1K8MA

Solution structure of the lipoic acid-bearing domain of the e2 component of human, mitochondrial branched-chain alpha-ketoacid dehydrogenase
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
87
structure length
87
Chain Sequence
MGQVVQFKLSDIGEGIREVTVKEWYVKEGDTVSQFDSICEVQSDKASVTITSRYDGVIKKLYYNLDDIAYVGKPLVDIETEALKDLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords E2 component of Branched-Chain alpha-Ketoacid Dehydrogenase
publication title Solution structure and dynamics of the lipoic acid-bearing domain of human mitochondrial branched-chain alpha-keto acid dehydrogenase complex
pubmed doi rcsb
source organism Homo sapiens
total genus 4
structure length 87
sequence length 87
ec nomenclature ec 2.3.1.168: Dihydrolipoyllysine-residue (2-methylpropanoyl)transferase.
pdb deposition date 2001-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00364 Biotin_lipoyl Biotin-requiring enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1k8mA00
1VDZA 4DK0A 2NN6I 1IW7D 1G291 4L8JA 2AUJD 4PV1C 1V8QA 3BG3A 2AWOA 1CFMA 1Q12A 3DXJC 4BA2I 3VR6A 2ZT9C 1ONLA 4KN7C 2K7VA 1O7LA 4KMUC 3IFTA 1K8OA 4G7ZC 1OXVA 2A69D 1H9MA 1ZKOA 4XIGS 2EJFC 2BE5D 1IW7C 3CRKC 3LWUA 4TKOB 3GD7A 3SDZA 3VA7A 2PPBC 3PUXA 2JEBI 3HGBA 2JEAI 1GHKA 1H9RA 1GUNA 3OPOA 1HPCA 2CW0C 4G7HC 2A69C 5JEAG 1OXUA 2L5TA 1IYVA 4XTCS 3MXUA 3A8KE 2BE5C 1YNJC 2D5DA 1ZYRC 1E2VA 2PNRC 3EQLC 1HTPA 3IKJA 1K8MA 2LMCB 1H9SB 2E74C 3ND8A 2D2CC 1DCZA 1DD2A 1Q1BA 1T5EA 2BA0A 1OXSC 4RCNA 3T56B 3WDNA 5BN4A 1GJXA 2E75C 2O5JC 1GUGA 1Z6HA 3D31A 3FPPA 4BA1I 1Y8NB 4TQUS 1CTMA 1H9JA 1I6VC 3AB9A 2K32A 2A68D 2A6HD 5C0XH 1A6XA 1OXTA 1B9MA 1H9KA 2B8FA 3ND9A 3PUWA 3PUVA 5K36H 4LJZC 5BN3A 5BN5A 5A35A 2E76C 5C0XG 4KN4C 3CRLC 3FMCA 2K33A 3QG1A 2DN8A 3VR5A 1HCZA 3H94A 2A68C 2A6HC 3M4YA 4IQZA 5KNCA 1Y8PB 2PCFB 3P20A 1EWHA 3W3AA 1Q90A 3U9SA 1HQMC 1FR3A 5KNDA 4OO1G 1VF5C 4OGQC 3T53B 3PUYA 4KKUA 4DNRB 3L7ZC 2BDOA 3A7LA 3GQBA 2F1MA 3OOCA 2EDGA 1O78A 2EJMA 1TU2B 3OW7A 4H44C 4JBWA 3PUZA 1B9NA 1BDOA 3PV0A 4KI0A 4IFDH 1DXMA 3TZUA 4JK1C 3VR2A 1H9SA 2NN6H 1SMYC 1VF7A 3QJYA 3SE0A 2V4DA 3VR3A 3LNNA 3VR4A 1Y69U 3M7NA 1E2ZA 1GUSA 2IT1A 2JXMB 2QF7A 2DNCA 3BDOA 4H0LC 1GUTA 4IFDG 2NN6G 1GUOA 4KHZA 1V43A 5K36G 1LABA 2B8GA 2DNEA 4HR7B 2JE6I 4I7ZC 2Q8IB 2YYZA 3RLFA 3I4LA 2KA7A 1QJOA 2D62A 1FYCA 3M85A 2AUKA 3QIAA 1YNNC 3NE5B 4LK1C 1CI3M 1GHJA 2BA1A 3MFYA 4KKSA 3A7AB 5JEAH 3KLRA 3A8IE 1E2WA 1Q1EA 2EJGC 4DK1A 4DNTB 2O5IC 1VCIA 2A6ED 3A8JE 1Z7TA 3D4RA 2R6GA 4GZYC 4KKTA 4OO1H 1LACA 3N6RA 2KCCA 4H13C 3T51B 5KNBA 1OXXK 3I73A 1IYUA 1Y8OB 3I72A 2EVBA 4G7OC 2A6EC 1TKWB 1PMRA
chains in the Genus database with same CATH superfamily
1VDZA 3K5NA 2IL8A 1F2YA 1XMQQ 3S2DH 1SJHD 2TMPA 3GTGB 4LF5Q 4A3FG 1CFMA 1KLUD 4UY8C 1ONLA 2UUBL 4DV3L 1VQEA 1SDFA 4R4IA 4DR2L 3H15A 4DR5L 4A3LG 2EJFC 2F0DA 5C5LA 4DV4L 4DV7L 3HGBA 1TQOA 5JJLA 1HPCA 2ZTDA 1B3AA 3L0OA 4ME5A 3MXUA 1BR9A 1WCMG 4ZQ3A 3L2PA 3PMFA 4C3JG 2LMCB 4B3SL 2EXZA 2ZM6L 1DCZA 3J80L 2RDGA 2XRQD 2UUAQ 4X62L 2NVXB 4UP7A 3E0EA 1BCPC 3C3LA 1VQNA 1IBKQ 4WJWA 3RNUA 3HOYG 5EPKA 5D3IB 4K2KA 1A6XA 1I6HB 1XPOA 4X64Q 3RLNA 4O1NA 3EJIA 2F0WA 5G3LF 3QG1A 3D3RA 3VR5A 2WKDA 1JB3A 3WOEA 4Z9CB 4IQZA 5KNCA 4M1UB 1NCVA 1Y8PB 1EY5A 3SEBA 2GVAA 2G5DA 5C4HA 1LV9A 5IGFA 4JI6Q 5GADC 4JBMA 3A56A 1TWHH 1U4PA 1QNKA 1Q8IA 2A73B 1E1OA 2F0QA 1UUPA 1VQPA 3IRBA 1QVFA 5D3DA 2HDMA 5EKKA 1TS2A 2NN6H 1QB5D 1PLFA 1VF7A 2H1EA 5IYBG 4H02A 1LTAD 4PMCA 4E6IA 1NMFA 3VR3A 1XMOQ 3J7A5 4P75A 3A5UA 5IGBA 3M7NA 1MSGA 1GUSA 3M4PA 4DF7A 3LGJA 4CDEC 4RWSC 2Y0SB 2F0VA 4WRDA 2KBNA 4P74A 4NXNL 1PH7A 4OELB 4RGMA 2BCOA 1WTPA 5GAEC 3DHQA 2B2VA 4R8IA 1K8AC 4KKSA 4DKAC 4A3KH 3S1QB 3OTOQ 5G3LD 4JI4Q 2WV6D 4K0KL 3NPPA 1J5EL 2JA5B 3PCOB 4DV2Q 3N6RA 3NBHA 4DGZA 2F0EA 2VUMB 4A3IG 4WJ4A 3EA6A 3I4OA 5H1SE 4BXXH 2EVBA 5IY0A 2AUJD 5DM63 4YY3Q 3BG3A 3I2ZA 1XPRA 1I94Q 1KTKA 4KMUC 3J80i 1H9MA 1B8AA 4F88A 3VA7A 1RTOA 4ZAIA 2IX0A 4NP5A 1PRTF 2EXDA 4JPBW 5C3EH 1A3TA 2EYOA 3I70A 3NUCA 1V1PB 3SVMA 1E2VA 4LNQA 2N88A 4IOAA 3W1BA 1J8IA 3ND8A 1HA5A 2SNMA 3RN2A 1CSQA 3J80E 2E75C 2B39A 4BXXG 4NKLA 3OMGA 4RH6A 1H9JA 3AB9A 3HKSA 5KRUA 2FMCA 3GTJB 5IGCA 4NDXA 4JV5Q 5K36H 2B63B 2IWHA 2PZUA 4HSPA 3S16H 3ERSX 4JI5L 2JA6B 2QEJC 2UU9L 4A3JH 3T4AC 3S17H 3AEVA 1MBYA 1KHIA 3T53B 4EVOA 2Z4HA 1E1TA 1PRTD 2JK8A 2L0CA 1IBLQ 2DJFC 5A2QL 2MGSA 3JAMi 2VW9A 1EWIA 3BS1A 4IFDH 3H6MA 2AQ1B 5I9OA 1STEA 3U4ZA 1GO3E 1HZAA 2MQHA 3EROA 3KJPA 5K36G 2KQ3A 3KLSA 5J39A 1X3EA 4GOPC 2ZXRA 3ICEA 3JAME 4A3JG 4FDBA 5C44B 4YCUA 1WTHA 2BH8A 3S1NH 2LFNA 1EYCA 2B2YA 1CA6A 4IJHA 4BBSB 3E3XA 1NY4A 4BY1H 4JI2L 4NMZA 4A3GH 1X56A 2PNHA 3CQZB 3VR6A 2KJXA 1HR0L 4DUZL 3AFPA 4ILWA 4R8NA 5EKIA 2FXQA 2NUCA 3M4OH 5K5PA 3KYHC 4J8QA 4A3BG 1VQLA 1GKHA 1KD1C 2PYKA 3SK5A 3T1HQ 2R92H 5D14A 2Z6KC 3GTOB 1M4VA 1B7YB 4LAAA 1ZYRC 3H3VH 2WAQE 2B2UC 1EY6A 4CJ0B 2OF1A 1MI2A 3TQYA 2K5VA 1VQOA 4CKCA 3HOWB 1DD2A 1Q1BA 4L5RC 1LTLA 4OO1I 1EU4A 3M7GA 3HOZB 1EIFA 2RHSB 4DV1Q 1I3QH 4FF1A 3Q8DA 5FO8B 4HJ7A 2A6HD 5C0XH 2EE1A 2RA4A 4ABNA 3NTHA 1VQDA 5JPNC 2CQAA 2E5LL 2F0KA 1LTGD 3M4YA 5IWAQ 4JYAL 4C3IB 2R92G 3G48A 1PTOH 4JOIA 3SK6A 2DUDA 1VF5C 2R7FA 3NSWA 1VQ7A 4LMQD 5EQ0A 3A7LA 4A3EB 2C9OA 1K0RA 2EDGA 1JORA 1TU2B 1V1PA 4K2LA 2AQ2B 5M3FH 5KGUA 1EOVA 1QG7A 1BBUA 4CDDC 3E0JA 2XN9C 4UHVA 5C3WA 2R7ZG 4JOIC 4NW2A 1M90C 3I4LA 4LF9Q 2IX3A 3S1RH 2F0NA 2HCCA 2L11A 1G2TA 2NVYH 4M8AA 3H3VC 1GHJA 1XPUA 1HZ9A 3K7AB 1FJGL 5EAYA 4DR1L 1K8GA 4ZUJA 1ZYRD 1LTSD 3R8BA 2YU9H 1D8LA 4OL7A 2EY5A 5I4DA 3CU7A 5JOBA 2WAQG 5FLXE 3CCSA 1JJ2A 1SN8A 2ALYB 3D8GA 5KNBA 2F0FA 1OXXK 2KCNA 5I2YA 4L5TA 1MKHA 3ERQA 5M3FG 4OX9L 4R4CA 2XNAC 4OO1G 4JVZA 2JN4A 1YJWA 2K5DA 4P2CB 4DK0A 4LFBQ 2EYJA 1DZ1A 3U58A 4HIKA 3M9BA 4ZKCB 2HQEA 3CD6A 2ZT9C 1HNZQ 2F0MA 2XGTA 3NELA 3MA2B 4HJ9A 2K4KA 4MN3A 3FPUB 4LF8Q 4GLXA 2PPBC 4YWLA 3U9OA 2F3IA 1PTOC 2Q2IA 1HNWL 3GTKH 5HGTA 1PFMA 2RBMA 1TWCH 4K5XA 5HURA 3HOUH 1VQ4A 2I46A 2R3ZA 2RCNA 2Z0SA 3ZJYC 4DV3Q 1KDCA 1PZKD 4PQXA 3NP8A 1T5EA 5IGGA 5BN4A 4DR5Q 3HRZC 4PMWA 1D2BA 1KXLA 4DV7Q 2D0PA 5M5WB 1Y8NB 2UXBQ 2PO4A 2HDLA 4TQUS 3KFUA 2Q2TA 3GTQB 1I6VC 1X3QA 1PFSA 1MGSA 2RKSA 1BVSA 5KYIA 2ZXPA 2B8FA 4RMFA 5D65A 3PUVA 4BBRH 5BN3A 5FJ8G 4FO2A 4AH6A 4F8MA 1F9RA 4LFCL 1JICA 5KIXA 2MUYA 2A68C 1HNXL 2E8GA 2RSNA 2MO0A 1LM0A 2IHFA 5IYCH 4HIMA 3CXCA 1D5ZC 1PH4A 1DOKA 2OQ0A 1BBWA 3D4DA 1CKNB 3K81C 3HOUG 2R93G 4LFAL 1DJRD 3L7ZC 3BVGA 4QIWE 1G6PA 1O78A 1P8LA 1X32A 5BR8L 2PW7A 1EIHA 2WINB 1Y1WG 1D1IA 1NSNS 4KJOA 3NWTA 1EYGA 1Y1VH 1ICFB 2PI2E 2K1BA 4HSVA 5C4JH 1IBML 2V4DA 4JI8L 3KOJA 2KHSA 4JI3L 4ZLTF 1Y69U 1VQMA 5CGKA 2YTVA 1NE3A 4JI1L 2MFIA 4KHZA 4A93B 4AQYL 3HKZE 1GVPA 3RLFA 4C3HG 1V1OA 2KA7A 2FINB 1U4RA 5AJ3L 1FYCA 3KLSX 1YIJA 3CPFA 2QDLA 2CH4W 4DUYQ 2XSCA 2XTIA 4J1MA 1DOLA 1KNAA 4QMGA 1V1QA 2A74C 4F7XA 3I4NH 1JR0D 3R93A 2RCFA 4IUPA 4J15A 3TEHB 2VQEL 3R3OA 2C5CA 3K0YA 2PMZE 1Y1VG 4JCVE 4WFN3 3I90A 4ALPA 4A3FB 4G7OC 3VYUA 4LF7L 2NBFA 4KN7C 5C4XH 4K0KQ 4N8X1 3FKIB 3X3NA 3V05A 1UNSA 1TWFH 4TKOB 3E6ZX 2Z9HA 4H7BA 2GN5A 1XNRL 1TY2A 2AMCB 2L9HA 3J7AV 2CW0C 3GTMB 2E2IB 2UXCL 2RHQB 2E2HH 4DK6C 1SNCA 1K8MA 1PV4A 5CV8A 3I55A 1PZID 2BA0A 2EYPA 1YI2A 3CAMA 2NTTA 3S2DB 1Z47A 1SFOH 4CHTB 3FPPA 1D5MC 2K32A 4FXGC 3HOXH 4IZ8A 1KDBA 3PO3H 1HUMA 3OWFA 1HH2P 2KECA 1K3RA 2VB2X 5EBDA 2DN8A 4EQNA 1C9OA 1B2TA 1B1ZA 3U9SA 1RL2A 3GO5A 4B9WA 4DXGA 4DR3L 2M2LA 5E4WC 4XDXA 4C2MB 3OOCA 1I4XA 2F1MA 3S2HH 3EVQA 5FOBB 3WOFA 3K57A 3OW7A 4R4OA 3B6YA 1PRTB 2VY3A 3PV0A 3QO2A 4GKJL 4R9WA 4R4QA 4LUOA 1TS5A 4EGVA 2EOTA 2F0GA 4KY6A 2UU9Q 2JXMB 2CH4A 4MHEA 1MIUA 3PO3G 1N34Q 1F2MA 1C0AA 2A8VA 4A3DB 2FFKB 1NNXA 4OHJA 1A2UA 4DR4Q 4AYBB 1QJOA 2D62A 1TWHB 4JI7L 3WWVA 4L5SA 4RHSA 5JEAH 2KHIA 3PIO3 1I4GA 5IYDH 3NTKA 3R2IA 4IPCA 1KNEA 3IAYA 2GVBA 1RJTA 3F1ZA 1CHQD 1LT6D 3J7AF 4ZK9B 1CKNA 4JI0L 3TS2A 1PH5A 1HJPA 1B53A 4LF6Q 2EYMA 4KD3A 2F0PA 5KEEA 2OTLA 1V8QA 1STBA 2AWOA 2JP1A 1R4QB 2CWPA 1IKMA 1A2TA 3Q6SA 3M3YH 1WTRA 4K6DA 1FGBD 2I07B 1XXGA 2MO1A 1RIPA 2UUCQ 4A3KB 1WCMH 4C3JH 2A69C 5JEAG 1G91A 4HIOA 1ZEQX 3STBC 1I5FA 5IYDG 4BY7G 3EQLC 1FL0A 1N36L 1SNDA 1STGA 2D2CC 2F0JA 3BYTB 3L3OC 5E3FA 4IOCA 4I65A 1WD1A 3HOYH 1JT8A 2F4IA 3URYA 3MZ5A 5DAUA 2FHTA 2AQ3B 4A4IA 2KEDA 2K05A 5LMUQ 3RUZA 3RZOB 1AH9A 4EX5A 5C3EB 5M5YH 3MEFA 2G9HD 1N33Q 4Q5VA 1STNA 3S1MH 1OO9B 1S5CD 1GD7A 3KF6B 1AFPA 4X65Q 3PQIA 1B70B 2VS1A 3I8ZA 3SXHA 5ELCA 3PUYA 5IYBH 4HJ8A 3K5OA 3BJUA 1EU3A 1HZCA 3VR2A 1SMYC 2HIXA 5I6YA 1BOSA 3LNNA 3IL8A 1E2ZA 2B2TC 1L2FA 2OEOA 2DNCA 2K28A 1LO5D 1GUOA 3S16B 3W2DA 2PQEA 5M3MH 2ZXOA 2TSSA 2Z4IA 1BCPF 2WIIB 2QW7A 3S17B 1EEFD 3NE5B 4RHRA 4YHHL 1VQIA 1WTOA 1B44D 2N78A 3A8IE 3ITPA 1LUZA 3PGZA 4AIMA 4N8FA 1SYFA 4DV6L 3T13A 4A3IH 1UE5A 4XQQA 4JC0A 1A62A 5J22A 1JWUD 4PNYA 1STAA 4IALA 1KRSA 5E7NA 2HHHL 2A6EC 4KI0A 2CFMA 3DWPA 4FXKC 1HZBA 1B4OA 4MTKA 4YWMA 1FJGQ 2DJGC 3H0GG 3ULJA 1O7LA 2L55A 3OWEB 5M3MG 5ELEA 4RKLA 2O4XA 4LWCA 3V96A 4DR6Q 3FDTA 4YCWA 4DR7L 2K03A 1S5FD 4X3SA 1U5KA 4OX9Q 4GLAC 3UDIA 1A63A 2BE5C 2X6GA 1BCPD 4GLVB 1VQAA 3D6CA 4L5QA 4NXML 3I7FA 2E74C 3CCMA 2HUGA 1UEAB 2KCMA 4BY1B 3DMUA 1NAPA 1SMYD 1QOHA 4A3GB 2F0HA 1U0LA 2UXDQ 4A3MG 3W5OA 4F87A 4CKEA 4HEDA 2EZVA 4RKBA 1OXTA 2F03A 1AW7A 2K50A 2JA7H 1VQKA 4GKKL 2A5HA 1SRUA 1WTWA 1IZ6A 2K33A 4FYDA 5CV4A 2VQFL 4IUNA 2Q8TA 2QDBA 2B29A 2CVRA 4RCOA 4IJLA 1VQJA 1F9SA 3D6WA 2YV5A 1MHWC 2EYHA 2N8NA 4GN3B 1WYDA 5GQOA 3CCJA 3DWQA 1I3QB 5FK9C 3PO2G 3K59A 1HNXQ 3F2DA 1K83H 3RLOA 5JAVA 1VQ8A 1PXUA 3S15H 1AE3A 3MXNA 1LT3D 4IFDI 1I50B 2ATWA 2JA7G 3KLWA 2JE6I 3K58A 3HOVG 5ISRA 5IOCA 1TT2A 3LWEA 4B3ML 4POFA 4QUCA 1IBMQ 4DXFA 2QA4A 2JA8H 4JI8Q 2WP8J 3DUZA 4GOPA 2EJGC 2HD3A 3K5LA 3J7ZC 4B3RL 5AFWA 4JI1Q 3TMEA 3KF6A 4AQYQ 2Q2UA 1K9MC 1KRTA 2Q8RE 1Y8OB 3NHHA 5T1GA 1EY8A 1HHVA 1SE4A 2F4VQ 4A3BH 4OWTB 2VB3X 2NVYB 1JQYD 3CRKC 3LWUA 5C4ZA 1SSOA 5FKAC 2JEAI 2YU9B 3HG9A 2SEBD 1S5DD 2NVQH 2JA8G 3FHWA 2L12A 3A8KE 3U4VA 4KHPL 1RDPD 4LF7Q 4K8JA 2BDNA 4PZ7A 1RHPA 1II3A 2KVMA 2Z8LA 2Z6KA 4B3TL 3T56B 2K5NA 2B2UA 1IXRA 1JOOA 1PH2A 3CF5A 2OTJA 2B2WC 2EQSA 1BUVT 2J7ZA 2E76C 3GTKB 2QILA 5C0XI 4X3KA 1Q90A 1TWCB 2N49A 3RR5A 5GAGC 3Q24A 5T1IA 4UAIA 2K04A 4UP9A 3F8TA 2M9VA 3QR8A 4LF5L 4K5VA 1ET6A 1PFBA 4IFDJ 3MEHA 4NB3A 2R7ZH 3NBIA 4DAVA 3VR4A 4BBRB 4U673 3HEJA 3SK8A 4J6HA 4YIJA 2VUMG 1LABA 1LT4D 4DR3Q 1W2BA 4KJNA 2C35B 5NUCA 2MP1A 3KDFB 2X69A 3QIAA 4GKJQ 5JPMC 5E1FA 2B63H 5A2QE 3K5MA 2ICIA 3D4RA 1Z7TA 3NQIA 1IBKL 1CZGA 1DGSA 3C1FA 4KKTA 4OO1H 5C4JB 4X64L 3S14H 1IYUA 2HCIA 2HQLA 2RQXA 4V0BA 2KOLA 2KUMA 5KYLA 1ESFA 5C5MA 3P1HA 1TWGH 1T9HA 1R9TH 5IP9G 4WORA 4JI6L 4G7ZC 1G8ZD 4HCEA 4XIGS 3TBIB 5LMNQ 2I5LX 2Q2HA 1MJEA 2XIWA 1SNPA 4IPGA 3OPOA 3F2CA 2N55A 3E9HA 1X54A 3I4NB 1NMGA 2B63G 2L4NA 1XMOL 2DGYA 5EKLA 3D4WA 4KK7A 4MZ9A 1V9PA 1ESRA 2JA6G 3L9AX 1YVCA 1X55A 3PF5A 5M5XB 5FO7B 1STHA 5ELDA 1S5BD 5FJ8H 5C4XB 5ELBA 5C0XJ 4RGTA 2EY2A 1C4QA 2K5QA 3UDGA 1TWFB 1H9KA 5IIFA 2LXKA 1AZQA 2WB1B 2R7DA 3VDYA 4RFBA 4DV2L 3CQZH 3QOJA 1JWMD 1LYLA 1YJ9A 2E2HB 5CC4A 2UUBQ 2R93H 3BYYB 4DR2Q 1AEXA 3X3MA 1KAWA 1IL8A 1Y1WH 1VQ9A 2X6LA 1RKNA 1EYDA 2VZAA 4DV4Q 4YY3L 3GQBA 1RD9D 1I94L 4DV5L 1PFNA 1SFOB 5GROA 4H44C 3PUZA 3TSSA 1PTOF 2F0LA 3I4MH 3CCEA 2O2LD 1HFGA 3TZUA 4A76A 3A74A 1SXTA 5C44G 1TIID 3HOXB 1ASYA 4CDCC 3FRPB 1CQVA 1JE5A 2IT1A 3BDOA 1MD2D 3FP9A 4C3HH 2ZM6Q 1KIXA 4B3SQ 4X62Q 5HY6A 1GM5A 3MXPA 4BBSG 2Q8IB 3Q0AA 1FNWA 3CMEA 3F2UA 1TWAH 3SR1A 1BKBA 2RSOA 1O80A 4CDFC 1KDAA 1YNNC 4LK1C 1XJVA 3A7AB 1SMXA 1A8VA 1VQFA 3S2HB 5CBAE 1VQ5A 1HXYD 1VCIA 4FNFA 1EFWA 1A0IA 4GZYC 2YTYA 2IW3A 1LACA 4C3IH 3I4MG 4JV5L 1KC8C 1ICWA 1HFNA 1L1OC 3KBGA 5JJZA 4IN3A 4YCVA 1SNOA 2YTXA 4A3EH 3OW2A 5CV9A 3HOWG 1PTOD 5JJKA 4DV6Q 2M00A 4IUTA 3J81L 1K0SA 2WFWA 1IW7C 2OXPA 4UP8A 5EJWA 5J1ZA 1IBLL 2NVTB 1GHKA 1ZXTA 1RTNA 2HHHQ 3GTPH 1OXUA 4EQ5A 1IL2A 3KDFA 4X66L 4JW0A 1YNJC 1VMCA 1BCPB 1CUKA 4HJAA 1EQQA 4NXNQ 3MC0B 4C3IG 1OXSC 5LHY1 1S72A 3D0FA 3U50C 4P73A 5FLMH 4DPGA 2FMMA 3D31A 1PHJA 2JJQA 3RN5A 4DR7Q 3VYTA 1TY0A 3CCUA 1CTMA 4Y7NH 4A3EG 1D5XC 4DA2A 4YWKA 1J5EQ 1HRJA 2A68D 2AWNA 1W3SA 3PUWA 4UDUC 3OHXC 1JOKA 1WCMB 1JCKB 1IHZA 4KN4C 3CRLC 1FNVA 2H4OA 4C3JB 1HCZA 1MSHA 1TS3A 1YNND 4KY7A 4HN7A 3BVMA 4FXDA 4K6LA 3KBXA 5KNDA 5EGTA 3DEPA 2I0QA 3G71A 1CT1D 3J7YW 1TR5A 3FVQA 4G4KA 4GS3A 3HOYB 1X6OA 1DM0B 3ER0A 4K5WA 2IHEA 5FLMG 4OWWB 5EBCA 2AHOB 4PZ8A 1WTVA 3T1YL 3A5ZB 3CCVA 3P7JA 3C46A 3HKZG 5IT9c 2PI2A 3DWAA 5E4XA 2NZHA 1DOMA 5IGDA 3BZDB 1QZHA 1GUTA 3T1HL 2K5WA 5M5YB 3ULLA 2DNEA 1EY0A 4PZ6A 3S1MB 5IGEA 4OONA 1C48A 3M85A 3TP8A 1JJCB 1SYGA 1EYAA 2NZOA 1E0BA 4ODGA 2L1BA 1QILA 4R1JA 3IFDA 3K0XA 1Q46A 1Q1EA 4DV1L 3MHBA 2J4XA 4JI5Q 1X3GA 4P72A 4GNXC 2KCCA 4Q0FA 4GN4B 5I2XA 4APVA 4IPHA 4I7AA 4IO9A 1I4PA 3G4SA 5IWAL 4HMIA 3NQTA 3DXJC 2NWGA 4PG3A 2EIFA 2CW0D 1WTXA 4B3RQ 4OIKA 3EN2A 3J81E 1U9RA 2WKCA 2B3GA 1SYBA 1H95A 3PUXA 1WJJA 1QVGA 1F77A 4BY7H 3Q22A 1F9PA 4A3IB 1E7ZA 2DY8A 1EL0A 1IKLA 2IY5B 3A0JA 4ULLA 1SYEA 1WOCA 2QKIC 1XYIA 1B50A 1E3PA 1R4PB 1AE2A 1STYA 3BZKA 3S9WA 3GTLH 1ILQA 1W6KA 2EY1A 4QY7A 3ULPA 4LF9L 3E9IA 3ONAB 1QNUA 4G57A 3TRZA 2OWOA 2XRSD 1D1KA 1X3PA 1BF4A 4O2DA 4B08A 3ND9A 4LJZC 5A35A 2PZTA 4DU9A 3FMCA 5CORA 2ICEC 3MFGA 3CCLA 4JI2Q 1NBWA 5EPJA 2I5HA 1F2LA 3C1EA 2RDHA 1HR0Q 4DUZQ 1X65A 4C1NK 4A93G 4O42A 3SHLA 1FR3A 3FKIH 4CKBA 4LFBL 1EEID 4KV6A 1N32L 3I3CA 3AU7A 4X3TA 3MXNB 3DM1A 4JBWA 1DXMA 1MJCA 1RODA 4CJ2C 1VQGA 4LF8L 2NZ1D 2OT2A 3KK7A 1JB7A 5LL6X 1V43A 4LF4L 4GOPB 4I7ZC 3TP5A 5CBEE 2P5ZX 3E5SA 2B2TA 3P75A 2VNUD 2CQOA 1WI5A 3MFYA 1JC7A 5JEAJ 5LL6S 4AYBE 3FKIG 1JMCA 2UXBL 1G2SA 4DNTB 4MTNA 2E5LQ 5IODA 4JYAQ 3A55A 2LXJA 2D9UA 1Q8KA 1OTCA 1K83B 3TP6A 3BU2A 4A3CH 3H0GH 5M9OA 1PMRA 3S15B 1EQVA 2NN6I 1G291 1YZ6A 4QUFA 4PV1C 1U4MA 4C2MH 4L6TB 3G6EA 4N9PA 2QEXA 4A3JB 4MNOA 2MHVA 3EIVA 1EY9A 1HQRD 3AQQA 1GUWA 1OXVA 2A69D 2MJ8A 3V2TA 1D6EC 4QB4A 2E2JH 3STBD 5LMNW 4JBKA 1X3FA 1H9RA 3VYRA 2JA8B 2FJ2A 1WVLA 3CKIB 1HA6A 2L5TA 4A3DH 1SE8A 3CC7A 1BXTA 3ZYYX 3N52A 2PNRC 1PH3A 3IKJA 1PVOA 1TS4A 1ET9A 1PYBA 4A3MH 3WDNA 1GJXA 3J81c 1Q3LA 4DR1Q 4DN4M 1Z6HA 4A3CG 3RZDH 4A3BB 1X9NA 1JJGA 2F0UA 5TSSA 3LX0A 4DUYL 2H5XA 1SNMA 4FP5D 1QCBD 1L0WA 5JVG3 3S1NB 2NVQB 1EIGA 4P71A 4RA8A 1JE4A 3CC2A 2PCFB 1W6JA 4XXEA 1EWHA 2ZJQA 2N3SA 3H91A 3KF8B 1ML0D 4KLKA 4A3DG 2PZWA 3NWSA 4AYBG 2F0IA 3JAML 3R2TA 2CWAA 4DV0L 2EYLA 2BDOA 4ZCKA 3PO2H 4FF4A 1HNWQ 1BDOA 4C1NI 3M4OB 5DNFA 4ME3A 1PRTC 4HCSA 4QJFA 1GOZA 1SE3A 1YEZA 3HOVH 2NN6G 2R92B 3UE1A 3J81j 3GTGH 2ZJRA 3OIPA 2B2VC 2YYZA 2BH2A 4DV5Q 4CGYB 3HP3A 2ZTCA 1TVXA 1Q86C 1Z9FA 1EOTA 3QWNA 2CCZA 3RZOH 4OIJA 3NTIA 2L15A 2O5IC 2A6ED 2F0SA 1WTQA 4LFCQ 4A3KG 3Q23A 1PYSB 1EWCA 1K3BC 2R7ZB 4H13C 5ELFA 5ELOA 4U68A 1Q7YC 1AN8A 2BOSA 3W1GA 2BA1A 2NVXH 4KHVA 4LFAQ 1Q12A 3TREA 4BA2I 5BR8Q 3TS0A 1QUQB 3IFTA 2JSOA 1PTOB 2Y0SE 1I6HH 2BE5D 2RF4A 3O13A 2WAQB 4JI3Q 3RMHA 4LUVA 4ZRZA 1CQFA 3AMUA 5M3FB 1CKMA 1EQTA 2D5DA 4BWGB 5C3EG 1HTPA 2Z1CA 3QB3A 5AJ3Q 3S14B 3GDEA 2PW5A 1N34L 1AZPA 4RCNA 1ENAA 3K8AA 5CV7A 2A19A 2KCTA 4IURA 4DK3C 1CK1A 3A54A 3M4QA 4DR4L 1SR3A 3S1RB 1PDQA 1TWGB 2HT1A 1TXYA 3S24A 1R9TB 1SLJA 3G6JB 2XWBB 1J6QA 4X66Q 1L0XB 2E2DC 2VQEQ 1QE6A 1DYQA 2ASBA 2DY7A 3EBEA 1UAPA 2B2WA 2A6HC 1EZ8A 1BO0A 2ID0A 1JOQA 1ENCA 5CYUA 1XNQL 4IPDA 3K6OA 2F3WA 3CCQA 4LF6L 5I6WA 3S1QH 4KKUA 3H3VI 4OXPA 4KTAA 1XNRQ 4NPSA 3CCRA 3K80C 1CA5A 2JA5H 1EZ6A 1B9NA 2UXCQ 5FLXL 3GV3A 4K8IA 4DAMA 1EY4A 1CHPD 1L1OB 3SE0A 2UUCL 2VUMH 4RGOS 4XT3B 1CSPA 1ENFA 4K14A 4IFDG 1PH6A 2KENA 5IT9L 4TSSA 4HR7B 5CR3A 3BDLA 1UWVA 3HOUB 3HZXA 2Y0SG 1JWSD 2R93B 1FNUA 3KJOA 3TP7A 1Y1WB 2QGQA 1LTID 1XMQL 3T1YQ 1YHQA 2F3VA 1E2WA 4QF4A 2B2YC 4CBVA 2HIVA 1NUCA 3KF8A 1BQQT 3I4MB 2LKVA 4WJ3M 5LMUL 2JA5G 4FF3A 1EUJA 2MPMA 3MVVA 1YITA 3KUPA 4C3HB 5IP9H 3BVZA 1N33L 2RDFA 5CV6A 4CJ1B 2VL6A 1BBXC 3NK9A 4BY1G 1TWAB 3BZCA 2IX1A 1FVIA 4X65L 2UUAL 4A3GG 5DLQE 1D7QA 1VQHA 3GTJH 3EFXD 1A3UA 2NYZD 1GUNA 1T5XD 1LTBD 1PYWD 1Y1VB 1IYVA 4XTCS 1I50H 2JA6H 3MXGA 3RD4A 3J80c 1EFID 1H9SB 1KAAA 4LUZA 4JI7Q 4KY5A 2QCPX 1NR4A 5EPLA 1S40A 2K5HA 4XYQA 4B9XA 5C3XA 1A3VA 5C6AA 2SDFA 1O7IA 1SJED 4RGNA 5BN5A 5HGQA 4JI0Q 4XQNA 2F52A 5C0XG 1LTTD 3H94A 4RAUC 3GTPB 1QUQA 3HFZB 4QIWB 3W3AA 4ZKBB 2XWJB 1I4RA 2K52A 4ZUIA 2F0TA 3GV6A 1HR0W 2KEEA 1VS0A 1VQ6A 1UE7A 4RG1A 1XTCD 1F2ZA 2EJMA 1S5ED 4KD4A 5C44H 1ASZA 2EY6A 1HUNA 1KL9A 4GNXB 1SE2A 3MWYW 4GN5A 3HKZB 4JK1C 4Y7NB 5I9PA 4DR6L 3OTOL 2WACA 3G7LA 3UDXA 1YJNA 5FO9B 1N36Q 4JI4L 4BBSH 1ILPA 2QF7A 1Y14B 4MIUA 1EIYB 1S4ZA 4QGUA 3SGIA 4R4TA 5IT9E 3JAMc 3PIOA 1N32Q 1YHAA 1AP0A 2J0TD 2SNSA 1EY7A 1SYDA 3KLRA 2PMZB 1VMPA 3VYSA 2UXDL 3NEMA 4O0AA 4DK1A 1CM9A 3CW2C 3TN2A 5L37A 3AFQA 1M1KC 2ZTEA 3GP7A 3GTOH 4LF4Q 4A75A 3PO3B 1UE1A 3PIPA 4XQJA 3T51B 1KLGD 3HOWH 4TRDA 1I4HA 2A1AA 1DONA 3HOZH 4FVMA 4L8JA 3MAQA 2K7VA 2XVSA 1L1OA 3DLLA 3CHBD 1U4LA 3SDZA 2JEBI 4JG2A 4FF2A 4DAPA 4G7HC 2K14A 5DEHA 1G6ZA 3CC4A 2ZJPA 1RCVD 3JC66 2ENBA 1FGUA 1NR2A 4YHHQ 1XWEA 2Z6BA 3C2PA 1S3OA 2LY7A 2PQAB 1GUGA 4ZYSA 3FEWX 3PSIA 4OWXB 3HOZG 4QQBX 3HS0C 3T16A 3F2BA 1B9MA 3NXWA 2OCEA 4DAYB 4BY7B 1LLRD 4BBRG 3P20A 4DFAA 4UPAA 2CHBD 1HQMC 3BDCA 2WB1E 5IE8A 3K7AH 5IYCG 1B3QA 3GTLB 1E24A 3OIQA 5CV5A 2F4VL 1QVCA 4IUVA 4OEMB 3M3YB 1O7YA 1H9SA 2GA4B 4NXMQ 3NENA 4QL5A 4JBJA 4EQOA 1C8CA 4BS9A 4DV0Q 5M5XH 1HTLD 3I91A 5DM73 4L63B 1LTRD 3UDFA 1N9WA 5F2DA 5FLXc 1VQCA 1SROA 1F9QA 3DEOA 4GKKQ 3TZDA 3A8JE 1SAPA 2R6GA 1XTDA 1KQSA 3AYHB 1YHBA 2VQFQ 4IUQA 1CKOA 3I4NG 4POGA 3CPWA 2EYFA 1PZJD 4GNXA 1IYJB 1IW7D 3VA5A 1J9OA 2K6AA 2LSSA 2R61A 5M5WH 2MNAA 1Q82C 1VQBA 3GTQH 1K8OA 5GAHC 3CP0A 1ZKOA 2JQOA 4IUUA 1KABA 1YNJD 2NB0A 3GD7A 3J81i 5C4XG 2OQKA 3PF4A 1GXDC 4C56C 3UI2A 4DNIA 1EQRA 2IPKD 3SK4A 3UE0A 2LS01 1NJIC 4X6AH 2WB1G 4LW1A 1N8RC 1XX8A 1O7ZA 1WD0A 4X3UA 4HMJA 4PMBA 3OSOA 3H0GB 4B3MQ 1K73C 2KHJA 4EQPA 5IP7H 1CZWA 1QWYA 4S3SA 5M3MB 1A15A 1M8AA 2O5JC 4BA1I 1NTGA 1PH1A 2K01A 5COYA 4HAEA 5CMDA 2JYOA 5JVH3 2G9DA 4HTHA 5ELNA 1PA6A 2E2JB 1G51A 1Q81C 1SNQA 3K7UC 1FD7D 4ID6A 3HOXG 2ES2A 2F0OA 2RVLA 3QOLA 4A93H 1SBBB 4TVAB 1K28A 2EPBA 3NBHB 1BNZA 2AKWB 4A3MB 1SEBD 4OGQC 4DNRB 2NVTH 1QZGA 1YBYA 3I56A 4V190 2K75A 3OYYA 3RZDB 5IP7G 1UE6A 1PH9A 3DM3A 3QJYA 4HJ5A 1UEBA 4HIDA 3CMAA 4KHPQ 5LMNL 4XT1B 2I5MX 1XNQQ 2PQAA 4A3FH 4H0LC 4B3TQ 1WFQA 4N9TA 1YNXA 1L0YB 2B8GA 4Y52H 1I4QA 2VXWA 4A3LH 1LT5D 2IJ0A 5JJIA 4XYOA 3PIP3 2SOBA 4DAYA 2AUKA 4QCLA 1CI3M 2V1CC 2NTSA 5J3BA 1SYCA 3TDQA 1HNZL 3PO2B 2D0OA 2E2IH 3GTMH 3OMCA 1RF2D 2CKZB 1C7YA 1P16A 3H09A 3MTSA 3I73A 2JA7B 3I72A 1E22A 1PH8A 3HOVB 2JA9A 1TKWB
chains in the Genus database with same CATH topology
1VDZA 3K5NA 2IL8A 1F2YA 1SJHD 2TMPA 3GTGB 1CFMA 1KLUD 1ONLA 1SDFA 2EJFC 2F0DA 5C5LA 3HGBA 1TQOA 1HPCA 1B3AA 4ME5A 3MXUA 1BR9A 4ZQ3A 3PMFA 4C3JG 2LMCB 2EXZA 1DCZA 3J80L 2RDGA 2XRQD 2NVXB 1BCPC 3C3LA 4WJWA 5EPKA 5D3IB 4K2KA 1A6XA 1I6HB 4O1NA 3EJIA 2F0WA 5G3LF 3QG1A 3D3RA 3VR5A 2WKDA 1JB3A 3WOEA 4Z9CB 4IQZA 5KNCA 4M1UB 1NCVA 1Y8PB 1EY5A 3SEBA 5C4HA 1LV9A 5IGFA 3A56A 1U4PA 1QNKA 1Q8IA 2A73B 2F0QA 1UUPA 5D3DA 2HDMA 5EKKA 1TS2A 2NN6H 1QB5D 1PLFA 1VF7A 2H1EA 1LTAD 4PMCA 4E6IA 3VR3A 5IGBA 3M7NA 1MSGA 1GUSA 4DF7A 4RWSC 2Y0SB 2F0VA 4WRDA 4RGMA 1WTPA 2BCOA 3DHQA 2B2VA 4R8IA 4KKSA 3S1QB 5G3LD 2WV6D 3NPPA 2JA5B 3N6RA 3NBHA 4DGZA 2F0EA 2VUMB 3EA6A 2EVBA 2AUJD 5DM63 3BG3A 1KTKA 4KMUC 1H9MA 4F88A 3VA7A 1RTOA 4ZAIA 2IX0A 4NP5A 1PRTF 1A3TA 2EYOA 3I70A 3NUCA 1V1PB 3SVMA 1E2VA 2N88A 1J8IA 3ND8A 1HA5A 2SNMA 3J80E 2E75C 2B39A 4NKLA 3OMGA 4RH6A 1H9JA 3AB9A 5KRUA 2FMCA 3GTJB 5IGCA 4NDXA 5K36H 2B63B 2IWHA 2PZUA 4HSPA 2JA6B 2QEJC 3T4AC 1MBYA 3T53B 4EVOA 2Z4HA 1PRTD 2L0CA 5A2QL 2MGSA 3BS1A 4IFDH 3H6MA 2AQ1B 5I9OA 1STEA 3EROA 5K36G 2KQ3A 3KLSA 5J39A 2ZXRA 3JAME 5C44B 2LFNA 1EYCA 2B2YA 1CA6A 4BBSB 4NMZA 3CQZB 3VR6A 2KJXA 4ILWA 4R8NA 5EKIA 2NUCA 5K5PA 4J8QA 2PYKA 3SK5A 5D14A 3GTOB 1M4VA 4LAAA 1ZYRC 2B2UC 1EY6A 4CJ0B 1MI2A 2OF1A 4CKCA 3HOWB 1DD2A 1Q1BA 4OO1I 1EU4A 3M7GA 3HOZB 4FF1A 5FO8B 2A6HD 5C0XH 2EE1A 2RA4A 4ABNA 3NTHA 5JPNC 2CQAA 2F0KA 1LTGD 3M4YA 4C3IB 1PTOH 3SK6A 1VF5C 3NSWA 4LMQD 5EQ0A 3A7LA 4A3EB 2C9OA 2EDGA 1JORA 1TU2B 1V1PA 4K2LA 2AQ2B 5KGUA 1QG7A 3E0JA 2XN9C 5C3WA 4NW2A 3I4LA 2IX3A 2F0NA 2HCCA 2L11A 1G2TA 4M8AA 3H3VC 1GHJA 3K7AB 4ZUJA 1ZYRD 1LTSD 3R8BA 4OL7A 2EY5A 5I4DA 3CU7A 5JOBA 5FLXE 3D8GA 5KNBA 2F0FA 1OXXK 2KCNA 5I2YA 3ERQA 2XNAC 4OO1G 2K5DA 4DK0A 4P2CB 2EYJA 1DZ1A 4ZKCB 2HQEA 2ZT9C 2F0MA 3MA2B 4MN3A 3FPUB 2PPBC 3U9OA 1PTOC 5HGTA 1PFMA 2RBMA 4K5XA 5HURA 2I46A 2R3ZA 1KDCA 1PZKD 4PQXA 3NP8A 1T5EA 5IGGA 5BN4A 3HRZC 4PMWA 1D2BA 5M5WB 1Y8NB 2PO4A 2HDLA 4TQUS 3GTQB 1I6VC 1X3QA 1MGSA 2RKSA 5KYIA 2ZXPA 2B8FA 5D65A 3PUVA 5BN3A 4FO2A 4F8MA 1F9RA 1JICA 5KIXA 2MUYA 2A68C 2RSNA 1D5ZC 1DOKA 3D4DA 1DJRD 3L7ZC 3BVGA 1O78A 1X32A 2PW7A 1EIHA 2WINB 1D1IA 1NSNS 4KJOA 3NWTA 2K1BA 4HSVA 2V4DA 2KHSA 4ZLTF 1Y69U 5CGKA 4KHZA 4A93B 3RLFA 4C3HG 1V1OA 2KA7A 2FINB 1U4RA 1FYCA 3KLSX 2XSCA 4J1MA 1DOLA 1KNAA 4QMGA 2A74C 4F7XA 1JR0D 3R93A 4IUPA 3R3OA 2C5CA 3K0YA 4WFN3 3I90A 4A3FB 4G7OC 3VYUA 2NBFA 4KN7C 3FKIB 3X3NA 3V05A 1UNSA 4TKOB 3E6ZX 4H7BA 1TY2A 2L9HA 3J7AV 2CW0C 3GTMB 2E2IB 1SNCA 1K8MA 5CV8A 1PZID 2BA0A 2EYPA 2NTTA 3S2DB 1Z47A 4CHTB 3FPPA 1D5MC 2K32A 4FXGC 4IZ8A 1KDBA 1HUMA 3OWFA 2KECA 2VB2X 5EBDA 2DN8A 4EQNA 1B2TA 1B1ZA 3U9SA 3GO5A 4B9WA 4DXGA 2M2LA 5E4WC 4XDXA 4C2MB 3OOCA 1I4XA 2F1MA 3EVQA 5FOBB 3WOFA 3K57A 3OW7A 1PRTB 3PV0A 3QO2A 4R9WA 1TS5A 4EGVA 2EOTA 2F0GA 4KY6A 2JXMB 4MHEA 1F2MA 4A3DB 2FFKB 4OHJA 1A2UA 4AYBB 1QJOA 2D62A 1TWHB 4RHSA 5JEAH 3PIO3 1I4GA 3NTKA 3R2IA 1KNEA 3IAYA 1RJTA 1CHQD 1LT6D 3J7AF 4ZK9B 1B53A 2EYMA 4KD3A 2F0PA 5KEEA 1V8QA 1STBA 2AWOA 2JP1A 1R4QB 1IKMA 1A2TA 3Q6SA 1WTRA 4K6DA 1FGBD 2I07B 1XXGA 4A3KB 2A69C 5JEAG 1G91A 1ZEQX 3EQLC 1SNDA 1STGA 2D2CC 2F0JA 3BYTB 3L3OC 5E3FA 4I65A 1WD1A 2F4IA 3URYA 3MZ5A 5DAUA 2FHTA 2AQ3B 2KEDA 2K05A 3RUZA 3RZOB 5C3EB 2G9HD 4Q5VA 1STNA 1OO9B 1S5CD 1AFPA 3I8ZA 3SXHA 5ELCA 3PUYA 3K5OA 1EU3A 3VR2A 1SMYC 5I6YA 1BOSA 3LNNA 3IL8A 1E2ZA 2B2TC 2OEOA 2DNCA 2K28A 1LO5D 1GUOA 3S16B 3W2DA 2PQEA 2ZXOA 2TSSA 2Z4IA 1BCPF 2WIIB 3S17B 1EEFD 3NE5B 4RHRA 1WTOA 1B44D 3A8IE 3ITPA 1SYFA 3T13A 4XQQA 5J22A 1JWUD 4PNYA 1STAA 4IALA 2A6EC 4KI0A 3DWPA 4FXKC 1B4OA 1O7LA 2L55A 3OWEB 5ELEA 4RKLA 2O4XA 3V96A 3FDTA 2K03A 1S5FD 4X3SA 2BE5C 2X6GA 1BCPD 3D6CA 2E74C 2HUGA 1UEAB 4BY1B 3DMUA 1NAPA 1SMYD 1QOHA 4A3GB 2F0HA 4F87A 4CKEA 4HEDA 2EZVA 4RKBA 1OXTA 2F03A 1AW7A 2A5HA 1WTWA 2K33A 4FYDA 5CV4A 4IUNA 2Q8TA 2QDBA 2CVRA 4RCOA 1F9SA 3D6WA 2EYHA 3DWQA 1I3QB 5FK9C 3K59A 5JAVA 1PXUA 3MXNA 1LT3D 4IFDI 1I50B 2JE6I 3K58A 5ISRA 5IOCA 1TT2A 3LWEA 4QUCA 4DXFA 2WP8J 3DUZA 2EJGC 3K5LA 5AFWA 3TMEA 2Q8RE 1Y8OB 3NHHA 5T1GA 1EY8A 1HHVA 1SE4A 2VB3X 2NVYB 1JQYD 3CRKC 3LWUA 5C4ZA 1SSOA 5FKAC 2JEAI 2YU9B 3HG9A 2SEBD 1S5DD 2L12A 3A8KE 1RDPD 4K8JA 2BDNA 1RHPA 1II3A 2KVMA 2Z8LA 3T56B 2B2UA 1JOOA 2B2WC 1BUVT 2J7ZA 2E76C 3GTKB 2QILA 5C0XI 4X3KA 1Q90A 1TWCB 3Q24A 5T1IA 4UAIA 2K04A 2M9VA 4K5VA 1ET6A 1PFBA 4IFDJ 3MEHA 3NBIA 4DAVA 3VR4A 4BBRB 4U673 3HEJA 3SK8A 4J6HA 4YIJA 1LABA 1LT4D 4KJNA 5NUCA 2MP1A 2X69A 3QIAA 5JPMC 5E1FA 5A2QE 3K5MA 2ICIA 3D4RA 1Z7TA 3NQIA 1CZGA 3C1FA 4KKTA 4OO1H 5C4JB 1IYUA 2HCIA 2RQXA 4V0BA 2KOLA 2KUMA 5KYLA 1ESFA 5C5MA 3P1HA 4WORA 4G7ZC 1G8ZD 4HCEA 4XIGS 3TBIB 2XIWA 1SNPA 3OPOA 2N55A 3I4NB 2L4NA 5EKLA 3D4WA 4KK7A 1ESRA 3L9AX 5M5XB 5FO7B 1STHA 5ELDA 1S5BD 5C4XB 5ELBA 5C0XJ 4RGTA 2EY2A 1C4QA 2K5QA 1TWFB 1H9KA 5IIFA 1AZQA 2WB1B 4RFBA 3QOJA 1JWMD 2E2HB 5CC4A 3BYYB 1AEXA 3X3MA 1IL8A 2X6LA 1RKNA 1EYDA 3GQBA 1RD9D 1PFNA 1SFOB 4H44C 3PUZA 3TSSA 1PTOF 2F0LA 2O2LD 1HFGA 3TZUA 1SXTA 1TIID 3HOXB 3FRPB 1CQVA 2IT1A 3BDOA 1MD2D 3MXPA 2Q8IB 3Q0AA 1FNWA 3F2UA 3SR1A 2RSOA 1O80A 1KDAA 1YNNC 4LK1C 3A7AB 3S2HB 5CBAE 1HXYD 1VCIA 4FNFA 4GZYC 2IW3A 1LACA 1ICWA 1HFNA 3KBGA 5JJZA 4IN3A 1SNOA 5CV9A 1PTOD 2M00A 4IUTA 3J81L 1IW7C 2OXPA 5EJWA 5J1ZA 2NVTB 1GHKA 1ZXTA 1RTNA 1OXUA 1YNJC 1VMCA 1BCPB 3MC0B 4C3IG 1OXSC 5LHY1 2FMMA 3D31A 3VYTA 1TY0A 1HRJA 1CTMA 1D5XC 4DA2A 2A68D 2AWNA 3PUWA 4UDUC 3OHXC 1JOKA 1WCMB 1JCKB 1IHZA 4KN4C 3CRLC 1FNVA 2H4OA 4C3JB 1HCZA 1MSHA 1TS3A 1YNND 4KY7A 4HN7A 3BVMA 4FXDA 4K6LA 3KBXA 5KNDA 5EGTA 3DEPA 1CT1D 3J7YW 1TR5A 3FVQA 4G4KA 3HOYB 1DM0B 4K5WA 5EBCA 1WTVA 3P7JA 3C46A 5E4XA 3DWAA 5IGDA 1DOMA 3BZDB 1GUTA 2K5WA 5M5YB 2DNEA 1EY0A 3S1MB 5IGEA 1C48A 3M85A 3TP8A 1SYGA 1EYAA 1E0BA 4ODGA 2L1BA 1QILA 3IFDA 1Q1EA 3MHBA 2J4XA 2KCCA 4Q0FA 5I2XA 1I4PA 4HMIA 3NQTA 3DXJC 2NWGA 2CW0D 1WTXA 4OIKA 3J81E 1U9RA 2WKCA 1SYBA 3PUXA 1F77A 3Q22A 1F9PA 4A3IB 1EL0A 2DY8A 1IKLA 4ULLA 1SYEA 2QKIC 1XYIA 1B50A 1R4PB 1STYA 3S9WA 1ILQA 1W6KA 2EY1A 3ONAB 1QNUA 4G57A 2XRSD 1D1KA 1X3PA 1BF4A 4B08A 3ND9A 4LJZC 5A35A 2PZTA 4DU9A 3FMCA 5CORA 2ICEC 3MFGA 5EPJA 1F2LA 3C1EA 2RDHA 4C1NK 4O42A 3SHLA 1FR3A 4CKBA 1EEID 4KV6A 3I3CA 3AU7A 4X3TA 3DM1A 4JBWA 1DXMA 1RODA 4CJ2C 2NZ1D 2OT2A 3KK7A 5LL6X 1V43A 4I7ZC 3TP5A 5CBEE 3E5SA 2B2TA 3P75A 2VNUD 3MFYA 1JC7A 5JEAJ 5LL6S 1G2SA 4DNTB 5IODA 3A55A 2D9UA 1K83B 3TP6A 5M9OA 1PMRA 3S15B 1EQVA 2NN6I 1G291 4QUFA 4PV1C 1U4MA 4L6TB 4N9PA 4A3JB 2MHVA 1EY9A 1HQRD 1GUWA 1OXVA 2A69D 2MJ8A 3V2TA 1D6EC 4QB4A 1H9RA 3VYRA 2JA8B 2FJ2A 1WVLA 3CKIB 1HA6A 2L5TA 1BXTA 3ZYYX 3N52A 2PNRC 3IKJA 1TS4A 1ET9A 3WDNA 1GJXA 1Q3LA 4DN4M 1Z6HA 4A3BB 2F0UA 5TSSA 3LX0A 1SNMA 4FP5D 1QCBD 5JVG3 3S1NB 2NVQB 1EIGA 4RA8A 1JE4A 2PCFB 1W6JA 4XXEA 1EWHA 3H91A 1ML0D 2PZWA 3NWSA 2F0IA 3JAML 3R2TA 2EYLA 2BDOA 4FF4A 1BDOA 4C1NI 3M4OB 5DNFA 1PRTC 4HCSA 1GOZA 1SE3A 2NN6G 2R92B 3OIPA 2B2VC 2YYZA 4CGYB 3HP3A 1TVXA 1EOTA 3QWNA 4OIJA 3NTIA 2O5IC 2A6ED 2F0SA 1WTQA 3Q23A 1EWCA 2R7ZB 4H13C 5ELFA 4U68A 1AN8A 2BOSA 2BA1A 4KHVA 1Q12A 4BA2I 3IFTA 2JSOA 1PTOB 2BE5D 3O13A 2WAQB 3RMHA 4ZRZA 1CQFA 3AMUA 5M3FB 1EQTA 2D5DA 4BWGB 1HTPA 2Z1CA 3QB3A 3S14B 2PW5A 1AZPA 4RCNA 1ENAA 5CV7A 4IURA 1CK1A 3A54A 3S1RB 1PDQA 1TWGB 1R9TB 3G6JB 2XWBB 1L0XB 2E2DC 1QE6A 1DYQA 2DY7A 1UAPA 2B2WA 2A6HC 1EZ8A 1BO0A 2ID0A 1JOQA 1ENCA 5CYUA 3K6OA 2F3WA 5I6WA 4KKUA 4KTAA 1CA5A 1EZ6A 1B9NA 5FLXL 3GV3A 4K8IA 1EY4A 1CHPD 3SE0A 4RGOS 4XT3B 1ENFA 4K14A 4IFDG 5IT9L 4TSSA 4HR7B 5CR3A 3BDLA 3HOUB 3HZXA 1JWSD 2R93B 1FNUA 3TP7A 1Y1WB 1LTID 2F3VA 1E2WA 4QF4A 2B2YC 4CBVA 1NUCA 3KF8A 1BQQT 3I4MB 2LKVA 4FF3A 2MPMA 3MVVA 3KUPA 4C3HB 3BVZA 2RDFA 5CV6A 4CJ1B 1BBXC 3NK9A 1TWAB 2IX1A 3EFXD 1A3UA 2NYZD 1GUNA 1T5XD 1LTBD 1PYWD 1Y1VB 1IYVA 4XTCS 3MXGA 3RD4A 1EFID 1H9SB 1KAAA 4KY5A 2QCPX 1NR4A 5EPLA 4XYQA 4B9XA 5C3XA 1A3VA 5C6AA 2SDFA 1SJED 4RGNA 5BN5A 4XQNA 5C0XG 1LTTD 3H94A 4RAUC 3GTPB 4QIWB 3W3AA 4ZKBB 2XWJB 1I4RA 4ZUIA 2F0TA 3GV6A 2KEEA 1XTCD 1F2ZA 2EJMA 1S5ED 4KD4A 1HUNA 2EY6A 1SE2A 3MWYW 3HKZB 4JK1C 4Y7NB 5I9PA 2WACA 3G7LA 5FO9B 1ILPA 2QF7A 4MIUA 1S4ZA 5IT9E 1AP0A 2J0TD 2SNSA 1EY7A 1SYDA 3KLRA 2PMZB 1VMPA 3VYSA 4DK1A 1CM9A 3TN2A 3GP7A 3PO3B 4XQJA 3T51B 1KLGD 4TRDA 1I4HA 1DONA 4FVMA 4L8JA 3MAQA 2K7VA 2XVSA 3CHBD 1U4LA 3SDZA 2JEBI 4FF2A 4DAPA 4G7HC 5DEHA 1G6ZA 1RCVD 2ENBA 1NR2A 1XWEA 3C2PA 2LY7A 1GUGA 4ZYSA 3FEWX 3HS0C 3T16A 1B9MA 3NXWA 4BY7B 1LLRD 3P20A 4DFAA 2CHBD 1HQMC 3BDCA 3GTLB 3OIQA 5CV5A 4IUVA 3M3YB 1O7YA 1H9SA 2GA4B 4EQOA 1C8CA 4BS9A 1HTLD 3I91A 5DM73 4L63B 1LTRD 5F2DA 1F9QA 3DEOA 3TZDA 3A8JE 1SAPA 2R6GA 4IUQA 2EYFA 1PZJD 1IW7D 3VA5A 1J9OA 2K6AA 2R61A 1K8OA 1ZKOA 4IUUA 1KABA 1YNJD 2NB0A 3GD7A 1GXDC 4C56C 3UI2A 3SK4A 2IPKD 2LS01 1XX8A 1O7ZA 1WD0A 4X3UA 4HMJA 4PMBA 3OSOA 3H0GB 4EQPA 5M3MB 1CZWA 1QWYA 4S3SA 2O5JC 1A15A 1M8AA 4BA1I 2K01A 5COYA 4HAEA 5CMDA 2JYOA 5JVH3 2G9DA 4HTHA 2E2JB 1SNQA 1FD7D 4ID6A 2F0OA 2RVLA 3QOLA 1SBBB 2EPBA 1BNZA 4A3MB 1SEBD 4OGQC 4DNRB 4V190 3RZDB 3QJYA 4XT1B 4H0LC 4N9TA 1L0YB 2B8GA 1I4QA 2VXWA 1LT5D 2IJ0A 4XYOA 3PIP3 2SOBA 4DAYA 2AUKA 4QCLA 1CI3M 2NTSA 1SYCA 3TDQA 3PO2B 3OMCA 1RF2D 3H09A 3MTSA 3I73A 2JA7B 3I72A 3HOVB 1TKWB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VDZ A;  4DK0 A;  2NN6 I;  1IW7 D;  1G29 1;  4L8J A;  2AUJ D;  4PV1 C;  1V8Q A;  3BG3 A;  2AWO A;  1CFM A;  1Q12 A;  3DXJ C;  4BA2 I;  3VR6 A;  2ZT9 C;  1ONL A;  4KN7 C;  2K7V A;  1O7L A;  4KMU C;  3IFT A;  1K8O A;  4G7Z C;  1OXV A;  2A69 D;  1H9M A;  1ZKO A;  4XIG S;  2EJF C;  2BE5 D;  1IW7 C;  3CRK C;  3LWU A;  4TKO B;  3GD7 A;  3SDZ A;  3VA7 A;  2PPB C;  3PUX A;  2JEB I;  3HGB A;  2JEA I;  1GHK A;  1H9R A;  1GUN A;  3OPO A;  1HPC A;  2CW0 C;  4G7H C;  2A69 C;  5JEA G;  1OXU A;  2L5T A;  1IYV A;  4XTC S;  3MXU A;  3A8K E;  2BE5 C;  1YNJ C;  2D5D A;  1ZYR C;  1E2V A;  2PNR C;  3EQL C;  1HTP A;  3IKJ A;  1K8M A;  2LMC B;  1H9S B;  2E74 C;  3ND8 A;  2D2C C;  1DCZ A;  1DD2 A;  1Q1B A;  1T5E A;  2BA0 A;  1OXS C;  4RCN A;  3T56 B;  3WDN A;  5BN4 A;  1GJX A;  2E75 C;  2O5J C;  1GUG A;  1Z6H A;  3D31 A;  3FPP A;  4BA1 I;  1Y8N B;  4TQU S;  1CTM A;  1H9J A;  1I6V C;  3AB9 A;  2K32 A;  2A68 D;  2A6H D;  5C0X H;  1A6X A;  1OXT A;  1B9M A;  1H9K A;  2B8F A;  3ND9 A;  3PUW A;  3PUV A;  5K36 H;  4LJZ C;  5BN3 A;  5BN5 A;  5A35 A;  2E76 C;  5C0X G;  4KN4 C;  3CRL C;  3FMC A;  2K33 A;  3QG1 A;  2DN8 A;  3VR5 A;  1HCZ A;  3H94 A;  2A68 C;  2A6H C;  3M4Y A;  4IQZ A;  5KNC A;  1Y8P B;  2PCF B;  3P20 A;  1EWH A;  3W3A A;  1Q90 A;  3U9S A;  1HQM C;  1FR3 A;  5KND A;  4OO1 G;  1VF5 C;  4OGQ C;  3T53 B;  3PUY A;  4KKU A;  4DNR B;  3L7Z C;  2BDO A;  3A7L A;  3GQB A;  2F1M A;  3OOC A;  2EDG A;  1O78 A;  2EJM A;  1TU2 B;  3OW7 A;  4H44 C;  4JBW A;  3PUZ A;  1B9N A;  1BDO A;  3PV0 A;  4KI0 A;  4IFD H;  1DXM A;  3TZU A;  4JK1 C;  3VR2 A;  1H9S A;  2NN6 H;  1SMY C;  1VF7 A;  3QJY A;  3SE0 A;  2V4D A;  3VR3 A;  3LNN A;  3VR4 A;  1Y69 U;  3M7N A;  1E2Z A;  1GUS A;  2IT1 A;  2JXM B;  2QF7 A;  2DNC A;  3BDO A;  4H0L C;  1GUT A;  4IFD G;  2NN6 G;  1GUO A;  4KHZ A;  1V43 A;  5K36 G;  1LAB A;  2B8G A;  2DNE A;  4HR7 B;  2JE6 I;  4I7Z C;  2Q8I B;  2YYZ A;  3RLF A;  3I4L A;  2KA7 A;  1QJO A;  2D62 A;  1FYC A;  3M85 A;  2AUK A;  3QIA A;  1YNN C;  3NE5 B;  4LK1 C;  1CI3 M;  1GHJ A;  2BA1 A;  3MFY A;  4KKS A;  3A7A B;  5JEA H;  3KLR A;  3A8I E;  1E2W A;  1Q1E A;  2EJG C;  4DK1 A;  4DNT B;  2O5I C;  1VCI A;  2A6E D;  3A8J E;  1Z7T A;  3D4R A;  2R6G A;  4GZY C;  4KKT A;  4OO1 H;  1LAC A;  3N6R A;  2KCC A;  4H13 C;  3T51 B;  5KNB A;  1OXX K;  3I73 A;  1IYU A;  1Y8O B;  3I72 A;  2EVB A;  4G7O C;  2A6E C;  1TKW B;  1PMR A; 
#chains in the Genus database with same CATH topology
 1VDZ A;  3K5N A;  2IL8 A;  1F2Y A;  1XMQ Q;  3S2D H;  1SJH D;  2TMP A;  3GTG B;  4LF5 Q;  4A3F G;  1CFM A;  1KLU D;  4UY8 C;  1ONL A;  2UUB L;  4DV3 L;  1VQE A;  1SDF A;  4R4I A;  4DR2 L;  3H15 A;  4DR5 L;  4A3L G;  2EJF C;  2F0D A;  5C5L A;  4DV4 L;  4DV7 L;  3HGB A;  1TQO A;  5JJL A;  1HPC A;  2ZTD A;  1B3A A;  3L0O A;  4ME5 A;  3MXU A;  1BR9 A;  1WCM G;  4ZQ3 A;  3L2P A;  3PMF A;  4C3J G;  2LMC B;  4B3S L;  2EXZ A;  2ZM6 L;  1DCZ A;  3J80 L;  2RDG A;  2XRQ D;  2UUA Q;  4X62 L;  2NVX B;  4UP7 A;  3E0E A;  1BCP C;  3C3L A;  1VQN A;  1IBK Q;  4WJW A;  3RNU A;  3HOY G;  5EPK A;  5D3I B;  4K2K A;  1A6X A;  1I6H B;  1XPO A;  4X64 Q;  3RLN A;  4O1N A;  3EJI A;  2F0W A;  5G3L F;  3QG1 A;  3D3R A;  3VR5 A;  2WKD A;  1JB3 A;  3WOE A;  4Z9C B;  4IQZ A;  5KNC A;  4M1U B;  1NCV A;  1Y8P B;  1EY5 A;  3SEB A;  2GVA A;  2G5D A;  5C4H A;  1LV9 A;  5IGF A;  4JI6 Q;  5GAD C;  4JBM A;  3A56 A;  1TWH H;  1U4P A;  1QNK A;  1Q8I A;  2A73 B;  1E1O A;  2F0Q A;  1UUP A;  1VQP A;  3IRB A;  1QVF A;  5D3D A;  2HDM A;  5EKK A;  1TS2 A;  2NN6 H;  1QB5 D;  1PLF A;  1VF7 A;  2H1E A;  5IYB G;  4H02 A;  1LTA D;  4PMC A;  4E6I A;  1NMF A;  3VR3 A;  1XMO Q;  3J7A 5;  4P75 A;  3A5U A;  5IGB A;  3M7N A;  1MSG A;  1GUS A;  3M4P A;  4DF7 A;  3LGJ A;  4CDE C;  4RWS C;  2Y0S B;  2F0V A;  4WRD A;  2KBN A;  4P74 A;  4NXN L;  1PH7 A;  4OEL B;  4RGM A;  2BCO A;  1WTP A;  5GAE C;  3DHQ A;  2B2V A;  4R8I A;  1K8A C;  4KKS A;  4DKA C;  4A3K H;  3S1Q B;  3OTO Q;  5G3L D;  4JI4 Q;  2WV6 D;  4K0K L;  3NPP A;  1J5E L;  2JA5 B;  3PCO B;  4DV2 Q;  3N6R A;  3NBH A;  4DGZ A;  2F0E A;  2VUM B;  4A3I G;  4WJ4 A;  3EA6 A;  3I4O A;  5H1S E;  4BXX H;  2EVB A;  5IY0 A;  2AUJ D;  5DM6 3;  4YY3 Q;  3BG3 A;  3I2Z A;  1XPR A;  1I94 Q;  1KTK A;  4KMU C;  3J80 i;  1H9M A;  1B8A A;  4F88 A;  3VA7 A;  1RTO A;  4ZAI A;  2IX0 A;  4NP5 A;  1PRT F;  2EXD A;  4JPB W;  5C3E H;  1A3T A;  2EYO A;  3I70 A;  3NUC A;  1V1P B;  3SVM A;  1E2V A;  4LNQ A;  2N88 A;  4IOA A;  3W1B A;  1J8I A;  3ND8 A;  1HA5 A;  2SNM A;  3RN2 A;  1CSQ A;  3J80 E;  2E75 C;  2B39 A;  4BXX G;  4NKL A;  3OMG A;  4RH6 A;  1H9J A;  3AB9 A;  3HKS A;  5KRU A;  2FMC A;  3GTJ B;  5IGC A;  4NDX A;  4JV5 Q;  5K36 H;  2B63 B;  2IWH A;  2PZU A;  4HSP A;  3S16 H;  3ERS X;  4JI5 L;  2JA6 B;  2QEJ C;  2UU9 L;  4A3J H;  3T4A C;  3S17 H;  3AEV A;  1MBY A;  1KHI A;  3T53 B;  4EVO A;  2Z4H A;  1E1T A;  1PRT D;  2JK8 A;  2L0C A;  1IBL Q;  2DJF C;  5A2Q L;  2MGS A;  3JAM i;  2VW9 A;  1EWI A;  3BS1 A;  4IFD H;  3H6M A;  2AQ1 B;  5I9O A;  1STE A;  3U4Z A;  1GO3 E;  1HZA A;  2MQH A;  3ERO A;  3KJP A;  5K36 G;  2KQ3 A;  3KLS A;  5J39 A;  1X3E A;  4GOP C;  2ZXR A;  3ICE A;  3JAM E;  4A3J G;  4FDB A;  5C44 B;  4YCU A;  1WTH A;  2BH8 A;  3S1N H;  2LFN A;  1EYC A;  2B2Y A;  1CA6 A;  4IJH A;  4BBS B;  3E3X A;  1NY4 A;  4BY1 H;  4JI2 L;  4NMZ A;  4A3G H;  1X56 A;  2PNH A;  3CQZ B;  3VR6 A;  2KJX A;  1HR0 L;  4DUZ L;  3AFP A;  4ILW A;  4R8N A;  5EKI A;  2FXQ A;  2NUC A;  3M4O H;  5K5P A;  3KYH C;  4J8Q A;  4A3B G;  1VQL A;  1GKH A;  1KD1 C;  2PYK A;  3SK5 A;  3T1H Q;  2R92 H;  5D14 A;  2Z6K C;  3GTO B;  1M4V A;  1B7Y B;  4LAA A;  1ZYR C;  3H3V H;  2WAQ E;  2B2U C;  1EY6 A;  4CJ0 B;  2OF1 A;  1MI2 A;  3TQY A;  2K5V A;  1VQO A;  4CKC A;  3HOW B;  1DD2 A;  1Q1B A;  4L5R C;  1LTL A;  4OO1 I;  1EU4 A;  3M7G A;  3HOZ B;  1EIF A;  2RHS B;  4DV1 Q;  1I3Q H;  4FF1 A;  3Q8D A;  5FO8 B;  4HJ7 A;  2A6H D;  5C0X H;  2EE1 A;  2RA4 A;  4ABN A;  3NTH A;  1VQD A;  5JPN C;  2CQA A;  2E5L L;  2F0K A;  1LTG D;  3M4Y A;  5IWA Q;  4JYA L;  4C3I B;  2R92 G;  3G48 A;  1PTO H;  4JOI A;  3SK6 A;  2DUD A;  1VF5 C;  2R7F A;  3NSW A;  1VQ7 A;  4LMQ D;  5EQ0 A;  3A7L A;  4A3E B;  2C9O A;  1K0R A;  2EDG A;  1JOR A;  1TU2 B;  1V1P A;  4K2L A;  2AQ2 B;  5M3F H;  5KGU A;  1EOV A;  1QG7 A;  1BBU A;  4CDD C;  3E0J A;  2XN9 C;  4UHV A;  5C3W A;  2R7Z G;  4JOI C;  4NW2 A;  1M90 C;  3I4L A;  4LF9 Q;  2IX3 A;  3S1R H;  2F0N A;  2HCC A;  2L11 A;  1G2T A;  2NVY H;  4M8A A;  3H3V C;  1GHJ A;  1XPU A;  1HZ9 A;  3K7A B;  1FJG L;  5EAY A;  4DR1 L;  1K8G A;  4ZUJ A;  1ZYR D;  1LTS D;  3R8B A;  2YU9 H;  1D8L A;  4OL7 A;  2EY5 A;  5I4D A;  3CU7 A;  5JOB A;  2WAQ G;  5FLX E;  3CCS A;  1JJ2 A;  1SN8 A;  2ALY B;  3D8G A;  5KNB A;  2F0F A;  1OXX K;  2KCN A;  5I2Y A;  4L5T A;  1MKH A;  3ERQ A;  5M3F G;  4OX9 L;  4R4C A;  2XNA C;  4OO1 G;  4JVZ A;  2JN4 A;  1YJW A;  2K5D A;  4P2C B;  4DK0 A;  4LFB Q;  2EYJ A;  1DZ1 A;  3U58 A;  4HIK A;  3M9B A;  4ZKC B;  2HQE A;  3CD6 A;  2ZT9 C;  1HNZ Q;  2F0M A;  2XGT A;  3NEL A;  3MA2 B;  4HJ9 A;  2K4K A;  4MN3 A;  3FPU B;  4LF8 Q;  4GLX A;  2PPB C;  4YWL A;  3U9O A;  2F3I A;  1PTO C;  2Q2I A;  1HNW L;  3GTK H;  5HGT A;  1PFM A;  2RBM A;  1TWC H;  4K5X A;  5HUR A;  3HOU H;  1VQ4 A;  2I46 A;  2R3Z A;  2RCN A;  2Z0S A;  3ZJY C;  4DV3 Q;  1KDC A;  1PZK D;  4PQX A;  3NP8 A;  1T5E A;  5IGG A;  5BN4 A;  4DR5 Q;  3HRZ C;  4PMW A;  1D2B A;  1KXL A;  4DV7 Q;  2D0P A;  5M5W B;  1Y8N B;  2UXB Q;  2PO4 A;  2HDL A;  4TQU S;  3KFU A;  2Q2T A;  3GTQ B;  1I6V C;  1X3Q A;  1PFS A;  1MGS A;  2RKS A;  1BVS A;  5KYI A;  2ZXP A;  2B8F A;  4RMF A;  5D65 A;  3PUV A;  4BBR H;  5BN3 A;  5FJ8 G;  4FO2 A;  4AH6 A;  4F8M A;  1F9R A;  4LFC L;  1JIC A;  5KIX A;  2MUY A;  2A68 C;  1HNX L;  2E8G A;  2RSN A;  2MO0 A;  1LM0 A;  2IHF A;  5IYC H;  4HIM A;  3CXC A;  1D5Z C;  1PH4 A;  1DOK A;  2OQ0 A;  1BBW A;  3D4D A;  1CKN B;  3K81 C;  3HOU G;  2R93 G;  4LFA L;  1DJR D;  3L7Z C;  3BVG A;  4QIW E;  1G6P A;  1O78 A;  1P8L A;  1X32 A;  5BR8 L;  2PW7 A;  1EIH A;  2WIN B;  1Y1W G;  1D1I A;  1NSN S;  4KJO A;  3NWT A;  1EYG A;  1Y1V H;  1ICF B;  2PI2 E;  2K1B A;  4HSV A;  5C4J H;  1IBM L;  2V4D A;  4JI8 L;  3KOJ A;  2KHS A;  4JI3 L;  4ZLT F;  1Y69 U;  1VQM A;  5CGK A;  2YTV A;  1NE3 A;  4JI1 L;  2MFI A;  4KHZ A;  4A93 B;  4AQY L;  3HKZ E;  1GVP A;  3RLF A;  4C3H G;  1V1O A;  2KA7 A;  2FIN B;  1U4R A;  5AJ3 L;  1FYC A;  3KLS X;  1YIJ A;  3CPF A;  2QDL A;  2CH4 W;  4DUY Q;  2XSC A;  2XTI A;  4J1M A;  1DOL A;  1KNA A;  4QMG A;  1V1Q A;  2A74 C;  4F7X A;  3I4N H;  1JR0 D;  3R93 A;  2RCF A;  4IUP A;  4J15 A;  3TEH B;  2VQE L;  3R3O A;  2C5C A;  3K0Y A;  2PMZ E;  1Y1V G;  4JCV E;  4WFN 3;  3I90 A;  4ALP A;  4A3F B;  4G7O C;  3VYU A;  4LF7 L;  2NBF A;  4KN7 C;  5C4X H;  4K0K Q;  4N8X 1;  3FKI B;  3X3N A;  3V05 A;  1UNS A;  1TWF H;  4TKO B;  3E6Z X;  2Z9H A;  4H7B A;  2GN5 A;  1XNR L;  1TY2 A;  2AMC B;  2L9H A;  3J7A V;  2CW0 C;  3GTM B;  2E2I B;  2UXC L;  2RHQ B;  2E2H H;  4DK6 C;  1SNC A;  1K8M A;  1PV4 A;  5CV8 A;  3I55 A;  1PZI D;  2BA0 A;  2EYP A;  1YI2 A;  3CAM A;  2NTT A;  3S2D B;  1Z47 A;  1SFO H;  4CHT B;  3FPP A;  1D5M C;  2K32 A;  4FXG C;  3HOX H;  4IZ8 A;  1KDB A;  3PO3 H;  1HUM A;  3OWF A;  1HH2 P;  2KEC A;  1K3R A;  2VB2 X;  5EBD A;  2DN8 A;  4EQN A;  1C9O A;  1B2T A;  1B1Z A;  3U9S A;  1RL2 A;  3GO5 A;  4B9W A;  4DXG A;  4DR3 L;  2M2L A;  5E4W C;  4XDX A;  4C2M B;  3OOC A;  1I4X A;  2F1M A;  3S2H H;  3EVQ A;  5FOB B;  3WOF A;  3K57 A;  3OW7 A;  4R4O A;  3B6Y A;  1PRT B;  2VY3 A;  3PV0 A;  3QO2 A;  4GKJ L;  4R9W A;  4R4Q A;  4LUO A;  1TS5 A;  4EGV A;  2EOT A;  2F0G A;  4KY6 A;  2UU9 Q;  2JXM B;  2CH4 A;  4MHE A;  1MIU A;  3PO3 G;  1N34 Q;  1F2M A;  1C0A A;  2A8V A;  4A3D B;  2FFK B;  1NNX A;  4OHJ A;  1A2U A;  4DR4 Q;  4AYB B;  1QJO A;  2D62 A;  1TWH B;  4JI7 L;  3WWV A;  4L5S A;  4RHS A;  5JEA H;  2KHI A;  3PIO 3;  1I4G A;  5IYD H;  3NTK A;  3R2I A;  4IPC A;  1KNE A;  3IAY A;  2GVB A;  1RJT A;  3F1Z A;  1CHQ D;  1LT6 D;  3J7A F;  4ZK9 B;  1CKN A;  4JI0 L;  3TS2 A;  1PH5 A;  1HJP A;  1B53 A;  4LF6 Q;  2EYM A;  4KD3 A;  2F0P A;  5KEE A;  2OTL A;  1V8Q A;  1STB A;  2AWO A;  2JP1 A;  1R4Q B;  2CWP A;  1IKM A;  1A2T A;  3Q6S A;  3M3Y H;  1WTR A;  4K6D A;  1FGB D;  2I07 B;  1XXG A;  2MO1 A;  1RIP A;  2UUC Q;  4A3K B;  1WCM H;  4C3J H;  2A69 C;  5JEA G;  1G91 A;  4HIO A;  1ZEQ X;  3STB C;  1I5F A;  5IYD G;  4BY7 G;  3EQL C;  1FL0 A;  1N36 L;  1SND A;  1STG A;  2D2C C;  2F0J A;  3BYT B;  3L3O C;  5E3F A;  4IOC A;  4I65 A;  1WD1 A;  3HOY H;  1JT8 A;  2F4I A;  3URY A;  3MZ5 A;  5DAU A;  2FHT A;  2AQ3 B;  4A4I A;  2KED A;  2K05 A;  5LMU Q;  3RUZ A;  3RZO B;  1AH9 A;  4EX5 A;  5C3E B;  5M5Y H;  3MEF A;  2G9H D;  1N33 Q;  4Q5V A;  1STN A;  3S1M H;  1OO9 B;  1S5C D;  1GD7 A;  3KF6 B;  1AFP A;  4X65 Q;  3PQI A;  1B70 B;  2VS1 A;  3I8Z A;  3SXH A;  5ELC A;  3PUY A;  5IYB H;  4HJ8 A;  3K5O A;  3BJU A;  1EU3 A;  1HZC A;  3VR2 A;  1SMY C;  2HIX A;  5I6Y A;  1BOS A;  3LNN A;  3IL8 A;  1E2Z A;  2B2T C;  1L2F A;  2OEO A;  2DNC A;  2K28 A;  1LO5 D;  1GUO A;  3S16 B;  3W2D A;  2PQE A;  5M3M H;  2ZXO A;  2TSS A;  2Z4I A;  1BCP F;  2WII B;  2QW7 A;  3S17 B;  1EEF D;  3NE5 B;  4RHR A;  4YHH L;  1VQI A;  1WTO A;  1B44 D;  2N78 A;  3A8I E;  3ITP A;  1LUZ A;  3PGZ A;  4AIM A;  4N8F A;  1SYF A;  4DV6 L;  3T13 A;  4A3I H;  1UE5 A;  4XQQ A;  4JC0 A;  1A62 A;  5J22 A;  1JWU D;  4PNY A;  1STA A;  4IAL A;  1KRS A;  5E7N A;  2HHH L;  2A6E C;  4KI0 A;  2CFM A;  3DWP A;  4FXK C;  1HZB A;  1B4O A;  4MTK A;  4YWM A;  1FJG Q;  2DJG C;  3H0G G;  3ULJ A;  1O7L A;  2L55 A;  3OWE B;  5M3M G;  5ELE A;  4RKL A;  2O4X A;  4LWC A;  3V96 A;  4DR6 Q;  3FDT A;  4YCW A;  4DR7 L;  2K03 A;  1S5F D;  4X3S A;  1U5K A;  4OX9 Q;  4GLA C;  3UDI A;  1A63 A;  2BE5 C;  2X6G A;  1BCP D;  4GLV B;  1VQA A;  3D6C A;  4L5Q A;  4NXM L;  3I7F A;  2E74 C;  3CCM A;  2HUG A;  1UEA B;  2KCM A;  4BY1 B;  3DMU A;  1NAP A;  1SMY D;  1QOH A;  4A3G B;  2F0H A;  1U0L A;  2UXD Q;  4A3M G;  3W5O A;  4F87 A;  4CKE A;  4HED A;  2EZV A;  4RKB A;  1OXT A;  2F03 A;  1AW7 A;  2K50 A;  2JA7 H;  1VQK A;  4GKK L;  2A5H A;  1SRU A;  1WTW A;  1IZ6 A;  2K33 A;  4FYD A;  5CV4 A;  2VQF L;  4IUN A;  2Q8T A;  2QDB A;  2B29 A;  2CVR A;  4RCO A;  4IJL A;  1VQJ A;  1F9S A;  3D6W A;  2YV5 A;  1MHW C;  2EYH A;  2N8N A;  4GN3 B;  1WYD A;  5GQO A;  3CCJ A;  3DWQ A;  1I3Q B;  5FK9 C;  3PO2 G;  3K59 A;  1HNX Q;  3F2D A;  1K83 H;  3RLO A;  5JAV A;  1VQ8 A;  1PXU A;  3S15 H;  1AE3 A;  3MXN A;  1LT3 D;  4IFD I;  1I50 B;  2ATW A;  2JA7 G;  3KLW A;  2JE6 I;  3K58 A;  3HOV G;  5ISR A;  5IOC A;  1TT2 A;  3LWE A;  4B3M L;  4POF A;  4QUC A;  1IBM Q;  4DXF A;  2QA4 A;  2JA8 H;  4JI8 Q;  2WP8 J;  3DUZ A;  4GOP A;  2EJG C;  2HD3 A;  3K5L A;  3J7Z C;  4B3R L;  5AFW A;  4JI1 Q;  3TME A;  3KF6 A;  4AQY Q;  2Q2U A;  1K9M C;  1KRT A;  2Q8R E;  1Y8O B;  3NHH A;  5T1G A;  1EY8 A;  1HHV A;  1SE4 A;  2F4V Q;  4A3B H;  4OWT B;  2VB3 X;  2NVY B;  1JQY D;  3CRK C;  3LWU A;  5C4Z A;  1SSO A;  5FKA C;  2JEA I;  2YU9 B;  3HG9 A;  2SEB D;  1S5D D;  2NVQ H;  2JA8 G;  3FHW A;  2L12 A;  3A8K E;  3U4V A;  4KHP L;  1RDP D;  4LF7 Q;  4K8J A;  2BDN A;  4PZ7 A;  1RHP A;  1II3 A;  2KVM A;  2Z8L A;  2Z6K A;  4B3T L;  3T56 B;  2K5N A;  2B2U A;  1IXR A;  1JOO A;  1PH2 A;  3CF5 A;  2OTJ A;  2B2W C;  2EQS A;  1BUV T;  2J7Z A;  2E76 C;  3GTK B;  2QIL A;  5C0X I;  4X3K A;  1Q90 A;  1TWC B;  2N49 A;  3RR5 A;  5GAG C;  3Q24 A;  5T1I A;  4UAI A;  2K04 A;  4UP9 A;  3F8T A;  2M9V A;  3QR8 A;  4LF5 L;  4K5V A;  1ET6 A;  1PFB A;  4IFD J;  3MEH A;  4NB3 A;  2R7Z H;  3NBI A;  4DAV A;  3VR4 A;  4BBR B;  4U67 3;  3HEJ A;  3SK8 A;  4J6H A;  4YIJ A;  2VUM G;  1LAB A;  1LT4 D;  4DR3 Q;  1W2B A;  4KJN A;  2C35 B;  5NUC A;  2MP1 A;  3KDF B;  2X69 A;  3QIA A;  4GKJ Q;  5JPM C;  5E1F A;  2B63 H;  5A2Q E;  3K5M A;  2ICI A;  3D4R A;  1Z7T A;  3NQI A;  1IBK L;  1CZG A;  1DGS A;  3C1F A;  4KKT A;  4OO1 H;  5C4J B;  4X64 L;  3S14 H;  1IYU A;  2HCI A;  2HQL A;  2RQX A;  4V0B A;  2KOL A;  2KUM A;  5KYL A;  1ESF A;  5C5M A;  3P1H A;  1TWG H;  1T9H A;  1R9T H;  5IP9 G;  4WOR A;  4JI6 L;  4G7Z C;  1G8Z D;  4HCE A;  4XIG S;  3TBI B;  5LMN Q;  2I5L X;  2Q2H A;  1MJE A;  2XIW A;  1SNP A;  4IPG A;  3OPO A;  3F2C A;  2N55 A;  3E9H A;  1X54 A;  3I4N B;  1NMG A;  2B63 G;  2L4N A;  1XMO L;  2DGY A;  5EKL A;  3D4W A;  4KK7 A;  4MZ9 A;  1V9P A;  1ESR A;  2JA6 G;  3L9A X;  1YVC A;  1X55 A;  3PF5 A;  5M5X B;  5FO7 B;  1STH A;  5ELD A;  1S5B D;  5FJ8 H;  5C4X B;  5ELB A;  5C0X J;  4RGT A;  2EY2 A;  1C4Q A;  2K5Q A;  3UDG A;  1TWF B;  1H9K A;  5IIF A;  2LXK A;  1AZQ A;  2WB1 B;  2R7D A;  3VDY A;  4RFB A;  4DV2 L;  3CQZ H;  3QOJ A;  1JWM D;  1LYL A;  1YJ9 A;  2E2H B;  5CC4 A;  2UUB Q;  2R93 H;  3BYY B;  4DR2 Q;  1AEX A;  3X3M A;  1KAW A;  1IL8 A;  1Y1W H;  1VQ9 A;  2X6L A;  1RKN A;  1EYD A;  2VZA A;  4DV4 Q;  4YY3 L;  3GQB A;  1RD9 D;  1I94 L;  4DV5 L;  1PFN A;  1SFO B;  5GRO A;  4H44 C;  3PUZ A;  3TSS A;  1PTO F;  2F0L A;  3I4M H;  3CCE A;  2O2L D;  1HFG A;  3TZU A;  4A76 A;  3A74 A;  1SXT A;  5C44 G;  1TII D;  3HOX B;  1ASY A;  4CDC C;  3FRP B;  1CQV A;  1JE5 A;  2IT1 A;  3BDO A;  1MD2 D;  3FP9 A;  4C3H H;  2ZM6 Q;  1KIX A;  4B3S Q;  4X62 Q;  5HY6 A;  1GM5 A;  3MXP A;  4BBS G;  2Q8I B;  3Q0A A;  1FNW A;  3CME A;  3F2U A;  1TWA H;  3SR1 A;  1BKB A;  2RSO A;  1O80 A;  4CDF C;  1KDA A;  1YNN C;  4LK1 C;  1XJV A;  3A7A B;  1SMX A;  1A8V A;  1VQF A;  3S2H B;  5CBA E;  1VQ5 A;  1HXY D;  1VCI A;  4FNF A;  1EFW A;  1A0I A;  4GZY C;  2YTY A;  2IW3 A;  1LAC A;  4C3I H;  3I4M G;  4JV5 L;  1KC8 C;  1ICW A;  1HFN A;  1L1O C;  3KBG A;  5JJZ A;  4IN3 A;  4YCV A;  1SNO A;  2YTX A;  4A3E H;  3OW2 A;  5CV9 A;  3HOW G;  1PTO D;  5JJK A;  4DV6 Q;  2M00 A;  4IUT A;  3J81 L;  1K0S A;  2WFW A;  1IW7 C;  2OXP A;  4UP8 A;  5EJW A;  5J1Z A;  1IBL L;  2NVT B;  1GHK A;  1ZXT A;  1RTN A;  2HHH Q;  3GTP H;  1OXU A;  4EQ5 A;  1IL2 A;  3KDF A;  4X66 L;  4JW0 A;  1YNJ C;  1VMC A;  1BCP B;  1CUK A;  4HJA A;  1EQQ A;  4NXN Q;  3MC0 B;  4C3I G;  1OXS C;  5LHY 1;  1S72 A;  3D0F A;  3U50 C;  4P73 A;  5FLM H;  4DPG A;  2FMM A;  3D31 A;  1PHJ A;  2JJQ A;  3RN5 A;  4DR7 Q;  3VYT A;  1TY0 A;  3CCU A;  1CTM A;  4Y7N H;  4A3E G;  1D5X C;  4DA2 A;  4YWK A;  1J5E Q;  1HRJ A;  2A68 D;  2AWN A;  1W3S A;  3PUW A;  4UDU C;  3OHX C;  1JOK A;  1WCM B;  1JCK B;  1IHZ A;  4KN4 C;  3CRL C;  1FNV A;  2H4O A;  4C3J B;  1HCZ A;  1MSH A;  1TS3 A;  1YNN D;  4KY7 A;  4HN7 A;  3BVM A;  4FXD A;  4K6L A;  3KBX A;  5KND A;  5EGT A;  3DEP A;  2I0Q A;  3G71 A;  1CT1 D;  3J7Y W;  1TR5 A;  3FVQ A;  4G4K A;  4GS3 A;  3HOY B;  1X6O A;  1DM0 B;  3ER0 A;  4K5W A;  2IHE A;  5FLM G;  4OWW B;  5EBC A;  2AHO B;  4PZ8 A;  1WTV A;  3T1Y L;  3A5Z B;  3CCV A;  3P7J A;  3C46 A;  3HKZ G;  5IT9 c;  2PI2 A;  3DWA A;  5E4X A;  2NZH A;  1DOM A;  5IGD A;  3BZD B;  1QZH A;  1GUT A;  3T1H L;  2K5W A;  5M5Y B;  3ULL A;  2DNE A;  1EY0 A;  4PZ6 A;  3S1M B;  5IGE A;  4OON A;  1C48 A;  3M85 A;  3TP8 A;  1JJC B;  1SYG A;  1EYA A;  2NZO A;  1E0B A;  4ODG A;  2L1B A;  1QIL A;  4R1J A;  3IFD A;  3K0X A;  1Q46 A;  1Q1E A;  4DV1 L;  3MHB A;  2J4X A;  4JI5 Q;  1X3G A;  4P72 A;  4GNX C;  2KCC A;  4Q0F A;  4GN4 B;  5I2X A;  4APV A;  4IPH A;  4I7A A;  4IO9 A;  1I4P A;  3G4S A;  5IWA L;  4HMI A;  3NQT A;  3DXJ C;  2NWG A;  4PG3 A;  2EIF A;  2CW0 D;  1WTX A;  4B3R Q;  4OIK A;  3EN2 A;  3J81 E;  1U9R A;  2WKC A;  2B3G A;  1SYB A;  1H95 A;  3PUX A;  1WJJ A;  1QVG A;  1F77 A;  4BY7 H;  3Q22 A;  1F9P A;  4A3I B;  1E7Z A;  2DY8 A;  1EL0 A;  1IKL A;  2IY5 B;  3A0J A;  4ULL A;  1SYE A;  1WOC A;  2QKI C;  1XYI A;  1B50 A;  1E3P A;  1R4P B;  1AE2 A;  1STY A;  3BZK A;  3S9W A;  3GTL H;  1ILQ A;  1W6K A;  2EY1 A;  4QY7 A;  3ULP A;  4LF9 L;  3E9I A;  3ONA B;  1QNU A;  4G57 A;  3TRZ A;  2OWO A;  2XRS D;  1D1K A;  1X3P A;  1BF4 A;  4O2D A;  4B08 A;  3ND9 A;  4LJZ C;  5A35 A;  2PZT A;  4DU9 A;  3FMC A;  5COR A;  2ICE C;  3MFG A;  3CCL A;  4JI2 Q;  1NBW A;  5EPJ A;  2I5H A;  1F2L A;  3C1E A;  2RDH A;  1HR0 Q;  4DUZ Q;  1X65 A;  4C1N K;  4A93 G;  4O42 A;  3SHL A;  1FR3 A;  3FKI H;  4CKB A;  4LFB L;  1EEI D;  4KV6 A;  1N32 L;  3I3C A;  3AU7 A;  4X3T A;  3MXN B;  3DM1 A;  4JBW A;  1DXM A;  1MJC A;  1ROD A;  4CJ2 C;  1VQG A;  4LF8 L;  2NZ1 D;  2OT2 A;  3KK7 A;  1JB7 A;  5LL6 X;  1V43 A;  4LF4 L;  4GOP B;  4I7Z C;  3TP5 A;  5CBE E;  2P5Z X;  3E5S A;  2B2T A;  3P75 A;  2VNU D;  2CQO A;  1WI5 A;  3MFY A;  1JC7 A;  5JEA J;  5LL6 S;  4AYB E;  3FKI G;  1JMC A;  2UXB L;  1G2S A;  4DNT B;  4MTN A;  2E5L Q;  5IOD A;  4JYA Q;  3A55 A;  2LXJ A;  2D9U A;  1Q8K A;  1OTC A;  1K83 B;  3TP6 A;  3BU2 A;  4A3C H;  3H0G H;  5M9O A;  1PMR A;  3S15 B;  1EQV A;  2NN6 I;  1G29 1;  1YZ6 A;  4QUF A;  4PV1 C;  1U4M A;  4C2M H;  4L6T B;  3G6E A;  4N9P A;  2QEX A;  4A3J B;  4MNO A;  2MHV A;  3EIV A;  1EY9 A;  1HQR D;  3AQQ A;  1GUW A;  1OXV A;  2A69 D;  2MJ8 A;  3V2T A;  1D6E C;  4QB4 A;  2E2J H;  3STB D;  5LMN W;  4JBK A;  1X3F A;  1H9R A;  3VYR A;  2JA8 B;  2FJ2 A;  1WVL A;  3CKI B;  1HA6 A;  2L5T A;  4A3D H;  1SE8 A;  3CC7 A;  1BXT A;  3ZYY X;  3N52 A;  2PNR C;  1PH3 A;  3IKJ A;  1PVO A;  1TS4 A;  1ET9 A;  1PYB A;  4A3M H;  3WDN A;  1GJX A;  3J81 c;  1Q3L A;  4DR1 Q;  4DN4 M;  1Z6H A;  4A3C G;  3RZD H;  4A3B B;  1X9N A;  1JJG A;  2F0U A;  5TSS A;  3LX0 A;  4DUY L;  2H5X A;  1SNM A;  4FP5 D;  1QCB D;  1L0W A;  5JVG 3;  3S1N B;  2NVQ B;  1EIG A;  4P71 A;  4RA8 A;  1JE4 A;  3CC2 A;  2PCF B;  1W6J A;  4XXE A;  1EWH A;  2ZJQ A;  2N3S A;  3H91 A;  3KF8 B;  1ML0 D;  4KLK A;  4A3D G;  2PZW A;  3NWS A;  4AYB G;  2F0I A;  3JAM L;  3R2T A;  2CWA A;  4DV0 L;  2EYL A;  2BDO A;  4ZCK A;  3PO2 H;  4FF4 A;  1HNW Q;  1BDO A;  4C1N I;  3M4O B;  5DNF A;  4ME3 A;  1PRT C;  4HCS A;  4QJF A;  1GOZ A;  1SE3 A;  1YEZ A;  3HOV H;  2NN6 G;  2R92 B;  3UE1 A;  3J81 j;  3GTG H;  2ZJR A;  3OIP A;  2B2V C;  2YYZ A;  2BH2 A;  4DV5 Q;  4CGY B;  3HP3 A;  2ZTC A;  1TVX A;  1Q86 C;  1Z9F A;  1EOT A;  3QWN A;  2CCZ A;  3RZO H;  4OIJ A;  3NTI A;  2L15 A;  2O5I C;  2A6E D;  2F0S A;  1WTQ A;  4LFC Q;  4A3K G;  3Q23 A;  1PYS B;  1EWC A;  1K3B C;  2R7Z B;  4H13 C;  5ELF A;  5ELO A;  4U68 A;  1Q7Y C;  1AN8 A;  2BOS A;  3W1G A;  2BA1 A;  2NVX H;  4KHV A;  4LFA Q;  1Q12 A;  3TRE A;  4BA2 I;  5BR8 Q;  3TS0 A;  1QUQ B;  3IFT A;  2JSO A;  1PTO B;  2Y0S E;  1I6H H;  2BE5 D;  2RF4 A;  3O13 A;  2WAQ B;  4JI3 Q;  3RMH A;  4LUV A;  4ZRZ A;  1CQF A;  3AMU A;  5M3F B;  1CKM A;  1EQT A;  2D5D A;  4BWG B;  5C3E G;  1HTP A;  2Z1C A;  3QB3 A;  5AJ3 Q;  3S14 B;  3GDE A;  2PW5 A;  1N34 L;  1AZP A;  4RCN A;  1ENA A;  3K8A A;  5CV7 A;  2A19 A;  2KCT A;  4IUR A;  4DK3 C;  1CK1 A;  3A54 A;  3M4Q A;  4DR4 L;  1SR3 A;  3S1R B;  1PDQ A;  1TWG B;  2HT1 A;  1TXY A;  3S24 A;  1R9T B;  1SLJ A;  3G6J B;  2XWB B;  1J6Q A;  4X66 Q;  1L0X B;  2E2D C;  2VQE Q;  1QE6 A;  1DYQ A;  2ASB A;  2DY7 A;  3EBE A;  1UAP A;  2B2W A;  2A6H C;  1EZ8 A;  1BO0 A;  2ID0 A;  1JOQ A;  1ENC A;  5CYU A;  1XNQ L;  4IPD A;  3K6O A;  2F3W A;  3CCQ A;  4LF6 L;  5I6W A;  3S1Q H;  4KKU A;  3H3V I;  4OXP A;  4KTA A;  1XNR Q;  4NPS A;  3CCR A;  3K80 C;  1CA5 A;  2JA5 H;  1EZ6 A;  1B9N A;  2UXC Q;  5FLX L;  3GV3 A;  4K8I A;  4DAM A;  1EY4 A;  1CHP D;  1L1O B;  3SE0 A;  2UUC L;  2VUM H;  4RGO S;  4XT3 B;  1CSP A;  1ENF A;  4K14 A;  4IFD G;  1PH6 A;  2KEN A;  5IT9 L;  4TSS A;  4HR7 B;  5CR3 A;  3BDL A;  1UWV A;  3HOU B;  3HZX A;  2Y0S G;  1JWS D;  2R93 B;  1FNU A;  3KJO A;  3TP7 A;  1Y1W B;  2QGQ A;  1LTI D;  1XMQ L;  3T1Y Q;  1YHQ A;  2F3V A;  1E2W A;  4QF4 A;  2B2Y C;  4CBV A;  2HIV A;  1NUC A;  3KF8 A;  1BQQ T;  3I4M B;  2LKV A;  4WJ3 M;  5LMU L;  2JA5 G;  4FF3 A;  1EUJ A;  2MPM A;  3MVV A;  1YIT A;  3KUP A;  4C3H B;  5IP9 H;  3BVZ A;  1N33 L;  2RDF A;  5CV6 A;  4CJ1 B;  2VL6 A;  1BBX C;  3NK9 A;  4BY1 G;  1TWA B;  3BZC A;  2IX1 A;  1FVI A;  4X65 L;  2UUA L;  4A3G G;  5DLQ E;  1D7Q A;  1VQH A;  3GTJ H;  3EFX D;  1A3U A;  2NYZ D;  1GUN A;  1T5X D;  1LTB D;  1PYW D;  1Y1V B;  1IYV A;  4XTC S;  1I50 H;  2JA6 H;  3MXG A;  3RD4 A;  3J80 c;  1EFI D;  1H9S B;  1KAA A;  4LUZ A;  4JI7 Q;  4KY5 A;  2QCP X;  1NR4 A;  5EPL A;  1S40 A;  2K5H A;  4XYQ A;  4B9X A;  5C3X A;  1A3V A;  5C6A A;  2SDF A;  1O7I A;  1SJE D;  4RGN A;  5BN5 A;  5HGQ A;  4JI0 Q;  4XQN A;  2F52 A;  5C0X G;  1LTT D;  3H94 A;  4RAU C;  3GTP B;  1QUQ A;  3HFZ B;  4QIW B;  3W3A A;  4ZKB B;  2XWJ B;  1I4R A;  2K52 A;  4ZUI A;  2F0T A;  3GV6 A;  1HR0 W;  2KEE A;  1VS0 A;  1VQ6 A;  1UE7 A;  4RG1 A;  1XTC D;  1F2Z A;  2EJM A;  1S5E D;  4KD4 A;  5C44 H;  1ASZ A;  2EY6 A;  1HUN A;  1KL9 A;  4GNX B;  1SE2 A;  3MWY W;  4GN5 A;  3HKZ B;  4JK1 C;  4Y7N B;  5I9P A;  4DR6 L;  3OTO L;  2WAC A;  3G7L A;  3UDX A;  1YJN A;  5FO9 B;  1N36 Q;  4JI4 L;  4BBS H;  1ILP A;  2QF7 A;  1Y14 B;  4MIU A;  1EIY B;  1S4Z A;  4QGU A;  3SGI A;  4R4T A;  5IT9 E;  3JAM c;  3PIO A;  1N32 Q;  1YHA A;  1AP0 A;  2J0T D;  2SNS A;  1EY7 A;  1SYD A;  3KLR A;  2PMZ B;  1VMP A;  3VYS A;  2UXD L;  3NEM A;  4O0A A;  4DK1 A;  1CM9 A;  3CW2 C;  3TN2 A;  5L37 A;  3AFQ A;  1M1K C;  2ZTE A;  3GP7 A;  3GTO H;  4LF4 Q;  4A75 A;  3PO3 B;  1UE1 A;  3PIP A;  4XQJ A;  3T51 B;  1KLG D;  3HOW H;  4TRD A;  1I4H A;  2A1A A;  1DON A;  3HOZ H;  4FVM A;  4L8J A;  3MAQ A;  2K7V A;  2XVS A;  1L1O A;  3DLL A;  3CHB D;  1U4L A;  3SDZ A;  2JEB I;  4JG2 A;  4FF2 A;  4DAP A;  4G7H C;  2K14 A;  5DEH A;  1G6Z A;  3CC4 A;  2ZJP A;  1RCV D;  3JC6 6;  2ENB A;  1FGU A;  1NR2 A;  4YHH Q;  1XWE A;  2Z6B A;  3C2P A;  1S3O A;  2LY7 A;  2PQA B;  1GUG A;  4ZYS A;  3FEW X;  3PSI A;  4OWX B;  3HOZ G;  4QQB X;  3HS0 C;  3T16 A;  3F2B A;  1B9M A;  3NXW A;  2OCE A;  4DAY B;  4BY7 B;  1LLR D;  4BBR G;  3P20 A;  4DFA A;  4UPA A;  2CHB D;  1HQM C;  3BDC A;  2WB1 E;  5IE8 A;  3K7A H;  5IYC G;  1B3Q A;  3GTL B;  1E24 A;  3OIQ A;  5CV5 A;  2F4V L;  1QVC A;  4IUV A;  4OEM B;  3M3Y B;  1O7Y A;  1H9S A;  2GA4 B;  4NXM Q;  3NEN A;  4QL5 A;  4JBJ A;  4EQO A;  1C8C A;  4BS9 A;  4DV0 Q;  5M5X H;  1HTL D;  3I91 A;  5DM7 3;  4L63 B;  1LTR D;  3UDF A;  1N9W A;  5F2D A;  5FLX c;  1VQC A;  1SRO A;  1F9Q A;  3DEO A;  4GKK Q;  3TZD A;  3A8J E;  1SAP A;  2R6G A;  1XTD A;  1KQS A;  3AYH B;  1YHB A;  2VQF Q;  4IUQ A;  1CKO A;  3I4N G;  4POG A;  3CPW A;  2EYF A;  1PZJ D;  4GNX A;  1IYJ B;  1IW7 D;  3VA5 A;  1J9O A;  2K6A A;  2LSS A;  2R61 A;  5M5W H;  2MNA A;  1Q82 C;  1VQB A;  3GTQ H;  1K8O A;  5GAH C;  3CP0 A;  1ZKO A;  2JQO A;  4IUU A;  1KAB A;  1YNJ D;  2NB0 A;  3GD7 A;  3J81 i;  5C4X G;  2OQK A;  3PF4 A;  1GXD C;  4C56 C;  3UI2 A;  4DNI A;  1EQR A;  2IPK D;  3SK4 A;  3UE0 A;  2LS0 1;  1NJI C;  4X6A H;  2WB1 G;  4LW1 A;  1N8R C;  1XX8 A;  1O7Z A;  1WD0 A;  4X3U A;  4HMJ A;  4PMB A;  3OSO A;  3H0G B;  4B3M Q;  1K73 C;  2KHJ A;  4EQP A;  5IP7 H;  1CZW A;  1QWY A;  4S3S A;  5M3M B;  1A15 A;  1M8A A;  2O5J C;  4BA1 I;  1NTG A;  1PH1 A;  2K01 A;  5COY A;  4HAE A;  5CMD A;  2JYO A;  5JVH 3;  2G9D A;  4HTH A;  5ELN A;  1PA6 A;  2E2J B;  1G51 A;  1Q81 C;  1SNQ A;  3K7U C;  1FD7 D;  4ID6 A;  3HOX G;  2ES2 A;  2F0O A;  2RVL A;  3QOL A;  4A93 H;  1SBB B;  4TVA B;  1K28 A;  2EPB A;  3NBH B;  1BNZ A;  2AKW B;  4A3M B;  1SEB D;  4OGQ C;  4DNR B;  2NVT H;  1QZG A;  1YBY A;  3I56 A;  4V19 0;  2K75 A;  3OYY A;  3RZD B;  5IP7 G;  1UE6 A;  1PH9 A;  3DM3 A;  3QJY A;  4HJ5 A;  1UEB A;  4HID A;  3CMA A;  4KHP Q;  5LMN L;  4XT1 B;  2I5M X;  1XNQ Q;  2PQA A;  4A3F H;  4H0L C;  4B3T Q;  1WFQ A;  4N9T A;  1YNX A;  1L0Y B;  2B8G A;  4Y52 H;  1I4Q A;  2VXW A;  4A3L H;  1LT5 D;  2IJ0 A;  5JJI A;  4XYO A;  3PIP 3;  2SOB A;  4DAY A;  2AUK A;  4QCL A;  1CI3 M;  2V1C C;  2NTS A;  5J3B A;  1SYC A;  3TDQ A;  1HNZ L;  3PO2 B;  2D0O A;  2E2I H;  3GTM H;  3OMC A;  1RF2 D;  2CKZ B;  1C7Y A;  1P16 A;  3H09 A;  3MTS A;  3I73 A;  2JA7 B;  3I72 A;  1E22 A;  1PH8 A;  3HOV B;  2JA9 A;  1TKW B; 
#chains in the Genus database with same CATH homology
 1VDZ A;  3K5N A;  2IL8 A;  1F2Y A;  1SJH D;  2TMP A;  3GTG B;  1CFM A;  1KLU D;  1ONL A;  1SDF A;  2EJF C;  2F0D A;  5C5L A;  3HGB A;  1TQO A;  1HPC A;  1B3A A;  4ME5 A;  3MXU A;  1BR9 A;  4ZQ3 A;  3PMF A;  4C3J G;  2LMC B;  2EXZ A;  1DCZ A;  3J80 L;  2RDG A;  2XRQ D;  2NVX B;  1BCP C;  3C3L A;  4WJW A;  5EPK A;  5D3I B;  4K2K A;  1A6X A;  1I6H B;  4O1N A;  3EJI A;  2F0W A;  5G3L F;  3QG1 A;  3D3R A;  3VR5 A;  2WKD A;  1JB3 A;  3WOE A;  4Z9C B;  4IQZ A;  5KNC A;  4M1U B;  1NCV A;  1Y8P B;  1EY5 A;  3SEB A;  5C4H A;  1LV9 A;  5IGF A;  3A56 A;  1U4P A;  1QNK A;  1Q8I A;  2A73 B;  2F0Q A;  1UUP A;  5D3D A;  2HDM A;  5EKK A;  1TS2 A;  2NN6 H;  1QB5 D;  1PLF A;  1VF7 A;  2H1E A;  1LTA D;  4PMC A;  4E6I A;  3VR3 A;  5IGB A;  3M7N A;  1MSG A;  1GUS A;  4DF7 A;  4RWS C;  2Y0S B;  2F0V A;  4WRD A;  4RGM A;  1WTP A;  2BCO A;  3DHQ A;  2B2V A;  4R8I A;  4KKS A;  3S1Q B;  5G3L D;  2WV6 D;  3NPP A;  2JA5 B;  3N6R A;  3NBH A;  4DGZ A;  2F0E A;  2VUM B;  3EA6 A;  2EVB A;  2AUJ D;  5DM6 3;  3BG3 A;  1KTK A;  4KMU C;  1H9M A;  4F88 A;  3VA7 A;  1RTO A;  4ZAI A;  2IX0 A;  4NP5 A;  1PRT F;  1A3T A;  2EYO A;  3I70 A;  3NUC A;  1V1P B;  3SVM A;  1E2V A;  2N88 A;  1J8I A;  3ND8 A;  1HA5 A;  2SNM A;  3J80 E;  2E75 C;  2B39 A;  4NKL A;  3OMG A;  4RH6 A;  1H9J A;  3AB9 A;  5KRU A;  2FMC A;  3GTJ B;  5IGC A;  4NDX A;  5K36 H;  2B63 B;  2IWH A;  2PZU A;  4HSP A;  2JA6 B;  2QEJ C;  3T4A C;  1MBY A;  3T53 B;  4EVO A;  2Z4H A;  1PRT D;  2L0C A;  5A2Q L;  2MGS A;  3BS1 A;  4IFD H;  3H6M A;  2AQ1 B;  5I9O A;  1STE A;  3ERO A;  5K36 G;  2KQ3 A;  3KLS A;  5J39 A;  2ZXR A;  3JAM E;  5C44 B;  2LFN A;  1EYC A;  2B2Y A;  1CA6 A;  4BBS B;  4NMZ A;  3CQZ B;  3VR6 A;  2KJX A;  4ILW A;  4R8N A;  5EKI A;  2NUC A;  5K5P A;  4J8Q A;  2PYK A;  3SK5 A;  5D14 A;  3GTO B;  1M4V A;  4LAA A;  1ZYR C;  2B2U C;  1EY6 A;  4CJ0 B;  1MI2 A;  2OF1 A;  4CKC A;  3HOW B;  1DD2 A;  1Q1B A;  4OO1 I;  1EU4 A;  3M7G A;  3HOZ B;  4FF1 A;  5FO8 B;  2A6H D;  5C0X H;  2EE1 A;  2RA4 A;  4ABN A;  3NTH A;  5JPN C;  2CQA A;  2F0K A;  1LTG D;  3M4Y A;  4C3I B;  1PTO H;  3SK6 A;  1VF5 C;  3NSW A;  4LMQ D;  5EQ0 A;  3A7L A;  4A3E B;  2C9O A;  2EDG A;  1JOR A;  1TU2 B;  1V1P A;  4K2L A;  2AQ2 B;  5KGU A;  1QG7 A;  3E0J A;  2XN9 C;  5C3W A;  4NW2 A;  3I4L A;  2IX3 A;  2F0N A;  2HCC A;  2L11 A;  1G2T A;  4M8A A;  3H3V C;  1GHJ A;  3K7A B;  4ZUJ A;  1ZYR D;  1LTS D;  3R8B A;  4OL7 A;  2EY5 A;  5I4D A;  3CU7 A;  5JOB A;  5FLX E;  3D8G A;  5KNB A;  2F0F A;  1OXX K;  2KCN A;  5I2Y A;  3ERQ A;  2XNA C;  4OO1 G;  2K5D A;  4DK0 A;  4P2C B;  2EYJ A;  1DZ1 A;  4ZKC B;  2HQE A;  2ZT9 C;  2F0M A;  3MA2 B;  4MN3 A;  3FPU B;  2PPB C;  3U9O A;  1PTO C;  5HGT A;  1PFM A;  2RBM A;  4K5X A;  5HUR A;  2I46 A;  2R3Z A;  1KDC A;  1PZK D;  4PQX A;  3NP8 A;  1T5E A;  5IGG A;  5BN4 A;  3HRZ C;  4PMW A;  1D2B A;  5M5W B;  1Y8N B;  2PO4 A;  2HDL A;  4TQU S;  3GTQ B;  1I6V C;  1X3Q A;  1MGS A;  2RKS A;  5KYI A;  2ZXP A;  2B8F A;  5D65 A;  3PUV A;  5BN3 A;  4FO2 A;  4F8M A;  1F9R A;  1JIC A;  5KIX A;  2MUY A;  2A68 C;  2RSN A;  1D5Z C;  1DOK A;  3D4D A;  1DJR D;  3L7Z C;  3BVG A;  1O78 A;  1X32 A;  2PW7 A;  1EIH A;  2WIN B;  1D1I A;  1NSN S;  4KJO A;  3NWT A;  2K1B A;  4HSV A;  2V4D A;  2KHS A;  4ZLT F;  1Y69 U;  5CGK A;  4KHZ A;  4A93 B;  3RLF A;  4C3H G;  1V1O A;  2KA7 A;  2FIN B;  1U4R A;  1FYC A;  3KLS X;  2XSC A;  4J1M A;  1DOL A;  1KNA A;  4QMG A;  2A74 C;  4F7X A;  1JR0 D;  3R93 A;  4IUP A;  3R3O A;  2C5C A;  3K0Y A;  4WFN 3;  3I90 A;  4A3F B;  4G7O C;  3VYU A;  2NBF A;  4KN7 C;  3FKI B;  3X3N A;  3V05 A;  1UNS A;  4TKO B;  3E6Z X;  4H7B A;  1TY2 A;  2L9H A;  3J7A V;  2CW0 C;  3GTM B;  2E2I B;  1SNC A;  1K8M A;  5CV8 A;  1PZI D;  2BA0 A;  2EYP A;  2NTT A;  3S2D B;  1Z47 A;  4CHT B;  3FPP A;  1D5M C;  2K32 A;  4FXG C;  4IZ8 A;  1KDB A;  1HUM A;  3OWF A;  2KEC A;  2VB2 X;  5EBD A;  2DN8 A;  4EQN A;  1B2T A;  1B1Z A;  3U9S A;  3GO5 A;  4B9W A;  4DXG A;  2M2L A;  5E4W C;  4XDX A;  4C2M B;  3OOC A;  1I4X A;  2F1M A;  3EVQ A;  5FOB B;  3WOF A;  3K57 A;  3OW7 A;  1PRT B;  3PV0 A;  3QO2 A;  4R9W A;  1TS5 A;  4EGV A;  2EOT A;  2F0G A;  4KY6 A;  2JXM B;  4MHE A;  1F2M A;  4A3D B;  2FFK B;  4OHJ A;  1A2U A;  4AYB B;  1QJO A;  2D62 A;  1TWH B;  4RHS A;  5JEA H;  3PIO 3;  1I4G A;  3NTK A;  3R2I A;  1KNE A;  3IAY A;  1RJT A;  1CHQ D;  1LT6 D;  3J7A F;  4ZK9 B;  1B53 A;  2EYM A;  4KD3 A;  2F0P A;  5KEE A;  1V8Q A;  1STB A;  2AWO A;  2JP1 A;  1R4Q B;  1IKM A;  1A2T A;  3Q6S A;  1WTR A;  4K6D A;  1FGB D;  2I07 B;  1XXG A;  4A3K B;  2A69 C;  5JEA G;  1G91 A;  1ZEQ X;  3EQL C;  1SND A;  1STG A;  2D2C C;  2F0J A;  3BYT B;  3L3O C;  5E3F A;  4I65 A;  1WD1 A;  2F4I A;  3URY A;  3MZ5 A;  5DAU A;  2FHT A;  2AQ3 B;  2KED A;  2K05 A;  3RUZ A;  3RZO B;  5C3E B;  2G9H D;  4Q5V A;  1STN A;  1OO9 B;  1S5C D;  1AFP A;  3I8Z A;  3SXH A;  5ELC A;  3PUY A;  3K5O A;  1EU3 A;  3VR2 A;  1SMY C;  5I6Y A;  1BOS A;  3LNN A;  3IL8 A;  1E2Z A;  2B2T C;  2OEO A;  2DNC A;  2K28 A;  1LO5 D;  1GUO A;  3S16 B;  3W2D A;  2PQE A;  2ZXO A;  2TSS A;  2Z4I A;  1BCP F;  2WII B;  3S17 B;  1EEF D;  3NE5 B;  4RHR A;  1WTO A;  1B44 D;  3A8I E;  3ITP A;  1SYF A;  3T13 A;  4XQQ A;  5J22 A;  1JWU D;  4PNY A;  1STA A;  4IAL A;  2A6E C;  4KI0 A;  3DWP A;  4FXK C;  1B4O A;  1O7L A;  2L55 A;  3OWE B;  5ELE A;  4RKL A;  2O4X A;  3V96 A;  3FDT A;  2K03 A;  1S5F D;  4X3S A;  2BE5 C;  2X6G A;  1BCP D;  3D6C A;  2E74 C;  2HUG A;  1UEA B;  4BY1 B;  3DMU A;  1NAP A;  1SMY D;  1QOH A;  4A3G B;  2F0H A;  4F87 A;  4CKE A;  4HED A;  2EZV A;  4RKB A;  1OXT A;  2F03 A;  1AW7 A;  2A5H A;  1WTW A;  2K33 A;  4FYD A;  5CV4 A;  4IUN A;  2Q8T A;  2QDB A;  2CVR A;  4RCO A;  1F9S A;  3D6W A;  2EYH A;  3DWQ A;  1I3Q B;  5FK9 C;  3K59 A;  5JAV A;  1PXU A;  3MXN A;  1LT3 D;  4IFD I;  1I50 B;  2JE6 I;  3K58 A;  5ISR A;  5IOC A;  1TT2 A;  3LWE A;  4QUC A;  4DXF A;  2WP8 J;  3DUZ A;  2EJG C;  3K5L A;  5AFW A;  3TME A;  2Q8R E;  1Y8O B;  3NHH A;  5T1G A;  1EY8 A;  1HHV A;  1SE4 A;  2VB3 X;  2NVY B;  1JQY D;  3CRK C;  3LWU A;  5C4Z A;  1SSO A;  5FKA C;  2JEA I;  2YU9 B;  3HG9 A;  2SEB D;  1S5D D;  2L12 A;  3A8K E;  1RDP D;  4K8J A;  2BDN A;  1RHP A;  1II3 A;  2KVM A;  2Z8L A;  3T56 B;  2B2U A;  1JOO A;  2B2W C;  1BUV T;  2J7Z A;  2E76 C;  3GTK B;  2QIL A;  5C0X I;  4X3K A;  1Q90 A;  1TWC B;  3Q24 A;  5T1I A;  4UAI A;  2K04 A;  2M9V A;  4K5V A;  1ET6 A;  1PFB A;  4IFD J;  3MEH A;  3NBI A;  4DAV A;  3VR4 A;  4BBR B;  4U67 3;  3HEJ A;  3SK8 A;  4J6H A;  4YIJ A;  1LAB A;  1LT4 D;  4KJN A;  5NUC A;  2MP1 A;  2X69 A;  3QIA A;  5JPM C;  5E1F A;  5A2Q E;  3K5M A;  2ICI A;  3D4R A;  1Z7T A;  3NQI A;  1CZG A;  3C1F A;  4KKT A;  4OO1 H;  5C4J B;  1IYU A;  2HCI A;  2RQX A;  4V0B A;  2KOL A;  2KUM A;  5KYL A;  1ESF A;  5C5M A;  3P1H A;  4WOR A;  4G7Z C;  1G8Z D;  4HCE A;  4XIG S;  3TBI B;  2XIW A;  1SNP A;  3OPO A;  2N55 A;  3I4N B;  2L4N A;  5EKL A;  3D4W A;  4KK7 A;  1ESR A;  3L9A X;  5M5X B;  5FO7 B;  1STH A;  5ELD A;  1S5B D;  5C4X B;  5ELB A;  5C0X J;  4RGT A;  2EY2 A;  1C4Q A;  2K5Q A;  1TWF B;  1H9K A;  5IIF A;  1AZQ A;  2WB1 B;  4RFB A;  3QOJ A;  1JWM D;  2E2H B;  5CC4 A;  3BYY B;  1AEX A;  3X3M A;  1IL8 A;  2X6L A;  1RKN A;  1EYD A;  3GQB A;  1RD9 D;  1PFN A;  1SFO B;  4H44 C;  3PUZ A;  3TSS A;  1PTO F;  2F0L A;  2O2L D;  1HFG A;  3TZU A;  1SXT A;  1TII D;  3HOX B;  3FRP B;  1CQV A;  2IT1 A;  3BDO A;  1MD2 D;  3MXP A;  2Q8I B;  3Q0A A;  1FNW A;  3F2U A;  3SR1 A;  2RSO A;  1O80 A;  1KDA A;  1YNN C;  4LK1 C;  3A7A B;  3S2H B;  5CBA E;  1HXY D;  1VCI A;  4FNF A;  4GZY C;  2IW3 A;  1LAC A;  1ICW A;  1HFN A;  3KBG A;  5JJZ A;  4IN3 A;  1SNO A;  5CV9 A;  1PTO D;  2M00 A;  4IUT A;  3J81 L;  1IW7 C;  2OXP A;  5EJW A;  5J1Z A;  2NVT B;  1GHK A;  1ZXT A;  1RTN A;  1OXU A;  1YNJ C;  1VMC A;  1BCP B;  3MC0 B;  4C3I G;  1OXS C;  5LHY 1;  2FMM A;  3D31 A;  3VYT A;  1TY0 A;  1HRJ A;  1CTM A;  1D5X C;  4DA2 A;  2A68 D;  2AWN A;  3PUW A;  4UDU C;  3OHX C;  1JOK A;  1WCM B;  1JCK B;  1IHZ A;  4KN4 C;  3CRL C;  1FNV A;  2H4O A;  4C3J B;  1HCZ A;  1MSH A;  1TS3 A;  1YNN D;  4KY7 A;  4HN7 A;  3BVM A;  4FXD A;  4K6L A;  3KBX A;  5KND A;  5EGT A;  3DEP A;  1CT1 D;  3J7Y W;  1TR5 A;  3FVQ A;  4G4K A;  3HOY B;  1DM0 B;  4K5W A;  5EBC A;  1WTV A;  3P7J A;  3C46 A;  5E4X A;  3DWA A;  5IGD A;  1DOM A;  3BZD B;  1GUT A;  2K5W A;  5M5Y B;  2DNE A;  1EY0 A;  3S1M B;  5IGE A;  1C48 A;  3M85 A;  3TP8 A;  1SYG A;  1EYA A;  1E0B A;  4ODG A;  2L1B A;  1QIL A;  3IFD A;  1Q1E A;  3MHB A;  2J4X A;  2KCC A;  4Q0F A;  5I2X A;  1I4P A;  4HMI A;  3NQT A;  3DXJ C;  2NWG A;  2CW0 D;  1WTX A;  4OIK A;  3J81 E;  1U9R A;  2WKC A;  1SYB A;  3PUX A;  1F77 A;  3Q22 A;  1F9P A;  4A3I B;  1EL0 A;  2DY8 A;  1IKL A;  4ULL A;  1SYE A;  2QKI C;  1XYI A;  1B50 A;  1R4P B;  1STY A;  3S9W A;  1ILQ A;  1W6K A;  2EY1 A;  3ONA B;  1QNU A;  4G57 A;  2XRS D;  1D1K A;  1X3P A;  1BF4 A;  4B08 A;  3ND9 A;  4LJZ C;  5A35 A;  2PZT A;  4DU9 A;  3FMC A;  5COR A;  2ICE C;  3MFG A;  5EPJ A;  1F2L A;  3C1E A;  2RDH A;  4C1N K;  4O42 A;  3SHL A;  1FR3 A;  4CKB A;  1EEI D;  4KV6 A;  3I3C A;  3AU7 A;  4X3T A;  3DM1 A;  4JBW A;  1DXM A;  1ROD A;  4CJ2 C;  2NZ1 D;  2OT2 A;  3KK7 A;  5LL6 X;  1V43 A;  4I7Z C;  3TP5 A;  5CBE E;  3E5S A;  2B2T A;  3P75 A;  2VNU D;  3MFY A;  1JC7 A;  5JEA J;  5LL6 S;  1G2S A;  4DNT B;  5IOD A;  3A55 A;  2D9U A;  1K83 B;  3TP6 A;  5M9O A;  1PMR A;  3S15 B;  1EQV A;  2NN6 I;  1G29 1;  4QUF A;  4PV1 C;  1U4M A;  4L6T B;  4N9P A;  4A3J B;  2MHV A;  1EY9 A;  1HQR D;  1GUW A;  1OXV A;  2A69 D;  2MJ8 A;  3V2T A;  1D6E C;  4QB4 A;  1H9R A;  3VYR A;  2JA8 B;  2FJ2 A;  1WVL A;  3CKI B;  1HA6 A;  2L5T A;  1BXT A;  3ZYY X;  3N52 A;  2PNR C;  3IKJ A;  1TS4 A;  1ET9 A;  3WDN A;  1GJX A;  1Q3L A;  4DN4 M;  1Z6H A;  4A3B B;  2F0U A;  5TSS A;  3LX0 A;  1SNM A;  4FP5 D;  1QCB D;  5JVG 3;  3S1N B;  2NVQ B;  1EIG A;  4RA8 A;  1JE4 A;  2PCF B;  1W6J A;  4XXE A;  1EWH A;  3H91 A;  1ML0 D;  2PZW A;  3NWS A;  2F0I A;  3JAM L;  3R2T A;  2EYL A;  2BDO A;  4FF4 A;  1BDO A;  4C1N I;  3M4O B;  5DNF A;  1PRT C;  4HCS A;  1GOZ A;  1SE3 A;  2NN6 G;  2R92 B;  3OIP A;  2B2V C;  2YYZ A;  4CGY B;  3HP3 A;  1TVX A;  1EOT A;  3QWN A;  4OIJ A;  3NTI A;  2O5I C;  2A6E D;  2F0S A;  1WTQ A;  3Q23 A;  1EWC A;  2R7Z B;  4H13 C;  5ELF A;  4U68 A;  1AN8 A;  2BOS A;  2BA1 A;  4KHV A;  1Q12 A;  4BA2 I;  3IFT A;  2JSO A;  1PTO B;  2BE5 D;  3O13 A;  2WAQ B;  3RMH A;  4ZRZ A;  1CQF A;  3AMU A;  5M3F B;  1EQT A;  2D5D A;  4BWG B;  1HTP A;  2Z1C A;  3QB3 A;  3S14 B;  2PW5 A;  1AZP A;  4RCN A;  1ENA A;  5CV7 A;  4IUR A;  1CK1 A;  3A54 A;  3S1R B;  1PDQ A;  1TWG B;  1R9T B;  3G6J B;  2XWB B;  1L0X B;  2E2D C;  1QE6 A;  1DYQ A;  2DY7 A;  1UAP A;  2B2W A;  2A6H C;  1EZ8 A;  1BO0 A;  2ID0 A;  1JOQ A;  1ENC A;  5CYU A;  3K6O A;  2F3W A;  5I6W A;  4KKU A;  4KTA A;  1CA5 A;  1EZ6 A;  1B9N A;  5FLX L;  3GV3 A;  4K8I A;  1EY4 A;  1CHP D;  3SE0 A;  4RGO S;  4XT3 B;  1ENF A;  4K14 A;  4IFD G;  5IT9 L;  4TSS A;  4HR7 B;  5CR3 A;  3BDL A;  3HOU B;  3HZX A;  1JWS D;  2R93 B;  1FNU A;  3TP7 A;  1Y1W B;  1LTI D;  2F3V A;  1E2W A;  4QF4 A;  2B2Y C;  4CBV A;  1NUC A;  3KF8 A;  1BQQ T;  3I4M B;  2LKV A;  4FF3 A;  2MPM A;  3MVV A;  3KUP A;  4C3H B;  3BVZ A;  2RDF A;  5CV6 A;  4CJ1 B;  1BBX C;  3NK9 A;  1TWA B;  2IX1 A;  3EFX D;  1A3U A;  2NYZ D;  1GUN A;  1T5X D;  1LTB D;  1PYW D;  1Y1V B;  1IYV A;  4XTC S;  3MXG A;  3RD4 A;  1EFI D;  1H9S B;  1KAA A;  4KY5 A;  2QCP X;  1NR4 A;  5EPL A;  4XYQ A;  4B9X A;  5C3X A;  1A3V A;  5C6A A;  2SDF A;  1SJE D;  4RGN A;  5BN5 A;  4XQN A;  5C0X G;  1LTT D;  3H94 A;  4RAU C;  3GTP B;  4QIW B;  3W3A A;  4ZKB B;  2XWJ B;  1I4R A;  4ZUI A;  2F0T A;  3GV6 A;  2KEE A;  1XTC D;  1F2Z A;  2EJM A;  1S5E D;  4KD4 A;  1HUN A;  2EY6 A;  1SE2 A;  3MWY W;  3HKZ B;  4JK1 C;  4Y7N B;  5I9P A;  2WAC A;  3G7L A;  5FO9 B;  1ILP A;  2QF7 A;  4MIU A;  1S4Z A;  5IT9 E;  1AP0 A;  2J0T D;  2SNS A;  1EY7 A;  1SYD A;  3KLR A;  2PMZ B;  1VMP A;  3VYS A;  4DK1 A;  1CM9 A;  3TN2 A;  3GP7 A;  3PO3 B;  4XQJ A;  3T51 B;  1KLG D;  4TRD A;  1I4H A;  1DON A;  4FVM A;  4L8J A;  3MAQ A;  2K7V A;  2XVS A;  3CHB D;  1U4L A;  3SDZ A;  2JEB I;  4FF2 A;  4DAP A;  4G7H C;  5DEH A;  1G6Z A;  1RCV D;  2ENB A;  1NR2 A;  1XWE A;  3C2P A;  2LY7 A;  1GUG A;  4ZYS A;  3FEW X;  3HS0 C;  3T16 A;  1B9M A;  3NXW A;  4BY7 B;  1LLR D;  3P20 A;  4DFA A;  2CHB D;  1HQM C;  3BDC A;  3GTL B;  3OIQ A;  5CV5 A;  4IUV A;  3M3Y B;  1O7Y A;  1H9S A;  2GA4 B;  4EQO A;  1C8C A;  4BS9 A;  1HTL D;  3I91 A;  5DM7 3;  4L63 B;  1LTR D;  5F2D A;  1F9Q A;  3DEO A;  3TZD A;  3A8J E;  1SAP A;  2R6G A;  4IUQ A;  2EYF A;  1PZJ D;  1IW7 D;  3VA5 A;  1J9O A;  2K6A A;  2R61 A;  1K8O A;  1ZKO A;  4IUU A;  1KAB A;  1YNJ D;  2NB0 A;  3GD7 A;  1GXD C;  4C56 C;  3UI2 A;  3SK4 A;  2IPK D;  2LS0 1;  1XX8 A;  1O7Z A;  1WD0 A;  4X3U A;  4HMJ A;  4PMB A;  3OSO A;  3H0G B;  4EQP A;  5M3M B;  1CZW A;  1QWY A;  4S3S A;  2O5J C;  1A15 A;  1M8A A;  4BA1 I;  2K01 A;  5COY A;  4HAE A;  5CMD A;  2JYO A;  5JVH 3;  2G9D A;  4HTH A;  2E2J B;  1SNQ A;  1FD7 D;  4ID6 A;  2F0O A;  2RVL A;  3QOL A;  1SBB B;  2EPB A;  1BNZ A;  4A3M B;  1SEB D;  4OGQ C;  4DNR B;  4V19 0;  3RZD B;  3QJY A;  4XT1 B;  4H0L C;  4N9T A;  1L0Y B;  2B8G A;  1I4Q A;  2VXW A;  1LT5 D;  2IJ0 A;  4XYO A;  3PIP 3;  2SOB A;  4DAY A;  2AUK A;  4QCL A;  1CI3 M;  2NTS A;  1SYC A;  3TDQ A;  3PO2 B;  3OMC A;  1RF2 D;  3H09 A;  3MTS A;  3I73 A;  2JA7 B;  3I72 A;  3HOV B;  1TKW B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...