2EY2A

Crystal structure of staphylococcal nuclease mutant t41c
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
136
structure length
136
Chain Sequence
KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDCPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Staphylococcal nuclease
publication title Threonine mutants of Staphylococcal nuclease
rcsb
source organism Staphylococcus aureus
total genus 38
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2005-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2ey2A00
2PQEA 3SK5A 4NDXA 5KYIA 1TT2A 4HMJA 5J39A 3HEJA 2EYPA 3C1EA 3QOJA 1EZ8A 1A3VA 2LKVA 3D4WA 4KD4A 3DHQA 1EZ6A 3SXHA 4DFAA 5JAVA 4K6DA 2EY1A 1EQVA 1SNDA 4E6IA 5CV7A 4DF7A 4K5XA 2F0VA 4IUNA 1F2MA 5F2DA 3V2TA 5CGKA 4PMBA 1SYDA 2PZTA 1STHA 2RBMA 1KDAA 2EYFA 2F0PA 4ZUIA 2SOBA 4KY5A 4MIUA 5IGGA 2F0MA 4YIJA 4KJOA 3TP7A 1SNPA 2F0WA 2F0TA 4DGZA 1KAAA 1STBA 1JORA 2EYHA 1TR5A 5JOBA 4N9PA 2OXPA 1JOKA 3LX0A 4WRDA 5CV4A 1KDCA 1EY8A 2NUCA 3MVVA 1SNCA 1SNQA 5KYLA 5C4HA 1SYGA 3OMCA 4NP5A 5I6YA 2F0IA 1EYAA 5EGTA 3OWFA 5IODA 5C5LA 2RDFA 2F3VA 3PMFA 3D8GA 5DAUA 4I65A 4K2LA 4F7XA 1EY5A 2F0JA 2PYKA 2O4XA 4DU9A 2ENBA 4KHVA 3NK9A 5CR3A 3RUZA 2F0EA 2F0SA 2EY5A 2EXZA 4KJNA 4K5VA 5CV6A 2WACA 4K2KA 5I9PA 3P1HA 3EJIA 5IGFA 5KRUA 5E3FA 5CV8A 3NQTA 4G57A 2PW7A 4QMGA 2PZUA 5CV5A 3R3OA 2QDBA 4ID6A 4WORA 2F3WA 2M00A 3TP5A 3TMEA 3HZXA 2EYOA 3MXPA 1KDBA 1F2YA 4EQPA 2EY2A 2PZWA 4J6HA 1EY4A 3MHBA 5C3XA 3D4DA 4ME5A 2F0HA 1JOOA 4F8MA 3ERQA 2F0LA 4IZ8A 4KTAA 1EY7A 5IGEA 1SYCA 4N9TA 2F0NA 4KY6A 3NUCA 5M9OA 4RKLA 4B9WA 1A2TA 2F0GA 3OSOA 5C4ZA 5K5PA 5J22A 2EYJA 2F0UA 2HQEA 4J1MA 5CV9A 4QF4A 1SYEA 4TRDA 5DEHA 1EYDA 2F0QA 4KY7A 5HGTA 1STAA 5IOCA 4QB4A 3SK4A 1ENAA 1EYCA 4B9XA 1F2ZA 1SYFA 2EYLA 4PMCA 5I6WA 5KIXA 3MZ5A 1STNA 5C5MA 5EKKA 1NSNS 3C1FA 2F0FA 2F0OA 4LAAA 1STGA 3S9WA 1KABA 4EQNA 5KEEA 5EKLA 4ODGA 4PNYA 2PW5A 5ISRA 2KHSA 4NKLA 4KV6A 2RKSA 4HMIA 1A2UA 3SR1A 3QB3A 3H6MA 5NUCA 5IIFA 3BDCA 4K14A 4OL7A 5I9OA 1IHZA 3QOLA 5IGCA 2EY6A 1A3UA 1STYA 3ITPA 3NHHA 3SHLA 3U9OA 1EY0A 4H7BA 5C3WA 3NXWA 5KGUA 5J1ZA 1NUCA 1SNOA 4K5WA 2F0DA 1RKNA 3E5SA 3T13A 2OF1A 4EQOA 1EY9A 1ENCA 3OMGA 1AEXA 1SNMA 1U9RA 5IGDA 3NP8A 4RKBA 1JOQA 4R8NA 2F0KA 5HURA 2SNSA 5E1FA 3TP6A 1A3TA 5IGBA 2KQ3A 4K8IA 3D6CA 2OEOA 3EVQA 1TQOA 4K8JA 4KD3A 3SK8A 3TP8A 3VA5A 2EYMA 4EVOA 5C6AA 3DMUA 4NMZA 2SNMA 1SYBA 4S3SA 5CC4A 1EY6A 3T16A 4ZUJA 3P75A 3MEHA 4ZQ3A 4IALA 3EROA 3BDLA 4HTHA 1II3A 3SK6A
chains in the Genus database with same CATH superfamily
2PQEA 4JOIA 2ZXRA 3RLOA 3KFUA 1XWEA 4JI8L 1AZPA 1EZ6A 1Y1WB 4DV6Q 1K8OA 2PNHA 1TWCB 2ZXOA 4E6IA 2LSSA 1Q82C 4DR3L 2MJ8A 5LMNW 3F2CA 4IUNA 1PRTB 1CM9A 2NTSA 1O7YA 5T1IA 5FJ8G 1CFMA 1SNPA 1FGBD 2MFIA 1V1PB 1LTGD 2AUJD 3QIAA 1PH2A 3GTGH 1CKNA 3HS0C 4IURA 2UU9Q 1X9NA 1VQJA 5KYLA 3KJOA 1IXRA 1CKNB 5EGTA 4LFAQ 2CKZB 4FF2A 5M3MB 5DAUA 2AKWB 1HNWQ 4P2CB 4RGOS 5JEAH 2M2LA 4KLKA 5M5WH 4HN7A 2HCIA 2KEEA 2IX3A 4M8AA 2ZTEA 2IL8A 2K5QA 3MXPA 5E7NA 4DAVA 1LT3D 2VUMB 1Q8KA 1VF7A 2QILA 2EDGA 2A6HC 1WTQA 3R2TA 4JI8Q 1KQSA 4ME5A 1O78A 1I6HH 2R3ZA 4TSSA 1F77A 3CU7A 4QL5A 3M9BA 2F0GA 4XXEA 4LF7L 1O80A 1CZGA 2ID0A 1STAA 4C3HB 1F2ZA 1EQQA 5IT9E 3BZKA 1LABA 1D5MC 1NSNS 5M5XH 3H0GB 3KUPA 2E2JH 3KK7A 2Z6KA 3A55A 4NKLA 4DAPA 4PG3A 2L12A 3WOFA 2A6HD 1ET6A 2G5DA 1U5KA 1A3UA 2NN6G 1Y1VB 3VYRA 1XMQL 5EPKA 1QVFA 4A3IB 1F9PA 3L2PA 4GOPA 3AB9A 2N3SA 3HOXG 1SDFA 4CKBA 2KCCA 1EEID 4GOPB 1XPOA 2CHBD 3RZDH 2F0KA 1EWHA 1KAWA 3FKIB 2B63B 4QJFA 3SK8A 2D9UA 1BBUA 3D4RA 1D1IA 2SNMA 1SYBA 3NENA 4YCVA 1DZ1A 4WJWA 3MXNA 4IPDA 4X3TA 1HHVA 4LF7Q 1T9HA 3E9IA 4C1NK 3MXNB 4GN3B 1SLJA 4JOIC 1U4RA 3C1EA 3I4MG 3D4WA 1LACA 2KCMA 4ME3A 1EQVA 2J0TD 5EQ0A 5TSSA 4UHVA 1PZID 4IUUA 1T5XD 3QJYA 2FMCA 4O1NA 4X3KA 1RDPD 1KDAA 4A3BG 3QWNA 3M4YA 1H9KA 2B2UC 2EYHA 1TR5A 1WTPA 1IYUA 2CQOA 1XMQQ 5JVG3 1EY8A 3MVVA 1QVCA 1PH3A 5IYDH 1Y1WG 2F0IA 4O2DA 2FHTA 2E75C 4A3KH 2A5HA 2XIWA 1Q3LA 1B53A 1SSOA 2K52A 1ML0D 2F0EA 1AZQA 4RGNA 1V8QA 5CMDA 4KKUA 4IUPA 5KRUA 1GKHA 2R6GA 2M00A 2UXDL 4CDCC 1VQOA 1VQ6A 3M4OH 3FPUB 4OXPA 3VR3A 4DR5Q 2E2HH 5M3MG 2PZWA 1Y8OB 2WAQE 2KHJA 1SYCA 2A8VA 3HOZH 2ZXPA 4XT1B 5J22A 1YITA 4J1MA 4P73A 1EQRA 2EIFA 1Q90A 5HGTA 2L15A 2JA9A 3F2BA 5ELCA 5K36H 2Q2TA 5EKKA 1Q7YC 1PH8A 2VUMG 3CW2C 1ASZA 4OX9L 3E6ZX 2FINB 4R4QA 3S17B 4LF5L 2I0QA 3TRZA 5I9OA 1CUKA 5FLXL 1C8CA 4RHRA 4C3HG 4JI1L 4LUOA 3T13A 2BDNA 1FNVA 1HCZA 1EIYB 3HOVB 3H0GG 3CXCA 3MA2B 1YZ6A 1X3QA 4HIMA 1LM0A 1XTDA 1GVPA 1VS0A 1LUZA 3L0OA 4AYBB 1LTID 4NMZA 1CQVA 1Y1VG 2B39A 1H9RA 2VW9A 3TS2A 2Q8TA 1WYDA 4X62L 4A3IG 3TREA 4ZRZA 4WJ4A 4A93B 1TT2A 4FF4A 2MHVA 1S72A 5M3FH 3HEJA 1PTOH 1XYIA 2B63G 3FKIG 2YTXA 2YU9B 5CV7A 1QUQA 4B3SL 1EU4A 4OX9Q 1TWHB 2KBNA 1QUQB 4XT3B 4LF5Q 2F0WA 3VDYA 1UE7A 3IRBA 2VZAA 3IFTA 1O7ZA 1R9TH 3GTKH 5CV4A 4DN4M 4JI1Q 4OEMB 1JICA 1KRSA 4Y7NB 3M4PA 3R93A 3OWFA 3DWPA 1EEFD 1LLRD 2HDMA 1CI3M 1IKMA 3A56A 2XGTA 2F0SA 4RA8A 1JJGA 1I50H 1UNSA 4IFDJ 1IL2A 1K8GA 4X62Q 2R7FA 2B2TA 1K3RA 5C4XH 1BDOA 1BKBA 3J81L 3GTQB 4EQPA 2A6EC 3H91A 3CPFA 1DJRD 1YIJA 4KHPL 4R8IA 2K33A 3ERQA 4LF9Q 1JQYD 3ND8A 4B3SQ 3NUCA 4M1UB 2UUCL 1STEA 1GJXA 1QJOA 2N55A 3FMCA 3S1QH 3PSIA 4BWGB 4A76A 3NWTA 4NW2A 1EYCA 3HOUB 1STNA 4YWMA 4TKOB 3OW7A 1B44D 1STGA 1KABA 4EQNA 1IL8A 1GD7A 1DGSA 2ZTDA 3U9SA 1VMPA 1MHWC 4L63B 2R7ZG 2DN8A 5EJWA 4DXGA 4LF6L 1VQ8A 1EFWA 3MFGA 1RKNA 3IKJA 2KCNA 2MPMA 1HNZL 2D0PA 1LYLA 5IGDA 3OMGA 4IFDH 1WOCA 3TP8A 1X3EA 4KHPQ 2WB1B 3FDTA 1WTVA 3UDGA 1ESFA 5A2QE 2UUCQ 1VQ7A 5C4JH 4ILWA 3HOVG 1PFMA 2NZ1D 3T1YL 4QCLA 1D7QA 4LFCL 3W5OA 4DV4L 1U0LA 3KF6A 4HIKA 2XWBB 2RSOA 4FXGC 1JWUD 3KF6B 4AYBG 1EWIA 1PLFA 4HJ7A 3BDOA 3U4ZA 4IJLA 1C7YA 1XX8A 3UDFA 1NNXA 4A93G 4OO1H 5IYBG 4DV5L 3NPPA 1ET9A 4LF6Q 1CQFA 1MKHA 1HNZQ 1EYAA 5IODA 1GHJA 3CCLA 4ZKBB 2Z0SA 5IP7H 1I3QB 1IZ6A 5KNCA 2YTVA 2EY5A 1W3SA 3A8JE 4KJNA 1QCBD 4K2KA 3ER0A 5E3FA 1TS4A 1HZCA 3K7AB 1ESRA 4OGQC 2KUMA 3ONAB 3S14H 4LW1A 3T1YQ 2ES2A 3ZJYC 4JI5L 4IQZA 4LFCQ 1JE4A 3A8KE 1X6OA 5C3XA 4DV4Q 4DK0A 2PNRC 1Q46A 1MI2A 2F0NA 3ULPA 4DV3L 2CFMA 4LF4Q 5K5PA 1YJNA 1CT1D 1Y14B 3D3RA 1FL0A 1HR0L 2F0QA 4A3JH 1PA6A 4B9XA 2OQ0A 2K14A 3MZ5A 4A3DB 1EOVA 4XQQA 4DV5Q 3VR4A 2E74C 2FJ2A 5KEEA 1YJWA 5DNFA 2A68C 2E2IB 1J6QA 4C56C 1I94L 1V43A 3NHHA 2TSSA 5HGQA 1RJTA 3A7AB 1OXSC 2SDFA 3HOUG 3H94A 1BR9A 4KKSA 5JJLA 1PVOA 1JOQA 3TS0A 1TQOA 3VA5A 4PZ7A 1PH4A 4DNTB 3DMUA 1PH6A 4L5SA 5CC4A 3J80E 3P75A 1X56A 4BS9A 1L0WA 3F2UA 4DV3Q 1YNJD 1WTXA 1K28A 3I70A 2X6LA 1TIID 4OELB 4RH6A 1HR0Q 4HSVA 3QOJA 4B3ML 5FLXE 2RQXA 4Y52H 4XYQA 4V190 1SNDA 4RFBA 2XSCA 3PGZA 4X66Q 5C0XG 2UUBL 2WB1G 3HOYH 5FLXc 2BA0A 1IYVA 3BYTB 1SYDA 2R92H 4KY5A 1FD7D 3A74A 4HJAA 4BXXG 1A15A 2NVQB 2NWGA 2MNAA 1KAAA 3TQYA 1KHIA 4OONA 1I94Q 1HFGA 3URYA 2GVBA 1K83B 3CD6A 3CPWA 2AMCB 4UY8C 3NTIA 5C4HA 3CCUA 5C44H 1HR0W 4JI3L 1S40A 2F3VA 5G3LF 1PFSA 4I65A 3JAML 1TS5A 3S24A 1GOZA 4CGYB 4P71A 3GTLH 1JCKB 2WACA 1IBLL 2NZHA 2L0CA 1KLGD 4A3FH 2Q8IB 4L5QA 4NXML 5HY6A 1TWAB 2I5MX 3RZOB 1XXGA 1KNEA 4B3MQ 1IW7C 2QF7A 4R1JA 4FDBA 5GAEC 2UUBQ 3BVZA 5GAGC 4PV1C 3BYYB 2B2YA 5C3EB 3CQZH 4ABNA 2WINB 2B2WC 1AN8A 5IYCH 2HIVA 3KF8A 3KLRA 1PYWD 1RL2A 1EWCA 1UE5A 1MD2D 2BOSA 3KF8B 1FR3A 1KD1C 2Y0SB 2L11A 1CA6A 2L55A 4C3JB 2NVTH 3NEMA 2UXCL 2KHSA 4JI3Q 4HMIA 3ZYYX 1IYJB 1IW7D 1ONLA 1I4XA 3I72A 4TQUS 1VQLA 3HOWH 2EOTA 3S2DH 2BE5D 1K9MC 3E3XA 3PUXA 1VQNA 4HAEA 1IBLQ 4A3DG 1PH9A 4FYDA 3J80i 2JA6H 4LFBL 4A4IA 4L5RC 4QGUA 3UE1A 4DAMA 4NXMQ 1HTLD 2RVLA 2B8GA 3HOXB 2ALYB 3TZUA 1G2SA 2MO0A 1FVIA 3VYSA 4H13C 1SMYC 3C46A 4ZQ3A 2VQEL 3CCQA 3GTGB 2ICIA 3GDEA 3M4QA 5BN5A 2C35B 4QQBX 1A6XA 1AE3A 2EYPA 3OOCA 3DHQA 3HKZE 2HCCA 5IP9G 2IY5B 5F2DA 3I4MB 2UXCQ 2Z1CA 1ZXTA 2Q8RE 3VA7A 1NJIC 4LK1C 2QDLA 1CK1A 1SMYD 2K5NA 1PXUA 4PZ6A 4BY1H 2F3IA 1V9PA 1VQPA 1B3QA 2PQAA 2RF4A 1B2TA 4NP5A 1I5FA 2C9OA 2CW0C 5C5LA 2RDFA 2R93B 2PQAB 4LFBQ 1U4MA 1LTSD 3TDQA 3HKSA 1PMRA 2CWAA 4Q0FA 1BBXC 3MTSA 1HA5A 4JW0A 1YI2A 5GAHC 2DY8A 4EQ5A 1A0IA 1SE2A 3BJUA 4DK3C 1XMOL 1JC7A 2VQEQ 3GTJH 2E2JB 2VS1A 1TS3A 2NVXH 1ZYRD 2HT1A 1WVLA 3K6OA 3D4DA 2PMZE 4K0KL 3DEOA 3CCJA 1EY7A 2CW0D 5IGEA 2YTYA 4B9WA 2HQEA 5DEHA 1SYEA 1A63A 4KY7A 1E3PA 2IPKD 2L4NA 4BA1I 4G7OC 3M7GA 1S3OA 1ZKOA 3HRZC 3RZDB 2JA5H 1L1OA 4LAAA 4DNRB 2Z4HA 1VQCA 1FNWA 1L1OB 5ELEA 1A2UA 5IIFA 4RGTA 1GUWA 5C3EG 1STYA 3SHLA 1BXTA 3J7A5 2RCNA 4JI2L 4MZ9A 4HR7B 1SNOA 3CC2A 4JI4L 3SE0A 3VR5A 1XMOQ 1SNMA 5EPLA 4FXDA 1KC8C 2Y0SG 1G2TA 2G9DA 3K5MA 4C3JG 2I46A 4FO2A 5HURA 1K8AC 1C9OA 2RCFA 1BBWA 3X3NA 4K0KQ 3J7YW 4ZKCB 2K6AA 3MEHA 2A69C 3SVMA 1WI5A 4X6AH 2XN9C 2MQHA 1NAPA 3BZDB 1Y1WH 1D2BA 1YVCA 1PFNA 3BVMA 4H0LC 3V05A 2WKCA 4U68A 2B3GA 4K6LA 4K6DA 5ELNA 2F0VA 3X3MA 2PZTA 5ELFA 4CJ2C 3G7LA 4MIUA 1VQDA 3T53B 4DGZA 3GV3A 1PRTF 2B2VC 3M4OB 3A54A 1N34L 4JI2Q 1KDCA 2A69D 2UUAL 1K3BC 4JI4Q 4P75A 5M3MH 4DR5L 3D8GA 5JEAG 1AW7A 4HJ9A 3WOEA 3HOZB 1RTOA 2O4XA 3C3LA 1KXLA 4RCOA 1H9SA 4K5VA 3K0XA 1PRTC 2KEDA 1RTNA 4EGVA 3I91A 3IFDA 1H9SB 1SXTA 3NTHA 4GN5A 4QMGA 2N78A 4ID6A 1ICFB 3UDXA 2VUMH 5LL6X 2R93G 3AMUA 1VQAA 3GTPH 1EY4A 2K4KA 2ICEC 2P5ZX 2DGYA 1Q1EA 1RHPA 3I4NH 4PMWA 4DV1L 2AUKA 4TRDA 1EYDA 2K01A 2KECA 1SR3A 2QKIC 5DM63 4C3IB 5KIXA 2EYLA 1TWGB 1PRTD 1VQEA 4DR7L 3C1FA 1MSHA 4CDDC 1N34Q 2N8NA 2UUAQ 2MGSA 3NTKA 3I7FA 1E22A 2AQ3B 3S15B 2DJFC 3SR1A 4XQJA 2NZOA 1DXMA 3HKZG 3PIOA 3EBEA 4JPBW 2F0DA 1X32A 1PTOB 2IW3A 4AIMA 2OF1A 4MTKA 3VYTA 2R7ZB 3S16B 3FKIH 1S5BD 4WFN3 2VXWA 2YV5A 1XPUA 3J7AF 4GKJL 1E7ZA 4EVOA 1O7LA 1N9WA 3BVGA 3F2DA 2J4XA 2JA8B 4XIGS 1KRTA 1N33L 4A3LH 3Q22A 1F9RA 2JQOA 2Z6KC 1R4PB 4IALA 3PUYA 5T1GA 4DV1Q 3D6WA 3PV0A 4LNQA 2D5DA 2BA1A 4UDUC 1SRUA 4DR7Q 5FKAC 4A3GB 2VY3A 4GOPC 4BBRH 1K8MA 4L5TA 1M90C 2LMCB 3DLLA 1Q8IA 2WFWA 3LX0A 4WRDA 4OWXB 1CTMA 2MO1A 2V1CC 1UWVA 2WAQB 1VQGA 1YJ9A 4RGMA 2PYKA 4DU9A 4FXKC 4GKJQ 4KHVA 2UXBL 3S1QB 4LF9L 4H02A 3OW2A 3U50C 3N52A 4C2MH 1HNXL 2PI2E 1N33Q 2OWOA 4HCEA 4DV2L 3TMEA 2EYOA 1Y8NB 4GN4B 1KIXA 2JN4A 2Z6BA 1VQ5A 3HOZG 1ENFA 1IKLA 1TY2A 1QILA 3A0JA 1A2TA 1G6ZA 1LT5D 1HPCA 1N8RC 5C0XI 1PTOF 4QB4A 2HHHL 1G51A 4CJ0B 2K28A 2O2LD 3A5UA 2VQFL 3CP0A 1S5CD 4IUTA 4A3EH 1SE4A 3NSWA 2OTJA 3QB3A 3H6MA 5NUCA 1SFOH 1TWFB 2PCFB 4DV0L 3U9OA 5C4JB 4JBMA 3B6YA 3ITPA 2UXBQ 4XQNA 2O5IC 4C3IG 4QIWE 1HNXQ 2E76C 4XTCS 3MAQA 3JC66 3G48A 4DV2Q 1JB7A 1VMCA 1A3TA 4B3TL 3D6CA 5I2YA 1TXYA 3Q24A 2LS01 2KVMA 3OYYA 1IBKL 4BY7B 2A6ED 4A93H 1Q1BA 1V1OA 3S1NB 4BBSH 3I4OA 1EZ8A 1A3VA 2LKVA 2HHHQ 3FVQA 3HG9A 4RHSA 4GNXA 1TWHH 1LT4D 1F9QA 2AQ2B 3F8TA 2VQFQ 5CGKA 4GNXB 1TKWB 4QUFA 2JA8G 1STHA 3HFZB 1FNUA 1IBML 3PO3H 3I56A 1STBA 4DV0Q 1Y69U 1JOKA 1WTRA 1MBYA 1DONA 1WCMB 1SNQA 1SE3A 5FO9B 3ULJA 4A3GG 3GQBA 1W2BA 4A3MH 1EY5A 4FP5D 3TEHB 3PO2H 4RG1A 2NTTA 1NY4A 4B3TQ 4JI7L 4AH6A 1Z47A 2RDHA 1KLUD 3OHXC 4A3JB 5DLQE 4LF4L 3P20A 1AE2A 2PW7A 2PZUA 1ILPA 2QDBA 3K81C 1IBKQ 5EBCA 3GTQH 3OWEB 3PUWA 2WAQG 2DUDA 5D3IB 1E2WA 5JVH3 3SEBA 3CCSA 4F8MA 2PO4A 1N32L 2CVRA 1G6PA 5I4DA 2K75A 2I07B 4POGA 3EIVA 2IHEA 3VR6A 2MUYA 1IBMQ 3GTOB 5JJKA 5BN3A 3FRPB 1HUMA 4HCSA 3KYHC 3STBC 1K73C 1HZBA 1JJ2A 4HJ5A 4B3RL 2QW7A 2B2TC 4J8QA 4YCWA 3I4LA 4K14A 2XNAC 1JWSD 1IHZA 2EY6A 3DUZA 2BH2A 2VB3X 4JI7Q 4IPCA 1X54A 1J8IA 1EIFA 3E5SA 3P7JA 1K0SA 4IFDG 1PFBA 1EY9A 1SE8A 1UE1A 3HOYB 3KOJA 1M1KC 1EUJA 1S5FD 1EL0A 4K8IA 3EVQA 4X66L 5GADC 1B9MA 3PIPA 4BXXH 4LF8L 4S3SA 3PIO3 1EY6A 3NQIA 1N32Q 1WTOA 3S1MB 4POFA 4NDXA 2IWHA 5C44B 1GHKA 1XNQL 4C1NI 5IT9L 1D5ZC 1DD2A 1D6EC 4GNXC 3T1HL 1HRJA 1QNUA 2JE6I 5LMUL 2VB2X 4B3RQ 1VQBA 4OO1G 1DM0B 4BY7G 4APVA 2E8GA 3E0JA 2XTIA 2C5CA 5JPMC 5JJIA 1HUNA 3KLSX 1L0YB 2A68D 1AP0A 3OMCA 5IP7G 1HQMC 3DM1A 1I3QH 3GTMH 3A5ZB 1LV9A 3S1RB 4JBKA 3D0FA 4FF3A 5EBDA 2F03A 4ZAIA 5JJZA 1WTWA 3H3VI 1VQFA 4IOCA 4UPAA 3H15A 1E2ZA 4LF8Q 3K7AH 1BCPB 2V4DA 4WORA 5LL6S 2F3WA 1WCMG 3KBXA 4DR1L 1KDBA 5A35A 2JP1A 1YHQA 4KN4C 1Z7TA 1XNQQ 3MHBA 2NVYH 5M5YH 1DYQA 3S2DB 3T1HQ 1JB3A 3KLSA 4A3JG 2D2CC 5C4ZA 1NMFA 5LMUQ 1WTHA 4DPGA 4QY7A 2FFKB 5IOCA 1X3PA 3SK4A 4DKAC 4MTNA 2JA6B 1JMCA 2OQKA 3I90A 5C5MA 3Q23A 4DV7L 5FLMH 5D14A 4LMQD 4P72A 5ELBA 4PZ8A 3S9WA 1JT8A 2RHQB 2PW5A 3K0YA 2IT1A 2E2IH 2JA7H 4DR2L 2RKSA 1NE3A 1YHAA 1Q86C 1M8AA 4OL7A 4FVMA 4IN3A 3TN2A 2EQSA 3BU2A 1NCVA 3NXWA 5AFWA 4LUVA 5CBEE 1E1TA 3H09A 4ZK9B 4DR1Q 5IP9H 4R8NA 4GLXA 5E1FA 3TP6A 3DWAA 3M3YB 4CDEC 1C4QA 1GUSA 1SAPA 2ZM6L 4G7ZC 1CKMA 5G3LD 3SK5A 3J81E 4IPHA 3NE5B 3SDZA 4JC0A 3HOYG 1XNRL 4A3CH 4DV7Q 3J81c 2R92G 1DOKA 3EQLC 2NVQH 4PMBA 4ZUIA 1BOSA 4DR2Q 3PF4A 1Z9FA 1K83H 3F1ZA 1JORA 4BA2I 5C44G 1W6KA 5FJ8H 3W3AA 3CKIB 1NMGA 1SNCA 4PQXA 1SYGA 2Z8LA 5GROA 1UAPA 3L9AX 3CCEA 1UEBA 3S2HH 1HH2P 4U673 5CR3A 3RUZA 1F2LA 4A3FG 2EXZA 5I9PA 1B9NA 1G8ZD 2AHOB 4JI6L 2K50A 4X64L 1BVSA 1TWAH 2EE1A 2ZM6Q 5M5WB 4G7HC 5BN4A 2QA4A 2JA5B 1HFNA 3RZOH 1CHQD 1HZ9A 1CSPA 4UAIA 1DOLA 1BO0A 2RA4A 2PPBC 2E5LL 4J6HA 5EPJA 1WD0A 1NR2A 2IX1A 1XNRQ 5DM73 2JJQA 2LFNA 4KTAA 2FMMA 2QGQA 2K32A 4KY6A 3KBGA 1I6HB 1I6VC 3CC7A 3RMHA 5IYCG 1TVXA 2Q2HA 1G91A 2KJXA 5FO8B 1M4VA 4FNFA 2ZT9C 3D31A 3RR5A 3R2IA 5E4WC 5ELOA 4DR4L 1DOMA 1D5XC 1CHPD 4C3JH 3RLNA 2F0OA 5M5XB 1PYSB 4HEDA 3I73A 1QVGA 5FO7B 1B8AA 1LTRD 4DAYA 2OTLA 1E24A 4JYAL 3QOLA 3MXUA 3RD4A 4HIOA 4IO9A 4DAYB 3J7ZC 2JA6G 1DCZA 2WKDA 2HD3A 2NN6H 3Q8DA 2K03A 2L9HA 3EA6A 4EQOA 3OTOQ 4JI6Q 4X64Q 5FK9C 2B2YC 1B50A 5IE8A 3HKZB 4RKBA 3K59A 3LWUA 3HOXH 3K7UC 1V1PA 1GUNA 2B2UA 2KQ3A 5IWAL 2DNEA 3J81i 2E5LQ 3H3VC 2KHIA 4JBJA 1KTKA 2GA4B 2BCOA 2JYOA 1J5EL 4ZUJA 2KCTA 2XWJB 2F52A 4CKCA 1HTPA 1LT6D 2YYZA 2CH4A 4KD4A 2EVBA 5KYIA 4HJ8A 4DFAA 1QZHA 4DR4Q 4N8FA 1OXTA 3I4MH 3PIP3 2K04A 1S5ED 4NPSA 2ZJRA 1RIPA 1CZWA 2SOBA 3TSSA 4IUVA 4BY1G 2H1EA 1AH9A 1AFPA 1P16A 4JYAQ 1C48A 3I8ZA 3AU7A 4N9PA 3NBIA 3MXGA 5H1SE 4A3BH 3LWEA 3GTPB 2R93H 1X3FA 2EXDA 2H5XA 2MP1A 3KDFA 4DR3Q 2PMZB 4GS3A 3KDFB 1TWCH 2OT2A 3I4NB 4A3KB 3O13A 1QB5D 5IWAQ 1U4PA 3MC0B 4QUCA 1PZJD 5IGFA 4OHJA 4JG2A 5CV8A 3MFYA 1QE6A 1J5EQ 3CRLC 1OXUA 5A2QL 1E0BA 1HQRD 3HZXA 5IT9c 2EZVA 1F9SA 4OWTB 2E2HB 4RMFA 3HP3A 4L6TB 3FP9A 5M9OA 3OSOA 4IPGA 1CSQA 5CYUA 3RLFA 2JA5G 1H9JA 1ENAA 4DK6C 4V0BA 4CHTB 1PYBA 2X6GA 4ODGA 4PNYA 1S5DD 3CRKC 4GLVB 4JK1C 3W1BA 5COYA 1W6JA 4H7BA 1LO5D 1NUCA 4B08A 4MHEA 4JVZA 1UE6A 4C3HH 5EAYA 2BH8A 2Z9HA 2IHFA 1GXDC 3JAME 4BBRB 1RF2D 3CHBD 3H0GH 1B70B 2JXMB 4DK1A 2EYMA 2BDOA 3R8BA 2K7VA 3JAMc 1L1OC 1BQQT 1K0RA 2ZJQA 3FEWX 1Y1VH 4HTHA 2VL6A 2ZTCA 3SK6A 1T5EA 3RNUA 3K80C 1HZAA 4A3IH 5J39A 5M3FB 2AWOA 1ZEQX 3I2ZA 1R4QB 4K5XA 1FGUA 4R4CA 4RCNA 2B63H 1BUVT 1I4GA 3OIQA 4C2MB 3AFQA 3BZCA 4H44C 4AYBE 5IGGA 3LNNA 3M7NA 1HXYD 2JSOA 5JOBA 2OXPA 3A7LA 1EIGA 4I7ZC 2NUCA 1R9TB 4YCUA 3GTKB 1VQ9A 2JEBI 2RDGA 2OCEA 2HDLA 4F7XA 2F0JA 4IFDI 2ENBA 3NK9A 4LJZC 5E4XA 4L8JA 2LXKA 3NQTA 4G57A 1I50B 2L1BA 3J80L 4ALPA 3R3OA 3DEPA 1PH1A 5IYDG 4A3EB 5C4XB 2EY2A 3CCMA 4O0AA 1EU3A 5FOBB 1SFOB 3NBHA 4A3KG 3I4NG 4IZ8A 2D62A 3K5LA 3UI2A 3NBHB 5CBAE 4CKEA 4C3IH 1RODA 5IY0A 1TWGH 3GV6A 2UXDQ 1NR4A 3KLWA 2N49A 3U4VA 1ASYA 3L7ZC 1Q12A 3T51B 4OO1I 1X65A 3GP7A 3I55A 3S15H 4R9WA 1JWMD 5EKLA 2JEAI 5ISRA 2HQLA 1X55A 2A74C 1GUTA 4KK7A 4DNIA 5IGCA 3JAMi 1Y8PB 4BBSB 5KNBA 2R7ZH 2LXJA 1WJJA 3S16H 2DNCA 3I3CA 1ENCA 1PH7A 3K8AA 5K36G 3NP8A 4RAUC 2SNSA 2B29A 2IX0A 3A8IE 5KNDA 2JA8H 1MGSA 5C6AA 4A3LG 1NTGA 3W1GA 3PO3B 2R61A 4KKTA 3S17H 3MWYW 2K5VA 4UP8A 3AEVA 3LGJA 1U4LA 3CF5A 1RD9D 2K1BA 4HMJA 3CCVA 2EJFC 3ERSX 1PTOC 1UEAB 1GUGA 3EFXD 3HOVH 5JAVA 4BBRG 4A3GH 4A3MB 2EY1A 1YNNC 3AFPA 3PO2B 4JV5L 4DF7A 1VDZA 2D0OA 3NELA 3V2TA 3RN2A 2PI2A 3PCOB 1KNAA 2DJGC 2WB1E 3EN2A 3T56B 4ULLA 2K05A 5D3DA 1VQMA 3C2PA 1MSGA 5M3FG 5I6YA 4FF1A 5IYBH 4G4KA 2KENA 4LWCA 3GD7A 2EPBA 1E1OA 4K2LA 1PTOD 2YU9H 3IL8A 3AQQA 1YNND 2RSNA 4CDFC 5ELDA 3QG1A 2NYZD 2ASBA 2SEBD 4R4TA 2I5HA 3G71A 3PQIA 4OWWB 2FXQA 4X65L 1ILQA 2IJ0A 4DA2A 4IUQA 2EJMA 1I4PA 3VYUA 3S14B 2Q2IA 1B7YB 1TY0A 4Y7NH 4MNOA 2RHSB 1D8LA 2AWNA 4DUZL 4JV5Q 4I7AA 4N9TA 1QOHA 1CA5A 1LTBD 2EYJA 4QIWB 4QF4A 4HIDA 3TZDA 4P74A 3WWVA 4Z9CB 1FYCA 1RCVD 4A3EG 5C4XG 5C0XJ 3W2DA 3Q6SA 3G4SA 1C0AA 1TWFH 2WIIB 4DUYL 3BDCA 1A8VA 3VR2A 2XRQD 5J1ZA 1GUOA 4K5WA 4YHHL 3CMEA 4F88A 1OO9B 1J9OA 4X65Q 4YY3L 1SBBB 2EJGC 1I4HA 3HOUH 5CORA 2K5DA 5IGBA 2A73B 4R4IA 1PHJA 4IOAA 2TMPA 4JI0L 3TBIB 2ATWA 3AYHB 3IAYA 4BY7H 1WFQA 2WP8J 4DUZQ 5BR8L 2F1MA 3ICEA 4HSPA 3K5NA 4UP7A 4BBSG 3S1NH 3EROA 1II3A 1L0XB 3FPPA 4N8X1 3K58A 4XYOA 3QR8A 4AQYL 1UUPA 1OXXK 3GTMB 4XDXA 1XTCD 4TVAB 1SJHD 1V1QA 1Z6HA 1F2MA 1B3AA 3PO3G 1BNZA 5C0XH 2F0MA 5L37A 4KJOA 3L3OC 3STBD 2R92B 4DUYQ 2CWPA 2HUGA 1WCMH 4GZYC 1KL9A 4YWLA 2XVSA 4YHHQ 2Z4IA 3K5OA 2ZJPA 1EFID 2NVYB 4A3MG 2B8FA 4DXFA 3MEFA 3PO2G 1E2VA 3ND9A 4YY3Q 5M5YB 4KHZA 3PMFA 3OPOA 2B2WA 2AQ1B 4UP9A 3ULLA 1SJED 1L2FA 2A19A 4JI0Q 5JPNC 3EJIA 3J81j 4LUZA 5BR8Q 3GTLB 2CH4W 3DWQA 2LY7A 4A3FB 1I4QA 5EKIA 4O42A 2K5WA 1F2YA 1YHBA 3WDNA 1EOTA 1YNJC 2JA7B 1QG7A 4JBWA 3KJPA 1LTTD 4AQYQ 3PUVA 4RWSC 2F0HA 1JOOA 1YNXA 3DXJC 1MIUA 1VF5C 4RKLA 3BS1A 2F4VL 2F0UA 5CV9A 3GTOH 2GN5A 1P8LA 1VCIA 3CQZB 5I6WA 1SYFA 1B1ZA 4JI5Q 2NB0A 3SGIA 3FHWA 1EYGA 1VQKA 1HJPA 1JJCB 3Q0AA 2NVTB 2L5TA 2F4IA 3J80c 5D65A 3HOWB 1S4ZA 3UDIA 4OIJA 3CAMA 2QEXA 2GVAA 1AEXA 1QNKA 1U9RA 4DR6L 1O7IA 4NB3A 3E9HA 4A3DH 4KN7C 1FJGL 2J7ZA 2Y0SE 4KD3A 1YEZA 4K8JA 4WJ3M 5GQOA 1D1KA 3NWSA 3S1MH 1N36L 1GM5A 2NN6I 2F4VQ 2VNUD 1QZGA 4EX5A 2X69A 4KI0A 4CBVA 3SXHA 1EIHA 4GLAC 3PUZA 3M85A 1JR0D 3S2HB 4NXNL 1VQHA 2WV6D 2E2DC 3PF5A 2RBMA 4YWKA 4ZCKA 2EYFA 2F0PA 3QO2A 1BF4A 1ICWA 4YIJA 3TP7A 2F0TA 1PZKD 4X3SA 3J7AV 2N88A 4CJ1B 3V96A 5AJ3L 4BY1B 2BE5C 3OIPA 3S1RH 3G6EA 3HGBA 4GKKL 4DR6Q 4Q5VA 3BG3A 5LHY1 2O5JC 1H9MA 1FJGQ 1H95A 1G291 1B4OA 2H4OA 1MJEA 2M9VA 2QCPX 1PDQA 1LTAD 1QWYA 5CV6A 3P1HA 5CV5A 1SEBD 3G6JB 1N36Q 3DM3A 3TP5A 1OXVA 2NBFA 4ZYSA 2CQAA 5LMNL 3N6RA 3CC4A 1TS2A 4R4OA 1X3GA 1BCPF 3GTJB 1YBYA 4JCVE 2NVXB 2F0LA 2QEJC 3E0EA 4NXNQ 1OTCA 2HIXA 1XJVA 2G9HD 4IJHA 1WD1A 2KA7A 4ZLTF 1VQIA 5FLMG 1CKOA 1GO3E 2Q2UA 1SMXA 4PMCA 1TU2B 4DV6L 2I5LX 1BCPC 1XPRA 3OTOL 2A1AA 2JA7G 2F0FA 2K5HA 4A75A 2XRSD 5AJ3Q 3K57A 4MN3A 1SN8A 4X3UA 4KV6A 2DY7A 2CCZA 4GKKQ 2R7DA 1I4RA 1EY0A 5I2XA 5C3WA 5KGUA 2UU9L 1A62A 3RN5A 5C3EH 4F87A 1EQTA 3GO5A 4KMUC 4LFAL 4J15A 1VQ4A 3CCRA 1PV4A 5JEAJ 2JK8A 5LMNQ 1JE5A 3M3YH 1PH5A 1HNWL 1BCPD 2KOLA 1MJCA 2OEOA 3H3VH 1SROA 2B2VA 3T4AC 1NBWA 5J3BA 3CMAA 3U58A 1Q81C 1ZYRC 3HOWG 3T16A 4A3BB 3UE0A 4OIKA 1LTLA 3BDLA 1HA6A 4A3CG
chains in the Genus database with same CATH topology
2PQEA 2ZXRA 1XWEA 1AZPA 1EZ6A 1Y1WB 1K8OA 1TWCB 2ZXOA 4E6IA 2MJ8A 4IUNA 1PRTB 1CM9A 2NTSA 1O7YA 5T1IA 1CFMA 1SNPA 1FGBD 1V1PB 1LTGD 2AUJD 3QIAA 3HS0C 4IURA 5KYLA 5EGTA 4FF2A 5M3MB 5DAUA 4P2CB 4RGOS 5JEAH 2M2LA 4HN7A 2HCIA 2KEEA 2IX3A 4M8AA 2IL8A 2K5QA 3MXPA 4DAVA 1LT3D 2VUMB 1VF7A 2QILA 2EDGA 2A6HC 1WTQA 3R2TA 4ME5A 1O78A 2R3ZA 4TSSA 1F77A 3CU7A 2F0GA 4XXEA 1O80A 1CZGA 2ID0A 1STAA 4C3HB 1F2ZA 5IT9E 1LABA 1D5MC 1NSNS 3H0GB 3KUPA 3KK7A 3A55A 4NKLA 4DAPA 2L12A 3WOFA 2A6HD 1ET6A 1A3UA 2NN6G 1Y1VB 3VYRA 5EPKA 4A3IB 1F9PA 3AB9A 1SDFA 4CKBA 2KCCA 1EEID 2CHBD 2F0KA 1EWHA 2B63B 3FKIB 3SK8A 2D9UA 3D4RA 1D1IA 2SNMA 1SYBA 1DZ1A 4WJWA 3MXNA 4X3TA 1HHVA 4C1NK 1U4RA 3C1EA 3D4WA 1LACA 1EQVA 2J0TD 5EQ0A 5TSSA 1PZID 4IUUA 1T5XD 3QJYA 2FMCA 4O1NA 4X3KA 1RDPD 1KDAA 3QWNA 3M4YA 1H9KA 2B2UC 2EYHA 1TR5A 1WTPA 1IYUA 5JVG3 1EY8A 3MVVA 2F0IA 2FHTA 2E75C 2A5HA 2XIWA 1Q3LA 1B53A 1SSOA 1ML0D 2F0EA 1AZQA 4RGNA 1V8QA 5CMDA 4KKUA 4IUPA 5KRUA 2R6GA 2M00A 3FPUB 3VR3A 2PZWA 1Y8OB 1SYCA 2ZXPA 4XT1B 5J22A 4J1MA 1Q90A 5HGTA 5ELCA 5K36H 5EKKA 3E6ZX 2FINB 3S17B 5I9OA 5FLXL 1C8CA 4RHRA 4C3HG 3T13A 2BDNA 1FNVA 1HCZA 3HOVB 3MA2B 1X3QA 4AYBB 1LTID 4NMZA 1CQVA 2B39A 1H9RA 2Q8TA 4ZRZA 4A93B 1TT2A 4FF4A 2MHVA 3HEJA 1PTOH 1XYIA 2YU9B 5CV7A 1EU4A 1TWHB 4XT3B 2F0WA 3IFTA 1O7ZA 5CV4A 4DN4M 1JICA 4Y7NB 3R93A 3OWFA 3DWPA 1EEFD 1LLRD 2HDMA 1CI3M 1IKMA 3A56A 2F0SA 4RA8A 1UNSA 4IFDJ 2B2TA 1BDOA 3J81L 3GTQB 4EQPA 2A6EC 3H91A 1DJRD 4R8IA 2K33A 3ERQA 1JQYD 3ND8A 3NUCA 4M1UB 1STEA 1GJXA 1QJOA 2N55A 3FMCA 4BWGB 3NWTA 4NW2A 1EYCA 3HOUB 1STNA 4TKOB 3OW7A 1B44D 1STGA 1KABA 4EQNA 1IL8A 3U9SA 1VMPA 4L63B 2DN8A 5EJWA 4DXGA 3MFGA 1RKNA 2KCNA 2MPMA 3IKJA 5IGDA 3OMGA 4IFDH 3TP8A 2WB1B 3FDTA 1WTVA 1ESFA 5A2QE 4ILWA 1PFMA 2NZ1D 4QCLA 2XWBB 2RSOA 4FXGC 1JWUD 1PLFA 3BDOA 1XX8A 4OO1H 3NPPA 1ET9A 1CQFA 1EYAA 5IODA 1GHJA 4ZKBB 1I3QB 5KNCA 2EY5A 4KJNA 3A8JE 1QCBD 4K2KA 5E3FA 4OGQC 1TS4A 3K7AB 1ESRA 2KUMA 3ONAB 4IQZA 1JE4A 3A8KE 5C3XA 4DK0A 2PNRC 1MI2A 2F0NA 5K5PA 1CT1D 3D3RA 2F0QA 4B9XA 3MZ5A 4A3DB 4XQQA 3VR4A 2E74C 2FJ2A 5KEEA 5DNFA 2A68C 2E2IB 4C56C 1V43A 3NHHA 2TSSA 1RJTA 3A7AB 1OXSC 2SDFA 3H94A 1BR9A 4KKSA 1JOQA 1TQOA 3VA5A 4DNTB 3DMUA 5CC4A 3J80E 3P75A 4BS9A 3F2UA 1YNJD 1WTXA 3I70A 2X6LA 1TIID 4RH6A 4HSVA 3QOJA 5FLXE 2RQXA 4XYQA 4V190 1SNDA 4RFBA 2XSCA 5C0XG 1IYVA 2BA0A 3BYTB 1SYDA 4KY5A 1FD7D 2NVQB 1A15A 2NWGA 1KAAA 1HFGA 3URYA 1K83B 3NTIA 5C4HA 2F3VA 5G3LF 4I65A 3JAML 1TS5A 1GOZA 4CGYB 1JCKB 2WACA 2L0CA 1KLGD 2Q8IB 1TWAB 3RZOB 1XXGA 1KNEA 1IW7C 2QF7A 3BVZA 4PV1C 3BYYB 2B2YA 5C3EB 4ABNA 2WINB 2B2WC 1AN8A 3KF8A 3KLRA 1PYWD 1EWCA 1MD2D 2BOSA 1FR3A 1CA6A 2Y0SB 2L11A 2L55A 4C3JB 2KHSA 4HMIA 3ZYYX 1IW7D 1ONLA 1I4XA 3I72A 4TQUS 2EOTA 2BE5D 3PUXA 4HAEA 4FYDA 1HTLD 2RVLA 2B8GA 3HOXB 3TZUA 1G2SA 3VYSA 4H13C 1SMYC 3C46A 4ZQ3A 3GTGB 2ICIA 5BN5A 1A6XA 2EYPA 3OOCA 3DHQA 2HCCA 5F2DA 3I4MB 2Z1CA 1ZXTA 2Q8RE 3VA7A 4LK1C 1CK1A 1SMYD 1PXUA 1B2TA 4NP5A 2C9OA 2CW0C 5C5LA 2RDFA 2R93B 1U4MA 1LTSD 3TDQA 1PMRA 4Q0FA 1BBXC 3MTSA 1HA5A 2DY8A 1SE2A 1JC7A 2E2JB 1TS3A 1ZYRD 1WVLA 3K6OA 3D4DA 3DEOA 1EY7A 2CW0D 5IGEA 4B9WA 2HQEA 5DEHA 1SYEA 4KY7A 2IPKD 2L4NA 4BA1I 4G7OC 3M7GA 1ZKOA 3HRZC 3RZDB 4LAAA 4DNRB 2Z4HA 1FNWA 5ELEA 1A2UA 5IIFA 4RGTA 1GUWA 1STYA 3SHLA 1BXTA 4HR7B 1SNOA 3SE0A 3VR5A 1SNMA 5EPLA 4FXDA 1G2TA 2G9DA 3K5MA 4C3JG 2I46A 4FO2A 5HURA 3X3NA 3J7YW 4ZKCB 2K6AA 3MEHA 2A69C 3SVMA 2XN9C 1NAPA 3BZDB 1D2BA 1PFNA 3BVMA 4H0LC 3V05A 2WKCA 4U68A 4K6LA 4K6DA 2F0VA 3X3MA 2PZTA 5ELFA 4CJ2C 3G7LA 4MIUA 3T53B 4DGZA 3GV3A 1PRTF 2B2VC 3M4OB 3A54A 1KDCA 2A69D 3D8GA 5JEAG 1AW7A 3WOEA 3HOZB 1RTOA 2O4XA 3C3LA 4RCOA 1H9SA 4K5VA 1PRTC 2KEDA 4EGVA 1RTNA 3I91A 3IFDA 1H9SB 1SXTA 3NTHA 4QMGA 4ID6A 5LL6X 3AMUA 1EY4A 2ICEC 1Q1EA 1RHPA 4PMWA 2AUKA 4TRDA 1EYDA 2K01A 2KECA 2QKIC 5DM63 4C3IB 5KIXA 2EYLA 1TWGB 1PRTD 3C1FA 1MSHA 2MGSA 3NTKA 2AQ3B 3S15B 3SR1A 4XQJA 1DXMA 2F0DA 1X32A 1PTOB 2IW3A 2OF1A 3VYTA 2R7ZB 3S16B 1S5BD 4WFN3 2VXWA 3J7AF 4EVOA 1O7LA 3BVGA 2J4XA 2JA8B 4XIGS 3Q22A 1F9RA 1R4PB 4IALA 3PUYA 5T1GA 3D6WA 3PV0A 2D5DA 2BA1A 4UDUC 5FKAC 4A3GB 1K8MA 2LMCB 1Q8IA 3LX0A 4WRDA 1CTMA 2WAQB 4RGMA 2PYKA 4DU9A 4FXKC 4KHVA 3S1QB 3N52A 4HCEA 3TMEA 2EYOA 1Y8NB 1ENFA 1IKLA 1TY2A 1QILA 1A2TA 1G6ZA 1LT5D 1HPCA 5C0XI 1PTOF 4QB4A 4CJ0B 2K28A 2O2LD 1S5CD 4IUTA 1SE4A 3NSWA 3QB3A 3H6MA 5NUCA 1TWFB 2PCFB 3U9OA 5C4JB 3ITPA 4XQNA 2O5IC 4C3IG 2E76C 4XTCS 3MAQA 1VMCA 1A3TA 3D6CA 5I2YA 3Q24A 2LS01 2KVMA 4BY7B 2A6ED 1Q1BA 1V1OA 3S1NB 1EZ8A 1A3VA 2LKVA 3FVQA 3HG9A 4RHSA 1LT4D 1F9QA 2AQ2B 5CGKA 1TKWB 4QUFA 1STHA 1FNUA 1STBA 1Y69U 1JOKA 1WTRA 1MBYA 1DONA 1WCMB 1SNQA 1SE3A 5FO9B 3GQBA 1EY5A 4FP5D 2NTTA 1Z47A 2RDHA 1KLUD 3OHXC 4A3JB 3P20A 2PW7A 2PZUA 1ILPA 2QDBA 5EBCA 3OWEB 3PUWA 5D3IB 1E2WA 5JVH3 3SEBA 4F8MA 2PO4A 2CVRA 5I4DA 2I07B 3VR6A 2MUYA 3GTOB 5BN3A 3FRPB 1HUMA 4HCSA 2B2TC 4J8QA 3I4LA 4K14A 2XNAC 1JWSD 1IHZA 2EY6A 3DUZA 2VB3X 1J8IA 3P7JA 3E5SA 4IFDG 1PFBA 1EY9A 3HOYB 1S5FD 1EL0A 4K8IA 3EVQA 1B9MA 4S3SA 3PIO3 1EY6A 3NQIA 1WTOA 3S1MB 4NDXA 2IWHA 5C44B 1GHKA 4C1NI 5IT9L 1D5ZC 1DD2A 1D6EC 1HRJA 1QNUA 2JE6I 2VB2X 4OO1G 1DM0B 3E0JA 1HUNA 2C5CA 5JPMC 3KLSX 1L0YB 2A68D 1AP0A 3OMCA 1HQMC 3DM1A 1LV9A 3S1RB 4FF3A 5EBDA 2F03A 4ZAIA 5JJZA 1WTWA 1E2ZA 1BCPB 2V4DA 4WORA 5LL6S 2F3WA 3KBXA 1KDBA 5A35A 2JP1A 4KN4C 1Z7TA 3MHBA 1DYQA 3S2DB 1JB3A 3KLSA 2D2CC 5C4ZA 2FFKB 5IOCA 1X3PA 3SK4A 2JA6B 3I90A 5C5MA 3Q23A 5D14A 4LMQD 5ELBA 3S9WA 2PW5A 3K0YA 2IT1A 2RKSA 1M8AA 4OL7A 4FVMA 4IN3A 3TN2A 1NCVA 3NXWA 5AFWA 5CBEE 3H09A 4ZK9B 4R8NA 5E1FA 3TP6A 3DWAA 3M3YB 1C4QA 1GUSA 1SAPA 4G7ZC 5G3LD 3SK5A 3J81E 3NE5B 3SDZA 1DOKA 3EQLC 4PMBA 4ZUIA 1BOSA 1JORA 4BA2I 1W6KA 3W3AA 3CKIB 1SNCA 4PQXA 1SYGA 2Z8LA 1UAPA 3L9AX 4U673 5CR3A 3RUZA 1F2LA 2EXZA 5I9PA 1B9NA 1G8ZD 2EE1A 5M5WB 4G7HC 5BN4A 1HFNA 2JA5B 1CHQD 4UAIA 1DOLA 1BO0A 2RA4A 2PPBC 4J6HA 5EPJA 1WD0A 1NR2A 2IX1A 5DM73 2LFNA 4KTAA 2FMMA 2K32A 4KY6A 3KBGA 1I6HB 1I6VC 3RMHA 1TVXA 1G91A 2KJXA 5FO8B 1M4VA 4FNFA 2ZT9C 3D31A 3R2IA 5E4WC 1DOMA 1D5XC 1CHPD 2F0OA 5M5XB 4HEDA 3I73A 5FO7B 1LTRD 4DAYA 3QOLA 3MXUA 3RD4A 1DCZA 2WKDA 2NN6H 2K03A 2L9HA 3EA6A 4EQOA 5FK9C 2B2YC 1B50A 3HKZB 4RKBA 3K59A 3LWUA 1V1PA 1GUNA 2B2UA 2KQ3A 2DNEA 3H3VC 1KTKA 2GA4B 2BCOA 2JYOA 4ZUJA 2XWJB 4CKCA 1HTPA 1LT6D 2YYZA 4KD4A 2EVBA 5KYIA 4DFAA 1OXTA 3PIP3 2K04A 1S5ED 1CZWA 2SOBA 3TSSA 4IUVA 2H1EA 1AFPA 1C48A 3I8ZA 3AU7A 4N9PA 3NBIA 3MXGA 3LWEA 3GTPB 2MP1A 2PMZB 2OT2A 3I4NB 4A3KB 3O13A 1QB5D 1U4PA 3MC0B 4QUCA 1PZJD 5IGFA 4OHJA 5CV8A 3MFYA 1QE6A 3CRLC 1OXUA 5A2QL 1E0BA 1HQRD 3HZXA 2EZVA 1F9SA 2E2HB 3HP3A 4L6TB 5M9OA 3OSOA 5CYUA 3RLFA 1H9JA 1ENAA 4V0BA 4CHTB 2X6GA 4ODGA 4PNYA 1S5DD 3CRKC 4JK1C 5COYA 1W6JA 4H7BA 1LO5D 1NUCA 4B08A 4MHEA 1GXDC 3JAME 4BBRB 1RF2D 3CHBD 2JXMB 4DK1A 2EYMA 2BDOA 3R8BA 2K7VA 1BQQT 3FEWX 4HTHA 3SK6A 1T5EA 5J39A 5M3FB 2AWOA 1ZEQX 1R4QB 4K5XA 4RCNA 1BUVT 1I4GA 4C2MB 3OIQA 5IGGA 3M7NA 4H44C 3LNNA 1HXYD 2JSOA 5JOBA 2OXPA 3A7LA 1EIGA 4I7ZC 2NUCA 1R9TB 3GTKB 2JEBI 2RDGA 2HDLA 4F7XA 2F0JA 4IFDI 2ENBA 3NK9A 4LJZC 5E4XA 4L8JA 3NQTA 4G57A 1I50B 2L1BA 3J80L 3R3OA 3DEPA 4A3EB 5C4XB 2EY2A 1EU3A 5FOBB 1SFOB 3NBHA 4IZ8A 2D62A 3K5LA 3UI2A 5CBAE 4CKEA 1RODA 3GV6A 1NR4A 3L7ZC 1Q12A 3T51B 4OO1I 3GP7A 4R9WA 1JWMD 5EKLA 2JEAI 5ISRA 2A74C 1GUTA 4KK7A 5IGCA 1Y8PB 4BBSB 5KNBA 2DNCA 3I3CA 1ENCA 5K36G 3NP8A 4RAUC 2SNSA 3A8IE 2IX0A 5KNDA 1MGSA 5C6AA 3PO3B 2R61A 4KKTA 3MWYW 1U4LA 1RD9D 2K1BA 4HMJA 2EJFC 1PTOC 1UEAB 1GUGA 3EFXD 5JAVA 4A3MB 2EY1A 1YNNC 3PO2B 4DF7A 1VDZA 3V2TA 1KNAA 3T56B 4ULLA 2K05A 5D3DA 3C2PA 1MSGA 5I6YA 4FF1A 4G4KA 3GD7A 2EPBA 4K2LA 1PTOD 3IL8A 1YNND 2RSNA 5ELDA 3QG1A 2NYZD 2SEBD 1ILQA 2IJ0A 4DA2A 4IUQA 2EJMA 1I4PA 3VYUA 3S14B 1TY0A 2AWNA 4N9TA 1QOHA 1CA5A 1LTBD 2EYJA 4QIWB 4QF4A 3TZDA 4Z9CB 1FYCA 1RCVD 5C0XJ 3W2DA 3Q6SA 2WIIB 3BDCA 3VR2A 2XRQD 5J1ZA 1GUOA 4K5WA 4F88A 1OO9B 1J9OA 1SBBB 2EJGC 1I4HA 5CORA 2K5DA 5IGBA 2A73B 2TMPA 3TBIB 3IAYA 2WP8J 2F1MA 4HSPA 3K5NA 3EROA 1II3A 1L0XB 3FPPA 3K58A 4XYOA 1UUPA 1OXXK 3GTMB 4XDXA 1XTCD 1SJHD 1Z6HA 1F2MA 1B3AA 1BNZA 5C0XH 2F0MA 4KJOA 3L3OC 2R92B 2HUGA 4GZYC 2XVSA 2Z4IA 3K5OA 1EFID 2NVYB 2B8FA 4DXFA 5M5YB 1E2VA 3ND9A 4KHZA 3PMFA 3OPOA 2B2WA 2AQ1B 1SJED 5JPNC 3EJIA 3GTLB 3DWQA 2LY7A 4A3FB 1I4QA 5EKIA 4O42A 2K5WA 1F2YA 3WDNA 1EOTA 1YNJC 2JA7B 1QG7A 4JBWA 1LTTD 3PUVA 4RWSC 2F0HA 1JOOA 3DXJC 1VF5C 4RKLA 3BS1A 2F0UA 5CV9A 1VCIA 3CQZB 5I6WA 1SYFA 1B1ZA 2NB0A 3Q0AA 2NVTB 2L5TA 2F4IA 5D65A 3HOWB 1S4ZA 4OIJA 1AEXA 1QNKA 1U9RA 4KN7C 2J7ZA 4KD3A 4K8JA 1D1KA 3NWSA 2NN6I 2VNUD 2X69A 4KI0A 4CBVA 3SXHA 1EIHA 3PUZA 3M85A 1JR0D 3S2HB 2WV6D 2E2DC 2RBMA 2EYFA 2F0PA 3QO2A 1BF4A 1ICWA 4YIJA 3TP7A 2F0TA 1PZKD 4X3SA 3J7AV 2N88A 4CJ1B 3V96A 4BY1B 2BE5C 3OIPA 3HGBA 4Q5VA 3BG3A 5LHY1 2O5JC 1H9MA 1G291 1B4OA 2H4OA 2M9VA 2QCPX 1PDQA 1LTAD 1QWYA 5CV6A 3P1HA 5CV5A 1SEBD 3G6JB 3TP5A 4ZYSA 1OXVA 2NBFA 2CQAA 3N6RA 1TS2A 1BCPF 3GTJB 2NVXB 2F0LA 2QEJC 2G9HD 1WD1A 2KA7A 4ZLTF 4PMCA 1TU2B 1BCPC 2F0FA 2XRSD 3K57A 4MN3A 4X3UA 4KV6A 2DY7A 1I4RA 1EY0A 5I2XA 5C3WA 5KGUA 4F87A 1EQTA 3GO5A 4KMUC 5JEAJ 1BCPD 2KOLA 2OEOA 3T4AC 2B2VA 1ZYRC 3T16A 4A3BB 4OIKA 3BDLA 1HA6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PQE A;  3SK5 A;  4NDX A;  5KYI A;  1TT2 A;  4HMJ A;  5J39 A;  3HEJ A;  2EYP A;  3C1E A;  3QOJ A;  1EZ8 A;  1A3V A;  2LKV A;  3D4W A;  4KD4 A;  3DHQ A;  1EZ6 A;  3SXH A;  4DFA A;  5JAV A;  4K6D A;  2EY1 A;  1EQV A;  1SND A;  4E6I A;  5CV7 A;  4DF7 A;  4K5X A;  2F0V A;  4IUN A;  1F2M A;  5F2D A;  3V2T A;  5CGK A;  4PMB A;  1SYD A;  2PZT A;  1STH A;  2RBM A;  1KDA A;  2EYF A;  2F0P A;  4ZUI A;  2SOB A;  4KY5 A;  4MIU A;  5IGG A;  2F0M A;  4YIJ A;  4KJO A;  3TP7 A;  1SNP A;  2F0W A;  2F0T A;  4DGZ A;  1KAA A;  1STB A;  1JOR A;  2EYH A;  1TR5 A;  5JOB A;  4N9P A;  2OXP A;  1JOK A;  3LX0 A;  4WRD A;  5CV4 A;  1KDC A;  1EY8 A;  2NUC A;  3MVV A;  1SNC A;  1SNQ A;  5KYL A;  5C4H A;  1SYG A;  3OMC A;  4NP5 A;  5I6Y A;  2F0I A;  1EYA A;  5EGT A;  3OWF A;  5IOD A;  5C5L A;  2RDF A;  2F3V A;  3PMF A;  3D8G A;  5DAU A;  4I65 A;  4K2L A;  4F7X A;  1EY5 A;  2F0J A;  2PYK A;  2O4X A;  4DU9 A;  2ENB A;  4KHV A;  3NK9 A;  5CR3 A;  3RUZ A;  2F0E A;  2F0S A;  2EY5 A;  2EXZ A;  4KJN A;  4K5V A;  5CV6 A;  2WAC A;  4K2K A;  5I9P A;  3P1H A;  3EJI A;  5IGF A;  5KRU A;  5E3F A;  5CV8 A;  3NQT A;  4G57 A;  2PW7 A;  4QMG A;  2PZU A;  5CV5 A;  3R3O A;  2QDB A;  4ID6 A;  4WOR A;  2F3W A;  2M00 A;  3TP5 A;  3TME A;  3HZX A;  2EYO A;  3MXP A;  1KDB A;  1F2Y A;  4EQP A;  2EY2 A;  2PZW A;  4J6H A;  1EY4 A;  3MHB A;  5C3X A;  3D4D A;  4ME5 A;  2F0H A;  1JOO A;  4F8M A;  3ERQ A;  2F0L A;  4IZ8 A;  4KTA A;  1EY7 A;  5IGE A;  1SYC A;  4N9T A;  2F0N A;  4KY6 A;  3NUC A;  5M9O A;  4RKL A;  4B9W A;  1A2T A;  2F0G A;  3OSO A;  5C4Z A;  5K5P A;  5J22 A;  2EYJ A;  2F0U A;  2HQE A;  4J1M A;  5CV9 A;  4QF4 A;  1SYE A;  4TRD A;  5DEH A;  1EYD A;  2F0Q A;  4KY7 A;  5HGT A;  1STA A;  5IOC A;  4QB4 A;  3SK4 A;  1ENA A;  1EYC A;  4B9X A;  1F2Z A;  1SYF A;  2EYL A;  4PMC A;  5I6W A;  5KIX A;  3MZ5 A;  1STN A;  5C5M A;  5EKK A;  1NSN S;  3C1F A;  2F0F A;  2F0O A;  4LAA A;  1STG A;  3S9W A;  1KAB A;  4EQN A;  5KEE A;  5EKL A;  4ODG A;  4PNY A;  2PW5 A;  5ISR A;  2KHS A;  4NKL A;  4KV6 A;  2RKS A;  4HMI A;  1A2U A;  3SR1 A;  3QB3 A;  3H6M A;  5NUC A;  5IIF A;  3BDC A;  4K14 A;  4OL7 A;  5I9O A;  1IHZ A;  3QOL A;  5IGC A;  2EY6 A;  1A3U A;  1STY A;  3ITP A;  3NHH A;  3SHL A;  3U9O A;  1EY0 A;  4H7B A;  5C3W A;  3NXW A;  5KGU A;  5J1Z A;  1NUC A;  1SNO A;  4K5W A;  2F0D A;  1RKN A;  3E5S A;  3T13 A;  2OF1 A;  4EQO A;  1EY9 A;  1ENC A;  3OMG A;  1AEX A;  1SNM A;  1U9R A;  5IGD A;  3NP8 A;  4RKB A;  1JOQ A;  4R8N A;  2F0K A;  5HUR A;  2SNS A;  5E1F A;  3TP6 A;  1A3T A;  5IGB A;  2KQ3 A;  4K8I A;  3D6C A;  2OEO A;  3EVQ A;  1TQO A;  4K8J A;  4KD3 A;  3SK8 A;  3TP8 A;  3VA5 A;  2EYM A;  4EVO A;  5C6A A;  3DMU A;  4NMZ A;  2SNM A;  1SYB A;  4S3S A;  5CC4 A;  1EY6 A;  3T16 A;  4ZUJ A;  3P75 A;  3MEH A;  4ZQ3 A;  4IAL A;  3ERO A;  3BDL A;  4HTH A;  1II3 A;  3SK6 A; 
#chains in the Genus database with same CATH topology
 2PQE A;  4JOI A;  2ZXR A;  3RLO A;  3KFU A;  1XWE A;  4JI8 L;  1AZP A;  1EZ6 A;  1Y1W B;  4DV6 Q;  1K8O A;  2PNH A;  1TWC B;  2ZXO A;  4E6I A;  2LSS A;  1Q82 C;  4DR3 L;  2MJ8 A;  5LMN W;  3F2C A;  4IUN A;  1PRT B;  1CM9 A;  2NTS A;  1O7Y A;  5T1I A;  5FJ8 G;  1CFM A;  1SNP A;  1FGB D;  2MFI A;  1V1P B;  1LTG D;  2AUJ D;  3QIA A;  1PH2 A;  3GTG H;  1CKN A;  3HS0 C;  4IUR A;  2UU9 Q;  1X9N A;  1VQJ A;  5KYL A;  3KJO A;  1IXR A;  1CKN B;  5EGT A;  4LFA Q;  2CKZ B;  4FF2 A;  5M3M B;  5DAU A;  2AKW B;  1HNW Q;  4P2C B;  4RGO S;  5JEA H;  2M2L A;  4KLK A;  5M5W H;  4HN7 A;  2HCI A;  2KEE A;  2IX3 A;  4M8A A;  2ZTE A;  2IL8 A;  2K5Q A;  3MXP A;  5E7N A;  4DAV A;  1LT3 D;  2VUM B;  1Q8K A;  1VF7 A;  2QIL A;  2EDG A;  2A6H C;  1WTQ A;  3R2T A;  4JI8 Q;  1KQS A;  4ME5 A;  1O78 A;  1I6H H;  2R3Z A;  4TSS A;  1F77 A;  3CU7 A;  4QL5 A;  3M9B A;  2F0G A;  4XXE A;  4LF7 L;  1O80 A;  1CZG A;  2ID0 A;  1STA A;  4C3H B;  1F2Z A;  1EQQ A;  5IT9 E;  3BZK A;  1LAB A;  1D5M C;  1NSN S;  5M5X H;  3H0G B;  3KUP A;  2E2J H;  3KK7 A;  2Z6K A;  3A55 A;  4NKL A;  4DAP A;  4PG3 A;  2L12 A;  3WOF A;  2A6H D;  1ET6 A;  2G5D A;  1U5K A;  1A3U A;  2NN6 G;  1Y1V B;  3VYR A;  1XMQ L;  5EPK A;  1QVF A;  4A3I B;  1F9P A;  3L2P A;  4GOP A;  3AB9 A;  2N3S A;  3HOX G;  1SDF A;  4CKB A;  2KCC A;  1EEI D;  4GOP B;  1XPO A;  2CHB D;  3RZD H;  2F0K A;  1EWH A;  1KAW A;  3FKI B;  2B63 B;  4QJF A;  3SK8 A;  2D9U A;  1BBU A;  3D4R A;  1D1I A;  2SNM A;  1SYB A;  3NEN A;  4YCV A;  1DZ1 A;  4WJW A;  3MXN A;  4IPD A;  4X3T A;  1HHV A;  4LF7 Q;  1T9H A;  3E9I A;  4C1N K;  3MXN B;  4GN3 B;  1SLJ A;  4JOI C;  1U4R A;  3C1E A;  3I4M G;  3D4W A;  1LAC A;  2KCM A;  4ME3 A;  1EQV A;  2J0T D;  5EQ0 A;  5TSS A;  4UHV A;  1PZI D;  4IUU A;  1T5X D;  3QJY A;  2FMC A;  4O1N A;  4X3K A;  1RDP D;  1KDA A;  4A3B G;  3QWN A;  3M4Y A;  1H9K A;  2B2U C;  2EYH A;  1TR5 A;  1WTP A;  1IYU A;  2CQO A;  1XMQ Q;  5JVG 3;  1EY8 A;  3MVV A;  1QVC A;  1PH3 A;  5IYD H;  1Y1W G;  2F0I A;  4O2D A;  2FHT A;  2E75 C;  4A3K H;  2A5H A;  2XIW A;  1Q3L A;  1B53 A;  1SSO A;  2K52 A;  1ML0 D;  2F0E A;  1AZQ A;  4RGN A;  1V8Q A;  5CMD A;  4KKU A;  4IUP A;  5KRU A;  1GKH A;  2R6G A;  2M00 A;  2UXD L;  4CDC C;  1VQO A;  1VQ6 A;  3M4O H;  3FPU B;  4OXP A;  3VR3 A;  4DR5 Q;  2E2H H;  5M3M G;  2PZW A;  1Y8O B;  2WAQ E;  2KHJ A;  1SYC A;  2A8V A;  3HOZ H;  2ZXP A;  4XT1 B;  5J22 A;  1YIT A;  4J1M A;  4P73 A;  1EQR A;  2EIF A;  1Q90 A;  5HGT A;  2L15 A;  2JA9 A;  3F2B A;  5ELC A;  5K36 H;  2Q2T A;  5EKK A;  1Q7Y C;  1PH8 A;  2VUM G;  3CW2 C;  1ASZ A;  4OX9 L;  3E6Z X;  2FIN B;  4R4Q A;  3S17 B;  4LF5 L;  2I0Q A;  3TRZ A;  5I9O A;  1CUK A;  5FLX L;  1C8C A;  4RHR A;  4C3H G;  4JI1 L;  4LUO A;  3T13 A;  2BDN A;  1FNV A;  1HCZ A;  1EIY B;  3HOV B;  3H0G G;  3CXC A;  3MA2 B;  1YZ6 A;  1X3Q A;  4HIM A;  1LM0 A;  1XTD A;  1GVP A;  1VS0 A;  1LUZ A;  3L0O A;  4AYB B;  1LTI D;  4NMZ A;  1CQV A;  1Y1V G;  2B39 A;  1H9R A;  2VW9 A;  3TS2 A;  2Q8T A;  1WYD A;  4X62 L;  4A3I G;  3TRE A;  4ZRZ A;  4WJ4 A;  4A93 B;  1TT2 A;  4FF4 A;  2MHV A;  1S72 A;  5M3F H;  3HEJ A;  1PTO H;  1XYI A;  2B63 G;  3FKI G;  2YTX A;  2YU9 B;  5CV7 A;  1QUQ A;  4B3S L;  1EU4 A;  4OX9 Q;  1TWH B;  2KBN A;  1QUQ B;  4XT3 B;  4LF5 Q;  2F0W A;  3VDY A;  1UE7 A;  3IRB A;  2VZA A;  3IFT A;  1O7Z A;  1R9T H;  3GTK H;  5CV4 A;  4DN4 M;  4JI1 Q;  4OEM B;  1JIC A;  1KRS A;  4Y7N B;  3M4P A;  3R93 A;  3OWF A;  3DWP A;  1EEF D;  1LLR D;  2HDM A;  1CI3 M;  1IKM A;  3A56 A;  2XGT A;  2F0S A;  4RA8 A;  1JJG A;  1I50 H;  1UNS A;  4IFD J;  1IL2 A;  1K8G A;  4X62 Q;  2R7F A;  2B2T A;  1K3R A;  5C4X H;  1BDO A;  1BKB A;  3J81 L;  3GTQ B;  4EQP A;  2A6E C;  3H91 A;  3CPF A;  1DJR D;  1YIJ A;  4KHP L;  4R8I A;  2K33 A;  3ERQ A;  4LF9 Q;  1JQY D;  3ND8 A;  4B3S Q;  3NUC A;  4M1U B;  2UUC L;  1STE A;  1GJX A;  1QJO A;  2N55 A;  3FMC A;  3S1Q H;  3PSI A;  4BWG B;  4A76 A;  3NWT A;  4NW2 A;  1EYC A;  3HOU B;  1STN A;  4YWM A;  4TKO B;  3OW7 A;  1B44 D;  1STG A;  1KAB A;  4EQN A;  1IL8 A;  1GD7 A;  1DGS A;  2ZTD A;  3U9S A;  1VMP A;  1MHW C;  4L63 B;  2R7Z G;  2DN8 A;  5EJW A;  4DXG A;  4LF6 L;  1VQ8 A;  1EFW A;  3MFG A;  1RKN A;  3IKJ A;  2KCN A;  2MPM A;  1HNZ L;  2D0P A;  1LYL A;  5IGD A;  3OMG A;  4IFD H;  1WOC A;  3TP8 A;  1X3E A;  4KHP Q;  2WB1 B;  3FDT A;  1WTV A;  3UDG A;  1ESF A;  5A2Q E;  2UUC Q;  1VQ7 A;  5C4J H;  4ILW A;  3HOV G;  1PFM A;  2NZ1 D;  3T1Y L;  4QCL A;  1D7Q A;  4LFC L;  3W5O A;  4DV4 L;  1U0L A;  3KF6 A;  4HIK A;  2XWB B;  2RSO A;  4FXG C;  1JWU D;  3KF6 B;  4AYB G;  1EWI A;  1PLF A;  4HJ7 A;  3BDO A;  3U4Z A;  4IJL A;  1C7Y A;  1XX8 A;  3UDF A;  1NNX A;  4A93 G;  4OO1 H;  5IYB G;  4DV5 L;  3NPP A;  1ET9 A;  4LF6 Q;  1CQF A;  1MKH A;  1HNZ Q;  1EYA A;  5IOD A;  1GHJ A;  3CCL A;  4ZKB B;  2Z0S A;  5IP7 H;  1I3Q B;  1IZ6 A;  5KNC A;  2YTV A;  2EY5 A;  1W3S A;  3A8J E;  4KJN A;  1QCB D;  4K2K A;  3ER0 A;  5E3F A;  1TS4 A;  1HZC A;  3K7A B;  1ESR A;  4OGQ C;  2KUM A;  3ONA B;  3S14 H;  4LW1 A;  3T1Y Q;  2ES2 A;  3ZJY C;  4JI5 L;  4IQZ A;  4LFC Q;  1JE4 A;  3A8K E;  1X6O A;  5C3X A;  4DV4 Q;  4DK0 A;  2PNR C;  1Q46 A;  1MI2 A;  2F0N A;  3ULP A;  4DV3 L;  2CFM A;  4LF4 Q;  5K5P A;  1YJN A;  1CT1 D;  1Y14 B;  3D3R A;  1FL0 A;  1HR0 L;  2F0Q A;  4A3J H;  1PA6 A;  4B9X A;  2OQ0 A;  2K14 A;  3MZ5 A;  4A3D B;  1EOV A;  4XQQ A;  4DV5 Q;  3VR4 A;  2E74 C;  2FJ2 A;  5KEE A;  1YJW A;  5DNF A;  2A68 C;  2E2I B;  1J6Q A;  4C56 C;  1I94 L;  1V43 A;  3NHH A;  2TSS A;  5HGQ A;  1RJT A;  3A7A B;  1OXS C;  2SDF A;  3HOU G;  3H94 A;  1BR9 A;  4KKS A;  5JJL A;  1PVO A;  1JOQ A;  3TS0 A;  1TQO A;  3VA5 A;  4PZ7 A;  1PH4 A;  4DNT B;  3DMU A;  1PH6 A;  4L5S A;  5CC4 A;  3J80 E;  3P75 A;  1X56 A;  4BS9 A;  1L0W A;  3F2U A;  4DV3 Q;  1YNJ D;  1WTX A;  1K28 A;  3I70 A;  2X6L A;  1TII D;  4OEL B;  4RH6 A;  1HR0 Q;  4HSV A;  3QOJ A;  4B3M L;  5FLX E;  2RQX A;  4Y52 H;  4XYQ A;  4V19 0;  1SND A;  4RFB A;  2XSC A;  3PGZ A;  4X66 Q;  5C0X G;  2UUB L;  2WB1 G;  3HOY H;  5FLX c;  2BA0 A;  1IYV A;  3BYT B;  1SYD A;  2R92 H;  4KY5 A;  1FD7 D;  3A74 A;  4HJA A;  4BXX G;  1A15 A;  2NVQ B;  2NWG A;  2MNA A;  1KAA A;  3TQY A;  1KHI A;  4OON A;  1I94 Q;  1HFG A;  3URY A;  2GVB A;  1K83 B;  3CD6 A;  3CPW A;  2AMC B;  4UY8 C;  3NTI A;  5C4H A;  3CCU A;  5C44 H;  1HR0 W;  4JI3 L;  1S40 A;  2F3V A;  5G3L F;  1PFS A;  4I65 A;  3JAM L;  1TS5 A;  3S24 A;  1GOZ A;  4CGY B;  4P71 A;  3GTL H;  1JCK B;  2WAC A;  1IBL L;  2NZH A;  2L0C A;  1KLG D;  4A3F H;  2Q8I B;  4L5Q A;  4NXM L;  5HY6 A;  1TWA B;  2I5M X;  3RZO B;  1XXG A;  1KNE A;  4B3M Q;  1IW7 C;  2QF7 A;  4R1J A;  4FDB A;  5GAE C;  2UUB Q;  3BVZ A;  5GAG C;  4PV1 C;  3BYY B;  2B2Y A;  5C3E B;  3CQZ H;  4ABN A;  2WIN B;  2B2W C;  1AN8 A;  5IYC H;  2HIV A;  3KF8 A;  3KLR A;  1PYW D;  1RL2 A;  1EWC A;  1UE5 A;  1MD2 D;  2BOS A;  3KF8 B;  1FR3 A;  1KD1 C;  2Y0S B;  2L11 A;  1CA6 A;  2L55 A;  4C3J B;  2NVT H;  3NEM A;  2UXC L;  2KHS A;  4JI3 Q;  4HMI A;  3ZYY X;  1IYJ B;  1IW7 D;  1ONL A;  1I4X A;  3I72 A;  4TQU S;  1VQL A;  3HOW H;  2EOT A;  3S2D H;  2BE5 D;  1K9M C;  3E3X A;  3PUX A;  1VQN A;  4HAE A;  1IBL Q;  4A3D G;  1PH9 A;  4FYD A;  3J80 i;  2JA6 H;  4LFB L;  4A4I A;  4L5R C;  4QGU A;  3UE1 A;  4DAM A;  4NXM Q;  1HTL D;  2RVL A;  2B8G A;  3HOX B;  2ALY B;  3TZU A;  1G2S A;  2MO0 A;  1FVI A;  3VYS A;  4H13 C;  1SMY C;  3C46 A;  4ZQ3 A;  2VQE L;  3CCQ A;  3GTG B;  2ICI A;  3GDE A;  3M4Q A;  5BN5 A;  2C35 B;  4QQB X;  1A6X A;  1AE3 A;  2EYP A;  3OOC A;  3DHQ A;  3HKZ E;  2HCC A;  5IP9 G;  2IY5 B;  5F2D A;  3I4M B;  2UXC Q;  2Z1C A;  1ZXT A;  2Q8R E;  3VA7 A;  1NJI C;  4LK1 C;  2QDL A;  1CK1 A;  1SMY D;  2K5N A;  1PXU A;  4PZ6 A;  4BY1 H;  2F3I A;  1V9P A;  1VQP A;  1B3Q A;  2PQA A;  2RF4 A;  1B2T A;  4NP5 A;  1I5F A;  2C9O A;  2CW0 C;  5C5L A;  2RDF A;  2R93 B;  2PQA B;  4LFB Q;  1U4M A;  1LTS D;  3TDQ A;  3HKS A;  1PMR A;  2CWA A;  4Q0F A;  1BBX C;  3MTS A;  1HA5 A;  4JW0 A;  1YI2 A;  5GAH C;  2DY8 A;  4EQ5 A;  1A0I A;  1SE2 A;  3BJU A;  4DK3 C;  1XMO L;  1JC7 A;  2VQE Q;  3GTJ H;  2E2J B;  2VS1 A;  1TS3 A;  2NVX H;  1ZYR D;  2HT1 A;  1WVL A;  3K6O A;  3D4D A;  2PMZ E;  4K0K L;  3DEO A;  3CCJ A;  1EY7 A;  2CW0 D;  5IGE A;  2YTY A;  4B9W A;  2HQE A;  5DEH A;  1SYE A;  1A63 A;  4KY7 A;  1E3P A;  2IPK D;  2L4N A;  4BA1 I;  4G7O C;  3M7G A;  1S3O A;  1ZKO A;  3HRZ C;  3RZD B;  2JA5 H;  1L1O A;  4LAA A;  4DNR B;  2Z4H A;  1VQC A;  1FNW A;  1L1O B;  5ELE A;  1A2U A;  5IIF A;  4RGT A;  1GUW A;  5C3E G;  1STY A;  3SHL A;  1BXT A;  3J7A 5;  2RCN A;  4JI2 L;  4MZ9 A;  4HR7 B;  1SNO A;  3CC2 A;  4JI4 L;  3SE0 A;  3VR5 A;  1XMO Q;  1SNM A;  5EPL A;  4FXD A;  1KC8 C;  2Y0S G;  1G2T A;  2G9D A;  3K5M A;  4C3J G;  2I46 A;  4FO2 A;  5HUR A;  1K8A C;  1C9O A;  2RCF A;  1BBW A;  3X3N A;  4K0K Q;  3J7Y W;  4ZKC B;  2K6A A;  3MEH A;  2A69 C;  3SVM A;  1WI5 A;  4X6A H;  2XN9 C;  2MQH A;  1NAP A;  3BZD B;  1Y1W H;  1D2B A;  1YVC A;  1PFN A;  3BVM A;  4H0L C;  3V05 A;  2WKC A;  4U68 A;  2B3G A;  4K6L A;  4K6D A;  5ELN A;  2F0V A;  3X3M A;  2PZT A;  5ELF A;  4CJ2 C;  3G7L A;  4MIU A;  1VQD A;  3T53 B;  4DGZ A;  3GV3 A;  1PRT F;  2B2V C;  3M4O B;  3A54 A;  1N34 L;  4JI2 Q;  1KDC A;  2A69 D;  2UUA L;  1K3B C;  4JI4 Q;  4P75 A;  5M3M H;  4DR5 L;  3D8G A;  5JEA G;  1AW7 A;  4HJ9 A;  3WOE A;  3HOZ B;  1RTO A;  2O4X A;  3C3L A;  1KXL A;  4RCO A;  1H9S A;  4K5V A;  3K0X A;  1PRT C;  2KED A;  1RTN A;  4EGV A;  3I91 A;  3IFD A;  1H9S B;  1SXT A;  3NTH A;  4GN5 A;  4QMG A;  2N78 A;  4ID6 A;  1ICF B;  3UDX A;  2VUM H;  5LL6 X;  2R93 G;  3AMU A;  1VQA A;  3GTP H;  1EY4 A;  2K4K A;  2ICE C;  2P5Z X;  2DGY A;  1Q1E A;  1RHP A;  3I4N H;  4PMW A;  4DV1 L;  2AUK A;  4TRD A;  1EYD A;  2K01 A;  2KEC A;  1SR3 A;  2QKI C;  5DM6 3;  4C3I B;  5KIX A;  2EYL A;  1TWG B;  1PRT D;  1VQE A;  4DR7 L;  3C1F A;  1MSH A;  4CDD C;  1N34 Q;  2N8N A;  2UUA Q;  2MGS A;  3NTK A;  3I7F A;  1E22 A;  2AQ3 B;  3S15 B;  2DJF C;  3SR1 A;  4XQJ A;  2NZO A;  1DXM A;  3HKZ G;  3PIO A;  3EBE A;  4JPB W;  2F0D A;  1X32 A;  1PTO B;  2IW3 A;  4AIM A;  2OF1 A;  4MTK A;  3VYT A;  2R7Z B;  3S16 B;  3FKI H;  1S5B D;  4WFN 3;  2VXW A;  2YV5 A;  1XPU A;  3J7A F;  4GKJ L;  1E7Z A;  4EVO A;  1O7L A;  1N9W A;  3BVG A;  3F2D A;  2J4X A;  2JA8 B;  4XIG S;  1KRT A;  1N33 L;  4A3L H;  3Q22 A;  1F9R A;  2JQO A;  2Z6K C;  1R4P B;  4IAL A;  3PUY A;  5T1G A;  4DV1 Q;  3D6W A;  3PV0 A;  4LNQ A;  2D5D A;  2BA1 A;  4UDU C;  1SRU A;  4DR7 Q;  5FKA C;  4A3G B;  2VY3 A;  4GOP C;  4BBR H;  1K8M A;  4L5T A;  1M90 C;  2LMC B;  3DLL A;  1Q8I A;  2WFW A;  3LX0 A;  4WRD A;  4OWX B;  1CTM A;  2MO1 A;  2V1C C;  1UWV A;  2WAQ B;  1VQG A;  1YJ9 A;  4RGM A;  2PYK A;  4DU9 A;  4FXK C;  4GKJ Q;  4KHV A;  2UXB L;  3S1Q B;  4LF9 L;  4H02 A;  3OW2 A;  3U50 C;  3N52 A;  4C2M H;  1HNX L;  2PI2 E;  1N33 Q;  2OWO A;  4HCE A;  4DV2 L;  3TME A;  2EYO A;  1Y8N B;  4GN4 B;  1KIX A;  2JN4 A;  2Z6B A;  1VQ5 A;  3HOZ G;  1ENF A;  1IKL A;  1TY2 A;  1QIL A;  3A0J A;  1A2T A;  1G6Z A;  1LT5 D;  1HPC A;  1N8R C;  5C0X I;  1PTO F;  4QB4 A;  2HHH L;  1G51 A;  4CJ0 B;  2K28 A;  2O2L D;  3A5U A;  2VQF L;  3CP0 A;  1S5C D;  4IUT A;  4A3E H;  1SE4 A;  3NSW A;  2OTJ A;  3QB3 A;  3H6M A;  5NUC A;  1SFO H;  1TWF B;  2PCF B;  4DV0 L;  3U9O A;  5C4J B;  4JBM A;  3B6Y A;  3ITP A;  2UXB Q;  4XQN A;  2O5I C;  4C3I G;  4QIW E;  1HNX Q;  2E76 C;  4XTC S;  3MAQ A;  3JC6 6;  3G48 A;  4DV2 Q;  1JB7 A;  1VMC A;  1A3T A;  4B3T L;  3D6C A;  5I2Y A;  1TXY A;  3Q24 A;  2LS0 1;  2KVM A;  3OYY A;  1IBK L;  4BY7 B;  2A6E D;  4A93 H;  1Q1B A;  1V1O A;  3S1N B;  4BBS H;  3I4O A;  1EZ8 A;  1A3V A;  2LKV A;  2HHH Q;  3FVQ A;  3HG9 A;  4RHS A;  4GNX A;  1TWH H;  1LT4 D;  1F9Q A;  2AQ2 B;  3F8T A;  2VQF Q;  5CGK A;  4GNX B;  1TKW B;  4QUF A;  2JA8 G;  1STH A;  3HFZ B;  1FNU A;  1IBM L;  3PO3 H;  3I56 A;  1STB A;  4DV0 Q;  1Y69 U;  1JOK A;  1WTR A;  1MBY A;  1DON A;  1WCM B;  1SNQ A;  1SE3 A;  5FO9 B;  3ULJ A;  4A3G G;  3GQB A;  1W2B A;  4A3M H;  1EY5 A;  4FP5 D;  3TEH B;  3PO2 H;  4RG1 A;  2NTT A;  1NY4 A;  4B3T Q;  4JI7 L;  4AH6 A;  1Z47 A;  2RDH A;  1KLU D;  3OHX C;  4A3J B;  5DLQ E;  4LF4 L;  3P20 A;  1AE2 A;  2PW7 A;  2PZU A;  1ILP A;  2QDB A;  3K81 C;  1IBK Q;  5EBC A;  3GTQ H;  3OWE B;  3PUW A;  2WAQ G;  2DUD A;  5D3I B;  1E2W A;  5JVH 3;  3SEB A;  3CCS A;  4F8M A;  2PO4 A;  1N32 L;  2CVR A;  1G6P A;  5I4D A;  2K75 A;  2I07 B;  4POG A;  3EIV A;  2IHE A;  3VR6 A;  2MUY A;  1IBM Q;  3GTO B;  5JJK A;  5BN3 A;  3FRP B;  1HUM A;  4HCS A;  3KYH C;  3STB C;  1K73 C;  1HZB A;  1JJ2 A;  4HJ5 A;  4B3R L;  2QW7 A;  2B2T C;  4J8Q A;  4YCW A;  3I4L A;  4K14 A;  2XNA C;  1JWS D;  1IHZ A;  2EY6 A;  3DUZ A;  2BH2 A;  2VB3 X;  4JI7 Q;  4IPC A;  1X54 A;  1J8I A;  1EIF A;  3E5S A;  3P7J A;  1K0S A;  4IFD G;  1PFB A;  1EY9 A;  1SE8 A;  1UE1 A;  3HOY B;  3KOJ A;  1M1K C;  1EUJ A;  1S5F D;  1EL0 A;  4K8I A;  3EVQ A;  4X66 L;  5GAD C;  1B9M A;  3PIP A;  4BXX H;  4LF8 L;  4S3S A;  3PIO 3;  1EY6 A;  3NQI A;  1N32 Q;  1WTO A;  3S1M B;  4POF A;  4NDX A;  2IWH A;  5C44 B;  1GHK A;  1XNQ L;  4C1N I;  5IT9 L;  1D5Z C;  1DD2 A;  1D6E C;  4GNX C;  3T1H L;  1HRJ A;  1QNU A;  2JE6 I;  5LMU L;  2VB2 X;  4B3R Q;  1VQB A;  4OO1 G;  1DM0 B;  4BY7 G;  4APV A;  2E8G A;  3E0J A;  2XTI A;  2C5C A;  5JPM C;  5JJI A;  1HUN A;  3KLS X;  1L0Y B;  2A68 D;  1AP0 A;  3OMC A;  5IP7 G;  1HQM C;  3DM1 A;  1I3Q H;  3GTM H;  3A5Z B;  1LV9 A;  3S1R B;  4JBK A;  3D0F A;  4FF3 A;  5EBD A;  2F03 A;  4ZAI A;  5JJZ A;  1WTW A;  3H3V I;  1VQF A;  4IOC A;  4UPA A;  3H15 A;  1E2Z A;  4LF8 Q;  3K7A H;  1BCP B;  2V4D A;  4WOR A;  5LL6 S;  2F3W A;  1WCM G;  3KBX A;  4DR1 L;  1KDB A;  5A35 A;  2JP1 A;  1YHQ A;  4KN4 C;  1Z7T A;  1XNQ Q;  3MHB A;  2NVY H;  5M5Y H;  1DYQ A;  3S2D B;  3T1H Q;  1JB3 A;  3KLS A;  4A3J G;  2D2C C;  5C4Z A;  1NMF A;  5LMU Q;  1WTH A;  4DPG A;  4QY7 A;  2FFK B;  5IOC A;  1X3P A;  3SK4 A;  4DKA C;  4MTN A;  2JA6 B;  1JMC A;  2OQK A;  3I90 A;  5C5M A;  3Q23 A;  4DV7 L;  5FLM H;  5D14 A;  4LMQ D;  4P72 A;  5ELB A;  4PZ8 A;  3S9W A;  1JT8 A;  2RHQ B;  2PW5 A;  3K0Y A;  2IT1 A;  2E2I H;  2JA7 H;  4DR2 L;  2RKS A;  1NE3 A;  1YHA A;  1Q86 C;  1M8A A;  4OL7 A;  4FVM A;  4IN3 A;  3TN2 A;  2EQS A;  3BU2 A;  1NCV A;  3NXW A;  5AFW A;  4LUV A;  5CBE E;  1E1T A;  3H09 A;  4ZK9 B;  4DR1 Q;  5IP9 H;  4R8N A;  4GLX A;  5E1F A;  3TP6 A;  3DWA A;  3M3Y B;  4CDE C;  1C4Q A;  1GUS A;  1SAP A;  2ZM6 L;  4G7Z C;  1CKM A;  5G3L D;  3SK5 A;  3J81 E;  4IPH A;  3NE5 B;  3SDZ A;  4JC0 A;  3HOY G;  1XNR L;  4A3C H;  4DV7 Q;  3J81 c;  2R92 G;  1DOK A;  3EQL C;  2NVQ H;  4PMB A;  4ZUI A;  1BOS A;  4DR2 Q;  3PF4 A;  1Z9F A;  1K83 H;  3F1Z A;  1JOR A;  4BA2 I;  5C44 G;  1W6K A;  5FJ8 H;  3W3A A;  3CKI B;  1NMG A;  1SNC A;  4PQX A;  1SYG A;  2Z8L A;  5GRO A;  1UAP A;  3L9A X;  3CCE A;  1UEB A;  3S2H H;  1HH2 P;  4U67 3;  5CR3 A;  3RUZ A;  1F2L A;  4A3F G;  2EXZ A;  5I9P A;  1B9N A;  1G8Z D;  2AHO B;  4JI6 L;  2K50 A;  4X64 L;  1BVS A;  1TWA H;  2EE1 A;  2ZM6 Q;  5M5W B;  4G7H C;  5BN4 A;  2QA4 A;  2JA5 B;  1HFN A;  3RZO H;  1CHQ D;  1HZ9 A;  1CSP A;  4UAI A;  1DOL A;  1BO0 A;  2RA4 A;  2PPB C;  2E5L L;  4J6H A;  5EPJ A;  1WD0 A;  1NR2 A;  2IX1 A;  1XNR Q;  5DM7 3;  2JJQ A;  2LFN A;  4KTA A;  2FMM A;  2QGQ A;  2K32 A;  4KY6 A;  3KBG A;  1I6H B;  1I6V C;  3CC7 A;  3RMH A;  5IYC G;  1TVX A;  2Q2H A;  1G91 A;  2KJX A;  5FO8 B;  1M4V A;  4FNF A;  2ZT9 C;  3D31 A;  3RR5 A;  3R2I A;  5E4W C;  5ELO A;  4DR4 L;  1DOM A;  1D5X C;  1CHP D;  4C3J H;  3RLN A;  2F0O A;  5M5X B;  1PYS B;  4HED A;  3I73 A;  1QVG A;  5FO7 B;  1B8A A;  1LTR D;  4DAY A;  2OTL A;  1E24 A;  4JYA L;  3QOL A;  3MXU A;  3RD4 A;  4HIO A;  4IO9 A;  4DAY B;  3J7Z C;  2JA6 G;  1DCZ A;  2WKD A;  2HD3 A;  2NN6 H;  3Q8D A;  2K03 A;  2L9H A;  3EA6 A;  4EQO A;  3OTO Q;  4JI6 Q;  4X64 Q;  5FK9 C;  2B2Y C;  1B50 A;  5IE8 A;  3HKZ B;  4RKB A;  3K59 A;  3LWU A;  3HOX H;  3K7U C;  1V1P A;  1GUN A;  2B2U A;  2KQ3 A;  5IWA L;  2DNE A;  3J81 i;  2E5L Q;  3H3V C;  2KHI A;  4JBJ A;  1KTK A;  2GA4 B;  2BCO A;  2JYO A;  1J5E L;  4ZUJ A;  2KCT A;  2XWJ B;  2F52 A;  4CKC A;  1HTP A;  1LT6 D;  2YYZ A;  2CH4 A;  4KD4 A;  2EVB A;  5KYI A;  4HJ8 A;  4DFA A;  1QZH A;  4DR4 Q;  4N8F A;  1OXT A;  3I4M H;  3PIP 3;  2K04 A;  1S5E D;  4NPS A;  2ZJR A;  1RIP A;  1CZW A;  2SOB A;  3TSS A;  4IUV A;  4BY1 G;  2H1E A;  1AH9 A;  1AFP A;  1P16 A;  4JYA Q;  1C48 A;  3I8Z A;  3AU7 A;  4N9P A;  3NBI A;  3MXG A;  5H1S E;  4A3B H;  3LWE A;  3GTP B;  2R93 H;  1X3F A;  2EXD A;  2H5X A;  2MP1 A;  3KDF A;  4DR3 Q;  2PMZ B;  4GS3 A;  3KDF B;  1TWC H;  2OT2 A;  3I4N B;  4A3K B;  3O13 A;  1QB5 D;  5IWA Q;  1U4P A;  3MC0 B;  4QUC A;  1PZJ D;  5IGF A;  4OHJ A;  4JG2 A;  5CV8 A;  3MFY A;  1QE6 A;  1J5E Q;  3CRL C;  1OXU A;  5A2Q L;  1E0B A;  1HQR D;  3HZX A;  5IT9 c;  2EZV A;  1F9S A;  4OWT B;  2E2H B;  4RMF A;  3HP3 A;  4L6T B;  3FP9 A;  5M9O A;  3OSO A;  4IPG A;  1CSQ A;  5CYU A;  3RLF A;  2JA5 G;  1H9J A;  1ENA A;  4DK6 C;  4V0B A;  4CHT B;  1PYB A;  2X6G A;  4ODG A;  4PNY A;  1S5D D;  3CRK C;  4GLV B;  4JK1 C;  3W1B A;  5COY A;  1W6J A;  4H7B A;  1LO5 D;  1NUC A;  4B08 A;  4MHE A;  4JVZ A;  1UE6 A;  4C3H H;  5EAY A;  2BH8 A;  2Z9H A;  2IHF A;  1GXD C;  3JAM E;  4BBR B;  1RF2 D;  3CHB D;  3H0G H;  1B70 B;  2JXM B;  4DK1 A;  2EYM A;  2BDO A;  3R8B A;  2K7V A;  3JAM c;  1L1O C;  1BQQ T;  1K0R A;  2ZJQ A;  3FEW X;  1Y1V H;  4HTH A;  2VL6 A;  2ZTC A;  3SK6 A;  1T5E A;  3RNU A;  3K80 C;  1HZA A;  4A3I H;  5J39 A;  5M3F B;  2AWO A;  1ZEQ X;  3I2Z A;  1R4Q B;  4K5X A;  1FGU A;  4R4C A;  4RCN A;  2B63 H;  1BUV T;  1I4G A;  3OIQ A;  4C2M B;  3AFQ A;  3BZC A;  4H44 C;  4AYB E;  5IGG A;  3LNN A;  3M7N A;  1HXY D;  2JSO A;  5JOB A;  2OXP A;  3A7L A;  1EIG A;  4I7Z C;  2NUC A;  1R9T B;  4YCU A;  3GTK B;  1VQ9 A;  2JEB I;  2RDG A;  2OCE A;  2HDL A;  4F7X A;  2F0J A;  4IFD I;  2ENB A;  3NK9 A;  4LJZ C;  5E4X A;  4L8J A;  2LXK A;  3NQT A;  4G57 A;  1I50 B;  2L1B A;  3J80 L;  4ALP A;  3R3O A;  3DEP A;  1PH1 A;  5IYD G;  4A3E B;  5C4X B;  2EY2 A;  3CCM A;  4O0A A;  1EU3 A;  5FOB B;  1SFO B;  3NBH A;  4A3K G;  3I4N G;  4IZ8 A;  2D62 A;  3K5L A;  3UI2 A;  3NBH B;  5CBA E;  4CKE A;  4C3I H;  1ROD A;  5IY0 A;  1TWG H;  3GV6 A;  2UXD Q;  1NR4 A;  3KLW A;  2N49 A;  3U4V A;  1ASY A;  3L7Z C;  1Q12 A;  3T51 B;  4OO1 I;  1X65 A;  3GP7 A;  3I55 A;  3S15 H;  4R9W A;  1JWM D;  5EKL A;  2JEA I;  5ISR A;  2HQL A;  1X55 A;  2A74 C;  1GUT A;  4KK7 A;  4DNI A;  5IGC A;  3JAM i;  1Y8P B;  4BBS B;  5KNB A;  2R7Z H;  2LXJ A;  1WJJ A;  3S16 H;  2DNC A;  3I3C A;  1ENC A;  1PH7 A;  3K8A A;  5K36 G;  3NP8 A;  4RAU C;  2SNS A;  2B29 A;  2IX0 A;  3A8I E;  5KND A;  2JA8 H;  1MGS A;  5C6A A;  4A3L G;  1NTG A;  3W1G A;  3PO3 B;  2R61 A;  4KKT A;  3S17 H;  3MWY W;  2K5V A;  4UP8 A;  3AEV A;  3LGJ A;  1U4L A;  3CF5 A;  1RD9 D;  2K1B A;  4HMJ A;  3CCV A;  2EJF C;  3ERS X;  1PTO C;  1UEA B;  1GUG A;  3EFX D;  3HOV H;  5JAV A;  4BBR G;  4A3G H;  4A3M B;  2EY1 A;  1YNN C;  3AFP A;  3PO2 B;  4JV5 L;  4DF7 A;  1VDZ A;  2D0O A;  3NEL A;  3V2T A;  3RN2 A;  2PI2 A;  3PCO B;  1KNA A;  2DJG C;  2WB1 E;  3EN2 A;  3T56 B;  4ULL A;  2K05 A;  5D3D A;  1VQM A;  3C2P A;  1MSG A;  5M3F G;  5I6Y A;  4FF1 A;  5IYB H;  4G4K A;  2KEN A;  4LWC A;  3GD7 A;  2EPB A;  1E1O A;  4K2L A;  1PTO D;  2YU9 H;  3IL8 A;  3AQQ A;  1YNN D;  2RSN A;  4CDF C;  5ELD A;  3QG1 A;  2NYZ D;  2ASB A;  2SEB D;  4R4T A;  2I5H A;  3G71 A;  3PQI A;  4OWW B;  2FXQ A;  4X65 L;  1ILQ A;  2IJ0 A;  4DA2 A;  4IUQ A;  2EJM A;  1I4P A;  3VYU A;  3S14 B;  2Q2I A;  1B7Y B;  1TY0 A;  4Y7N H;  4MNO A;  2RHS B;  1D8L A;  2AWN A;  4DUZ L;  4JV5 Q;  4I7A A;  4N9T A;  1QOH A;  1CA5 A;  1LTB D;  2EYJ A;  4QIW B;  4QF4 A;  4HID A;  3TZD A;  4P74 A;  3WWV A;  4Z9C B;  1FYC A;  1RCV D;  4A3E G;  5C4X G;  5C0X J;  3W2D A;  3Q6S A;  3G4S A;  1C0A A;  1TWF H;  2WII B;  4DUY L;  3BDC A;  1A8V A;  3VR2 A;  2XRQ D;  5J1Z A;  1GUO A;  4K5W A;  4YHH L;  3CME A;  4F88 A;  1OO9 B;  1J9O A;  4X65 Q;  4YY3 L;  1SBB B;  2EJG C;  1I4H A;  3HOU H;  5COR A;  2K5D A;  5IGB A;  2A73 B;  4R4I A;  1PHJ A;  4IOA A;  2TMP A;  4JI0 L;  3TBI B;  2ATW A;  3AYH B;  3IAY A;  4BY7 H;  1WFQ A;  2WP8 J;  4DUZ Q;  5BR8 L;  2F1M A;  3ICE A;  4HSP A;  3K5N A;  4UP7 A;  4BBS G;  3S1N H;  3ERO A;  1II3 A;  1L0X B;  3FPP A;  4N8X 1;  3K58 A;  4XYO A;  3QR8 A;  4AQY L;  1UUP A;  1OXX K;  3GTM B;  4XDX A;  1XTC D;  4TVA B;  1SJH D;  1V1Q A;  1Z6H A;  1F2M A;  1B3A A;  3PO3 G;  1BNZ A;  5C0X H;  2F0M A;  5L37 A;  4KJO A;  3L3O C;  3STB D;  2R92 B;  4DUY Q;  2CWP A;  2HUG A;  1WCM H;  4GZY C;  1KL9 A;  4YWL A;  2XVS A;  4YHH Q;  2Z4I A;  3K5O A;  2ZJP A;  1EFI D;  2NVY B;  4A3M G;  2B8F A;  4DXF A;  3MEF A;  3PO2 G;  1E2V A;  3ND9 A;  4YY3 Q;  5M5Y B;  4KHZ A;  3PMF A;  3OPO A;  2B2W A;  2AQ1 B;  4UP9 A;  3ULL A;  1SJE D;  1L2F A;  2A19 A;  4JI0 Q;  5JPN C;  3EJI A;  3J81 j;  4LUZ A;  5BR8 Q;  3GTL B;  2CH4 W;  3DWQ A;  2LY7 A;  4A3F B;  1I4Q A;  5EKI A;  4O42 A;  2K5W A;  1F2Y A;  1YHB A;  3WDN A;  1EOT A;  1YNJ C;  2JA7 B;  1QG7 A;  4JBW A;  3KJP A;  1LTT D;  4AQY Q;  3PUV A;  4RWS C;  2F0H A;  1JOO A;  1YNX A;  3DXJ C;  1MIU A;  1VF5 C;  4RKL A;  3BS1 A;  2F4V L;  2F0U A;  5CV9 A;  3GTO H;  2GN5 A;  1P8L A;  1VCI A;  3CQZ B;  5I6W A;  1SYF A;  1B1Z A;  4JI5 Q;  2NB0 A;  3SGI A;  3FHW A;  1EYG A;  1VQK A;  1HJP A;  1JJC B;  3Q0A A;  2NVT B;  2L5T A;  2F4I A;  3J80 c;  5D65 A;  3HOW B;  1S4Z A;  3UDI A;  4OIJ A;  3CAM A;  2QEX A;  2GVA A;  1AEX A;  1QNK A;  1U9R A;  4DR6 L;  1O7I A;  4NB3 A;  3E9H A;  4A3D H;  4KN7 C;  1FJG L;  2J7Z A;  2Y0S E;  4KD3 A;  1YEZ A;  4K8J A;  4WJ3 M;  5GQO A;  1D1K A;  3NWS A;  3S1M H;  1N36 L;  1GM5 A;  2NN6 I;  2F4V Q;  2VNU D;  1QZG A;  4EX5 A;  2X69 A;  4KI0 A;  4CBV A;  3SXH A;  1EIH A;  4GLA C;  3PUZ A;  3M85 A;  1JR0 D;  3S2H B;  4NXN L;  1VQH A;  2WV6 D;  2E2D C;  3PF5 A;  2RBM A;  4YWK A;  4ZCK A;  2EYF A;  2F0P A;  3QO2 A;  1BF4 A;  1ICW A;  4YIJ A;  3TP7 A;  2F0T A;  1PZK D;  4X3S A;  3J7A V;  2N88 A;  4CJ1 B;  3V96 A;  5AJ3 L;  4BY1 B;  2BE5 C;  3OIP A;  3S1R H;  3G6E A;  3HGB A;  4GKK L;  4DR6 Q;  4Q5V A;  3BG3 A;  5LHY 1;  2O5J C;  1H9M A;  1FJG Q;  1H95 A;  1G29 1;  1B4O A;  2H4O A;  1MJE A;  2M9V A;  2QCP X;  1PDQ A;  1LTA D;  1QWY A;  5CV6 A;  3P1H A;  5CV5 A;  1SEB D;  3G6J B;  1N36 Q;  3DM3 A;  3TP5 A;  1OXV A;  2NBF A;  4ZYS A;  2CQA A;  5LMN L;  3N6R A;  3CC4 A;  1TS2 A;  4R4O A;  1X3G A;  1BCP F;  3GTJ B;  1YBY A;  4JCV E;  2NVX B;  2F0L A;  2QEJ C;  3E0E A;  4NXN Q;  1OTC A;  2HIX A;  1XJV A;  2G9H D;  4IJH A;  1WD1 A;  2KA7 A;  4ZLT F;  1VQI A;  5FLM G;  1CKO A;  1GO3 E;  2Q2U A;  1SMX A;  4PMC A;  1TU2 B;  4DV6 L;  2I5L X;  1BCP C;  1XPR A;  3OTO L;  2A1A A;  2JA7 G;  2F0F A;  2K5H A;  4A75 A;  2XRS D;  5AJ3 Q;  3K57 A;  4MN3 A;  1SN8 A;  4X3U A;  4KV6 A;  2DY7 A;  2CCZ A;  4GKK Q;  2R7D A;  1I4R A;  1EY0 A;  5I2X A;  5C3W A;  5KGU A;  2UU9 L;  1A62 A;  3RN5 A;  5C3E H;  4F87 A;  1EQT A;  3GO5 A;  4KMU C;  4LFA L;  4J15 A;  1VQ4 A;  3CCR A;  1PV4 A;  5JEA J;  2JK8 A;  5LMN Q;  1JE5 A;  3M3Y H;  1PH5 A;  1HNW L;  1BCP D;  2KOL A;  1MJC A;  2OEO A;  3H3V H;  1SRO A;  2B2V A;  3T4A C;  1NBW A;  5J3B A;  3CMA A;  3U58 A;  1Q81 C;  1ZYR C;  3HOW G;  3T16 A;  4A3B B;  3UE0 A;  4OIK A;  1LTL A;  3BDL A;  1HA6 A;  4A3C G; 
#chains in the Genus database with same CATH homology
 2PQE A;  2ZXR A;  1XWE A;  1AZP A;  1EZ6 A;  1Y1W B;  1K8O A;  1TWC B;  2ZXO A;  4E6I A;  2MJ8 A;  4IUN A;  1PRT B;  1CM9 A;  2NTS A;  1O7Y A;  5T1I A;  1CFM A;  1SNP A;  1FGB D;  1V1P B;  1LTG D;  2AUJ D;  3QIA A;  3HS0 C;  4IUR A;  5KYL A;  5EGT A;  4FF2 A;  5M3M B;  5DAU A;  4P2C B;  4RGO S;  5JEA H;  2M2L A;  4HN7 A;  2HCI A;  2KEE A;  2IX3 A;  4M8A A;  2IL8 A;  2K5Q A;  3MXP A;  4DAV A;  1LT3 D;  2VUM B;  1VF7 A;  2QIL A;  2EDG A;  2A6H C;  1WTQ A;  3R2T A;  4ME5 A;  1O78 A;  2R3Z A;  4TSS A;  1F77 A;  3CU7 A;  2F0G A;  4XXE A;  1O80 A;  1CZG A;  2ID0 A;  1STA A;  4C3H B;  1F2Z A;  5IT9 E;  1LAB A;  1D5M C;  1NSN S;  3H0G B;  3KUP A;  3KK7 A;  3A55 A;  4NKL A;  4DAP A;  2L12 A;  3WOF A;  2A6H D;  1ET6 A;  1A3U A;  2NN6 G;  1Y1V B;  3VYR A;  5EPK A;  4A3I B;  1F9P A;  3AB9 A;  1SDF A;  4CKB A;  2KCC A;  1EEI D;  2CHB D;  2F0K A;  1EWH A;  2B63 B;  3FKI B;  3SK8 A;  2D9U A;  3D4R A;  1D1I A;  2SNM A;  1SYB A;  1DZ1 A;  4WJW A;  3MXN A;  4X3T A;  1HHV A;  4C1N K;  1U4R A;  3C1E A;  3D4W A;  1LAC A;  1EQV A;  2J0T D;  5EQ0 A;  5TSS A;  1PZI D;  4IUU A;  1T5X D;  3QJY A;  2FMC A;  4O1N A;  4X3K A;  1RDP D;  1KDA A;  3QWN A;  3M4Y A;  1H9K A;  2B2U C;  2EYH A;  1TR5 A;  1WTP A;  1IYU A;  5JVG 3;  1EY8 A;  3MVV A;  2F0I A;  2FHT A;  2E75 C;  2A5H A;  2XIW A;  1Q3L A;  1B53 A;  1SSO A;  1ML0 D;  2F0E A;  1AZQ A;  4RGN A;  1V8Q A;  5CMD A;  4KKU A;  4IUP A;  5KRU A;  2R6G A;  2M00 A;  3FPU B;  3VR3 A;  2PZW A;  1Y8O B;  1SYC A;  2ZXP A;  4XT1 B;  5J22 A;  4J1M A;  1Q90 A;  5HGT A;  5ELC A;  5K36 H;  5EKK A;  3E6Z X;  2FIN B;  3S17 B;  5I9O A;  5FLX L;  1C8C A;  4RHR A;  4C3H G;  3T13 A;  2BDN A;  1FNV A;  1HCZ A;  3HOV B;  3MA2 B;  1X3Q A;  4AYB B;  1LTI D;  4NMZ A;  1CQV A;  2B39 A;  1H9R A;  2Q8T A;  4ZRZ A;  4A93 B;  1TT2 A;  4FF4 A;  2MHV A;  3HEJ A;  1PTO H;  1XYI A;  2YU9 B;  5CV7 A;  1EU4 A;  1TWH B;  4XT3 B;  2F0W A;  3IFT A;  1O7Z A;  5CV4 A;  4DN4 M;  1JIC A;  4Y7N B;  3R93 A;  3OWF A;  3DWP A;  1EEF D;  1LLR D;  2HDM A;  1CI3 M;  1IKM A;  3A56 A;  2F0S A;  4RA8 A;  1UNS A;  4IFD J;  2B2T A;  1BDO A;  3J81 L;  3GTQ B;  4EQP A;  2A6E C;  3H91 A;  1DJR D;  4R8I A;  2K33 A;  3ERQ A;  1JQY D;  3ND8 A;  3NUC A;  4M1U B;  1STE A;  1GJX A;  1QJO A;  2N55 A;  3FMC A;  4BWG B;  3NWT A;  4NW2 A;  1EYC A;  3HOU B;  1STN A;  4TKO B;  3OW7 A;  1B44 D;  1STG A;  1KAB A;  4EQN A;  1IL8 A;  3U9S A;  1VMP A;  4L63 B;  2DN8 A;  5EJW A;  4DXG A;  3MFG A;  1RKN A;  2KCN A;  2MPM A;  3IKJ A;  5IGD A;  3OMG A;  4IFD H;  3TP8 A;  2WB1 B;  3FDT A;  1WTV A;  1ESF A;  5A2Q E;  4ILW A;  1PFM A;  2NZ1 D;  4QCL A;  2XWB B;  2RSO A;  4FXG C;  1JWU D;  1PLF A;  3BDO A;  1XX8 A;  4OO1 H;  3NPP A;  1ET9 A;  1CQF A;  1EYA A;  5IOD A;  1GHJ A;  4ZKB B;  1I3Q B;  5KNC A;  2EY5 A;  4KJN A;  3A8J E;  1QCB D;  4K2K A;  5E3F A;  4OGQ C;  1TS4 A;  3K7A B;  1ESR A;  2KUM A;  3ONA B;  4IQZ A;  1JE4 A;  3A8K E;  5C3X A;  4DK0 A;  2PNR C;  1MI2 A;  2F0N A;  5K5P A;  1CT1 D;  3D3R A;  2F0Q A;  4B9X A;  3MZ5 A;  4A3D B;  4XQQ A;  3VR4 A;  2E74 C;  2FJ2 A;  5KEE A;  5DNF A;  2A68 C;  2E2I B;  4C56 C;  1V43 A;  3NHH A;  2TSS A;  1RJT A;  3A7A B;  1OXS C;  2SDF A;  3H94 A;  1BR9 A;  4KKS A;  1JOQ A;  1TQO A;  3VA5 A;  4DNT B;  3DMU A;  5CC4 A;  3J80 E;  3P75 A;  4BS9 A;  3F2U A;  1YNJ D;  1WTX A;  3I70 A;  2X6L A;  1TII D;  4RH6 A;  4HSV A;  3QOJ A;  5FLX E;  2RQX A;  4XYQ A;  4V19 0;  1SND A;  4RFB A;  2XSC A;  5C0X G;  1IYV A;  2BA0 A;  3BYT B;  1SYD A;  4KY5 A;  1FD7 D;  2NVQ B;  1A15 A;  2NWG A;  1KAA A;  1HFG A;  3URY A;  1K83 B;  3NTI A;  5C4H A;  2F3V A;  5G3L F;  4I65 A;  3JAM L;  1TS5 A;  1GOZ A;  4CGY B;  1JCK B;  2WAC A;  2L0C A;  1KLG D;  2Q8I B;  1TWA B;  3RZO B;  1XXG A;  1KNE A;  1IW7 C;  2QF7 A;  3BVZ A;  4PV1 C;  3BYY B;  2B2Y A;  5C3E B;  4ABN A;  2WIN B;  2B2W C;  1AN8 A;  3KF8 A;  3KLR A;  1PYW D;  1EWC A;  1MD2 D;  2BOS A;  1FR3 A;  1CA6 A;  2Y0S B;  2L11 A;  2L55 A;  4C3J B;  2KHS A;  4HMI A;  3ZYY X;  1IW7 D;  1ONL A;  1I4X A;  3I72 A;  4TQU S;  2EOT A;  2BE5 D;  3PUX A;  4HAE A;  4FYD A;  1HTL D;  2RVL A;  2B8G A;  3HOX B;  3TZU A;  1G2S A;  3VYS A;  4H13 C;  1SMY C;  3C46 A;  4ZQ3 A;  3GTG B;  2ICI A;  5BN5 A;  1A6X A;  2EYP A;  3OOC A;  3DHQ A;  2HCC A;  5F2D A;  3I4M B;  2Z1C A;  1ZXT A;  2Q8R E;  3VA7 A;  4LK1 C;  1CK1 A;  1SMY D;  1PXU A;  1B2T A;  4NP5 A;  2C9O A;  2CW0 C;  5C5L A;  2RDF A;  2R93 B;  1U4M A;  1LTS D;  3TDQ A;  1PMR A;  4Q0F A;  1BBX C;  3MTS A;  1HA5 A;  2DY8 A;  1SE2 A;  1JC7 A;  2E2J B;  1TS3 A;  1ZYR D;  1WVL A;  3K6O A;  3D4D A;  3DEO A;  1EY7 A;  2CW0 D;  5IGE A;  4B9W A;  2HQE A;  5DEH A;  1SYE A;  4KY7 A;  2IPK D;  2L4N A;  4BA1 I;  4G7O C;  3M7G A;  1ZKO A;  3HRZ C;  3RZD B;  4LAA A;  4DNR B;  2Z4H A;  1FNW A;  5ELE A;  1A2U A;  5IIF A;  4RGT A;  1GUW A;  1STY A;  3SHL A;  1BXT A;  4HR7 B;  1SNO A;  3SE0 A;  3VR5 A;  1SNM A;  5EPL A;  4FXD A;  1G2T A;  2G9D A;  3K5M A;  4C3J G;  2I46 A;  4FO2 A;  5HUR A;  3X3N A;  3J7Y W;  4ZKC B;  2K6A A;  3MEH A;  2A69 C;  3SVM A;  2XN9 C;  1NAP A;  3BZD B;  1D2B A;  1PFN A;  3BVM A;  4H0L C;  3V05 A;  2WKC A;  4U68 A;  4K6L A;  4K6D A;  2F0V A;  3X3M A;  2PZT A;  5ELF A;  4CJ2 C;  3G7L A;  4MIU A;  3T53 B;  4DGZ A;  3GV3 A;  1PRT F;  2B2V C;  3M4O B;  3A54 A;  1KDC A;  2A69 D;  3D8G A;  5JEA G;  1AW7 A;  3WOE A;  3HOZ B;  1RTO A;  2O4X A;  3C3L A;  4RCO A;  1H9S A;  4K5V A;  1PRT C;  2KED A;  4EGV A;  1RTN A;  3I91 A;  3IFD A;  1H9S B;  1SXT A;  3NTH A;  4QMG A;  4ID6 A;  5LL6 X;  3AMU A;  1EY4 A;  2ICE C;  1Q1E A;  1RHP A;  4PMW A;  2AUK A;  4TRD A;  1EYD A;  2K01 A;  2KEC A;  2QKI C;  5DM6 3;  4C3I B;  5KIX A;  2EYL A;  1TWG B;  1PRT D;  3C1F A;  1MSH A;  2MGS A;  3NTK A;  2AQ3 B;  3S15 B;  3SR1 A;  4XQJ A;  1DXM A;  2F0D A;  1X32 A;  1PTO B;  2IW3 A;  2OF1 A;  3VYT A;  2R7Z B;  3S16 B;  1S5B D;  4WFN 3;  2VXW A;  3J7A F;  4EVO A;  1O7L A;  3BVG A;  2J4X A;  2JA8 B;  4XIG S;  3Q22 A;  1F9R A;  1R4P B;  4IAL A;  3PUY A;  5T1G A;  3D6W A;  3PV0 A;  2D5D A;  2BA1 A;  4UDU C;  5FKA C;  4A3G B;  1K8M A;  2LMC B;  1Q8I A;  3LX0 A;  4WRD A;  1CTM A;  2WAQ B;  4RGM A;  2PYK A;  4DU9 A;  4FXK C;  4KHV A;  3S1Q B;  3N52 A;  4HCE A;  3TME A;  2EYO A;  1Y8N B;  1ENF A;  1IKL A;  1TY2 A;  1QIL A;  1A2T A;  1G6Z A;  1LT5 D;  1HPC A;  5C0X I;  1PTO F;  4QB4 A;  4CJ0 B;  2K28 A;  2O2L D;  1S5C D;  4IUT A;  1SE4 A;  3NSW A;  3QB3 A;  3H6M A;  5NUC A;  1TWF B;  2PCF B;  3U9O A;  5C4J B;  3ITP A;  4XQN A;  2O5I C;  4C3I G;  2E76 C;  4XTC S;  3MAQ A;  1VMC A;  1A3T A;  3D6C A;  5I2Y A;  3Q24 A;  2LS0 1;  2KVM A;  4BY7 B;  2A6E D;  1Q1B A;  1V1O A;  3S1N B;  1EZ8 A;  1A3V A;  2LKV A;  3FVQ A;  3HG9 A;  4RHS A;  1LT4 D;  1F9Q A;  2AQ2 B;  5CGK A;  1TKW B;  4QUF A;  1STH A;  1FNU A;  1STB A;  1Y69 U;  1JOK A;  1WTR A;  1MBY A;  1DON A;  1WCM B;  1SNQ A;  1SE3 A;  5FO9 B;  3GQB A;  1EY5 A;  4FP5 D;  2NTT A;  1Z47 A;  2RDH A;  1KLU D;  3OHX C;  4A3J B;  3P20 A;  2PW7 A;  2PZU A;  1ILP A;  2QDB A;  5EBC A;  3OWE B;  3PUW A;  5D3I B;  1E2W A;  5JVH 3;  3SEB A;  4F8M A;  2PO4 A;  2CVR A;  5I4D A;  2I07 B;  3VR6 A;  2MUY A;  3GTO B;  5BN3 A;  3FRP B;  1HUM A;  4HCS A;  2B2T C;  4J8Q A;  3I4L A;  4K14 A;  2XNA C;  1JWS D;  1IHZ A;  2EY6 A;  3DUZ A;  2VB3 X;  1J8I A;  3P7J A;  3E5S A;  4IFD G;  1PFB A;  1EY9 A;  3HOY B;  1S5F D;  1EL0 A;  4K8I A;  3EVQ A;  1B9M A;  4S3S A;  3PIO 3;  1EY6 A;  3NQI A;  1WTO A;  3S1M B;  4NDX A;  2IWH A;  5C44 B;  1GHK A;  4C1N I;  5IT9 L;  1D5Z C;  1DD2 A;  1D6E C;  1HRJ A;  1QNU A;  2JE6 I;  2VB2 X;  4OO1 G;  1DM0 B;  3E0J A;  1HUN A;  2C5C A;  5JPM C;  3KLS X;  1L0Y B;  2A68 D;  1AP0 A;  3OMC A;  1HQM C;  3DM1 A;  1LV9 A;  3S1R B;  4FF3 A;  5EBD A;  2F03 A;  4ZAI A;  5JJZ A;  1WTW A;  1E2Z A;  1BCP B;  2V4D A;  4WOR A;  5LL6 S;  2F3W A;  3KBX A;  1KDB A;  5A35 A;  2JP1 A;  4KN4 C;  1Z7T A;  3MHB A;  1DYQ A;  3S2D B;  1JB3 A;  3KLS A;  2D2C C;  5C4Z A;  2FFK B;  5IOC A;  1X3P A;  3SK4 A;  2JA6 B;  3I90 A;  5C5M A;  3Q23 A;  5D14 A;  4LMQ D;  5ELB A;  3S9W A;  2PW5 A;  3K0Y A;  2IT1 A;  2RKS A;  1M8A A;  4OL7 A;  4FVM A;  4IN3 A;  3TN2 A;  1NCV A;  3NXW A;  5AFW A;  5CBE E;  3H09 A;  4ZK9 B;  4R8N A;  5E1F A;  3TP6 A;  3DWA A;  3M3Y B;  1C4Q A;  1GUS A;  1SAP A;  4G7Z C;  5G3L D;  3SK5 A;  3J81 E;  3NE5 B;  3SDZ A;  1DOK A;  3EQL C;  4PMB A;  4ZUI A;  1BOS A;  1JOR A;  4BA2 I;  1W6K A;  3W3A A;  3CKI B;  1SNC A;  4PQX A;  1SYG A;  2Z8L A;  1UAP A;  3L9A X;  4U67 3;  5CR3 A;  3RUZ A;  1F2L A;  2EXZ A;  5I9P A;  1B9N A;  1G8Z D;  2EE1 A;  5M5W B;  4G7H C;  5BN4 A;  1HFN A;  2JA5 B;  1CHQ D;  4UAI A;  1DOL A;  1BO0 A;  2RA4 A;  2PPB C;  4J6H A;  5EPJ A;  1WD0 A;  1NR2 A;  2IX1 A;  5DM7 3;  2LFN A;  4KTA A;  2FMM A;  2K32 A;  4KY6 A;  3KBG A;  1I6H B;  1I6V C;  3RMH A;  1TVX A;  1G91 A;  2KJX A;  5FO8 B;  1M4V A;  4FNF A;  2ZT9 C;  3D31 A;  3R2I A;  5E4W C;  1DOM A;  1D5X C;  1CHP D;  2F0O A;  5M5X B;  4HED A;  3I73 A;  5FO7 B;  1LTR D;  4DAY A;  3QOL A;  3MXU A;  3RD4 A;  1DCZ A;  2WKD A;  2NN6 H;  2K03 A;  2L9H A;  3EA6 A;  4EQO A;  5FK9 C;  2B2Y C;  1B50 A;  3HKZ B;  4RKB A;  3K59 A;  3LWU A;  1V1P A;  1GUN A;  2B2U A;  2KQ3 A;  2DNE A;  3H3V C;  1KTK A;  2GA4 B;  2BCO A;  2JYO A;  4ZUJ A;  2XWJ B;  4CKC A;  1HTP A;  1LT6 D;  2YYZ A;  4KD4 A;  2EVB A;  5KYI A;  4DFA A;  1OXT A;  3PIP 3;  2K04 A;  1S5E D;  1CZW A;  2SOB A;  3TSS A;  4IUV A;  2H1E A;  1AFP A;  1C48 A;  3I8Z A;  3AU7 A;  4N9P A;  3NBI A;  3MXG A;  3LWE A;  3GTP B;  2MP1 A;  2PMZ B;  2OT2 A;  3I4N B;  4A3K B;  3O13 A;  1QB5 D;  1U4P A;  3MC0 B;  4QUC A;  1PZJ D;  5IGF A;  4OHJ A;  5CV8 A;  3MFY A;  1QE6 A;  3CRL C;  1OXU A;  5A2Q L;  1E0B A;  1HQR D;  3HZX A;  2EZV A;  1F9S A;  2E2H B;  3HP3 A;  4L6T B;  5M9O A;  3OSO A;  5CYU A;  3RLF A;  1H9J A;  1ENA A;  4V0B A;  4CHT B;  2X6G A;  4ODG A;  4PNY A;  1S5D D;  3CRK C;  4JK1 C;  5COY A;  1W6J A;  4H7B A;  1LO5 D;  1NUC A;  4B08 A;  4MHE A;  1GXD C;  3JAM E;  4BBR B;  1RF2 D;  3CHB D;  2JXM B;  4DK1 A;  2EYM A;  2BDO A;  3R8B A;  2K7V A;  1BQQ T;  3FEW X;  4HTH A;  3SK6 A;  1T5E A;  5J39 A;  5M3F B;  2AWO A;  1ZEQ X;  1R4Q B;  4K5X A;  4RCN A;  1BUV T;  1I4G A;  4C2M B;  3OIQ A;  5IGG A;  3M7N A;  4H44 C;  3LNN A;  1HXY D;  2JSO A;  5JOB A;  2OXP A;  3A7L A;  1EIG A;  4I7Z C;  2NUC A;  1R9T B;  3GTK B;  2JEB I;  2RDG A;  2HDL A;  4F7X A;  2F0J A;  4IFD I;  2ENB A;  3NK9 A;  4LJZ C;  5E4X A;  4L8J A;  3NQT A;  4G57 A;  1I50 B;  2L1B A;  3J80 L;  3R3O A;  3DEP A;  4A3E B;  5C4X B;  2EY2 A;  1EU3 A;  5FOB B;  1SFO B;  3NBH A;  4IZ8 A;  2D62 A;  3K5L A;  3UI2 A;  5CBA E;  4CKE A;  1ROD A;  3GV6 A;  1NR4 A;  3L7Z C;  1Q12 A;  3T51 B;  4OO1 I;  3GP7 A;  4R9W A;  1JWM D;  5EKL A;  2JEA I;  5ISR A;  2A74 C;  1GUT A;  4KK7 A;  5IGC A;  1Y8P B;  4BBS B;  5KNB A;  2DNC A;  3I3C A;  1ENC A;  5K36 G;  3NP8 A;  4RAU C;  2SNS A;  3A8I E;  2IX0 A;  5KND A;  1MGS A;  5C6A A;  3PO3 B;  2R61 A;  4KKT A;  3MWY W;  1U4L A;  1RD9 D;  2K1B A;  4HMJ A;  2EJF C;  1PTO C;  1UEA B;  1GUG A;  3EFX D;  5JAV A;  4A3M B;  2EY1 A;  1YNN C;  3PO2 B;  4DF7 A;  1VDZ A;  3V2T A;  1KNA A;  3T56 B;  4ULL A;  2K05 A;  5D3D A;  3C2P A;  1MSG A;  5I6Y A;  4FF1 A;  4G4K A;  3GD7 A;  2EPB A;  4K2L A;  1PTO D;  3IL8 A;  1YNN D;  2RSN A;  5ELD A;  3QG1 A;  2NYZ D;  2SEB D;  1ILQ A;  2IJ0 A;  4DA2 A;  4IUQ A;  2EJM A;  1I4P A;  3VYU A;  3S14 B;  1TY0 A;  2AWN A;  4N9T A;  1QOH A;  1CA5 A;  1LTB D;  2EYJ A;  4QIW B;  4QF4 A;  3TZD A;  4Z9C B;  1FYC A;  1RCV D;  5C0X J;  3W2D A;  3Q6S A;  2WII B;  3BDC A;  3VR2 A;  2XRQ D;  5J1Z A;  1GUO A;  4K5W A;  4F88 A;  1OO9 B;  1J9O A;  1SBB B;  2EJG C;  1I4H A;  5COR A;  2K5D A;  5IGB A;  2A73 B;  2TMP A;  3TBI B;  3IAY A;  2WP8 J;  2F1M A;  4HSP A;  3K5N A;  3ERO A;  1II3 A;  1L0X B;  3FPP A;  3K58 A;  4XYO A;  1UUP A;  1OXX K;  3GTM B;  4XDX A;  1XTC D;  1SJH D;  1Z6H A;  1F2M A;  1B3A A;  1BNZ A;  5C0X H;  2F0M A;  4KJO A;  3L3O C;  2R92 B;  2HUG A;  4GZY C;  2XVS A;  2Z4I A;  3K5O A;  1EFI D;  2NVY B;  2B8F A;  4DXF A;  5M5Y B;  1E2V A;  3ND9 A;  4KHZ A;  3PMF A;  3OPO A;  2B2W A;  2AQ1 B;  1SJE D;  5JPN C;  3EJI A;  3GTL B;  3DWQ A;  2LY7 A;  4A3F B;  1I4Q A;  5EKI A;  4O42 A;  2K5W A;  1F2Y A;  3WDN A;  1EOT A;  1YNJ C;  2JA7 B;  1QG7 A;  4JBW A;  1LTT D;  3PUV A;  4RWS C;  2F0H A;  1JOO A;  3DXJ C;  1VF5 C;  4RKL A;  3BS1 A;  2F0U A;  5CV9 A;  1VCI A;  3CQZ B;  5I6W A;  1SYF A;  1B1Z A;  2NB0 A;  3Q0A A;  2NVT B;  2L5T A;  2F4I A;  5D65 A;  3HOW B;  1S4Z A;  4OIJ A;  1AEX A;  1QNK A;  1U9R A;  4KN7 C;  2J7Z A;  4KD3 A;  4K8J A;  1D1K A;  3NWS A;  2NN6 I;  2VNU D;  2X69 A;  4KI0 A;  4CBV A;  3SXH A;  1EIH A;  3PUZ A;  3M85 A;  1JR0 D;  3S2H B;  2WV6 D;  2E2D C;  2RBM A;  2EYF A;  2F0P A;  3QO2 A;  1BF4 A;  1ICW A;  4YIJ A;  3TP7 A;  2F0T A;  1PZK D;  4X3S A;  3J7A V;  2N88 A;  4CJ1 B;  3V96 A;  4BY1 B;  2BE5 C;  3OIP A;  3HGB A;  4Q5V A;  3BG3 A;  5LHY 1;  2O5J C;  1H9M A;  1G29 1;  1B4O A;  2H4O A;  2M9V A;  2QCP X;  1PDQ A;  1LTA D;  1QWY A;  5CV6 A;  3P1H A;  5CV5 A;  1SEB D;  3G6J B;  3TP5 A;  4ZYS A;  1OXV A;  2NBF A;  2CQA A;  3N6R A;  1TS2 A;  1BCP F;  3GTJ B;  2NVX B;  2F0L A;  2QEJ C;  2G9H D;  1WD1 A;  2KA7 A;  4ZLT F;  4PMC A;  1TU2 B;  1BCP C;  2F0F A;  2XRS D;  3K57 A;  4MN3 A;  4X3U A;  4KV6 A;  2DY7 A;  1I4R A;  1EY0 A;  5I2X A;  5C3W A;  5KGU A;  4F87 A;  1EQT A;  3GO5 A;  4KMU C;  5JEA J;  1BCP D;  2KOL A;  2OEO A;  3T4A C;  2B2V A;  1ZYR C;  3T16 A;  4A3B B;  4OIK A;  3BDL A;  1HA6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...