4DV4Q

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, a914g
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
99
structure length
99
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
total genus 17
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4dv4Q00
1KRSA 5LMNQ 4YCWA 2JA7G 3I7FA 2QA4A 1YNXA 1P16A 3S1QH 3TRZA 4A75A 2UXBL 1PVOA 1PYSB 2KBNA 2E2HH 4XTCS 1C0AA 4JV5L 2V1CC 2PI2A 4MTNA 4LFCQ 2VZAA 3H15A 1YZ6A 4PZ8A 3UDFA 3KFUA 4IFDI 1E3PA 3J80c 2F4VL 4R1JA 3M4PA 1G51A 1I50H 4GNXA 3G4SA 3KJPA 1HZAA 4BY1H 2LXKA 3M3YH 1SROA 4OWTB 4Y7NH 4DR7L 3J80i 3W1GA 4LFBQ 2BH8A 1VQ6A 4IJLA 2Q2HA 4DAMA 4YY3Q 1N36L 4YWMA 4C2MH 4TVAB 2EQSA 3CCRA 4DUYQ 1WI5A 4BY1G 4ALPA 3KF6B 1YHAA 1I94L 4K0KL 3ER0A 3CW2C 4DR6L 4BBRH 3PV0A 1UWVA 3S2HH 3GD7A 4LF7Q 2Z6KC 3KJOA 2Q2TA 3TS0A 3CCEA 1YI2A 1Y1WG 3U4VA 4POGA 2JK8A 4BBRG 4R4TA 2JEBI 4MNOA 3GTQH 2UXDL 1CKNB 3UDGA 1B8AA 5GAHC 4JI7Q 1KHIA 2ZM6Q 3PO3H 1VQLA 1I6HH 4LF9L 3ULJA 1VQ4A 4UPAA 2CWPA 4LF4L 3CCJA 3K8AA 1ASYA 1SN8A 3G6EA 2E8GA 5M3MG 3PO3G 4P73A 1PYBA 2EIFA 4ME3A 1VQMA 1QVGA 3F2BA 1VQOA 3PUWA 2HT1A 4QIWE 3FKIH 1V9PA 5IYCH 5FJ8H 3JAMc 4A3IH 3U58A 5IT9c 5J3BA 4BA2I 3U4ZA 3CPWA 1N33Q 3H0GH 4JI6Q 1HNWL 1YBYA 1L1OA 1K8AC 4KI0A 1K0RA 2GN5A 3NELA 5FJ8G 2Q2IA 2E5LL 4LF5Q 3K80C 4DR3L 4FDBA 5HGQA 1VQDA 2VQFQ 1KL9A 1U0LA 1B7YB 4TQUS 2IY5B 1PH6A 4RG1A 4JI2Q 4HIMA 4IPGA 4YHHQ 5M5XH 4X62Q 2OQ0A 3K7UC 4DR5Q 5EAYA 2JA9A 5M3FH 4B3RQ 1NJIC 4Y52H 3B6YA 1XMQL 1PV4A 3SGIA 4MZ9A 1IBMQ 1XNRL 3M85A 2MQHA 4P72A 1XTDA 2DUDA 4L5RC 4NXMQ 1KIXA 2UXCQ 4BY7G 2A8VA 1KC8C 1HH2P 1C7YA 3FP9A 4DR2L 3CCLA 4JI0Q 1OXUA 4A3GH 4DUZQ 3RR5A 3I56A 3HOUG 1NMFA 1U5KA 2KCMA 4LUOA 1PH9A 4DV3L 3OTOQ 4JOIA 2VUMG 2VY3A 2I5HA 3T1HL 4OO1I 3TEHB 1M1KC 3HFZB 4O2DA 4X65Q 4DNIA 3PIPA 1VQFA 2YTYA 3PUVA 1N34L 3M7NA 3ICEA 1CKMA 1K3RA 2UUBQ 1W2BA 1HNZQ 3GTKH 1UEBA 4DV0L 3H3VI 4JYAQ 1QUQA 3NENA 5LMNL 1MKHA 1K9MC 2I5MX 2IX1A 1N32Q 4QJFA 1QZHA 4HIKA 1UE7A 5ELNA 3TREA 4EX5A 4JI5Q 1YITA 2C35B 3RLNA 5IY0A 4NB3A 4AH6A 1JJ2A 2JJQA 1HR0W 4BBSH 5IYDG 4A3CH 1BBWA 5IP9H 4QL5A 1UE6A 3HOWG 4APVA 1SFOH 4A3JG 2NVXH 1SLJA 3E9IA 2R93H 4BBSG 1KQSA 2FXQA 2JA8G 3HOVG 3PF4A 3GO5A 2D62A 5IP9G 2YTVA 2JEAI 1NBWA 1AE3A 2BA0A 2E2IH 3KDFA 1EIFA 4P75A 1X3EA 4LFBL 1B70B 4YWLA 2K75A 4A3KH 2WFWA 4R4IA 1TWGH 4YY3L 4H02A 5C3EG 1Y1VH 4KLKA 3ERSX 1SR3A 3CCUA 4LWCA 2K5NA 3K0XA 3KF8B 2WB1G 4JBJA 2HHHQ 1Q86C 2Z6KA 1HNXQ 3ZJYC 5LMUQ 3CC4A 1Y1VG 3RN5A 3AFQA 3CF5A 1N8RC 1PH3A 4DR4Q 4OX9Q 5C4XH 1L1OB 5M5YH 1HJPA 3CC7A 1PH5A 1ASZA 2B63H 4JI7L 4A3DH 5C4XG 1IXRA 4PG3A 1C9OA 3E9HA 1A0IA 4YWKA 5JEAJ 1EFWA 1HR0Q 1IBLQ 2KENA 5M5WH 2B63G 1VQGA 3GTLH 3I4MH 5JJLA 3PGZA 2MFIA 3T1YL 3EIVA 2Q2UA 1S40A 4KHPQ 1KRTA 1SMXA 5C0XJ 2E2JH 2OTLA 1YHQA 1TWAH 1OXSC 1Q7YC 2VQEQ 1N33L 5FLMH 2RHQB 3CAMA 3J81i 1XNQQ 4A76A 2UU9Q 3W1BA 4LFAQ 4JI6L 3RZOH 2K14A 4LF5L 1A62A 1VQCA 4LW1A 5FLMG 5JEAG 2GVAA 1IZ6A 3J81j 2VQFL 4GLXA 2WP8J 1PH2A 4A3BH 4DV4Q 1Q46A 4GKKQ 1FL0A 4DV5Q 3G48A 4UP9A 4JI2L 4LF6Q 5C0XG 3PUZA 4X62L 2XTIA 4YHHL 1X56A 4DV1Q 3RNUA 3MXNB 1XMOQ 4B3SQ 4IPHA 4A3BG 4B3MQ 4DR5L 2N78A 1IBKQ 4R4OA 2GVBA 3RLOA 1PH8A 4B3RL 4GN4B 1GO3E 1Q12A 2D0OA 2PQAA 2YTXA 3BU2A 4IJHA 4A3FH 1AE2A 2HQLA 4QQBX 4JBKA 5AJ3Q 3OW2A 1MIUA 1CSQA 1QUQB 4C3HH 3S1RH 3HKSA 1NY4A 1A8VA 4NXML 2UXCL 4JI0L 4DUZL 4DV6Q 5HY6A 4DV7Q 3JC66 3FKIG 2R7ZH 5IYCG 3AEVA 4A3IG 3A5ZB 1LYLA 3OTOL 3Q8DA 1KD1C 3H0GG 4JBWA 2WB1E 4DPGA 4X64Q 1XPOA 3H3VH 1FJGL 3HOZH 5GAEC 2UUAQ 1IYJB 3CCSA 5GAGC 4C3IH 2UUBL 3TQYA 3S14H 1LTLA 4PZ7A 1K83H 1S3OA 1BVSA 3G71A 2R92H 4AIMA 3HOZG 4JYAL 1G6PA 2R6GA 3FHWA 3KDFB 2NZOA 1OXVA 5BR8L 1N32L 3J7A5 4OXPA 2KHJA 3I55A 2R92G 2VW9A 1J6QA 3F2CA 3K7AH 5GADC 1PH1A 4AYBE 4JI3Q 3GDEA 5M3FG 3GTMH 2EXDA 4LNQA 1VQHA 4GOPC 1BBUA 4WJ4A 3PO2H 1Q1BA 1K73C 4NPSA 3GTGH 4IOAA 1JJCB 1J5EQ 1HZ9A 2CQOA 3L7ZC 2MNAA 3UE0A 2UUCQ 2HIVA 2XGTA 2K5HA 1VQKA 4B3TQ 4A3GG 4GKJQ 1XJVA 1JB7A 3M4QA 1L2FA 3GTOH 4JI4Q 5IYBH 1X55A 1TWHH 2DGYA 5DLQE 5ELOA 3STBC 2JE6I 4BXXH 1V1QA 3PUXA 4HJAA 4IFDJ 5IYBG 2ES2A 3M9BA 1LUZA 1YVCA 3EN2A 3DLLA 4HJ5A 3UDIA 4IPDA 1YJNA 4IPCA 4BXXG 4LF8Q 4RMFA 2HHHL 1N9WA 1HNXL 1OXTA 2ZJPA 5LMUL 4DR1Q 1QZGA 1VQ7A 5C4JH 2ASBA 4DR4L 1Y14B 4OX9L 2E5LQ 3W5OA 3RZDH 4HJ7A 2CCZA 1TWFH 2N3SA 2KCTA 1X3FA 4UP7A 5JJIA 1WYDA 3E0EA 4LFCL 3A5UA 2JA5H 5LMNW 4IFDG 2N49A 4DV2Q 1IBLL 2NN6G 2AWNA 2YYZA 4X66Q 3TS2A 1EOVA 4A3CG 1CUKA 1S72A 3F2DA 3CCMA 1FVIA 2JA5G 2ID0A 1VQNA 2CWAA 1L0WA 4AQYQ 2R93G 1RL2A 4JI1Q 1YIJA 1E7ZA 1V43A 1WFQA 1T9HA 2K5VA 2PQAB 3S1MH 2VQEL 3HKZE 1XNQL 4LUVA 2L15A 1VQAA 2B3GA 3CCQA 2ZTCA 4DUYL 2UU9L 3OYYA 4JC0A 3GTJH 1P8LA 1BKBA 4LFAL 3CD6A 1JT8A 1GVPA 1VQBA 4A3KG 3CQZH 1YHBA 1FGUA 2LXJA 4LF7L 1EIYB 1JMCA 3UDXA 3RN2A 2JA6H 4DV4L 4GKKL 1VQEA 4DV3Q 2OTJA 1PH4A 3BZCA 5IE8A 4DV1L 1HZBA 1QVCA 1XMOL 3M4OH 4B3SL 4O0AA 5GQOA 1YEZA 4JI8Q 2ZM6L 1X9NA 1X65A 3MEFA 1N34Q 1IBKL 4B3ML 2Y0SG 5IWAQ 1K8GA 3D0FA 1EQRA 1GKHA 4AYBG 3CCVA 1I3QH 1YJ9A 2JA7H 4A3DG 3J81c 5AJ3L 1Z47A 2ATWA 3S24A 2K50A 1NTGA 4A3EH 3S16H 4QY7A 4GS3A 3I4MG 4J15A 1TWCH 5K36G 3CMAA 5C44H 1PH7A 4HIDA 4DV7L 1JE5A 4DV6L 4A3EG 2NVQH 2K52A 1CKOA 1WJJA 4OWXB 2K4KA 5E7NA 5C44G 3F8TA 1I5FA 3IRBA 1Z9FA 4X64L 2VNUD 4HJ8A 4NXNQ 2IX0A 3KLWA 1MJEA 3CXCA 2UUAL 1QVFA 2QGQA 2CFMA 3L2PA 2NN6I 3F1ZA 2I0QA 3PSIA 4A4IA 2NVYH 1VQ8A 4OWWB 1WCMH 2RHSB 1E22A 4IOCA 1OTCA 4IO9A 4DAYB 1H95A 4GN3B 1NMGA 4JI3L 1IBML 1SRUA 1WOCA 1WCMG 3K81C 4GOPA 2YU9H 4JBMA 1Y1WH 4A3FG 1Q1EA 2RCNA 3I4NH 1PHJA 1DGSA 3LGJA 2IT1A 2NZHA 5H1SE 1J5EL 4YCUA 3D31A 2UXBQ 3KOJA 2WAQG 2UUCL 3I4NG 4QGUA 4OO1G 2A1AA 3S15H 4JV5Q 1EQQA 4B3TL 4GKJL 2R7ZG 1D8LA 4P74A 4X65L 3A74A 5M3MH 2OCEA 1TXYA 4JI4L 2CKZB 1XPUA 3HKZG 1HNZL 2PMZE 2F4VQ 2PNHA 2ZTDA 3T1YQ 4GNXC 3NEMA 4DR7Q 4DKAC 3S1NH 4X6AH 4LF8L 1UE1A 4GN5A 1M90C 2Y0SE 2KHIA 4JI5L 3S17H 1N36Q 3UE1A 4HIOA 4DR1L 3AQQA 3DM3A 4UP8A 1X54A 1I94Q 2I5LX 3JAMi 2AHOB 4K0KQ 1NE3A 4DR6Q 2H5XA 1PA6A 3S2DH 1JJGA 1VQJA 3PIOA 2YV5A 2OWOA 3PO2G 4DV2L 4PMWA 2MO1A 4X66L 2UXDQ 2LSSA 1RIPA 4POFA 5C0XI 1EYGA 2ZTEA 4AQYL 2OQKA 4JI1L 4LF9Q 3J7ZC 4XIGS 3U50C 3L0OA 3WWVA 3PUYA 1Q81C 4LF4Q 2ALYB 1VQPA 4BY7H 5FLXc 2VS1A 3I4OA 4KHZA 4P71A 4DK3C 1OXXK 1IL2A 2NVTH 4WJ3M 1O7IA 2VL6A 3KF6A 2BH2A 3HOUH 3CPFA 3GTPH 4L5SA 3STBD 1W3SA 3EBEA 3HOYH 2D0PA 2VUMH 2JQOA 1E1TA 1X3GA 1HNWQ 1A63A 5JJKA 4GLAC 3RLFA 4OONA 3VDYA 1L1OC 1VQIA 1GD7A 1VCIA 4A3MH 4HJ9A 3ULLA 4DR3Q 3HOYG 1HZCA 2MO0A 2B29A 1CKNA 2R7FA 3I2ZA 3BZKA 4R4QA 1KXLA 1Q8KA 4JI8L 3A0JA 3KYHC 1FJGQ 4A3MG 2A19A 5IWAL 2QEXA 1HR0L 1R9TH 2WAQE 2AMCB 5IP7H 3PCOB 1AH9A 3NBHB 3ULPA 4GNXB 1VQ9A 4BA1I 4JG2A 4UY8C 4KHPL 3AYHB 1Q82C 5BR8Q 2R7DA 5IP7G 1GM5A 3BJUA 1E24A 1SE8A 1VQ5A 1XMQQ 5IYDH 4LUZA 5GROA 1XNRQ 2BA1A 4L5TA 1LM0A 2RF4A 3HOWH 4A3JH 4GOPB 2IHFA 2F52A 4GLVB 4A93H 4C3JH 3CMEA 2JA8H 3HOVH 4DR2Q 4DK6C 2N8NA 4JCVE 1X6OA 2Z0SA 1E1OA 4NXNL 1VS0A 3CP0A 1YJWA 4A93G 1PFSA 4DV5L 2ZJQA 4R4CA 4EQ5A 4A3LH 2IHEA 4LF6L 1UE5A 4JOIC 2HIXA 3HOXH 3T1HQ 1EUJA 1EWIA 1XPRA 2JA6G 2ZJRA 2PI2E 4PZ6A 4YCVA 5C3EH 4A3LG 2AWOA 1G291 3HOXG 1CSPA 1KAWA 2AKWB 1MJCA 3CC2A 4DV0Q 3AFPA 3PF5A 4L5QA 2F3IA 1D7QA
chains in the Genus database with same CATH superfamily
4K6DA 2EYPA 1GHJA 2K05A 4CJ0B 1I4XA 1ZXTA 4JV5L 1S4ZA 1VDZA 2EYLA 3CQZB 3KFUA 4IFDI 2EYMA 1QJOA 1VMPA 4R1JA 3M4PA 2PYKA 2K7VA 4OWTB 5I6YA 3J80i 1VQ6A 4NKLA 5K36G 1CT1D 4DUYQ 4ILWA 3PV0A 1UWVA 3S2HH 3GD7A 2JA7B 4A3EB 2PNRC 2CVRA 4BBRG 4JVZA 5C44B 2JEBI 4MNOA 5JVG3 2UXDL 1XXGA 1CKNB 3UDGA 3OMGA 1AEXA 1ET6A 2NVQB 1I4QA 4FXGC 4LF9L 3ULJA 1VQ4A 4LF4L 1HUMA 3K8AA 5G3LF 5IODA 1ASYA 1SN8A 2A69D 4P73A 2EIFA 1QVGA 3MWYW 3R93A 2WACA 3F2BA 1VQOA 2RVLA 4QIWE 1O7LA 3KF8A 3JAMc 1ILPA 5FK9C 5EBCA 2OEOA 1HNWL 2J0TD 1WCMB 2E5LL 1C8CA 4FDBA 1VQDA 4WFN3 1U0LA 1U4LA 1X32A 1Y1WB 2IY5B 2PW7A 1LABA 3E0JA 3SK8A 4IPGA 2OQ0A 1V1PA 3K7UC 3SHLA 1ESRA 1W6JA 2JA9A 4K8JA 4B3RQ 2PZTA 4TSSA 5F2DA 3I72A 3EVQA 4P72A 5FO8B 2EDGA 2F0WA 4DR2L 1KNAA 3DWPA 3I56A 1NMFA 4LUOA 4DV3L 3UI2A 5I9PA 3OTOQ 1BCPF 2VUMG 1H9RA 2B2YA 3FPUB 3VR4A 3T1HL 3HFZB 1N34L 3MFYA 1PTOF 2PW5A 1CKMA 5E4WC 2UUBQ 1W2BA 1UEBA 1SE4A 5NUCA 3NENA 3VR2A 5LMNL 1K9MC 2I5MX 1EFID 1YNNC 1UE7A 5ELNA 2Z1CA 1Z6HA 3TREA 1ZEQX 1HR0W 4IFDH 5IYDG 4A3CH 2NN6H 5IP9H 4X3TA 1BF4A 2DY8A 2NVXH 1SLJA 3MA2B 3HOYB 2D62A 1TKWB 4RFBA 4XQQA 2JEAI 5JJZA 4H02A 2O2LD 1EY4A 3X3MA 1E0BA 4KLKA 5C3EG 3KF8B 2SNSA 3AFQA 2EYFA 4XDXA 1O78A 5M5YH 3J81L 2NTSA 3HOWB 4A3JB 4A93B 3E9HA 2JA8B 3GTLH 1V1PB 3EIVA 1SE2A 2KEDA 2QDBA 1TWAH 2VQEQ 4A76A 2UU9Q 2CH4A 4LF5L 4LW1A 5JEAG 4DK0A 4Z9CB 3J81j 1PH2A 4DV5Q 4JI2L 4DV1Q 2RQXA 1X56A 4IPHA 4CDDC 3C3LA 4M1UB 4IJHA 2EYJA 2IWHA 4ZCKA 4QQBX 4ID6A 4CGYB 1LO5D 1S5DD 4JI0L 2J7ZA 1RKNA 2F0IA 4DV7Q 3JC66 3TBIB 3BVMA 5IYCG 4RGNA 3BYYB 2E75C 4DPGA 1XPOA 5L37A 1M8AA 3CCSA 1VF5C 3S2HB 3HG9A 2BCOA 3G71A 3HOZG 3HRZC 1G6PA 1LT6D 3D4WA 4C3IG 4DNRB 5BR8L 3OWEB 3SE0A 4OXPA 3I55A 3VYUA 2VW9A 1J6QA 3F2CA 1G6ZA 3GDEA 1B9MA 4LNQA 1BBUA 1Q1BA 1B3AA 4J1MA 5E3FA 4NPSA 1JJCB 2CQOA 3L7ZC 3UE0A 5FLXL 3DEOA 4ZUIA 1XJVA 1JB7A 5IYBH 3AU7A 1X55A 4BXXH 2KQ3A 1XTCD 1EL0A 1YVCA 4IPDA 1YJNA 5C6AA 5CR3A 1HNXL 1JWMD 2ASBA 4DR4L 5C4JH 1WTPA 4OX9L 1O7ZA 4CJ2C 4F87A 1GUNA 1A15A 4UP7A 1B2TA 3TZUA 4RA8A 3WOEA 1IBLL 2YYZA 2A6ED 3CRLC 1S72A 5G3LD 1DCZA 1VQNA 2R93G 5K5PA 1RL2A 4JI1Q 3ITPA 4Q5VA 1L0XB 4G4KA 3S1MH 4XQJA 4DUYL 3CCQA 1LACA 3OYYA 2KEEA 2MGSA 1JT8A 3QB3A 1G2TA 4A3KG 3OSOA 1K8MA 2B2TA 4HCSA 2OTJA 1PH4A 4FF3A 4B3SL 1X9NA 1YEZA 4JI8Q 4AYBG 1I3QH 2NVXB 1Z47A 1FR3A 1NTGA 2WV6D 3VA7A 1MBYA 1PH7A 1G91A 1GXDC 2EJGC 1JE5A 4K6LA 1CKOA 4RGTA 3VYRA 1WJJA 4OWXB 5E7NA 2EY6A 1Z9FA 1BCPD 3BYTB 1H9SB 4NXNQ 2LS01 3DHQA 3NP8A 2J4XA 2UUAL 1PTOD 3F1ZA 1NR4A 1U4MA 3PSIA 4ME5A 1SBBB 3KBGA 5EKLA 5M5YB 2XIWA 4IOCA 5CV7A 3D4DA 1WOCA 1EY7A 4GOPA 3GTLB 2NZHA 2B2UA 1J5EL 1TWAB 1HXYD 3K6OA 4OO1G 4JV5Q 4QF4A 2A69C 1D8LA 4P74A 3JAML 2D2CC 1TXYA 1XPUA 3EFXD 1BDOA 1B53A 3QWNA 3I73A 5KNCA 2X69A 2F03A 4GNXC 4MHEA 3S1NH 4LF8L 4HIOA 3AQQA 1A2TA 1IKLA 1SMYC 2AHOB 3R2TA 4OHJA 1Y8OB 2B2UC 2K28A 3M4YA 1S5FD 3PO2G 4DV2L 2UXDQ 1STGA 2XSCA 3U9OA 2VXWA 4LF9Q 4J6HA 3WWVA 1MI2A 4LF4Q 1HFGA 3OHXC 1HPCA 1HQRD 3IKJA 2NVTH 1O7IA 1ILQA 3F2UA 4KD3A 2A73B 3GTPH 3BVZA 3STBD 3NQTA 1JWUD 2Z6BA 3EBEA 2VUMH 3FEWX 3IFTA 2PQEA 1KLUD 2EPBA 1LTSD 1E1TA 2Z8LA 1HNWQ 1ENAA 1QCBD 4OONA 1L1OC 5T1IA 4QB4A 3VA5A 4LK1C 3ULLA 1HZCA 2MO0A 2R7FA 1SYDA 3I2ZA 1KXLA 1Q8KA 3A0JA 1Q90A 1FJGQ 5EPJA 4H7BA 2QEXA 2K6AA 1R9TH 1I4HA 5IP7H 1STNA 4GNXB 4UY8C 4CKBA 1Q82C 1UNSA 3BJUA 1E24A 1SNMA 5IYDH 5ELCA 2C9OA 4LUZA 1F77A 1LM0A 4GOPB 2NYZD 3MC0B 4DR2Q 1X6OA 3T13A 1D5XC 1VS0A 4IUUA 1PFSA 4DV5L 1NR2A 3DUZA 4R4CA 1PLFA 5JPNC 3T1HQ 5C4JB 1XX8A 2EZVA 4U68A 3I70A 4N9TA 2PI2E 1RD9D 3BDOA 5C3EH 4A3LG 2AWOA 4RH6A 3HOXG 2AKWB 4IQZA 3CC2A 3AFPA 4YIJA 1SXTA 4L5QA 2MPMA 1DJRD 1D7QA 5LMNQ 4YCWA 3I7FA 3KUPA 4A75A 2BE5D 1PYSB 1U4PA 2KBNA 3S1MB 1J8IA 2V1CC 4NW2A 4RCNA 1QG7A 1LTBD 1JOKA 4PZ8A 3J80c 3N6RA 1PZKD 1X3PA 3MFGA 1GOZA 2CQAA 4C56C 4BY1H 1SROA 4Y7NH 2Y0SB 4RWSC 3M3YH 3W1GA 1IKMA 1WTWA 2Q2HA 4DAMA 2VB3X 4C2MH 3Q23A 2EQSA 4KJNA 3CCRA 4ALPA 4K0KL 1JOQA 1ET9A 1RCVD 1I3QB 2A6HD 4LF7Q 2Z6KC 2QKIC 2Q2TA 3U4VA 1BR9A 1EQTA 4J8QA 1LLRD 1I6HH 1CI3M 1KHIA 1X3QA 1VQLA 3PO3H 3DM1A 5C4HA 4K14A 4UPAA 2CWPA 3CCJA 2X6LA 2Z4HA 4ME3A 3URYA 1V9PA 5IYCH 5FJ8H 5IT9c 5J3BA 4XQNA 3CPWA 1B50A 3G7LA 1YBYA 1K8AC 3NELA 4LF5Q 2Q2IA 4V0BA 4PMBA 4DR3L 3D3RA 3DMUA 2L0CA 2F3VA 5D14A 1KL9A 3FVQA 2WAQB 1PH6A 4KHVA 4JI2Q 3NTHA 5M5XH 4OIJA 4Y52H 1XMQL 1PV4A 3SGIA 4MZ9A 1IBMQ 1XNRL 5KEEA 2MQHA 2DUDA 1EOTA 1KIXA 2A8VA 1C7YA 4JI0Q 3CCLA 5C5MA 4CBVA 4K5WA 3RR5A 2KCMA 3S1NB 1YNJD 4JOIA 3OOCA 4CJ1B 2I5HA 4OO1I 3R3OA 3M7NA 5FOBB 1SEBD 1K3RA 3A8JE 1C48A 2I46A 3GTKH 4DV0L 1D5ZC 1MKHA 2IX1A 4LAAA 1QZHA 4RGOS 1YITA 2C35B 1EY9A 1JJ2A 4U673 2JJQA 2A6EC 2NVTB 3QG1A 2DN8A 3C1EA 1SFOH 3GTPB 4WJWA 2R93H 4BBSG 1KQSA 1F9RA 2VUMB 1JC7A 2WINB 3P75A 2BA0A 2E2IH 3KDFA 3NPPA 4KN4C 1B70B 4DU9A 4A3KH 3V2TA 1EIHA 1GHKA 3ERSX 1R9TB 2K5NA 3K0XA 1KABA 1IW7D 2WB1G 1Q86C 1HNXQ 3GV3A 3DXJC 4RGMA 1Y1VG 2O4XA 3BDLA 4DR4Q 4DAVA 4OX9Q 4H44C 4K5VA 1K28A 3CU7A 1ASZA 2PZUA 4JI7L 5C4XG 4PV1C 1C9OA 4YWKA 1EFWA 1HR0Q 1IBLQ 2KENA 1H9JA 3NSWA 3W2DA 1CA6A 2B63G 1S40A 1KRTA 1SMXA 3OMCA 2OTLA 1Q7YC 2L4NA 2RHQB 3J81i 1BCPC 3L9AX 5C3EB 3RZOH 1PTOC 5FLMG 1PXUA 5C0XH 3FMCA 2WP8J 4A3BH 2EJMA 5E1FA 1Q46A 4UP9A 1QOHA 4TKOB 1EZ6A 4YHHL 4X62L 2XTIA 4B3SQ 3A55A 1D1IA 3RLOA 1NCVA 2D0OA 3BU2A 1JORA 2PQAA 2QCPX 3DEPA 4JBKA 4KKSA 3OW2A 1CSQA 4ZQ3A 2NUCA 1ZKOA 1EWHA 1KNEA 5EQ0A 4RCOA 5J39A 4DUZL 4DFAA 4BY1B 3M3YB 4Y7NB 5I6WA 2VB2X 3VR5A 3Q8DA 2EJFC 4C2MB 2WB1E 3EQLC 3AB9A 2HUGA 1FJGL 2UUAQ 1IYJB 5GAGC 3TQYA 4PZ7A 1K83H 1S3OA 1BVSA 2R92H 4AIMA 4JYAL 2EYHA 3A7AB 1SJED 3KDFB 2NZOA 1LTRD 1N32L 2B8FA 1I6HB 3PO3B 5M3FG 1V8QA 2EXDA 2K01A 5C3WA 4WJ4A 1ZYRD 3PO2H 1PRTC 1J5EQ 1EU4A 1HZ9A 2IPKD 3OWFA 2XGTA 1VQKA 4RHRA 3ERQA 5LHY1 1L2FA 1WTQA 4QCLA 2DGYA 4HR7B 3STBC 2B2WC 4DAYA 1KDCA 4DN4M 1D2BA 3GQBA 3PUXA 4HJAA 1CK1A 5DM73 2ES2A 3FDTA 5HGTA 3DLLA 3UDIA 1STBA 4IPCA 1II3A 5M5XB 2HHHL 4LF8Q 1N9WA 1SNCA 2WKCA 2ZJPA 5LMUL 1QZGA 2ICIA 3HP3A 4FF4A 1Y14B 2QEJC 3W5OA 2PO4A 4HJ7A 1BOSA 2PZWA 2CCZA 2N3SA 2KCTA 1X3FA 1WYDA 2KHSA 3E0EA 4FO2A 2JA5H 2N49A 4DV2Q 3TS2A 3LX0A 1EOVA 3IFDA 3CCMA 3HZXA 2XN9C 3H09A 1MD2D 1YIJA 1PDQA 1E7ZA 1V43A 1WFQA 4ZKCB 1T9HA 2K5VA 3MZ5A 2PQAB 4ZUJA 1I4PA 3HKZE 3WDNA 1XNQL 4LUVA 2L15A 5KNDA 1VQAA 1LT4D 3CD6A 1Y8NB 4JC0A 1P8LA 1BKBA 3A54A 1GVPA 1VQBA 2DJGC 5EPLA 3GTKB 5CBAE 4LF7L 3OPOA 3G6JB 1JMCA 5COYA 5CC4A 4DV4L 2IJ0A 1QVCA 4KMUC 1QWYA 2F0DA 1TR5A 4O0AA 5GQOA 3TP6A 1IBKL 4B3ML 4CKEA 1SDFA 3D0FA 1EQRA 1GKHA 1YJ9A 4HTHA 1SFOB 5AJ3L 2R93B 3HGBA 4TRDA 4GS3A 1TWCH 4IUTA 2E2IB 4HIDA 4DV6L 4A3EG 2K52A 4A3KB 5C44G 1I5FA 2VNUD 2OF1A 1SYEA 3S9WA 2BDOA 2K32A 1MJEA 2F1MA 3NBHA 2I0QA 4A4IA 2RHSB 2A68D 3U9SA 4DAYB 4AYBB 1TIID 1IBML 1WTVA 1WCMG 3K81C 4A3FG 4IURA 3I4NH 1PHJA 2IT1A 5H1SE 4N8FA 2UUCL 2N88A 2A1AA 4R8IA 4DF7A 3S15H 1RF2D 2MHVA 2R7ZG 3RZOB 3A74A 5IT9L 4JI4L 3PMFA 4JK1C 1K8OA 4I7AA 3KLRA 2ZTDA 4A3BB 4IUQA 4FP5D 2RSNA 1FNVA 4H13C 4DKAC 1M90C 3S17H 3A8IE 3UE1A 4DR1L 4UP8A 1TY0A 1X54A 3JAMi 4K0KQ 4MN3A 3T56B 2P5ZX 1CQFA 1H9SA 3PIOA 1JJGA 1VMCA 1LTTD 2KJXA 1EIGA 4KKTA 4PMWA 2MO1A 1FGBD 4PQXA 4AQYL 3U50C 2HCIA 2ALYB 4Q0FA 3T51B 4WJ3M 4P71A 3M7GA 2VL6A 3KF6A 2KA7A 5KIXA 2F0GA 4L5SA 3Q0AA 1K83B 3I90A 2R92B 2WIIB 2JQOA 1SNDA 4ZYSA 1X3GA 1VCIA 4A3MH 3HOYG 4DR3Q 1TQOA 5KNBA 3BZKA 1PYWD 1Y8PB 3PO2B 4BS9A 3CRKC 5IWAL 2F0EA 1HR0L 2AMCB 1G8ZD 3NBHB 5CV9A 3ULPA 3ONAB 4HMJA 3E3XA 4HSVA 1SE8A 2M00A 1STYA 2QW7A 2NTTA 1XMQQ 5GROA 1XNRQ 1F9SA 2RF4A 3R8BA 4GLVB 3CMEA 3EA6A 4JCVE 1E1OA 3BZDB 4A93G 4CDEC 1GUWA 4EQ5A 4ULLA 1UE5A 3TP5A 2HIXA 1EWIA 1K3BC 1RHPA 2FHTA 2JA6G 5CMDA 2ZJRA 4FYDA 5JOBA 4G7HC 5BN4A 2JA5B 4DV0Q 3PF5A 2AQ2B 4IALA 2RCFA 1KRSA 2WKDA 4UAIA 2QA4A 2F0MA 3C2PA 1WD0A 3TRZA 5A35A 1SNQA 3P1HA 2E2HH 4XTCS 1C0AA 2F0SA 1AZQA 1FYCA 4KY5A 4LFCQ 5IGEA 3H15A 1YZ6A 2F4VL 2XRQD 2XRSD 2L1BA 4GNXA 5K36H 1I6VC 4EQPA 3KJPA 2B2VC 3N52A 5IGFA 1LTID 2BH8A 4IJLA 3TP7A 3ZYYX 1N36L 4TVAB 1WI5A 3KF6B 3QOLA 1I94L 4ZK9B 3ER0A 2IW3A 4ZLTF 4DR6L 4BBRH 1KAAA 3TS0A 1CQVA 4POGA 2JK8A 3A8KE 3KLSA 4R4TA 5A2QL 1TWCB 4HCEA 3GTQH 1B8AA 5GAHC 4JI7Q 4MTKA 2AQ3B 4MIUA 2E8GA 5M3MG 5KGUA 1VQMA 1NAPA 3PUWA 4BA2I 5ELEA 4CKCA 4XT3B 1L1OA 1DM0B 4KI0A 3K80C 1A2UA 2MJ8A 4L8JA 3I4NB 2H1EA 2SEBD 4YHHQ 4X62Q 1UAPA 5EAYA 1IL8A 5IGGA 1SYGA 5M3FH 3S15B 1ZYRC 1NJIC 3B6YA 4B9XA 2DY7A 1T5XD 3M85A 2X6GA 1XTDA 4BY7G 4O42A 1DZ1A 2G5DA 1KC8C 3FP9A 1OXUA 4DUZQ 1WTXA 5LL6S 3HOUG 1U5KA 4EQNA 3Q6SA 1D5MC 1PH9A 1CZWA 3S17B 5C4ZA 2VY3A 3MXNA 1U9RA 3GV6A 3TEHB 4F88A 4O2DA 4X65Q 3H94A 2NWGA 3PIPA 1JQYD 2YTYA 2F0QA 5C5LA 3ICEA 1HA6A 1HNZQ 4JYAQ 1QUQA 1N32Q 4HSPA 2CHBD 4QJFA 1GUGA 4JI5Q 4KN7C 3PQIA 3RLNA 5IY0A 1G2SA 2F3WA 2MUYA 1PFBA 5ELDA 4BWGB 4QL5A 1UE6A 3SK4A 4RKLA 4APVA 1E2WA 3SK6A 1F2YA 4C3JG 3NUCA 3PF4A 1NUCA 2F0FA 3HOVG 5IP9G 4KY7A 2M9VA 1NBWA 1AE3A 3DWQA 5IGDA 4P75A 2FMMA 4A3MB 4LFBL 2K75A 3I91A 4R4IA 4YY3L 1F2ZA 1WTRA 1SR3A 3CCUA 4JBJA 2HHHQ 2Z6KA 3A56A 1RODA 3ZJYC 1A3UA 5LMUQ 1N8RC 5EBDA 1PH3A 1L1OB 3BG3A 3CC7A 1HJPA 1PH5A 1KLGD 1B9NA 4WRDA 4S3SA 2ENBA 2LKVA 1IXRA 4XXEA 1OO9B 5M5WH 1IYUA 3LWUA 5JJLA 4OGQC 5CV6A 1SNOA 3PGZA 2MFIA 4QIWB 5D3IB 4KHPQ 1V1OA 4P2CB 5C0XJ 2E2JH 1OXSC 1N33L 1XNQQ 5JEAH 5IIFA 1LT5D 4JI6L 4IUVA 2K14A 1A62A 3H6MA 1VQCA 2RDFA 2GVAA 1TVXA 2L5TA 4ZAIA 2VQFL 3D8GA 2DNEA 4DV4Q 1FL0A 1TS2A 3RNUA 3MXNB 3SXHA 4B3MQ 4DR5L 1IBKQ 2E2HB 4R4OA 2GVBA 1PH8A 2KECA 3MVVA 4GN4B 1GO3E 2YTXA 1PTOH 4A3FH 2QILA 2HQLA 1S5BD 3NK9A 5AJ3Q 1MIUA 1STAA 1QUQB 3S1RH 2O5JC 3HKSA 1A6XA 1NY4A 1A8VA 4NXML 2UXCL 2Z4IA 2R7ZH 4DV6Q 5HY6A 1EY0A 3FKIG 1D1KA 4A3IG 1CFMA 2K04A 3H0GG 4JBWA 4PNYA 3MTSA 4IN3A 3HOZH 5GAEC 4BBRB 4C3IH 3S14H 1LTLA 2K03A 3ND8A 4O1NA 2R6GA 4LMQD 1OXVA 2HD3A 4XYOA 3J7A5 3GTQB 4R8NA 2KHJA 4DXFA 1PH1A 1H9KA 3WOFA 3GTMH 4NP5A 1BO0A 1K73C 3GTGH 4IOAA 2CW0D 1LT3D 2UUCQ 2K5HA 4A3GG 4JW0A 1DONA 3J81E 1F2LA 4JI4Q 2AUJD 1ESFA 1TWHH 5ELOA 2JE6I 2DNCA 5J1ZA 4E6IA 5CYUA 3OIPA 4IFDJ 2TSSA 5IYBG 1UUPA 4HJ5A 4BXXG 1JCKB 4N9PA 4DR1Q 2XVSA 5M3FB 1DD2A 3SDZA 3RZDH 4IUNA 1GJXA 4NMZA 1EWCA 1ENCA 1ONLA 1TWFH 5JJIA 4X3UA 4LFCL 3A5UA 5LMNW 5IOCA 4HN7A 2BOSA 2BDNA 1FVIA 2CWAA 1SNPA 2FINB 1L0WA 4AQYQ 3NE5B 1EY6A 5FO9B 2RSOA 3ND9A 4OL7A 4OEMB 1F9QA 2ZTCA 4LFAL 3GTJH 4ODGA 2RBMA 1PZID 1FD7D 2F0PA 1YHBA 2LXJA 4DGZA 2IL8A 2F0HA 4KKUA 1RTOA 3RN2A 2JA6H 4ABNA 4GKKL 1VQEA 2GA4B 4G7ZC 3BZCA 1HZBA 1XMOL 3M4OH 2SDFA 4KJOA 1GUOA 1VF7A 2F0TA 3MEFA 2Y0SG 5IWAQ 5DM63 3VYSA 3K5LA 4A3DG 2RA4A 3KLSX 2ATWA 3S24A 5DAUA 3S16H 4QY7A 1U4RA 4M8AA 4FNFA 1Q3LA 2EOTA 5E4XA 3I4MG 3P7JA 4PMCA 3CMAA 1EYDA 1BBXC 2RDHA 2JP1A 2K4KA 4X64L 3IRBA 4HJ8A 4OELB 2IX0A 3NBIA 3C1FA 3CXCA 2L12A 1QVFA 2Q8TA 2QGQA 3L2PA 1TT2A 3TMEA 1IHZA 2NN6I 5FLXE 2NVYH 1VQ8A 4OWWB 1I4RA 1B4OA 1E22A 5CGKA 1OTCA 4IO9A 2E76C 4X3KA 2KVMA 4GN3B 3J7AV 2HDLA 1PFMA 4JI3L 1SRUA 2YU9H 4JBMA 5M5WB 2RCNA 2G9DA 3J7YW 4OO1H 1S5ED 4YCUA 5CV4A 1F2MA 4C3HG 5J22A 3KOJA 2E2JB 2WAQG 1ICFB 1ENFA 2ZXRA 1EQQA 4B3TL 4GKJL 1GUSA 4X65L 5M3MH 2OCEA 2B2WA 3HKZG 1HNZL 2PMZE 3NQIA 2F4VQ 3X3NA 2DJFC 4C1NK 3K58A 5FKAC 3T1YQ 1SJHD 3NEMA 2PCFB 3QIAA 4X6AH 1UE1A 4GN5A 1DOKA 2Y0SE 4JI5L 1BCPB 1N36Q 5ELFA 1I94Q 2HCCA 1PTOB 4A3FB 4DR6Q 1GUTA 2ZXPA 1PA6A 3S2DH 1Q8IA 3S1RB 2D9UA 5KYIA 5LL6X 3SVMA 2OWOA 3RUZA 1SMYD 4X66L 2F0KA 3MXUA 2C5CA 2R7ZB 2ZTEA 1E2VA 5M9OA 1CHQD 4XIGS 5I2XA 1Q81C 1MSHA 1WTHA 2ZXOA 4BY7H 3I4OA 1IL2A 4DK3C 3MHBA 3HOZB 2BH2A 2OT2A 3PIO3 3HOUH 2L9HA 4C3IB 3S14B 4FXKC 1AP0A 2D0PA 4K5XA 5EKIA 2K5DA 1A63A 3D6WA 5JJKA 4GLAC 2Z9HA 1EYCA 4HJ9A 2V4DA 2B29A 4R4QA 2EY1A 3GTMB 4EGVA 2WAQE 3GTGB 2H4OA 1AH9A 4KTAA 2K33A 4KHPL 3AYHB 3VR3A 5JAVA 5IP7G 1QILA 1TWHB 4QUCA 2IHFA 2F52A 1D6EC 2AQ1B 4C3JH 1PRTB 3HOVH 1M4VA 4DK6C 3C46A 4IUPA 4DXGA 3CP0A 2JYOA 1YJWA 1BNZA 4FVMA 4A3LH 1CM9A 2JXMB 3HOXH 1FNUA 2HDMA 1QE6A 2B2YC 5A2QE 1NSNS 1LTGD 4YCVA 3RZDB 1AFPA 1G291 2LMCB 3JAME 1TWFB 4K8IA 1KAWA 1MJCA 2BE5C 1EY5A 1STHA 4UDUC 2IX3A 2JA7G 5CORA 1YNXA 3E6ZX 1P16A 3S1QH 1PVOA 2UXBL 3J80L 4CDCC 3K59A 2PI2A 1HRJA 4MTNA 3GTJB 1RJTA 2VZAA 1C4QA 3D4RA 3MEHA 1FNWA 4CDFC 3UDFA 1PRTF 4XYQA 1E3PA 5D65A 1G51A 5ISRA 1I50H 2JA6B 3G4SA 1HZAA 2F0NA 2LXKA 2F0UA 4DR7L 4LFBQ 3IL8A 3M4OB 2A6HC 5FO7B 4YY3Q 4YWMA 1EYAA 4KD4A 4BY1G 1STEA 1YHAA 3QO2A 3HEJA 3P20A 3CW2C 3QR8A 4CHTB 3KJOA 2Q8IB 5AFWA 3TDQA 3CCEA 4HAEA 1YI2A 1Y1WG 3S16B 1HTLD 3V05A 3Q24A 1JICA 1W6KA 2Q8RE 1TS5A 2ZM6Q 3K5MA 4FXDA 5IGCA 3G6EA 3PO3G 3K5NA 1PYBA 2HT1A 3FKIH 4B08A 4A3IH 3U58A 3FPPA 3MXPA 3U4ZA 1N33Q 3I8ZA 3H0GH 2NVYB 5C3XA 4JI6Q 5FJ8G 1K0RA 2GN5A 2QF7A 2KCCA 2EE1A 2TMPA 3QJYA 5HGQA 2VQFQ 4WORA 1B7YB 2YU9B 4TQUS 5EKKA 4RG1A 1UEAB 1J9OA 5JPMC 4HIMA 2M2LA 1RTNA 5CV5A 4HEDA 4ZKBB 4DR5Q 1AZPA 2CW0C 5M3MB 1CZGA 2B8GA 1YNJC 4NXMQ 4L5RC 2UXCQ 1JE4A 1HH2P 5I9OA 4A3GH 5KRUA 4C1NI 5CV8A 1DOLA 1M1KC 4DNIA 1VQFA 3PUVA 3TN2A 5BN3A 3S2DB 1DYQA 3H3VI 1QNKA 3T53B 4KV6A 4HIKA 4EX5A 4G7OC 3R2IA 4NB3A 4AH6A 2K5QA 3PIP3 1NNXA 4BY7B 4BBSH 4DA2A 1BBWA 3HOWG 2F0LA 3HOUB 4A3JG 3E9IA 2RDGA 2FFKB 2EVBA 3EROA 2FXQA 2JA8G 3GO5A 2YTVA 4KY6A 2B2VA 1EIFA 1IW7C 1X3EA 4DK1A 4YWLA 1EZ8A 2WFWA 1TWGH 5JVH3 2FJ2A 1Y1VH 2AUKA 4LWCA 1WTOA 5DNFA 1HHVA 3CC4A 3RN5A 3QOJA 3CF5A 4QUFA 5C4XH 1SSOA 4F7XA 2B63H 1E2ZA 2NZ1D 5CBEE 4FF2A 4A3DH 4PG3A 1A0IA 4C3JB 5JEAJ 3HOVB 2F0JA 4F8MA 5EGTA 1VQGA 3I4MH 4N8X1 5EPKA 5KYLA 3T1YL 2Q2UA 2KUMA 3I3CA 1YHQA 2EY2A 3HOXB 2R61A 4NDXA 5FLMH 3CAMA 3BVGA 3W1BA 4L63B 4LFAQ 3Q22A 1EQVA 2NB0A 1TU2B 4OIKA 1IZ6A 5IGBA 4GLXA 2B2TC 3SEBA 4GKKQ 3G48A 1ICWA 5DEHA 5C0XG 1LTAD 3KK7A 3PUZA 1XMOQ 4LF6Q 3S1QB 4A3BG 2N78A 1MGSA 4B3RL 1Q12A 3I4LA 4DAPA 1LV9A 4GZYC 1AE2A 1JWSD 1RDPD 4FF1A 1EEFD 3NTKA 4C3HH 1I50B 2N55A 2ZT9C 2OXPA 3AEVA 1HCZA 3A5ZB 1LYLA 3OTOL 1KD1C 4X64Q 2O5IC 3H3VH 1O7YA 4L6TB 1MSGA 1R4QB 2UUBL 1WVLA 2A74C 3FHWA 2MP1A 3SR1A 2R92G 3K7AH 5GADC 4JI3Q 4AYBE 2NBFA 1Y69U 3NTIA 1VQHA 4GOPC 1KTKA 3CKIB 5I2YA 2MNAA 3FKIB 4A3IB 2HIVA 4B3TQ 5HURA 4GKJQ 1PRTD 3H0GB 4EVOA 3M4QA 3GTOH 1S5CD 5DLQE 2FMCA 1V1QA 1IYVA 2LFNA 2SNMA 3M9BA 1LUZA 3EN2A 2L11A 3BS1A 3A7LA 1B1ZA 4RMFA 1OXTA 3E5SA 3MXGA 1VQ7A 4V190 1AN8A 2E2DC 4X3SA 2E5LQ 3TZDA 3OW7A 1YNND 1JB3A 4ZRZA 4IFDG 2EYOA 4A3CG 2NN6G 2AWNA 4X66Q 1HFNA 4A3GB 1CUKA 3F2DA 5TSSA 2JA5G 2ID0A 2F0OA 1HTPA 3RD4A 3K0YA 2VQEL 1K0SA 2B3GA 2UU9L 1DOMA 3K57A 1O80A 2SOBA 1BQQT 3CQZH 1FGUA 1EIYB 1SYBA 1SYFA 3UDXA 1CHPD 4DV3Q 5IE8A 4DV1L 3EJIA 2ZM6L 1N34Q 1X65A 1L0YB 4BBSB 1K8GA 1XYIA 2RKSA 3CCVA 1T5EA 2JA7H 3J81c 2K50A 4A3EH 4IZ8A 2XNAC 4J15A 2KCNA 4R9WA 1CTMA 5C44H 2HQEA 4DV7L 2NVQH 3KBXA 2ICEC 1B3QA 3CHBD 2QDLA 2WB1B 3BDCA 5EJWA 1TWGB 1JOOA 3F8TA 1Y1VB 3GP7A 3KLWA 1XWEA 2PMZB 2A68C 2CFMA 3NXWA 3NHHA 5BN5A 3LNNA 1A3TA 5C4XB 1AW7A 1SYCA 1WCMH 3D6CA 5T1GA 1ML0D 1EY8A 1PFNA 4B9WA 3LWEA 2B63B 1I4GA 1H95A 2EXZA 4A3DB 3H3VC 1NMGA 1SAPA 2A5HA 1Y1WH 1HQMC 1Q1EA 1A3VA 2JN4A 1HUNA 3I4MB 1DGSA 3LGJA 2G9HD 2F4IA 4UHVA 1JR0D 3D31A 2UXBQ 3FRPB 3I4NG 4QGUA 3T16A 3W3AA 4G57A 3MAQA 1PMRA 1DXMA 2XWJB 3NWTA 1TS4A 2CKZB 4XT1B 3VYTA 2PNHA 3K5OA 2CH4W 1R4PB 4RAUC 4DR7Q 2KHIA 3DM3A 3O13A 2I5LX 1KDAA 1EU3A 1NE3A 2D5DA 2K5WA 4RHSA 2H5XA 1VQJA 1TY2A 2YV5A 4C3HB 2I07B 3TP8A 2K1BA 2JSOA 1H9MA 2LSSA 1RIPA 2XWBB 4POFA 5C0XI 1EYGA 1BXTA 2OQKA 1MHWC 2EY5A 1BUVT 4JI1L 3J7ZC 2KOLA 3L0OA 1TS3A 3PUYA 1PZJD 3HKZB 3TSSA 1VQPA 3HS0C 5FLXc 2VS1A 4KHZA 1OXXK 3V96A 3CPFA 3SK5A 1HA5A 1W3SA 2E74C 4HMIA 4I65A 3HOYH 1QNUA 4LJZC 3RLFA 3VDYA 1VQIA 1GD7A 4RKBA 3J80E 1CKNA 3K7AB 5ELBA 4JI8L 1B44D 3KYHC 4A3MG 2A19A 4K2KA 4K2LA 4H0LC 5I4DA 4JPBW 3PCOB 4DNTB 3J7AF 1F9PA 3OIQA 2L55A 4BA1I 4JG2A 4EQOA 1VQ9A 5BR8Q 1WD1A 2R7DA 3RMHA 1GM5A 1VQ5A 2PPBC 3GTOB 2BA1A 4L5TA 3HOWH 4A3JH 4A93H 2B39A 3T4AC 2JA8H 4KK7A 1KDBA 1EEID 2N8NA 4I7ZC 2Z0SA 4NXNL 3DWAA 4QMGA 1CA5A 5D3DA 1QB5D 2ZJQA 2F0VA 2IHEA 3VR6A 4LF6L 4JOIC 1XPRA 1EUJA 3IAYA 3AMUA 3L3OC 4PZ6A 1CSPA 5IT9E 1SE3A 1Z7TA 2LY7A 2R3ZA 3H91A 3NWSA 2F3IA
chains in the Genus database with same CATH topology
1KRSA 5LMNQ 4YCWA 2JA7G 3I7FA 2QA4A 1YNXA 1P16A 3S1QH 3TRZA 4A75A 2UXBL 1PVOA 1PYSB 2KBNA 2E2HH 4XTCS 1C0AA 4JV5L 2V1CC 2PI2A 4MTNA 4LFCQ 2VZAA 3H15A 1YZ6A 4PZ8A 3UDFA 3KFUA 4IFDI 1E3PA 3J80c 2F4VL 4R1JA 3M4PA 1G51A 1I50H 4GNXA 3G4SA 3KJPA 1HZAA 4BY1H 2LXKA 3M3YH 1SROA 4OWTB 4Y7NH 4DR7L 3J80i 3W1GA 4LFBQ 2BH8A 1VQ6A 4IJLA 2Q2HA 4DAMA 4YY3Q 1N36L 4YWMA 4C2MH 4TVAB 2EQSA 3CCRA 4DUYQ 1WI5A 4BY1G 4ALPA 3KF6B 1YHAA 1I94L 4K0KL 3ER0A 3CW2C 4DR6L 4BBRH 3PV0A 1UWVA 3S2HH 3GD7A 4LF7Q 2Z6KC 3KJOA 2Q2TA 3TS0A 3CCEA 1YI2A 1Y1WG 3U4VA 4POGA 2JK8A 4BBRG 4R4TA 2JEBI 4MNOA 3GTQH 2UXDL 1CKNB 3UDGA 1B8AA 5GAHC 4JI7Q 1KHIA 2ZM6Q 3PO3H 1VQLA 1I6HH 4LF9L 3ULJA 1VQ4A 4UPAA 2CWPA 4LF4L 3CCJA 3K8AA 1ASYA 1SN8A 3G6EA 2E8GA 5M3MG 3PO3G 4P73A 1PYBA 2EIFA 4ME3A 1VQMA 1QVGA 3F2BA 1VQOA 3PUWA 2HT1A 4QIWE 3FKIH 1V9PA 5IYCH 5FJ8H 3JAMc 4A3IH 3U58A 5IT9c 5J3BA 4BA2I 3U4ZA 3CPWA 1N33Q 3H0GH 4JI6Q 1HNWL 1YBYA 1L1OA 1K8AC 4KI0A 1K0RA 2GN5A 3NELA 5FJ8G 2Q2IA 2E5LL 4LF5Q 3K80C 4DR3L 4FDBA 5HGQA 1VQDA 2VQFQ 1KL9A 1U0LA 1B7YB 4TQUS 2IY5B 1PH6A 4RG1A 4JI2Q 4HIMA 4IPGA 4YHHQ 5M5XH 4X62Q 2OQ0A 3K7UC 4DR5Q 5EAYA 2JA9A 5M3FH 4B3RQ 1NJIC 4Y52H 3B6YA 1XMQL 1PV4A 3SGIA 4MZ9A 1IBMQ 1XNRL 3M85A 2MQHA 4P72A 1XTDA 2DUDA 4L5RC 4NXMQ 1KIXA 2UXCQ 4BY7G 2A8VA 1KC8C 1HH2P 1C7YA 3FP9A 4DR2L 3CCLA 4JI0Q 1OXUA 4A3GH 4DUZQ 3RR5A 3I56A 3HOUG 1NMFA 1U5KA 2KCMA 4LUOA 1PH9A 4DV3L 3OTOQ 4JOIA 2VUMG 2VY3A 2I5HA 3T1HL 4OO1I 3TEHB 1M1KC 3HFZB 4O2DA 4X65Q 4DNIA 3PIPA 1VQFA 2YTYA 3PUVA 1N34L 3M7NA 3ICEA 1CKMA 1K3RA 2UUBQ 1W2BA 1HNZQ 3GTKH 1UEBA 4DV0L 3H3VI 4JYAQ 1QUQA 3NENA 5LMNL 1MKHA 1K9MC 2I5MX 2IX1A 1N32Q 4QJFA 1QZHA 4HIKA 1UE7A 5ELNA 3TREA 4EX5A 4JI5Q 1YITA 2C35B 3RLNA 5IY0A 4NB3A 4AH6A 1JJ2A 2JJQA 1HR0W 4BBSH 5IYDG 4A3CH 1BBWA 5IP9H 4QL5A 1UE6A 3HOWG 4APVA 1SFOH 4A3JG 2NVXH 1SLJA 3E9IA 2R93H 4BBSG 1KQSA 2FXQA 2JA8G 3HOVG 3PF4A 3GO5A 2D62A 5IP9G 2YTVA 2JEAI 1NBWA 1AE3A 2BA0A 2E2IH 3KDFA 1EIFA 4P75A 1X3EA 4LFBL 1B70B 4YWLA 2K75A 4A3KH 2WFWA 4R4IA 1TWGH 4YY3L 4H02A 5C3EG 1Y1VH 4KLKA 3ERSX 1SR3A 3CCUA 4LWCA 2K5NA 3K0XA 3KF8B 2WB1G 4JBJA 2HHHQ 1Q86C 2Z6KA 1HNXQ 3ZJYC 5LMUQ 3CC4A 1Y1VG 3RN5A 3AFQA 3CF5A 1N8RC 1PH3A 4DR4Q 4OX9Q 5C4XH 1L1OB 5M5YH 1HJPA 3CC7A 1PH5A 1ASZA 2B63H 4JI7L 4A3DH 5C4XG 1IXRA 4PG3A 1C9OA 3E9HA 1A0IA 4YWKA 5JEAJ 1EFWA 1HR0Q 1IBLQ 2KENA 5M5WH 2B63G 1VQGA 3GTLH 3I4MH 5JJLA 3PGZA 2MFIA 3T1YL 3EIVA 2Q2UA 1S40A 4KHPQ 1KRTA 1SMXA 5C0XJ 2E2JH 2OTLA 1YHQA 1TWAH 1OXSC 1Q7YC 2VQEQ 1N33L 5FLMH 2RHQB 3CAMA 3J81i 1XNQQ 4A76A 2UU9Q 3W1BA 4LFAQ 4JI6L 3RZOH 2K14A 4LF5L 1A62A 1VQCA 4LW1A 5FLMG 5JEAG 2GVAA 1IZ6A 3J81j 2VQFL 4GLXA 2WP8J 1PH2A 4A3BH 4DV4Q 1Q46A 4GKKQ 1FL0A 4DV5Q 3G48A 4UP9A 4JI2L 4LF6Q 5C0XG 3PUZA 4X62L 2XTIA 4YHHL 1X56A 4DV1Q 3RNUA 3MXNB 1XMOQ 4B3SQ 4IPHA 4A3BG 4B3MQ 4DR5L 2N78A 1IBKQ 4R4OA 2GVBA 3RLOA 1PH8A 4B3RL 4GN4B 1GO3E 1Q12A 2D0OA 2PQAA 2YTXA 3BU2A 4IJHA 4A3FH 1AE2A 2HQLA 4QQBX 4JBKA 5AJ3Q 3OW2A 1MIUA 1CSQA 1QUQB 4C3HH 3S1RH 3HKSA 1NY4A 1A8VA 4NXML 2UXCL 4JI0L 4DUZL 4DV6Q 5HY6A 4DV7Q 3JC66 3FKIG 2R7ZH 5IYCG 3AEVA 4A3IG 3A5ZB 1LYLA 3OTOL 3Q8DA 1KD1C 3H0GG 4JBWA 2WB1E 4DPGA 4X64Q 1XPOA 3H3VH 1FJGL 3HOZH 5GAEC 2UUAQ 1IYJB 3CCSA 5GAGC 4C3IH 2UUBL 3TQYA 3S14H 1LTLA 4PZ7A 1K83H 1S3OA 1BVSA 3G71A 2R92H 4AIMA 3HOZG 4JYAL 1G6PA 2R6GA 3FHWA 3KDFB 2NZOA 1OXVA 5BR8L 1N32L 3J7A5 4OXPA 2KHJA 3I55A 2R92G 2VW9A 1J6QA 3F2CA 3K7AH 5GADC 1PH1A 4AYBE 4JI3Q 3GDEA 5M3FG 3GTMH 2EXDA 4LNQA 1VQHA 4GOPC 1BBUA 4WJ4A 3PO2H 1Q1BA 1K73C 4NPSA 3GTGH 4IOAA 1JJCB 1J5EQ 1HZ9A 2CQOA 3L7ZC 2MNAA 3UE0A 2UUCQ 2HIVA 2XGTA 2K5HA 1VQKA 4B3TQ 4A3GG 4GKJQ 1XJVA 1JB7A 3M4QA 1L2FA 3GTOH 4JI4Q 5IYBH 1X55A 1TWHH 2DGYA 5DLQE 5ELOA 3STBC 2JE6I 4BXXH 1V1QA 3PUXA 4HJAA 4IFDJ 5IYBG 2ES2A 3M9BA 1LUZA 1YVCA 3EN2A 3DLLA 4HJ5A 3UDIA 4IPDA 1YJNA 4IPCA 4BXXG 4LF8Q 4RMFA 2HHHL 1N9WA 1HNXL 1OXTA 2ZJPA 5LMUL 4DR1Q 1QZGA 1VQ7A 5C4JH 2ASBA 4DR4L 1Y14B 4OX9L 2E5LQ 3W5OA 3RZDH 4HJ7A 2CCZA 1TWFH 2N3SA 2KCTA 1X3FA 4UP7A 5JJIA 1WYDA 3E0EA 4LFCL 3A5UA 2JA5H 5LMNW 4IFDG 2N49A 4DV2Q 1IBLL 2NN6G 2AWNA 2YYZA 4X66Q 3TS2A 1EOVA 4A3CG 1CUKA 1S72A 3F2DA 3CCMA 1FVIA 2JA5G 2ID0A 1VQNA 2CWAA 1L0WA 4AQYQ 2R93G 1RL2A 4JI1Q 1YIJA 1E7ZA 1V43A 1WFQA 1T9HA 2K5VA 2PQAB 3S1MH 2VQEL 3HKZE 1XNQL 4LUVA 2L15A 1VQAA 2B3GA 3CCQA 2ZTCA 4DUYL 2UU9L 3OYYA 4JC0A 3GTJH 1P8LA 1BKBA 4LFAL 3CD6A 1JT8A 1GVPA 1VQBA 4A3KG 3CQZH 1YHBA 1FGUA 2LXJA 4LF7L 1EIYB 1JMCA 3UDXA 3RN2A 2JA6H 4DV4L 4GKKL 1VQEA 4DV3Q 2OTJA 1PH4A 3BZCA 5IE8A 4DV1L 1HZBA 1QVCA 1XMOL 3M4OH 4B3SL 4O0AA 5GQOA 1YEZA 4JI8Q 2ZM6L 1X9NA 1X65A 3MEFA 1N34Q 1IBKL 4B3ML 2Y0SG 5IWAQ 1K8GA 3D0FA 1EQRA 1GKHA 4AYBG 3CCVA 1I3QH 1YJ9A 2JA7H 4A3DG 3J81c 5AJ3L 1Z47A 2ATWA 3S24A 2K50A 1NTGA 4A3EH 3S16H 4QY7A 4GS3A 3I4MG 4J15A 1TWCH 5K36G 3CMAA 5C44H 1PH7A 4HIDA 4DV7L 1JE5A 4DV6L 4A3EG 2NVQH 2K52A 1CKOA 1WJJA 4OWXB 2K4KA 5E7NA 5C44G 3F8TA 1I5FA 3IRBA 1Z9FA 4X64L 2VNUD 4HJ8A 4NXNQ 2IX0A 3KLWA 1MJEA 3CXCA 2UUAL 1QVFA 2QGQA 2CFMA 3L2PA 2NN6I 3F1ZA 2I0QA 3PSIA 4A4IA 2NVYH 1VQ8A 4OWWB 1WCMH 2RHSB 1E22A 4IOCA 1OTCA 4IO9A 4DAYB 1H95A 4GN3B 1NMGA 4JI3L 1IBML 1SRUA 1WOCA 1WCMG 3K81C 4GOPA 2YU9H 4JBMA 1Y1WH 4A3FG 1Q1EA 2RCNA 3I4NH 1PHJA 1DGSA 3LGJA 2IT1A 2NZHA 5H1SE 1J5EL 4YCUA 3D31A 2UXBQ 3KOJA 2WAQG 2UUCL 3I4NG 4QGUA 4OO1G 2A1AA 3S15H 4JV5Q 1EQQA 4B3TL 4GKJL 2R7ZG 1D8LA 4P74A 4X65L 3A74A 5M3MH 2OCEA 1TXYA 4JI4L 2CKZB 1XPUA 3HKZG 1HNZL 2PMZE 2F4VQ 2PNHA 2ZTDA 3T1YQ 4GNXC 3NEMA 4DR7Q 4DKAC 3S1NH 4X6AH 4LF8L 1UE1A 4GN5A 1M90C 2Y0SE 2KHIA 4JI5L 3S17H 1N36Q 3UE1A 4HIOA 4DR1L 3AQQA 3DM3A 4UP8A 1X54A 1I94Q 2I5LX 3JAMi 2AHOB 4K0KQ 1NE3A 4DR6Q 2H5XA 1PA6A 3S2DH 1JJGA 1VQJA 3PIOA 2YV5A 2OWOA 3PO2G 4DV2L 4PMWA 2MO1A 4X66L 2UXDQ 2LSSA 1RIPA 4POFA 5C0XI 1EYGA 2ZTEA 4AQYL 2OQKA 4JI1L 4LF9Q 3J7ZC 4XIGS 3U50C 3L0OA 3WWVA 3PUYA 1Q81C 4LF4Q 2ALYB 1VQPA 4BY7H 5FLXc 2VS1A 3I4OA 4KHZA 4P71A 4DK3C 1OXXK 1IL2A 2NVTH 4WJ3M 1O7IA 2VL6A 3KF6A 2BH2A 3HOUH 3CPFA 3GTPH 4L5SA 3STBD 1W3SA 3EBEA 3HOYH 2D0PA 2VUMH 2JQOA 1E1TA 1X3GA 1HNWQ 1A63A 5JJKA 4GLAC 3RLFA 4OONA 3VDYA 1L1OC 1VQIA 1GD7A 1VCIA 4A3MH 4HJ9A 3ULLA 4DR3Q 3HOYG 1HZCA 2MO0A 2B29A 1CKNA 2R7FA 3I2ZA 3BZKA 4R4QA 1KXLA 1Q8KA 4JI8L 3A0JA 3KYHC 1FJGQ 4A3MG 2A19A 5IWAL 2QEXA 1HR0L 1R9TH 2WAQE 2AMCB 5IP7H 3PCOB 1AH9A 3NBHB 3ULPA 4GNXB 1VQ9A 4BA1I 4JG2A 4UY8C 4KHPL 3AYHB 1Q82C 5BR8Q 2R7DA 5IP7G 1GM5A 3BJUA 1E24A 1SE8A 1VQ5A 1XMQQ 5IYDH 4LUZA 5GROA 1XNRQ 2BA1A 4L5TA 1LM0A 2RF4A 3HOWH 4A3JH 4GOPB 2IHFA 2F52A 4GLVB 4A93H 4C3JH 3CMEA 2JA8H 3HOVH 4DR2Q 4DK6C 2N8NA 4JCVE 1X6OA 2Z0SA 1E1OA 4NXNL 1VS0A 3CP0A 1YJWA 4A93G 1PFSA 4DV5L 2ZJQA 4R4CA 4EQ5A 4A3LH 2IHEA 4LF6L 1UE5A 4JOIC 2HIXA 3HOXH 3T1HQ 1EUJA 1EWIA 1XPRA 2JA6G 2ZJRA 2PI2E 4PZ6A 4YCVA 5C3EH 4A3LG 2AWOA 1G291 3HOXG 1CSPA 1KAWA 2AKWB 1MJCA 3CC2A 4DV0Q 3AFPA 3PF5A 4L5QA 2F3IA 1D7QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KRS A;  5LMN Q;  4YCW A;  2JA7 G;  3I7F A;  2QA4 A;  1YNX A;  1P16 A;  3S1Q H;  3TRZ A;  4A75 A;  2UXB L;  1PVO A;  1PYS B;  2KBN A;  2E2H H;  4XTC S;  1C0A A;  4JV5 L;  2V1C C;  2PI2 A;  4MTN A;  4LFC Q;  2VZA A;  3H15 A;  1YZ6 A;  4PZ8 A;  3UDF A;  3KFU A;  4IFD I;  1E3P A;  3J80 c;  2F4V L;  4R1J A;  3M4P A;  1G51 A;  1I50 H;  4GNX A;  3G4S A;  3KJP A;  1HZA A;  4BY1 H;  2LXK A;  3M3Y H;  1SRO A;  4OWT B;  4Y7N H;  4DR7 L;  3J80 i;  3W1G A;  4LFB Q;  2BH8 A;  1VQ6 A;  4IJL A;  2Q2H A;  4DAM A;  4YY3 Q;  1N36 L;  4YWM A;  4C2M H;  4TVA B;  2EQS A;  3CCR A;  4DUY Q;  1WI5 A;  4BY1 G;  4ALP A;  3KF6 B;  1YHA A;  1I94 L;  4K0K L;  3ER0 A;  3CW2 C;  4DR6 L;  4BBR H;  3PV0 A;  1UWV A;  3S2H H;  3GD7 A;  4LF7 Q;  2Z6K C;  3KJO A;  2Q2T A;  3TS0 A;  3CCE A;  1YI2 A;  1Y1W G;  3U4V A;  4POG A;  2JK8 A;  4BBR G;  4R4T A;  2JEB I;  4MNO A;  3GTQ H;  2UXD L;  1CKN B;  3UDG A;  1B8A A;  5GAH C;  4JI7 Q;  1KHI A;  2ZM6 Q;  3PO3 H;  1VQL A;  1I6H H;  4LF9 L;  3ULJ A;  1VQ4 A;  4UPA A;  2CWP A;  4LF4 L;  3CCJ A;  3K8A A;  1ASY A;  1SN8 A;  3G6E A;  2E8G A;  5M3M G;  3PO3 G;  4P73 A;  1PYB A;  2EIF A;  4ME3 A;  1VQM A;  1QVG A;  3F2B A;  1VQO A;  3PUW A;  2HT1 A;  4QIW E;  3FKI H;  1V9P A;  5IYC H;  5FJ8 H;  3JAM c;  4A3I H;  3U58 A;  5IT9 c;  5J3B A;  4BA2 I;  3U4Z A;  3CPW A;  1N33 Q;  3H0G H;  4JI6 Q;  1HNW L;  1YBY A;  1L1O A;  1K8A C;  4KI0 A;  1K0R A;  2GN5 A;  3NEL A;  5FJ8 G;  2Q2I A;  2E5L L;  4LF5 Q;  3K80 C;  4DR3 L;  4FDB A;  5HGQ A;  1VQD A;  2VQF Q;  1KL9 A;  1U0L A;  1B7Y B;  4TQU S;  2IY5 B;  1PH6 A;  4RG1 A;  4JI2 Q;  4HIM A;  4IPG A;  4YHH Q;  5M5X H;  4X62 Q;  2OQ0 A;  3K7U C;  4DR5 Q;  5EAY A;  2JA9 A;  5M3F H;  4B3R Q;  1NJI C;  4Y52 H;  3B6Y A;  1XMQ L;  1PV4 A;  3SGI A;  4MZ9 A;  1IBM Q;  1XNR L;  3M85 A;  2MQH A;  4P72 A;  1XTD A;  2DUD A;  4L5R C;  4NXM Q;  1KIX A;  2UXC Q;  4BY7 G;  2A8V A;  1KC8 C;  1HH2 P;  1C7Y A;  3FP9 A;  4DR2 L;  3CCL A;  4JI0 Q;  1OXU A;  4A3G H;  4DUZ Q;  3RR5 A;  3I56 A;  3HOU G;  1NMF A;  1U5K A;  2KCM A;  4LUO A;  1PH9 A;  4DV3 L;  3OTO Q;  4JOI A;  2VUM G;  2VY3 A;  2I5H A;  3T1H L;  4OO1 I;  3TEH B;  1M1K C;  3HFZ B;  4O2D A;  4X65 Q;  4DNI A;  3PIP A;  1VQF A;  2YTY A;  3PUV A;  1N34 L;  3M7N A;  3ICE A;  1CKM A;  1K3R A;  2UUB Q;  1W2B A;  1HNZ Q;  3GTK H;  1UEB A;  4DV0 L;  3H3V I;  4JYA Q;  1QUQ A;  3NEN A;  5LMN L;  1MKH A;  1K9M C;  2I5M X;  2IX1 A;  1N32 Q;  4QJF A;  1QZH A;  4HIK A;  1UE7 A;  5ELN A;  3TRE A;  4EX5 A;  4JI5 Q;  1YIT A;  2C35 B;  3RLN A;  5IY0 A;  4NB3 A;  4AH6 A;  1JJ2 A;  2JJQ A;  1HR0 W;  4BBS H;  5IYD G;  4A3C H;  1BBW A;  5IP9 H;  4QL5 A;  1UE6 A;  3HOW G;  4APV A;  1SFO H;  4A3J G;  2NVX H;  1SLJ A;  3E9I A;  2R93 H;  4BBS G;  1KQS A;  2FXQ A;  2JA8 G;  3HOV G;  3PF4 A;  3GO5 A;  2D62 A;  5IP9 G;  2YTV A;  2JEA I;  1NBW A;  1AE3 A;  2BA0 A;  2E2I H;  3KDF A;  1EIF A;  4P75 A;  1X3E A;  4LFB L;  1B70 B;  4YWL A;  2K75 A;  4A3K H;  2WFW A;  4R4I A;  1TWG H;  4YY3 L;  4H02 A;  5C3E G;  1Y1V H;  4KLK A;  3ERS X;  1SR3 A;  3CCU A;  4LWC A;  2K5N A;  3K0X A;  3KF8 B;  2WB1 G;  4JBJ A;  2HHH Q;  1Q86 C;  2Z6K A;  1HNX Q;  3ZJY C;  5LMU Q;  3CC4 A;  1Y1V G;  3RN5 A;  3AFQ A;  3CF5 A;  1N8R C;  1PH3 A;  4DR4 Q;  4OX9 Q;  5C4X H;  1L1O B;  5M5Y H;  1HJP A;  3CC7 A;  1PH5 A;  1ASZ A;  2B63 H;  4JI7 L;  4A3D H;  5C4X G;  1IXR A;  4PG3 A;  1C9O A;  3E9H A;  1A0I A;  4YWK A;  5JEA J;  1EFW A;  1HR0 Q;  1IBL Q;  2KEN A;  5M5W H;  2B63 G;  1VQG A;  3GTL H;  3I4M H;  5JJL A;  3PGZ A;  2MFI A;  3T1Y L;  3EIV A;  2Q2U A;  1S40 A;  4KHP Q;  1KRT A;  1SMX A;  5C0X J;  2E2J H;  2OTL A;  1YHQ A;  1TWA H;  1OXS C;  1Q7Y C;  2VQE Q;  1N33 L;  5FLM H;  2RHQ B;  3CAM A;  3J81 i;  1XNQ Q;  4A76 A;  2UU9 Q;  3W1B A;  4LFA Q;  4JI6 L;  3RZO H;  2K14 A;  4LF5 L;  1A62 A;  1VQC A;  4LW1 A;  5FLM G;  5JEA G;  2GVA A;  1IZ6 A;  3J81 j;  2VQF L;  4GLX A;  2WP8 J;  1PH2 A;  4A3B H;  4DV4 Q;  1Q46 A;  4GKK Q;  1FL0 A;  4DV5 Q;  3G48 A;  4UP9 A;  4JI2 L;  4LF6 Q;  5C0X G;  3PUZ A;  4X62 L;  2XTI A;  4YHH L;  1X56 A;  4DV1 Q;  3RNU A;  3MXN B;  1XMO Q;  4B3S Q;  4IPH A;  4A3B G;  4B3M Q;  4DR5 L;  2N78 A;  1IBK Q;  4R4O A;  2GVB A;  3RLO A;  1PH8 A;  4B3R L;  4GN4 B;  1GO3 E;  1Q12 A;  2D0O A;  2PQA A;  2YTX A;  3BU2 A;  4IJH A;  4A3F H;  1AE2 A;  2HQL A;  4QQB X;  4JBK A;  5AJ3 Q;  3OW2 A;  1MIU A;  1CSQ A;  1QUQ B;  4C3H H;  3S1R H;  3HKS A;  1NY4 A;  1A8V A;  4NXM L;  2UXC L;  4JI0 L;  4DUZ L;  4DV6 Q;  5HY6 A;  4DV7 Q;  3JC6 6;  3FKI G;  2R7Z H;  5IYC G;  3AEV A;  4A3I G;  3A5Z B;  1LYL A;  3OTO L;  3Q8D A;  1KD1 C;  3H0G G;  4JBW A;  2WB1 E;  4DPG A;  4X64 Q;  1XPO A;  3H3V H;  1FJG L;  3HOZ H;  5GAE C;  2UUA Q;  1IYJ B;  3CCS A;  5GAG C;  4C3I H;  2UUB L;  3TQY A;  3S14 H;  1LTL A;  4PZ7 A;  1K83 H;  1S3O A;  1BVS A;  3G71 A;  2R92 H;  4AIM A;  3HOZ G;  4JYA L;  1G6P A;  2R6G A;  3FHW A;  3KDF B;  2NZO A;  1OXV A;  5BR8 L;  1N32 L;  3J7A 5;  4OXP A;  2KHJ A;  3I55 A;  2R92 G;  2VW9 A;  1J6Q A;  3F2C A;  3K7A H;  5GAD C;  1PH1 A;  4AYB E;  4JI3 Q;  3GDE A;  5M3F G;  3GTM H;  2EXD A;  4LNQ A;  1VQH A;  4GOP C;  1BBU A;  4WJ4 A;  3PO2 H;  1Q1B A;  1K73 C;  4NPS A;  3GTG H;  4IOA A;  1JJC B;  1J5E Q;  1HZ9 A;  2CQO A;  3L7Z C;  2MNA A;  3UE0 A;  2UUC Q;  2HIV A;  2XGT A;  2K5H A;  1VQK A;  4B3T Q;  4A3G G;  4GKJ Q;  1XJV A;  1JB7 A;  3M4Q A;  1L2F A;  3GTO H;  4JI4 Q;  5IYB H;  1X55 A;  1TWH H;  2DGY A;  5DLQ E;  5ELO A;  3STB C;  2JE6 I;  4BXX H;  1V1Q A;  3PUX A;  4HJA A;  4IFD J;  5IYB G;  2ES2 A;  3M9B A;  1LUZ A;  1YVC A;  3EN2 A;  3DLL A;  4HJ5 A;  3UDI A;  4IPD A;  1YJN A;  4IPC A;  4BXX G;  4LF8 Q;  4RMF A;  2HHH L;  1N9W A;  1HNX L;  1OXT A;  2ZJP A;  5LMU L;  4DR1 Q;  1QZG A;  1VQ7 A;  5C4J H;  2ASB A;  4DR4 L;  1Y14 B;  4OX9 L;  2E5L Q;  3W5O A;  3RZD H;  4HJ7 A;  2CCZ A;  1TWF H;  2N3S A;  2KCT A;  1X3F A;  4UP7 A;  5JJI A;  1WYD A;  3E0E A;  4LFC L;  3A5U A;  2JA5 H;  5LMN W;  4IFD G;  2N49 A;  4DV2 Q;  1IBL L;  2NN6 G;  2AWN A;  2YYZ A;  4X66 Q;  3TS2 A;  1EOV A;  4A3C G;  1CUK A;  1S72 A;  3F2D A;  3CCM A;  1FVI A;  2JA5 G;  2ID0 A;  1VQN A;  2CWA A;  1L0W A;  4AQY Q;  2R93 G;  1RL2 A;  4JI1 Q;  1YIJ A;  1E7Z A;  1V43 A;  1WFQ A;  1T9H A;  2K5V A;  2PQA B;  3S1M H;  2VQE L;  3HKZ E;  1XNQ L;  4LUV A;  2L15 A;  1VQA A;  2B3G A;  3CCQ A;  2ZTC A;  4DUY L;  2UU9 L;  3OYY A;  4JC0 A;  3GTJ H;  1P8L A;  1BKB A;  4LFA L;  3CD6 A;  1JT8 A;  1GVP A;  1VQB A;  4A3K G;  3CQZ H;  1YHB A;  1FGU A;  2LXJ A;  4LF7 L;  1EIY B;  1JMC A;  3UDX A;  3RN2 A;  2JA6 H;  4DV4 L;  4GKK L;  1VQE A;  4DV3 Q;  2OTJ A;  1PH4 A;  3BZC A;  5IE8 A;  4DV1 L;  1HZB A;  1QVC A;  1XMO L;  3M4O H;  4B3S L;  4O0A A;  5GQO A;  1YEZ A;  4JI8 Q;  2ZM6 L;  1X9N A;  1X65 A;  3MEF A;  1N34 Q;  1IBK L;  4B3M L;  2Y0S G;  5IWA Q;  1K8G A;  3D0F A;  1EQR A;  1GKH A;  4AYB G;  3CCV A;  1I3Q H;  1YJ9 A;  2JA7 H;  4A3D G;  3J81 c;  5AJ3 L;  1Z47 A;  2ATW A;  3S24 A;  2K50 A;  1NTG A;  4A3E H;  3S16 H;  4QY7 A;  4GS3 A;  3I4M G;  4J15 A;  1TWC H;  5K36 G;  3CMA A;  5C44 H;  1PH7 A;  4HID A;  4DV7 L;  1JE5 A;  4DV6 L;  4A3E G;  2NVQ H;  2K52 A;  1CKO A;  1WJJ A;  4OWX B;  2K4K A;  5E7N A;  5C44 G;  3F8T A;  1I5F A;  3IRB A;  1Z9F A;  4X64 L;  2VNU D;  4HJ8 A;  4NXN Q;  2IX0 A;  3KLW A;  1MJE A;  3CXC A;  2UUA L;  1QVF A;  2QGQ A;  2CFM A;  3L2P A;  2NN6 I;  3F1Z A;  2I0Q A;  3PSI A;  4A4I A;  2NVY H;  1VQ8 A;  4OWW B;  1WCM H;  2RHS B;  1E22 A;  4IOC A;  1OTC A;  4IO9 A;  4DAY B;  1H95 A;  4GN3 B;  1NMG A;  4JI3 L;  1IBM L;  1SRU A;  1WOC A;  1WCM G;  3K81 C;  4GOP A;  2YU9 H;  4JBM A;  1Y1W H;  4A3F G;  1Q1E A;  2RCN A;  3I4N H;  1PHJ A;  1DGS A;  3LGJ A;  2IT1 A;  2NZH A;  5H1S E;  1J5E L;  4YCU A;  3D31 A;  2UXB Q;  3KOJ A;  2WAQ G;  2UUC L;  3I4N G;  4QGU A;  4OO1 G;  2A1A A;  3S15 H;  4JV5 Q;  1EQQ A;  4B3T L;  4GKJ L;  2R7Z G;  1D8L A;  4P74 A;  4X65 L;  3A74 A;  5M3M H;  2OCE A;  1TXY A;  4JI4 L;  2CKZ B;  1XPU A;  3HKZ G;  1HNZ L;  2PMZ E;  2F4V Q;  2PNH A;  2ZTD A;  3T1Y Q;  4GNX C;  3NEM A;  4DR7 Q;  4DKA C;  3S1N H;  4X6A H;  4LF8 L;  1UE1 A;  4GN5 A;  1M90 C;  2Y0S E;  2KHI A;  4JI5 L;  3S17 H;  1N36 Q;  3UE1 A;  4HIO A;  4DR1 L;  3AQQ A;  3DM3 A;  4UP8 A;  1X54 A;  1I94 Q;  2I5L X;  3JAM i;  2AHO B;  4K0K Q;  1NE3 A;  4DR6 Q;  2H5X A;  1PA6 A;  3S2D H;  1JJG A;  1VQJ A;  3PIO A;  2YV5 A;  2OWO A;  3PO2 G;  4DV2 L;  4PMW A;  2MO1 A;  4X66 L;  2UXD Q;  2LSS A;  1RIP A;  4POF A;  5C0X I;  1EYG A;  2ZTE A;  4AQY L;  2OQK A;  4JI1 L;  4LF9 Q;  3J7Z C;  4XIG S;  3U50 C;  3L0O A;  3WWV A;  3PUY A;  1Q81 C;  4LF4 Q;  2ALY B;  1VQP A;  4BY7 H;  5FLX c;  2VS1 A;  3I4O A;  4KHZ A;  4P71 A;  4DK3 C;  1OXX K;  1IL2 A;  2NVT H;  4WJ3 M;  1O7I A;  2VL6 A;  3KF6 A;  2BH2 A;  3HOU H;  3CPF A;  3GTP H;  4L5S A;  3STB D;  1W3S A;  3EBE A;  3HOY H;  2D0P A;  2VUM H;  2JQO A;  1E1T A;  1X3G A;  1HNW Q;  1A63 A;  5JJK A;  4GLA C;  3RLF A;  4OON A;  3VDY A;  1L1O C;  1VQI A;  1GD7 A;  1VCI A;  4A3M H;  4HJ9 A;  3ULL A;  4DR3 Q;  3HOY G;  1HZC A;  2MO0 A;  2B29 A;  1CKN A;  2R7F A;  3I2Z A;  3BZK A;  4R4Q A;  1KXL A;  1Q8K A;  4JI8 L;  3A0J A;  3KYH C;  1FJG Q;  4A3M G;  2A19 A;  5IWA L;  2QEX A;  1HR0 L;  1R9T H;  2WAQ E;  2AMC B;  5IP7 H;  3PCO B;  1AH9 A;  3NBH B;  3ULP A;  4GNX B;  1VQ9 A;  4BA1 I;  4JG2 A;  4UY8 C;  4KHP L;  3AYH B;  1Q82 C;  5BR8 Q;  2R7D A;  5IP7 G;  1GM5 A;  3BJU A;  1E24 A;  1SE8 A;  1VQ5 A;  1XMQ Q;  5IYD H;  4LUZ A;  5GRO A;  1XNR Q;  2BA1 A;  4L5T A;  1LM0 A;  2RF4 A;  3HOW H;  4A3J H;  4GOP B;  2IHF A;  2F52 A;  4GLV B;  4A93 H;  4C3J H;  3CME A;  2JA8 H;  3HOV H;  4DR2 Q;  4DK6 C;  2N8N A;  4JCV E;  1X6O A;  2Z0S A;  1E1O A;  4NXN L;  1VS0 A;  3CP0 A;  1YJW A;  4A93 G;  1PFS A;  4DV5 L;  2ZJQ A;  4R4C A;  4EQ5 A;  4A3L H;  2IHE A;  4LF6 L;  1UE5 A;  4JOI C;  2HIX A;  3HOX H;  3T1H Q;  1EUJ A;  1EWI A;  1XPR A;  2JA6 G;  2ZJR A;  2PI2 E;  4PZ6 A;  4YCV A;  5C3E H;  4A3L G;  2AWO A;  1G29 1;  3HOX G;  1CSP A;  1KAW A;  2AKW B;  1MJC A;  3CC2 A;  4DV0 Q;  3AFP A;  3PF5 A;  4L5Q A;  2F3I A;  1D7Q A; 
#chains in the Genus database with same CATH topology
 4K6D A;  2EYP A;  1GHJ A;  2K05 A;  4CJ0 B;  1I4X A;  1ZXT A;  4JV5 L;  1S4Z A;  1VDZ A;  2EYL A;  3CQZ B;  3KFU A;  4IFD I;  2EYM A;  1QJO A;  1VMP A;  4R1J A;  3M4P A;  2PYK A;  2K7V A;  4OWT B;  5I6Y A;  3J80 i;  1VQ6 A;  4NKL A;  5K36 G;  1CT1 D;  4DUY Q;  4ILW A;  3PV0 A;  1UWV A;  3S2H H;  3GD7 A;  2JA7 B;  4A3E B;  2PNR C;  2CVR A;  4BBR G;  4JVZ A;  5C44 B;  2JEB I;  4MNO A;  5JVG 3;  2UXD L;  1XXG A;  1CKN B;  3UDG A;  3OMG A;  1AEX A;  1ET6 A;  2NVQ B;  1I4Q A;  4FXG C;  4LF9 L;  3ULJ A;  1VQ4 A;  4LF4 L;  1HUM A;  3K8A A;  5G3L F;  5IOD A;  1ASY A;  1SN8 A;  2A69 D;  4P73 A;  2EIF A;  1QVG A;  3MWY W;  3R93 A;  2WAC A;  3F2B A;  1VQO A;  2RVL A;  4QIW E;  1O7L A;  3KF8 A;  3JAM c;  1ILP A;  5FK9 C;  5EBC A;  2OEO A;  1HNW L;  2J0T D;  1WCM B;  2E5L L;  1C8C A;  4FDB A;  1VQD A;  4WFN 3;  1U0L A;  1U4L A;  1X32 A;  1Y1W B;  2IY5 B;  2PW7 A;  1LAB A;  3E0J A;  3SK8 A;  4IPG A;  2OQ0 A;  1V1P A;  3K7U C;  3SHL A;  1ESR A;  1W6J A;  2JA9 A;  4K8J A;  4B3R Q;  2PZT A;  4TSS A;  5F2D A;  3I72 A;  3EVQ A;  4P72 A;  5FO8 B;  2EDG A;  2F0W A;  4DR2 L;  1KNA A;  3DWP A;  3I56 A;  1NMF A;  4LUO A;  4DV3 L;  3UI2 A;  5I9P A;  3OTO Q;  1BCP F;  2VUM G;  1H9R A;  2B2Y A;  3FPU B;  3VR4 A;  3T1H L;  3HFZ B;  1N34 L;  3MFY A;  1PTO F;  2PW5 A;  1CKM A;  5E4W C;  2UUB Q;  1W2B A;  1UEB A;  1SE4 A;  5NUC A;  3NEN A;  3VR2 A;  5LMN L;  1K9M C;  2I5M X;  1EFI D;  1YNN C;  1UE7 A;  5ELN A;  2Z1C A;  1Z6H A;  3TRE A;  1ZEQ X;  1HR0 W;  4IFD H;  5IYD G;  4A3C H;  2NN6 H;  5IP9 H;  4X3T A;  1BF4 A;  2DY8 A;  2NVX H;  1SLJ A;  3MA2 B;  3HOY B;  2D62 A;  1TKW B;  4RFB A;  4XQQ A;  2JEA I;  5JJZ A;  4H02 A;  2O2L D;  1EY4 A;  3X3M A;  1E0B A;  4KLK A;  5C3E G;  3KF8 B;  2SNS A;  3AFQ A;  2EYF A;  4XDX A;  1O78 A;  5M5Y H;  3J81 L;  2NTS A;  3HOW B;  4A3J B;  4A93 B;  3E9H A;  2JA8 B;  3GTL H;  1V1P B;  3EIV A;  1SE2 A;  2KED A;  2QDB A;  1TWA H;  2VQE Q;  4A76 A;  2UU9 Q;  2CH4 A;  4LF5 L;  4LW1 A;  5JEA G;  4DK0 A;  4Z9C B;  3J81 j;  1PH2 A;  4DV5 Q;  4JI2 L;  4DV1 Q;  2RQX A;  1X56 A;  4IPH A;  4CDD C;  3C3L A;  4M1U B;  4IJH A;  2EYJ A;  2IWH A;  4ZCK A;  4QQB X;  4ID6 A;  4CGY B;  1LO5 D;  1S5D D;  4JI0 L;  2J7Z A;  1RKN A;  2F0I A;  4DV7 Q;  3JC6 6;  3TBI B;  3BVM A;  5IYC G;  4RGN A;  3BYY B;  2E75 C;  4DPG A;  1XPO A;  5L37 A;  1M8A A;  3CCS A;  1VF5 C;  3S2H B;  3HG9 A;  2BCO A;  3G71 A;  3HOZ G;  3HRZ C;  1G6P A;  1LT6 D;  3D4W A;  4C3I G;  4DNR B;  5BR8 L;  3OWE B;  3SE0 A;  4OXP A;  3I55 A;  3VYU A;  2VW9 A;  1J6Q A;  3F2C A;  1G6Z A;  3GDE A;  1B9M A;  4LNQ A;  1BBU A;  1Q1B A;  1B3A A;  4J1M A;  5E3F A;  4NPS A;  1JJC B;  2CQO A;  3L7Z C;  3UE0 A;  5FLX L;  3DEO A;  4ZUI A;  1XJV A;  1JB7 A;  5IYB H;  3AU7 A;  1X55 A;  4BXX H;  2KQ3 A;  1XTC D;  1EL0 A;  1YVC A;  4IPD A;  1YJN A;  5C6A A;  5CR3 A;  1HNX L;  1JWM D;  2ASB A;  4DR4 L;  5C4J H;  1WTP A;  4OX9 L;  1O7Z A;  4CJ2 C;  4F87 A;  1GUN A;  1A15 A;  4UP7 A;  1B2T A;  3TZU A;  4RA8 A;  3WOE A;  1IBL L;  2YYZ A;  2A6E D;  3CRL C;  1S72 A;  5G3L D;  1DCZ A;  1VQN A;  2R93 G;  5K5P A;  1RL2 A;  4JI1 Q;  3ITP A;  4Q5V A;  1L0X B;  4G4K A;  3S1M H;  4XQJ A;  4DUY L;  3CCQ A;  1LAC A;  3OYY A;  2KEE A;  2MGS A;  1JT8 A;  3QB3 A;  1G2T A;  4A3K G;  3OSO A;  1K8M A;  2B2T A;  4HCS A;  2OTJ A;  1PH4 A;  4FF3 A;  4B3S L;  1X9N A;  1YEZ A;  4JI8 Q;  4AYB G;  1I3Q H;  2NVX B;  1Z47 A;  1FR3 A;  1NTG A;  2WV6 D;  3VA7 A;  1MBY A;  1PH7 A;  1G91 A;  1GXD C;  2EJG C;  1JE5 A;  4K6L A;  1CKO A;  4RGT A;  3VYR A;  1WJJ A;  4OWX B;  5E7N A;  2EY6 A;  1Z9F A;  1BCP D;  3BYT B;  1H9S B;  4NXN Q;  2LS0 1;  3DHQ A;  3NP8 A;  2J4X A;  2UUA L;  1PTO D;  3F1Z A;  1NR4 A;  1U4M A;  3PSI A;  4ME5 A;  1SBB B;  3KBG A;  5EKL A;  5M5Y B;  2XIW A;  4IOC A;  5CV7 A;  3D4D A;  1WOC A;  1EY7 A;  4GOP A;  3GTL B;  2NZH A;  2B2U A;  1J5E L;  1TWA B;  1HXY D;  3K6O A;  4OO1 G;  4JV5 Q;  4QF4 A;  2A69 C;  1D8L A;  4P74 A;  3JAM L;  2D2C C;  1TXY A;  1XPU A;  3EFX D;  1BDO A;  1B53 A;  3QWN A;  3I73 A;  5KNC A;  2X69 A;  2F03 A;  4GNX C;  4MHE A;  3S1N H;  4LF8 L;  4HIO A;  3AQQ A;  1A2T A;  1IKL A;  1SMY C;  2AHO B;  3R2T A;  4OHJ A;  1Y8O B;  2B2U C;  2K28 A;  3M4Y A;  1S5F D;  3PO2 G;  4DV2 L;  2UXD Q;  1STG A;  2XSC A;  3U9O A;  2VXW A;  4LF9 Q;  4J6H A;  3WWV A;  1MI2 A;  4LF4 Q;  1HFG A;  3OHX C;  1HPC A;  1HQR D;  3IKJ A;  2NVT H;  1O7I A;  1ILQ A;  3F2U A;  4KD3 A;  2A73 B;  3GTP H;  3BVZ A;  3STB D;  3NQT A;  1JWU D;  2Z6B A;  3EBE A;  2VUM H;  3FEW X;  3IFT A;  2PQE A;  1KLU D;  2EPB A;  1LTS D;  1E1T A;  2Z8L A;  1HNW Q;  1ENA A;  1QCB D;  4OON A;  1L1O C;  5T1I A;  4QB4 A;  3VA5 A;  4LK1 C;  3ULL A;  1HZC A;  2MO0 A;  2R7F A;  1SYD A;  3I2Z A;  1KXL A;  1Q8K A;  3A0J A;  1Q90 A;  1FJG Q;  5EPJ A;  4H7B A;  2QEX A;  2K6A A;  1R9T H;  1I4H A;  5IP7 H;  1STN A;  4GNX B;  4UY8 C;  4CKB A;  1Q82 C;  1UNS A;  3BJU A;  1E24 A;  1SNM A;  5IYD H;  5ELC A;  2C9O A;  4LUZ A;  1F77 A;  1LM0 A;  4GOP B;  2NYZ D;  3MC0 B;  4DR2 Q;  1X6O A;  3T13 A;  1D5X C;  1VS0 A;  4IUU A;  1PFS A;  4DV5 L;  1NR2 A;  3DUZ A;  4R4C A;  1PLF A;  5JPN C;  3T1H Q;  5C4J B;  1XX8 A;  2EZV A;  4U68 A;  3I70 A;  4N9T A;  2PI2 E;  1RD9 D;  3BDO A;  5C3E H;  4A3L G;  2AWO A;  4RH6 A;  3HOX G;  2AKW B;  4IQZ A;  3CC2 A;  3AFP A;  4YIJ A;  1SXT A;  4L5Q A;  2MPM A;  1DJR D;  1D7Q A;  5LMN Q;  4YCW A;  3I7F A;  3KUP A;  4A75 A;  2BE5 D;  1PYS B;  1U4P A;  2KBN A;  3S1M B;  1J8I A;  2V1C C;  4NW2 A;  4RCN A;  1QG7 A;  1LTB D;  1JOK A;  4PZ8 A;  3J80 c;  3N6R A;  1PZK D;  1X3P A;  3MFG A;  1GOZ A;  2CQA A;  4C56 C;  4BY1 H;  1SRO A;  4Y7N H;  2Y0S B;  4RWS C;  3M3Y H;  3W1G A;  1IKM A;  1WTW A;  2Q2H A;  4DAM A;  2VB3 X;  4C2M H;  3Q23 A;  2EQS A;  4KJN A;  3CCR A;  4ALP A;  4K0K L;  1JOQ A;  1ET9 A;  1RCV D;  1I3Q B;  2A6H D;  4LF7 Q;  2Z6K C;  2QKI C;  2Q2T A;  3U4V A;  1BR9 A;  1EQT A;  4J8Q A;  1LLR D;  1I6H H;  1CI3 M;  1KHI A;  1X3Q A;  1VQL A;  3PO3 H;  3DM1 A;  5C4H A;  4K14 A;  4UPA A;  2CWP A;  3CCJ A;  2X6L A;  2Z4H A;  4ME3 A;  3URY A;  1V9P A;  5IYC H;  5FJ8 H;  5IT9 c;  5J3B A;  4XQN A;  3CPW A;  1B50 A;  3G7L A;  1YBY A;  1K8A C;  3NEL A;  4LF5 Q;  2Q2I A;  4V0B A;  4PMB A;  4DR3 L;  3D3R A;  3DMU A;  2L0C A;  2F3V A;  5D14 A;  1KL9 A;  3FVQ A;  2WAQ B;  1PH6 A;  4KHV A;  4JI2 Q;  3NTH A;  5M5X H;  4OIJ A;  4Y52 H;  1XMQ L;  1PV4 A;  3SGI A;  4MZ9 A;  1IBM Q;  1XNR L;  5KEE A;  2MQH A;  2DUD A;  1EOT A;  1KIX A;  2A8V A;  1C7Y A;  4JI0 Q;  3CCL A;  5C5M A;  4CBV A;  4K5W A;  3RR5 A;  2KCM A;  3S1N B;  1YNJ D;  4JOI A;  3OOC A;  4CJ1 B;  2I5H A;  4OO1 I;  3R3O A;  3M7N A;  5FOB B;  1SEB D;  1K3R A;  3A8J E;  1C48 A;  2I46 A;  3GTK H;  4DV0 L;  1D5Z C;  1MKH A;  2IX1 A;  4LAA A;  1QZH A;  4RGO S;  1YIT A;  2C35 B;  1EY9 A;  1JJ2 A;  4U67 3;  2JJQ A;  2A6E C;  2NVT B;  3QG1 A;  2DN8 A;  3C1E A;  1SFO H;  3GTP B;  4WJW A;  2R93 H;  4BBS G;  1KQS A;  1F9R A;  2VUM B;  1JC7 A;  2WIN B;  3P75 A;  2BA0 A;  2E2I H;  3KDF A;  3NPP A;  4KN4 C;  1B70 B;  4DU9 A;  4A3K H;  3V2T A;  1EIH A;  1GHK A;  3ERS X;  1R9T B;  2K5N A;  3K0X A;  1KAB A;  1IW7 D;  2WB1 G;  1Q86 C;  1HNX Q;  3GV3 A;  3DXJ C;  4RGM A;  1Y1V G;  2O4X A;  3BDL A;  4DR4 Q;  4DAV A;  4OX9 Q;  4H44 C;  4K5V A;  1K28 A;  3CU7 A;  1ASZ A;  2PZU A;  4JI7 L;  5C4X G;  4PV1 C;  1C9O A;  4YWK A;  1EFW A;  1HR0 Q;  1IBL Q;  2KEN A;  1H9J A;  3NSW A;  3W2D A;  1CA6 A;  2B63 G;  1S40 A;  1KRT A;  1SMX A;  3OMC A;  2OTL A;  1Q7Y C;  2L4N A;  2RHQ B;  3J81 i;  1BCP C;  3L9A X;  5C3E B;  3RZO H;  1PTO C;  5FLM G;  1PXU A;  5C0X H;  3FMC A;  2WP8 J;  4A3B H;  2EJM A;  5E1F A;  1Q46 A;  4UP9 A;  1QOH A;  4TKO B;  1EZ6 A;  4YHH L;  4X62 L;  2XTI A;  4B3S Q;  3A55 A;  1D1I A;  3RLO A;  1NCV A;  2D0O A;  3BU2 A;  1JOR A;  2PQA A;  2QCP X;  3DEP A;  4JBK A;  4KKS A;  3OW2 A;  1CSQ A;  4ZQ3 A;  2NUC A;  1ZKO A;  1EWH A;  1KNE A;  5EQ0 A;  4RCO A;  5J39 A;  4DUZ L;  4DFA A;  4BY1 B;  3M3Y B;  4Y7N B;  5I6W A;  2VB2 X;  3VR5 A;  3Q8D A;  2EJF C;  4C2M B;  2WB1 E;  3EQL C;  3AB9 A;  2HUG A;  1FJG L;  2UUA Q;  1IYJ B;  5GAG C;  3TQY A;  4PZ7 A;  1K83 H;  1S3O A;  1BVS A;  2R92 H;  4AIM A;  4JYA L;  2EYH A;  3A7A B;  1SJE D;  3KDF B;  2NZO A;  1LTR D;  1N32 L;  2B8F A;  1I6H B;  3PO3 B;  5M3F G;  1V8Q A;  2EXD A;  2K01 A;  5C3W A;  4WJ4 A;  1ZYR D;  3PO2 H;  1PRT C;  1J5E Q;  1EU4 A;  1HZ9 A;  2IPK D;  3OWF A;  2XGT A;  1VQK A;  4RHR A;  3ERQ A;  5LHY 1;  1L2F A;  1WTQ A;  4QCL A;  2DGY A;  4HR7 B;  3STB C;  2B2W C;  4DAY A;  1KDC A;  4DN4 M;  1D2B A;  3GQB A;  3PUX A;  4HJA A;  1CK1 A;  5DM7 3;  2ES2 A;  3FDT A;  5HGT A;  3DLL A;  3UDI A;  1STB A;  4IPC A;  1II3 A;  5M5X B;  2HHH L;  4LF8 Q;  1N9W A;  1SNC A;  2WKC A;  2ZJP A;  5LMU L;  1QZG A;  2ICI A;  3HP3 A;  4FF4 A;  1Y14 B;  2QEJ C;  3W5O A;  2PO4 A;  4HJ7 A;  1BOS A;  2PZW A;  2CCZ A;  2N3S A;  2KCT A;  1X3F A;  1WYD A;  2KHS A;  3E0E A;  4FO2 A;  2JA5 H;  2N49 A;  4DV2 Q;  3TS2 A;  3LX0 A;  1EOV A;  3IFD A;  3CCM A;  3HZX A;  2XN9 C;  3H09 A;  1MD2 D;  1YIJ A;  1PDQ A;  1E7Z A;  1V43 A;  1WFQ A;  4ZKC B;  1T9H A;  2K5V A;  3MZ5 A;  2PQA B;  4ZUJ A;  1I4P A;  3HKZ E;  3WDN A;  1XNQ L;  4LUV A;  2L15 A;  5KND A;  1VQA A;  1LT4 D;  3CD6 A;  1Y8N B;  4JC0 A;  1P8L A;  1BKB A;  3A54 A;  1GVP A;  1VQB A;  2DJG C;  5EPL A;  3GTK B;  5CBA E;  4LF7 L;  3OPO A;  3G6J B;  1JMC A;  5COY A;  5CC4 A;  4DV4 L;  2IJ0 A;  1QVC A;  4KMU C;  1QWY A;  2F0D A;  1TR5 A;  4O0A A;  5GQO A;  3TP6 A;  1IBK L;  4B3M L;  4CKE A;  1SDF A;  3D0F A;  1EQR A;  1GKH A;  1YJ9 A;  4HTH A;  1SFO B;  5AJ3 L;  2R93 B;  3HGB A;  4TRD A;  4GS3 A;  1TWC H;  4IUT A;  2E2I B;  4HID A;  4DV6 L;  4A3E G;  2K52 A;  4A3K B;  5C44 G;  1I5F A;  2VNU D;  2OF1 A;  1SYE A;  3S9W A;  2BDO A;  2K32 A;  1MJE A;  2F1M A;  3NBH A;  2I0Q A;  4A4I A;  2RHS B;  2A68 D;  3U9S A;  4DAY B;  4AYB B;  1TII D;  1IBM L;  1WTV A;  1WCM G;  3K81 C;  4A3F G;  4IUR A;  3I4N H;  1PHJ A;  2IT1 A;  5H1S E;  4N8F A;  2UUC L;  2N88 A;  2A1A A;  4R8I A;  4DF7 A;  3S15 H;  1RF2 D;  2MHV A;  2R7Z G;  3RZO B;  3A74 A;  5IT9 L;  4JI4 L;  3PMF A;  4JK1 C;  1K8O A;  4I7A A;  3KLR A;  2ZTD A;  4A3B B;  4IUQ A;  4FP5 D;  2RSN A;  1FNV A;  4H13 C;  4DKA C;  1M90 C;  3S17 H;  3A8I E;  3UE1 A;  4DR1 L;  4UP8 A;  1TY0 A;  1X54 A;  3JAM i;  4K0K Q;  4MN3 A;  3T56 B;  2P5Z X;  1CQF A;  1H9S A;  3PIO A;  1JJG A;  1VMC A;  1LTT D;  2KJX A;  1EIG A;  4KKT A;  4PMW A;  2MO1 A;  1FGB D;  4PQX A;  4AQY L;  3U50 C;  2HCI A;  2ALY B;  4Q0F A;  3T51 B;  4WJ3 M;  4P71 A;  3M7G A;  2VL6 A;  3KF6 A;  2KA7 A;  5KIX A;  2F0G A;  4L5S A;  3Q0A A;  1K83 B;  3I90 A;  2R92 B;  2WII B;  2JQO A;  1SND A;  4ZYS A;  1X3G A;  1VCI A;  4A3M H;  3HOY G;  4DR3 Q;  1TQO A;  5KNB A;  3BZK A;  1PYW D;  1Y8P B;  3PO2 B;  4BS9 A;  3CRK C;  5IWA L;  2F0E A;  1HR0 L;  2AMC B;  1G8Z D;  3NBH B;  5CV9 A;  3ULP A;  3ONA B;  4HMJ A;  3E3X A;  4HSV A;  1SE8 A;  2M00 A;  1STY A;  2QW7 A;  2NTT A;  1XMQ Q;  5GRO A;  1XNR Q;  1F9S A;  2RF4 A;  3R8B A;  4GLV B;  3CME A;  3EA6 A;  4JCV E;  1E1O A;  3BZD B;  4A93 G;  4CDE C;  1GUW A;  4EQ5 A;  4ULL A;  1UE5 A;  3TP5 A;  2HIX A;  1EWI A;  1K3B C;  1RHP A;  2FHT A;  2JA6 G;  5CMD A;  2ZJR A;  4FYD A;  5JOB A;  4G7H C;  5BN4 A;  2JA5 B;  4DV0 Q;  3PF5 A;  2AQ2 B;  4IAL A;  2RCF A;  1KRS A;  2WKD A;  4UAI A;  2QA4 A;  2F0M A;  3C2P A;  1WD0 A;  3TRZ A;  5A35 A;  1SNQ A;  3P1H A;  2E2H H;  4XTC S;  1C0A A;  2F0S A;  1AZQ A;  1FYC A;  4KY5 A;  4LFC Q;  5IGE A;  3H15 A;  1YZ6 A;  2F4V L;  2XRQ D;  2XRS D;  2L1B A;  4GNX A;  5K36 H;  1I6V C;  4EQP A;  3KJP A;  2B2V C;  3N52 A;  5IGF A;  1LTI D;  2BH8 A;  4IJL A;  3TP7 A;  3ZYY X;  1N36 L;  4TVA B;  1WI5 A;  3KF6 B;  3QOL A;  1I94 L;  4ZK9 B;  3ER0 A;  2IW3 A;  4ZLT F;  4DR6 L;  4BBR H;  1KAA A;  3TS0 A;  1CQV A;  4POG A;  2JK8 A;  3A8K E;  3KLS A;  4R4T A;  5A2Q L;  1TWC B;  4HCE A;  3GTQ H;  1B8A A;  5GAH C;  4JI7 Q;  4MTK A;  2AQ3 B;  4MIU A;  2E8G A;  5M3M G;  5KGU A;  1VQM A;  1NAP A;  3PUW A;  4BA2 I;  5ELE A;  4CKC A;  4XT3 B;  1L1O A;  1DM0 B;  4KI0 A;  3K80 C;  1A2U A;  2MJ8 A;  4L8J A;  3I4N B;  2H1E A;  2SEB D;  4YHH Q;  4X62 Q;  1UAP A;  5EAY A;  1IL8 A;  5IGG A;  1SYG A;  5M3F H;  3S15 B;  1ZYR C;  1NJI C;  3B6Y A;  4B9X A;  2DY7 A;  1T5X D;  3M85 A;  2X6G A;  1XTD A;  4BY7 G;  4O42 A;  1DZ1 A;  2G5D A;  1KC8 C;  3FP9 A;  1OXU A;  4DUZ Q;  1WTX A;  5LL6 S;  3HOU G;  1U5K A;  4EQN A;  3Q6S A;  1D5M C;  1PH9 A;  1CZW A;  3S17 B;  5C4Z A;  2VY3 A;  3MXN A;  1U9R A;  3GV6 A;  3TEH B;  4F88 A;  4O2D A;  4X65 Q;  3H94 A;  2NWG A;  3PIP A;  1JQY D;  2YTY A;  2F0Q A;  5C5L A;  3ICE A;  1HA6 A;  1HNZ Q;  4JYA Q;  1QUQ A;  1N32 Q;  4HSP A;  2CHB D;  4QJF A;  1GUG A;  4JI5 Q;  4KN7 C;  3PQI A;  3RLN A;  5IY0 A;  1G2S A;  2F3W A;  2MUY A;  1PFB A;  5ELD A;  4BWG B;  4QL5 A;  1UE6 A;  3SK4 A;  4RKL A;  4APV A;  1E2W A;  3SK6 A;  1F2Y A;  4C3J G;  3NUC A;  3PF4 A;  1NUC A;  2F0F A;  3HOV G;  5IP9 G;  4KY7 A;  2M9V A;  1NBW A;  1AE3 A;  3DWQ A;  5IGD A;  4P75 A;  2FMM A;  4A3M B;  4LFB L;  2K75 A;  3I91 A;  4R4I A;  4YY3 L;  1F2Z A;  1WTR A;  1SR3 A;  3CCU A;  4JBJ A;  2HHH Q;  2Z6K A;  3A56 A;  1ROD A;  3ZJY C;  1A3U A;  5LMU Q;  1N8R C;  5EBD A;  1PH3 A;  1L1O B;  3BG3 A;  3CC7 A;  1HJP A;  1PH5 A;  1KLG D;  1B9N A;  4WRD A;  4S3S A;  2ENB A;  2LKV A;  1IXR A;  4XXE A;  1OO9 B;  5M5W H;  1IYU A;  3LWU A;  5JJL A;  4OGQ C;  5CV6 A;  1SNO A;  3PGZ A;  2MFI A;  4QIW B;  5D3I B;  4KHP Q;  1V1O A;  4P2C B;  5C0X J;  2E2J H;  1OXS C;  1N33 L;  1XNQ Q;  5JEA H;  5IIF A;  1LT5 D;  4JI6 L;  4IUV A;  2K14 A;  1A62 A;  3H6M A;  1VQC A;  2RDF A;  2GVA A;  1TVX A;  2L5T A;  4ZAI A;  2VQF L;  3D8G A;  2DNE A;  4DV4 Q;  1FL0 A;  1TS2 A;  3RNU A;  3MXN B;  3SXH A;  4B3M Q;  4DR5 L;  1IBK Q;  2E2H B;  4R4O A;  2GVB A;  1PH8 A;  2KEC A;  3MVV A;  4GN4 B;  1GO3 E;  2YTX A;  1PTO H;  4A3F H;  2QIL A;  2HQL A;  1S5B D;  3NK9 A;  5AJ3 Q;  1MIU A;  1STA A;  1QUQ B;  3S1R H;  2O5J C;  3HKS A;  1A6X A;  1NY4 A;  1A8V A;  4NXM L;  2UXC L;  2Z4I A;  2R7Z H;  4DV6 Q;  5HY6 A;  1EY0 A;  3FKI G;  1D1K A;  4A3I G;  1CFM A;  2K04 A;  3H0G G;  4JBW A;  4PNY A;  3MTS A;  4IN3 A;  3HOZ H;  5GAE C;  4BBR B;  4C3I H;  3S14 H;  1LTL A;  2K03 A;  3ND8 A;  4O1N A;  2R6G A;  4LMQ D;  1OXV A;  2HD3 A;  4XYO A;  3J7A 5;  3GTQ B;  4R8N A;  2KHJ A;  4DXF A;  1PH1 A;  1H9K A;  3WOF A;  3GTM H;  4NP5 A;  1BO0 A;  1K73 C;  3GTG H;  4IOA A;  2CW0 D;  1LT3 D;  2UUC Q;  2K5H A;  4A3G G;  4JW0 A;  1DON A;  3J81 E;  1F2L A;  4JI4 Q;  2AUJ D;  1ESF A;  1TWH H;  5ELO A;  2JE6 I;  2DNC A;  5J1Z A;  4E6I A;  5CYU A;  3OIP A;  4IFD J;  2TSS A;  5IYB G;  1UUP A;  4HJ5 A;  4BXX G;  1JCK B;  4N9P A;  4DR1 Q;  2XVS A;  5M3F B;  1DD2 A;  3SDZ A;  3RZD H;  4IUN A;  1GJX A;  4NMZ A;  1EWC A;  1ENC A;  1ONL A;  1TWF H;  5JJI A;  4X3U A;  4LFC L;  3A5U A;  5LMN W;  5IOC A;  4HN7 A;  2BOS A;  2BDN A;  1FVI A;  2CWA A;  1SNP A;  2FIN B;  1L0W A;  4AQY Q;  3NE5 B;  1EY6 A;  5FO9 B;  2RSO A;  3ND9 A;  4OL7 A;  4OEM B;  1F9Q A;  2ZTC A;  4LFA L;  3GTJ H;  4ODG A;  2RBM A;  1PZI D;  1FD7 D;  2F0P A;  1YHB A;  2LXJ A;  4DGZ A;  2IL8 A;  2F0H A;  4KKU A;  1RTO A;  3RN2 A;  2JA6 H;  4ABN A;  4GKK L;  1VQE A;  2GA4 B;  4G7Z C;  3BZC A;  1HZB A;  1XMO L;  3M4O H;  2SDF A;  4KJO A;  1GUO A;  1VF7 A;  2F0T A;  3MEF A;  2Y0S G;  5IWA Q;  5DM6 3;  3VYS A;  3K5L A;  4A3D G;  2RA4 A;  3KLS X;  2ATW A;  3S24 A;  5DAU A;  3S16 H;  4QY7 A;  1U4R A;  4M8A A;  4FNF A;  1Q3L A;  2EOT A;  5E4X A;  3I4M G;  3P7J A;  4PMC A;  3CMA A;  1EYD A;  1BBX C;  2RDH A;  2JP1 A;  2K4K A;  4X64 L;  3IRB A;  4HJ8 A;  4OEL B;  2IX0 A;  3NBI A;  3C1F A;  3CXC A;  2L12 A;  1QVF A;  2Q8T A;  2QGQ A;  3L2P A;  1TT2 A;  3TME A;  1IHZ A;  2NN6 I;  5FLX E;  2NVY H;  1VQ8 A;  4OWW B;  1I4R A;  1B4O A;  1E22 A;  5CGK A;  1OTC A;  4IO9 A;  2E76 C;  4X3K A;  2KVM A;  4GN3 B;  3J7A V;  2HDL A;  1PFM A;  4JI3 L;  1SRU A;  2YU9 H;  4JBM A;  5M5W B;  2RCN A;  2G9D A;  3J7Y W;  4OO1 H;  1S5E D;  4YCU A;  5CV4 A;  1F2M A;  4C3H G;  5J22 A;  3KOJ A;  2E2J B;  2WAQ G;  1ICF B;  1ENF A;  2ZXR A;  1EQQ A;  4B3T L;  4GKJ L;  1GUS A;  4X65 L;  5M3M H;  2OCE A;  2B2W A;  3HKZ G;  1HNZ L;  2PMZ E;  3NQI A;  2F4V Q;  3X3N A;  2DJF C;  4C1N K;  3K58 A;  5FKA C;  3T1Y Q;  1SJH D;  3NEM A;  2PCF B;  3QIA A;  4X6A H;  1UE1 A;  4GN5 A;  1DOK A;  2Y0S E;  4JI5 L;  1BCP B;  1N36 Q;  5ELF A;  1I94 Q;  2HCC A;  1PTO B;  4A3F B;  4DR6 Q;  1GUT A;  2ZXP A;  1PA6 A;  3S2D H;  1Q8I A;  3S1R B;  2D9U A;  5KYI A;  5LL6 X;  3SVM A;  2OWO A;  3RUZ A;  1SMY D;  4X66 L;  2F0K A;  3MXU A;  2C5C A;  2R7Z B;  2ZTE A;  1E2V A;  5M9O A;  1CHQ D;  4XIG S;  5I2X A;  1Q81 C;  1MSH A;  1WTH A;  2ZXO A;  4BY7 H;  3I4O A;  1IL2 A;  4DK3 C;  3MHB A;  3HOZ B;  2BH2 A;  2OT2 A;  3PIO 3;  3HOU H;  2L9H A;  4C3I B;  3S14 B;  4FXK C;  1AP0 A;  2D0P A;  4K5X A;  5EKI A;  2K5D A;  1A63 A;  3D6W A;  5JJK A;  4GLA C;  2Z9H A;  1EYC A;  4HJ9 A;  2V4D A;  2B29 A;  4R4Q A;  2EY1 A;  3GTM B;  4EGV A;  2WAQ E;  3GTG B;  2H4O A;  1AH9 A;  4KTA A;  2K33 A;  4KHP L;  3AYH B;  3VR3 A;  5JAV A;  5IP7 G;  1QIL A;  1TWH B;  4QUC A;  2IHF A;  2F52 A;  1D6E C;  2AQ1 B;  4C3J H;  1PRT B;  3HOV H;  1M4V A;  4DK6 C;  3C46 A;  4IUP A;  4DXG A;  3CP0 A;  2JYO A;  1YJW A;  1BNZ A;  4FVM A;  4A3L H;  1CM9 A;  2JXM B;  3HOX H;  1FNU A;  2HDM A;  1QE6 A;  2B2Y C;  5A2Q E;  1NSN S;  1LTG D;  4YCV A;  3RZD B;  1AFP A;  1G29 1;  2LMC B;  3JAM E;  1TWF B;  4K8I A;  1KAW A;  1MJC A;  2BE5 C;  1EY5 A;  1STH A;  4UDU C;  2IX3 A;  2JA7 G;  5COR A;  1YNX A;  3E6Z X;  1P16 A;  3S1Q H;  1PVO A;  2UXB L;  3J80 L;  4CDC C;  3K59 A;  2PI2 A;  1HRJ A;  4MTN A;  3GTJ B;  1RJT A;  2VZA A;  1C4Q A;  3D4R A;  3MEH A;  1FNW A;  4CDF C;  3UDF A;  1PRT F;  4XYQ A;  1E3P A;  5D65 A;  1G51 A;  5ISR A;  1I50 H;  2JA6 B;  3G4S A;  1HZA A;  2F0N A;  2LXK A;  2F0U A;  4DR7 L;  4LFB Q;  3IL8 A;  3M4O B;  2A6H C;  5FO7 B;  4YY3 Q;  4YWM A;  1EYA A;  4KD4 A;  4BY1 G;  1STE A;  1YHA A;  3QO2 A;  3HEJ A;  3P20 A;  3CW2 C;  3QR8 A;  4CHT B;  3KJO A;  2Q8I B;  5AFW A;  3TDQ A;  3CCE A;  4HAE A;  1YI2 A;  1Y1W G;  3S16 B;  1HTL D;  3V05 A;  3Q24 A;  1JIC A;  1W6K A;  2Q8R E;  1TS5 A;  2ZM6 Q;  3K5M A;  4FXD A;  5IGC A;  3G6E A;  3PO3 G;  3K5N A;  1PYB A;  2HT1 A;  3FKI H;  4B08 A;  4A3I H;  3U58 A;  3FPP A;  3MXP A;  3U4Z A;  1N33 Q;  3I8Z A;  3H0G H;  2NVY B;  5C3X A;  4JI6 Q;  5FJ8 G;  1K0R A;  2GN5 A;  2QF7 A;  2KCC A;  2EE1 A;  2TMP A;  3QJY A;  5HGQ A;  2VQF Q;  4WOR A;  1B7Y B;  2YU9 B;  4TQU S;  5EKK A;  4RG1 A;  1UEA B;  1J9O A;  5JPM C;  4HIM A;  2M2L A;  1RTN A;  5CV5 A;  4HED A;  4ZKB B;  4DR5 Q;  1AZP A;  2CW0 C;  5M3M B;  1CZG A;  2B8G A;  1YNJ C;  4NXM Q;  4L5R C;  2UXC Q;  1JE4 A;  1HH2 P;  5I9O A;  4A3G H;  5KRU A;  4C1N I;  5CV8 A;  1DOL A;  1M1K C;  4DNI A;  1VQF A;  3PUV A;  3TN2 A;  5BN3 A;  3S2D B;  1DYQ A;  3H3V I;  1QNK A;  3T53 B;  4KV6 A;  4HIK A;  4EX5 A;  4G7O C;  3R2I A;  4NB3 A;  4AH6 A;  2K5Q A;  3PIP 3;  1NNX A;  4BY7 B;  4BBS H;  4DA2 A;  1BBW A;  3HOW G;  2F0L A;  3HOU B;  4A3J G;  3E9I A;  2RDG A;  2FFK B;  2EVB A;  3ERO A;  2FXQ A;  2JA8 G;  3GO5 A;  2YTV A;  4KY6 A;  2B2V A;  1EIF A;  1IW7 C;  1X3E A;  4DK1 A;  4YWL A;  1EZ8 A;  2WFW A;  1TWG H;  5JVH 3;  2FJ2 A;  1Y1V H;  2AUK A;  4LWC A;  1WTO A;  5DNF A;  1HHV A;  3CC4 A;  3RN5 A;  3QOJ A;  3CF5 A;  4QUF A;  5C4X H;  1SSO A;  4F7X A;  2B63 H;  1E2Z A;  2NZ1 D;  5CBE E;  4FF2 A;  4A3D H;  4PG3 A;  1A0I A;  4C3J B;  5JEA J;  3HOV B;  2F0J A;  4F8M A;  5EGT A;  1VQG A;  3I4M H;  4N8X 1;  5EPK A;  5KYL A;  3T1Y L;  2Q2U A;  2KUM A;  3I3C A;  1YHQ A;  2EY2 A;  3HOX B;  2R61 A;  4NDX A;  5FLM H;  3CAM A;  3BVG A;  3W1B A;  4L63 B;  4LFA Q;  3Q22 A;  1EQV A;  2NB0 A;  1TU2 B;  4OIK A;  1IZ6 A;  5IGB A;  4GLX A;  2B2T C;  3SEB A;  4GKK Q;  3G48 A;  1ICW A;  5DEH A;  5C0X G;  1LTA D;  3KK7 A;  3PUZ A;  1XMO Q;  4LF6 Q;  3S1Q B;  4A3B G;  2N78 A;  1MGS A;  4B3R L;  1Q12 A;  3I4L A;  4DAP A;  1LV9 A;  4GZY C;  1AE2 A;  1JWS D;  1RDP D;  4FF1 A;  1EEF D;  3NTK A;  4C3H H;  1I50 B;  2N55 A;  2ZT9 C;  2OXP A;  3AEV A;  1HCZ A;  3A5Z B;  1LYL A;  3OTO L;  1KD1 C;  4X64 Q;  2O5I C;  3H3V H;  1O7Y A;  4L6T B;  1MSG A;  1R4Q B;  2UUB L;  1WVL A;  2A74 C;  3FHW A;  2MP1 A;  3SR1 A;  2R92 G;  3K7A H;  5GAD C;  4JI3 Q;  4AYB E;  2NBF A;  1Y69 U;  3NTI A;  1VQH A;  4GOP C;  1KTK A;  3CKI B;  5I2Y A;  2MNA A;  3FKI B;  4A3I B;  2HIV A;  4B3T Q;  5HUR A;  4GKJ Q;  1PRT D;  3H0G B;  4EVO A;  3M4Q A;  3GTO H;  1S5C D;  5DLQ E;  2FMC A;  1V1Q A;  1IYV A;  2LFN A;  2SNM A;  3M9B A;  1LUZ A;  3EN2 A;  2L11 A;  3BS1 A;  3A7L A;  1B1Z A;  4RMF A;  1OXT A;  3E5S A;  3MXG A;  1VQ7 A;  4V19 0;  1AN8 A;  2E2D C;  4X3S A;  2E5L Q;  3TZD A;  3OW7 A;  1YNN D;  1JB3 A;  4ZRZ A;  4IFD G;  2EYO A;  4A3C G;  2NN6 G;  2AWN A;  4X66 Q;  1HFN A;  4A3G B;  1CUK A;  3F2D A;  5TSS A;  2JA5 G;  2ID0 A;  2F0O A;  1HTP A;  3RD4 A;  3K0Y A;  2VQE L;  1K0S A;  2B3G A;  2UU9 L;  1DOM A;  3K57 A;  1O80 A;  2SOB A;  1BQQ T;  3CQZ H;  1FGU A;  1EIY B;  1SYB A;  1SYF A;  3UDX A;  1CHP D;  4DV3 Q;  5IE8 A;  4DV1 L;  3EJI A;  2ZM6 L;  1N34 Q;  1X65 A;  1L0Y B;  4BBS B;  1K8G A;  1XYI A;  2RKS A;  3CCV A;  1T5E A;  2JA7 H;  3J81 c;  2K50 A;  4A3E H;  4IZ8 A;  2XNA C;  4J15 A;  2KCN A;  4R9W A;  1CTM A;  5C44 H;  2HQE A;  4DV7 L;  2NVQ H;  3KBX A;  2ICE C;  1B3Q A;  3CHB D;  2QDL A;  2WB1 B;  3BDC A;  5EJW A;  1TWG B;  1JOO A;  3F8T A;  1Y1V B;  3GP7 A;  3KLW A;  1XWE A;  2PMZ B;  2A68 C;  2CFM A;  3NXW A;  3NHH A;  5BN5 A;  3LNN A;  1A3T A;  5C4X B;  1AW7 A;  1SYC A;  1WCM H;  3D6C A;  5T1G A;  1ML0 D;  1EY8 A;  1PFN A;  4B9W A;  3LWE A;  2B63 B;  1I4G A;  1H95 A;  2EXZ A;  4A3D B;  3H3V C;  1NMG A;  1SAP A;  2A5H A;  1Y1W H;  1HQM C;  1Q1E A;  1A3V A;  2JN4 A;  1HUN A;  3I4M B;  1DGS A;  3LGJ A;  2G9H D;  2F4I A;  4UHV A;  1JR0 D;  3D31 A;  2UXB Q;  3FRP B;  3I4N G;  4QGU A;  3T16 A;  3W3A A;  4G57 A;  3MAQ A;  1PMR A;  1DXM A;  2XWJ B;  3NWT A;  1TS4 A;  2CKZ B;  4XT1 B;  3VYT A;  2PNH A;  3K5O A;  2CH4 W;  1R4P B;  4RAU C;  4DR7 Q;  2KHI A;  3DM3 A;  3O13 A;  2I5L X;  1KDA A;  1EU3 A;  1NE3 A;  2D5D A;  2K5W A;  4RHS A;  2H5X A;  1VQJ A;  1TY2 A;  2YV5 A;  4C3H B;  2I07 B;  3TP8 A;  2K1B A;  2JSO A;  1H9M A;  2LSS A;  1RIP A;  2XWB B;  4POF A;  5C0X I;  1EYG A;  1BXT A;  2OQK A;  1MHW C;  2EY5 A;  1BUV T;  4JI1 L;  3J7Z C;  2KOL A;  3L0O A;  1TS3 A;  3PUY A;  1PZJ D;  3HKZ B;  3TSS A;  1VQP A;  3HS0 C;  5FLX c;  2VS1 A;  4KHZ A;  1OXX K;  3V96 A;  3CPF A;  3SK5 A;  1HA5 A;  1W3S A;  2E74 C;  4HMI A;  4I65 A;  3HOY H;  1QNU A;  4LJZ C;  3RLF A;  3VDY A;  1VQI A;  1GD7 A;  4RKB A;  3J80 E;  1CKN A;  3K7A B;  5ELB A;  4JI8 L;  1B44 D;  3KYH C;  4A3M G;  2A19 A;  4K2K A;  4K2L A;  4H0L C;  5I4D A;  4JPB W;  3PCO B;  4DNT B;  3J7A F;  1F9P A;  3OIQ A;  2L55 A;  4BA1 I;  4JG2 A;  4EQO A;  1VQ9 A;  5BR8 Q;  1WD1 A;  2R7D A;  3RMH A;  1GM5 A;  1VQ5 A;  2PPB C;  3GTO B;  2BA1 A;  4L5T A;  3HOW H;  4A3J H;  4A93 H;  2B39 A;  3T4A C;  2JA8 H;  4KK7 A;  1KDB A;  1EEI D;  2N8N A;  4I7Z C;  2Z0S A;  4NXN L;  3DWA A;  4QMG A;  1CA5 A;  5D3D A;  1QB5 D;  2ZJQ A;  2F0V A;  2IHE A;  3VR6 A;  4LF6 L;  4JOI C;  1XPR A;  1EUJ A;  3IAY A;  3AMU A;  3L3O C;  4PZ6 A;  1CSP A;  5IT9 E;  1SE3 A;  1Z7T A;  2LY7 A;  2R3Z A;  3H91 A;  3NWS A;  2F3I A; 
#chains in the Genus database with same CATH homology
 1KRS A;  5LMN Q;  4YCW A;  2JA7 G;  3I7F A;  2QA4 A;  1YNX A;  1P16 A;  3S1Q H;  3TRZ A;  4A75 A;  2UXB L;  1PVO A;  1PYS B;  2KBN A;  2E2H H;  4XTC S;  1C0A A;  4JV5 L;  2V1C C;  2PI2 A;  4MTN A;  4LFC Q;  2VZA A;  3H15 A;  1YZ6 A;  4PZ8 A;  3UDF A;  3KFU A;  4IFD I;  1E3P A;  3J80 c;  2F4V L;  4R1J A;  3M4P A;  1G51 A;  1I50 H;  4GNX A;  3G4S A;  3KJP A;  1HZA A;  4BY1 H;  2LXK A;  3M3Y H;  1SRO A;  4OWT B;  4Y7N H;  4DR7 L;  3J80 i;  3W1G A;  4LFB Q;  2BH8 A;  1VQ6 A;  4IJL A;  2Q2H A;  4DAM A;  4YY3 Q;  1N36 L;  4YWM A;  4C2M H;  4TVA B;  2EQS A;  3CCR A;  4DUY Q;  1WI5 A;  4BY1 G;  4ALP A;  3KF6 B;  1YHA A;  1I94 L;  4K0K L;  3ER0 A;  3CW2 C;  4DR6 L;  4BBR H;  3PV0 A;  1UWV A;  3S2H H;  3GD7 A;  4LF7 Q;  2Z6K C;  3KJO A;  2Q2T A;  3TS0 A;  3CCE A;  1YI2 A;  1Y1W G;  3U4V A;  4POG A;  2JK8 A;  4BBR G;  4R4T A;  2JEB I;  4MNO A;  3GTQ H;  2UXD L;  1CKN B;  3UDG A;  1B8A A;  5GAH C;  4JI7 Q;  1KHI A;  2ZM6 Q;  3PO3 H;  1VQL A;  1I6H H;  4LF9 L;  3ULJ A;  1VQ4 A;  4UPA A;  2CWP A;  4LF4 L;  3CCJ A;  3K8A A;  1ASY A;  1SN8 A;  3G6E A;  2E8G A;  5M3M G;  3PO3 G;  4P73 A;  1PYB A;  2EIF A;  4ME3 A;  1VQM A;  1QVG A;  3F2B A;  1VQO A;  3PUW A;  2HT1 A;  4QIW E;  3FKI H;  1V9P A;  5IYC H;  5FJ8 H;  3JAM c;  4A3I H;  3U58 A;  5IT9 c;  5J3B A;  4BA2 I;  3U4Z A;  3CPW A;  1N33 Q;  3H0G H;  4JI6 Q;  1HNW L;  1YBY A;  1L1O A;  1K8A C;  4KI0 A;  1K0R A;  2GN5 A;  3NEL A;  5FJ8 G;  2Q2I A;  2E5L L;  4LF5 Q;  3K80 C;  4DR3 L;  4FDB A;  5HGQ A;  1VQD A;  2VQF Q;  1KL9 A;  1U0L A;  1B7Y B;  4TQU S;  2IY5 B;  1PH6 A;  4RG1 A;  4JI2 Q;  4HIM A;  4IPG A;  4YHH Q;  5M5X H;  4X62 Q;  2OQ0 A;  3K7U C;  4DR5 Q;  5EAY A;  2JA9 A;  5M3F H;  4B3R Q;  1NJI C;  4Y52 H;  3B6Y A;  1XMQ L;  1PV4 A;  3SGI A;  4MZ9 A;  1IBM Q;  1XNR L;  3M85 A;  2MQH A;  4P72 A;  1XTD A;  2DUD A;  4L5R C;  4NXM Q;  1KIX A;  2UXC Q;  4BY7 G;  2A8V A;  1KC8 C;  1HH2 P;  1C7Y A;  3FP9 A;  4DR2 L;  3CCL A;  4JI0 Q;  1OXU A;  4A3G H;  4DUZ Q;  3RR5 A;  3I56 A;  3HOU G;  1NMF A;  1U5K A;  2KCM A;  4LUO A;  1PH9 A;  4DV3 L;  3OTO Q;  4JOI A;  2VUM G;  2VY3 A;  2I5H A;  3T1H L;  4OO1 I;  3TEH B;  1M1K C;  3HFZ B;  4O2D A;  4X65 Q;  4DNI A;  3PIP A;  1VQF A;  2YTY A;  3PUV A;  1N34 L;  3M7N A;  3ICE A;  1CKM A;  1K3R A;  2UUB Q;  1W2B A;  1HNZ Q;  3GTK H;  1UEB A;  4DV0 L;  3H3V I;  4JYA Q;  1QUQ A;  3NEN A;  5LMN L;  1MKH A;  1K9M C;  2I5M X;  2IX1 A;  1N32 Q;  4QJF A;  1QZH A;  4HIK A;  1UE7 A;  5ELN A;  3TRE A;  4EX5 A;  4JI5 Q;  1YIT A;  2C35 B;  3RLN A;  5IY0 A;  4NB3 A;  4AH6 A;  1JJ2 A;  2JJQ A;  1HR0 W;  4BBS H;  5IYD G;  4A3C H;  1BBW A;  5IP9 H;  4QL5 A;  1UE6 A;  3HOW G;  4APV A;  1SFO H;  4A3J G;  2NVX H;  1SLJ A;  3E9I A;  2R93 H;  4BBS G;  1KQS A;  2FXQ A;  2JA8 G;  3HOV G;  3PF4 A;  3GO5 A;  2D62 A;  5IP9 G;  2YTV A;  2JEA I;  1NBW A;  1AE3 A;  2BA0 A;  2E2I H;  3KDF A;  1EIF A;  4P75 A;  1X3E A;  4LFB L;  1B70 B;  4YWL A;  2K75 A;  4A3K H;  2WFW A;  4R4I A;  1TWG H;  4YY3 L;  4H02 A;  5C3E G;  1Y1V H;  4KLK A;  3ERS X;  1SR3 A;  3CCU A;  4LWC A;  2K5N A;  3K0X A;  3KF8 B;  2WB1 G;  4JBJ A;  2HHH Q;  1Q86 C;  2Z6K A;  1HNX Q;  3ZJY C;  5LMU Q;  3CC4 A;  1Y1V G;  3RN5 A;  3AFQ A;  3CF5 A;  1N8R C;  1PH3 A;  4DR4 Q;  4OX9 Q;  5C4X H;  1L1O B;  5M5Y H;  1HJP A;  3CC7 A;  1PH5 A;  1ASZ A;  2B63 H;  4JI7 L;  4A3D H;  5C4X G;  1IXR A;  4PG3 A;  1C9O A;  3E9H A;  1A0I A;  4YWK A;  5JEA J;  1EFW A;  1HR0 Q;  1IBL Q;  2KEN A;  5M5W H;  2B63 G;  1VQG A;  3GTL H;  3I4M H;  5JJL A;  3PGZ A;  2MFI A;  3T1Y L;  3EIV A;  2Q2U A;  1S40 A;  4KHP Q;  1KRT A;  1SMX A;  5C0X J;  2E2J H;  2OTL A;  1YHQ A;  1TWA H;  1OXS C;  1Q7Y C;  2VQE Q;  1N33 L;  5FLM H;  2RHQ B;  3CAM A;  3J81 i;  1XNQ Q;  4A76 A;  2UU9 Q;  3W1B A;  4LFA Q;  4JI6 L;  3RZO H;  2K14 A;  4LF5 L;  1A62 A;  1VQC A;  4LW1 A;  5FLM G;  5JEA G;  2GVA A;  1IZ6 A;  3J81 j;  2VQF L;  4GLX A;  2WP8 J;  1PH2 A;  4A3B H;  4DV4 Q;  1Q46 A;  4GKK Q;  1FL0 A;  4DV5 Q;  3G48 A;  4UP9 A;  4JI2 L;  4LF6 Q;  5C0X G;  3PUZ A;  4X62 L;  2XTI A;  4YHH L;  1X56 A;  4DV1 Q;  3RNU A;  3MXN B;  1XMO Q;  4B3S Q;  4IPH A;  4A3B G;  4B3M Q;  4DR5 L;  2N78 A;  1IBK Q;  4R4O A;  2GVB A;  3RLO A;  1PH8 A;  4B3R L;  4GN4 B;  1GO3 E;  1Q12 A;  2D0O A;  2PQA A;  2YTX A;  3BU2 A;  4IJH A;  4A3F H;  1AE2 A;  2HQL A;  4QQB X;  4JBK A;  5AJ3 Q;  3OW2 A;  1MIU A;  1CSQ A;  1QUQ B;  4C3H H;  3S1R H;  3HKS A;  1NY4 A;  1A8V A;  4NXM L;  2UXC L;  4JI0 L;  4DUZ L;  4DV6 Q;  5HY6 A;  4DV7 Q;  3JC6 6;  3FKI G;  2R7Z H;  5IYC G;  3AEV A;  4A3I G;  3A5Z B;  1LYL A;  3OTO L;  3Q8D A;  1KD1 C;  3H0G G;  4JBW A;  2WB1 E;  4DPG A;  4X64 Q;  1XPO A;  3H3V H;  1FJG L;  3HOZ H;  5GAE C;  2UUA Q;  1IYJ B;  3CCS A;  5GAG C;  4C3I H;  2UUB L;  3TQY A;  3S14 H;  1LTL A;  4PZ7 A;  1K83 H;  1S3O A;  1BVS A;  3G71 A;  2R92 H;  4AIM A;  3HOZ G;  4JYA L;  1G6P A;  2R6G A;  3FHW A;  3KDF B;  2NZO A;  1OXV A;  5BR8 L;  1N32 L;  3J7A 5;  4OXP A;  2KHJ A;  3I55 A;  2R92 G;  2VW9 A;  1J6Q A;  3F2C A;  3K7A H;  5GAD C;  1PH1 A;  4AYB E;  4JI3 Q;  3GDE A;  5M3F G;  3GTM H;  2EXD A;  4LNQ A;  1VQH A;  4GOP C;  1BBU A;  4WJ4 A;  3PO2 H;  1Q1B A;  1K73 C;  4NPS A;  3GTG H;  4IOA A;  1JJC B;  1J5E Q;  1HZ9 A;  2CQO A;  3L7Z C;  2MNA A;  3UE0 A;  2UUC Q;  2HIV A;  2XGT A;  2K5H A;  1VQK A;  4B3T Q;  4A3G G;  4GKJ Q;  1XJV A;  1JB7 A;  3M4Q A;  1L2F A;  3GTO H;  4JI4 Q;  5IYB H;  1X55 A;  1TWH H;  2DGY A;  5DLQ E;  5ELO A;  3STB C;  2JE6 I;  4BXX H;  1V1Q A;  3PUX A;  4HJA A;  4IFD J;  5IYB G;  2ES2 A;  3M9B A;  1LUZ A;  1YVC A;  3EN2 A;  3DLL A;  4HJ5 A;  3UDI A;  4IPD A;  1YJN A;  4IPC A;  4BXX G;  4LF8 Q;  4RMF A;  2HHH L;  1N9W A;  1HNX L;  1OXT A;  2ZJP A;  5LMU L;  4DR1 Q;  1QZG A;  1VQ7 A;  5C4J H;  2ASB A;  4DR4 L;  1Y14 B;  4OX9 L;  2E5L Q;  3W5O A;  3RZD H;  4HJ7 A;  2CCZ A;  1TWF H;  2N3S A;  2KCT A;  1X3F A;  4UP7 A;  5JJI A;  1WYD A;  3E0E A;  4LFC L;  3A5U A;  2JA5 H;  5LMN W;  4IFD G;  2N49 A;  4DV2 Q;  1IBL L;  2NN6 G;  2AWN A;  2YYZ A;  4X66 Q;  3TS2 A;  1EOV A;  4A3C G;  1CUK A;  1S72 A;  3F2D A;  3CCM A;  1FVI A;  2JA5 G;  2ID0 A;  1VQN A;  2CWA A;  1L0W A;  4AQY Q;  2R93 G;  1RL2 A;  4JI1 Q;  1YIJ A;  1E7Z A;  1V43 A;  1WFQ A;  1T9H A;  2K5V A;  2PQA B;  3S1M H;  2VQE L;  3HKZ E;  1XNQ L;  4LUV A;  2L15 A;  1VQA A;  2B3G A;  3CCQ A;  2ZTC A;  4DUY L;  2UU9 L;  3OYY A;  4JC0 A;  3GTJ H;  1P8L A;  1BKB A;  4LFA L;  3CD6 A;  1JT8 A;  1GVP A;  1VQB A;  4A3K G;  3CQZ H;  1YHB A;  1FGU A;  2LXJ A;  4LF7 L;  1EIY B;  1JMC A;  3UDX A;  3RN2 A;  2JA6 H;  4DV4 L;  4GKK L;  1VQE A;  4DV3 Q;  2OTJ A;  1PH4 A;  3BZC A;  5IE8 A;  4DV1 L;  1HZB A;  1QVC A;  1XMO L;  3M4O H;  4B3S L;  4O0A A;  5GQO A;  1YEZ A;  4JI8 Q;  2ZM6 L;  1X9N A;  1X65 A;  3MEF A;  1N34 Q;  1IBK L;  4B3M L;  2Y0S G;  5IWA Q;  1K8G A;  3D0F A;  1EQR A;  1GKH A;  4AYB G;  3CCV A;  1I3Q H;  1YJ9 A;  2JA7 H;  4A3D G;  3J81 c;  5AJ3 L;  1Z47 A;  2ATW A;  3S24 A;  2K50 A;  1NTG A;  4A3E H;  3S16 H;  4QY7 A;  4GS3 A;  3I4M G;  4J15 A;  1TWC H;  5K36 G;  3CMA A;  5C44 H;  1PH7 A;  4HID A;  4DV7 L;  1JE5 A;  4DV6 L;  4A3E G;  2NVQ H;  2K52 A;  1CKO A;  1WJJ A;  4OWX B;  2K4K A;  5E7N A;  5C44 G;  3F8T A;  1I5F A;  3IRB A;  1Z9F A;  4X64 L;  2VNU D;  4HJ8 A;  4NXN Q;  2IX0 A;  3KLW A;  1MJE A;  3CXC A;  2UUA L;  1QVF A;  2QGQ A;  2CFM A;  3L2P A;  2NN6 I;  3F1Z A;  2I0Q A;  3PSI A;  4A4I A;  2NVY H;  1VQ8 A;  4OWW B;  1WCM H;  2RHS B;  1E22 A;  4IOC A;  1OTC A;  4IO9 A;  4DAY B;  1H95 A;  4GN3 B;  1NMG A;  4JI3 L;  1IBM L;  1SRU A;  1WOC A;  1WCM G;  3K81 C;  4GOP A;  2YU9 H;  4JBM A;  1Y1W H;  4A3F G;  1Q1E A;  2RCN A;  3I4N H;  1PHJ A;  1DGS A;  3LGJ A;  2IT1 A;  2NZH A;  5H1S E;  1J5E L;  4YCU A;  3D31 A;  2UXB Q;  3KOJ A;  2WAQ G;  2UUC L;  3I4N G;  4QGU A;  4OO1 G;  2A1A A;  3S15 H;  4JV5 Q;  1EQQ A;  4B3T L;  4GKJ L;  2R7Z G;  1D8L A;  4P74 A;  4X65 L;  3A74 A;  5M3M H;  2OCE A;  1TXY A;  4JI4 L;  2CKZ B;  1XPU A;  3HKZ G;  1HNZ L;  2PMZ E;  2F4V Q;  2PNH A;  2ZTD A;  3T1Y Q;  4GNX C;  3NEM A;  4DR7 Q;  4DKA C;  3S1N H;  4X6A H;  4LF8 L;  1UE1 A;  4GN5 A;  1M90 C;  2Y0S E;  2KHI A;  4JI5 L;  3S17 H;  1N36 Q;  3UE1 A;  4HIO A;  4DR1 L;  3AQQ A;  3DM3 A;  4UP8 A;  1X54 A;  1I94 Q;  2I5L X;  3JAM i;  2AHO B;  4K0K Q;  1NE3 A;  4DR6 Q;  2H5X A;  1PA6 A;  3S2D H;  1JJG A;  1VQJ A;  3PIO A;  2YV5 A;  2OWO A;  3PO2 G;  4DV2 L;  4PMW A;  2MO1 A;  4X66 L;  2UXD Q;  2LSS A;  1RIP A;  4POF A;  5C0X I;  1EYG A;  2ZTE A;  4AQY L;  2OQK A;  4JI1 L;  4LF9 Q;  3J7Z C;  4XIG S;  3U50 C;  3L0O A;  3WWV A;  3PUY A;  1Q81 C;  4LF4 Q;  2ALY B;  1VQP A;  4BY7 H;  5FLX c;  2VS1 A;  3I4O A;  4KHZ A;  4P71 A;  4DK3 C;  1OXX K;  1IL2 A;  2NVT H;  4WJ3 M;  1O7I A;  2VL6 A;  3KF6 A;  2BH2 A;  3HOU H;  3CPF A;  3GTP H;  4L5S A;  3STB D;  1W3S A;  3EBE A;  3HOY H;  2D0P A;  2VUM H;  2JQO A;  1E1T A;  1X3G A;  1HNW Q;  1A63 A;  5JJK A;  4GLA C;  3RLF A;  4OON A;  3VDY A;  1L1O C;  1VQI A;  1GD7 A;  1VCI A;  4A3M H;  4HJ9 A;  3ULL A;  4DR3 Q;  3HOY G;  1HZC A;  2MO0 A;  2B29 A;  1CKN A;  2R7F A;  3I2Z A;  3BZK A;  4R4Q A;  1KXL A;  1Q8K A;  4JI8 L;  3A0J A;  3KYH C;  1FJG Q;  4A3M G;  2A19 A;  5IWA L;  2QEX A;  1HR0 L;  1R9T H;  2WAQ E;  2AMC B;  5IP7 H;  3PCO B;  1AH9 A;  3NBH B;  3ULP A;  4GNX B;  1VQ9 A;  4BA1 I;  4JG2 A;  4UY8 C;  4KHP L;  3AYH B;  1Q82 C;  5BR8 Q;  2R7D A;  5IP7 G;  1GM5 A;  3BJU A;  1E24 A;  1SE8 A;  1VQ5 A;  1XMQ Q;  5IYD H;  4LUZ A;  5GRO A;  1XNR Q;  2BA1 A;  4L5T A;  1LM0 A;  2RF4 A;  3HOW H;  4A3J H;  4GOP B;  2IHF A;  2F52 A;  4GLV B;  4A93 H;  4C3J H;  3CME A;  2JA8 H;  3HOV H;  4DR2 Q;  4DK6 C;  2N8N A;  4JCV E;  1X6O A;  2Z0S A;  1E1O A;  4NXN L;  1VS0 A;  3CP0 A;  1YJW A;  4A93 G;  1PFS A;  4DV5 L;  2ZJQ A;  4R4C A;  4EQ5 A;  4A3L H;  2IHE A;  4LF6 L;  1UE5 A;  4JOI C;  2HIX A;  3HOX H;  3T1H Q;  1EUJ A;  1EWI A;  1XPR A;  2JA6 G;  2ZJR A;  2PI2 E;  4PZ6 A;  4YCV A;  5C3E H;  4A3L G;  2AWO A;  1G29 1;  3HOX G;  1CSP A;  1KAW A;  2AKW B;  1MJC A;  3CC2 A;  4DV0 Q;  3AFP A;  3PF5 A;  4L5Q A;  2F3I A;  1D7Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...