1K8MA

Solution structure of the lipoic acid-bearing domain of the e2 component of human, mitochondrial branched-chain alpha-ketoacid dehydrogenase
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
87
structure length
87
Chain Sequence
MGQVVQFKLSDIGEGIREVTVKEWYVKEGDTVSQFDSICEVQSDKASVTITSRYDGVIKKLYYNLDDIAYVGKPLVDIETEALKDLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure and dynamics of the lipoic acid-bearing domain of human mitochondrial branched-chain alpha-keto acid dehydrogenase complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords E2 component of Branched-Chain alpha-Ketoacid Dehydrogenase
total genus 4
structure length 87
sequence length 87
ec nomenclature ec 2.3.1.168: Dihydrolipoyllysine-residue (2-methylpropanoyl)transferase.
pdb deposition date 2001-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00364 Biotin_lipoyl Biotin-requiring enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1k8mA00
1OXSC 1TKWB 2AWOA 3LNNA 1Y8OB 3I4LA 2A6ED 4TQUS 2BE5C 1Y8NB 3OPOA 2A68D 3U9SA 4KMUC 4BA1I 1GUSA 2EDGA 4KKTA 1HPCA 1E2WA 3OOCA 4LK1C 1CI3M 5JEAH 4G7HC 1FYCA 1YNJC 1VDZA 3BDOA 1OXVA 3A8JE 3FPPA 3PUXA 1Q90A 3D4RA 1H9JA 2PNRC 4KHZA 3T53B 4IFDH 1K8MA 3IFTA 2D62A 2LMCB 1Q12A 2A69C 3QG1A 4IFDG 1DCZA 1IYVA 1Z7TA 2R6GA 2A68C 1GUTA 5JEAG 2V4DA 3GQBA 3OW7A 3M7NA 2K33A 3A8KE 2A69D 1GUGA 5A35A 1Q1EA 1H9RA 3KLRA 3W3AA 5BN5A 2IT1A 1PMRA 3MXUA 3T51B 2E75C 1GJXA 3M4YA 4KN4C 4PV1C 2QF7A 1IYUA 2BE5D 2A6EC 3ND9A 3TZUA 1HQMC 1Q1BA 2NN6I 5C0XG 2D5DA 2AUJD 2PCFB 4KKSA 4JK1C 1LABA 3T56B 3RLFA 1EWHA 3D31A 3QJYA 4DNTB 3A7AB 1LACA 2E76C 3FMCA 1VF7A 1K8OA 1GHJA 4HR7B 2YYZA 2NN6H 3VR2A 5K36H 1DXMA 1YNNC 1T5EA 2JEBI 1OXXK 2DNCA 3NE5B 2EJGC 3N6RA 4L8JA 2B8FA 3VR3A 1HTPA 2A6HC 3VR6A 3A8IE 2BA1A 1QJOA 2Q8IB 1O7LA 3EQLC 3PUYA 1GUNA 4RCNA 1GHKA 1IW7D 4OO1H 3VA7A 1IW7C 3CRLC 2DN8A 1CFMA 1FR3A 1G291 1H9KA 3WDNA 2B8GA 2JEAI 2A6HD 3BG3A 1Y8PB 1Z6HA 2NN6G 3H94A 5KNCA 4H0LC 1H9SA 4OGQC 2D2CC 4G7ZC 3M85A 2KCCA 4H44C 4DK1A 1O78A 2JXMB 2EJFC 4KN7C 3AB9A 1OXTA 5BN3A 2CW0C 1VCIA 3GD7A 1B9NA 1ONLA 4GZYC 2AUKA 2E74C 4OO1G 4LJZC 5KNBA 4I7ZC 3PUWA 1V8QA 1SMYC 3P20A 1E2VA 3HGBA 4IQZA 2O5IC 2ZT9C 3LWUA 4BA2I 1B9MA 3QIAA 3DXJC 1A6XA 2EJMA 2O5JC 3SDZA 4H13C 5K36G 1BDOA 3I73A 3PUZA 1DD2A 2BDOA 1H9MA 1ZKOA 3SE0A 4DK0A 2JE6I 2PPBC 3CRKC 4XTCS 1VF5C 2DNEA 3ND8A 4XIGS 1Y69U 4JBWA 2F1MA 3VR4A 2BA0A 2K7VA 2L5TA 4DNRB 1ZYRC 5KNDA 1E2ZA 1HCZA 5C0XH 4G7OC 1TU2B 3A7LA 1OXUA 1V43A 4KKUA 4TKOB 2EVBA 1I6VC 3VR5A 3MFYA 4KI0A 2KA7A 3PUVA 1H9SB 3I72A 3PV0A 1GUOA 5BN4A 2K32A 3IKJA 3L7ZC 1CTMA
chains in the Genus database with same CATH superfamily
1TKWB 1LTTD 1KRTA 4C3JG 3K57A 3ER0A 1VQLA 2CKZB 1IKLA 2SOBA 3MXGA 1HUNA 4RKBA 4S3SA 2A68D 1V1OA 5JJLA 1XMOQ 1LT5D 3RR5A 2R92G 5M3MG 2UUAQ 3CW2C 3E9HA 3AMUA 1TS4A 1YZ6A 1DCZA 3KF8B 1GUTA 1RL2A 2IHFA 4IOAA 1G8ZD 3HOYG 1WI5A 4DV5Q 1HQRD 4QY7A 4UP8A 4FF4A 2PNHA 5EGTA 1J8IA 1AN8A 2IPKD 3H15A 3E5SA 4A3FH 1ASYA 3HOUG 4WJ3M 2MO0A 2PQAA 3M4YA 2EYOA 3RMHA 3VYSA 2Y0SG 2LXKA 2E5LL 3FRPB 3J7A5 1EQVA 1TWHB 2HD3A 3RLFA 3GTOH 3EIVA 2UXCQ 1JWSD 3QWNA 3L0OA 1LACA 1S5DD 4CKBA 1FJGL 1WCMG 4YY3L 4GKKL 2WB1G 3V05A 2WB1B 5K36H 1DXMA 4B3TQ 2I0QA 3NE5B 3S1QH 3N6RA 1FJGQ 5LL6X 1PH1A 5IE8A 3D0FA 3D8GA 3ONAB 5BR8Q 1X9NA 3CRLC 4DGZA 4DV3L 3R3OA 1LT3D 4N8FA 3W2DA 1Z6HA 1AZPA 2A1AA 1EIFA 1KLUD 2IW3A 1DJRD 1O78A 1SYGA 3HZXA 3J80E 5CV4A 5BN3A 1BUVT 2F3VA 1YJWA 3EBEA 2F0JA 1TXYA 2IHEA 3KLSX 1HR0L 3NBIA 4DR5L 4JI3L 4YCUA 2UUCL 1GXDC 2WV6D 1JB3A 1NR2A 3SDZA 1SYCA 4L5RC 2VQEQ 3SE0A 4XTCS 1S5ED 2CCZA 2UXBL 3HFZB 3S9WA 1EIHA 3TS2A 4QB4A 5IGDA 1S5CD 2EVBA 4GN5A 4LF8L 1CM9A 3FVQA 3H3VC 4LF9Q 3BVZA 3L7ZC 4RHSA 2JA7H 3NEMA 1EEID 1X56A 1Y8NB 4PQXA 3DWQA 1HPCA 5D14A 1O7ZA 1IKMA 4GKJL 1U0LA 5M5YH 4Q0FA 1WD0A 1PH9A 1VQMA 1JC7A 2JSOA 1MGSA 2R6GA 3HRZC 2XIWA 4CDFC 1M90C 3MXPA 2VQFQ 4X65L 4A3BB 2JP1A 5DLQE 1L0WA 1ZXTA 3NQIA 1Z47A 1LTID 2IT1A 1Y1WB 3J7ZC 3S14B 3NXWA 1N36L 1E1OA 1I3QH 1SE3A 4PV1C 3A56A 2A6EC 2PMZE 2F52A 1TY2A 5ELOA 2OTJA 1N9WA 3FEWX 4A3MH 1JT8A 2UXDQ 5CBAE 5FK9C 1WTQA 5BR8L 2NN6H 1A8VA 4FXKC 1XNQL 1EFID 1YNNC 4OXPA 4ZUIA 2ZJQA 3WOFA 4ID6A 3KJOA 2F0NA 1QJOA 1ESFA 3S17H 1CHQD 3EQLC 1VQ7A 1QNUA 2K05A 4OO1H 1A2UA 1K3RA 1I4XA 1C7YA 3NBHB 4OHJA 4DA2A 3CHBD 2ZXRA 4DR4Q 3BG3A 5ELCA 4Q5VA 2FHTA 2E5LQ 4OWXB 1J5EL 1UAPA 1GOZA 4IPCA 4JI4L 1VQFA 4Z9CB 5KNBA 3T1HQ 3P20A 1F2ZA 4IQZA 3GTJB 4JPBW 5JVG3 2B2TC 1HNZL 2Z1CA 2HCIA 3AFPA 2HHHL 4C1NI 1YHQA 2NVTB 3S14H 1JOQA 3TP5A 4R4CA 4JOIA 1HJPA 1EL0A 2C9OA 2JA5H 1Y69U 3HKZE 2KENA 3I4OA 3DUZA 2KOLA 5FJ8H 4A3MB 2UUAL 1TU2B 4KKUA 2I5MX 1I6VC 3VR5A 5HY6A 4AYBE 4IUUA 1VQPA 1H9SB 3GV3A 4ZUJA 2AWOA 3TS0A 5GAGC 3CQZB 1BCPF 1X3PA 4TQUS 1ENFA 1SEBD 2EE1A 5EKIA 2VNUD 4A3BH 4A3GH 1CI3M 4LAAA 3UDGA 1YNJC 1XJVA 3A8JE 1H9JA 1QZHA 4L6TB 3NHHA 3RNUA 4KHPQ 4K2KA 2WKCA 4F87A 3SK6A 3FP9A 5CYUA 3MA2B 1K8AC 2R7DA 1EZ6A 4HMJA 2WP8J 1PLFA 2M9VA 1U4MA 2K01A 2DUDA 1PMRA 1EUJA 3SHLA 3JAMc 3Q6SA 5E1FA 2M00A 3Q8DA 1DYQA 4IN3A 4KN4C 5IWAQ 1QE6A 1PV4A 1DOMA 3OW2A 2PCFB 4KKSA 1STGA 1S40A 4X65Q 4X6AH 1PH6A 3D31A 1Q3LA 2ASBA 2JA9A 2JA6G 1CA5A 1NBWA 2JA5B 3CKIB 2B2WA 4KD4A 1PZKD 2HUGA 4HMIA 4K8IA 3HOWH 1JICA 1SMYD 2B2UA 1NAPA 3I70A 3NENA 1PH5A 1STYA 2F0PA 1FNWA 3S2HB 4C1NK 2RDGA 4RCNA 5KIXA 1EYDA 1XX8A 5FO8B 3K8AA 1EZ8A 1NJIC 1CSPA 2A6HD 3NBHA 1ICWA 5EPKA 3EVQA 2QCPX 2NVXB 1F2LA 3AB9A 2IWHA 1KIXA 2VUMH 3GTQH 4K6LA 4K2LA 2JA8H 3K59A 3G71A 4HIDA 2SNMA 4QQBX 3EA6A 1EEFD 2EJMA 3CAMA 1VQJA 1K28A 1HTLD 1SFOB 3S16H 2K5HA 4K14A 1F77A 2L12A 3PO2G 5CR3A 4YWKA 3CCUA 3I4MB 4OO1I 1TWGH 3PSIA 3H3VH 1SNPA 3OMCA 1XMQQ 4QIWE 4C3HG 5C0XH 2VS1A 3ERSX 1SBBB 3NUCA 1KL9A 5FLXE 2J0TD 3HOYB 2QEJC 2FJ2A 1L1OB 2K32A 3IKJA 1JMCA 4DU9A 4R4IA 2YU9B 3A0JA 2F0QA 5JPNC 4FNFA 1PFNA 2DY7A 2EYFA 2G9DA 1RTNA 1PFBA 3NTHA 3CCJA 4G7HC 3I2ZA 4B3RQ 1SNOA 1OXVA 3F2BA 3T13A 1BNZA 3U9OA 2LMCB 2RCFA 2A5HA 1HNZQ 2V4DA 2BCOA 3BZKA 2GVAA 4IPGA 4DR2L 1SNCA 2K33A 2KHJA 4LF4L 2MNAA 5BN5A 3T1YL 1YHAA 1FGUA 4RAUC 1EYGA 1VQDA 4XYQA 4GOPC 3QOJA 3ULJA 1PXUA 4C3IG 4FDBA 3T1YQ 3G6JB 2LSSA 4DN4M 1SNQA 1NY4A 3T56B 4JI5Q 4J15A 4DNTB 3HKSA 2KCTA 3FMCA 3FKIG 2CW0D 3PF5A 2PI2E 2K03A 3BDLA 4LF8Q 2F4IA 3X3NA 1SSOA 1EY7A 2K52A 1TR5A 4H02A 1JORA 1TS5A 4LFAL 2EOTA 4B9XA 3GTLH 1RF2D 1FR3A 1PH2A 4O0AA 1VQEA 3GP7A 1LTBD 2YTYA 1YI2A 3H0GG 3DHQA 3KF6A 2KCCA 4LUVA 2JXMB 3H0GB 2RCNA 3S2DH 3RZDH 3MTSA 3HGBA 4BA2I 3CC2A 2X6GA 3QO2A 4C56C 1IBMQ 4IFDJ 2JQOA 3HOWG 3I90A 1Q86C 5KRUA 4IFDI 4KJNA 3OIPA 5IGCA 3BS1A 2OCEA 2RA4A 2AQ2B 4G57A 5C4ZA 1WVLA 1B44D 1Y1VH 4YHHL 1X3GA 3C3LA 4TKOB 1EYAA 3OTOQ 2NVYH 4LF9L 5BN4A 2NTTA 2OTLA 5GROA 1BCPC 4YHHQ 3I4LA 1QCBD 3C2PA 3U4ZA 4XQQA 5IGEA 3BVMA 3CQZH 1E0BA 1RIPA 5IP9G 1HZ9A 4HJ8A 1FYCA 1O7IA 1KXLA 5C3WA 4P75A 4K5WA 3HG9A 3J80c 5M5YB 4X3KA 4KLKA 1JE5A 4UPAA 3URYA 1VQAA 4U68A 5JEAG 4JI0L 2NBFA 4FF1A 2NVQH 1HR0Q 1XTCD 1AE2A 4YWMA 5L37A 3G6EA 1Q1EA 4JI2L 1GD7A 1NMGA 4A3DG 2F0VA 3HOUB 1EOVA 1LTSD 2CQAA 2TSSA 3S15H 1BQQT 3ND9A 3CCMA 1SNDA 2NYZD 4CJ0B 4EQOA 4OIJA 1Y14B 1Y1VG 4JK1C 4POGA 3CCLA 3Q22A 1B70B 2PYKA 3NWTA 3M4QA 4AIMA 2OWOA 3M4OH 1IBML 1VF7A 5FO9B 3BZDB 2PMZB 1A2TA 4APVA 1X3QA 1F2YA 4L8JA 4IJHA 1P8LA 4A3KG 2O4XA 1GUNA 1R4PB 1UUPA 1IW7D 5C3EB 4X64L 3S2DB 1QVGA 4XXEA 4YY3Q 1AW7A 1G291 1CHPD 3H0GH 2ID0A 4DR3Q 3H94A 5E4WC 3K5MA 2D2CC 1ESRA 2FMCA 4LFAQ 3ZJYC 3LX0A 5D3DA 3CXCA 4DV5L 3S15B 4I7AA 1I4PA 1UWVA 5LMNL 2B39A 2NZOA 2VW9A 3MC0B 4JVZA 1SYEA 4RCOA 4BBRH 4L5TA 3I73A 4JYAL 2B2VA 3HOZG 3FKIH 3DLLA 4M1UB 4CDEC 3PIP3 4R8IA 2RQXA 1W6JA 5E3FA 2F0DA 2IJ0A 3RN2A 1XNRL 4HJ7A 2I07B 2B2YC 1GUOA 4DR2Q 1WTOA 4ILWA 1Y8OB 2KHIA 3OWFA 4KY7A 3F2DA 1Q7YC 1T5XD 1C4QA 4XT3B 5JJZA 2PO4A 1STEA 3TEHB 1B4OA 2Z4IA 3PIOA 3M3YH 1HA6A 1Q12A 5IODA 3CC7A 4BXXG 2ZTCA 1UE6A 4FYDA 5I9OA 5I2XA 2AWNA 2JA5G 4Y52H 2XWBB 4X3TA 5EQ0A 5IY0A 2R7ZH 3U58A 3GTKH 2B2WC 1XMQL 4RGOS 1GJXA 1GUWA 4DV2Q 1SJED 1W6KA 5C0XG 2XRSD 1KABA 1EWHA 1CA6A 5EPJA 1TWCH 3FKIB 3TP8A 2FFKB 1GHJA 1NSNS 1UE7A 4DPGA 3MEFA 4LUZA 2OT2A 4HAEA 1JJCB 5C3EH 1J9OA 4F88A 1VQ5A 3UI2A 2R3ZA 2XSCA 2KBNA 4DV3Q 3VYRA 3KF8A 4UHVA 1IW7C 1UE5A 1JB7A 3UDXA 2N88A 2CQOA 5KYIA 3PO2B 2B63G 2NN6G 5CGKA 2WFWA 3K80C 3TBIB 3PO3H 1FL0A 4BY1G 4KN7C 2E2HB 3M3YB 3MFGA 1V1PB 1QUQA 3EROA 1D6EC 1TWFH 2H1EA 5A2QE 1ILQA 1SMYC 1D2BA 3RZDB 3KDFB 1A15A 1G2SA 3MXNA 3I3CA 5FLXc 1GM5A 4IALA 1ZKOA 3I56A 3EN2A 1Q82C 2PPBC 1NE3A 1EY6A 1KAAA 3M7GA 4B3ML 4PNYA 4OX9Q 1CKNB 3TSSA 5CC4A 4JCVE 4IUPA 2F03A 5CV5A 4B3SQ 4KI0A 3I72A 3EFXD 2HDLA 1S3OA 2QEXA 3G7LA 4DR7Q 1NNXA 3K58A 2OQKA 2BE5C 5LMNW 2VB2X 3Q23A 4BA1I 4LUOA 1U4PA 3UE1A 5AJ3Q 4KKTA 1CK1A 4RHRA 4LK1C 2ES2A 4C3IB 5IOCA 3GTGH 3FPPA 4RGMA 1STHA 2KHSA 4GKKQ 3NWSA 3CC4A 1YJ9A 4DKAC 3I4MH 2R92H 1X54A 4IZ8A 3ZYYX 2ATWA 1V9PA 5KEEA 1FVIA 1YNXA 1ET6A 1MSHA 5JOBA 2NB0A 1XNRQ 2HDMA 3CPWA 2I5HA 1RKNA 1K0SA 5C6AA 3DMUA 4H7BA 4LF6Q 4ZYSA 1SNMA 2ZM6Q 4X62Q 5E4XA 4NKLA 3BDCA 4KV6A 5FKAC 1WTXA 1EY5A 4BY7B 2R93G 1F9QA 2WACA 4X3SA 5ISRA 5CORA 3M4OB 5JJIA 2ENBA 1PZJD 2EYHA 2YYZA 2CHBD 2F0EA 5I4DA 3QR8A 1TWAB 4BBRG 1O80A 1LUZA 1LT6D 3DM1A 3J80i 3NP8A 3CCQA 1G91A 1AH9A 3KBGA 4QUCA 4DUYQ 1KD1C 4DAYB 4E6IA 4LMQD 1RJTA 4A3JG 2DN8A 1BCPD 5COYA 4P73A 2WAQB 1Y8PB 3TDQA 1PFSA 5C0XI 2SEBD 4UDUC 4A3IB 3W1GA 3K5LA 2ZXPA 4A3EG 1OXTA 2CW0C 1BBXC 4ZKBB 4GZYC 4LF5L 2E74C 1F9RA 1KDBA 4BBSG 2XVSA 3PUWA 1V8QA 2KVMA 1GVPA 3G48A 2OEOA 1VQBA 1PZID 4C3JB 1D8LA 3DEPA 2UXDL 3J81L 2QW7A 1DOLA 2N8NA 1Y1WH 3STBC 2L9HA 2MJ8A 3HOZB 3BU2A 2R92B 4DK6C 5IWAL 3KFUA 2F0KA 1OO9B 2PI2A 5C44G 2NWGA 3MZ5A 4GNXB 3I4MG 3QOLA 1I50H 1B8AA 1N36Q 4DV6Q 4OONA 3STBD 3I91A 2K5VA 3TMEA 1VQ4A 2N55A 3R8BA 3CMEA 3S2HH 4N9TA 4A3DB 2G9HD 3K6OA 2UUBL 3UDFA 2Q2UA 3D4RA 4L5SA 1E1TA 3OHXC 3G4SA 5CV6A 1M4VA 1Z7TA 3U4VA 1WCMB 3BYYB 4HEDA 1EU4A 4IUNA 2EXZA 1JCKB 3MAQA 3F8TA 1EQQA 1RDPD 2K28A 2NVTH 2A8VA 3S16B 3T51B 5LHY1 4HCSA 3JAMi 3GTJH 2HQEA 4HJ9A 4YIJA 1X55A 4XDXA 2KCNA 4LF4Q 3J7AF 4DV1L 1IL2A 4DR4L 3J81j 1WD1A 5JEAJ 3SK5A 4DR5Q 2UUCQ 1VS0A 5D65A 2LXJA 2DY8A 4XT1B 3VR2A 2B63H 3RZOB 3T16A 2DNCA 2P5ZX 2IX0A 4HJ5A 2EJGC 3K7AB 4NW2A 4KTAA 2SNSA 1TWFB 3A5ZB 4IUTA 4A3CH 1HA5A 5GQOA 1WTRA 5EKLA 4JI6Q 1AE3A 4HIOA 1EWCA 3NPPA 2LFNA 3DWAA 4J8QA 1EY4A 2JA6H 1XNQQ 4A93B 3GD7A 2IL8A 1XXGA 3Q24A 3TN2A 2AUKA 5EPLA 4LJZC 1UEAB 1XWEA 1N34Q 1IHZA 5G3LD 2ZT9C 1PYSB 3NSWA 1B9MA 3QIAA 4NB3A 1KRSA 5C3EG 3RLNA 4H13C 2NVXH 1E7ZA 4ZRZA 5J1ZA 2K6AA 2JK8A 4DNIA 1GO3E 1AEXA 1AP0A 1XMOL 3UDIA 3GTPB 4KD3A 5C4HA 2QKIC 1MJCA 3J80L 4BXXH 2VQFL 2OF1A 1HXYD 4DUZL 3FPUB 1RD9D 5F2DA 5DAUA 4NXNQ 1VQHA 4KY6A 2F0UA 4F7XA 2RF4A 4IPHA 3K81C 3S1NH 1E3PA 1TWCB 4OL7A 4FF3A 1HZBA 4DK3C 2D0PA 2ICIA 2L11A 2L15A 2A68C 1WOCA 3K5NA 5HURA 2YV5A 4K5XA 1EWIA 2J4XA 1I3QB 4QIWB 2EYPA 3OTOL 1LM0A 5C0XJ 1SE4A 2UXBQ 1TVXA 2J7ZA 3HKZB 4JYAQ 2N78A 1SLJA 1SN8A 3K7AH 1JOOA 2KCMA 4BY7G 2B63B 4HSPA 1A3UA 3V2TA 4I65A 4GLAC 2HT1A 3HOZH 1K8OA 1KHIA 2QGQA 2F4VL 4GOPA 2LKVA 5FLMH 2B8FA 2M2LA 1J6QA 2A19A 1QB5D 4B08A 4J1MA 2VUMG 3PCOB 4B3TL 2ZTDA 1UE1A 1PTOD 4QF4A 2A74C 4OWTB 1JOKA 2B8GA 1LT4D 2CVRA 2WAQG 5EKKA 4JI8L 2UXCL 1BBWA 4A93H 3SK4A 4A4IA 5KNCA 2ICEC 4EQ5A 4GOPB 1Q46A 3V96A 3M85A 4H44C 4A3IH 3NTIA 3OMGA 4A3MG 2IX3A 1ONLA 4AYBB 3PQIA 5IYDG 3R93A 1MSGA 1PH7A 2AQ1B 2MO1A 4DV4Q 4CKCA 3LWEA 3DXJC 3IRBA 3J7AV 5M5XH 4NP5A 2NTSA 4A3DH 3HOVH 4JW0A 1CSQA 3ICEA 2V1CC 1A63A 3CMAA 2KUMA 2QDLA 3NK9A 5EBCA 1HCZA 3HS0C 5J22A 3PUVA 4IPDA 3NQTA 4DV4L 4A3GB 3S1NB 2F0TA 3ULPA 4JG2A 1F9SA 2R7ZG 5LMNQ 4OWWB 4HN7A 2KQ3A 1MBYA 1EOTA 2CWPA 5J3BA 3U9SA 1HHVA 1PRTB 3K0XA 4L63B 2E2JH 3VA5A 2I5LX 1QZGA 2NVYB 4ZAIA 3BDOA 1JJ2A 4IFDH 2PNRC 2R61A 4WJWA 4EX5A 3D4WA 1D1KA 2EY2A 3KLSA 5GAEC 1IYVA 1VQNA 3GQBA 4N9PA 4QUFA 3GV6A 3MWYW 3CD6A 2IY5B 1VQGA 3CCSA 5A35A 3GTKB 4BBRB 1XYIA 1SFOH 1K83H 1CZWA 3HOVB 3M4PA 2E75C 2QF7A 2HIVA 2X69A 4HCEA 1U5KA 1HR0W 4R8NA 5I6YA 5FJ8G 4DXGA 2CH4A 4GS3A 1I4RA 4A3LG 3A7AB 5HGQA 1V1QA 2E76C 2MHVA 5M5XB 2VL6A 4JI4Q 1HTPA 1ENCA 4C2MB 4BS9A 4ZK9B 2C5CA 1DOKA 4ODGA 2EIFA 4P74A 4YCVA 4IOCA 1L1OC 4HTHA 2XN9C 1HFGA 1PRTC 4BBSH 1A0IA 1I4GA 1QVFA 2DJGC 1X3FA 3WDNA 2RSNA 4NXML 4CGYB 3IAYA 1SAPA 4CDCC 1IXRA 4EQNA 2BH2A 4OGQC 4RMFA 4DR6L 2Q2TA 4Y7NB 1S72A 1TWHH 3SK8A 2Z6KA 1VQCA 1BR9A 3A74A 4I7ZC 3D4DA 2MFIA 1VQKA 3X3MA 1DONA 4DUZQ 3JAML 5IP7H 4CKEA 4FXGC 4DV0L 1WTPA 1WTHA 3PUZA 1KQSA 3KDFA 1DGSA 1CKOA 2DNEA 1WFQA 3A54A 4DV7L 4DR6Q 1IZ6A 4DNRB 1ZYRC 1E2ZA 1S5FD 2Q2HA 2K14A 1MJEA 4LFCQ 2RHSB 1EU3A 1FD7D 3E3XA 1PH3A 1NUCA 3H6MA 5M3MH 2D0OA 1MKHA 4JI5L 2Z6BA 3OPOA 1ZYRD 5AFWA 4K6DA 5FO7B 2F0OA 1XPUA 1HNWQ 3P1HA 1BVSA 5C4JH 2K5QA 3CU7A 3AYHB 3IFTA 1VMPA 4B9WA 2VXWA 4IFDG 2F0FA 2BOSA 1CQFA 1STAA 5ELEA 4OIKA 1PYWD 1HFNA 1SE2A 4X64Q 4UP9A 1MIUA 1JWMD 2Z0SA 1L2FA 4GNXA 4EGVA 4O1NA 3PIO3 4KY5A 5CV8A 1SR3A 1QILA 4JBJA 1STNA 4WORA 2EY5A 2E8GA 4V190 4FF2A 2UUBQ 1Y1VB 2NN6I 1EIYB 3GDEA 5CV7A 4Y7NH 2RDHA 3H3VI 2WINB 3A55A 1HRJA 4IUQA 2Z9HA 5IIFA 4UP7A 1PTOH 1ET9A 3P75A 4DV7Q 2A6HC 4RGNA 4QCLA 4N8X1 3A8IE 4RH6A 1XPRA 5M3FH 1O7LA 1GHKA 4O42A 5LL6S 1BCPB 1G51A 3F1ZA 2ZJPA 1C0AA 5G3LF 4WJ4A 3RUZA 3PO3G 2H4OA 1IBKL 2K5WA 3HOXH 3S1MB 4F8MA 2B2VC 2EYMA 2PZUA 3MVVA 1B9NA 4ABNA 1YHBA 1KNAA 2MGSA 4ZQ3A 1O7YA 2O5IC 4X66L 1OTCA 5K36G 1HNXQ 2BDOA 1ZEQX 2K5DA 3CRKC 1VF5C 5ELFA 3ND8A 3C46A 4JBWA 4BY7H 4LNQA 3QB3A 4ULLA 3CPFA 3GO5A 1WJJA 3E0EA 3DEOA 4U673 5ELDA 3MFYA 1AFPA 3PMFA 3PV0A 4A3GG 3TZDA 1IYJB 5E7NA 4G4KA 2Q8RE 1YIJA 1HZCA 2EYLA 3WOEA 2CWAA 1K83B 4MNOA 3NELA 3S24A 2KJXA 1GUSA 1G6PA 2EDGA 2YU9H 1L1OA 5I2YA 2D62A 3VYTA 4IUVA 2E2IB 3GTMB 1SROA 1I4HA 1ASZA 1HNXL 3KLWA 1B3AA 2OXPA 1QOHA 3GTPH 4DV0Q 3M7NA 2F3WA 4GKJQ 3A8KE 1H95A 1EIGA 1U4LA 1H9RA 1E22A 5CV9A 4C3JH 4NPSA 1Y1WG 4PG3A 4GLXA 2ALYB 4XQJA 5IYBH 5KYLA 3I8ZA 2AUJD 3FDTA 1I50B 4UY8C 4IJLA 4DR7L 4GN3B 2B2YA 3T4AC 3AFQA 1RCVD 2WKDA 3N52A 5CMDA 3SEBA 2AHOB 1J5EQ 2K5NA 4R4QA 2TMPA 2F4VQ 1B3QA 3GTLB 4B3MQ 4OX9L 1Q8KA 1S4ZA 3K7UC 2JA8G 4ME3A 4LFBQ 5C4XB 2NZHA 1YVCA 5C4XG 4K8JA 2DJFC 1KAWA 2ZXOA 2F0SA 1P16A 5IT9E 2JEAI 1M1KC 3I4NB 2JA6B 4G7ZC 4DK1A 2E2IH 5I9PA 4MTNA 1A3VA 3SR1A 4OO1G 4JBKA 2FXQA 3E0JA 4A3KB 1E2VA 1DM0B 5IYBG 1RODA 4RFBA 1A6XA 1XPOA 3GTQB 2VUMB 2RBMA 2VB3X 4A3FB 1X32A 2UU9Q 1VQ6A 2QILA 1PRTF 1SYBA 4FVMA 2KEEA 4B3SL 4GLVB 5FOBB 3H09A 4EQPA 1UEBA 4GN4B 4R1JA 4DR1L 1MHWC 4A3LH 5EJWA 1TQOA 4RA8A 4IURA 1NR4A 5EBDA 1EQRA 4M8AA 4JI1Q 4JBMA 3I55A 3RN5A 1SXTA 1YEZA 1CT1D 2KA7A 1CTMA 1K3BC 1PH4A 4DAPA 2O2LD 4JI1L 1F2MA 3TREA 4L5QA 1EY8A 4KMUC 2MPMA 4RG1A 1ENAA 2L4NA 4RKLA 2R7FA 4MTKA 1NMFA 1E2WA 1LTLA 1D5MC 4B3RL 3PUXA 4KHZA 2NVQB 1K8MA 5C4JB 3E6ZX 4R4OA 5IP9H 1VQIA 2E2JB 3OW7A 1I4QA 3BVGA 2WIIB 5IT9L 3KLRA 3MXUA 3SGIA 2EPBA 2X6LA 3F2CA 4RGTA 3MHBA 1N8RC 2VQEL 2HQLA 1Q1BA 4JI8Q 2E2HH 3ULLA 1X65A 4V0BA 1LTAD 1SYFA 4KJOA 5M9OA 1VMCA 2WB1E 3NTKA 2UU9L 4BY1H 5IGFA 4NMZA 5C3XA 1PTOC 2PW5A 1I6HB 5IP7G 2PW7A 2B3GA 2PQEA 3U50C 3VR3A 2BA1A 4PZ8A 5IYDH 1K8GA 2GN5A 5M5WB 5M3FG 3S1RH 5M3FB 3B6YA 4C2MH 3PO3B 1BO0A 3KK7A 3RZOH 4LF5Q 1MD2D 2K1BA 3CCEA 5DNFA 4DV6L 1HH2P 1HUMA 3I7FA 3HOXB 3GTMH 4RWSC 4A3JH 5DM73 1JWUD 1CKNA 1EY0A 4C3IH 3JC66 1YBYA 3C1FA 3KYHC 4KHVA 1PRTD 1W2BA 1WYDA 1G2TA 4YCWA 1H9MA 4DK0A 5GAHC 2JE6I 5K5PA 2JN4A 1RTOA 4PMBA 4XIGS 2F1MA 4GNXC 1C8CA 3VR4A 4CDDC 1XTDA 4PMCA 4XYOA 4DAVA 5T1GA 4QJFA 1TWGB 1PA6A 1KLGD 2L55A 2YTXA 2VZAA 1NCVA 3VYUA 1ML0D 2N49A 4HIKA 3PGZA 4NXNL 4LWCA 1QUQB 2F0WA 3LNNA 1EFWA 1V1PA 1WTVA 2B29A 1GKHA 1E24A 1SDFA 5IT9c 3MEHA 1YITA 2JA7B 2Z6KC 2Y0SE 3A5UA 1VDZA 4WFN3 1Q90A 3T53B 2EQSA 2A69C 5T1IA 2R93B 5J39A 1C48A 3DWPA 3TQYA 3PIPA 1N34L 5A2QL 4DAMA 2XGTA 3PO2H 4JI0Q 3SVMA 1VQ9A 5C5MA 5IGGA 4X62L 4DR1Q 1BF4A 2BE5D 1JJGA 5M3MB 3TZUA 5ELBA 1Q81C 4A3JB 1PDQA 2Z4HA 5TSSA 1AZQA 3QJYA 5HGTA 4CJ2C 1JR0D 1SMXA 5JJKA 4JI6L 4JV5L 5ELNA 1FNVA 4QMGA 2K04A 3J81i 1T5EA 4HIMA 2RHQB 2CFMA 5M5WH 3S1RB 1G6ZA 3VR6A 1CZGA 2Z8LA 2H5XA 2MUYA 4JI2Q 3TRZA 1CKMA 4NDXA 2K75A 1ICFB 2DGYA 5IGBA 3WWVA 2ZTEA 1I94Q 1CFMA 5DM63 3BZCA 3T1HL 5JAVA 4ZLTF 1BXTA 2AMCB 3S1MH 1IL8A 4BWGB 4UAIA 5C44B 1H9SA 1TY0A 1CQVA 2A73B 2IX1A 4TRDA 1SJHD 2EJFC 2EY1A 1RHPA 5LMUQ 1VCIA 3UE0A 3BJUA 3CCVA 3VDYA 1II3A 3DM3A 4A75A 3IL8A 5IYCG 3LWUA 1PTOB 1KDCA 2Q8TA 4YWLA 2EZVA 2PQAB 1WCMH 2ZJRA 4HSVA 1HNWL 2B2UC 4OELB 3E9IA 1LTGD 2K7VA 2L5TA 4FO2A 4JI7Q 1Z9FA 1QNKA 2QDBA 3L9AX 2F0LA 2B2TA 3Q0AA 1OXUA 2RKSA 1UNSA 3CCRA 2OQ0A 4A3BG 1B2TA 1YJNA 2XWJB 1OXSC 3C1EA 2GVBA 3BYTB 1I6HH 2C35B 2BH8A 2F0HA 1Q8IA 3KBXA 2ZM6L 3TP6A 3OWEB 4LF6L 4FXDA 1JQYD 1W3SA 4FP5D 1NTGA 3QG1A 4QL5A 1SE8A 3GTGB 1N32Q 2XNAC 2YTVA 1N33L 5C44H 3AQQA 2A69D 1GUGA 4KK7A 1MI2A 3ITPA 3W3AA 3P7JA 1YNJD 4LFCL 1TS3A 4R4TA 4XQNA 4QGUA 3F2UA 1IBLQ 3SXHA 3H91A 4DV2L 2SDFA 2K4KA 1S5BD 5AJ3L 1BBUA 1HQMC 2NZ1D 4MIUA 2Y0SB 4OEMB 1TS2A 4DUYL 1JE4A 1IBKQ 5I6WA 3KUPA 1L0XB 2F3IA 4DXFA 3MXNB 4BY1B 3RLOA 1D5ZC 4A93G 2MP1A 3J7YW 1LYLA 2JEBI 5JPMC 2EY6A 3HP3A 3J81c 1X3EA 4JOIC 1QWYA 1T9HA 2L1BA 1B1ZA 3PUYA 1SRUA 1KDAA 2BDNA 1TWAH 2KEDA 3CP0A 3D3RA 4PZ6A 2QA4A 4A3EH 1EY9A 3FHWA 2EYJA 1K73C 4AQYQ 3I4NH 2CH4W 1I94L 1SYDA 4H0LC 1D5XC 2FINB 2XRQD 2K50A 2AQ3B 2KECA 1PYBA 3J81E 5JVH3 4CHTB 4DR3L 4LW1A 4MZ9A 2NUCA 4CJ1B 3L3OC 1U4RA 1LO5D 4DV1Q 4A3KH 4LF7Q 1I5FA 2JA8B 3R2TA 3IFDA 4AQYL 2F0IA 4TVAB 1BOSA 4JV5Q 3HOUH 1WTWA 1R9TH 3O13A 1LLRD 2HCCA 3EJIA 4P71A 2PZWA 1YNND 2I46A 1IBLL 2BA0A 2EXDA 5KNDA 4G7OC 4JC0A 2VY3A 1V43A 3KF6B 1BKBA 4TSSA 1QVCA 2G5DA 3LGJA 2D9UA 4LF7L 5C5LA 3HEJA 2A6ED 3L2PA 1STBA 2JA7G 4POFA 1PHJA 1PTOF 3ERQA 3K0YA 1LTRD 3OOCA 1FGBD 5JEAH 4P72A 1KTKA 1K9MC 1TT2A 2GA4B 5GADC 2L0CA 2RSOA 1VQ8A 3CF5A 4C3HH 1X6OA 2PZTA 4DAYA 1KNEA 4PZ7A 4A76A 1N33Q 2FMMA 3D6CA 4HJAA 4JI7L 1PH8A 3HOVG 4MN3A 4ZKCB 1R4QB 2RDFA 1IYUA 1KC8C 1L0YB 1F9PA 2F0MA 1CUKA 2D5DA 1B50A 4X66Q 1LABA 1DZ1A 2F0GA 4NXMQ 4DF7A 2N3SA 4A3IG 5H1SE 4K0KQ 4ALPA 3HOXG 3W5OA 4HR7B 3W1BA 4A3EB 2JYOA 2AKWB 5LMUL 3OYYA 3AU7A 5FLXL 1QG7A 4AYBG 1OXXK 1ILPA 3D6WA 4A3CG 1A62A 3S17B 2LS01 2HIXA 4WRDA 4X3UA 1PVOA 2Q8IB 5IYCH 3HKZG 3VA7A 1EYCA 4DFAA 3K5OA 1N32L 1M8AA 5FLMG 1H9KA 1VQOA 5NUCA 2XTIA 4JI3Q 1A3TA 4J6HA 3I4NG 3KJPA 5D3IB 4CBVA 3RD4A 5EAYA 1PFMA 4ME5A 1U9RA 3PF4A 4LFBL 1R9TB 4C3HB 5C4XH 4PMWA 3OSOA 1D1IA 2LY7A 4MHEA 5CBEE 3HOWB 1C9OA 4K0KL 2R7ZB 5DEHA 1EQTA 2O5JC 4ZCKA 1HZAA 4A3FG 3OIQA 1BDOA 3KOJA 4K5VA 4AH6A 1DD2A 4EVOA 1FNUA 2E2DC 2RVLA 3S1QB 2Q2IA 3TP7A 2JJQA 2R93H 4IO9A 4KHPL 3JAME 3HOYH 1B53A 1B7YB 3R2IA 2WAQE 4R9WA 3AEVA 1LV9A 4O2DA 2MQHA 3A7LA 3GTOB 3M9BA 4BBSB 1K0RA 2HHHQ 1TIID 4P2CB 1D7QA 5KGUA
chains in the Genus database with same CATH topology
1TKWB 1LTTD 4C3JG 3K57A 2SOBA 1IKLA 3MXGA 1HUNA 4RKBA 4S3SA 2A68D 1V1OA 1LT5D 3AMUA 1TS4A 1DCZA 1GUTA 1G8ZD 1HQRD 4FF4A 5EGTA 1J8IA 1AN8A 2IPKD 3E5SA 3M4YA 2EYOA 3RMHA 3VYSA 3FRPB 1EQVA 1TWHB 3RLFA 1JWSD 3QWNA 1LACA 1S5DD 4CKBA 3V05A 2WB1B 5K36H 1DXMA 3NE5B 3N6RA 5LL6X 3D8GA 3ONAB 3CRLC 4DGZA 3R3OA 1LT3D 3W2DA 1Z6HA 1AZPA 1KLUD 2IW3A 1DJRD 1O78A 1SYGA 3HZXA 3J80E 5CV4A 5BN3A 1BUVT 2F3VA 2F0JA 3KLSX 3NBIA 1GXDC 2WV6D 1JB3A 1NR2A 3SDZA 1SYCA 3SE0A 4XTCS 1S5ED 3S9WA 1EIHA 4QB4A 5IGDA 1S5CD 2EVBA 1CM9A 3FVQA 3H3VC 3BVZA 3L7ZC 4RHSA 1EEID 1Y8NB 4PQXA 3DWQA 1HPCA 5D14A 1O7ZA 1IKMA 4Q0FA 1WD0A 1JC7A 2JSOA 1MGSA 2R6GA 3HRZC 2XIWA 3MXPA 4A3BB 2JP1A 1ZXTA 3NQIA 1Z47A 1LTID 2IT1A 1Y1WB 3S14B 3NXWA 1SE3A 4PV1C 3A56A 2A6EC 1TY2A 3FEWX 5CBAE 5FK9C 1WTQA 2NN6H 4FXKC 1EFID 1YNNC 4ZUIA 3WOFA 4ID6A 2F0NA 1QJOA 1ESFA 1CHQD 3EQLC 1QNUA 2K05A 4OO1H 1A2UA 1I4XA 4OHJA 4DA2A 3CHBD 2ZXRA 3BG3A 5ELCA 4Q5VA 2FHTA 1UAPA 1GOZA 4Z9CB 5KNBA 3P20A 1F2ZA 4IQZA 3GTJB 5JVG3 2B2TC 2Z1CA 2HCIA 4C1NI 2NVTB 1JOQA 3TP5A 1EL0A 2C9OA 1Y69U 3DUZA 2KOLA 4A3MB 1TU2B 4KKUA 1I6VC 3VR5A 4IUUA 1H9SB 3GV3A 4ZUJA 2AWOA 3CQZB 1BCPF 1X3PA 4TQUS 1ENFA 1SEBD 2EE1A 5EKIA 2VNUD 1CI3M 4LAAA 1YNJC 3A8JE 1H9JA 4L6TB 3NHHA 4K2KA 2WKCA 4F87A 3SK6A 5CYUA 3MA2B 1EZ6A 4HMJA 1PLFA 2WP8J 2M9VA 1U4MA 2K01A 1PMRA 3SHLA 3Q6SA 5E1FA 2M00A 1DYQA 4IN3A 4KN4C 1QE6A 1DOMA 2PCFB 4KKSA 1STGA 3D31A 1Q3LA 1CA5A 2JA5B 3CKIB 2B2WA 4KD4A 1PZKD 2HUGA 4HMIA 4K8IA 1JICA 1SMYD 2B2UA 1NAPA 3I70A 1STYA 2F0PA 1FNWA 3S2HB 4C1NK 2RDGA 4RCNA 5KIXA 1EYDA 1XX8A 5FO8B 1EZ8A 2A6HD 3NBHA 1ICWA 5EPKA 3EVQA 2QCPX 2NVXB 1F2LA 3AB9A 2IWHA 4K6LA 4K2LA 3K59A 2SNMA 3EA6A 1EEFD 2EJMA 1HTLD 1SFOB 4K14A 1F77A 2L12A 5CR3A 3I4MB 4OO1I 1SNPA 3OMCA 4C3HG 5C0XH 3NUCA 1SBBB 5FLXE 2J0TD 3HOYB 2QEJC 2FJ2A 2K32A 3IKJA 4DU9A 2YU9B 2F0QA 5JPNC 4FNFA 1PFNA 2DY7A 2EYFA 2G9DA 1RTNA 1PFBA 3NTHA 4G7HC 1SNOA 1OXVA 3T13A 1BNZA 3U9OA 2LMCB 2A5HA 2V4DA 2BCOA 1SNCA 2K33A 5BN5A 4RAUC 4XYQA 3QOJA 1PXUA 4C3IG 3G6JB 4DN4M 1SNQA 3T56B 4DNTB 3FMCA 2CW0D 2K03A 3BDLA 2F4IA 3X3NA 1SSOA 1EY7A 1TR5A 1JORA 1TS5A 2EOTA 4B9XA 1RF2D 1FR3A 3GP7A 1LTBD 3DHQA 2KCCA 2JXMB 3H0GB 3MTSA 3HGBA 4BA2I 2X6GA 3QO2A 4C56C 4IFDJ 3I90A 5KRUA 4IFDI 4KJNA 3OIPA 5IGCA 3BS1A 2RA4A 2AQ2B 5C4ZA 4G57A 1WVLA 1B44D 3C3LA 4TKOB 1EYAA 5BN4A 2NTTA 1BCPC 3I4LA 1QCBD 3C2PA 4XQQA 5IGEA 3BVMA 1E0BA 1FYCA 5C3WA 4K5WA 3HG9A 5M5YB 4X3KA 3URYA 4U68A 5JEAG 2NBFA 4FF1A 1XTCD 1Q1EA 2F0VA 3HOUB 1LTSD 2CQAA 2TSSA 1BQQT 3ND9A 1SNDA 2NYZD 4CJ0B 4EQOA 4OIJA 4JK1C 3Q22A 2PYKA 3NWTA 1VF7A 5FO9B 3BZDB 2PMZB 1A2TA 1X3QA 1F2YA 4L8JA 2O4XA 1GUNA 1R4PB 1UUPA 1IW7D 5C3EB 3S2DB 4XXEA 1AW7A 1G291 1CHPD 2ID0A 3H94A 5E4WC 3K5MA 2D2CC 1ESRA 2FMCA 3LX0A 5D3DA 3S15B 1I4PA 2B39A 3MC0B 1SYEA 4RCOA 3I73A 2B2VA 4M1UB 3PIP3 4R8IA 2RQXA 1W6JA 5E3FA 2F0DA 2IJ0A 2I07B 2B2YC 1GUOA 1WTOA 4ILWA 1Y8OB 3OWFA 4KY7A 1T5XD 5JJZA 1C4QA 4XT3B 2PO4A 1STEA 1B4OA 2Z4IA 1HA6A 1Q12A 5IODA 4FYDA 5I9OA 5I2XA 2AWNA 2XWBB 4X3TA 5EQ0A 2B2WC 4RGOS 1GJXA 1GUWA 1SJED 1W6KA 5C0XG 2XRSD 1KABA 1EWHA 1CA6A 5EPJA 3FKIB 3TP8A 2FFKB 1GHJA 1NSNS 2OT2A 4HAEA 1J9OA 4F88A 3UI2A 2R3ZA 2XSCA 3VYRA 3KF8A 1IW7C 2N88A 5KYIA 3PO2B 2NN6G 5CGKA 3TBIB 4KN7C 2E2HB 3M3YB 3MFGA 1V1PB 1D6EC 3EROA 2H1EA 5A2QE 1D2BA 1ILQA 1SMYC 3RZDB 1A15A 1G2SA 3MXNA 3I3CA 4IALA 1ZKOA 2PPBC 1EY6A 1KAAA 3M7GA 4PNYA 5CC4A 3TSSA 4IUPA 2F03A 5CV5A 4KI0A 3I72A 3EFXD 2HDLA 3G7LA 3K58A 2BE5C 2VB2X 3Q23A 4BA1I 1U4PA 4KKTA 1CK1A 4RHRA 4LK1C 4C3IB 5IOCA 3FPPA 4RGMA 1STHA 2KHSA 3NWSA 4IZ8A 3ZYYX 5KEEA 1ET6A 1MSHA 5JOBA 2NB0A 2HDMA 1RKNA 5C6AA 3DMUA 4H7BA 4ZYSA 1SNMA 5E4XA 4NKLA 3BDCA 4KV6A 5FKAC 1WTXA 1EY5A 4BY7B 1F9QA 2WACA 4X3SA 5ISRA 5CORA 3M4OB 2ENBA 1PZJD 2EYHA 2YYZA 2CHBD 2F0EA 5I4DA 1TWAB 1O80A 1LT6D 3DM1A 3NP8A 1G91A 3KBGA 4QUCA 4E6IA 4LMQD 1RJTA 2DN8A 1BCPD 5COYA 2WAQB 1Y8PB 3TDQA 5C0XI 2SEBD 4UDUC 4A3IB 3K5LA 2ZXPA 1OXTA 2CW0C 1BBXC 4ZKBB 4GZYC 2E74C 1F9RA 1KDBA 2XVSA 3PUWA 1V8QA 2KVMA 2OEOA 1PZID 4C3JB 3DEPA 3J81L 1DOLA 2L9HA 2MJ8A 3HOZB 2R92B 2F0KA 1OO9B 2NWGA 3MZ5A 3QOLA 3I91A 3TMEA 2N55A 3R8BA 4N9TA 4A3DB 2G9HD 3K6OA 3D4RA 3OHXC 5CV6A 1M4VA 1Z7TA 1WCMB 3BYYB 1EU4A 4HEDA 4IUNA 2EXZA 1JCKB 3MAQA 1RDPD 2K28A 3S16B 3T51B 5LHY1 4HCSA 2HQEA 4YIJA 4XDXA 2KCNA 3J7AF 1WD1A 5JEAJ 3SK5A 5D65A 2DY8A 4XT1B 3VR2A 3RZOB 3T16A 2DNCA 2IX0A 2EJGC 3K7AB 4NW2A 4KTAA 2SNSA 1TWFB 4IUTA 1HA5A 1WTRA 5EKLA 1EWCA 3NPPA 2LFNA 3DWAA 4J8QA 1EY4A 4A93B 3GD7A 2IL8A 1XXGA 3Q24A 3TN2A 2AUKA 5EPLA 4LJZC 1UEAB 1XWEA 1IHZA 5G3LD 2ZT9C 3NSWA 1B9MA 3QIAA 4H13C 4ZRZA 5J1ZA 2K6AA 1AP0A 1AEXA 3GTPB 4KD3A 5C4HA 2QKIC 3J80L 2OF1A 1HXYD 3FPUB 1RD9D 5F2DA 5DAUA 4KY6A 2F0UA 4F7XA 1TWCB 4OL7A 4FF3A 2ICIA 2L11A 2A68C 3K5NA 5HURA 4K5XA 2J4XA 1I3QB 4QIWB 2EYPA 5C0XJ 1SE4A 1TVXA 2J7ZA 3HKZB 1JOOA 2B63B 4HSPA 1A3UA 3V2TA 4I65A 1K8OA 2LKVA 2B8FA 2M2LA 1QB5D 4B08A 4J1MA 1PTOD 4QF4A 2A74C 1JOKA 2B8GA 1LT4D 2CVRA 5EKKA 3SK4A 5KNCA 2ICEC 3M85A 3V96A 4H44C 3NTIA 3OMGA 2IX3A 1ONLA 4AYBB 3R93A 1MSGA 2AQ1B 4CKCA 3LWEA 3DXJC 3J7AV 4NP5A 2NTSA 2KUMA 3NK9A 5EBCA 1HCZA 3HS0C 5J22A 3PUVA 3NQTA 4A3GB 3S1NB 2F0TA 1F9SA 4HN7A 2KQ3A 1MBYA 1EOTA 3U9SA 1HHVA 1PRTB 4L63B 3VA5A 2NVYB 4ZAIA 3BDOA 4IFDH 2PNRC 2R61A 4WJWA 3D4WA 1D1KA 2EY2A 3KLSA 1IYVA 3GQBA 4N9PA 4QUFA 3GV6A 3MWYW 5A35A 3GTKB 4BBRB 1XYIA 1CZWA 3HOVB 2E75C 2QF7A 2X69A 4HCEA 4R8NA 5I6YA 4DXGA 1I4RA 3A7AB 2E76C 2MHVA 5M5XB 1HTPA 1ENCA 4C2MB 4BS9A 4ZK9B 2C5CA 1DOKA 4ODGA 4HTHA 2XN9C 1HFGA 1PRTC 1I4GA 3WDNA 2RSNA 4CGYB 3IAYA 1SAPA 4EQNA 4OGQC 4Y7NB 3SK8A 3D4DA 1BR9A 4I7ZC 3X3MA 1DONA 3JAML 4CKEA 4FXGC 1WTPA 3PUZA 2DNEA 3A54A 4DNRB 1ZYRC 1E2ZA 1S5FD 1EU3A 1FD7D 1NUCA 3H6MA 3OPOA 1ZYRD 5AFWA 4K6DA 5FO7B 2F0OA 3P1HA 2K5QA 3CU7A 4B9WA 3IFTA 1VMPA 2VXWA 4IFDG 2F0FA 2BOSA 1CQFA 1STAA 5ELEA 4OIKA 1PYWD 1HFNA 1SE2A 1JWMD 4EGVA 4O1NA 3PIO3 4KY5A 5CV8A 1QILA 1STNA 4WORA 2EY5A 4V190 4FF2A 1Y1VB 2NN6I 5CV7A 2RDHA 2WINB 3A55A 1HRJA 4IUQA 5IIFA 1PTOH 1ET9A 3P75A 2A6HC 4RGNA 4QCLA 3A8IE 4RH6A 1O7LA 1GHKA 4O42A 5LL6S 1BCPB 5G3LF 3RUZA 2H4OA 2K5WA 3S1MB 4F8MA 2B2VC 2EYMA 2PZUA 3MVVA 1B9NA 4ABNA 1KNAA 2MGSA 4ZQ3A 1O7YA 2O5IC 5K36G 2BDOA 1ZEQX 2K5DA 3CRKC 1VF5C 5ELFA 3ND8A 3C46A 4JBWA 3QB3A 4ULLA 3GO5A 3DEOA 4U673 5ELDA 3MFYA 1AFPA 3PMFA 3PV0A 3TZDA 4G4KA 2Q8RE 2EYLA 3WOEA 1K83B 2KJXA 1GUSA 2EDGA 5I2YA 2D62A 3VYTA 4IUVA 2E2IB 3GTMB 1I4HA 1B3AA 2OXPA 1QOHA 3M7NA 2F3WA 3A8KE 1EIGA 1U4LA 1H9RA 5CV9A 4XQJA 5KYLA 3I8ZA 2AUJD 3FDTA 1I50B 2B2YA 3T4AC 1RCVD 2WKDA 3N52A 5CMDA 3SEBA 2TMPA 3GTLB 1S4ZA 5C4XB 4K8JA 2ZXOA 2F0SA 5IT9E 2JEAI 3I4NB 2JA6B 4G7ZC 4DK1A 5I9PA 1A3VA 3SR1A 4OO1G 3E0JA 4A3KB 1E2VA 1DM0B 1RODA 4RFBA 1A6XA 3GTQB 2VUMB 2RBMA 2VB3X 4A3FB 1X32A 2QILA 1PRTF 1SYBA 4FVMA 2KEEA 5FOBB 3H09A 4EQPA 5EJWA 1TQOA 4RA8A 4IURA 1NR4A 5EBDA 4M8AA 1SXTA 1CT1D 2KA7A 1CTMA 4DAPA 2O2LD 1F2MA 1EY8A 4KMUC 2MPMA 1ENAA 2L4NA 4RKLA 1E2WA 1D5MC 3PUXA 4KHZA 2NVQB 1K8MA 5C4JB 3E6ZX 2E2JB 3OW7A 1I4QA 3BVGA 2WIIB 5IT9L 3KLRA 3MXUA 2EPBA 2X6LA 4RGTA 3MHBA 1Q1BA 4V0BA 1LTAD 1SYFA 4KJOA 5M9OA 1VMCA 3NTKA 5IGFA 4NMZA 5C3XA 1PTOC 2PW5A 1I6HB 2PW7A 2PQEA 3VR3A 2BA1A 5M5WB 5M3FB 3PO3B 1BO0A 3KK7A 1MD2D 2K1BA 5DNFA 1HUMA 3HOXB 4RWSC 5DM73 1JWUD 1EY0A 3C1FA 4KHVA 1PRTD 1G2TA 1H9MA 4DK0A 2JE6I 5K5PA 1C8CA 1RTOA 4PMBA 4XIGS 2F1MA 3VR4A 4PMCA 4XYOA 4DAVA 5T1GA 1TWGB 1KLGD 2L55A 1NCVA 3VYUA 1ML0D 2F0WA 3LNNA 1V1PA 1WTVA 1SDFA 3MEHA 2JA7B 1VDZA 4WFN3 1Q90A 3T53B 2A69C 5T1IA 2R93B 5J39A 1C48A 3DWPA 5A2QL 3SVMA 5C5MA 5IGGA 1BF4A 2BE5D 5M3MB 3TZUA 5ELBA 4A3JB 1PDQA 2Z4HA 5TSSA 1AZQA 3QJYA 5HGTA 4CJ2C 1JR0D 1FNVA 4QMGA 2K04A 1T5EA 3S1RB 1G6ZA 3VR6A 1CZGA 2Z8LA 2MUYA 4NDXA 5IGBA 1CFMA 5DM63 5JAVA 4ZLTF 1BXTA 1IL8A 4BWGB 4UAIA 5C44B 1H9SA 1TY0A 1CQVA 2A73B 2IX1A 4TRDA 1SJHD 2EJFC 2EY1A 1RHPA 1VCIA 1II3A 3IL8A 3LWUA 1PTOB 1KDCA 2Q8TA 2EZVA 4HSVA 2B2UC 1LTGD 2K7VA 2L5TA 4FO2A 1QNKA 2QDBA 3L9AX 2F0LA 2B2TA 3Q0AA 1OXUA 2RKSA 1UNSA 1B2TA 2XWJB 1OXSC 3C1EA 3BYTB 2F0HA 1Q8IA 3KBXA 3TP6A 3OWEB 4FXDA 1JQYD 4FP5D 3QG1A 3GTGB 2XNAC 2A69D 1GUGA 4KK7A 1MI2A 3ITPA 3W3AA 3P7JA 1YNJD 1TS3A 4XQNA 3F2UA 3SXHA 3H91A 2SDFA 1S5BD 1HQMC 2NZ1D 4MIUA 2Y0SB 1TS2A 1JE4A 5I6WA 3KUPA 1L0XB 4DXFA 4BY1B 1D5ZC 2MP1A 3J7YW 2JEBI 5JPMC 2EY6A 3HP3A 1QWYA 2L1BA 1B1ZA 3PUYA 1KDAA 2BDNA 2KEDA 3D3RA 1EY9A 2EYJA 1SYDA 4H0LC 1D5XC 2FINB 2XRQD 2AQ3B 2KECA 3J81E 5JVH3 4CHTB 2NUCA 4CJ1B 3L3OC 1U4RA 1LO5D 2JA8B 3R2TA 3IFDA 2F0IA 1BOSA 1WTWA 3O13A 1LLRD 2HCCA 3EJIA 2PZWA 1YNND 2I46A 2BA0A 5KNDA 4G7OC 1V43A 4TSSA 2D9UA 5C5LA 3HEJA 2A6ED 1STBA 1PTOF 3ERQA 3K0YA 1LTRD 3OOCA 1FGBD 5JEAH 1KTKA 1TT2A 2GA4B 2L0CA 2RSOA 2PZTA 4DAYA 1KNEA 2FMMA 3D6CA 4MN3A 4ZKCB 1R4QB 2RDFA 1IYUA 1L0YB 1F9PA 2F0MA 2D5DA 1B50A 1LABA 1DZ1A 2F0GA 4DF7A 4HR7B 4A3EB 2JYOA 3AU7A 5FLXL 1QG7A 1OXXK 1ILPA 3D6WA 3S17B 2LS01 4WRDA 4X3UA 2Q8IB 3VA7A 1EYCA 4DFAA 3K5OA 1M8AA 1H9KA 5NUCA 1A3TA 4J6HA 5D3IB 4CBVA 3RD4A 1PFMA 4ME5A 1U9RA 1R9TB 4C3HB 4PMWA 3OSOA 1D1IA 2LY7A 4MHEA 5CBEE 3HOWB 2R7ZB 5DEHA 1EQTA 2O5JC 3OIQA 1BDOA 4K5VA 1DD2A 4EVOA 1FNUA 2E2DC 2RVLA 3S1QB 3TP7A 3JAME 1B53A 3R2IA 4R9WA 1LV9A 3A7LA 3GTOB 4BBSB 1TIID 4P2CB 5KGUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OXS C;  1TKW B;  2AWO A;  3LNN A;  1Y8O B;  3I4L A;  2A6E D;  4TQU S;  2BE5 C;  1Y8N B;  3OPO A;  2A68 D;  3U9S A;  4KMU C;  4BA1 I;  1GUS A;  2EDG A;  4KKT A;  1HPC A;  1E2W A;  3OOC A;  4LK1 C;  1CI3 M;  5JEA H;  4G7H C;  1FYC A;  1YNJ C;  1VDZ A;  3BDO A;  1OXV A;  3A8J E;  3FPP A;  3PUX A;  1Q90 A;  3D4R A;  1H9J A;  2PNR C;  4KHZ A;  3T53 B;  4IFD H;  1K8M A;  3IFT A;  2D62 A;  2LMC B;  1Q12 A;  2A69 C;  3QG1 A;  4IFD G;  1DCZ A;  1IYV A;  1Z7T A;  2R6G A;  2A68 C;  1GUT A;  5JEA G;  2V4D A;  3GQB A;  3OW7 A;  3M7N A;  2K33 A;  3A8K E;  2A69 D;  1GUG A;  5A35 A;  1Q1E A;  1H9R A;  3KLR A;  3W3A A;  5BN5 A;  2IT1 A;  1PMR A;  3MXU A;  3T51 B;  2E75 C;  1GJX A;  3M4Y A;  4KN4 C;  4PV1 C;  2QF7 A;  1IYU A;  2BE5 D;  2A6E C;  3ND9 A;  3TZU A;  1HQM C;  1Q1B A;  2NN6 I;  5C0X G;  2D5D A;  2AUJ D;  2PCF B;  4KKS A;  4JK1 C;  1LAB A;  3T56 B;  3RLF A;  1EWH A;  3D31 A;  3QJY A;  4DNT B;  3A7A B;  1LAC A;  2E76 C;  3FMC A;  1VF7 A;  1K8O A;  1GHJ A;  4HR7 B;  2YYZ A;  2NN6 H;  3VR2 A;  5K36 H;  1DXM A;  1YNN C;  1T5E A;  2JEB I;  1OXX K;  2DNC A;  3NE5 B;  2EJG C;  3N6R A;  4L8J A;  2B8F A;  3VR3 A;  1HTP A;  2A6H C;  3VR6 A;  3A8I E;  2BA1 A;  1QJO A;  2Q8I B;  1O7L A;  3EQL C;  3PUY A;  1GUN A;  4RCN A;  1GHK A;  1IW7 D;  4OO1 H;  3VA7 A;  1IW7 C;  3CRL C;  2DN8 A;  1CFM A;  1FR3 A;  1G29 1;  1H9K A;  3WDN A;  2B8G A;  2JEA I;  2A6H D;  3BG3 A;  1Y8P B;  1Z6H A;  2NN6 G;  3H94 A;  5KNC A;  4H0L C;  1H9S A;  4OGQ C;  2D2C C;  4G7Z C;  3M85 A;  2KCC A;  4H44 C;  4DK1 A;  1O78 A;  2JXM B;  2EJF C;  4KN7 C;  3AB9 A;  1OXT A;  5BN3 A;  2CW0 C;  1VCI A;  3GD7 A;  1B9N A;  1ONL A;  4GZY C;  2AUK A;  2E74 C;  4OO1 G;  4LJZ C;  5KNB A;  4I7Z C;  3PUW A;  1V8Q A;  1SMY C;  3P20 A;  1E2V A;  3HGB A;  4IQZ A;  2O5I C;  2ZT9 C;  3LWU A;  4BA2 I;  1B9M A;  3QIA A;  3DXJ C;  1A6X A;  2EJM A;  2O5J C;  3SDZ A;  4H13 C;  5K36 G;  1BDO A;  3I73 A;  3PUZ A;  1DD2 A;  2BDO A;  1H9M A;  1ZKO A;  3SE0 A;  4DK0 A;  2JE6 I;  2PPB C;  3CRK C;  4XTC S;  1VF5 C;  2DNE A;  3ND8 A;  4XIG S;  1Y69 U;  4JBW A;  2F1M A;  3VR4 A;  2BA0 A;  2K7V A;  2L5T A;  4DNR B;  1ZYR C;  5KND A;  1E2Z A;  1HCZ A;  5C0X H;  4G7O C;  1TU2 B;  3A7L A;  1OXU A;  1V43 A;  4KKU A;  4TKO B;  2EVB A;  1I6V C;  3VR5 A;  3MFY A;  4KI0 A;  2KA7 A;  3PUV A;  1H9S B;  3I72 A;  3PV0 A;  1GUO A;  5BN4 A;  2K32 A;  3IKJ A;  3L7Z C;  1CTM A; 
#chains in the Genus database with same CATH topology
 1TKW B;  1LTT D;  1KRT A;  4C3J G;  3K57 A;  3ER0 A;  1VQL A;  2CKZ B;  1IKL A;  2SOB A;  3MXG A;  1HUN A;  4RKB A;  4S3S A;  2A68 D;  1V1O A;  5JJL A;  1XMO Q;  1LT5 D;  3RR5 A;  2R92 G;  5M3M G;  2UUA Q;  3CW2 C;  3E9H A;  3AMU A;  1TS4 A;  1YZ6 A;  1DCZ A;  3KF8 B;  1GUT A;  1RL2 A;  2IHF A;  4IOA A;  1G8Z D;  3HOY G;  1WI5 A;  4DV5 Q;  1HQR D;  4QY7 A;  4UP8 A;  4FF4 A;  2PNH A;  5EGT A;  1J8I A;  1AN8 A;  2IPK D;  3H15 A;  3E5S A;  4A3F H;  1ASY A;  3HOU G;  4WJ3 M;  2MO0 A;  2PQA A;  3M4Y A;  2EYO A;  3RMH A;  3VYS A;  2Y0S G;  2LXK A;  2E5L L;  3FRP B;  3J7A 5;  1EQV A;  1TWH B;  2HD3 A;  3RLF A;  3GTO H;  3EIV A;  2UXC Q;  1JWS D;  3QWN A;  3L0O A;  1LAC A;  1S5D D;  4CKB A;  1FJG L;  1WCM G;  4YY3 L;  4GKK L;  2WB1 G;  3V05 A;  2WB1 B;  5K36 H;  1DXM A;  4B3T Q;  2I0Q A;  3NE5 B;  3S1Q H;  3N6R A;  1FJG Q;  5LL6 X;  1PH1 A;  5IE8 A;  3D0F A;  3D8G A;  3ONA B;  5BR8 Q;  1X9N A;  3CRL C;  4DGZ A;  4DV3 L;  3R3O A;  1LT3 D;  4N8F A;  3W2D A;  1Z6H A;  1AZP A;  2A1A A;  1EIF A;  1KLU D;  2IW3 A;  1DJR D;  1O78 A;  1SYG A;  3HZX A;  3J80 E;  5CV4 A;  5BN3 A;  1BUV T;  2F3V A;  1YJW A;  3EBE A;  2F0J A;  1TXY A;  2IHE A;  3KLS X;  1HR0 L;  3NBI A;  4DR5 L;  4JI3 L;  4YCU A;  2UUC L;  1GXD C;  2WV6 D;  1JB3 A;  1NR2 A;  3SDZ A;  1SYC A;  4L5R C;  2VQE Q;  3SE0 A;  4XTC S;  1S5E D;  2CCZ A;  2UXB L;  3HFZ B;  3S9W A;  1EIH A;  3TS2 A;  4QB4 A;  5IGD A;  1S5C D;  2EVB A;  4GN5 A;  4LF8 L;  1CM9 A;  3FVQ A;  3H3V C;  4LF9 Q;  3BVZ A;  3L7Z C;  4RHS A;  2JA7 H;  3NEM A;  1EEI D;  1X56 A;  1Y8N B;  4PQX A;  3DWQ A;  1HPC A;  5D14 A;  1O7Z A;  1IKM A;  4GKJ L;  1U0L A;  5M5Y H;  4Q0F A;  1WD0 A;  1PH9 A;  1VQM A;  1JC7 A;  2JSO A;  1MGS A;  2R6G A;  3HRZ C;  2XIW A;  4CDF C;  1M90 C;  3MXP A;  2VQF Q;  4X65 L;  4A3B B;  2JP1 A;  5DLQ E;  1L0W A;  1ZXT A;  3NQI A;  1Z47 A;  1LTI D;  2IT1 A;  1Y1W B;  3J7Z C;  3S14 B;  3NXW A;  1N36 L;  1E1O A;  1I3Q H;  1SE3 A;  4PV1 C;  3A56 A;  2A6E C;  2PMZ E;  2F52 A;  1TY2 A;  5ELO A;  2OTJ A;  1N9W A;  3FEW X;  4A3M H;  1JT8 A;  2UXD Q;  5CBA E;  5FK9 C;  1WTQ A;  5BR8 L;  2NN6 H;  1A8V A;  4FXK C;  1XNQ L;  1EFI D;  1YNN C;  4OXP A;  4ZUI A;  2ZJQ A;  3WOF A;  4ID6 A;  3KJO A;  2F0N A;  1QJO A;  1ESF A;  3S17 H;  1CHQ D;  3EQL C;  1VQ7 A;  1QNU A;  2K05 A;  4OO1 H;  1A2U A;  1K3R A;  1I4X A;  1C7Y A;  3NBH B;  4OHJ A;  4DA2 A;  3CHB D;  2ZXR A;  4DR4 Q;  3BG3 A;  5ELC A;  4Q5V A;  2FHT A;  2E5L Q;  4OWX B;  1J5E L;  1UAP A;  1GOZ A;  4IPC A;  4JI4 L;  1VQF A;  4Z9C B;  5KNB A;  3T1H Q;  3P20 A;  1F2Z A;  4IQZ A;  3GTJ B;  4JPB W;  5JVG 3;  2B2T C;  1HNZ L;  2Z1C A;  2HCI A;  3AFP A;  2HHH L;  4C1N I;  1YHQ A;  2NVT B;  3S14 H;  1JOQ A;  3TP5 A;  4R4C A;  4JOI A;  1HJP A;  1EL0 A;  2C9O A;  2JA5 H;  1Y69 U;  3HKZ E;  2KEN A;  3I4O A;  3DUZ A;  2KOL A;  5FJ8 H;  4A3M B;  2UUA L;  1TU2 B;  4KKU A;  2I5M X;  1I6V C;  3VR5 A;  5HY6 A;  4AYB E;  4IUU A;  1VQP A;  1H9S B;  3GV3 A;  4ZUJ A;  2AWO A;  3TS0 A;  5GAG C;  3CQZ B;  1BCP F;  1X3P A;  4TQU S;  1ENF A;  1SEB D;  2EE1 A;  5EKI A;  2VNU D;  4A3B H;  4A3G H;  1CI3 M;  4LAA A;  3UDG A;  1YNJ C;  1XJV A;  3A8J E;  1H9J A;  1QZH A;  4L6T B;  3NHH A;  3RNU A;  4KHP Q;  4K2K A;  2WKC A;  4F87 A;  3SK6 A;  3FP9 A;  5CYU A;  3MA2 B;  1K8A C;  2R7D A;  1EZ6 A;  4HMJ A;  2WP8 J;  1PLF A;  2M9V A;  1U4M A;  2K01 A;  2DUD A;  1PMR A;  1EUJ A;  3SHL A;  3JAM c;  3Q6S A;  5E1F A;  2M00 A;  3Q8D A;  1DYQ A;  4IN3 A;  4KN4 C;  5IWA Q;  1QE6 A;  1PV4 A;  1DOM A;  3OW2 A;  2PCF B;  4KKS A;  1STG A;  1S40 A;  4X65 Q;  4X6A H;  1PH6 A;  3D31 A;  1Q3L A;  2ASB A;  2JA9 A;  2JA6 G;  1CA5 A;  1NBW A;  2JA5 B;  3CKI B;  2B2W A;  4KD4 A;  1PZK D;  2HUG A;  4HMI A;  4K8I A;  3HOW H;  1JIC A;  1SMY D;  2B2U A;  1NAP A;  3I70 A;  3NEN A;  1PH5 A;  1STY A;  2F0P A;  1FNW A;  3S2H B;  4C1N K;  2RDG A;  4RCN A;  5KIX A;  1EYD A;  1XX8 A;  5FO8 B;  3K8A A;  1EZ8 A;  1NJI C;  1CSP A;  2A6H D;  3NBH A;  1ICW A;  5EPK A;  3EVQ A;  2QCP X;  2NVX B;  1F2L A;  3AB9 A;  2IWH A;  1KIX A;  2VUM H;  3GTQ H;  4K6L A;  4K2L A;  2JA8 H;  3K59 A;  3G71 A;  4HID A;  2SNM A;  4QQB X;  3EA6 A;  1EEF D;  2EJM A;  3CAM A;  1VQJ A;  1K28 A;  1HTL D;  1SFO B;  3S16 H;  2K5H A;  4K14 A;  1F77 A;  2L12 A;  3PO2 G;  5CR3 A;  4YWK A;  3CCU A;  3I4M B;  4OO1 I;  1TWG H;  3PSI A;  3H3V H;  1SNP A;  3OMC A;  1XMQ Q;  4QIW E;  4C3H G;  5C0X H;  2VS1 A;  3ERS X;  1SBB B;  3NUC A;  1KL9 A;  5FLX E;  2J0T D;  3HOY B;  2QEJ C;  2FJ2 A;  1L1O B;  2K32 A;  3IKJ A;  1JMC A;  4DU9 A;  4R4I A;  2YU9 B;  3A0J A;  2F0Q A;  5JPN C;  4FNF A;  1PFN A;  2DY7 A;  2EYF A;  2G9D A;  1RTN A;  1PFB A;  3NTH A;  3CCJ A;  4G7H C;  3I2Z A;  4B3R Q;  1SNO A;  1OXV A;  3F2B A;  3T13 A;  1BNZ A;  3U9O A;  2LMC B;  2RCF A;  2A5H A;  1HNZ Q;  2V4D A;  2BCO A;  3BZK A;  2GVA A;  4IPG A;  4DR2 L;  1SNC A;  2K33 A;  2KHJ A;  4LF4 L;  2MNA A;  5BN5 A;  3T1Y L;  1YHA A;  1FGU A;  4RAU C;  1EYG A;  1VQD A;  4XYQ A;  4GOP C;  3QOJ A;  3ULJ A;  1PXU A;  4C3I G;  4FDB A;  3T1Y Q;  3G6J B;  2LSS A;  4DN4 M;  1SNQ A;  1NY4 A;  3T56 B;  4JI5 Q;  4J15 A;  4DNT B;  3HKS A;  2KCT A;  3FMC A;  3FKI G;  2CW0 D;  3PF5 A;  2PI2 E;  2K03 A;  3BDL A;  4LF8 Q;  2F4I A;  3X3N A;  1SSO A;  1EY7 A;  2K52 A;  1TR5 A;  4H02 A;  1JOR A;  1TS5 A;  4LFA L;  2EOT A;  4B9X A;  3GTL H;  1RF2 D;  1FR3 A;  1PH2 A;  4O0A A;  1VQE A;  3GP7 A;  1LTB D;  2YTY A;  1YI2 A;  3H0G G;  3DHQ A;  3KF6 A;  2KCC A;  4LUV A;  2JXM B;  3H0G B;  2RCN A;  3S2D H;  3RZD H;  3MTS A;  3HGB A;  4BA2 I;  3CC2 A;  2X6G A;  3QO2 A;  4C56 C;  1IBM Q;  4IFD J;  2JQO A;  3HOW G;  3I90 A;  1Q86 C;  5KRU A;  4IFD I;  4KJN A;  3OIP A;  5IGC A;  3BS1 A;  2OCE A;  2RA4 A;  2AQ2 B;  4G57 A;  5C4Z A;  1WVL A;  1B44 D;  1Y1V H;  4YHH L;  1X3G A;  3C3L A;  4TKO B;  1EYA A;  3OTO Q;  2NVY H;  4LF9 L;  5BN4 A;  2NTT A;  2OTL A;  5GRO A;  1BCP C;  4YHH Q;  3I4L A;  1QCB D;  3C2P A;  3U4Z A;  4XQQ A;  5IGE A;  3BVM A;  3CQZ H;  1E0B A;  1RIP A;  5IP9 G;  1HZ9 A;  4HJ8 A;  1FYC A;  1O7I A;  1KXL A;  5C3W A;  4P75 A;  4K5W A;  3HG9 A;  3J80 c;  5M5Y B;  4X3K A;  4KLK A;  1JE5 A;  4UPA A;  3URY A;  1VQA A;  4U68 A;  5JEA G;  4JI0 L;  2NBF A;  4FF1 A;  2NVQ H;  1HR0 Q;  1XTC D;  1AE2 A;  4YWM A;  5L37 A;  3G6E A;  1Q1E A;  4JI2 L;  1GD7 A;  1NMG A;  4A3D G;  2F0V A;  3HOU B;  1EOV A;  1LTS D;  2CQA A;  2TSS A;  3S15 H;  1BQQ T;  3ND9 A;  3CCM A;  1SND A;  2NYZ D;  4CJ0 B;  4EQO A;  4OIJ A;  1Y14 B;  1Y1V G;  4JK1 C;  4POG A;  3CCL A;  3Q22 A;  1B70 B;  2PYK A;  3NWT A;  3M4Q A;  4AIM A;  2OWO A;  3M4O H;  1IBM L;  1VF7 A;  5FO9 B;  3BZD B;  2PMZ B;  1A2T A;  4APV A;  1X3Q A;  1F2Y A;  4L8J A;  4IJH A;  1P8L A;  4A3K G;  2O4X A;  1GUN A;  1R4P B;  1UUP A;  1IW7 D;  5C3E B;  4X64 L;  3S2D B;  1QVG A;  4XXE A;  4YY3 Q;  1AW7 A;  1G29 1;  1CHP D;  3H0G H;  2ID0 A;  4DR3 Q;  3H94 A;  5E4W C;  3K5M A;  2D2C C;  1ESR A;  2FMC A;  4LFA Q;  3ZJY C;  3LX0 A;  5D3D A;  3CXC A;  4DV5 L;  3S15 B;  4I7A A;  1I4P A;  1UWV A;  5LMN L;  2B39 A;  2NZO A;  2VW9 A;  3MC0 B;  4JVZ A;  1SYE A;  4RCO A;  4BBR H;  4L5T A;  3I73 A;  4JYA L;  2B2V A;  3HOZ G;  3FKI H;  3DLL A;  4M1U B;  4CDE C;  3PIP 3;  4R8I A;  2RQX A;  1W6J A;  5E3F A;  2F0D A;  2IJ0 A;  3RN2 A;  1XNR L;  4HJ7 A;  2I07 B;  2B2Y C;  1GUO A;  4DR2 Q;  1WTO A;  4ILW A;  1Y8O B;  2KHI A;  3OWF A;  4KY7 A;  3F2D A;  1Q7Y C;  1T5X D;  1C4Q A;  4XT3 B;  5JJZ A;  2PO4 A;  1STE A;  3TEH B;  1B4O A;  2Z4I A;  3PIO A;  3M3Y H;  1HA6 A;  1Q12 A;  5IOD A;  3CC7 A;  4BXX G;  2ZTC A;  1UE6 A;  4FYD A;  5I9O A;  5I2X A;  2AWN A;  2JA5 G;  4Y52 H;  2XWB B;  4X3T A;  5EQ0 A;  5IY0 A;  2R7Z H;  3U58 A;  3GTK H;  2B2W C;  1XMQ L;  4RGO S;  1GJX A;  1GUW A;  4DV2 Q;  1SJE D;  1W6K A;  5C0X G;  2XRS D;  1KAB A;  1EWH A;  1CA6 A;  5EPJ A;  1TWC H;  3FKI B;  3TP8 A;  2FFK B;  1GHJ A;  1NSN S;  1UE7 A;  4DPG A;  3MEF A;  4LUZ A;  2OT2 A;  4HAE A;  1JJC B;  5C3E H;  1J9O A;  4F88 A;  1VQ5 A;  3UI2 A;  2R3Z A;  2XSC A;  2KBN A;  4DV3 Q;  3VYR A;  3KF8 A;  4UHV A;  1IW7 C;  1UE5 A;  1JB7 A;  3UDX A;  2N88 A;  2CQO A;  5KYI A;  3PO2 B;  2B63 G;  2NN6 G;  5CGK A;  2WFW A;  3K80 C;  3TBI B;  3PO3 H;  1FL0 A;  4BY1 G;  4KN7 C;  2E2H B;  3M3Y B;  3MFG A;  1V1P B;  1QUQ A;  3ERO A;  1D6E C;  1TWF H;  2H1E A;  5A2Q E;  1ILQ A;  1SMY C;  1D2B A;  3RZD B;  3KDF B;  1A15 A;  1G2S A;  3MXN A;  3I3C A;  5FLX c;  1GM5 A;  4IAL A;  1ZKO A;  3I56 A;  3EN2 A;  1Q82 C;  2PPB C;  1NE3 A;  1EY6 A;  1KAA A;  3M7G A;  4B3M L;  4PNY A;  4OX9 Q;  1CKN B;  3TSS A;  5CC4 A;  4JCV E;  4IUP A;  2F03 A;  5CV5 A;  4B3S Q;  4KI0 A;  3I72 A;  3EFX D;  2HDL A;  1S3O A;  2QEX A;  3G7L A;  4DR7 Q;  1NNX A;  3K58 A;  2OQK A;  2BE5 C;  5LMN W;  2VB2 X;  3Q23 A;  4BA1 I;  4LUO A;  1U4P A;  3UE1 A;  5AJ3 Q;  4KKT A;  1CK1 A;  4RHR A;  4LK1 C;  2ES2 A;  4C3I B;  5IOC A;  3GTG H;  3FPP A;  4RGM A;  1STH A;  2KHS A;  4GKK Q;  3NWS A;  3CC4 A;  1YJ9 A;  4DKA C;  3I4M H;  2R92 H;  1X54 A;  4IZ8 A;  3ZYY X;  2ATW A;  1V9P A;  5KEE A;  1FVI A;  1YNX A;  1ET6 A;  1MSH A;  5JOB A;  2NB0 A;  1XNR Q;  2HDM A;  3CPW A;  2I5H A;  1RKN A;  1K0S A;  5C6A A;  3DMU A;  4H7B A;  4LF6 Q;  4ZYS A;  1SNM A;  2ZM6 Q;  4X62 Q;  5E4X A;  4NKL A;  3BDC A;  4KV6 A;  5FKA C;  1WTX A;  1EY5 A;  4BY7 B;  2R93 G;  1F9Q A;  2WAC A;  4X3S A;  5ISR A;  5COR A;  3M4O B;  5JJI A;  2ENB A;  1PZJ D;  2EYH A;  2YYZ A;  2CHB D;  2F0E A;  5I4D A;  3QR8 A;  1TWA B;  4BBR G;  1O80 A;  1LUZ A;  1LT6 D;  3DM1 A;  3J80 i;  3NP8 A;  3CCQ A;  1G91 A;  1AH9 A;  3KBG A;  4QUC A;  4DUY Q;  1KD1 C;  4DAY B;  4E6I A;  4LMQ D;  1RJT A;  4A3J G;  2DN8 A;  1BCP D;  5COY A;  4P73 A;  2WAQ B;  1Y8P B;  3TDQ A;  1PFS A;  5C0X I;  2SEB D;  4UDU C;  4A3I B;  3W1G A;  3K5L A;  2ZXP A;  4A3E G;  1OXT A;  2CW0 C;  1BBX C;  4ZKB B;  4GZY C;  4LF5 L;  2E74 C;  1F9R A;  1KDB A;  4BBS G;  2XVS A;  3PUW A;  1V8Q A;  2KVM A;  1GVP A;  3G48 A;  2OEO A;  1VQB A;  1PZI D;  4C3J B;  1D8L A;  3DEP A;  2UXD L;  3J81 L;  2QW7 A;  1DOL A;  2N8N A;  1Y1W H;  3STB C;  2L9H A;  2MJ8 A;  3HOZ B;  3BU2 A;  2R92 B;  4DK6 C;  5IWA L;  3KFU A;  2F0K A;  1OO9 B;  2PI2 A;  5C44 G;  2NWG A;  3MZ5 A;  4GNX B;  3I4M G;  3QOL A;  1I50 H;  1B8A A;  1N36 Q;  4DV6 Q;  4OON A;  3STB D;  3I91 A;  2K5V A;  3TME A;  1VQ4 A;  2N55 A;  3R8B A;  3CME A;  3S2H H;  4N9T A;  4A3D B;  2G9H D;  3K6O A;  2UUB L;  3UDF A;  2Q2U A;  3D4R A;  4L5S A;  1E1T A;  3OHX C;  3G4S A;  5CV6 A;  1M4V A;  1Z7T A;  3U4V A;  1WCM B;  3BYY B;  4HED A;  1EU4 A;  4IUN A;  2EXZ A;  1JCK B;  3MAQ A;  3F8T A;  1EQQ A;  1RDP D;  2K28 A;  2NVT H;  2A8V A;  3S16 B;  3T51 B;  5LHY 1;  4HCS A;  3JAM i;  3GTJ H;  2HQE A;  4HJ9 A;  4YIJ A;  1X55 A;  4XDX A;  2KCN A;  4LF4 Q;  3J7A F;  4DV1 L;  1IL2 A;  4DR4 L;  3J81 j;  1WD1 A;  5JEA J;  3SK5 A;  4DR5 Q;  2UUC Q;  1VS0 A;  5D65 A;  2LXJ A;  2DY8 A;  4XT1 B;  3VR2 A;  2B63 H;  3RZO B;  3T16 A;  2DNC A;  2P5Z X;  2IX0 A;  4HJ5 A;  2EJG C;  3K7A B;  4NW2 A;  4KTA A;  2SNS A;  1TWF B;  3A5Z B;  4IUT A;  4A3C H;  1HA5 A;  5GQO A;  1WTR A;  5EKL A;  4JI6 Q;  1AE3 A;  4HIO A;  1EWC A;  3NPP A;  2LFN A;  3DWA A;  4J8Q A;  1EY4 A;  2JA6 H;  1XNQ Q;  4A93 B;  3GD7 A;  2IL8 A;  1XXG A;  3Q24 A;  3TN2 A;  2AUK A;  5EPL A;  4LJZ C;  1UEA B;  1XWE A;  1N34 Q;  1IHZ A;  5G3L D;  2ZT9 C;  1PYS B;  3NSW A;  1B9M A;  3QIA A;  4NB3 A;  1KRS A;  5C3E G;  3RLN A;  4H13 C;  2NVX H;  1E7Z A;  4ZRZ A;  5J1Z A;  2K6A A;  2JK8 A;  4DNI A;  1GO3 E;  1AEX A;  1AP0 A;  1XMO L;  3UDI A;  3GTP B;  4KD3 A;  5C4H A;  2QKI C;  1MJC A;  3J80 L;  4BXX H;  2VQF L;  2OF1 A;  1HXY D;  4DUZ L;  3FPU B;  1RD9 D;  5F2D A;  5DAU A;  4NXN Q;  1VQH A;  4KY6 A;  2F0U A;  4F7X A;  2RF4 A;  4IPH A;  3K81 C;  3S1N H;  1E3P A;  1TWC B;  4OL7 A;  4FF3 A;  1HZB A;  4DK3 C;  2D0P A;  2ICI A;  2L11 A;  2L15 A;  2A68 C;  1WOC A;  3K5N A;  5HUR A;  2YV5 A;  4K5X A;  1EWI A;  2J4X A;  1I3Q B;  4QIW B;  2EYP A;  3OTO L;  1LM0 A;  5C0X J;  1SE4 A;  2UXB Q;  1TVX A;  2J7Z A;  3HKZ B;  4JYA Q;  2N78 A;  1SLJ A;  1SN8 A;  3K7A H;  1JOO A;  2KCM A;  4BY7 G;  2B63 B;  4HSP A;  1A3U A;  3V2T A;  4I65 A;  4GLA C;  2HT1 A;  3HOZ H;  1K8O A;  1KHI A;  2QGQ A;  2F4V L;  4GOP A;  2LKV A;  5FLM H;  2B8F A;  2M2L A;  1J6Q A;  2A19 A;  1QB5 D;  4B08 A;  4J1M A;  2VUM G;  3PCO B;  4B3T L;  2ZTD A;  1UE1 A;  1PTO D;  4QF4 A;  2A74 C;  4OWT B;  1JOK A;  2B8G A;  1LT4 D;  2CVR A;  2WAQ G;  5EKK A;  4JI8 L;  2UXC L;  1BBW A;  4A93 H;  3SK4 A;  4A4I A;  5KNC A;  2ICE C;  4EQ5 A;  4GOP B;  1Q46 A;  3V96 A;  3M85 A;  4H44 C;  4A3I H;  3NTI A;  3OMG A;  4A3M G;  2IX3 A;  1ONL A;  4AYB B;  3PQI A;  5IYD G;  3R93 A;  1MSG A;  1PH7 A;  2AQ1 B;  2MO1 A;  4DV4 Q;  4CKC A;  3LWE A;  3DXJ C;  3IRB A;  3J7A V;  5M5X H;  4NP5 A;  2NTS A;  4A3D H;  3HOV H;  4JW0 A;  1CSQ A;  3ICE A;  2V1C C;  1A63 A;  3CMA A;  2KUM A;  2QDL A;  3NK9 A;  5EBC A;  1HCZ A;  3HS0 C;  5J22 A;  3PUV A;  4IPD A;  3NQT A;  4DV4 L;  4A3G B;  3S1N B;  2F0T A;  3ULP A;  4JG2 A;  1F9S A;  2R7Z G;  5LMN Q;  4OWW B;  4HN7 A;  2KQ3 A;  1MBY A;  1EOT A;  2CWP A;  5J3B A;  3U9S A;  1HHV A;  1PRT B;  3K0X A;  4L63 B;  2E2J H;  3VA5 A;  2I5L X;  1QZG A;  2NVY B;  4ZAI A;  3BDO A;  1JJ2 A;  4IFD H;  2PNR C;  2R61 A;  4WJW A;  4EX5 A;  3D4W A;  1D1K A;  2EY2 A;  3KLS A;  5GAE C;  1IYV A;  1VQN A;  3GQB A;  4N9P A;  4QUF A;  3GV6 A;  3MWY W;  3CD6 A;  2IY5 B;  1VQG A;  3CCS A;  5A35 A;  3GTK B;  4BBR B;  1XYI A;  1SFO H;  1K83 H;  1CZW A;  3HOV B;  3M4P A;  2E75 C;  2QF7 A;  2HIV A;  2X69 A;  4HCE A;  1U5K A;  1HR0 W;  4R8N A;  5I6Y A;  5FJ8 G;  4DXG A;  2CH4 A;  4GS3 A;  1I4R A;  4A3L G;  3A7A B;  5HGQ A;  1V1Q A;  2E76 C;  2MHV A;  5M5X B;  2VL6 A;  4JI4 Q;  1HTP A;  1ENC A;  4C2M B;  4BS9 A;  4ZK9 B;  2C5C A;  1DOK A;  4ODG A;  2EIF A;  4P74 A;  4YCV A;  4IOC A;  1L1O C;  4HTH A;  2XN9 C;  1HFG A;  1PRT C;  4BBS H;  1A0I A;  1I4G A;  1QVF A;  2DJG C;  1X3F A;  3WDN A;  2RSN A;  4NXM L;  4CGY B;  3IAY A;  1SAP A;  4CDC C;  1IXR A;  4EQN A;  2BH2 A;  4OGQ C;  4RMF A;  4DR6 L;  2Q2T A;  4Y7N B;  1S72 A;  1TWH H;  3SK8 A;  2Z6K A;  1VQC A;  1BR9 A;  3A74 A;  4I7Z C;  3D4D A;  2MFI A;  1VQK A;  3X3M A;  1DON A;  4DUZ Q;  3JAM L;  5IP7 H;  4CKE A;  4FXG C;  4DV0 L;  1WTP A;  1WTH A;  3PUZ A;  1KQS A;  3KDF A;  1DGS A;  1CKO A;  2DNE A;  1WFQ A;  3A54 A;  4DV7 L;  4DR6 Q;  1IZ6 A;  4DNR B;  1ZYR C;  1E2Z A;  1S5F D;  2Q2H A;  2K14 A;  1MJE A;  4LFC Q;  2RHS B;  1EU3 A;  1FD7 D;  3E3X A;  1PH3 A;  1NUC A;  3H6M A;  5M3M H;  2D0O A;  1MKH A;  4JI5 L;  2Z6B A;  3OPO A;  1ZYR D;  5AFW A;  4K6D A;  5FO7 B;  2F0O A;  1XPU A;  1HNW Q;  3P1H A;  1BVS A;  5C4J H;  2K5Q A;  3CU7 A;  3AYH B;  3IFT A;  1VMP A;  4B9W A;  2VXW A;  4IFD G;  2F0F A;  2BOS A;  1CQF A;  1STA A;  5ELE A;  4OIK A;  1PYW D;  1HFN A;  1SE2 A;  4X64 Q;  4UP9 A;  1MIU A;  1JWM D;  2Z0S A;  1L2F A;  4GNX A;  4EGV A;  4O1N A;  3PIO 3;  4KY5 A;  5CV8 A;  1SR3 A;  1QIL A;  4JBJ A;  1STN A;  4WOR A;  2EY5 A;  2E8G A;  4V19 0;  4FF2 A;  2UUB Q;  1Y1V B;  2NN6 I;  1EIY B;  3GDE A;  5CV7 A;  4Y7N H;  2RDH A;  3H3V I;  2WIN B;  3A55 A;  1HRJ A;  4IUQ A;  2Z9H A;  5IIF A;  4UP7 A;  1PTO H;  1ET9 A;  3P75 A;  4DV7 Q;  2A6H C;  4RGN A;  4QCL A;  4N8X 1;  3A8I E;  4RH6 A;  1XPR A;  5M3F H;  1O7L A;  1GHK A;  4O42 A;  5LL6 S;  1BCP B;  1G51 A;  3F1Z A;  2ZJP A;  1C0A A;  5G3L F;  4WJ4 A;  3RUZ A;  3PO3 G;  2H4O A;  1IBK L;  2K5W A;  3HOX H;  3S1M B;  4F8M A;  2B2V C;  2EYM A;  2PZU A;  3MVV A;  1B9N A;  4ABN A;  1YHB A;  1KNA A;  2MGS A;  4ZQ3 A;  1O7Y A;  2O5I C;  4X66 L;  1OTC A;  5K36 G;  1HNX Q;  2BDO A;  1ZEQ X;  2K5D A;  3CRK C;  1VF5 C;  5ELF A;  3ND8 A;  3C46 A;  4JBW A;  4BY7 H;  4LNQ A;  3QB3 A;  4ULL A;  3CPF A;  3GO5 A;  1WJJ A;  3E0E A;  3DEO A;  4U67 3;  5ELD A;  3MFY A;  1AFP A;  3PMF A;  3PV0 A;  4A3G G;  3TZD A;  1IYJ B;  5E7N A;  4G4K A;  2Q8R E;  1YIJ A;  1HZC A;  2EYL A;  3WOE A;  2CWA A;  1K83 B;  4MNO A;  3NEL A;  3S24 A;  2KJX A;  1GUS A;  1G6P A;  2EDG A;  2YU9 H;  1L1O A;  5I2Y A;  2D62 A;  3VYT A;  4IUV A;  2E2I B;  3GTM B;  1SRO A;  1I4H A;  1ASZ A;  1HNX L;  3KLW A;  1B3A A;  2OXP A;  1QOH A;  3GTP H;  4DV0 Q;  3M7N A;  2F3W A;  4GKJ Q;  3A8K E;  1H95 A;  1EIG A;  1U4L A;  1H9R A;  1E22 A;  5CV9 A;  4C3J H;  4NPS A;  1Y1W G;  4PG3 A;  4GLX A;  2ALY B;  4XQJ A;  5IYB H;  5KYL A;  3I8Z A;  2AUJ D;  3FDT A;  1I50 B;  4UY8 C;  4IJL A;  4DR7 L;  4GN3 B;  2B2Y A;  3T4A C;  3AFQ A;  1RCV D;  2WKD A;  3N52 A;  5CMD A;  3SEB A;  2AHO B;  1J5E Q;  2K5N A;  4R4Q A;  2TMP A;  2F4V Q;  1B3Q A;  3GTL B;  4B3M Q;  4OX9 L;  1Q8K A;  1S4Z A;  3K7U C;  2JA8 G;  4ME3 A;  4LFB Q;  5C4X B;  2NZH A;  1YVC A;  5C4X G;  4K8J A;  2DJF C;  1KAW A;  2ZXO A;  2F0S A;  1P16 A;  5IT9 E;  2JEA I;  1M1K C;  3I4N B;  2JA6 B;  4G7Z C;  4DK1 A;  2E2I H;  5I9P A;  4MTN A;  1A3V A;  3SR1 A;  4OO1 G;  4JBK A;  2FXQ A;  3E0J A;  4A3K B;  1E2V A;  1DM0 B;  5IYB G;  1ROD A;  4RFB A;  1A6X A;  1XPO A;  3GTQ B;  2VUM B;  2RBM A;  2VB3 X;  4A3F B;  1X32 A;  2UU9 Q;  1VQ6 A;  2QIL A;  1PRT F;  1SYB A;  4FVM A;  2KEE A;  4B3S L;  4GLV B;  5FOB B;  3H09 A;  4EQP A;  1UEB A;  4GN4 B;  4R1J A;  4DR1 L;  1MHW C;  4A3L H;  5EJW A;  1TQO A;  4RA8 A;  4IUR A;  1NR4 A;  5EBD A;  1EQR A;  4M8A A;  4JI1 Q;  4JBM A;  3I55 A;  3RN5 A;  1SXT A;  1YEZ A;  1CT1 D;  2KA7 A;  1CTM A;  1K3B C;  1PH4 A;  4DAP A;  2O2L D;  4JI1 L;  1F2M A;  3TRE A;  4L5Q A;  1EY8 A;  4KMU C;  2MPM A;  4RG1 A;  1ENA A;  2L4N A;  4RKL A;  2R7F A;  4MTK A;  1NMF A;  1E2W A;  1LTL A;  1D5M C;  4B3R L;  3PUX A;  4KHZ A;  2NVQ B;  1K8M A;  5C4J B;  3E6Z X;  4R4O A;  5IP9 H;  1VQI A;  2E2J B;  3OW7 A;  1I4Q A;  3BVG A;  2WII B;  5IT9 L;  3KLR A;  3MXU A;  3SGI A;  2EPB A;  2X6L A;  3F2C A;  4RGT A;  3MHB A;  1N8R C;  2VQE L;  2HQL A;  1Q1B A;  4JI8 Q;  2E2H H;  3ULL A;  1X65 A;  4V0B A;  1LTA D;  1SYF A;  4KJO A;  5M9O A;  1VMC A;  2WB1 E;  3NTK A;  2UU9 L;  4BY1 H;  5IGF A;  4NMZ A;  5C3X A;  1PTO C;  2PW5 A;  1I6H B;  5IP7 G;  2PW7 A;  2B3G A;  2PQE A;  3U50 C;  3VR3 A;  2BA1 A;  4PZ8 A;  5IYD H;  1K8G A;  2GN5 A;  5M5W B;  5M3F G;  3S1R H;  5M3F B;  3B6Y A;  4C2M H;  3PO3 B;  1BO0 A;  3KK7 A;  3RZO H;  4LF5 Q;  1MD2 D;  2K1B A;  3CCE A;  5DNF A;  4DV6 L;  1HH2 P;  1HUM A;  3I7F A;  3HOX B;  3GTM H;  4RWS C;  4A3J H;  5DM7 3;  1JWU D;  1CKN A;  1EY0 A;  4C3I H;  3JC6 6;  1YBY A;  3C1F A;  3KYH C;  4KHV A;  1PRT D;  1W2B A;  1WYD A;  1G2T A;  4YCW A;  1H9M A;  4DK0 A;  5GAH C;  2JE6 I;  5K5P A;  2JN4 A;  1RTO A;  4PMB A;  4XIG S;  2F1M A;  4GNX C;  1C8C A;  3VR4 A;  4CDD C;  1XTD A;  4PMC A;  4XYO A;  4DAV A;  5T1G A;  4QJF A;  1TWG B;  1PA6 A;  1KLG D;  2L55 A;  2YTX A;  2VZA A;  1NCV A;  3VYU A;  1ML0 D;  2N49 A;  4HIK A;  3PGZ A;  4NXN L;  4LWC A;  1QUQ B;  2F0W A;  3LNN A;  1EFW A;  1V1P A;  1WTV A;  2B29 A;  1GKH A;  1E24 A;  1SDF A;  5IT9 c;  3MEH A;  1YIT A;  2JA7 B;  2Z6K C;  2Y0S E;  3A5U A;  1VDZ A;  4WFN 3;  1Q90 A;  3T53 B;  2EQS A;  2A69 C;  5T1I A;  2R93 B;  5J39 A;  1C48 A;  3DWP A;  3TQY A;  3PIP A;  1N34 L;  5A2Q L;  4DAM A;  2XGT A;  3PO2 H;  4JI0 Q;  3SVM A;  1VQ9 A;  5C5M A;  5IGG A;  4X62 L;  4DR1 Q;  1BF4 A;  2BE5 D;  1JJG A;  5M3M B;  3TZU A;  5ELB A;  1Q81 C;  4A3J B;  1PDQ A;  2Z4H A;  5TSS A;  1AZQ A;  3QJY A;  5HGT A;  4CJ2 C;  1JR0 D;  1SMX A;  5JJK A;  4JI6 L;  4JV5 L;  5ELN A;  1FNV A;  4QMG A;  2K04 A;  3J81 i;  1T5E A;  4HIM A;  2RHQ B;  2CFM A;  5M5W H;  3S1R B;  1G6Z A;  3VR6 A;  1CZG A;  2Z8L A;  2H5X A;  2MUY A;  4JI2 Q;  3TRZ A;  1CKM A;  4NDX A;  2K75 A;  1ICF B;  2DGY A;  5IGB A;  3WWV A;  2ZTE A;  1I94 Q;  1CFM A;  5DM6 3;  3BZC A;  3T1H L;  5JAV A;  4ZLT F;  1BXT A;  2AMC B;  3S1M H;  1IL8 A;  4BWG B;  4UAI A;  5C44 B;  1H9S A;  1TY0 A;  1CQV A;  2A73 B;  2IX1 A;  4TRD A;  1SJH D;  2EJF C;  2EY1 A;  1RHP A;  5LMU Q;  1VCI A;  3UE0 A;  3BJU A;  3CCV A;  3VDY A;  1II3 A;  3DM3 A;  4A75 A;  3IL8 A;  5IYC G;  3LWU A;  1PTO B;  1KDC A;  2Q8T A;  4YWL A;  2EZV A;  2PQA B;  1WCM H;  2ZJR A;  4HSV A;  1HNW L;  2B2U C;  4OEL B;  3E9I A;  1LTG D;  2K7V A;  2L5T A;  4FO2 A;  4JI7 Q;  1Z9F A;  1QNK A;  2QDB A;  3L9A X;  2F0L A;  2B2T A;  3Q0A A;  1OXU A;  2RKS A;  1UNS A;  3CCR A;  2OQ0 A;  4A3B G;  1B2T A;  1YJN A;  2XWJ B;  1OXS C;  3C1E A;  2GVB A;  3BYT B;  1I6H H;  2C35 B;  2BH8 A;  2F0H A;  1Q8I A;  3KBX A;  2ZM6 L;  3TP6 A;  3OWE B;  4LF6 L;  4FXD A;  1JQY D;  1W3S A;  4FP5 D;  1NTG A;  3QG1 A;  4QL5 A;  1SE8 A;  3GTG B;  1N32 Q;  2XNA C;  2YTV A;  1N33 L;  5C44 H;  3AQQ A;  2A69 D;  1GUG A;  4KK7 A;  1MI2 A;  3ITP A;  3W3A A;  3P7J A;  1YNJ D;  4LFC L;  1TS3 A;  4R4T A;  4XQN A;  4QGU A;  3F2U A;  1IBL Q;  3SXH A;  3H91 A;  4DV2 L;  2SDF A;  2K4K A;  1S5B D;  5AJ3 L;  1BBU A;  1HQM C;  2NZ1 D;  4MIU A;  2Y0S B;  4OEM B;  1TS2 A;  4DUY L;  1JE4 A;  1IBK Q;  5I6W A;  3KUP A;  1L0X B;  2F3I A;  4DXF A;  3MXN B;  4BY1 B;  3RLO A;  1D5Z C;  4A93 G;  2MP1 A;  3J7Y W;  1LYL A;  2JEB I;  5JPM C;  2EY6 A;  3HP3 A;  3J81 c;  1X3E A;  4JOI C;  1QWY A;  1T9H A;  2L1B A;  1B1Z A;  3PUY A;  1SRU A;  1KDA A;  2BDN A;  1TWA H;  2KED A;  3CP0 A;  3D3R A;  4PZ6 A;  2QA4 A;  4A3E H;  1EY9 A;  3FHW A;  2EYJ A;  1K73 C;  4AQY Q;  3I4N H;  2CH4 W;  1I94 L;  1SYD A;  4H0L C;  1D5X C;  2FIN B;  2XRQ D;  2K50 A;  2AQ3 B;  2KEC A;  1PYB A;  3J81 E;  5JVH 3;  4CHT B;  4DR3 L;  4LW1 A;  4MZ9 A;  2NUC A;  4CJ1 B;  3L3O C;  1U4R A;  1LO5 D;  4DV1 Q;  4A3K H;  4LF7 Q;  1I5F A;  2JA8 B;  3R2T A;  3IFD A;  4AQY L;  2F0I A;  4TVA B;  1BOS A;  4JV5 Q;  3HOU H;  1WTW A;  1R9T H;  3O13 A;  1LLR D;  2HCC A;  3EJI A;  4P71 A;  2PZW A;  1YNN D;  2I46 A;  1IBL L;  2BA0 A;  2EXD A;  5KND A;  4G7O C;  4JC0 A;  2VY3 A;  1V43 A;  3KF6 B;  1BKB A;  4TSS A;  1QVC A;  2G5D A;  3LGJ A;  2D9U A;  4LF7 L;  5C5L A;  3HEJ A;  2A6E D;  3L2P A;  1STB A;  2JA7 G;  4POF A;  1PHJ A;  1PTO F;  3ERQ A;  3K0Y A;  1LTR D;  3OOC A;  1FGB D;  5JEA H;  4P72 A;  1KTK A;  1K9M C;  1TT2 A;  2GA4 B;  5GAD C;  2L0C A;  2RSO A;  1VQ8 A;  3CF5 A;  4C3H H;  1X6O A;  2PZT A;  4DAY A;  1KNE A;  4PZ7 A;  4A76 A;  1N33 Q;  2FMM A;  3D6C A;  4HJA A;  4JI7 L;  1PH8 A;  3HOV G;  4MN3 A;  4ZKC B;  1R4Q B;  2RDF A;  1IYU A;  1KC8 C;  1L0Y B;  1F9P A;  2F0M A;  1CUK A;  2D5D A;  1B50 A;  4X66 Q;  1LAB A;  1DZ1 A;  2F0G A;  4NXM Q;  4DF7 A;  2N3S A;  4A3I G;  5H1S E;  4K0K Q;  4ALP A;  3HOX G;  3W5O A;  4HR7 B;  3W1B A;  4A3E B;  2JYO A;  2AKW B;  5LMU L;  3OYY A;  3AU7 A;  5FLX L;  1QG7 A;  4AYB G;  1OXX K;  1ILP A;  3D6W A;  4A3C G;  1A62 A;  3S17 B;  2LS0 1;  2HIX A;  4WRD A;  4X3U A;  1PVO A;  2Q8I B;  5IYC H;  3HKZ G;  3VA7 A;  1EYC A;  4DFA A;  3K5O A;  1N32 L;  1M8A A;  5FLM G;  1H9K A;  1VQO A;  5NUC A;  2XTI A;  4JI3 Q;  1A3T A;  4J6H A;  3I4N G;  3KJP A;  5D3I B;  4CBV A;  3RD4 A;  5EAY A;  1PFM A;  4ME5 A;  1U9R A;  3PF4 A;  4LFB L;  1R9T B;  4C3H B;  5C4X H;  4PMW A;  3OSO A;  1D1I A;  2LY7 A;  4MHE A;  5CBE E;  3HOW B;  1C9O A;  4K0K L;  2R7Z B;  5DEH A;  1EQT A;  2O5J C;  4ZCK A;  1HZA A;  4A3F G;  3OIQ A;  1BDO A;  3KOJ A;  4K5V A;  4AH6 A;  1DD2 A;  4EVO A;  1FNU A;  2E2D C;  2RVL A;  3S1Q B;  2Q2I A;  3TP7 A;  2JJQ A;  2R93 H;  4IO9 A;  4KHP L;  3JAM E;  3HOY H;  1B53 A;  1B7Y B;  3R2I A;  2WAQ E;  4R9W A;  3AEV A;  1LV9 A;  4O2D A;  2MQH A;  3A7L A;  3GTO B;  3M9B A;  4BBS B;  1K0R A;  2HHH Q;  1TII D;  4P2C B;  1D7Q A;  5KGU A; 
#chains in the Genus database with same CATH homology
 1TKW B;  1LTT D;  4C3J G;  3K57 A;  2SOB A;  1IKL A;  3MXG A;  1HUN A;  4RKB A;  4S3S A;  2A68 D;  1V1O A;  1LT5 D;  3AMU A;  1TS4 A;  1DCZ A;  1GUT A;  1G8Z D;  1HQR D;  4FF4 A;  5EGT A;  1J8I A;  1AN8 A;  2IPK D;  3E5S A;  3M4Y A;  2EYO A;  3RMH A;  3VYS A;  3FRP B;  1EQV A;  1TWH B;  3RLF A;  1JWS D;  3QWN A;  1LAC A;  1S5D D;  4CKB A;  3V05 A;  2WB1 B;  5K36 H;  1DXM A;  3NE5 B;  3N6R A;  5LL6 X;  3D8G A;  3ONA B;  3CRL C;  4DGZ A;  3R3O A;  1LT3 D;  3W2D A;  1Z6H A;  1AZP A;  1KLU D;  2IW3 A;  1DJR D;  1O78 A;  1SYG A;  3HZX A;  3J80 E;  5CV4 A;  5BN3 A;  1BUV T;  2F3V A;  2F0J A;  3KLS X;  3NBI A;  1GXD C;  2WV6 D;  1JB3 A;  1NR2 A;  3SDZ A;  1SYC A;  3SE0 A;  4XTC S;  1S5E D;  3S9W A;  1EIH A;  4QB4 A;  5IGD A;  1S5C D;  2EVB A;  1CM9 A;  3FVQ A;  3H3V C;  3BVZ A;  3L7Z C;  4RHS A;  1EEI D;  1Y8N B;  4PQX A;  3DWQ A;  1HPC A;  5D14 A;  1O7Z A;  1IKM A;  4Q0F A;  1WD0 A;  1JC7 A;  2JSO A;  1MGS A;  2R6G A;  3HRZ C;  2XIW A;  3MXP A;  4A3B B;  2JP1 A;  1ZXT A;  3NQI A;  1Z47 A;  1LTI D;  2IT1 A;  1Y1W B;  3S14 B;  3NXW A;  1SE3 A;  4PV1 C;  3A56 A;  2A6E C;  1TY2 A;  3FEW X;  5CBA E;  5FK9 C;  1WTQ A;  2NN6 H;  4FXK C;  1EFI D;  1YNN C;  4ZUI A;  3WOF A;  4ID6 A;  2F0N A;  1QJO A;  1ESF A;  1CHQ D;  3EQL C;  1QNU A;  2K05 A;  4OO1 H;  1A2U A;  1I4X A;  4OHJ A;  4DA2 A;  3CHB D;  2ZXR A;  3BG3 A;  5ELC A;  4Q5V A;  2FHT A;  1UAP A;  1GOZ A;  4Z9C B;  5KNB A;  3P20 A;  1F2Z A;  4IQZ A;  3GTJ B;  5JVG 3;  2B2T C;  2Z1C A;  2HCI A;  4C1N I;  2NVT B;  1JOQ A;  3TP5 A;  1EL0 A;  2C9O A;  1Y69 U;  3DUZ A;  2KOL A;  4A3M B;  1TU2 B;  4KKU A;  1I6V C;  3VR5 A;  4IUU A;  1H9S B;  3GV3 A;  4ZUJ A;  2AWO A;  3CQZ B;  1BCP F;  1X3P A;  4TQU S;  1ENF A;  1SEB D;  2EE1 A;  5EKI A;  2VNU D;  1CI3 M;  4LAA A;  1YNJ C;  3A8J E;  1H9J A;  4L6T B;  3NHH A;  4K2K A;  2WKC A;  4F87 A;  3SK6 A;  5CYU A;  3MA2 B;  1EZ6 A;  4HMJ A;  1PLF A;  2WP8 J;  2M9V A;  1U4M A;  2K01 A;  1PMR A;  3SHL A;  3Q6S A;  5E1F A;  2M00 A;  1DYQ A;  4IN3 A;  4KN4 C;  1QE6 A;  1DOM A;  2PCF B;  4KKS A;  1STG A;  3D31 A;  1Q3L A;  1CA5 A;  2JA5 B;  3CKI B;  2B2W A;  4KD4 A;  1PZK D;  2HUG A;  4HMI A;  4K8I A;  1JIC A;  1SMY D;  2B2U A;  1NAP A;  3I70 A;  1STY A;  2F0P A;  1FNW A;  3S2H B;  4C1N K;  2RDG A;  4RCN A;  5KIX A;  1EYD A;  1XX8 A;  5FO8 B;  1EZ8 A;  2A6H D;  3NBH A;  1ICW A;  5EPK A;  3EVQ A;  2QCP X;  2NVX B;  1F2L A;  3AB9 A;  2IWH A;  4K6L A;  4K2L A;  3K59 A;  2SNM A;  3EA6 A;  1EEF D;  2EJM A;  1HTL D;  1SFO B;  4K14 A;  1F77 A;  2L12 A;  5CR3 A;  3I4M B;  4OO1 I;  1SNP A;  3OMC A;  4C3H G;  5C0X H;  3NUC A;  1SBB B;  5FLX E;  2J0T D;  3HOY B;  2QEJ C;  2FJ2 A;  2K32 A;  3IKJ A;  4DU9 A;  2YU9 B;  2F0Q A;  5JPN C;  4FNF A;  1PFN A;  2DY7 A;  2EYF A;  2G9D A;  1RTN A;  1PFB A;  3NTH A;  4G7H C;  1SNO A;  1OXV A;  3T13 A;  1BNZ A;  3U9O A;  2LMC B;  2A5H A;  2V4D A;  2BCO A;  1SNC A;  2K33 A;  5BN5 A;  4RAU C;  4XYQ A;  3QOJ A;  1PXU A;  4C3I G;  3G6J B;  4DN4 M;  1SNQ A;  3T56 B;  4DNT B;  3FMC A;  2CW0 D;  2K03 A;  3BDL A;  2F4I A;  3X3N A;  1SSO A;  1EY7 A;  1TR5 A;  1JOR A;  1TS5 A;  2EOT A;  4B9X A;  1RF2 D;  1FR3 A;  3GP7 A;  1LTB D;  3DHQ A;  2KCC A;  2JXM B;  3H0G B;  3MTS A;  3HGB A;  4BA2 I;  2X6G A;  3QO2 A;  4C56 C;  4IFD J;  3I90 A;  5KRU A;  4IFD I;  4KJN A;  3OIP A;  5IGC A;  3BS1 A;  2RA4 A;  2AQ2 B;  5C4Z A;  4G57 A;  1WVL A;  1B44 D;  3C3L A;  4TKO B;  1EYA A;  5BN4 A;  2NTT A;  1BCP C;  3I4L A;  1QCB D;  3C2P A;  4XQQ A;  5IGE A;  3BVM A;  1E0B A;  1FYC A;  5C3W A;  4K5W A;  3HG9 A;  5M5Y B;  4X3K A;  3URY A;  4U68 A;  5JEA G;  2NBF A;  4FF1 A;  1XTC D;  1Q1E A;  2F0V A;  3HOU B;  1LTS D;  2CQA A;  2TSS A;  1BQQ T;  3ND9 A;  1SND A;  2NYZ D;  4CJ0 B;  4EQO A;  4OIJ A;  4JK1 C;  3Q22 A;  2PYK A;  3NWT A;  1VF7 A;  5FO9 B;  3BZD B;  2PMZ B;  1A2T A;  1X3Q A;  1F2Y A;  4L8J A;  2O4X A;  1GUN A;  1R4P B;  1UUP A;  1IW7 D;  5C3E B;  3S2D B;  4XXE A;  1AW7 A;  1G29 1;  1CHP D;  2ID0 A;  3H94 A;  5E4W C;  3K5M A;  2D2C C;  1ESR A;  2FMC A;  3LX0 A;  5D3D A;  3S15 B;  1I4P A;  2B39 A;  3MC0 B;  1SYE A;  4RCO A;  3I73 A;  2B2V A;  4M1U B;  3PIP 3;  4R8I A;  2RQX A;  1W6J A;  5E3F A;  2F0D A;  2IJ0 A;  2I07 B;  2B2Y C;  1GUO A;  1WTO A;  4ILW A;  1Y8O B;  3OWF A;  4KY7 A;  1T5X D;  5JJZ A;  1C4Q A;  4XT3 B;  2PO4 A;  1STE A;  1B4O A;  2Z4I A;  1HA6 A;  1Q12 A;  5IOD A;  4FYD A;  5I9O A;  5I2X A;  2AWN A;  2XWB B;  4X3T A;  5EQ0 A;  2B2W C;  4RGO S;  1GJX A;  1GUW A;  1SJE D;  1W6K A;  5C0X G;  2XRS D;  1KAB A;  1EWH A;  1CA6 A;  5EPJ A;  3FKI B;  3TP8 A;  2FFK B;  1GHJ A;  1NSN S;  2OT2 A;  4HAE A;  1J9O A;  4F88 A;  3UI2 A;  2R3Z A;  2XSC A;  3VYR A;  3KF8 A;  1IW7 C;  2N88 A;  5KYI A;  3PO2 B;  2NN6 G;  5CGK A;  3TBI B;  4KN7 C;  2E2H B;  3M3Y B;  3MFG A;  1V1P B;  1D6E C;  3ERO A;  2H1E A;  5A2Q E;  1D2B A;  1ILQ A;  1SMY C;  3RZD B;  1A15 A;  1G2S A;  3MXN A;  3I3C A;  4IAL A;  1ZKO A;  2PPB C;  1EY6 A;  1KAA A;  3M7G A;  4PNY A;  5CC4 A;  3TSS A;  4IUP A;  2F03 A;  5CV5 A;  4KI0 A;  3I72 A;  3EFX D;  2HDL A;  3G7L A;  3K58 A;  2BE5 C;  2VB2 X;  3Q23 A;  4BA1 I;  1U4P A;  4KKT A;  1CK1 A;  4RHR A;  4LK1 C;  4C3I B;  5IOC A;  3FPP A;  4RGM A;  1STH A;  2KHS A;  3NWS A;  4IZ8 A;  3ZYY X;  5KEE A;  1ET6 A;  1MSH A;  5JOB A;  2NB0 A;  2HDM A;  1RKN A;  5C6A A;  3DMU A;  4H7B A;  4ZYS A;  1SNM A;  5E4X A;  4NKL A;  3BDC A;  4KV6 A;  5FKA C;  1WTX A;  1EY5 A;  4BY7 B;  1F9Q A;  2WAC A;  4X3S A;  5ISR A;  5COR A;  3M4O B;  2ENB A;  1PZJ D;  2EYH A;  2YYZ A;  2CHB D;  2F0E A;  5I4D A;  1TWA B;  1O80 A;  1LT6 D;  3DM1 A;  3NP8 A;  1G91 A;  3KBG A;  4QUC A;  4E6I A;  4LMQ D;  1RJT A;  2DN8 A;  1BCP D;  5COY A;  2WAQ B;  1Y8P B;  3TDQ A;  5C0X I;  2SEB D;  4UDU C;  4A3I B;  3K5L A;  2ZXP A;  1OXT A;  2CW0 C;  1BBX C;  4ZKB B;  4GZY C;  2E74 C;  1F9R A;  1KDB A;  2XVS A;  3PUW A;  1V8Q A;  2KVM A;  2OEO A;  1PZI D;  4C3J B;  3DEP A;  3J81 L;  1DOL A;  2L9H A;  2MJ8 A;  3HOZ B;  2R92 B;  2F0K A;  1OO9 B;  2NWG A;  3MZ5 A;  3QOL A;  3I91 A;  3TME A;  2N55 A;  3R8B A;  4N9T A;  4A3D B;  2G9H D;  3K6O A;  3D4R A;  3OHX C;  5CV6 A;  1M4V A;  1Z7T A;  1WCM B;  3BYY B;  1EU4 A;  4HED A;  4IUN A;  2EXZ A;  1JCK B;  3MAQ A;  1RDP D;  2K28 A;  3S16 B;  3T51 B;  5LHY 1;  4HCS A;  2HQE A;  4YIJ A;  4XDX A;  2KCN A;  3J7A F;  1WD1 A;  5JEA J;  3SK5 A;  5D65 A;  2DY8 A;  4XT1 B;  3VR2 A;  3RZO B;  3T16 A;  2DNC A;  2IX0 A;  2EJG C;  3K7A B;  4NW2 A;  4KTA A;  2SNS A;  1TWF B;  4IUT A;  1HA5 A;  1WTR A;  5EKL A;  1EWC A;  3NPP A;  2LFN A;  3DWA A;  4J8Q A;  1EY4 A;  4A93 B;  3GD7 A;  2IL8 A;  1XXG A;  3Q24 A;  3TN2 A;  2AUK A;  5EPL A;  4LJZ C;  1UEA B;  1XWE A;  1IHZ A;  5G3L D;  2ZT9 C;  3NSW A;  1B9M A;  3QIA A;  4H13 C;  4ZRZ A;  5J1Z A;  2K6A A;  1AP0 A;  1AEX A;  3GTP B;  4KD3 A;  5C4H A;  2QKI C;  3J80 L;  2OF1 A;  1HXY D;  3FPU B;  1RD9 D;  5F2D A;  5DAU A;  4KY6 A;  2F0U A;  4F7X A;  1TWC B;  4OL7 A;  4FF3 A;  2ICI A;  2L11 A;  2A68 C;  3K5N A;  5HUR A;  4K5X A;  2J4X A;  1I3Q B;  4QIW B;  2EYP A;  5C0X J;  1SE4 A;  1TVX A;  2J7Z A;  3HKZ B;  1JOO A;  2B63 B;  4HSP A;  1A3U A;  3V2T A;  4I65 A;  1K8O A;  2LKV A;  2B8F A;  2M2L A;  1QB5 D;  4B08 A;  4J1M A;  1PTO D;  4QF4 A;  2A74 C;  1JOK A;  2B8G A;  1LT4 D;  2CVR A;  5EKK A;  3SK4 A;  5KNC A;  2ICE C;  3M85 A;  3V96 A;  4H44 C;  3NTI A;  3OMG A;  2IX3 A;  1ONL A;  4AYB B;  3R93 A;  1MSG A;  2AQ1 B;  4CKC A;  3LWE A;  3DXJ C;  3J7A V;  4NP5 A;  2NTS A;  2KUM A;  3NK9 A;  5EBC A;  1HCZ A;  3HS0 C;  5J22 A;  3PUV A;  3NQT A;  4A3G B;  3S1N B;  2F0T A;  1F9S A;  4HN7 A;  2KQ3 A;  1MBY A;  1EOT A;  3U9S A;  1HHV A;  1PRT B;  4L63 B;  3VA5 A;  2NVY B;  4ZAI A;  3BDO A;  4IFD H;  2PNR C;  2R61 A;  4WJW A;  3D4W A;  1D1K A;  2EY2 A;  3KLS A;  1IYV A;  3GQB A;  4N9P A;  4QUF A;  3GV6 A;  3MWY W;  5A35 A;  3GTK B;  4BBR B;  1XYI A;  1CZW A;  3HOV B;  2E75 C;  2QF7 A;  2X69 A;  4HCE A;  4R8N A;  5I6Y A;  4DXG A;  1I4R A;  3A7A B;  2E76 C;  2MHV A;  5M5X B;  1HTP A;  1ENC A;  4C2M B;  4BS9 A;  4ZK9 B;  2C5C A;  1DOK A;  4ODG A;  4HTH A;  2XN9 C;  1HFG A;  1PRT C;  1I4G A;  3WDN A;  2RSN A;  4CGY B;  3IAY A;  1SAP A;  4EQN A;  4OGQ C;  4Y7N B;  3SK8 A;  3D4D A;  1BR9 A;  4I7Z C;  3X3M A;  1DON A;  3JAM L;  4CKE A;  4FXG C;  1WTP A;  3PUZ A;  2DNE A;  3A54 A;  4DNR B;  1ZYR C;  1E2Z A;  1S5F D;  1EU3 A;  1FD7 D;  1NUC A;  3H6M A;  3OPO A;  1ZYR D;  5AFW A;  4K6D A;  5FO7 B;  2F0O A;  3P1H A;  2K5Q A;  3CU7 A;  4B9W A;  3IFT A;  1VMP A;  2VXW A;  4IFD G;  2F0F A;  2BOS A;  1CQF A;  1STA A;  5ELE A;  4OIK A;  1PYW D;  1HFN A;  1SE2 A;  1JWM D;  4EGV A;  4O1N A;  3PIO 3;  4KY5 A;  5CV8 A;  1QIL A;  1STN A;  4WOR A;  2EY5 A;  4V19 0;  4FF2 A;  1Y1V B;  2NN6 I;  5CV7 A;  2RDH A;  2WIN B;  3A55 A;  1HRJ A;  4IUQ A;  5IIF A;  1PTO H;  1ET9 A;  3P75 A;  2A6H C;  4RGN A;  4QCL A;  3A8I E;  4RH6 A;  1O7L A;  1GHK A;  4O42 A;  5LL6 S;  1BCP B;  5G3L F;  3RUZ A;  2H4O A;  2K5W A;  3S1M B;  4F8M A;  2B2V C;  2EYM A;  2PZU A;  3MVV A;  1B9N A;  4ABN A;  1KNA A;  2MGS A;  4ZQ3 A;  1O7Y A;  2O5I C;  5K36 G;  2BDO A;  1ZEQ X;  2K5D A;  3CRK C;  1VF5 C;  5ELF A;  3ND8 A;  3C46 A;  4JBW A;  3QB3 A;  4ULL A;  3GO5 A;  3DEO A;  4U67 3;  5ELD A;  3MFY A;  1AFP A;  3PMF A;  3PV0 A;  3TZD A;  4G4K A;  2Q8R E;  2EYL A;  3WOE A;  1K83 B;  2KJX A;  1GUS A;  2EDG A;  5I2Y A;  2D62 A;  3VYT A;  4IUV A;  2E2I B;  3GTM B;  1I4H A;  1B3A A;  2OXP A;  1QOH A;  3M7N A;  2F3W A;  3A8K E;  1EIG A;  1U4L A;  1H9R A;  5CV9 A;  4XQJ A;  5KYL A;  3I8Z A;  2AUJ D;  3FDT A;  1I50 B;  2B2Y A;  3T4A C;  1RCV D;  2WKD A;  3N52 A;  5CMD A;  3SEB A;  2TMP A;  3GTL B;  1S4Z A;  5C4X B;  4K8J A;  2ZXO A;  2F0S A;  5IT9 E;  2JEA I;  3I4N B;  2JA6 B;  4G7Z C;  4DK1 A;  5I9P A;  1A3V A;  3SR1 A;  4OO1 G;  3E0J A;  4A3K B;  1E2V A;  1DM0 B;  1ROD A;  4RFB A;  1A6X A;  3GTQ B;  2VUM B;  2RBM A;  2VB3 X;  4A3F B;  1X32 A;  2QIL A;  1PRT F;  1SYB A;  4FVM A;  2KEE A;  5FOB B;  3H09 A;  4EQP A;  5EJW A;  1TQO A;  4RA8 A;  4IUR A;  1NR4 A;  5EBD A;  4M8A A;  1SXT A;  1CT1 D;  2KA7 A;  1CTM A;  4DAP A;  2O2L D;  1F2M A;  1EY8 A;  4KMU C;  2MPM A;  1ENA A;  2L4N A;  4RKL A;  1E2W A;  1D5M C;  3PUX A;  4KHZ A;  2NVQ B;  1K8M A;  5C4J B;  3E6Z X;  2E2J B;  3OW7 A;  1I4Q A;  3BVG A;  2WII B;  5IT9 L;  3KLR A;  3MXU A;  2EPB A;  2X6L A;  4RGT A;  3MHB A;  1Q1B A;  4V0B A;  1LTA D;  1SYF A;  4KJO A;  5M9O A;  1VMC A;  3NTK A;  5IGF A;  4NMZ A;  5C3X A;  1PTO C;  2PW5 A;  1I6H B;  2PW7 A;  2PQE A;  3VR3 A;  2BA1 A;  5M5W B;  5M3F B;  3PO3 B;  1BO0 A;  3KK7 A;  1MD2 D;  2K1B A;  5DNF A;  1HUM A;  3HOX B;  4RWS C;  5DM7 3;  1JWU D;  1EY0 A;  3C1F A;  4KHV A;  1PRT D;  1G2T A;  1H9M A;  4DK0 A;  2JE6 I;  5K5P A;  1C8C A;  1RTO A;  4PMB A;  4XIG S;  2F1M A;  3VR4 A;  4PMC A;  4XYO A;  4DAV A;  5T1G A;  1TWG B;  1KLG D;  2L55 A;  1NCV A;  3VYU A;  1ML0 D;  2F0W A;  3LNN A;  1V1P A;  1WTV A;  1SDF A;  3MEH A;  2JA7 B;  1VDZ A;  4WFN 3;  1Q90 A;  3T53 B;  2A69 C;  5T1I A;  2R93 B;  5J39 A;  1C48 A;  3DWP A;  5A2Q L;  3SVM A;  5C5M A;  5IGG A;  1BF4 A;  2BE5 D;  5M3M B;  3TZU A;  5ELB A;  4A3J B;  1PDQ A;  2Z4H A;  5TSS A;  1AZQ A;  3QJY A;  5HGT A;  4CJ2 C;  1JR0 D;  1FNV A;  4QMG A;  2K04 A;  1T5E A;  3S1R B;  1G6Z A;  3VR6 A;  1CZG A;  2Z8L A;  2MUY A;  4NDX A;  5IGB A;  1CFM A;  5DM6 3;  5JAV A;  4ZLT F;  1BXT A;  1IL8 A;  4BWG B;  4UAI A;  5C44 B;  1H9S A;  1TY0 A;  1CQV A;  2A73 B;  2IX1 A;  4TRD A;  1SJH D;  2EJF C;  2EY1 A;  1RHP A;  1VCI A;  1II3 A;  3IL8 A;  3LWU A;  1PTO B;  1KDC A;  2Q8T A;  2EZV A;  4HSV A;  2B2U C;  1LTG D;  2K7V A;  2L5T A;  4FO2 A;  1QNK A;  2QDB A;  3L9A X;  2F0L A;  2B2T A;  3Q0A A;  1OXU A;  2RKS A;  1UNS A;  1B2T A;  2XWJ B;  1OXS C;  3C1E A;  3BYT B;  2F0H A;  1Q8I A;  3KBX A;  3TP6 A;  3OWE B;  4FXD A;  1JQY D;  4FP5 D;  3QG1 A;  3GTG B;  2XNA C;  2A69 D;  1GUG A;  4KK7 A;  1MI2 A;  3ITP A;  3W3A A;  3P7J A;  1YNJ D;  1TS3 A;  4XQN A;  3F2U A;  3SXH A;  3H91 A;  2SDF A;  1S5B D;  1HQM C;  2NZ1 D;  4MIU A;  2Y0S B;  1TS2 A;  1JE4 A;  5I6W A;  3KUP A;  1L0X B;  4DXF A;  4BY1 B;  1D5Z C;  2MP1 A;  3J7Y W;  2JEB I;  5JPM C;  2EY6 A;  3HP3 A;  1QWY A;  2L1B A;  1B1Z A;  3PUY A;  1KDA A;  2BDN A;  2KED A;  3D3R A;  1EY9 A;  2EYJ A;  1SYD A;  4H0L C;  1D5X C;  2FIN B;  2XRQ D;  2AQ3 B;  2KEC A;  3J81 E;  5JVH 3;  4CHT B;  2NUC A;  4CJ1 B;  3L3O C;  1U4R A;  1LO5 D;  2JA8 B;  3R2T A;  3IFD A;  2F0I A;  1BOS A;  1WTW A;  3O13 A;  1LLR D;  2HCC A;  3EJI A;  2PZW A;  1YNN D;  2I46 A;  2BA0 A;  5KND A;  4G7O C;  1V43 A;  4TSS A;  2D9U A;  5C5L A;  3HEJ A;  2A6E D;  1STB A;  1PTO F;  3ERQ A;  3K0Y A;  1LTR D;  3OOC A;  1FGB D;  5JEA H;  1KTK A;  1TT2 A;  2GA4 B;  2L0C A;  2RSO A;  2PZT A;  4DAY A;  1KNE A;  2FMM A;  3D6C A;  4MN3 A;  4ZKC B;  1R4Q B;  2RDF A;  1IYU A;  1L0Y B;  1F9P A;  2F0M A;  2D5D A;  1B50 A;  1LAB A;  1DZ1 A;  2F0G A;  4DF7 A;  4HR7 B;  4A3E B;  2JYO A;  3AU7 A;  5FLX L;  1QG7 A;  1OXX K;  1ILP A;  3D6W A;  3S17 B;  2LS0 1;  4WRD A;  4X3U A;  2Q8I B;  3VA7 A;  1EYC A;  4DFA A;  3K5O A;  1M8A A;  1H9K A;  5NUC A;  1A3T A;  4J6H A;  5D3I B;  4CBV A;  3RD4 A;  1PFM A;  4ME5 A;  1U9R A;  1R9T B;  4C3H B;  4PMW A;  3OSO A;  1D1I A;  2LY7 A;  4MHE A;  5CBE E;  3HOW B;  2R7Z B;  5DEH A;  1EQT A;  2O5J C;  3OIQ A;  1BDO A;  4K5V A;  1DD2 A;  4EVO A;  1FNU A;  2E2D C;  2RVL A;  3S1Q B;  3TP7 A;  3JAM E;  1B53 A;  3R2I A;  4R9W A;  1LV9 A;  3A7L A;  3GTO B;  4BBS B;  1TII D;  4P2C B;  5KGU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...