1K8MA

Solution structure of the lipoic acid-bearing domain of the e2 component of human, mitochondrial branched-chain alpha-ketoacid dehydrogenase
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
87
structure length
87
Chain Sequence
b'MGQVVQFKLSDIGEGIREVTVKEWYVKEGDTVSQFDSICEVQSDKASVTITSRYDGVIKKLYYNLDDIAYVGKPLVDIETEALKDLE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E2 component of Branched-Chain alpha-Ketoacid Dehydrogenase
publication title Solution structure and dynamics of the lipoic acid-bearing domain of human mitochondrial branched-chain alpha-keto acid dehydrogenase complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 4
structure length 87
sequence length 87
ec nomenclature ec 2.3.1.168: Dihydrolipoyllysine-residue (2-methylpropanoyl)transferase.
pdb deposition date 2001-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00364 Biotin_lipoyl Biotin-requiring enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1k8mA00
4JK1C 1B9NA 1ZYRC 1Y8PB 2D62A 3QIAA 3SE0A 2EVBA 1GUSA 3LWUA 5BN3A 3VR2A 1DXMA 1IW7D 3I4LA 3T56B 3GD7A 1HCZA 3VR4A 1GUTA 2ZT9C 1FYCA 2AUKA 4TKOB 5C0XH 2K7VA 2BE5C 2A68D 2O5JC 3A7AB 5JEAH 3OPOA 3P20A 1FR3A 1ONLA 1OXSC 4JBWA 2A6EC 3FPPA 3TZUA 4OGQC 2A6HC 5KNCA 3MFYA 4I7ZC 1IYVA 2JEBI 4H44C 1K8MA 2Q8IB 1GHKA 3PUWA 1SMYC 2E76C 4GZYC 1QJOA 2CW0C 2DNCA 2QF7A 2PCFB 3BDOA 1YNJC 1YNNC 3QJYA 4BA1I 3SDZA 3I72A 4KHZA 1IW7C 4BA2I 1I6VC 1V8QA 3D31A 1OXTA 2F1MA 4KN4C 3VR6A 4IFDH 1Q90A 2A68C 1OXVA 3NE5B 1PMRA 3H94A 1Q12A 2EJFC 2K33A 1H9JA 1HTPA 3A7LA 3W3AA 2O5IC 4OO1H 4KMUC 2KCCA 3RLFA 3T51B 1HPCA 4DK0A 4DK1A 1E2WA 2BA0A 1H9KA 3IFTA 1GHJA 4LK1C 2JXMB 5BN5A 2E74C 1H9SB 5K36G 3EQLC 1LACA 1OXUA 3ND8A 4KKUA 4KKTA 3T53B 2KA7A 1IYUA 3M4YA 1O78A 4L8JA 3CRLC 2L5TA 2K32A 2V4DA 3LNNA 2YYZA 2BA1A 1BDOA 1DD2A 4H13C 2NN6I 3CRKC 2EJMA 2JEAI 4DNTB 1E2ZA 2BDOA 3A8IE 3MXUA 1G291 3VA7A 2PPBC 1TKWB 2R6GA 2NN6G 2EJGC 3M85A 1EWHA 3PV0A 1Y69U 4KKSA 1Y8OB 1GJXA 3L7ZC 4DNRB 3A8JE 3GQBA 3FMCA 1GUOA 1Q1EA 3ND9A 4KN7C 1GUNA 1LABA 4XTCS 2DNEA 3A8KE 5A35A 4TQUS 3WDNA 1GUGA 4G7ZC 5C0XG 2AWOA 2IT1A 3DXJC 5JEAG 4LJZC 2AUJD 2A69D 2E75C 2D2CC 1Z7TA 3PUYA 3KLRA 3BG3A 2EDGA 3PUXA 3QG1A 1VF5C 1H9SA 4H0LC 4RCNA 2JE6I 3HGBA 3OOCA 2PNRC 4IQZA 3D4RA 1B9MA 1VDZA 3I73A 3PUVA 3N6RA 4G7HC 4PV1C 2LMCB 5K36H 3PUZA 3U9SA 5KNDA 1A6XA 2D5DA 1E2VA 1HQMC 4KI0A 3VR5A 5BN4A 4G7OC 1V43A 4XIGS 1VCIA 2BE5D 1Z6HA 1CI3M 1T5EA 4IFDG 3VR3A 4HR7B 3OW7A 1OXXK 2A69C 2A6ED 1H9MA 1Q1BA 2DN8A 1H9RA 2A6HD 1O7LA 4OO1G 2B8FA 1ZKOA 2NN6H 3IKJA 1CTMA 1K8OA 3M7NA 1Y8NB 2B8GA 3AB9A 1TU2B 1CFMA 5KNBA 1VF7A 1DCZA
chains in the Genus database with same CATH superfamily
1TS5A 5FO7B 1Y8PB 1B1ZA 1VQDA 4BBRG 5BN3A 3IAYA 3K5OA 1DXMA 2R7FA 3GD7A 3GTQB 1XXGA 4AH6A 1MKHA 4JBWA 1QCBD 3BU2A 4A3GB 4DU9A 5I6WA 2RHQB 3UE1A 2FINB 4HCEA 4HEDA 4ODGA 2N78A 2DNCA 1L0YB 3I2ZA 3J7AF 1AZPA 4BBRB 2UU9Q 1DOLA 1B50A 3I72A 2MJ8A 1RDPD 1I3QH 1IBML 3M4OB 5IYDH 3K7AH 1CM9A 3NE5B 5FLXc 2JA9A 1E0BA 5IYBH 4HMIA 4QCLA 1WTOA 3KLSA 1RF2D 2Q8TA 3CPWA 3RZDB 1CZWA 2N55A 1H9KA 4JI4Q 1KL9A 3T1HL 1LACA 2UXCL 5TSSA 1V1PB 2WB1E 2F0PA 4ZUIA 2F0HA 4DUZQ 4FVMA 1VQIA 3Q0AA 1HTLD 2B2UC 3ERSX 2J4XA 3TN2A 3OYYA 3HOXH 1WTWA 4JI7L 4DNTB 4F8MA 1G291 4LNQA 1F9PA 1NE3A 2R92G 4JI2L 5LMNQ 4JC0A 1KTKA 3PV0A 3MWYW 1FGBD 3A8JE 2QGQA 4KN7C 3T1YL 1AE2A 2NVXH 2ZJRA 1XMQQ 2IT1A 1CA5A 1IZ6A 2KEEA 4RKLA 1JOOA 2EYFA 2R92B 2WACA 4LUOA 5IP7G 2B2TA 5T1GA 2RHSB 1JICA 3JAML 2A74C 3D6WA 4A3KH 3ULLA 4NW2A 3CQZB 4IUTA 2GN5A 1AH9A 1F2LA 4DR5L 2WINB 1DM0B 2WKCA 1LT3D 4FP5D 4HR7B 4DAYA 1OXXK 5CV9A 1O80A 1WJJA 4NKLA 1N36L 2DUDA 4A76A 4DR1L 3CD6A 2PMZE 4A3JG 3PO3B 1VQBA 2OCEA 3SE0A 2EVBA 1NJIC 4LFAQ 1EFID 5IWAQ 3RR5A 3PIOA 4DKAC 2A68D 4DR2Q 5C4XG 1EYAA 3P20A 1N34L 3AU7A 2B29A 4LFCL 4OGQC 4DV6L 4H44C 1S72A 1S5BD 4TVAB 4LUZA 4X62L 2CVRA 4A3BH 3HG9A 4KJNA 4YHHQ 1TWHB 2F0JA 2HQLA 3L2PA 1OXTA 1X9NA 5C4XB 4DR3Q 2ZTEA 1C0AA 4K6LA 4HSPA 2QDBA 4HN7A 3RLFA 4IPHA 1AEXA 3S2DH 5KYIA 4A93G 3IFTA 4LK1C 4XYOA 3K57A 4B08A 1PHJA 1M90C 3T53B 1Z47A 3PO3H 2K28A 1NMFA 1PTOB 3AFQA 3KK7A 2UU9L 1K28A 1BKBA 2F0QA 2PQEA 3CCSA 2PPBC 2JA7G 5KIXA 4LF8Q 4YCVA 4OX9Q 4DPGA 1CSPA 4JVZA 2R93H 4MIUA 3DEOA 1HZBA 3I8ZA 5GROA 1RD9D 2CWPA 3SVMA 3KBXA 3MC0B 1GUNA 1PH5A 1V9PA 4CGYB 4DV0Q 4A3EG 1LTRD 1TWAH 1PFSA 2LS01 1SE8A 1RCVD 4JI4L 4FO2A 1M8AA 1HQRD 1YNJD 2P5ZX 4KD3A 2M9VA 2PNRC 3DWQA 3V96A 3J80E 3WOEA 1B9MA 4KHVA 3J81E 4DUZL 3S1NB 4JI3Q 3CU7A 4WJWA 4KY5A 3Q24A 1E2VA 4KI0A 1K0SA 2C35B 2NVYH 4KD4A 4JYAQ 2HIVA 2PI2A 4JI5Q 1Y1WB 1ENAA 1P8LA 2ALYB 5LMNL 3VR3A 1JOKA 1XJVA 1S4ZA 1NCVA 2A73B 5IGFA 4X3UA 2R61A 3F2DA 1I4GA 1UUPA 1VF7A 3MVVA 1XMQL 3PCOB 1XPRA 1QZGA 2X69A 4LF4Q 1I94L 1NSNS 1V1PA 4DV3Q 4UP8A 4TKOB 1EQVA 2SNSA 4Q5VA 4YIJA 1Q8KA 2MPMA 1L0XB 3U9OA 3BZKA 4L5QA 2Q8IB 4CDDC 5AJ3Q 1VS0A 1Z9FA 3C2PA 3GTPH 1EIHA 3HOYG 1YNJC 1PVOA 2RDHA 4X3KA 1Q7YC 3S1NH 2VUMH 4TSSA 2HCIA 2K5VA 3QOJA 3HFZB 2UXBQ 1MSHA 4MHEA 1H9JA 3TREA 2MGSA 4PMWA 1UE6A 3DWPA 2MUYA 2HQEA 5IWAL 5IGCA 3NUCA 4DR2L 1JE5A 3F2CA 5BN5A 2KENA 3GTJH 4JI6Q 3HOYB 4YY3L 1H9SB 4RCOA 3E9HA 1RKNA 3C1EA 3FDTA 1OXUA 4C3IH 1YJNA 2KA7A 2TMPA 1TWCH 3CCRA 4UDUC 2YYZA 4DR6Q 4JV5Q 2NWGA 1H95A 2UUAQ 3AMUA 4LW1A 4JBKA 5HGQA 2EJMA 1GO3E 3MXUA 2RCNA 2BH2A 4JOIA 4YHHL 3A55A 5COYA 2D0PA 5DNFA 1HUNA 1UEAB 4EGVA 4EQPA 1EU4A 3PGZA 4S3SA 1EIGA 1PH1A 2HCCA 4HSVA 1LO5D 2NVTH 1KNEA 1T5XD 4LJZC 4C3HG 1CSQA 1Z7TA 4OELB 3BG3A 5M3FB 1VQKA 3QG1A 3H3VH 3BVZA 4IQZA 4ZKBB 1LT4D 3I73A 5IYCH 1MHWC 4EQOA 1HA6A 4DAPA 1WTHA 3ER0A 2SDFA 1DZ1A 4LF8L 1LTID 3F2UA 4OX9L 1U4PA 1XTDA 2A69C 4JI1Q 2HHHL 1CKNA 1ZKOA 1CTMA 1I6HH 2IX1A 1DCZA 2CFMA 3GTGH 1RTOA 1XNRQ 5E1FA 4HJAA 1ML0D 3SK6A 1J8IA 3OPOA 1MGSA 3I4MG 4WJ4A 1LTTD 1JCKB 3FPUB 2X6LA 4JYAL 4LF5Q 2QW7A 4JI5L 3CHBD 3RLOA 5M3FH 3W1BA 1PFMA 2PCFB 2KCTA 4UAIA 3TS0A 1JJ2A 4FDBA 1VQGA 2UUBQ 1KNAA 4BY7G 4C1NI 1OXVA 3K5MA 4F7XA 4PMCA 1XPOA 1B7YB 3CC4A 3HOUB 1NUCA 4LF4L 1D5ZC 4TRDA 3TS2A 3HP3A 4DV3L 2AQ1B 1Q82C 1UNSA 1DGSA 4ZUJA 2NUCA 5G3LD 2YV5A 5CBAE 4A3IG 1O78A 3I3CA 1U4RA 4NDXA 3BYTB 5J3BA 5AJ3L 4BY7B 1EYCA 4RAUC 2F0OA 3CRKC 5EKLA 4UY8C 3A56A 2F0IA 3HOZG 3RZOH 3JAME 1PH6A 4MTNA 3A5UA 2B63H 1EY8A 2J7ZA 4E6IA 2C5CA 2IHFA 3KF6B 4KY7A 1Y69U 1AP0A 4R9WA 2UXBL 1SN8A 3LWEA 2KCMA 2K5NA 2OTLA 4A3MH 4DV5Q 3FKIG 2R7ZG 2ES2A 4P75A 2AWOA 2I5LX 4JI6L 4GLVB 1PFBA 1G91A 1D5MC 2PZUA 3HOZB 2ZTDA 4ZLTF 4QGUA 3GTLH 3KLSX 3VDYA 1HUMA 4ZCKA 1S5DD 5C44G 3HOUH 4Y7NH 1I4HA 4DR6L 4JV5L 3HKSA 2UUAL 1HR0W 1EFWA 3VR5A 2HIXA 2PZTA 1BCPB 2BE5D 3Q8DA 1LTGD 4GKKQ 1Q3LA 3OW7A 1XYIA 1Q1BA 3DMUA 5EPJA 4XXEA 1O7LA 1AZQA 4KLKA 3FVQA 3IKJA 4ZYSA 2NVQB 3I91A 1D6EC 3PO2B 3CCUA 1LT5D 2E2HB 2CH4W 5C3WA 3SK8A 3PMFA 1NR4A 5C4JB 1DJRD 1GUTA 1EYGA 5IT9L 3P75A 1I4PA 2K7VA 2N3SA 2KQ3A 1NMGA 2G9DA 1DOMA 1OTCA 1K8AC 1EWCA 2A6HC 2K5DA 2JEBI 3CP0A 4DV2Q 1QJOA 4IJHA 4ME5A 4JI1L 3SXHA 2MNAA 3A74A 1RHPA 1KDCA 3HKZE 4KV6A 5ELNA 3FP9A 2B2WA 1HTPA 4JBMA 1NBWA 1XNRL 5LMNW 1YIJA 5FLMG 1TY0A 3N52A 2K50A 4NB3A 5CV6A 1WTPA 5K36G 4OWWB 2Z8LA 5EQ0A 1AE3A 3PO2H 5EPKA 3H0GH 3CC2A 1IL2A 1GUWA 1E1OA 4LF5L 3K81C 3G6EA 4O0AA 1DD2A 3UDFA 4XT3B 2FHTA 3D8GA 3VA7A 2BDOA 1EYDA 3NTKA 2R6GA 4DAYB 1MD2D 2EJGC 1KIXA 2UUBL 4NXNQ 1VQ5A 2B2YA 2RVLA 1ENCA 1WFQA 4UP9A 1U0LA 4YCWA 3NELA 1UE5A 2MFIA 3OWFA 2Z6KA 3QO2A 4DV4Q 2IHEA 5K5PA 1SYDA 2K1BA 1BO0A 3KDFB 5HGTA 1A2TA 4H0LC 4RCNA 2EYOA 2A8VA 2QA4A 3RNUA 1J6QA 2WV6D 1YEZA 2LFNA 5IP9H 4UPAA 1TS4A 2QDLA 4RH6A 5EKKA 3OTOQ 5IYDG 3R2IA 1JJCB 5I4DA 2YTYA 4RGOS 5IYBG 1SJHD 4NMZA 1YJWA 3GP7A 1KC8C 4R4QA 2NN6H 4DV5L 1Y8NB 2PW7A 1EL0A 5GQOA 1O7ZA 1GUSA 3KF8A 2RA4A 3VR2A 3ITPA 1PYBA 1FYCA 1TWFH 1LLRD 3K7AB 3NEMA 5CV5A 1HRJA 2D0OA 4WJ3M 4K2KA 3HOXG 1KRSA 3PIP3 4GOPA 3TP8A 3P1HA 1VQHA 2F52A 3EJIA 4RG1A 2E76C 3DUZA 2K03A 1GVPA 1IKMA 1YHBA 3ONAB 1BVSA 1PRTC 4GNXC 1EEID 1KAWA 3H3VI 3HOXB 2EYLA 1ET9A 2IX0A 1C7YA 1EY5A 3RN5A 4DUYQ 3GO5A 4FYDA 1B2TA 5CMDA 4P72A 4A3KG 1BCPF 2G9HD 3FEWX 5EJWA 2NVXB 2RF4A 3CRLC 2V4DA 4ID6A 5L37A 4DV2L 2K5QA 3BZDB 2N49A 1B53A 4NPSA 3E0JA 2JEAI 3A8IE 3A5ZB 4QUFA 2SNMA 2E2JH 1B44D 1PXUA 1SE2A 3CCVA 4LF6Q 4A3KB 1TVXA 2IPKD 3SK4A 5ELFA 3TP7A 3Q23A 5C3EH 2JK8A 3DXJC 5IODA 1CKOA 1EWIA 1PV4A 2F4IA 3SHLA 2RKSA 1PH7A 5I6YA 2EDGA 2VQFQ 1BOSA 3WWVA 1IBKQ 2HT1A 1STNA 1VDZA 5NUCA 4G7HC 4A3FH 3TDQA 3C1FA 3BS1A 1FJGL 4CBVA 1A3TA 1VQOA 2Q2IA 3EN2A 2B2UA 4NXNL 3KFUA 2LSSA 1H9MA 4HMJA 5IGGA 3BZCA 4IUPA 1YZ6A 2EXZA 3TZDA 1I94Q 1CFMA 1HJPA 4DV4L 3O13A 3T13A 1ENFA 3GTOH 4A3BB 5IOCA 4X6AH 3PQIA 3PO3G 4U68A 3PF4A 1A3VA 1A62A 5C4ZA 1ONLA 2EY5A 4GN4B 1LTLA 2HDLA 4JG2A 3OTOL 3PUWA 3S2DB 2R93G 1L2FA 2NYZD 3UDIA 5IY0A 3HOWB 3HRZC 1IXRA 3F8TA 1IW7C 1XWEA 1A2UA 2C9OA 4IUNA 1V8QA 2JJQA 2XRSD 2XVSA 4DA2A 4DV7L 1KQSA 1Q12A 3KDFA 3NSWA 5CV8A 2O5IC 3CMEA 4KMUC 4YY3Q 4B9XA 3EBEA 2EY2A 2R93B 1GHJA 1RODA 3S1MH 3M4PA 3I90A 2F0UA 2F4VQ 1IL8A 1KAAA 3M4YA 2XN9C 2K32A 3AYHB 4QF4A 4RGMA 1TWAB 1CA6A 4K5XA 1SBBB 2Q2TA 1TKWB 3RD4A 2A5HA 1HHVA 2AKWB 4FXGC 2CCZA 4DAMA 4QUCA 1CKNB 4RKBA 1S5ED 1GUOA 1Q1EA 5C6AA 3MFGA 2MP1A 1JORA 2NVYB 1U9RA 2KECA 3HOWH 2K14A 4M8AA 1C4QA 5LHY1 1SFOH 1UAPA 2AUJD 4DUYL 2ID0A 1A63A 2K04A 3CCQA 1VF5C 2UXDQ 3BVMA 3PUVA 1BQQT 2H4OA 1IYJB 5FK9C 4X64Q 5IT9E 1VQ6A 4QB4A 4JCVE 4A4IA 3NBIA 1MSGA 1I4XA 1STBA 3TSSA 2VUMG 1S40A 2HHHQ 1CI3M 1X32A 4IPDA 5IP7H 3GTKB 3BJUA 2ZJQA 4UP7A 1Y1WG 2A1AA 4LF6L 2B8FA 3S16H 3SGIA 5KNBA 1BUVT 4L6TB 4XQNA 3QIAA 3GTPB 4DNIA 4A3CH 4C3IG 2VQFL 4LMQD 1IBKL 2VUMB 3E0EA 2O5JC 2E2IH 5JAVA 1R4PB 2EQSA 1XMOQ 4MTKA 1VQAA 5FOBB 2A6EC 4O42A 4PMBA 2KEDA 2NZHA 1GHKA 1YITA 1S5CD 2JP1A 3GTJB 1EY4A 4WORA 4BXXH 2VQEQ 3F2BA 4DR7Q 1PZKD 1QWYA 3P7JA 3VYRA 1R4QB 1E7ZA 4C3IB 4DV1Q 3J80c 3TP5A 1PH2A 2EYPA 4KN4C 1TWCB 3NWTA 3J81c 3OMGA 4IN3A 2H5XA 1C48A 4Q0FA 3CCMA 1SYCA 1JE4A 1V1OA 3EFXD 2KCCA 3GTKH 1B8AA 1PH8A 3NP8A 3HS0C 4R8NA 5IE8A 1ESRA 1HNWL 2QCPX 1HZAA 2F0KA 2ATWA 2PI2E 4CJ0B 2NVTB 2F3VA 3NXWA 2OWOA 5M3MH 4A93H 1ICFB 5AFWA 2JA5H 2NN6I 3MTSA 2VNUD 3TQYA 4BY1B 1U4MA 1EWHA 3AQQA 4KKSA 2HUGA 4H02A 2XWJB 1FL0A 3ZYYX 1S3OA 1VQFA 2CHBD 1PH9A 2A69D 2D2CC 2WAQG 4AYBG 2Z4IA 2PZWA 3PUXA 4LAAA 1X3QA 2F4VL 5KGUA 2AHOB 3HGBA 3TEHB 3M9BA 2F0SA 4MZ9A 5I9PA 1I6HB 3MAQA 3QWNA 3CAMA 5M3FG 1FGUA 2F0DA 4FF1A 1W2BA 3I4NH 3GTGB 4RWSC 4G4KA 1KDAA 3NWSA 5EBCA 3LGJA 1VQLA 4DN4M 2WAQB 4AYBB 1E3PA 3S2HB 4GKJL 2K01A 1TWGH 1B70B 2FFKB 1CUKA 3NK9A 4A3LH 4HAEA 2Y0SB 4R1JA 2JQOA 1PTOD 1WD0A 3AB9A 1EZ8A 2XTIA 4OONA 1YI2A 1HXYD 1R9TB 4CHTB 4BY1H 2NTTA 1II3A 1KHIA 4OXPA 4LFBQ 5FLXL 4R4TA 2UXDL 4EX5A 2JYOA 1JMCA 1FR3A 2VS1A 1L1OB 4WRDA 4X64L 4P71A 1IYVA 4CKBA 4K5VA 1QVGA 1XPUA 2ASBA 2B63G 1J5EQ 4DXGA 4CDCC 2NZOA 3QR8A 3GV6A 4KHZA 4A3MG 1ASYA 4IFDH 4O2DA 1F9SA 3CKIB 5KRUA 1NNXA 2JA6B 2WKDA 1VQCA 2XIWA 3E3XA 3RZOB 1E22A 4DK0A 4DK1A 1B3QA 2B63B 2RSNA 5JVH3 3S2HH 2VL6A 3HOUG 3ERQA 1F2MA 4N8X1 2RBMA 1WCMB 2KUMA 5JPMC 1XMOL 5EGTA 1MJEA 3BDLA 2VW9A 4QY7A 3W2DA 4EVOA 4K0KQ 1PYWD 1PTOC 3OIPA 3OSOA 1X55A 2SEBD 4A3MB 1R9TH 1IKLA 4IALA 4KHPQ 2L5TA 3GV3A 1STYA 2FJ2A 4HIOA 2K4KA 1KLGD 2VQEL 4DR7L 4DV1L 1LTAD 3TP6A 1I4RA 3GTLB 1YVCA 1CQFA 1DONA 4Y7NB 3L7ZC 5I2XA 3ND9A 4OIJA 4XTCS 2DNEA 5A35A 2SOBA 5I2YA 3WDNA 2IW3A 3KF8B 3W5OA 2F0VA 1MIUA 1UEBA 3PUYA 3AFPA 2DJGC 3VYSA 1PDQA 5D14A 2KJXA 2JA6H 3MEHA 1VQ8A 2WP8J 4ZQ3A 4GOPB 3CW2C 4IZ8A 4RHRA 2D5DA 1HQMC 4C3HH 5C3XA 1WCMH 3FHWA 1SAPA 4XT1B 2L12A 5FJ8H 1YBYA 2CWAA 4OWTB 2A6HD 2L11A 3T4AC 1E1TA 1JB3A 5A2QL 4DK3C 1AFPA 5FO8B 2D62A 1QNUA 2L9HA 2I5HA 1YHQA 3PO2G 1JQYD 5D3DA 3JAMc 2F0LA 3J7AV 1LTBD 3H0GG 3VA5A 1WTRA 3CXCA 4KTAA 1GD7A 3PIO3 4JW0A 4A3DB 4H7BA 3CMAA 1PFNA 5LMUL 1ZEQX 5CR3A 1LUZA 4N9TA 2CW0C 2L15A 3QJYA 1SNPA 2VB2X 3SDZA 2WB1B 3I70A 3I4MH 1Y1VH 3H0GB 2KBNA 5G3LF 1VQ9A 3KLWA 1PMRA 2YTVA 1C9OA 1CKMA 2F3IA 2K33A 5IGEA 4C2MH 1RL2A 2WIIB 1SLJA 2KOLA 4FF3A 2OQ0A 5KYLA 4LFBL 2BA0A 4F87A 5IP9G 2CH4A 4F88A 3H09A 1I50H 2R3ZA 1EQRA 1J5EL 5I9OA 3ULPA 3IRBA 5M5YH 3SK5A 2K5HA 1E2ZA 1L0WA 2TSSA 2NN6G 3IL8A 1SSOA 4CJ1B 5JJZA 4A3DH 3A54A 4NP5A 3A0JA 2JA8H 2IX3A 1K0RA 1NTGA 4POFA 1T9HA 5DM73 3TMEA 3M3YH 3WOFA 2WFWA 1L1OA 4B9WA 4POGA 1NR2A 4HIDA 2JE6I 4K0KL 2PMZB 3E6ZX 4KHPL 2EY6A 1DYQA 2RQXA 5F2DA 1FJGQ 3GTMB 4HJ9A 4IJLA 4KY6A 5DEHA 4GLAC 2ZXRA 5ISRA 3I7FA 1EY9A 3NTHA 1V43A 2BH8A 3BVGA 3X3NA 2YU9H 1TWFB 1SNOA 1JR0D 2I07B 2OQKA 2WAQE 1QVCA 4AYBE 3MHBA 5JJLA 4IFDJ 4PQXA 4G57A 4DGZA 1BBWA 1A15A 3MXGA 4N8FA 3EVQA 5DLQE 1BF4A 1ESFA 4PZ7A 1N8RC 1EU3A 5CC4A 3I4LA 3T56B 3DM1A 4XYQA 1PRTD 5C0XH 1ILQA 5JEAH 1N9WA 1WTVA 2UUCQ 2X6GA 2Q8RE 2PQAB 1TQOA 4C3JB 2F0TA 1LM0A 5ELBA 2B2VA 5GAEC 2B3GA 4BA1I 3DHQA 4QIWB 4BBSB 4MNOA 4DV7Q 3J81j 3GTMH 3D31A 4I7AA 1QB5D 5C3EG 1F9QA 3URYA 3L3OC 1QE6A 2PW5A 2QKIC 1E2WA 1FNWA 2EXDA 4RHSA 1P16A 1U5KA 4GN5A 2E2JB 3I56A 4RGNA 4A3FG 3C3LA 1KRTA 4Y52H 2CQAA 1F2ZA 1EY6A 3T16A 4L8JA 1VQ7A 1NY4A 1WVLA 4R8IA 5C3EB 4H13C 2G5DA 5JJIA 1VQ4A 1ZYRD 3HOVH 4YCUA 2I0QA 1C8CA 2DGYA 2PNHA 3U4ZA 4FXKC 3RN2A 5HY6A 4P2CB 3K59A 1HNXL 4C3JH 4A3FB 1CHQD 4HIKA 5D65A 1LABA 4B3SQ 3HZXA 3CCLA 4V0BA 4X3TA 4BBSH 2IL8A 1X3EA 3K0YA 4CKEA 3K5NA 5M9OA 5GADC 5ELEA 4I65A 3UDXA 1CHPD 5JVG3 4ME3A 3DWAA 2K52A 4KK7A 1HR0Q 1SMXA 3D0FA 5FLXE 4R4IA 1BCPC 2ENBA 3U9SA 3GTOB 1D5XC 1O7YA 1PZJD 4C56C 3NENA 4IFDI 3MXNA 3S15H 5E4WC 1WYDA 4DF7A 3Q22A 4DAVA 4IUVA 1WTXA 3S17B 2BDNA 4RMFA 1D1KA 3M7GA 2FXQA 3UE0A 2IWHA 3SEBA 3S1RH 4X66Q 2B8GA 1X54A 1TU2B 1STGA 5EKIA 1B9NA 1ZYRC 2Z6BA 3LWUA 1IW7D 4JI0Q 1STAA 3VR4A 4XQQA 3D3RA 4L5SA 4A3BG 4AIMA 1F9RA 1QG7A 3MFYA 3KUPA 1SYGA 4QQBX 3NTIA 4GZYC 1SMYC 2XGTA 1D8LA 1K83H 1SE4A 3KBGA 5BR8Q 3VYTA 4IO9A 3S1MB 1PH4A 3CF5A 3GTQH 3L0OA 1I6VC 3HOWG 3VR6A 2EE1A 1Q90A 1JC7A 3OW2A 3U58A 2F0GA 1Q81C 3W3AA 4OO1H 3A7LA 4A3GH 3S17H 4DFAA 3KJOA 1HNWQ 1KXLA 2M00A 3G48A 1CZGA 2B2TC 2JXMB 1X3GA 4BBRH 2E74C 5CORA 2UUCL 2XSCA 3I4OA 4A75A 1TS2A 2RCFA 1I4QA 3NQIA 3ND8A 1SDFA 5CYUA 3M4OH 5J22A 3EIVA 1IYUA 4KJOA 1PH3A 2BA1A 2J0TD 3J80i 1SFOB 2DJFC 4EQ5A 3J81i 5EAYA 1HA5A 3RZDH 3S24A 3H15A 1G8ZD 3M85A 1GJXA 4K6DA 1QVFA 1TIID 3RLNA 1SXTA 4A3CG 4XDXA 1VQEA 1GUGA 4R4OA 1M4VA 1SNMA 2ZXOA 5A2QE 2F0EA 5C0XJ 3ICEA 1JT8A 3KLRA 5JEAJ 1K3BC 2F0FA 2PQAA 4GLXA 3UDGA 4ILWA 4Z9CB 3G71A 3S16B 2Z4HA 1VQJA 2KHSA 4BXXG 3L9AX 3G4SA 2AQ3B 4M1UB 5BN4A 1HNZQ 2Z0SA 2BCOA 3CPFA 1BNZA 4GKJQ 1T5EA 2E2IB 1ILPA 1DOKA 2A6ED 2F0NA 1SROA 1A0IA 1MBYA 4A3JB 2R92H 1RTNA 4B3SL 2V1CC 3QOLA 4CKCA 1CT1D 3J7ZC 2ICIA 4HCSA 4IUQA 3CQZH 2VXWA 2ZT9C 1BR9A 1KLUD 4OHJA 5GAGC 4U673 1HR0L 4PZ8A 5C5MA 5EPLA 5CV7A 1UE7A 5M3MG 2JA5G 1ICWA 3KOJA 2E8GA 4I7ZC 2CQOA 1K8MA 1RIPA 2LKVA 3J7A5 1M1KC 4QIWE 1LV9A 4K2LA 1N32Q 1GKHA 3U4VA 1EOTA 1EQQA 2OXPA 1QUQA 1SYFA 1K8GA 1X3FA 4X66L 2A68C 2QEXA 4LF9Q 5IT9c 1PYSB 4MN3A 1Y14B 2MQHA 3MXPA 5JJKA 5M3MB 4A93B 2JA5B 4ULLA 3MZ5A 2HDMA 2AWNA 4JI0L 3K6OA 1BXTA 3QB3A 4A3JH 1X6OA 2L55A 2DY7A 1VQPA 2ZTCA 5DM63 1EOVA 2KCNA 1TWHH 3I4NG 3EA6A 1IBLQ 1LTSD 5M5WB 1JWMD 5C4XH 3U50C 2JA7B 2L0CA 3CCEA 3K8AA 5BR8L 1D1IA 4LUVA 4A3LG 3DLLA 4ZAIA 3K7UC 1V1QA 1I5FA 2Z1CA 4A3EB 1AW7A 3NQTA 2AMCB 3RMHA 3NBHB 2VB3X 4BY1G 5C0XI 3I4NB 4RA8A 1HFGA 5IYCG 4TQUS 4GN3B 4ABNA 4G7ZC 3R3OA 1PTOH 2E75C 2B39A 4ZRZA 3AEVA 1W3SA 3H91A 3D4DA 4JPBW 1YNND 2GA4B 1TWGB 2LXJA 1MJCA 1QNKA 4BS9A 1G51A 3MA2B 2ZXPA 4B3RQ 3B6YA 4NXMQ 3GDEA 5KNDA 5IGDA 1A6XA 1IHZA 4J1MA 4B3TQ 4XIGS 3HKZG 2RSOA 5IIFA 2XWBB 5D3IB 4IFDG 1BBUA 2R7DA 5M5WH 4P73A 2JA7H 4X65Q 2K05A 1TT2A 5E4XA 1VQMA 2HD3A 1CQVA 1HFNA 2Y0SG 1HCZA 1Y1WH 3HKZB 2AUKA 4A3EH 4DR4Q 3PIPA 1K73C 2EY1A 3A7AB 4LFAL 5LMUQ 1PLFA 1PZID 4RGTA 5KEEA 1GM5A 5FO9B 5KNCA 4JOIC 1HNZL 3MEFA 3S14B 2VZAA 1YHAA 1Q86C 3BDOA 1E24A 1SE3A 1YNNC 2JN4A 4YWLA 4BA2I 3S9WA 1W6JA 3IFDA 2F1MA 2F03A 1VQNA 3K5LA 3JAMi 4JBJA 2ZM6Q 4IPCA 2FMMA 5JOBA 2I46A 4UHVA 1WOCA 4ZK9B 1G2TA 4L5RC 1SYBA 3V05A 4ZKCB 4DR3L 3X3MA 3T51B 4BWGB 1Q8IA 3E5SA 2JA6G 3RUZA 4APVA 4IPGA 2XRQD 4CDEC 1G6ZA 1WCMG 3LNNA 2F3WA 4AQYQ 1N32L 5FJ8G 1XTCD 1G6PA 3E9IA 4WFN3 2EYHA 4IOCA 4OWXB 5CBEE 2OF1A 3VYUA 1Y8OB 3J7YW 3HOYH 2GVAA 2PYKA 3BDCA 1J9OA 1TS3A 4LF9L 3S14H 1QOHA 4B3MQ 2O4XA 4C3HB 1F77A 3V2TA 2CKZB 4XQJA 1N33Q 2K5WA 1XX8A 2OTJA 4DV0L 4L5TA 4J6HA 4LF7Q 1TR5A 2MHVA 3ULJA 2XNAC 3OOCA 2N8NA 2EIFA 1IBLL 5DAUA 3R93A 1PA6A 1PTOF 1SEBD 4LWCA 3OHXC 2FMCA 2YTXA 4HJ7A 1SYEA 1QZHA 4JI3L 3H6MA 1Y1VG 1VCIA 2IJ0A 5HURA 4OO1I 1TY2A 2N88A 1H9RA 2IY5B 1KDBA 1K8OA 1KABA 2KHJA 1AN8A 2MO0A 2NBFA 2CW0D 3STBD 4HJ5A 2QEJC 4OIKA 1WTQA 4RFBA 4N9PA 1D2BA 4DXFA 1W6KA 1XNQQ 4QMGA 3I4MB 1UE1A 4K8IA 3JC66 1F2YA 1Y1VB 2RDGA 1HH2P 4B3RL 5M5XB 1A8VA 4NXML 3FPPA 4C2MB 4B3TL 2F0MA 3SR1A 4A3DG 1FD7D 1JOQA 1VMPA 5GAHC 2JA8G 3NBHA 3HEJA 1VMCA 4X65L 4JI8Q 1I50B 3CC7A 1WI5A 1EIFA 1JJGA 5C5LA 2WB1G 3H94A 5M5YB 1YNXA 1PRTB 4GNXB 4IOAA 3K58A 1HPCA 2OT2A 2AQ2B 1S5FD 3OWEB 2E5LQ 4DR4L 2E2DC 4A3IB 3K80C 2JA8B 2VY3A 2KHIA 4KKTA 3STBC 4K14A 4FF4A 1SNCA 4EQNA 2OEOA 4FNFA 1B3AA 1X56A 3H3VC 3M3YB 1X3PA 2Q2UA 3D4WA 3DM3A 2MO1A 3MXNB 3FRPB 5LL6X 5ELOA 1G2SA 3Q6SA 4HJ8A 1A3UA 1HNXQ 3BYYB 5FKAC 5M5XH 5J1ZA 2ZJPA 3FKIB 2R7ZB 2ZM6L 3GQBA 2EOTA 3R2TA 3OIQA 3FMCA 1FVIA 2NB0A 4J8QA 1QILA 3I55A 4R4CA 2O2LD 2YU9B 4BY7H 5C0XG 5J39A 1X65A 5JEAG 3DEPA 1SRUA 4IUUA 1B4OA 5C44B 5LL6S 2PO4A 1H9SA 5ELDA 1SJED 4K5WA 3D4RA 4HIMA 3N6RA 1UWVA 1EUJA 2LMCB 4AQYL 4ALPA 2JSOA 1SNDA 4A3IH 4CDFC 4GS3A 1OO9B 2BOSA 1TXYA 3K0XA 4C1NK 3EROA 2KVMA 2B2WC 2DN8A 2EZVA 1IBMQ 3HOZH 1KD1C 4B3ML 2L4NA 3F1ZA 3M7NA 4X3SA 4QL5A 4K8JA 4JK1C 5T1IA 4O1NA 5CGKA 2QILA 1N33L 1EY7A 3J80L 1GOZA 1MI2A 4LF7L 3FKIH 3UI2A 2R7ZH 3J81L 1ASZA 1L1OC 2BE5C 1STHA 1CK1A 5ELCA 5JPNC 1OXSC 3T1HQ 2Q2HA 3TZUA 2UXCQ 4PG3A 3HOVG 2I5MX 1SR3A 2NVQH 4QJFA 1K9MC 3C46A 5C44H 2E2HH 2Y0SE 2QF7A 2B2YC 1JB7A 4JI7Q 3NPPA 5CV4A 3D6CA 5C4JH 4C3JG 1HZ9A 3S1QB 2EPBA 1D7QA 4JI2Q 4FXDA 4OEMB 2F0WA 2Z6KC 4PZ6A 1LT6D 2ICEC 4J15A 3KJPA 4BBSG 3CCJA 5E7NA 1EY0A 5EBDA 2EJFC 4IURA 3T1YQ 5C4HA 3HOVB 1EEFD 1XNQL 1STEA 4YWMA 1RJTA 4DK6C 3OMCA 2EYMA 1EIYB 1JWSD 3EQLC 3W1GA 4KKUA 4OL7A 1SNQA 3KYHC 3PSIA 2LXKA 1BDOA 3G6JB 1WD1A 2B2VC 1BBXC 4L63B 1O7IA 1GXDC 2D9UA 4P74A 4DR5Q 2NTSA 4JI8L 3ZJYC 4HTHA 5E3FA 1ZXTA 1BCPD 1FNVA 1K3RA 1U4LA 4DNRB 2M2LA 2NZ1D 3NHHA 2GVBA 1N36Q 3A8KE 4DR1Q 3S15B 2L1BA 1LYLA 3S1QH 1HZCA 4PNYA 2E5LL 4V190 1YJ9A 3LX0A 2K6AA 1ET6A 2RDFA 4GOPC 5FLMH 5H1SE 3S1RB 1EZ6A 2EYJA 1N34Q 1I3QB 2DY8A 4PV1C 1NAPA 4YWKA 3R8BA 1Q46A 3PUZA 5K36H 4LFCQ 4DV6Q 1JWUD 4G7OC 2K75A 3M4QA 2Z9HA 1EQTA 4FF2A 1Z6HA 4X62Q 4CJ2C 1PRTF 5IGBA 2H1EA 1QUQB 4GNXA 4OO1G 4A3GG 1FNUA 2LY7A 3KF6A 4GKKL 2A19A 1SMYD 3G7LA 3PF5A 3TRZA 3TBIB 1K83B
chains in the Genus database with same CATH topology
1TS5A 5FO7B 1Y8PB 1B1ZA 5BN3A 3IAYA 3K5OA 1DXMA 3GD7A 3GTQB 1XXGA 4JBWA 1QCBD 4A3GB 4DU9A 5I6WA 2FINB 4HCEA 4HEDA 4ODGA 2DNCA 1L0YB 3J7AF 1AZPA 4BBRB 1DOLA 1B50A 3I72A 2MJ8A 1RDPD 3M4OB 1CM9A 3NE5B 1E0BA 4HMIA 4QCLA 1WTOA 3KLSA 1RF2D 2Q8TA 3RZDB 1CZWA 2N55A 1H9KA 1LACA 5TSSA 1V1PB 2F0PA 4ZUIA 2F0HA 4FVMA 3Q0AA 1HTLD 2B2UC 2J4XA 3TN2A 1WTWA 4DNTB 4F8MA 1G291 1F9PA 1KTKA 3PV0A 3MWYW 1FGBD 3A8JE 4KN7C 2IT1A 1CA5A 2KEEA 4RKLA 1JOOA 2EYFA 2R92B 2WACA 2B2TA 5T1GA 1JICA 3JAML 2A74C 3D6WA 4NW2A 3CQZB 4IUTA 1F2LA 2WINB 1DM0B 2WKCA 1LT3D 4FP5D 4HR7B 4DAYA 1OXXK 5CV9A 1O80A 4NKLA 3PO3B 3SE0A 2EVBA 1EFID 2A68D 1EYAA 3P20A 3AU7A 4OGQC 4H44C 1S5BD 2CVRA 3HG9A 4KJNA 1TWHB 2F0JA 1OXTA 5C4XB 4K6LA 4HSPA 2QDBA 4HN7A 3RLFA 1AEXA 5KYIA 3IFTA 4LK1C 4XYOA 3K57A 4B08A 3T53B 1Z47A 2K28A 1PTOB 3KK7A 2F0QA 2PQEA 2PPBC 5KIXA 4MIUA 3DEOA 3I8ZA 1RD9D 3SVMA 3KBXA 3MC0B 1GUNA 4CGYB 1LTRD 2LS01 1RCVD 4FO2A 1M8AA 1HQRD 1YNJD 4KD3A 2M9VA 2PNRC 3DWQA 3V96A 3J80E 3WOEA 1B9MA 4KHVA 3J81E 3S1NB 3CU7A 4WJWA 4KY5A 3Q24A 1E2VA 4KI0A 4KD4A 1Y1WB 1ENAA 3VR3A 1JOKA 1S4ZA 1NCVA 2A73B 5IGFA 4X3UA 2R61A 1I4GA 1UUPA 1VF7A 3MVVA 2X69A 1NSNS 1V1PA 4TKOB 1EQVA 2SNSA 4Q5VA 4YIJA 2MPMA 1L0XB 3U9OA 2Q8IB 3C2PA 1EIHA 1YNJC 2RDHA 4X3KA 4TSSA 2HCIA 3QOJA 1MSHA 4MHEA 1H9JA 2MGSA 4PMWA 3DWPA 2MUYA 2HQEA 5IGCA 3NUCA 5BN5A 3HOYB 1H9SB 4RCOA 1RKNA 3C1EA 3FDTA 1OXUA 2KA7A 2TMPA 4UDUC 2YYZA 2NWGA 3AMUA 2EJMA 3MXUA 3A55A 5COYA 5DNFA 1HUNA 1UEAB 4EGVA 4EQPA 1EU4A 4S3SA 1EIGA 2HCCA 4HSVA 1LO5D 1KNEA 1T5XD 4LJZC 4C3HG 1Z7TA 3BG3A 5M3FB 3QG1A 3BVZA 4IQZA 4ZKBB 1LT4D 3I73A 1HA6A 4EQOA 4DAPA 2SDFA 1DZ1A 1LTID 3F2UA 1U4PA 2A69C 1ZKOA 1CTMA 2IX1A 1DCZA 1RTOA 5E1FA 1ML0D 3SK6A 1J8IA 3OPOA 1MGSA 1LTTD 1JCKB 3FPUB 2X6LA 3CHBD 1PFMA 2PCFB 4UAIA 1KNAA 4C1NI 1OXVA 3K5MA 4F7XA 4PMCA 3HOUB 1NUCA 1D5ZC 4TRDA 3HP3A 2AQ1B 1UNSA 4ZUJA 2NUCA 5G3LD 5CBAE 1O78A 3I3CA 1U4RA 4NDXA 3BYTB 4BY7B 1EYCA 4RAUC 2F0OA 3CRKC 5EKLA 3A56A 2F0IA 3JAME 1EY8A 2J7ZA 4E6IA 2C5CA 1Y69U 4KY7A 1AP0A 4R9WA 3LWEA 2AWOA 1PFBA 1G91A 1D5MC 2PZUA 3HOZB 4ZLTF 3KLSX 1HUMA 1S5DD 1I4HA 3VR5A 2PZTA 1BCPB 2BE5D 1LTGD 1Q3LA 3OW7A 1XYIA 1Q1BA 3DMUA 5EPJA 4XXEA 1O7LA 1AZQA 3FVQA 3IKJA 4ZYSA 2NVQB 3I91A 1D6EC 3PO2B 1LT5D 2E2HB 5C3WA 3SK8A 3PMFA 1NR4A 5C4JB 1DJRD 1GUTA 5IT9L 3P75A 1I4PA 2K7VA 2KQ3A 2G9DA 1DOMA 1EWCA 2A6HC 2K5DA 2JEBI 1QJOA 4ME5A 3SXHA 1RHPA 1KDCA 4KV6A 2B2WA 1HTPA 1TY0A 3N52A 5CV6A 1WTPA 5K36G 2Z8LA 5EQ0A 5EPKA 1GUWA 1DD2A 4XT3B 2FHTA 3D8GA 3VA7A 2BDOA 1EYDA 3NTKA 2R6GA 1MD2D 2EJGC 2B2YA 2RVLA 1ENCA 3OWFA 3QO2A 5K5PA 1SYDA 2K1BA 1BO0A 5HGTA 1A2TA 4H0LC 4RCNA 2EYOA 2WV6D 2LFNA 1TS4A 4RH6A 5EKKA 3R2IA 5I4DA 4RGOS 1SJHD 4NMZA 3GP7A 2NN6H 1Y8NB 2PW7A 1EL0A 1O7ZA 1GUSA 3KF8A 2RA4A 3VR2A 3ITPA 1FYCA 1LLRD 3K7AB 5CV5A 1HRJA 4K2KA 3PIP3 3TP8A 3P1HA 3EJIA 2E76C 3DUZA 2K03A 1IKMA 3ONAB 1PRTC 1EEID 3HOXB 2EYLA 1ET9A 2IX0A 1EY5A 3GO5A 4FYDA 1B2TA 5CMDA 1BCPF 2G9HD 3FEWX 5EJWA 2NVXB 3CRLC 2V4DA 4ID6A 2K5QA 3BZDB 1B53A 3E0JA 2JEAI 3A8IE 4QUFA 2SNMA 1B44D 1PXUA 1SE2A 4A3KB 1TVXA 2IPKD 3SK4A 5ELFA 3TP7A 3Q23A 3DXJC 5IODA 2F4IA 3SHLA 2RKSA 5I6YA 2EDGA 1BOSA 1STNA 1VDZA 5NUCA 4G7HC 3TDQA 3C1FA 3BS1A 4CBVA 1A3TA 2B2UA 1H9MA 4HMJA 5IGGA 4IUPA 2EXZA 3TZDA 1CFMA 3O13A 3T13A 1ENFA 4A3BB 5IOCA 4U68A 1A3VA 5C4ZA 1ONLA 2EY5A 2HDLA 3PUWA 3S2DB 2NYZD 3HOWB 3HRZC 1IW7C 1XWEA 1A2UA 2C9OA 4IUNA 1V8QA 2XRSD 2XVSA 4DA2A 1Q12A 3NSWA 5CV8A 2O5IC 4KMUC 4B9XA 2EY2A 2R93B 1GHJA 1RODA 3I90A 2F0UA 1IL8A 1KAAA 3M4YA 2XN9C 2K32A 4QF4A 4RGMA 1TWAB 1CA6A 4K5XA 1SBBB 1TKWB 3RD4A 2A5HA 1HHVA 4FXGC 4QUCA 4RKBA 1S5ED 1GUOA 1Q1EA 5C6AA 3MFGA 2MP1A 1JORA 2NVYB 1U9RA 2KECA 4M8AA 1C4QA 5LHY1 1UAPA 2AUJD 2ID0A 2K04A 1VF5C 3BVMA 3PUVA 1BQQT 2H4OA 5FK9C 5IT9E 4QB4A 3NBIA 1MSGA 1I4XA 1STBA 3TSSA 1CI3M 1X32A 3GTKB 2B8FA 5KNBA 1BUVT 4L6TB 4XQNA 3QIAA 3GTPB 4C3IG 4LMQD 2VUMB 2O5JC 5JAVA 1R4PB 5FOBB 2A6EC 4O42A 4PMBA 2KEDA 1GHKA 1S5CD 2JP1A 3GTJB 1EY4A 4WORA 1PZKD 1QWYA 3P7JA 3VYRA 1R4QB 4C3IB 3TP5A 2EYPA 4KN4C 1TWCB 3NWTA 3OMGA 4IN3A 1C48A 4Q0FA 1SYCA 1JE4A 1V1OA 3EFXD 2KCCA 3NP8A 3HS0C 4R8NA 1ESRA 2QCPX 2F0KA 4CJ0B 2NVTB 2F3VA 3NXWA 5AFWA 2NN6I 3MTSA 2VNUD 4BY1B 1U4MA 1EWHA 4KKSA 2HUGA 2XWJB 3ZYYX 2CHBD 2A69D 2D2CC 2Z4IA 2PZWA 3PUXA 4LAAA 1X3QA 5KGUA 3HGBA 2F0SA 5I9PA 1I6HB 3MAQA 3QWNA 2F0DA 4FF1A 3GTGB 4RWSC 4G4KA 1KDAA 3NWSA 5EBCA 4DN4M 2WAQB 4AYBB 3S2HB 2K01A 2FFKB 3NK9A 4HAEA 2Y0SB 1WD0A 1PTOD 3AB9A 1EZ8A 1R9TB 1HXYD 4CHTB 2NTTA 1II3A 5FLXL 2JYOA 1FR3A 4WRDA 1IYVA 4CKBA 4K5VA 4DXGA 3GV6A 4KHZA 4IFDH 1F9SA 3CKIB 5KRUA 2JA6B 2WKDA 2XIWA 3RZOB 4DK0A 4DK1A 2B63B 2RSNA 5JVH3 3ERQA 1F2MA 2RBMA 1WCMB 2KUMA 5JPMC 5EGTA 3BDLA 3W2DA 4EVOA 1PYWD 1PTOC 3OIPA 3OSOA 2SEBD 4A3MB 1IKLA 4IALA 2L5TA 3GV3A 1STYA 2FJ2A 1KLGD 1LTAD 3TP6A 1I4RA 3GTLB 1CQFA 1DONA 4Y7NB 3L7ZC 5I2XA 3ND9A 4OIJA 4XTCS 2DNEA 5A35A 2SOBA 5I2YA 3WDNA 2IW3A 2F0VA 3PUYA 3VYSA 1PDQA 5D14A 2KJXA 3MEHA 2WP8J 4ZQ3A 4IZ8A 4RHRA 2D5DA 1HQMC 5C3XA 1SAPA 4XT1B 2L12A 2A6HD 2L11A 3T4AC 1JB3A 5A2QL 1AFPA 5FO8B 2D62A 1QNUA 2L9HA 1JQYD 5D3DA 2F0LA 3J7AV 1LTBD 3VA5A 1WTRA 4KTAA 3PIO3 4A3DB 4H7BA 1PFNA 1ZEQX 5CR3A 4N9TA 2CW0C 3QJYA 1SNPA 2VB2X 3SDZA 2WB1B 3I70A 3H0GB 5G3LF 1PMRA 5IGEA 2K33A 2WIIB 2KOLA 4FF3A 5KYLA 2BA0A 4F87A 4F88A 3H09A 2R3ZA 5I9OA 3SK5A 1E2ZA 2TSSA 2NN6G 3IL8A 1SSOA 4CJ1B 5JJZA 3A54A 4NP5A 2IX3A 5DM73 3TMEA 3WOFA 4B9WA 1NR2A 2JE6I 2PMZB 3E6ZX 2EY6A 1DYQA 2RQXA 5F2DA 3GTMB 4KY6A 5DEHA 2ZXRA 5ISRA 1EY9A 3NTHA 1V43A 3BVGA 3X3NA 1TWFB 1SNOA 1JR0D 2I07B 3MHBA 4IFDJ 4PQXA 4G57A 4DGZA 1A15A 3MXGA 3EVQA 1BF4A 1ESFA 1EU3A 5CC4A 3I4LA 3T56B 3DM1A 4XYQA 1PRTD 5C0XH 1ILQA 5JEAH 1WTVA 2X6GA 2Q8RE 1TQOA 4C3JB 2F0TA 5ELBA 2B2VA 4BA1I 3DHQA 4QIWB 4BBSB 3D31A 1QB5D 1F9QA 3URYA 3L3OC 1QE6A 2PW5A 2QKIC 1E2WA 1FNWA 4RHSA 2E2JB 4RGNA 3C3LA 2CQAA 1F2ZA 1EY6A 3T16A 4L8JA 1WVLA 4R8IA 5C3EB 4H13C 1ZYRD 1C8CA 4FXKC 4P2CB 3K59A 4A3FB 1CHQD 5D65A 1LABA 3HZXA 4V0BA 4X3TA 2IL8A 3K0YA 4CKEA 3K5NA 5M9OA 5ELEA 4I65A 1CHPD 5JVG3 3DWAA 4KK7A 5FLXE 1BCPC 2ENBA 3U9SA 3GTOB 1D5XC 1O7YA 1PZJD 4C56C 4IFDI 3MXNA 5E4WC 4DF7A 3Q22A 4DAVA 4IUVA 1WTXA 3S17B 2BDNA 1D1KA 3M7GA 2IWHA 3SEBA 2B8GA 1TU2B 1STGA 5EKIA 1B9NA 1ZYRC 3LWUA 1IW7D 1STAA 3VR4A 4XQQA 3D3RA 1F9RA 1QG7A 3MFYA 3KUPA 1SYGA 3NTIA 4GZYC 1SMYC 1SE4A 3KBGA 3VYTA 3S1MB 1I6VC 3VR6A 2EE1A 1Q90A 1JC7A 2F0GA 3W3AA 4OO1H 3A7LA 4DFAA 2M00A 1CZGA 2B2TC 2JXMB 2E74C 5CORA 2XSCA 1TS2A 3NQIA 1I4QA 3ND8A 1SDFA 5CYUA 5J22A 1IYUA 4KJOA 2BA1A 2J0TD 1SFOB 1HA5A 1G8ZD 3M85A 1GJXA 4K6DA 1TIID 1SXTA 4XDXA 1GUGA 1M4VA 1SNMA 2ZXOA 5A2QE 2F0EA 5C0XJ 3KLRA 5JEAJ 2F0FA 4ILWA 4Z9CB 3S16B 2Z4HA 2KHSA 3L9AX 2AQ3B 4M1UB 5BN4A 2BCOA 1BNZA 1T5EA 2E2IB 1ILPA 1DOKA 2A6ED 2F0NA 1MBYA 4A3JB 1RTNA 3QOLA 4CKCA 1CT1D 2ICIA 4HCSA 4IUQA 2VXWA 2ZT9C 1BR9A 1KLUD 4OHJA 4U673 5C5MA 5EPLA 5CV7A 1ICWA 4I7ZC 1K8MA 2LKVA 1LV9A 4K2LA 1EOTA 2OXPA 1SYFA 2A68C 4MN3A 3MXPA 5M3MB 4A93B 2JA5B 4ULLA 3MZ5A 2HDMA 2AWNA 3K6OA 1BXTA 3QB3A 2L55A 2DY7A 5DM63 2KCNA 3EA6A 1LTSD 5M5WB 1JWMD 2JA7B 2L0CA 1D1IA 4ZAIA 2Z1CA 4A3EB 1AW7A 3NQTA 3RMHA 2VB3X 5C0XI 3I4NB 4RA8A 1HFGA 4TQUS 4ABNA 4G7ZC 3R3OA 1PTOH 2E75C 2B39A 4ZRZA 3H91A 3D4DA 1YNND 2GA4B 1TWGB 1QNKA 4BS9A 3MA2B 2ZXPA 5KNDA 1A6XA 5IGDA 1IHZA 4J1MA 4XIGS 2RSOA 5IIFA 2XWBB 5D3IB 4IFDG 2K05A 1TT2A 5E4XA 1CQVA 1HFNA 1HCZA 3HKZB 2AUKA 2EY1A 3A7AB 1PLFA 1PZID 4RGTA 5KEEA 5FO9B 5KNCA 3S14B 3BDOA 1SE3A 1YNNC 4BA2I 3S9WA 1W6JA 3IFDA 2F1MA 2F03A 3K5LA 2FMMA 5JOBA 2I46A 4ZK9B 1G2TA 1SYBA 3V05A 4ZKCB 3X3MA 3T51B 4BWGB 1Q8IA 3E5SA 3RUZA 2XRQD 1G6ZA 3LNNA 2F3WA 1XTCD 4WFN3 2EYHA 5CBEE 2OF1A 3VYUA 1Y8OB 3J7YW 2PYKA 3BDCA 1J9OA 1TS3A 1QOHA 2O4XA 4C3HB 1F77A 3V2TA 4XQJA 2K5WA 1XX8A 4J6HA 1TR5A 2MHVA 2XNAC 3OOCA 5DAUA 3R93A 1PTOF 1SEBD 3OHXC 2FMCA 1SYEA 3H6MA 2IJ0A 1VCIA 5HURA 4OO1I 1TY2A 2N88A 1H9RA 1KDBA 1K8OA 1KABA 1AN8A 2NBFA 2CW0D 2QEJC 4OIKA 1WTQA 4RFBA 4N9PA 1D2BA 4DXFA 1W6KA 4QMGA 3I4MB 4K8IA 1F2YA 1Y1VB 2RDGA 5M5XB 3FPPA 4C2MB 2F0MA 3SR1A 1FD7D 1JOQA 1VMPA 3NBHA 3HEJA 1VMCA 1I50B 5C5LA 3H94A 5M5YB 1PRTB 3K58A 1HPCA 2OT2A 2AQ2B 1S5FD 3OWEB 2E2DC 4A3IB 2JA8B 4KKTA 4FF4A 4K14A 1SNCA 4EQNA 2OEOA 4FNFA 1B3AA 3H3VC 3M3YB 1X3PA 3D4WA 3FRPB 5LL6X 1G2SA 3Q6SA 1A3UA 3BYYB 5FKAC 5J1ZA 3FKIB 2R7ZB 3GQBA 2EOTA 3OIQA 3FMCA 3R2TA 2NB0A 4J8QA 1QILA 2O2LD 2YU9B 5C0XG 5J39A 5JEAG 3DEPA 4IUUA 1B4OA 5C44B 5LL6S 2PO4A 1H9SA 5ELDA 1SJED 4K5WA 3D4RA 3N6RA 2LMCB 2JSOA 1SNDA 1OO9B 2BOSA 4C1NK 3EROA 2KVMA 2B2WC 2DN8A 2EZVA 2L4NA 3M7NA 4X3SA 4K8JA 4JK1C 5T1IA 4O1NA 5CGKA 2QILA 1EY7A 3J80L 1GOZA 1MI2A 3UI2A 3J81L 2BE5C 1STHA 1CK1A 5ELCA 5JPNC 1OXSC 3TZUA 3C46A 2QF7A 2B2YC 3NPPA 5CV4A 3D6CA 4C3JG 3S1QB 2EPBA 4FXDA 2F0WA 1LT6D 2ICEC 1EY0A 5EBDA 2EJFC 4IURA 5C4HA 3HOVB 1EEFD 1STEA 1RJTA 3OMCA 2EYMA 1JWSD 3EQLC 4KKUA 4OL7A 1SNQA 1BDOA 3G6JB 1WD1A 2B2VC 1BBXC 4L63B 1GXDC 2D9UA 2NTSA 4HTHA 5E3FA 1ZXTA 1BCPD 1FNVA 1U4LA 4DNRB 2M2LA 2NZ1D 3NHHA 3A8KE 3S15B 2L1BA 4PNYA 4V190 3LX0A 2K6AA 1ET6A 2RDFA 3S1RB 1EZ6A 2EYJA 1I3QB 2DY8A 4PV1C 1NAPA 3R8BA 5K36H 3PUZA 1JWUD 4G7OC 1EQTA 4FF2A 1Z6HA 4CJ2C 1PRTF 5IGBA 2H1EA 4OO1G 1FNUA 2LY7A 1SMYD 3G7LA 3TBIB 1K83B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JK1 C;  1B9N A;  1ZYR C;  1Y8P B;  2D62 A;  3QIA A;  3SE0 A;  2EVB A;  1GUS A;  3LWU A;  5BN3 A;  3VR2 A;  1DXM A;  1IW7 D;  3I4L A;  3T56 B;  3GD7 A;  1HCZ A;  3VR4 A;  1GUT A;  2ZT9 C;  1FYC A;  2AUK A;  4TKO B;  5C0X H;  2K7V A;  2BE5 C;  2A68 D;  2O5J C;  3A7A B;  5JEA H;  3OPO A;  3P20 A;  1FR3 A;  1ONL A;  1OXS C;  4JBW A;  2A6E C;  3FPP A;  3TZU A;  4OGQ C;  2A6H C;  5KNC A;  3MFY A;  4I7Z C;  1IYV A;  2JEB I;  4H44 C;  1K8M A;  2Q8I B;  1GHK A;  3PUW A;  1SMY C;  2E76 C;  4GZY C;  1QJO A;  2CW0 C;  2DNC A;  2QF7 A;  2PCF B;  3BDO A;  1YNJ C;  1YNN C;  3QJY A;  4BA1 I;  3SDZ A;  3I72 A;  4KHZ A;  1IW7 C;  4BA2 I;  1I6V C;  1V8Q A;  3D31 A;  1OXT A;  2F1M A;  4KN4 C;  3VR6 A;  4IFD H;  1Q90 A;  2A68 C;  1OXV A;  3NE5 B;  1PMR A;  3H94 A;  1Q12 A;  2EJF C;  2K33 A;  1H9J A;  1HTP A;  3A7L A;  3W3A A;  2O5I C;  4OO1 H;  4KMU C;  2KCC A;  3RLF A;  3T51 B;  1HPC A;  4DK0 A;  4DK1 A;  1E2W A;  2BA0 A;  1H9K A;  3IFT A;  1GHJ A;  4LK1 C;  2JXM B;  5BN5 A;  2E74 C;  1H9S B;  5K36 G;  3EQL C;  1LAC A;  1OXU A;  3ND8 A;  4KKU A;  4KKT A;  3T53 B;  2KA7 A;  1IYU A;  3M4Y A;  1O78 A;  4L8J A;  3CRL C;  2L5T A;  2K32 A;  2V4D A;  3LNN A;  2YYZ A;  2BA1 A;  1BDO A;  1DD2 A;  4H13 C;  2NN6 I;  3CRK C;  2EJM A;  2JEA I;  4DNT B;  1E2Z A;  2BDO A;  3A8I E;  3MXU A;  1G29 1;  3VA7 A;  2PPB C;  1TKW B;  2R6G A;  2NN6 G;  2EJG C;  3M85 A;  1EWH A;  3PV0 A;  1Y69 U;  4KKS A;  1Y8O B;  1GJX A;  3L7Z C;  4DNR B;  3A8J E;  3GQB A;  3FMC A;  1GUO A;  1Q1E A;  3ND9 A;  4KN7 C;  1GUN A;  1LAB A;  4XTC S;  2DNE A;  3A8K E;  5A35 A;  4TQU S;  3WDN A;  1GUG A;  4G7Z C;  5C0X G;  2AWO A;  2IT1 A;  3DXJ C;  5JEA G;  4LJZ C;  2AUJ D;  2A69 D;  2E75 C;  2D2C C;  1Z7T A;  3PUY A;  3KLR A;  3BG3 A;  2EDG A;  3PUX A;  3QG1 A;  1VF5 C;  1H9S A;  4H0L C;  4RCN A;  2JE6 I;  3HGB A;  3OOC A;  2PNR C;  4IQZ A;  3D4R A;  1B9M A;  1VDZ A;  3I73 A;  3PUV A;  3N6R A;  4G7H C;  4PV1 C;  2LMC B;  5K36 H;  3PUZ A;  3U9S A;  5KND A;  1A6X A;  2D5D A;  1E2V A;  1HQM C;  4KI0 A;  3VR5 A;  5BN4 A;  4G7O C;  1V43 A;  4XIG S;  1VCI A;  2BE5 D;  1Z6H A;  1CI3 M;  1T5E A;  4IFD G;  3VR3 A;  4HR7 B;  3OW7 A;  1OXX K;  2A69 C;  2A6E D;  1H9M A;  1Q1B A;  2DN8 A;  1H9R A;  2A6H D;  1O7L A;  4OO1 G;  2B8F A;  1ZKO A;  2NN6 H;  3IKJ A;  1CTM A;  1K8O A;  3M7N A;  1Y8N B;  2B8G A;  3AB9 A;  1TU2 B;  1CFM A;  5KNB A;  1VF7 A;  1DCZ A; 
#chains in the Genus database with same CATH topology
 1TS5 A;  5FO7 B;  1Y8P B;  1B1Z A;  1VQD A;  4BBR G;  5BN3 A;  3IAY A;  3K5O A;  1DXM A;  2R7F A;  3GD7 A;  3GTQ B;  1XXG A;  4AH6 A;  1MKH A;  4JBW A;  1QCB D;  3BU2 A;  4A3G B;  4DU9 A;  5I6W A;  2RHQ B;  3UE1 A;  2FIN B;  4HCE A;  4HED A;  4ODG A;  2N78 A;  2DNC A;  1L0Y B;  3I2Z A;  3J7A F;  1AZP A;  4BBR B;  2UU9 Q;  1DOL A;  1B50 A;  3I72 A;  2MJ8 A;  1RDP D;  1I3Q H;  1IBM L;  3M4O B;  5IYD H;  3K7A H;  1CM9 A;  3NE5 B;  5FLX c;  2JA9 A;  1E0B A;  5IYB H;  4HMI A;  4QCL A;  1WTO A;  3KLS A;  1RF2 D;  2Q8T A;  3CPW A;  3RZD B;  1CZW A;  2N55 A;  1H9K A;  4JI4 Q;  1KL9 A;  3T1H L;  1LAC A;  2UXC L;  5TSS A;  1V1P B;  2WB1 E;  2F0P A;  4ZUI A;  2F0H A;  4DUZ Q;  4FVM A;  1VQI A;  3Q0A A;  1HTL D;  2B2U C;  3ERS X;  2J4X A;  3TN2 A;  3OYY A;  3HOX H;  1WTW A;  4JI7 L;  4DNT B;  4F8M A;  1G29 1;  4LNQ A;  1F9P A;  1NE3 A;  2R92 G;  4JI2 L;  5LMN Q;  4JC0 A;  1KTK A;  3PV0 A;  3MWY W;  1FGB D;  3A8J E;  2QGQ A;  4KN7 C;  3T1Y L;  1AE2 A;  2NVX H;  2ZJR A;  1XMQ Q;  2IT1 A;  1CA5 A;  1IZ6 A;  2KEE A;  4RKL A;  1JOO A;  2EYF A;  2R92 B;  2WAC A;  4LUO A;  5IP7 G;  2B2T A;  5T1G A;  2RHS B;  1JIC A;  3JAM L;  2A74 C;  3D6W A;  4A3K H;  3ULL A;  4NW2 A;  3CQZ B;  4IUT A;  2GN5 A;  1AH9 A;  1F2L A;  4DR5 L;  2WIN B;  1DM0 B;  2WKC A;  1LT3 D;  4FP5 D;  4HR7 B;  4DAY A;  1OXX K;  5CV9 A;  1O80 A;  1WJJ A;  4NKL A;  1N36 L;  2DUD A;  4A76 A;  4DR1 L;  3CD6 A;  2PMZ E;  4A3J G;  3PO3 B;  1VQB A;  2OCE A;  3SE0 A;  2EVB A;  1NJI C;  4LFA Q;  1EFI D;  5IWA Q;  3RR5 A;  3PIO A;  4DKA C;  2A68 D;  4DR2 Q;  5C4X G;  1EYA A;  3P20 A;  1N34 L;  3AU7 A;  2B29 A;  4LFC L;  4OGQ C;  4DV6 L;  4H44 C;  1S72 A;  1S5B D;  4TVA B;  4LUZ A;  4X62 L;  2CVR A;  4A3B H;  3HG9 A;  4KJN A;  4YHH Q;  1TWH B;  2F0J A;  2HQL A;  3L2P A;  1OXT A;  1X9N A;  5C4X B;  4DR3 Q;  2ZTE A;  1C0A A;  4K6L A;  4HSP A;  2QDB A;  4HN7 A;  3RLF A;  4IPH A;  1AEX A;  3S2D H;  5KYI A;  4A93 G;  3IFT A;  4LK1 C;  4XYO A;  3K57 A;  4B08 A;  1PHJ A;  1M90 C;  3T53 B;  1Z47 A;  3PO3 H;  2K28 A;  1NMF A;  1PTO B;  3AFQ A;  3KK7 A;  2UU9 L;  1K28 A;  1BKB A;  2F0Q A;  2PQE A;  3CCS A;  2PPB C;  2JA7 G;  5KIX A;  4LF8 Q;  4YCV A;  4OX9 Q;  4DPG A;  1CSP A;  4JVZ A;  2R93 H;  4MIU A;  3DEO A;  1HZB A;  3I8Z A;  5GRO A;  1RD9 D;  2CWP A;  3SVM A;  3KBX A;  3MC0 B;  1GUN A;  1PH5 A;  1V9P A;  4CGY B;  4DV0 Q;  4A3E G;  1LTR D;  1TWA H;  1PFS A;  2LS0 1;  1SE8 A;  1RCV D;  4JI4 L;  4FO2 A;  1M8A A;  1HQR D;  1YNJ D;  2P5Z X;  4KD3 A;  2M9V A;  2PNR C;  3DWQ A;  3V96 A;  3J80 E;  3WOE A;  1B9M A;  4KHV A;  3J81 E;  4DUZ L;  3S1N B;  4JI3 Q;  3CU7 A;  4WJW A;  4KY5 A;  3Q24 A;  1E2V A;  4KI0 A;  1K0S A;  2C35 B;  2NVY H;  4KD4 A;  4JYA Q;  2HIV A;  2PI2 A;  4JI5 Q;  1Y1W B;  1ENA A;  1P8L A;  2ALY B;  5LMN L;  3VR3 A;  1JOK A;  1XJV A;  1S4Z A;  1NCV A;  2A73 B;  5IGF A;  4X3U A;  2R61 A;  3F2D A;  1I4G A;  1UUP A;  1VF7 A;  3MVV A;  1XMQ L;  3PCO B;  1XPR A;  1QZG A;  2X69 A;  4LF4 Q;  1I94 L;  1NSN S;  1V1P A;  4DV3 Q;  4UP8 A;  4TKO B;  1EQV A;  2SNS A;  4Q5V A;  4YIJ A;  1Q8K A;  2MPM A;  1L0X B;  3U9O A;  3BZK A;  4L5Q A;  2Q8I B;  4CDD C;  5AJ3 Q;  1VS0 A;  1Z9F A;  3C2P A;  3GTP H;  1EIH A;  3HOY G;  1YNJ C;  1PVO A;  2RDH A;  4X3K A;  1Q7Y C;  3S1N H;  2VUM H;  4TSS A;  2HCI A;  2K5V A;  3QOJ A;  3HFZ B;  2UXB Q;  1MSH A;  4MHE A;  1H9J A;  3TRE A;  2MGS A;  4PMW A;  1UE6 A;  3DWP A;  2MUY A;  2HQE A;  5IWA L;  5IGC A;  3NUC A;  4DR2 L;  1JE5 A;  3F2C A;  5BN5 A;  2KEN A;  3GTJ H;  4JI6 Q;  3HOY B;  4YY3 L;  1H9S B;  4RCO A;  3E9H A;  1RKN A;  3C1E A;  3FDT A;  1OXU A;  4C3I H;  1YJN A;  2KA7 A;  2TMP A;  1TWC H;  3CCR A;  4UDU C;  2YYZ A;  4DR6 Q;  4JV5 Q;  2NWG A;  1H95 A;  2UUA Q;  3AMU A;  4LW1 A;  4JBK A;  5HGQ A;  2EJM A;  1GO3 E;  3MXU A;  2RCN A;  2BH2 A;  4JOI A;  4YHH L;  3A55 A;  5COY A;  2D0P A;  5DNF A;  1HUN A;  1UEA B;  4EGV A;  4EQP A;  1EU4 A;  3PGZ A;  4S3S A;  1EIG A;  1PH1 A;  2HCC A;  4HSV A;  1LO5 D;  2NVT H;  1KNE A;  1T5X D;  4LJZ C;  4C3H G;  1CSQ A;  1Z7T A;  4OEL B;  3BG3 A;  5M3F B;  1VQK A;  3QG1 A;  3H3V H;  3BVZ A;  4IQZ A;  4ZKB B;  1LT4 D;  3I73 A;  5IYC H;  1MHW C;  4EQO A;  1HA6 A;  4DAP A;  1WTH A;  3ER0 A;  2SDF A;  1DZ1 A;  4LF8 L;  1LTI D;  3F2U A;  4OX9 L;  1U4P A;  1XTD A;  2A69 C;  4JI1 Q;  2HHH L;  1CKN A;  1ZKO A;  1CTM A;  1I6H H;  2IX1 A;  1DCZ A;  2CFM A;  3GTG H;  1RTO A;  1XNR Q;  5E1F A;  4HJA A;  1ML0 D;  3SK6 A;  1J8I A;  3OPO A;  1MGS A;  3I4M G;  4WJ4 A;  1LTT D;  1JCK B;  3FPU B;  2X6L A;  4JYA L;  4LF5 Q;  2QW7 A;  4JI5 L;  3CHB D;  3RLO A;  5M3F H;  3W1B A;  1PFM A;  2PCF B;  2KCT A;  4UAI A;  3TS0 A;  1JJ2 A;  4FDB A;  1VQG A;  2UUB Q;  1KNA A;  4BY7 G;  4C1N I;  1OXV A;  3K5M A;  4F7X A;  4PMC A;  1XPO A;  1B7Y B;  3CC4 A;  3HOU B;  1NUC A;  4LF4 L;  1D5Z C;  4TRD A;  3TS2 A;  3HP3 A;  4DV3 L;  2AQ1 B;  1Q82 C;  1UNS A;  1DGS A;  4ZUJ A;  2NUC A;  5G3L D;  2YV5 A;  5CBA E;  4A3I G;  1O78 A;  3I3C A;  1U4R A;  4NDX A;  3BYT B;  5J3B A;  5AJ3 L;  4BY7 B;  1EYC A;  4RAU C;  2F0O A;  3CRK C;  5EKL A;  4UY8 C;  3A56 A;  2F0I A;  3HOZ G;  3RZO H;  3JAM E;  1PH6 A;  4MTN A;  3A5U A;  2B63 H;  1EY8 A;  2J7Z A;  4E6I A;  2C5C A;  2IHF A;  3KF6 B;  4KY7 A;  1Y69 U;  1AP0 A;  4R9W A;  2UXB L;  1SN8 A;  3LWE A;  2KCM A;  2K5N A;  2OTL A;  4A3M H;  4DV5 Q;  3FKI G;  2R7Z G;  2ES2 A;  4P75 A;  2AWO A;  2I5L X;  4JI6 L;  4GLV B;  1PFB A;  1G91 A;  1D5M C;  2PZU A;  3HOZ B;  2ZTD A;  4ZLT F;  4QGU A;  3GTL H;  3KLS X;  3VDY A;  1HUM A;  4ZCK A;  1S5D D;  5C44 G;  3HOU H;  4Y7N H;  1I4H A;  4DR6 L;  4JV5 L;  3HKS A;  2UUA L;  1HR0 W;  1EFW A;  3VR5 A;  2HIX A;  2PZT A;  1BCP B;  2BE5 D;  3Q8D A;  1LTG D;  4GKK Q;  1Q3L A;  3OW7 A;  1XYI A;  1Q1B A;  3DMU A;  5EPJ A;  4XXE A;  1O7L A;  1AZQ A;  4KLK A;  3FVQ A;  3IKJ A;  4ZYS A;  2NVQ B;  3I91 A;  1D6E C;  3PO2 B;  3CCU A;  1LT5 D;  2E2H B;  2CH4 W;  5C3W A;  3SK8 A;  3PMF A;  1NR4 A;  5C4J B;  1DJR D;  1GUT A;  1EYG A;  5IT9 L;  3P75 A;  1I4P A;  2K7V A;  2N3S A;  2KQ3 A;  1NMG A;  2G9D A;  1DOM A;  1OTC A;  1K8A C;  1EWC A;  2A6H C;  2K5D A;  2JEB I;  3CP0 A;  4DV2 Q;  1QJO A;  4IJH A;  4ME5 A;  4JI1 L;  3SXH A;  2MNA A;  3A74 A;  1RHP A;  1KDC A;  3HKZ E;  4KV6 A;  5ELN A;  3FP9 A;  2B2W A;  1HTP A;  4JBM A;  1NBW A;  1XNR L;  5LMN W;  1YIJ A;  5FLM G;  1TY0 A;  3N52 A;  2K50 A;  4NB3 A;  5CV6 A;  1WTP A;  5K36 G;  4OWW B;  2Z8L A;  5EQ0 A;  1AE3 A;  3PO2 H;  5EPK A;  3H0G H;  3CC2 A;  1IL2 A;  1GUW A;  1E1O A;  4LF5 L;  3K81 C;  3G6E A;  4O0A A;  1DD2 A;  3UDF A;  4XT3 B;  2FHT A;  3D8G A;  3VA7 A;  2BDO A;  1EYD A;  3NTK A;  2R6G A;  4DAY B;  1MD2 D;  2EJG C;  1KIX A;  2UUB L;  4NXN Q;  1VQ5 A;  2B2Y A;  2RVL A;  1ENC A;  1WFQ A;  4UP9 A;  1U0L A;  4YCW A;  3NEL A;  1UE5 A;  2MFI A;  3OWF A;  2Z6K A;  3QO2 A;  4DV4 Q;  2IHE A;  5K5P A;  1SYD A;  2K1B A;  1BO0 A;  3KDF B;  5HGT A;  1A2T A;  4H0L C;  4RCN A;  2EYO A;  2A8V A;  2QA4 A;  3RNU A;  1J6Q A;  2WV6 D;  1YEZ A;  2LFN A;  5IP9 H;  4UPA A;  1TS4 A;  2QDL A;  4RH6 A;  5EKK A;  3OTO Q;  5IYD G;  3R2I A;  1JJC B;  5I4D A;  2YTY A;  4RGO S;  5IYB G;  1SJH D;  4NMZ A;  1YJW A;  3GP7 A;  1KC8 C;  4R4Q A;  2NN6 H;  4DV5 L;  1Y8N B;  2PW7 A;  1EL0 A;  5GQO A;  1O7Z A;  1GUS A;  3KF8 A;  2RA4 A;  3VR2 A;  3ITP A;  1PYB A;  1FYC A;  1TWF H;  1LLR D;  3K7A B;  3NEM A;  5CV5 A;  1HRJ A;  2D0O A;  4WJ3 M;  4K2K A;  3HOX G;  1KRS A;  3PIP 3;  4GOP A;  3TP8 A;  3P1H A;  1VQH A;  2F52 A;  3EJI A;  4RG1 A;  2E76 C;  3DUZ A;  2K03 A;  1GVP A;  1IKM A;  1YHB A;  3ONA B;  1BVS A;  1PRT C;  4GNX C;  1EEI D;  1KAW A;  3H3V I;  3HOX B;  2EYL A;  1ET9 A;  2IX0 A;  1C7Y A;  1EY5 A;  3RN5 A;  4DUY Q;  3GO5 A;  4FYD A;  1B2T A;  5CMD A;  4P72 A;  4A3K G;  1BCP F;  2G9H D;  3FEW X;  5EJW A;  2NVX B;  2RF4 A;  3CRL C;  2V4D A;  4ID6 A;  5L37 A;  4DV2 L;  2K5Q A;  3BZD B;  2N49 A;  1B53 A;  4NPS A;  3E0J A;  2JEA I;  3A8I E;  3A5Z B;  4QUF A;  2SNM A;  2E2J H;  1B44 D;  1PXU A;  1SE2 A;  3CCV A;  4LF6 Q;  4A3K B;  1TVX A;  2IPK D;  3SK4 A;  5ELF A;  3TP7 A;  3Q23 A;  5C3E H;  2JK8 A;  3DXJ C;  5IOD A;  1CKO A;  1EWI A;  1PV4 A;  2F4I A;  3SHL A;  2RKS A;  1PH7 A;  5I6Y A;  2EDG A;  2VQF Q;  1BOS A;  3WWV A;  1IBK Q;  2HT1 A;  1STN A;  1VDZ A;  5NUC A;  4G7H C;  4A3F H;  3TDQ A;  3C1F A;  3BS1 A;  1FJG L;  4CBV A;  1A3T A;  1VQO A;  2Q2I A;  3EN2 A;  2B2U A;  4NXN L;  3KFU A;  2LSS A;  1H9M A;  4HMJ A;  5IGG A;  3BZC A;  4IUP A;  1YZ6 A;  2EXZ A;  3TZD A;  1I94 Q;  1CFM A;  1HJP A;  4DV4 L;  3O13 A;  3T13 A;  1ENF A;  3GTO H;  4A3B B;  5IOC A;  4X6A H;  3PQI A;  3PO3 G;  4U68 A;  3PF4 A;  1A3V A;  1A62 A;  5C4Z A;  1ONL A;  2EY5 A;  4GN4 B;  1LTL A;  2HDL A;  4JG2 A;  3OTO L;  3PUW A;  3S2D B;  2R93 G;  1L2F A;  2NYZ D;  3UDI A;  5IY0 A;  3HOW B;  3HRZ C;  1IXR A;  3F8T A;  1IW7 C;  1XWE A;  1A2U A;  2C9O A;  4IUN A;  1V8Q A;  2JJQ A;  2XRS D;  2XVS A;  4DA2 A;  4DV7 L;  1KQS A;  1Q12 A;  3KDF A;  3NSW A;  5CV8 A;  2O5I C;  3CME A;  4KMU C;  4YY3 Q;  4B9X A;  3EBE A;  2EY2 A;  2R93 B;  1GHJ A;  1ROD A;  3S1M H;  3M4P A;  3I90 A;  2F0U A;  2F4V Q;  1IL8 A;  1KAA A;  3M4Y A;  2XN9 C;  2K32 A;  3AYH B;  4QF4 A;  4RGM A;  1TWA B;  1CA6 A;  4K5X A;  1SBB B;  2Q2T A;  1TKW B;  3RD4 A;  2A5H A;  1HHV A;  2AKW B;  4FXG C;  2CCZ A;  4DAM A;  4QUC A;  1CKN B;  4RKB A;  1S5E D;  1GUO A;  1Q1E A;  5C6A A;  3MFG A;  2MP1 A;  1JOR A;  2NVY B;  1U9R A;  2KEC A;  3HOW H;  2K14 A;  4M8A A;  1C4Q A;  5LHY 1;  1SFO H;  1UAP A;  2AUJ D;  4DUY L;  2ID0 A;  1A63 A;  2K04 A;  3CCQ A;  1VF5 C;  2UXD Q;  3BVM A;  3PUV A;  1BQQ T;  2H4O A;  1IYJ B;  5FK9 C;  4X64 Q;  5IT9 E;  1VQ6 A;  4QB4 A;  4JCV E;  4A4I A;  3NBI A;  1MSG A;  1I4X A;  1STB A;  3TSS A;  2VUM G;  1S40 A;  2HHH Q;  1CI3 M;  1X32 A;  4IPD A;  5IP7 H;  3GTK B;  3BJU A;  2ZJQ A;  4UP7 A;  1Y1W G;  2A1A A;  4LF6 L;  2B8F A;  3S16 H;  3SGI A;  5KNB A;  1BUV T;  4L6T B;  4XQN A;  3QIA A;  3GTP B;  4DNI A;  4A3C H;  4C3I G;  2VQF L;  4LMQ D;  1IBK L;  2VUM B;  3E0E A;  2O5J C;  2E2I H;  5JAV A;  1R4P B;  2EQS A;  1XMO Q;  4MTK A;  1VQA A;  5FOB B;  2A6E C;  4O42 A;  4PMB A;  2KED A;  2NZH A;  1GHK A;  1YIT A;  1S5C D;  2JP1 A;  3GTJ B;  1EY4 A;  4WOR A;  4BXX H;  2VQE Q;  3F2B A;  4DR7 Q;  1PZK D;  1QWY A;  3P7J A;  3VYR A;  1R4Q B;  1E7Z A;  4C3I B;  4DV1 Q;  3J80 c;  3TP5 A;  1PH2 A;  2EYP A;  4KN4 C;  1TWC B;  3NWT A;  3J81 c;  3OMG A;  4IN3 A;  2H5X A;  1C48 A;  4Q0F A;  3CCM A;  1SYC A;  1JE4 A;  1V1O A;  3EFX D;  2KCC A;  3GTK H;  1B8A A;  1PH8 A;  3NP8 A;  3HS0 C;  4R8N A;  5IE8 A;  1ESR A;  1HNW L;  2QCP X;  1HZA A;  2F0K A;  2ATW A;  2PI2 E;  4CJ0 B;  2NVT B;  2F3V A;  3NXW A;  2OWO A;  5M3M H;  4A93 H;  1ICF B;  5AFW A;  2JA5 H;  2NN6 I;  3MTS A;  2VNU D;  3TQY A;  4BY1 B;  1U4M A;  1EWH A;  3AQQ A;  4KKS A;  2HUG A;  4H02 A;  2XWJ B;  1FL0 A;  3ZYY X;  1S3O A;  1VQF A;  2CHB D;  1PH9 A;  2A69 D;  2D2C C;  2WAQ G;  4AYB G;  2Z4I A;  2PZW A;  3PUX A;  4LAA A;  1X3Q A;  2F4V L;  5KGU A;  2AHO B;  3HGB A;  3TEH B;  3M9B A;  2F0S A;  4MZ9 A;  5I9P A;  1I6H B;  3MAQ A;  3QWN A;  3CAM A;  5M3F G;  1FGU A;  2F0D A;  4FF1 A;  1W2B A;  3I4N H;  3GTG B;  4RWS C;  4G4K A;  1KDA A;  3NWS A;  5EBC A;  3LGJ A;  1VQL A;  4DN4 M;  2WAQ B;  4AYB B;  1E3P A;  3S2H B;  4GKJ L;  2K01 A;  1TWG H;  1B70 B;  2FFK B;  1CUK A;  3NK9 A;  4A3L H;  4HAE A;  2Y0S B;  4R1J A;  2JQO A;  1PTO D;  1WD0 A;  3AB9 A;  1EZ8 A;  2XTI A;  4OON A;  1YI2 A;  1HXY D;  1R9T B;  4CHT B;  4BY1 H;  2NTT A;  1II3 A;  1KHI A;  4OXP A;  4LFB Q;  5FLX L;  4R4T A;  2UXD L;  4EX5 A;  2JYO A;  1JMC A;  1FR3 A;  2VS1 A;  1L1O B;  4WRD A;  4X64 L;  4P71 A;  1IYV A;  4CKB A;  4K5V A;  1QVG A;  1XPU A;  2ASB A;  2B63 G;  1J5E Q;  4DXG A;  4CDC C;  2NZO A;  3QR8 A;  3GV6 A;  4KHZ A;  4A3M G;  1ASY A;  4IFD H;  4O2D A;  1F9S A;  3CKI B;  5KRU A;  1NNX A;  2JA6 B;  2WKD A;  1VQC A;  2XIW A;  3E3X A;  3RZO B;  1E22 A;  4DK0 A;  4DK1 A;  1B3Q A;  2B63 B;  2RSN A;  5JVH 3;  3S2H H;  2VL6 A;  3HOU G;  3ERQ A;  1F2M A;  4N8X 1;  2RBM A;  1WCM B;  2KUM A;  5JPM C;  1XMO L;  5EGT A;  1MJE A;  3BDL A;  2VW9 A;  4QY7 A;  3W2D A;  4EVO A;  4K0K Q;  1PYW D;  1PTO C;  3OIP A;  3OSO A;  1X55 A;  2SEB D;  4A3M B;  1R9T H;  1IKL A;  4IAL A;  4KHP Q;  2L5T A;  3GV3 A;  1STY A;  2FJ2 A;  4HIO A;  2K4K A;  1KLG D;  2VQE L;  4DR7 L;  4DV1 L;  1LTA D;  3TP6 A;  1I4R A;  3GTL B;  1YVC A;  1CQF A;  1DON A;  4Y7N B;  3L7Z C;  5I2X A;  3ND9 A;  4OIJ A;  4XTC S;  2DNE A;  5A35 A;  2SOB A;  5I2Y A;  3WDN A;  2IW3 A;  3KF8 B;  3W5O A;  2F0V A;  1MIU A;  1UEB A;  3PUY A;  3AFP A;  2DJG C;  3VYS A;  1PDQ A;  5D14 A;  2KJX A;  2JA6 H;  3MEH A;  1VQ8 A;  2WP8 J;  4ZQ3 A;  4GOP B;  3CW2 C;  4IZ8 A;  4RHR A;  2D5D A;  1HQM C;  4C3H H;  5C3X A;  1WCM H;  3FHW A;  1SAP A;  4XT1 B;  2L12 A;  5FJ8 H;  1YBY A;  2CWA A;  4OWT B;  2A6H D;  2L11 A;  3T4A C;  1E1T A;  1JB3 A;  5A2Q L;  4DK3 C;  1AFP A;  5FO8 B;  2D62 A;  1QNU A;  2L9H A;  2I5H A;  1YHQ A;  3PO2 G;  1JQY D;  5D3D A;  3JAM c;  2F0L A;  3J7A V;  1LTB D;  3H0G G;  3VA5 A;  1WTR A;  3CXC A;  4KTA A;  1GD7 A;  3PIO 3;  4JW0 A;  4A3D B;  4H7B A;  3CMA A;  1PFN A;  5LMU L;  1ZEQ X;  5CR3 A;  1LUZ A;  4N9T A;  2CW0 C;  2L15 A;  3QJY A;  1SNP A;  2VB2 X;  3SDZ A;  2WB1 B;  3I70 A;  3I4M H;  1Y1V H;  3H0G B;  2KBN A;  5G3L F;  1VQ9 A;  3KLW A;  1PMR A;  2YTV A;  1C9O A;  1CKM A;  2F3I A;  2K33 A;  5IGE A;  4C2M H;  1RL2 A;  2WII B;  1SLJ A;  2KOL A;  4FF3 A;  2OQ0 A;  5KYL A;  4LFB L;  2BA0 A;  4F87 A;  5IP9 G;  2CH4 A;  4F88 A;  3H09 A;  1I50 H;  2R3Z A;  1EQR A;  1J5E L;  5I9O A;  3ULP A;  3IRB A;  5M5Y H;  3SK5 A;  2K5H A;  1E2Z A;  1L0W A;  2TSS A;  2NN6 G;  3IL8 A;  1SSO A;  4CJ1 B;  5JJZ A;  4A3D H;  3A54 A;  4NP5 A;  3A0J A;  2JA8 H;  2IX3 A;  1K0R A;  1NTG A;  4POF A;  1T9H A;  5DM7 3;  3TME A;  3M3Y H;  3WOF A;  2WFW A;  1L1O A;  4B9W A;  4POG A;  1NR2 A;  4HID A;  2JE6 I;  4K0K L;  2PMZ B;  3E6Z X;  4KHP L;  2EY6 A;  1DYQ A;  2RQX A;  5F2D A;  1FJG Q;  3GTM B;  4HJ9 A;  4IJL A;  4KY6 A;  5DEH A;  4GLA C;  2ZXR A;  5ISR A;  3I7F A;  1EY9 A;  3NTH A;  1V43 A;  2BH8 A;  3BVG A;  3X3N A;  2YU9 H;  1TWF B;  1SNO A;  1JR0 D;  2I07 B;  2OQK A;  2WAQ E;  1QVC A;  4AYB E;  3MHB A;  5JJL A;  4IFD J;  4PQX A;  4G57 A;  4DGZ A;  1BBW A;  1A15 A;  3MXG A;  4N8F A;  3EVQ A;  5DLQ E;  1BF4 A;  1ESF A;  4PZ7 A;  1N8R C;  1EU3 A;  5CC4 A;  3I4L A;  3T56 B;  3DM1 A;  4XYQ A;  1PRT D;  5C0X H;  1ILQ A;  5JEA H;  1N9W A;  1WTV A;  2UUC Q;  2X6G A;  2Q8R E;  2PQA B;  1TQO A;  4C3J B;  2F0T A;  1LM0 A;  5ELB A;  2B2V A;  5GAE C;  2B3G A;  4BA1 I;  3DHQ A;  4QIW B;  4BBS B;  4MNO A;  4DV7 Q;  3J81 j;  3GTM H;  3D31 A;  4I7A A;  1QB5 D;  5C3E G;  1F9Q A;  3URY A;  3L3O C;  1QE6 A;  2PW5 A;  2QKI C;  1E2W A;  1FNW A;  2EXD A;  4RHS A;  1P16 A;  1U5K A;  4GN5 A;  2E2J B;  3I56 A;  4RGN A;  4A3F G;  3C3L A;  1KRT A;  4Y52 H;  2CQA A;  1F2Z A;  1EY6 A;  3T16 A;  4L8J A;  1VQ7 A;  1NY4 A;  1WVL A;  4R8I A;  5C3E B;  4H13 C;  2G5D A;  5JJI A;  1VQ4 A;  1ZYR D;  3HOV H;  4YCU A;  2I0Q A;  1C8C A;  2DGY A;  2PNH A;  3U4Z A;  4FXK C;  3RN2 A;  5HY6 A;  4P2C B;  3K59 A;  1HNX L;  4C3J H;  4A3F B;  1CHQ D;  4HIK A;  5D65 A;  1LAB A;  4B3S Q;  3HZX A;  3CCL A;  4V0B A;  4X3T A;  4BBS H;  2IL8 A;  1X3E A;  3K0Y A;  4CKE A;  3K5N A;  5M9O A;  5GAD C;  5ELE A;  4I65 A;  3UDX A;  1CHP D;  5JVG 3;  4ME3 A;  3DWA A;  2K52 A;  4KK7 A;  1HR0 Q;  1SMX A;  3D0F A;  5FLX E;  4R4I A;  1BCP C;  2ENB A;  3U9S A;  3GTO B;  1D5X C;  1O7Y A;  1PZJ D;  4C56 C;  3NEN A;  4IFD I;  3MXN A;  3S15 H;  5E4W C;  1WYD A;  4DF7 A;  3Q22 A;  4DAV A;  4IUV A;  1WTX A;  3S17 B;  2BDN A;  4RMF A;  1D1K A;  3M7G A;  2FXQ A;  3UE0 A;  2IWH A;  3SEB A;  3S1R H;  4X66 Q;  2B8G A;  1X54 A;  1TU2 B;  1STG A;  5EKI A;  1B9N A;  1ZYR C;  2Z6B A;  3LWU A;  1IW7 D;  4JI0 Q;  1STA A;  3VR4 A;  4XQQ A;  3D3R A;  4L5S A;  4A3B G;  4AIM A;  1F9R A;  1QG7 A;  3MFY A;  3KUP A;  1SYG A;  4QQB X;  3NTI A;  4GZY C;  1SMY C;  2XGT A;  1D8L A;  1K83 H;  1SE4 A;  3KBG A;  5BR8 Q;  3VYT A;  4IO9 A;  3S1M B;  1PH4 A;  3CF5 A;  3GTQ H;  3L0O A;  1I6V C;  3HOW G;  3VR6 A;  2EE1 A;  1Q90 A;  1JC7 A;  3OW2 A;  3U58 A;  2F0G A;  1Q81 C;  3W3A A;  4OO1 H;  3A7L A;  4A3G H;  3S17 H;  4DFA A;  3KJO A;  1HNW Q;  1KXL A;  2M00 A;  3G48 A;  1CZG A;  2B2T C;  2JXM B;  1X3G A;  4BBR H;  2E74 C;  5COR A;  2UUC L;  2XSC A;  3I4O A;  4A75 A;  1TS2 A;  2RCF A;  1I4Q A;  3NQI A;  3ND8 A;  1SDF A;  5CYU A;  3M4O H;  5J22 A;  3EIV A;  1IYU A;  4KJO A;  1PH3 A;  2BA1 A;  2J0T D;  3J80 i;  1SFO B;  2DJF C;  4EQ5 A;  3J81 i;  5EAY A;  1HA5 A;  3RZD H;  3S24 A;  3H15 A;  1G8Z D;  3M85 A;  1GJX A;  4K6D A;  1QVF A;  1TII D;  3RLN A;  1SXT A;  4A3C G;  4XDX A;  1VQE A;  1GUG A;  4R4O A;  1M4V A;  1SNM A;  2ZXO A;  5A2Q E;  2F0E A;  5C0X J;  3ICE A;  1JT8 A;  3KLR A;  5JEA J;  1K3B C;  2F0F A;  2PQA A;  4GLX A;  3UDG A;  4ILW A;  4Z9C B;  3G71 A;  3S16 B;  2Z4H A;  1VQJ A;  2KHS A;  4BXX G;  3L9A X;  3G4S A;  2AQ3 B;  4M1U B;  5BN4 A;  1HNZ Q;  2Z0S A;  2BCO A;  3CPF A;  1BNZ A;  4GKJ Q;  1T5E A;  2E2I B;  1ILP A;  1DOK A;  2A6E D;  2F0N A;  1SRO A;  1A0I A;  1MBY A;  4A3J B;  2R92 H;  1RTN A;  4B3S L;  2V1C C;  3QOL A;  4CKC A;  1CT1 D;  3J7Z C;  2ICI A;  4HCS A;  4IUQ A;  3CQZ H;  2VXW A;  2ZT9 C;  1BR9 A;  1KLU D;  4OHJ A;  5GAG C;  4U67 3;  1HR0 L;  4PZ8 A;  5C5M A;  5EPL A;  5CV7 A;  1UE7 A;  5M3M G;  2JA5 G;  1ICW A;  3KOJ A;  2E8G A;  4I7Z C;  2CQO A;  1K8M A;  1RIP A;  2LKV A;  3J7A 5;  1M1K C;  4QIW E;  1LV9 A;  4K2L A;  1N32 Q;  1GKH A;  3U4V A;  1EOT A;  1EQQ A;  2OXP A;  1QUQ A;  1SYF A;  1K8G A;  1X3F A;  4X66 L;  2A68 C;  2QEX A;  4LF9 Q;  5IT9 c;  1PYS B;  4MN3 A;  1Y14 B;  2MQH A;  3MXP A;  5JJK A;  5M3M B;  4A93 B;  2JA5 B;  4ULL A;  3MZ5 A;  2HDM A;  2AWN A;  4JI0 L;  3K6O A;  1BXT A;  3QB3 A;  4A3J H;  1X6O A;  2L55 A;  2DY7 A;  1VQP A;  2ZTC A;  5DM6 3;  1EOV A;  2KCN A;  1TWH H;  3I4N G;  3EA6 A;  1IBL Q;  1LTS D;  5M5W B;  1JWM D;  5C4X H;  3U50 C;  2JA7 B;  2L0C A;  3CCE A;  3K8A A;  5BR8 L;  1D1I A;  4LUV A;  4A3L G;  3DLL A;  4ZAI A;  3K7U C;  1V1Q A;  1I5F A;  2Z1C A;  4A3E B;  1AW7 A;  3NQT A;  2AMC B;  3RMH A;  3NBH B;  2VB3 X;  4BY1 G;  5C0X I;  3I4N B;  4RA8 A;  1HFG A;  5IYC G;  4TQU S;  4GN3 B;  4ABN A;  4G7Z C;  3R3O A;  1PTO H;  2E75 C;  2B39 A;  4ZRZ A;  3AEV A;  1W3S A;  3H91 A;  3D4D A;  4JPB W;  1YNN D;  2GA4 B;  1TWG B;  2LXJ A;  1MJC A;  1QNK A;  4BS9 A;  1G51 A;  3MA2 B;  2ZXP A;  4B3R Q;  3B6Y A;  4NXM Q;  3GDE A;  5KND A;  5IGD A;  1A6X A;  1IHZ A;  4J1M A;  4B3T Q;  4XIG S;  3HKZ G;  2RSO A;  5IIF A;  2XWB B;  5D3I B;  4IFD G;  1BBU A;  2R7D A;  5M5W H;  4P73 A;  2JA7 H;  4X65 Q;  2K05 A;  1TT2 A;  5E4X A;  1VQM A;  2HD3 A;  1CQV A;  1HFN A;  2Y0S G;  1HCZ A;  1Y1W H;  3HKZ B;  2AUK A;  4A3E H;  4DR4 Q;  3PIP A;  1K73 C;  2EY1 A;  3A7A B;  4LFA L;  5LMU Q;  1PLF A;  1PZI D;  4RGT A;  5KEE A;  1GM5 A;  5FO9 B;  5KNC A;  4JOI C;  1HNZ L;  3MEF A;  3S14 B;  2VZA A;  1YHA A;  1Q86 C;  3BDO A;  1E24 A;  1SE3 A;  1YNN C;  2JN4 A;  4YWL A;  4BA2 I;  3S9W A;  1W6J A;  3IFD A;  2F1M A;  2F03 A;  1VQN A;  3K5L A;  3JAM i;  4JBJ A;  2ZM6 Q;  4IPC A;  2FMM A;  5JOB A;  2I46 A;  4UHV A;  1WOC A;  4ZK9 B;  1G2T A;  4L5R C;  1SYB A;  3V05 A;  4ZKC B;  4DR3 L;  3X3M A;  3T51 B;  4BWG B;  1Q8I A;  3E5S A;  2JA6 G;  3RUZ A;  4APV A;  4IPG A;  2XRQ D;  4CDE C;  1G6Z A;  1WCM G;  3LNN A;  2F3W A;  4AQY Q;  1N32 L;  5FJ8 G;  1XTC D;  1G6P A;  3E9I A;  4WFN 3;  2EYH A;  4IOC A;  4OWX B;  5CBE E;  2OF1 A;  3VYU A;  1Y8O B;  3J7Y W;  3HOY H;  2GVA A;  2PYK A;  3BDC A;  1J9O A;  1TS3 A;  4LF9 L;  3S14 H;  1QOH A;  4B3M Q;  2O4X A;  4C3H B;  1F77 A;  3V2T A;  2CKZ B;  4XQJ A;  1N33 Q;  2K5W A;  1XX8 A;  2OTJ A;  4DV0 L;  4L5T A;  4J6H A;  4LF7 Q;  1TR5 A;  2MHV A;  3ULJ A;  2XNA C;  3OOC A;  2N8N A;  2EIF A;  1IBL L;  5DAU A;  3R93 A;  1PA6 A;  1PTO F;  1SEB D;  4LWC A;  3OHX C;  2FMC A;  2YTX A;  4HJ7 A;  1SYE A;  1QZH A;  4JI3 L;  3H6M A;  1Y1V G;  1VCI A;  2IJ0 A;  5HUR A;  4OO1 I;  1TY2 A;  2N88 A;  1H9R A;  2IY5 B;  1KDB A;  1K8O A;  1KAB A;  2KHJ A;  1AN8 A;  2MO0 A;  2NBF A;  2CW0 D;  3STB D;  4HJ5 A;  2QEJ C;  4OIK A;  1WTQ A;  4RFB A;  4N9P A;  1D2B A;  4DXF A;  1W6K A;  1XNQ Q;  4QMG A;  3I4M B;  1UE1 A;  4K8I A;  3JC6 6;  1F2Y A;  1Y1V B;  2RDG A;  1HH2 P;  4B3R L;  5M5X B;  1A8V A;  4NXM L;  3FPP A;  4C2M B;  4B3T L;  2F0M A;  3SR1 A;  4A3D G;  1FD7 D;  1JOQ A;  1VMP A;  5GAH C;  2JA8 G;  3NBH A;  3HEJ A;  1VMC A;  4X65 L;  4JI8 Q;  1I50 B;  3CC7 A;  1WI5 A;  1EIF A;  1JJG A;  5C5L A;  2WB1 G;  3H94 A;  5M5Y B;  1YNX A;  1PRT B;  4GNX B;  4IOA A;  3K58 A;  1HPC A;  2OT2 A;  2AQ2 B;  1S5F D;  3OWE B;  2E5L Q;  4DR4 L;  2E2D C;  4A3I B;  3K80 C;  2JA8 B;  2VY3 A;  2KHI A;  4KKT A;  3STB C;  4K14 A;  4FF4 A;  1SNC A;  4EQN A;  2OEO A;  4FNF A;  1B3A A;  1X56 A;  3H3V C;  3M3Y B;  1X3P A;  2Q2U A;  3D4W A;  3DM3 A;  2MO1 A;  3MXN B;  3FRP B;  5LL6 X;  5ELO A;  1G2S A;  3Q6S A;  4HJ8 A;  1A3U A;  1HNX Q;  3BYY B;  5FKA C;  5M5X H;  5J1Z A;  2ZJP A;  3FKI B;  2R7Z B;  2ZM6 L;  3GQB A;  2EOT A;  3R2T A;  3OIQ A;  3FMC A;  1FVI A;  2NB0 A;  4J8Q A;  1QIL A;  3I55 A;  4R4C A;  2O2L D;  2YU9 B;  4BY7 H;  5C0X G;  5J39 A;  1X65 A;  5JEA G;  3DEP A;  1SRU A;  4IUU A;  1B4O A;  5C44 B;  5LL6 S;  2PO4 A;  1H9S A;  5ELD A;  1SJE D;  4K5W A;  3D4R A;  4HIM A;  3N6R A;  1UWV A;  1EUJ A;  2LMC B;  4AQY L;  4ALP A;  2JSO A;  1SND A;  4A3I H;  4CDF C;  4GS3 A;  1OO9 B;  2BOS A;  1TXY A;  3K0X A;  4C1N K;  3ERO A;  2KVM A;  2B2W C;  2DN8 A;  2EZV A;  1IBM Q;  3HOZ H;  1KD1 C;  4B3M L;  2L4N A;  3F1Z A;  3M7N A;  4X3S A;  4QL5 A;  4K8J A;  4JK1 C;  5T1I A;  4O1N A;  5CGK A;  2QIL A;  1N33 L;  1EY7 A;  3J80 L;  1GOZ A;  1MI2 A;  4LF7 L;  3FKI H;  3UI2 A;  2R7Z H;  3J81 L;  1ASZ A;  1L1O C;  2BE5 C;  1STH A;  1CK1 A;  5ELC A;  5JPN C;  1OXS C;  3T1H Q;  2Q2H A;  3TZU A;  2UXC Q;  4PG3 A;  3HOV G;  2I5M X;  1SR3 A;  2NVQ H;  4QJF A;  1K9M C;  3C46 A;  5C44 H;  2E2H H;  2Y0S E;  2QF7 A;  2B2Y C;  1JB7 A;  4JI7 Q;  3NPP A;  5CV4 A;  3D6C A;  5C4J H;  4C3J G;  1HZ9 A;  3S1Q B;  2EPB A;  1D7Q A;  4JI2 Q;  4FXD A;  4OEM B;  2F0W A;  2Z6K C;  4PZ6 A;  1LT6 D;  2ICE C;  4J15 A;  3KJP A;  4BBS G;  3CCJ A;  5E7N A;  1EY0 A;  5EBD A;  2EJF C;  4IUR A;  3T1Y Q;  5C4H A;  3HOV B;  1EEF D;  1XNQ L;  1STE A;  4YWM A;  1RJT A;  4DK6 C;  3OMC A;  2EYM A;  1EIY B;  1JWS D;  3EQL C;  3W1G A;  4KKU A;  4OL7 A;  1SNQ A;  3KYH C;  3PSI A;  2LXK A;  1BDO A;  3G6J B;  1WD1 A;  2B2V C;  1BBX C;  4L63 B;  1O7I A;  1GXD C;  2D9U A;  4P74 A;  4DR5 Q;  2NTS A;  4JI8 L;  3ZJY C;  4HTH A;  5E3F A;  1ZXT A;  1BCP D;  1FNV A;  1K3R A;  1U4L A;  4DNR B;  2M2L A;  2NZ1 D;  3NHH A;  2GVB A;  1N36 Q;  3A8K E;  4DR1 Q;  3S15 B;  2L1B A;  1LYL A;  3S1Q H;  1HZC A;  4PNY A;  2E5L L;  4V19 0;  1YJ9 A;  3LX0 A;  2K6A A;  1ET6 A;  2RDF A;  4GOP C;  5FLM H;  5H1S E;  3S1R B;  1EZ6 A;  2EYJ A;  1N34 Q;  1I3Q B;  2DY8 A;  4PV1 C;  1NAP A;  4YWK A;  3R8B A;  1Q46 A;  3PUZ A;  5K36 H;  4LFC Q;  4DV6 Q;  1JWU D;  4G7O C;  2K75 A;  3M4Q A;  2Z9H A;  1EQT A;  4FF2 A;  1Z6H A;  4X62 Q;  4CJ2 C;  1PRT F;  5IGB A;  2H1E A;  1QUQ B;  4GNX A;  4OO1 G;  4A3G G;  1FNU A;  2LY7 A;  3KF6 A;  4GKK L;  2A19 A;  1SMY D;  3G7L A;  3PF5 A;  3TRZ A;  3TBI B;  1K83 B; 
#chains in the Genus database with same CATH homology
 1TS5 A;  5FO7 B;  1Y8P B;  1B1Z A;  5BN3 A;  3IAY A;  3K5O A;  1DXM A;  3GD7 A;  3GTQ B;  1XXG A;  4JBW A;  1QCB D;  4A3G B;  4DU9 A;  5I6W A;  2FIN B;  4HCE A;  4HED A;  4ODG A;  2DNC A;  1L0Y B;  3J7A F;  1AZP A;  4BBR B;  1DOL A;  1B50 A;  3I72 A;  2MJ8 A;  1RDP D;  3M4O B;  1CM9 A;  3NE5 B;  1E0B A;  4HMI A;  4QCL A;  1WTO A;  3KLS A;  1RF2 D;  2Q8T A;  3RZD B;  1CZW A;  2N55 A;  1H9K A;  1LAC A;  5TSS A;  1V1P B;  2F0P A;  4ZUI A;  2F0H A;  4FVM A;  3Q0A A;  1HTL D;  2B2U C;  2J4X A;  3TN2 A;  1WTW A;  4DNT B;  4F8M A;  1G29 1;  1F9P A;  1KTK A;  3PV0 A;  3MWY W;  1FGB D;  3A8J E;  4KN7 C;  2IT1 A;  1CA5 A;  2KEE A;  4RKL A;  1JOO A;  2EYF A;  2R92 B;  2WAC A;  2B2T A;  5T1G A;  1JIC A;  3JAM L;  2A74 C;  3D6W A;  4NW2 A;  3CQZ B;  4IUT A;  1F2L A;  2WIN B;  1DM0 B;  2WKC A;  1LT3 D;  4FP5 D;  4HR7 B;  4DAY A;  1OXX K;  5CV9 A;  1O80 A;  4NKL A;  3PO3 B;  3SE0 A;  2EVB A;  1EFI D;  2A68 D;  1EYA A;  3P20 A;  3AU7 A;  4OGQ C;  4H44 C;  1S5B D;  2CVR A;  3HG9 A;  4KJN A;  1TWH B;  2F0J A;  1OXT A;  5C4X B;  4K6L A;  4HSP A;  2QDB A;  4HN7 A;  3RLF A;  1AEX A;  5KYI A;  3IFT A;  4LK1 C;  4XYO A;  3K57 A;  4B08 A;  3T53 B;  1Z47 A;  2K28 A;  1PTO B;  3KK7 A;  2F0Q A;  2PQE A;  2PPB C;  5KIX A;  4MIU A;  3DEO A;  3I8Z A;  1RD9 D;  3SVM A;  3KBX A;  3MC0 B;  1GUN A;  4CGY B;  1LTR D;  2LS0 1;  1RCV D;  4FO2 A;  1M8A A;  1HQR D;  1YNJ D;  4KD3 A;  2M9V A;  2PNR C;  3DWQ A;  3V96 A;  3J80 E;  3WOE A;  1B9M A;  4KHV A;  3J81 E;  3S1N B;  3CU7 A;  4WJW A;  4KY5 A;  3Q24 A;  1E2V A;  4KI0 A;  4KD4 A;  1Y1W B;  1ENA A;  3VR3 A;  1JOK A;  1S4Z A;  1NCV A;  2A73 B;  5IGF A;  4X3U A;  2R61 A;  1I4G A;  1UUP A;  1VF7 A;  3MVV A;  2X69 A;  1NSN S;  1V1P A;  4TKO B;  1EQV A;  2SNS A;  4Q5V A;  4YIJ A;  2MPM A;  1L0X B;  3U9O A;  2Q8I B;  3C2P A;  1EIH A;  1YNJ C;  2RDH A;  4X3K A;  4TSS A;  2HCI A;  3QOJ A;  1MSH A;  4MHE A;  1H9J A;  2MGS A;  4PMW A;  3DWP A;  2MUY A;  2HQE A;  5IGC A;  3NUC A;  5BN5 A;  3HOY B;  1H9S B;  4RCO A;  1RKN A;  3C1E A;  3FDT A;  1OXU A;  2KA7 A;  2TMP A;  4UDU C;  2YYZ A;  2NWG A;  3AMU A;  2EJM A;  3MXU A;  3A55 A;  5COY A;  5DNF A;  1HUN A;  1UEA B;  4EGV A;  4EQP A;  1EU4 A;  4S3S A;  1EIG A;  2HCC A;  4HSV A;  1LO5 D;  1KNE A;  1T5X D;  4LJZ C;  4C3H G;  1Z7T A;  3BG3 A;  5M3F B;  3QG1 A;  3BVZ A;  4IQZ A;  4ZKB B;  1LT4 D;  3I73 A;  1HA6 A;  4EQO A;  4DAP A;  2SDF A;  1DZ1 A;  1LTI D;  3F2U A;  1U4P A;  2A69 C;  1ZKO A;  1CTM A;  2IX1 A;  1DCZ A;  1RTO A;  5E1F A;  1ML0 D;  3SK6 A;  1J8I A;  3OPO A;  1MGS A;  1LTT D;  1JCK B;  3FPU B;  2X6L A;  3CHB D;  1PFM A;  2PCF B;  4UAI A;  1KNA A;  4C1N I;  1OXV A;  3K5M A;  4F7X A;  4PMC A;  3HOU B;  1NUC A;  1D5Z C;  4TRD A;  3HP3 A;  2AQ1 B;  1UNS A;  4ZUJ A;  2NUC A;  5G3L D;  5CBA E;  1O78 A;  3I3C A;  1U4R A;  4NDX A;  3BYT B;  4BY7 B;  1EYC A;  4RAU C;  2F0O A;  3CRK C;  5EKL A;  3A56 A;  2F0I A;  3JAM E;  1EY8 A;  2J7Z A;  4E6I A;  2C5C A;  1Y69 U;  4KY7 A;  1AP0 A;  4R9W A;  3LWE A;  2AWO A;  1PFB A;  1G91 A;  1D5M C;  2PZU A;  3HOZ B;  4ZLT F;  3KLS X;  1HUM A;  1S5D D;  1I4H A;  3VR5 A;  2PZT A;  1BCP B;  2BE5 D;  1LTG D;  1Q3L A;  3OW7 A;  1XYI A;  1Q1B A;  3DMU A;  5EPJ A;  4XXE A;  1O7L A;  1AZQ A;  3FVQ A;  3IKJ A;  4ZYS A;  2NVQ B;  3I91 A;  1D6E C;  3PO2 B;  1LT5 D;  2E2H B;  5C3W A;  3SK8 A;  3PMF A;  1NR4 A;  5C4J B;  1DJR D;  1GUT A;  5IT9 L;  3P75 A;  1I4P A;  2K7V A;  2KQ3 A;  2G9D A;  1DOM A;  1EWC A;  2A6H C;  2K5D A;  2JEB I;  1QJO A;  4ME5 A;  3SXH A;  1RHP A;  1KDC A;  4KV6 A;  2B2W A;  1HTP A;  1TY0 A;  3N52 A;  5CV6 A;  1WTP A;  5K36 G;  2Z8L A;  5EQ0 A;  5EPK A;  1GUW A;  1DD2 A;  4XT3 B;  2FHT A;  3D8G A;  3VA7 A;  2BDO A;  1EYD A;  3NTK A;  2R6G A;  1MD2 D;  2EJG C;  2B2Y A;  2RVL A;  1ENC A;  3OWF A;  3QO2 A;  5K5P A;  1SYD A;  2K1B A;  1BO0 A;  5HGT A;  1A2T A;  4H0L C;  4RCN A;  2EYO A;  2WV6 D;  2LFN A;  1TS4 A;  4RH6 A;  5EKK A;  3R2I A;  5I4D A;  4RGO S;  1SJH D;  4NMZ A;  3GP7 A;  2NN6 H;  1Y8N B;  2PW7 A;  1EL0 A;  1O7Z A;  1GUS A;  3KF8 A;  2RA4 A;  3VR2 A;  3ITP A;  1FYC A;  1LLR D;  3K7A B;  5CV5 A;  1HRJ A;  4K2K A;  3PIP 3;  3TP8 A;  3P1H A;  3EJI A;  2E76 C;  3DUZ A;  2K03 A;  1IKM A;  3ONA B;  1PRT C;  1EEI D;  3HOX B;  2EYL A;  1ET9 A;  2IX0 A;  1EY5 A;  3GO5 A;  4FYD A;  1B2T A;  5CMD A;  1BCP F;  2G9H D;  3FEW X;  5EJW A;  2NVX B;  3CRL C;  2V4D A;  4ID6 A;  2K5Q A;  3BZD B;  1B53 A;  3E0J A;  2JEA I;  3A8I E;  4QUF A;  2SNM A;  1B44 D;  1PXU A;  1SE2 A;  4A3K B;  1TVX A;  2IPK D;  3SK4 A;  5ELF A;  3TP7 A;  3Q23 A;  3DXJ C;  5IOD A;  2F4I A;  3SHL A;  2RKS A;  5I6Y A;  2EDG A;  1BOS A;  1STN A;  1VDZ A;  5NUC A;  4G7H C;  3TDQ A;  3C1F A;  3BS1 A;  4CBV A;  1A3T A;  2B2U A;  1H9M A;  4HMJ A;  5IGG A;  4IUP A;  2EXZ A;  3TZD A;  1CFM A;  3O13 A;  3T13 A;  1ENF A;  4A3B B;  5IOC A;  4U68 A;  1A3V A;  5C4Z A;  1ONL A;  2EY5 A;  2HDL A;  3PUW A;  3S2D B;  2NYZ D;  3HOW B;  3HRZ C;  1IW7 C;  1XWE A;  1A2U A;  2C9O A;  4IUN A;  1V8Q A;  2XRS D;  2XVS A;  4DA2 A;  1Q12 A;  3NSW A;  5CV8 A;  2O5I C;  4KMU C;  4B9X A;  2EY2 A;  2R93 B;  1GHJ A;  1ROD A;  3I90 A;  2F0U A;  1IL8 A;  1KAA A;  3M4Y A;  2XN9 C;  2K32 A;  4QF4 A;  4RGM A;  1TWA B;  1CA6 A;  4K5X A;  1SBB B;  1TKW B;  3RD4 A;  2A5H A;  1HHV A;  4FXG C;  4QUC A;  4RKB A;  1S5E D;  1GUO A;  1Q1E A;  5C6A A;  3MFG A;  2MP1 A;  1JOR A;  2NVY B;  1U9R A;  2KEC A;  4M8A A;  1C4Q A;  5LHY 1;  1UAP A;  2AUJ D;  2ID0 A;  2K04 A;  1VF5 C;  3BVM A;  3PUV A;  1BQQ T;  2H4O A;  5FK9 C;  5IT9 E;  4QB4 A;  3NBI A;  1MSG A;  1I4X A;  1STB A;  3TSS A;  1CI3 M;  1X32 A;  3GTK B;  2B8F A;  5KNB A;  1BUV T;  4L6T B;  4XQN A;  3QIA A;  3GTP B;  4C3I G;  4LMQ D;  2VUM B;  2O5J C;  5JAV A;  1R4P B;  5FOB B;  2A6E C;  4O42 A;  4PMB A;  2KED A;  1GHK A;  1S5C D;  2JP1 A;  3GTJ B;  1EY4 A;  4WOR A;  1PZK D;  1QWY A;  3P7J A;  3VYR A;  1R4Q B;  4C3I B;  3TP5 A;  2EYP A;  4KN4 C;  1TWC B;  3NWT A;  3OMG A;  4IN3 A;  1C48 A;  4Q0F A;  1SYC A;  1JE4 A;  1V1O A;  3EFX D;  2KCC A;  3NP8 A;  3HS0 C;  4R8N A;  1ESR A;  2QCP X;  2F0K A;  4CJ0 B;  2NVT B;  2F3V A;  3NXW A;  5AFW A;  2NN6 I;  3MTS A;  2VNU D;  4BY1 B;  1U4M A;  1EWH A;  4KKS A;  2HUG A;  2XWJ B;  3ZYY X;  2CHB D;  2A69 D;  2D2C C;  2Z4I A;  2PZW A;  3PUX A;  4LAA A;  1X3Q A;  5KGU A;  3HGB A;  2F0S A;  5I9P A;  1I6H B;  3MAQ A;  3QWN A;  2F0D A;  4FF1 A;  3GTG B;  4RWS C;  4G4K A;  1KDA A;  3NWS A;  5EBC A;  4DN4 M;  2WAQ B;  4AYB B;  3S2H B;  2K01 A;  2FFK B;  3NK9 A;  4HAE A;  2Y0S B;  1WD0 A;  1PTO D;  3AB9 A;  1EZ8 A;  1R9T B;  1HXY D;  4CHT B;  2NTT A;  1II3 A;  5FLX L;  2JYO A;  1FR3 A;  4WRD A;  1IYV A;  4CKB A;  4K5V A;  4DXG A;  3GV6 A;  4KHZ A;  4IFD H;  1F9S A;  3CKI B;  5KRU A;  2JA6 B;  2WKD A;  2XIW A;  3RZO B;  4DK0 A;  4DK1 A;  2B63 B;  2RSN A;  5JVH 3;  3ERQ A;  1F2M A;  2RBM A;  1WCM B;  2KUM A;  5JPM C;  5EGT A;  3BDL A;  3W2D A;  4EVO A;  1PYW D;  1PTO C;  3OIP A;  3OSO A;  2SEB D;  4A3M B;  1IKL A;  4IAL A;  2L5T A;  3GV3 A;  1STY A;  2FJ2 A;  1KLG D;  1LTA D;  3TP6 A;  1I4R A;  3GTL B;  1CQF A;  1DON A;  4Y7N B;  3L7Z C;  5I2X A;  3ND9 A;  4OIJ A;  4XTC S;  2DNE A;  5A35 A;  2SOB A;  5I2Y A;  3WDN A;  2IW3 A;  2F0V A;  3PUY A;  3VYS A;  1PDQ A;  5D14 A;  2KJX A;  3MEH A;  2WP8 J;  4ZQ3 A;  4IZ8 A;  4RHR A;  2D5D A;  1HQM C;  5C3X A;  1SAP A;  4XT1 B;  2L12 A;  2A6H D;  2L11 A;  3T4A C;  1JB3 A;  5A2Q L;  1AFP A;  5FO8 B;  2D62 A;  1QNU A;  2L9H A;  1JQY D;  5D3D A;  2F0L A;  3J7A V;  1LTB D;  3VA5 A;  1WTR A;  4KTA A;  3PIO 3;  4A3D B;  4H7B A;  1PFN A;  1ZEQ X;  5CR3 A;  4N9T A;  2CW0 C;  3QJY A;  1SNP A;  2VB2 X;  3SDZ A;  2WB1 B;  3I70 A;  3H0G B;  5G3L F;  1PMR A;  5IGE A;  2K33 A;  2WII B;  2KOL A;  4FF3 A;  5KYL A;  2BA0 A;  4F87 A;  4F88 A;  3H09 A;  2R3Z A;  5I9O A;  3SK5 A;  1E2Z A;  2TSS A;  2NN6 G;  3IL8 A;  1SSO A;  4CJ1 B;  5JJZ A;  3A54 A;  4NP5 A;  2IX3 A;  5DM7 3;  3TME A;  3WOF A;  4B9W A;  1NR2 A;  2JE6 I;  2PMZ B;  3E6Z X;  2EY6 A;  1DYQ A;  2RQX A;  5F2D A;  3GTM B;  4KY6 A;  5DEH A;  2ZXR A;  5ISR A;  1EY9 A;  3NTH A;  1V43 A;  3BVG A;  3X3N A;  1TWF B;  1SNO A;  1JR0 D;  2I07 B;  3MHB A;  4IFD J;  4PQX A;  4G57 A;  4DGZ A;  1A15 A;  3MXG A;  3EVQ A;  1BF4 A;  1ESF A;  1EU3 A;  5CC4 A;  3I4L A;  3T56 B;  3DM1 A;  4XYQ A;  1PRT D;  5C0X H;  1ILQ A;  5JEA H;  1WTV A;  2X6G A;  2Q8R E;  1TQO A;  4C3J B;  2F0T A;  5ELB A;  2B2V A;  4BA1 I;  3DHQ A;  4QIW B;  4BBS B;  3D31 A;  1QB5 D;  1F9Q A;  3URY A;  3L3O C;  1QE6 A;  2PW5 A;  2QKI C;  1E2W A;  1FNW A;  4RHS A;  2E2J B;  4RGN A;  3C3L A;  2CQA A;  1F2Z A;  1EY6 A;  3T16 A;  4L8J A;  1WVL A;  4R8I A;  5C3E B;  4H13 C;  1ZYR D;  1C8C A;  4FXK C;  4P2C B;  3K59 A;  4A3F B;  1CHQ D;  5D65 A;  1LAB A;  3HZX A;  4V0B A;  4X3T A;  2IL8 A;  3K0Y A;  4CKE A;  3K5N A;  5M9O A;  5ELE A;  4I65 A;  1CHP D;  5JVG 3;  3DWA A;  4KK7 A;  5FLX E;  1BCP C;  2ENB A;  3U9S A;  3GTO B;  1D5X C;  1O7Y A;  1PZJ D;  4C56 C;  4IFD I;  3MXN A;  5E4W C;  4DF7 A;  3Q22 A;  4DAV A;  4IUV A;  1WTX A;  3S17 B;  2BDN A;  1D1K A;  3M7G A;  2IWH A;  3SEB A;  2B8G A;  1TU2 B;  1STG A;  5EKI A;  1B9N A;  1ZYR C;  3LWU A;  1IW7 D;  1STA A;  3VR4 A;  4XQQ A;  3D3R A;  1F9R A;  1QG7 A;  3MFY A;  3KUP A;  1SYG A;  3NTI A;  4GZY C;  1SMY C;  1SE4 A;  3KBG A;  3VYT A;  3S1M B;  1I6V C;  3VR6 A;  2EE1 A;  1Q90 A;  1JC7 A;  2F0G A;  3W3A A;  4OO1 H;  3A7L A;  4DFA A;  2M00 A;  1CZG A;  2B2T C;  2JXM B;  2E74 C;  5COR A;  2XSC A;  1TS2 A;  3NQI A;  1I4Q A;  3ND8 A;  1SDF A;  5CYU A;  5J22 A;  1IYU A;  4KJO A;  2BA1 A;  2J0T D;  1SFO B;  1HA5 A;  1G8Z D;  3M85 A;  1GJX A;  4K6D A;  1TII D;  1SXT A;  4XDX A;  1GUG A;  1M4V A;  1SNM A;  2ZXO A;  5A2Q E;  2F0E A;  5C0X J;  3KLR A;  5JEA J;  2F0F A;  4ILW A;  4Z9C B;  3S16 B;  2Z4H A;  2KHS A;  3L9A X;  2AQ3 B;  4M1U B;  5BN4 A;  2BCO A;  1BNZ A;  1T5E A;  2E2I B;  1ILP A;  1DOK A;  2A6E D;  2F0N A;  1MBY A;  4A3J B;  1RTN A;  3QOL A;  4CKC A;  1CT1 D;  2ICI A;  4HCS A;  4IUQ A;  2VXW A;  2ZT9 C;  1BR9 A;  1KLU D;  4OHJ A;  4U67 3;  5C5M A;  5EPL A;  5CV7 A;  1ICW A;  4I7Z C;  1K8M A;  2LKV A;  1LV9 A;  4K2L A;  1EOT A;  2OXP A;  1SYF A;  2A68 C;  4MN3 A;  3MXP A;  5M3M B;  4A93 B;  2JA5 B;  4ULL A;  3MZ5 A;  2HDM A;  2AWN A;  3K6O A;  1BXT A;  3QB3 A;  2L55 A;  2DY7 A;  5DM6 3;  2KCN A;  3EA6 A;  1LTS D;  5M5W B;  1JWM D;  2JA7 B;  2L0C A;  1D1I A;  4ZAI A;  2Z1C A;  4A3E B;  1AW7 A;  3NQT A;  3RMH A;  2VB3 X;  5C0X I;  3I4N B;  4RA8 A;  1HFG A;  4TQU S;  4ABN A;  4G7Z C;  3R3O A;  1PTO H;  2E75 C;  2B39 A;  4ZRZ A;  3H91 A;  3D4D A;  1YNN D;  2GA4 B;  1TWG B;  1QNK A;  4BS9 A;  3MA2 B;  2ZXP A;  5KND A;  1A6X A;  5IGD A;  1IHZ A;  4J1M A;  4XIG S;  2RSO A;  5IIF A;  2XWB B;  5D3I B;  4IFD G;  2K05 A;  1TT2 A;  5E4X A;  1CQV A;  1HFN A;  1HCZ A;  3HKZ B;  2AUK A;  2EY1 A;  3A7A B;  1PLF A;  1PZI D;  4RGT A;  5KEE A;  5FO9 B;  5KNC A;  3S14 B;  3BDO A;  1SE3 A;  1YNN C;  4BA2 I;  3S9W A;  1W6J A;  3IFD A;  2F1M A;  2F03 A;  3K5L A;  2FMM A;  5JOB A;  2I46 A;  4ZK9 B;  1G2T A;  1SYB A;  3V05 A;  4ZKC B;  3X3M A;  3T51 B;  4BWG B;  1Q8I A;  3E5S A;  3RUZ A;  2XRQ D;  1G6Z A;  3LNN A;  2F3W A;  1XTC D;  4WFN 3;  2EYH A;  5CBE E;  2OF1 A;  3VYU A;  1Y8O B;  3J7Y W;  2PYK A;  3BDC A;  1J9O A;  1TS3 A;  1QOH A;  2O4X A;  4C3H B;  1F77 A;  3V2T A;  4XQJ A;  2K5W A;  1XX8 A;  4J6H A;  1TR5 A;  2MHV A;  2XNA C;  3OOC A;  5DAU A;  3R93 A;  1PTO F;  1SEB D;  3OHX C;  2FMC A;  1SYE A;  3H6M A;  2IJ0 A;  1VCI A;  5HUR A;  4OO1 I;  1TY2 A;  2N88 A;  1H9R A;  1KDB A;  1K8O A;  1KAB A;  1AN8 A;  2NBF A;  2CW0 D;  2QEJ C;  4OIK A;  1WTQ A;  4RFB A;  4N9P A;  1D2B A;  4DXF A;  1W6K A;  4QMG A;  3I4M B;  4K8I A;  1F2Y A;  1Y1V B;  2RDG A;  5M5X B;  3FPP A;  4C2M B;  2F0M A;  3SR1 A;  1FD7 D;  1JOQ A;  1VMP A;  3NBH A;  3HEJ A;  1VMC A;  1I50 B;  5C5L A;  3H94 A;  5M5Y B;  1PRT B;  3K58 A;  1HPC A;  2OT2 A;  2AQ2 B;  1S5F D;  3OWE B;  2E2D C;  4A3I B;  2JA8 B;  4KKT A;  4FF4 A;  4K14 A;  1SNC A;  4EQN A;  2OEO A;  4FNF A;  1B3A A;  3H3V C;  3M3Y B;  1X3P A;  3D4W A;  3FRP B;  5LL6 X;  1G2S A;  3Q6S A;  1A3U A;  3BYY B;  5FKA C;  5J1Z A;  3FKI B;  2R7Z B;  3GQB A;  2EOT A;  3OIQ A;  3FMC A;  3R2T A;  2NB0 A;  4J8Q A;  1QIL A;  2O2L D;  2YU9 B;  5C0X G;  5J39 A;  5JEA G;  3DEP A;  4IUU A;  1B4O A;  5C44 B;  5LL6 S;  2PO4 A;  1H9S A;  5ELD A;  1SJE D;  4K5W A;  3D4R A;  3N6R A;  2LMC B;  2JSO A;  1SND A;  1OO9 B;  2BOS A;  4C1N K;  3ERO A;  2KVM A;  2B2W C;  2DN8 A;  2EZV A;  2L4N A;  3M7N A;  4X3S A;  4K8J A;  4JK1 C;  5T1I A;  4O1N A;  5CGK A;  2QIL A;  1EY7 A;  3J80 L;  1GOZ A;  1MI2 A;  3UI2 A;  3J81 L;  2BE5 C;  1STH A;  1CK1 A;  5ELC A;  5JPN C;  1OXS C;  3TZU A;  3C46 A;  2QF7 A;  2B2Y C;  3NPP A;  5CV4 A;  3D6C A;  4C3J G;  3S1Q B;  2EPB A;  4FXD A;  2F0W A;  1LT6 D;  2ICE C;  1EY0 A;  5EBD A;  2EJF C;  4IUR A;  5C4H A;  3HOV B;  1EEF D;  1STE A;  1RJT A;  3OMC A;  2EYM A;  1JWS D;  3EQL C;  4KKU A;  4OL7 A;  1SNQ A;  1BDO A;  3G6J B;  1WD1 A;  2B2V C;  1BBX C;  4L63 B;  1GXD C;  2D9U A;  2NTS A;  4HTH A;  5E3F A;  1ZXT A;  1BCP D;  1FNV A;  1U4L A;  4DNR B;  2M2L A;  2NZ1 D;  3NHH A;  3A8K E;  3S15 B;  2L1B A;  4PNY A;  4V19 0;  3LX0 A;  2K6A A;  1ET6 A;  2RDF A;  3S1R B;  1EZ6 A;  2EYJ A;  1I3Q B;  2DY8 A;  4PV1 C;  1NAP A;  3R8B A;  5K36 H;  3PUZ A;  1JWU D;  4G7O C;  1EQT A;  4FF2 A;  1Z6H A;  4CJ2 C;  1PRT F;  5IGB A;  2H1E A;  4OO1 G;  1FNU A;  2LY7 A;  1SMY D;  3G7L A;  3TBI B;  1K83 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...