4DV4Q

Crystal structure of the thermus thermophilus 30s ribosomal subunit with a 16s rrna mutation, a914g
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
99
structure length
99
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin resistance
rcsb
molecule tags Ribosome
total genus 17
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2012-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4dv4Q00
4DNIA 3F2CA 4LF4Q 4DR1Q 3M7NA 4HIDA 4A3LG 3D0FA 2WAQG 4NPSA 4B3TQ 4YWMA 1TWCH 2RHSB 2ZTCA 1HNWQ 1MKHA 1DGSA 1VCIA 4GKKL 1JB7A 1YVCA 1I50H 5JEAJ 1CSQA 4L5TA 1BBWA 4YCVA 1YITA 1IBLQ 5M3MG 1N36Q 1Y14B 3ICEA 3I56A 3NELA 1SFOH 1I3QH 1VQ4A 4KHPL 2VW9A 1TWFH 2B3GA 3ER0A 1E1TA 4C2MH 1XJVA 2A1AA 3H15A 1X6OA 4MTNA 2VQFL 2K14A 1ASYA 4DR4L 2HQLA 1Z9FA 4B3RQ 2R7DA 2UXCL 5IYBG 2PQAA 3F8TA 1LM0A 3HOVH 1EYGA 4LF6Q 1HZAA 4DV6Q 1L1OA 2CKZB 2MO1A 1S72A 2WAQE 1HNXQ 1FL0A 1QVGA 3GO5A 4IFDI 2YV5A 1N32L 3S1NH 3OYYA 4O0AA 3STBD 2ZJQA 2DUDA 3I4MG 4X65Q 4DR3L 1CKOA 2V1CC 2UXDL 4JI5Q 3GTPH 1WOCA 2JK8A 1PH1A 1N33L 2VUMG 5IWAL 2MQHA 3AFQA 3U4VA 3L0OA 3W1GA 4LNQA 1HZBA 3PUZA 1A0IA 3I2ZA 4OWXB 4C3JH 4L5SA 3K80C 4LFBQ 1JT8A 1TXYA 4R1JA 4X64Q 4DUZQ 2KHJA 4OONA 3W5OA 4Y7NH 1Z47A 3CC2A 1I5FA 5IP7H 4QQBX 1N34Q 1WYDA 2UU9L 1PV4A 1GO3E 4R4OA 1QVFA 3PF4A 2RCNA 2DGYA 4JI4L 4QY7A 3J80i 4BXXH 3CCLA 2A8VA 4A3IH 1RIPA 4JV5L 2K75A 4A93H 1OXXK 3ULLA 4LWCA 3HOYH 3U58A 3S1RH 1PHJA 1GD7A 2MNAA 1IBML 1SE8A 3KDFB 4RMFA 4DV5Q 1N9WA 4LF7Q 3RZOH 2N3SA 3GTGH 4A3MH 1X9NA 3J7ZC 4XTCS 3KJPA 1E22A 2UUAL 2ATWA 3S2HH 5M5YH 3J81c 4JYAQ 2UXCQ 3HFZB 1VQJA 4IOCA 1VQKA 3PO2H 1MJCA 2JA5H 1EOVA 1WCMH 4DV3L 4DR6Q 3UDFA 2CWPA 3JAMc 5ELNA 1OXUA 2R92G 1LYLA 4R4IA 1Q1EA 3A5ZB 4LFAL 3J81j 2JEAI 4P72A 1NY4A 4LF5Q 3PUYA 5GADC 1N33Q 1BBUA 4DR1L 3VDYA 1JE5A 1YJNA 4B3TL 1WFQA 1HNWL 4LUOA 2NVTH 4PMWA 1EFWA 2OWOA 3KYHC 2D0OA 3CCRA 1KXLA 3PCOB 1CKNA 3CP0A 5IYDG 3AFPA 4QIWE 4YWKA 3HKZG 2PI2A 1IBLL 3K0XA 4IPGA 3S2DH 1X3GA 2LXJA 1E3PA 3OTOQ 3I55A 4QL5A 2AMCB 1K83H 1BVSA 5IP7G 2D62A 3BJUA 3K8AA 3PGZA 4PZ7A 4X6AH 1FVIA 3F1ZA 3KF6B 4MNOA 3M3YH 1LTLA 1YJWA 5IYBH 4BXXG 4UP8A 4JV5Q 2I5LX 4KLKA 4A3IG 3GTMH 4LW1A 1JMCA 4A3CH 4LF6L 1VQCA 4DR7L 4DV6L 4GNXA 1H95A 4JI7Q 3HOYG 4JBWA 2XGTA 2NN6I 3KLWA 1PVOA 2UUAQ 4OX9Q 2H5XA 4A3MG 3I4MH 5FLXc 2IX0A 4DPGA 4Y52H 4JI1Q 1NE3A 4JI5L 3HKZE 2YU9H 4IPCA 1UE5A 1J5EL 2VUMH 2RF4A 2JA5G 1QUQA 1VQHA 1WCMG 3G4SA 3EIVA 4YWLA 2N8NA 4UP9A 1JJ2A 1VQNA 4BA2I 2LXKA 1PH3A 3AYHB 4AIMA 1UWVA 3NENA 3L2PA 1KL9A 2BH8A 3HOXH 1CUKA 1NTGA 4LFBL 4JBKA 2F4VQ 1XMOQ 1AH9A 2WP8J 1FGUA 4X64L 4LF9L 1PH6A 3K81C 4YY3Q 4JI3L 4YHHQ 4DUZL 1PYSB 3ULPA 4HJ9A 3CCSA 1N34L 4A3DH 4DV0Q 4HIKA 2AHOB 1UE7A 2ALYB 1EQQA 4WJ3M 1TWGH 4GN3B 2ZTEA 1XMQQ 4UY8C 2JE6I 3UE0A 2YTVA 3NEMA 1IXRA 3J81i 3GTJH 3CCVA 1OTCA 3RR5A 3ULJA 4P74A 3M4OH 3FKIH 4XIGS 2I5HA 1CKMA 3CCJA 1HZCA 4DV5L 1VQAA 4A3EH 2OQKA 1PH9A 4LF7L 4IFDG 2K5NA 1P8LA 3T1YQ 2IT1A 5C4XH 1K9MC 4BY1H 2D0PA 3MEFA 4JYAL 2K50A 2OCEA 3PUWA 4JCVE 1L2FA 1JJCB 1MIUA 4A3JH 2Z6KA 3G71A 1M1KC 4DR7Q 1I94L 1VQ9A 4A3CG 4DV4Q 4DR6L 3A74A 2R92H 2EXDA 3CW2C 3H0GH 1V9PA 3M85A 1YIJA 3UE1A 1IZ6A 3S24A 2K4KA 2ZTDA 3GDEA 4OWWB 2BH2A 3H3VI 4LF5L 1S3OA 4X66Q 4HJ7A 2ZM6Q 1J5EQ 4EQ5A 1Q82C 1X55A 2HT1A 2JA7H 5C3EH 1SR3A 2VL6A 4J15A 4IFDJ 1VQBA 1TWAH 3FHWA 1X3FA 3RLNA 1K8GA 2RHQB 1PH2A 1L0WA 2PMZE 3RLFA 4R4CA 3KJOA 4FDBA 4JC0A 1G291 2R7FA 3HOXG 5IYDH 3U50C 4IJLA 4DKAC 4LF9Q 1HZ9A 2R7ZH 4JI3Q 1VS0A 1PYBA 4X62Q 3OTOL 3I4NH 1L1OC 1VQOA 3KFUA 4A3DG 4JI6Q 4C3HH 3S17H 4NXNQ 3KF8B 2UUCL 4A3GG 4OO1I 1SRUA 3CD6A 1OXSC 4APVA 3FKIG 1VQFA 4IPDA 1B70B 3T1HQ 1HH2P 2N78A 1V1QA 3JC66 5FJ8H 1KAWA 1KQSA 2I0QA 4JI7L 4A3EG 4B3SQ 4BY1G 4OX9L 1VQ8A 5C4XG 3CF5A 1KHIA 3LGJA 4JI0Q 4JI1L 1XPOA 2JA6H 3TRZA 4DR5Q 3PUVA 4A3JG 1I94Q 1OXTA 5IYCH 3S1QH 1D8LA 2YTYA 3AEVA 2GVAA 4HIMA 5H1SE 2E2IH 3H0GG 3CCQA 5LMNQ 2HHHL 1I6HH 1X54A 1BKBA 3PV0A 1Q7YC 2F4VL 4GS3A 1XMOL 1QVCA 2I5MX 2L15A 1VQLA 2JA7G 5C3EG 4UP7A 2C35B 2EQSA 4YY3L 4YHHL 2B29A 1OXVA 1PH4A 4DV7L 2Y0SG 4BA1I 4JBJA 4QJFA 1K73C 4DV0L 1EWIA 3CCUA 3STBC 2NVQH 3RLOA 4POGA 1VQDA 1YEZA 1P16A 3TS2A 1XMQL 3HOZH 3E0EA 2R7ZG 3WWVA 3GD7A 2QEXA 4HJAA 3RZDH 1XNQQ 2VNUD 3SGIA 1CKNB 3UDXA 1CSPA 3I4NG 1EIFA 5K36G 4GOPA 2NN6G 1WI5A 3CC7A 3T1YL 1IL2A 4DV1L 1K8AC 2BA1A 5GROA 3GTQH 3H3VH 2UUCQ 4BY7H 4WJ4A 1N8RC 2QA4A 1VQIA 4GN5A 4DK6C 3CMEA 4JOIA 2B63H 3UDIA 1X65A 5C0XI 3S15H 4IPHA 2FXQA 4DV4L 4LUVA 5FJ8G 4P73A 2F52A 2AWOA 5GQOA 4P75A 5E7NA 2CCZA 2E5LQ 1C0AA 4GKJQ 4GLXA 1HJPA 4X66L 2JJQA 2Q2HA 2ZM6L 2JA6G 2K5HA 3RN5A 4JI2L 4DAYB 1GVPA 4RG1A 1KD1C 2Q2UA 1IYJB 1SMXA 3CCMA 1R9TH 5IYCG 1VQEA 1YHBA 2XTIA 3TQYA 2HHHQ 2PI2E 2OTLA 3PIOA 1VQ7A 2KCTA 3ZJYC 3TS0A 4LFCL 5AJ3Q 1AE3A 5BR8Q 4ALPA 1QUQB 1YNXA 2ZJPA 4DV2Q 2E2HH 2UXBQ 1XNRQ 4PZ6A 1HR0Q 3DM3A 3A5UA 4DV7Q 4K0KQ 3NBHB 2VZAA 4GLVB 4JOIC 3S1MH 1Y1VH 4X62L 2KCMA 4GNXC 4NB3A 2JA8H 4IJHA 3CXCA 4R4TA 2ZJRA 1FJGQ 3J7A5 4JI6L 1EUJA 3CCEA 4NXNL 2AKWB 1NMFA 2F3IA 1B8AA 2JQOA 3W1BA 3HOZG 4A3GH 2IX1A 2HIXA 3FP9A 5LMNW 4DR2Q 4EX5A 4PG3A 1YHAA 3L7ZC 3T1HL 1YZ6A 2CFMA 1G6PA 2R93H 3CPFA 3TREA 2VS1A 4AQYQ 3JAMi 1SROA 5FLMG 4DV1Q 4B3SL 3UDGA 5GAEC 4BBRH 4BY7G 4JI0L 3I4OA 2B63G 3PO3H 4DR5L 2OQ0A 4AYBG 1B7YB 3BU2A 3F2DA 1GKHA 4BBSH 1WJJA 4C3IH 2PQAB 5LMNL 3CAMA 1L1OB 3CPWA 4A3BH 1KRSA 4DUYQ 1C9OA 1E24A 2K52A 4JI2Q 4A75A 4NXMQ 2KHIA 3G6EA 5M3FH 1VQPA 4YCUA 2NZHA 1E7ZA 3PSIA 2ID0A 3E9HA 1TWHH 2UUBQ 4UPAA 1NJIC 1IBKQ 3TEHB 4LFCQ 2A19A 1EIYB 5LMUQ 3HOWH 1A8VA 4A3FH 1GM5A 1AE2A 4B3ML 1K0RA 4LF8Q 3BZKA 5GAGC 2AWNA 3EBEA 5GAHC 4H02A 4ME3A 4OO1G 4MZ9A 1NBWA 2HIVA 4AYBE 4IO9A 3HOUH 2JEBI 2Z6KC 2E2JH 2Q2IA 2VQEQ 1XNQL 1Y1VG 1YBYA 2GVBA 3PIPA 1K3RA 2JA8G 1HNZQ 3M4QA 1U5KA 2NVYH 1KIXA 2CQOA 1Q8KA 5JJKA 3PF5A 1W3SA 1UEBA 1VQGA 1KRTA 4AH6A 1PFSA 2Z0SA 1QZGA 3B6YA 1Q46A 1W2BA 1PH8A 2E8GA 3MXNB 2NZOA 4PZ8A 4DK3C 1SLJA 2R93G 1HR0W 5IY0A 3G48A 5C44H 4KHZA 2E5LL 3IRBA 4GKJL 4BBRG 3GTKH 2LSSA 1Q1BA 2R6GA 1PA6A 3DLLA 3AQQA 2IY5B 2GN5A 3PO3G 3EN2A 4GKKQ 3GTLH 1V43A 3BZCA 4JBMA 3KDFA 5JJLA 4BBSG 1X3EA 5IP9H 2MO0A 1ASZA 1JJGA 3U4ZA 1EQRA 1LUZA 3Q8DA 4GN4B 4DAMA 5JJIA 5AJ3L 5BR8L 4A3BG 4KHPQ 1G51A 3ERSX 1U0LA 3GTOH 1Q12A 1XTDA 4DV2L 2UXBL 1XNRL 5M3FG 3M4PA 1HR0L 4A76A 3A0JA 1A63A 4K0KL 2VQFQ 4A3KH 4O2DA 4DR4Q 3D31A 1Y1WH 4JI8L 4TVAB 3RNUA 2ES2A 1FJGL 3HOWG 3KOJA 4TQUS 5M5WH 4B3MQ 3HOVG 4A3FG 2K5VA 2IHEA 1N32Q 3K7UC 4YCWA 4QGUA 1YHQA 1PH7A 1M90C 4HJ5A 5IT9c 4DR2L 2WB1G 5J3BA 5HGQA 3HOUG 2NVXH 4DR3Q 5C0XG 2UXDQ 2YTXA 1YI2A 2N49A 5FLMH 4AQYL 1X56A 4LF4L 1T9HA 2WFWA 5IWAQ 4A3LH 2KENA 1VQ6A 2BA0A 2VY3A 1D7QA 1J6QA 1VQ5A 1C7YA 4POFA 3S16H 1QZHA 5DLQE 5M5XH 4GOPB 1MJEA 1VQMA 4OXPA 1S40A 3S14H 2Y0SE 3E9IA 3PUXA 4P71A 2MFIA 3I7FA 4GLAC 4A4IA 2OTJA 5C44G 5M3MH 1RL2A 2JA9A 3KF6A 4GNXB 1N36L 4DUYL 5EAYA 5C0XJ 4NXML 4OWTB 1UE1A 3CQZH 1UE6A 3HKSA 2UU9Q 2WB1E 2EIFA 1E1OA 4LUZA 4JI4Q 2UUBL 5IP9G 4R4QA 1IBKL 1YJ9A 4KI0A 2KBNA 2ASBA 4B3RL 2CWAA 3K7AH 1SN8A 3F2BA 5LMUL 4GOPC 4A93G 1IBMQ 4IOAA 4LF8L 1HNXL 1KC8C 1Q81C 3J80c 3CMAA 3OW2A 3CC4A 1Q86C 2Q2TA 1O7IA 1NMGA 3M9BA 4A3KG 5IE8A 5C4JH 4JG2A 4JI8Q 2VQEL 4X65L 2IHFA 1Y1WG 1XPUA 5JEAG 1XPRA 4L5RC 5HY6A 2QGQA 4HIOA 1HNZL 4L5QA 3PO2G 4DV3Q 1PH5A 4LFAQ 1A62A 2YYZA 3RN2A 5ELOA 4HJ8A 2PNHA
chains in the Genus database with same CATH superfamily
4DNIA 1JB3A 3AB9A 3D0FA 1GUGA 3OMCA 4YWMA 5CBAE 3BDLA 2HUGA 2WAQB 1W6JA 5JEAJ 4XDXA 4ME5A 4FYDA 3NWTA 1QE6A 1XX8A 3T4AC 1I3QH 2VXWA 4KHPL 2VW9A 1XJVA 3EVQA 2LMCB 5DNFA 5IGCA 3TZDA 3CQZB 4KMUC 2D2CC 1Z9FA 2UXCL 5IT9E 3CHBD 3D4RA 4PMCA 2CKZB 2MO1A 1S72A 1HNXQ 1FL0A 5E4XA 2YV5A 2EXZA 2E2HB 1W6KA 2CQAA 2HQEA 5IT9L 1CA6A 2PZUA 4DR3L 1EYAA 1A2UA 1D1IA 3QWNA 5FK9C 5IGGA 2VUMG 3DWAA 3U4VA 4RA8A 3Q24A 3PUZA 4C3JH 1JT8A 3EFXD 3VA5A 3CKIB 1RKNA 3HEJA 4K6LA 1I5FA 2NB0A 1AFPA 4JI4L 1WTOA 3J7YW 3J80E 3CCLA 2F0TA 4A3IH 1RIPA 2JXMB 4JV5L 2G5DA 3U9OA 1DONA 2HCIA 2L55A 2MNAA 1SE8A 3KDFB 1UUPA 3J80L 2N3SA 4IALA 3KJPA 4JYAQ 3S2HH 5M5YH 2UXCQ 3GQBA 4IOCA 1VQKA 1WCMH 2CWPA 3JAMc 5ELNA 1OXUA 5KNBA 2R92G 3ND9A 2F0FA 3A5ZB 3KK7A 2B2TA 1H9SB 1QB5D 2J0TD 1EYCA 3VDYA 1U4RA 4Q0FA 2XNAC 1EZ6A 4I7ZC 3CCRA 4C3JB 5IYDG 3AFPA 1RDPD 1MI2A 1V1OA 1IBLL 3S2DH 3I55A 2DY7A 2QKIC 4CJ1B 5IP7G 3K8AA 3PGZA 5G3LD 2RKSA 3GTLB 1FVIA 3F1ZA 3M3YH 1YJWA 3C3LA 4JV5Q 1TS3A 2KCCA 2B2WC 4LW1A 1JMCA 1K8MA 3GTMH 1EIHA 4JBWA 3TP7A 3KLWA 1K8OA 1X32A 2DJFC 4JI1Q 4JI5L 2FJ2A 1UE5A 1J5EL 3S2HB 5M5YB 4V190 3QR8A 1VQHA 4YWLA 1JJ2A 4BA2I 1WCMB 1UWVA 2MP1A 1KL9A 1ENAA 4U68A 1PZKD 3HOXH 1BNZA 1ZYRD 4E6IA 1VMPA 1NTGA 4LFBL 4DN4M 1XMOQ 4X64L 4M1UB 4YY3Q 3PIP3 2EE1A 4KK7A 1PYSB 1Z7TA 1JWMD 1O7ZA 4HIKA 2ALYB 3QOJA 2ZTEA 3T16A 4UY8C 1B9MA 2JE6I 2F03A 3NEMA 3CCVA 2E76C 5I9PA 2F0PA 1L0YB 3S2DB 1CKMA 4H7BA 1HZCA 1VQAA 1PH9A 4IFDG 4BY1H 1K9MC 1JE4A 2XWJB 3J81L 4ILWA 1MIUA 2WKCA 3EA6A 4A3JH 3G71A 4A3CG 3M3YB 5LL6X 3GTMB 3NQIA 1SE4A 3CW2C 3H0GH 1E2WA 3H3VI 3UE1A 4OWWB 2ZTDA 1S3OA 4CDCC 2ZM6Q 1J5EQ 4EQ5A 1LT3D 2O2LD 1TQOA 1X3FA 2RHQB 4DK0A 1L0WA 4ZK9B 5IOCA 1EY0A 4FDBA 4B9XA 4S3SA 3HOXB 2J7ZA 1VS0A 1UAPA 4X62Q 3I4NH 1L1OC 3A55A 5K36H 3KFUA 5BN4A 2EYLA 4ZLTF 3CD6A 3FKIG 4QUFA 3MVVA 1ONLA 2N78A 4JI7L 5FJ8H 1GHKA 3HRZC 2I0QA 2WINB 3MA2B 5C4XG 2EYFA 3LWEA 5FLXL 1KHIA 1A6XA 1JOOA 4BY1B 4JI0Q 3TRZA 1LABA 1KNAA 4HTHA 2M00A 3K5NA 3QG1A 5IYCH 2GVAA 3SXHA 5IGBA 5H1SE 2E2IH 1IHZA 1X54A 3H0GB 1TIID 3NSWA 3I4LA 3C1EA 5CV8A 1LTID 2SEBD 4FP5D 3D6CA 4UP7A 5KEEA 2A73B 3A7AB 4YHHL 1OXVA 3KBXA 1A3UA 4QJFA 4DV0L 1EWIA 4G57A 3I8ZA 1YEZA 3TS2A 3HOZH 1F9QA 1J8IA 3GD7A 3RZDH 1D2BA 1QCBD 3UDXA 1CSPA 4Y7NB 1LTGD 4M8AA 4GOPA 3I4NB 1EQVA 3MTSA 3GTQH 4C56C 3H3VH 3CMEA 5COYA 2EJFC 5C0XI 4ODGA 2K01A 2AQ3B 3HOYB 3S1RB 1C0AA 1HJPA 2JJQA 3K5LA 3RN5A 4JI2L 4RG1A 1KD1C 1R9TH 2ICEC 1B2TA 2PI2E 2NTSA 2RVLA 2E2IB 4Z9CB 1YNXA 3X3NA 2SOBA 3I72A 2F0GA 4OHJA 4K0KQ 5KYLA 3CXCA 3J7A5 4JI6L 5T1IA 5IIFA 4N9PA 1EQTA 3W1BA 1B8AA 3IL8A 1HA5A 4PG3A 1XTCD 3RZDB 3CPFA 5NUCA 1SROA 3TP6A 1K83B 1JR0D 3I4OA 2B63G 2WV6D 3BYYB 3BYTB 1FD7D 4NP5A 3F2DA 3CRKC 4U673 3I91A 3MHBA 2A6HD 4HN7A 1STBA 2DY8A 3CAMA 5JOBA 2B8GA 3CPWA 3ERQA 4DUYQ 4JI2Q 4A75A 2K52A 4NXMQ 1EOTA 1S5CD 2KHIA 5M3FH 2F0KA 5G3LF 4YCUA 1H9JA 3PSIA 3E9HA 2EJMA 5EJWA 1NJIC 1RTOA 2CW0D 1HUNA 1JWSD 1PTOH 3HG9A 1U4LA 4A3FH 1K0RA 3BZKA 3EBEA 4ME3A 3E0JA 3OHXC 5C0XH 2R3ZA 2E2JH 2Q2IA 2VQEQ 1I4QA 2F0DA 1H9MA 1ZYRC 1Q8KA 4G7ZC 4HSPA 4C1NI 1UEBA 1KRTA 1XYIA 3M4OB 1QZGA 1HTLD 1SLJA 1X3PA 2OXPA 5I6WA 5CYUA 1K28A 1ZKOA 4KHZA 4IUTA 3IRBA 3KF8A 4RH6A 4GKJL 2GN5A 1Q90A 4GKKQ 1V43A 1TY0A 1GJXA 5KRUA 5A2QE 3KDFA 4CHTB 3DMUA 1VDZA 3K58A 2HCCA 1LUZA 5CR3A 5JJIA 1CT1D 3R8BA 4A3BG 1G51A 1Q12A 1HR0L 4LK1C 2F0UA 1SE2A 5M3FB 4MIUA 1TWAB 5ELBA 3D31A 4TVAB 5C4HA 1H9SA 3HOVG 1PTOB 1N32Q 3DEPA 4HJ5A 3HOUG 2NVXH 1EY7A 2UXDQ 2WB1B 1CQFA 1BF4A 2F0JA 4AQYL 2E2JB 1KDCA 1D7QA 3S16H 1KLGD 1QZHA 1VMCA 1LT5D 4OXPA 1S40A 3S14H 1S5BD 3I7FA 4QMGA 3BZDB 3I3CA 3P1HA 4OWTB 3VYSA 3HKSA 2UU9Q 4RKBA 2EIFA 4F88A 1D5MC 5LHY1 2AQ2B 4IUPA 4R4QA 4RGTA 5IP9G 5ELDA 2FHTA 2CWAA 2D9UA 1B50A 3PQIA 3W3AA 4LF8L 1Q81C 3CC4A 3M9BA 2F0IA 2FMMA 4N8X1 3PO2G 4L5RC 3M7GA 2H1EA 2QGQA 4DV3Q 1SEBD 5I4DA 4IUVA 2E75C 2RDHA 1A15A 1Y8NB 3P20A 3ND8A 2WACA 3RN2A 4HJ8A 1WD1A 4NDXA 1S5FD 3F2CA 4DR1Q 2NVXB 5IODA 3M7NA 4A3LG 2AUKA 1GUOA 2RHSB 2ZTCA 3MXUA 2ZXRA 5F2DA 1JB7A 4AYBB 1CSQA 3EJIA 3S16B 4PNYA 1WTXA 3S14B 5M3MG 1Y14B 1CZGA 3I56A 3I70A 1VQ4A 1DYQA 1TWFH 3ER0A 1JQYD 4C2MH 2HDMA 1EL0A 2K14A 1WD0A 1ENFA 2J4XA 5IYBG 4I65A 1LM0A 4IUUA 1EYGA 4LF6Q 1HZAA 4DV6Q 4PQXA 1ENCA 4IFDI 2X69A 2K5DA 2DUDA 4KD3A 1SNCA 2V1CC 3GTPH 4KKUA 2MQHA 3AFQA 2LFNA 2DNCA 3L0OA 3W1GA 4LNQA 1CM9A 1HZBA 1DJRD 3I2ZA 1HFGA 4OWXB 1AZPA 3C46A 3DXJC 4XQNA 1TXYA 4CJ2C 1D5ZC 4DUZQ 4TKOB 1D6EC 2A6ED 4ZYSA 1II3A 5IP7H 1N34Q 3PO3B 1WYDA 1GO3E 4ZKCB 2DGYA 1LLRD 3MXNA 3J80i 5K5PA 2VB3X 3OWFA 3ULLA 3PMFA 2C9OA 1IBML 3NPPA 4RMFA 4DFAA 4DV5Q 4LF7Q 3GTGH 4DF7A 4C2MB 2X6GA 2A6HC 1TKWB 2B2VA 4DR6Q 3PIO3 1PRTB 4XQQA 3FPUB 4LFAL 2JEAI 4LF5Q 3L9AX 3PUYA 1LV9A 2CW0C 3GTPB 1ET9A 1WFQA 2RDFA 3N6RA 3DM1A 3OWEB 3DWPA 5BN3A 3K0XA 2SDFA 4QL5A 4IFDH 3OOCA 1MBYA 3KF6B 4MNOA 4CKCA 1QG7A 4BXXG 4KY5A 4A3CH 1H95A 2NWGA 5KNDA 1ILQA 1MSGA 3A56A 2H5XA 2KEDA 4A3MG 4OX9Q 1FYCA 3GTGB 3TMEA 1SDFA 2SNSA 4R9WA 5TSSA 3Q22A 3K5OA 3EIVA 4P2CB 2N8NA 4L8JA 2LXKA 3AYHB 4AIMA 3L2PA 3HGBA 4CJ0B 3VR2A 1CUKA 5LL6S 4EQOA 3NUCA 4CBVA 2ENBA 4JI3L 2AUJD 3ULPA 4CDFC 2MJ8A 3NXWA 2AHOB 4CDEC 1EU4A 2L12A 1XMQQ 2OF1A 1IXRA 1Z6HA 5J1ZA 3J81i 3MWYW 1EWCA 4P74A 2ZXOA 3FKIH 4XIGS 2I5HA 3T1YQ 2IT1A 5C4XH 3JAME 4JYAL 2ZT9C 2OCEA 4FF3A 1GHJA 3IKJA 4JCVE 5EPKA 3OSOA 3AU7A 2PPBC 2XN9C 1B1ZA 4C1NK 4DV4Q 1BOSA 1TR5A 4YIJA 3NE5B 1YIJA 1IZ6A 2K4KA 2BH2A 2Q8IB 4XT3B 5KIXA 1H9RA 2O5JC 1Q82C 1SR3A 1MHWC 4J15A 1A3VA 3FHWA 2PMZE 3VR5A 3NTIA 1LTRD 2XVSA 3U50C 4IJLA 3SK5A 1O78A 4JI3Q 4CDDC 2B39A 4KKSA 3LNNA 1VQOA 1IKMA 1PRTD 4A3DG 3S17H 3KF8B 3HZXA 1O80A 2NYZD 4J8QA 4A3GG 1SRUA 3WOEA 4EGVA 4APVA 4F7XA 4IPDA 1B70B 1SE3A 1HH2P 1IKLA 1V1QA 3JC66 1I3QB 1KQSA 4A3EG 4B3SQ 4DNTB 3MXGA 1ZXTA 1QJOA 4JI1L 5C4XB 4DR5Q 3PUVA 1STEA 1TU2B 1D8LA 2YTYA 4HIMA 1F2LA 2O5IC 5LMNQ 1BKBA 5C4ZA 4GS3A 1XMOL 1QVCA 1VQLA 3H91A 4K2LA 5C3EG 1SNMA 4YY3L 2B29A 5EKKA 4RGMA 1PFNA 4B08A 4ZUIA 1AP0A 2Y0SG 5C3WA 1K73C 3SK4A 4UHVA 3P7JA 1IYUA 2NVQH 3RLOA 2F3WA 2R7ZG 4HJAA 5EKIA 3SGIA 1EIFA 4B9WA 4QB4A 4C3HG 2BA1A 3MEHA 2IL8A 2B2TC 3S17B 4WJ4A 2QA4A 2B63H 1CHPD 4A3IB 2FXQA 4LUVA 4X3TA 1EY8A 2A6EC 4P73A 2F52A 5GQOA 4P75A 2F0OA 2JA6G 2ZM6L 2K5HA 1CFMA 1STAA 3VA7A 1IYJB 1V8QA 2TMPA 2F0SA 1V1PA 2M9VA 1VQ7A 2KCTA 1F9SA 1AE3A 1QUQB 4JK1C 3K59A 4ULLA 1XNRQ 2EVBA 3U9SA 3DM3A 1F2ZA 3NBHB 4RCOA 4X62L 2KCMA 4NB3A 3BVZA 4IJHA 2ZJRA 2LS01 1FJGQ 3SEBA 1IYVA 1C48A 2F3IA 2JQOA 2WIIB 2NVQB 3FP9A 5LMNW 1WTHA 3H6MA 3WDNA 1TVXA 3I73A 4EX5A 1YHAA 1G6PA 1YZ6A 4OEMB 4OELB 1WTRA 1E2ZA 4BY7G 4JI0L 2OQ0A 3Q23A 1B7YB 2B63B 1GOZA 2F0NA 4ZUJA 1HUMA 1TT2A 1WJJA 4PMBA 1AZQA 2IWHA 5EKLA 4A3BH 1E24A 1VQPA 3RD4A 1E7ZA 2PZWA 2ID0A 2NBFA 1TWHH 3TEHB 1A3TA 1EIYB 1HHVA 3TP5A 3VYTA 2AWNA 2PW5A 5GAHC 4H02A 3HOUH 4X6AH 2JEBI 1YBYA 2JA8G 3M4QA 1G2SA 1STYA 3PF5A 2Z1CA 1W3SA 3UI2A 5C5MA 2RCFA 4HMJA 1EWHA 3B6YA 2E8GA 3MXNB 1STGA 4KV6A 5IY0A 2QDLA 3G48A 4CGYB 4OGQC 4BBRG 2R6GA 1PA6A 4Q5VA 1HXYD 4A3JB 5JJLA 5I9OA 4C3IG 5IP9H 1NCVA 5FO7B 4DAMA 1U0LA 4XYOA 1RODA 2DNEA 4A3BB 3M4PA 1GUTA 3A0JA 4K0KL 2VQFQ 4DR4Q 1TS4A 3RNUA 2VB2X 2L11A 1TWHB 3HOWG 1EFID 2BOSA 4TQUS 1SYCA 1SMYC 2EJGC 5EPLA 3K7UC 4YCWA 1M90C 5ELEA 5HGQA 4LMQD 3BG3A 3A8KE 4V0BA 3HOUB 1YI2A 5FLMH 1HA6A 1X56A 1BCPB 4LF4L 1T9HA 5IWAQ 4A3LH 2VY3A 4H13C 1JOQA 5DLQE 2NTTA 3AMUA 4G4KA 3WOFA 3NP8A 1E2VA 2OTJA 5C44G 5M3MH 1PRTC 2JA9A 3KF6A 3NTHA 1N36L 4DUYL 4NXML 2EY6A 5C0XJ 1UE6A 4QF4A 1JORA 1E1OA 5E3FA 2PYKA 4EVOA 1YJ9A 1T5EA 2KBNA 3A7LA 3K7AH 1SN8A 3F2BA 4MN3A 4GOPC 4IOAA 3HS0C 1S5DD 1Q86C 2Q2TA 1NMGA 5C4JH 2VQEL 4X65L 2K5WA 1Y1WG 3D3RA 5JEAG 5HY6A 3FRPB 4L5QA 2A74C 1SYFA 4RHSA 3V96A 3HOZB 2YYZA 1I4PA 2CHBD 4LF4Q 3KBGA 2IPKD 4NPSA 4B3TQ 3GTQB 1TWCH 1HNWQ 1MKHA 1DGSA 1U9RA 4TSSA 4GKKL 1YVCA 1I50H 4KY6A 3URYA 4L5TA 2F0HA 4G7HC 1N36Q 3MFGA 1BQQT 3NELA 1JWUD 3ICEA 2B2UA 3TP8A 5M3MB 2B3GA 1E1TA 2B2YA 2A1AA 2LKVA 3DHQA 2A5HA 1R9TB 2HQLA 1SYDA 5AFWA 1Q8IA 4EQNA 3K7AB 1QVGA 3GO5A 1N32L 3TBIB 3S1NH 4X65Q 1CKOA 2UXDL 5I2YA 2BE5D 1WOCA 5C4JB 4IN3A 5KGUA 1A0IA 3TZUA 1F2MA 2B2YC 3RUZA 5CMDA 2Z4IA 3V05A 4JW0A 2F3VA 2K5QA 4RWSC 4XT1B 3W5OA 1Z47A 3QIAA 5DAUA 4FNFA 5DM63 1T5XD 4QQBX 3PF4A 2UU9L 4R4OA 2RCNA 3IFDA 4QY7A 1I50B 4BXXH 3OW7A 2A8VA 1PZID 4A93H 1R4PB 4LWCA 5A2QL 3U58A 1GD7A 3RZOH 1BO0A 1WVLA 2OT2A 4A3MH 5JPNC 3J7ZC 4ZRZA 5HGTA 5DM73 4K5WA 3LWUA 1GXDC 4NW2A 5L37A 4DV3L 4K6DA 1NAPA 4A3FB 3QOLA 1LYLA 1EEID 3O13A 3J81j 4P72A 1F9PA 3S1NB 5GADC 4DR1L 3RMHA 4K8JA 4LUOA 2NVTH 4PMWA 1EFWA 2XIWA 1KXLA 3CP0A 3FMCA 4QIWE 3HKZG 2PI2A 5T1GA 1X3GA 2LXJA 1EY9A 2ICIA 1E3PA 3OTOQ 1BVSA 2PCFB 4FF4A 5A35A 1XWEA 1UEAB 2I5LX 4LF6L 1VQCA 4DV6L 4GNXA 3HOYG 3H09A 2XGTA 1PVOA 4A93B 1V1PB 3RZOB 4CKEA 2IX0A 1I6VC 2Q8RE 2YU9H 3HKZE 2VUMH 2F0EA 2RF4A 2JA5G 1EU3A 1QUQA 2L1BA 2F4IA 3VYRA 2QDBA 1IW7C 2L0CA 1RTNA 2BH8A 3NBHA 4N9TA 4JBKA 3T56B 2F4VQ 1KAAA 3MXPA 2WP8J 4RHRA 4X3SA 2CH4W 3K81C 4DUZL 1STHA 5C6AA 1N34L 4A3DH 1UE7A 1KDAA 1SNPA 1Q3LA 4WJ3M 2NVTB 2EOTA 4FXKC 1OTCA 1CZWA 2BCOA 1K0SA 1EYDA 1M8AA 4DV5L 4K5XA 4A3EH 2OQKA 2PMZB 4LF7L 2K5NA 1FNVA 2K50A 5BN5A 2KVMA 1B9NA 2Z6KA 5IGEA 1I94L 4DR6L 5CV7A 2R92H 1HQMC 2EXDA 2I46A 3M85A 1ICFB 5M9OA 3I4MG 4L6TB 4LF5L 4X66Q 4HJ7A 1FGBD 5C3EH 5FOBB 2YU9B 4IFDJ 1VQBA 3RLNA 2VUMB 1ZEQX 2TSSA 4JVZA 2KECA 4PV1C 5CV5A 1KLUD 3RLFA 3KJOA 4FF1A 1G291 5IYDH 3NBIA 4RFBA 4DKAC 1HZ9A 2R7ZH 1PYBA 1PTOD 1SYEA 2F0QA 4C3HH 1B3AA 5JJZA 4NXNQ 4A3DB 3LX0A 2UUCL 1VF5C 4KJNA 2F0LA 3FPPA 1TY2A 1F77A 1PYWD 4XQJA 3T1HQ 1TWFB 2E74C 1EY5A 2A68D 4IQZA 1VQ8A 4OX9L 4A3EB 5D65A 3LGJA 2JA6H 1XPOA 5J39A 3M4YA 1I94Q 1OXTA 3CU7A 1LTAD 2R92B 1I6HH 4FF2A 3PV0A 1HCZA 2E2DC 2L15A 2JA7G 3W2DA 2C35B 5C3EB 5CV9A 4JBJA 3GV6A 1EIGA 4POGA 1VQDA 1XMQL 1PXUA 3E0EA 2BE5C 2QEXA 5EQ0A 1XNQQ 4KJOA 3OIQA 1CKNB 2B2VC 2NN6G 1WI5A 2K33A 3CC7A 3T1YL 1K8AC 2UUCQ 2K6AA 4J1MA 4C3HB 4BY7H 2RSNA 1VQIA 3C1FA 4GN5A 4JOIA 3UDIA 1X65A 2GA4B 4IPHA 4DV4L 2EYHA 4IZ8A 5E7NA 2CCZA 2E5LQ 1HRJA 4IUQA 4GLXA 2Q2HA 2IW3A 4DAYB 2JA6B 2K04A 1CHQD 2XTIA 4DK1A 1EEFD 1DXMA 2OTLA 5ELFA 3TS0A 5AJ3Q 5BR8Q 2Z4HA 1I6HB 2ZJPA 4DV2Q 2E2HH 1SSOA 5J22A 2UXBQ 3A5UA 1IL8A 4GLVB 4JOIC 1G8ZD 1FR3A 4JPBW 2JA8H 1R4QB 3ONAB 4R4TA 1EUJA 2Z9HA 2AKWB 1NMFA 2B8FA 3F2UA 2HIXA 4DR2Q 2R61A 3NWSA 2CFMA 2K7VA 1TS2A 2VS1A 4B3SL 1XXGA 5GAEC 3DEOA 4BBRH 1WTVA 3T13A 4DR5L 4BY7B 1GUSA 4AYBG 3BU2A 3JAML 4C3IH 3R2IA 1SMYD 1CA5A 5LMNL 1PLFA 2KCNA 1KRSA 2EY2A 3OMGA 4ZKBB 1WTQA 5D3DA 3G6EA 4MHEA 2NZHA 2QCPX 3E5SA 2UUBQ 1IBKQ 4O42A 1UNSA 3H3VC 2A19A 4ZCKA 5LMUQ 4NKLA 3HOWH 4K5VA 1GM5A 1AE2A 2XSCA 4F8MA 4OO1G 4AYBE 2HIVA 3J7AV 5D14A 3N52A 1Y1VG 3PIPA 4ID6A 1HNZQ 2JA8B 1KIXA 2MUYA 1B53A 4HAEA 4AH6A 1O7LA 1PH8A 3FKIB 2DN8A 1KDBA 1RF2D 4I7AA 2R93G 1D5XC 1M4VA 2RA4A 5C44H 3SDZA 3G6JB 1QILA 1Q1BA 2LSSA 3DLLA 4BBRB 3PO3G 3GTLH 3BZCA 2EYMA 4JBMA 5EBCA 4BBSG 1X3EA 3A54A 1ASZA 3U4ZA 2XWBB 4DU9A 3Q8DA 4GN4B 4C3IB 1QNKA 4H44C 4KHPQ 3ERSX 3R3OA 3GTOH 1XTDA 1XNRL 2HDLA 1BR9A 1A63A 1L0XB 4N8FA 1Y1WH 4JI8L 1MGSA 1H9KA 5JEAH 1FJGL 3DUZA 5M5WH 1QWYA 2K5VA 2IHEA 3HOWB 3J7AF 4QGUA 4KTAA 1YHQA 1PH7A 5IT9c 4HCSA 4DR3Q 2B2WA 2N49A 2WFWA 1K3BC 2A69D 2KENA 2BA0A 1J6QA 1C7YA 5M5XH 1MJEA 2QILA 4KY7A 1VQMA 1AW7A 1PTOC 1SYBA 3PUXA 2KJXA 1SNQA 2Y0SE 3E9IA 4P71A 2RDGA 4A4IA 4RGOS 3VYUA 1RL2A 1PTOF 4GNXB 3BS1A 5C44B 1CK1A 1UE1A 5JAVA 4LJZC 4KD4A 4DXGA 1DOKA 4JI4Q 2ASBA 2EYJA 4B3RL 4DAVA 2EYOA 1LACA 4FO2A 2A68C 2QF7A 3HP3A 1KC8C 2PO4A 3J80c 4UDUC 3CMAA 3OW2A 3GTOB 3ITPA 1Y8PB 4A3KG 5IE8A 3Q6SA 4JG2A 1JICA 4JI8Q 2IHFA 1SNOA 1XPRA 1NR4A 1Y1WB 1PH5A 5M5WB 1RCVD 2PNHA 5E4WC 2ZJQA 5CBEE 3FDTA 1U4PA 4HIDA 3KUPA 1DOLA 2WAQG 4X3UA 1DD2A 1VCIA 1DOMA 4HR7B 5M5XB 2ZXPA 1BBWA 4YCVA 1YITA 1IBLQ 4WORA 1SFOH 5FO8B 3J81E 2AQ1B 1U4MA 1CTMA 3KLSA 3SR1A 3H15A 1X6OA 4MTNA 2VQFL 4X3KA 1ASYA 4DR4L 3ZYYX 2R7DA 4B3RQ 2C5CA 2PQAA 3F8TA 3NQTA 3HOVH 1L1OA 3TDQA 2WAQE 3GV3A 3GP7A 3OYYA 1A2TA 4O0AA 3STBD 4JI5Q 2JK8A 5CGKA 1PH1A 1N33L 2G9HD 1KTKA 1FNUA 1RJTA 5IWAL 1AN8A 4L63B 3T51B 1AEXA 4EQPA 4L5SA 2IJ0A 3L3OC 3K80C 4LFBQ 4QUCA 4R1JA 4X64Q 3K57A 2N88A 2KHJA 2EY1A 3BDCA 1TS5A 3I90A 4OONA 1RD9D 4Y7NH 3CC2A 4CKBA 1X3QA 3X3MA 1QVFA 1PV4A 1SYGA 4FXGC 3V2TA 2K75A 5FLXE 1OXXK 1IW7D 4WRDA 3S1RH 1PHJA 3HOYH 3S9WA 1N9WA 1SFOB 1Y69U 2IY5B 1X9NA 2UUAL 4XTCS 2ATWA 1E22A 1LT4D 5IGFA 3J81c 2XRSD 3HFZB 1VQJA 5ISRA 1O7YA 3PO2H 4QIWB 4RKLA 1MJCA 2JA5H 1G91A 1EOVA 3K0YA 3UDFA 2FFKB 3HOVB 4IUNA 1Y8OB 4R4IA 1Q1EA 4GZYC 2L4NA 1NY4A 1YNND 1N33Q 1BBUA 3EQLC 3IFTA 3P75A 1BUVT 1EY4A 1JE5A 1YJNA 4B3TL 2MPMA 1HNWL 4TRDA 4C3JG 5D3IB 5E1FA 2OWOA 3KYHC 2D0OA 1NUCA 3PCOB 1CKNA 3MC0B 4YWKA 4FVMA 3HKZB 1EY6A 4IPGA 1PMRA 1PRTF 3VR3A 2AMCB 1K83H 2D62A 3BJUA 2MGSA 4PZ7A 2EDGA 2Q8TA 1LTLA 4WJWA 3R93A 5IYBH 4UP8A 3VR6A 4KLKA 4A3IG 4J6HA 4DR7L 4JI7Q 2NN6I 3QO2A 4DAYA 3C2PA 2UUAQ 3I4MH 3OIPA 5FLXc 4DPGA 2WKDA 4Y52H 1NE3A 4IPCA 1CI3M 4WFN3 3KLRA 1MSHA 1WCMG 3G4SA 3PO2B 1OO9B 1VQNA 4UP9A 2JA5B 2MHVA 2RBMA 1PH3A 1NNXA 3CRLC 4RCNA 3NENA 3D4WA 1ML0D 2BDOA 1FNWA 1AH9A 1FGUA 4LF9L 3VR4A 1PH6A 1KABA 1B3QA 4YHHQ 2CVRA 1PZJD 4HJ9A 2Z6BA 4RAUC 3CCSA 3BDOA 3TN2A 1DM0B 4DV0Q 2JSOA 4G7OC 1EQQA 1TWGH 1SAPA 3MFYA 4GN3B 5C3XA 1F9RA 2K28A 2YTVA 3UE0A 3QB3A 2IX3A 3GTJH 3M4OH 3RR5A 3ULJA 1LTBD 2M2LA 2A69C 4UAIA 4DAPA 3CCJA 3IAYA 2QW7A 1P8LA 2NUCA 1B4OA 3NHHA 2D0PA 3MEFA 3R2TA 3PUWA 4H0LC 2RSOA 1L2FA 1JJCB 3D6WA 1M1KC 4DR7Q 5KNCA 1VQ9A 1ET6A 2SNMA 4K8IA 3A74A 3BVMA 2EZVA 3NTKA 1SNDA 1V9PA 3A8JE 3S24A 3GDEA 2JYOA 3KLSX 1J9OA 1ICWA 3I4MB 1SXTA 1X55A 2HT1A 2JA7H 2VL6A 1TWAH 1K8GA 4HEDA 1PH2A 1HTPA 4ABNA 2LY7A 4KHVA 1ESFA 4R4CA 2B2UC 2QEJC 4JC0A 2R7FA 3HOXG 2DJGC 3E6ZX 1HFNA 4LF9Q 2HD3A 2N55A 5I2XA 4R8IA 2EYPA 3OTOL 1TWCB 2NN6H 3SK6A 4JI6Q 3Q0AA 2F0VA 1B44D 4ZAIA 1I4RA 4OO1I 1BCPD 1TWGB 2KHSA 3E3XA 1OXSC 2K05A 4HMIA 4ZQ3A 5CV4A 1VQFA 3GTJB 1KAWA 1WTPA 4BY1G 1GUWA 3CF5A 1YNJD 2PQEA 2KEEA 4A3JG 1LTTD 4DGZA 3S1QH 3AEVA 5JVG3 1KNEA 3H0GG 3CCQA 2HHHL 3SK8A 4DXFA 1Q7YC 2F4VL 2EPBA 2I5MX 1ILPA 4BS9A 4RGNA 2EQSA 2JA7B 2F0WA 1PH4A 4DV7L 1NSNS 4BA1I 1DCZA 3CCUA 3STBC 1JOKA 1P16A 2P5ZX 3WWVA 2JP1A 4IURA 2VNUD 1PFMA 3I4NG 5FO9B 5K36G 1IL2A 1VF7A 4DV1L 5GROA 2FINB 1N8RC 4DK6C 2K03A 3S15H 1G6ZA 5FJ8G 2AWOA 4XYQA 2KQ3A 5C5LA 4DNRB 4A3MB 4GKJQ 5EBDA 1NR2A 4X66L 3SVMA 1HPCA 3A8IE 1GVPA 2Q2UA 2Z8LA 1SMXA 3CCMA 5IYCG 1VQEA 1YHBA 3TQYA 2HHHQ 2V4DA 3PIOA 3QJYA 3S1QB 3D8GA 3ZJYC 4LFCL 4HCEA 4ALPA 5JVH3 4PZ6A 5CORA 1HR0Q 4OO1H 2FMCA 2CH4A 5EGTA 4DV7Q 2D5DA 2NZ1D 2VZAA 3S1MH 1Y1VH 3MZ5A 2PZTA 4GNXC 1S5ED 3CCEA 4NXNL 4A3GH 2K32A 1YNNC 3HOZG 4MTKA 2IX1A 5HURA 3FVQA 3L7ZC 3T1HL 2R93H 4O1NA 3TREA 4AQYQ 3JAMi 5FLMG 4DV1Q 3UDGA 4KN7C 4OL7A 3PO3H 5EPJA 2KOLA 3K5MA 1GKHA 3S15B 2X6LA 2OEOA 4BBSH 2JN4A 2PQAB 4NMZA 1DZ1A 1L1OB 1C9OA 2PW7A 2KUMA 2K1BA 1MD2D 4FXDA 4K2KA 4UPAA 5CC4A 4LFCQ 1JCKB 1A8VA 4B3ML 4LF8Q 5GAGC 5ELCA 2L5TA 4MZ9A 1NBWA 4IO9A 2Z6KC 1XNQL 4KKTA 1ESRA 1HQRD 2F0MA 2GVBA 1K3RA 3S1MB 1Y1VB 5JPMC 3EROA 1U5KA 2NVYH 1E0BA 2CQOA 5JJKA 3T53B 5FKAC 1VQGA 4A3GB 1PFSA 2Z0SA 1Q46A 2EY5A 1W2BA 4PZ8A 1RHPA 2NZOA 4DK3C 1HR0W 2R93B 2F1MA 2G9DA 3D4DA 2XRQD 2E5LL 5I6YA 3GTKH 1SJHD 1QOHA 3AQQA 2RQXA 3EN2A 1I4HA 4F87A 1F2YA 2MO0A 2H4OA 1C8CA 1JJGA 4BBSB 1EQRA 3OPOA 5KYIA 5AJ3L 5BR8L 1EZ8A 3SE0A 4XXEA 4DV2L 2UXBL 3BVGA 5M3FG 4A76A 2BDNA 1BDOA 3NK9A 4O2DA 4A3KH 1I4XA 3G7LA 4K14A 1WTWA 4OIJA 2ES2A 2Y0SB 1PDQA 3KOJA 4B3MQ 4A3FG 1CQVA 2O4XA 4DR2L 2WB1G 5J3BA 2R7ZB 3FEWX 5C0XG 2YTXA 1PFBA 3TSSA 1SJED 2PNRC 4LAAA 1VQ6A 4BWGB 5CV6A 1QNUA 2NVYB 1VQ5A 4POFA 4GOPB 1GUNA 2KA7A 1LO5D 1G2TA 2MFIA 4DA2A 1S4ZA 4GLAC 2I07B 3MAQA 3K6OA 1LT6D 5EAYA 3SHLA 3GTKB 3CQZH 3DWQA 1BCPC 2WB1E 4OIKA 4LUZA 1JC7A 4R8NA 2UUBL 1BCPF 1IBKL 4KI0A 5LMUL 2L9HA 4A93G 1IBMQ 1YNJC 1HNXL 1I4GA 1C4QA 1SBBB 1O7IA 1D1KA 1LTSD 5IGDA 4A3KB 1XPUA 4QCLA 1BBXC 1BXTA 1HNZL 4HIOA 4HSVA 1STNA 4KN4C 5DEHA 4LFAQ 1A62A 5ELOA 3H94A
chains in the Genus database with same CATH topology
4DNIA 3F2CA 4LF4Q 4DR1Q 3M7NA 4HIDA 4A3LG 3D0FA 2WAQG 4NPSA 4B3TQ 4YWMA 1TWCH 2RHSB 2ZTCA 1HNWQ 1MKHA 1DGSA 1VCIA 4GKKL 1JB7A 1YVCA 1I50H 5JEAJ 1CSQA 4L5TA 1BBWA 4YCVA 1YITA 1IBLQ 5M3MG 1N36Q 1Y14B 3ICEA 3I56A 3NELA 1SFOH 1I3QH 1VQ4A 4KHPL 2VW9A 1TWFH 2B3GA 3ER0A 1E1TA 4C2MH 1XJVA 2A1AA 3H15A 1X6OA 4MTNA 2VQFL 2K14A 1ASYA 4DR4L 2HQLA 1Z9FA 4B3RQ 2R7DA 2UXCL 5IYBG 2PQAA 3F8TA 1LM0A 3HOVH 1EYGA 4LF6Q 1HZAA 4DV6Q 1L1OA 2CKZB 2MO1A 1S72A 2WAQE 1HNXQ 1FL0A 1QVGA 3GO5A 4IFDI 2YV5A 1N32L 3S1NH 3OYYA 4O0AA 3STBD 2ZJQA 2DUDA 3I4MG 4X65Q 4DR3L 1CKOA 2V1CC 2UXDL 4JI5Q 3GTPH 1WOCA 2JK8A 1PH1A 1N33L 2VUMG 5IWAL 2MQHA 3AFQA 3U4VA 3L0OA 3W1GA 4LNQA 1HZBA 3PUZA 1A0IA 3I2ZA 4OWXB 4C3JH 4L5SA 3K80C 4LFBQ 1JT8A 1TXYA 4R1JA 4X64Q 4DUZQ 2KHJA 4OONA 3W5OA 4Y7NH 1Z47A 3CC2A 1I5FA 5IP7H 4QQBX 1N34Q 1WYDA 2UU9L 1PV4A 1GO3E 4R4OA 1QVFA 3PF4A 2RCNA 2DGYA 4JI4L 4QY7A 3J80i 4BXXH 3CCLA 2A8VA 4A3IH 1RIPA 4JV5L 2K75A 4A93H 1OXXK 3ULLA 4LWCA 3HOYH 3U58A 3S1RH 1PHJA 1GD7A 2MNAA 1IBML 1SE8A 3KDFB 4RMFA 4DV5Q 1N9WA 4LF7Q 3RZOH 2N3SA 3GTGH 4A3MH 1X9NA 3J7ZC 4XTCS 3KJPA 1E22A 2UUAL 2ATWA 3S2HH 5M5YH 3J81c 4JYAQ 2UXCQ 3HFZB 1VQJA 4IOCA 1VQKA 3PO2H 1MJCA 2JA5H 1EOVA 1WCMH 4DV3L 4DR6Q 3UDFA 2CWPA 3JAMc 5ELNA 1OXUA 2R92G 1LYLA 4R4IA 1Q1EA 3A5ZB 4LFAL 3J81j 2JEAI 4P72A 1NY4A 4LF5Q 3PUYA 5GADC 1N33Q 1BBUA 4DR1L 3VDYA 1JE5A 1YJNA 4B3TL 1WFQA 1HNWL 4LUOA 2NVTH 4PMWA 1EFWA 2OWOA 3KYHC 2D0OA 3CCRA 1KXLA 3PCOB 1CKNA 3CP0A 5IYDG 3AFPA 4QIWE 4YWKA 3HKZG 2PI2A 1IBLL 3K0XA 4IPGA 3S2DH 1X3GA 2LXJA 1E3PA 3OTOQ 3I55A 4QL5A 2AMCB 1K83H 1BVSA 5IP7G 2D62A 3BJUA 3K8AA 3PGZA 4PZ7A 4X6AH 1FVIA 3F1ZA 3KF6B 4MNOA 3M3YH 1LTLA 1YJWA 5IYBH 4BXXG 4UP8A 4JV5Q 2I5LX 4KLKA 4A3IG 3GTMH 4LW1A 1JMCA 4A3CH 4LF6L 1VQCA 4DR7L 4DV6L 4GNXA 1H95A 4JI7Q 3HOYG 4JBWA 2XGTA 2NN6I 3KLWA 1PVOA 2UUAQ 4OX9Q 2H5XA 4A3MG 3I4MH 5FLXc 2IX0A 4DPGA 4Y52H 4JI1Q 1NE3A 4JI5L 3HKZE 2YU9H 4IPCA 1UE5A 1J5EL 2VUMH 2RF4A 2JA5G 1QUQA 1VQHA 1WCMG 3G4SA 3EIVA 4YWLA 2N8NA 4UP9A 1JJ2A 1VQNA 4BA2I 2LXKA 1PH3A 3AYHB 4AIMA 1UWVA 3NENA 3L2PA 1KL9A 2BH8A 3HOXH 1CUKA 1NTGA 4LFBL 4JBKA 2F4VQ 1XMOQ 1AH9A 2WP8J 1FGUA 4X64L 4LF9L 1PH6A 3K81C 4YY3Q 4JI3L 4YHHQ 4DUZL 1PYSB 3ULPA 4HJ9A 3CCSA 1N34L 4A3DH 4DV0Q 4HIKA 2AHOB 1UE7A 2ALYB 1EQQA 4WJ3M 1TWGH 4GN3B 2ZTEA 1XMQQ 4UY8C 2JE6I 3UE0A 2YTVA 3NEMA 1IXRA 3J81i 3GTJH 3CCVA 1OTCA 3RR5A 3ULJA 4P74A 3M4OH 3FKIH 4XIGS 2I5HA 1CKMA 3CCJA 1HZCA 4DV5L 1VQAA 4A3EH 2OQKA 1PH9A 4LF7L 4IFDG 2K5NA 1P8LA 3T1YQ 2IT1A 5C4XH 1K9MC 4BY1H 2D0PA 3MEFA 4JYAL 2K50A 2OCEA 3PUWA 4JCVE 1L2FA 1JJCB 1MIUA 4A3JH 2Z6KA 3G71A 1M1KC 4DR7Q 1I94L 1VQ9A 4A3CG 4DV4Q 4DR6L 3A74A 2R92H 2EXDA 3CW2C 3H0GH 1V9PA 3M85A 1YIJA 3UE1A 1IZ6A 3S24A 2K4KA 2ZTDA 3GDEA 4OWWB 2BH2A 3H3VI 4LF5L 1S3OA 4X66Q 4HJ7A 2ZM6Q 1J5EQ 4EQ5A 1Q82C 1X55A 2HT1A 2JA7H 5C3EH 1SR3A 2VL6A 4J15A 4IFDJ 1VQBA 1TWAH 3FHWA 1X3FA 3RLNA 1K8GA 2RHQB 1PH2A 1L0WA 2PMZE 3RLFA 4R4CA 3KJOA 4FDBA 4JC0A 1G291 2R7FA 3HOXG 5IYDH 3U50C 4IJLA 4DKAC 4LF9Q 1HZ9A 2R7ZH 4JI3Q 1VS0A 1PYBA 4X62Q 3OTOL 3I4NH 1L1OC 1VQOA 3KFUA 4A3DG 4JI6Q 4C3HH 3S17H 4NXNQ 3KF8B 2UUCL 4A3GG 4OO1I 1SRUA 3CD6A 1OXSC 4APVA 3FKIG 1VQFA 4IPDA 1B70B 3T1HQ 1HH2P 2N78A 1V1QA 3JC66 5FJ8H 1KAWA 1KQSA 2I0QA 4JI7L 4A3EG 4B3SQ 4BY1G 4OX9L 1VQ8A 5C4XG 3CF5A 1KHIA 3LGJA 4JI0Q 4JI1L 1XPOA 2JA6H 3TRZA 4DR5Q 3PUVA 4A3JG 1I94Q 1OXTA 5IYCH 3S1QH 1D8LA 2YTYA 3AEVA 2GVAA 4HIMA 5H1SE 2E2IH 3H0GG 3CCQA 5LMNQ 2HHHL 1I6HH 1X54A 1BKBA 3PV0A 1Q7YC 2F4VL 4GS3A 1XMOL 1QVCA 2I5MX 2L15A 1VQLA 2JA7G 5C3EG 4UP7A 2C35B 2EQSA 4YY3L 4YHHL 2B29A 1OXVA 1PH4A 4DV7L 2Y0SG 4BA1I 4JBJA 4QJFA 1K73C 4DV0L 1EWIA 3CCUA 3STBC 2NVQH 3RLOA 4POGA 1VQDA 1YEZA 1P16A 3TS2A 1XMQL 3HOZH 3E0EA 2R7ZG 3WWVA 3GD7A 2QEXA 4HJAA 3RZDH 1XNQQ 2VNUD 3SGIA 1CKNB 3UDXA 1CSPA 3I4NG 1EIFA 5K36G 4GOPA 2NN6G 1WI5A 3CC7A 3T1YL 1IL2A 4DV1L 1K8AC 2BA1A 5GROA 3GTQH 3H3VH 2UUCQ 4BY7H 4WJ4A 1N8RC 2QA4A 1VQIA 4GN5A 4DK6C 3CMEA 4JOIA 2B63H 3UDIA 1X65A 5C0XI 3S15H 4IPHA 2FXQA 4DV4L 4LUVA 5FJ8G 4P73A 2F52A 2AWOA 5GQOA 4P75A 5E7NA 2CCZA 2E5LQ 1C0AA 4GKJQ 4GLXA 1HJPA 4X66L 2JJQA 2Q2HA 2ZM6L 2JA6G 2K5HA 3RN5A 4JI2L 4DAYB 1GVPA 4RG1A 1KD1C 2Q2UA 1IYJB 1SMXA 3CCMA 1R9TH 5IYCG 1VQEA 1YHBA 2XTIA 3TQYA 2HHHQ 2PI2E 2OTLA 3PIOA 1VQ7A 2KCTA 3ZJYC 3TS0A 4LFCL 5AJ3Q 1AE3A 5BR8Q 4ALPA 1QUQB 1YNXA 2ZJPA 4DV2Q 2E2HH 2UXBQ 1XNRQ 4PZ6A 1HR0Q 3DM3A 3A5UA 4DV7Q 4K0KQ 3NBHB 2VZAA 4GLVB 4JOIC 3S1MH 1Y1VH 4X62L 2KCMA 4GNXC 4NB3A 2JA8H 4IJHA 3CXCA 4R4TA 2ZJRA 1FJGQ 3J7A5 4JI6L 1EUJA 3CCEA 4NXNL 2AKWB 1NMFA 2F3IA 1B8AA 2JQOA 3W1BA 3HOZG 4A3GH 2IX1A 2HIXA 3FP9A 5LMNW 4DR2Q 4EX5A 4PG3A 1YHAA 3L7ZC 3T1HL 1YZ6A 2CFMA 1G6PA 2R93H 3CPFA 3TREA 2VS1A 4AQYQ 3JAMi 1SROA 5FLMG 4DV1Q 4B3SL 3UDGA 5GAEC 4BBRH 4BY7G 4JI0L 3I4OA 2B63G 3PO3H 4DR5L 2OQ0A 4AYBG 1B7YB 3BU2A 3F2DA 1GKHA 4BBSH 1WJJA 4C3IH 2PQAB 5LMNL 3CAMA 1L1OB 3CPWA 4A3BH 1KRSA 4DUYQ 1C9OA 1E24A 2K52A 4JI2Q 4A75A 4NXMQ 2KHIA 3G6EA 5M3FH 1VQPA 4YCUA 2NZHA 1E7ZA 3PSIA 2ID0A 3E9HA 1TWHH 2UUBQ 4UPAA 1NJIC 1IBKQ 3TEHB 4LFCQ 2A19A 1EIYB 5LMUQ 3HOWH 1A8VA 4A3FH 1GM5A 1AE2A 4B3ML 1K0RA 4LF8Q 3BZKA 5GAGC 2AWNA 3EBEA 5GAHC 4H02A 4ME3A 4OO1G 4MZ9A 1NBWA 2HIVA 4AYBE 4IO9A 3HOUH 2JEBI 2Z6KC 2E2JH 2Q2IA 2VQEQ 1XNQL 1Y1VG 1YBYA 2GVBA 3PIPA 1K3RA 2JA8G 1HNZQ 3M4QA 1U5KA 2NVYH 1KIXA 2CQOA 1Q8KA 5JJKA 3PF5A 1W3SA 1UEBA 1VQGA 1KRTA 4AH6A 1PFSA 2Z0SA 1QZGA 3B6YA 1Q46A 1W2BA 1PH8A 2E8GA 3MXNB 2NZOA 4PZ8A 4DK3C 1SLJA 2R93G 1HR0W 5IY0A 3G48A 5C44H 4KHZA 2E5LL 3IRBA 4GKJL 4BBRG 3GTKH 2LSSA 1Q1BA 2R6GA 1PA6A 3DLLA 3AQQA 2IY5B 2GN5A 3PO3G 3EN2A 4GKKQ 3GTLH 1V43A 3BZCA 4JBMA 3KDFA 5JJLA 4BBSG 1X3EA 5IP9H 2MO0A 1ASZA 1JJGA 3U4ZA 1EQRA 1LUZA 3Q8DA 4GN4B 4DAMA 5JJIA 5AJ3L 5BR8L 4A3BG 4KHPQ 1G51A 3ERSX 1U0LA 3GTOH 1Q12A 1XTDA 4DV2L 2UXBL 1XNRL 5M3FG 3M4PA 1HR0L 4A76A 3A0JA 1A63A 4K0KL 2VQFQ 4A3KH 4O2DA 4DR4Q 3D31A 1Y1WH 4JI8L 4TVAB 3RNUA 2ES2A 1FJGL 3HOWG 3KOJA 4TQUS 5M5WH 4B3MQ 3HOVG 4A3FG 2K5VA 2IHEA 1N32Q 3K7UC 4YCWA 4QGUA 1YHQA 1PH7A 1M90C 4HJ5A 5IT9c 4DR2L 2WB1G 5J3BA 5HGQA 3HOUG 2NVXH 4DR3Q 5C0XG 2UXDQ 2YTXA 1YI2A 2N49A 5FLMH 4AQYL 1X56A 4LF4L 1T9HA 2WFWA 5IWAQ 4A3LH 2KENA 1VQ6A 2BA0A 2VY3A 1D7QA 1J6QA 1VQ5A 1C7YA 4POFA 3S16H 1QZHA 5DLQE 5M5XH 4GOPB 1MJEA 1VQMA 4OXPA 1S40A 3S14H 2Y0SE 3E9IA 3PUXA 4P71A 2MFIA 3I7FA 4GLAC 4A4IA 2OTJA 5C44G 5M3MH 1RL2A 2JA9A 3KF6A 4GNXB 1N36L 4DUYL 5EAYA 5C0XJ 4NXML 4OWTB 1UE1A 3CQZH 1UE6A 3HKSA 2UU9Q 2WB1E 2EIFA 1E1OA 4LUZA 4JI4Q 2UUBL 5IP9G 4R4QA 1IBKL 1YJ9A 4KI0A 2KBNA 2ASBA 4B3RL 2CWAA 3K7AH 1SN8A 3F2BA 5LMUL 4GOPC 4A93G 1IBMQ 4IOAA 4LF8L 1HNXL 1KC8C 1Q81C 3J80c 3CMAA 3OW2A 3CC4A 1Q86C 2Q2TA 1O7IA 1NMGA 3M9BA 4A3KG 5IE8A 5C4JH 4JG2A 4JI8Q 2VQEL 4X65L 2IHFA 1Y1WG 1XPUA 5JEAG 1XPRA 4L5RC 5HY6A 2QGQA 4HIOA 1HNZL 4L5QA 3PO2G 4DV3Q 1PH5A 4LFAQ 1A62A 2YYZA 3RN2A 5ELOA 4HJ8A 2PNHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DNI A;  3F2C A;  4LF4 Q;  4DR1 Q;  3M7N A;  4HID A;  4A3L G;  3D0F A;  2WAQ G;  4NPS A;  4B3T Q;  4YWM A;  1TWC H;  2RHS B;  2ZTC A;  1HNW Q;  1MKH A;  1DGS A;  1VCI A;  4GKK L;  1JB7 A;  1YVC A;  1I50 H;  5JEA J;  1CSQ A;  4L5T A;  1BBW A;  4YCV A;  1YIT A;  1IBL Q;  5M3M G;  1N36 Q;  1Y14 B;  3ICE A;  3I56 A;  3NEL A;  1SFO H;  1I3Q H;  1VQ4 A;  4KHP L;  2VW9 A;  1TWF H;  2B3G A;  3ER0 A;  1E1T A;  4C2M H;  1XJV A;  2A1A A;  3H15 A;  1X6O A;  4MTN A;  2VQF L;  2K14 A;  1ASY A;  4DR4 L;  2HQL A;  1Z9F A;  4B3R Q;  2R7D A;  2UXC L;  5IYB G;  2PQA A;  3F8T A;  1LM0 A;  3HOV H;  1EYG A;  4LF6 Q;  1HZA A;  4DV6 Q;  1L1O A;  2CKZ B;  2MO1 A;  1S72 A;  2WAQ E;  1HNX Q;  1FL0 A;  1QVG A;  3GO5 A;  4IFD I;  2YV5 A;  1N32 L;  3S1N H;  3OYY A;  4O0A A;  3STB D;  2ZJQ A;  2DUD A;  3I4M G;  4X65 Q;  4DR3 L;  1CKO A;  2V1C C;  2UXD L;  4JI5 Q;  3GTP H;  1WOC A;  2JK8 A;  1PH1 A;  1N33 L;  2VUM G;  5IWA L;  2MQH A;  3AFQ A;  3U4V A;  3L0O A;  3W1G A;  4LNQ A;  1HZB A;  3PUZ A;  1A0I A;  3I2Z A;  4OWX B;  4C3J H;  4L5S A;  3K80 C;  4LFB Q;  1JT8 A;  1TXY A;  4R1J A;  4X64 Q;  4DUZ Q;  2KHJ A;  4OON A;  3W5O A;  4Y7N H;  1Z47 A;  3CC2 A;  1I5F A;  5IP7 H;  4QQB X;  1N34 Q;  1WYD A;  2UU9 L;  1PV4 A;  1GO3 E;  4R4O A;  1QVF A;  3PF4 A;  2RCN A;  2DGY A;  4JI4 L;  4QY7 A;  3J80 i;  4BXX H;  3CCL A;  2A8V A;  4A3I H;  1RIP A;  4JV5 L;  2K75 A;  4A93 H;  1OXX K;  3ULL A;  4LWC A;  3HOY H;  3U58 A;  3S1R H;  1PHJ A;  1GD7 A;  2MNA A;  1IBM L;  1SE8 A;  3KDF B;  4RMF A;  4DV5 Q;  1N9W A;  4LF7 Q;  3RZO H;  2N3S A;  3GTG H;  4A3M H;  1X9N A;  3J7Z C;  4XTC S;  3KJP A;  1E22 A;  2UUA L;  2ATW A;  3S2H H;  5M5Y H;  3J81 c;  4JYA Q;  2UXC Q;  3HFZ B;  1VQJ A;  4IOC A;  1VQK A;  3PO2 H;  1MJC A;  2JA5 H;  1EOV A;  1WCM H;  4DV3 L;  4DR6 Q;  3UDF A;  2CWP A;  3JAM c;  5ELN A;  1OXU A;  2R92 G;  1LYL A;  4R4I A;  1Q1E A;  3A5Z B;  4LFA L;  3J81 j;  2JEA I;  4P72 A;  1NY4 A;  4LF5 Q;  3PUY A;  5GAD C;  1N33 Q;  1BBU A;  4DR1 L;  3VDY A;  1JE5 A;  1YJN A;  4B3T L;  1WFQ A;  1HNW L;  4LUO A;  2NVT H;  4PMW A;  1EFW A;  2OWO A;  3KYH C;  2D0O A;  3CCR A;  1KXL A;  3PCO B;  1CKN A;  3CP0 A;  5IYD G;  3AFP A;  4QIW E;  4YWK A;  3HKZ G;  2PI2 A;  1IBL L;  3K0X A;  4IPG A;  3S2D H;  1X3G A;  2LXJ A;  1E3P A;  3OTO Q;  3I55 A;  4QL5 A;  2AMC B;  1K83 H;  1BVS A;  5IP7 G;  2D62 A;  3BJU A;  3K8A A;  3PGZ A;  4PZ7 A;  4X6A H;  1FVI A;  3F1Z A;  3KF6 B;  4MNO A;  3M3Y H;  1LTL A;  1YJW A;  5IYB H;  4BXX G;  4UP8 A;  4JV5 Q;  2I5L X;  4KLK A;  4A3I G;  3GTM H;  4LW1 A;  1JMC A;  4A3C H;  4LF6 L;  1VQC A;  4DR7 L;  4DV6 L;  4GNX A;  1H95 A;  4JI7 Q;  3HOY G;  4JBW A;  2XGT A;  2NN6 I;  3KLW A;  1PVO A;  2UUA Q;  4OX9 Q;  2H5X A;  4A3M G;  3I4M H;  5FLX c;  2IX0 A;  4DPG A;  4Y52 H;  4JI1 Q;  1NE3 A;  4JI5 L;  3HKZ E;  2YU9 H;  4IPC A;  1UE5 A;  1J5E L;  2VUM H;  2RF4 A;  2JA5 G;  1QUQ A;  1VQH A;  1WCM G;  3G4S A;  3EIV A;  4YWL A;  2N8N A;  4UP9 A;  1JJ2 A;  1VQN A;  4BA2 I;  2LXK A;  1PH3 A;  3AYH B;  4AIM A;  1UWV A;  3NEN A;  3L2P A;  1KL9 A;  2BH8 A;  3HOX H;  1CUK A;  1NTG A;  4LFB L;  4JBK A;  2F4V Q;  1XMO Q;  1AH9 A;  2WP8 J;  1FGU A;  4X64 L;  4LF9 L;  1PH6 A;  3K81 C;  4YY3 Q;  4JI3 L;  4YHH Q;  4DUZ L;  1PYS B;  3ULP A;  4HJ9 A;  3CCS A;  1N34 L;  4A3D H;  4DV0 Q;  4HIK A;  2AHO B;  1UE7 A;  2ALY B;  1EQQ A;  4WJ3 M;  1TWG H;  4GN3 B;  2ZTE A;  1XMQ Q;  4UY8 C;  2JE6 I;  3UE0 A;  2YTV A;  3NEM A;  1IXR A;  3J81 i;  3GTJ H;  3CCV A;  1OTC A;  3RR5 A;  3ULJ A;  4P74 A;  3M4O H;  3FKI H;  4XIG S;  2I5H A;  1CKM A;  3CCJ A;  1HZC A;  4DV5 L;  1VQA A;  4A3E H;  2OQK A;  1PH9 A;  4LF7 L;  4IFD G;  2K5N A;  1P8L A;  3T1Y Q;  2IT1 A;  5C4X H;  1K9M C;  4BY1 H;  2D0P A;  3MEF A;  4JYA L;  2K50 A;  2OCE A;  3PUW A;  4JCV E;  1L2F A;  1JJC B;  1MIU A;  4A3J H;  2Z6K A;  3G71 A;  1M1K C;  4DR7 Q;  1I94 L;  1VQ9 A;  4A3C G;  4DV4 Q;  4DR6 L;  3A74 A;  2R92 H;  2EXD A;  3CW2 C;  3H0G H;  1V9P A;  3M85 A;  1YIJ A;  3UE1 A;  1IZ6 A;  3S24 A;  2K4K A;  2ZTD A;  3GDE A;  4OWW B;  2BH2 A;  3H3V I;  4LF5 L;  1S3O A;  4X66 Q;  4HJ7 A;  2ZM6 Q;  1J5E Q;  4EQ5 A;  1Q82 C;  1X55 A;  2HT1 A;  2JA7 H;  5C3E H;  1SR3 A;  2VL6 A;  4J15 A;  4IFD J;  1VQB A;  1TWA H;  3FHW A;  1X3F A;  3RLN A;  1K8G A;  2RHQ B;  1PH2 A;  1L0W A;  2PMZ E;  3RLF A;  4R4C A;  3KJO A;  4FDB A;  4JC0 A;  1G29 1;  2R7F A;  3HOX G;  5IYD H;  3U50 C;  4IJL A;  4DKA C;  4LF9 Q;  1HZ9 A;  2R7Z H;  4JI3 Q;  1VS0 A;  1PYB A;  4X62 Q;  3OTO L;  3I4N H;  1L1O C;  1VQO A;  3KFU A;  4A3D G;  4JI6 Q;  4C3H H;  3S17 H;  4NXN Q;  3KF8 B;  2UUC L;  4A3G G;  4OO1 I;  1SRU A;  3CD6 A;  1OXS C;  4APV A;  3FKI G;  1VQF A;  4IPD A;  1B70 B;  3T1H Q;  1HH2 P;  2N78 A;  1V1Q A;  3JC6 6;  5FJ8 H;  1KAW A;  1KQS A;  2I0Q A;  4JI7 L;  4A3E G;  4B3S Q;  4BY1 G;  4OX9 L;  1VQ8 A;  5C4X G;  3CF5 A;  1KHI A;  3LGJ A;  4JI0 Q;  4JI1 L;  1XPO A;  2JA6 H;  3TRZ A;  4DR5 Q;  3PUV A;  4A3J G;  1I94 Q;  1OXT A;  5IYC H;  3S1Q H;  1D8L A;  2YTY A;  3AEV A;  2GVA A;  4HIM A;  5H1S E;  2E2I H;  3H0G G;  3CCQ A;  5LMN Q;  2HHH L;  1I6H H;  1X54 A;  1BKB A;  3PV0 A;  1Q7Y C;  2F4V L;  4GS3 A;  1XMO L;  1QVC A;  2I5M X;  2L15 A;  1VQL A;  2JA7 G;  5C3E G;  4UP7 A;  2C35 B;  2EQS A;  4YY3 L;  4YHH L;  2B29 A;  1OXV A;  1PH4 A;  4DV7 L;  2Y0S G;  4BA1 I;  4JBJ A;  4QJF A;  1K73 C;  4DV0 L;  1EWI A;  3CCU A;  3STB C;  2NVQ H;  3RLO A;  4POG A;  1VQD A;  1YEZ A;  1P16 A;  3TS2 A;  1XMQ L;  3HOZ H;  3E0E A;  2R7Z G;  3WWV A;  3GD7 A;  2QEX A;  4HJA A;  3RZD H;  1XNQ Q;  2VNU D;  3SGI A;  1CKN B;  3UDX A;  1CSP A;  3I4N G;  1EIF A;  5K36 G;  4GOP A;  2NN6 G;  1WI5 A;  3CC7 A;  3T1Y L;  1IL2 A;  4DV1 L;  1K8A C;  2BA1 A;  5GRO A;  3GTQ H;  3H3V H;  2UUC Q;  4BY7 H;  4WJ4 A;  1N8R C;  2QA4 A;  1VQI A;  4GN5 A;  4DK6 C;  3CME A;  4JOI A;  2B63 H;  3UDI A;  1X65 A;  5C0X I;  3S15 H;  4IPH A;  2FXQ A;  4DV4 L;  4LUV A;  5FJ8 G;  4P73 A;  2F52 A;  2AWO A;  5GQO A;  4P75 A;  5E7N A;  2CCZ A;  2E5L Q;  1C0A A;  4GKJ Q;  4GLX A;  1HJP A;  4X66 L;  2JJQ A;  2Q2H A;  2ZM6 L;  2JA6 G;  2K5H A;  3RN5 A;  4JI2 L;  4DAY B;  1GVP A;  4RG1 A;  1KD1 C;  2Q2U A;  1IYJ B;  1SMX A;  3CCM A;  1R9T H;  5IYC G;  1VQE A;  1YHB A;  2XTI A;  3TQY A;  2HHH Q;  2PI2 E;  2OTL A;  3PIO A;  1VQ7 A;  2KCT A;  3ZJY C;  3TS0 A;  4LFC L;  5AJ3 Q;  1AE3 A;  5BR8 Q;  4ALP A;  1QUQ B;  1YNX A;  2ZJP A;  4DV2 Q;  2E2H H;  2UXB Q;  1XNR Q;  4PZ6 A;  1HR0 Q;  3DM3 A;  3A5U A;  4DV7 Q;  4K0K Q;  3NBH B;  2VZA A;  4GLV B;  4JOI C;  3S1M H;  1Y1V H;  4X62 L;  2KCM A;  4GNX C;  4NB3 A;  2JA8 H;  4IJH A;  3CXC A;  4R4T A;  2ZJR A;  1FJG Q;  3J7A 5;  4JI6 L;  1EUJ A;  3CCE A;  4NXN L;  2AKW B;  1NMF A;  2F3I A;  1B8A A;  2JQO A;  3W1B A;  3HOZ G;  4A3G H;  2IX1 A;  2HIX A;  3FP9 A;  5LMN W;  4DR2 Q;  4EX5 A;  4PG3 A;  1YHA A;  3L7Z C;  3T1H L;  1YZ6 A;  2CFM A;  1G6P A;  2R93 H;  3CPF A;  3TRE A;  2VS1 A;  4AQY Q;  3JAM i;  1SRO A;  5FLM G;  4DV1 Q;  4B3S L;  3UDG A;  5GAE C;  4BBR H;  4BY7 G;  4JI0 L;  3I4O A;  2B63 G;  3PO3 H;  4DR5 L;  2OQ0 A;  4AYB G;  1B7Y B;  3BU2 A;  3F2D A;  1GKH A;  4BBS H;  1WJJ A;  4C3I H;  2PQA B;  5LMN L;  3CAM A;  1L1O B;  3CPW A;  4A3B H;  1KRS A;  4DUY Q;  1C9O A;  1E24 A;  2K52 A;  4JI2 Q;  4A75 A;  4NXM Q;  2KHI A;  3G6E A;  5M3F H;  1VQP A;  4YCU A;  2NZH A;  1E7Z A;  3PSI A;  2ID0 A;  3E9H A;  1TWH H;  2UUB Q;  4UPA A;  1NJI C;  1IBK Q;  3TEH B;  4LFC Q;  2A19 A;  1EIY B;  5LMU Q;  3HOW H;  1A8V A;  4A3F H;  1GM5 A;  1AE2 A;  4B3M L;  1K0R A;  4LF8 Q;  3BZK A;  5GAG C;  2AWN A;  3EBE A;  5GAH C;  4H02 A;  4ME3 A;  4OO1 G;  4MZ9 A;  1NBW A;  2HIV A;  4AYB E;  4IO9 A;  3HOU H;  2JEB I;  2Z6K C;  2E2J H;  2Q2I A;  2VQE Q;  1XNQ L;  1Y1V G;  1YBY A;  2GVB A;  3PIP A;  1K3R A;  2JA8 G;  1HNZ Q;  3M4Q A;  1U5K A;  2NVY H;  1KIX A;  2CQO A;  1Q8K A;  5JJK A;  3PF5 A;  1W3S A;  1UEB A;  1VQG A;  1KRT A;  4AH6 A;  1PFS A;  2Z0S A;  1QZG A;  3B6Y A;  1Q46 A;  1W2B A;  1PH8 A;  2E8G A;  3MXN B;  2NZO A;  4PZ8 A;  4DK3 C;  1SLJ A;  2R93 G;  1HR0 W;  5IY0 A;  3G48 A;  5C44 H;  4KHZ A;  2E5L L;  3IRB A;  4GKJ L;  4BBR G;  3GTK H;  2LSS A;  1Q1B A;  2R6G A;  1PA6 A;  3DLL A;  3AQQ A;  2IY5 B;  2GN5 A;  3PO3 G;  3EN2 A;  4GKK Q;  3GTL H;  1V43 A;  3BZC A;  4JBM A;  3KDF A;  5JJL A;  4BBS G;  1X3E A;  5IP9 H;  2MO0 A;  1ASZ A;  1JJG A;  3U4Z A;  1EQR A;  1LUZ A;  3Q8D A;  4GN4 B;  4DAM A;  5JJI A;  5AJ3 L;  5BR8 L;  4A3B G;  4KHP Q;  1G51 A;  3ERS X;  1U0L A;  3GTO H;  1Q12 A;  1XTD A;  4DV2 L;  2UXB L;  1XNR L;  5M3F G;  3M4P A;  1HR0 L;  4A76 A;  3A0J A;  1A63 A;  4K0K L;  2VQF Q;  4A3K H;  4O2D A;  4DR4 Q;  3D31 A;  1Y1W H;  4JI8 L;  4TVA B;  3RNU A;  2ES2 A;  1FJG L;  3HOW G;  3KOJ A;  4TQU S;  5M5W H;  4B3M Q;  3HOV G;  4A3F G;  2K5V A;  2IHE A;  1N32 Q;  3K7U C;  4YCW A;  4QGU A;  1YHQ A;  1PH7 A;  1M90 C;  4HJ5 A;  5IT9 c;  4DR2 L;  2WB1 G;  5J3B A;  5HGQ A;  3HOU G;  2NVX H;  4DR3 Q;  5C0X G;  2UXD Q;  2YTX A;  1YI2 A;  2N49 A;  5FLM H;  4AQY L;  1X56 A;  4LF4 L;  1T9H A;  2WFW A;  5IWA Q;  4A3L H;  2KEN A;  1VQ6 A;  2BA0 A;  2VY3 A;  1D7Q A;  1J6Q A;  1VQ5 A;  1C7Y A;  4POF A;  3S16 H;  1QZH A;  5DLQ E;  5M5X H;  4GOP B;  1MJE A;  1VQM A;  4OXP A;  1S40 A;  3S14 H;  2Y0S E;  3E9I A;  3PUX A;  4P71 A;  2MFI A;  3I7F A;  4GLA C;  4A4I A;  2OTJ A;  5C44 G;  5M3M H;  1RL2 A;  2JA9 A;  3KF6 A;  4GNX B;  1N36 L;  4DUY L;  5EAY A;  5C0X J;  4NXM L;  4OWT B;  1UE1 A;  3CQZ H;  1UE6 A;  3HKS A;  2UU9 Q;  2WB1 E;  2EIF A;  1E1O A;  4LUZ A;  4JI4 Q;  2UUB L;  5IP9 G;  4R4Q A;  1IBK L;  1YJ9 A;  4KI0 A;  2KBN A;  2ASB A;  4B3R L;  2CWA A;  3K7A H;  1SN8 A;  3F2B A;  5LMU L;  4GOP C;  4A93 G;  1IBM Q;  4IOA A;  4LF8 L;  1HNX L;  1KC8 C;  1Q81 C;  3J80 c;  3CMA A;  3OW2 A;  3CC4 A;  1Q86 C;  2Q2T A;  1O7I A;  1NMG A;  3M9B A;  4A3K G;  5IE8 A;  5C4J H;  4JG2 A;  4JI8 Q;  2VQE L;  4X65 L;  2IHF A;  1Y1W G;  1XPU A;  5JEA G;  1XPR A;  4L5R C;  5HY6 A;  2QGQ A;  4HIO A;  1HNZ L;  4L5Q A;  3PO2 G;  4DV3 Q;  1PH5 A;  4LFA Q;  1A62 A;  2YYZ A;  3RN2 A;  5ELO A;  4HJ8 A;  2PNH A; 
#chains in the Genus database with same CATH topology
 4DNI A;  1JB3 A;  3AB9 A;  3D0F A;  1GUG A;  3OMC A;  4YWM A;  5CBA E;  3BDL A;  2HUG A;  2WAQ B;  1W6J A;  5JEA J;  4XDX A;  4ME5 A;  4FYD A;  3NWT A;  1QE6 A;  1XX8 A;  3T4A C;  1I3Q H;  2VXW A;  4KHP L;  2VW9 A;  1XJV A;  3EVQ A;  2LMC B;  5DNF A;  5IGC A;  3TZD A;  3CQZ B;  4KMU C;  2D2C C;  1Z9F A;  2UXC L;  5IT9 E;  3CHB D;  3D4R A;  4PMC A;  2CKZ B;  2MO1 A;  1S72 A;  1HNX Q;  1FL0 A;  5E4X A;  2YV5 A;  2EXZ A;  2E2H B;  1W6K A;  2CQA A;  2HQE A;  5IT9 L;  1CA6 A;  2PZU A;  4DR3 L;  1EYA A;  1A2U A;  1D1I A;  3QWN A;  5FK9 C;  5IGG A;  2VUM G;  3DWA A;  3U4V A;  4RA8 A;  3Q24 A;  3PUZ A;  4C3J H;  1JT8 A;  3EFX D;  3VA5 A;  3CKI B;  1RKN A;  3HEJ A;  4K6L A;  1I5F A;  2NB0 A;  1AFP A;  4JI4 L;  1WTO A;  3J7Y W;  3J80 E;  3CCL A;  2F0T A;  4A3I H;  1RIP A;  2JXM B;  4JV5 L;  2G5D A;  3U9O A;  1DON A;  2HCI A;  2L55 A;  2MNA A;  1SE8 A;  3KDF B;  1UUP A;  3J80 L;  2N3S A;  4IAL A;  3KJP A;  4JYA Q;  3S2H H;  5M5Y H;  2UXC Q;  3GQB A;  4IOC A;  1VQK A;  1WCM H;  2CWP A;  3JAM c;  5ELN A;  1OXU A;  5KNB A;  2R92 G;  3ND9 A;  2F0F A;  3A5Z B;  3KK7 A;  2B2T A;  1H9S B;  1QB5 D;  2J0T D;  1EYC A;  3VDY A;  1U4R A;  4Q0F A;  2XNA C;  1EZ6 A;  4I7Z C;  3CCR A;  4C3J B;  5IYD G;  3AFP A;  1RDP D;  1MI2 A;  1V1O A;  1IBL L;  3S2D H;  3I55 A;  2DY7 A;  2QKI C;  4CJ1 B;  5IP7 G;  3K8A A;  3PGZ A;  5G3L D;  2RKS A;  3GTL B;  1FVI A;  3F1Z A;  3M3Y H;  1YJW A;  3C3L A;  4JV5 Q;  1TS3 A;  2KCC A;  2B2W C;  4LW1 A;  1JMC A;  1K8M A;  3GTM H;  1EIH A;  4JBW A;  3TP7 A;  3KLW A;  1K8O A;  1X32 A;  2DJF C;  4JI1 Q;  4JI5 L;  2FJ2 A;  1UE5 A;  1J5E L;  3S2H B;  5M5Y B;  4V19 0;  3QR8 A;  1VQH A;  4YWL A;  1JJ2 A;  4BA2 I;  1WCM B;  1UWV A;  2MP1 A;  1KL9 A;  1ENA A;  4U68 A;  1PZK D;  3HOX H;  1BNZ A;  1ZYR D;  4E6I A;  1VMP A;  1NTG A;  4LFB L;  4DN4 M;  1XMO Q;  4X64 L;  4M1U B;  4YY3 Q;  3PIP 3;  2EE1 A;  4KK7 A;  1PYS B;  1Z7T A;  1JWM D;  1O7Z A;  4HIK A;  2ALY B;  3QOJ A;  2ZTE A;  3T16 A;  4UY8 C;  1B9M A;  2JE6 I;  2F03 A;  3NEM A;  3CCV A;  2E76 C;  5I9P A;  2F0P A;  1L0Y B;  3S2D B;  1CKM A;  4H7B A;  1HZC A;  1VQA A;  1PH9 A;  4IFD G;  4BY1 H;  1K9M C;  1JE4 A;  2XWJ B;  3J81 L;  4ILW A;  1MIU A;  2WKC A;  3EA6 A;  4A3J H;  3G71 A;  4A3C G;  3M3Y B;  5LL6 X;  3GTM B;  3NQI A;  1SE4 A;  3CW2 C;  3H0G H;  1E2W A;  3H3V I;  3UE1 A;  4OWW B;  2ZTD A;  1S3O A;  4CDC C;  2ZM6 Q;  1J5E Q;  4EQ5 A;  1LT3 D;  2O2L D;  1TQO A;  1X3F A;  2RHQ B;  4DK0 A;  1L0W A;  4ZK9 B;  5IOC A;  1EY0 A;  4FDB A;  4B9X A;  4S3S A;  3HOX B;  2J7Z A;  1VS0 A;  1UAP A;  4X62 Q;  3I4N H;  1L1O C;  3A55 A;  5K36 H;  3KFU A;  5BN4 A;  2EYL A;  4ZLT F;  3CD6 A;  3FKI G;  4QUF A;  3MVV A;  1ONL A;  2N78 A;  4JI7 L;  5FJ8 H;  1GHK A;  3HRZ C;  2I0Q A;  2WIN B;  3MA2 B;  5C4X G;  2EYF A;  3LWE A;  5FLX L;  1KHI A;  1A6X A;  1JOO A;  4BY1 B;  4JI0 Q;  3TRZ A;  1LAB A;  1KNA A;  4HTH A;  2M00 A;  3K5N A;  3QG1 A;  5IYC H;  2GVA A;  3SXH A;  5IGB A;  5H1S E;  2E2I H;  1IHZ A;  1X54 A;  3H0G B;  1TII D;  3NSW A;  3I4L A;  3C1E A;  5CV8 A;  1LTI D;  2SEB D;  4FP5 D;  3D6C A;  4UP7 A;  5KEE A;  2A73 B;  3A7A B;  4YHH L;  1OXV A;  3KBX A;  1A3U A;  4QJF A;  4DV0 L;  1EWI A;  4G57 A;  3I8Z A;  1YEZ A;  3TS2 A;  3HOZ H;  1F9Q A;  1J8I A;  3GD7 A;  3RZD H;  1D2B A;  1QCB D;  3UDX A;  1CSP A;  4Y7N B;  1LTG D;  4M8A A;  4GOP A;  3I4N B;  1EQV A;  3MTS A;  3GTQ H;  4C56 C;  3H3V H;  3CME A;  5COY A;  2EJF C;  5C0X I;  4ODG A;  2K01 A;  2AQ3 B;  3HOY B;  3S1R B;  1C0A A;  1HJP A;  2JJQ A;  3K5L A;  3RN5 A;  4JI2 L;  4RG1 A;  1KD1 C;  1R9T H;  2ICE C;  1B2T A;  2PI2 E;  2NTS A;  2RVL A;  2E2I B;  4Z9C B;  1YNX A;  3X3N A;  2SOB A;  3I72 A;  2F0G A;  4OHJ A;  4K0K Q;  5KYL A;  3CXC A;  3J7A 5;  4JI6 L;  5T1I A;  5IIF A;  4N9P A;  1EQT A;  3W1B A;  1B8A A;  3IL8 A;  1HA5 A;  4PG3 A;  1XTC D;  3RZD B;  3CPF A;  5NUC A;  1SRO A;  3TP6 A;  1K83 B;  1JR0 D;  3I4O A;  2B63 G;  2WV6 D;  3BYY B;  3BYT B;  1FD7 D;  4NP5 A;  3F2D A;  3CRK C;  4U67 3;  3I91 A;  3MHB A;  2A6H D;  4HN7 A;  1STB A;  2DY8 A;  3CAM A;  5JOB A;  2B8G A;  3CPW A;  3ERQ A;  4DUY Q;  4JI2 Q;  4A75 A;  2K52 A;  4NXM Q;  1EOT A;  1S5C D;  2KHI A;  5M3F H;  2F0K A;  5G3L F;  4YCU A;  1H9J A;  3PSI A;  3E9H A;  2EJM A;  5EJW A;  1NJI C;  1RTO A;  2CW0 D;  1HUN A;  1JWS D;  1PTO H;  3HG9 A;  1U4L A;  4A3F H;  1K0R A;  3BZK A;  3EBE A;  4ME3 A;  3E0J A;  3OHX C;  5C0X H;  2R3Z A;  2E2J H;  2Q2I A;  2VQE Q;  1I4Q A;  2F0D A;  1H9M A;  1ZYR C;  1Q8K A;  4G7Z C;  4HSP A;  4C1N I;  1UEB A;  1KRT A;  1XYI A;  3M4O B;  1QZG A;  1HTL D;  1SLJ A;  1X3P A;  2OXP A;  5I6W A;  5CYU A;  1K28 A;  1ZKO A;  4KHZ A;  4IUT A;  3IRB A;  3KF8 A;  4RH6 A;  4GKJ L;  2GN5 A;  1Q90 A;  4GKK Q;  1V43 A;  1TY0 A;  1GJX A;  5KRU A;  5A2Q E;  3KDF A;  4CHT B;  3DMU A;  1VDZ A;  3K58 A;  2HCC A;  1LUZ A;  5CR3 A;  5JJI A;  1CT1 D;  3R8B A;  4A3B G;  1G51 A;  1Q12 A;  1HR0 L;  4LK1 C;  2F0U A;  1SE2 A;  5M3F B;  4MIU A;  1TWA B;  5ELB A;  3D31 A;  4TVA B;  5C4H A;  1H9S A;  3HOV G;  1PTO B;  1N32 Q;  3DEP A;  4HJ5 A;  3HOU G;  2NVX H;  1EY7 A;  2UXD Q;  2WB1 B;  1CQF A;  1BF4 A;  2F0J A;  4AQY L;  2E2J B;  1KDC A;  1D7Q A;  3S16 H;  1KLG D;  1QZH A;  1VMC A;  1LT5 D;  4OXP A;  1S40 A;  3S14 H;  1S5B D;  3I7F A;  4QMG A;  3BZD B;  3I3C A;  3P1H A;  4OWT B;  3VYS A;  3HKS A;  2UU9 Q;  4RKB A;  2EIF A;  4F88 A;  1D5M C;  5LHY 1;  2AQ2 B;  4IUP A;  4R4Q A;  4RGT A;  5IP9 G;  5ELD A;  2FHT A;  2CWA A;  2D9U A;  1B50 A;  3PQI A;  3W3A A;  4LF8 L;  1Q81 C;  3CC4 A;  3M9B A;  2F0I A;  2FMM A;  4N8X 1;  3PO2 G;  4L5R C;  3M7G A;  2H1E A;  2QGQ A;  4DV3 Q;  1SEB D;  5I4D A;  4IUV A;  2E75 C;  2RDH A;  1A15 A;  1Y8N B;  3P20 A;  3ND8 A;  2WAC A;  3RN2 A;  4HJ8 A;  1WD1 A;  4NDX A;  1S5F D;  3F2C A;  4DR1 Q;  2NVX B;  5IOD A;  3M7N A;  4A3L G;  2AUK A;  1GUO A;  2RHS B;  2ZTC A;  3MXU A;  2ZXR A;  5F2D A;  1JB7 A;  4AYB B;  1CSQ A;  3EJI A;  3S16 B;  4PNY A;  1WTX A;  3S14 B;  5M3M G;  1Y14 B;  1CZG A;  3I56 A;  3I70 A;  1VQ4 A;  1DYQ A;  1TWF H;  3ER0 A;  1JQY D;  4C2M H;  2HDM A;  1EL0 A;  2K14 A;  1WD0 A;  1ENF A;  2J4X A;  5IYB G;  4I65 A;  1LM0 A;  4IUU A;  1EYG A;  4LF6 Q;  1HZA A;  4DV6 Q;  4PQX A;  1ENC A;  4IFD I;  2X69 A;  2K5D A;  2DUD A;  4KD3 A;  1SNC A;  2V1C C;  3GTP H;  4KKU A;  2MQH A;  3AFQ A;  2LFN A;  2DNC A;  3L0O A;  3W1G A;  4LNQ A;  1CM9 A;  1HZB A;  1DJR D;  3I2Z A;  1HFG A;  4OWX B;  1AZP A;  3C46 A;  3DXJ C;  4XQN A;  1TXY A;  4CJ2 C;  1D5Z C;  4DUZ Q;  4TKO B;  1D6E C;  2A6E D;  4ZYS A;  1II3 A;  5IP7 H;  1N34 Q;  3PO3 B;  1WYD A;  1GO3 E;  4ZKC B;  2DGY A;  1LLR D;  3MXN A;  3J80 i;  5K5P A;  2VB3 X;  3OWF A;  3ULL A;  3PMF A;  2C9O A;  1IBM L;  3NPP A;  4RMF A;  4DFA A;  4DV5 Q;  4LF7 Q;  3GTG H;  4DF7 A;  4C2M B;  2X6G A;  2A6H C;  1TKW B;  2B2V A;  4DR6 Q;  3PIO 3;  1PRT B;  4XQQ A;  3FPU B;  4LFA L;  2JEA I;  4LF5 Q;  3L9A X;  3PUY A;  1LV9 A;  2CW0 C;  3GTP B;  1ET9 A;  1WFQ A;  2RDF A;  3N6R A;  3DM1 A;  3OWE B;  3DWP A;  5BN3 A;  3K0X A;  2SDF A;  4QL5 A;  4IFD H;  3OOC A;  1MBY A;  3KF6 B;  4MNO A;  4CKC A;  1QG7 A;  4BXX G;  4KY5 A;  4A3C H;  1H95 A;  2NWG A;  5KND A;  1ILQ A;  1MSG A;  3A56 A;  2H5X A;  2KED A;  4A3M G;  4OX9 Q;  1FYC A;  3GTG B;  3TME A;  1SDF A;  2SNS A;  4R9W A;  5TSS A;  3Q22 A;  3K5O A;  3EIV A;  4P2C B;  2N8N A;  4L8J A;  2LXK A;  3AYH B;  4AIM A;  3L2P A;  3HGB A;  4CJ0 B;  3VR2 A;  1CUK A;  5LL6 S;  4EQO A;  3NUC A;  4CBV A;  2ENB A;  4JI3 L;  2AUJ D;  3ULP A;  4CDF C;  2MJ8 A;  3NXW A;  2AHO B;  4CDE C;  1EU4 A;  2L12 A;  1XMQ Q;  2OF1 A;  1IXR A;  1Z6H A;  5J1Z A;  3J81 i;  3MWY W;  1EWC A;  4P74 A;  2ZXO A;  3FKI H;  4XIG S;  2I5H A;  3T1Y Q;  2IT1 A;  5C4X H;  3JAM E;  4JYA L;  2ZT9 C;  2OCE A;  4FF3 A;  1GHJ A;  3IKJ A;  4JCV E;  5EPK A;  3OSO A;  3AU7 A;  2PPB C;  2XN9 C;  1B1Z A;  4C1N K;  4DV4 Q;  1BOS A;  1TR5 A;  4YIJ A;  3NE5 B;  1YIJ A;  1IZ6 A;  2K4K A;  2BH2 A;  2Q8I B;  4XT3 B;  5KIX A;  1H9R A;  2O5J C;  1Q82 C;  1SR3 A;  1MHW C;  4J15 A;  1A3V A;  3FHW A;  2PMZ E;  3VR5 A;  3NTI A;  1LTR D;  2XVS A;  3U50 C;  4IJL A;  3SK5 A;  1O78 A;  4JI3 Q;  4CDD C;  2B39 A;  4KKS A;  3LNN A;  1VQO A;  1IKM A;  1PRT D;  4A3D G;  3S17 H;  3KF8 B;  3HZX A;  1O80 A;  2NYZ D;  4J8Q A;  4A3G G;  1SRU A;  3WOE A;  4EGV A;  4APV A;  4F7X A;  4IPD A;  1B70 B;  1SE3 A;  1HH2 P;  1IKL A;  1V1Q A;  3JC6 6;  1I3Q B;  1KQS A;  4A3E G;  4B3S Q;  4DNT B;  3MXG A;  1ZXT A;  1QJO A;  4JI1 L;  5C4X B;  4DR5 Q;  3PUV A;  1STE A;  1TU2 B;  1D8L A;  2YTY A;  4HIM A;  1F2L A;  2O5I C;  5LMN Q;  1BKB A;  5C4Z A;  4GS3 A;  1XMO L;  1QVC A;  1VQL A;  3H91 A;  4K2L A;  5C3E G;  1SNM A;  4YY3 L;  2B29 A;  5EKK A;  4RGM A;  1PFN A;  4B08 A;  4ZUI A;  1AP0 A;  2Y0S G;  5C3W A;  1K73 C;  3SK4 A;  4UHV A;  3P7J A;  1IYU A;  2NVQ H;  3RLO A;  2F3W A;  2R7Z G;  4HJA A;  5EKI A;  3SGI A;  1EIF A;  4B9W A;  4QB4 A;  4C3H G;  2BA1 A;  3MEH A;  2IL8 A;  2B2T C;  3S17 B;  4WJ4 A;  2QA4 A;  2B63 H;  1CHP D;  4A3I B;  2FXQ A;  4LUV A;  4X3T A;  1EY8 A;  2A6E C;  4P73 A;  2F52 A;  5GQO A;  4P75 A;  2F0O A;  2JA6 G;  2ZM6 L;  2K5H A;  1CFM A;  1STA A;  3VA7 A;  1IYJ B;  1V8Q A;  2TMP A;  2F0S A;  1V1P A;  2M9V A;  1VQ7 A;  2KCT A;  1F9S A;  1AE3 A;  1QUQ B;  4JK1 C;  3K59 A;  4ULL A;  1XNR Q;  2EVB A;  3U9S A;  3DM3 A;  1F2Z A;  3NBH B;  4RCO A;  4X62 L;  2KCM A;  4NB3 A;  3BVZ A;  4IJH A;  2ZJR A;  2LS0 1;  1FJG Q;  3SEB A;  1IYV A;  1C48 A;  2F3I A;  2JQO A;  2WII B;  2NVQ B;  3FP9 A;  5LMN W;  1WTH A;  3H6M A;  3WDN A;  1TVX A;  3I73 A;  4EX5 A;  1YHA A;  1G6P A;  1YZ6 A;  4OEM B;  4OEL B;  1WTR A;  1E2Z A;  4BY7 G;  4JI0 L;  2OQ0 A;  3Q23 A;  1B7Y B;  2B63 B;  1GOZ A;  2F0N A;  4ZUJ A;  1HUM A;  1TT2 A;  1WJJ A;  4PMB A;  1AZQ A;  2IWH A;  5EKL A;  4A3B H;  1E24 A;  1VQP A;  3RD4 A;  1E7Z A;  2PZW A;  2ID0 A;  2NBF A;  1TWH H;  3TEH B;  1A3T A;  1EIY B;  1HHV A;  3TP5 A;  3VYT A;  2AWN A;  2PW5 A;  5GAH C;  4H02 A;  3HOU H;  4X6A H;  2JEB I;  1YBY A;  2JA8 G;  3M4Q A;  1G2S A;  1STY A;  3PF5 A;  2Z1C A;  1W3S A;  3UI2 A;  5C5M A;  2RCF A;  4HMJ A;  1EWH A;  3B6Y A;  2E8G A;  3MXN B;  1STG A;  4KV6 A;  5IY0 A;  2QDL A;  3G48 A;  4CGY B;  4OGQ C;  4BBR G;  2R6G A;  1PA6 A;  4Q5V A;  1HXY D;  4A3J B;  5JJL A;  5I9O A;  4C3I G;  5IP9 H;  1NCV A;  5FO7 B;  4DAM A;  1U0L A;  4XYO A;  1ROD A;  2DNE A;  4A3B B;  3M4P A;  1GUT A;  3A0J A;  4K0K L;  2VQF Q;  4DR4 Q;  1TS4 A;  3RNU A;  2VB2 X;  2L11 A;  1TWH B;  3HOW G;  1EFI D;  2BOS A;  4TQU S;  1SYC A;  1SMY C;  2EJG C;  5EPL A;  3K7U C;  4YCW A;  1M90 C;  5ELE A;  5HGQ A;  4LMQ D;  3BG3 A;  3A8K E;  4V0B A;  3HOU B;  1YI2 A;  5FLM H;  1HA6 A;  1X56 A;  1BCP B;  4LF4 L;  1T9H A;  5IWA Q;  4A3L H;  2VY3 A;  4H13 C;  1JOQ A;  5DLQ E;  2NTT A;  3AMU A;  4G4K A;  3WOF A;  3NP8 A;  1E2V A;  2OTJ A;  5C44 G;  5M3M H;  1PRT C;  2JA9 A;  3KF6 A;  3NTH A;  1N36 L;  4DUY L;  4NXM L;  2EY6 A;  5C0X J;  1UE6 A;  4QF4 A;  1JOR A;  1E1O A;  5E3F A;  2PYK A;  4EVO A;  1YJ9 A;  1T5E A;  2KBN A;  3A7L A;  3K7A H;  1SN8 A;  3F2B A;  4MN3 A;  4GOP C;  4IOA A;  3HS0 C;  1S5D D;  1Q86 C;  2Q2T A;  1NMG A;  5C4J H;  2VQE L;  4X65 L;  2K5W A;  1Y1W G;  3D3R A;  5JEA G;  5HY6 A;  3FRP B;  4L5Q A;  2A74 C;  1SYF A;  4RHS A;  3V96 A;  3HOZ B;  2YYZ A;  1I4P A;  2CHB D;  4LF4 Q;  3KBG A;  2IPK D;  4NPS A;  4B3T Q;  3GTQ B;  1TWC H;  1HNW Q;  1MKH A;  1DGS A;  1U9R A;  4TSS A;  4GKK L;  1YVC A;  1I50 H;  4KY6 A;  3URY A;  4L5T A;  2F0H A;  4G7H C;  1N36 Q;  3MFG A;  1BQQ T;  3NEL A;  1JWU D;  3ICE A;  2B2U A;  3TP8 A;  5M3M B;  2B3G A;  1E1T A;  2B2Y A;  2A1A A;  2LKV A;  3DHQ A;  2A5H A;  1R9T B;  2HQL A;  1SYD A;  5AFW A;  1Q8I A;  4EQN A;  3K7A B;  1QVG A;  3GO5 A;  1N32 L;  3TBI B;  3S1N H;  4X65 Q;  1CKO A;  2UXD L;  5I2Y A;  2BE5 D;  1WOC A;  5C4J B;  4IN3 A;  5KGU A;  1A0I A;  3TZU A;  1F2M A;  2B2Y C;  3RUZ A;  5CMD A;  2Z4I A;  3V05 A;  4JW0 A;  2F3V A;  2K5Q A;  4RWS C;  4XT1 B;  3W5O A;  1Z47 A;  3QIA A;  5DAU A;  4FNF A;  5DM6 3;  1T5X D;  4QQB X;  3PF4 A;  2UU9 L;  4R4O A;  2RCN A;  3IFD A;  4QY7 A;  1I50 B;  4BXX H;  3OW7 A;  2A8V A;  1PZI D;  4A93 H;  1R4P B;  4LWC A;  5A2Q L;  3U58 A;  1GD7 A;  3RZO H;  1BO0 A;  1WVL A;  2OT2 A;  4A3M H;  5JPN C;  3J7Z C;  4ZRZ A;  5HGT A;  5DM7 3;  4K5W A;  3LWU A;  1GXD C;  4NW2 A;  5L37 A;  4DV3 L;  4K6D A;  1NAP A;  4A3F B;  3QOL A;  1LYL A;  1EEI D;  3O13 A;  3J81 j;  4P72 A;  1F9P A;  3S1N B;  5GAD C;  4DR1 L;  3RMH A;  4K8J A;  4LUO A;  2NVT H;  4PMW A;  1EFW A;  2XIW A;  1KXL A;  3CP0 A;  3FMC A;  4QIW E;  3HKZ G;  2PI2 A;  5T1G A;  1X3G A;  2LXJ A;  1EY9 A;  2ICI A;  1E3P A;  3OTO Q;  1BVS A;  2PCF B;  4FF4 A;  5A35 A;  1XWE A;  1UEA B;  2I5L X;  4LF6 L;  1VQC A;  4DV6 L;  4GNX A;  3HOY G;  3H09 A;  2XGT A;  1PVO A;  4A93 B;  1V1P B;  3RZO B;  4CKE A;  2IX0 A;  1I6V C;  2Q8R E;  2YU9 H;  3HKZ E;  2VUM H;  2F0E A;  2RF4 A;  2JA5 G;  1EU3 A;  1QUQ A;  2L1B A;  2F4I A;  3VYR A;  2QDB A;  1IW7 C;  2L0C A;  1RTN A;  2BH8 A;  3NBH A;  4N9T A;  4JBK A;  3T56 B;  2F4V Q;  1KAA A;  3MXP A;  2WP8 J;  4RHR A;  4X3S A;  2CH4 W;  3K81 C;  4DUZ L;  1STH A;  5C6A A;  1N34 L;  4A3D H;  1UE7 A;  1KDA A;  1SNP A;  1Q3L A;  4WJ3 M;  2NVT B;  2EOT A;  4FXK C;  1OTC A;  1CZW A;  2BCO A;  1K0S A;  1EYD A;  1M8A A;  4DV5 L;  4K5X A;  4A3E H;  2OQK A;  2PMZ B;  4LF7 L;  2K5N A;  1FNV A;  2K50 A;  5BN5 A;  2KVM A;  1B9N A;  2Z6K A;  5IGE A;  1I94 L;  4DR6 L;  5CV7 A;  2R92 H;  1HQM C;  2EXD A;  2I46 A;  3M85 A;  1ICF B;  5M9O A;  3I4M G;  4L6T B;  4LF5 L;  4X66 Q;  4HJ7 A;  1FGB D;  5C3E H;  5FOB B;  2YU9 B;  4IFD J;  1VQB A;  3RLN A;  2VUM B;  1ZEQ X;  2TSS A;  4JVZ A;  2KEC A;  4PV1 C;  5CV5 A;  1KLU D;  3RLF A;  3KJO A;  4FF1 A;  1G29 1;  5IYD H;  3NBI A;  4RFB A;  4DKA C;  1HZ9 A;  2R7Z H;  1PYB A;  1PTO D;  1SYE A;  2F0Q A;  4C3H H;  1B3A A;  5JJZ A;  4NXN Q;  4A3D B;  3LX0 A;  2UUC L;  1VF5 C;  4KJN A;  2F0L A;  3FPP A;  1TY2 A;  1F77 A;  1PYW D;  4XQJ A;  3T1H Q;  1TWF B;  2E74 C;  1EY5 A;  2A68 D;  4IQZ A;  1VQ8 A;  4OX9 L;  4A3E B;  5D65 A;  3LGJ A;  2JA6 H;  1XPO A;  5J39 A;  3M4Y A;  1I94 Q;  1OXT A;  3CU7 A;  1LTA D;  2R92 B;  1I6H H;  4FF2 A;  3PV0 A;  1HCZ A;  2E2D C;  2L15 A;  2JA7 G;  3W2D A;  2C35 B;  5C3E B;  5CV9 A;  4JBJ A;  3GV6 A;  1EIG A;  4POG A;  1VQD A;  1XMQ L;  1PXU A;  3E0E A;  2BE5 C;  2QEX A;  5EQ0 A;  1XNQ Q;  4KJO A;  3OIQ A;  1CKN B;  2B2V C;  2NN6 G;  1WI5 A;  2K33 A;  3CC7 A;  3T1Y L;  1K8A C;  2UUC Q;  2K6A A;  4J1M A;  4C3H B;  4BY7 H;  2RSN A;  1VQI A;  3C1F A;  4GN5 A;  4JOI A;  3UDI A;  1X65 A;  2GA4 B;  4IPH A;  4DV4 L;  2EYH A;  4IZ8 A;  5E7N A;  2CCZ A;  2E5L Q;  1HRJ A;  4IUQ A;  4GLX A;  2Q2H A;  2IW3 A;  4DAY B;  2JA6 B;  2K04 A;  1CHQ D;  2XTI A;  4DK1 A;  1EEF D;  1DXM A;  2OTL A;  5ELF A;  3TS0 A;  5AJ3 Q;  5BR8 Q;  2Z4H A;  1I6H B;  2ZJP A;  4DV2 Q;  2E2H H;  1SSO A;  5J22 A;  2UXB Q;  3A5U A;  1IL8 A;  4GLV B;  4JOI C;  1G8Z D;  1FR3 A;  4JPB W;  2JA8 H;  1R4Q B;  3ONA B;  4R4T A;  1EUJ A;  2Z9H A;  2AKW B;  1NMF A;  2B8F A;  3F2U A;  2HIX A;  4DR2 Q;  2R61 A;  3NWS A;  2CFM A;  2K7V A;  1TS2 A;  2VS1 A;  4B3S L;  1XXG A;  5GAE C;  3DEO A;  4BBR H;  1WTV A;  3T13 A;  4DR5 L;  4BY7 B;  1GUS A;  4AYB G;  3BU2 A;  3JAM L;  4C3I H;  3R2I A;  1SMY D;  1CA5 A;  5LMN L;  1PLF A;  2KCN A;  1KRS A;  2EY2 A;  3OMG A;  4ZKB B;  1WTQ A;  5D3D A;  3G6E A;  4MHE A;  2NZH A;  2QCP X;  3E5S A;  2UUB Q;  1IBK Q;  4O42 A;  1UNS A;  3H3V C;  2A19 A;  4ZCK A;  5LMU Q;  4NKL A;  3HOW H;  4K5V A;  1GM5 A;  1AE2 A;  2XSC A;  4F8M A;  4OO1 G;  4AYB E;  2HIV A;  3J7A V;  5D14 A;  3N52 A;  1Y1V G;  3PIP A;  4ID6 A;  1HNZ Q;  2JA8 B;  1KIX A;  2MUY A;  1B53 A;  4HAE A;  4AH6 A;  1O7L A;  1PH8 A;  3FKI B;  2DN8 A;  1KDB A;  1RF2 D;  4I7A A;  2R93 G;  1D5X C;  1M4V A;  2RA4 A;  5C44 H;  3SDZ A;  3G6J B;  1QIL A;  1Q1B A;  2LSS A;  3DLL A;  4BBR B;  3PO3 G;  3GTL H;  3BZC A;  2EYM A;  4JBM A;  5EBC A;  4BBS G;  1X3E A;  3A54 A;  1ASZ A;  3U4Z A;  2XWB B;  4DU9 A;  3Q8D A;  4GN4 B;  4C3I B;  1QNK A;  4H44 C;  4KHP Q;  3ERS X;  3R3O A;  3GTO H;  1XTD A;  1XNR L;  2HDL A;  1BR9 A;  1A63 A;  1L0X B;  4N8F A;  1Y1W H;  4JI8 L;  1MGS A;  1H9K A;  5JEA H;  1FJG L;  3DUZ A;  5M5W H;  1QWY A;  2K5V A;  2IHE A;  3HOW B;  3J7A F;  4QGU A;  4KTA A;  1YHQ A;  1PH7 A;  5IT9 c;  4HCS A;  4DR3 Q;  2B2W A;  2N49 A;  2WFW A;  1K3B C;  2A69 D;  2KEN A;  2BA0 A;  1J6Q A;  1C7Y A;  5M5X H;  1MJE A;  2QIL A;  4KY7 A;  1VQM A;  1AW7 A;  1PTO C;  1SYB A;  3PUX A;  2KJX A;  1SNQ A;  2Y0S E;  3E9I A;  4P71 A;  2RDG A;  4A4I A;  4RGO S;  3VYU A;  1RL2 A;  1PTO F;  4GNX B;  3BS1 A;  5C44 B;  1CK1 A;  1UE1 A;  5JAV A;  4LJZ C;  4KD4 A;  4DXG A;  1DOK A;  4JI4 Q;  2ASB A;  2EYJ A;  4B3R L;  4DAV A;  2EYO A;  1LAC A;  4FO2 A;  2A68 C;  2QF7 A;  3HP3 A;  1KC8 C;  2PO4 A;  3J80 c;  4UDU C;  3CMA A;  3OW2 A;  3GTO B;  3ITP A;  1Y8P B;  4A3K G;  5IE8 A;  3Q6S A;  4JG2 A;  1JIC A;  4JI8 Q;  2IHF A;  1SNO A;  1XPR A;  1NR4 A;  1Y1W B;  1PH5 A;  5M5W B;  1RCV D;  2PNH A;  5E4W C;  2ZJQ A;  5CBE E;  3FDT A;  1U4P A;  4HID A;  3KUP A;  1DOL A;  2WAQ G;  4X3U A;  1DD2 A;  1VCI A;  1DOM A;  4HR7 B;  5M5X B;  2ZXP A;  1BBW A;  4YCV A;  1YIT A;  1IBL Q;  4WOR A;  1SFO H;  5FO8 B;  3J81 E;  2AQ1 B;  1U4M A;  1CTM A;  3KLS A;  3SR1 A;  3H15 A;  1X6O A;  4MTN A;  2VQF L;  4X3K A;  1ASY A;  4DR4 L;  3ZYY X;  2R7D A;  4B3R Q;  2C5C A;  2PQA A;  3F8T A;  3NQT A;  3HOV H;  1L1O A;  3TDQ A;  2WAQ E;  3GV3 A;  3GP7 A;  3OYY A;  1A2T A;  4O0A A;  3STB D;  4JI5 Q;  2JK8 A;  5CGK A;  1PH1 A;  1N33 L;  2G9H D;  1KTK A;  1FNU A;  1RJT A;  5IWA L;  1AN8 A;  4L63 B;  3T51 B;  1AEX A;  4EQP A;  4L5S A;  2IJ0 A;  3L3O C;  3K80 C;  4LFB Q;  4QUC A;  4R1J A;  4X64 Q;  3K57 A;  2N88 A;  2KHJ A;  2EY1 A;  3BDC A;  1TS5 A;  3I90 A;  4OON A;  1RD9 D;  4Y7N H;  3CC2 A;  4CKB A;  1X3Q A;  3X3M A;  1QVF A;  1PV4 A;  1SYG A;  4FXG C;  3V2T A;  2K75 A;  5FLX E;  1OXX K;  1IW7 D;  4WRD A;  3S1R H;  1PHJ A;  3HOY H;  3S9W A;  1N9W A;  1SFO B;  1Y69 U;  2IY5 B;  1X9N A;  2UUA L;  4XTC S;  2ATW A;  1E22 A;  1LT4 D;  5IGF A;  3J81 c;  2XRS D;  3HFZ B;  1VQJ A;  5ISR A;  1O7Y A;  3PO2 H;  4QIW B;  4RKL A;  1MJC A;  2JA5 H;  1G91 A;  1EOV A;  3K0Y A;  3UDF A;  2FFK B;  3HOV B;  4IUN A;  1Y8O B;  4R4I A;  1Q1E A;  4GZY C;  2L4N A;  1NY4 A;  1YNN D;  1N33 Q;  1BBU A;  3EQL C;  3IFT A;  3P75 A;  1BUV T;  1EY4 A;  1JE5 A;  1YJN A;  4B3T L;  2MPM A;  1HNW L;  4TRD A;  4C3J G;  5D3I B;  5E1F A;  2OWO A;  3KYH C;  2D0O A;  1NUC A;  3PCO B;  1CKN A;  3MC0 B;  4YWK A;  4FVM A;  3HKZ B;  1EY6 A;  4IPG A;  1PMR A;  1PRT F;  3VR3 A;  2AMC B;  1K83 H;  2D62 A;  3BJU A;  2MGS A;  4PZ7 A;  2EDG A;  2Q8T A;  1LTL A;  4WJW A;  3R93 A;  5IYB H;  4UP8 A;  3VR6 A;  4KLK A;  4A3I G;  4J6H A;  4DR7 L;  4JI7 Q;  2NN6 I;  3QO2 A;  4DAY A;  3C2P A;  2UUA Q;  3I4M H;  3OIP A;  5FLX c;  4DPG A;  2WKD A;  4Y52 H;  1NE3 A;  4IPC A;  1CI3 M;  4WFN 3;  3KLR A;  1MSH A;  1WCM G;  3G4S A;  3PO2 B;  1OO9 B;  1VQN A;  4UP9 A;  2JA5 B;  2MHV A;  2RBM A;  1PH3 A;  1NNX A;  3CRL C;  4RCN A;  3NEN A;  3D4W A;  1ML0 D;  2BDO A;  1FNW A;  1AH9 A;  1FGU A;  4LF9 L;  3VR4 A;  1PH6 A;  1KAB A;  1B3Q A;  4YHH Q;  2CVR A;  1PZJ D;  4HJ9 A;  2Z6B A;  4RAU C;  3CCS A;  3BDO A;  3TN2 A;  1DM0 B;  4DV0 Q;  2JSO A;  4G7O C;  1EQQ A;  1TWG H;  1SAP A;  3MFY A;  4GN3 B;  5C3X A;  1F9R A;  2K28 A;  2YTV A;  3UE0 A;  3QB3 A;  2IX3 A;  3GTJ H;  3M4O H;  3RR5 A;  3ULJ A;  1LTB D;  2M2L A;  2A69 C;  4UAI A;  4DAP A;  3CCJ A;  3IAY A;  2QW7 A;  1P8L A;  2NUC A;  1B4O A;  3NHH A;  2D0P A;  3MEF A;  3R2T A;  3PUW A;  4H0L C;  2RSO A;  1L2F A;  1JJC B;  3D6W A;  1M1K C;  4DR7 Q;  5KNC A;  1VQ9 A;  1ET6 A;  2SNM A;  4K8I A;  3A74 A;  3BVM A;  2EZV A;  3NTK A;  1SND A;  1V9P A;  3A8J E;  3S24 A;  3GDE A;  2JYO A;  3KLS X;  1J9O A;  1ICW A;  3I4M B;  1SXT A;  1X55 A;  2HT1 A;  2JA7 H;  2VL6 A;  1TWA H;  1K8G A;  4HED A;  1PH2 A;  1HTP A;  4ABN A;  2LY7 A;  4KHV A;  1ESF A;  4R4C A;  2B2U C;  2QEJ C;  4JC0 A;  2R7F A;  3HOX G;  2DJG C;  3E6Z X;  1HFN A;  4LF9 Q;  2HD3 A;  2N55 A;  5I2X A;  4R8I A;  2EYP A;  3OTO L;  1TWC B;  2NN6 H;  3SK6 A;  4JI6 Q;  3Q0A A;  2F0V A;  1B44 D;  4ZAI A;  1I4R A;  4OO1 I;  1BCP D;  1TWG B;  2KHS A;  3E3X A;  1OXS C;  2K05 A;  4HMI A;  4ZQ3 A;  5CV4 A;  1VQF A;  3GTJ B;  1KAW A;  1WTP A;  4BY1 G;  1GUW A;  3CF5 A;  1YNJ D;  2PQE A;  2KEE A;  4A3J G;  1LTT D;  4DGZ A;  3S1Q H;  3AEV A;  5JVG 3;  1KNE A;  3H0G G;  3CCQ A;  2HHH L;  3SK8 A;  4DXF A;  1Q7Y C;  2F4V L;  2EPB A;  2I5M X;  1ILP A;  4BS9 A;  4RGN A;  2EQS A;  2JA7 B;  2F0W A;  1PH4 A;  4DV7 L;  1NSN S;  4BA1 I;  1DCZ A;  3CCU A;  3STB C;  1JOK A;  1P16 A;  2P5Z X;  3WWV A;  2JP1 A;  4IUR A;  2VNU D;  1PFM A;  3I4N G;  5FO9 B;  5K36 G;  1IL2 A;  1VF7 A;  4DV1 L;  5GRO A;  2FIN B;  1N8R C;  4DK6 C;  2K03 A;  3S15 H;  1G6Z A;  5FJ8 G;  2AWO A;  4XYQ A;  2KQ3 A;  5C5L A;  4DNR B;  4A3M B;  4GKJ Q;  5EBD A;  1NR2 A;  4X66 L;  3SVM A;  1HPC A;  3A8I E;  1GVP A;  2Q2U A;  2Z8L A;  1SMX A;  3CCM A;  5IYC G;  1VQE A;  1YHB A;  3TQY A;  2HHH Q;  2V4D A;  3PIO A;  3QJY A;  3S1Q B;  3D8G A;  3ZJY C;  4LFC L;  4HCE A;  4ALP A;  5JVH 3;  4PZ6 A;  5COR A;  1HR0 Q;  4OO1 H;  2FMC A;  2CH4 A;  5EGT A;  4DV7 Q;  2D5D A;  2NZ1 D;  2VZA A;  3S1M H;  1Y1V H;  3MZ5 A;  2PZT A;  4GNX C;  1S5E D;  3CCE A;  4NXN L;  4A3G H;  2K32 A;  1YNN C;  3HOZ G;  4MTK A;  2IX1 A;  5HUR A;  3FVQ A;  3L7Z C;  3T1H L;  2R93 H;  4O1N A;  3TRE A;  4AQY Q;  3JAM i;  5FLM G;  4DV1 Q;  3UDG A;  4KN7 C;  4OL7 A;  3PO3 H;  5EPJ A;  2KOL A;  3K5M A;  1GKH A;  3S15 B;  2X6L A;  2OEO A;  4BBS H;  2JN4 A;  2PQA B;  4NMZ A;  1DZ1 A;  1L1O B;  1C9O A;  2PW7 A;  2KUM A;  2K1B A;  1MD2 D;  4FXD A;  4K2K A;  4UPA A;  5CC4 A;  4LFC Q;  1JCK B;  1A8V A;  4B3M L;  4LF8 Q;  5GAG C;  5ELC A;  2L5T A;  4MZ9 A;  1NBW A;  4IO9 A;  2Z6K C;  1XNQ L;  4KKT A;  1ESR A;  1HQR D;  2F0M A;  2GVB A;  1K3R A;  3S1M B;  1Y1V B;  5JPM C;  3ERO A;  1U5K A;  2NVY H;  1E0B A;  2CQO A;  5JJK A;  3T53 B;  5FKA C;  1VQG A;  4A3G B;  1PFS A;  2Z0S A;  1Q46 A;  2EY5 A;  1W2B A;  4PZ8 A;  1RHP A;  2NZO A;  4DK3 C;  1HR0 W;  2R93 B;  2F1M A;  2G9D A;  3D4D A;  2XRQ D;  2E5L L;  5I6Y A;  3GTK H;  1SJH D;  1QOH A;  3AQQ A;  2RQX A;  3EN2 A;  1I4H A;  4F87 A;  1F2Y A;  2MO0 A;  2H4O A;  1C8C A;  1JJG A;  4BBS B;  1EQR A;  3OPO A;  5KYI A;  5AJ3 L;  5BR8 L;  1EZ8 A;  3SE0 A;  4XXE A;  4DV2 L;  2UXB L;  3BVG A;  5M3F G;  4A76 A;  2BDN A;  1BDO A;  3NK9 A;  4O2D A;  4A3K H;  1I4X A;  3G7L A;  4K14 A;  1WTW A;  4OIJ A;  2ES2 A;  2Y0S B;  1PDQ A;  3KOJ A;  4B3M Q;  4A3F G;  1CQV A;  2O4X A;  4DR2 L;  2WB1 G;  5J3B A;  2R7Z B;  3FEW X;  5C0X G;  2YTX A;  1PFB A;  3TSS A;  1SJE D;  2PNR C;  4LAA A;  1VQ6 A;  4BWG B;  5CV6 A;  1QNU A;  2NVY B;  1VQ5 A;  4POF A;  4GOP B;  1GUN A;  2KA7 A;  1LO5 D;  1G2T A;  2MFI A;  4DA2 A;  1S4Z A;  4GLA C;  2I07 B;  3MAQ A;  3K6O A;  1LT6 D;  5EAY A;  3SHL A;  3GTK B;  3CQZ H;  3DWQ A;  1BCP C;  2WB1 E;  4OIK A;  4LUZ A;  1JC7 A;  4R8N A;  2UUB L;  1BCP F;  1IBK L;  4KI0 A;  5LMU L;  2L9H A;  4A93 G;  1IBM Q;  1YNJ C;  1HNX L;  1I4G A;  1C4Q A;  1SBB B;  1O7I A;  1D1K A;  1LTS D;  5IGD A;  4A3K B;  1XPU A;  4QCL A;  1BBX C;  1BXT A;  1HNZ L;  4HIO A;  4HSV A;  1STN A;  4KN4 C;  5DEH A;  4LFA Q;  1A62 A;  5ELO A;  3H94 A; 
#chains in the Genus database with same CATH homology
 4DNI A;  3F2C A;  4LF4 Q;  4DR1 Q;  3M7N A;  4HID A;  4A3L G;  3D0F A;  2WAQ G;  4NPS A;  4B3T Q;  4YWM A;  1TWC H;  2RHS B;  2ZTC A;  1HNW Q;  1MKH A;  1DGS A;  1VCI A;  4GKK L;  1JB7 A;  1YVC A;  1I50 H;  5JEA J;  1CSQ A;  4L5T A;  1BBW A;  4YCV A;  1YIT A;  1IBL Q;  5M3M G;  1N36 Q;  1Y14 B;  3ICE A;  3I56 A;  3NEL A;  1SFO H;  1I3Q H;  1VQ4 A;  4KHP L;  2VW9 A;  1TWF H;  2B3G A;  3ER0 A;  1E1T A;  4C2M H;  1XJV A;  2A1A A;  3H15 A;  1X6O A;  4MTN A;  2VQF L;  2K14 A;  1ASY A;  4DR4 L;  2HQL A;  1Z9F A;  4B3R Q;  2R7D A;  2UXC L;  5IYB G;  2PQA A;  3F8T A;  1LM0 A;  3HOV H;  1EYG A;  4LF6 Q;  1HZA A;  4DV6 Q;  1L1O A;  2CKZ B;  2MO1 A;  1S72 A;  2WAQ E;  1HNX Q;  1FL0 A;  1QVG A;  3GO5 A;  4IFD I;  2YV5 A;  1N32 L;  3S1N H;  3OYY A;  4O0A A;  3STB D;  2ZJQ A;  2DUD A;  3I4M G;  4X65 Q;  4DR3 L;  1CKO A;  2V1C C;  2UXD L;  4JI5 Q;  3GTP H;  1WOC A;  2JK8 A;  1PH1 A;  1N33 L;  2VUM G;  5IWA L;  2MQH A;  3AFQ A;  3U4V A;  3L0O A;  3W1G A;  4LNQ A;  1HZB A;  3PUZ A;  1A0I A;  3I2Z A;  4OWX B;  4C3J H;  4L5S A;  3K80 C;  4LFB Q;  1JT8 A;  1TXY A;  4R1J A;  4X64 Q;  4DUZ Q;  2KHJ A;  4OON A;  3W5O A;  4Y7N H;  1Z47 A;  3CC2 A;  1I5F A;  5IP7 H;  4QQB X;  1N34 Q;  1WYD A;  2UU9 L;  1PV4 A;  1GO3 E;  4R4O A;  1QVF A;  3PF4 A;  2RCN A;  2DGY A;  4JI4 L;  4QY7 A;  3J80 i;  4BXX H;  3CCL A;  2A8V A;  4A3I H;  1RIP A;  4JV5 L;  2K75 A;  4A93 H;  1OXX K;  3ULL A;  4LWC A;  3HOY H;  3U58 A;  3S1R H;  1PHJ A;  1GD7 A;  2MNA A;  1IBM L;  1SE8 A;  3KDF B;  4RMF A;  4DV5 Q;  1N9W A;  4LF7 Q;  3RZO H;  2N3S A;  3GTG H;  4A3M H;  1X9N A;  3J7Z C;  4XTC S;  3KJP A;  1E22 A;  2UUA L;  2ATW A;  3S2H H;  5M5Y H;  3J81 c;  4JYA Q;  2UXC Q;  3HFZ B;  1VQJ A;  4IOC A;  1VQK A;  3PO2 H;  1MJC A;  2JA5 H;  1EOV A;  1WCM H;  4DV3 L;  4DR6 Q;  3UDF A;  2CWP A;  3JAM c;  5ELN A;  1OXU A;  2R92 G;  1LYL A;  4R4I A;  1Q1E A;  3A5Z B;  4LFA L;  3J81 j;  2JEA I;  4P72 A;  1NY4 A;  4LF5 Q;  3PUY A;  5GAD C;  1N33 Q;  1BBU A;  4DR1 L;  3VDY A;  1JE5 A;  1YJN A;  4B3T L;  1WFQ A;  1HNW L;  4LUO A;  2NVT H;  4PMW A;  1EFW A;  2OWO A;  3KYH C;  2D0O A;  3CCR A;  1KXL A;  3PCO B;  1CKN A;  3CP0 A;  5IYD G;  3AFP A;  4QIW E;  4YWK A;  3HKZ G;  2PI2 A;  1IBL L;  3K0X A;  4IPG A;  3S2D H;  1X3G A;  2LXJ A;  1E3P A;  3OTO Q;  3I55 A;  4QL5 A;  2AMC B;  1K83 H;  1BVS A;  5IP7 G;  2D62 A;  3BJU A;  3K8A A;  3PGZ A;  4PZ7 A;  4X6A H;  1FVI A;  3F1Z A;  3KF6 B;  4MNO A;  3M3Y H;  1LTL A;  1YJW A;  5IYB H;  4BXX G;  4UP8 A;  4JV5 Q;  2I5L X;  4KLK A;  4A3I G;  3GTM H;  4LW1 A;  1JMC A;  4A3C H;  4LF6 L;  1VQC A;  4DR7 L;  4DV6 L;  4GNX A;  1H95 A;  4JI7 Q;  3HOY G;  4JBW A;  2XGT A;  2NN6 I;  3KLW A;  1PVO A;  2UUA Q;  4OX9 Q;  2H5X A;  4A3M G;  3I4M H;  5FLX c;  2IX0 A;  4DPG A;  4Y52 H;  4JI1 Q;  1NE3 A;  4JI5 L;  3HKZ E;  2YU9 H;  4IPC A;  1UE5 A;  1J5E L;  2VUM H;  2RF4 A;  2JA5 G;  1QUQ A;  1VQH A;  1WCM G;  3G4S A;  3EIV A;  4YWL A;  2N8N A;  4UP9 A;  1JJ2 A;  1VQN A;  4BA2 I;  2LXK A;  1PH3 A;  3AYH B;  4AIM A;  1UWV A;  3NEN A;  3L2P A;  1KL9 A;  2BH8 A;  3HOX H;  1CUK A;  1NTG A;  4LFB L;  4JBK A;  2F4V Q;  1XMO Q;  1AH9 A;  2WP8 J;  1FGU A;  4X64 L;  4LF9 L;  1PH6 A;  3K81 C;  4YY3 Q;  4JI3 L;  4YHH Q;  4DUZ L;  1PYS B;  3ULP A;  4HJ9 A;  3CCS A;  1N34 L;  4A3D H;  4DV0 Q;  4HIK A;  2AHO B;  1UE7 A;  2ALY B;  1EQQ A;  4WJ3 M;  1TWG H;  4GN3 B;  2ZTE A;  1XMQ Q;  4UY8 C;  2JE6 I;  3UE0 A;  2YTV A;  3NEM A;  1IXR A;  3J81 i;  3GTJ H;  3CCV A;  1OTC A;  3RR5 A;  3ULJ A;  4P74 A;  3M4O H;  3FKI H;  4XIG S;  2I5H A;  1CKM A;  3CCJ A;  1HZC A;  4DV5 L;  1VQA A;  4A3E H;  2OQK A;  1PH9 A;  4LF7 L;  4IFD G;  2K5N A;  1P8L A;  3T1Y Q;  2IT1 A;  5C4X H;  1K9M C;  4BY1 H;  2D0P A;  3MEF A;  4JYA L;  2K50 A;  2OCE A;  3PUW A;  4JCV E;  1L2F A;  1JJC B;  1MIU A;  4A3J H;  2Z6K A;  3G71 A;  1M1K C;  4DR7 Q;  1I94 L;  1VQ9 A;  4A3C G;  4DV4 Q;  4DR6 L;  3A74 A;  2R92 H;  2EXD A;  3CW2 C;  3H0G H;  1V9P A;  3M85 A;  1YIJ A;  3UE1 A;  1IZ6 A;  3S24 A;  2K4K A;  2ZTD A;  3GDE A;  4OWW B;  2BH2 A;  3H3V I;  4LF5 L;  1S3O A;  4X66 Q;  4HJ7 A;  2ZM6 Q;  1J5E Q;  4EQ5 A;  1Q82 C;  1X55 A;  2HT1 A;  2JA7 H;  5C3E H;  1SR3 A;  2VL6 A;  4J15 A;  4IFD J;  1VQB A;  1TWA H;  3FHW A;  1X3F A;  3RLN A;  1K8G A;  2RHQ B;  1PH2 A;  1L0W A;  2PMZ E;  3RLF A;  4R4C A;  3KJO A;  4FDB A;  4JC0 A;  1G29 1;  2R7F A;  3HOX G;  5IYD H;  3U50 C;  4IJL A;  4DKA C;  4LF9 Q;  1HZ9 A;  2R7Z H;  4JI3 Q;  1VS0 A;  1PYB A;  4X62 Q;  3OTO L;  3I4N H;  1L1O C;  1VQO A;  3KFU A;  4A3D G;  4JI6 Q;  4C3H H;  3S17 H;  4NXN Q;  3KF8 B;  2UUC L;  4A3G G;  4OO1 I;  1SRU A;  3CD6 A;  1OXS C;  4APV A;  3FKI G;  1VQF A;  4IPD A;  1B70 B;  3T1H Q;  1HH2 P;  2N78 A;  1V1Q A;  3JC6 6;  5FJ8 H;  1KAW A;  1KQS A;  2I0Q A;  4JI7 L;  4A3E G;  4B3S Q;  4BY1 G;  4OX9 L;  1VQ8 A;  5C4X G;  3CF5 A;  1KHI A;  3LGJ A;  4JI0 Q;  4JI1 L;  1XPO A;  2JA6 H;  3TRZ A;  4DR5 Q;  3PUV A;  4A3J G;  1I94 Q;  1OXT A;  5IYC H;  3S1Q H;  1D8L A;  2YTY A;  3AEV A;  2GVA A;  4HIM A;  5H1S E;  2E2I H;  3H0G G;  3CCQ A;  5LMN Q;  2HHH L;  1I6H H;  1X54 A;  1BKB A;  3PV0 A;  1Q7Y C;  2F4V L;  4GS3 A;  1XMO L;  1QVC A;  2I5M X;  2L15 A;  1VQL A;  2JA7 G;  5C3E G;  4UP7 A;  2C35 B;  2EQS A;  4YY3 L;  4YHH L;  2B29 A;  1OXV A;  1PH4 A;  4DV7 L;  2Y0S G;  4BA1 I;  4JBJ A;  4QJF A;  1K73 C;  4DV0 L;  1EWI A;  3CCU A;  3STB C;  2NVQ H;  3RLO A;  4POG A;  1VQD A;  1YEZ A;  1P16 A;  3TS2 A;  1XMQ L;  3HOZ H;  3E0E A;  2R7Z G;  3WWV A;  3GD7 A;  2QEX A;  4HJA A;  3RZD H;  1XNQ Q;  2VNU D;  3SGI A;  1CKN B;  3UDX A;  1CSP A;  3I4N G;  1EIF A;  5K36 G;  4GOP A;  2NN6 G;  1WI5 A;  3CC7 A;  3T1Y L;  1IL2 A;  4DV1 L;  1K8A C;  2BA1 A;  5GRO A;  3GTQ H;  3H3V H;  2UUC Q;  4BY7 H;  4WJ4 A;  1N8R C;  2QA4 A;  1VQI A;  4GN5 A;  4DK6 C;  3CME A;  4JOI A;  2B63 H;  3UDI A;  1X65 A;  5C0X I;  3S15 H;  4IPH A;  2FXQ A;  4DV4 L;  4LUV A;  5FJ8 G;  4P73 A;  2F52 A;  2AWO A;  5GQO A;  4P75 A;  5E7N A;  2CCZ A;  2E5L Q;  1C0A A;  4GKJ Q;  4GLX A;  1HJP A;  4X66 L;  2JJQ A;  2Q2H A;  2ZM6 L;  2JA6 G;  2K5H A;  3RN5 A;  4JI2 L;  4DAY B;  1GVP A;  4RG1 A;  1KD1 C;  2Q2U A;  1IYJ B;  1SMX A;  3CCM A;  1R9T H;  5IYC G;  1VQE A;  1YHB A;  2XTI A;  3TQY A;  2HHH Q;  2PI2 E;  2OTL A;  3PIO A;  1VQ7 A;  2KCT A;  3ZJY C;  3TS0 A;  4LFC L;  5AJ3 Q;  1AE3 A;  5BR8 Q;  4ALP A;  1QUQ B;  1YNX A;  2ZJP A;  4DV2 Q;  2E2H H;  2UXB Q;  1XNR Q;  4PZ6 A;  1HR0 Q;  3DM3 A;  3A5U A;  4DV7 Q;  4K0K Q;  3NBH B;  2VZA A;  4GLV B;  4JOI C;  3S1M H;  1Y1V H;  4X62 L;  2KCM A;  4GNX C;  4NB3 A;  2JA8 H;  4IJH A;  3CXC A;  4R4T A;  2ZJR A;  1FJG Q;  3J7A 5;  4JI6 L;  1EUJ A;  3CCE A;  4NXN L;  2AKW B;  1NMF A;  2F3I A;  1B8A A;  2JQO A;  3W1B A;  3HOZ G;  4A3G H;  2IX1 A;  2HIX A;  3FP9 A;  5LMN W;  4DR2 Q;  4EX5 A;  4PG3 A;  1YHA A;  3L7Z C;  3T1H L;  1YZ6 A;  2CFM A;  1G6P A;  2R93 H;  3CPF A;  3TRE A;  2VS1 A;  4AQY Q;  3JAM i;  1SRO A;  5FLM G;  4DV1 Q;  4B3S L;  3UDG A;  5GAE C;  4BBR H;  4BY7 G;  4JI0 L;  3I4O A;  2B63 G;  3PO3 H;  4DR5 L;  2OQ0 A;  4AYB G;  1B7Y B;  3BU2 A;  3F2D A;  1GKH A;  4BBS H;  1WJJ A;  4C3I H;  2PQA B;  5LMN L;  3CAM A;  1L1O B;  3CPW A;  4A3B H;  1KRS A;  4DUY Q;  1C9O A;  1E24 A;  2K52 A;  4JI2 Q;  4A75 A;  4NXM Q;  2KHI A;  3G6E A;  5M3F H;  1VQP A;  4YCU A;  2NZH A;  1E7Z A;  3PSI A;  2ID0 A;  3E9H A;  1TWH H;  2UUB Q;  4UPA A;  1NJI C;  1IBK Q;  3TEH B;  4LFC Q;  2A19 A;  1EIY B;  5LMU Q;  3HOW H;  1A8V A;  4A3F H;  1GM5 A;  1AE2 A;  4B3M L;  1K0R A;  4LF8 Q;  3BZK A;  5GAG C;  2AWN A;  3EBE A;  5GAH C;  4H02 A;  4ME3 A;  4OO1 G;  4MZ9 A;  1NBW A;  2HIV A;  4AYB E;  4IO9 A;  3HOU H;  2JEB I;  2Z6K C;  2E2J H;  2Q2I A;  2VQE Q;  1XNQ L;  1Y1V G;  1YBY A;  2GVB A;  3PIP A;  1K3R A;  2JA8 G;  1HNZ Q;  3M4Q A;  1U5K A;  2NVY H;  1KIX A;  2CQO A;  1Q8K A;  5JJK A;  3PF5 A;  1W3S A;  1UEB A;  1VQG A;  1KRT A;  4AH6 A;  1PFS A;  2Z0S A;  1QZG A;  3B6Y A;  1Q46 A;  1W2B A;  1PH8 A;  2E8G A;  3MXN B;  2NZO A;  4PZ8 A;  4DK3 C;  1SLJ A;  2R93 G;  1HR0 W;  5IY0 A;  3G48 A;  5C44 H;  4KHZ A;  2E5L L;  3IRB A;  4GKJ L;  4BBR G;  3GTK H;  2LSS A;  1Q1B A;  2R6G A;  1PA6 A;  3DLL A;  3AQQ A;  2IY5 B;  2GN5 A;  3PO3 G;  3EN2 A;  4GKK Q;  3GTL H;  1V43 A;  3BZC A;  4JBM A;  3KDF A;  5JJL A;  4BBS G;  1X3E A;  5IP9 H;  2MO0 A;  1ASZ A;  1JJG A;  3U4Z A;  1EQR A;  1LUZ A;  3Q8D A;  4GN4 B;  4DAM A;  5JJI A;  5AJ3 L;  5BR8 L;  4A3B G;  4KHP Q;  1G51 A;  3ERS X;  1U0L A;  3GTO H;  1Q12 A;  1XTD A;  4DV2 L;  2UXB L;  1XNR L;  5M3F G;  3M4P A;  1HR0 L;  4A76 A;  3A0J A;  1A63 A;  4K0K L;  2VQF Q;  4A3K H;  4O2D A;  4DR4 Q;  3D31 A;  1Y1W H;  4JI8 L;  4TVA B;  3RNU A;  2ES2 A;  1FJG L;  3HOW G;  3KOJ A;  4TQU S;  5M5W H;  4B3M Q;  3HOV G;  4A3F G;  2K5V A;  2IHE A;  1N32 Q;  3K7U C;  4YCW A;  4QGU A;  1YHQ A;  1PH7 A;  1M90 C;  4HJ5 A;  5IT9 c;  4DR2 L;  2WB1 G;  5J3B A;  5HGQ A;  3HOU G;  2NVX H;  4DR3 Q;  5C0X G;  2UXD Q;  2YTX A;  1YI2 A;  2N49 A;  5FLM H;  4AQY L;  1X56 A;  4LF4 L;  1T9H A;  2WFW A;  5IWA Q;  4A3L H;  2KEN A;  1VQ6 A;  2BA0 A;  2VY3 A;  1D7Q A;  1J6Q A;  1VQ5 A;  1C7Y A;  4POF A;  3S16 H;  1QZH A;  5DLQ E;  5M5X H;  4GOP B;  1MJE A;  1VQM A;  4OXP A;  1S40 A;  3S14 H;  2Y0S E;  3E9I A;  3PUX A;  4P71 A;  2MFI A;  3I7F A;  4GLA C;  4A4I A;  2OTJ A;  5C44 G;  5M3M H;  1RL2 A;  2JA9 A;  3KF6 A;  4GNX B;  1N36 L;  4DUY L;  5EAY A;  5C0X J;  4NXM L;  4OWT B;  1UE1 A;  3CQZ H;  1UE6 A;  3HKS A;  2UU9 Q;  2WB1 E;  2EIF A;  1E1O A;  4LUZ A;  4JI4 Q;  2UUB L;  5IP9 G;  4R4Q A;  1IBK L;  1YJ9 A;  4KI0 A;  2KBN A;  2ASB A;  4B3R L;  2CWA A;  3K7A H;  1SN8 A;  3F2B A;  5LMU L;  4GOP C;  4A93 G;  1IBM Q;  4IOA A;  4LF8 L;  1HNX L;  1KC8 C;  1Q81 C;  3J80 c;  3CMA A;  3OW2 A;  3CC4 A;  1Q86 C;  2Q2T A;  1O7I A;  1NMG A;  3M9B A;  4A3K G;  5IE8 A;  5C4J H;  4JG2 A;  4JI8 Q;  2VQE L;  4X65 L;  2IHF A;  1Y1W G;  1XPU A;  5JEA G;  1XPR A;  4L5R C;  5HY6 A;  2QGQ A;  4HIO A;  1HNZ L;  4L5Q A;  3PO2 G;  4DV3 Q;  1PH5 A;  4LFA Q;  1A62 A;  2YYZ A;  3RN2 A;  5ELO A;  4HJ8 A;  2PNH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...