC L;  4V19 0;  2DY8 A;  3ULJ A;  4HTH A;  3EN2 A;  3TME A;  1N32 Q;  4OWT B;  5LL6 S;  1S4Z A;  2XSC A;  3U58 A;  1KQS A;  2LSS A;  2E75 C;  4FDB A;  1B44 D;  4HMJ A;  3KLS X;  3CCE A;  2E74 C;  5HUR A;  1XYI A;  3W3A A;  3Q24 A;  2YTY A;  4OEL B;  4ZKB B;  4IFD G;  4YY3 L;  1X9N A;  1SYB A;  4ZKC B;  3BVG A;  3M3Y H;  2EDG A;  2Z6K A;  4A3G B;  1K0R A;  2K5H A;  3AQQ A;  3MZ5 A;  1AEX A;  2PI2 E;  4A3F B;  1Y1W G;  4LAA A;  2R93 H;  4IJL A;  2JA7 G;  1AFP A;  1KD1 C;  4IJH A;  4HJ8 A;  1I6V C;  5C4Z A;  1GUG A;  1VMP A;  5E1F A;  2R7Z G;  1NR2 A;  1C8C A;  1EIY B;  1WTP A;  3LWU A;  1MHW C;  3M7N A;  1BVS A;  4DF7 A;  5JPN C;  5KYI A;  2M9V A;  2IX3 A;  3EBE A;  1HFG A;  4DR7 L;  4Y7N H;  4IPG A;  1VQD A;  1FYC A;  4FP5 D;  4K6D A;  2I46 A;  2PZW A;  5M9O A;  3MVV A;  1PTO D;  5CR3 A;  1AZQ A;  1Q8K A;  4G7H C;  2QEJ C;  1MD2 D;  3UDX A;  4BA2 I;  4A3M H;  1KC8 C;  2ES2 A;  4R8I A;  4G4K A;  4X66 Q;  4G7Z C;  1WTW A;  1IBK Q;  1STY A;  2PW5 A;  1QE6 A;  1IBL L;  3I4M G;  2Y0S B;  1UWV A;  1PH4 A;  1A3V A;  5KND A;  3NTH A;  4YY3 Q;  3J81 E;  2F0F A;  2K7V A;  3NE5 B;  3NXW A;  1HZA A;  3ULP A;  4A3J H;  3J7Z C;  3K0X A;  1NCV A;  2R93 B;  1SNO A;  5C44 H;  1EIF A;  2A74 C;  1BXT A;  2JN4 A;  3DUZ A;  3TP7 A;  1D1K A;  1PTO F;  2IY5 B;  5IOD A;  1STE A;  2JSO A;  2B2T A;  5BN5 A;  2AHO B;  4RCN A;  1OXX K;  2VY3 A;  3KYH C;  4HJA A;  1YZ6 A;  5DM6 3;  4LFA L;  2NBF A;  3UE0 A;  4FNF A;  4X6A H;  2H1E A;  2ZJQ A;  1PZJ D;  2BOS A;  3A8J E;  3OMG A;  4BY1 H;  3JAM c;  1PH3 A;  3BU2 A;  1K8G A;  2K04 A;  2PQA A;  2YU9 B;  2X69 A;  3TP5 A;  1ENA A;  3G6J B;  4P2C B;  1LTR D;  1Z6H A;  4K2K A;  5M3M G;  2F0U A;  4DR7 Q;  5C4J B;  4GLV B;  1Q7Y C;  1JB7 A;  1I6H B;  2R7D A;  2K50 A;  4A3J B;  4PZ6 A;  1PRT C;  3SK4 A;  4DV5 Q;  4RKB A;  3S9W A;  1SSO A;  1GVP A;  5FJ8 H;  1V9P A;  3K7A B;  4I7A A;  4PV1 C;  2ZM6 Q;  1HUN A;  2ENB A;  2I5L X;  3MFY A;  1GHK A;  5T1G A;  4LF6 L;  1QNU A;  4TQU S;  4KHP L;  2Q8R E;  5LL6 X;  1X55 A;  2E2I H;  4XIG S;  2KCN A;  2RSN A;  4EQN A;  4PMB A;  4HAE A;  4JK1 C;  4XQQ A;  1ZXT A;  1PLF A;  4A3D B;  4A3J G;  2EXZ A;  4DFA A;  3NP8 A;  1EFI D;  1KRT A;  5J22 A;  1U4P A;  4GKK L;  4K8I A;  4C3H B;  1R4Q B;  4DK6 C;  1G6Z A;  4A3L H;  3KJP A;  2Q2U A;  2A68 D;  1MSG A;  2VXW A;  4JI7 L;  5K36 H;  3K7U C;  3I2Z A;  1VQP A;  1YEZ A;  2OCE A;  3PO3 B;  2BE5 D;  1JJG A;  1CZW A;  1FJG L;  3FRP B;  2PI2 A;  3K7A H;  3WWV A;  1A2T A;  4QJF A;  1PH9 A;  1TII D;  2K5N A;  1O7Y A;  1H9S A;  2D2C C;  2EYO A;  5LMN W;  3H3V H;  1SYC A;  3WDN A;  4JI5 Q;  4FO2 A;  2CQO A;  4JBW A;  1IHZ A;  3HOU B;  2RBM A;  4JYA Q;  1I3Q B;  3KDF B;  2N88 A;  2N78 A;  3P75 A;  5CGK A;  3ERS X;  3IFD A;  4RHS A;  4JOI A;  5CV4 A;  4DV0 L;  1F9S A;  2EY2 A;  3K5M A;  1HNW Q;  2SNS A;  2IPK D;  3BDL A;  2M2L A;  1IKM A;  3K81 C;  3EJI A;  2F3W A;  2F4V Q;  4A75 A;  5C4H A;  2F0M A;  5AJ3 L;  1FGU A;  2QEX A;  5LMN Q;  5J39 A;  1X54 A;  2R7Z B;  1RJT A;  1Q82 C;  3TN2 A;  1TKW B;  5IYC G;  3HG9 A;  2N55 A;  3VR5 A;  2N49 A;  5E4X A;  2WAQ B;  3CC4 A;  2R3Z A;  3BDO A;  4DV4 Q;  2LY7 A;  3T1H Q;  1CA5 A;  1YHQ A;  3VR3 A;  5GAE C;  5M3F H;  3TZU A;  1BOS A;  3FKI G;  1VQF A;  1GUT A;  3I56 A;  2OXP A;  3A5Z B;  1ESF A;  3D4W A;  1C48 A;  2G9H D;  2PZT A;  3B6Y A;  1I94 L;  4QB4 A;  1JOK A;  5DNF A;  2AMC B;  5ELB A;  3MWY W;  3S2H B;  3PCO B;  2AQ2 B;  2PZU A;  2Q2I A;  2QCP X;  5CV5 A;  3KOJ A;  2JA8 H;  3RMH A;  1I94 Q;  4LK1 C;  4DK0 A;  1LT4 D;  3HOW B;  4IPD A;  3TS2 A;  4K0K Q;  1ASZ A;  3G48 A;  3GO5 A;  4JI7 Q;  4MNO A;  3NPP A;  3WOE A;  1B1Z A;  3S1Q B;  1EY0 A;  1SFO B;  4Q5V A;  1RTO A;  1TS5 A;  3K0Y A;  1D5M C;  2VQE Q;  2F0D A;  5FKA C;  4GOP B;  1LT3 D;  4KV6 A;  5BN3 A;  2KA7 A;  3N6R A;  4JBK A;  4BA1 I;  4UP9 A;  4DNR B;  4LJZ C;  3DHQ A;  5JAV A;  3HOV G;  1J5E L;  1TWC H;  1XNQ L;  2F0I A;  5M3F B;  1VQO A;  5IP9 G;  5D14 A;  1D6E C;  2DJF C;  3CME A;  3OIQ A;  2MO0 A;  1Y1V G;  2AWN A;  2TSS A;  2UU9 L;  1ICW A;  2QW7 A;  2K4K A;  2ZXR A;  2PMZ B;  4N9T A;  4V0B A;  4ZUJ A;  3J80 E;  1YNJ D;  3CC2 A;  1TVX A;  1YJ9 A;  3GTL H;  1Q3L A;  4GNX C;  4DV0 Q;  1IYU A;  3MFG A;  1KL9 A;  3E0E A;  1KDB A;  3I55 A;  3U4V A;  1CQV A;  2C35 B;  5IT9 E;  4ZK9 B;  1EY6 A;  5JJL A;  4OIK A;  3S2D H;  1PFB A;  1S5B D;  4KN4 C;  1NMG A;  2F0Q A;  2VB2 X;  2JA7 H;  5JEA J;  4GZY C;  4EQP A;  1Y1V B;  1ICF B;  3I73 A;  3OWF A;  4Q0F A;  2K52 A;  2NVY B;  3A55 A;  2I5M X;  3F8T A;  3CAM A;  5F2D A;  5DM7 3;  4KKS A;  1QIL A;  3PUY A;  1WD1 A;  4B08 A;  5JJI A;  1DOK A;  1ILP A;  1G91 A;  1QCB D;  2G5D A;  2PQE A;  4DNI A;  1VQM A;  4LF7 Q;  3PIO 3;  4DUY L;  5CYU A;  1Q12 A;  3RZD B;  4ABN A;  1EQQ A;  3BS1 A;  4IUT A;  4DR5 Q;  1XMQ L;  2Z8L A;  3J81 j;  2EPB A;  2MPM A;  3PO2 H;  2O5I C;  1KAB A;  1BCP B;  1FGB D;  4RGN A;  3CD6 A;  2AUJ D;  5C3X A;  1E24 A;  3IRB A;  4A3E H;  2ZTE A;  4RAU C;  4LWC A;  4LFC Q;  1KLU D;  1ZYR C;  2JYO A;  3H6M A;  3K8A A;  2B2W A;  4B9X A;  1EY4 A;  4P73 A;  1PFS A;  4P72 A;  3PUV A;  3OHX C;  1Y1V H;  4QGU A;  1KDC A;  1ML0 D;  5JOB A;  1LO5 D;  3J80 i;  4UPA A;  1KNA A;  4YHH L;  2RDG A;  4PZ8 A;  2UUC L;  5JEA G;  1CKN B;  3F2D A;  1X3P A;  1EYD A;  1C0A A;  3RLN A;  3M85 A;  1XTC D;  1HPC A;  3A74 A;  4YCW A;  3M9B A;  1Y8N B;  1PYW D;  2KHS A;  1EY8 A;  2OT2 A;  2QF7 A;  2WIN B;  1GUN A;  1IKL A;  2G9D A;  1PH6 A;  2UU9 Q;  1U4M A;  1PVO A;  4EX5 A;  1K3R A;  1K83 H;  4YHH Q;  3HKS A;  1PMR A;  2JA5 G;  1QUQ A;  2ZT9 C;  5E4W C;  4DV6 L;  4A3G H;  3E0J A;  1TY0 A;  3W1G A;  1JB3 A;  3PUZ A;  4KLK A;  2WII B;  4JI0 L;  4A3E B;  5C6A A;  2NVQ H;  5M5W H;  4DR4 L;  4ZQ3 A;  4OXP A;  1XXG A;  4DK1 A;  1WJJ A;  4GN3 B;  4A93 G;  1AH9 A;  1EYG A;  2D0P A;  3DM3 A;  3HEJ A;  4I65 A;  3G7L A;  4J8Q A;  3OW2 A;  2GA4 B;  2B2W C;  5GAH C;  1SNC A;  4R4Q A;  1K3B C;  3IAY A;  1UE7 A;  4CKE A;  3J81 i;  2WP8 J;  4P75 A;  1VQL A;  1OO9 B;  1HHV A;  1RD9 D;  4RCO A;  4KY6 A;  1S3O A;  3FP9 A;  2CVR A;  4DK3 C;  1W2B A;  1F2Y A;  2VL6 A;  1JJC B;  1ONL A;  2JP1 A;  3I4O A;  4MTN A;  1I4P A;  1C7Y A;  1NSN S;  1L0Y B;  1E0B A;  3D6C A;  4X62 Q;  1A0I A;  2HT1 A;  2JA8 G;  3F1Z A;  1HZ9 A;  1YHA A;  1O7L A;  4NKL A;  1SRO A;  4X65 L;  1CUK A;  4DAY A;  3ND9 A;  3HOX B;  2A69 D;  1B7Y B;  5CV7 A;  1F9Q A;  4ME5 A;  1XJV A;  1G6P A;  4C3I H;  1I5F A;  5BR8 Q;  2R7F A;  1HTP A;  4AQY Q;  2B63 H;  4KHP Q;  4KMU C;  3CCL A;  4YIJ A;  4OWW B;  5M3F G;  2R6G A;  3FKI H;  1A15 A;  2K1B A;  1ENC A;  1I4R A;  2LFN A;  3CRL C;  2IHF A;  1IXR A;  3L0O A;  3R8B A;  4K6L A;  5IP7 G;  3L7Z C;  4ZRZ A;  4QY7 A;  3IFT A;  2ZTD A;  1S72 A;  2J0T D;  3M3Y B;  1H9M A;  1STA A;  2E2J B;  3A7L A;  4IAL A;  3S1N H;  1I6H H;  2H5X A;  5LHY 1;  1Y69 U;  1BR9 A;  1BBW A;  1WCM H;  3RN2 A;  1FD7 D;  4JV5 L;  2E5L Q;  4IFD I;  1Q46 A;  4C3J B;  2RF4 A;  2C5C A;  5CV9 A;  1V1P B;  4PG3 A;  4A3I B;  2Q2T A;  4QL5 A;  3I4N B;  1WTH A;  1S5E D;  3RZO B;  1HR0 L;  5IP9 H;  2GVB A;  3I3C A;  3SK5 A;  2A6E C;  3QB3 A;  4JOI C;  3AFP A;  3KF8 A;  1SNM A;  1VF7 A;  3MTS A;  2UUB Q;  4C3H H;  2LMC B;  2IW3 A;  3PIO A;  2F3V A;  5KYL A;  1EOV A;  1PTO H;  1TWF B;  3NEM A;  5LMN L;  2KEE A;  5CV6 A;  3HP3 A;  2EIF A;  2FJ2 A;  4UHV A;  2MJ8 A;  1KNE A;  1W6J A;  1U0L A;  1I4Q A;  1L2F A;  1PH8 A;  1VQK A;  2WFW A;  1S5F D;  4LF8 L;  4FVM A;  4HIO A;  2A69 C;  2DN8 A;  1V1Q A;  2Z4I A;  3NWT A;  3HOZ G;  1TS2 A;  4OEM B;  1IZ6 A;  3BDC A;  4RKL A;  4DU9 A;  4RA8 A;  3SK6 A;  4H13 C;  4XXE A;  3AU7 A;  3P7J A;  4DV5 L;  4KY7 A;  5FLX L;  3HOU H;  5H1S E;  2AWO A;  4DV4 L;  4BY1 B;  1DM0 B;  1QUQ B;  5G3L D;  1VQB A;  2A5H A;  3AB9 A;  2E8G A;  4ZCK A;  1EL0 A;  1Y14 B;  4OO1 G;  1LTB D;  2N3S A;  4DNT B;  3Q0A A;  4JI4 L;  1D5X C;  2NZ1 D;  2EYJ A;  2XNA C;  1XPU A;  5C4J H;  1R9T H;  2K03 A;  1X3E A;  2RKS A;  1A8V A;  1LTG D;  4KY5 A;  1PH7 A;  3M4O B;  2EOT A;  2PO4 A;  3J7A 5;  1BO0 A;  1B50 A;  5J1Z A;  5G3L F;  4DKA C;  4QCL A;  5KIX A;  2K28 A;  1EYC A;  1V1O A;  1CK1 A;  4GKJ Q;  4JI4 Q;  1XNR Q;  5K36 G;  3PF5 A;  1AE2 A;  3M7G A;  1IYV A;  2F0P A;  1DZ1 A;  4UAI A;  4OX9 Q;  4JI5 L;  4DR1 L;  1F77 A;  4EGV A;  3AYH B;  3VYT A;  4RMF A;  4C1N K;  1GJX A;  1B53 A;  1WFQ A;  3K80 C;  3GD7 A;  2WKD A;  3S2H H;  4K0K L;  1F2M A;  1VQE A;  1M90 C;  2JA6 H;  1N9W A;  4NB3 A;  3GTG H;  3VDY A;  3NHH A;  4XTC S;  1Q1E A;  1YBY A;  2RA4 A;  3RNU A;  1EEF D;  1JT8 A;  2HD3 A;  1R9T B;  2IWH A;  1TT2 A;  4C2M H;  3I4L A;  4LMQ D;  1D1I A;  2N8N A;  3HKZ G;  2FMC A;  4JI8 Q;  1EY5 A;  4L5T A;  1SXT A;  1V1P A;  1E3P A;  4O1N A;  2IJ0 A;  4C3I G;  4JVZ A;  1IBM L;  2L11 A;  1SNP A;  2BDO A;  5COR A;  2JXM B;  3DEO A;  2F0K A;  4JI2 Q;  4C1N I;  1IYJ B;  4FXG C;  1TY2 A;  1B2T A;  4A3B B;  1I3Q H;  5GAG C;  1DOM A;  4DV7 L;  1K8O A;  1VQJ A;  2B2T C;  3KLR A;  2JEA I;  1AE3 A;  1TWA H;  4JG2 A;  3Q22 A;  2VQF Q;  3E6Z X;  1ESR A;  4LNQ A;  2JA6 B;  4WJ4 A;  1XMQ Q;  1UE1 A;  1DGS A;  3I72 A;  4RGO S;  1CSQ A;  5BR8 L;  4DAV A;  4APV A;  5NUC A;  4A3G G;  5LMU Q;  2KEC A;  4EVO A;  2K33 A;  4NDX A;  2F0J A;  4C2M B;  4RG1 A;  4RWS C;  5GRO A;  2BA0 A;  2JA7 B;  1CFM A;  2WB1 B;  4C3J G;  2K14 A;  2L55 A;  5FOB B;  1LTL A;  2WB1 E;  2NVX B;  4IO9 A;  1PFN A;  1F2Z A;  3KF6 B;  1CQF A;  2YV5 A;  4PMC A;  3L2P A;  4OX9 L;  1HTL D;  3DM1 A;  5EKK A;  3KUP A;  2SNM A;  3BZD B;  1PA6 A;  4QF4 A;  4YWL A;  5DLQ E;  2BCO A;  2WB1 G;  5IYD G;  4BY7 H;  1TWA B;  5FO7 B;  1ET6 A;  2RHQ B;  4KJN A;  1N36 L;  3A0J A;  1EWI A;  5KNC A;  2VQF L;  3CQZ H;  3H0G H;  4L5S A;  2NB0 A;  2F4V L;  1NAP A;  3H91 A;  1SFO H;  4A3C H;  1MJC A;  4HSP A;  3MXG A;  1EU4 A;  4NMZ A;  3UDG A;  1YVC A;  2PNR C;  4RHR A;  2IL8 A;  3DEP A;  1RTN A;  3KLW A;  4FYD A;  2KOL A;  1TU2 B;  3HOY G;  2HHH Q;  2F0H A;  3NWS A;  4DN4 M;  1KAA A;  1WYD A;  3I8Z A;  2PCF B;  2LXJ A;  5IYB G;  2X6L A;  4JBJ A;  4HJ9 A;  5L37 A;  3E5S A;  4CJ1 B;  1CHP D;  4B9W A;  3BJU A;  1BKB A;  1HR0 Q;  4TSS A;  1UE6 A;  1XWE A;  3EQL C;  1O7I A;  3D0F A;  1K83 B;  3R93 A;  1DON A;  4JW0 A;  2JQO A;  1BNZ A;  1CHQ D;  2HHH L;  1TWG B;  1HNX Q;  1GO3 E;  1G51 A;  3D4D A;  2EVB A;  4NXN L;  2BH2 A;  3CQZ B;  1O7Z A;  5M5W B;  1IW7 C;  1SR3 A;  1UAP A;  3J80 L;  4DV1 L;  1BF4 A;  1STG A;  3O13 A;  4XDX A;  4B3T Q;  1QWY A;  3URY A;  2SOB A;  1NTG A;  3M4P A;  1H9J A;  4X3T A;  3I91 A;  1ZYR D;  1JC7 A;  4AYB B;  3KBG A;  3PO2 G;  3FHW A;  3S24 A;  3I90 A;  4KJO A;  1C4Q A;  2QGQ A;  3ITP A;  1VQ4 A;  3D3R A;  3QOL A;  2OWO A;  4H0L C;  4O0A A;  1ZKO A;  5IGC A;  1VS0 A;  3RR5 A;  3H3V C;  2IT1 A;  4UP8 A;  4KI0 A;  1EOT A;  2YYZ A;  4ZLT F;  4QUF A;  4JI1 L;  1JIC A;  1SE3 A;  3X3N A;  4IQZ A;  1Q86 C;  4LF7 L;  3CMA A;  1C9O A;  3U4Z A;  4LF6 Q;  2PQA B;  1HCZ A;  1YIT A;  3V96 A;  5IGF A;  2B63 G;  2PYK A;  1O80 A;  3STB D;  1SMY D;  1YJW A;  4C3H G;  1QJO A;  1SJH D;  2F0S A;  4FF4 A;  3HOY H;  3L9A X;  3P1H A;  4DUZ Q;  2XWB B;  1EY7 A;  1EU3 A;  5IYB H;  4ALP A;  1P16 A;  4JI8 L;  4GOP A;  3MEF A;  3HOX H;  4AYB E;  1G29 1;  3GTQ B;  1VQI A;  4K8J A;  2O5J C;  4A4I A;  1LAB A;  1HFN A;  4LF9 L;  4C3I B;  1JWM D;  2B63 B;  2UXB Q;  1PRT F;  2K5W A;  3MXN B;  1VQG A;  1UEA B;  3S17 B;  2KEN A;  1QZG A;  3HFZ B;  3FDT A;  1LYL A;  3CPF A;  4DR3 Q;  2JE6 I;  3A8K E;  4KD3 A;  1SE2 A;  2AUK A;  3R2I A;  5EGT A;  4A93 H;  3EIV A;  4FXK C;  2XRS D;  2NWG A;  1PHJ A;  4DGZ A;  4JCV E;  4X64 L;  1MI2 A;  2L4N A;  2GVA A;  1IBM Q;  4S3S A;  4OON A;  1RCV D;  2WKC A;  3NEN A;  2CWP A;  2F52 A;  4EQ5 A;  1XNR L;  1W6K A;  2RHS B;  3QO2 A;  3WOF A;  4L5Q A;  3CF5 A;  4B3T L;  4X64 Q;  1BCP D;  4TKO B;  2K5V A;  2VS1 A;  2DNE A;  5C44 B;  1N34 Q;  5ELO A;  1L1O B;  1S40 A;  5JVG 3;  4L63 B;  2HCI A;  3GTO B;  1PTO C;  1BUV T;  2KCM A;  4C3J H;  1I50 H;  1QB5 D;  1YNJ C;  3TRE A;  3I4M B;  3V05 A;  5KNB A;  4B3R Q;  1BQQ T;  4R1J A;  4HCE A;  3L3O C;  4PNY A;  1PFM A;  2EYH A;  3K5O A;  1QVG A;  1RKN A;  2Y0S E;  1SAP A;  2AQ1 B;  2R93 G;  1AW7 A;  3PIP 3;  4A3F G;  1Y1W B;  4LUZ A;  3SR1 A;  4TVA B;  2E2D C;  1JR0 D;  3MAQ A;  3E9H A;  2CKZ B;  3J81 c;  2YU9 H;  3VA7 A;  5HY6 A;  4ODG A;  4DXF A;  1NR4 A;  1MJE A;  1HNZ L;  3T51 B;  4DV7 Q;  2EY5 A;  3KDF A;  2RCN A;  4HCS A;  4ZAI A;  1NBW A;  1KLG D;  4BBS B;  2RQX A;  4DV2 L;  3JAM L;  3W5O A;  3PUW A;  3TS0 A;  4JI0 Q;  2Z9H A;  5EPJ A;  3TP8 A;  1PDQ A;  1CSP A;  1RL2 A;  2KCC A;  2EYP A;  5C4X H;  4JI6 L;  4NXM Q;  2CW0 D;  2CW0 C;  5I4D A;  1CA6 A;  2MHV A;  1I50 B;  3CCS A;  1Q8I A;  3I4M H;  2UXB L;  3NEL A;  3LX0 A;  1K9M C;  2F0V A;  5EJW A;  2B2V A;  3ONA B;  1JOR A;  1XPR A;  4IUN A;  5EAY A;  5I9O A;  3EA6 A;  1L1O A;  1H9R A;  5A2Q E;  3S1M H;  1SBB B;  1DOL A;  2AKW B;  2LS0 1;  2OF1 A;  4QIW E;  4DV1 Q;  1LT6 D;  4Y52 H;  1UUP A;  1EZ6 A;  1PYS B;  3T1Y Q;  1VF5 C;  5EPK A;  1MKH A;  2XVS A;  2E2J H;  1KXL A;  1A3U A;  1IL8 A;  2SDF A;  1VQC A;  4DAP A;  2Z6B A;  1MBY A;  3CCM A;  4B3R L;  3BVM A;  2VB3 X;  5T1I A;  1ILQ A;  3LNN A;  2LXK A;  3X3M A;  3VR4 A;  3U50 C;  2Z0S A;  1PYB A;  3CCR A;  3TDQ A;  1K8M A;  3K57 A;  3SDZ A;  3OTO Q;  5AJ3 Q;  1M8A A;  1NUC A;  4A3I H;  3DWA A;  5IIF A;  3KFU A;  1QOH A;  1K28 A;  4RGM A;  4HID A;  2EJF C;  4GN4 B;  5D3I B;  3TSS A;  2F0W A;  2RVL A;  1DXM A;  5M3M B;  1ET9 A;  4IUQ A;  3RUZ A;  3R2T A;  4X66 L;  3G6E A;  2QDL A;  5J3B A;  3J7Y W;  3S1M B;  2R92 B;  3S16 H;  1STN A;  1R4P B;  1HNZ Q;  1B9M A;  1GUW A;  3FVQ A;  3DMU A;  5EQ0 A;  1B3Q A;  1I4X A;  3SXH A;  1GUO A;  1GXD C;  1STH A;  1EY9 A;  2BA1 A;  4Z9C B;  3GTM H;  2E5L L;  3HOU G;  2NUC A;  2VZA A;  2VW9 A;  2QA4 A;  2NN6 G;  2UUA L;  1OXV A;  4JV5 Q;  2Q2H A;  3FPP A;  5IOC A;  5C0X H;  4QQB X;  1DJR D;  1YNN C;  2R7Z H;  5IGD A;  2NVT H;  4XYO A;  1VQ5 A;  1D5Z C;  4DV3 L;  5IY0 A;  1Q81 C;  2UUA Q;  4X3K A;  1PZI D;  2JK8 A;  4GNX A;  1WVL A;  4OO1 H;  3C1F A;  3W1B A;  2R92 G;  4IUR A;  1HA6 A;  2V1C C;  2CH4 W;  2MQH A;  5EBD A;  1I4G A;  4KN7 C;  5ELC A;  3KK7 A;  5FLM G;  2XRQ D;  3NK9 A;  3PMF A;  4RFB A;  3U9S A;  2E2I B;  1SN8 A;  4G57 A;  1LM0 A;  2CQA A;  4PZ7 A;  3VYR A;  1SYD A;  3BZK A;  4IUV A;  1IW7 D;  3UDF A;  2QIL A;  1JE4 A;  4LFA Q;  1J5E Q;  2F3I A;  1MSH A;  3G71 A;  4XQN A;  3T13 A;  2XGT A;  1PRT B;  3BZC A;  4LFB L;  4WJW A;  2F0O A;  2WAQ G;  3A56 A;  3S14 B;  5HGT A;  4F87 A;  3OMC A;  4F8M A;  2UXD L;  3QJY A;  1ENF A;  5AFW A;  4XQJ A;  3GTM B;  4IOC A;  4LF4 Q;  3A8I E;  4G7O C;  3JAM i;  5C44 G;  1N32 L;  3S1Q H;  2PPB C;  4XT3 B;  4UP7 A;  3M4O H;  3RN5 A;  4R4C A;  1PXU A;  1SYF A;  2EJG C;  1EFW A;  2JJQ A;  1L1O C;  4DR4 Q;  2ALY B;  2WAC A;  4X62 L;  1IBK L;  5IT9 c;  3J7A V;  3CCV A;  3Q23 A;  4MIU A;  3HOW G;  4CGY B;  4FXD A;  4JPB W;  4XYQ A;  1J8I A;  2CFM A;  4ILW A;  4NPS A;  2NN6 I;  1TS4 A;  2O4X A;  1Q1B A;  4I7Z C;  4QIW B;  5IGE A;  2RDF A;  1I4H A;  5C0X G;  1MIU A;  2PNH A;  4YWM A;  1WTO A;  3RLO A;  1YIJ A;  4K5W A;  4KHV A;  5FLX E;  1Z9F A;  1HR0 W;  1CT1 D;  2MP1 A;  3S14 H;  1E1O A;  3GTG B;  1VQA A;  2JA9 A;  2Y0S G;  3K58 A;  1SJE D;  4BBS G;  1E7Z A;  1WTR A;  5I6W A;  2VUM B;  1X6O A;  5C5L A;  2I07 B;  2L0C A;  1SLJ A;  5FJ8 G;  1WTV A;  4DR6 Q;  2HDM A;  4CDF C;  1GM5 A;  1Q90 A;  5D65 A;  1D8L A;  3NTI A;  2OEO A;  1NY4 A;  3MXN A;  1N8R C;  1EQR A;  1EWC A;  1FNW A;  5I2X A;  4M1U B;  1EIG A;  5D3D A;  2UUB L;  2HQL A;  3JAM E;  1B9N A;  1AZP A;  5M5X B;  4PQX A;  1IBL Q;  4X65 Q;  1EWH A;  5I9P A;  2VUM G;  4IPC A;  3GTP H;  2B2U A;  1SYG A;  2EYL A;  4R4O A;  4KHZ A;  1BBU A;  4A3B H;  3GQB A;  4WRD A;  1CI3 M;  2GN5 A;  1A2U A;  2ZJP A;  5IWA Q;  4H7B A;  3D31 A;  2EJM A;  2F0G A;  1N33 L;  4A3L G;  3IL8 A;  2J4X A;  4CDD C;  4XT1 B;  3PUX A;  1WD0 A;  3HZX A;  3GTJ B;  1X65 A;  1VDZ A;  3CC7 A;  1DYQ A;  1TWH B;  3HOW H;  1N33 Q;  2F0E A;  2K6A A;  1K0S A;  3QIA A;  4CKC A;  1V43 A;  3TZD A;  4LF9 Q;  1NE3 A;  3NBH A;  4K2L A;  2A1A A;  3NSW A;  4GKK Q;  2L12 A;  1A3T A;  3N52 A;  3DXJ C;  4J15 A;  4LUO A;  3NQT A;  4GKJ L;  3SE0 A;  3SVM A;  5ELF A;  2OTJ A;  3TRZ A;  1HRJ A;  4A3I G;  3CXC A;  5M5Y B;  5LMU L;  4MN3 A;  4ME3 A;  4OO1 I;  4DR5 L;  4OGQ C;  3ND8 A;  3GTP B;  1YNX A;  1JCK B;  3ZYY X;  3OIP A;  2Z4H A;  2OQ0 A;  1CKN A;  2XWJ B;  1FR3 A;  1AP0 A;  3FEW X;  3U9O A;  4JI6 Q;  5JJK A;  2KHJ A;  4DV2 Q;  1RHP A;  1S5D D;  2HUG A;  3QOJ A;  4JC0 A;  5JEA H;  2KHI A;  2ID0 A;  4X3U A;  5ELE A;  3S1R H;  1EZ8 A;  3CKI B;  4JYA L;  4GLX A;  3MHB A;  4JBM A;  2DUD A;  2NN6 H;  1VQ9 A;  2HIX A;  1HA5 A;  2B29 A;  2JEB I;  4HIK A;  4ULL A;  2NTS A;  1T5E A;  2DGY A;  1D7Q A;  4B3S L;  4OIJ A;  5C0X J;  1CM9 A;  3FPU B;  4JI3 Q;  1QVF A;  3VYS A;  2H4O A;  3TEH B;  4OHJ A;  1JMC A;  1LUZ A;  2HDL A;  1M1K C;  3D8G A;  1J6Q A;  1V8Q A;  2KCT A;  1T5X D;  2E2H B;  4A3E G;  1TR5 A;  2ZTC A;  2V4D A;  4MTK A;  5KEE A;  4A93 B;  4IUP A;  1E2V A;  5E7N A;  1PZK D;  2K5D A;  1X32 A;  4NP5 A;  3M4Y A;  1FNU A;  3AMU A;  1SE4 A;  5HGQ A;  3VA5 A;  5A35 A;  1UNS A;  1Z7T A;  2B3G A;  3BG3 A;  4U67 3;  4A3K B;  1Y8P B;  4EQO A;  3PQI A;  5I2Y A;  3ER0 A;  1GUS A;  1JOO A;  5DAU A;  4OL7 A;  2RSO A;  5ELN A;  3KF6 A;  5C3W A;  4HSV A;  4A3F H;  3T16 A;  2L1B A;  3PGZ A;  2ASB A;  1F2L A;  2J7Z A;  2D62 A;  2NZH A;  2A8V A;  3BYY B;  1ROD A;  4N8X 1;  2KBN A;  3STB C;  4POG A;  4LF5 L;  3R3O A;  1TXY A;  1GKH A;  5JVH 3;  2FMM A;  3HOV H;  5CV8 A;  2Z1C A;  1X3G A;  3CHB D;  4R4T A;  2CCZ A;  1UEB A;  5FLM H;  4WOR A;  3F2B A;  2XN9 C;  2KED A;  1PH1 A;  3ERO A;  3FKI B;  2B2U C;  2E2H H;  2ICE C;  4DR6 L;  1EEI D;  4ZYS A;  4Y7N B;  4B3M L;  2KUM A;  3D4R A;  3MXP A;  5C3E H;  3HOX G;  2R61 A;  1HXY D;  1YNN D;  2NTT A;  3J81 L;  3A5U A;  4QUC A;  1HQM C;  3OPO A;  5CMD A;  1BDO A;  4H44 C;  4KTA A;  4BBR H;  2LKV A;  3S15 H;  3CPW A;  1XMO Q;  3LWE A;  2YTX A;  1QNK A;  3DWQ A;  1X3F A;  4BBS H;  3ERQ A;  2D9U A;  4E6I A;  3S1N B;  2UXC L;  5EPL A;  2NVQ B;  4QMG A;  1BBX C;  1XX8 A;  3KF8 B;  1SND A;  1VQ6 A;  5IGG A;  3QG1 A;  2K5Q A;  2A19 A;  2HIV A;  2CWA A;  1FJG Q;  2HCC A;  1LAC A;  1SEB D;  2ZXO A;  5IGB A;  3HOV B;  2XIW A;  2RCF A;  4R8N A;  3GV3 A;  1EIH A;  1E2W A;  3NBI A;  5IP7 H;  4KKU A;  5IT9 L;  3I4N H;  3S17 H;  1Z47 A;  2CH4 A;  1N34 L;  2I0Q A;  2UXD Q;  5EKI A;  5CBE E;  2EE1 A;  2VNU D;  1KIX A;  4LFB Q;  1JWS D;  1XPO A;  1LTA D;  4A3B G;  5GQO A;  3T4A C;  5KGU A;  4H02 A;  4KK7 A;  4BXX G;  4BWG B;  1B4O A;  3S15 B;  2E76 C;  3C1E A;  2B2Y A;  1JJ2 A;  1KDA A;  2JA6 G;  1LTT D;  3UE1 A;  1JE5 A;  2KJX A;  1PTO B;  3I7F A;  1LLR D;  3BYT B;  3NQI A;  1X3Q A;  1U9R A;  1SNQ A;  1GHJ A;  2FHT A;  3A7A B;  1B3A A;  1QVC A;  4AIM A;  3GTO H;  2D0O A;  3DLL A;  2B8F A;  3ICE A;  3V2T A;  1B70 B;  2PW7 A;  4FF1 A;  4IFD H;  2A6H D;  2A6H C;  2I5H A;  2MGS A;  1MGS A;  1NNX A;  4CJ2 C;  1WOC A;  4JI3 L;  2F1M A;  4AH6 A;  1XTD A;  1VMC A;  1QG7 A;  4J1M A;  4L6T B;  1LTI D;  4A3D H;  2A68 C;  4J6H A;  3W2D A;  3CCU A;  1WCM G;  1SDF A;  4GLA C;  1Y1W H;  1SE8 A;  1ZEQ X;  4WJ3 M;  5C4X G;  1GD7 A;  4HR7 B;  2R92 H;  3S16 B;  1PH2 A;  4KKT A;  1EQT A;  4DR1 Q;  4DAM A;  2JA5 H;  2O2L D;  4CHT B;  4A3M B;  1CTM A;  5IE8 A;  1XNQ Q;  3HOZ H;  3RD4 A;  4UY8 C;  2MUY A;  3I4N G;  1NMF A;  1N36 Q;  2Z6K C;  4CJ0 B;  3MC0 B;  4DXG A;  2WAQ E;  3CRK C;  3PO3 H;  4IFD J;  2OTL A;  1U5K A;  2F0L A;  2Q8T A;  1T9H A;  4GN5 A;  4IPH A;  4M8A A;  4X3S A;  1B8A A;  4F88 A;  1KAW A;  3GV6 A;  4K5X A;  2HQE A;  1WCM B;  5C4X B;  4RH6 A;  4L5R C;  1HUM A;  1ASY A;  4DR3 L;  3IKJ A;  3PV0 A;  3TBI B;  2FIN B;  4IZ8 A;  3RZO H;  1X56 A;  5ELD A;  2Q8I B;  1CZG A;  3EVQ A;  4MZ9 A;  1PH5 A;  1SYE A;  3VYU A;  4HIM A;  5JPM C;  2A73 B;  3H09 A;  2P5Z X;  2SEB D;  1XMO L;  2ZJR A;  5EBC A;  2EQS A;  3Q8D A;  4A3K G;  2QDB A;  1LT5 D;  2K32 A;  4B3S Q;  4GS3 A;  2JA5 B;  1AN8 A;  4BY7 G;  5IYD H;  3AFQ A;  4DV3 Q;  4DUZ L;  3HOZ B;  3T1H L;  2NZO A;  2L9H A;  5I6Y A;  2NYZ D;  4F7X A;  2EY1 A;  2PMZ E;  3PSI A;  1TWF H;  4UDU C;  4P74 A;  5FLX c;  1SMX A;  4B3M Q;  4NXM L;  2EZV A;  4DUY Q;  2RDH A;  1HQR D;  4NW2 A;  4N9P A;  5ISR A;  2EXD A;  3MEH A;  4A76 A;  3OOC A;  4JI2 L;  4N8F A;  2EYM A;  4O2D A;  1G2T A;  2MFI A;  1EYA A;  2DY7 A;  3SEB A;  1FVI A;  5M3M H;  1QZH A;  3OSO A;  4CKB A;  1YI2 A;  1VQN A;  2ATW A;  3KLS A;  3ZJY C;  2VQE L;  3I70 A;  3BVZ A;  3JC6 6;  3SGI A;  3SK8 A;  1NJI C;  1OXS C;  1U4R A;  2QKI C;  4BBR G;  2JA8 B;  5TSS A;  2F03 A;  1WI5 A;  4IUU A;  5A2Q L;  4CDE C;  1FL0 A;  1HNX L;  2KVM A;  4CDC C;  1PRT D;  2L15 A;  4L8J A;  4TRD A;  1RDP D;  3MXU A;  1DD2 A;  4MHE A;  3CW2 C;  1YHB A;  2IX1 A;  1HZC A;  2NVT B;  2NVX H;  1M4V A;  3OYY A;  4LF5 Q;  1S5C D;  3D6W A;  4YWK A;  5KRU A;  1BCP F;  1WTQ A;  3G4S A;  1TWC B;  3CCJ A;  1W3S A;  4C56 C;  5C0X I;  2EY6 A;  4DPG A;  4POF A;  2K01 A;  1LTS D;  2XTI A;  3UI2 A;  3H15 A;  3C46 A;  2OQK A;  4OWX B;  4PMW A;  1K73 C;  1VQH A;  3C2P A;  1L0W A;  3HKZ B;  2WV6 D;  4DV6 Q;  2EYF A;  1G2S A;  2K75 A;  4YCV A;  1OXT A;  3GTL B;  4BXX H;  4HN7 A;  2KQ3 A;  3RLF A;  1F9P A;  3QR8 A;  3J7A F;  1TWH H;  4WFN 3;  2ICI A;  3H0G B;  4LW1 A;  2BH8 A;  1TQO A;  2IX0 A;  3H94 A;  4HED A;  4YCU A;  2BE5 C;  1A62 A;  3CP0 A;  1Y8O B;  3P20 A;  2F4I A;  3S2D B;  2B39 A;  1CKO A;  1CKM A;  1BCP C;  3UDI A;  5FO8 B;  2UXC Q;  1LV9 A;  4ID6 A;  4DR2 Q;  2UUC Q;  1STB A;  2IHE A;  5K5P A;  1TS3 A;  1JOQ A;  3HRZ C;  3KBX A;  4P71 A;  3QWN A;  1F9R A;  3NUC A;  4O42 A;  4DR2 L;  4RGT A;  4CBV A;  1YJN A;  4R4I A;  3GDE A;  3H0G G;  3ULL A;  4DAY B;  3AEV A;  1DCZ A;  1RF2 D;  1VQ7 A;  3NTK A;  4K5V A;  2MNA A;  1EUJ A;  3M4Q A;  2A6E D;  3T56 B;  4FF3 A;  4HMI A;  2MO1 A;  4JI1 Q;  3NBH B;  3HKZ E;  4A3M G;  5CC4 A;  1H9S B;  3E9I A;  4LUV A;  2K05 A;  5IYC H;  4HJ7 A;  5FO9 B;  5IWA L;  4AQY L;  2VUM H;  3F2C A;  3J80 c;  4HJ5 A;  4LF4 L;  1VQ8 A;  2C9O A;  2F0N A;  2ZXP A;  4KD4 A;  3SHL A;  4IOA A;  3DWP A;  5C5M A;  2D5D A;  4U68 A;  3VR6 A;  3C3L A;  3E3X A;  2CHB D;  1JWU D;  1HH2 P;  2AQ3 B;  3HS0 C;  3LGJ A;  1SMY C;  1L0X B;  4NXN Q;  5M5X H;  1PV4 A;  5JJZ A;  3K5L A;  5COY A;  2DJG C;  4K14 A;  3GTK H;  3OWE B;  4A3C G;  5DEH A;  4BY1 G;  1J9O A;  1U4L A;  1OXU A;  4BY7 B;  2X6G A;  4BS9 A;  4A3K H;  3T53 B;  1JQY D;  1P8L A;  4GOP C;  1E2Z A;  3H3V I;  2F0T A;  3HOY B;  1FNV A;  3GTJ H;  5BN4 A;  3CU7 A;  2B8G A;  3PF4 A;  4IN3 A;  1K8A C;  5C3E G;  2TMP A;  3MA2 B;  3EFX D;  5FK9 C;  5CBA E;  1A6X A;  1H9K A;  3OW7 A;  3GP7 A;  3F2U A;  3GTQ H;  2BDN A;  1A63 A;  4R9W A;  1UE5 A;  5EKL A;  2NVY H;  1IL2 A;  1EQV A;  1KTK A;  4LF8 Q;  5E3F A;  1RIP A;  3VR2 A;  1H95 A;  3K5N A;  1KHI A;  5M5Y H;  3HGB A;  2ZM6 L; 
#chains in the Genus database with same CATH homology
 2FXQ A;  2IT1 A;  3A74 A;  4YCW A;  3M9B A;  4GNX B;  4UP8 A;  4KI0 A;  2YYZ A;  5E7N A;  4A3D G;  1VCI A;  4JI1 L;  3RZD H;  1HNW L;  1Q86 C;  1E22 A;  1PH6 A;  5GAD C;  2UU9 Q;  4LF7 L;  3CMA A;  1C9O A;  3U4Z A;  3OTO L;  4LF6 Q;  2PQA B;  4EX5 A;  1PVO A;  1YIT A;  4AYB G;  2B63 G;  1K3R A;  5HGQ A;  1K83 H;  4YHH Q;  3HKS A;  1OTC A;  2B3G A;  3STB D;  3KJO A;  1YJW A;  2JA5 G;  1QUQ A;  1TWG H;  1SRU A;  4DV6 L;  3ER0 A;  4A3G H;  3HOY H;  3W1G A;  3TQY A;  3CCQ A;  5ELN A;  3PUZ A;  4KLK A;  3KF6 A;  4JI0 L;  3T1Y L;  4DUZ Q;  4A3F H;  2ASB A;  3PGZ A;  1HJP A;  5M5W H;  2NVQ H;  4DR4 L;  2D62 A;  2NZH A;  4OXP A;  5IYB H;  4ALP A;  3PIP A;  2A8V A;  3PO3 G;  1P16 A;  2YTV A;  4JI8 L;  4GOP A;  1WJJ A;  1E1T A;  3MEF A;  4GN3 B;  2KBN A;  3HOX H;  3STB C;  4AYB E;  2D0P A;  1G29 1;  1EYG A;  4POG A;  1VQI A;  1AH9 A;  4LF5 L;  1KRS A;  4A4I A;  3DM3 A;  1HZB A;  1TXY A;  1GKH A;  4LFC L;  3HOV H;  4LF9 L;  3OW2 A;  1X3G A;  5GAH C;  4R4Q A;  2UXB Q;  4R4T A;  2CCZ A;  3MXN B;  1UEB A;  1VQG A;  3ULJ A;  5FLM H;  3F2B A;  1UE7 A;  3J81 i;  2KEN A;  1PH1 A;  2WP8 J;  3EN2 A;  3HFZ B;  1QZG A;  4OWT B;  2E2H H;  1LYL A;  3CPF A;  4DR6 L;  1N32 Q;  4DR3 Q;  3U58 A;  4B3M L;  1KQS A;  2LSS A;  4P75 A;  1VQL A;  2JE6 I;  4FDB A;  5C3E H;  3HOX G;  4A93 H;  1S3O A;  3FP9 A;  3EIV A;  3CCE A;  4DK3 C;  1W2B A;  3A5U A;  2VL6 A;  1JJC B;  1C7Y A;  3I4O A;  4MTN A;  1PHJ A;  2YTY A;  4IFD G;  4JCV E;  4BBR H;  4YY3 L;  1X9N A;  3S15 H;  4X64 L;  1IBM Q;  2GVA A;  3CPW A;  4OON A;  4EQ5 A;  3NEN A;  2CWP A;  2F52 A;  1XMO Q;  4X62 Q;  1A0I A;  1XNR L;  2HT1 A;  2JA8 G;  2YTX A;  3M3Y H;  3F1Z A;  1HZ9 A;  2Z6K A;  2RHS B;  1YHA A;  4L5Q A;  1X3F A;  1K0R A;  2K5H A;  3CF5 A;  3AQQ A;  4BBS H;  4B3T L;  2UXC L;  4X64 Q;  2PI2 E;  1Y1W G;  2K5V A;  2VS1 A;  1SRO A;  4X65 L;  2R93 H;  1CUK A;  4IJL A;  1N34 Q;  2JA7 G;  5ELO A;  3KF8 B;  1KD1 C;  1L1O B;  4IJH A;  4HJ8 A;  1S40 A;  1VQ6 A;  2A19 A;  1B7Y B;  2HIV A;  2CWA A;  1FJG Q;  2R7Z G;  2KCM A;  4C3J H;  1XJV A;  1EIY B;  1I50 H;  1G6P A;  4C3I H;  1I5F A;  3M7N A;  3TRE A;  5BR8 Q;  2R7F A;  5IP7 H;  4AQY Q;  2B63 H;  3I4N H;  4B3R Q;  4KHP Q;  1BVS A;  3CCL A;  4R1J A;  3S17 H;  4OWW B;  5M3F G;  2R6G A;  1Z47 A;  2I0Q A;  1N34 L;  2UXD Q;  3EBE A;  3FKI H;  1QVG A;  4DR7 L;  2Y0S E;  4Y7N H;  2R93 G;  4IPG A;  2VNU D;  1VQD A;  1KIX A;  4LFB Q;  4A3F G;  4LUZ A;  1XPO A;  4TVA B;  4A3B G;  5GQO A;  1Q8K A;  3E9H A;  2CKZ B;  3J81 c;  2YU9 H;  4H02 A;  2IHF A;  5HY6 A;  1IXR A;  3UDX A;  4BA2 I;  3L0O A;  4BXX G;  4A3M H;  1KC8 C;  5IP7 G;  3L7Z C;  2ES2 A;  4QY7 A;  1MJE A;  2ZTD A;  1HNZ L;  4X66 Q;  1S72 A;  1JJ2 A;  2JA6 G;  4DV7 Q;  1IBK Q;  1IBL L;  3KDF A;  3UE1 A;  3I4M G;  1UWV A;  2RCN A;  1PH4 A;  1NBW A;  1JE5 A;  4YY3 Q;  3I7F A;  4DV2 L;  1I6H H;  1HZA A;  3ULP A;  4A3J H;  3S1N H;  3TS0 A;  3W5O A;  2H5X A;  3PUW A;  3J7Z C;  4JI0 Q;  3K0X A;  5C44 H;  1EIF A;  1BBW A;  1WCM H;  1CSP A;  3RN2 A;  1QVC A;  1RL2 A;  4JV5 L;  4AIM A;  3GTO H;  5C4X H;  4JI6 L;  2IY5 B;  4NXM Q;  2D0O A;  2E5L Q;  3DLL A;  1Q46 A;  4IFD I;  2RF4 A;  2AHO B;  1OXX K;  2VY3 A;  3CCS A;  3KYH C;  4HJA A;  3ICE A;  1YZ6 A;  1B70 B;  4PG3 A;  2Q2T A;  4QL5 A;  3I4M H;  2I5H A;  2UXB L;  3NEL A;  1HR0 L;  4LFA L;  1WOC A;  4JI3 L;  4AH6 A;  1XTD A;  5IP9 H;  1K9M C;  2GVB A;  3UE0 A;  4A3D H;  4X6A H;  2ZJQ A;  1XPR A;  5EAY A;  3CCU A;  1WCM G;  4GLA C;  1Y1W H;  4BY1 H;  4JOI C;  3JAM c;  1PH3 A;  1SE8 A;  3AFP A;  1L1O A;  4WJ3 M;  3BU2 A;  3S1M H;  1GD7 A;  5C4X G;  2R92 H;  1PH2 A;  2AKW B;  1K8G A;  2PQA A;  4DR1 Q;  4QIW E;  2UUB Q;  4DAM A;  2JA5 H;  4C3H H;  4DV1 Q;  4Y52 H;  3PIO A;  5IE8 A;  1XNQ Q;  1PYS B;  3HOZ H;  3T1Y Q;  4UY8 C;  3I4N G;  1MKH A;  1NMF A;  1EOV A;  2E2J H;  1KXL A;  5M3M G;  1N36 Q;  2Z6K C;  4DR7 Q;  4GLV B;  1Q7Y C;  3NEM A;  2WAQ E;  2R7D A;  2K50 A;  1VQC A;  4PZ6 A;  5LMN L;  1U5K A;  1JB7 A;  2OTL A;  4IFD J;  1T9H A;  2EIF A;  4GN5 A;  4IPH A;  4DV5 Q;  1B8A A;  1KAW A;  3CCM A;  1GVP A;  5FJ8 H;  1V9P A;  4B3R L;  1U0L A;  1L2F A;  2LXK A;  1PH8 A;  1VQK A;  2WFW A;  3U50 C;  4LF8 L;  2Z0S A;  1PYB A;  2ZM6 Q;  3CCR A;  2I5L X;  3RR5 A;  4L5R C;  1R9T H;  4HIO A;  3OTO Q;  4LF6 L;  1V1Q A;  5AJ3 Q;  3HOZ G;  3PO3 H;  1IZ6 A;  1ASY A;  4DR3 L;  4A3I H;  4TQU S;  3PV0 A;  3KFU A;  4KHP L;  1X55 A;  4HID A;  4XIG S;  4DV5 L;  2E2I H;  1X56 A;  4GN4 B;  3RZO H;  3HOU H;  5H1S E;  4MZ9 A;  2AWO A;  4A3J G;  1PH5 A;  4DV4 L;  4X66 L;  3G6E A;  4HIM A;  5J3B A;  1QUQ B;  1KRT A;  1VQB A;  3S16 H;  1XMO L;  2ZJR A;  1HNZ Q;  2EQS A;  3Q8D A;  4A3K G;  2E8G A;  1Y14 B;  4B3S Q;  4GKK L;  4OO1 G;  4GS3 A;  2N3S A;  4BY7 G;  5IYD H;  3AFQ A;  4DK6 C;  4DV3 Q;  4A3L H;  4DUZ L;  3T1H L;  2NZO A;  3KJP A;  2Q2U A;  4JI4 L;  3GTM H;  2BA1 A;  4JI7 L;  2E5L L;  3HOU G;  2VZA A;  2VW9 A;  1XPU A;  3K7U C;  2PMZ E;  3I2Z A;  1TWF H;  3PSI A;  1YEZ A;  2NN6 G;  1X3E A;  1OXV A;  2OCE A;  1A8V A;  2Q2H A;  4P74 A;  2QA4 A;  2UUA L;  5FLX c;  1SMX A;  4JV5 Q;  4B3M Q;  4QQB X;  1FJG L;  4A93 G;  1JJG A;  1PH7 A;  4NXM L;  2R7Z H;  2PI2 A;  3K7A H;  4DUY Q;  3J7A 5;  2NVT H;  3WWV A;  1VQ5 A;  4DV3 L;  5IY0 A;  1Q81 C;  4QJF A;  4GNX A;  4DKA C;  2JK8 A;  1PH9 A;  2UUA Q;  3W1B A;  2EXD A;  2K5N A;  4A76 A;  2R92 G;  4JI2 L;  2V1C C;  4O2D A;  2MQH A;  5LMN W;  3H3V H;  4JI5 Q;  2MFI A;  5FLM G;  4GKJ Q;  4JI4 Q;  1XNR Q;  2CQO A;  5K36 G;  4JBW A;  3PF5 A;  1SN8 A;  1AE2 A;  1LM0 A;  4PZ7 A;  1FVI A;  3BZK A;  5M3M H;  1QZH A;  4OX9 Q;  4JYA Q;  4JI5 L;  3UDF A;  4DR1 L;  4LFA Q;  3KDF B;  2F3I A;  2N78 A;  3AYH B;  1YI2 A;  1J5E Q;  1VQN A;  4RMF A;  2ATW A;  3ERS X;  3ZJY C;  3G71 A;  4JOI A;  2VQE L;  2XGT A;  4DV0 L;  3JC6 6;  3SGI A;  1WFQ A;  3BZC A;  3K80 C;  3GD7 A;  1NJI C;  1OXS C;  3S2H H;  4LFB L;  2WAQ G;  4K0K L;  1VQE A;  1M90 C;  2JA6 H;  1N9W A;  4NB3 A;  1HNW Q;  4BBR G;  3GTG H;  3VDY A;  2UXD L;  4XTC S;  1WI5 A;  3K81 C;  1Q1E A;  1YBY A;  4IOC A;  3RNU A;  4LF4 Q;  2F4V Q;  1FL0 A;  1HNX L;  4A75 A;  3JAM i;  5C44 G;  1N32 L;  1JT8 A;  3S1Q H;  5AJ3 L;  1FGU A;  2L15 A;  2QEX A;  4C2M H;  5LMN Q;  2N8N A;  3HKZ G;  4UP7 A;  1X54 A;  3CW2 C;  1YHB A;  3M4O H;  3RN5 A;  1Q82 C;  4R4C A;  2IX1 A;  1HZC A;  4JI8 Q;  5IYC G;  1EFW A;  4L5T A;  2JJQ A;  2NVX H;  1L1O C;  3OYY A;  4DR4 Q;  2N49 A;  2ALY B;  1E3P A;  1VQP A;  4LF5 Q;  4X62 L;  1IBK L;  4YWK A;  5IT9 c;  3CC4 A;  3CCV A;  4DV4 Q;  3T1H Q;  1IBM L;  3HOW G;  3G4S A;  3CCJ A;  1W3S A;  1YHQ A;  5C0X I;  4DPG A;  2CFM A;  4POF A;  5GAE C;  5M3F H;  2XTI A;  4NPS A;  2NN6 I;  4JI2 Q;  3FKI G;  3H15 A;  1IYJ B;  2OQK A;  4OWX B;  1VQF A;  1Q1B A;  3I56 A;  4PMW A;  3A5Z B;  1K73 C;  1I3Q H;  5GAG C;  4DV7 L;  1VQH A;  1MIU A;  2PNH A;  3B6Y A;  5C0X G;  1L0W A;  4YWM A;  1I94 L;  1VQJ A;  3RLO A;  4DV6 Q;  1YIJ A;  2AMC B;  2JEA I;  1AE3 A;  1TWA H;  2K75 A;  4JG2 A;  1Z9F A;  3PCO B;  4YCV A;  2VQF Q;  2Q2I A;  1OXT A;  1HR0 W;  4LNQ A;  4BXX H;  3S14 H;  1E1O A;  4WJ4 A;  3KOJ A;  2JA8 H;  1XMQ Q;  1VQA A;  2JA9 A;  1UE1 A;  1DGS A;  2Y0S G;  3RLF A;  1I94 Q;  1CSQ A;  5BR8 L;  4BBS G;  1E7Z A;  3TS2 A;  1TWH H;  4IPD A;  1X6O A;  4APV A;  4LW1 A;  1ASZ A;  4K0K Q;  4A3G G;  3G48 A;  2BH8 A;  3GO5 A;  5LMU Q;  2IX0 A;  4JI7 Q;  1SLJ A;  4MNO A;  5FJ8 G;  4DR6 Q;  4YCU A;  1A62 A;  3CP0 A;  3HOW H;  1GM5 A;  4RG1 A;  5GRO A;  1D8L A;  2BA0 A;  2VQE Q;  1NY4 A;  1CKO A;  1N8R C;  1CKM A;  1EQR A;  3UDI A;  4GOP B;  2K14 A;  1LTL A;  2WB1 E;  2UXC Q;  4JBK A;  4DR2 Q;  2UUC Q;  4IO9 A;  4BA1 I;  4UP9 A;  2IHE A;  3KF6 B;  2UUB L;  2HQL A;  2YV5 A;  3HOV G;  3L2P A;  1J5E L;  4P71 A;  1TWC H;  1XNQ L;  4OX9 L;  1IBL Q;  4DR2 L;  4X65 Q;  1VQO A;  5IP9 G;  1YJN A;  2VUM G;  4R4I A;  3GDE A;  3H0G G;  4IPC A;  3ULL A;  4DAY B;  3AEV A;  3GTP H;  1VQ7 A;  1PA6 A;  4R4O A;  4KHZ A;  3CME A;  1BBU A;  2MNA A;  4A3B H;  1EUJ A;  1Y1V G;  2AWN A;  2MO0 A;  3M4Q A;  4YWL A;  5C4J H;  2GN5 A;  2UU9 L;  5DLQ E;  2K4K A;  2ZJP A;  5IWA Q;  2MO1 A;  4JI1 Q;  3NBH B;  3HKZ E;  4A3M G;  2WB1 G;  5IYD G;  4BY7 H;  3D31 A;  3E9I A;  4LUV A;  2RHQ B;  1N33 L;  3CC2 A;  4A3L G;  5IYC H;  1YJ9 A;  3GTL H;  3PUX A;  4HJ7 A;  4GNX C;  3A0J A;  1N36 L;  1EWI A;  4DV0 Q;  5IWA L;  4AQY L;  1X65 A;  3CC7 A;  1KL9 A;  3E0E A;  2VQF L;  3CQZ H;  2VUM H;  3H0G H;  1N33 Q;  3I55 A;  3U4V A;  3J80 c;  3F2C A;  4L5S A;  4HJ5 A;  2C35 B;  4LF4 L;  2F4V L;  1V43 A;  1VQ8 A;  4LF9 Q;  1NE3 A;  1SFO H;  4A3C H;  5JJL A;  3S2D H;  1MJC A;  1NMG A;  2A1A A;  3UDG A;  2JA7 H;  1YVC A;  5JEA J;  4IOA A;  4GKK Q;  2K52 A;  3KLW A;  4J15 A;  4LUO A;  4GKJ L;  2I5M X;  3F8T A;  3CAM A;  3HOY G;  2HHH Q;  1HH2 P;  2OTJ A;  3TRZ A;  3LGJ A;  4A3I G;  4NXN Q;  1WYD A;  3CXC A;  5M5X H;  1PV4 A;  2LXJ A;  3PUY A;  5JJI A;  5LMU L;  5IYB G;  4ME3 A;  4JBJ A;  4HJ9 A;  4OO1 I;  4DR5 L;  4DNI A;  1VQM A;  4LF7 Q;  3GTK H;  4A3C G;  1YNX A;  4BY1 G;  4DUY L;  1Q12 A;  2OQ0 A;  1EQQ A;  1CKN A;  3BJU A;  1BKB A;  1HR0 Q;  1UE6 A;  4DR5 Q;  1XMQ L;  1OXU A;  1O7I A;  3D0F A;  3J81 j;  4JI6 Q;  3PO2 H;  4A3K H;  2KHJ A;  5JJK A;  2JQO A;  4DV2 Q;  2HHH L;  1HNX Q;  1GO3 E;  1P8L A;  4GOP C;  4JC0 A;  3CD6 A;  3H3V I;  1G51 A;  2KHI A;  4NXN L;  3GTJ H;  2BH2 A;  1E24 A;  2ID0 A;  3PF4 A;  3IRB A;  3S1R H;  4A3E H;  5C3E G;  1K8A C;  4JYA L;  2ZTE A;  1SR3 A;  4LWC A;  4LFC Q;  4DV1 L;  4GLX A;  4JBM A;  2DUD A;  1VQ9 A;  3K8A A;  2HIX A;  4B3T Q;  4P73 A;  1PFS A;  2B29 A;  2JEB I;  4P72 A;  4HIK A;  3GTQ H;  1NTG A;  3M4P A;  3PUV A;  2DGY A;  1Y1V H;  4QGU A;  1D7Q A;  4B3S L;  3PO2 G;  1A63 A;  3J80 i;  5C0X J;  3FHW A;  4UPA A;  1UE5 A;  3S24 A;  4YHH L;  4JI3 Q;  3TEH B;  1QVF A;  1JMC A;  2NVY H;  1LUZ A;  2QGQ A;  4PZ8 A;  1VQ4 A;  2UUC L;  2OWO A;  1M1K C;  4LF8 Q;  1IL2 A;  5JEA G;  1J6Q A;  1CKN B;  4O0A A;  3F2D A;  1RIP A;  1H95 A;  2KCT A;  1C0A A;  3RLN A;  3M85 A;  1KHI A;  4A3E G;  1VS0 A;  5M5Y H;  2ZTC A;  2ZM6 L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...