2DY8A

Solution structure of the second chromodomain of yeast chd1
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
69
structure length
69
Chain Sequence
b'DEFEEFHVPERIIDSQRASLEDGTSQLQYLVKWRRLNYDEATWENATDIVKLAPEQVKHFQNRENSKIL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Chromo domain protein 1
publication title Structural Polymorphism of Chromodomains in Chd1
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Hydrolase
total genus 11
structure length 69
sequence length 69
ec nomenclature ec 3.6.1.-:
pdb deposition date 2006-09-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2dy8A00
1WTQA 1NR4A 1J9OA 2K28A 1RHPA 1HFGA 5EPJA 2L11A 5E4WC 1WTPA 2CVRA 1U4RA 1M8AA 3ONAB 4MHEA 2L1BA 1PFMA 2B2VC 3I3CA 1KNEA 3I90A 2FMMA 4O42A 5DNFA 3UI2A 1ILQA 4IUVA 1JICA 2Q8TA 3H91A 2NZ1D 4NW2A 3TZDA 4CJ0B 2VXWA 1F9RA 1ICWA 3R93A 1WTWA 1EIHA 2EE1A 1ILPA 1BBXC 1ML0D 1NR2A 1PLFA 1EL0A 3TN2A 1BNZA 2M2LA 1SSOA 2RA4A 1NCVA 1IKLA 1CM9A 1WD0A 4ZLTF 1DOLA 2B2TA 1U4PA 2B2YC 3GV6A 4HAEA 1F9QA 1QNKA 1HUMA 2B2UC 2NYZD 2DY8A 4RWSC 1B2TA 1F2LA 1B50A 2X6LA 4UAIA 2RVLA 3MTSA 1KNAA 1AZPA 1J8IA 2X69A 4U68A 1VMPA 4ZKBB 2B2WA 1WTOA 1AP0A 5D14A 1XYIA 2R3ZA 5CORA 1PFBA 2JYOA 3KBXA 5CBAE 5AFWA 2K03A 1X32A 2MPMA 1DOKA 3N52A 3I91A 2HUGA 4X3KA 4ZAIA 2HCCA 4R8IA 4HSVA 2N55A 3DEPA 3MWYW 1S4ZA 4X3TA 5COYA 2H1EA 2K01A 2IL8A 2L12A 1RTOA 4XT3B 2MP1A 2NWGA 4HCSA 4ZK9B 2JP1A 2L4NA 4XT1B 4OIJA 4R9WA 3FDTA 3F2UA 1A15A 1B3AA 1WTRA 1MSGA 1EQTA 2KEDA 1F9SA 1F9PA 2L9HA 4CJ2C 1BF4A 1B4OA 1RJTA 1JE4A 3HP3A 1O80A 2K1BA 1G2SA 4RA8A 2RSOA 2D9UA 2N88A 3G7LA 5E4XA 1HHVA 1EIGA 5T1IA 2KEEA 4RAUC 2HDMA 1WTXA 1HFNA 2K04A 2EPBA 1SAPA 1VMCA 1NAPA 2B2VA 3DEOA 1TVXA 3DM1A 4HEDA 1G2TA 1ESRA 5D65A 1WD1A 1U4MA 2MGSA 4OIKA 2DY7A 1MSHA 1U4LA 5EQ0A 1CA6A 1X3PA 5CBEE 2FINB 2B2YA 2B2TC 2BDNA 1O7ZA 3I8ZA 4X3SA 2SDFA 1EOTA 1XX8A 2B2UA 1DOMA 4IUPA 3P7JA 5EPLA 2HCIA 4CJ1B 3GV3A 1RODA 4ZKCB 1HRJA 1Q3LA 3QO2A 4LMQD 1CA5A 1GUWA 3D6WA 2B2WC 1IL8A 2KECA 3SVMA 4IURA 5EJWA 4DN4M 2KUMA 2MJ8A 2RSNA 1X3QA 5EPKA 4XDXA 1QG7A 3IFDA 3LWEA 1WTVA 4QUFA 2XIWA 2FHTA 1WVLA 1C8CA 4QUCA 1MI2A 1LV9A 2KOLA 2HDLA 3Q6SA 1O7YA 1G6ZA 4IUUA 1QE6A 2FFKB 2X6GA 5JJZA 2FJ2A 1RTNA 3KUPA 1G91A 3FPUB 3IL8A 4X3UA 1PFNA 2K05A 5EKIA 5CMDA 2EOTA 2KVMA 1HUNA 1BO0A 4MN3A 1MGSA 1B53A 1ZXTA 4IUQA 1PDQA 1HA6A 1SDFA 1DONA 4IUTA 1DZ1A 1IKMA 5T1GA 2J7ZA 2Q8RE 1E0BA 1AZQA
chains in the Genus database with same CATH superfamily
4PZ6A 3Q8DA 3I72A 5I6YA 1PHJA 4A3IH 3HOXG 1U4RA 3OIPA 3HOUH 2EYHA 1KNEA 3P1HA 4LFCL 1YNNC 1I4HA 1JJ2A 2EJGC 4A3EB 3KLSX 1R9TH 1WTWA 3OTOQ 2QDLA 2HHHQ 2NB0A 1NMGA 1EL0A 3M4PA 1Y1WH 2LSSA 2RHSB 1NCVA 3AYHB 1U4PA 4ZUJA 4JI1Q 1HUMA 1A62A 3A5ZB 1B2TA 2X6LA 4B3ML 4LFAQ 3FPPA 1PTOF 1S5DD 4FDBA 2F03A 2ICEC 1Y69U 3L7ZC 5AFWA 2DUDA 3RR5A 1T5XD 1LT6D 1PZID 1YNJC 5AJ3L 2ZTDA 2Z6KA 1QCBD 1BBWA 3K57A 2GVBA 1NNXA 4EX5A 3PO3B 2WIIB 2D5DA 1WTRA 4CJ2C 2Y0SB 2EY2A 5FJ8G 1IHZA 4XQJA 3K5LA 4L5TA 1U9RA 4X62L 4KI0A 3BVMA 4FYDA 5E3FA 4AYBE 2NZOA 5IT9E 3TMEA 3S2HB 1JWMD 3PO2H 2JA6G 2UXCL 2B2YA 4DPGA 3BYYB 1BXTA 4P73A 3H3VH 4B3RL 1UWVA 3G4SA 2VUMB 1YHQA 3HOWG 4GN5A 2NBFA 4ZUIA 2MJ8A 1K8AC 3LWEA 4DR5L 4B3TL 2WKCA 2EVBA 1XNQL 1UUPA 1EZ8A 1MI2A 2M00A 3W1BA 3KK7A 2QILA 3VYUA 1H9SB 2Z6KC 1L1OB 5CGKA 2DJGC 4DK6C 3FPUB 5I9PA 4UP9A 1FYCA 3S1NH 4LNQA 1E24A 4BBRG 3K81C 4LUOA 1DZ1A 1NTGA 1C9OA 4QL5A 2Q8RE 2DN8A 1SNOA 3QB3A 3NELA 4RGOS 4BY1G 3MEHA 3A74A 3D6CA 4HJ7A 1E2ZA 2VB3X 2JA5B 5FO8B 1WJJA 4DUYQ 2WAQG 3VA7A 4TRDA 3FMCA 2SEBD 1ILQA 2Q8TA 4A76A 5ISRA 4FNFA 3UDXA 1YNND 4ME3A 1PLFA 2AKWB 4C56C 1TY0A 1G291 1PXUA 1SXTA 1EWCA 1Z7TA 1DOLA 2B2YC 1GUNA 4JI7Q 3SK6A 1YNXA 4O0AA 1VMPA 1EY0A 4AQYL 3S16B 3MXGA 5CORA 1Y1VH 3L9AX 3NEMA 3NTIA 1UE1A 3R2IA 4DR4L 1STBA 3CCJA 4DR1L 5JVH3 4RMFA 2K7VA 1SJHD 4QJFA 1K83H 3PUXA 4P71A 1FNUA 4RHSA 4YWMA 1VQIA 4A93G 2G9HD 3F2UA 3FRPB 1FJGQ 3GTLB 2K1BA 1PZJD 2RSOA 4YHHL 4LF7L 5IOCA 3G7LA 1PYWD 1VQ5A 3SK4A 1CK1A 2I5LX 4FXGC 5C3EG 1WI5A 1TU2B 2ZM6L 4KK7A 3H3VC 4F7XA 1U4MA 5FLMG 1MJEA 1PH4A 4G4KA 5LMNL 2Z0SA 1VDZA 1PH9A 2FINB 4BXXG 2BDNA 3QOLA 1NUCA 5I9OA 3GTPH 3T1YL 3GV3A 4CKEA 4DF7A 2WV6D 5A2QE 4DV2L 2VQFQ 1I6HH 2RDFA 1IL8A 5M5YB 1QVCA 4IURA 4B3SL 4MZ9A 3J81E 3KDFB 3RN2A 1H9KA 2K5NA 4R4TA 5IT9c 2XTIA 2KHSA 2AWOA 1YJWA 3SR1A 2IX1A 2E2IH 2NVYB 1NJIC 2CH4A 4OX9Q 2JXMB 3F1ZA 2D0PA 3FKIH 1HUNA 1TWFB 3PSIA 1EU3A 4QCLA 3QJYA 2DJFC 4J1MA 5J22A 2F4VQ 2PW5A 2HIVA 2I46A 4FXKC 1E0BA 3PF4A 1STNA 1PVOA 3U9SA 5LMNW 1VS0A 1GVPA 2JE6I 1QJOA 3SK5A 1HXYD 5GADC 4JI2Q 1K28A 2R7ZG 2VQEQ 1CHQD 4RG1A 3I4MB 3CMAA 3WOEA 3TN2A 1J5EQ 4JG2A 1W6KA 2DGYA 1RIPA 2CQAA 1X9NA 2NYZD 4NP5A 4LF5L 4UAIA 1FL0A 2Q2UA 1WTOA 5C4JB 3NTKA 1PRTB 4A3BH 4L5QA 2Z8LA 3DUZA 2F0NA 4HIKA 2IT1A 2N8NA 1I6HB 3TP6A 2K01A 3F2CA 4XT3B 3HOVG 1IW7C 2BCOA 4ODGA 2JP1A 1HJPA 4JBKA 1JR0D 4S3SA 4C3HH 1JE4A 5C5LA 3M4OH 3E3XA 4H13C 1PV4A 3MXNB 1HNWL 4A3DH 1GUTA 2EZVA 3STBC 3TP8A 5FLXE 1TWHB 3LWUA 2YU9H 2GVAA 4C3JB 1IBLQ 4XQQA 1PH6A 2QEXA 1XMQL 5NUCA 5FOBB 4OWTB 5BN3A 4P75A 3ULJA 4DXFA 1BUVT 1BVSA 3I8ZA 4I65A 1XX8A 2B8GA 2WKDA 1SRUA 2HCIA 5JEAG 4J6HA 3PCOB 4HJ9A 1M4VA 4DR3L 2NVQH 3RZOH 2I5HA 2JA9A 1CT1D 2JA8B 4OELB 2PQAA 5IT9L 2E74C 4A3KH 1QZHA 2PO4A 4Z9CB 2H4OA 4LF8Q 4DV4Q 4BY7G 1RTNA 1STGA 1I4GA 1V9PA 5IP7H 1E2VA 3TRZA 1HNXQ 1EEFD 1CUKA 1C0AA 1PDQA 3KFUA 2KCTA 3R8BA 4F88A 2R6GA 3GO5A 5DEHA 4K8JA 4YIJA 2ID0A 4YCUA 4LF9L 3GTQB 1PH8A 1ENAA 2R93G 1RHPA 1HFGA 3SHLA 3LGJA 1PMRA 5D3DA 4IUVA 1JICA 3J81i 1Q82C 4A3FB 4KN4C 4TSSA 4RGTA 1ILPA 4JI4Q 4FP5D 2B63G 1K8GA 3NWSA 2C35B 1O78A 3TBIB 3V2TA 3CU7A 4PZ8A 1T9HA 2PNHA 3GV6A 2Q2TA 2ZXPA 1QNKA 5IYCG 4OO1H 5BN4A 2V4DA 3RUZA 1TKWB 3L3OC 1B7YB 5CR3A 1DD2A 3HOYG 4K2LA 3OWEB 2OTJA 2Z4IA 3N52A 2HUGA 2HCCA 1S4ZA 5COYA 3RZDH 2DNEA 4GKKL 2JK8A 1V1OA 2L12A 2PZTA 1YZ6A 5ELFA 2L4NA 4OIJA 5C3XA 3M3YH 4R9WA 1B3AA 4APVA 1JE5A 1IW7D 3ULLA 5C4XG 1YBYA 2KCCA 1SR3A 3HP3A 3T13A 4LFBL 2H5XA 2N3SA 3AEVA 3PMFA 1CKMA 1LABA 1B70B 4GLVB 4YCVA 5DM73 1TWAH 5TSSA 3H94A 3STBD 1IL2A 3J80i 4C3IH 2HT1A 3E0JA 3GTOB 1CQVA 1TWGB 2E76C 2A68C 4WORA 4BBSB 1I3QB 1VQNA 4JW0A 2AQ3B 5KNCA 1YI2A 3KLSA 2WAQE 1GD7A 3A5UA 1FNWA 1QUQB 2VNUD 2A73B 1GUWA 1S5BD 1ASZA 1KABA 4DKAC 4M1UB 5K5PA 4QUFA 3VYRA 5ELNA 3NWTA 3TEHB 5FO9B 4PZ7A 4XIGS 2RCNA 1G6ZA 1QE6A 2F0IA 5FKAC 5GROA 4KHPQ 1QNUA 1GO3E 2JA7G 4M8AA 3CPWA 1G91A 2UU9L 4RCNA 5A2QL 1KL9A 3BZKA 3CCLA 3VR5A 4A3MG 2MFIA 3NE5B 4LUVA 1WTQA 5J1ZA 3NBHA 1IBKQ 2CVRA 4HR7B 4GOPB 2L1BA 2ATWA 3I7FA 1P16A 3OIQA 3DMUA 2RDGA 1PRTF 1LT5D 2KHJA 2KHIA 5HY6A 2ZT9C 4X64Q 4JV5L 1BCPC 3SGIA 5FO7B 1Q1BA 5I6WA 4IPGA 2OEOA 3GTJH 2BDOA 5E1FA 4CHTB 3GTKH 5IGEA 3U58A 3C1FA 2F4VL 1TS5A 3I4NH 5IYDH 3KBXA 3T51B 4N8FA 4HSPA 4PMCA 1HH2P 4R8IA 4IO9A 4O1NA 3DEPA 2WB1G 1LLRD 2LMCB 3OTOL 2HHHL 2J4XA 3KYHC 3J7A5 2OCEA 1KRSA 1LTSD 2PZUA 2RKSA 3MC0B 4JI1L 3AFQA 5ELEA 1N34Q 1BDOA 1IYJB 4JK1C 3TS0A 2C5CA 1HHVA 4LFAL 1G6PA 4ULLA 5ELOA 4PQXA 5I2XA 2K04A 2EPBA 5M5WB 4ZRZA 3I4LA 1VQ7A 1TVXA 1WCMH 4KLKA 1ESRA 2R92B 5D65A 4A3JB 2QCPX 2EYFA 3H0GG 2JN4A 5CYUA 5JJIA 3CQZB 1STAA 1DJRD 2IX3A 1VQJA 4UP7A 3CPFA 4CJ1B 2VB2X 1HZBA 4HTHA 4DUZQ 5KNBA 2IJ0A 4WJ3M 1KDBA 3HOXH 5EPKA 4A3GB 3NSWA 4QUCA 3I55A 5KIXA 1EWHA 2HDLA 3SDZA 2E2HH 1MD2D 2YYZA 3HKZB 3TQYA 4XQNA 4DV6Q 1EZ6A 1JT8A 4WJ4A 5HGQA 3UE1A 3IL8A 2I5MX 3S15H 1HQRD 3D8GA 2VW9A 4IJLA 1X55A 5T1GA 2YTXA 4DV3Q 1E3PA 1J9OA 4IALA 3W5OA 2D62A 3OSOA 3I3CA 1OO9B 5KRUA 4Y52H 1EYCA 4EVOA 1F9RA 1QVFA 5DLQE 1BBXC 1OXTA 5M3MB 1Q1EA 3ND8A 1BNZA 4BS9A 4LF4Q 1T5EA 1XTCD 5FJ8H 1BCPD 5C44G 1F2LA 1OXUA 4CBVA 1N33Q 3OPOA 1N32Q 2B2WA 2JQOA 4WRDA 2HQEA 2NVXB 4DUYL 1GJXA 2L5TA 3K8AA 2JA6H 2K5QA 1KHIA 2HIXA 2R7FA 1RTOA 4QF4A 3A55A 3I4OA 4ZK9B 2F0FA 2ES2A 2OWOA 3Q22A 1A15A 1EQTA 1F9SA 4RH6A 1XXGA 1BQQT 2E5LQ 4JI7L 3KF8B 1O80A 3DLLA 3A56A 4A3EG 4J8QA 3HOWH 1HNZQ 5KYLA 4YWLA 1EQRA 4A4IA 1M90C 1D1KA 4CGYB 5M3FB 3J7AF 4L63B 1I5FA 4X6AH 1VQ4A 3URYA 3HOZB 4P2CB 1L0YB 2N78A 1LUZA 2F52A 1PA6A 3BJUA 4BA1I 5HURA 4BA2I 4IPCA 1CA6A 2YV5A 4QQBX 4OGQC 4BBRH 2TMPA 2NN6G 2F0WA 2ZXRA 5K36G 3S17H 4BY1H 3KF6A 4ZCKA 5IODA 4LMQD 2B2WC 2NVTB 4KD3A 1HQMC 1JQYD 1GHJA 2PW7A 1O7LA 1XTDA 3A7AB 1SE3A 4UDUC 3PO3G 1VQEA 2BA1A 2E8GA 2Y0SG 5ELBA 1D6EC 1SYBA 4JOIA 1VF5C 1X3EA 4A3IB 3HOUB 2CCZA 1MGSA 3S1MH 3IAYA 2E2JH 3QOJA 2LFNA 4I7ZC 1R9TB 3CC4A 3JAMc 1AW7A 3BYTB 3TSSA 1SMYC 1Y1WB 3CC2A 1SN8A 3MVVA 1P8LA 4R1JA 1LTTD 2NZ1D 2KJXA 5CV5A 3R93A 1SYCA 4NB3A 2EY6A 2VUMG 3NTHA 1Y8PB 1JMCA 3NHHA 2F0VA 3T1HQ 1WD0A 4A93H 1OXSC 4OX9L 3DWPA 5JJKA 1CSQA 4RWSC 3W1GA 2F0DA 2CW0C 2EXZA 3A8KE 3V05A 4C1NK 3VR4A 1J8IA 4KV6A 4HMJA 4DR2Q 2X69A 2KENA 3HS0C 1C48A 3WOFA 1ET9A 1OXXK 5D14A 5C3EH 1UE5A 1PFBA 5KGUA 5LL6X 2ZJRA 4JBJA 4X66Q 4H7BA 2A6HC 5FLMH 2MO0A 4JI2L 1XPRA 3KLRA 2IHFA 2AUJD 1NE3A 3G48A 1EEID 5IGCA 2VQEL 5C0XG 4BXXH 2CWAA 4JOIC 4R4IA 1HTPA 3SK8A 1J5EL 2JA5G 1KD1C 2NN6I 5IYBG 4KY6A 2CKZB 3BZCA 2GA4B 1B4OA 1RJTA 4NXNQ 2XNAC 1G2SA 1YJNA 5T1IA 2B3GA 4XYQA 4LJZC 3PO2B 1HFNA 2WP8J 1CSPA 2KCNA 2K14A 3G71A 3C3LA 4TKOB 1SEBD 4JI3Q 1GHKA 1W3SA 1ZYRD 3MXPA 2MGSA 3Q0AA 1CQFA 3DWAA 3AQQA 5E7NA 5HGTA 5LMUQ 1EOVA 2Z9HA 1SLJA 3D4WA 1D5MC 3F2DA 5L37A 1L0WA 5FK9C 5BR8Q 2XRSD 4R4OA 2F3IA 2XIWA 1VQHA 2R7ZH 2HD3A 1LV9A 1CKNA 3K7AH 3S1NB 1IBLL 2IWHA 4G57A 3FHWA 1UE6A 1XNRQ 1XWEA 1YHAA 1GUOA 4NMZA 1TT2A 3EVQA 4HJ8A 4IUTA 2M9VA 4DV0Q 1IKMA 1AZQA 2GN5A 1EFWA 1IXRA 1X3FA 2WB1E 3M4YA 2PPBC 3JAML 4HN7A 1KRTA 1WTPA 1S5ED 2PYKA 1EIFA 2A5HA 1SMYD 3E5SA 3KJPA 3G6JB 1IYUA 4UY8C 3S1QH 2UUBQ 1A63A 3HOVH 5C0XI 4DV4L 1Q86C 1CM9A 2B2TA 3O13A 1Y1VB 4G7ZC 4IPHA 1KLGD 2DY8A 4V190 5F2DA 1HNXL 1F2ZA 3GTGH 3BDLA 1I4RA 3K80C 1AZPA 2PMZB 3TREA 1KDCA 1LTAD 4ILWA 2CW0D 2K33A 4EQOA 1M1KC 3EROA 1K83B 3T16A 4DFAA 3UE0A 1X32A 1DOKA 3LNNA 4J15A 3RNUA 4FXDA 1PYSB 3MWYW 2A6HD 4GNXA 1A6XA 4JI4L 2F0KA 1SFOH 1NSNS 3MFYA 1I4PA 3X3MA 4DR6Q 5JEAH 1ENCA 3OW7A 2NUCA 3H15A 1G8ZD 3I4MG 2HDMA 4QIWE 5D3IB 1WTXA 4A3CG 2EJFC 4EQNA 4QY7A 1L0XB 1NY4A 1SAPA 2WINB 4JVZA 3GTPB 2TSSA 4BY7H 4DNIA 4DK1A 4OIKA 4HMIA 2DY7A 5EQ0A 4FF4A 2QKIC 2F0PA 3QIAA 2B2TC 1STHA 5EPLA 2P5ZX 2IW3A 1I94Q 5JPNC 2RBMA 3VR3A 1H9MA 2XGTA 2SNSA 1EYAA 2R93H 2E2IB 1PH5A 1B1ZA 1V1QA 2LS01 3IFDA 1WTVA 1Z9FA 3FKIB 1KTKA 2E2DC 5IP9G 2B63H 1S40A 1Q81C 4GNXC 2FJ2A 3U4ZA 1TWCH 1YITA 4IPDA 5IYCH 2K05A 3NP8A 1EQQA 2C9OA 2KBNA 4DNTB 4C3JG 5JAVA 3HOYH 3IKJA 2F0TA 3CW2C 2V1CC 2HQLA 2OT2A 3PGZA 3AU7A 3EFXD 3H91A 3TZDA 2K6AA 3VYSA 4Y7NH 3K5NA 3PUVA 2EE1A 5GAGC 4DAYA 4IFDG 3CXCA 1SYGA 5KYIA 4A3BB 4KHPL 5C4XH 3EA6A 3KLWA 1VQ8A 3D4RA 4XXEA 2JA8G 1QWYA 3MTSA 4UHVA 1D5XC 4IZ8A 5M5XH 1QZGA 1UNSA 3LX0A 3RD4A 2R3ZA 4IJHA 1OXVA 3EQLC 5EBCA 3JC66 2IHEA 3VYTA 1IBKL 2AMCB 3OWFA 2PQAB 4HIDA 4AH6A 1CI3M 2EJMA 4HSVA 4C3HB 4OEMB 3M4OB 1UE7A 4KKUA 2PCFB 2A19A 1A3UA 1A3VA 3I73A 1VQDA 4MTKA 2AWNA 2F0QA 4HCSA 4X64L 3ERSX 3OMCA 4A3DB 4JBWA 3EJIA 1F2MA 1V1PA 1FR3A 1F9PA 4QB4A 2YU9B 2L55A 4DV1Q 4RA8A 4DV7Q 4A3FG 4NXMQ 1TS3A 2Y0SE 4DXGA 1PZKD 1EIGA 2AUKA 1PTOH 4FF1A 5JJLA 4KN7C 3BDCA 3DM3A 4AIMA 5KEEA 4AYBB 3DEOA 3GTMH 2RDHA 2BH8A 4B9WA 4DK3C 1K8MA 4O2DA 2JA7H 2F4IA 2N49A 1X3PA 2NVQB 5H1SE 2PZWA 2ZJQA 4OWWB 2F0HA 4A3MH 3RZOB 1O7ZA 2MHVA 3P7JA 4KMUC 1CZWA 1ZKOA 1KC8C 4XTCS 4A3KB 4DAMA 4JYAQ 3KJOA 4JI6Q 3CD6A 1D1IA 1N34L 1BOSA 4R4CA 2JJQA 4V0BA 4PMBA 4H0LC 1HCZA 1WVLA 2O5IC 3VR2A 1BKBA 3UDGA 4CDEC 5I2YA 2FFKB 1SNCA 5JJZA 4IFDI 4DR7Q 1SNPA 2XWJB 5CMDA 2F0OA 2AQ2B 3J80c 1BO0A 1VQAA 1ZXTA 3E9IA 4F87A 3PQIA 1U0LA 3MXUA 3D3RA 5LL6S 4DUZL 2L15A 5M9OA 1K0RA 2K28A 4YWKA 1V43A 4BBSG 4O42A 4N9TA 3I90A 2FMMA 3UI2A 1W2BA 5EBDA 3KOJA 4C2MH 4JI8Q 3UDIA 3QG1A 1RL2A 1BCPB 3CCMA 2VY3A 1FGBD 1I50H 4PMWA 4K14A 4DV6L 3M9BA 3PIO3 3K59A 4Q5VA 3OMGA 3RZDB 4KY7A 3PIP3 2MNAA 1XYIA 1QILA 4DV3L 2EYJA 1VQFA 1EQVA 3WWVA 2UUAQ 3M3YB 3WDNA 2IPKD 4RFBA 2QGQA 3I91A 3H0GH 4ID6A 3ULPA 3ZJYC 2LY7A 1AE3A 3NUCA 4JI5Q 1Q90A 1QOHA 5CV6A 1PTOC 2AHOB 5C4HA 4K5WA 2F0JA 1CHPD 4DAVA 1N8RC 4LF4L 3I56A 2O5JC 2K75A 2F3WA 1BF4A 1TWAB 1SNMA 5JEAJ 4RGNA 4C3IB 1IYVA 2PQEA 2XSCA 2KEEA 1N33L 3NBHB 1N32L 4RCOA 1TY2A 3G6EA 4EQPA 1JB3A 3T4AC 3A0JA 4HEDA 1LT4D 1EWIA 1MJCA 3K5OA 3M7NA 4HIOA 2E75C 5CV7A 2F0SA 3IRBA 2QDBA 2EQSA 2QW7A 3NENA 3L2PA 3J7YW 2QF7A 5G3LD 2MUYA 1DXMA 3A8JE 4QGUA 1XMOQ 1Q3LA 3QO2A 4JI0Q 2E5LL 3SVMA 4KD4A 1KAWA 1HNZL 3S2DH 1N36Q 1A2TA 1QG7A 3CCRA 4N9PA 1GXDC 4IN3A 2EXDA 1CKOA 3RN5A 1O7YA 4Q0FA 1X54A 5A35A 3OW2A 5GAHC 3GDEA 3MA2B 5C44H 3BVGA 4FVMA 2EOTA 1H95A 1HR0Q 1K3BC 2K50A 1HZAA 2KCMA 2R92G 4A3JG 1DYQA 3HZXA 4A3LG 3S14H 3T53B 4MHEA 3PIOA 2ZJPA 5DNFA 2Q2IA 2RF4A 3JAME 2A69C 3GTJB 3PUYA 1II3A 4OHJA 4UP8A 3PIPA 3GTKB 1VQBA 3OHXC 1C7YA 4LF6Q 3F8TA 3K7UC 3PUWA 1IKLA 1E1OA 3I4NB 5J3BA 1Z6HA 2ZXOA 4GN3B 1PH7A 1VF7A 4A3GG 3CCSA 2UXDQ 1SNQA 5IGFA 1NMFA 4A3EH 1AFPA 4RKBA 4K0KQ 4ZKBB 2F0UA 2EY5A 3HG9A 3HKZG 2I07B 2OF1A 2WFWA 2G9DA 5C6AA 1MIUA 1SNDA 5CBAE 2K4KA 2K5WA 2K03A 2MPMA 4KHZA 1ENFA 3OOCA 2KA7A 2PI2E 1YHBA 1H9RA 1Q8IA 3OYYA 1GM5A 1RDPD 2B29A 1AH9A 2NN6H 3A8IE 3T1HL 5K36H 1AE2A 5CV8A 1PTOD 1WCMB 3CCVA 1TQOA 4YCWA 2D9UA 1L2FA 1SE4A 4DR2L 5M3MG 1Q8KA 3PO3H 4UPAA 2LXKA 1K73C 4GKJQ 3D0FA 4X66L 1AEXA 1RCVD 2XRQD 1VQLA 2JEAI 4BWGB 3TS2A 1U4LA 3HOXB 4E6IA 2XN9C 5KNDA 3S9WA 4H44C 1EY8A 1VQCA 2BE5C 4MIUA 2E2HB 1DM0B 4F8MA 4NXNL 3S2HH 1B3QA 5EJWA 3GD7A 2EYLA 1UEAB 3H09A 3S15B 1VQ9A 1ZYRC 2VUMH 2Q2HA 3ICEA 3Q6SA 3B6YA 2UUCQ 4IUUA 2EDGA 1RD9D 4JI3L 2WACA 3KUPA 4HJAA 5M3FG 1EFID 5LMUL 3HOZG 4IOAA 1OTCA 2O4XA 4MNOA 2OTLA 1BCPF 1FJGL 1NR4A 5BR8L 4JCVE 3ERQA 3S1RH 4CJ0B 1EY5A 5C0XH 1EIHA 3D4DA 1ML0D 1R4QB 2A69D 3AMUA 1X3GA 2RA4A 2JA5H 4ABNA 5IYBH 1EU4A 4ZLTF 4G7OC 4GN4B 1I6VC 4DV5Q 1RKNA 1XNRL 3CP0A 1C4QA 1EY4A 3KF6B 1IBMQ 4KKTA 3RLNA 4U68A 4X65Q 2JA6B 2B8FA 4DV0L 2VQFL 3QWNA 2CHBD 1WFQA 5IY0A 4A3IG 2LXJA 3HOUG 4ZAIA 2EYMA 3HOWB 1H9SA 2UUBL 1K0SA 3S16H 1L1OA 3JAMi 1PFSA 1Y1WG 2F3VA 2R61A 2CFMA 2OXPA 5JOBA 1MSGA 1K9MC 2K5DA 4YY3Q 1DGSA 3E6ZX 3ITPA 1S5FD 4NDXA 5C5MA 2F0EA 4RAUC 4P74A 2IY5B 2K5HA 3BZDB 4BBRB 3DM1A 2ASBA 1VQMA 1G2TA 1TS2A 5BN5A 5IWAQ 3GTLH 1LTBD 3S17B 1FVIA 4BY1B 1S72A 3TZUA 2WAQB 4K8IA 1Q7YC 2VL6A 4H02A 3T56B 2FMCA 2SDFA 1VQGA 3S1RB 1BR9A 1DOMA 3C1EA 1ICFB 2B2UA 4DR6L 1ET6A 2UXBQ 1KDAA 1WTHA 3J7AV 3AFPA 3D6WA 2NTSA 2BE5D 3MFGA 3W2DA 2KUMA 1EYGA 4LFCQ 4ALPA 3S1MB 3CRKC 3NPPA 2YTYA 3R3OA 2E2JB 2EY1A 5M5YH 4MTNA 3BS1A 1L1OC 1VCIA 3PO2G 1SE2A 4LWCA 3HKSA 3KBGA 4GS3A 3U9OA 1K3RA 2ZTCA 1ZEQX 5CV4A 2PNRC 5C3WA 4B3MQ 5GAEC 1JC7A 1I94L 3RLFA 4L6TB 2NVYH 4JPBW 5IGGA 1NBWA 3RLOA 1VQPA 1LACA 1QVGA 4A93B 2Z6BA 1TWFH 5AJ3Q 1CZGA 3QR8A 4NW2A 1G51A 2VXWA 1YEZA 3W3AA 3CCUA 1YNJD 4HIMA 2D0OA 4GZYC 3GQBA 3MEFA 2M2LA 4KY5A 3P75A 2YTVA 3EBEA 3UDFA 5C3EB 1S5CD 2J0TD 3J7ZC 1I4XA 3I70A 1HZCA 2B2UC 3BDOA 5JPMC 1PH3A 4RHRA 3Q24A 4LUZA 3TP5A 1KNAA 3CHBD 2F0MA 3PV0A 3I4MH 2RQXA 4X62Q 4A3CH 1A0IA 3KDFA 1MKHA 2JYOA 3AB9A 5IGBA 4QMGA 3C46A 1VQOA 1CKNB 3K0XA 5GQOA 4XYOA 2A6EC 4K2KA 2UXCQ 5C4JH 2LKVA 3A54A 4CDCC 5CC4A 4LF8L 2NWGA 1R4PB 2SOBA 1A3TA 1Y14B 4R4QA 4B3RQ 4CDFC 4U673 5E4XA 3CRLC 4WFN3 4R8NA 4B3TQ 4DR5Q 1XNQQ 1H9JA 3K5MA 5IP9H 1Y1VG 2AQ1B 1SYFA 1XPOA 2BOSA 4POGA 4GLAC 2OQ0A 1TWHH 2R7ZB 4C3JH 3TP7A 3K7AB 1RODA 3H3VI 1HRJA 4DV1L 1CA5A 2KECA 5IGDA 1F77A 2CH4W 3ZYYX 4DV7L 4NXML 3F2BA 3VDYA 3I2ZA 1A2UA 4CDDC 2PI2A 1EY9A 4LW1A 4IFDH 4GNXB 1JWSD 4P72A 3L0OA 3FVQA 1PH1A 4KJOA 3HKZE 1JORA 4GLXA 2JA8H 2I0QA 1DONA 1B8AA 4AQYQ 1KLUD 1O7IA 3S1QB 2J7ZA 3HOVB 1U5KA 4L8JA 3MXNA 3E0EA 4JI6L 2L11A 5E4WC 3J80E 4DR4Q 4JYAL 1M8AA 3ONAB 1PFMA 1CFMA 4DR1Q 1RF2D 3M7GA 3GTGB 3NXWA 4ME5A 1E2WA 3GTQH 4DU9A 3VA5A 5C0XJ 1I4QA 3HGBA 3S24A 1HZ9A 1Z47A 3H6MA 4DR7L 1JOQA 3FKIG 5J39A 4YHHQ 4A3FH 4LF7Q 2RVLA 3DWQA 5EKLA 5DM63 1PRTC 1E7ZA 3EIVA 1SFOB 2ZM6Q 4X3KA 5LMNQ 1J6QA 3ER0A 4JI8L 2A6ED 3NK9A 1K8OA 4G7HC 3NBIA 3T1YQ 1JCKB 4XT1B 2R7DA 2Z4HA 3FDTA 1XJVA 1B9MA 3A7LA 4RKLA 4DV2Q 4B3SQ 1CTMA 4BY7B 2N88A 1X6OA 3E9HA 3CAMA 1FD7D 3GP7A 4KTAA 1HPCA 1TR5A 4NKLA 4A3BG 1VMCA 2B2VA 2UUAL 1X65A 1MHWC 1Y8OB 1HTLD 1WD1A 2EYOA 4DAYB 4OL7A 2R93B 1Y8NB 2SNMA 2A74C 1KIXA 1LYLA 4JI5L 3J81c 2QEJC 2VS1A 2KQ3A 3MHBA 4DK0A 1EOTA 1UEBA 4TVAB 4L5RC 2JEBI 4DGZA 4ZKCB 2B63B 3GTOH 2F0GA 4C3HG 1TWGH 1GUGA 2D2CC 3VR6A 1TXYA 3SXHA 4DN4M 4BBSH 1I3QH 5EAYA 1TWCB 1C8CA 4A3DG 1PH2A 2BH2A 3DHQA 1DCZA 1JOOA 1TS4A 4ZQ3A 1SROA 3HOYB 4JBMA 1SE8A 1SBBB 4DAPA 1PFNA 2B39A 3HRZC 1JOKA 4MN3A 4LF5Q 1V1PB 3HEJA 4POFA 2K5VA 4AYBG 4KJNA 2ICIA 4K5VA 1EUJA 4Y7NB 3PF5A 4B9XA 1XMOL 2RCFA 4RGMA 4JI0L 1VQ6A 1E22A 4K6DA 4ZYSA 2B2VC 1N36L 5C4XB 5EKKA 3FEWX 1B44D 1GUSA 1LTGD 1LO5D 2L0CA 4A3KG 1NR2A 5EGTA 1D8LA 5M5XB 3MAQA 1QB5D 5I4DA 3ND9A 1JWUD 5IIFA 1F9QA 4B08A 5IP7G 1QUQA 1HR0L 3CF5A 1B9NA 5JVG3 1HNWQ 4KKSA 5ELCA 4L5SA 1EYDA 4PV1C 3Q23A 4FO2A 3CCQA 2QA4A 2IX0A 1STYA 2Z1CA 4FF2A 2BA0A 1PRTD 2N55A 1AN8A 1XMQQ 4N8X1 4X3TA 1Q46A 2IL8A 3M4QA 3FP9A 1JJGA 2MP1A 1PTOB 4LF6L 1Q12A 1IZ6A 1EIYB 4TQUS 2KEDA 3GTMB 5FLXc 2UXDL 4OO1G 4DR3Q 2JA7B 2CQOA 4OXPA 4K0KL 4EQ5A 1XPUA 4JC0A 3N6RA 3K0YA 4GOPA 4A3MB 2VZAA 2FXQA 2OQKA 3M85A 1HR0W 4DA2A 2XVSA 3K58A 5CBEE 5M5WH 1D2BA 4PG3A 3U50C 4WJWA 3CCEA 1D7QA 3J81L 2R92H 4A3JH 3IFTA 4LF9Q 3CQZH 4A3LH 1KXLA 3CMEA 2RSNA 4OWXB 4FF3A 1X3QA 3D31A 5IE8A 2KOLA 4GKJL 4DNRB 4IUNA 1E1TA 2NZHA 4K5XA 4C3IG 2EYPA 4IFDJ 1UAPA 1N9WA 1LM0A 4A3GH 4NPSA 2NTTA 2KVMA 4KHVA 1B53A 3NQTA 1V8QA 1HA6A 1SDFA 2WB1B 1MBYA 4CKCA 3J81j 4C2MB 5EPJA 2XWBB 1ONLA 1I50B 4GOPC 1BBUA 3CKIB 1WOCA 3EN2A 4LAAA 1ICWA 2EIFA 5C4ZA 4GKKQ 4A75A 1EY7A 3BVZA 2UUCL 3X3NA 1YJ9A 1F2YA 1SSOA 1W6JA 2MQHA 5LHY1 4HJ5A 1PYBA 2ALYB 2RHQB 4K6LA 4HAEA 2ENBA 1KQSA 4LFBQ 2DNCA 3H0GB 1B50A 4OO1I 3J80L 3SE0A 5M3MH 1AP0A 2ZTEA 1YIJA 1SJED 1VQKA 2PMZE 1FNVA 1JB7A 1GKHA 4CKBA 1SMXA 4EGVA 5DAUA 1WYDA 3CC7A 2H1EA 2O2LD 1S3OA 1ESFA 2F0LA 4C1NI 2NVXH 2A68D 1FGUA 3P20A 2A8VA 4DV5L 1SYDA 2JSOA 2L9HA 3SEBA 4I7AA 3C2PA 3K6OA 4QIWB 5ELDA 5FLXL 1STEA 1GOZA 1YVCA 1IBML 4PNYA 4X65L 5G3LF 1TIID 3I4NG 1D5ZC 1NAPA 3NQIA 5IYDG 2MO1A 3BU2A 5CV9A 3PUZA 4IOCA 1MSHA 3R2TA 2K32A 2UU9Q 5M3FH 3U4VA 4IQZA 3S2DB 4X3SA 3HFZB 1X56A 3HOZH 4IUPA 1EY6A 2CWPA 4HCEA 2K52A 2G5DA 4YY3L 3V96A 1HA5A 1SYEA 4XDXA 1LTID 1LTRD 5C44B 1LTLA 2FHTA 3TDQA 3RMHA 1WCMG 5IWAL 1A8VA 2X6GA 2NVTH 4JV5Q 3DXJC 1LT3D 2Q8IB 3S14B 4X3UA 5EKIA 2A1AA 1ASYA 3MZ5A 3BG3A 4IUQA 4LK1C 2UXBL 1JJCB 3KF8A 1KAAA 4OONA 2F1MA
chains in the Genus database with same CATH topology
3I72A 5I6YA 1U4RA 3OIPA 2EYHA 1KNEA 3P1HA 1YNNC 1I4HA 2EJGC 4A3EB 3KLSX 1WTWA 2NB0A 1EL0A 1NCVA 1U4PA 4ZUJA 1HUMA 1B2TA 2X6LA 3FPPA 1PTOF 1S5DD 2F03A 2ICEC 1Y69U 3L7ZC 5AFWA 1T5XD 1LT6D 1PZID 1YNJC 1QCBD 3K57A 3PO3B 2WIIB 2D5DA 1WTRA 4CJ2C 2Y0SB 2EY2A 1IHZA 4XQJA 3K5LA 1U9RA 4KI0A 3BVMA 4FYDA 5E3FA 5IT9E 3TMEA 3S2HB 1JWMD 2B2YA 3BYYB 1BXTA 2VUMB 2NBFA 4ZUIA 2MJ8A 3LWEA 2WKCA 2EVBA 1UUPA 1EZ8A 1MI2A 2M00A 3KK7A 2QILA 3VYUA 1H9SB 5CGKA 3FPUB 5I9PA 1FYCA 1DZ1A 2Q8RE 2DN8A 1SNOA 3QB3A 4RGOS 3MEHA 3D6CA 1E2ZA 2VB3X 2JA5B 5FO8B 3VA7A 4TRDA 3FMCA 2SEBD 1ILQA 2Q8TA 5ISRA 4FNFA 1YNND 1PLFA 4C56C 1TY0A 1G291 1PXUA 1SXTA 1EWCA 1Z7TA 1DOLA 2B2YC 1GUNA 3SK6A 1VMPA 1EY0A 3S16B 3MXGA 5CORA 3L9AX 3NTIA 3R2IA 1STBA 5JVH3 2K7VA 1SJHD 3PUXA 1FNUA 4RHSA 2G9HD 3F2UA 3FRPB 3GTLB 2K1BA 1PZJD 2RSOA 5IOCA 3G7LA 1PYWD 3SK4A 1CK1A 4FXGC 1TU2B 4KK7A 3H3VC 4F7XA 1U4MA 4G4KA 1VDZA 2FINB 2BDNA 3QOLA 1NUCA 5I9OA 3GV3A 4CKEA 4DF7A 2WV6D 5A2QE 2RDFA 1IL8A 5M5YB 4IURA 3J81E 1H9KA 2KHSA 2AWOA 3SR1A 2IX1A 2NVYB 2JXMB 1HUNA 1TWFB 1EU3A 4QCLA 3QJYA 4J1MA 5J22A 2PW5A 2I46A 4FXKC 1E0BA 1STNA 3U9SA 2JE6I 1QJOA 3SK5A 1HXYD 1CHQD 3I4MB 3WOEA 3TN2A 1W6KA 2CQAA 2NYZD 4NP5A 4UAIA 1WTOA 5C4JB 3NTKA 1PRTB 2Z8LA 3DUZA 2F0NA 2IT1A 1I6HB 3TP6A 2K01A 4XT3B 1IW7C 2BCOA 4ODGA 2JP1A 1JR0D 4S3SA 1JE4A 5C5LA 4H13C 1GUTA 2EZVA 3TP8A 5FLXE 1TWHB 3LWUA 4C3JB 4XQQA 5NUCA 5FOBB 5BN3A 4DXFA 1BUVT 3I8ZA 4I65A 1XX8A 2B8GA 2WKDA 2HCIA 5JEAG 4J6HA 1M4VA 1CT1D 2JA8B 5IT9L 2E74C 2PO4A 4Z9CB 2H4OA 1RTNA 1STGA 1I4GA 1E2VA 1EEFD 1PDQA 3R8BA 4F88A 2R6GA 3GO5A 5DEHA 4K8JA 4YIJA 2ID0A 3GTQB 1ENAA 1RHPA 1HFGA 3SHLA 1PMRA 5D3DA 4IUVA 1JICA 4A3FB 4KN4C 4TSSA 4RGTA 1ILPA 4FP5D 3NWSA 1O78A 3TBIB 3V2TA 3CU7A 3GV6A 2ZXPA 1QNKA 4OO1H 5BN4A 2V4DA 3RUZA 1TKWB 3L3OC 5CR3A 1DD2A 4K2LA 3OWEB 2Z4IA 3N52A 2HUGA 2HCCA 1S4ZA 5COYA 2DNEA 2L12A 1V1OA 2PZTA 5ELFA 2L4NA 4OIJA 5C3XA 4R9WA 1B3AA 1IW7D 3HP3A 2KCCA 3T13A 3PMFA 1LABA 5DM73 5TSSA 3H94A 3E0JA 3GTOB 1CQVA 1TWGB 2E76C 2A68C 4WORA 4BBSB 1I3QB 2AQ3B 5KNCA 3KLSA 1FNWA 2VNUD 2A73B 1GUWA 1S5BD 1KABA 5K5PA 4M1UB 4QUFA 3VYRA 5FO9B 3NWTA 4XIGS 1G6ZA 1QE6A 2F0IA 5FKAC 1QNUA 4M8AA 1G91A 4RCNA 5A2QL 3VR5A 3NE5B 1WTQA 5J1ZA 3NBHA 2CVRA 4HR7B 2L1BA 3OIQA 3DMUA 2RDGA 1PRTF 1LT5D 2ZT9C 1BCPC 5FO7B 1Q1BA 5I6WA 2OEOA 2BDOA 5E1FA 4CHTB 5IGEA 3C1FA 1TS5A 3KBXA 3T51B 4HSPA 4PMCA 4R8IA 4O1NA 3DEPA 1LLRD 2LMCB 2J4XA 1LTSD 2PZUA 2RKSA 3MC0B 5ELEA 1BDOA 4JK1C 1HHVA 2C5CA 4ULLA 4PQXA 5I2XA 2K04A 2EPBA 5M5WB 4ZRZA 3I4LA 1TVXA 1ESRA 2R92B 5D65A 4A3JB 2QCPX 2EYFA 5CYUA 3CQZB 1STAA 1DJRD 2IX3A 4CJ1B 2VB2X 4HTHA 5KNBA 2IJ0A 1KDBA 5EPKA 4A3GB 3NSWA 4QUCA 5KIXA 1EWHA 2HDLA 3SDZA 1MD2D 2YYZA 3HKZB 4XQNA 1EZ6A 3IL8A 1HQRD 3D8GA 5T1GA 1J9OA 4IALA 2D62A 3OSOA 3I3CA 1OO9B 5KRUA 1EYCA 4EVOA 1F9RA 1BBXC 1OXTA 5M3MB 1Q1EA 3ND8A 1BNZA 4BS9A 1T5EA 1XTCD 1BCPD 1F2LA 1OXUA 4CBVA 3OPOA 2B2WA 4WRDA 2HQEA 2NVXB 1GJXA 2L5TA 2K5QA 1RTOA 4QF4A 3A55A 4ZK9B 2F0FA 3Q22A 1A15A 1EQTA 1F9SA 4RH6A 1XXGA 1BQQT 1O80A 3A56A 4J8QA 5KYLA 1D1KA 4CGYB 5M3FB 3J7AF 4L63B 3URYA 3HOZB 4P2CB 1L0YB 4BA1I 5HURA 4BA2I 1CA6A 4OGQC 2TMPA 2NN6G 2F0WA 2ZXRA 5K36G 5IODA 4LMQD 2B2WC 2NVTB 4KD3A 1HQMC 1JQYD 1GHJA 2PW7A 1O7LA 3A7AB 1SE3A 4UDUC 2BA1A 5ELBA 1D6EC 1SYBA 1VF5C 4A3IB 3HOUB 1MGSA 3IAYA 3QOJA 2LFNA 4I7ZC 1R9TB 1AW7A 3BYTB 3TSSA 1SMYC 1Y1WB 3MVVA 5CV5A 1LTTD 2NZ1D 2KJXA 3R93A 1SYCA 2EY6A 3NTHA 1Y8PB 3NHHA 2F0VA 1WD0A 1OXSC 3DWPA 4RWSC 2F0DA 2CW0C 2EXZA 3A8KE 3V05A 4C1NK 3VR4A 1J8IA 4KV6A 4HMJA 2X69A 3HS0C 1C48A 3WOFA 1ET9A 1OXXK 5D14A 1PFBA 5KGUA 5LL6X 4H7BA 2A6HC 3KLRA 2AUJD 5IGCA 1EEID 5C0XG 1HTPA 3SK8A 2NN6I 4KY6A 2GA4B 1B4OA 1RJTA 2XNAC 1G2SA 5T1IA 4XYQA 4LJZC 3PO2B 1HFNA 2WP8J 2KCNA 3C3LA 4TKOB 1SEBD 1GHKA 3MXPA 1ZYRD 2MGSA 3Q0AA 1CQFA 3DWAA 5HGTA 3D4WA 1D5MC 5FK9C 2XRSD 2XIWA 1LV9A 3S1NB 2IWHA 4G57A 1XWEA 1GUOA 4NMZA 1TT2A 3EVQA 4IUTA 2M9VA 1IKMA 1AZQA 3M4YA 2PPBC 3JAML 4HN7A 1WTPA 1S5ED 2PYKA 2A5HA 1SMYD 3E5SA 3G6JB 1IYUA 5C0XI 1CM9A 2B2TA 3O13A 1Y1VB 4G7ZC 1KLGD 2DY8A 4V190 5F2DA 1F2ZA 3BDLA 1I4RA 1AZPA 2PMZB 1KDCA 1LTAD 4ILWA 2CW0D 2K33A 4EQOA 3EROA 1K83B 3T16A 4DFAA 1X32A 1DOKA 3LNNA 4FXDA 3MWYW 2A6HD 1A6XA 2F0KA 1NSNS 3MFYA 1I4PA 3X3MA 5JEAH 1ENCA 3OW7A 2NUCA 1G8ZD 2HDMA 5D3IB 1WTXA 2EJFC 4EQNA 1L0XB 1SAPA 2WINB 3GTPB 2TSSA 4DK1A 4OIKA 4HMIA 2DY7A 5EQ0A 4FF4A 2QKIC 2F0PA 3QIAA 2B2TC 1STHA 5EPLA 2IW3A 5JPNC 2RBMA 3VR3A 1H9MA 2SNSA 1EYAA 2E2IB 1B1ZA 2LS01 1WTVA 3IFDA 3FKIB 1KTKA 2E2DC 2FJ2A 2K05A 3NP8A 2C9OA 4DNTB 4C3JG 5JAVA 3IKJA 2F0TA 2OT2A 3AU7A 3EFXD 3H91A 3TZDA 2K6AA 3VYSA 3K5NA 3PUVA 2EE1A 4DAYA 4IFDG 1SYGA 5KYIA 4A3BB 3EA6A 3D4RA 4XXEA 1QWYA 3MTSA 1D5XC 4IZ8A 1UNSA 3LX0A 3RD4A 2R3ZA 1OXVA 3EQLC 5EBCA 3VYTA 3OWFA 1CI3M 2EJMA 4HSVA 4C3HB 3M4OB 4KKUA 2PCFB 1A3UA 1A3VA 3I73A 2AWNA 2F0QA 4HCSA 3OMCA 4A3DB 4JBWA 3EJIA 1F2MA 1V1PA 1FR3A 1F9PA 4QB4A 2YU9B 2L55A 4RA8A 1TS3A 4DXGA 1PZKD 1EIGA 2AUKA 1PTOH 4FF1A 4KN7C 3BDCA 5KEEA 4AYBB 3DEOA 2RDHA 4B9WA 1K8MA 2F4IA 1X3PA 2NVQB 2PZWA 3RZOB 2F0HA 1O7ZA 2MHVA 3P7JA 4KMUC 1CZWA 1ZKOA 4XTCS 4A3KB 1D1IA 1BOSA 4V0BA 4PMBA 4H0LC 1HCZA 1WVLA 2O5IC 3VR2A 5I2YA 2FFKB 1SNCA 5JJZA 4IFDI 1SNPA 2XWJB 5CMDA 2F0OA 2AQ2B 1BO0A 1ZXTA 4F87A 3MXUA 3D3RA 5LL6S 5M9OA 2K28A 1V43A 4O42A 4N9TA 3I90A 2FMMA 3UI2A 5EBDA 3QG1A 1BCPB 1FGBD 4PMWA 4K14A 3PIO3 3K59A 4Q5VA 3OMGA 3RZDB 4KY7A 3PIP3 1XYIA 1QILA 2EYJA 1EQVA 3M3YB 3WDNA 2IPKD 4RFBA 3I91A 4ID6A 2LY7A 3NUCA 1Q90A 1QOHA 5CV6A 1PTOC 5C4HA 4K5WA 2F0JA 1CHPD 4DAVA 2O5JC 2F3WA 1BF4A 1TWAB 1SNMA 5JEAJ 4RGNA 4C3IB 1IYVA 2PQEA 2XSCA 2KEEA 4RCOA 1TY2A 4EQPA 1JB3A 3T4AC 4HEDA 1LT4D 3K5OA 3M7NA 2E75C 5CV7A 2F0SA 2QDBA 3J7YW 2QF7A 5G3LD 2MUYA 1DXMA 3A8JE 1Q3LA 3QO2A 3SVMA 4KD4A 1A2TA 1QG7A 4N9PA 1GXDC 4IN3A 1O7YA 4Q0FA 5A35A 3MA2B 3BVGA 4FVMA 2EOTA 1DYQA 3HZXA 3T53B 4MHEA 5DNFA 3JAME 2A69C 3GTJB 3PUYA 1II3A 4OHJA 3GTKB 3OHXC 3PUWA 1IKLA 3I4NB 1Z6HA 2ZXOA 1VF7A 1SNQA 5IGFA 1AFPA 4RKBA 4ZKBB 2F0UA 2EY5A 3HG9A 2I07B 2OF1A 2G9DA 5C6AA 1SNDA 5CBAE 2K5WA 2K03A 2MPMA 4KHZA 1ENFA 3OOCA 2KA7A 1H9RA 1Q8IA 1RDPD 2NN6H 3A8IE 5K36H 5CV8A 1PTOD 1WCMB 1TQOA 2D9UA 1SE4A 1AEXA 1RCVD 2XRQD 2JEAI 4BWGB 1U4LA 3HOXB 4E6IA 2XN9C 5KNDA 3S9WA 4H44C 1EY8A 2BE5C 4MIUA 2E2HB 1DM0B 4F8MA 5EJWA 3GD7A 2EYLA 1UEAB 3H09A 3S15B 1ZYRC 3Q6SA 4IUUA 2EDGA 1RD9D 2WACA 3KUPA 1EFID 2O4XA 1BCPF 1NR4A 3ERQA 4CJ0B 1EY5A 5C0XH 1EIHA 3D4DA 1ML0D 1R4QB 2A69D 3AMUA 2RA4A 4ABNA 1EU4A 4ZLTF 4G7OC 1I6VC 1RKNA 1C4QA 1EY4A 4KKTA 4U68A 2JA6B 2B8FA 3QWNA 2CHBD 4ZAIA 2EYMA 3HOWB 1H9SA 2F3VA 2R61A 2OXPA 5JOBA 1MSGA 2K5DA 3E6ZX 3ITPA 1S5FD 4NDXA 5C5MA 2F0EA 4RAUC 3BZDB 4BBRB 3DM1A 1G2TA 1TS2A 5BN5A 3S17B 1LTBD 4BY1B 3TZUA 2WAQB 4K8IA 3T56B 2FMCA 2SDFA 3S1RB 1BR9A 1DOMA 2B2UA 3C1EA 1ET6A 1KDAA 3J7AV 3D6WA 2NTSA 2BE5D 3MFGA 3W2DA 2KUMA 3S1MB 3CRKC 3NPPA 3R3OA 2E2JB 2EY1A 3BS1A 1VCIA 1SE2A 3KBGA 3U9OA 1ZEQX 5CV4A 2PNRC 5C3WA 1JC7A 3RLFA 4L6TB 5IGGA 1LACA 4A93B 1CZGA 4NW2A 2VXWA 3W3AA 1YNJD 4GZYC 3GQBA 2M2LA 4KY5A 3P75A 5C3EB 1S5CD 2J0TD 1I4XA 3I70A 2B2UC 5JPMC 3BDOA 4RHRA 3Q24A 3TP5A 1KNAA 3CHBD 2F0MA 3PV0A 2RQXA 2JYOA 3AB9A 5IGBA 4QMGA 3C46A 4XYOA 2A6EC 4K2KA 2LKVA 3A54A 5CC4A 2NWGA 1R4PB 2SOBA 1A3TA 4U673 5E4XA 3CRLC 4WFN3 4R8NA 1H9JA 3K5MA 2AQ1B 1SYFA 2BOSA 2R7ZB 3TP7A 3K7AB 1RODA 1HRJA 1CA5A 2KECA 5IGDA 1F77A 3ZYYX 1A2UA 1EY9A 4IFDH 1JWSD 3FVQA 4KJOA 1JORA 1DONA 1KLUD 3S1QB 2J7ZA 3HOVB 4L8JA 3MXNA 2L11A 5E4WC 3J80E 1M8AA 3ONAB 1PFMA 1CFMA 1RF2D 3M7GA 3GTGB 3NXWA 4ME5A 1E2WA 4DU9A 3VA5A 5C0XJ 1I4QA 3HGBA 3H6MA 1Z47A 1JOQA 5J39A 2RVLA 3DWQA 5EKLA 5DM63 1PRTC 1SFOB 4X3KA 2A6ED 3NK9A 1K8OA 4G7HC 3NBIA 1JCKB 4XT1B 2Z4HA 3FDTA 1B9MA 3A7LA 4RKLA 1CTMA 4BY7B 2N88A 1FD7D 3GP7A 4KTAA 1HPCA 1TR5A 4NKLA 1VMCA 2B2VA 1Y8OB 1HTLD 1WD1A 2EYOA 4OL7A 2R93B 1Y8NB 2SNMA 2A74C 2QEJC 3MHBA 2KQ3A 4DK0A 1EOTA 2JEBI 4DGZA 4ZKCB 2B63B 2F0GA 4C3HG 2D2CC 1GUGA 3VR6A 3SXHA 4DN4M 1TWCB 1C8CA 3DHQA 1DCZA 1JOOA 1TS4A 4ZQ3A 3HOYB 1SBBB 4DAPA 1PFNA 2B39A 3HRZC 1JOKA 4MN3A 1V1PB 3HEJA 4KJNA 2ICIA 4K5VA 4Y7NB 4B9XA 4RGMA 4K6DA 4ZYSA 2B2VC 5C4XB 5EKKA 3FEWX 1B44D 1GUSA 1LTGD 1LO5D 2L0CA 1NR2A 5EGTA 5M5XB 3MAQA 1QB5D 5I4DA 3ND9A 1JWUD 5IIFA 1F9QA 4B08A 1B9NA 5JVG3 4KKSA 5ELCA 1EYDA 4PV1C 3Q23A 4FO2A 2IX0A 1STYA 2Z1CA 4FF2A 2BA0A 1PRTD 2N55A 1AN8A 4X3TA 2IL8A 2MP1A 1PTOB 1Q12A 4TQUS 2KEDA 3GTMB 4OO1G 2JA7B 3N6RA 3K0YA 4A3MB 3M85A 4DA2A 2XVSA 3K58A 5CBEE 1D2BA 4WJWA 3J81L 3IFTA 2RSNA 4FF3A 1X3QA 3D31A 2KOLA 4DNRB 4IUNA 4K5XA 4C3IG 2EYPA 4IFDJ 1UAPA 2NTTA 2KVMA 4KHVA 1B53A 3NQTA 1V8QA 1HA6A 1SDFA 2WB1B 1MBYA 4CKCA 4C2MB 5EPJA 2XWBB 1ONLA 1I50B 3CKIB 4LAAA 5C4ZA 1ICWA 1EY7A 3BVZA 3X3NA 1F2YA 1SSOA 1W6JA 5LHY1 4K6LA 4HAEA 2ENBA 2DNCA 3H0GB 1B50A 4OO1I 3J80L 3SE0A 1AP0A 1SJED 1FNVA 4CKBA 4EGVA 5DAUA 2H1EA 2O2LD 1ESFA 2F0LA 4C1NI 2A68D 3P20A 1SYDA 2JSOA 2L9HA 3SEBA 3C2PA 3K6OA 4QIWB 5ELDA 5FLXL 1STEA 1GOZA 4PNYA 5G3LF 1TIID 1D5ZC 1NAPA 3NQIA 5CV9A 3PUZA 1MSHA 3R2TA 2K32A 4IQZA 3S2DB 4X3SA 4IUPA 1EY6A 4HCEA 3V96A 1HA5A 1SYEA 4XDXA 1LTID 1LTRD 5C44B 2FHTA 3TDQA 3RMHA 2X6GA 3DXJC 1LT3D 2Q8IB 3S14B 4X3UA 5EKIA 3MZ5A 3BG3A 4IUQA 4LK1C 3KF8A 1KAAA 2F1MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WTQ A;  1NR4 A;  1J9O A;  2K28 A;  1RHP A;  1HFG A;  5EPJ A;  2L11 A;  5E4W C;  1WTP A;  2CVR A;  1U4R A;  1M8A A;  3ONA B;  4MHE A;  2L1B A;  1PFM A;  2B2V C;  3I3C A;  1KNE A;  3I90 A;  2FMM A;  4O42 A;  5DNF A;  3UI2 A;  1ILQ A;  4IUV A;  1JIC A;  2Q8T A;  3H91 A;  2NZ1 D;  4NW2 A;  3TZD A;  4CJ0 B;  2VXW A;  1F9R A;  1ICW A;  3R93 A;  1WTW A;  1EIH A;  2EE1 A;  1ILP A;  1BBX C;  1ML0 D;  1NR2 A;  1PLF A;  1EL0 A;  3TN2 A;  1BNZ A;  2M2L A;  1SSO A;  2RA4 A;  1NCV A;  1IKL A;  1CM9 A;  1WD0 A;  4ZLT F;  1DOL A;  2B2T A;  1U4P A;  2B2Y C;  3GV6 A;  4HAE A;  1F9Q A;  1QNK A;  1HUM A;  2B2U C;  2NYZ D;  2DY8 A;  4RWS C;  1B2T A;  1F2L A;  1B50 A;  2X6L A;  4UAI A;  2RVL A;  3MTS A;  1KNA A;  1AZP A;  1J8I A;  2X69 A;  4U68 A;  1VMP A;  4ZKB B;  2B2W A;  1WTO A;  1AP0 A;  5D14 A;  1XYI A;  2R3Z A;  5COR A;  1PFB A;  2JYO A;  3KBX A;  5CBA E;  5AFW A;  2K03 A;  1X32 A;  2MPM A;  1DOK A;  3N52 A;  3I91 A;  2HUG A;  4X3K A;  4ZAI A;  2HCC A;  4R8I A;  4HSV A;  2N55 A;  3DEP A;  3MWY W;  1S4Z A;  4X3T A;  5COY A;  2H1E A;  2K01 A;  2IL8 A;  2L12 A;  1RTO A;  4XT3 B;  2MP1 A;  2NWG A;  4HCS A;  4ZK9 B;  2JP1 A;  2L4N A;  4XT1 B;  4OIJ A;  4R9W A;  3FDT A;  3F2U A;  1A15 A;  1B3A A;  1WTR A;  1MSG A;  1EQT A;  2KED A;  1F9S A;  1F9P A;  2L9H A;  4CJ2 C;  1BF4 A;  1B4O A;  1RJT A;  1JE4 A;  3HP3 A;  1O80 A;  2K1B A;  1G2S A;  4RA8 A;  2RSO A;  2D9U A;  2N88 A;  3G7L A;  5E4X A;  1HHV A;  1EIG A;  5T1I A;  2KEE A;  4RAU C;  2HDM A;  1WTX A;  1HFN A;  2K04 A;  2EPB A;  1SAP A;  1VMC A;  1NAP A;  2B2V A;  3DEO A;  1TVX A;  3DM1 A;  4HED A;  1G2T A;  1ESR A;  5D65 A;  1WD1 A;  1U4M A;  2MGS A;  4OIK A;  2DY7 A;  1MSH A;  1U4L A;  5EQ0 A;  1CA6 A;  1X3P A;  5CBE E;  2FIN B;  2B2Y A;  2B2T C;  2BDN A;  1O7Z A;  3I8Z A;  4X3S A;  2SDF A;  1EOT A;  1XX8 A;  2B2U A;  1DOM A;  4IUP A;  3P7J A;  5EPL A;  2HCI A;  4CJ1 B;  3GV3 A;  1ROD A;  4ZKC B;  1HRJ A;  1Q3L A;  3QO2 A;  4LMQ D;  1CA5 A;  1GUW A;  3D6W A;  2B2W C;  1IL8 A;  2KEC A;  3SVM A;  4IUR A;  5EJW A;  4DN4 M;  2KUM A;  2MJ8 A;  2RSN A;  1X3Q A;  5EPK A;  4XDX A;  1QG7 A;  3IFD A;  3LWE A;  1WTV A;  4QUF A;  2XIW A;  2FHT A;  1WVL A;  1C8C A;  4QUC A;  1MI2 A;  1LV9 A;  2KOL A;  2HDL A;  3Q6S A;  1O7Y A;  1G6Z A;  4IUU A;  1QE6 A;  2FFK B;  2X6G A;  5JJZ A;  2FJ2 A;  1RTN A;  3KUP A;  1G91 A;  3FPU B;  3IL8 A;  4X3U A;  1PFN A;  2K05 A;  5EKI A;  5CMD A;  2EOT A;  2KVM A;  1HUN A;  1BO0 A;  4MN3 A;  1MGS A;  1B53 A;  1ZXT A;  4IUQ A;  1PDQ A;  1HA6 A;  1SDF A;  1DON A;  4IUT A;  1DZ1 A;  1IKM A;  5T1G A;  2J7Z A;  2Q8R E;  1E0B A;  1AZQ A; 
#chains in the Genus database with same CATH topology
 4PZ6 A;  3Q8D A;  3I72 A;  5I6Y A;  1PHJ A;  4A3I H;  3HOX G;  1U4R A;  3OIP A;  3HOU H;  2EYH A;  1KNE A;  3P1H A;  4LFC L;  1YNN C;  1I4H A;  1JJ2 A;  2EJG C;  4A3E B;  3KLS X;  1R9T H;  1WTW A;  3OTO Q;  2QDL A;  2HHH Q;  2NB0 A;  1NMG A;  1EL0 A;  3M4P A;  1Y1W H;  2LSS A;  2RHS B;  1NCV A;  3AYH B;  1U4P A;  4ZUJ A;  4JI1 Q;  1HUM A;  1A62 A;  3A5Z B;  1B2T A;  2X6L A;  4B3M L;  4LFA Q;  3FPP A;  1PTO F;  1S5D D;  4FDB A;  2F03 A;  2ICE C;  1Y69 U;  3L7Z C;  5AFW A;  2DUD A;  3RR5 A;  1T5X D;  1LT6 D;  1PZI D;  1YNJ C;  5AJ3 L;  2ZTD A;  2Z6K A;  1QCB D;  1BBW A;  3K57 A;  2GVB A;  1NNX A;  4EX5 A;  3PO3 B;  2WII B;  2D5D A;  1WTR A;  4CJ2 C;  2Y0S B;  2EY2 A;  5FJ8 G;  1IHZ A;  4XQJ A;  3K5L A;  4L5T A;  1U9R A;  4X62 L;  4KI0 A;  3BVM A;  4FYD A;  5E3F A;  4AYB E;  2NZO A;  5IT9 E;  3TME A;  3S2H B;  1JWM D;  3PO2 H;  2JA6 G;  2UXC L;  2B2Y A;  4DPG A;  3BYY B;  1BXT A;  4P73 A;  3H3V H;  4B3R L;  1UWV A;  3G4S A;  2VUM B;  1YHQ A;  3HOW G;  4GN5 A;  2NBF A;  4ZUI A;  2MJ8 A;  1K8A C;  3LWE A;  4DR5 L;  4B3T L;  2WKC A;  2EVB A;  1XNQ L;  1UUP A;  1EZ8 A;  1MI2 A;  2M00 A;  3W1B A;  3KK7 A;  2QIL A;  3VYU A;  1H9S B;  2Z6K C;  1L1O B;  5CGK A;  2DJG C;  4DK6 C;  3FPU B;  5I9P A;  4UP9 A;  1FYC A;  3S1N H;  4LNQ A;  1E24 A;  4BBR G;  3K81 C;  4LUO A;  1DZ1 A;  1NTG A;  1C9O A;  4QL5 A;  2Q8R E;  2DN8 A;  1SNO A;  3QB3 A;  3NEL A;  4RGO S;  4BY1 G;  3MEH A;  3A74 A;  3D6C A;  4HJ7 A;  1E2Z A;  2VB3 X;  2JA5 B;  5FO8 B;  1WJJ A;  4DUY Q;  2WAQ G;  3VA7 A;  4TRD A;  3FMC A;  2SEB D;  1ILQ A;  2Q8T A;  4A76 A;  5ISR A;  4FNF A;  3UDX A;  1YNN D;  4ME3 A;  1PLF A;  2AKW B;  4C56 C;  1TY0 A;  1G29 1;  1PXU A;  1SXT A;  1EWC A;  1Z7T A;  1DOL A;  2B2Y C;  1GUN A;  4JI7 Q;  3SK6 A;  1YNX A;  4O0A A;  1VMP A;  1EY0 A;  4AQY L;  3S16 B;  3MXG A;  5COR A;  1Y1V H;  3L9A X;  3NEM A;  3NTI A;  1UE1 A;  3R2I A;  4DR4 L;  1STB A;  3CCJ A;  4DR1 L;  5JVH 3;  4RMF A;  2K7V A;  1SJH D;  4QJF A;  1K83 H;  3PUX A;  4P71 A;  1FNU A;  4RHS A;  4YWM A;  1VQI A;  4A93 G;  2G9H D;  3F2U A;  3FRP B;  1FJG Q;  3GTL B;  2K1B A;  1PZJ D;  2RSO A;  4YHH L;  4LF7 L;  5IOC A;  3G7L A;  1PYW D;  1VQ5 A;  3SK4 A;  1CK1 A;  2I5L X;  4FXG C;  5C3E G;  1WI5 A;  1TU2 B;  2ZM6 L;  4KK7 A;  3H3V C;  4F7X A;  1U4M A;  5FLM G;  1MJE A;  1PH4 A;  4G4K A;  5LMN L;  2Z0S A;  1VDZ A;  1PH9 A;  2FIN B;  4BXX G;  2BDN A;  3QOL A;  1NUC A;  5I9O A;  3GTP H;  3T1Y L;  3GV3 A;  4CKE A;  4DF7 A;  2WV6 D;  5A2Q E;  4DV2 L;  2VQF Q;  1I6H H;  2RDF A;  1IL8 A;  5M5Y B;  1QVC A;  4IUR A;  4B3S L;  4MZ9 A;  3J81 E;  3KDF B;  3RN2 A;  1H9K A;  2K5N A;  4R4T A;  5IT9 c;  2XTI A;  2KHS A;  2AWO A;  1YJW A;  3SR1 A;  2IX1 A;  2E2I H;  2NVY B;  1NJI C;  2CH4 A;  4OX9 Q;  2JXM B;  3F1Z A;  2D0P A;  3FKI H;  1HUN A;  1TWF B;  3PSI A;  1EU3 A;  4QCL A;  3QJY A;  2DJF C;  4J1M A;  5J22 A;  2F4V Q;  2PW5 A;  2HIV A;  2I46 A;  4FXK C;  1E0B A;  3PF4 A;  1STN A;  1PVO A;  3U9S A;  5LMN W;  1VS0 A;  1GVP A;  2JE6 I;  1QJO A;  3SK5 A;  1HXY D;  5GAD C;  4JI2 Q;  1K28 A;  2R7Z G;  2VQE Q;  1CHQ D;  4RG1 A;  3I4M B;  3CMA A;  3WOE A;  3TN2 A;  1J5E Q;  4JG2 A;  1W6K A;  2DGY A;  1RIP A;  2CQA A;  1X9N A;  2NYZ D;  4NP5 A;  4LF5 L;  4UAI A;  1FL0 A;  2Q2U A;  1WTO A;  5C4J B;  3NTK A;  1PRT B;  4A3B H;  4L5Q A;  2Z8L A;  3DUZ A;  2F0N A;  4HIK A;  2IT1 A;  2N8N A;  1I6H B;  3TP6 A;  2K01 A;  3F2C A;  4XT3 B;  3HOV G;  1IW7 C;  2BCO A;  4ODG A;  2JP1 A;  1HJP A;  4JBK A;  1JR0 D;  4S3S A;  4C3H H;  1JE4 A;  5C5L A;  3M4O H;  3E3X A;  4H13 C;  1PV4 A;  3MXN B;  1HNW L;  4A3D H;  1GUT A;  2EZV A;  3STB C;  3TP8 A;  5FLX E;  1TWH B;  3LWU A;  2YU9 H;  2GVA A;  4C3J B;  1IBL Q;  4XQQ A;  1PH6 A;  2QEX A;  1XMQ L;  5NUC A;  5FOB B;  4OWT B;  5BN3 A;  4P75 A;  3ULJ A;  4DXF A;  1BUV T;  1BVS A;  3I8Z A;  4I65 A;  1XX8 A;  2B8G A;  2WKD A;  1SRU A;  2HCI A;  5JEA G;  4J6H A;  3PCO B;  4HJ9 A;  1M4V A;  4DR3 L;  2NVQ H;  3RZO H;  2I5H A;  2JA9 A;  1CT1 D;  2JA8 B;  4OEL B;  2PQA A;  5IT9 L;  2E74 C;  4A3K H;  1QZH A;  2PO4 A;  4Z9C B;  2H4O A;  4LF8 Q;  4DV4 Q;  4BY7 G;  1RTN A;  1STG A;  1I4G A;  1V9P A;  5IP7 H;  1E2V A;  3TRZ A;  1HNX Q;  1EEF D;  1CUK A;  1C0A A;  1PDQ A;  3KFU A;  2KCT A;  3R8B A;  4F88 A;  2R6G A;  3GO5 A;  5DEH A;  4K8J A;  4YIJ A;  2ID0 A;  4YCU A;  4LF9 L;  3GTQ B;  1PH8 A;  1ENA A;  2R93 G;  1RHP A;  1HFG A;  3SHL A;  3LGJ A;  1PMR A;  5D3D A;  4IUV A;  1JIC A;  3J81 i;  1Q82 C;  4A3F B;  4KN4 C;  4TSS A;  4RGT A;  1ILP A;  4JI4 Q;  4FP5 D;  2B63 G;  1K8G A;  3NWS A;  2C35 B;  1O78 A;  3TBI B;  3V2T A;  3CU7 A;  4PZ8 A;  1T9H A;  2PNH A;  3GV6 A;  2Q2T A;  2ZXP A;  1QNK A;  5IYC G;  4OO1 H;  5BN4 A;  2V4D A;  3RUZ A;  1TKW B;  3L3O C;  1B7Y B;  5CR3 A;  1DD2 A;  3HOY G;  4K2L A;  3OWE B;  2OTJ A;  2Z4I A;  3N52 A;  2HUG A;  2HCC A;  1S4Z A;  5COY A;  3RZD H;  2DNE A;  4GKK L;  2JK8 A;  1V1O A;  2L12 A;  2PZT A;  1YZ6 A;  5ELF A;  2L4N A;  4OIJ A;  5C3X A;  3M3Y H;  4R9W A;  1B3A A;  4APV A;  1JE5 A;  1IW7 D;  3ULL A;  5C4X G;  1YBY A;  2KCC A;  1SR3 A;  3HP3 A;  3T13 A;  4LFB L;  2H5X A;  2N3S A;  3AEV A;  3PMF A;  1CKM A;  1LAB A;  1B70 B;  4GLV B;  4YCV A;  5DM7 3;  1TWA H;  5TSS A;  3H94 A;  3STB D;  1IL2 A;  3J80 i;  4C3I H;  2HT1 A;  3E0J A;  3GTO B;  1CQV A;  1TWG B;  2E76 C;  2A68 C;  4WOR A;  4BBS B;  1I3Q B;  1VQN A;  4JW0 A;  2AQ3 B;  5KNC A;  1YI2 A;  3KLS A;  2WAQ E;  1GD7 A;  3A5U A;  1FNW A;  1QUQ B;  2VNU D;  2A73 B;  1GUW A;  1S5B D;  1ASZ A;  1KAB A;  4DKA C;  4M1U B;  5K5P A;  4QUF A;  3VYR A;  5ELN A;  3NWT A;  3TEH B;  5FO9 B;  4PZ7 A;  4XIG S;  2RCN A;  1G6Z A;  1QE6 A;  2F0I A;  5FKA C;  5GRO A;  4KHP Q;  1QNU A;  1GO3 E;  2JA7 G;  4M8A A;  3CPW A;  1G91 A;  2UU9 L;  4RCN A;  5A2Q L;  1KL9 A;  3BZK A;  3CCL A;  3VR5 A;  4A3M G;  2MFI A;  3NE5 B;  4LUV A;  1WTQ A;  5J1Z A;  3NBH A;  1IBK Q;  2CVR A;  4HR7 B;  4GOP B;  2L1B A;  2ATW A;  3I7F A;  1P16 A;  3OIQ A;  3DMU A;  2RDG A;  1PRT F;  1LT5 D;  2KHJ A;  2KHI A;  5HY6 A;  2ZT9 C;  4X64 Q;  4JV5 L;  1BCP C;  3SGI A;  5FO7 B;  1Q1B A;  5I6W A;  4IPG A;  2OEO A;  3GTJ H;  2BDO A;  5E1F A;  4CHT B;  3GTK H;  5IGE A;  3U58 A;  3C1F A;  2F4V L;  1TS5 A;  3I4N H;  5IYD H;  3KBX A;  3T51 B;  4N8F A;  4HSP A;  4PMC A;  1HH2 P;  4R8I A;  4IO9 A;  4O1N A;  3DEP A;  2WB1 G;  1LLR D;  2LMC B;  3OTO L;  2HHH L;  2J4X A;  3KYH C;  3J7A 5;  2OCE A;  1KRS A;  1LTS D;  2PZU A;  2RKS A;  3MC0 B;  4JI1 L;  3AFQ A;  5ELE A;  1N34 Q;  1BDO A;  1IYJ B;  4JK1 C;  3TS0 A;  2C5C A;  1HHV A;  4LFA L;  1G6P A;  4ULL A;  5ELO A;  4PQX A;  5I2X A;  2K04 A;  2EPB A;  5M5W B;  4ZRZ A;  3I4L A;  1VQ7 A;  1TVX A;  1WCM H;  4KLK A;  1ESR A;  2R92 B;  5D65 A;  4A3J B;  2QCP X;  2EYF A;  3H0G G;  2JN4 A;  5CYU A;  5JJI A;  3CQZ B;  1STA A;  1DJR D;  2IX3 A;  1VQJ A;  4UP7 A;  3CPF A;  4CJ1 B;  2VB2 X;  1HZB A;  4HTH A;  4DUZ Q;  5KNB A;  2IJ0 A;  4WJ3 M;  1KDB A;  3HOX H;  5EPK A;  4A3G B;  3NSW A;  4QUC A;  3I55 A;  5KIX A;  1EWH A;  2HDL A;  3SDZ A;  2E2H H;  1MD2 D;  2YYZ A;  3HKZ B;  3TQY A;  4XQN A;  4DV6 Q;  1EZ6 A;  1JT8 A;  4WJ4 A;  5HGQ A;  3UE1 A;  3IL8 A;  2I5M X;  3S15 H;  1HQR D;  3D8G A;  2VW9 A;  4IJL A;  1X55 A;  5T1G A;  2YTX A;  4DV3 Q;  1E3P A;  1J9O A;  4IAL A;  3W5O A;  2D62 A;  3OSO A;  3I3C A;  1OO9 B;  5KRU A;  4Y52 H;  1EYC A;  4EVO A;  1F9R A;  1QVF A;  5DLQ E;  1BBX C;  1OXT A;  5M3M B;  1Q1E A;  3ND8 A;  1BNZ A;  4BS9 A;  4LF4 Q;  1T5E A;  1XTC D;  5FJ8 H;  1BCP D;  5C44 G;  1F2L A;  1OXU A;  4CBV A;  1N33 Q;  3OPO A;  1N32 Q;  2B2W A;  2JQO A;  4WRD A;  2HQE A;  2NVX B;  4DUY L;  1GJX A;  2L5T A;  3K8A A;  2JA6 H;  2K5Q A;  1KHI A;  2HIX A;  2R7F A;  1RTO A;  4QF4 A;  3A55 A;  3I4O A;  4ZK9 B;  2F0F A;  2ES2 A;  2OWO A;  3Q22 A;  1A15 A;  1EQT A;  1F9S A;  4RH6 A;  1XXG A;  1BQQ T;  2E5L Q;  4JI7 L;  3KF8 B;  1O80 A;  3DLL A;  3A56 A;  4A3E G;  4J8Q A;  3HOW H;  1HNZ Q;  5KYL A;  4YWL A;  1EQR A;  4A4I A;  1M90 C;  1D1K A;  4CGY B;  5M3F B;  3J7A F;  4L63 B;  1I5F A;  4X6A H;  1VQ4 A;  3URY A;  3HOZ B;  4P2C B;  1L0Y B;  2N78 A;  1LUZ A;  2F52 A;  1PA6 A;  3BJU A;  4BA1 I;  5HUR A;  4BA2 I;  4IPC A;  1CA6 A;  2YV5 A;  4QQB X;  4OGQ C;  4BBR H;  2TMP A;  2NN6 G;  2F0W A;  2ZXR A;  5K36 G;  3S17 H;  4BY1 H;  3KF6 A;  4ZCK A;  5IOD A;  4LMQ D;  2B2W C;  2NVT B;  4KD3 A;  1HQM C;  1JQY D;  1GHJ A;  2PW7 A;  1O7L A;  1XTD A;  3A7A B;  1SE3 A;  4UDU C;  3PO3 G;  1VQE A;  2BA1 A;  2E8G A;  2Y0S G;  5ELB A;  1D6E C;  1SYB A;  4JOI A;  1VF5 C;  1X3E A;  4A3I B;  3HOU B;  2CCZ A;  1MGS A;  3S1M H;  3IAY A;  2E2J H;  3QOJ A;  2LFN A;  4I7Z C;  1R9T B;  3CC4 A;  3JAM c;  1AW7 A;  3BYT B;  3TSS A;  1SMY C;  1Y1W B;  3CC2 A;  1SN8 A;  3MVV A;  1P8L A;  4R1J A;  1LTT D;  2NZ1 D;  2KJX A;  5CV5 A;  3R93 A;  1SYC A;  4NB3 A;  2EY6 A;  2VUM G;  3NTH A;  1Y8P B;  1JMC A;  3NHH A;  2F0V A;  3T1H Q;  1WD0 A;  4A93 H;  1OXS C;  4OX9 L;  3DWP A;  5JJK A;  1CSQ A;  4RWS C;  3W1G A;  2F0D A;  2CW0 C;  2EXZ A;  3A8K E;  3V05 A;  4C1N K;  3VR4 A;  1J8I A;  4KV6 A;  4HMJ A;  4DR2 Q;  2X69 A;  2KEN A;  3HS0 C;  1C48 A;  3WOF A;  1ET9 A;  1OXX K;  5D14 A;  5C3E H;  1UE5 A;  1PFB A;  5KGU A;  5LL6 X;  2ZJR A;  4JBJ A;  4X66 Q;  4H7B A;  2A6H C;  5FLM H;  2MO0 A;  4JI2 L;  1XPR A;  3KLR A;  2IHF A;  2AUJ D;  1NE3 A;  3G48 A;  1EEI D;  5IGC A;  2VQE L;  5C0X G;  4BXX H;  2CWA A;  4JOI C;  4R4I A;  1HTP A;  3SK8 A;  1J5E L;  2JA5 G;  1KD1 C;  2NN6 I;  5IYB G;  4KY6 A;  2CKZ B;  3BZC A;  2GA4 B;  1B4O A;  1RJT A;  4NXN Q;  2XNA C;  1G2S A;  1YJN A;  5T1I A;  2B3G A;  4XYQ A;  4LJZ C;  3PO2 B;  1HFN A;  2WP8 J;  1CSP A;  2KCN A;  2K14 A;  3G71 A;  3C3L A;  4TKO B;  1SEB D;  4JI3 Q;  1GHK A;  1W3S A;  1ZYR D;  3MXP A;  2MGS A;  3Q0A A;  1CQF A;  3DWA A;  3AQQ A;  5E7N A;  5HGT A;  5LMU Q;  1EOV A;  2Z9H A;  1SLJ A;  3D4W A;  1D5M C;  3F2D A;  5L37 A;  1L0W A;  5FK9 C;  5BR8 Q;  2XRS D;  4R4O A;  2F3I A;  2XIW A;  1VQH A;  2R7Z H;  2HD3 A;  1LV9 A;  1CKN A;  3K7A H;  3S1N B;  1IBL L;  2IWH A;  4G57 A;  3FHW A;  1UE6 A;  1XNR Q;  1XWE A;  1YHA A;  1GUO A;  4NMZ A;  1TT2 A;  3EVQ A;  4HJ8 A;  4IUT A;  2M9V A;  4DV0 Q;  1IKM A;  1AZQ A;  2GN5 A;  1EFW A;  1IXR A;  1X3F A;  2WB1 E;  3M4Y A;  2PPB C;  3JAM L;  4HN7 A;  1KRT A;  1WTP A;  1S5E D;  2PYK A;  1EIF A;  2A5H A;  1SMY D;  3E5S A;  3KJP A;  3G6J B;  1IYU A;  4UY8 C;  3S1Q H;  2UUB Q;  1A63 A;  3HOV H;  5C0X I;  4DV4 L;  1Q86 C;  1CM9 A;  2B2T A;  3O13 A;  1Y1V B;  4G7Z C;  4IPH A;  1KLG D;  2DY8 A;  4V19 0;  5F2D A;  1HNX L;  1F2Z A;  3GTG H;  3BDL A;  1I4R A;  3K80 C;  1AZP A;  2PMZ B;  3TRE A;  1KDC A;  1LTA D;  4ILW A;  2CW0 D;  2K33 A;  4EQO A;  1M1K C;  3ERO A;  1K83 B;  3T16 A;  4DFA A;  3UE0 A;  1X32 A;  1DOK A;  3LNN A;  4J15 A;  3RNU A;  4FXD A;  1PYS B;  3MWY W;  2A6H D;  4GNX A;  1A6X A;  4JI4 L;  2F0K A;  1SFO H;  1NSN S;  3MFY A;  1I4P A;  3X3M A;  4DR6 Q;  5JEA H;  1ENC A;  3OW7 A;  2NUC A;  3H15 A;  1G8Z D;  3I4M G;  2HDM A;  4QIW E;  5D3I B;  1WTX A;  4A3C G;  2EJF C;  4EQN A;  4QY7 A;  1L0X B;  1NY4 A;  1SAP A;  2WIN B;  4JVZ A;  3GTP B;  2TSS A;  4BY7 H;  4DNI A;  4DK1 A;  4OIK A;  4HMI A;  2DY7 A;  5EQ0 A;  4FF4 A;  2QKI C;  2F0P A;  3QIA A;  2B2T C;  1STH A;  5EPL A;  2P5Z X;  2IW3 A;  1I94 Q;  5JPN C;  2RBM A;  3VR3 A;  1H9M A;  2XGT A;  2SNS A;  1EYA A;  2R93 H;  2E2I B;  1PH5 A;  1B1Z A;  1V1Q A;  2LS0 1;  3IFD A;  1WTV A;  1Z9F A;  3FKI B;  1KTK A;  2E2D C;  5IP9 G;  2B63 H;  1S40 A;  1Q81 C;  4GNX C;  2FJ2 A;  3U4Z A;  1TWC H;  1YIT A;  4IPD A;  5IYC H;  2K05 A;  3NP8 A;  1EQQ A;  2C9O A;  2KBN A;  4DNT B;  4C3J G;  5JAV A;  3HOY H;  3IKJ A;  2F0T A;  3CW2 C;  2V1C C;  2HQL A;  2OT2 A;  3PGZ A;  3AU7 A;  3EFX D;  3H91 A;  3TZD A;  2K6A A;  3VYS A;  4Y7N H;  3K5N A;  3PUV A;  2EE1 A;  5GAG C;  4DAY A;  4IFD G;  3CXC A;  1SYG A;  5KYI A;  4A3B B;  4KHP L;  5C4X H;  3EA6 A;  3KLW A;  1VQ8 A;  3D4R A;  4XXE A;  2JA8 G;  1QWY A;  3MTS A;  4UHV A;  1D5X C;  4IZ8 A;  5M5X H;  1QZG A;  1UNS A;  3LX0 A;  3RD4 A;  2R3Z A;  4IJH A;  1OXV A;  3EQL C;  5EBC A;  3JC6 6;  2IHE A;  3VYT A;  1IBK L;  2AMC B;  3OWF A;  2PQA B;  4HID A;  4AH6 A;  1CI3 M;  2EJM A;  4HSV A;  4C3H B;  4OEM B;  3M4O B;  1UE7 A;  4KKU A;  2PCF B;  2A19 A;  1A3U A;  1A3V A;  3I73 A;  1VQD A;  4MTK A;  2AWN A;  2F0Q A;  4HCS A;  4X64 L;  3ERS X;  3OMC A;  4A3D B;  4JBW A;  3EJI A;  1F2M A;  1V1P A;  1FR3 A;  1F9P A;  4QB4 A;  2YU9 B;  2L55 A;  4DV1 Q;  4RA8 A;  4DV7 Q;  4A3F G;  4NXM Q;  1TS3 A;  2Y0S E;  4DXG A;  1PZK D;  1EIG A;  2AUK A;  1PTO H;  4FF1 A;  5JJL A;  4KN7 C;  3BDC A;  3DM3 A;  4AIM A;  5KEE A;  4AYB B;  3DEO A;  3GTM H;  2RDH A;  2BH8 A;  4B9W A;  4DK3 C;  1K8M A;  4O2D A;  2JA7 H;  2F4I A;  2N49 A;  1X3P A;  2NVQ B;  5H1S E;  2PZW A;  2ZJQ A;  4OWW B;  2F0H A;  4A3M H;  3RZO B;  1O7Z A;  2MHV A;  3P7J A;  4KMU C;  1CZW A;  1ZKO A;  1KC8 C;  4XTC S;  4A3K B;  4DAM A;  4JYA Q;  3KJO A;  4JI6 Q;  3CD6 A;  1D1I A;  1N34 L;  1BOS A;  4R4C A;  2JJQ A;  4V0B A;  4PMB A;  4H0L C;  1HCZ A;  1WVL A;  2O5I C;  3VR2 A;  1BKB A;  3UDG A;  4CDE C;  5I2Y A;  2FFK B;  1SNC A;  5JJZ A;  4IFD I;  4DR7 Q;  1SNP A;  2XWJ B;  5CMD A;  2F0O A;  2AQ2 B;  3J80 c;  1BO0 A;  1VQA A;  1ZXT A;  3E9I A;  4F87 A;  3PQI A;  1U0L A;  3MXU A;  3D3R A;  5LL6 S;  4DUZ L;  2L15 A;  5M9O A;  1K0R A;  2K28 A;  4YWK A;  1V43 A;  4BBS G;  4O42 A;  4N9T A;  3I90 A;  2FMM A;  3UI2 A;  1W2B A;  5EBD A;  3KOJ A;  4C2M H;  4JI8 Q;  3UDI A;  3QG1 A;  1RL2 A;  1BCP B;  3CCM A;  2VY3 A;  1FGB D;  1I50 H;  4PMW A;  4K14 A;  4DV6 L;  3M9B A;  3PIO 3;  3K59 A;  4Q5V A;  3OMG A;  3RZD B;  4KY7 A;  3PIP 3;  2MNA A;  1XYI A;  1QIL A;  4DV3 L;  2EYJ A;  1VQF A;  1EQV A;  3WWV A;  2UUA Q;  3M3Y B;  3WDN A;  2IPK D;  4RFB A;  2QGQ A;  3I91 A;  3H0G H;  4ID6 A;  3ULP A;  3ZJY C;  2LY7 A;  1AE3 A;  3NUC A;  4JI5 Q;  1Q90 A;  1QOH A;  5CV6 A;  1PTO C;  2AHO B;  5C4H A;  4K5W A;  2F0J A;  1CHP D;  4DAV A;  1N8R C;  4LF4 L;  3I56 A;  2O5J C;  2K75 A;  2F3W A;  1BF4 A;  1TWA B;  1SNM A;  5JEA J;  4RGN A;  4C3I B;  1IYV A;  2PQE A;  2XSC A;  2KEE A;  1N33 L;  3NBH B;  1N32 L;  4RCO A;  1TY2 A;  3G6E A;  4EQP A;  1JB3 A;  3T4A C;  3A0J A;  4HED A;  1LT4 D;  1EWI A;  1MJC A;  3K5O A;  3M7N A;  4HIO A;  2E75 C;  5CV7 A;  2F0S A;  3IRB A;  2QDB A;  2EQS A;  2QW7 A;  3NEN A;  3L2P A;  3J7Y W;  2QF7 A;  5G3L D;  2MUY A;  1DXM A;  3A8J E;  4QGU A;  1XMO Q;  1Q3L A;  3QO2 A;  4JI0 Q;  2E5L L;  3SVM A;  4KD4 A;  1KAW A;  1HNZ L;  3S2D H;  1N36 Q;  1A2T A;  1QG7 A;  3CCR A;  4N9P A;  1GXD C;  4IN3 A;  2EXD A;  1CKO A;  3RN5 A;  1O7Y A;  4Q0F A;  1X54 A;  5A35 A;  3OW2 A;  5GAH C;  3GDE A;  3MA2 B;  5C44 H;  3BVG A;  4FVM A;  2EOT A;  1H95 A;  1HR0 Q;  1K3B C;  2K50 A;  1HZA A;  2KCM A;  2R92 G;  4A3J G;  1DYQ A;  3HZX A;  4A3L G;  3S14 H;  3T53 B;  4MHE A;  3PIO A;  2ZJP A;  5DNF A;  2Q2I A;  2RF4 A;  3JAM E;  2A69 C;  3GTJ B;  3PUY A;  1II3 A;  4OHJ A;  4UP8 A;  3PIP A;  3GTK B;  1VQB A;  3OHX C;  1C7Y A;  4LF6 Q;  3F8T A;  3K7U C;  3PUW A;  1IKL A;  1E1O A;  3I4N B;  5J3B A;  1Z6H A;  2ZXO A;  4GN3 B;  1PH7 A;  1VF7 A;  4A3G G;  3CCS A;  2UXD Q;  1SNQ A;  5IGF A;  1NMF A;  4A3E H;  1AFP A;  4RKB A;  4K0K Q;  4ZKB B;  2F0U A;  2EY5 A;  3HG9 A;  3HKZ G;  2I07 B;  2OF1 A;  2WFW A;  2G9D A;  5C6A A;  1MIU A;  1SND A;  5CBA E;  2K4K A;  2K5W A;  2K03 A;  2MPM A;  4KHZ A;  1ENF A;  3OOC A;  2KA7 A;  2PI2 E;  1YHB A;  1H9R A;  1Q8I A;  3OYY A;  1GM5 A;  1RDP D;  2B29 A;  1AH9 A;  2NN6 H;  3A8I E;  3T1H L;  5K36 H;  1AE2 A;  5CV8 A;  1PTO D;  1WCM B;  3CCV A;  1TQO A;  4YCW A;  2D9U A;  1L2F A;  1SE4 A;  4DR2 L;  5M3M G;  1Q8K A;  3PO3 H;  4UPA A;  2LXK A;  1K73 C;  4GKJ Q;  3D0F A;  4X66 L;  1AEX A;  1RCV D;  2XRQ D;  1VQL A;  2JEA I;  4BWG B;  3TS2 A;  1U4L A;  3HOX B;  4E6I A;  2XN9 C;  5KND A;  3S9W A;  4H44 C;  1EY8 A;  1VQC A;  2BE5 C;  4MIU A;  2E2H B;  1DM0 B;  4F8M A;  4NXN L;  3S2H H;  1B3Q A;  5EJW A;  3GD7 A;  2EYL A;  1UEA B;  3H09 A;  3S15 B;  1VQ9 A;  1ZYR C;  2VUM H;  2Q2H A;  3ICE A;  3Q6S A;  3B6Y A;  2UUC Q;  4IUU A;  2EDG A;  1RD9 D;  4JI3 L;  2WAC A;  3KUP A;  4HJA A;  5M3F G;  1EFI D;  5LMU L;  3HOZ G;  4IOA A;  1OTC A;  2O4X A;  4MNO A;  2OTL A;  1BCP F;  1FJG L;  1NR4 A;  5BR8 L;  4JCV E;  3ERQ A;  3S1R H;  4CJ0 B;  1EY5 A;  5C0X H;  1EIH A;  3D4D A;  1ML0 D;  1R4Q B;  2A69 D;  3AMU A;  1X3G A;  2RA4 A;  2JA5 H;  4ABN A;  5IYB H;  1EU4 A;  4ZLT F;  4G7O C;  4GN4 B;  1I6V C;  4DV5 Q;  1RKN A;  1XNR L;  3CP0 A;  1C4Q A;  1EY4 A;  3KF6 B;  1IBM Q;  4KKT A;  3RLN A;  4U68 A;  4X65 Q;  2JA6 B;  2B8F A;  4DV0 L;  2VQF L;  3QWN A;  2CHB D;  1WFQ A;  5IY0 A;  4A3I G;  2LXJ A;  3HOU G;  4ZAI A;  2EYM A;  3HOW B;  1H9S A;  2UUB L;  1K0S A;  3S16 H;  1L1O A;  3JAM i;  1PFS A;  1Y1W G;  2F3V A;  2R61 A;  2CFM A;  2OXP A;  5JOB A;  1MSG A;  1K9M C;  2K5D A;  4YY3 Q;  1DGS A;  3E6Z X;  3ITP A;  1S5F D;  4NDX A;  5C5M A;  2F0E A;  4RAU C;  4P74 A;  2IY5 B;  2K5H A;  3BZD B;  4BBR B;  3DM1 A;  2ASB A;  1VQM A;  1G2T A;  1TS2 A;  5BN5 A;  5IWA Q;  3GTL H;  1LTB D;  3S17 B;  1FVI A;  4BY1 B;  1S72 A;  3TZU A;  2WAQ B;  4K8I A;  1Q7Y C;  2VL6 A;  4H02 A;  3T56 B;  2FMC A;  2SDF A;  1VQG A;  3S1R B;  1BR9 A;  1DOM A;  3C1E A;  1ICF B;  2B2U A;  4DR6 L;  1ET6 A;  2UXB Q;  1KDA A;  1WTH A;  3J7A V;  3AFP A;  3D6W A;  2NTS A;  2BE5 D;  3MFG A;  3W2D A;  2KUM A;  1EYG A;  4LFC Q;  4ALP A;  3S1M B;  3CRK C;  3NPP A;  2YTY A;  3R3O A;  2E2J B;  2EY1 A;  5M5Y H;  4MTN A;  3BS1 A;  1L1O C;  1VCI A;  3PO2 G;  1SE2 A;  4LWC A;  3HKS A;  3KBG A;  4GS3 A;  3U9O A;  1K3R A;  2ZTC A;  1ZEQ X;  5CV4 A;  2PNR C;  5C3W A;  4B3M Q;  5GAE C;  1JC7 A;  1I94 L;  3RLF A;  4L6T B;  2NVY H;  4JPB W;  5IGG A;  1NBW A;  3RLO A;  1VQP A;  1LAC A;  1QVG A;  4A93 B;  2Z6B A;  1TWF H;  5AJ3 Q;  1CZG A;  3QR8 A;  4NW2 A;  1G51 A;  2VXW A;  1YEZ A;  3W3A A;  3CCU A;  1YNJ D;  4HIM A;  2D0O A;  4GZY C;  3GQB A;  3MEF A;  2M2L A;  4KY5 A;  3P75 A;  2YTV A;  3EBE A;  3UDF A;  5C3E B;  1S5C D;  2J0T D;  3J7Z C;  1I4X A;  3I70 A;  1HZC A;  2B2U C;  3BDO A;  5JPM C;  1PH3 A;  4RHR A;  3Q24 A;  4LUZ A;  3TP5 A;  1KNA A;  3CHB D;  2F0M A;  3PV0 A;  3I4M H;  2RQX A;  4X62 Q;  4A3C H;  1A0I A;  3KDF A;  1MKH A;  2JYO A;  3AB9 A;  5IGB A;  4QMG A;  3C46 A;  1VQO A;  1CKN B;  3K0X A;  5GQO A;  4XYO A;  2A6E C;  4K2K A;  2UXC Q;  5C4J H;  2LKV A;  3A54 A;  4CDC C;  5CC4 A;  4LF8 L;  2NWG A;  1R4P B;  2SOB A;  1A3T A;  1Y14 B;  4R4Q A;  4B3R Q;  4CDF C;  4U67 3;  5E4X A;  3CRL C;  4WFN 3;  4R8N A;  4B3T Q;  4DR5 Q;  1XNQ Q;  1H9J A;  3K5M A;  5IP9 H;  1Y1V G;  2AQ1 B;  1SYF A;  1XPO A;  2BOS A;  4POG A;  4GLA C;  2OQ0 A;  1TWH H;  2R7Z B;  4C3J H;  3TP7 A;  3K7A B;  1ROD A;  3H3V I;  1HRJ A;  4DV1 L;  1CA5 A;  2KEC A;  5IGD A;  1F77 A;  2CH4 W;  3ZYY X;  4DV7 L;  4NXM L;  3F2B A;  3VDY A;  3I2Z A;  1A2U A;  4CDD C;  2PI2 A;  1EY9 A;  4LW1 A;  4IFD H;  4GNX B;  1JWS D;  4P72 A;  3L0O A;  3FVQ A;  1PH1 A;  4KJO A;  3HKZ E;  1JOR A;  4GLX A;  2JA8 H;  2I0Q A;  1DON A;  1B8A A;  4AQY Q;  1KLU D;  1O7I A;  3S1Q B;  2J7Z A;  3HOV B;  1U5K A;  4L8J A;  3MXN A;  3E0E A;  4JI6 L;  2L11 A;  5E4W C;  3J80 E;  4DR4 Q;  4JYA L;  1M8A A;  3ONA B;  1PFM A;  1CFM A;  4DR1 Q;  1RF2 D;  3M7G A;  3GTG B;  3NXW A;  4ME5 A;  1E2W A;  3GTQ H;  4DU9 A;  3VA5 A;  5C0X J;  1I4Q A;  3HGB A;  3S24 A;  1HZ9 A;  1Z47 A;  3H6M A;  4DR7 L;  1JOQ A;  3FKI G;  5J39 A;  4YHH Q;  4A3F H;  4LF7 Q;  2RVL A;  3DWQ A;  5EKL A;  5DM6 3;  1PRT C;  1E7Z A;  3EIV A;  1SFO B;  2ZM6 Q;  4X3K A;  5LMN Q;  1J6Q A;  3ER0 A;  4JI8 L;  2A6E D;  3NK9 A;  1K8O A;  4G7H C;  3NBI A;  3T1Y Q;  1JCK B;  4XT1 B;  2R7D A;  2Z4H A;  3FDT A;  1XJV A;  1B9M A;  3A7L A;  4RKL A;  4DV2 Q;  4B3S Q;  1CTM A;  4BY7 B;  2N88 A;  1X6O A;  3E9H A;  3CAM A;  1FD7 D;  3GP7 A;  4KTA A;  1HPC A;  1TR5 A;  4NKL A;  4A3B G;  1VMC A;  2B2V A;  2UUA L;  1X65 A;  1MHW C;  1Y8O B;  1HTL D;  1WD1 A;  2EYO A;  4DAY B;  4OL7 A;  2R93 B;  1Y8N B;  2SNM A;  2A74 C;  1KIX A;  1LYL A;  4JI5 L;  3J81 c;  2QEJ C;  2VS1 A;  2KQ3 A;  3MHB A;  4DK0 A;  1EOT A;  1UEB A;  4TVA B;  4L5R C;  2JEB I;  4DGZ A;  4ZKC B;  2B63 B;  3GTO H;  2F0G A;  4C3H G;  1TWG H;  1GUG A;  2D2C C;  3VR6 A;  1TXY A;  3SXH A;  4DN4 M;  4BBS H;  1I3Q H;  5EAY A;  1TWC B;  1C8C A;  4A3D G;  1PH2 A;  2BH2 A;  3DHQ A;  1DCZ A;  1JOO A;  1TS4 A;  4ZQ3 A;  1SRO A;  3HOY B;  4JBM A;  1SE8 A;  1SBB B;  4DAP A;  1PFN A;  2B39 A;  3HRZ C;  1JOK A;  4MN3 A;  4LF5 Q;  1V1P B;  3HEJ A;  4POF A;  2K5V A;  4AYB G;  4KJN A;  2ICI A;  4K5V A;  1EUJ A;  4Y7N B;  3PF5 A;  4B9X A;  1XMO L;  2RCF A;  4RGM A;  4JI0 L;  1VQ6 A;  1E22 A;  4K6D A;  4ZYS A;  2B2V C;  1N36 L;  5C4X B;  5EKK A;  3FEW X;  1B44 D;  1GUS A;  1LTG D;  1LO5 D;  2L0C A;  4A3K G;  1NR2 A;  5EGT A;  1D8L A;  5M5X B;  3MAQ A;  1QB5 D;  5I4D A;  3ND9 A;  1JWU D;  5IIF A;  1F9Q A;  4B08 A;  5IP7 G;  1QUQ A;  1HR0 L;  3CF5 A;  1B9N A;  5JVG 3;  1HNW Q;  4KKS A;  5ELC A;  4L5S A;  1EYD A;  4PV1 C;  3Q23 A;  4FO2 A;  3CCQ A;  2QA4 A;  2IX0 A;  1STY A;  2Z1C A;  4FF2 A;  2BA0 A;  1PRT D;  2N55 A;  1AN8 A;  1XMQ Q;  4N8X 1;  4X3T A;  1Q46 A;  2IL8 A;  3M4Q A;  3FP9 A;  1JJG A;  2MP1 A;  1PTO B;  4LF6 L;  1Q12 A;  1IZ6 A;  1EIY B;  4TQU S;  2KED A;  3GTM B;  5FLX c;  2UXD L;  4OO1 G;  4DR3 Q;  2JA7 B;  2CQO A;  4OXP A;  4K0K L;  4EQ5 A;  1XPU A;  4JC0 A;  3N6R A;  3K0Y A;  4GOP A;  4A3M B;  2VZA A;  2FXQ A;  2OQK A;  3M85 A;  1HR0 W;  4DA2 A;  2XVS A;  3K58 A;  5CBE E;  5M5W H;  1D2B A;  4PG3 A;  3U50 C;  4WJW A;  3CCE A;  1D7Q A;  3J81 L;  2R92 H;  4A3J H;  3IFT A;  4LF9 Q;  3CQZ H;  4A3L H;  1KXL A;  3CME A;  2RSN A;  4OWX B;  4FF3 A;  1X3Q A;  3D31 A;  5IE8 A;  2KOL A;  4GKJ L;  4DNR B;  4IUN A;  1E1T A;  2NZH A;  4K5X A;  4C3I G;  2EYP A;  4IFD J;  1UAP A;  1N9W A;  1LM0 A;  4A3G H;  4NPS A;  2NTT A;  2KVM A;  4KHV A;  1B53 A;  3NQT A;  1V8Q A;  1HA6 A;  1SDF A;  2WB1 B;  1MBY A;  4CKC A;  3J81 j;  4C2M B;  5EPJ A;  2XWB B;  1ONL A;  1I50 B;  4GOP C;  1BBU A;  3CKI B;  1WOC A;  3EN2 A;  4LAA A;  1ICW A;  2EIF A;  5C4Z A;  4GKK Q;  4A75 A;  1EY7 A;  3BVZ A;  2UUC L;  3X3N A;  1YJ9 A;  1F2Y A;  1SSO A;  1W6J A;  2MQH A;  5LHY 1;  4HJ5 A;  1PYB A;  2ALY B;  2RHQ B;  4K6L A;  4HAE A;  2ENB A;  1KQS A;  4LFB Q;  2DNC A;  3H0G B;  1B50 A;  4OO1 I;  3J80 L;  3SE0 A;  5M3M H;  1AP0 A;  2ZTE A;  1YIJ A;  1SJE D;  1VQK A;  2PMZ E;  1FNV A;  1JB7 A;  1GKH A;  4CKB A;  1SMX A;  4EGV A;  5DAU A;  1WYD A;  3CC7 A;  2H1E A;  2O2L D;  1S3O A;  1ESF A;  2F0L A;  4C1N I;  2NVX H;  2A68 D;  1FGU A;  3P20 A;  2A8V A;  4DV5 L;  1SYD A;  2JSO A;  2L9H A;  3SEB A;  4I7A A;  3C2P A;  3K6O A;  4QIW B;  5ELD A;  5FLX L;  1STE A;  1GOZ A;  1YVC A;  1IBM L;  4PNY A;  4X65 L;  5G3L F;  1TII D;  3I4N G;  1D5Z C;  1NAP A;  3NQI A;  5IYD G;  2MO1 A;  3BU2 A;  5CV9 A;  3PUZ A;  4IOC A;  1MSH A;  3R2T A;  2K32 A;  2UU9 Q;  5M3F H;  3U4V A;  4IQZ A;  3S2D B;  4X3S A;  3HFZ B;  1X56 A;  3HOZ H;  4IUP A;  1EY6 A;  2CWP A;  4HCE A;  2K52 A;  2G5D A;  4YY3 L;  3V96 A;  1HA5 A;  1SYE A;  4XDX A;  1LTI D;  1LTR D;  5C44 B;  1LTL A;  2FHT A;  3TDQ A;  3RMH A;  1WCM G;  5IWA L;  1A8V A;  2X6G A;  2NVT H;  4JV5 Q;  3DXJ C;  1LT3 D;  2Q8I B;  3S14 B;  4X3U A;  5EKI A;  2A1A A;  1ASY A;  3MZ5 A;  3BG3 A;  4IUQ A;  4LK1 C;  2UXB L;  1JJC B;  3KF8 A;  1KAA A;  4OON A;  2F1M A; 
#chains in the Genus database with same CATH homology
 3I72 A;  5I6Y A;  1U4R A;  3OIP A;  2EYH A;  1KNE A;  3P1H A;  1YNN C;  1I4H A;  2EJG C;  4A3E B;  3KLS X;  1WTW A;  2NB0 A;  1EL0 A;  1NCV A;  1U4P A;  4ZUJ A;  1HUM A;  1B2T A;  2X6L A;  3FPP A;  1PTO F;  1S5D D;  2F03 A;  2ICE C;  1Y69 U;  3L7Z C;  5AFW A;  1T5X D;  1LT6 D;  1PZI D;  1YNJ C;  1QCB D;  3K57 A;  3PO3 B;  2WII B;  2D5D A;  1WTR A;  4CJ2 C;  2Y0S B;  2EY2 A;  1IHZ A;  4XQJ A;  3K5L A;  1U9R A;  4KI0 A;  3BVM A;  4FYD A;  5E3F A;  5IT9 E;  3TME A;  3S2H B;  1JWM D;  2B2Y A;  3BYY B;  1BXT A;  2VUM B;  2NBF A;  4ZUI A;  2MJ8 A;  3LWE A;  2WKC A;  2EVB A;  1UUP A;  1EZ8 A;  1MI2 A;  2M00 A;  3KK7 A;  2QIL A;  3VYU A;  1H9S B;  5CGK A;  3FPU B;  5I9P A;  1FYC A;  1DZ1 A;  2Q8R E;  2DN8 A;  1SNO A;  3QB3 A;  4RGO S;  3MEH A;  3D6C A;  1E2Z A;  2VB3 X;  2JA5 B;  5FO8 B;  3VA7 A;  4TRD A;  3FMC A;  2SEB D;  1ILQ A;  2Q8T A;  5ISR A;  4FNF A;  1YNN D;  1PLF A;  4C56 C;  1TY0 A;  1G29 1;  1PXU A;  1SXT A;  1EWC A;  1Z7T A;  1DOL A;  2B2Y C;  1GUN A;  3SK6 A;  1VMP A;  1EY0 A;  3S16 B;  3MXG A;  5COR A;  3L9A X;  3NTI A;  3R2I A;  1STB A;  5JVH 3;  2K7V A;  1SJH D;  3PUX A;  1FNU A;  4RHS A;  2G9H D;  3F2U A;  3FRP B;  3GTL B;  2K1B A;  1PZJ D;  2RSO A;  5IOC A;  3G7L A;  1PYW D;  3SK4 A;  1CK1 A;  4FXG C;  1TU2 B;  4KK7 A;  3H3V C;  4F7X A;  1U4M A;  4G4K A;  1VDZ A;  2FIN B;  2BDN A;  3QOL A;  1NUC A;  5I9O A;  3GV3 A;  4CKE A;  4DF7 A;  2WV6 D;  5A2Q E;  2RDF A;  1IL8 A;  5M5Y B;  4IUR A;  3J81 E;  1H9K A;  2KHS A;  2AWO A;  3SR1 A;  2IX1 A;  2NVY B;  2JXM B;  1HUN A;  1TWF B;  1EU3 A;  4QCL A;  3QJY A;  4J1M A;  5J22 A;  2PW5 A;  2I46 A;  4FXK C;  1E0B A;  1STN A;  3U9S A;  2JE6 I;  1QJO A;  3SK5 A;  1HXY D;  1CHQ D;  3I4M B;  3WOE A;  3TN2 A;  1W6K A;  2CQA A;  2NYZ D;  4NP5 A;  4UAI A;  1WTO A;  5C4J B;  3NTK A;  1PRT B;  2Z8L A;  3DUZ A;  2F0N A;  2IT1 A;  1I6H B;  3TP6 A;  2K01 A;  4XT3 B;  1IW7 C;  2BCO A;  4ODG A;  2JP1 A;  1JR0 D;  4S3S A;  1JE4 A;  5C5L A;  4H13 C;  1GUT A;  2EZV A;  3TP8 A;  5FLX E;  1TWH B;  3LWU A;  4C3J B;  4XQQ A;  5NUC A;  5FOB B;  5BN3 A;  4DXF A;  1BUV T;  3I8Z A;  4I65 A;  1XX8 A;  2B8G A;  2WKD A;  2HCI A;  5JEA G;  4J6H A;  1M4V A;  1CT1 D;  2JA8 B;  5IT9 L;  2E74 C;  2PO4 A;  4Z9C B;  2H4O A;  1RTN A;  1STG A;  1I4G A;  1E2V A;  1EEF D;  1PDQ A;  3R8B A;  4F88 A;  2R6G A;  3GO5 A;  5DEH A;  4K8J A;  4YIJ A;  2ID0 A;  3GTQ B;  1ENA A;  1RHP A;  1HFG A;  3SHL A;  1PMR A;  5D3D A;  4IUV A;  1JIC A;  4A3F B;  4KN4 C;  4TSS A;  4RGT A;  1ILP A;  4FP5 D;  3NWS A;  1O78 A;  3TBI B;  3V2T A;  3CU7 A;  3GV6 A;  2ZXP A;  1QNK A;  4OO1 H;  5BN4 A;  2V4D A;  3RUZ A;  1TKW B;  3L3O C;  5CR3 A;  1DD2 A;  4K2L A;  3OWE B;  2Z4I A;  3N52 A;  2HUG A;  2HCC A;  1S4Z A;  5COY A;  2DNE A;  2L12 A;  1V1O A;  2PZT A;  5ELF A;  2L4N A;  4OIJ A;  5C3X A;  4R9W A;  1B3A A;  1IW7 D;  3HP3 A;  2KCC A;  3T13 A;  3PMF A;  1LAB A;  5DM7 3;  5TSS A;  3H94 A;  3E0J A;  3GTO B;  1CQV A;  1TWG B;  2E76 C;  2A68 C;  4WOR A;  4BBS B;  1I3Q B;  2AQ3 B;  5KNC A;  3KLS A;  1FNW A;  2VNU D;  2A73 B;  1GUW A;  1S5B D;  1KAB A;  5K5P A;  4M1U B;  4QUF A;  3VYR A;  5FO9 B;  3NWT A;  4XIG S;  1G6Z A;  1QE6 A;  2F0I A;  5FKA C;  1QNU A;  4M8A A;  1G91 A;  4RCN A;  5A2Q L;  3VR5 A;  3NE5 B;  1WTQ A;  5J1Z A;  3NBH A;  2CVR A;  4HR7 B;  2L1B A;  3OIQ A;  3DMU A;  2RDG A;  1PRT F;  1LT5 D;  2ZT9 C;  1BCP C;  5FO7 B;  1Q1B A;  5I6W A;  2OEO A;  2BDO A;  5E1F A;  4CHT B;  5IGE A;  3C1F A;  1TS5 A;  3KBX A;  3T51 B;  4HSP A;  4PMC A;  4R8I A;  4O1N A;  3DEP A;  1LLR D;  2LMC B;  2J4X A;  1LTS D;  2PZU A;  2RKS A;  3MC0 B;  5ELE A;  1BDO A;  4JK1 C;  1HHV A;  2C5C A;  4ULL A;  4PQX A;  5I2X A;  2K04 A;  2EPB A;  5M5W B;  4ZRZ A;  3I4L A;  1TVX A;  1ESR A;  2R92 B;  5D65 A;  4A3J B;  2QCP X;  2EYF A;  5CYU A;  3CQZ B;  1STA A;  1DJR D;  2IX3 A;  4CJ1 B;  2VB2 X;  4HTH A;  5KNB A;  2IJ0 A;  1KDB A;  5EPK A;  4A3G B;  3NSW A;  4QUC A;  5KIX A;  1EWH A;  2HDL A;  3SDZ A;  1MD2 D;  2YYZ A;  3HKZ B;  4XQN A;  1EZ6 A;  3IL8 A;  1HQR D;  3D8G A;  5T1G A;  1J9O A;  4IAL A;  2D62 A;  3OSO A;  3I3C A;  1OO9 B;  5KRU A;  1EYC A;  4EVO A;  1F9R A;  1BBX C;  1OXT A;  5M3M B;  1Q1E A;  3ND8 A;  1BNZ A;  4BS9 A;  1T5E A;  1XTC D;  1BCP D;  1F2L A;  1OXU A;  4CBV A;  3OPO A;  2B2W A;  4WRD A;  2HQE A;  2NVX B;  1GJX A;  2L5T A;  2K5Q A;  1RTO A;  4QF4 A;  3A55 A;  4ZK9 B;  2F0F A;  3Q22 A;  1A15 A;  1EQT A;  1F9S A;  4RH6 A;  1XXG A;  1BQQ T;  1O80 A;  3A56 A;  4J8Q A;  5KYL A;  1D1K A;  4CGY B;  5M3F B;  3J7A F;  4L63 B;  3URY A;  3HOZ B;  4P2C B;  1L0Y B;  4BA1 I;  5HUR A;  4BA2 I;  1CA6 A;  4OGQ C;  2TMP A;  2NN6 G;  2F0W A;  2ZXR A;  5K36 G;  5IOD A;  4LMQ D;  2B2W C;  2NVT B;  4KD3 A;  1HQM C;  1JQY D;  1GHJ A;  2PW7 A;  1O7L A;  3A7A B;  1SE3 A;  4UDU C;  2BA1 A;  5ELB A;  1D6E C;  1SYB A;  1VF5 C;  4A3I B;  3HOU B;  1MGS A;  3IAY A;  3QOJ A;  2LFN A;  4I7Z C;  1R9T B;  1AW7 A;  3BYT B;  3TSS A;  1SMY C;  1Y1W B;  3MVV A;  5CV5 A;  1LTT D;  2NZ1 D;  2KJX A;  3R93 A;  1SYC A;  2EY6 A;  3NTH A;  1Y8P B;  3NHH A;  2F0V A;  1WD0 A;  1OXS C;  3DWP A;  4RWS C;  2F0D A;  2CW0 C;  2EXZ A;  3A8K E;  3V05 A;  4C1N K;  3VR4 A;  1J8I A;  4KV6 A;  4HMJ A;  2X69 A;  3HS0 C;  1C48 A;  3WOF A;  1ET9 A;  1OXX K;  5D14 A;  1PFB A;  5KGU A;  5LL6 X;  4H7B A;  2A6H C;  3KLR A;  2AUJ D;  5IGC A;  1EEI D;  5C0X G;  1HTP A;  3SK8 A;  2NN6 I;  4KY6 A;  2GA4 B;  1B4O A;  1RJT A;  2XNA C;  1G2S A;  5T1I A;  4XYQ A;  4LJZ C;  3PO2 B;  1HFN A;  2WP8 J;  2KCN A;  3C3L A;  4TKO B;  1SEB D;  1GHK A;  3MXP A;  1ZYR D;  2MGS A;  3Q0A A;  1CQF A;  3DWA A;  5HGT A;  3D4W A;  1D5M C;  5FK9 C;  2XRS D;  2XIW A;  1LV9 A;  3S1N B;  2IWH A;  4G57 A;  1XWE A;  1GUO A;  4NMZ A;  1TT2 A;  3EVQ A;  4IUT A;  2M9V A;  1IKM A;  1AZQ A;  3M4Y A;  2PPB C;  3JAM L;  4HN7 A;  1WTP A;  1S5E D;  2PYK A;  2A5H A;  1SMY D;  3E5S A;  3G6J B;  1IYU A;  5C0X I;  1CM9 A;  2B2T A;  3O13 A;  1Y1V B;  4G7Z C;  1KLG D;  2DY8 A;  4V19 0;  5F2D A;  1F2Z A;  3BDL A;  1I4R A;  1AZP A;  2PMZ B;  1KDC A;  1LTA D;  4ILW A;  2CW0 D;  2K33 A;  4EQO A;  3ERO A;  1K83 B;  3T16 A;  4DFA A;  1X32 A;  1DOK A;  3LNN A;  4FXD A;  3MWY W;  2A6H D;  1A6X A;  2F0K A;  1NSN S;  3MFY A;  1I4P A;  3X3M A;  5JEA H;  1ENC A;  3OW7 A;  2NUC A;  1G8Z D;  2HDM A;  5D3I B;  1WTX A;  2EJF C;  4EQN A;  1L0X B;  1SAP A;  2WIN B;  3GTP B;  2TSS A;  4DK1 A;  4OIK A;  4HMI A;  2DY7 A;  5EQ0 A;  4FF4 A;  2QKI C;  2F0P A;  3QIA A;  2B2T C;  1STH A;  5EPL A;  2IW3 A;  5JPN C;  2RBM A;  3VR3 A;  1H9M A;  2SNS A;  1EYA A;  2E2I B;  1B1Z A;  2LS0 1;  1WTV A;  3IFD A;  3FKI B;  1KTK A;  2E2D C;  2FJ2 A;  2K05 A;  3NP8 A;  2C9O A;  4DNT B;  4C3J G;  5JAV A;  3IKJ A;  2F0T A;  2OT2 A;  3AU7 A;  3EFX D;  3H91 A;  3TZD A;  2K6A A;  3VYS A;  3K5N A;  3PUV A;  2EE1 A;  4DAY A;  4IFD G;  1SYG A;  5KYI A;  4A3B B;  3EA6 A;  3D4R A;  4XXE A;  1QWY A;  3MTS A;  1D5X C;  4IZ8 A;  1UNS A;  3LX0 A;  3RD4 A;  2R3Z A;  1OXV A;  3EQL C;  5EBC A;  3VYT A;  3OWF A;  1CI3 M;  2EJM A;  4HSV A;  4C3H B;  3M4O B;  4KKU A;  2PCF B;  1A3U A;  1A3V A;  3I73 A;  2AWN A;  2F0Q A;  4HCS A;  3OMC A;  4A3D B;  4JBW A;  3EJI A;  1F2M A;  1V1P A;  1FR3 A;  1F9P A;  4QB4 A;  2YU9 B;  2L55 A;  4RA8 A;  1TS3 A;  4DXG A;  1PZK D;  1EIG A;  2AUK A;  1PTO H;  4FF1 A;  4KN7 C;  3BDC A;  5KEE A;  4AYB B;  3DEO A;  2RDH A;  4B9W A;  1K8M A;  2F4I A;  1X3P A;  2NVQ B;  2PZW A;  3RZO B;  2F0H A;  1O7Z A;  2MHV A;  3P7J A;  4KMU C;  1CZW A;  1ZKO A;  4XTC S;  4A3K B;  1D1I A;  1BOS A;  4V0B A;  4PMB A;  4H0L C;  1HCZ A;  1WVL A;  2O5I C;  3VR2 A;  5I2Y A;  2FFK B;  1SNC A;  5JJZ A;  4IFD I;  1SNP A;  2XWJ B;  5CMD A;  2F0O A;  2AQ2 B;  1BO0 A;  1ZXT A;  4F87 A;  3MXU A;  3D3R A;  5LL6 S;  5M9O A;  2K28 A;  1V43 A;  4O42 A;  4N9T A;  3I90 A;  2FMM A;  3UI2 A;  5EBD A;  3QG1 A;  1BCP B;  1FGB D;  4PMW A;  4K14 A;  3PIO 3;  3K59 A;  4Q5V A;  3OMG A;  3RZD B;  4KY7 A;  3PIP 3;  1XYI A;  1QIL A;  2EYJ A;  1EQV A;  3M3Y B;  3WDN A;  2IPK D;  4RFB A;  3I91 A;  4ID6 A;  2LY7 A;  3NUC A;  1Q90 A;  1QOH A;  5CV6 A;  1PTO C;  5C4H A;  4K5W A;  2F0J A;  1CHP D;  4DAV A;  2O5J C;  2F3W A;  1BF4 A;  1TWA B;  1SNM A;  5JEA J;  4RGN A;  4C3I B;  1IYV A;  2PQE A;  2XSC A;  2KEE A;  4RCO A;  1TY2 A;  4EQP A;  1JB3 A;  3T4A C;  4HED A;  1LT4 D;  3K5O A;  3M7N A;  2E75 C;  5CV7 A;  2F0S A;  2QDB A;  3J7Y W;  2QF7 A;  5G3L D;  2MUY A;  1DXM A;  3A8J E;  1Q3L A;  3QO2 A;  3SVM A;  4KD4 A;  1A2T A;  1QG7 A;  4N9P A;  1GXD C;  4IN3 A;  1O7Y A;  4Q0F A;  5A35 A;  3MA2 B;  3BVG A;  4FVM A;  2EOT A;  1DYQ A;  3HZX A;  3T53 B;  4MHE A;  5DNF A;  3JAM E;  2A69 C;  3GTJ B;  3PUY A;  1II3 A;  4OHJ A;  3GTK B;  3OHX C;  3PUW A;  1IKL A;  3I4N B;  1Z6H A;  2ZXO A;  1VF7 A;  1SNQ A;  5IGF A;  1AFP A;  4RKB A;  4ZKB B;  2F0U A;  2EY5 A;  3HG9 A;  2I07 B;  2OF1 A;  2G9D A;  5C6A A;  1SND A;  5CBA E;  2K5W A;  2K03 A;  2MPM A;  4KHZ A;  1ENF A;  3OOC A;  2KA7 A;  1H9R A;  1Q8I A;  1RDP D;  2NN6 H;  3A8I E;  5K36 H;  5CV8 A;  1PTO D;  1WCM B;  1TQO A;  2D9U A;  1SE4 A;  1AEX A;  1RCV D;  2XRQ D;  2JEA I;  4BWG B;  1U4L A;  3HOX B;  4E6I A;  2XN9 C;  5KND A;  3S9W A;  4H44 C;  1EY8 A;  2BE5 C;  4MIU A;  2E2H B;  1DM0 B;  4F8M A;  5EJW A;  3GD7 A;  2EYL A;  1UEA B;  3H09 A;  3S15 B;  1ZYR C;  3Q6S A;  4IUU A;  2EDG A;  1RD9 D;  2WAC A;  3KUP A;  1EFI D;  2O4X A;  1BCP F;  1NR4 A;  3ERQ A;  4CJ0 B;  1EY5 A;  5C0X H;  1EIH A;  3D4D A;  1ML0 D;  1R4Q B;  2A69 D;  3AMU A;  2RA4 A;  4ABN A;  1EU4 A;  4ZLT F;  4G7O C;  1I6V C;  1RKN A;  1C4Q A;  1EY4 A;  4KKT A;  4U68 A;  2JA6 B;  2B8F A;  3QWN A;  2CHB D;  4ZAI A;  2EYM A;  3HOW B;  1H9S A;  2F3V A;  2R61 A;  2OXP A;  5JOB A;  1MSG A;  2K5D A;  3E6Z X;  3ITP A;  1S5F D;  4NDX A;  5C5M A;  2F0E A;  4RAU C;  3BZD B;  4BBR B;  3DM1 A;  1G2T A;  1TS2 A;  5BN5 A;  3S17 B;  1LTB D;  4BY1 B;  3TZU A;  2WAQ B;  4K8I A;  3T56 B;  2FMC A;  2SDF A;  3S1R B;  1BR9 A;  1DOM A;  2B2U A;  3C1E A;  1ET6 A;  1KDA A;  3J7A V;  3D6W A;  2NTS A;  2BE5 D;  3MFG A;  3W2D A;  2KUM A;  3S1M B;  3CRK C;  3NPP A;  3R3O A;  2E2J B;  2EY1 A;  3BS1 A;  1VCI A;  1SE2 A;  3KBG A;  3U9O A;  1ZEQ X;  5CV4 A;  2PNR C;  5C3W A;  1JC7 A;  3RLF A;  4L6T B;  5IGG A;  1LAC A;  4A93 B;  1CZG A;  4NW2 A;  2VXW A;  3W3A A;  1YNJ D;  4GZY C;  3GQB A;  2M2L A;  4KY5 A;  3P75 A;  5C3E B;  1S5C D;  2J0T D;  1I4X A;  3I70 A;  2B2U C;  5JPM C;  3BDO A;  4RHR A;  3Q24 A;  3TP5 A;  1KNA A;  3CHB D;  2F0M A;  3PV0 A;  2RQX A;  2JYO A;  3AB9 A;  5IGB A;  4QMG A;  3C46 A;  4XYO A;  2A6E C;  4K2K A;  2LKV A;  3A54 A;  5CC4 A;  2NWG A;  1R4P B;  2SOB A;  1A3T A;  4U67 3;  5E4X A;  3CRL C;  4WFN 3;  4R8N A;  1H9J A;  3K5M A;  2AQ1 B;  1SYF A;  2BOS A;  2R7Z B;  3TP7 A;  3K7A B;  1ROD A;  1HRJ A;  1CA5 A;  2KEC A;  5IGD A;  1F77 A;  3ZYY X;  1A2U A;  1EY9 A;  4IFD H;  1JWS D;  3FVQ A;  4KJO A;  1JOR A;  1DON A;  1KLU D;  3S1Q B;  2J7Z A;  3HOV B;  4L8J A;  3MXN A;  2L11 A;  5E4W C;  3J80 E;  1M8A A;  3ONA B;  1PFM A;  1CFM A;  1RF2 D;  3M7G A;  3GTG B;  3NXW A;  4ME5 A;  1E2W A;  4DU9 A;  3VA5 A;  5C0X J;  1I4Q A;  3HGB A;  3H6M A;  1Z47 A;  1JOQ A;  5J39 A;  2RVL A;  3DWQ A;  5EKL A;  5DM6 3;  1PRT C;  1SFO B;  4X3K A;  2A6E D;  3NK9 A;  1K8O A;  4G7H C;  3NBI A;  1JCK B;  4XT1 B;  2Z4H A;  3FDT A;  1B9M A;  3A7L A;  4RKL A;  1CTM A;  4BY7 B;  2N88 A;  1FD7 D;  3GP7 A;  4KTA A;  1HPC A;  1TR5 A;  4NKL A;  1VMC A;  2B2V A;  1Y8O B;  1HTL D;  1WD1 A;  2EYO A;  4OL7 A;  2R93 B;  1Y8N B;  2SNM A;  2A74 C;  2QEJ C;  3MHB A;  2KQ3 A;  4DK0 A;  1EOT A;  2JEB I;  4DGZ A;  4ZKC B;  2B63 B;  2F0G A;  4C3H G;  2D2C C;  1GUG A;  3VR6 A;  3SXH A;  4DN4 M;  1TWC B;  1C8C A;  3DHQ A;  1DCZ A;  1JOO A;  1TS4 A;  4ZQ3 A;  3HOY B;  1SBB B;  4DAP A;  1PFN A;  2B39 A;  3HRZ C;  1JOK A;  4MN3 A;  1V1P B;  3HEJ A;  4KJN A;  2ICI A;  4K5V A;  4Y7N B;  4B9X A;  4RGM A;  4K6D A;  4ZYS A;  2B2V C;  5C4X B;  5EKK A;  3FEW X;  1B44 D;  1GUS A;  1LTG D;  1LO5 D;  2L0C A;  1NR2 A;  5EGT A;  5M5X B;  3MAQ A;  1QB5 D;  5I4D A;  3ND9 A;  1JWU D;  5IIF A;  1F9Q A;  4B08 A;  1B9N A;  5JVG 3;  4KKS A;  5ELC A;  1EYD A;  4PV1 C;  3Q23 A;  4FO2 A;  2IX0 A;  1STY A;  2Z1C A;  4FF2 A;  2BA0 A;  1PRT D;  2N55 A;  1AN8 A;  4X3T A;  2IL8 A;  2MP1 A;  1PTO B;  1Q12 A;  4TQU S;  2KED A;  3GTM B;  4OO1 G;  2JA7 B;  3N6R A;  3K0Y A;  4A3M B;  3M85 A;  4DA2 A;  2XVS A;  3K58 A;  5CBE E;  1D2B A;  4WJW A;  3J81 L;  3IFT A;  2RSN A;  4FF3 A;  1X3Q A;  3D31 A;  2KOL A;  4DNR B;  4IUN A;  4K5X A;  4C3I G;  2EYP A;  4IFD J;  1UAP A;  2NTT A;  2KVM A;  4KHV A;  1B53 A;  3NQT A;  1V8Q A;  1HA6 A;  1SDF A;  2WB1 B;  1MBY A;  4CKC A;  4C2M B;  5EPJ A;  2XWB B;  1ONL A;  1I50 B;  3CKI B;  4LAA A;  5C4Z A;  1ICW A;  1EY7 A;  3BVZ A;  3X3N A;  1F2Y A;  1SSO A;  1W6J A;  5LHY 1;  4K6L A;  4HAE A;  2ENB A;  2DNC A;  3H0G B;  1B50 A;  4OO1 I;  3J80 L;  3SE0 A;  1AP0 A;  1SJE D;  1FNV A;  4CKB A;  4EGV A;  5DAU A;  2H1E A;  2O2L D;  1ESF A;  2F0L A;  4C1N I;  2A68 D;  3P20 A;  1SYD A;  2JSO A;  2L9H A;  3SEB A;  3C2P A;  3K6O A;  4QIW B;  5ELD A;  5FLX L;  1STE A;  1GOZ A;  4PNY A;  5G3L F;  1TII D;  1D5Z C;  1NAP A;  3NQI A;  5CV9 A;  3PUZ A;  1MSH A;  3R2T A;  2K32 A;  4IQZ A;  3S2D B;  4X3S A;  4IUP A;  1EY6 A;  4HCE A;  3V96 A;  1HA5 A;  1SYE A;  4XDX A;  1LTI D;  1LTR D;  5C44 B;  2FHT A;  3TDQ A;  3RMH A;  2X6G A;  3DXJ C;  1LT3 D;  2Q8I B;  3S14 B;  4X3U A;  5EKI A;  3MZ5 A;  3BG3 A;  4IUQ A;  4LK1 C;  3KF8 A;  1KAA A;  2F1M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...