2EY2A

Crystal structure of staphylococcal nuclease mutant t41c
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
136
structure length
136
Chain Sequence
b'KLHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDCPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Staphylococcal nuclease
molecule tags Hydrolase
source organism Staphylococcus aureus
publication title Threonine mutants of Staphylococcal nuclease
rcsb
total genus 38
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2005-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2ey2A00
3D8GA 3MXPA 4YIJA 3TP5A 5CC4A 2F0UA 3NQTA 5HGTA 2EYOA 4G57A 5C4ZA 1EY9A 4K5XA 3MEHA 5C3WA 2OF1A 3V2TA 4K6DA 5I6WA 2SOBA 4NMZA 5IGCA 1SYBA 2EXZA 2RBMA 3EVQA 4B9WA 2EYJA 5C6AA 1RKNA 3RUZA 5I9OA 2EY1A 4QMGA 3BDCA 1EY6A 5E3FA 3EJIA 1JORA 1AEXA 3OSOA 1F2YA 1JOKA 2F3VA 3SK5A 2F0EA 4I65A 3T16A 4K2LA 4H7BA 1STGA 2PW5A 3D6CA 5IODA 4R8NA 1STBA 2OEOA 4PMBA 5CV6A 2F0FA 4IUNA 5CR3A 4EVOA 1II3A 2F0SA 5CV7A 1STNA 4ID6A 4EQOA 2EY6A 1SNMA 3E5SA 2F0QA 3S9WA 2RDFA 5I9PA 2O4XA 2F0JA 4HMJA 4K8JA 5EKKA 5IOCA 5KEEA 4HTHA 4KY7A 1STAA 3OMCA 5E1FA 2SNSA 5EGTA 4DF7A 5ISRA 4OL7A 1EYDA 3C1EA 3HZXA 3H6MA 5K5PA 4F7XA 1JOOA 4QF4A 1EY5A 1KABA 2NUCA 2F0LA 3SR1A 3NK9A 1SYGA 1TQOA 2OXPA 4QB4A 3TP6A 4J6HA 5IGFA 1A2UA 5CGKA 5KIXA 5KYLA 3DMUA 3MHBA 4PMCA 4J1MA 3U9OA 3D4DA 2EYFA 1EYCA 5C5MA 2F0WA 4K8IA 1NSNS 4DGZA 3NUCA 1A3VA 5CV8A 3NHHA 3NP8A 2F0KA 1SNDA 5CV5A 4ZQ3A 4KHVA 1EZ8A 1STYA 2PYKA 3D4WA 3SXHA 1SYEA 2KQ3A 3PMFA 4RKLA 5IGDA 3R3OA 2EY5A 4K5WA 1EY8A 5HURA 2RKSA 1EY0A 5CV9A 4EQPA 1ENCA 5IGEA 5CV4A 2QDBA 3DHQA 3OMGA 2F0DA 4NP5A 4DU9A 4E6IA 4KJOA 5M9OA 2PZTA 4WORA 3VA5A 4KY6A 2KHSA 5J39A 5NUCA 1STHA 5IGBA 4ZUIA 2ENBA 3TP7A 5EKLA 3MZ5A 2EYHA 1KDCA 5C5LA 1TT2A 2F3WA 5DEHA 4EQNA 2F0IA 5KYIA 2WACA 4LAAA 1EY7A 2F0HA 1A3UA 3ERQA 3P1HA 4HMIA 4NDXA 2PZWA 3QOJA 5F2DA 3MVVA 2SNMA 4KD4A 4RKBA 2LKVA 1SNQA 4NKLA 4ODGA 3SK8A 5C3XA 1KDAA 4S3SA 1EY4A 1ENAA 4K5VA 4IZ8A 3OWFA 2F0NA 1NUCA 4N9TA 3C1FA 4ME5A 5J22A 1SYDA 5JOBA 5IGGA 4K14A 3SHLA 2F0OA 4TRDA 4PNYA 1IHZA 1SYCA 2PW7A 3QOLA 4K2KA 1A2TA 4KJNA 1A3TA 3T13A 1KAAA 1SYFA 2EYMA 3QB3A 4KTAA 4KY5A 4KV6A 3P75A 3TP8A 2F0TA 5KRUA 1KDBA 4IALA 3TMEA 1SNCA 1F2ZA 1TR5A 2F0VA 2M00A 5I6YA 5IIFA 1EQVA 4N9PA 4F8MA 5JAVA 2F0MA 1EYAA 1EZ6A 2EYPA 3ITPA 4B9XA 2F0GA 3HEJA 2F0PA 1SNOA 2HQEA 4MIUA 5J1ZA 4ZUJA 2PZUA 5DAUA 2PQEA 2EY2A 3EROA 3BDLA 1U9RA 3NXWA 1SNPA 5C4HA 3SK4A 1F2MA 4KD3A 5KGUA 4WRDA 2EYLA 4DFAA 3LX0A 3SK6A 1JOQA
chains in the Genus database with same CATH superfamily
2J0TD 1FVIA 3I8ZA 5CC4A 3CC2A 4R9WA 3STBC 3ULJA 4G57A 2NVYB 1E2VA 3V2TA 5I6WA 1D5ZC 5EAYA 3PIPA 5E3FA 4LF8Q 3CMAA 4LF7Q 5M3MG 4B3RQ 2A6HD 4I65A 4K2LA 1TWCH 1YNJD 4H7BA 1DM0B 2QCPX 2L11A 4DAYA 5DM73 4X3TA 3HOXH 3KFUA 4ALPA 3Q0AA 1CM9A 2OWOA 3BVGA 2IL8A 3ULPA 1D1IA 5EKKA 2KCMA 5IT9c 2K5DA 1J9OA 4CDDC 2EDGA 4R4QA 2NVQH 1TWAB 2L1BA 1YJNA 3PIO3 3WWVA 4G4KA 5M5YH 2B39A 1SYGA 1WTVA 1V1PA 1Q1BA 1ILQA 3KOJA 5IY0A 4A3EB 4DR4Q 2A5HA 5CV8A 1EZ8A 1E24A 1SEBD 4JI8L 3GTJB 3S2DB 4JI2Q 3MXGA 1STEA 1G2TA 2YU9B 4OO1I 1Y1VH 5JPNC 2CWPA 1MJCA 3NPPA 3A74A 2B2TA 2L0CA 2B2YA 3D31A 2KHSA 3OIQA 1NJIC 4GLVB 1F2LA 1S4ZA 1XPOA 4BXXG 2EYHA 1CHQD 4HR7B 2B63B 4A3GH 4JYAQ 5GAHC 4HIMA 4KHZA 4DV0Q 3JC66 2R7DA 2KJXA 3OTOQ 3DXJC 5M5WH 1MBYA 1Y1VG 4YWLA 1VQNA 4A3DG 4DUYL 5E4WC 5COYA 4JK1C 1NY4A 2F0TA 5C4XH 3CCSA 4DKAC 2VB2X 4N9PA 4LF8L 4LUVA 4FXKC 2RF4A 5D3IB 1QVFA 2ZM6L 1HUMA 5M5YB 2PPBC 1TS3A 3I4MB 1A0IA 1ZXTA 2Q2TA 4HCEA 3KBGA 1OXXK 4B3SQ 5ELBA 4WRDA 3LX0A 3K58A 2L9HA 1B7YB 3HOWB 1YBYA 3MEHA 1SE8A 4A3FB 2OF1A 2JA8G 1O78A 2ATWA 3GTPH 3RUZA 1Y1WG 3S15H 3BDCA 4GOPB 1VQPA 3EJIA 3OSOA 4DAPA 2PNRC 4ZKBB 2ZTDA 2A68D 2IW3A 3D6CA 4IPGA 3C46A 3RMHA 2OEOA 5CV6A 1FL0A 2F0SA 1STNA 1WYDA 4JI7Q 3ONAB 5EJWA 4DV2Q 4LF7L 3L2PA 4WFN3 3VR3A 1IL8A 4DK1A 4HTHA 4C3IH 1O80A 1EQRA 4B3MQ 4JOIC 4X3SA 5ISRA 4LF9L 4WJ3M 1Q12A 3CP0A 3ERSX 2DNEA 3Q8DA 1EY5A 4A3KB 3HOYB 5FOBB 3S2HH 2BE5C 4LUOA 2EOTA 3WOFA 5GAGC 2KHJA 2B8GA 4J1MA 1CHPD 3ZYYX 4K8IA 3GDEA 1XXGA 4ZQ3A 1Z7TA 3S1QH 1STYA 3KDFB 2R6GA 1YJ9A 3KF6B 3QG1A 4AYBG 3UDFA 5CV9A 5C4JH 5JJKA 1C9OA 1X3FA 4OEMB 5JVG3 4KKTA 3PGZA 1PH4A 1TS2A 2Y0SG 3CCJA 1E7ZA 1X3PA 1VQFA 2WB1E 4Q0FA 4GN3B 2DUDA 4XXEA 4JI3Q 4AYBE 3GTQB 1LACA 3E6ZX 4OO1G 2LKVA 4Q5VA 2RQXA 3DUZA 1BCPF 1UWVA 3A54A 5BR8L 1JC7A 3FEWX 3QOLA 1WTRA 1A3TA 1UAPA 1IXRA 4FXGC 1ESFA 2GVBA 4RGNA 1VQ5A 3BZDB 2M00A 1SE3A 2G5DA 3PCOB 1Q8IA 3W5OA 3RN5A 3HOYH 2N88A 2K33A 4X66Q 4RG1A 2HDMA 1SNPA 2XVSA 4LFAQ 4JI6L 1JT8A 4GS3A 1SE4A 1MSGA 2BA1A 1FNUA 3SDZA 2BH2A 4KHPQ 3KLRA 2YTXA 2UU9L 1CZGA 3Q6SA 3R8BA 4XDXA 1K3RA 2R7FA 3EVQA 3AMUA 3LGJA 3AQQA 3CCMA 4GLAC 1K0RA 1OXTA 4B3RL 2LSSA 2I0QA 4NW2A 4NXNL 1QNKA 2C9OA 2K5QA 5C0XI 4ID6A 1XNQQ 1VF7A 1SNMA 3H3VC 1A62A 1KLGD 2B29A 4DR7L 4YCUA 1PZID 3HOUB 2NBFA 5IOCA 1LTRD 4YY3L 3CPWA 2OCEA 1WVLA 1ET6A 3T53B 2Z6KA 2AQ1B 2HIVA 1QB5D 3NK9A 4J6HA 5IT9E 1GKHA 2JEBI 4OWXB 1HTPA 2VUMB 1EYCA 5C0XJ 3PO2B 1VDZA 4A3BH 3N6RA 4B3TQ 4MHEA 3PV0A 4GNXC 1VMCA 4K5WA 3H3VI 2MPMA 4HAEA 2K5NA 2YU9H 5M5WB 1Q7YC 1L0XB 3GO5A 1CK1A 3BJUA 1S40A 3I3CA 5EKLA 4QIWE 1VQ9A 4LNQA 3MZ5A 1TWFB 1VQMA 2F3WA 2YV5A 5L37A 1HNWQ 1CA6A 3C3LA 1PH1A 4C1NI 3M85A 2ICIA 1BCPD 4HMIA 2PZWA 1V1PB 2ZXOA 3U4VA 2SNMA 4C3JB 3HS0C 4NKLA 3SK8A 4DNIA 4DV4L 4LF5Q 3RZOB 5FO9B 4LF4L 1RL2A 1AN8A 5ELDA 3TZDA 4JI3L 3D3RA 3J81E 2L55A 3CC7A 5KRUA 2IY5B 2B8FA 5C0XG 3K8AA 4PZ6A 1VQJA 3FHWA 2FMMA 3A8IE 3IKJA 4A3JG 3S2HB 4RH6A 1GUWA 2Z0SA 4BBSB 4IQZA 5I4DA 1VQKA 1ZKOA 1HQRD 4H13C 2UXDL 4U68A 4DFAA 4LFCQ 4JI8Q 4JVZA 4NXML 1NMFA 1A8VA 2QEJC 1I94Q 4OHJA 3F2BA 1JR0D 3VDYA 4A3BB 1HUNA 1BOSA 1LTTD 1U4PA 2N3SA 2SOBA 1UE5A 1X54A 5FJ8H 1L0WA 4JI6Q 1RD9D 2D9UA 1RTOA 3K81C 2VZAA 4DR6Q 4A3CG 2FJ2A 1KTKA 1G91A 1STGA 3U50C 3CPFA 3SVMA 1E22A 1PFNA 4PMBA 1QVGA 1DOKA 3OW2A 5KNCA 3F2DA 1I6HH 2F0QA 5K36G 3FVQA 3DWAA 2O4XA 1E3PA 4BBRB 4X65Q 3CRKC 3LNNA 3NTHA 2KCNA 2PI2E 2SNSA 2LXKA 5ELOA 2DY7A 3PF4A 1QZGA 2M2LA 3A0JA 4DK6C 4HJ8A 3RLNA 3M4OH 3TP6A 1LABA 4BY1H 4A3EH 1D2BA 1X3GA 4IPDA 2N49A 1LTLA 2F0KA 5M5XB 1HHVA 1EQQA 2UUBQ 3K59A 5C4XG 2V1CC 1I4HA 1EY8A 3A8KE 1ENCA 5IGEA 2H4OA 4JI1Q 5DM63 2E2DC 4DXFA 3CF5A 2ZJPA 2XIWA 4JI0Q 3I90A 3GTQH 5GADC 2IJ0A 4DV5L 1EEFD 2PMZE 4C3IG 2NVTH 4A3MB 1Q46A 4DR5L 3WDNA 1BBUA 2F0HA 4PQXA 4IN3A 4ABNA 5I9OA 3CCVA 2OT2A 3GTMB 2EE1A 4K0KL 4DNRB 4RKBA 3W1GA 3UDIA 5E7NA 1YNND 1N36Q 3GTOB 4IOAA 1EY4A 4ZRZA 1HA5A 4ME5A 4RCOA 4NXMQ 1AFPA 1EIFA 3TS2A 4PNYA 3PIP3 3K7AH 3P75A 2WFWA 1CFMA 1EQVA 1VQCA 4LF4Q 3ICEA 1H9SB 2F0GA 3G7LA 3VYSA 5GROA 3TREA 3UE1A 3JAML 1L0YB 5HGQA 4CDFC 3MWYW 2VB3X 2L4NA 5C4HA 1TXYA 4AYBB 4HIDA 1GHKA 1CQFA 1V1QA 1PTOF 4YWKA 3B6YA 4KHPL 3HOWH 5IP9H 5C44G 3PO2H 1D7QA 2EPBA 5IGCA 5C3EG 4NMZA 1VQIA 2MNAA 4R8IA 1LTGD 4H0LC 1SLJA 4LFCL 4MTKA 1X9NA 1LT6D 3KUPA 2DGYA 1ML0D 1YHBA 2YTVA 1HJPA 2N78A 5FO8B 3AFQA 2JA7G 3GTKB 4U673 3GTPB 2B2TC 5CR3A 1IL2A 3W3AA 4RWSC 3T1HL 4K8JA 4FNFA 1WJJA 3HKZE 4A3MG 5E1FA 1YNXA 2JA7B 1WOCA 2E8GA 3FRPB 4JI0L 1JQYD 2NZHA 3L0OA 4Y7NB 1IBLL 3SR1A 5T1GA 4UP8A 1PH3A 1JJCB 1PTOD 2EYFA 1FYCA 1EWCA 3RLFA 4O1NA 3NP8A 1B3AA 3A7LA 1XNRQ 3BS1A 1BBWA 1F9SA 3UDXA 2VQFL 4P73A 1EUJA 2UUCL 2HCIA 2I5LX 4NP5A 4NPSA 4DU9A 4L5TA 1JWSD 1I4RA 1HZAA 1OXSC 5CMDA 1GOZA 1KRTA 3N52A 2IHFA 1EOVA 2K5HA 3RD4A 4JI5L 5JJLA 1H9JA 4DR7Q 2FHTA 4CKEA 1A3UA 2XSCA 4DA2A 3M3YH 2TSSA 4NXNQ 3CMEA 3MA2B 4POGA 2Z8LA 3NTKA 3KBXA 1D5XC 1Y1VB 1YZ6A 1EEID 3C1FA 1SYDA 4ME3A 1SYCA 1A2TA 2EIFA 3NELA 3S1QB 1KAAA 2AQ3B 4H02A 4YY3Q 4AQYL 4IALA 1K8OA 1EOTA 5EBDA 4L5QA 1VMPA 1J5EL 1PHJA 5J1ZA 1HCZA 2PZUA 1BF4A 5FK9C 3R93A 3EROA 1SAPA 1CI3M 2K6AA 2D62A 3CHBD 1SFOH 1I50H 5CBEE 1PRTB 2E76C 3EBEA 1JICA 4BY7H 1EY9A 1G8ZD 5FLMH 4A3JB 5IYCH 4DAYB 3IAYA 3J7YW 4L6TB 1EIYB 4RFBA 1JJ2A 1HNWL 4MTNA 4A3LH 1NR2A 5IT9L 4C56C 2AUJD 2ZJRA 5DLQE 2EJMA 2QGQA 2TMPA 1PFBA 3S15B 4TSSA 4FF3A 4UDUC 1GD7A 3NBIA 1VS0A 5JEAJ 3CAMA 2NWGA 3H0GH 5IYCG 4LFBL 4HMJA 2Q8TA 2CVRA 2XRQD 2CKZB 5IWAQ 5I2XA 1WTOA 3G4SA 4OX9L 1EIHA 5BN5A 1STAA 1TY0A 4C3HB 2RHSB 1N36L 1BO0A 3S17H 3TDQA 4F7XA 4ZK9B 4B3TL 2XNAC 5IP9G 5C44H 5EPKA 4Y52H 1HZ9A 3AB9A 3FDTA 1CUKA 3D4DA 1QZHA 1GUNA 1T9HA 1NAPA 1HQMC 3JAMi 1ZEQX 1TWGH 1SNDA 1Q86C 4A3BG 4KHVA 3PO2G 1SYEA 2D5DA 1KC8C 5IGDA 1YHQA 1ET9A 3R3OA 4DUZL 4UY8C 1HFNA 5EKIA 2DY8A 1U4LA 3M3YB 5C4JB 3BU2A 4BS9A 3DEOA 4C2MB 3KF6A 1RCVD 2EVBA 1KDCA 3J7ZC 1AP0A 2A73B 3V05A 3P1HA 5C3XA 2C5CA 2GA4B 3K7AB 3W2DA 2CH4A 5IP7G 1WCMB 4K5VA 2MO0A 1K3BC 4G7HC 3S17B 4JI5Q 2F0OA 5FLXc 3I70A 2HDLA 5ELEA 3CC4A 3H0GG 2R93G 5ELFA 4KV6A 1L1OA 4DV3Q 3MAQA 2ES2A 2QF7A 2GN5A 4F8MA 1S5BD 2B2UC 4Y7NH 5FLMG 1PTOC 3WOEA 2E2IB 2EY2A 4A3LG 2XWBB 3HG9A 1V9PA 3VYTA 2NN6I 1YJWA 2R61A 1LLRD 3M7NA 1JOQA 1C48A 1JWUD 4ZYSA 1M4VA 1PRTD 2K7VA 3I7FA 1X6OA 3I72A 4DR5Q 2EXZA 3HOVB 3DLLA 2VL6A 4JV5L 1EY6A 1X3EA 4IFDH 1WFQA 5EPJA 4X65L 3CW2C 4IUTA 1A6XA 1DXMA 1RJTA 1PLFA 3ER0A 3BG3A 5KEEA 1O7ZA 4A3CH 2RA4A 1FNWA 1HA6A 1JB7A 3H6MA 4L63B 1B9MA 4KN4C 4N8X1 3W1BA 1DGSA 1GUSA 4QB4A 4HJ5A 2OXPA 1TWGB 3GTMH 5KIXA 2I5HA 4KKUA 2UUAL 2RSNA 4XQJA 3SGIA 2QEXA 3PUXA 2RCNA 1M1KC 1HNXL 2WINB 1CKOA 1LO5D 3PMFA 3EFXD 1S5ED 5BR8Q 4RHRA 2KOLA 5CV4A 3HFZB 2QDBA 4QJFA 1VQEA 3F2UA 1N9WA 2XTIA 5LL6S 1FJGQ 3I4NG 2NZ1D 1TWFH 1MD2D 3NQIA 1ASYA 3NBHA 5C5LA 2K4KA 4PV1C 1WD0A 4NDXA 3QOJA 4KD4A 1SNQA 3HKSA 2CQOA 3HP3A 1GUTA 4MNOA 1TWAH 3HOUH 4UPAA 4NB3A 4JI4L 3I4NB 2K28A 4PZ7A 2VNUD 4FF1A 3TN2A 2IX3A 4IO9A 4DV6L 5I6YA 4BA1I 4IFDI 4A75A 1C7YA 3S16B 3HKZG 5C44B 4G7ZC 3PSIA 2LMCB 2UXBL 4A3KH 4BA2I 3P7JA 4B3ML 2JA5H 1W3SA 3FMCA 1PTOB 1QNUA 3NWTA 1Y8OB 2J7ZA 4YIJA 2PI2A 2IHEA 4JPBW 1PH6A 1QJOA 1L1OC 1JMCA 5GQOA 2UUCQ 1NTGA 2K01A 4GN5A 3OOCA 3H0GB 1VQ8A 2NVXH 4CKBA 3Q23A 1SYBA 1MHWC 4AH6A 2AWNA 3QWNA 1WI5A 3IFTA 3HOXB 5EBCA 4BBRG 4A3KG 4DR2Q 3VR2A 1U0LA 4L5RC 1UE7A 1IBKQ 3GTKH 3BVZA 3S1NH 2R92B 4R8NA 1B50A 2OQ0A 5D14A 1WTXA 1XMOL 1IBML 3MXUA 4DV0L 3U58A 2EY6A 1JWMD 2KA7A 3BDOA 4V0BA 2I46A 4PMWA 1PH2A 4IFDG 3SEBA 3I73A 1X55A 4TQUS 4DV1L 3OMCA 3I4NH 1BXTA 4HIOA 3C1EA 1NCVA 4B08A 4H44C 1KABA 4X3UA 1VQAA 3F8TA 1I94L 4GOPC 2X69A 2ZXPA 2RVLA 3IL8A 5LMNL 3DWPA 4C2MH 1K28A 5JJZA 4FDBA 5C4XB 4ZAIA 3J81j 2PYKA 3VR6A 2K32A 1D1KA 2UXCQ 2KQ3A 4A3EG 2E2JB 1SJHD 4C3HG 4AQYQ 1WCMH 4HJ7A 2F0DA 2XRSD 4FYDA 1N33Q 4JI7L 3VA5A 3M9BA 2B63H 1STHA 4A3GB 4A3MH 2ENBA 2MFIA 2OTLA 1TY2A 3AU7A 2CCZA 1TT2A 5DEHA 5LMUQ 1EY7A 4IFDJ 3C2PA 3S1MH 2JA8H 1Z47A 1W6JA 2F0NA 5J22A 2HD3A 2R7ZB 3A5UA 1XMQQ 2A69C 1IHZA 2PO4A 3TQYA 5H1SE 1UUPA 2B63G 4RGOS 1TR5A 2HT1A 3T56B 3KDFA 1EYAA 2KHIA 3D0FA 4GNXA 4KLKA 4IPCA 5J3BA 1LTAD 3FP9A 4GOPA 1I3QB 3NXWA 1KRSA 2HUGA 3BDLA 2PNHA 4R4TA 3FKIG 4DV7Q 4XIGS 4KD3A 2Z4HA 3U9SA 4LFAL 4BBSG 4A3JH 2N55A 2RSOA 2E5LL 3HGBA 2ZT9C 1C0AA 1PZKD 4P72A 1YIJA 3S1NB 5LHY1 2R7ZG 3K0YA 2G9HD 4LK1C 1JORA 1JCKB 1F2YA 3T16A 2F0EA 2R93H 2PW5A 4CGYB 3K7UC 1EU3A 4A3GG 1XNQL 1I5FA 3P20A 4F87A 2IT1A 5D3DA 3J81L 4I7AA 3J81i 2R7ZH 1B2TA 4OL7A 2IWHA 4IJLA 1I3QH 3KLWA 4BBSH 1IYVA 1NR4A 2A1AA 4P2CB 4DK3C 3S1RB 5M3FH 2WAQG 5FKAC 1AH9A 4OIJA 2MUYA 4O42A 5C3EH 2UXBQ 2CWAA 2EY5A 2F4VL 1QCBD 3X3NA 5LMNQ 2UU9Q 4DV3L 1JE4A 2PZTA 4CJ2C 4X3KA 4JBWA 5FLXL 1SMYC 4X66L 2BE5D 2JK8A 4DXGA 2BDOA 4OWWB 3HOUG 1LT5D 2WACA 3J81c 1E1OA 2A8VA 5K36H 2R92G 1ZYRC 3ERQA 1ZYRD 4I7ZC 1F9RA 3HOXG 4DV4Q 2NVQB 3HOVH 1LV9A 4L5SA 1VQBA 1HZCA 5IE8A 4XTCS 3OWEB 5JEAG 1GHJA 2F0VA 4CBVA 1XNRL 1SRUA 5JAVA 1C8CA 5M3FG 4JI2L 1SJED 1S5DD 2SDFA 1QUQB 3PUZA 2PQEA 2VW9A 1ASZA 5C0XH 2HHHQ 3AFPA 2YTYA 1F2MA 2EQSA 4UHVA 4GLXA 1RDPD 4IJHA 2MQHA 1PFSA 1QWYA 4K5XA 4P74A 3HRZC 3HOYG 2KBNA 2EZVA 2JJQA 3I55A 3S1RH 4ILWA 2PMZB 2EYJA 1RKNA 2EY1A 4ZCKA 5CORA 1IBLQ 1VQOA 1N8RC 4JBJA 1JOKA 3SK5A 5CYUA 2UUAQ 2KEEA 3PO3H 5IODA 4DR6L 2A68C 4JI4Q 2ZTCA 1BUVT 1IYUA 1N32Q 4IUUA 4IUNA 2A6EC 1II3A 4C3IB 1TS4A 2NTSA 4EQOA 4BY7B 2K75A 3NWSA 3MFGA 1B4OA 1QOHA 3E5SA 1I4XA 3S9WA 2O5JC 1PXUA 1DONA 1F9QA 2VQFQ 4RGMA 1PFMA 2DN8A 4LF6Q 3CD6A 5M3MH 1PYSB 5ELCA 1Y1WH 5EGTA 2UXDQ 4O2DA 4IOCA 2JA8B 3HZXA 4OO1H 3PUYA 4A3FG 1VQLA 3HOWG 3DEPA 1B3QA 1C4QA 1E2WA 2CHBD 3U9OA 4EGVA 1VQGA 4A3FH 3M4PA 5T1IA 2K05A 5FJ8G 1UE6A 1HTLD 4MZ9A 3E0EA 2PQAA 2K04A 1CTMA 2JA6B 3OMGA 2E2JH 1V43A 2PQAB 2F52A 2FINB 2R93B 1LT3D 4A3DB 2CW0D 1AE2A 2BA0A 4DV5Q 5KNBA 1R9TH 5A2QE 2F0IA 1IZ6A 4LAAA 4IUQA 5CGKA 3MVVA 2ZJQA 4ODGA 2RCFA 4S3SA 2ALYB 1SROA 3ZJYC 1ILPA 1EIGA 2X6GA 1MI2A 2JA7H 1D5MC 1J6QA 1L2FA 2KCTA 4C3HH 3HOVG 4JCVE 2ID0A 1SN8A 2HQLA 1W6KA 2UUBL 5IP7H 2B2YC 2EJGC 3MTSA 2L15A 1Y8NB 3T51B 2F1MA 4GKKQ 1EZ6A 1KD1C 2ZXRA 2HQEA 1IKLA 2JP1A 4MIUA 1PV4A 4X62L 2ASBA 1VQHA 5BN3A 3CCQA 4A3IH 1Y14B 3I2ZA 1SMXA 4QL5A 1H9RA 1G6ZA 1HPCA 2AMCB 1T5XD 5HGTA 2F0UA 2EYOA 5C3WA 4JI1L 2AWOA 1IYJB 1RF2D 1EQTA 4K6LA 1I6VC 5LMUL 2HCCA 2D0PA 1SFOB 1VQDA 1PMRA 1B9NA 5G3LD 1STBA 2F0FA 2KCCA 1SE2A 4DR3Q 3I4LA 3OTOL 4HJAA 1RIPA 3M7GA 2X6LA 2RDFA 4R4CA 1BR9A 2Z6BA 5G3LF 4DUYQ 3K6OA 1N33L 1GUGA 4HCSA 1CKNB 2NYZD 3RNUA 3K57A 1TKWB 5K5PA 3JAME 5EPLA 2LXJA 2YYZA 1CT1D 3KLSA 1WTWA 1GVPA 1VF5C 2F0WA 2E5LQ 3NHHA 1ENFA 3A8JE 2VUMG 1KXLA 3F1ZA 1QVCA 2AHOB 2Q8IB 3SXHA 1KNEA 1B70B 5HURA 1G6PA 4QY7A 1NMGA 2RDHA 4WJ4A 4HJ9A 2OQKA 1YEZA 3PQIA 2B2WC 4XQNA 1PVOA 1WTPA 1K8GA 1W2BA 4EQNA 4MN3A 3J80E 5KYIA 1TWCB 1NBWA 3H91A 3TZUA 1CKNA 1BCPB 4EX5A 1PA6A 1ENAA 2D2CC 2JA9A 5IGGA 1UEAB 3L3OC 3RZOH 1N34L 2NB0A 1TU2B 5EQ0A 3D6WA 3KJOA 1PH5A 4HN7A 4HSVA 1BBXC 1EL0A 3OHXC 5GAEC 2F03A 3ULLA 3DM1A 4OXPA 5E4XA 3H15A 3GTGB 2F3IA 3BZCA 4OX9Q 2E2HH 1MSHA 4LF9Q 2AUKA 2V4DA 2WKDA 4ZLTF 1JE5A 4JBMA 4X62Q 1A63A 1HZBA 2E75C 1H9MA 4XYQA 3CCEA 5C6AA 1AEXA 1RODA 3CXCA 1H9KA 3DM3A 2NTTA 1Q1EA 2JYOA 1UNSA 1BCPC 3EQLC 1KQSA 3K0XA 2QILA 3RLOA 1OXVA 1Q81C 4QUCA 1Q8KA 4EVOA 3A5ZB 4TKOB 2LY7A 2WB1B 4RA8A 1OTCA 4KI0A 1FGUA 3Q22A 3HOZG 3PF5A 4CDEC 4ZKCB 4KMUC 2IPKD 4DF7A 4OIKA 1PYBA 2H1EA 3CCUA 4B3SL 2E74C 3CU7A 3NTIA 3CCLA 3GTJH 3KF8B 4R4OA 1JOOA 2HHHL 3S2DH 3I4MH 1J5EQ 1TQOA 5M5XH 2CW0C 5IGFA 1A2UA 3K5NA 3MHBA 2B2VC 4QGUA 1I4PA 5CBAE 2ICEC 3K80C 1A3VA 1KAWA 3FPPA 1K83H 3NE5B 1V8QA 2MO1A 2RDGA 2KENA 1HNZQ 2K14A 2DJFC 4BY1G 3L7ZC 2QA4A 4XT3B 2I07B 4JOIA 3J80c 4GN4B 1N34Q 1HH2P 5HY6A 1QG7A 4IURA 1AZQA 4KY6A 1XTCD 1Z6HA 2JN4A 3TP7A 1JJGA 4FP5D 4QCLA 4A3DH 5FLXE 1XJVA 2BOSA 1N32L 1T5EA 5F2DA 1G2SA 3NENA 3UDGA 5C4ZA 4IZ8A 3OW7A 1NUCA 1LM0A 1Y69U 4TRDA 4N8FA 4ULLA 4BXXH 1SYFA 2Z4IA 5C3EB 4LF6L 2Y0SB 3TP8A 1K0SA 3TMEA 1SNCA 2Q2HA 5IIFA 1ONLA 4A3IG 2F0MA 4PG3A 1M90C 1EYGA 2B2UA 2E2HB 1IBKL 5DAUA 4TVAB 2H5XA 3SE0A 4M8AA 1BVSA 2DNCA 1U9RA 1CSPA 4QIWB 2N8NA 3NQTA 4JBKA 1V1OA 2K1BA 1SDFA 1QUQA 1G51A 2JE6I 2BCOA 1PTOH 4LJZC 2Z1CA 2J4XA 4YCWA 3J7AF 1S3OA 4C1NK 1YNJC 4RAUC 1SXTA 3G48A 5ELNA 1YVCA 4BWGB 3LWEA 4GZYC 3K5LA 1PYWD 4GNXB 1EWHA 1DOMA 4V190 4DUZQ 4A4IA 3A55A 3RN2A 1FJGL 1U4MA 4X64Q 3STBD 1QE6A 3S24A 1HXYD 5FO7B 4KY7A 3ND8A 1P8LA 3CRLC 1TIID 2JXMB 1KL9A 5A2QL 2E2IH 3S16H 1FNVA 5IYDH 5JPMC 3GTLB 4R4IA 1AW7A 4PZ8A 1HR0L 4PMCA 5LL6X 2LS01 2WP8J 4A93H 1NSNS 3U4ZA 1B1ZA 5CV5A 3H09A 3JAMc 3D4WA 3KK7A 1NE3A 3T4AC 4DAVA 4RKLA 2RKSA 4IUPA 5LMNW 4EQPA 1K8MA 1CZWA 4KJOA 3I4OA 5J39A 1SSOA 1R9TB 5M3FB 3T1HQ 1YHAA 3KF8A 3HOZB 2WB1G 3H94A 2JEAI 4DR3L 1Q3LA 1DCZA 4FO2A 4UAIA 1OXUA 1GUOA 2Z9HA 3QIAA 4N9TA 1VQ7A 1EFWA 3G6EA 2PW7A 5IYBH 4KY5A 3VYRA 3MEFA 1DJRD 1O7IA 1VQ6A 2Y0SE 2VQEL 4JV5Q 1DZ1A 2AQ2B 1MIUA 2VUMH 1K73C 3R2TA 1LYLA 2KUMA 2M9VA 1VQ4A 4JW0A 1K8AC 1SNOA 1IW7D 4LWCA 3GTLH 1X56A 5AFWA 1HR0W 4CJ1B 1X3QA 1XTDA 3IFDA 2Z6KC 3SK4A 3FKIH 2MHVA 3T1YQ 4RCNA 3SK6A 1D8LA 3DWQA 3EIVA 4AIMA 3MXNB 2AKWB 5BN4A 1I50B 4FVMA 5IYDG 1GO3E 3MC0B 5AJ3L 4A93B 1LTID 2RBMA 4B9WA 1XWEA 2DJGC 2R3ZA 4QMGA 1RTNA 1KNAA 3O13A 2R92H 5A35A 2F3VA 4IPHA 3S14H 2VS1A 3M4QA 4QUFA 4C3JG 1I4GA 4DR2L 3IRBA 2NN6H 3PUWA 2K52A 2BDNA 2P5ZX 2A6ED 3GV6A 4OWTB 4XQQA 4YWMA 3K5MA 3G71A 1I4QA 3GP7A 5TSSA 2A69D 1E0BA 1TVXA 5I9PA 4YHHQ 2F4VQ 3CKIB 3GV3A 1SR3A 1DYQA 2Q2IA 1Y8PB 2BH8A 2IX1A 3LWUA 2QW7A 2B2WA 4RGTA 3KLSX 4A76A 2XGTA 2F0LA 4L8JA 2KECA 3ND9A 4YCVA 5C5MA 4GKJQ 4LMQD 2RHQB 3NBHB 2K50A 4M1UB 5DNFA 4APVA 5JVH3 3VR5A 4FF2A 3FKIB 3TBIB 4O0AA 5M9OA 3GD7A 1XYIA 3URYA 3CQZH 4WORA 3E3XA 2QDLA 1TS5A 2G9DA 1FR3A 5IGBA 4OGQC 1CKMA 2A6HC 2L12A 4DAMA 1PRTF 1X32A 1XPRA 1B8AA 4K0KQ 3EA6A 2Q8RE 3S14B 4LW1A 1IBMQ 1KDAA 4OELB 3NEMA 3OWFA 1ESRA 5JOBA 4K2KA 1VCIA 3BYYB 1U5KA 4KTAA 4BBRH 3OIPA 4RMFA 3Q24A 1KDBA 3I56A 4UP9A 1TWHH 4HEDA 4FF4A 1CSQA 4B9XA 4A93G 3CCRA 3AYHB 4ZUJA 1UE1A 3M4OB 4X6AH 3J80L 1WTQA 1K9MC 4DR4L 4CDCC 2VQEQ 1YNNC 2NVXB 2UXCL 2PCFB 3MXPA 3D8GA 1HR0Q 3TRZA 2LFNA 1Q90A 3KJPA 1BNZA 4CKCA 1Z9FA 3VR4A 3H3VH 1HNXQ 1BKBA 3L9AX 4IUVA 1HRJA 3UE0A 1IW7C 5IYBG 4P71A 2ZTEA 2CQAA 1M8AA 3PO3G 2O2LD 4GKJL 4DN4M 5AJ3Q 1XPUA 3EN2A 2FXQA 1EU4A 2NVYH 1GM5A 3OPOA 1BDOA 4DNTB 3AEVA 2SEBD 2F0JA 3X3MA 3VYUA 2CH4W 1L1OB 3PIOA 1PZJD 2GVAA 4J15A 4XT1B 4LF5L 2VXWA 2FFKB 1GXDC 3TS0A 3S1MB 1H9SA 2NUCA 3KYHC 1EWIA 2ZM6Q 3E0JA 4UP7A 1RHPA 2KVMA 5KNDA 4DGZA 2WV6D 3NUCA 1KLUD 4DV6Q 1DOLA 1Q82C 1TWHB 1XMQL 1OO9B 1J8IA 4DV2L 4LFBQ 4DPGA 1YITA 1H95A 2JA5B 3G6JB 4P75A 1WD1A 3D4RA 3QO2A 2KEDA 3HKZB 4DR1L 2NN6G 1LUZA 4FXDA 3GQBA 1EFID 1D6EC 5KYLA 4HIKA 3PO3B 2OTJA 4JC0A 4JG2A 1S5CD 1S72A 1ICFB 2F4IA 1Y1WB 2MGSA 1B44D 3T13A 4KJNA 2NZOA 4XYOA 4LUZA 3VA7A 3NSWA 1XX8A 1XMOQ 2JA5G 2EYPA 1E2ZA 1YI2A 3HEJA 1FGBD 2L5TA 4CJ0B 1F9PA 3K5OA 4RHSA 3BVMA 3RR5A 5D65A 3I4MG 4EQ5A 1G291 2JA6G 2K5VA 3E9IA 1MKHA 2JQOA 4OONA 3UI2A 3TP5A 1O7YA 3BZKA 3J7A5 1AZPA 4K6DA 2QKIC 1PDQA 3M4YA 4F88A 4A3IB 4KKSA 2JSOA 3GTGH 1SMYD 2MJ8A 1A15A 4X64L 2EJFC 2WKCA 2XN9C 1WTHA 1PH7A 1SBBB 2HIXA 1PH9A 2Q2UA 3BYTB 2B3GA 5CV7A 4CHTB 2I5MX 3OYYA 4J8QA 2VY3A 3QJYA 1I6HB 4KK7A 4DK0A 4BY7G 1PRTC 1E1TA 4QQBX 1KIXA 2D0OA 1B53A 3MXNA 4WJWA 3J7AV 1EYDA 4DR1Q 3F2CA 3MFYA 4QF4A 2K5WA 4KN7C 1AE3A 1P16A 1JB3A 3T1YL 4C3JH 3RZDH 3DMUA 4BY1B 1X65A 3TEHB 2NVTB 1F77A 2O5IC 3A56A 2A19A 3A7AB 1GJXA 1MGSA 1CQVA 1R4QB 2WAQB 3CQZB 5I2YA 2C35B 1NNXA 1ICWA 1EY0A 1DD2A 3GTOH 1MJEA 2B2VA 3DHQA 2WIIB 4R1JA 4E6IA 3J80i 3PUVA 3I91A 4DV7L 2K03A 5NUCA 4HSPA 1U4RA 4POFA 3V96A 4ZUIA 4Z9CB 1R4PB 2MP1A 1K83B 5IWAL 3HOZH 2CFMA 4G7OC 3R2IA 1O7LA 4YHHL 4DV1Q 1S5FD 1FD7D 5JJIA 2FMCA 5M3MB 1LT4D 2A74C 2EXDA 1WCMG 4K14A 3SHLA 1IKMA 3QR8A 2EYMA 1UEBA 3QB3A 1QILA 1HFGA 1LTSD 1F2ZA 1LTBD 3ITPA 1HNZL 2IX0A 2F0PA 4GKKL 3FPUB 2XWJB 3TSSA 1BQQT 3E9HA 3RZDB 4JYAL 1KHIA 1PH8A 2WAQE 2JA6H 5JEAH 5KGUA 1CA5A 2EYLA
chains in the Genus database with same CATH topology
2J0TD 3I8ZA 5CC4A 4R9WA 4G57A 2NVYB 1E2VA 3V2TA 5I6WA 1D5ZC 5E3FA 2A6HD 4I65A 4K2LA 1YNJD 4H7BA 1DM0B 2QCPX 2L11A 4DAYA 5DM73 4X3TA 3Q0AA 1CM9A 3BVGA 2IL8A 1D1IA 5EKKA 2K5DA 1J9OA 2EDGA 1TWAB 2L1BA 3PIO3 4G4KA 2B39A 1SYGA 1WTVA 1V1PA 1Q1BA 1ILQA 4A3EB 2A5HA 5CV8A 1EZ8A 1SEBD 3GTJB 3S2DB 3MXGA 1STEA 1G2TA 2YU9B 4OO1I 5JPNC 3NPPA 2B2TA 2L0CA 2B2YA 3D31A 2KHSA 3OIQA 1F2LA 1S4ZA 2EYHA 1CHQD 4HR7B 2B63B 4KHZA 2KJXA 3DXJC 1MBYA 5E4WC 5COYA 4JK1C 2F0TA 2VB2X 4N9PA 4FXKC 5D3IB 1HUMA 5M5YB 2PPBC 3I4MB 1TS3A 1ZXTA 4HCEA 3KBGA 1OXXK 5ELBA 4WRDA 3LX0A 3K58A 2L9HA 3HOWB 3MEHA 4A3FB 2OF1A 1O78A 3RUZA 3BDCA 3EJIA 3OSOA 4DAPA 2PNRC 4ZKBB 2A68D 2IW3A 3D6CA 3C46A 3RMHA 2OEOA 5CV6A 2F0SA 1STNA 3ONAB 5EJWA 4WFN3 3VR3A 1IL8A 4DK1A 4HTHA 1O80A 4X3SA 5ISRA 1Q12A 2DNEA 1EY5A 4A3KB 3HOYB 5FOBB 2BE5C 2EOTA 3WOFA 2B8GA 4J1MA 1CHPD 3ZYYX 4K8IA 1XXGA 4ZQ3A 1Z7TA 1STYA 2R6GA 3QG1A 5CV9A 5JVG3 4KKTA 1TS2A 1X3PA 4Q0FA 4XXEA 3GTQB 1LACA 3E6ZX 4OO1G 2LKVA 4Q5VA 2RQXA 3DUZA 1BCPF 3A54A 1JC7A 3FEWX 3QOLA 1WTRA 1A3TA 1UAPA 4FXGC 1ESFA 4RGNA 3BZDB 2M00A 1SE3A 1Q8IA 2N88A 2K33A 2HDMA 1SNPA 2XVSA 1SE4A 1MSGA 2BA1A 1FNUA 3SDZA 3KLRA 1CZGA 3Q6SA 3R8BA 4XDXA 3EVQA 3AMUA 1OXTA 4NW2A 1QNKA 2C9OA 2K5QA 5C0XI 4ID6A 1VF7A 1SNMA 3H3VC 1KLGD 1PZID 3HOUB 2NBFA 5IOCA 1LTRD 1WVLA 1ET6A 3T53B 2AQ1B 1QB5D 3NK9A 4J6HA 5IT9E 2JEBI 1HTPA 2VUMB 1EYCA 5C0XJ 3PO2B 1VDZA 3N6RA 4MHEA 3PV0A 1VMCA 4K5WA 2MPMA 4HAEA 5M5WB 1L0XB 3GO5A 1CK1A 3I3CA 5EKLA 3MZ5A 1TWFB 2F3WA 1CA6A 3C3LA 4C1NI 3M85A 2ICIA 1BCPD 4HMIA 4C3JB 1V1PB 2PZWA 2ZXOA 2SNMA 2R93B 3HS0C 4NKLA 3SK8A 3RZOB 5FO9B 1AN8A 5ELDA 3TZDA 3D3RA 3J81E 2L55A 5KRUA 2B8FA 5C0XG 2FMMA 3A8IE 3IKJA 3S2HB 4RH6A 1GUWA 4BBSB 4IQZA 5I4DA 1ZKOA 1HQRD 4H13C 4U68A 4DFAA 2QEJC 4OHJA 1JR0D 1HUNA 4A3BB 1BOSA 1LTTD 1U4PA 2SOBA 1RD9D 2D9UA 1RTOA 2FJ2A 1KTKA 1G91A 1STGA 3SVMA 1PFNA 4PMBA 1DOKA 5KNCA 5K36G 2F0QA 3FVQA 3DWAA 2O4XA 4BBRB 3CRKC 3LNNA 3NTHA 2KCNA 2SNSA 2DY7A 2M2LA 3TP6A 1LABA 1D2BA 2F0KA 5M5XB 1HHVA 3K59A 1I4HA 1EY8A 3A8KE 1ENCA 5IGEA 2H4OA 5DM63 2E2DC 4DXFA 2XIWA 3I90A 2IJ0A 1EEFD 4C3IG 4A3MB 3WDNA 2F0HA 4PQXA 4IN3A 4ABNA 5I9OA 3GTMB 2OT2A 2EE1A 4DNRB 4RKBA 3GTOB 1YNND 1EY4A 4ZRZA 1HA5A 4ME5A 4RCOA 1AFPA 4PNYA 3PIP3 3P75A 1CFMA 1EQVA 1H9SB 2F0GA 3G7LA 3VYSA 3JAML 1L0YB 3MWYW 2VB3X 2L4NA 5C4HA 4AYBB 1GHKA 1CQFA 1PTOF 2EPBA 5IGCA 4NMZA 4R8IA 1LTGD 4H0LC 1LT6D 3KUPA 1ML0D 5FO8B 3GTKB 4U673 3GTPB 2B2TC 5CR3A 3W3AA 4RWSC 4K8JA 4FNFA 5E1FA 2JA7B 3FRPB 1JQYD 4Y7NB 3SR1A 5T1GA 1PTOD 2EYFA 1FYCA 1EWCA 3RLFA 4O1NA 3NP8A 1B3AA 3A7LA 3BS1A 1F9SA 2HCIA 4NP5A 4DU9A 5CMDA 1JWSD 1I4RA 1OXSC 1GOZA 3N52A 3RD4A 1H9JA 2FHTA 4CKEA 1A3UA 2XSCA 4DA2A 2TSSA 3MA2B 2Z8LA 3NTKA 3KBXA 1D5XC 1Y1VB 1EEID 3C1FA 1SYDA 1SYCA 1A2TA 3S1QB 1KAAA 2AQ3B 4IALA 1K8OA 1EOTA 5EBDA 1VMPA 5J1ZA 1HCZA 2PZUA 1BF4A 5FK9C 3R93A 3EROA 1SAPA 1CI3M 2K6AA 2D62A 3CHBD 5CBEE 1PRTB 2E76C 1JICA 1EY9A 1G8ZD 4A3JB 3IAYA 3J7YW 4L6TB 4RFBA 5IT9L 1NR2A 4C56C 2AUJD 2EJMA 2TMPA 1PFBA 3S15B 4TSSA 4FF3A 4UDUC 3NBIA 5JEAJ 2NWGA 4HMJA 2Q8TA 2CVRA 2XRQD 1WTOA 1EIHA 5I2XA 5BN5A 1STAA 1TY0A 4C3HB 1BO0A 3TDQA 4F7XA 4ZK9B 2XNAC 5EPKA 3AB9A 3FDTA 3D4DA 1GUNA 1NAPA 1HQMC 1ZEQX 1SNDA 4KHVA 1SYEA 2D5DA 5IGDA 1ET9A 3R3OA 1HFNA 5EKIA 2DY8A 1U4LA 3M3YB 5C4JB 4BS9A 3DEOA 4C2MB 1RCVD 2EVBA 1KDCA 1AP0A 2A73B 3V05A 3P1HA 5C3XA 2C5CA 2GA4B 3K7AB 3W2DA 1WCMB 4K5VA 4G7HC 3S17B 2F0OA 3I70A 2HDLA 5ELEA 5ELFA 4KV6A 3MAQA 2QF7A 4F8MA 1S5BD 2B2UC 1PTOC 3WOEA 2E2IB 2EY2A 2XWBB 3HG9A 3VYTA 2NN6I 2R61A 1LLRD 3M7NA 1JOQA 1C48A 1JWUD 4ZYSA 1M4VA 1PRTD 2K7VA 3I72A 3HOVB 2EXZA 1EY6A 4IFDH 5EPJA 4IUTA 1A6XA 1DXMA 1RJTA 1PLFA 3BG3A 5KEEA 1O7ZA 2RA4A 1FNWA 1HA6A 3H6MA 4L63B 1B9MA 4KN4C 1GUSA 4QB4A 2OXPA 1TWGB 5KIXA 4KKUA 2RSNA 4XQJA 3PUXA 2WINB 1LO5D 3PMFA 3EFXD 1S5ED 4RHRA 2KOLA 5CV4A 2QDBA 3F2UA 5LL6S 2NZ1D 1MD2D 3NQIA 3NBHA 5C5LA 4PV1C 1WD0A 4NDXA 3QOJA 4KD4A 1SNQA 3HP3A 1GUTA 3I4NB 2K28A 2VNUD 4FF1A 3TN2A 2IX3A 5I6YA 4BA1I 4IFDI 3S16B 5C44B 4G7ZC 2LMCB 4BA2I 3P7JA 3FMCA 1PTOB 1QNUA 3NWTA 1Y8OB 2J7ZA 4YIJA 1QJOA 2K01A 3OOCA 3H0GB 4CKBA 3Q23A 1SYBA 2AWNA 3QWNA 3IFTA 3HOXB 5EBCA 3VR2A 3BVZA 2R92B 4R8NA 1B50A 5D14A 1WTXA 3MXUA 2EY6A 1JWMD 2KA7A 3BDOA 4V0BA 2I46A 4PMWA 4IFDG 3SEBA 3I73A 4TQUS 3OMCA 1BXTA 3C1EA 1NCVA 4B08A 4H44C 1KABA 4X3UA 2X69A 2ZXPA 2RVLA 3IL8A 3DWPA 5JJZA 5C4XB 4ZAIA 2PYKA 3VR6A 2K32A 1D1KA 2KQ3A 2E2JB 1SJHD 4C3HG 2F0DA 2XRSD 4FYDA 3VA5A 4A3GB 1STHA 2ENBA 1TY2A 3AU7A 1TT2A 5DEHA 1EY7A 4IFDJ 3C2PA 1Z47A 1W6JA 2F0NA 5J22A 2R7ZB 2A69C 1IHZA 2PO4A 1UUPA 4RGOS 1TR5A 3T56B 1EYAA 1LTAD 1I3QB 3BDLA 3NXWA 2HUGA 4XIGS 4KD3A 2Z4HA 3U9SA 2N55A 2RSOA 3HGBA 2ZT9C 1PZKD 3S1NB 5LHY1 3K0YA 2G9HD 4LK1C 1JORA 1JCKB 1F2YA 3T16A 2F0EA 2PW5A 4CGYB 1EU3A 4F87A 3P20A 2IT1A 5D3DA 3J81L 1B2TA 4OL7A 2IWHA 1IYVA 1NR4A 4P2CB 3S1RB 5FKAC 4OIJA 2MUYA 4O42A 2EY5A 1QCBD 3X3NA 1JE4A 2PZTA 4CJ2C 4X3KA 4JBWA 5FLXL 1SMYC 2BE5D 4DXGA 2BDOA 1LT5D 2WACA 5K36H 1ZYRC 3ERQA 1ZYRD 4I7ZC 1F9RA 2NVQB 1LV9A 4XTCS 3OWEB 5JEAG 1GHJA 2F0VA 4CBVA 5JAVA 1C8CA 1SJED 1S5DD 2SDFA 3PUZA 2PQEA 5C0XH 1F2MA 1RDPD 1QWYA 4K5XA 3HRZC 2EZVA 4ILWA 2PMZB 2EYJA 1RKNA 2EY1A 5CORA 1JOKA 3SK5A 5CYUA 2KEEA 5IODA 2A68C 1BUVT 1IYUA 4IUUA 4IUNA 2A6EC 1II3A 4C3IB 1TS4A 2NTSA 4EQOA 4BY7B 3NWSA 3MFGA 1B4OA 1QOHA 3E5SA 1I4XA 3S9WA 2O5JC 1PXUA 1DONA 1F9QA 4RGMA 1PFMA 2DN8A 5ELCA 5EGTA 2JA8B 3HZXA 4OO1H 3PUYA 3DEPA 1C4QA 1E2WA 2CHBD 3U9OA 4EGVA 5T1IA 2K05A 1HTLD 2K04A 1CTMA 2JA6B 3OMGA 1V43A 2FINB 1LT3D 4A3DB 2CW0D 2BA0A 5KNBA 5A2QE 2F0IA 4LAAA 4IUQA 5CGKA 3MVVA 4ODGA 4S3SA 1ILPA 1EIGA 2X6GA 1MI2A 1D5MC 2ID0A 1W6KA 2B2YC 2EJGC 3MTSA 1Y8NB 3T51B 2F1MA 1EZ6A 2ZXRA 2HQEA 1IKLA 2JP1A 4MIUA 5BN3A 1H9RA 1G6ZA 1HPCA 1T5XD 5HGTA 2F0UA 2EYOA 5C3WA 2AWOA 1RF2D 1EQTA 4K6LA 1I6VC 2HCCA 1SFOB 1PMRA 1B9NA 5G3LD 1STBA 2F0FA 2KCCA 1SE2A 3I4LA 3M7GA 2X6LA 2RDFA 1BR9A 5G3LF 3K6OA 1GUGA 4HCSA 2NYZD 3K57A 1TKWB 5K5PA 3JAME 5EPLA 2YYZA 1CT1D 3KLSA 1WTWA 1VF5C 2F0WA 3NHHA 1ENFA 3A8JE 2Q8IB 3SXHA 1KNEA 5HURA 2RDHA 2B2WC 4XQNA 1WTPA 4EQNA 4MN3A 3J80E 5KYIA 1TWCB 3H91A 3TZUA 1BCPB 1ENAA 2D2CC 5IGGA 1UEAB 3L3OC 2NB0A 1TU2B 5EQ0A 3D6WA 4HN7A 4HSVA 1BBXC 1EL0A 3OHXC 2F03A 3DM1A 5E4XA 3GTGB 1MSHA 2AUKA 2V4DA 2WKDA 4ZLTF 2E75C 1H9MA 4XYQA 5C6AA 1AEXA 1RODA 1H9KA 2NTTA 1Q1EA 2JYOA 1UNSA 1BCPC 3EQLC 2QILA 1OXVA 4QUCA 4EVOA 4TKOB 2LY7A 2WB1B 4RA8A 4KI0A 3Q22A 4ZKCB 4KMUC 4DF7A 2IPKD 4OIKA 2H1EA 2E74C 3CU7A 3NTIA 1JOOA 1TQOA 2CW0C 5IGFA 1A2UA 3K5NA 3MHBA 2B2VC 1I4PA 5CBAE 2ICEC 1A3VA 3FPPA 3NE5B 1V8QA 2RDGA 3L7ZC 4XT3B 2I07B 1QG7A 4IURA 1AZQA 4KY6A 1XTCD 1Z6HA 3TP7A 4FP5D 4QCLA 5FLXE 2BOSA 1T5EA 5F2DA 1G2SA 5C4ZA 4IZ8A 3OW7A 1NUCA 1Y69U 4TRDA 4ULLA 1SYFA 2Z4IA 5C3EB 2Y0SB 3TP8A 3TMEA 1SNCA 5IIFA 1ONLA 2F0MA 2B2UA 2E2HB 5DAUA 3SE0A 4M8AA 2DNCA 1U9RA 4QIWB 3NQTA 1V1OA 2K1BA 1SDFA 2JE6I 2BCOA 1PTOH 4LJZC 2Z1CA 2J4XA 3J7AF 4C1NK 1YNJC 4RAUC 1SXTA 4BWGB 3LWEA 4GZYC 3K5LA 1PYWD 1EWHA 1DOMA 4V190 3A55A 1U4MA 1QE6A 1HXYD 5FO7B 4KY7A 3ND8A 3CRLC 1TIID 2JXMB 5A2QL 1FNVA 5JPMC 3GTLB 1AW7A 4PMCA 5LL6X 2LS01 2WP8J 1NSNS 1B1ZA 5CV5A 3H09A 3D4WA 3KK7A 3T4AC 4DAVA 4RKLA 2RKSA 4IUPA 4EQPA 1K8MA 1CZWA 4KJOA 5J39A 1SSOA 1R9TB 5M3FB 3KF8A 3HOZB 3H94A 2JEAI 1Q3LA 1DCZA 4FO2A 4UAIA 1OXUA 1GUOA 3QIAA 4N9TA 2PW7A 4KY5A 3VYRA 1DJRD 1DZ1A 2AQ2B 3R2TA 2KUMA 2M9VA 1SNOA 1IW7D 5AFWA 4CJ1B 1X3QA 3IFDA 3SK4A 2MHVA 4RCNA 3SK6A 3DWQA 5BN4A 1I50B 4FVMA 3MC0B 4A93B 1LTID 2RBMA 4B9WA 1XWEA 2R3ZA 4QMGA 1RTNA 1KNAA 3O13A 5A35A 2F3VA 4QUFA 4C3JG 1I4GA 2NN6H 3PUWA 2BDNA 2A6ED 3GV6A 4XQQA 3K5MA 1I4QA 3GP7A 5TSSA 2A69D 1E0BA 1TVXA 5I9PA 3CKIB 3GV3A 1DYQA 1Y8PB 2IX1A 3LWUA 2B2WA 4RGTA 3KLSX 4L8JA 2F0LA 2KECA 3ND9A 5C5MA 4LMQD 4M1UB 5DNFA 5JVH3 3VR5A 4FF2A 3FKIB 3TBIB 5M9OA 3GD7A 1XYIA 3URYA 4WORA 1TS5A 2G9DA 1FR3A 5IGBA 4OGQC 2A6HC 2L12A 1PRTF 1X32A 3EA6A 2Q8RE 3S14B 1KDAA 3OWFA 1ESRA 5JOBA 4K2KA 1VCIA 3BYYB 4KTAA 3OIPA 3Q24A 1KDBA 4HEDA 4FF4A 4B9XA 4ZUJA 3M4OB 3J80L 1WTQA 1YNNC 2NVXB 2PCFB 3MXPA 3D8GA 2LFNA 1Q90A 1BNZA 4CKCA 3VR4A 3L9AX 4IUVA 1HRJA 1IW7C 2CQAA 1M8AA 2O2LD 4DN4M 1EU4A 3OPOA 1BDOA 4DNTB 2SEBD 2F0JA 3X3MA 3VYUA 1PZJD 4XT1B 2VXWA 2FFKB 1GXDC 3S1MB 1H9SA 2NUCA 3E0JA 1RHPA 2KVMA 5KNDA 4DGZA 2WV6D 3NUCA 1KLUD 1DOLA 1TWHB 1OO9B 1J8IA 2JA5B 3G6JB 1WD1A 3D4RA 3QO2A 2KEDA 3HKZB 2NN6G 4FXDA 3GQBA 1EFID 1D6EC 5KYLA 3PO3B 1S5CD 2F4IA 1Y1WB 2MGSA 1B44D 3T13A 4KJNA 4XYOA 3VA7A 3NSWA 1XX8A 2EYPA 1E2ZA 3HEJA 1FGBD 2L5TA 4CJ0B 1F9PA 3K5OA 4RHSA 3BVMA 5D65A 1G291 3UI2A 3TP5A 1O7YA 1AZPA 4K6DA 2QKIC 1PDQA 3M4YA 4F88A 4A3IB 4KKSA 2JSOA 1SMYD 2MJ8A 1A15A 2EJFC 2WKCA 2XN9C 1SBBB 3BYTB 5CV7A 4CHTB 4J8QA 3QJYA 1I6HB 4KK7A 4DK0A 1PRTC 1B53A 3J7AV 4WJWA 3MXNA 1EYDA 3MFYA 4QF4A 2K5WA 4KN7C 1JB3A 3DMUA 4BY1B 2NVTB 1F77A 2O5IC 3A56A 3A7AB 1GJXA 1MGSA 1CQVA 1R4QB 2WAQB 3CQZB 5I2YA 1ICWA 1EY0A 1DD2A 2B2VA 3DHQA 2WIIB 4E6IA 3PUVA 3I91A 2K03A 5NUCA 4HSPA 1U4RA 3V96A 4ZUIA 4Z9CB 1R4PB 2MP1A 1K83B 4G7OC 3R2IA 1O7LA 1S5FD 1FD7D 2FMCA 5M3MB 1LT4D 2A74C 4K14A 3SHLA 1IKMA 2EYMA 3QB3A 1QILA 1HFGA 1LTSD 1F2ZA 1LTBD 3ITPA 2IX0A 2F0PA 3FPUB 2XWJB 3TSSA 1BQQT 3RZDB 5JEAH 5KGUA 1CA5A 2EYLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D8G A;  3MXP A;  4YIJ A;  3TP5 A;  5CC4 A;  2F0U A;  3NQT A;  5HGT A;  2EYO A;  4G57 A;  5C4Z A;  1EY9 A;  4K5X A;  3MEH A;  5C3W A;  2OF1 A;  3V2T A;  4K6D A;  5I6W A;  2SOB A;  4NMZ A;  5IGC A;  1SYB A;  2EXZ A;  2RBM A;  3EVQ A;  4B9W A;  2EYJ A;  5C6A A;  1RKN A;  3RUZ A;  5I9O A;  2EY1 A;  4QMG A;  3BDC A;  1EY6 A;  5E3F A;  3EJI A;  1JOR A;  1AEX A;  3OSO A;  1F2Y A;  1JOK A;  2F3V A;  3SK5 A;  2F0E A;  4I65 A;  3T16 A;  4K2L A;  4H7B A;  1STG A;  2PW5 A;  3D6C A;  5IOD A;  4R8N A;  1STB A;  2OEO A;  4PMB A;  5CV6 A;  2F0F A;  4IUN A;  5CR3 A;  4EVO A;  1II3 A;  2F0S A;  5CV7 A;  1STN A;  4ID6 A;  4EQO A;  2EY6 A;  1SNM A;  3E5S A;  2F0Q A;  3S9W A;  2RDF A;  5I9P A;  2O4X A;  2F0J A;  4HMJ A;  4K8J A;  5EKK A;  5IOC A;  5KEE A;  4HTH A;  4KY7 A;  1STA A;  3OMC A;  5E1F A;  2SNS A;  5EGT A;  4DF7 A;  5ISR A;  4OL7 A;  1EYD A;  3C1E A;  3HZX A;  3H6M A;  5K5P A;  4F7X A;  1JOO A;  4QF4 A;  1EY5 A;  1KAB A;  2NUC A;  2F0L A;  3SR1 A;  3NK9 A;  1SYG A;  1TQO A;  2OXP A;  4QB4 A;  3TP6 A;  4J6H A;  5IGF A;  1A2U A;  5CGK A;  5KIX A;  5KYL A;  3DMU A;  3MHB A;  4PMC A;  4J1M A;  3U9O A;  3D4D A;  2EYF A;  1EYC A;  5C5M A;  2F0W A;  4K8I A;  1NSN S;  4DGZ A;  3NUC A;  1A3V A;  5CV8 A;  3NHH A;  3NP8 A;  2F0K A;  1SND A;  5CV5 A;  4ZQ3 A;  4KHV A;  1EZ8 A;  1STY A;  2PYK A;  3D4W A;  3SXH A;  1SYE A;  2KQ3 A;  3PMF A;  4RKL A;  5IGD A;  3R3O A;  2EY5 A;  4K5W A;  1EY8 A;  5HUR A;  2RKS A;  1EY0 A;  5CV9 A;  4EQP A;  1ENC A;  5IGE A;  5CV4 A;  2QDB A;  3DHQ A;  3OMG A;  2F0D A;  4NP5 A;  4DU9 A;  4E6I A;  4KJO A;  5M9O A;  2PZT A;  4WOR A;  3VA5 A;  4KY6 A;  2KHS A;  5J39 A;  5NUC A;  1STH A;  5IGB A;  4ZUI A;  2ENB A;  3TP7 A;  5EKL A;  3MZ5 A;  2EYH A;  1KDC A;  5C5L A;  1TT2 A;  2F3W A;  5DEH A;  4EQN A;  2F0I A;  5KYI A;  2WAC A;  4LAA A;  1EY7 A;  2F0H A;  1A3U A;  3ERQ A;  3P1H A;  4HMI A;  4NDX A;  2PZW A;  3QOJ A;  5F2D A;  3MVV A;  2SNM A;  4KD4 A;  4RKB A;  2LKV A;  1SNQ A;  4NKL A;  4ODG A;  3SK8 A;  5C3X A;  1KDA A;  4S3S A;  1EY4 A;  1ENA A;  4K5V A;  4IZ8 A;  3OWF A;  2F0N A;  1NUC A;  4N9T A;  3C1F A;  4ME5 A;  5J22 A;  1SYD A;  5JOB A;  5IGG A;  4K14 A;  3SHL A;  2F0O A;  4TRD A;  4PNY A;  1IHZ A;  1SYC A;  2PW7 A;  3QOL A;  4K2K A;  1A2T A;  4KJN A;  1A3T A;  3T13 A;  1KAA A;  1SYF A;  2EYM A;  3QB3 A;  4KTA A;  4KY5 A;  4KV6 A;  3P75 A;  3TP8 A;  2F0T A;  5KRU A;  1KDB A;  4IAL A;  3TME A;  1SNC A;  1F2Z A;  1TR5 A;  2F0V A;  2M00 A;  5I6Y A;  5IIF A;  1EQV A;  4N9P A;  4F8M A;  5JAV A;  2F0M A;  1EYA A;  1EZ6 A;  2EYP A;  3ITP A;  4B9X A;  2F0G A;  3HEJ A;  2F0P A;  1SNO A;  2HQE A;  4MIU A;  5J1Z A;  4ZUJ A;  2PZU A;  5DAU A;  2PQE A;  2EY2 A;  3ERO A;  3BDL A;  1U9R A;  3NXW A;  1SNP A;  5C4H A;  3SK4 A;  1F2M A;  4KD3 A;  5KGU A;  4WRD A;  2EYL A;  4DFA A;  3LX0 A;  3SK6 A;  1JOQ A; 
#chains in the Genus database with same CATH topology
 2J0T D;  1FVI A;  3I8Z A;  5CC4 A;  3CC2 A;  4R9W A;  3STB C;  3ULJ A;  4G57 A;  2NVY B;  1E2V A;  3V2T A;  5I6W A;  1D5Z C;  5EAY A;  3PIP A;  5E3F A;  4LF8 Q;  3CMA A;  4LF7 Q;  5M3M G;  4B3R Q;  2A6H D;  4I65 A;  4K2L A;  1TWC H;  1YNJ D;  4H7B A;  1DM0 B;  2QCP X;  2L11 A;  4DAY A;  5DM7 3;  4X3T A;  3HOX H;  3KFU A;  4ALP A;  3Q0A A;  1CM9 A;  2OWO A;  3BVG A;  2IL8 A;  3ULP A;  1D1I A;  5EKK A;  2KCM A;  5IT9 c;  2K5D A;  1J9O A;  4CDD C;  2EDG A;  4R4Q A;  2NVQ H;  1TWA B;  2L1B A;  1YJN A;  3PIO 3;  3WWV A;  4G4K A;  5M5Y H;  2B39 A;  1SYG A;  1WTV A;  1V1P A;  1Q1B A;  1ILQ A;  3KOJ A;  5IY0 A;  4A3E B;  4DR4 Q;  2A5H A;  5CV8 A;  1EZ8 A;  1E24 A;  1SEB D;  4JI8 L;  3GTJ B;  3S2D B;  4JI2 Q;  3MXG A;  1STE A;  1G2T A;  2YU9 B;  4OO1 I;  1Y1V H;  5JPN C;  2CWP A;  1MJC A;  3NPP A;  3A74 A;  2B2T A;  2L0C A;  2B2Y A;  3D31 A;  2KHS A;  3OIQ A;  1NJI C;  4GLV B;  1F2L A;  1S4Z A;  1XPO A;  4BXX G;  2EYH A;  1CHQ D;  4HR7 B;  2B63 B;  4A3G H;  4JYA Q;  5GAH C;  4HIM A;  4KHZ A;  4DV0 Q;  3JC6 6;  2R7D A;  2KJX A;  3OTO Q;  3DXJ C;  5M5W H;  1MBY A;  1Y1V G;  4YWL A;  1VQN A;  4A3D G;  4DUY L;  5E4W C;  5COY A;  4JK1 C;  1NY4 A;  2F0T A;  5C4X H;  3CCS A;  4DKA C;  2VB2 X;  4N9P A;  4LF8 L;  4LUV A;  4FXK C;  2RF4 A;  5D3I B;  1QVF A;  2ZM6 L;  1HUM A;  5M5Y B;  2PPB C;  1TS3 A;  3I4M B;  1A0I A;  1ZXT A;  2Q2T A;  4HCE A;  3KBG A;  1OXX K;  4B3S Q;  5ELB A;  4WRD A;  3LX0 A;  3K58 A;  2L9H A;  1B7Y B;  3HOW B;  1YBY A;  3MEH A;  1SE8 A;  4A3F B;  2OF1 A;  2JA8 G;  1O78 A;  2ATW A;  3GTP H;  3RUZ A;  1Y1W G;  3S15 H;  3BDC A;  4GOP B;  1VQP A;  3EJI A;  3OSO A;  4DAP A;  2PNR C;  4ZKB B;  2ZTD A;  2A68 D;  2IW3 A;  3D6C A;  4IPG A;  3C46 A;  3RMH A;  2OEO A;  5CV6 A;  1FL0 A;  2F0S A;  1STN A;  1WYD A;  4JI7 Q;  3ONA B;  5EJW A;  4DV2 Q;  4LF7 L;  3L2P A;  4WFN 3;  3VR3 A;  1IL8 A;  4DK1 A;  4HTH A;  4C3I H;  1O80 A;  1EQR A;  4B3M Q;  4JOI C;  4X3S A;  5ISR A;  4LF9 L;  4WJ3 M;  1Q12 A;  3CP0 A;  3ERS X;  2DNE A;  3Q8D A;  1EY5 A;  4A3K B;  3HOY B;  5FOB B;  3S2H H;  2BE5 C;  4LUO A;  2EOT A;  3WOF A;  5GAG C;  2KHJ A;  2B8G A;  4J1M A;  1CHP D;  3ZYY X;  4K8I A;  3GDE A;  1XXG A;  4ZQ3 A;  1Z7T A;  3S1Q H;  1STY A;  3KDF B;  2R6G A;  1YJ9 A;  3KF6 B;  3QG1 A;  4AYB G;  3UDF A;  5CV9 A;  5C4J H;  5JJK A;  1C9O A;  1X3F A;  4OEM B;  5JVG 3;  4KKT A;  3PGZ A;  1PH4 A;  1TS2 A;  2Y0S G;  3CCJ A;  1E7Z A;  1X3P A;  1VQF A;  2WB1 E;  4Q0F A;  4GN3 B;  2DUD A;  4XXE A;  4JI3 Q;  4AYB E;  3GTQ B;  1LAC A;  3E6Z X;  4OO1 G;  2LKV A;  4Q5V A;  2RQX A;  3DUZ A;  1BCP F;  1UWV A;  3A54 A;  5BR8 L;  1JC7 A;  3FEW X;  3QOL A;  1WTR A;  1A3T A;  1UAP A;  1IXR A;  4FXG C;  1ESF A;  2GVB A;  4RGN A;  1VQ5 A;  3BZD B;  2M00 A;  1SE3 A;  2G5D A;  3PCO B;  1Q8I A;  3W5O A;  3RN5 A;  3HOY H;  2N88 A;  2K33 A;  4X66 Q;  4RG1 A;  2HDM A;  1SNP A;  2XVS A;  4LFA Q;  4JI6 L;  1JT8 A;  4GS3 A;  1SE4 A;  1MSG A;  2BA1 A;  1FNU A;  3SDZ A;  2BH2 A;  4KHP Q;  3KLR A;  2YTX A;  2UU9 L;  1CZG A;  3Q6S A;  3R8B A;  4XDX A;  1K3R A;  2R7F A;  3EVQ A;  3AMU A;  3LGJ A;  3AQQ A;  3CCM A;  4GLA C;  1K0R A;  1OXT A;  4B3R L;  2LSS A;  2I0Q A;  4NW2 A;  4NXN L;  1QNK A;  2C9O A;  2K5Q A;  5C0X I;  4ID6 A;  1XNQ Q;  1VF7 A;  1SNM A;  3H3V C;  1A62 A;  1KLG D;  2B29 A;  4DR7 L;  4YCU A;  1PZI D;  3HOU B;  2NBF A;  5IOC A;  1LTR D;  4YY3 L;  3CPW A;  2OCE A;  1WVL A;  1ET6 A;  3T53 B;  2Z6K A;  2AQ1 B;  2HIV A;  1QB5 D;  3NK9 A;  4J6H A;  5IT9 E;  1GKH A;  2JEB I;  4OWX B;  1HTP A;  2VUM B;  1EYC A;  5C0X J;  3PO2 B;  1VDZ A;  4A3B H;  3N6R A;  4B3T Q;  4MHE A;  3PV0 A;  4GNX C;  1VMC A;  4K5W A;  3H3V I;  2MPM A;  4HAE A;  2K5N A;  2YU9 H;  5M5W B;  1Q7Y C;  1L0X B;  3GO5 A;  1CK1 A;  3BJU A;  1S40 A;  3I3C A;  5EKL A;  4QIW E;  1VQ9 A;  4LNQ A;  3MZ5 A;  1TWF B;  1VQM A;  2F3W A;  2YV5 A;  5L37 A;  1HNW Q;  1CA6 A;  3C3L A;  1PH1 A;  4C1N I;  3M85 A;  2ICI A;  1BCP D;  4HMI A;  2PZW A;  1V1P B;  2ZXO A;  3U4V A;  2SNM A;  4C3J B;  3HS0 C;  4NKL A;  3SK8 A;  4DNI A;  4DV4 L;  4LF5 Q;  3RZO B;  5FO9 B;  4LF4 L;  1RL2 A;  1AN8 A;  5ELD A;  3TZD A;  4JI3 L;  3D3R A;  3J81 E;  2L55 A;  3CC7 A;  5KRU A;  2IY5 B;  2B8F A;  5C0X G;  3K8A A;  4PZ6 A;  1VQJ A;  3FHW A;  2FMM A;  3A8I E;  3IKJ A;  4A3J G;  3S2H B;  4RH6 A;  1GUW A;  2Z0S A;  4BBS B;  4IQZ A;  5I4D A;  1VQK A;  1ZKO A;  1HQR D;  4H13 C;  2UXD L;  4U68 A;  4DFA A;  4LFC Q;  4JI8 Q;  4JVZ A;  4NXM L;  1NMF A;  1A8V A;  2QEJ C;  1I94 Q;  4OHJ A;  3F2B A;  1JR0 D;  3VDY A;  4A3B B;  1HUN A;  1BOS A;  1LTT D;  1U4P A;  2N3S A;  2SOB A;  1UE5 A;  1X54 A;  5FJ8 H;  1L0W A;  4JI6 Q;  1RD9 D;  2D9U A;  1RTO A;  3K81 C;  2VZA A;  4DR6 Q;  4A3C G;  2FJ2 A;  1KTK A;  1G91 A;  1STG A;  3U50 C;  3CPF A;  3SVM A;  1E22 A;  1PFN A;  4PMB A;  1QVG A;  1DOK A;  3OW2 A;  5KNC A;  3F2D A;  1I6H H;  2F0Q A;  5K36 G;  3FVQ A;  3DWA A;  2O4X A;  1E3P A;  4BBR B;  4X65 Q;  3CRK C;  3LNN A;  3NTH A;  2KCN A;  2PI2 E;  2SNS A;  2LXK A;  5ELO A;  2DY7 A;  3PF4 A;  1QZG A;  2M2L A;  3A0J A;  4DK6 C;  4HJ8 A;  3RLN A;  3M4O H;  3TP6 A;  1LAB A;  4BY1 H;  4A3E H;  1D2B A;  1X3G A;  4IPD A;  2N49 A;  1LTL A;  2F0K A;  5M5X B;  1HHV A;  1EQQ A;  2UUB Q;  3K59 A;  5C4X G;  2V1C C;  1I4H A;  1EY8 A;  3A8K E;  1ENC A;  5IGE A;  2H4O A;  4JI1 Q;  5DM6 3;  2E2D C;  4DXF A;  3CF5 A;  2ZJP A;  2XIW A;  4JI0 Q;  3I90 A;  3GTQ H;  5GAD C;  2IJ0 A;  4DV5 L;  1EEF D;  2PMZ E;  4C3I G;  2NVT H;  4A3M B;  1Q46 A;  4DR5 L;  3WDN A;  1BBU A;  2F0H A;  4PQX A;  4IN3 A;  4ABN A;  5I9O A;  3CCV A;  2OT2 A;  3GTM B;  2EE1 A;  4K0K L;  4DNR B;  4RKB A;  3W1G A;  3UDI A;  5E7N A;  1YNN D;  1N36 Q;  3GTO B;  4IOA A;  1EY4 A;  4ZRZ A;  1HA5 A;  4ME5 A;  4RCO A;  4NXM Q;  1AFP A;  1EIF A;  3TS2 A;  4PNY A;  3PIP 3;  3K7A H;  3P75 A;  2WFW A;  1CFM A;  1EQV A;  1VQC A;  4LF4 Q;  3ICE A;  1H9S B;  2F0G A;  3G7L A;  3VYS A;  5GRO A;  3TRE A;  3UE1 A;  3JAM L;  1L0Y B;  5HGQ A;  4CDF C;  3MWY W;  2VB3 X;  2L4N A;  5C4H A;  1TXY A;  4AYB B;  4HID A;  1GHK A;  1CQF A;  1V1Q A;  1PTO F;  4YWK A;  3B6Y A;  4KHP L;  3HOW H;  5IP9 H;  5C44 G;  3PO2 H;  1D7Q A;  2EPB A;  5IGC A;  5C3E G;  4NMZ A;  1VQI A;  2MNA A;  4R8I A;  1LTG D;  4H0L C;  1SLJ A;  4LFC L;  4MTK A;  1X9N A;  1LT6 D;  3KUP A;  2DGY A;  1ML0 D;  1YHB A;  2YTV A;  1HJP A;  2N78 A;  5FO8 B;  3AFQ A;  2JA7 G;  3GTK B;  4U67 3;  3GTP B;  2B2T C;  5CR3 A;  1IL2 A;  3W3A A;  4RWS C;  3T1H L;  4K8J A;  4FNF A;  1WJJ A;  3HKZ E;  4A3M G;  5E1F A;  1YNX A;  2JA7 B;  1WOC A;  2E8G A;  3FRP B;  4JI0 L;  1JQY D;  2NZH A;  3L0O A;  4Y7N B;  1IBL L;  3SR1 A;  5T1G A;  4UP8 A;  1PH3 A;  1JJC B;  1PTO D;  2EYF A;  1FYC A;  1EWC A;  3RLF A;  4O1N A;  3NP8 A;  1B3A A;  3A7L A;  1XNR Q;  3BS1 A;  1BBW A;  1F9S A;  3UDX A;  2VQF L;  4P73 A;  1EUJ A;  2UUC L;  2HCI A;  2I5L X;  4NP5 A;  4NPS A;  4DU9 A;  4L5T A;  1JWS D;  1I4R A;  1HZA A;  1OXS C;  5CMD A;  1GOZ A;  1KRT A;  3N52 A;  2IHF A;  1EOV A;  2K5H A;  3RD4 A;  4JI5 L;  5JJL A;  1H9J A;  4DR7 Q;  2FHT A;  4CKE A;  1A3U A;  2XSC A;  4DA2 A;  3M3Y H;  2TSS A;  4NXN Q;  3CME A;  3MA2 B;  4POG A;  2Z8L A;  3NTK A;  3KBX A;  1D5X C;  1Y1V B;  1YZ6 A;  1EEI D;  3C1F A;  1SYD A;  4ME3 A;  1SYC A;  1A2T A;  2EIF A;  3NEL A;  3S1Q B;  1KAA A;  2AQ3 B;  4H02 A;  4YY3 Q;  4AQY L;  4IAL A;  1K8O A;  1EOT A;  5EBD A;  4L5Q A;  1VMP A;  1J5E L;  1PHJ A;  5J1Z A;  1HCZ A;  2PZU A;  1BF4 A;  5FK9 C;  3R93 A;  3ERO A;  1SAP A;  1CI3 M;  2K6A A;  2D62 A;  3CHB D;  1SFO H;  1I50 H;  5CBE E;  1PRT B;  2E76 C;  3EBE A;  1JIC A;  4BY7 H;  1EY9 A;  1G8Z D;  5FLM H;  4A3J B;  5IYC H;  4DAY B;  3IAY A;  3J7Y W;  4L6T B;  1EIY B;  4RFB A;  1JJ2 A;  1HNW L;  4MTN A;  4A3L H;  1NR2 A;  5IT9 L;  4C56 C;  2AUJ D;  2ZJR A;  5DLQ E;  2EJM A;  2QGQ A;  2TMP A;  1PFB A;  3S15 B;  4TSS A;  4FF3 A;  4UDU C;  1GD7 A;  3NBI A;  1VS0 A;  5JEA J;  3CAM A;  2NWG A;  3H0G H;  5IYC G;  4LFB L;  4HMJ A;  2Q8T A;  2CVR A;  2XRQ D;  2CKZ B;  5IWA Q;  5I2X A;  1WTO A;  3G4S A;  4OX9 L;  1EIH A;  5BN5 A;  1STA A;  1TY0 A;  4C3H B;  2RHS B;  1N36 L;  1BO0 A;  3S17 H;  3TDQ A;  4F7X A;  4ZK9 B;  4B3T L;  2XNA C;  5IP9 G;  5C44 H;  5EPK A;  4Y52 H;  1HZ9 A;  3AB9 A;  3FDT A;  1CUK A;  3D4D A;  1QZH A;  1GUN A;  1T9H A;  1NAP A;  1HQM C;  3JAM i;  1ZEQ X;  1TWG H;  1SND A;  1Q86 C;  4A3B G;  4KHV A;  3PO2 G;  1SYE A;  2D5D A;  1KC8 C;  5IGD A;  1YHQ A;  1ET9 A;  3R3O A;  4DUZ L;  4UY8 C;  1HFN A;  5EKI A;  2DY8 A;  1U4L A;  3M3Y B;  5C4J B;  3BU2 A;  4BS9 A;  3DEO A;  4C2M B;  3KF6 A;  1RCV D;  2EVB A;  1KDC A;  3J7Z C;  1AP0 A;  2A73 B;  3V05 A;  3P1H A;  5C3X A;  2C5C A;  2GA4 B;  3K7A B;  3W2D A;  2CH4 A;  5IP7 G;  1WCM B;  4K5V A;  2MO0 A;  1K3B C;  4G7H C;  3S17 B;  4JI5 Q;  2F0O A;  5FLX c;  3I70 A;  2HDL A;  5ELE A;  3CC4 A;  3H0G G;  2R93 G;  5ELF A;  4KV6 A;  1L1O A;  4DV3 Q;  3MAQ A;  2ES2 A;  2QF7 A;  2GN5 A;  4F8M A;  1S5B D;  2B2U C;  4Y7N H;  5FLM G;  1PTO C;  3WOE A;  2E2I B;  2EY2 A;  4A3L G;  2XWB B;  3HG9 A;  1V9P A;  3VYT A;  2NN6 I;  1YJW A;  2R61 A;  1LLR D;  3M7N A;  1JOQ A;  1C48 A;  1JWU D;  4ZYS A;  1M4V A;  1PRT D;  2K7V A;  3I7F A;  1X6O A;  3I72 A;  4DR5 Q;  2EXZ A;  3HOV B;  3DLL A;  2VL6 A;  4JV5 L;  1EY6 A;  1X3E A;  4IFD H;  1WFQ A;  5EPJ A;  4X65 L;  3CW2 C;  4IUT A;  1A6X A;  1DXM A;  1RJT A;  1PLF A;  3ER0 A;  3BG3 A;  5KEE A;  1O7Z A;  4A3C H;  2RA4 A;  1FNW A;  1HA6 A;  1JB7 A;  3H6M A;  4L63 B;  1B9M A;  4KN4 C;  4N8X 1;  3W1B A;  1DGS A;  1GUS A;  4QB4 A;  4HJ5 A;  2OXP A;  1TWG B;  3GTM H;  5KIX A;  2I5H A;  4KKU A;  2UUA L;  2RSN A;  4XQJ A;  3SGI A;  2QEX A;  3PUX A;  2RCN A;  1M1K C;  1HNX L;  2WIN B;  1CKO A;  1LO5 D;  3PMF A;  3EFX D;  1S5E D;  5BR8 Q;  4RHR A;  2KOL A;  5CV4 A;  3HFZ B;  2QDB A;  4QJF A;  1VQE A;  3F2U A;  1N9W A;  2XTI A;  5LL6 S;  1FJG Q;  3I4N G;  2NZ1 D;  1TWF H;  1MD2 D;  3NQI A;  1ASY A;  3NBH A;  5C5L A;  2K4K A;  4PV1 C;  1WD0 A;  4NDX A;  3QOJ A;  4KD4 A;  1SNQ A;  3HKS A;  2CQO A;  3HP3 A;  1GUT A;  4MNO A;  1TWA H;  3HOU H;  4UPA A;  4NB3 A;  4JI4 L;  3I4N B;  2K28 A;  4PZ7 A;  2VNU D;  4FF1 A;  3TN2 A;  2IX3 A;  4IO9 A;  4DV6 L;  5I6Y A;  4BA1 I;  4IFD I;  4A75 A;  1C7Y A;  3S16 B;  3HKZ G;  5C44 B;  4G7Z C;  3PSI A;  2LMC B;  2UXB L;  4A3K H;  4BA2 I;  3P7J A;  4B3M L;  2JA5 H;  1W3S A;  3FMC A;  1PTO B;  1QNU A;  3NWT A;  1Y8O B;  2J7Z A;  4YIJ A;  2PI2 A;  2IHE A;  4JPB W;  1PH6 A;  1QJO A;  1L1O C;  1JMC A;  5GQO A;  2UUC Q;  1NTG A;  2K01 A;  4GN5 A;  3OOC A;  3H0G B;  1VQ8 A;  2NVX H;  4CKB A;  3Q23 A;  1SYB A;  1MHW C;  4AH6 A;  2AWN A;  3QWN A;  1WI5 A;  3IFT A;  3HOX B;  5EBC A;  4BBR G;  4A3K G;  4DR2 Q;  3VR2 A;  1U0L A;  4L5R C;  1UE7 A;  1IBK Q;  3GTK H;  3BVZ A;  3S1N H;  2R92 B;  4R8N A;  1B50 A;  2OQ0 A;  5D14 A;  1WTX A;  1XMO L;  1IBM L;  3MXU A;  4DV0 L;  3U58 A;  2EY6 A;  1JWM D;  2KA7 A;  3BDO A;  4V0B A;  2I46 A;  4PMW A;  1PH2 A;  4IFD G;  3SEB A;  3I73 A;  1X55 A;  4TQU S;  4DV1 L;  3OMC A;  3I4N H;  1BXT A;  4HIO A;  3C1E A;  1NCV A;  4B08 A;  4H44 C;  1KAB A;  4X3U A;  1VQA A;  3F8T A;  1I94 L;  4GOP C;  2X69 A;  2ZXP A;  2RVL A;  3IL8 A;  5LMN L;  3DWP A;  4C2M H;  1K28 A;  5JJZ A;  4FDB A;  5C4X B;  4ZAI A;  3J81 j;  2PYK A;  3VR6 A;  2K32 A;  1D1K A;  2UXC Q;  2KQ3 A;  4A3E G;  2E2J B;  1SJH D;  4C3H G;  4AQY Q;  1WCM H;  4HJ7 A;  2F0D A;  2XRS D;  4FYD A;  1N33 Q;  4JI7 L;  3VA5 A;  3M9B A;  2B63 H;  1STH A;  4A3G B;  4A3M H;  2ENB A;  2MFI A;  2OTL A;  1TY2 A;  3AU7 A;  2CCZ A;  1TT2 A;  5DEH A;  5LMU Q;  1EY7 A;  4IFD J;  3C2P A;  3S1M H;  2JA8 H;  1Z47 A;  1W6J A;  2F0N A;  5J22 A;  2HD3 A;  2R7Z B;  3A5U A;  1XMQ Q;  2A69 C;  1IHZ A;  2PO4 A;  3TQY A;  5H1S E;  1UUP A;  2B63 G;  4RGO S;  1TR5 A;  2HT1 A;  3T56 B;  3KDF A;  1EYA A;  2KHI A;  3D0F A;  4GNX A;  4KLK A;  4IPC A;  5J3B A;  1LTA D;  3FP9 A;  4GOP A;  1I3Q B;  3NXW A;  1KRS A;  2HUG A;  3BDL A;  2PNH A;  4R4T A;  3FKI G;  4DV7 Q;  4XIG S;  4KD3 A;  2Z4H A;  3U9S A;  4LFA L;  4BBS G;  4A3J H;  2N55 A;  2RSO A;  2E5L L;  3HGB A;  2ZT9 C;  1C0A A;  1PZK D;  4P72 A;  1YIJ A;  3S1N B;  5LHY 1;  2R7Z G;  3K0Y A;  2G9H D;  4LK1 C;  1JOR A;  1JCK B;  1F2Y A;  3T16 A;  2F0E A;  2R93 H;  2PW5 A;  4CGY B;  3K7U C;  1EU3 A;  4A3G G;  1XNQ L;  1I5F A;  3P20 A;  4F87 A;  2IT1 A;  5D3D A;  3J81 L;  4I7A A;  3J81 i;  2R7Z H;  1B2T A;  4OL7 A;  2IWH A;  4IJL A;  1I3Q H;  3KLW A;  4BBS H;  1IYV A;  1NR4 A;  2A1A A;  4P2C B;  4DK3 C;  3S1R B;  5M3F H;  2WAQ G;  5FKA C;  1AH9 A;  4OIJ A;  2MUY A;  4O42 A;  5C3E H;  2UXB Q;  2CWA A;  2EY5 A;  2F4V L;  1QCB D;  3X3N A;  5LMN Q;  2UU9 Q;  4DV3 L;  1JE4 A;  2PZT A;  4CJ2 C;  4X3K A;  4JBW A;  5FLX L;  1SMY C;  4X66 L;  2BE5 D;  2JK8 A;  4DXG A;  2BDO A;  4OWW B;  3HOU G;  1LT5 D;  2WAC A;  3J81 c;  1E1O A;  2A8V A;  5K36 H;  2R92 G;  1ZYR C;  3ERQ A;  1ZYR D;  4I7Z C;  1F9R A;  3HOX G;  4DV4 Q;  2NVQ B;  3HOV H;  1LV9 A;  4L5S A;  1VQB A;  1HZC A;  5IE8 A;  4XTC S;  3OWE B;  5JEA G;  1GHJ A;  2F0V A;  4CBV A;  1XNR L;  1SRU A;  5JAV A;  1C8C A;  5M3F G;  4JI2 L;  1SJE D;  1S5D D;  2SDF A;  1QUQ B;  3PUZ A;  2PQE A;  2VW9 A;  1ASZ A;  5C0X H;  2HHH Q;  3AFP A;  2YTY A;  1F2M A;  2EQS A;  4UHV A;  4GLX A;  1RDP D;  4IJH A;  2MQH A;  1PFS A;  1QWY A;  4K5X A;  4P74 A;  3HRZ C;  3HOY G;  2KBN A;  2EZV A;  2JJQ A;  3I55 A;  3S1R H;  4ILW A;  2PMZ B;  2EYJ A;  1RKN A;  2EY1 A;  4ZCK A;  5COR A;  1IBL Q;  1VQO A;  1N8R C;  4JBJ A;  1JOK A;  3SK5 A;  5CYU A;  2UUA Q;  2KEE A;  3PO3 H;  5IOD A;  4DR6 L;  2A68 C;  4JI4 Q;  2ZTC A;  1BUV T;  1IYU A;  1N32 Q;  4IUU A;  4IUN A;  2A6E C;  1II3 A;  4C3I B;  1TS4 A;  2NTS A;  4EQO A;  4BY7 B;  2K75 A;  3NWS A;  3MFG A;  1B4O A;  1QOH A;  3E5S A;  1I4X A;  3S9W A;  2O5J C;  1PXU A;  1DON A;  1F9Q A;  2VQF Q;  4RGM A;  1PFM A;  2DN8 A;  4LF6 Q;  3CD6 A;  5M3M H;  1PYS B;  5ELC A;  1Y1W H;  5EGT A;  2UXD Q;  4O2D A;  4IOC A;  2JA8 B;  3HZX A;  4OO1 H;  3PUY A;  4A3F G;  1VQL A;  3HOW G;  3DEP A;  1B3Q A;  1C4Q A;  1E2W A;  2CHB D;  3U9O A;  4EGV A;  1VQG A;  4A3F H;  3M4P A;  5T1I A;  2K05 A;  5FJ8 G;  1UE6 A;  1HTL D;  4MZ9 A;  3E0E A;  2PQA A;  2K04 A;  1CTM A;  2JA6 B;  3OMG A;  2E2J H;  1V43 A;  2PQA B;  2F52 A;  2FIN B;  2R93 B;  1LT3 D;  4A3D B;  2CW0 D;  1AE2 A;  2BA0 A;  4DV5 Q;  5KNB A;  1R9T H;  5A2Q E;  2F0I A;  1IZ6 A;  4LAA A;  4IUQ A;  5CGK A;  3MVV A;  2ZJQ A;  4ODG A;  2RCF A;  4S3S A;  2ALY B;  1SRO A;  3ZJY C;  1ILP A;  1EIG A;  2X6G A;  1MI2 A;  2JA7 H;  1D5M C;  1J6Q A;  1L2F A;  2KCT A;  4C3H H;  3HOV G;  4JCV E;  2ID0 A;  1SN8 A;  2HQL A;  1W6K A;  2UUB L;  5IP7 H;  2B2Y C;  2EJG C;  3MTS A;  2L15 A;  1Y8N B;  3T51 B;  2F1M A;  4GKK Q;  1EZ6 A;  1KD1 C;  2ZXR A;  2HQE A;  1IKL A;  2JP1 A;  4MIU A;  1PV4 A;  4X62 L;  2ASB A;  1VQH A;  5BN3 A;  3CCQ A;  4A3I H;  1Y14 B;  3I2Z A;  1SMX A;  4QL5 A;  1H9R A;  1G6Z A;  1HPC A;  2AMC B;  1T5X D;  5HGT A;  2F0U A;  2EYO A;  5C3W A;  4JI1 L;  2AWO A;  1IYJ B;  1RF2 D;  1EQT A;  4K6L A;  1I6V C;  5LMU L;  2HCC A;  2D0P A;  1SFO B;  1VQD A;  1PMR A;  1B9N A;  5G3L D;  1STB A;  2F0F A;  2KCC A;  1SE2 A;  4DR3 Q;  3I4L A;  3OTO L;  4HJA A;  1RIP A;  3M7G A;  2X6L A;  2RDF A;  4R4C A;  1BR9 A;  2Z6B A;  5G3L F;  4DUY Q;  3K6O A;  1N33 L;  1GUG A;  4HCS A;  1CKN B;  2NYZ D;  3RNU A;  3K57 A;  1TKW B;  5K5P A;  3JAM E;  5EPL A;  2LXJ A;  2YYZ A;  1CT1 D;  3KLS A;  1WTW A;  1GVP A;  1VF5 C;  2F0W A;  2E5L Q;  3NHH A;  1ENF A;  3A8J E;  2VUM G;  1KXL A;  3F1Z A;  1QVC A;  2AHO B;  2Q8I B;  3SXH A;  1KNE A;  1B70 B;  5HUR A;  1G6P A;  4QY7 A;  1NMG A;  2RDH A;  4WJ4 A;  4HJ9 A;  2OQK A;  1YEZ A;  3PQI A;  2B2W C;  4XQN A;  1PVO A;  1WTP A;  1K8G A;  1W2B A;  4EQN A;  4MN3 A;  3J80 E;  5KYI A;  1TWC B;  1NBW A;  3H91 A;  3TZU A;  1CKN A;  1BCP B;  4EX5 A;  1PA6 A;  1ENA A;  2D2C C;  2JA9 A;  5IGG A;  1UEA B;  3L3O C;  3RZO H;  1N34 L;  2NB0 A;  1TU2 B;  5EQ0 A;  3D6W A;  3KJO A;  1PH5 A;  4HN7 A;  4HSV A;  1BBX C;  1EL0 A;  3OHX C;  5GAE C;  2F03 A;  3ULL A;  3DM1 A;  4OXP A;  5E4X A;  3H15 A;  3GTG B;  2F3I A;  3BZC A;  4OX9 Q;  2E2H H;  1MSH A;  4LF9 Q;  2AUK A;  2V4D A;  2WKD A;  4ZLT F;  1JE5 A;  4JBM A;  4X62 Q;  1A63 A;  1HZB A;  2E75 C;  1H9M A;  4XYQ A;  3CCE A;  5C6A A;  1AEX A;  1ROD A;  3CXC A;  1H9K A;  3DM3 A;  2NTT A;  1Q1E A;  2JYO A;  1UNS A;  1BCP C;  3EQL C;  1KQS A;  3K0X A;  2QIL A;  3RLO A;  1OXV A;  1Q81 C;  4QUC A;  1Q8K A;  4EVO A;  3A5Z B;  4TKO B;  2LY7 A;  2WB1 B;  4RA8 A;  1OTC A;  4KI0 A;  1FGU A;  3Q22 A;  3HOZ G;  3PF5 A;  4CDE C;  4ZKC B;  4KMU C;  2IPK D;  4DF7 A;  4OIK A;  1PYB A;  2H1E A;  3CCU A;  4B3S L;  2E74 C;  3CU7 A;  3NTI A;  3CCL A;  3GTJ H;  3KF8 B;  4R4O A;  1JOO A;  2HHH L;  3S2D H;  3I4M H;  1J5E Q;  1TQO A;  5M5X H;  2CW0 C;  5IGF A;  1A2U A;  3K5N A;  3MHB A;  2B2V C;  4QGU A;  1I4P A;  5CBA E;  2ICE C;  3K80 C;  1A3V A;  1KAW A;  3FPP A;  1K83 H;  3NE5 B;  1V8Q A;  2MO1 A;  2RDG A;  2KEN A;  1HNZ Q;  2K14 A;  2DJF C;  4BY1 G;  3L7Z C;  2QA4 A;  4XT3 B;  2I07 B;  4JOI A;  3J80 c;  4GN4 B;  1N34 Q;  1HH2 P;  5HY6 A;  1QG7 A;  4IUR A;  1AZQ A;  4KY6 A;  1XTC D;  1Z6H A;  2JN4 A;  3TP7 A;  1JJG A;  4FP5 D;  4QCL A;  4A3D H;  5FLX E;  1XJV A;  2BOS A;  1N32 L;  1T5E A;  5F2D A;  1G2S A;  3NEN A;  3UDG A;  5C4Z A;  4IZ8 A;  3OW7 A;  1NUC A;  1LM0 A;  1Y69 U;  4TRD A;  4N8F A;  4ULL A;  4BXX H;  1SYF A;  2Z4I A;  5C3E B;  4LF6 L;  2Y0S B;  3TP8 A;  1K0S A;  3TME A;  1SNC A;  2Q2H A;  5IIF A;  1ONL A;  4A3I G;  2F0M A;  4PG3 A;  1M90 C;  1EYG A;  2B2U A;  2E2H B;  1IBK L;  5DAU A;  4TVA B;  2H5X A;  3SE0 A;  4M8A A;  1BVS A;  2DNC A;  1U9R A;  1CSP A;  4QIW B;  2N8N A;  3NQT A;  4JBK A;  1V1O A;  2K1B A;  1SDF A;  1QUQ A;  1G51 A;  2JE6 I;  2BCO A;  1PTO H;  4LJZ C;  2Z1C A;  2J4X A;  4YCW A;  3J7A F;  1S3O A;  4C1N K;  1YNJ C;  4RAU C;  1SXT A;  3G48 A;  5ELN A;  1YVC A;  4BWG B;  3LWE A;  4GZY C;  3K5L A;  1PYW D;  4GNX B;  1EWH A;  1DOM A;  4V19 0;  4DUZ Q;  4A4I A;  3A55 A;  3RN2 A;  1FJG L;  1U4M A;  4X64 Q;  3STB D;  1QE6 A;  3S24 A;  1HXY D;  5FO7 B;  4KY7 A;  3ND8 A;  1P8L A;  3CRL C;  1TII D;  2JXM B;  1KL9 A;  5A2Q L;  2E2I H;  3S16 H;  1FNV A;  5IYD H;  5JPM C;  3GTL B;  4R4I A;  1AW7 A;  4PZ8 A;  1HR0 L;  4PMC A;  5LL6 X;  2LS0 1;  2WP8 J;  4A93 H;  1NSN S;  3U4Z A;  1B1Z A;  5CV5 A;  3H09 A;  3JAM c;  3D4W A;  3KK7 A;  1NE3 A;  3T4A C;  4DAV A;  4RKL A;  2RKS A;  4IUP A;  5LMN W;  4EQP A;  1K8M A;  1CZW A;  4KJO A;  3I4O A;  5J39 A;  1SSO A;  1R9T B;  5M3F B;  3T1H Q;  1YHA A;  3KF8 A;  3HOZ B;  2WB1 G;  3H94 A;  2JEA I;  4DR3 L;  1Q3L A;  1DCZ A;  4FO2 A;  4UAI A;  1OXU A;  1GUO A;  2Z9H A;  3QIA A;  4N9T A;  1VQ7 A;  1EFW A;  3G6E A;  2PW7 A;  5IYB H;  4KY5 A;  3VYR A;  3MEF A;  1DJR D;  1O7I A;  1VQ6 A;  2Y0S E;  2VQE L;  4JV5 Q;  1DZ1 A;  2AQ2 B;  1MIU A;  2VUM H;  1K73 C;  3R2T A;  1LYL A;  2KUM A;  2M9V A;  1VQ4 A;  4JW0 A;  1K8A C;  1SNO A;  1IW7 D;  4LWC A;  3GTL H;  1X56 A;  5AFW A;  1HR0 W;  4CJ1 B;  1X3Q A;  1XTD A;  3IFD A;  2Z6K C;  3SK4 A;  3FKI H;  2MHV A;  3T1Y Q;  4RCN A;  3SK6 A;  1D8L A;  3DWQ A;  3EIV A;  4AIM A;  3MXN B;  2AKW B;  5BN4 A;  1I50 B;  4FVM A;  5IYD G;  1GO3 E;  3MC0 B;  5AJ3 L;  4A93 B;  1LTI D;  2RBM A;  4B9W A;  1XWE A;  2DJG C;  2R3Z A;  4QMG A;  1RTN A;  1KNA A;  3O13 A;  2R92 H;  5A35 A;  2F3V A;  4IPH A;  3S14 H;  2VS1 A;  3M4Q A;  4QUF A;  4C3J G;  1I4G A;  4DR2 L;  3IRB A;  2NN6 H;  3PUW A;  2K52 A;  2BDN A;  2P5Z X;  2A6E D;  3GV6 A;  4OWT B;  4XQQ A;  4YWM A;  3K5M A;  3G71 A;  1I4Q A;  3GP7 A;  5TSS A;  2A69 D;  1E0B A;  1TVX A;  5I9P A;  4YHH Q;  2F4V Q;  3CKI B;  3GV3 A;  1SR3 A;  1DYQ A;  2Q2I A;  1Y8P B;  2BH8 A;  2IX1 A;  3LWU A;  2QW7 A;  2B2W A;  4RGT A;  3KLS X;  4A76 A;  2XGT A;  2F0L A;  4L8J A;  2KEC A;  3ND9 A;  4YCV A;  5C5M A;  4GKJ Q;  4LMQ D;  2RHQ B;  3NBH B;  2K50 A;  4M1U B;  5DNF A;  4APV A;  5JVH 3;  3VR5 A;  4FF2 A;  3FKI B;  3TBI B;  4O0A A;  5M9O A;  3GD7 A;  1XYI A;  3URY A;  3CQZ H;  4WOR A;  3E3X A;  2QDL A;  1TS5 A;  2G9D A;  1FR3 A;  5IGB A;  4OGQ C;  1CKM A;  2A6H C;  2L12 A;  4DAM A;  1PRT F;  1X32 A;  1XPR A;  1B8A A;  4K0K Q;  3EA6 A;  2Q8R E;  3S14 B;  4LW1 A;  1IBM Q;  1KDA A;  4OEL B;  3NEM A;  3OWF A;  1ESR A;  5JOB A;  4K2K A;  1VCI A;  3BYY B;  1U5K A;  4KTA A;  4BBR H;  3OIP A;  4RMF A;  3Q24 A;  1KDB A;  3I56 A;  4UP9 A;  1TWH H;  4HED A;  4FF4 A;  1CSQ A;  4B9X A;  4A93 G;  3CCR A;  3AYH B;  4ZUJ A;  1UE1 A;  3M4O B;  4X6A H;  3J80 L;  1WTQ A;  1K9M C;  4DR4 L;  4CDC C;  2VQE Q;  1YNN C;  2NVX B;  2UXC L;  2PCF B;  3MXP A;  3D8G A;  1HR0 Q;  3TRZ A;  2LFN A;  1Q90 A;  3KJP A;  1BNZ A;  4CKC A;  1Z9F A;  3VR4 A;  3H3V H;  1HNX Q;  1BKB A;  3L9A X;  4IUV A;  1HRJ A;  3UE0 A;  1IW7 C;  5IYB G;  4P71 A;  2ZTE A;  2CQA A;  1M8A A;  3PO3 G;  2O2L D;  4GKJ L;  4DN4 M;  5AJ3 Q;  1XPU A;  3EN2 A;  2FXQ A;  1EU4 A;  2NVY H;  1GM5 A;  3OPO A;  1BDO A;  4DNT B;  3AEV A;  2SEB D;  2F0J A;  3X3M A;  3VYU A;  2CH4 W;  1L1O B;  3PIO A;  1PZJ D;  2GVA A;  4J15 A;  4XT1 B;  4LF5 L;  2VXW A;  2FFK B;  1GXD C;  3TS0 A;  3S1M B;  1H9S A;  2NUC A;  3KYH C;  1EWI A;  2ZM6 Q;  3E0J A;  4UP7 A;  1RHP A;  2KVM A;  5KND A;  4DGZ A;  2WV6 D;  3NUC A;  1KLU D;  4DV6 Q;  1DOL A;  1Q82 C;  1TWH B;  1XMQ L;  1OO9 B;  1J8I A;  4DV2 L;  4LFB Q;  4DPG A;  1YIT A;  1H95 A;  2JA5 B;  3G6J B;  4P75 A;  1WD1 A;  3D4R A;  3QO2 A;  2KED A;  3HKZ B;  4DR1 L;  2NN6 G;  1LUZ A;  4FXD A;  3GQB A;  1EFI D;  1D6E C;  5KYL A;  4HIK A;  3PO3 B;  2OTJ A;  4JC0 A;  4JG2 A;  1S5C D;  1S72 A;  1ICF B;  2F4I A;  1Y1W B;  2MGS A;  1B44 D;  3T13 A;  4KJN A;  2NZO A;  4XYO A;  4LUZ A;  3VA7 A;  3NSW A;  1XX8 A;  1XMO Q;  2JA5 G;  2EYP A;  1E2Z A;  1YI2 A;  3HEJ A;  1FGB D;  2L5T A;  4CJ0 B;  1F9P A;  3K5O A;  4RHS A;  3BVM A;  3RR5 A;  5D65 A;  3I4M G;  4EQ5 A;  1G29 1;  2JA6 G;  2K5V A;  3E9I A;  1MKH A;  2JQO A;  4OON A;  3UI2 A;  3TP5 A;  1O7Y A;  3BZK A;  3J7A 5;  1AZP A;  4K6D A;  2QKI C;  1PDQ A;  3M4Y A;  4F88 A;  4A3I B;  4KKS A;  2JSO A;  3GTG H;  1SMY D;  2MJ8 A;  1A15 A;  4X64 L;  2EJF C;  2WKC A;  2XN9 C;  1WTH A;  1PH7 A;  1SBB B;  2HIX A;  1PH9 A;  2Q2U A;  3BYT B;  2B3G A;  5CV7 A;  4CHT B;  2I5M X;  3OYY A;  4J8Q A;  2VY3 A;  3QJY A;  1I6H B;  4KK7 A;  4DK0 A;  4BY7 G;  1PRT C;  1E1T A;  4QQB X;  1KIX A;  2D0O A;  1B53 A;  3MXN A;  4WJW A;  3J7A V;  1EYD A;  4DR1 Q;  3F2C A;  3MFY A;  4QF4 A;  2K5W A;  4KN7 C;  1AE3 A;  1P16 A;  1JB3 A;  3T1Y L;  4C3J H;  3RZD H;  3DMU A;  4BY1 B;  1X65 A;  3TEH B;  2NVT B;  1F77 A;  2O5I C;  3A56 A;  2A19 A;  3A7A B;  1GJX A;  1MGS A;  1CQV A;  1R4Q B;  2WAQ B;  3CQZ B;  5I2Y A;  2C35 B;  1NNX A;  1ICW A;  1EY0 A;  1DD2 A;  3GTO H;  1MJE A;  2B2V A;  3DHQ A;  2WII B;  4R1J A;  4E6I A;  3J80 i;  3PUV A;  3I91 A;  4DV7 L;  2K03 A;  5NUC A;  4HSP A;  1U4R A;  4POF A;  3V96 A;  4ZUI A;  4Z9C B;  1R4P B;  2MP1 A;  1K83 B;  5IWA L;  3HOZ H;  2CFM A;  4G7O C;  3R2I A;  1O7L A;  4YHH L;  4DV1 Q;  1S5F D;  1FD7 D;  5JJI A;  2FMC A;  5M3M B;  1LT4 D;  2A74 C;  2EXD A;  1WCM G;  4K14 A;  3SHL A;  1IKM A;  3QR8 A;  2EYM A;  1UEB A;  3QB3 A;  1QIL A;  1HFG A;  1LTS D;  1F2Z A;  1LTB D;  3ITP A;  1HNZ L;  2IX0 A;  2F0P A;  4GKK L;  3FPU B;  2XWJ B;  3TSS A;  1BQQ T;  3E9H A;  3RZD B;  4JYA L;  1KHI A;  1PH8 A;  2WAQ E;  2JA6 H;  5JEA H;  5KGU A;  1CA5 A;  2EYL A; 
#chains in the Genus database with same CATH homology
 2J0T D;  3I8Z A;  5CC4 A;  4R9W A;  4G57 A;  2NVY B;  1E2V A;  3V2T A;  5I6W A;  1D5Z C;  5E3F A;  2A6H D;  4I65 A;  4K2L A;  1YNJ D;  4H7B A;  1DM0 B;  2QCP X;  2L11 A;  4DAY A;  5DM7 3;  4X3T A;  3Q0A A;  1CM9 A;  3BVG A;  2IL8 A;  1D1I A;  5EKK A;  2K5D A;  1J9O A;  2EDG A;  1TWA B;  2L1B A;  3PIO 3;  4G4K A;  2B39 A;  1SYG A;  1WTV A;  1V1P A;  1Q1B A;  1ILQ A;  4A3E B;  2A5H A;  5CV8 A;  1EZ8 A;  1SEB D;  3GTJ B;  3S2D B;  3MXG A;  1STE A;  1G2T A;  2YU9 B;  4OO1 I;  5JPN C;  3NPP A;  2B2T A;  2L0C A;  2B2Y A;  3D31 A;  2KHS A;  3OIQ A;  1F2L A;  1S4Z A;  2EYH A;  1CHQ D;  4HR7 B;  2B63 B;  4KHZ A;  2KJX A;  3DXJ C;  1MBY A;  5E4W C;  5COY A;  4JK1 C;  2F0T A;  2VB2 X;  4N9P A;  4FXK C;  5D3I B;  1HUM A;  5M5Y B;  2PPB C;  3I4M B;  1TS3 A;  1ZXT A;  4HCE A;  3KBG A;  1OXX K;  5ELB A;  4WRD A;  3LX0 A;  3K58 A;  2L9H A;  3HOW B;  3MEH A;  4A3F B;  2OF1 A;  1O78 A;  3RUZ A;  3BDC A;  3EJI A;  3OSO A;  4DAP A;  2PNR C;  4ZKB B;  2A68 D;  2IW3 A;  3D6C A;  3C46 A;  3RMH A;  2OEO A;  5CV6 A;  2F0S A;  1STN A;  3ONA B;  5EJW A;  4WFN 3;  3VR3 A;  1IL8 A;  4DK1 A;  4HTH A;  1O80 A;  4X3S A;  5ISR A;  1Q12 A;  2DNE A;  1EY5 A;  4A3K B;  3HOY B;  5FOB B;  2BE5 C;  2EOT A;  3WOF A;  2B8G A;  4J1M A;  1CHP D;  3ZYY X;  4K8I A;  1XXG A;  4ZQ3 A;  1Z7T A;  1STY A;  2R6G A;  3QG1 A;  5CV9 A;  5JVG 3;  4KKT A;  1TS2 A;  1X3P A;  4Q0F A;  4XXE A;  3GTQ B;  1LAC A;  3E6Z X;  4OO1 G;  2LKV A;  4Q5V A;  2RQX A;  3DUZ A;  1BCP F;  3A54 A;  1JC7 A;  3FEW X;  3QOL A;  1WTR A;  1A3T A;  1UAP A;  4FXG C;  1ESF A;  4RGN A;  3BZD B;  2M00 A;  1SE3 A;  1Q8I A;  2N88 A;  2K33 A;  2HDM A;  1SNP A;  2XVS A;  1SE4 A;  1MSG A;  2BA1 A;  1FNU A;  3SDZ A;  3KLR A;  1CZG A;  3Q6S A;  3R8B A;  4XDX A;  3EVQ A;  3AMU A;  1OXT A;  4NW2 A;  1QNK A;  2C9O A;  2K5Q A;  5C0X I;  4ID6 A;  1VF7 A;  1SNM A;  3H3V C;  1KLG D;  1PZI D;  3HOU B;  2NBF A;  5IOC A;  1LTR D;  1WVL A;  1ET6 A;  3T53 B;  2AQ1 B;  1QB5 D;  3NK9 A;  4J6H A;  5IT9 E;  2JEB I;  1HTP A;  2VUM B;  1EYC A;  5C0X J;  3PO2 B;  1VDZ A;  3N6R A;  4MHE A;  3PV0 A;  1VMC A;  4K5W A;  2MPM A;  4HAE A;  5M5W B;  1L0X B;  3GO5 A;  1CK1 A;  3I3C A;  5EKL A;  3MZ5 A;  1TWF B;  2F3W A;  1CA6 A;  3C3L A;  4C1N I;  3M85 A;  2ICI A;  1BCP D;  4HMI A;  4C3J B;  1V1P B;  2PZW A;  2ZXO A;  2SNM A;  2R93 B;  3HS0 C;  4NKL A;  3SK8 A;  3RZO B;  5FO9 B;  1AN8 A;  5ELD A;  3TZD A;  3D3R A;  3J81 E;  2L55 A;  5KRU A;  2B8F A;  5C0X G;  2FMM A;  3A8I E;  3IKJ A;  3S2H B;  4RH6 A;  1GUW A;  4BBS B;  4IQZ A;  5I4D A;  1ZKO A;  1HQR D;  4H13 C;  4U68 A;  4DFA A;  2QEJ C;  4OHJ A;  1JR0 D;  1HUN A;  4A3B B;  1BOS A;  1LTT D;  1U4P A;  2SOB A;  1RD9 D;  2D9U A;  1RTO A;  2FJ2 A;  1KTK A;  1G91 A;  1STG A;  3SVM A;  1PFN A;  4PMB A;  1DOK A;  5KNC A;  5K36 G;  2F0Q A;  3FVQ A;  3DWA A;  2O4X A;  4BBR B;  3CRK C;  3LNN A;  3NTH A;  2KCN A;  2SNS A;  2DY7 A;  2M2L A;  3TP6 A;  1LAB A;  1D2B A;  2F0K A;  5M5X B;  1HHV A;  3K59 A;  1I4H A;  1EY8 A;  3A8K E;  1ENC A;  5IGE A;  2H4O A;  5DM6 3;  2E2D C;  4DXF A;  2XIW A;  3I90 A;  2IJ0 A;  1EEF D;  4C3I G;  4A3M B;  3WDN A;  2F0H A;  4PQX A;  4IN3 A;  4ABN A;  5I9O A;  3GTM B;  2OT2 A;  2EE1 A;  4DNR B;  4RKB A;  3GTO B;  1YNN D;  1EY4 A;  4ZRZ A;  1HA5 A;  4ME5 A;  4RCO A;  1AFP A;  4PNY A;  3PIP 3;  3P75 A;  1CFM A;  1EQV A;  1H9S B;  2F0G A;  3G7L A;  3VYS A;  3JAM L;  1L0Y B;  3MWY W;  2VB3 X;  2L4N A;  5C4H A;  4AYB B;  1GHK A;  1CQF A;  1PTO F;  2EPB A;  5IGC A;  4NMZ A;  4R8I A;  1LTG D;  4H0L C;  1LT6 D;  3KUP A;  1ML0 D;  5FO8 B;  3GTK B;  4U67 3;  3GTP B;  2B2T C;  5CR3 A;  3W3A A;  4RWS C;  4K8J A;  4FNF A;  5E1F A;  2JA7 B;  3FRP B;  1JQY D;  4Y7N B;  3SR1 A;  5T1G A;  1PTO D;  2EYF A;  1FYC A;  1EWC A;  3RLF A;  4O1N A;  3NP8 A;  1B3A A;  3A7L A;  3BS1 A;  1F9S A;  2HCI A;  4NP5 A;  4DU9 A;  5CMD A;  1JWS D;  1I4R A;  1OXS C;  1GOZ A;  3N52 A;  3RD4 A;  1H9J A;  2FHT A;  4CKE A;  1A3U A;  2XSC A;  4DA2 A;  2TSS A;  3MA2 B;  2Z8L A;  3NTK A;  3KBX A;  1D5X C;  1Y1V B;  1EEI D;  3C1F A;  1SYD A;  1SYC A;  1A2T A;  3S1Q B;  1KAA A;  2AQ3 B;  4IAL A;  1K8O A;  1EOT A;  5EBD A;  1VMP A;  5J1Z A;  1HCZ A;  2PZU A;  1BF4 A;  5FK9 C;  3R93 A;  3ERO A;  1SAP A;  1CI3 M;  2K6A A;  2D62 A;  3CHB D;  5CBE E;  1PRT B;  2E76 C;  1JIC A;  1EY9 A;  1G8Z D;  4A3J B;  3IAY A;  3J7Y W;  4L6T B;  4RFB A;  5IT9 L;  1NR2 A;  4C56 C;  2AUJ D;  2EJM A;  2TMP A;  1PFB A;  3S15 B;  4TSS A;  4FF3 A;  4UDU C;  3NBI A;  5JEA J;  2NWG A;  4HMJ A;  2Q8T A;  2CVR A;  2XRQ D;  1WTO A;  1EIH A;  5I2X A;  5BN5 A;  1STA A;  1TY0 A;  4C3H B;  1BO0 A;  3TDQ A;  4F7X A;  4ZK9 B;  2XNA C;  5EPK A;  3AB9 A;  3FDT A;  3D4D A;  1GUN A;  1NAP A;  1HQM C;  1ZEQ X;  1SND A;  4KHV A;  1SYE A;  2D5D A;  5IGD A;  1ET9 A;  3R3O A;  1HFN A;  5EKI A;  2DY8 A;  1U4L A;  3M3Y B;  5C4J B;  4BS9 A;  3DEO A;  4C2M B;  1RCV D;  2EVB A;  1KDC A;  1AP0 A;  2A73 B;  3V05 A;  3P1H A;  5C3X A;  2C5C A;  2GA4 B;  3K7A B;  3W2D A;  1WCM B;  4K5V A;  4G7H C;  3S17 B;  2F0O A;  3I70 A;  2HDL A;  5ELE A;  5ELF A;  4KV6 A;  3MAQ A;  2QF7 A;  4F8M A;  1S5B D;  2B2U C;  1PTO C;  3WOE A;  2E2I B;  2EY2 A;  2XWB B;  3HG9 A;  3VYT A;  2NN6 I;  2R61 A;  1LLR D;  3M7N A;  1JOQ A;  1C48 A;  1JWU D;  4ZYS A;  1M4V A;  1PRT D;  2K7V A;  3I72 A;  3HOV B;  2EXZ A;  1EY6 A;  4IFD H;  5EPJ A;  4IUT A;  1A6X A;  1DXM A;  1RJT A;  1PLF A;  3BG3 A;  5KEE A;  1O7Z A;  2RA4 A;  1FNW A;  1HA6 A;  3H6M A;  4L63 B;  1B9M A;  4KN4 C;  1GUS A;  4QB4 A;  2OXP A;  1TWG B;  5KIX A;  4KKU A;  2RSN A;  4XQJ A;  3PUX A;  2WIN B;  1LO5 D;  3PMF A;  3EFX D;  1S5E D;  4RHR A;  2KOL A;  5CV4 A;  2QDB A;  3F2U A;  5LL6 S;  2NZ1 D;  1MD2 D;  3NQI A;  3NBH A;  5C5L A;  4PV1 C;  1WD0 A;  4NDX A;  3QOJ A;  4KD4 A;  1SNQ A;  3HP3 A;  1GUT A;  3I4N B;  2K28 A;  2VNU D;  4FF1 A;  3TN2 A;  2IX3 A;  5I6Y A;  4BA1 I;  4IFD I;  3S16 B;  5C44 B;  4G7Z C;  2LMC B;  4BA2 I;  3P7J A;  3FMC A;  1PTO B;  1QNU A;  3NWT A;  1Y8O B;  2J7Z A;  4YIJ A;  1QJO A;  2K01 A;  3OOC A;  3H0G B;  4CKB A;  3Q23 A;  1SYB A;  2AWN A;  3QWN A;  3IFT A;  3HOX B;  5EBC A;  3VR2 A;  3BVZ A;  2R92 B;  4R8N A;  1B50 A;  5D14 A;  1WTX A;  3MXU A;  2EY6 A;  1JWM D;  2KA7 A;  3BDO A;  4V0B A;  2I46 A;  4PMW A;  4IFD G;  3SEB A;  3I73 A;  4TQU S;  3OMC A;  1BXT A;  3C1E A;  1NCV A;  4B08 A;  4H44 C;  1KAB A;  4X3U A;  2X69 A;  2ZXP A;  2RVL A;  3IL8 A;  3DWP A;  5JJZ A;  5C4X B;  4ZAI A;  2PYK A;  3VR6 A;  2K32 A;  1D1K A;  2KQ3 A;  2E2J B;  1SJH D;  4C3H G;  2F0D A;  2XRS D;  4FYD A;  3VA5 A;  4A3G B;  1STH A;  2ENB A;  1TY2 A;  3AU7 A;  1TT2 A;  5DEH A;  1EY7 A;  4IFD J;  3C2P A;  1Z47 A;  1W6J A;  2F0N A;  5J22 A;  2R7Z B;  2A69 C;  1IHZ A;  2PO4 A;  1UUP A;  4RGO S;  1TR5 A;  3T56 B;  1EYA A;  1LTA D;  1I3Q B;  3BDL A;  3NXW A;  2HUG A;  4XIG S;  4KD3 A;  2Z4H A;  3U9S A;  2N55 A;  2RSO A;  3HGB A;  2ZT9 C;  1PZK D;  3S1N B;  5LHY 1;  3K0Y A;  2G9H D;  4LK1 C;  1JOR A;  1JCK B;  1F2Y A;  3T16 A;  2F0E A;  2PW5 A;  4CGY B;  1EU3 A;  4F87 A;  3P20 A;  2IT1 A;  5D3D A;  3J81 L;  1B2T A;  4OL7 A;  2IWH A;  1IYV A;  1NR4 A;  4P2C B;  3S1R B;  5FKA C;  4OIJ A;  2MUY A;  4O42 A;  2EY5 A;  1QCB D;  3X3N A;  1JE4 A;  2PZT A;  4CJ2 C;  4X3K A;  4JBW A;  5FLX L;  1SMY C;  2BE5 D;  4DXG A;  2BDO A;  1LT5 D;  2WAC A;  5K36 H;  1ZYR C;  3ERQ A;  1ZYR D;  4I7Z C;  1F9R A;  2NVQ B;  1LV9 A;  4XTC S;  3OWE B;  5JEA G;  1GHJ A;  2F0V A;  4CBV A;  5JAV A;  1C8C A;  1SJE D;  1S5D D;  2SDF A;  3PUZ A;  2PQE A;  5C0X H;  1F2M A;  1RDP D;  1QWY A;  4K5X A;  3HRZ C;  2EZV A;  4ILW A;  2PMZ B;  2EYJ A;  1RKN A;  2EY1 A;  5COR A;  1JOK A;  3SK5 A;  5CYU A;  2KEE A;  5IOD A;  2A68 C;  1BUV T;  1IYU A;  4IUU A;  4IUN A;  2A6E C;  1II3 A;  4C3I B;  1TS4 A;  2NTS A;  4EQO A;  4BY7 B;  3NWS A;  3MFG A;  1B4O A;  1QOH A;  3E5S A;  1I4X A;  3S9W A;  2O5J C;  1PXU A;  1DON A;  1F9Q A;  4RGM A;  1PFM A;  2DN8 A;  5ELC A;  5EGT A;  2JA8 B;  3HZX A;  4OO1 H;  3PUY A;  3DEP A;  1C4Q A;  1E2W A;  2CHB D;  3U9O A;  4EGV A;  5T1I A;  2K05 A;  1HTL D;  2K04 A;  1CTM A;  2JA6 B;  3OMG A;  1V43 A;  2FIN B;  1LT3 D;  4A3D B;  2CW0 D;  2BA0 A;  5KNB A;  5A2Q E;  2F0I A;  4LAA A;  4IUQ A;  5CGK A;  3MVV A;  4ODG A;  4S3S A;  1ILP A;  1EIG A;  2X6G A;  1MI2 A;  1D5M C;  2ID0 A;  1W6K A;  2B2Y C;  2EJG C;  3MTS A;  1Y8N B;  3T51 B;  2F1M A;  1EZ6 A;  2ZXR A;  2HQE A;  1IKL A;  2JP1 A;  4MIU A;  5BN3 A;  1H9R A;  1G6Z A;  1HPC A;  1T5X D;  5HGT A;  2F0U A;  2EYO A;  5C3W A;  2AWO A;  1RF2 D;  1EQT A;  4K6L A;  1I6V C;  2HCC A;  1SFO B;  1PMR A;  1B9N A;  5G3L D;  1STB A;  2F0F A;  2KCC A;  1SE2 A;  3I4L A;  3M7G A;  2X6L A;  2RDF A;  1BR9 A;  5G3L F;  3K6O A;  1GUG A;  4HCS A;  2NYZ D;  3K57 A;  1TKW B;  5K5P A;  3JAM E;  5EPL A;  2YYZ A;  1CT1 D;  3KLS A;  1WTW A;  1VF5 C;  2F0W A;  3NHH A;  1ENF A;  3A8J E;  2Q8I B;  3SXH A;  1KNE A;  5HUR A;  2RDH A;  2B2W C;  4XQN A;  1WTP A;  4EQN A;  4MN3 A;  3J80 E;  5KYI A;  1TWC B;  3H91 A;  3TZU A;  1BCP B;  1ENA A;  2D2C C;  5IGG A;  1UEA B;  3L3O C;  2NB0 A;  1TU2 B;  5EQ0 A;  3D6W A;  4HN7 A;  4HSV A;  1BBX C;  1EL0 A;  3OHX C;  2F03 A;  3DM1 A;  5E4X A;  3GTG B;  1MSH A;  2AUK A;  2V4D A;  2WKD A;  4ZLT F;  2E75 C;  1H9M A;  4XYQ A;  5C6A A;  1AEX A;  1ROD A;  1H9K A;  2NTT A;  1Q1E A;  2JYO A;  1UNS A;  1BCP C;  3EQL C;  2QIL A;  1OXV A;  4QUC A;  4EVO A;  4TKO B;  2LY7 A;  2WB1 B;  4RA8 A;  4KI0 A;  3Q22 A;  4ZKC B;  4KMU C;  4DF7 A;  2IPK D;  4OIK A;  2H1E A;  2E74 C;  3CU7 A;  3NTI A;  1JOO A;  1TQO A;  2CW0 C;  5IGF A;  1A2U A;  3K5N A;  3MHB A;  2B2V C;  1I4P A;  5CBA E;  2ICE C;  1A3V A;  3FPP A;  3NE5 B;  1V8Q A;  2RDG A;  3L7Z C;  4XT3 B;  2I07 B;  1QG7 A;  4IUR A;  1AZQ A;  4KY6 A;  1XTC D;  1Z6H A;  3TP7 A;  4FP5 D;  4QCL A;  5FLX E;  2BOS A;  1T5E A;  5F2D A;  1G2S A;  5C4Z A;  4IZ8 A;  3OW7 A;  1NUC A;  1Y69 U;  4TRD A;  4ULL A;  1SYF A;  2Z4I A;  5C3E B;  2Y0S B;  3TP8 A;  3TME A;  1SNC A;  5IIF A;  1ONL A;  2F0M A;  2B2U A;  2E2H B;  5DAU A;  3SE0 A;  4M8A A;  2DNC A;  1U9R A;  4QIW B;  3NQT A;  1V1O A;  2K1B A;  1SDF A;  2JE6 I;  2BCO A;  1PTO H;  4LJZ C;  2Z1C A;  2J4X A;  3J7A F;  4C1N K;  1YNJ C;  4RAU C;  1SXT A;  4BWG B;  3LWE A;  4GZY C;  3K5L A;  1PYW D;  1EWH A;  1DOM A;  4V19 0;  3A55 A;  1U4M A;  1QE6 A;  1HXY D;  5FO7 B;  4KY7 A;  3ND8 A;  3CRL C;  1TII D;  2JXM B;  5A2Q L;  1FNV A;  5JPM C;  3GTL B;  1AW7 A;  4PMC A;  5LL6 X;  2LS0 1;  2WP8 J;  1NSN S;  1B1Z A;  5CV5 A;  3H09 A;  3D4W A;  3KK7 A;  3T4A C;  4DAV A;  4RKL A;  2RKS A;  4IUP A;  4EQP A;  1K8M A;  1CZW A;  4KJO A;  5J39 A;  1SSO A;  1R9T B;  5M3F B;  3KF8 A;  3HOZ B;  3H94 A;  2JEA I;  1Q3L A;  1DCZ A;  4FO2 A;  4UAI A;  1OXU A;  1GUO A;  3QIA A;  4N9T A;  2PW7 A;  4KY5 A;  3VYR A;  1DJR D;  1DZ1 A;  2AQ2 B;  3R2T A;  2KUM A;  2M9V A;  1SNO A;  1IW7 D;  5AFW A;  4CJ1 B;  1X3Q A;  3IFD A;  3SK4 A;  2MHV A;  4RCN A;  3SK6 A;  3DWQ A;  5BN4 A;  1I50 B;  4FVM A;  3MC0 B;  4A93 B;  1LTI D;  2RBM A;  4B9W A;  1XWE A;  2R3Z A;  4QMG A;  1RTN A;  1KNA A;  3O13 A;  5A35 A;  2F3V A;  4QUF A;  4C3J G;  1I4G A;  2NN6 H;  3PUW A;  2BDN A;  2A6E D;  3GV6 A;  4XQQ A;  3K5M A;  1I4Q A;  3GP7 A;  5TSS A;  2A69 D;  1E0B A;  1TVX A;  5I9P A;  3CKI B;  3GV3 A;  1DYQ A;  1Y8P B;  2IX1 A;  3LWU A;  2B2W A;  4RGT A;  3KLS X;  4L8J A;  2F0L A;  2KEC A;  3ND9 A;  5C5M A;  4LMQ D;  4M1U B;  5DNF A;  5JVH 3;  3VR5 A;  4FF2 A;  3FKI B;  3TBI B;  5M9O A;  3GD7 A;  1XYI A;  3URY A;  4WOR A;  1TS5 A;  2G9D A;  1FR3 A;  5IGB A;  4OGQ C;  2A6H C;  2L12 A;  1PRT F;  1X32 A;  3EA6 A;  2Q8R E;  3S14 B;  1KDA A;  3OWF A;  1ESR A;  5JOB A;  4K2K A;  1VCI A;  3BYY B;  4KTA A;  3OIP A;  3Q24 A;  1KDB A;  4HED A;  4FF4 A;  4B9X A;  4ZUJ A;  3M4O B;  3J80 L;  1WTQ A;  1YNN C;  2NVX B;  2PCF B;  3MXP A;  3D8G A;  2LFN A;  1Q90 A;  1BNZ A;  4CKC A;  3VR4 A;  3L9A X;  4IUV A;  1HRJ A;  1IW7 C;  2CQA A;  1M8A A;  2O2L D;  4DN4 M;  1EU4 A;  3OPO A;  1BDO A;  4DNT B;  2SEB D;  2F0J A;  3X3M A;  3VYU A;  1PZJ D;  4XT1 B;  2VXW A;  2FFK B;  1GXD C;  3S1M B;  1H9S A;  2NUC A;  3E0J A;  1RHP A;  2KVM A;  5KND A;  4DGZ A;  2WV6 D;  3NUC A;  1KLU D;  1DOL A;  1TWH B;  1OO9 B;  1J8I A;  2JA5 B;  3G6J B;  1WD1 A;  3D4R A;  3QO2 A;  2KED A;  3HKZ B;  2NN6 G;  4FXD A;  3GQB A;  1EFI D;  1D6E C;  5KYL A;  3PO3 B;  1S5C D;  2F4I A;  1Y1W B;  2MGS A;  1B44 D;  3T13 A;  4KJN A;  4XYO A;  3VA7 A;  3NSW A;  1XX8 A;  2EYP A;  1E2Z A;  3HEJ A;  1FGB D;  2L5T A;  4CJ0 B;  1F9P A;  3K5O A;  4RHS A;  3BVM A;  5D65 A;  1G29 1;  3UI2 A;  3TP5 A;  1O7Y A;  1AZP A;  4K6D A;  2QKI C;  1PDQ A;  3M4Y A;  4F88 A;  4A3I B;  4KKS A;  2JSO A;  1SMY D;  2MJ8 A;  1A15 A;  2EJF C;  2WKC A;  2XN9 C;  1SBB B;  3BYT B;  5CV7 A;  4CHT B;  4J8Q A;  3QJY A;  1I6H B;  4KK7 A;  4DK0 A;  1PRT C;  1B53 A;  3J7A V;  4WJW A;  3MXN A;  1EYD A;  3MFY A;  4QF4 A;  2K5W A;  4KN7 C;  1JB3 A;  3DMU A;  4BY1 B;  2NVT B;  1F77 A;  2O5I C;  3A56 A;  3A7A B;  1GJX A;  1MGS A;  1CQV A;  1R4Q B;  2WAQ B;  3CQZ B;  5I2Y A;  1ICW A;  1EY0 A;  1DD2 A;  2B2V A;  3DHQ A;  2WII B;  4E6I A;  3PUV A;  3I91 A;  2K03 A;  5NUC A;  4HSP A;  1U4R A;  3V96 A;  4ZUI A;  4Z9C B;  1R4P B;  2MP1 A;  1K83 B;  4G7O C;  3R2I A;  1O7L A;  1S5F D;  1FD7 D;  2FMC A;  5M3M B;  1LT4 D;  2A74 C;  4K14 A;  3SHL A;  1IKM A;  2EYM A;  3QB3 A;  1QIL A;  1HFG A;  1LTS D;  1F2Z A;  1LTB D;  3ITP A;  2IX0 A;  2F0P A;  3FPU B;  2XWJ B;  3TSS A;  1BQQ T;  3RZD B;  5JEA H;  5KGU A;  1CA5 A;  2EYL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...