2EY2A

Crystal structure of staphylococcal nuclease mutant t41c
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
136
structure length
136
Chain Sequence
KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDCPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Staphylococcal nuclease
publication title Threonine mutants of Staphylococcal nuclease
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 38
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2005-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2ey2A00
2EYPA 5I9PA 5JOBA 4DF7A 1EZ6A 2NUCA 2EYJA 2F0SA 5J1ZA 5J22A 5I6WA 1KDCA 2PZUA 1SYDA 3P75A 5CV4A 3ITPA 5HURA 3C1EA 4KY5A 3RUZA 3TP8A 3V2TA 4B9WA 1A2TA 2EY5A 2LKVA 1ENCA 2F0NA 4ZQ3A 3SHLA 3MEHA 2M00A 4IALA 2F0JA 2RKSA 1SNCA 5KGUA 2EYFA 5NUCA 2QDBA 4I65A 4KY7A 1TQOA 2OXPA 1SYBA 4IUNA 4QB4A 2EY6A 4J1MA 4J6HA 3MHBA 4ODGA 3SXHA 3EVQA 5CR3A 4PMBA 1JOOA 5C3XA 1SNOA 4HMIA 2PZWA 2F0EA 5M9OA 1RKNA 2PQEA 1NUCA 1TR5A 2F0MA 4K6DA 5CV8A 5C5MA 3SK5A 3TMEA 5C4HA 3NP8A 2RDFA 2EY2A 2PW5A 4H7BA 4F7XA 1TT2A 2PZTA 2KQ3A 2F0LA 1NSNS 2F0TA 1SYFA 2F0UA 5C6AA 2SNSA 4EQNA 3D6CA 3P1HA 3D4WA 5DAUA 1SYGA 2HQEA 4N9TA 4RKBA 1SYCA 1U9RA 4YIJA 3OSOA 2ENBA 4K5VA 4K2KA 1EY0A 1KDBA 3NUCA 4KY6A 5CV6A 5I6YA 2EYMA 1A3VA 4KJOA 1EQVA 1F2MA 4R8NA 4E6IA 1F2YA 4K8JA 4DU9A 2PW7A 3DMUA 4S3SA 5KIXA 4ME5A 1EYCA 5C5LA 2SNMA 1EYAA 3D8GA 4K8IA 3C1FA 4WRDA 5IGBA 1A2UA 5KRUA 1ENAA 3NXWA 5CV5A 4B9XA 3OWFA 1STHA 2F0IA 3VA5A 3NK9A 1KAAA 3SK4A 3S9WA 3MVVA 3T16A 5J39A 3BDLA 5E1FA 3D4DA 1SNQA 3QB3A 2F0PA 4QF4A 2OF1A 4RKLA 3T13A 5IODA 1EY5A 1EY4A 2F0DA 4HTHA 4ID6A 1SNPA 2EY1A 4ZUJA 2WACA 1AEXA 1SNMA 4MIUA 2F0OA 3TP7A 2F0QA 2KHSA 2EYLA 1EYDA 4QMGA 5KYIA 3R3OA 5CGKA 2F0WA 3PMFA 4NKLA 5CC4A 1EY6A 4KD3A 4N9PA 3SK6A 4PNYA 3E5SA 2F0FA 2F0GA 5IGDA 3EROA 3HZXA 1II3A 4KHVA 1STBA 4DFAA 3OMCA 3DHQA 1A3TA 1KABA 4K5WA 4KTAA 1STGA 2F0VA 2OEOA 4DGZA 5EKKA 3HEJA 5KEEA 3BDCA 5CV9A 1JOKA 2F0KA 1IHZA 3ERQA 3SR1A 3EJIA 4PMCA 3TP6A 1EY9A 3NHHA 2RBMA 5C3WA 5HGTA 4ZUIA 2O4XA 3MZ5A 4KV6A 1F2ZA 1SYEA 4OL7A 2EYOA 5I9OA 2F3WA 5CV7A 5KYLA 4F8MA 5F2DA 1JOQA 3LX0A 4NDXA 5C4ZA 1STAA 4K5XA 3QOJA 5IGGA 3H6MA 4EQOA 1EZ8A 4EVOA 2SOBA 1A3UA 5IGEA 5IGCA 5IOCA 4TRDA 3NQTA 2EXZA 3OMGA 3QOLA 1KDAA 2F0HA 4NP5A 4WORA 4EQPA 5EGTA 3TP5A 5IGFA 1EY7A 1SNDA 3U9OA 4NMZA 4IZ8A 5E3FA 4KD4A 5ISRA 4HMJA 4LAAA 5DEHA 5IIFA 3SK8A 1STYA 4KJNA 3MXPA 5K5PA 4K14A 5EKLA 2F3VA 1EY8A 2PYKA 4G57A 1JORA 1STNA 2EYHA 4K2LA 5JAVA
chains in the Genus database with same CATH superfamily
2A5HA 1EZ6A 1J8IA 1VS0A 3IRBA 5DNFA 1SMXA 3S15H 3F2UA 1ESFA 4IFDH 1XMQQ 2IX0A 1ENCA 4ZQ3A 2N49A 3I55A 1B1ZA 2RKSA 2R7ZG 2JJQA 2F03A 1SN8A 3DEPA 3BVGA 4DA2A 5D3DA 2LSSA 1KC8C 2N8NA 1E22A 2E74C 3KF6A 4FF4A 4DKAC 3TDQA 2CHBD 1QCBD 3ERSX 4HSVA 3HG9A 2UUCQ 3CC2A 3NP8A 5FLMG 4DV0Q 1SBBB 5C3EG 4AQYL 1G291 3UDFA 5M5XH 5C4JH 3J80c 3P1HA 3E9IA 2UU9L 1J5EQ 3Q23A 1B44D 1L1OC 2JQOA 1VQLA 1WJJA 2ENBA 1C48A 1DM0B 4JC0A 2EYMA 1M8AA 4CDCC 1HNXQ 1ZYRD 1NR2A 2BCOA 2KEDA 2PW7A 2IWHA 1FL0A 4GOPC 2VNUD 4EQ5A 4DV3L 1NR4A 1QUQB 3C1FA 3RD4A 4GLXA 2OTJA 3U4VA 4B9XA 4HIDA 3I72A 3K8AA 4KKSA 3NK9A 2WAQB 3S2DH 5E1FA 3S1MH 3H94A 5I2YA 2QCPX 5M5YB 2KUMA 3PIPA 2AQ1B 2F0DA 4ALPA 5C44B 4B3SQ 1EEID 1X3QA 4B3TL 1LT4D 1K28A 2WFWA 3NE5B 4PNYA 1XMOL 3HOWG 2JA5G 1VMCA 3OMCA 3M7GA 4QUFA 2XNAC 5KNBA 1N36L 4P71A 2AQ2B 1E0BA 3K59A 1E3PA 1PTOD 1GM5A 3M4OB 3BZKA 1FGUA 5I9OA 4CJ0B 1G6PA 4JYAL 4BWGB 2PCFB 1A63A 2M9VA 1WTHA 1PZJD 1U5KA 3EIVA 3CQZB 2EXZA 3NQTA 4WORA 3KJOA 1O7ZA 1WCMH 5E3FA 3R2IA 2AKWB 2QEJC 4Y52H 4UY8C 5LMNQ 1X55A 1KXLA 1IL8A 1A15A 1YNJC 3K57A 1CA6A 1HUNA 3K7AB 4OIKA 5M3FG 2NVYB 5I6WA 1O7LA 2JA7B 1DCZA 4N8FA 4DUZL 3RUZA 3HOYH 1CHQD 2L55A 4R8IA 2F0JA 1JR0D 4F87A 3PO3B 1X3GA 1QZGA 3EVQA 4LF9L 1K0SA 3MXGA 3GTKH 4RGNA 1HPCA 1STEA 5IYDH 3RN2A 4BA2I 4Q0FA 4LFAL 4F7XA 4C3IG 3FKIG 2F0TA 2K14A 4DV1L 5C6AA 1VQFA 3M85A 2N3SA 5AFWA 3S14B 3WWVA 1K3RA 2J7ZA 4O0AA 1YJWA 5ELEA 3DLLA 1YVCA 4K5VA 1FJGL 2ID0A 4R8NA 5C4XG 4POFA 1KRTA 4RA8A 2AUKA 2UUBQ 1S5DD 1AZPA 5JJKA 4A3EH 1IL2A 2K75A 4CDFC 1YIJA 2AWNA 2LMCB 2V4DA 3S17H 1E7ZA 3I4NH 5D3IB 3KOJA 4ZCKA 5LMUL 2OCEA 5T1IA 3MVVA 4LF8Q 3PGZA 4A3BH 1HNZQ 3PUXA 2YU9H 3I8ZA 3MXUA 4HAEA 1Y1WH 1EU3A 5A35A 4HIMA 2MPMA 1WD1A 1GKHA 2UUCL 2CFMA 4DV0L 3EROA 4GS3A 4DR6Q 4IUVA 4G7HC 3PIOA 2EJFC 1LACA 4LF4L 4P74A 4ZLTF 4POGA 4CBVA 3SR1A 5C3WA 4HJ8A 1EYGA 3WDNA 1V1OA 4RGOS 1OXXK 1I6VC 2JA6B 4GKKQ 3ZJYC 1OXUA 1ML0D 1HR0Q 1AP0A 2NBFA 3PCOB 1K8OA 3PF4A 3K5NA 1I3QB 3FHWA 5K36H 4QCLA 2DJFC 2SOBA 5E7NA 1AFPA 4TRDA 1BCPB 2D62A 3R93A 3X3MA 4LFBQ 3CKIB 3CCEA 4DV6L 4J15A 3G6EA 5IY0A 1KD1C 2XSCA 4JV5L 4KJNA 1XNQQ 1IBLL 4GKJQ 5EKLA 1BCPC 3OIQA 4DV5Q 2Q8TA 2EYPA 2HCIA 3VYUA 3B6YA 2QGQA 2OQ0A 3C1EA 1BNZA 4BY7G 4OX9Q 4IPCA 2VW9A 5IWAQ 2OTLA 5NUCA 3OWEB 3FVQA 1J9OA 2XWJB 1SYBA 2GN5A 4KKTA 5KNDA 1LT3D 1IZ6A 1D5ZC 1S5ED 4J6HA 3J80i 4PMBA 1S5CD 4HIOA 3I70A 4WFN3 1IKMA 2F0MA 4K6DA 5C5MA 1E2WA 3E3XA 3SE0A 3RR5A 4BBSG 2L11A 4A3IB 1LTTD 5DM73 3J80E 2FJ2A 2R92H 1PLFA 1PTOH 2R93B 3D4WA 2VUMB 3AFPA 1CKMA 1IBKL 3S1QB 1F2MA 1K0RA 4GLAC 1IBML 5I2XA 1HUMA 2NN6I 2VL6A 4MN3A 4OWXB 3PIP3 2IX1A 2PMZE 3T16A 2JEAI 3LGJA 4KKUA 4IO9A 1H9MA 4X64Q 5M3MB 3CU7A 1VQ6A 4B3RQ 3J81c 1VQKA 1AEXA 4MIUA 1QVFA 4KMUC 2EYLA 5CGKA 4A3FG 3S24A 1YNNC 3E5SA 3HOWH 5IYBG 3NELA 5ELCA 1HJPA 2F4VL 1KABA 3I4MH 1I4GA 1STGA 4DNTB 3PF5A 3H3VC 4KK7A 3NENA 1BDOA 4X3UA 3HOUB 4UAIA 2DY7A 1IHZA 4X3KA 5G3LF 2NTTA 3CMEA 4JI4L 1LTRD 2L4NA 4MZ9A 4CGYB 2K50A 2E5LL 1SYEA 4OL7A 2ZJQA 2R6GA 3KF8B 4NDXA 1X54A 2K7VA 1VQ9A 2JA5B 3OOCA 3UE0A 4LF5L 2LS01 2NVTB 1KDAA 4EQPA 1SNDA 2P5ZX 3GTMB 4XQJA 2EJGC 3BVMA 3RLFA 2K01A 1TS5A 4A75A 5I9PA 5M3FH 4A3GG 1XX8A 3DM1A 1YI2A 4B9WA 5GQOA 4ZYSA 4DAYB 1VQJA 1MD2D 5EJWA 1KLGD 1N32Q 1TU2B 3H0GB 1TKWB 4BBRB 1VQCA 5KGUA 2EYFA 2YTXA 3I4LA 4Z9CB 4FO2A 3NWSA 4IUNA 1PHJA 4GLVB 4CDDC 3KLRA 4JI0Q 2WP8J 1R4QB 1OTCA 2N88A 1HRJA 1Y14B 3SK5A 4FF1A 2C35B 3W2DA 5GAHC 3HOXH 1BR9A 3E0EA 3GTPH 2TMPA 2ZM6Q 3K80C 2Z1CA 1T5XD 3MTSA 3W3AA 5LL6X 1IW7C 4RKBA 4QL5A 1PH1A 1TWFB 3F1ZA 5I6YA 2FMMA 4FF2A 5C4XH 1QG7A 3CCQA 1DGSA 3ULPA 3T1HQ 2RHSB 4JPBW 4C3IB 4UPAA 3VA5A 1GO3E 3A5ZB 2RHQB 1V1PB 2OF1A 2BE5C 1A6XA 2WB1B 3T4AC 4RMFA 4GNXC 4UP8A 1HA6A 4NKLA 3MWYW 3EBEA 1STBA 3D3RA 1SLJA 1IXRA 4LUZA 1X3PA 4DGZA 2H5XA 2JE6I 5KEEA 5EBDA 5CYUA 3BZDB 1SFOH 4X62Q 1JWMD 2MUYA 4JI6Q 1M4VA 2B3GA 1LTLA 4HJ7A 3LX0A 3STBC 1I94L 5COYA 2XN9C 1A0IA 5IGEA 3QOLA 3GTJB 1L0XB 4X65Q 4DV4L 1W6KA 2PPBC 4DR2L 2RA4A 4NMZA 2I46A 4IZ8A 4B08A 4X64L 4HMJA 1I4PA 4B3RL 3L7ZC 4G7ZC 1K3BC 2FXQA 1K73C 2QDLA 1JORA 1TVXA 4ZAIA 1SE4A 1GVPA 4LF6L 1YNXA 4JI3L 1A2TA 1PV4A 2MO1A 4YCUA 2WIIB 4A3JH 5AJ3L 1R9TH 1RTOA 4C3HG 4QB4A 4GZYC 2E2JB 3RN5A 2MGSA 4YWKA 1F9PA 2K6AA 2CH4A 2NN6G 1BBUA 4AQYQ 3J7A5 1WCMG 1PFBA 5JJLA 1DYQA 2KOLA 1BBXC 5M9OA 4OIJA 4R4IA 2MFIA 2UU9Q 1JWSD 1BOSA 2A73B 2SDFA 3TZUA 4BBSH 4A3CG 3RMHA 2PW5A 2QEXA 3A74A 5G3LD 3R8BA 4Y7NH 1EIFA 3JC66 3KK7A 1JC7A 4BXXH 3FPUB 1SYCA 3HOYG 4DV3Q 2F1MA 3NBHA 1AW7A 4DR1L 1JB3A 5CBAE 4ZKBB 3J81i 4K8JA 5A2QE 1D2BA 1TY0A 2Z0SA 5JEAJ 4B3TQ 1SRUA 4MTKA 2FMCA 4RCNA 1EFWA 2RCFA 5FJ8H 4APVA 3J81E 1TWCH 2CQAA 4U68A 1XMOQ 2DNEA 2CCZA 3S16H 4LJZC 4HCSA 2L9HA 1H9SB 5JVH3 3AYHB 3AB9A 1XPUA 2F0QA 2IHEA 1JJCB 4KD3A 1YNJD 5IYBH 2DNCA 3V05A 3GTLH 1PXUA 3TQYA 3GTOH 3W1GA 4JVZA 4A3DH 4K5WA 4DPGA 5EKKA 2GA4B 1EFID 4A3EG 4JW0A 2JA8H 3NHHA 1ILPA 3I4NG 4YCWA 1V9PA 3K81C 3N6RA 3T1HL 2EPBA 2KECA 4A93B 4F8MA 2B8FA 3E6ZX 4OELB 4A3FB 4A3BG 2Z9HA 2PNRC 1X6OA 2VQEQ 4A3KG 4FXGC 2HIXA 1A3UA 4H44C 4LFCL 1Y1WG 4NP5A 2F0HA 4GN3B 1VQAA 5A2QL 3M7NA 4QIWB 2A6ED 4DUZQ 1LYLA 2JSOA 1DOKA 1FGBD 2EYHA 2R7FA 4K2LA 2B2UC 3FPPA 4CKCA 3S2HB 4A3GH 4MHEA 3T51B 5CV4A 4LF9Q 4KY5A 5LHY1 4IOCA 3OTOL 3MEHA 5I4DA 2EQSA 5K36G 3IL8A 2HIVA 3S1RH 4LFAQ 1CSPA 1GJXA 4AYBE 4DV1Q 5JPMC 2A68C 3TMEA 3HS0C 1JWUD 4A3MH 2B63H 5BR8L 3TS0A 3HOZH 2QILA 1HZCA 3A8KE 4RH6A 1FJGQ 1Z6HA 2NVQB 4DXFA 1WTWA 3CCJA 3D6CA 1EEFD 4JI1Q 1C8CA 3RZDB 2G9DA 1EU4A 1DOLA 5LMUQ 1Y8PB 5FOBB 3DMUA 3I91A 1JCKB 3A0JA 3RLOA 1I50H 1VQOA 2DN8A 5GAEC 1NE3A 3D4RA 3OWFA 4A3LG 2FHTA 4DR3L 2UXBL 3NTIA 4FYDA 1EOVA 1NMFA 4ID6A 4C3JG 2X6LA 2YYZA 3KDFB 2R92G 4O2DA 4LF4Q 1TIID 1J6QA 1YJNA 3SK6A 2KVMA 2Q8IB 1KRSA 4X66L 1MSGA 1D1IA 4XYQA 4OEMB 1WTXA 1PRTB 1EY9A 3Q6SA 4DAMA 1TS2A 1EWCA 4OWTB 3GP7A 2JXMB 2R7DA 4DV6Q 4XT1B 3VDYA 1ZEQX 2ALYB 4CJ2C 1G6ZA 4K5XA 3CCUA 4JV5Q 2FINB 1IBLQ 4BA1I 3M4QA 5C44H 1K9MC 2PQAA 3KLSA 2BH8A 3SGIA 3MEFA 3SK8A 1Y69U 1YZ6A 3I4MG 4GN4B 3S1MB 3U9SA 4DF7A 3HKZE 3CCMA 2F0SA 4N8X1 2QF7A 3M4OH 1Q81C 1Y1VH 2RSNA 5HURA 5M5WB 3V2TA 3SHLA 5ELFA 4X6AH 3CC4A 4RGMA 4C3HH 1HFNA 2CWAA 1P16A 2BA0A 1OXSC 2KCCA 4IUQA 2YV5A 2NN6H 2JA9A 1G51A 4HJ9A 4CHTB 1Q8IA 2VQEL 1SE3A 2E76C 5JEAH 3VYSA 4A3CH 1UE6A 1SDFA 1IBKQ 2KQ3A 2PMZB 1YHQA 2L1BA 2J4XA 1PH7A 1S5FD 2NVYH 1IBMQ 5DAUA 3U50C 4YIJA 1G2SA 1WD0A 1EUJA 3KBXA 3WOFA 5T1GA 3T53B 4JI8L 4S3SA 5KIXA 3FDTA 4LF7L 3KFUA 3I90A 2KEEA 2NTSA 5DLQE 3F2BA 1VF5C 3C2PA 4C1NK 4PZ8A 2Z6BA 3HOXG 2F4VQ 1TWAH 3I2ZA 1I4QA 2F52A 2B2WC 4TSSA 1ONLA 2KHSA 3ND9A 1B3AA 5KYIA 3S14H 1I4RA 1OXTA 1U4LA 4JI4Q 4A4IA 4NB3A 4UHVA 2E5LQ 3KBGA 4DFAA 1PH8A 2OEOA 1Z47A 1CSQA 4H0LC 3BDCA 4JI1L 4FVMA 1VQ7A 2ZT9C 1PH5A 3RNUA 1LT5D 3KLWA 2B8GA 3CXCA 4LF5Q 1DZ1A 3PUWA 4R4QA 4H13C 2EYOA 4AYBG 1V1QA 4ME3A 1XJVA 1BF4A 3V96A 4A3KH 1HCZA 4F88A 5IGGA 2DGYA 4EQOA 1EZ8A 2MQHA 3OMGA 2XVSA 5IGFA 2AHOB 4A3EB 1KL9A 2K52A 3S17B 3I7FA 1N34L 3I4NB 4OXPA 3F8TA 4QJFA 2WKCA 1U0LA 5H1SE 2YU9B 2O5JC 4IUPA 1Y1WB 2PZUA 3GTQH 1PH6A 2EY5A 1PFMA 1VCIA 3FMCA 1YHAA 3J81j 1I3QH 4DR4L 2K5QA 2JP1A 1QWYA 2H4OA 3MFGA 5FO7B 1AE3A 4RHSA 1JJGA 2WINB 4HN7A 3CCVA 4NW2A 5JJIA 4PQXA 1GOZA 3RZOB 2NVXB 1AH9A 2XRSD 4R9WA 2NYZD 4IJHA 3DUZA 2CW0C 3G48A 1T9HA 2KCMA 3G4SA 4JOIC 1MGSA 4G7OC 1AE2A 2UXDL 4DUYL 4J8QA 1LV9A 1LTGD 4IURA 1JMCA 1EWHA 2B2YC 3CPFA 1O80A 4A3JG 2IPKD 1WTRA 2A8VA 3STBD 2QKIC 2NWGA 4ME5A 4GN5A 1N33L 3D8GA 2WAQE 4A3LH 1EIHA 2O5IC 4PZ7A 1BBWA 4RWSC 1Q90A 2MJ8A 1ESRA 2F0PA 2G9HD 1GUOA 4C3JH 4A3IH 2R7ZB 1RF2D 4HTHA 1SNPA 3TS2A 3I3CA 4BXXG 1CK1A 3PMFA 4LWCA 2XRQD 3HKZG 5IGDA 2F0FA 1OXVA 3URYA 1II3A 4EX5A 1CT1D 3K5MA 2VXWA 1JE4A 1EIGA 5IP9G 3I73A 5C3EB 3PO2G 1I94Q 1LABA 1FVIA 4OONA 1PTOB 5CBEE 1UE7A 4DV4Q 2LXKA 4DR2Q 1HNWL 5FJ8G 4L5SA 1W2BA 5M3MH 1LTBD 3UDIA 1W6JA 5FLXE 4XIGS 1GUWA 3H3VH 1GD7A 4DR7L 2HCCA 1RIPA 1SEBD 3DEOA 5LMNW 4R4OA 5EKIA 4LF6Q 5E4XA 1XPOA 4JI3Q 4A3DG 1EY8A 1PYWD 1SJHD 3ULJA 4OO1H 3GD7A 1JOOA 3TSSA 3WOEA 3HOUH 5JOBA 5AJ3Q 2VY3A 2JA8G 4TVAB 2HHHL 1CHPD 2NZOA 1PH3A 2JEBI 4TKOB 1NAPA 1AZQA 2C5CA 3HOVG 1Q12A 4KN4C 3TEHB 1K8GA 3HOWB 3MAQA 2Q2UA 2EE1A 4TQUS 1VQEA 2E2IH 1IKLA 2UXCL 1TQOA 2OXPA 3NPPA 1A62A 1QVGA 4YCVA 2LFNA 1RCVD 1JE5A 1B9NA 3KF6B 2KJXA 1L1OA 4I7AA 1MJEA 1UAPA 4DR1Q 1NSNS 1W3SA 2Y0SE 4IN3A 5ELDA 4BY1G 1SMYC 4GOPA 5FO8B 3T1YL 1CZGA 4Q5VA 5FLXL 1TWGH 1EY0A 3NUCA 4KY6A 4X3SA 3HP3A 2UUAL 2Z6KC 2EVBA 1FNVA 1QUQA 1LT6D 4K8IA 5M3FB 2AMCB 2A19A 5CV5A 3CAMA 3GQBA 1SROA 4A3MG 3A5UA 2B63G 4RKLA 3HOZG 2VB3X 1ICFB 3FP9A 3OHXC 1Q82C 2WACA 3DWQA 3A8IE 1A8VA 3AQQA 3CCRA 2MO0A 1LLRD 1C0AA 2IL8A 2PQAB 1TWFH 4HCEA 4X3TA 1XNRL 3PUZA 1C4QA 2F0VA 2IW3A 3HEJA 1B50A 1HR0W 2F0KA 3FKIB 3HOXB 1FNUA 4LFCQ 3MZ5A 1F2ZA 4NXNL 1B53A 5IP7H 1U4RA 2D0PA 4JI7Q 1G2TA 1LUZA 2A68D 1E1TA 1HQRD 4DK0A 5C4XB 4LNQA 2FFKB 3TBIB 3A7LA 1RHPA 3U9OA 4LUVA 4KD4A 5ISRA 1GHKA 3GV3A 1LTAD 2OT2A 1PYSB 5JJZA 4AIMA 3OTOQ 4L5RC 1B3QA 1QNUA 3KUPA 1I6HH 1B9MA 3QO2A 1UEAB 1X56A 1RTNA 4OHJA 4RGTA 1T5EA 2H1EA 2DY8A 3P75A 4RHRA 2WAQG 4LW1A 5FK9C 1LM0A 1S3OA 1F9QA 4KHZA 2Z8LA 1LTID 4XT3B 5BR8Q 5C44G 4JI2L 4J1MA 3JAMc 3SXHA 2JK8A 1SFOB 3PQIA 2N55A 2IT1A 4XDXA 4HMIA 4DN4M 4DK1A 5IE8A 2Q2HA 2B2WA 3VR4A 1PYBA 5C4HA 4DV2L 2HT1A 3M4PA 2VQFL 3DXJC 1TWHH 5C0XH 1UNSA 3AU7A 1F2LA 2E75C 4FF3A 4HIKA 3PUYA 1SYFA 1BCPF 4NPSA 1BXTA 1Y1VG 2RCNA 2HQEA 3MXNA 4QY7A 5CV6A 5GAGC 4DR3Q 2UXBQ 1EQVA 1S40A 3P7JA 3H3VI 1U4PA 1H9JA 3OYYA 1JICA 1MJCA 1A2UA 1XYIA 5JEAG 4BY7B 4OO1I 4L63B 3PSIA 3T13A 3GTGH 1SXTA 4X66Q 4P73A 4JBJA 1GXDC 2Z4IA 3FEWX 2VS1A 1SNMA 2JA7G 2B2TC 4QMGA 2E2HH 3M3YB 2F0WA 1EY6A 1VQNA 4QQBX 4KHVA 5KNCA 2ZXRA 5IT9L 1MI2A 1VF7A 1Z7TA 2D5DA 5IP9H 3Q0AA 1HXYD 3PO2H 4BBSB 1UE5A 1GHJA 1IYUA 4PMCA 1JT8A 1CKNA 3PUVA 1Q1BA 3T56B 1KAWA 2YTVA 1CQFA 4K0KL 1F9SA 5EPKA 3DM3A 2WKDA 5EGTA 3S1NB 4FXKC 4JI5L 2Y0SG 2ZJRA 3NTHA 2BA1A 1KTKA 1RODA 4L8JA 3MXPA 5EAYA 3TZDA 1IYVA 2F3VA 1CFMA 2CVRA 2PYKA 4HJAA 1TWCB 2B2YA 2GVBA 3S16B 3MA2B 3KJPA 2MP1A 5E4WC 2EYJA 5J1ZA 1YJ9A 1ICWA 3HOVH 4A93H 1F9RA 3BVZA 1FD7D 4KLKA 3HRZC 2M00A 4DV7L 4C2MB 3CCLA 1PDQA 3MFYA 3GTLB 2RQXA 3GTOB 1M1KC 4HR7B 1L2FA 3NQIA 4ODGA 5CR3A 1CKOA 3IAYA 4JI7L 1K83B 1BO0A 2K5VA 1SNOA 1I5FA 5L37A 5DM63 5CV8A 4DXGA 5LL6S 2B2VC 4BY1H 3S2HH 4V0BA 3HFZB 4XQNA 2I5HA 4JI8Q 1ZXTA 3A55A 3X3NA 4LF7Q 2O2LD 4O42A 1RD9D 3G6JB 4UP9A 3I4OA 3KLSX 1F2YA 1YBYA 1P8LA 1EOTA 4DU9A 1MSHA 3CD6A 1S5BD 3NWTA 4WRDA 4YWMA 5KRUA 2HDMA 1ENAA 4OGQC 1DOMA 4A3GB 1X65A 3VYRA 3CPWA 1KAAA 5J39A 3E9HA 1WTPA 1Q1EA 3GDEA 1VDZA 1RJTA 1WTQA 3BZCA 4M1UB 3K5LA 1EY4A 1UUPA 4EGVA 4IOAA 3S1RB 2F0OA 2Z4HA 5BN5A 2K03A 2K04A 4N9PA 2XTIA 4JG2A 4YHHL 3HZXA 3Q22A 1MBYA 4KTAA 1O78A 2M2LA 3OW2A 1RL2A 2K1BA 3HOZB 3CRLC 3LWUA 3DWAA 1VQPA 2B29A 1B4OA 1VQIA 4L5TA 2O4XA 1NBWA 2L5TA 3LWEA 3S15B 1Q8KA 2F3WA 5C0XI 3C46A 3KF8A 4NXML 5ELBA 2AWOA 5C4ZA 1N34Q 4YY3L 1WVLA 3QOJA 4A3IG 1BCPD 3VR6A 2CW0D 1KHIA 3BYTB 2R93G 3HGBA 2VUMG 1I50B 4LAAA 3M9BA 1CI3M 1G8ZD 1GUNA 2NZ1D 5BN4A 1PZKD 2E2DC 2D0OA 2ZJPA 3JAMi 5JAVA 1L1OB 2EXDA 1HA5A 4DR4Q 2NUCA 1B7YB 3BYYB 5M5XB 2Z6KA 5C4JB 4DAYA 5EBCA 3F2DA 4B3MQ 1PRTC 2L0CA 4GOPB 4DK6C 5M5YH 5M3MG 3JAME 3TREA 1BKBA 2EY6A 2IY5B 4WJ4A 5FLXc 1ET9A 1GUTA 2XGTA 2RDHA 5FO9B 2BOSA 4DAVA 2UXDQ 2F0EA 4PG3A 2EOTA 5HGQA 1B8AA 4DUYQ 3S2DB 2C9OA 4MNOA 1SR3A 4OO1G 3HOUG 1NY4A 3VR2A 3NSWA 1PA6A 4N9TA 5M5WH 1N33Q 1U9RA 2CKZB 3G7LA 1WTVA 2KHIA 1PFSA 2Q2TA 2XWBB 1CQVA 1S4ZA 2L12A 3CQZH 1QB5D 4KHPQ 2EDGA 5TSSA 5EPLA 1TXYA 3FRPB 5IGBA 4GNXA 4RCOA 4DR5Q 1Y1VB 3TN2A 1CUKA 1V1PA 1YNND 1XXGA 3QB3A 3W1BA 3UDXA 4ZUJA 3K7AH 3Q24A 4C3HB 3J7AF 4RAUC 1K8AC 2JA7H 3TP7A 3JAML 1ASYA 3R3OA 1WCMB 3CW2C 4L6TB 3H0GG 4BBRG 3DHQA 3PO3H 1HNWQ 1HZAA 3L9AX 3EQLC 2IJ0A 2G5DA 3A8JE 3UE1A 3ICEA 3MC0B 1KQSA 4DR7Q 4CJ1B 3HOYB 3BS1A 5F2DA 1FYCA 4PV1C 1STAA 4H02A 1EQQA 1HFGA 3H6MA 3W5OA 4DAPA 3G71A 5IGCA 3CF5A 3CRKC 2BDNA 1DXMA 4WJWA 2K5WA 4QIWE 3UI2A 4HJ5A 3GTKB 1SMYD 2HHHQ 1VMPA 1CM9A 1CZWA 5D14A 2EZVA 2SNSA 3BJUA 1EQRA 1TWAB 2UXCQ 2QW7A 3M4YA 1JQYD 1Y8NB 2A6EC 5IP7G 2Y0SB 2ASBA 1C9OA 3MXNB 2WB1G 2A69C 1WI5A 3NTKA 4CKEA 1XMQL 4FDBA 3ND8A 5CORA 2PZWA 1VQHA 1UEBA 2EIFA 1DONA 1NUCA 1IW7D 3T1YQ 1DD2A 2A6HC 2B2TA 1UE1A 4A3BB 4JCVE 2RDFA 4H7BA 4A3KB 1HQMC 2UUAQ 3QG1A 2F0UA 1Q7YC 1HZBA 2JA6H 3CP0A 1SYGA 4R4CA 4IFDI 1JB7A 3OSOA 3TRZA 3NBHB 4V190 3D0FA 2BE5D 5IYCH 4B3ML 1J5EL 1EYCA 4RFBA 4XXEA 5IT9c 3RZOH 2NVXH 2F0IA 1KNEA 3GTQB 3K6OA 1HNXL 1CKNB 3K58A 3E0JA 5C0XG 2ZTCA 4IQZA 1H9SA 2JYOA 4LUOA 1KNAA 1XNRQ 1LO5D 3A7AB 3NEMA 1X32A 5CC4A 5GROA 4NXNQ 2F4IA 2IX3A 4O1NA 2OWOA 1VQ8A 4B3SL 2ICEC 3ERQA 2I5MX 2K5NA 3H91A 4ABNA 1V43A 1WOCA 5C0XJ 1ZYRC 3AEVA 1D7QA 4CDEC 4KHPL 1JOQA 1E2ZA 2K5HA 3BG3A 2R7ZH 4DR5L 2R93H 2B2VA 1BVSA 1VQGA 3EFXD 3L0OA 2VUMH 1I4HA 2B2UA 3TP5A 2B39A 4RG1A 3GV6A 3S1QH 2PI2E 1SAPA 5K5PA 2ZTEA 2VB2X 2CQOA 3VR5A 3J7ZC 5FLMH 1Z9FA 5C3EH 1PH2A 4C3JB 1QVCA 2R92B 3N52A 5J22A 4HEDA 4JI2Q 3ITPA 4IPGA 5LMNL 2LKVA 2I07B 2F0NA 1H9KA 1MHWC 4IALA 2K05A 1C7YA 4DV2Q 1VQMA 1SNCA 1PTOC 2VQFQ 4XTCS 2JN4A 5FKAC 1PVOA 1PRTF 1QOHA 5C3XA 1K8MA 1QNKA 2BDOA 1NCVA 1PH4A 2PQEA 3ER0A 3LNNA 4MTNA 1L0YB 3VYTA 1VQ5A 1WFQA 4P75A 4KN7C 1TT2A 3ULLA 2Q2IA 2F0LA 3EN2A 3VA7A 1NTGA 2D2CC 4EQNA 5JPNC 1PH9A 1N8RC 4A93G 3Q8DA 2JA5H 3K0YA 3I4MB 4KI0A 4XQQA 3KYHC 1EIYB 1TY2A 2NVTH 4ULLA 3GTMH 3H15A 3U4ZA 2IHFA 3J80L 1SNQA 2UUBL 1EL0A 1G91A 2N78A 3KDFA 2EY1A 1D6EC 2E2IB 2ES2A 3QJYA 2I0QA 1EYDA 3C3LA 3J7YW 1QE6A 4LF8L 4IPDA 1YEZA 1D5MC 3OPOA 4I7ZC 2F0GA 3H0GH 4BBRH 1PFNA 1HNZL 1JJ2A 1GUGA 2ATWA 2DUDA 3NBIA 1EQTA 3BDOA 3OIPA 1VQDA 4K0KQ 5CV9A 1JOKA 4IPHA 5ELOA 3TP6A 2X69A 2RBMA 3A54A 4DR6L 2YTYA 1M90C 3CMAA 3P20A 5CV7A 4YWLA 3K7UC 2RDGA 4JI5Q 4JBWA 1TWGB 1XPRA 1KIXA 1HH2P 3CC7A 1FNWA 1V8QA 2DJGC 2LY7A 4GKKL 1HR0L 2ICIA 1NNXA 3QIAA 1XTCD 3QR8A 4R1JA 2ZXOA 5DEHA 1STYA 1CTMA 2J0TD 2K33A 2PI2A 4K14A 5GADC 4FP5D 2TSSA 2ZXPA 4LFBL 4DV7Q 4C3IH 4LMQD 3FKIH 4JBKA 1HTLD 3GTPB 3IKJA 3J7AV 1QILA 4QUCA 1XNQL 3QWNA 4QGUA 4FNFA 3K0XA 3TP8A 4GKJL 4DV5L 4IFDG 5EQ0A 1F77A 4ZKCB 2QDBA 4G4KA 4I65A 1R4PB 4LK1C 3MHBA 4OX9L 1RKNA 1TS3A 5IWAL 1QJOA 2XIWA 4AYBB 4GNXB 2MHVA 1ZKOA 3OW7A 1VQBA 2ZTDA 5EPJA 4PMWA 2K4KA 5HY6A 2AUJD 3PIO3 2K28A 4JK1C 4IFDJ 1QZHA 2AQ3B 2KCNA 3L2PA 1FR3A 4DNIA 4K2KA 1KDBA 1Y8OB 1A3VA 1N9WA 4KJOA 1WTOA 4E6IA 4ZK9B 3GTJH 4P2CB 1I4XA 2CWPA 1XWEA 2OQKA 5IT9E 1I6HB 5C5LA 4C56C 2SNMA 2MNAA 2CH4W 4R4TA 1STHA 2Q8RE 2WV6D 1NJIC 3D4DA 1ASZA 1E24A 4QF4A 4YHHQ 1LTSD 1EY5A 3ONAB 3EA6A 2KBNA 1D1KA 1SE8A 3SVMA 1D5XC 2A74C 5J3BA 1B2TA 1GUSA 1X3FA 3DWPA 4NXMQ 2E2JH 1PRTD 1TWHB 2KA7A 4YY3Q 4C1NI 2NB0A 3EJIA 3F2CA 3CHBD 4ZUIA 3H09A 1WYDA 1RDPD 2HDLA 5KYLA 4BY7H 4HSPA 1X3EA 4A3JB 1R9TB 1Q3LA 4A76A 4IJLA 1HTPA 2EJMA 3IFDA 3M3YH 1EY7A 2R61A 1PMRA 3CCSA 3R2TA 3PO3G 1EWIA 1KLUD 4P72A 4L5QA 2D9UA 4OWWB 2KENA 3GTGB 3D6WA 4Y7NB 3VR3A 1KDCA 1ET6A 2I5LX 1SYDA 4WJ3M 1YHBA 1ILQA 2VZAA 3HKZB 2KHJA 2E2HB 4DK3C 1OO9B 1HZ9A 3A56A 4KY7A 3I56A 3PO2B 2PO4A 3S1NH 1Q46A 1O7IA 4JOIA 1PTOF 1N32L 1ENFA 1BQQT 1TR5A 5IYDG 2K5DA 2EY2A 1HHVA 1BUVT 5BN3A 2PZTA 4JI0L 5ELNA 2RVLA 1IYJB 1DJRD 1AN8A 3L3OC 1VQ4A 1SSOA 4JBMA 2PNHA 2V1CC 1CA5A 1H9RA 1N36Q 4A3FH 3AFQA 3AMUA 1SE2A 3O13A 4C2MH 3UDGA 4A3DB 4ILWA 2ZM6L 5CMDA 4JYAQ 4IUUA 3BU2A 1PZID 2JA8B 4UDUC 1EYAA 1H95A 1K83H 3NXWA 4M8AA 4DNRB 2SEBD 4K6LA 1S72A 3SK4A 2RF4A 3S9WA 2GVAA 2QA4A 3BDLA 5JVG3 3HOVB 2A1AA 5IODA 4U673 1Q86C 1XTDA 2JA6G 3K5OA 5D65A 3HKSA 1U4MA 2L15A 4UP7A 4XYOA 2BH2A 1UWVA 2KCTA 2RSOA 2NZHA 1A3TA 2LXJA 1YITA 3PV0A 2X6GA 1D8LA 3SDZA 5IYCG 1NMGA 1X9NA 1SJED 5HGTA 3RLNA 4BY1B 2A69D 4KV6A 2WB1E 3GO5A 4IUTA 3J81L 4PZ6A 2HUGA 4CKBA 2K32A 1E1OA 2HQLA 4ZRZA 3SEBA 4X62L 2A6HD 1E2VA 4EVOA 5IOCA 2E8GA 1MKHA 4JI6L 2NVQH 4FXDA 3RZDH 4AH6A 2R3ZA 1L0WA 5IIFA 1TS4A 2HD3A 3U58A 4A3MB 4BS9A 2B63B 3ZYYX 1MIUA 1O7YA 4G57A 1B70B 1STNA 3D31A 4X65L 3IFTA 2F3IA
chains in the Genus database with same CATH topology
2A5HA 1EZ6A 1J8IA 5DNFA 3F2UA 1ESFA 4IFDH 2IX0A 1ENCA 4ZQ3A 1B1ZA 2RKSA 2F03A 3DEPA 3BVGA 4DA2A 5D3DA 2E74C 4FF4A 3TDQA 2CHBD 1QCBD 4HSVA 3HG9A 3NP8A 1SBBB 1G291 3P1HA 3Q23A 1B44D 2ENBA 1C48A 1DM0B 2EYMA 1M8AA 1ZYRD 1NR2A 2BCOA 2KEDA 2PW7A 2IWHA 2VNUD 1NR4A 3C1FA 3RD4A 4B9XA 3I72A 4KKSA 3NK9A 2WAQB 5E1FA 3H94A 5I2YA 2QCPX 5M5YB 2KUMA 2AQ1B 2F0DA 5C44B 1EEID 1X3QA 1LT4D 3NE5B 4PNYA 1VMCA 3OMCA 3M7GA 4QUFA 2XNAC 5KNBA 2AQ2B 1E0BA 3K59A 1PTOD 3M4OB 5I9OA 4CJ0B 4BWGB 2PCFB 2M9VA 1PZJD 3CQZB 2EXZA 3NQTA 4WORA 1O7ZA 5E3FA 3R2IA 2QEJC 1IL8A 1A15A 1YNJC 3K57A 1CA6A 1HUNA 3K7AB 4OIKA 2NVYB 5I6WA 1O7LA 2JA7B 1DCZA 3RUZA 1CHQD 2L55A 4R8IA 2F0JA 1JR0D 4F87A 3PO3B 3EVQA 3MXGA 4RGNA 1HPCA 1STEA 4BA2I 4Q0FA 4F7XA 4C3IG 2F0TA 5C6AA 3M85A 5AFWA 3S14B 2J7ZA 5ELEA 4K5VA 2ID0A 4R8NA 4RA8A 2AUKA 1S5DD 1AZPA 2AWNA 2LMCB 2V4DA 5D3IB 5T1IA 3MVVA 3PUXA 3I8ZA 3MXUA 4HAEA 1EU3A 5A35A 2MPMA 1WD1A 3EROA 4IUVA 4G7HC 2EJFC 1LACA 4ZLTF 4CBVA 3SR1A 5C3WA 3WDNA 1V1OA 4RGOS 1OXXK 1I6VC 2JA6B 1OXUA 1ML0D 1AP0A 2NBFA 1K8OA 3K5NA 1I3QB 5K36H 4QCLA 2SOBA 1AFPA 4TRDA 1BCPB 2D62A 3R93A 3X3MA 3CKIB 2XSCA 4KJNA 5EKLA 1BCPC 3OIQA 2Q8TA 2EYPA 2HCIA 3VYUA 3C1EA 1BNZA 5NUCA 3OWEB 2XWJB 1J9OA 3FVQA 1SYBA 4KKTA 5KNDA 1LT3D 1D5ZC 1S5ED 4J6HA 4PMBA 1S5CD 3I70A 4WFN3 1IKMA 2F0MA 4K6DA 5C5MA 1E2WA 3SE0A 2L11A 4A3IB 1LTTD 5DM73 3J80E 2FJ2A 1PLFA 1PTOH 2R93B 3D4WA 2VUMB 3S1QB 1F2MA 5I2XA 1HUMA 2NN6I 4MN3A 3PIP3 2IX1A 3T16A 2JEAI 4KKUA 1H9MA 5M3MB 3CU7A 1AEXA 4MIUA 4KMUC 2EYLA 5CGKA 1YNNC 3E5SA 5ELCA 1KABA 1I4GA 1STGA 4DNTB 3H3VC 4KK7A 1BDOA 4X3UA 3HOUB 4UAIA 2DY7A 1IHZA 4X3KA 5G3LF 2NTTA 1LTRD 2L4NA 4CGYB 1SYEA 4OL7A 2R6GA 4NDXA 2K7VA 2JA5B 3OOCA 2LS01 2NVTB 1KDAA 4EQPA 1SNDA 3GTMB 4XQJA 2EJGC 3BVMA 3RLFA 2K01A 1TS5A 5I9PA 1XX8A 3DM1A 4B9WA 4ZYSA 5EJWA 1MD2D 1KLGD 1TU2B 3H0GB 1TKWB 4BBRB 5KGUA 2EYFA 4Z9CB 3I4LA 4FO2A 3NWSA 4IUNA 3KLRA 2WP8J 1R4QB 2N88A 1HRJA 3SK5A 4FF1A 3W2DA 1BR9A 2TMPA 2Z1CA 1T5XD 3MTSA 3W3AA 5LL6X 1IW7C 4RKBA 1TWFB 5I6YA 2FMMA 4FF2A 1QG7A 4C3IB 3VA5A 1V1PB 2OF1A 2BE5C 1A6XA 2WB1B 3T4AC 1HA6A 4NKLA 3MWYW 1STBA 3D3RA 4DGZA 1X3PA 2JE6I 5KEEA 5EBDA 5CYUA 3BZDB 1JWMD 2MUYA 1M4VA 3LX0A 5COYA 2XN9C 5IGEA 3QOLA 3GTJB 1L0XB 1W6KA 2PPBC 2RA4A 4NMZA 2I46A 4IZ8A 4B08A 4HMJA 1I4PA 3L7ZC 4G7ZC 1JORA 1TVXA 4ZAIA 1SE4A 1A2TA 2WIIB 1RTOA 4C3HG 4QB4A 4GZYC 2E2JB 2MGSA 1F9PA 2K6AA 2NN6G 1PFBA 1DYQA 2KOLA 1BBXC 5M9OA 4OIJA 1JWSD 1BOSA 2A73B 2SDFA 3TZUA 3RMHA 2PW5A 5G3LD 3R8BA 3KK7A 1JC7A 3FPUB 1SYCA 2F1MA 3NBHA 1AW7A 1JB3A 5CBAE 4ZKBB 4K8JA 5A2QE 1D2BA 1TY0A 5JEAJ 2FMCA 4RCNA 3J81E 2CQAA 4U68A 2DNEA 4LJZC 4HCSA 2L9HA 1H9SB 5JVH3 3AB9A 2F0QA 4KD3A 1YNJD 2DNCA 3V05A 1PXUA 4K5WA 5EKKA 2GA4B 1EFID 3NHHA 1ILPA 3N6RA 2EPBA 2KECA 4A93B 4F8MA 2B8FA 3E6ZX 4A3FB 2PNRC 4FXGC 1A3UA 4H44C 4NP5A 2F0HA 5A2QL 3M7NA 4QIWB 2A6ED 2JSOA 1DOKA 1FGBD 2EYHA 4K2LA 2B2UC 3FPPA 4CKCA 3S2HB 4MHEA 3T51B 5CV4A 4KY5A 5LHY1 3MEHA 5I4DA 5K36G 3IL8A 1GJXA 5JPMC 2A68C 3TMEA 3HS0C 1JWUD 2QILA 3A8KE 4RH6A 1Z6HA 2NVQB 4DXFA 1WTWA 3D6CA 1EEFD 1C8CA 3RZDB 2G9DA 1EU4A 1DOLA 1Y8PB 5FOBB 3DMUA 3I91A 1JCKB 2DN8A 3D4RA 3OWFA 2FHTA 3NTIA 4FYDA 4ID6A 4C3JG 2X6LA 2YYZA 1TIID 3SK6A 2KVMA 2Q8IB 1MSGA 1D1IA 4XYQA 1WTXA 1PRTB 1EY9A 3Q6SA 1TS2A 1EWCA 3GP7A 2JXMB 4XT1B 1G6ZA 1ZEQX 4CJ2C 4K5XA 2FINB 4BA1I 3KLSA 3SK8A 1Y69U 3S1MB 3U9SA 4DF7A 2F0SA 2QF7A 2RSNA 5HURA 5M5WB 3V2TA 3SHLA 5ELFA 4RGMA 1HFNA 2BA0A 1OXSC 2KCCA 4IUQA 2NN6H 4CHTB 1Q8IA 1SE3A 2E76C 5JEAH 3VYSA 1SDFA 2KQ3A 2PMZB 2L1BA 2J4XA 1S5FD 5DAUA 4YIJA 1G2SA 1WD0A 3KBXA 3WOFA 5T1GA 3T53B 4S3SA 5KIXA 3FDTA 3I90A 2KEEA 2NTSA 1VF5C 3C2PA 4C1NK 1I4QA 2B2WC 4TSSA 1ONLA 2KHSA 3ND9A 1B3AA 5KYIA 1I4RA 1OXTA 1U4LA 3KBGA 4DFAA 2OEOA 1Z47A 4H0LC 3BDCA 4FVMA 2ZT9C 1LT5D 2B8GA 1DZ1A 3PUWA 4H13C 2EYOA 1BF4A 3V96A 1HCZA 4F88A 5IGGA 4EQOA 1EZ8A 3OMGA 2XVSA 5IGFA 4A3EB 3S17B 3I4NB 2WKCA 2YU9B 2O5JC 4IUPA 1Y1WB 2PZUA 2EY5A 1PFMA 1VCIA 3FMCA 2K5QA 5FO7B 2JP1A 1QWYA 2H4OA 3MFGA 4RHSA 2WINB 4HN7A 4NW2A 4PQXA 1GOZA 3RZOB 2NVXB 2XRSD 4R9WA 2NYZD 3DUZA 2CW0C 1MGSA 4G7OC 4J8QA 1LV9A 1LTGD 4IURA 1EWHA 2B2YC 1O80A 2IPKD 1WTRA 2QKIC 2NWGA 4ME5A 3D8GA 1EIHA 2O5IC 4RWSC 1Q90A 2MJ8A 1ESRA 2F0PA 2G9HD 1GUOA 2R7ZB 1RF2D 4HTHA 1SNPA 3I3CA 1CK1A 3PMFA 2XRQD 5IGDA 2F0FA 1OXVA 3URYA 1II3A 1CT1D 3K5MA 2VXWA 1JE4A 1EIGA 3I73A 5C3EB 1LABA 1PTOB 5CBEE 1LTBD 1W6JA 5FLXE 4XIGS 1GUWA 2HCCA 1SEBD 3DEOA 5EKIA 5E4XA 1EY8A 1PYWD 1SJHD 4OO1H 3TSSA 3GD7A 1JOOA 3WOEA 5JOBA 1CHPD 2JEBI 4TKOB 1NAPA 1AZQA 2C5CA 1Q12A 4KN4C 3HOWB 3MAQA 2EE1A 4TQUS 1IKLA 1TQOA 2OXPA 3NPPA 2LFNA 1RCVD 1B9NA 2KJXA 1UAPA 1NSNS 4IN3A 5ELDA 1SMYC 5FO8B 1CZGA 4Q5VA 5FLXL 1EY0A 3NUCA 4KY6A 4X3SA 3HP3A 2EVBA 1FNVA 1LT6D 4K8IA 5M3FB 5CV5A 3GQBA 4RKLA 2VB3X 3OHXC 2WACA 3DWQA 3A8IE 1LLRD 2IL8A 4HCEA 4X3TA 3PUZA 1C4QA 2F0VA 2IW3A 3HEJA 1B50A 2F0KA 3FKIB 3HOXB 1FNUA 3MZ5A 1F2ZA 1B53A 1U4RA 1G2TA 2A68D 1HQRD 4DK0A 5C4XB 2FFKB 3TBIB 3A7LA 1RHPA 3U9OA 4KD4A 5ISRA 1GHKA 3GV3A 1LTAD 2OT2A 5JJZA 1QNUA 3KUPA 1B9MA 3QO2A 1UEAB 1RTNA 4OHJA 4RGTA 1T5EA 2H1EA 2DY8A 3P75A 4RHRA 5FK9C 1F9QA 4KHZA 2Z8LA 1LTID 4XT3B 4J1MA 3SXHA 1SFOB 2N55A 2IT1A 4XDXA 4HMIA 4DN4M 4DK1A 2B2WA 3VR4A 5C4HA 3DXJC 5C0XH 1UNSA 3AU7A 1F2LA 2E75C 4FF3A 3PUYA 1SYFA 1BCPF 1BXTA 2HQEA 3MXNA 5CV6A 1EQVA 3P7JA 1U4PA 1H9JA 1JICA 1A2UA 1XYIA 5JEAG 4BY7B 4OO1I 4L63B 3T13A 1SXTA 1GXDC 2Z4IA 3FEWX 1SNMA 2B2TC 4QMGA 3M3YB 2F0WA 1EY6A 4KHVA 5KNCA 2ZXRA 5IT9L 1MI2A 1VF7A 1Z7TA 2D5DA 3Q0AA 1HXYD 4BBSB 1GHJA 1IYUA 4PMCA 3PUVA 1Q1BA 3T56B 1CQFA 1F9SA 5EPKA 2WKDA 5EGTA 3S1NB 4FXKC 3NTHA 2BA1A 1KTKA 1RODA 4L8JA 3MXPA 3TZDA 1IYVA 2F3VA 1CFMA 2CVRA 2PYKA 1TWCB 2B2YA 3S16B 3MA2B 2MP1A 5E4WC 2EYJA 5J1ZA 1ICWA 1F9RA 3BVZA 1FD7D 3HRZC 2M00A 4C2MB 1PDQA 3MFYA 3GTLB 2RQXA 3GTOB 4HR7B 3NQIA 4ODGA 5CR3A 3IAYA 1K83B 1BO0A 1SNOA 5DM63 5CV8A 4DXGA 5LL6S 2B2VC 4V0BA 4XQNA 1ZXTA 3A55A 3X3NA 2O2LD 4O42A 1RD9D 3G6JB 3KLSX 1F2YA 1EOTA 4DU9A 1MSHA 1S5BD 3NWTA 4WRDA 5KRUA 2HDMA 1ENAA 4OGQC 1DOMA 4A3GB 3VYRA 1KAAA 5J39A 1WTPA 1Q1EA 1VDZA 1RJTA 1WTQA 4M1UB 3K5LA 1EY4A 1UUPA 4EGVA 3S1RB 2F0OA 2Z4HA 5BN5A 2K03A 2K04A 4N9PA 3HZXA 3Q22A 1MBYA 4KTAA 1O78A 2M2LA 2K1BA 3HOZB 3CRLC 3LWUA 3DWAA 1B4OA 2O4XA 3LWEA 2L5TA 3S15B 2F3WA 5C0XI 3C46A 3KF8A 5ELBA 2AWOA 5C4ZA 1WVLA 3QOJA 1BCPD 3VR6A 2CW0D 3BYTB 3HGBA 1I50B 4LAAA 1CI3M 1G8ZD 1GUNA 2NZ1D 5BN4A 1PZKD 2E2DC 5JAVA 1HA5A 2NUCA 3BYYB 5M5XB 5C4JB 4DAYA 5EBCA 1PRTC 2L0CA 3JAME 2EY6A 1ET9A 1GUTA 2RDHA 5FO9B 2BOSA 4DAVA 2F0EA 2EOTA 3S2DB 2C9OA 4OO1G 3VR2A 3NSWA 4N9TA 1U9RA 3G7LA 1WTVA 2XWBB 1CQVA 1S4ZA 2L12A 1QB5D 2EDGA 5TSSA 5EPLA 3FRPB 5IGBA 4RCOA 1Y1VB 3TN2A 1V1PA 1YNND 1XXGA 3QB3A 4ZUJA 3Q24A 4C3HB 3J7AF 4RAUC 3TP7A 3JAML 3R3OA 1WCMB 4L6TB 3DHQA 3L9AX 3EQLC 2IJ0A 3A8JE 3MC0B 4CJ1B 3HOYB 3BS1A 5F2DA 1FYCA 4PV1C 1STAA 1HFGA 3H6MA 4DAPA 5IGCA 3CRKC 2BDNA 1DXMA 4WJWA 2K5WA 3UI2A 3GTKB 1SMYD 1VMPA 1CM9A 1CZWA 5D14A 2EZVA 2SNSA 1TWAB 3M4YA 1JQYD 1Y8NB 2A6EC 2Y0SB 2A69C 3NTKA 4CKEA 5CORA 3ND8A 2PZWA 1DONA 1NUCA 1IW7D 1DD2A 2A6HC 2B2TA 4A3BB 2RDFA 4H7BA 4A3KB 1HQMC 3QG1A 2F0UA 1SYGA 4IFDI 3OSOA 4V190 2BE5D 1EYCA 4RFBA 4XXEA 2F0IA 1KNEA 3GTQB 3K6OA 3K58A 3E0JA 5C0XG 4IQZA 1H9SA 2JYOA 1KNAA 1LO5D 3A7AB 1X32A 5CC4A 2F4IA 2IX3A 4O1NA 2ICEC 3ERQA 3H91A 4ABNA 1V43A 5C0XJ 1ZYRC 1JOQA 1E2ZA 3BG3A 2B2VA 3EFXD 1I4HA 2B2UA 3TP5A 2B39A 3GV6A 1SAPA 5K5PA 2VB2X 3VR5A 4C3JB 2R92B 3N52A 5J22A 4HEDA 3ITPA 2LKVA 2I07B 2F0NA 1H9KA 4IALA 2K05A 1SNCA 1PTOC 4XTCS 5FKAC 1PRTF 1QOHA 5C3XA 1K8MA 1QNKA 2BDOA 1NCVA 2PQEA 3LNNA 1L0YB 3VYTA 4KN7C 1TT2A 2F0LA 3VA7A 2D2CC 4EQNA 5JPNC 3K0YA 3I4MB 4KI0A 4XQQA 1TY2A 4ULLA 3J80L 1SNQA 1EL0A 1G91A 2EY1A 1D6EC 2E2IB 3QJYA 1EYDA 3C3LA 3J7YW 1QE6A 1D5MC 3OPOA 4I7ZC 2F0GA 1PFNA 1GUGA 3NBIA 1EQTA 3BDOA 3OIPA 5CV9A 1JOKA 3TP6A 2X69A 2RBMA 3A54A 3P20A 5CV7A 2RDGA 4JBWA 1TWGB 1FNWA 1V8QA 2LY7A 2ICIA 3QIAA 1XTCD 2ZXOA 5DEHA 1STYA 1CTMA 2J0TD 2K33A 4K14A 4FP5D 2TSSA 2ZXPA 4LMQD 1HTLD 3GTPB 3IKJA 3J7AV 1QILA 4QUCA 3QWNA 4FNFA 3TP8A 4IFDG 5EQ0A 1F77A 4ZKCB 2QDBA 4G4KA 4I65A 1R4PB 4LK1C 3MHBA 1RKNA 1TS3A 1QJOA 2XIWA 4AYBB 2MHVA 1ZKOA 3OW7A 5EPJA 4PMWA 2AUJD 3PIO3 2K28A 4JK1C 4IFDJ 2AQ3B 2KCNA 1FR3A 4K2KA 1KDBA 1Y8OB 1A3VA 4KJOA 1WTOA 4E6IA 4ZK9B 4P2CB 1I4XA 1XWEA 5IT9E 1I6HB 5C5LA 4C56C 2SNMA 1STHA 2Q8RE 2WV6D 3D4DA 4QF4A 1LTSD 1EY5A 3ONAB 3EA6A 1D1KA 3SVMA 1D5XC 2A74C 1B2TA 1GUSA 3DWPA 1PRTD 1TWHB 2KA7A 4C1NI 2NB0A 3EJIA 3CHBD 4ZUIA 3H09A 1RDPD 2HDLA 5KYLA 4HSPA 4A3JB 1R9TB 1Q3LA 1HTPA 2EJMA 3IFDA 1EY7A 2R61A 1PMRA 3R2TA 1KLUD 2D9UA 3GTGB 3D6WA 4Y7NB 3VR3A 1KDCA 1ET6A 1SYDA 1ILQA 3HKZB 2E2HB 1OO9B 3A56A 4KY7A 3PO2B 2PO4A 1PTOF 1ENFA 1BQQT 1TR5A 2K5DA 2EY2A 1HHVA 1BUVT 5BN3A 2PZTA 2RVLA 1DJRD 1AN8A 3L3OC 1SSOA 1CA5A 1H9RA 3AMUA 1SE2A 3O13A 4A3DB 4ILWA 5CMDA 4IUUA 1PZID 2JA8B 4UDUC 1EYAA 3NXWA 4M8AA 4DNRB 2SEBD 4K6LA 3SK4A 3S9WA 5JVG3 3BDLA 3HOVB 5IODA 4U673 3K5OA 5D65A 1U4MA 4XYOA 2RSOA 1A3TA 3PV0A 2X6GA 3SDZA 1SJED 5HGTA 4BY1B 2A69D 4KV6A 3GO5A 4IUTA 3J81L 2HUGA 4CKBA 2K32A 4ZRZA 3SEBA 2A6HD 1E2VA 4EVOA 5IOCA 4FXDA 2R3ZA 5IIFA 1TS4A 4A3MB 4BS9A 2B63B 3ZYYX 1O7YA 4G57A 1STNA 3D31A 3IFTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EYP A;  5I9P A;  5JOB A;  4DF7 A;  1EZ6 A;  2NUC A;  2EYJ A;  2F0S A;  5J1Z A;  5J22 A;  5I6W A;  1KDC A;  2PZU A;  1SYD A;  3P75 A;  5CV4 A;  3ITP A;  5HUR A;  3C1E A;  4KY5 A;  3RUZ A;  3TP8 A;  3V2T A;  4B9W A;  1A2T A;  2EY5 A;  2LKV A;  1ENC A;  2F0N A;  4ZQ3 A;  3SHL A;  3MEH A;  2M00 A;  4IAL A;  2F0J A;  2RKS A;  1SNC A;  5KGU A;  2EYF A;  5NUC A;  2QDB A;  4I65 A;  4KY7 A;  1TQO A;  2OXP A;  1SYB A;  4IUN A;  4QB4 A;  2EY6 A;  4J1M A;  4J6H A;  3MHB A;  4ODG A;  3SXH A;  3EVQ A;  5CR3 A;  4PMB A;  1JOO A;  5C3X A;  1SNO A;  4HMI A;  2PZW A;  2F0E A;  5M9O A;  1RKN A;  2PQE A;  1NUC A;  1TR5 A;  2F0M A;  4K6D A;  5CV8 A;  5C5M A;  3SK5 A;  3TME A;  5C4H A;  3NP8 A;  2RDF A;  2EY2 A;  2PW5 A;  4H7B A;  4F7X A;  1TT2 A;  2PZT A;  2KQ3 A;  2F0L A;  1NSN S;  2F0T A;  1SYF A;  2F0U A;  5C6A A;  2SNS A;  4EQN A;  3D6C A;  3P1H A;  3D4W A;  5DAU A;  1SYG A;  2HQE A;  4N9T A;  4RKB A;  1SYC A;  1U9R A;  4YIJ A;  3OSO A;  2ENB A;  4K5V A;  4K2K A;  1EY0 A;  1KDB A;  3NUC A;  4KY6 A;  5CV6 A;  5I6Y A;  2EYM A;  1A3V A;  4KJO A;  1EQV A;  1F2M A;  4R8N A;  4E6I A;  1F2Y A;  4K8J A;  4DU9 A;  2PW7 A;  3DMU A;  4S3S A;  5KIX A;  4ME5 A;  1EYC A;  5C5L A;  2SNM A;  1EYA A;  3D8G A;  4K8I A;  3C1F A;  4WRD A;  5IGB A;  1A2U A;  5KRU A;  1ENA A;  3NXW A;  5CV5 A;  4B9X A;  3OWF A;  1STH A;  2F0I A;  3VA5 A;  3NK9 A;  1KAA A;  3SK4 A;  3S9W A;  3MVV A;  3T16 A;  5J39 A;  3BDL A;  5E1F A;  3D4D A;  1SNQ A;  3QB3 A;  2F0P A;  4QF4 A;  2OF1 A;  4RKL A;  3T13 A;  5IOD A;  1EY5 A;  1EY4 A;  2F0D A;  4HTH A;  4ID6 A;  1SNP A;  2EY1 A;  4ZUJ A;  2WAC A;  1AEX A;  1SNM A;  4MIU A;  2F0O A;  3TP7 A;  2F0Q A;  2KHS A;  2EYL A;  1EYD A;  4QMG A;  5KYI A;  3R3O A;  5CGK A;  2F0W A;  3PMF A;  4NKL A;  5CC4 A;  1EY6 A;  4KD3 A;  4N9P A;  3SK6 A;  4PNY A;  3E5S A;  2F0F A;  2F0G A;  5IGD A;  3ERO A;  3HZX A;  1II3 A;  4KHV A;  1STB A;  4DFA A;  3OMC A;  3DHQ A;  1A3T A;  1KAB A;  4K5W A;  4KTA A;  1STG A;  2F0V A;  2OEO A;  4DGZ A;  5EKK A;  3HEJ A;  5KEE A;  3BDC A;  5CV9 A;  1JOK A;  2F0K A;  1IHZ A;  3ERQ A;  3SR1 A;  3EJI A;  4PMC A;  3TP6 A;  1EY9 A;  3NHH A;  2RBM A;  5C3W A;  5HGT A;  4ZUI A;  2O4X A;  3MZ5 A;  4KV6 A;  1F2Z A;  1SYE A;  4OL7 A;  2EYO A;  5I9O A;  2F3W A;  5CV7 A;  5KYL A;  4F8M A;  5F2D A;  1JOQ A;  3LX0 A;  4NDX A;  5C4Z A;  1STA A;  4K5X A;  3QOJ A;  5IGG A;  3H6M A;  4EQO A;  1EZ8 A;  4EVO A;  2SOB A;  1A3U A;  5IGE A;  5IGC A;  5IOC A;  4TRD A;  3NQT A;  2EXZ A;  3OMG A;  3QOL A;  1KDA A;  2F0H A;  4NP5 A;  4WOR A;  4EQP A;  5EGT A;  3TP5 A;  5IGF A;  1EY7 A;  1SND A;  3U9O A;  4NMZ A;  4IZ8 A;  5E3F A;  4KD4 A;  5ISR A;  4HMJ A;  4LAA A;  5DEH A;  5IIF A;  3SK8 A;  1STY A;  4KJN A;  3MXP A;  5K5P A;  4K14 A;  5EKL A;  2F3V A;  1EY8 A;  2PYK A;  4G57 A;  1JOR A;  1STN A;  2EYH A;  4K2L A;  5JAV A; 
#chains in the Genus database with same CATH topology
 2A5H A;  1EZ6 A;  1J8I A;  1VS0 A;  3IRB A;  5DNF A;  1SMX A;  3S15 H;  3F2U A;  1ESF A;  4IFD H;  1XMQ Q;  2IX0 A;  1ENC A;  4ZQ3 A;  2N49 A;  3I55 A;  1B1Z A;  2RKS A;  2R7Z G;  2JJQ A;  2F03 A;  1SN8 A;  3DEP A;  3BVG A;  4DA2 A;  5D3D A;  2LSS A;  1KC8 C;  2N8N A;  1E22 A;  2E74 C;  3KF6 A;  4FF4 A;  4DKA C;  3TDQ A;  2CHB D;  1QCB D;  3ERS X;  4HSV A;  3HG9 A;  2UUC Q;  3CC2 A;  3NP8 A;  5FLM G;  4DV0 Q;  1SBB B;  5C3E G;  4AQY L;  1G29 1;  3UDF A;  5M5X H;  5C4J H;  3J80 c;  3P1H A;  3E9I A;  2UU9 L;  1J5E Q;  3Q23 A;  1B44 D;  1L1O C;  2JQO A;  1VQL A;  1WJJ A;  2ENB A;  1C48 A;  1DM0 B;  4JC0 A;  2EYM A;  1M8A A;  4CDC C;  1HNX Q;  1ZYR D;  1NR2 A;  2BCO A;  2KED A;  2PW7 A;  2IWH A;  1FL0 A;  4GOP C;  2VNU D;  4EQ5 A;  4DV3 L;  1NR4 A;  1QUQ B;  3C1F A;  3RD4 A;  4GLX A;  2OTJ A;  3U4V A;  4B9X A;  4HID A;  3I72 A;  3K8A A;  4KKS A;  3NK9 A;  2WAQ B;  3S2D H;  5E1F A;  3S1M H;  3H94 A;  5I2Y A;  2QCP X;  5M5Y B;  2KUM A;  3PIP A;  2AQ1 B;  2F0D A;  4ALP A;  5C44 B;  4B3S Q;  1EEI D;  1X3Q A;  4B3T L;  1LT4 D;  1K28 A;  2WFW A;  3NE5 B;  4PNY A;  1XMO L;  3HOW G;  2JA5 G;  1VMC A;  3OMC A;  3M7G A;  4QUF A;  2XNA C;  5KNB A;  1N36 L;  4P71 A;  2AQ2 B;  1E0B A;  3K59 A;  1E3P A;  1PTO D;  1GM5 A;  3M4O B;  3BZK A;  1FGU A;  5I9O A;  4CJ0 B;  1G6P A;  4JYA L;  4BWG B;  2PCF B;  1A63 A;  2M9V A;  1WTH A;  1PZJ D;  1U5K A;  3EIV A;  3CQZ B;  2EXZ A;  3NQT A;  4WOR A;  3KJO A;  1O7Z A;  1WCM H;  5E3F A;  3R2I A;  2AKW B;  2QEJ C;  4Y52 H;  4UY8 C;  5LMN Q;  1X55 A;  1KXL A;  1IL8 A;  1A15 A;  1YNJ C;  3K57 A;  1CA6 A;  1HUN A;  3K7A B;  4OIK A;  5M3F G;  2NVY B;  5I6W A;  1O7L A;  2JA7 B;  1DCZ A;  4N8F A;  4DUZ L;  3RUZ A;  3HOY H;  1CHQ D;  2L55 A;  4R8I A;  2F0J A;  1JR0 D;  4F87 A;  3PO3 B;  1X3G A;  1QZG A;  3EVQ A;  4LF9 L;  1K0S A;  3MXG A;  3GTK H;  4RGN A;  1HPC A;  1STE A;  5IYD H;  3RN2 A;  4BA2 I;  4Q0F A;  4LFA L;  4F7X A;  4C3I G;  3FKI G;  2F0T A;  2K14 A;  4DV1 L;  5C6A A;  1VQF A;  3M85 A;  2N3S A;  5AFW A;  3S14 B;  3WWV A;  1K3R A;  2J7Z A;  4O0A A;  1YJW A;  5ELE A;  3DLL A;  1YVC A;  4K5V A;  1FJG L;  2ID0 A;  4R8N A;  5C4X G;  4POF A;  1KRT A;  4RA8 A;  2AUK A;  2UUB Q;  1S5D D;  1AZP A;  5JJK A;  4A3E H;  1IL2 A;  2K75 A;  4CDF C;  1YIJ A;  2AWN A;  2LMC B;  2V4D A;  3S17 H;  1E7Z A;  3I4N H;  5D3I B;  3KOJ A;  4ZCK A;  5LMU L;  2OCE A;  5T1I A;  3MVV A;  4LF8 Q;  3PGZ A;  4A3B H;  1HNZ Q;  3PUX A;  2YU9 H;  3I8Z A;  3MXU A;  4HAE A;  1Y1W H;  1EU3 A;  5A35 A;  4HIM A;  2MPM A;  1WD1 A;  1GKH A;  2UUC L;  2CFM A;  4DV0 L;  3ERO A;  4GS3 A;  4DR6 Q;  4IUV A;  4G7H C;  3PIO A;  2EJF C;  1LAC A;  4LF4 L;  4P74 A;  4ZLT F;  4POG A;  4CBV A;  3SR1 A;  5C3W A;  4HJ8 A;  1EYG A;  3WDN A;  1V1O A;  4RGO S;  1OXX K;  1I6V C;  2JA6 B;  4GKK Q;  3ZJY C;  1OXU A;  1ML0 D;  1HR0 Q;  1AP0 A;  2NBF A;  3PCO B;  1K8O A;  3PF4 A;  3K5N A;  1I3Q B;  3FHW A;  5K36 H;  4QCL A;  2DJF C;  2SOB A;  5E7N A;  1AFP A;  4TRD A;  1BCP B;  2D62 A;  3R93 A;  3X3M A;  4LFB Q;  3CKI B;  3CCE A;  4DV6 L;  4J15 A;  3G6E A;  5IY0 A;  1KD1 C;  2XSC A;  4JV5 L;  4KJN A;  1XNQ Q;  1IBL L;  4GKJ Q;  5EKL A;  1BCP C;  3OIQ A;  4DV5 Q;  2Q8T A;  2EYP A;  2HCI A;  3VYU A;  3B6Y A;  2QGQ A;  2OQ0 A;  3C1E A;  1BNZ A;  4BY7 G;  4OX9 Q;  4IPC A;  2VW9 A;  5IWA Q;  2OTL A;  5NUC A;  3OWE B;  3FVQ A;  1J9O A;  2XWJ B;  1SYB A;  2GN5 A;  4KKT A;  5KND A;  1LT3 D;  1IZ6 A;  1D5Z C;  1S5E D;  4J6H A;  3J80 i;  4PMB A;  1S5C D;  4HIO A;  3I70 A;  4WFN 3;  1IKM A;  2F0M A;  4K6D A;  5C5M A;  1E2W A;  3E3X A;  3SE0 A;  3RR5 A;  4BBS G;  2L11 A;  4A3I B;  1LTT D;  5DM7 3;  3J80 E;  2FJ2 A;  2R92 H;  1PLF A;  1PTO H;  2R93 B;  3D4W A;  2VUM B;  3AFP A;  1CKM A;  1IBK L;  3S1Q B;  1F2M A;  1K0R A;  4GLA C;  1IBM L;  5I2X A;  1HUM A;  2NN6 I;  2VL6 A;  4MN3 A;  4OWX B;  3PIP 3;  2IX1 A;  2PMZ E;  3T16 A;  2JEA I;  3LGJ A;  4KKU A;  4IO9 A;  1H9M A;  4X64 Q;  5M3M B;  3CU7 A;  1VQ6 A;  4B3R Q;  3J81 c;  1VQK A;  1AEX A;  4MIU A;  1QVF A;  4KMU C;  2EYL A;  5CGK A;  4A3F G;  3S24 A;  1YNN C;  3E5S A;  3HOW H;  5IYB G;  3NEL A;  5ELC A;  1HJP A;  2F4V L;  1KAB A;  3I4M H;  1I4G A;  1STG A;  4DNT B;  3PF5 A;  3H3V C;  4KK7 A;  3NEN A;  1BDO A;  4X3U A;  3HOU B;  4UAI A;  2DY7 A;  1IHZ A;  4X3K A;  5G3L F;  2NTT A;  3CME A;  4JI4 L;  1LTR D;  2L4N A;  4MZ9 A;  4CGY B;  2K50 A;  2E5L L;  1SYE A;  4OL7 A;  2ZJQ A;  2R6G A;  3KF8 B;  4NDX A;  1X54 A;  2K7V A;  1VQ9 A;  2JA5 B;  3OOC A;  3UE0 A;  4LF5 L;  2LS0 1;  2NVT B;  1KDA A;  4EQP A;  1SND A;  2P5Z X;  3GTM B;  4XQJ A;  2EJG C;  3BVM A;  3RLF A;  2K01 A;  1TS5 A;  4A75 A;  5I9P A;  5M3F H;  4A3G G;  1XX8 A;  3DM1 A;  1YI2 A;  4B9W A;  5GQO A;  4ZYS A;  4DAY B;  1VQJ A;  1MD2 D;  5EJW A;  1KLG D;  1N32 Q;  1TU2 B;  3H0G B;  1TKW B;  4BBR B;  1VQC A;  5KGU A;  2EYF A;  2YTX A;  3I4L A;  4Z9C B;  4FO2 A;  3NWS A;  4IUN A;  1PHJ A;  4GLV B;  4CDD C;  3KLR A;  4JI0 Q;  2WP8 J;  1R4Q B;  1OTC A;  2N88 A;  1HRJ A;  1Y14 B;  3SK5 A;  4FF1 A;  2C35 B;  3W2D A;  5GAH C;  3HOX H;  1BR9 A;  3E0E A;  3GTP H;  2TMP A;  2ZM6 Q;  3K80 C;  2Z1C A;  1T5X D;  3MTS A;  3W3A A;  5LL6 X;  1IW7 C;  4RKB A;  4QL5 A;  1PH1 A;  1TWF B;  3F1Z A;  5I6Y A;  2FMM A;  4FF2 A;  5C4X H;  1QG7 A;  3CCQ A;  1DGS A;  3ULP A;  3T1H Q;  2RHS B;  4JPB W;  4C3I B;  4UPA A;  3VA5 A;  1GO3 E;  3A5Z B;  2RHQ B;  1V1P B;  2OF1 A;  2BE5 C;  1A6X A;  2WB1 B;  3T4A C;  4RMF A;  4GNX C;  4UP8 A;  1HA6 A;  4NKL A;  3MWY W;  3EBE A;  1STB A;  3D3R A;  1SLJ A;  1IXR A;  4LUZ A;  1X3P A;  4DGZ A;  2H5X A;  2JE6 I;  5KEE A;  5EBD A;  5CYU A;  3BZD B;  1SFO H;  4X62 Q;  1JWM D;  2MUY A;  4JI6 Q;  1M4V A;  2B3G A;  1LTL A;  4HJ7 A;  3LX0 A;  3STB C;  1I94 L;  5COY A;  2XN9 C;  1A0I A;  5IGE A;  3QOL A;  3GTJ B;  1L0X B;  4X65 Q;  4DV4 L;  1W6K A;  2PPB C;  4DR2 L;  2RA4 A;  4NMZ A;  2I46 A;  4IZ8 A;  4B08 A;  4X64 L;  4HMJ A;  1I4P A;  4B3R L;  3L7Z C;  4G7Z C;  1K3B C;  2FXQ A;  1K73 C;  2QDL A;  1JOR A;  1TVX A;  4ZAI A;  1SE4 A;  1GVP A;  4LF6 L;  1YNX A;  4JI3 L;  1A2T A;  1PV4 A;  2MO1 A;  4YCU A;  2WII B;  4A3J H;  5AJ3 L;  1R9T H;  1RTO A;  4C3H G;  4QB4 A;  4GZY C;  2E2J B;  3RN5 A;  2MGS A;  4YWK A;  1F9P A;  2K6A A;  2CH4 A;  2NN6 G;  1BBU A;  4AQY Q;  3J7A 5;  1WCM G;  1PFB A;  5JJL A;  1DYQ A;  2KOL A;  1BBX C;  5M9O A;  4OIJ A;  4R4I A;  2MFI A;  2UU9 Q;  1JWS D;  1BOS A;  2A73 B;  2SDF A;  3TZU A;  4BBS H;  4A3C G;  3RMH A;  2PW5 A;  2QEX A;  3A74 A;  5G3L D;  3R8B A;  4Y7N H;  1EIF A;  3JC6 6;  3KK7 A;  1JC7 A;  4BXX H;  3FPU B;  1SYC A;  3HOY G;  4DV3 Q;  2F1M A;  3NBH A;  1AW7 A;  4DR1 L;  1JB3 A;  5CBA E;  4ZKB B;  3J81 i;  4K8J A;  5A2Q E;  1D2B A;  1TY0 A;  2Z0S A;  5JEA J;  4B3T Q;  1SRU A;  4MTK A;  2FMC A;  4RCN A;  1EFW A;  2RCF A;  5FJ8 H;  4APV A;  3J81 E;  1TWC H;  2CQA A;  4U68 A;  1XMO Q;  2DNE A;  2CCZ A;  3S16 H;  4LJZ C;  4HCS A;  2L9H A;  1H9S B;  5JVH 3;  3AYH B;  3AB9 A;  1XPU A;  2F0Q A;  2IHE A;  1JJC B;  4KD3 A;  1YNJ D;  5IYB H;  2DNC A;  3V05 A;  3GTL H;  1PXU A;  3TQY A;  3GTO H;  3W1G A;  4JVZ A;  4A3D H;  4K5W A;  4DPG A;  5EKK A;  2GA4 B;  1EFI D;  4A3E G;  4JW0 A;  2JA8 H;  3NHH A;  1ILP A;  3I4N G;  4YCW A;  1V9P A;  3K81 C;  3N6R A;  3T1H L;  2EPB A;  2KEC A;  4A93 B;  4F8M A;  2B8F A;  3E6Z X;  4OEL B;  4A3F B;  4A3B G;  2Z9H A;  2PNR C;  1X6O A;  2VQE Q;  4A3K G;  4FXG C;  2HIX A;  1A3U A;  4H44 C;  4LFC L;  1Y1W G;  4NP5 A;  2F0H A;  4GN3 B;  1VQA A;  5A2Q L;  3M7N A;  4QIW B;  2A6E D;  4DUZ Q;  1LYL A;  2JSO A;  1DOK A;  1FGB D;  2EYH A;  2R7F A;  4K2L A;  2B2U C;  3FPP A;  4CKC A;  3S2H B;  4A3G H;  4MHE A;  3T51 B;  5CV4 A;  4LF9 Q;  4KY5 A;  5LHY 1;  4IOC A;  3OTO L;  3MEH A;  5I4D A;  2EQS A;  5K36 G;  3IL8 A;  2HIV A;  3S1R H;  4LFA Q;  1CSP A;  1GJX A;  4AYB E;  4DV1 Q;  5JPM C;  2A68 C;  3TME A;  3HS0 C;  1JWU D;  4A3M H;  2B63 H;  5BR8 L;  3TS0 A;  3HOZ H;  2QIL A;  1HZC A;  3A8K E;  4RH6 A;  1FJG Q;  1Z6H A;  2NVQ B;  4DXF A;  1WTW A;  3CCJ A;  3D6C A;  1EEF D;  4JI1 Q;  1C8C A;  3RZD B;  2G9D A;  1EU4 A;  1DOL A;  5LMU Q;  1Y8P B;  5FOB B;  3DMU A;  3I91 A;  1JCK B;  3A0J A;  3RLO A;  1I50 H;  1VQO A;  2DN8 A;  5GAE C;  1NE3 A;  3D4R A;  3OWF A;  4A3L G;  2FHT A;  4DR3 L;  2UXB L;  3NTI A;  4FYD A;  1EOV A;  1NMF A;  4ID6 A;  4C3J G;  2X6L A;  2YYZ A;  3KDF B;  2R92 G;  4O2D A;  4LF4 Q;  1TII D;  1J6Q A;  1YJN A;  3SK6 A;  2KVM A;  2Q8I B;  1KRS A;  4X66 L;  1MSG A;  1D1I A;  4XYQ A;  4OEM B;  1WTX A;  1PRT B;  1EY9 A;  3Q6S A;  4DAM A;  1TS2 A;  1EWC A;  4OWT B;  3GP7 A;  2JXM B;  2R7D A;  4DV6 Q;  4XT1 B;  3VDY A;  1ZEQ X;  2ALY B;  4CJ2 C;  1G6Z A;  4K5X A;  3CCU A;  4JV5 Q;  2FIN B;  1IBL Q;  4BA1 I;  3M4Q A;  5C44 H;  1K9M C;  2PQA A;  3KLS A;  2BH8 A;  3SGI A;  3MEF A;  3SK8 A;  1Y69 U;  1YZ6 A;  3I4M G;  4GN4 B;  3S1M B;  3U9S A;  4DF7 A;  3HKZ E;  3CCM A;  2F0S A;  4N8X 1;  2QF7 A;  3M4O H;  1Q81 C;  1Y1V H;  2RSN A;  5HUR A;  5M5W B;  3V2T A;  3SHL A;  5ELF A;  4X6A H;  3CC4 A;  4RGM A;  4C3H H;  1HFN A;  2CWA A;  1P16 A;  2BA0 A;  1OXS C;  2KCC A;  4IUQ A;  2YV5 A;  2NN6 H;  2JA9 A;  1G51 A;  4HJ9 A;  4CHT B;  1Q8I A;  2VQE L;  1SE3 A;  2E76 C;  5JEA H;  3VYS A;  4A3C H;  1UE6 A;  1SDF A;  1IBK Q;  2KQ3 A;  2PMZ B;  1YHQ A;  2L1B A;  2J4X A;  1PH7 A;  1S5F D;  2NVY H;  1IBM Q;  5DAU A;  3U50 C;  4YIJ A;  1G2S A;  1WD0 A;  1EUJ A;  3KBX A;  3WOF A;  5T1G A;  3T53 B;  4JI8 L;  4S3S A;  5KIX A;  3FDT A;  4LF7 L;  3KFU A;  3I90 A;  2KEE A;  2NTS A;  5DLQ E;  3F2B A;  1VF5 C;  3C2P A;  4C1N K;  4PZ8 A;  2Z6B A;  3HOX G;  2F4V Q;  1TWA H;  3I2Z A;  1I4Q A;  2F52 A;  2B2W C;  4TSS A;  1ONL A;  2KHS A;  3ND9 A;  1B3A A;  5KYI A;  3S14 H;  1I4R A;  1OXT A;  1U4L A;  4JI4 Q;  4A4I A;  4NB3 A;  4UHV A;  2E5L Q;  3KBG A;  4DFA A;  1PH8 A;  2OEO A;  1Z47 A;  1CSQ A;  4H0L C;  3BDC A;  4JI1 L;  4FVM A;  1VQ7 A;  2ZT9 C;  1PH5 A;  3RNU A;  1LT5 D;  3KLW A;  2B8G A;  3CXC A;  4LF5 Q;  1DZ1 A;  3PUW A;  4R4Q A;  4H13 C;  2EYO A;  4AYB G;  1V1Q A;  4ME3 A;  1XJV A;  1BF4 A;  3V96 A;  4A3K H;  1HCZ A;  4F88 A;  5IGG A;  2DGY A;  4EQO A;  1EZ8 A;  2MQH A;  3OMG A;  2XVS A;  5IGF A;  2AHO B;  4A3E B;  1KL9 A;  2K52 A;  3S17 B;  3I7F A;  1N34 L;  3I4N B;  4OXP A;  3F8T A;  4QJF A;  2WKC A;  1U0L A;  5H1S E;  2YU9 B;  2O5J C;  4IUP A;  1Y1W B;  2PZU A;  3GTQ H;  1PH6 A;  2EY5 A;  1PFM A;  1VCI A;  3FMC A;  1YHA A;  3J81 j;  1I3Q H;  4DR4 L;  2K5Q A;  2JP1 A;  1QWY A;  2H4O A;  3MFG A;  5FO7 B;  1AE3 A;  4RHS A;  1JJG A;  2WIN B;  4HN7 A;  3CCV A;  4NW2 A;  5JJI A;  4PQX A;  1GOZ A;  3RZO B;  2NVX B;  1AH9 A;  2XRS D;  4R9W A;  2NYZ D;  4IJH A;  3DUZ A;  2CW0 C;  3G48 A;  1T9H A;  2KCM A;  3G4S A;  4JOI C;  1MGS A;  4G7O C;  1AE2 A;  2UXD L;  4DUY L;  4J8Q A;  1LV9 A;  1LTG D;  4IUR A;  1JMC A;  1EWH A;  2B2Y C;  3CPF A;  1O80 A;  4A3J G;  2IPK D;  1WTR A;  2A8V A;  3STB D;  2QKI C;  2NWG A;  4ME5 A;  4GN5 A;  1N33 L;  3D8G A;  2WAQ E;  4A3L H;  1EIH A;  2O5I C;  4PZ7 A;  1BBW A;  4RWS C;  1Q90 A;  2MJ8 A;  1ESR A;  2F0P A;  2G9H D;  1GUO A;  4C3J H;  4A3I H;  2R7Z B;  1RF2 D;  4HTH A;  1SNP A;  3TS2 A;  3I3C A;  4BXX G;  1CK1 A;  3PMF A;  4LWC A;  2XRQ D;  3HKZ G;  5IGD A;  2F0F A;  1OXV A;  3URY A;  1II3 A;  4EX5 A;  1CT1 D;  3K5M A;  2VXW A;  1JE4 A;  1EIG A;  5IP9 G;  3I73 A;  5C3E B;  3PO2 G;  1I94 Q;  1LAB A;  1FVI A;  4OON A;  1PTO B;  5CBE E;  1UE7 A;  4DV4 Q;  2LXK A;  4DR2 Q;  1HNW L;  5FJ8 G;  4L5S A;  1W2B A;  5M3M H;  1LTB D;  3UDI A;  1W6J A;  5FLX E;  4XIG S;  1GUW A;  3H3V H;  1GD7 A;  4DR7 L;  2HCC A;  1RIP A;  1SEB D;  3DEO A;  5LMN W;  4R4O A;  5EKI A;  4LF6 Q;  5E4X A;  1XPO A;  4JI3 Q;  4A3D G;  1EY8 A;  1PYW D;  1SJH D;  3ULJ A;  4OO1 H;  3GD7 A;  1JOO A;  3TSS A;  3WOE A;  3HOU H;  5JOB A;  5AJ3 Q;  2VY3 A;  2JA8 G;  4TVA B;  2HHH L;  1CHP D;  2NZO A;  1PH3 A;  2JEB I;  4TKO B;  1NAP A;  1AZQ A;  2C5C A;  3HOV G;  1Q12 A;  4KN4 C;  3TEH B;  1K8G A;  3HOW B;  3MAQ A;  2Q2U A;  2EE1 A;  4TQU S;  1VQE A;  2E2I H;  1IKL A;  2UXC L;  1TQO A;  2OXP A;  3NPP A;  1A62 A;  1QVG A;  4YCV A;  2LFN A;  1RCV D;  1JE5 A;  1B9N A;  3KF6 B;  2KJX A;  1L1O A;  4I7A A;  1MJE A;  1UAP A;  4DR1 Q;  1NSN S;  1W3S A;  2Y0S E;  4IN3 A;  5ELD A;  4BY1 G;  1SMY C;  4GOP A;  5FO8 B;  3T1Y L;  1CZG A;  4Q5V A;  5FLX L;  1TWG H;  1EY0 A;  3NUC A;  4KY6 A;  4X3S A;  3HP3 A;  2UUA L;  2Z6K C;  2EVB A;  1FNV A;  1QUQ A;  1LT6 D;  4K8I A;  5M3F B;  2AMC B;  2A19 A;  5CV5 A;  3CAM A;  3GQB A;  1SRO A;  4A3M G;  3A5U A;  2B63 G;  4RKL A;  3HOZ G;  2VB3 X;  1ICF B;  3FP9 A;  3OHX C;  1Q82 C;  2WAC A;  3DWQ A;  3A8I E;  1A8V A;  3AQQ A;  3CCR A;  2MO0 A;  1LLR D;  1C0A A;  2IL8 A;  2PQA B;  1TWF H;  4HCE A;  4X3T A;  1XNR L;  3PUZ A;  1C4Q A;  2F0V A;  2IW3 A;  3HEJ A;  1B50 A;  1HR0 W;  2F0K A;  3FKI B;  3HOX B;  1FNU A;  4LFC Q;  3MZ5 A;  1F2Z A;  4NXN L;  1B53 A;  5IP7 H;  1U4R A;  2D0P A;  4JI7 Q;  1G2T A;  1LUZ A;  2A68 D;  1E1T A;  1HQR D;  4DK0 A;  5C4X B;  4LNQ A;  2FFK B;  3TBI B;  3A7L A;  1RHP A;  3U9O A;  4LUV A;  4KD4 A;  5ISR A;  1GHK A;  3GV3 A;  1LTA D;  2OT2 A;  1PYS B;  5JJZ A;  4AIM A;  3OTO Q;  4L5R C;  1B3Q A;  1QNU A;  3KUP A;  1I6H H;  1B9M A;  3QO2 A;  1UEA B;  1X56 A;  1RTN A;  4OHJ A;  4RGT A;  1T5E A;  2H1E A;  2DY8 A;  3P75 A;  4RHR A;  2WAQ G;  4LW1 A;  5FK9 C;  1LM0 A;  1S3O A;  1F9Q A;  4KHZ A;  2Z8L A;  1LTI D;  4XT3 B;  5BR8 Q;  5C44 G;  4JI2 L;  4J1M A;  3JAM c;  3SXH A;  2JK8 A;  1SFO B;  3PQI A;  2N55 A;  2IT1 A;  4XDX A;  4HMI A;  4DN4 M;  4DK1 A;  5IE8 A;  2Q2H A;  2B2W A;  3VR4 A;  1PYB A;  5C4H A;  4DV2 L;  2HT1 A;  3M4P A;  2VQF L;  3DXJ C;  1TWH H;  5C0X H;  1UNS A;  3AU7 A;  1F2L A;  2E75 C;  4FF3 A;  4HIK A;  3PUY A;  1SYF A;  1BCP F;  4NPS A;  1BXT A;  1Y1V G;  2RCN A;  2HQE A;  3MXN A;  4QY7 A;  5CV6 A;  5GAG C;  4DR3 Q;  2UXB Q;  1EQV A;  1S40 A;  3P7J A;  3H3V I;  1U4P A;  1H9J A;  3OYY A;  1JIC A;  1MJC A;  1A2U A;  1XYI A;  5JEA G;  4BY7 B;  4OO1 I;  4L63 B;  3PSI A;  3T13 A;  3GTG H;  1SXT A;  4X66 Q;  4P73 A;  4JBJ A;  1GXD C;  2Z4I A;  3FEW X;  2VS1 A;  1SNM A;  2JA7 G;  2B2T C;  4QMG A;  2E2H H;  3M3Y B;  2F0W A;  1EY6 A;  1VQN A;  4QQB X;  4KHV A;  5KNC A;  2ZXR A;  5IT9 L;  1MI2 A;  1VF7 A;  1Z7T A;  2D5D A;  5IP9 H;  3Q0A A;  1HXY D;  3PO2 H;  4BBS B;  1UE5 A;  1GHJ A;  1IYU A;  4PMC A;  1JT8 A;  1CKN A;  3PUV A;  1Q1B A;  3T56 B;  1KAW A;  2YTV A;  1CQF A;  4K0K L;  1F9S A;  5EPK A;  3DM3 A;  2WKD A;  5EGT A;  3S1N B;  4FXK C;  4JI5 L;  2Y0S G;  2ZJR A;  3NTH A;  2BA1 A;  1KTK A;  1ROD A;  4L8J A;  3MXP A;  5EAY A;  3TZD A;  1IYV A;  2F3V A;  1CFM A;  2CVR A;  2PYK A;  4HJA A;  1TWC B;  2B2Y A;  2GVB A;  3S16 B;  3MA2 B;  3KJP A;  2MP1 A;  5E4W C;  2EYJ A;  5J1Z A;  1YJ9 A;  1ICW A;  3HOV H;  4A93 H;  1F9R A;  3BVZ A;  1FD7 D;  4KLK A;  3HRZ C;  2M00 A;  4DV7 L;  4C2M B;  3CCL A;  1PDQ A;  3MFY A;  3GTL B;  2RQX A;  3GTO B;  1M1K C;  4HR7 B;  1L2F A;  3NQI A;  4ODG A;  5CR3 A;  1CKO A;  3IAY A;  4JI7 L;  1K83 B;  1BO0 A;  2K5V A;  1SNO A;  1I5F A;  5L37 A;  5DM6 3;  5CV8 A;  4DXG A;  5LL6 S;  2B2V C;  4BY1 H;  3S2H H;  4V0B A;  3HFZ B;  4XQN A;  2I5H A;  4JI8 Q;  1ZXT A;  3A55 A;  3X3N A;  4LF7 Q;  2O2L D;  4O42 A;  1RD9 D;  3G6J B;  4UP9 A;  3I4O A;  3KLS X;  1F2Y A;  1YBY A;  1P8L A;  1EOT A;  4DU9 A;  1MSH A;  3CD6 A;  1S5B D;  3NWT A;  4WRD A;  4YWM A;  5KRU A;  2HDM A;  1ENA A;  4OGQ C;  1DOM A;  4A3G B;  1X65 A;  3VYR A;  3CPW A;  1KAA A;  5J39 A;  3E9H A;  1WTP A;  1Q1E A;  3GDE A;  1VDZ A;  1RJT A;  1WTQ A;  3BZC A;  4M1U B;  3K5L A;  1EY4 A;  1UUP A;  4EGV A;  4IOA A;  3S1R B;  2F0O A;  2Z4H A;  5BN5 A;  2K03 A;  2K04 A;  4N9P A;  2XTI A;  4JG2 A;  4YHH L;  3HZX A;  3Q22 A;  1MBY A;  4KTA A;  1O78 A;  2M2L A;  3OW2 A;  1RL2 A;  2K1B A;  3HOZ B;  3CRL C;  3LWU A;  3DWA A;  1VQP A;  2B29 A;  1B4O A;  1VQI A;  4L5T A;  2O4X A;  1NBW A;  2L5T A;  3LWE A;  3S15 B;  1Q8K A;  2F3W A;  5C0X I;  3C46 A;  3KF8 A;  4NXM L;  5ELB A;  2AWO A;  5C4Z A;  1N34 Q;  4YY3 L;  1WVL A;  3QOJ A;  4A3I G;  1BCP D;  3VR6 A;  2CW0 D;  1KHI A;  3BYT B;  2R93 G;  3HGB A;  2VUM G;  1I50 B;  4LAA A;  3M9B A;  1CI3 M;  1G8Z D;  1GUN A;  2NZ1 D;  5BN4 A;  1PZK D;  2E2D C;  2D0O A;  2ZJP A;  3JAM i;  5JAV A;  1L1O B;  2EXD A;  1HA5 A;  4DR4 Q;  2NUC A;  1B7Y B;  3BYY B;  5M5X B;  2Z6K A;  5C4J B;  4DAY A;  5EBC A;  3F2D A;  4B3M Q;  1PRT C;  2L0C A;  4GOP B;  4DK6 C;  5M5Y H;  5M3M G;  3JAM E;  3TRE A;  1BKB A;  2EY6 A;  2IY5 B;  4WJ4 A;  5FLX c;  1ET9 A;  1GUT A;  2XGT A;  2RDH A;  5FO9 B;  2BOS A;  4DAV A;  2UXD Q;  2F0E A;  4PG3 A;  2EOT A;  5HGQ A;  1B8A A;  4DUY Q;  3S2D B;  2C9O A;  4MNO A;  1SR3 A;  4OO1 G;  3HOU G;  1NY4 A;  3VR2 A;  3NSW A;  1PA6 A;  4N9T A;  5M5W H;  1N33 Q;  1U9R A;  2CKZ B;  3G7L A;  1WTV A;  2KHI A;  1PFS A;  2Q2T A;  2XWB B;  1CQV A;  1S4Z A;  2L12 A;  3CQZ H;  1QB5 D;  4KHP Q;  2EDG A;  5TSS A;  5EPL A;  1TXY A;  3FRP B;  5IGB A;  4GNX A;  4RCO A;  4DR5 Q;  1Y1V B;  3TN2 A;  1CUK A;  1V1P A;  1YNN D;  1XXG A;  3QB3 A;  3W1B A;  3UDX A;  4ZUJ A;  3K7A H;  3Q24 A;  4C3H B;  3J7A F;  4RAU C;  1K8A C;  2JA7 H;  3TP7 A;  3JAM L;  1ASY A;  3R3O A;  1WCM B;  3CW2 C;  4L6T B;  3H0G G;  4BBR G;  3DHQ A;  3PO3 H;  1HNW Q;  1HZA A;  3L9A X;  3EQL C;  2IJ0 A;  2G5D A;  3A8J E;  3UE1 A;  3ICE A;  3MC0 B;  1KQS A;  4DR7 Q;  4CJ1 B;  3HOY B;  3BS1 A;  5F2D A;  1FYC A;  4PV1 C;  1STA A;  4H02 A;  1EQQ A;  1HFG A;  3H6M A;  3W5O A;  4DAP A;  3G71 A;  5IGC A;  3CF5 A;  3CRK C;  2BDN A;  1DXM A;  4WJW A;  2K5W A;  4QIW E;  3UI2 A;  4HJ5 A;  3GTK B;  1SMY D;  2HHH Q;  1VMP A;  1CM9 A;  1CZW A;  5D14 A;  2EZV A;  2SNS A;  3BJU A;  1EQR A;  1TWA B;  2UXC Q;  2QW7 A;  3M4Y A;  1JQY D;  1Y8N B;  2A6E C;  5IP7 G;  2Y0S B;  2ASB A;  1C9O A;  3MXN B;  2WB1 G;  2A69 C;  1WI5 A;  3NTK A;  4CKE A;  1XMQ L;  4FDB A;  3ND8 A;  5COR A;  2PZW A;  1VQH A;  1UEB A;  2EIF A;  1DON A;  1NUC A;  1IW7 D;  3T1Y Q;  1DD2 A;  2A6H C;  2B2T A;  1UE1 A;  4A3B B;  4JCV E;  2RDF A;  4H7B A;  4A3K B;  1HQM C;  2UUA Q;  3QG1 A;  2F0U A;  1Q7Y C;  1HZB A;  2JA6 H;  3CP0 A;  1SYG A;  4R4C A;  4IFD I;  1JB7 A;  3OSO A;  3TRZ A;  3NBH B;  4V19 0;  3D0F A;  2BE5 D;  5IYC H;  4B3M L;  1J5E L;  1EYC A;  4RFB A;  4XXE A;  5IT9 c;  3RZO H;  2NVX H;  2F0I A;  1KNE A;  3GTQ B;  3K6O A;  1HNX L;  1CKN B;  3K58 A;  3E0J A;  5C0X G;  2ZTC A;  4IQZ A;  1H9S A;  2JYO A;  4LUO A;  1KNA A;  1XNR Q;  1LO5 D;  3A7A B;  3NEM A;  1X32 A;  5CC4 A;  5GRO A;  4NXN Q;  2F4I A;  2IX3 A;  4O1N A;  2OWO A;  1VQ8 A;  4B3S L;  2ICE C;  3ERQ A;  2I5M X;  2K5N A;  3H91 A;  4ABN A;  1V43 A;  1WOC A;  5C0X J;  1ZYR C;  3AEV A;  1D7Q A;  4CDE C;  4KHP L;  1JOQ A;  1E2Z A;  2K5H A;  3BG3 A;  2R7Z H;  4DR5 L;  2R93 H;  2B2V A;  1BVS A;  1VQG A;  3EFX D;  3L0O A;  2VUM H;  1I4H A;  2B2U A;  3TP5 A;  2B39 A;  4RG1 A;  3GV6 A;  3S1Q H;  2PI2 E;  1SAP A;  5K5P A;  2ZTE A;  2VB2 X;  2CQO A;  3VR5 A;  3J7Z C;  5FLM H;  1Z9F A;  5C3E H;  1PH2 A;  4C3J B;  1QVC A;  2R92 B;  3N52 A;  5J22 A;  4HED A;  4JI2 Q;  3ITP A;  4IPG A;  5LMN L;  2LKV A;  2I07 B;  2F0N A;  1H9K A;  1MHW C;  4IAL A;  2K05 A;  1C7Y A;  4DV2 Q;  1VQM A;  1SNC A;  1PTO C;  2VQF Q;  4XTC S;  2JN4 A;  5FKA C;  1PVO A;  1PRT F;  1QOH A;  5C3X A;  1K8M A;  1QNK A;  2BDO A;  1NCV A;  1PH4 A;  2PQE A;  3ER0 A;  3LNN A;  4MTN A;  1L0Y B;  3VYT A;  1VQ5 A;  1WFQ A;  4P75 A;  4KN7 C;  1TT2 A;  3ULL A;  2Q2I A;  2F0L A;  3EN2 A;  3VA7 A;  1NTG A;  2D2C C;  4EQN A;  5JPN C;  1PH9 A;  1N8R C;  4A93 G;  3Q8D A;  2JA5 H;  3K0Y A;  3I4M B;  4KI0 A;  4XQQ A;  3KYH C;  1EIY B;  1TY2 A;  2NVT H;  4ULL A;  3GTM H;  3H15 A;  3U4Z A;  2IHF A;  3J80 L;  1SNQ A;  2UUB L;  1EL0 A;  1G91 A;  2N78 A;  3KDF A;  2EY1 A;  1D6E C;  2E2I B;  2ES2 A;  3QJY A;  2I0Q A;  1EYD A;  3C3L A;  3J7Y W;  1QE6 A;  4LF8 L;  4IPD A;  1YEZ A;  1D5M C;  3OPO A;  4I7Z C;  2F0G A;  3H0G H;  4BBR H;  1PFN A;  1HNZ L;  1JJ2 A;  1GUG A;  2ATW A;  2DUD A;  3NBI A;  1EQT A;  3BDO A;  3OIP A;  1VQD A;  4K0K Q;  5CV9 A;  1JOK A;  4IPH A;  5ELO A;  3TP6 A;  2X69 A;  2RBM A;  3A54 A;  4DR6 L;  2YTY A;  1M90 C;  3CMA A;  3P20 A;  5CV7 A;  4YWL A;  3K7U C;  2RDG A;  4JI5 Q;  4JBW A;  1TWG B;  1XPR A;  1KIX A;  1HH2 P;  3CC7 A;  1FNW A;  1V8Q A;  2DJG C;  2LY7 A;  4GKK L;  1HR0 L;  2ICI A;  1NNX A;  3QIA A;  1XTC D;  3QR8 A;  4R1J A;  2ZXO A;  5DEH A;  1STY A;  1CTM A;  2J0T D;  2K33 A;  2PI2 A;  4K14 A;  5GAD C;  4FP5 D;  2TSS A;  2ZXP A;  4LFB L;  4DV7 Q;  4C3I H;  4LMQ D;  3FKI H;  4JBK A;  1HTL D;  3GTP B;  3IKJ A;  3J7A V;  1QIL A;  4QUC A;  1XNQ L;  3QWN A;  4QGU A;  4FNF A;  3K0X A;  3TP8 A;  4GKJ L;  4DV5 L;  4IFD G;  5EQ0 A;  1F77 A;  4ZKC B;  2QDB A;  4G4K A;  4I65 A;  1R4P B;  4LK1 C;  3MHB A;  4OX9 L;  1RKN A;  1TS3 A;  5IWA L;  1QJO A;  2XIW A;  4AYB B;  4GNX B;  2MHV A;  1ZKO A;  3OW7 A;  1VQB A;  2ZTD A;  5EPJ A;  4PMW A;  2K4K A;  5HY6 A;  2AUJ D;  3PIO 3;  2K28 A;  4JK1 C;  4IFD J;  1QZH A;  2AQ3 B;  2KCN A;  3L2P A;  1FR3 A;  4DNI A;  4K2K A;  1KDB A;  1Y8O B;  1A3V A;  1N9W A;  4KJO A;  1WTO A;  4E6I A;  4ZK9 B;  3GTJ H;  4P2C B;  1I4X A;  2CWP A;  1XWE A;  2OQK A;  5IT9 E;  1I6H B;  5C5L A;  4C56 C;  2SNM A;  2MNA A;  2CH4 W;  4R4T A;  1STH A;  2Q8R E;  2WV6 D;  1NJI C;  3D4D A;  1ASZ A;  1E24 A;  4QF4 A;  4YHH Q;  1LTS D;  1EY5 A;  3ONA B;  3EA6 A;  2KBN A;  1D1K A;  1SE8 A;  3SVM A;  1D5X C;  2A74 C;  5J3B A;  1B2T A;  1GUS A;  1X3F A;  3DWP A;  4NXM Q;  2E2J H;  1PRT D;  1TWH B;  2KA7 A;  4YY3 Q;  4C1N I;  2NB0 A;  3EJI A;  3F2C A;  3CHB D;  4ZUI A;  3H09 A;  1WYD A;  1RDP D;  2HDL A;  5KYL A;  4BY7 H;  4HSP A;  1X3E A;  4A3J B;  1R9T B;  1Q3L A;  4A76 A;  4IJL A;  1HTP A;  2EJM A;  3IFD A;  3M3Y H;  1EY7 A;  2R61 A;  1PMR A;  3CCS A;  3R2T A;  3PO3 G;  1EWI A;  1KLU D;  4P72 A;  4L5Q A;  2D9U A;  4OWW B;  2KEN A;  3GTG B;  3D6W A;  4Y7N B;  3VR3 A;  1KDC A;  1ET6 A;  2I5L X;  1SYD A;  4WJ3 M;  1YHB A;  1ILQ A;  2VZA A;  3HKZ B;  2KHJ A;  2E2H B;  4DK3 C;  1OO9 B;  1HZ9 A;  3A56 A;  4KY7 A;  3I56 A;  3PO2 B;  2PO4 A;  3S1N H;  1Q46 A;  1O7I A;  4JOI A;  1PTO F;  1N32 L;  1ENF A;  1BQQ T;  1TR5 A;  5IYD G;  2K5D A;  2EY2 A;  1HHV A;  1BUV T;  5BN3 A;  2PZT A;  4JI0 L;  5ELN A;  2RVL A;  1IYJ B;  1DJR D;  1AN8 A;  3L3O C;  1VQ4 A;  1SSO A;  4JBM A;  2PNH A;  2V1C C;  1CA5 A;  1H9R A;  1N36 Q;  4A3F H;  3AFQ A;  3AMU A;  1SE2 A;  3O13 A;  4C2M H;  3UDG A;  4A3D B;  4ILW A;  2ZM6 L;  5CMD A;  4JYA Q;  4IUU A;  3BU2 A;  1PZI D;  2JA8 B;  4UDU C;  1EYA A;  1H95 A;  1K83 H;  3NXW A;  4M8A A;  4DNR B;  2SEB D;  4K6L A;  1S72 A;  3SK4 A;  2RF4 A;  3S9W A;  2GVA A;  2QA4 A;  3BDL A;  5JVG 3;  3HOV B;  2A1A A;  5IOD A;  4U67 3;  1Q86 C;  1XTD A;  2JA6 G;  3K5O A;  5D65 A;  3HKS A;  1U4M A;  2L15 A;  4UP7 A;  4XYO A;  2BH2 A;  1UWV A;  2KCT A;  2RSO A;  2NZH A;  1A3T A;  2LXJ A;  1YIT A;  3PV0 A;  2X6G A;  1D8L A;  3SDZ A;  5IYC G;  1NMG A;  1X9N A;  1SJE D;  5HGT A;  3RLN A;  4BY1 B;  2A69 D;  4KV6 A;  2WB1 E;  3GO5 A;  4IUT A;  3J81 L;  4PZ6 A;  2HUG A;  4CKB A;  2K32 A;  1E1O A;  2HQL A;  4ZRZ A;  3SEB A;  4X62 L;  2A6H D;  1E2V A;  4EVO A;  5IOC A;  2E8G A;  1MKH A;  4JI6 L;  2NVQ H;  4FXD A;  3RZD H;  4AH6 A;  2R3Z A;  1L0W A;  5IIF A;  1TS4 A;  2HD3 A;  3U58 A;  4A3M B;  4BS9 A;  2B63 B;  3ZYY X;  1MIU A;  1O7Y A;  4G57 A;  1B70 B;  1STN A;  3D31 A;  4X65 L;  3IFT A;  2F3I A; 
#chains in the Genus database with same CATH homology
 2A5H A;  1EZ6 A;  1J8I A;  5DNF A;  3F2U A;  1ESF A;  4IFD H;  2IX0 A;  1ENC A;  4ZQ3 A;  1B1Z A;  2RKS A;  2F03 A;  3DEP A;  3BVG A;  4DA2 A;  5D3D A;  2E74 C;  4FF4 A;  3TDQ A;  2CHB D;  1QCB D;  4HSV A;  3HG9 A;  3NP8 A;  1SBB B;  1G29 1;  3P1H A;  3Q23 A;  1B44 D;  2ENB A;  1C48 A;  1DM0 B;  2EYM A;  1M8A A;  1ZYR D;  1NR2 A;  2BCO A;  2KED A;  2PW7 A;  2IWH A;  2VNU D;  1NR4 A;  3C1F A;  3RD4 A;  4B9X A;  3I72 A;  4KKS A;  3NK9 A;  2WAQ B;  5E1F A;  3H94 A;  5I2Y A;  2QCP X;  5M5Y B;  2KUM A;  2AQ1 B;  2F0D A;  5C44 B;  1EEI D;  1X3Q A;  1LT4 D;  3NE5 B;  4PNY A;  1VMC A;  3OMC A;  3M7G A;  4QUF A;  2XNA C;  5KNB A;  2AQ2 B;  1E0B A;  3K59 A;  1PTO D;  3M4O B;  5I9O A;  4CJ0 B;  4BWG B;  2PCF B;  2M9V A;  1PZJ D;  3CQZ B;  2EXZ A;  3NQT A;  4WOR A;  1O7Z A;  5E3F A;  3R2I A;  2QEJ C;  1IL8 A;  1A15 A;  1YNJ C;  3K57 A;  1CA6 A;  1HUN A;  3K7A B;  4OIK A;  2NVY B;  5I6W A;  1O7L A;  2JA7 B;  1DCZ A;  3RUZ A;  1CHQ D;  2L55 A;  4R8I A;  2F0J A;  1JR0 D;  4F87 A;  3PO3 B;  3EVQ A;  3MXG A;  4RGN A;  1HPC A;  1STE A;  4BA2 I;  4Q0F A;  4F7X A;  4C3I G;  2F0T A;  5C6A A;  3M85 A;  5AFW A;  3S14 B;  2J7Z A;  5ELE A;  4K5V A;  2ID0 A;  4R8N A;  4RA8 A;  2AUK A;  1S5D D;  1AZP A;  2AWN A;  2LMC B;  2V4D A;  5D3I B;  5T1I A;  3MVV A;  3PUX A;  3I8Z A;  3MXU A;  4HAE A;  1EU3 A;  5A35 A;  2MPM A;  1WD1 A;  3ERO A;  4IUV A;  4G7H C;  2EJF C;  1LAC A;  4ZLT F;  4CBV A;  3SR1 A;  5C3W A;  3WDN A;  1V1O A;  4RGO S;  1OXX K;  1I6V C;  2JA6 B;  1OXU A;  1ML0 D;  1AP0 A;  2NBF A;  1K8O A;  3K5N A;  1I3Q B;  5K36 H;  4QCL A;  2SOB A;  1AFP A;  4TRD A;  1BCP B;  2D62 A;  3R93 A;  3X3M A;  3CKI B;  2XSC A;  4KJN A;  5EKL A;  1BCP C;  3OIQ A;  2Q8T A;  2EYP A;  2HCI A;  3VYU A;  3C1E A;  1BNZ A;  5NUC A;  3OWE B;  2XWJ B;  1J9O A;  3FVQ A;  1SYB A;  4KKT A;  5KND A;  1LT3 D;  1D5Z C;  1S5E D;  4J6H A;  4PMB A;  1S5C D;  3I70 A;  4WFN 3;  1IKM A;  2F0M A;  4K6D A;  5C5M A;  1E2W A;  3SE0 A;  2L11 A;  4A3I B;  1LTT D;  5DM7 3;  3J80 E;  2FJ2 A;  1PLF A;  1PTO H;  2R93 B;  3D4W A;  2VUM B;  3S1Q B;  1F2M A;  5I2X A;  1HUM A;  2NN6 I;  4MN3 A;  3PIP 3;  2IX1 A;  3T16 A;  2JEA I;  4KKU A;  1H9M A;  5M3M B;  3CU7 A;  1AEX A;  4MIU A;  4KMU C;  2EYL A;  5CGK A;  1YNN C;  3E5S A;  5ELC A;  1KAB A;  1I4G A;  1STG A;  4DNT B;  3H3V C;  4KK7 A;  1BDO A;  4X3U A;  3HOU B;  4UAI A;  2DY7 A;  1IHZ A;  4X3K A;  5G3L F;  2NTT A;  1LTR D;  2L4N A;  4CGY B;  1SYE A;  4OL7 A;  2R6G A;  4NDX A;  2K7V A;  2JA5 B;  3OOC A;  2LS0 1;  2NVT B;  1KDA A;  4EQP A;  1SND A;  3GTM B;  4XQJ A;  2EJG C;  3BVM A;  3RLF A;  2K01 A;  1TS5 A;  5I9P A;  1XX8 A;  3DM1 A;  4B9W A;  4ZYS A;  5EJW A;  1MD2 D;  1KLG D;  1TU2 B;  3H0G B;  1TKW B;  4BBR B;  5KGU A;  2EYF A;  4Z9C B;  3I4L A;  4FO2 A;  3NWS A;  4IUN A;  3KLR A;  2WP8 J;  1R4Q B;  2N88 A;  1HRJ A;  3SK5 A;  4FF1 A;  3W2D A;  1BR9 A;  2TMP A;  2Z1C A;  1T5X D;  3MTS A;  3W3A A;  5LL6 X;  1IW7 C;  4RKB A;  1TWF B;  5I6Y A;  2FMM A;  4FF2 A;  1QG7 A;  4C3I B;  3VA5 A;  1V1P B;  2OF1 A;  2BE5 C;  1A6X A;  2WB1 B;  3T4A C;  1HA6 A;  4NKL A;  3MWY W;  1STB A;  3D3R A;  4DGZ A;  1X3P A;  2JE6 I;  5KEE A;  5EBD A;  5CYU A;  3BZD B;  1JWM D;  2MUY A;  1M4V A;  3LX0 A;  5COY A;  2XN9 C;  5IGE A;  3QOL A;  3GTJ B;  1L0X B;  1W6K A;  2PPB C;  2RA4 A;  4NMZ A;  2I46 A;  4IZ8 A;  4B08 A;  4HMJ A;  1I4P A;  3L7Z C;  4G7Z C;  1JOR A;  1TVX A;  4ZAI A;  1SE4 A;  1A2T A;  2WII B;  1RTO A;  4C3H G;  4QB4 A;  4GZY C;  2E2J B;  2MGS A;  1F9P A;  2K6A A;  2NN6 G;  1PFB A;  1DYQ A;  2KOL A;  1BBX C;  5M9O A;  4OIJ A;  1JWS D;  1BOS A;  2A73 B;  2SDF A;  3TZU A;  3RMH A;  2PW5 A;  5G3L D;  3R8B A;  3KK7 A;  1JC7 A;  3FPU B;  1SYC A;  2F1M A;  3NBH A;  1AW7 A;  1JB3 A;  5CBA E;  4ZKB B;  4K8J A;  5A2Q E;  1D2B A;  1TY0 A;  5JEA J;  2FMC A;  4RCN A;  3J81 E;  2CQA A;  4U68 A;  2DNE A;  4LJZ C;  4HCS A;  2L9H A;  1H9S B;  5JVH 3;  3AB9 A;  2F0Q A;  4KD3 A;  1YNJ D;  2DNC A;  3V05 A;  1PXU A;  4K5W A;  5EKK A;  2GA4 B;  1EFI D;  3NHH A;  1ILP A;  3N6R A;  2EPB A;  2KEC A;  4A93 B;  4F8M A;  2B8F A;  3E6Z X;  4A3F B;  2PNR C;  4FXG C;  1A3U A;  4H44 C;  4NP5 A;  2F0H A;  5A2Q L;  3M7N A;  4QIW B;  2A6E D;  2JSO A;  1DOK A;  1FGB D;  2EYH A;  4K2L A;  2B2U C;  3FPP A;  4CKC A;  3S2H B;  4MHE A;  3T51 B;  5CV4 A;  4KY5 A;  5LHY 1;  3MEH A;  5I4D A;  5K36 G;  3IL8 A;  1GJX A;  5JPM C;  2A68 C;  3TME A;  3HS0 C;  1JWU D;  2QIL A;  3A8K E;  4RH6 A;  1Z6H A;  2NVQ B;  4DXF A;  1WTW A;  3D6C A;  1EEF D;  1C8C A;  3RZD B;  2G9D A;  1EU4 A;  1DOL A;  1Y8P B;  5FOB B;  3DMU A;  3I91 A;  1JCK B;  2DN8 A;  3D4R A;  3OWF A;  2FHT A;  3NTI A;  4FYD A;  4ID6 A;  4C3J G;  2X6L A;  2YYZ A;  1TII D;  3SK6 A;  2KVM A;  2Q8I B;  1MSG A;  1D1I A;  4XYQ A;  1WTX A;  1PRT B;  1EY9 A;  3Q6S A;  1TS2 A;  1EWC A;  3GP7 A;  2JXM B;  4XT1 B;  1G6Z A;  1ZEQ X;  4CJ2 C;  4K5X A;  2FIN B;  4BA1 I;  3KLS A;  3SK8 A;  1Y69 U;  3S1M B;  3U9S A;  4DF7 A;  2F0S A;  2QF7 A;  2RSN A;  5HUR A;  5M5W B;  3V2T A;  3SHL A;  5ELF A;  4RGM A;  1HFN A;  2BA0 A;  1OXS C;  2KCC A;  4IUQ A;  2NN6 H;  4CHT B;  1Q8I A;  1SE3 A;  2E76 C;  5JEA H;  3VYS A;  1SDF A;  2KQ3 A;  2PMZ B;  2L1B A;  2J4X A;  1S5F D;  5DAU A;  4YIJ A;  1G2S A;  1WD0 A;  3KBX A;  3WOF A;  5T1G A;  3T53 B;  4S3S A;  5KIX A;  3FDT A;  3I90 A;  2KEE A;  2NTS A;  1VF5 C;  3C2P A;  4C1N K;  1I4Q A;  2B2W C;  4TSS A;  1ONL A;  2KHS A;  3ND9 A;  1B3A A;  5KYI A;  1I4R A;  1OXT A;  1U4L A;  3KBG A;  4DFA A;  2OEO A;  1Z47 A;  4H0L C;  3BDC A;  4FVM A;  2ZT9 C;  1LT5 D;  2B8G A;  1DZ1 A;  3PUW A;  4H13 C;  2EYO A;  1BF4 A;  3V96 A;  1HCZ A;  4F88 A;  5IGG A;  4EQO A;  1EZ8 A;  3OMG A;  2XVS A;  5IGF A;  4A3E B;  3S17 B;  3I4N B;  2WKC A;  2YU9 B;  2O5J C;  4IUP A;  1Y1W B;  2PZU A;  2EY5 A;  1PFM A;  1VCI A;  3FMC A;  2K5Q A;  5FO7 B;  2JP1 A;  1QWY A;  2H4O A;  3MFG A;  4RHS A;  2WIN B;  4HN7 A;  4NW2 A;  4PQX A;  1GOZ A;  3RZO B;  2NVX B;  2XRS D;  4R9W A;  2NYZ D;  3DUZ A;  2CW0 C;  1MGS A;  4G7O C;  4J8Q A;  1LV9 A;  1LTG D;  4IUR A;  1EWH A;  2B2Y C;  1O80 A;  2IPK D;  1WTR A;  2QKI C;  2NWG A;  4ME5 A;  3D8G A;  1EIH A;  2O5I C;  4RWS C;  1Q90 A;  2MJ8 A;  1ESR A;  2F0P A;  2G9H D;  1GUO A;  2R7Z B;  1RF2 D;  4HTH A;  1SNP A;  3I3C A;  1CK1 A;  3PMF A;  2XRQ D;  5IGD A;  2F0F A;  1OXV A;  3URY A;  1II3 A;  1CT1 D;  3K5M A;  2VXW A;  1JE4 A;  1EIG A;  3I73 A;  5C3E B;  1LAB A;  1PTO B;  5CBE E;  1LTB D;  1W6J A;  5FLX E;  4XIG S;  1GUW A;  2HCC A;  1SEB D;  3DEO A;  5EKI A;  5E4X A;  1EY8 A;  1PYW D;  1SJH D;  4OO1 H;  3TSS A;  3GD7 A;  1JOO A;  3WOE A;  5JOB A;  1CHP D;  2JEB I;  4TKO B;  1NAP A;  1AZQ A;  2C5C A;  1Q12 A;  4KN4 C;  3HOW B;  3MAQ A;  2EE1 A;  4TQU S;  1IKL A;  1TQO A;  2OXP A;  3NPP A;  2LFN A;  1RCV D;  1B9N A;  2KJX A;  1UAP A;  1NSN S;  4IN3 A;  5ELD A;  1SMY C;  5FO8 B;  1CZG A;  4Q5V A;  5FLX L;  1EY0 A;  3NUC A;  4KY6 A;  4X3S A;  3HP3 A;  2EVB A;  1FNV A;  1LT6 D;  4K8I A;  5M3F B;  5CV5 A;  3GQB A;  4RKL A;  2VB3 X;  3OHX C;  2WAC A;  3DWQ A;  3A8I E;  1LLR D;  2IL8 A;  4HCE A;  4X3T A;  3PUZ A;  1C4Q A;  2F0V A;  2IW3 A;  3HEJ A;  1B50 A;  2F0K A;  3FKI B;  3HOX B;  1FNU A;  3MZ5 A;  1F2Z A;  1B53 A;  1U4R A;  1G2T A;  2A68 D;  1HQR D;  4DK0 A;  5C4X B;  2FFK B;  3TBI B;  3A7L A;  1RHP A;  3U9O A;  4KD4 A;  5ISR A;  1GHK A;  3GV3 A;  1LTA D;  2OT2 A;  5JJZ A;  1QNU A;  3KUP A;  1B9M A;  3QO2 A;  1UEA B;  1RTN A;  4OHJ A;  4RGT A;  1T5E A;  2H1E A;  2DY8 A;  3P75 A;  4RHR A;  5FK9 C;  1F9Q A;  4KHZ A;  2Z8L A;  1LTI D;  4XT3 B;  4J1M A;  3SXH A;  1SFO B;  2N55 A;  2IT1 A;  4XDX A;  4HMI A;  4DN4 M;  4DK1 A;  2B2W A;  3VR4 A;  5C4H A;  3DXJ C;  5C0X H;  1UNS A;  3AU7 A;  1F2L A;  2E75 C;  4FF3 A;  3PUY A;  1SYF A;  1BCP F;  1BXT A;  2HQE A;  3MXN A;  5CV6 A;  1EQV A;  3P7J A;  1U4P A;  1H9J A;  1JIC A;  1A2U A;  1XYI A;  5JEA G;  4BY7 B;  4OO1 I;  4L63 B;  3T13 A;  1SXT A;  1GXD C;  2Z4I A;  3FEW X;  1SNM A;  2B2T C;  4QMG A;  3M3Y B;  2F0W A;  1EY6 A;  4KHV A;  5KNC A;  2ZXR A;  5IT9 L;  1MI2 A;  1VF7 A;  1Z7T A;  2D5D A;  3Q0A A;  1HXY D;  4BBS B;  1GHJ A;  1IYU A;  4PMC A;  3PUV A;  1Q1B A;  3T56 B;  1CQF A;  1F9S A;  5EPK A;  2WKD A;  5EGT A;  3S1N B;  4FXK C;  3NTH A;  2BA1 A;  1KTK A;  1ROD A;  4L8J A;  3MXP A;  3TZD A;  1IYV A;  2F3V A;  1CFM A;  2CVR A;  2PYK A;  1TWC B;  2B2Y A;  3S16 B;  3MA2 B;  2MP1 A;  5E4W C;  2EYJ A;  5J1Z A;  1ICW A;  1F9R A;  3BVZ A;  1FD7 D;  3HRZ C;  2M00 A;  4C2M B;  1PDQ A;  3MFY A;  3GTL B;  2RQX A;  3GTO B;  4HR7 B;  3NQI A;  4ODG A;  5CR3 A;  3IAY A;  1K83 B;  1BO0 A;  1SNO A;  5DM6 3;  5CV8 A;  4DXG A;  5LL6 S;  2B2V C;  4V0B A;  4XQN A;  1ZXT A;  3A55 A;  3X3N A;  2O2L D;  4O42 A;  1RD9 D;  3G6J B;  3KLS X;  1F2Y A;  1EOT A;  4DU9 A;  1MSH A;  1S5B D;  3NWT A;  4WRD A;  5KRU A;  2HDM A;  1ENA A;  4OGQ C;  1DOM A;  4A3G B;  3VYR A;  1KAA A;  5J39 A;  1WTP A;  1Q1E A;  1VDZ A;  1RJT A;  1WTQ A;  4M1U B;  3K5L A;  1EY4 A;  1UUP A;  4EGV A;  3S1R B;  2F0O A;  2Z4H A;  5BN5 A;  2K03 A;  2K04 A;  4N9P A;  3HZX A;  3Q22 A;  1MBY A;  4KTA A;  1O78 A;  2M2L A;  2K1B A;  3HOZ B;  3CRL C;  3LWU A;  3DWA A;  1B4O A;  2O4X A;  3LWE A;  2L5T A;  3S15 B;  2F3W A;  5C0X I;  3C46 A;  3KF8 A;  5ELB A;  2AWO A;  5C4Z A;  1WVL A;  3QOJ A;  1BCP D;  3VR6 A;  2CW0 D;  3BYT B;  3HGB A;  1I50 B;  4LAA A;  1CI3 M;  1G8Z D;  1GUN A;  2NZ1 D;  5BN4 A;  1PZK D;  2E2D C;  5JAV A;  1HA5 A;  2NUC A;  3BYY B;  5M5X B;  5C4J B;  4DAY A;  5EBC A;  1PRT C;  2L0C A;  3JAM E;  2EY6 A;  1ET9 A;  1GUT A;  2RDH A;  5FO9 B;  2BOS A;  4DAV A;  2F0E A;  2EOT A;  3S2D B;  2C9O A;  4OO1 G;  3VR2 A;  3NSW A;  4N9T A;  1U9R A;  3G7L A;  1WTV A;  2XWB B;  1CQV A;  1S4Z A;  2L12 A;  1QB5 D;  2EDG A;  5TSS A;  5EPL A;  3FRP B;  5IGB A;  4RCO A;  1Y1V B;  3TN2 A;  1V1P A;  1YNN D;  1XXG A;  3QB3 A;  4ZUJ A;  3Q24 A;  4C3H B;  3J7A F;  4RAU C;  3TP7 A;  3JAM L;  3R3O A;  1WCM B;  4L6T B;  3DHQ A;  3L9A X;  3EQL C;  2IJ0 A;  3A8J E;  3MC0 B;  4CJ1 B;  3HOY B;  3BS1 A;  5F2D A;  1FYC A;  4PV1 C;  1STA A;  1HFG A;  3H6M A;  4DAP A;  5IGC A;  3CRK C;  2BDN A;  1DXM A;  4WJW A;  2K5W A;  3UI2 A;  3GTK B;  1SMY D;  1VMP A;  1CM9 A;  1CZW A;  5D14 A;  2EZV A;  2SNS A;  1TWA B;  3M4Y A;  1JQY D;  1Y8N B;  2A6E C;  2Y0S B;  2A69 C;  3NTK A;  4CKE A;  5COR A;  3ND8 A;  2PZW A;  1DON A;  1NUC A;  1IW7 D;  1DD2 A;  2A6H C;  2B2T A;  4A3B B;  2RDF A;  4H7B A;  4A3K B;  1HQM C;  3QG1 A;  2F0U A;  1SYG A;  4IFD I;  3OSO A;  4V19 0;  2BE5 D;  1EYC A;  4RFB A;  4XXE A;  2F0I A;  1KNE A;  3GTQ B;  3K6O A;  3K58 A;  3E0J A;  5C0X G;  4IQZ A;  1H9S A;  2JYO A;  1KNA A;  1LO5 D;  3A7A B;  1X32 A;  5CC4 A;  2F4I A;  2IX3 A;  4O1N A;  2ICE C;  3ERQ A;  3H91 A;  4ABN A;  1V43 A;  5C0X J;  1ZYR C;  1JOQ A;  1E2Z A;  3BG3 A;  2B2V A;  3EFX D;  1I4H A;  2B2U A;  3TP5 A;  2B39 A;  3GV6 A;  1SAP A;  5K5P A;  2VB2 X;  3VR5 A;  4C3J B;  2R92 B;  3N52 A;  5J22 A;  4HED A;  3ITP A;  2LKV A;  2I07 B;  2F0N A;  1H9K A;  4IAL A;  2K05 A;  1SNC A;  1PTO C;  4XTC S;  5FKA C;  1PRT F;  1QOH A;  5C3X A;  1K8M A;  1QNK A;  2BDO A;  1NCV A;  2PQE A;  3LNN A;  1L0Y B;  3VYT A;  4KN7 C;  1TT2 A;  2F0L A;  3VA7 A;  2D2C C;  4EQN A;  5JPN C;  3K0Y A;  3I4M B;  4KI0 A;  4XQQ A;  1TY2 A;  4ULL A;  3J80 L;  1SNQ A;  1EL0 A;  1G91 A;  2EY1 A;  1D6E C;  2E2I B;  3QJY A;  1EYD A;  3C3L A;  3J7Y W;  1QE6 A;  1D5M C;  3OPO A;  4I7Z C;  2F0G A;  1PFN A;  1GUG A;  3NBI A;  1EQT A;  3BDO A;  3OIP A;  5CV9 A;  1JOK A;  3TP6 A;  2X69 A;  2RBM A;  3A54 A;  3P20 A;  5CV7 A;  2RDG A;  4JBW A;  1TWG B;  1FNW A;  1V8Q A;  2LY7 A;  2ICI A;  3QIA A;  1XTC D;  2ZXO A;  5DEH A;  1STY A;  1CTM A;  2J0T D;  2K33 A;  4K14 A;  4FP5 D;  2TSS A;  2ZXP A;  4LMQ D;  1HTL D;  3GTP B;  3IKJ A;  3J7A V;  1QIL A;  4QUC A;  3QWN A;  4FNF A;  3TP8 A;  4IFD G;  5EQ0 A;  1F77 A;  4ZKC B;  2QDB A;  4G4K A;  4I65 A;  1R4P B;  4LK1 C;  3MHB A;  1RKN A;  1TS3 A;  1QJO A;  2XIW A;  4AYB B;  2MHV A;  1ZKO A;  3OW7 A;  5EPJ A;  4PMW A;  2AUJ D;  3PIO 3;  2K28 A;  4JK1 C;  4IFD J;  2AQ3 B;  2KCN A;  1FR3 A;  4K2K A;  1KDB A;  1Y8O B;  1A3V A;  4KJO A;  1WTO A;  4E6I A;  4ZK9 B;  4P2C B;  1I4X A;  1XWE A;  5IT9 E;  1I6H B;  5C5L A;  4C56 C;  2SNM A;  1STH A;  2Q8R E;  2WV6 D;  3D4D A;  4QF4 A;  1LTS D;  1EY5 A;  3ONA B;  3EA6 A;  1D1K A;  3SVM A;  1D5X C;  2A74 C;  1B2T A;  1GUS A;  3DWP A;  1PRT D;  1TWH B;  2KA7 A;  4C1N I;  2NB0 A;  3EJI A;  3CHB D;  4ZUI A;  3H09 A;  1RDP D;  2HDL A;  5KYL A;  4HSP A;  4A3J B;  1R9T B;  1Q3L A;  1HTP A;  2EJM A;  3IFD A;  1EY7 A;  2R61 A;  1PMR A;  3R2T A;  1KLU D;  2D9U A;  3GTG B;  3D6W A;  4Y7N B;  3VR3 A;  1KDC A;  1ET6 A;  1SYD A;  1ILQ A;  3HKZ B;  2E2H B;  1OO9 B;  3A56 A;  4KY7 A;  3PO2 B;  2PO4 A;  1PTO F;  1ENF A;  1BQQ T;  1TR5 A;  2K5D A;  2EY2 A;  1HHV A;  1BUV T;  5BN3 A;  2PZT A;  2RVL A;  1DJR D;  1AN8 A;  3L3O C;  1SSO A;  1CA5 A;  1H9R A;  3AMU A;  1SE2 A;  3O13 A;  4A3D B;  4ILW A;  5CMD A;  4IUU A;  1PZI D;  2JA8 B;  4UDU C;  1EYA A;  3NXW A;  4M8A A;  4DNR B;  2SEB D;  4K6L A;  3SK4 A;  3S9W A;  5JVG 3;  3BDL A;  3HOV B;  5IOD A;  4U67 3;  3K5O A;  5D65 A;  1U4M A;  4XYO A;  2RSO A;  1A3T A;  3PV0 A;  2X6G A;  3SDZ A;  1SJE D;  5HGT A;  4BY1 B;  2A69 D;  4KV6 A;  3GO5 A;  4IUT A;  3J81 L;  2HUG A;  4CKB A;  2K32 A;  4ZRZ A;  3SEB A;  2A6H D;  1E2V A;  4EVO A;  5IOC A;  4FXD A;  2R3Z A;  5IIF A;  1TS4 A;  4A3M B;  4BS9 A;  2B63 B;  3ZYY X;  1O7Y A;  4G57 A;  1STN A;  3D31 A;  3IFT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...