1XX8A

Nmr structure of the w24a mutant of the hyperthermophile sac7d protein
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
66
structure length
66
Chain Sequence
MVKVKFKYKGEEKEVDTSKIKKVARVGKMVSFTYDDNGKTGRGAVSEKDAPKELLDMLARAEREKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Sac7d
publication title Role of a surface tryptophan in defining the structure, stability, and DNA binding of the hyperthermophile protein sac7d
pubmed doi rcsb
source organism Sulfolobus acidocaldarius
total genus 4
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2004-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02294 7kD_DNA_binding 7kD DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1xx8A00
2NYZD 2HCIA 5E4XA 4X3TA 3TN2A 1B4OA 4IUQA 1G2SA 2M2LA 2MGSA 2B2TC 3QO2A 1HUMA 1MSHA 1ML0D 2HDLA 4R9WA 1XYIA 3G7LA 2KEEA 1ILQA 1X32A 2B2WA 3I90A 2J7ZA 3ONAB 1O80A 1WVLA 4OIKA 4ZK9B 3SVMA 4X3KA 2NZ1D 2N55A 1SDFA 2X69A 4IUPA 1CA5A 3I91A 2DY8A 3P7JA 1WTPA 2L12A 5EJWA 5EKIA 2RA4A 1EIGA 2B2TA 2HCCA 5DNFA 1BNZA 1ESRA 1AP0A 1ZXTA 1B50A 4LMQD 4RAUC 3IFDA 2CVRA 5E4WC 1A15A 2MJ8A 2N88A 4XT3B 1WTVA 3GV6A 3I3CA 1O7ZA 2IL8A 1JICA 2B2UC 2MP1A 1SSOA 3FDTA 3IL8A 1PDQA 1EIHA 1IKLA 2X6LA 4U68A 2KECA 2X6GA 2HUGA 4IUUA 4CJ0B 2MPMA 1RJTA 2R3ZA 4HCSA 1KNEA 1DZ1A 1X3QA 2HDMA 4X3UA 4R8IA 1AZQA 1EOTA 2D9UA 1DOKA 3H91A 1KNAA 4IUTA 1G6ZA 1VMPA 1RHPA 2L11A 1HA6A 2EPBA 1BO0A 1U4LA 2KVMA 3DEPA 4RA8A 2Q8TA 4CJ1B 1WTOA 1WD0A 4XT1B 1JE4A 4NW2A 2SDFA 1F9SA 2B2UA 2FMMA 5EPKA 3R93A 2FJ2A 5CBEE 2B2YC 1WD1A 1VMCA 2K1BA 3N52A 4HSVA 4X3SA 1HRJA 4MN3A 3FPUB 1PLFA 1LV9A 1CM9A 1WTWA 4MHEA 1ILPA 1B2TA 5EPLA 1ICWA 1XX8A 2RVLA 1U4PA 1NR4A 2B2VC 3HP3A 3MTSA 4DN4M 5D65A 1IKMA 2KEDA 1DOMA 5EQ0A 1NAPA 2JP1A 3TZDA 3DEOA 1MGSA 1Q3LA 1GUWA 1B3AA 1F9PA 3LWEA 1WTQA 2K03A 2KUMA 4HAEA 1J8IA 1SAPA 5CBAE 3DM1A 3GV3A 4ZAIA 1F9QA 4ZLTF 1MSGA 1CA6A 1O7YA 1HUNA 4O42A 1QG7A 1RTNA 3F2UA 4UAIA 1HHVA 1RTOA 1PFMA 1EQTA 1F2LA 1RODA 2FFKB 5T1IA 4OIJA 1G91A 1U4MA 2DY7A 1F9RA 2EOTA 3KUPA 5T1GA 1QE6A 1DONA 1J9OA 1G2TA 2FINB 1QNKA 1TVXA 2BDNA 2L1BA 3D6WA 4IURA 4XDXA 2K01A 2XIWA 5CMDA 4CJ2C 5EPJA 3KBXA 1AZPA 5JJZA 3I8ZA 2K04A 1M8AA 4QUFA 1BBXC 5COYA 1NCVA 1X3PA 4RWSC 1HFNA 1EL0A 2VXWA 3UI2A 2FHTA 5CORA 1BF4A 2K05A 1DOLA 1PFBA 2B2YA 1MI2A 5AFWA 1HFGA 2Q8RE 2JYOA 4ZKBB 5D14A 1PFNA 2EE1A 2RSNA 4ZKCB 2B2WC 2L9HA 1E0BA 2K28A 1NR2A 1S4ZA 2L4NA 1U4RA 2RSOA 3Q6SA 1IL8A 2KOLA 4QUCA 2B2VA 1WTXA 1B53A 4IUVA 2NWGA 3MWYW 4HEDA 2H1EA 1WTRA 1C8CA
chains in the Genus database with same CATH superfamily
1QUQB 1GM5A 1BOSA 3D6CA 3SGIA 3HOWH 1V1PB 2MGSA 3D4RA 3E0EA 5KGUA 4GN4B 1ILQA 4I7ZC 3QWNA 3NXWA 3MEHA 2YTVA 3HS0C 3KDFB 2R7ZG 3F1ZA 3LX0A 2EJGC 3J80c 2L12A 3NQTA 4MIUA 1Q82C 1Y1VH 2HCCA 1SE8A 5GAEC 3G4SA 3PF5A 1EQQA 3I4MB 2K32A 1GHKA 1IBLL 5CV4A 4A3EG 5FO9B 4A3JG 1A15A 1Q86C 4DV4L 2F0NA 2WP8J 5L37A 4HJAA 5FLXc 1G51A 2X6GA 1E1TA 3VYTA 1H9SA 1UEAB 3SHLA 3H91A 1D6EC 1Y8OB 2F0TA 2DJFC 4QL5A 4DGZA 4KKSA 1I3QB 2FMCA 4WJWA 4MTKA 2Q2UA 2R7ZB 1F9SA 4X64L 2A8VA 2VW9A 2Z8LA 1S5ED 2K1BA 3VA7A 1QILA 4P74A 4JG2A 2V4DA 2H4OA 1ICWA 5JJLA 4A3BG 1SFOB 3HOVG 4A3EB 5NUCA 4A3JB 5M3FH 1F9PA 4LFBQ 2JJQA 3K8AA 3GV3A 3A8IE 2WV6D 1K3BC 4QQBX 3BYTB 2E2JH 1TQOA 2M00A 1D2BA 3DM3A 4OX9L 5T1IA 3DMUA 1PH8A 2WINB 3CAMA 4IALA 1G2TA 1YJ9A 2XVSA 1NE3A 2EYOA 3HZXA 3D6WA 3PUXA 4OL7A 4BS9A 1VQ5A 5JJZA 1M8AA 2M9VA 4IFDI 1EFID 3NTHA 5D3DA 1EFWA 1KIXA 4JI0Q 3KBGA 4A3BB 4DF7A 2VUMG 1EY6A 4RG1A 3HOVB 3AFQA 3GTMH 1I4XA 1K0RA 1SNQA 3AQQA 4C3HH 3WOEA 2CW0C 2PMZB 2RQXA 2VB3X 2B39A 4ZQ3A 1FJGL 4E6IA 3KF6B 1C9OA 2H1EA 2FXQA 2Q2IA 3L9AX 3HGBA 1SYBA 3VR6A 5C4XH 1XMQQ 2QW7A 4A3FH 1C0AA 1TWFH 1LT6D 1S5BD 4NXNL 4LF8Q 2CWAA 2J0TD 4LUZA 4BBRG 5C0XG 2EXZA 5J22A 5J39A 1VQMA 3MA2B 3SK6A 4L8JA 3BVGA 2VUMB 1NBWA 3AU7A 3MXNA 4BY1G 2B8GA 3S15B 4DR2L 1K8GA 3S24A 1B44D 1A6XA 1SLJA 1Q7YC 1E24A 2Z9HA 4LNQA 4N8FA 2IL8A 1L0XB 1V1OA 1UE1A 1L2FA 1EEFD 1E2VA 1NY4A 1CI3M 1CKNA 1XMOQ 1DZ1A 1BCPD 4ME5A 4BBRB 1C48A 3VR3A 4R4IA 2R61A 2E8GA 2E2HH 3F8TA 2SDFA 4IUNA 1OXVA 2FJ2A 1WD1A 1QZHA 2I5HA 3N52A 3OW2A 2R92G 3NWTA 4DK6C 1B2TA 1PTOC 1NJIC 4KJNA 4BY1B 1WI5A 2JP1A 4EVOA 2UUBL 4DV3L 4LF6Q 1HTLD 4JPBW 3QG1A 2N78A 1JMCA 1XWEA 3FRPB 2QF7A 1IBKL 3KLRA 2C9OA 4OO1H 4UDUC 1QOHA 4IOAA 2EYHA 1EQTA 2F0QA 3HRZC 1W6JA 2FINB 1ASZA 4YHHQ 3M4OB 4CJ2C 3G71A 2ZTCA 2VS1A 3FHWA 4BXXG 2R92B 5COYA 3DXJC 2F0DA 3I2ZA 2Z4HA 1ZEQX 4K0KQ 1XNQL 4ULLA 2Q8RE 5C4JH 5J1ZA 4YCUA 3KF8B 2IY5B 1GUTA 4OWXB 1IL8A 3CHBD 3J80E 5FKAC 1EY8A 2LMCB 2RDHA 4DR4L 3H0GH 4LF5L 3RZDB 2EYLA 3S1RH 4OONA 2A5HA 3HKSA 3C1EA 3EFXD 1A2UA 4DAPA 4K2LA 2KBNA 5FLXE 1KQSA 2UUAL 4LAAA 2DN8A 1B9NA 4IPCA 4NDXA 1T5XD 4KV6A 5EJWA 4GNXB 2ZXPA 1BNZA 1WFQA 2CFMA 1Q1EA 4LF4L 1TWGH 1YEZA 2IPKD 3H15A 2F3WA 1X9NA 1ET6A 2B2UC 4C2MB 4ALPA 1TWHH 3DWAA 3C1FA 4HTHA 3NE5B 1Y8PB 1TS5A 1EIHA 1LO5D 3BG3A 1SJHD 4JI2L 4HCSA 2HDMA 3AFPA 3CQZB 4IUTA 4RKBA 5EBCA 1IHZA 4K6LA 4Y7NH 4BA2I 2MO0A 2EDGA 2AQ1B 4IFDG 2RDGA 2P5ZX 3KLSA 2JA8H 1D5ZC 4ZCKA 2XTIA 4JI4Q 4MHEA 1ILPA 1U4PA 3T56B 3PIP3 2HT1A 2WIIB 1JOKA 2B8FA 4AYBE 1EUJA 3PO2G 3PIOA 3NSWA 2CW0D 4RCNA 3UDXA 4P72A 4ZLTF 2EYJA 2LFNA 4NPSA 4OXPA 1UWVA 1MSGA 5HY6A 1CA6A 5C3XA 3K7UC 4POFA 4DU9A 4OX9Q 1QNUA 4JC0A 4ZUIA 4KHPQ 4YWLA 4G4KA 4NKLA 2SNSA 4JBWA 5KNDA 5IGGA 3E0JA 4N9PA 2GVAA 3A54A 2PPBC 1KLUD 1X3EA 1YNXA 3J81j 2EVBA 5D3IB 1PA6A 1VQ6A 1TIID 2XNAC 1D7QA 4M8AA 5EKKA 1HFGA 4JI1L 3PO2B 4GS3A 2B2WC 3KLSX 4L5SA 2UXBL 4A3LG 2KCCA 4WRDA 4UP8A 4EQPA 2EJMA 4RGMA 3CF5A 2QDLA 3GTOH 5IP9H 3CCSA 4R9WA 2CH4A 5C5LA 1CT1D 4QY7A 2Q8IB 2F0JA 2LSSA 2NZ1D 1QZGA 1I6VC 3W3AA 2DY8A 3K5OA 4DK0A 1CKOA 3R2TA 4K5XA 1CUKA 1U9RA 1N34L 1PTOD 3P1HA 1GXDC 3GTQH 5EGTA 4JOIC 4KLKA 2WKDA 2ZM6L 4Q0FA 4GKKQ 2EYMA 3T51B 3JAMi 1WJJA 4IJHA 4G7OC 1GUGA 1SYCA 3HOZG 4A3IG 1QVFA 1EY7A 3S1NB 5BN3A 3SEBA 2TMPA 3G6EA 1R9TB 1I50B 4R8IA 3RUZA 3S14H 1VMPA 3URYA 3OWFA 2EPBA 1CTMA 1KAAA 2IX3A 1CZGA 5LMUQ 1PYBA 2OWOA 4PNYA 2EYPA 3HG9A 1LTGD 4LFCQ 2R93H 1Z47A 3CCEA 2UUCQ 1PH7A 5FLMH 1HR0Q 2F0WA 2JA6G 3OPOA 2KEDA 2EY1A 4RGOS 4DV3Q 1B3AA 3BS1A 1I6HH 1MIUA 1UE7A 4A3DH 5CBAE 4ZAIA 4GOPB 4X62L 3HOZB 4A3IB 1TT2A 1VCIA 1V1QA 3FP9A 5IYCH 3CU7A 1NNXA 1F77A 4A3MG 1YJWA 4CGYB 4JI7L 1BR9A 1E7ZA 3FPPA 2JA6B 2A74C 4V190 2Z0SA 1W2BA 1XNQQ 1VQGA 3HFZB 5AFWA 2JYOA 4ZKBB 5KIXA 1PFNA 1A2TA 1VQLA 4JI6Q 5C3EG 3V05A 1PV4A 5LMNW 4WJ4A 4L5TA 2ENBA 1JOOA 4DK3C 1SE2A 2XWBB 3CCJA 4DR7L 1TS4A 3BDLA 1YHQA 3S16B 2BH2A 1EY4A 3BU2A 4RH6A 2CQOA 3BDOA 3QOLA 1PH1A 4WFN3 3VYSA 1SYDA 4NB3A 5E1FA 2MUYA 4DK1A 4A3MH 2JEAI 1U5KA 4LWCA 3HOYH 2JEBI 1SNMA 4LF4Q 2QILA 2K5VA 4AQYL 4LF7L 1OXSC 4JI8Q 5C3EB 4GKJQ 2PNHA 1O7ZA 3BDCA 5ELOA 4GLAC 3S1MB 3PCOB 1CFMA 4IZ8A 2ZJPA 2B63G 3NP8A 1PDQA 3NELA 1IKLA 3SXHA 4ILWA 5GADC 2HUGA 1UEBA 2CWPA 1JCKB 4JI2Q 5BN5A 1KNEA 4UP7A 1SBBB 2UXCQ 1DOKA 3CCVA 4FO2A 2OTJA 5ELBA 1WD0A 1EZ6A 2JSOA 3MFGA 4XT1B 1FNUA 5C0XJ 3HOWG 4DV2Q 2F03A 3U9OA 3D8GA 4XQNA 1WTWA 4GNXC 1XTCD 4HIDA 5D65A 5EQ0A 5K36G 2NVTH 4JYAQ 2SNMA 4TRDA 3NHHA 2LY7A 1LTRD 1HZ9A 5JPNC 2B63B 4A3KH 1KXLA 4JBKA 4MNOA 1HHVA 2ZXOA 1U4MA 4LJZC 2EOTA 4HIMA 1G8ZD 2L1BA 1LTLA 3HOWB 4L63B 3S17H 1TWCB 3ULJA 3I4NH 4JBMA 1EL0A 2VXWA 4DR1L 1GUOA 1K83H 4UHVA 5IODA 2EE1A 5LL6X 2YYZA 1SROA 5GAHC 3T1YQ 2DGYA 2J4XA 2UXBQ 2I5MX 3FKIG 1B53A 1EIYB 1EEID 1BXTA 3K57A 1GJXA 1O7LA 1STEA 1DXMA 4X3TA 4DUYL 2JE6I 1IYJB 5J3BA 1XYIA 5M5WH 3GTGH 4O1NA 1N8RC 5CV9A 2PQEA 2K52A 4OHJA 5IY0A 2A73B 3TDQA 3RZOH 4GLVB 1TWAH 1OO9B 4LFAL 3CCRA 1VQ9A 1PTOH 2AWOA 3KLWA 1BBUA 1CHPD 1MHWC 1L1OC 3IFDA 4OWWB 5C6AA 3FKIB 1K28A 4QJFA 1VQOA 4C3HG 2NN6I 3P75A 4CDEC 4IUUA 1QWYA 1RJTA 3GO5A 1QVCA 1OXXK 1PFSA 3QIAA 4FYDA 1HZBA 4JV5Q 4DV7L 2F0HA 3K5LA 4QMGA 2I07B 5IYDH 2B2UA 1SXTA 1NTGA 1VMCA 2WAQE 3MFYA 3I55A 1HRJA 4L6TB 1FD7D 4B9XA 1PLFA 4YY3L 1YNJC 1H9MA 1NR4A 2OF1A 1RKNA 3EIVA 1X54A 3ZJYC 3T1HL 1I4RA 2EXDA 3T53B 5JVG3 1H9SB 1HCZA 4N8X1 4C3HB 2VQEL 2YU9H 3ITPA 4O42A 1BDOA 1RODA 2BH8A 3BVZA 2ZXRA 5AJ3L 5BN4A 3HOXH 2K01A 4JI7Q 1TWFB 3KBXA 3HOUG 1AZPA 1DD2A 2QDBA 1VQHA 3H3VC 4IFDJ 2F0IA 1P16A 1PH2A 1YZ6A 1K8MA 2D5DA 3S1QB 2VQFL 4KD4A 1KTKA 2UU9L 1DOLA 1KABA 2B2YA 2V1CC 4KHZA 4JK1C 3CMEA 3OHXC 4JW0A 4C1NK 4G7ZC 4KN7C 3Q0AA 4A3GH 4QUCA 3NK9A 4GOPC 2KOLA 3RNUA 1WTXA 2NWGA 3MWYW 4DAVA 3DHQA 1PH4A 4B3SL 1C4QA 3RLOA 2NYZD 5KNBA 3LNNA 2DNCA 5BR8Q 1G2SA 3QO2A 4DA2A 1HQMC 2KCTA 3QR8A 2EZVA 4MTNA 3I7FA 2B2WA 2EY6A 3I90A 4POGA 1YITA 3HOUB 1LTTD 3C3LA 3I91A 5IWAL 2NVYH 2NVQB 2E2HB 3MZ5A 1Z6HA 2E2IH 1N32Q 1ESRA 3I4MH 3M3YH 4LF7Q 2OTLA 3MXPA 5E4WC 5CV7A 4DNTB 1XNRL 2SOBA 4XT3B 1EWIA 1IYVA 4PV1C 1B9MA 2BA0A 1PVOA 4A4IA 2F1MA 3TMEA 1AZQA 1OXTA 1PZKD 3B6YA 3EJIA 4JOIA 2DUDA 5C5MA 1I3QH 1UNSA 2A69C 2VL6A 4RHRA 2E74C 3H0GG 2R7ZH 2BOSA 1VDZA 1BBWA 3MXNB 4HCEA 4ZRZA 3U4VA 3JAML 4CDCC 1Y8NB 2HQLA 2AMCB 5C4ZA 3F2BA 3E6ZX 1SFOH 1Y69U 1DOMA 4A3EH 3ZYYX 1SE4A 4X65Q 3K0YA 3SK4A 1MGSA 1JJ2A 4A3JH 2RF4A 5FK9C 3OTOL 1F2YA 2ATWA 1CKNB 5C4JB 4KD3A 3NENA 5DAUA 3CC4A 3PGZA 5ELDA 3A55A 3A0JA 2L15A 2WKCA 1QG7A 4QGUA 1E22A 1ENAA 1G91A 2R7DA 1AEXA 1Q8KA 2LXKA 2F52A 4DR3Q 3H0GB 4L5QA 2TSSA 3NBIA 3S1RB 3PUZA 4B9WA 5JEAJ 2NVXH 1X3PA 4RWSC 4B3MQ 1MKHA 4KY5A 4DUZQ 2F3VA 1KDAA 1VS0A 3CC7A 4A3BH 2K5DA 1LM0A 4UPAA 1MI2A 1I94Q 2JA8G 3CKIB 2MHVA 3DUZA 3PIO3 1E0BA 3UI2A 3Q6SA 5IGCA 2B2VA 1VQJA 4DV0L 1B7YB 2NN6G 1SYFA 4EQ5A 3MHBA 2PI2E 1HNZL 5IIFA 2EJFC 2VZAA 4IO9A 4ZYSA 1WOCA 1Q8IA 1DGSA 1ESFA 4KTAA 4B08A 1J6QA 4F7XA 2JK8A 1PH3A 1K73C 1JE5A 3U50C 2VUMH 4JI5L 1YNJD 4LF9Q 3JAMc 4KK7A 3S15H 3P20A 2JA8B 5I6YA 5JAVA 4RAUC 3RLFA 4FDBA 1V9PA 4TSSA 3UE0A 3TP7A 2F4VL 4ID6A 4R4OA 5DM73 5CV5A 2NZHA 2ZTEA 3CD6A 2IHFA 5A35A 3M7NA 2Q2TA 5ELNA 3W2DA 4P2CB 4FF1A 4BBRH 3KK7A 1KDBA 3I56A 2RCNA 5LL6S 1FNWA 1K3RA 4JI3L 1JE4A 1JQYD 2R7FA 1FGBD 4IPGA 4NW2A 3PUWA 4XXEA 3A8JE 5M5XH 1N36L 2ZJRA 2ICIA 4X3SA 4MN3A 3J81i 3BVMA 3FPUB 1IBLQ 1F2MA 1ZYRC 3UDFA 5E3FA 1JWMD 4BY1H 3MTSA 4DV4Q 1RD9D 2ASBA 2PNRC 4H0LC 3T1HQ 1MBYA 1STHA 2A6HD 2L5TA 1KHIA 3ULLA 1S5FD 5CYUA 3S2HB 3L2PA 1R4QB 1PFMA 1X55A 1EYGA 4X64Q 1HR0W 1JR0D 3RN2A 4DXGA 3EVQA 1DM0B 3NTKA 3M4OH 4JBJA 2RHSB 3AMUA 3I8ZA 1CSPA 1ET9A 4HJ7A 4RMFA 2VQFQ 4R4TA 3MXGA 4XTCS 2K05A 2F4IA 2JA5H 4H02A 1GOZA 3E9IA 1HNXL 1HA6A 1IW7C 1VQPA 1IBML 1RL2A 3I4LA 3TQYA 1C8CA 1X3FA 1GO3E 1ASYA 2CCZA 3RZDH 3GP7A 3VYRA 1Z9FA 1C7YA 4X66L 1MSHA 1XPUA 5F2DA 3I72A 2KQ3A 1W3SA 2AWNA 2VNUD 1SEBD 5IYCG 2GN5A 2A69D 1HH2P 3TS2A 1SR3A 2JA7G 2N55A 3S14B 3M7GA 4UY8C 4HIOA 5IWAQ 5IT9L 4NP5A 1K9MC 1EIGA 1FJGQ 4H44C 3VR2A 1Y14B 1KDCA 1PH5A 1KD1C 3GD7A 4HSPA 1XNRQ 1SNOA 4WJ3M 3GV6A 1JICA 3DWPA 4NXNQ 2PMZE 4A93H 4U68A 2XSCA 1D8LA 2K7VA 2LS01 3OW7A 4CJ0B 3A5UA 1SNCA 5IP7G 4DV6L 1GVPA 2O2LD 4X3UA 3RLNA 3CQZH 3PUVA 1L1OA 5JOBA 1CKMA 5GQOA 4RA8A 2F0LA 1J5EL 4A3CH 2JA7B 1VQKA 2FMMA 1B70B 1UAPA 3GDEA 4DR2Q 1KLGD 1LACA 2F0GA 2SEBD 3F2DA 4DAYA 3GTLH 1XXGA 5LMNL 2A68C 1IKMA 4KMUC 1YNND 1NAPA 2N3SA 3PV0A 4C3IH 1Q3LA 1E2WA 1Y1WH 1Q90A 1VQAA 1GD7A 1UUPA 4DAMA 5C44G 3NBHA 3J7AF 2BDOA 4IPDA 3R3OA 1HUNA 1EQRA 4OEMB 4TQUS 1B8AA 3TSSA 2NBFA 3GTJB 3RR5A 5ELCA 2HQEA 2JXMB 1X3GA 5JEAG 4YCWA 2A6ED 1E2ZA 4IFDH 1PYWD 3SDZA 4ABNA 2K04A 3I4OA 1WCMH 1VQ4A 2UUBQ 5I9OA 1CQFA 1BKBA 4O2DA 4EX5A 4BBSH 4A76A 1D5XC 5IT9c 3I70A 2Z6BA 1RDPD 3CPWA 2KHJA 4GZYC 3PO3G 5D14A 1IBKQ 3PO2H 1NMGA 4ZKCB 5C44B 4C3JH 3T13A 4DV0Q 4R1JA 1EQVA 4UP9A 1WTRA 2B29A 1ICFB 4GLXA 2EY2A 3JAME 3A74A 3ERSX 3K7AB 4KJOA 2KHSA 1QCBD 4ODGA 3WDNA 4A3KG 2F3IA 1VQCA 4H7BA 1ONLA 5K5PA 2CQAA 1WVLA 2DNEA 5KEEA 1T9HA 2F0EA 1KRTA 3V2TA 3W1GA 5DLQE 4Y52H 3IAYA 1S3OA 5EKIA 3SK5A 1ZYRD 3LWUA 1FGUA 4K2KA 3I4NG 2BE5C 3PO3B 4I7AA 4K5WA 1JB3A 1SJED 3AEVA 1WTVA 4DR4Q 4LF5Q 3PF4A 4CDDC 4R4QA 4LFBL 3LGJA 1R9TH 1XPOA 4A3KB 1EOTA 3FEWX 3ULPA 2AHOB 4DR5L 2UUAQ 3CCMA 4NXML 3OIQA 1JB7A 3U4ZA 4P71A 1YHAA 2Z6KC 5EPKA 3SR1A 1GUNA 3ICEA 3K80C 4IPHA 2XWJB 2F0MA 3PUYA 4HSVA 5JJKA 3H3VH 1SNPA 2RDFA 2Z1CA 4KHVA 5LHY1 4X6AH 3S17B 3A7LA 2K5WA 2F0VA 2C35B 4XQQA 3I4NB 2OXPA 4RFBA 4FVMA 4K5VA 3DEOA 2Z4IA 5C4HA 1FL0A 4XQJA 4JI0L 1QB5D 2EQSA 1B3QA 1K83B 5KRUA 1IW7D 4CKBA 1L0YB 1VQIA 4LUOA 4A3IH 3GTPB 1VQBA 1W6KA 2MO1A 3F2UA 4OO1I 1CQVA 3PQIA 2FFKB 4OIJA 2I5LX 5IYBH 1STAA 2PW5A 1XTDA 4B3TL 4FF2A 3SE0A 3UDGA 1XMQL 2EY5A 5FO7B 2AUJD 5H1SE 2QCPX 5M5WB 1N33L 3J7ZC 3F2CA 2JQOA 3MXUA 1SYEA 4C1NI 5IYDG 3TS0A 1KAWA 1HJPA 2EYFA 4M1UB 2JA6H 5ELFA 1Y1VG 3S9WA 3BZDB 4OELB 2XRQD 2WFWA 1A3UA 1HNXQ 1PZID 1PTOB 2D62A 1IBMQ 3S2DB 2IW3A 2ICEC 1AN8A 1SE3A 1G291 5E4XA 1VQ7A 3R8BA 2M2LA 4X66Q 2HDLA 3STBD 2PQAB 1GUSA 1Q46A 4BY7H 3S16H 2E76C 3CCLA 5M5YH 1EU4A 2J7ZA 1XMOL 1YIJA 1HNWL 4IOCA 1HA5A 5EAYA 1FNVA 1AE2A 4IQZA 4JI1Q 2RA4A 2OQ0A 3TEHB 1Y1VB 5CV6A 5DNFA 1AH9A 1WTHA 2A68D 5M9OA 4RHSA 1STYA 2LXJA 3RD4A 1Z7TA 4AH6A 4CKEA 5C3EH 5M3FG 1X6OA 2NUCA 2ZTDA 3I3CA 4ME3A 1YBYA 2AQ2B 3WOFA 5CC4A 4V0BA 4GN5A 4LF6L 2HIVA 4S3SA 1RF2D 2AQ3B 2MPMA 3J7AV 3GQBA 2PI2A 3BZKA 1STBA 3U9SA 1KNAA 1RHPA 2IX1A 1U4LA 4LK1C 2NZOA 3PMFA 3R93A 1ENCA 2HIXA 1N34Q 1E3PA 4YHHL 1PXUA 1LV9A 4PMBA 2O4XA 4CDFC 2MFIA 2ZM6Q 4KY7A 3KJPA 3D4DA 2O5IC 1FR3A 5M3FB 5IGEA 1WTQA 4K0KL 4IN3A 1SAPA 4DNRB 3NWSA 2B63H 1TKWB 2LKVA 2K4KA 2E2JB 4KI0A 3J81L 5C4XG 5IT9E 4JVZA 5FJ8H 3K6OA 4A3FG 1UE5A 2K75A 1JJCB 1QNKA 1QUQA 4HJ9A 4IURA 5HGQA 1SNDA 2XIWA 1V1PA 3G6JB 1CHQD 4J6HA 4J8QA 1TWCH 3X3NA 4QUFA 5I4DA 5M3MH 1HFNA 1TU2B 1JOQA 3KDFA 4AYBG 5CORA 1FVIA 4X62Q 2NVYB 4XIGS 3GTMB 3TP8A 2AKWB 5K36H 2BE5D 2RSNA 3TREA 2E2IB 4DV1L 2XGTA 1MJCA 4KKTA 3A7AB 3M3YB 2G5DA 3VDYA 1SMYC 4EGVA 4K8JA 2O5JC 2ZJQA 1PRTB 5C4XB 4OGQC 4A3FB 1IXRA 3PSIA 3GTKH 2B2TC 2K50A 1HUMA 4PMCA 2F0FA 1LLRD 1O80A 4OWTB 1I5FA 4KKUA 4OIKA 2BA1A 3K0XA 2C5CA 2F0KA 2RCFA 2A6HC 4RGNA 4AYBB 4YCVA 1QVGA 1M1KC 5EKLA 2DJGC 4QIWB 4JI4L 1SMXA 3JC66 1U0LA 4H13C 1WYDA 3T4AC 2MJ8A 2KJXA 3FKIH 4HMJA 1HPCA 4DR7Q 4B3RL 3WWVA 4OO1G 1II3A 1STNA 2R3ZA 1X3QA 3CC2A 3RMHA 2RKSA 4DR5Q 3J81c 1OXUA 1TY2A 4NXMQ 3ER0A 4PQXA 4KHPL 1BCPF 4C56C 2B3GA 2KCMA 1VQNA 4AQYQ 1LTBD 2RVLA 3EN2A 2G9DA 1UE6A 1X56A 3L3OC 4HN7A 1HTPA 4KY6A 3OYYA 2NVXB 5CR3A 2HHHL 3E3XA 3CPFA 2CHBD 4HAEA 1L0WA 3H6MA 1D1IA 2IX0A 1K8OA 4LW1A 1V8QA 3KOJA 5KYIA 3BJUA 1H9JA 1RTNA 3H09A 3KF6A 4UAIA 4FXGC 5IGDA 2K5QA 3KUPA 3RN5A 1KRSA 1PH9A 4B3TQ 2NTSA 1A63A 3CMAA 4XDXA 5CMDA 5A2QL 1EY5A 1LABA 4PZ6A 1N33Q 3OOCA 1P8LA 2YV5A 3S1QH 1S5DD 1BF4A 2K33A 2D0PA 1CZWA 1PZJD 5G3LF 1H9RA 2L9HA 1JORA 4FNFA 4Q5VA 2L0CA 4P75A 1GKHA 3NTIA 2RHQB 3K5MA 3D0FA 4GKKL 4IUQA 3V96A 4BWGB 1I4HA 4FXDA 1ML0D 1VF7A 3A8KE 2NB0A 4HMIA 1HNWQ 3HOUH 2Q2HA 4DR1Q 1YNNC 3HOVH 1MJEA 4AIMA 1A3TA 1DCZA 2NVQH 5HURA 5LMUL 5M5XB 1YJNA 1GHJA 4LFCL 2E5LL 1B50A 2UUCL 4LMQD 4PG3A 1TWGB 3OMGA 3J80i 3H3VI 1HR0L 1AW7A 2N88A 4EQNA 2QA4A 1RIPA 1TWHB 4DUYQ 2JA5G 3NPPA 3A5ZB 3FVQA 2A6EC 2ES2A 3BZCA 4RKLA 3EROA 2AUKA 2IT1A 4CKCA 1G6ZA 1VQ8A 3J7YW 4Y7NB 3DEPA 2KVMA 1WTOA 4CJ1B 1SRUA 4LFAQ 1LT4D 2L55A 5CBEE 5FOBB 3CRKC 3HKZG 4FXKC 3C2PA 1A3VA 2PW7A 3L7ZC 2Y0SG 3QJYA 1M90C 3C46A 3FMCA 3TRZA 2F0UA 1LTSD 3HP3A 1N9WA 3TZUA 5G3LD 1NSNS 1LT5D 4Z9CB 3OMCA 1G6PA 4TVAB 5CGKA 5JVH3 2K03A 1JC7A 1J8IA 2Z6KA 3MAQA 2JA5B 1LT3D 2YTYA 3KF8A 4DPGA 4DV7Q 1O7YA 1SMYD 4JI6L 1B1ZA 5C0XH 5IP9G 2DY7A 5T1GA 3W5OA 4J1MA 3M9BA 4A93G 2G9HD 1YVCA 2BDNA 2KHIA 4YY3Q 4F8MA 3HKZB 1NCVA 2Y0SB 2A19A 4A3CG 4XYQA 3TP5A 1PFBA 2VB2X 3Q8DA 2VQEQ 2A1AA 2RSOA 2K28A 1NR2A 1S4ZA 2L4NA 5EPLA 4GNXA 4DV1Q 4YWMA 4C3IG 1Y1WG 1EY9A 4JI8L 3MVVA 4GKJL 5AJ3Q 2HCIA 3GTOB 1B4OA 4O0AA 2I0QA 4DKAC 3NEMA 4U673 5I2XA 1RCVD 1I4QA 4A93B 1X32A 2R92H 2WB1G 3D3RA 2UXCL 3O13A 4ZK9B 3SVMA 1SDFA 4IUPA 3UE1A 2IWHA 2UU9Q 4QB4A 3P7JA 1WTPA 1D1KA 2R93G 3BYYB 4DV2L 5FLMG 3J81E 3GTQB 4CHTB 1NMFA 2R6GA 1WCMG 4B3SQ 2PZUA 3GTLB 1VF5C 3QOJA 1QJOA 2D2CC 3N6RA 3MC0B 1PTOF 3T16A 4HIKA 2MP1A 4BBSG 4A3DG 2NN6H 4C3IB 1TR5A 3IL8A 1Y1WB 4B3RQ 4QF4A 1PRTC 4JYAL 2KECA 1TY0A 3OWEB 2OT2A 2E2DC 4C3JG 4G7HC 4QIWE 2QEXA 1JWSD 1BCPB 2UXDL 1O78A 3Q24A 3M85A 1CSQA 2ZT9C 2WB1B 3I73A 4BXXH 4DV5L 1TS2A 2Q8TA 2K5HA 2PZWA 5KYLA 3CRLC 2B2YC 1TS3A 2BCOA 1NUCA 4DR6L 2R93B 4K6DA 1KC8C 1H95A 3NQIA 1Q1BA 1AFPA 2PO4A 4FF4A 4C2MH 2KCNA 1WCMB 5GAGC 2HHHQ 1GUWA 2JN4A 3LWEA 4ZUJA 3DLLA 1I6HB 4BBSB 1D5MC 4A3DB 1F9QA 3STBC 2N49A 3IFTA 5I9PA 4K8IA 2D0OA 1L1OB 5TSSA 1BQQT 3SK8A 4C3JB 3T1YL 3S2HH 1RTOA 1H9KA 3KYHC 4RCOA 1STGA 2E75C 2MQHA 3TBIB 1TVXA 1A8VA 2WAQG 4DAYB 5I6WA 2KA7A 2QGQA 1BBXC 1YI2A 4PZ8A 5JJIA 4HJ8A 5ELEA 3OTOQ 1EOVA 2FHTA 5IGBA 2I46A 3U58A 2F0SA 1SYGA 3NBHB 4DXFA 5IGFA 1LYLA 2CH4W 2WACA 3HOYG 2PYKA 3VR5A 1BVSA 3OIPA 2PCFB 1PYSB 2QEJC 1F2ZA 2H5XA 3HEJA 4HEDA 2K5NA 2PZTA 4K14A 1Q12A 2MNAA 5CV8A 4FF3A 4WORA 2KEEA 4P73A 2WAQB 5DEHA 4NMZA 5KNCA 4X3KA 4JV5L 2JA9A 1FYCA 5IYBG 2X69A 1CA5A 2YTXA 2F0OA 2VY3A 3ERQA 3EQLC 1DJRD 3CW2C 4A3MB 1XPRA 3Q22A 3EBEA 2B2TA 1EU3A 3UDIA 3PIPA 3HOYB 2E5LQ 5DM63 2CVRA 1AE3A 3CCUA 1EIFA 5HGTA 1HNZQ 3FDTA 5A2QE 2X6LA 4EQOA 4DNIA 5C3WA 3Q23A 3M4PA 4J15A 1PRTF 4GOPA 2OCEA 3CXCA 2N8NA 2D9UA 2HD3A 3L0OA 3D4WA 1IYUA 2JA7H 5FO8B 4N9TA 4JI5Q 4BY7G 3KJOA 1EY0A 2KENA 3VR4A 1A62A 3X3MA 1XX8A 4DN4M 2B2VC 2F4VQ 4A3LH 1K0SA 4LUVA 3G48A 3TZDA 4HR7B 1I4GA 2NVTB 2KUMA 5ISRA 3OSOA 1EZ8A 3S1NH 3VYUA 1SN8A 1I50H 3A56A 4QCLA 2XN9C 5IP7H 1JWUD 3GTJH 4JI3Q 3EA6A 1V43A 1N36Q 1F9RA 1DONA 1QE6A 1VQEA 1JJGA 4PZ7A 1Q81C 4F87A 4GN3B 5BR8L 1I4PA 4BY7B 3M4YA 4R4CA 4YIJA 5M5YB 3VA5A 2XRSD 3IKJA 2F0PA 1OTCA 3K58A 1HQRD 1TXYA 2RBMA 1EWCA 1IZ6A 1EYCA 1JT8A 3HOZH 3HKZE 1N32L 5C44H 1U4RA 5IE8A 3AB9A 1MD2D 4IJLA 2Y0SE 3W1BA 1PMRA 3CP0A 1VQFA 1EWHA 1CK1A 1PRTD 1LTID 3TN2A 3K7AH 3K81C 4BA1I 5JPMC 2K14A 5JEAH 1EYDA 1T5EA 4LF8L 3G7LA 3GTGB 4I65A 4TKOB 3ONAB 3QB3A 5FJ8G 4RGTA 1LTAD 1PH6A 1EYAA 3KFUA 1BUVT 2OQKA 1KL9A 3RZOB 1XJVA 4JCVE 1M4VA 1TWAB 4FP5D 4CBVA 1DYQA 3M4QA 3R2IA 1AP0A 3PO3H 1ZXTA 4F88A 1A0IA 1YHBA 1HZCA 5M3MG 1ENFA 1S40A 3NUCA 3DWQA 4X65L 3H94A 1SSOA 1HZAA 3ND8A 4PMWA 3J7A5 2UXDQ 1LUZA 5EBDA 2ALYB 2L11A 1E1OA 3ND9A 4KN4C 3TP6A 1BO0A 1O7IA 4DV5Q 3HOXG 1R4PB 3J80L 4L5RC 5C0XI 2EIFA 4DR3L 3E5SA 5GROA 4DR6Q 2NTTA 1CM9A 1X65A 2WB1E 2PQAA 3S1MH 4B3ML 4XYOA 5M3MB 4DUZL 2ID0A 4HJ5A 3K59A 2IJ0A 5FLXL 5I2YA 4MZ9A 4A3GG 4APVA 3DM1A 1I94L 4DV6Q 2IHEA 1ZKOA 3GTPH 4G57A 2YU9B 5IOCA 2GA4B 3AYHB 1J5EQ 1BCPC 1F2LA 2K6AA 2GVBA 1S5CD 1J9OA 4A75A 3HOXB 3GTKB 4DFAA 3IRBA 2OEOA 5LMNQ 5EPJA 4YWKA 3MEFA 3E9HA 3K5NA 2QKIC 1IL2A 2CKZB 3I4MG 3D31A 4R8NA 1PHJA 4A3GB 3S2DH 4LF9L 3CCQA 1K8AC 4IUVA 1HXYD 1VQDA 5E7NA 1S72A
chains in the Genus database with same CATH topology
1BOSA 3D6CA 1V1PB 2MGSA 3D4RA 5KGUA 1ILQA 4I7ZC 3QWNA 3NXWA 3MEHA 3HS0C 3LX0A 2EJGC 2L12A 3NQTA 4MIUA 2HCCA 3I4MB 2K32A 1GHKA 5CV4A 5FO9B 1A15A 2F0NA 2WP8J 2X6GA 3VYTA 1H9SA 1UEAB 3SHLA 3H91A 1D6EC 1Y8OB 2F0TA 4DGZA 4KKSA 1I3QB 2FMCA 4WJWA 2R7ZB 1F9SA 2Z8LA 1S5ED 2K1BA 3VA7A 1QILA 2V4DA 2H4OA 1ICWA 1SFOB 4A3EB 5NUCA 4A3JB 1F9PA 3GV3A 3A8IE 2WV6D 3BYTB 1TQOA 2M00A 1D2BA 5T1IA 3DMUA 2WINB 4IALA 1G2TA 2XVSA 2EYOA 3HZXA 3D6WA 3PUXA 4OL7A 4BS9A 5JJZA 1M8AA 2M9VA 4IFDI 1EFID 3NTHA 5D3DA 3KBGA 4A3BB 4DF7A 1EY6A 3HOVB 1I4XA 1SNQA 3WOEA 2CW0C 2PMZB 2RQXA 2VB3X 2B39A 4ZQ3A 4E6IA 2H1EA 3L9AX 3HGBA 1SYBA 3VR6A 1LT6D 1S5BD 2J0TD 5C0XG 2EXZA 5J22A 5J39A 3MA2B 3SK6A 4L8JA 3BVGA 2VUMB 3AU7A 3MXNA 2B8GA 3S15B 1B44D 1A6XA 2IL8A 1L0XB 1V1OA 1EEFD 1E2VA 1CI3M 1DZ1A 1BCPD 4ME5A 4BBRB 1C48A 3VR3A 2R61A 2SDFA 4IUNA 1OXVA 2FJ2A 1WD1A 3N52A 3NWTA 1B2TA 1PTOC 4KJNA 4BY1B 2JP1A 4EVOA 1HTLD 3QG1A 1XWEA 3FRPB 2QF7A 3KLRA 2C9OA 4OO1H 4UDUC 1QOHA 2EYHA 1EQTA 2F0QA 3HRZC 1W6JA 2FINB 3M4OB 4CJ2C 2R92B 5COYA 3DXJC 2F0DA 2Z4HA 1ZEQX 4ULLA 2Q8RE 5J1ZA 1GUTA 1IL8A 3CHBD 3J80E 5FKAC 1EY8A 2LMCB 2RDHA 3RZDB 2EYLA 2A5HA 3C1EA 3EFXD 1A2UA 4DAPA 4K2LA 5FLXE 4LAAA 2DN8A 1B9NA 4NDXA 1T5XD 4KV6A 5EJWA 2ZXPA 1BNZA 1Q1EA 2IPKD 2F3WA 1ET6A 2B2UC 4C2MB 3DWAA 3C1FA 4HTHA 3NE5B 1Y8PB 1TS5A 1EIHA 1LO5D 3BG3A 1SJHD 4HCSA 2HDMA 3CQZB 4IUTA 4RKBA 5EBCA 1IHZA 4K6LA 4BA2I 2EDGA 2AQ1B 4IFDG 2RDGA 3KLSA 1D5ZC 4MHEA 1ILPA 1U4PA 3T56B 3PIP3 2WIIB 1JOKA 2B8FA 3NSWA 2CW0D 4RCNA 4ZLTF 2EYJA 2LFNA 1MSGA 1CA6A 5C3XA 4DU9A 1QNUA 4ZUIA 4G4KA 4NKLA 2SNSA 4JBWA 5KNDA 5IGGA 3E0JA 4N9PA 3A54A 2PPBC 1KLUD 2EVBA 5D3IB 1TIID 2XNAC 4M8AA 5EKKA 1HFGA 3PO2B 2B2WC 3KLSX 2KCCA 4WRDA 4EQPA 2EJMA 4RGMA 4R9WA 5C5LA 1CT1D 2Q8IB 2F0JA 2NZ1D 1I6VC 3W3AA 2DY8A 3K5OA 4DK0A 3R2TA 4K5XA 1U9RA 1PTOD 3P1HA 1GXDC 5EGTA 2WKDA 4Q0FA 2EYMA 3T51B 4G7OC 1GUGA 1SYCA 1EY7A 3S1NB 5BN3A 3SEBA 2TMPA 1R9TB 1I50B 4R8IA 3RUZA 1VMPA 3URYA 3OWFA 2EPBA 1CTMA 1KAAA 2IX3A 1CZGA 4PNYA 2EYPA 3HG9A 1LTGD 1Z47A 2F0WA 3OPOA 2KEDA 2EY1A 4RGOS 1B3AA 3BS1A 5CBAE 4ZAIA 3HOZB 4A3IB 1TT2A 1VCIA 3CU7A 1F77A 4CGYB 1BR9A 3FPPA 2JA6B 2A74C 4V190 5AFWA 2JYOA 4ZKBB 5KIXA 1PFNA 1A2TA 3V05A 2ENBA 1JOOA 1SE2A 2XWBB 1TS4A 3BDLA 3S16B 1EY4A 4RH6A 3BDOA 3QOLA 4WFN3 3VYSA 1SYDA 5E1FA 2MUYA 4DK1A 2JEAI 2JEBI 1SNMA 2QILA 1OXSC 5C3EB 1O7ZA 3BDCA 3S1MB 1CFMA 4IZ8A 3NP8A 1PDQA 1IKLA 3SXHA 4ILWA 2HUGA 1JCKB 5BN5A 1KNEA 1SBBB 1DOKA 4FO2A 5ELBA 1WD0A 1EZ6A 2JSOA 3MFGA 4XT1B 1FNUA 5C0XJ 2F03A 3U9OA 3D8GA 4XQNA 1WTWA 1XTCD 5D65A 5EQ0A 5K36G 2SNMA 4TRDA 3NHHA 2LY7A 1LTRD 5JPNC 2B63B 1HHVA 2ZXOA 1U4MA 4LJZC 2EOTA 1G8ZD 2L1BA 3HOWB 4L63B 1TWCB 1EL0A 2VXWA 1GUOA 5IODA 2EE1A 5LL6X 2YYZA 2J4XA 1B53A 1EEID 1BXTA 3K57A 1GJXA 1O7LA 1STEA 1DXMA 4X3TA 2JE6I 1XYIA 4O1NA 5CV9A 2PQEA 4OHJA 2A73B 3TDQA 1OO9B 1PTOH 2AWOA 1CHPD 3IFDA 5C6AA 3FKIB 4C3HG 2NN6I 3P75A 4IUUA 1QWYA 1RJTA 3GO5A 1OXXK 3QIAA 4FYDA 2F0HA 3K5LA 4QMGA 2I07B 2B2UA 1SXTA 1VMCA 3MFYA 1HRJA 4L6TB 1FD7D 4B9XA 1PLFA 1YNJC 1H9MA 1NR4A 2OF1A 1RKNA 1I4RA 3T53B 5JVG3 1H9SB 1HCZA 4C3HB 3ITPA 4O42A 1BDOA 1RODA 3BVZA 2ZXRA 5BN4A 2K01A 1TWFB 3KBXA 1AZPA 1DD2A 2QDBA 3H3VC 4IFDJ 2F0IA 1K8MA 2D5DA 3S1QB 4KD4A 1KTKA 1DOLA 1KABA 2B2YA 4KHZA 4JK1C 3OHXC 4C1NK 4G7ZC 4KN7C 3Q0AA 4QUCA 3NK9A 2KOLA 1WTXA 2NWGA 3MWYW 4DAVA 3DHQA 1C4QA 2NYZD 5KNBA 3LNNA 2DNCA 1G2SA 3QO2A 4DA2A 1HQMC 2EZVA 2B2WA 2EY6A 3I90A 3HOUB 1LTTD 3C3LA 3I91A 2NVQB 2E2HB 3MZ5A 1Z6HA 1ESRA 3MXPA 5E4WC 5CV7A 4DNTB 2SOBA 4XT3B 1IYVA 4PV1C 1B9MA 2BA0A 2F1MA 3TMEA 1AZQA 1OXTA 1PZKD 3EJIA 5C5MA 1UNSA 2A69C 4RHRA 2E74C 2BOSA 1VDZA 4HCEA 4ZRZA 3JAML 1Y8NB 5C4ZA 3E6ZX 1Y69U 1DOMA 3ZYYX 1SE4A 3K0YA 3SK4A 1MGSA 5FK9C 1F2YA 5C4JB 4KD3A 5DAUA 5ELDA 3A55A 2WKCA 1QG7A 1ENAA 1G91A 1AEXA 3H0GB 2TSSA 3NBIA 3S1RB 3PUZA 4B9WA 5JEAJ 1X3PA 4RWSC 4KY5A 2F3VA 1KDAA 2K5DA 1MI2A 3CKIB 2MHVA 3DUZA 3PIO3 1E0BA 3UI2A 3Q6SA 5IGCA 2B2VA 2NN6G 1SYFA 3MHBA 5IIFA 2EJFC 4ZYSA 1Q8IA 1ESFA 4KTAA 4B08A 4F7XA 1YNJD 4KK7A 3P20A 2JA8B 5I6YA 5JAVA 4RAUC 3RLFA 4TSSA 3TP7A 4ID6A 5DM73 5CV5A 5A35A 3M7NA 3W2DA 4P2CB 4FF1A 3KK7A 1KDBA 5LL6S 1FNWA 1JE4A 1JQYD 4NW2A 1FGBD 4XXEA 3PUWA 3A8JE 2ICIA 4X3SA 4MN3A 3BVMA 3FPUB 1F2MA 1ZYRC 5E3FA 1JWMD 3MTSA 1RD9D 2PNRC 4H0LC 1MBYA 1STHA 2A6HD 2L5TA 1S5FD 5CYUA 3S2HB 1R4QB 1PFMA 1JR0D 4DXGA 3EVQA 1DM0B 3NTKA 3AMUA 3I8ZA 1ET9A 3MXGA 4XTCS 2K05A 2F4IA 1GOZA 1HA6A 1IW7C 3I4LA 1C8CA 3GP7A 3VYRA 1MSHA 5F2DA 3I72A 2KQ3A 2AWNA 2VNUD 1SEBD 2A69D 2N55A 3S14B 3M7GA 5IT9L 4NP5A 1EIGA 4H44C 3VR2A 1KDCA 3GD7A 4HSPA 1SNOA 3GV6A 1JICA 3DWPA 4U68A 2XSCA 2LS01 2K7VA 3OW7A 4CJ0B 1SNCA 4X3UA 2O2LD 3PUVA 5JOBA 4RA8A 2F0LA 2JA7B 2FMMA 1UAPA 1KLGD 1LACA 2F0GA 2SEBD 4DAYA 1XXGA 2A68C 1IKMA 4KMUC 1YNND 1NAPA 3PV0A 1Q3LA 1E2WA 1Q90A 1UUPA 3NBHA 3J7AF 2BDOA 3R3OA 1HUNA 4TQUS 3TSSA 2NBFA 3GTJB 5ELCA 2HQEA 2JXMB 5JEAG 2A6ED 1E2ZA 4IFDH 1PYWD 3SDZA 4ABNA 2K04A 5I9OA 1CQFA 1D5XC 3I70A 1RDPD 4GZYC 5D14A 4ZKCB 5C44B 3T13A 1EQVA 1WTRA 2EY2A 3JAME 3K7AB 4KJOA 2KHSA 1QCBD 4ODGA 3WDNA 4H7BA 1ONLA 5K5PA 2CQAA 1WVLA 2DNEA 5KEEA 2F0EA 3V2TA 3IAYA 5EKIA 3SK5A 1ZYRD 3LWUA 4K2KA 3PO3B 2BE5C 4K5WA 1JB3A 1SJED 1WTVA 4A3KB 1EOTA 3FEWX 3OIQA 3SR1A 5EPKA 1GUNA 2XWJB 2F0MA 3PUYA 4HSVA 1SNPA 2RDFA 2Z1CA 4KHVA 5LHY1 3S17B 3A7LA 2K5WA 2F0VA 4XQQA 3I4NB 2OXPA 4RFBA 4FVMA 4K5VA 3DEOA 2Z4IA 5C4HA 4XQJA 1QB5D 5KRUA 1K83B 1IW7D 4CKBA 1L0YB 3GTPB 1W6KA 3F2UA 4OO1I 1CQVA 2FFKB 4OIJA 1STAA 2PW5A 4FF2A 3SE0A 2EY5A 5FO7B 2AUJD 2QCPX 5M5WB 3MXUA 1SYEA 4C1NI 2EYFA 4M1UB 5ELFA 3S9WA 3BZDB 2XRQD 1A3UA 1PZID 1PTOB 2D62A 3S2DB 2IW3A 2ICEC 1AN8A 1SE3A 1G291 5E4XA 3R8BA 2M2LA 2HDLA 1GUSA 2E76C 1EU4A 2J7ZA 1HA5A 1FNVA 4IQZA 2RA4A 1Y1VB 5CV6A 5DNFA 2A68D 5M9OA 4RHSA 1STYA 3RD4A 1Z7TA 4CKEA 2NUCA 3I3CA 2AQ2B 3WOFA 5CC4A 4V0BA 4S3SA 1RF2D 2AQ3B 2MPMA 3J7AV 3GQBA 1STBA 3U9SA 1KNAA 1RHPA 2IX1A 1U4LA 4LK1C 3PMFA 3R93A 1ENCA 1PXUA 1LV9A 4PMBA 2O4XA 4KY7A 3D4DA 2O5IC 1FR3A 5M3FB 5IGEA 1WTQA 4IN3A 1SAPA 4DNRB 3NWSA 1TKWB 2LKVA 2E2JB 4KI0A 3J81L 5IT9E 3K6OA 1QNKA 4IURA 1SNDA 2XIWA 1V1PA 3G6JB 1CHQD 4J6HA 4J8QA 3X3NA 4QUFA 5I4DA 1HFNA 1TU2B 1JOQA 5CORA 2NVYB 4XIGS 3GTMB 3TP8A 5K36H 2BE5D 2RSNA 2E2IB 4KKTA 3A7AB 3M3YB 1SMYC 4EGVA 4K8JA 2O5JC 1PRTB 5C4XB 4OGQC 4A3FB 2B2TC 1HUMA 4PMCA 2F0FA 1LLRD 1O80A 4KKUA 4OIKA 2BA1A 2C5CA 2F0KA 4AYBB 2A6HC 4RGNA 5EKLA 4QIWB 4H13C 3T4AC 2MJ8A 2KJXA 4HMJA 1HPCA 4OO1G 1II3A 1STNA 2R3ZA 1X3QA 3RMHA 2RKSA 1OXUA 1TY2A 4PQXA 1BCPF 4C56C 1LTBD 2RVLA 2G9DA 4HN7A 3L3OC 4KY6A 1HTPA 2NVXB 5CR3A 2CHBD 4HAEA 3H6MA 1D1IA 2IX0A 1K8OA 1V8QA 5KYIA 1H9JA 1RTNA 3H09A 4UAIA 4FXGC 5IGDA 2K5QA 3KUPA 2NTSA 4XDXA 5CMDA 5A2QL 1EY5A 1LABA 3OOCA 1S5DD 1BF4A 2K33A 1CZWA 1PZJD 5G3LF 1H9RA 2L9HA 1JORA 4FNFA 4Q5VA 2L0CA 3NTIA 3K5MA 4IUQA 3V96A 4BWGB 1I4HA 4FXDA 1ML0D 1VF7A 3A8KE 2NB0A 4HMIA 1YNNC 1A3TA 1DCZA 5HURA 5M5XB 1GHJA 1B50A 4LMQD 1TWGB 3OMGA 1AW7A 2N88A 4EQNA 1TWHB 3NPPA 3FVQA 2A6EC 4RKLA 3EROA 2AUKA 2IT1A 4CKCA 1G6ZA 3J7YW 4Y7NB 3DEPA 2KVMA 1WTOA 4CJ1B 1LT4D 2L55A 5CBEE 5FOBB 3CRKC 4FXKC 3C2PA 1A3VA 2PW7A 3L7ZC 3QJYA 3C46A 3FMCA 2F0UA 1LTSD 3HP3A 3TZUA 5G3LD 1NSNS 1LT5D 4Z9CB 3OMCA 5CGKA 5JVH3 2K03A 1JC7A 1J8IA 3MAQA 2JA5B 1LT3D 3KF8A 1O7YA 1SMYD 1B1ZA 5C0XH 2DY7A 5T1GA 4J1MA 2G9HD 2BDNA 4F8MA 3HKZB 1NCVA 2Y0SB 4XYQA 3TP5A 1PFBA 2VB2X 5EPLA 2RSOA 2K28A 1NR2A 1S4ZA 2L4NA 4C3IG 1EY9A 3MVVA 2HCIA 3GTOB 1B4OA 4U673 5I2XA 1RCVD 1I4QA 4A93B 1X32A 3D3RA 3O13A 4ZK9B 3SVMA 1SDFA 4IUPA 2IWHA 4QB4A 3P7JA 1WTPA 1D1KA 3BYYB 3J81E 3GTQB 4CHTB 2R6GA 3GTLB 2PZUA 1VF5C 3QOJA 1QJOA 2D2CC 3N6RA 3MC0B 1PTOF 3T16A 2MP1A 2NN6H 4C3IB 1TR5A 3IL8A 1Y1WB 4QF4A 1PRTC 2KECA 1TY0A 3OWEB 2OT2A 2E2DC 4C3JG 4G7HC 1JWSD 1BCPB 1O78A 3Q24A 3M85A 2ZT9C 2WB1B 3I73A 1TS2A 2Q8TA 2PZWA 5KYLA 3CRLC 2B2YC 1TS3A 2BCOA 1NUCA 2R93B 4K6DA 3NQIA 1Q1BA 1AFPA 2PO4A 4FF4A 2KCNA 1WCMB 1GUWA 4ZUJA 3LWEA 1I6HB 4BBSB 1D5MC 4A3DB 1F9QA 3IFTA 5I9PA 4K8IA 5TSSA 1BQQT 3SK8A 4C3JB 1RTOA 1H9KA 4RCOA 1STGA 2E75C 3TBIB 1TVXA 5I6WA 2KA7A 1BBXC 5ELEA 2FHTA 5IGBA 2I46A 2F0SA 1SYGA 4DXFA 5IGFA 2WACA 2PYKA 3VR5A 3OIPA 2PCFB 2QEJC 1F2ZA 3HEJA 4HEDA 2PZTA 4K14A 1Q12A 5CV8A 4FF3A 4WORA 2KEEA 2WAQB 5DEHA 4NMZA 5KNCA 4X3KA 1FYCA 2X69A 1CA5A 2F0OA 3ERQA 3EQLC 1DJRD 4A3MB 3Q22A 2B2TA 1EU3A 3HOYB 5DM63 2CVRA 5HGTA 3FDTA 5A2QE 2X6LA 4EQOA 5C3WA 3Q23A 1PRTF 2D9UA 3D4WA 1IYUA 5FO8B 4N9TA 1EY0A 3VR4A 3X3MA 1XX8A 4DN4M 2B2VC 3TZDA 4HR7B 1I4GA 2NVTB 2KUMA 5ISRA 3OSOA 1EZ8A 3VYUA 3A56A 4QCLA 2XN9C 1JWUD 3EA6A 1V43A 1F9RA 1DONA 1QE6A 4F87A 1I4PA 4BY7B 3M4YA 4YIJA 5M5YB 3VA5A 2XRSD 3IKJA 2F0PA 3K58A 1HQRD 2RBMA 1EWCA 1EYCA 1U4RA 3AB9A 1MD2D 1PMRA 1EWHA 1CK1A 1PRTD 1LTID 3TN2A 4BA1I 5JPMC 5JEAH 1EYDA 1T5EA 3G7LA 3GTGB 4I65A 4TKOB 3ONAB 3QB3A 4RGTA 1LTAD 1EYAA 1BUVT 3RZOB 1M4VA 1TWAB 4FP5D 4CBVA 1DYQA 3R2IA 1AP0A 1ZXTA 4F88A 1ENFA 3NUCA 3DWQA 3H94A 1SSOA 3ND8A 4PMWA 5EBDA 4KN4C 2L11A 3TP6A 3ND9A 1BO0A 1R4PB 3J80L 5C0XI 3E5SA 2NTTA 1CM9A 4XYOA 5M3MB 2ID0A 3K59A 2IJ0A 5FLXL 5I2YA 3DM1A 1ZKOA 4G57A 2YU9B 5IOCA 2GA4B 1BCPC 1F2LA 2K6AA 1S5CD 1J9OA 3HOXB 3GTKB 4DFAA 2OEOA 5EPJA 3K5NA 2QKIC 3D31A 4R8NA 4A3GB 4IUVA 1HXYD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NYZ D;  2HCI A;  5E4X A;  4X3T A;  3TN2 A;  1B4O A;  4IUQ A;  1G2S A;  2M2L A;  2MGS A;  2B2T C;  3QO2 A;  1HUM A;  1MSH A;  1ML0 D;  2HDL A;  4R9W A;  1XYI A;  3G7L A;  2KEE A;  1ILQ A;  1X32 A;  2B2W A;  3I90 A;  2J7Z A;  3ONA B;  1O80 A;  1WVL A;  4OIK A;  4ZK9 B;  3SVM A;  4X3K A;  2NZ1 D;  2N55 A;  1SDF A;  2X69 A;  4IUP A;  1CA5 A;  3I91 A;  2DY8 A;  3P7J A;  1WTP A;  2L12 A;  5EJW A;  5EKI A;  2RA4 A;  1EIG A;  2B2T A;  2HCC A;  5DNF A;  1BNZ A;  1ESR A;  1AP0 A;  1ZXT A;  1B50 A;  4LMQ D;  4RAU C;  3IFD A;  2CVR A;  5E4W C;  1A15 A;  2MJ8 A;  2N88 A;  4XT3 B;  1WTV A;  3GV6 A;  3I3C A;  1O7Z A;  2IL8 A;  1JIC A;  2B2U C;  2MP1 A;  1SSO A;  3FDT A;  3IL8 A;  1PDQ A;  1EIH A;  1IKL A;  2X6L A;  4U68 A;  2KEC A;  2X6G A;  2HUG A;  4IUU A;  4CJ0 B;  2MPM A;  1RJT A;  2R3Z A;  4HCS A;  1KNE A;  1DZ1 A;  1X3Q A;  2HDM A;  4X3U A;  4R8I A;  1AZQ A;  1EOT A;  2D9U A;  1DOK A;  3H91 A;  1KNA A;  4IUT A;  1G6Z A;  1VMP A;  1RHP A;  2L11 A;  1HA6 A;  2EPB A;  1BO0 A;  1U4L A;  2KVM A;  3DEP A;  4RA8 A;  2Q8T A;  4CJ1 B;  1WTO A;  1WD0 A;  4XT1 B;  1JE4 A;  4NW2 A;  2SDF A;  1F9S A;  2B2U A;  2FMM A;  5EPK A;  3R93 A;  2FJ2 A;  5CBE E;  2B2Y C;  1WD1 A;  1VMC A;  2K1B A;  3N52 A;  4HSV A;  4X3S A;  1HRJ A;  4MN3 A;  3FPU B;  1PLF A;  1LV9 A;  1CM9 A;  1WTW A;  4MHE A;  1ILP A;  1B2T A;  5EPL A;  1ICW A;  1XX8 A;  2RVL A;  1U4P A;  1NR4 A;  2B2V C;  3HP3 A;  3MTS A;  4DN4 M;  5D65 A;  1IKM A;  2KED A;  1DOM A;  5EQ0 A;  1NAP A;  2JP1 A;  3TZD A;  3DEO A;  1MGS A;  1Q3L A;  1GUW A;  1B3A A;  1F9P A;  3LWE A;  1WTQ A;  2K03 A;  2KUM A;  4HAE A;  1J8I A;  1SAP A;  5CBA E;  3DM1 A;  3GV3 A;  4ZAI A;  1F9Q A;  4ZLT F;  1MSG A;  1CA6 A;  1O7Y A;  1HUN A;  4O42 A;  1QG7 A;  1RTN A;  3F2U A;  4UAI A;  1HHV A;  1RTO A;  1PFM A;  1EQT A;  1F2L A;  1ROD A;  2FFK B;  5T1I A;  4OIJ A;  1G91 A;  1U4M A;  2DY7 A;  1F9R A;  2EOT A;  3KUP A;  5T1G A;  1QE6 A;  1DON A;  1J9O A;  1G2T A;  2FIN B;  1QNK A;  1TVX A;  2BDN A;  2L1B A;  3D6W A;  4IUR A;  4XDX A;  2K01 A;  2XIW A;  5CMD A;  4CJ2 C;  5EPJ A;  3KBX A;  1AZP A;  5JJZ A;  3I8Z A;  2K04 A;  1M8A A;  4QUF A;  1BBX C;  5COY A;  1NCV A;  1X3P A;  4RWS C;  1HFN A;  1EL0 A;  2VXW A;  3UI2 A;  2FHT A;  5COR A;  1BF4 A;  2K05 A;  1DOL A;  1PFB A;  2B2Y A;  1MI2 A;  5AFW A;  1HFG A;  2Q8R E;  2JYO A;  4ZKB B;  5D14 A;  1PFN A;  2EE1 A;  2RSN A;  4ZKC B;  2B2W C;  2L9H A;  1E0B A;  2K28 A;  1NR2 A;  1S4Z A;  2L4N A;  1U4R A;  2RSO A;  3Q6S A;  1IL8 A;  2KOL A;  4QUC A;  2B2V A;  1WTX A;  1B53 A;  4IUV A;  2NWG A;  3MWY W;  4HED A;  2H1E A;  1WTR A;  1C8C A; 
#chains in the Genus database with same CATH topology
 1QUQ B;  1GM5 A;  1BOS A;  3D6C A;  3SGI A;  3HOW H;  1V1P B;  2MGS A;  3D4R A;  3E0E A;  5KGU A;  4GN4 B;  1ILQ A;  4I7Z C;  3QWN A;  3NXW A;  3MEH A;  2YTV A;  3HS0 C;  3KDF B;  2R7Z G;  3F1Z A;  3LX0 A;  2EJG C;  3J80 c;  2L12 A;  3NQT A;  4MIU A;  1Q82 C;  1Y1V H;  2HCC A;  1SE8 A;  5GAE C;  3G4S A;  3PF5 A;  1EQQ A;  3I4M B;  2K32 A;  1GHK A;  1IBL L;  5CV4 A;  4A3E G;  5FO9 B;  4A3J G;  1A15 A;  1Q86 C;  4DV4 L;  2F0N A;  2WP8 J;  5L37 A;  4HJA A;  5FLX c;  1G51 A;  2X6G A;  1E1T A;  3VYT A;  1H9S A;  1UEA B;  3SHL A;  3H91 A;  1D6E C;  1Y8O B;  2F0T A;  2DJF C;  4QL5 A;  4DGZ A;  4KKS A;  1I3Q B;  2FMC A;  4WJW A;  4MTK A;  2Q2U A;  2R7Z B;  1F9S A;  4X64 L;  2A8V A;  2VW9 A;  2Z8L A;  1S5E D;  2K1B A;  3VA7 A;  1QIL A;  4P74 A;  4JG2 A;  2V4D A;  2H4O A;  1ICW A;  5JJL A;  4A3B G;  1SFO B;  3HOV G;  4A3E B;  5NUC A;  4A3J B;  5M3F H;  1F9P A;  4LFB Q;  2JJQ A;  3K8A A;  3GV3 A;  3A8I E;  2WV6 D;  1K3B C;  4QQB X;  3BYT B;  2E2J H;  1TQO A;  2M00 A;  1D2B A;  3DM3 A;  4OX9 L;  5T1I A;  3DMU A;  1PH8 A;  2WIN B;  3CAM A;  4IAL A;  1G2T A;  1YJ9 A;  2XVS A;  1NE3 A;  2EYO A;  3HZX A;  3D6W A;  3PUX A;  4OL7 A;  4BS9 A;  1VQ5 A;  5JJZ A;  1M8A A;  2M9V A;  4IFD I;  1EFI D;  3NTH A;  5D3D A;  1EFW A;  1KIX A;  4JI0 Q;  3KBG A;  4A3B B;  4DF7 A;  2VUM G;  1EY6 A;  4RG1 A;  3HOV B;  3AFQ A;  3GTM H;  1I4X A;  1K0R A;  1SNQ A;  3AQQ A;  4C3H H;  3WOE A;  2CW0 C;  2PMZ B;  2RQX A;  2VB3 X;  2B39 A;  4ZQ3 A;  1FJG L;  4E6I A;  3KF6 B;  1C9O A;  2H1E A;  2FXQ A;  2Q2I A;  3L9A X;  3HGB A;  1SYB A;  3VR6 A;  5C4X H;  1XMQ Q;  2QW7 A;  4A3F H;  1C0A A;  1TWF H;  1LT6 D;  1S5B D;  4NXN L;  4LF8 Q;  2CWA A;  2J0T D;  4LUZ A;  4BBR G;  5C0X G;  2EXZ A;  5J22 A;  5J39 A;  1VQM A;  3MA2 B;  3SK6 A;  4L8J A;  3BVG A;  2VUM B;  1NBW A;  3AU7 A;  3MXN A;  4BY1 G;  2B8G A;  3S15 B;  4DR2 L;  1K8G A;  3S24 A;  1B44 D;  1A6X A;  1SLJ A;  1Q7Y C;  1E24 A;  2Z9H A;  4LNQ A;  4N8F A;  2IL8 A;  1L0X B;  1V1O A;  1UE1 A;  1L2F A;  1EEF D;  1E2V A;  1NY4 A;  1CI3 M;  1CKN A;  1XMO Q;  1DZ1 A;  1BCP D;  4ME5 A;  4BBR B;  1C48 A;  3VR3 A;  4R4I A;  2R61 A;  2E8G A;  2E2H H;  3F8T A;  2SDF A;  4IUN A;  1OXV A;  2FJ2 A;  1WD1 A;  1QZH A;  2I5H A;  3N52 A;  3OW2 A;  2R92 G;  3NWT A;  4DK6 C;  1B2T A;  1PTO C;  1NJI C;  4KJN A;  4BY1 B;  1WI5 A;  2JP1 A;  4EVO A;  2UUB L;  4DV3 L;  4LF6 Q;  1HTL D;  4JPB W;  3QG1 A;  2N78 A;  1JMC A;  1XWE A;  3FRP B;  2QF7 A;  1IBK L;  3KLR A;  2C9O A;  4OO1 H;  4UDU C;  1QOH A;  4IOA A;  2EYH A;  1EQT A;  2F0Q A;  3HRZ C;  1W6J A;  2FIN B;  1ASZ A;  4YHH Q;  3M4O B;  4CJ2 C;  3G71 A;  2ZTC A;  2VS1 A;  3FHW A;  4BXX G;  2R92 B;  5COY A;  3DXJ C;  2F0D A;  3I2Z A;  2Z4H A;  1ZEQ X;  4K0K Q;  1XNQ L;  4ULL A;  2Q8R E;  5C4J H;  5J1Z A;  4YCU A;  3KF8 B;  2IY5 B;  1GUT A;  4OWX B;  1IL8 A;  3CHB D;  3J80 E;  5FKA C;  1EY8 A;  2LMC B;  2RDH A;  4DR4 L;  3H0G H;  4LF5 L;  3RZD B;  2EYL A;  3S1R H;  4OON A;  2A5H A;  3HKS A;  3C1E A;  3EFX D;  1A2U A;  4DAP A;  4K2L A;  2KBN A;  5FLX E;  1KQS A;  2UUA L;  4LAA A;  2DN8 A;  1B9N A;  4IPC A;  4NDX A;  1T5X D;  4KV6 A;  5EJW A;  4GNX B;  2ZXP A;  1BNZ A;  1WFQ A;  2CFM A;  1Q1E A;  4LF4 L;  1TWG H;  1YEZ A;  2IPK D;  3H15 A;  2F3W A;  1X9N A;  1ET6 A;  2B2U C;  4C2M B;  4ALP A;  1TWH H;  3DWA A;  3C1F A;  4HTH A;  3NE5 B;  1Y8P B;  1TS5 A;  1EIH A;  1LO5 D;  3BG3 A;  1SJH D;  4JI2 L;  4HCS A;  2HDM A;  3AFP A;  3CQZ B;  4IUT A;  4RKB A;  5EBC A;  1IHZ A;  4K6L A;  4Y7N H;  4BA2 I;  2MO0 A;  2EDG A;  2AQ1 B;  4IFD G;  2RDG A;  2P5Z X;  3KLS A;  2JA8 H;  1D5Z C;  4ZCK A;  2XTI A;  4JI4 Q;  4MHE A;  1ILP A;  1U4P A;  3T56 B;  3PIP 3;  2HT1 A;  2WII B;  1JOK A;  2B8F A;  4AYB E;  1EUJ A;  3PO2 G;  3PIO A;  3NSW A;  2CW0 D;  4RCN A;  3UDX A;  4P72 A;  4ZLT F;  2EYJ A;  2LFN A;  4NPS A;  4OXP A;  1UWV A;  1MSG A;  5HY6 A;  1CA6 A;  5C3X A;  3K7U C;  4POF A;  4DU9 A;  4OX9 Q;  1QNU A;  4JC0 A;  4ZUI A;  4KHP Q;  4YWL A;  4G4K A;  4NKL A;  2SNS A;  4JBW A;  5KND A;  5IGG A;  3E0J A;  4N9P A;  2GVA A;  3A54 A;  2PPB C;  1KLU D;  1X3E A;  1YNX A;  3J81 j;  2EVB A;  5D3I B;  1PA6 A;  1VQ6 A;  1TII D;  2XNA C;  1D7Q A;  4M8A A;  5EKK A;  1HFG A;  4JI1 L;  3PO2 B;  4GS3 A;  2B2W C;  3KLS X;  4L5S A;  2UXB L;  4A3L G;  2KCC A;  4WRD A;  4UP8 A;  4EQP A;  2EJM A;  4RGM A;  3CF5 A;  2QDL A;  3GTO H;  5IP9 H;  3CCS A;  4R9W A;  2CH4 A;  5C5L A;  1CT1 D;  4QY7 A;  2Q8I B;  2F0J A;  2LSS A;  2NZ1 D;  1QZG A;  1I6V C;  3W3A A;  2DY8 A;  3K5O A;  4DK0 A;  1CKO A;  3R2T A;  4K5X A;  1CUK A;  1U9R A;  1N34 L;  1PTO D;  3P1H A;  1GXD C;  3GTQ H;  5EGT A;  4JOI C;  4KLK A;  2WKD A;  2ZM6 L;  4Q0F A;  4GKK Q;  2EYM A;  3T51 B;  3JAM i;  1WJJ A;  4IJH A;  4G7O C;  1GUG A;  1SYC A;  3HOZ G;  4A3I G;  1QVF A;  1EY7 A;  3S1N B;  5BN3 A;  3SEB A;  2TMP A;  3G6E A;  1R9T B;  1I50 B;  4R8I A;  3RUZ A;  3S14 H;  1VMP A;  3URY A;  3OWF A;  2EPB A;  1CTM A;  1KAA A;  2IX3 A;  1CZG A;  5LMU Q;  1PYB A;  2OWO A;  4PNY A;  2EYP A;  3HG9 A;  1LTG D;  4LFC Q;  2R93 H;  1Z47 A;  3CCE A;  2UUC Q;  1PH7 A;  5FLM H;  1HR0 Q;  2F0W A;  2JA6 G;  3OPO A;  2KED A;  2EY1 A;  4RGO S;  4DV3 Q;  1B3A A;  3BS1 A;  1I6H H;  1MIU A;  1UE7 A;  4A3D H;  5CBA E;  4ZAI A;  4GOP B;  4X62 L;  3HOZ B;  4A3I B;  1TT2 A;  1VCI A;  1V1Q A;  3FP9 A;  5IYC H;  3CU7 A;  1NNX A;  1F77 A;  4A3M G;  1YJW A;  4CGY B;  4JI7 L;  1BR9 A;  1E7Z A;  3FPP A;  2JA6 B;  2A74 C;  4V19 0;  2Z0S A;  1W2B A;  1XNQ Q;  1VQG A;  3HFZ B;  5AFW A;  2JYO A;  4ZKB B;  5KIX A;  1PFN A;  1A2T A;  1VQL A;  4JI6 Q;  5C3E G;  3V05 A;  1PV4 A;  5LMN W;  4WJ4 A;  4L5T A;  2ENB A;  1JOO A;  4DK3 C;  1SE2 A;  2XWB B;  3CCJ A;  4DR7 L;  1TS4 A;  3BDL A;  1YHQ A;  3S16 B;  2BH2 A;  1EY4 A;  3BU2 A;  4RH6 A;  2CQO A;  3BDO A;  3QOL A;  1PH1 A;  4WFN 3;  3VYS A;  1SYD A;  4NB3 A;  5E1F A;  2MUY A;  4DK1 A;  4A3M H;  2JEA I;  1U5K A;  4LWC A;  3HOY H;  2JEB I;  1SNM A;  4LF4 Q;  2QIL A;  2K5V A;  4AQY L;  4LF7 L;  1OXS C;  4JI8 Q;  5C3E B;  4GKJ Q;  2PNH A;  1O7Z A;  3BDC A;  5ELO A;  4GLA C;  3S1M B;  3PCO B;  1CFM A;  4IZ8 A;  2ZJP A;  2B63 G;  3NP8 A;  1PDQ A;  3NEL A;  1IKL A;  3SXH A;  4ILW A;  5GAD C;  2HUG A;  1UEB A;  2CWP A;  1JCK B;  4JI2 Q;  5BN5 A;  1KNE A;  4UP7 A;  1SBB B;  2UXC Q;  1DOK A;  3CCV A;  4FO2 A;  2OTJ A;  5ELB A;  1WD0 A;  1EZ6 A;  2JSO A;  3MFG A;  4XT1 B;  1FNU A;  5C0X J;  3HOW G;  4DV2 Q;  2F03 A;  3U9O A;  3D8G A;  4XQN A;  1WTW A;  4GNX C;  1XTC D;  4HID A;  5D65 A;  5EQ0 A;  5K36 G;  2NVT H;  4JYA Q;  2SNM A;  4TRD A;  3NHH A;  2LY7 A;  1LTR D;  1HZ9 A;  5JPN C;  2B63 B;  4A3K H;  1KXL A;  4JBK A;  4MNO A;  1HHV A;  2ZXO A;  1U4M A;  4LJZ C;  2EOT A;  4HIM A;  1G8Z D;  2L1B A;  1LTL A;  3HOW B;  4L63 B;  3S17 H;  1TWC B;  3ULJ A;  3I4N H;  4JBM A;  1EL0 A;  2VXW A;  4DR1 L;  1GUO A;  1K83 H;  4UHV A;  5IOD A;  2EE1 A;  5LL6 X;  2YYZ A;  1SRO A;  5GAH C;  3T1Y Q;  2DGY A;  2J4X A;  2UXB Q;  2I5M X;  3FKI G;  1B53 A;  1EIY B;  1EEI D;  1BXT A;  3K57 A;  1GJX A;  1O7L A;  1STE A;  1DXM A;  4X3T A;  4DUY L;  2JE6 I;  1IYJ B;  5J3B A;  1XYI A;  5M5W H;  3GTG H;  4O1N A;  1N8R C;  5CV9 A;  2PQE A;  2K52 A;  4OHJ A;  5IY0 A;  2A73 B;  3TDQ A;  3RZO H;  4GLV B;  1TWA H;  1OO9 B;  4LFA L;  3CCR A;  1VQ9 A;  1PTO H;  2AWO A;  3KLW A;  1BBU A;  1CHP D;  1MHW C;  1L1O C;  3IFD A;  4OWW B;  5C6A A;  3FKI B;  1K28 A;  4QJF A;  1VQO A;  4C3H G;  2NN6 I;  3P75 A;  4CDE C;  4IUU A;  1QWY A;  1RJT A;  3GO5 A;  1QVC A;  1OXX K;  1PFS A;  3QIA A;  4FYD A;  1HZB A;  4JV5 Q;  4DV7 L;  2F0H A;  3K5L A;  4QMG A;  2I07 B;  5IYD H;  2B2U A;  1SXT A;  1NTG A;  1VMC A;  2WAQ E;  3MFY A;  3I55 A;  1HRJ A;  4L6T B;  1FD7 D;  4B9X A;  1PLF A;  4YY3 L;  1YNJ C;  1H9M A;  1NR4 A;  2OF1 A;  1RKN A;  3EIV A;  1X54 A;  3ZJY C;  3T1H L;  1I4R A;  2EXD A;  3T53 B;  5JVG 3;  1H9S B;  1HCZ A;  4N8X 1;  4C3H B;  2VQE L;  2YU9 H;  3ITP A;  4O42 A;  1BDO A;  1ROD A;  2BH8 A;  3BVZ A;  2ZXR A;  5AJ3 L;  5BN4 A;  3HOX H;  2K01 A;  4JI7 Q;  1TWF B;  3KBX A;  3HOU G;  1AZP A;  1DD2 A;  2QDB A;  1VQH A;  3H3V C;  4IFD J;  2F0I A;  1P16 A;  1PH2 A;  1YZ6 A;  1K8M A;  2D5D A;  3S1Q B;  2VQF L;  4KD4 A;  1KTK A;  2UU9 L;  1DOL A;  1KAB A;  2B2Y A;  2V1C C;  4KHZ A;  4JK1 C;  3CME A;  3OHX C;  4JW0 A;  4C1N K;  4G7Z C;  4KN7 C;  3Q0A A;  4A3G H;  4QUC A;  3NK9 A;  4GOP C;  2KOL A;  3RNU A;  1WTX A;  2NWG A;  3MWY W;  4DAV A;  3DHQ A;  1PH4 A;  4B3S L;  1C4Q A;  3RLO A;  2NYZ D;  5KNB A;  3LNN A;  2DNC A;  5BR8 Q;  1G2S A;  3QO2 A;  4DA2 A;  1HQM C;  2KCT A;  3QR8 A;  2EZV A;  4MTN A;  3I7F A;  2B2W A;  2EY6 A;  3I90 A;  4POG A;  1YIT A;  3HOU B;  1LTT D;  3C3L A;  3I91 A;  5IWA L;  2NVY H;  2NVQ B;  2E2H B;  3MZ5 A;  1Z6H A;  2E2I H;  1N32 Q;  1ESR A;  3I4M H;  3M3Y H;  4LF7 Q;  2OTL A;  3MXP A;  5E4W C;  5CV7 A;  4DNT B;  1XNR L;  2SOB A;  4XT3 B;  1EWI A;  1IYV A;  4PV1 C;  1B9M A;  2BA0 A;  1PVO A;  4A4I A;  2F1M A;  3TME A;  1AZQ A;  1OXT A;  1PZK D;  3B6Y A;  3EJI A;  4JOI A;  2DUD A;  5C5M A;  1I3Q H;  1UNS A;  2A69 C;  2VL6 A;  4RHR A;  2E74 C;  3H0G G;  2R7Z H;  2BOS A;  1VDZ A;  1BBW A;  3MXN B;  4HCE A;  4ZRZ A;  3U4V A;  3JAM L;  4CDC C;  1Y8N B;  2HQL A;  2AMC B;  5C4Z A;  3F2B A;  3E6Z X;  1SFO H;  1Y69 U;  1DOM A;  4A3E H;  3ZYY X;  1SE4 A;  4X65 Q;  3K0Y A;  3SK4 A;  1MGS A;  1JJ2 A;  4A3J H;  2RF4 A;  5FK9 C;  3OTO L;  1F2Y A;  2ATW A;  1CKN B;  5C4J B;  4KD3 A;  3NEN A;  5DAU A;  3CC4 A;  3PGZ A;  5ELD A;  3A55 A;  3A0J A;  2L15 A;  2WKC A;  1QG7 A;  4QGU A;  1E22 A;  1ENA A;  1G91 A;  2R7D A;  1AEX A;  1Q8K A;  2LXK A;  2F52 A;  4DR3 Q;  3H0G B;  4L5Q A;  2TSS A;  3NBI A;  3S1R B;  3PUZ A;  4B9W A;  5JEA J;  2NVX H;  1X3P A;  4RWS C;  4B3M Q;  1MKH A;  4KY5 A;  4DUZ Q;  2F3V A;  1KDA A;  1VS0 A;  3CC7 A;  4A3B H;  2K5D A;  1LM0 A;  4UPA A;  1MI2 A;  1I94 Q;  2JA8 G;  3CKI B;  2MHV A;  3DUZ A;  3PIO 3;  1E0B A;  3UI2 A;  3Q6S A;  5IGC A;  2B2V A;  1VQJ A;  4DV0 L;  1B7Y B;  2NN6 G;  1SYF A;  4EQ5 A;  3MHB A;  2PI2 E;  1HNZ L;  5IIF A;  2EJF C;  2VZA A;  4IO9 A;  4ZYS A;  1WOC A;  1Q8I A;  1DGS A;  1ESF A;  4KTA A;  4B08 A;  1J6Q A;  4F7X A;  2JK8 A;  1PH3 A;  1K73 C;  1JE5 A;  3U50 C;  2VUM H;  4JI5 L;  1YNJ D;  4LF9 Q;  3JAM c;  4KK7 A;  3S15 H;  3P20 A;  2JA8 B;  5I6Y A;  5JAV A;  4RAU C;  3RLF A;  4FDB A;  1V9P A;  4TSS A;  3UE0 A;  3TP7 A;  2F4V L;  4ID6 A;  4R4O A;  5DM7 3;  5CV5 A;  2NZH A;  2ZTE A;  3CD6 A;  2IHF A;  5A35 A;  3M7N A;  2Q2T A;  5ELN A;  3W2D A;  4P2C B;  4FF1 A;  4BBR H;  3KK7 A;  1KDB A;  3I56 A;  2RCN A;  5LL6 S;  1FNW A;  1K3R A;  4JI3 L;  1JE4 A;  1JQY D;  2R7F A;  1FGB D;  4IPG A;  4NW2 A;  3PUW A;  4XXE A;  3A8J E;  5M5X H;  1N36 L;  2ZJR A;  2ICI A;  4X3S A;  4MN3 A;  3J81 i;  3BVM A;  3FPU B;  1IBL Q;  1F2M A;  1ZYR C;  3UDF A;  5E3F A;  1JWM D;  4BY1 H;  3MTS A;  4DV4 Q;  1RD9 D;  2ASB A;  2PNR C;  4H0L C;  3T1H Q;  1MBY A;  1STH A;  2A6H D;  2L5T A;  1KHI A;  3ULL A;  1S5F D;  5CYU A;  3S2H B;  3L2P A;  1R4Q B;  1PFM A;  1X55 A;  1EYG A;  4X64 Q;  1HR0 W;  1JR0 D;  3RN2 A;  4DXG A;  3EVQ A;  1DM0 B;  3NTK A;  3M4O H;  4JBJ A;  2RHS B;  3AMU A;  3I8Z A;  1CSP A;  1ET9 A;  4HJ7 A;  4RMF A;  2VQF Q;  4R4T A;  3MXG A;  4XTC S;  2K05 A;  2F4I A;  2JA5 H;  4H02 A;  1GOZ A;  3E9I A;  1HNX L;  1HA6 A;  1IW7 C;  1VQP A;  1IBM L;  1RL2 A;  3I4L A;  3TQY A;  1C8C A;  1X3F A;  1GO3 E;  1ASY A;  2CCZ A;  3RZD H;  3GP7 A;  3VYR A;  1Z9F A;  1C7Y A;  4X66 L;  1MSH A;  1XPU A;  5F2D A;  3I72 A;  2KQ3 A;  1W3S A;  2AWN A;  2VNU D;  1SEB D;  5IYC G;  2GN5 A;  2A69 D;  1HH2 P;  3TS2 A;  1SR3 A;  2JA7 G;  2N55 A;  3S14 B;  3M7G A;  4UY8 C;  4HIO A;  5IWA Q;  5IT9 L;  4NP5 A;  1K9M C;  1EIG A;  1FJG Q;  4H44 C;  3VR2 A;  1Y14 B;  1KDC A;  1PH5 A;  1KD1 C;  3GD7 A;  4HSP A;  1XNR Q;  1SNO A;  4WJ3 M;  3GV6 A;  1JIC A;  3DWP A;  4NXN Q;  2PMZ E;  4A93 H;  4U68 A;  2XSC A;  1D8L A;  2K7V A;  2LS0 1;  3OW7 A;  4CJ0 B;  3A5U A;  1SNC A;  5IP7 G;  4DV6 L;  1GVP A;  2O2L D;  4X3U A;  3RLN A;  3CQZ H;  3PUV A;  1L1O A;  5JOB A;  1CKM A;  5GQO A;  4RA8 A;  2F0L A;  1J5E L;  4A3C H;  2JA7 B;  1VQK A;  2FMM A;  1B70 B;  1UAP A;  3GDE A;  4DR2 Q;  1KLG D;  1LAC A;  2F0G A;  2SEB D;  3F2D A;  4DAY A;  3GTL H;  1XXG A;  5LMN L;  2A68 C;  1IKM A;  4KMU C;  1YNN D;  1NAP A;  2N3S A;  3PV0 A;  4C3I H;  1Q3L A;  1E2W A;  1Y1W H;  1Q90 A;  1VQA A;  1GD7 A;  1UUP A;  4DAM A;  5C44 G;  3NBH A;  3J7A F;  2BDO A;  4IPD A;  3R3O A;  1HUN A;  1EQR A;  4OEM B;  4TQU S;  1B8A A;  3TSS A;  2NBF A;  3GTJ B;  3RR5 A;  5ELC A;  2HQE A;  2JXM B;  1X3G A;  5JEA G;  4YCW A;  2A6E D;  1E2Z A;  4IFD H;  1PYW D;  3SDZ A;  4ABN A;  2K04 A;  3I4O A;  1WCM H;  1VQ4 A;  2UUB Q;  5I9O A;  1CQF A;  1BKB A;  4O2D A;  4EX5 A;  4BBS H;  4A76 A;  1D5X C;  5IT9 c;  3I70 A;  2Z6B A;  1RDP D;  3CPW A;  2KHJ A;  4GZY C;  3PO3 G;  5D14 A;  1IBK Q;  3PO2 H;  1NMG A;  4ZKC B;  5C44 B;  4C3J H;  3T13 A;  4DV0 Q;  4R1J A;  1EQV A;  4UP9 A;  1WTR A;  2B29 A;  1ICF B;  4GLX A;  2EY2 A;  3JAM E;  3A74 A;  3ERS X;  3K7A B;  4KJO A;  2KHS A;  1QCB D;  4ODG A;  3WDN A;  4A3K G;  2F3I A;  1VQC A;  4H7B A;  1ONL A;  5K5P A;  2CQA A;  1WVL A;  2DNE A;  5KEE A;  1T9H A;  2F0E A;  1KRT A;  3V2T A;  3W1G A;  5DLQ E;  4Y52 H;  3IAY A;  1S3O A;  5EKI A;  3SK5 A;  1ZYR D;  3LWU A;  1FGU A;  4K2K A;  3I4N G;  2BE5 C;  3PO3 B;  4I7A A;  4K5W A;  1JB3 A;  1SJE D;  3AEV A;  1WTV A;  4DR4 Q;  4LF5 Q;  3PF4 A;  4CDD C;  4R4Q A;  4LFB L;  3LGJ A;  1R9T H;  1XPO A;  4A3K B;  1EOT A;  3FEW X;  3ULP A;  2AHO B;  4DR5 L;  2UUA Q;  3CCM A;  4NXM L;  3OIQ A;  1JB7 A;  3U4Z A;  4P71 A;  1YHA A;  2Z6K C;  5EPK A;  3SR1 A;  1GUN A;  3ICE A;  3K80 C;  4IPH A;  2XWJ B;  2F0M A;  3PUY A;  4HSV A;  5JJK A;  3H3V H;  1SNP A;  2RDF A;  2Z1C A;  4KHV A;  5LHY 1;  4X6A H;  3S17 B;  3A7L A;  2K5W A;  2F0V A;  2C35 B;  4XQQ A;  3I4N B;  2OXP A;  4RFB A;  4FVM A;  4K5V A;  3DEO A;  2Z4I A;  5C4H A;  1FL0 A;  4XQJ A;  4JI0 L;  1QB5 D;  2EQS A;  1B3Q A;  1K83 B;  5KRU A;  1IW7 D;  4CKB A;  1L0Y B;  1VQI A;  4LUO A;  4A3I H;  3GTP B;  1VQB A;  1W6K A;  2MO1 A;  3F2U A;  4OO1 I;  1CQV A;  3PQI A;  2FFK B;  4OIJ A;  2I5L X;  5IYB H;  1STA A;  2PW5 A;  1XTD A;  4B3T L;  4FF2 A;  3SE0 A;  3UDG A;  1XMQ L;  2EY5 A;  5FO7 B;  2AUJ D;  5H1S E;  2QCP X;  5M5W B;  1N33 L;  3J7Z C;  3F2C A;  2JQO A;  3MXU A;  1SYE A;  4C1N I;  5IYD G;  3TS0 A;  1KAW A;  1HJP A;  2EYF A;  4M1U B;  2JA6 H;  5ELF A;  1Y1V G;  3S9W A;  3BZD B;  4OEL B;  2XRQ D;  2WFW A;  1A3U A;  1HNX Q;  1PZI D;  1PTO B;  2D62 A;  1IBM Q;  3S2D B;  2IW3 A;  2ICE C;  1AN8 A;  1SE3 A;  1G29 1;  5E4X A;  1VQ7 A;  3R8B A;  2M2L A;  4X66 Q;  2HDL A;  3STB D;  2PQA B;  1GUS A;  1Q46 A;  4BY7 H;  3S16 H;  2E76 C;  3CCL A;  5M5Y H;  1EU4 A;  2J7Z A;  1XMO L;  1YIJ A;  1HNW L;  4IOC A;  1HA5 A;  5EAY A;  1FNV A;  1AE2 A;  4IQZ A;  4JI1 Q;  2RA4 A;  2OQ0 A;  3TEH B;  1Y1V B;  5CV6 A;  5DNF A;  1AH9 A;  1WTH A;  2A68 D;  5M9O A;  4RHS A;  1STY A;  2LXJ A;  3RD4 A;  1Z7T A;  4AH6 A;  4CKE A;  5C3E H;  5M3F G;  1X6O A;  2NUC A;  2ZTD A;  3I3C A;  4ME3 A;  1YBY A;  2AQ2 B;  3WOF A;  5CC4 A;  4V0B A;  4GN5 A;  4LF6 L;  2HIV A;  4S3S A;  1RF2 D;  2AQ3 B;  2MPM A;  3J7A V;  3GQB A;  2PI2 A;  3BZK A;  1STB A;  3U9S A;  1KNA A;  1RHP A;  2IX1 A;  1U4L A;  4LK1 C;  2NZO A;  3PMF A;  3R93 A;  1ENC A;  2HIX A;  1N34 Q;  1E3P A;  4YHH L;  1PXU A;  1LV9 A;  4PMB A;  2O4X A;  4CDF C;  2MFI A;  2ZM6 Q;  4KY7 A;  3KJP A;  3D4D A;  2O5I C;  1FR3 A;  5M3F B;  5IGE A;  1WTQ A;  4K0K L;  4IN3 A;  1SAP A;  4DNR B;  3NWS A;  2B63 H;  1TKW B;  2LKV A;  2K4K A;  2E2J B;  4KI0 A;  3J81 L;  5C4X G;  5IT9 E;  4JVZ A;  5FJ8 H;  3K6O A;  4A3F G;  1UE5 A;  2K75 A;  1JJC B;  1QNK A;  1QUQ A;  4HJ9 A;  4IUR A;  5HGQ A;  1SND A;  2XIW A;  1V1P A;  3G6J B;  1CHQ D;  4J6H A;  4J8Q A;  1TWC H;  3X3N A;  4QUF A;  5I4D A;  5M3M H;  1HFN A;  1TU2 B;  1JOQ A;  3KDF A;  4AYB G;  5COR A;  1FVI A;  4X62 Q;  2NVY B;  4XIG S;  3GTM B;  3TP8 A;  2AKW B;  5K36 H;  2BE5 D;  2RSN A;  3TRE A;  2E2I B;  4DV1 L;  2XGT A;  1MJC A;  4KKT A;  3A7A B;  3M3Y B;  2G5D A;  3VDY A;  1SMY C;  4EGV A;  4K8J A;  2O5J C;  2ZJQ A;  1PRT B;  5C4X B;  4OGQ C;  4A3F B;  1IXR A;  3PSI A;  3GTK H;  2B2T C;  2K50 A;  1HUM A;  4PMC A;  2F0F A;  1LLR D;  1O80 A;  4OWT B;  1I5F A;  4KKU A;  4OIK A;  2BA1 A;  3K0X A;  2C5C A;  2F0K A;  2RCF A;  2A6H C;  4RGN A;  4AYB B;  4YCV A;  1QVG A;  1M1K C;  5EKL A;  2DJG C;  4QIW B;  4JI4 L;  1SMX A;  3JC6 6;  1U0L A;  4H13 C;  1WYD A;  3T4A C;  2MJ8 A;  2KJX A;  3FKI H;  4HMJ A;  1HPC A;  4DR7 Q;  4B3R L;  3WWV A;  4OO1 G;  1II3 A;  1STN A;  2R3Z A;  1X3Q A;  3CC2 A;  3RMH A;  2RKS A;  4DR5 Q;  3J81 c;  1OXU A;  1TY2 A;  4NXM Q;  3ER0 A;  4PQX A;  4KHP L;  1BCP F;  4C56 C;  2B3G A;  2KCM A;  1VQN A;  4AQY Q;  1LTB D;  2RVL A;  3EN2 A;  2G9D A;  1UE6 A;  1X56 A;  3L3O C;  4HN7 A;  1HTP A;  4KY6 A;  3OYY A;  2NVX B;  5CR3 A;  2HHH L;  3E3X A;  3CPF A;  2CHB D;  4HAE A;  1L0W A;  3H6M A;  1D1I A;  2IX0 A;  1K8O A;  4LW1 A;  1V8Q A;  3KOJ A;  5KYI A;  3BJU A;  1H9J A;  1RTN A;  3H09 A;  3KF6 A;  4UAI A;  4FXG C;  5IGD A;  2K5Q A;  3KUP A;  3RN5 A;  1KRS A;  1PH9 A;  4B3T Q;  2NTS A;  1A63 A;  3CMA A;  4XDX A;  5CMD A;  5A2Q L;  1EY5 A;  1LAB A;  4PZ6 A;  1N33 Q;  3OOC A;  1P8L A;  2YV5 A;  3S1Q H;  1S5D D;  1BF4 A;  2K33 A;  2D0P A;  1CZW A;  1PZJ D;  5G3L F;  1H9R A;  2L9H A;  1JOR A;  4FNF A;  4Q5V A;  2L0C A;  4P75 A;  1GKH A;  3NTI A;  2RHQ B;  3K5M A;  3D0F A;  4GKK L;  4IUQ A;  3V96 A;  4BWG B;  1I4H A;  4FXD A;  1ML0 D;  1VF7 A;  3A8K E;  2NB0 A;  4HMI A;  1HNW Q;  3HOU H;  2Q2H A;  4DR1 Q;  1YNN C;  3HOV H;  1MJE A;  4AIM A;  1A3T A;  1DCZ A;  2NVQ H;  5HUR A;  5LMU L;  5M5X B;  1YJN A;  1GHJ A;  4LFC L;  2E5L L;  1B50 A;  2UUC L;  4LMQ D;  4PG3 A;  1TWG B;  3OMG A;  3J80 i;  3H3V I;  1HR0 L;  1AW7 A;  2N88 A;  4EQN A;  2QA4 A;  1RIP A;  1TWH B;  4DUY Q;  2JA5 G;  3NPP A;  3A5Z B;  3FVQ A;  2A6E C;  2ES2 A;  3BZC A;  4RKL A;  3ERO A;  2AUK A;  2IT1 A;  4CKC A;  1G6Z A;  1VQ8 A;  3J7Y W;  4Y7N B;  3DEP A;  2KVM A;  1WTO A;  4CJ1 B;  1SRU A;  4LFA Q;  1LT4 D;  2L55 A;  5CBE E;  5FOB B;  3CRK C;  3HKZ G;  4FXK C;  3C2P A;  1A3V A;  2PW7 A;  3L7Z C;  2Y0S G;  3QJY A;  1M90 C;  3C46 A;  3FMC A;  3TRZ A;  2F0U A;  1LTS D;  3HP3 A;  1N9W A;  3TZU A;  5G3L D;  1NSN S;  1LT5 D;  4Z9C B;  3OMC A;  1G6P A;  4TVA B;  5CGK A;  5JVH 3;  2K03 A;  1JC7 A;  1J8I A;  2Z6K A;  3MAQ A;  2JA5 B;  1LT3 D;  2YTY A;  3KF8 A;  4DPG A;  4DV7 Q;  1O7Y A;  1SMY D;  4JI6 L;  1B1Z A;  5C0X H;  5IP9 G;  2DY7 A;  5T1G A;  3W5O A;  4J1M A;  3M9B A;  4A93 G;  2G9H D;  1YVC A;  2BDN A;  2KHI A;  4YY3 Q;  4F8M A;  3HKZ B;  1NCV A;  2Y0S B;  2A19 A;  4A3C G;  4XYQ A;  3TP5 A;  1PFB A;  2VB2 X;  3Q8D A;  2VQE Q;  2A1A A;  2RSO A;  2K28 A;  1NR2 A;  1S4Z A;  2L4N A;  5EPL A;  4GNX A;  4DV1 Q;  4YWM A;  4C3I G;  1Y1W G;  1EY9 A;  4JI8 L;  3MVV A;  4GKJ L;  5AJ3 Q;  2HCI A;  3GTO B;  1B4O A;  4O0A A;  2I0Q A;  4DKA C;  3NEM A;  4U67 3;  5I2X A;  1RCV D;  1I4Q A;  4A93 B;  1X32 A;  2R92 H;  2WB1 G;  3D3R A;  2UXC L;  3O13 A;  4ZK9 B;  3SVM A;  1SDF A;  4IUP A;  3UE1 A;  2IWH A;  2UU9 Q;  4QB4 A;  3P7J A;  1WTP A;  1D1K A;  2R93 G;  3BYY B;  4DV2 L;  5FLM G;  3J81 E;  3GTQ B;  4CHT B;  1NMF A;  2R6G A;  1WCM G;  4B3S Q;  2PZU A;  3GTL B;  1VF5 C;  3QOJ A;  1QJO A;  2D2C C;  3N6R A;  3MC0 B;  1PTO F;  3T16 A;  4HIK A;  2MP1 A;  4BBS G;  4A3D G;  2NN6 H;  4C3I B;  1TR5 A;  3IL8 A;  1Y1W B;  4B3R Q;  4QF4 A;  1PRT C;  4JYA L;  2KEC A;  1TY0 A;  3OWE B;  2OT2 A;  2E2D C;  4C3J G;  4G7H C;  4QIW E;  2QEX A;  1JWS D;  1BCP B;  2UXD L;  1O78 A;  3Q24 A;  3M85 A;  1CSQ A;  2ZT9 C;  2WB1 B;  3I73 A;  4BXX H;  4DV5 L;  1TS2 A;  2Q8T A;  2K5H A;  2PZW A;  5KYL A;  3CRL C;  2B2Y C;  1TS3 A;  2BCO A;  1NUC A;  4DR6 L;  2R93 B;  4K6D A;  1KC8 C;  1H95 A;  3NQI A;  1Q1B A;  1AFP A;  2PO4 A;  4FF4 A;  4C2M H;  2KCN A;  1WCM B;  5GAG C;  2HHH Q;  1GUW A;  2JN4 A;  3LWE A;  4ZUJ A;  3DLL A;  1I6H B;  4BBS B;  1D5M C;  4A3D B;  1F9Q A;  3STB C;  2N49 A;  3IFT A;  5I9P A;  4K8I A;  2D0O A;  1L1O B;  5TSS A;  1BQQ T;  3SK8 A;  4C3J B;  3T1Y L;  3S2H H;  1RTO A;  1H9K A;  3KYH C;  4RCO A;  1STG A;  2E75 C;  2MQH A;  3TBI B;  1TVX A;  1A8V A;  2WAQ G;  4DAY B;  5I6W A;  2KA7 A;  2QGQ A;  1BBX C;  1YI2 A;  4PZ8 A;  5JJI A;  4HJ8 A;  5ELE A;  3OTO Q;  1EOV A;  2FHT A;  5IGB A;  2I46 A;  3U58 A;  2F0S A;  1SYG A;  3NBH B;  4DXF A;  5IGF A;  1LYL A;  2CH4 W;  2WAC A;  3HOY G;  2PYK A;  3VR5 A;  1BVS A;  3OIP A;  2PCF B;  1PYS B;  2QEJ C;  1F2Z A;  2H5X A;  3HEJ A;  4HED A;  2K5N A;  2PZT A;  4K14 A;  1Q12 A;  2MNA A;  5CV8 A;  4FF3 A;  4WOR A;  2KEE A;  4P73 A;  2WAQ B;  5DEH A;  4NMZ A;  5KNC A;  4X3K A;  4JV5 L;  2JA9 A;  1FYC A;  5IYB G;  2X69 A;  1CA5 A;  2YTX A;  2F0O A;  2VY3 A;  3ERQ A;  3EQL C;  1DJR D;  3CW2 C;  4A3M B;  1XPR A;  3Q22 A;  3EBE A;  2B2T A;  1EU3 A;  3UDI A;  3PIP A;  3HOY B;  2E5L Q;  5DM6 3;  2CVR A;  1AE3 A;  3CCU A;  1EIF A;  5HGT A;  1HNZ Q;  3FDT A;  5A2Q E;  2X6L A;  4EQO A;  4DNI A;  5C3W A;  3Q23 A;  3M4P A;  4J15 A;  1PRT F;  4GOP A;  2OCE A;  3CXC A;  2N8N A;  2D9U A;  2HD3 A;  3L0O A;  3D4W A;  1IYU A;  2JA7 H;  5FO8 B;  4N9T A;  4JI5 Q;  4BY7 G;  3KJO A;  1EY0 A;  2KEN A;  3VR4 A;  1A62 A;  3X3M A;  1XX8 A;  4DN4 M;  2B2V C;  2F4V Q;  4A3L H;  1K0S A;  4LUV A;  3G48 A;  3TZD A;  4HR7 B;  1I4G A;  2NVT B;  2KUM A;  5ISR A;  3OSO A;  1EZ8 A;  3S1N H;  3VYU A;  1SN8 A;  1I50 H;  3A56 A;  4QCL A;  2XN9 C;  5IP7 H;  1JWU D;  3GTJ H;  4JI3 Q;  3EA6 A;  1V43 A;  1N36 Q;  1F9R A;  1DON A;  1QE6 A;  1VQE A;  1JJG A;  4PZ7 A;  1Q81 C;  4F87 A;  4GN3 B;  5BR8 L;  1I4P A;  4BY7 B;  3M4Y A;  4R4C A;  4YIJ A;  5M5Y B;  3VA5 A;  2XRS D;  3IKJ A;  2F0P A;  1OTC A;  3K58 A;  1HQR D;  1TXY A;  2RBM A;  1EWC A;  1IZ6 A;  1EYC A;  1JT8 A;  3HOZ H;  3HKZ E;  1N32 L;  5C44 H;  1U4R A;  5IE8 A;  3AB9 A;  1MD2 D;  4IJL A;  2Y0S E;  3W1B A;  1PMR A;  3CP0 A;  1VQF A;  1EWH A;  1CK1 A;  1PRT D;  1LTI D;  3TN2 A;  3K7A H;  3K81 C;  4BA1 I;  5JPM C;  2K14 A;  5JEA H;  1EYD A;  1T5E A;  4LF8 L;  3G7L A;  3GTG B;  4I65 A;  4TKO B;  3ONA B;  3QB3 A;  5FJ8 G;  4RGT A;  1LTA D;  1PH6 A;  1EYA A;  3KFU A;  1BUV T;  2OQK A;  1KL9 A;  3RZO B;  1XJV A;  4JCV E;  1M4V A;  1TWA B;  4FP5 D;  4CBV A;  1DYQ A;  3M4Q A;  3R2I A;  1AP0 A;  3PO3 H;  1ZXT A;  4F88 A;  1A0I A;  1YHB A;  1HZC A;  5M3M G;  1ENF A;  1S40 A;  3NUC A;  3DWQ A;  4X65 L;  3H94 A;  1SSO A;  1HZA A;  3ND8 A;  4PMW A;  3J7A 5;  2UXD Q;  1LUZ A;  5EBD A;  2ALY B;  2L11 A;  1E1O A;  3ND9 A;  4KN4 C;  3TP6 A;  1BO0 A;  1O7I A;  4DV5 Q;  3HOX G;  1R4P B;  3J80 L;  4L5R C;  5C0X I;  2EIF A;  4DR3 L;  3E5S A;  5GRO A;  4DR6 Q;  2NTT A;  1CM9 A;  1X65 A;  2WB1 E;  2PQA A;  3S1M H;  4B3M L;  4XYO A;  5M3M B;  4DUZ L;  2ID0 A;  4HJ5 A;  3K59 A;  2IJ0 A;  5FLX L;  5I2Y A;  4MZ9 A;  4A3G G;  4APV A;  3DM1 A;  1I94 L;  4DV6 Q;  2IHE A;  1ZKO A;  3GTP H;  4G57 A;  2YU9 B;  5IOC A;  2GA4 B;  3AYH B;  1J5E Q;  1BCP C;  1F2L A;  2K6A A;  2GVB A;  1S5C D;  1J9O A;  4A75 A;  3HOX B;  3GTK B;  4DFA A;  3IRB A;  2OEO A;  5LMN Q;  5EPJ A;  4YWK A;  3MEF A;  3E9H A;  3K5N A;  2QKI C;  1IL2 A;  2CKZ B;  3I4M G;  3D31 A;  4R8N A;  1PHJ A;  4A3G B;  3S2D H;  4LF9 L;  3CCQ A;  1K8A C;  4IUV A;  1HXY D;  1VQD A;  5E7N A;  1S72 A; 
#chains in the Genus database with same CATH homology
 1BOS A;  3D6C A;  1V1P B;  2MGS A;  3D4R A;  5KGU A;  1ILQ A;  4I7Z C;  3QWN A;  3NXW A;  3MEH A;  3HS0 C;  3LX0 A;  2EJG C;  2L12 A;  3NQT A;  4MIU A;  2HCC A;  3I4M B;  2K32 A;  1GHK A;  5CV4 A;  5FO9 B;  1A15 A;  2F0N A;  2WP8 J;  2X6G A;  3VYT A;  1H9S A;  1UEA B;  3SHL A;  3H91 A;  1D6E C;  1Y8O B;  2F0T A;  4DGZ A;  4KKS A;  1I3Q B;  2FMC A;  4WJW A;  2R7Z B;  1F9S A;  2Z8L A;  1S5E D;  2K1B A;  3VA7 A;  1QIL A;  2V4D A;  2H4O A;  1ICW A;  1SFO B;  4A3E B;  5NUC A;  4A3J B;  1F9P A;  3GV3 A;  3A8I E;  2WV6 D;  3BYT B;  1TQO A;  2M00 A;  1D2B A;  5T1I A;  3DMU A;  2WIN B;  4IAL A;  1G2T A;  2XVS A;  2EYO A;  3HZX A;  3D6W A;  3PUX A;  4OL7 A;  4BS9 A;  5JJZ A;  1M8A A;  2M9V A;  4IFD I;  1EFI D;  3NTH A;  5D3D A;  3KBG A;  4A3B B;  4DF7 A;  1EY6 A;  3HOV B;  1I4X A;  1SNQ A;  3WOE A;  2CW0 C;  2PMZ B;  2RQX A;  2VB3 X;  2B39 A;  4ZQ3 A;  4E6I A;  2H1E A;  3L9A X;  3HGB A;  1SYB A;  3VR6 A;  1LT6 D;  1S5B D;  2J0T D;  5C0X G;  2EXZ A;  5J22 A;  5J39 A;  3MA2 B;  3SK6 A;  4L8J A;  3BVG A;  2VUM B;  3AU7 A;  3MXN A;  2B8G A;  3S15 B;  1B44 D;  1A6X A;  2IL8 A;  1L0X B;  1V1O A;  1EEF D;  1E2V A;  1CI3 M;  1DZ1 A;  1BCP D;  4ME5 A;  4BBR B;  1C48 A;  3VR3 A;  2R61 A;  2SDF A;  4IUN A;  1OXV A;  2FJ2 A;  1WD1 A;  3N52 A;  3NWT A;  1B2T A;  1PTO C;  4KJN A;  4BY1 B;  2JP1 A;  4EVO A;  1HTL D;  3QG1 A;  1XWE A;  3FRP B;  2QF7 A;  3KLR A;  2C9O A;  4OO1 H;  4UDU C;  1QOH A;  2EYH A;  1EQT A;  2F0Q A;  3HRZ C;  1W6J A;  2FIN B;  3M4O B;  4CJ2 C;  2R92 B;  5COY A;  3DXJ C;  2F0D A;  2Z4H A;  1ZEQ X;  4ULL A;  2Q8R E;  5J1Z A;  1GUT A;  1IL8 A;  3CHB D;  3J80 E;  5FKA C;  1EY8 A;  2LMC B;  2RDH A;  3RZD B;  2EYL A;  2A5H A;  3C1E A;  3EFX D;  1A2U A;  4DAP A;  4K2L A;  5FLX E;  4LAA A;  2DN8 A;  1B9N A;  4NDX A;  1T5X D;  4KV6 A;  5EJW A;  2ZXP A;  1BNZ A;  1Q1E A;  2IPK D;  2F3W A;  1ET6 A;  2B2U C;  4C2M B;  3DWA A;  3C1F A;  4HTH A;  3NE5 B;  1Y8P B;  1TS5 A;  1EIH A;  1LO5 D;  3BG3 A;  1SJH D;  4HCS A;  2HDM A;  3CQZ B;  4IUT A;  4RKB A;  5EBC A;  1IHZ A;  4K6L A;  4BA2 I;  2EDG A;  2AQ1 B;  4IFD G;  2RDG A;  3KLS A;  1D5Z C;  4MHE A;  1ILP A;  1U4P A;  3T56 B;  3PIP 3;  2WII B;  1JOK A;  2B8F A;  3NSW A;  2CW0 D;  4RCN A;  4ZLT F;  2EYJ A;  2LFN A;  1MSG A;  1CA6 A;  5C3X A;  4DU9 A;  1QNU A;  4ZUI A;  4G4K A;  4NKL A;  2SNS A;  4JBW A;  5KND A;  5IGG A;  3E0J A;  4N9P A;  3A54 A;  2PPB C;  1KLU D;  2EVB A;  5D3I B;  1TII D;  2XNA C;  4M8A A;  5EKK A;  1HFG A;  3PO2 B;  2B2W C;  3KLS X;  2KCC A;  4WRD A;  4EQP A;  2EJM A;  4RGM A;  4R9W A;  5C5L A;  1CT1 D;  2Q8I B;  2F0J A;  2NZ1 D;  1I6V C;  3W3A A;  2DY8 A;  3K5O A;  4DK0 A;  3R2T A;  4K5X A;  1U9R A;  1PTO D;  3P1H A;  1GXD C;  5EGT A;  2WKD A;  4Q0F A;  2EYM A;  3T51 B;  4G7O C;  1GUG A;  1SYC A;  1EY7 A;  3S1N B;  5BN3 A;  3SEB A;  2TMP A;  1R9T B;  1I50 B;  4R8I A;  3RUZ A;  1VMP A;  3URY A;  3OWF A;  2EPB A;  1CTM A;  1KAA A;  2IX3 A;  1CZG A;  4PNY A;  2EYP A;  3HG9 A;  1LTG D;  1Z47 A;  2F0W A;  3OPO A;  2KED A;  2EY1 A;  4RGO S;  1B3A A;  3BS1 A;  5CBA E;  4ZAI A;  3HOZ B;  4A3I B;  1TT2 A;  1VCI A;  3CU7 A;  1F77 A;  4CGY B;  1BR9 A;  3FPP A;  2JA6 B;  2A74 C;  4V19 0;  5AFW A;  2JYO A;  4ZKB B;  5KIX A;  1PFN A;  1A2T A;  3V05 A;  2ENB A;  1JOO A;  1SE2 A;  2XWB B;  1TS4 A;  3BDL A;  3S16 B;  1EY4 A;  4RH6 A;  3BDO A;  3QOL A;  4WFN 3;  3VYS A;  1SYD A;  5E1F A;  2MUY A;  4DK1 A;  2JEA I;  2JEB I;  1SNM A;  2QIL A;  1OXS C;  5C3E B;  1O7Z A;  3BDC A;  3S1M B;  1CFM A;  4IZ8 A;  3NP8 A;  1PDQ A;  1IKL A;  3SXH A;  4ILW A;  2HUG A;  1JCK B;  5BN5 A;  1KNE A;  1SBB B;  1DOK A;  4FO2 A;  5ELB A;  1WD0 A;  1EZ6 A;  2JSO A;  3MFG A;  4XT1 B;  1FNU A;  5C0X J;  2F03 A;  3U9O A;  3D8G A;  4XQN A;  1WTW A;  1XTC D;  5D65 A;  5EQ0 A;  5K36 G;  2SNM A;  4TRD A;  3NHH A;  2LY7 A;  1LTR D;  5JPN C;  2B63 B;  1HHV A;  2ZXO A;  1U4M A;  4LJZ C;  2EOT A;  1G8Z D;  2L1B A;  3HOW B;  4L63 B;  1TWC B;  1EL0 A;  2VXW A;  1GUO A;  5IOD A;  2EE1 A;  5LL6 X;  2YYZ A;  2J4X A;  1B53 A;  1EEI D;  1BXT A;  3K57 A;  1GJX A;  1O7L A;  1STE A;  1DXM A;  4X3T A;  2JE6 I;  1XYI A;  4O1N A;  5CV9 A;  2PQE A;  4OHJ A;  2A73 B;  3TDQ A;  1OO9 B;  1PTO H;  2AWO A;  1CHP D;  3IFD A;  5C6A A;  3FKI B;  4C3H G;  2NN6 I;  3P75 A;  4IUU A;  1QWY A;  1RJT A;  3GO5 A;  1OXX K;  3QIA A;  4FYD A;  2F0H A;  3K5L A;  4QMG A;  2I07 B;  2B2U A;  1SXT A;  1VMC A;  3MFY A;  1HRJ A;  4L6T B;  1FD7 D;  4B9X A;  1PLF A;  1YNJ C;  1H9M A;  1NR4 A;  2OF1 A;  1RKN A;  1I4R A;  3T53 B;  5JVG 3;  1H9S B;  1HCZ A;  4C3H B;  3ITP A;  4O42 A;  1BDO A;  1ROD A;  3BVZ A;  2ZXR A;  5BN4 A;  2K01 A;  1TWF B;  3KBX A;  1AZP A;  1DD2 A;  2QDB A;  3H3V C;  4IFD J;  2F0I A;  1K8M A;  2D5D A;  3S1Q B;  4KD4 A;  1KTK A;  1DOL A;  1KAB A;  2B2Y A;  4KHZ A;  4JK1 C;  3OHX C;  4C1N K;  4G7Z C;  4KN7 C;  3Q0A A;  4QUC A;  3NK9 A;  2KOL A;  1WTX A;  2NWG A;  3MWY W;  4DAV A;  3DHQ A;  1C4Q A;  2NYZ D;  5KNB A;  3LNN A;  2DNC A;  1G2S A;  3QO2 A;  4DA2 A;  1HQM C;  2EZV A;  2B2W A;  2EY6 A;  3I90 A;  3HOU B;  1LTT D;  3C3L A;  3I91 A;  2NVQ B;  2E2H B;  3MZ5 A;  1Z6H A;  1ESR A;  3MXP A;  5E4W C;  5CV7 A;  4DNT B;  2SOB A;  4XT3 B;  1IYV A;  4PV1 C;  1B9M A;  2BA0 A;  2F1M A;  3TME A;  1AZQ A;  1OXT A;  1PZK D;  3EJI A;  5C5M A;  1UNS A;  2A69 C;  4RHR A;  2E74 C;  2BOS A;  1VDZ A;  4HCE A;  4ZRZ A;  3JAM L;  1Y8N B;  5C4Z A;  3E6Z X;  1Y69 U;  1DOM A;  3ZYY X;  1SE4 A;  3K0Y A;  3SK4 A;  1MGS A;  5FK9 C;  1F2Y A;  5C4J B;  4KD3 A;  5DAU A;  5ELD A;  3A55 A;  2WKC A;  1QG7 A;  1ENA A;  1G91 A;  1AEX A;  3H0G B;  2TSS A;  3NBI A;  3S1R B;  3PUZ A;  4B9W A;  5JEA J;  1X3P A;  4RWS C;  4KY5 A;  2F3V A;  1KDA A;  2K5D A;  1MI2 A;  3CKI B;  2MHV A;  3DUZ A;  3PIO 3;  1E0B A;  3UI2 A;  3Q6S A;  5IGC A;  2B2V A;  2NN6 G;  1SYF A;  3MHB A;  5IIF A;  2EJF C;  4ZYS A;  1Q8I A;  1ESF A;  4KTA A;  4B08 A;  4F7X A;  1YNJ D;  4KK7 A;  3P20 A;  2JA8 B;  5I6Y A;  5JAV A;  4RAU C;  3RLF A;  4TSS A;  3TP7 A;  4ID6 A;  5DM7 3;  5CV5 A;  5A35 A;  3M7N A;  3W2D A;  4P2C B;  4FF1 A;  3KK7 A;  1KDB A;  5LL6 S;  1FNW A;  1JE4 A;  1JQY D;  4NW2 A;  1FGB D;  4XXE A;  3PUW A;  3A8J E;  2ICI A;  4X3S A;  4MN3 A;  3BVM A;  3FPU B;  1F2M A;  1ZYR C;  5E3F A;  1JWM D;  3MTS A;  1RD9 D;  2PNR C;  4H0L C;  1MBY A;  1STH A;  2A6H D;  2L5T A;  1S5F D;  5CYU A;  3S2H B;  1R4Q B;  1PFM A;  1JR0 D;  4DXG A;  3EVQ A;  1DM0 B;  3NTK A;  3AMU A;  3I8Z A;  1ET9 A;  3MXG A;  4XTC S;  2K05 A;  2F4I A;  1GOZ A;  1HA6 A;  1IW7 C;  3I4L A;  1C8C A;  3GP7 A;  3VYR A;  1MSH A;  5F2D A;  3I72 A;  2KQ3 A;  2AWN A;  2VNU D;  1SEB D;  2A69 D;  2N55 A;  3S14 B;  3M7G A;  5IT9 L;  4NP5 A;  1EIG A;  4H44 C;  3VR2 A;  1KDC A;  3GD7 A;  4HSP A;  1SNO A;  3GV6 A;  1JIC A;  3DWP A;  4U68 A;  2XSC A;  2LS0 1;  2K7V A;  3OW7 A;  4CJ0 B;  1SNC A;  4X3U A;  2O2L D;  3PUV A;  5JOB A;  4RA8 A;  2F0L A;  2JA7 B;  2FMM A;  1UAP A;  1KLG D;  1LAC A;  2F0G A;  2SEB D;  4DAY A;  1XXG A;  2A68 C;  1IKM A;  4KMU C;  1YNN D;  1NAP A;  3PV0 A;  1Q3L A;  1E2W A;  1Q90 A;  1UUP A;  3NBH A;  3J7A F;  2BDO A;  3R3O A;  1HUN A;  4TQU S;  3TSS A;  2NBF A;  3GTJ B;  5ELC A;  2HQE A;  2JXM B;  5JEA G;  2A6E D;  1E2Z A;  4IFD H;  1PYW D;  3SDZ A;  4ABN A;  2K04 A;  5I9O A;  1CQF A;  1D5X C;  3I70 A;  1RDP D;  4GZY C;  5D14 A;  4ZKC B;  5C44 B;  3T13 A;  1EQV A;  1WTR A;  2EY2 A;  3JAM E;  3K7A B;  4KJO A;  2KHS A;  1QCB D;  4ODG A;  3WDN A;  4H7B A;  1ONL A;  5K5P A;  2CQA A;  1WVL A;  2DNE A;  5KEE A;  2F0E A;  3V2T A;  3IAY A;  5EKI A;  3SK5 A;  1ZYR D;  3LWU A;  4K2K A;  3PO3 B;  2BE5 C;  4K5W A;  1JB3 A;  1SJE D;  1WTV A;  4A3K B;  1EOT A;  3FEW X;  3OIQ A;  3SR1 A;  5EPK A;  1GUN A;  2XWJ B;  2F0M A;  3PUY A;  4HSV A;  1SNP A;  2RDF A;  2Z1C A;  4KHV A;  5LHY 1;  3S17 B;  3A7L A;  2K5W A;  2F0V A;  4XQQ A;  3I4N B;  2OXP A;  4RFB A;  4FVM A;  4K5V A;  3DEO A;  2Z4I A;  5C4H A;  4XQJ A;  1QB5 D;  5KRU A;  1K83 B;  1IW7 D;  4CKB A;  1L0Y B;  3GTP B;  1W6K A;  3F2U A;  4OO1 I;  1CQV A;  2FFK B;  4OIJ A;  1STA A;  2PW5 A;  4FF2 A;  3SE0 A;  2EY5 A;  5FO7 B;  2AUJ D;  2QCP X;  5M5W B;  3MXU A;  1SYE A;  4C1N I;  2EYF A;  4M1U B;  5ELF A;  3S9W A;  3BZD B;  2XRQ D;  1A3U A;  1PZI D;  1PTO B;  2D62 A;  3S2D B;  2IW3 A;  2ICE C;  1AN8 A;  1SE3 A;  1G29 1;  5E4X A;  3R8B A;  2M2L A;  2HDL A;  1GUS A;  2E76 C;  1EU4 A;  2J7Z A;  1HA5 A;  1FNV A;  4IQZ A;  2RA4 A;  1Y1V B;  5CV6 A;  5DNF A;  2A68 D;  5M9O A;  4RHS A;  1STY A;  3RD4 A;  1Z7T A;  4CKE A;  2NUC A;  3I3C A;  2AQ2 B;  3WOF A;  5CC4 A;  4V0B A;  4S3S A;  1RF2 D;  2AQ3 B;  2MPM A;  3J7A V;  3GQB A;  1STB A;  3U9S A;  1KNA A;  1RHP A;  2IX1 A;  1U4L A;  4LK1 C;  3PMF A;  3R93 A;  1ENC A;  1PXU A;  1LV9 A;  4PMB A;  2O4X A;  4KY7 A;  3D4D A;  2O5I C;  1FR3 A;  5M3F B;  5IGE A;  1WTQ A;  4IN3 A;  1SAP A;  4DNR B;  3NWS A;  1TKW B;  2LKV A;  2E2J B;  4KI0 A;  3J81 L;  5IT9 E;  3K6O A;  1QNK A;  4IUR A;  1SND A;  2XIW A;  1V1P A;  3G6J B;  1CHQ D;  4J6H A;  4J8Q A;  3X3N A;  4QUF A;  5I4D A;  1HFN A;  1TU2 B;  1JOQ A;  5COR A;  2NVY B;  4XIG S;  3GTM B;  3TP8 A;  5K36 H;  2BE5 D;  2RSN A;  2E2I B;  4KKT A;  3A7A B;  3M3Y B;  1SMY C;  4EGV A;  4K8J A;  2O5J C;  1PRT B;  5C4X B;  4OGQ C;  4A3F B;  2B2T C;  1HUM A;  4PMC A;  2F0F A;  1LLR D;  1O80 A;  4KKU A;  4OIK A;  2BA1 A;  2C5C A;  2F0K A;  4AYB B;  2A6H C;  4RGN A;  5EKL A;  4QIW B;  4H13 C;  3T4A C;  2MJ8 A;  2KJX A;  4HMJ A;  1HPC A;  4OO1 G;  1II3 A;  1STN A;  2R3Z A;  1X3Q A;  3RMH A;  2RKS A;  1OXU A;  1TY2 A;  4PQX A;  1BCP F;  4C56 C;  1LTB D;  2RVL A;  2G9D A;  4HN7 A;  3L3O C;  4KY6 A;  1HTP A;  2NVX B;  5CR3 A;  2CHB D;  4HAE A;  3H6M A;  1D1I A;  2IX0 A;  1K8O A;  1V8Q A;  5KYI A;  1H9J A;  1RTN A;  3H09 A;  4UAI A;  4FXG C;  5IGD A;  2K5Q A;  3KUP A;  2NTS A;  4XDX A;  5CMD A;  5A2Q L;  1EY5 A;  1LAB A;  3OOC A;  1S5D D;  1BF4 A;  2K33 A;  1CZW A;  1PZJ D;  5G3L F;  1H9R A;  2L9H A;  1JOR A;  4FNF A;  4Q5V A;  2L0C A;  3NTI A;  3K5M A;  4IUQ A;  3V96 A;  4BWG B;  1I4H A;  4FXD A;  1ML0 D;  1VF7 A;  3A8K E;  2NB0 A;  4HMI A;  1YNN C;  1A3T A;  1DCZ A;  5HUR A;  5M5X B;  1GHJ A;  1B50 A;  4LMQ D;  1TWG B;  3OMG A;  1AW7 A;  2N88 A;  4EQN A;  1TWH B;  3NPP A;  3FVQ A;  2A6E C;  4RKL A;  3ERO A;  2AUK A;  2IT1 A;  4CKC A;  1G6Z A;  3J7Y W;  4Y7N B;  3DEP A;  2KVM A;  1WTO A;  4CJ1 B;  1LT4 D;  2L55 A;  5CBE E;  5FOB B;  3CRK C;  4FXK C;  3C2P A;  1A3V A;  2PW7 A;  3L7Z C;  3QJY A;  3C46 A;  3FMC A;  2F0U A;  1LTS D;  3HP3 A;  3TZU A;  5G3L D;  1NSN S;  1LT5 D;  4Z9C B;  3OMC A;  5CGK A;  5JVH 3;  2K03 A;  1JC7 A;  1J8I A;  3MAQ A;  2JA5 B;  1LT3 D;  3KF8 A;  1O7Y A;  1SMY D;  1B1Z A;  5C0X H;  2DY7 A;  5T1G A;  4J1M A;  2G9H D;  2BDN A;  4F8M A;  3HKZ B;  1NCV A;  2Y0S B;  4XYQ A;  3TP5 A;  1PFB A;  2VB2 X;  5EPL A;  2RSO A;  2K28 A;  1NR2 A;  1S4Z A;  2L4N A;  4C3I G;  1EY9 A;  3MVV A;  2HCI A;  3GTO B;  1B4O A;  4U67 3;  5I2X A;  1RCV D;  1I4Q A;  4A93 B;  1X32 A;  3D3R A;  3O13 A;  4ZK9 B;  3SVM A;  1SDF A;  4IUP A;  2IWH A;  4QB4 A;  3P7J A;  1WTP A;  1D1K A;  3BYY B;  3J81 E;  3GTQ B;  4CHT B;  2R6G A;  3GTL B;  2PZU A;  1VF5 C;  3QOJ A;  1QJO A;  2D2C C;  3N6R A;  3MC0 B;  1PTO F;  3T16 A;  2MP1 A;  2NN6 H;  4C3I B;  1TR5 A;  3IL8 A;  1Y1W B;  4QF4 A;  1PRT C;  2KEC A;  1TY0 A;  3OWE B;  2OT2 A;  2E2D C;  4C3J G;  4G7H C;  1JWS D;  1BCP B;  1O78 A;  3Q24 A;  3M85 A;  2ZT9 C;  2WB1 B;  3I73 A;  1TS2 A;  2Q8T A;  2PZW A;  5KYL A;  3CRL C;  2B2Y C;  1TS3 A;  2BCO A;  1NUC A;  2R93 B;  4K6D A;  3NQI A;  1Q1B A;  1AFP A;  2PO4 A;  4FF4 A;  2KCN A;  1WCM B;  1GUW A;  4ZUJ A;  3LWE A;  1I6H B;  4BBS B;  1D5M C;  4A3D B;  1F9Q A;  3IFT A;  5I9P A;  4K8I A;  5TSS A;  1BQQ T;  3SK8 A;  4C3J B;  1RTO A;  1H9K A;  4RCO A;  1STG A;  2E75 C;  3TBI B;  1TVX A;  5I6W A;  2KA7 A;  1BBX C;  5ELE A;  2FHT A;  5IGB A;  2I46 A;  2F0S A;  1SYG A;  4DXF A;  5IGF A;  2WAC A;  2PYK A;  3VR5 A;  3OIP A;  2PCF B;  2QEJ C;  1F2Z A;  3HEJ A;  4HED A;  2PZT A;  4K14 A;  1Q12 A;  5CV8 A;  4FF3 A;  4WOR A;  2KEE A;  2WAQ B;  5DEH A;  4NMZ A;  5KNC A;  4X3K A;  1FYC A;  2X69 A;  1CA5 A;  2F0O A;  3ERQ A;  3EQL C;  1DJR D;  4A3M B;  3Q22 A;  2B2T A;  1EU3 A;  3HOY B;  5DM6 3;  2CVR A;  5HGT A;  3FDT A;  5A2Q E;  2X6L A;  4EQO A;  5C3W A;  3Q23 A;  1PRT F;  2D9U A;  3D4W A;  1IYU A;  5FO8 B;  4N9T A;  1EY0 A;  3VR4 A;  3X3M A;  1XX8 A;  4DN4 M;  2B2V C;  3TZD A;  4HR7 B;  1I4G A;  2NVT B;  2KUM A;  5ISR A;  3OSO A;  1EZ8 A;  3VYU A;  3A56 A;  4QCL A;  2XN9 C;  1JWU D;  3EA6 A;  1V43 A;  1F9R A;  1DON A;  1QE6 A;  4F87 A;  1I4P A;  4BY7 B;  3M4Y A;  4YIJ A;  5M5Y B;  3VA5 A;  2XRS D;  3IKJ A;  2F0P A;  3K58 A;  1HQR D;  2RBM A;  1EWC A;  1EYC A;  1U4R A;  3AB9 A;  1MD2 D;  1PMR A;  1EWH A;  1CK1 A;  1PRT D;  1LTI D;  3TN2 A;  4BA1 I;  5JPM C;  5JEA H;  1EYD A;  1T5E A;  3G7L A;  3GTG B;  4I65 A;  4TKO B;  3ONA B;  3QB3 A;  4RGT A;  1LTA D;  1EYA A;  1BUV T;  3RZO B;  1M4V A;  1TWA B;  4FP5 D;  4CBV A;  1DYQ A;  3R2I A;  1AP0 A;  1ZXT A;  4F88 A;  1ENF A;  3NUC A;  3DWQ A;  3H94 A;  1SSO A;  3ND8 A;  4PMW A;  5EBD A;  4KN4 C;  2L11 A;  3TP6 A;  3ND9 A;  1BO0 A;  1R4P B;  3J80 L;  5C0X I;  3E5S A;  2NTT A;  1CM9 A;  4XYO A;  5M3M B;  2ID0 A;  3K59 A;  2IJ0 A;  5FLX L;  5I2Y A;  3DM1 A;  1ZKO A;  4G57 A;  2YU9 B;  5IOC A;  2GA4 B;  1BCP C;  1F2L A;  2K6A A;  1S5C D;  1J9O A;  3HOX B;  3GTK B;  4DFA A;  2OEO A;  5EPJ A;  3K5N A;  2QKI C;  3D31 A;  4R8N A;  4A3G B;  4IUV A;  1HXY D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...