4JI1L

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
124
structure length
123
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKLLGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 14
structure length 123
sequence length 124
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4ji1L00
4LF8Q 3RR5A 1Y1WH 1QVFA 2UXCQ 1XNQL 4QY7A 4P71A 4NXNL 4QQBX 1Z9FA 2VY3A 5FJ8G 4JI0L 2EIFA 4POFA 1Q8KA 4JI7Q 4LUZA 2A19A 4YY3Q 1K0RA 2YV5A 2ZTEA 1HNXL 4A3EH 5C0XG 2R7ZG 3GTOH 4A3BG 4HIMA 4B3RQ 1K3RA 1D7QA 1QUQB 1PFSA 3GTKH 4LF9Q 4DR4L 3CC7A 1J6QA 1TWAH 1XMOQ 1VQKA 3OW2A 1NMGA 3M4QA 4JI5Q 1JJ2A 3G6EA 3CQZH 3B6YA 3S1NH 3S2HH 4JYAQ 3HKSA 3J80i 2BA1A 4R4IA 2D62A 2KENA 4DUZQ 4WJ3M 1KAWA 1EOVA 1HH2P 1SRUA 2C35B 3G4SA 1A8VA 4DV2Q 4IPDA 4LFCL 3HOWH 3HOVG 2PI2A 2B63G 5GAEC 1OXXK 1Y1VH 2LXJA 4GNXC 1KRTA 1TWGH 4JI8Q 3DM3A 4DK3C 4GKKL 2Z6KA 3CMAA 4A3DH 1WCMH 5IYBG 4JI2Q 3PF5A 3M85A 1YJNA 4DUZL 2AWOA 1PH1A 4KHPQ 2XTIA 2NZOA 2HHHQ 4HIOA 1YJ9A 4DV0Q 3PIOA 4IOCA 1N32L 1N36Q 2JA7G 3KF8B 4A76A 1VQHA 1KD1C 3K7UC 1FJGL 3I4NG 4B3RL 4FDBA 1N8RC 4HJ8A 1WCMG 2R7DA 4B3SQ 3T1HQ 4LF6L 4YCVA 4BXXG 4ALPA 4DAYB 4GLXA 3CXCA 1WFQA 2E2IH 3A5ZB 3D0FA 1XNQQ 1S3OA 4NB3A 1IZ6A 1Q1EA 4JBKA 3S17H 3KYHC 4DR7Q 2Q2TA 1VQJA 2JA9A 1VQFA 3E9IA 3I4NH 2BA0A 1N32Q 4MTNA 2AKWB 2KCTA 4APVA 1VQ6A 3F2DA 1CKMA 2NVYH 4DV3L 1VQ8A 4MNOA 4B3MQ 4DK6C 3S24A 4DPGA 4A3GH 5JJLA 2L15A 1PH5A 3OTOQ 4LF7L 4YWKA 4QJFA 3TRZA 4RG1A 4A3IG 1EQQA 1VS0A 2ASBA 1E3PA 1T9HA 2KHJA 3KF6B 2I5MX 5K36G 1CKOA 1JMCA 1EIFA 1WYDA 1WI5A 1NTGA 1KRSA 1IXRA 2WAQE 3HFZB 3I56A 2IHFA 4YWLA 4KLKA 4L5TA 2Q2UA 2D0OA 1VQLA 2ATWA 4A3KH 2D0PA 1E1OA 3GTQH 1QVCA 1HZBA 1FL0A 1VQEA 1X65A 2R6GA 3GDEA 4JBJA 5GAHC 1A0IA 1MIUA 4GOPB 4R1JA 4LF7Q 4Y52H 2R93G 1NJIC 4DV6Q 3L2PA 3JAMc 3CCLA 3CC4A 1HZCA 2JA5G 4A3CH 1NY4A 1O7IA 4IJHA 1IBKQ 3S1MH 1JJGA 2K75A 2AWNA 4A3LG 4P73A 3HOUG 3M3YH 4DR6Q 1SE8A 4LF5Q 2Z6KC 3RZOH 4JI3Q 2NN6G 1Y1WG 2UUBQ 1HNZQ 1VQCA 3J81i 1TXYA 4AYBE 1V43A 4UPAA 1UE7A 2YTVA 4DAMA 4C2MH 2H5XA 2LXKA 3AFQA 1RIPA 3W1GA 4LFAL 3E0EA 2IX0A 2NZHA 2OWOA 2QGQA 3CCMA 1Q86C 5IWAL 5AJ3L 2UUCL 4BY1G 3F1ZA 3PO3H 2ZM6L 3AQQA 1N33Q 1QUQA 1ASYA 2F52A 2E2JH 1G51A 4L5RC 1E1TA 3TEHB 5M3FG 3HOVH 2K14A 4LFAQ 1XJVA 1Q7YC 3HOXH 1VQGA 3CCJA 4BA1I 5IE8A 2B63H 1Y1VG 2WFWA 3H3VI 2UXBL 4X66L 1K8GA 3PUYA 2RHQB 5FJ8H 3L7ZC 2JA6G 4P75A 4QL5A 1YITA 3CCSA 1CUKA 3TQYA 4DV1L 1BVSA 4A3EG 1A62A 4GKKQ 1M1KC 2UUBL 1GO3E 1YHBA 1GM5A 2PQAA 1X6OA 4AH6A 4DR5Q 1HR0W 4BBRH 4A3MH 3CCQA 4JI5L 3FP9A 2JA7H 1IBKL 2JA6H 1YNXA 4L5SA 4DUYQ 2F4VQ 1QZGA 2GVBA 1I6HH 3VDYA 3RLOA 4AYBG 3J80c 2EXDA 2CCZA 4GLAC 1UE6A 3HOWG 1PA6A 4HJAA 3L0OA 4BBRG 3KDFA 2ZM6Q 3TS2A 5AJ3Q 2FXQA 3PF4A 1VQAA 4OONA 2HIXA 3S1QH 1Q1BA 1V1QA 5IYDG 2I5LX 4JI7L 2E8GA 4RMFA 3UDFA 2MFIA 3MEFA 1VQOA 5ELNA 3AFPA 3ICEA 4YWMA 3CP0A 4JBMA 1PH4A 2IY5B 2WB1G 3JAMi 3JC66 4QIWE 1UEBA 1UE5A 3I4OA 4B3ML 2MO1A 2ZJQA 5EAYA 2ID0A 4A3IH 3KF6A 1N9WA 2JQOA 1PYSB 4HIKA 3KLWA 4DV2L 2OQKA 1J5EL 4XIGS 3J7ZC 3UDXA 4LFBL 2NVTH 4DUYL 1TWFH 5E7NA 4DV7L 1QVGA 3HOZH 1VQDA 1FGUA 1XPOA 3GTGH 5C44H 1VQ5A 1EFWA 3I4MH 1GD7A 2CWPA 3GO5A 5C0XI 3M7NA 3NENA 2CKZB 4R4OA 4DV6L 1H95A 1XMQQ 5LMNL 2UUAQ 4IFDJ 3PUWA 4PG3A 3F2CA 4A3GG 3CC2A 3J81j 5C44G 4DV7Q 2VW9A 3GTMH 2KBNA 3K0XA 1VQIA 1BBUA 3S1RH 3NBHB 1EIYB 4LFCQ 2A8VA 3RLFA 5FLXc 3GTLH 1Y14B 4JI1L 3HKZE 5C4XH 4IO9A 2BH2A 1JJCB 3FKIG 5IT9c 2ZJPA 5LMNQ 1CSPA 1VQPA 4JI4L 3CPFA 4HJ5A 1VQ4A 4JYAL 2CFMA 1YIJA 2JEBI 1UWVA 1MJEA 2OCEA 4O0AA 2VQFL 3CD6A 4IPCA 2RHSB 3AYHB 1HZ9A 4OX9L 4YY3L 5IP7G 3H3VH 2JA5H 3Q8DA 4JI0Q 1Q46A 3ZJYC 2YTXA 1GVPA 3S2DH 4DNIA 5GQOA 2GN5A 5IWAQ 2UUCQ 4MZ9A 1N33L 4A3LH 3GTJH 5M3FH 3UE1A 3OTOL 1HNZL 2JJQA 4R4QA 5M5YH 4GS3A 2VQFQ 3HOXG 1LUZA 2YYZA 3I7FA 1OTCA 4DV0L 3T1YQ 1K73C 1OXVA 5IP9H 1HR0L 2Q2IA 3I55A 4JOIC 2HQLA 3WWVA 4BBSG 3H0GG 3NEMA 3KJOA 4YHHL 1MJCA 4R4CA 1PH6A 1Z47A 4OO1G 3U4VA 3D31A 3I2ZA 1EWIA 4JI8L 4QGUA 2QA4A 1AE3A 3ER0A 4BY1H 4DR5L 3S15H 3W1BA 1S40A 2ALYB 2F3IA 5GADC 5C0XJ 1PH3A 3PV0A 4PZ6A 1AE2A 3OYYA 3UE0A 4A3BH 2AHOB 4A93H 2F4VL 4DV4Q 1HNWQ 2UXBQ 1N36L 2PNHA 4DR2Q 3HOYH 4JBWA 3KJPA 2OTLA 1XMOL 4KHZA 3PUXA 4DR4Q 1SLJA 4LF4L 5ELOA 1HZAA 3M9BA 1X3GA 1X3FA 2K5VA 4OWWB 5IYDH 1PV4A 1R9TH 1U5KA 3MXNB 3ULPA 3PO2G 3AEVA 4NXNQ 1FVIA 3CPWA 1P16A 1YVCA 2I0QA 1VQBA 4XTCS 4PZ8A 3BJUA 3F8TA 4LNQA 2R92G 3CMEA 4A75A 2NVXH 1HNXQ 1IL2A 3FHWA 4YCWA 5GROA 1XPRA 2N49A 4GNXB 1L0WA 3PO2H 4UP8A 1IBMQ 2DUDA 4HJ7A 2UXCL 2IX1A 3T1YL 4DV5L 5JJKA 1SR3A 2PI2E 2R92H 5M3MH 1FJGQ 2WP8J 1IYJB 2B3GA 2AMCB 4TVAB 2K5NA 2JA8G 3U50C 3KOJA 4AQYQ 2WB1E 2K5HA 4B3SL 1P8LA 3LGJA 3T1HL 4LF6Q 4UP7A 1PH8A 1VCIA 4O2DA 4YCUA 3CF5A 5JEAG 1KXLA 1V9PA 1E24A 2UU9Q 3KDFB 1JT8A 1YJWA 1EUJA 1K83H 2N8NA 4P72A 3U4ZA 4LF4Q 5M3MG 4DV5Q 5BR8L 4GOPA 4C3JH 2KCMA 1IBLL 1JB7A 1GKHA 4POGA 3BU2A 4X62L 2CQOA 4OO1I 1XTDA 4KHPL 2GVAA 2VQEQ 2R93H 2HHHL 1C0AA 3K80C 1SFOH 1KC8C 4JI1Q 4BY7H 3CCUA 2ZTCA 3STBD 1X55A 5J3BA 1SMXA 4DR6L 2Q2HA 1J5EQ 3HOZG 2E5LL 4GKJL 4IPGA 1G6PA 4H02A 5IYCH 1U0LA 2ZTDA 3PGZA 5BR8Q 1EQRA 3DLLA 1IBLQ 1XNRL 1L2FA 4AIMA 1RL2A 1XMQL 2UUAL 4HIDA 5IP7H 2Y0SG 1XPUA 4X66Q 3BZKA 3PUVA 1TWHH 5FLMH 4AQYL 1BKBA 1CSQA 4A3JH 1YZ6A 4DR2L 3ULJA 1YHQA 4K0KL 5IYCG 5HGQA 1Q82C 3S14H 1E7ZA 3CCVA 3S16H 2UU9L 2VNUD 3EBEA 3FKIH 2MQHA 4X64L 5IP9G 3G71A 1YEZA 2VZAA 4UY8C 1YI2A 1PVOA 2YTYA 1NBWA 1SROA 3ULLA 1OXTA 1KIXA 1W3SA 1Q81C 4A3JG 4NPSA 3RNUA 1N34Q 2N78A 3RN5A 4K0KQ 3E9HA 4YHHQ 1K8AC 2VS1A 1B7YB 3G48A 1I94L 4GKJQ 1K9MC 2UXDL 2RCNA 4JCVE 4C3IH 1X9NA 4WJ4A 1YBYA 2OQ0A 4GN4B 1WJJA 2LSSA 3J81c 1L1OA 4DV1Q 2OTJA 2R7FA 1XNRQ 4JOIA 4A93G 2CWAA 4DKAC 2NN6I 1X54A 2VQEL 2HT1A 4DR7L 3K81C 3ERSX 4JC0A 3W5OA 3HOYG 5LMUL 4LUVA 3K8AA 4LWCA 5GAGC 1S72A 2MO0A 3A0JA 3SGIA 3NELA 2VUMH 3RLNA 1C9OA 1E22A 3RZDH 1PH7A 4BBSH 1WOCA 4X6AH 2Z0SA 3H0GH 4OXPA 1Q12A 2Y0SE 1I3QH 5M5WH 3RN2A 1VQ7A 1DGSA 1KQSA 3HKZG 4DR3Q 2ES2A 1EYGA 1PH2A 5LMUQ 1I5FA 1BBWA 1B8AA 2JK8A 2KHIA 4GN5A 4IJLA 4LFBQ 3A5UA 2VUMG 4GNXA 1CKNB 1NE3A 4BXXH 4R4TA 5H1SE 1G291 4B3TL 2WAQG 4NXML 4GLVB 2I5HA 1CKNA 2BH8A 3PSIA 5C4JH 4A3MG 4OWXB 1I94Q 2UXDQ 1D8LA 2B29A 2K4KA 2E5LQ 1VQNA 4DR3L 4KI0A 3CW2C 2RF4A 4J15A 4BA2I 4A3DG 3EN2A 5DLQE 3STBC 1KL9A 5HY6A 5IYBH 1PHJA 1HR0Q 1ASZA 2DGYA 2NVQH 4A4IA 5IY0A 3M4PA 4P74A 4EX5A 1QZHA 4JI6L 4OX9Q 3A74A 2QEXA 2VL6A 3CCEA 2ZJRA 3CAMA 1X3EA 1NMFA 4GN3B 4JV5L 4Y7NH 1M90C 3IRBA 3GD7A 1IBML 3H15A 4L5QA 3EIVA 4X64Q 2YU9H 1SN8A 2JE6I 3TREA 4UP9A 5JJIA 1PYBA 1HJPA 4BY7G 3M4OH 1KHIA 4DR1L 3PUZA 1N34L 4A3KG 4TQUS 1TWCH 1LYLA 4NXMQ 1L1OB 1I50H 1OXSC 4B3TQ 2JA8H 3UDIA 1VQ9A 1L1OC 4JI2L 4HJ9A 2IT1A 2V1CC 3U58A 1W2BA 1A63A 4LUOA 5C3EH 1OXUA 4X62Q 5FLMG 4X65L 4EQ5A 3TS0A 5JEAJ 4DR1Q 3HOUH 3J7A5 4IFDG 3F2BA 4LF9L 1PH9A 3KFUA 4ME3A 4A3FG 4JI6Q 2K52A 4PMWA 1LTLA 2K50A 3GTPH 4C3HH 5C3EG 2E2HH 1YHAA 1AH9A 2MNAA 4JV5Q 2PMZE 4IFDI 4JG2A 4X65Q 2JEAI 4LW1A 2HIVA 3PCOB 2A1AA 3K7AH 2EQSA 4DV4L 4IPHA 1VQMA 4LF8L 4IOAA 1HNWL 1UE1A 5M5XH 4A3FH 4PZ7A 5C4XG 3PIPA 2IHEA 3I4MG 3PO3G 4DV3Q 4A3CG 1JE5A 3UDGA 2N3SA 3BZCA 2XGTA 1LM0A 4JI4Q 1C7YA 4OWTB 1MKHA 2R7ZH 1X56A 1B70B 2PQAB 3CCRA 4LF5L 4JI3L 4GOPC 5LMNW
chains in the Genus database with same CATH superfamily
1TIID 1II3A 1Z9FA 3GTMB 2F3VA 3CRKC 2ZTEA 1EWHA 4A3EH 2R7ZG 4B3RQ 4A3BG 1D7QA 1I4PA 3GTKH 4DR4L 4CKBA 3CC7A 1VQKA 1PFMA 4K8JA 4JK1C 1KAAA 3CQZH 3B6YA 2EDGA 4JYAQ 2V4DA 3HKSA 2TMPA 4DUZQ 1KAWA 1SRUA 3HOWH 1ONLA 1A8VA 4LFCL 4DK0A 3KK7A 5KYLA 4GZYC 3BS1A 5EQ0A 2DY8A 2LXJA 2B2TA 4GKKL 3CMAA 4A3MB 1YJNA 1XYIA 2E76C 2XTIA 4EQPA 1ZXTA 4DV0Q 4DNTB 1N32L 3DWAA 5C6AA 1VQHA 1JOOA 4B3RL 4XQQA 4HJ8A 4B3SQ 1ILQA 1A3TA 4LF6L 1BDOA 1WFQA 2E2IH 3VR2A 1EY9A 1IZ6A 4V0BA 3S17H 1ICWA 2JXMB 3I91A 1Z6HA 5EBDA 3SDZA 2KCTA 4APVA 1VQ8A 1CKMA 4EVOA 2SNSA 1H9SA 3MXPA 4HAEA 2BDNA 1MHWC 3S24A 5JJLA 1PFNA 4K5VA 1IYUA 4LF7L 4YWKA 1SYFA 5CV4A 3TRZA 4RG1A 3M4YA 4A3IG 4V190 2RSNA 2I5MX 1WI5A 2R93B 1KRSA 2WAQE 3HFZB 2LS01 3I56A 4FXDA 1EYCA 2F0KA 4L5TA 5E3FA 2D0OA 2ATWA 2O5JC 1QVCA 2XSCA 4PV1C 5GAHC 2JYOA 4DAYA 1A0IA 1BR9A 1MIUA 2RBMA 3J80L 2I46A 1ZYRD 1HZCA 4A3CH 1O7IA 2EYOA 2O4XA 4IJHA 3S1MH 3BG3A 2F1MA 2A68D 3VR3A 2LKVA 3RZOH 5D14A 3HOVB 3J81i 1E0BA 1TXYA 2B2TC 3T4AC 2QEJC 2YTVA 3H3VC 4C2MH 1C48A 3AFQA 3HZXA 1Q8IA 2NZHA 5G3LD 2OWOA 5IWAL 3IKJA 3F1ZA 1QUQA 1ASYA 1DZ1A 2E2JH 4L5RC 2FHTA 3H6MA 3HRZC 2PNRC 4ODGA 4A3DB 2K14A 2PW7A 4BA1I 5IE8A 3Q6SA 2PZUA 5EGTA 3NSWA 1YITA 3CCSA 3TQYA 1CZWA 4A3EG 1A62A 1XTCD 2PQAA 4NDXA 3CCQA 1X3QA 1XWEA 2F4VQ 5COYA 1FGBD 3HOWG 2CCZA 2QKIC 1UE6A 4ZLTF 3C46A 3S17B 4BBRG 1JC7A 3C2PA 2FXQA 1X32A 2F0HA 4XXEA 5IYDG 3UDFA 2MFIA 2VB2X 3AFPA 4JBMA 2D5DA 2WB1G 1PRTD 3K7AB 3ERQA 3JC66 1O78A 2XNAC 1UE5A 3UI2A 2MO1A 4OIJA 5CORA 2WIIB 1O7YA 1N9WA 4RHSA 1HA6A 3KLWA 3GQBA 1TY2A 1LT6D 2NVXB 1QVGA 2WV6D 3HEJA 5C44H 1GD7A 5K5PA 5C0XI 2XWBB 3NENA 4KHVA 4DV6L 2F03A 1MD2D 1GUGA 1WCMB 4DFAA 2EVBA 1PXUA 2XRSD 4LFCQ 3NBHB 2A8VA 3RLFA 2EY6A 2FMCA 2EXZA 1GOZA 1JJCB 3FKIG 2B2UA 2BOSA 2CFMA 4DAPA 4DXFA 3OSOA 1CFMA 3BDOA 1NCVA 1HZ9A 3VR5A 3H3VH 3ZJYC 2PPBC 5L37A 1LT4D 5IWAQ 3S2DH 5IGGA 4XDXA 4NMZA 2VXWA 4KKUA 2E2HB 2JJQA 1GUSA 4GS3A 3HOXG 5IT9L 4ZUJA 3H0GG 4KKTA 3KJOA 1RJTA 1JWUD 4K5XA 3U4VA 4K2LA 3LX0A 1S40A 1SJED 5C0XJ 3H0GB 3A7LA 4A93H 1VMPA 4K5WA 3JAME 2F3WA 4JBWA 1I6HB 5ELEA 1XMOL 3D4WA 1CT1D 1SYGA 1SYDA 3M9BA 4Y7NB 3MXNB 3ULPA 3PO2G 2F0QA 3R93A 4NXNQ 5DAUA 4FF1A 2R92G 1B4OA 4A75A 3QR8A 4UDUC 1IL2A 1S4ZA 1L0WA 1Z7TA 4UP8A 4FP5D 3BDLA 1WTPA 2UXCL 4QMGA 3R2IA 4HSVA 2K03A 2IX1A 4CBVA 1LACA 1AEXA 5JJKA 1SR3A 4U68A 1BO0A 1U9RA 4DK1A 1H9MA 2B3GA 2AMCB 1ET6A 2K5NA 2KUMA 1ENAA 4IUQA 3U50C 2K5HA 4B3SL 3LGJA 1HQMC 3SK5A 3CF5A 4O2DA 3OHXC 1YJWA 3K57A 5M3MG 4POGA 3K5LA 4FYDA 3MXNA 3OIPA 4ABNA 1I4QA 2HHHL 1BCPF 2LY7A 1V1PB 1F2MA 3STBD 2ZT9C 2Q2HA 2R3ZA 2E5LL 1V1PA 1G6PA 3NE5B 4H44C 5IYCH 1U0LA 3PGZA 4C3IB 3DLLA 2WB1B 5K36H 2NBFA 4E6IA 3AMUA 1F2YA 4ZRZA 2UUAL 1HRJA 3NP8A 2IL8A 1GUWA 2HDLA 1XPUA 3BZKA 4KV6A 3I4NB 1CSQA 2K5WA 3ULJA 5J1ZA 3S14H 3CCVA 3S16H 2ZXRA 2VNUD 3EBEA 1ML0D 3FKIH 4X64L 2CHBD 4UY8C 1YI2A 4NPSA 2MHVA 4K0KQ 2J4XA 1K8AC 1K8OA 2E74C 1WD0A 4JCVE 2K5QA 4GN4B 2EJFC 1BXTA 3J81c 4DV1Q 1IKMA 3FPPA 2K6AA 1UUPA 5IGCA 1F9RA 3W5OA 3HOYG 5C4HA 3K8AA 4LWCA 3WOEA 5GAGC 4PQXA 1C9OA 1JICA 4N9TA 1E22A 5ELCA 4X6AH 2Z0SA 3NHHA 3H0GH 4XT1B 4OXPA 1G91A 4DN4M 3C1EA 3S2HB 4F8MA 2ES2A 1SNQA 1BCPC 1SE2A 1V1OA 4IJLA 4LFBQ 2VUMG 2RVLA 4BXXH 4R4TA 5H1SE 1H9KA 3KBXA 4B3TL 4GLVB 3MFYA 3OWFA 5C4JH 4OWXB 1Y1WB 4FO2A 4ZKCB 4KI0A 1DCZA 5C3XA 2M00A 4BA2I 5HY6A 5A2QE 3N52A 1PHJA 2NVQH 2DGYA 4CJ1B 1PZJD 3VYSA 4A4IA 5IY0A 2DJGC 2WKDA 2QEXA 1B3QA 3NWTA 2ZJRA 1R9TB 1NMFA 3IL8A 4GN3B 5I6YA 5FOBB 2KCCA 2EY1A 2PQEA 2JP1A 2K33A 1A2UA 2DY7A 5JJIA 4UP9A 3H91A 1HJPA 4DR1L 1LTGD 3PUZA 3C3LA 2Y0SB 1L1OB 1LV9A 2NWGA 3K5MA 2DJFC 3S1NB 5J22A 1A63A 4HCEA 3I4MB 1OXUA 3W2DA 3Q24A 5JEAJ 3DWQA 4PMCA 3J7A5 4IFDG 5FKAC 1PH9A 4RFBA 4A3FG 2K50A 2G9DA 5IGEA 1YHAA 3DEPA 4JV5Q 3OMCA 2HIVA 4DV4L 2D2CC 1HQRD 2RDHA 4F7XA 4DV3Q 5EPJA 3NTHA 1UAPA 1B9NA 1RTOA 2N3SA 1LM0A 3BZCA 4JI4Q 1D6EC 2PQAB 3J7YW 4GOPC 1FNWA 5LMNW 1JT8A 1Y1WH 1IW7C 5D3DA 4QY7A 3HKZB 4P71A 4NXNL 5FJ8G 1UEAB 2A19A 1S5ED 1K0RA 4UAIA 4G7HC 1O7LA 3EQLC 1PFSA 4LF9Q 2F0FA 1RD9D 3X3NA 1J6QA 1TWAH 4DXGA 1XMOQ 3OW2A 3M4QA 5KIXA 3S1NH 3G6EA 1JOQA 1WTRA 1G2TA 4F88A 4R4IA 2KENA 1JWMD 1STHA 1HH2P 2OF1A 3MFGA 3RMHA 4DV2Q 1B53A 2PI2A 1I4HA 1SXTA 2F0WA 2KECA 5GAEC 1OXXK 1Y1VH 5IT9E 4DAVA 4OEMB 1KRTA 1TWGH 2L4NA 3U9OA 4GNXC 2YU9B 2B8FA 1Q3LA 3QO2A 4Q5VA 5IYBG 2AWOA 3MA2B 1PH1A 2N55A 3N6RA 2NZOA 3MC0B 2HHHQ 1YJ9A 2ENBA 2EYHA 4IOCA 4BBSB 2JA7G 4A76A 1N8RC 1HFGA 1SMYC 1WCMG 2A6HD 5CV8A 3ND9A 1D1IA 3SHLA 3T1HQ 4BXXG 4ALPA 4DAYB 1K0SA 3A5ZB 3D0FA 1STGA 2BE5D 1S3OA 4J8QA 4KY6A 4NB3A 3E9IA 3I4NH 1N32Q 3C1FA 3P1HA 1TT2A 3Q0AA 2NVYH 3F2DA 1XXGA 1JORA 1GJXA 1HUMA 4MNOA 5EBCA 3RUZA 4DPGA 4A3GH 2K5DA 1PH5A 1EEID 1KLGD 4KN4C 1VS0A 1E3PA 2KHJA 3KF6B 5K36G 2EOTA 3BYTB 3VA5A 3DXJC 3V05A 1IXRA 3HOXB 4YWLA 2D9UA 5CC4A 1E1OA 3GTQH 3ITPA 1FL0A 1X65A 3I4MG 4BBRB 4LF7Q 4GOPB 1DD2A 2SOBA 2R93G 2AUJD 1D5MC 2A73B 4Z9CB 2JA5G 3EVQA 1G6ZA 3MTSA 2K75A 5EPKA 1RHPA 2A5HA 3M3YH 5C4ZA 2Z8LA 2Z6KC 1TVXA 3BDCA 4AYBE 4OHJA 1EYAA 1V43A 3QWNA 1R4QB 5CV5A 1SNPA 1RIPA 4LFAL 2IX0A 1CK1A 2UUCL 5AJ3L 4C2MB 2F0NA 4BY1G 2ZM6L 4L63B 4M1UB 5NUCA 1ESFA 3H94A 3K0YA 1VQGA 2WFWA 1OO9B 1S5CD 5BN4A 5FJ8H 3L7ZC 4QL5A 2KEDA 1YHBA 1GM5A 3S15B 1X6OA 5AFWA 2QCPX 4DR5Q 4IN3A 2JA6H 3GTOB 4ZKBB 1WTQA 1EFID 4OELB 4N8X1 5JPMC 1LT3D 2EXDA 4GLAC 1EWCA 3T56B 2B2VC 4TKOB 4BWGB 1T5EA 3PF4A 4J1MA 1VQAA 4XQNA 3AU7A 1Q1BA 2MP1A 3I90A 2C5CA 1B1ZA 1V1QA 2OEOA 3A8JE 5CV7A 4JI7L 4IQZA 4P2CB 5ELNA 2L5TA 3ICEA 3K58A 2ICEC 2IY5B 2HCCA 1C8CA 4KD4A 1YNND 2PYKA 2ID0A 4A3IH 1PYSB 3IAYA 1SNOA 4R8IA 1BF4A 4HIKA 3WDNA 2OQKA 3DEOA 3UDXA 2KHSA 5E7NA 4AYBB 1VQDA 1XPOA 5CBAE 5CGKA 3GTGH 1VQ5A 4ZK9B 1FNVA 3VR4A 2CKZB 4Q0FA 2RKSA 1W6KA 5LMNL 4PG3A 3F2CA 1LABA 3CC2A 3ONAB 4A3GG 3L9AX 1D2BA 3J80E 2VW9A 3A7AB 1EZ6A 1BBUA 1VQIA 5FLXc 3GTLH 4A93B 1HPCA 1Y14B 3HKZE 4JI1L 4IO9A 5IT9c 5LMNQ 1CSPA 1H9SB 3CPFA 4FVMA 2F0TA 2M9VA 4HJ5A 2OCEA 3EJIA 2RHSB 5KGUA 5IP7G 2JA5H 4JI0Q 4LMQD 1QOHA 2YTXA 1WTXA 5GQOA 2GN5A 4HCSA 3UE1A 4C56C 5IOCA 3BVGA 4R4QA 1LUZA 4DV0L 4XYQA 1NUCA 5IP9H 1HR0L 2R61A 5EJWA 1EY0A 2K28A 5I9OA 4JOIC 4BBSG 3NEMA 4YHHL 1MJCA 3NPPA 4JI8L 1SBBB 2QA4A 1AE3A 1AW7A 1SAPA 2K04A 3ZYYX 5FLXL 4BY1H 3FVQA 3W1BA 3NXWA 4XT3B 1PMRA 1U4MA 3PV0A 2B2VA 5FLXE 1HNWQ 3SK8A 2PNHA 4DR2Q 2OTLA 5JAVA 4UHVA 2ZXOA 1TKWB 4DR4Q 5E1FA 1HZAA 1X3GA 2K5VA 2B8GA 4DNRB 5IYDH 1R9TH 1U5KA 1PTOC 4FNFA 1JCKB 4RCOA 3LNNA 2B2YC 4X3UA 1VQBA 4C1NI 2XVSA 4PZ8A 3CMEA 2NVQB 1SNCA 2NVXH 1EU4A 1HNXQ 4IALA 4RGMA 3FHWA 1PYWD 4GNXB 1QWYA 4N8FA 1IBMQ 4O42A 5A2QL 5C3WA 1PFBA 1IYJB 2F0OA 4TVAB 4AQYQ 5EKKA 1VCIA 3U9SA 1IHZA 1KXLA 1V9PA 3KDFB 5ISRA 2A6ED 1EUJA 4LF4Q 3S1QB 3U4ZA 4DV5Q 5BR8L 1IBLL 4C3JH 1Y8OB 2KCMA 1JB7A 1GKHA 3EA6A 5ELDA 4X62L 2A74C 3OOCA 4JW0A 3NUCA 4KHPL 2IWHA 2R93H 1DOMA 3K80C 4KMUC 4BY7H 3CCUA 2ZTCA 1X55A 3QG1A 4GKJL 3GV3A 3NBIA 3VYUA 2Q8IB 4H02A 1PRTC 2SNMA 4DGZA 1RL2A 4IUTA 1XMQL 4HIDA 3OWEB 2Y0SG 3SK6A 4X66Q 3PUVA 2XWJB 4QB4A 5FLMH 5EPLA 4A3JH 1YZ6A 1KTKA 4K0KL 1TU2B 1PRTB 2MQHA 1RF2D 1NBWA 1OXTA 4HSPA 1Q81C 1N34Q 3S1MB 3RN5A 3E9HA 1B7YB 2B2WC 4C3IH 2OQ0A 3LWUA 3RD4A 4CHTB 1K8MA 1WJJA 2LSSA 1L1OA 2XRQD 4ZYSA 4A93G 2CWAA 2VQEL 1U4PA 1X54A 1TS2A 4DR7L 1HUNA 3ERSX 4JC0A 3BZDB 3SGIA 3NELA 1CA6A 1PH7A 2FMMA 1WOCA 4BBSH 1Y8NB 1DGSA 1TS3A 3T53B 1EYDA 1I5FA 1BBWA 4HMIA 3A5UA 4GNXA 1QB5D 1NE3A 3VR6A 2WAQG 1I4GA 1FYCA 2UXDQ 2BH8A 4C1NK 1CI3M 1D8LA 2B29A 2K4KA 4DR3L 4MHEA 5M3FB 3CW2C 2RF4A 1K83B 4A3DG 3EN2A 5DLQE 3STBC 3DMUA 3I4LA 4U673 3M4PA 4EX5A 1QZHA 3BVZA 4OX9Q 2F0PA 3CAMA 5E4XA 2AQ2B 4JV5L 4RGTA 4L5QA 4CJ2C 3TREA 5A35A 3GTLB 1B2TA 3M7GA 1KHIA 4A3KG 4NXMQ 4RCNA 3UDIA 2MGSA 5J39A 1L1OC 3JAML 1VQ9A 3MVVA 4JI2L 1I4RA 4B9XA 1VF7A 2IT1A 1PZKD 1V8QA 4X62Q 1H9RA 4X65L 3TS0A 4DR1Q 3HOUH 1SDFA 2NN6H 3F2BA 3KFUA 4ME3A 4JI6Q 1PTOD 5FK9C 2K52A 4PMWA 4A3BB 1IKLA 3GTPH 5C3EG 1EY8A 4KK7A 1NNXA 4A3IB 4IFDI 5CV9A 1AZPA 2F0LA 3S2DB 3DUZA 2JSOA 1CM9A 3PCOB 4HEDA 2EQSA 4PMBA 4IPHA 4IOAA 2WINB 3SK4A 1CQVA 5C4XG 1Y8PB 1LTRD 3NBHA 2IHEA 3PO3G 4R8NA 4I7ZC 1G8ZD 2XN9C 4CDDC 1DOKA 2R7ZH 5JOBA 3A54A 3GTPB 2AQ1B 4LF8Q 3RR5A 2EZVA 1QVFA 1XNQL 4TRDA 4QQBX 3KF8A 3NQTA 3J81L 1GUNA 1W6JA 2EIFA 3D4DA 1Q8KA 4JI7Q 4YY3Q 1HNXL 1VF5C 5I4DA 5C0XG 3GTOH 4HIMA 1K3RA 1L0XB 1QUQB 1EU3A 4OL7A 4L6TB 4HMJA 4OIKA 1HXYD 4CGYB 1JJ2A 2Q8RE 3J80i 2BA1A 1TWCB 3G4SA 1EOVA 1J5EQ 1MSHA 3HOVG 2B63G 1PDQA 4WJWA 3W3AA 2OT2A 3V2TA 4JI2Q 3G6JB 3M85A 4DUZL 2X6LA 5IGBA 1SMYD 3LWEA 1FJGL 3O13A 4FDBA 2KCNA 5T1IA 2NTSA 1LTAD 2G5DA 4RGOS 5LL6S 2LMCB 1XNQQ 4HN7A 1Q1EA 3KYHC 2JA9A 1VQFA 2BA0A 4MTNA 3MAQA 1VQ6A 2KEEA 3GP7A 1SYCA 2QDBA 3VYRA 4B3MQ 3MEHA 2L15A 3OTOQ 3PIO3 3FKIB 4QJFA 4K2KA 4ULLA 2ASBA 1T9HA 3S14B 1CKOA 2L11A 1JMCA 1WYDA 4K6LA 5JVH3 2O5IC 2B39A 2CW0C 2Q2UA 4A3KH 3TP7A 4IURA 4JBJA 1HZBA 2R6GA 1VQEA 3FMCA 3T16A 4Y52H 2ZXPA 3JAMc 4QIWB 1B3AA 5C5LA 1IBKQ 3QIAA 4CDCC 1JJGA 4A3LG 4P73A 3HOUG 4DR6Q 1SE8A 4JI3Q 2NN6G 1RCVD 1Y1WG 2UUBQ 1EL0A 4QF4A 1HNZQ 2A69D 2QF7A 2PZWA 4MN3A 1A3VA 4PNYA 4UPAA 1UE7A 1QCBD 2OXPA 1SE4A 1O7ZA 4IUPA 4DAMA 2H5XA 2LXKA 1HA5A 1K3BC 3DM1A 3E0EA 1JWSD 1CQFA 4QCLA 3CCMA 1HTLD 1EEFD 1JR0D 2HCIA 3PO3H 5M3MB 2EJMA 5M3FG 3TEHB 3TZDA 2QDLA 1XJVA 3MZ5A 1Y1VG 1LLRD 1JQYD 4X66L 5IGFA 3PUYA 2RHQB 4P75A 2Z9HA 3NTIA 2Z6BA 4C3JB 4QUFA 1BVSA 1M1KC 2UUBL 1GO3E 1NR2A 4BBRH 2BCOA 4CDEC 4JI5L 1PLFA 3FP9A 2JA7H 1IBKL 5FO9B 1YNXA 4DUYQ 1QZGA 1UNSA 2GVBA 1I6HH 4CKCA 3TP6A 1PA6A 3V96A 3L0OA 4HJAA 1EOTA 3TS2A 1HCZA 1BCPD 3EFXD 3L3OC 4ZQ3A 4OONA 3NWSA 3S1QH 2CW0D 2I5LX 2E8GA 2X6GA 4RMFA 5M5XB 5KRUA 1PH4A 4IUNA 2F0EA 4KJNA 4QIWE 1GHKA 2L0CA 4B3ML 2EYMA 2ZJQA 5EAYA 3KF6A 2JQOA 3P20A 1A15A 1QG7A 1J5EL 4LFBL 5CYUA 4G7OC 2RDGA 3HOWB 2JN4A 5DM63 1EFWA 3I4MH 2CWPA 3OPOA 4ID6A 4RHRA 4ZAIA 1LTBD 4R4OA 3HG9A 1XMQQ 4IFDJ 3GTGB 3CHBD 1WTHA 3J81j 4ZCKA 5C44G 3GTMH 3MXUA 2QILA 4R9WA 3S1RH 1EIYB 5C4XH 3J7AV 3T51B 2K1BA 2P5ZX 2RCFA 3R8BA 4G4KA 4JYAL 2JEBI 1ESRA 1UWVA 1MJEA 1STYA 2ICIA 4O0AA 2A68C 2JA5B 4LJZC 1WVLA 3AYHB 3HP3A 2AQ3B 1EZ8A 5C44B 4YY3L 3Q8DA 1Q46A 1ZYRC 1KNAA 4DNIA 5IIFA 4X3SA 1N33L 4A3LH 5C0XH 3GTJH 3MHBA 4RKBA 2VQFQ 2YYZA 3I7FA 1LTSD 1OXVA 2Q2IA 1QILA 1M8AA 3I55A 2NZ1D 3HOUB 3WWVA 2HQLA 2PMZB 4EQOA 1PH6A 4OO1G 2SEBD 3I2ZA 1EWIA 3I73A 4QGUA 3ER0A 2DN8A 4N9PA 1EY5A 5CMDA 3S15H 2F3IA 1PH3A 4PZ6A 1AE2A 3OYYA 5KEEA 4B9WA 4LK1C 2F4VL 3CKIB 1YNNC 1N36L 3KJPA 4KHZA 3PUXA 1PTOH 1DYQA 4FF2A 2EY5A 5ELOA 2F0JA 2JA7B 4OWWB 1PV4A 2L1BA 1IYVA 2EE1A 3AEVA 1FVIA 1PTOF 1YVCA 3RZDB 4XTCS 5GROA 4YCWA 4DA2A 1XPRA 1K28A 2N49A 2F4IA 3PO2H 2DUDA 3E6ZX 4HJ7A 1Y69U 3T1YL 5CV6A 2E2JB 2R92H 5M3MH 3PO3B 3URYA 2WP8J 3A55A 1WTWA 3K59A 3KOJA 3QB3A 1KLUD 5G3LF 1LO5D 3H3VI 3T1HL 1QNUA 4UP7A 2HDMA 3D8GA 5JJZA 2N8NA 1DOLA 1RDPD 4OO1I 4K14A 4WRDA 4ILWA 4O1NA 2VQEQ 3RZOB 1C0AA 2LFNA 4FXGC 1KC8C 4JI1Q 3IFDA 1F9SA 1SMXA 1BBXC 1ILPA 4DR6L 2JA6B 1SE3A 4IPGA 4KY5A 1B9MA 4A3GB 1CZGA 1CHPD 3KLRA 1WTOA 1L2FA 4M8AA 4AIMA 1NAPA 5IP7H 3I8ZA 4A3KB 1VDZA 2VUMB 3VYTA 1DJRD 1TWHH 4KTAA 1F2ZA 5IYCG 2CH4W 5HGQA 1S5BD 5DNFA 1LTID 2WACA 5IP9G 3G71A 2VZAA 1PVOA 2YTYA 4WORA 3M3YB 3ULLA 2J7ZA 1KIXA 1W3SA 2E75C 2B2UC 3FRPB 1MSGA 1HTPA 2N78A 5BN3A 2HD3A 2VS1A 3K5NA 3WOFA 1RKNA 1I94L 4GKJQ 1K9MC 1X9NA 2R92B 1SSOA 2OTJA 1XNRQ 2G9HD 4JOIA 5I6WA 4KY7A 2NN6I 2WAQB 2HT1A 3K81C 3PO2B 4BY7B 5LMUL 1S72A 2PW5A 5T1GA 2MO0A 1IL8A 1ENCA 2VUMH 3RZDH 4XQJA 4JVZA 2E2DC 1I3QH 5M5WH 3RN2A 3TMEA 3HKZG 1EYGA 2SDFA 1PH2A 1H9JA 5LMUQ 2Q8TA 2KHIA 3Q22A 5F2DA 1ZEQX 1MBYA 1G291 4KD3A 4NXML 2I5HA 1CKNA 1I94Q 4A3MG 2I07B 3G7LA 3QOJA 1VQNA 1E2WA 4XYOA 1A2TA 2FFKB 4J15A 2XIWA 1QE6A 1HR0Q 4YIJA 3A8KE 5HGTA 3TP5A 2EYFA 1FR3A 4P74A 4JI6L 3HGBA 3MXGA 2VL6A 3CCEA 1X3EA 4HR7B 1M90C 3IRBA 2H4OA 3GD7A 1IBML 3H15A 1TWGB 3EIVA 4X64Q 2YU9H 2JE6I 2HQEA 3HOYB 1PYBA 3FEWX 4BY7G 3OIQA 4TQUS 2EY2A 3CU7A 1OXSC 1TR5A 4HJ9A 2V1CC 3KBGA 3A56A 4G57A 1PTOB 1QNKA 5FLMG 4HTHA 2MUYA 5C4XB 2Z4HA 5FO8B 3SVMA 1LTLA 4C3HH 5M5YB 4B08A 4K8IA 1AH9A 2MNAA 2PMZE 3OW7A 4X65Q 5I2XA 2JEAI 4LW1A 3SR1A 2A1AA 4IFDH 3K7AH 5KNCA 4LF8L 1HNWL 5HURA 1UE1A 5M5XH 4A3FH 4A3CG 1JE5A 2XGTA 1C7YA 3PMFA 1EQVA 1BQQT 1X56A 3CCRA 2F0IA 4JI3L 4C3HB 2DNEA 2UXCQ 2VB3X 1I6VC 2VY3A 4MIUA 4FF4A 4JI0L 4POFA 4LUZA 3SXHA 2YV5A 4A3FB 1NMGA 4JI5Q 4EQNA 5KNDA 3S2HH 4G7ZC 1I3QB 4I65A 5M5WB 1F9QA 1STEA 2D62A 2IW3A 4WJ3M 2C35B 3BYYB 1EY4A 4IPDA 1TS4A 4OGQC 2B2YA 4JI8Q 3DM3A 4DK3C 1A6XA 2Z6KA 4A3DH 1JB3A 1WCMH 3PF5A 3S9WA 2F0MA 4KHPQ 1BNZA 2RSOA 3D4RA 3NQIA 2L55A 4HIOA 1MI2A 3PIOA 1N36Q 3KF8B 1L0YB 1KD1C 3K7UC 3I4NG 3H09A 4L8JA 2R7DA 4YCVA 4GLXA 3CXCA 3D6WA 5ELFA 3TP8A 2IX3A 2K01A 4JBKA 4DR7Q 2Q2TA 1VQJA 2AKWB 1RODA 4RGNA 4DV3L 4ZUIA 4DK6C 3NK9A 1BOSA 5TSSA 4RA8A 2EYJA 1EQQA 4DF7A 4J6HA 5C4JB 2EYPA 3EROA 5FO7B 1EIFA 4CJ0B 1NTGA 2IHFA 4KLKA 1VQLA 1SNMA 2D0PA 3P7JA 1TS5A 3TDQA 3GDEA 1DM0B 5C5MA 1AN8A 4H0LC 4R1JA 1NJIC 3SEBA 4DV6Q 3L2PA 5M9OA 3CCLA 3CC4A 1NY4A 2PO4A 4F87A 2AWNA 3TZUA 4LF5Q 1VQCA 1T5XD 4KKSA 3K6OA 2C9OA 3K5OA 1A3UA 4RKLA 3W1GA 2QGQA 1Q86C 2N88A 3D6CA 1M4VA 3AQQA 1N33Q 2F52A 1G51A 3I72A 1E1TA 3HOVH 3T13A 1YNJD 2F0SA 4LFAQ 1Q7YC 3CRLC 3HOXH 2B63H 3CCJA 3S16B 3F2UA 3R3OA 2UXBL 1RTNA 1K8GA 1TWHB 4RWSC 2JA6G 1CUKA 4DV1L 4I7AA 1X3PA 1TY0A 4GKKQ 3CQZB 4AH6A 1HR0W 4A3MH 4QUCA 4L5SA 2CQAA 2IJ0A 3VDYA 3RLOA 4AYBG 3J80c 1FNUA 2A69C 1Q90A 2ZM6Q 3KDFA 5AJ3Q 2DNCA 2J0TD 2HIXA 2R7ZB 2EJGC 2FJ2A 5LL6X 1LT5D 1VQOA 3MEFA 3I70A 4YWMA 3CP0A 3JAMi 1UEBA 3FPUB 1ZKOA 1ENFA 1F2LA 2NUCA 3I4OA 1AP0A 2FINB 4LAAA 4DV2L 1Y1VB 4XIGS 3J7ZC 2F0VA 2NVTH 4DUYL 1TWFH 4DV7L 2PCFB 3HOZH 1FGUA 4K6DA 2KA7A 2X69A 5C3EB 3GO5A 3M7NA 5CBEE 3PQIA 1H95A 1TWAB 2UUAQ 2GA4B 4C3HG 3PUWA 1I50B 2JA8B 4NKLA 1ICFB 5KNBA 1QJOA 4DV7Q 1SYEA 2KBNA 3K0XA 3BVMA 1GUOA 2QW7A 1EY7A 2BE5C 2BH2A 5IODA 1CA5A 1VQPA 2ZJPA 2MJ8A 4JI4L 2TSSA 3ND8A 1JOKA 2A6HC 1VQ4A 3TN2A 4ME5A 1YIJA 4IUVA 2RDFA 2VQFL 3CD6A 1EQTA 4IPCA 5ELBA 2NB0A 1STNA 4OX9L 3NTKA 3P75A 1GVPA 1TWFB 2MPMA 2UUCQ 2HUGA 4MZ9A 5M3FH 1KDBA 3OTOL 1HNZL 5M5YH 3TBIB 1SYBA 3T1YQ 1K73C 3GTJB 2K7VA 2F0UA 4CKEA 1KNEA 4R4CA 1U4RA 1GHJA 1Z47A 3D31A 2K05A 4DR5L 2ALYB 2B2WA 5GADC 2KJXA 1GXDC 5JPNC 1E2VA 3UE0A 4A3BH 2AHOB 4DV4Q 1SEBD 2CH4A 5DM73 2UXBQ 3S1RB 1J8IA 3HOYH 4FF3A 1SLJA 5D3IB 4LF4L 1X3FA 1KABA 3SE0A 4X3KA 5IGDA 2K32A 3CPWA 1P16A 2CVRA 2L12A 2I0QA 1EY6A 3BJUA 2H1EA 3F8TA 5JVG3 4LNQA 3FDTA 3J7AF 3M4OB 1VMCA 2B63B 5EKLA 1J9OA 5CR3A 4DV5L 2O2LD 2PI2E 3R2TA 3J81E 5DEHA 1FJGQ 2JA8G 3KUPA 2WB1E 1P8LA 4LF6Q 1PH8A 5D65A 4YCUA 5JEAG 4TSSA 1E24A 2UU9Q 2AUKA 3HS0C 1K83H 4P72A 3VA7A 4S3SA 1DONA 4GOPA 4RH6A 3E3XA 3BU2A 4JPBW 2CQOA 5BN5A 1XTDA 2F0GA 2PZTA 1B50A 2GVAA 4DU9A 1SFOH 1S5FD 4CDFC 5J3BA 1MGSA 1XX8A 3HOZG 3E0JA 4C3JG 1STBA 3MWYW 3TSSA 2ZTDA 1XNRL 5BR8Q 1IBLQ 1EQRA 4FXKC 1BCPB 5E4WC 3X3MA 3GTQB 3IFTA 1LTTD 5I9PA 4NP5A 1PZID 4AQYL 1BKBA 1FD7D 2KVMA 4DR2L 1YHQA 1SFOB 3Q23A 3I3CA 1Q82C 2KQ3A 1E7ZA 2Z1CA 1AFPA 2F0DA 2UU9L 1NSNS 1U4LA 1YEZA 4C3IG 3OMGA 1HHVA 1SROA 3D3RA 4A3JG 1D5ZC 3RNUA 2NVYB 4OO1H 4WFN3 4YHHQ 3G48A 3GV6A 1WTVA 2UXDL 4WJ4A 2RCNA 1DXMA 1YBYA 1SNDA 3A8IE 2R7FA 1D5XC 4KN7C 4DKAC 2NTTA 4LUVA 4A3JB 3QJYA 2A6EC 3A0JA 1F77A 3RLNA 1PRTF 1G2SA 1Q12A 2Y0SE 1VQ7A 1C4QA 2EPBA 1KQSA 1CTMA 4DR3Q 1E2ZA 4MTKA 1WD1A 4GN5A 2JK8A 1B8AA 3GTKB 4KJOA 2EYLA 4A3EB 3KLSX 1B44D 1CKNB 1CHQD 4IUUA 1F9PA 1S5DD 3PSIA 5KYIA 1O80A 2WKCA 2E5LQ 4RAUC 2E2IB 1EIHA 4BS9A 1OTCA 5IYBH 1KL9A 1ASZA 1KDCA 3A74A 4Y7NH 1ET9A 2BDOA 3AB9A 1SN8A 4H13C 2RA4A 1JE4A 3M4OH 1IW7D 1N34L 3DWPA 1TWCH 1LYLA 3E5SA 1YNJC 1I50H 2JA8H 4B3TQ 2M2LA 3DHQA 1STAA 4IZ8A 3U58A 5JEAH 1W2BA 1HFNA 4LUOA 4EGVA 5C3EH 4X3TA 1I4XA 2IPKD 4EQ5A 5I2YA 3KLSA 5EKIA 2NYZD 3QOLA 2NVTB 4LF9L 1EIGA 1R4PB 2RQXA 2E2HH 1BUVT 5LHY1 3PIP3 4BY1B 4JG2A 1KDAA 1TQOA 1VQMA 4NW2A 1AZQA 1NR4A 4PZ7A 3PIPA 1GUTA 2L9HA 3HOZB 3UDGA 1D1KA 2Z4IA 4H7BA 4OWTB 2KOLA 1MKHA 1B70B 4LF5L 1SJHD
chains in the Genus database with same CATH topology
4LF8Q 3RR5A 1Y1WH 1QVFA 2UXCQ 1XNQL 4QY7A 4P71A 4NXNL 4QQBX 1Z9FA 2VY3A 5FJ8G 4JI0L 2EIFA 4POFA 1Q8KA 4JI7Q 4LUZA 2A19A 4YY3Q 1K0RA 2YV5A 2ZTEA 1HNXL 4A3EH 5C0XG 2R7ZG 3GTOH 4A3BG 4HIMA 4B3RQ 1K3RA 1D7QA 1QUQB 1PFSA 3GTKH 4LF9Q 4DR4L 3CC7A 1J6QA 1TWAH 1XMOQ 1VQKA 3OW2A 1NMGA 3M4QA 4JI5Q 1JJ2A 3G6EA 3CQZH 3B6YA 3S1NH 3S2HH 4JYAQ 3HKSA 3J80i 2BA1A 4R4IA 2D62A 2KENA 4DUZQ 4WJ3M 1KAWA 1EOVA 1HH2P 1SRUA 2C35B 3G4SA 1A8VA 4DV2Q 4IPDA 4LFCL 3HOWH 3HOVG 2PI2A 2B63G 5GAEC 1OXXK 1Y1VH 2LXJA 4GNXC 1KRTA 1TWGH 4JI8Q 3DM3A 4DK3C 4GKKL 2Z6KA 3CMAA 4A3DH 1WCMH 5IYBG 4JI2Q 3PF5A 3M85A 1YJNA 4DUZL 2AWOA 1PH1A 4KHPQ 2XTIA 2NZOA 2HHHQ 4HIOA 1YJ9A 4DV0Q 3PIOA 4IOCA 1N32L 1N36Q 2JA7G 3KF8B 4A76A 1VQHA 1KD1C 3K7UC 1FJGL 3I4NG 4B3RL 4FDBA 1N8RC 4HJ8A 1WCMG 2R7DA 4B3SQ 3T1HQ 4LF6L 4YCVA 4BXXG 4ALPA 4DAYB 4GLXA 3CXCA 1WFQA 2E2IH 3A5ZB 3D0FA 1XNQQ 1S3OA 4NB3A 1IZ6A 1Q1EA 4JBKA 3S17H 3KYHC 4DR7Q 2Q2TA 1VQJA 2JA9A 1VQFA 3E9IA 3I4NH 2BA0A 1N32Q 4MTNA 2AKWB 2KCTA 4APVA 1VQ6A 3F2DA 1CKMA 2NVYH 4DV3L 1VQ8A 4MNOA 4B3MQ 4DK6C 3S24A 4DPGA 4A3GH 5JJLA 2L15A 1PH5A 3OTOQ 4LF7L 4YWKA 4QJFA 3TRZA 4RG1A 4A3IG 1EQQA 1VS0A 2ASBA 1E3PA 1T9HA 2KHJA 3KF6B 2I5MX 5K36G 1CKOA 1JMCA 1EIFA 1WYDA 1WI5A 1NTGA 1KRSA 1IXRA 2WAQE 3HFZB 3I56A 2IHFA 4YWLA 4KLKA 4L5TA 2Q2UA 2D0OA 1VQLA 2ATWA 4A3KH 2D0PA 1E1OA 3GTQH 1QVCA 1HZBA 1FL0A 1VQEA 1X65A 2R6GA 3GDEA 4JBJA 5GAHC 1A0IA 1MIUA 4GOPB 4R1JA 4LF7Q 4Y52H 2R93G 1NJIC 4DV6Q 3L2PA 3JAMc 3CCLA 3CC4A 1HZCA 2JA5G 4A3CH 1NY4A 1O7IA 4IJHA 1IBKQ 3S1MH 1JJGA 2K75A 2AWNA 4A3LG 4P73A 3HOUG 3M3YH 4DR6Q 1SE8A 4LF5Q 2Z6KC 3RZOH 4JI3Q 2NN6G 1Y1WG 2UUBQ 1HNZQ 1VQCA 3J81i 1TXYA 4AYBE 1V43A 4UPAA 1UE7A 2YTVA 4DAMA 4C2MH 2H5XA 2LXKA 3AFQA 1RIPA 3W1GA 4LFAL 3E0EA 2IX0A 2NZHA 2OWOA 2QGQA 3CCMA 1Q86C 5IWAL 5AJ3L 2UUCL 4BY1G 3F1ZA 3PO3H 2ZM6L 3AQQA 1N33Q 1QUQA 1ASYA 2F52A 2E2JH 1G51A 4L5RC 1E1TA 3TEHB 5M3FG 3HOVH 2K14A 4LFAQ 1XJVA 1Q7YC 3HOXH 1VQGA 3CCJA 4BA1I 5IE8A 2B63H 1Y1VG 2WFWA 3H3VI 2UXBL 4X66L 1K8GA 3PUYA 2RHQB 5FJ8H 3L7ZC 2JA6G 4P75A 4QL5A 1YITA 3CCSA 1CUKA 3TQYA 4DV1L 1BVSA 4A3EG 1A62A 4GKKQ 1M1KC 2UUBL 1GO3E 1YHBA 1GM5A 2PQAA 1X6OA 4AH6A 4DR5Q 1HR0W 4BBRH 4A3MH 3CCQA 4JI5L 3FP9A 2JA7H 1IBKL 2JA6H 1YNXA 4L5SA 4DUYQ 2F4VQ 1QZGA 2GVBA 1I6HH 3VDYA 3RLOA 4AYBG 3J80c 2EXDA 2CCZA 4GLAC 1UE6A 3HOWG 1PA6A 4HJAA 3L0OA 4BBRG 3KDFA 2ZM6Q 3TS2A 5AJ3Q 2FXQA 3PF4A 1VQAA 4OONA 2HIXA 3S1QH 1Q1BA 1V1QA 5IYDG 2I5LX 4JI7L 2E8GA 4RMFA 3UDFA 2MFIA 3MEFA 1VQOA 5ELNA 3AFPA 3ICEA 4YWMA 3CP0A 4JBMA 1PH4A 2IY5B 2WB1G 3JAMi 3JC66 4QIWE 1UEBA 1UE5A 3I4OA 4B3ML 2MO1A 2ZJQA 5EAYA 2ID0A 4A3IH 3KF6A 1N9WA 2JQOA 1PYSB 4HIKA 3KLWA 4DV2L 2OQKA 1J5EL 4XIGS 3J7ZC 3UDXA 4LFBL 2NVTH 4DUYL 1TWFH 5E7NA 4DV7L 1QVGA 3HOZH 1VQDA 1FGUA 1XPOA 3GTGH 5C44H 1VQ5A 1EFWA 3I4MH 1GD7A 2CWPA 3GO5A 5C0XI 3M7NA 3NENA 2CKZB 4R4OA 4DV6L 1H95A 1XMQQ 5LMNL 2UUAQ 4IFDJ 3PUWA 4PG3A 3F2CA 4A3GG 3CC2A 3J81j 5C44G 4DV7Q 2VW9A 3GTMH 2KBNA 3K0XA 1VQIA 1BBUA 3S1RH 3NBHB 1EIYB 4LFCQ 2A8VA 3RLFA 5FLXc 3GTLH 1Y14B 4JI1L 3HKZE 5C4XH 4IO9A 2BH2A 1JJCB 3FKIG 5IT9c 2ZJPA 5LMNQ 1CSPA 1VQPA 4JI4L 3CPFA 4HJ5A 1VQ4A 4JYAL 2CFMA 1YIJA 2JEBI 1UWVA 1MJEA 2OCEA 4O0AA 2VQFL 3CD6A 4IPCA 2RHSB 3AYHB 1HZ9A 4OX9L 4YY3L 5IP7G 3H3VH 2JA5H 3Q8DA 4JI0Q 1Q46A 3ZJYC 2YTXA 1GVPA 3S2DH 4DNIA 5GQOA 2GN5A 5IWAQ 2UUCQ 4MZ9A 1N33L 4A3LH 3GTJH 5M3FH 3UE1A 3OTOL 1HNZL 2JJQA 4R4QA 5M5YH 4GS3A 2VQFQ 3HOXG 1LUZA 2YYZA 3I7FA 1OTCA 4DV0L 3T1YQ 1K73C 1OXVA 5IP9H 1HR0L 2Q2IA 3I55A 4JOIC 2HQLA 3WWVA 4BBSG 3H0GG 3NEMA 3KJOA 4YHHL 1MJCA 4R4CA 1PH6A 1Z47A 4OO1G 3U4VA 3D31A 3I2ZA 1EWIA 4JI8L 4QGUA 2QA4A 1AE3A 3ER0A 4BY1H 4DR5L 3S15H 3W1BA 1S40A 2ALYB 2F3IA 5GADC 5C0XJ 1PH3A 3PV0A 4PZ6A 1AE2A 3OYYA 3UE0A 4A3BH 2AHOB 4A93H 2F4VL 4DV4Q 1HNWQ 2UXBQ 1N36L 2PNHA 4DR2Q 3HOYH 4JBWA 3KJPA 2OTLA 1XMOL 4KHZA 3PUXA 4DR4Q 1SLJA 4LF4L 5ELOA 1HZAA 3M9BA 1X3GA 1X3FA 2K5VA 4OWWB 5IYDH 1PV4A 1R9TH 1U5KA 3MXNB 3ULPA 3PO2G 3AEVA 4NXNQ 1FVIA 3CPWA 1P16A 1YVCA 2I0QA 1VQBA 4XTCS 4PZ8A 3BJUA 3F8TA 4LNQA 2R92G 3CMEA 4A75A 2NVXH 1HNXQ 1IL2A 3FHWA 4YCWA 5GROA 1XPRA 2N49A 4GNXB 1L0WA 3PO2H 4UP8A 1IBMQ 2DUDA 4HJ7A 2UXCL 2IX1A 3T1YL 4DV5L 5JJKA 1SR3A 2PI2E 2R92H 5M3MH 1FJGQ 2WP8J 1IYJB 2B3GA 2AMCB 4TVAB 2K5NA 2JA8G 3U50C 3KOJA 4AQYQ 2WB1E 2K5HA 4B3SL 1P8LA 3LGJA 3T1HL 4LF6Q 4UP7A 1PH8A 1VCIA 4O2DA 4YCUA 3CF5A 5JEAG 1KXLA 1V9PA 1E24A 2UU9Q 3KDFB 1JT8A 1YJWA 1EUJA 1K83H 2N8NA 4P72A 3U4ZA 4LF4Q 5M3MG 4DV5Q 5BR8L 4GOPA 4C3JH 2KCMA 1IBLL 1JB7A 1GKHA 4POGA 3BU2A 4X62L 2CQOA 4OO1I 1XTDA 4KHPL 2GVAA 2VQEQ 2R93H 2HHHL 1C0AA 3K80C 1SFOH 1KC8C 4JI1Q 4BY7H 3CCUA 2ZTCA 3STBD 1X55A 5J3BA 1SMXA 4DR6L 2Q2HA 1J5EQ 3HOZG 2E5LL 4GKJL 4IPGA 1G6PA 4H02A 5IYCH 1U0LA 2ZTDA 3PGZA 5BR8Q 1EQRA 3DLLA 1IBLQ 1XNRL 1L2FA 4AIMA 1RL2A 1XMQL 2UUAL 4HIDA 5IP7H 2Y0SG 1XPUA 4X66Q 3BZKA 3PUVA 1TWHH 5FLMH 4AQYL 1BKBA 1CSQA 4A3JH 1YZ6A 4DR2L 3ULJA 1YHQA 4K0KL 5IYCG 5HGQA 1Q82C 3S14H 1E7ZA 3CCVA 3S16H 2UU9L 2VNUD 3EBEA 3FKIH 2MQHA 4X64L 5IP9G 3G71A 1YEZA 2VZAA 4UY8C 1YI2A 1PVOA 2YTYA 1NBWA 1SROA 3ULLA 1OXTA 1KIXA 1W3SA 1Q81C 4A3JG 4NPSA 3RNUA 1N34Q 2N78A 3RN5A 4K0KQ 3E9HA 4YHHQ 1K8AC 2VS1A 1B7YB 3G48A 1I94L 4GKJQ 1K9MC 2UXDL 2RCNA 4JCVE 4C3IH 1X9NA 4WJ4A 1YBYA 2OQ0A 4GN4B 1WJJA 2LSSA 3J81c 1L1OA 4DV1Q 2OTJA 2R7FA 1XNRQ 4JOIA 4A93G 2CWAA 4DKAC 2NN6I 1X54A 2VQEL 2HT1A 4DR7L 3K81C 3ERSX 4JC0A 3W5OA 3HOYG 5LMUL 4LUVA 3K8AA 4LWCA 5GAGC 1S72A 2MO0A 3A0JA 3SGIA 3NELA 2VUMH 3RLNA 1C9OA 1E22A 3RZDH 1PH7A 4BBSH 1WOCA 4X6AH 2Z0SA 3H0GH 4OXPA 1Q12A 2Y0SE 1I3QH 5M5WH 3RN2A 1VQ7A 1DGSA 1KQSA 3HKZG 4DR3Q 2ES2A 1EYGA 1PH2A 5LMUQ 1I5FA 1BBWA 1B8AA 2JK8A 2KHIA 4GN5A 4IJLA 4LFBQ 3A5UA 2VUMG 4GNXA 1CKNB 1NE3A 4BXXH 4R4TA 5H1SE 1G291 4B3TL 2WAQG 4NXML 4GLVB 2I5HA 1CKNA 2BH8A 3PSIA 5C4JH 4A3MG 4OWXB 1I94Q 2UXDQ 1D8LA 2B29A 2K4KA 2E5LQ 1VQNA 4DR3L 4KI0A 3CW2C 2RF4A 4J15A 4BA2I 4A3DG 3EN2A 5DLQE 3STBC 1KL9A 5HY6A 5IYBH 1PHJA 1HR0Q 1ASZA 2DGYA 2NVQH 4A4IA 5IY0A 3M4PA 4P74A 4EX5A 1QZHA 4JI6L 4OX9Q 3A74A 2QEXA 2VL6A 3CCEA 2ZJRA 3CAMA 1X3EA 1NMFA 4GN3B 4JV5L 4Y7NH 1M90C 3IRBA 3GD7A 1IBML 3H15A 4L5QA 3EIVA 4X64Q 2YU9H 1SN8A 2JE6I 3TREA 4UP9A 5JJIA 1PYBA 1HJPA 4BY7G 3M4OH 1KHIA 4DR1L 3PUZA 1N34L 4A3KG 4TQUS 1TWCH 1LYLA 4NXMQ 1L1OB 1I50H 1OXSC 4B3TQ 2JA8H 3UDIA 1VQ9A 1L1OC 4JI2L 4HJ9A 2IT1A 2V1CC 3U58A 1W2BA 1A63A 4LUOA 5C3EH 1OXUA 4X62Q 5FLMG 4X65L 4EQ5A 3TS0A 5JEAJ 4DR1Q 3HOUH 3J7A5 4IFDG 3F2BA 4LF9L 1PH9A 3KFUA 4ME3A 4A3FG 4JI6Q 2K52A 4PMWA 1LTLA 2K50A 3GTPH 4C3HH 5C3EG 2E2HH 1YHAA 1AH9A 2MNAA 4JV5Q 2PMZE 4IFDI 4JG2A 4X65Q 2JEAI 4LW1A 2HIVA 3PCOB 2A1AA 3K7AH 2EQSA 4DV4L 4IPHA 1VQMA 4LF8L 4IOAA 1HNWL 1UE1A 5M5XH 4A3FH 4PZ7A 5C4XG 3PIPA 2IHEA 3I4MG 3PO3G 4DV3Q 4A3CG 1JE5A 3UDGA 2N3SA 3BZCA 2XGTA 1LM0A 4JI4Q 1C7YA 4OWTB 1MKHA 2R7ZH 1X56A 1B70B 2PQAB 3CCRA 4LF5L 4JI3L 4GOPC 5LMNW
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF8 Q;  3RR5 A;  1Y1W H;  1QVF A;  2UXC Q;  1XNQ L;  4QY7 A;  4P71 A;  4NXN L;  4QQB X;  1Z9F A;  2VY3 A;  5FJ8 G;  4JI0 L;  2EIF A;  4POF A;  1Q8K A;  4JI7 Q;  4LUZ A;  2A19 A;  4YY3 Q;  1K0R A;  2YV5 A;  2ZTE A;  1HNX L;  4A3E H;  5C0X G;  2R7Z G;  3GTO H;  4A3B G;  4HIM A;  4B3R Q;  1K3R A;  1D7Q A;  1QUQ B;  1PFS A;  3GTK H;  4LF9 Q;  4DR4 L;  3CC7 A;  1J6Q A;  1TWA H;  1XMO Q;  1VQK A;  3OW2 A;  1NMG A;  3M4Q A;  4JI5 Q;  1JJ2 A;  3G6E A;  3CQZ H;  3B6Y A;  3S1N H;  3S2H H;  4JYA Q;  3HKS A;  3J80 i;  2BA1 A;  4R4I A;  2D62 A;  2KEN A;  4DUZ Q;  4WJ3 M;  1KAW A;  1EOV A;  1HH2 P;  1SRU A;  2C35 B;  3G4S A;  1A8V A;  4DV2 Q;  4IPD A;  4LFC L;  3HOW H;  3HOV G;  2PI2 A;  2B63 G;  5GAE C;  1OXX K;  1Y1V H;  2LXJ A;  4GNX C;  1KRT A;  1TWG H;  4JI8 Q;  3DM3 A;  4DK3 C;  4GKK L;  2Z6K A;  3CMA A;  4A3D H;  1WCM H;  5IYB G;  4JI2 Q;  3PF5 A;  3M85 A;  1YJN A;  4DUZ L;  2AWO A;  1PH1 A;  4KHP Q;  2XTI A;  2NZO A;  2HHH Q;  4HIO A;  1YJ9 A;  4DV0 Q;  3PIO A;  4IOC A;  1N32 L;  1N36 Q;  2JA7 G;  3KF8 B;  4A76 A;  1VQH A;  1KD1 C;  3K7U C;  1FJG L;  3I4N G;  4B3R L;  4FDB A;  1N8R C;  4HJ8 A;  1WCM G;  2R7D A;  4B3S Q;  3T1H Q;  4LF6 L;  4YCV A;  4BXX G;  4ALP A;  4DAY B;  4GLX A;  3CXC A;  1WFQ A;  2E2I H;  3A5Z B;  3D0F A;  1XNQ Q;  1S3O A;  4NB3 A;  1IZ6 A;  1Q1E A;  4JBK A;  3S17 H;  3KYH C;  4DR7 Q;  2Q2T A;  1VQJ A;  2JA9 A;  1VQF A;  3E9I A;  3I4N H;  2BA0 A;  1N32 Q;  4MTN A;  2AKW B;  2KCT A;  4APV A;  1VQ6 A;  3F2D A;  1CKM A;  2NVY H;  4DV3 L;  1VQ8 A;  4MNO A;  4B3M Q;  4DK6 C;  3S24 A;  4DPG A;  4A3G H;  5JJL A;  2L15 A;  1PH5 A;  3OTO Q;  4LF7 L;  4YWK A;  4QJF A;  3TRZ A;  4RG1 A;  4A3I G;  1EQQ A;  1VS0 A;  2ASB A;  1E3P A;  1T9H A;  2KHJ A;  3KF6 B;  2I5M X;  5K36 G;  1CKO A;  1JMC A;  1EIF A;  1WYD A;  1WI5 A;  1NTG A;  1KRS A;  1IXR A;  2WAQ E;  3HFZ B;  3I56 A;  2IHF A;  4YWL A;  4KLK A;  4L5T A;  2Q2U A;  2D0O A;  1VQL A;  2ATW A;  4A3K H;  2D0P A;  1E1O A;  3GTQ H;  1QVC A;  1HZB A;  1FL0 A;  1VQE A;  1X65 A;  2R6G A;  3GDE A;  4JBJ A;  5GAH C;  1A0I A;  1MIU A;  4GOP B;  4R1J A;  4LF7 Q;  4Y52 H;  2R93 G;  1NJI C;  4DV6 Q;  3L2P A;  3JAM c;  3CCL A;  3CC4 A;  1HZC A;  2JA5 G;  4A3C H;  1NY4 A;  1O7I A;  4IJH A;  1IBK Q;  3S1M H;  1JJG A;  2K75 A;  2AWN A;  4A3L G;  4P73 A;  3HOU G;  3M3Y H;  4DR6 Q;  1SE8 A;  4LF5 Q;  2Z6K C;  3RZO H;  4JI3 Q;  2NN6 G;  1Y1W G;  2UUB Q;  1HNZ Q;  1VQC A;  3J81 i;  1TXY A;  4AYB E;  1V43 A;  4UPA A;  1UE7 A;  2YTV A;  4DAM A;  4C2M H;  2H5X A;  2LXK A;  3AFQ A;  1RIP A;  3W1G A;  4LFA L;  3E0E A;  2IX0 A;  2NZH A;  2OWO A;  2QGQ A;  3CCM A;  1Q86 C;  5IWA L;  5AJ3 L;  2UUC L;  4BY1 G;  3F1Z A;  3PO3 H;  2ZM6 L;  3AQQ A;  1N33 Q;  1QUQ A;  1ASY A;  2F52 A;  2E2J H;  1G51 A;  4L5R C;  1E1T A;  3TEH B;  5M3F G;  3HOV H;  2K14 A;  4LFA Q;  1XJV A;  1Q7Y C;  3HOX H;  1VQG A;  3CCJ A;  4BA1 I;  5IE8 A;  2B63 H;  1Y1V G;  2WFW A;  3H3V I;  2UXB L;  4X66 L;  1K8G A;  3PUY A;  2RHQ B;  5FJ8 H;  3L7Z C;  2JA6 G;  4P75 A;  4QL5 A;  1YIT A;  3CCS A;  1CUK A;  3TQY A;  4DV1 L;  1BVS A;  4A3E G;  1A62 A;  4GKK Q;  1M1K C;  2UUB L;  1GO3 E;  1YHB A;  1GM5 A;  2PQA A;  1X6O A;  4AH6 A;  4DR5 Q;  1HR0 W;  4BBR H;  4A3M H;  3CCQ A;  4JI5 L;  3FP9 A;  2JA7 H;  1IBK L;  2JA6 H;  1YNX A;  4L5S A;  4DUY Q;  2F4V Q;  1QZG A;  2GVB A;  1I6H H;  3VDY A;  3RLO A;  4AYB G;  3J80 c;  2EXD A;  2CCZ A;  4GLA C;  1UE6 A;  3HOW G;  1PA6 A;  4HJA A;  3L0O A;  4BBR G;  3KDF A;  2ZM6 Q;  3TS2 A;  5AJ3 Q;  2FXQ A;  3PF4 A;  1VQA A;  4OON A;  2HIX A;  3S1Q H;  1Q1B A;  1V1Q A;  5IYD G;  2I5L X;  4JI7 L;  2E8G A;  4RMF A;  3UDF A;  2MFI A;  3MEF A;  1VQO A;  5ELN A;  3AFP A;  3ICE A;  4YWM A;  3CP0 A;  4JBM A;  1PH4 A;  2IY5 B;  2WB1 G;  3JAM i;  3JC6 6;  4QIW E;  1UEB A;  1UE5 A;  3I4O A;  4B3M L;  2MO1 A;  2ZJQ A;  5EAY A;  2ID0 A;  4A3I H;  3KF6 A;  1N9W A;  2JQO A;  1PYS B;  4HIK A;  3KLW A;  4DV2 L;  2OQK A;  1J5E L;  4XIG S;  3J7Z C;  3UDX A;  4LFB L;  2NVT H;  4DUY L;  1TWF H;  5E7N A;  4DV7 L;  1QVG A;  3HOZ H;  1VQD A;  1FGU A;  1XPO A;  3GTG H;  5C44 H;  1VQ5 A;  1EFW A;  3I4M H;  1GD7 A;  2CWP A;  3GO5 A;  5C0X I;  3M7N A;  3NEN A;  2CKZ B;  4R4O A;  4DV6 L;  1H95 A;  1XMQ Q;  5LMN L;  2UUA Q;  4IFD J;  3PUW A;  4PG3 A;  3F2C A;  4A3G G;  3CC2 A;  3J81 j;  5C44 G;  4DV7 Q;  2VW9 A;  3GTM H;  2KBN A;  3K0X A;  1VQI A;  1BBU A;  3S1R H;  3NBH B;  1EIY B;  4LFC Q;  2A8V A;  3RLF A;  5FLX c;  3GTL H;  1Y14 B;  4JI1 L;  3HKZ E;  5C4X H;  4IO9 A;  2BH2 A;  1JJC B;  3FKI G;  5IT9 c;  2ZJP A;  5LMN Q;  1CSP A;  1VQP A;  4JI4 L;  3CPF A;  4HJ5 A;  1VQ4 A;  4JYA L;  2CFM A;  1YIJ A;  2JEB I;  1UWV A;  1MJE A;  2OCE A;  4O0A A;  2VQF L;  3CD6 A;  4IPC A;  2RHS B;  3AYH B;  1HZ9 A;  4OX9 L;  4YY3 L;  5IP7 G;  3H3V H;  2JA5 H;  3Q8D A;  4JI0 Q;  1Q46 A;  3ZJY C;  2YTX A;  1GVP A;  3S2D H;  4DNI A;  5GQO A;  2GN5 A;  5IWA Q;  2UUC Q;  4MZ9 A;  1N33 L;  4A3L H;  3GTJ H;  5M3F H;  3UE1 A;  3OTO L;  1HNZ L;  2JJQ A;  4R4Q A;  5M5Y H;  4GS3 A;  2VQF Q;  3HOX G;  1LUZ A;  2YYZ A;  3I7F A;  1OTC A;  4DV0 L;  3T1Y Q;  1K73 C;  1OXV A;  5IP9 H;  1HR0 L;  2Q2I A;  3I55 A;  4JOI C;  2HQL A;  3WWV A;  4BBS G;  3H0G G;  3NEM A;  3KJO A;  4YHH L;  1MJC A;  4R4C A;  1PH6 A;  1Z47 A;  4OO1 G;  3U4V A;  3D31 A;  3I2Z A;  1EWI A;  4JI8 L;  4QGU A;  2QA4 A;  1AE3 A;  3ER0 A;  4BY1 H;  4DR5 L;  3S15 H;  3W1B A;  1S40 A;  2ALY B;  2F3I A;  5GAD C;  5C0X J;  1PH3 A;  3PV0 A;  4PZ6 A;  1AE2 A;  3OYY A;  3UE0 A;  4A3B H;  2AHO B;  4A93 H;  2F4V L;  4DV4 Q;  1HNW Q;  2UXB Q;  1N36 L;  2PNH A;  4DR2 Q;  3HOY H;  4JBW A;  3KJP A;  2OTL A;  1XMO L;  4KHZ A;  3PUX A;  4DR4 Q;  1SLJ A;  4LF4 L;  5ELO A;  1HZA A;  3M9B A;  1X3G A;  1X3F A;  2K5V A;  4OWW B;  5IYD H;  1PV4 A;  1R9T H;  1U5K A;  3MXN B;  3ULP A;  3PO2 G;  3AEV A;  4NXN Q;  1FVI A;  3CPW A;  1P16 A;  1YVC A;  2I0Q A;  1VQB A;  4XTC S;  4PZ8 A;  3BJU A;  3F8T A;  4LNQ A;  2R92 G;  3CME A;  4A75 A;  2NVX H;  1HNX Q;  1IL2 A;  3FHW A;  4YCW A;  5GRO A;  1XPR A;  2N49 A;  4GNX B;  1L0W A;  3PO2 H;  4UP8 A;  1IBM Q;  2DUD A;  4HJ7 A;  2UXC L;  2IX1 A;  3T1Y L;  4DV5 L;  5JJK A;  1SR3 A;  2PI2 E;  2R92 H;  5M3M H;  1FJG Q;  2WP8 J;  1IYJ B;  2B3G A;  2AMC B;  4TVA B;  2K5N A;  2JA8 G;  3U50 C;  3KOJ A;  4AQY Q;  2WB1 E;  2K5H A;  4B3S L;  1P8L A;  3LGJ A;  3T1H L;  4LF6 Q;  4UP7 A;  1PH8 A;  1VCI A;  4O2D A;  4YCU A;  3CF5 A;  5JEA G;  1KXL A;  1V9P A;  1E24 A;  2UU9 Q;  3KDF B;  1JT8 A;  1YJW A;  1EUJ A;  1K83 H;  2N8N A;  4P72 A;  3U4Z A;  4LF4 Q;  5M3M G;  4DV5 Q;  5BR8 L;  4GOP A;  4C3J H;  2KCM A;  1IBL L;  1JB7 A;  1GKH A;  4POG A;  3BU2 A;  4X62 L;  2CQO A;  4OO1 I;  1XTD A;  4KHP L;  2GVA A;  2VQE Q;  2R93 H;  2HHH L;  1C0A A;  3K80 C;  1SFO H;  1KC8 C;  4JI1 Q;  4BY7 H;  3CCU A;  2ZTC A;  3STB D;  1X55 A;  5J3B A;  1SMX A;  4DR6 L;  2Q2H A;  1J5E Q;  3HOZ G;  2E5L L;  4GKJ L;  4IPG A;  1G6P A;  4H02 A;  5IYC H;  1U0L A;  2ZTD A;  3PGZ A;  5BR8 Q;  1EQR A;  3DLL A;  1IBL Q;  1XNR L;  1L2F A;  4AIM A;  1RL2 A;  1XMQ L;  2UUA L;  4HID A;  5IP7 H;  2Y0S G;  1XPU A;  4X66 Q;  3BZK A;  3PUV A;  1TWH H;  5FLM H;  4AQY L;  1BKB A;  1CSQ A;  4A3J H;  1YZ6 A;  4DR2 L;  3ULJ A;  1YHQ A;  4K0K L;  5IYC G;  5HGQ A;  1Q82 C;  3S14 H;  1E7Z A;  3CCV A;  3S16 H;  2UU9 L;  2VNU D;  3EBE A;  3FKI H;  2MQH A;  4X64 L;  5IP9 G;  3G71 A;  1YEZ A;  2VZA A;  4UY8 C;  1YI2 A;  1PVO A;  2YTY A;  1NBW A;  1SRO A;  3ULL A;  1OXT A;  1KIX A;  1W3S A;  1Q81 C;  4A3J G;  4NPS A;  3RNU A;  1N34 Q;  2N78 A;  3RN5 A;  4K0K Q;  3E9H A;  4YHH Q;  1K8A C;  2VS1 A;  1B7Y B;  3G48 A;  1I94 L;  4GKJ Q;  1K9M C;  2UXD L;  2RCN A;  4JCV E;  4C3I H;  1X9N A;  4WJ4 A;  1YBY A;  2OQ0 A;  4GN4 B;  1WJJ A;  2LSS A;  3J81 c;  1L1O A;  4DV1 Q;  2OTJ A;  2R7F A;  1XNR Q;  4JOI A;  4A93 G;  2CWA A;  4DKA C;  2NN6 I;  1X54 A;  2VQE L;  2HT1 A;  4DR7 L;  3K81 C;  3ERS X;  4JC0 A;  3W5O A;  3HOY G;  5LMU L;  4LUV A;  3K8A A;  4LWC A;  5GAG C;  1S72 A;  2MO0 A;  3A0J A;  3SGI A;  3NEL A;  2VUM H;  3RLN A;  1C9O A;  1E22 A;  3RZD H;  1PH7 A;  4BBS H;  1WOC A;  4X6A H;  2Z0S A;  3H0G H;  4OXP A;  1Q12 A;  2Y0S E;  1I3Q H;  5M5W H;  3RN2 A;  1VQ7 A;  1DGS A;  1KQS A;  3HKZ G;  4DR3 Q;  2ES2 A;  1EYG A;  1PH2 A;  5LMU Q;  1I5F A;  1BBW A;  1B8A A;  2JK8 A;  2KHI A;  4GN5 A;  4IJL A;  4LFB Q;  3A5U A;  2VUM G;  4GNX A;  1CKN B;  1NE3 A;  4BXX H;  4R4T A;  5H1S E;  1G29 1;  4B3T L;  2WAQ G;  4NXM L;  4GLV B;  2I5H A;  1CKN A;  2BH8 A;  3PSI A;  5C4J H;  4A3M G;  4OWX B;  1I94 Q;  2UXD Q;  1D8L A;  2B29 A;  2K4K A;  2E5L Q;  1VQN A;  4DR3 L;  4KI0 A;  3CW2 C;  2RF4 A;  4J15 A;  4BA2 I;  4A3D G;  3EN2 A;  5DLQ E;  3STB C;  1KL9 A;  5HY6 A;  5IYB H;  1PHJ A;  1HR0 Q;  1ASZ A;  2DGY A;  2NVQ H;  4A4I A;  5IY0 A;  3M4P A;  4P74 A;  4EX5 A;  1QZH A;  4JI6 L;  4OX9 Q;  3A74 A;  2QEX A;  2VL6 A;  3CCE A;  2ZJR A;  3CAM A;  1X3E A;  1NMF A;  4GN3 B;  4JV5 L;  4Y7N H;  1M90 C;  3IRB A;  3GD7 A;  1IBM L;  3H15 A;  4L5Q A;  3EIV A;  4X64 Q;  2YU9 H;  1SN8 A;  2JE6 I;  3TRE A;  4UP9 A;  5JJI A;  1PYB A;  1HJP A;  4BY7 G;  3M4O H;  1KHI A;  4DR1 L;  3PUZ A;  1N34 L;  4A3K G;  4TQU S;  1TWC H;  1LYL A;  4NXM Q;  1L1O B;  1I50 H;  1OXS C;  4B3T Q;  2JA8 H;  3UDI A;  1VQ9 A;  1L1O C;  4JI2 L;  4HJ9 A;  2IT1 A;  2V1C C;  3U58 A;  1W2B A;  1A63 A;  4LUO A;  5C3E H;  1OXU A;  4X62 Q;  5FLM G;  4X65 L;  4EQ5 A;  3TS0 A;  5JEA J;  4DR1 Q;  3HOU H;  3J7A 5;  4IFD G;  3F2B A;  4LF9 L;  1PH9 A;  3KFU A;  4ME3 A;  4A3F G;  4JI6 Q;  2K52 A;  4PMW A;  1LTL A;  2K50 A;  3GTP H;  4C3H H;  5C3E G;  2E2H H;  1YHA A;  1AH9 A;  2MNA A;  4JV5 Q;  2PMZ E;  4IFD I;  4JG2 A;  4X65 Q;  2JEA I;  4LW1 A;  2HIV A;  3PCO B;  2A1A A;  3K7A H;  2EQS A;  4DV4 L;  4IPH A;  1VQM A;  4LF8 L;  4IOA A;  1HNW L;  1UE1 A;  5M5X H;  4A3F H;  4PZ7 A;  5C4X G;  3PIP A;  2IHE A;  3I4M G;  3PO3 G;  4DV3 Q;  4A3C G;  1JE5 A;  3UDG A;  2N3S A;  3BZC A;  2XGT A;  1LM0 A;  4JI4 Q;  1C7Y A;  4OWT B;  1MKH A;  2R7Z H;  1X56 A;  1B70 B;  2PQA B;  3CCR A;  4LF5 L;  4JI3 L;  4GOP C;  5LMN W; 
#chains in the Genus database with same CATH topology
 1TII D;  1II3 A;  1Z9F A;  3GTM B;  2F3V A;  3CRK C;  2ZTE A;  1EWH A;  4A3E H;  2R7Z G;  4B3R Q;  4A3B G;  1D7Q A;  1I4P A;  3GTK H;  4DR4 L;  4CKB A;  3CC7 A;  1VQK A;  1PFM A;  4K8J A;  4JK1 C;  1KAA A;  3CQZ H;  3B6Y A;  2EDG A;  4JYA Q;  2V4D A;  3HKS A;  2TMP A;  4DUZ Q;  1KAW A;  1SRU A;  3HOW H;  1ONL A;  1A8V A;  4LFC L;  4DK0 A;  3KK7 A;  5KYL A;  4GZY C;  3BS1 A;  5EQ0 A;  2DY8 A;  2LXJ A;  2B2T A;  4GKK L;  3CMA A;  4A3M B;  1YJN A;  1XYI A;  2E76 C;  2XTI A;  4EQP A;  1ZXT A;  4DV0 Q;  4DNT B;  1N32 L;  3DWA A;  5C6A A;  1VQH A;  1JOO A;  4B3R L;  4XQQ A;  4HJ8 A;  4B3S Q;  1ILQ A;  1A3T A;  4LF6 L;  1BDO A;  1WFQ A;  2E2I H;  3VR2 A;  1EY9 A;  1IZ6 A;  4V0B A;  3S17 H;  1ICW A;  2JXM B;  3I91 A;  1Z6H A;  5EBD A;  3SDZ A;  2KCT A;  4APV A;  1VQ8 A;  1CKM A;  4EVO A;  2SNS A;  1H9S A;  3MXP A;  4HAE A;  2BDN A;  1MHW C;  3S24 A;  5JJL A;  1PFN A;  4K5V A;  1IYU A;  4LF7 L;  4YWK A;  1SYF A;  5CV4 A;  3TRZ A;  4RG1 A;  3M4Y A;  4A3I G;  4V19 0;  2RSN A;  2I5M X;  1WI5 A;  2R93 B;  1KRS A;  2WAQ E;  3HFZ B;  2LS0 1;  3I56 A;  4FXD A;  1EYC A;  2F0K A;  4L5T A;  5E3F A;  2D0O A;  2ATW A;  2O5J C;  1QVC A;  2XSC A;  4PV1 C;  5GAH C;  2JYO A;  4DAY A;  1A0I A;  1BR9 A;  1MIU A;  2RBM A;  3J80 L;  2I46 A;  1ZYR D;  1HZC A;  4A3C H;  1O7I A;  2EYO A;  2O4X A;  4IJH A;  3S1M H;  3BG3 A;  2F1M A;  2A68 D;  3VR3 A;  2LKV A;  3RZO H;  5D14 A;  3HOV B;  3J81 i;  1E0B A;  1TXY A;  2B2T C;  3T4A C;  2QEJ C;  2YTV A;  3H3V C;  4C2M H;  1C48 A;  3AFQ A;  3HZX A;  1Q8I A;  2NZH A;  5G3L D;  2OWO A;  5IWA L;  3IKJ A;  3F1Z A;  1QUQ A;  1ASY A;  1DZ1 A;  2E2J H;  4L5R C;  2FHT A;  3H6M A;  3HRZ C;  2PNR C;  4ODG A;  4A3D B;  2K14 A;  2PW7 A;  4BA1 I;  5IE8 A;  3Q6S A;  2PZU A;  5EGT A;  3NSW A;  1YIT A;  3CCS A;  3TQY A;  1CZW A;  4A3E G;  1A62 A;  1XTC D;  2PQA A;  4NDX A;  3CCQ A;  1X3Q A;  1XWE A;  2F4V Q;  5COY A;  1FGB D;  3HOW G;  2CCZ A;  2QKI C;  1UE6 A;  4ZLT F;  3C46 A;  3S17 B;  4BBR G;  1JC7 A;  3C2P A;  2FXQ A;  1X32 A;  2F0H A;  4XXE A;  5IYD G;  3UDF A;  2MFI A;  2VB2 X;  3AFP A;  4JBM A;  2D5D A;  2WB1 G;  1PRT D;  3K7A B;  3ERQ A;  3JC6 6;  1O78 A;  2XNA C;  1UE5 A;  3UI2 A;  2MO1 A;  4OIJ A;  5COR A;  2WII B;  1O7Y A;  1N9W A;  4RHS A;  1HA6 A;  3KLW A;  3GQB A;  1TY2 A;  1LT6 D;  2NVX B;  1QVG A;  2WV6 D;  3HEJ A;  5C44 H;  1GD7 A;  5K5P A;  5C0X I;  2XWB B;  3NEN A;  4KHV A;  4DV6 L;  2F03 A;  1MD2 D;  1GUG A;  1WCM B;  4DFA A;  2EVB A;  1PXU A;  2XRS D;  4LFC Q;  3NBH B;  2A8V A;  3RLF A;  2EY6 A;  2FMC A;  2EXZ A;  1GOZ A;  1JJC B;  3FKI G;  2B2U A;  2BOS A;  2CFM A;  4DAP A;  4DXF A;  3OSO A;  1CFM A;  3BDO A;  1NCV A;  1HZ9 A;  3VR5 A;  3H3V H;  3ZJY C;  2PPB C;  5L37 A;  1LT4 D;  5IWA Q;  3S2D H;  5IGG A;  4XDX A;  4NMZ A;  2VXW A;  4KKU A;  2E2H B;  2JJQ A;  1GUS A;  4GS3 A;  3HOX G;  5IT9 L;  4ZUJ A;  3H0G G;  4KKT A;  3KJO A;  1RJT A;  1JWU D;  4K5X A;  3U4V A;  4K2L A;  3LX0 A;  1S40 A;  1SJE D;  5C0X J;  3H0G B;  3A7L A;  4A93 H;  1VMP A;  4K5W A;  3JAM E;  2F3W A;  4JBW A;  1I6H B;  5ELE A;  1XMO L;  3D4W A;  1CT1 D;  1SYG A;  1SYD A;  3M9B A;  4Y7N B;  3MXN B;  3ULP A;  3PO2 G;  2F0Q A;  3R93 A;  4NXN Q;  5DAU A;  4FF1 A;  2R92 G;  1B4O A;  4A75 A;  3QR8 A;  4UDU C;  1IL2 A;  1S4Z A;  1L0W A;  1Z7T A;  4UP8 A;  4FP5 D;  3BDL A;  1WTP A;  2UXC L;  4QMG A;  3R2I A;  4HSV A;  2K03 A;  2IX1 A;  4CBV A;  1LAC A;  1AEX A;  5JJK A;  1SR3 A;  4U68 A;  1BO0 A;  1U9R A;  4DK1 A;  1H9M A;  2B3G A;  2AMC B;  1ET6 A;  2K5N A;  2KUM A;  1ENA A;  4IUQ A;  3U50 C;  2K5H A;  4B3S L;  3LGJ A;  1HQM C;  3SK5 A;  3CF5 A;  4O2D A;  3OHX C;  1YJW A;  3K57 A;  5M3M G;  4POG A;  3K5L A;  4FYD A;  3MXN A;  3OIP A;  4ABN A;  1I4Q A;  2HHH L;  1BCP F;  2LY7 A;  1V1P B;  1F2M A;  3STB D;  2ZT9 C;  2Q2H A;  2R3Z A;  2E5L L;  1V1P A;  1G6P A;  3NE5 B;  4H44 C;  5IYC H;  1U0L A;  3PGZ A;  4C3I B;  3DLL A;  2WB1 B;  5K36 H;  2NBF A;  4E6I A;  3AMU A;  1F2Y A;  4ZRZ A;  2UUA L;  1HRJ A;  3NP8 A;  2IL8 A;  1GUW A;  2HDL A;  1XPU A;  3BZK A;  4KV6 A;  3I4N B;  1CSQ A;  2K5W A;  3ULJ A;  5J1Z A;  3S14 H;  3CCV A;  3S16 H;  2ZXR A;  2VNU D;  3EBE A;  1ML0 D;  3FKI H;  4X64 L;  2CHB D;  4UY8 C;  1YI2 A;  4NPS A;  2MHV A;  4K0K Q;  2J4X A;  1K8A C;  1K8O A;  2E74 C;  1WD0 A;  4JCV E;  2K5Q A;  4GN4 B;  2EJF C;  1BXT A;  3J81 c;  4DV1 Q;  1IKM A;  3FPP A;  2K6A A;  1UUP A;  5IGC A;  1F9R A;  3W5O A;  3HOY G;  5C4H A;  3K8A A;  4LWC A;  3WOE A;  5GAG C;  4PQX A;  1C9O A;  1JIC A;  4N9T A;  1E22 A;  5ELC A;  4X6A H;  2Z0S A;  3NHH A;  3H0G H;  4XT1 B;  4OXP A;  1G91 A;  4DN4 M;  3C1E A;  3S2H B;  4F8M A;  2ES2 A;  1SNQ A;  1BCP C;  1SE2 A;  1V1O A;  4IJL A;  4LFB Q;  2VUM G;  2RVL A;  4BXX H;  4R4T A;  5H1S E;  1H9K A;  3KBX A;  4B3T L;  4GLV B;  3MFY A;  3OWF A;  5C4J H;  4OWX B;  1Y1W B;  4FO2 A;  4ZKC B;  4KI0 A;  1DCZ A;  5C3X A;  2M00 A;  4BA2 I;  5HY6 A;  5A2Q E;  3N52 A;  1PHJ A;  2NVQ H;  2DGY A;  4CJ1 B;  1PZJ D;  3VYS A;  4A4I A;  5IY0 A;  2DJG C;  2WKD A;  2QEX A;  1B3Q A;  3NWT A;  2ZJR A;  1R9T B;  1NMF A;  3IL8 A;  4GN3 B;  5I6Y A;  5FOB B;  2KCC A;  2EY1 A;  2PQE A;  2JP1 A;  2K33 A;  1A2U A;  2DY7 A;  5JJI A;  4UP9 A;  3H91 A;  1HJP A;  4DR1 L;  1LTG D;  3PUZ A;  3C3L A;  2Y0S B;  1L1O B;  1LV9 A;  2NWG A;  3K5M A;  2DJF C;  3S1N B;  5J22 A;  1A63 A;  4HCE A;  3I4M B;  1OXU A;  3W2D A;  3Q24 A;  5JEA J;  3DWQ A;  4PMC A;  3J7A 5;  4IFD G;  5FKA C;  1PH9 A;  4RFB A;  4A3F G;  2K50 A;  2G9D A;  5IGE A;  1YHA A;  3DEP A;  4JV5 Q;  3OMC A;  2HIV A;  4DV4 L;  2D2C C;  1HQR D;  2RDH A;  4F7X A;  4DV3 Q;  5EPJ A;  3NTH A;  1UAP A;  1B9N A;  1RTO A;  2N3S A;  1LM0 A;  3BZC A;  4JI4 Q;  1D6E C;  2PQA B;  3J7Y W;  4GOP C;  1FNW A;  5LMN W;  1JT8 A;  1Y1W H;  1IW7 C;  5D3D A;  4QY7 A;  3HKZ B;  4P71 A;  4NXN L;  5FJ8 G;  1UEA B;  2A19 A;  1S5E D;  1K0R A;  4UAI A;  4G7H C;  1O7L A;  3EQL C;  1PFS A;  4LF9 Q;  2F0F A;  1RD9 D;  3X3N A;  1J6Q A;  1TWA H;  4DXG A;  1XMO Q;  3OW2 A;  3M4Q A;  5KIX A;  3S1N H;  3G6E A;  1JOQ A;  1WTR A;  1G2T A;  4F88 A;  4R4I A;  2KEN A;  1JWM D;  1STH A;  1HH2 P;  2OF1 A;  3MFG A;  3RMH A;  4DV2 Q;  1B53 A;  2PI2 A;  1I4H A;  1SXT A;  2F0W A;  2KEC A;  5GAE C;  1OXX K;  1Y1V H;  5IT9 E;  4DAV A;  4OEM B;  1KRT A;  1TWG H;  2L4N A;  3U9O A;  4GNX C;  2YU9 B;  2B8F A;  1Q3L A;  3QO2 A;  4Q5V A;  5IYB G;  2AWO A;  3MA2 B;  1PH1 A;  2N55 A;  3N6R A;  2NZO A;  3MC0 B;  2HHH Q;  1YJ9 A;  2ENB A;  2EYH A;  4IOC A;  4BBS B;  2JA7 G;  4A76 A;  1N8R C;  1HFG A;  1SMY C;  1WCM G;  2A6H D;  5CV8 A;  3ND9 A;  1D1I A;  3SHL A;  3T1H Q;  4BXX G;  4ALP A;  4DAY B;  1K0S A;  3A5Z B;  3D0F A;  1STG A;  2BE5 D;  1S3O A;  4J8Q A;  4KY6 A;  4NB3 A;  3E9I A;  3I4N H;  1N32 Q;  3C1F A;  3P1H A;  1TT2 A;  3Q0A A;  2NVY H;  3F2D A;  1XXG A;  1JOR A;  1GJX A;  1HUM A;  4MNO A;  5EBC A;  3RUZ A;  4DPG A;  4A3G H;  2K5D A;  1PH5 A;  1EEI D;  1KLG D;  4KN4 C;  1VS0 A;  1E3P A;  2KHJ A;  3KF6 B;  5K36 G;  2EOT A;  3BYT B;  3VA5 A;  3DXJ C;  3V05 A;  1IXR A;  3HOX B;  4YWL A;  2D9U A;  5CC4 A;  1E1O A;  3GTQ H;  3ITP A;  1FL0 A;  1X65 A;  3I4M G;  4BBR B;  4LF7 Q;  4GOP B;  1DD2 A;  2SOB A;  2R93 G;  2AUJ D;  1D5M C;  2A73 B;  4Z9C B;  2JA5 G;  3EVQ A;  1G6Z A;  3MTS A;  2K75 A;  5EPK A;  1RHP A;  2A5H A;  3M3Y H;  5C4Z A;  2Z8L A;  2Z6K C;  1TVX A;  3BDC A;  4AYB E;  4OHJ A;  1EYA A;  1V43 A;  3QWN A;  1R4Q B;  5CV5 A;  1SNP A;  1RIP A;  4LFA L;  2IX0 A;  1CK1 A;  2UUC L;  5AJ3 L;  4C2M B;  2F0N A;  4BY1 G;  2ZM6 L;  4L63 B;  4M1U B;  5NUC A;  1ESF A;  3H94 A;  3K0Y A;  1VQG A;  2WFW A;  1OO9 B;  1S5C D;  5BN4 A;  5FJ8 H;  3L7Z C;  4QL5 A;  2KED A;  1YHB A;  1GM5 A;  3S15 B;  1X6O A;  5AFW A;  2QCP X;  4DR5 Q;  4IN3 A;  2JA6 H;  3GTO B;  4ZKB B;  1WTQ A;  1EFI D;  4OEL B;  4N8X 1;  5JPM C;  1LT3 D;  2EXD A;  4GLA C;  1EWC A;  3T56 B;  2B2V C;  4TKO B;  4BWG B;  1T5E A;  3PF4 A;  4J1M A;  1VQA A;  4XQN A;  3AU7 A;  1Q1B A;  2MP1 A;  3I90 A;  2C5C A;  1B1Z A;  1V1Q A;  2OEO A;  3A8J E;  5CV7 A;  4JI7 L;  4IQZ A;  4P2C B;  5ELN A;  2L5T A;  3ICE A;  3K58 A;  2ICE C;  2IY5 B;  2HCC A;  1C8C A;  4KD4 A;  1YNN D;  2PYK A;  2ID0 A;  4A3I H;  1PYS B;  3IAY A;  1SNO A;  4R8I A;  1BF4 A;  4HIK A;  3WDN A;  2OQK A;  3DEO A;  3UDX A;  2KHS A;  5E7N A;  4AYB B;  1VQD A;  1XPO A;  5CBA E;  5CGK A;  3GTG H;  1VQ5 A;  4ZK9 B;  1FNV A;  3VR4 A;  2CKZ B;  4Q0F A;  2RKS A;  1W6K A;  5LMN L;  4PG3 A;  3F2C A;  1LAB A;  3CC2 A;  3ONA B;  4A3G G;  3L9A X;  1D2B A;  3J80 E;  2VW9 A;  3A7A B;  1EZ6 A;  1BBU A;  1VQI A;  5FLX c;  3GTL H;  4A93 B;  1HPC A;  1Y14 B;  3HKZ E;  4JI1 L;  4IO9 A;  5IT9 c;  5LMN Q;  1CSP A;  1H9S B;  3CPF A;  4FVM A;  2F0T A;  2M9V A;  4HJ5 A;  2OCE A;  3EJI A;  2RHS B;  5KGU A;  5IP7 G;  2JA5 H;  4JI0 Q;  4LMQ D;  1QOH A;  2YTX A;  1WTX A;  5GQO A;  2GN5 A;  4HCS A;  3UE1 A;  4C56 C;  5IOC A;  3BVG A;  4R4Q A;  1LUZ A;  4DV0 L;  4XYQ A;  1NUC A;  5IP9 H;  1HR0 L;  2R61 A;  5EJW A;  1EY0 A;  2K28 A;  5I9O A;  4JOI C;  4BBS G;  3NEM A;  4YHH L;  1MJC A;  3NPP A;  4JI8 L;  1SBB B;  2QA4 A;  1AE3 A;  1AW7 A;  1SAP A;  2K04 A;  3ZYY X;  5FLX L;  4BY1 H;  3FVQ A;  3W1B A;  3NXW A;  4XT3 B;  1PMR A;  1U4M A;  3PV0 A;  2B2V A;  5FLX E;  1HNW Q;  3SK8 A;  2PNH A;  4DR2 Q;  2OTL A;  5JAV A;  4UHV A;  2ZXO A;  1TKW B;  4DR4 Q;  5E1F A;  1HZA A;  1X3G A;  2K5V A;  2B8G A;  4DNR B;  5IYD H;  1R9T H;  1U5K A;  1PTO C;  4FNF A;  1JCK B;  4RCO A;  3LNN A;  2B2Y C;  4X3U A;  1VQB A;  4C1N I;  2XVS A;  4PZ8 A;  3CME A;  2NVQ B;  1SNC A;  2NVX H;  1EU4 A;  1HNX Q;  4IAL A;  4RGM A;  3FHW A;  1PYW D;  4GNX B;  1QWY A;  4N8F A;  1IBM Q;  4O42 A;  5A2Q L;  5C3W A;  1PFB A;  1IYJ B;  2F0O A;  4TVA B;  4AQY Q;  5EKK A;  1VCI A;  3U9S A;  1IHZ A;  1KXL A;  1V9P A;  3KDF B;  5ISR A;  2A6E D;  1EUJ A;  4LF4 Q;  3S1Q B;  3U4Z A;  4DV5 Q;  5BR8 L;  1IBL L;  4C3J H;  1Y8O B;  2KCM A;  1JB7 A;  1GKH A;  3EA6 A;  5ELD A;  4X62 L;  2A74 C;  3OOC A;  4JW0 A;  3NUC A;  4KHP L;  2IWH A;  2R93 H;  1DOM A;  3K80 C;  4KMU C;  4BY7 H;  3CCU A;  2ZTC A;  1X55 A;  3QG1 A;  4GKJ L;  3GV3 A;  3NBI A;  3VYU A;  2Q8I B;  4H02 A;  1PRT C;  2SNM A;  4DGZ A;  1RL2 A;  4IUT A;  1XMQ L;  4HID A;  3OWE B;  2Y0S G;  3SK6 A;  4X66 Q;  3PUV A;  2XWJ B;  4QB4 A;  5FLM H;  5EPL A;  4A3J H;  1YZ6 A;  1KTK A;  4K0K L;  1TU2 B;  1PRT B;  2MQH A;  1RF2 D;  1NBW A;  1OXT A;  4HSP A;  1Q81 C;  1N34 Q;  3S1M B;  3RN5 A;  3E9H A;  1B7Y B;  2B2W C;  4C3I H;  2OQ0 A;  3LWU A;  3RD4 A;  4CHT B;  1K8M A;  1WJJ A;  2LSS A;  1L1O A;  2XRQ D;  4ZYS A;  4A93 G;  2CWA A;  2VQE L;  1U4P A;  1X54 A;  1TS2 A;  4DR7 L;  1HUN A;  3ERS X;  4JC0 A;  3BZD B;  3SGI A;  3NEL A;  1CA6 A;  1PH7 A;  2FMM A;  1WOC A;  4BBS H;  1Y8N B;  1DGS A;  1TS3 A;  3T53 B;  1EYD A;  1I5F A;  1BBW A;  4HMI A;  3A5U A;  4GNX A;  1QB5 D;  1NE3 A;  3VR6 A;  2WAQ G;  1I4G A;  1FYC A;  2UXD Q;  2BH8 A;  4C1N K;  1CI3 M;  1D8L A;  2B29 A;  2K4K A;  4DR3 L;  4MHE A;  5M3F B;  3CW2 C;  2RF4 A;  1K83 B;  4A3D G;  3EN2 A;  5DLQ E;  3STB C;  3DMU A;  3I4L A;  4U67 3;  3M4P A;  4EX5 A;  1QZH A;  3BVZ A;  4OX9 Q;  2F0P A;  3CAM A;  5E4X A;  2AQ2 B;  4JV5 L;  4RGT A;  4L5Q A;  4CJ2 C;  3TRE A;  5A35 A;  3GTL B;  1B2T A;  3M7G A;  1KHI A;  4A3K G;  4NXM Q;  4RCN A;  3UDI A;  2MGS A;  5J39 A;  1L1O C;  3JAM L;  1VQ9 A;  3MVV A;  4JI2 L;  1I4R A;  4B9X A;  1VF7 A;  2IT1 A;  1PZK D;  1V8Q A;  4X62 Q;  1H9R A;  4X65 L;  3TS0 A;  4DR1 Q;  3HOU H;  1SDF A;  2NN6 H;  3F2B A;  3KFU A;  4ME3 A;  4JI6 Q;  1PTO D;  5FK9 C;  2K52 A;  4PMW A;  4A3B B;  1IKL A;  3GTP H;  5C3E G;  1EY8 A;  4KK7 A;  1NNX A;  4A3I B;  4IFD I;  5CV9 A;  1AZP A;  2F0L A;  3S2D B;  3DUZ A;  2JSO A;  1CM9 A;  3PCO B;  4HED A;  2EQS A;  4PMB A;  4IPH A;  4IOA A;  2WIN B;  3SK4 A;  1CQV A;  5C4X G;  1Y8P B;  1LTR D;  3NBH A;  2IHE A;  3PO3 G;  4R8N A;  4I7Z C;  1G8Z D;  2XN9 C;  4CDD C;  1DOK A;  2R7Z H;  5JOB A;  3A54 A;  3GTP B;  2AQ1 B;  4LF8 Q;  3RR5 A;  2EZV A;  1QVF A;  1XNQ L;  4TRD A;  4QQB X;  3KF8 A;  3NQT A;  3J81 L;  1GUN A;  1W6J A;  2EIF A;  3D4D A;  1Q8K A;  4JI7 Q;  4YY3 Q;  1HNX L;  1VF5 C;  5I4D A;  5C0X G;  3GTO H;  4HIM A;  1K3R A;  1L0X B;  1QUQ B;  1EU3 A;  4OL7 A;  4L6T B;  4HMJ A;  4OIK A;  1HXY D;  4CGY B;  1JJ2 A;  2Q8R E;  3J80 i;  2BA1 A;  1TWC B;  3G4S A;  1EOV A;  1J5E Q;  1MSH A;  3HOV G;  2B63 G;  1PDQ A;  4WJW A;  3W3A A;  2OT2 A;  3V2T A;  4JI2 Q;  3G6J B;  3M85 A;  4DUZ L;  2X6L A;  5IGB A;  1SMY D;  3LWE A;  1FJG L;  3O13 A;  4FDB A;  2KCN A;  5T1I A;  2NTS A;  1LTA D;  2G5D A;  4RGO S;  5LL6 S;  2LMC B;  1XNQ Q;  4HN7 A;  1Q1E A;  3KYH C;  2JA9 A;  1VQF A;  2BA0 A;  4MTN A;  3MAQ A;  1VQ6 A;  2KEE A;  3GP7 A;  1SYC A;  2QDB A;  3VYR A;  4B3M Q;  3MEH A;  2L15 A;  3OTO Q;  3PIO 3;  3FKI B;  4QJF A;  4K2K A;  4ULL A;  2ASB A;  1T9H A;  3S14 B;  1CKO A;  2L11 A;  1JMC A;  1WYD A;  4K6L A;  5JVH 3;  2O5I C;  2B39 A;  2CW0 C;  2Q2U A;  4A3K H;  3TP7 A;  4IUR A;  4JBJ A;  1HZB A;  2R6G A;  1VQE A;  3FMC A;  3T16 A;  4Y52 H;  2ZXP A;  3JAM c;  4QIW B;  1B3A A;  5C5L A;  1IBK Q;  3QIA A;  4CDC C;  1JJG A;  4A3L G;  4P73 A;  3HOU G;  4DR6 Q;  1SE8 A;  4JI3 Q;  2NN6 G;  1RCV D;  1Y1W G;  2UUB Q;  1EL0 A;  4QF4 A;  1HNZ Q;  2A69 D;  2QF7 A;  2PZW A;  4MN3 A;  1A3V A;  4PNY A;  4UPA A;  1UE7 A;  1QCB D;  2OXP A;  1SE4 A;  1O7Z A;  4IUP A;  4DAM A;  2H5X A;  2LXK A;  1HA5 A;  1K3B C;  3DM1 A;  3E0E A;  1JWS D;  1CQF A;  4QCL A;  3CCM A;  1HTL D;  1EEF D;  1JR0 D;  2HCI A;  3PO3 H;  5M3M B;  2EJM A;  5M3F G;  3TEH B;  3TZD A;  2QDL A;  1XJV A;  3MZ5 A;  1Y1V G;  1LLR D;  1JQY D;  4X66 L;  5IGF A;  3PUY A;  2RHQ B;  4P75 A;  2Z9H A;  3NTI A;  2Z6B A;  4C3J B;  4QUF A;  1BVS A;  1M1K C;  2UUB L;  1GO3 E;  1NR2 A;  4BBR H;  2BCO A;  4CDE C;  4JI5 L;  1PLF A;  3FP9 A;  2JA7 H;  1IBK L;  5FO9 B;  1YNX A;  4DUY Q;  1QZG A;  1UNS A;  2GVB A;  1I6H H;  4CKC A;  3TP6 A;  1PA6 A;  3V96 A;  3L0O A;  4HJA A;  1EOT A;  3TS2 A;  1HCZ A;  1BCP D;  3EFX D;  3L3O C;  4ZQ3 A;  4OON A;  3NWS A;  3S1Q H;  2CW0 D;  2I5L X;  2E8G A;  2X6G A;  4RMF A;  5M5X B;  5KRU A;  1PH4 A;  4IUN A;  2F0E A;  4KJN A;  4QIW E;  1GHK A;  2L0C A;  4B3M L;  2EYM A;  2ZJQ A;  5EAY A;  3KF6 A;  2JQO A;  3P20 A;  1A15 A;  1QG7 A;  1J5E L;  4LFB L;  5CYU A;  4G7O C;  2RDG A;  3HOW B;  2JN4 A;  5DM6 3;  1EFW A;  3I4M H;  2CWP A;  3OPO A;  4ID6 A;  4RHR A;  4ZAI A;  1LTB D;  4R4O A;  3HG9 A;  1XMQ Q;  4IFD J;  3GTG B;  3CHB D;  1WTH A;  3J81 j;  4ZCK A;  5C44 G;  3GTM H;  3MXU A;  2QIL A;  4R9W A;  3S1R H;  1EIY B;  5C4X H;  3J7A V;  3T51 B;  2K1B A;  2P5Z X;  2RCF A;  3R8B A;  4G4K A;  4JYA L;  2JEB I;  1ESR A;  1UWV A;  1MJE A;  1STY A;  2ICI A;  4O0A A;  2A68 C;  2JA5 B;  4LJZ C;  1WVL A;  3AYH B;  3HP3 A;  2AQ3 B;  1EZ8 A;  5C44 B;  4YY3 L;  3Q8D A;  1Q46 A;  1ZYR C;  1KNA A;  4DNI A;  5IIF A;  4X3S A;  1N33 L;  4A3L H;  5C0X H;  3GTJ H;  3MHB A;  4RKB A;  2VQF Q;  2YYZ A;  3I7F A;  1LTS D;  1OXV A;  2Q2I A;  1QIL A;  1M8A A;  3I55 A;  2NZ1 D;  3HOU B;  3WWV A;  2HQL A;  2PMZ B;  4EQO A;  1PH6 A;  4OO1 G;  2SEB D;  3I2Z A;  1EWI A;  3I73 A;  4QGU A;  3ER0 A;  2DN8 A;  4N9P A;  1EY5 A;  5CMD A;  3S15 H;  2F3I A;  1PH3 A;  4PZ6 A;  1AE2 A;  3OYY A;  5KEE A;  4B9W A;  4LK1 C;  2F4V L;  3CKI B;  1YNN C;  1N36 L;  3KJP A;  4KHZ A;  3PUX A;  1PTO H;  1DYQ A;  4FF2 A;  2EY5 A;  5ELO A;  2F0J A;  2JA7 B;  4OWW B;  1PV4 A;  2L1B A;  1IYV A;  2EE1 A;  3AEV A;  1FVI A;  1PTO F;  1YVC A;  3RZD B;  4XTC S;  5GRO A;  4YCW A;  4DA2 A;  1XPR A;  1K28 A;  2N49 A;  2F4I A;  3PO2 H;  2DUD A;  3E6Z X;  4HJ7 A;  1Y69 U;  3T1Y L;  5CV6 A;  2E2J B;  2R92 H;  5M3M H;  3PO3 B;  3URY A;  2WP8 J;  3A55 A;  1WTW A;  3K59 A;  3KOJ A;  3QB3 A;  1KLU D;  5G3L F;  1LO5 D;  3H3V I;  3T1H L;  1QNU A;  4UP7 A;  2HDM A;  3D8G A;  5JJZ A;  2N8N A;  1DOL A;  1RDP D;  4OO1 I;  4K14 A;  4WRD A;  4ILW A;  4O1N A;  2VQE Q;  3RZO B;  1C0A A;  2LFN A;  4FXG C;  1KC8 C;  4JI1 Q;  3IFD A;  1F9S A;  1SMX A;  1BBX C;  1ILP A;  4DR6 L;  2JA6 B;  1SE3 A;  4IPG A;  4KY5 A;  1B9M A;  4A3G B;  1CZG A;  1CHP D;  3KLR A;  1WTO A;  1L2F A;  4M8A A;  4AIM A;  1NAP A;  5IP7 H;  3I8Z A;  4A3K B;  1VDZ A;  2VUM B;  3VYT A;  1DJR D;  1TWH H;  4KTA A;  1F2Z A;  5IYC G;  2CH4 W;  5HGQ A;  1S5B D;  5DNF A;  1LTI D;  2WAC A;  5IP9 G;  3G71 A;  2VZA A;  1PVO A;  2YTY A;  4WOR A;  3M3Y B;  3ULL A;  2J7Z A;  1KIX A;  1W3S A;  2E75 C;  2B2U C;  3FRP B;  1MSG A;  1HTP A;  2N78 A;  5BN3 A;  2HD3 A;  2VS1 A;  3K5N A;  3WOF A;  1RKN A;  1I94 L;  4GKJ Q;  1K9M C;  1X9N A;  2R92 B;  1SSO A;  2OTJ A;  1XNR Q;  2G9H D;  4JOI A;  5I6W A;  4KY7 A;  2NN6 I;  2WAQ B;  2HT1 A;  3K81 C;  3PO2 B;  4BY7 B;  5LMU L;  1S72 A;  2PW5 A;  5T1G A;  2MO0 A;  1IL8 A;  1ENC A;  2VUM H;  3RZD H;  4XQJ A;  4JVZ A;  2E2D C;  1I3Q H;  5M5W H;  3RN2 A;  3TME A;  3HKZ G;  1EYG A;  2SDF A;  1PH2 A;  1H9J A;  5LMU Q;  2Q8T A;  2KHI A;  3Q22 A;  5F2D A;  1ZEQ X;  1MBY A;  1G29 1;  4KD3 A;  4NXM L;  2I5H A;  1CKN A;  1I94 Q;  4A3M G;  2I07 B;  3G7L A;  3QOJ A;  1VQN A;  1E2W A;  4XYO A;  1A2T A;  2FFK B;  4J15 A;  2XIW A;  1QE6 A;  1HR0 Q;  4YIJ A;  3A8K E;  5HGT A;  3TP5 A;  2EYF A;  1FR3 A;  4P74 A;  4JI6 L;  3HGB A;  3MXG A;  2VL6 A;  3CCE A;  1X3E A;  4HR7 B;  1M90 C;  3IRB A;  2H4O A;  3GD7 A;  1IBM L;  3H15 A;  1TWG B;  3EIV A;  4X64 Q;  2YU9 H;  2JE6 I;  2HQE A;  3HOY B;  1PYB A;  3FEW X;  4BY7 G;  3OIQ A;  4TQU S;  2EY2 A;  3CU7 A;  1OXS C;  1TR5 A;  4HJ9 A;  2V1C C;  3KBG A;  3A56 A;  4G57 A;  1PTO B;  1QNK A;  5FLM G;  4HTH A;  2MUY A;  5C4X B;  2Z4H A;  5FO8 B;  3SVM A;  1LTL A;  4C3H H;  5M5Y B;  4B08 A;  4K8I A;  1AH9 A;  2MNA A;  2PMZ E;  3OW7 A;  4X65 Q;  5I2X A;  2JEA I;  4LW1 A;  3SR1 A;  2A1A A;  4IFD H;  3K7A H;  5KNC A;  4LF8 L;  1HNW L;  5HUR A;  1UE1 A;  5M5X H;  4A3F H;  4A3C G;  1JE5 A;  2XGT A;  1C7Y A;  3PMF A;  1EQV A;  1BQQ T;  1X56 A;  3CCR A;  2F0I A;  4JI3 L;  4C3H B;  2DNE A;  2UXC Q;  2VB3 X;  1I6V C;  2VY3 A;  4MIU A;  4FF4 A;  4JI0 L;  4POF A;  4LUZ A;  3SXH A;  2YV5 A;  4A3F B;  1NMG A;  4JI5 Q;  4EQN A;  5KND A;  3S2H H;  4G7Z C;  1I3Q B;  4I65 A;  5M5W B;  1F9Q A;  1STE A;  2D62 A;  2IW3 A;  4WJ3 M;  2C35 B;  3BYY B;  1EY4 A;  4IPD A;  1TS4 A;  4OGQ C;  2B2Y A;  4JI8 Q;  3DM3 A;  4DK3 C;  1A6X A;  2Z6K A;  4A3D H;  1JB3 A;  1WCM H;  3PF5 A;  3S9W A;  2F0M A;  4KHP Q;  1BNZ A;  2RSO A;  3D4R A;  3NQI A;  2L55 A;  4HIO A;  1MI2 A;  3PIO A;  1N36 Q;  3KF8 B;  1L0Y B;  1KD1 C;  3K7U C;  3I4N G;  3H09 A;  4L8J A;  2R7D A;  4YCV A;  4GLX A;  3CXC A;  3D6W A;  5ELF A;  3TP8 A;  2IX3 A;  2K01 A;  4JBK A;  4DR7 Q;  2Q2T A;  1VQJ A;  2AKW B;  1ROD A;  4RGN A;  4DV3 L;  4ZUI A;  4DK6 C;  3NK9 A;  1BOS A;  5TSS A;  4RA8 A;  2EYJ A;  1EQQ A;  4DF7 A;  4J6H A;  5C4J B;  2EYP A;  3ERO A;  5FO7 B;  1EIF A;  4CJ0 B;  1NTG A;  2IHF A;  4KLK A;  1VQL A;  1SNM A;  2D0P A;  3P7J A;  1TS5 A;  3TDQ A;  3GDE A;  1DM0 B;  5C5M A;  1AN8 A;  4H0L C;  4R1J A;  1NJI C;  3SEB A;  4DV6 Q;  3L2P A;  5M9O A;  3CCL A;  3CC4 A;  1NY4 A;  2PO4 A;  4F87 A;  2AWN A;  3TZU A;  4LF5 Q;  1VQC A;  1T5X D;  4KKS A;  3K6O A;  2C9O A;  3K5O A;  1A3U A;  4RKL A;  3W1G A;  2QGQ A;  1Q86 C;  2N88 A;  3D6C A;  1M4V A;  3AQQ A;  1N33 Q;  2F52 A;  1G51 A;  3I72 A;  1E1T A;  3HOV H;  3T13 A;  1YNJ D;  2F0S A;  4LFA Q;  1Q7Y C;  3CRL C;  3HOX H;  2B63 H;  3CCJ A;  3S16 B;  3F2U A;  3R3O A;  2UXB L;  1RTN A;  1K8G A;  1TWH B;  4RWS C;  2JA6 G;  1CUK A;  4DV1 L;  4I7A A;  1X3P A;  1TY0 A;  4GKK Q;  3CQZ B;  4AH6 A;  1HR0 W;  4A3M H;  4QUC A;  4L5S A;  2CQA A;  2IJ0 A;  3VDY A;  3RLO A;  4AYB G;  3J80 c;  1FNU A;  2A69 C;  1Q90 A;  2ZM6 Q;  3KDF A;  5AJ3 Q;  2DNC A;  2J0T D;  2HIX A;  2R7Z B;  2EJG C;  2FJ2 A;  5LL6 X;  1LT5 D;  1VQO A;  3MEF A;  3I70 A;  4YWM A;  3CP0 A;  3JAM i;  1UEB A;  3FPU B;  1ZKO A;  1ENF A;  1F2L A;  2NUC A;  3I4O A;  1AP0 A;  2FIN B;  4LAA A;  4DV2 L;  1Y1V B;  4XIG S;  3J7Z C;  2F0V A;  2NVT H;  4DUY L;  1TWF H;  4DV7 L;  2PCF B;  3HOZ H;  1FGU A;  4K6D A;  2KA7 A;  2X69 A;  5C3E B;  3GO5 A;  3M7N A;  5CBE E;  3PQI A;  1H95 A;  1TWA B;  2UUA Q;  2GA4 B;  4C3H G;  3PUW A;  1I50 B;  2JA8 B;  4NKL A;  1ICF B;  5KNB A;  1QJO A;  4DV7 Q;  1SYE A;  2KBN A;  3K0X A;  3BVM A;  1GUO A;  2QW7 A;  1EY7 A;  2BE5 C;  2BH2 A;  5IOD A;  1CA5 A;  1VQP A;  2ZJP A;  2MJ8 A;  4JI4 L;  2TSS A;  3ND8 A;  1JOK A;  2A6H C;  1VQ4 A;  3TN2 A;  4ME5 A;  1YIJ A;  4IUV A;  2RDF A;  2VQF L;  3CD6 A;  1EQT A;  4IPC A;  5ELB A;  2NB0 A;  1STN A;  4OX9 L;  3NTK A;  3P75 A;  1GVP A;  1TWF B;  2MPM A;  2UUC Q;  2HUG A;  4MZ9 A;  5M3F H;  1KDB A;  3OTO L;  1HNZ L;  5M5Y H;  3TBI B;  1SYB A;  3T1Y Q;  1K73 C;  3GTJ B;  2K7V A;  2F0U A;  4CKE A;  1KNE A;  4R4C A;  1U4R A;  1GHJ A;  1Z47 A;  3D31 A;  2K05 A;  4DR5 L;  2ALY B;  2B2W A;  5GAD C;  2KJX A;  1GXD C;  5JPN C;  1E2V A;  3UE0 A;  4A3B H;  2AHO B;  4DV4 Q;  1SEB D;  2CH4 A;  5DM7 3;  2UXB Q;  3S1R B;  1J8I A;  3HOY H;  4FF3 A;  1SLJ A;  5D3I B;  4LF4 L;  1X3F A;  1KAB A;  3SE0 A;  4X3K A;  5IGD A;  2K32 A;  3CPW A;  1P16 A;  2CVR A;  2L12 A;  2I0Q A;  1EY6 A;  3BJU A;  2H1E A;  3F8T A;  5JVG 3;  4LNQ A;  3FDT A;  3J7A F;  3M4O B;  1VMC A;  2B63 B;  5EKL A;  1J9O A;  5CR3 A;  4DV5 L;  2O2L D;  2PI2 E;  3R2T A;  3J81 E;  5DEH A;  1FJG Q;  2JA8 G;  3KUP A;  2WB1 E;  1P8L A;  4LF6 Q;  1PH8 A;  5D65 A;  4YCU A;  5JEA G;  4TSS A;  1E24 A;  2UU9 Q;  2AUK A;  3HS0 C;  1K83 H;  4P72 A;  3VA7 A;  4S3S A;  1DON A;  4GOP A;  4RH6 A;  3E3X A;  3BU2 A;  4JPB W;  2CQO A;  5BN5 A;  1XTD A;  2F0G A;  2PZT A;  1B50 A;  2GVA A;  4DU9 A;  1SFO H;  1S5F D;  4CDF C;  5J3B A;  1MGS A;  1XX8 A;  3HOZ G;  3E0J A;  4C3J G;  1STB A;  3MWY W;  3TSS A;  2ZTD A;  1XNR L;  5BR8 Q;  1IBL Q;  1EQR A;  4FXK C;  1BCP B;  5E4W C;  3X3M A;  3GTQ B;  3IFT A;  1LTT D;  5I9P A;  4NP5 A;  1PZI D;  4AQY L;  1BKB A;  1FD7 D;  2KVM A;  4DR2 L;  1YHQ A;  1SFO B;  3Q23 A;  3I3C A;  1Q82 C;  2KQ3 A;  1E7Z A;  2Z1C A;  1AFP A;  2F0D A;  2UU9 L;  1NSN S;  1U4L A;  1YEZ A;  4C3I G;  3OMG A;  1HHV A;  1SRO A;  3D3R A;  4A3J G;  1D5Z C;  3RNU A;  2NVY B;  4OO1 H;  4WFN 3;  4YHH Q;  3G48 A;  3GV6 A;  1WTV A;  2UXD L;  4WJ4 A;  2RCN A;  1DXM A;  1YBY A;  1SND A;  3A8I E;  2R7F A;  1D5X C;  4KN7 C;  4DKA C;  2NTT A;  4LUV A;  4A3J B;  3QJY A;  2A6E C;  3A0J A;  1F77 A;  3RLN A;  1PRT F;  1G2S A;  1Q12 A;  2Y0S E;  1VQ7 A;  1C4Q A;  2EPB A;  1KQS A;  1CTM A;  4DR3 Q;  1E2Z A;  4MTK A;  1WD1 A;  4GN5 A;  2JK8 A;  1B8A A;  3GTK B;  4KJO A;  2EYL A;  4A3E B;  3KLS X;  1B44 D;  1CKN B;  1CHQ D;  4IUU A;  1F9P A;  1S5D D;  3PSI A;  5KYI A;  1O80 A;  2WKC A;  2E5L Q;  4RAU C;  2E2I B;  1EIH A;  4BS9 A;  1OTC A;  5IYB H;  1KL9 A;  1ASZ A;  1KDC A;  3A74 A;  4Y7N H;  1ET9 A;  2BDO A;  3AB9 A;  1SN8 A;  4H13 C;  2RA4 A;  1JE4 A;  3M4O H;  1IW7 D;  1N34 L;  3DWP A;  1TWC H;  1LYL A;  3E5S A;  1YNJ C;  1I50 H;  2JA8 H;  4B3T Q;  2M2L A;  3DHQ A;  1STA A;  4IZ8 A;  3U58 A;  5JEA H;  1W2B A;  1HFN A;  4LUO A;  4EGV A;  5C3E H;  4X3T A;  1I4X A;  2IPK D;  4EQ5 A;  5I2Y A;  3KLS A;  5EKI A;  2NYZ D;  3QOL A;  2NVT B;  4LF9 L;  1EIG A;  1R4P B;  2RQX A;  2E2H H;  1BUV T;  5LHY 1;  3PIP 3;  4BY1 B;  4JG2 A;  1KDA A;  1TQO A;  1VQM A;  4NW2 A;  1AZQ A;  1NR4 A;  4PZ7 A;  3PIP A;  1GUT A;  2L9H A;  3HOZ B;  3UDG A;  1D1K A;  2Z4I A;  4H7B A;  4OWT B;  2KOL A;  1MKH A;  1B70 B;  4LF5 L;  1SJH D; 
#chains in the Genus database with same CATH homology
 4LF8 Q;  3RR5 A;  1Y1W H;  1QVF A;  2UXC Q;  1XNQ L;  4QY7 A;  4P71 A;  4NXN L;  4QQB X;  1Z9F A;  2VY3 A;  5FJ8 G;  4JI0 L;  2EIF A;  4POF A;  1Q8K A;  4JI7 Q;  4LUZ A;  2A19 A;  4YY3 Q;  1K0R A;  2YV5 A;  2ZTE A;  1HNX L;  4A3E H;  5C0X G;  2R7Z G;  3GTO H;  4A3B G;  4HIM A;  4B3R Q;  1K3R A;  1D7Q A;  1QUQ B;  1PFS A;  3GTK H;  4LF9 Q;  4DR4 L;  3CC7 A;  1J6Q A;  1TWA H;  1XMO Q;  1VQK A;  3OW2 A;  1NMG A;  3M4Q A;  4JI5 Q;  1JJ2 A;  3G6E A;  3CQZ H;  3B6Y A;  3S1N H;  3S2H H;  4JYA Q;  3HKS A;  3J80 i;  2BA1 A;  4R4I A;  2D62 A;  2KEN A;  4DUZ Q;  4WJ3 M;  1KAW A;  1EOV A;  1HH2 P;  1SRU A;  2C35 B;  3G4S A;  1A8V A;  4DV2 Q;  4IPD A;  4LFC L;  3HOW H;  3HOV G;  2PI2 A;  2B63 G;  5GAE C;  1OXX K;  1Y1V H;  2LXJ A;  4GNX C;  1KRT A;  1TWG H;  4JI8 Q;  3DM3 A;  4DK3 C;  4GKK L;  2Z6K A;  3CMA A;  4A3D H;  1WCM H;  5IYB G;  4JI2 Q;  3PF5 A;  3M85 A;  1YJN A;  4DUZ L;  2AWO A;  1PH1 A;  4KHP Q;  2XTI A;  2NZO A;  2HHH Q;  4HIO A;  1YJ9 A;  4DV0 Q;  3PIO A;  4IOC A;  1N32 L;  1N36 Q;  2JA7 G;  3KF8 B;  4A76 A;  1VQH A;  1KD1 C;  3K7U C;  1FJG L;  3I4N G;  4B3R L;  4FDB A;  1N8R C;  4HJ8 A;  1WCM G;  2R7D A;  4B3S Q;  3T1H Q;  4LF6 L;  4YCV A;  4BXX G;  4ALP A;  4DAY B;  4GLX A;  3CXC A;  1WFQ A;  2E2I H;  3A5Z B;  3D0F A;  1XNQ Q;  1S3O A;  4NB3 A;  1IZ6 A;  1Q1E A;  4JBK A;  3S17 H;  3KYH C;  4DR7 Q;  2Q2T A;  1VQJ A;  2JA9 A;  1VQF A;  3E9I A;  3I4N H;  2BA0 A;  1N32 Q;  4MTN A;  2AKW B;  2KCT A;  4APV A;  1VQ6 A;  3F2D A;  1CKM A;  2NVY H;  4DV3 L;  1VQ8 A;  4MNO A;  4B3M Q;  4DK6 C;  3S24 A;  4DPG A;  4A3G H;  5JJL A;  2L15 A;  1PH5 A;  3OTO Q;  4LF7 L;  4YWK A;  4QJF A;  3TRZ A;  4RG1 A;  4A3I G;  1EQQ A;  1VS0 A;  2ASB A;  1E3P A;  1T9H A;  2KHJ A;  3KF6 B;  2I5M X;  5K36 G;  1CKO A;  1JMC A;  1EIF A;  1WYD A;  1WI5 A;  1NTG A;  1KRS A;  1IXR A;  2WAQ E;  3HFZ B;  3I56 A;  2IHF A;  4YWL A;  4KLK A;  4L5T A;  2Q2U A;  2D0O A;  1VQL A;  2ATW A;  4A3K H;  2D0P A;  1E1O A;  3GTQ H;  1QVC A;  1HZB A;  1FL0 A;  1VQE A;  1X65 A;  2R6G A;  3GDE A;  4JBJ A;  5GAH C;  1A0I A;  1MIU A;  4GOP B;  4R1J A;  4LF7 Q;  4Y52 H;  2R93 G;  1NJI C;  4DV6 Q;  3L2P A;  3JAM c;  3CCL A;  3CC4 A;  1HZC A;  2JA5 G;  4A3C H;  1NY4 A;  1O7I A;  4IJH A;  1IBK Q;  3S1M H;  1JJG A;  2K75 A;  2AWN A;  4A3L G;  4P73 A;  3HOU G;  3M3Y H;  4DR6 Q;  1SE8 A;  4LF5 Q;  2Z6K C;  3RZO H;  4JI3 Q;  2NN6 G;  1Y1W G;  2UUB Q;  1HNZ Q;  1VQC A;  3J81 i;  1TXY A;  4AYB E;  1V43 A;  4UPA A;  1UE7 A;  2YTV A;  4DAM A;  4C2M H;  2H5X A;  2LXK A;  3AFQ A;  1RIP A;  3W1G A;  4LFA L;  3E0E A;  2IX0 A;  2NZH A;  2OWO A;  2QGQ A;  3CCM A;  1Q86 C;  5IWA L;  5AJ3 L;  2UUC L;  4BY1 G;  3F1Z A;  3PO3 H;  2ZM6 L;  3AQQ A;  1N33 Q;  1QUQ A;  1ASY A;  2F52 A;  2E2J H;  1G51 A;  4L5R C;  1E1T A;  3TEH B;  5M3F G;  3HOV H;  2K14 A;  4LFA Q;  1XJV A;  1Q7Y C;  3HOX H;  1VQG A;  3CCJ A;  4BA1 I;  5IE8 A;  2B63 H;  1Y1V G;  2WFW A;  3H3V I;  2UXB L;  4X66 L;  1K8G A;  3PUY A;  2RHQ B;  5FJ8 H;  3L7Z C;  2JA6 G;  4P75 A;  4QL5 A;  1YIT A;  3CCS A;  1CUK A;  3TQY A;  4DV1 L;  1BVS A;  4A3E G;  1A62 A;  4GKK Q;  1M1K C;  2UUB L;  1GO3 E;  1YHB A;  1GM5 A;  2PQA A;  1X6O A;  4AH6 A;  4DR5 Q;  1HR0 W;  4BBR H;  4A3M H;  3CCQ A;  4JI5 L;  3FP9 A;  2JA7 H;  1IBK L;  2JA6 H;  1YNX A;  4L5S A;  4DUY Q;  2F4V Q;  1QZG A;  2GVB A;  1I6H H;  3VDY A;  3RLO A;  4AYB G;  3J80 c;  2EXD A;  2CCZ A;  4GLA C;  1UE6 A;  3HOW G;  1PA6 A;  4HJA A;  3L0O A;  4BBR G;  3KDF A;  2ZM6 Q;  3TS2 A;  5AJ3 Q;  2FXQ A;  3PF4 A;  1VQA A;  4OON A;  2HIX A;  3S1Q H;  1Q1B A;  1V1Q A;  5IYD G;  2I5L X;  4JI7 L;  2E8G A;  4RMF A;  3UDF A;  2MFI A;  3MEF A;  1VQO A;  5ELN A;  3AFP A;  3ICE A;  4YWM A;  3CP0 A;  4JBM A;  1PH4 A;  2IY5 B;  2WB1 G;  3JAM i;  3JC6 6;  4QIW E;  1UEB A;  1UE5 A;  3I4O A;  4B3M L;  2MO1 A;  2ZJQ A;  5EAY A;  2ID0 A;  4A3I H;  3KF6 A;  1N9W A;  2JQO A;  1PYS B;  4HIK A;  3KLW A;  4DV2 L;  2OQK A;  1J5E L;  4XIG S;  3J7Z C;  3UDX A;  4LFB L;  2NVT H;  4DUY L;  1TWF H;  5E7N A;  4DV7 L;  1QVG A;  3HOZ H;  1VQD A;  1FGU A;  1XPO A;  3GTG H;  5C44 H;  1VQ5 A;  1EFW A;  3I4M H;  1GD7 A;  2CWP A;  3GO5 A;  5C0X I;  3M7N A;  3NEN A;  2CKZ B;  4R4O A;  4DV6 L;  1H95 A;  1XMQ Q;  5LMN L;  2UUA Q;  4IFD J;  3PUW A;  4PG3 A;  3F2C A;  4A3G G;  3CC2 A;  3J81 j;  5C44 G;  4DV7 Q;  2VW9 A;  3GTM H;  2KBN A;  3K0X A;  1VQI A;  1BBU A;  3S1R H;  3NBH B;  1EIY B;  4LFC Q;  2A8V A;  3RLF A;  5FLX c;  3GTL H;  1Y14 B;  4JI1 L;  3HKZ E;  5C4X H;  4IO9 A;  2BH2 A;  1JJC B;  3FKI G;  5IT9 c;  2ZJP A;  5LMN Q;  1CSP A;  1VQP A;  4JI4 L;  3CPF A;  4HJ5 A;  1VQ4 A;  4JYA L;  2CFM A;  1YIJ A;  2JEB I;  1UWV A;  1MJE A;  2OCE A;  4O0A A;  2VQF L;  3CD6 A;  4IPC A;  2RHS B;  3AYH B;  1HZ9 A;  4OX9 L;  4YY3 L;  5IP7 G;  3H3V H;  2JA5 H;  3Q8D A;  4JI0 Q;  1Q46 A;  3ZJY C;  2YTX A;  1GVP A;  3S2D H;  4DNI A;  5GQO A;  2GN5 A;  5IWA Q;  2UUC Q;  4MZ9 A;  1N33 L;  4A3L H;  3GTJ H;  5M3F H;  3UE1 A;  3OTO L;  1HNZ L;  2JJQ A;  4R4Q A;  5M5Y H;  4GS3 A;  2VQF Q;  3HOX G;  1LUZ A;  2YYZ A;  3I7F A;  1OTC A;  4DV0 L;  3T1Y Q;  1K73 C;  1OXV A;  5IP9 H;  1HR0 L;  2Q2I A;  3I55 A;  4JOI C;  2HQL A;  3WWV A;  4BBS G;  3H0G G;  3NEM A;  3KJO A;  4YHH L;  1MJC A;  4R4C A;  1PH6 A;  1Z47 A;  4OO1 G;  3U4V A;  3D31 A;  3I2Z A;  1EWI A;  4JI8 L;  4QGU A;  2QA4 A;  1AE3 A;  3ER0 A;  4BY1 H;  4DR5 L;  3S15 H;  3W1B A;  1S40 A;  2ALY B;  2F3I A;  5GAD C;  5C0X J;  1PH3 A;  3PV0 A;  4PZ6 A;  1AE2 A;  3OYY A;  3UE0 A;  4A3B H;  2AHO B;  4A93 H;  2F4V L;  4DV4 Q;  1HNW Q;  2UXB Q;  1N36 L;  2PNH A;  4DR2 Q;  3HOY H;  4JBW A;  3KJP A;  2OTL A;  1XMO L;  4KHZ A;  3PUX A;  4DR4 Q;  1SLJ A;  4LF4 L;  5ELO A;  1HZA A;  3M9B A;  1X3G A;  1X3F A;  2K5V A;  4OWW B;  5IYD H;  1PV4 A;  1R9T H;  1U5K A;  3MXN B;  3ULP A;  3PO2 G;  3AEV A;  4NXN Q;  1FVI A;  3CPW A;  1P16 A;  1YVC A;  2I0Q A;  1VQB A;  4XTC S;  4PZ8 A;  3BJU A;  3F8T A;  4LNQ A;  2R92 G;  3CME A;  4A75 A;  2NVX H;  1HNX Q;  1IL2 A;  3FHW A;  4YCW A;  5GRO A;  1XPR A;  2N49 A;  4GNX B;  1L0W A;  3PO2 H;  4UP8 A;  1IBM Q;  2DUD A;  4HJ7 A;  2UXC L;  2IX1 A;  3T1Y L;  4DV5 L;  5JJK A;  1SR3 A;  2PI2 E;  2R92 H;  5M3M H;  1FJG Q;  2WP8 J;  1IYJ B;  2B3G A;  2AMC B;  4TVA B;  2K5N A;  2JA8 G;  3U50 C;  3KOJ A;  4AQY Q;  2WB1 E;  2K5H A;  4B3S L;  1P8L A;  3LGJ A;  3T1H L;  4LF6 Q;  4UP7 A;  1PH8 A;  1VCI A;  4O2D A;  4YCU A;  3CF5 A;  5JEA G;  1KXL A;  1V9P A;  1E24 A;  2UU9 Q;  3KDF B;  1JT8 A;  1YJW A;  1EUJ A;  1K83 H;  2N8N A;  4P72 A;  3U4Z A;  4LF4 Q;  5M3M G;  4DV5 Q;  5BR8 L;  4GOP A;  4C3J H;  2KCM A;  1IBL L;  1JB7 A;  1GKH A;  4POG A;  3BU2 A;  4X62 L;  2CQO A;  4OO1 I;  1XTD A;  4KHP L;  2GVA A;  2VQE Q;  2R93 H;  2HHH L;  1C0A A;  3K80 C;  1SFO H;  1KC8 C;  4JI1 Q;  4BY7 H;  3CCU A;  2ZTC A;  3STB D;  1X55 A;  5J3B A;  1SMX A;  4DR6 L;  2Q2H A;  1J5E Q;  3HOZ G;  2E5L L;  4GKJ L;  4IPG A;  1G6P A;  4H02 A;  5IYC H;  1U0L A;  2ZTD A;  3PGZ A;  5BR8 Q;  1EQR A;  3DLL A;  1IBL Q;  1XNR L;  1L2F A;  4AIM A;  1RL2 A;  1XMQ L;  2UUA L;  4HID A;  5IP7 H;  2Y0S G;  1XPU A;  4X66 Q;  3BZK A;  3PUV A;  1TWH H;  5FLM H;  4AQY L;  1BKB A;  1CSQ A;  4A3J H;  1YZ6 A;  4DR2 L;  3ULJ A;  1YHQ A;  4K0K L;  5IYC G;  5HGQ A;  1Q82 C;  3S14 H;  1E7Z A;  3CCV A;  3S16 H;  2UU9 L;  2VNU D;  3EBE A;  3FKI H;  2MQH A;  4X64 L;  5IP9 G;  3G71 A;  1YEZ A;  2VZA A;  4UY8 C;  1YI2 A;  1PVO A;  2YTY A;  1NBW A;  1SRO A;  3ULL A;  1OXT A;  1KIX A;  1W3S A;  1Q81 C;  4A3J G;  4NPS A;  3RNU A;  1N34 Q;  2N78 A;  3RN5 A;  4K0K Q;  3E9H A;  4YHH Q;  1K8A C;  2VS1 A;  1B7Y B;  3G48 A;  1I94 L;  4GKJ Q;  1K9M C;  2UXD L;  2RCN A;  4JCV E;  4C3I H;  1X9N A;  4WJ4 A;  1YBY A;  2OQ0 A;  4GN4 B;  1WJJ A;  2LSS A;  3J81 c;  1L1O A;  4DV1 Q;  2OTJ A;  2R7F A;  1XNR Q;  4JOI A;  4A93 G;  2CWA A;  4DKA C;  2NN6 I;  1X54 A;  2VQE L;  2HT1 A;  4DR7 L;  3K81 C;  3ERS X;  4JC0 A;  3W5O A;  3HOY G;  5LMU L;  4LUV A;  3K8A A;  4LWC A;  5GAG C;  1S72 A;  2MO0 A;  3A0J A;  3SGI A;  3NEL A;  2VUM H;  3RLN A;  1C9O A;  1E22 A;  3RZD H;  1PH7 A;  4BBS H;  1WOC A;  4X6A H;  2Z0S A;  3H0G H;  4OXP A;  1Q12 A;  2Y0S E;  1I3Q H;  5M5W H;  3RN2 A;  1VQ7 A;  1DGS A;  1KQS A;  3HKZ G;  4DR3 Q;  2ES2 A;  1EYG A;  1PH2 A;  5LMU Q;  1I5F A;  1BBW A;  1B8A A;  2JK8 A;  2KHI A;  4GN5 A;  4IJL A;  4LFB Q;  3A5U A;  2VUM G;  4GNX A;  1CKN B;  1NE3 A;  4BXX H;  4R4T A;  5H1S E;  1G29 1;  4B3T L;  2WAQ G;  4NXM L;  4GLV B;  2I5H A;  1CKN A;  2BH8 A;  3PSI A;  5C4J H;  4A3M G;  4OWX B;  1I94 Q;  2UXD Q;  1D8L A;  2B29 A;  2K4K A;  2E5L Q;  1VQN A;  4DR3 L;  4KI0 A;  3CW2 C;  2RF4 A;  4J15 A;  4BA2 I;  4A3D G;  3EN2 A;  5DLQ E;  3STB C;  1KL9 A;  5HY6 A;  5IYB H;  1PHJ A;  1HR0 Q;  1ASZ A;  2DGY A;  2NVQ H;  4A4I A;  5IY0 A;  3M4P A;  4P74 A;  4EX5 A;  1QZH A;  4JI6 L;  4OX9 Q;  3A74 A;  2QEX A;  2VL6 A;  3CCE A;  2ZJR A;  3CAM A;  1X3E A;  1NMF A;  4GN3 B;  4JV5 L;  4Y7N H;  1M90 C;  3IRB A;  3GD7 A;  1IBM L;  3H15 A;  4L5Q A;  3EIV A;  4X64 Q;  2YU9 H;  1SN8 A;  2JE6 I;  3TRE A;  4UP9 A;  5JJI A;  1PYB A;  1HJP A;  4BY7 G;  3M4O H;  1KHI A;  4DR1 L;  3PUZ A;  1N34 L;  4A3K G;  4TQU S;  1TWC H;  1LYL A;  4NXM Q;  1L1O B;  1I50 H;  1OXS C;  4B3T Q;  2JA8 H;  3UDI A;  1VQ9 A;  1L1O C;  4JI2 L;  4HJ9 A;  2IT1 A;  2V1C C;  3U58 A;  1W2B A;  1A63 A;  4LUO A;  5C3E H;  1OXU A;  4X62 Q;  5FLM G;  4X65 L;  4EQ5 A;  3TS0 A;  5JEA J;  4DR1 Q;  3HOU H;  3J7A 5;  4IFD G;  3F2B A;  4LF9 L;  1PH9 A;  3KFU A;  4ME3 A;  4A3F G;  4JI6 Q;  2K52 A;  4PMW A;  1LTL A;  2K50 A;  3GTP H;  4C3H H;  5C3E G;  2E2H H;  1YHA A;  1AH9 A;  2MNA A;  4JV5 Q;  2PMZ E;  4IFD I;  4JG2 A;  4X65 Q;  2JEA I;  4LW1 A;  2HIV A;  3PCO B;  2A1A A;  3K7A H;  2EQS A;  4DV4 L;  4IPH A;  1VQM A;  4LF8 L;  4IOA A;  1HNW L;  1UE1 A;  5M5X H;  4A3F H;  4PZ7 A;  5C4X G;  3PIP A;  2IHE A;  3I4M G;  3PO3 G;  4DV3 Q;  4A3C G;  1JE5 A;  3UDG A;  2N3S A;  3BZC A;  2XGT A;  1LM0 A;  4JI4 Q;  1C7Y A;  4OWT B;  1MKH A;  2R7Z H;  1X56 A;  1B70 B;  2PQA B;  3CCR A;  4LF5 L;  4JI3 L;  4GOP C;  5LMN W; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...