4JI1L

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
124
structure length
123
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKLLGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 14
structure length 123
sequence length 124
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4ji1L00
4A3CH 3CCVA 4GNXA 4KI0A 3CD6A 2HT1A 3HOWG 1FGUA 2B29A 3KF8B 4BBRH 2LSSA 5FJ8H 3PO2H 3T1YQ 4L5RC 3D31A 3UDXA 2JA6H 3STBD 3ULPA 4GOPA 3PF4A 1XPOA 4A3EG 4NXMQ 1YVCA 5M3MH 1K0RA 5GAHC 1N34L 3A74A 3GTOH 1IXRA 3AYHB 2DUDA 4GLVB 3UE1A 5BR8L 4DV3L 2JA5G 3RZDH 1PH8A 3CP0A 3G71A 1E1TA 3DM3A 2OQ0A 1Q7YC 1SROA 4C2MH 2JA8H 2UXCQ 1NMGA 2VQFQ 2F4VL 4IPDA 1A0IA 1Y1WH 2N3SA 3EBEA 1RIPA 4HJ8A 3M4PA 1EWIA 4X64Q 1KRSA 2ZTEA 5LMUQ 4GS3A 2JA5H 1XNRL 4JI6Q 1LM0A 3I4OA 5LMNL 3CAMA 1HNZL 4WJ4A 1B7YB 2OQKA 2NVTH 2N78A 4BY1G 4DPGA 3CXCA 1VQKA 3T1HQ 1PH2A 4OWWB 2YTXA 1KAWA 1PH3A 1NMFA 4DAMA 1XPUA 4JBWA 3HOXG 2GVAA 3A5ZB 4DUZQ 4DKAC 4IOCA 1OXTA 3ULLA 2NVYH 2B63H 5IYDH 4GN5A 3AFPA 1JT8A 2BA1A 2UXBL 4OONA 4OO1I 4LUZA 2JA7G 3WWVA 1VQHA 1NTGA 2IX0A 3NENA 1HH2P 1SN8A 2NZOA 4LFAL 2YYZA 5M5WH 4R4QA 3KLWA 2VQEL 3JC66 2IHFA 4DV0L 1KD1C 3DLLA 4BA2I 1NY4A 4OWTB 4HJAA 3KF6A 4A3EH 4H02A 3S1RH 2H5XA 1N8RC 1E24A 4K0KQ 4A76A 3HOYG 4QY7A 3CC7A 3I4NH 1HZAA 4IFDJ 3I4MH 3PCOB 2F3IA 4LFCL 3HOZH 1BBWA 1U0LA 2KCMA 2K5HA 1Z9FA 2K50A 2I0QA 4LF6Q 1YJ9A 4DUYL 1VQLA 2R7ZG 3NBHB 3GD7A 5IT9c 4BA1I 4L5TA 2RHSB 3RLFA 4BBSH 1MJCA 1VQBA 4DK6C 1Q8KA 1VQOA 1PH7A 4A3BG 1UE1A 4RG1A 3K81C 5LMNQ 1HNZQ 4B3SL 3BZKA 4AYBG 2MO1A 3IRBA 3FHWA 2E5LQ 1YHAA 1S40A 4LUOA 4IPCA 5FLMG 2NN6I 4YY3Q 1PYBA 3RR5A 2E2IH 3ZJYC 3J80i 1B70B 4HJ7A 1MKHA 1X65A 4IPHA 4JOIC 5GAGC 4POGA 2A8VA 2QGQA 3FKIG 1UEBA 1MJEA 2UXCL 1RL2A 1KRTA 1D7QA 1OXXK 1WYDA 1E1OA 2JK8A 2UUBL 5C3EG 4DR2L 2ZJRA 2D62A 5M3FG 2JJQA 4R1JA 3CCRA 3PV0A 1S72A 4B3SQ 2XTIA 3PSIA 1SE8A 2Y0SE 2Q2UA 3PUXA 3FKIH 2VQEQ 1L1OA 2B3GA 3KF6B 2ZM6L 3MEFA 3S2DH 1PVOA 3S15H 2WP8J 4B3RQ 3PIOA 3Q8DA 3CF5A 4IFDI 1Q1EA 2MO0A 1IYJB 1DGSA 5C44H 1YJWA 4MNOA 4LF4Q 4YWLA 1SMXA 3KJPA 2UXDL 3ER0A 5C4JH 3UDIA 1X55A 4JOIA 2PQAB 2YTYA 2ZJPA 4DR4L 1VQFA 4DR5L 1L2FA 4A3JG 1M90C 1N32Q 5GAEC 1X6OA 4YCUA 4LNQA 4XTCS 3MXNB 4GOPB 4QQBX 1YITA 1TWGH 4B3TQ 4R4IA 4R4OA 1I3QH 2I5HA 1V9PA 1L1OC 1QVCA 1KL9A 1EQQA 2UXDQ 5IYDG 1K9MC 4LF9Q 3M3YH 2YU9H 4LF6L 4DV1Q 4P71A 3M4QA 1Q12A 4X62Q 4Y7NH 4DV7L 4DUZL 2CFMA 2VW9A 3VDYA 3I4NG 3HOUG 5GROA 3PF5A 3A5UA 4QL5A 2UU9Q 1X3GA 1X3FA 1PH9A 1NE3A 5K36G 1J5EQ 2GVBA 1VS0A 1N36L 4OX9L 3AEVA 4A3LH 1G6PA 3H15A 1ASYA 1JMCA 4DR7Q 1E22A 1XNRQ 4X65L 5HY6A 4BBSG 3F8TA 1CSPA 3H0GH 4JI1Q 1K8AC 3L2PA 2R7FA 2OTLA 4JI0Q 1NBWA 1AH9A 1A8VA 3JAMc 1L0WA 1XMOL 1OXVA 1K83H 1XMQQ 1PH4A 1YZ6A 1I50H 4UPAA 4YY3L 5C44G 3GO5A 3TS0A 2RF4A 2VZAA 2AWNA 2R92G 4JV5Q 3CC2A 4JI3Q 1A62A 3U58A 1S3OA 1Q82C 1Y1VG 2JA9A 4EX5A 3S2HH 5HGQA 4A3MH 1N36Q 4OX9Q 2R92H 1AE3A 3PUVA 1Y1WG 1I5FA 4A3DH 3K0XA 5H1SE 1O7IA 1OXUA 2LXJA 4DK3C 4DV6L 2UUAQ 5IYCG 4JI5Q 1EYGA 4P72A 2PNHA 4YWMA 1EQRA 1KQSA 3HKSA 4B3RL 1HR0W 4LF7Q 4GN3B 2Y0SG 5C4XG 4LFBQ 1XJVA 2K52A 5ELOA 2BH8A 4DV5Q 1T9HA 1X54A 3BZCA 3OW2A 1IBKL 3TS2A 4DV4Q 4L5QA 4LF8L 2ZTCA 2GN5A 1PV4A 3HOVG 4POFA 5BR8Q 2KENA 1XNQL 3CC4A 4BY7G 2CWAA 5DLQE 1IBLL 1IBMQ 1G291 1UE7A 3GTGH 5JEAJ 3J81i 2WAQG 4A3KH 3HOYH 4AH6A 1BVSA 4Y52H 2E8GA 5GQOA 4GNXC 2JA8G 2A1AA 1L1OB 1VQ8A 2HHHL 3KJOA 1E3PA 2WB1G 2E5LL 1C9OA 1QUQA 2R7ZH 2K75A 3W5OA 4GKKQ 1FL0A 4A3KG 4OWXB 4DV3Q 1JE5A 3ERSX 1HJPA 2CWPA 2ZM6Q 4HIOA 3PUYA 2IY5B 1VQAA 3K8AA 3CCUA 2Q2HA 2UU9L 1SLJA 4BY1H 3M4OH 3SGIA 1TWFH 1N9WA 1A63A 3KYHC 2K5NA 4C3IH 5GADC 4DV2L 4O2DA 2DGYA 3CW2C 3GTJH 5LMUL 1I94L 1WJJA 1VQ4A 4YHHQ 5IY0A 1HR0Q 1W3SA 3BJUA 1VCIA 3I56A 1FVIA 4DR2Q 1JB7A 2VUMG 2NVQH 4JG2A 2R6GA 1XTDA 5IYBH 1XMOQ 1VQNA 1YEZA 2F4VQ 2JA7H 4JI8L 3F2BA 5C4XH 4JI0L 1HNWQ 1K8GA 1GKHA 5IP7H 3W1GA 5M3FH 2VUMH 3CCQA 4NPSA 1JJ2A 1I94Q 4HIMA 3K7AH 4JI3L 1Z47A 2ALYB 3LGJA 4JC0A 5M5XH 4DV4L 1PA6A 4LF8Q 4A3CG 3L0OA 2ID0A 4DR4Q 5FJ8G 4ALPA 2A19A 4NXNL 3PO2G 4MTNA 2ES2A 4IJLA 3L7ZC 3U50C 3J81j 3CCJA 3RNUA 1LTLA 1VQPA 1R9TH 3EIVA 2K4KA 1VQCA 4JI5L 4DV6Q 4YCWA 1KIXA 2UUAL 3OTOQ 4MZ9A 4HIKA 2NN6G 4A3FG 1VQ6A 4IOAA 1J5EL 1CKNB 3RN5A 3S24A 3B6YA 3J7ZC 4ME3A 5JJKA 2D0OA 2EQSA 4PZ8A 3RN2A 4A3GG 3OYYA 4KHPL 3GTPH 3I7FA 2CCZA 3CPWA 3CMAA 3K7UC 2ATWA 5IWAL 4A3IG 4DNIA 3GTMH 1HNWL 3CMEA 1EIYB 4A3DG 1VQJA 4DR3Q 2VQFL 1IL2A 3E9HA 4B3MQ 1YNXA 5JJLA 1TXYA 4JI1L 3UE0A 4QGUA 3F2CA 2KCTA 1TWCH 1WCMH 1NJIC 1VQGA 1VQEA 2PI2A 1HZBA 3NELA 4LUVA 1Q1BA 2I5LX 1C7YA 3HOVH 3S1MH 5JEAG 4R4CA 4HJ9A 4X66Q 3E0EA 1K73C 3PGZA 3CCEA 4JV5L 2Z0SA 3G4SA 4DV1L 1GM5A 2K14A 3EN2A 1VQ5A 3J81c 2YTVA 1UE5A 4X6AH 4B3ML 1YI2A 1OTCA 4DR1Q 2YV5A 4GLAC 1VQMA 2Q2TA 5C0XJ 3M9BA 4JI2Q 2NVXH 1TWAH 1IBLQ 4OXPA 1CKNA 1YBYA 4X66L 3PUZA 4A3MG 4A4IA 1X56A 4IO9A 1VQ7A 2D0PA 4GN4B 3TREA 1YJNA 3RZOH 5AJ3L 1WFQA 3HKZE 2JA6G 4DV5L 2Z6KC 2CKZB 4JI4Q 4JI7L 3AQQA 4DUYQ 4C3HH 4X62L 1HNXQ 3A0JA 3UDFA 1I6HH 1P16A 2ZTDA 1EOVA 1CSQA 2JEAI 3PO3H 3GTQH 4PG3A 2KHIA 2AHOB 4HIDA 1MIUA 4JYAQ 1BBUA 1FJGQ 3M85A 5AJ3Q 1G51A 2VY3A 5ELNA 3HKZG 1YIJA 2IX1A 3U4VA 1QVFA 3E9IA 1GO3E 4IPGA 2LXKA 4UY8C 4DV7Q 1PHJA 4KHPQ 4AIMA 1PH1A 5C3EH 4DR6Q 3S17H 4JI8Q 1SR3A 2HIVA 3PIPA 4LFBL 3NEMA 4A93G 2JQOA 3I4MG 5IP9G 1J6QA 1EIFA 2L15A 2Z6KA 3H3VI 2HQLA 2RHQB 3J7A5 1B8AA 5FLXc 4X65Q 4BXXG 4P75A 2R93G 1N34Q 3M7NA 2JE6I 4PZ6A 1UWVA 1SFOH 3S14H 3ICEA 3KOJA 3HFZB 3JAMi 2AMCB 1PFSA 3F2DA 3CCMA 1CUKA 2PQAA 3G6EA 4A3BH 2WAQE 4J15A 1YHBA 4BXXH 4JI6L 3T1YL 2UUBQ 2OWOA 5IYCH 3OTOL 2JEBI 4IFDG 4XIGS 5IYBG 3TEHB 4LFCQ 3H3VH 3G48A 1KXLA 1WI5A 1U5KA 2V1CC 5EAYA 3I55A 1JJCB 2CQOA 3I2ZA 3S1QH 2ASBA 4JCVE 1QZHA 1VQIA 1Y14B 2AKWB 2VNUD 3T1HL 2VL6A 5IWAQ 3H0GG 1WCMG 1GD7A 4KHZA 2EIFA 2FXQA 4DV2Q 2AWOA 1W2BA 1Q86C 1IBML 4C3JH 3K80C 4QJFA 2E2HH 4BY7H 1EFWA 1VQ9A 1LYLA 1QUQB 3AFQA 1OXSC 4BBRG 2E2JH 3HOUH 1IBKQ 2MQHA 2UUCL 4OO1G 4AYBE 4GKKL 1HNXL 1QZGA 1V43A 2OCEA 2RCNA 2VS1A 4A93H 4LW1A 4TVAB 4JI4L 4LF7L 4A3LG 1PH6A 5C0XG 3CCSA 5M3MG 4FDBA 4DR3L 2N8NA 4EQ5A 4B3TL 2BH2A 4A3GH 1PYSB 2C35B 3J80c 4AQYL 4UP7A 4UP8A 4APVA 4L5SA 2EXDA 3PO3G 3UDGA 4A3IH 1LUZA 4GKJL 4R4TA 3CPFA 4DR5Q 1C0AA 4DV0Q 3S16H 1SRUA 4JI2L 3TRZA 1D8LA 2B63G 4LFAQ 1X3EA 4DR1L 4A3FH 1XMQL 1HZCA 3BU2A 2HHHQ 2BA0A 5FLMH 1VQDA 2WFWA 1Q81C 4DR6L 5J3BA 2IHEA 2KHJA 1QVGA 4LF5L 4K0KL 4O0AA 2N49A 3HOWH 4PZ7A 1ASZA 2QA4A 1KC8C 1V1QA 3PUWA 4JBJA 4JBMA 4DR7L 4NB3A 4YHHL 1X9NA 1HR0L 4GKJQ 3D0FA 2XGTA 3HOXH 4NXML 4IJHA 3FP9A 2I5MX 4PMWA 1YHQA 1XPRA 1N33Q 3GTKH 1BKBA 1PH5A 2NZHA 4NXNQ 1N32L 1H95A 1E7ZA 1WOCA 2PI2E 4YCVA 2MNAA 1Q46A 3CCLA 5IE8A 3GTLH 2R93H 4QIWE 4TQUS 2UXBQ 3KDFA 1GVPA 3HOZG 2IT1A 3RLNA 1M1KC 4JBKA 2PMZE 4LF5Q 1KHIA 2MFIA 4RMFA 4UP9A 2UUCQ 4LF9L 1IZ6A 2F52A 5IP9H 3CQZH 4JI7Q 3STBC 4GOPC 2WB1E 1HZ9A 3TQYA 4P74A 3W1BA 4DAYB 1UE6A 3S1NH 5JJIA 3ULJA 4HJ5A 4LWCA 5LMNW 1EUJA 3KFUA 1K3RA 1N33L 1CKOA 1TWHH 2HIXA 2K5VA 3GDEA 4KLKA 1Y1VH 3KDFB 2R7DA 1XNQQ 4A3JH 2OTJA 3U4ZA 2Q2IA 4AQYQ 4X64L 1JJGA 5C0XI 4WJ3M 3RLOA 2KBNA 4JYAL 4P73A 5E7NA 1CKMA 5IP7G 4A75A 4GNXB 4YWKA 4LF4L 1FJGL 4GLXA 1P8LA 2ZJQA 3F1ZA 2QEXA 5M5YH 1AE2A
chains in the Genus database with same CATH superfamily
4GNXA 1NAPA 4KI0A 2HT1A 4CKBA 2LSSA 5FJ8H 3MFYA 3PO2H 2A73B 1TWHB 3STBD 1Z6HA 3PF4A 3S1NB 2SEBD 2PNRC 1WTQA 1YVCA 5M3MH 3A74A 4C3JB 4WORA 3TBIB 1IXRA 2DN8A 5EBCA 3UE1A 1PH8A 3CP0A 3DM3A 2OQ0A 4N8X1 1SROA 2EDGA 3CHBD 1K0SA 1DYQA 2VQFQ 3V05A 3S1QB 4K5VA 1KRSA 2ZTEA 4GS3A 1LM0A 2JA8B 4WJ4A 1W6JA 5C4JB 3H94A 4BY1G 3CXCA 1VQKA 3SR1A 3T1HQ 2LY7A 1KLGD 1KAWA 2A74C 1WTHA 3LWUA 1NMFA 1WTPA 3GV3A 2GVAA 4N9PA 1HUNA 4XT3B 3EA6A 4LMQD 2CH4W 5AFWA 4A3FB 2CQAA 3R2IA 5C4XB 1LTID 4OONA 1J9OA 2QDLA 3VR4A 3D3RA 3HOVB 4LFAL 2BDNA 3NK9A 4R4QA 4OIKA 4CKCA 5CV5A 3S1RH 2H5XA 1U4PA 1E24A 3HOYG 3CC7A 3HOZH 5FLXE 3R8BA 2PYKA 2B8FA 4KD3A 4I7ZC 4ODGA 4A93B 1MI2A 2MUYA 1Q8KA 3LX0A 1VQOA 4A3BG 1SE2A 4TSSA 4B3SL 3BZKA 4DK1A 4N9TA 3HKZB 2E5LQ 2DJGC 3HGBA 5FLMG 1EU4A 1D1KA 3J80i 4HJ7A 4JOIC 1JE4A 5GAGC 2QGQA 3C1FA 3FEWX 1I4PA 1KRTA 1D7QA 1E1OA 1JICA 2UUBL 5C3EG 2ZJRA 5M3FG 4G7OC 2JJQA 4R1JA 1EY7A 3PV0A 4UHVA 4B3SQ 4FP5D 2WKCA 1L1OA 4A3IB 3S15H 2WP8J 4B3RQ 4IFDI 4QCLA 1YJWA 1IYJB 3OOCA 4MNOA 1SMXA 4RAUC 3A8JE 3AB9A 1DOMA 2PQAB 2LFNA 3MXUA 5LL6S 4DR4L 1O7LA 1L2FA 1M90C 2Q8RE 4Y7NB 3KUPA 4XTCS 1MSHA 4F8MA 1TWGH 3GTPB 4B3TQ 1I3QH 2I5HA 1IW7D 4C3HB 1L1OC 2B2VC 4LF9Q 2YU9H 2V4DA 3NP8A 2F0KA 2TMPA 4X62Q 4Y7NH 2KHSA 3GP7A 2CFMA 3I4NG 3RMHA 2F0DA 3A5UA 2VUMB 1PH9A 1NE3A 4C56C 2GVBA 2HDLA 3C1EA 4A3LH 4MN3A 1JMCA 5KNDA 3HRZC 3H0GH 4K2LA 1K8AC 3L2PA 2EY5A 4XQQA 1JCKB 4M8AA 1L0WA 4HAEA 1K83H 1PH4A 1GHKA 1I50H 4UPAA 2RF4A 2VZAA 4JV5Q 5C4ZA 3U58A 2FFKB 1Y1VG 2EVBA 4F7XA 3C2PA 2F1MA 1N36Q 1AE3A 3K5OA 3PUVA 1JORA 2KOLA 4I7AA 5H1SE 1OXUA 2UUAQ 5IYCG 1WCMB 4G4KA 1KQSA 2DY8A 5C4XG 1IL8A 1XJVA 1JC7A 4DV4Q 5J39A 3WOEA 3HOVG 4POFA 3DWQA 2KENA 3IAYA 1XNQL 1E2WA 2MPMA 4CJ0B 3HOYH 3MWYW 2P5ZX 5GQOA 5JAVA 5KRUA 4GNXC 2JA8G 1ONLA 2HHHL 2KEEA 3BYYB 1SYDA 2A6EC 1CZGA 1SE3A 3BZDB 2E5LL 2WB1G 1C9OA 2R7ZH 3P1HA 4X3UA 4G7ZC 1CZWA 2K7VA 1VQAA 1ET9A 3OWEB 3K8AA 1MGSA 1LTSD 4CJ1B 1I94L 5LMUL 3BDCA 4FXKC 1HR0Q 4PQXA 1FVIA 4X3TA 2ENBA 4JG2A 1JOOA 5IYBH 1XMOQ 1YEZA 3HP3A 1VQNA 3F2BA 3AU7A 4FF1A 2O2LD 5IP7H 1D2BA 3W1GA 3PIO3 1UNSA 2E74C 3A7LA 4B08A 1I94Q 4HIMA 1HCZA 1HQMC 1JOKA 2PZWA 1H9SA 4A3CG 4DV4L 5EPJA 3L0OA 5K5PA 2ID0A 1M8AA 2F0PA 4NXNL 2CHBD 3ND8A 4DXFA 3E0JA 3U50C 3J81j 1VQPA 4ZQ3A 5EJWA 1PMRA 2MGSA 3QR8A 1YNNC 1SJHD 4HIKA 2LS01 3B6YA 3J7ZC 4PZ8A 4FXGC 4A3GG 3OYYA 4KHPL 3I7FA 3N52A 3GTMH 1F2MA 4A3IG 1HNWL 2BCOA 1KNEA 4RGTA 1X3PA 1STNA 4B9XA 2VQFL 1IL2A 4B3MQ 1YNXA 3DM1A 1TXYA 1LT4D 1XYIA 3NWSA 3HEJA 1HZBA 3NELA 1EY4A 1C7YA 1Q90A 1I4RA 3GV6A 4DV1L 4FO2A 3EN2A 2WINB 2YTVA 1OTCA 5CV9A 4H44C 1HTLD 2NVXH 1D5XC 3J7AF 4OXPA 4X66L 3HOYB 4OO1H 4J1MA 4V190 1WFQA 3A56A 2Z9HA 2JA6G 1V1OA 2Z6KC 1EQTA 2X6GA 4N8FA 3E5SA 1HNXQ 1S5DD 3RZDB 1I6HH 3WOFA 2NWGA 1CSQA 3PO3H 4NDXA 1MIUA 2O4XA 3MAQA 3M85A 5IGFA 1BDOA 2VY3A 1CI3M 3U4VA 3S1MB 4UY8C 1D6EC 4DV7Q 1PHJA 4A3BB 3T4AC 4DR6Q 2OT2A 2HUGA 2HIVA 2ICIA 4A93G 3JAME 1EIFA 4I65A 1STAA 2F0LA 3X3MA 1B8AA 4UDUC 5I6YA 4X65Q 1B9NA 4BXXG 1O80A 2F4IA 4PZ6A 1UWVA 3ICEA 3H09A 2XSCA 3D6CA 4J15A 4BXXH 1G2SA 3NTIA 2UUBQ 2AUKA 2JEBI 2L1BA 4XIGS 5IYBG 1TVXA 1KXLA 1I4XA 3I2ZA 3S1QH 2RQXA 1EY9A 1CM9A 1EY6A 1BF4A 2D9UA 2VL6A 1MSGA 4KHZA 1GD7A 2PW7A 2A6HC 2EIFA 1W2BA 4A3CH 3TMEA 2E2HH 4C3JH 4QJFA 1DD2A 4L6TB 1PZID 5I9PA 2L9HA 1D5MC 3I73A 2E2JH 1PYWD 1BQQT 4H13C 4OGQC 5EKLA 4OO1G 4GKKL 5CC4A 3NQTA 5DEHA 4ZCKA 3CCSA 5IIFA 4FDBA 2N8NA 4B3TL 4K5WA 4A3GH 2C35B 3J80c 4UP7A 4APVA 3UDGA 4A3IH 3K58A 2F0NA 4ZRZA 1C0AA 1AEXA 3S16H 4JI2L 3TRZA 1ENFA 5J1ZA 4A3FH 2IWHA 1XMQL 1ML0D 2L5TA 3ZYYX 3J7AV 1WTOA 1FD7D 2IHEA 4K0KL 1PRTB 2N49A 2B2YC 1KC8C 4JBJA 4DR7L 4YHHL 4KJOA 1EYCA 4Z9CB 3FP9A 4PMWA 1GUTA 1XPRA 3GTKH 1N32L 1E7ZA 2OF1A 3GTLH 2EXZA 4OHJA 3KDFA 2PW5A 2DY7A 4IZ8A 4LF5Q 4RMFA 3WDNA 1SJED 4GZYC 5M5XB 3S1NH 3ULJA 4LWCA 1BUVT 1CKOA 2NZ1D 2JA6B 3GDEA 1XNQQ 3KF8A 2KECA 1Y8NB 1NSNS 3IL8A 5EPKA 4GNXB 4IUTA 3F1ZA 2QEXA 5M5YH 4E6IA 3BDOA 1I50B 2F0WA 4C3IG 4DFAA 1PTOC 3HOWG 3KF8B 3FKIB 5CBEE 3T1YQ 3D31A 3D4WA 3MTSA 4L5RC 1BNZA 1LTBD 1Z7TA 1STBA 1SMYD 4P2CB 3VA5A 3X3NA 1PTOF 1N34L 3AYHB 2DUDA 2JA5G 4HN7A 3MXPA 2J7ZA 1E1TA 1Q7YC 4CDFC 4R8NA 4X64Q 2RBMA 5HGTA 5LMUQ 5E1FA 3I8ZA 2JA5H 1CFMA 1JWUD 3I4OA 5LMNL 2CW0D 2KEDA 1F9QA 4DK0A 1HNZL 1B7YB 1A2UA 1TY2A 4OWWB 5EKKA 1LTTD 1XPUA 3SXHA 4IOCA 2B63H 5IYDH 2NVYH 2Q8IB 1GUOA 1KDBA 2BA1A 2UXBL 1V1PA 3WWVA 1NTGA 1IW7C 2EYFA 2IX0A 1HH2P 1SN8A 1YNJC 2F3VA 2YYZA 5M5WH 2QF7A 3JC66 5ELFA 1F9PA 2D5DA 1F77A 4HJAA 4A3EH 2IW3A 1JWSD 4Q5VA 2R61A 5C5LA 1N8RC 1I4QA 4A76A 4IFDJ 3I4NH 2EYJA 3I4MH 4U68A 1BBWA 1U0LA 2F3WA 2K5HA 2K50A 2OEOA 2F0OA 1YJ9A 4DUYL 3GD7A 3RLFA 4BBSH 1MJCA 3OWFA 3TP6A 5IGBA 1PH7A 1L0YB 1UE1A 5LMNQ 1HNZQ 1VDZA 4AYBG 2MO1A 4DNRB 1SNDA 3A8KE 3NWTA 4YY3Q 2EJMA 2E2IH 3BS1A 1X65A 1IYUA 1U4LA 3IFTA 4YIJA 4POGA 1MJEA 5CV6A 3KBGA 1MHWC 4HMJA 2JK8A 1T5XD 1QB5D 3S14B 5ELEA 3CCRA 1S72A 5KNCA 1TT2A 5EQ0A 3JAML 2TSSA 2L55A 4S3SA 2QW7A 3K7AB 3R3OA 1L0XB 3MEFA 1JOQA 1FNWA 5C3WA 2NB0A 3H0GB 1PVOA 2K04A 3PIOA 3Q8DA 1K83B 5A35A 4LF4Q 4YWLA 2EYLA 3J81E 1TWFB 2G9DA 1F9SA 3FMCA 4A3JB 3ER0A 1X55A 3VYSA 2ZJPA 4QB4A 4A3JG 3FPUB 4EQNA 1N32Q 1X6OA 4LNQA 2HQEA 3MXNB 4GOPB 4QQBX 3NQIA 1IYVA 5IGGA 2Z4IA 1A3UA 3V2TA 1EZ8A 1PLFA 1Y1VB 4R4OA 3QOLA 4DAVA 1QVCA 2JYOA 1QJOA 5IYDG 5FO7B 5JJZA 1Q12A 1AW7A 4DUZL 5D14A 2EJFC 1O78A 5GROA 3PF5A 4KD4A 5C0XH 1E22A 1XNRQ 4X65L 3EROA 4BBSG 4ZUJA 5COYA 4JI1Q 2R7FA 3QWNA 3ITPA 1NBWA 1FR3A 4CBVA 4JI0Q 1XMOL 2K33A 3SHLA 1S5ED 5C44G 3TS0A 3GO5A 1S5BD 1A62A 1HQRD 1BOSA 2JA9A 1WTXA 5FO9B 3S2HH 4A3MH 1B1ZA 1EYDA 4KKTA 3SK6A 4OX9Q 1Y1WG 1RODA 4A3DH 1O7IA 4DV6L 1K8MA 1EYGA 2PNHA 4YWMA 4F88A 2F0TA 3S9WA 4NP5A 3UI2A 2HCIA 4DV5Q 3BVGA 4FF3A 2GN5A 1PV4A 2CWAA 5DLQE 1IBLL 5JEAJ 4JVZA 3NBIA 3J81i 4A3KH 4AH6A 1BVSA 2A68C 4KN4C 1VQ8A 3KJOA 2F0IA 1TWGB 1PRTC 1QUQA 2E76C 3CKIB 4GKKQ 1FL0A 4A3KG 4DV3Q 3ERSX 2ZM6Q 1GXDC 2Z8LA 4BY1H 3Q24A 1PFBA 1C48A 3KYHC 4DV2L 5D65A 3KBXA 4YHHQ 3BJUA 1JB7A 3PMFA 2K32A 1QG7A 3V96A 2F0MA 1XTDA 3DEOA 1NCVA 3OPOA 3TN2A 5C6AA 3ERQA 5C4XH 1STHA 3QJYA 1R4PB 2KUMA 4DU9A 5M3FH 3EFXD 2D2CC 1Z47A 3LGJA 4JC0A 2O5JC 4DR4Q 5FJ8G 4ALPA 2ES2A 4IJLA 3L7ZC 3CCJA 4ZKBB 1HRJA 4WFN3 3EIVA 1DOLA 4JI5L 4YCWA 1KIXA 4HEDA 2UUAL 1DCZA 3FRPB 4A3FG 4IOAA 4RGMA 3K6OA 3S24A 2F0JA 2EQSA 3RN2A 3QO2A 1G8ZD 3GTPH 4BBSB 2C9OA 2IPKD 3A7AB 2ATWA 3CMEA 3MZ5A 3MEHA 1JR0D 4A3DG 1WTWA 3TZDA 1VQJA 4DR3Q 1KTKA 5I2XA 2PZUA 4KKSA 4BBRB 1I6VC 4QGUA 2KCTA 1TWCH 1NJIC 2PQEA 4A3DB 1Q1BA 3HOVH 1NNXA 1NR4A 3S1MH 5JEAG 1IKMA 3OIPA 3E0EA 4X66Q 3PGZA 1LV9A 3BVMA 1ILQA 4CDEC 3G4SA 5M5WB 1GM5A 2K01A 2QEJC 4X6AH 3RUZA 1YI2A 1WD0A 1ENCA 2M9VA 1TWAH 1VMPA 1IBLQ 1CKNA 5D3DA 2E2DC 3K0YA 1KAAA 4DV5L 3T51B 2B8GA 2CKZB 4JI7L 3AQQA 4C3HH 3A0JA 2GA4B 1RDPD 1EOVA 4PG3A 2R92B 2KHIA 1LT6D 3T13A 1BBUA 1ICWA 1G51A 1I3QB 5EPLA 2IX1A 1QVFA 1PXUA 3HG9A 4IPGA 5CR3A 4KHPQ 4AIMA 2EY1A 3S17H 3PIPA 2DNEA 3J7YW 3S2DB 5M3FB 5IP9G 2BDOA 3J80L 2R93G 1SNMA 5L37A 2JE6I 1TR5A 1EIHA 3JAMi 3F2DA 3K5NA 2JP1A 1CUKA 2PQAA 2E75C 3G7LA 2WAQE 1YHBA 2KJXA 4HR7B 2OWOA 5IYCH 2I07B 3H3VH 2MJ8A 2ZXOA 1JJCB 5DAUA 4JCVE 1K28A 4XYQA 3OIQA 5EBDA 1Q86C 3Q0AA 3O13A 1EFWA 3AFQA 1OXSC 1IBKQ 2MQHA 2UUCL 1F2LA 4RHSA 1QZGA 1V43A 4FF2A 3VA7A 2SNMA 4LW1A 5E3FA 4JI4L 4A3LG 2KA7A 2SDFA 4DR3L 4EQ5A 2KCNA 1EU3A 4K8IA 3NPPA 4UP8A 1O7ZA 2EXDA 3VR6A 1LUZA 3CPFA 4KV6A 4A3EB 4DV0Q 2WACA 4OIJA 2B2UA 3Q22A 1B53A 1X3EA 3BU2A 3LWEA 4DR6L 1QVGA 2KHJA 4O1NA 1E0BA 4IUNA 4PZ7A 2QA4A 5C4HA 4JBMA 5IGDA 4NB3A 5E4XA 1X9NA 1EZ6A 2XGTA 3H91A 1N33Q 1BKBA 1EYAA 1PH5A 3DUZA 1WOCA 2JXMB 2PI2E 1Q46A 1SXTA 2R93H 4ZYSA 3I4MB 4TQUS 1LTGD 4RH6A 2B2UC 1KHIA 2UUCQ 1IZ6A 4GOPC 2WB1E 1KNAA 1HZ9A 4P74A 5G3LD 3W1BA 1UE6A 4DAYB 4DA2A 4MIUA 1WD1A 2A69D 5LMNW 5C3XA 2K5VA 4ZK9B 4KLKA 2OTJA 1LTAD 2A69C 5KIXA 1JJGA 4X64L 3D8GA 1RJTA 4WJ3M 4JYAL 4P73A 5E7NA 4OL7A 1CKMA 4TKOB 5IP7G 4A75A 1FJGL 1AFPA 4K6DA 2EYOA 1RHPA 4QIWB 3CCVA 1PRTF 3CD6A 1EOTA 1FGUA 1BCPF 3MA2B 4BBRH 5FKAC 2HDMA 3VR5A 3W3AA 2RDFA 4WJWA 1ZEQX 3MXNA 4GOPA 1B3AA 3M7GA 5GAHC 3GTQB 4DV3L 2R3ZA 3G71A 2UXCQ 1A3VA 1GUSA 4IPDA 1A0IA 1Y1WH 2N3SA 3BG3A 1F2ZA 3TDQA 4HJ8A 3M4PA 1EWIA 3SE0A 1XNRL 1B50A 3QIAA 4K5XA 5TSSA 1W6KA 2OQKA 1TWAB 2NVTH 2Q8TA 3MC0B 1GJXA 4IALA 4R8IA 1A6XA 1H9MA 2YTXA 2B2WA 3NE5B 1PH3A 3KLSX 2K05A 4DAMA 4JBWA 2XIWA 2NVQB 4DKAC 1G2TA 1BR9A 3D4DA 5KGUA 1EWHA 1STGA 2Y0SB 3PIP3 1IHZA 1M4VA 4LUZA 1RF2D 4DAPA 3NENA 3P20A 4B9WA 3KLWA 1KD1C 4K8JA 4CHTB 2F03A 1NY4A 1UAPA 1SEBD 3KF6A 3NBHA 4H02A 1CA5A 1PDQA 2RDHA 4K0KQ 4KY5A 3MXGA 2WIIB 2F3IA 4LFCL 2KCMA 1Z9FA 1CK1A 3NBHB 5IT9c 4BY7B 1QNUA 2EY2A 4L5TA 4IUQA 1VQBA 4ZKCB 3IFDA 5IT9L 2Z4HA 3QOJA 4K2KA 4WRDA 2XN9C 2I46A 1BCPC 2ICEC 3IRBA 1ESFA 3FHWA 1YHAA 1S40A 3I4NB 3F2UA 4LUOA 1G6ZA 2NN6I 2N88A 2RSNA 3RR5A 3S16B 3M4YA 3ZJYC 2K5QA 1MKHA 2A8VA 3FKIG 3TP8A 1OXXK 1WYDA 4DR2L 3SEBA 2D62A 1PTOD 3PSIA 3SK4A 1ZYRC 3U9SA 1B44D 2Y0SE 4C1NI 3PUXA 2VQEQ 5C44B 4ME5A 2B2VA 3KF6B 3SDZA 3S2DH 3N6RA 5BN4A 3CF5A 3K5LA 2MO0A 1DGSA 1YNJD 4J6HA 4DXGA 4DF7A 5C4JH 3UDIA 2QCPX 1XXGA 4JOIA 1O7YA 1VQFA 1B3QA 2DNCA 4YCUA 4FYDA 2B39A 1YITA 1NR2A 1SYFA 2H1EA 4BWGB 1EQQA 1AP0A 2UXDQ 4L63B 2K5DA 1K9MC 3GQBA 1ESRA 1XX8A 2QILA 3DXJC 4LF6L 4PV1C 4DV7L 5LL6X 2VW9A 3HOUG 1X3FA 5FOBB 4IURA 5K36G 2BE5C 1J5EQ 4RCOA 1MBYA 1VS0A 1N36L 3AEVA 5ISRA 3SVMA 3H15A 3ONAB 5HY6A 3HOZB 1CSPA 1HPCA 1S5CD 2SOBA 1AH9A 2RVLA 3ND9A 2R92G 3QB3A 2AWNA 2X69A 4IUVA 3CC2A 4JI3Q 3K59A 1C4QA 4K6LA 3NHHA 1S3OA 1Q82C 4RFBA 1RCVD 4EX5A 2MP1A 5BN5A 2IL8A 3CQZB 2R92H 3URYA 3P75A 1DOKA 1B4OA 3K0XA 1KLUD 4DK3C 5EKIA 3HKSA 4B3RL 1HR0W 3D6WA 4GN3B 2Y0SG 2XWJB 2EOTA 2ZXRA 2K52A 4BS9A 3TS2A 1IBKL 4PMCA 4LF8L 2ZTCA 2A5HA 5BR8Q 4PMBA 3CC4A 5E4WC 1B9MA 2RKSA 2WAQG 3CU7A 1GUGA 5KEEA 2PPBC 2NVXB 1L1OB 2CVRA 5CYUA 1ZXTA 4CDDC 5JVH3 2A6HD 2K75A 4JW0A 4R9WA 4OWXB 1JE5A 5KNBA 4HIOA 3PUYA 2UU9L 2Q2HA 1UEAB 3SGIA 2OXPA 1N9WA 3Q6SA 4LK1C 2K5NA 4C3IH 5GADC 2JA7B 1A3TA 3GTJH 1IKLA 2FINB 3AMUA 2VUMG 4DR2Q 1EL0A 1CQVA 2NVQH 3S17B 1XWEA 2F4VQ 1BO0A 4JI0L 2EYMA 1HNWQ 2FHTA 2K1BA 1K8GA 5M5YB 2VUMH 2O5IC 1LT5D 1TKWB 2L12A 4ZLTF 3CCQA 1JWMD 3K7AH 1CT1D 2J0TD 2ALYB 5C5MA 3SK5A 4F87A 4LF8Q 2ZXPA 3TP5A 1PA6A 4ABNA 1DZ1A 2PCFB 2A19A 3PO2G 5DM73 4MTNA 5ELBA 1AN8A 5IODA 2L11A 1LTLA 2MHVA 3BYTB 1R9TH 1VQCA 1A2TA 4RGNA 3OTOQ 4MZ9A 4HSVA 3R93A 3VYUA 5CBAE 4ME3A 3H6MA 2D0OA 5I9OA 5I6WA 2CCZA 3IKJA 3K7UC 1GUWA 5JPNC 5M9OA 3GTJB 1QCBD 3E9HA 2VXWA 3A55A 2CH4A 4JI1L 1X3QA 2DJFC 4OEMB 1T5EA 1WCMH 4CGYB 1VQEA 5FO8B 2XRSD 2I5LX 1ET6A 2CW0C 2LKVA 4CDCC 3PO3B 1E2VA 1STEA 4R4CA 3CCEA 1DONA 3EJIA 2B63B 4A3GB 3SK8A 1NUCA 1UE5A 2F0EA 4DR1Q 2YV5A 4GLAC 1VQMA 4RKBA 2Q2TA 5FK9C 1EY8A 1J8IA 1PRTD 3PUZA 4A3MG 4IO9A 1VQ7A 1WVLA 3PQIA 3RZOH 2M00A 1RKNA 3BDLA 1Q8IA 4DUYQ 4XDXA 4X62L 1VMCA 1P16A 3KLSA 2ZTDA 2JEAI 3GTQH 1VF7A 2AHOB 1VF5C 4JYAQ 2C5CA 1FJGQ 2F0FA 3HKZG 4LJZC 1PZJD 2WV6D 4IUUA 3VYRA 2AQ2B 4IUPA 1PH1A 5C3EH 3HS0C 3NEMA 3H3VI 1EEID 2Z6KA 2HQLA 2RHQB 3OMGA 5LHY1 4KJNA 4P75A 3NUCA 3M7NA 2A6ED 1SYCA 4RCNA 3S14H 1E2ZA 3KOJA 3CCMA 1PFSA 2KQ3A 4A3BH 3C3LA 2PZTA 4JI6L 3T1YL 3OTOL 3Q23A 5DM63 4LFCQ 3GTOB 2V1CC 4KHVA 5EAYA 3I55A 2EJGC 2ASBA 1OO9B 1QZHA 1R9TB 1Y14B 2AKWB 4G7HC 2B2TC 2F0UA 4UAIA 3I90A 3H0GG 1WCMG 4DV2Q 2FXQA 1IBML 2AWOA 2K5WA 3W2DA 2J4XA 4OELB 1G91A 4QF4A 1VQ9A 1QUQB 4BBRG 1HA5A 4AYBE 3PO2B 1HNXL 1XTCD 2VS1A 4A93H 4DN4M 4TVAB 4LF7L 3I70A 4QUFA 2BH2A 4CKEA 1PYSB 2KVMA 3DMUA 4AQYL 2B2TA 4GKJL 3TZUA 3FDTA 4O42A 4LFAQ 4DR1L 5FLMH 1Q81C 1TWCB 3OMCA 3HOUB 4LF5L 2R7ZB 3HOWH 2RCFA 3DEPA 1TY0A 1ASZA 1V1QA 4GKJQ 3CRLC 3D0FA 1RTNA 1EQVA 2I5MX 1YHQA 3FPPA 1H95A 4NXNQ 2NZHA 3VYTA 5CMDA 1CQFA 4YCVA 2MNAA 2A68D 4HCSA 3CCLA 2KCCA 3HOZG 3RLNA 1H9JA 4JBKA 2PMZE 5IP9H 4JI7Q 3KFUA 2F0VA 2Z1CA 1TWHH 2B2YA 3KDFB 2R7DA 1WTVA 3U4ZA 4PNYA 5M3MB 4AQYQ 2K03A 3RLOA 4RGOS 4YWKA 2ZJQA 2PO4A 3KLRA 5C3EB 4KY6A 2L0CA 1AE2A 1QILA 2B29A 1I4GA 2ZT9C 2NVTB 4IN3A 1H9SB 5CORA 3UDXA 3HZXA 2JA6H 3ULPA 4DAYA 1XPOA 2EYPA 4A3EG 4NXMQ 3GTMB 1K0RA 1SYGA 2EE1A 3GTOH 4GLVB 5BR8L 4JPBW 3RZDH 2JA8H 4C2MH 4MTKA 5JVG3 1NMGA 4KK7A 2F4VL 3EBEA 1RIPA 4DNTB 2WKDA 4XQNA 4X3KA 4JI6Q 3CAMA 2N78A 4DPGA 2R93B 1PH2A 1D1IA 2JSOA 3FVQA 1RTOA 1EIGA 3HOXG 3A5ZB 4DUZQ 4EQOA 1OXTA 3A54A 4RHRA 4XYOA 3ULLA 4GN5A 3I72A 1HUMA 3AFPA 3NXWA 1JT8A 5ELDA 1Y8PB 4OO1I 3I4LA 2JA7G 3VR3A 1VQHA 3G6JB 1BCPB 5BN3A 2FMCA 2NZOA 1U4RA 3MVVA 2VQEL 3TP7A 2IHFA 3L9AX 1FNUA 3DLLA 4DV0L 3D4RA 3KK7A 4BA2I 4OWTB 1ZKOA 4C3IB 2VB3X 4QY7A 1HZAA 3PCOB 2I0QA 4LF6Q 4KN7C 3A8IE 4XXEA 1VQLA 2R7ZG 5J22A 5CV7A 2E2HB 4BA1I 2RHSB 2NVYB 4DK6C 4RKLA 3GTGB 1PTOB 4RG1A 3K81C 4XQJA 1PZKD 1HTPA 4ZUIA 1EWCA 4IQZA 2AQ3B 4IPCA 3VR2A 1PYBA 1MD2D 1B70B 1SNPA 4IPHA 3E6ZX 2UXCL 4LAAA 1UEBA 2WB1B 1RL2A 1SNQA 3I91A 2XTIA 1SE8A 2XWBB 1STYA 2Q2UA 2XNAC 3FKIH 2PMZB 1GOZA 2B3GA 2ZM6L 1ENAA 3T53B 1A15A 1SFOB 4TRDA 4QUCA 2EYHA 5T1GA 4NMZA 1Q1EA 5C44H 3KJPA 2UXDL 2XVSA 3T56B 2EY6A 1K3BC 2YTYA 4DR5L 4KKUA 5GAEC 1H9RA 1BCPD 1DM0B 4FXDA 1DXMA 4EGVA 1QE6A 4R4IA 1D5ZC 4FNFA 1V9PA 5EGTA 5CV4A 1KL9A 4K14A 3M3YH 4DV1Q 2RSOA 4P71A 3M4QA 4NW2A 3VDYA 1PFNA 4L8JA 4QL5A 2UU9Q 1X3GA 4EVOA 5KYIA 4C1NK 4DGZA 4OX9L 1G6PA 1ASYA 4DR7Q 3F8TA 2OTLA 3GTKB 4H0LC 1A8VA 2BOSA 1SYEA 3JAMc 1OXVA 1XMQQ 2AUJD 1YZ6A 1LO5D 4YY3L 4MHEA 4HTHA 1FGBD 1SSOA 4C3HG 2F0HA 2XRQD 5HGQA 1I5FA 5T1IA 5I4DA 1LT3D 2LXJA 4JI5Q 5IGEA 4P72A 4IFDH 1EQRA 4LF7Q 4LFBQ 2SNSA 1PTOH 3LNNA 5ELOA 2AQ1B 2BH8A 1T9HA 1X54A 3BZCA 1RD9D 3OW2A 4L5QA 1YNND 1C8CA 3HOXB 2BE5D 4HSPA 4NKLA 2Z6BA 4BY7G 3HOWB 5NUCA 4EQPA 1G291 1UE7A 1IBMQ 3GTGH 4Y52H 2E8GA 2A1AA 5KYLA 2G5DA 1E3PA 1FNVA 3W5OA 1Y1WB 4V0BA 1HJPA 2CWPA 1QNKA 3TSSA 2IY5B 1U9RA 4QMGA 4J8QA 3CCUA 1SLJA 2M2LA 1QOHA 3M4OH 2NTTA 1TWFH 4H7BA 1A63A 1JB3A 4O2DA 2DGYA 3CW2C 1EY5A 1SDFA 1WJJA 1VQ4A 5IY0A 1W3SA 5A2QE 1VCIA 3I56A 5CGKA 1GUNA 1TQOA 2R6GA 2JA7H 4JI8L 1CA6A 2VB2X 1KABA 1R4QB 1GKHA 4X3SA 5A2QL 1F9RA 1V8QA 4BY1B 4NPSA 1JJ2A 4JI3L 5M5XH 3BVZA 2L4NA 5JEAH 4ILWA 5JOBA 1I4HA 3DHQA 3RNUA 1EY0A 2NBFA 2K4KA 4DV6Q 1H9KA 1LLRD 2NN6G 1VQ6A 1Y69U 1J5EL 1CKNB 3RN5A 5JJKA 1CHPD 2JN4A 1SNCA 3CPWA 1F2YA 3T16A 3CMAA 1CTMA 3QG1A 5IWAL 1HXYD 4DNIA 3RZOB 1LACA 1CHQD 3EVQA 3H3VC 4HCEA 1TS5A 1EIYB 4Q0FA 5G3LF 5JJLA 1ILPA 3UE0A 3F2CA 3DWAA 4FVMA 1VQGA 2PI2A 1TU2B 4LUVA 1BBXC 2WAQB 1QWYA 4AYBB 2NUCA 1TS2A 3OHXC 3S1RB 4HJ9A 1K73C 1V1PB 4JV5L 4JK1C 1JQYD 2Z0SA 1HHVA 2B2WC 2NYZD 2F0SA 2K14A 1VQ5A 1EEFD 3GTLB 4ID6A 3J81c 4B3ML 3NTHA 1UUPA 1TS3A 5I2YA 5C0XJ 3M9BA 4JI2Q 1II3A 4HMIA 1YBYA 4A4IA 1X56A 2D0PA 4GN4B 3TREA 1YJNA 5AJ3L 4ULLA 2RA4A 3HKZE 1KDAA 1AZQA 1LTRD 4JI4Q 2G9HD 3DWPA 3UDFA 1AZPA 3MFGA 3K5MA 1EFID 3L3OC 1TS4A 4HIDA 3M3YB 1ZYRD 4M1UB 3S2HB 1SE4A 3U9OA 4C2MB 5AJ3Q 1B2TA 1Q3LA 1FYCA 4G57A 5ELNA 4C3JG 1YIJA 5K36H 3CRKC 3RD4A 3E9IA 1GO3E 2LXKA 2IJ0A 1SMYC 1SAPA 1DJRD 1PFMA 2QKIC 4ZAIA 1SR3A 4JI8Q 2K28A 4LFBL 2JQOA 1ICFB 5FLXL 1WTRA 3I4MG 1J6QA 3J7A5 2L15A 2K6AA 4RWSC 5FLXc 4KTAA 5D3IB 1SYBA 1N34Q 4U673 1SFOH 5IT9E 2JA5B 3HFZB 3K57A 2AMCB 1HFNA 2HD3A 3G6EA 3E3XA 4RA8A 3J80E 4IFDG 4CJ2C 4XT1B 3TEHB 3R2TA 3G48A 1WI5A 1U5KA 2CQOA 2YU9B 1VQIA 2VNUD 3T1HL 3OW7A 5IWAQ 3OSOA 3P7JA 1HA6A 4BY7H 3K80C 1BXTA 1LYLA 3HOUH 3S15B 1SNOA 2RCNA 2OCEA 5F2DA 3NSWA 1PH6A 5C0XG 1HFGA 1KDCA 5M3MG 4A3MB 2RDGA 4L5SA 5CV8A 3PO3G 2N55A 4R4TA 1X32A 3NTKA 4DR5Q 3M4OB 1TIID 2F0GA 2E2IB 1SRUA 1D8LA 2B63G 1K8OA 1HZCA 1S4ZA 5JPMC 2HHHQ 2BA0A 1VQDA 2WFWA 2E2JB 2EZVA 5J3BA 2H4OA 2QDBA 5IOCA 4O0AA 1S5FD 1I6HB 3PUWA 1HR0L 4FF4A 3HOXH 4NXML 4IJHA 1Y8OB 4KY7A 4A3KB 2X6LA 2IX3A 5ELCA 3I3CA 3J81L 3EQLC 5IE8A 4QIWE 2UXBQ 1GVPA 2IT1A 2NTSA 1M1KC 5HURA 2MFIA 4LF9L 4UP9A 1LABA 2F52A 3CQZH 2NN6H 3STBC 2LMCB 4KMUC 3TQYA 5JJIA 4HJ5A 1EUJA 1K3RA 2FMMA 1N33L 2HIXA 1Y1VH 4A3JH 3MHBA 2FJ2A 2Q2IA 5DNFA 2EPBA 5C0XI 2KBNA 3C46A 5IGCA 1U4MA 1SBBB 1GHJA 4LF4L 2HCCA 4GLXA 1P8LA 2F0QA
chains in the Genus database with same CATH topology
4A3CH 3CCVA 4GNXA 4KI0A 3CD6A 2HT1A 3HOWG 1FGUA 2B29A 3KF8B 4BBRH 2LSSA 5FJ8H 3PO2H 3T1YQ 4L5RC 3D31A 3UDXA 2JA6H 3STBD 3ULPA 4GOPA 3PF4A 1XPOA 4A3EG 4NXMQ 1YVCA 5M3MH 1K0RA 5GAHC 1N34L 3A74A 3GTOH 1IXRA 3AYHB 2DUDA 4GLVB 3UE1A 5BR8L 4DV3L 2JA5G 3RZDH 1PH8A 3CP0A 3G71A 1E1TA 3DM3A 2OQ0A 1Q7YC 1SROA 4C2MH 2JA8H 2UXCQ 1NMGA 2VQFQ 2F4VL 4IPDA 1A0IA 1Y1WH 2N3SA 3EBEA 1RIPA 4HJ8A 3M4PA 1EWIA 4X64Q 1KRSA 2ZTEA 5LMUQ 4GS3A 2JA5H 1XNRL 4JI6Q 1LM0A 3I4OA 5LMNL 3CAMA 1HNZL 4WJ4A 1B7YB 2OQKA 2NVTH 2N78A 4BY1G 4DPGA 3CXCA 1VQKA 3T1HQ 1PH2A 4OWWB 2YTXA 1KAWA 1PH3A 1NMFA 4DAMA 1XPUA 4JBWA 3HOXG 2GVAA 3A5ZB 4DUZQ 4DKAC 4IOCA 1OXTA 3ULLA 2NVYH 2B63H 5IYDH 4GN5A 3AFPA 1JT8A 2BA1A 2UXBL 4OONA 4OO1I 4LUZA 2JA7G 3WWVA 1VQHA 1NTGA 2IX0A 3NENA 1HH2P 1SN8A 2NZOA 4LFAL 2YYZA 5M5WH 4R4QA 3KLWA 2VQEL 3JC66 2IHFA 4DV0L 1KD1C 3DLLA 4BA2I 1NY4A 4OWTB 4HJAA 3KF6A 4A3EH 4H02A 3S1RH 2H5XA 1N8RC 1E24A 4K0KQ 4A76A 3HOYG 4QY7A 3CC7A 3I4NH 1HZAA 4IFDJ 3I4MH 3PCOB 2F3IA 4LFCL 3HOZH 1BBWA 1U0LA 2KCMA 2K5HA 1Z9FA 2K50A 2I0QA 4LF6Q 1YJ9A 4DUYL 1VQLA 2R7ZG 3NBHB 3GD7A 5IT9c 4BA1I 4L5TA 2RHSB 3RLFA 4BBSH 1MJCA 1VQBA 4DK6C 1Q8KA 1VQOA 1PH7A 4A3BG 1UE1A 4RG1A 3K81C 5LMNQ 1HNZQ 4B3SL 3BZKA 4AYBG 2MO1A 3IRBA 3FHWA 2E5LQ 1YHAA 1S40A 4LUOA 4IPCA 5FLMG 2NN6I 4YY3Q 1PYBA 3RR5A 2E2IH 3ZJYC 3J80i 1B70B 4HJ7A 1MKHA 1X65A 4IPHA 4JOIC 5GAGC 4POGA 2A8VA 2QGQA 3FKIG 1UEBA 1MJEA 2UXCL 1RL2A 1KRTA 1D7QA 1OXXK 1WYDA 1E1OA 2JK8A 2UUBL 5C3EG 4DR2L 2ZJRA 2D62A 5M3FG 2JJQA 4R1JA 3CCRA 3PV0A 1S72A 4B3SQ 2XTIA 3PSIA 1SE8A 2Y0SE 2Q2UA 3PUXA 3FKIH 2VQEQ 1L1OA 2B3GA 3KF6B 2ZM6L 3MEFA 3S2DH 1PVOA 3S15H 2WP8J 4B3RQ 3PIOA 3Q8DA 3CF5A 4IFDI 1Q1EA 2MO0A 1IYJB 1DGSA 5C44H 1YJWA 4MNOA 4LF4Q 4YWLA 1SMXA 3KJPA 2UXDL 3ER0A 5C4JH 3UDIA 1X55A 4JOIA 2PQAB 2YTYA 2ZJPA 4DR4L 1VQFA 4DR5L 1L2FA 4A3JG 1M90C 1N32Q 5GAEC 1X6OA 4YCUA 4LNQA 4XTCS 3MXNB 4GOPB 4QQBX 1YITA 1TWGH 4B3TQ 4R4IA 4R4OA 1I3QH 2I5HA 1V9PA 1L1OC 1QVCA 1KL9A 1EQQA 2UXDQ 5IYDG 1K9MC 4LF9Q 3M3YH 2YU9H 4LF6L 4DV1Q 4P71A 3M4QA 1Q12A 4X62Q 4Y7NH 4DV7L 4DUZL 2CFMA 2VW9A 3VDYA 3I4NG 3HOUG 5GROA 3PF5A 3A5UA 4QL5A 2UU9Q 1X3GA 1X3FA 1PH9A 1NE3A 5K36G 1J5EQ 2GVBA 1VS0A 1N36L 4OX9L 3AEVA 4A3LH 1G6PA 3H15A 1ASYA 1JMCA 4DR7Q 1E22A 1XNRQ 4X65L 5HY6A 4BBSG 3F8TA 1CSPA 3H0GH 4JI1Q 1K8AC 3L2PA 2R7FA 2OTLA 4JI0Q 1NBWA 1AH9A 1A8VA 3JAMc 1L0WA 1XMOL 1OXVA 1K83H 1XMQQ 1PH4A 1YZ6A 1I50H 4UPAA 4YY3L 5C44G 3GO5A 3TS0A 2RF4A 2VZAA 2AWNA 2R92G 4JV5Q 3CC2A 4JI3Q 1A62A 3U58A 1S3OA 1Q82C 1Y1VG 2JA9A 4EX5A 3S2HH 5HGQA 4A3MH 1N36Q 4OX9Q 2R92H 1AE3A 3PUVA 1Y1WG 1I5FA 4A3DH 3K0XA 5H1SE 1O7IA 1OXUA 2LXJA 4DK3C 4DV6L 2UUAQ 5IYCG 4JI5Q 1EYGA 4P72A 2PNHA 4YWMA 1EQRA 1KQSA 3HKSA 4B3RL 1HR0W 4LF7Q 4GN3B 2Y0SG 5C4XG 4LFBQ 1XJVA 2K52A 5ELOA 2BH8A 4DV5Q 1T9HA 1X54A 3BZCA 3OW2A 1IBKL 3TS2A 4DV4Q 4L5QA 4LF8L 2ZTCA 2GN5A 1PV4A 3HOVG 4POFA 5BR8Q 2KENA 1XNQL 3CC4A 4BY7G 2CWAA 5DLQE 1IBLL 1IBMQ 1G291 1UE7A 3GTGH 5JEAJ 3J81i 2WAQG 4A3KH 3HOYH 4AH6A 1BVSA 4Y52H 2E8GA 5GQOA 4GNXC 2JA8G 2A1AA 1L1OB 1VQ8A 2HHHL 3KJOA 1E3PA 2WB1G 2E5LL 1C9OA 1QUQA 2R7ZH 2K75A 3W5OA 4GKKQ 1FL0A 4A3KG 4OWXB 4DV3Q 1JE5A 3ERSX 1HJPA 2CWPA 2ZM6Q 4HIOA 3PUYA 2IY5B 1VQAA 3K8AA 3CCUA 2Q2HA 2UU9L 1SLJA 4BY1H 3M4OH 3SGIA 1TWFH 1N9WA 1A63A 3KYHC 2K5NA 4C3IH 5GADC 4DV2L 4O2DA 2DGYA 3CW2C 3GTJH 5LMUL 1I94L 1WJJA 1VQ4A 4YHHQ 5IY0A 1HR0Q 1W3SA 3BJUA 1VCIA 3I56A 1FVIA 4DR2Q 1JB7A 2VUMG 2NVQH 4JG2A 2R6GA 1XTDA 5IYBH 1XMOQ 1VQNA 1YEZA 2F4VQ 2JA7H 4JI8L 3F2BA 5C4XH 4JI0L 1HNWQ 1K8GA 1GKHA 5IP7H 3W1GA 5M3FH 2VUMH 3CCQA 4NPSA 1JJ2A 1I94Q 4HIMA 3K7AH 4JI3L 1Z47A 2ALYB 3LGJA 4JC0A 5M5XH 4DV4L 1PA6A 4LF8Q 4A3CG 3L0OA 2ID0A 4DR4Q 5FJ8G 4ALPA 2A19A 4NXNL 3PO2G 4MTNA 2ES2A 4IJLA 3L7ZC 3U50C 3J81j 3CCJA 3RNUA 1LTLA 1VQPA 1R9TH 3EIVA 2K4KA 1VQCA 4JI5L 4DV6Q 4YCWA 1KIXA 2UUAL 3OTOQ 4MZ9A 4HIKA 2NN6G 4A3FG 1VQ6A 4IOAA 1J5EL 1CKNB 3RN5A 3S24A 3B6YA 3J7ZC 4ME3A 5JJKA 2D0OA 2EQSA 4PZ8A 3RN2A 4A3GG 3OYYA 4KHPL 3GTPH 3I7FA 2CCZA 3CPWA 3CMAA 3K7UC 2ATWA 5IWAL 4A3IG 4DNIA 3GTMH 1HNWL 3CMEA 1EIYB 4A3DG 1VQJA 4DR3Q 2VQFL 1IL2A 3E9HA 4B3MQ 1YNXA 5JJLA 1TXYA 4JI1L 3UE0A 4QGUA 3F2CA 2KCTA 1TWCH 1WCMH 1NJIC 1VQGA 1VQEA 2PI2A 1HZBA 3NELA 4LUVA 1Q1BA 2I5LX 1C7YA 3HOVH 3S1MH 5JEAG 4R4CA 4HJ9A 4X66Q 3E0EA 1K73C 3PGZA 3CCEA 4JV5L 2Z0SA 3G4SA 4DV1L 1GM5A 2K14A 3EN2A 1VQ5A 3J81c 2YTVA 1UE5A 4X6AH 4B3ML 1YI2A 1OTCA 4DR1Q 2YV5A 4GLAC 1VQMA 2Q2TA 5C0XJ 3M9BA 4JI2Q 2NVXH 1TWAH 1IBLQ 4OXPA 1CKNA 1YBYA 4X66L 3PUZA 4A3MG 4A4IA 1X56A 4IO9A 1VQ7A 2D0PA 4GN4B 3TREA 1YJNA 3RZOH 5AJ3L 1WFQA 3HKZE 2JA6G 4DV5L 2Z6KC 2CKZB 4JI4Q 4JI7L 3AQQA 4DUYQ 4C3HH 4X62L 1HNXQ 3A0JA 3UDFA 1I6HH 1P16A 2ZTDA 1EOVA 1CSQA 2JEAI 3PO3H 3GTQH 4PG3A 2KHIA 2AHOB 4HIDA 1MIUA 4JYAQ 1BBUA 1FJGQ 3M85A 5AJ3Q 1G51A 2VY3A 5ELNA 3HKZG 1YIJA 2IX1A 3U4VA 1QVFA 3E9IA 1GO3E 4IPGA 2LXKA 4UY8C 4DV7Q 1PHJA 4KHPQ 4AIMA 1PH1A 5C3EH 4DR6Q 3S17H 4JI8Q 1SR3A 2HIVA 3PIPA 4LFBL 3NEMA 4A93G 2JQOA 3I4MG 5IP9G 1J6QA 1EIFA 2L15A 2Z6KA 3H3VI 2HQLA 2RHQB 3J7A5 1B8AA 5FLXc 4X65Q 4BXXG 4P75A 2R93G 1N34Q 3M7NA 2JE6I 4PZ6A 1UWVA 1SFOH 3S14H 3ICEA 3KOJA 3HFZB 3JAMi 2AMCB 1PFSA 3F2DA 3CCMA 1CUKA 2PQAA 3G6EA 4A3BH 2WAQE 4J15A 1YHBA 4BXXH 4JI6L 3T1YL 2UUBQ 2OWOA 5IYCH 3OTOL 2JEBI 4IFDG 4XIGS 5IYBG 3TEHB 4LFCQ 3H3VH 3G48A 1KXLA 1WI5A 1U5KA 2V1CC 5EAYA 3I55A 1JJCB 2CQOA 3I2ZA 3S1QH 2ASBA 4JCVE 1QZHA 1VQIA 1Y14B 2AKWB 2VNUD 3T1HL 2VL6A 5IWAQ 3H0GG 1WCMG 1GD7A 4KHZA 2EIFA 2FXQA 4DV2Q 2AWOA 1W2BA 1Q86C 1IBML 4C3JH 3K80C 4QJFA 2E2HH 4BY7H 1EFWA 1VQ9A 1LYLA 1QUQB 3AFQA 1OXSC 4BBRG 2E2JH 3HOUH 1IBKQ 2MQHA 2UUCL 4OO1G 4AYBE 4GKKL 1HNXL 1QZGA 1V43A 2OCEA 2RCNA 2VS1A 4A93H 4LW1A 4TVAB 4JI4L 4LF7L 4A3LG 1PH6A 5C0XG 3CCSA 5M3MG 4FDBA 4DR3L 2N8NA 4EQ5A 4B3TL 2BH2A 4A3GH 1PYSB 2C35B 3J80c 4AQYL 4UP7A 4UP8A 4APVA 4L5SA 2EXDA 3PO3G 3UDGA 4A3IH 1LUZA 4GKJL 4R4TA 3CPFA 4DR5Q 1C0AA 4DV0Q 3S16H 1SRUA 4JI2L 3TRZA 1D8LA 2B63G 4LFAQ 1X3EA 4DR1L 4A3FH 1XMQL 1HZCA 3BU2A 2HHHQ 2BA0A 5FLMH 1VQDA 2WFWA 1Q81C 4DR6L 5J3BA 2IHEA 2KHJA 1QVGA 4LF5L 4K0KL 4O0AA 2N49A 3HOWH 4PZ7A 1ASZA 2QA4A 1KC8C 1V1QA 3PUWA 4JBJA 4JBMA 4DR7L 4NB3A 4YHHL 1X9NA 1HR0L 4GKJQ 3D0FA 2XGTA 3HOXH 4NXML 4IJHA 3FP9A 2I5MX 4PMWA 1YHQA 1XPRA 1N33Q 3GTKH 1BKBA 1PH5A 2NZHA 4NXNQ 1N32L 1H95A 1E7ZA 1WOCA 2PI2E 4YCVA 2MNAA 1Q46A 3CCLA 5IE8A 3GTLH 2R93H 4QIWE 4TQUS 2UXBQ 3KDFA 1GVPA 3HOZG 2IT1A 3RLNA 1M1KC 4JBKA 2PMZE 4LF5Q 1KHIA 2MFIA 4RMFA 4UP9A 2UUCQ 4LF9L 1IZ6A 2F52A 5IP9H 3CQZH 4JI7Q 3STBC 4GOPC 2WB1E 1HZ9A 3TQYA 4P74A 3W1BA 4DAYB 1UE6A 3S1NH 5JJIA 3ULJA 4HJ5A 4LWCA 5LMNW 1EUJA 3KFUA 1K3RA 1N33L 1CKOA 1TWHH 2HIXA 2K5VA 3GDEA 4KLKA 1Y1VH 3KDFB 2R7DA 1XNQQ 4A3JH 2OTJA 3U4ZA 2Q2IA 4AQYQ 4X64L 1JJGA 5C0XI 4WJ3M 3RLOA 2KBNA 4JYAL 4P73A 5E7NA 1CKMA 5IP7G 4A75A 4GNXB 4YWKA 4LF4L 1FJGL 4GLXA 1P8LA 2ZJQA 3F1ZA 2QEXA 5M5YH 1AE2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A3C H;  3CCV A;  4GNX A;  4KI0 A;  3CD6 A;  2HT1 A;  3HOW G;  1FGU A;  2B29 A;  3KF8 B;  4BBR H;  2LSS A;  5FJ8 H;  3PO2 H;  3T1Y Q;  4L5R C;  3D31 A;  3UDX A;  2JA6 H;  3STB D;  3ULP A;  4GOP A;  3PF4 A;  1XPO A;  4A3E G;  4NXM Q;  1YVC A;  5M3M H;  1K0R A;  5GAH C;  1N34 L;  3A74 A;  3GTO H;  1IXR A;  3AYH B;  2DUD A;  4GLV B;  3UE1 A;  5BR8 L;  4DV3 L;  2JA5 G;  3RZD H;  1PH8 A;  3CP0 A;  3G71 A;  1E1T A;  3DM3 A;  2OQ0 A;  1Q7Y C;  1SRO A;  4C2M H;  2JA8 H;  2UXC Q;  1NMG A;  2VQF Q;  2F4V L;  4IPD A;  1A0I A;  1Y1W H;  2N3S A;  3EBE A;  1RIP A;  4HJ8 A;  3M4P A;  1EWI A;  4X64 Q;  1KRS A;  2ZTE A;  5LMU Q;  4GS3 A;  2JA5 H;  1XNR L;  4JI6 Q;  1LM0 A;  3I4O A;  5LMN L;  3CAM A;  1HNZ L;  4WJ4 A;  1B7Y B;  2OQK A;  2NVT H;  2N78 A;  4BY1 G;  4DPG A;  3CXC A;  1VQK A;  3T1H Q;  1PH2 A;  4OWW B;  2YTX A;  1KAW A;  1PH3 A;  1NMF A;  4DAM A;  1XPU A;  4JBW A;  3HOX G;  2GVA A;  3A5Z B;  4DUZ Q;  4DKA C;  4IOC A;  1OXT A;  3ULL A;  2NVY H;  2B63 H;  5IYD H;  4GN5 A;  3AFP A;  1JT8 A;  2BA1 A;  2UXB L;  4OON A;  4OO1 I;  4LUZ A;  2JA7 G;  3WWV A;  1VQH A;  1NTG A;  2IX0 A;  3NEN A;  1HH2 P;  1SN8 A;  2NZO A;  4LFA L;  2YYZ A;  5M5W H;  4R4Q A;  3KLW A;  2VQE L;  3JC6 6;  2IHF A;  4DV0 L;  1KD1 C;  3DLL A;  4BA2 I;  1NY4 A;  4OWT B;  4HJA A;  3KF6 A;  4A3E H;  4H02 A;  3S1R H;  2H5X A;  1N8R C;  1E24 A;  4K0K Q;  4A76 A;  3HOY G;  4QY7 A;  3CC7 A;  3I4N H;  1HZA A;  4IFD J;  3I4M H;  3PCO B;  2F3I A;  4LFC L;  3HOZ H;  1BBW A;  1U0L A;  2KCM A;  2K5H A;  1Z9F A;  2K50 A;  2I0Q A;  4LF6 Q;  1YJ9 A;  4DUY L;  1VQL A;  2R7Z G;  3NBH B;  3GD7 A;  5IT9 c;  4BA1 I;  4L5T A;  2RHS B;  3RLF A;  4BBS H;  1MJC A;  1VQB A;  4DK6 C;  1Q8K A;  1VQO A;  1PH7 A;  4A3B G;  1UE1 A;  4RG1 A;  3K81 C;  5LMN Q;  1HNZ Q;  4B3S L;  3BZK A;  4AYB G;  2MO1 A;  3IRB A;  3FHW A;  2E5L Q;  1YHA A;  1S40 A;  4LUO A;  4IPC A;  5FLM G;  2NN6 I;  4YY3 Q;  1PYB A;  3RR5 A;  2E2I H;  3ZJY C;  3J80 i;  1B70 B;  4HJ7 A;  1MKH A;  1X65 A;  4IPH A;  4JOI C;  5GAG C;  4POG A;  2A8V A;  2QGQ A;  3FKI G;  1UEB A;  1MJE A;  2UXC L;  1RL2 A;  1KRT A;  1D7Q A;  1OXX K;  1WYD A;  1E1O A;  2JK8 A;  2UUB L;  5C3E G;  4DR2 L;  2ZJR A;  2D62 A;  5M3F G;  2JJQ A;  4R1J A;  3CCR A;  3PV0 A;  1S72 A;  4B3S Q;  2XTI A;  3PSI A;  1SE8 A;  2Y0S E;  2Q2U A;  3PUX A;  3FKI H;  2VQE Q;  1L1O A;  2B3G A;  3KF6 B;  2ZM6 L;  3MEF A;  3S2D H;  1PVO A;  3S15 H;  2WP8 J;  4B3R Q;  3PIO A;  3Q8D A;  3CF5 A;  4IFD I;  1Q1E A;  2MO0 A;  1IYJ B;  1DGS A;  5C44 H;  1YJW A;  4MNO A;  4LF4 Q;  4YWL A;  1SMX A;  3KJP A;  2UXD L;  3ER0 A;  5C4J H;  3UDI A;  1X55 A;  4JOI A;  2PQA B;  2YTY A;  2ZJP A;  4DR4 L;  1VQF A;  4DR5 L;  1L2F A;  4A3J G;  1M90 C;  1N32 Q;  5GAE C;  1X6O A;  4YCU A;  4LNQ A;  4XTC S;  3MXN B;  4GOP B;  4QQB X;  1YIT A;  1TWG H;  4B3T Q;  4R4I A;  4R4O A;  1I3Q H;  2I5H A;  1V9P A;  1L1O C;  1QVC A;  1KL9 A;  1EQQ A;  2UXD Q;  5IYD G;  1K9M C;  4LF9 Q;  3M3Y H;  2YU9 H;  4LF6 L;  4DV1 Q;  4P71 A;  3M4Q A;  1Q12 A;  4X62 Q;  4Y7N H;  4DV7 L;  4DUZ L;  2CFM A;  2VW9 A;  3VDY A;  3I4N G;  3HOU G;  5GRO A;  3PF5 A;  3A5U A;  4QL5 A;  2UU9 Q;  1X3G A;  1X3F A;  1PH9 A;  1NE3 A;  5K36 G;  1J5E Q;  2GVB A;  1VS0 A;  1N36 L;  4OX9 L;  3AEV A;  4A3L H;  1G6P A;  3H15 A;  1ASY A;  1JMC A;  4DR7 Q;  1E22 A;  1XNR Q;  4X65 L;  5HY6 A;  4BBS G;  3F8T A;  1CSP A;  3H0G H;  4JI1 Q;  1K8A C;  3L2P A;  2R7F A;  2OTL A;  4JI0 Q;  1NBW A;  1AH9 A;  1A8V A;  3JAM c;  1L0W A;  1XMO L;  1OXV A;  1K83 H;  1XMQ Q;  1PH4 A;  1YZ6 A;  1I50 H;  4UPA A;  4YY3 L;  5C44 G;  3GO5 A;  3TS0 A;  2RF4 A;  2VZA A;  2AWN A;  2R92 G;  4JV5 Q;  3CC2 A;  4JI3 Q;  1A62 A;  3U58 A;  1S3O A;  1Q82 C;  1Y1V G;  2JA9 A;  4EX5 A;  3S2H H;  5HGQ A;  4A3M H;  1N36 Q;  4OX9 Q;  2R92 H;  1AE3 A;  3PUV A;  1Y1W G;  1I5F A;  4A3D H;  3K0X A;  5H1S E;  1O7I A;  1OXU A;  2LXJ A;  4DK3 C;  4DV6 L;  2UUA Q;  5IYC G;  4JI5 Q;  1EYG A;  4P72 A;  2PNH A;  4YWM A;  1EQR A;  1KQS A;  3HKS A;  4B3R L;  1HR0 W;  4LF7 Q;  4GN3 B;  2Y0S G;  5C4X G;  4LFB Q;  1XJV A;  2K52 A;  5ELO A;  2BH8 A;  4DV5 Q;  1T9H A;  1X54 A;  3BZC A;  3OW2 A;  1IBK L;  3TS2 A;  4DV4 Q;  4L5Q A;  4LF8 L;  2ZTC A;  2GN5 A;  1PV4 A;  3HOV G;  4POF A;  5BR8 Q;  2KEN A;  1XNQ L;  3CC4 A;  4BY7 G;  2CWA A;  5DLQ E;  1IBL L;  1IBM Q;  1G29 1;  1UE7 A;  3GTG H;  5JEA J;  3J81 i;  2WAQ G;  4A3K H;  3HOY H;  4AH6 A;  1BVS A;  4Y52 H;  2E8G A;  5GQO A;  4GNX C;  2JA8 G;  2A1A A;  1L1O B;  1VQ8 A;  2HHH L;  3KJO A;  1E3P A;  2WB1 G;  2E5L L;  1C9O A;  1QUQ A;  2R7Z H;  2K75 A;  3W5O A;  4GKK Q;  1FL0 A;  4A3K G;  4OWX B;  4DV3 Q;  1JE5 A;  3ERS X;  1HJP A;  2CWP A;  2ZM6 Q;  4HIO A;  3PUY A;  2IY5 B;  1VQA A;  3K8A A;  3CCU A;  2Q2H A;  2UU9 L;  1SLJ A;  4BY1 H;  3M4O H;  3SGI A;  1TWF H;  1N9W A;  1A63 A;  3KYH C;  2K5N A;  4C3I H;  5GAD C;  4DV2 L;  4O2D A;  2DGY A;  3CW2 C;  3GTJ H;  5LMU L;  1I94 L;  1WJJ A;  1VQ4 A;  4YHH Q;  5IY0 A;  1HR0 Q;  1W3S A;  3BJU A;  1VCI A;  3I56 A;  1FVI A;  4DR2 Q;  1JB7 A;  2VUM G;  2NVQ H;  4JG2 A;  2R6G A;  1XTD A;  5IYB H;  1XMO Q;  1VQN A;  1YEZ A;  2F4V Q;  2JA7 H;  4JI8 L;  3F2B A;  5C4X H;  4JI0 L;  1HNW Q;  1K8G A;  1GKH A;  5IP7 H;  3W1G A;  5M3F H;  2VUM H;  3CCQ A;  4NPS A;  1JJ2 A;  1I94 Q;  4HIM A;  3K7A H;  4JI3 L;  1Z47 A;  2ALY B;  3LGJ A;  4JC0 A;  5M5X H;  4DV4 L;  1PA6 A;  4LF8 Q;  4A3C G;  3L0O A;  2ID0 A;  4DR4 Q;  5FJ8 G;  4ALP A;  2A19 A;  4NXN L;  3PO2 G;  4MTN A;  2ES2 A;  4IJL A;  3L7Z C;  3U50 C;  3J81 j;  3CCJ A;  3RNU A;  1LTL A;  1VQP A;  1R9T H;  3EIV A;  2K4K A;  1VQC A;  4JI5 L;  4DV6 Q;  4YCW A;  1KIX A;  2UUA L;  3OTO Q;  4MZ9 A;  4HIK A;  2NN6 G;  4A3F G;  1VQ6 A;  4IOA A;  1J5E L;  1CKN B;  3RN5 A;  3S24 A;  3B6Y A;  3J7Z C;  4ME3 A;  5JJK A;  2D0O A;  2EQS A;  4PZ8 A;  3RN2 A;  4A3G G;  3OYY A;  4KHP L;  3GTP H;  3I7F A;  2CCZ A;  3CPW A;  3CMA A;  3K7U C;  2ATW A;  5IWA L;  4A3I G;  4DNI A;  3GTM H;  1HNW L;  3CME A;  1EIY B;  4A3D G;  1VQJ A;  4DR3 Q;  2VQF L;  1IL2 A;  3E9H A;  4B3M Q;  1YNX A;  5JJL A;  1TXY A;  4JI1 L;  3UE0 A;  4QGU A;  3F2C A;  2KCT A;  1TWC H;  1WCM H;  1NJI C;  1VQG A;  1VQE A;  2PI2 A;  1HZB A;  3NEL A;  4LUV A;  1Q1B A;  2I5L X;  1C7Y A;  3HOV H;  3S1M H;  5JEA G;  4R4C A;  4HJ9 A;  4X66 Q;  3E0E A;  1K73 C;  3PGZ A;  3CCE A;  4JV5 L;  2Z0S A;  3G4S A;  4DV1 L;  1GM5 A;  2K14 A;  3EN2 A;  1VQ5 A;  3J81 c;  2YTV A;  1UE5 A;  4X6A H;  4B3M L;  1YI2 A;  1OTC A;  4DR1 Q;  2YV5 A;  4GLA C;  1VQM A;  2Q2T A;  5C0X J;  3M9B A;  4JI2 Q;  2NVX H;  1TWA H;  1IBL Q;  4OXP A;  1CKN A;  1YBY A;  4X66 L;  3PUZ A;  4A3M G;  4A4I A;  1X56 A;  4IO9 A;  1VQ7 A;  2D0P A;  4GN4 B;  3TRE A;  1YJN A;  3RZO H;  5AJ3 L;  1WFQ A;  3HKZ E;  2JA6 G;  4DV5 L;  2Z6K C;  2CKZ B;  4JI4 Q;  4JI7 L;  3AQQ A;  4DUY Q;  4C3H H;  4X62 L;  1HNX Q;  3A0J A;  3UDF A;  1I6H H;  1P16 A;  2ZTD A;  1EOV A;  1CSQ A;  2JEA I;  3PO3 H;  3GTQ H;  4PG3 A;  2KHI A;  2AHO B;  4HID A;  1MIU A;  4JYA Q;  1BBU A;  1FJG Q;  3M85 A;  5AJ3 Q;  1G51 A;  2VY3 A;  5ELN A;  3HKZ G;  1YIJ A;  2IX1 A;  3U4V A;  1QVF A;  3E9I A;  1GO3 E;  4IPG A;  2LXK A;  4UY8 C;  4DV7 Q;  1PHJ A;  4KHP Q;  4AIM A;  1PH1 A;  5C3E H;  4DR6 Q;  3S17 H;  4JI8 Q;  1SR3 A;  2HIV A;  3PIP A;  4LFB L;  3NEM A;  4A93 G;  2JQO A;  3I4M G;  5IP9 G;  1J6Q A;  1EIF A;  2L15 A;  2Z6K A;  3H3V I;  2HQL A;  2RHQ B;  3J7A 5;  1B8A A;  5FLX c;  4X65 Q;  4BXX G;  4P75 A;  2R93 G;  1N34 Q;  3M7N A;  2JE6 I;  4PZ6 A;  1UWV A;  1SFO H;  3S14 H;  3ICE A;  3KOJ A;  3HFZ B;  3JAM i;  2AMC B;  1PFS A;  3F2D A;  3CCM A;  1CUK A;  2PQA A;  3G6E A;  4A3B H;  2WAQ E;  4J15 A;  1YHB A;  4BXX H;  4JI6 L;  3T1Y L;  2UUB Q;  2OWO A;  5IYC H;  3OTO L;  2JEB I;  4IFD G;  4XIG S;  5IYB G;  3TEH B;  4LFC Q;  3H3V H;  3G48 A;  1KXL A;  1WI5 A;  1U5K A;  2V1C C;  5EAY A;  3I55 A;  1JJC B;  2CQO A;  3I2Z A;  3S1Q H;  2ASB A;  4JCV E;  1QZH A;  1VQI A;  1Y14 B;  2AKW B;  2VNU D;  3T1H L;  2VL6 A;  5IWA Q;  3H0G G;  1WCM G;  1GD7 A;  4KHZ A;  2EIF A;  2FXQ A;  4DV2 Q;  2AWO A;  1W2B A;  1Q86 C;  1IBM L;  4C3J H;  3K80 C;  4QJF A;  2E2H H;  4BY7 H;  1EFW A;  1VQ9 A;  1LYL A;  1QUQ B;  3AFQ A;  1OXS C;  4BBR G;  2E2J H;  3HOU H;  1IBK Q;  2MQH A;  2UUC L;  4OO1 G;  4AYB E;  4GKK L;  1HNX L;  1QZG A;  1V43 A;  2OCE A;  2RCN A;  2VS1 A;  4A93 H;  4LW1 A;  4TVA B;  4JI4 L;  4LF7 L;  4A3L G;  1PH6 A;  5C0X G;  3CCS A;  5M3M G;  4FDB A;  4DR3 L;  2N8N A;  4EQ5 A;  4B3T L;  2BH2 A;  4A3G H;  1PYS B;  2C35 B;  3J80 c;  4AQY L;  4UP7 A;  4UP8 A;  4APV A;  4L5S A;  2EXD A;  3PO3 G;  3UDG A;  4A3I H;  1LUZ A;  4GKJ L;  4R4T A;  3CPF A;  4DR5 Q;  1C0A A;  4DV0 Q;  3S16 H;  1SRU A;  4JI2 L;  3TRZ A;  1D8L A;  2B63 G;  4LFA Q;  1X3E A;  4DR1 L;  4A3F H;  1XMQ L;  1HZC A;  3BU2 A;  2HHH Q;  2BA0 A;  5FLM H;  1VQD A;  2WFW A;  1Q81 C;  4DR6 L;  5J3B A;  2IHE A;  2KHJ A;  1QVG A;  4LF5 L;  4K0K L;  4O0A A;  2N49 A;  3HOW H;  4PZ7 A;  1ASZ A;  2QA4 A;  1KC8 C;  1V1Q A;  3PUW A;  4JBJ A;  4JBM A;  4DR7 L;  4NB3 A;  4YHH L;  1X9N A;  1HR0 L;  4GKJ Q;  3D0F A;  2XGT A;  3HOX H;  4NXM L;  4IJH A;  3FP9 A;  2I5M X;  4PMW A;  1YHQ A;  1XPR A;  1N33 Q;  3GTK H;  1BKB A;  1PH5 A;  2NZH A;  4NXN Q;  1N32 L;  1H95 A;  1E7Z A;  1WOC A;  2PI2 E;  4YCV A;  2MNA A;  1Q46 A;  3CCL A;  5IE8 A;  3GTL H;  2R93 H;  4QIW E;  4TQU S;  2UXB Q;  3KDF A;  1GVP A;  3HOZ G;  2IT1 A;  3RLN A;  1M1K C;  4JBK A;  2PMZ E;  4LF5 Q;  1KHI A;  2MFI A;  4RMF A;  4UP9 A;  2UUC Q;  4LF9 L;  1IZ6 A;  2F52 A;  5IP9 H;  3CQZ H;  4JI7 Q;  3STB C;  4GOP C;  2WB1 E;  1HZ9 A;  3TQY A;  4P74 A;  3W1B A;  4DAY B;  1UE6 A;  3S1N H;  5JJI A;  3ULJ A;  4HJ5 A;  4LWC A;  5LMN W;  1EUJ A;  3KFU A;  1K3R A;  1N33 L;  1CKO A;  1TWH H;  2HIX A;  2K5V A;  3GDE A;  4KLK A;  1Y1V H;  3KDF B;  2R7D A;  1XNQ Q;  4A3J H;  2OTJ A;  3U4Z A;  2Q2I A;  4AQY Q;  4X64 L;  1JJG A;  5C0X I;  4WJ3 M;  3RLO A;  2KBN A;  4JYA L;  4P73 A;  5E7N A;  1CKM A;  5IP7 G;  4A75 A;  4GNX B;  4YWK A;  4LF4 L;  1FJG L;  4GLX A;  1P8L A;  2ZJQ A;  3F1Z A;  2QEX A;  5M5Y H;  1AE2 A; 
#chains in the Genus database with same CATH topology
 4GNX A;  1NAP A;  4KI0 A;  2HT1 A;  4CKB A;  2LSS A;  5FJ8 H;  3MFY A;  3PO2 H;  2A73 B;  1TWH B;  3STB D;  1Z6H A;  3PF4 A;  3S1N B;  2SEB D;  2PNR C;  1WTQ A;  1YVC A;  5M3M H;  3A74 A;  4C3J B;  4WOR A;  3TBI B;  1IXR A;  2DN8 A;  5EBC A;  3UE1 A;  1PH8 A;  3CP0 A;  3DM3 A;  2OQ0 A;  4N8X 1;  1SRO A;  2EDG A;  3CHB D;  1K0S A;  1DYQ A;  2VQF Q;  3V05 A;  3S1Q B;  4K5V A;  1KRS A;  2ZTE A;  4GS3 A;  1LM0 A;  2JA8 B;  4WJ4 A;  1W6J A;  5C4J B;  3H94 A;  4BY1 G;  3CXC A;  1VQK A;  3SR1 A;  3T1H Q;  2LY7 A;  1KLG D;  1KAW A;  2A74 C;  1WTH A;  3LWU A;  1NMF A;  1WTP A;  3GV3 A;  2GVA A;  4N9P A;  1HUN A;  4XT3 B;  3EA6 A;  4LMQ D;  2CH4 W;  5AFW A;  4A3F B;  2CQA A;  3R2I A;  5C4X B;  1LTI D;  4OON A;  1J9O A;  2QDL A;  3VR4 A;  3D3R A;  3HOV B;  4LFA L;  2BDN A;  3NK9 A;  4R4Q A;  4OIK A;  4CKC A;  5CV5 A;  3S1R H;  2H5X A;  1U4P A;  1E24 A;  3HOY G;  3CC7 A;  3HOZ H;  5FLX E;  3R8B A;  2PYK A;  2B8F A;  4KD3 A;  4I7Z C;  4ODG A;  4A93 B;  1MI2 A;  2MUY A;  1Q8K A;  3LX0 A;  1VQO A;  4A3B G;  1SE2 A;  4TSS A;  4B3S L;  3BZK A;  4DK1 A;  4N9T A;  3HKZ B;  2E5L Q;  2DJG C;  3HGB A;  5FLM G;  1EU4 A;  1D1K A;  3J80 i;  4HJ7 A;  4JOI C;  1JE4 A;  5GAG C;  2QGQ A;  3C1F A;  3FEW X;  1I4P A;  1KRT A;  1D7Q A;  1E1O A;  1JIC A;  2UUB L;  5C3E G;  2ZJR A;  5M3F G;  4G7O C;  2JJQ A;  4R1J A;  1EY7 A;  3PV0 A;  4UHV A;  4B3S Q;  4FP5 D;  2WKC A;  1L1O A;  4A3I B;  3S15 H;  2WP8 J;  4B3R Q;  4IFD I;  4QCL A;  1YJW A;  1IYJ B;  3OOC A;  4MNO A;  1SMX A;  4RAU C;  3A8J E;  3AB9 A;  1DOM A;  2PQA B;  2LFN A;  3MXU A;  5LL6 S;  4DR4 L;  1O7L A;  1L2F A;  1M90 C;  2Q8R E;  4Y7N B;  3KUP A;  4XTC S;  1MSH A;  4F8M A;  1TWG H;  3GTP B;  4B3T Q;  1I3Q H;  2I5H A;  1IW7 D;  4C3H B;  1L1O C;  2B2V C;  4LF9 Q;  2YU9 H;  2V4D A;  3NP8 A;  2F0K A;  2TMP A;  4X62 Q;  4Y7N H;  2KHS A;  3GP7 A;  2CFM A;  3I4N G;  3RMH A;  2F0D A;  3A5U A;  2VUM B;  1PH9 A;  1NE3 A;  4C56 C;  2GVB A;  2HDL A;  3C1E A;  4A3L H;  4MN3 A;  1JMC A;  5KND A;  3HRZ C;  3H0G H;  4K2L A;  1K8A C;  3L2P A;  2EY5 A;  4XQQ A;  1JCK B;  4M8A A;  1L0W A;  4HAE A;  1K83 H;  1PH4 A;  1GHK A;  1I50 H;  4UPA A;  2RF4 A;  2VZA A;  4JV5 Q;  5C4Z A;  3U58 A;  2FFK B;  1Y1V G;  2EVB A;  4F7X A;  3C2P A;  2F1M A;  1N36 Q;  1AE3 A;  3K5O A;  3PUV A;  1JOR A;  2KOL A;  4I7A A;  5H1S E;  1OXU A;  2UUA Q;  5IYC G;  1WCM B;  4G4K A;  1KQS A;  2DY8 A;  5C4X G;  1IL8 A;  1XJV A;  1JC7 A;  4DV4 Q;  5J39 A;  3WOE A;  3HOV G;  4POF A;  3DWQ A;  2KEN A;  3IAY A;  1XNQ L;  1E2W A;  2MPM A;  4CJ0 B;  3HOY H;  3MWY W;  2P5Z X;  5GQO A;  5JAV A;  5KRU A;  4GNX C;  2JA8 G;  1ONL A;  2HHH L;  2KEE A;  3BYY B;  1SYD A;  2A6E C;  1CZG A;  1SE3 A;  3BZD B;  2E5L L;  2WB1 G;  1C9O A;  2R7Z H;  3P1H A;  4X3U A;  4G7Z C;  1CZW A;  2K7V A;  1VQA A;  1ET9 A;  3OWE B;  3K8A A;  1MGS A;  1LTS D;  4CJ1 B;  1I94 L;  5LMU L;  3BDC A;  4FXK C;  1HR0 Q;  4PQX A;  1FVI A;  4X3T A;  2ENB A;  4JG2 A;  1JOO A;  5IYB H;  1XMO Q;  1YEZ A;  3HP3 A;  1VQN A;  3F2B A;  3AU7 A;  4FF1 A;  2O2L D;  5IP7 H;  1D2B A;  3W1G A;  3PIO 3;  1UNS A;  2E74 C;  3A7L A;  4B08 A;  1I94 Q;  4HIM A;  1HCZ A;  1HQM C;  1JOK A;  2PZW A;  1H9S A;  4A3C G;  4DV4 L;  5EPJ A;  3L0O A;  5K5P A;  2ID0 A;  1M8A A;  2F0P A;  4NXN L;  2CHB D;  3ND8 A;  4DXF A;  3E0J A;  3U50 C;  3J81 j;  1VQP A;  4ZQ3 A;  5EJW A;  1PMR A;  2MGS A;  3QR8 A;  1YNN C;  1SJH D;  4HIK A;  2LS0 1;  3B6Y A;  3J7Z C;  4PZ8 A;  4FXG C;  4A3G G;  3OYY A;  4KHP L;  3I7F A;  3N52 A;  3GTM H;  1F2M A;  4A3I G;  1HNW L;  2BCO A;  1KNE A;  4RGT A;  1X3P A;  1STN A;  4B9X A;  2VQF L;  1IL2 A;  4B3M Q;  1YNX A;  3DM1 A;  1TXY A;  1LT4 D;  1XYI A;  3NWS A;  3HEJ A;  1HZB A;  3NEL A;  1EY4 A;  1C7Y A;  1Q90 A;  1I4R A;  3GV6 A;  4DV1 L;  4FO2 A;  3EN2 A;  2WIN B;  2YTV A;  1OTC A;  5CV9 A;  4H44 C;  1HTL D;  2NVX H;  1D5X C;  3J7A F;  4OXP A;  4X66 L;  3HOY B;  4OO1 H;  4J1M A;  4V19 0;  1WFQ A;  3A56 A;  2Z9H A;  2JA6 G;  1V1O A;  2Z6K C;  1EQT A;  2X6G A;  4N8F A;  3E5S A;  1HNX Q;  1S5D D;  3RZD B;  1I6H H;  3WOF A;  2NWG A;  1CSQ A;  3PO3 H;  4NDX A;  1MIU A;  2O4X A;  3MAQ A;  3M85 A;  5IGF A;  1BDO A;  2VY3 A;  1CI3 M;  3U4V A;  3S1M B;  4UY8 C;  1D6E C;  4DV7 Q;  1PHJ A;  4A3B B;  3T4A C;  4DR6 Q;  2OT2 A;  2HUG A;  2HIV A;  2ICI A;  4A93 G;  3JAM E;  1EIF A;  4I65 A;  1STA A;  2F0L A;  3X3M A;  1B8A A;  4UDU C;  5I6Y A;  4X65 Q;  1B9N A;  4BXX G;  1O80 A;  2F4I A;  4PZ6 A;  1UWV A;  3ICE A;  3H09 A;  2XSC A;  3D6C A;  4J15 A;  4BXX H;  1G2S A;  3NTI A;  2UUB Q;  2AUK A;  2JEB I;  2L1B A;  4XIG S;  5IYB G;  1TVX A;  1KXL A;  1I4X A;  3I2Z A;  3S1Q H;  2RQX A;  1EY9 A;  1CM9 A;  1EY6 A;  1BF4 A;  2D9U A;  2VL6 A;  1MSG A;  4KHZ A;  1GD7 A;  2PW7 A;  2A6H C;  2EIF A;  1W2B A;  4A3C H;  3TME A;  2E2H H;  4C3J H;  4QJF A;  1DD2 A;  4L6T B;  1PZI D;  5I9P A;  2L9H A;  1D5M C;  3I73 A;  2E2J H;  1PYW D;  1BQQ T;  4H13 C;  4OGQ C;  5EKL A;  4OO1 G;  4GKK L;  5CC4 A;  3NQT A;  5DEH A;  4ZCK A;  3CCS A;  5IIF A;  4FDB A;  2N8N A;  4B3T L;  4K5W A;  4A3G H;  2C35 B;  3J80 c;  4UP7 A;  4APV A;  3UDG A;  4A3I H;  3K58 A;  2F0N A;  4ZRZ A;  1C0A A;  1AEX A;  3S16 H;  4JI2 L;  3TRZ A;  1ENF A;  5J1Z A;  4A3F H;  2IWH A;  1XMQ L;  1ML0 D;  2L5T A;  3ZYY X;  3J7A V;  1WTO A;  1FD7 D;  2IHE A;  4K0K L;  1PRT B;  2N49 A;  2B2Y C;  1KC8 C;  4JBJ A;  4DR7 L;  4YHH L;  4KJO A;  1EYC A;  4Z9C B;  3FP9 A;  4PMW A;  1GUT A;  1XPR A;  3GTK H;  1N32 L;  1E7Z A;  2OF1 A;  3GTL H;  2EXZ A;  4OHJ A;  3KDF A;  2PW5 A;  2DY7 A;  4IZ8 A;  4LF5 Q;  4RMF A;  3WDN A;  1SJE D;  4GZY C;  5M5X B;  3S1N H;  3ULJ A;  4LWC A;  1BUV T;  1CKO A;  2NZ1 D;  2JA6 B;  3GDE A;  1XNQ Q;  3KF8 A;  2KEC A;  1Y8N B;  1NSN S;  3IL8 A;  5EPK A;  4GNX B;  4IUT A;  3F1Z A;  2QEX A;  5M5Y H;  4E6I A;  3BDO A;  1I50 B;  2F0W A;  4C3I G;  4DFA A;  1PTO C;  3HOW G;  3KF8 B;  3FKI B;  5CBE E;  3T1Y Q;  3D31 A;  3D4W A;  3MTS A;  4L5R C;  1BNZ A;  1LTB D;  1Z7T A;  1STB A;  1SMY D;  4P2C B;  3VA5 A;  3X3N A;  1PTO F;  1N34 L;  3AYH B;  2DUD A;  2JA5 G;  4HN7 A;  3MXP A;  2J7Z A;  1E1T A;  1Q7Y C;  4CDF C;  4R8N A;  4X64 Q;  2RBM A;  5HGT A;  5LMU Q;  5E1F A;  3I8Z A;  2JA5 H;  1CFM A;  1JWU D;  3I4O A;  5LMN L;  2CW0 D;  2KED A;  1F9Q A;  4DK0 A;  1HNZ L;  1B7Y B;  1A2U A;  1TY2 A;  4OWW B;  5EKK A;  1LTT D;  1XPU A;  3SXH A;  4IOC A;  2B63 H;  5IYD H;  2NVY H;  2Q8I B;  1GUO A;  1KDB A;  2BA1 A;  2UXB L;  1V1P A;  3WWV A;  1NTG A;  1IW7 C;  2EYF A;  2IX0 A;  1HH2 P;  1SN8 A;  1YNJ C;  2F3V A;  2YYZ A;  5M5W H;  2QF7 A;  3JC6 6;  5ELF A;  1F9P A;  2D5D A;  1F77 A;  4HJA A;  4A3E H;  2IW3 A;  1JWS D;  4Q5V A;  2R61 A;  5C5L A;  1N8R C;  1I4Q A;  4A76 A;  4IFD J;  3I4N H;  2EYJ A;  3I4M H;  4U68 A;  1BBW A;  1U0L A;  2F3W A;  2K5H A;  2K50 A;  2OEO A;  2F0O A;  1YJ9 A;  4DUY L;  3GD7 A;  3RLF A;  4BBS H;  1MJC A;  3OWF A;  3TP6 A;  5IGB A;  1PH7 A;  1L0Y B;  1UE1 A;  5LMN Q;  1HNZ Q;  1VDZ A;  4AYB G;  2MO1 A;  4DNR B;  1SND A;  3A8K E;  3NWT A;  4YY3 Q;  2EJM A;  2E2I H;  3BS1 A;  1X65 A;  1IYU A;  1U4L A;  3IFT A;  4YIJ A;  4POG A;  1MJE A;  5CV6 A;  3KBG A;  1MHW C;  4HMJ A;  2JK8 A;  1T5X D;  1QB5 D;  3S14 B;  5ELE A;  3CCR A;  1S72 A;  5KNC A;  1TT2 A;  5EQ0 A;  3JAM L;  2TSS A;  2L55 A;  4S3S A;  2QW7 A;  3K7A B;  3R3O A;  1L0X B;  3MEF A;  1JOQ A;  1FNW A;  5C3W A;  2NB0 A;  3H0G B;  1PVO A;  2K04 A;  3PIO A;  3Q8D A;  1K83 B;  5A35 A;  4LF4 Q;  4YWL A;  2EYL A;  3J81 E;  1TWF B;  2G9D A;  1F9S A;  3FMC A;  4A3J B;  3ER0 A;  1X55 A;  3VYS A;  2ZJP A;  4QB4 A;  4A3J G;  3FPU B;  4EQN A;  1N32 Q;  1X6O A;  4LNQ A;  2HQE A;  3MXN B;  4GOP B;  4QQB X;  3NQI A;  1IYV A;  5IGG A;  2Z4I A;  1A3U A;  3V2T A;  1EZ8 A;  1PLF A;  1Y1V B;  4R4O A;  3QOL A;  4DAV A;  1QVC A;  2JYO A;  1QJO A;  5IYD G;  5FO7 B;  5JJZ A;  1Q12 A;  1AW7 A;  4DUZ L;  5D14 A;  2EJF C;  1O78 A;  5GRO A;  3PF5 A;  4KD4 A;  5C0X H;  1E22 A;  1XNR Q;  4X65 L;  3ERO A;  4BBS G;  4ZUJ A;  5COY A;  4JI1 Q;  2R7F A;  3QWN A;  3ITP A;  1NBW A;  1FR3 A;  4CBV A;  4JI0 Q;  1XMO L;  2K33 A;  3SHL A;  1S5E D;  5C44 G;  3TS0 A;  3GO5 A;  1S5B D;  1A62 A;  1HQR D;  1BOS A;  2JA9 A;  1WTX A;  5FO9 B;  3S2H H;  4A3M H;  1B1Z A;  1EYD A;  4KKT A;  3SK6 A;  4OX9 Q;  1Y1W G;  1ROD A;  4A3D H;  1O7I A;  4DV6 L;  1K8M A;  1EYG A;  2PNH A;  4YWM A;  4F88 A;  2F0T A;  3S9W A;  4NP5 A;  3UI2 A;  2HCI A;  4DV5 Q;  3BVG A;  4FF3 A;  2GN5 A;  1PV4 A;  2CWA A;  5DLQ E;  1IBL L;  5JEA J;  4JVZ A;  3NBI A;  3J81 i;  4A3K H;  4AH6 A;  1BVS A;  2A68 C;  4KN4 C;  1VQ8 A;  3KJO A;  2F0I A;  1TWG B;  1PRT C;  1QUQ A;  2E76 C;  3CKI B;  4GKK Q;  1FL0 A;  4A3K G;  4DV3 Q;  3ERS X;  2ZM6 Q;  1GXD C;  2Z8L A;  4BY1 H;  3Q24 A;  1PFB A;  1C48 A;  3KYH C;  4DV2 L;  5D65 A;  3KBX A;  4YHH Q;  3BJU A;  1JB7 A;  3PMF A;  2K32 A;  1QG7 A;  3V96 A;  2F0M A;  1XTD A;  3DEO A;  1NCV A;  3OPO A;  3TN2 A;  5C6A A;  3ERQ A;  5C4X H;  1STH A;  3QJY A;  1R4P B;  2KUM A;  4DU9 A;  5M3F H;  3EFX D;  2D2C C;  1Z47 A;  3LGJ A;  4JC0 A;  2O5J C;  4DR4 Q;  5FJ8 G;  4ALP A;  2ES2 A;  4IJL A;  3L7Z C;  3CCJ A;  4ZKB B;  1HRJ A;  4WFN 3;  3EIV A;  1DOL A;  4JI5 L;  4YCW A;  1KIX A;  4HED A;  2UUA L;  1DCZ A;  3FRP B;  4A3F G;  4IOA A;  4RGM A;  3K6O A;  3S24 A;  2F0J A;  2EQS A;  3RN2 A;  3QO2 A;  1G8Z D;  3GTP H;  4BBS B;  2C9O A;  2IPK D;  3A7A B;  2ATW A;  3CME A;  3MZ5 A;  3MEH A;  1JR0 D;  4A3D G;  1WTW A;  3TZD A;  1VQJ A;  4DR3 Q;  1KTK A;  5I2X A;  2PZU A;  4KKS A;  4BBR B;  1I6V C;  4QGU A;  2KCT A;  1TWC H;  1NJI C;  2PQE A;  4A3D B;  1Q1B A;  3HOV H;  1NNX A;  1NR4 A;  3S1M H;  5JEA G;  1IKM A;  3OIP A;  3E0E A;  4X66 Q;  3PGZ A;  1LV9 A;  3BVM A;  1ILQ A;  4CDE C;  3G4S A;  5M5W B;  1GM5 A;  2K01 A;  2QEJ C;  4X6A H;  3RUZ A;  1YI2 A;  1WD0 A;  1ENC A;  2M9V A;  1TWA H;  1VMP A;  1IBL Q;  1CKN A;  5D3D A;  2E2D C;  3K0Y A;  1KAA A;  4DV5 L;  3T51 B;  2B8G A;  2CKZ B;  4JI7 L;  3AQQ A;  4C3H H;  3A0J A;  2GA4 B;  1RDP D;  1EOV A;  4PG3 A;  2R92 B;  2KHI A;  1LT6 D;  3T13 A;  1BBU A;  1ICW A;  1G51 A;  1I3Q B;  5EPL A;  2IX1 A;  1QVF A;  1PXU A;  3HG9 A;  4IPG A;  5CR3 A;  4KHP Q;  4AIM A;  2EY1 A;  3S17 H;  3PIP A;  2DNE A;  3J7Y W;  3S2D B;  5M3F B;  5IP9 G;  2BDO A;  3J80 L;  2R93 G;  1SNM A;  5L37 A;  2JE6 I;  1TR5 A;  1EIH A;  3JAM i;  3F2D A;  3K5N A;  2JP1 A;  1CUK A;  2PQA A;  2E75 C;  3G7L A;  2WAQ E;  1YHB A;  2KJX A;  4HR7 B;  2OWO A;  5IYC H;  2I07 B;  3H3V H;  2MJ8 A;  2ZXO A;  1JJC B;  5DAU A;  4JCV E;  1K28 A;  4XYQ A;  3OIQ A;  5EBD A;  1Q86 C;  3Q0A A;  3O13 A;  1EFW A;  3AFQ A;  1OXS C;  1IBK Q;  2MQH A;  2UUC L;  1F2L A;  4RHS A;  1QZG A;  1V43 A;  4FF2 A;  3VA7 A;  2SNM A;  4LW1 A;  5E3F A;  4JI4 L;  4A3L G;  2KA7 A;  2SDF A;  4DR3 L;  4EQ5 A;  2KCN A;  1EU3 A;  4K8I A;  3NPP A;  4UP8 A;  1O7Z A;  2EXD A;  3VR6 A;  1LUZ A;  3CPF A;  4KV6 A;  4A3E B;  4DV0 Q;  2WAC A;  4OIJ A;  2B2U A;  3Q22 A;  1B53 A;  1X3E A;  3BU2 A;  3LWE A;  4DR6 L;  1QVG A;  2KHJ A;  4O1N A;  1E0B A;  4IUN A;  4PZ7 A;  2QA4 A;  5C4H A;  4JBM A;  5IGD A;  4NB3 A;  5E4X A;  1X9N A;  1EZ6 A;  2XGT A;  3H91 A;  1N33 Q;  1BKB A;  1EYA A;  1PH5 A;  3DUZ A;  1WOC A;  2JXM B;  2PI2 E;  1Q46 A;  1SXT A;  2R93 H;  4ZYS A;  3I4M B;  4TQU S;  1LTG D;  4RH6 A;  2B2U C;  1KHI A;  2UUC Q;  1IZ6 A;  4GOP C;  2WB1 E;  1KNA A;  1HZ9 A;  4P74 A;  5G3L D;  3W1B A;  1UE6 A;  4DAY B;  4DA2 A;  4MIU A;  1WD1 A;  2A69 D;  5LMN W;  5C3X A;  2K5V A;  4ZK9 B;  4KLK A;  2OTJ A;  1LTA D;  2A69 C;  5KIX A;  1JJG A;  4X64 L;  3D8G A;  1RJT A;  4WJ3 M;  4JYA L;  4P73 A;  5E7N A;  4OL7 A;  1CKM A;  4TKO B;  5IP7 G;  4A75 A;  1FJG L;  1AFP A;  4K6D A;  2EYO A;  1RHP A;  4QIW B;  3CCV A;  1PRT F;  3CD6 A;  1EOT A;  1FGU A;  1BCP F;  3MA2 B;  4BBR H;  5FKA C;  2HDM A;  3VR5 A;  3W3A A;  2RDF A;  4WJW A;  1ZEQ X;  3MXN A;  4GOP A;  1B3A A;  3M7G A;  5GAH C;  3GTQ B;  4DV3 L;  2R3Z A;  3G71 A;  2UXC Q;  1A3V A;  1GUS A;  4IPD A;  1A0I A;  1Y1W H;  2N3S A;  3BG3 A;  1F2Z A;  3TDQ A;  4HJ8 A;  3M4P A;  1EWI A;  3SE0 A;  1XNR L;  1B50 A;  3QIA A;  4K5X A;  5TSS A;  1W6K A;  2OQK A;  1TWA B;  2NVT H;  2Q8T A;  3MC0 B;  1GJX A;  4IAL A;  4R8I A;  1A6X A;  1H9M A;  2YTX A;  2B2W A;  3NE5 B;  1PH3 A;  3KLS X;  2K05 A;  4DAM A;  4JBW A;  2XIW A;  2NVQ B;  4DKA C;  1G2T A;  1BR9 A;  3D4D A;  5KGU A;  1EWH A;  1STG A;  2Y0S B;  3PIP 3;  1IHZ A;  1M4V A;  4LUZ A;  1RF2 D;  4DAP A;  3NEN A;  3P20 A;  4B9W A;  3KLW A;  1KD1 C;  4K8J A;  4CHT B;  2F03 A;  1NY4 A;  1UAP A;  1SEB D;  3KF6 A;  3NBH A;  4H02 A;  1CA5 A;  1PDQ A;  2RDH A;  4K0K Q;  4KY5 A;  3MXG A;  2WII B;  2F3I A;  4LFC L;  2KCM A;  1Z9F A;  1CK1 A;  3NBH B;  5IT9 c;  4BY7 B;  1QNU A;  2EY2 A;  4L5T A;  4IUQ A;  1VQB A;  4ZKC B;  3IFD A;  5IT9 L;  2Z4H A;  3QOJ A;  4K2K A;  4WRD A;  2XN9 C;  2I46 A;  1BCP C;  2ICE C;  3IRB A;  1ESF A;  3FHW A;  1YHA A;  1S40 A;  3I4N B;  3F2U A;  4LUO A;  1G6Z A;  2NN6 I;  2N88 A;  2RSN A;  3RR5 A;  3S16 B;  3M4Y A;  3ZJY C;  2K5Q A;  1MKH A;  2A8V A;  3FKI G;  3TP8 A;  1OXX K;  1WYD A;  4DR2 L;  3SEB A;  2D62 A;  1PTO D;  3PSI A;  3SK4 A;  1ZYR C;  3U9S A;  1B44 D;  2Y0S E;  4C1N I;  3PUX A;  2VQE Q;  5C44 B;  4ME5 A;  2B2V A;  3KF6 B;  3SDZ A;  3S2D H;  3N6R A;  5BN4 A;  3CF5 A;  3K5L A;  2MO0 A;  1DGS A;  1YNJ D;  4J6H A;  4DXG A;  4DF7 A;  5C4J H;  3UDI A;  2QCP X;  1XXG A;  4JOI A;  1O7Y A;  1VQF A;  1B3Q A;  2DNC A;  4YCU A;  4FYD A;  2B39 A;  1YIT A;  1NR2 A;  1SYF A;  2H1E A;  4BWG B;  1EQQ A;  1AP0 A;  2UXD Q;  4L63 B;  2K5D A;  1K9M C;  3GQB A;  1ESR A;  1XX8 A;  2QIL A;  3DXJ C;  4LF6 L;  4PV1 C;  4DV7 L;  5LL6 X;  2VW9 A;  3HOU G;  1X3F A;  5FOB B;  4IUR A;  5K36 G;  2BE5 C;  1J5E Q;  4RCO A;  1MBY A;  1VS0 A;  1N36 L;  3AEV A;  5ISR A;  3SVM A;  3H15 A;  3ONA B;  5HY6 A;  3HOZ B;  1CSP A;  1HPC A;  1S5C D;  2SOB A;  1AH9 A;  2RVL A;  3ND9 A;  2R92 G;  3QB3 A;  2AWN A;  2X69 A;  4IUV A;  3CC2 A;  4JI3 Q;  3K59 A;  1C4Q A;  4K6L A;  3NHH A;  1S3O A;  1Q82 C;  4RFB A;  1RCV D;  4EX5 A;  2MP1 A;  5BN5 A;  2IL8 A;  3CQZ B;  2R92 H;  3URY A;  3P75 A;  1DOK A;  1B4O A;  3K0X A;  1KLU D;  4DK3 C;  5EKI A;  3HKS A;  4B3R L;  1HR0 W;  3D6W A;  4GN3 B;  2Y0S G;  2XWJ B;  2EOT A;  2ZXR A;  2K52 A;  4BS9 A;  3TS2 A;  1IBK L;  4PMC A;  4LF8 L;  2ZTC A;  2A5H A;  5BR8 Q;  4PMB A;  3CC4 A;  5E4W C;  1B9M A;  2RKS A;  2WAQ G;  3CU7 A;  1GUG A;  5KEE A;  2PPB C;  2NVX B;  1L1O B;  2CVR A;  5CYU A;  1ZXT A;  4CDD C;  5JVH 3;  2A6H D;  2K75 A;  4JW0 A;  4R9W A;  4OWX B;  1JE5 A;  5KNB A;  4HIO A;  3PUY A;  2UU9 L;  2Q2H A;  1UEA B;  3SGI A;  2OXP A;  1N9W A;  3Q6S A;  4LK1 C;  2K5N A;  4C3I H;  5GAD C;  2JA7 B;  1A3T A;  3GTJ H;  1IKL A;  2FIN B;  3AMU A;  2VUM G;  4DR2 Q;  1EL0 A;  1CQV A;  2NVQ H;  3S17 B;  1XWE A;  2F4V Q;  1BO0 A;  4JI0 L;  2EYM A;  1HNW Q;  2FHT A;  2K1B A;  1K8G A;  5M5Y B;  2VUM H;  2O5I C;  1LT5 D;  1TKW B;  2L12 A;  4ZLT F;  3CCQ A;  1JWM D;  3K7A H;  1CT1 D;  2J0T D;  2ALY B;  5C5M A;  3SK5 A;  4F87 A;  4LF8 Q;  2ZXP A;  3TP5 A;  1PA6 A;  4ABN A;  1DZ1 A;  2PCF B;  2A19 A;  3PO2 G;  5DM7 3;  4MTN A;  5ELB A;  1AN8 A;  5IOD A;  2L11 A;  1LTL A;  2MHV A;  3BYT B;  1R9T H;  1VQC A;  1A2T A;  4RGN A;  3OTO Q;  4MZ9 A;  4HSV A;  3R93 A;  3VYU A;  5CBA E;  4ME3 A;  3H6M A;  2D0O A;  5I9O A;  5I6W A;  2CCZ A;  3IKJ A;  3K7U C;  1GUW A;  5JPN C;  5M9O A;  3GTJ B;  1QCB D;  3E9H A;  2VXW A;  3A55 A;  2CH4 A;  4JI1 L;  1X3Q A;  2DJF C;  4OEM B;  1T5E A;  1WCM H;  4CGY B;  1VQE A;  5FO8 B;  2XRS D;  2I5L X;  1ET6 A;  2CW0 C;  2LKV A;  4CDC C;  3PO3 B;  1E2V A;  1STE A;  4R4C A;  3CCE A;  1DON A;  3EJI A;  2B63 B;  4A3G B;  3SK8 A;  1NUC A;  1UE5 A;  2F0E A;  4DR1 Q;  2YV5 A;  4GLA C;  1VQM A;  4RKB A;  2Q2T A;  5FK9 C;  1EY8 A;  1J8I A;  1PRT D;  3PUZ A;  4A3M G;  4IO9 A;  1VQ7 A;  1WVL A;  3PQI A;  3RZO H;  2M00 A;  1RKN A;  3BDL A;  1Q8I A;  4DUY Q;  4XDX A;  4X62 L;  1VMC A;  1P16 A;  3KLS A;  2ZTD A;  2JEA I;  3GTQ H;  1VF7 A;  2AHO B;  1VF5 C;  4JYA Q;  2C5C A;  1FJG Q;  2F0F A;  3HKZ G;  4LJZ C;  1PZJ D;  2WV6 D;  4IUU A;  3VYR A;  2AQ2 B;  4IUP A;  1PH1 A;  5C3E H;  3HS0 C;  3NEM A;  3H3V I;  1EEI D;  2Z6K A;  2HQL A;  2RHQ B;  3OMG A;  5LHY 1;  4KJN A;  4P75 A;  3NUC A;  3M7N A;  2A6E D;  1SYC A;  4RCN A;  3S14 H;  1E2Z A;  3KOJ A;  3CCM A;  1PFS A;  2KQ3 A;  4A3B H;  3C3L A;  2PZT A;  4JI6 L;  3T1Y L;  3OTO L;  3Q23 A;  5DM6 3;  4LFC Q;  3GTO B;  2V1C C;  4KHV A;  5EAY A;  3I55 A;  2EJG C;  2ASB A;  1OO9 B;  1QZH A;  1R9T B;  1Y14 B;  2AKW B;  4G7H C;  2B2T C;  2F0U A;  4UAI A;  3I90 A;  3H0G G;  1WCM G;  4DV2 Q;  2FXQ A;  1IBM L;  2AWO A;  2K5W A;  3W2D A;  2J4X A;  4OEL B;  1G91 A;  4QF4 A;  1VQ9 A;  1QUQ B;  4BBR G;  1HA5 A;  4AYB E;  3PO2 B;  1HNX L;  1XTC D;  2VS1 A;  4A93 H;  4DN4 M;  4TVA B;  4LF7 L;  3I70 A;  4QUF A;  2BH2 A;  4CKE A;  1PYS B;  2KVM A;  3DMU A;  4AQY L;  2B2T A;  4GKJ L;  3TZU A;  3FDT A;  4O42 A;  4LFA Q;  4DR1 L;  5FLM H;  1Q81 C;  1TWC B;  3OMC A;  3HOU B;  4LF5 L;  2R7Z B;  3HOW H;  2RCF A;  3DEP A;  1TY0 A;  1ASZ A;  1V1Q A;  4GKJ Q;  3CRL C;  3D0F A;  1RTN A;  1EQV A;  2I5M X;  1YHQ A;  3FPP A;  1H95 A;  4NXN Q;  2NZH A;  3VYT A;  5CMD A;  1CQF A;  4YCV A;  2MNA A;  2A68 D;  4HCS A;  3CCL A;  2KCC A;  3HOZ G;  3RLN A;  1H9J A;  4JBK A;  2PMZ E;  5IP9 H;  4JI7 Q;  3KFU A;  2F0V A;  2Z1C A;  1TWH H;  2B2Y A;  3KDF B;  2R7D A;  1WTV A;  3U4Z A;  4PNY A;  5M3M B;  4AQY Q;  2K03 A;  3RLO A;  4RGO S;  4YWK A;  2ZJQ A;  2PO4 A;  3KLR A;  5C3E B;  4KY6 A;  2L0C A;  1AE2 A;  1QIL A;  2B29 A;  1I4G A;  2ZT9 C;  2NVT B;  4IN3 A;  1H9S B;  5COR A;  3UDX A;  3HZX A;  2JA6 H;  3ULP A;  4DAY A;  1XPO A;  2EYP A;  4A3E G;  4NXM Q;  3GTM B;  1K0R A;  1SYG A;  2EE1 A;  3GTO H;  4GLV B;  5BR8 L;  4JPB W;  3RZD H;  2JA8 H;  4C2M H;  4MTK A;  5JVG 3;  1NMG A;  4KK7 A;  2F4V L;  3EBE A;  1RIP A;  4DNT B;  2WKD A;  4XQN A;  4X3K A;  4JI6 Q;  3CAM A;  2N78 A;  4DPG A;  2R93 B;  1PH2 A;  1D1I A;  2JSO A;  3FVQ A;  1RTO A;  1EIG A;  3HOX G;  3A5Z B;  4DUZ Q;  4EQO A;  1OXT A;  3A54 A;  4RHR A;  4XYO A;  3ULL A;  4GN5 A;  3I72 A;  1HUM A;  3AFP A;  3NXW A;  1JT8 A;  5ELD A;  1Y8P B;  4OO1 I;  3I4L A;  2JA7 G;  3VR3 A;  1VQH A;  3G6J B;  1BCP B;  5BN3 A;  2FMC A;  2NZO A;  1U4R A;  3MVV A;  2VQE L;  3TP7 A;  2IHF A;  3L9A X;  1FNU A;  3DLL A;  4DV0 L;  3D4R A;  3KK7 A;  4BA2 I;  4OWT B;  1ZKO A;  4C3I B;  2VB3 X;  4QY7 A;  1HZA A;  3PCO B;  2I0Q A;  4LF6 Q;  4KN7 C;  3A8I E;  4XXE A;  1VQL A;  2R7Z G;  5J22 A;  5CV7 A;  2E2H B;  4BA1 I;  2RHS B;  2NVY B;  4DK6 C;  4RKL A;  3GTG B;  1PTO B;  4RG1 A;  3K81 C;  4XQJ A;  1PZK D;  1HTP A;  4ZUI A;  1EWC A;  4IQZ A;  2AQ3 B;  4IPC A;  3VR2 A;  1PYB A;  1MD2 D;  1B70 B;  1SNP A;  4IPH A;  3E6Z X;  2UXC L;  4LAA A;  1UEB A;  2WB1 B;  1RL2 A;  1SNQ A;  3I91 A;  2XTI A;  1SE8 A;  2XWB B;  1STY A;  2Q2U A;  2XNA C;  3FKI H;  2PMZ B;  1GOZ A;  2B3G A;  2ZM6 L;  1ENA A;  3T53 B;  1A15 A;  1SFO B;  4TRD A;  4QUC A;  2EYH A;  5T1G A;  4NMZ A;  1Q1E A;  5C44 H;  3KJP A;  2UXD L;  2XVS A;  3T56 B;  2EY6 A;  1K3B C;  2YTY A;  4DR5 L;  4KKU A;  5GAE C;  1H9R A;  1BCP D;  1DM0 B;  4FXD A;  1DXM A;  4EGV A;  1QE6 A;  4R4I A;  1D5Z C;  4FNF A;  1V9P A;  5EGT A;  5CV4 A;  1KL9 A;  4K14 A;  3M3Y H;  4DV1 Q;  2RSO A;  4P71 A;  3M4Q A;  4NW2 A;  3VDY A;  1PFN A;  4L8J A;  4QL5 A;  2UU9 Q;  1X3G A;  4EVO A;  5KYI A;  4C1N K;  4DGZ A;  4OX9 L;  1G6P A;  1ASY A;  4DR7 Q;  3F8T A;  2OTL A;  3GTK B;  4H0L C;  1A8V A;  2BOS A;  1SYE A;  3JAM c;  1OXV A;  1XMQ Q;  2AUJ D;  1YZ6 A;  1LO5 D;  4YY3 L;  4MHE A;  4HTH A;  1FGB D;  1SSO A;  4C3H G;  2F0H A;  2XRQ D;  5HGQ A;  1I5F A;  5T1I A;  5I4D A;  1LT3 D;  2LXJ A;  4JI5 Q;  5IGE A;  4P72 A;  4IFD H;  1EQR A;  4LF7 Q;  4LFB Q;  2SNS A;  1PTO H;  3LNN A;  5ELO A;  2AQ1 B;  2BH8 A;  1T9H A;  1X54 A;  3BZC A;  1RD9 D;  3OW2 A;  4L5Q A;  1YNN D;  1C8C A;  3HOX B;  2BE5 D;  4HSP A;  4NKL A;  2Z6B A;  4BY7 G;  3HOW B;  5NUC A;  4EQP A;  1G29 1;  1UE7 A;  1IBM Q;  3GTG H;  4Y52 H;  2E8G A;  2A1A A;  5KYL A;  2G5D A;  1E3P A;  1FNV A;  3W5O A;  1Y1W B;  4V0B A;  1HJP A;  2CWP A;  1QNK A;  3TSS A;  2IY5 B;  1U9R A;  4QMG A;  4J8Q A;  3CCU A;  1SLJ A;  2M2L A;  1QOH A;  3M4O H;  2NTT A;  1TWF H;  4H7B A;  1A63 A;  1JB3 A;  4O2D A;  2DGY A;  3CW2 C;  1EY5 A;  1SDF A;  1WJJ A;  1VQ4 A;  5IY0 A;  1W3S A;  5A2Q E;  1VCI A;  3I56 A;  5CGK A;  1GUN A;  1TQO A;  2R6G A;  2JA7 H;  4JI8 L;  1CA6 A;  2VB2 X;  1KAB A;  1R4Q B;  1GKH A;  4X3S A;  5A2Q L;  1F9R A;  1V8Q A;  4BY1 B;  4NPS A;  1JJ2 A;  4JI3 L;  5M5X H;  3BVZ A;  2L4N A;  5JEA H;  4ILW A;  5JOB A;  1I4H A;  3DHQ A;  3RNU A;  1EY0 A;  2NBF A;  2K4K A;  4DV6 Q;  1H9K A;  1LLR D;  2NN6 G;  1VQ6 A;  1Y69 U;  1J5E L;  1CKN B;  3RN5 A;  5JJK A;  1CHP D;  2JN4 A;  1SNC A;  3CPW A;  1F2Y A;  3T16 A;  3CMA A;  1CTM A;  3QG1 A;  5IWA L;  1HXY D;  4DNI A;  3RZO B;  1LAC A;  1CHQ D;  3EVQ A;  3H3V C;  4HCE A;  1TS5 A;  1EIY B;  4Q0F A;  5G3L F;  5JJL A;  1ILP A;  3UE0 A;  3F2C A;  3DWA A;  4FVM A;  1VQG A;  2PI2 A;  1TU2 B;  4LUV A;  1BBX C;  2WAQ B;  1QWY A;  4AYB B;  2NUC A;  1TS2 A;  3OHX C;  3S1R B;  4HJ9 A;  1K73 C;  1V1P B;  4JV5 L;  4JK1 C;  1JQY D;  2Z0S A;  1HHV A;  2B2W C;  2NYZ D;  2F0S A;  2K14 A;  1VQ5 A;  1EEF D;  3GTL B;  4ID6 A;  3J81 c;  4B3M L;  3NTH A;  1UUP A;  1TS3 A;  5I2Y A;  5C0X J;  3M9B A;  4JI2 Q;  1II3 A;  4HMI A;  1YBY A;  4A4I A;  1X56 A;  2D0P A;  4GN4 B;  3TRE A;  1YJN A;  5AJ3 L;  4ULL A;  2RA4 A;  3HKZ E;  1KDA A;  1AZQ A;  1LTR D;  4JI4 Q;  2G9H D;  3DWP A;  3UDF A;  1AZP A;  3MFG A;  3K5M A;  1EFI D;  3L3O C;  1TS4 A;  4HID A;  3M3Y B;  1ZYR D;  4M1U B;  3S2H B;  1SE4 A;  3U9O A;  4C2M B;  5AJ3 Q;  1B2T A;  1Q3L A;  1FYC A;  4G57 A;  5ELN A;  4C3J G;  1YIJ A;  5K36 H;  3CRK C;  3RD4 A;  3E9I A;  1GO3 E;  2LXK A;  2IJ0 A;  1SMY C;  1SAP A;  1DJR D;  1PFM A;  2QKI C;  4ZAI A;  1SR3 A;  4JI8 Q;  2K28 A;  4LFB L;  2JQO A;  1ICF B;  5FLX L;  1WTR A;  3I4M G;  1J6Q A;  3J7A 5;  2L15 A;  2K6A A;  4RWS C;  5FLX c;  4KTA A;  5D3I B;  1SYB A;  1N34 Q;  4U67 3;  1SFO H;  5IT9 E;  2JA5 B;  3HFZ B;  3K57 A;  2AMC B;  1HFN A;  2HD3 A;  3G6E A;  3E3X A;  4RA8 A;  3J80 E;  4IFD G;  4CJ2 C;  4XT1 B;  3TEH B;  3R2T A;  3G48 A;  1WI5 A;  1U5K A;  2CQO A;  2YU9 B;  1VQI A;  2VNU D;  3T1H L;  3OW7 A;  5IWA Q;  3OSO A;  3P7J A;  1HA6 A;  4BY7 H;  3K80 C;  1BXT A;  1LYL A;  3HOU H;  3S15 B;  1SNO A;  2RCN A;  2OCE A;  5F2D A;  3NSW A;  1PH6 A;  5C0X G;  1HFG A;  1KDC A;  5M3M G;  4A3M B;  2RDG A;  4L5S A;  5CV8 A;  3PO3 G;  2N55 A;  4R4T A;  1X32 A;  3NTK A;  4DR5 Q;  3M4O B;  1TII D;  2F0G A;  2E2I B;  1SRU A;  1D8L A;  2B63 G;  1K8O A;  1HZC A;  1S4Z A;  5JPM C;  2HHH Q;  2BA0 A;  1VQD A;  2WFW A;  2E2J B;  2EZV A;  5J3B A;  2H4O A;  2QDB A;  5IOC A;  4O0A A;  1S5F D;  1I6H B;  3PUW A;  1HR0 L;  4FF4 A;  3HOX H;  4NXM L;  4IJH A;  1Y8O B;  4KY7 A;  4A3K B;  2X6L A;  2IX3 A;  5ELC A;  3I3C A;  3J81 L;  3EQL C;  5IE8 A;  4QIW E;  2UXB Q;  1GVP A;  2IT1 A;  2NTS A;  1M1K C;  5HUR A;  2MFI A;  4LF9 L;  4UP9 A;  1LAB A;  2F52 A;  3CQZ H;  2NN6 H;  3STB C;  2LMC B;  4KMU C;  3TQY A;  5JJI A;  4HJ5 A;  1EUJ A;  1K3R A;  2FMM A;  1N33 L;  2HIX A;  1Y1V H;  4A3J H;  3MHB A;  2FJ2 A;  2Q2I A;  5DNF A;  2EPB A;  5C0X I;  2KBN A;  3C46 A;  5IGC A;  1U4M A;  1SBB B;  1GHJ A;  4LF4 L;  2HCC A;  4GLX A;  1P8L A;  2F0Q A; 
#chains in the Genus database with same CATH homology
 4A3C H;  3CCV A;  4GNX A;  4KI0 A;  3CD6 A;  2HT1 A;  3HOW G;  1FGU A;  2B29 A;  3KF8 B;  4BBR H;  2LSS A;  5FJ8 H;  3PO2 H;  3T1Y Q;  4L5R C;  3D31 A;  3UDX A;  2JA6 H;  3STB D;  3ULP A;  4GOP A;  3PF4 A;  1XPO A;  4A3E G;  4NXM Q;  1YVC A;  5M3M H;  1K0R A;  5GAH C;  1N34 L;  3A74 A;  3GTO H;  1IXR A;  3AYH B;  2DUD A;  4GLV B;  3UE1 A;  5BR8 L;  4DV3 L;  2JA5 G;  3RZD H;  1PH8 A;  3CP0 A;  3G71 A;  1E1T A;  3DM3 A;  2OQ0 A;  1Q7Y C;  1SRO A;  4C2M H;  2JA8 H;  2UXC Q;  1NMG A;  2VQF Q;  2F4V L;  4IPD A;  1A0I A;  1Y1W H;  2N3S A;  3EBE A;  1RIP A;  4HJ8 A;  3M4P A;  1EWI A;  4X64 Q;  1KRS A;  2ZTE A;  5LMU Q;  4GS3 A;  2JA5 H;  1XNR L;  4JI6 Q;  1LM0 A;  3I4O A;  5LMN L;  3CAM A;  1HNZ L;  4WJ4 A;  1B7Y B;  2OQK A;  2NVT H;  2N78 A;  4BY1 G;  4DPG A;  3CXC A;  1VQK A;  3T1H Q;  1PH2 A;  4OWW B;  2YTX A;  1KAW A;  1PH3 A;  1NMF A;  4DAM A;  1XPU A;  4JBW A;  3HOX G;  2GVA A;  3A5Z B;  4DUZ Q;  4DKA C;  4IOC A;  1OXT A;  3ULL A;  2NVY H;  2B63 H;  5IYD H;  4GN5 A;  3AFP A;  1JT8 A;  2BA1 A;  2UXB L;  4OON A;  4OO1 I;  4LUZ A;  2JA7 G;  3WWV A;  1VQH A;  1NTG A;  2IX0 A;  3NEN A;  1HH2 P;  1SN8 A;  2NZO A;  4LFA L;  2YYZ A;  5M5W H;  4R4Q A;  3KLW A;  2VQE L;  3JC6 6;  2IHF A;  4DV0 L;  1KD1 C;  3DLL A;  4BA2 I;  1NY4 A;  4OWT B;  4HJA A;  3KF6 A;  4A3E H;  4H02 A;  3S1R H;  2H5X A;  1N8R C;  1E24 A;  4K0K Q;  4A76 A;  3HOY G;  4QY7 A;  3CC7 A;  3I4N H;  1HZA A;  4IFD J;  3I4M H;  3PCO B;  2F3I A;  4LFC L;  3HOZ H;  1BBW A;  1U0L A;  2KCM A;  2K5H A;  1Z9F A;  2K50 A;  2I0Q A;  4LF6 Q;  1YJ9 A;  4DUY L;  1VQL A;  2R7Z G;  3NBH B;  3GD7 A;  5IT9 c;  4BA1 I;  4L5T A;  2RHS B;  3RLF A;  4BBS H;  1MJC A;  1VQB A;  4DK6 C;  1Q8K A;  1VQO A;  1PH7 A;  4A3B G;  1UE1 A;  4RG1 A;  3K81 C;  5LMN Q;  1HNZ Q;  4B3S L;  3BZK A;  4AYB G;  2MO1 A;  3IRB A;  3FHW A;  2E5L Q;  1YHA A;  1S40 A;  4LUO A;  4IPC A;  5FLM G;  2NN6 I;  4YY3 Q;  1PYB A;  3RR5 A;  2E2I H;  3ZJY C;  3J80 i;  1B70 B;  4HJ7 A;  1MKH A;  1X65 A;  4IPH A;  4JOI C;  5GAG C;  4POG A;  2A8V A;  2QGQ A;  3FKI G;  1UEB A;  1MJE A;  2UXC L;  1RL2 A;  1KRT A;  1D7Q A;  1OXX K;  1WYD A;  1E1O A;  2JK8 A;  2UUB L;  5C3E G;  4DR2 L;  2ZJR A;  2D62 A;  5M3F G;  2JJQ A;  4R1J A;  3CCR A;  3PV0 A;  1S72 A;  4B3S Q;  2XTI A;  3PSI A;  1SE8 A;  2Y0S E;  2Q2U A;  3PUX A;  3FKI H;  2VQE Q;  1L1O A;  2B3G A;  3KF6 B;  2ZM6 L;  3MEF A;  3S2D H;  1PVO A;  3S15 H;  2WP8 J;  4B3R Q;  3PIO A;  3Q8D A;  3CF5 A;  4IFD I;  1Q1E A;  2MO0 A;  1IYJ B;  1DGS A;  5C44 H;  1YJW A;  4MNO A;  4LF4 Q;  4YWL A;  1SMX A;  3KJP A;  2UXD L;  3ER0 A;  5C4J H;  3UDI A;  1X55 A;  4JOI A;  2PQA B;  2YTY A;  2ZJP A;  4DR4 L;  1VQF A;  4DR5 L;  1L2F A;  4A3J G;  1M90 C;  1N32 Q;  5GAE C;  1X6O A;  4YCU A;  4LNQ A;  4XTC S;  3MXN B;  4GOP B;  4QQB X;  1YIT A;  1TWG H;  4B3T Q;  4R4I A;  4R4O A;  1I3Q H;  2I5H A;  1V9P A;  1L1O C;  1QVC A;  1KL9 A;  1EQQ A;  2UXD Q;  5IYD G;  1K9M C;  4LF9 Q;  3M3Y H;  2YU9 H;  4LF6 L;  4DV1 Q;  4P71 A;  3M4Q A;  1Q12 A;  4X62 Q;  4Y7N H;  4DV7 L;  4DUZ L;  2CFM A;  2VW9 A;  3VDY A;  3I4N G;  3HOU G;  5GRO A;  3PF5 A;  3A5U A;  4QL5 A;  2UU9 Q;  1X3G A;  1X3F A;  1PH9 A;  1NE3 A;  5K36 G;  1J5E Q;  2GVB A;  1VS0 A;  1N36 L;  4OX9 L;  3AEV A;  4A3L H;  1G6P A;  3H15 A;  1ASY A;  1JMC A;  4DR7 Q;  1E22 A;  1XNR Q;  4X65 L;  5HY6 A;  4BBS G;  3F8T A;  1CSP A;  3H0G H;  4JI1 Q;  1K8A C;  3L2P A;  2R7F A;  2OTL A;  4JI0 Q;  1NBW A;  1AH9 A;  1A8V A;  3JAM c;  1L0W A;  1XMO L;  1OXV A;  1K83 H;  1XMQ Q;  1PH4 A;  1YZ6 A;  1I50 H;  4UPA A;  4YY3 L;  5C44 G;  3GO5 A;  3TS0 A;  2RF4 A;  2VZA A;  2AWN A;  2R92 G;  4JV5 Q;  3CC2 A;  4JI3 Q;  1A62 A;  3U58 A;  1S3O A;  1Q82 C;  1Y1V G;  2JA9 A;  4EX5 A;  3S2H H;  5HGQ A;  4A3M H;  1N36 Q;  4OX9 Q;  2R92 H;  1AE3 A;  3PUV A;  1Y1W G;  1I5F A;  4A3D H;  3K0X A;  5H1S E;  1O7I A;  1OXU A;  2LXJ A;  4DK3 C;  4DV6 L;  2UUA Q;  5IYC G;  4JI5 Q;  1EYG A;  4P72 A;  2PNH A;  4YWM A;  1EQR A;  1KQS A;  3HKS A;  4B3R L;  1HR0 W;  4LF7 Q;  4GN3 B;  2Y0S G;  5C4X G;  4LFB Q;  1XJV A;  2K52 A;  5ELO A;  2BH8 A;  4DV5 Q;  1T9H A;  1X54 A;  3BZC A;  3OW2 A;  1IBK L;  3TS2 A;  4DV4 Q;  4L5Q A;  4LF8 L;  2ZTC A;  2GN5 A;  1PV4 A;  3HOV G;  4POF A;  5BR8 Q;  2KEN A;  1XNQ L;  3CC4 A;  4BY7 G;  2CWA A;  5DLQ E;  1IBL L;  1IBM Q;  1G29 1;  1UE7 A;  3GTG H;  5JEA J;  3J81 i;  2WAQ G;  4A3K H;  3HOY H;  4AH6 A;  1BVS A;  4Y52 H;  2E8G A;  5GQO A;  4GNX C;  2JA8 G;  2A1A A;  1L1O B;  1VQ8 A;  2HHH L;  3KJO A;  1E3P A;  2WB1 G;  2E5L L;  1C9O A;  1QUQ A;  2R7Z H;  2K75 A;  3W5O A;  4GKK Q;  1FL0 A;  4A3K G;  4OWX B;  4DV3 Q;  1JE5 A;  3ERS X;  1HJP A;  2CWP A;  2ZM6 Q;  4HIO A;  3PUY A;  2IY5 B;  1VQA A;  3K8A A;  3CCU A;  2Q2H A;  2UU9 L;  1SLJ A;  4BY1 H;  3M4O H;  3SGI A;  1TWF H;  1N9W A;  1A63 A;  3KYH C;  2K5N A;  4C3I H;  5GAD C;  4DV2 L;  4O2D A;  2DGY A;  3CW2 C;  3GTJ H;  5LMU L;  1I94 L;  1WJJ A;  1VQ4 A;  4YHH Q;  5IY0 A;  1HR0 Q;  1W3S A;  3BJU A;  1VCI A;  3I56 A;  1FVI A;  4DR2 Q;  1JB7 A;  2VUM G;  2NVQ H;  4JG2 A;  2R6G A;  1XTD A;  5IYB H;  1XMO Q;  1VQN A;  1YEZ A;  2F4V Q;  2JA7 H;  4JI8 L;  3F2B A;  5C4X H;  4JI0 L;  1HNW Q;  1K8G A;  1GKH A;  5IP7 H;  3W1G A;  5M3F H;  2VUM H;  3CCQ A;  4NPS A;  1JJ2 A;  1I94 Q;  4HIM A;  3K7A H;  4JI3 L;  1Z47 A;  2ALY B;  3LGJ A;  4JC0 A;  5M5X H;  4DV4 L;  1PA6 A;  4LF8 Q;  4A3C G;  3L0O A;  2ID0 A;  4DR4 Q;  5FJ8 G;  4ALP A;  2A19 A;  4NXN L;  3PO2 G;  4MTN A;  2ES2 A;  4IJL A;  3L7Z C;  3U50 C;  3J81 j;  3CCJ A;  3RNU A;  1LTL A;  1VQP A;  1R9T H;  3EIV A;  2K4K A;  1VQC A;  4JI5 L;  4DV6 Q;  4YCW A;  1KIX A;  2UUA L;  3OTO Q;  4MZ9 A;  4HIK A;  2NN6 G;  4A3F G;  1VQ6 A;  4IOA A;  1J5E L;  1CKN B;  3RN5 A;  3S24 A;  3B6Y A;  3J7Z C;  4ME3 A;  5JJK A;  2D0O A;  2EQS A;  4PZ8 A;  3RN2 A;  4A3G G;  3OYY A;  4KHP L;  3GTP H;  3I7F A;  2CCZ A;  3CPW A;  3CMA A;  3K7U C;  2ATW A;  5IWA L;  4A3I G;  4DNI A;  3GTM H;  1HNW L;  3CME A;  1EIY B;  4A3D G;  1VQJ A;  4DR3 Q;  2VQF L;  1IL2 A;  3E9H A;  4B3M Q;  1YNX A;  5JJL A;  1TXY A;  4JI1 L;  3UE0 A;  4QGU A;  3F2C A;  2KCT A;  1TWC H;  1WCM H;  1NJI C;  1VQG A;  1VQE A;  2PI2 A;  1HZB A;  3NEL A;  4LUV A;  1Q1B A;  2I5L X;  1C7Y A;  3HOV H;  3S1M H;  5JEA G;  4R4C A;  4HJ9 A;  4X66 Q;  3E0E A;  1K73 C;  3PGZ A;  3CCE A;  4JV5 L;  2Z0S A;  3G4S A;  4DV1 L;  1GM5 A;  2K14 A;  3EN2 A;  1VQ5 A;  3J81 c;  2YTV A;  1UE5 A;  4X6A H;  4B3M L;  1YI2 A;  1OTC A;  4DR1 Q;  2YV5 A;  4GLA C;  1VQM A;  2Q2T A;  5C0X J;  3M9B A;  4JI2 Q;  2NVX H;  1TWA H;  1IBL Q;  4OXP A;  1CKN A;  1YBY A;  4X66 L;  3PUZ A;  4A3M G;  4A4I A;  1X56 A;  4IO9 A;  1VQ7 A;  2D0P A;  4GN4 B;  3TRE A;  1YJN A;  3RZO H;  5AJ3 L;  1WFQ A;  3HKZ E;  2JA6 G;  4DV5 L;  2Z6K C;  2CKZ B;  4JI4 Q;  4JI7 L;  3AQQ A;  4DUY Q;  4C3H H;  4X62 L;  1HNX Q;  3A0J A;  3UDF A;  1I6H H;  1P16 A;  2ZTD A;  1EOV A;  1CSQ A;  2JEA I;  3PO3 H;  3GTQ H;  4PG3 A;  2KHI A;  2AHO B;  4HID A;  1MIU A;  4JYA Q;  1BBU A;  1FJG Q;  3M85 A;  5AJ3 Q;  1G51 A;  2VY3 A;  5ELN A;  3HKZ G;  1YIJ A;  2IX1 A;  3U4V A;  1QVF A;  3E9I A;  1GO3 E;  4IPG A;  2LXK A;  4UY8 C;  4DV7 Q;  1PHJ A;  4KHP Q;  4AIM A;  1PH1 A;  5C3E H;  4DR6 Q;  3S17 H;  4JI8 Q;  1SR3 A;  2HIV A;  3PIP A;  4LFB L;  3NEM A;  4A93 G;  2JQO A;  3I4M G;  5IP9 G;  1J6Q A;  1EIF A;  2L15 A;  2Z6K A;  3H3V I;  2HQL A;  2RHQ B;  3J7A 5;  1B8A A;  5FLX c;  4X65 Q;  4BXX G;  4P75 A;  2R93 G;  1N34 Q;  3M7N A;  2JE6 I;  4PZ6 A;  1UWV A;  1SFO H;  3S14 H;  3ICE A;  3KOJ A;  3HFZ B;  3JAM i;  2AMC B;  1PFS A;  3F2D A;  3CCM A;  1CUK A;  2PQA A;  3G6E A;  4A3B H;  2WAQ E;  4J15 A;  1YHB A;  4BXX H;  4JI6 L;  3T1Y L;  2UUB Q;  2OWO A;  5IYC H;  3OTO L;  2JEB I;  4IFD G;  4XIG S;  5IYB G;  3TEH B;  4LFC Q;  3H3V H;  3G48 A;  1KXL A;  1WI5 A;  1U5K A;  2V1C C;  5EAY A;  3I55 A;  1JJC B;  2CQO A;  3I2Z A;  3S1Q H;  2ASB A;  4JCV E;  1QZH A;  1VQI A;  1Y14 B;  2AKW B;  2VNU D;  3T1H L;  2VL6 A;  5IWA Q;  3H0G G;  1WCM G;  1GD7 A;  4KHZ A;  2EIF A;  2FXQ A;  4DV2 Q;  2AWO A;  1W2B A;  1Q86 C;  1IBM L;  4C3J H;  3K80 C;  4QJF A;  2E2H H;  4BY7 H;  1EFW A;  1VQ9 A;  1LYL A;  1QUQ B;  3AFQ A;  1OXS C;  4BBR G;  2E2J H;  3HOU H;  1IBK Q;  2MQH A;  2UUC L;  4OO1 G;  4AYB E;  4GKK L;  1HNX L;  1QZG A;  1V43 A;  2OCE A;  2RCN A;  2VS1 A;  4A93 H;  4LW1 A;  4TVA B;  4JI4 L;  4LF7 L;  4A3L G;  1PH6 A;  5C0X G;  3CCS A;  5M3M G;  4FDB A;  4DR3 L;  2N8N A;  4EQ5 A;  4B3T L;  2BH2 A;  4A3G H;  1PYS B;  2C35 B;  3J80 c;  4AQY L;  4UP7 A;  4UP8 A;  4APV A;  4L5S A;  2EXD A;  3PO3 G;  3UDG A;  4A3I H;  1LUZ A;  4GKJ L;  4R4T A;  3CPF A;  4DR5 Q;  1C0A A;  4DV0 Q;  3S16 H;  1SRU A;  4JI2 L;  3TRZ A;  1D8L A;  2B63 G;  4LFA Q;  1X3E A;  4DR1 L;  4A3F H;  1XMQ L;  1HZC A;  3BU2 A;  2HHH Q;  2BA0 A;  5FLM H;  1VQD A;  2WFW A;  1Q81 C;  4DR6 L;  5J3B A;  2IHE A;  2KHJ A;  1QVG A;  4LF5 L;  4K0K L;  4O0A A;  2N49 A;  3HOW H;  4PZ7 A;  1ASZ A;  2QA4 A;  1KC8 C;  1V1Q A;  3PUW A;  4JBJ A;  4JBM A;  4DR7 L;  4NB3 A;  4YHH L;  1X9N A;  1HR0 L;  4GKJ Q;  3D0F A;  2XGT A;  3HOX H;  4NXM L;  4IJH A;  3FP9 A;  2I5M X;  4PMW A;  1YHQ A;  1XPR A;  1N33 Q;  3GTK H;  1BKB A;  1PH5 A;  2NZH A;  4NXN Q;  1N32 L;  1H95 A;  1E7Z A;  1WOC A;  2PI2 E;  4YCV A;  2MNA A;  1Q46 A;  3CCL A;  5IE8 A;  3GTL H;  2R93 H;  4QIW E;  4TQU S;  2UXB Q;  3KDF A;  1GVP A;  3HOZ G;  2IT1 A;  3RLN A;  1M1K C;  4JBK A;  2PMZ E;  4LF5 Q;  1KHI A;  2MFI A;  4RMF A;  4UP9 A;  2UUC Q;  4LF9 L;  1IZ6 A;  2F52 A;  5IP9 H;  3CQZ H;  4JI7 Q;  3STB C;  4GOP C;  2WB1 E;  1HZ9 A;  3TQY A;  4P74 A;  3W1B A;  4DAY B;  1UE6 A;  3S1N H;  5JJI A;  3ULJ A;  4HJ5 A;  4LWC A;  5LMN W;  1EUJ A;  3KFU A;  1K3R A;  1N33 L;  1CKO A;  1TWH H;  2HIX A;  2K5V A;  3GDE A;  4KLK A;  1Y1V H;  3KDF B;  2R7D A;  1XNQ Q;  4A3J H;  2OTJ A;  3U4Z A;  2Q2I A;  4AQY Q;  4X64 L;  1JJG A;  5C0X I;  4WJ3 M;  3RLO A;  2KBN A;  4JYA L;  4P73 A;  5E7N A;  1CKM A;  5IP7 G;  4A75 A;  4GNX B;  4YWK A;  4LF4 L;  1FJG L;  4GLX A;  1P8L A;  2ZJQ A;  3F1Z A;  2QEX A;  5M5Y H;  1AE2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...