4JI1L

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
124
structure length
123
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKLLGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 14
structure length 123
sequence length 124
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4ji1L00
3RLNA 3OTOL 2JEAI 4A3GG 2VNUD 2AHOB 3K80C 3CF5A 4AQYQ 4BBRH 4DUYL 3CC2A 2WB1G 2Y0SE 2B29A 3NELA 3RLOA 3A5UA 1VQ4A 1JJ2A 2JE6I 1VQMA 5JJLA 1E3PA 4GS3A 4OO1G 3GTKH 3UDIA 2VS1A 3FP9A 4X65Q 3CCQA 1YIJA 1N8RC 4LFAL 4A3LH 4X6AH 2MO1A 4NXMQ 3RNUA 2JA6H 1P16A 3CCEA 4QL5A 4B3TL 1Y1VH 2B3GA 3CCSA 1TWFH 4P74A 4HJAA 4JI0Q 2EQSA 4B3RL 5ELNA 3HKZE 4JI4L 4XTCS 2VQEQ 4QJFA 2D0OA 1X56A 3BZCA 4LW1A 2C35B 2OCEA 4HJ7A 3I4NH 4IFDI 4DV4Q 4LF9Q 4R4IA 1VQNA 2KCMA 3FKIH 4BA1I 1VQCA 1R9TH 4JI3Q 4LF7Q 4NXNQ 4H02A 1EFWA 4LWCA 3IRBA 3HOXG 1KIXA 2EIFA 1YHAA 3JAMc 3UE1A 3GTQH 1FL0A 2VL6A 4YWLA 1HNZL 2A8VA 4DR4L 4BXXG 3ER0A 4RG1A 2R92G 4GKKL 3W1GA 4YWMA 2YTVA 3UE0A 4GNXA 3RN2A 1YBYA 2UUBL 4LNQA 2A1AA 4JI8L 3HOYH 1PVOA 4JI2L 2PI2E 1PH3A 3PIPA 1I3QH 2N8NA 5IP9H 1J5EL 2OWOA 2R7ZH 3I4MG 1C9OA 1WOCA 1LYLA 5C3EG 1E22A 4L5TA 4DK3C 1Q12A 3PV0A 4UP8A 1Q7YC 4DR3Q 3HOWG 2JA9A 1VQ8A 1K8GA 2VUMG 2K14A 4DAYB 5IT9c 4A3MH 1EOVA 1HZBA 1V9PA 1VQBA 3T1HQ 1YJWA 1HNXL 2ES2A 4JI7L 1N32L 1SE8A 3JC66 4KHPL 2K5NA 2N49A 1IZ6A 3HOUH 1B7YB 1Z9FA 1VQ6A 2IX1A 3B6YA 1WI5A 1X55A 5M3FH 1Q86C 1MIUA 1L1OC 4P71A 3M4OH 3JAMi 3AQQA 4A3IG 2DGYA 1HZAA 2MFIA 3GO5A 4BY7G 1K9MC 4P73A 1GKHA 4DR2L 1AE2A 1K0RA 3KLWA 1WYDA 3PUZA 3A74A 3RN5A 1CSQA 1TXYA 4OXPA 2F4VQ 1MJCA 2UXDL 4UP7A 2HIXA 1G6PA 2A19A 3M3YH 2E8GA 3PF4A 2ID0A 4AIMA 4X62Q 3UDFA 4XIGS 4A3FG 5GAEC 4GOPB 2NVTH 3GTJH 1BVSA 2NVYH 3CP0A 1OXVA 3J7ZC 1HR0Q 3GTGH 2R93H 3PUVA 2OQKA 4AYBE 4DV1Q 4IOAA 3U4ZA 4C3HH 2AWNA 1Y1WG 1XNQQ 1L1OA 2ATWA 3E9HA 4GKJL 5ELOA 4LF8L 3KF6B 4JBKA 5LMNW 2WB1E 2WAQG 4JI1Q 1CKMA 1JB7A 1CSPA 4DUZQ 3M9BA 4GN3B 4A3BG 4A3GH 1K3RA 2UUAL 3F2DA 3OTOQ 2OTJA 1YNXA 2CKZB 3G6EA 3KJPA 4DUYQ 3PUXA 4LFBL 4DV2L 1TWHH 3EN2A 1U0LA 1VQGA 2I5LX 1XNRL 1K8AC 4GN5A 1I94L 2JA5G 4OX9L 3S1MH 4IFDJ 4NB3A 1A62A 1D7QA 5C44G 1TWGH 2HIVA 2VW9A 3NBHB 4DV0L 3TQYA 4LFAQ 1PH8A 2UXBQ 5C0XI 2ZJQA 5LMNL 5JJIA 4O2DA 4IFDG 3L0OA 1SMXA 2HQLA 3I2ZA 1XJVA 3ULJA 1O7IA 1QVCA 4DV7L 3H3VH 4NPSA 4B3SL 2L15A 4B3TQ 1VQLA 4B3RQ 1OTCA 4DV3L 1KHIA 1SFOH 1Q81C 2NVXH 1UEBA 1FGUA 5IYCG 3A0JA 1VQOA 1PH5A 4JBJA 4HIOA 1S72A 1A63A 1QZHA 4L5SA 2Q2IA 1L0WA 2QGQA 4YHHL 4LF4L 1LTLA 5GADC 1IBKL 2IT1A 3HKSA 4B3ML 3S14H 2BA1A 4UP9A 1G291 2NN6I 5FJ8G 4IPGA 2JA8G 1QVFA 4BXXH 1HNZQ 2R92H 1JT8A 4GLXA 4DR4Q 1EWIA 1PYBA 1IBLL 1NE3A 2VQFL 2YTXA 2E5LL 2JQOA 3M4PA 1YI2A 4TVAB 1EQQA 3RZOH 1OXXK 1XTDA 2HT1A 1I50H 2UUBQ 3HOZH 4A76A 4JI8Q 3KOJA 4DK6C 4JI2Q 1SROA 3T1YL 3TS0A 4PZ6A 3I4MH 1J5EQ 5C3EH 5M5XH 2IX0A 1QZGA 1B70B 5GROA 4OWWB 1N34Q 1LM0A 4IO9A 1LUZA 2Z0SA 3F8TA 3HOWH 3W5OA 4IOCA 2Q2UA 3A5ZB 1KAWA 2R93G 4AQYL 2VUMH 1NMGA 2QA4A 2IHFA 4JC0A 2CCZA 4OX9Q 1HNXQ 1E24A 3K7UC 1PH1A 4QGUA 1RL2A 2YU9H 4JI7Q 2JK8A 1N32Q 2D62A 1L2FA 3NEMA 2LXJA 4C3JH 3CQZH 4GNXB 3GTOH 1Q46A 1PHJA 2VZAA 3L7ZC 4A93G 4A3IH 1HH2P 2AKWB 1NTGA 1CKOA 2KHIA 3ULLA 1YITA 4A3LG 4BY7H 3S2HH 3PO3G 2MO0A 3L2PA 3F2BA 1GVPA 2Q2TA 3CMAA 5E7NA 5AJ3Q 4JBWA 2JA6G 2NVQH 4RMFA 1SLJA 1U5KA 4JI6L 5FLMG 3CCJA 1C7YA 4JI0L 1JE5A 2ZJPA 3S1QH 2VQEL 4BY1G 1X6OA 3Q8DA 5EAYA 2F52A 1WCMG 4YCUA 3U4VA 5BR8Q 1EYGA 1VQ7A 2KENA 4DKAC 5IWAQ 1BBWA 4LFCQ 2UUCL 2UXDQ 3NENA 1QUQA 1XMQQ 1JJCB 4MNOA 3U58A 4FDBA 3S17H 4A3CG 4JV5L 3D31A 3DLLA 1KXLA 2R7FA 4NXNL 1A8VA 4DV6L 4A3FH 3S16H 3TREA 2LXKA 2WAQE 5IP7G 3H0GG 4HJ9A 4JOIC 4KI0A 1MJEA 4GOPC 1FJGL 3ICEA 3TRZA 2RHQB 4DR6L 1Y1WH 1KRSA 4LF5L 1CKNA 3EBEA 4LF6Q 4L5QA 1VQHA 4JG2A 4LF8Q 1N9WA 3G71A 1VQDA 1T9HA 5C0XJ 1WFQA 3PSIA 4IPCA 1I6HH 1HNWL 3KFUA 4JYAL 1VQPA 2JJQA 1NJIC 1P8LA 2UXCL 1G51A 3MXNB 3STBD 3WWVA 5IYDG 4A3KG 3S15H 4DUZL 5LMUL 5C0XG 3I55A 4DV2Q 3CMEA 4Y52H 2R6GA 3PGZA 1ASZA 2JA5H 1QVGA 1XNRQ 1I94Q 2JA7G 2N78A 3UDGA 2PMZE 2OQ0A 1EIYB 1XPUA 5C44H 4KLKA 3VDYA 4YY3L 1HZCA 1VQIA 3ULPA 4DV0Q 2K50A 2K75A 5LMNQ 4A3EG 1N36L 1HR0W 1PH9A 2PQAB 3BJUA 3J80c 1VQAA 4X64L 3M7NA 2ALYB 2ASBA 4GN4B 5IYBG 4B3SQ 3OYYA 3AFPA 3E9IA 4IPHA 3CCRA 1IBML 4DV3Q 2CWAA 3KF6A 3GTLH 2UU9L 1KL9A 2K4KA 2HHHL 4KHZA 2NZOA 3PUWA 4C3IH 4A3DG 4PMWA 4LUOA 1WJJA 2H5XA 1IXRA 4O0AA 1W3SA 2EXDA 3AYHB 1HZ9A 2RCNA 3EIVA 2YV5A 3KDFB 4YHHQ 4A75A 1PYSB 1IBKQ 1MKHA 4LF4Q 4HJ8A 2PNHA 2B63G 1IL2A 5FJ8H 3DM3A 3PIOA 1AE3A 2RF4A 2JA8H 2E2IH 4BBSG 1E7ZA 4WJ4A 1S40A 4ALPA 1KQSA 3W1BA 5C4JH 1XPRA 3MEFA 4HIKA 1IBLQ 4DR7L 3F1ZA 2BH8A 2VQFQ 4JI4Q 4DV5L 5J3BA 1IYJB 2AWOA 1X3FA 4DR5L 2MNAA 3AFQA 1Q8KA 2LSSA 2ZM6L 4YWKA 3T1YQ 3S24A 2I0QA 3TEHB 1X54A 4YCWA 3HOXH 3OW2A 3J80i 1VQKA 3CW2C 4DAMA 1OXUA 4R4CA 2K5HA 3M85A 2YTYA 1BKBA 2IHEA 3GD7A 4LUZA 4R4QA 3CCVA 4DR1L 1BBUA 2MQHA 2Q2HA 4LUVA 3CCUA 1KD1C 4GKKQ 3PUYA 1YHBA 1PH7A 4OWXB 2ZJRA 3HOVG 3KYHC 1AH9A 3GDEA 4R4TA 4X66L 1NMFA 3BZKA 2I5HA 1Q1BA 1N33L 5C4XG 1RIPA 5M3MG 2GN5A 3PO2G 1VQ5A 2CFMA 1XMOL 4AH6A 3KJOA 4A3JG 1E1TA 4POGA 2WFWA 3S2DH 4K0KL 2CQOA 4A93H 4JI5L 1X3EA 4GNXC 5H1SE 3FHWA 2UXBL 1K73C 1D8LA 3PO3H 1I5FA 3J7A5 1UE1A 4BBRG 5FLMH 1Q82C 2E2JH 4J15A 4JI6Q 4IJLA 1X9NA 3CC7A 4BY1H 3U50C 4KHPQ 1WCMH 3HFZB 2XTIA 1B8AA 3CPFA 4UPAA 1V43A 2F3IA 1ASYA 2UUCQ 1EUJA 2Y0SG 5M5WH 4X65L 1SRUA 3CXCA 1GM5A 1VS0A 3K7AH 5DLQE 4A3CH 1C0AA 4DPGA 1VQEA 2XGTA 3SGIA 2D0PA 3STBC 1UE6A 2QEXA 4NXML 4DV6Q 4JV5Q 4DR2Q 1A0IA 5GAHC 3CCLA 1HJPA 3I7FA 5IP7H 2Z6KC 3H0GH 4A3BH 4PG3A 5K36G 4P72A 1FJGQ 3RR5A 4PZ8A 4EX5A 3CD6A 1Y1VG 3GTMH 5HGQA 2VY3A 1YVCA 4OO1I 4QQBX 4WJ3M 4LF5Q 1M90C 5M5YH 1H95A 1VQFA 3F2CA 4HIMA 1PA6A 4MZ9A 1PH2A 1VCIA 3E0EA 5IE8A 3HOZG 1TWCH 4JBMA 2N3SA 4DV4L 3CAMA 4LF9L 3I4NG 4APVA 1Z47A 1UE7A 1PV4A 1HNWQ 4JI3L 4LF7L 3HKZG 4JYAQ 3FKIG 3H3VI 1K83H 4PZ7A 1N34L 4Y7NH 2UXCQ 1QUQB 2FXQA 2GVBA 1NY4A 2ZTCA 1CUKA 4JCVE 4A3KH 1W2BA 5JEAJ 5IYDH 2V1CC 3BU2A 4GLVB 5LMUQ 1NBWA 3K0XA 2E2HH 2JA7H 1SR3A 3J81c 2GVAA 4GKJQ 5IY0A 3ERSX 5JEAG 1JJGA 1UE5A 3HOYG 1CKNB 4OONA 2K52A 4YY3Q 1YZ6A 2Z6KA 1DGSA 3I56A 4EQ5A 5IP9G 1V1QA 3CCMA 4A3EH 4C2MH 2R7ZG 3RLFA 1YJ9A 1N36Q 3S1RH 3AEVA 2UUAQ 4X64Q 1VQJA 3LGJA 1Q1EA 4R4OA 4R1JA 5IYBH 4DR3L 4LFBQ 5AJ3L 3CC4A 4QIWE 1IBMQ 1GD7A 1PFSA 1X65A 4HJ5A 1XPOA 3T1HL 2UU9Q 2HHHQ 4A3MG 4A3DH 4DNIA 1M1KC 1SN8A 5BR8L 3S1NH 3M4QA 1L1OB 5IWAL 3HOUG 5JJKA 4QY7A 5GQOA 4LFCL 4BA2I 2B63H 5M3FG 4JOIA 4MTNA 4GLAC 4YCVA 2ZTDA 4P75A 2BA0A 4A4IA 4GOPA 1XMQL 1YHQA 1JMCA 2YYZA 3D0FA 3J81j 2K5VA 1KRTA 1VQ9A 4BBSH 2PI2A 1S3OA 4DV7Q 5HY6A 1OXSC 4OWTB 4DR7Q 2NN6G 2R7DA 3J81i 5IYCH 3ZJYC 1YJNA 2CWPA 4DV5Q 5GAGC 1X3GA 2WP8J 4DR5Q 1YEZA 4LF6L 2DUDA 1TWAH 2F4VL 3UDXA 4ME3A 1EIFA 1GO3E 2ZM6Q 1UWVA 3PCOB 2I5MX 2PQAA 4B3MQ 2AMCB 5FLXc 3H15A 4L5RC 3CPWA 2OTLA 3PF5A 4X62L 1EQRA 3G48A 4DR6Q 4DR1Q 4POFA 1HR0L 2E5LQ 2KCTA 2RHSB 3KF8B 1PH6A 3HOVH 1FVIA 2BH2A 1OXTA 2KBNA 4DV1L 3RZDH 3I4OA 4X66Q 2ZTEA 5C4XH 1XNQL 5M3MH 4IPDA 1N33Q 3PO2H 3TS2A 3K81C 3KDFA 4A3JH 1XMOQ 4TQUS 1KC8C 4UY8C 1E1OA 4JI1L 3GTPH 1J6QA 2JEBI 2KHJA 4K0KQ 4JI5Q 3G4SA 4HIDA 2NZHA 4AYBG 2IY5B 4IJHA 1Y14B 3K8AA 1PH4A
chains in the Genus database with same CATH superfamily
2VNUD 1SNPA 4MN3A 2AHOB 5AFWA 5EPLA 3CF5A 4AQYQ 4BBRH 1SYFA 4C56C 2WB1G 2O5JC 2NVTB 4EGVA 2K5QA 1VQ4A 5JJLA 1E3PA 4OO1G 1D6EC 2VS1A 3QIAA 3UDIA 1YIJA 5NUCA 3I3CA 1CHQD 5K36H 3M4YA 1P16A 5JOBA 4B3RL 1F9RA 2WB1B 3OWEB 3HOVB 3HKZE 1DONA 4XTCS 2VQEQ 4QJFA 3RZDB 3BZCA 1X3PA 1QB5D 4A3JB 4R4IA 1D5ZC 1TT2A 4BA1I 1R9TH 1VQCA 4LF7Q 3QG1A 4IUUA 1EFWA 4LWCA 3IRBA 3HOXG 2BDOA 4RGTA 1FL0A 3K58A 1EYCA 4RG1A 1XTCD 2R92G 3W1GA 1F2YA 2UUBL 2A1AA 4JI8L 1RJTA 3RD4A 5I6YA 2EY2A 2PI2E 1PH3A 3PIPA 1JCKB 2N8NA 2Y0SB 5IP9H 1IL8A 1E22A 4L5TA 4XQQA 1VQ8A 1YJWA 4KHPL 1LT6D 1C48A 2K5NA 2EYFA 2MPMA 1IZ6A 4F87A 1RD9D 5DNFA 2IX1A 1G8ZD 3HOZB 1Q86C 1L1OC 3J7YW 2D5DA 3JAMi 1B3QA 2MFIA 4BY7G 1SAPA 1UAPA 4RWSC 1RKNA 2HDLA 1QWYA 1STNA 1PRTC 4FF4A 1LACA 1R4QB 3KLWA 3A74A 2MJ8A 4H13C 5L37A 1WTPA 1MJCA 5CV7A 1O80A 1SNQA 1QE6A 2KCNA 4CKBA 2ID0A 1HUMA 1DJRD 4ZQ3A 4XIGS 4BY7B 4KN4C 2NVYH 3J7ZC 1OXVA 1HR0Q 1KNAA 3QWNA 4AYBE 2JXMB 1Y1WG 5ELOA 3KF6B 1STAA 2WAQG 4JI1Q 1LT5D 3MTSA 1BBXC 1ILQA 1RF2D 1EWCA 4DUZQ 2CVRA 3K57A 2AQ3B 3F2DA 3T56B 5J22A 2CKZB 4LFBL 2MP1A 3KJPA 4DUYQ 2QDBA 1VQGA 1HTPA 3BVZA 4ILWA 5EKIA 3SEBA 3S1MH 3NTIA 4K5WA 2B2VA 2G9DA 1RTNA 1H9RA 1TWGH 1SMYC 2O4XA 2WAQB 3D4DA 5LMNL 1CA6A 3M3YB 5JJIA 3NBIA 1V1PA 2HQLA 4FNFA 1QVCA 4NPSA 1FNUA 1MBYA 1VQLA 1OTCA 3GTGB 4M1UB 1SFOH 1Q81C 2NVXH 5IYCG 4J6HA 1VQOA 4C3HB 1YNND 4JBJA 1S72A 1QZHA 2Q2IA 1JWUD 1TU2B 4YHHL 2IT1A 3HKSA 1ICWA 4FVMA 1EY9A 2NN6I 1STEA 3CRLC 4ZYSA 4DR4Q 1IKMA 1IBLL 2VQFL 3M4PA 1EQQA 4IUPA 3RZOH 3D8GA 3GTLB 4DK6C 5EPJA 2QCPX 1ILPA 3EFXD 3J7AV 3BZDB 1HHVA 1B70B 1TKWB 2L1BA 3MFYA 3HOWH 4AQYL 3WOFA 1FNVA 5KYIA 1HNXQ 4G7OC 5DM63 4L8JA 2D62A 4XQNA 5D3DA 1O7ZA 3CQZH 3GTOH 3N6RA 3L7ZC 4A93G 2NZ1D 1HH2P 3FPUB 1CKOA 1TIID 1X3QA 5IIFA 4A3LG 3PO3G 2TSSA 5AJ3Q 4JBWA 2NVQH 2E74C 4Q5VA 1U5KA 4FP5D 1C7YA 1JE5A 4K8JA 2VQEL 3C46A 1X6OA 3U4VA 1WCMG 4DKAC 5IWAQ 4FF1A 4LFCQ 3MWYW 2UUCL 2UXDQ 3VR4A 1QUQA 1JJCB 4MNOA 3U58A 1UEAB 4JV5L 4A93B 2RA4A 3X3MA 4A3FH 2RKSA 3S16H 3KBGA 2I07B 2LXKA 4K2LA 2R3ZA 3X3NA 2VUMB 4FF2A 1KRSA 2K01A 1IW7D 3OIPA 1VQHA 2BDNA 5FOBB 4LMQD 4DNTB 1VQDA 3FRPB 5C0XJ 1WFQA 3PSIA 1I6HH 4ABNA 4A3IB 1P8LA 1NJIC 2MHVA 1EEFD 1CM9A 5IYDG 2LKVA 1LLRD 1TS5A 5LMUL 1AEXA 2EDGA 1KTKA 3PGZA 1EY6A 2JA5H 1QVGA 3E5SA 3S1QB 1I94Q 2OQ0A 5C44H 4KLKA 1S4ZA 5J1ZA 1VQIA 4DK0A 3S17B 1L0YB 2PQAB 4ZRZA 4X64L 1EFID 2ALYB 1TS2A 1AZPA 4B3SQ 1Y8OB 1IBML 2RVLA 5CC4A 2J0TD 1B50A 3G7LA 1F2ZA 2H5XA 3D3RA 2F03A 2EXDA 3EIVA 3KDFB 1IBKQ 4LF4Q 3CD6A 2PZUA 3KF8A 5FJ8H 5CV5A 3PIOA 4BBSG 2JN4A 4ALPA 1XPRA 1CK1A 1V1PB 5CV9A 1BUVT 3NWTA 2MNAA 2LSSA 4YWKA 4B08A 3I90A 3HOXH 1LABA 1BCPD 1QG7A 1OXUA 4NKLA 3MFGA 2PMZB 4DR1L 3U9SA 1KD1C 5FKAC 4OWXB 2ZJRA 1AH9A 3ONAB 4K6DA 3IKJA 2BE5C 1N33L 1A3VA 4C3IB 2G9HD 1XMOL 1B2TA 3T4AC 1T5EA 4POGA 4K0KL 1G6ZA 3NXWA 3FHWA 1I5FA 3J7A5 2XSCA 2ICIA 4BBRG 4HEDA 1Q82C 5C4JB 5A35A 1SYDA 4BY1H 4X3TA 3IL8A 2JYOA 1B8AA 4RKBA 1HQMC 1EUJA 3CXCA 1GM5A 1VS0A 4DPGA 3STBC 4NXML 5G3LF 1RTOA 2QEXA 1U4MA 3K5LA 1B4OA 3CCLA 1GUWA 1HJPA 5K36G 1YNJC 2Z6KC 4P72A 1FJGQ 3RR5A 1MGSA 4ZCKA 4EX5A 3M7GA 1ICFB 4K5VA 5HGQA 1YVCA 4WJ3M 1H95A 2SDFA 5IE8A 2EVBA 3CAMA 3KK7A 3A8JE 2GA4B 2KQ3A 1UE7A 1ZYRD 3S2DB 1HNWQ 4XYQA 4Y7NH 4DK1A 1H9SA 1QUQB 2FXQA 4DNRB 4GLVB 1EY7A 1I4PA 1SYCA 2JA7H 4GKJQ 1JB3A 2EZVA 4L6TB 1JJGA 3SXHA 4KV6A 1U9RA 5IP9G 4G7HC 3VYUA 4KY7A 4C2MH 5A2QE 2F0EA 2M2LA 3LGJA 4R4OA 4R1JA 4U673 5AJ3L 3CC4A 1DOLA 1GD7A 1X65A 3E3XA 3Q6SA 1BNZA 2HHHQ 4A3DH 4ZK9B 3BYTB 5IWAL 1B9MA 3MC0B 5JJKA 4LFCL 3SR1A 2XRQD 4YCVA 2BA0A 3TDQA 3NUCA 1KRTA 1K83B 2B2VC 1QNKA 2B2YA 4XXEA 2EJFC 4DV7Q 3I73A 4A3KB 4DR7Q 2O2LD 5E4XA 5IYCH 3ZJYC 2CWPA 3WOEA 5GAGC 5FO8B 1PTOC 1EIFA 1GO3E 1STYA 4KKUA 1TS4A 3MZ5A 3H15A 4A3EB 4X62L 1EQRA 5ISRA 3K6OA 4DR6Q 2E5LQ 1MSGA 3KF8B 2BH2A 4DF7A 1XNQL 4IPDA 5FO7B 2K6AA 2KHSA 3S1NB 1ESFA 1M4VA 3CKIB 4UY8C 3GTPH 3HS0C 1SBBB 3TBIB 2NZHA 4RKLA 4Z9CB 2B63B 3P75A 4IJHA 3RLNA 3OTOL 1E2ZA 1U4PA 4OEMB 4QUCA 2Y0SE 3NP8A 2K28A 2NVYB 4FYDA 3A5UA 2JE6I 1JR0D 2WIIB 1VQMA 4GZYC 4G57A 4A3LH 3H94A 3HGBA 3CU7A 3RNUA 1MSHA 3CCEA 3Q22A 4B3TL 1Y1VH 1TWFH 4HJAA 2EQSA 1JOOA 2D0OA 1X56A 4LW1A 4X3SA 5C4XB 5M3MB 4CGYB 3PO2B 1W6KA 3S1MB 4LF9Q 3CHBD 1VQNA 4JI3Q 1TWGB 3IFTA 2EIFA 3JAMc 4N9PA 3GTQH 1NUCA 4YWMA 2PCFB 4NP5A 4GNXA 3RN2A 2B2WA 3J81E 3HOYH 3H6MA 4JI2L 3NTHA 2AUKA 4Q0FA 2FHTA 2R7ZH 3GTKB 1C9OA 1LTSD 3L9AX 1GHJA 3DUZA 5IOCA 3PV0A 4KTAA 4DR3Q 3HOWG 3SVMA 1H9SB 2K14A 4DAYB 4OX9L 2F0HA 3LWEA 1N32L 1B3AA 2Q8IB 2F0UA 1Z9FA 4RGOS 1SDFA 1O7LA 2BE5D 5M3FH 1F9SA 1WTVA 4DN4M 1S5CD 3AQQA 4IURA 2K1BA 4P73A 2Z8LA 3OHXC 1AE2A 2NN6H 1WYDA 2IW3A 3I8ZA 1ZXTA 2EYPA 2SNSA 1MHWC 1PZID 2F4VQ 1G6PA 3CQZB 2E8GA 5IGGA 4AIMA 4IUVA 1TY2A 4A3FG 3HZXA 5FLXE 5GAEC 2IX3A 3CP0A 2NVQB 2F0TA 4IOAA 4DV1Q 2AWNA 1SNOA 4A3MB 2ATWA 4GKJL 4FXKC 3PIO3 1KNEA 3HOUB 1CKMA 4G7ZC 1CSPA 3D6CA 3M4OB 4GN3B 4A3GH 2OTJA 1BR9A 4XQJA 4PV1C 1TWHH 3EN2A 1SNDA 2NTSA 2L0CA 5CBEE 5JVH3 2JA5G 4F7XA 1WD0A 5C44G 2HIVA 2VW9A 4DV0L 3TQYA 1Q90A 4LFAQ 2B8GA 1SMXA 3I2ZA 5E3FA 4DV7L 2L15A 2A69C 1PZJD 2DN8A 3K59A 4DV3L 2G5DA 1FGUA 1ENAA 1PH5A 3BYYB 1KLGD 4HTHA 2K5WA 4L5SA 3NK9A 4C1NI 5GADC 2SEBD 3BDLA 1G291 5FJ8G 1QVFA 4BXXH 2XIWA 1HNZQ 1JT8A 2H4OA 4GLXA 1EWIA 1F77A 1PYBA 2E5LL 4QQBX 1YI2A 1BDOA 2HUGA 4K6LA 1OXXK 1EU4A 2CW0C 3T16A 2A73B 3TP8A 3OPOA 1I50H 1LT4D 2EY5A 3I4MH 3A7LA 1J5EQ 5JPMC 1PTOD 3K5OA 5M5XH 1QZGA 1N34Q 2Z4HA 1GUSA 1LUZA 3W5OA 4IOCA 2Q2UA 1KAWA 1NMGA 2IHFA 4ZAIA 1DZ1A 4JC0A 4OELB 2FFKB 1RL2A 1J9OA 2YU9H 2JK8A 4JI7Q 1L2FA 3NEMA 2PW7A 4C3JH 4FO2A 1E2VA 5DEHA 4GNXB 4EQPA 2VZAA 1PHJA 1K8MA 2AKWB 1NTGA 5LHY1 3HOXB 2MO0A 3L2PA 1GVPA 2IJ0A 5E7NA 1WTRA 2R92B 1WTXA 2NBFA 1LTID 4BY1G 1EYAA 5JVG3 2B8FA 2A6HD 4XDXA 2KENA 1K0SA 3H09A 4ODGA 4FDBA 1EY4A 4IUQA 1A8VA 4ZLTF 1TS3A 3TREA 4XT1B 4KI0A 1WTOA 3L3OC 1EIGA 1EWHA 3FVQA 3V2TA 3HG9A 1G2TA 3VYSA 4LF5L 3NPPA 2B2YC 3MAQA 4LF8Q 5ELDA 5LL6S 2RSNA 2MGSA 4YIJA 3BDOA 1ENCA 1O78A 5EJWA 3KFUA 2JJQA 4RAUC 1EU3A 1E0BA 2UXCL 4X3KA 5DM73 3MXNB 2M9VA 1HA6A 3WWVA 1BO0A 1ML0D 3S15H 5EBDA 5CV6A 2QDLA 3DHQA 3CMEA 4DV2Q 4N9TA 5EBCA 1XNRQ 2JA7G 1SE2A 1K3BC 2N78A 2PMZE 1PFBA 1EIYB 4HSVA 1DCZA 1VDZA 4IFDH 1N36L 1AFPA 1EZ8A 3M7NA 5BN3A 2CH4W 5E1FA 1W6JA 1JICA 2CWAA 2UU9L 1GUNA 3R93A 1Y1WB 4A3DG 2E2DC 4NW2A 2JA7B 1ESRA 1IXRA 1CQFA 1HZ9A 4BS9A 4HJ8A 2F0JA 2JA8H 1C4QA 2KOLA 4HIKA 3F1ZA 4JI4Q 2PW5A 4DV5L 4H7BA 2AWOA 4DR5L 4A3DB 3NBHA 3T1YQ 4YCWA 3OSOA 3LX0A 3J80i 1I4XA 3M85A 1CTMA 2YTYA 4LUZA 3CCVA 2R93H 2Q2HA 2HCIA 3PUYA 1VMPA 3GDEA 3H3VC 4X66L 4RCNA 3BZKA 5FK9C 2BCOA 1HTLD 1VQ5A 4AH6A 4V190 3MXPA 1E1TA 4I7ZC 2CQOA 1X3EA 4GNXC 2CQAA 4PNYA 5COYA 3SDZA 4ME5A 1XXGA 1CZWA 4N8FA 3NHHA 4XYOA 1S5ED 4JI6Q 3I72A 1LT3D 1B9NA 2PPBC 2F3IA 1DXMA 2DJFC 4KD3A 5FO9B 1QNUA 3K7AH 3GTPB 4WJ4A 1VQEA 2XGTA 3SGIA 1A3UA 2D0PA 4FXGC 4DV6Q 5GAHC 3I7FA 4IALA 2WKDA 3GTMH 1Y1VG 1SNMA 2EXZA 2A69D 5M5YH 1VQFA 2ZXPA 4MZ9A 1VCIA 1TWCH 2N3SA 2VXWA 1Z47A 5EKLA 1VF7A 4LF7L 3HKZG 3MVVA 4JYAQ 1N34L 3VA7A 2GVBA 3PO3B 2ZTCA 1CUKA 4OHJA 5TSSA 2V1CC 3SE0A 4JW0A 1S5FD 1NBWA 2E2HH 2PZWA 2E2JB 5BN4A 1TWFB 3R3OA 3ERSX 4I7AA 5CGKA 1WCMB 1FYCA 1QILA 4JK1C 1F2LA 1PLFA 3D4WA 5CYUA 5K5PA 2F0MA 2F4IA 3HOYG 4YY3Q 2X69A 1DGSA 3CCMA 5M5WB 2R7ZG 3RLFA 3S1RH 3QO2A 1VQJA 4OIKA 5IYBH 5KNBA 1NR4A 3OWFA 1XPOA 4DAVA 1CT1D 1M1KC 2L11A 3SK5A 1JWSD 2FJ2A 1CHPD 3M4QA 3I91A 4R9WA 3HOYB 2N88A 4BA2I 5M3FG 3BVMA 1LTGD 4JOIA 4MTNA 1JMCA 3S2HH 1AW7A 2FINB 2R7ZB 3J81j 2KUMA 1EL0A 5HY6A 5JPNC 1WTQA 2NN6G 2R7DA 1GUTA 1YJNA 2HQEA 5IGFA 1RODA 3S9WA 4ME3A 2ZM6Q 1BOSA 4B3MQ 2AMCB 3URYA 3W2DA 3CPWA 4L5RC 3G48A 2OT2A 1HR0L 3TSSA 5I9OA 3HOVH 2Q8TA 3RZDH 1PRTD 4KHVA 1HFGA 3I4OA 2ZTEA 1F9QA 3TS2A 4A3JH 2ENBA 3ND9A 4TQUS 1E1OA 4JI1L 4QIWB 4JI5Q 1I4RA 5IGEA 4HIDA 1JWMD 2XVSA 4AYBG 3P20A 1AZQA 2IY5B 4DUZL 3K8AA 1V8QA 1BXTA 4A3GG 4BBSB 3K80C 3KUPA 4H0LC 4DUYL 2F1MA 2B29A 3RLOA 1JJ2A 1A6XA 3SK8A 1SXTA 3D4RA 4GS3A 3TN2A 2LS01 3VR6A 1UUPA 3FP9A 4X65Q 1N8RC 2EYMA 5C3WA 2D2CC 4QL5A 2P5ZX 3CCSA 4HSPA 1JQYD 4P74A 5ELNA 4JI4L 1VF5C 4R8IA 2OCEA 4HJ7A 1CZGA 3I4NH 4IFDI 4DV4Q 2KCMA 3FKIH 2F0KA 4NXNQ 4H02A 1SMYD 1YHAA 2A8VA 5CV4A 4DR4L 4BXXG 5C3XA 4BBRB 3DEPA 3A8KE 1GUOA 2JSOA 1YBYA 5JEAH 4LNQA 4DAPA 1PVOA 1PH4A 2F0PA 5E4WC 1NSNS 2PNRC 1I3QH 2OWOA 4PMCA 3I4MG 1WOCA 2K04A 5EPKA 4DK3C 1Q12A 4UP8A 1Q7YC 2M00A 1CA5A 3NTKA 2L5TA 2JA9A 1K8GA 4N8X1 4RA8A 1MD2D 5IT9c 1EOVA 1HZBA 1V9PA 1VQBA 3T1HQ 1HNXL 3KLRA 2ES2A 1JORA 3JC66 5C4HA 5IT9L 2J7ZA 1B7YB 3OMGA 4QMGA 1VQ6A 3B6YA 1X55A 4C3JG 2XRSD 2EJGC 2DGYA 1R9TB 3GO5A 1K9MC 1BCPF 1GKHA 2NUCA 1K0RA 2V4DA 3RN5A 1O7YA 3SK4A 1CSQA 2H1EA 1TXYA 2ZXOA 4OXPA 2UXDL 1LTAD 2A19A 4TSSA 3M3YH 3FEWX 3A8IE 3UDFA 3GTJH 1BVSA 1A2UA 4JVZA 3GTGH 3PUVA 2F0QA 2OQKA 1IYUA 3BVGA 4C3HH 1SJED 5KIXA 1L1OA 3TP7A 4JBKA 1DOKA 2WB1E 3OOCA 1BQQT 1PZKD 1FNWA 1K3RA 1I4HA 1YNXA 2PYKA 4DA2A 4WFN3 3D6WA 5I6WA 3V05A 3NSWA 2I5LX 1LTBD 3IFDA 1I94L 5KNCA 3CRKC 2BOSA 1OO9B 1XYIA 1NNXA 3A56A 2UXBQ 2B2TA 1PH8A 2OEOA 3BG3A 4O2DA 4IFDG 3L0OA 3QJYA 1X32A 5J39A 1ET6A 1XJVA 4B3SL 2HD3A 4B3RQ 2F0NA 1ONLA 3A0JA 2K03A 4HIOA 1A63A 1SE4A 1SSOA 1HXYD 1C8CA 2K33A 1L0WA 2QGQA 4LF4L 1LTLA 1IBKL 4B3ML 4RFBA 2BA1A 4UP9A 3S14H 2TMPA 4H44C 2JA8G 1H9KA 3JAME 3T53B 4TVAB 1SYEA 4DXFA 4WORA 2N55A 2UUBQ 4A76A 4JI8Q 3KOJA 5CORA 2F3WA 3TS0A 1HRJA 3A54A 5C3EH 2F0GA 2RBMA 2IX0A 5GROA 1LM0A 1B44D 2Z0SA 3F8TA 3LWUA 3A5ZB 1JC7A 2R93G 2VUMH 2QA4A 1E2WA 4RH6A 3K7UC 1SFOB 5C5LA 2NVXB 2LY7A 4MHEA 3G6JB 1Q46A 2FMCA 3A7AB 4A3IH 2KHIA 3K5MA 3WDNA 3F2BA 3CMAA 1PFMA 2JA6G 4CJ2C 3FPPA 2F0OA 1R4PB 4LJZC 3CCJA 3I4LA 3S1QH 1I4QA 3ITPA 3RZOB 3Q8DA 5EAYA 2F52A 5BR8Q 5EGTA 4DGZA 1EYGA 1BBWA 1CI3M 3NENA 3DEOA 2A68C 3S17H 3D31A 4CKCA 3DLLA 2R7FA 2F0VA 2F0FA 4NXNL 1KXLA 4CBVA 2C9OA 2EY6A 2XN9C 1II3A 3HOWB 2WAQE 1FJGL 3TRZA 2IWHA 4JOIC 2K7VA 1GHKA 4F88A 2K5DA 3P1HA 5I4DA 1CFMA 2KECA 4L5QA 4S3SA 4JG2A 3DM1A 3MHBA 1S5DD 3J81L 3GTOB 1HNWL 3P7JA 3H91A 3K7AB 2Q8RE 3STBD 5JAVA 5ELBA 4CJ0B 2WINB 1YNJD 1YNNC 2RSOA 1PTOH 1SEBD 3UDGA 1SNCA 3E0JA 2E75C 1HZCA 3ULPA 4CKEA 2K50A 1HUNA 2K75A 4HAEA 5LMNQ 2Z1CA 3J80c 1VQAA 4A3FB 3R2IA 4QB4A 1GXDC 2F0WA 1MI2A 3S16B 4GN4B 5IYBG 4IPHA 3E9IA 3J80L 3TZUA 2HDMA 4V0BA 2DNEA 3KF6A 2E2HB 1RHPA 2HHHL 3HEJA 4KHZA 4KJOA 2EYHA 4C3IH 4LUOA 1WJJA 1BCPB 1K28A 2L55A 3AYHB 5D14A 2RCNA 4UHVA 4YHHQ 1PYSB 1MKHA 2XWJB 1I6HB 2KCCA 3DM3A 2AQ2B 1WD1A 1S5BD 2ZT9C 2E2IH 2SNMA 4EQNA 1S40A 5C4JH 4DR7L 1IBLQ 2VQFQ 2BH8A 1HQRD 1IYJB 2XWBB 2JA5B 2J4XA 2AUJD 3AFQA 1Q8KA 2I0QA 4CDEC 3TEHB 5C44B 1A3TA 1VQKA 1VMCA 3CW2C 2EOTA 3DWAA 3VR3A 1UNSA 4LAAA 3GD7A 4DR6L 1EQVA 3CCUA 4GKKQ 1PH7A 2QF7A 3HOVG 3KYHC 4NMZA 4R4TA 1NMFA 3F2UA 1Q1BA 2I46A 2XNAC 2GN5A 1LO5D 2CFMA 2OF1A 3KJOA 4A3JG 3ZYYX 2WFWA 2CH4A 1IKLA 3S2DH 1TVXA 3A55A 1RDPD 5H1SE 2UXBL 2PO4A 5IGCA 1UE1A 4BWGB 4F8MA 2RDHA 5FLMH 4J15A 1IW7C 1LTRD 1PMRA 4IJLA 3AU7A 3CC7A 3U50C 2XTIA 1STGA 2KJXA 5KRUA 1DOMA 4KD4A 4DU9A 2UUCQ 1DM0B 2Y0SG 4A3CH 1SRUA 1C0AA 1J8IA 5DLQE 4ID6A 4JV5Q 1UE6A 1SJHD 4DR2Q 1A0IA 5IP7H 4A3BH 3H0GH 4PG3A 5F2DA 5T1IA 1SYBA 1TR5A 4EVOA 5CV8A 5D65A 2VY3A 1M90C 3SHLA 3F2CA 2JP1A 3NE5B 3HOZG 4JBMA 4LF9L 3I4NG 1T5XD 2EYOA 4APVA 4JI3L 3FKIG 3O13A 1K83H 4PZ7A 1NY4A 4DFAA 4A3KH 4JCVE 2LFNA 3BU2A 2B2UA 5C0XH 5LMUQ 3K0XA 1WVLA 1SR3A 2GVAA 3EA6A 1PXUA 4BY1B 5JEAG 1UE5A 5KYLA 1CQVA 4OONA 2K52A 1YZ6A 2Z6KA 3I4NB 1V1QA 4K2KA 4A3EH 1LTTD 3AEVA 2UUAQ 3FKIB 2L4NA 4X64Q 4ZUJA 4DR3L 1TY0A 2K32A 3OMCA 4QIWE 4M8AA 1IBMQ 4FXDA 1PFSA 1Y69U 4KN7C 5BR8L 3S1NH 4QY7A 1BCPC 2B63H 5ELCA 4GOPA 4P75A 1KDBA 1I3QB 1I6VC 3D0FA 1VQ9A 1PTOF 2K5VA 2PI2A 1EYDA 3NQIA 4Y7NB 1DYQA 3OW7A 2SOBA 2B2TC 3J81i 2RDGA 3OIQA 5M9OA 1F2MA 1X3GA 3Q24A 1TWAH 2F4VL 3UDXA 1D1IA 1Y8PB 1UWVA 2PQAA 2OTLA 4J1MA 4C2MB 2EJMA 2R61A 2A68D 4DR1Q 3VA5A 4O42A 2RHSB 1PH6A 4KKTA 4CJ1B 2NTTA 3RMHA 4DV1L 1BF4A 5C4XH 4C3HG 5M3MH 1N33Q 3PO2H 3K81C 3KDFA 1XMOQ 3R2TA 2JEBI 4E6IA 2LMCB 4K0KQ 3G4SA 2PQEA 1Y14B 3QB3A 4PQXA 2JEAI 3CC2A 2CHBD 3GTJB 3NELA 4O1NA 1EIHA 1NR2A 1JOQA 2EPBA 1ZYRC 3NWSA 3GTKH 5IGBA 3CCQA 2B2WC 4X6AH 4LFAL 2MO1A 4NXMQ 4K8IA 2L12A 1I4GA 2JA6H 1PDQA 1RCVD 3VYRA 2B3GA 1QJOA 3C1EA 4JI0Q 5CR3A 2WKCA 4J8QA 4B9XA 2C35B 2WV6D 5C5MA 1KIXA 3UE1A 2VL6A 4IN3A 5D3IB 4YWLA 1HNZL 3ER0A 4GKKL 4R8NA 2YTVA 1GOZA 3UE0A 2DJGC 2HCCA 2A5HA 1STBA 2F0IA 3MXGA 1J5EL 1LYLA 4UDUC 5C3EG 3E6ZX 2WACA 3S14B 3KLSX 2VUMG 2EYJA 2OXPA 1Y1VB 2VB2X 4A3MH 4JI7L 5KGUA 1SE8A 3ERQA 4ZKBB 2CW0D 2N49A 3HOUH 4CDFC 2F3VA 1WI5A 1MIUA 2FMMA 4P71A 3M4OH 1FD7D 4A3IG 3HKZB 1HZAA 5C3EB 1STHA 2KEEA 1LV9A 4DR2L 3GTQB 3W3AA 2KA7A 3R8BA 4IZ8A 3PUZA 1G2SA 1Z6HA 4PMBA 2A74C 1Y8NB 4X3UA 5I2YA 4UP7A 2HIXA 3QR8A 3PF4A 2F0LA 2C5CA 4X62Q 1ET9A 4GOPB 2NVTH 3DXJC 2IL8A 2O5IC 5I9PA 3U4ZA 4FF3A 4HCSA 1XNQQ 3E9HA 4C1NK 4LF8L 2F0SA 3MXUA 4B9WA 5LMNW 4NDXA 4ZKCB 5G3LD 5M3FB 2AQ1B 1JB7A 1AP0A 3M9BA 1EY8A 2UUAL 3OTOQ 1KABA 3G6EA 4CDCC 3PUXA 2RCFA 4OIJA 4QUFA 4DV2L 1U0LA 4JPBW 3LNNA 1XNRL 1K8AC 1ENFA 4GN5A 2L9HA 3VR5A 4ZUIA 4IFDJ 1D5XC 4NB3A 5IODA 4OO1H 3GP7A 1A62A 1D7QA 3NBHB 5C0XI 2ZJQA 3EVQA 4WRDA 1Q3LA 2QILA 1B1ZA 3ULJA 1SYGA 1O7IA 2A6EC 3H3VH 4B3TQ 3DWQA 3EJIA 1KHIA 1UEBA 4C3IG 1PTOB 1JE4A 1WTWA 3C3LA 3C2PA 3SK6A 4AYBB 1KDAA 4KY6A 4IPGA 3MEHA 4A3GB 4QF4A 2R92H 4RGMA 1NE3A 1A15A 2YTXA 5EQ0A 2JQOA 4KK7A 1TWHB 4MIUA 1XTDA 2HT1A 1SE3A 3AB9A 3FMCA 3BS1A 3HOZH 3DWPA 2NYZD 3FDTA 1SROA 4JI2Q 3T1YL 4PZ6A 3U9OA 4OWWB 4IO9A 2Z6BA 1D2BA 1EOTA 3KLSA 2E2IB 3Q23A 4OX9Q 1E24A 3PIP3 1PH1A 2IPKD 4QGUA 1N32Q 5IT9E 3EQLC 2B2UC 4K14A 5T1GA 2LXJA 3T13A 3GV6A 3RUZA 2DY8A 4BY7H 1YITA 3ULLA 4IUTA 2Q2TA 2KVMA 4RMFA 3HP3A 1SLJA 4OL7A 4JI6L 2D9UA 5FLMG 4JI0L 2ZJPA 2Z4IA 1PRTF 1VQ7A 1FR3A 4YCUA 1IHZA 1HCZA 3HRZC 1I50B 2EYLA 3GV3A 4UAIA 1EQTA 1XMQQ 3I4MB 4A3CG 5KNDA 4IQZA 4DV6L 5M5XB 3KBXA 4DAYA 5IP7G 4HJ9A 3H0GG 1MJEA 1FGBD 4A3BG 4GOPC 3ICEA 4HCEA 2RHQB 1Y1WH 1JOKA 5IGDA 1CKNA 3EBEA 1IYVA 5LL6X 4LF6Q 1H9MA 2YU9B 1Q8IA 1B53A 1N9WA 3PMFA 3G71A 1T9HA 4C3JB 4IPCA 5JJZA 4JYAL 4CHTB 1VQPA 5DAUA 4MTKA 1F9PA 1G51A 1EY0A 4A3KG 3V96A 5C0XG 3I55A 4A3BB 3H0GB 4Y52H 3UI2A 2R6GA 1ASZA 1G91A 4OGQC 3Q0AA 1XPUA 3K0YA 3PQIA 3VDYA 4YY3L 5HGTA 2X6LA 4I65A 4DV0Q 1WTHA 1HR0W 4A3EG 1PH9A 1HFNA 3BJUA 1XWEA 5A2QL 1EZ6A 2ICEC 5BN5A 4L63B 2ASBA 3OYYA 3AFPA 3CCRA 4DV3Q 2RQXA 3GTLH 1KL9A 1PYWD 2K4KA 2NZOA 3PUWA 2KEDA 4PMWA 1D1KA 4O0AA 1W3SA 1U4RA 2YV5A 4A75A 2X6GA 4RGNA 2B63G 2PNHA 1IL2A 1AE3A 2RF4A 1E7ZA 5ELEA 1KQSA 3W1BA 3MEFA 3S15B 2DY7A 5J3BA 4HMJA 1X3FA 3GQBA 2ZM6L 3S24A 1X54A 3OW2A 4DAMA 5C6AA 4R4CA 2K5HA 5CBAE 1BKBA 2IHEA 4R4QA 1BBUA 2MQHA 4LUVA 1YHBA 2EY1A 1L0XB 1H9JA 2A6HC 4U68A 2I5HA 5C4XG 1RIPA 5M3MG 3PO2G 1AN8A 2NWGA 1DD2A 4IUNA 1TWAB 4A93H 4JI5L 4G4KA 1K73C 1D8LA 2ZXRA 3PO3H 4K5XA 1ZEQX 2E76C 2EE1A 2JA8B 4KJNA 4XT3B 2E2JH 1X9NA 4TKOB 1HA5A 4KHPQ 1WCMH 3HFZB 3CPFA 4UPAA 1V43A 1ASYA 2CCZA 5M5WH 4X65L 3ND8A 4KY5A 2QW7A 3T51B 5C4ZA 3MA2B 1NAPA 2R93B 4PZ8A 3JAML 2A6ED 4OO1I 4LF5Q 2F0DA 4TRDA 4HIMA 1PA6A 1PH2A 1PFNA 3E0EA 3QOJA 4HMIA 4DV4L 1HPCA 3TZDA 1Z7TA 5ELFA 1PV4A 1D5MC 3IAYA 3H3VI 2UXCQ 3TP6A 3VYTA 1W2BA 3QOLA 5IYDH 1XX8A 5JEAJ 2JA6B 1NCVA 2QEJC 1QOHA 4RCOA 4ULLA 1GUGA 3J81c 5IY0A 1EY5A 1KAAA 3NQTA 1CKNB 4P2CB 3I56A 4EQ5A 4DXGA 5HURA 4LK1C 2B39A 3TP5A 1YJ9A 1N36Q 1Q1EA 4KMUC 4LFBQ 3J80E 3VR2A 1KLUD 3J7AF 2RDFA 4HJ5A 5EKKA 3GTMB 3T1HL 2UU9Q 5CMDA 4A3MG 4QCLA 2K05A 4KKSA 4DNIA 1SN8A 3TMEA 1M8AA 5M5YB 1QCBD 1L1OB 3HOUG 2NB0A 5GQOA 1TWCB 1EEID 1XMQL 1GJXA 4GLAC 3MXNA 2ZTDA 4A4IA 3C1FA 1YHQA 4RHRA 2YYZA 4BBSH 3EROA 3K5NA 1PRTB 1S3OA 3BDCA 1OXSC 4OWTB 1ZKOA 3I70A 4DV5Q 1A2TA 3N52A 4DR5Q 2WP8J 3DMUA 1YEZA 4LF6L 2MUYA 2DUDA 4HN7A 1KDCA 3PCOB 2I5MX 3AMUA 5I2XA 4RHSA 4EQOA 5FLXc 5KEEA 1K8OA 3PF5A 4HR7B 3S1RB 1TQOA 4POFA 5FLXL 2PZTA 2KCTA 1FVIA 2QKIC 1OXTA 2KBNA 2DNCA 1V1OA 4WJWA 4X66Q 2VB3X 1U4LA 1KC8C 1J6QA 2KHJA 4CDDC 3S2HB 2Z9HA
chains in the Genus database with same CATH topology
3RLNA 3OTOL 2JEAI 4A3GG 2VNUD 2AHOB 3K80C 3CF5A 4AQYQ 4BBRH 4DUYL 3CC2A 2WB1G 2Y0SE 2B29A 3NELA 3RLOA 3A5UA 1VQ4A 1JJ2A 2JE6I 1VQMA 5JJLA 1E3PA 4GS3A 4OO1G 3GTKH 3UDIA 2VS1A 3FP9A 4X65Q 3CCQA 1YIJA 1N8RC 4LFAL 4A3LH 4X6AH 2MO1A 4NXMQ 3RNUA 2JA6H 1P16A 3CCEA 4QL5A 4B3TL 1Y1VH 2B3GA 3CCSA 1TWFH 4P74A 4HJAA 4JI0Q 2EQSA 4B3RL 5ELNA 3HKZE 4JI4L 4XTCS 2VQEQ 4QJFA 2D0OA 1X56A 3BZCA 4LW1A 2C35B 2OCEA 4HJ7A 3I4NH 4IFDI 4DV4Q 4LF9Q 4R4IA 1VQNA 2KCMA 3FKIH 4BA1I 1VQCA 1R9TH 4JI3Q 4LF7Q 4NXNQ 4H02A 1EFWA 4LWCA 3IRBA 3HOXG 1KIXA 2EIFA 1YHAA 3JAMc 3UE1A 3GTQH 1FL0A 2VL6A 4YWLA 1HNZL 2A8VA 4DR4L 4BXXG 3ER0A 4RG1A 2R92G 4GKKL 3W1GA 4YWMA 2YTVA 3UE0A 4GNXA 3RN2A 1YBYA 2UUBL 4LNQA 2A1AA 4JI8L 3HOYH 1PVOA 4JI2L 2PI2E 1PH3A 3PIPA 1I3QH 2N8NA 5IP9H 1J5EL 2OWOA 2R7ZH 3I4MG 1C9OA 1WOCA 1LYLA 5C3EG 1E22A 4L5TA 4DK3C 1Q12A 3PV0A 4UP8A 1Q7YC 4DR3Q 3HOWG 2JA9A 1VQ8A 1K8GA 2VUMG 2K14A 4DAYB 5IT9c 4A3MH 1EOVA 1HZBA 1V9PA 1VQBA 3T1HQ 1YJWA 1HNXL 2ES2A 4JI7L 1N32L 1SE8A 3JC66 4KHPL 2K5NA 2N49A 1IZ6A 3HOUH 1B7YB 1Z9FA 1VQ6A 2IX1A 3B6YA 1WI5A 1X55A 5M3FH 1Q86C 1MIUA 1L1OC 4P71A 3M4OH 3JAMi 3AQQA 4A3IG 2DGYA 1HZAA 2MFIA 3GO5A 4BY7G 1K9MC 4P73A 1GKHA 4DR2L 1AE2A 1K0RA 3KLWA 1WYDA 3PUZA 3A74A 3RN5A 1CSQA 1TXYA 4OXPA 2F4VQ 1MJCA 2UXDL 4UP7A 2HIXA 1G6PA 2A19A 3M3YH 2E8GA 3PF4A 2ID0A 4AIMA 4X62Q 3UDFA 4XIGS 4A3FG 5GAEC 4GOPB 2NVTH 3GTJH 1BVSA 2NVYH 3CP0A 1OXVA 3J7ZC 1HR0Q 3GTGH 2R93H 3PUVA 2OQKA 4AYBE 4DV1Q 4IOAA 3U4ZA 4C3HH 2AWNA 1Y1WG 1XNQQ 1L1OA 2ATWA 3E9HA 4GKJL 5ELOA 4LF8L 3KF6B 4JBKA 5LMNW 2WB1E 2WAQG 4JI1Q 1CKMA 1JB7A 1CSPA 4DUZQ 3M9BA 4GN3B 4A3BG 4A3GH 1K3RA 2UUAL 3F2DA 3OTOQ 2OTJA 1YNXA 2CKZB 3G6EA 3KJPA 4DUYQ 3PUXA 4LFBL 4DV2L 1TWHH 3EN2A 1U0LA 1VQGA 2I5LX 1XNRL 1K8AC 4GN5A 1I94L 2JA5G 4OX9L 3S1MH 4IFDJ 4NB3A 1A62A 1D7QA 5C44G 1TWGH 2HIVA 2VW9A 3NBHB 4DV0L 3TQYA 4LFAQ 1PH8A 2UXBQ 5C0XI 2ZJQA 5LMNL 5JJIA 4O2DA 4IFDG 3L0OA 1SMXA 2HQLA 3I2ZA 1XJVA 3ULJA 1O7IA 1QVCA 4DV7L 3H3VH 4NPSA 4B3SL 2L15A 4B3TQ 1VQLA 4B3RQ 1OTCA 4DV3L 1KHIA 1SFOH 1Q81C 2NVXH 1UEBA 1FGUA 5IYCG 3A0JA 1VQOA 1PH5A 4JBJA 4HIOA 1S72A 1A63A 1QZHA 4L5SA 2Q2IA 1L0WA 2QGQA 4YHHL 4LF4L 1LTLA 5GADC 1IBKL 2IT1A 3HKSA 4B3ML 3S14H 2BA1A 4UP9A 1G291 2NN6I 5FJ8G 4IPGA 2JA8G 1QVFA 4BXXH 1HNZQ 2R92H 1JT8A 4GLXA 4DR4Q 1EWIA 1PYBA 1IBLL 1NE3A 2VQFL 2YTXA 2E5LL 2JQOA 3M4PA 1YI2A 4TVAB 1EQQA 3RZOH 1OXXK 1XTDA 2HT1A 1I50H 2UUBQ 3HOZH 4A76A 4JI8Q 3KOJA 4DK6C 4JI2Q 1SROA 3T1YL 3TS0A 4PZ6A 3I4MH 1J5EQ 5C3EH 5M5XH 2IX0A 1QZGA 1B70B 5GROA 4OWWB 1N34Q 1LM0A 4IO9A 1LUZA 2Z0SA 3F8TA 3HOWH 3W5OA 4IOCA 2Q2UA 3A5ZB 1KAWA 2R93G 4AQYL 2VUMH 1NMGA 2QA4A 2IHFA 4JC0A 2CCZA 4OX9Q 1HNXQ 1E24A 3K7UC 1PH1A 4QGUA 1RL2A 2YU9H 4JI7Q 2JK8A 1N32Q 2D62A 1L2FA 3NEMA 2LXJA 4C3JH 3CQZH 4GNXB 3GTOH 1Q46A 1PHJA 2VZAA 3L7ZC 4A93G 4A3IH 1HH2P 2AKWB 1NTGA 1CKOA 2KHIA 3ULLA 1YITA 4A3LG 4BY7H 3S2HH 3PO3G 2MO0A 3L2PA 3F2BA 1GVPA 2Q2TA 3CMAA 5E7NA 5AJ3Q 4JBWA 2JA6G 2NVQH 4RMFA 1SLJA 1U5KA 4JI6L 5FLMG 3CCJA 1C7YA 4JI0L 1JE5A 2ZJPA 3S1QH 2VQEL 4BY1G 1X6OA 3Q8DA 5EAYA 2F52A 1WCMG 4YCUA 3U4VA 5BR8Q 1EYGA 1VQ7A 2KENA 4DKAC 5IWAQ 1BBWA 4LFCQ 2UUCL 2UXDQ 3NENA 1QUQA 1XMQQ 1JJCB 4MNOA 3U58A 4FDBA 3S17H 4A3CG 4JV5L 3D31A 3DLLA 1KXLA 2R7FA 4NXNL 1A8VA 4DV6L 4A3FH 3S16H 3TREA 2LXKA 2WAQE 5IP7G 3H0GG 4HJ9A 4JOIC 4KI0A 1MJEA 4GOPC 1FJGL 3ICEA 3TRZA 2RHQB 4DR6L 1Y1WH 1KRSA 4LF5L 1CKNA 3EBEA 4LF6Q 4L5QA 1VQHA 4JG2A 4LF8Q 1N9WA 3G71A 1VQDA 1T9HA 5C0XJ 1WFQA 3PSIA 4IPCA 1I6HH 1HNWL 3KFUA 4JYAL 1VQPA 2JJQA 1NJIC 1P8LA 2UXCL 1G51A 3MXNB 3STBD 3WWVA 5IYDG 4A3KG 3S15H 4DUZL 5LMUL 5C0XG 3I55A 4DV2Q 3CMEA 4Y52H 2R6GA 3PGZA 1ASZA 2JA5H 1QVGA 1XNRQ 1I94Q 2JA7G 2N78A 3UDGA 2PMZE 2OQ0A 1EIYB 1XPUA 5C44H 4KLKA 3VDYA 4YY3L 1HZCA 1VQIA 3ULPA 4DV0Q 2K50A 2K75A 5LMNQ 4A3EG 1N36L 1HR0W 1PH9A 2PQAB 3BJUA 3J80c 1VQAA 4X64L 3M7NA 2ALYB 2ASBA 4GN4B 5IYBG 4B3SQ 3OYYA 3AFPA 3E9IA 4IPHA 3CCRA 1IBML 4DV3Q 2CWAA 3KF6A 3GTLH 2UU9L 1KL9A 2K4KA 2HHHL 4KHZA 2NZOA 3PUWA 4C3IH 4A3DG 4PMWA 4LUOA 1WJJA 2H5XA 1IXRA 4O0AA 1W3SA 2EXDA 3AYHB 1HZ9A 2RCNA 3EIVA 2YV5A 3KDFB 4YHHQ 4A75A 1PYSB 1IBKQ 1MKHA 4LF4Q 4HJ8A 2PNHA 2B63G 1IL2A 5FJ8H 3DM3A 3PIOA 1AE3A 2RF4A 2JA8H 2E2IH 4BBSG 1E7ZA 4WJ4A 1S40A 4ALPA 1KQSA 3W1BA 5C4JH 1XPRA 3MEFA 4HIKA 1IBLQ 4DR7L 3F1ZA 2BH8A 2VQFQ 4JI4Q 4DV5L 5J3BA 1IYJB 2AWOA 1X3FA 4DR5L 2MNAA 3AFQA 1Q8KA 2LSSA 2ZM6L 4YWKA 3T1YQ 3S24A 2I0QA 3TEHB 1X54A 4YCWA 3HOXH 3OW2A 3J80i 1VQKA 3CW2C 4DAMA 1OXUA 4R4CA 2K5HA 3M85A 2YTYA 1BKBA 2IHEA 3GD7A 4LUZA 4R4QA 3CCVA 4DR1L 1BBUA 2MQHA 2Q2HA 4LUVA 3CCUA 1KD1C 4GKKQ 3PUYA 1YHBA 1PH7A 4OWXB 2ZJRA 3HOVG 3KYHC 1AH9A 3GDEA 4R4TA 4X66L 1NMFA 3BZKA 2I5HA 1Q1BA 1N33L 5C4XG 1RIPA 5M3MG 2GN5A 3PO2G 1VQ5A 2CFMA 1XMOL 4AH6A 3KJOA 4A3JG 1E1TA 4POGA 2WFWA 3S2DH 4K0KL 2CQOA 4A93H 4JI5L 1X3EA 4GNXC 5H1SE 3FHWA 2UXBL 1K73C 1D8LA 3PO3H 1I5FA 3J7A5 1UE1A 4BBRG 5FLMH 1Q82C 2E2JH 4J15A 4JI6Q 4IJLA 1X9NA 3CC7A 4BY1H 3U50C 4KHPQ 1WCMH 3HFZB 2XTIA 1B8AA 3CPFA 4UPAA 1V43A 2F3IA 1ASYA 2UUCQ 1EUJA 2Y0SG 5M5WH 4X65L 1SRUA 3CXCA 1GM5A 1VS0A 3K7AH 5DLQE 4A3CH 1C0AA 4DPGA 1VQEA 2XGTA 3SGIA 2D0PA 3STBC 1UE6A 2QEXA 4NXML 4DV6Q 4JV5Q 4DR2Q 1A0IA 5GAHC 3CCLA 1HJPA 3I7FA 5IP7H 2Z6KC 3H0GH 4A3BH 4PG3A 5K36G 4P72A 1FJGQ 3RR5A 4PZ8A 4EX5A 3CD6A 1Y1VG 3GTMH 5HGQA 2VY3A 1YVCA 4OO1I 4QQBX 4WJ3M 4LF5Q 1M90C 5M5YH 1H95A 1VQFA 3F2CA 4HIMA 1PA6A 4MZ9A 1PH2A 1VCIA 3E0EA 5IE8A 3HOZG 1TWCH 4JBMA 2N3SA 4DV4L 3CAMA 4LF9L 3I4NG 4APVA 1Z47A 1UE7A 1PV4A 1HNWQ 4JI3L 4LF7L 3HKZG 4JYAQ 3FKIG 3H3VI 1K83H 4PZ7A 1N34L 4Y7NH 2UXCQ 1QUQB 2FXQA 2GVBA 1NY4A 2ZTCA 1CUKA 4JCVE 4A3KH 1W2BA 5JEAJ 5IYDH 2V1CC 3BU2A 4GLVB 5LMUQ 1NBWA 3K0XA 2E2HH 2JA7H 1SR3A 3J81c 2GVAA 4GKJQ 5IY0A 3ERSX 5JEAG 1JJGA 1UE5A 3HOYG 1CKNB 4OONA 2K52A 4YY3Q 1YZ6A 2Z6KA 1DGSA 3I56A 4EQ5A 5IP9G 1V1QA 3CCMA 4A3EH 4C2MH 2R7ZG 3RLFA 1YJ9A 1N36Q 3S1RH 3AEVA 2UUAQ 4X64Q 1VQJA 3LGJA 1Q1EA 4R4OA 4R1JA 5IYBH 4DR3L 4LFBQ 5AJ3L 3CC4A 4QIWE 1IBMQ 1GD7A 1PFSA 1X65A 4HJ5A 1XPOA 3T1HL 2UU9Q 2HHHQ 4A3MG 4A3DH 4DNIA 1M1KC 1SN8A 5BR8L 3S1NH 3M4QA 1L1OB 5IWAL 3HOUG 5JJKA 4QY7A 5GQOA 4LFCL 4BA2I 2B63H 5M3FG 4JOIA 4MTNA 4GLAC 4YCVA 2ZTDA 4P75A 2BA0A 4A4IA 4GOPA 1XMQL 1YHQA 1JMCA 2YYZA 3D0FA 3J81j 2K5VA 1KRTA 1VQ9A 4BBSH 2PI2A 1S3OA 4DV7Q 5HY6A 1OXSC 4OWTB 4DR7Q 2NN6G 2R7DA 3J81i 5IYCH 3ZJYC 1YJNA 2CWPA 4DV5Q 5GAGC 1X3GA 2WP8J 4DR5Q 1YEZA 4LF6L 2DUDA 1TWAH 2F4VL 3UDXA 4ME3A 1EIFA 1GO3E 2ZM6Q 1UWVA 3PCOB 2I5MX 2PQAA 4B3MQ 2AMCB 5FLXc 3H15A 4L5RC 3CPWA 2OTLA 3PF5A 4X62L 1EQRA 3G48A 4DR6Q 4DR1Q 4POFA 1HR0L 2E5LQ 2KCTA 2RHSB 3KF8B 1PH6A 3HOVH 1FVIA 2BH2A 1OXTA 2KBNA 4DV1L 3RZDH 3I4OA 4X66Q 2ZTEA 5C4XH 1XNQL 5M3MH 4IPDA 1N33Q 3PO2H 3TS2A 3K81C 3KDFA 4A3JH 1XMOQ 4TQUS 1KC8C 4UY8C 1E1OA 4JI1L 3GTPH 1J6QA 2JEBI 2KHJA 4K0KQ 4JI5Q 3G4SA 4HIDA 2NZHA 4AYBG 2IY5B 4IJHA 1Y14B 3K8AA 1PH4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RLN A;  3OTO L;  2JEA I;  4A3G G;  2VNU D;  2AHO B;  3K80 C;  3CF5 A;  4AQY Q;  4BBR H;  4DUY L;  3CC2 A;  2WB1 G;  2Y0S E;  2B29 A;  3NEL A;  3RLO A;  3A5U A;  1VQ4 A;  1JJ2 A;  2JE6 I;  1VQM A;  5JJL A;  1E3P A;  4GS3 A;  4OO1 G;  3GTK H;  3UDI A;  2VS1 A;  3FP9 A;  4X65 Q;  3CCQ A;  1YIJ A;  1N8R C;  4LFA L;  4A3L H;  4X6A H;  2MO1 A;  4NXM Q;  3RNU A;  2JA6 H;  1P16 A;  3CCE A;  4QL5 A;  4B3T L;  1Y1V H;  2B3G A;  3CCS A;  1TWF H;  4P74 A;  4HJA A;  4JI0 Q;  2EQS A;  4B3R L;  5ELN A;  3HKZ E;  4JI4 L;  4XTC S;  2VQE Q;  4QJF A;  2D0O A;  1X56 A;  3BZC A;  4LW1 A;  2C35 B;  2OCE A;  4HJ7 A;  3I4N H;  4IFD I;  4DV4 Q;  4LF9 Q;  4R4I A;  1VQN A;  2KCM A;  3FKI H;  4BA1 I;  1VQC A;  1R9T H;  4JI3 Q;  4LF7 Q;  4NXN Q;  4H02 A;  1EFW A;  4LWC A;  3IRB A;  3HOX G;  1KIX A;  2EIF A;  1YHA A;  3JAM c;  3UE1 A;  3GTQ H;  1FL0 A;  2VL6 A;  4YWL A;  1HNZ L;  2A8V A;  4DR4 L;  4BXX G;  3ER0 A;  4RG1 A;  2R92 G;  4GKK L;  3W1G A;  4YWM A;  2YTV A;  3UE0 A;  4GNX A;  3RN2 A;  1YBY A;  2UUB L;  4LNQ A;  2A1A A;  4JI8 L;  3HOY H;  1PVO A;  4JI2 L;  2PI2 E;  1PH3 A;  3PIP A;  1I3Q H;  2N8N A;  5IP9 H;  1J5E L;  2OWO A;  2R7Z H;  3I4M G;  1C9O A;  1WOC A;  1LYL A;  5C3E G;  1E22 A;  4L5T A;  4DK3 C;  1Q12 A;  3PV0 A;  4UP8 A;  1Q7Y C;  4DR3 Q;  3HOW G;  2JA9 A;  1VQ8 A;  1K8G A;  2VUM G;  2K14 A;  4DAY B;  5IT9 c;  4A3M H;  1EOV A;  1HZB A;  1V9P A;  1VQB A;  3T1H Q;  1YJW A;  1HNX L;  2ES2 A;  4JI7 L;  1N32 L;  1SE8 A;  3JC6 6;  4KHP L;  2K5N A;  2N49 A;  1IZ6 A;  3HOU H;  1B7Y B;  1Z9F A;  1VQ6 A;  2IX1 A;  3B6Y A;  1WI5 A;  1X55 A;  5M3F H;  1Q86 C;  1MIU A;  1L1O C;  4P71 A;  3M4O H;  3JAM i;  3AQQ A;  4A3I G;  2DGY A;  1HZA A;  2MFI A;  3GO5 A;  4BY7 G;  1K9M C;  4P73 A;  1GKH A;  4DR2 L;  1AE2 A;  1K0R A;  3KLW A;  1WYD A;  3PUZ A;  3A74 A;  3RN5 A;  1CSQ A;  1TXY A;  4OXP A;  2F4V Q;  1MJC A;  2UXD L;  4UP7 A;  2HIX A;  1G6P A;  2A19 A;  3M3Y H;  2E8G A;  3PF4 A;  2ID0 A;  4AIM A;  4X62 Q;  3UDF A;  4XIG S;  4A3F G;  5GAE C;  4GOP B;  2NVT H;  3GTJ H;  1BVS A;  2NVY H;  3CP0 A;  1OXV A;  3J7Z C;  1HR0 Q;  3GTG H;  2R93 H;  3PUV A;  2OQK A;  4AYB E;  4DV1 Q;  4IOA A;  3U4Z A;  4C3H H;  2AWN A;  1Y1W G;  1XNQ Q;  1L1O A;  2ATW A;  3E9H A;  4GKJ L;  5ELO A;  4LF8 L;  3KF6 B;  4JBK A;  5LMN W;  2WB1 E;  2WAQ G;  4JI1 Q;  1CKM A;  1JB7 A;  1CSP A;  4DUZ Q;  3M9B A;  4GN3 B;  4A3B G;  4A3G H;  1K3R A;  2UUA L;  3F2D A;  3OTO Q;  2OTJ A;  1YNX A;  2CKZ B;  3G6E A;  3KJP A;  4DUY Q;  3PUX A;  4LFB L;  4DV2 L;  1TWH H;  3EN2 A;  1U0L A;  1VQG A;  2I5L X;  1XNR L;  1K8A C;  4GN5 A;  1I94 L;  2JA5 G;  4OX9 L;  3S1M H;  4IFD J;  4NB3 A;  1A62 A;  1D7Q A;  5C44 G;  1TWG H;  2HIV A;  2VW9 A;  3NBH B;  4DV0 L;  3TQY A;  4LFA Q;  1PH8 A;  2UXB Q;  5C0X I;  2ZJQ A;  5LMN L;  5JJI A;  4O2D A;  4IFD G;  3L0O A;  1SMX A;  2HQL A;  3I2Z A;  1XJV A;  3ULJ A;  1O7I A;  1QVC A;  4DV7 L;  3H3V H;  4NPS A;  4B3S L;  2L15 A;  4B3T Q;  1VQL A;  4B3R Q;  1OTC A;  4DV3 L;  1KHI A;  1SFO H;  1Q81 C;  2NVX H;  1UEB A;  1FGU A;  5IYC G;  3A0J A;  1VQO A;  1PH5 A;  4JBJ A;  4HIO A;  1S72 A;  1A63 A;  1QZH A;  4L5S A;  2Q2I A;  1L0W A;  2QGQ A;  4YHH L;  4LF4 L;  1LTL A;  5GAD C;  1IBK L;  2IT1 A;  3HKS A;  4B3M L;  3S14 H;  2BA1 A;  4UP9 A;  1G29 1;  2NN6 I;  5FJ8 G;  4IPG A;  2JA8 G;  1QVF A;  4BXX H;  1HNZ Q;  2R92 H;  1JT8 A;  4GLX A;  4DR4 Q;  1EWI A;  1PYB A;  1IBL L;  1NE3 A;  2VQF L;  2YTX A;  2E5L L;  2JQO A;  3M4P A;  1YI2 A;  4TVA B;  1EQQ A;  3RZO H;  1OXX K;  1XTD A;  2HT1 A;  1I50 H;  2UUB Q;  3HOZ H;  4A76 A;  4JI8 Q;  3KOJ A;  4DK6 C;  4JI2 Q;  1SRO A;  3T1Y L;  3TS0 A;  4PZ6 A;  3I4M H;  1J5E Q;  5C3E H;  5M5X H;  2IX0 A;  1QZG A;  1B70 B;  5GRO A;  4OWW B;  1N34 Q;  1LM0 A;  4IO9 A;  1LUZ A;  2Z0S A;  3F8T A;  3HOW H;  3W5O A;  4IOC A;  2Q2U A;  3A5Z B;  1KAW A;  2R93 G;  4AQY L;  2VUM H;  1NMG A;  2QA4 A;  2IHF A;  4JC0 A;  2CCZ A;  4OX9 Q;  1HNX Q;  1E24 A;  3K7U C;  1PH1 A;  4QGU A;  1RL2 A;  2YU9 H;  4JI7 Q;  2JK8 A;  1N32 Q;  2D62 A;  1L2F A;  3NEM A;  2LXJ A;  4C3J H;  3CQZ H;  4GNX B;  3GTO H;  1Q46 A;  1PHJ A;  2VZA A;  3L7Z C;  4A93 G;  4A3I H;  1HH2 P;  2AKW B;  1NTG A;  1CKO A;  2KHI A;  3ULL A;  1YIT A;  4A3L G;  4BY7 H;  3S2H H;  3PO3 G;  2MO0 A;  3L2P A;  3F2B A;  1GVP A;  2Q2T A;  3CMA A;  5E7N A;  5AJ3 Q;  4JBW A;  2JA6 G;  2NVQ H;  4RMF A;  1SLJ A;  1U5K A;  4JI6 L;  5FLM G;  3CCJ A;  1C7Y A;  4JI0 L;  1JE5 A;  2ZJP A;  3S1Q H;  2VQE L;  4BY1 G;  1X6O A;  3Q8D A;  5EAY A;  2F52 A;  1WCM G;  4YCU A;  3U4V A;  5BR8 Q;  1EYG A;  1VQ7 A;  2KEN A;  4DKA C;  5IWA Q;  1BBW A;  4LFC Q;  2UUC L;  2UXD Q;  3NEN A;  1QUQ A;  1XMQ Q;  1JJC B;  4MNO A;  3U58 A;  4FDB A;  3S17 H;  4A3C G;  4JV5 L;  3D31 A;  3DLL A;  1KXL A;  2R7F A;  4NXN L;  1A8V A;  4DV6 L;  4A3F H;  3S16 H;  3TRE A;  2LXK A;  2WAQ E;  5IP7 G;  3H0G G;  4HJ9 A;  4JOI C;  4KI0 A;  1MJE A;  4GOP C;  1FJG L;  3ICE A;  3TRZ A;  2RHQ B;  4DR6 L;  1Y1W H;  1KRS A;  4LF5 L;  1CKN A;  3EBE A;  4LF6 Q;  4L5Q A;  1VQH A;  4JG2 A;  4LF8 Q;  1N9W A;  3G71 A;  1VQD A;  1T9H A;  5C0X J;  1WFQ A;  3PSI A;  4IPC A;  1I6H H;  1HNW L;  3KFU A;  4JYA L;  1VQP A;  2JJQ A;  1NJI C;  1P8L A;  2UXC L;  1G51 A;  3MXN B;  3STB D;  3WWV A;  5IYD G;  4A3K G;  3S15 H;  4DUZ L;  5LMU L;  5C0X G;  3I55 A;  4DV2 Q;  3CME A;  4Y52 H;  2R6G A;  3PGZ A;  1ASZ A;  2JA5 H;  1QVG A;  1XNR Q;  1I94 Q;  2JA7 G;  2N78 A;  3UDG A;  2PMZ E;  2OQ0 A;  1EIY B;  1XPU A;  5C44 H;  4KLK A;  3VDY A;  4YY3 L;  1HZC A;  1VQI A;  3ULP A;  4DV0 Q;  2K50 A;  2K75 A;  5LMN Q;  4A3E G;  1N36 L;  1HR0 W;  1PH9 A;  2PQA B;  3BJU A;  3J80 c;  1VQA A;  4X64 L;  3M7N A;  2ALY B;  2ASB A;  4GN4 B;  5IYB G;  4B3S Q;  3OYY A;  3AFP A;  3E9I A;  4IPH A;  3CCR A;  1IBM L;  4DV3 Q;  2CWA A;  3KF6 A;  3GTL H;  2UU9 L;  1KL9 A;  2K4K A;  2HHH L;  4KHZ A;  2NZO A;  3PUW A;  4C3I H;  4A3D G;  4PMW A;  4LUO A;  1WJJ A;  2H5X A;  1IXR A;  4O0A A;  1W3S A;  2EXD A;  3AYH B;  1HZ9 A;  2RCN A;  3EIV A;  2YV5 A;  3KDF B;  4YHH Q;  4A75 A;  1PYS B;  1IBK Q;  1MKH A;  4LF4 Q;  4HJ8 A;  2PNH A;  2B63 G;  1IL2 A;  5FJ8 H;  3DM3 A;  3PIO A;  1AE3 A;  2RF4 A;  2JA8 H;  2E2I H;  4BBS G;  1E7Z A;  4WJ4 A;  1S40 A;  4ALP A;  1KQS A;  3W1B A;  5C4J H;  1XPR A;  3MEF A;  4HIK A;  1IBL Q;  4DR7 L;  3F1Z A;  2BH8 A;  2VQF Q;  4JI4 Q;  4DV5 L;  5J3B A;  1IYJ B;  2AWO A;  1X3F A;  4DR5 L;  2MNA A;  3AFQ A;  1Q8K A;  2LSS A;  2ZM6 L;  4YWK A;  3T1Y Q;  3S24 A;  2I0Q A;  3TEH B;  1X54 A;  4YCW A;  3HOX H;  3OW2 A;  3J80 i;  1VQK A;  3CW2 C;  4DAM A;  1OXU A;  4R4C A;  2K5H A;  3M85 A;  2YTY A;  1BKB A;  2IHE A;  3GD7 A;  4LUZ A;  4R4Q A;  3CCV A;  4DR1 L;  1BBU A;  2MQH A;  2Q2H A;  4LUV A;  3CCU A;  1KD1 C;  4GKK Q;  3PUY A;  1YHB A;  1PH7 A;  4OWX B;  2ZJR A;  3HOV G;  3KYH C;  1AH9 A;  3GDE A;  4R4T A;  4X66 L;  1NMF A;  3BZK A;  2I5H A;  1Q1B A;  1N33 L;  5C4X G;  1RIP A;  5M3M G;  2GN5 A;  3PO2 G;  1VQ5 A;  2CFM A;  1XMO L;  4AH6 A;  3KJO A;  4A3J G;  1E1T A;  4POG A;  2WFW A;  3S2D H;  4K0K L;  2CQO A;  4A93 H;  4JI5 L;  1X3E A;  4GNX C;  5H1S E;  3FHW A;  2UXB L;  1K73 C;  1D8L A;  3PO3 H;  1I5F A;  3J7A 5;  1UE1 A;  4BBR G;  5FLM H;  1Q82 C;  2E2J H;  4J15 A;  4JI6 Q;  4IJL A;  1X9N A;  3CC7 A;  4BY1 H;  3U50 C;  4KHP Q;  1WCM H;  3HFZ B;  2XTI A;  1B8A A;  3CPF A;  4UPA A;  1V43 A;  2F3I A;  1ASY A;  2UUC Q;  1EUJ A;  2Y0S G;  5M5W H;  4X65 L;  1SRU A;  3CXC A;  1GM5 A;  1VS0 A;  3K7A H;  5DLQ E;  4A3C H;  1C0A A;  4DPG A;  1VQE A;  2XGT A;  3SGI A;  2D0P A;  3STB C;  1UE6 A;  2QEX A;  4NXM L;  4DV6 Q;  4JV5 Q;  4DR2 Q;  1A0I A;  5GAH C;  3CCL A;  1HJP A;  3I7F A;  5IP7 H;  2Z6K C;  3H0G H;  4A3B H;  4PG3 A;  5K36 G;  4P72 A;  1FJG Q;  3RR5 A;  4PZ8 A;  4EX5 A;  3CD6 A;  1Y1V G;  3GTM H;  5HGQ A;  2VY3 A;  1YVC A;  4OO1 I;  4QQB X;  4WJ3 M;  4LF5 Q;  1M90 C;  5M5Y H;  1H95 A;  1VQF A;  3F2C A;  4HIM A;  1PA6 A;  4MZ9 A;  1PH2 A;  1VCI A;  3E0E A;  5IE8 A;  3HOZ G;  1TWC H;  4JBM A;  2N3S A;  4DV4 L;  3CAM A;  4LF9 L;  3I4N G;  4APV A;  1Z47 A;  1UE7 A;  1PV4 A;  1HNW Q;  4JI3 L;  4LF7 L;  3HKZ G;  4JYA Q;  3FKI G;  3H3V I;  1K83 H;  4PZ7 A;  1N34 L;  4Y7N H;  2UXC Q;  1QUQ B;  2FXQ A;  2GVB A;  1NY4 A;  2ZTC A;  1CUK A;  4JCV E;  4A3K H;  1W2B A;  5JEA J;  5IYD H;  2V1C C;  3BU2 A;  4GLV B;  5LMU Q;  1NBW A;  3K0X A;  2E2H H;  2JA7 H;  1SR3 A;  3J81 c;  2GVA A;  4GKJ Q;  5IY0 A;  3ERS X;  5JEA G;  1JJG A;  1UE5 A;  3HOY G;  1CKN B;  4OON A;  2K52 A;  4YY3 Q;  1YZ6 A;  2Z6K A;  1DGS A;  3I56 A;  4EQ5 A;  5IP9 G;  1V1Q A;  3CCM A;  4A3E H;  4C2M H;  2R7Z G;  3RLF A;  1YJ9 A;  1N36 Q;  3S1R H;  3AEV A;  2UUA Q;  4X64 Q;  1VQJ A;  3LGJ A;  1Q1E A;  4R4O A;  4R1J A;  5IYB H;  4DR3 L;  4LFB Q;  5AJ3 L;  3CC4 A;  4QIW E;  1IBM Q;  1GD7 A;  1PFS A;  1X65 A;  4HJ5 A;  1XPO A;  3T1H L;  2UU9 Q;  2HHH Q;  4A3M G;  4A3D H;  4DNI A;  1M1K C;  1SN8 A;  5BR8 L;  3S1N H;  3M4Q A;  1L1O B;  5IWA L;  3HOU G;  5JJK A;  4QY7 A;  5GQO A;  4LFC L;  4BA2 I;  2B63 H;  5M3F G;  4JOI A;  4MTN A;  4GLA C;  4YCV A;  2ZTD A;  4P75 A;  2BA0 A;  4A4I A;  4GOP A;  1XMQ L;  1YHQ A;  1JMC A;  2YYZ A;  3D0F A;  3J81 j;  2K5V A;  1KRT A;  1VQ9 A;  4BBS H;  2PI2 A;  1S3O A;  4DV7 Q;  5HY6 A;  1OXS C;  4OWT B;  4DR7 Q;  2NN6 G;  2R7D A;  3J81 i;  5IYC H;  3ZJY C;  1YJN A;  2CWP A;  4DV5 Q;  5GAG C;  1X3G A;  2WP8 J;  4DR5 Q;  1YEZ A;  4LF6 L;  2DUD A;  1TWA H;  2F4V L;  3UDX A;  4ME3 A;  1EIF A;  1GO3 E;  2ZM6 Q;  1UWV A;  3PCO B;  2I5M X;  2PQA A;  4B3M Q;  2AMC B;  5FLX c;  3H15 A;  4L5R C;  3CPW A;  2OTL A;  3PF5 A;  4X62 L;  1EQR A;  3G48 A;  4DR6 Q;  4DR1 Q;  4POF A;  1HR0 L;  2E5L Q;  2KCT A;  2RHS B;  3KF8 B;  1PH6 A;  3HOV H;  1FVI A;  2BH2 A;  1OXT A;  2KBN A;  4DV1 L;  3RZD H;  3I4O A;  4X66 Q;  2ZTE A;  5C4X H;  1XNQ L;  5M3M H;  4IPD A;  1N33 Q;  3PO2 H;  3TS2 A;  3K81 C;  3KDF A;  4A3J H;  1XMO Q;  4TQU S;  1KC8 C;  4UY8 C;  1E1O A;  4JI1 L;  3GTP H;  1J6Q A;  2JEB I;  2KHJ A;  4K0K Q;  4JI5 Q;  3G4S A;  4HID A;  2NZH A;  4AYB G;  2IY5 B;  4IJH A;  1Y14 B;  3K8A A;  1PH4 A; 
#chains in the Genus database with same CATH topology
 2VNU D;  1SNP A;  4MN3 A;  2AHO B;  5AFW A;  5EPL A;  3CF5 A;  4AQY Q;  4BBR H;  1SYF A;  4C56 C;  2WB1 G;  2O5J C;  2NVT B;  4EGV A;  2K5Q A;  1VQ4 A;  5JJL A;  1E3P A;  4OO1 G;  1D6E C;  2VS1 A;  3QIA A;  3UDI A;  1YIJ A;  5NUC A;  3I3C A;  1CHQ D;  5K36 H;  3M4Y A;  1P16 A;  5JOB A;  4B3R L;  1F9R A;  2WB1 B;  3OWE B;  3HOV B;  3HKZ E;  1DON A;  4XTC S;  2VQE Q;  4QJF A;  3RZD B;  3BZC A;  1X3P A;  1QB5 D;  4A3J B;  4R4I A;  1D5Z C;  1TT2 A;  4BA1 I;  1R9T H;  1VQC A;  4LF7 Q;  3QG1 A;  4IUU A;  1EFW A;  4LWC A;  3IRB A;  3HOX G;  2BDO A;  4RGT A;  1FL0 A;  3K58 A;  1EYC A;  4RG1 A;  1XTC D;  2R92 G;  3W1G A;  1F2Y A;  2UUB L;  2A1A A;  4JI8 L;  1RJT A;  3RD4 A;  5I6Y A;  2EY2 A;  2PI2 E;  1PH3 A;  3PIP A;  1JCK B;  2N8N A;  2Y0S B;  5IP9 H;  1IL8 A;  1E22 A;  4L5T A;  4XQQ A;  1VQ8 A;  1YJW A;  4KHP L;  1LT6 D;  1C48 A;  2K5N A;  2EYF A;  2MPM A;  1IZ6 A;  4F87 A;  1RD9 D;  5DNF A;  2IX1 A;  1G8Z D;  3HOZ B;  1Q86 C;  1L1O C;  3J7Y W;  2D5D A;  3JAM i;  1B3Q A;  2MFI A;  4BY7 G;  1SAP A;  1UAP A;  4RWS C;  1RKN A;  2HDL A;  1QWY A;  1STN A;  1PRT C;  4FF4 A;  1LAC A;  1R4Q B;  3KLW A;  3A74 A;  2MJ8 A;  4H13 C;  5L37 A;  1WTP A;  1MJC A;  5CV7 A;  1O80 A;  1SNQ A;  1QE6 A;  2KCN A;  4CKB A;  2ID0 A;  1HUM A;  1DJR D;  4ZQ3 A;  4XIG S;  4BY7 B;  4KN4 C;  2NVY H;  3J7Z C;  1OXV A;  1HR0 Q;  1KNA A;  3QWN A;  4AYB E;  2JXM B;  1Y1W G;  5ELO A;  3KF6 B;  1STA A;  2WAQ G;  4JI1 Q;  1LT5 D;  3MTS A;  1BBX C;  1ILQ A;  1RF2 D;  1EWC A;  4DUZ Q;  2CVR A;  3K57 A;  2AQ3 B;  3F2D A;  3T56 B;  5J22 A;  2CKZ B;  4LFB L;  2MP1 A;  3KJP A;  4DUY Q;  2QDB A;  1VQG A;  1HTP A;  3BVZ A;  4ILW A;  5EKI A;  3SEB A;  3S1M H;  3NTI A;  4K5W A;  2B2V A;  2G9D A;  1RTN A;  1H9R A;  1TWG H;  1SMY C;  2O4X A;  2WAQ B;  3D4D A;  5LMN L;  1CA6 A;  3M3Y B;  5JJI A;  3NBI A;  1V1P A;  2HQL A;  4FNF A;  1QVC A;  4NPS A;  1FNU A;  1MBY A;  1VQL A;  1OTC A;  3GTG B;  4M1U B;  1SFO H;  1Q81 C;  2NVX H;  5IYC G;  4J6H A;  1VQO A;  4C3H B;  1YNN D;  4JBJ A;  1S72 A;  1QZH A;  2Q2I A;  1JWU D;  1TU2 B;  4YHH L;  2IT1 A;  3HKS A;  1ICW A;  4FVM A;  1EY9 A;  2NN6 I;  1STE A;  3CRL C;  4ZYS A;  4DR4 Q;  1IKM A;  1IBL L;  2VQF L;  3M4P A;  1EQQ A;  4IUP A;  3RZO H;  3D8G A;  3GTL B;  4DK6 C;  5EPJ A;  2QCP X;  1ILP A;  3EFX D;  3J7A V;  3BZD B;  1HHV A;  1B70 B;  1TKW B;  2L1B A;  3MFY A;  3HOW H;  4AQY L;  3WOF A;  1FNV A;  5KYI A;  1HNX Q;  4G7O C;  5DM6 3;  4L8J A;  2D62 A;  4XQN A;  5D3D A;  1O7Z A;  3CQZ H;  3GTO H;  3N6R A;  3L7Z C;  4A93 G;  2NZ1 D;  1HH2 P;  3FPU B;  1CKO A;  1TII D;  1X3Q A;  5IIF A;  4A3L G;  3PO3 G;  2TSS A;  5AJ3 Q;  4JBW A;  2NVQ H;  2E74 C;  4Q5V A;  1U5K A;  4FP5 D;  1C7Y A;  1JE5 A;  4K8J A;  2VQE L;  3C46 A;  1X6O A;  3U4V A;  1WCM G;  4DKA C;  5IWA Q;  4FF1 A;  4LFC Q;  3MWY W;  2UUC L;  2UXD Q;  3VR4 A;  1QUQ A;  1JJC B;  4MNO A;  3U58 A;  1UEA B;  4JV5 L;  4A93 B;  2RA4 A;  3X3M A;  4A3F H;  2RKS A;  3S16 H;  3KBG A;  2I07 B;  2LXK A;  4K2L A;  2R3Z A;  3X3N A;  2VUM B;  4FF2 A;  1KRS A;  2K01 A;  1IW7 D;  3OIP A;  1VQH A;  2BDN A;  5FOB B;  4LMQ D;  4DNT B;  1VQD A;  3FRP B;  5C0X J;  1WFQ A;  3PSI A;  1I6H H;  4ABN A;  4A3I B;  1P8L A;  1NJI C;  2MHV A;  1EEF D;  1CM9 A;  5IYD G;  2LKV A;  1LLR D;  1TS5 A;  5LMU L;  1AEX A;  2EDG A;  1KTK A;  3PGZ A;  1EY6 A;  2JA5 H;  1QVG A;  3E5S A;  3S1Q B;  1I94 Q;  2OQ0 A;  5C44 H;  4KLK A;  1S4Z A;  5J1Z A;  1VQI A;  4DK0 A;  3S17 B;  1L0Y B;  2PQA B;  4ZRZ A;  4X64 L;  1EFI D;  2ALY B;  1TS2 A;  1AZP A;  4B3S Q;  1Y8O B;  1IBM L;  2RVL A;  5CC4 A;  2J0T D;  1B50 A;  3G7L A;  1F2Z A;  2H5X A;  3D3R A;  2F03 A;  2EXD A;  3EIV A;  3KDF B;  1IBK Q;  4LF4 Q;  3CD6 A;  2PZU A;  3KF8 A;  5FJ8 H;  5CV5 A;  3PIO A;  4BBS G;  2JN4 A;  4ALP A;  1XPR A;  1CK1 A;  1V1P B;  5CV9 A;  1BUV T;  3NWT A;  2MNA A;  2LSS A;  4YWK A;  4B08 A;  3I90 A;  3HOX H;  1LAB A;  1BCP D;  1QG7 A;  1OXU A;  4NKL A;  3MFG A;  2PMZ B;  4DR1 L;  3U9S A;  1KD1 C;  5FKA C;  4OWX B;  2ZJR A;  1AH9 A;  3ONA B;  4K6D A;  3IKJ A;  2BE5 C;  1N33 L;  1A3V A;  4C3I B;  2G9H D;  1XMO L;  1B2T A;  3T4A C;  1T5E A;  4POG A;  4K0K L;  1G6Z A;  3NXW A;  3FHW A;  1I5F A;  3J7A 5;  2XSC A;  2ICI A;  4BBR G;  4HED A;  1Q82 C;  5C4J B;  5A35 A;  1SYD A;  4BY1 H;  4X3T A;  3IL8 A;  2JYO A;  1B8A A;  4RKB A;  1HQM C;  1EUJ A;  3CXC A;  1GM5 A;  1VS0 A;  4DPG A;  3STB C;  4NXM L;  5G3L F;  1RTO A;  2QEX A;  1U4M A;  3K5L A;  1B4O A;  3CCL A;  1GUW A;  1HJP A;  5K36 G;  1YNJ C;  2Z6K C;  4P72 A;  1FJG Q;  3RR5 A;  1MGS A;  4ZCK A;  4EX5 A;  3M7G A;  1ICF B;  4K5V A;  5HGQ A;  1YVC A;  4WJ3 M;  1H95 A;  2SDF A;  5IE8 A;  2EVB A;  3CAM A;  3KK7 A;  3A8J E;  2GA4 B;  2KQ3 A;  1UE7 A;  1ZYR D;  3S2D B;  1HNW Q;  4XYQ A;  4Y7N H;  4DK1 A;  1H9S A;  1QUQ B;  2FXQ A;  4DNR B;  4GLV B;  1EY7 A;  1I4P A;  1SYC A;  2JA7 H;  4GKJ Q;  1JB3 A;  2EZV A;  4L6T B;  1JJG A;  3SXH A;  4KV6 A;  1U9R A;  5IP9 G;  4G7H C;  3VYU A;  4KY7 A;  4C2M H;  5A2Q E;  2F0E A;  2M2L A;  3LGJ A;  4R4O A;  4R1J A;  4U67 3;  5AJ3 L;  3CC4 A;  1DOL A;  1GD7 A;  1X65 A;  3E3X A;  3Q6S A;  1BNZ A;  2HHH Q;  4A3D H;  4ZK9 B;  3BYT B;  5IWA L;  1B9M A;  3MC0 B;  5JJK A;  4LFC L;  3SR1 A;  2XRQ D;  4YCV A;  2BA0 A;  3TDQ A;  3NUC A;  1KRT A;  1K83 B;  2B2V C;  1QNK A;  2B2Y A;  4XXE A;  2EJF C;  4DV7 Q;  3I73 A;  4A3K B;  4DR7 Q;  2O2L D;  5E4X A;  5IYC H;  3ZJY C;  2CWP A;  3WOE A;  5GAG C;  5FO8 B;  1PTO C;  1EIF A;  1GO3 E;  1STY A;  4KKU A;  1TS4 A;  3MZ5 A;  3H15 A;  4A3E B;  4X62 L;  1EQR A;  5ISR A;  3K6O A;  4DR6 Q;  2E5L Q;  1MSG A;  3KF8 B;  2BH2 A;  4DF7 A;  1XNQ L;  4IPD A;  5FO7 B;  2K6A A;  2KHS A;  3S1N B;  1ESF A;  1M4V A;  3CKI B;  4UY8 C;  3GTP H;  3HS0 C;  1SBB B;  3TBI B;  2NZH A;  4RKL A;  4Z9C B;  2B63 B;  3P75 A;  4IJH A;  3RLN A;  3OTO L;  1E2Z A;  1U4P A;  4OEM B;  4QUC A;  2Y0S E;  3NP8 A;  2K28 A;  2NVY B;  4FYD A;  3A5U A;  2JE6 I;  1JR0 D;  2WII B;  1VQM A;  4GZY C;  4G57 A;  4A3L H;  3H94 A;  3HGB A;  3CU7 A;  3RNU A;  1MSH A;  3CCE A;  3Q22 A;  4B3T L;  1Y1V H;  1TWF H;  4HJA A;  2EQS A;  1JOO A;  2D0O A;  1X56 A;  4LW1 A;  4X3S A;  5C4X B;  5M3M B;  4CGY B;  3PO2 B;  1W6K A;  3S1M B;  4LF9 Q;  3CHB D;  1VQN A;  4JI3 Q;  1TWG B;  3IFT A;  2EIF A;  3JAM c;  4N9P A;  3GTQ H;  1NUC A;  4YWM A;  2PCF B;  4NP5 A;  4GNX A;  3RN2 A;  2B2W A;  3J81 E;  3HOY H;  3H6M A;  4JI2 L;  3NTH A;  2AUK A;  4Q0F A;  2FHT A;  2R7Z H;  3GTK B;  1C9O A;  1LTS D;  3L9A X;  1GHJ A;  3DUZ A;  5IOC A;  3PV0 A;  4KTA A;  4DR3 Q;  3HOW G;  3SVM A;  1H9S B;  2K14 A;  4DAY B;  4OX9 L;  2F0H A;  3LWE A;  1N32 L;  1B3A A;  2Q8I B;  2F0U A;  1Z9F A;  4RGO S;  1SDF A;  1O7L A;  2BE5 D;  5M3F H;  1F9S A;  1WTV A;  4DN4 M;  1S5C D;  3AQQ A;  4IUR A;  2K1B A;  4P73 A;  2Z8L A;  3OHX C;  1AE2 A;  2NN6 H;  1WYD A;  2IW3 A;  3I8Z A;  1ZXT A;  2EYP A;  2SNS A;  1MHW C;  1PZI D;  2F4V Q;  1G6P A;  3CQZ B;  2E8G A;  5IGG A;  4AIM A;  4IUV A;  1TY2 A;  4A3F G;  3HZX A;  5FLX E;  5GAE C;  2IX3 A;  3CP0 A;  2NVQ B;  2F0T A;  4IOA A;  4DV1 Q;  2AWN A;  1SNO A;  4A3M B;  2ATW A;  4GKJ L;  4FXK C;  3PIO 3;  1KNE A;  3HOU B;  1CKM A;  4G7Z C;  1CSP A;  3D6C A;  3M4O B;  4GN3 B;  4A3G H;  2OTJ A;  1BR9 A;  4XQJ A;  4PV1 C;  1TWH H;  3EN2 A;  1SND A;  2NTS A;  2L0C A;  5CBE E;  5JVH 3;  2JA5 G;  4F7X A;  1WD0 A;  5C44 G;  2HIV A;  2VW9 A;  4DV0 L;  3TQY A;  1Q90 A;  4LFA Q;  2B8G A;  1SMX A;  3I2Z A;  5E3F A;  4DV7 L;  2L15 A;  2A69 C;  1PZJ D;  2DN8 A;  3K59 A;  4DV3 L;  2G5D A;  1FGU A;  1ENA A;  1PH5 A;  3BYY B;  1KLG D;  4HTH A;  2K5W A;  4L5S A;  3NK9 A;  4C1N I;  5GAD C;  2SEB D;  3BDL A;  1G29 1;  5FJ8 G;  1QVF A;  4BXX H;  2XIW A;  1HNZ Q;  1JT8 A;  2H4O A;  4GLX A;  1EWI A;  1F77 A;  1PYB A;  2E5L L;  4QQB X;  1YI2 A;  1BDO A;  2HUG A;  4K6L A;  1OXX K;  1EU4 A;  2CW0 C;  3T16 A;  2A73 B;  3TP8 A;  3OPO A;  1I50 H;  1LT4 D;  2EY5 A;  3I4M H;  3A7L A;  1J5E Q;  5JPM C;  1PTO D;  3K5O A;  5M5X H;  1QZG A;  1N34 Q;  2Z4H A;  1GUS A;  1LUZ A;  3W5O A;  4IOC A;  2Q2U A;  1KAW A;  1NMG A;  2IHF A;  4ZAI A;  1DZ1 A;  4JC0 A;  4OEL B;  2FFK B;  1RL2 A;  1J9O A;  2YU9 H;  2JK8 A;  4JI7 Q;  1L2F A;  3NEM A;  2PW7 A;  4C3J H;  4FO2 A;  1E2V A;  5DEH A;  4GNX B;  4EQP A;  2VZA A;  1PHJ A;  1K8M A;  2AKW B;  1NTG A;  5LHY 1;  3HOX B;  2MO0 A;  3L2P A;  1GVP A;  2IJ0 A;  5E7N A;  1WTR A;  2R92 B;  1WTX A;  2NBF A;  1LTI D;  4BY1 G;  1EYA A;  5JVG 3;  2B8F A;  2A6H D;  4XDX A;  2KEN A;  1K0S A;  3H09 A;  4ODG A;  4FDB A;  1EY4 A;  4IUQ A;  1A8V A;  4ZLT F;  1TS3 A;  3TRE A;  4XT1 B;  4KI0 A;  1WTO A;  3L3O C;  1EIG A;  1EWH A;  3FVQ A;  3V2T A;  3HG9 A;  1G2T A;  3VYS A;  4LF5 L;  3NPP A;  2B2Y C;  3MAQ A;  4LF8 Q;  5ELD A;  5LL6 S;  2RSN A;  2MGS A;  4YIJ A;  3BDO A;  1ENC A;  1O78 A;  5EJW A;  3KFU A;  2JJQ A;  4RAU C;  1EU3 A;  1E0B A;  2UXC L;  4X3K A;  5DM7 3;  3MXN B;  2M9V A;  1HA6 A;  3WWV A;  1BO0 A;  1ML0 D;  3S15 H;  5EBD A;  5CV6 A;  2QDL A;  3DHQ A;  3CME A;  4DV2 Q;  4N9T A;  5EBC A;  1XNR Q;  2JA7 G;  1SE2 A;  1K3B C;  2N78 A;  2PMZ E;  1PFB A;  1EIY B;  4HSV A;  1DCZ A;  1VDZ A;  4IFD H;  1N36 L;  1AFP A;  1EZ8 A;  3M7N A;  5BN3 A;  2CH4 W;  5E1F A;  1W6J A;  1JIC A;  2CWA A;  2UU9 L;  1GUN A;  3R93 A;  1Y1W B;  4A3D G;  2E2D C;  4NW2 A;  2JA7 B;  1ESR A;  1IXR A;  1CQF A;  1HZ9 A;  4BS9 A;  4HJ8 A;  2F0J A;  2JA8 H;  1C4Q A;  2KOL A;  4HIK A;  3F1Z A;  4JI4 Q;  2PW5 A;  4DV5 L;  4H7B A;  2AWO A;  4DR5 L;  4A3D B;  3NBH A;  3T1Y Q;  4YCW A;  3OSO A;  3LX0 A;  3J80 i;  1I4X A;  3M85 A;  1CTM A;  2YTY A;  4LUZ A;  3CCV A;  2R93 H;  2Q2H A;  2HCI A;  3PUY A;  1VMP A;  3GDE A;  3H3V C;  4X66 L;  4RCN A;  3BZK A;  5FK9 C;  2BCO A;  1HTL D;  1VQ5 A;  4AH6 A;  4V19 0;  3MXP A;  1E1T A;  4I7Z C;  2CQO A;  1X3E A;  4GNX C;  2CQA A;  4PNY A;  5COY A;  3SDZ A;  4ME5 A;  1XXG A;  1CZW A;  4N8F A;  3NHH A;  4XYO A;  1S5E D;  4JI6 Q;  3I72 A;  1LT3 D;  1B9N A;  2PPB C;  2F3I A;  1DXM A;  2DJF C;  4KD3 A;  5FO9 B;  1QNU A;  3K7A H;  3GTP B;  4WJ4 A;  1VQE A;  2XGT A;  3SGI A;  1A3U A;  2D0P A;  4FXG C;  4DV6 Q;  5GAH C;  3I7F A;  4IAL A;  2WKD A;  3GTM H;  1Y1V G;  1SNM A;  2EXZ A;  2A69 D;  5M5Y H;  1VQF A;  2ZXP A;  4MZ9 A;  1VCI A;  1TWC H;  2N3S A;  2VXW A;  1Z47 A;  5EKL A;  1VF7 A;  4LF7 L;  3HKZ G;  3MVV A;  4JYA Q;  1N34 L;  3VA7 A;  2GVB A;  3PO3 B;  2ZTC A;  1CUK A;  4OHJ A;  5TSS A;  2V1C C;  3SE0 A;  4JW0 A;  1S5F D;  1NBW A;  2E2H H;  2PZW A;  2E2J B;  5BN4 A;  1TWF B;  3R3O A;  3ERS X;  4I7A A;  5CGK A;  1WCM B;  1FYC A;  1QIL A;  4JK1 C;  1F2L A;  1PLF A;  3D4W A;  5CYU A;  5K5P A;  2F0M A;  2F4I A;  3HOY G;  4YY3 Q;  2X69 A;  1DGS A;  3CCM A;  5M5W B;  2R7Z G;  3RLF A;  3S1R H;  3QO2 A;  1VQJ A;  4OIK A;  5IYB H;  5KNB A;  1NR4 A;  3OWF A;  1XPO A;  4DAV A;  1CT1 D;  1M1K C;  2L11 A;  3SK5 A;  1JWS D;  2FJ2 A;  1CHP D;  3M4Q A;  3I91 A;  4R9W A;  3HOY B;  2N88 A;  4BA2 I;  5M3F G;  3BVM A;  1LTG D;  4JOI A;  4MTN A;  1JMC A;  3S2H H;  1AW7 A;  2FIN B;  2R7Z B;  3J81 j;  2KUM A;  1EL0 A;  5HY6 A;  5JPN C;  1WTQ A;  2NN6 G;  2R7D A;  1GUT A;  1YJN A;  2HQE A;  5IGF A;  1ROD A;  3S9W A;  4ME3 A;  2ZM6 Q;  1BOS A;  4B3M Q;  2AMC B;  3URY A;  3W2D A;  3CPW A;  4L5R C;  3G48 A;  2OT2 A;  1HR0 L;  3TSS A;  5I9O A;  3HOV H;  2Q8T A;  3RZD H;  1PRT D;  4KHV A;  1HFG A;  3I4O A;  2ZTE A;  1F9Q A;  3TS2 A;  4A3J H;  2ENB A;  3ND9 A;  4TQU S;  1E1O A;  4JI1 L;  4QIW B;  4JI5 Q;  1I4R A;  5IGE A;  4HID A;  1JWM D;  2XVS A;  4AYB G;  3P20 A;  1AZQ A;  2IY5 B;  4DUZ L;  3K8A A;  1V8Q A;  1BXT A;  4A3G G;  4BBS B;  3K80 C;  3KUP A;  4H0L C;  4DUY L;  2F1M A;  2B29 A;  3RLO A;  1JJ2 A;  1A6X A;  3SK8 A;  1SXT A;  3D4R A;  4GS3 A;  3TN2 A;  2LS0 1;  3VR6 A;  1UUP A;  3FP9 A;  4X65 Q;  1N8R C;  2EYM A;  5C3W A;  2D2C C;  4QL5 A;  2P5Z X;  3CCS A;  4HSP A;  1JQY D;  4P74 A;  5ELN A;  4JI4 L;  1VF5 C;  4R8I A;  2OCE A;  4HJ7 A;  1CZG A;  3I4N H;  4IFD I;  4DV4 Q;  2KCM A;  3FKI H;  2F0K A;  4NXN Q;  4H02 A;  1SMY D;  1YHA A;  2A8V A;  5CV4 A;  4DR4 L;  4BXX G;  5C3X A;  4BBR B;  3DEP A;  3A8K E;  1GUO A;  2JSO A;  1YBY A;  5JEA H;  4LNQ A;  4DAP A;  1PVO A;  1PH4 A;  2F0P A;  5E4W C;  1NSN S;  2PNR C;  1I3Q H;  2OWO A;  4PMC A;  3I4M G;  1WOC A;  2K04 A;  5EPK A;  4DK3 C;  1Q12 A;  4UP8 A;  1Q7Y C;  2M00 A;  1CA5 A;  3NTK A;  2L5T A;  2JA9 A;  1K8G A;  4N8X 1;  4RA8 A;  1MD2 D;  5IT9 c;  1EOV A;  1HZB A;  1V9P A;  1VQB A;  3T1H Q;  1HNX L;  3KLR A;  2ES2 A;  1JOR A;  3JC6 6;  5C4H A;  5IT9 L;  2J7Z A;  1B7Y B;  3OMG A;  4QMG A;  1VQ6 A;  3B6Y A;  1X55 A;  4C3J G;  2XRS D;  2EJG C;  2DGY A;  1R9T B;  3GO5 A;  1K9M C;  1BCP F;  1GKH A;  2NUC A;  1K0R A;  2V4D A;  3RN5 A;  1O7Y A;  3SK4 A;  1CSQ A;  2H1E A;  1TXY A;  2ZXO A;  4OXP A;  2UXD L;  1LTA D;  2A19 A;  4TSS A;  3M3Y H;  3FEW X;  3A8I E;  3UDF A;  3GTJ H;  1BVS A;  1A2U A;  4JVZ A;  3GTG H;  3PUV A;  2F0Q A;  2OQK A;  1IYU A;  3BVG A;  4C3H H;  1SJE D;  5KIX A;  1L1O A;  3TP7 A;  4JBK A;  1DOK A;  2WB1 E;  3OOC A;  1BQQ T;  1PZK D;  1FNW A;  1K3R A;  1I4H A;  1YNX A;  2PYK A;  4DA2 A;  4WFN 3;  3D6W A;  5I6W A;  3V05 A;  3NSW A;  2I5L X;  1LTB D;  3IFD A;  1I94 L;  5KNC A;  3CRK C;  2BOS A;  1OO9 B;  1XYI A;  1NNX A;  3A56 A;  2UXB Q;  2B2T A;  1PH8 A;  2OEO A;  3BG3 A;  4O2D A;  4IFD G;  3L0O A;  3QJY A;  1X32 A;  5J39 A;  1ET6 A;  1XJV A;  4B3S L;  2HD3 A;  4B3R Q;  2F0N A;  1ONL A;  3A0J A;  2K03 A;  4HIO A;  1A63 A;  1SE4 A;  1SSO A;  1HXY D;  1C8C A;  2K33 A;  1L0W A;  2QGQ A;  4LF4 L;  1LTL A;  1IBK L;  4B3M L;  4RFB A;  2BA1 A;  4UP9 A;  3S14 H;  2TMP A;  4H44 C;  2JA8 G;  1H9K A;  3JAM E;  3T53 B;  4TVA B;  1SYE A;  4DXF A;  4WOR A;  2N55 A;  2UUB Q;  4A76 A;  4JI8 Q;  3KOJ A;  5COR A;  2F3W A;  3TS0 A;  1HRJ A;  3A54 A;  5C3E H;  2F0G A;  2RBM A;  2IX0 A;  5GRO A;  1LM0 A;  1B44 D;  2Z0S A;  3F8T A;  3LWU A;  3A5Z B;  1JC7 A;  2R93 G;  2VUM H;  2QA4 A;  1E2W A;  4RH6 A;  3K7U C;  1SFO B;  5C5L A;  2NVX B;  2LY7 A;  4MHE A;  3G6J B;  1Q46 A;  2FMC A;  3A7A B;  4A3I H;  2KHI A;  3K5M A;  3WDN A;  3F2B A;  3CMA A;  1PFM A;  2JA6 G;  4CJ2 C;  3FPP A;  2F0O A;  1R4P B;  4LJZ C;  3CCJ A;  3I4L A;  3S1Q H;  1I4Q A;  3ITP A;  3RZO B;  3Q8D A;  5EAY A;  2F52 A;  5BR8 Q;  5EGT A;  4DGZ A;  1EYG A;  1BBW A;  1CI3 M;  3NEN A;  3DEO A;  2A68 C;  3S17 H;  3D31 A;  4CKC A;  3DLL A;  2R7F A;  2F0V A;  2F0F A;  4NXN L;  1KXL A;  4CBV A;  2C9O A;  2EY6 A;  2XN9 C;  1II3 A;  3HOW B;  2WAQ E;  1FJG L;  3TRZ A;  2IWH A;  4JOI C;  2K7V A;  1GHK A;  4F88 A;  2K5D A;  3P1H A;  5I4D A;  1CFM A;  2KEC A;  4L5Q A;  4S3S A;  4JG2 A;  3DM1 A;  3MHB A;  1S5D D;  3J81 L;  3GTO B;  1HNW L;  3P7J A;  3H91 A;  3K7A B;  2Q8R E;  3STB D;  5JAV A;  5ELB A;  4CJ0 B;  2WIN B;  1YNJ D;  1YNN C;  2RSO A;  1PTO H;  1SEB D;  3UDG A;  1SNC A;  3E0J A;  2E75 C;  1HZC A;  3ULP A;  4CKE A;  2K50 A;  1HUN A;  2K75 A;  4HAE A;  5LMN Q;  2Z1C A;  3J80 c;  1VQA A;  4A3F B;  3R2I A;  4QB4 A;  1GXD C;  2F0W A;  1MI2 A;  3S16 B;  4GN4 B;  5IYB G;  4IPH A;  3E9I A;  3J80 L;  3TZU A;  2HDM A;  4V0B A;  2DNE A;  3KF6 A;  2E2H B;  1RHP A;  2HHH L;  3HEJ A;  4KHZ A;  4KJO A;  2EYH A;  4C3I H;  4LUO A;  1WJJ A;  1BCP B;  1K28 A;  2L55 A;  3AYH B;  5D14 A;  2RCN A;  4UHV A;  4YHH Q;  1PYS B;  1MKH A;  2XWJ B;  1I6H B;  2KCC A;  3DM3 A;  2AQ2 B;  1WD1 A;  1S5B D;  2ZT9 C;  2E2I H;  2SNM A;  4EQN A;  1S40 A;  5C4J H;  4DR7 L;  1IBL Q;  2VQF Q;  2BH8 A;  1HQR D;  1IYJ B;  2XWB B;  2JA5 B;  2J4X A;  2AUJ D;  3AFQ A;  1Q8K A;  2I0Q A;  4CDE C;  3TEH B;  5C44 B;  1A3T A;  1VQK A;  1VMC A;  3CW2 C;  2EOT A;  3DWA A;  3VR3 A;  1UNS A;  4LAA A;  3GD7 A;  4DR6 L;  1EQV A;  3CCU A;  4GKK Q;  1PH7 A;  2QF7 A;  3HOV G;  3KYH C;  4NMZ A;  4R4T A;  1NMF A;  3F2U A;  1Q1B A;  2I46 A;  2XNA C;  2GN5 A;  1LO5 D;  2CFM A;  2OF1 A;  3KJO A;  4A3J G;  3ZYY X;  2WFW A;  2CH4 A;  1IKL A;  3S2D H;  1TVX A;  3A55 A;  1RDP D;  5H1S E;  2UXB L;  2PO4 A;  5IGC A;  1UE1 A;  4BWG B;  4F8M A;  2RDH A;  5FLM H;  4J15 A;  1IW7 C;  1LTR D;  1PMR A;  4IJL A;  3AU7 A;  3CC7 A;  3U50 C;  2XTI A;  1STG A;  2KJX A;  5KRU A;  1DOM A;  4KD4 A;  4DU9 A;  2UUC Q;  1DM0 B;  2Y0S G;  4A3C H;  1SRU A;  1C0A A;  1J8I A;  5DLQ E;  4ID6 A;  4JV5 Q;  1UE6 A;  1SJH D;  4DR2 Q;  1A0I A;  5IP7 H;  4A3B H;  3H0G H;  4PG3 A;  5F2D A;  5T1I A;  1SYB A;  1TR5 A;  4EVO A;  5CV8 A;  5D65 A;  2VY3 A;  1M90 C;  3SHL A;  3F2C A;  2JP1 A;  3NE5 B;  3HOZ G;  4JBM A;  4LF9 L;  3I4N G;  1T5X D;  2EYO A;  4APV A;  4JI3 L;  3FKI G;  3O13 A;  1K83 H;  4PZ7 A;  1NY4 A;  4DFA A;  4A3K H;  4JCV E;  2LFN A;  3BU2 A;  2B2U A;  5C0X H;  5LMU Q;  3K0X A;  1WVL A;  1SR3 A;  2GVA A;  3EA6 A;  1PXU A;  4BY1 B;  5JEA G;  1UE5 A;  5KYL A;  1CQV A;  4OON A;  2K52 A;  1YZ6 A;  2Z6K A;  3I4N B;  1V1Q A;  4K2K A;  4A3E H;  1LTT D;  3AEV A;  2UUA Q;  3FKI B;  2L4N A;  4X64 Q;  4ZUJ A;  4DR3 L;  1TY0 A;  2K32 A;  3OMC A;  4QIW E;  4M8A A;  1IBM Q;  4FXD A;  1PFS A;  1Y69 U;  4KN7 C;  5BR8 L;  3S1N H;  4QY7 A;  1BCP C;  2B63 H;  5ELC A;  4GOP A;  4P75 A;  1KDB A;  1I3Q B;  1I6V C;  3D0F A;  1VQ9 A;  1PTO F;  2K5V A;  2PI2 A;  1EYD A;  3NQI A;  4Y7N B;  1DYQ A;  3OW7 A;  2SOB A;  2B2T C;  3J81 i;  2RDG A;  3OIQ A;  5M9O A;  1F2M A;  1X3G A;  3Q24 A;  1TWA H;  2F4V L;  3UDX A;  1D1I A;  1Y8P B;  1UWV A;  2PQA A;  2OTL A;  4J1M A;  4C2M B;  2EJM A;  2R61 A;  2A68 D;  4DR1 Q;  3VA5 A;  4O42 A;  2RHS B;  1PH6 A;  4KKT A;  4CJ1 B;  2NTT A;  3RMH A;  4DV1 L;  1BF4 A;  5C4X H;  4C3H G;  5M3M H;  1N33 Q;  3PO2 H;  3K81 C;  3KDF A;  1XMO Q;  3R2T A;  2JEB I;  4E6I A;  2LMC B;  4K0K Q;  3G4S A;  2PQE A;  1Y14 B;  3QB3 A;  4PQX A;  2JEA I;  3CC2 A;  2CHB D;  3GTJ B;  3NEL A;  4O1N A;  1EIH A;  1NR2 A;  1JOQ A;  2EPB A;  1ZYR C;  3NWS A;  3GTK H;  5IGB A;  3CCQ A;  2B2W C;  4X6A H;  4LFA L;  2MO1 A;  4NXM Q;  4K8I A;  2L12 A;  1I4G A;  2JA6 H;  1PDQ A;  1RCV D;  3VYR A;  2B3G A;  1QJO A;  3C1E A;  4JI0 Q;  5CR3 A;  2WKC A;  4J8Q A;  4B9X A;  2C35 B;  2WV6 D;  5C5M A;  1KIX A;  3UE1 A;  2VL6 A;  4IN3 A;  5D3I B;  4YWL A;  1HNZ L;  3ER0 A;  4GKK L;  4R8N A;  2YTV A;  1GOZ A;  3UE0 A;  2DJG C;  2HCC A;  2A5H A;  1STB A;  2F0I A;  3MXG A;  1J5E L;  1LYL A;  4UDU C;  5C3E G;  3E6Z X;  2WAC A;  3S14 B;  3KLS X;  2VUM G;  2EYJ A;  2OXP A;  1Y1V B;  2VB2 X;  4A3M H;  4JI7 L;  5KGU A;  1SE8 A;  3ERQ A;  4ZKB B;  2CW0 D;  2N49 A;  3HOU H;  4CDF C;  2F3V A;  1WI5 A;  1MIU A;  2FMM A;  4P71 A;  3M4O H;  1FD7 D;  4A3I G;  3HKZ B;  1HZA A;  5C3E B;  1STH A;  2KEE A;  1LV9 A;  4DR2 L;  3GTQ B;  3W3A A;  2KA7 A;  3R8B A;  4IZ8 A;  3PUZ A;  1G2S A;  1Z6H A;  4PMB A;  2A74 C;  1Y8N B;  4X3U A;  5I2Y A;  4UP7 A;  2HIX A;  3QR8 A;  3PF4 A;  2F0L A;  2C5C A;  4X62 Q;  1ET9 A;  4GOP B;  2NVT H;  3DXJ C;  2IL8 A;  2O5I C;  5I9P A;  3U4Z A;  4FF3 A;  4HCS A;  1XNQ Q;  3E9H A;  4C1N K;  4LF8 L;  2F0S A;  3MXU A;  4B9W A;  5LMN W;  4NDX A;  4ZKC B;  5G3L D;  5M3F B;  2AQ1 B;  1JB7 A;  1AP0 A;  3M9B A;  1EY8 A;  2UUA L;  3OTO Q;  1KAB A;  3G6E A;  4CDC C;  3PUX A;  2RCF A;  4OIJ A;  4QUF A;  4DV2 L;  1U0L A;  4JPB W;  3LNN A;  1XNR L;  1K8A C;  1ENF A;  4GN5 A;  2L9H A;  3VR5 A;  4ZUI A;  4IFD J;  1D5X C;  4NB3 A;  5IOD A;  4OO1 H;  3GP7 A;  1A62 A;  1D7Q A;  3NBH B;  5C0X I;  2ZJQ A;  3EVQ A;  4WRD A;  1Q3L A;  2QIL A;  1B1Z A;  3ULJ A;  1SYG A;  1O7I A;  2A6E C;  3H3V H;  4B3T Q;  3DWQ A;  3EJI A;  1KHI A;  1UEB A;  4C3I G;  1PTO B;  1JE4 A;  1WTW A;  3C3L A;  3C2P A;  3SK6 A;  4AYB B;  1KDA A;  4KY6 A;  4IPG A;  3MEH A;  4A3G B;  4QF4 A;  2R92 H;  4RGM A;  1NE3 A;  1A15 A;  2YTX A;  5EQ0 A;  2JQO A;  4KK7 A;  1TWH B;  4MIU A;  1XTD A;  2HT1 A;  1SE3 A;  3AB9 A;  3FMC A;  3BS1 A;  3HOZ H;  3DWP A;  2NYZ D;  3FDT A;  1SRO A;  4JI2 Q;  3T1Y L;  4PZ6 A;  3U9O A;  4OWW B;  4IO9 A;  2Z6B A;  1D2B A;  1EOT A;  3KLS A;  2E2I B;  3Q23 A;  4OX9 Q;  1E24 A;  3PIP 3;  1PH1 A;  2IPK D;  4QGU A;  1N32 Q;  5IT9 E;  3EQL C;  2B2U C;  4K14 A;  5T1G A;  2LXJ A;  3T13 A;  3GV6 A;  3RUZ A;  2DY8 A;  4BY7 H;  1YIT A;  3ULL A;  4IUT A;  2Q2T A;  2KVM A;  4RMF A;  3HP3 A;  1SLJ A;  4OL7 A;  4JI6 L;  2D9U A;  5FLM G;  4JI0 L;  2ZJP A;  2Z4I A;  1PRT F;  1VQ7 A;  1FR3 A;  4YCU A;  1IHZ A;  1HCZ A;  3HRZ C;  1I50 B;  2EYL A;  3GV3 A;  4UAI A;  1EQT A;  1XMQ Q;  3I4M B;  4A3C G;  5KND A;  4IQZ A;  4DV6 L;  5M5X B;  3KBX A;  4DAY A;  5IP7 G;  4HJ9 A;  3H0G G;  1MJE A;  1FGB D;  4A3B G;  4GOP C;  3ICE A;  4HCE A;  2RHQ B;  1Y1W H;  1JOK A;  5IGD A;  1CKN A;  3EBE A;  1IYV A;  5LL6 X;  4LF6 Q;  1H9M A;  2YU9 B;  1Q8I A;  1B53 A;  1N9W A;  3PMF A;  3G71 A;  1T9H A;  4C3J B;  4IPC A;  5JJZ A;  4JYA L;  4CHT B;  1VQP A;  5DAU A;  4MTK A;  1F9P A;  1G51 A;  1EY0 A;  4A3K G;  3V96 A;  5C0X G;  3I55 A;  4A3B B;  3H0G B;  4Y52 H;  3UI2 A;  2R6G A;  1ASZ A;  1G91 A;  4OGQ C;  3Q0A A;  1XPU A;  3K0Y A;  3PQI A;  3VDY A;  4YY3 L;  5HGT A;  2X6L A;  4I65 A;  4DV0 Q;  1WTH A;  1HR0 W;  4A3E G;  1PH9 A;  1HFN A;  3BJU A;  1XWE A;  5A2Q L;  1EZ6 A;  2ICE C;  5BN5 A;  4L63 B;  2ASB A;  3OYY A;  3AFP A;  3CCR A;  4DV3 Q;  2RQX A;  3GTL H;  1KL9 A;  1PYW D;  2K4K A;  2NZO A;  3PUW A;  2KED A;  4PMW A;  1D1K A;  4O0A A;  1W3S A;  1U4R A;  2YV5 A;  4A75 A;  2X6G A;  4RGN A;  2B63 G;  2PNH A;  1IL2 A;  1AE3 A;  2RF4 A;  1E7Z A;  5ELE A;  1KQS A;  3W1B A;  3MEF A;  3S15 B;  2DY7 A;  5J3B A;  4HMJ A;  1X3F A;  3GQB A;  2ZM6 L;  3S24 A;  1X54 A;  3OW2 A;  4DAM A;  5C6A A;  4R4C A;  2K5H A;  5CBA E;  1BKB A;  2IHE A;  4R4Q A;  1BBU A;  2MQH A;  4LUV A;  1YHB A;  2EY1 A;  1L0X B;  1H9J A;  2A6H C;  4U68 A;  2I5H A;  5C4X G;  1RIP A;  5M3M G;  3PO2 G;  1AN8 A;  2NWG A;  1DD2 A;  4IUN A;  1TWA B;  4A93 H;  4JI5 L;  4G4K A;  1K73 C;  1D8L A;  2ZXR A;  3PO3 H;  4K5X A;  1ZEQ X;  2E76 C;  2EE1 A;  2JA8 B;  4KJN A;  4XT3 B;  2E2J H;  1X9N A;  4TKO B;  1HA5 A;  4KHP Q;  1WCM H;  3HFZ B;  3CPF A;  4UPA A;  1V43 A;  1ASY A;  2CCZ A;  5M5W H;  4X65 L;  3ND8 A;  4KY5 A;  2QW7 A;  3T51 B;  5C4Z A;  3MA2 B;  1NAP A;  2R93 B;  4PZ8 A;  3JAM L;  2A6E D;  4OO1 I;  4LF5 Q;  2F0D A;  4TRD A;  4HIM A;  1PA6 A;  1PH2 A;  1PFN A;  3E0E A;  3QOJ A;  4HMI A;  4DV4 L;  1HPC A;  3TZD A;  1Z7T A;  5ELF A;  1PV4 A;  1D5M C;  3IAY A;  3H3V I;  2UXC Q;  3TP6 A;  3VYT A;  1W2B A;  3QOL A;  5IYD H;  1XX8 A;  5JEA J;  2JA6 B;  1NCV A;  2QEJ C;  1QOH A;  4RCO A;  4ULL A;  1GUG A;  3J81 c;  5IY0 A;  1EY5 A;  1KAA A;  3NQT A;  1CKN B;  4P2C B;  3I56 A;  4EQ5 A;  4DXG A;  5HUR A;  4LK1 C;  2B39 A;  3TP5 A;  1YJ9 A;  1N36 Q;  1Q1E A;  4KMU C;  4LFB Q;  3J80 E;  3VR2 A;  1KLU D;  3J7A F;  2RDF A;  4HJ5 A;  5EKK A;  3GTM B;  3T1H L;  2UU9 Q;  5CMD A;  4A3M G;  4QCL A;  2K05 A;  4KKS A;  4DNI A;  1SN8 A;  3TME A;  1M8A A;  5M5Y B;  1QCB D;  1L1O B;  3HOU G;  2NB0 A;  5GQO A;  1TWC B;  1EEI D;  1XMQ L;  1GJX A;  4GLA C;  3MXN A;  2ZTD A;  4A4I A;  3C1F A;  1YHQ A;  4RHR A;  2YYZ A;  4BBS H;  3ERO A;  3K5N A;  1PRT B;  1S3O A;  3BDC A;  1OXS C;  4OWT B;  1ZKO A;  3I70 A;  4DV5 Q;  1A2T A;  3N52 A;  4DR5 Q;  2WP8 J;  3DMU A;  1YEZ A;  4LF6 L;  2MUY A;  2DUD A;  4HN7 A;  1KDC A;  3PCO B;  2I5M X;  3AMU A;  5I2X A;  4RHS A;  4EQO A;  5FLX c;  5KEE A;  1K8O A;  3PF5 A;  4HR7 B;  3S1R B;  1TQO A;  4POF A;  5FLX L;  2PZT A;  2KCT A;  1FVI A;  2QKI C;  1OXT A;  2KBN A;  2DNC A;  1V1O A;  4WJW A;  4X66 Q;  2VB3 X;  1U4L A;  1KC8 C;  1J6Q A;  2KHJ A;  4CDD C;  3S2H B;  2Z9H A; 
#chains in the Genus database with same CATH homology
 3RLN A;  3OTO L;  2JEA I;  4A3G G;  2VNU D;  2AHO B;  3K80 C;  3CF5 A;  4AQY Q;  4BBR H;  4DUY L;  3CC2 A;  2WB1 G;  2Y0S E;  2B29 A;  3NEL A;  3RLO A;  3A5U A;  1VQ4 A;  1JJ2 A;  2JE6 I;  1VQM A;  5JJL A;  1E3P A;  4GS3 A;  4OO1 G;  3GTK H;  3UDI A;  2VS1 A;  3FP9 A;  4X65 Q;  3CCQ A;  1YIJ A;  1N8R C;  4LFA L;  4A3L H;  4X6A H;  2MO1 A;  4NXM Q;  3RNU A;  2JA6 H;  1P16 A;  3CCE A;  4QL5 A;  4B3T L;  1Y1V H;  2B3G A;  3CCS A;  1TWF H;  4P74 A;  4HJA A;  4JI0 Q;  2EQS A;  4B3R L;  5ELN A;  3HKZ E;  4JI4 L;  4XTC S;  2VQE Q;  4QJF A;  2D0O A;  1X56 A;  3BZC A;  4LW1 A;  2C35 B;  2OCE A;  4HJ7 A;  3I4N H;  4IFD I;  4DV4 Q;  4LF9 Q;  4R4I A;  1VQN A;  2KCM A;  3FKI H;  4BA1 I;  1VQC A;  1R9T H;  4JI3 Q;  4LF7 Q;  4NXN Q;  4H02 A;  1EFW A;  4LWC A;  3IRB A;  3HOX G;  1KIX A;  2EIF A;  1YHA A;  3JAM c;  3UE1 A;  3GTQ H;  1FL0 A;  2VL6 A;  4YWL A;  1HNZ L;  2A8V A;  4DR4 L;  4BXX G;  3ER0 A;  4RG1 A;  2R92 G;  4GKK L;  3W1G A;  4YWM A;  2YTV A;  3UE0 A;  4GNX A;  3RN2 A;  1YBY A;  2UUB L;  4LNQ A;  2A1A A;  4JI8 L;  3HOY H;  1PVO A;  4JI2 L;  2PI2 E;  1PH3 A;  3PIP A;  1I3Q H;  2N8N A;  5IP9 H;  1J5E L;  2OWO A;  2R7Z H;  3I4M G;  1C9O A;  1WOC A;  1LYL A;  5C3E G;  1E22 A;  4L5T A;  4DK3 C;  1Q12 A;  3PV0 A;  4UP8 A;  1Q7Y C;  4DR3 Q;  3HOW G;  2JA9 A;  1VQ8 A;  1K8G A;  2VUM G;  2K14 A;  4DAY B;  5IT9 c;  4A3M H;  1EOV A;  1HZB A;  1V9P A;  1VQB A;  3T1H Q;  1YJW A;  1HNX L;  2ES2 A;  4JI7 L;  1N32 L;  1SE8 A;  3JC6 6;  4KHP L;  2K5N A;  2N49 A;  1IZ6 A;  3HOU H;  1B7Y B;  1Z9F A;  1VQ6 A;  2IX1 A;  3B6Y A;  1WI5 A;  1X55 A;  5M3F H;  1Q86 C;  1MIU A;  1L1O C;  4P71 A;  3M4O H;  3JAM i;  3AQQ A;  4A3I G;  2DGY A;  1HZA A;  2MFI A;  3GO5 A;  4BY7 G;  1K9M C;  4P73 A;  1GKH A;  4DR2 L;  1AE2 A;  1K0R A;  3KLW A;  1WYD A;  3PUZ A;  3A74 A;  3RN5 A;  1CSQ A;  1TXY A;  4OXP A;  2F4V Q;  1MJC A;  2UXD L;  4UP7 A;  2HIX A;  1G6P A;  2A19 A;  3M3Y H;  2E8G A;  3PF4 A;  2ID0 A;  4AIM A;  4X62 Q;  3UDF A;  4XIG S;  4A3F G;  5GAE C;  4GOP B;  2NVT H;  3GTJ H;  1BVS A;  2NVY H;  3CP0 A;  1OXV A;  3J7Z C;  1HR0 Q;  3GTG H;  2R93 H;  3PUV A;  2OQK A;  4AYB E;  4DV1 Q;  4IOA A;  3U4Z A;  4C3H H;  2AWN A;  1Y1W G;  1XNQ Q;  1L1O A;  2ATW A;  3E9H A;  4GKJ L;  5ELO A;  4LF8 L;  3KF6 B;  4JBK A;  5LMN W;  2WB1 E;  2WAQ G;  4JI1 Q;  1CKM A;  1JB7 A;  1CSP A;  4DUZ Q;  3M9B A;  4GN3 B;  4A3B G;  4A3G H;  1K3R A;  2UUA L;  3F2D A;  3OTO Q;  2OTJ A;  1YNX A;  2CKZ B;  3G6E A;  3KJP A;  4DUY Q;  3PUX A;  4LFB L;  4DV2 L;  1TWH H;  3EN2 A;  1U0L A;  1VQG A;  2I5L X;  1XNR L;  1K8A C;  4GN5 A;  1I94 L;  2JA5 G;  4OX9 L;  3S1M H;  4IFD J;  4NB3 A;  1A62 A;  1D7Q A;  5C44 G;  1TWG H;  2HIV A;  2VW9 A;  3NBH B;  4DV0 L;  3TQY A;  4LFA Q;  1PH8 A;  2UXB Q;  5C0X I;  2ZJQ A;  5LMN L;  5JJI A;  4O2D A;  4IFD G;  3L0O A;  1SMX A;  2HQL A;  3I2Z A;  1XJV A;  3ULJ A;  1O7I A;  1QVC A;  4DV7 L;  3H3V H;  4NPS A;  4B3S L;  2L15 A;  4B3T Q;  1VQL A;  4B3R Q;  1OTC A;  4DV3 L;  1KHI A;  1SFO H;  1Q81 C;  2NVX H;  1UEB A;  1FGU A;  5IYC G;  3A0J A;  1VQO A;  1PH5 A;  4JBJ A;  4HIO A;  1S72 A;  1A63 A;  1QZH A;  4L5S A;  2Q2I A;  1L0W A;  2QGQ A;  4YHH L;  4LF4 L;  1LTL A;  5GAD C;  1IBK L;  2IT1 A;  3HKS A;  4B3M L;  3S14 H;  2BA1 A;  4UP9 A;  1G29 1;  2NN6 I;  5FJ8 G;  4IPG A;  2JA8 G;  1QVF A;  4BXX H;  1HNZ Q;  2R92 H;  1JT8 A;  4GLX A;  4DR4 Q;  1EWI A;  1PYB A;  1IBL L;  1NE3 A;  2VQF L;  2YTX A;  2E5L L;  2JQO A;  3M4P A;  1YI2 A;  4TVA B;  1EQQ A;  3RZO H;  1OXX K;  1XTD A;  2HT1 A;  1I50 H;  2UUB Q;  3HOZ H;  4A76 A;  4JI8 Q;  3KOJ A;  4DK6 C;  4JI2 Q;  1SRO A;  3T1Y L;  3TS0 A;  4PZ6 A;  3I4M H;  1J5E Q;  5C3E H;  5M5X H;  2IX0 A;  1QZG A;  1B70 B;  5GRO A;  4OWW B;  1N34 Q;  1LM0 A;  4IO9 A;  1LUZ A;  2Z0S A;  3F8T A;  3HOW H;  3W5O A;  4IOC A;  2Q2U A;  3A5Z B;  1KAW A;  2R93 G;  4AQY L;  2VUM H;  1NMG A;  2QA4 A;  2IHF A;  4JC0 A;  2CCZ A;  4OX9 Q;  1HNX Q;  1E24 A;  3K7U C;  1PH1 A;  4QGU A;  1RL2 A;  2YU9 H;  4JI7 Q;  2JK8 A;  1N32 Q;  2D62 A;  1L2F A;  3NEM A;  2LXJ A;  4C3J H;  3CQZ H;  4GNX B;  3GTO H;  1Q46 A;  1PHJ A;  2VZA A;  3L7Z C;  4A93 G;  4A3I H;  1HH2 P;  2AKW B;  1NTG A;  1CKO A;  2KHI A;  3ULL A;  1YIT A;  4A3L G;  4BY7 H;  3S2H H;  3PO3 G;  2MO0 A;  3L2P A;  3F2B A;  1GVP A;  2Q2T A;  3CMA A;  5E7N A;  5AJ3 Q;  4JBW A;  2JA6 G;  2NVQ H;  4RMF A;  1SLJ A;  1U5K A;  4JI6 L;  5FLM G;  3CCJ A;  1C7Y A;  4JI0 L;  1JE5 A;  2ZJP A;  3S1Q H;  2VQE L;  4BY1 G;  1X6O A;  3Q8D A;  5EAY A;  2F52 A;  1WCM G;  4YCU A;  3U4V A;  5BR8 Q;  1EYG A;  1VQ7 A;  2KEN A;  4DKA C;  5IWA Q;  1BBW A;  4LFC Q;  2UUC L;  2UXD Q;  3NEN A;  1QUQ A;  1XMQ Q;  1JJC B;  4MNO A;  3U58 A;  4FDB A;  3S17 H;  4A3C G;  4JV5 L;  3D31 A;  3DLL A;  1KXL A;  2R7F A;  4NXN L;  1A8V A;  4DV6 L;  4A3F H;  3S16 H;  3TRE A;  2LXK A;  2WAQ E;  5IP7 G;  3H0G G;  4HJ9 A;  4JOI C;  4KI0 A;  1MJE A;  4GOP C;  1FJG L;  3ICE A;  3TRZ A;  2RHQ B;  4DR6 L;  1Y1W H;  1KRS A;  4LF5 L;  1CKN A;  3EBE A;  4LF6 Q;  4L5Q A;  1VQH A;  4JG2 A;  4LF8 Q;  1N9W A;  3G71 A;  1VQD A;  1T9H A;  5C0X J;  1WFQ A;  3PSI A;  4IPC A;  1I6H H;  1HNW L;  3KFU A;  4JYA L;  1VQP A;  2JJQ A;  1NJI C;  1P8L A;  2UXC L;  1G51 A;  3MXN B;  3STB D;  3WWV A;  5IYD G;  4A3K G;  3S15 H;  4DUZ L;  5LMU L;  5C0X G;  3I55 A;  4DV2 Q;  3CME A;  4Y52 H;  2R6G A;  3PGZ A;  1ASZ A;  2JA5 H;  1QVG A;  1XNR Q;  1I94 Q;  2JA7 G;  2N78 A;  3UDG A;  2PMZ E;  2OQ0 A;  1EIY B;  1XPU A;  5C44 H;  4KLK A;  3VDY A;  4YY3 L;  1HZC A;  1VQI A;  3ULP A;  4DV0 Q;  2K50 A;  2K75 A;  5LMN Q;  4A3E G;  1N36 L;  1HR0 W;  1PH9 A;  2PQA B;  3BJU A;  3J80 c;  1VQA A;  4X64 L;  3M7N A;  2ALY B;  2ASB A;  4GN4 B;  5IYB G;  4B3S Q;  3OYY A;  3AFP A;  3E9I A;  4IPH A;  3CCR A;  1IBM L;  4DV3 Q;  2CWA A;  3KF6 A;  3GTL H;  2UU9 L;  1KL9 A;  2K4K A;  2HHH L;  4KHZ A;  2NZO A;  3PUW A;  4C3I H;  4A3D G;  4PMW A;  4LUO A;  1WJJ A;  2H5X A;  1IXR A;  4O0A A;  1W3S A;  2EXD A;  3AYH B;  1HZ9 A;  2RCN A;  3EIV A;  2YV5 A;  3KDF B;  4YHH Q;  4A75 A;  1PYS B;  1IBK Q;  1MKH A;  4LF4 Q;  4HJ8 A;  2PNH A;  2B63 G;  1IL2 A;  5FJ8 H;  3DM3 A;  3PIO A;  1AE3 A;  2RF4 A;  2JA8 H;  2E2I H;  4BBS G;  1E7Z A;  4WJ4 A;  1S40 A;  4ALP A;  1KQS A;  3W1B A;  5C4J H;  1XPR A;  3MEF A;  4HIK A;  1IBL Q;  4DR7 L;  3F1Z A;  2BH8 A;  2VQF Q;  4JI4 Q;  4DV5 L;  5J3B A;  1IYJ B;  2AWO A;  1X3F A;  4DR5 L;  2MNA A;  3AFQ A;  1Q8K A;  2LSS A;  2ZM6 L;  4YWK A;  3T1Y Q;  3S24 A;  2I0Q A;  3TEH B;  1X54 A;  4YCW A;  3HOX H;  3OW2 A;  3J80 i;  1VQK A;  3CW2 C;  4DAM A;  1OXU A;  4R4C A;  2K5H A;  3M85 A;  2YTY A;  1BKB A;  2IHE A;  3GD7 A;  4LUZ A;  4R4Q A;  3CCV A;  4DR1 L;  1BBU A;  2MQH A;  2Q2H A;  4LUV A;  3CCU A;  1KD1 C;  4GKK Q;  3PUY A;  1YHB A;  1PH7 A;  4OWX B;  2ZJR A;  3HOV G;  3KYH C;  1AH9 A;  3GDE A;  4R4T A;  4X66 L;  1NMF A;  3BZK A;  2I5H A;  1Q1B A;  1N33 L;  5C4X G;  1RIP A;  5M3M G;  2GN5 A;  3PO2 G;  1VQ5 A;  2CFM A;  1XMO L;  4AH6 A;  3KJO A;  4A3J G;  1E1T A;  4POG A;  2WFW A;  3S2D H;  4K0K L;  2CQO A;  4A93 H;  4JI5 L;  1X3E A;  4GNX C;  5H1S E;  3FHW A;  2UXB L;  1K73 C;  1D8L A;  3PO3 H;  1I5F A;  3J7A 5;  1UE1 A;  4BBR G;  5FLM H;  1Q82 C;  2E2J H;  4J15 A;  4JI6 Q;  4IJL A;  1X9N A;  3CC7 A;  4BY1 H;  3U50 C;  4KHP Q;  1WCM H;  3HFZ B;  2XTI A;  1B8A A;  3CPF A;  4UPA A;  1V43 A;  2F3I A;  1ASY A;  2UUC Q;  1EUJ A;  2Y0S G;  5M5W H;  4X65 L;  1SRU A;  3CXC A;  1GM5 A;  1VS0 A;  3K7A H;  5DLQ E;  4A3C H;  1C0A A;  4DPG A;  1VQE A;  2XGT A;  3SGI A;  2D0P A;  3STB C;  1UE6 A;  2QEX A;  4NXM L;  4DV6 Q;  4JV5 Q;  4DR2 Q;  1A0I A;  5GAH C;  3CCL A;  1HJP A;  3I7F A;  5IP7 H;  2Z6K C;  3H0G H;  4A3B H;  4PG3 A;  5K36 G;  4P72 A;  1FJG Q;  3RR5 A;  4PZ8 A;  4EX5 A;  3CD6 A;  1Y1V G;  3GTM H;  5HGQ A;  2VY3 A;  1YVC A;  4OO1 I;  4QQB X;  4WJ3 M;  4LF5 Q;  1M90 C;  5M5Y H;  1H95 A;  1VQF A;  3F2C A;  4HIM A;  1PA6 A;  4MZ9 A;  1PH2 A;  1VCI A;  3E0E A;  5IE8 A;  3HOZ G;  1TWC H;  4JBM A;  2N3S A;  4DV4 L;  3CAM A;  4LF9 L;  3I4N G;  4APV A;  1Z47 A;  1UE7 A;  1PV4 A;  1HNW Q;  4JI3 L;  4LF7 L;  3HKZ G;  4JYA Q;  3FKI G;  3H3V I;  1K83 H;  4PZ7 A;  1N34 L;  4Y7N H;  2UXC Q;  1QUQ B;  2FXQ A;  2GVB A;  1NY4 A;  2ZTC A;  1CUK A;  4JCV E;  4A3K H;  1W2B A;  5JEA J;  5IYD H;  2V1C C;  3BU2 A;  4GLV B;  5LMU Q;  1NBW A;  3K0X A;  2E2H H;  2JA7 H;  1SR3 A;  3J81 c;  2GVA A;  4GKJ Q;  5IY0 A;  3ERS X;  5JEA G;  1JJG A;  1UE5 A;  3HOY G;  1CKN B;  4OON A;  2K52 A;  4YY3 Q;  1YZ6 A;  2Z6K A;  1DGS A;  3I56 A;  4EQ5 A;  5IP9 G;  1V1Q A;  3CCM A;  4A3E H;  4C2M H;  2R7Z G;  3RLF A;  1YJ9 A;  1N36 Q;  3S1R H;  3AEV A;  2UUA Q;  4X64 Q;  1VQJ A;  3LGJ A;  1Q1E A;  4R4O A;  4R1J A;  5IYB H;  4DR3 L;  4LFB Q;  5AJ3 L;  3CC4 A;  4QIW E;  1IBM Q;  1GD7 A;  1PFS A;  1X65 A;  4HJ5 A;  1XPO A;  3T1H L;  2UU9 Q;  2HHH Q;  4A3M G;  4A3D H;  4DNI A;  1M1K C;  1SN8 A;  5BR8 L;  3S1N H;  3M4Q A;  1L1O B;  5IWA L;  3HOU G;  5JJK A;  4QY7 A;  5GQO A;  4LFC L;  4BA2 I;  2B63 H;  5M3F G;  4JOI A;  4MTN A;  4GLA C;  4YCV A;  2ZTD A;  4P75 A;  2BA0 A;  4A4I A;  4GOP A;  1XMQ L;  1YHQ A;  1JMC A;  2YYZ A;  3D0F A;  3J81 j;  2K5V A;  1KRT A;  1VQ9 A;  4BBS H;  2PI2 A;  1S3O A;  4DV7 Q;  5HY6 A;  1OXS C;  4OWT B;  4DR7 Q;  2NN6 G;  2R7D A;  3J81 i;  5IYC H;  3ZJY C;  1YJN A;  2CWP A;  4DV5 Q;  5GAG C;  1X3G A;  2WP8 J;  4DR5 Q;  1YEZ A;  4LF6 L;  2DUD A;  1TWA H;  2F4V L;  3UDX A;  4ME3 A;  1EIF A;  1GO3 E;  2ZM6 Q;  1UWV A;  3PCO B;  2I5M X;  2PQA A;  4B3M Q;  2AMC B;  5FLX c;  3H15 A;  4L5R C;  3CPW A;  2OTL A;  3PF5 A;  4X62 L;  1EQR A;  3G48 A;  4DR6 Q;  4DR1 Q;  4POF A;  1HR0 L;  2E5L Q;  2KCT A;  2RHS B;  3KF8 B;  1PH6 A;  3HOV H;  1FVI A;  2BH2 A;  1OXT A;  2KBN A;  4DV1 L;  3RZD H;  3I4O A;  4X66 Q;  2ZTE A;  5C4X H;  1XNQ L;  5M3M H;  4IPD A;  1N33 Q;  3PO2 H;  3TS2 A;  3K81 C;  3KDF A;  4A3J H;  1XMO Q;  4TQU S;  1KC8 C;  4UY8 C;  1E1O A;  4JI1 L;  3GTP H;  1J6Q A;  2JEB I;  2KHJ A;  4K0K Q;  4JI5 Q;  3G4S A;  4HID A;  2NZH A;  4AYB G;  2IY5 B;  4IJH A;  1Y14 B;  3K8A A;  1PH4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...