1ENAA

Crystal structures of the binary ca2+ and pdtp complexes and the ternary complex of the asp 21->glu mutant of staphylococcal nuclease. implications for catalysis and ligand binding
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
135
structure length
135
Chain Sequence
LHKEPATLIKAIDGETVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase(phosphoric diester)
molecule keywords STAPHYLOCOCCAL NUCLEASE
publication title Crystal structures of the binary Ca2+ and pdTp complexes and the ternary complex of the Asp21-->Glu mutant of staphylococcal nuclease. Implications for catalysis and ligand binding.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 32
structure length 135
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 1994-02-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1enaA00
2F0JA 4NKLA 2KQ3A 2PZUA 2EXZA 1SYBA 2EYHA 1SNPA 2RBMA 4K2KA 2F0DA 2OXPA 2F0EA 4EVOA 2PYKA 5DEHA 1A3TA 1F2MA 4N9PA 2F3VA 2SNMA 2OF1A 3ERQA 4N9TA 5E1FA 3NHHA 4RKLA 4ODGA 3H6MA 3SK4A 3OWFA 2QDBA 1STHA 3P75A 4PNYA 5C4HA 2PW7A 1EQVA 5CV4A 2PZWA 1EZ6A 4K2LA 1EY9A 1TQOA 5C3WA 2F0GA 1TT2A 2F0SA 3SXHA 4R8NA 5EKLA 5IIFA 3U9OA 2PQEA 5KIXA 5CV5A 5C5MA 3R3OA 2SOBA 1STNA 2F0LA 4S3SA 1NUCA 4K5VA 3S9WA 3C1FA 3MZ5A 3NK9A 5EKKA 5CR3A 1SNMA 2EY2A 4K8IA 2EY5A 3LX0A 3T16A 1EY8A 3SK8A 1TR5A 3BDLA 1EY7A 4G57A 3NUCA 3SK5A 4K14A 4IALA 2EYPA 2SNSA 4DF7A 3OMGA 4KHVA 3DMUA 3P1HA 4MIUA 1A2UA 1KDBA 2OEOA 4ZUIA 5JAVA 1JORA 3SK6A 3TP7A 5I6YA 5C5LA 3SR1A 2PZTA 2F0MA 3EVQA 4EQOA 2F0OA 3SHLA 3D4WA 1KDAA 4K5XA 1SNOA 1STYA 4YIJA 3DHQA 5J1ZA 5NUCA 1STBA 4J1MA 4ID6A 1ENAA 1A2TA 1F2YA 2RDFA 2F0PA 5DAUA 4KY5A 2ENBA 4K5WA 2PW5A 3EJIA 4KJNA 2F0TA 2EYFA 1SYGA 1U9RA 3EROA 4ME5A 4NMZA 5IGCA 4KV6A 4K8JA 1EZ8A 1KABA 1STGA 1A3UA 1F2ZA 3MHBA 4QMGA 5J39A 3QOJA 5IGGA 4J6HA 3OMCA 4QF4A 5HGTA 3TMEA 2F0WA 3MEHA 1EYDA 5CC4A 4RKBA 3QOLA 2EYOA 1SYDA 3V2TA 4NDXA 1RKNA 3T13A 1NSNS 2NUCA 1ENCA 4KY7A 5KEEA 2M00A 2LKVA 3HZXA 5I6WA 3NXWA 4WORA 3QB3A 5IODA 4LAAA 3PMFA 5EGTA 5C3XA 5IGEA 5IGBA 1SYEA 5KYIA 3ITPA 3TP6A 5HURA 1SNQA 2F0HA 5K5PA 2EYMA 2F0NA 4ZUJA 2RKSA 1KDCA 3RUZA 5I9PA 1EY5A 2EYLA 5IGDA 1JOQA 5KRUA 2F0FA 2O4XA 4PMBA 4KJOA 1SNDA 4KD3A 1SYCA 4DGZA 2F0UA 3NQTA 3TP8A 2F0KA 1A3VA 5I9OA 4I65A 4IZ8A 2EY6A 2HQEA 3D8GA 5CV7A 5ISRA 4EQNA 5KGUA 3MXPA 2KHSA 5CV8A 2F3WA 2F0IA 3C1EA 4OL7A 5E3FA 3TP5A 4F8MA 5C4ZA 5CV9A 5IGFA 1JOKA 2WACA 3BDCA 3HEJA 3D6CA 4DFAA 5IOCA 5J22A 3VA5A 4DU9A 1II3A 1EYAA 4H7BA 4NP5A 5CGKA 1AEXA 4E6IA 5F2DA 2F0VA 5KYLA 5CV6A 1IHZA 1EY4A 2EY1A 1KAAA 4KD4A 1EY0A 4KTAA 4QB4A 4ZQ3A 5C6AA 5M9OA 4TRDA 1EY6A 4HTHA 4B9WA 3E5SA 5JOBA 4F7XA 2F0QA 4K6DA 3D4DA 1STAA 4IUNA 4KY6A 3NP8A 4WRDA 1SYFA 3MVVA 4B9XA 1JOOA 1SNCA 4EQPA 1EYCA 4HMIA 4PMCA 4HMJA 3OSOA 2EYJA
chains in the Genus database with same CATH superfamily
1L1OB 1XNQL 4IQZA 2NB0A 4L5QA 1A3TA 4N9PA 2F3VA 3K58A 3K0YA 1JE4A 1IYVA 4DAYA 4A3MH 1EQVA 1FGBD 4QJFA 2E5LL 1QJOA 2I07B 2F0SA 1X6OA 4ABNA 3G48A 1NCVA 2I0QA 4ZKCB 4S3SA 4B3ML 3NPPA 2B29A 3CCUA 4LF8Q 2JEBI 3SVMA 2EY5A 4JI3Q 1EY7A 2PCFB 5IYDG 1WTPA 2Z4IA 4MZ9A 1Q90A 1VQ9A 4A4IA 5C4XB 1SMXA 2Y0SB 1Q8KA 1E3PA 1A62A 1WTOA 1FVIA 4DV6Q 2K01A 4BY1H 4JI4L 5DAUA 4DV3L 4ZRZA 1OTCA 1JT8A 3S1QH 2HDMA 1HNXL 3PF5A 4BBSG 4DV7Q 3A5ZB 4XYQA 4DA2A 2KHJA 1B9MA 5HGTA 5LMNQ 2NVQH 2TSSA 2WAQB 1ENCA 3HZXA 1HXYD 2F4IA 1VQ6A 3BZCA 3GTLB 2CHBD 3MA2B 1SYEA 1JCKB 4X6AH 2WKCA 3S17H 4A3EB 2ATWA 1LTGD 2F0FA 3Q23A 1XNQQ 1SXTA 1B4OA 1PH8A 3JC66 4FVMA 2E2HB 3CCLA 2WACA 4CDFC 2NWGA 4LUZA 3MC0B 3W5OA 1Z9FA 5TSSA 4NPSA 5IP7H 2DNEA 3VA7A 2ZXRA 4GLAC 4KTAA 2ZT9C 3SGIA 1NMGA 3S1NB 4C3HH 2VUMB 1KAWA 2A68D 3CCEA 2Z0SA 4OX9L 2JSOA 4PMCA 2L5TA 2RA4A 4JBMA 4IJLA 4JI4Q 2F0JA 1DCZA 1LYLA 3NQIA 4R9WA 1I3QH 5EPJA 1H9SB 4DV3Q 3G7LA 5EAYA 5ELDA 2PYKA 4P2CB 2SNMA 2OF1A 4N9TA 5E1FA 1HNXQ 3H6MA 3NENA 1STHA 2CCZA 1BOSA 2PZWA 4HAEA 1VQFA 3CRLC 1F2LA 2VNUD 3KYHC 1TY0A 4OO1H 4DK0A 1SMYD 3Q24A 3CRKC 3PO3G 1AH9A 1BDOA 2R7FA 1GXDC 3HOZG 4P74A 2FJ2A 2IPKD 2XRQD 4A3KG 4DV5L 3H94A 2K75A 4DNTB 3KLWA 3DMUA 3J80L 1N34L 3EQLC 1YJ9A 1VQBA 4QIWB 2F0OA 1ENFA 1B3QA 1MHWC 3PUZA 2G9DA 4J1MA 3K5LA 2RDFA 1LUZA 2ENBA 4P71A 4OO1I 5FKAC 3T53B 1LTAD 1PZJD 1G6ZA 1BBWA 3FMCA 4NXNQ 4J6HA 3OMCA 2KENA 1YJNA 3TMEA 2QDLA 2VS1A 1EEFD 4P72A 1D8LA 2JA5G 4ZCKA 4RGOS 2UUAL 4L6TB 1GD7A 1EOTA 4WORA 1CHQD 4MNOA 4RMFA 2K1BA 4OX9Q 3ND9A 5M5XH 3OIQA 4OWTB 1MI2A 3TS0A 3RUZA 2FMMA 3K6OA 1SN8A 2PMZB 1BCPD 3L7ZC 4FF2A 4R4TA 3GTMB 2L9HA 2O2LD 2F3WA 2XIWA 4UY8C 3PIP3 1IL2A 3SDZA 1E1OA 2DUDA 3D6CA 4JI8L 1MJCA 3VA5A 2JA7G 3QG1A 2QGQA 5K36H 3U9SA 5F2DA 4ZLTF 2A1AA 2E2JH 3RZDH 4GKJL 3P20A 3U58A 2MJ8A 2EE1A 4DV5Q 1NR4A 3E5SA 1PH7A 1S5CD 4O0AA 4DV2L 1KIXA 3HS0C 2HQLA 1YHAA 3ICEA 1KC8C 1X65A 1WJJA 3HP3A 2A6HD 3FVQA 1I6HH 1IZ6A 1JC7A 1LTBD 2EYJA 2A73B 2NTTA 2F0DA 2EVBA 4XT3B 2K6AA 4A3IH 1CSPA 1Y8PB 1HNWL 4O1NA 1S4ZA 3P75A 1EUJA 4IUQA 4K2LA 3ER0A 1H9MA 1BXTA 1TS5A 3UDXA 5C3EG 1PVOA 2L55A 4JOIA 1W6KA 1HQMC 1HA6A 1HHVA 2UUAQ 1NUCA 2FHTA 4A3BH 2DY8A 1OXTA 3D3RA 1TXYA 1TR5A 3PF4A 2YU9B 5FLMG 2ES2A 4IFDH 4C2MB 5E4XA 4UHVA 2IWHA 4LMQD 4A76A 2UU9L 3I4NG 1MSHA 1X55A 1I94L 1GO3E 1NR2A 2AQ3B 4OEMB 4CHTB 4KJNA 1BF4A 1HZCA 4JI8Q 1CKNA 1G291 3W1GA 4C1NI 2WB1B 4HIDA 2JA8H 2BDOA 3DEPA 3HRZC 1KL9A 3HOYG 1HR0L 3J81c 2ZTCA 2A68C 4F87A 3HOVH 4GKJQ 1T5EA 1VQ4A 3LWEA 3K5MA 3QOLA 4IFDI 1VQKA 1B9NA 3I3CA 3V05A 5M3MG 4A3LG 4DV2Q 2RSNA 4MTNA 1SDFA 2CH4W 2HUGA 2JA6G 1D5XC 1JWSD 1KTKA 1EQRA 3TP6A 5JPMC 3I4MG 1IL8A 2F0HA 1EWIA 1EWHA 1BUVT 2XTIA 1HZ9A 3QR8A 1F9RA 1SMYC 3HFZB 3ULPA 1SNDA 4KD3A 4X3SA 1CKNB 2F0KA 1EL0A 1HNWQ 1SAPA 5CYUA 1Q8IA 1IW7D 2AWNA 2MFIA 1VQEA 3K7UC 1Y1VH 2IW3A 1AEXA 3H15A 4ZYSA 1M90C 4JK1C 4DR7L 3JAML 4CKBA 1AZPA 3KBXA 3S15B 5C4XH 1LV9A 2KCCA 1WD0A 1K8AC 1I94Q 3HOXB 2RCNA 1E2WA 3ZYYX 4A3FG 2K50A 2CVRA 2EYHA 2B2UC 2L1BA 4P73A 4C3JB 1XX8A 3HOUG 2B2UA 3I90A 4IURA 2PW7A 1IXRA 1EZ6A 3HKSA 1ICFB 1ASYA 5ELOA 2R93B 1J9OA 3BS1A 4BS9A 3STBD 1U4MA 2XRSD 1XPUA 1HTLD 1BCPC 3CC7A 2XNAC 1GUWA 3T16A 1EY8A 3RLFA 1D5ZC 2RDGA 1SE3A 2Z1CA 1JB3A 5FJ8H 4A3EH 1VQ8A 5JAVA 2VB2X 2XGTA 2K28A 4HEDA 1FNUA 1MD2D 2JJQA 4O42A 3A56A 1S72A 4A93G 3E9IA 3M9BA 1JJGA 1FR3A 5IWAQ 4N8X1 2NVXB 2AMCB 2E2HH 1SROA 3NE5B 4HJ8A 4LK1C 4TSSA 4B3TL 1FL0A 4LFCQ 4BXXH 4MTKA 2F52A 4DR7Q 2A6HC 1VCIA 4DR3L 1BCPB 4JBJA 1PTOD 2E8GA 2AWOA 3Q0AA 4JI2L 2VUMH 1SLJA 5JVG3 1M4VA 4WJ4A 4LAAA 5EGTA 1WCMG 5IGEA 1BNZA 4YHHL 2I5MX 1NE3A 1SNQA 5C44B 2A69D 3CPFA 1EWCA 4FXKC 2B63B 1UNSA 1KLUD 3FDTA 4UDUC 3AFPA 3OPOA 4LW1A 2GN5A 4X3KA 1PFBA 1Y1WB 4MHEA 1DM0B 5DM63 4I7AA 4IPGA 3HEJA 3OW2A 2DJGC 4AIMA 4R4IA 1ESRA 2JQOA 4EX5A 1YITA 1D7QA 2AUJD 3L0OA 1S5ED 4JI1L 1DOKA 2EJFC 3GP7A 1WTQA 4R4CA 4IO9A 4HMIA 2CKZB 2VW9A 2NN6H 4KHZA 1OXXK 3CQZB 4ZKBB 1CFMA 3D6WA 3H09A 2WINB 1EIFA 4B3TQ 1K83B 3TREA 1F77A 2AHOB 3FKIG 3HKZB 2MUYA 5E4WC 3UI2A 5A35A 3A8KE 3NTIA 3LNNA 2QDBA 3U4VA 5C4HA 4AQYL 1W2BA 2JEAI 3D0FA 4GS3A 1ET9A 1PDQA 5C0XH 3K57A 3I4LA 2B2YC 1BO0A 3U9OA 3CU7A 3VYRA 4JI0L 1STNA 4JI2Q 2D2CC 3DM1A 1O7ZA 3FRPB 5E7NA 1TWAB 2B2YA 2EOTA 2NN6I 4BBRB 4YHHQ 4GN4B 2HIVA 1IW7C 2B2TC 1WVLA 1EU4A 1IYJB 4MIUA 4R8IA 5LMUL 2B2TA 3WWVA 5G3LD 3I55A 1ASZA 2EDGA 4YWMA 1K28A 3JAME 4GNXA 4YY3L 4DR2Q 1VQHA 1K8MA 2OQ0A 1JE5A 5C0XI 4K5WA 1BVSA 3G4SA 4GLXA 1VMCA 1PH6A 1PFNA 1IBLL 2ASBA 2AKWB 1F2ZA 1MIUA 1HNZQ 4KKSA 1M1KC 3KBGA 1DXMA 1B7YB 4QUCA 4H13C 2NUCA 1PHJA 2HHHQ 2JE6I 2A19A 5C3XA 1Q3LA 2MPMA 1JR0D 1GUNA 2WIIB 2RKSA 2VL6A 4BY1G 2BE5C 3FP9A 5DNFA 1UE5A 5GAGC 4IPCA 1S5DD 2EQSA 5I9OA 3NBHB 2EY6A 2HDLA 4YCUA 4AQYQ 2UXBL 3UDFA 1O7YA 1UAPA 5IE8A 2ZM6L 5IGFA 1TWHB 3DXJC 2MO1A 3FHWA 4RA8A 3BDCA 4UPAA 2DNCA 3S16B 1RF2D 1KNAA 3VR6A 4WJ3M 4JI0Q 1CK1A 3KLSA 4E6IA 2C5CA 4ALPA 3T1HQ 2E76C 2DJFC 4ZQ3A 5C6AA 4A3JB 2YU9H 1OO9B 1EY6A 1R4PB 4C2MH 1AE3A 3KF6B 3F2CA 4K0KL 5IT9c 3S24A 5LMUQ 1B44D 4AYBG 3PO3B 1NAPA 3BJUA 2IHEA 1A6XA 3J81j 4YY3Q 3OTOL 3S2DH 4NKLA 3HOZB 3G6EA 1X9NA 1UE1A 1PTOC 2XN9C 2GA4B 1WTVA 4H0LC 4LFAL 4DV7L 3CCJA 4A75A 4J8QA 4RH6A 1V43A 1PXUA 2K4KA 1E1TA 4DUZL 2R92G 5IP7G 2A69C 3L9AX 3BZDB 3VYUA 1WTXA 3J7A5 2PQEA 1V9PA 2VQEL 2G5DA 4A3GG 3I72A 1FJGQ 1YZ6A 2EY2A 4FF4A 3LX0A 4C3HG 2EJGC 2O5IC 4DF7A 4PZ8A 2K04A 4HJAA 3K8AA 4C3IG 5A2QL 5I6YA 4R4QA 3MXNA 2NZ1D 1IBML 1FYCA 2UXBQ 1CUKA 1PTOB 2UUBL 2ZM6Q 1A2TA 3GV6A 5GADC 4ME5A 4NMZA 2F03A 1Y1VB 4K8JA 3QO2A 4OO1G 3EBEA 1KLGD 5CC4A 3A0JA 3V2TA 2QCPX 3P7JA 3IFDA 1ZXTA 1HTPA 3S15H 5KEEA 2M00A 2B8FA 4K0KQ 1E7ZA 3H3VC 4DR5L 3MXNB 4XT1B 5KYIA 4RCNA 3X3NA 4DAYB 2K5QA 4FDBA 1FNWA 4APVA 3OTOQ 3HOXH 2D62A 1HZAA 3OYYA 4CJ1B 2KEDA 3WDNA 1YNND 3TP8A 1A3VA 1TIID 4LFAQ 1TS2A 4C3JH 1AE2A 1JB7A 2KEEA 1A0IA 4DUZQ 3H91A 1VQMA 4AYBE 2R93H 2Z4HA 4IPDA 1RL2A 2R7ZG 2VQEQ 5CGKA 1YHBA 1VQDA 2B3GA 4BWGB 1PYBA 3H0GG 1IHZA 1NNXA 5CV6A 1DOLA 1N33L 2JK8A 3PO2G 5COYA 1LABA 1PFMA 5M5YB 5I2XA 5M3FG 4XTCS 4C1NK 3CKIB 4JI7L 5IYCH 1IBMQ 3G71A 4HMJA 3WOEA 2UUBQ 1U0LA 3TN2A 2NVXH 1SYBA 4KK7A 5EPLA 2F0EA 3ERSX 5CBAE 3T1YL 1FGUA 1PRTF 1QUQA 1XMOQ 1LTRD 2OT2A 4OELB 4NXNL 3J81i 2QKIC 2QEXA 2R7DA 1PZID 2OCEA 1I50B 5K36G 1Q1EA 1IKLA 2VZAA 5C3WA 2SDFA 1YJWA 1TWGH 3UDIA 5BN4A 3SXHA 3I4NB 1C9OA 1LTLA 1B53A 4IOAA 1YNJD 4JW0A 2ZJQA 4DR5Q 3S14B 3DM3A 3X3MA 4YCVA 2RCFA 5C44H 1P16A 2B63H 1FD7D 2B39A 1EFID 2NVTB 2OEOA 4LNQA 1UE6A 1K8GA 1Y69U 4A3IG 1STYA 1Y1WH 3OOCA 4A3DB 2F0PA 2FXQA 2JA6B 1XNRL 1NBWA 2K14A 4ZAIA 1EQQA 4POGA 1WOCA 1EZ8A 2H1EA 4IOCA 3BVZA 4V190 3S2HB 3TZDA 1N33Q 2NVYB 2BDNA 4DAVA 4X66Q 4A3BG 3BDOA 4DK6C 5CMDA 4H44C 4UAIA 4IFDG 4JBKA 3PMFA 5ELCA 1GHKA 3EN2A 3ITPA 4JI7Q 2AUKA 3CQZH 2Q8RE 2K7VA 2ZTEA 2PI2A 1NTGA 5IYDH 1K83H 4QGUA 3T1YQ 4I65A 1VQGA 4EQNA 3GV3A 2QEJC 4IUTA 3R8BA 3HOVG 5A2QE 2N55A 1QWYA 4A3FB 1QVFA 1X56A 2PNHA 1X3QA 2F0VA 1W3SA 1TWAH 3MXUA 4BBRH 1UEAB 2KCMA 1GHJA 1ZYRD 2SEBD 5ELBA 1ILQA 1HA5A 1I4XA 2IJ0A 1GM5A 1STEA 2IX0A 1FNVA 1J6QA 4POFA 5KNDA 3F1ZA 5FLXL 4GZYC 3DUZA 1XNRQ 5JEAH 4EVOA 1Z47A 1F2MA 3A5UA 4G7HC 3NHHA 4DV4L 4PNYA 2WKDA 2VXWA 1EIGA 2K5VA 1YNXA 1SSOA 4R8NA 1OXSC 1D5MC 4UP7A 1SE2A 3OW7A 1YNNC 2N78A 3Q6SA 3V96A 5CR3A 5C4XG 4QCLA 2D0OA 2KOLA 3PUXA 4HIOA 3A54A 3C46A 3E3XA 2P5ZX 2NYZD 3AB9A 1XJVA 1QILA 2D5DA 5HGQA 1LLRD 1QG7A 4EQOA 3SHLA 4JOIC 3DHQA 2B2WC 1TWHH 2AQ1B 2EYFA 2PQAA 3S16H 2B2WA 3KFUA 1DGSA 1EEID 2IHFA 2JP1A 1LACA 4RHSA 2I5HA 2J7ZA 4A3JH 3ULJA 2K03A 5I6WA 4KKUA 5FJ8G 3MFGA 4TVAB 4L8JA 3PO3H 1YEZA 2BH8A 3I2ZA 5ELNA 3S2DB 2EYMA 1VQLA 1C0AA 1WTWA 5I9PA 3HOZH 2NZHA 1H9JA 1NY4A 1YNJC 1HH2P 4DV4Q 5M9OA 2F0IA 2IY5B 1K73C 1WI5A 4OIKA 5J22A 2V1CC 4H7BA 5CORA 2Q2IA 1YI2A 2UXCQ 1E2VA 2X69A 1RHPA 1D1KA 3DEOA 3AYHB 1EY4A 1DOMA 1U4RA 2CWPA 2VUMG 4CDDC 5IYBH 3W3AA 1CM9A 4K6DA 2CQOA 4IUNA 3K0XA 2E75C 2J0TD 3MVVA 3NP8A 4BY7B 1JOOA 3CHBD 3OHXC 1R9TB 2HIXA 3A74A 1E24A 1PTOH 5IWAL 4BA1I 3W1BA 3HOWB 5IP9G 1C4QA 4FO2A 1A15A 4DAMA 1JMCA 1D6EC 2WP8J 3OWFA 2LFNA 4LFCL 4G4KA 3EFXD 3A7AB 2ZJRA 3GDEA 3MEFA 3J80i 2K32A 1CA5A 3RLOA 5CV5A 4EQ5A 2BH2A 5GAEC 1Y14B 1YVCA 3IL8A 1SBBB 1N36L 3NTHA 4JC0A 4OONA 3BDLA 4K14A 3VR2A 2SNSA 2OWOA 2NN6G 5JJLA 3VYTA 4X65L 4LF7Q 1O7IA 4OGQC 2M9VA 3D31A 4CJ2C 1XPRA 4KI0A 4DUYL 3BVMA 4GN3B 4DXFA 3L3OC 2X6LA 1ZYRC 3CC2A 3CD6A 4MN3A 2F0TA 1HPCA 2BE5D 2L12A 3R2TA 3QWNA 3QJYA 1A3UA 5C0XG 3PUYA 3ZJYC 3RZOB 5FLXE 2F0WA 4I7ZC 1EYDA 1F9PA 4RKBA 3A55A 3CW2C 3H3VH 5I2YA 2RHQB 5M5YH 5JVH3 1VF5C 2RDHA 3QB3A 4X3UA 1N32Q 3E6ZX 1SJED 2CH4A 5JEAJ 1MSGA 5AFWA 2A8VA 2JYOA 4KJOA 4XDXA 2F0UA 2XWBB 5CV7A 2KHSA 2C9OA 2ZTDA 1I50H 4KN4C 1C8CA 1TWGB 2B8GA 4IN3A 3T51B 3I4NH 4PV1C 4JVZA 4JI6L 3TZUA 2MQHA 3S14H 2EY1A 4QY7A 1N36Q 1RTOA 3NSWA 4KD4A 2NVTH 4FF3A 1STAA 4X65Q 2EPBA 5GAHC 4LF5L 3GTQH 4A3LH 1OXUA 4DR2L 4DUYQ 1SFOB 4A3GB 1VDZA 1G8ZD 1XMQQ 4A3DH 5LHY1 2JA6H 3K81C 2NZOA 3PIOA 3B6YA 5I4DA 1BKBA 2UXDL 1HNZL 3SK4A 1V1OA 4HSPA 5EKIA 4C3IB 4YCWA 3S2HH 2NVYH 2EXDA 3CCQA 1PZKD 4JG2A 4CJ0B 4IFDJ 5IIFA 2TMPA 2HHHL 2SOBA 1UWVA 3I56A 2X6GA 1GKHA 2BCOA 2PI2E 3IFTA 1OXVA 3F8TA 3UE1A 1O7LA 4RHRA 1XWEA 2KVMA 5H1SE 3S1MB 5BN5A 4AH6A 4R4OA 1VF7A 1KDBA 1HRJA 4PG3A 3CCMA 1F9SA 3SK6A 3MAQA 2PZTA 4XQNA 4NXML 1V1QA 1CSQA 2DY7A 2WB1G 3CCVA 3E0JA 1STBA 3BYTB 2K5HA 4KMUC 1PH4A 3EJIA 2Q2UA 4HJ9A 1DZ1A 5JJKA 4G7ZC 1S40A 4KV6A 5DLQE 4JI6Q 1XTCD 3AU7A 2J4XA 5FO9B 4A3FH 4XYOA 1LT5D 1CHPD 4YWLA 2Q8IB 4QUFA 1PH1A 1QCBD 1VQ7A 3T1HL 3U4ZA 5BR8L 1MJEA 1JICA 2VY3A 4FNFA 1M8AA 4BBSB 1I5FA 3J7YW 1PMRA 4GNXC 1U4PA 4KHPL 4B08A 1A63A 1BQQT 1PH5A 2R7ZB 1LTSD 4LF5Q 2C35B 5K5PA 3ONAB 2I5LX 1ZKOA 3BYYB 4A3MG 3H0GB 1AW7A 4IUVA 2PPBC 3DWAA 1LT3D 3PO2B 3GTJB 4IZ8A 3M7GA 1CTMA 1G2SA 2UXDQ 4F8MA 3PUVA 4RGTA 4CBVA 3CPWA 3J80c 5M3FB 4CDEC 4WJWA 4DU9A 2CFMA 1GJXA 1ONLA 1FJGL 3FEWX 3MXGA 2HCCA 1T5XD 4GNXB 4GKKQ 2UUCL 5L37A 3GTKB 3HOXG 1U5KA 4WRDA 1EIHA 1SYFA 4H02A 4KLKA 4NXMQ 3J81L 4OIJA 4C3JG 2PZUA 1V1PA 3FPPA 4JBWA 5DEHA 4OWWB 1Y8NB 1UUPA 2CW0C 1VQAA 2F4VQ 2R93G 3RLNA 4RKLA 4ODGA 3C2PA 5BR8Q 3I73A 1S5FD 2F0GA 3TEHB 3VDYA 2WB1E 1Q1BA 4KHPQ 3S1RB 4CGYB 2YTVA 4Z9CB 4L5TA 4M1UB 3F2UA 1Q7YC 1D2BA 2EYPA 5IYCG 4KHVA 4LUOA 3P1HA 4IUPA 4A3KB 2N88A 2F0MA 1D1IA 1F9QA 5CBEE 4NW2A 2RVLA 5GQOA 2IX1A 1SYGA 1RJTA 2IX3A 2MHVA 3N6RA 4QQBX 4QF4A 2E2IB 2FFKB 1ZEQX 1L1OA 4B3RL 3NWTA 2UUCQ 2RF4A 3T13A 2Q2TA 3K7AB 5C44G 1VQOA 3M3YB 2LKVA 4FF1A 3RR5A 2B63G 4PZ7A 4BY7H 2JA5B 1R9TH 2CQAA 2R6GA 1Q46A 1TU2B 3KDFA 5FOBB 3ND8A 3HOWH 5AJ3L 5C4JB 1BCPF 1TS4A 1K8OA 1KRTA 3LWUA 1XMOL 2LSSA 4ME3A 3E9HA 5EBDA 3R93A 5KGUA 5CV8A 3C1EA 4OL7A 5C4ZA 1ICWA 2YV5A 3RMHA 1Q82C 1EYAA 1C7YA 2K5NA 2BA1A 4DAPA 2JA7B 3I7FA 4C56C 3KDFB 1A8VA 4IPHA 3J7AV 3GTOB 3BU2A 1BR9A 4UP8A 3HKZG 5FK9C 1X3GA 4K2KA 1G6PA 2OXPA 5C0XJ 1VQPA 2K5DA 1TKWB 2RSOA 3CP0A 1K0SA 1MKHA 4P75A 4GOPC 3RZOH 2RHSB 3TSSA 4X66L 4B3RQ 1WFQA 3CF5A 1UEBA 2JN4A 5EKLA 4BBRG 4YWKA 4GOPA 2XVSA 3OWEB 3R2IA 2E74C 3BZKA 1UE7A 5EKKA 1X3EA 1HFNA 5C3EB 1XPOA 3SK8A 1YIJA 4F88A 4XXEA 3NUCA 3M7NA 1W6JA 2DGYA 1KHIA 5AJ3Q 3TP7A 3JAMc 3GD7A 5JEAG 1HR0W 1KDAA 2N8NA 5J1ZA 1E2ZA 1HQRD 1ENAA 4ID6A 2OTJA 5LL6X 1PYWD 1J5EL 4RAUC 5J39A 3MHBA 4GOPB 1LT6D 4OWXB 4Q5VA 3J81E 2E5LQ 3HOYB 3SEBA 1H9SA 2KHIA 2LS01 1XTDA 2LMCB 1RD9D 5KNCA 4LUVA 1ML0D 1EOVA 4KY7A 4B3MQ 2R92H 5IODA 1L0XB 2R61A 1CZGA 1P8LA 2ALYB 1QUQB 5IGBA 4FXDA 5HURA 5M3MB 3GTQB 3A7LA 4R1JA 4A3CH 1SFOH 4ZUJA 4A3GH 2A74C 1PH2A 1KDCA 2EYLA 3KJOA 2EZVA 2A5HA 4PMBA 2MNAA 3I4MB 4JCVE 3NQTA 3F2DA 5FO7B 1TWCB 4HIKA 3K59A 4C3IH 3TP5A 3N52A 5ELFA 2KECA 4OXPA 3W2DA 4LF4L 1TS3A 3SE0A 5D14A 4DFAA 2YYZA 3KUPA 1Y8OB 3HKZE 4GLVB 4A3JG 1VQ5A 3GTPB 1S5BD 3AFQA 1SE4A 2PO4A 5D3DA 2FMCA 2Z9HA 3S1MH 3FPUB 4HTHA 5JOBA 4B9WA 3TDQA 2GVBA 1I4RA 3E0EA 1SNCA 3CAMA 1VQJA 3O13A 2JA8G 2F3IA 2EXZA 4IJHA 1SNPA 2RBMA 1J5EQ 1ILPA 2O5JC 3RD4A 3AQQA 5EJWA 4LF6L 1I4PA 2QW7A 1VQCA 5CV4A 1RTNA 2ZXPA 1EQTA 1EY9A 5JJIA 2GVAA 2HCIA 4BBSH 1I4HA 3HOUB 5C5MA 3CXCA 3KOJA 4FXGC 1IBKL 1I6VC 4JPBW 2Q8TA 5IYBG 4DR1L 1PV4A 1GUGA 1N9WA 2LY7A 1Q86C 5D3IB 4QL5A 2R7ZH 1MBYA 2Q2HA 1AZQA 3A8JE 2NTSA 2Z6BA 3H0GH 2Z6KC 1JORA 5KNBA 4DR6L 3RNUA 1LT4D 3PO2H 5C5LA 3GTJH 4BA2I 1Y1VG 2HT1A 3VR3A 3C3LA 2Z6KA 4K5XA 4YIJA 5NUCA 3M4OB 4Y52H 1F2YA 5M3FH 1LTID 2PW5A 4LF4Q 1I4GA 5ELEA 1GUTA 4A93B 2UXCL 1TWFB 4K6LA 5IGGA 5IT9L 1PA6A 5M5WB 4Y7NB 2Y0SG 2MO0A 4ILWA 4DV1L 1PTOF 2H5XA 1KXLA 1KD1C 3GTKH 3NXWA 2BA0A 3DWQA 1K3BC 3T56B 1EU3A 4X62L 1EY5A 1WCMB 5KRUA 1N34Q 1U4LA 3RN5A 3D8GA 3NBIA 3URYA 5ISRA 1Q12A 3KF8A 4LF6Q 2L0CA 1CKMA 1PYSB 2WAQG 1JOKA 1MGSA 4KN7C 1B50A 1XYIA 4IUUA 1WTRA 4NP5A 1HJPA 2RQXA 1IBKQ 3S1RH 3NTKA 4DR1Q 4A3EG 2OQKA 1YBYA 4DXGA 3AMUA 3CMAA 4ZK9B 2V4DA 1NMFA 4GN5A 1GOZA 4F7XA 4DN4M 3D4DA 4L63B 2PQAB 4KY6A 3GO5A 4DR6Q 4LF7L 1SR3A 4A3KH 1X54A 1QVGA 1EFWA 4J15A 4JI5L 3KF8B 2KQ3A 1QE6A 2AQ2B 3HG9A 4BXXG 5LL6S 1EYGA 2KCTA 4DNRB 4HCSA 1PRTD 1KRSA 1G51A 1K3RA 2Z8LA 2A6ED 2E2IH 4LFBL 3FKIB 1TT2A 3M85A 1JJ2A 4U68A 4DV1Q 3GTGB 3K7AH 2KCNA 3M3YH 2LXJA 4JV5L 2WFWA 4K5VA 1R4QB 3PIPA 4UP9A 2JA5H 3TS2A 1DONA 3K80C 1N32L 2ID0A 3A8IE 1GUOA 4IALA 4X62Q 1RDPD 3I91A 4X3TA 4DK1A 3UDGA 5C4JH 4A3DG 2EIFA 2Y0SE 5G3LF 3EVQA 4WFN3 1B2TA 5JPNC 1TY2A 5J3BA 4HJ5A 4KY5A 3UE0A 1G2TA 3CCRA 5T1IA 1KABA 1PLFA 4QMGA 3GQBA 3K5OA 4A3MB 4HCEA 2ZXOA 3PSIA 1JJCB 1VQNA 5IY0A 2QF7A 2JA7H 2IT1A 1L2FA 2EYOA 4NDXA 3G6JB 3J80E 2WAQE 3GTOH 2G9HD 3VYSA 4JI5Q 1VS0A 3PIO3 4DR4L 1JWMD 1XMQL 4DK3C 2L4NA 2O4XA 4L5SA 1O78A 2UU9Q 2DN8A 3MXPA 1SRUA 1X3FA 4BY1B 1WD1A 3BVGA 4LFBQ 3S1QB 1H9KA 5IOCA 2XWJB 2CW0D 1E0BA 1HR0Q 4JV5Q 1PH9A 2OTLA 5EQ0A 4RGMA 5C3EH 1GVPA 3BG3A 2NVQB 1EIYB 4TRDA 3QIAA 2L15A 1XXGA 4RG1A 3PV0A 3GTLH 1EYCA 5FLMH 5IT9E 5BN3A 2KBNA 3S17B 2MGSA 4HIMA 1TVXA 3MTSA 4AYBB 4DV0L 5LMNW 3H3VI 4L5RC 3EA6A 2MP1A 3ERQA 1Z6HA 2BOSA 3WOFA 2N49A 2FINB 2K5WA 2PNRC 3VR5A 3IAYA 1AP0A 3OIPA 3HOYH 4CDCC 4LWCA 4TQUS 4DNIA 4RCOA 5KIXA 1E22A 3R3OA 4RWSC 2R92B 3C1FA 3NK9A 4K8IA 1J8IA 2H4OA 4TKOB 5M3MH 3EIVA 4DR4Q 4G57A 4KKTA 3SK5A 1NJIC 2K33A 3S1NH 1SE8A 4ZUIA 4C3HB 3I4MH 1DYQA 1BBXC 2K52A 3D4WA 4QIWE 1SNOA 1TWCH 3HGBA 1QOHA 5HY6A 1I3QB 3MWYW 1U9RA 3TQYA 1GUSA 1HCZA 1VQIA 2KJXA 3DLLA 3M4PA 3DWPA 5IP9H 2M2LA 4NB3A 5EPKA 1PH3A 3GTPH 2R3ZA 3TRZA 3MEHA 3CCSA 4GKKL 1YHQA 1PFSA 2ZJPA 2JXMB 3VR4A 5JJZA 2D0PA 3Q22A 1K9MC 1PRTC 4ULLA 4DPGA 2YTYA 3KK7A 5D65A 2A6EC 5IGDA 2VQFL 1AFPA 1JOQA 4DV0Q 4Q0FA 3RN2A 2PMZE 2F4VL 3J7AF 1L0YB 3D4RA 3NWSA 3F2BA 5E3FA 3KLSX 2ICIA 3AEVA 3U50C 2YTXA 3L2PA 3HOUH 1HFGA 1CQFA 1II3A 2EJMA 2JA9A 4PZ6A 2D9UA 4OHJA 1I4QA 3LGJA 3I4OA 1HZBA 1O80A 1BBUA 5FO8B 4EGVA 4HR7B 1T9HA 4DR3Q 4X64L 1SEBD 4QB4A 1CI3M 1HUMA 4BY7G 4V0BA 1PRTB 1X32A 4CKCA 2F0QA 1SJHD 3Q8DA 5DM73 1KQSA 1CQVA 3HOWG 4EQPA 1G91A 3JAMi 3PGZA 1Z7TA 1H9RA 5M5XB 3M4OH 4RFBA 3NEMA 1JQYD 1N8RC 1CZWA 1QZHA 2L11A 3IRBA 2VB3X 4JYAL 2HD3A 4A93H 3TBIB 1WTHA 3GTMH 2I46A 4DKAC 1TWFH 1RCVD 1HUNA 1IYUA 4PQXA 5M5WH 1TQOA 3PCOB 3K5NA 4Y7NH 4LF9L 1ET6A 2NBFA 4G7OC 1QVCA 3NBHA 4FYDA 1RIPA 2F0LA 3T4AC 4B3SL 3S9WA 3MZ5A 1SNMA 3RZDB 2E2JB 2LXKA 3J7ZC 1LTTD 3CC4A 4PMWA 1QNKA 4JI1Q 1V8QA 2QILA 3I70A 3OMGA 2VQFQ 1WCMH 1A2UA 2N3SA 1QB5D 2E2DC 3SR1A 1I6HB 4M8AA 1K0RA 3IKJA 3I8ZA 1WYDA 4XQJA 3KLRA 1LM0A 1ESFA 3KF6A 3STBC 1C48A 3NELA 3EROA 1QNUA 2ICEC 5IGCA 4A3IB 1STGA 1S3OA 4HN7A 3ULLA 5FLXc 3QOJA 1CA6A 1Q81C 4XQQA 3PUWA 4X64Q 1SYDA 3MFYA 1RKNA 1H95A 1B8AA 1NSNS 1V1PB 5T1GA 1B1ZA 1L0WA 2WV6D 4A3BB 4LF8L 4RGNA 4U673 2IL8A 4JI3L 4LJZC 1CT1D 4CKEA 2K05A 2F0NA 1DJRD 5EBCA 2F1MA 1SYCA 4DGZA 4JYAQ 1RODA 1L1OC 2HQEA 4DV6L 2XSCA 1QZGA 1B70B 3M4YA 5CV9A 1LO5D 1B3AA 3FKIH 4LF9Q 1AN8A 4O2DA 1IBLQ 2JA8B 3GTGH 1VMPA 4N8FA 2B2VC 3CMEA 1IKMA 4B3SQ 3HOVB 2KUMA 3M4QA 5KYLA 4HJ7A 5LMNL 1KAAA 4XIGS 1DD2A 4HSVA 1EY0A 2B2VA 1KNEA 3PQIA 1X3PA 2QA4A 3KJPA 4A3CG 1Y1WG 4FP5D 2KA7A 4B9XA 5GROA 3OSOA 2CWAA 1JWUD 1CKOA
chains in the Genus database with same CATH topology
4IQZA 2NB0A 1A3TA 4N9PA 2F3VA 3K58A 3K0YA 1JE4A 1IYVA 4DAYA 1EQVA 1FGBD 1QJOA 2I07B 2F0SA 4ABNA 1NCVA 4ZKCB 4S3SA 3NPPA 2JEBI 3SVMA 2EY5A 1EY7A 2PCFB 1WTPA 2Z4IA 1Q90A 5C4XB 2Y0SB 1WTOA 2K01A 5DAUA 4ZRZA 2HDMA 4XYQA 4DA2A 1B9MA 5HGTA 2TSSA 2WAQB 1ENCA 3HZXA 1HXYD 2F4IA 3GTLB 2CHBD 3MA2B 1SYEA 1JCKB 2WKCA 4A3EB 1LTGD 2F0FA 3Q23A 1SXTA 1B4OA 4FVMA 2E2HB 2WACA 2NWGA 3MC0B 5TSSA 2DNEA 3VA7A 2ZXRA 4KTAA 2ZT9C 3S1NB 2VUMB 2A68D 2JSOA 4PMCA 2L5TA 2RA4A 2F0JA 1DCZA 3NQIA 4R9WA 5EPJA 1H9SB 3G7LA 5ELDA 2PYKA 4P2CB 2SNMA 2OF1A 4N9TA 5E1FA 3H6MA 1STHA 1BOSA 2PZWA 4HAEA 3CRLC 1F2LA 2VNUD 1TY0A 4OO1H 4DK0A 1SMYD 3Q24A 3CRKC 1BDOA 1GXDC 2FJ2A 2IPKD 2XRQD 3H94A 4DNTB 3DMUA 3J80L 3EQLC 4QIWB 2F0OA 1ENFA 3PUZA 2G9DA 4J1MA 3K5LA 2RDFA 2ENBA 4OO1I 5FKAC 3T53B 1LTAD 1PZJD 1G6ZA 3FMCA 4J6HA 3OMCA 3TMEA 1EEFD 4RGOS 4L6TB 4WORA 1EOTA 1CHQD 2K1BA 3ND9A 3OIQA 1MI2A 3RUZA 2FMMA 3K6OA 2PMZB 1BCPD 3L7ZC 4FF2A 3GTMB 2L9HA 2O2LD 2F3WA 2XIWA 3PIP3 3SDZA 3D6CA 3VA5A 3QG1A 5K36H 3U9SA 5F2DA 4ZLTF 3P20A 2MJ8A 2EE1A 1NR4A 3E5SA 1S5CD 3HS0C 3HP3A 2A6HD 3FVQA 1JC7A 1LTBD 2EYJA 2A73B 2NTTA 2F0DA 2EVBA 4XT3B 2K6AA 1Y8PB 4O1NA 1S4ZA 3P75A 4IUQA 4K2LA 1H9MA 1BXTA 1TS5A 2L55A 1W6KA 1HQMC 1HA6A 1HHVA 1NUCA 2FHTA 2DY8A 1OXTA 3D3RA 1TR5A 2YU9B 4IFDH 4C2MB 5E4XA 2IWHA 4LMQD 1MSHA 1NR2A 2AQ3B 4CHTB 4KJNA 1BF4A 1G291 4C1NI 2WB1B 2BDOA 3DEPA 3HRZC 2A68C 4F87A 1T5EA 3LWEA 3K5MA 3QOLA 4IFDI 1B9NA 3I3CA 3V05A 2RSNA 1SDFA 2HUGA 1D5XC 1JWSD 1KTKA 3TP6A 5JPMC 1IL8A 2F0HA 1EWHA 1BUVT 1F9RA 1SMYC 1SNDA 4KD3A 4X3SA 2F0KA 1EL0A 1SAPA 5CYUA 1Q8IA 1IW7D 2AWNA 2IW3A 1AEXA 4ZYSA 4JK1C 3JAML 4CKBA 1AZPA 3KBXA 3S15B 1LV9A 2KCCA 1WD0A 3HOXB 1E2WA 3ZYYX 2CVRA 2EYHA 2B2UC 2L1BA 4C3JB 1XX8A 2B2UA 3I90A 4IURA 2PW7A 1EZ6A 2R93B 1J9OA 3BS1A 4BS9A 1U4MA 2XRSD 1HTLD 1BCPC 2XNAC 1GUWA 3T16A 1EY8A 3RLFA 1D5ZC 2RDGA 1SE3A 2Z1CA 1JB3A 5JAVA 2VB2X 2K28A 4HEDA 1FNUA 1MD2D 4O42A 3A56A 1FR3A 2NVXB 3NE5B 4LK1C 4TSSA 2A6HC 1VCIA 1BCPB 1PTOD 2AWOA 3Q0AA 5JVG3 1M4VA 4LAAA 5EGTA 5IGEA 1BNZA 1SNQA 5C44B 2A69D 4FXKC 1EWCA 2B63B 1UNSA 1KLUD 3FDTA 4UDUC 3OPOA 4X3KA 1PFBA 1Y1WB 4MHEA 1DM0B 5DM63 3HEJA 1ESRA 2AUJD 1S5ED 1DOKA 2EJFC 3GP7A 1WTQA 4HMIA 2NN6H 4KHZA 1OXXK 3CQZB 4ZKBB 1CFMA 3D6WA 3H09A 2WINB 1K83B 1F77A 3HKZB 2MUYA 3UI2A 5A35A 5E4WC 3A8KE 3NTIA 3LNNA 2QDBA 5C4HA 2JEAI 1ET9A 1PDQA 5C0XH 3K57A 3I4LA 2B2YC 1BO0A 3U9OA 3CU7A 3VYRA 1STNA 2D2CC 3DM1A 1O7ZA 3FRPB 1TWAB 2B2YA 2EOTA 2NN6I 4BBRB 1IW7C 2B2TC 1WVLA 1EU4A 4MIUA 4R8IA 2B2TA 5G3LD 2EDGA 3JAME 1K8MA 5C0XI 4K5WA 1VMCA 1PFNA 1F2ZA 4KKSA 3KBGA 1DXMA 4QUCA 4H13C 2NUCA 2JE6I 5C3XA 1Q3LA 2MPMA 1JR0D 1GUNA 2WIIB 2RKSA 2BE5C 5DNFA 1S5DD 5I9OA 2EY6A 2HDLA 1O7YA 1UAPA 5IGFA 1TWHB 3DXJC 4RA8A 3BDCA 2DNCA 3S16B 1RF2D 1KNAA 3VR6A 1CK1A 3KLSA 4E6IA 2C5CA 2E76C 4ZQ3A 5C6AA 4A3JB 1OO9B 1EY6A 1R4PB 1B44D 3PO3B 1NAPA 1A6XA 4NKLA 3HOZB 1PTOC 2XN9C 2GA4B 1WTVA 4H0LC 4J8QA 4RH6A 1V43A 1PXUA 2A69C 3L9AX 3BZDB 3VYUA 1WTXA 2PQEA 3I72A 2EY2A 4FF4A 3LX0A 4C3HG 2EJGC 2O5IC 4DF7A 2K04A 4C3IG 5A2QL 5I6YA 3MXNA 2NZ1D 1FYCA 1PTOB 1A2TA 3GV6A 4ME5A 4NMZA 2F03A 1Y1VB 4K8JA 3QO2A 4OO1G 1KLGD 5CC4A 3V2TA 2QCPX 3P7JA 3IFDA 1ZXTA 1HTPA 5KEEA 2M00A 2B8FA 3H3VC 4XT1B 5KYIA 4RCNA 3X3NA 2K5QA 1FNWA 2D62A 4CJ1B 2KEDA 3WDNA 1YNND 3TP8A 1A3VA 1TIID 1TS2A 2KEEA 3H91A 2Z4HA 5CGKA 4BWGB 5CV6A 1IHZA 1DOLA 5COYA 1LABA 1PFMA 5M5YB 5I2XA 4XTCS 4C1NK 3CKIB 4HMJA 3WOEA 3TN2A 1SYBA 4KK7A 5EPLA 2F0EA 5CBAE 1PRTF 1LTRD 2OT2A 2QKIC 1PZID 5K36G 1I50B 1Q1EA 1IKLA 5C3WA 2SDFA 5BN4A 3SXHA 3I4NB 1B53A 1YNJD 3S14B 3X3MA 1FD7D 2B39A 1EFID 2NVTB 2OEOA 1Y69U 1STYA 4A3DB 3OOCA 2F0PA 2JA6B 4ZAIA 1EZ8A 2H1EA 3BVZA 4V190 3S2HB 3TZDA 2NVYB 2BDNA 4DAVA 3BDOA 5CMDA 4H44C 4UAIA 4IFDG 3PMFA 5ELCA 1GHKA 3ITPA 2AUKA 2Q8RE 2K7VA 4I65A 4EQNA 3GV3A 2QEJC 4IUTA 3R8BA 5A2QE 2N55A 1QWYA 4A3FB 1X3QA 2F0VA 3MXUA 1UEAB 1GHJA 1ZYRD 2SEBD 5ELBA 1ILQA 1HA5A 1I4XA 2IJ0A 1STEA 2IX0A 1FNVA 5KNDA 5FLXL 4GZYC 3DUZA 5JEAH 4EVOA 1Z47A 1F2MA 4G7HC 3NHHA 4PNYA 2WKDA 2VXWA 1EIGA 1SSOA 4R8NA 1OXSC 1D5MC 1SE2A 3OW7A 1YNNC 3Q6SA 3V96A 5CR3A 4QCLA 2KOLA 3PUXA 3A54A 3C46A 2NYZD 3AB9A 1QILA 2D5DA 1LLRD 1QG7A 4EQOA 3SHLA 3DHQA 2B2WC 2AQ1B 2EYFA 2B2WA 1EEID 2JP1A 1LACA 4RHSA 2J7ZA 2K03A 5I6WA 4KKUA 3MFGA 4L8JA 3S2DB 2EYMA 1WTWA 5I9PA 1H9JA 1YNJC 5M9OA 2F0IA 4OIKA 5J22A 4H7BA 5CORA 1E2VA 2X69A 1RHPA 1D1KA 3DEOA 1EY4A 1DOMA 1U4RA 3W3AA 1CM9A 4K6DA 4IUNA 2E75C 2J0TD 3MVVA 3NP8A 4BY7B 1JOOA 3CHBD 3OHXC 1R9TB 1PTOH 4BA1I 3HOWB 1C4QA 4FO2A 1A15A 1D6EC 2WP8J 3OWFA 2LFNA 4G4KA 3EFXD 3A7AB 1CA5A 2K32A 5CV5A 3IL8A 1SBBB 3NTHA 3BDLA 4K14A 3VR2A 2SNSA 2NN6G 3VYTA 4OGQC 2M9VA 3D31A 4CJ2C 4KI0A 3BVMA 4DXFA 3L3OC 2X6LA 1ZYRC 4MN3A 2F0TA 1HPCA 2BE5D 2L12A 3R2TA 3QWNA 3QJYA 1A3UA 5C0XG 3PUYA 3RZOB 5FLXE 2F0WA 4I7ZC 1EYDA 1F9PA 4RKBA 3A55A 5I2YA 5JVH3 1VF5C 2RDHA 3QB3A 4X3UA 3E6ZX 1SJED 5JEAJ 1MSGA 5AFWA 2JYOA 4KJOA 4XDXA 2F0UA 2XWBB 5CV7A 2KHSA 2C9OA 4KN4C 1C8CA 1TWGB 2B8GA 4IN3A 3T51B 4PV1C 3TZUA 2EY1A 1RTOA 3NSWA 4KD4A 4FF3A 1STAA 2EPBA 1OXUA 1SFOB 4A3GB 1VDZA 1G8ZD 5LHY1 5I4DA 3SK4A 1V1OA 4HSPA 5EKIA 4C3IB 1PZKD 4CJ0B 4IFDJ 5IIFA 2TMPA 2SOBA 2X6GA 2BCOA 3IFTA 1OXVA 1O7LA 4RHRA 1XWEA 2KVMA 3S1MB 5BN5A 1VF7A 1KDBA 1HRJA 1F9SA 3SK6A 3MAQA 2PZTA 4XQNA 2DY7A 3E0JA 1STBA 3BYTB 4KMUC 3EJIA 1DZ1A 4G7ZC 4KV6A 1XTCD 3AU7A 2J4XA 5FO9B 4XYOA 1LT5D 1CHPD 2Q8IB 4QUFA 1QCBD 1JICA 4FNFA 1M8AA 4BBSB 3J7YW 1PMRA 1U4PA 4B08A 1BQQT 2R7ZB 1LTSD 5K5PA 3ONAB 1ZKOA 3BYYB 3H0GB 1AW7A 4IUVA 2PPBC 3DWAA 1LT3D 3PO2B 3GTJB 4IZ8A 3M7GA 1CTMA 1G2SA 4F8MA 3PUVA 4RGTA 4CBVA 5M3FB 4WJWA 4DU9A 1GJXA 1ONLA 3FEWX 3MXGA 2HCCA 1T5XD 3GTKB 4WRDA 1EIHA 1SYFA 3J81L 4OIJA 4C3JG 2PZUA 1V1PA 3FPPA 4JBWA 5DEHA 1Y8NB 1UUPA 2CW0C 4RKLA 4ODGA 3C2PA 3I73A 1S5FD 2F0GA 1Q1BA 3S1RB 4CGYB 4Z9CB 4M1UB 3F2UA 1D2BA 2EYPA 4KHVA 3P1HA 4IUPA 4A3KB 2N88A 2F0MA 1D1IA 1F9QA 5CBEE 4NW2A 2RVLA 2IX1A 1SYGA 1RJTA 2IX3A 2MHVA 3N6RA 4QF4A 2E2IB 2FFKB 1ZEQX 3NWTA 3T13A 3K7AB 3M3YB 2LKVA 4FF1A 2JA5B 2CQAA 2R6GA 1TU2B 5FOBB 3ND8A 5C4JB 1BCPF 1TS4A 1K8OA 3LWUA 5KGUA 3R93A 5EBDA 5C4ZA 5CV8A 3C1EA 4OL7A 1ICWA 3RMHA 1EYAA 2BA1A 4DAPA 2JA7B 4C56C 3J7AV 3GTOB 1BR9A 5FK9C 4K2KA 2OXPA 5C0XJ 2K5DA 1TKWB 2RSOA 3TSSA 5EKLA 2XVSA 3OWEB 2E74C 3R2IA 5EKKA 1HFNA 5C3EB 3SK8A 4F88A 4XXEA 3NUCA 3M7NA 1W6JA 3TP7A 3GD7A 5JEAG 1KDAA 5J1ZA 1E2ZA 1HQRD 1ENAA 4ID6A 5LL6X 1PYWD 4RAUC 5J39A 3MHBA 1LT6D 4Q5VA 3J81E 3HOYB 3SEBA 1H9SA 2LS01 2LMCB 1RD9D 5KNCA 1ML0D 4KY7A 5IODA 1L0XB 1CZGA 2R61A 5IGBA 4FXDA 5HURA 5M3MB 3GTQB 3A7LA 4ZUJA 2A74C 1KDCA 2EYLA 2EZVA 2A5HA 4PMBA 3I4MB 3NQTA 5FO7B 1TWCB 3K59A 3TP5A 3N52A 5ELFA 2KECA 3W2DA 1TS3A 3SE0A 5D14A 4DFAA 2YYZA 3KUPA 1Y8OB 3GTPB 1S5BD 1SE4A 2PO4A 5D3DA 2FMCA 3FPUB 4HTHA 5JOBA 4B9WA 3TDQA 1I4RA 1SNCA 3O13A 2EXZA 1SNPA 2RBMA 1ILPA 2O5JC 3RD4A 5EJWA 1I4PA 5CV4A 1RTNA 2ZXPA 1EQTA 1EY9A 2HCIA 1I4HA 3HOUB 5C5MA 4FXGC 1I6VC 2Q8TA 1GUGA 2LY7A 5D3IB 1MBYA 1AZQA 3A8JE 2NTSA 1JORA 5KNBA 1LT4D 5C5LA 4BA2I 3VR3A 3C3LA 4K5XA 4YIJA 5NUCA 3M4OB 1F2YA 1LTID 2PW5A 1I4GA 5ELEA 1GUTA 4A93B 1TWFB 4K6LA 5IGGA 5IT9L 5M5WB 4Y7NB 4ILWA 1PTOF 3NXWA 2BA0A 3DWQA 3T56B 1EU3A 1EY5A 1WCMB 5KRUA 1U4LA 3D8GA 3NBIA 3URYA 5ISRA 1Q12A 3KF8A 2L0CA 1JOKA 1MGSA 4KN7C 1B50A 1XYIA 4IUUA 1WTRA 4NP5A 2RQXA 3NTKA 4DXGA 3AMUA 4ZK9B 2V4DA 1GOZA 4F7XA 4DN4M 3D4DA 4L63B 4KY6A 3GO5A 2KQ3A 1QE6A 2AQ2B 3HG9A 5LL6S 4DNRB 4HCSA 1PRTD 2Z8LA 2A6ED 3FKIB 1TT2A 3M85A 4U68A 3GTGB 2KCNA 4K5VA 1R4QB 1DONA 2ID0A 3A8IE 1GUOA 4IALA 1RDPD 3I91A 4X3TA 4DK1A 5G3LF 3EVQA 4WFN3 1B2TA 5JPNC 1TY2A 4KY5A 1G2TA 5T1IA 1KABA 1PLFA 4QMGA 3GQBA 3K5OA 4A3MB 4HCEA 2ZXOA 2QF7A 2IT1A 2EYOA 4NDXA 3G6JB 3J80E 2G9HD 3VYSA 3PIO3 1JWMD 2L4NA 2O4XA 1O78A 2DN8A 3MXPA 4BY1B 1WD1A 3BVGA 3S1QB 1H9KA 5IOCA 2XWJB 2CW0D 1E0BA 5EQ0A 4RGMA 3BG3A 2NVQB 4TRDA 3QIAA 1XXGA 3PV0A 1EYCA 5IT9E 5BN3A 3S17B 2MGSA 1TVXA 3MTSA 4AYBB 3EA6A 2MP1A 3ERQA 1Z6HA 2BOSA 3WOFA 2FINB 2K5WA 2PNRC 3VR5A 3IAYA 1AP0A 3OIPA 4TQUS 4RCOA 5KIXA 3R3OA 4RWSC 2R92B 3C1FA 3NK9A 4K8IA 1J8IA 2H4OA 4TKOB 4G57A 4KKTA 3SK5A 2K33A 4ZUIA 4C3HB 1DYQA 1BBXC 3D4WA 1SNOA 3HGBA 1QOHA 1I3QB 3MWYW 1U9RA 1GUSA 1HCZA 2KJXA 3DWPA 2M2LA 5EPKA 2R3ZA 3MEHA 2JXMB 3VR4A 5JJZA 3Q22A 1PRTC 4ULLA 3KK7A 5D65A 2A6EC 5IGDA 1AFPA 1JOQA 4Q0FA 3J7AF 1L0YB 3D4RA 3NWSA 5E3FA 3KLSX 2ICIA 1HFGA 1CQFA 1II3A 2EJMA 2D9UA 4OHJA 1I4QA 1O80A 5FO8B 4EGVA 4HR7B 1SEBD 4QB4A 1CI3M 1HUMA 4V0BA 1PRTB 1X32A 4CKCA 2F0QA 1SJHD 5DM73 1CQVA 4EQPA 1G91A 1Z7TA 1H9RA 5M5XB 4RFBA 1JQYD 1CZWA 2L11A 2VB3X 3TBIB 2I46A 1RCVD 1HUNA 1IYUA 4PQXA 1TQOA 3K5NA 1ET6A 2NBFA 4G7OC 4FYDA 3NBHA 2F0LA 3T4AC 3S9WA 3MZ5A 1SNMA 3RZDB 2E2JB 1LTTD 4PMWA 1QNKA 1V8QA 2QILA 3I70A 3OMGA 1A2UA 1QB5D 2E2DC 3SR1A 1I6HB 4M8AA 3IKJA 3I8ZA 4XQJA 3KLRA 1ESFA 1C48A 3EROA 1QNUA 2ICEC 5IGCA 4A3IB 1STGA 4HN7A 3QOJA 1CA6A 4XQQA 3PUWA 1SYDA 3MFYA 1RKNA 1NSNS 1V1PB 5T1GA 1B1ZA 2WV6D 4A3BB 4RGNA 4U673 2IL8A 4LJZC 1CT1D 4CKEA 2K05A 2F0NA 1DJRD 5EBCA 2F1MA 1SYCA 4DGZA 1RODA 2HQEA 2XSCA 3M4YA 5CV9A 1LO5D 1B3AA 1AN8A 2JA8B 1VMPA 2B2VC 1IKMA 3HOVB 2KUMA 5KYLA 1DD2A 1KAAA 4XIGS 4HSVA 1EY0A 2B2VA 1KNEA 1X3PA 4FP5D 2KA7A 4B9XA 3OSOA 1JWUD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F0J A;  4NKL A;  2KQ3 A;  2PZU A;  2EXZ A;  1SYB A;  2EYH A;  1SNP A;  2RBM A;  4K2K A;  2F0D A;  2OXP A;  2F0E A;  4EVO A;  2PYK A;  5DEH A;  1A3T A;  1F2M A;  4N9P A;  2F3V A;  2SNM A;  2OF1 A;  3ERQ A;  4N9T A;  5E1F A;  3NHH A;  4RKL A;  4ODG A;  3H6M A;  3SK4 A;  3OWF A;  2QDB A;  1STH A;  3P75 A;  4PNY A;  5C4H A;  2PW7 A;  1EQV A;  5CV4 A;  2PZW A;  1EZ6 A;  4K2L A;  1EY9 A;  1TQO A;  5C3W A;  2F0G A;  1TT2 A;  2F0S A;  3SXH A;  4R8N A;  5EKL A;  5IIF A;  3U9O A;  2PQE A;  5KIX A;  5CV5 A;  5C5M A;  3R3O A;  2SOB A;  1STN A;  2F0L A;  4S3S A;  1NUC A;  4K5V A;  3S9W A;  3C1F A;  3MZ5 A;  3NK9 A;  5EKK A;  5CR3 A;  1SNM A;  2EY2 A;  4K8I A;  2EY5 A;  3LX0 A;  3T16 A;  1EY8 A;  3SK8 A;  1TR5 A;  3BDL A;  1EY7 A;  4G57 A;  3NUC A;  3SK5 A;  4K14 A;  4IAL A;  2EYP A;  2SNS A;  4DF7 A;  3OMG A;  4KHV A;  3DMU A;  3P1H A;  4MIU A;  1A2U A;  1KDB A;  2OEO A;  4ZUI A;  5JAV A;  1JOR A;  3SK6 A;  3TP7 A;  5I6Y A;  5C5L A;  3SR1 A;  2PZT A;  2F0M A;  3EVQ A;  4EQO A;  2F0O A;  3SHL A;  3D4W A;  1KDA A;  4K5X A;  1SNO A;  1STY A;  4YIJ A;  3DHQ A;  5J1Z A;  5NUC A;  1STB A;  4J1M A;  4ID6 A;  1ENA A;  1A2T A;  1F2Y A;  2RDF A;  2F0P A;  5DAU A;  4KY5 A;  2ENB A;  4K5W A;  2PW5 A;  3EJI A;  4KJN A;  2F0T A;  2EYF A;  1SYG A;  1U9R A;  3ERO A;  4ME5 A;  4NMZ A;  5IGC A;  4KV6 A;  4K8J A;  1EZ8 A;  1KAB A;  1STG A;  1A3U A;  1F2Z A;  3MHB A;  4QMG A;  5J39 A;  3QOJ A;  5IGG A;  4J6H A;  3OMC A;  4QF4 A;  5HGT A;  3TME A;  2F0W A;  3MEH A;  1EYD A;  5CC4 A;  4RKB A;  3QOL A;  2EYO A;  1SYD A;  3V2T A;  4NDX A;  1RKN A;  3T13 A;  1NSN S;  2NUC A;  1ENC A;  4KY7 A;  5KEE A;  2M00 A;  2LKV A;  3HZX A;  5I6W A;  3NXW A;  4WOR A;  3QB3 A;  5IOD A;  4LAA A;  3PMF A;  5EGT A;  5C3X A;  5IGE A;  5IGB A;  1SYE A;  5KYI A;  3ITP A;  3TP6 A;  5HUR A;  1SNQ A;  2F0H A;  5K5P A;  2EYM A;  2F0N A;  4ZUJ A;  2RKS A;  1KDC A;  3RUZ A;  5I9P A;  1EY5 A;  2EYL A;  5IGD A;  1JOQ A;  5KRU A;  2F0F A;  2O4X A;  4PMB A;  4KJO A;  1SND A;  4KD3 A;  1SYC A;  4DGZ A;  2F0U A;  3NQT A;  3TP8 A;  2F0K A;  1A3V A;  5I9O A;  4I65 A;  4IZ8 A;  2EY6 A;  2HQE A;  3D8G A;  5CV7 A;  5ISR A;  4EQN A;  5KGU A;  3MXP A;  2KHS A;  5CV8 A;  2F3W A;  2F0I A;  3C1E A;  4OL7 A;  5E3F A;  3TP5 A;  4F8M A;  5C4Z A;  5CV9 A;  5IGF A;  1JOK A;  2WAC A;  3BDC A;  3HEJ A;  3D6C A;  4DFA A;  5IOC A;  5J22 A;  3VA5 A;  4DU9 A;  1II3 A;  1EYA A;  4H7B A;  4NP5 A;  5CGK A;  1AEX A;  4E6I A;  5F2D A;  2F0V A;  5KYL A;  5CV6 A;  1IHZ A;  1EY4 A;  2EY1 A;  1KAA A;  4KD4 A;  1EY0 A;  4KTA A;  4QB4 A;  4ZQ3 A;  5C6A A;  5M9O A;  4TRD A;  1EY6 A;  4HTH A;  4B9W A;  3E5S A;  5JOB A;  4F7X A;  2F0Q A;  4K6D A;  3D4D A;  1STA A;  4IUN A;  4KY6 A;  3NP8 A;  4WRD A;  1SYF A;  3MVV A;  4B9X A;  1JOO A;  1SNC A;  4EQP A;  1EYC A;  4HMI A;  4PMC A;  4HMJ A;  3OSO A;  2EYJ A; 
#chains in the Genus database with same CATH topology
 1L1O B;  1XNQ L;  4IQZ A;  2NB0 A;  4L5Q A;  1A3T A;  4N9P A;  2F3V A;  3K58 A;  3K0Y A;  1JE4 A;  1IYV A;  4DAY A;  4A3M H;  1EQV A;  1FGB D;  4QJF A;  2E5L L;  1QJO A;  2I07 B;  2F0S A;  1X6O A;  4ABN A;  3G48 A;  1NCV A;  2I0Q A;  4ZKC B;  4S3S A;  4B3M L;  3NPP A;  2B29 A;  3CCU A;  4LF8 Q;  2JEB I;  3SVM A;  2EY5 A;  4JI3 Q;  1EY7 A;  2PCF B;  5IYD G;  1WTP A;  2Z4I A;  4MZ9 A;  1Q90 A;  1VQ9 A;  4A4I A;  5C4X B;  1SMX A;  2Y0S B;  1Q8K A;  1E3P A;  1A62 A;  1WTO A;  1FVI A;  4DV6 Q;  2K01 A;  4BY1 H;  4JI4 L;  5DAU A;  4DV3 L;  4ZRZ A;  1OTC A;  1JT8 A;  3S1Q H;  2HDM A;  1HNX L;  3PF5 A;  4BBS G;  4DV7 Q;  3A5Z B;  4XYQ A;  4DA2 A;  2KHJ A;  1B9M A;  5HGT A;  5LMN Q;  2NVQ H;  2TSS A;  2WAQ B;  1ENC A;  3HZX A;  1HXY D;  2F4I A;  1VQ6 A;  3BZC A;  3GTL B;  2CHB D;  3MA2 B;  1SYE A;  1JCK B;  4X6A H;  2WKC A;  3S17 H;  4A3E B;  2ATW A;  1LTG D;  2F0F A;  3Q23 A;  1XNQ Q;  1SXT A;  1B4O A;  1PH8 A;  3JC6 6;  4FVM A;  2E2H B;  3CCL A;  2WAC A;  4CDF C;  2NWG A;  4LUZ A;  3MC0 B;  3W5O A;  1Z9F A;  5TSS A;  4NPS A;  5IP7 H;  2DNE A;  3VA7 A;  2ZXR A;  4GLA C;  4KTA A;  2ZT9 C;  3SGI A;  1NMG A;  3S1N B;  4C3H H;  2VUM B;  1KAW A;  2A68 D;  3CCE A;  2Z0S A;  4OX9 L;  2JSO A;  4PMC A;  2L5T A;  2RA4 A;  4JBM A;  4IJL A;  4JI4 Q;  2F0J A;  1DCZ A;  1LYL A;  3NQI A;  4R9W A;  1I3Q H;  5EPJ A;  1H9S B;  4DV3 Q;  3G7L A;  5EAY A;  5ELD A;  2PYK A;  4P2C B;  2SNM A;  2OF1 A;  4N9T A;  5E1F A;  1HNX Q;  3H6M A;  3NEN A;  1STH A;  2CCZ A;  1BOS A;  2PZW A;  4HAE A;  1VQF A;  3CRL C;  1F2L A;  2VNU D;  3KYH C;  1TY0 A;  4OO1 H;  4DK0 A;  1SMY D;  3Q24 A;  3CRK C;  3PO3 G;  1AH9 A;  1BDO A;  2R7F A;  1GXD C;  3HOZ G;  4P74 A;  2FJ2 A;  2IPK D;  2XRQ D;  4A3K G;  4DV5 L;  3H94 A;  2K75 A;  4DNT B;  3KLW A;  3DMU A;  3J80 L;  1N34 L;  3EQL C;  1YJ9 A;  1VQB A;  4QIW B;  2F0O A;  1ENF A;  1B3Q A;  1MHW C;  3PUZ A;  2G9D A;  4J1M A;  3K5L A;  2RDF A;  1LUZ A;  2ENB A;  4P71 A;  4OO1 I;  5FKA C;  3T53 B;  1LTA D;  1PZJ D;  1G6Z A;  1BBW A;  3FMC A;  4NXN Q;  4J6H A;  3OMC A;  2KEN A;  1YJN A;  3TME A;  2QDL A;  2VS1 A;  1EEF D;  4P72 A;  1D8L A;  2JA5 G;  4ZCK A;  4RGO S;  2UUA L;  4L6T B;  1GD7 A;  1EOT A;  4WOR A;  1CHQ D;  4MNO A;  4RMF A;  2K1B A;  4OX9 Q;  3ND9 A;  5M5X H;  3OIQ A;  4OWT B;  1MI2 A;  3TS0 A;  3RUZ A;  2FMM A;  3K6O A;  1SN8 A;  2PMZ B;  1BCP D;  3L7Z C;  4FF2 A;  4R4T A;  3GTM B;  2L9H A;  2O2L D;  2F3W A;  2XIW A;  4UY8 C;  3PIP 3;  1IL2 A;  3SDZ A;  1E1O A;  2DUD A;  3D6C A;  4JI8 L;  1MJC A;  3VA5 A;  2JA7 G;  3QG1 A;  2QGQ A;  5K36 H;  3U9S A;  5F2D A;  4ZLT F;  2A1A A;  2E2J H;  3RZD H;  4GKJ L;  3P20 A;  3U58 A;  2MJ8 A;  2EE1 A;  4DV5 Q;  1NR4 A;  3E5S A;  1PH7 A;  1S5C D;  4O0A A;  4DV2 L;  1KIX A;  3HS0 C;  2HQL A;  1YHA A;  3ICE A;  1KC8 C;  1X65 A;  1WJJ A;  3HP3 A;  2A6H D;  3FVQ A;  1I6H H;  1IZ6 A;  1JC7 A;  1LTB D;  2EYJ A;  2A73 B;  2NTT A;  2F0D A;  2EVB A;  4XT3 B;  2K6A A;  4A3I H;  1CSP A;  1Y8P B;  1HNW L;  4O1N A;  1S4Z A;  3P75 A;  1EUJ A;  4IUQ A;  4K2L A;  3ER0 A;  1H9M A;  1BXT A;  1TS5 A;  3UDX A;  5C3E G;  1PVO A;  2L55 A;  4JOI A;  1W6K A;  1HQM C;  1HA6 A;  1HHV A;  2UUA Q;  1NUC A;  2FHT A;  4A3B H;  2DY8 A;  1OXT A;  3D3R A;  1TXY A;  1TR5 A;  3PF4 A;  2YU9 B;  5FLM G;  2ES2 A;  4IFD H;  4C2M B;  5E4X A;  4UHV A;  2IWH A;  4LMQ D;  4A76 A;  2UU9 L;  3I4N G;  1MSH A;  1X55 A;  1I94 L;  1GO3 E;  1NR2 A;  2AQ3 B;  4OEM B;  4CHT B;  4KJN A;  1BF4 A;  1HZC A;  4JI8 Q;  1CKN A;  1G29 1;  3W1G A;  4C1N I;  2WB1 B;  4HID A;  2JA8 H;  2BDO A;  3DEP A;  3HRZ C;  1KL9 A;  3HOY G;  1HR0 L;  3J81 c;  2ZTC A;  2A68 C;  4F87 A;  3HOV H;  4GKJ Q;  1T5E A;  1VQ4 A;  3LWE A;  3K5M A;  3QOL A;  4IFD I;  1VQK A;  1B9N A;  3I3C A;  3V05 A;  5M3M G;  4A3L G;  4DV2 Q;  2RSN A;  4MTN A;  1SDF A;  2CH4 W;  2HUG A;  2JA6 G;  1D5X C;  1JWS D;  1KTK A;  1EQR A;  3TP6 A;  5JPM C;  3I4M G;  1IL8 A;  2F0H A;  1EWI A;  1EWH A;  1BUV T;  2XTI A;  1HZ9 A;  3QR8 A;  1F9R A;  1SMY C;  3HFZ B;  3ULP A;  1SND A;  4KD3 A;  4X3S A;  1CKN B;  2F0K A;  1EL0 A;  1HNW Q;  1SAP A;  5CYU A;  1Q8I A;  1IW7 D;  2AWN A;  2MFI A;  1VQE A;  3K7U C;  1Y1V H;  2IW3 A;  1AEX A;  3H15 A;  4ZYS A;  1M90 C;  4JK1 C;  4DR7 L;  3JAM L;  4CKB A;  1AZP A;  3KBX A;  3S15 B;  5C4X H;  1LV9 A;  2KCC A;  1WD0 A;  1K8A C;  1I94 Q;  3HOX B;  2RCN A;  1E2W A;  3ZYY X;  4A3F G;  2K50 A;  2CVR A;  2EYH A;  2B2U C;  2L1B A;  4P73 A;  4C3J B;  1XX8 A;  3HOU G;  2B2U A;  3I90 A;  4IUR A;  2PW7 A;  1IXR A;  1EZ6 A;  3HKS A;  1ICF B;  1ASY A;  5ELO A;  2R93 B;  1J9O A;  3BS1 A;  4BS9 A;  3STB D;  1U4M A;  2XRS D;  1XPU A;  1HTL D;  1BCP C;  3CC7 A;  2XNA C;  1GUW A;  3T16 A;  1EY8 A;  3RLF A;  1D5Z C;  2RDG A;  1SE3 A;  2Z1C A;  1JB3 A;  5FJ8 H;  4A3E H;  1VQ8 A;  5JAV A;  2VB2 X;  2XGT A;  2K28 A;  4HED A;  1FNU A;  1MD2 D;  2JJQ A;  4O42 A;  3A56 A;  1S72 A;  4A93 G;  3E9I A;  3M9B A;  1JJG A;  1FR3 A;  5IWA Q;  4N8X 1;  2NVX B;  2AMC B;  2E2H H;  1SRO A;  3NE5 B;  4HJ8 A;  4LK1 C;  4TSS A;  4B3T L;  1FL0 A;  4LFC Q;  4BXX H;  4MTK A;  2F52 A;  4DR7 Q;  2A6H C;  1VCI A;  4DR3 L;  1BCP B;  4JBJ A;  1PTO D;  2E8G A;  2AWO A;  3Q0A A;  4JI2 L;  2VUM H;  1SLJ A;  5JVG 3;  1M4V A;  4WJ4 A;  4LAA A;  5EGT A;  1WCM G;  5IGE A;  1BNZ A;  4YHH L;  2I5M X;  1NE3 A;  1SNQ A;  5C44 B;  2A69 D;  3CPF A;  1EWC A;  4FXK C;  2B63 B;  1UNS A;  1KLU D;  3FDT A;  4UDU C;  3AFP A;  3OPO A;  4LW1 A;  2GN5 A;  4X3K A;  1PFB A;  1Y1W B;  4MHE A;  1DM0 B;  5DM6 3;  4I7A A;  4IPG A;  3HEJ A;  3OW2 A;  2DJG C;  4AIM A;  4R4I A;  1ESR A;  2JQO A;  4EX5 A;  1YIT A;  1D7Q A;  2AUJ D;  3L0O A;  1S5E D;  4JI1 L;  1DOK A;  2EJF C;  3GP7 A;  1WTQ A;  4R4C A;  4IO9 A;  4HMI A;  2CKZ B;  2VW9 A;  2NN6 H;  4KHZ A;  1OXX K;  3CQZ B;  4ZKB B;  1CFM A;  3D6W A;  3H09 A;  2WIN B;  1EIF A;  4B3T Q;  1K83 B;  3TRE A;  1F77 A;  2AHO B;  3FKI G;  3HKZ B;  2MUY A;  5E4W C;  3UI2 A;  5A35 A;  3A8K E;  3NTI A;  3LNN A;  2QDB A;  3U4V A;  5C4H A;  4AQY L;  1W2B A;  2JEA I;  3D0F A;  4GS3 A;  1ET9 A;  1PDQ A;  5C0X H;  3K57 A;  3I4L A;  2B2Y C;  1BO0 A;  3U9O A;  3CU7 A;  3VYR A;  4JI0 L;  1STN A;  4JI2 Q;  2D2C C;  3DM1 A;  1O7Z A;  3FRP B;  5E7N A;  1TWA B;  2B2Y A;  2EOT A;  2NN6 I;  4BBR B;  4YHH Q;  4GN4 B;  2HIV A;  1IW7 C;  2B2T C;  1WVL A;  1EU4 A;  1IYJ B;  4MIU A;  4R8I A;  5LMU L;  2B2T A;  3WWV A;  5G3L D;  3I55 A;  1ASZ A;  2EDG A;  4YWM A;  1K28 A;  3JAM E;  4GNX A;  4YY3 L;  4DR2 Q;  1VQH A;  1K8M A;  2OQ0 A;  1JE5 A;  5C0X I;  4K5W A;  1BVS A;  3G4S A;  4GLX A;  1VMC A;  1PH6 A;  1PFN A;  1IBL L;  2ASB A;  2AKW B;  1F2Z A;  1MIU A;  1HNZ Q;  4KKS A;  1M1K C;  3KBG A;  1DXM A;  1B7Y B;  4QUC A;  4H13 C;  2NUC A;  1PHJ A;  2HHH Q;  2JE6 I;  2A19 A;  5C3X A;  1Q3L A;  2MPM A;  1JR0 D;  1GUN A;  2WII B;  2RKS A;  2VL6 A;  4BY1 G;  2BE5 C;  3FP9 A;  5DNF A;  1UE5 A;  5GAG C;  4IPC A;  1S5D D;  2EQS A;  5I9O A;  3NBH B;  2EY6 A;  2HDL A;  4YCU A;  4AQY Q;  2UXB L;  3UDF A;  1O7Y A;  1UAP A;  5IE8 A;  2ZM6 L;  5IGF A;  1TWH B;  3DXJ C;  2MO1 A;  3FHW A;  4RA8 A;  3BDC A;  4UPA A;  2DNC A;  3S16 B;  1RF2 D;  1KNA A;  3VR6 A;  4WJ3 M;  4JI0 Q;  1CK1 A;  3KLS A;  4E6I A;  2C5C A;  4ALP A;  3T1H Q;  2E76 C;  2DJF C;  4ZQ3 A;  5C6A A;  4A3J B;  2YU9 H;  1OO9 B;  1EY6 A;  1R4P B;  4C2M H;  1AE3 A;  3KF6 B;  3F2C A;  4K0K L;  5IT9 c;  3S24 A;  5LMU Q;  1B44 D;  4AYB G;  3PO3 B;  1NAP A;  3BJU A;  2IHE A;  1A6X A;  3J81 j;  4YY3 Q;  3OTO L;  3S2D H;  4NKL A;  3HOZ B;  3G6E A;  1X9N A;  1UE1 A;  1PTO C;  2XN9 C;  2GA4 B;  1WTV A;  4H0L C;  4LFA L;  4DV7 L;  3CCJ A;  4A75 A;  4J8Q A;  4RH6 A;  1V43 A;  1PXU A;  2K4K A;  1E1T A;  4DUZ L;  2R92 G;  5IP7 G;  2A69 C;  3L9A X;  3BZD B;  3VYU A;  1WTX A;  3J7A 5;  2PQE A;  1V9P A;  2VQE L;  2G5D A;  4A3G G;  3I72 A;  1FJG Q;  1YZ6 A;  2EY2 A;  4FF4 A;  3LX0 A;  4C3H G;  2EJG C;  2O5I C;  4DF7 A;  4PZ8 A;  2K04 A;  4HJA A;  3K8A A;  4C3I G;  5A2Q L;  5I6Y A;  4R4Q A;  3MXN A;  2NZ1 D;  1IBM L;  1FYC A;  2UXB Q;  1CUK A;  1PTO B;  2UUB L;  2ZM6 Q;  1A2T A;  3GV6 A;  5GAD C;  4ME5 A;  4NMZ A;  2F03 A;  1Y1V B;  4K8J A;  3QO2 A;  4OO1 G;  3EBE A;  1KLG D;  5CC4 A;  3A0J A;  3V2T A;  2QCP X;  3P7J A;  3IFD A;  1ZXT A;  1HTP A;  3S15 H;  5KEE A;  2M00 A;  2B8F A;  4K0K Q;  1E7Z A;  3H3V C;  4DR5 L;  3MXN B;  4XT1 B;  5KYI A;  4RCN A;  3X3N A;  4DAY B;  2K5Q A;  4FDB A;  1FNW A;  4APV A;  3OTO Q;  3HOX H;  2D62 A;  1HZA A;  3OYY A;  4CJ1 B;  2KED A;  3WDN A;  1YNN D;  3TP8 A;  1A3V A;  1TII D;  4LFA Q;  1TS2 A;  4C3J H;  1AE2 A;  1JB7 A;  2KEE A;  1A0I A;  4DUZ Q;  3H91 A;  1VQM A;  4AYB E;  2R93 H;  2Z4H A;  4IPD A;  1RL2 A;  2R7Z G;  2VQE Q;  5CGK A;  1YHB A;  1VQD A;  2B3G A;  4BWG B;  1PYB A;  3H0G G;  1IHZ A;  1NNX A;  5CV6 A;  1DOL A;  1N33 L;  2JK8 A;  3PO2 G;  5COY A;  1LAB A;  1PFM A;  5M5Y B;  5I2X A;  5M3F G;  4XTC S;  4C1N K;  3CKI B;  4JI7 L;  5IYC H;  1IBM Q;  3G71 A;  4HMJ A;  3WOE A;  2UUB Q;  1U0L A;  3TN2 A;  2NVX H;  1SYB A;  4KK7 A;  5EPL A;  2F0E A;  3ERS X;  5CBA E;  3T1Y L;  1FGU A;  1PRT F;  1QUQ A;  1XMO Q;  1LTR D;  2OT2 A;  4OEL B;  4NXN L;  3J81 i;  2QKI C;  2QEX A;  2R7D A;  1PZI D;  2OCE A;  1I50 B;  5K36 G;  1Q1E A;  1IKL A;  2VZA A;  5C3W A;  2SDF A;  1YJW A;  1TWG H;  3UDI A;  5BN4 A;  3SXH A;  3I4N B;  1C9O A;  1LTL A;  1B53 A;  4IOA A;  1YNJ D;  4JW0 A;  2ZJQ A;  4DR5 Q;  3S14 B;  3DM3 A;  3X3M A;  4YCV A;  2RCF A;  5C44 H;  1P16 A;  2B63 H;  1FD7 D;  2B39 A;  1EFI D;  2NVT B;  2OEO A;  4LNQ A;  1UE6 A;  1K8G A;  1Y69 U;  4A3I G;  1STY A;  1Y1W H;  3OOC A;  4A3D B;  2F0P A;  2FXQ A;  2JA6 B;  1XNR L;  1NBW A;  2K14 A;  4ZAI A;  1EQQ A;  4POG A;  1WOC A;  1EZ8 A;  2H1E A;  4IOC A;  3BVZ A;  4V19 0;  3S2H B;  3TZD A;  1N33 Q;  2NVY B;  2BDN A;  4DAV A;  4X66 Q;  4A3B G;  3BDO A;  4DK6 C;  5CMD A;  4H44 C;  4UAI A;  4IFD G;  4JBK A;  3PMF A;  5ELC A;  1GHK A;  3EN2 A;  3ITP A;  4JI7 Q;  2AUK A;  3CQZ H;  2Q8R E;  2K7V A;  2ZTE A;  2PI2 A;  1NTG A;  5IYD H;  1K83 H;  4QGU A;  3T1Y Q;  4I65 A;  1VQG A;  4EQN A;  3GV3 A;  2QEJ C;  4IUT A;  3R8B A;  3HOV G;  5A2Q E;  2N55 A;  1QWY A;  4A3F B;  1QVF A;  1X56 A;  2PNH A;  1X3Q A;  2F0V A;  1W3S A;  1TWA H;  3MXU A;  4BBR H;  1UEA B;  2KCM A;  1GHJ A;  1ZYR D;  2SEB D;  5ELB A;  1ILQ A;  1HA5 A;  1I4X A;  2IJ0 A;  1GM5 A;  1STE A;  2IX0 A;  1FNV A;  1J6Q A;  4POF A;  5KND A;  3F1Z A;  5FLX L;  4GZY C;  3DUZ A;  1XNR Q;  5JEA H;  4EVO A;  1Z47 A;  1F2M A;  3A5U A;  4G7H C;  3NHH A;  4DV4 L;  4PNY A;  2WKD A;  2VXW A;  1EIG A;  2K5V A;  1YNX A;  1SSO A;  4R8N A;  1OXS C;  1D5M C;  4UP7 A;  1SE2 A;  3OW7 A;  1YNN C;  2N78 A;  3Q6S A;  3V96 A;  5CR3 A;  5C4X G;  4QCL A;  2D0O A;  2KOL A;  3PUX A;  4HIO A;  3A54 A;  3C46 A;  3E3X A;  2P5Z X;  2NYZ D;  3AB9 A;  1XJV A;  1QIL A;  2D5D A;  5HGQ A;  1LLR D;  1QG7 A;  4EQO A;  3SHL A;  4JOI C;  3DHQ A;  2B2W C;  1TWH H;  2AQ1 B;  2EYF A;  2PQA A;  3S16 H;  2B2W A;  3KFU A;  1DGS A;  1EEI D;  2IHF A;  2JP1 A;  1LAC A;  4RHS A;  2I5H A;  2J7Z A;  4A3J H;  3ULJ A;  2K03 A;  5I6W A;  4KKU A;  5FJ8 G;  3MFG A;  4TVA B;  4L8J A;  3PO3 H;  1YEZ A;  2BH8 A;  3I2Z A;  5ELN A;  3S2D B;  2EYM A;  1VQL A;  1C0A A;  1WTW A;  5I9P A;  3HOZ H;  2NZH A;  1H9J A;  1NY4 A;  1YNJ C;  1HH2 P;  4DV4 Q;  5M9O A;  2F0I A;  2IY5 B;  1K73 C;  1WI5 A;  4OIK A;  5J22 A;  2V1C C;  4H7B A;  5COR A;  2Q2I A;  1YI2 A;  2UXC Q;  1E2V A;  2X69 A;  1RHP A;  1D1K A;  3DEO A;  3AYH B;  1EY4 A;  1DOM A;  1U4R A;  2CWP A;  2VUM G;  4CDD C;  5IYB H;  3W3A A;  1CM9 A;  4K6D A;  2CQO A;  4IUN A;  3K0X A;  2E75 C;  2J0T D;  3MVV A;  3NP8 A;  4BY7 B;  1JOO A;  3CHB D;  3OHX C;  1R9T B;  2HIX A;  3A74 A;  1E24 A;  1PTO H;  5IWA L;  4BA1 I;  3W1B A;  3HOW B;  5IP9 G;  1C4Q A;  4FO2 A;  1A15 A;  4DAM A;  1JMC A;  1D6E C;  2WP8 J;  3OWF A;  2LFN A;  4LFC L;  4G4K A;  3EFX D;  3A7A B;  2ZJR A;  3GDE A;  3MEF A;  3J80 i;  2K32 A;  1CA5 A;  3RLO A;  5CV5 A;  4EQ5 A;  2BH2 A;  5GAE C;  1Y14 B;  1YVC A;  3IL8 A;  1SBB B;  1N36 L;  3NTH A;  4JC0 A;  4OON A;  3BDL A;  4K14 A;  3VR2 A;  2SNS A;  2OWO A;  2NN6 G;  5JJL A;  3VYT A;  4X65 L;  4LF7 Q;  1O7I A;  4OGQ C;  2M9V A;  3D31 A;  4CJ2 C;  1XPR A;  4KI0 A;  4DUY L;  3BVM A;  4GN3 B;  4DXF A;  3L3O C;  2X6L A;  1ZYR C;  3CC2 A;  3CD6 A;  4MN3 A;  2F0T A;  1HPC A;  2BE5 D;  2L12 A;  3R2T A;  3QWN A;  3QJY A;  1A3U A;  5C0X G;  3PUY A;  3ZJY C;  3RZO B;  5FLX E;  2F0W A;  4I7Z C;  1EYD A;  1F9P A;  4RKB A;  3A55 A;  3CW2 C;  3H3V H;  5I2Y A;  2RHQ B;  5M5Y H;  5JVH 3;  1VF5 C;  2RDH A;  3QB3 A;  4X3U A;  1N32 Q;  3E6Z X;  1SJE D;  2CH4 A;  5JEA J;  1MSG A;  5AFW A;  2A8V A;  2JYO A;  4KJO A;  4XDX A;  2F0U A;  2XWB B;  5CV7 A;  2KHS A;  2C9O A;  2ZTD A;  1I50 H;  4KN4 C;  1C8C A;  1TWG B;  2B8G A;  4IN3 A;  3T51 B;  3I4N H;  4PV1 C;  4JVZ A;  4JI6 L;  3TZU A;  2MQH A;  3S14 H;  2EY1 A;  4QY7 A;  1N36 Q;  1RTO A;  3NSW A;  4KD4 A;  2NVT H;  4FF3 A;  1STA A;  4X65 Q;  2EPB A;  5GAH C;  4LF5 L;  3GTQ H;  4A3L H;  1OXU A;  4DR2 L;  4DUY Q;  1SFO B;  4A3G B;  1VDZ A;  1G8Z D;  1XMQ Q;  4A3D H;  5LHY 1;  2JA6 H;  3K81 C;  2NZO A;  3PIO A;  3B6Y A;  5I4D A;  1BKB A;  2UXD L;  1HNZ L;  3SK4 A;  1V1O A;  4HSP A;  5EKI A;  4C3I B;  4YCW A;  3S2H H;  2NVY H;  2EXD A;  3CCQ A;  1PZK D;  4JG2 A;  4CJ0 B;  4IFD J;  5IIF A;  2TMP A;  2HHH L;  2SOB A;  1UWV A;  3I56 A;  2X6G A;  1GKH A;  2BCO A;  2PI2 E;  3IFT A;  1OXV A;  3F8T A;  3UE1 A;  1O7L A;  4RHR A;  1XWE A;  2KVM A;  5H1S E;  3S1M B;  5BN5 A;  4AH6 A;  4R4O A;  1VF7 A;  1KDB A;  1HRJ A;  4PG3 A;  3CCM A;  1F9S A;  3SK6 A;  3MAQ A;  2PZT A;  4XQN A;  4NXM L;  1V1Q A;  1CSQ A;  2DY7 A;  2WB1 G;  3CCV A;  3E0J A;  1STB A;  3BYT B;  2K5H A;  4KMU C;  1PH4 A;  3EJI A;  2Q2U A;  4HJ9 A;  1DZ1 A;  5JJK A;  4G7Z C;  1S40 A;  4KV6 A;  5DLQ E;  4JI6 Q;  1XTC D;  3AU7 A;  2J4X A;  5FO9 B;  4A3F H;  4XYO A;  1LT5 D;  1CHP D;  4YWL A;  2Q8I B;  4QUF A;  1PH1 A;  1QCB D;  1VQ7 A;  3T1H L;  3U4Z A;  5BR8 L;  1MJE A;  1JIC A;  2VY3 A;  4FNF A;  1M8A A;  4BBS B;  1I5F A;  3J7Y W;  1PMR A;  4GNX C;  1U4P A;  4KHP L;  4B08 A;  1A63 A;  1BQQ T;  1PH5 A;  2R7Z B;  1LTS D;  4LF5 Q;  2C35 B;  5K5P A;  3ONA B;  2I5L X;  1ZKO A;  3BYY B;  4A3M G;  3H0G B;  1AW7 A;  4IUV A;  2PPB C;  3DWA A;  1LT3 D;  3PO2 B;  3GTJ B;  4IZ8 A;  3M7G A;  1CTM A;  1G2S A;  2UXD Q;  4F8M A;  3PUV A;  4RGT A;  4CBV A;  3CPW A;  3J80 c;  5M3F B;  4CDE C;  4WJW A;  4DU9 A;  2CFM A;  1GJX A;  1ONL A;  1FJG L;  3FEW X;  3MXG A;  2HCC A;  1T5X D;  4GNX B;  4GKK Q;  2UUC L;  5L37 A;  3GTK B;  3HOX G;  1U5K A;  4WRD A;  1EIH A;  1SYF A;  4H02 A;  4KLK A;  4NXM Q;  3J81 L;  4OIJ A;  4C3J G;  2PZU A;  1V1P A;  3FPP A;  4JBW A;  5DEH A;  4OWW B;  1Y8N B;  1UUP A;  2CW0 C;  1VQA A;  2F4V Q;  2R93 G;  3RLN A;  4RKL A;  4ODG A;  3C2P A;  5BR8 Q;  3I73 A;  1S5F D;  2F0G A;  3TEH B;  3VDY A;  2WB1 E;  1Q1B A;  4KHP Q;  3S1R B;  4CGY B;  2YTV A;  4Z9C B;  4L5T A;  4M1U B;  3F2U A;  1Q7Y C;  1D2B A;  2EYP A;  5IYC G;  4KHV A;  4LUO A;  3P1H A;  4IUP A;  4A3K B;  2N88 A;  2F0M A;  1D1I A;  1F9Q A;  5CBE E;  4NW2 A;  2RVL A;  5GQO A;  2IX1 A;  1SYG A;  1RJT A;  2IX3 A;  2MHV A;  3N6R A;  4QQB X;  4QF4 A;  2E2I B;  2FFK B;  1ZEQ X;  1L1O A;  4B3R L;  3NWT A;  2UUC Q;  2RF4 A;  3T13 A;  2Q2T A;  3K7A B;  5C44 G;  1VQO A;  3M3Y B;  2LKV A;  4FF1 A;  3RR5 A;  2B63 G;  4PZ7 A;  4BY7 H;  2JA5 B;  1R9T H;  2CQA A;  2R6G A;  1Q46 A;  1TU2 B;  3KDF A;  5FOB B;  3ND8 A;  3HOW H;  5AJ3 L;  5C4J B;  1BCP F;  1TS4 A;  1K8O A;  1KRT A;  3LWU A;  1XMO L;  2LSS A;  4ME3 A;  3E9H A;  5EBD A;  3R93 A;  5KGU A;  5CV8 A;  3C1E A;  4OL7 A;  5C4Z A;  1ICW A;  2YV5 A;  3RMH A;  1Q82 C;  1EYA A;  1C7Y A;  2K5N A;  2BA1 A;  4DAP A;  2JA7 B;  3I7F A;  4C56 C;  3KDF B;  1A8V A;  4IPH A;  3J7A V;  3GTO B;  3BU2 A;  1BR9 A;  4UP8 A;  3HKZ G;  5FK9 C;  1X3G A;  4K2K A;  1G6P A;  2OXP A;  5C0X J;  1VQP A;  2K5D A;  1TKW B;  2RSO A;  3CP0 A;  1K0S A;  1MKH A;  4P75 A;  4GOP C;  3RZO H;  2RHS B;  3TSS A;  4X66 L;  4B3R Q;  1WFQ A;  3CF5 A;  1UEB A;  2JN4 A;  5EKL A;  4BBR G;  4YWK A;  4GOP A;  2XVS A;  3OWE B;  3R2I A;  2E74 C;  3BZK A;  1UE7 A;  5EKK A;  1X3E A;  1HFN A;  5C3E B;  1XPO A;  3SK8 A;  1YIJ A;  4F88 A;  4XXE A;  3NUC A;  3M7N A;  1W6J A;  2DGY A;  1KHI A;  5AJ3 Q;  3TP7 A;  3JAM c;  3GD7 A;  5JEA G;  1HR0 W;  1KDA A;  2N8N A;  5J1Z A;  1E2Z A;  1HQR D;  1ENA A;  4ID6 A;  2OTJ A;  5LL6 X;  1PYW D;  1J5E L;  4RAU C;  5J39 A;  3MHB A;  4GOP B;  1LT6 D;  4OWX B;  4Q5V A;  3J81 E;  2E5L Q;  3HOY B;  3SEB A;  1H9S A;  2KHI A;  2LS0 1;  1XTD A;  2LMC B;  1RD9 D;  5KNC A;  4LUV A;  1ML0 D;  1EOV A;  4KY7 A;  4B3M Q;  2R92 H;  5IOD A;  1L0X B;  2R61 A;  1CZG A;  1P8L A;  2ALY B;  1QUQ B;  5IGB A;  4FXD A;  5HUR A;  5M3M B;  3GTQ B;  3A7L A;  4R1J A;  4A3C H;  1SFO H;  4ZUJ A;  4A3G H;  2A74 C;  1PH2 A;  1KDC A;  2EYL A;  3KJO A;  2EZV A;  2A5H A;  4PMB A;  2MNA A;  3I4M B;  4JCV E;  3NQT A;  3F2D A;  5FO7 B;  1TWC B;  4HIK A;  3K59 A;  4C3I H;  3TP5 A;  3N52 A;  5ELF A;  2KEC A;  4OXP A;  3W2D A;  4LF4 L;  1TS3 A;  3SE0 A;  5D14 A;  4DFA A;  2YYZ A;  3KUP A;  1Y8O B;  3HKZ E;  4GLV B;  4A3J G;  1VQ5 A;  3GTP B;  1S5B D;  3AFQ A;  1SE4 A;  2PO4 A;  5D3D A;  2FMC A;  2Z9H A;  3S1M H;  3FPU B;  4HTH A;  5JOB A;  4B9W A;  3TDQ A;  2GVB A;  1I4R A;  3E0E A;  1SNC A;  3CAM A;  1VQJ A;  3O13 A;  2JA8 G;  2F3I A;  2EXZ A;  4IJH A;  1SNP A;  2RBM A;  1J5E Q;  1ILP A;  2O5J C;  3RD4 A;  3AQQ A;  5EJW A;  4LF6 L;  1I4P A;  2QW7 A;  1VQC A;  5CV4 A;  1RTN A;  2ZXP A;  1EQT A;  1EY9 A;  5JJI A;  2GVA A;  2HCI A;  4BBS H;  1I4H A;  3HOU B;  5C5M A;  3CXC A;  3KOJ A;  4FXG C;  1IBK L;  1I6V C;  4JPB W;  2Q8T A;  5IYB G;  4DR1 L;  1PV4 A;  1GUG A;  1N9W A;  2LY7 A;  1Q86 C;  5D3I B;  4QL5 A;  2R7Z H;  1MBY A;  2Q2H A;  1AZQ A;  3A8J E;  2NTS A;  2Z6B A;  3H0G H;  2Z6K C;  1JOR A;  5KNB A;  4DR6 L;  3RNU A;  1LT4 D;  3PO2 H;  5C5L A;  3GTJ H;  4BA2 I;  1Y1V G;  2HT1 A;  3VR3 A;  3C3L A;  2Z6K A;  4K5X A;  4YIJ A;  5NUC A;  3M4O B;  4Y52 H;  1F2Y A;  5M3F H;  1LTI D;  2PW5 A;  4LF4 Q;  1I4G A;  5ELE A;  1GUT A;  4A93 B;  2UXC L;  1TWF B;  4K6L A;  5IGG A;  5IT9 L;  1PA6 A;  5M5W B;  4Y7N B;  2Y0S G;  2MO0 A;  4ILW A;  4DV1 L;  1PTO F;  2H5X A;  1KXL A;  1KD1 C;  3GTK H;  3NXW A;  2BA0 A;  3DWQ A;  1K3B C;  3T56 B;  1EU3 A;  4X62 L;  1EY5 A;  1WCM B;  5KRU A;  1N34 Q;  1U4L A;  3RN5 A;  3D8G A;  3NBI A;  3URY A;  5ISR A;  1Q12 A;  3KF8 A;  4LF6 Q;  2L0C A;  1CKM A;  1PYS B;  2WAQ G;  1JOK A;  1MGS A;  4KN7 C;  1B50 A;  1XYI A;  4IUU A;  1WTR A;  4NP5 A;  1HJP A;  2RQX A;  1IBK Q;  3S1R H;  3NTK A;  4DR1 Q;  4A3E G;  2OQK A;  1YBY A;  4DXG A;  3AMU A;  3CMA A;  4ZK9 B;  2V4D A;  1NMF A;  4GN5 A;  1GOZ A;  4F7X A;  4DN4 M;  3D4D A;  4L63 B;  2PQA B;  4KY6 A;  3GO5 A;  4DR6 Q;  4LF7 L;  1SR3 A;  4A3K H;  1X54 A;  1QVG A;  1EFW A;  4J15 A;  4JI5 L;  3KF8 B;  2KQ3 A;  1QE6 A;  2AQ2 B;  3HG9 A;  4BXX G;  5LL6 S;  1EYG A;  2KCT A;  4DNR B;  4HCS A;  1PRT D;  1KRS A;  1G51 A;  1K3R A;  2Z8L A;  2A6E D;  2E2I H;  4LFB L;  3FKI B;  1TT2 A;  3M85 A;  1JJ2 A;  4U68 A;  4DV1 Q;  3GTG B;  3K7A H;  2KCN A;  3M3Y H;  2LXJ A;  4JV5 L;  2WFW A;  4K5V A;  1R4Q B;  3PIP A;  4UP9 A;  2JA5 H;  3TS2 A;  1DON A;  3K80 C;  1N32 L;  2ID0 A;  3A8I E;  1GUO A;  4IAL A;  4X62 Q;  1RDP D;  3I91 A;  4X3T A;  4DK1 A;  3UDG A;  5C4J H;  4A3D G;  2EIF A;  2Y0S E;  5G3L F;  3EVQ A;  4WFN 3;  1B2T A;  5JPN C;  1TY2 A;  5J3B A;  4HJ5 A;  4KY5 A;  3UE0 A;  1G2T A;  3CCR A;  5T1I A;  1KAB A;  1PLF A;  4QMG A;  3GQB A;  3K5O A;  4A3M B;  4HCE A;  2ZXO A;  3PSI A;  1JJC B;  1VQN A;  5IY0 A;  2QF7 A;  2JA7 H;  2IT1 A;  1L2F A;  2EYO A;  4NDX A;  3G6J B;  3J80 E;  2WAQ E;  3GTO H;  2G9H D;  3VYS A;  4JI5 Q;  1VS0 A;  3PIO 3;  4DR4 L;  1JWM D;  1XMQ L;  4DK3 C;  2L4N A;  2O4X A;  4L5S A;  1O78 A;  2UU9 Q;  2DN8 A;  3MXP A;  1SRU A;  1X3F A;  4BY1 B;  1WD1 A;  3BVG A;  4LFB Q;  3S1Q B;  1H9K A;  5IOC A;  2XWJ B;  2CW0 D;  1E0B A;  1HR0 Q;  4JV5 Q;  1PH9 A;  2OTL A;  5EQ0 A;  4RGM A;  5C3E H;  1GVP A;  3BG3 A;  2NVQ B;  1EIY B;  4TRD A;  3QIA A;  2L15 A;  1XXG A;  4RG1 A;  3PV0 A;  3GTL H;  1EYC A;  5FLM H;  5IT9 E;  5BN3 A;  2KBN A;  3S17 B;  2MGS A;  4HIM A;  1TVX A;  3MTS A;  4AYB B;  4DV0 L;  5LMN W;  3H3V I;  4L5R C;  3EA6 A;  2MP1 A;  3ERQ A;  1Z6H A;  2BOS A;  3WOF A;  2N49 A;  2FIN B;  2K5W A;  2PNR C;  3VR5 A;  3IAY A;  1AP0 A;  3OIP A;  3HOY H;  4CDC C;  4LWC A;  4TQU S;  4DNI A;  4RCO A;  5KIX A;  1E22 A;  3R3O A;  4RWS C;  2R92 B;  3C1F A;  3NK9 A;  4K8I A;  1J8I A;  2H4O A;  4TKO B;  5M3M H;  3EIV A;  4DR4 Q;  4G57 A;  4KKT A;  3SK5 A;  1NJI C;  2K33 A;  3S1N H;  1SE8 A;  4ZUI A;  4C3H B;  3I4M H;  1DYQ A;  1BBX C;  2K52 A;  3D4W A;  4QIW E;  1SNO A;  1TWC H;  3HGB A;  1QOH A;  5HY6 A;  1I3Q B;  3MWY W;  1U9R A;  3TQY A;  1GUS A;  1HCZ A;  1VQI A;  2KJX A;  3DLL A;  3M4P A;  3DWP A;  5IP9 H;  2M2L A;  4NB3 A;  5EPK A;  1PH3 A;  3GTP H;  2R3Z A;  3TRZ A;  3MEH A;  3CCS A;  4GKK L;  1YHQ A;  1PFS A;  2ZJP A;  2JXM B;  3VR4 A;  5JJZ A;  2D0P A;  3Q22 A;  1K9M C;  1PRT C;  4ULL A;  4DPG A;  2YTY A;  3KK7 A;  5D65 A;  2A6E C;  5IGD A;  2VQF L;  1AFP A;  1JOQ A;  4DV0 Q;  4Q0F A;  3RN2 A;  2PMZ E;  2F4V L;  3J7A F;  1L0Y B;  3D4R A;  3NWS A;  3F2B A;  5E3F A;  3KLS X;  2ICI A;  3AEV A;  3U50 C;  2YTX A;  3L2P A;  3HOU H;  1HFG A;  1CQF A;  1II3 A;  2EJM A;  2JA9 A;  4PZ6 A;  2D9U A;  4OHJ A;  1I4Q A;  3LGJ A;  3I4O A;  1HZB A;  1O80 A;  1BBU A;  5FO8 B;  4EGV A;  4HR7 B;  1T9H A;  4DR3 Q;  4X64 L;  1SEB D;  4QB4 A;  1CI3 M;  1HUM A;  4BY7 G;  4V0B A;  1PRT B;  1X32 A;  4CKC A;  2F0Q A;  1SJH D;  3Q8D A;  5DM7 3;  1KQS A;  1CQV A;  3HOW G;  4EQP A;  1G91 A;  3JAM i;  3PGZ A;  1Z7T A;  1H9R A;  5M5X B;  3M4O H;  4RFB A;  3NEM A;  1JQY D;  1N8R C;  1CZW A;  1QZH A;  2L11 A;  3IRB A;  2VB3 X;  4JYA L;  2HD3 A;  4A93 H;  3TBI B;  1WTH A;  3GTM H;  2I46 A;  4DKA C;  1TWF H;  1RCV D;  1HUN A;  1IYU A;  4PQX A;  5M5W H;  1TQO A;  3PCO B;  3K5N A;  4Y7N H;  4LF9 L;  1ET6 A;  2NBF A;  4G7O C;  1QVC A;  3NBH A;  4FYD A;  1RIP A;  2F0L A;  3T4A C;  4B3S L;  3S9W A;  3MZ5 A;  1SNM A;  3RZD B;  2E2J B;  2LXK A;  3J7Z C;  1LTT D;  3CC4 A;  4PMW A;  1QNK A;  4JI1 Q;  1V8Q A;  2QIL A;  3I70 A;  3OMG A;  2VQF Q;  1WCM H;  1A2U A;  2N3S A;  1QB5 D;  2E2D C;  3SR1 A;  1I6H B;  4M8A A;  1K0R A;  3IKJ A;  3I8Z A;  1WYD A;  4XQJ A;  3KLR A;  1LM0 A;  1ESF A;  3KF6 A;  3STB C;  1C48 A;  3NEL A;  3ERO A;  1QNU A;  2ICE C;  5IGC A;  4A3I B;  1STG A;  1S3O A;  4HN7 A;  3ULL A;  5FLX c;  3QOJ A;  1CA6 A;  1Q81 C;  4XQQ A;  3PUW A;  4X64 Q;  1SYD A;  3MFY A;  1RKN A;  1H95 A;  1B8A A;  1NSN S;  1V1P B;  5T1G A;  1B1Z A;  1L0W A;  2WV6 D;  4A3B B;  4LF8 L;  4RGN A;  4U67 3;  2IL8 A;  4JI3 L;  4LJZ C;  1CT1 D;  4CKE A;  2K05 A;  2F0N A;  1DJR D;  5EBC A;  2F1M A;  1SYC A;  4DGZ A;  4JYA Q;  1ROD A;  1L1O C;  2HQE A;  4DV6 L;  2XSC A;  1QZG A;  1B70 B;  3M4Y A;  5CV9 A;  1LO5 D;  1B3A A;  3FKI H;  4LF9 Q;  1AN8 A;  4O2D A;  1IBL Q;  2JA8 B;  3GTG H;  1VMP A;  4N8F A;  2B2V C;  3CME A;  1IKM A;  4B3S Q;  3HOV B;  2KUM A;  3M4Q A;  5KYL A;  4HJ7 A;  5LMN L;  1KAA A;  4XIG S;  1DD2 A;  4HSV A;  1EY0 A;  2B2V A;  1KNE A;  3PQI A;  1X3P A;  2QA4 A;  3KJP A;  4A3C G;  1Y1W G;  4FP5 D;  2KA7 A;  4B9X A;  5GRO A;  3OSO A;  2CWA A;  1JWU D;  1CKO A; 
#chains in the Genus database with same CATH homology
 4IQZ A;  2NB0 A;  1A3T A;  4N9P A;  2F3V A;  3K58 A;  3K0Y A;  1JE4 A;  1IYV A;  4DAY A;  1EQV A;  1FGB D;  1QJO A;  2I07 B;  2F0S A;  4ABN A;  1NCV A;  4ZKC B;  4S3S A;  3NPP A;  2JEB I;  3SVM A;  2EY5 A;  1EY7 A;  2PCF B;  1WTP A;  2Z4I A;  1Q90 A;  5C4X B;  2Y0S B;  1WTO A;  2K01 A;  5DAU A;  4ZRZ A;  2HDM A;  4XYQ A;  4DA2 A;  1B9M A;  5HGT A;  2TSS A;  2WAQ B;  1ENC A;  3HZX A;  1HXY D;  2F4I A;  3GTL B;  2CHB D;  3MA2 B;  1SYE A;  1JCK B;  2WKC A;  4A3E B;  1LTG D;  2F0F A;  3Q23 A;  1SXT A;  1B4O A;  4FVM A;  2E2H B;  2WAC A;  2NWG A;  3MC0 B;  5TSS A;  2DNE A;  3VA7 A;  2ZXR A;  4KTA A;  2ZT9 C;  3S1N B;  2VUM B;  2A68 D;  2JSO A;  4PMC A;  2L5T A;  2RA4 A;  2F0J A;  1DCZ A;  3NQI A;  4R9W A;  5EPJ A;  1H9S B;  3G7L A;  5ELD A;  2PYK A;  4P2C B;  2SNM A;  2OF1 A;  4N9T A;  5E1F A;  3H6M A;  1STH A;  1BOS A;  2PZW A;  4HAE A;  3CRL C;  1F2L A;  2VNU D;  1TY0 A;  4OO1 H;  4DK0 A;  1SMY D;  3Q24 A;  3CRK C;  1BDO A;  1GXD C;  2FJ2 A;  2IPK D;  2XRQ D;  3H94 A;  4DNT B;  3DMU A;  3J80 L;  3EQL C;  4QIW B;  2F0O A;  1ENF A;  3PUZ A;  2G9D A;  4J1M A;  3K5L A;  2RDF A;  2ENB A;  4OO1 I;  5FKA C;  3T53 B;  1LTA D;  1PZJ D;  1G6Z A;  3FMC A;  4J6H A;  3OMC A;  3TME A;  1EEF D;  4RGO S;  4L6T B;  4WOR A;  1EOT A;  1CHQ D;  2K1B A;  3ND9 A;  3OIQ A;  1MI2 A;  3RUZ A;  2FMM A;  3K6O A;  2PMZ B;  1BCP D;  3L7Z C;  4FF2 A;  3GTM B;  2L9H A;  2O2L D;  2F3W A;  2XIW A;  3PIP 3;  3SDZ A;  3D6C A;  3VA5 A;  3QG1 A;  5K36 H;  3U9S A;  5F2D A;  4ZLT F;  3P20 A;  2MJ8 A;  2EE1 A;  1NR4 A;  3E5S A;  1S5C D;  3HS0 C;  3HP3 A;  2A6H D;  3FVQ A;  1JC7 A;  1LTB D;  2EYJ A;  2A73 B;  2NTT A;  2F0D A;  2EVB A;  4XT3 B;  2K6A A;  1Y8P B;  4O1N A;  1S4Z A;  3P75 A;  4IUQ A;  4K2L A;  1H9M A;  1BXT A;  1TS5 A;  2L55 A;  1W6K A;  1HQM C;  1HA6 A;  1HHV A;  1NUC A;  2FHT A;  2DY8 A;  1OXT A;  3D3R A;  1TR5 A;  2YU9 B;  4IFD H;  4C2M B;  5E4X A;  2IWH A;  4LMQ D;  1MSH A;  1NR2 A;  2AQ3 B;  4CHT B;  4KJN A;  1BF4 A;  1G29 1;  4C1N I;  2WB1 B;  2BDO A;  3DEP A;  3HRZ C;  2A68 C;  4F87 A;  1T5E A;  3LWE A;  3K5M A;  3QOL A;  4IFD I;  1B9N A;  3I3C A;  3V05 A;  2RSN A;  1SDF A;  2HUG A;  1D5X C;  1JWS D;  1KTK A;  3TP6 A;  5JPM C;  1IL8 A;  2F0H A;  1EWH A;  1BUV T;  1F9R A;  1SMY C;  1SND A;  4KD3 A;  4X3S A;  2F0K A;  1EL0 A;  1SAP A;  5CYU A;  1Q8I A;  1IW7 D;  2AWN A;  2IW3 A;  1AEX A;  4ZYS A;  4JK1 C;  3JAM L;  4CKB A;  1AZP A;  3KBX A;  3S15 B;  1LV9 A;  2KCC A;  1WD0 A;  3HOX B;  1E2W A;  3ZYY X;  2CVR A;  2EYH A;  2B2U C;  2L1B A;  4C3J B;  1XX8 A;  2B2U A;  3I90 A;  4IUR A;  2PW7 A;  1EZ6 A;  2R93 B;  1J9O A;  3BS1 A;  4BS9 A;  1U4M A;  2XRS D;  1HTL D;  1BCP C;  2XNA C;  1GUW A;  3T16 A;  1EY8 A;  3RLF A;  1D5Z C;  2RDG A;  1SE3 A;  2Z1C A;  1JB3 A;  5JAV A;  2VB2 X;  2K28 A;  4HED A;  1FNU A;  1MD2 D;  4O42 A;  3A56 A;  1FR3 A;  2NVX B;  3NE5 B;  4LK1 C;  4TSS A;  2A6H C;  1VCI A;  1BCP B;  1PTO D;  2AWO A;  3Q0A A;  5JVG 3;  1M4V A;  4LAA A;  5EGT A;  5IGE A;  1BNZ A;  1SNQ A;  5C44 B;  2A69 D;  4FXK C;  1EWC A;  2B63 B;  1UNS A;  1KLU D;  3FDT A;  4UDU C;  3OPO A;  4X3K A;  1PFB A;  1Y1W B;  4MHE A;  1DM0 B;  5DM6 3;  3HEJ A;  1ESR A;  2AUJ D;  1S5E D;  1DOK A;  2EJF C;  3GP7 A;  1WTQ A;  4HMI A;  2NN6 H;  4KHZ A;  1OXX K;  3CQZ B;  4ZKB B;  1CFM A;  3D6W A;  3H09 A;  2WIN B;  1K83 B;  1F77 A;  3HKZ B;  2MUY A;  3UI2 A;  5A35 A;  5E4W C;  3A8K E;  3NTI A;  3LNN A;  2QDB A;  5C4H A;  2JEA I;  1ET9 A;  1PDQ A;  5C0X H;  3K57 A;  3I4L A;  2B2Y C;  1BO0 A;  3U9O A;  3CU7 A;  3VYR A;  1STN A;  2D2C C;  3DM1 A;  1O7Z A;  3FRP B;  1TWA B;  2B2Y A;  2EOT A;  2NN6 I;  4BBR B;  1IW7 C;  2B2T C;  1WVL A;  1EU4 A;  4MIU A;  4R8I A;  2B2T A;  5G3L D;  2EDG A;  3JAM E;  1K8M A;  5C0X I;  4K5W A;  1VMC A;  1PFN A;  1F2Z A;  4KKS A;  3KBG A;  1DXM A;  4QUC A;  4H13 C;  2NUC A;  2JE6 I;  5C3X A;  1Q3L A;  2MPM A;  1JR0 D;  1GUN A;  2WII B;  2RKS A;  2BE5 C;  5DNF A;  1S5D D;  5I9O A;  2EY6 A;  2HDL A;  1O7Y A;  1UAP A;  5IGF A;  1TWH B;  3DXJ C;  4RA8 A;  3BDC A;  2DNC A;  3S16 B;  1RF2 D;  1KNA A;  3VR6 A;  1CK1 A;  3KLS A;  4E6I A;  2C5C A;  2E76 C;  4ZQ3 A;  5C6A A;  4A3J B;  1OO9 B;  1EY6 A;  1R4P B;  1B44 D;  3PO3 B;  1NAP A;  1A6X A;  4NKL A;  3HOZ B;  1PTO C;  2XN9 C;  2GA4 B;  1WTV A;  4H0L C;  4J8Q A;  4RH6 A;  1V43 A;  1PXU A;  2A69 C;  3L9A X;  3BZD B;  3VYU A;  1WTX A;  2PQE A;  3I72 A;  2EY2 A;  4FF4 A;  3LX0 A;  4C3H G;  2EJG C;  2O5I C;  4DF7 A;  2K04 A;  4C3I G;  5A2Q L;  5I6Y A;  3MXN A;  2NZ1 D;  1FYC A;  1PTO B;  1A2T A;  3GV6 A;  4ME5 A;  4NMZ A;  2F03 A;  1Y1V B;  4K8J A;  3QO2 A;  4OO1 G;  1KLG D;  5CC4 A;  3V2T A;  2QCP X;  3P7J A;  3IFD A;  1ZXT A;  1HTP A;  5KEE A;  2M00 A;  2B8F A;  3H3V C;  4XT1 B;  5KYI A;  4RCN A;  3X3N A;  2K5Q A;  1FNW A;  2D62 A;  4CJ1 B;  2KED A;  3WDN A;  1YNN D;  3TP8 A;  1A3V A;  1TII D;  1TS2 A;  2KEE A;  3H91 A;  2Z4H A;  5CGK A;  4BWG B;  5CV6 A;  1IHZ A;  1DOL A;  5COY A;  1LAB A;  1PFM A;  5M5Y B;  5I2X A;  4XTC S;  4C1N K;  3CKI B;  4HMJ A;  3WOE A;  3TN2 A;  1SYB A;  4KK7 A;  5EPL A;  2F0E A;  5CBA E;  1PRT F;  1LTR D;  2OT2 A;  2QKI C;  1PZI D;  5K36 G;  1I50 B;  1Q1E A;  1IKL A;  5C3W A;  2SDF A;  5BN4 A;  3SXH A;  3I4N B;  1B53 A;  1YNJ D;  3S14 B;  3X3M A;  1FD7 D;  2B39 A;  1EFI D;  2NVT B;  2OEO A;  1Y69 U;  1STY A;  4A3D B;  3OOC A;  2F0P A;  2JA6 B;  4ZAI A;  1EZ8 A;  2H1E A;  3BVZ A;  4V19 0;  3S2H B;  3TZD A;  2NVY B;  2BDN A;  4DAV A;  3BDO A;  5CMD A;  4H44 C;  4UAI A;  4IFD G;  3PMF A;  5ELC A;  1GHK A;  3ITP A;  2AUK A;  2Q8R E;  2K7V A;  4I65 A;  4EQN A;  3GV3 A;  2QEJ C;  4IUT A;  3R8B A;  5A2Q E;  2N55 A;  1QWY A;  4A3F B;  1X3Q A;  2F0V A;  3MXU A;  1UEA B;  1GHJ A;  1ZYR D;  2SEB D;  5ELB A;  1ILQ A;  1HA5 A;  1I4X A;  2IJ0 A;  1STE A;  2IX0 A;  1FNV A;  5KND A;  5FLX L;  4GZY C;  3DUZ A;  5JEA H;  4EVO A;  1Z47 A;  1F2M A;  4G7H C;  3NHH A;  4PNY A;  2WKD A;  2VXW A;  1EIG A;  1SSO A;  4R8N A;  1OXS C;  1D5M C;  1SE2 A;  3OW7 A;  1YNN C;  3Q6S A;  3V96 A;  5CR3 A;  4QCL A;  2KOL A;  3PUX A;  3A54 A;  3C46 A;  2NYZ D;  3AB9 A;  1QIL A;  2D5D A;  1LLR D;  1QG7 A;  4EQO A;  3SHL A;  3DHQ A;  2B2W C;  2AQ1 B;  2EYF A;  2B2W A;  1EEI D;  2JP1 A;  1LAC A;  4RHS A;  2J7Z A;  2K03 A;  5I6W A;  4KKU A;  3MFG A;  4L8J A;  3S2D B;  2EYM A;  1WTW A;  5I9P A;  1H9J A;  1YNJ C;  5M9O A;  2F0I A;  4OIK A;  5J22 A;  4H7B A;  5COR A;  1E2V A;  2X69 A;  1RHP A;  1D1K A;  3DEO A;  1EY4 A;  1DOM A;  1U4R A;  3W3A A;  1CM9 A;  4K6D A;  4IUN A;  2E75 C;  2J0T D;  3MVV A;  3NP8 A;  4BY7 B;  1JOO A;  3CHB D;  3OHX C;  1R9T B;  1PTO H;  4BA1 I;  3HOW B;  1C4Q A;  4FO2 A;  1A15 A;  1D6E C;  2WP8 J;  3OWF A;  2LFN A;  4G4K A;  3EFX D;  3A7A B;  1CA5 A;  2K32 A;  5CV5 A;  3IL8 A;  1SBB B;  3NTH A;  3BDL A;  4K14 A;  3VR2 A;  2SNS A;  2NN6 G;  3VYT A;  4OGQ C;  2M9V A;  3D31 A;  4CJ2 C;  4KI0 A;  3BVM A;  4DXF A;  3L3O C;  2X6L A;  1ZYR C;  4MN3 A;  2F0T A;  1HPC A;  2BE5 D;  2L12 A;  3R2T A;  3QWN A;  3QJY A;  1A3U A;  5C0X G;  3PUY A;  3RZO B;  5FLX E;  2F0W A;  4I7Z C;  1EYD A;  1F9P A;  4RKB A;  3A55 A;  5I2Y A;  5JVH 3;  1VF5 C;  2RDH A;  3QB3 A;  4X3U A;  3E6Z X;  1SJE D;  5JEA J;  1MSG A;  5AFW A;  2JYO A;  4KJO A;  4XDX A;  2F0U A;  2XWB B;  5CV7 A;  2KHS A;  2C9O A;  4KN4 C;  1C8C A;  1TWG B;  2B8G A;  4IN3 A;  3T51 B;  4PV1 C;  3TZU A;  2EY1 A;  1RTO A;  3NSW A;  4KD4 A;  4FF3 A;  1STA A;  2EPB A;  1OXU A;  1SFO B;  4A3G B;  1VDZ A;  1G8Z D;  5LHY 1;  5I4D A;  3SK4 A;  1V1O A;  4HSP A;  5EKI A;  4C3I B;  1PZK D;  4CJ0 B;  4IFD J;  5IIF A;  2TMP A;  2SOB A;  2X6G A;  2BCO A;  3IFT A;  1OXV A;  1O7L A;  4RHR A;  1XWE A;  2KVM A;  3S1M B;  5BN5 A;  1VF7 A;  1KDB A;  1HRJ A;  1F9S A;  3SK6 A;  3MAQ A;  2PZT A;  4XQN A;  2DY7 A;  3E0J A;  1STB A;  3BYT B;  4KMU C;  3EJI A;  1DZ1 A;  4G7Z C;  4KV6 A;  1XTC D;  3AU7 A;  2J4X A;  5FO9 B;  4XYO A;  1LT5 D;  1CHP D;  2Q8I B;  4QUF A;  1QCB D;  1JIC A;  4FNF A;  1M8A A;  4BBS B;  3J7Y W;  1PMR A;  1U4P A;  4B08 A;  1BQQ T;  2R7Z B;  1LTS D;  5K5P A;  3ONA B;  1ZKO A;  3BYY B;  3H0G B;  1AW7 A;  4IUV A;  2PPB C;  3DWA A;  1LT3 D;  3PO2 B;  3GTJ B;  4IZ8 A;  3M7G A;  1CTM A;  1G2S A;  4F8M A;  3PUV A;  4RGT A;  4CBV A;  5M3F B;  4WJW A;  4DU9 A;  1GJX A;  1ONL A;  3FEW X;  3MXG A;  2HCC A;  1T5X D;  3GTK B;  4WRD A;  1EIH A;  1SYF A;  3J81 L;  4OIJ A;  4C3J G;  2PZU A;  1V1P A;  3FPP A;  4JBW A;  5DEH A;  1Y8N B;  1UUP A;  2CW0 C;  4RKL A;  4ODG A;  3C2P A;  3I73 A;  1S5F D;  2F0G A;  1Q1B A;  3S1R B;  4CGY B;  4Z9C B;  4M1U B;  3F2U A;  1D2B A;  2EYP A;  4KHV A;  3P1H A;  4IUP A;  4A3K B;  2N88 A;  2F0M A;  1D1I A;  1F9Q A;  5CBE E;  4NW2 A;  2RVL A;  2IX1 A;  1SYG A;  1RJT A;  2IX3 A;  2MHV A;  3N6R A;  4QF4 A;  2E2I B;  2FFK B;  1ZEQ X;  3NWT A;  3T13 A;  3K7A B;  3M3Y B;  2LKV A;  4FF1 A;  2JA5 B;  2CQA A;  2R6G A;  1TU2 B;  5FOB B;  3ND8 A;  5C4J B;  1BCP F;  1TS4 A;  1K8O A;  3LWU A;  5KGU A;  3R93 A;  5EBD A;  5C4Z A;  5CV8 A;  3C1E A;  4OL7 A;  1ICW A;  3RMH A;  1EYA A;  2BA1 A;  4DAP A;  2JA7 B;  4C56 C;  3J7A V;  3GTO B;  1BR9 A;  5FK9 C;  4K2K A;  2OXP A;  5C0X J;  2K5D A;  1TKW B;  2RSO A;  3TSS A;  5EKL A;  2XVS A;  3OWE B;  2E74 C;  3R2I A;  5EKK A;  1HFN A;  5C3E B;  3SK8 A;  4F88 A;  4XXE A;  3NUC A;  3M7N A;  1W6J A;  3TP7 A;  3GD7 A;  5JEA G;  1KDA A;  5J1Z A;  1E2Z A;  1HQR D;  1ENA A;  4ID6 A;  5LL6 X;  1PYW D;  4RAU C;  5J39 A;  3MHB A;  1LT6 D;  4Q5V A;  3J81 E;  3HOY B;  3SEB A;  1H9S A;  2LS0 1;  2LMC B;  1RD9 D;  5KNC A;  1ML0 D;  4KY7 A;  5IOD A;  1L0X B;  1CZG A;  2R61 A;  5IGB A;  4FXD A;  5HUR A;  5M3M B;  3GTQ B;  3A7L A;  4ZUJ A;  2A74 C;  1KDC A;  2EYL A;  2EZV A;  2A5H A;  4PMB A;  3I4M B;  3NQT A;  5FO7 B;  1TWC B;  3K59 A;  3TP5 A;  3N52 A;  5ELF A;  2KEC A;  3W2D A;  1TS3 A;  3SE0 A;  5D14 A;  4DFA A;  2YYZ A;  3KUP A;  1Y8O B;  3GTP B;  1S5B D;  1SE4 A;  2PO4 A;  5D3D A;  2FMC A;  3FPU B;  4HTH A;  5JOB A;  4B9W A;  3TDQ A;  1I4R A;  1SNC A;  3O13 A;  2EXZ A;  1SNP A;  2RBM A;  1ILP A;  2O5J C;  3RD4 A;  5EJW A;  1I4P A;  5CV4 A;  1RTN A;  2ZXP A;  1EQT A;  1EY9 A;  2HCI A;  1I4H A;  3HOU B;  5C5M A;  4FXG C;  1I6V C;  2Q8T A;  1GUG A;  2LY7 A;  5D3I B;  1MBY A;  1AZQ A;  3A8J E;  2NTS A;  1JOR A;  5KNB A;  1LT4 D;  5C5L A;  4BA2 I;  3VR3 A;  3C3L A;  4K5X A;  4YIJ A;  5NUC A;  3M4O B;  1F2Y A;  1LTI D;  2PW5 A;  1I4G A;  5ELE A;  1GUT A;  4A93 B;  1TWF B;  4K6L A;  5IGG A;  5IT9 L;  5M5W B;  4Y7N B;  4ILW A;  1PTO F;  3NXW A;  2BA0 A;  3DWQ A;  3T56 B;  1EU3 A;  1EY5 A;  1WCM B;  5KRU A;  1U4L A;  3D8G A;  3NBI A;  3URY A;  5ISR A;  1Q12 A;  3KF8 A;  2L0C A;  1JOK A;  1MGS A;  4KN7 C;  1B50 A;  1XYI A;  4IUU A;  1WTR A;  4NP5 A;  2RQX A;  3NTK A;  4DXG A;  3AMU A;  4ZK9 B;  2V4D A;  1GOZ A;  4F7X A;  4DN4 M;  3D4D A;  4L63 B;  4KY6 A;  3GO5 A;  2KQ3 A;  1QE6 A;  2AQ2 B;  3HG9 A;  5LL6 S;  4DNR B;  4HCS A;  1PRT D;  2Z8L A;  2A6E D;  3FKI B;  1TT2 A;  3M85 A;  4U68 A;  3GTG B;  2KCN A;  4K5V A;  1R4Q B;  1DON A;  2ID0 A;  3A8I E;  1GUO A;  4IAL A;  1RDP D;  3I91 A;  4X3T A;  4DK1 A;  5G3L F;  3EVQ A;  4WFN 3;  1B2T A;  5JPN C;  1TY2 A;  4KY5 A;  1G2T A;  5T1I A;  1KAB A;  1PLF A;  4QMG A;  3GQB A;  3K5O A;  4A3M B;  4HCE A;  2ZXO A;  2QF7 A;  2IT1 A;  2EYO A;  4NDX A;  3G6J B;  3J80 E;  2G9H D;  3VYS A;  3PIO 3;  1JWM D;  2L4N A;  2O4X A;  1O78 A;  2DN8 A;  3MXP A;  4BY1 B;  1WD1 A;  3BVG A;  3S1Q B;  1H9K A;  5IOC A;  2XWJ B;  2CW0 D;  1E0B A;  5EQ0 A;  4RGM A;  3BG3 A;  2NVQ B;  4TRD A;  3QIA A;  1XXG A;  3PV0 A;  1EYC A;  5IT9 E;  5BN3 A;  3S17 B;  2MGS A;  1TVX A;  3MTS A;  4AYB B;  3EA6 A;  2MP1 A;  3ERQ A;  1Z6H A;  2BOS A;  3WOF A;  2FIN B;  2K5W A;  2PNR C;  3VR5 A;  3IAY A;  1AP0 A;  3OIP A;  4TQU S;  4RCO A;  5KIX A;  3R3O A;  4RWS C;  2R92 B;  3C1F A;  3NK9 A;  4K8I A;  1J8I A;  2H4O A;  4TKO B;  4G57 A;  4KKT A;  3SK5 A;  2K33 A;  4ZUI A;  4C3H B;  1DYQ A;  1BBX C;  3D4W A;  1SNO A;  3HGB A;  1QOH A;  1I3Q B;  3MWY W;  1U9R A;  1GUS A;  1HCZ A;  2KJX A;  3DWP A;  2M2L A;  5EPK A;  2R3Z A;  3MEH A;  2JXM B;  3VR4 A;  5JJZ A;  3Q22 A;  1PRT C;  4ULL A;  3KK7 A;  5D65 A;  2A6E C;  5IGD A;  1AFP A;  1JOQ A;  4Q0F A;  3J7A F;  1L0Y B;  3D4R A;  3NWS A;  5E3F A;  3KLS X;  2ICI A;  1HFG A;  1CQF A;  1II3 A;  2EJM A;  2D9U A;  4OHJ A;  1I4Q A;  1O80 A;  5FO8 B;  4EGV A;  4HR7 B;  1SEB D;  4QB4 A;  1CI3 M;  1HUM A;  4V0B A;  1PRT B;  1X32 A;  4CKC A;  2F0Q A;  1SJH D;  5DM7 3;  1CQV A;  4EQP A;  1G91 A;  1Z7T A;  1H9R A;  5M5X B;  4RFB A;  1JQY D;  1CZW A;  2L11 A;  2VB3 X;  3TBI B;  2I46 A;  1RCV D;  1HUN A;  1IYU A;  4PQX A;  1TQO A;  3K5N A;  1ET6 A;  2NBF A;  4G7O C;  4FYD A;  3NBH A;  2F0L A;  3T4A C;  3S9W A;  3MZ5 A;  1SNM A;  3RZD B;  2E2J B;  1LTT D;  4PMW A;  1QNK A;  1V8Q A;  2QIL A;  3I70 A;  3OMG A;  1A2U A;  1QB5 D;  2E2D C;  3SR1 A;  1I6H B;  4M8A A;  3IKJ A;  3I8Z A;  4XQJ A;  3KLR A;  1ESF A;  1C48 A;  3ERO A;  1QNU A;  2ICE C;  5IGC A;  4A3I B;  1STG A;  4HN7 A;  3QOJ A;  1CA6 A;  4XQQ A;  3PUW A;  1SYD A;  3MFY A;  1RKN A;  1NSN S;  1V1P B;  5T1G A;  1B1Z A;  2WV6 D;  4A3B B;  4RGN A;  4U67 3;  2IL8 A;  4LJZ C;  1CT1 D;  4CKE A;  2K05 A;  2F0N A;  1DJR D;  5EBC A;  2F1M A;  1SYC A;  4DGZ A;  1ROD A;  2HQE A;  2XSC A;  3M4Y A;  5CV9 A;  1LO5 D;  1B3A A;  1AN8 A;  2JA8 B;  1VMP A;  2B2V C;  1IKM A;  3HOV B;  2KUM A;  5KYL A;  1DD2 A;  1KAA A;  4XIG S;  4HSV A;  1EY0 A;  2B2V A;  1KNE A;  1X3P A;  4FP5 D;  2KA7 A;  4B9X A;  3OSO A;  1JWU D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...