2DY8A

Solution structure of the second chromodomain of yeast chd1
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
69
structure length
69
Chain Sequence
DEFEEFHVPERIIDSQRASLEDGTSQLQYLVKWRRLNYDEATWENATDIVKLAPEQVKHFQNRENSKIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Hydrolase
molecule keywords Chromo domain protein 1
publication title Structural Polymorphism of Chromodomains in Chd1
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 11
structure length 69
sequence length 69
ec nomenclature ec 3.6.1.-:
pdb deposition date 2006-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2dy8A00
5DNFA 1EQTA 2FHTA 2RA4A 4HSVA 1O7ZA 5T1IA 4RWSC 2FJ2A 1AP0A 1CM9A 1ZXTA 1B2TA 1B3AA 1DOKA 2DY8A 2HCCA 3TN2A 1X3PA 1AZPA 1RJTA 2JP1A 2X6GA 5JJZA 1WTQA 3R93A 3Q6SA 1WD0A 1C8CA 2B2YA 1J8IA 3FDTA 1WTXA 3GV3A 3DEOA 5D14A 1G2SA 1WD1A 1HA6A 5D65A 1EOTA 3I91A 1ILQA 2B2VA 1F2LA 1TVXA 1G91A 2NWGA 4X3TA 4X3SA 1JICA 1VMPA 4ZKCB 2D9UA 4XDXA 1IL8A 2Q8RE 1NCVA 2K28A 4ZAIA 2MP1A 1WVLA 2K05A 4OIKA 4ZK9B 5CMDA 1B50A 2B2UC 2FFKB 1F9PA 1B53A 1XYIA 1WTWA 2L1BA 1BF4A 5E4XA 3MTSA 5CORA 3I3CA 1DOLA 1HFNA 1X3QA 2MGSA 4OIJA 2L4NA 2HUGA 2NYZD 2JYOA 3GV6A 2DY7A 4NW2A 1BNZA 2CVRA 5EJWA 1QG7A 2X6LA 3QO2A 1PLFA 2L11A 2RSNA 1G6ZA 5EKIA 2X69A 2EOTA 2FINB 3F2UA 2BDNA 2B2TC 1MSGA 2FMMA 1DOMA 4MN3A 4RAUC 5CBAE 1F9SA 4HCSA 2K1BA 3IFDA 1MSHA 4QUCA 1HHVA 4LMQD 1WTPA 2HDMA 2KOLA 1DZ1A 4XT1B 1VMCA 1RTOA 4CJ2C 2RVLA 4ZLTF 1ESRA 3G7LA 1CA5A 2R3ZA 1BO0A 3LWEA 2L9HA 1BBXC 1ILPA 3TZDA 1RODA 1SSOA 1QE6A 3I8ZA 1EIHA 4MHEA 4HEDA 3I90A 4RA8A 1NAPA 2K04A 1MGSA 2M2LA 3KUPA 5EQ0A 1QNKA 1GUWA 1S4ZA 4XT3B 1E0BA 2B2UA 2SDFA 4HAEA 5COYA 2MJ8A 1HRJA 1Q3LA 1SAPA 1ML0D 2N88A 2K03A 3HP3A 4O42A 1PDQA 1X32A 4X3UA 2KEEA 1J9OA 1NR4A 3P7JA 4IUPA 4IURA 1PFBA 3ONAB 2J7ZA 2VXWA 1JE4A 3DEPA 3N52A 3IL8A 1CA6A 1B4OA 1A15A 1F9RA 1ICWA 2B2YC 4X3KA 3DM1A 5EPJA 1U4MA 5EPKA 1WTRA 1NR2A 2HDLA 4CJ0B 2RSOA 2KVMA 1AZQA 2KUMA 1EIGA 2B2VC 1IKMA 1RTNA 2HCIA 2KEDA 1RHPA 1O7YA 2B2TA 3FPUB 3H91A 5AFWA 2EE1A 1U4RA 4CJ1B 1PFMA 2B2WC 1EL0A 1LV9A 1MI2A 2MPMA 1WTOA 1G2TA 2H1EA 1KNAA 2L12A 1WTVA 1IKLA 4QUFA 1U4LA 1O80A 1XX8A 4IUQA 1F9QA 1KNEA 2EPBA 4R9WA 4IUUA 1HFGA 4U68A 4IUVA 4ZKBB 1U4PA 2XIWA 3KBXA 4IUTA 4UAIA 5T1GA 3UI2A 5CBEE 1DONA 4R8IA 3D6WA 2B2WA 5EPLA 2NZ1D 2Q8TA 2IL8A 2K01A 1PFNA 1HUNA 1HUMA 2KECA 3MWYW 2N55A 5E4WC 3SVMA 1SDFA 4DN4M 1M8AA
chains in the Genus database with same CATH superfamily
4N9TA 3S2DH 5E3FA 5EBDA 4KD4A 4A3GG 4LFCQ 4YY3L 2MQHA 1IBML 1IHZA 3NTKA 1ONLA 2VB2X 4G4KA 2F0IA 1N34Q 4A3FB 1OXXK 3DHQA 1I50B 2LMCB 3SHLA 3T1HQ 3OPOA 5LMNQ 4DUYQ 3E0JA 5C0XG 4LK1C 3J81c 3PO2G 4H13C 4X3SA 3I4NG 1S5FD 5IGGA 4B3TQ 3D4RA 4YCVA 3LX0A 4PQXA 1P8LA 4QF4A 4DR1Q 3OW2A 2J0TD 1BF4A 2R6GA 2JA7B 3CMAA 4A76A 4LWCA 3I3CA 1XXGA 1V43A 1X6OA 3S1MB 4DAVA 2CVRA 1K8GA 3VA7A 4JG2A 1PVOA 1SN8A 1SYFA 1S40A 3QO2A 2BE5D 1SNOA 3C46A 1K0SA 5DAUA 3WDNA 1Q7YC 4ZLTF 3E6ZX 1VQIA 2NVXB 1JORA 2B63B 3S9WA 3GTLH 1JJ2A 1SSOA 3GTPB 1AE2A 1QE6A 3PO3G 4APVA 3ULPA 2Z1CA 2UU9Q 4KTAA 1PH9A 5IYDG 2R7ZB 1JOKA 1S4ZA 5IP7H 1I3QB 5COYA 4IJLA 4O42A 3QIAA 3KDFA 3P1HA 2Q2TA 2C35B 1K83B 5C4JB 2K6AA 5M3MB 2KA7A 2XWBB 1PFBA 3ONAB 2HIVA 1XNRQ 5M5XH 5FLXc 1MJCA 2B2YC 1GHJA 5ELBA 4DV6L 2ICEC 2K5DA 1AZQA 1X3EA 2VS1A 4DV2L 1E2WA 2HQLA 3J81j 4IFDI 1HZAA 5I6YA 3FPUB 1GHKA 2EE1A 3MXGA 3C1FA 3HOXG 2Z4IA 1QUQA 4LW1A 2I5MX 4E6IA 1CT1D 1HNWQ 1XX8A 1SNQA 1HUNA 4KKTA 3PSIA 1O7IA 1EIYB 3TREA 1FGUA 1QVGA 4B9XA 1O78A 1CSPA 1TQOA 2O5IC 5M3FG 1ENCA 2D0OA 3BYTB 1BOSA 1BBWA 4PMBA 5C4XB 4GLAC 2MNAA 4KMUC 3U58A 4KY6A 1WD1A 1EFWA 3M4OB 1BVSA 4WRDA 2ZM6L 3HOYG 5JJLA 1G91A 1SRUA 5TSSA 4JI0Q 1C4QA 4LNQA 2L55A 1I6HB 2DJFC 1TS4A 4ZK9B 3UDGA 1EY0A 3W3AA 5CC4A 3FHWA 4ILWA 3CPWA 1N36L 4I7AA 2BA0A 3J80E 1I4XA 5I4DA 4BBSG 5KIXA 5EBCA 3WOEA 2QKIC 1B9MA 1S5ED 1K8AC 2YTYA 4HJ9A 5CV8A 1HR0Q 1XNQQ 2BDOA 3RLOA 1WYDA 2L11A 1VQ4A 3RLFA 1CQVA 2MFIA 4CKBA 2PPBC 1YIJA 3GTQB 3H3VH 1UWVA 3S14B 2WAQG 2NUCA 1HQMC 4LMQD 5IP9G 4DV6Q 1WTPA 4PV1C 1ESRA 3CKIB 3G71A 4MTNA 3TS2A 4LUVA 4DV2Q 1K3BC 1BBXC 1B9NA 2EJFC 1FR3A 1K73C 1EIHA 3A7AB 4RA8A 1NSNS 2ZXRA 1NMGA 1VQ6A 1UE7A 1ASYA 5C3EH 4DR5Q 3KF6A 4RH6A 3TSSA 5ELFA 4QQBX 2O4XA 3ND8A 3NE5B 3N6RA 1NR4A 2E2JH 1E1TA 3HZXA 2F03A 3N52A 2BOSA 1F9RA 3VYRA 2JE6I 1ICWA 4DV4L 4OONA 1N9WA 3E5SA 1VQJA 5ELNA 5IT9E 1LO5D 3NPPA 4ZUJA 4TRDA 3F2BA 2PZTA 3PUXA 2PZUA 4NXNL 3J81L 2PW5A 4A93H 4C2MH 1UE1A 1S5BD 1II3A 4OELB 3NQTA 3A55A 4IUTA 1IYVA 5LL6S 5FO9B 3SR1A 1E3PA 4XQNA 4A3MG 2C5CA 5IE8A 1PRTF 1EQVA 5DNFA 1PH2A 4HSVA 1A3UA 1YNNC 2Y0SE 3VR2A 1B3AA 2HCCA 2DY8A 3M7NA 1AZPA 4NPSA 1RJTA 2KHJA 1GUNA 3VR6A 1EWIA 1BCPF 3NWSA 1GUTA 4N8X1 2B3GA 1RIPA 1HNXQ 1ILQA 4LF4L 5G3LD 1LYLA 4JK1C 5M5WH 4XDXA 3VYTA 5CV5A 3HOXH 5JVG3 4DAPA 1EWCA 3A56A 2RDFA 2UUAL 3PV0A 3ND9A 2M9VA 2KQ3A 1SYEA 4GKKQ 4KJNA 3HG9A 1BNZA 1ET9A 4L63B 4BWGB 2Z6KA 4A3FG 5IWAL 4V190 5M3FH 2A6ED 2WINB 3HOVH 5FLXL 3CD6A 4LF8Q 4JI2L 3W1GA 3I7FA 2BDNA 1TY0A 2FMMA 4FVMA 3OTOL 1S3OA 4DV4Q 1EY7A 3I56A 4HJ5A 2E2IB 1DZ1A 1PTOB 1CA5A 4A3IH 2JA7G 2GVAA 3G7LA 1FYCA 2L9HA 3KYHC 2EIFA 3MHBA 1OTCA 2EYOA 1YITA 2L5TA 3R2IA 3KUPA 4XYQA 5EQ0A 3H0GB 2F0OA 4J8QA 2B2UA 4X62Q 5J3BA 4TQUS 1HRJA 5BN5A 2I5HA 4OWXB 5C3XA 3CCMA 2R93G 2Y0SB 1I94L 4LUOA 2SNMA 1LT6D 4UPAA 5I6WA 2J7ZA 1C48A 4UHVA 1K0RA 2IPKD 5FJ8H 1UEBA 3P20A 2IJ0A 2PQAB 2RSOA 4K8IA 1KDAA 1X65A 4JBJA 1VQ5A 1IYJB 2R7ZG 4R4QA 1U4RA 2I5LX 3R3OA 2ZJQA 4PZ8A 2R92B 1K9MC 4KHPL 4RGMA 5C5MA 2EYLA 4JV5L 3H6MA 4DFAA 4GNXA 5M3MG 3CQZB 1G51A 4KI0A 5A35A 3UI2A 3G6EA 3S1RB 4C3HB 4R8IA 5J39A 3KLRA 4MNOA 2DNEA 1LTTD 1EQTA 1O7ZA 1HQRD 1A6XA 1I5FA 2FJ2A 3L3OC 1STYA 4LF7L 1W2BA 4A3GB 4XTCS 5J1ZA 1RD9D 4A3JG 1EOTA 1DGSA 4J6HA 1ENAA 3TP7A 1T5XD 2G5DA 1WVLA 2V4DA 3EFXD 5IGFA 1IW7C 1IL2A 1B53A 1SE3A 4O1NA 3TRZA 1SE8A 1QZHA 3CC7A 4A3EB 2QILA 3NUCA 5C4XG 4HSPA 2DY7A 2XTIA 3S16B 5JJKA 3HOZB 4BBRG 1AE3A 4LF6Q 5CV7A 2X6LA 3GQBA 1WI5A 1IBKL 4EQPA 4EVOA 3E9IA 1KDCA 1TWFH 3OW7A 1F77A 4LFBL 4KD3A 4IPGA 2B8FA 2NZHA 3PIOA 1ZYRC 4MZ9A 1UE5A 1RTOA 1FD7D 4ZUIA 3A8JE 2PCFB 4PMCA 4WORA 1RODA 2B29A 1T5EA 4DAMA 3NXWA 3FKIH 2M00A 1NAPA 3PO3B 4DA2A 3TEHB 4XT3B 5JPMC 4JV5Q 4IPHA 1FGBD 1B44D 1WTHA 2OT2A 3I4MB 4P72A 3L9AX 1Y1VH 2JA5B 2OF1A 3JAMc 4RHRA 4B3SL 2A1AA 4R8NA 4B3RL 2CWPA 4A3FH 1JMCA 4TKOB 4GZYC 1I50H 3ULJA 4F88A 1G8ZD 4C1NI 4YHHQ 5JEAG 1FJGL 2A6HC 1E22A 3A54A 2PMZE 1Y8NB 4IUNA 4RGNA 4ZYSA 5AFWA 1JJGA 1B3QA 5C0XJ 1I4HA 1SJHD 3KF8B 2ZTDA 2PI2E 1XPOA 1EOVA 4CDDC 1UE6A 4DR2Q 1EFID 3SK8A 2DGYA 2F1MA 4DK0A 4QL5A 3MEFA 1L1OC 3I72A 5E7NA 4JI3L 1Q90A 1EY8A 4IO9A 5T1IA 2CHBD 4R4CA 4P73A 5K36H 1D7QA 4IJHA 2NVXH 4PNYA 1L0XB 2B63H 1IBKQ 1JWMD 4B3ML 1EYAA 4BY1H 2K5WA 2EYHA 2B2VA 1N33Q 4A3LH 2R7ZH 2J4XA 4I65A 4LJZC 5CV6A 1EWHA 1I4RA 2TSSA 3C1EA 3K5NA 3OOCA 4ZCKA 1CHPD 1I4PA 1JWUD 1L1OB 1K83H 1Q1EA 3X3MA 1KAAA 3K57A 3UE0A 4K8JA 2IX3A 1HFNA 4DAYB 4HIMA 2HUGA 3AMUA 1EUJA 3OMCA 2JSOA 3ITPA 2CH4W 1GO3E 4ALPA 1O7LA 3CRKC 5LL6X 1Q46A 4F7XA 1DXMA 2PMZB 2EOTA 4DV3Q 1NUCA 2AUJD 4WJWA 1GOZA 1CTMA 2B2TC 4NXML 2CKZB 2A8VA 1H9MA 1Y1WB 1LUZA 2AHOB 1F2MA 5AJ3Q 1AH9A 1TS2A 5KRUA 1PH1A 3W2DA 4BXXG 2AQ3B 2C9OA 2P5ZX 1PRTD 3D8GA 3H94A 2ZJPA 4OO1G 3PGZA 4IPCA 2JQOA 3EVQA 4H02A 2H4OA 3BYYB 5GADC 4Z9CB 4Y7NB 2UXDL 5C4XH 1BCPD 2QF7A 1H95A 2AQ2B 1GUOA 4JI3Q 5GQOA 3S1NH 1EZ8A 3M4OH 3STBD 5IIFA 2ZXOA 3S15B 4JCVE 1TWGH 4OL7A 3VR4A 1I6HH 2KEDA 2VW9A 3H0GG 3NBHB 1V1PB 2B2WC 2F0GA 4LF5L 1LACA 5M5YB 3IRBA 4GKJL 2EQSA 3CU7A 1SYDA 2Y0SG 4HR7B 2XIWA 2BH8A 3D6CA 5T1GA 2ASBA 2UXBQ 1J6QA 4LAAA 2E2HB 3J81i 2K5QA 5IYCG 3MXUA 4RKLA 2KECA 2NVYB 2YTVA 4DK6C 2TMPA 1G2SA 2PNHA 4A3MB 3SE0A 1XMQQ 3W5OA 4LF9L 1HJPA 1DOKA 4KKSA 3ULLA 5JPNC 2R92G 5JJZA 3Q6SA 1EIFA 2OEOA 1PV4A 2ALYB 2F3WA 3I91A 4C3HG 4IOAA 4X3TA 4MTKA 5GAGC 3EJIA 4DU9A 2NVTB 1NCVA 1J5EL 2HQEA 3QR8A 4KKUA 1B50A 2WACA 2K7VA 4UP8A 4KN4C 5H1SE 2ICIA 5E1FA 1QNUA 4FF3A 1D5MC 5F2DA 4ZRZA 1S72A 2L4NA 4KV6A 3JAML 2F0FA 3HOUB 3CRLC 2JN4A 3OMGA 2ENBA 2UUBQ 4KHZA 2F0NA 1OXVA 4C3IB 2EXDA 1JC7A 4X66Q 2WV6D 2JA6B 1LM0A 1FNVA 3C2PA 1DOMA 5CBAE 1F9SA 1XMOL 2XRQD 4QUCA 2JA8G 4A3EG 3UDXA 4A3CH 4DUZQ 3I8ZA 1UAPA 3HOZG 4PMWA 4GKJQ 4K0KQ 4HAEA 2E5LL 3O13A 1ML0D 4IALA 3BS1A 4DR4L 3R8BA 1XPRA 1N32L 4N8FA 2PNRC 1CUKA 1X54A 3K5LA 2YV5A 2R93B 3AFQA 3IL8A 2HHHQ 2RCNA 4BY7G 3DM1A 5EPKA 3B6YA 4X64L 2F0SA 2K50A 3TP8A 2Q2IA 2OCEA 2ID0A 3WOFA 1NBWA 3CP0A 3I4MG 1Z7TA 4JOIA 2L12A 3K7AB 5I9OA 3L2PA 2JA5G 2N3SA 4K5VA 4R1JA 3K5OA 4IUUA 3J80c 3TDQA 3M4QA 4OO1H 2NB0A 5EPLA 4JI5Q 1NE3A 4K6DA 2XVSA 4F87A 1DJRD 1L0YB 3PUVA 3A0JA 4YY3Q 3S1QB 1IBMQ 4NB3A 1GM5A 3V05A 3UDIA 1PTOH 4RFBA 1L0WA 4IPDA 1YNJC 3DEOA 3FVQA 1EU4A 5D65A 1TIID 4YWKA 3VYSA 1GUGA 1TVXA 2F0LA 2R7DA 4A3JB 3H0GH 1JICA 3GTMB 4DV5L 4ZAIA 3KJOA 2F0UA 3NENA 1LTAD 4NDXA 2FFKB 2YU9B 2A68D 1RDPD 5E4XA 3MTSA 2YYZA 1DCZA 4JBMA 1LLRD 3QJYA 2JEAI 2OTLA 2UXCL 4HJAA 4DR7L 2AKWB 4BBRB 4QB4A 4L5RC 1D1KA 5IT9c 3H3VI 2Z6BA 2IT1A 4BA1I 1PMRA 5KNBA 2R92H 2EY1A 5KYLA 4JYAL 1TWAH 4HCSA 2F0VA 2RCFA 1U5KA 3CQZH 2VUMB 1VMCA 5IGEA 1HTLD 1PYWD 3S1RH 3KFUA 4WJ4A 1BQQT 1SNDA 1LTGD 2RDHA 3T13A 3KDFB 4X65L 1PZID 4I7ZC 2Q8IB 1SBBB 1C7YA 2SDFA 3M4PA 5KEEA 2LXKA 4LFAL 3HKZE 4A3GH 2KEEA 4DV0L 1Y1WG 1JE4A 3F2DA 2K32A 2RDGA 4GLVB 1KABA 2E76C 3GTOB 1NR2A 1QUQB 3I55A 5C0XH 1JT8A 1QVFA 1MHWC 1QOHA 3PO2H 4A3DB 3I4NH 1KL9A 1RHPA 3T53B 3A5UA 3H15A 3CW2C 1HNZL 3J7AF 5BR8L 3RUZA 5CV4A 1VQCA 3HOWG 4IUQA 2RF4A 1KNEA 1S5CD 1H9SA 2VQFL 3KBXA 4QMGA 3S16H 1KD1C 3HOZH 1PHJA 4P2CB 1LT4D 1SFOB 3GTGB 2EYMA 2IY5B 2IL8A 1VQ9A 4JC0A 4EGVA 3SVMA 1QILA 5GROA 1Y8PB 1KLUD 5JVH3 4RWSC 5GAEC 1BR9A 1E7ZA 4DKAC 4IOCA 3RZOB 1FNWA 2UXCQ 5DLQE 1C8CA 1BKBA 2PW7A 5KYIA 3RD4A 2ZM6Q 4ULLA 1YNND 3PO3H 3S2DB 1VMPA 2MHVA 1H9RA 4JYAQ 1RCVD 4FXDA 5IYDH 3SXHA 2HD3A 2K75A 1N36Q 1CKOA 1CKMA 3NEMA 2VB3X 3TQYA 1YHBA 4OWTB 4X65Q 3GO5A 1D1IA 3HKZB 4OIJA 2JXMB 1Q12A 1Y69U 1PTOD 1KDBA 2KENA 3Q22A 1JOQA 2G9DA 4Y52H 1VF7A 1G6ZA 1LTBD 2EVBA 5JEAJ 1MIUA 1MSGA 1H9JA 4R4IA 1KXLA 4L8JA 1VQOA 1CZWA 1XPUA 4DR3L 1YZ6A 2RVLA 2I0QA 2E75C 2NN6G 1QZGA 3CCLA 2LSSA 1Q1BA 4ODGA 3KF6B 1EQRA 3HOUG 1EU3A 2K04A 3J80L 1Z9FA 4A3KB 3R2TA 1E0BA 2MUYA 1A62A 4C3IG 4JI4L 2CW0C 2JA6G 4F8MA 3DM3A 3CCSA 1Y8OB 3GTLB 4X3UA 2XNAC 4OHJA 4CHTB 3E0EA 4P75A 5ELOA 1A15A 5ELEA 4QJFA 2A69D 1LT5D 2EY6A 3LNNA 1XTCD 3HOYH 4NKLA 1ICFB 2G9HD 1D2BA 3D4WA 5BN4A 4NXNQ 3NWTA 5CR3A 4AQYL 4DNRB 1WTOA 1XTDA 2EXZA 1HFGA 1U4PA 1JB3A 2GA4B 4BBSH 3S2HB 3OIPA 2Z6KC 2K01A 1PFNA 2KHIA 5E4WC 4DXGA 1LTRD 2ES2A 1CM9A 3CMEA 3S24A 1VQLA 3TN2A 1ESFA 5IT9L 2X6GA 2EZVA 1X3FA 3EQLC 1RL2A 5IP9H 5KNCA 2QEXA 1WTXA 2QEJC 2VNUD 4OEMB 2SNSA 1E24A 1F2LA 5KGUA 4LF4Q 1X55A 2I46A 3CCRA 5DM63 2JEBI 2JK8A 2F0EA 2KBNA 4DR3Q 4WJ3M 2K05A 3BZKA 3NELA 5FK9C 2B2UC 2PYKA 2UUAQ 1KC8C 2L1BA 1I4GA 5I9PA 3CCJA 2MGSA 2F3IA 1VCIA 5IYBG 1YHQA 5IWAQ 3P75A 1OXUA 1X3GA 3M9BA 3ZJYC 1PFSA 1JE5A 1IW7D 1STAA 4P71A 3T51B 1TWHH 1B7YB 2O2LD 1SE2A 3J7AV 4JI2Q 1E2ZA 2DN8A 4DNTB 1SR3A 4DV7L 5M5YH 2FINB 3JAMi 3OTOQ 5LMUL 3BG3A 2K1BA 3IFDA 1MSHA 1YEZA 1FL0A 3MC0B 1L2FA 2OXPA 3VR3A 2R3ZA 3QB3A 4GNXC 3BZCA 3CCQA 1GUSA 2JA8B 2E2HH 2N49A 1ILPA 1BBUA 2IX1A 2AWNA 3NQIA 1D6EC 4Q0FA 5A2QE 2M2LA 2NVYH 1EY6A 2QCPX 4UY8C 1UUPA 2EYJA 2RHSB 4WFN3 5JAVA 4A3MH 1ZYRD 3BVMA 1SAPA 3BZDB 2QDLA 3HFZB 4K14A 1I94Q 2F0TA 3VDYA 3L0OA 5HGTA 2L15A 2VUMG 1W6KA 4JI6L 3A74A 3I73A 2HDLA 1KQSA 4Q5VA 1TU2B 4BY7B 2F0MA 3MEHA 5IY0A 4OGQC 4GNXB 1PFMA 2E2JB 1STNA 4GS3A 5FLMG 4FF2A 4KHPQ 1CKNA 4PZ6A 3PF4A 2NN6H 3GP7A 4ZKBB 3U9SA 4IFDJ 2A6HD 3D31A 4OXPA 3KBGA 4UAIA 3IKJA 1DONA 3MXNA 2MO0A 2EYPA 4H44C 3EA6A 3RNUA 5EGTA 2BCOA 1S5DD 4A93B 1MD2D 1EZ6A 2IHFA 4YCUA 4EQ5A 1SE4A 2QW7A 4DN4M 2FHTA 4A3DG 1HR0W 4LF7Q 2KCMA 3D3RA 4QCLA 5BN3A 3PIO3 2JA7H 4QIWE 4G57A 3K0YA 3Q0AA 1QVCA 3HRZC 3S1MH 3KLSX 2IW3A 4POGA 2K28A 2MP1A 3MXPA 1VQDA 1HPCA 1XYIA 3PCOB 2LS01 1MKHA 4IN3A 5CORA 2R93H 4M1UB 1VQMA 2EYFA 1VQ8A 3GV6A 3I70A 5M5WB 1R4PB 1CI3M 3FP9A 2KHSA 2AQ1B 3GTPH 2NVQB 1EEID 3MVVA 5EKIA 1HZBA 2DUDA 4JI7L 3GDEA 4LFBQ 4MN3A 2UUCL 2K4KA 3K7AH 3SEBA 1I3QH 4AYBE 2VQEL 4JI6Q 4POFA 3FEWX 3BDLA 5C4JH 3LWEA 2F0WA 5M3MH 4G7ZC 3HKZG 3FRPB 3CC2A 1SMYC 4HEDA 1GUWA 4DR6L 2ATWA 1EEFD 1E2VA 1V1PA 2LXJA 2F0PA 4U673 3S1QH 1KLGD 2VZAA 4JW0A 4B3SQ 2F0JA 3P7JA 3AQQA 4B3RQ 4JI8L 5C44B 1TXYA 1FJGQ 4A3JH 4RHSA 3U4VA 1X9NA 4QIWB 2B2VC 4FXKC 4NMZA 4A3KG 3BDCA 4C3JB 2YU9H 3KJPA 2MPMA 2H1EA 3T4AC 2PQEA 2K5VA 1IKLA 3GD7A 4QUFA 3CCVA 1MJEA 1B8AA 1Y14B 2EPBA 3HOWB 3OWFA 3FPPA 2B2WA 1SNPA 4KHVA 3V2TA 3K0XA 1YI2A 1M1KC 2EY2A 5IP7G 1Q8IA 3OWEB 4BBRH 4OX9L 2NZOA 2OQKA 4YIJA 3T1YL 4CJ1B 3K8AA 4LFCL 1U9RA 2VUMH 1N34L 4AYBB 3KLSA 4B3MQ 2ZTCA 1A0IA 3M85A 3GTKB 1LT3D 3T1HL 5LMNL 4FO2A 4GN3B 4A75A 1K8MA 1WCMB 4RG1A 3G48A 1CHQD 5DM73 1IL8A 1OXSC 5FLMH 4B3TL 3K6OA 4OIKA 1F9PA 4CDFC 1WTWA 1Q8KA 4DR1L 4O0AA 2E74C 2XSCA 4RGOS 3GTQH 1SYGA 2A19A 3A5ZB 3S14H 4NW2A 2OTJA 1AW7A 3GTOH 3QG1A 5G3LF 1C0AA 1UNSA 4K6LA 1AFPA 5JEAH 4TSSA 1OO9B 4A4IA 3J7ZC 2EJGC 3T16A 2HIXA 3CXCA 4QY7A 4NXMQ 3RZDB 2LFNA 2PZWA 2EJMA 4IFDG 2HDMA 4XT1B 3EN2A 4RMFA 1SFOH 1TWCB 2AMCB 1TWFB 2UU9L 2IWHA 3TMEA 4P74A 2L0CA 1TS3A 3PQIA 4EX5A 3U9OA 3L7ZC 5IGBA 5NUCA 1Q3LA 3CF5A 2N8NA 2UXDQ 1OXTA 3RZOH 1LTSD 1J9OA 1HTPA 4IURA 4AH6A 3FKIB 1XNRL 2VY3A 3DEPA 4K2LA 1A2UA 4AIMA 4GOPC 3RN2A 5C3WA 1U4MA 2CWAA 3AYHB 1Y1VB 5ELDA 3KK7A 1O7YA 4HJ8A 4LF5Q 5IGCA 2XGTA 3M3YB 1KNAA 5C6AA 3OIQA 3A8IE 3PF5A 1U4LA 1HNWL 4N9PA 4OO1I 2D0PA 4R9WA 4CKCA 3D6WA 1EQQA 2Q8TA 2O5JC 2N55A 2K14A 5FO8B 3I4OA 4XQJA 1SNCA 2IX0A 5C3EG 4GOPB 1SDFA 3NK9A 3RMHA 1SYBA 1E1OA 4DXFA 4LF9Q 1ZXTA 2DNCA 4DK1A 1X3PA 3R93A 1SMXA 2B2YA 1G6PA 1A2TA 2Q2HA 1NNXA 2CH4A 4BXXH 3A8KE 2NWGA 3BVGA 1I6VC 4A3KH 1F2ZA 2F4IA 2D9UA 4JI0L 3MZ5A 2Q8RE 1J5EQ 2EY5A 1FNUA 4XQQA 3UE1A 4A93G 4KJOA 4K5XA 2BE5C 4OWWB 1YNJD 4BY1B 2CFMA 2QDBA 1SLJA 3TZUA 2D62A 4KK7A 5D3DA 2NYZD 3UDFA 3PUYA 5C5LA 2E2IH 4ME5A 4FF1A 1EY4A 3NTIA 1HR0L 1XNQL 2K5NA 1IBLL 4QGUA 2KCCA 2F3VA 3CCUA 1ET6A 2WP8J 1XMOQ 2N78A 2HT1A 2KOLA 4CDEC 4JOIC 3QOJA 2F0KA 1BO0A 4PZ7A 5DEHA 3S2HH 4KN7C 3J81E 4MHEA 3I90A 1BXTA 5IYCH 1PH3A 5M9OA 2V1CC 4XIGS 4PG3A 1T9HA 2E5LQ 1VQNA 2E2DC 4FP5D 4DR5L 1PH5A 3K58A 2NTTA 3CHBD 4DR4Q 2WIIB 4ID6A 3TP5A 1N32Q 1X32A 4LUZA 3QWNA 3NTHA 3KOJA 3V96A 4RKBA 2LKVA 1R9TB 1PH8A 2AWOA 4O2DA 5C0XI 4S3SA 2JJQA 3HOVG 3AB9A 1PH6A 1F2YA 1WTRA 2AUKA 2KVMA 3A7LA 4YWMA 3MA2B 4X64Q 3D4DA 1EIGA 3RLNA 4C3HH 1RTNA 2HCIA 5GAHC 1PXUA 4IFDH 5D3IB 2A68C 5C4ZA 4A3IG 4YWLA 3S1NB 3CC4A 3HKSA 3M4YA 1TWGB 1Q86C 5C44G 2NZ1D 2ZXPA 4DNIA 1M90C 2NBFA 2Q2UA 4YCWA 1HCZA 1P16A 1TT2A 1STBA 1RF2D 4C3JG 3S17B 1SXTA 5IODA 5FJ8G 5FLXE 5IGDA 2JA8H 4JBKA 4A3BB 1SYCA 1J8IA 1GVPA 1IBLQ 2RKSA 4HJ7A 1EYGA 3GTJB 4A3EH 1HNXL 4HIDA 5KNDA 1W3SA 5ELCA 3K59A 4DV5Q 1X56A 4UP7A 1VQPA 1V1OA 3K81C 3SK5A 4GKKL 5FKAC 4AYBG 5EJWA 3SK4A 1PH4A 1SROA 1HH2P 4K5WA 4BY7H 3RN5A 4DR7Q 5CYUA 1YJWA 1SEBD 1WCMG 2DJGC 2RSNA 4LF8L 4G7OC 1TKWB 3URYA 5JJIA 2A73B 4B9WA 1JR0D 4L5TA 3I4MH 3F1ZA 2JA9A 4NP5A 1HZ9A 2JA5H 3AEVA 5LHY1 1NMFA 3J7A5 1STHA 4FDBA 2F0QA 1QNKA 3LWUA 1VDZA 3RR5A 1YJ9A 1FVIA 3DWAA 4X62L 1SJED 2BH2A 2EDGA 1JOOA 4LFAQ 4R4TA 1JQYD 3M7GA 4DV0Q 4KLKA 2VXWA 2SEBD 3SDZA 4B08A 3IFTA 1CA6A 4X3KA 1U0LA 2K5HA 4CJ0B 3IAYA 3ZYYX 2CW0D 3Q24A 1VQGA 3MFYA 1RKNA 3MFGA 1H9SB 1HNZQ 5BR8Q 2PQAA 3F8TA 1LV9A 5HY6A 1WTVA 1W6JA 2VQFQ 1IZ6A 1NTGA 1CQFA 5CBEE 4IQZA 3FKIG 5HURA 1PTOC 4J1MA 1HUMA 2F0HA 3EBEA 2NVQH 3MWYW 4EQOA 1GXDC 1Y1VG 3VYUA 3TBIB 2RA4A 1KRTA 4G7HC 2WB1E 4JPBW 4DV1L 1B2TA 1WJJA 5LMNW 3DMUA 2D2CC 3G6JB 2QA4A 1VQ7A 2FMCA 5M5XB 3I2ZA 1ASZA 1HA6A 1BDOA 1C9OA 1YJNA 2RQXA 1DD2A 3NBIA 1IXRA 1EYDA 3DUZA 5J22A 5CMDA 2A6EC 2GVBA 2B39A 3U50C 1VS0A 5JOBA 3ERQA 4H0LC 5C44H 5HGQA 5L37A 3NHHA 1Y1WH 3Q23A 2A69C 1QG7A 1XWEA 2QGQA 4LF6L 1A8VA 2OQ0A 2D5DA 3CAMA 4GLXA 2GN5A 1PYSB 1NY4A 5K36G 4C3JH 3I4LA 4RAUC 2KCNA 2WKDA 3DWPA 1LTID 2B63G 2ZTEA 4Y7NH 3HOWH 4BY1G 4ME3A 4HN7A 4A3LG 4ZQ3A 2Z4HA 1VQFA 1MGSA 3H3VC 1K8OA 1TWAB 2A5HA 3S15H 2K52A 4JI4Q 2F4VL 4FNFA 3HP3A 3EROA 1ENFA 3SK6A 1VQKA 1TR5A 3E9HA 3DXJC 3T56B 2WB1B 3GTKH 3DLLA 4FXGC 4TVAB 5EPJA 1WCMH 2XN9C 4YHHL 3CPFA 1KIXA 5CGKA 4DV1Q 3F2CA 3H91A 1ZEQX 4KY7A 1VQEA 5C4HA 4AQYQ 2NN6I 1IYUA 1MI2A 5I2XA 4KY5A 4UP9A 1O80A 2A74C 3BU2A 4IUVA 3U4ZA 4DR2L 2K33A 4DF7A 1VQBA 2Z9HA 3PO2B 4JVZA 3KF8A 3I4NB 3K80C 1B70B 1H9KA 5K5PA 1VQHA 3HGBA 3EIVA 1WFQA 4HIKA 4MIUA 1M8AA 1D5ZC 1M4VA 5C3EB 1AP0A 1QWYA 3RZDH 2NVTH 4XXEA 4R4OA 1EY9A 1GD7A 4CBVA 4JI1L 1ZKOA 2JP1A 1VF5C 2LY7A 4CDCC 3PIPA 2PO4A 3FDTA 3GV3A 1B1ZA 4M8AA 5ISRA 3G4SA 1D8LA 1TWCH 2H5XA 1N33L 4JBWA 3Q8DA 3HOUH 1JWSD 3OHXC 1V9PA 1QCBD 4C1NK 1CK1A 4K2KA 4EQNA 1HXYD 1KTKA 4GN4B 1SNMA 3NP8A 3HS0C 4C3IH 3NSWA 2MO1A 5EAYA 4C2MB 2JA6H 1MBYA 1X3QA 1L1OA 1YNXA 4A3BG 2F4VQ 1I4QA 1YVCA 4RGTA 4DAYA 2WFWA 4FYDA 1A3TA 2X69A 4DV3L 4DV7Q 3E3XA 3F2UA 5LMUQ 1YHAA 3M3YH 3DWQA 1LABA 1HHVA 2CQAA 3BDOA 5AJ3L 2NTSA 3PIP3 3PUWA 4CJ2C 1V8QA 1PYBA 5FO7B 3VR5A 3FMCA 3PMFA 1NJIC 1Z6HA 1HA5A 2PI2A 2WAQE 3MAQA 3HOXB 1TY2A 2MJ8A 2Z0SA 1PZKD 1A3VA 3BJUA 2R61A 1AN8A 4CGYB 4L6TB 1EYCA 5EKKA 4HTHA 1SMYD 3K5MA 1QB5D 3AU7A 2Z8LA 3VA5A 3W1BA 3WWVA 1B4OA 1K28A 2VL6A 1DM0B 1LTLA 1N8RC 1GJXA 4DGZA 5M3FB 1CKNB 3HOVB 2KUMA 1JB7A 1IKMA 3SGIA 2B2TA 4JI1Q 1EL0A 2XRSD 5CV9A 3MXNB 4L5SA 5A2QL 1G2TA 1D5XC 1CZGA 2KCTA 4L5QA 4A3CG 2RBMA 3KLWA 3NBHA 4A3IB 4ABNA 3HOYB 2UXBL 4UDUC 3K7UC 4HMJA 5IYBH 1KHIA 2ZT9C 4DK3C 2SOBA 3BVZA 2F0DA 4RCOA 4BA2I 4RCNA 1AEXA 1HZCA 2BA1A 1PA6A 1XMQL 3GTMH 3JAME 1CSQA 2OWOA 4BBSB 4HMIA 1WTQA 5FOBB 1WD0A 3C3LA 1V1QA 5D14A 3CCEA 4DPGA 4C56C 4GN5A 4J15A 4ZKCB 1A63A 3OYYA 1EY5A 2R7FA 2WAQB 3ER0A 1R9TH 1DOLA 2JYOA 1DYQA 2UUBL 1QJOA 1GKHA 4HIOA 4CKEA 1PLFA 2RHQB 2XWJB 4BS9A 4X66L 1XJVA 4DUYL 1STEA 5EKLA 4JI7Q 5I2YA 1PRTC 1VQAA 1CFMA 2UUCQ 4IZ8A 1PZJD 2VQEQ 1JJCB 1STGA 1PTOF 1TWHB 3TZDA 4DUZL 1BCPC 3LGJA 3JC66 4DR6Q 1UEAB 2FXQA 3STBC 4K0KL 4V0BA 2YTXA 4X6AH 2N88A 3ERSX 2K03A 4XYOA 1PDQA 4A3DH 3S17H 3PUZA 4FF4A 1Q81C 2CQOA 4IUPA 1JCKB 1KAWA 4JI8Q 3ICEA 4A3BH 3H09A 1PRTB 4HCEA 2F52A 3GTJH 2I07B 2HHHL 3D0FA 3OSOA 1BUVT 2ZJRA 1Z47A 3J7YW 3QOLA 4H7BA 1WOCA 3AFPA 2B8GA 2CCZA 1R4QB 3GTGH 1BCPB 4GOPA 5IOCA 3TP6A 1YBYA 3X3NA 1F9QA 4U68A 2KJXA 2WKCA 1Q82C 1G291 2WB1G 2E8GA 1K3RA 3J80i 2IHEA 4JI5L 1PH7A 1KRSA 3HEJA 4OX9Q 3T1YQ 3TS0A 1TS5A
chains in the Genus database with same CATH topology
4N9TA 5E3FA 5EBDA 4KD4A 1IHZA 3NTKA 1ONLA 2VB2X 4G4KA 2F0IA 4A3FB 1OXXK 3DHQA 1I50B 2LMCB 3SHLA 3OPOA 3E0JA 5C0XG 4LK1C 4H13C 4X3SA 1S5FD 5IGGA 3D4RA 3LX0A 4PQXA 4QF4A 2J0TD 1BF4A 2R6GA 2JA7B 3I3CA 1XXGA 1V43A 3S1MB 4DAVA 2CVRA 3VA7A 1SYFA 3QO2A 2BE5D 1SNOA 3C46A 5DAUA 3WDNA 4ZLTF 3E6ZX 2NVXB 1JORA 2B63B 3S9WA 1SSOA 3GTPB 1QE6A 2Z1CA 4KTAA 2R7ZB 1JOKA 1S4ZA 1I3QB 5COYA 4O42A 3QIAA 3P1HA 5C4JB 1K83B 2K6AA 5M3MB 2KA7A 2XWBB 1PFBA 3ONAB 2B2YC 1GHJA 5ELBA 2ICEC 2K5DA 1AZQA 1E2WA 4IFDI 5I6YA 3FPUB 1GHKA 2EE1A 3MXGA 3C1FA 2Z4IA 4E6IA 1CT1D 1XX8A 1SNQA 1HUNA 4KKTA 4B9XA 1O78A 1TQOA 2O5IC 1ENCA 3BYTB 1BOSA 4PMBA 5C4XB 4KMUC 4KY6A 1WD1A 3M4OB 4WRDA 1G91A 5TSSA 1C4QA 2L55A 1I6HB 1TS4A 4ZK9B 1EY0A 3W3AA 5CC4A 4ILWA 2BA0A 3J80E 1I4XA 5I4DA 5KIXA 5EBCA 3WOEA 2QKIC 1B9MA 1S5ED 5CV8A 2BDOA 2L11A 3RLFA 1CQVA 2PPBC 4CKBA 3GTQB 3S14B 2NUCA 1HQMC 4LMQD 1WTPA 4PV1C 1ESRA 3CKIB 1BBXC 1B9NA 2EJFC 1FR3A 1EIHA 3A7AB 4RA8A 1NSNS 2ZXRA 4RH6A 3TSSA 5ELFA 2O4XA 3ND8A 3NE5B 3N6RA 1NR4A 3HZXA 2F03A 3N52A 2BOSA 1F9RA 3VYRA 2JE6I 1ICWA 3E5SA 5IT9E 1LO5D 3NPPA 4ZUJA 4TRDA 2PZTA 3PUXA 2PZUA 3J81L 2PW5A 1S5BD 1II3A 3NQTA 3A55A 4IUTA 1IYVA 5LL6S 5FO9B 3SR1A 4XQNA 2C5CA 1PRTF 1EQVA 5DNFA 4HSVA 1A3UA 1YNNC 3VR2A 1B3AA 2HCCA 2DY8A 3M7NA 1AZPA 1RJTA 1GUNA 3VR6A 1BCPF 3NWSA 1GUTA 1ILQA 5G3LD 4JK1C 4XDXA 3VYTA 5CV5A 5JVG3 4DAPA 1EWCA 3A56A 2RDFA 3PV0A 3ND9A 2M9VA 2KQ3A 1SYEA 4KJNA 3HG9A 1BNZA 1ET9A 4L63B 4BWGB 4V190 2A6ED 2WINB 5FLXL 2BDNA 1TY0A 2FMMA 4FVMA 1EY7A 2E2IB 1DZ1A 1PTOB 1CA5A 3G7LA 1FYCA 2L9HA 3MHBA 2EYOA 2L5TA 3R2IA 3KUPA 4XYQA 5EQ0A 3H0GB 2F0OA 4J8QA 2B2UA 4TQUS 1HRJA 5BN5A 5C3XA 2Y0SB 2SNMA 1LT6D 5I6WA 2J7ZA 1C48A 2IPKD 3P20A 2IJ0A 2RSOA 4K8IA 1KDAA 1U4RA 3R3OA 2R92B 4RGMA 5C5MA 2EYLA 3H6MA 4DFAA 3CQZB 4KI0A 5A35A 3UI2A 3S1RB 4C3HB 4R8IA 5J39A 3KLRA 2DNEA 1LTTD 1EQTA 1O7ZA 1HQRD 1A6XA 2FJ2A 3L3OC 1STYA 4A3GB 4XTCS 5J1ZA 1RD9D 1EOTA 4J6HA 1ENAA 3TP7A 1T5XD 1WVLA 2V4DA 3EFXD 5IGFA 1IW7C 1B53A 1SE3A 4O1NA 4A3EB 2QILA 3NUCA 4HSPA 2DY7A 3S16B 3HOZB 5CV7A 2X6LA 3GQBA 4EQPA 4EVOA 1KDCA 3OW7A 1F77A 4KD3A 2B8FA 1ZYRC 1RTOA 1FD7D 4ZUIA 3A8JE 2PCFB 4PMCA 4WORA 1RODA 1T5EA 3NXWA 2M00A 1NAPA 3PO3B 4DA2A 4XT3B 5JPMC 1FGBD 1B44D 2OT2A 3I4MB 3L9AX 2JA5B 2OF1A 4RHRA 4R8NA 4TKOB 4GZYC 4F88A 1G8ZD 4C1NI 5JEAG 2A6HC 3A54A 1Y8NB 4IUNA 4RGNA 4ZYSA 5AFWA 5C0XJ 1I4HA 1SJHD 1EFID 3SK8A 2F1MA 4DK0A 3I72A 1Q90A 1EY8A 5T1IA 2CHBD 5K36H 4PNYA 1L0XB 1JWMD 1EYAA 2K5WA 2EYHA 2B2VA 2J4XA 4I65A 4LJZC 5CV6A 1EWHA 1I4RA 2TSSA 3C1EA 3K5NA 3OOCA 1CHPD 1I4PA 1JWUD 1Q1EA 3X3MA 1KAAA 3K57A 4K8JA 2IX3A 1HFNA 2HUGA 3AMUA 3OMCA 2JSOA 3ITPA 1O7LA 3CRKC 5LL6X 4F7XA 1DXMA 2PMZB 2EOTA 1NUCA 2AUJD 4WJWA 1GOZA 1CTMA 2B2TC 1H9MA 1Y1WB 1F2MA 1TS2A 5KRUA 3W2DA 2AQ3B 2C9OA 3D8GA 1PRTD 3H94A 4OO1G 3EVQA 2H4OA 3BYYB 4Z9CB 4Y7NB 1BCPD 2QF7A 2AQ2B 1GUOA 1EZ8A 5IIFA 2ZXOA 3S15B 4OL7A 3VR4A 2KEDA 1V1PB 2B2WC 2F0GA 1LACA 5M5YB 3CU7A 1SYDA 4HR7B 2XIWA 3D6CA 5T1GA 4LAAA 2E2HB 2K5QA 3MXUA 4RKLA 2KECA 2NVYB 2TMPA 1G2SA 4A3MB 3SE0A 1DOKA 4KKSA 5JPNC 5JJZA 3Q6SA 2OEOA 2F3WA 3I91A 4C3HG 4X3TA 3EJIA 4DU9A 2NVTB 1NCVA 2HQEA 4KKUA 1B50A 2WACA 2K7VA 4KN4C 2ICIA 5E1FA 1QNUA 4FF3A 1D5MC 5F2DA 4ZRZA 2L4NA 4KV6A 3JAML 2F0FA 3HOUB 3CRLC 3OMGA 2ENBA 4KHZA 2F0NA 1OXVA 4C3IB 1JC7A 2WV6D 2JA6B 1FNVA 3C2PA 1DOMA 5CBAE 1F9SA 2XRQD 4QUCA 3I8ZA 1UAPA 4PMWA 4HAEA 3O13A 1ML0D 4IALA 3BS1A 3R8BA 2PNRC 3K5LA 2R93B 3IL8A 3DM1A 5EPKA 2F0SA 3TP8A 2ID0A 3WOFA 1Z7TA 2L12A 3K7AB 5I9OA 4K5VA 3K5OA 4IUUA 3TDQA 4OO1H 2NB0A 5EPLA 4K6DA 2XVSA 4F87A 1DJRD 1L0YB 3PUVA 3S1QB 3V05A 1PTOH 4RFBA 1YNJC 3DEOA 3FVQA 1EU4A 5D65A 1TIID 3VYSA 1GUGA 1TVXA 2F0LA 4A3JB 1JICA 3GTMB 4ZAIA 2F0UA 1LTAD 4NDXA 2FFKB 2YU9B 2A68D 1RDPD 5E4XA 3MTSA 2YYZA 1DCZA 1LLRD 3QJYA 2JEAI 4BBRB 4QB4A 1D1KA 2IT1A 4BA1I 1PMRA 5KNBA 2EY1A 5KYLA 4HCSA 2F0VA 2VUMB 1VMCA 5IGEA 1HTLD 1PYWD 1BQQT 1SNDA 1LTGD 2RDHA 3T13A 1PZID 4I7ZC 2Q8IB 1SBBB 2SDFA 5KEEA 2KEEA 1JE4A 2K32A 2RDGA 1KABA 2E76C 3GTOB 1NR2A 5C0XH 1QOHA 4A3DB 1RHPA 3T53B 3J7AF 3RUZA 5CV4A 4IUQA 1KNEA 1S5CD 1H9SA 3KBXA 4QMGA 4P2CB 1LT4D 1SFOB 3GTGB 2EYMA 2IL8A 4EGVA 3SVMA 1QILA 5JVH3 1Y8PB 1KLUD 4RWSC 1BR9A 3RZOB 1FNWA 1C8CA 2PW7A 5KYIA 3RD4A 4ULLA 1YNND 3S2DB 1VMPA 2MHVA 1H9RA 1RCVD 4FXDA 3SXHA 2VB3X 3GO5A 1D1IA 3HKZB 4OIJA 2JXMB 1Q12A 1Y69U 1PTOD 1KDBA 3Q22A 1JOQA 2G9DA 1VF7A 1G6ZA 1LTBD 2EVBA 5JEAJ 1MSGA 1H9JA 4L8JA 1CZWA 2RVLA 2E75C 2NN6G 1Q1BA 4ODGA 1EU3A 2K04A 3J80L 4A3KB 3R2TA 1E0BA 2MUYA 4C3IG 2CW0C 4F8MA 1Y8OB 3GTLB 4X3UA 2XNAC 4OHJA 4CHTB 1A15A 5ELEA 2A69D 1LT5D 2EY6A 3LNNA 1XTCD 4NKLA 2G9HD 1D2BA 3D4WA 5BN4A 3NWTA 5CR3A 4DNRB 1WTOA 2EXZA 1HFGA 1U4PA 1JB3A 2GA4B 3S2HB 3OIPA 2K01A 1PFNA 5E4WC 4DXGA 1LTRD 1CM9A 3TN2A 1ESFA 5IT9L 2X6GA 2EZVA 3EQLC 5KNCA 1WTXA 2QEJC 2VNUD 2SNSA 1F2LA 5KGUA 2I46A 5DM63 2JEBI 2F0EA 2K05A 5FK9C 2B2UC 2PYKA 2L1BA 1I4GA 5I9PA 2MGSA 1VCIA 3P75A 1OXUA 1STAA 1IW7D 3T51B 2O2LD 1SE2A 3J7AV 1E2ZA 2DN8A 4DNTB 2FINB 3BG3A 2K1BA 3IFDA 1MSHA 3MC0B 2OXPA 3VR3A 2R3ZA 3QB3A 2JA8B 1GUSA 1ILPA 2IX1A 2AWNA 3NQIA 1D6EC 4Q0FA 5A2QE 2M2LA 1EY6A 2QCPX 1UUPA 2EYJA 4WFN3 5JAVA 1ZYRD 3BVMA 1SAPA 3BZDB 4K14A 2F0TA 5HGTA 1W6KA 3I73A 2HDLA 4Q5VA 1TU2B 4BY7B 2F0MA 3MEHA 4OGQC 1PFMA 2E2JB 1STNA 4FF2A 2NN6H 3GP7A 4ZKBB 3U9SA 4IFDJ 2A6HD 3D31A 3KBGA 4UAIA 3IKJA 1DONA 3MXNA 2EYPA 4H44C 3EA6A 5EGTA 2BCOA 1S5DD 4A93B 1MD2D 1EZ6A 1SE4A 4DN4M 2FHTA 3D3RA 4QCLA 5BN3A 3PIO3 4G57A 3K0YA 3Q0AA 3HRZC 3KLSX 2IW3A 2K28A 2MP1A 3MXPA 1HPCA 1XYIA 2LS01 4IN3A 5CORA 4M1UB 2EYFA 3GV6A 3I70A 5M5WB 1R4PB 1CI3M 2KHSA 2AQ1B 2NVQB 1EEID 3MVVA 5EKIA 4MN3A 3SEBA 3FEWX 3BDLA 3LWEA 2F0WA 4G7ZC 3FRPB 1SMYC 4HEDA 1GUWA 1EEFD 1E2VA 1V1PA 2F0PA 4U673 1KLGD 2F0JA 3P7JA 5C44B 4RHSA 4QIWB 2B2VC 4FXKC 4NMZA 3BDCA 4C3JB 2MPMA 2H1EA 3T4AC 2PQEA 3GD7A 1IKLA 4QUFA 2EPBA 3HOWB 3OWFA 3FPPA 2B2WA 1SNPA 4KHVA 3V2TA 2EY2A 1Q8IA 3OWEB 4YIJA 4CJ1B 1U9RA 4AYBB 3KLSA 3M85A 3GTKB 1LT3D 4FO2A 1K8MA 1WCMB 1CHQD 5DM73 1IL8A 1OXSC 3K6OA 4OIKA 1F9PA 1WTWA 2E74C 2XSCA 4RGOS 1SYGA 4NW2A 1AW7A 3QG1A 5G3LF 1UNSA 4K6LA 1AFPA 5JEAH 4TSSA 1OO9B 2EJGC 3T16A 3RZDB 2LFNA 2PZWA 2EJMA 4IFDG 2HDMA 4XT1B 1TWCB 1TWFB 2IWHA 3TMEA 2L0CA 1TS3A 3U9OA 3L7ZC 5IGBA 5NUCA 1Q3LA 1OXTA 1LTSD 1J9OA 1HTPA 4IURA 3FKIB 3DEPA 4K2LA 1A2UA 5C3WA 1U4MA 1Y1VB 5ELDA 3KK7A 1O7YA 5IGCA 3M3YB 1KNAA 5C6AA 3OIQA 3A8IE 1U4LA 4N9PA 4OO1I 4R9WA 4CKCA 3D6WA 2Q8TA 2O5JC 2N55A 5FO8B 4XQJA 1SNCA 2IX0A 1SDFA 3NK9A 3RMHA 1SYBA 4DXFA 1ZXTA 2DNCA 4DK1A 1X3PA 3R93A 2B2YA 1A2TA 3A8KE 2NWGA 3BVGA 1I6VC 1F2ZA 2F4IA 2D9UA 3MZ5A 2Q8RE 2EY5A 1FNUA 4XQQA 4KJOA 4K5XA 2BE5C 1YNJD 4BY1B 2QDBA 3TZUA 2D62A 4KK7A 5D3DA 2NYZD 3PUYA 5C5LA 4ME5A 4FF1A 1EY4A 3NTIA 2KCCA 2F3VA 1ET6A 2WP8J 2KOLA 3QOJA 2F0KA 1BO0A 5DEHA 4KN7C 3J81E 4MHEA 3I90A 1BXTA 5M9OA 4XIGS 2E2DC 4FP5D 3K58A 2NTTA 3CHBD 2WIIB 4ID6A 3TP5A 1X32A 3QWNA 3NTHA 3V96A 4RKBA 2LKVA 1R9TB 2AWOA 5C0XI 4S3SA 3AB9A 1F2YA 1WTRA 2AUKA 2KVMA 3A7LA 3MA2B 3D4DA 1EIGA 1RTNA 2HCIA 1PXUA 4IFDH 5D3IB 2A68C 5C4ZA 3S1NB 3M4YA 1TWGB 2NZ1D 2ZXPA 2NBFA 1HCZA 1TT2A 1STBA 1RF2D 4C3JG 3S17B 1SXTA 5IODA 5FLXE 5IGDA 4A3BB 1SYCA 1J8IA 2RKSA 3GTJB 5KNDA 5ELCA 3K59A 1V1OA 3SK5A 5FKAC 5EJWA 3SK4A 4K5WA 5CYUA 1SEBD 2RSNA 4G7OC 1TKWB 3URYA 2A73B 4B9WA 1JR0D 4NP5A 5LHY1 1STHA 2F0QA 1QNKA 3LWUA 1VDZA 3DWAA 1SJED 2EDGA 1JOOA 1JQYD 3M7GA 2VXWA 2SEBD 3SDZA 4B08A 3IFTA 1CA6A 4X3KA 4CJ0B 3IAYA 3ZYYX 2CW0D 3Q24A 3MFYA 1RKNA 3MFGA 1H9SB 1LV9A 1WTVA 1W6JA 1CQFA 5CBEE 4IQZA 5HURA 1PTOC 4J1MA 1HUMA 2F0HA 3MWYW 4EQOA 1GXDC 3VYUA 3TBIB 2RA4A 4G7HC 1B2TA 3DMUA 2D2CC 3G6JB 2FMCA 5M5XB 1HA6A 1BDOA 2RQXA 1DD2A 3NBIA 1EYDA 3DUZA 5J22A 5CMDA 2A6EC 2B39A 5JOBA 3ERQA 4H0LC 3NHHA 3Q23A 2A69C 1QG7A 1XWEA 2D5DA 5K36G 3I4LA 4RAUC 2KCNA 2WKDA 3DWPA 1LTID 4HN7A 4ZQ3A 2Z4HA 1MGSA 3H3VC 1K8OA 1TWAB 2A5HA 4FNFA 3HP3A 3EROA 1ENFA 3SK6A 1TR5A 3DXJC 3T56B 2WB1B 4FXGC 5EPJA 2XN9C 5CGKA 3H91A 1ZEQX 4KY7A 5C4HA 2NN6I 1IYUA 1MI2A 5I2XA 4KY5A 1O80A 2A74C 4IUVA 2K33A 4DF7A 3PO2B 3KF8A 3I4NB 1H9KA 5K5PA 3HGBA 4MIUA 1M8AA 1D5ZC 1M4VA 5C3EB 1AP0A 1QWYA 4XXEA 1EY9A 4CBVA 1ZKOA 2JP1A 1VF5C 2LY7A 2PO4A 3FDTA 3GV3A 1B1ZA 4M8AA 5ISRA 4JBWA 1JWSD 3OHXC 4EQNA 1QCBD 4C1NK 1CK1A 4K2KA 1HXYD 1KTKA 1SNMA 3NP8A 3HS0C 3NSWA 4C2MB 1MBYA 1X3QA 1I4QA 4RGTA 4DAYA 4FYDA 1A3TA 2X69A 3F2UA 3DWQA 1LABA 1HHVA 2CQAA 3BDOA 3PIP3 2NTSA 3PUWA 4CJ2C 1V8QA 5FO7B 3VR5A 3FMCA 3PMFA 1Z6HA 1HA5A 3MAQA 3HOXB 1TY2A 2MJ8A 1PZKD 1A3VA 2R61A 1AN8A 4CGYB 4L6TB 1EYCA 5EKKA 4HTHA 1SMYD 3K5MA 1QB5D 3AU7A 2Z8LA 3VA5A 1B4OA 1DM0B 1GJXA 4DGZA 5M3FB 3HOVB 2KUMA 1IKMA 2B2TA 1EL0A 2XRSD 5CV9A 5A2QL 1G2TA 1D5XC 1CZGA 2RBMA 3NBHA 4A3IB 4ABNA 3HOYB 4UDUC 4HMJA 2ZT9C 2SOBA 3BVZA 2F0DA 4RCOA 4BA2I 4RCNA 1AEXA 2BA1A 3JAME 4BBSB 4HMIA 1WTQA 5FOBB 1WD0A 3C3LA 5D14A 4C56C 4ZKCB 1EY5A 2WAQB 1DOLA 2JYOA 1DYQA 1QJOA 4CKEA 1PLFA 2XWJB 4BS9A 1STEA 5EKLA 5I2YA 1PRTC 1CFMA 4IZ8A 1PZJD 1STGA 1PTOF 1TWHB 3TZDA 1BCPC 1UEAB 4V0BA 2N88A 2K03A 4XYOA 1PDQA 3PUZA 4FF4A 4IUPA 1JCKB 3H09A 1PRTB 4HCEA 2I07B 3OSOA 1BUVT 1Z47A 3J7YW 3QOLA 4H7BA 2B8GA 1R4QB 1BCPB 5IOCA 3TP6A 3X3NA 1F9QA 4U68A 2KJXA 2WKCA 1G291 3HEJA 1TS5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DNF A;  1EQT A;  2FHT A;  2RA4 A;  4HSV A;  1O7Z A;  5T1I A;  4RWS C;  2FJ2 A;  1AP0 A;  1CM9 A;  1ZXT A;  1B2T A;  1B3A A;  1DOK A;  2DY8 A;  2HCC A;  3TN2 A;  1X3P A;  1AZP A;  1RJT A;  2JP1 A;  2X6G A;  5JJZ A;  1WTQ A;  3R93 A;  3Q6S A;  1WD0 A;  1C8C A;  2B2Y A;  1J8I A;  3FDT A;  1WTX A;  3GV3 A;  3DEO A;  5D14 A;  1G2S A;  1WD1 A;  1HA6 A;  5D65 A;  1EOT A;  3I91 A;  1ILQ A;  2B2V A;  1F2L A;  1TVX A;  1G91 A;  2NWG A;  4X3T A;  4X3S A;  1JIC A;  1VMP A;  4ZKC B;  2D9U A;  4XDX A;  1IL8 A;  2Q8R E;  1NCV A;  2K28 A;  4ZAI A;  2MP1 A;  1WVL A;  2K05 A;  4OIK A;  4ZK9 B;  5CMD A;  1B50 A;  2B2U C;  2FFK B;  1F9P A;  1B53 A;  1XYI A;  1WTW A;  2L1B A;  1BF4 A;  5E4X A;  3MTS A;  5COR A;  3I3C A;  1DOL A;  1HFN A;  1X3Q A;  2MGS A;  4OIJ A;  2L4N A;  2HUG A;  2NYZ D;  2JYO A;  3GV6 A;  2DY7 A;  4NW2 A;  1BNZ A;  2CVR A;  5EJW A;  1QG7 A;  2X6L A;  3QO2 A;  1PLF A;  2L11 A;  2RSN A;  1G6Z A;  5EKI A;  2X69 A;  2EOT A;  2FIN B;  3F2U A;  2BDN A;  2B2T C;  1MSG A;  2FMM A;  1DOM A;  4MN3 A;  4RAU C;  5CBA E;  1F9S A;  4HCS A;  2K1B A;  3IFD A;  1MSH A;  4QUC A;  1HHV A;  4LMQ D;  1WTP A;  2HDM A;  2KOL A;  1DZ1 A;  4XT1 B;  1VMC A;  1RTO A;  4CJ2 C;  2RVL A;  4ZLT F;  1ESR A;  3G7L A;  1CA5 A;  2R3Z A;  1BO0 A;  3LWE A;  2L9H A;  1BBX C;  1ILP A;  3TZD A;  1ROD A;  1SSO A;  1QE6 A;  3I8Z A;  1EIH A;  4MHE A;  4HED A;  3I90 A;  4RA8 A;  1NAP A;  2K04 A;  1MGS A;  2M2L A;  3KUP A;  5EQ0 A;  1QNK A;  1GUW A;  1S4Z A;  4XT3 B;  1E0B A;  2B2U A;  2SDF A;  4HAE A;  5COY A;  2MJ8 A;  1HRJ A;  1Q3L A;  1SAP A;  1ML0 D;  2N88 A;  2K03 A;  3HP3 A;  4O42 A;  1PDQ A;  1X32 A;  4X3U A;  2KEE A;  1J9O A;  1NR4 A;  3P7J A;  4IUP A;  4IUR A;  1PFB A;  3ONA B;  2J7Z A;  2VXW A;  1JE4 A;  3DEP A;  3N52 A;  3IL8 A;  1CA6 A;  1B4O A;  1A15 A;  1F9R A;  1ICW A;  2B2Y C;  4X3K A;  3DM1 A;  5EPJ A;  1U4M A;  5EPK A;  1WTR A;  1NR2 A;  2HDL A;  4CJ0 B;  2RSO A;  2KVM A;  1AZQ A;  2KUM A;  1EIG A;  2B2V C;  1IKM A;  1RTN A;  2HCI A;  2KED A;  1RHP A;  1O7Y A;  2B2T A;  3FPU B;  3H91 A;  5AFW A;  2EE1 A;  1U4R A;  4CJ1 B;  1PFM A;  2B2W C;  1EL0 A;  1LV9 A;  1MI2 A;  2MPM A;  1WTO A;  1G2T A;  2H1E A;  1KNA A;  2L12 A;  1WTV A;  1IKL A;  4QUF A;  1U4L A;  1O80 A;  1XX8 A;  4IUQ A;  1F9Q A;  1KNE A;  2EPB A;  4R9W A;  4IUU A;  1HFG A;  4U68 A;  4IUV A;  4ZKB B;  1U4P A;  2XIW A;  3KBX A;  4IUT A;  4UAI A;  5T1G A;  3UI2 A;  5CBE E;  1DON A;  4R8I A;  3D6W A;  2B2W A;  5EPL A;  2NZ1 D;  2Q8T A;  2IL8 A;  2K01 A;  1PFN A;  1HUN A;  1HUM A;  2KEC A;  3MWY W;  2N55 A;  5E4W C;  3SVM A;  1SDF A;  4DN4 M;  1M8A A; 
#chains in the Genus database with same CATH topology
 4N9T A;  3S2D H;  5E3F A;  5EBD A;  4KD4 A;  4A3G G;  4LFC Q;  4YY3 L;  2MQH A;  1IBM L;  1IHZ A;  3NTK A;  1ONL A;  2VB2 X;  4G4K A;  2F0I A;  1N34 Q;  4A3F B;  1OXX K;  3DHQ A;  1I50 B;  2LMC B;  3SHL A;  3T1H Q;  3OPO A;  5LMN Q;  4DUY Q;  3E0J A;  5C0X G;  4LK1 C;  3J81 c;  3PO2 G;  4H13 C;  4X3S A;  3I4N G;  1S5F D;  5IGG A;  4B3T Q;  3D4R A;  4YCV A;  3LX0 A;  4PQX A;  1P8L A;  4QF4 A;  4DR1 Q;  3OW2 A;  2J0T D;  1BF4 A;  2R6G A;  2JA7 B;  3CMA A;  4A76 A;  4LWC A;  3I3C A;  1XXG A;  1V43 A;  1X6O A;  3S1M B;  4DAV A;  2CVR A;  1K8G A;  3VA7 A;  4JG2 A;  1PVO A;  1SN8 A;  1SYF A;  1S40 A;  3QO2 A;  2BE5 D;  1SNO A;  3C46 A;  1K0S A;  5DAU A;  3WDN A;  1Q7Y C;  4ZLT F;  3E6Z X;  1VQI A;  2NVX B;  1JOR A;  2B63 B;  3S9W A;  3GTL H;  1JJ2 A;  1SSO A;  3GTP B;  1AE2 A;  1QE6 A;  3PO3 G;  4APV A;  3ULP A;  2Z1C A;  2UU9 Q;  4KTA A;  1PH9 A;  5IYD G;  2R7Z B;  1JOK A;  1S4Z A;  5IP7 H;  1I3Q B;  5COY A;  4IJL A;  4O42 A;  3QIA A;  3KDF A;  3P1H A;  2Q2T A;  2C35 B;  1K83 B;  5C4J B;  2K6A A;  5M3M B;  2KA7 A;  2XWB B;  1PFB A;  3ONA B;  2HIV A;  1XNR Q;  5M5X H;  5FLX c;  1MJC A;  2B2Y C;  1GHJ A;  5ELB A;  4DV6 L;  2ICE C;  2K5D A;  1AZQ A;  1X3E A;  2VS1 A;  4DV2 L;  1E2W A;  2HQL A;  3J81 j;  4IFD I;  1HZA A;  5I6Y A;  3FPU B;  1GHK A;  2EE1 A;  3MXG A;  3C1F A;  3HOX G;  2Z4I A;  1QUQ A;  4LW1 A;  2I5M X;  4E6I A;  1CT1 D;  1HNW Q;  1XX8 A;  1SNQ A;  1HUN A;  4KKT A;  3PSI A;  1O7I A;  1EIY B;  3TRE A;  1FGU A;  1QVG A;  4B9X A;  1O78 A;  1CSP A;  1TQO A;  2O5I C;  5M3F G;  1ENC A;  2D0O A;  3BYT B;  1BOS A;  1BBW A;  4PMB A;  5C4X B;  4GLA C;  2MNA A;  4KMU C;  3U58 A;  4KY6 A;  1WD1 A;  1EFW A;  3M4O B;  1BVS A;  4WRD A;  2ZM6 L;  3HOY G;  5JJL A;  1G91 A;  1SRU A;  5TSS A;  4JI0 Q;  1C4Q A;  4LNQ A;  2L55 A;  1I6H B;  2DJF C;  1TS4 A;  4ZK9 B;  3UDG A;  1EY0 A;  3W3A A;  5CC4 A;  3FHW A;  4ILW A;  3CPW A;  1N36 L;  4I7A A;  2BA0 A;  3J80 E;  1I4X A;  5I4D A;  4BBS G;  5KIX A;  5EBC A;  3WOE A;  2QKI C;  1B9M A;  1S5E D;  1K8A C;  2YTY A;  4HJ9 A;  5CV8 A;  1HR0 Q;  1XNQ Q;  2BDO A;  3RLO A;  1WYD A;  2L11 A;  1VQ4 A;  3RLF A;  1CQV A;  2MFI A;  4CKB A;  2PPB C;  1YIJ A;  3GTQ B;  3H3V H;  1UWV A;  3S14 B;  2WAQ G;  2NUC A;  1HQM C;  4LMQ D;  5IP9 G;  4DV6 Q;  1WTP A;  4PV1 C;  1ESR A;  3CKI B;  3G71 A;  4MTN A;  3TS2 A;  4LUV A;  4DV2 Q;  1K3B C;  1BBX C;  1B9N A;  2EJF C;  1FR3 A;  1K73 C;  1EIH A;  3A7A B;  4RA8 A;  1NSN S;  2ZXR A;  1NMG A;  1VQ6 A;  1UE7 A;  1ASY A;  5C3E H;  4DR5 Q;  3KF6 A;  4RH6 A;  3TSS A;  5ELF A;  4QQB X;  2O4X A;  3ND8 A;  3NE5 B;  3N6R A;  1NR4 A;  2E2J H;  1E1T A;  3HZX A;  2F03 A;  3N52 A;  2BOS A;  1F9R A;  3VYR A;  2JE6 I;  1ICW A;  4DV4 L;  4OON A;  1N9W A;  3E5S A;  1VQJ A;  5ELN A;  5IT9 E;  1LO5 D;  3NPP A;  4ZUJ A;  4TRD A;  3F2B A;  2PZT A;  3PUX A;  2PZU A;  4NXN L;  3J81 L;  2PW5 A;  4A93 H;  4C2M H;  1UE1 A;  1S5B D;  1II3 A;  4OEL B;  3NQT A;  3A55 A;  4IUT A;  1IYV A;  5LL6 S;  5FO9 B;  3SR1 A;  1E3P A;  4XQN A;  4A3M G;  2C5C A;  5IE8 A;  1PRT F;  1EQV A;  5DNF A;  1PH2 A;  4HSV A;  1A3U A;  1YNN C;  2Y0S E;  3VR2 A;  1B3A A;  2HCC A;  2DY8 A;  3M7N A;  1AZP A;  4NPS A;  1RJT A;  2KHJ A;  1GUN A;  3VR6 A;  1EWI A;  1BCP F;  3NWS A;  1GUT A;  4N8X 1;  2B3G A;  1RIP A;  1HNX Q;  1ILQ A;  4LF4 L;  5G3L D;  1LYL A;  4JK1 C;  5M5W H;  4XDX A;  3VYT A;  5CV5 A;  3HOX H;  5JVG 3;  4DAP A;  1EWC A;  3A56 A;  2RDF A;  2UUA L;  3PV0 A;  3ND9 A;  2M9V A;  2KQ3 A;  1SYE A;  4GKK Q;  4KJN A;  3HG9 A;  1BNZ A;  1ET9 A;  4L63 B;  4BWG B;  2Z6K A;  4A3F G;  5IWA L;  4V19 0;  5M3F H;  2A6E D;  2WIN B;  3HOV H;  5FLX L;  3CD6 A;  4LF8 Q;  4JI2 L;  3W1G A;  3I7F A;  2BDN A;  1TY0 A;  2FMM A;  4FVM A;  3OTO L;  1S3O A;  4DV4 Q;  1EY7 A;  3I56 A;  4HJ5 A;  2E2I B;  1DZ1 A;  1PTO B;  1CA5 A;  4A3I H;  2JA7 G;  2GVA A;  3G7L A;  1FYC A;  2L9H A;  3KYH C;  2EIF A;  3MHB A;  1OTC A;  2EYO A;  1YIT A;  2L5T A;  3R2I A;  3KUP A;  4XYQ A;  5EQ0 A;  3H0G B;  2F0O A;  4J8Q A;  2B2U A;  4X62 Q;  5J3B A;  4TQU S;  1HRJ A;  5BN5 A;  2I5H A;  4OWX B;  5C3X A;  3CCM A;  2R93 G;  2Y0S B;  1I94 L;  4LUO A;  2SNM A;  1LT6 D;  4UPA A;  5I6W A;  2J7Z A;  1C48 A;  4UHV A;  1K0R A;  2IPK D;  5FJ8 H;  1UEB A;  3P20 A;  2IJ0 A;  2PQA B;  2RSO A;  4K8I A;  1KDA A;  1X65 A;  4JBJ A;  1VQ5 A;  1IYJ B;  2R7Z G;  4R4Q A;  1U4R A;  2I5L X;  3R3O A;  2ZJQ A;  4PZ8 A;  2R92 B;  1K9M C;  4KHP L;  4RGM A;  5C5M A;  2EYL A;  4JV5 L;  3H6M A;  4DFA A;  4GNX A;  5M3M G;  3CQZ B;  1G51 A;  4KI0 A;  5A35 A;  3UI2 A;  3G6E A;  3S1R B;  4C3H B;  4R8I A;  5J39 A;  3KLR A;  4MNO A;  2DNE A;  1LTT D;  1EQT A;  1O7Z A;  1HQR D;  1A6X A;  1I5F A;  2FJ2 A;  3L3O C;  1STY A;  4LF7 L;  1W2B A;  4A3G B;  4XTC S;  5J1Z A;  1RD9 D;  4A3J G;  1EOT A;  1DGS A;  4J6H A;  1ENA A;  3TP7 A;  1T5X D;  2G5D A;  1WVL A;  2V4D A;  3EFX D;  5IGF A;  1IW7 C;  1IL2 A;  1B53 A;  1SE3 A;  4O1N A;  3TRZ A;  1SE8 A;  1QZH A;  3CC7 A;  4A3E B;  2QIL A;  3NUC A;  5C4X G;  4HSP A;  2DY7 A;  2XTI A;  3S16 B;  5JJK A;  3HOZ B;  4BBR G;  1AE3 A;  4LF6 Q;  5CV7 A;  2X6L A;  3GQB A;  1WI5 A;  1IBK L;  4EQP A;  4EVO A;  3E9I A;  1KDC A;  1TWF H;  3OW7 A;  1F77 A;  4LFB L;  4KD3 A;  4IPG A;  2B8F A;  2NZH A;  3PIO A;  1ZYR C;  4MZ9 A;  1UE5 A;  1RTO A;  1FD7 D;  4ZUI A;  3A8J E;  2PCF B;  4PMC A;  4WOR A;  1ROD A;  2B29 A;  1T5E A;  4DAM A;  3NXW A;  3FKI H;  2M00 A;  1NAP A;  3PO3 B;  4DA2 A;  3TEH B;  4XT3 B;  5JPM C;  4JV5 Q;  4IPH A;  1FGB D;  1B44 D;  1WTH A;  2OT2 A;  3I4M B;  4P72 A;  3L9A X;  1Y1V H;  2JA5 B;  2OF1 A;  3JAM c;  4RHR A;  4B3S L;  2A1A A;  4R8N A;  4B3R L;  2CWP A;  4A3F H;  1JMC A;  4TKO B;  4GZY C;  1I50 H;  3ULJ A;  4F88 A;  1G8Z D;  4C1N I;  4YHH Q;  5JEA G;  1FJG L;  2A6H C;  1E22 A;  3A54 A;  2PMZ E;  1Y8N B;  4IUN A;  4RGN A;  4ZYS A;  5AFW A;  1JJG A;  1B3Q A;  5C0X J;  1I4H A;  1SJH D;  3KF8 B;  2ZTD A;  2PI2 E;  1XPO A;  1EOV A;  4CDD C;  1UE6 A;  4DR2 Q;  1EFI D;  3SK8 A;  2DGY A;  2F1M A;  4DK0 A;  4QL5 A;  3MEF A;  1L1O C;  3I72 A;  5E7N A;  4JI3 L;  1Q90 A;  1EY8 A;  4IO9 A;  5T1I A;  2CHB D;  4R4C A;  4P73 A;  5K36 H;  1D7Q A;  4IJH A;  2NVX H;  4PNY A;  1L0X B;  2B63 H;  1IBK Q;  1JWM D;  4B3M L;  1EYA A;  4BY1 H;  2K5W A;  2EYH A;  2B2V A;  1N33 Q;  4A3L H;  2R7Z H;  2J4X A;  4I65 A;  4LJZ C;  5CV6 A;  1EWH A;  1I4R A;  2TSS A;  3C1E A;  3K5N A;  3OOC A;  4ZCK A;  1CHP D;  1I4P A;  1JWU D;  1L1O B;  1K83 H;  1Q1E A;  3X3M A;  1KAA A;  3K57 A;  3UE0 A;  4K8J A;  2IX3 A;  1HFN A;  4DAY B;  4HIM A;  2HUG A;  3AMU A;  1EUJ A;  3OMC A;  2JSO A;  3ITP A;  2CH4 W;  1GO3 E;  4ALP A;  1O7L A;  3CRK C;  5LL6 X;  1Q46 A;  4F7X A;  1DXM A;  2PMZ B;  2EOT A;  4DV3 Q;  1NUC A;  2AUJ D;  4WJW A;  1GOZ A;  1CTM A;  2B2T C;  4NXM L;  2CKZ B;  2A8V A;  1H9M A;  1Y1W B;  1LUZ A;  2AHO B;  1F2M A;  5AJ3 Q;  1AH9 A;  1TS2 A;  5KRU A;  1PH1 A;  3W2D A;  4BXX G;  2AQ3 B;  2C9O A;  2P5Z X;  1PRT D;  3D8G A;  3H94 A;  2ZJP A;  4OO1 G;  3PGZ A;  4IPC A;  2JQO A;  3EVQ A;  4H02 A;  2H4O A;  3BYY B;  5GAD C;  4Z9C B;  4Y7N B;  2UXD L;  5C4X H;  1BCP D;  2QF7 A;  1H95 A;  2AQ2 B;  1GUO A;  4JI3 Q;  5GQO A;  3S1N H;  1EZ8 A;  3M4O H;  3STB D;  5IIF A;  2ZXO A;  3S15 B;  4JCV E;  1TWG H;  4OL7 A;  3VR4 A;  1I6H H;  2KED A;  2VW9 A;  3H0G G;  3NBH B;  1V1P B;  2B2W C;  2F0G A;  4LF5 L;  1LAC A;  5M5Y B;  3IRB A;  4GKJ L;  2EQS A;  3CU7 A;  1SYD A;  2Y0S G;  4HR7 B;  2XIW A;  2BH8 A;  3D6C A;  5T1G A;  2ASB A;  2UXB Q;  1J6Q A;  4LAA A;  2E2H B;  3J81 i;  2K5Q A;  5IYC G;  3MXU A;  4RKL A;  2KEC A;  2NVY B;  2YTV A;  4DK6 C;  2TMP A;  1G2S A;  2PNH A;  4A3M B;  3SE0 A;  1XMQ Q;  3W5O A;  4LF9 L;  1HJP A;  1DOK A;  4KKS A;  3ULL A;  5JPN C;  2R92 G;  5JJZ A;  3Q6S A;  1EIF A;  2OEO A;  1PV4 A;  2ALY B;  2F3W A;  3I91 A;  4C3H G;  4IOA A;  4X3T A;  4MTK A;  5GAG C;  3EJI A;  4DU9 A;  2NVT B;  1NCV A;  1J5E L;  2HQE A;  3QR8 A;  4KKU A;  1B50 A;  2WAC A;  2K7V A;  4UP8 A;  4KN4 C;  5H1S E;  2ICI A;  5E1F A;  1QNU A;  4FF3 A;  1D5M C;  5F2D A;  4ZRZ A;  1S72 A;  2L4N A;  4KV6 A;  3JAM L;  2F0F A;  3HOU B;  3CRL C;  2JN4 A;  3OMG A;  2ENB A;  2UUB Q;  4KHZ A;  2F0N A;  1OXV A;  4C3I B;  2EXD A;  1JC7 A;  4X66 Q;  2WV6 D;  2JA6 B;  1LM0 A;  1FNV A;  3C2P A;  1DOM A;  5CBA E;  1F9S A;  1XMO L;  2XRQ D;  4QUC A;  2JA8 G;  4A3E G;  3UDX A;  4A3C H;  4DUZ Q;  3I8Z A;  1UAP A;  3HOZ G;  4PMW A;  4GKJ Q;  4K0K Q;  4HAE A;  2E5L L;  3O13 A;  1ML0 D;  4IAL A;  3BS1 A;  4DR4 L;  3R8B A;  1XPR A;  1N32 L;  4N8F A;  2PNR C;  1CUK A;  1X54 A;  3K5L A;  2YV5 A;  2R93 B;  3AFQ A;  3IL8 A;  2HHH Q;  2RCN A;  4BY7 G;  3DM1 A;  5EPK A;  3B6Y A;  4X64 L;  2F0S A;  2K50 A;  3TP8 A;  2Q2I A;  2OCE A;  2ID0 A;  3WOF A;  1NBW A;  3CP0 A;  3I4M G;  1Z7T A;  4JOI A;  2L12 A;  3K7A B;  5I9O A;  3L2P A;  2JA5 G;  2N3S A;  4K5V A;  4R1J A;  3K5O A;  4IUU A;  3J80 c;  3TDQ A;  3M4Q A;  4OO1 H;  2NB0 A;  5EPL A;  4JI5 Q;  1NE3 A;  4K6D A;  2XVS A;  4F87 A;  1DJR D;  1L0Y B;  3PUV A;  3A0J A;  4YY3 Q;  3S1Q B;  1IBM Q;  4NB3 A;  1GM5 A;  3V05 A;  3UDI A;  1PTO H;  4RFB A;  1L0W A;  4IPD A;  1YNJ C;  3DEO A;  3FVQ A;  1EU4 A;  5D65 A;  1TII D;  4YWK A;  3VYS A;  1GUG A;  1TVX A;  2F0L A;  2R7D A;  4A3J B;  3H0G H;  1JIC A;  3GTM B;  4DV5 L;  4ZAI A;  3KJO A;  2F0U A;  3NEN A;  1LTA D;  4NDX A;  2FFK B;  2YU9 B;  2A68 D;  1RDP D;  5E4X A;  3MTS A;  2YYZ A;  1DCZ A;  4JBM A;  1LLR D;  3QJY A;  2JEA I;  2OTL A;  2UXC L;  4HJA A;  4DR7 L;  2AKW B;  4BBR B;  4QB4 A;  4L5R C;  1D1K A;  5IT9 c;  3H3V I;  2Z6B A;  2IT1 A;  4BA1 I;  1PMR A;  5KNB A;  2R92 H;  2EY1 A;  5KYL A;  4JYA L;  1TWA H;  4HCS A;  2F0V A;  2RCF A;  1U5K A;  3CQZ H;  2VUM B;  1VMC A;  5IGE A;  1HTL D;  1PYW D;  3S1R H;  3KFU A;  4WJ4 A;  1BQQ T;  1SND A;  1LTG D;  2RDH A;  3T13 A;  3KDF B;  4X65 L;  1PZI D;  4I7Z C;  2Q8I B;  1SBB B;  1C7Y A;  2SDF A;  3M4P A;  5KEE A;  2LXK A;  4LFA L;  3HKZ E;  4A3G H;  2KEE A;  4DV0 L;  1Y1W G;  1JE4 A;  3F2D A;  2K32 A;  2RDG A;  4GLV B;  1KAB A;  2E76 C;  3GTO B;  1NR2 A;  1QUQ B;  3I55 A;  5C0X H;  1JT8 A;  1QVF A;  1MHW C;  1QOH A;  3PO2 H;  4A3D B;  3I4N H;  1KL9 A;  1RHP A;  3T53 B;  3A5U A;  3H15 A;  3CW2 C;  1HNZ L;  3J7A F;  5BR8 L;  3RUZ A;  5CV4 A;  1VQC A;  3HOW G;  4IUQ A;  2RF4 A;  1KNE A;  1S5C D;  1H9S A;  2VQF L;  3KBX A;  4QMG A;  3S16 H;  1KD1 C;  3HOZ H;  1PHJ A;  4P2C B;  1LT4 D;  1SFO B;  3GTG B;  2EYM A;  2IY5 B;  2IL8 A;  1VQ9 A;  4JC0 A;  4EGV A;  3SVM A;  1QIL A;  5GRO A;  1Y8P B;  1KLU D;  5JVH 3;  4RWS C;  5GAE C;  1BR9 A;  1E7Z A;  4DKA C;  4IOC A;  3RZO B;  1FNW A;  2UXC Q;  5DLQ E;  1C8C A;  1BKB A;  2PW7 A;  5KYI A;  3RD4 A;  2ZM6 Q;  4ULL A;  1YNN D;  3PO3 H;  3S2D B;  1VMP A;  2MHV A;  1H9R A;  4JYA Q;  1RCV D;  4FXD A;  5IYD H;  3SXH A;  2HD3 A;  2K75 A;  1N36 Q;  1CKO A;  1CKM A;  3NEM A;  2VB3 X;  3TQY A;  1YHB A;  4OWT B;  4X65 Q;  3GO5 A;  1D1I A;  3HKZ B;  4OIJ A;  2JXM B;  1Q12 A;  1Y69 U;  1PTO D;  1KDB A;  2KEN A;  3Q22 A;  1JOQ A;  2G9D A;  4Y52 H;  1VF7 A;  1G6Z A;  1LTB D;  2EVB A;  5JEA J;  1MIU A;  1MSG A;  1H9J A;  4R4I A;  1KXL A;  4L8J A;  1VQO A;  1CZW A;  1XPU A;  4DR3 L;  1YZ6 A;  2RVL A;  2I0Q A;  2E75 C;  2NN6 G;  1QZG A;  3CCL A;  2LSS A;  1Q1B A;  4ODG A;  3KF6 B;  1EQR A;  3HOU G;  1EU3 A;  2K04 A;  3J80 L;  1Z9F A;  4A3K B;  3R2T A;  1E0B A;  2MUY A;  1A62 A;  4C3I G;  4JI4 L;  2CW0 C;  2JA6 G;  4F8M A;  3DM3 A;  3CCS A;  1Y8O B;  3GTL B;  4X3U A;  2XNA C;  4OHJ A;  4CHT B;  3E0E A;  4P75 A;  5ELO A;  1A15 A;  5ELE A;  4QJF A;  2A69 D;  1LT5 D;  2EY6 A;  3LNN A;  1XTC D;  3HOY H;  4NKL A;  1ICF B;  2G9H D;  1D2B A;  3D4W A;  5BN4 A;  4NXN Q;  3NWT A;  5CR3 A;  4AQY L;  4DNR B;  1WTO A;  1XTD A;  2EXZ A;  1HFG A;  1U4P A;  1JB3 A;  2GA4 B;  4BBS H;  3S2H B;  3OIP A;  2Z6K C;  2K01 A;  1PFN A;  2KHI A;  5E4W C;  4DXG A;  1LTR D;  2ES2 A;  1CM9 A;  3CME A;  3S24 A;  1VQL A;  3TN2 A;  1ESF A;  5IT9 L;  2X6G A;  2EZV A;  1X3F A;  3EQL C;  1RL2 A;  5IP9 H;  5KNC A;  2QEX A;  1WTX A;  2QEJ C;  2VNU D;  4OEM B;  2SNS A;  1E24 A;  1F2L A;  5KGU A;  4LF4 Q;  1X55 A;  2I46 A;  3CCR A;  5DM6 3;  2JEB I;  2JK8 A;  2F0E A;  2KBN A;  4DR3 Q;  4WJ3 M;  2K05 A;  3BZK A;  3NEL A;  5FK9 C;  2B2U C;  2PYK A;  2UUA Q;  1KC8 C;  2L1B A;  1I4G A;  5I9P A;  3CCJ A;  2MGS A;  2F3I A;  1VCI A;  5IYB G;  1YHQ A;  5IWA Q;  3P75 A;  1OXU A;  1X3G A;  3M9B A;  3ZJY C;  1PFS A;  1JE5 A;  1IW7 D;  1STA A;  4P71 A;  3T51 B;  1TWH H;  1B7Y B;  2O2L D;  1SE2 A;  3J7A V;  4JI2 Q;  1E2Z A;  2DN8 A;  4DNT B;  1SR3 A;  4DV7 L;  5M5Y H;  2FIN B;  3JAM i;  3OTO Q;  5LMU L;  3BG3 A;  2K1B A;  3IFD A;  1MSH A;  1YEZ A;  1FL0 A;  3MC0 B;  1L2F A;  2OXP A;  3VR3 A;  2R3Z A;  3QB3 A;  4GNX C;  3BZC A;  3CCQ A;  1GUS A;  2JA8 B;  2E2H H;  2N49 A;  1ILP A;  1BBU A;  2IX1 A;  2AWN A;  3NQI A;  1D6E C;  4Q0F A;  5A2Q E;  2M2L A;  2NVY H;  1EY6 A;  2QCP X;  4UY8 C;  1UUP A;  2EYJ A;  2RHS B;  4WFN 3;  5JAV A;  4A3M H;  1ZYR D;  3BVM A;  1SAP A;  3BZD B;  2QDL A;  3HFZ B;  4K14 A;  1I94 Q;  2F0T A;  3VDY A;  3L0O A;  5HGT A;  2L15 A;  2VUM G;  1W6K A;  4JI6 L;  3A74 A;  3I73 A;  2HDL A;  1KQS A;  4Q5V A;  1TU2 B;  4BY7 B;  2F0M A;  3MEH A;  5IY0 A;  4OGQ C;  4GNX B;  1PFM A;  2E2J B;  1STN A;  4GS3 A;  5FLM G;  4FF2 A;  4KHP Q;  1CKN A;  4PZ6 A;  3PF4 A;  2NN6 H;  3GP7 A;  4ZKB B;  3U9S A;  4IFD J;  2A6H D;  3D31 A;  4OXP A;  3KBG A;  4UAI A;  3IKJ A;  1DON A;  3MXN A;  2MO0 A;  2EYP A;  4H44 C;  3EA6 A;  3RNU A;  5EGT A;  2BCO A;  1S5D D;  4A93 B;  1MD2 D;  1EZ6 A;  2IHF A;  4YCU A;  4EQ5 A;  1SE4 A;  2QW7 A;  4DN4 M;  2FHT A;  4A3D G;  1HR0 W;  4LF7 Q;  2KCM A;  3D3R A;  4QCL A;  5BN3 A;  3PIO 3;  2JA7 H;  4QIW E;  4G57 A;  3K0Y A;  3Q0A A;  1QVC A;  3HRZ C;  3S1M H;  3KLS X;  2IW3 A;  4POG A;  2K28 A;  2MP1 A;  3MXP A;  1VQD A;  1HPC A;  1XYI A;  3PCO B;  2LS0 1;  1MKH A;  4IN3 A;  5COR A;  2R93 H;  4M1U B;  1VQM A;  2EYF A;  1VQ8 A;  3GV6 A;  3I70 A;  5M5W B;  1R4P B;  1CI3 M;  3FP9 A;  2KHS A;  2AQ1 B;  3GTP H;  2NVQ B;  1EEI D;  3MVV A;  5EKI A;  1HZB A;  2DUD A;  4JI7 L;  3GDE A;  4LFB Q;  4MN3 A;  2UUC L;  2K4K A;  3K7A H;  3SEB A;  1I3Q H;  4AYB E;  2VQE L;  4JI6 Q;  4POF A;  3FEW X;  3BDL A;  5C4J H;  3LWE A;  2F0W A;  5M3M H;  4G7Z C;  3HKZ G;  3FRP B;  3CC2 A;  1SMY C;  4HED A;  1GUW A;  4DR6 L;  2ATW A;  1EEF D;  1E2V A;  1V1P A;  2LXJ A;  2F0P A;  4U67 3;  3S1Q H;  1KLG D;  2VZA A;  4JW0 A;  4B3S Q;  2F0J A;  3P7J A;  3AQQ A;  4B3R Q;  4JI8 L;  5C44 B;  1TXY A;  1FJG Q;  4A3J H;  4RHS A;  3U4V A;  1X9N A;  4QIW B;  2B2V C;  4FXK C;  4NMZ A;  4A3K G;  3BDC A;  4C3J B;  2YU9 H;  3KJP A;  2MPM A;  2H1E A;  3T4A C;  2PQE A;  2K5V A;  1IKL A;  3GD7 A;  4QUF A;  3CCV A;  1MJE A;  1B8A A;  1Y14 B;  2EPB A;  3HOW B;  3OWF A;  3FPP A;  2B2W A;  1SNP A;  4KHV A;  3V2T A;  3K0X A;  1YI2 A;  1M1K C;  2EY2 A;  5IP7 G;  1Q8I A;  3OWE B;  4BBR H;  4OX9 L;  2NZO A;  2OQK A;  4YIJ A;  3T1Y L;  4CJ1 B;  3K8A A;  4LFC L;  1U9R A;  2VUM H;  1N34 L;  4AYB B;  3KLS A;  4B3M Q;  2ZTC A;  1A0I A;  3M85 A;  3GTK B;  1LT3 D;  3T1H L;  5LMN L;  4FO2 A;  4GN3 B;  4A75 A;  1K8M A;  1WCM B;  4RG1 A;  3G48 A;  1CHQ D;  5DM7 3;  1IL8 A;  1OXS C;  5FLM H;  4B3T L;  3K6O A;  4OIK A;  1F9P A;  4CDF C;  1WTW A;  1Q8K A;  4DR1 L;  4O0A A;  2E74 C;  2XSC A;  4RGO S;  3GTQ H;  1SYG A;  2A19 A;  3A5Z B;  3S14 H;  4NW2 A;  2OTJ A;  1AW7 A;  3GTO H;  3QG1 A;  5G3L F;  1C0A A;  1UNS A;  4K6L A;  1AFP A;  5JEA H;  4TSS A;  1OO9 B;  4A4I A;  3J7Z C;  2EJG C;  3T16 A;  2HIX A;  3CXC A;  4QY7 A;  4NXM Q;  3RZD B;  2LFN A;  2PZW A;  2EJM A;  4IFD G;  2HDM A;  4XT1 B;  3EN2 A;  4RMF A;  1SFO H;  1TWC B;  2AMC B;  1TWF B;  2UU9 L;  2IWH A;  3TME A;  4P74 A;  2L0C A;  1TS3 A;  3PQI A;  4EX5 A;  3U9O A;  3L7Z C;  5IGB A;  5NUC A;  1Q3L A;  3CF5 A;  2N8N A;  2UXD Q;  1OXT A;  3RZO H;  1LTS D;  1J9O A;  1HTP A;  4IUR A;  4AH6 A;  3FKI B;  1XNR L;  2VY3 A;  3DEP A;  4K2L A;  1A2U A;  4AIM A;  4GOP C;  3RN2 A;  5C3W A;  1U4M A;  2CWA A;  3AYH B;  1Y1V B;  5ELD A;  3KK7 A;  1O7Y A;  4HJ8 A;  4LF5 Q;  5IGC A;  2XGT A;  3M3Y B;  1KNA A;  5C6A A;  3OIQ A;  3A8I E;  3PF5 A;  1U4L A;  1HNW L;  4N9P A;  4OO1 I;  2D0P A;  4R9W A;  4CKC A;  3D6W A;  1EQQ A;  2Q8T A;  2O5J C;  2N55 A;  2K14 A;  5FO8 B;  3I4O A;  4XQJ A;  1SNC A;  2IX0 A;  5C3E G;  4GOP B;  1SDF A;  3NK9 A;  3RMH A;  1SYB A;  1E1O A;  4DXF A;  4LF9 Q;  1ZXT A;  2DNC A;  4DK1 A;  1X3P A;  3R93 A;  1SMX A;  2B2Y A;  1G6P A;  1A2T A;  2Q2H A;  1NNX A;  2CH4 A;  4BXX H;  3A8K E;  2NWG A;  3BVG A;  1I6V C;  4A3K H;  1F2Z A;  2F4I A;  2D9U A;  4JI0 L;  3MZ5 A;  2Q8R E;  1J5E Q;  2EY5 A;  1FNU A;  4XQQ A;  3UE1 A;  4A93 G;  4KJO A;  4K5X A;  2BE5 C;  4OWW B;  1YNJ D;  4BY1 B;  2CFM A;  2QDB A;  1SLJ A;  3TZU A;  2D62 A;  4KK7 A;  5D3D A;  2NYZ D;  3UDF A;  3PUY A;  5C5L A;  2E2I H;  4ME5 A;  4FF1 A;  1EY4 A;  3NTI A;  1HR0 L;  1XNQ L;  2K5N A;  1IBL L;  4QGU A;  2KCC A;  2F3V A;  3CCU A;  1ET6 A;  2WP8 J;  1XMO Q;  2N78 A;  2HT1 A;  2KOL A;  4CDE C;  4JOI C;  3QOJ A;  2F0K A;  1BO0 A;  4PZ7 A;  5DEH A;  3S2H H;  4KN7 C;  3J81 E;  4MHE A;  3I90 A;  1BXT A;  5IYC H;  1PH3 A;  5M9O A;  2V1C C;  4XIG S;  4PG3 A;  1T9H A;  2E5L Q;  1VQN A;  2E2D C;  4FP5 D;  4DR5 L;  1PH5 A;  3K58 A;  2NTT A;  3CHB D;  4DR4 Q;  2WII B;  4ID6 A;  3TP5 A;  1N32 Q;  1X32 A;  4LUZ A;  3QWN A;  3NTH A;  3KOJ A;  3V96 A;  4RKB A;  2LKV A;  1R9T B;  1PH8 A;  2AWO A;  4O2D A;  5C0X I;  4S3S A;  2JJQ A;  3HOV G;  3AB9 A;  1PH6 A;  1F2Y A;  1WTR A;  2AUK A;  2KVM A;  3A7L A;  4YWM A;  3MA2 B;  4X64 Q;  3D4D A;  1EIG A;  3RLN A;  4C3H H;  1RTN A;  2HCI A;  5GAH C;  1PXU A;  4IFD H;  5D3I B;  2A68 C;  5C4Z A;  4A3I G;  4YWL A;  3S1N B;  3CC4 A;  3HKS A;  3M4Y A;  1TWG B;  1Q86 C;  5C44 G;  2NZ1 D;  2ZXP A;  4DNI A;  1M90 C;  2NBF A;  2Q2U A;  4YCW A;  1HCZ A;  1P16 A;  1TT2 A;  1STB A;  1RF2 D;  4C3J G;  3S17 B;  1SXT A;  5IOD A;  5FJ8 G;  5FLX E;  5IGD A;  2JA8 H;  4JBK A;  4A3B B;  1SYC A;  1J8I A;  1GVP A;  1IBL Q;  2RKS A;  4HJ7 A;  1EYG A;  3GTJ B;  4A3E H;  1HNX L;  4HID A;  5KND A;  1W3S A;  5ELC A;  3K59 A;  4DV5 Q;  1X56 A;  4UP7 A;  1VQP A;  1V1O A;  3K81 C;  3SK5 A;  4GKK L;  5FKA C;  4AYB G;  5EJW A;  3SK4 A;  1PH4 A;  1SRO A;  1HH2 P;  4K5W A;  4BY7 H;  3RN5 A;  4DR7 Q;  5CYU A;  1YJW A;  1SEB D;  1WCM G;  2DJG C;  2RSN A;  4LF8 L;  4G7O C;  1TKW B;  3URY A;  5JJI A;  2A73 B;  4B9W A;  1JR0 D;  4L5T A;  3I4M H;  3F1Z A;  2JA9 A;  4NP5 A;  1HZ9 A;  2JA5 H;  3AEV A;  5LHY 1;  1NMF A;  3J7A 5;  1STH A;  4FDB A;  2F0Q A;  1QNK A;  3LWU A;  1VDZ A;  3RR5 A;  1YJ9 A;  1FVI A;  3DWA A;  4X62 L;  1SJE D;  2BH2 A;  2EDG A;  1JOO A;  4LFA Q;  4R4T A;  1JQY D;  3M7G A;  4DV0 Q;  4KLK A;  2VXW A;  2SEB D;  3SDZ A;  4B08 A;  3IFT A;  1CA6 A;  4X3K A;  1U0L A;  2K5H A;  4CJ0 B;  3IAY A;  3ZYY X;  2CW0 D;  3Q24 A;  1VQG A;  3MFY A;  1RKN A;  3MFG A;  1H9S B;  1HNZ Q;  5BR8 Q;  2PQA A;  3F8T A;  1LV9 A;  5HY6 A;  1WTV A;  1W6J A;  2VQF Q;  1IZ6 A;  1NTG A;  1CQF A;  5CBE E;  4IQZ A;  3FKI G;  5HUR A;  1PTO C;  4J1M A;  1HUM A;  2F0H A;  3EBE A;  2NVQ H;  3MWY W;  4EQO A;  1GXD C;  1Y1V G;  3VYU A;  3TBI B;  2RA4 A;  1KRT A;  4G7H C;  2WB1 E;  4JPB W;  4DV1 L;  1B2T A;  1WJJ A;  5LMN W;  3DMU A;  2D2C C;  3G6J B;  2QA4 A;  1VQ7 A;  2FMC A;  5M5X B;  3I2Z A;  1ASZ A;  1HA6 A;  1BDO A;  1C9O A;  1YJN A;  2RQX A;  1DD2 A;  3NBI A;  1IXR A;  1EYD A;  3DUZ A;  5J22 A;  5CMD A;  2A6E C;  2GVB A;  2B39 A;  3U50 C;  1VS0 A;  5JOB A;  3ERQ A;  4H0L C;  5C44 H;  5HGQ A;  5L37 A;  3NHH A;  1Y1W H;  3Q23 A;  2A69 C;  1QG7 A;  1XWE A;  2QGQ A;  4LF6 L;  1A8V A;  2OQ0 A;  2D5D A;  3CAM A;  4GLX A;  2GN5 A;  1PYS B;  1NY4 A;  5K36 G;  4C3J H;  3I4L A;  4RAU C;  2KCN A;  2WKD A;  3DWP A;  1LTI D;  2B63 G;  2ZTE A;  4Y7N H;  3HOW H;  4BY1 G;  4ME3 A;  4HN7 A;  4A3L G;  4ZQ3 A;  2Z4H A;  1VQF A;  1MGS A;  3H3V C;  1K8O A;  1TWA B;  2A5H A;  3S15 H;  2K52 A;  4JI4 Q;  2F4V L;  4FNF A;  3HP3 A;  3ERO A;  1ENF A;  3SK6 A;  1VQK A;  1TR5 A;  3E9H A;  3DXJ C;  3T56 B;  2WB1 B;  3GTK H;  3DLL A;  4FXG C;  4TVA B;  5EPJ A;  1WCM H;  2XN9 C;  4YHH L;  3CPF A;  1KIX A;  5CGK A;  4DV1 Q;  3F2C A;  3H91 A;  1ZEQ X;  4KY7 A;  1VQE A;  5C4H A;  4AQY Q;  2NN6 I;  1IYU A;  1MI2 A;  5I2X A;  4KY5 A;  4UP9 A;  1O80 A;  2A74 C;  3BU2 A;  4IUV A;  3U4Z A;  4DR2 L;  2K33 A;  4DF7 A;  1VQB A;  2Z9H A;  3PO2 B;  4JVZ A;  3KF8 A;  3I4N B;  3K80 C;  1B70 B;  1H9K A;  5K5P A;  1VQH A;  3HGB A;  3EIV A;  1WFQ A;  4HIK A;  4MIU A;  1M8A A;  1D5Z C;  1M4V A;  5C3E B;  1AP0 A;  1QWY A;  3RZD H;  2NVT H;  4XXE A;  4R4O A;  1EY9 A;  1GD7 A;  4CBV A;  4JI1 L;  1ZKO A;  2JP1 A;  1VF5 C;  2LY7 A;  4CDC C;  3PIP A;  2PO4 A;  3FDT A;  3GV3 A;  1B1Z A;  4M8A A;  5ISR A;  3G4S A;  1D8L A;  1TWC H;  2H5X A;  1N33 L;  4JBW A;  3Q8D A;  3HOU H;  1JWS D;  3OHX C;  1V9P A;  1QCB D;  4C1N K;  1CK1 A;  4K2K A;  4EQN A;  1HXY D;  1KTK A;  4GN4 B;  1SNM A;  3NP8 A;  3HS0 C;  4C3I H;  3NSW A;  2MO1 A;  5EAY A;  4C2M B;  2JA6 H;  1MBY A;  1X3Q A;  1L1O A;  1YNX A;  4A3B G;  2F4V Q;  1I4Q A;  1YVC A;  4RGT A;  4DAY A;  2WFW A;  4FYD A;  1A3T A;  2X69 A;  4DV3 L;  4DV7 Q;  3E3X A;  3F2U A;  5LMU Q;  1YHA A;  3M3Y H;  3DWQ A;  1LAB A;  1HHV A;  2CQA A;  3BDO A;  5AJ3 L;  2NTS A;  3PIP 3;  3PUW A;  4CJ2 C;  1V8Q A;  1PYB A;  5FO7 B;  3VR5 A;  3FMC A;  3PMF A;  1NJI C;  1Z6H A;  1HA5 A;  2PI2 A;  2WAQ E;  3MAQ A;  3HOX B;  1TY2 A;  2MJ8 A;  2Z0S A;  1PZK D;  1A3V A;  3BJU A;  2R61 A;  1AN8 A;  4CGY B;  4L6T B;  1EYC A;  5EKK A;  4HTH A;  1SMY D;  3K5M A;  1QB5 D;  3AU7 A;  2Z8L A;  3VA5 A;  3W1B A;  3WWV A;  1B4O A;  1K28 A;  2VL6 A;  1DM0 B;  1LTL A;  1N8R C;  1GJX A;  4DGZ A;  5M3F B;  1CKN B;  3HOV B;  2KUM A;  1JB7 A;  1IKM A;  3SGI A;  2B2T A;  4JI1 Q;  1EL0 A;  2XRS D;  5CV9 A;  3MXN B;  4L5S A;  5A2Q L;  1G2T A;  1D5X C;  1CZG A;  2KCT A;  4L5Q A;  4A3C G;  2RBM A;  3KLW A;  3NBH A;  4A3I B;  4ABN A;  3HOY B;  2UXB L;  4UDU C;  3K7U C;  4HMJ A;  5IYB H;  1KHI A;  2ZT9 C;  4DK3 C;  2SOB A;  3BVZ A;  2F0D A;  4RCO A;  4BA2 I;  4RCN A;  1AEX A;  1HZC A;  2BA1 A;  1PA6 A;  1XMQ L;  3GTM H;  3JAM E;  1CSQ A;  2OWO A;  4BBS B;  4HMI A;  1WTQ A;  5FOB B;  1WD0 A;  3C3L A;  1V1Q A;  5D14 A;  3CCE A;  4DPG A;  4C56 C;  4GN5 A;  4J15 A;  4ZKC B;  1A63 A;  3OYY A;  1EY5 A;  2R7F A;  2WAQ B;  3ER0 A;  1R9T H;  1DOL A;  2JYO A;  1DYQ A;  2UUB L;  1QJO A;  1GKH A;  4HIO A;  4CKE A;  1PLF A;  2RHQ B;  2XWJ B;  4BS9 A;  4X66 L;  1XJV A;  4DUY L;  1STE A;  5EKL A;  4JI7 Q;  5I2Y A;  1PRT C;  1VQA A;  1CFM A;  2UUC Q;  4IZ8 A;  1PZJ D;  2VQE Q;  1JJC B;  1STG A;  1PTO F;  1TWH B;  3TZD A;  4DUZ L;  1BCP C;  3LGJ A;  3JC6 6;  4DR6 Q;  1UEA B;  2FXQ A;  3STB C;  4K0K L;  4V0B A;  2YTX A;  4X6A H;  2N88 A;  3ERS X;  2K03 A;  4XYO A;  1PDQ A;  4A3D H;  3S17 H;  3PUZ A;  4FF4 A;  1Q81 C;  2CQO A;  4IUP A;  1JCK B;  1KAW A;  4JI8 Q;  3ICE A;  4A3B H;  3H09 A;  1PRT B;  4HCE A;  2F52 A;  3GTJ H;  2I07 B;  2HHH L;  3D0F A;  3OSO A;  1BUV T;  2ZJR A;  1Z47 A;  3J7Y W;  3QOL A;  4H7B A;  1WOC A;  3AFP A;  2B8G A;  2CCZ A;  1R4Q B;  3GTG H;  1BCP B;  4GOP A;  5IOC A;  3TP6 A;  1YBY A;  3X3N A;  1F9Q A;  4U68 A;  2KJX A;  2WKC A;  1Q82 C;  1G29 1;  2WB1 G;  2E8G A;  1K3R A;  3J80 i;  2IHE A;  4JI5 L;  1PH7 A;  1KRS A;  3HEJ A;  4OX9 Q;  3T1Y Q;  3TS0 A;  1TS5 A; 
#chains in the Genus database with same CATH homology
 4N9T A;  5E3F A;  5EBD A;  4KD4 A;  1IHZ A;  3NTK A;  1ONL A;  2VB2 X;  4G4K A;  2F0I A;  4A3F B;  1OXX K;  3DHQ A;  1I50 B;  2LMC B;  3SHL A;  3OPO A;  3E0J A;  5C0X G;  4LK1 C;  4H13 C;  4X3S A;  1S5F D;  5IGG A;  3D4R A;  3LX0 A;  4PQX A;  4QF4 A;  2J0T D;  1BF4 A;  2R6G A;  2JA7 B;  3I3C A;  1XXG A;  1V43 A;  3S1M B;  4DAV A;  2CVR A;  3VA7 A;  1SYF A;  3QO2 A;  2BE5 D;  1SNO A;  3C46 A;  5DAU A;  3WDN A;  4ZLT F;  3E6Z X;  2NVX B;  1JOR A;  2B63 B;  3S9W A;  1SSO A;  3GTP B;  1QE6 A;  2Z1C A;  4KTA A;  2R7Z B;  1JOK A;  1S4Z A;  1I3Q B;  5COY A;  4O42 A;  3QIA A;  3P1H A;  5C4J B;  1K83 B;  2K6A A;  5M3M B;  2KA7 A;  2XWB B;  1PFB A;  3ONA B;  2B2Y C;  1GHJ A;  5ELB A;  2ICE C;  2K5D A;  1AZQ A;  1E2W A;  4IFD I;  5I6Y A;  3FPU B;  1GHK A;  2EE1 A;  3MXG A;  3C1F A;  2Z4I A;  4E6I A;  1CT1 D;  1XX8 A;  1SNQ A;  1HUN A;  4KKT A;  4B9X A;  1O78 A;  1TQO A;  2O5I C;  1ENC A;  3BYT B;  1BOS A;  4PMB A;  5C4X B;  4KMU C;  4KY6 A;  1WD1 A;  3M4O B;  4WRD A;  1G91 A;  5TSS A;  1C4Q A;  2L55 A;  1I6H B;  1TS4 A;  4ZK9 B;  1EY0 A;  3W3A A;  5CC4 A;  4ILW A;  2BA0 A;  3J80 E;  1I4X A;  5I4D A;  5KIX A;  5EBC A;  3WOE A;  2QKI C;  1B9M A;  1S5E D;  5CV8 A;  2BDO A;  2L11 A;  3RLF A;  1CQV A;  2PPB C;  4CKB A;  3GTQ B;  3S14 B;  2NUC A;  1HQM C;  4LMQ D;  1WTP A;  4PV1 C;  1ESR A;  3CKI B;  1BBX C;  1B9N A;  2EJF C;  1FR3 A;  1EIH A;  3A7A B;  4RA8 A;  1NSN S;  2ZXR A;  4RH6 A;  3TSS A;  5ELF A;  2O4X A;  3ND8 A;  3NE5 B;  3N6R A;  1NR4 A;  3HZX A;  2F03 A;  3N52 A;  2BOS A;  1F9R A;  3VYR A;  2JE6 I;  1ICW A;  3E5S A;  5IT9 E;  1LO5 D;  3NPP A;  4ZUJ A;  4TRD A;  2PZT A;  3PUX A;  2PZU A;  3J81 L;  2PW5 A;  1S5B D;  1II3 A;  3NQT A;  3A55 A;  4IUT A;  1IYV A;  5LL6 S;  5FO9 B;  3SR1 A;  4XQN A;  2C5C A;  1PRT F;  1EQV A;  5DNF A;  4HSV A;  1A3U A;  1YNN C;  3VR2 A;  1B3A A;  2HCC A;  2DY8 A;  3M7N A;  1AZP A;  1RJT A;  1GUN A;  3VR6 A;  1BCP F;  3NWS A;  1GUT A;  1ILQ A;  5G3L D;  4JK1 C;  4XDX A;  3VYT A;  5CV5 A;  5JVG 3;  4DAP A;  1EWC A;  3A56 A;  2RDF A;  3PV0 A;  3ND9 A;  2M9V A;  2KQ3 A;  1SYE A;  4KJN A;  3HG9 A;  1BNZ A;  1ET9 A;  4L63 B;  4BWG B;  4V19 0;  2A6E D;  2WIN B;  5FLX L;  2BDN A;  1TY0 A;  2FMM A;  4FVM A;  1EY7 A;  2E2I B;  1DZ1 A;  1PTO B;  1CA5 A;  3G7L A;  1FYC A;  2L9H A;  3MHB A;  2EYO A;  2L5T A;  3R2I A;  3KUP A;  4XYQ A;  5EQ0 A;  3H0G B;  2F0O A;  4J8Q A;  2B2U A;  4TQU S;  1HRJ A;  5BN5 A;  5C3X A;  2Y0S B;  2SNM A;  1LT6 D;  5I6W A;  2J7Z A;  1C48 A;  2IPK D;  3P20 A;  2IJ0 A;  2RSO A;  4K8I A;  1KDA A;  1U4R A;  3R3O A;  2R92 B;  4RGM A;  5C5M A;  2EYL A;  3H6M A;  4DFA A;  3CQZ B;  4KI0 A;  5A35 A;  3UI2 A;  3S1R B;  4C3H B;  4R8I A;  5J39 A;  3KLR A;  2DNE A;  1LTT D;  1EQT A;  1O7Z A;  1HQR D;  1A6X A;  2FJ2 A;  3L3O C;  1STY A;  4A3G B;  4XTC S;  5J1Z A;  1RD9 D;  1EOT A;  4J6H A;  1ENA A;  3TP7 A;  1T5X D;  1WVL A;  2V4D A;  3EFX D;  5IGF A;  1IW7 C;  1B53 A;  1SE3 A;  4O1N A;  4A3E B;  2QIL A;  3NUC A;  4HSP A;  2DY7 A;  3S16 B;  3HOZ B;  5CV7 A;  2X6L A;  3GQB A;  4EQP A;  4EVO A;  1KDC A;  3OW7 A;  1F77 A;  4KD3 A;  2B8F A;  1ZYR C;  1RTO A;  1FD7 D;  4ZUI A;  3A8J E;  2PCF B;  4PMC A;  4WOR A;  1ROD A;  1T5E A;  3NXW A;  2M00 A;  1NAP A;  3PO3 B;  4DA2 A;  4XT3 B;  5JPM C;  1FGB D;  1B44 D;  2OT2 A;  3I4M B;  3L9A X;  2JA5 B;  2OF1 A;  4RHR A;  4R8N A;  4TKO B;  4GZY C;  4F88 A;  1G8Z D;  4C1N I;  5JEA G;  2A6H C;  3A54 A;  1Y8N B;  4IUN A;  4RGN A;  4ZYS A;  5AFW A;  5C0X J;  1I4H A;  1SJH D;  1EFI D;  3SK8 A;  2F1M A;  4DK0 A;  3I72 A;  1Q90 A;  1EY8 A;  5T1I A;  2CHB D;  5K36 H;  4PNY A;  1L0X B;  1JWM D;  1EYA A;  2K5W A;  2EYH A;  2B2V A;  2J4X A;  4I65 A;  4LJZ C;  5CV6 A;  1EWH A;  1I4R A;  2TSS A;  3C1E A;  3K5N A;  3OOC A;  1CHP D;  1I4P A;  1JWU D;  1Q1E A;  3X3M A;  1KAA A;  3K57 A;  4K8J A;  2IX3 A;  1HFN A;  2HUG A;  3AMU A;  3OMC A;  2JSO A;  3ITP A;  1O7L A;  3CRK C;  5LL6 X;  4F7X A;  1DXM A;  2PMZ B;  2EOT A;  1NUC A;  2AUJ D;  4WJW A;  1GOZ A;  1CTM A;  2B2T C;  1H9M A;  1Y1W B;  1F2M A;  1TS2 A;  5KRU A;  3W2D A;  2AQ3 B;  2C9O A;  3D8G A;  1PRT D;  3H94 A;  4OO1 G;  3EVQ A;  2H4O A;  3BYY B;  4Z9C B;  4Y7N B;  1BCP D;  2QF7 A;  2AQ2 B;  1GUO A;  1EZ8 A;  5IIF A;  2ZXO A;  3S15 B;  4OL7 A;  3VR4 A;  2KED A;  1V1P B;  2B2W C;  2F0G A;  1LAC A;  5M5Y B;  3CU7 A;  1SYD A;  4HR7 B;  2XIW A;  3D6C A;  5T1G A;  4LAA A;  2E2H B;  2K5Q A;  3MXU A;  4RKL A;  2KEC A;  2NVY B;  2TMP A;  1G2S A;  4A3M B;  3SE0 A;  1DOK A;  4KKS A;  5JPN C;  5JJZ A;  3Q6S A;  2OEO A;  2F3W A;  3I91 A;  4C3H G;  4X3T A;  3EJI A;  4DU9 A;  2NVT B;  1NCV A;  2HQE A;  4KKU A;  1B50 A;  2WAC A;  2K7V A;  4KN4 C;  2ICI A;  5E1F A;  1QNU A;  4FF3 A;  1D5M C;  5F2D A;  4ZRZ A;  2L4N A;  4KV6 A;  3JAM L;  2F0F A;  3HOU B;  3CRL C;  3OMG A;  2ENB A;  4KHZ A;  2F0N A;  1OXV A;  4C3I B;  1JC7 A;  2WV6 D;  2JA6 B;  1FNV A;  3C2P A;  1DOM A;  5CBA E;  1F9S A;  2XRQ D;  4QUC A;  3I8Z A;  1UAP A;  4PMW A;  4HAE A;  3O13 A;  1ML0 D;  4IAL A;  3BS1 A;  3R8B A;  2PNR C;  3K5L A;  2R93 B;  3IL8 A;  3DM1 A;  5EPK A;  2F0S A;  3TP8 A;  2ID0 A;  3WOF A;  1Z7T A;  2L12 A;  3K7A B;  5I9O A;  4K5V A;  3K5O A;  4IUU A;  3TDQ A;  4OO1 H;  2NB0 A;  5EPL A;  4K6D A;  2XVS A;  4F87 A;  1DJR D;  1L0Y B;  3PUV A;  3S1Q B;  3V05 A;  1PTO H;  4RFB A;  1YNJ C;  3DEO A;  3FVQ A;  1EU4 A;  5D65 A;  1TII D;  3VYS A;  1GUG A;  1TVX A;  2F0L A;  4A3J B;  1JIC A;  3GTM B;  4ZAI A;  2F0U A;  1LTA D;  4NDX A;  2FFK B;  2YU9 B;  2A68 D;  1RDP D;  5E4X A;  3MTS A;  2YYZ A;  1DCZ A;  1LLR D;  3QJY A;  2JEA I;  4BBR B;  4QB4 A;  1D1K A;  2IT1 A;  4BA1 I;  1PMR A;  5KNB A;  2EY1 A;  5KYL A;  4HCS A;  2F0V A;  2VUM B;  1VMC A;  5IGE A;  1HTL D;  1PYW D;  1BQQ T;  1SND A;  1LTG D;  2RDH A;  3T13 A;  1PZI D;  4I7Z C;  2Q8I B;  1SBB B;  2SDF A;  5KEE A;  2KEE A;  1JE4 A;  2K32 A;  2RDG A;  1KAB A;  2E76 C;  3GTO B;  1NR2 A;  5C0X H;  1QOH A;  4A3D B;  1RHP A;  3T53 B;  3J7A F;  3RUZ A;  5CV4 A;  4IUQ A;  1KNE A;  1S5C D;  1H9S A;  3KBX A;  4QMG A;  4P2C B;  1LT4 D;  1SFO B;  3GTG B;  2EYM A;  2IL8 A;  4EGV A;  3SVM A;  1QIL A;  5JVH 3;  1Y8P B;  1KLU D;  4RWS C;  1BR9 A;  3RZO B;  1FNW A;  1C8C A;  2PW7 A;  5KYI A;  3RD4 A;  4ULL A;  1YNN D;  3S2D B;  1VMP A;  2MHV A;  1H9R A;  1RCV D;  4FXD A;  3SXH A;  2VB3 X;  3GO5 A;  1D1I A;  3HKZ B;  4OIJ A;  2JXM B;  1Q12 A;  1Y69 U;  1PTO D;  1KDB A;  3Q22 A;  1JOQ A;  2G9D A;  1VF7 A;  1G6Z A;  1LTB D;  2EVB A;  5JEA J;  1MSG A;  1H9J A;  4L8J A;  1CZW A;  2RVL A;  2E75 C;  2NN6 G;  1Q1B A;  4ODG A;  1EU3 A;  2K04 A;  3J80 L;  4A3K B;  3R2T A;  1E0B A;  2MUY A;  4C3I G;  2CW0 C;  4F8M A;  1Y8O B;  3GTL B;  4X3U A;  2XNA C;  4OHJ A;  4CHT B;  1A15 A;  5ELE A;  2A69 D;  1LT5 D;  2EY6 A;  3LNN A;  1XTC D;  4NKL A;  2G9H D;  1D2B A;  3D4W A;  5BN4 A;  3NWT A;  5CR3 A;  4DNR B;  1WTO A;  2EXZ A;  1HFG A;  1U4P A;  1JB3 A;  2GA4 B;  3S2H B;  3OIP A;  2K01 A;  1PFN A;  5E4W C;  4DXG A;  1LTR D;  1CM9 A;  3TN2 A;  1ESF A;  5IT9 L;  2X6G A;  2EZV A;  3EQL C;  5KNC A;  1WTX A;  2QEJ C;  2VNU D;  2SNS A;  1F2L A;  5KGU A;  2I46 A;  5DM6 3;  2JEB I;  2F0E A;  2K05 A;  5FK9 C;  2B2U C;  2PYK A;  2L1B A;  1I4G A;  5I9P A;  2MGS A;  1VCI A;  3P75 A;  1OXU A;  1STA A;  1IW7 D;  3T51 B;  2O2L D;  1SE2 A;  3J7A V;  1E2Z A;  2DN8 A;  4DNT B;  2FIN B;  3BG3 A;  2K1B A;  3IFD A;  1MSH A;  3MC0 B;  2OXP A;  3VR3 A;  2R3Z A;  3QB3 A;  2JA8 B;  1GUS A;  1ILP A;  2IX1 A;  2AWN A;  3NQI A;  1D6E C;  4Q0F A;  5A2Q E;  2M2L A;  1EY6 A;  2QCP X;  1UUP A;  2EYJ A;  4WFN 3;  5JAV A;  1ZYR D;  3BVM A;  1SAP A;  3BZD B;  4K14 A;  2F0T A;  5HGT A;  1W6K A;  3I73 A;  2HDL A;  4Q5V A;  1TU2 B;  4BY7 B;  2F0M A;  3MEH A;  4OGQ C;  1PFM A;  2E2J B;  1STN A;  4FF2 A;  2NN6 H;  3GP7 A;  4ZKB B;  3U9S A;  4IFD J;  2A6H D;  3D31 A;  3KBG A;  4UAI A;  3IKJ A;  1DON A;  3MXN A;  2EYP A;  4H44 C;  3EA6 A;  5EGT A;  2BCO A;  1S5D D;  4A93 B;  1MD2 D;  1EZ6 A;  1SE4 A;  4DN4 M;  2FHT A;  3D3R A;  4QCL A;  5BN3 A;  3PIO 3;  4G57 A;  3K0Y A;  3Q0A A;  3HRZ C;  3KLS X;  2IW3 A;  2K28 A;  2MP1 A;  3MXP A;  1HPC A;  1XYI A;  2LS0 1;  4IN3 A;  5COR A;  4M1U B;  2EYF A;  3GV6 A;  3I70 A;  5M5W B;  1R4P B;  1CI3 M;  2KHS A;  2AQ1 B;  2NVQ B;  1EEI D;  3MVV A;  5EKI A;  4MN3 A;  3SEB A;  3FEW X;  3BDL A;  3LWE A;  2F0W A;  4G7Z C;  3FRP B;  1SMY C;  4HED A;  1GUW A;  1EEF D;  1E2V A;  1V1P A;  2F0P A;  4U67 3;  1KLG D;  2F0J A;  3P7J A;  5C44 B;  4RHS A;  4QIW B;  2B2V C;  4FXK C;  4NMZ A;  3BDC A;  4C3J B;  2MPM A;  2H1E A;  3T4A C;  2PQE A;  3GD7 A;  1IKL A;  4QUF A;  2EPB A;  3HOW B;  3OWF A;  3FPP A;  2B2W A;  1SNP A;  4KHV A;  3V2T A;  2EY2 A;  1Q8I A;  3OWE B;  4YIJ A;  4CJ1 B;  1U9R A;  4AYB B;  3KLS A;  3M85 A;  3GTK B;  1LT3 D;  4FO2 A;  1K8M A;  1WCM B;  1CHQ D;  5DM7 3;  1IL8 A;  1OXS C;  3K6O A;  4OIK A;  1F9P A;  1WTW A;  2E74 C;  2XSC A;  4RGO S;  1SYG A;  4NW2 A;  1AW7 A;  3QG1 A;  5G3L F;  1UNS A;  4K6L A;  1AFP A;  5JEA H;  4TSS A;  1OO9 B;  2EJG C;  3T16 A;  3RZD B;  2LFN A;  2PZW A;  2EJM A;  4IFD G;  2HDM A;  4XT1 B;  1TWC B;  1TWF B;  2IWH A;  3TME A;  2L0C A;  1TS3 A;  3U9O A;  3L7Z C;  5IGB A;  5NUC A;  1Q3L A;  1OXT A;  1LTS D;  1J9O A;  1HTP A;  4IUR A;  3FKI B;  3DEP A;  4K2L A;  1A2U A;  5C3W A;  1U4M A;  1Y1V B;  5ELD A;  3KK7 A;  1O7Y A;  5IGC A;  3M3Y B;  1KNA A;  5C6A A;  3OIQ A;  3A8I E;  1U4L A;  4N9P A;  4OO1 I;  4R9W A;  4CKC A;  3D6W A;  2Q8T A;  2O5J C;  2N55 A;  5FO8 B;  4XQJ A;  1SNC A;  2IX0 A;  1SDF A;  3NK9 A;  3RMH A;  1SYB A;  4DXF A;  1ZXT A;  2DNC A;  4DK1 A;  1X3P A;  3R93 A;  2B2Y A;  1A2T A;  3A8K E;  2NWG A;  3BVG A;  1I6V C;  1F2Z A;  2F4I A;  2D9U A;  3MZ5 A;  2Q8R E;  2EY5 A;  1FNU A;  4XQQ A;  4KJO A;  4K5X A;  2BE5 C;  1YNJ D;  4BY1 B;  2QDB A;  3TZU A;  2D62 A;  4KK7 A;  5D3D A;  2NYZ D;  3PUY A;  5C5L A;  4ME5 A;  4FF1 A;  1EY4 A;  3NTI A;  2KCC A;  2F3V A;  1ET6 A;  2WP8 J;  2KOL A;  3QOJ A;  2F0K A;  1BO0 A;  5DEH A;  4KN7 C;  3J81 E;  4MHE A;  3I90 A;  1BXT A;  5M9O A;  4XIG S;  2E2D C;  4FP5 D;  3K58 A;  2NTT A;  3CHB D;  2WII B;  4ID6 A;  3TP5 A;  1X32 A;  3QWN A;  3NTH A;  3V96 A;  4RKB A;  2LKV A;  1R9T B;  2AWO A;  5C0X I;  4S3S A;  3AB9 A;  1F2Y A;  1WTR A;  2AUK A;  2KVM A;  3A7L A;  3MA2 B;  3D4D A;  1EIG A;  1RTN A;  2HCI A;  1PXU A;  4IFD H;  5D3I B;  2A68 C;  5C4Z A;  3S1N B;  3M4Y A;  1TWG B;  2NZ1 D;  2ZXP A;  2NBF A;  1HCZ A;  1TT2 A;  1STB A;  1RF2 D;  4C3J G;  3S17 B;  1SXT A;  5IOD A;  5FLX E;  5IGD A;  4A3B B;  1SYC A;  1J8I A;  2RKS A;  3GTJ B;  5KND A;  5ELC A;  3K59 A;  1V1O A;  3SK5 A;  5FKA C;  5EJW A;  3SK4 A;  4K5W A;  5CYU A;  1SEB D;  2RSN A;  4G7O C;  1TKW B;  3URY A;  2A73 B;  4B9W A;  1JR0 D;  4NP5 A;  5LHY 1;  1STH A;  2F0Q A;  1QNK A;  3LWU A;  1VDZ A;  3DWA A;  1SJE D;  2EDG A;  1JOO A;  1JQY D;  3M7G A;  2VXW A;  2SEB D;  3SDZ A;  4B08 A;  3IFT A;  1CA6 A;  4X3K A;  4CJ0 B;  3IAY A;  3ZYY X;  2CW0 D;  3Q24 A;  3MFY A;  1RKN A;  3MFG A;  1H9S B;  1LV9 A;  1WTV A;  1W6J A;  1CQF A;  5CBE E;  4IQZ A;  5HUR A;  1PTO C;  4J1M A;  1HUM A;  2F0H A;  3MWY W;  4EQO A;  1GXD C;  3VYU A;  3TBI B;  2RA4 A;  4G7H C;  1B2T A;  3DMU A;  2D2C C;  3G6J B;  2FMC A;  5M5X B;  1HA6 A;  1BDO A;  2RQX A;  1DD2 A;  3NBI A;  1EYD A;  3DUZ A;  5J22 A;  5CMD A;  2A6E C;  2B39 A;  5JOB A;  3ERQ A;  4H0L C;  3NHH A;  3Q23 A;  2A69 C;  1QG7 A;  1XWE A;  2D5D A;  5K36 G;  3I4L A;  4RAU C;  2KCN A;  2WKD A;  3DWP A;  1LTI D;  4HN7 A;  4ZQ3 A;  2Z4H A;  1MGS A;  3H3V C;  1K8O A;  1TWA B;  2A5H A;  4FNF A;  3HP3 A;  3ERO A;  1ENF A;  3SK6 A;  1TR5 A;  3DXJ C;  3T56 B;  2WB1 B;  4FXG C;  5EPJ A;  2XN9 C;  5CGK A;  3H91 A;  1ZEQ X;  4KY7 A;  5C4H A;  2NN6 I;  1IYU A;  1MI2 A;  5I2X A;  4KY5 A;  1O80 A;  2A74 C;  4IUV A;  2K33 A;  4DF7 A;  3PO2 B;  3KF8 A;  3I4N B;  1H9K A;  5K5P A;  3HGB A;  4MIU A;  1M8A A;  1D5Z C;  1M4V A;  5C3E B;  1AP0 A;  1QWY A;  4XXE A;  1EY9 A;  4CBV A;  1ZKO A;  2JP1 A;  1VF5 C;  2LY7 A;  2PO4 A;  3FDT A;  3GV3 A;  1B1Z A;  4M8A A;  5ISR A;  4JBW A;  1JWS D;  3OHX C;  4EQN A;  1QCB D;  4C1N K;  1CK1 A;  4K2K A;  1HXY D;  1KTK A;  1SNM A;  3NP8 A;  3HS0 C;  3NSW A;  4C2M B;  1MBY A;  1X3Q A;  1I4Q A;  4RGT A;  4DAY A;  4FYD A;  1A3T A;  2X69 A;  3F2U A;  3DWQ A;  1LAB A;  1HHV A;  2CQA A;  3BDO A;  3PIP 3;  2NTS A;  3PUW A;  4CJ2 C;  1V8Q A;  5FO7 B;  3VR5 A;  3FMC A;  3PMF A;  1Z6H A;  1HA5 A;  3MAQ A;  3HOX B;  1TY2 A;  2MJ8 A;  1PZK D;  1A3V A;  2R61 A;  1AN8 A;  4CGY B;  4L6T B;  1EYC A;  5EKK A;  4HTH A;  1SMY D;  3K5M A;  1QB5 D;  3AU7 A;  2Z8L A;  3VA5 A;  1B4O A;  1DM0 B;  1GJX A;  4DGZ A;  5M3F B;  3HOV B;  2KUM A;  1IKM A;  2B2T A;  1EL0 A;  2XRS D;  5CV9 A;  5A2Q L;  1G2T A;  1D5X C;  1CZG A;  2RBM A;  3NBH A;  4A3I B;  4ABN A;  3HOY B;  4UDU C;  4HMJ A;  2ZT9 C;  2SOB A;  3BVZ A;  2F0D A;  4RCO A;  4BA2 I;  4RCN A;  1AEX A;  2BA1 A;  3JAM E;  4BBS B;  4HMI A;  1WTQ A;  5FOB B;  1WD0 A;  3C3L A;  5D14 A;  4C56 C;  4ZKC B;  1EY5 A;  2WAQ B;  1DOL A;  2JYO A;  1DYQ A;  1QJO A;  4CKE A;  1PLF A;  2XWJ B;  4BS9 A;  1STE A;  5EKL A;  5I2Y A;  1PRT C;  1CFM A;  4IZ8 A;  1PZJ D;  1STG A;  1PTO F;  1TWH B;  3TZD A;  1BCP C;  1UEA B;  4V0B A;  2N88 A;  2K03 A;  4XYO A;  1PDQ A;  3PUZ A;  4FF4 A;  4IUP A;  1JCK B;  3H09 A;  1PRT B;  4HCE A;  2I07 B;  3OSO A;  1BUV T;  1Z47 A;  3J7Y W;  3QOL A;  4H7B A;  2B8G A;  1R4Q B;  1BCP B;  5IOC A;  3TP6 A;  3X3N A;  1F9Q A;  4U68 A;  2KJX A;  2WKC A;  1G29 1;  3HEJ A;  1TS5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...