1XX8A

Nmr structure of the w24a mutant of the hyperthermophile sac7d protein
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
66
structure length
66
Chain Sequence
MVKVKFKYKGEEKEVDTSKIKKVARVGKMVSFTYDDNGKTGRGAVSEKDAPKELLDMLARAEREKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Role of a surface tryptophan in defining the structure, stability, and DNA binding of the hyperthermophile protein sac7d
pubmed doi rcsb
source organism Sulfolobus acidocaldarius
molecule tags Dna binding protein
molecule keywords Sac7d
total genus 4
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2004-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02294 7kD_DNA_binding 7kD DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1xx8A00
2L1BA 1EQTA 2B2VC 4X3KA 4DN4M 2K03A 1XYIA 2X69A 3IFDA 1X3PA 3KUPA 4ZK9B 2KECA 1BBXC 3F2UA 1AZQA 1B53A 3G7LA 4RAUC 1SDFA 1O80A 1G2TA 2NWGA 2Q8TA 1DOKA 1JE4A 1IKLA 1Q3LA 1ILPA 1AZPA 1F9RA 5JJZA 1NCVA 2B2TA 1JICA 2B2VA 2JYOA 2X6GA 2DY8A 3HP3A 2RSOA 2K1BA 1DZ1A 1O7ZA 2B2WC 4LMQD 1C8CA 1EIGA 3N52A 1RJTA 1WTVA 1RTNA 1HRJA 3P7JA 3R93A 1CA5A 5CBAE 2L9HA 1RHPA 4QUFA 2B2WA 3Q6SA 1M8AA 1U4PA 1BO0A 1RODA 1IKMA 2K28A 3IL8A 1A15A 3H91A 1WTXA 1RTOA 1U4LA 4HAEA 4X3UA 1EIHA 1G2SA 1PDQA 2D9UA 3FPUB 5EKIA 3DEOA 2FHTA 1DOLA 1PFBA 1LV9A 2KOLA 1G91A 4MN3A 4MHEA 2N88A 1HUNA 2DY7A 1KNEA 1CA6A 1NAPA 4O42A 2BDNA 4IUVA 3I91A 2KUMA 4U68A 4XT1B 4RA8A 1HFNA 1MGSA 3FDTA 1ILQA 1F2LA 2CVRA 2HUGA 1PFNA 2SDFA 2M2LA 3KBXA 2K01A 1GUWA 1TVXA 2HDMA 4IUQA 1WTPA 5D14A 4UAIA 1ZXTA 5EPLA 1F9PA 3ONAB 1SAPA 4XDXA 1WTOA 5E4XA 1MSGA 4OIJA 3GV6A 1QG7A 2J7ZA 1WTRA 4X3TA 4IURA 1EL0A 4IUTA 4IUUA 1S4ZA 1B3AA 1PLFA 1X32A 2MPMA 5AFWA 2B2UC 2FINB 2L12A 5CMDA 1QNKA 1F9QA 1KNAA 2FJ2A 2FMMA 1WD0A 5DNFA 5CORA 2MP1A 2N55A 5EJWA 2NYZD 2B2YA 2RSNA 2FFKB 2NZ1D 3LWEA 4R8IA 1B2TA 3I8ZA 2KVMA 2MJ8A 2R3ZA 3D6WA 1WVLA 1XX8A 2B2YC 1BF4A 1NR4A 1VMCA 1B50A 1DONA 2HCCA 4R9WA 1WD1A 5CBEE 4X3SA 5E4WC 1PFMA 2VXWA 4ZKCB 4CJ0B 1HA6A 1CM9A 3I90A 1B4OA 3MTSA 4ZLTF 2EOTA 1O7YA 4NW2A 2HCIA 1J9OA 2K04A 3DM1A 1AP0A 3UI2A 3GV3A 3DEPA 2H1EA 3SVMA 3QO2A 2KEEA 1DOMA 2L4NA 4IUPA 2KEDA 3I3CA 1U4MA 3TN2A 4HSVA 1SSOA 2EE1A 4CJ2C 2B2TC 5EQ0A 2Q8RE 1NR2A 2EPBA 5D65A 5T1GA 4XT3B 1J8IA 4ZKBB 1MSHA 2IL8A 5T1IA 5EPKA 1ICWA 1F9SA 1MI2A 2B2UA 2X6LA 1WTQA 1QE6A 1HFGA 1E0BA 1ESRA 1X3QA 2RVLA 1IL8A 4RWSC 4HEDA 3MWYW 1EOTA 1HUMA 1U4RA 5COYA 2K05A 3TZDA 1BNZA 4ZAIA 2RA4A 1G6ZA 1HHVA 4CJ1B 2L11A 5EPJA 2JP1A 2XIWA 2MGSA 4HCSA 2HDLA 4OIKA 1WTWA 4QUCA 1ML0D 1VMPA
chains in the Genus database with same CATH superfamily
2K5VA 1NMGA 4F7XA 2V4DA 2JA9A 2ZJRA 1HXYD 3BU2A 5FLMH 5C5MA 4KV6A 2I5HA 1LACA 4LK1C 2N49A 5CGKA 1IBLL 2B2VA 3K57A 1Q81C 4HTHA 1QVGA 4DK0A 2LY7A 3P7JA 1HNXL 1GO3E 3STBC 1RODA 1D5MC 4DAMA 4A3CH 1V9PA 1G2SA 3O13A 5EKIA 3Q23A 3OWFA 5FO7B 1A3TA 4IOCA 5ELEA 3W1BA 4C1NI 2DJGC 4BY1B 3T1HQ 4IPDA 4RA8A 3Q22A 3R2TA 4DR4Q 4OXPA 2M2LA 1Z6HA 1EY6A 1TVXA 4B3RL 4GKJL 1D1IA 1BCPF 3DLLA 1SLJA 2UUAQ 1TS3A 3BYYB 1XMOQ 3STBD 2VQFL 2L12A 5CMDA 1JJCB 2HHHQ 1GUTA 4FP5D 3BZDB 3TREA 4A3KG 1B2TA 1PTOC 3I4MG 4DV7Q 4BY1G 1KC8C 4ODGA 2VUMG 3FMCA 5FLXE 4NPSA 1E24A 1WD1A 4L8JA 3PIO3 3HKZG 4ZKCB 3OSOA 1O78A 1LTAD 2EOTA 1HPCA 3DM1A 3UI2A 4K5VA 3ND9A 2AUKA 4HSVA 3K8AA 1LTRD 5FOBB 3GTMH 4A93G 1CQVA 2PZWA 3M9BA 1STNA 4RCNA 4DNRB 1B1ZA 3OW7A 5T1IA 2DGYA 4XXEA 4RFBA 1KABA 2BA0A 1S5DD 1E0BA 1F2MA 3T16A 3I70A 2RQXA 5CR3A 1B44D 4CJ1B 5EPJA 5JVH3 1DJRD 4JCVE 1F2YA 4JG2A 1QWYA 2XWJB 2D62A 2F0LA 4DN4M 4P72A 4BY1H 2VY3A 4DKAC 4DV7L 2K32A 3F2UA 5KRUA 2Y0SE 2IW3A 1KDBA 1KAAA 1RD9D 1F9RA 4K8IA 2EYHA 5IWAL 4GKKL 2JA8G 2A69C 3KDFB 3J80i 3TS2A 2Q2IA 3E5SA 4A3MG 1VQHA 2WKCA 2JSOA 4S3SA 4DUZQ 3L3OC 4DAVA 3VA7A 1R4PB 2XSCA 3A8KE 1X3FA 3NXWA 3U50C 1ASYA 3M4QA 4JOIC 1KLGD 5JOBA 1XWEA 3I4MH 4X3UA 1Z7TA 5FJ8G 2F1MA 4LFBQ 1SBBB 2WFWA 1V1PB 3KFUA 1SN8A 2KOLA 2DY7A 1HH2P 1BBUA 2KUMA 2M9VA 3G4SA 2G9DA 2WAQB 2A69D 3I56A 1FGBD 5HGQA 5D14A 1SNQA 1STYA 1J6QA 1Q7YC 2R6GA 2C5CA 3PUXA 1K3BC 1GXDC 2Z4IA 2IX0A 3NTIA 3VYTA 1LT5D 4X62L 2KVMA 1X54A 4GLAC 5C3XA 2CHBD 2EJGC 1Q46A 2DNEA 5C0XG 2JN4A 1BDOA 2Q2HA 4QIWE 1EY0A 1SNPA 3A5ZB 4RHRA 4X3SA 1PFMA 3CP0A 2F0IA 1HR0L 5DM73 4HR7B 2L15A 3GTOB 2O4XA 3ITPA 3GV3A 4JVZA 2AKWB 3E6ZX 3CU7A 3CHBD 4G57A 1QUQA 2CCZA 3S2DH 2EYPA 2F0GA 5C44G 2MNAA 2MQHA 1YITA 4A3DB 3HEJA 4QL5A 4UDUC 2OTJA 4GNXB 2ZXRA 4HEDA 1TWGB 3NHHA 4OO1I 2VQEL 3ICEA 3AEVA 1I3QH 1PRTB 2B8FA 3WDNA 1TIID 4CDDC 5JEAH 1XJVA 3U58A 3S14H 1CKOA 1LTGD 4DV5L 1BBXC 1OTCA 1E2WA 3GTGB 5HGTA 4DR3L 1STEA 1I4RA 2NWGA 1Q3LA 5KGUA 4MTKA 1IW7D 4GN3B 4JPBW 4KI0A 4WJWA 1PYSB 1PH8A 4JI6L 2TMPA 2K1BA 3VR6A 4V0BA 2B2WC 3BVGA 3CKIB 1HNZQ 1VQDA 1X65A 2L9HA 1JJ2A 3EBEA 1K0SA 1RTOA 2J4XA 3L0OA 1RKNA 2NN6I 2YV5A 2RF4A 1G91A 3J81j 1OXXK 5ELCA 2E2DC 3U4VA 5BN5A 5IIFA 4XT1B 1PTOD 1IW7C 4FNFA 4X64L 2WACA 2PW7A 3KJPA 3ONAB 5C0XH 3DM3A 3R2IA 1AFPA 4KMUC 1EL0A 1JMCA 3RLOA 3SK6A 4A3KH 2QDLA 5IYBG 2R7ZB 1CKNB 3H0GG 4A3LH 1QNKA 5GQOA 1ASZA 5CORA 1G6PA 1EEID 3OPOA 2EYFA 4DK1A 4R8IA 4A3CG 3HOVH 4BBRG 4K0KL 1E2VA 1HCZA 2B8GA 5A2QE 3UE1A 2K5QA 1DCZA 1NSNS 2PNHA 3QR8A 4NXNL 3M7NA 2EYOA 1HJPA 1B50A 3S16B 1TWCB 1U5KA 1SFOB 2CW0D 3A0JA 1H9RA 3MTSA 2SEBD 1OXUA 2SNMA 1KQSA 4JYAQ 2CQAA 3DMUA 4R4TA 1I4PA 3S1QB 1RL2A 5C4XG 5IGCA 1PRTD 5C4ZA 3I7FA 3BZKA 4LF5L 3SK5A 3TP5A 4JI1Q 4ZUJA 2F03A 1CK1A 2QDBA 4WJ4A 1X3GA 4J15A 1I4XA 3I4OA 4DAYA 2QEXA 3S24A 2PQEA 4C3JB 2XIWA 1NTGA 4OIKA 1BBWA 3EIVA 5LMUQ 4BWGB 4GNXC 2PPBC 4NXNQ 4LFAQ 4IZ8A 2KCMA 2Q8TA 3MXGA 3CCQA 1UUPA 5IWAQ 1MJCA 2Y0SG 3CCUA 4FF2A 3TMEA 1YI2A 2XN9C 3E9IA 1MJEA 1FJGL 3N52A 4O1NA 1V1QA 2B2WA 2NZOA 4APVA 3IL8A 1D6EC 1LTBD 3CD6A 3PO2G 4B3RQ 4GKJQ 3MHBA 1DOLA 4K0KQ 4DR1Q 1M90C 4MHEA 2PNRC 5LHY1 3K6OA 2ZTEA 5JJLA 3A54A 2BCOA 2Z1CA 1F2LA 4Q0FA 1JWUD 3NUCA 4B3SQ 2E75C 5KEEA 1F9PA 2RCFA 3E9HA 5KYIA 2N78A 3J80L 2J7ZA 4JI8Q 2Z4HA 4YCUA 2ZXPA 4R4QA 1MIUA 2UXCQ 1PTOF 1Z47A 5AFWA 5EBDA 4KHPQ 2WINB 1W6JA 4JI7L 1TWGH 2I5LX 3MZ5A 5EJWA 3VR2A 4FXKC 1Q1BA 1SFOH 2R92G 1PYWD 4CKBA 3CAMA 5JEAG 4R9WA 4DK6C 5IYDG 2YTYA 4NB3A 1CM9A 1B4OA 1N33L 1I6HB 4RKLA 5M5XB 1J5EL 2IY5B 1XPRA 3QO2A 1BUVT 2EE1A 2OF1A 1DD2A 1QVFA 1YHBA 2Y0SB 3SDZA 4A3BB 2IL8A 2VNUD 4DAYB 3S17B 3JAME 2ZTDA 5GAHC 2JA7B 1I94Q 1HUMA 3RN2A 1K83H 5IGFA 1VQOA 4PMWA 2D0OA 4N8FA 3TDQA 2MGSA 4HCSA 1OO9B 5IP9H 3NK9A 1ML0D 1WCMH 5I6WA 3P1HA 2F0VA 4NXMQ 4C3JG 3MXUA 4C3HH 4QY7A 1FVIA 5CV6A 4QGUA 4OGQC 1PV4A 2GN5A 2F4VL 1JE4A 3CPFA 3S17H 2NUCA 2R7FA 4LF4Q 1CKMA 3QWNA 4LFCQ 5A35A 1DZ1A 5M5YH 3KYHC 3GTLH 3ULJA 5IGGA 5J3BA 3NPPA 5M5XH 4LF8Q 2F0FA 1W2BA 1IHZA 1JCKB 3H91A 1A3VA 2AUJD 4KY6A 4DR2Q 4YWMA 2AQ2B 1NY4A 2JA6B 4K6LA 1AH9A 2JA7G 3A7AB 3I4NH 1Y1VH 4L5SA 3M85A 1KRSA 4O42A 3VYRA 3H09A 1YNJD 2Z6KC 1PXUA 4B3TQ 1XPOA 4A3BG 1CHPD 3SR1A 1E22A 4RCOA 3RZOB 4CGYB 5C44H 4O0AA 4ID6A 5BR8L 2F0DA 5DAUA 3CRLC 2A6HC 2CWPA 3PIOA 3M4OB 4OIJA 5K36G 3GV6A 2K5DA 4X3TA 3RN5A 4RGOS 2MHVA 3U9SA 5IP7H 4BBRB 3DHQA 2A6EC 2MP1A 1DXMA 2CH4W 2FMCA 4YY3L 3T13A 4OX9L 1TT2A 4TSSA 1EFID 3TP7A 2ZM6Q 1NNXA 1NR4A 3M3YB 1II3A 1TKWB 2PI2E 1UE7A 3PO3H 4LW1A 1HNWQ 3GO5A 4CJ0B 1E7ZA 3DUZA 3GTLB 1N9WA 3FKIG 3CCLA 5ISRA 4L63B 2UUBQ 2AWOA 5BN4A 2EIFA 2R61A 1SR3A 5D65A 2K33A 1J8IA 3WOEA 4EQPA 1I6VC 2WB1E 1XNRQ 1F9SA 2G9HD 4DFAA 4DV3L 1EWIA 1WCMB 3CMAA 1IL8A 2F0MA 4G7OC 2DN8A 1D8LA 2L11A 3K0XA 4GNXA 1TS5A 5FJ8H 3WOFA 3S14B 1ZKOA 4XQJA 4ULLA 3EFXD 1Q1EA 4JI0L 1VMPA 2L1BA 5IT9E 3I4LA 1XYIA 1EIYB 3GTQH 1ICFB 3MFGA 4A4IA 4RAUC 3EN2A 4DV0Q 1XPUA 4JBJA 3BZCA 1XNQQ 1EQVA 1PH6A 1C7YA 4A3IG 2P5ZX 3PQIA 4OX9Q 1HZCA 2JYOA 2PMZE 2OTLA 1SMYC 1RJTA 2JEBI 1FL0A 3NWTA 4MIUA 2KA7A 5C6AA 4HJ5A 1GKHA 1Y1WB 1CSQA 1O7IA 3SGIA 3KLSX 3HG9A 4GOPA 3DEOA 4PNYA 4I7AA 2R92H 1PFBA 3NBHA 5JAVA 2AHOB 4K8JA 4IUVA 4J8QA 1AE3A 4FF3A 1HFNA 1B7YB 3KBXA 1VQAA 3HOYB 1SE2A 3QIAA 4XDXA 1SAPA 3K5MA 3GTJB 1Q12A 2KCNA 4RGNA 1LLRD 3OHXC 4A3EH 1SE3A 4I65A 1BQQT 3AU7A 3V96A 2R3ZA 1JE5A 1VMCA 1S5FD 5GAGC 3S1MB 4HIKA 2RHSB 1MD2D 2WAQE 2WP8J 3QOJA 4PMBA 4L6TB 5EBCA 3K81C 4UPAA 5M3FH 3P20A 1C0AA 4P75A 1AP0A 2QGQA 2RHQB 3UDXA 2NVYH 5D3DA 1VF5C 3FPPA 1XNQL 1U4MA 2F0UA 1GUNA 1NUCA 1I4HA 3KF6A 3MA2B 4A3MB 1ENCA 4ZUIA 1MSHA 4XYOA 4X65L 4EGVA 2F0WA 4GZYC 2F0EA 4HIDA 2OWOA 5GADC 2IHEA 1ESRA 4JW0A 5C3EB 3IAYA 3PUYA 5E7NA 1UE5A 4UP9A 3EA6A 5C4XH 2AMCB 1D7QA 2JP1A 1JT8A 4AYBG 1CHQD 4A3JH 1SYGA 3X3MA 1N33Q 1AEXA 1HA5A 4NMZA 2BH8A 4KLKA 3OW2A 3KF6B 1AZQA 1CFMA 2WB1B 4B9WA 4IPCA 1ENAA 2JJQA 1R4QB 1JQYD 1EY9A 3HOUG 4WRDA 1BKBA 1YBYA 1KTKA 1CZWA 1TXYA 3G71A 4DV6L 4LF6L 4JOIA 1YNJC 2Q8IB 1EYDA 1X56A 2RDFA 1KD1C 2XWBB 1U4PA 3D0FA 2G5DA 2K28A 3K5NA 4DV4Q 5IODA 2A6HD 1XMQL 1TU2B 1GUGA 4EQ5A 3KJOA 5IY0A 1EY4A 4FXDA 5IP9G 1L1OC 2SNSA 2OQKA 3CC4A 2GVAA 2KCTA 4A3DG 2VUMB 1KNEA 5I2XA 4IJLA 3VR4A 4C3IB 1EYAA 3PGZA 4A3KB 4NP5A 3FDTA 2MO1A 1JB7A 4BBRH 1VQIA 2VW9A 4HIMA 4KJOA 1EZ8A 4CDCC 1CSPA 4X66Q 2NVQH 3S2HB 2MPMA 4BBSH 1S40A 1K8AC 1CT1D 1YJWA 3LWEA 3QOLA 3GTKB 4DV3Q 1HTLD 4Y7NB 3Q8DA 3G48A 1GD7A 1E1OA 1Q82C 3CC2A 3G6JB 4RGMA 3S1NH 2RCNA 1HA6A 2JA5G 2JA8H 3KLRA 4L5QA 5L37A 3H3VC 2HD3A 1PZJD 2K75A 3A7LA 2ZTCA 1Y8PB 2KEEA 3J7ZC 2LXKA 3I3CA 3HKSA 4O2DA 2EPBA 1K9MC 4DV0L 1JOKA 3IFTA 1A3UA 4IN3A 2JA5H 2IJ0A 1VQNA 1CTMA 1D5ZC 2RVLA 3KDFA 1AN8A 1E2ZA 2KHIA 4JI0Q 4OO1H 2CW0C 2H4OA 3ULLA 1QVCA 1SMYD 1HNWL 4QUCA 2B63B 3RZDH 1EIFA 1N34L 1EQTA 1QNUA 2JQOA 1PRTC 3IFDA 1HZ9A 3EVQA 5BR8Q 3PMFA 3MXNA 2MO0A 1U0LA 1SDFA 1VQ9A 3E0JA 1YJNA 1IKLA 4DR1L 1WYDA 3P75A 3FVQA 4WFN3 5JVG3 1UEAB 3EROA 3NENA 4DAPA 1EYGA 1IYVA 1EZ6A 3GTPB 1EIGA 4JBWA 5M3FB 3GTPH 2FXQA 3K7AH 2B63G 4EX5A 4NDXA 2PQAB 4BBSB 5DEHA 5C3EG 2EYMA 2XRQD 4PMCA 1W6KA 5JEAJ 1SNDA 2ICEC 4Q5VA 3S15H 3CRKC 1LV9A 1TY0A 1VDZA 1YZ6A 4XQNA 2HUGA 2QEJC 4GN5A 1JOOA 2K01A 3GTGH 4HCEA 4Y52H 3KLSA 3PUVA 4GLVB 1TWAH 5E4XA 1OXSC 2BOSA 3R8BA 1HNZL 4IUTA 5C5LA 5M3MB 1VQ8A 2JA5B 4JBKA 1N32L 1JWSD 2F0TA 4A3MH 1WI5A 3TRZA 3T53B 2ASBA 2MJ8A 2CH4A 3I4MB 3DWAA 3QB3A 2JEAI 1Y8NB 2A74C 1LO5D 3MFYA 4YHHQ 3CXCA 1EWHA 3PIPA 3HOVG 4G4KA 5EAYA 4GLXA 4QMGA 3HOXB 5FLXL 3I72A 1S5CD 3CQZB 3HOYG 1LABA 1I94L 1TS2A 1SE8A 5LL6S 2CFMA 2KBNA 4F88A 1DOMA 2KEDA 3TN2A 4PZ8A 2BDOA 1SSOA 2Z0SA 3S15B 2CKZB 3UDFA 1VQGA 3Q24A 1VF7A 3M4YA 1EFWA 3A5UA 3T56B 1K28A 4IFDH 5IT9L 4POFA 3BVMA 2HHHL 1L0YB 3OIQA 1K3RA 1V1OA 1BNZA 1C4QA 2ID0A 4P74A 3C2PA 1L1OB 3I4NG 1VQ5A 5LMNQ 3VDYA 4A3IB 4C3IG 3J81E 1K8OA 3VR3A 4PZ7A 1STGA 3PF5A 4KK7A 3D3RA 1D1KA 3HOUB 1SJED 3BYTB 3S1MH 4DUYQ 2R93B 1H9SB 1SMXA 2C9OA 2AWNA 4DV1L 5IOCA 1C8CA 2JA6H 3NTKA 1HRJA 1RTNA 1NBWA 2KJXA 1KIXA 1CA5A 1SYCA 3H6MA 3CCVA 3W1GA 4HAEA 1U4LA 2C35B 2GA4B 3ER0A 4AQYL 1WTXA 2F0NA 2BA1A 4IFDG 3K0YA 1KL9A 2F0SA 1PH9A 2A5HA 1LUZA 3HOWB 3TQYA 2WB1G 4N8X1 1SEBD 1STHA 1IYUA 2VZAA 3N6RA 2H5XA 3NTHA 2PYKA 3S1NB 3EJIA 4PG3A 4IUQA 2A8VA 3A55A 1ZXTA 3HOZB 4FF4A 1EYCA 3J7YW 4UP8A 2FINB 4ALPA 4A3IH 5E3FA 3WWVA 4B08A 4L5RC 2OEOA 1LTSD 3I8ZA 2E2HH 1FNUA 2L5TA 2EY1A 2B2YC 2R93H 2PZTA 3PSIA 4HJ9A 1FYCA 3E0EA 1BCPD 3T1YQ 5LMNW 1A63A 4IUNA 3BDCA 1WOCA 2H1EA 5IYDH 4IOAA 1VQBA 3TSSA 1SNOA 4A76A 1WJJA 5ELFA 4ZYSA 4X62Q 4M1UB 2RDGA 4XT3B 4KHZA 4P73A 2A73B 3S1RH 1ICWA 5EKKA 1MI2A 3CCJA 5J39A 1QE6A 2ENBA 4RWSC 1TR5A 1SYDA 2VQFQ 1CZGA 4R4OA 4EQNA 3H3VI 4HJ8A 4A3EG 3F2BA 1TS4A 4LF7L 1K83B 3QG1A 5CV8A 3TP6A 1WTWA 4KN4C 2JA7H 4TVAB 4DV1Q 5A2QL 3AFQA 3LWUA 3HGBA 2KCCA 1PTOB 4X64Q 5D3IB 1EOVA 1Z9FA 5M5WH 1PH2A 1SRUA 4OWXB 1AZPA 2IT1A 1UE6A 1KDCA 3A56A 2PCFB 1O7ZA 2NN6G 3K80C 4P71A 4H44C 1WTVA 4X66L 3S9WA 5AJ3Q 5M5YB 3R93A 3L9AX 4QQBX 1IKMA 1PH1A 3CW2C 1S72A 1B9MA 1HR0Q 2YTXA 2B29A 2YYZA 2D9UA 2PZUA 3FRPB 1UWVA 1WCMG 4MN3A 2N88A 3SEBA 1UNSA 3H15A 3I91A 5TSSA 3J80E 1A8VA 3IKJA 3U9OA 1STBA 3TBIB 4V190 1SYEA 2K50A 2PMZB 3U4ZA 2V1CC 3PUZA 4LF6Q 3K5LA 4OWWB 2Z6KA 4J1MA 1MSGA 3T1YL 3FKIB 3KOJA 2FMMA 2EXDA 1XNRL 1NJIC 2RSNA 3L7ZC 2E5LL 2J0TD 4LUOA 4HJAA 1EU4A 4LWCA 5ELNA 1A2TA 4YY3Q 1N36Q 2ES2A 3HOXH 2NTSA 1L0XB 4C2MH 1QILA 4KD3A 2PQAA 3D8GA 3NQTA 2F0QA 4NW2A 2K04A 1BCPB 3DEPA 3D4WA 5M3FG 1YHAA 3Q0AA 2LSSA 2A19A 1VQJA 2QILA 3C46A 5EPKA 1JOQA 2B2UA 4LF9Q 2X6LA 3PO2B 1FD7D 1DGSA 1GHJA 2F52A 2BE5C 5CV7A 1Q86C 1BXTA 2Z6BA 2O5IC 1Y1VG 5G3LD 1ZYRD 2K05A 4H0LC 4FYDA 2RA4A 4IPGA 5ELBA 4LFAL 2NVTH 1QB5D 4AQYQ 3F2DA 4JV5L 4DR2L 4K5WA 1HR0W 3URYA 1DYQA 4HMIA 3HOWH 3OYYA 5M5WB 4JK1C 1H9MA 4X3KA 1BR9A 1X3PA 1DM0B 1HQMC 2KECA 3ULPA 2L55A 3VYUA 4OL7A 1TWHH 4LF4L 2JA6G 4ILWA 1QOHA 1N32Q 3T51B 3J7AV 4JI1L 1TQOA 2E8GA 2DY8A 3I2ZA 2UUCQ 3VR5A 4LUVA 4C3HG 3J81L 5M9OA 2AQ1B 2E2IB 1GHKA 1M8AA 1A15A 4F87A 4RKBA 4LAAA 1SXTA 2EY6A 4DR6Q 5IGBA 2XRSD 2DNCA 3K7UC 1I4GA 1HUNA 1V1PA 5KNBA 1QUQB 2R7DA 3BDOA 2ZJPA 1VQPA 3C1FA 4LFBL 4IFDI 5CV5A 2ZJQA 4NXML 4JBMA 2B63H 1TWFB 1UAPA 1GUWA 4EQOA 4WJ3M 2F3IA 1WTPA 2GVBA 4QF4A 2EZVA 2EVBA 5FO9B 4FF1A 3LNNA 2XTIA 4DR5Q 1VQEA 4JI2L 5CYUA 2NVXB 2IHFA 4IURA 4GOPB 4IUUA 1BCPC 3PIP3 1PTOH 1FNVA 5DNFA 4FO2A 1GUSA 3DXJC 1KLUD 2B2YA 2FFKB 3K7AB 2R92B 4EVOA 3M4OH 5FO8B 2MFIA 4A3JB 4TQUS 3LGJA 1PFSA 3OWEB 1XTCD 3V05A 3SK4A 2A68D 5CBEE 4XIGS 3RZOH 1YNND 1Y69U 1S5ED 4KN7C 4DV4L 1O7LA 5KNCA 4MTNA 4AYBE 4GS3A 1EY7A 3AB9A 1RIPA 1G291 4R1JA 3GP7A 2NVYB 4R8NA 5T1GA 3F1ZA 1H9KA 1JR0D 3S2HH 4X6AH 1JB3A 4DR3Q 1X9NA 3F2CA 3TZDA 1G6ZA 3I55A 1I5FA 1IBMQ 4CDEC 4AYBB 1EY8A 3ERSX 4DXFA 3KF8A 2KQ3A 2EYJA 2VQEQ 1FGUA 1ESFA 3KUPA 3MVVA 4N9PA 5GROA 2VB3X 5KIXA 4A3FB 5IE8A 1TWFH 4P2CB 4PV1C 4MNOA 5JJKA 1ILPA 4ZRZA 5JJZA 5J22A 1ZEQX 1R9TH 3M4PA 1NCVA 3RLFA 3S16H 1C9OA 2RSOA 4J6HA 4OWTB 4BS9A 5FLXc 4RG1A 4BY7B 2MUYA 3ZYYX 5I9OA 3W5OA 4ZQ3A 3M3YH 4QCLA 2Q2TA 3AMUA 1ET9A 1L1OA 3MAQA 2B3GA 1M1KC 1JWMD 1PA6A 4GN4B 1WFQA 3HZXA 2E74C 4OONA 2CQOA 3K5OA 3GTJH 4K2KA 4CDFC 1QCBD 3SHLA 4I7ZC 2F4VQ 3LX0A 1HQRD 2SDFA 3UE0A 2OT2A 3X3NA 2OXPA 1RDPD 4K14A 4M8AA 4LNQA 5C4XB 1AE2A 1WTOA 2VUMH 1F77A 5I4DA 3J81c 4DV6Q 4F8MA 1WTRA 1X3EA 1B3AA 1X32A 5ELDA 1RCVD 5HY6A 5LL6X 3GTKH 3VYSA 2I0QA 2NZHA 2O5JC 2FJ2A 3S2DB 4ABNA 2NZ1D 3A8JE 4LF5Q 4PQXA 3W2DA 3PO2H 3L2PA 4DR6L 1EWCA 4A93H 4DNIA 5IYCH 1F2ZA 4H13C 3OMGA 3KLWA 3GTMB 4DV2L 5CV4A 1Q8KA 1O7YA 4KKSA 1EU3A 5H1SE 3S1RB 4B3MQ 3D4RA 3BDLA 1A0IA 3GTQB 3SE0A 2Q8RE 1NR2A 3H94A 1YNXA 2HIVA 4YWKA 1BVSA 1JC7A 5C4JB 1H95A 4CKCA 1B8AA 5NUCA 5C3WA 1KAWA 3I73A 4ZAIA 4DR7Q 2EXZA 3H0GH 4BY7G 2F3WA 4RH6A 2N8NA 4FDBA 3MEFA 2QW7A 1E3PA 4K5XA 4CBVA 2EY5A 4PZ6A 2LXJA 2UXBL 4GKKQ 4FXGC 1B53A 4JI6Q 5FK9C 4DUYL 5CC4A 4A3FG 2E76C 3FEWX 1K8GA 1HTPA 2K5WA 3BJUA 3T4AC 2A1AA 1NE3A 2D0PA 1GOZA 1Y14B 1MKHA 4LMQD 5C3EH 1TWHB 3K59A 1N36L 1MBYA 3KF8B 1STAA 3EQLC 1FJGQ 1PZID 2RKSA 5IGDA 2E5LQ 4AH6A 1MHWC 3FP9A 2IWHA 3SXHA 4JI3Q 3HOZH 4KY7A 5BN3A 4JI7Q 1LTTD 2F0HA 1PHJA 4A93B 1T9HA 1M4VA 1EQQA 2UXCL 5C44B 1MGSA 4JI4L 1VQ7A 4OEMB 1I3QB 1SROA 3ND8A 3RD4A 5AJ3L 3CF5A 2PO4A 3W3AA 1E1TA 4XQQA 4KD4A 4R4IA 1XMOL 4Y7NH 4DR7L 1KXLA 4H02A 1T5XD 4TKOB 4LF7Q 2JE6I 1P16A 5IT9c 4YCVA 4KKUA 1PH4A 3D6CA 1PLFA 1HZBA 2DUDA 2NBFA 4DV2Q 4A3JG 1KNAA 5CV9A 1FR3A 3NQIA 5K36H 5E1FA 3V2TA 4C1NK 1K73C 2RBMA 4C2MB 4IO9A 4IFDJ 1TWCH 3IRBA 1L2FA 5J1ZA 2VL6A 4IJHA 3OTOQ 3TS0A 2VXWA 1I50B 4QIWB 4JYAL 4HN7A 4L5TA 2F0KA 2EJFC 4C3HB 3SVMA 1SYFA 3A8IE 3MC0B 1XTDA 3AYHB 2NVQB 1Q90A 3NBHB 3BVZA 1A62A 2B2TC 2OCEA 4DA2A 3OOCA 4OO1G 1C48A 1YNNC 4CHTB 1P8LA 4ME5A 5M3MG 4Z9CB 4OELB 5LMUL 3MWYW 4IPHA 2F0OA 1G8ZD 2F0JA 2YU9H 4LF8L 3NSWA 1X55A 1HHVA 5JJIA 1W3SA 1IBKL 2VB2X 2L0CA 4ME3A 3CCMA 2O2LD 4JI5Q 2WAQG 5F2DA 4H7BA 1PH7A 2ZM6L 3PCOB 1ZYRC 4XTCS 1Y1VB 4R4CA 2QF7A 3ZJYC 4LF9L 2KENA 3F8TA 4K6DA 4DPGA 2B2TA 5GAEC 1JICA 2X6GA 2VS1A 2PI2A 3A74A 1KRTA 1LT3D 1Q8IA 1PMRA 3BS1A 5I2YA 5DM63 2QA4A 4TRDA 4B9XA 4JV5Q 3R3OA 2K5HA 1CQFA 1RHPA 1BO0A 1CKNA 2UXDL 3TP8A 5C0XJ 3NBIA 2JA8B 1PH3A 1YVCA 4RMFA 4X65Q 4UY8C 1UEBA 3B6YA 4OHJA 2IX1A 1CA6A 1IYJB 2HIXA 4DXGA 5I6YA 4KY5A 1LM0A 4NKLA 3J7A5 2D2CC 4JI3L 5HURA 1PFNA 4GOPC 4K2LA 5EGTA 1VCIA 5KNDA 4IALA 4KHVA 5FKAC 3TZUA 4LFCL 4A3GH 2XGTA 5C4HA 4MZ9A 4POGA 4A75A 1AW7A 4QB4A 1GJXA 2ATWA 4A3BH 1F9QA 3E3XA 1V43A 2NYZD 3RZDB 1PZKD 5C4JH 3CPWA 4C3IH 3DWPA 1WVLA 2UU9Q 3J81i 4LUZA 2F3VA 3ERQA 3KBGA 3C1EA 1LTID 1OXVA 3I90A 3KK7A 3HKZB 4ZLTF 4B3SL 4G7ZC 4UHVA 2HCIA 4B3ML 3PV0A 4LJZC 1EUJA 3NE5B 3CQZH 1R9TB 1B70B 1HZAA 2A6ED 3RUZA 4QJFA 4ZKBB 5JPMC 3PO3G 4C3JH 2KHJA 1CI3M 3CC7A 4DV5Q 1WTQA 1A2UA 1X3QA 3OIPA 3UDIA 1U4RA 3H3VH 1CUKA 2E2JB 2E2JH 1Y8OB 4CKEA 4WORA 3HKZE 3JAMi 4BXXG 1B9NA 4KKTA 4JI4Q 2B2VC 2UU9L 2YTVA 2X69A 3CMEA 2ICIA 4KTAA 1OXTA 3RLNA 2NVTB 1SYBA 2K6AA 3G7LA 2AQ3B 1PVOA 1IBLQ 1G2TA 1DOKA 4DNTB 4KHPL 2NB0A 4U673 2I46A 4BA1I 2LKVA 3HP3A 2K52A 2K7VA 2ZT9C 2EJMA 3HOUH 4HSPA 1XXGA 5IYCG 5CBAE 2UUCL 1PRTF 5EKLA 3GDEA 1ONLA 1K0RA 4RHSA 4N9TA 1EIHA 2HT1A 3FPUB 1IXRA 4DF7A 2BDNA 2UXBQ 2F0PA 1JJGA 3PF4A 4U68A 4G7HC 3TEHB 2UUBL 1EY5A 2NVXH 2KHSA 3D31A 1ILQA 1GVPA 4A3GB 2SOBA 4A3FH 3VA5A 3H0GB 4UAIA 1ET6A 2R7ZG 1LYLA 5EPLA 3UDGA 1J5EQ 1N34Q 4DUZL 2QCPX 1VQCA 1QJOA 1QG7A 2DJFC 1SE4A 1S4ZA 2IX3A 1WTHA 1BF4A 4KJNA 3CCSA 4JC0A 2Z9HA 5M3MH 4C56C 3M7GA 1YJ9A 1A6XA 2HQLA 4E6IA 3D6WA 1GM5A 3JAML 1XX8A 3S1QH 2UXDQ 3C3LA 1PH5A 4UP7A 4JI5L 1DONA 2LFNA 4RGTA 2K4KA 3GD7A 3PUWA 4BA2I 1LT4D 1N8RC 4YWLA 1Y1WH 1LT6D 3BG3A 5G3LF 2L4NA 2ALYB 4IUPA 2BH2A 1TWAB 2EY2A 2R93G 1UE1A 3K58A 2R7ZH 1EQRA 1ENFA 2I07B 5IGEA 3G6EA 3NELA 2ZXOA 1EOTA 2K5NA 2A68C 1IZ6A 5LMNL 4DGZA 1IBKQ 2IPKD 5IP7G 1JORA 1SJHD 3I4NB 3J80c 1QZGA 3OTOL 1EEFD 5C0XI 2WIIB 2LMCB 3MXPA 3SK8A 2K03A 5FLMG 4ZK9B 1IL2A 1BOSA 3GTOH 1O80A 1YIJA 1KDAA 1NMFA 2CWAA 1VQ6A 4FVMA 3JAMc 5I9PA 3J7AF 3HOYH 1Y1WG 1YHQA 1V8QA 1YEZA 1VQFA 1VQMA 1I50H 4XYQA 3NP8A 2HQEA 3HRZC 3RR5A 2EQSA 3NWSA 2TSSA 3Q6SA 2XNAC 4QUFA 4DR5L 2Z8LA 3HOXG 2E2IH 4A3EB 5DLQE 5ELOA 3GQBA 1PDQA 3T1HL 3CCRA 1G51A 1VS0A 2FHTA 2OQ0A 1H9JA 3NEMA 1RF2D 3PO3B 4DR4L 1X6OA 4BXXH 2WV6D 4AIMA 1NAPA 5IYBH 4B3TL 1T5EA 1KHIA 2PW5A 4YCWA 3FKIH 2NTTA 4HIOA 2M00A 2LS01 2CVRA 2QKIC 1GUOA 2B39A 2UUAL 3DWQA 2HDMA 1IBML 1D2BA 1HNXQ 1S3OA 1VQKA 2EDGA 3HOVB 4HMJA 3JC66 4YIJA 3CCEA 2F4IA 4YHHL 2K14A 3QJYA 1S5BD 1VQ4A 4DK3C 2B2UC 1WD0A 3HFZB 2N55A 5K5PA 1PYBA 1K8MA 2YU9B 2JK8A 3HS0C 1I6HH 1D5XC 3RMHA 1U9RA 1I4QA 1XMQQ 4IQZA 1LTLA 1B3QA 1VQLA 3OMCA 4JI8L 2HCCA 2BE5D 5E4WC 2JXMB 3RNUA 3AQQA 4DU9A 4BBSG 2XVSA 3D4DA 1J9OA 2N3SA 3HOZG 2NN6H 1QZHA 2D5DA 4BY7H 3MEHA 1TY2A 1FNWA 4CJ2C 5EQ0A 3MXNB 4A3GG 2WKDA 2I5MX 4HJ7A 4ZCKA 1H9SA 1HFGA 2E2HB 3HOWG 5COYA 4A3DH 4JI2Q 2RDHA 5JPNC 1SNMA 3AFPA 1SNCA 2EYLA 3FHWA 5KYLA 2HDLA 2Q2UA 4A3LG 1L0WA
chains in the Genus database with same CATH topology
4F7XA 2V4DA 1HXYD 5C5MA 4KV6A 1LACA 4LK1C 5CGKA 2B2VA 3K57A 4HTHA 4DK0A 2LY7A 3P7JA 1RODA 1D5MC 1G2SA 3O13A 5EKIA 3Q23A 3OWFA 5FO7B 1A3TA 5ELEA 4C1NI 4BY1B 4RA8A 3Q22A 3R2TA 2M2LA 1Z6HA 1EY6A 1TVXA 1D1IA 1BCPF 1TS3A 3BYYB 2L12A 5CMDA 1GUTA 4FP5D 3BZDB 1B2TA 1PTOC 4ODGA 3FMCA 5FLXE 1WD1A 4L8JA 3PIO3 4ZKCB 3OSOA 1O78A 1LTAD 2EOTA 1HPCA 3DM1A 3UI2A 4K5VA 3ND9A 2AUKA 4HSVA 1LTRD 5FOBB 1CQVA 2PZWA 4RCNA 1STNA 4DNRB 1B1ZA 3OW7A 5T1IA 4XXEA 4RFBA 1KABA 2BA0A 1S5DD 1E0BA 1F2MA 3T16A 3I70A 2RQXA 5CR3A 1B44D 4CJ1B 5EPJA 5JVH3 1DJRD 1F2YA 1QWYA 2XWJB 2D62A 2F0LA 4DN4M 2K32A 3F2UA 5KRUA 2IW3A 1KDBA 1KAAA 1RD9D 1F9RA 4K8IA 2EYHA 2A69C 3E5SA 2WKCA 2JSOA 4S3SA 3L3OC 4DAVA 3VA7A 1R4PB 2XSCA 3A8KE 3NXWA 1KLGD 5JOBA 1XWEA 4X3UA 1Z7TA 2F1MA 1SBBB 1V1PB 2KOLA 2DY7A 2KUMA 2M9VA 2G9DA 2WAQB 2A69D 1FGBD 5D14A 1SNQA 1STYA 2R6GA 2C5CA 3PUXA 1GXDC 2Z4IA 2IX0A 3NTIA 3VYTA 1LT5D 2KVMA 5C3XA 2CHBD 2EJGC 5C0XG 2DNEA 1BDOA 1EY0A 1SNPA 4RHRA 4X3SA 1PFMA 2F0IA 5DM73 4HR7B 3GTOB 2O4XA 3ITPA 3GV3A 3E6ZX 3CU7A 3CHBD 4G57A 2EYPA 2F0GA 4A3DB 3HEJA 4UDUC 2ZXRA 4HEDA 1TWGB 3NHHA 4OO1I 1PRTB 2B8FA 3WDNA 1TIID 5JEAH 1LTGD 1BBXC 3GTGB 1E2WA 5HGTA 1STEA 1I4RA 2NWGA 1Q3LA 5KGUA 1IW7D 4KI0A 4WJWA 2TMPA 2K1BA 3VR6A 4V0BA 2B2WC 3BVGA 3CKIB 2L9HA 1RTOA 2J4XA 1RKNA 2NN6I 1G91A 1OXXK 5ELCA 2E2DC 5BN5A 5IIFA 4XT1B 1PTOD 1IW7C 4FNFA 2WACA 2PW7A 3ONAB 5C0XH 3R2IA 1AFPA 4KMUC 1EL0A 3SK6A 2R7ZB 1QNKA 5CORA 1EEID 3OPOA 2EYFA 4DK1A 4R8IA 1E2VA 1HCZA 2B8GA 5A2QE 2K5QA 1DCZA 1NSNS 3M7NA 2EYOA 1B50A 3S16B 1TWCB 1SFOB 2CW0D 1H9RA 3MTSA 2SEBD 1OXUA 2SNMA 2CQAA 3DMUA 1I4PA 3S1QB 5IGCA 1PRTD 5C4ZA 3SK5A 3TP5A 4ZUJA 2F03A 1CK1A 2QDBA 1I4XA 4DAYA 2PQEA 4C3JB 2XIWA 4OIKA 4BWGB 2PPBC 4IZ8A 2Q8TA 3MXGA 1UUPA 4FF2A 3TMEA 2XN9C 3N52A 4O1NA 2B2WA 3IL8A 1D6EC 1LTBD 1DOLA 3MHBA 4MHEA 2PNRC 5LHY1 3K6OA 3A54A 2BCOA 2Z1CA 1F2LA 4Q0FA 1JWUD 3NUCA 2E75C 5KEEA 1F9PA 5KYIA 3J80L 2J7ZA 2Z4HA 2ZXPA 1PTOF 1Z47A 5AFWA 5EBDA 2WINB 1W6JA 5EJWA 3MZ5A 3VR2A 4FXKC 1Q1BA 1PYWD 4CKBA 5JEAG 4R9WA 1CM9A 1B4OA 1I6HB 4RKLA 5M5XB 3QO2A 1BUVT 2EE1A 2OF1A 1DD2A 2Y0SB 3SDZA 4A3BB 2IL8A 2VNUD 3S17B 3JAME 2JA7B 1HUMA 5IGFA 4PMWA 3TDQA 2MGSA 4HCSA 1OO9B 3NK9A 1ML0D 5I6WA 3P1HA 2F0VA 4C3JG 3MXUA 5CV6A 4OGQC 1JE4A 2NUCA 3QWNA 5A35A 1DZ1A 5IGGA 3NPPA 2F0FA 1IHZA 1JCKB 3H91A 1A3VA 2AUJD 4KY6A 2AQ2B 2JA6B 4K6LA 3A7AB 3M85A 4O42A 3VYRA 3H09A 1YNJD 1PXUA 1CHPD 3SR1A 4RCOA 3RZOB 4CGYB 4ID6A 2F0DA 5DAUA 3CRLC 2A6HC 3M4OB 5K36G 4OIJA 3GV6A 2K5DA 4X3TA 4RGOS 2MHVA 3U9SA 4BBRB 3DHQA 2A6EC 2MP1A 1DXMA 2FMCA 3T13A 1TT2A 4TSSA 1EFID 3TP7A 1NR4A 3M3YB 1II3A 1TKWB 3GO5A 4CJ0B 3DUZA 3GTLB 5ISRA 4L63B 2AWOA 5BN4A 2R61A 5D65A 2K33A 1J8IA 3WOEA 4EQPA 1I6VC 1F9SA 2G9HD 4DFAA 1WCMB 4G7OC 1IL8A 2F0MA 2DN8A 2L11A 1TS5A 3WOFA 3S14B 1ZKOA 4XQJA 4ULLA 3EFXD 1Q1EA 1VMPA 2L1BA 5IT9E 3I4LA 1XYIA 3MFGA 4RAUC 1EQVA 2JYOA 1SMYC 1RJTA 2JEBI 3NWTA 4MIUA 2KA7A 5C6AA 1Y1WB 3KLSX 3HG9A 3DEOA 4PNYA 1PFBA 3NBHA 5JAVA 4K8JA 4IUVA 4J8QA 4FF3A 1HFNA 3KBXA 3HOYB 1SE2A 3QIAA 4XDXA 1SAPA 3K5MA 3GTJB 1Q12A 2KCNA 4RGNA 1LLRD 3OHXC 1SE3A 4I65A 1BQQT 3AU7A 3V96A 2R3ZA 1VMCA 1S5FD 3S1MB 1MD2D 4PMBA 2WP8J 3QOJA 4L6TB 5EBCA 3P20A 1AP0A 5D3DA 1VF5C 3FPPA 1U4MA 2F0UA 1GUNA 1NUCA 1I4HA 3MA2B 4A3MB 1ENCA 4ZUIA 1MSHA 4XYOA 4EGVA 2F0WA 4GZYC 2F0EA 3IAYA 1ESRA 5C3EB 3PUYA 3EA6A 2JP1A 1CHQD 1SYGA 3X3MA 1AEXA 1HA5A 4NMZA 1AZQA 1CFMA 2WB1B 4B9WA 1ENAA 1R4QB 1JQYD 1EY9A 4WRDA 1KTKA 1CZWA 1YNJC 2Q8IB 1EYDA 2RDFA 2XWBB 1U4PA 2K28A 3K5NA 5IODA 2A6HD 1TU2B 1GUGA 1EY4A 4FXDA 2SNSA 2VUMB 1KNEA 5I2XA 3VR4A 4C3IB 1EYAA 4A3KB 4NP5A 3FDTA 4KJOA 1EZ8A 3S2HB 2MPMA 1CT1D 3LWEA 3QOLA 1HTLD 4Y7NB 3G6JB 4RGMA 1HA6A 3KLRA 3H3VC 1PZJD 3A7LA 1Y8PB 2KEEA 3I3CA 2EPBA 1JOKA 3IFTA 1A3UA 4IN3A 2IJ0A 1CTMA 1D5ZC 2RVLA 1AN8A 1E2ZA 4OO1H 2CW0C 2H4OA 1SMYD 4QUCA 2B63B 1EQTA 1QNUA 1PRTC 3IFDA 3EVQA 3PMFA 3MXNA 1SDFA 3E0JA 1IKLA 3P75A 3FVQA 4WFN3 5JVG3 1UEAB 3EROA 4DAPA 1IYVA 1EZ6A 3GTPB 1EIGA 4JBWA 5M3FB 4NDXA 4BBSB 5DEHA 2EYMA 2XRQD 4PMCA 1W6KA 5JEAJ 1SNDA 2ICEC 4Q5VA 3CRKC 1LV9A 1TY0A 1VDZA 4XQNA 2HUGA 2QEJC 1JOOA 2K01A 4HCEA 3KLSA 3PUVA 5E4XA 1OXSC 2BOSA 3R8BA 4IUTA 5C5LA 5M3MB 2JA5B 1JWSD 2F0TA 3T53B 2MJ8A 3I4MB 3DWAA 3QB3A 2JEAI 1Y8NB 2A74C 1LO5D 3MFYA 1EWHA 4G4KA 4QMGA 3HOXB 5FLXL 3I72A 1S5CD 3CQZB 1LABA 1TS2A 5LL6S 4F88A 1DOMA 2KEDA 3TN2A 2BDOA 1SSOA 3S15B 3Q24A 1VF7A 3M4YA 3T56B 4IFDH 5IT9L 3BVMA 1L0YB 3OIQA 1V1OA 1BNZA 1C4QA 2ID0A 3C2PA 4A3IB 4C3IG 3J81E 1K8OA 3VR3A 1STGA 4KK7A 3D3RA 1D1KA 3HOUB 1SJED 3BYTB 2R93B 1H9SB 2C9OA 2AWNA 5IOCA 1C8CA 3NTKA 1HRJA 1RTNA 2KJXA 1CA5A 1SYCA 3H6MA 1WTXA 4HAEA 1U4LA 2GA4B 4IFDG 2F0NA 2BA1A 3K0YA 2F0SA 2A5HA 3HOWB 1SEBD 1STHA 1IYUA 3N6RA 3NTHA 2PYKA 3S1NB 3EJIA 4IUQA 3A55A 1ZXTA 3HOZB 4FF4A 1EYCA 3J7YW 2FINB 5E3FA 4B08A 2OEOA 1LTSD 3I8ZA 1FNUA 2L5TA 2EY1A 2B2YC 2PZTA 1FYCA 1BCPD 4IUNA 3BDCA 2H1EA 3TSSA 1SNOA 5ELFA 4ZYSA 4M1UB 2RDGA 4XT3B 4KHZA 2A73B 1ICWA 5EKKA 1MI2A 5J39A 1QE6A 2ENBA 4RWSC 1TR5A 1SYDA 1CZGA 4EQNA 1TS4A 1K83B 3QG1A 5CV8A 3TP6A 1WTWA 4KN4C 5A2QL 3LWUA 3HGBA 2KCCA 1PTOB 5D3IB 1AZPA 2IT1A 1KDCA 3A56A 2PCFB 1O7ZA 2NN6G 4H44C 1WTVA 3S9WA 5M5YB 3R93A 3L9AX 1IKMA 1B9MA 2YYZA 2D9UA 2PZUA 3FRPB 4MN3A 2N88A 3SEBA 1UNSA 3I91A 5TSSA 3J80E 3IKJA 3U9OA 1STBA 3TBIB 4V190 1SYEA 2PMZB 3PUZA 3K5LA 4J1MA 1MSGA 3FKIB 2FMMA 2RSNA 3L7ZC 2J0TD 1EU4A 1A2TA 2NTSA 1L0XB 1QILA 4KD3A 3D8GA 3NQTA 2F0QA 4NW2A 2K04A 1BCPB 3DEPA 3D4WA 3Q0AA 2QILA 3C46A 5EPKA 1JOQA 2B2UA 2X6LA 3PO2B 1FD7D 1GHJA 5CV7A 2BE5C 1BXTA 2O5IC 5G3LD 1ZYRD 2K05A 4H0LC 4FYDA 2RA4A 5ELBA 1QB5D 4K5WA 3URYA 1DYQA 4HMIA 5M5WB 4JK1C 1H9MA 4X3KA 1BR9A 1X3PA 1DM0B 1HQMC 2KECA 2L55A 3VYUA 4OL7A 4ILWA 1QOHA 3T51B 3J7AV 1TQOA 2DY8A 3VR5A 4C3HG 3J81L 5M9OA 2AQ1B 2E2IB 1GHKA 1M8AA 1A15A 4F87A 4RKBA 4LAAA 1SXTA 2EY6A 5IGBA 2XRSD 2DNCA 1I4GA 1HUNA 1V1PA 5KNBA 3BDOA 3C1FA 4IFDI 5CV5A 1TWFB 1UAPA 1GUWA 4EQOA 1WTPA 4QF4A 2EZVA 2EVBA 5FO9B 4FF1A 3LNNA 5CYUA 2NVXB 4IURA 4IUUA 1BCPC 3PIP3 1PTOH 1FNVA 5DNFA 4FO2A 1GUSA 3DXJC 1KLUD 2B2YA 2FFKB 3K7AB 2R92B 4EVOA 5FO8B 4A3JB 4TQUS 3OWEB 1XTCD 3V05A 3SK4A 2A68D 5CBEE 4XIGS 1YNND 1Y69U 1S5ED 4KN7C 1O7LA 5KNCA 1EY7A 3AB9A 1G291 3GP7A 2NVYB 4R8NA 5T1GA 1H9KA 1JR0D 1JB3A 3TZDA 1G6ZA 4AYBB 1EY8A 4DXFA 3KF8A 2KQ3A 2EYJA 1ESFA 3KUPA 3MVVA 4N9PA 2VB3X 5KIXA 4A3FB 4P2CB 4PV1C 1ILPA 4ZRZA 5JJZA 5J22A 1ZEQX 1NCVA 3RLFA 2RSOA 4J6HA 4BS9A 4BY7B 2MUYA 3ZYYX 5I9OA 4ZQ3A 4QCLA 3AMUA 1ET9A 3MAQA 1JWMD 3HZXA 2E74C 3K5OA 4K2KA 1QCBD 3SHLA 4I7ZC 3LX0A 1HQRD 2SDFA 2OT2A 3X3NA 2OXPA 1RDPD 4K14A 4M8AA 5C4XB 1WTOA 1F77A 5I4DA 4F8MA 1WTRA 1B3AA 1X32A 5ELDA 1RCVD 5LL6X 3VYSA 2O5JC 2FJ2A 3S2DB 4ABNA 2NZ1D 3A8JE 4PQXA 3W2DA 1EWCA 1F2ZA 4H13C 3OMGA 3GTMB 5CV4A 1O7YA 4KKSA 1EU3A 3S1RB 3D4RA 3BDLA 3GTQB 3SE0A 2Q8RE 1NR2A 3H94A 1JC7A 5C4JB 4CKCA 5NUCA 5C3WA 3I73A 4ZAIA 2EXZA 2F3WA 4RH6A 4K5XA 4CBVA 2EY5A 4FXGC 1B53A 5FK9C 5CC4A 2E76C 3FEWX 1HTPA 2K5WA 3T4AC 1GOZA 4LMQD 1TWHB 3K59A 1MBYA 1STAA 3EQLC 1PZID 2RKSA 5IGDA 2IWHA 3SXHA 4KY7A 5BN3A 1LTTD 2F0HA 4A93B 1M4VA 5C44B 1MGSA 1I3QB 3ND8A 3RD4A 3GTKB 2PO4A 3W3AA 4XQQA 4KD4A 1T5XD 4TKOB 2JE6I 4KKUA 3D6CA 1PLFA 2NBFA 1KNAA 5CV9A 1FR3A 3NQIA 5K36H 5E1FA 3V2TA 4C1NK 2RBMA 4C2MB 4IFDJ 5J1ZA 2VXWA 1I50B 4QIWB 4HN7A 2F0KA 2EJFC 4C3HB 3SVMA 1SYFA 3A8IE 3MC0B 2NVQB 1Q90A 3BVZA 2B2TC 4DA2A 3OOCA 4OO1G 1C48A 1YNNC 4CHTB 4ME5A 4Z9CB 3MWYW 2F0OA 1G8ZD 2F0JA 3NSWA 1HHVA 2VB2X 2L0CA 2O2LD 5F2DA 4H7BA 1ZYRC 4XTCS 1Y1VB 2QF7A 4K6DA 2B2TA 1JICA 2X6GA 1LT3D 1Q8IA 1PMRA 3BS1A 5I2YA 5DM63 4TRDA 4B9XA 3R3OA 1CQFA 1RHPA 1BO0A 3TP8A 5C0XJ 3NBIA 2JA8B 4OHJA 2IX1A 1CA6A 4DXGA 5I6YA 4KY5A 4NKLA 2D2CC 5HURA 1PFNA 4K2LA 5EGTA 1VCIA 5KNDA 4IALA 4KHVA 5FKAC 3TZUA 5C4HA 1AW7A 4QB4A 1GJXA 1F9QA 1V43A 2NYZD 3RZDB 1PZKD 3DWPA 1WVLA 2F3VA 3ERQA 3KBGA 3C1EA 1LTID 1OXVA 3I90A 3KK7A 3HKZB 4ZLTF 4G7ZC 2HCIA 3PV0A 4LJZC 3NE5B 1R9TB 2A6ED 3RUZA 4ZKBB 5JPMC 1CI3M 1WTQA 1A2UA 1X3QA 3OIPA 1U4RA 2E2JB 1Y8OB 4CKEA 4WORA 1B9NA 4KKTA 2B2VC 2X69A 2ICIA 4KTAA 1OXTA 2NVTB 1SYBA 2K6AA 3G7LA 2AQ3B 1G2TA 1DOKA 4DNTB 2NB0A 4U673 2I46A 4BA1I 2LKVA 3HP3A 2K7VA 2ZT9C 2EJMA 4HSPA 1XXGA 5CBAE 1PRTF 5EKLA 1ONLA 4RHSA 4N9TA 1EIHA 3FPUB 4DF7A 2BDNA 2F0PA 4U68A 4G7HC 1EY5A 2KHSA 3D31A 1ILQA 4A3GB 2SOBA 3VA5A 3H0GB 4UAIA 1ET6A 5EPLA 2QCPX 1QJOA 1QG7A 1SE4A 1S4ZA 2IX3A 1BF4A 4KJNA 4C56C 3M7GA 1A6XA 4E6IA 3D6WA 3JAML 1XX8A 3C3LA 1DONA 2LFNA 4RGTA 3GD7A 3PUWA 4BA2I 1LT4D 1LT6D 3BG3A 5G3LF 2L4NA 4IUPA 1TWAB 2EY2A 3K58A 1ENFA 2I07B 5IGEA 2ZXOA 1EOTA 2A68C 4DGZA 2IPKD 1JORA 1SJHD 3I4NB 1EEFD 5C0XI 2WIIB 2LMCB 3MXPA 3SK8A 2K03A 4ZK9B 1BOSA 1O80A 1KDAA 4FVMA 5I9PA 3J7AF 1V8QA 4XYQA 3NP8A 2HQEA 3HRZC 3NWSA 2TSSA 3Q6SA 2XNAC 4QUFA 2Z8LA 4A3EB 3GQBA 1PDQA 2FHTA 1H9JA 1RF2D 3PO3B 2WV6D 1NAPA 1T5EA 2PW5A 2NTTA 2M00A 2LS01 2CVRA 2QKIC 1GUOA 2B39A 3DWQA 2HDMA 1D2BA 2EDGA 3HOVB 4HMJA 4YIJA 2F4IA 3QJYA 1S5BD 2B2UC 1WD0A 5K5PA 2N55A 2YU9B 1K8MA 3HS0C 1D5XC 3RMHA 1U9RA 1I4QA 4IQZA 3OMCA 2HCCA 2BE5D 5E4WC 2JXMB 4DU9A 2XVSA 3D4DA 1J9OA 2NN6H 2D5DA 3MEHA 1TY2A 1FNWA 4CJ2C 5EQ0A 2WKDA 1H9SA 1HFGA 2E2HB 5COYA 2RDHA 5JPNC 1SNMA 1SNCA 2EYLA 5KYLA 2HDLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L1B A;  1EQT A;  2B2V C;  4X3K A;  4DN4 M;  2K03 A;  1XYI A;  2X69 A;  3IFD A;  1X3P A;  3KUP A;  4ZK9 B;  2KEC A;  1BBX C;  3F2U A;  1AZQ A;  1B53 A;  3G7L A;  4RAU C;  1SDF A;  1O80 A;  1G2T A;  2NWG A;  2Q8T A;  1DOK A;  1JE4 A;  1IKL A;  1Q3L A;  1ILP A;  1AZP A;  1F9R A;  5JJZ A;  1NCV A;  2B2T A;  1JIC A;  2B2V A;  2JYO A;  2X6G A;  2DY8 A;  3HP3 A;  2RSO A;  2K1B A;  1DZ1 A;  1O7Z A;  2B2W C;  4LMQ D;  1C8C A;  1EIG A;  3N52 A;  1RJT A;  1WTV A;  1RTN A;  1HRJ A;  3P7J A;  3R93 A;  1CA5 A;  5CBA E;  2L9H A;  1RHP A;  4QUF A;  2B2W A;  3Q6S A;  1M8A A;  1U4P A;  1BO0 A;  1ROD A;  1IKM A;  2K28 A;  3IL8 A;  1A15 A;  3H91 A;  1WTX A;  1RTO A;  1U4L A;  4HAE A;  4X3U A;  1EIH A;  1G2S A;  1PDQ A;  2D9U A;  3FPU B;  5EKI A;  3DEO A;  2FHT A;  1DOL A;  1PFB A;  1LV9 A;  2KOL A;  1G91 A;  4MN3 A;  4MHE A;  2N88 A;  1HUN A;  2DY7 A;  1KNE A;  1CA6 A;  1NAP A;  4O42 A;  2BDN A;  4IUV A;  3I91 A;  2KUM A;  4U68 A;  4XT1 B;  4RA8 A;  1HFN A;  1MGS A;  3FDT A;  1ILQ A;  1F2L A;  2CVR A;  2HUG A;  1PFN A;  2SDF A;  2M2L A;  3KBX A;  2K01 A;  1GUW A;  1TVX A;  2HDM A;  4IUQ A;  1WTP A;  5D14 A;  4UAI A;  1ZXT A;  5EPL A;  1F9P A;  3ONA B;  1SAP A;  4XDX A;  1WTO A;  5E4X A;  1MSG A;  4OIJ A;  3GV6 A;  1QG7 A;  2J7Z A;  1WTR A;  4X3T A;  4IUR A;  1EL0 A;  4IUT A;  4IUU A;  1S4Z A;  1B3A A;  1PLF A;  1X32 A;  2MPM A;  5AFW A;  2B2U C;  2FIN B;  2L12 A;  5CMD A;  1QNK A;  1F9Q A;  1KNA A;  2FJ2 A;  2FMM A;  1WD0 A;  5DNF A;  5COR A;  2MP1 A;  2N55 A;  5EJW A;  2NYZ D;  2B2Y A;  2RSN A;  2FFK B;  2NZ1 D;  3LWE A;  4R8I A;  1B2T A;  3I8Z A;  2KVM A;  2MJ8 A;  2R3Z A;  3D6W A;  1WVL A;  1XX8 A;  2B2Y C;  1BF4 A;  1NR4 A;  1VMC A;  1B50 A;  1DON A;  2HCC A;  4R9W A;  1WD1 A;  5CBE E;  4X3S A;  5E4W C;  1PFM A;  2VXW A;  4ZKC B;  4CJ0 B;  1HA6 A;  1CM9 A;  3I90 A;  1B4O A;  3MTS A;  4ZLT F;  2EOT A;  1O7Y A;  4NW2 A;  2HCI A;  1J9O A;  2K04 A;  3DM1 A;  1AP0 A;  3UI2 A;  3GV3 A;  3DEP A;  2H1E A;  3SVM A;  3QO2 A;  2KEE A;  1DOM A;  2L4N A;  4IUP A;  2KED A;  3I3C A;  1U4M A;  3TN2 A;  4HSV A;  1SSO A;  2EE1 A;  4CJ2 C;  2B2T C;  5EQ0 A;  2Q8R E;  1NR2 A;  2EPB A;  5D65 A;  5T1G A;  4XT3 B;  1J8I A;  4ZKB B;  1MSH A;  2IL8 A;  5T1I A;  5EPK A;  1ICW A;  1F9S A;  1MI2 A;  2B2U A;  2X6L A;  1WTQ A;  1QE6 A;  1HFG A;  1E0B A;  1ESR A;  1X3Q A;  2RVL A;  1IL8 A;  4RWS C;  4HED A;  3MWY W;  1EOT A;  1HUM A;  1U4R A;  5COY A;  2K05 A;  3TZD A;  1BNZ A;  4ZAI A;  2RA4 A;  1G6Z A;  1HHV A;  4CJ1 B;  2L11 A;  5EPJ A;  2JP1 A;  2XIW A;  2MGS A;  4HCS A;  2HDL A;  4OIK A;  1WTW A;  4QUC A;  1ML0 D;  1VMP A; 
#chains in the Genus database with same CATH topology
 2K5V A;  1NMG A;  4F7X A;  2V4D A;  2JA9 A;  2ZJR A;  1HXY D;  3BU2 A;  5FLM H;  5C5M A;  4KV6 A;  2I5H A;  1LAC A;  4LK1 C;  2N49 A;  5CGK A;  1IBL L;  2B2V A;  3K57 A;  1Q81 C;  4HTH A;  1QVG A;  4DK0 A;  2LY7 A;  3P7J A;  1HNX L;  1GO3 E;  3STB C;  1ROD A;  1D5M C;  4DAM A;  4A3C H;  1V9P A;  1G2S A;  3O13 A;  5EKI A;  3Q23 A;  3OWF A;  5FO7 B;  1A3T A;  4IOC A;  5ELE A;  3W1B A;  4C1N I;  2DJG C;  4BY1 B;  3T1H Q;  4IPD A;  4RA8 A;  3Q22 A;  3R2T A;  4DR4 Q;  4OXP A;  2M2L A;  1Z6H A;  1EY6 A;  1TVX A;  4B3R L;  4GKJ L;  1D1I A;  1BCP F;  3DLL A;  1SLJ A;  2UUA Q;  1TS3 A;  3BYY B;  1XMO Q;  3STB D;  2VQF L;  2L12 A;  5CMD A;  1JJC B;  2HHH Q;  1GUT A;  4FP5 D;  3BZD B;  3TRE A;  4A3K G;  1B2T A;  1PTO C;  3I4M G;  4DV7 Q;  4BY1 G;  1KC8 C;  4ODG A;  2VUM G;  3FMC A;  5FLX E;  4NPS A;  1E24 A;  1WD1 A;  4L8J A;  3PIO 3;  3HKZ G;  4ZKC B;  3OSO A;  1O78 A;  1LTA D;  2EOT A;  1HPC A;  3DM1 A;  3UI2 A;  4K5V A;  3ND9 A;  2AUK A;  4HSV A;  3K8A A;  1LTR D;  5FOB B;  3GTM H;  4A93 G;  1CQV A;  2PZW A;  3M9B A;  1STN A;  4RCN A;  4DNR B;  1B1Z A;  3OW7 A;  5T1I A;  2DGY A;  4XXE A;  4RFB A;  1KAB A;  2BA0 A;  1S5D D;  1E0B A;  1F2M A;  3T16 A;  3I70 A;  2RQX A;  5CR3 A;  1B44 D;  4CJ1 B;  5EPJ A;  5JVH 3;  1DJR D;  4JCV E;  1F2Y A;  4JG2 A;  1QWY A;  2XWJ B;  2D62 A;  2F0L A;  4DN4 M;  4P72 A;  4BY1 H;  2VY3 A;  4DKA C;  4DV7 L;  2K32 A;  3F2U A;  5KRU A;  2Y0S E;  2IW3 A;  1KDB A;  1KAA A;  1RD9 D;  1F9R A;  4K8I A;  2EYH A;  5IWA L;  4GKK L;  2JA8 G;  2A69 C;  3KDF B;  3J80 i;  3TS2 A;  2Q2I A;  3E5S A;  4A3M G;  1VQH A;  2WKC A;  2JSO A;  4S3S A;  4DUZ Q;  3L3O C;  4DAV A;  3VA7 A;  1R4P B;  2XSC A;  3A8K E;  1X3F A;  3NXW A;  3U50 C;  1ASY A;  3M4Q A;  4JOI C;  1KLG D;  5JOB A;  1XWE A;  3I4M H;  4X3U A;  1Z7T A;  5FJ8 G;  2F1M A;  4LFB Q;  1SBB B;  2WFW A;  1V1P B;  3KFU A;  1SN8 A;  2KOL A;  2DY7 A;  1HH2 P;  1BBU A;  2KUM A;  2M9V A;  3G4S A;  2G9D A;  2WAQ B;  2A69 D;  3I56 A;  1FGB D;  5HGQ A;  5D14 A;  1SNQ A;  1STY A;  1J6Q A;  1Q7Y C;  2R6G A;  2C5C A;  3PUX A;  1K3B C;  1GXD C;  2Z4I A;  2IX0 A;  3NTI A;  3VYT A;  1LT5 D;  4X62 L;  2KVM A;  1X54 A;  4GLA C;  5C3X A;  2CHB D;  2EJG C;  1Q46 A;  2DNE A;  5C0X G;  2JN4 A;  1BDO A;  2Q2H A;  4QIW E;  1EY0 A;  1SNP A;  3A5Z B;  4RHR A;  4X3S A;  1PFM A;  3CP0 A;  2F0I A;  1HR0 L;  5DM7 3;  4HR7 B;  2L15 A;  3GTO B;  2O4X A;  3ITP A;  3GV3 A;  4JVZ A;  2AKW B;  3E6Z X;  3CU7 A;  3CHB D;  4G57 A;  1QUQ A;  2CCZ A;  3S2D H;  2EYP A;  2F0G A;  5C44 G;  2MNA A;  2MQH A;  1YIT A;  4A3D B;  3HEJ A;  4QL5 A;  4UDU C;  2OTJ A;  4GNX B;  2ZXR A;  4HED A;  1TWG B;  3NHH A;  4OO1 I;  2VQE L;  3ICE A;  3AEV A;  1I3Q H;  1PRT B;  2B8F A;  3WDN A;  1TII D;  4CDD C;  5JEA H;  1XJV A;  3U58 A;  3S14 H;  1CKO A;  1LTG D;  4DV5 L;  1BBX C;  1OTC A;  1E2W A;  3GTG B;  5HGT A;  4DR3 L;  1STE A;  1I4R A;  2NWG A;  1Q3L A;  5KGU A;  4MTK A;  1IW7 D;  4GN3 B;  4JPB W;  4KI0 A;  4WJW A;  1PYS B;  1PH8 A;  4JI6 L;  2TMP A;  2K1B A;  3VR6 A;  4V0B A;  2B2W C;  3BVG A;  3CKI B;  1HNZ Q;  1VQD A;  1X65 A;  2L9H A;  1JJ2 A;  3EBE A;  1K0S A;  1RTO A;  2J4X A;  3L0O A;  1RKN A;  2NN6 I;  2YV5 A;  2RF4 A;  1G91 A;  3J81 j;  1OXX K;  5ELC A;  2E2D C;  3U4V A;  5BN5 A;  5IIF A;  4XT1 B;  1PTO D;  1IW7 C;  4FNF A;  4X64 L;  2WAC A;  2PW7 A;  3KJP A;  3ONA B;  5C0X H;  3DM3 A;  3R2I A;  1AFP A;  4KMU C;  1EL0 A;  1JMC A;  3RLO A;  3SK6 A;  4A3K H;  2QDL A;  5IYB G;  2R7Z B;  1CKN B;  3H0G G;  4A3L H;  1QNK A;  5GQO A;  1ASZ A;  5COR A;  1G6P A;  1EEI D;  3OPO A;  2EYF A;  4DK1 A;  4R8I A;  4A3C G;  3HOV H;  4BBR G;  4K0K L;  1E2V A;  1HCZ A;  2B8G A;  5A2Q E;  3UE1 A;  2K5Q A;  1DCZ A;  1NSN S;  2PNH A;  3QR8 A;  4NXN L;  3M7N A;  2EYO A;  1HJP A;  1B50 A;  3S16 B;  1TWC B;  1U5K A;  1SFO B;  2CW0 D;  3A0J A;  1H9R A;  3MTS A;  2SEB D;  1OXU A;  2SNM A;  1KQS A;  4JYA Q;  2CQA A;  3DMU A;  4R4T A;  1I4P A;  3S1Q B;  1RL2 A;  5C4X G;  5IGC A;  1PRT D;  5C4Z A;  3I7F A;  3BZK A;  4LF5 L;  3SK5 A;  3TP5 A;  4JI1 Q;  4ZUJ A;  2F03 A;  1CK1 A;  2QDB A;  4WJ4 A;  1X3G A;  4J15 A;  1I4X A;  3I4O A;  4DAY A;  2QEX A;  3S24 A;  2PQE A;  4C3J B;  2XIW A;  1NTG A;  4OIK A;  1BBW A;  3EIV A;  5LMU Q;  4BWG B;  4GNX C;  2PPB C;  4NXN Q;  4LFA Q;  4IZ8 A;  2KCM A;  2Q8T A;  3MXG A;  3CCQ A;  1UUP A;  5IWA Q;  1MJC A;  2Y0S G;  3CCU A;  4FF2 A;  3TME A;  1YI2 A;  2XN9 C;  3E9I A;  1MJE A;  1FJG L;  3N52 A;  4O1N A;  1V1Q A;  2B2W A;  2NZO A;  4APV A;  3IL8 A;  1D6E C;  1LTB D;  3CD6 A;  3PO2 G;  4B3R Q;  4GKJ Q;  3MHB A;  1DOL A;  4K0K Q;  4DR1 Q;  1M90 C;  4MHE A;  2PNR C;  5LHY 1;  3K6O A;  2ZTE A;  5JJL A;  3A54 A;  2BCO A;  2Z1C A;  1F2L A;  4Q0F A;  1JWU D;  3NUC A;  4B3S Q;  2E75 C;  5KEE A;  1F9P A;  2RCF A;  3E9H A;  5KYI A;  2N78 A;  3J80 L;  2J7Z A;  4JI8 Q;  2Z4H A;  4YCU A;  2ZXP A;  4R4Q A;  1MIU A;  2UXC Q;  1PTO F;  1Z47 A;  5AFW A;  5EBD A;  4KHP Q;  2WIN B;  1W6J A;  4JI7 L;  1TWG H;  2I5L X;  3MZ5 A;  5EJW A;  3VR2 A;  4FXK C;  1Q1B A;  1SFO H;  2R92 G;  1PYW D;  4CKB A;  3CAM A;  5JEA G;  4R9W A;  4DK6 C;  5IYD G;  2YTY A;  4NB3 A;  1CM9 A;  1B4O A;  1N33 L;  1I6H B;  4RKL A;  5M5X B;  1J5E L;  2IY5 B;  1XPR A;  3QO2 A;  1BUV T;  2EE1 A;  2OF1 A;  1DD2 A;  1QVF A;  1YHB A;  2Y0S B;  3SDZ A;  4A3B B;  2IL8 A;  2VNU D;  4DAY B;  3S17 B;  3JAM E;  2ZTD A;  5GAH C;  2JA7 B;  1I94 Q;  1HUM A;  3RN2 A;  1K83 H;  5IGF A;  1VQO A;  4PMW A;  2D0O A;  4N8F A;  3TDQ A;  2MGS A;  4HCS A;  1OO9 B;  5IP9 H;  3NK9 A;  1ML0 D;  1WCM H;  5I6W A;  3P1H A;  2F0V A;  4NXM Q;  4C3J G;  3MXU A;  4C3H H;  4QY7 A;  1FVI A;  5CV6 A;  4QGU A;  4OGQ C;  1PV4 A;  2GN5 A;  2F4V L;  1JE4 A;  3CPF A;  3S17 H;  2NUC A;  2R7F A;  4LF4 Q;  1CKM A;  3QWN A;  4LFC Q;  5A35 A;  1DZ1 A;  5M5Y H;  3KYH C;  3GTL H;  3ULJ A;  5IGG A;  5J3B A;  3NPP A;  5M5X H;  4LF8 Q;  2F0F A;  1W2B A;  1IHZ A;  1JCK B;  3H91 A;  1A3V A;  2AUJ D;  4KY6 A;  4DR2 Q;  4YWM A;  2AQ2 B;  1NY4 A;  2JA6 B;  4K6L A;  1AH9 A;  2JA7 G;  3A7A B;  3I4N H;  1Y1V H;  4L5S A;  3M85 A;  1KRS A;  4O42 A;  3VYR A;  3H09 A;  1YNJ D;  2Z6K C;  1PXU A;  4B3T Q;  1XPO A;  4A3B G;  1CHP D;  3SR1 A;  1E22 A;  4RCO A;  3RZO B;  4CGY B;  5C44 H;  4O0A A;  4ID6 A;  5BR8 L;  2F0D A;  5DAU A;  3CRL C;  2A6H C;  2CWP A;  3PIO A;  3M4O B;  4OIJ A;  5K36 G;  3GV6 A;  2K5D A;  4X3T A;  3RN5 A;  4RGO S;  2MHV A;  3U9S A;  5IP7 H;  4BBR B;  3DHQ A;  2A6E C;  2MP1 A;  1DXM A;  2CH4 W;  2FMC A;  4YY3 L;  3T13 A;  4OX9 L;  1TT2 A;  4TSS A;  1EFI D;  3TP7 A;  2ZM6 Q;  1NNX A;  1NR4 A;  3M3Y B;  1II3 A;  1TKW B;  2PI2 E;  1UE7 A;  3PO3 H;  4LW1 A;  1HNW Q;  3GO5 A;  4CJ0 B;  1E7Z A;  3DUZ A;  3GTL B;  1N9W A;  3FKI G;  3CCL A;  5ISR A;  4L63 B;  2UUB Q;  2AWO A;  5BN4 A;  2EIF A;  2R61 A;  1SR3 A;  5D65 A;  2K33 A;  1J8I A;  3WOE A;  4EQP A;  1I6V C;  2WB1 E;  1XNR Q;  1F9S A;  2G9H D;  4DFA A;  4DV3 L;  1EWI A;  1WCM B;  3CMA A;  1IL8 A;  2F0M A;  4G7O C;  2DN8 A;  1D8L A;  2L11 A;  3K0X A;  4GNX A;  1TS5 A;  5FJ8 H;  3WOF A;  3S14 B;  1ZKO A;  4XQJ A;  4ULL A;  3EFX D;  1Q1E A;  4JI0 L;  1VMP A;  2L1B A;  5IT9 E;  3I4L A;  1XYI A;  1EIY B;  3GTQ H;  1ICF B;  3MFG A;  4A4I A;  4RAU C;  3EN2 A;  4DV0 Q;  1XPU A;  4JBJ A;  3BZC A;  1XNQ Q;  1EQV A;  1PH6 A;  1C7Y A;  4A3I G;  2P5Z X;  3PQI A;  4OX9 Q;  1HZC A;  2JYO A;  2PMZ E;  2OTL A;  1SMY C;  1RJT A;  2JEB I;  1FL0 A;  3NWT A;  4MIU A;  2KA7 A;  5C6A A;  4HJ5 A;  1GKH A;  1Y1W B;  1CSQ A;  1O7I A;  3SGI A;  3KLS X;  3HG9 A;  4GOP A;  3DEO A;  4PNY A;  4I7A A;  2R92 H;  1PFB A;  3NBH A;  5JAV A;  2AHO B;  4K8J A;  4IUV A;  4J8Q A;  1AE3 A;  4FF3 A;  1HFN A;  1B7Y B;  3KBX A;  1VQA A;  3HOY B;  1SE2 A;  3QIA A;  4XDX A;  1SAP A;  3K5M A;  3GTJ B;  1Q12 A;  2KCN A;  4RGN A;  1LLR D;  3OHX C;  4A3E H;  1SE3 A;  4I65 A;  1BQQ T;  3AU7 A;  3V96 A;  2R3Z A;  1JE5 A;  1VMC A;  1S5F D;  5GAG C;  3S1M B;  4HIK A;  2RHS B;  1MD2 D;  2WAQ E;  2WP8 J;  3QOJ A;  4PMB A;  4L6T B;  5EBC A;  3K81 C;  4UPA A;  5M3F H;  3P20 A;  1C0A A;  4P75 A;  1AP0 A;  2QGQ A;  2RHQ B;  3UDX A;  2NVY H;  5D3D A;  1VF5 C;  3FPP A;  1XNQ L;  1U4M A;  2F0U A;  1GUN A;  1NUC A;  1I4H A;  3KF6 A;  3MA2 B;  4A3M B;  1ENC A;  4ZUI A;  1MSH A;  4XYO A;  4X65 L;  4EGV A;  2F0W A;  4GZY C;  2F0E A;  4HID A;  2OWO A;  5GAD C;  2IHE A;  1ESR A;  4JW0 A;  5C3E B;  3IAY A;  3PUY A;  5E7N A;  1UE5 A;  4UP9 A;  3EA6 A;  5C4X H;  2AMC B;  1D7Q A;  2JP1 A;  1JT8 A;  4AYB G;  1CHQ D;  4A3J H;  1SYG A;  3X3M A;  1N33 Q;  1AEX A;  1HA5 A;  4NMZ A;  2BH8 A;  4KLK A;  3OW2 A;  3KF6 B;  1AZQ A;  1CFM A;  2WB1 B;  4B9W A;  4IPC A;  1ENA A;  2JJQ A;  1R4Q B;  1JQY D;  1EY9 A;  3HOU G;  4WRD A;  1BKB A;  1YBY A;  1KTK A;  1CZW A;  1TXY A;  3G71 A;  4DV6 L;  4LF6 L;  4JOI A;  1YNJ C;  2Q8I B;  1EYD A;  1X56 A;  2RDF A;  1KD1 C;  2XWB B;  1U4P A;  3D0F A;  2G5D A;  2K28 A;  3K5N A;  4DV4 Q;  5IOD A;  2A6H D;  1XMQ L;  1TU2 B;  1GUG A;  4EQ5 A;  3KJO A;  5IY0 A;  1EY4 A;  4FXD A;  5IP9 G;  1L1O C;  2SNS A;  2OQK A;  3CC4 A;  2GVA A;  2KCT A;  4A3D G;  2VUM B;  1KNE A;  5I2X A;  4IJL A;  3VR4 A;  4C3I B;  1EYA A;  3PGZ A;  4A3K B;  4NP5 A;  3FDT A;  2MO1 A;  1JB7 A;  4BBR H;  1VQI A;  2VW9 A;  4HIM A;  4KJO A;  1EZ8 A;  4CDC C;  1CSP A;  4X66 Q;  2NVQ H;  3S2H B;  2MPM A;  4BBS H;  1S40 A;  1K8A C;  1CT1 D;  1YJW A;  3LWE A;  3QOL A;  3GTK B;  4DV3 Q;  1HTL D;  4Y7N B;  3Q8D A;  3G48 A;  1GD7 A;  1E1O A;  1Q82 C;  3CC2 A;  3G6J B;  4RGM A;  3S1N H;  2RCN A;  1HA6 A;  2JA5 G;  2JA8 H;  3KLR A;  4L5Q A;  5L37 A;  3H3V C;  2HD3 A;  1PZJ D;  2K75 A;  3A7L A;  2ZTC A;  1Y8P B;  2KEE A;  3J7Z C;  2LXK A;  3I3C A;  3HKS A;  4O2D A;  2EPB A;  1K9M C;  4DV0 L;  1JOK A;  3IFT A;  1A3U A;  4IN3 A;  2JA5 H;  2IJ0 A;  1VQN A;  1CTM A;  1D5Z C;  2RVL A;  3KDF A;  1AN8 A;  1E2Z A;  2KHI A;  4JI0 Q;  4OO1 H;  2CW0 C;  2H4O A;  3ULL A;  1QVC A;  1SMY D;  1HNW L;  4QUC A;  2B63 B;  3RZD H;  1EIF A;  1N34 L;  1EQT A;  1QNU A;  2JQO A;  1PRT C;  3IFD A;  1HZ9 A;  3EVQ A;  5BR8 Q;  3PMF A;  3MXN A;  2MO0 A;  1U0L A;  1SDF A;  1VQ9 A;  3E0J A;  1YJN A;  1IKL A;  4DR1 L;  1WYD A;  3P75 A;  3FVQ A;  4WFN 3;  5JVG 3;  1UEA B;  3ERO A;  3NEN A;  4DAP A;  1EYG A;  1IYV A;  1EZ6 A;  3GTP B;  1EIG A;  4JBW A;  5M3F B;  3GTP H;  2FXQ A;  3K7A H;  2B63 G;  4EX5 A;  4NDX A;  2PQA B;  4BBS B;  5DEH A;  5C3E G;  2EYM A;  2XRQ D;  4PMC A;  1W6K A;  5JEA J;  1SND A;  2ICE C;  4Q5V A;  3S15 H;  3CRK C;  1LV9 A;  1TY0 A;  1VDZ A;  1YZ6 A;  4XQN A;  2HUG A;  2QEJ C;  4GN5 A;  1JOO A;  2K01 A;  3GTG H;  4HCE A;  4Y52 H;  3KLS A;  3PUV A;  4GLV B;  1TWA H;  5E4X A;  1OXS C;  2BOS A;  3R8B A;  1HNZ L;  4IUT A;  5C5L A;  5M3M B;  1VQ8 A;  2JA5 B;  4JBK A;  1N32 L;  1JWS D;  2F0T A;  4A3M H;  1WI5 A;  3TRZ A;  3T53 B;  2ASB A;  2MJ8 A;  2CH4 A;  3I4M B;  3DWA A;  3QB3 A;  2JEA I;  1Y8N B;  2A74 C;  1LO5 D;  3MFY A;  4YHH Q;  3CXC A;  1EWH A;  3PIP A;  3HOV G;  4G4K A;  5EAY A;  4GLX A;  4QMG A;  3HOX B;  5FLX L;  3I72 A;  1S5C D;  3CQZ B;  3HOY G;  1LAB A;  1I94 L;  1TS2 A;  1SE8 A;  5LL6 S;  2CFM A;  2KBN A;  4F88 A;  1DOM A;  2KED A;  3TN2 A;  4PZ8 A;  2BDO A;  1SSO A;  2Z0S A;  3S15 B;  2CKZ B;  3UDF A;  1VQG A;  3Q24 A;  1VF7 A;  3M4Y A;  1EFW A;  3A5U A;  3T56 B;  1K28 A;  4IFD H;  5IT9 L;  4POF A;  3BVM A;  2HHH L;  1L0Y B;  3OIQ A;  1K3R A;  1V1O A;  1BNZ A;  1C4Q A;  2ID0 A;  4P74 A;  3C2P A;  1L1O B;  3I4N G;  1VQ5 A;  5LMN Q;  3VDY A;  4A3I B;  4C3I G;  3J81 E;  1K8O A;  3VR3 A;  4PZ7 A;  1STG A;  3PF5 A;  4KK7 A;  3D3R A;  1D1K A;  3HOU B;  1SJE D;  3BYT B;  3S1M H;  4DUY Q;  2R93 B;  1H9S B;  1SMX A;  2C9O A;  2AWN A;  4DV1 L;  5IOC A;  1C8C A;  2JA6 H;  3NTK A;  1HRJ A;  1RTN A;  1NBW A;  2KJX A;  1KIX A;  1CA5 A;  1SYC A;  3H6M A;  3CCV A;  3W1G A;  4HAE A;  1U4L A;  2C35 B;  2GA4 B;  3ER0 A;  4AQY L;  1WTX A;  2F0N A;  2BA1 A;  4IFD G;  3K0Y A;  1KL9 A;  2F0S A;  1PH9 A;  2A5H A;  1LUZ A;  3HOW B;  3TQY A;  2WB1 G;  4N8X 1;  1SEB D;  1STH A;  1IYU A;  2VZA A;  3N6R A;  2H5X A;  3NTH A;  2PYK A;  3S1N B;  3EJI A;  4PG3 A;  4IUQ A;  2A8V A;  3A55 A;  1ZXT A;  3HOZ B;  4FF4 A;  1EYC A;  3J7Y W;  4UP8 A;  2FIN B;  4ALP A;  4A3I H;  5E3F A;  3WWV A;  4B08 A;  4L5R C;  2OEO A;  1LTS D;  3I8Z A;  2E2H H;  1FNU A;  2L5T A;  2EY1 A;  2B2Y C;  2R93 H;  2PZT A;  3PSI A;  4HJ9 A;  1FYC A;  3E0E A;  1BCP D;  3T1Y Q;  5LMN W;  1A63 A;  4IUN A;  3BDC A;  1WOC A;  2H1E A;  5IYD H;  4IOA A;  1VQB A;  3TSS A;  1SNO A;  4A76 A;  1WJJ A;  5ELF A;  4ZYS A;  4X62 Q;  4M1U B;  2RDG A;  4XT3 B;  4KHZ A;  4P73 A;  2A73 B;  3S1R H;  1ICW A;  5EKK A;  1MI2 A;  3CCJ A;  5J39 A;  1QE6 A;  2ENB A;  4RWS C;  1TR5 A;  1SYD A;  2VQF Q;  1CZG A;  4R4O A;  4EQN A;  3H3V I;  4HJ8 A;  4A3E G;  3F2B A;  1TS4 A;  4LF7 L;  1K83 B;  3QG1 A;  5CV8 A;  3TP6 A;  1WTW A;  4KN4 C;  2JA7 H;  4TVA B;  4DV1 Q;  5A2Q L;  3AFQ A;  3LWU A;  3HGB A;  2KCC A;  1PTO B;  4X64 Q;  5D3I B;  1EOV A;  1Z9F A;  5M5W H;  1PH2 A;  1SRU A;  4OWX B;  1AZP A;  2IT1 A;  1UE6 A;  1KDC A;  3A56 A;  2PCF B;  1O7Z A;  2NN6 G;  3K80 C;  4P71 A;  4H44 C;  1WTV A;  4X66 L;  3S9W A;  5AJ3 Q;  5M5Y B;  3R93 A;  3L9A X;  4QQB X;  1IKM A;  1PH1 A;  3CW2 C;  1S72 A;  1B9M A;  1HR0 Q;  2YTX A;  2B29 A;  2YYZ A;  2D9U A;  2PZU A;  3FRP B;  1UWV A;  1WCM G;  4MN3 A;  2N88 A;  3SEB A;  1UNS A;  3H15 A;  3I91 A;  5TSS A;  3J80 E;  1A8V A;  3IKJ A;  3U9O A;  1STB A;  3TBI B;  4V19 0;  1SYE A;  2K50 A;  2PMZ B;  3U4Z A;  2V1C C;  3PUZ A;  4LF6 Q;  3K5L A;  4OWW B;  2Z6K A;  4J1M A;  1MSG A;  3T1Y L;  3FKI B;  3KOJ A;  2FMM A;  2EXD A;  1XNR L;  1NJI C;  2RSN A;  3L7Z C;  2E5L L;  2J0T D;  4LUO A;  4HJA A;  1EU4 A;  4LWC A;  5ELN A;  1A2T A;  4YY3 Q;  1N36 Q;  2ES2 A;  3HOX H;  2NTS A;  1L0X B;  4C2M H;  1QIL A;  4KD3 A;  2PQA A;  3D8G A;  3NQT A;  2F0Q A;  4NW2 A;  2K04 A;  1BCP B;  3DEP A;  3D4W A;  5M3F G;  1YHA A;  3Q0A A;  2LSS A;  2A19 A;  1VQJ A;  2QIL A;  3C46 A;  5EPK A;  1JOQ A;  2B2U A;  4LF9 Q;  2X6L A;  3PO2 B;  1FD7 D;  1DGS A;  1GHJ A;  2F52 A;  2BE5 C;  5CV7 A;  1Q86 C;  1BXT A;  2Z6B A;  2O5I C;  1Y1V G;  5G3L D;  1ZYR D;  2K05 A;  4H0L C;  4FYD A;  2RA4 A;  4IPG A;  5ELB A;  4LFA L;  2NVT H;  1QB5 D;  4AQY Q;  3F2D A;  4JV5 L;  4DR2 L;  4K5W A;  1HR0 W;  3URY A;  1DYQ A;  4HMI A;  3HOW H;  3OYY A;  5M5W B;  4JK1 C;  1H9M A;  4X3K A;  1BR9 A;  1X3P A;  1DM0 B;  1HQM C;  2KEC A;  3ULP A;  2L55 A;  3VYU A;  4OL7 A;  1TWH H;  4LF4 L;  2JA6 G;  4ILW A;  1QOH A;  1N32 Q;  3T51 B;  3J7A V;  4JI1 L;  1TQO A;  2E8G A;  2DY8 A;  3I2Z A;  2UUC Q;  3VR5 A;  4LUV A;  4C3H G;  3J81 L;  5M9O A;  2AQ1 B;  2E2I B;  1GHK A;  1M8A A;  1A15 A;  4F87 A;  4RKB A;  4LAA A;  1SXT A;  2EY6 A;  4DR6 Q;  5IGB A;  2XRS D;  2DNC A;  3K7U C;  1I4G A;  1HUN A;  1V1P A;  5KNB A;  1QUQ B;  2R7D A;  3BDO A;  2ZJP A;  1VQP A;  3C1F A;  4LFB L;  4IFD I;  5CV5 A;  2ZJQ A;  4NXM L;  4JBM A;  2B63 H;  1TWF B;  1UAP A;  1GUW A;  4EQO A;  4WJ3 M;  2F3I A;  1WTP A;  2GVB A;  4QF4 A;  2EZV A;  2EVB A;  5FO9 B;  4FF1 A;  3LNN A;  2XTI A;  4DR5 Q;  1VQE A;  4JI2 L;  5CYU A;  2NVX B;  2IHF A;  4IUR A;  4GOP B;  4IUU A;  1BCP C;  3PIP 3;  1PTO H;  1FNV A;  5DNF A;  4FO2 A;  1GUS A;  3DXJ C;  1KLU D;  2B2Y A;  2FFK B;  3K7A B;  2R92 B;  4EVO A;  3M4O H;  5FO8 B;  2MFI A;  4A3J B;  4TQU S;  3LGJ A;  1PFS A;  3OWE B;  1XTC D;  3V05 A;  3SK4 A;  2A68 D;  5CBE E;  4XIG S;  3RZO H;  1YNN D;  1Y69 U;  1S5E D;  4KN7 C;  4DV4 L;  1O7L A;  5KNC A;  4MTN A;  4AYB E;  4GS3 A;  1EY7 A;  3AB9 A;  1RIP A;  1G29 1;  4R1J A;  3GP7 A;  2NVY B;  4R8N A;  5T1G A;  3F1Z A;  1H9K A;  1JR0 D;  3S2H H;  4X6A H;  1JB3 A;  4DR3 Q;  1X9N A;  3F2C A;  3TZD A;  1G6Z A;  3I55 A;  1I5F A;  1IBM Q;  4CDE C;  4AYB B;  1EY8 A;  3ERS X;  4DXF A;  3KF8 A;  2KQ3 A;  2EYJ A;  2VQE Q;  1FGU A;  1ESF A;  3KUP A;  3MVV A;  4N9P A;  5GRO A;  2VB3 X;  5KIX A;  4A3F B;  5IE8 A;  1TWF H;  4P2C B;  4PV1 C;  4MNO A;  5JJK A;  1ILP A;  4ZRZ A;  5JJZ A;  5J22 A;  1ZEQ X;  1R9T H;  3M4P A;  1NCV A;  3RLF A;  3S16 H;  1C9O A;  2RSO A;  4J6H A;  4OWT B;  4BS9 A;  5FLX c;  4RG1 A;  4BY7 B;  2MUY A;  3ZYY X;  5I9O A;  3W5O A;  4ZQ3 A;  3M3Y H;  4QCL A;  2Q2T A;  3AMU A;  1ET9 A;  1L1O A;  3MAQ A;  2B3G A;  1M1K C;  1JWM D;  1PA6 A;  4GN4 B;  1WFQ A;  3HZX A;  2E74 C;  4OON A;  2CQO A;  3K5O A;  3GTJ H;  4K2K A;  4CDF C;  1QCB D;  3SHL A;  4I7Z C;  2F4V Q;  3LX0 A;  1HQR D;  2SDF A;  3UE0 A;  2OT2 A;  3X3N A;  2OXP A;  1RDP D;  4K14 A;  4M8A A;  4LNQ A;  5C4X B;  1AE2 A;  1WTO A;  2VUM H;  1F77 A;  5I4D A;  3J81 c;  4DV6 Q;  4F8M A;  1WTR A;  1X3E A;  1B3A A;  1X32 A;  5ELD A;  1RCV D;  5HY6 A;  5LL6 X;  3GTK H;  3VYS A;  2I0Q A;  2NZH A;  2O5J C;  2FJ2 A;  3S2D B;  4ABN A;  2NZ1 D;  3A8J E;  4LF5 Q;  4PQX A;  3W2D A;  3PO2 H;  3L2P A;  4DR6 L;  1EWC A;  4A93 H;  4DNI A;  5IYC H;  1F2Z A;  4H13 C;  3OMG A;  3KLW A;  3GTM B;  4DV2 L;  5CV4 A;  1Q8K A;  1O7Y A;  4KKS A;  1EU3 A;  5H1S E;  3S1R B;  4B3M Q;  3D4R A;  3BDL A;  1A0I A;  3GTQ B;  3SE0 A;  2Q8R E;  1NR2 A;  3H94 A;  1YNX A;  2HIV A;  4YWK A;  1BVS A;  1JC7 A;  5C4J B;  1H95 A;  4CKC A;  1B8A A;  5NUC A;  5C3W A;  1KAW A;  3I73 A;  4ZAI A;  4DR7 Q;  2EXZ A;  3H0G H;  4BY7 G;  2F3W A;  4RH6 A;  2N8N A;  4FDB A;  3MEF A;  2QW7 A;  1E3P A;  4K5X A;  4CBV A;  2EY5 A;  4PZ6 A;  2LXJ A;  2UXB L;  4GKK Q;  4FXG C;  1B53 A;  4JI6 Q;  5FK9 C;  4DUY L;  5CC4 A;  4A3F G;  2E76 C;  3FEW X;  1K8G A;  1HTP A;  2K5W A;  3BJU A;  3T4A C;  2A1A A;  1NE3 A;  2D0P A;  1GOZ A;  1Y14 B;  1MKH A;  4LMQ D;  5C3E H;  1TWH B;  3K59 A;  1N36 L;  1MBY A;  3KF8 B;  1STA A;  3EQL C;  1FJG Q;  1PZI D;  2RKS A;  5IGD A;  2E5L Q;  4AH6 A;  1MHW C;  3FP9 A;  2IWH A;  3SXH A;  4JI3 Q;  3HOZ H;  4KY7 A;  5BN3 A;  4JI7 Q;  1LTT D;  2F0H A;  1PHJ A;  4A93 B;  1T9H A;  1M4V A;  1EQQ A;  2UXC L;  5C44 B;  1MGS A;  4JI4 L;  1VQ7 A;  4OEM B;  1I3Q B;  1SRO A;  3ND8 A;  3RD4 A;  5AJ3 L;  3CF5 A;  2PO4 A;  3W3A A;  1E1T A;  4XQQ A;  4KD4 A;  4R4I A;  1XMO L;  4Y7N H;  4DR7 L;  1KXL A;  4H02 A;  1T5X D;  4TKO B;  4LF7 Q;  2JE6 I;  1P16 A;  5IT9 c;  4YCV A;  4KKU A;  1PH4 A;  3D6C A;  1PLF A;  1HZB A;  2DUD A;  2NBF A;  4DV2 Q;  4A3J G;  1KNA A;  5CV9 A;  1FR3 A;  3NQI A;  5K36 H;  5E1F A;  3V2T A;  4C1N K;  1K73 C;  2RBM A;  4C2M B;  4IO9 A;  4IFD J;  1TWC H;  3IRB A;  1L2F A;  5J1Z A;  2VL6 A;  4IJH A;  3OTO Q;  3TS0 A;  2VXW A;  1I50 B;  4QIW B;  4JYA L;  4HN7 A;  4L5T A;  2F0K A;  2EJF C;  4C3H B;  3SVM A;  1SYF A;  3A8I E;  3MC0 B;  1XTD A;  3AYH B;  2NVQ B;  1Q90 A;  3NBH B;  3BVZ A;  1A62 A;  2B2T C;  2OCE A;  4DA2 A;  3OOC A;  4OO1 G;  1C48 A;  1YNN C;  4CHT B;  1P8L A;  4ME5 A;  5M3M G;  4Z9C B;  4OEL B;  5LMU L;  3MWY W;  4IPH A;  2F0O A;  1G8Z D;  2F0J A;  2YU9 H;  4LF8 L;  3NSW A;  1X55 A;  1HHV A;  5JJI A;  1W3S A;  1IBK L;  2VB2 X;  2L0C A;  4ME3 A;  3CCM A;  2O2L D;  4JI5 Q;  2WAQ G;  5F2D A;  4H7B A;  1PH7 A;  2ZM6 L;  3PCO B;  1ZYR C;  4XTC S;  1Y1V B;  4R4C A;  2QF7 A;  3ZJY C;  4LF9 L;  2KEN A;  3F8T A;  4K6D A;  4DPG A;  2B2T A;  5GAE C;  1JIC A;  2X6G A;  2VS1 A;  2PI2 A;  3A74 A;  1KRT A;  1LT3 D;  1Q8I A;  1PMR A;  3BS1 A;  5I2Y A;  5DM6 3;  2QA4 A;  4TRD A;  4B9X A;  4JV5 Q;  3R3O A;  2K5H A;  1CQF A;  1RHP A;  1BO0 A;  1CKN A;  2UXD L;  3TP8 A;  5C0X J;  3NBI A;  2JA8 B;  1PH3 A;  1YVC A;  4RMF A;  4X65 Q;  4UY8 C;  1UEB A;  3B6Y A;  4OHJ A;  2IX1 A;  1CA6 A;  1IYJ B;  2HIX A;  4DXG A;  5I6Y A;  4KY5 A;  1LM0 A;  4NKL A;  3J7A 5;  2D2C C;  4JI3 L;  5HUR A;  1PFN A;  4GOP C;  4K2L A;  5EGT A;  1VCI A;  5KND A;  4IAL A;  4KHV A;  5FKA C;  3TZU A;  4LFC L;  4A3G H;  2XGT A;  5C4H A;  4MZ9 A;  4POG A;  4A75 A;  1AW7 A;  4QB4 A;  1GJX A;  2ATW A;  4A3B H;  1F9Q A;  3E3X A;  1V43 A;  2NYZ D;  3RZD B;  1PZK D;  5C4J H;  3CPW A;  4C3I H;  3DWP A;  1WVL A;  2UU9 Q;  3J81 i;  4LUZ A;  2F3V A;  3ERQ A;  3KBG A;  3C1E A;  1LTI D;  1OXV A;  3I90 A;  3KK7 A;  3HKZ B;  4ZLT F;  4B3S L;  4G7Z C;  4UHV A;  2HCI A;  4B3M L;  3PV0 A;  4LJZ C;  1EUJ A;  3NE5 B;  3CQZ H;  1R9T B;  1B70 B;  1HZA A;  2A6E D;  3RUZ A;  4QJF A;  4ZKB B;  5JPM C;  3PO3 G;  4C3J H;  2KHJ A;  1CI3 M;  3CC7 A;  4DV5 Q;  1WTQ A;  1A2U A;  1X3Q A;  3OIP A;  3UDI A;  1U4R A;  3H3V H;  1CUK A;  2E2J B;  2E2J H;  1Y8O B;  4CKE A;  4WOR A;  3HKZ E;  3JAM i;  4BXX G;  1B9N A;  4KKT A;  4JI4 Q;  2B2V C;  2UU9 L;  2YTV A;  2X69 A;  3CME A;  2ICI A;  4KTA A;  1OXT A;  3RLN A;  2NVT B;  1SYB A;  2K6A A;  3G7L A;  2AQ3 B;  1PVO A;  1IBL Q;  1G2T A;  1DOK A;  4DNT B;  4KHP L;  2NB0 A;  4U67 3;  2I46 A;  4BA1 I;  2LKV A;  3HP3 A;  2K52 A;  2K7V A;  2ZT9 C;  2EJM A;  3HOU H;  4HSP A;  1XXG A;  5IYC G;  5CBA E;  2UUC L;  1PRT F;  5EKL A;  3GDE A;  1ONL A;  1K0R A;  4RHS A;  4N9T A;  1EIH A;  2HT1 A;  3FPU B;  1IXR A;  4DF7 A;  2BDN A;  2UXB Q;  2F0P A;  1JJG A;  3PF4 A;  4U68 A;  4G7H C;  3TEH B;  2UUB L;  1EY5 A;  2NVX H;  2KHS A;  3D31 A;  1ILQ A;  1GVP A;  4A3G B;  2SOB A;  4A3F H;  3VA5 A;  3H0G B;  4UAI A;  1ET6 A;  2R7Z G;  1LYL A;  5EPL A;  3UDG A;  1J5E Q;  1N34 Q;  4DUZ L;  2QCP X;  1VQC A;  1QJO A;  1QG7 A;  2DJF C;  1SE4 A;  1S4Z A;  2IX3 A;  1WTH A;  1BF4 A;  4KJN A;  3CCS A;  4JC0 A;  2Z9H A;  5M3M H;  4C56 C;  3M7G A;  1YJ9 A;  1A6X A;  2HQL A;  4E6I A;  3D6W A;  1GM5 A;  3JAM L;  1XX8 A;  3S1Q H;  2UXD Q;  3C3L A;  1PH5 A;  4UP7 A;  4JI5 L;  1DON A;  2LFN A;  4RGT A;  2K4K A;  3GD7 A;  3PUW A;  4BA2 I;  1LT4 D;  1N8R C;  4YWL A;  1Y1W H;  1LT6 D;  3BG3 A;  5G3L F;  2L4N A;  2ALY B;  4IUP A;  2BH2 A;  1TWA B;  2EY2 A;  2R93 G;  1UE1 A;  3K58 A;  2R7Z H;  1EQR A;  1ENF A;  2I07 B;  5IGE A;  3G6E A;  3NEL A;  2ZXO A;  1EOT A;  2K5N A;  2A68 C;  1IZ6 A;  5LMN L;  4DGZ A;  1IBK Q;  2IPK D;  5IP7 G;  1JOR A;  1SJH D;  3I4N B;  3J80 c;  1QZG A;  3OTO L;  1EEF D;  5C0X I;  2WII B;  2LMC B;  3MXP A;  3SK8 A;  2K03 A;  5FLM G;  4ZK9 B;  1IL2 A;  1BOS A;  3GTO H;  1O80 A;  1YIJ A;  1KDA A;  1NMF A;  2CWA A;  1VQ6 A;  4FVM A;  3JAM c;  5I9P A;  3J7A F;  3HOY H;  1Y1W G;  1YHQ A;  1V8Q A;  1YEZ A;  1VQF A;  1VQM A;  1I50 H;  4XYQ A;  3NP8 A;  2HQE A;  3HRZ C;  3RR5 A;  2EQS A;  3NWS A;  2TSS A;  3Q6S A;  2XNA C;  4QUF A;  4DR5 L;  2Z8L A;  3HOX G;  2E2I H;  4A3E B;  5DLQ E;  5ELO A;  3GQB A;  1PDQ A;  3T1H L;  3CCR A;  1G51 A;  1VS0 A;  2FHT A;  2OQ0 A;  1H9J A;  3NEM A;  1RF2 D;  3PO3 B;  4DR4 L;  1X6O A;  4BXX H;  2WV6 D;  4AIM A;  1NAP A;  5IYB H;  4B3T L;  1T5E A;  1KHI A;  2PW5 A;  4YCW A;  3FKI H;  2NTT A;  4HIO A;  2M00 A;  2LS0 1;  2CVR A;  2QKI C;  1GUO A;  2B39 A;  2UUA L;  3DWQ A;  2HDM A;  1IBM L;  1D2B A;  1HNX Q;  1S3O A;  1VQK A;  2EDG A;  3HOV B;  4HMJ A;  3JC6 6;  4YIJ A;  3CCE A;  2F4I A;  4YHH L;  2K14 A;  3QJY A;  1S5B D;  1VQ4 A;  4DK3 C;  2B2U C;  1WD0 A;  3HFZ B;  2N55 A;  5K5P A;  1PYB A;  1K8M A;  2YU9 B;  2JK8 A;  3HS0 C;  1I6H H;  1D5X C;  3RMH A;  1U9R A;  1I4Q A;  1XMQ Q;  4IQZ A;  1LTL A;  1B3Q A;  1VQL A;  3OMC A;  4JI8 L;  2HCC A;  2BE5 D;  5E4W C;  2JXM B;  3RNU A;  3AQQ A;  4DU9 A;  4BBS G;  2XVS A;  3D4D A;  1J9O A;  2N3S A;  3HOZ G;  2NN6 H;  1QZH A;  2D5D A;  4BY7 H;  3MEH A;  1TY2 A;  1FNW A;  4CJ2 C;  5EQ0 A;  3MXN B;  4A3G G;  2WKD A;  2I5M X;  4HJ7 A;  4ZCK A;  1H9S A;  1HFG A;  2E2H B;  3HOW G;  5COY A;  4A3D H;  4JI2 Q;  2RDH A;  5JPN C;  1SNM A;  3AFP A;  1SNC A;  2EYL A;  3FHW A;  5KYL A;  2HDL A;  2Q2U A;  4A3L G;  1L0W A; 
#chains in the Genus database with same CATH homology
 4F7X A;  2V4D A;  1HXY D;  5C5M A;  4KV6 A;  1LAC A;  4LK1 C;  5CGK A;  2B2V A;  3K57 A;  4HTH A;  4DK0 A;  2LY7 A;  3P7J A;  1ROD A;  1D5M C;  1G2S A;  3O13 A;  5EKI A;  3Q23 A;  3OWF A;  5FO7 B;  1A3T A;  5ELE A;  4C1N I;  4BY1 B;  4RA8 A;  3Q22 A;  3R2T A;  2M2L A;  1Z6H A;  1EY6 A;  1TVX A;  1D1I A;  1BCP F;  1TS3 A;  3BYY B;  2L12 A;  5CMD A;  1GUT A;  4FP5 D;  3BZD B;  1B2T A;  1PTO C;  4ODG A;  3FMC A;  5FLX E;  1WD1 A;  4L8J A;  3PIO 3;  4ZKC B;  3OSO A;  1O78 A;  1LTA D;  2EOT A;  1HPC A;  3DM1 A;  3UI2 A;  4K5V A;  3ND9 A;  2AUK A;  4HSV A;  1LTR D;  5FOB B;  1CQV A;  2PZW A;  4RCN A;  1STN A;  4DNR B;  1B1Z A;  3OW7 A;  5T1I A;  4XXE A;  4RFB A;  1KAB A;  2BA0 A;  1S5D D;  1E0B A;  1F2M A;  3T16 A;  3I70 A;  2RQX A;  5CR3 A;  1B44 D;  4CJ1 B;  5EPJ A;  5JVH 3;  1DJR D;  1F2Y A;  1QWY A;  2XWJ B;  2D62 A;  2F0L A;  4DN4 M;  2K32 A;  3F2U A;  5KRU A;  2IW3 A;  1KDB A;  1KAA A;  1RD9 D;  1F9R A;  4K8I A;  2EYH A;  2A69 C;  3E5S A;  2WKC A;  2JSO A;  4S3S A;  3L3O C;  4DAV A;  3VA7 A;  1R4P B;  2XSC A;  3A8K E;  3NXW A;  1KLG D;  5JOB A;  1XWE A;  4X3U A;  1Z7T A;  2F1M A;  1SBB B;  1V1P B;  2KOL A;  2DY7 A;  2KUM A;  2M9V A;  2G9D A;  2WAQ B;  2A69 D;  1FGB D;  5D14 A;  1SNQ A;  1STY A;  2R6G A;  2C5C A;  3PUX A;  1GXD C;  2Z4I A;  2IX0 A;  3NTI A;  3VYT A;  1LT5 D;  2KVM A;  5C3X A;  2CHB D;  2EJG C;  5C0X G;  2DNE A;  1BDO A;  1EY0 A;  1SNP A;  4RHR A;  4X3S A;  1PFM A;  2F0I A;  5DM7 3;  4HR7 B;  3GTO B;  2O4X A;  3ITP A;  3GV3 A;  3E6Z X;  3CU7 A;  3CHB D;  4G57 A;  2EYP A;  2F0G A;  4A3D B;  3HEJ A;  4UDU C;  2ZXR A;  4HED A;  1TWG B;  3NHH A;  4OO1 I;  1PRT B;  2B8F A;  3WDN A;  1TII D;  5JEA H;  1LTG D;  1BBX C;  3GTG B;  1E2W A;  5HGT A;  1STE A;  1I4R A;  2NWG A;  1Q3L A;  5KGU A;  1IW7 D;  4KI0 A;  4WJW A;  2TMP A;  2K1B A;  3VR6 A;  4V0B A;  2B2W C;  3BVG A;  3CKI B;  2L9H A;  1RTO A;  2J4X A;  1RKN A;  2NN6 I;  1G91 A;  1OXX K;  5ELC A;  2E2D C;  5BN5 A;  5IIF A;  4XT1 B;  1PTO D;  1IW7 C;  4FNF A;  2WAC A;  2PW7 A;  3ONA B;  5C0X H;  3R2I A;  1AFP A;  4KMU C;  1EL0 A;  3SK6 A;  2R7Z B;  1QNK A;  5COR A;  1EEI D;  3OPO A;  2EYF A;  4DK1 A;  4R8I A;  1E2V A;  1HCZ A;  2B8G A;  5A2Q E;  2K5Q A;  1DCZ A;  1NSN S;  3M7N A;  2EYO A;  1B50 A;  3S16 B;  1TWC B;  1SFO B;  2CW0 D;  1H9R A;  3MTS A;  2SEB D;  1OXU A;  2SNM A;  2CQA A;  3DMU A;  1I4P A;  3S1Q B;  5IGC A;  1PRT D;  5C4Z A;  3SK5 A;  3TP5 A;  4ZUJ A;  2F03 A;  1CK1 A;  2QDB A;  1I4X A;  4DAY A;  2PQE A;  4C3J B;  2XIW A;  4OIK A;  4BWG B;  2PPB C;  4IZ8 A;  2Q8T A;  3MXG A;  1UUP A;  4FF2 A;  3TME A;  2XN9 C;  3N52 A;  4O1N A;  2B2W A;  3IL8 A;  1D6E C;  1LTB D;  1DOL A;  3MHB A;  4MHE A;  2PNR C;  5LHY 1;  3K6O A;  3A54 A;  2BCO A;  2Z1C A;  1F2L A;  4Q0F A;  1JWU D;  3NUC A;  2E75 C;  5KEE A;  1F9P A;  5KYI A;  3J80 L;  2J7Z A;  2Z4H A;  2ZXP A;  1PTO F;  1Z47 A;  5AFW A;  5EBD A;  2WIN B;  1W6J A;  5EJW A;  3MZ5 A;  3VR2 A;  4FXK C;  1Q1B A;  1PYW D;  4CKB A;  5JEA G;  4R9W A;  1CM9 A;  1B4O A;  1I6H B;  4RKL A;  5M5X B;  3QO2 A;  1BUV T;  2EE1 A;  2OF1 A;  1DD2 A;  2Y0S B;  3SDZ A;  4A3B B;  2IL8 A;  2VNU D;  3S17 B;  3JAM E;  2JA7 B;  1HUM A;  5IGF A;  4PMW A;  3TDQ A;  2MGS A;  4HCS A;  1OO9 B;  3NK9 A;  1ML0 D;  5I6W A;  3P1H A;  2F0V A;  4C3J G;  3MXU A;  5CV6 A;  4OGQ C;  1JE4 A;  2NUC A;  3QWN A;  5A35 A;  1DZ1 A;  5IGG A;  3NPP A;  2F0F A;  1IHZ A;  1JCK B;  3H91 A;  1A3V A;  2AUJ D;  4KY6 A;  2AQ2 B;  2JA6 B;  4K6L A;  3A7A B;  3M85 A;  4O42 A;  3VYR A;  3H09 A;  1YNJ D;  1PXU A;  1CHP D;  3SR1 A;  4RCO A;  3RZO B;  4CGY B;  4ID6 A;  2F0D A;  5DAU A;  3CRL C;  2A6H C;  3M4O B;  5K36 G;  4OIJ A;  3GV6 A;  2K5D A;  4X3T A;  4RGO S;  2MHV A;  3U9S A;  4BBR B;  3DHQ A;  2A6E C;  2MP1 A;  1DXM A;  2FMC A;  3T13 A;  1TT2 A;  4TSS A;  1EFI D;  3TP7 A;  1NR4 A;  3M3Y B;  1II3 A;  1TKW B;  3GO5 A;  4CJ0 B;  3DUZ A;  3GTL B;  5ISR A;  4L63 B;  2AWO A;  5BN4 A;  2R61 A;  5D65 A;  2K33 A;  1J8I A;  3WOE A;  4EQP A;  1I6V C;  1F9S A;  2G9H D;  4DFA A;  1WCM B;  4G7O C;  1IL8 A;  2F0M A;  2DN8 A;  2L11 A;  1TS5 A;  3WOF A;  3S14 B;  1ZKO A;  4XQJ A;  4ULL A;  3EFX D;  1Q1E A;  1VMP A;  2L1B A;  5IT9 E;  3I4L A;  1XYI A;  3MFG A;  4RAU C;  1EQV A;  2JYO A;  1SMY C;  1RJT A;  2JEB I;  3NWT A;  4MIU A;  2KA7 A;  5C6A A;  1Y1W B;  3KLS X;  3HG9 A;  3DEO A;  4PNY A;  1PFB A;  3NBH A;  5JAV A;  4K8J A;  4IUV A;  4J8Q A;  4FF3 A;  1HFN A;  3KBX A;  3HOY B;  1SE2 A;  3QIA A;  4XDX A;  1SAP A;  3K5M A;  3GTJ B;  1Q12 A;  2KCN A;  4RGN A;  1LLR D;  3OHX C;  1SE3 A;  4I65 A;  1BQQ T;  3AU7 A;  3V96 A;  2R3Z A;  1VMC A;  1S5F D;  3S1M B;  1MD2 D;  4PMB A;  2WP8 J;  3QOJ A;  4L6T B;  5EBC A;  3P20 A;  1AP0 A;  5D3D A;  1VF5 C;  3FPP A;  1U4M A;  2F0U A;  1GUN A;  1NUC A;  1I4H A;  3MA2 B;  4A3M B;  1ENC A;  4ZUI A;  1MSH A;  4XYO A;  4EGV A;  2F0W A;  4GZY C;  2F0E A;  3IAY A;  1ESR A;  5C3E B;  3PUY A;  3EA6 A;  2JP1 A;  1CHQ D;  1SYG A;  3X3M A;  1AEX A;  1HA5 A;  4NMZ A;  1AZQ A;  1CFM A;  2WB1 B;  4B9W A;  1ENA A;  1R4Q B;  1JQY D;  1EY9 A;  4WRD A;  1KTK A;  1CZW A;  1YNJ C;  2Q8I B;  1EYD A;  2RDF A;  2XWB B;  1U4P A;  2K28 A;  3K5N A;  5IOD A;  2A6H D;  1TU2 B;  1GUG A;  1EY4 A;  4FXD A;  2SNS A;  2VUM B;  1KNE A;  5I2X A;  3VR4 A;  4C3I B;  1EYA A;  4A3K B;  4NP5 A;  3FDT A;  4KJO A;  1EZ8 A;  3S2H B;  2MPM A;  1CT1 D;  3LWE A;  3QOL A;  1HTL D;  4Y7N B;  3G6J B;  4RGM A;  1HA6 A;  3KLR A;  3H3V C;  1PZJ D;  3A7L A;  1Y8P B;  2KEE A;  3I3C A;  2EPB A;  1JOK A;  3IFT A;  1A3U A;  4IN3 A;  2IJ0 A;  1CTM A;  1D5Z C;  2RVL A;  1AN8 A;  1E2Z A;  4OO1 H;  2CW0 C;  2H4O A;  1SMY D;  4QUC A;  2B63 B;  1EQT A;  1QNU A;  1PRT C;  3IFD A;  3EVQ A;  3PMF A;  3MXN A;  1SDF A;  3E0J A;  1IKL A;  3P75 A;  3FVQ A;  4WFN 3;  5JVG 3;  1UEA B;  3ERO A;  4DAP A;  1IYV A;  1EZ6 A;  3GTP B;  1EIG A;  4JBW A;  5M3F B;  4NDX A;  4BBS B;  5DEH A;  2EYM A;  2XRQ D;  4PMC A;  1W6K A;  5JEA J;  1SND A;  2ICE C;  4Q5V A;  3CRK C;  1LV9 A;  1TY0 A;  1VDZ A;  4XQN A;  2HUG A;  2QEJ C;  1JOO A;  2K01 A;  4HCE A;  3KLS A;  3PUV A;  5E4X A;  1OXS C;  2BOS A;  3R8B A;  4IUT A;  5C5L A;  5M3M B;  2JA5 B;  1JWS D;  2F0T A;  3T53 B;  2MJ8 A;  3I4M B;  3DWA A;  3QB3 A;  2JEA I;  1Y8N B;  2A74 C;  1LO5 D;  3MFY A;  1EWH A;  4G4K A;  4QMG A;  3HOX B;  5FLX L;  3I72 A;  1S5C D;  3CQZ B;  1LAB A;  1TS2 A;  5LL6 S;  4F88 A;  1DOM A;  2KED A;  3TN2 A;  2BDO A;  1SSO A;  3S15 B;  3Q24 A;  1VF7 A;  3M4Y A;  3T56 B;  4IFD H;  5IT9 L;  3BVM A;  1L0Y B;  3OIQ A;  1V1O A;  1BNZ A;  1C4Q A;  2ID0 A;  3C2P A;  4A3I B;  4C3I G;  3J81 E;  1K8O A;  3VR3 A;  1STG A;  4KK7 A;  3D3R A;  1D1K A;  3HOU B;  1SJE D;  3BYT B;  2R93 B;  1H9S B;  2C9O A;  2AWN A;  5IOC A;  1C8C A;  3NTK A;  1HRJ A;  1RTN A;  2KJX A;  1CA5 A;  1SYC A;  3H6M A;  1WTX A;  4HAE A;  1U4L A;  2GA4 B;  4IFD G;  2F0N A;  2BA1 A;  3K0Y A;  2F0S A;  2A5H A;  3HOW B;  1SEB D;  1STH A;  1IYU A;  3N6R A;  3NTH A;  2PYK A;  3S1N B;  3EJI A;  4IUQ A;  3A55 A;  1ZXT A;  3HOZ B;  4FF4 A;  1EYC A;  3J7Y W;  2FIN B;  5E3F A;  4B08 A;  2OEO A;  1LTS D;  3I8Z A;  1FNU A;  2L5T A;  2EY1 A;  2B2Y C;  2PZT A;  1FYC A;  1BCP D;  4IUN A;  3BDC A;  2H1E A;  3TSS A;  1SNO A;  5ELF A;  4ZYS A;  4M1U B;  2RDG A;  4XT3 B;  4KHZ A;  2A73 B;  1ICW A;  5EKK A;  1MI2 A;  5J39 A;  1QE6 A;  2ENB A;  4RWS C;  1TR5 A;  1SYD A;  1CZG A;  4EQN A;  1TS4 A;  1K83 B;  3QG1 A;  5CV8 A;  3TP6 A;  1WTW A;  4KN4 C;  5A2Q L;  3LWU A;  3HGB A;  2KCC A;  1PTO B;  5D3I B;  1AZP A;  2IT1 A;  1KDC A;  3A56 A;  2PCF B;  1O7Z A;  2NN6 G;  4H44 C;  1WTV A;  3S9W A;  5M5Y B;  3R93 A;  3L9A X;  1IKM A;  1B9M A;  2YYZ A;  2D9U A;  2PZU A;  3FRP B;  4MN3 A;  2N88 A;  3SEB A;  1UNS A;  3I91 A;  5TSS A;  3J80 E;  3IKJ A;  3U9O A;  1STB A;  3TBI B;  4V19 0;  1SYE A;  2PMZ B;  3PUZ A;  3K5L A;  4J1M A;  1MSG A;  3FKI B;  2FMM A;  2RSN A;  3L7Z C;  2J0T D;  1EU4 A;  1A2T A;  2NTS A;  1L0X B;  1QIL A;  4KD3 A;  3D8G A;  3NQT A;  2F0Q A;  4NW2 A;  2K04 A;  1BCP B;  3DEP A;  3D4W A;  3Q0A A;  2QIL A;  3C46 A;  5EPK A;  1JOQ A;  2B2U A;  2X6L A;  3PO2 B;  1FD7 D;  1GHJ A;  5CV7 A;  2BE5 C;  1BXT A;  2O5I C;  5G3L D;  1ZYR D;  2K05 A;  4H0L C;  4FYD A;  2RA4 A;  5ELB A;  1QB5 D;  4K5W A;  3URY A;  1DYQ A;  4HMI A;  5M5W B;  4JK1 C;  1H9M A;  4X3K A;  1BR9 A;  1X3P A;  1DM0 B;  1HQM C;  2KEC A;  2L55 A;  3VYU A;  4OL7 A;  4ILW A;  1QOH A;  3T51 B;  3J7A V;  1TQO A;  2DY8 A;  3VR5 A;  4C3H G;  3J81 L;  5M9O A;  2AQ1 B;  2E2I B;  1GHK A;  1M8A A;  1A15 A;  4F87 A;  4RKB A;  4LAA A;  1SXT A;  2EY6 A;  5IGB A;  2XRS D;  2DNC A;  1I4G A;  1HUN A;  1V1P A;  5KNB A;  3BDO A;  3C1F A;  4IFD I;  5CV5 A;  1TWF B;  1UAP A;  1GUW A;  4EQO A;  1WTP A;  4QF4 A;  2EZV A;  2EVB A;  5FO9 B;  4FF1 A;  3LNN A;  5CYU A;  2NVX B;  4IUR A;  4IUU A;  1BCP C;  3PIP 3;  1PTO H;  1FNV A;  5DNF A;  4FO2 A;  1GUS A;  3DXJ C;  1KLU D;  2B2Y A;  2FFK B;  3K7A B;  2R92 B;  4EVO A;  5FO8 B;  4A3J B;  4TQU S;  3OWE B;  1XTC D;  3V05 A;  3SK4 A;  2A68 D;  5CBE E;  4XIG S;  1YNN D;  1Y69 U;  1S5E D;  4KN7 C;  1O7L A;  5KNC A;  1EY7 A;  3AB9 A;  1G29 1;  3GP7 A;  2NVY B;  4R8N A;  5T1G A;  1H9K A;  1JR0 D;  1JB3 A;  3TZD A;  1G6Z A;  4AYB B;  1EY8 A;  4DXF A;  3KF8 A;  2KQ3 A;  2EYJ A;  1ESF A;  3KUP A;  3MVV A;  4N9P A;  2VB3 X;  5KIX A;  4A3F B;  4P2C B;  4PV1 C;  1ILP A;  4ZRZ A;  5JJZ A;  5J22 A;  1ZEQ X;  1NCV A;  3RLF A;  2RSO A;  4J6H A;  4BS9 A;  4BY7 B;  2MUY A;  3ZYY X;  5I9O A;  4ZQ3 A;  4QCL A;  3AMU A;  1ET9 A;  3MAQ A;  1JWM D;  3HZX A;  2E74 C;  3K5O A;  4K2K A;  1QCB D;  3SHL A;  4I7Z C;  3LX0 A;  1HQR D;  2SDF A;  2OT2 A;  3X3N A;  2OXP A;  1RDP D;  4K14 A;  4M8A A;  5C4X B;  1WTO A;  1F77 A;  5I4D A;  4F8M A;  1WTR A;  1B3A A;  1X32 A;  5ELD A;  1RCV D;  5LL6 X;  3VYS A;  2O5J C;  2FJ2 A;  3S2D B;  4ABN A;  2NZ1 D;  3A8J E;  4PQX A;  3W2D A;  1EWC A;  1F2Z A;  4H13 C;  3OMG A;  3GTM B;  5CV4 A;  1O7Y A;  4KKS A;  1EU3 A;  3S1R B;  3D4R A;  3BDL A;  3GTQ B;  3SE0 A;  2Q8R E;  1NR2 A;  3H94 A;  1JC7 A;  5C4J B;  4CKC A;  5NUC A;  5C3W A;  3I73 A;  4ZAI A;  2EXZ A;  2F3W A;  4RH6 A;  4K5X A;  4CBV A;  2EY5 A;  4FXG C;  1B53 A;  5FK9 C;  5CC4 A;  2E76 C;  3FEW X;  1HTP A;  2K5W A;  3T4A C;  1GOZ A;  4LMQ D;  1TWH B;  3K59 A;  1MBY A;  1STA A;  3EQL C;  1PZI D;  2RKS A;  5IGD A;  2IWH A;  3SXH A;  4KY7 A;  5BN3 A;  1LTT D;  2F0H A;  4A93 B;  1M4V A;  5C44 B;  1MGS A;  1I3Q B;  3ND8 A;  3RD4 A;  3GTK B;  2PO4 A;  3W3A A;  4XQQ A;  4KD4 A;  1T5X D;  4TKO B;  2JE6 I;  4KKU A;  3D6C A;  1PLF A;  2NBF A;  1KNA A;  5CV9 A;  1FR3 A;  3NQI A;  5K36 H;  5E1F A;  3V2T A;  4C1N K;  2RBM A;  4C2M B;  4IFD J;  5J1Z A;  2VXW A;  1I50 B;  4QIW B;  4HN7 A;  2F0K A;  2EJF C;  4C3H B;  3SVM A;  1SYF A;  3A8I E;  3MC0 B;  2NVQ B;  1Q90 A;  3BVZ A;  2B2T C;  4DA2 A;  3OOC A;  4OO1 G;  1C48 A;  1YNN C;  4CHT B;  4ME5 A;  4Z9C B;  3MWY W;  2F0O A;  1G8Z D;  2F0J A;  3NSW A;  1HHV A;  2VB2 X;  2L0C A;  2O2L D;  5F2D A;  4H7B A;  1ZYR C;  4XTC S;  1Y1V B;  2QF7 A;  4K6D A;  2B2T A;  1JIC A;  2X6G A;  1LT3 D;  1Q8I A;  1PMR A;  3BS1 A;  5I2Y A;  5DM6 3;  4TRD A;  4B9X A;  3R3O A;  1CQF A;  1RHP A;  1BO0 A;  3TP8 A;  5C0X J;  3NBI A;  2JA8 B;  4OHJ A;  2IX1 A;  1CA6 A;  4DXG A;  5I6Y A;  4KY5 A;  4NKL A;  2D2C C;  5HUR A;  1PFN A;  4K2L A;  5EGT A;  1VCI A;  5KND A;  4IAL A;  4KHV A;  5FKA C;  3TZU A;  5C4H A;  1AW7 A;  4QB4 A;  1GJX A;  1F9Q A;  1V43 A;  2NYZ D;  3RZD B;  1PZK D;  3DWP A;  1WVL A;  2F3V A;  3ERQ A;  3KBG A;  3C1E A;  1LTI D;  1OXV A;  3I90 A;  3KK7 A;  3HKZ B;  4ZLT F;  4G7Z C;  2HCI A;  3PV0 A;  4LJZ C;  3NE5 B;  1R9T B;  2A6E D;  3RUZ A;  4ZKB B;  5JPM C;  1CI3 M;  1WTQ A;  1A2U A;  1X3Q A;  3OIP A;  1U4R A;  2E2J B;  1Y8O B;  4CKE A;  4WOR A;  1B9N A;  4KKT A;  2B2V C;  2X69 A;  2ICI A;  4KTA A;  1OXT A;  2NVT B;  1SYB A;  2K6A A;  3G7L A;  2AQ3 B;  1G2T A;  1DOK A;  4DNT B;  2NB0 A;  4U67 3;  2I46 A;  4BA1 I;  2LKV A;  3HP3 A;  2K7V A;  2ZT9 C;  2EJM A;  4HSP A;  1XXG A;  5CBA E;  1PRT F;  5EKL A;  1ONL A;  4RHS A;  4N9T A;  1EIH A;  3FPU B;  4DF7 A;  2BDN A;  2F0P A;  4U68 A;  4G7H C;  1EY5 A;  2KHS A;  3D31 A;  1ILQ A;  4A3G B;  2SOB A;  3VA5 A;  3H0G B;  4UAI A;  1ET6 A;  5EPL A;  2QCP X;  1QJO A;  1QG7 A;  1SE4 A;  1S4Z A;  2IX3 A;  1BF4 A;  4KJN A;  4C56 C;  3M7G A;  1A6X A;  4E6I A;  3D6W A;  3JAM L;  1XX8 A;  3C3L A;  1DON A;  2LFN A;  4RGT A;  3GD7 A;  3PUW A;  4BA2 I;  1LT4 D;  1LT6 D;  3BG3 A;  5G3L F;  2L4N A;  4IUP A;  1TWA B;  2EY2 A;  3K58 A;  1ENF A;  2I07 B;  5IGE A;  2ZXO A;  1EOT A;  2A68 C;  4DGZ A;  2IPK D;  1JOR A;  1SJH D;  3I4N B;  1EEF D;  5C0X I;  2WII B;  2LMC B;  3MXP A;  3SK8 A;  2K03 A;  4ZK9 B;  1BOS A;  1O80 A;  1KDA A;  4FVM A;  5I9P A;  3J7A F;  1V8Q A;  4XYQ A;  3NP8 A;  2HQE A;  3HRZ C;  3NWS A;  2TSS A;  3Q6S A;  2XNA C;  4QUF A;  2Z8L A;  4A3E B;  3GQB A;  1PDQ A;  2FHT A;  1H9J A;  1RF2 D;  3PO3 B;  2WV6 D;  1NAP A;  1T5E A;  2PW5 A;  2NTT A;  2M00 A;  2LS0 1;  2CVR A;  2QKI C;  1GUO A;  2B39 A;  3DWQ A;  2HDM A;  1D2B A;  2EDG A;  3HOV B;  4HMJ A;  4YIJ A;  2F4I A;  3QJY A;  1S5B D;  2B2U C;  1WD0 A;  5K5P A;  2N55 A;  2YU9 B;  1K8M A;  3HS0 C;  1D5X C;  3RMH A;  1U9R A;  1I4Q A;  4IQZ A;  3OMC A;  2HCC A;  2BE5 D;  5E4W C;  2JXM B;  4DU9 A;  2XVS A;  3D4D A;  1J9O A;  2NN6 H;  2D5D A;  3MEH A;  1TY2 A;  1FNW A;  4CJ2 C;  5EQ0 A;  2WKD A;  1H9S A;  1HFG A;  2E2H B;  5COY A;  2RDH A;  5JPN C;  1SNM A;  1SNC A;  2EYL A;  5KYL A;  2HDL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...