1XX8A

Nmr structure of the w24a mutant of the hyperthermophile sac7d protein
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
66
structure length
66
Chain Sequence
MVKVKFKYKGEEKEVDTSKIKKVARVGKMVSFTYDDNGKTGRGAVSEKDAPKELLDMLARAEREKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Role of a surface tryptophan in defining the structure, stability, and DNA binding of the hyperthermophile protein sac7d
pubmed doi rcsb
source organism Sulfolobus acidocaldarius
molecule tags Dna binding protein
molecule keywords Sac7d
total genus 4
structure length 66
sequence length 66
ec nomenclature
pdb deposition date 2004-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02294 7kD_DNA_binding 7kD DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1xx8A00
1NR2A 3I90A 1G2TA 2HDLA 1LV9A 1O7ZA 4ZLTF 1X32A 4RAUC 1IKLA 2X6LA 4NW2A 2VXWA 3R93A 4CJ0B 1HFNA 4CJ1B 1QG7A 2EOTA 1AP0A 2HCCA 4X3SA 4XDXA 2EPBA 2Q8TA 1KNAA 1JE4A 2K1BA 4IUUA 2KECA 1IKMA 2KEDA 1WTXA 1WTPA 1RTOA 2FHTA 3SVMA 1NCVA 1E0BA 1NR4A 1RODA 1EQTA 2L11A 3P7JA 1HUNA 2KUMA 1A15A 2JYOA 2FFKB 1WTRA 5EPKA 1MI2A 1U4RA 1QNKA 2FMMA 2HUGA 1O7YA 4ZK9B 5EPJA 3H91A 1XYIA 1GUWA 5AFWA 2MGSA 5T1GA 1ML0D 2D9UA 2RSNA 1BF4A 3GV3A 1HFGA 2K03A 2MJ8A 2B2YC 2K01A 1BO0A 2L4NA 1B2TA 1EOTA 4ZKCB 1DZ1A 5E4WC 1Q3LA 3LWEA 2B2UA 3Q6SA 1O80A 3DEOA 2K28A 4OIJA 2HCIA 2HDMA 3UI2A 2FJ2A 1HA6A 5EPLA 4QUCA 4X3KA 3KBXA 1SDFA 2J7ZA 1EIGA 5CBEE 2B2TC 1X3PA 4HAEA 4HEDA 4UAIA 1IL8A 2MPMA 2RSOA 2XIWA 4MN3A 1TVXA 2DY7A 4O42A 2M2LA 4IUTA 3FDTA 1G2SA 4HSVA 1PDQA 1F2LA 5D65A 5EQ0A 4RWSC 4U68A 1CA5A 1VMCA 1PFBA 3DEPA 3G7LA 1S4ZA 3IFDA 5E4XA 1RJTA 4IUVA 5D14A 1B50A 2B2WC 4MHEA 3IL8A 1BBXC 1HHVA 4RA8A 1ESRA 1F9RA 1MSHA 1ICWA 1XX8A 2B2VA 2KEEA 4QUFA 4OIKA 1MSGA 1WD1A 1U4MA 1BNZA 5DNFA 1G6ZA 1RHPA 2JP1A 2BDNA 3MWYW 1AZPA 2MP1A 2H1EA 4IUQA 2FINB 1JICA 1DOLA 1F9SA 1M8AA 1VMPA 4R9WA 4ZAIA 1F9PA 2EE1A 5JJZA 3QO2A 3N52A 2B2UC 3ONAB 2B2YA 4X3UA 1AZQA 2CVRA 1QE6A 3DM1A 1MGSA 1NAPA 1ILPA 1HRJA 1WD0A 1G91A 3HP3A 3F2UA 1DONA 1WTOA 1KNEA 2IL8A 4IUPA 2N55A 1ILQA 1B53A 1U4LA 2KOLA 2L12A 1PFMA 4ZKBB 4X3TA 1WVLA 1PLFA 1X3QA 2B2VC 2R3ZA 1SSOA 2RA4A 3I91A 4HCSA 4XT3B 1CA6A 2B2WA 1WTWA 1DOMA 5EKIA 3I3CA 2RVLA 5EJWA 1WTVA 2Q8RE 3FPUB 4R8IA 1WTQA 1B3AA 3TZDA 5CORA 1PFNA 2NZ1D 2NWGA 4XT1B 1J9OA 1RTNA 2L9HA 2K05A 3D6WA 2K04A 4IURA 3TN2A 4DN4M 2KVMA 2N88A 3I8ZA 2DY8A 4CJ2C 1EL0A 2NYZD 1SAPA 1F9QA 1EIHA 1CM9A 3GV6A 5T1IA 5CBAE 1U4PA 1DOKA 1B4OA 2B2TA 1HUMA 5COYA 2X69A 3KUPA 1C8CA 1ZXTA 2SDFA 1J8IA 5CMDA 2X6GA 2L1BA 3MTSA 4LMQD
chains in the Genus database with same CATH superfamily
4A3CH 3FHWA 1NR2A 3E5SA 4Q5VA 1TWHH 5ELFA 4IALA 3L0OA 2VXWA 1QG7A 3TP6A 5JEAG 1E24A 1SMXA 2HCCA 5K36G 1VQJA 4TSSA 1EFID 1FYCA 1EZ6A 2SEBD 2UXDL 1RTOA 1X3EA 4C3HG 3I70A 5GAEC 2NZOA 4GNXA 3K5OA 2HUGA 1VQCA 2NVTB 3H91A 5E3FA 3UE0A 5GROA 4B3RL 1BCPF 4QIWE 4DXFA 3GTKH 4K5XA 5ELBA 1Q82C 2K01A 3Q6SA 5DLQE 3PO3H 4PZ6A 4OIJA 5F2DA 3TDQA 1EYDA 4CBVA 1SDFA 2J7ZA 2R7FA 1LTAD 1EY7A 5CBEE 1X3PA 4DR6Q 2UUAL 5M5XH 2EYMA 3OIQA 4BY1G 1E2ZA 3G48A 4IUTA 4NXNQ 3BS1A 1R9TB 3RLNA 4CDDC 3LWUA 4A3FB 2EXZA 1F2MA 3SK6A 1RJTA 1FJGL 2K7VA 3U9OA 4OL7A 2JA8G 4OHJA 3HOZB 5CV4A 5IGGA 1SYBA 1MSGA 3S2HB 1XNRQ 2YU9B 1Z7TA 4BBRG 1TXYA 3J81i 3WOEA 1YIJA 2VB3X 3EQLC 1GUNA 2EE1A 1V43A 3KDFB 4K5WA 4QY7A 2JE6I 1HR0L 1H9KA 3BZCA 3VYSA 2PQEA 3GTGB 1LTLA 1MGSA 4YWKA 4DR5L 1WD0A 2JA6G 4AIMA 2L55A 3W1BA 1KNEA 1PTOH 1H9SA 3E0EA 4BS9A 2R92G 3ITPA 1Y14B 4DA2A 1Q1BA 2KA7A 1H9JA 2B2WA 1TWGB 1JWSD 4BBSB 3G4SA 2GVBA 4A3IH 2MFIA 2YTVA 3L9AX 1J9OA 2L9HA 2KCCA 4MIUA 2PZUA 4XIGS 4G7ZC 1STGA 3GV6A 4GN3B 4HMIA 3BZKA 1F2YA 1XNRL 2EYFA 3KUPA 1WI5A 1EQVA 3TREA 4F8MA 4RHSA 1SNMA 1XMOL 5IYCG 4JPBW 3VYUA 4DK3C 1QUQB 1TY2A 4EQOA 1R9TH 3MFYA 4RAUC 1EY8A 3CCVA 1NSNS 2WINB 3HKZG 3QIAA 2FHTA 1E0BA 1UUPA 1PMRA 3PUWA 2PZTA 3CD6A 5EPJA 5C0XJ 3ZYYX 1A62A 4FNFA 1IBLL 5I2YA 4LW1A 4NMZA 4PZ7A 1LTGD 1B2TA 1O7LA 3D4RA 2Y0SG 1DZ1A 2D62A 5E4WC 4P72A 5A2QL 3HOZG 4J15A 1O80A 2FMCA 1KHIA 1J5EL 2HCIA 3CAMA 1EU4A 1EIYB 1CZGA 5C44G 2MO1A 5JPMC 1UAPA 2F0IA 1IBKL 1SYFA 5IY0A 4HJ9A 1RD9D 2OCEA 5C4XB 1I94Q 1J5EQ 4DNIA 3S16B 2M2LA 2F3IA 3R2TA 4IFDJ 1SNQA 1A8VA 2K75A 4HJAA 4C3IG 1Q12A 3ERQA 4KJNA 2ZXRA 3HOXH 1SFOB 2JA7B 4DV7L 4Y7NB 3DEPA 1S4ZA 5LMUL 1HA5A 1EQRA 1HHVA 3H6MA 2B2VA 4Z9CB 4OIKA 4BY7B 1EEFD 1JOOA 3K5MA 3F2CA 3HOWH 3ZJYC 2WB1B 4JI5Q 2CHBD 3K81C 3MAQA 3D4DA 5J3BA 2E8GA 4DUYQ 2NTTA 1VS0A 2H4OA 1SROA 4P75A 4TVAB 1Y1WG 1U4LA 4KJOA 1GO3E 2PI2A 3SE0A 2B2VC 1EFWA 3I91A 4H02A 4A3MB 3Q8DA 3M4OB 4OO1G 3IRBA 4CDEC 3HOWG 1HZCA 1PXUA 2WB1G 2DNCA 4XT1B 3J80L 4DKAC 3J81E 3S1RB 4A3BH 3BG3A 3MC0B 4DPGA 2F0GA 1MHWC 3TS0A 2F3VA 1VQAA 5C3XA 1SJED 1IBMQ 4M1UB 3I4MB 1CK1A 2X6GA 1CKMA 2ASBA 3BZDB 3ICEA 4KKTA 4ZLTF 1X32A 4LFCQ 2LXJA 3X3NA 1E7ZA 4GN4B 4XYQA 5FJ8H 1HNWQ 2OT2A 4NP5A 2KEDA 3P1HA 1WTPA 4HR7B 4EVOA 1Y1VG 1UNSA 5M3FG 2BDOA 1N33Q 4DR3L 1DYQA 5EPKA 2QDBA 1U4RA 2SNMA 4LF5Q 3KLSA 2IX0A 3OPOA 1N34Q 3AMUA 1YVCA 3ERSX 3GV3A 3K8AA 2R7ZB 4YY3L 1PA6A 1H9SB 3GTOB 1QVFA 4ZKCB 3VDYA 4JI6L 3R3OA 1UE5A 2G9HD 4O2DA 2XRQD 4LF6L 1TS4A 4OEMB 3AQQA 1L0WA 4GZYC 1WJJA 1ZEQX 2QF7A 3BVMA 4AYBG 2RDHA 3QOLA 2VQFL 2RSOA 1IYVA 2B29A 4DNRB 3J80i 4ZCKA 3STBD 3WOFA 3KJOA 1NNXA 1PDQA 3T53B 5DM63 4OWXB 4LNQA 4KKUA 1STAA 3NBHA 3I4MH 1ZYRC 5JAVA 1TWAB 3A8IE 4EQPA 1HNZL 3S1QH 2H1EA 3I7FA 2QCPX 2Z4IA 1F9PA 1VQ9A 2EVBA 3SDZA 2BCOA 2EYOA 4QMGA 1HTLD 4A3CG 1PRTD 4I7AA 1ILPA 3H0GH 1N32L 2RQXA 4QIWB 2C35B 2UXCQ 1Q8KA 4X3TA 1SNPA 2LFNA 2E75C 1CA6A 5C6AA 1DOMA 3GTPB 2RF4A 3SGIA 3M4QA 1TU2B 2F03A 2N8NA 5E1FA 3IKJA 2K05A 2R6GA 2K04A 3KF6B 3PO2G 2JA8B 2NYZD 4DUZL 3BDCA 1IYJB 2F0OA 4UP8A 1BUVT 2VQEQ 4A75A 1Z47A 4GLXA 3CF5A 1VQNA 5ELDA 2MO0A 1XPRA 4IPGA 4Q0FA 3KK7A 2PZWA 3CQZB 1PH4A 4B3TQ 4CKBA 1B9NA 1SRUA 1V8QA 1FVIA 3U9SA 4JC0A 1JE4A 4KD4A 1T9HA 2OTLA 1IKMA 1PH7A 1KAAA 3I4MG 4L6TB 2KUMA 2JYOA 3C46A 2NVXH 2VL6A 5DM73 1VQHA 1U0LA 4A3BG 4C3HH 3VR6A 2D9UA 3ER0A 3H3VI 2LMCB 3PF5A 4FF3A 4EQNA 2K03A 5IYBH 1IZ6A 2K5NA 2BE5C 4JI0Q 5ELEA 5M3FB 2A5HA 4C1NI 2HD3A 4DV5Q 4B3SL 2CWAA 1EWCA 1HA6A 3OW2A 1XMOQ 4DV2L 2K50A 4ZUIA 1LT3D 1VQBA 2HHHQ 3O13A 5IWAQ 2Z6KC 2UU9L 2XIWA 1BBWA 2RKSA 1JC7A 4LF9Q 1PYWD 1YNND 4DXGA 1LLRD 4DV4Q 4A3EB 4BXXH 1NBWA 5D14A 1EUJA 1SE2A 4F88A 4DU9A 3A74A 1WD1A 4OONA 4TQUS 1GHKA 1BNZA 4AYBB 5I9PA 1RHPA 2BDNA 2QDLA 1M8AA 2K5WA 4R9WA 2UUCL 1S5ED 4FXGC 4JK1C 1QNUA 3EBEA 5IYBG 1VQIA 5M5YH 3VR4A 4C3JB 1MKHA 1LT5D 1TQOA 1GUOA 5FLXc 4RHRA 2R3ZA 4ODGA 4H7BA 1JE5A 1HZ9A 2A6ED 4UP9A 5D3DA 3I56A 3PIP3 3STBC 5EKIA 3K5LA 5IYDG 2O4XA 4BXXG 5C3WA 1CT1D 1FGUA 3QOJA 1KRTA 4EX5A 2EYPA 1PH9A 1DD2A 1CQFA 2O5JC 1EIHA 1CM9A 1C0AA 4RCOA 2JSOA 5DEHA 2B39A 1O78A 3J7AF 2IT1A 4R4QA 1A2TA 1ZXTA 4DK6C 1J8IA 5CMDA 4IJHA 1NTGA 3E6ZX 2CH4W 3I90A 3K0YA 1GD7A 2YU9H 1G2TA 1LV9A 4KHVA 2F0QA 3HFZB 3NHHA 3NPPA 2AQ1B 3R93A 5C3EH 1HFNA 1VQLA 5ELOA 4X66L 2CCZA 4XDXA 2VUMB 3CQZH 1PRTC 3S24A 3NTKA 4B3TL 4APVA 2OQKA 1KIXA 3NENA 5IT9E 2L11A 2RDGA 5BN3A 3GTMB 1EY5A 1JJCB 4QB4A 1YNNC 5M5WB 3TRZA 1DJRD 3E0JA 3Q22A 1BVSA 4QCLA 2F0PA 1HFGA 2ATWA 3V05A 3K59A 1A63A 3HG9A 4F7XA 2ZM6L 2XGTA 2XVSA 1W2BA 1S3OA 2R92B 4QUCA 1TS5A 4JCVE 5FO9B 1ENFA 5FKAC 3RLOA 3PUVA 1QWYA 1QOHA 4PMWA 2QKIC 1BDOA 3CCUA 1G8ZD 4O0AA 3IFTA 4YCUA 4GKJQ 4GLVB 2K4KA 1XJVA 1JMCA 4HJ7A 3A56A 2KEEA 5KGUA 5IWAL 5IE8A 4JYAQ 3T1YL 1PVOA 3UE1A 2CW0C 4ZAIA 5LMUQ 4JW0A 1I4XA 3SR1A 4RGOS 5M3MG 1V1OA 4A3IG 2LSSA 2DGYA 4POFA 4R4CA 2J4XA 1V1PA 4J8QA 5DAUA 2F3WA 2OWOA 1XWEA 5M5WH 2FXQA 4KHPQ 3K7AH 4FF4A 3H0GB 1Q90A 1D7QA 3A5UA 3GQBA 1MJEA 1CHPD 4KTAA 1XMQQ 1QZGA 1Q8IA 1WYDA 3WDNA 4L5TA 3GTJB 3MA2B 1ENAA 2HT1A 1GVPA 3BVGA 5COYA 4K6LA 2A68C 2AUKA 2ZM6Q 2Q2HA 4DF7A 1P16A 2DUDA 1K83H 1VDZA 4BY1H 4IFDH 5K36H 3CCQA 3PV0A 2EOTA 3T1HL 1LUZA 3EROA 2EYHA 4P74A 1UE6A 4DAYB 1I50H 2VB2X 2F0FA 2WACA 4UHVA 2E2JB 3CCJA 1MI2A 5C4JH 1G6PA 5JVG3 2E2HH 3PO2B 1Z9FA 3PIOA 4ALPA 5FOBB 1UEBA 4H44C 1Z6HA 5A35A 3KBGA 3S1MH 4DAPA 1VQFA 4YCVA 1K8GA 2PQAB 1MBYA 1I3QH 1EEID 3GTOH 1Q1EA 2F0DA 1R4QB 4IZ8A 3KYHC 1YJ9A 1AFPA 4NXNL 1TIID 2BA1A 4A3IB 1L0YB 4OO1H 2PNRC 1MIUA 3TQYA 3TS2A 3KF6A 3VYRA 2R93H 4DV0Q 1J6QA 5BN4A 1KTKA 3FEWX 4QL5A 1CKNB 4O42A 3RMHA 4ZUJA 5JEAJ 3MXNA 4FF2A 4GKKL 5D65A 4JI5L 3B6YA 2NVQB 1CA5A 4NXML 4RG1A 2YTXA 3PO3B 2UU9Q 3J81L 1PTOC 2I5HA 4BY1B 4N9TA 1U4MA 2NB0A 2EYLA 3CXCA 4ZYSA 5A2QE 4A76A 3HOZH 4X6AH 2E2IH 4AYBE 1KC8C 4DNTB 1KLGD 1QE6A 3M3YH 1BCPD 4DR1L 1WOCA 2VW9A 4JVZA 3F2UA 3UDIA 3R8BA 1S72A 5JJIA 2PYKA 1N9WA 3H94A 4XYOA 2VQEL 5M5YB 1Y1VH 1WTVA 1BBUA 2KCTA 1KXLA 4FXKC 4A4IA 2BH2A 3EA6A 1LT6D 4XQNA 1STNA 3ULJA 1EL0A 4LUOA 1JJ2A 5LMNL 1ET6A 1SNOA 4OX9L 1DOKA 3E9HA 4DV5L 1YZ6A 2B2TA 5C3EB 1EYGA 3MTSA 2NVYH 4KN4C 3HOVH 3S15B 1IKLA 4CJ1B 4N8X1 4JOIC 2F0NA 1B70B 2E2DC 2KECA 1V1QA 2Z6BA 1NR4A 2IX1A 2UUBQ 3H3VH 1Y69U 4FXDA 3EN2A 1SEBD 2AMCB 2WKDA 2D5DA 2KHIA 5E7NA 3J80E 1A3VA 4LFAQ 1PH8A 5FO7B 3NBHB 5JJKA 3CC4A 4MTNA 3JAMc 1DGSA 1FGBD 2WFWA 3Q23A 4IOAA 2B2UA 2MHVA 3FP9A 4FO2A 4GS3A 3OMCA 4LK1C 4BA1I 2NVYB 1EIGA 1RL2A 2Y0SE 1KDAA 3PIPA 1I5FA 1IL8A 1OXSC 4WJ4A 4MN3A 1TVXA 3L2PA 3U4VA 3QR8A 5M5XB 3G6JB 1VQOA 3NELA 4U68A 1X3GA 3D3RA 4C2MB 1UWVA 4IUVA 3A7LA 1NE3A 4K5VA 4XQQA 3M85A 5BR8Q 1I94L 4L5SA 1F9RA 4IPCA 3S15H 3HOVB 2KJXA 3AYHB 2PI2E 3HOUH 4DV1Q 2JP1A 1AZPA 3UDGA 4KI0A 3M7NA 1LTTD 1EWHA 3GTPH 1AEXA 4DGZA 2RCFA 3M7GA 4RKBA 1Q86C 1D5MC 5M3FH 4Y7NH 4FYDA 3L7ZC 1IYUA 2BOSA 2IL8A 1SYCA 1AE3A 2ZT9C 1JCKB 3H15A 1PLFA 3PF4A 1CI3M 4C56C 3I3CA 1K73C 1VQ8A 3CMAA 3D8GA 1ESFA 4B08A 1RTNA 3C1FA 4BBSH 4YWLA 3S2DH 2DY8A 4IO9A 1S40A 2K32A 1IXRA 2M9VA 4RMFA 2LY7A 3FRPB 3OMGA 1C8CA 4R4IA 1XPUA 1K9MC 1X65A 4R1JA 4LMQD 4LF4Q 4GNXB 2VZAA 3S1RH 1D6EC 2X6LA 1N34L 2CFMA 1VQPA 1WTXA 4A3EG 4P73A 1IBLQ 3P7JA 2ZTCA 1Q7YC 5GAGC 4C3IB 1SNCA 1QVCA 4QGUA 1QNKA 1YHBA 2Q8IB 1O7YA 2H5XA 5J39A 1CUKA 1VF7A 4HIMA 1X3FA 2A1AA 2I5MX 5AFWA 2MGSA 3RUZA 4JI2L 4A3JB 2XTIA 1E2WA 1YNXA 1PH6A 4L8JA 4QQBX 4R8NA 1STBA 1KQSA 4IUNA 5IP9G 2UXBL 1N8RC 1HTPA 2IW3A 1BCPC 2AQ2B 2HDMA 1PTOF 2IHEA 1WCMG 3VR2A 1GKHA 1TR5A 2EY6A 2ALYB 3QG1A 2PQAA 1DM0B 4NXMQ 1U9RA 5K5PA 4A3KH 3FDTA 2R61A 1XMQL 3J7YW 4YHHQ 3K7UC 3RZDB 3A8JE 3G7LA 4A3MH 3I55A 1IW7D 4HCEA 4CHTB 3MXNB 4HN7A 1MSHA 1U5KA 3KLSX 1ICWA 1VQGA 4YIJA 2JA5G 3NSWA 5EKLA 2NVQH 1VQKA 4A3BB 2FINB 1YJWA 1STYA 3VR3A 3G6EA 3Q24A 4F87A 3GTQB 4HSPA 2CVRA 1DXMA 2PPBC 3I4NH 1FNUA 1AH9A 1KD1C 2QEXA 3W5OA 1B53A 3OSOA 5LL6X 4JBKA 1VQDA 4H0LC 5G3LF 1VQ4A 2RVLA 4YWMA 2VUMG 1L0XB 1UE7A 4GKKQ 1EYCA 2E5LL 1LTBD 3D6WA 3F2BA 4XTCS 1E1TA 2KVMA 1JB7A 3RD4A 1Y1VB 1PRTB 3CW2C 3RZOH 1I6HB 2GN5A 3UDFA 3S1QB 2C9OA 1C48A 3V96A 4K8IA 3PMFA 3URYA 3OIPA 1F2ZA 1HR0Q 5JJLA 3U58A 1SJHD 3M9BA 1D1KA 3TP8A 1HZAA 2XN9C 3G71A 3A55A 2F0EA 5GAHC 1BCPB 1JWMD 4WJWA 2XRSD 3HOXG 1WTRA 4A3KG 2Z4HA 4ZK9B 1D8LA 1XYIA 3GP7A 2F0SA 2KBNA 3OHXC 1HPCA 5IGDA 1PYSB 4OELB 4POGA 2CKZB 1B1ZA 2UUAQ 3S14B 4B9XA 2R7ZH 1RIPA 1SXTA 2K28A 5JPNC 1BOSA 1PRTF 1BKBA 4ABNA 2V1CC 2YTYA 3PUYA 5IODA 5IYCH 3KF8B 4LFBL 1HZBA 3PQIA 4LUVA 1EY4A 4JI4L 2B8GA 2EXDA 5CV6A 1VMCA 1PFBA 2LKVA 5E4XA 2NVTH 1BBXC 4RA8A 4LF5L 3DUZA 4WORA 2NN6H 4JBMA 3HZXA 1JORA 2MQHA 4C2MH 2JQOA 2MP1A 3K0XA 2E2HB 1DOLA 1CKOA 5CC4A 5JEAH 4X64Q 1YITA 1JT8A 5KYIA 3PUZA 2XWBB 3EJIA 1I50B 3SK5A 2GA4B 3OYYA 5D3IB 4RGMA 3M3YB 1A3TA 1B8AA 4JYAL 3S2HH 2L12A 1HQRD 1OXUA 2TMPA 3TP7A 1JB3A 1GM5A 2DN8A 2JEAI 2Q8RE 2M00A 4K6DA 5CORA 2NZ1D 3MXPA 2PMZB 1I6HH 4IURA 5KEEA 1I3QB 4CJ2C 3P75A 4FF1A 4WJ3M 5CBAE 2I5LX 3FKIH 4A3DG 4N9PA 1B4OA 5JOBA 4B3SQ 1CFMA 3OTOL 2R93B 1JOQA 2L1BA 5CV7A 1LM0A 3RZOB 3K80C 1T5EA 5EBCA 1K0RA 2CW0D 3L3OC 4GOPC 1SFOH 2UUBL 4NW2A 3CPFA 2N3SA 2RCNA 2F0WA 4AH6A 3D4WA 2A69D 3BVZA 4JI3L 2IHFA 4LF7L 1NCVA 4LF9L 1HUNA 4A3DB 4CDFC 1S5CD 2SOBA 1A15A 1OO9B 2Y0SB 1I4GA 3BYTB 2G9DA 1GUWA 1HXYD 3GD7A 2F0LA 2PCFB 1BF4A 2Q2IA 2E2IB 3CU7A 5KIXA 3JAML 2EYJA 2QILA 3DXJC 3PO3G 4KHZA 2WAQB 4ID6A 3OWFA 1Q3LA 4CKEA 1NJIC 5M3MH 4B3MQ 2B8FA 4HIKA 5KYLA 2L5TA 5CV8A 4DV6L 3CRLC 4HJ5A 4X62L 4DV4L 3RZDH 4KHPL 3CPWA 2E76C 1K0SA 1HNZQ 3KDFA 3HOVG 2R92H 5C5LA 2RHQB 4DV3Q 4QF4A 2XNAC 4JOIA 3PIO3 2EJMA 4C3JG 3KF8A 1S5DD 1W6KA 2B2WC 1SLJA 4K8JA 4KLKA 1VQ7A 2VNUD 1D1IA 2IPKD 2UXCL 2DNEA 5AJ3L 4Y52H 2NTSA 5FO8B 5JJZA 3QO2A 3N52A 4S3SA 3J80c 4GKJL 2E5LQ 1L1OC 4O1NA 1Y8PB 1HRJA 1G91A 2ZXPA 1A3UA 3A5ZB 4B3ML 4ZKBB 1K8AC 2F0TA 2AUJD 5C44H 1FNVA 4GLAC 1CQVA 1QVGA 4KY6A 1Y8NB 4KK7A 1YBYA 2NWGA 2WIIB 5KNBA 3NEMA 5ISRA 2CWPA 1HNXQ 3JAMi 2Z0SA 4DN4M 4C3HB 4BBRB 1F9QA 2NN6G 1ET9A 1C7YA 1Y1WH 3VYTA 2Z6KA 1TS3A 1A0IA 1HUMA 2ZXOA 1E3PA 4PNYA 3VA7A 2BA0A 1QILA 3M4OH 2OTJA 2Q2TA 1PV4A 1T5XD 1ONLA 2A19A 3AU7A 1B3QA 3QJYA 1BR9A 1AP0A 3C3LA 2RBMA 1G51A 4LFBQ 1XPOA 1EU3A 3J7AV 2ZTDA 5LHY1 1DCZA 3E9IA 1K28A 3K5NA 4G7OC 3HOUB 2P5ZX 4ME3A 1PZJD 4I7ZC 1KLUD 3BU2A 1CSQA 1HR0W 2B3GA 1KL9A 2EQSA 3F1ZA 4LF6Q 1TWFB 4LF8L 3T13A 1UEAB 3PO2H 4L63B 1BQQT 4ZQ3A 3SHLA 3LWEA 4B3RQ 3J81j 3GTQH 2ENBA 1R4PB 2K5DA 3HKSA 5BR8L 2PMZE 3U50C 1G291 3AEVA 3LNNA 1E22A 5EKKA 4DK0A 4HEDA 4CDCC 3NBIA 2DY7A 5AJ3Q 1Y1WB 2B63H 1M1KC 3GO5A 1F2LA 1KDBA 3EFXD 3NQTA 2PW5A 1HNXL 5FJ8G 4G7HC 5IYDH 3IFDA 4KD3A 1B7YB 1ESRA 2WAQG 2EY1A 1S5BD 4UPAA 4HTHA 3EIVA 3QWNA 4JI4Q 4CGYB 3GTGH 1SE8A 2WV6D 3ONAB 1GJXA 5HGTA 4HIDA 4DR2L 4K14A 5IOCA 4PQXA 1H9MA 2NN6I 1XNQL 3S1NH 3MXGA 3H09A 1SE4A 2KOLA 2KENA 2I46A 3WWVA 2O2LD 1WVLA 4KKSA 2HHHL 1NMGA 5I6WA 1RDPD 4XT3B 1MJCA 4WFN3 3OTOQ 2YYZA 2WP8J 2D0OA 4A3GB 4AQYL 3TSSA 3UDXA 2DJGC 3X3MA 2PO4A 4FP5D 3NK9A 3RN2A 5LL6S 1HJPA 4PZ8A 4RGTA 5C0XI 2F0UA 1O7ZA 2V4DA 3RR5A 4BBSG 1VF5C 4A3KB 1RCVD 5C4ZA 2O5IC 2ZJRA 3HRZC 1GXDC 4IPHA 2ID0A 3NP8A 3RN5A 2F0VA 3DWAA 1HCZA 2FMMA 2B63G 3K6OA 1TY0A 2K52A 1HNWL 1OTCA 4OWTB 5M3MB 4JI3Q 4LF7Q 3T16A 3CCSA 2B2YC 3A7AB 3PGZA 4OX9Q 1ASYA 3HOUG 4DK1A 1EOTA 1SE3A 4LFAL 4DR5Q 3LX0A 1PHJA 1TS2A 1IBML 1TWFH 2JA6B 2E74C 2EJGC 1FR3A 2VS1A 4X3KA 3CHBD 4M8AA 5KRUA 3H0GG 5IIFA 2JN4A 3PUXA 5IT9L 1WCMH 3TP5A 4ILWA 1X55A 4EGVA 1JWUD 2NBFA 2IWHA 5EQ0A 1TWCB 1CZWA 1IBKQ 4L5QA 1S5FD 1EQQA 3HEJA 5CR3A 2UUCQ 3U4ZA 2A6HD 3V2TA 2AKWB 3W2DA 2VUMH 5ELNA 2IX3A 3SEBA 2A68D 1SN8A 2B2UC 2L15A 5GQOA 2F0JA 2HIVA 1LYLA 3DM1A 2Q2UA 3E3XA 1TWGH 5FLMH 5I6YA 4X64L 5HGQA 1PFMA 4DR3Q 1XTDA 4NB3A 1PFSA 4ULLA 2VY3A 4CKCA 1SSOA 4HCSA 4DV2Q 2JXMB 1B3AA 2JK8A 3DM3A 1D2BA 1JR0D 4KV6A 1PFNA 3AFQA 3CCRA 2JJQA 3I8ZA 5IP7G 3NTIA 1ZYRD 3CP0A 1ZKOA 5T1IA 2R7DA 4A93H 5IGEA 5CYUA 2X69A 2SDFA 4A93G 4V190 3JC66 2GVAA 2HDLA 3HGBA 1JQYD 1GHJA 3DLLA 1PZKD 1V9PA 2D2CC 3A54A 2CQOA 5FLXE 4JV5L 5IT9c 3GTLH 2LXKA 2K1BA 1X54A 4IUUA 5I9OA 4DV7Q 1LTRD 3NQIA 3KLWA 4PV1C 3SVMA 1XXGA 3J7ZC 1W3SA 3BJUA 3MEHA 4R4TA 4LWCA 1BXTA 3CC7A 2UXDQ 4LJZC 5T1GA 2RSNA 4BY7H 5C4XH 5C0XH 1YNJC 2ZJQA 4DUZQ 4H13C 1VQ5A 5C5MA 4EQ5A 3A0JA 4K2KA 2Z9HA 4A3LG 2NVXB 3HOXB 5H1SE 2QEJC 2A8VA 4DV3L 1H9RA 3ULPA 3CCEA 5I4DA 5KNDA 2ICIA 1SYGA 3I4OA 2L0CA 5FLMG 2MPMA 3T1HQ 4V0BA 2QW7A 3TEHB 1VQ6A 3J81c 4JI7Q 5EAYA 2UXBQ 4HSVA 4DFAA 3I72A 2BH8A 1JJGA 1PH3A 5G3LD 2F0KA 2KCMA 4RFBA 2ZJPA 4OWWB 1I4HA 5CGKA 5LMNQ 2EY5A 4YCWA 4YHHL 3MWYW 5IGFA 1VQMA 4A3JH 1KRSA 1F9SA 3SK8A 4R4OA 2AWOA 2K6AA 3GTLB 2N49A 4JBJA 5I2XA 2B2YA 1QCBD 1KAWA 5IGBA 1L1OA 2AWNA 2OXPA 5HURA 5C4HA 3HP3A 1WTOA 1AN8A 3FKIG 4A3DH 5J1ZA 5FLXL 4IPDA 1A6XA 1EY9A 2A69C 3DWPA 3MZ5A 4DV0L 2F52A 4U673 4N8FA 4E6IA 4JI7L 3CKIB 5IP7H 4PMCA 3MEFA 1EY6A 4QJFA 1C9OA 3CCMA 4PG3A 1EZ8A 1TWAH 3T51B 3H3VC 1LTSD 3S17B 1PTOD 2C5CA 1AW7A 5HY6A 2OQ0A 2RHSB 1X9NA 4JV5Q 4G4KA 1U4PA 4L5RC 3HOYB 2XWJB 1ICFB 2IJ0A 2WKCA 4NPSA 2EY2A 3RLFA 4ZRZA 5FK9C 5M9OA 4OGQC 2VQFQ 1N33L 4JI1Q 1YJNA 4DAMA 4K0KQ 4JG2A 5JVH3 1KNAA 4LF4L 3KLRA 1IW7C 2KHSA 3MVVA 1EQTA 1EYAA 2OF1A 4B9WA 2PNHA 2FFKB 2LS01 5C0XG 5C4XG 4GN5A 4A3GG 2G5DA 3NUCA 3K7AB 2R93G 1H95A 3C2PA 5CV5A 1L1OB 4MTKA 2L4NA 1CTMA 1LACA 4IQZA 2F4VL 2CQAA 4HIOA 1STHA 3M4YA 2E2JH 5NUCA 2N78A 5EPLA 5EBDA 1V1PB 3KBXA 4LFCL 2JA6H 2B2TC 1SMYD 3MXUA 2F4VQ 3S1MB 4C3IH 4IFDG 1GOZA 2F4IA 1SNDA 3FKIB 1NUCA 1IHZA 4DR7Q 3Q0AA 4DV1L 3CRKC 1EY0A 1M90C 2WAQE 4AQYQ 5C4JB 2ICEC 3IL8A 4TKOB 4BBRH 4A3JG 1LO5D 3FVQA 3JAME 4JI8L 4IUQA 3TMEA 1M4VA 1SR3A 4HMJA 4X3UA 1AZQA 4K0KL 1PTOB 3FPPA 2OEOA 1PYBA 4JI1L 4C3JH 2JEBI 1NMFA 1P8LA 2NZHA 4FVMA 2N55A 4DV6Q 1W6JA 3J7A5 2JA7G 5ELCA 2I0QA 3K58A 1LTID 2RA4A 1NY4A 1X3QA 3C1EA 3NTHA 4UDUC 1B9MA 1WTWA 1AE2A 2KCNA 4A3EH 3FPUB 1UE1A 3TZDA 3S17H 3NWTA 4KY5A 1WTHA 2K5HA 1OXXK 3GTMH 2JA5B 3TN2A 2TSSA 3GDEA 1SAPA 1ASZA 4KY7A 1VQEA 4A3GH 3D31A 1OXTA 4JI0L 1N36L 2JA7H 1TT2A 3R2IA 2RDFA 3I2ZA 3K57A 4FDBA 3D6CA 1SMYC 3KFUA 4DR2Q 1GUGA 1X56A 2EJFC 4ME5A 3HOWB 4X3SA 2IY5B 5CV9A 2EPBA 2Q8TA 4DAYA 1N36Q 3T4AC 4DR1Q 4OXPA 4X65Q 3LGJA 3KOJA 4LF8Q 1RODA 3PCOB 4G57A 1I4PA 1A2UA 3M4PA 4X65L 1LABA 1QJOA 1I4QA 2HIXA 3AFPA 2Z1CA 3FMCA 1CHQD 4IFDI 3I73A 1SYDA 1Q81C 1RF2D 4XXEA 1BO0A 1K83B 1LT4D 3HOYG 3DEOA 2K5QA 5IGCA 1SBBB 4BWGB 2I07B 3BYYB 2EDGA 4UY8C 4RH6A 2AQ3B 4DR4L 1G2SA 2Z8LA 3OOCA 4LAAA 4KMUC 4RWSC 4UP7A 2CH4A 4MZ9A 3I4NB 1B50A 1ENCA 3OW7A 3BDLA 4MNOA 4QUFA 1XX8A 1XNQQ 1I6VC 1EIFA 3KJPA 4A3FH 3F8TA 3S14H 1D5XC 1STEA 1VMPA 1VCIA 2K33A 1CKNA 4A93B 2F0HA 2A74C 1KDCA 1WFQA 1HQMC 4GOPB 1TKWB 1DONA 1I4RA 3SXHA 1JOKA 4LUZA 4JI8Q 1ILQA 3I4NG 1K3RA 5LMNW 3MHBA 3S16H 1B44D 3HKZB 2AHOB 2XSCA 4A3FG 4GNXC 1E1OA 1MD2D 2HQLA 4R8IA 1PH5A 1OXVA 3CC2A 4J1MA 4IN3A 4DR4Q 1YHAA 2BE5D 3OWEB 1PZID 2WB1E 3GTJH 2MNAA 1YI2A 5J22A 2ES2A 3ULLA 4BY7G 1FD7D 1EOVA 1FJGQ 4C1NK 1K3BC 3DHQA 3TBIB 3CMEA 4UAIA 1K8MA 5TSSA 2F1MA 4IOCA 2B63B 1C4QA 4IJLA 4CJ0B 4DR6L 3HS0C 3IAYA 4P2CB 2F0MA 3T56B 1TWCH 2EIFA 3AB9A 1L2FA 5KNCA 3ND8A 4K2LA 5C44B 3TZUA 4GOPA 3CCLA 2QGQA 2HQEA 4RGNA 1YEZA 1EWIA 3GTKB 1Y8OB 4PMBA 3T1YQ 3SK4A 1KABA 2JA9A 4NDXA 1ML0D 1HH2P 3PSIA 5BN5A 4WRDA 2MJ8A 1WCMB 4I65A 3NXWA 4X62Q 2A73B 2NUCA 3DWQA 3S2DB 5C3EG 4JBWA 2YV5A 3UI2A 1XTCD 5L37A 2A6EC 2FJ2A 3MFGA 3N6RA 2SNSA 1D5ZC 4A3LH 4OO1I 1FNWA 1E2VA 3QB3A 3NE5B 2KQ3A 1GUSA 4HAEA 3NWSA 1IL2A 4A3MG 1TWHB 1II3A 4RCNA 1RKNA 3ND9A 4NKLA 3BDOA 4MHEA 4DUYL 1X6OA 1CSPA 2J0TD 1QZHA 2PW7A 1QUQA 4KN7C 4DAVA 2K5VA 3DMUA 2KHJA 4XQJA 5DNFA 1G6ZA 2R7ZG 3P20A 1JICA 1K8OA 2DJFC 3VR5A 3RNUA 2ZTEA 3HOYH 5IP9H 3F2DA 4HJ8A 3A8KE 1PH1A 3D0FA 1NAPA 1PH2A 4X66Q 4IUPA 3W1GA 3HKZE 2K14A 3W3AA 2EZVA 2JA5H 4P71A 4TRDA 1O7IA 4J6HA 5EJWA 1N32Q 3EVQA 1QB5D 1WTQA 1Q46A 3I4LA 1YNJD 4DR7L 2QA4A 2JA8H 4BA2I 3VA5A 4JI2Q 2D0PA 1F77A 2N88A 3S1NB 2MUYA 1SYEA 1YHQA 5GADC 2A6HC 4JI6Q 1GUTA 4YY3Q 5EGTA 4RKLA 3S9WA 1FL0A
chains in the Genus database with same CATH topology
1NR2A 3E5SA 4Q5VA 5ELFA 4IALA 2VXWA 1QG7A 3TP6A 5JEAG 2HCCA 5K36G 4TSSA 1EFID 1FYCA 1EZ6A 2SEBD 1RTOA 4C3HG 3I70A 3K5OA 2HUGA 2NVTB 3H91A 5E3FA 1BCPF 4DXFA 4K5XA 5ELBA 2K01A 3Q6SA 4OIJA 5F2DA 3TDQA 1EYDA 4CBVA 1SDFA 2J7ZA 1LTAD 1EY7A 5CBEE 1X3PA 2EYMA 3OIQA 1E2ZA 4IUTA 3BS1A 1R9TB 3LWUA 4A3FB 2EXZA 1F2MA 3SK6A 1RJTA 2K7VA 3U9OA 4OL7A 4OHJA 3HOZB 5CV4A 5IGGA 1SYBA 1MSGA 3S2HB 2YU9B 1Z7TA 3WOEA 2VB3X 3EQLC 1GUNA 2EE1A 1V43A 4K5WA 2JE6I 1H9KA 3VYSA 2PQEA 3GTGB 1MGSA 1WD0A 2L55A 1KNEA 1PTOH 1H9SA 4BS9A 3ITPA 4DA2A 1Q1BA 2KA7A 1H9JA 2B2WA 1TWGB 1JWSD 4BBSB 3L9AX 1J9OA 2L9HA 2KCCA 4MIUA 2PZUA 4XIGS 4G7ZC 1STGA 3GV6A 4HMIA 1F2YA 2EYFA 3KUPA 1EQVA 4F8MA 4RHSA 1SNMA 3VYUA 1TY2A 4EQOA 3MFYA 4RAUC 1EY8A 1NSNS 2WINB 3QIAA 2FHTA 1E0BA 1UUPA 1PMRA 3PUWA 2PZTA 5EPJA 5C0XJ 3ZYYX 4FNFA 5I2YA 4NMZA 1B2TA 1LTGD 1O7LA 3D4RA 1DZ1A 2D62A 5E4WC 5A2QL 1O80A 2FMCA 2HCIA 1EU4A 1CZGA 5JPMC 1UAPA 2F0IA 1SYFA 1RD9D 5C4XB 3S16B 2M2LA 3R2TA 4IFDJ 1SNQA 4C3IG 1Q12A 3ERQA 4KJNA 2ZXRA 2JA7B 1SFOB 4Y7NB 3DEPA 1S4ZA 1HA5A 1HHVA 3H6MA 2B2VA 4Z9CB 4OIKA 4BY7B 1EEFD 1JOOA 3K5MA 2WB1B 2CHBD 3MAQA 3D4DA 2NTTA 2H4OA 1U4LA 4KJOA 3SE0A 2B2VC 3I91A 4A3MB 3M4OB 4OO1G 1PXUA 2DNCA 4XT1B 3J80L 3J81E 3S1RB 3BG3A 3MC0B 2F0GA 2F3VA 5C3XA 1SJED 4M1UB 3I4MB 1CK1A 2X6GA 3BZDB 4KKTA 4ZLTF 1X32A 3X3NA 4XYQA 2OT2A 4NP5A 2KEDA 3P1HA 1WTPA 4HR7B 4EVOA 1UNSA 2BDOA 1DYQA 5EPKA 2QDBA 1U4RA 2SNMA 3KLSA 2IX0A 3OPOA 3AMUA 3GV3A 2R7ZB 1H9SB 3GTOB 4ZKCB 3R3OA 2G9HD 2XRQD 1TS4A 4GZYC 1ZEQX 2QF7A 3BVMA 2RDHA 3QOLA 2RSOA 1IYVA 4DNRB 3WOFA 1PDQA 3T53B 5DM63 4KKUA 1STAA 3NBHA 1ZYRC 5JAVA 1TWAB 3A8IE 4EQPA 2H1EA 2QCPX 2Z4IA 1F9PA 2EVBA 3SDZA 2BCOA 2EYOA 4QMGA 1HTLD 1PRTD 1ILPA 2RQXA 4QIWB 4X3TA 1SNPA 2LFNA 2E75C 1CA6A 5C6AA 1DOMA 3GTPB 1TU2B 2F03A 5E1FA 3IKJA 2K05A 2R6GA 2K04A 2JA8B 2NYZD 3BDCA 2F0OA 1BUVT 1Z47A 5ELDA 4Q0FA 3KK7A 2PZWA 3CQZB 4CKBA 1B9NA 1V8QA 3U9SA 1JE4A 4KD4A 1IKMA 1KAAA 4L6TB 2KUMA 2JYOA 3C46A 5DM73 3VR6A 2D9UA 2LMCB 4FF3A 4EQNA 2K03A 2BE5C 5ELEA 5M3FB 2A5HA 4C1NI 1EWCA 1HA6A 4ZUIA 1LT3D 3O13A 2XIWA 2RKSA 1JC7A 4DXGA 1PYWD 1YNND 1LLRD 4A3EB 5D14A 1SE2A 4F88A 4DU9A 1WD1A 4TQUS 1GHKA 1BNZA 4AYBB 5I9PA 1RHPA 2BDNA 1M8AA 2K5WA 4R9WA 1S5ED 4FXGC 4JK1C 1QNUA 3VR4A 4C3JB 1LT5D 1TQOA 1GUOA 4RHRA 2R3ZA 4ODGA 4H7BA 5D3DA 2A6ED 3PIP3 5EKIA 3K5LA 2O4XA 5C3WA 1CT1D 3QOJA 2EYPA 1DD2A 1CQFA 2O5JC 1EIHA 1CM9A 4RCOA 2JSOA 5DEHA 2B39A 3J7AF 1O78A 2IT1A 1J8IA 1A2TA 1ZXTA 5CMDA 3E6ZX 3I90A 3K0YA 1G2TA 1LV9A 4KHVA 2F0QA 3NHHA 3NPPA 2AQ1B 3R93A 1HFNA 2VUMB 4XDXA 1PRTC 3NTKA 5IT9E 2L11A 2RDGA 5BN3A 3GTMB 1EY5A 4QB4A 5M5WB 1YNNC 1DJRD 3E0JA 3Q22A 4QCLA 2F0PA 1HFGA 3V05A 3K59A 3HG9A 4F7XA 2XVSA 2R92B 4QUCA 1TS5A 5FO9B 1ENFA 5FKAC 3PUVA 1QWYA 1QOHA 4PMWA 2QKIC 1BDOA 1G8ZD 3IFTA 3A56A 2KEEA 5KGUA 2CW0C 4ZAIA 1I4XA 3SR1A 4RGOS 1V1OA 2J4XA 1V1PA 4J8QA 5DAUA 2F3WA 1XWEA 4FF4A 3H0GB 1Q90A 3GQBA 1CHPD 4KTAA 1Q8IA 3WDNA 3GTJB 3MA2B 1ENAA 3BVGA 5COYA 4K6LA 2A68C 2AUKA 4DF7A 1VDZA 4IFDH 5K36H 3PV0A 2EOTA 3EROA 2EYHA 2VB2X 2F0FA 2WACA 2E2JB 1MI2A 5JVG3 3PO2B 5FOBB 4H44C 1Z6HA 5A35A 3KBGA 4DAPA 1MBYA 1EEID 1Q1EA 2F0DA 1R4QB 4IZ8A 1AFPA 1TIID 2BA1A 4A3IB 1L0YB 4OO1H 2PNRC 3VYRA 5BN4A 1KTKA 3FEWX 4O42A 3RMHA 4ZUJA 5JEAJ 4FF2A 3MXNA 5D65A 2NVQB 1CA5A 3PO3B 3J81L 1PTOC 4BY1B 4N9TA 1U4MA 2NB0A 2EYLA 4ZYSA 5A2QE 4DNTB 1KLGD 1QE6A 1BCPD 3F2UA 3R8BA 2PYKA 4XYOA 3H94A 5M5YB 1WTVA 4FXKC 3EA6A 1LT6D 4XQNA 1STNA 1EL0A 1ET6A 1SNOA 1DOKA 2B2TA 5C3EB 3MTSA 4KN4C 3S15B 1IKLA 4CJ1B 2F0NA 2E2DC 2KECA 1NR4A 2IX1A 1Y69U 4FXDA 1SEBD 3J80E 2D5DA 2WKDA 1A3VA 5FO7B 1FGBD 3Q23A 2B2UA 2MHVA 4FO2A 3OMCA 4LK1C 4BA1I 2NVYB 1EIGA 1KDAA 1IL8A 1OXSC 4MN3A 1TVXA 5M5XB 3G6JB 4U68A 4C2MB 3D3RA 4IUVA 3A7LA 4K5VA 4XQQA 3M85A 1F9RA 3HOVB 2KJXA 2JP1A 1AZPA 4KI0A 3M7NA 1LTTD 1EWHA 1AEXA 4DGZA 3M7GA 4RKBA 1D5MC 4FYDA 3L7ZC 1IYUA 2BOSA 2IL8A 1SYCA 2ZT9C 1JCKB 1PLFA 1CI3M 4C56C 3I3CA 3D8GA 1ESFA 4B08A 1RTNA 3C1FA 2DY8A 2K32A 2M9VA 2LY7A 3FRPB 3OMGA 1C8CA 4LMQD 1D6EC 2X6LA 1WTXA 3P7JA 4C3IB 1SNCA 1QNKA 2Q8IB 1O7YA 5J39A 1VF7A 5AFWA 2MGSA 3RUZA 4A3JB 1E2WA 4L8JA 4R8NA 1STBA 4IUNA 1HTPA 2IW3A 1BCPC 2AQ2B 2HDMA 1PTOF 3VR2A 1TR5A 2EY6A 3QG1A 1DM0B 1U9RA 5K5PA 3FDTA 2R61A 3J7YW 3RZDB 3A8JE 3G7LA 1IW7D 4HCEA 4CHTB 4HN7A 1MSHA 3KLSX 1ICWA 4YIJA 3NSWA 5EKLA 4A3BB 2FINB 1STYA 3VR3A 3Q24A 4F87A 3GTQB 4HSPA 2CVRA 1DXMA 2PPBC 1FNUA 1B53A 3OSOA 5LL6X 4H0LC 5G3LF 2RVLA 1L0XB 1EYCA 1LTBD 3D6WA 4XTCS 2KVMA 3RD4A 1Y1VB 1PRTB 1I6HB 3S1QB 2C9OA 1C48A 3V96A 4K8IA 3PMFA 3URYA 3OIPA 1F2ZA 1SJHD 1D1KA 3TP8A 2XN9C 3A55A 2F0EA 1BCPB 1JWMD 4WJWA 2XRSD 1WTRA 2Z4HA 4ZK9B 1XYIA 3GP7A 2F0SA 3OHXC 1HPCA 5IGDA 1B1ZA 3S14B 4B9XA 1SXTA 2K28A 5JPNC 1BOSA 1PRTF 4ABNA 3PUYA 5IODA 1EY4A 2B8GA 5CV6A 1VMCA 1PFBA 2LKVA 5E4XA 1BBXC 4RA8A 3DUZA 4WORA 2NN6H 3HZXA 1JORA 2MP1A 2E2HB 1DOLA 5CC4A 5JEAH 5KYIA 3PUZA 2XWBB 3EJIA 1I50B 3SK5A 2GA4B 5D3IB 4RGMA 3M3YB 1A3TA 2L12A 1HQRD 1OXUA 2TMPA 3TP7A 1JB3A 2DN8A 2JEAI 2Q8RE 2M00A 4K6DA 5CORA 2NZ1D 3MXPA 2PMZB 4IURA 5KEEA 1I3QB 4CJ2C 3P75A 4FF1A 5CBAE 4N9PA 1B4OA 5JOBA 1CFMA 2R93B 1JOQA 2L1BA 5CV7A 3RZOB 5EBCA 1T5EA 2CW0D 3L3OC 4NW2A 2F0WA 3D4WA 2A69D 3BVZA 1NCVA 1HUNA 4A3DB 1S5CD 2SOBA 1A15A 1OO9B 2Y0SB 1I4GA 3BYTB 2G9DA 1GUWA 1HXYD 3GD7A 2F0LA 2PCFB 1BF4A 2E2IB 3CU7A 5KIXA 3JAML 2EYJA 2QILA 3DXJC 4KHZA 2WAQB 4ID6A 3OWFA 1Q3LA 4CKEA 2B8FA 5KYLA 2L5TA 5CV8A 3CRLC 2E76C 5C5LA 4QF4A 2XNAC 3PIO3 2EJMA 4C3JG 3KF8A 1S5DD 1W6KA 2B2WC 4K8JA 2VNUD 1D1IA 2IPKD 2DNEA 2NTSA 5FO8B 5JJZA 3QO2A 3N52A 4S3SA 4O1NA 1Y8PB 1HRJA 1G91A 2ZXPA 1A3UA 4ZKBB 2F0TA 2AUJD 1FNVA 1CQVA 4KY6A 1Y8NB 4KK7A 2NWGA 2WIIB 5KNBA 5ISRA 4DN4M 4C3HB 4BBRB 1F9QA 2NN6G 1ET9A 3VYTA 1TS3A 1HUMA 2ZXOA 4PNYA 3VA7A 2BA0A 1QILA 1T5XD 1ONLA 3AU7A 3QJYA 1BR9A 1AP0A 3C3LA 2RBMA 1EU3A 3J7AV 5LHY1 1DCZA 3K5NA 4G7OC 3HOUB 1PZJD 4I7ZC 1KLUD 1TWFB 3T13A 1UEAB 4L63B 1BQQT 4ZQ3A 3SHLA 3LWEA 2ENBA 1R4PB 2K5DA 1G291 3LNNA 5EKKA 4DK0A 4HEDA 3NBIA 2DY7A 1Y1WB 3GO5A 1F2LA 1KDBA 3EFXD 3NQTA 2PW5A 4G7HC 3IFDA 4KD3A 1ESRA 2EY1A 1S5BD 4HTHA 3QWNA 4CGYB 2WV6D 3ONAB 1GJXA 5HGTA 4K14A 5IOCA 4PQXA 1H9MA 2NN6I 3MXGA 3H09A 1SE4A 2KOLA 2I46A 2O2LD 1WVLA 4KKSA 5I6WA 1RDPD 4XT3B 4WFN3 2YYZA 2WP8J 4A3GB 3TSSA 3X3MA 2PO4A 4FP5D 3NK9A 5LL6S 4RGTA 5C0XI 2F0UA 1O7ZA 2V4DA 1VF5C 4A3KB 1RCVD 5C4ZA 2O5IC 3HRZC 1GXDC 2ID0A 3NP8A 2F0VA 3DWAA 1HCZA 2FMMA 3K6OA 1TY0A 5M3MB 3T16A 2B2YC 3A7AB 4DK1A 1EOTA 1SE3A 3LX0A 1TS2A 2JA6B 2E74C 2EJGC 1FR3A 4X3KA 3CHBD 4M8AA 5KRUA 5IIFA 3PUXA 5IT9L 3TP5A 4ILWA 4EGVA 1JWUD 2NBFA 2IWHA 5EQ0A 1TWCB 1CZWA 1S5FD 3HEJA 5CR3A 2A6HD 3V2TA 3W2DA 2IX3A 3SEBA 2A68D 2B2UC 2F0JA 3DM1A 5I6YA 1PFMA 4ULLA 4CKCA 1SSOA 4HCSA 2JXMB 1B3AA 1D2BA 1JR0D 4KV6A 1PFNA 3I8ZA 3NTIA 1ZYRD 1ZKOA 5T1IA 5IGEA 5CYUA 2X69A 2SDFA 4V190 2HDLA 3HGBA 1JQYD 1GHJA 1PZKD 5FLXE 2D2CC 3A54A 2K1BA 4IUUA 5I9OA 1LTRD 3NQIA 4PV1C 3SVMA 1XXGA 3MEHA 1BXTA 4LJZC 5T1GA 2RSNA 5C0XH 1YNJC 4H13C 5C5MA 4K2KA 2NVXB 3HOXB 2QEJC 1H9RA 5I4DA 5KNDA 2ICIA 1SYGA 2L0CA 2MPMA 4V0BA 4HSVA 4DFAA 3I72A 5G3LD 2F0KA 4RFBA 1I4HA 5CGKA 2EY5A 3MWYW 5IGFA 1F9SA 3SK8A 2AWOA 2K6AA 3GTLB 5I2XA 2B2YA 1QCBD 5IGBA 2AWNA 5HURA 2OXPA 5C4HA 3HP3A 1WTOA 1AN8A 5J1ZA 5FLXL 1A6XA 1EY9A 2A69C 3DWPA 3MZ5A 4U673 4E6IA 3CKIB 4PMCA 1EY6A 1EZ8A 3T51B 3H3VC 1LTSD 3S17B 1PTOD 2C5CA 1AW7A 4G4KA 1U4PA 3HOYB 2XWJB 2IJ0A 2WKCA 2EY2A 3RLFA 4ZRZA 5FK9C 5M9OA 4OGQC 5JVH3 1KNAA 3KLRA 1IW7C 2KHSA 3MVVA 1EQTA 1EYAA 2OF1A 4B9WA 2FFKB 2LS01 5C0XG 3NUCA 3K7AB 3C2PA 5CV5A 2L4NA 1CTMA 1LACA 4IQZA 2CQAA 1STHA 3M4YA 5NUCA 5EPLA 5EBDA 1V1PB 3KBXA 2B2TC 1SMYD 3MXUA 3S1MB 4IFDG 1GOZA 2F4IA 1SNDA 3FKIB 1IHZA 1NUCA 3Q0AA 3CRKC 1EY0A 5C4JB 2ICEC 3IL8A 4TKOB 1LO5D 3FVQA 3JAME 4IUQA 3TMEA 1M4VA 4HMJA 4X3UA 1AZQA 1PTOB 3FPPA 2OEOA 2JEBI 4FVMA 2N55A 1W6JA 5ELCA 3K58A 1LTID 2RA4A 1X3QA 3C1EA 3NTHA 4UDUC 1B9MA 1WTWA 2KCNA 3FPUB 3TZDA 3NWTA 4KY5A 1OXXK 2JA5B 3TN2A 2TSSA 1SAPA 4KY7A 3D31A 1OXTA 1TT2A 3R2IA 2RDFA 3K57A 3D6CA 1SMYC 1GUGA 2EJFC 4ME5A 3HOWB 4X3SA 5CV9A 2EPBA 2Q8TA 4DAYA 3T4AC 1RODA 4G57A 1I4PA 1A2UA 1LABA 1QJOA 1I4QA 3FMCA 2Z1CA 1CHQD 4IFDI 3I73A 1SYDA 1RF2D 4XXEA 1BO0A 1K83B 1LT4D 3DEOA 2K5QA 5IGCA 1SBBB 4BWGB 2I07B 3BYYB 2EDGA 4RH6A 2AQ3B 1G2SA 2Z8LA 3OOCA 4LAAA 4KMUC 4RWSC 3I4NB 1B50A 1ENCA 3OW7A 3BDLA 4QUFA 1XX8A 1I6VC 1D5XC 1STEA 1VMPA 1VCIA 2K33A 4A93B 2F0HA 2A74C 1KDCA 1HQMC 1TKWB 1DONA 1I4RA 3SXHA 1JOKA 1ILQA 3MHBA 1B44D 3HKZB 2XSCA 1MD2D 4R8IA 1OXVA 4J1MA 4IN3A 2BE5D 3OWEB 1PZID 5J22A 1FD7D 4C1NK 3DHQA 3TBIB 4UAIA 1K8MA 5TSSA 2F1MA 2B63B 1C4QA 4CJ0B 3HS0C 3IAYA 4P2CB 2F0MA 3T56B 3AB9A 5KNCA 3ND8A 4K2LA 5C44B 3TZUA 2HQEA 4RGNA 3GTKB 1Y8OB 4PMBA 3SK4A 1KABA 4NDXA 1ML0D 5BN5A 4WRDA 2MJ8A 1WCMB 4I65A 3NXWA 2A73B 2NUCA 3DWQA 3S2DB 4JBWA 3UI2A 1XTCD 2A6EC 2FJ2A 3MFGA 3N6RA 2SNSA 1D5ZC 4OO1I 1FNWA 1E2VA 3QB3A 3NE5B 2KQ3A 1GUSA 4HAEA 3NWSA 1TWHB 1II3A 4RCNA 1RKNA 3ND9A 4NKLA 3BDOA 4MHEA 2J0TD 2PW7A 4KN7C 4DAVA 3DMUA 4XQJA 5DNFA 1G6ZA 3P20A 1JICA 1K8OA 3VR5A 3A8KE 1NAPA 4IUPA 3W3AA 2EZVA 4TRDA 4J6HA 5EJWA 3EVQA 1QB5D 1WTQA 3I4LA 1YNJD 4BA2I 3VA5A 1F77A 2N88A 3S1NB 2MUYA 1SYEA 2A6HC 1GUTA 5EGTA 4RKLA 3S9WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NR2 A;  3I90 A;  1G2T A;  2HDL A;  1LV9 A;  1O7Z A;  4ZLT F;  1X32 A;  4RAU C;  1IKL A;  2X6L A;  4NW2 A;  2VXW A;  3R93 A;  4CJ0 B;  1HFN A;  4CJ1 B;  1QG7 A;  2EOT A;  1AP0 A;  2HCC A;  4X3S A;  4XDX A;  2EPB A;  2Q8T A;  1KNA A;  1JE4 A;  2K1B A;  4IUU A;  2KEC A;  1IKM A;  2KED A;  1WTX A;  1WTP A;  1RTO A;  2FHT A;  3SVM A;  1NCV A;  1E0B A;  1NR4 A;  1ROD A;  1EQT A;  2L11 A;  3P7J A;  1HUN A;  2KUM A;  1A15 A;  2JYO A;  2FFK B;  1WTR A;  5EPK A;  1MI2 A;  1U4R A;  1QNK A;  2FMM A;  2HUG A;  1O7Y A;  4ZK9 B;  5EPJ A;  3H91 A;  1XYI A;  1GUW A;  5AFW A;  2MGS A;  5T1G A;  1ML0 D;  2D9U A;  2RSN A;  1BF4 A;  3GV3 A;  1HFG A;  2K03 A;  2MJ8 A;  2B2Y C;  2K01 A;  1BO0 A;  2L4N A;  1B2T A;  1EOT A;  4ZKC B;  1DZ1 A;  5E4W C;  1Q3L A;  3LWE A;  2B2U A;  3Q6S A;  1O80 A;  3DEO A;  2K28 A;  4OIJ A;  2HCI A;  2HDM A;  3UI2 A;  2FJ2 A;  1HA6 A;  5EPL A;  4QUC A;  4X3K A;  3KBX A;  1SDF A;  2J7Z A;  1EIG A;  5CBE E;  2B2T C;  1X3P A;  4HAE A;  4HED A;  4UAI A;  1IL8 A;  2MPM A;  2RSO A;  2XIW A;  4MN3 A;  1TVX A;  2DY7 A;  4O42 A;  2M2L A;  4IUT A;  3FDT A;  1G2S A;  4HSV A;  1PDQ A;  1F2L A;  5D65 A;  5EQ0 A;  4RWS C;  4U68 A;  1CA5 A;  1VMC A;  1PFB A;  3DEP A;  3G7L A;  1S4Z A;  3IFD A;  5E4X A;  1RJT A;  4IUV A;  5D14 A;  1B50 A;  2B2W C;  4MHE A;  3IL8 A;  1BBX C;  1HHV A;  4RA8 A;  1ESR A;  1F9R A;  1MSH A;  1ICW A;  1XX8 A;  2B2V A;  2KEE A;  4QUF A;  4OIK A;  1MSG A;  1WD1 A;  1U4M A;  1BNZ A;  5DNF A;  1G6Z A;  1RHP A;  2JP1 A;  2BDN A;  3MWY W;  1AZP A;  2MP1 A;  2H1E A;  4IUQ A;  2FIN B;  1JIC A;  1DOL A;  1F9S A;  1M8A A;  1VMP A;  4R9W A;  4ZAI A;  1F9P A;  2EE1 A;  5JJZ A;  3QO2 A;  3N52 A;  2B2U C;  3ONA B;  2B2Y A;  4X3U A;  1AZQ A;  2CVR A;  1QE6 A;  3DM1 A;  1MGS A;  1NAP A;  1ILP A;  1HRJ A;  1WD0 A;  1G91 A;  3HP3 A;  3F2U A;  1DON A;  1WTO A;  1KNE A;  2IL8 A;  4IUP A;  2N55 A;  1ILQ A;  1B53 A;  1U4L A;  2KOL A;  2L12 A;  1PFM A;  4ZKB B;  4X3T A;  1WVL A;  1PLF A;  1X3Q A;  2B2V C;  2R3Z A;  1SSO A;  2RA4 A;  3I91 A;  4HCS A;  4XT3 B;  1CA6 A;  2B2W A;  1WTW A;  1DOM A;  5EKI A;  3I3C A;  2RVL A;  5EJW A;  1WTV A;  2Q8R E;  3FPU B;  4R8I A;  1WTQ A;  1B3A A;  3TZD A;  5COR A;  1PFN A;  2NZ1 D;  2NWG A;  4XT1 B;  1J9O A;  1RTN A;  2L9H A;  2K05 A;  3D6W A;  2K04 A;  4IUR A;  3TN2 A;  4DN4 M;  2KVM A;  2N88 A;  3I8Z A;  2DY8 A;  4CJ2 C;  1EL0 A;  2NYZ D;  1SAP A;  1F9Q A;  1EIH A;  1CM9 A;  3GV6 A;  5T1I A;  5CBA E;  1U4P A;  1DOK A;  1B4O A;  2B2T A;  1HUM A;  5COY A;  2X69 A;  3KUP A;  1C8C A;  1ZXT A;  2SDF A;  1J8I A;  5CMD A;  2X6G A;  2L1B A;  3MTS A;  4LMQ D; 
#chains in the Genus database with same CATH topology
 4A3C H;  3FHW A;  1NR2 A;  3E5S A;  4Q5V A;  1TWH H;  5ELF A;  4IAL A;  3L0O A;  2VXW A;  1QG7 A;  3TP6 A;  5JEA G;  1E24 A;  1SMX A;  2HCC A;  5K36 G;  1VQJ A;  4TSS A;  1EFI D;  1FYC A;  1EZ6 A;  2SEB D;  2UXD L;  1RTO A;  1X3E A;  4C3H G;  3I70 A;  5GAE C;  2NZO A;  4GNX A;  3K5O A;  2HUG A;  1VQC A;  2NVT B;  3H91 A;  5E3F A;  3UE0 A;  5GRO A;  4B3R L;  1BCP F;  4QIW E;  4DXF A;  3GTK H;  4K5X A;  5ELB A;  1Q82 C;  2K01 A;  3Q6S A;  5DLQ E;  3PO3 H;  4PZ6 A;  4OIJ A;  5F2D A;  3TDQ A;  1EYD A;  4CBV A;  1SDF A;  2J7Z A;  2R7F A;  1LTA D;  1EY7 A;  5CBE E;  1X3P A;  4DR6 Q;  2UUA L;  5M5X H;  2EYM A;  3OIQ A;  4BY1 G;  1E2Z A;  3G48 A;  4IUT A;  4NXN Q;  3BS1 A;  1R9T B;  3RLN A;  4CDD C;  3LWU A;  4A3F B;  2EXZ A;  1F2M A;  3SK6 A;  1RJT A;  1FJG L;  2K7V A;  3U9O A;  4OL7 A;  2JA8 G;  4OHJ A;  3HOZ B;  5CV4 A;  5IGG A;  1SYB A;  1MSG A;  3S2H B;  1XNR Q;  2YU9 B;  1Z7T A;  4BBR G;  1TXY A;  3J81 i;  3WOE A;  1YIJ A;  2VB3 X;  3EQL C;  1GUN A;  2EE1 A;  1V43 A;  3KDF B;  4K5W A;  4QY7 A;  2JE6 I;  1HR0 L;  1H9K A;  3BZC A;  3VYS A;  2PQE A;  3GTG B;  1LTL A;  1MGS A;  4YWK A;  4DR5 L;  1WD0 A;  2JA6 G;  4AIM A;  2L55 A;  3W1B A;  1KNE A;  1PTO H;  1H9S A;  3E0E A;  4BS9 A;  2R92 G;  3ITP A;  1Y14 B;  4DA2 A;  1Q1B A;  2KA7 A;  1H9J A;  2B2W A;  1TWG B;  1JWS D;  4BBS B;  3G4S A;  2GVB A;  4A3I H;  2MFI A;  2YTV A;  3L9A X;  1J9O A;  2L9H A;  2KCC A;  4MIU A;  2PZU A;  4XIG S;  4G7Z C;  1STG A;  3GV6 A;  4GN3 B;  4HMI A;  3BZK A;  1F2Y A;  1XNR L;  2EYF A;  3KUP A;  1WI5 A;  1EQV A;  3TRE A;  4F8M A;  4RHS A;  1SNM A;  1XMO L;  5IYC G;  4JPB W;  3VYU A;  4DK3 C;  1QUQ B;  1TY2 A;  4EQO A;  1R9T H;  3MFY A;  4RAU C;  1EY8 A;  3CCV A;  1NSN S;  2WIN B;  3HKZ G;  3QIA A;  2FHT A;  1E0B A;  1UUP A;  1PMR A;  3PUW A;  2PZT A;  3CD6 A;  5EPJ A;  5C0X J;  3ZYY X;  1A62 A;  4FNF A;  1IBL L;  5I2Y A;  4LW1 A;  4NMZ A;  4PZ7 A;  1LTG D;  1B2T A;  1O7L A;  3D4R A;  2Y0S G;  1DZ1 A;  2D62 A;  5E4W C;  4P72 A;  5A2Q L;  3HOZ G;  4J15 A;  1O80 A;  2FMC A;  1KHI A;  1J5E L;  2HCI A;  3CAM A;  1EU4 A;  1EIY B;  1CZG A;  5C44 G;  2MO1 A;  5JPM C;  1UAP A;  2F0I A;  1IBK L;  1SYF A;  5IY0 A;  4HJ9 A;  1RD9 D;  2OCE A;  5C4X B;  1I94 Q;  1J5E Q;  4DNI A;  3S16 B;  2M2L A;  2F3I A;  3R2T A;  4IFD J;  1SNQ A;  1A8V A;  2K75 A;  4HJA A;  4C3I G;  1Q12 A;  3ERQ A;  4KJN A;  2ZXR A;  3HOX H;  1SFO B;  2JA7 B;  4DV7 L;  4Y7N B;  3DEP A;  1S4Z A;  5LMU L;  1HA5 A;  1EQR A;  1HHV A;  3H6M A;  2B2V A;  4Z9C B;  4OIK A;  4BY7 B;  1EEF D;  1JOO A;  3K5M A;  3F2C A;  3HOW H;  3ZJY C;  2WB1 B;  4JI5 Q;  2CHB D;  3K81 C;  3MAQ A;  3D4D A;  5J3B A;  2E8G A;  4DUY Q;  2NTT A;  1VS0 A;  2H4O A;  1SRO A;  4P75 A;  4TVA B;  1Y1W G;  1U4L A;  4KJO A;  1GO3 E;  2PI2 A;  3SE0 A;  2B2V C;  1EFW A;  3I91 A;  4H02 A;  4A3M B;  3Q8D A;  3M4O B;  4OO1 G;  3IRB A;  4CDE C;  3HOW G;  1HZC A;  1PXU A;  2WB1 G;  2DNC A;  4XT1 B;  3J80 L;  4DKA C;  3J81 E;  3S1R B;  4A3B H;  3BG3 A;  3MC0 B;  4DPG A;  2F0G A;  1MHW C;  3TS0 A;  2F3V A;  1VQA A;  5C3X A;  1SJE D;  1IBM Q;  4M1U B;  3I4M B;  1CK1 A;  2X6G A;  1CKM A;  2ASB A;  3BZD B;  3ICE A;  4KKT A;  4ZLT F;  1X32 A;  4LFC Q;  2LXJ A;  3X3N A;  1E7Z A;  4GN4 B;  4XYQ A;  5FJ8 H;  1HNW Q;  2OT2 A;  4NP5 A;  2KED A;  3P1H A;  1WTP A;  4HR7 B;  4EVO A;  1Y1V G;  1UNS A;  5M3F G;  2BDO A;  1N33 Q;  4DR3 L;  1DYQ A;  5EPK A;  2QDB A;  1U4R A;  2SNM A;  4LF5 Q;  3KLS A;  2IX0 A;  3OPO A;  1N34 Q;  3AMU A;  1YVC A;  3ERS X;  3GV3 A;  3K8A A;  2R7Z B;  4YY3 L;  1PA6 A;  1H9S B;  3GTO B;  1QVF A;  4ZKC B;  3VDY A;  4JI6 L;  3R3O A;  1UE5 A;  2G9H D;  4O2D A;  2XRQ D;  4LF6 L;  1TS4 A;  4OEM B;  3AQQ A;  1L0W A;  4GZY C;  1WJJ A;  1ZEQ X;  2QF7 A;  3BVM A;  4AYB G;  2RDH A;  3QOL A;  2VQF L;  2RSO A;  1IYV A;  2B29 A;  4DNR B;  3J80 i;  4ZCK A;  3STB D;  3WOF A;  3KJO A;  1NNX A;  1PDQ A;  3T53 B;  5DM6 3;  4OWX B;  4LNQ A;  4KKU A;  1STA A;  3NBH A;  3I4M H;  1ZYR C;  5JAV A;  1TWA B;  3A8I E;  4EQP A;  1HNZ L;  3S1Q H;  2H1E A;  3I7F A;  2QCP X;  2Z4I A;  1F9P A;  1VQ9 A;  2EVB A;  3SDZ A;  2BCO A;  2EYO A;  4QMG A;  1HTL D;  4A3C G;  1PRT D;  4I7A A;  1ILP A;  3H0G H;  1N32 L;  2RQX A;  4QIW B;  2C35 B;  2UXC Q;  1Q8K A;  4X3T A;  1SNP A;  2LFN A;  2E75 C;  1CA6 A;  5C6A A;  1DOM A;  3GTP B;  2RF4 A;  3SGI A;  3M4Q A;  1TU2 B;  2F03 A;  2N8N A;  5E1F A;  3IKJ A;  2K05 A;  2R6G A;  2K04 A;  3KF6 B;  3PO2 G;  2JA8 B;  2NYZ D;  4DUZ L;  3BDC A;  1IYJ B;  2F0O A;  4UP8 A;  1BUV T;  2VQE Q;  4A75 A;  1Z47 A;  4GLX A;  3CF5 A;  1VQN A;  5ELD A;  2MO0 A;  1XPR A;  4IPG A;  4Q0F A;  3KK7 A;  2PZW A;  3CQZ B;  1PH4 A;  4B3T Q;  4CKB A;  1B9N A;  1SRU A;  1V8Q A;  1FVI A;  3U9S A;  4JC0 A;  1JE4 A;  4KD4 A;  1T9H A;  2OTL A;  1IKM A;  1PH7 A;  1KAA A;  3I4M G;  4L6T B;  2KUM A;  2JYO A;  3C46 A;  2NVX H;  2VL6 A;  5DM7 3;  1VQH A;  1U0L A;  4A3B G;  4C3H H;  3VR6 A;  2D9U A;  3ER0 A;  3H3V I;  2LMC B;  3PF5 A;  4FF3 A;  4EQN A;  2K03 A;  5IYB H;  1IZ6 A;  2K5N A;  2BE5 C;  4JI0 Q;  5ELE A;  5M3F B;  2A5H A;  4C1N I;  2HD3 A;  4DV5 Q;  4B3S L;  2CWA A;  1EWC A;  1HA6 A;  3OW2 A;  1XMO Q;  4DV2 L;  2K50 A;  4ZUI A;  1LT3 D;  1VQB A;  2HHH Q;  3O13 A;  5IWA Q;  2Z6K C;  2UU9 L;  2XIW A;  1BBW A;  2RKS A;  1JC7 A;  4LF9 Q;  1PYW D;  1YNN D;  4DXG A;  1LLR D;  4DV4 Q;  4A3E B;  4BXX H;  1NBW A;  5D14 A;  1EUJ A;  1SE2 A;  4F88 A;  4DU9 A;  3A74 A;  1WD1 A;  4OON A;  4TQU S;  1GHK A;  1BNZ A;  4AYB B;  5I9P A;  1RHP A;  2BDN A;  2QDL A;  1M8A A;  2K5W A;  4R9W A;  2UUC L;  1S5E D;  4FXG C;  4JK1 C;  1QNU A;  3EBE A;  5IYB G;  1VQI A;  5M5Y H;  3VR4 A;  4C3J B;  1MKH A;  1LT5 D;  1TQO A;  1GUO A;  5FLX c;  4RHR A;  2R3Z A;  4ODG A;  4H7B A;  1JE5 A;  1HZ9 A;  2A6E D;  4UP9 A;  5D3D A;  3I56 A;  3PIP 3;  3STB C;  5EKI A;  3K5L A;  5IYD G;  2O4X A;  4BXX G;  5C3W A;  1CT1 D;  1FGU A;  3QOJ A;  1KRT A;  4EX5 A;  2EYP A;  1PH9 A;  1DD2 A;  1CQF A;  2O5J C;  1EIH A;  1CM9 A;  1C0A A;  4RCO A;  2JSO A;  5DEH A;  2B39 A;  1O78 A;  3J7A F;  2IT1 A;  4R4Q A;  1A2T A;  1ZXT A;  4DK6 C;  1J8I A;  5CMD A;  4IJH A;  1NTG A;  3E6Z X;  2CH4 W;  3I90 A;  3K0Y A;  1GD7 A;  2YU9 H;  1G2T A;  1LV9 A;  4KHV A;  2F0Q A;  3HFZ B;  3NHH A;  3NPP A;  2AQ1 B;  3R93 A;  5C3E H;  1HFN A;  1VQL A;  5ELO A;  4X66 L;  2CCZ A;  4XDX A;  2VUM B;  3CQZ H;  1PRT C;  3S24 A;  3NTK A;  4B3T L;  4APV A;  2OQK A;  1KIX A;  3NEN A;  5IT9 E;  2L11 A;  2RDG A;  5BN3 A;  3GTM B;  1EY5 A;  1JJC B;  4QB4 A;  1YNN C;  5M5W B;  3TRZ A;  1DJR D;  3E0J A;  3Q22 A;  1BVS A;  4QCL A;  2F0P A;  1HFG A;  2ATW A;  3V05 A;  3K59 A;  1A63 A;  3HG9 A;  4F7X A;  2ZM6 L;  2XGT A;  2XVS A;  1W2B A;  1S3O A;  2R92 B;  4QUC A;  1TS5 A;  4JCV E;  5FO9 B;  1ENF A;  5FKA C;  3RLO A;  3PUV A;  1QWY A;  1QOH A;  4PMW A;  2QKI C;  1BDO A;  3CCU A;  1G8Z D;  4O0A A;  3IFT A;  4YCU A;  4GKJ Q;  4GLV B;  2K4K A;  1XJV A;  1JMC A;  4HJ7 A;  3A56 A;  2KEE A;  5KGU A;  5IWA L;  5IE8 A;  4JYA Q;  3T1Y L;  1PVO A;  3UE1 A;  2CW0 C;  4ZAI A;  5LMU Q;  4JW0 A;  1I4X A;  3SR1 A;  4RGO S;  5M3M G;  1V1O A;  4A3I G;  2LSS A;  2DGY A;  4POF A;  4R4C A;  2J4X A;  1V1P A;  4J8Q A;  5DAU A;  2F3W A;  2OWO A;  1XWE A;  5M5W H;  2FXQ A;  4KHP Q;  3K7A H;  4FF4 A;  3H0G B;  1Q90 A;  1D7Q A;  3A5U A;  3GQB A;  1MJE A;  1CHP D;  4KTA A;  1XMQ Q;  1QZG A;  1Q8I A;  1WYD A;  3WDN A;  4L5T A;  3GTJ B;  3MA2 B;  1ENA A;  2HT1 A;  1GVP A;  3BVG A;  5COY A;  4K6L A;  2A68 C;  2AUK A;  2ZM6 Q;  2Q2H A;  4DF7 A;  1P16 A;  2DUD A;  1K83 H;  1VDZ A;  4BY1 H;  4IFD H;  5K36 H;  3CCQ A;  3PV0 A;  2EOT A;  3T1H L;  1LUZ A;  3ERO A;  2EYH A;  4P74 A;  1UE6 A;  4DAY B;  1I50 H;  2VB2 X;  2F0F A;  2WAC A;  4UHV A;  2E2J B;  3CCJ A;  1MI2 A;  5C4J H;  1G6P A;  5JVG 3;  2E2H H;  3PO2 B;  1Z9F A;  3PIO A;  4ALP A;  5FOB B;  1UEB A;  4H44 C;  1Z6H A;  5A35 A;  3KBG A;  3S1M H;  4DAP A;  1VQF A;  4YCV A;  1K8G A;  2PQA B;  1MBY A;  1I3Q H;  1EEI D;  3GTO H;  1Q1E A;  2F0D A;  1R4Q B;  4IZ8 A;  3KYH C;  1YJ9 A;  1AFP A;  4NXN L;  1TII D;  2BA1 A;  4A3I B;  1L0Y B;  4OO1 H;  2PNR C;  1MIU A;  3TQY A;  3TS2 A;  3KF6 A;  3VYR A;  2R93 H;  4DV0 Q;  1J6Q A;  5BN4 A;  1KTK A;  3FEW X;  4QL5 A;  1CKN B;  4O42 A;  3RMH A;  4ZUJ A;  5JEA J;  3MXN A;  4FF2 A;  4GKK L;  5D65 A;  4JI5 L;  3B6Y A;  2NVQ B;  1CA5 A;  4NXM L;  4RG1 A;  2YTX A;  3PO3 B;  2UU9 Q;  3J81 L;  1PTO C;  2I5H A;  4BY1 B;  4N9T A;  1U4M A;  2NB0 A;  2EYL A;  3CXC A;  4ZYS A;  5A2Q E;  4A76 A;  3HOZ H;  4X6A H;  2E2I H;  4AYB E;  1KC8 C;  4DNT B;  1KLG D;  1QE6 A;  3M3Y H;  1BCP D;  4DR1 L;  1WOC A;  2VW9 A;  4JVZ A;  3F2U A;  3UDI A;  3R8B A;  1S72 A;  5JJI A;  2PYK A;  1N9W A;  3H94 A;  4XYO A;  2VQE L;  5M5Y B;  1Y1V H;  1WTV A;  1BBU A;  2KCT A;  1KXL A;  4FXK C;  4A4I A;  2BH2 A;  3EA6 A;  1LT6 D;  4XQN A;  1STN A;  3ULJ A;  1EL0 A;  4LUO A;  1JJ2 A;  5LMN L;  1ET6 A;  1SNO A;  4OX9 L;  1DOK A;  3E9H A;  4DV5 L;  1YZ6 A;  2B2T A;  5C3E B;  1EYG A;  3MTS A;  2NVY H;  4KN4 C;  3HOV H;  3S15 B;  1IKL A;  4CJ1 B;  4N8X 1;  4JOI C;  2F0N A;  1B70 B;  2E2D C;  2KEC A;  1V1Q A;  2Z6B A;  1NR4 A;  2IX1 A;  2UUB Q;  3H3V H;  1Y69 U;  4FXD A;  3EN2 A;  1SEB D;  2AMC B;  2WKD A;  2D5D A;  2KHI A;  5E7N A;  3J80 E;  1A3V A;  4LFA Q;  1PH8 A;  5FO7 B;  3NBH B;  5JJK A;  3CC4 A;  4MTN A;  3JAM c;  1DGS A;  1FGB D;  2WFW A;  3Q23 A;  4IOA A;  2B2U A;  2MHV A;  3FP9 A;  4FO2 A;  4GS3 A;  3OMC A;  4LK1 C;  4BA1 I;  2NVY B;  1EIG A;  1RL2 A;  2Y0S E;  1KDA A;  3PIP A;  1I5F A;  1IL8 A;  1OXS C;  4WJ4 A;  4MN3 A;  1TVX A;  3L2P A;  3U4V A;  3QR8 A;  5M5X B;  3G6J B;  1VQO A;  3NEL A;  4U68 A;  1X3G A;  3D3R A;  4C2M B;  1UWV A;  4IUV A;  3A7L A;  1NE3 A;  4K5V A;  4XQQ A;  3M85 A;  5BR8 Q;  1I94 L;  4L5S A;  1F9R A;  4IPC A;  3S15 H;  3HOV B;  2KJX A;  3AYH B;  2PI2 E;  3HOU H;  4DV1 Q;  2JP1 A;  1AZP A;  3UDG A;  4KI0 A;  3M7N A;  1LTT D;  1EWH A;  3GTP H;  1AEX A;  4DGZ A;  2RCF A;  3M7G A;  4RKB A;  1Q86 C;  1D5M C;  5M3F H;  4Y7N H;  4FYD A;  3L7Z C;  1IYU A;  2BOS A;  2IL8 A;  1SYC A;  1AE3 A;  2ZT9 C;  1JCK B;  3H15 A;  1PLF A;  3PF4 A;  1CI3 M;  4C56 C;  3I3C A;  1K73 C;  1VQ8 A;  3CMA A;  3D8G A;  1ESF A;  4B08 A;  1RTN A;  3C1F A;  4BBS H;  4YWL A;  3S2D H;  2DY8 A;  4IO9 A;  1S40 A;  2K32 A;  1IXR A;  2M9V A;  4RMF A;  2LY7 A;  3FRP B;  3OMG A;  1C8C A;  4R4I A;  1XPU A;  1K9M C;  1X65 A;  4R1J A;  4LMQ D;  4LF4 Q;  4GNX B;  2VZA A;  3S1R H;  1D6E C;  2X6L A;  1N34 L;  2CFM A;  1VQP A;  1WTX A;  4A3E G;  4P73 A;  1IBL Q;  3P7J A;  2ZTC A;  1Q7Y C;  5GAG C;  4C3I B;  1SNC A;  1QVC A;  4QGU A;  1QNK A;  1YHB A;  2Q8I B;  1O7Y A;  2H5X A;  5J39 A;  1CUK A;  1VF7 A;  4HIM A;  1X3F A;  2A1A A;  2I5M X;  5AFW A;  2MGS A;  3RUZ A;  4JI2 L;  4A3J B;  2XTI A;  1E2W A;  1YNX A;  1PH6 A;  4L8J A;  4QQB X;  4R8N A;  1STB A;  1KQS A;  4IUN A;  5IP9 G;  2UXB L;  1N8R C;  1HTP A;  2IW3 A;  1BCP C;  2AQ2 B;  2HDM A;  1PTO F;  2IHE A;  1WCM G;  3VR2 A;  1GKH A;  1TR5 A;  2EY6 A;  2ALY B;  3QG1 A;  2PQA A;  1DM0 B;  4NXM Q;  1U9R A;  5K5P A;  4A3K H;  3FDT A;  2R61 A;  1XMQ L;  3J7Y W;  4YHH Q;  3K7U C;  3RZD B;  3A8J E;  3G7L A;  4A3M H;  3I55 A;  1IW7 D;  4HCE A;  4CHT B;  3MXN B;  4HN7 A;  1MSH A;  1U5K A;  3KLS X;  1ICW A;  1VQG A;  4YIJ A;  2JA5 G;  3NSW A;  5EKL A;  2NVQ H;  1VQK A;  4A3B B;  2FIN B;  1YJW A;  1STY A;  3VR3 A;  3G6E A;  3Q24 A;  4F87 A;  3GTQ B;  4HSP A;  2CVR A;  1DXM A;  2PPB C;  3I4N H;  1FNU A;  1AH9 A;  1KD1 C;  2QEX A;  3W5O A;  1B53 A;  3OSO A;  5LL6 X;  4JBK A;  1VQD A;  4H0L C;  5G3L F;  1VQ4 A;  2RVL A;  4YWM A;  2VUM G;  1L0X B;  1UE7 A;  4GKK Q;  1EYC A;  2E5L L;  1LTB D;  3D6W A;  3F2B A;  4XTC S;  1E1T A;  2KVM A;  1JB7 A;  3RD4 A;  1Y1V B;  1PRT B;  3CW2 C;  3RZO H;  1I6H B;  2GN5 A;  3UDF A;  3S1Q B;  2C9O A;  1C48 A;  3V96 A;  4K8I A;  3PMF A;  3URY A;  3OIP A;  1F2Z A;  1HR0 Q;  5JJL A;  3U58 A;  1SJH D;  3M9B A;  1D1K A;  3TP8 A;  1HZA A;  2XN9 C;  3G71 A;  3A55 A;  2F0E A;  5GAH C;  1BCP B;  1JWM D;  4WJW A;  2XRS D;  3HOX G;  1WTR A;  4A3K G;  2Z4H A;  4ZK9 B;  1D8L A;  1XYI A;  3GP7 A;  2F0S A;  2KBN A;  3OHX C;  1HPC A;  5IGD A;  1PYS B;  4OEL B;  4POG A;  2CKZ B;  1B1Z A;  2UUA Q;  3S14 B;  4B9X A;  2R7Z H;  1RIP A;  1SXT A;  2K28 A;  5JPN C;  1BOS A;  1PRT F;  1BKB A;  4ABN A;  2V1C C;  2YTY A;  3PUY A;  5IOD A;  5IYC H;  3KF8 B;  4LFB L;  1HZB A;  3PQI A;  4LUV A;  1EY4 A;  4JI4 L;  2B8G A;  2EXD A;  5CV6 A;  1VMC A;  1PFB A;  2LKV A;  5E4X A;  2NVT H;  1BBX C;  4RA8 A;  4LF5 L;  3DUZ A;  4WOR A;  2NN6 H;  4JBM A;  3HZX A;  1JOR A;  2MQH A;  4C2M H;  2JQO A;  2MP1 A;  3K0X A;  2E2H B;  1DOL A;  1CKO A;  5CC4 A;  5JEA H;  4X64 Q;  1YIT A;  1JT8 A;  5KYI A;  3PUZ A;  2XWB B;  3EJI A;  1I50 B;  3SK5 A;  2GA4 B;  3OYY A;  5D3I B;  4RGM A;  3M3Y B;  1A3T A;  1B8A A;  4JYA L;  3S2H H;  2L12 A;  1HQR D;  1OXU A;  2TMP A;  3TP7 A;  1JB3 A;  1GM5 A;  2DN8 A;  2JEA I;  2Q8R E;  2M00 A;  4K6D A;  5COR A;  2NZ1 D;  3MXP A;  2PMZ B;  1I6H H;  4IUR A;  5KEE A;  1I3Q B;  4CJ2 C;  3P75 A;  4FF1 A;  4WJ3 M;  5CBA E;  2I5L X;  3FKI H;  4A3D G;  4N9P A;  1B4O A;  5JOB A;  4B3S Q;  1CFM A;  3OTO L;  2R93 B;  1JOQ A;  2L1B A;  5CV7 A;  1LM0 A;  3RZO B;  3K80 C;  1T5E A;  5EBC A;  1K0R A;  2CW0 D;  3L3O C;  4GOP C;  1SFO H;  2UUB L;  4NW2 A;  3CPF A;  2N3S A;  2RCN A;  2F0W A;  4AH6 A;  3D4W A;  2A69 D;  3BVZ A;  4JI3 L;  2IHF A;  4LF7 L;  1NCV A;  4LF9 L;  1HUN A;  4A3D B;  4CDF C;  1S5C D;  2SOB A;  1A15 A;  1OO9 B;  2Y0S B;  1I4G A;  3BYT B;  2G9D A;  1GUW A;  1HXY D;  3GD7 A;  2F0L A;  2PCF B;  1BF4 A;  2Q2I A;  2E2I B;  3CU7 A;  5KIX A;  3JAM L;  2EYJ A;  2QIL A;  3DXJ C;  3PO3 G;  4KHZ A;  2WAQ B;  4ID6 A;  3OWF A;  1Q3L A;  4CKE A;  1NJI C;  5M3M H;  4B3M Q;  2B8F A;  4HIK A;  5KYL A;  2L5T A;  5CV8 A;  4DV6 L;  3CRL C;  4HJ5 A;  4X62 L;  4DV4 L;  3RZD H;  4KHP L;  3CPW A;  2E76 C;  1K0S A;  1HNZ Q;  3KDF A;  3HOV G;  2R92 H;  5C5L A;  2RHQ B;  4DV3 Q;  4QF4 A;  2XNA C;  4JOI A;  3PIO 3;  2EJM A;  4C3J G;  3KF8 A;  1S5D D;  1W6K A;  2B2W C;  1SLJ A;  4K8J A;  4KLK A;  1VQ7 A;  2VNU D;  1D1I A;  2IPK D;  2UXC L;  2DNE A;  5AJ3 L;  4Y52 H;  2NTS A;  5FO8 B;  5JJZ A;  3QO2 A;  3N52 A;  4S3S A;  3J80 c;  4GKJ L;  2E5L Q;  1L1O C;  4O1N A;  1Y8P B;  1HRJ A;  1G91 A;  2ZXP A;  1A3U A;  3A5Z B;  4B3M L;  4ZKB B;  1K8A C;  2F0T A;  2AUJ D;  5C44 H;  1FNV A;  4GLA C;  1CQV A;  1QVG A;  4KY6 A;  1Y8N B;  4KK7 A;  1YBY A;  2NWG A;  2WII B;  5KNB A;  3NEM A;  5ISR A;  2CWP A;  1HNX Q;  3JAM i;  2Z0S A;  4DN4 M;  4C3H B;  4BBR B;  1F9Q A;  2NN6 G;  1ET9 A;  1C7Y A;  1Y1W H;  3VYT A;  2Z6K A;  1TS3 A;  1A0I A;  1HUM A;  2ZXO A;  1E3P A;  4PNY A;  3VA7 A;  2BA0 A;  1QIL A;  3M4O H;  2OTJ A;  2Q2T A;  1PV4 A;  1T5X D;  1ONL A;  2A19 A;  3AU7 A;  1B3Q A;  3QJY A;  1BR9 A;  1AP0 A;  3C3L A;  2RBM A;  1G51 A;  4LFB Q;  1XPO A;  1EU3 A;  3J7A V;  2ZTD A;  5LHY 1;  1DCZ A;  3E9I A;  1K28 A;  3K5N A;  4G7O C;  3HOU B;  2P5Z X;  4ME3 A;  1PZJ D;  4I7Z C;  1KLU D;  3BU2 A;  1CSQ A;  1HR0 W;  2B3G A;  1KL9 A;  2EQS A;  3F1Z A;  4LF6 Q;  1TWF B;  4LF8 L;  3T13 A;  1UEA B;  3PO2 H;  4L63 B;  1BQQ T;  4ZQ3 A;  3SHL A;  3LWE A;  4B3R Q;  3J81 j;  3GTQ H;  2ENB A;  1R4P B;  2K5D A;  3HKS A;  5BR8 L;  2PMZ E;  3U50 C;  1G29 1;  3AEV A;  3LNN A;  1E22 A;  5EKK A;  4DK0 A;  4HED A;  4CDC C;  3NBI A;  2DY7 A;  5AJ3 Q;  1Y1W B;  2B63 H;  1M1K C;  3GO5 A;  1F2L A;  1KDB A;  3EFX D;  3NQT A;  2PW5 A;  1HNX L;  5FJ8 G;  4G7H C;  5IYD H;  3IFD A;  4KD3 A;  1B7Y B;  1ESR A;  2WAQ G;  2EY1 A;  1S5B D;  4UPA A;  4HTH A;  3EIV A;  3QWN A;  4JI4 Q;  4CGY B;  3GTG H;  1SE8 A;  2WV6 D;  3ONA B;  1GJX A;  5HGT A;  4HID A;  4DR2 L;  4K14 A;  5IOC A;  4PQX A;  1H9M A;  2NN6 I;  1XNQ L;  3S1N H;  3MXG A;  3H09 A;  1SE4 A;  2KOL A;  2KEN A;  2I46 A;  3WWV A;  2O2L D;  1WVL A;  4KKS A;  2HHH L;  1NMG A;  5I6W A;  1RDP D;  4XT3 B;  1MJC A;  4WFN 3;  3OTO Q;  2YYZ A;  2WP8 J;  2D0O A;  4A3G B;  4AQY L;  3TSS A;  3UDX A;  2DJG C;  3X3M A;  2PO4 A;  4FP5 D;  3NK9 A;  3RN2 A;  5LL6 S;  1HJP A;  4PZ8 A;  4RGT A;  5C0X I;  2F0U A;  1O7Z A;  2V4D A;  3RR5 A;  4BBS G;  1VF5 C;  4A3K B;  1RCV D;  5C4Z A;  2O5I C;  2ZJR A;  3HRZ C;  1GXD C;  4IPH A;  2ID0 A;  3NP8 A;  3RN5 A;  2F0V A;  3DWA A;  1HCZ A;  2FMM A;  2B63 G;  3K6O A;  1TY0 A;  2K52 A;  1HNW L;  1OTC A;  4OWT B;  5M3M B;  4JI3 Q;  4LF7 Q;  3T16 A;  3CCS A;  2B2Y C;  3A7A B;  3PGZ A;  4OX9 Q;  1ASY A;  3HOU G;  4DK1 A;  1EOT A;  1SE3 A;  4LFA L;  4DR5 Q;  3LX0 A;  1PHJ A;  1TS2 A;  1IBM L;  1TWF H;  2JA6 B;  2E74 C;  2EJG C;  1FR3 A;  2VS1 A;  4X3K A;  3CHB D;  4M8A A;  5KRU A;  3H0G G;  5IIF A;  2JN4 A;  3PUX A;  5IT9 L;  1WCM H;  3TP5 A;  4ILW A;  1X55 A;  4EGV A;  1JWU D;  2NBF A;  2IWH A;  5EQ0 A;  1TWC B;  1CZW A;  1IBK Q;  4L5Q A;  1S5F D;  1EQQ A;  3HEJ A;  5CR3 A;  2UUC Q;  3U4Z A;  2A6H D;  3V2T A;  2AKW B;  3W2D A;  2VUM H;  5ELN A;  2IX3 A;  3SEB A;  2A68 D;  1SN8 A;  2B2U C;  2L15 A;  5GQO A;  2F0J A;  2HIV A;  1LYL A;  3DM1 A;  2Q2U A;  3E3X A;  1TWG H;  5FLM H;  5I6Y A;  4X64 L;  5HGQ A;  1PFM A;  4DR3 Q;  1XTD A;  4NB3 A;  1PFS A;  4ULL A;  2VY3 A;  4CKC A;  1SSO A;  4HCS A;  4DV2 Q;  2JXM B;  1B3A A;  2JK8 A;  3DM3 A;  1D2B A;  1JR0 D;  4KV6 A;  1PFN A;  3AFQ A;  3CCR A;  2JJQ A;  3I8Z A;  5IP7 G;  3NTI A;  1ZYR D;  3CP0 A;  1ZKO A;  5T1I A;  2R7D A;  4A93 H;  5IGE A;  5CYU A;  2X69 A;  2SDF A;  4A93 G;  4V19 0;  3JC6 6;  2GVA A;  2HDL A;  3HGB A;  1JQY D;  1GHJ A;  3DLL A;  1PZK D;  1V9P A;  2D2C C;  3A54 A;  2CQO A;  5FLX E;  4JV5 L;  5IT9 c;  3GTL H;  2LXK A;  2K1B A;  1X54 A;  4IUU A;  5I9O A;  4DV7 Q;  1LTR D;  3NQI A;  3KLW A;  4PV1 C;  3SVM A;  1XXG A;  3J7Z C;  1W3S A;  3BJU A;  3MEH A;  4R4T A;  4LWC A;  1BXT A;  3CC7 A;  2UXD Q;  4LJZ C;  5T1G A;  2RSN A;  4BY7 H;  5C4X H;  5C0X H;  1YNJ C;  2ZJQ A;  4DUZ Q;  4H13 C;  1VQ5 A;  5C5M A;  4EQ5 A;  3A0J A;  4K2K A;  2Z9H A;  4A3L G;  2NVX B;  3HOX B;  5H1S E;  2QEJ C;  2A8V A;  4DV3 L;  1H9R A;  3ULP A;  3CCE A;  5I4D A;  5KND A;  2ICI A;  1SYG A;  3I4O A;  2L0C A;  5FLM G;  2MPM A;  3T1H Q;  4V0B A;  2QW7 A;  3TEH B;  1VQ6 A;  3J81 c;  4JI7 Q;  5EAY A;  2UXB Q;  4HSV A;  4DFA A;  3I72 A;  2BH8 A;  1JJG A;  1PH3 A;  5G3L D;  2F0K A;  2KCM A;  4RFB A;  2ZJP A;  4OWW B;  1I4H A;  5CGK A;  5LMN Q;  2EY5 A;  4YCW A;  4YHH L;  3MWY W;  5IGF A;  1VQM A;  4A3J H;  1KRS A;  1F9S A;  3SK8 A;  4R4O A;  2AWO A;  2K6A A;  3GTL B;  2N49 A;  4JBJ A;  5I2X A;  2B2Y A;  1QCB D;  1KAW A;  5IGB A;  1L1O A;  2AWN A;  2OXP A;  5HUR A;  5C4H A;  3HP3 A;  1WTO A;  1AN8 A;  3FKI G;  4A3D H;  5J1Z A;  5FLX L;  4IPD A;  1A6X A;  1EY9 A;  2A69 C;  3DWP A;  3MZ5 A;  4DV0 L;  2F52 A;  4U67 3;  4N8F A;  4E6I A;  4JI7 L;  3CKI B;  5IP7 H;  4PMC A;  3MEF A;  1EY6 A;  4QJF A;  1C9O A;  3CCM A;  4PG3 A;  1EZ8 A;  1TWA H;  3T51 B;  3H3V C;  1LTS D;  3S17 B;  1PTO D;  2C5C A;  1AW7 A;  5HY6 A;  2OQ0 A;  2RHS B;  1X9N A;  4JV5 Q;  4G4K A;  1U4P A;  4L5R C;  3HOY B;  2XWJ B;  1ICF B;  2IJ0 A;  2WKC A;  4NPS A;  2EY2 A;  3RLF A;  4ZRZ A;  5FK9 C;  5M9O A;  4OGQ C;  2VQF Q;  1N33 L;  4JI1 Q;  1YJN A;  4DAM A;  4K0K Q;  4JG2 A;  5JVH 3;  1KNA A;  4LF4 L;  3KLR A;  1IW7 C;  2KHS A;  3MVV A;  1EQT A;  1EYA A;  2OF1 A;  4B9W A;  2PNH A;  2FFK B;  2LS0 1;  5C0X G;  5C4X G;  4GN5 A;  4A3G G;  2G5D A;  3NUC A;  3K7A B;  2R93 G;  1H95 A;  3C2P A;  5CV5 A;  1L1O B;  4MTK A;  2L4N A;  1CTM A;  1LAC A;  4IQZ A;  2F4V L;  2CQA A;  4HIO A;  1STH A;  3M4Y A;  2E2J H;  5NUC A;  2N78 A;  5EPL A;  5EBD A;  1V1P B;  3KBX A;  4LFC L;  2JA6 H;  2B2T C;  1SMY D;  3MXU A;  2F4V Q;  3S1M B;  4C3I H;  4IFD G;  1GOZ A;  2F4I A;  1SND A;  3FKI B;  1NUC A;  1IHZ A;  4DR7 Q;  3Q0A A;  4DV1 L;  3CRK C;  1EY0 A;  1M90 C;  2WAQ E;  4AQY Q;  5C4J B;  2ICE C;  3IL8 A;  4TKO B;  4BBR H;  4A3J G;  1LO5 D;  3FVQ A;  3JAM E;  4JI8 L;  4IUQ A;  3TME A;  1M4V A;  1SR3 A;  4HMJ A;  4X3U A;  1AZQ A;  4K0K L;  1PTO B;  3FPP A;  2OEO A;  1PYB A;  4JI1 L;  4C3J H;  2JEB I;  1NMF A;  1P8L A;  2NZH A;  4FVM A;  2N55 A;  4DV6 Q;  1W6J A;  3J7A 5;  2JA7 G;  5ELC A;  2I0Q A;  3K58 A;  1LTI D;  2RA4 A;  1NY4 A;  1X3Q A;  3C1E A;  3NTH A;  4UDU C;  1B9M A;  1WTW A;  1AE2 A;  2KCN A;  4A3E H;  3FPU B;  1UE1 A;  3TZD A;  3S17 H;  3NWT A;  4KY5 A;  1WTH A;  2K5H A;  1OXX K;  3GTM H;  2JA5 B;  3TN2 A;  2TSS A;  3GDE A;  1SAP A;  1ASZ A;  4KY7 A;  1VQE A;  4A3G H;  3D31 A;  1OXT A;  4JI0 L;  1N36 L;  2JA7 H;  1TT2 A;  3R2I A;  2RDF A;  3I2Z A;  3K57 A;  4FDB A;  3D6C A;  1SMY C;  3KFU A;  4DR2 Q;  1GUG A;  1X56 A;  2EJF C;  4ME5 A;  3HOW B;  4X3S A;  2IY5 B;  5CV9 A;  2EPB A;  2Q8T A;  4DAY A;  1N36 Q;  3T4A C;  4DR1 Q;  4OXP A;  4X65 Q;  3LGJ A;  3KOJ A;  4LF8 Q;  1ROD A;  3PCO B;  4G57 A;  1I4P A;  1A2U A;  3M4P A;  4X65 L;  1LAB A;  1QJO A;  1I4Q A;  2HIX A;  3AFP A;  2Z1C A;  3FMC A;  1CHQ D;  4IFD I;  3I73 A;  1SYD A;  1Q81 C;  1RF2 D;  4XXE A;  1BO0 A;  1K83 B;  1LT4 D;  3HOY G;  3DEO A;  2K5Q A;  5IGC A;  1SBB B;  4BWG B;  2I07 B;  3BYY B;  2EDG A;  4UY8 C;  4RH6 A;  2AQ3 B;  4DR4 L;  1G2S A;  2Z8L A;  3OOC A;  4LAA A;  4KMU C;  4RWS C;  4UP7 A;  2CH4 A;  4MZ9 A;  3I4N B;  1B50 A;  1ENC A;  3OW7 A;  3BDL A;  4MNO A;  4QUF A;  1XX8 A;  1XNQ Q;  1I6V C;  1EIF A;  3KJP A;  4A3F H;  3F8T A;  3S14 H;  1D5X C;  1STE A;  1VMP A;  1VCI A;  2K33 A;  1CKN A;  4A93 B;  2F0H A;  2A74 C;  1KDC A;  1WFQ A;  1HQM C;  4GOP B;  1TKW B;  1DON A;  1I4R A;  3SXH A;  1JOK A;  4LUZ A;  4JI8 Q;  1ILQ A;  3I4N G;  1K3R A;  5LMN W;  3MHB A;  3S16 H;  1B44 D;  3HKZ B;  2AHO B;  2XSC A;  4A3F G;  4GNX C;  1E1O A;  1MD2 D;  2HQL A;  4R8I A;  1PH5 A;  1OXV A;  3CC2 A;  4J1M A;  4IN3 A;  4DR4 Q;  1YHA A;  2BE5 D;  3OWE B;  1PZI D;  2WB1 E;  3GTJ H;  2MNA A;  1YI2 A;  5J22 A;  2ES2 A;  3ULL A;  4BY7 G;  1FD7 D;  1EOV A;  1FJG Q;  4C1N K;  1K3B C;  3DHQ A;  3TBI B;  3CME A;  4UAI A;  1K8M A;  5TSS A;  2F1M A;  4IOC A;  2B63 B;  1C4Q A;  4IJL A;  4CJ0 B;  4DR6 L;  3HS0 C;  3IAY A;  4P2C B;  2F0M A;  3T56 B;  1TWC H;  2EIF A;  3AB9 A;  1L2F A;  5KNC A;  3ND8 A;  4K2L A;  5C44 B;  3TZU A;  4GOP A;  3CCL A;  2QGQ A;  2HQE A;  4RGN A;  1YEZ A;  1EWI A;  3GTK B;  1Y8O B;  4PMB A;  3T1Y Q;  3SK4 A;  1KAB A;  2JA9 A;  4NDX A;  1ML0 D;  1HH2 P;  3PSI A;  5BN5 A;  4WRD A;  2MJ8 A;  1WCM B;  4I65 A;  3NXW A;  4X62 Q;  2A73 B;  2NUC A;  3DWQ A;  3S2D B;  5C3E G;  4JBW A;  2YV5 A;  3UI2 A;  1XTC D;  5L37 A;  2A6E C;  2FJ2 A;  3MFG A;  3N6R A;  2SNS A;  1D5Z C;  4A3L H;  4OO1 I;  1FNW A;  1E2V A;  3QB3 A;  3NE5 B;  2KQ3 A;  1GUS A;  4HAE A;  3NWS A;  1IL2 A;  4A3M G;  1TWH B;  1II3 A;  4RCN A;  1RKN A;  3ND9 A;  4NKL A;  3BDO A;  4MHE A;  4DUY L;  1X6O A;  1CSP A;  2J0T D;  1QZH A;  2PW7 A;  1QUQ A;  4KN7 C;  4DAV A;  2K5V A;  3DMU A;  2KHJ A;  4XQJ A;  5DNF A;  1G6Z A;  2R7Z G;  3P20 A;  1JIC A;  1K8O A;  2DJF C;  3VR5 A;  3RNU A;  2ZTE A;  3HOY H;  5IP9 H;  3F2D A;  4HJ8 A;  3A8K E;  1PH1 A;  3D0F A;  1NAP A;  1PH2 A;  4X66 Q;  4IUP A;  3W1G A;  3HKZ E;  2K14 A;  3W3A A;  2EZV A;  2JA5 H;  4P71 A;  4TRD A;  1O7I A;  4J6H A;  5EJW A;  1N32 Q;  3EVQ A;  1QB5 D;  1WTQ A;  1Q46 A;  3I4L A;  1YNJ D;  4DR7 L;  2QA4 A;  2JA8 H;  4BA2 I;  3VA5 A;  4JI2 Q;  2D0P A;  1F77 A;  2N88 A;  3S1N B;  2MUY A;  1SYE A;  1YHQ A;  5GAD C;  2A6H C;  4JI6 Q;  1GUT A;  4YY3 Q;  5EGT A;  4RKL A;  3S9W A;  1FL0 A; 
#chains in the Genus database with same CATH homology
 1NR2 A;  3E5S A;  4Q5V A;  5ELF A;  4IAL A;  2VXW A;  1QG7 A;  3TP6 A;  5JEA G;  2HCC A;  5K36 G;  4TSS A;  1EFI D;  1FYC A;  1EZ6 A;  2SEB D;  1RTO A;  4C3H G;  3I70 A;  3K5O A;  2HUG A;  2NVT B;  3H91 A;  5E3F A;  1BCP F;  4DXF A;  4K5X A;  5ELB A;  2K01 A;  3Q6S A;  4OIJ A;  5F2D A;  3TDQ A;  1EYD A;  4CBV A;  1SDF A;  2J7Z A;  1LTA D;  1EY7 A;  5CBE E;  1X3P A;  2EYM A;  3OIQ A;  1E2Z A;  4IUT A;  3BS1 A;  1R9T B;  3LWU A;  4A3F B;  2EXZ A;  1F2M A;  3SK6 A;  1RJT A;  2K7V A;  3U9O A;  4OL7 A;  4OHJ A;  3HOZ B;  5CV4 A;  5IGG A;  1SYB A;  1MSG A;  3S2H B;  2YU9 B;  1Z7T A;  3WOE A;  2VB3 X;  3EQL C;  1GUN A;  2EE1 A;  1V43 A;  4K5W A;  2JE6 I;  1H9K A;  3VYS A;  2PQE A;  3GTG B;  1MGS A;  1WD0 A;  2L55 A;  1KNE A;  1PTO H;  1H9S A;  4BS9 A;  3ITP A;  4DA2 A;  1Q1B A;  2KA7 A;  1H9J A;  2B2W A;  1TWG B;  1JWS D;  4BBS B;  3L9A X;  1J9O A;  2L9H A;  2KCC A;  4MIU A;  2PZU A;  4XIG S;  4G7Z C;  1STG A;  3GV6 A;  4HMI A;  1F2Y A;  2EYF A;  3KUP A;  1EQV A;  4F8M A;  4RHS A;  1SNM A;  3VYU A;  1TY2 A;  4EQO A;  3MFY A;  4RAU C;  1EY8 A;  1NSN S;  2WIN B;  3QIA A;  2FHT A;  1E0B A;  1UUP A;  1PMR A;  3PUW A;  2PZT A;  5EPJ A;  5C0X J;  3ZYY X;  4FNF A;  5I2Y A;  4NMZ A;  1B2T A;  1LTG D;  1O7L A;  3D4R A;  1DZ1 A;  2D62 A;  5E4W C;  5A2Q L;  1O80 A;  2FMC A;  2HCI A;  1EU4 A;  1CZG A;  5JPM C;  1UAP A;  2F0I A;  1SYF A;  1RD9 D;  5C4X B;  3S16 B;  2M2L A;  3R2T A;  4IFD J;  1SNQ A;  4C3I G;  1Q12 A;  3ERQ A;  4KJN A;  2ZXR A;  2JA7 B;  1SFO B;  4Y7N B;  3DEP A;  1S4Z A;  1HA5 A;  1HHV A;  3H6M A;  2B2V A;  4Z9C B;  4OIK A;  4BY7 B;  1EEF D;  1JOO A;  3K5M A;  2WB1 B;  2CHB D;  3MAQ A;  3D4D A;  2NTT A;  2H4O A;  1U4L A;  4KJO A;  3SE0 A;  2B2V C;  3I91 A;  4A3M B;  3M4O B;  4OO1 G;  1PXU A;  2DNC A;  4XT1 B;  3J80 L;  3J81 E;  3S1R B;  3BG3 A;  3MC0 B;  2F0G A;  2F3V A;  5C3X A;  1SJE D;  4M1U B;  3I4M B;  1CK1 A;  2X6G A;  3BZD B;  4KKT A;  4ZLT F;  1X32 A;  3X3N A;  4XYQ A;  2OT2 A;  4NP5 A;  2KED A;  3P1H A;  1WTP A;  4HR7 B;  4EVO A;  1UNS A;  2BDO A;  1DYQ A;  5EPK A;  2QDB A;  1U4R A;  2SNM A;  3KLS A;  2IX0 A;  3OPO A;  3AMU A;  3GV3 A;  2R7Z B;  1H9S B;  3GTO B;  4ZKC B;  3R3O A;  2G9H D;  2XRQ D;  1TS4 A;  4GZY C;  1ZEQ X;  2QF7 A;  3BVM A;  2RDH A;  3QOL A;  2RSO A;  1IYV A;  4DNR B;  3WOF A;  1PDQ A;  3T53 B;  5DM6 3;  4KKU A;  1STA A;  3NBH A;  1ZYR C;  5JAV A;  1TWA B;  3A8I E;  4EQP A;  2H1E A;  2QCP X;  2Z4I A;  1F9P A;  2EVB A;  3SDZ A;  2BCO A;  2EYO A;  4QMG A;  1HTL D;  1PRT D;  1ILP A;  2RQX A;  4QIW B;  4X3T A;  1SNP A;  2LFN A;  2E75 C;  1CA6 A;  5C6A A;  1DOM A;  3GTP B;  1TU2 B;  2F03 A;  5E1F A;  3IKJ A;  2K05 A;  2R6G A;  2K04 A;  2JA8 B;  2NYZ D;  3BDC A;  2F0O A;  1BUV T;  1Z47 A;  5ELD A;  4Q0F A;  3KK7 A;  2PZW A;  3CQZ B;  4CKB A;  1B9N A;  1V8Q A;  3U9S A;  1JE4 A;  4KD4 A;  1IKM A;  1KAA A;  4L6T B;  2KUM A;  2JYO A;  3C46 A;  5DM7 3;  3VR6 A;  2D9U A;  2LMC B;  4FF3 A;  4EQN A;  2K03 A;  2BE5 C;  5ELE A;  5M3F B;  2A5H A;  4C1N I;  1EWC A;  1HA6 A;  4ZUI A;  1LT3 D;  3O13 A;  2XIW A;  2RKS A;  1JC7 A;  4DXG A;  1PYW D;  1YNN D;  1LLR D;  4A3E B;  5D14 A;  1SE2 A;  4F88 A;  4DU9 A;  1WD1 A;  4TQU S;  1GHK A;  1BNZ A;  4AYB B;  5I9P A;  1RHP A;  2BDN A;  1M8A A;  2K5W A;  4R9W A;  1S5E D;  4FXG C;  4JK1 C;  1QNU A;  3VR4 A;  4C3J B;  1LT5 D;  1TQO A;  1GUO A;  4RHR A;  2R3Z A;  4ODG A;  4H7B A;  5D3D A;  2A6E D;  3PIP 3;  5EKI A;  3K5L A;  2O4X A;  5C3W A;  1CT1 D;  3QOJ A;  2EYP A;  1DD2 A;  1CQF A;  2O5J C;  1EIH A;  1CM9 A;  4RCO A;  2JSO A;  5DEH A;  2B39 A;  3J7A F;  1O78 A;  2IT1 A;  1J8I A;  1A2T A;  1ZXT A;  5CMD A;  3E6Z X;  3I90 A;  3K0Y A;  1G2T A;  1LV9 A;  4KHV A;  2F0Q A;  3NHH A;  3NPP A;  2AQ1 B;  3R93 A;  1HFN A;  2VUM B;  4XDX A;  1PRT C;  3NTK A;  5IT9 E;  2L11 A;  2RDG A;  5BN3 A;  3GTM B;  1EY5 A;  4QB4 A;  5M5W B;  1YNN C;  1DJR D;  3E0J A;  3Q22 A;  4QCL A;  2F0P A;  1HFG A;  3V05 A;  3K59 A;  3HG9 A;  4F7X A;  2XVS A;  2R92 B;  4QUC A;  1TS5 A;  5FO9 B;  1ENF A;  5FKA C;  3PUV A;  1QWY A;  1QOH A;  4PMW A;  2QKI C;  1BDO A;  1G8Z D;  3IFT A;  3A56 A;  2KEE A;  5KGU A;  2CW0 C;  4ZAI A;  1I4X A;  3SR1 A;  4RGO S;  1V1O A;  2J4X A;  1V1P A;  4J8Q A;  5DAU A;  2F3W A;  1XWE A;  4FF4 A;  3H0G B;  1Q90 A;  3GQB A;  1CHP D;  4KTA A;  1Q8I A;  3WDN A;  3GTJ B;  3MA2 B;  1ENA A;  3BVG A;  5COY A;  4K6L A;  2A68 C;  2AUK A;  4DF7 A;  1VDZ A;  4IFD H;  5K36 H;  3PV0 A;  2EOT A;  3ERO A;  2EYH A;  2VB2 X;  2F0F A;  2WAC A;  2E2J B;  1MI2 A;  5JVG 3;  3PO2 B;  5FOB B;  4H44 C;  1Z6H A;  5A35 A;  3KBG A;  4DAP A;  1MBY A;  1EEI D;  1Q1E A;  2F0D A;  1R4Q B;  4IZ8 A;  1AFP A;  1TII D;  2BA1 A;  4A3I B;  1L0Y B;  4OO1 H;  2PNR C;  3VYR A;  5BN4 A;  1KTK A;  3FEW X;  4O42 A;  3RMH A;  4ZUJ A;  5JEA J;  4FF2 A;  3MXN A;  5D65 A;  2NVQ B;  1CA5 A;  3PO3 B;  3J81 L;  1PTO C;  4BY1 B;  4N9T A;  1U4M A;  2NB0 A;  2EYL A;  4ZYS A;  5A2Q E;  4DNT B;  1KLG D;  1QE6 A;  1BCP D;  3F2U A;  3R8B A;  2PYK A;  4XYO A;  3H94 A;  5M5Y B;  1WTV A;  4FXK C;  3EA6 A;  1LT6 D;  4XQN A;  1STN A;  1EL0 A;  1ET6 A;  1SNO A;  1DOK A;  2B2T A;  5C3E B;  3MTS A;  4KN4 C;  3S15 B;  1IKL A;  4CJ1 B;  2F0N A;  2E2D C;  2KEC A;  1NR4 A;  2IX1 A;  1Y69 U;  4FXD A;  1SEB D;  3J80 E;  2D5D A;  2WKD A;  1A3V A;  5FO7 B;  1FGB D;  3Q23 A;  2B2U A;  2MHV A;  4FO2 A;  3OMC A;  4LK1 C;  4BA1 I;  2NVY B;  1EIG A;  1KDA A;  1IL8 A;  1OXS C;  4MN3 A;  1TVX A;  5M5X B;  3G6J B;  4U68 A;  4C2M B;  3D3R A;  4IUV A;  3A7L A;  4K5V A;  4XQQ A;  3M85 A;  1F9R A;  3HOV B;  2KJX A;  2JP1 A;  1AZP A;  4KI0 A;  3M7N A;  1LTT D;  1EWH A;  1AEX A;  4DGZ A;  3M7G A;  4RKB A;  1D5M C;  4FYD A;  3L7Z C;  1IYU A;  2BOS A;  2IL8 A;  1SYC A;  2ZT9 C;  1JCK B;  1PLF A;  1CI3 M;  4C56 C;  3I3C A;  3D8G A;  1ESF A;  4B08 A;  1RTN A;  3C1F A;  2DY8 A;  2K32 A;  2M9V A;  2LY7 A;  3FRP B;  3OMG A;  1C8C A;  4LMQ D;  1D6E C;  2X6L A;  1WTX A;  3P7J A;  4C3I B;  1SNC A;  1QNK A;  2Q8I B;  1O7Y A;  5J39 A;  1VF7 A;  5AFW A;  2MGS A;  3RUZ A;  4A3J B;  1E2W A;  4L8J A;  4R8N A;  1STB A;  4IUN A;  1HTP A;  2IW3 A;  1BCP C;  2AQ2 B;  2HDM A;  1PTO F;  3VR2 A;  1TR5 A;  2EY6 A;  3QG1 A;  1DM0 B;  1U9R A;  5K5P A;  3FDT A;  2R61 A;  3J7Y W;  3RZD B;  3A8J E;  3G7L A;  1IW7 D;  4HCE A;  4CHT B;  4HN7 A;  1MSH A;  3KLS X;  1ICW A;  4YIJ A;  3NSW A;  5EKL A;  4A3B B;  2FIN B;  1STY A;  3VR3 A;  3Q24 A;  4F87 A;  3GTQ B;  4HSP A;  2CVR A;  1DXM A;  2PPB C;  1FNU A;  1B53 A;  3OSO A;  5LL6 X;  4H0L C;  5G3L F;  2RVL A;  1L0X B;  1EYC A;  1LTB D;  3D6W A;  4XTC S;  2KVM A;  3RD4 A;  1Y1V B;  1PRT B;  1I6H B;  3S1Q B;  2C9O A;  1C48 A;  3V96 A;  4K8I A;  3PMF A;  3URY A;  3OIP A;  1F2Z A;  1SJH D;  1D1K A;  3TP8 A;  2XN9 C;  3A55 A;  2F0E A;  1BCP B;  1JWM D;  4WJW A;  2XRS D;  1WTR A;  2Z4H A;  4ZK9 B;  1XYI A;  3GP7 A;  2F0S A;  3OHX C;  1HPC A;  5IGD A;  1B1Z A;  3S14 B;  4B9X A;  1SXT A;  2K28 A;  5JPN C;  1BOS A;  1PRT F;  4ABN A;  3PUY A;  5IOD A;  1EY4 A;  2B8G A;  5CV6 A;  1VMC A;  1PFB A;  2LKV A;  5E4X A;  1BBX C;  4RA8 A;  3DUZ A;  4WOR A;  2NN6 H;  3HZX A;  1JOR A;  2MP1 A;  2E2H B;  1DOL A;  5CC4 A;  5JEA H;  5KYI A;  3PUZ A;  2XWB B;  3EJI A;  1I50 B;  3SK5 A;  2GA4 B;  5D3I B;  4RGM A;  3M3Y B;  1A3T A;  2L12 A;  1HQR D;  1OXU A;  2TMP A;  3TP7 A;  1JB3 A;  2DN8 A;  2JEA I;  2Q8R E;  2M00 A;  4K6D A;  5COR A;  2NZ1 D;  3MXP A;  2PMZ B;  4IUR A;  5KEE A;  1I3Q B;  4CJ2 C;  3P75 A;  4FF1 A;  5CBA E;  4N9P A;  1B4O A;  5JOB A;  1CFM A;  2R93 B;  1JOQ A;  2L1B A;  5CV7 A;  3RZO B;  5EBC A;  1T5E A;  2CW0 D;  3L3O C;  4NW2 A;  2F0W A;  3D4W A;  2A69 D;  3BVZ A;  1NCV A;  1HUN A;  4A3D B;  1S5C D;  2SOB A;  1A15 A;  1OO9 B;  2Y0S B;  1I4G A;  3BYT B;  2G9D A;  1GUW A;  1HXY D;  3GD7 A;  2F0L A;  2PCF B;  1BF4 A;  2E2I B;  3CU7 A;  5KIX A;  3JAM L;  2EYJ A;  2QIL A;  3DXJ C;  4KHZ A;  2WAQ B;  4ID6 A;  3OWF A;  1Q3L A;  4CKE A;  2B8F A;  5KYL A;  2L5T A;  5CV8 A;  3CRL C;  2E76 C;  5C5L A;  4QF4 A;  2XNA C;  3PIO 3;  2EJM A;  4C3J G;  3KF8 A;  1S5D D;  1W6K A;  2B2W C;  4K8J A;  2VNU D;  1D1I A;  2IPK D;  2DNE A;  2NTS A;  5FO8 B;  5JJZ A;  3QO2 A;  3N52 A;  4S3S A;  4O1N A;  1Y8P B;  1HRJ A;  1G91 A;  2ZXP A;  1A3U A;  4ZKB B;  2F0T A;  2AUJ D;  1FNV A;  1CQV A;  4KY6 A;  1Y8N B;  4KK7 A;  2NWG A;  2WII B;  5KNB A;  5ISR A;  4DN4 M;  4C3H B;  4BBR B;  1F9Q A;  2NN6 G;  1ET9 A;  3VYT A;  1TS3 A;  1HUM A;  2ZXO A;  4PNY A;  3VA7 A;  2BA0 A;  1QIL A;  1T5X D;  1ONL A;  3AU7 A;  3QJY A;  1BR9 A;  1AP0 A;  3C3L A;  2RBM A;  1EU3 A;  3J7A V;  5LHY 1;  1DCZ A;  3K5N A;  4G7O C;  3HOU B;  1PZJ D;  4I7Z C;  1KLU D;  1TWF B;  3T13 A;  1UEA B;  4L63 B;  1BQQ T;  4ZQ3 A;  3SHL A;  3LWE A;  2ENB A;  1R4P B;  2K5D A;  1G29 1;  3LNN A;  5EKK A;  4DK0 A;  4HED A;  3NBI A;  2DY7 A;  1Y1W B;  3GO5 A;  1F2L A;  1KDB A;  3EFX D;  3NQT A;  2PW5 A;  4G7H C;  3IFD A;  4KD3 A;  1ESR A;  2EY1 A;  1S5B D;  4HTH A;  3QWN A;  4CGY B;  2WV6 D;  3ONA B;  1GJX A;  5HGT A;  4K14 A;  5IOC A;  4PQX A;  1H9M A;  2NN6 I;  3MXG A;  3H09 A;  1SE4 A;  2KOL A;  2I46 A;  2O2L D;  1WVL A;  4KKS A;  5I6W A;  1RDP D;  4XT3 B;  4WFN 3;  2YYZ A;  2WP8 J;  4A3G B;  3TSS A;  3X3M A;  2PO4 A;  4FP5 D;  3NK9 A;  5LL6 S;  4RGT A;  5C0X I;  2F0U A;  1O7Z A;  2V4D A;  1VF5 C;  4A3K B;  1RCV D;  5C4Z A;  2O5I C;  3HRZ C;  1GXD C;  2ID0 A;  3NP8 A;  2F0V A;  3DWA A;  1HCZ A;  2FMM A;  3K6O A;  1TY0 A;  5M3M B;  3T16 A;  2B2Y C;  3A7A B;  4DK1 A;  1EOT A;  1SE3 A;  3LX0 A;  1TS2 A;  2JA6 B;  2E74 C;  2EJG C;  1FR3 A;  4X3K A;  3CHB D;  4M8A A;  5KRU A;  5IIF A;  3PUX A;  5IT9 L;  3TP5 A;  4ILW A;  4EGV A;  1JWU D;  2NBF A;  2IWH A;  5EQ0 A;  1TWC B;  1CZW A;  1S5F D;  3HEJ A;  5CR3 A;  2A6H D;  3V2T A;  3W2D A;  2IX3 A;  3SEB A;  2A68 D;  2B2U C;  2F0J A;  3DM1 A;  5I6Y A;  1PFM A;  4ULL A;  4CKC A;  1SSO A;  4HCS A;  2JXM B;  1B3A A;  1D2B A;  1JR0 D;  4KV6 A;  1PFN A;  3I8Z A;  3NTI A;  1ZYR D;  1ZKO A;  5T1I A;  5IGE A;  5CYU A;  2X69 A;  2SDF A;  4V19 0;  2HDL A;  3HGB A;  1JQY D;  1GHJ A;  1PZK D;  5FLX E;  2D2C C;  3A54 A;  2K1B A;  4IUU A;  5I9O A;  1LTR D;  3NQI A;  4PV1 C;  3SVM A;  1XXG A;  3MEH A;  1BXT A;  4LJZ C;  5T1G A;  2RSN A;  5C0X H;  1YNJ C;  4H13 C;  5C5M A;  4K2K A;  2NVX B;  3HOX B;  2QEJ C;  1H9R A;  5I4D A;  5KND A;  2ICI A;  1SYG A;  2L0C A;  2MPM A;  4V0B A;  4HSV A;  4DFA A;  3I72 A;  5G3L D;  2F0K A;  4RFB A;  1I4H A;  5CGK A;  2EY5 A;  3MWY W;  5IGF A;  1F9S A;  3SK8 A;  2AWO A;  2K6A A;  3GTL B;  5I2X A;  2B2Y A;  1QCB D;  5IGB A;  2AWN A;  5HUR A;  2OXP A;  5C4H A;  3HP3 A;  1WTO A;  1AN8 A;  5J1Z A;  5FLX L;  1A6X A;  1EY9 A;  2A69 C;  3DWP A;  3MZ5 A;  4U67 3;  4E6I A;  3CKI B;  4PMC A;  1EY6 A;  1EZ8 A;  3T51 B;  3H3V C;  1LTS D;  3S17 B;  1PTO D;  2C5C A;  1AW7 A;  4G4K A;  1U4P A;  3HOY B;  2XWJ B;  2IJ0 A;  2WKC A;  2EY2 A;  3RLF A;  4ZRZ A;  5FK9 C;  5M9O A;  4OGQ C;  5JVH 3;  1KNA A;  3KLR A;  1IW7 C;  2KHS A;  3MVV A;  1EQT A;  1EYA A;  2OF1 A;  4B9W A;  2FFK B;  2LS0 1;  5C0X G;  3NUC A;  3K7A B;  3C2P A;  5CV5 A;  2L4N A;  1CTM A;  1LAC A;  4IQZ A;  2CQA A;  1STH A;  3M4Y A;  5NUC A;  5EPL A;  5EBD A;  1V1P B;  3KBX A;  2B2T C;  1SMY D;  3MXU A;  3S1M B;  4IFD G;  1GOZ A;  2F4I A;  1SND A;  3FKI B;  1IHZ A;  1NUC A;  3Q0A A;  3CRK C;  1EY0 A;  5C4J B;  2ICE C;  3IL8 A;  4TKO B;  1LO5 D;  3FVQ A;  3JAM E;  4IUQ A;  3TME A;  1M4V A;  4HMJ A;  4X3U A;  1AZQ A;  1PTO B;  3FPP A;  2OEO A;  2JEB I;  4FVM A;  2N55 A;  1W6J A;  5ELC A;  3K58 A;  1LTI D;  2RA4 A;  1X3Q A;  3C1E A;  3NTH A;  4UDU C;  1B9M A;  1WTW A;  2KCN A;  3FPU B;  3TZD A;  3NWT A;  4KY5 A;  1OXX K;  2JA5 B;  3TN2 A;  2TSS A;  1SAP A;  4KY7 A;  3D31 A;  1OXT A;  1TT2 A;  3R2I A;  2RDF A;  3K57 A;  3D6C A;  1SMY C;  1GUG A;  2EJF C;  4ME5 A;  3HOW B;  4X3S A;  5CV9 A;  2EPB A;  2Q8T A;  4DAY A;  3T4A C;  1ROD A;  4G57 A;  1I4P A;  1A2U A;  1LAB A;  1QJO A;  1I4Q A;  3FMC A;  2Z1C A;  1CHQ D;  4IFD I;  3I73 A;  1SYD A;  1RF2 D;  4XXE A;  1BO0 A;  1K83 B;  1LT4 D;  3DEO A;  2K5Q A;  5IGC A;  1SBB B;  4BWG B;  2I07 B;  3BYY B;  2EDG A;  4RH6 A;  2AQ3 B;  1G2S A;  2Z8L A;  3OOC A;  4LAA A;  4KMU C;  4RWS C;  3I4N B;  1B50 A;  1ENC A;  3OW7 A;  3BDL A;  4QUF A;  1XX8 A;  1I6V C;  1D5X C;  1STE A;  1VMP A;  1VCI A;  2K33 A;  4A93 B;  2F0H A;  2A74 C;  1KDC A;  1HQM C;  1TKW B;  1DON A;  1I4R A;  3SXH A;  1JOK A;  1ILQ A;  3MHB A;  1B44 D;  3HKZ B;  2XSC A;  1MD2 D;  4R8I A;  1OXV A;  4J1M A;  4IN3 A;  2BE5 D;  3OWE B;  1PZI D;  5J22 A;  1FD7 D;  4C1N K;  3DHQ A;  3TBI B;  4UAI A;  1K8M A;  5TSS A;  2F1M A;  2B63 B;  1C4Q A;  4CJ0 B;  3HS0 C;  3IAY A;  4P2C B;  2F0M A;  3T56 B;  3AB9 A;  5KNC A;  3ND8 A;  4K2L A;  5C44 B;  3TZU A;  2HQE A;  4RGN A;  3GTK B;  1Y8O B;  4PMB A;  3SK4 A;  1KAB A;  4NDX A;  1ML0 D;  5BN5 A;  4WRD A;  2MJ8 A;  1WCM B;  4I65 A;  3NXW A;  2A73 B;  2NUC A;  3DWQ A;  3S2D B;  4JBW A;  3UI2 A;  1XTC D;  2A6E C;  2FJ2 A;  3MFG A;  3N6R A;  2SNS A;  1D5Z C;  4OO1 I;  1FNW A;  1E2V A;  3QB3 A;  3NE5 B;  2KQ3 A;  1GUS A;  4HAE A;  3NWS A;  1TWH B;  1II3 A;  4RCN A;  1RKN A;  3ND9 A;  4NKL A;  3BDO A;  4MHE A;  2J0T D;  2PW7 A;  4KN7 C;  4DAV A;  3DMU A;  4XQJ A;  5DNF A;  1G6Z A;  3P20 A;  1JIC A;  1K8O A;  3VR5 A;  3A8K E;  1NAP A;  4IUP A;  3W3A A;  2EZV A;  4TRD A;  4J6H A;  5EJW A;  3EVQ A;  1QB5 D;  1WTQ A;  3I4L A;  1YNJ D;  4BA2 I;  3VA5 A;  1F77 A;  2N88 A;  3S1N B;  2MUY A;  1SYE A;  2A6H C;  1GUT A;  5EGT A;  4RKL A;  3S9W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...