4JI1L

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
124
structure length
123
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKLLGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
total genus 14
structure length 123
sequence length 124
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4ji1L00
3CCLA 4L5RC 4LF9L 3CCVA 3E9IA 1HJPA 1UEBA 2VL6A 4P73A 3K0XA 4R4QA 3K7AH 4LFCL 1GO3E 4QGUA 4A3MH 3GO5A 3RNUA 2WAQG 1PH3A 4DPGA 3CAMA 5M3MH 3ULJA 2C35B 3BJUA 2BA0A 4QQBX 3CPFA 2OCEA 5C3EG 1I50H 2ATWA 1PH1A 2ID0A 2HQLA 4IJHA 3W5OA 4AQYQ 4BXXG 3HKZE 4B3SL 1I6HH 1VQKA 4LF6L 4HIMA 4GOPC 4H02A 2I5MX 1VQLA 5FLXc 4NXNQ 4NPSA 1C0AA 4PMWA 1DGSA 4JI8Q 2KHIA 2RCNA 3A5UA 5LMUQ 4P74A 4YHHQ 4X65Q 3ULPA 2E2IH 1YI2A 2AWOA 1XNRL 4A3GH 4GN5A 2VUMH 3RR5A 1YHAA 4IOCA 4A93H 1JJCB 3JC66 4DNIA 4EX5A 1FL0A 5M3MG 3CCQA 4LUOA 1MKHA 1S40A 1YEZA 2UXCL 2YU9H 1HNWL 1PH6A 3BU2A 3K81C 4JCVE 4DUZQ 3PCOB 1Q81C 3FP9A 4A3BH 2NN6I 4GN4B 3I7FA 4GNXA 5H1SE 5IYCH 4JI6Q 4HJ9A 1LUZA 3G6EA 3J80c 1WCMG 4FDBA 4DR3L 1L1OA 4A3GG 4YY3L 2ZTDA 3UDIA 2GVBA 4UP7A 1N36Q 4A93G 1WOCA 2OQ0A 3PO3H 4GNXB 2UUCQ 4IFDI 4HJ8A 1SFOH 3UDGA 4JYAQ 5ELOA 1VQ5A 2VNUD 1CKNA 4ALPA 1X9NA 4B3TL 1L1OB 2QA4A 2DUDA 2E5LQ 3J7ZC 1YNXA 2VQEL 1RIPA 3L2PA 2Y0SG 2YTXA 4A3BG 4PG3A 2B63H 2EIFA 3CW2C 1EQRA 2IX0A 1C9OA 1I3QH 1JE5A 1X56A 1VQFA 1Y1VG 1CKNB 4AYBE 3CC4A 4LF5Q 5EAYA 2FXQA 2K5VA 2R7DA 5FJ8H 2NZOA 4LF8Q 5IYBH 5J3BA 1V1QA 1ASYA 3ZJYC 2PMZE 5BR8Q 2HHHQ 3PO3G 4B3RQ 2VQFL 1N32L 2Z6KA 2R92H 4BY1H 2AWNA 1X54A 3CF5A 1N34Q 1RL2A 3CCEA 3S16H 2QEXA 4A3JH 2E2HH 4JI5Q 4X66Q 3TS0A 4JI4L 1VQDA 1MIUA 3HOUG 1P8LA 1VQBA 2BH2A 1WFQA 5FJ8G 3GTPH 4DKAC 1YJWA 1EYGA 3F2BA 4LF9Q 1M90C 4LFCQ 1XMQQ 3HOVH 4JOIA 3ICEA 3I4NG 4WJ3M 1X3EA 1PFSA 1YHBA 4L5SA 1OXUA 2R92G 3JAMc 1IL2A 1TXYA 2LSSA 3KOJA 4A3CH 3RN2A 5C0XG 3FKIH 4LFAL 4A4IA 3KF6A 4Y7NH 1YITA 4R4TA 1Q8KA 3GTMH 3AFPA 3OTOL 2I5LX 2JA5G 4B3SQ 1K73C 2MNAA 4LF6Q 4DV4L 5E7NA 2KBNA 4LF4L 4BBRG 3CMEA 3KF6B 1Z9FA 4MNOA 1QZGA 3HOVG 1XPRA 3NEMA 3U50C 2F3IA 5K36G 4LFBL 1XNRQ 4BY7G 1G6PA 1CSQA 4GN3B 1PYBA 1SROA 3HOYH 3CPWA 4A3CG 3DLLA 1LTLA 1NMFA 3FKIG 1X3GA 2K4KA 4YCUA 3S14H 2UXCQ 1IYJB 1GD7A 4IPGA 5IP7H 1HNWQ 1H95A 3K80C 4JI2L 3M7NA 1VQPA 4R4CA 1I94Q 4K0KL 3UE0A 4HIDA 1OTCA 4Y52H 3TS2A 3GTOH 1V43A 1YBYA 3J81j 4X64L 2ASBA 3BZCA 2MFIA 4ME3A 1B7YB 1AE3A 4DR3Q 2R7ZH 4YCWA 4J15A 3L7ZC 2UXBL 4DV7L 3AEVA 4YY3Q 1D8LA 3OW2A 1PHJA 4IPHA 3JAMi 1KIXA 1PVOA 3HOYG 2K50A 1EWIA 4YWLA 4UP9A 2CWPA 2B29A 3GTJH 1KQSA 3UDXA 1E3PA 1VS0A 1WYDA 1IBML 1Y14B 4DAMA 4B3TQ 1K3RA 3GDEA 1J5EL 2VQEQ 2Q2IA 1BVSA 2Z0SA 4DV1L 1BBWA 4MTNA 2A8VA 3A74A 4PZ6A 5M5WH 4GNXC 4A3MG 5IYDH 2R7ZG 2NVXH 1JB7A 1NE3A 2IHEA 2VZAA 1UE7A 1B70B 2F4VL 2NVYH 1L1OC 2B3GA 4JI7L 4B3ML 2IX1A 1VQCA 2WAQE 1N9WA 2ZTCA 3M9BA 2JQOA 1PA6A 4UY8C 1YJNA 4JC0A 2GVAA 4DK3C 3M85A 3TEHB 2VQFQ 4DUYL 1GVPA 1SR3A 4A3IH 2GN5A 2E2JH 1PH8A 1I94L 2JK8A 1N32Q 1EOVA 2CKZB 1K83H 3Q8DA 3I56A 3PGZA 3GD7A 3EN2A 4DR5L 2VW9A 2WP8J 2PI2E 1S72A 4DK6C 1PV4A 3S2HH 4JG2A 2NVQH 4JI4Q 4OO1G 1YVCA 1E7ZA 3F2DA 1CKMA 5IYDG 4PZ7A 4KLKA 1Q82C 1CUKA 2HT1A 3HOZH 4OWXB 5LMNL 1J6QA 2VUMG 4EQ5A 1VQNA 2AMCB 4DR4L 1T9HA 1SN8A 4DAYB 2K5NA 1Q86C 1TWFH 2JA9A 3E0EA 3F8TA 4JBKA 3CCMA 4A3IG 1FGUA 2WB1G 4HJAA 1PH5A 2HIVA 2XTIA 2Z6KC 3PF4A 2JEBI 4LFAQ 1JT8A 2EQSA 4IJLA 3GTGH 5JJKA 2LXKA 3HOXH 2UXDL 1NTGA 5IYCG 4OX9L 2ZM6L 1CKOA 3OTOQ 4JI0L 1K8AC 3HOZG 4R1JA 3S17H 3EIVA 3F2CA 2BH8A 4DV4Q 3FHWA 4NXML 4LF4Q 4OWWB 4DR6L 4IO9A 2N8NA 2JA8H 1PYSB 2YV5A 2RHSB 2WFWA 5FLMH 1LYLA 3VDYA 1YZ6A 1WJJA 4JOIC 3CC2A 2ZJRA 1HZ9A 4LFBQ 2YTYA 1MJEA 1I5FA 1FJGL 1VQ8A 2RHQB 2IT1A 5M5XH 4HJ7A 2WB1E 4OWTB 2BA1A 3MEFA 3H3VH 1K0RA 1QUQA 1N33L 2B63G 1QVCA 4OONA 4LUVA 1IBLL 4JI2Q 3HOXG 1X55A 2D0OA 1BKBA 2Y0SE 4GLAC 2JA6H 3M4QA 4DR2L 1PH4A 4MZ9A 3S1RH 3S1MH 5IYBG 1PH9A 4A3DH 1EIFA 4X64Q 1QUQB 2JA8G 2KENA 2MO1A 1Q1EA 4NB3A 1E22A 3RLNA 5FLMG 1W2BA 3M4OH 2UXBQ 4DV7Q 4GS3A 4BY1G 2KHJA 3KJPA 3CD6A 1XNQL 2V1CC 1R9TH 5JJIA 2I5HA 5HGQA 4A3JG 5C4JH 4YCVA 3ER0A 2UU9L 4AH6A 2K14A 4DV2Q 2D62A 1Q7YC 1IBMQ 4KI0A 2JA6G 3RZDH 1J5EQ 2AHOB 1IBKL 3S15H 1LM0A 4A3DG 2E8GA 4DV1Q 2OQKA 3TREA 1Q46A 3NELA 3UE1A 2UUAL 2IHFA 3RLFA 4DR1L 1SLJA 2CWAA 1E1OA 4AIMA 1GKHA 4JI3L 4A3FH 1EFWA 2F4VQ 4JI7Q 1HH2P 4B3MQ 1NMGA 2VS1A 4A76A 2JEAI 2ZJQA 4DUYQ 1JJ2A 1HNZL 3NBHB 3K7UC 5IP9H 1X65A 1AE2A 5GADC 4DR5Q 2AKWB 3WWVA 1XMQL 3KLWA 2PI2A 1VQGA 3HFZB 4RMFA 3SGIA 3W1BA 4C2MH 1G51A 3T1HL 4POGA 5C0XI 4KHPL 5GROA 3STBD 3GTKH 1A62A 1XMOL 1D7QA 3GTQH 5LMNQ 1JMCA 4GLVB 4DV6L 4L5TA 4A3FG 3CCJA 2CCZA 3AYHB 4DR4Q 5C4XH 2LXJA 1N8RC 3RZOH 1HR0L 4POFA 1QVFA 1BBUA 4LW1A 3W1GA 1FVIA 4QIWE 4QY7A 3D31A 1EUJA 2N78A 5IP7G 5C3EH 4DV2L 1TWAH 4A3KH 3S1QH 1VQHA 3CC7A 1K8GA 2UUBL 3CP0A 5DLQE 4IPCA 1EQQA 1YJ9A 5IP9G 1E1TA 1M1KC 5IWAL 4IFDJ 2KCTA 1SMXA 3CCUA 1UE6A 1XJVA 2MQHA 2H5XA 3I2ZA 3PV0A 4KHZA 2UXDQ 4OX9Q 5IE8A 3I55A 2ZM6Q 4UP8A 1TWCH 4JI0Q 1HZBA 4QL5A 4JI1Q 4DV5L 2D0PA 4O2DA 4A3EH 3PUZA 1OXXK 2ZTEA 1IXRA 4HIOA 2NN6G 5C44H 3H0GH 4NXMQ 4DR6Q 1YHQA 3AQQA 1JJGA 2JA7H 5IY0A 5C4XG 1NY4A 4JV5L 2CQOA 5IT9c 1VQ7A 4QJFA 5JJLA 5GQOA 4L5QA 2K75A 2R6GA 3A0JA 4TQUS 4A3KG 3CMAA 3KJOA 4DV3L 1FJGQ 2R93H 1KL9A 1O7IA 4DR7L 2Q2HA 1VQ9A 2QGQA 1MJCA 1EIYB 1VQJA 3KYHC 4IFDG 1L2FA 1N33Q 4GKJL 3PUYA 1IBLQ 1XPOA 1UE5A 1U0LA 3M4PA 1Z47A 4DV0L 1WCMH 4IPDA 2ZJPA 5LMNW 5JEAJ 4HIKA 4DR2Q 4A3EG 4LF7L 3HOWH 5AJ3L 3U58A 4TVAB 3H0GG 5C44G 1QVGA 3G71A 2Q2UA 1XPUA 1HNXL 4BA1I 2JA7G 4GKKL 2RF4A 4YWKA 4X62L 3PUWA 5M3FH 4XTCS 1KD1C 2KCMA 3L0OA 4BA2I 2Q2TA 1UWVA 2ALYB 2K52A 2R93G 2F52A 1XNQQ 3S24A 3T1YL 1A63A 4GOPA 3ERSX 1Q1BA 3AFQA 1NBWA 4AYBG 2UU9Q 3J81c 3CCSA 1VQIA 4JI1L 4GLXA 1Y1VH 3PO2H 1OXSC 1IBKQ 4PZ8A 3HOWG 2K5HA 4C3JH 3UDFA 5M5YH 5JEAG 3CXCA 1NJIC 3S2DH 4GOPB 2MO0A 1Y1WH 2OTJA 1E24A 4XIGS 1W3SA 4DR1Q 2UUAQ 3EBEA 3G4SA 4R4IA 2CFMA 1XTDA 5M3FG 3DM3A 3CCRA 4JI3Q 3B6YA 4OO1I 4AQYL 2R7FA 1VQMA 2PQAA 1YIJA 3CQZH 1X3FA 3STBC 3U4VA 2OWOA 5ELNA 4NXNL 3F1ZA 2HIXA 1HNZQ 4LWCA 3GTLH 1TWGH 2IY5B 4JI8L 1CSPA 4HJ5A 1Q12A 3HOUH 3PSIA 3PO2G 5LMUL 1S3OA 4YHHL 4X65L 4UPAA 2JE6I 1SRUA 2PQAB 1SE8A 3T1HQ 3TRZA 3TQYA 4P71A 1U5KA 1UE1A 3LGJA 4C3HH 1Y1WG 4KHPQ 5GAGC 3I4NH 1XMOQ 4R4OA 3M3YH 2PNHA 4YWMA 3I4MH 4DUZL 4O0AA 4DV6Q 2I0QA 3KDFA 2JJQA 1GM5A 1X6OA 3PUVA 5C0XJ 1L0WA 2N3SA 4OXPA 3RN5A 1HR0Q 4APVA 3KFUA 3K8AA 2VY3A 5GAEC 1B8AA 3J81i 4X6AH 3U4ZA 3D0FA 4JI6L 2NVTH 2UUBQ 5GAHC 3IRBA 3J80i 1VQAA 1OXVA 2A1AA 3KDFB 2JA5H 5IWAQ 1KHIA 2XGTA 1N36L 2L15A 1AH9A 4BBRH 1QZHA 3I4OA 2UUCL 1KXLA 2DGYA 1HZAA 4DV5Q 4JYAL 3H15A 3S1NH 3I4MG 3NENA 4BY7H 4WJ4A 1PH7A 1VQEA 2E5LL 1KRTA 4JV5Q 1G291 3OYYA 3RLOA 2YYZA 4LUZA 2OTLA 4BBSH 3A5ZB 1TWHH 4JBJA 3BZKA 2N49A 3E9HA 1A0IA 1WI5A 4DV3Q 1C7YA 1ASZA 4LNQA 4LF5L 4DR7Q 1KAWA 1VQ4A 1K9MC 1VQ6A 3J7A5 2EXDA 4LF8L 2A19A 1VCIA 4GKJQ 1VQOA 4C3IH 5BR8L 1KC8C 2HHHL 4A3LH 3H3VI 4B3RL 3PIPA 3MXNB 1A8VA 3KF8B 1P16A 4DV0Q 1PH2A 4LF7Q 4P72A 1OXTA 3PUXA 3ULLA 4K0KQ 5HY6A 4P75A 5AJ3Q 1HR0W 1IZ6A 1HNXQ 1V9PA 1N34L 4GKKQ 4A3LG 3G48A 4X62Q 4JBMA 4JI5L 3HKZG 4X66L 4RG1A 3PF5A 1KRSA 2ES2A 4BBSG 4A75A 2YTVA 4BXXH 3HKSA 3T1YQ 2NZHA 3PIOA 4JBWA 1HZCA 4IOAA
chains in the Genus database with same CATH superfamily
2ZXRA 4L5RC 1SSOA 1UEBA 2EY2A 2O5IC 3K7AH 2F0QA 4KY7A 3Q0AA 3RNUA 3QG1A 1SDFA 3CAMA 1BQQT 4A3KB 1BNZA 1PMRA 5I4DA 3CPFA 4EVOA 4AQYQ 1PFBA 2H1EA 1I6HH 3FPPA 3QO2A 1GJXA 2DNEA 4LF6L 5CV5A 4HIMA 1VQLA 3FEWX 5FLXc 2CHBD 1C0AA 3H0GB 4PMWA 1BUVT 5LMUQ 4YHHQ 3NXWA 4X65Q 2E2IH 1FGBD 2AWOA 1YHAA 1DJRD 4LUOA 1JOKA 2F0VA 4ZYSA 3Q23A 2TMPA 4HTHA 3H91A 2YU9H 1ILQA 1HNWL 3SK8A 4AYBB 4ID6A 2B2VC 2F3WA 5ELFA 1IYUA 4JI6Q 1SYCA 4PNYA 1XTCD 4KY5A 3J80c 1DOKA 3KUPA 2RSOA 4A3GG 3DHQA 1HUMA 5M3FB 4UP7A 2BDNA 5FOBB 4IFDI 3BVGA 1DD2A 4KKUA 1O78A 1EEID 3OIQA 1DYQA 5ELOA 1JORA 2B8GA 1QE6A 5M9OA 1QILA 2F0NA 2QA4A 1A2TA 2E5LQ 4R8IA 4A3BG 1ET6A 2CW0C 4FXGC 5DEHA 2B63H 1TY0A 1S5CD 2IX0A 4AYBE 1Y1WB 1ENCA 1G91A 4J8QA 3ZJYC 4N9PA 5BR8Q 3PO3G 1JB3A 2VQFL 3I90A 2AQ3B 2SNMA 3TP7A 1N34Q 1I4XA 3S16H 2K03A 4A3JH 4QMGA 2QDBA 5CBEE 1HQMC 1MIUA 3HOUG 2BH2A 4KK7A 1BOSA 5DM63 2N88A 4DKAC 4CKEA 1BCPB 1SMYC 1EYGA 3NTHA 1X3EA 1PFSA 3C1FA 3JAMc 1IL2A 1LTRD 2NVTB 1RODA 3QJYA 4G7HC 5A2QL 4LFAL 5JVH3 4HMIA 3MXNA 1U4RA 1H9MA 2OF1A 2I5LX 1B3AA 4XQJA 2C9OA 4LF6Q 1RHPA 4XYOA 1Z9FA 1QZGA 1M4VA 1XPRA 1KABA 3NSWA 3HOVG 4DAPA 2DJGC 1ONLA 2PCFB 5G3LF 1PYBA 1SROA 3HOYH 1S5DD 3FKIG 5C4ZA 1IYJB 1HNWQ 4JI2L 4R4CA 4Y52H 3ERQA 3GTKB 3TS2A 5BN4A 1YBYA 1SE4A 4FP5D 3L9AX 4X64L 1EYAA 5IGGA 1B7YB 5C4XB 3E5SA 4H13C 4J15A 3AEVA 2EYPA 1D8LA 2NN6H 3VYSA 5FLXE 5IOCA 1PVOA 2EDGA 4FF2A 1ZYRD 3IKJA 1VS0A 1SMYD 4DAMA 1K3RA 5C3WA 1J5EL 1CZWA 1A15A 1BVSA 2EXZA 4R8NA 3A74A 1STGA 1K0SA 4LK1C 1NE3A 2Z4IA 5EKKA 1T5EA 4JI7L 5HGTA 2IX1A 1PA6A 3M9BA 2R93B 5E4WC 3J80E 2GVAA 2VQFQ 3TEHB 4RKLA 5EKIA 2WACA 5I9PA 3PGZA 4IUVA 2IPKD 3EN2A 1B53A 1NR4A 3NQIA 2E75C 1A3UA 1CT1D 2B2UA 1Q82C 3H3VC 1G2TA 4M8AA 4RKBA 3DXJC 2L4NA 2VUMG 3KLRA 1VQNA 2K5DA 1PXUA 2NTTA 4DU9A 4DAYB 4RGNA 4A3IG 1FGUA 4A3BB 2FHTA 3K6OA 3PMFA 2OEOA 4LFAQ 3RUZA 5JJKA 1SNPA 5KEEA 3HOXH 4OX9L 5A35A 2RDGA 4R1JA 1AZQA 3F2CA 4RCNA 4OWWB 1RCVD 4IO9A 3IFTA 2YV5A 2WFWA 5FLMH 1HZ9A 5FO7B 2F0WA 1MJEA 1I5FA 1VQ8A 3GTLB 2RHQB 2IT1A 3HOUB 1K0RA 4RGMA 4OONA 4JI2Q 1JE4A 1HA6A 1HA5A 3JAME 1PH4A 1LTGD 3LNNA 2KEDA 2EJFC 4X64Q 4B9XA 2E2HB 2Q8IB 3QOLA 4L63B 5ELCA 4BY1G 1EY6A 1RTOA 1L0XB 4XT1B 3RZDH 1J5EQ 2AHOB 4I7AA 3TZUA 1IBKL 3J7YW 5CV9A 1LM0A 4A3DG 2E8GA 2OQKA 2L12A 3K5NA 3V2TA 1E1OA 4A3FH 3NHHA 2LS01 5CC4A 1QNUA 4JI7Q 2MGSA 1HH2P 1NMGA 1O7LA 2RDFA 1JJ2A 1KDBA 2AKWB 2DJFC 1B3QA 4FXKC 3SGIA 1G51A 3OMGA 1HFGA 5C0XI 5GROA 3GTKH 1A62A 1ET9A 4RH6A 4TKOB 4GLVB 4L5TA 3DWAA 3W3AA 4QUCA 3RD4A 4RCOA 5C4XH 2LXJA 4RFBA 1MD2D 4LW1A 4POFA 1QVFA 1FVIA 1PRTC 4QY7A 5IP7G 3CC7A 2MP1A 3EQLC 3T53B 3CP0A 4IFDJ 5IP9G 3BVMA 2KCTA 1SMXA 3PV0A 2H5XA 4KHZA 4OX9Q 3I55A 4WFN3 4GZYC 1TWCH 3LWEA 1RJTA 2B2UC 2ZTEA 1IXRA 5IT9L 1NY4A 4JV5L 1B2TA 3P7JA 2K75A 4HSVA 1U9RA 1LTSD 2AQ2B 2KECA 2R93H 2N55A 4DR7L 1VQ9A 1MJCA 1EIYB 2F4IA 4IFDG 2NVXB 2QDLA 5J39A 3PUYA 1XPOA 2VUMB 1B1ZA 4HIKA 3MXUA 2ZJPA 4K5XA 5LMNW 5JEAJ 4A3EG 3FVQA 1CK1A 4TVAB 5I6YA 4A3IB 1QVGA 4BA1I 1XXGA 3I8ZA 4HEDA 4YWKA 1BCPF 1FD7D 1WTHA 1VF7A 2Q2TA 4XQNA 3T1YL 3ERSX 2KOLA 2P5ZX 4K6DA 1H9RA 3PO2H 1PRTD 1IBKQ 4PZ8A 3HOWG 1SFOB 5JEAG 3S2DH 2MPMA 2HCIA 3C1EA 1O80A 1LABA 3EBEA 2HD3A 2CFMA 3CCRA 1VQMA 2D9UA 1LTTD 3K5MA 1HXYD 4LWCA 3GTLH 1TWGH 4JI8L 4HJ5A 3HOUH 3HP3A 3PSIA 4ZRZA 1BXTA 4ABNA 4H0LC 1SE8A 4C3JG 5IGBA 4UAIA 1UE1A 4Q0FA 4BY1B 5GAGC 1C4QA 3TN2A 5M5XB 3M3YH 4DN4M 1Y8NB 4DUZL 5I9OA 4L6TB 3PUVA 2CH4A 2IWHA 3K8AA 3J81i 4A3DB 3D0FA 3J80i 1VQAA 1OXVA 2A1AA 3KDFB 4PMCA 4TRDA 3ONAB 3AB9A 4K5VA 1PTOC 4QIWB 1KXLA 1SYBA 1HZAA 1FNUA 2EPBA 3I4MG 3NENA 4WJ4A 1D5MC 4JV5Q 2IX3A 3OYYA 2OTLA 4JBJA 2SNSA 4FVMA 3E9HA 5LL6S 4DR7Q 1VQ6A 3K59A 4ZAIA 4LF8L 3VYUA 1K8MA 2EYFA 1KC8C 3N6RA 3MXNB 1A8VA 4K8JA 1PH2A 4P72A 3ULLA 4F7XA 5HY6A 5I2YA 1IZ6A 3SEBA 4RG1A 1LT4D 3GTOB 5LL6X 2CH4W 3HKSA 1V1PA 2NZHA 3PIOA 4JBWA 3T1YQ 1HQRD 3QR8A 1RKNA 3CCLA 1SNOA 1QNKA 4LF9L 3CCVA 3EVQA 4LFCL 2VL6A 1GO3E 3RZOB 3E3XA 3OHXC 1KDCA 3BYYB 4QQBX 2BA0A 3V05A 2ATWA 1PH1A 1MHWC 1PTOD 2ID0A 3LWUA 3SK5A 4BXXG 4IUQA 1VQKA 2IJ0A 2NBFA 4A3EB 1SBBB 4NPSA 2NVYB 3HG9A 4JI8Q 1DGSA 2KHIA 5IIFA 3KK7A 4P74A 1F2LA 4MIUA 1EYDA 2VUMH 3RR5A 2E2JB 1JJCB 3JC66 3TP5A 4EX5A 5M3MG 3CCQA 1CQFA 1S40A 3SHLA 2UXCL 3EA6A 1PH6A 4JCVE 3K81C 4DUZQ 3CRLC 4KTAA 1DOMA 1Q81C 3FP9A 5IGEA 1T5XD 3HOZB 4WORA 5KNDA 3HOWB 4GNXA 5C3XA 4ZUJA 4HJ9A 3ITPA 4FDBA 1EWCA 2F0GA 1L1OA 4YY3L 2ZTDA 4IQZA 3UDIA 4A93G 1WOCA 2O2LD 1B44D 2NYZD 1SFOH 3KLSA 3OWEB 1CKNA 4B3TL 3T51B 2DUDA 1RIPA 2YTXA 4PG3A 3S17B 3UI2A 3CW2C 1HRJA 1E2VA 1C9OA 4XYQA 5J1ZA 2JN4A 2FXQA 5EAYA 1ILPA 2NZOA 2J7ZA 4NMZA 4LF8Q 1V1QA 1DZ1A 1ASYA 2PMZE 1C48A 5KNBA 3I4LA 1SJED 1TS3A 1GOZA 4CKBA 4BY1H 2V4DA 2EYOA 4L8JA 3S1MB 2FMMA 1VQDA 2A68C 1WFQA 5FJ8G 2FINB 2Z9HA 4NKLA 3F2BA 4LF9Q 3I4MB 3EFXD 4UHVA 4LFCQ 2KJXA 1R9TB 3I4NG 2B2TC 3TMEA 1TIID 1YHBA 1I4QA 3A8JE 2R92G 1Z6HA 2LSSA 3KOJA 1A6XA 5C0XG 1PLFA 4A4IA 1YITA 1H9SB 3GTMH 3OTOL 2K6AA 2L9HA 3MAQA 3SE0A 4YIJA 4BBRG 3KF6B 3CMEA 3GP7A 4UDUC 4HSPA 4ME5A 2MUYA 3NEMA 3U50C 1JQYD 5K36G 4LFBL 1CSQA 2X6GA 1ZXTA 5CYUA 2EOTA 3R2TA 2PYKA 3CPWA 4A3CG 1STHA 1LTLA 2VB3X 1X3GA 3BS1A 2UXCQ 5IP7H 4KKSA 2SDFA 1VQPA 1I94Q 4HIDA 3ND8A 5JPNC 1KAAA 1X3PA 2IL8A 3GTOH 1V43A 5EBCA 2EE1A 3MHBA 5CGKA 3I3CA 3NWSA 4I65A 5EQ0A 3L7ZC 4S3SA 4X3UA 2UXBL 1SYFA 4YY3Q 1PHJA 4IPHA 1MI2A 1SAPA 3S1QB 1NAPA 1TS4A 2A68D 2K50A 4YWLA 4UP9A 2B29A 3AU7A 1HPCA 3UDXA 1WYDA 4N8X1 3WOEA 4B3TQ 3BZDB 5EBDA 2WINB 1KLUD 1PZKD 4DV1L 1B4OA 1BBWA 4MTNA 5M5WH 5C44B 4OO1H 4GNXC 5M3MB 3L3OC 4A3MG 2R7ZG 1JB7A 1UE7A 1B70B 2NVYH 1L1OC 1I50B 1VQCA 1FR3A 2ICIA 4UY8C 2JQOA 2J0TD 4DK3C 2E2JH 1EOVA 4DR5L 1RD9D 1S72A 2WP8J 4DK6C 1PV4A 4LJZC 2GA4B 3D8GA 4OEMB 5T1GA 1E7ZA 3F2DA 5IYDG 2HT1A 1Y8PB 3HOZH 5LMNL 4CDEC 5L37A 1SN8A 4O1NA 1IKLA 1DM0B 1Q86C 3QOJA 1TWFH 3F8TA 3CCMA 1PH5A 4HJAA 2CQAA 1I4RA 1D5ZC 2XTIA 3HRZC 2XWJB 2EQSA 1TT2A 1F9RA 4F87A 4HR7B 2WIIB 1CKOA 3OTOQ 4JI0L 3SR1A 3S17H 1F9SA 3EIVA 2JA8H 1PYSB 2BDOA 2HCCA 3D4WA 4C1NI 1LYLA 5CBAE 3U9SA 4X3KA 4LFBQ 3DUZA 3M4YA 2YTYA 4FF1A 1I3QB 3I72A 1QUQA 1QVCA 3SVMA 2MHVA 2F0SA 3MA2B 5K5PA 4DA2A 4DR2L 4MZ9A 1ZYRC 3S1RH 3I4NB 1PH9A 3S1MH 5A2QE 1CHPD 1EIFA 4C1NK 2MO1A 5DM73 5CR3A 1F77A 2UXBQ 3HEJA 4GS3A 2R3ZA 2KHJA 2V1CC 1R9TH 5C4JH 1EY9A 3ER0A 3X3NA 4AH6A 2D62A 1Q7YC 3M7GA 4BBRB 2JA6G 1PFMA 2BE5D 3NK9A 3S15H 2NB0A 5BN3A 4DV1Q 1EY0A 3S1NB 1EYCA 4IURA 3TREA 3UE1A 2UUAL 3RLFA 3VA5A 4EQOA 4AIMA 1EFWA 1TWHB 1YNND 2JXMB 3SK6A 4A76A 2NWGA 4HN7A 2JEAI 4PV1C 1HNZL 3NBHB 3I70A 1TR5A 4DR5Q 2PI2A 3HFZB 3W1BA 3T1HL 3T16A 4POGA 1HCZA 4KHPL 3Q24A 1D7QA 4J1MA 5LMNQ 4E6IA 4DFAA 2KVMA 1XWEA 1BBUA 1EZ8A 3S2HB 4A3KH 3S1QH 1VQHA 1SXTA 3V96A 4DK1A 1G8ZD 1M1KC 3MXPA 4A3MB 3VYRA 3CCUA 1UE6A 4B9WA 1XJVA 1H9JA 1HUNA 4JI0Q 1HZBA 4QL5A 4JI1Q 1QG7A 3PUZA 1OXXK 1PDQA 3H0GH 5C44H 1II3A 1F2ZA 5IT9c 1SNDA 1BDOA 4QJFA 5JJLA 1TU2B 3KJOA 4OHJA 1O7IA 2QGQA 3VR6A 3KYHC 2B2WA 5D65A 4GKJL 4A3GB 1UE5A 3DMUA 5D3DA 1Z47A 4DR2Q 4KN7C 1D1IA 1EOTA 5AJ3L 3FPUB 2M00A 2KHSA 3T13A 1QJOA 3K5LA 2Q2UA 2JA7G 1HFNA 4GKKL 4X62L 1WD1A 3PUWA 5M3FH 4XTCS 2KCMA 4RHRA 2F52A 4GOPA 1GUTA 3J81L 1VMPA 4WRDA 3CCSA 5EGTA 1VQIA 2PZUA 3PO3B 1NJIC 5JPMC 3OOCA 5JVG3 1Y1WH 2OTJA 1E24A 2RQXA 2RSNA 1WTVA 2UUAQ 2F0OA 1GUSA 3DM3A 2EJGC 3B6YA 2R7FA 1J8IA 2PQAA 3NQTA 1X3FA 3U4VA 4CKCA 2EY5A 2OWOA 4NXNL 2I07B 1HNZQ 3DWQA 3QIAA 2QILA 1V8QA 4U68A 1TVXA 1SRUA 2JE6I 4LAAA 1EY4A 4O42A 1SNMA 3T1HQ 1U5KA 3LGJA 3R2IA 4KHPQ 3I4NH 3U9OA 2JJQA 2XNAC 5J22A 2IW3A 4APVA 5C0XH 2F0EA 2A6HC 3RN5A 2VY3A 4FNFA 4HMJA 2RVLA 2NVTH 5GAHC 3HOVB 1KHIA 4G57A 2LKVA 3TZDA 1GUOA 2EY1A 1N36L 4BBRH 4C3HG 2K5WA 2DGYA 4JYAL 3FKIB 3H15A 3S1NH 4Y7NB 1PH7A 1CFMA 3WDNA 3GQBA 5KRUA 1TWHH 2N49A 1A0IA 1QCBD 1WI5A 1C7YA 1ASZA 2KCCA 2H4OA 4I7ZC 1K9MC 3NUCA 4GKJQ 1VQOA 3HS0C 2HDMA 1EZ6A 2HHHL 4ZQ3A 3KF8B 2A6EC 1PFNA 5AJ3Q 2PPBC 1JWUD 1HR0W 1Y8OB 2EYMA 4GKKQ 4X62Q 2EVBA 4JBMA 3OIPA 4BBSG 1KRSA 1RDPD 2YTVA 2JSOA 5IT9E 1EU4A 3S2HH 2B2WC 1SE2A 3MFYA 3E9IA 4C3IG 3IL8A 2L1BA 4P73A 3K0XA 4A3MH 4A3LG 2A6HD 4QGUA 2WAQG 1PH3A 1SNQA 1ESFA 4DPGA 3DEOA 3ULJA 4IALA 3OW7A 1ZEQX 1KTKA 2C35B 3BJUA 2OCEA 5C3EG 1QB5D 2MJ8A 2HQLA 4NW2A 3HKZE 3NTKA 4B3SL 2WKDA 4H02A 2I5MX 4GOPC 4NXNQ 5FO9B 3CHBD 5C4HA 2RCNA 2JA7B 1E2ZA 1S5BD 3ULPA 1HTPA 1EWHA 2KEEA 1YI2A 4A3GH 4GN5A 2LY7A 4IOCA 3KBXA 4DNIA 3MVVA 1MKHA 2XN9C 3BU2A 3PCOB 5EPJA 2A6ED 2F0HA 4A3BH 1AZPA 3MZ5A 4GN4B 3I7FA 5H1SE 1K8OA 1O7YA 1LUZA 2FFKB 1I4HA 3VR5A 3G6EA 4DR3L 2F0MA 5G3LD 3NP8A 1N36Q 1K28A 5E4XA 1CI3M 2JYOA 3NE5B 5KIXA 1VF5C 3PO3H 2D2CC 4HJ8A 3D3RA 4JYAQ 2A5HA 2VNUD 2PNRC 4ALPA 1FYCA 1X9NA 1JOQA 2VQEL 3L2PA 2Y0SG 1TKWB 2XWBB 2EIFA 1LV9A 2HDLA 1JE5A 3TSSA 4RGTA 1Q8IA 2B2YA 2HHHQ 3DEPA 4CJ2C 2C5CA 4CGYB 2Z6KA 1X54A 3CF5A 5FKAC 2QEXA 5C5LA 2E2HH 1ENFA 4JI4L 4C3HB 3R8BA 3M4OB 1WTOA 2F0TA 1DCZA 5EJWA 1M90C 1CA5A 1KLGD 3HOVH 3ICEA 1WD0A 2G9HD 4L5SA 4HCEA 1OXUA 2K1BA 1TXYA 3FKIH 5IGCA 2DY7A 4Y7NH 2NZ1D 1Q8KA 5T1IA 1YNJC 1D5XC 4JPBW 1IKMA 3AFPA 3D4DA 3FDTA 2JA5G 4B3SQ 2K28A 1DONA 4DV4L 3ND9A 2KBNA 4LF4L 2B2TA 4CDDC 3S9WA 2EYJA 2O4XA 3A8IE 4GN3B 1CA6A 1GD7A 4IPGA 1H95A 3K80C 3M7NA 1OTCA 3W2DA 1DOLA 1WTQA 3GTQB 4BS9A 3J81j 1LT3D 5JJZA 3BZCA 2MFIA 3G6JB 4DR3Q 1EIHA 4DV7L 5C3EB 4EQNA 3JAMi 3HOYG 5TSSA 1NSNS 5KGUA 1QWYA 1Y14B 3GDEA 3NWTA 2VQEQ 2Z0SA 2A8VA 3A8KE 3QB3A 1EY5A 2NVXH 2XVSA 2X69A 2VZAA 1BR9A 1YNJD 1F9QA 1ICWA 4B3ML 2WAQE 1YJNA 4JC0A 3M85A 1STBA 2VB2X 2K7VA 1SR3A 4A3IH 2GN5A 3BDCA 1I94L 2JK8A 3ZYYX 4ZKCB 3Q8DA 3LX0A 4KJNA 2PI2E 1EQTA 4IUUA 2PMZB 1PRTB 4DAYA 4JG2A 4JI4Q 1B50A 1CUKA 4OWXB 1CM9A 3CU7A 2G5DA 2DN8A 4DR4L 1T9HA 4FYDA 3HZXA 1A3VA 2B2YC 2K5NA 2X6LA 3E0EA 2Y0SB 1VDZA 3BYTB 3I91A 5IGDA 2HIVA 2Z6KC 4IUTA 2JEBI 4IJLA 1BCPC 2LXKA 4C3JB 2UXDL 1NTGA 1STNA 5IYCG 2AQ1B 1SYDA 2BOSA 4CBVA 5CORA 4DV4Q 4NXML 4DR6L 3FHWA 4LF4Q 1W6KA 4FF4A 3GV3A 3CQZB 3CC2A 4DGZA 1FJGL 5C6AA 1SJHD 3WOFA 5M5XH 2WB1E 4OWTB 2BA1A 3MEFA 3TDQA 3H3VH 1IBLL 3HOXG 1X55A 2D0OA 2Y0SE 3C2PA 5ELEA 3X3MA 1KDAA 4A3DH 5IYBG 1KNEA 4OIJA 4NB3A 1E22A 3RLNA 5FLMG 3M4OH 3VR3A 3S16B 3F2UA 4DV7Q 2HQEA 1GUWA 1HHVA 5JJIA 1NCVA 2I5HA 4IUNA 5HGQA 2JA5B 1GHJA 4FO2A 2UU9L 4DV2Q 2K14A 1NNXA 1EL0A 4KI0A 4CDFC 2QEJC 1EY8A 1UEAB 1VMCA 2K01A 1SE3A 3D6WA 3NELA 4DXGA 4DR1L 2RBMA 4ZUIA 1BCPD 4V0BA 2PW7A 4JI3L 2HUGA 4B3MQ 3P20A 2VS1A 2AUJD 4ILWA 5IP9H 5GADC 3WWVA 1VQGA 4RMFA 5D3IB 3STBD 2LFNA 2F0JA 3GTQH 4A3FG 4JK1C 2CCZA 4KD3A 4OGQC 4DR4Q 1N8RC 3RZOH 1HR0L 1PTOB 1U4PA 3W1GA 5C3EH 1EUJA 2N78A 1A2UA 1SYGA 1JICA 5ISRA 4IPCA 4FF3A 1YJ9A 5IWAL 4IFDH 1JR0D 4RGOS 2A74C 1S4ZA 3I2ZA 2UXDQ 2KA7A 5IE8A 1ESRA 4UP8A 4CJ1B 1ML0D 4DV5L 2D0PA 4O2DA 4A3EH 1G2SA 4HIOA 3TP8A 4U673 4NXMQ 1JJGA 4DR6Q 3AQQA 4OL7A 3VA7A 1CZGA 5C4XG 1VQ7A 2O5JC 5GQOA 4L5QA 2R6GA 4TQUS 3DWPA 4K2LA 4DV3L 1FJGQ 4DF7A 2Z4HA 3IAYA 2F0KA 2ICEC 1L2FA 5CMDA 1W6JA 1IBLQ 1IL8A 4A93B 1U0LA 3M4PA 3IFDA 2B39A 4IPDA 5CV7A 4K0KL 3A7LA 3GV6A 2ZXPA 3HOWH 5JEAH 4K2KA 3U58A 3G71A 3SXHA 1Q3LA 2BE5C 5COYA 2EYHA 1KD1C 1UWVA 2K52A 2R93G 3R3OA 3AFQA 1NBWA 5KYIA 2UU9Q 1NR2A 2Q8TA 5D14A 3J81c 1YNNC 4NP5A 4JI1L 4GLXA 3K0YA 2K04A 4C3JH 2F1MA 5KNCA 4DNTB 2K05A 1W3SA 4DR1Q 3H6MA 2F0LA 5AFWA 3T56B 4MHEA 4JI3Q 3C46A 4OO1I 3HOXB 1YIJA 1TQOA 3CQZH 5F2DA 1WTWA 1MSHA 5ELNA 4G7ZC 4QCLA 1EEFD 2IY5B 3PO2G 4IUPA 4UPAA 4KMUC 3TQYA 4CJ0B 2R92B 1KNAA 1TS2A 2LMCB 2PNHA 3N52A 3I4MH 4O0AA 1XX8A 3KDFA 5JOBA 1GM5A 1HTLD 1X6OA 1U4MA 1HR0Q 5GAEC 2FJ2A 1LLRD 1B8AA 4X6AH 3GTPB 3SDZA 2SEBD 3BVZA 1AW7A 3IRBA 1STAA 2JA5H 1SEBD 1WTXA 2Z1CA 5IWAQ 3URYA 2L15A 1AH9A 3MC0B 1Y69U 3I4OA 2UUCL 4DV5Q 2WV6D 1J9OA 3RZDB 4H44C 4LUZA 1F2YA 3BZKA 2BCOA 2E2DC 4DV3Q 1C8CA 4LNQA 4LF5L 2ENBA 3J7A5 5E3FA 2EXDA 1D1KA 4A3FB 1F2MA 4B3RL 3PIPA 1F9PA 4M1UB 4K0KQ 3D4RA 2CW0D 1OXTA 1PRTF 3PUXA 3S14B 4P75A 2EJMA 2E74C 3OSOA 4JI5L 3HKZG 4X66L 2ES2A 1JWSD 1PTOH 2XIWA 2F0PA 4BXXH 1PZID 3G7LA 2R7ZB 1HZCA 2OT2A 4X3TA 4IOAA 3EJIA 1HJPA 4RWSC 4R4QA 1XMQL 3GO5A 3PIO3 3I73A 5CV4A 3GTJB 1RTNA 3NPPA 1V1PB 3Q22A 5M3MH 3C3LA 3K5OA 4J6HA 1I50H 3A54A 3MFGA 4IJHA 2Z6BA 3W5OA 3A7AB 4PMBA 5FLXL 1TWCB 5JAVA 3E6ZX 3A5UA 5I2XA 1XNRL 4P2CB 4A93H 3J81E 1FL0A 2B8FA 1YEZA 3K58A 1K83B 5ELDA 4ZLTF 4CHTB 1I6VC 2NVQB 2K5QA 4K5WA 2NN6I 4C56C 1MSGA 5IYCH 3J80L 4BWGB 5E1FA 1WCMG 3OWFA 4N9TA 4IZ8A 2GVBA 2OQ0A 1V1OA 4GNXB 2UUCQ 3UDGA 3OMCA 3GTGB 1VQ5A 2F0UA 1L1OB 3J7ZC 1S5FD 1YNXA 3TP6A 3PO2B 1EQRA 3S2DB 1I3QH 1X56A 1Y1VG 1VQFA 3CC4A 1CKNB 4LF5Q 2SOBA 2K5VA 2R7DA 5FJ8H 5IYBH 3BDOA 5J3BA 2F03A 2ZXOA 2EYLA 4B3RQ 2KUMA 1N32L 2R92H 2AWNA 1TWGB 1RL2A 3CCEA 2JA6B 3VR4A 3MEHA 4X66Q 4JI5Q 3TS0A 4ZKBB 3OPOA 1R4QB 1PTOF 2CVRA 3MTSA 1P8LA 1VQBA 3RMHA 2QCPX 1WVLA 1D2BA 3GTPH 3M3YB 1YJWA 5CV8A 1ICFB 1XMQQ 1H9SA 4JOIA 1UNSA 1MGSA 4WJ3M 5K36H 1SNCA 3JAML 1NUCA 4XXEA 4A3CH 3RN2A 2F0FA 3KF6A 4R4TA 4K8IA 3FRPB 5KYLA 4JW0A 1K73C 2MNAA 2XRQD 5E7NA 4CDCC 1LT6D 1BBXC 4MNOA 2F3IA 1XNRQ 1S5ED 4BY7G 1G6PA 3HKZB 3DLLA 4PQXA 1B9NA 1NMFA 4Z9CB 2K4KA 4YCUA 3S14H 4KD4A 5ELBA 1GUNA 4C2MB 3UE0A 4XT3B 2NTSA 3P75A 2M9VA 1CQVA 3R93A 1JOOA 2J4XA 2ASBA 1Q90A 4ME3A 1AE3A 2R7ZH 4YCWA 5EKLA 3FMCA 4ZCKA 3OW2A 1KIXA 1TWAB 1EWIA 2CWPA 3BDLA 4OELB 3GTJH 1KQSA 1E3PA 4RA8A 4F8MA 1IBML 5FO8B 2QF7A 3E0JA 2AUKA 2Q2IA 4PZ6A 5IYDH 1LTBD 4WJWA 2IHEA 2F4VL 2B3GA 4H7BA 4G4KA 1N9WA 2ZTCA 4DK0A 4DUYL 1GVPA 1PH8A 1LACA 4RAUC 1N32Q 2CKZB 3J7AV 1K83H 3I56A 1JWMD 3GD7A 2A73B 2VW9A 1EU3A 1WCMB 4X3SA 1MBYA 2PW5A 2EZVA 4V190 2NUCA 2NVQH 3SK4A 4OO1G 2E76C 1YVCA 4JVZA 1ZKOA 4KN4C 1CKMA 4PZ7A 4KLKA 2A69C 4B08A 1H9KA 1I4GA 1J6QA 4EQ5A 2AMCB 5C5MA 1I4PA 2JA9A 4JBKA 3DM1A 2L5TA 2WB1G 1L0YB 3PF4A 1JC7A 4OIKA 1Y1VB 4MTKA 1JT8A 3GTGH 5M5YB 2ZM6L 1TY2A 2F0IA 1K8AC 3HOZG 1EQVA 1D6EC 2BH8A 2R61A 1A3TA 2N8NA 1RF2D 2VXWA 2RHSB 4TSSA 2PQEA 2G9DA 3VDYA 1WJJA 1YZ6A 2K33A 4JOIC 1DXMA 2ZJRA 5FK9C 2D5DA 2XRSD 2ZT9C 3BG3A 4HJ7A 1E0BA 4IN3A 1N33L 1LO5D 2B63G 4LUVA 3O13A 1WTRA 1TS5A 1BKBA 4GLAC 4KHVA 2JA6H 3M4QA 4ULLA 2QKIC 1AN8A 4LMQD 4HCSA 1QUQB 2JA8G 2KENA 1Q1EA 1BO0A 1W2BA 1XYIA 2PO4A 4EQPA 1STEA 5HURA 1IHZA 3KJPA 3CD6A 1XNQL 2A69D 4A3JG 2RDHA 4YCVA 3PQIA 1IBMQ 3VYTA 3T4AC 4KV6A 1B9MA 4QUFA 4MN3A 4BY7B 1Q46A 4FXDA 2IHFA 1SLJA 1UAPA 2CWAA 3NBHA 4XQQA 1GXDC 1GKHA 4HAEA 2F4VQ 4BBSB 5NUCA 1STYA 3GTMB 2Q8RE 4XDXA 2ZJQA 4RHSA 4DUYQ 3MXGA 1R4PB 3K7UC 5CV6A 2L11A 4R9WA 2KCNA 4C3IB 1X65A 1AE2A 1BF4A 1IYVA 2WAQB 3KLWA 4C2MH 4F88A 1G6ZA 3D6CA 1XMOL 2PZWA 4DAVA 4DV6L 1JMCA 3CCJA 3EROA 4QB4A 3AYHB 3CRKC 1WTPA 3PIP3 3MWYW 4QIWE 3D31A 4DV2L 3QWNA 1TWAH 1UUPA 2M2LA 1AEXA 1K8GA 4ODGA 2UUBL 5DLQE 1EQQA 2RKSA 1E1TA 3K7AB 3NTIA 2MQHA 2DY8A 2ZM6Q 4DNRB 4K14A 2Z8LA 2NN6G 2EY6A 1YHQA 2JP1A 2JA7H 5IY0A 2CQOA 1OO9B 1I6HB 5IODA 3A0JA 1X3QA 4A3KG 3CMAA 4KJOA 1IW7C 1KL9A 3AMUA 2Q2HA 5M5WB 1Z7TA 1VQJA 3H09A 2E2IB 3Q6SA 1N33Q 2QW7A 2DNCA 2PZTA 4DV0L 1WCMH 4LF7L 3KBGA 4KKTA 2YU9B 5C44G 3H0GG 2KQ3A 5EPKA 1CTMA 1XPUA 2WB1B 5EPLA 1HNXL 2RF4A 1JCKB 4BA2I 3L0OA 4Q5VA 1AFPA 2ALYB 2L55A 1XNQQ 3S24A 2I46A 1A63A 1Q1BA 4AYBG 2WKCA 2L0CA 3H94A 1Y1VH 1OXSC 2K5HA 3UDFA 5M5YH 3CXCA 1TWFB 3J7AF 5I6WA 4GOPB 2MO0A 3VR2A 5LHY1 4XIGS 3G4SA 4R4IA 1XTDA 5M3FG 3HGBA 2B63B 4AQYL 3A56A 5DAUA 5BN5A 2B2VA 1PYWD 3STBC 1M8AA 4EGVA 3F1ZA 2HIXA 2OXPA 1CSPA 3P1HA 1Q12A 2JA8B 5LMUL 1S3OA 4YHHL 4X65L 4G7OC 1ENAA 2PQAB 2F3VA 2XSCA 1IW7D 3TRZA 1Y1WG 4P71A 4C3HH 3K57A 1XMOQ 4R4OA 5IGFA 4A3JB 4QF4A 4YWMA 1K3BC 4DV6Q 2I0QA 1CHQD 1PZJD 4ZK9B 5C0XJ 1L0WA 2N3SA 4OXPA 3KFUA 4KY6A 1SYEA 3S1RB 3U4ZA 4JI6L 2UUBQ 2RCFA 3KLSX 1EY7A 3CKIB 3NBIA 1AP0A 1U4LA 2XGTA 2FMCA 4NDXA 1QZHA 4K6LA 2F0DA 4BY7H 5C4JB 1VQEA 2E5LL 1KRTA 1E2WA 1G291 5DNFA 3A55A 4DXFA 3RLOA 2YYZA 4BBSH 3A5ZB 3TBIB 1GUGA 3S15B 3KF8A 1KAWA 1VQ4A 2A19A 1VCIA 1GHKA 1EFID 4C3IH 5BR8L 4A3LH 3H3VI 1FNVA 1O7ZA 4DV0Q 3HOYB 1P16A 4LF7Q 4N8FA 1LTAD 2K32A 1HNXQ 1V9PA 1N34L 1LTID 1EIGA 3G48A 1QOHA 2RA4A 1LT5D 3PF5A 4A75A 1X32A 1FNWA 2TSSA
chains in the Genus database with same CATH topology
3CCLA 4L5RC 4LF9L 3CCVA 3E9IA 1HJPA 1UEBA 2VL6A 4P73A 3K0XA 4R4QA 3K7AH 4LFCL 1GO3E 4QGUA 4A3MH 3GO5A 3RNUA 2WAQG 1PH3A 4DPGA 3CAMA 5M3MH 3ULJA 2C35B 3BJUA 2BA0A 4QQBX 3CPFA 2OCEA 5C3EG 1I50H 2ATWA 1PH1A 2ID0A 2HQLA 4IJHA 3W5OA 4AQYQ 4BXXG 3HKZE 4B3SL 1I6HH 1VQKA 4LF6L 4HIMA 4GOPC 4H02A 2I5MX 1VQLA 5FLXc 4NXNQ 4NPSA 1C0AA 4PMWA 1DGSA 4JI8Q 2KHIA 2RCNA 3A5UA 5LMUQ 4P74A 4YHHQ 4X65Q 3ULPA 2E2IH 1YI2A 2AWOA 1XNRL 4A3GH 4GN5A 2VUMH 3RR5A 1YHAA 4IOCA 4A93H 1JJCB 3JC66 4DNIA 4EX5A 1FL0A 5M3MG 3CCQA 4LUOA 1MKHA 1S40A 1YEZA 2UXCL 2YU9H 1HNWL 1PH6A 3BU2A 3K81C 4JCVE 4DUZQ 3PCOB 1Q81C 3FP9A 4A3BH 2NN6I 4GN4B 3I7FA 4GNXA 5H1SE 5IYCH 4JI6Q 4HJ9A 1LUZA 3G6EA 3J80c 1WCMG 4FDBA 4DR3L 1L1OA 4A3GG 4YY3L 2ZTDA 3UDIA 2GVBA 4UP7A 1N36Q 4A93G 1WOCA 2OQ0A 3PO3H 4GNXB 2UUCQ 4IFDI 4HJ8A 1SFOH 3UDGA 4JYAQ 5ELOA 1VQ5A 2VNUD 1CKNA 4ALPA 1X9NA 4B3TL 1L1OB 2QA4A 2DUDA 2E5LQ 3J7ZC 1YNXA 2VQEL 1RIPA 3L2PA 2Y0SG 2YTXA 4A3BG 4PG3A 2B63H 2EIFA 3CW2C 1EQRA 2IX0A 1C9OA 1I3QH 1JE5A 1X56A 1VQFA 1Y1VG 1CKNB 4AYBE 3CC4A 4LF5Q 5EAYA 2FXQA 2K5VA 2R7DA 5FJ8H 2NZOA 4LF8Q 5IYBH 5J3BA 1V1QA 1ASYA 3ZJYC 2PMZE 5BR8Q 2HHHQ 3PO3G 4B3RQ 2VQFL 1N32L 2Z6KA 2R92H 4BY1H 2AWNA 1X54A 3CF5A 1N34Q 1RL2A 3CCEA 3S16H 2QEXA 4A3JH 2E2HH 4JI5Q 4X66Q 3TS0A 4JI4L 1VQDA 1MIUA 3HOUG 1P8LA 1VQBA 2BH2A 1WFQA 5FJ8G 3GTPH 4DKAC 1YJWA 1EYGA 3F2BA 4LF9Q 1M90C 4LFCQ 1XMQQ 3HOVH 4JOIA 3ICEA 3I4NG 4WJ3M 1X3EA 1PFSA 1YHBA 4L5SA 1OXUA 2R92G 3JAMc 1IL2A 1TXYA 2LSSA 3KOJA 4A3CH 3RN2A 5C0XG 3FKIH 4LFAL 4A4IA 3KF6A 4Y7NH 1YITA 4R4TA 1Q8KA 3GTMH 3AFPA 3OTOL 2I5LX 2JA5G 4B3SQ 1K73C 2MNAA 4LF6Q 4DV4L 5E7NA 2KBNA 4LF4L 4BBRG 3CMEA 3KF6B 1Z9FA 4MNOA 1QZGA 3HOVG 1XPRA 3NEMA 3U50C 2F3IA 5K36G 4LFBL 1XNRQ 4BY7G 1G6PA 1CSQA 4GN3B 1PYBA 1SROA 3HOYH 3CPWA 4A3CG 3DLLA 1LTLA 1NMFA 3FKIG 1X3GA 2K4KA 4YCUA 3S14H 2UXCQ 1IYJB 1GD7A 4IPGA 5IP7H 1HNWQ 1H95A 3K80C 4JI2L 3M7NA 1VQPA 4R4CA 1I94Q 4K0KL 3UE0A 4HIDA 1OTCA 4Y52H 3TS2A 3GTOH 1V43A 1YBYA 3J81j 4X64L 2ASBA 3BZCA 2MFIA 4ME3A 1B7YB 1AE3A 4DR3Q 2R7ZH 4YCWA 4J15A 3L7ZC 2UXBL 4DV7L 3AEVA 4YY3Q 1D8LA 3OW2A 1PHJA 4IPHA 3JAMi 1KIXA 1PVOA 3HOYG 2K50A 1EWIA 4YWLA 4UP9A 2CWPA 2B29A 3GTJH 1KQSA 3UDXA 1E3PA 1VS0A 1WYDA 1IBML 1Y14B 4DAMA 4B3TQ 1K3RA 3GDEA 1J5EL 2VQEQ 2Q2IA 1BVSA 2Z0SA 4DV1L 1BBWA 4MTNA 2A8VA 3A74A 4PZ6A 5M5WH 4GNXC 4A3MG 5IYDH 2R7ZG 2NVXH 1JB7A 1NE3A 2IHEA 2VZAA 1UE7A 1B70B 2F4VL 2NVYH 1L1OC 2B3GA 4JI7L 4B3ML 2IX1A 1VQCA 2WAQE 1N9WA 2ZTCA 3M9BA 2JQOA 1PA6A 4UY8C 1YJNA 4JC0A 2GVAA 4DK3C 3M85A 3TEHB 2VQFQ 4DUYL 1GVPA 1SR3A 4A3IH 2GN5A 2E2JH 1PH8A 1I94L 2JK8A 1N32Q 1EOVA 2CKZB 1K83H 3Q8DA 3I56A 3PGZA 3GD7A 3EN2A 4DR5L 2VW9A 2WP8J 2PI2E 1S72A 4DK6C 1PV4A 3S2HH 4JG2A 2NVQH 4JI4Q 4OO1G 1YVCA 1E7ZA 3F2DA 1CKMA 5IYDG 4PZ7A 4KLKA 1Q82C 1CUKA 2HT1A 3HOZH 4OWXB 5LMNL 1J6QA 2VUMG 4EQ5A 1VQNA 2AMCB 4DR4L 1T9HA 1SN8A 4DAYB 2K5NA 1Q86C 1TWFH 2JA9A 3E0EA 3F8TA 4JBKA 3CCMA 4A3IG 1FGUA 2WB1G 4HJAA 1PH5A 2HIVA 2XTIA 2Z6KC 3PF4A 2JEBI 4LFAQ 1JT8A 2EQSA 4IJLA 3GTGH 5JJKA 2LXKA 3HOXH 2UXDL 1NTGA 5IYCG 4OX9L 2ZM6L 1CKOA 3OTOQ 4JI0L 1K8AC 3HOZG 4R1JA 3S17H 3EIVA 3F2CA 2BH8A 4DV4Q 3FHWA 4NXML 4LF4Q 4OWWB 4DR6L 4IO9A 2N8NA 2JA8H 1PYSB 2YV5A 2RHSB 2WFWA 5FLMH 1LYLA 3VDYA 1YZ6A 1WJJA 4JOIC 3CC2A 2ZJRA 1HZ9A 4LFBQ 2YTYA 1MJEA 1I5FA 1FJGL 1VQ8A 2RHQB 2IT1A 5M5XH 4HJ7A 2WB1E 4OWTB 2BA1A 3MEFA 3H3VH 1K0RA 1QUQA 1N33L 2B63G 1QVCA 4OONA 4LUVA 1IBLL 4JI2Q 3HOXG 1X55A 2D0OA 1BKBA 2Y0SE 4GLAC 2JA6H 3M4QA 4DR2L 1PH4A 4MZ9A 3S1RH 3S1MH 5IYBG 1PH9A 4A3DH 1EIFA 4X64Q 1QUQB 2JA8G 2KENA 2MO1A 1Q1EA 4NB3A 1E22A 3RLNA 5FLMG 1W2BA 3M4OH 2UXBQ 4DV7Q 4GS3A 4BY1G 2KHJA 3KJPA 3CD6A 1XNQL 2V1CC 1R9TH 5JJIA 2I5HA 5HGQA 4A3JG 5C4JH 4YCVA 3ER0A 2UU9L 4AH6A 2K14A 4DV2Q 2D62A 1Q7YC 1IBMQ 4KI0A 2JA6G 3RZDH 1J5EQ 2AHOB 1IBKL 3S15H 1LM0A 4A3DG 2E8GA 4DV1Q 2OQKA 3TREA 1Q46A 3NELA 3UE1A 2UUAL 2IHFA 3RLFA 4DR1L 1SLJA 2CWAA 1E1OA 4AIMA 1GKHA 4JI3L 4A3FH 1EFWA 2F4VQ 4JI7Q 1HH2P 4B3MQ 1NMGA 2VS1A 4A76A 2JEAI 2ZJQA 4DUYQ 1JJ2A 1HNZL 3NBHB 3K7UC 5IP9H 1X65A 1AE2A 5GADC 4DR5Q 2AKWB 3WWVA 1XMQL 3KLWA 2PI2A 1VQGA 3HFZB 4RMFA 3SGIA 3W1BA 4C2MH 1G51A 3T1HL 4POGA 5C0XI 4KHPL 5GROA 3STBD 3GTKH 1A62A 1XMOL 1D7QA 3GTQH 5LMNQ 1JMCA 4GLVB 4DV6L 4L5TA 4A3FG 3CCJA 2CCZA 3AYHB 4DR4Q 5C4XH 2LXJA 1N8RC 3RZOH 1HR0L 4POFA 1QVFA 1BBUA 4LW1A 3W1GA 1FVIA 4QIWE 4QY7A 3D31A 1EUJA 2N78A 5IP7G 5C3EH 4DV2L 1TWAH 4A3KH 3S1QH 1VQHA 3CC7A 1K8GA 2UUBL 3CP0A 5DLQE 4IPCA 1EQQA 1YJ9A 5IP9G 1E1TA 1M1KC 5IWAL 4IFDJ 2KCTA 1SMXA 3CCUA 1UE6A 1XJVA 2MQHA 2H5XA 3I2ZA 3PV0A 4KHZA 2UXDQ 4OX9Q 5IE8A 3I55A 2ZM6Q 4UP8A 1TWCH 4JI0Q 1HZBA 4QL5A 4JI1Q 4DV5L 2D0PA 4O2DA 4A3EH 3PUZA 1OXXK 2ZTEA 1IXRA 4HIOA 2NN6G 5C44H 3H0GH 4NXMQ 4DR6Q 1YHQA 3AQQA 1JJGA 2JA7H 5IY0A 5C4XG 1NY4A 4JV5L 2CQOA 5IT9c 1VQ7A 4QJFA 5JJLA 5GQOA 4L5QA 2K75A 2R6GA 3A0JA 4TQUS 4A3KG 3CMAA 3KJOA 4DV3L 1FJGQ 2R93H 1KL9A 1O7IA 4DR7L 2Q2HA 1VQ9A 2QGQA 1MJCA 1EIYB 1VQJA 3KYHC 4IFDG 1L2FA 1N33Q 4GKJL 3PUYA 1IBLQ 1XPOA 1UE5A 1U0LA 3M4PA 1Z47A 4DV0L 1WCMH 4IPDA 2ZJPA 5LMNW 5JEAJ 4HIKA 4DR2Q 4A3EG 4LF7L 3HOWH 5AJ3L 3U58A 4TVAB 3H0GG 5C44G 1QVGA 3G71A 2Q2UA 1XPUA 1HNXL 4BA1I 2JA7G 4GKKL 2RF4A 4YWKA 4X62L 3PUWA 5M3FH 4XTCS 1KD1C 2KCMA 3L0OA 4BA2I 2Q2TA 1UWVA 2ALYB 2K52A 2R93G 2F52A 1XNQQ 3S24A 3T1YL 1A63A 4GOPA 3ERSX 1Q1BA 3AFQA 1NBWA 4AYBG 2UU9Q 3J81c 3CCSA 1VQIA 4JI1L 4GLXA 1Y1VH 3PO2H 1OXSC 1IBKQ 4PZ8A 3HOWG 2K5HA 4C3JH 3UDFA 5M5YH 5JEAG 3CXCA 1NJIC 3S2DH 4GOPB 2MO0A 1Y1WH 2OTJA 1E24A 4XIGS 1W3SA 4DR1Q 2UUAQ 3EBEA 3G4SA 4R4IA 2CFMA 1XTDA 5M3FG 3DM3A 3CCRA 4JI3Q 3B6YA 4OO1I 4AQYL 2R7FA 1VQMA 2PQAA 1YIJA 3CQZH 1X3FA 3STBC 3U4VA 2OWOA 5ELNA 4NXNL 3F1ZA 2HIXA 1HNZQ 4LWCA 3GTLH 1TWGH 2IY5B 4JI8L 1CSPA 4HJ5A 1Q12A 3HOUH 3PSIA 3PO2G 5LMUL 1S3OA 4YHHL 4X65L 4UPAA 2JE6I 1SRUA 2PQAB 1SE8A 3T1HQ 3TRZA 3TQYA 4P71A 1U5KA 1UE1A 3LGJA 4C3HH 1Y1WG 4KHPQ 5GAGC 3I4NH 1XMOQ 4R4OA 3M3YH 2PNHA 4YWMA 3I4MH 4DUZL 4O0AA 4DV6Q 2I0QA 3KDFA 2JJQA 1GM5A 1X6OA 3PUVA 5C0XJ 1L0WA 2N3SA 4OXPA 3RN5A 1HR0Q 4APVA 3KFUA 3K8AA 2VY3A 5GAEC 1B8AA 3J81i 4X6AH 3U4ZA 3D0FA 4JI6L 2NVTH 2UUBQ 5GAHC 3IRBA 3J80i 1VQAA 1OXVA 2A1AA 3KDFB 2JA5H 5IWAQ 1KHIA 2XGTA 1N36L 2L15A 1AH9A 4BBRH 1QZHA 3I4OA 2UUCL 1KXLA 2DGYA 1HZAA 4DV5Q 4JYAL 3H15A 3S1NH 3I4MG 3NENA 4BY7H 4WJ4A 1PH7A 1VQEA 2E5LL 1KRTA 4JV5Q 1G291 3OYYA 3RLOA 2YYZA 4LUZA 2OTLA 4BBSH 3A5ZB 1TWHH 4JBJA 3BZKA 2N49A 3E9HA 1A0IA 1WI5A 4DV3Q 1C7YA 1ASZA 4LNQA 4LF5L 4DR7Q 1KAWA 1VQ4A 1K9MC 1VQ6A 3J7A5 2EXDA 4LF8L 2A19A 1VCIA 4GKJQ 1VQOA 4C3IH 5BR8L 1KC8C 2HHHL 4A3LH 3H3VI 4B3RL 3PIPA 3MXNB 1A8VA 3KF8B 1P16A 4DV0Q 1PH2A 4LF7Q 4P72A 1OXTA 3PUXA 3ULLA 4K0KQ 5HY6A 4P75A 5AJ3Q 1HR0W 1IZ6A 1HNXQ 1V9PA 1N34L 4GKKQ 4A3LG 3G48A 4X62Q 4JBMA 4JI5L 3HKZG 4X66L 4RG1A 3PF5A 1KRSA 2ES2A 4BBSG 4A75A 2YTVA 4BXXH 3HKSA 3T1YQ 2NZHA 3PIOA 4JBWA 1HZCA 4IOAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCL A;  4L5R C;  4LF9 L;  3CCV A;  3E9I A;  1HJP A;  1UEB A;  2VL6 A;  4P73 A;  3K0X A;  4R4Q A;  3K7A H;  4LFC L;  1GO3 E;  4QGU A;  4A3M H;  3GO5 A;  3RNU A;  2WAQ G;  1PH3 A;  4DPG A;  3CAM A;  5M3M H;  3ULJ A;  2C35 B;  3BJU A;  2BA0 A;  4QQB X;  3CPF A;  2OCE A;  5C3E G;  1I50 H;  2ATW A;  1PH1 A;  2ID0 A;  2HQL A;  4IJH A;  3W5O A;  4AQY Q;  4BXX G;  3HKZ E;  4B3S L;  1I6H H;  1VQK A;  4LF6 L;  4HIM A;  4GOP C;  4H02 A;  2I5M X;  1VQL A;  5FLX c;  4NXN Q;  4NPS A;  1C0A A;  4PMW A;  1DGS A;  4JI8 Q;  2KHI A;  2RCN A;  3A5U A;  5LMU Q;  4P74 A;  4YHH Q;  4X65 Q;  3ULP A;  2E2I H;  1YI2 A;  2AWO A;  1XNR L;  4A3G H;  4GN5 A;  2VUM H;  3RR5 A;  1YHA A;  4IOC A;  4A93 H;  1JJC B;  3JC6 6;  4DNI A;  4EX5 A;  1FL0 A;  5M3M G;  3CCQ A;  4LUO A;  1MKH A;  1S40 A;  1YEZ A;  2UXC L;  2YU9 H;  1HNW L;  1PH6 A;  3BU2 A;  3K81 C;  4JCV E;  4DUZ Q;  3PCO B;  1Q81 C;  3FP9 A;  4A3B H;  2NN6 I;  4GN4 B;  3I7F A;  4GNX A;  5H1S E;  5IYC H;  4JI6 Q;  4HJ9 A;  1LUZ A;  3G6E A;  3J80 c;  1WCM G;  4FDB A;  4DR3 L;  1L1O A;  4A3G G;  4YY3 L;  2ZTD A;  3UDI A;  2GVB A;  4UP7 A;  1N36 Q;  4A93 G;  1WOC A;  2OQ0 A;  3PO3 H;  4GNX B;  2UUC Q;  4IFD I;  4HJ8 A;  1SFO H;  3UDG A;  4JYA Q;  5ELO A;  1VQ5 A;  2VNU D;  1CKN A;  4ALP A;  1X9N A;  4B3T L;  1L1O B;  2QA4 A;  2DUD A;  2E5L Q;  3J7Z C;  1YNX A;  2VQE L;  1RIP A;  3L2P A;  2Y0S G;  2YTX A;  4A3B G;  4PG3 A;  2B63 H;  2EIF A;  3CW2 C;  1EQR A;  2IX0 A;  1C9O A;  1I3Q H;  1JE5 A;  1X56 A;  1VQF A;  1Y1V G;  1CKN B;  4AYB E;  3CC4 A;  4LF5 Q;  5EAY A;  2FXQ A;  2K5V A;  2R7D A;  5FJ8 H;  2NZO A;  4LF8 Q;  5IYB H;  5J3B A;  1V1Q A;  1ASY A;  3ZJY C;  2PMZ E;  5BR8 Q;  2HHH Q;  3PO3 G;  4B3R Q;  2VQF L;  1N32 L;  2Z6K A;  2R92 H;  4BY1 H;  2AWN A;  1X54 A;  3CF5 A;  1N34 Q;  1RL2 A;  3CCE A;  3S16 H;  2QEX A;  4A3J H;  2E2H H;  4JI5 Q;  4X66 Q;  3TS0 A;  4JI4 L;  1VQD A;  1MIU A;  3HOU G;  1P8L A;  1VQB A;  2BH2 A;  1WFQ A;  5FJ8 G;  3GTP H;  4DKA C;  1YJW A;  1EYG A;  3F2B A;  4LF9 Q;  1M90 C;  4LFC Q;  1XMQ Q;  3HOV H;  4JOI A;  3ICE A;  3I4N G;  4WJ3 M;  1X3E A;  1PFS A;  1YHB A;  4L5S A;  1OXU A;  2R92 G;  3JAM c;  1IL2 A;  1TXY A;  2LSS A;  3KOJ A;  4A3C H;  3RN2 A;  5C0X G;  3FKI H;  4LFA L;  4A4I A;  3KF6 A;  4Y7N H;  1YIT A;  4R4T A;  1Q8K A;  3GTM H;  3AFP A;  3OTO L;  2I5L X;  2JA5 G;  4B3S Q;  1K73 C;  2MNA A;  4LF6 Q;  4DV4 L;  5E7N A;  2KBN A;  4LF4 L;  4BBR G;  3CME A;  3KF6 B;  1Z9F A;  4MNO A;  1QZG A;  3HOV G;  1XPR A;  3NEM A;  3U50 C;  2F3I A;  5K36 G;  4LFB L;  1XNR Q;  4BY7 G;  1G6P A;  1CSQ A;  4GN3 B;  1PYB A;  1SRO A;  3HOY H;  3CPW A;  4A3C G;  3DLL A;  1LTL A;  1NMF A;  3FKI G;  1X3G A;  2K4K A;  4YCU A;  3S14 H;  2UXC Q;  1IYJ B;  1GD7 A;  4IPG A;  5IP7 H;  1HNW Q;  1H95 A;  3K80 C;  4JI2 L;  3M7N A;  1VQP A;  4R4C A;  1I94 Q;  4K0K L;  3UE0 A;  4HID A;  1OTC A;  4Y52 H;  3TS2 A;  3GTO H;  1V43 A;  1YBY A;  3J81 j;  4X64 L;  2ASB A;  3BZC A;  2MFI A;  4ME3 A;  1B7Y B;  1AE3 A;  4DR3 Q;  2R7Z H;  4YCW A;  4J15 A;  3L7Z C;  2UXB L;  4DV7 L;  3AEV A;  4YY3 Q;  1D8L A;  3OW2 A;  1PHJ A;  4IPH A;  3JAM i;  1KIX A;  1PVO A;  3HOY G;  2K50 A;  1EWI A;  4YWL A;  4UP9 A;  2CWP A;  2B29 A;  3GTJ H;  1KQS A;  3UDX A;  1E3P A;  1VS0 A;  1WYD A;  1IBM L;  1Y14 B;  4DAM A;  4B3T Q;  1K3R A;  3GDE A;  1J5E L;  2VQE Q;  2Q2I A;  1BVS A;  2Z0S A;  4DV1 L;  1BBW A;  4MTN A;  2A8V A;  3A74 A;  4PZ6 A;  5M5W H;  4GNX C;  4A3M G;  5IYD H;  2R7Z G;  2NVX H;  1JB7 A;  1NE3 A;  2IHE A;  2VZA A;  1UE7 A;  1B70 B;  2F4V L;  2NVY H;  1L1O C;  2B3G A;  4JI7 L;  4B3M L;  2IX1 A;  1VQC A;  2WAQ E;  1N9W A;  2ZTC A;  3M9B A;  2JQO A;  1PA6 A;  4UY8 C;  1YJN A;  4JC0 A;  2GVA A;  4DK3 C;  3M85 A;  3TEH B;  2VQF Q;  4DUY L;  1GVP A;  1SR3 A;  4A3I H;  2GN5 A;  2E2J H;  1PH8 A;  1I94 L;  2JK8 A;  1N32 Q;  1EOV A;  2CKZ B;  1K83 H;  3Q8D A;  3I56 A;  3PGZ A;  3GD7 A;  3EN2 A;  4DR5 L;  2VW9 A;  2WP8 J;  2PI2 E;  1S72 A;  4DK6 C;  1PV4 A;  3S2H H;  4JG2 A;  2NVQ H;  4JI4 Q;  4OO1 G;  1YVC A;  1E7Z A;  3F2D A;  1CKM A;  5IYD G;  4PZ7 A;  4KLK A;  1Q82 C;  1CUK A;  2HT1 A;  3HOZ H;  4OWX B;  5LMN L;  1J6Q A;  2VUM G;  4EQ5 A;  1VQN A;  2AMC B;  4DR4 L;  1T9H A;  1SN8 A;  4DAY B;  2K5N A;  1Q86 C;  1TWF H;  2JA9 A;  3E0E A;  3F8T A;  4JBK A;  3CCM A;  4A3I G;  1FGU A;  2WB1 G;  4HJA A;  1PH5 A;  2HIV A;  2XTI A;  2Z6K C;  3PF4 A;  2JEB I;  4LFA Q;  1JT8 A;  2EQS A;  4IJL A;  3GTG H;  5JJK A;  2LXK A;  3HOX H;  2UXD L;  1NTG A;  5IYC G;  4OX9 L;  2ZM6 L;  1CKO A;  3OTO Q;  4JI0 L;  1K8A C;  3HOZ G;  4R1J A;  3S17 H;  3EIV A;  3F2C A;  2BH8 A;  4DV4 Q;  3FHW A;  4NXM L;  4LF4 Q;  4OWW B;  4DR6 L;  4IO9 A;  2N8N A;  2JA8 H;  1PYS B;  2YV5 A;  2RHS B;  2WFW A;  5FLM H;  1LYL A;  3VDY A;  1YZ6 A;  1WJJ A;  4JOI C;  3CC2 A;  2ZJR A;  1HZ9 A;  4LFB Q;  2YTY A;  1MJE A;  1I5F A;  1FJG L;  1VQ8 A;  2RHQ B;  2IT1 A;  5M5X H;  4HJ7 A;  2WB1 E;  4OWT B;  2BA1 A;  3MEF A;  3H3V H;  1K0R A;  1QUQ A;  1N33 L;  2B63 G;  1QVC A;  4OON A;  4LUV A;  1IBL L;  4JI2 Q;  3HOX G;  1X55 A;  2D0O A;  1BKB A;  2Y0S E;  4GLA C;  2JA6 H;  3M4Q A;  4DR2 L;  1PH4 A;  4MZ9 A;  3S1R H;  3S1M H;  5IYB G;  1PH9 A;  4A3D H;  1EIF A;  4X64 Q;  1QUQ B;  2JA8 G;  2KEN A;  2MO1 A;  1Q1E A;  4NB3 A;  1E22 A;  3RLN A;  5FLM G;  1W2B A;  3M4O H;  2UXB Q;  4DV7 Q;  4GS3 A;  4BY1 G;  2KHJ A;  3KJP A;  3CD6 A;  1XNQ L;  2V1C C;  1R9T H;  5JJI A;  2I5H A;  5HGQ A;  4A3J G;  5C4J H;  4YCV A;  3ER0 A;  2UU9 L;  4AH6 A;  2K14 A;  4DV2 Q;  2D62 A;  1Q7Y C;  1IBM Q;  4KI0 A;  2JA6 G;  3RZD H;  1J5E Q;  2AHO B;  1IBK L;  3S15 H;  1LM0 A;  4A3D G;  2E8G A;  4DV1 Q;  2OQK A;  3TRE A;  1Q46 A;  3NEL A;  3UE1 A;  2UUA L;  2IHF A;  3RLF A;  4DR1 L;  1SLJ A;  2CWA A;  1E1O A;  4AIM A;  1GKH A;  4JI3 L;  4A3F H;  1EFW A;  2F4V Q;  4JI7 Q;  1HH2 P;  4B3M Q;  1NMG A;  2VS1 A;  4A76 A;  2JEA I;  2ZJQ A;  4DUY Q;  1JJ2 A;  1HNZ L;  3NBH B;  3K7U C;  5IP9 H;  1X65 A;  1AE2 A;  5GAD C;  4DR5 Q;  2AKW B;  3WWV A;  1XMQ L;  3KLW A;  2PI2 A;  1VQG A;  3HFZ B;  4RMF A;  3SGI A;  3W1B A;  4C2M H;  1G51 A;  3T1H L;  4POG A;  5C0X I;  4KHP L;  5GRO A;  3STB D;  3GTK H;  1A62 A;  1XMO L;  1D7Q A;  3GTQ H;  5LMN Q;  1JMC A;  4GLV B;  4DV6 L;  4L5T A;  4A3F G;  3CCJ A;  2CCZ A;  3AYH B;  4DR4 Q;  5C4X H;  2LXJ A;  1N8R C;  3RZO H;  1HR0 L;  4POF A;  1QVF A;  1BBU A;  4LW1 A;  3W1G A;  1FVI A;  4QIW E;  4QY7 A;  3D31 A;  1EUJ A;  2N78 A;  5IP7 G;  5C3E H;  4DV2 L;  1TWA H;  4A3K H;  3S1Q H;  1VQH A;  3CC7 A;  1K8G A;  2UUB L;  3CP0 A;  5DLQ E;  4IPC A;  1EQQ A;  1YJ9 A;  5IP9 G;  1E1T A;  1M1K C;  5IWA L;  4IFD J;  2KCT A;  1SMX A;  3CCU A;  1UE6 A;  1XJV A;  2MQH A;  2H5X A;  3I2Z A;  3PV0 A;  4KHZ A;  2UXD Q;  4OX9 Q;  5IE8 A;  3I55 A;  2ZM6 Q;  4UP8 A;  1TWC H;  4JI0 Q;  1HZB A;  4QL5 A;  4JI1 Q;  4DV5 L;  2D0P A;  4O2D A;  4A3E H;  3PUZ A;  1OXX K;  2ZTE A;  1IXR A;  4HIO A;  2NN6 G;  5C44 H;  3H0G H;  4NXM Q;  4DR6 Q;  1YHQ A;  3AQQ A;  1JJG A;  2JA7 H;  5IY0 A;  5C4X G;  1NY4 A;  4JV5 L;  2CQO A;  5IT9 c;  1VQ7 A;  4QJF A;  5JJL A;  5GQO A;  4L5Q A;  2K75 A;  2R6G A;  3A0J A;  4TQU S;  4A3K G;  3CMA A;  3KJO A;  4DV3 L;  1FJG Q;  2R93 H;  1KL9 A;  1O7I A;  4DR7 L;  2Q2H A;  1VQ9 A;  2QGQ A;  1MJC A;  1EIY B;  1VQJ A;  3KYH C;  4IFD G;  1L2F A;  1N33 Q;  4GKJ L;  3PUY A;  1IBL Q;  1XPO A;  1UE5 A;  1U0L A;  3M4P A;  1Z47 A;  4DV0 L;  1WCM H;  4IPD A;  2ZJP A;  5LMN W;  5JEA J;  4HIK A;  4DR2 Q;  4A3E G;  4LF7 L;  3HOW H;  5AJ3 L;  3U58 A;  4TVA B;  3H0G G;  5C44 G;  1QVG A;  3G71 A;  2Q2U A;  1XPU A;  1HNX L;  4BA1 I;  2JA7 G;  4GKK L;  2RF4 A;  4YWK A;  4X62 L;  3PUW A;  5M3F H;  4XTC S;  1KD1 C;  2KCM A;  3L0O A;  4BA2 I;  2Q2T A;  1UWV A;  2ALY B;  2K52 A;  2R93 G;  2F52 A;  1XNQ Q;  3S24 A;  3T1Y L;  1A63 A;  4GOP A;  3ERS X;  1Q1B A;  3AFQ A;  1NBW A;  4AYB G;  2UU9 Q;  3J81 c;  3CCS A;  1VQI A;  4JI1 L;  4GLX A;  1Y1V H;  3PO2 H;  1OXS C;  1IBK Q;  4PZ8 A;  3HOW G;  2K5H A;  4C3J H;  3UDF A;  5M5Y H;  5JEA G;  3CXC A;  1NJI C;  3S2D H;  4GOP B;  2MO0 A;  1Y1W H;  2OTJ A;  1E24 A;  4XIG S;  1W3S A;  4DR1 Q;  2UUA Q;  3EBE A;  3G4S A;  4R4I A;  2CFM A;  1XTD A;  5M3F G;  3DM3 A;  3CCR A;  4JI3 Q;  3B6Y A;  4OO1 I;  4AQY L;  2R7F A;  1VQM A;  2PQA A;  1YIJ A;  3CQZ H;  1X3F A;  3STB C;  3U4V A;  2OWO A;  5ELN A;  4NXN L;  3F1Z A;  2HIX A;  1HNZ Q;  4LWC A;  3GTL H;  1TWG H;  2IY5 B;  4JI8 L;  1CSP A;  4HJ5 A;  1Q12 A;  3HOU H;  3PSI A;  3PO2 G;  5LMU L;  1S3O A;  4YHH L;  4X65 L;  4UPA A;  2JE6 I;  1SRU A;  2PQA B;  1SE8 A;  3T1H Q;  3TRZ A;  3TQY A;  4P71 A;  1U5K A;  1UE1 A;  3LGJ A;  4C3H H;  1Y1W G;  4KHP Q;  5GAG C;  3I4N H;  1XMO Q;  4R4O A;  3M3Y H;  2PNH A;  4YWM A;  3I4M H;  4DUZ L;  4O0A A;  4DV6 Q;  2I0Q A;  3KDF A;  2JJQ A;  1GM5 A;  1X6O A;  3PUV A;  5C0X J;  1L0W A;  2N3S A;  4OXP A;  3RN5 A;  1HR0 Q;  4APV A;  3KFU A;  3K8A A;  2VY3 A;  5GAE C;  1B8A A;  3J81 i;  4X6A H;  3U4Z A;  3D0F A;  4JI6 L;  2NVT H;  2UUB Q;  5GAH C;  3IRB A;  3J80 i;  1VQA A;  1OXV A;  2A1A A;  3KDF B;  2JA5 H;  5IWA Q;  1KHI A;  2XGT A;  1N36 L;  2L15 A;  1AH9 A;  4BBR H;  1QZH A;  3I4O A;  2UUC L;  1KXL A;  2DGY A;  1HZA A;  4DV5 Q;  4JYA L;  3H15 A;  3S1N H;  3I4M G;  3NEN A;  4BY7 H;  4WJ4 A;  1PH7 A;  1VQE A;  2E5L L;  1KRT A;  4JV5 Q;  1G29 1;  3OYY A;  3RLO A;  2YYZ A;  4LUZ A;  2OTL A;  4BBS H;  3A5Z B;  1TWH H;  4JBJ A;  3BZK A;  2N49 A;  3E9H A;  1A0I A;  1WI5 A;  4DV3 Q;  1C7Y A;  1ASZ A;  4LNQ A;  4LF5 L;  4DR7 Q;  1KAW A;  1VQ4 A;  1K9M C;  1VQ6 A;  3J7A 5;  2EXD A;  4LF8 L;  2A19 A;  1VCI A;  4GKJ Q;  1VQO A;  4C3I H;  5BR8 L;  1KC8 C;  2HHH L;  4A3L H;  3H3V I;  4B3R L;  3PIP A;  3MXN B;  1A8V A;  3KF8 B;  1P16 A;  4DV0 Q;  1PH2 A;  4LF7 Q;  4P72 A;  1OXT A;  3PUX A;  3ULL A;  4K0K Q;  5HY6 A;  4P75 A;  5AJ3 Q;  1HR0 W;  1IZ6 A;  1HNX Q;  1V9P A;  1N34 L;  4GKK Q;  4A3L G;  3G48 A;  4X62 Q;  4JBM A;  4JI5 L;  3HKZ G;  4X66 L;  4RG1 A;  3PF5 A;  1KRS A;  2ES2 A;  4BBS G;  4A75 A;  2YTV A;  4BXX H;  3HKS A;  3T1Y Q;  2NZH A;  3PIO A;  4JBW A;  1HZC A;  4IOA A; 
#chains in the Genus database with same CATH topology
 2ZXR A;  4L5R C;  1SSO A;  1UEB A;  2EY2 A;  2O5I C;  3K7A H;  2F0Q A;  4KY7 A;  3Q0A A;  3RNU A;  3QG1 A;  1SDF A;  3CAM A;  1BQQ T;  4A3K B;  1BNZ A;  1PMR A;  5I4D A;  3CPF A;  4EVO A;  4AQY Q;  1PFB A;  2H1E A;  1I6H H;  3FPP A;  3QO2 A;  1GJX A;  2DNE A;  4LF6 L;  5CV5 A;  4HIM A;  1VQL A;  3FEW X;  5FLX c;  2CHB D;  1C0A A;  3H0G B;  4PMW A;  1BUV T;  5LMU Q;  4YHH Q;  3NXW A;  4X65 Q;  2E2I H;  1FGB D;  2AWO A;  1YHA A;  1DJR D;  4LUO A;  1JOK A;  2F0V A;  4ZYS A;  3Q23 A;  2TMP A;  4HTH A;  3H91 A;  2YU9 H;  1ILQ A;  1HNW L;  3SK8 A;  4AYB B;  4ID6 A;  2B2V C;  2F3W A;  5ELF A;  1IYU A;  4JI6 Q;  1SYC A;  4PNY A;  1XTC D;  4KY5 A;  3J80 c;  1DOK A;  3KUP A;  2RSO A;  4A3G G;  3DHQ A;  1HUM A;  5M3F B;  4UP7 A;  2BDN A;  5FOB B;  4IFD I;  3BVG A;  1DD2 A;  4KKU A;  1O78 A;  1EEI D;  3OIQ A;  1DYQ A;  5ELO A;  1JOR A;  2B8G A;  1QE6 A;  5M9O A;  1QIL A;  2F0N A;  2QA4 A;  1A2T A;  2E5L Q;  4R8I A;  4A3B G;  1ET6 A;  2CW0 C;  4FXG C;  5DEH A;  2B63 H;  1TY0 A;  1S5C D;  2IX0 A;  4AYB E;  1Y1W B;  1ENC A;  1G91 A;  4J8Q A;  3ZJY C;  4N9P A;  5BR8 Q;  3PO3 G;  1JB3 A;  2VQF L;  3I90 A;  2AQ3 B;  2SNM A;  3TP7 A;  1N34 Q;  1I4X A;  3S16 H;  2K03 A;  4A3J H;  4QMG A;  2QDB A;  5CBE E;  1HQM C;  1MIU A;  3HOU G;  2BH2 A;  4KK7 A;  1BOS A;  5DM6 3;  2N88 A;  4DKA C;  4CKE A;  1BCP B;  1SMY C;  1EYG A;  3NTH A;  1X3E A;  1PFS A;  3C1F A;  3JAM c;  1IL2 A;  1LTR D;  2NVT B;  1ROD A;  3QJY A;  4G7H C;  5A2Q L;  4LFA L;  5JVH 3;  4HMI A;  3MXN A;  1U4R A;  1H9M A;  2OF1 A;  2I5L X;  1B3A A;  4XQJ A;  2C9O A;  4LF6 Q;  1RHP A;  4XYO A;  1Z9F A;  1QZG A;  1M4V A;  1XPR A;  1KAB A;  3NSW A;  3HOV G;  4DAP A;  2DJG C;  1ONL A;  2PCF B;  5G3L F;  1PYB A;  1SRO A;  3HOY H;  1S5D D;  3FKI G;  5C4Z A;  1IYJ B;  1HNW Q;  4JI2 L;  4R4C A;  4Y52 H;  3ERQ A;  3GTK B;  3TS2 A;  5BN4 A;  1YBY A;  1SE4 A;  4FP5 D;  3L9A X;  4X64 L;  1EYA A;  5IGG A;  1B7Y B;  5C4X B;  3E5S A;  4H13 C;  4J15 A;  3AEV A;  2EYP A;  1D8L A;  2NN6 H;  3VYS A;  5FLX E;  5IOC A;  1PVO A;  2EDG A;  4FF2 A;  1ZYR D;  3IKJ A;  1VS0 A;  1SMY D;  4DAM A;  1K3R A;  5C3W A;  1J5E L;  1CZW A;  1A15 A;  1BVS A;  2EXZ A;  4R8N A;  3A74 A;  1STG A;  1K0S A;  4LK1 C;  1NE3 A;  2Z4I A;  5EKK A;  1T5E A;  4JI7 L;  5HGT A;  2IX1 A;  1PA6 A;  3M9B A;  2R93 B;  5E4W C;  3J80 E;  2GVA A;  2VQF Q;  3TEH B;  4RKL A;  5EKI A;  2WAC A;  5I9P A;  3PGZ A;  4IUV A;  2IPK D;  3EN2 A;  1B53 A;  1NR4 A;  3NQI A;  2E75 C;  1A3U A;  1CT1 D;  2B2U A;  1Q82 C;  3H3V C;  1G2T A;  4M8A A;  4RKB A;  3DXJ C;  2L4N A;  2VUM G;  3KLR A;  1VQN A;  2K5D A;  1PXU A;  2NTT A;  4DU9 A;  4DAY B;  4RGN A;  4A3I G;  1FGU A;  4A3B B;  2FHT A;  3K6O A;  3PMF A;  2OEO A;  4LFA Q;  3RUZ A;  5JJK A;  1SNP A;  5KEE A;  3HOX H;  4OX9 L;  5A35 A;  2RDG A;  4R1J A;  1AZQ A;  3F2C A;  4RCN A;  4OWW B;  1RCV D;  4IO9 A;  3IFT A;  2YV5 A;  2WFW A;  5FLM H;  1HZ9 A;  5FO7 B;  2F0W A;  1MJE A;  1I5F A;  1VQ8 A;  3GTL B;  2RHQ B;  2IT1 A;  3HOU B;  1K0R A;  4RGM A;  4OON A;  4JI2 Q;  1JE4 A;  1HA6 A;  1HA5 A;  3JAM E;  1PH4 A;  1LTG D;  3LNN A;  2KED A;  2EJF C;  4X64 Q;  4B9X A;  2E2H B;  2Q8I B;  3QOL A;  4L63 B;  5ELC A;  4BY1 G;  1EY6 A;  1RTO A;  1L0X B;  4XT1 B;  3RZD H;  1J5E Q;  2AHO B;  4I7A A;  3TZU A;  1IBK L;  3J7Y W;  5CV9 A;  1LM0 A;  4A3D G;  2E8G A;  2OQK A;  2L12 A;  3K5N A;  3V2T A;  1E1O A;  4A3F H;  3NHH A;  2LS0 1;  5CC4 A;  1QNU A;  4JI7 Q;  2MGS A;  1HH2 P;  1NMG A;  1O7L A;  2RDF A;  1JJ2 A;  1KDB A;  2AKW B;  2DJF C;  1B3Q A;  4FXK C;  3SGI A;  1G51 A;  3OMG A;  1HFG A;  5C0X I;  5GRO A;  3GTK H;  1A62 A;  1ET9 A;  4RH6 A;  4TKO B;  4GLV B;  4L5T A;  3DWA A;  3W3A A;  4QUC A;  3RD4 A;  4RCO A;  5C4X H;  2LXJ A;  4RFB A;  1MD2 D;  4LW1 A;  4POF A;  1QVF A;  1FVI A;  1PRT C;  4QY7 A;  5IP7 G;  3CC7 A;  2MP1 A;  3EQL C;  3T53 B;  3CP0 A;  4IFD J;  5IP9 G;  3BVM A;  2KCT A;  1SMX A;  3PV0 A;  2H5X A;  4KHZ A;  4OX9 Q;  3I55 A;  4WFN 3;  4GZY C;  1TWC H;  3LWE A;  1RJT A;  2B2U C;  2ZTE A;  1IXR A;  5IT9 L;  1NY4 A;  4JV5 L;  1B2T A;  3P7J A;  2K75 A;  4HSV A;  1U9R A;  1LTS D;  2AQ2 B;  2KEC A;  2R93 H;  2N55 A;  4DR7 L;  1VQ9 A;  1MJC A;  1EIY B;  2F4I A;  4IFD G;  2NVX B;  2QDL A;  5J39 A;  3PUY A;  1XPO A;  2VUM B;  1B1Z A;  4HIK A;  3MXU A;  2ZJP A;  4K5X A;  5LMN W;  5JEA J;  4A3E G;  3FVQ A;  1CK1 A;  4TVA B;  5I6Y A;  4A3I B;  1QVG A;  4BA1 I;  1XXG A;  3I8Z A;  4HED A;  4YWK A;  1BCP F;  1FD7 D;  1WTH A;  1VF7 A;  2Q2T A;  4XQN A;  3T1Y L;  3ERS X;  2KOL A;  2P5Z X;  4K6D A;  1H9R A;  3PO2 H;  1PRT D;  1IBK Q;  4PZ8 A;  3HOW G;  1SFO B;  5JEA G;  3S2D H;  2MPM A;  2HCI A;  3C1E A;  1O80 A;  1LAB A;  3EBE A;  2HD3 A;  2CFM A;  3CCR A;  1VQM A;  2D9U A;  1LTT D;  3K5M A;  1HXY D;  4LWC A;  3GTL H;  1TWG H;  4JI8 L;  4HJ5 A;  3HOU H;  3HP3 A;  3PSI A;  4ZRZ A;  1BXT A;  4ABN A;  4H0L C;  1SE8 A;  4C3J G;  5IGB A;  4UAI A;  1UE1 A;  4Q0F A;  4BY1 B;  5GAG C;  1C4Q A;  3TN2 A;  5M5X B;  3M3Y H;  4DN4 M;  1Y8N B;  4DUZ L;  5I9O A;  4L6T B;  3PUV A;  2CH4 A;  2IWH A;  3K8A A;  3J81 i;  4A3D B;  3D0F A;  3J80 i;  1VQA A;  1OXV A;  2A1A A;  3KDF B;  4PMC A;  4TRD A;  3ONA B;  3AB9 A;  4K5V A;  1PTO C;  4QIW B;  1KXL A;  1SYB A;  1HZA A;  1FNU A;  2EPB A;  3I4M G;  3NEN A;  4WJ4 A;  1D5M C;  4JV5 Q;  2IX3 A;  3OYY A;  2OTL A;  4JBJ A;  2SNS A;  4FVM A;  3E9H A;  5LL6 S;  4DR7 Q;  1VQ6 A;  3K59 A;  4ZAI A;  4LF8 L;  3VYU A;  1K8M A;  2EYF A;  1KC8 C;  3N6R A;  3MXN B;  1A8V A;  4K8J A;  1PH2 A;  4P72 A;  3ULL A;  4F7X A;  5HY6 A;  5I2Y A;  1IZ6 A;  3SEB A;  4RG1 A;  1LT4 D;  3GTO B;  5LL6 X;  2CH4 W;  3HKS A;  1V1P A;  2NZH A;  3PIO A;  4JBW A;  3T1Y Q;  1HQR D;  3QR8 A;  1RKN A;  3CCL A;  1SNO A;  1QNK A;  4LF9 L;  3CCV A;  3EVQ A;  4LFC L;  2VL6 A;  1GO3 E;  3RZO B;  3E3X A;  3OHX C;  1KDC A;  3BYY B;  4QQB X;  2BA0 A;  3V05 A;  2ATW A;  1PH1 A;  1MHW C;  1PTO D;  2ID0 A;  3LWU A;  3SK5 A;  4BXX G;  4IUQ A;  1VQK A;  2IJ0 A;  2NBF A;  4A3E B;  1SBB B;  4NPS A;  2NVY B;  3HG9 A;  4JI8 Q;  1DGS A;  2KHI A;  5IIF A;  3KK7 A;  4P74 A;  1F2L A;  4MIU A;  1EYD A;  2VUM H;  3RR5 A;  2E2J B;  1JJC B;  3JC6 6;  3TP5 A;  4EX5 A;  5M3M G;  3CCQ A;  1CQF A;  1S40 A;  3SHL A;  2UXC L;  3EA6 A;  1PH6 A;  4JCV E;  3K81 C;  4DUZ Q;  3CRL C;  4KTA A;  1DOM A;  1Q81 C;  3FP9 A;  5IGE A;  1T5X D;  3HOZ B;  4WOR A;  5KND A;  3HOW B;  4GNX A;  5C3X A;  4ZUJ A;  4HJ9 A;  3ITP A;  4FDB A;  1EWC A;  2F0G A;  1L1O A;  4YY3 L;  2ZTD A;  4IQZ A;  3UDI A;  4A93 G;  1WOC A;  2O2L D;  1B44 D;  2NYZ D;  1SFO H;  3KLS A;  3OWE B;  1CKN A;  4B3T L;  3T51 B;  2DUD A;  1RIP A;  2YTX A;  4PG3 A;  3S17 B;  3UI2 A;  3CW2 C;  1HRJ A;  1E2V A;  1C9O A;  4XYQ A;  5J1Z A;  2JN4 A;  2FXQ A;  5EAY A;  1ILP A;  2NZO A;  2J7Z A;  4NMZ A;  4LF8 Q;  1V1Q A;  1DZ1 A;  1ASY A;  2PMZ E;  1C48 A;  5KNB A;  3I4L A;  1SJE D;  1TS3 A;  1GOZ A;  4CKB A;  4BY1 H;  2V4D A;  2EYO A;  4L8J A;  3S1M B;  2FMM A;  1VQD A;  2A68 C;  1WFQ A;  5FJ8 G;  2FIN B;  2Z9H A;  4NKL A;  3F2B A;  4LF9 Q;  3I4M B;  3EFX D;  4UHV A;  4LFC Q;  2KJX A;  1R9T B;  3I4N G;  2B2T C;  3TME A;  1TII D;  1YHB A;  1I4Q A;  3A8J E;  2R92 G;  1Z6H A;  2LSS A;  3KOJ A;  1A6X A;  5C0X G;  1PLF A;  4A4I A;  1YIT A;  1H9S B;  3GTM H;  3OTO L;  2K6A A;  2L9H A;  3MAQ A;  3SE0 A;  4YIJ A;  4BBR G;  3KF6 B;  3CME A;  3GP7 A;  4UDU C;  4HSP A;  4ME5 A;  2MUY A;  3NEM A;  3U50 C;  1JQY D;  5K36 G;  4LFB L;  1CSQ A;  2X6G A;  1ZXT A;  5CYU A;  2EOT A;  3R2T A;  2PYK A;  3CPW A;  4A3C G;  1STH A;  1LTL A;  2VB3 X;  1X3G A;  3BS1 A;  2UXC Q;  5IP7 H;  4KKS A;  2SDF A;  1VQP A;  1I94 Q;  4HID A;  3ND8 A;  5JPN C;  1KAA A;  1X3P A;  2IL8 A;  3GTO H;  1V43 A;  5EBC A;  2EE1 A;  3MHB A;  5CGK A;  3I3C A;  3NWS A;  4I65 A;  5EQ0 A;  3L7Z C;  4S3S A;  4X3U A;  2UXB L;  1SYF A;  4YY3 Q;  1PHJ A;  4IPH A;  1MI2 A;  1SAP A;  3S1Q B;  1NAP A;  1TS4 A;  2A68 D;  2K50 A;  4YWL A;  4UP9 A;  2B29 A;  3AU7 A;  1HPC A;  3UDX A;  1WYD A;  4N8X 1;  3WOE A;  4B3T Q;  3BZD B;  5EBD A;  2WIN B;  1KLU D;  1PZK D;  4DV1 L;  1B4O A;  1BBW A;  4MTN A;  5M5W H;  5C44 B;  4OO1 H;  4GNX C;  5M3M B;  3L3O C;  4A3M G;  2R7Z G;  1JB7 A;  1UE7 A;  1B70 B;  2NVY H;  1L1O C;  1I50 B;  1VQC A;  1FR3 A;  2ICI A;  4UY8 C;  2JQO A;  2J0T D;  4DK3 C;  2E2J H;  1EOV A;  4DR5 L;  1RD9 D;  1S72 A;  2WP8 J;  4DK6 C;  1PV4 A;  4LJZ C;  2GA4 B;  3D8G A;  4OEM B;  5T1G A;  1E7Z A;  3F2D A;  5IYD G;  2HT1 A;  1Y8P B;  3HOZ H;  5LMN L;  4CDE C;  5L37 A;  1SN8 A;  4O1N A;  1IKL A;  1DM0 B;  1Q86 C;  3QOJ A;  1TWF H;  3F8T A;  3CCM A;  1PH5 A;  4HJA A;  2CQA A;  1I4R A;  1D5Z C;  2XTI A;  3HRZ C;  2XWJ B;  2EQS A;  1TT2 A;  1F9R A;  4F87 A;  4HR7 B;  2WII B;  1CKO A;  3OTO Q;  4JI0 L;  3SR1 A;  3S17 H;  1F9S A;  3EIV A;  2JA8 H;  1PYS B;  2BDO A;  2HCC A;  3D4W A;  4C1N I;  1LYL A;  5CBA E;  3U9S A;  4X3K A;  4LFB Q;  3DUZ A;  3M4Y A;  2YTY A;  4FF1 A;  1I3Q B;  3I72 A;  1QUQ A;  1QVC A;  3SVM A;  2MHV A;  2F0S A;  3MA2 B;  5K5P A;  4DA2 A;  4DR2 L;  4MZ9 A;  1ZYR C;  3S1R H;  3I4N B;  1PH9 A;  3S1M H;  5A2Q E;  1CHP D;  1EIF A;  4C1N K;  2MO1 A;  5DM7 3;  5CR3 A;  1F77 A;  2UXB Q;  3HEJ A;  4GS3 A;  2R3Z A;  2KHJ A;  2V1C C;  1R9T H;  5C4J H;  1EY9 A;  3ER0 A;  3X3N A;  4AH6 A;  2D62 A;  1Q7Y C;  3M7G A;  4BBR B;  2JA6 G;  1PFM A;  2BE5 D;  3NK9 A;  3S15 H;  2NB0 A;  5BN3 A;  4DV1 Q;  1EY0 A;  3S1N B;  1EYC A;  4IUR A;  3TRE A;  3UE1 A;  2UUA L;  3RLF A;  3VA5 A;  4EQO A;  4AIM A;  1EFW A;  1TWH B;  1YNN D;  2JXM B;  3SK6 A;  4A76 A;  2NWG A;  4HN7 A;  2JEA I;  4PV1 C;  1HNZ L;  3NBH B;  3I70 A;  1TR5 A;  4DR5 Q;  2PI2 A;  3HFZ B;  3W1B A;  3T1H L;  3T16 A;  4POG A;  1HCZ A;  4KHP L;  3Q24 A;  1D7Q A;  4J1M A;  5LMN Q;  4E6I A;  4DFA A;  2KVM A;  1XWE A;  1BBU A;  1EZ8 A;  3S2H B;  4A3K H;  3S1Q H;  1VQH A;  1SXT A;  3V96 A;  4DK1 A;  1G8Z D;  1M1K C;  3MXP A;  4A3M B;  3VYR A;  3CCU A;  1UE6 A;  4B9W A;  1XJV A;  1H9J A;  1HUN A;  4JI0 Q;  1HZB A;  4QL5 A;  4JI1 Q;  1QG7 A;  3PUZ A;  1OXX K;  1PDQ A;  3H0G H;  5C44 H;  1II3 A;  1F2Z A;  5IT9 c;  1SND A;  1BDO A;  4QJF A;  5JJL A;  1TU2 B;  3KJO A;  4OHJ A;  1O7I A;  2QGQ A;  3VR6 A;  3KYH C;  2B2W A;  5D65 A;  4GKJ L;  4A3G B;  1UE5 A;  3DMU A;  5D3D A;  1Z47 A;  4DR2 Q;  4KN7 C;  1D1I A;  1EOT A;  5AJ3 L;  3FPU B;  2M00 A;  2KHS A;  3T13 A;  1QJO A;  3K5L A;  2Q2U A;  2JA7 G;  1HFN A;  4GKK L;  4X62 L;  1WD1 A;  3PUW A;  5M3F H;  4XTC S;  2KCM A;  4RHR A;  2F52 A;  4GOP A;  1GUT A;  3J81 L;  1VMP A;  4WRD A;  3CCS A;  5EGT A;  1VQI A;  2PZU A;  3PO3 B;  1NJI C;  5JPM C;  3OOC A;  5JVG 3;  1Y1W H;  2OTJ A;  1E24 A;  2RQX A;  2RSN A;  1WTV A;  2UUA Q;  2F0O A;  1GUS A;  3DM3 A;  2EJG C;  3B6Y A;  2R7F A;  1J8I A;  2PQA A;  3NQT A;  1X3F A;  3U4V A;  4CKC A;  2EY5 A;  2OWO A;  4NXN L;  2I07 B;  1HNZ Q;  3DWQ A;  3QIA A;  2QIL A;  1V8Q A;  4U68 A;  1TVX A;  1SRU A;  2JE6 I;  4LAA A;  1EY4 A;  4O42 A;  1SNM A;  3T1H Q;  1U5K A;  3LGJ A;  3R2I A;  4KHP Q;  3I4N H;  3U9O A;  2JJQ A;  2XNA C;  5J22 A;  2IW3 A;  4APV A;  5C0X H;  2F0E A;  2A6H C;  3RN5 A;  2VY3 A;  4FNF A;  4HMJ A;  2RVL A;  2NVT H;  5GAH C;  3HOV B;  1KHI A;  4G57 A;  2LKV A;  3TZD A;  1GUO A;  2EY1 A;  1N36 L;  4BBR H;  4C3H G;  2K5W A;  2DGY A;  4JYA L;  3FKI B;  3H15 A;  3S1N H;  4Y7N B;  1PH7 A;  1CFM A;  3WDN A;  3GQB A;  5KRU A;  1TWH H;  2N49 A;  1A0I A;  1QCB D;  1WI5 A;  1C7Y A;  1ASZ A;  2KCC A;  2H4O A;  4I7Z C;  1K9M C;  3NUC A;  4GKJ Q;  1VQO A;  3HS0 C;  2HDM A;  1EZ6 A;  2HHH L;  4ZQ3 A;  3KF8 B;  2A6E C;  1PFN A;  5AJ3 Q;  2PPB C;  1JWU D;  1HR0 W;  1Y8O B;  2EYM A;  4GKK Q;  4X62 Q;  2EVB A;  4JBM A;  3OIP A;  4BBS G;  1KRS A;  1RDP D;  2YTV A;  2JSO A;  5IT9 E;  1EU4 A;  3S2H H;  2B2W C;  1SE2 A;  3MFY A;  3E9I A;  4C3I G;  3IL8 A;  2L1B A;  4P73 A;  3K0X A;  4A3M H;  4A3L G;  2A6H D;  4QGU A;  2WAQ G;  1PH3 A;  1SNQ A;  1ESF A;  4DPG A;  3DEO A;  3ULJ A;  4IAL A;  3OW7 A;  1ZEQ X;  1KTK A;  2C35 B;  3BJU A;  2OCE A;  5C3E G;  1QB5 D;  2MJ8 A;  2HQL A;  4NW2 A;  3HKZ E;  3NTK A;  4B3S L;  2WKD A;  4H02 A;  2I5M X;  4GOP C;  4NXN Q;  5FO9 B;  3CHB D;  5C4H A;  2RCN A;  2JA7 B;  1E2Z A;  1S5B D;  3ULP A;  1HTP A;  1EWH A;  2KEE A;  1YI2 A;  4A3G H;  4GN5 A;  2LY7 A;  4IOC A;  3KBX A;  4DNI A;  3MVV A;  1MKH A;  2XN9 C;  3BU2 A;  3PCO B;  5EPJ A;  2A6E D;  2F0H A;  4A3B H;  1AZP A;  3MZ5 A;  4GN4 B;  3I7F A;  5H1S E;  1K8O A;  1O7Y A;  1LUZ A;  2FFK B;  1I4H A;  3VR5 A;  3G6E A;  4DR3 L;  2F0M A;  5G3L D;  3NP8 A;  1N36 Q;  1K28 A;  5E4X A;  1CI3 M;  2JYO A;  3NE5 B;  5KIX A;  1VF5 C;  3PO3 H;  2D2C C;  4HJ8 A;  3D3R A;  4JYA Q;  2A5H A;  2VNU D;  2PNR C;  4ALP A;  1FYC A;  1X9N A;  1JOQ A;  2VQE L;  3L2P A;  2Y0S G;  1TKW B;  2XWB B;  2EIF A;  1LV9 A;  2HDL A;  1JE5 A;  3TSS A;  4RGT A;  1Q8I A;  2B2Y A;  2HHH Q;  3DEP A;  4CJ2 C;  2C5C A;  4CGY B;  2Z6K A;  1X54 A;  3CF5 A;  5FKA C;  2QEX A;  5C5L A;  2E2H H;  1ENF A;  4JI4 L;  4C3H B;  3R8B A;  3M4O B;  1WTO A;  2F0T A;  1DCZ A;  5EJW A;  1M90 C;  1CA5 A;  1KLG D;  3HOV H;  3ICE A;  1WD0 A;  2G9H D;  4L5S A;  4HCE A;  1OXU A;  2K1B A;  1TXY A;  3FKI H;  5IGC A;  2DY7 A;  4Y7N H;  2NZ1 D;  1Q8K A;  5T1I A;  1YNJ C;  1D5X C;  4JPB W;  1IKM A;  3AFP A;  3D4D A;  3FDT A;  2JA5 G;  4B3S Q;  2K28 A;  1DON A;  4DV4 L;  3ND9 A;  2KBN A;  4LF4 L;  2B2T A;  4CDD C;  3S9W A;  2EYJ A;  2O4X A;  3A8I E;  4GN3 B;  1CA6 A;  1GD7 A;  4IPG A;  1H95 A;  3K80 C;  3M7N A;  1OTC A;  3W2D A;  1DOL A;  1WTQ A;  3GTQ B;  4BS9 A;  3J81 j;  1LT3 D;  5JJZ A;  3BZC A;  2MFI A;  3G6J B;  4DR3 Q;  1EIH A;  4DV7 L;  5C3E B;  4EQN A;  3JAM i;  3HOY G;  5TSS A;  1NSN S;  5KGU A;  1QWY A;  1Y14 B;  3GDE A;  3NWT A;  2VQE Q;  2Z0S A;  2A8V A;  3A8K E;  3QB3 A;  1EY5 A;  2NVX H;  2XVS A;  2X69 A;  2VZA A;  1BR9 A;  1YNJ D;  1F9Q A;  1ICW A;  4B3M L;  2WAQ E;  1YJN A;  4JC0 A;  3M85 A;  1STB A;  2VB2 X;  2K7V A;  1SR3 A;  4A3I H;  2GN5 A;  3BDC A;  1I94 L;  2JK8 A;  3ZYY X;  4ZKC B;  3Q8D A;  3LX0 A;  4KJN A;  2PI2 E;  1EQT A;  4IUU A;  2PMZ B;  1PRT B;  4DAY A;  4JG2 A;  4JI4 Q;  1B50 A;  1CUK A;  4OWX B;  1CM9 A;  3CU7 A;  2G5D A;  2DN8 A;  4DR4 L;  1T9H A;  4FYD A;  3HZX A;  1A3V A;  2B2Y C;  2K5N A;  2X6L A;  3E0E A;  2Y0S B;  1VDZ A;  3BYT B;  3I91 A;  5IGD A;  2HIV A;  2Z6K C;  4IUT A;  2JEB I;  4IJL A;  1BCP C;  2LXK A;  4C3J B;  2UXD L;  1NTG A;  1STN A;  5IYC G;  2AQ1 B;  1SYD A;  2BOS A;  4CBV A;  5COR A;  4DV4 Q;  4NXM L;  4DR6 L;  3FHW A;  4LF4 Q;  1W6K A;  4FF4 A;  3GV3 A;  3CQZ B;  3CC2 A;  4DGZ A;  1FJG L;  5C6A A;  1SJH D;  3WOF A;  5M5X H;  2WB1 E;  4OWT B;  2BA1 A;  3MEF A;  3TDQ A;  3H3V H;  1IBL L;  3HOX G;  1X55 A;  2D0O A;  2Y0S E;  3C2P A;  5ELE A;  3X3M A;  1KDA A;  4A3D H;  5IYB G;  1KNE A;  4OIJ A;  4NB3 A;  1E22 A;  3RLN A;  5FLM G;  3M4O H;  3VR3 A;  3S16 B;  3F2U A;  4DV7 Q;  2HQE A;  1GUW A;  1HHV A;  5JJI A;  1NCV A;  2I5H A;  4IUN A;  5HGQ A;  2JA5 B;  1GHJ A;  4FO2 A;  2UU9 L;  4DV2 Q;  2K14 A;  1NNX A;  1EL0 A;  4KI0 A;  4CDF C;  2QEJ C;  1EY8 A;  1UEA B;  1VMC A;  2K01 A;  1SE3 A;  3D6W A;  3NEL A;  4DXG A;  4DR1 L;  2RBM A;  4ZUI A;  1BCP D;  4V0B A;  2PW7 A;  4JI3 L;  2HUG A;  4B3M Q;  3P20 A;  2VS1 A;  2AUJ D;  4ILW A;  5IP9 H;  5GAD C;  3WWV A;  1VQG A;  4RMF A;  5D3I B;  3STB D;  2LFN A;  2F0J A;  3GTQ H;  4A3F G;  4JK1 C;  2CCZ A;  4KD3 A;  4OGQ C;  4DR4 Q;  1N8R C;  3RZO H;  1HR0 L;  1PTO B;  1U4P A;  3W1G A;  5C3E H;  1EUJ A;  2N78 A;  1A2U A;  1SYG A;  1JIC A;  5ISR A;  4IPC A;  4FF3 A;  1YJ9 A;  5IWA L;  4IFD H;  1JR0 D;  4RGO S;  2A74 C;  1S4Z A;  3I2Z A;  2UXD Q;  2KA7 A;  5IE8 A;  1ESR A;  4UP8 A;  4CJ1 B;  1ML0 D;  4DV5 L;  2D0P A;  4O2D A;  4A3E H;  1G2S A;  4HIO A;  3TP8 A;  4U67 3;  4NXM Q;  1JJG A;  4DR6 Q;  3AQQ A;  4OL7 A;  3VA7 A;  1CZG A;  5C4X G;  1VQ7 A;  2O5J C;  5GQO A;  4L5Q A;  2R6G A;  4TQU S;  3DWP A;  4K2L A;  4DV3 L;  1FJG Q;  4DF7 A;  2Z4H A;  3IAY A;  2F0K A;  2ICE C;  1L2F A;  5CMD A;  1W6J A;  1IBL Q;  1IL8 A;  4A93 B;  1U0L A;  3M4P A;  3IFD A;  2B39 A;  4IPD A;  5CV7 A;  4K0K L;  3A7L A;  3GV6 A;  2ZXP A;  3HOW H;  5JEA H;  4K2K A;  3U58 A;  3G71 A;  3SXH A;  1Q3L A;  2BE5 C;  5COY A;  2EYH A;  1KD1 C;  1UWV A;  2K52 A;  2R93 G;  3R3O A;  3AFQ A;  1NBW A;  5KYI A;  2UU9 Q;  1NR2 A;  2Q8T A;  5D14 A;  3J81 c;  1YNN C;  4NP5 A;  4JI1 L;  4GLX A;  3K0Y A;  2K04 A;  4C3J H;  2F1M A;  5KNC A;  4DNT B;  2K05 A;  1W3S A;  4DR1 Q;  3H6M A;  2F0L A;  5AFW A;  3T56 B;  4MHE A;  4JI3 Q;  3C46 A;  4OO1 I;  3HOX B;  1YIJ A;  1TQO A;  3CQZ H;  5F2D A;  1WTW A;  1MSH A;  5ELN A;  4G7Z C;  4QCL A;  1EEF D;  2IY5 B;  3PO2 G;  4IUP A;  4UPA A;  4KMU C;  3TQY A;  4CJ0 B;  2R92 B;  1KNA A;  1TS2 A;  2LMC B;  2PNH A;  3N52 A;  3I4M H;  4O0A A;  1XX8 A;  3KDF A;  5JOB A;  1GM5 A;  1HTL D;  1X6O A;  1U4M A;  1HR0 Q;  5GAE C;  2FJ2 A;  1LLR D;  1B8A A;  4X6A H;  3GTP B;  3SDZ A;  2SEB D;  3BVZ A;  1AW7 A;  3IRB A;  1STA A;  2JA5 H;  1SEB D;  1WTX A;  2Z1C A;  5IWA Q;  3URY A;  2L15 A;  1AH9 A;  3MC0 B;  1Y69 U;  3I4O A;  2UUC L;  4DV5 Q;  2WV6 D;  1J9O A;  3RZD B;  4H44 C;  4LUZ A;  1F2Y A;  3BZK A;  2BCO A;  2E2D C;  4DV3 Q;  1C8C A;  4LNQ A;  4LF5 L;  2ENB A;  3J7A 5;  5E3F A;  2EXD A;  1D1K A;  4A3F B;  1F2M A;  4B3R L;  3PIP A;  1F9P A;  4M1U B;  4K0K Q;  3D4R A;  2CW0 D;  1OXT A;  1PRT F;  3PUX A;  3S14 B;  4P75 A;  2EJM A;  2E74 C;  3OSO A;  4JI5 L;  3HKZ G;  4X66 L;  2ES2 A;  1JWS D;  1PTO H;  2XIW A;  2F0P A;  4BXX H;  1PZI D;  3G7L A;  2R7Z B;  1HZC A;  2OT2 A;  4X3T A;  4IOA A;  3EJI A;  1HJP A;  4RWS C;  4R4Q A;  1XMQ L;  3GO5 A;  3PIO 3;  3I73 A;  5CV4 A;  3GTJ B;  1RTN A;  3NPP A;  1V1P B;  3Q22 A;  5M3M H;  3C3L A;  3K5O A;  4J6H A;  1I50 H;  3A54 A;  3MFG A;  4IJH A;  2Z6B A;  3W5O A;  3A7A B;  4PMB A;  5FLX L;  1TWC B;  5JAV A;  3E6Z X;  3A5U A;  5I2X A;  1XNR L;  4P2C B;  4A93 H;  3J81 E;  1FL0 A;  2B8F A;  1YEZ A;  3K58 A;  1K83 B;  5ELD A;  4ZLT F;  4CHT B;  1I6V C;  2NVQ B;  2K5Q A;  4K5W A;  2NN6 I;  4C56 C;  1MSG A;  5IYC H;  3J80 L;  4BWG B;  5E1F A;  1WCM G;  3OWF A;  4N9T A;  4IZ8 A;  2GVB A;  2OQ0 A;  1V1O A;  4GNX B;  2UUC Q;  3UDG A;  3OMC A;  3GTG B;  1VQ5 A;  2F0U A;  1L1O B;  3J7Z C;  1S5F D;  1YNX A;  3TP6 A;  3PO2 B;  1EQR A;  3S2D B;  1I3Q H;  1X56 A;  1Y1V G;  1VQF A;  3CC4 A;  1CKN B;  4LF5 Q;  2SOB A;  2K5V A;  2R7D A;  5FJ8 H;  5IYB H;  3BDO A;  5J3B A;  2F03 A;  2ZXO A;  2EYL A;  4B3R Q;  2KUM A;  1N32 L;  2R92 H;  2AWN A;  1TWG B;  1RL2 A;  3CCE A;  2JA6 B;  3VR4 A;  3MEH A;  4X66 Q;  4JI5 Q;  3TS0 A;  4ZKB B;  3OPO A;  1R4Q B;  1PTO F;  2CVR A;  3MTS A;  1P8L A;  1VQB A;  3RMH A;  2QCP X;  1WVL A;  1D2B A;  3GTP H;  3M3Y B;  1YJW A;  5CV8 A;  1ICF B;  1XMQ Q;  1H9S A;  4JOI A;  1UNS A;  1MGS A;  4WJ3 M;  5K36 H;  1SNC A;  3JAM L;  1NUC A;  4XXE A;  4A3C H;  3RN2 A;  2F0F A;  3KF6 A;  4R4T A;  4K8I A;  3FRP B;  5KYL A;  4JW0 A;  1K73 C;  2MNA A;  2XRQ D;  5E7N A;  4CDC C;  1LT6 D;  1BBX C;  4MNO A;  2F3I A;  1XNR Q;  1S5E D;  4BY7 G;  1G6P A;  3HKZ B;  3DLL A;  4PQX A;  1B9N A;  1NMF A;  4Z9C B;  2K4K A;  4YCU A;  3S14 H;  4KD4 A;  5ELB A;  1GUN A;  4C2M B;  3UE0 A;  4XT3 B;  2NTS A;  3P75 A;  2M9V A;  1CQV A;  3R93 A;  1JOO A;  2J4X A;  2ASB A;  1Q90 A;  4ME3 A;  1AE3 A;  2R7Z H;  4YCW A;  5EKL A;  3FMC A;  4ZCK A;  3OW2 A;  1KIX A;  1TWA B;  1EWI A;  2CWP A;  3BDL A;  4OEL B;  3GTJ H;  1KQS A;  1E3P A;  4RA8 A;  4F8M A;  1IBM L;  5FO8 B;  2QF7 A;  3E0J A;  2AUK A;  2Q2I A;  4PZ6 A;  5IYD H;  1LTB D;  4WJW A;  2IHE A;  2F4V L;  2B3G A;  4H7B A;  4G4K A;  1N9W A;  2ZTC A;  4DK0 A;  4DUY L;  1GVP A;  1PH8 A;  1LAC A;  4RAU C;  1N32 Q;  2CKZ B;  3J7A V;  1K83 H;  3I56 A;  1JWM D;  3GD7 A;  2A73 B;  2VW9 A;  1EU3 A;  1WCM B;  4X3S A;  1MBY A;  2PW5 A;  2EZV A;  4V19 0;  2NUC A;  2NVQ H;  3SK4 A;  4OO1 G;  2E76 C;  1YVC A;  4JVZ A;  1ZKO A;  4KN4 C;  1CKM A;  4PZ7 A;  4KLK A;  2A69 C;  4B08 A;  1H9K A;  1I4G A;  1J6Q A;  4EQ5 A;  2AMC B;  5C5M A;  1I4P A;  2JA9 A;  4JBK A;  3DM1 A;  2L5T A;  2WB1 G;  1L0Y B;  3PF4 A;  1JC7 A;  4OIK A;  1Y1V B;  4MTK A;  1JT8 A;  3GTG H;  5M5Y B;  2ZM6 L;  1TY2 A;  2F0I A;  1K8A C;  3HOZ G;  1EQV A;  1D6E C;  2BH8 A;  2R61 A;  1A3T A;  2N8N A;  1RF2 D;  2VXW A;  2RHS B;  4TSS A;  2PQE A;  2G9D A;  3VDY A;  1WJJ A;  1YZ6 A;  2K33 A;  4JOI C;  1DXM A;  2ZJR A;  5FK9 C;  2D5D A;  2XRS D;  2ZT9 C;  3BG3 A;  4HJ7 A;  1E0B A;  4IN3 A;  1N33 L;  1LO5 D;  2B63 G;  4LUV A;  3O13 A;  1WTR A;  1TS5 A;  1BKB A;  4GLA C;  4KHV A;  2JA6 H;  3M4Q A;  4ULL A;  2QKI C;  1AN8 A;  4LMQ D;  4HCS A;  1QUQ B;  2JA8 G;  2KEN A;  1Q1E A;  1BO0 A;  1W2B A;  1XYI A;  2PO4 A;  4EQP A;  1STE A;  5HUR A;  1IHZ A;  3KJP A;  3CD6 A;  1XNQ L;  2A69 D;  4A3J G;  2RDH A;  4YCV A;  3PQI A;  1IBM Q;  3VYT A;  3T4A C;  4KV6 A;  1B9M A;  4QUF A;  4MN3 A;  4BY7 B;  1Q46 A;  4FXD A;  2IHF A;  1SLJ A;  1UAP A;  2CWA A;  3NBH A;  4XQQ A;  1GXD C;  1GKH A;  4HAE A;  2F4V Q;  4BBS B;  5NUC A;  1STY A;  3GTM B;  2Q8R E;  4XDX A;  2ZJQ A;  4RHS A;  4DUY Q;  3MXG A;  1R4P B;  3K7U C;  5CV6 A;  2L11 A;  4R9W A;  2KCN A;  4C3I B;  1X65 A;  1AE2 A;  1BF4 A;  1IYV A;  2WAQ B;  3KLW A;  4C2M H;  4F88 A;  1G6Z A;  3D6C A;  1XMO L;  2PZW A;  4DAV A;  4DV6 L;  1JMC A;  3CCJ A;  3ERO A;  4QB4 A;  3AYH B;  3CRK C;  1WTP A;  3PIP 3;  3MWY W;  4QIW E;  3D31 A;  4DV2 L;  3QWN A;  1TWA H;  1UUP A;  2M2L A;  1AEX A;  1K8G A;  4ODG A;  2UUB L;  5DLQ E;  1EQQ A;  2RKS A;  1E1T A;  3K7A B;  3NTI A;  2MQH A;  2DY8 A;  2ZM6 Q;  4DNR B;  4K14 A;  2Z8L A;  2NN6 G;  2EY6 A;  1YHQ A;  2JP1 A;  2JA7 H;  5IY0 A;  2CQO A;  1OO9 B;  1I6H B;  5IOD A;  3A0J A;  1X3Q A;  4A3K G;  3CMA A;  4KJO A;  1IW7 C;  1KL9 A;  3AMU A;  2Q2H A;  5M5W B;  1Z7T A;  1VQJ A;  3H09 A;  2E2I B;  3Q6S A;  1N33 Q;  2QW7 A;  2DNC A;  2PZT A;  4DV0 L;  1WCM H;  4LF7 L;  3KBG A;  4KKT A;  2YU9 B;  5C44 G;  3H0G G;  2KQ3 A;  5EPK A;  1CTM A;  1XPU A;  2WB1 B;  5EPL A;  1HNX L;  2RF4 A;  1JCK B;  4BA2 I;  3L0O A;  4Q5V A;  1AFP A;  2ALY B;  2L55 A;  1XNQ Q;  3S24 A;  2I46 A;  1A63 A;  1Q1B A;  4AYB G;  2WKC A;  2L0C A;  3H94 A;  1Y1V H;  1OXS C;  2K5H A;  3UDF A;  5M5Y H;  3CXC A;  1TWF B;  3J7A F;  5I6W A;  4GOP B;  2MO0 A;  3VR2 A;  5LHY 1;  4XIG S;  3G4S A;  4R4I A;  1XTD A;  5M3F G;  3HGB A;  2B63 B;  4AQY L;  3A56 A;  5DAU A;  5BN5 A;  2B2V A;  1PYW D;  3STB C;  1M8A A;  4EGV A;  3F1Z A;  2HIX A;  2OXP A;  1CSP A;  3P1H A;  1Q12 A;  2JA8 B;  5LMU L;  1S3O A;  4YHH L;  4X65 L;  4G7O C;  1ENA A;  2PQA B;  2F3V A;  2XSC A;  1IW7 D;  3TRZ A;  1Y1W G;  4P71 A;  4C3H H;  3K57 A;  1XMO Q;  4R4O A;  5IGF A;  4A3J B;  4QF4 A;  4YWM A;  1K3B C;  4DV6 Q;  2I0Q A;  1CHQ D;  1PZJ D;  4ZK9 B;  5C0X J;  1L0W A;  2N3S A;  4OXP A;  3KFU A;  4KY6 A;  1SYE A;  3S1R B;  3U4Z A;  4JI6 L;  2UUB Q;  2RCF A;  3KLS X;  1EY7 A;  3CKI B;  3NBI A;  1AP0 A;  1U4L A;  2XGT A;  2FMC A;  4NDX A;  1QZH A;  4K6L A;  2F0D A;  4BY7 H;  5C4J B;  1VQE A;  2E5L L;  1KRT A;  1E2W A;  1G29 1;  5DNF A;  3A55 A;  4DXF A;  3RLO A;  2YYZ A;  4BBS H;  3A5Z B;  3TBI B;  1GUG A;  3S15 B;  3KF8 A;  1KAW A;  1VQ4 A;  2A19 A;  1VCI A;  1GHK A;  1EFI D;  4C3I H;  5BR8 L;  4A3L H;  3H3V I;  1FNV A;  1O7Z A;  4DV0 Q;  3HOY B;  1P16 A;  4LF7 Q;  4N8F A;  1LTA D;  2K32 A;  1HNX Q;  1V9P A;  1N34 L;  1LTI D;  1EIG A;  3G48 A;  1QOH A;  2RA4 A;  1LT5 D;  3PF5 A;  4A75 A;  1X32 A;  1FNW A;  2TSS A; 
#chains in the Genus database with same CATH homology
 3CCL A;  4L5R C;  4LF9 L;  3CCV A;  3E9I A;  1HJP A;  1UEB A;  2VL6 A;  4P73 A;  3K0X A;  4R4Q A;  3K7A H;  4LFC L;  1GO3 E;  4QGU A;  4A3M H;  3GO5 A;  3RNU A;  2WAQ G;  1PH3 A;  4DPG A;  3CAM A;  5M3M H;  3ULJ A;  2C35 B;  3BJU A;  2BA0 A;  4QQB X;  3CPF A;  2OCE A;  5C3E G;  1I50 H;  2ATW A;  1PH1 A;  2ID0 A;  2HQL A;  4IJH A;  3W5O A;  4AQY Q;  4BXX G;  3HKZ E;  4B3S L;  1I6H H;  1VQK A;  4LF6 L;  4HIM A;  4GOP C;  4H02 A;  2I5M X;  1VQL A;  5FLX c;  4NXN Q;  4NPS A;  1C0A A;  4PMW A;  1DGS A;  4JI8 Q;  2KHI A;  2RCN A;  3A5U A;  5LMU Q;  4P74 A;  4YHH Q;  4X65 Q;  3ULP A;  2E2I H;  1YI2 A;  2AWO A;  1XNR L;  4A3G H;  4GN5 A;  2VUM H;  3RR5 A;  1YHA A;  4IOC A;  4A93 H;  1JJC B;  3JC6 6;  4DNI A;  4EX5 A;  1FL0 A;  5M3M G;  3CCQ A;  4LUO A;  1MKH A;  1S40 A;  1YEZ A;  2UXC L;  2YU9 H;  1HNW L;  1PH6 A;  3BU2 A;  3K81 C;  4JCV E;  4DUZ Q;  3PCO B;  1Q81 C;  3FP9 A;  4A3B H;  2NN6 I;  4GN4 B;  3I7F A;  4GNX A;  5H1S E;  5IYC H;  4JI6 Q;  4HJ9 A;  1LUZ A;  3G6E A;  3J80 c;  1WCM G;  4FDB A;  4DR3 L;  1L1O A;  4A3G G;  4YY3 L;  2ZTD A;  3UDI A;  2GVB A;  4UP7 A;  1N36 Q;  4A93 G;  1WOC A;  2OQ0 A;  3PO3 H;  4GNX B;  2UUC Q;  4IFD I;  4HJ8 A;  1SFO H;  3UDG A;  4JYA Q;  5ELO A;  1VQ5 A;  2VNU D;  1CKN A;  4ALP A;  1X9N A;  4B3T L;  1L1O B;  2QA4 A;  2DUD A;  2E5L Q;  3J7Z C;  1YNX A;  2VQE L;  1RIP A;  3L2P A;  2Y0S G;  2YTX A;  4A3B G;  4PG3 A;  2B63 H;  2EIF A;  3CW2 C;  1EQR A;  2IX0 A;  1C9O A;  1I3Q H;  1JE5 A;  1X56 A;  1VQF A;  1Y1V G;  1CKN B;  4AYB E;  3CC4 A;  4LF5 Q;  5EAY A;  2FXQ A;  2K5V A;  2R7D A;  5FJ8 H;  2NZO A;  4LF8 Q;  5IYB H;  5J3B A;  1V1Q A;  1ASY A;  3ZJY C;  2PMZ E;  5BR8 Q;  2HHH Q;  3PO3 G;  4B3R Q;  2VQF L;  1N32 L;  2Z6K A;  2R92 H;  4BY1 H;  2AWN A;  1X54 A;  3CF5 A;  1N34 Q;  1RL2 A;  3CCE A;  3S16 H;  2QEX A;  4A3J H;  2E2H H;  4JI5 Q;  4X66 Q;  3TS0 A;  4JI4 L;  1VQD A;  1MIU A;  3HOU G;  1P8L A;  1VQB A;  2BH2 A;  1WFQ A;  5FJ8 G;  3GTP H;  4DKA C;  1YJW A;  1EYG A;  3F2B A;  4LF9 Q;  1M90 C;  4LFC Q;  1XMQ Q;  3HOV H;  4JOI A;  3ICE A;  3I4N G;  4WJ3 M;  1X3E A;  1PFS A;  1YHB A;  4L5S A;  1OXU A;  2R92 G;  3JAM c;  1IL2 A;  1TXY A;  2LSS A;  3KOJ A;  4A3C H;  3RN2 A;  5C0X G;  3FKI H;  4LFA L;  4A4I A;  3KF6 A;  4Y7N H;  1YIT A;  4R4T A;  1Q8K A;  3GTM H;  3AFP A;  3OTO L;  2I5L X;  2JA5 G;  4B3S Q;  1K73 C;  2MNA A;  4LF6 Q;  4DV4 L;  5E7N A;  2KBN A;  4LF4 L;  4BBR G;  3CME A;  3KF6 B;  1Z9F A;  4MNO A;  1QZG A;  3HOV G;  1XPR A;  3NEM A;  3U50 C;  2F3I A;  5K36 G;  4LFB L;  1XNR Q;  4BY7 G;  1G6P A;  1CSQ A;  4GN3 B;  1PYB A;  1SRO A;  3HOY H;  3CPW A;  4A3C G;  3DLL A;  1LTL A;  1NMF A;  3FKI G;  1X3G A;  2K4K A;  4YCU A;  3S14 H;  2UXC Q;  1IYJ B;  1GD7 A;  4IPG A;  5IP7 H;  1HNW Q;  1H95 A;  3K80 C;  4JI2 L;  3M7N A;  1VQP A;  4R4C A;  1I94 Q;  4K0K L;  3UE0 A;  4HID A;  1OTC A;  4Y52 H;  3TS2 A;  3GTO H;  1V43 A;  1YBY A;  3J81 j;  4X64 L;  2ASB A;  3BZC A;  2MFI A;  4ME3 A;  1B7Y B;  1AE3 A;  4DR3 Q;  2R7Z H;  4YCW A;  4J15 A;  3L7Z C;  2UXB L;  4DV7 L;  3AEV A;  4YY3 Q;  1D8L A;  3OW2 A;  1PHJ A;  4IPH A;  3JAM i;  1KIX A;  1PVO A;  3HOY G;  2K50 A;  1EWI A;  4YWL A;  4UP9 A;  2CWP A;  2B29 A;  3GTJ H;  1KQS A;  3UDX A;  1E3P A;  1VS0 A;  1WYD A;  1IBM L;  1Y14 B;  4DAM A;  4B3T Q;  1K3R A;  3GDE A;  1J5E L;  2VQE Q;  2Q2I A;  1BVS A;  2Z0S A;  4DV1 L;  1BBW A;  4MTN A;  2A8V A;  3A74 A;  4PZ6 A;  5M5W H;  4GNX C;  4A3M G;  5IYD H;  2R7Z G;  2NVX H;  1JB7 A;  1NE3 A;  2IHE A;  2VZA A;  1UE7 A;  1B70 B;  2F4V L;  2NVY H;  1L1O C;  2B3G A;  4JI7 L;  4B3M L;  2IX1 A;  1VQC A;  2WAQ E;  1N9W A;  2ZTC A;  3M9B A;  2JQO A;  1PA6 A;  4UY8 C;  1YJN A;  4JC0 A;  2GVA A;  4DK3 C;  3M85 A;  3TEH B;  2VQF Q;  4DUY L;  1GVP A;  1SR3 A;  4A3I H;  2GN5 A;  2E2J H;  1PH8 A;  1I94 L;  2JK8 A;  1N32 Q;  1EOV A;  2CKZ B;  1K83 H;  3Q8D A;  3I56 A;  3PGZ A;  3GD7 A;  3EN2 A;  4DR5 L;  2VW9 A;  2WP8 J;  2PI2 E;  1S72 A;  4DK6 C;  1PV4 A;  3S2H H;  4JG2 A;  2NVQ H;  4JI4 Q;  4OO1 G;  1YVC A;  1E7Z A;  3F2D A;  1CKM A;  5IYD G;  4PZ7 A;  4KLK A;  1Q82 C;  1CUK A;  2HT1 A;  3HOZ H;  4OWX B;  5LMN L;  1J6Q A;  2VUM G;  4EQ5 A;  1VQN A;  2AMC B;  4DR4 L;  1T9H A;  1SN8 A;  4DAY B;  2K5N A;  1Q86 C;  1TWF H;  2JA9 A;  3E0E A;  3F8T A;  4JBK A;  3CCM A;  4A3I G;  1FGU A;  2WB1 G;  4HJA A;  1PH5 A;  2HIV A;  2XTI A;  2Z6K C;  3PF4 A;  2JEB I;  4LFA Q;  1JT8 A;  2EQS A;  4IJL A;  3GTG H;  5JJK A;  2LXK A;  3HOX H;  2UXD L;  1NTG A;  5IYC G;  4OX9 L;  2ZM6 L;  1CKO A;  3OTO Q;  4JI0 L;  1K8A C;  3HOZ G;  4R1J A;  3S17 H;  3EIV A;  3F2C A;  2BH8 A;  4DV4 Q;  3FHW A;  4NXM L;  4LF4 Q;  4OWW B;  4DR6 L;  4IO9 A;  2N8N A;  2JA8 H;  1PYS B;  2YV5 A;  2RHS B;  2WFW A;  5FLM H;  1LYL A;  3VDY A;  1YZ6 A;  1WJJ A;  4JOI C;  3CC2 A;  2ZJR A;  1HZ9 A;  4LFB Q;  2YTY A;  1MJE A;  1I5F A;  1FJG L;  1VQ8 A;  2RHQ B;  2IT1 A;  5M5X H;  4HJ7 A;  2WB1 E;  4OWT B;  2BA1 A;  3MEF A;  3H3V H;  1K0R A;  1QUQ A;  1N33 L;  2B63 G;  1QVC A;  4OON A;  4LUV A;  1IBL L;  4JI2 Q;  3HOX G;  1X55 A;  2D0O A;  1BKB A;  2Y0S E;  4GLA C;  2JA6 H;  3M4Q A;  4DR2 L;  1PH4 A;  4MZ9 A;  3S1R H;  3S1M H;  5IYB G;  1PH9 A;  4A3D H;  1EIF A;  4X64 Q;  1QUQ B;  2JA8 G;  2KEN A;  2MO1 A;  1Q1E A;  4NB3 A;  1E22 A;  3RLN A;  5FLM G;  1W2B A;  3M4O H;  2UXB Q;  4DV7 Q;  4GS3 A;  4BY1 G;  2KHJ A;  3KJP A;  3CD6 A;  1XNQ L;  2V1C C;  1R9T H;  5JJI A;  2I5H A;  5HGQ A;  4A3J G;  5C4J H;  4YCV A;  3ER0 A;  2UU9 L;  4AH6 A;  2K14 A;  4DV2 Q;  2D62 A;  1Q7Y C;  1IBM Q;  4KI0 A;  2JA6 G;  3RZD H;  1J5E Q;  2AHO B;  1IBK L;  3S15 H;  1LM0 A;  4A3D G;  2E8G A;  4DV1 Q;  2OQK A;  3TRE A;  1Q46 A;  3NEL A;  3UE1 A;  2UUA L;  2IHF A;  3RLF A;  4DR1 L;  1SLJ A;  2CWA A;  1E1O A;  4AIM A;  1GKH A;  4JI3 L;  4A3F H;  1EFW A;  2F4V Q;  4JI7 Q;  1HH2 P;  4B3M Q;  1NMG A;  2VS1 A;  4A76 A;  2JEA I;  2ZJQ A;  4DUY Q;  1JJ2 A;  1HNZ L;  3NBH B;  3K7U C;  5IP9 H;  1X65 A;  1AE2 A;  5GAD C;  4DR5 Q;  2AKW B;  3WWV A;  1XMQ L;  3KLW A;  2PI2 A;  1VQG A;  3HFZ B;  4RMF A;  3SGI A;  3W1B A;  4C2M H;  1G51 A;  3T1H L;  4POG A;  5C0X I;  4KHP L;  5GRO A;  3STB D;  3GTK H;  1A62 A;  1XMO L;  1D7Q A;  3GTQ H;  5LMN Q;  1JMC A;  4GLV B;  4DV6 L;  4L5T A;  4A3F G;  3CCJ A;  2CCZ A;  3AYH B;  4DR4 Q;  5C4X H;  2LXJ A;  1N8R C;  3RZO H;  1HR0 L;  4POF A;  1QVF A;  1BBU A;  4LW1 A;  3W1G A;  1FVI A;  4QIW E;  4QY7 A;  3D31 A;  1EUJ A;  2N78 A;  5IP7 G;  5C3E H;  4DV2 L;  1TWA H;  4A3K H;  3S1Q H;  1VQH A;  3CC7 A;  1K8G A;  2UUB L;  3CP0 A;  5DLQ E;  4IPC A;  1EQQ A;  1YJ9 A;  5IP9 G;  1E1T A;  1M1K C;  5IWA L;  4IFD J;  2KCT A;  1SMX A;  3CCU A;  1UE6 A;  1XJV A;  2MQH A;  2H5X A;  3I2Z A;  3PV0 A;  4KHZ A;  2UXD Q;  4OX9 Q;  5IE8 A;  3I55 A;  2ZM6 Q;  4UP8 A;  1TWC H;  4JI0 Q;  1HZB A;  4QL5 A;  4JI1 Q;  4DV5 L;  2D0P A;  4O2D A;  4A3E H;  3PUZ A;  1OXX K;  2ZTE A;  1IXR A;  4HIO A;  2NN6 G;  5C44 H;  3H0G H;  4NXM Q;  4DR6 Q;  1YHQ A;  3AQQ A;  1JJG A;  2JA7 H;  5IY0 A;  5C4X G;  1NY4 A;  4JV5 L;  2CQO A;  5IT9 c;  1VQ7 A;  4QJF A;  5JJL A;  5GQO A;  4L5Q A;  2K75 A;  2R6G A;  3A0J A;  4TQU S;  4A3K G;  3CMA A;  3KJO A;  4DV3 L;  1FJG Q;  2R93 H;  1KL9 A;  1O7I A;  4DR7 L;  2Q2H A;  1VQ9 A;  2QGQ A;  1MJC A;  1EIY B;  1VQJ A;  3KYH C;  4IFD G;  1L2F A;  1N33 Q;  4GKJ L;  3PUY A;  1IBL Q;  1XPO A;  1UE5 A;  1U0L A;  3M4P A;  1Z47 A;  4DV0 L;  1WCM H;  4IPD A;  2ZJP A;  5LMN W;  5JEA J;  4HIK A;  4DR2 Q;  4A3E G;  4LF7 L;  3HOW H;  5AJ3 L;  3U58 A;  4TVA B;  3H0G G;  5C44 G;  1QVG A;  3G71 A;  2Q2U A;  1XPU A;  1HNX L;  4BA1 I;  2JA7 G;  4GKK L;  2RF4 A;  4YWK A;  4X62 L;  3PUW A;  5M3F H;  4XTC S;  1KD1 C;  2KCM A;  3L0O A;  4BA2 I;  2Q2T A;  1UWV A;  2ALY B;  2K52 A;  2R93 G;  2F52 A;  1XNQ Q;  3S24 A;  3T1Y L;  1A63 A;  4GOP A;  3ERS X;  1Q1B A;  3AFQ A;  1NBW A;  4AYB G;  2UU9 Q;  3J81 c;  3CCS A;  1VQI A;  4JI1 L;  4GLX A;  1Y1V H;  3PO2 H;  1OXS C;  1IBK Q;  4PZ8 A;  3HOW G;  2K5H A;  4C3J H;  3UDF A;  5M5Y H;  5JEA G;  3CXC A;  1NJI C;  3S2D H;  4GOP B;  2MO0 A;  1Y1W H;  2OTJ A;  1E24 A;  4XIG S;  1W3S A;  4DR1 Q;  2UUA Q;  3EBE A;  3G4S A;  4R4I A;  2CFM A;  1XTD A;  5M3F G;  3DM3 A;  3CCR A;  4JI3 Q;  3B6Y A;  4OO1 I;  4AQY L;  2R7F A;  1VQM A;  2PQA A;  1YIJ A;  3CQZ H;  1X3F A;  3STB C;  3U4V A;  2OWO A;  5ELN A;  4NXN L;  3F1Z A;  2HIX A;  1HNZ Q;  4LWC A;  3GTL H;  1TWG H;  2IY5 B;  4JI8 L;  1CSP A;  4HJ5 A;  1Q12 A;  3HOU H;  3PSI A;  3PO2 G;  5LMU L;  1S3O A;  4YHH L;  4X65 L;  4UPA A;  2JE6 I;  1SRU A;  2PQA B;  1SE8 A;  3T1H Q;  3TRZ A;  3TQY A;  4P71 A;  1U5K A;  1UE1 A;  3LGJ A;  4C3H H;  1Y1W G;  4KHP Q;  5GAG C;  3I4N H;  1XMO Q;  4R4O A;  3M3Y H;  2PNH A;  4YWM A;  3I4M H;  4DUZ L;  4O0A A;  4DV6 Q;  2I0Q A;  3KDF A;  2JJQ A;  1GM5 A;  1X6O A;  3PUV A;  5C0X J;  1L0W A;  2N3S A;  4OXP A;  3RN5 A;  1HR0 Q;  4APV A;  3KFU A;  3K8A A;  2VY3 A;  5GAE C;  1B8A A;  3J81 i;  4X6A H;  3U4Z A;  3D0F A;  4JI6 L;  2NVT H;  2UUB Q;  5GAH C;  3IRB A;  3J80 i;  1VQA A;  1OXV A;  2A1A A;  3KDF B;  2JA5 H;  5IWA Q;  1KHI A;  2XGT A;  1N36 L;  2L15 A;  1AH9 A;  4BBR H;  1QZH A;  3I4O A;  2UUC L;  1KXL A;  2DGY A;  1HZA A;  4DV5 Q;  4JYA L;  3H15 A;  3S1N H;  3I4M G;  3NEN A;  4BY7 H;  4WJ4 A;  1PH7 A;  1VQE A;  2E5L L;  1KRT A;  4JV5 Q;  1G29 1;  3OYY A;  3RLO A;  2YYZ A;  4LUZ A;  2OTL A;  4BBS H;  3A5Z B;  1TWH H;  4JBJ A;  3BZK A;  2N49 A;  3E9H A;  1A0I A;  1WI5 A;  4DV3 Q;  1C7Y A;  1ASZ A;  4LNQ A;  4LF5 L;  4DR7 Q;  1KAW A;  1VQ4 A;  1K9M C;  1VQ6 A;  3J7A 5;  2EXD A;  4LF8 L;  2A19 A;  1VCI A;  4GKJ Q;  1VQO A;  4C3I H;  5BR8 L;  1KC8 C;  2HHH L;  4A3L H;  3H3V I;  4B3R L;  3PIP A;  3MXN B;  1A8V A;  3KF8 B;  1P16 A;  4DV0 Q;  1PH2 A;  4LF7 Q;  4P72 A;  1OXT A;  3PUX A;  3ULL A;  4K0K Q;  5HY6 A;  4P75 A;  5AJ3 Q;  1HR0 W;  1IZ6 A;  1HNX Q;  1V9P A;  1N34 L;  4GKK Q;  4A3L G;  3G48 A;  4X62 Q;  4JBM A;  4JI5 L;  3HKZ G;  4X66 L;  4RG1 A;  3PF5 A;  1KRS A;  2ES2 A;  4BBS G;  4A75 A;  2YTV A;  4BXX H;  3HKS A;  3T1Y Q;  2NZH A;  3PIO A;  4JBW A;  1HZC A;  4IOA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...