1ENAA

Crystal structures of the binary ca2+ and pdtp complexes and the ternary complex of the asp 21->glu mutant of staphylococcal nuclease. implications for catalysis and ligand binding
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
135
structure length
135
Chain Sequence
b'LHKEPATLIKAIDGETVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STAPHYLOCOCCAL NUCLEASE
molecule tags Hydrolase(phosphoric diester)
source organism Staphylococcus aureus
publication title Crystal structures of the binary Ca2+ and pdTp complexes and the ternary complex of the Asp21-->Glu mutant of staphylococcal nuclease. Implications for catalysis and ligand binding.
pubmed doi rcsb
total genus 32
structure length 135
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 1994-02-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1enaA00
1STBA 5E3FA 4NP5A 4NMZA 4KV6A 4ZUIA 4F8MA 5KIXA 3OMGA 3TP5A 2F0DA 4ME5A 1STGA 1II3A 3NQTA 1SNCA 4DU9A 3VA5A 2F0NA 1A2UA 2F0KA 3T13A 2OF1A 1A3TA 1ENCA 5IGBA 1NUCA 4KJNA 2F0LA 1EY7A 2OEOA 4F7XA 1EZ8A 2PW5A 5IGGA 3MVVA 1EY0A 3DHQA 3NUCA 4K2LA 3BDCA 5DAUA 1U9RA 5KEEA 5IGDA 5EKKA 4J1MA 4ZQ3A 5I9OA 1RKNA 3P1HA 1JOOA 1SNQA 3C1EA 2KQ3A 3LX0A 3D4WA 2F0OA 4E6IA 4I65A 4RKBA 3P75A 3TP7A 5CV4A 4KHVA 3ITPA 2M00A 4OL7A 3U9OA 3T16A 4EQOA 5KYIA 2F0FA 2PQEA 1SYCA 4WRDA 3NXWA 2EYHA 2OXPA 3QOJA 3E5SA 4IUNA 4IZ8A 2SOBA 1A2TA 3OWFA 2PYKA 5NUCA 1KDAA 1SNPA 4N9TA 2F0PA 3HEJA 1A3VA 3MHBA 3NK9A 1STHA 5IOCA 2F0MA 2EYJA 4ID6A 2RBMA 2EY5A 1JOQA 4HTHA 4K2KA 4NKLA 5J1ZA 3NP8A 1KDCA 2EYMA 5C4ZA 4LAAA 1STNA 3SK6A 2PW7A 1SYEA 1A3UA 5C4HA 1KDBA 1EYAA 1SYDA 2F0WA 4G57A 4K8JA 1EQVA 5CV7A 5CV5A 4N9PA 4YIJA 4TRDA 1EY6A 3D4DA 4DFAA 3QB3A 5CV6A 2EYOA 5M9OA 5E1FA 2F0EA 1TR5A 2WACA 3MZ5A 3PMFA 4K8IA 1SNDA 4KY6A 3V2TA 4EVOA 2LKVA 2PZWA 4QF4A 4KD3A 2EXZA 5KGUA 5DEHA 4EQPA 2SNMA 4K5VA 3TMEA 4KTAA 2F0UA 3D8GA 5K5PA 2EYPA 3SK8A 3MEHA 4PMCA 4HMIA 4NDXA 2RKSA 3NHHA 1JORA 2EY2A 3SXHA 2PZTA 2EYFA 4IALA 5IIFA 5F2DA 3SR1A 5CC4A 1F2ZA 3MXPA 1SYFA 4KJOA 3QOLA 5EGTA 5IGFA 1JOKA 1EY5A 3DMUA 2EY1A 4RKLA 4EQNA 2O4XA 2F0TA 2F3VA 4K5XA 1NSNS 1SNMA 2KHSA 4DF7A 2ENBA 3C1FA 4QB4A 3TP6A 3R3OA 4DGZA 3ERQA 3HZXA 2EYLA 4B9XA 4PMBA 2F0GA 5J22A 5IGCA 1EY8A 2PZUA 2EY6A 4QMGA 4R8NA 4ZUJA 5C3WA 5CGKA 4K5WA 4H7BA 4ODGA 1F2MA 5C6AA 4B9WA 4KY5A 2NUCA 1KABA 5EKLA 5KYLA 5J39A 3D6CA 1STYA 1ENAA 3SK5A 5C3XA 2F0QA 4HMJA 4S3SA 4WORA 3H6MA 3SK4A 5C5MA 5HURA 5IODA 5HGTA 2F0VA 3OMCA 2F0JA 4K14A 1EY9A 3EVQA 1KAAA 5JAVA 3RUZA 2F0IA 2RDFA 3S9WA 4PNYA 3EJIA 4K6DA 4KY7A 1STAA 5I6WA 1SYBA 5JOBA 5I6YA 1EYDA 5CV8A 3SHLA 3EROA 4J6HA 5CV9A 1SNOA 1F2YA 1EY4A 2F3WA 2QDBA 1EYCA 2F0SA 1TQOA 2SNSA 1TT2A 3BDLA 3TP8A 1IHZA 5ISRA 5C5LA 1AEXA 1EZ6A 2F0HA 4KD4A 5I9PA 1SYGA 5KRUA 5IGEA 4MIUA 3OSOA 2HQEA 5CR3A
chains in the Genus database with same CATH superfamily
1SN8A 1VQMA 2V1CC 4IO9A 1VQ7A 4L5TA 1HHVA 1DYQA 3TEHB 2K1BA 1GHKA 2YTVA 5IGBA 1HNXQ 3L9AX 3NUCA 4JI3Q 4JW0A 2K5QA 1JWUD 3PUZA 1VQBA 4RG1A 2KENA 3K5MA 2K52A 1IBKL 4PV1C 2WB1B 2KJXA 4BXXG 3HOUB 1VF5C 4DR2Q 4IFDG 1GKHA 1A2TA 1RL2A 1WI5A 2JA5G 4ILWA 4OHJA 1F9SA 3MHBA 3AU7A 2AWOA 1TWHB 4ULLA 2CHBD 2UXCL 1TS2A 4LAAA 1EFWA 2X69A 5C44G 1PRTB 1N36L 1BCPD 3GTKB 3H3VI 2H1EA 2N49A 1EY6A 3JAME 5M9OA 1IW7C 3BDOA 5C4JB 2P5ZX 3GO5A 4DPGA 2ICIA 2PZWA 4XQNA 3FP9A 3BYTB 4MTNA 3TMEA 1Z7TA 3HOYH 4A3DH 1VQAA 2EJGC 2JP1A 2EY2A 2IL8A 2EIFA 4PG3A 5GAEC 3GTQB 2VY3A 3EFXD 3G6JB 3K81C 4LUVA 3W1GA 3QOLA 2EY1A 4RKLA 2O4XA 4IPCA 4X6AH 2AQ2B 2JEAI 5C3EH 3A55A 4YCUA 1IYJB 1O80A 1PV4A 3NTKA 4AQYQ 3IRBA 3HOWB 1PH2A 2FINB 1YVCA 1W6JA 4FVMA 5HGTA 2NVQH 2I07B 2KUMA 2R93G 3VR3A 1KLUD 3MXUA 5JEAH 4A3BG 4JPBW 5M5YB 1HUMA 3DEOA 3VR5A 4DV7L 4C3JH 5C44B 1SMYD 3BDLA 4FF4A 1W2BA 3FPUB 2Q2IA 1LT6D 4JC0A 1RF2D 5I9PA 5K36H 1JWMD 1EOVA 2D9UA 2M2LA 3QO2A 5CR3A 5JJZA 5A2QL 3E9HA 4LF4L 4R4CA 4UP9A 3HOYG 4HSVA 2F0NA 2F0KA 2I0QA 2CKZB 4X64Q 4K2LA 5D65A 1PMRA 2XRQD 1JOOA 2RHQB 2Z8LA 4IPDA 4OONA 1LT5D 1O7YA 2JA6G 3PO3G 3T16A 2PQEA 1D2BA 3GV6A 2LXJA 1SNPA 4DR2L 1W3SA 4X62Q 5HY6A 1Y1WG 3HKZG 3HOWG 4DUZQ 1G291 4RCOA 5FK9C 5M3MB 1SEBD 4ZRZA 3STBD 5DM63 4A3IB 4F88A 4TQUS 2ZXRA 3T53B 1EQVA 4LF5L 5C3EG 1NMFA 1C7YA 1J6QA 4EVOA 5EPKA 3SEBA 3Q23A 4K5VA 1P16A 5D3DA 1B53A 3KUPA 2AWNA 1KTKA 4TSSA 1FYCA 3H15A 4JYAQ 4A3JG 1SYFA 1R4PB 2KBNA 1HTPA 3G48A 1Z47A 1OXVA 4C3HB 3RLOA 2F0TA 2WKDA 3P20A 4LUZA 1SNMA 4F87A 4I7AA 2KHIA 2XSCA 2F52A 1VQIA 3DUZA 4PMBA 1NTGA 4I7ZC 3T1YQ 1D6EC 2JN4A 3PF4A 1JQYD 5JJLA 1VQJA 3EN2A 2OT2A 1A62A 5IYDG 1D5MC 3CP0A 1YBYA 4C2MH 3K58A 1VQOA 1GD7A 2AQ3B 3HOZB 2WV6D 4V0BA 2I5HA 4KN4C 4GKJL 1EQQA 3RZDB 4LFCQ 2ZM6Q 4DK1A 1XWEA 1JICA 2VB2X 4KHPL 4OO1H 2A1AA 1ICFB 2UUBQ 1VQCA 4WFN3 1AE2A 2VW9A 1ILQA 2VQFQ 1AEXA 1H9RA 4KD4A 4QY7A 5FLXE 3OTOL 4JG2A 2YU9B 3H3VH 3G7LA 4YWMA 1AP0A 2IPKD 4DR7L 4NP5A 1A8VA 4CGYB 3I56A 5C0XJ 4F8MA 2HHHL 3U58A 1VQ9A 1H9SA 2YV5A 4DAVA 3NELA 1ENCA 2JEBI 2JK8A 2F0LA 1EY7A 1QVFA 3J80E 1G51A 1C8CA 2UXBQ 2ALYB 3K5LA 4RGNA 5D3IB 4DXFA 5E4XA 1G91A 4LFBL 4KHVA 1EU3A 4B3TQ 1EEID 3LWUA 2F0FA 3HOXB 1SYCA 3PIPA 1FL0A 5JEAJ 2EJFC 1KDAA 1L0XB 5IOCA 1K3BC 1EIYB 3FPPA 2R92G 2N78A 4HTHA 4B3RL 1XNRQ 2E2IH 4LF9L 1PTOC 2PW7A 4DR5L 2FMMA 4RCNA 3NQIA 3GTPH 5CV7A 2WIIB 2ZTDA 1T9HA 2R7ZG 5CV6A 3KK7A 5KNBA 4JI1L 3CC7A 1SNDA 1AZQA 1J9OA 5BN4A 3C3LA 4EQPA 2EQSA 5GROA 1VQ4A 1ZXTA 4NDXA 1KHIA 2IHEA 2EYFA 3AMUA 4KJOA 3UDGA 3NBHA 4RGOS 3PCOB 3CPFA 3M4OB 1CI3M 2MJ8A 4DN4M 3ERQA 2EYLA 1SJHD 1SMXA 1AN8A 3ULJA 5M5XB 2QEXA 2NVYB 3I72A 4IOAA 2MNAA 1OXXK 1WCMB 2F0QA 4DK3C 1MIUA 2F0VA 3EVQA 1KAAA 4RAUC 4OWXB 4DV2L 3DEPA 1IKMA 3KYHC 3X3MA 1QZGA 3V05A 4A3DG 1WCMH 1TWCB 1BBXC 1ET9A 1IXRA 1FNVA 1IHZA 2NVYH 2ICEC 3E0EA 4A3BB 1X6OA 1SYGA 1S5DD 5IP9G 1Q3LA 3A8JE 2NVXB 1STBA 1EIGA 1SSOA 3C46A 1N34L 4DV0L 1SNCA 4C1NK 3VA5A 1WYDA 3KLRA 3F8TA 1VCIA 4X3UA 2WFWA 4R8IA 4LK1C 2UU9Q 2ZJQA 3K0YA 4F7XA 2M9VA 3DHQA 4DAYB 1E3PA 2NYZD 3NTIA 3UE1A 1BNZA 5I9OA 3HG9A 3A8KE 3A54A 4RKBA 3J81c 4HR7B 3G71A 1V1QA 3GTPB 3K59A 1SR3A 3PGZA 4RMFA 2QGQA 5IT9L 1K8OA 3O13A 2E5LL 3NE5B 1B1ZA 3Q22A 4OO1I 3PUYA 3S1NB 3CCEA 4RWSC 5LMUQ 1BCPB 1JC7A 1VMCA 4KTAA 4PMCA 1DZ1A 2BDOA 3J7A5 4LW1A 4XYQA 4LWCA 5BR8L 1Y8NB 5CC4A 2OQKA 3KFUA 1I3QH 4GZYC 1ONLA 1Q8IA 2QCPX 3FDTA 2KOLA 5C4XG 2EVBA 1VQPA 2EY6A 4ZLTF 1KNAA 4JI3L 4UAIA 3ER0A 2Q8IB 4KKSA 4CDCC 3T4AC 4XYOA 2IX0A 1YHAA 2YTXA 3I4NG 4ABNA 2B29A 1Q7YC 3I70A 5C5MA 2B3GA 3TBIB 2D62A 3HOVB 1CQFA 3RUZA 1G2SA 4LNQA 2XVSA 2N8NA 5IWAQ 5IYBH 3RZDH 4KY7A 3JAML 1I4RA 4AYBE 2OWOA 3MXNB 5IYCG 4ZCKA 2K7VA 4C2MB 1EY4A 4A93G 3CQZB 3GD7A 1OO9B 1DCZA 1PZKD 1TT2A 1Q1EA 4ZKCB 2Z4IA 2KECA 2E2HB 1RTNA 3D3RA 3KF8A 1B8AA 1FNUA 4R4IA 2B2WA 3KDFA 1LT3D 2CFMA 5I4DA 2N55A 1NY4A 3NSWA 2BH2A 4CJ0B 1D1IA 4HJ5A 1DONA 4H44C 3NWSA 1PXUA 2L5TA 4NXMQ 1JMCA 2CW0C 2RF4A 3BVZA 2UXCQ 1UE7A 4JI4L 3I7FA 4I65A 3S24A 4LF4Q 4IUUA 4LFAQ 4GLVB 3NXWA 1B50A 3QOJA 2F4VQ 3U4VA 5NUCA 4P74A 3HS0C 1WTVA 1HH2P 1CKMA 3U9SA 1WVLA 3J81i 2WINB 1LTTD 4A3IH 5LL6S 2DY7A 3J7ZC 1SYEA 2Y0SB 2F0WA 4AYBB 3Q24A 3WOEA 2K5NA 5C4XH 1CA5A 1ZEQX 2X6LA 1MHWC 4A93B 1EFID 2HCIA 2B39A 5FO8B 4M1UB 2EYPA 4MHEA 2JJQA 1B7YB 3A5UA 4C1NI 3MXPA 2RCFA 1A6XA 2GVBA 1MD2D 4OWWB 3HZXA 3PIOA 1K0SA 2L1BA 1KIXA 5EPJA 3NBHB 4ODGA 3I55A 2A6HC 3NPPA 5EKLA 1G2TA 2IX3A 4N8FA 3GTGH 2O5IC 3FMCA 5HURA 1PH3A 4C3JB 5C44H 4JYAL 4K0KL 5M5YH 1IBMQ 3VYUA 4PMWA 1OTCA 2A68D 3RD4A 3SGIA 1C0AA 1SYBA 2NVQB 1EYDA 1RJTA 4DR6Q 2Y0SE 5CV9A 2R7FA 4LMQD 3KJPA 1TS5A 1Q1BA 4GOPC 2AHOB 2UUCL 4GN5A 3H0GB 2D5DA 1PH4A 3GQBA 4DAMA 4HCSA 1XPOA 2PI2E 1H95A 5C3EB 3A0JA 4JBJA 4DU9A 4UP8A 1FGBD 4P2CB 1BO0A 4Q0FA 3CCVA 4O1NA 4XXEA 4U673 3GTQH 2UU9L 2PW5A 5KNCA 1PRTF 1YJ9A 4A3DB 5IGDA 4IUPA 3J81j 4ZQ3A 3MA2B 3BU2A 2JQOA 4JI8L 3CCLA 4WJ3M 4YHHL 4JI4Q 2RHSB 4QIWB 3U9OA 5KYIA 5JPMC 3MEFA 2XIWA 4IZ8A 4KKTA 3TRZA 4P72A 4RA8A 1B9MA 1TWGH 1WCMG 4C3JG 2L0CA 1DOKA 3IFDA 4DV5L 2Q2UA 3PUWA 5J3BA 1STNA 4ZKBB 3TS2A 4CKBA 1KDBA 1EYAA 1QCBD 4A3MH 1KRSA 2JA5B 2K01A 1SAPA 2MHVA 4TRDA 4XTCS 3JAMi 2NN6G 4AH6A 3HOUH 1GUSA 2WB1G 3OW7A 4QUCA 2VL6A 1B3QA 4A4IA 3JC66 4JV5Q 5IWAL 1Q46A 2Q8RE 2HHHQ 2ZXPA 3EBEA 2JE6I 4DNTB 1SROA 5F2DA 1HTLD 4OXPA 5EGTA 4X3KA 5IYDH 1K8AC 1EEFD 4DF7A 1GOZA 5J22A 4CJ2C 5IGCA 1VS0A 1Y1WH 2NVTH 3BZDB 5GADC 1QE6A 2LMCB 4C56C 2JA8H 4GS3A 1ENAA 1HZ9A 3I4NH 2DY8A 4B3SL 3W2DA 4RGMA 5EJWA 4A3CH 5ELBA 2F0IA 2K4KA 4DXGA 3I4OA 2PPBC 1FNWA 2GN5A 4BY7G 1RDPD 1BKBA 3RN2A 1PVOA 1HR0W 4J6HA 1HRJA 2FJ2A 2QKIC 4HJAA 5C5LA 5JEAG 4X65Q 1IKLA 1U4MA 4LF6L 1NCVA 3UDXA 1MBYA 2MQHA 5IT9c 1PH8A 1EYGA 4LFBQ 3FKIG 1KAWA 1LYLA 3TP5A 4ME5A 2D0PA 2F0DA 2PCFB 3GTJB 3FKIB 4HN7A 5FLMH 1IL2A 4HSPA 3IAYA 1HNXL 2E2JH 2ZJRA 4GOPA 2DGYA 1LUZA 4A3KG 1ZKOA 1IBKQ 1NBWA 1R9TH 4DR1Q 5L37A 4JI7L 5GAGC 3E5SA 3QJYA 5FLXc 3L3OC 1I50B 2EPBA 1DM0B 1K9MC 1ESRA 4YHHQ 1YNNC 1R4QB 2HQLA 3K80C 1L0YB 3B6YA 3HOZG 2I5MX 1SBBB 4DK0A 1PH5A 1NMGA 5CV5A 2NBFA 1MI2A 2VNUD 2XTIA 1LTSD 1UAPA 4DV5Q 4IUVA 2XN9C 1UE6A 1YHQA 3S16H 2E8GA 5FKAC 3PMFA 3R93A 2C5CA 1B2TA 2LKVA 4QF4A 2A6EC 2HCCA 3OIQA 4YCWA 3JAMc 1KQSA 3M3YH 2JA9A 1S72A 1TU2B 3MEHA 4GNXA 1N8RC 4A3EH 1YJNA 3SXHA 1E24A 2KCCA 3SR1A 4CDEC 2UUAL 1E0BA 1S5FD 1SDFA 3C1FA 3CXCA 2ASBA 2JA7H 2TSSA 1EWHA 4K5WA 3G4SA 1HNZQ 4H7BA 1QJOA 1XMQQ 3WWVA 1DGSA 1NAPA 1WTXA 3HOVG 3BZKA 5AJ3Q 2VS1A 3WOFA 3S17B 4B3SQ 1CM9A 4IPGA 4NPSA 4HIKA 2SDFA 2KVMA 1XPUA 1K83H 2Y0SG 2KEDA 3CRKC 2EJMA 1PDQA 3MAQA 1SNOA 1F2YA 2F3WA 5G3LD 4BY7B 1EZ6A 3CMEA 1AFPA 1SFOH 2VQEQ 3MC0B 5IGEA 1Y14B 4Y7NH 5E3FA 3WDNA 4NMZA 3VYTA 1PYBA 2F1MA 2MO0A 2K05A 4DV1Q 4L5SA 2IHFA 3T1HL 1GHJA 2SEBD 2VUMH 2V4DA 3BDCA 1PH7A 1SE2A 5IT9E 4OWTB 5TSSA 3J81E 1LTID 4R1JA 4JI8Q 5JVG3 5M3FH 4FF2A 4A3LH 3CCSA 2M00A 3R2TA 1PA6A 4WRDA 2EE1A 4R4OA 3OWFA 2A69D 5LMUL 1A3VA 4ID6A 1F2LA 2EY5A 4BBSB 1JOQA 1UUPA 1KDCA 5G3LF 3RZOH 2A73B 3E6ZX 1VQNA 3E3XA 4DR7Q 2NZOA 1X65A 4O0AA 4X66L 1NJIC 2XWBB 1PTOB 1ML0D 2D2CC 3KBGA 2F03A 5LHY1 4KY6A 3MZ5A 1VQGA 1I94L 3HRZC 2B2VA 4XT3B 5M5WB 1I5FA 3S14B 4IFDH 1JORA 4BBRB 3K8AA 2ZM6L 3F2CA 2CWPA 2R93B 3EA6A 4JI0Q 4A3JH 4IQZA 3E0JA 2KEEA 1LM0A 2BDNA 5IGFA 1GUWA 3S1RB 1HR0L 4UHVA 1K8GA 1KLGD 1QNKA 5KNDA 1EQRA 1EOTA 2HIVA 1M90C 1JE5A 1UE5A 4UP7A 1K0RA 5C3WA 3UI2A 1MJCA 1VF7A 2VZAA 4P71A 1STYA 2PO4A 2I46A 1CKOA 2QEJC 2WAQB 4K0KQ 4G7OC 3KLWA 4DUYL 3M7NA 3K6OA 2QILA 1VDZA 4PQXA 2ZJPA 4K6LA 5LMNQ 5I6YA 5E4WC 3OMCA 5LMNW 2A8VA 3TP8A 1F9PA 1YHBA 5ISRA 3RN5A 2N3SA 3GDEA 4LF8L 3QR8A 1A15A 2HQEA 4JOIA 3SVMA 1VQHA 1XX8A 3OWEB 2PMZE 1II3A 3S1RH 4B08A 4HEDA 4RFBA 4YY3Q 2OF1A 2K03A 2FMCA 3MWYW 1NUCA 1UEAB 2YYZA 4EX5A 1CHPD 2R93H 1EZ8A 4BBRH 4DKAC 1YNJC 2C35B 5C0XH 2F4VL 3CD6A 4GKKL 3X3NA 4TVAB 5BN3A 5M5WH 3TZDA 1PFNA 3P1HA 2KQ3A 3VA7A 4A3KH 2L4NA 2ZT9C 1IW7D 2ATWA 4A3IG 3URYA 1YIJA 2A74C 3A8IE 5EBCA 4XDXA 3AFPA 2OXPA 2K75A 4RGTA 1HQMC 1H9KA 4LF6Q 3OHXC 2PYKA 5K36G 1AW7A 4N9TA 3MFGA 4DV4Q 3T56B 3RZOB 4ZAIA 1BVSA 2ID0A 4IUTA 3EIVA 1NR4A 3ONAB 4BBSG 1ENFA 4K8JA 5JJKA 1IBML 3VR6A 4BY1G 2BCOA 2Z4HA 2UXBL 3TDQA 5E1FA 3GTMH 2R92B 1PZID 1V43A 3V2TA 4PZ6A 4WJ4A 2EXZA 1I4XA 4FYDA 1S3OA 2F0UA 5FLXL 4DUZL 5COYA 4UY8C 1M4VA 1X9NA 3VYRA 2VUMB 4IFDJ 3S1QB 3PO2H 2OTLA 2VXWA 1CKNA 3NENA 3EQLC 1QILA 1HQRD 3QWNA 2R7DA 2R3ZA 2N88A 5CORA 4G7ZC 4DA2A 1JB7A 1TWAH 2F0GA 2Z6KC 2PZUA 3S15B 1JJCB 1SFOB 5CGKA 1KL9A 1YZ6A 2KHJA 3M4PA 1G8ZD 1KABA 1UWVA 4QQBX 3NEMA 3D6CA 1Q90A 1S5BD 1KD1C 4BY7H 2CW0D 2FXQA 2R6GA 2OQ0A 2IWHA 5IODA 3AYHB 5GAHC 1HFNA 4G4KA 4JK1C 3AFQA 5LL6X 3KBXA 1N32Q 4YY3L 1Z6HA 2WP8J 3DWAA 1CKNB 4XQQA 3GTLH 3I4MB 2XWJB 1GO3E 1IL8A 1RTOA 4IFDI 1B9NA 2KA7A 3D6WA 2B2UC 1OXTA 4KV6A 1F9QA 3HGBA 5IE8A 4DV6Q 1HZCA 1STGA 1L1OA 1TIID 3I4LA 3S2DH 3A56A 3DWPA 3GP7A 5ELEA 2IT1A 2K32A 1QB5D 3STBC 2K5DA 1SE3A 2DNCA 3MVVA 4A3EB 1JB3A 3CAMA 1U9RA 3W5OA 3QIAA 1IBLQ 3M3YB 5EKKA 3BG3A 4C3IH 1PH6A 3K7AH 4IJHA 1BUVT 3S16B 4GLXA 2IX1A 4FNFA 1U4RA 4DNIA 4OGQC 2F0PA 3NK9A 3GTOH 1STHA 2OCEA 2F0MA 4FDBA 3HP3A 1UEBA 3F1ZA 4JV5L 5DLQE 2Q2TA 5J1ZA 3S1MB 3AB9A 1N34Q 1WTOA 2G9HD 1RIPA 2HD3A 4JI1Q 3R8BA 4ZK9B 1X3PA 4IN3A 1I50H 4YIJA 1SJED 4X66Q 3QB3A 2F0EA 2LXKA 1WTQA 2CH4A 1I94Q 1SE4A 4IPHA 1HA5A 4HMIA 3NHHA 2E2JB 2RSOA 3TSSA 4A3LG 1X32A 3I8ZA 4DR5Q 2B8GA 1I6HB 3FKIH 1IBLL 3MXNA 2DN8A 3D4RA 1VQKA 1IYVA 2D0OA 1NE3A 4R8NA 4GKJQ 1Y1VB 2L11A 3PO3H 4HJ8A 4GNXC 1F2MA 1E22A 2A19A 1KNEA 5KYLA 3CHBD 3OYYA 5FO9B 1GM5A 2MO1A 4J8QA 1LV9A 1H9SB 4NB3A 4CHTB 1YITA 4FF1A 4S3SA 4WORA 1S5CD 3SK4A 1PFMA 2F0JA 4PZ8A 4A3GG 3S9WA 3TREA 1EUJA 2B63B 3K5OA 2PQAB 4A3GB 2JA8G 1NNXA 1BBWA 5EQ0A 3IL8A 3I4NB 3SDZA 5FO7B 2Z9HA 4NW2A 2JA8B 3M85A 3S2HH 3CC2A 4HIOA 3M9BA 4X3SA 1V1PB 1J5EQ 1Y1WB 3HKZB 2UUCQ 2WAQG 3FEWX 3OMGA 1D5ZC 1XTCD 3DWQA 3CU7A 3T13A 2L55A 4L6TB 1A3TA 1JCKB 1QUQB 2NZ1D 4RH6A 1KXLA 3DM1A 3PV0A 1I4GA 1XXGA 3H3VC 2TMPA 5DAUA 2FHTA 2ZTCA 1A0IA 4N8X1 1RKNA 3C1EA 3D4WA 4E6IA 1HZBA 2HDMA 2XNAC 3CF5A 3TP7A 2UUAQ 1TS4A 1VQEA 1TWFB 4LF7L 4IUNA 1JR0D 5IP9H 4ME3A 2JA5H 3CC4A 4A3MB 5DNFA 3RLNA 3OOCA 4DV4L 3T1HQ 2RCNA 4K2KA 4DV2Q 2IY5B 2AUJD 1W6KA 1N36Q 1A3UA 4A3FH 2DJFC 1TWGB 4HIDA 2CQAA 1TY0A 1B3AA 2JA6B 2HDLA 4TKOB 1B44D 2A68C 1EIHA 2MPMA 1O7LA 1UNSA 5C0XG 5IP7H 1VQDA 3OW2A 2HT1A 2K6AA 4DK6C 3D31A 3I3CA 3HOXG 1XNQL 3FHWA 3LGJA 2L9HA 4JI0L 2JXMB 4R9WA 1K8MA 3RLFA 3ZJYC 3OPOA 1HUNA 2A6ED 3NWTA 4KK7A 2CWAA 1PH1A 2XGTA 4V190 5EPLA 1M8AA 1C9OA 1WOCA 1MJEA 4QMGA 3KF6B 1L0WA 1XJVA 4FXKC 4JOIC 4QL5A 5I2YA 3H0GH 4JI7Q 4IUQA 2NUCA 2R7ZB 1QUQA 2K50A 3DM3A 1DOMA 4J15A 1S40A 2B2YA 3T51B 5BR8Q 4K14A 2Q2HA 2F3IA 3L2PA 3KF6A 2NZHA 2E2DC 2VQEL 1CTMA 1DJRD 4G7HC 5JOBA 1Q81C 1N32L 1RCVD 2BE5D 1YJWA 4CKCA 3GTGB 4OIJA 1EYCA 1HXYD 2F0SA 2NTSA 3NBIA 4FO2A 2R7ZH 5D14A 3QG1A 1KRTA 4XT1B 4FF3A 1HNWQ 1C48A 1WD1A 1MGSA 4X65L 3ICEA 4JVZA 1N9WA 1V9PA 5IYBG 3HOUG 1CT1D 1D1KA 4H0LC 3PF5A 2H5XA 5JVH3 1SE8A 3TZUA 3J7AF 1HR0Q 3CCQA 4Q5VA 1TXYA 1Q12A 2F0OA 4A93H 5ELCA 1CQVA 3BVMA 4EQ5A 1XYIA 3UE0A 2JA6H 4EQOA 5C4XB 1GJXA 2RVLA 1X54A 3LWEA 4A3FB 3R2IA 2F4IA 4P75A 4ALPA 2RQXA 1MSHA 4CJ1B 5EBDA 1Q82C 4DV6L 2QA4A 1RD9D 1CA6A 4UPAA 3J7AV 4A3MG 3FRPB 4X64L 4DUYQ 4JBWA 1Q8KA 1TWFH 3P7JA 4OIKA 1C4QA 3CRLC 1X55A 4DV0Q 4K8IA 2Q8TA 5JJIA 1LT4D 4DV7Q 1VQLA 1BXTA 4DNRB 4R4TA 3ULLA 1GUGA 1U5KA 5I2XA 4IALA 4L63B 1JOKA 2EZVA 2BH8A 4JI5Q 4X3TA 4GKKQ 2F3VA 1EIFA 2R61A 1LABA 2RDHA 3KLSA 1LTGD 1X3EA 4HCEA 2ENBA 5A2QE 4DGZA 5AFWA 1EY8A 1SLJA 3PSIA 2EXDA 1PFSA 2X6GA 2QDLA 1LTBD 4KY5A 2E2HH 3S2HB 3CQZH 1PLFA 3SK5A 1CHQD 4LF8Q 4QGUA 3C2PA 4GNXB 3A5ZB 3CKIB 4A3GH 2B63H 2RDFA 1V1OA 2NWGA 3HOVH 1O78A 1YNXA 2UUBL 1PHJA 1JWSD 1T5EA 4MNOA 2SNSA 2NVTB 1LLRD 1V8QA 1YI2A 1E1OA 3M7GA 1OXSC 2EOTA 3PO3B 1QOHA 1Y1VH 2Z6BA 1J5EL 1WFQA 3V96A 4NXML 1K3RA 1SRUA 3DLLA 1XNRL 5FJ8H 4HIMA 1I3QB 1I6HH 4CBVA 3BVGA 3J7YW 4KJNA 1H9JA 4FXGC 2B2TA 2RA4A 2PQAA 2BA0A 1OXUA 3MTSA 3RMHA 1E1TA 2K5VA 1PRTC 1E2ZA 5CV4A 1X3GA 3ERSX 2BOSA 3S1NH 2C9OA 3CPWA 4OO1G 1YNJD 2EYHA 4BBRG 1L2FA 2SOBA 1HA6A 1LTRD 3D0FA 1GUNA 3NP8A 3S1MH 4L5RC 3GTOB 4JI2L 3HFZB 4A3FG 2NB0A 1WTHA 4H02A 4R4QA 3UDFA 2EYOA 4DV1L 1F9RA 3K7AB 1TR5A 2WACA 5CYUA 2A6HD 2L15A 3PIO3 1BQQT 4KD3A 2CH4W 4C3IB 3AQQA 1H9MA 4ZYSA 1KC8C 3D8GA 3UDIA 4DR1L 2B63G 2E74C 3KF8B 3MFYA 4QJFA 3F2UA 1EWIA 1CSQA 5FJ8G 2HUGA 4LUOA 3PUXA 1F2ZA 2K33A 1LTLA 1EY5A 4EQNA 1CZGA 3S2DB 2J7ZA 1IZ6A 2KHSA 4QB4A 2VB3X 2NN6H 5IYCH 4B9XA 3CMAA 2NVXH 2E76C 1PRTD 2AMCB 4DR6L 1D5XC 3VYSA 4A3BH 1PFBA 5C6AA 3I4MH 3GTLB 4U68A 2UXDQ 1FD7D 2BA1A 3K7UC 4B3MQ 1TWCH 1QVCA 4HMJA 3H6MA 1QNUA 2JYOA 3ZYYX 1BDOA 1EY9A 2B8FA 2QW7A 3TQYA 1ET6A 4DV3Q 5CMDA 1CSPA 3EJIA 1XNQQ 4KMUC 5C0XI 1STAA 4GOPB 3RNUA 1X3QA 2A69C 3SHLA 2AQ1B 2H4OA 5E7NA 4CDFC 4YCVA 1GUOA 3TN2A 3F2BA 1I6VC 1BCPF 5M5XH 5JPNC 3VDYA 4BA1I 1ILPA 3S15H 1TWAB 2PNHA 3MXGA 4ZUIA 4OEMB 2IW3A 1BOSA 1XMQL 3M4OH 3KOJA 2G5DA 4BS9A 4C3IG 1V1PA 2B2WC 1XMOL 1GUTA 3PO2B 3S1QH 2VUMG 3VR2A 5KEEA 4LF7Q 1CFMA 4JI2Q 2RSNA 3ITPA 2R92H 3GTMB 4OL7A 4AQYL 2B2VC 3A74A 3I4MG 1VQ6A 4B3RQ 2XRSD 1BCPC 1GVPA 3W3AA 1N33L 3HEJA 3K57A 4AIMA 4LFAL 1FJGQ 2EYJA 5GQOA 2RBMA 2E2IB 4BXXH 4C3HG 3J80L 1Y69U 5FLMG 2ZXOA 2MP1A 5ELNA 2E5LQ 1SYDA 2QF7A 2K04A 2KCMA 1STEA 1TY2A 5IP7G 2ES2A 1BR9A 1ZYRC 3HOXH 2JSOA 2VQFL 2CCZA 1QG7A 2I5LX 4M8AA 3J81L 4O42A 4A3KB 4YWKA 3E9IA 4KLKA 4KHZA 1PYSB 1WTRA 1AZPA 3I90A 3FVQA 3PUVA 1QWYA 2MUYA 3A7LA 2NTTA 3ND9A 5HGQA 1F77A 4KI0A 3RR5A 4K5XA 1SXTA 2E75C 1BF4A 1L1OC 3PO2G 3HKSA 2LS01 4DR4L 1E2VA 2K14A 2WB1E 1HPCA 1DXMA 4ZUJA 2B2UA 2YU9H 3N6RA 5H1SE 4UDUC 4B9WA 4QIWE 1PTOD 1TVXA 4NXNQ 5J39A 3N52A 2KCTA 2CVRA 4DR3L 1VMPA 3L7ZC 1EQTA 3U50C 2PNRC 3DXJC 4A3EG 3BJUA 4PNYA 5T1GA 2K5WA 5I6WA 1NR2A 3HOZH 1S5ED 4JI6L 5ELFA 3T1YL 3H91A 2GVAA 2QDBA 2L12A 4L5QA 3CW2C 3BS1A 3PIP3 1K28A 2JA7G 2Z6KA 4GN3B 4OX9Q 5CBAE 5KRUA 4MIUA 3OSOA 1LO5D 3NTHA 1FGUA 4HJ9A 3VR4A 2WAQE 4MTKA 5KIXA 3CCUA 4C3HH 3NQTA 1JE4A 1T5XD 2YTYA 1EL0A 2Z0SA 4A3JB 3M4QA 2J4XA 4JBKA 3KLSX 1Y8OB 2B2TC 1EY0A 1RHPA 4CKEA 2LFNA 2G9DA 3U4ZA 2DUDA 3S14H 1SNQA 3LX0A 3M4YA 4LF5Q 1DOLA 3P75A 1ICWA 1PZJD 4NXNL 4JI5L 3J80i 1PTOH 1UE1A 2RDGA 4HAEA 3GV3A 4JBMA 1D7QA 4HJ7A 5BN5A 1WD0A 4X62L 3H09A 3LNNA 4NKLA 4WJWA 5FOBB 5M3MH 2O5JC 1G6PA 2EYMA 1FR3A 4KHPQ 3AEVA 4BBSH 1AH9A 4DAPA 3SK6A 1A63A 1WJJA 4DAYA 1Z9FA 4G57A 4BWGB 4RHRA 1B70B 5M3FG 1VQ5A 4OX9L 4DFAA 1PTOF 1PYWD 1ZYRD 3HKZE 5M3FB 4GLAC 2DJGC 1YEZA 5DEHA 1E2WA 4BA2I 1JT8A 1HNWL 4XIGS 2RKSA 2OTJA 2HIXA 1JJ2A 2PZTA 1YNND 5ELDA 1MKHA 4A3CG 4APVA 1D8LA 1E7ZA 5EAYA 3TP6A 3R3OA 4YWLA 4XQJA 4Y7NB 2EDGA 4JI6Q 4DR4Q 1DD2A 4MN3A 1PH9A 4IJLA 2PMZB 2UXDL 4PZ7A 1P8LA 1L1OB 3W1BA 3OTOQ 4CDDC 1K83B 4QCLA 4DR3Q 1HFGA 5JAVA 3I73A 2GA4B 5M3MG 4K6DA 3KJOA 1TKWB 1WTPA 3S17H 5CV8A 5EKIA 3EROA 2ZTEA 4LFCL 3HOWH 3ND8A 2WKCA 2A5HA 1S4ZA 1LTAD 5AJ3L 1K73C 1X3FA 4N9PA 2JA7B 2BE5C 2PI2A 2MFIA 3KDFB 4H13C 3F2DA 5DM73 2FFKB 1A2UA 4B3ML 4Y52H 5LMNL 4L8JA 2OEOA 3I91A 1U0LA 1EU4A 5IGGA 5ELOA 2K5HA 4Z9CB 4DV3L 1VQFA 2O2LD 3HOYB 4OELB 1G6ZA 1U4LA 4J1MA 1BBUA 1CK1A 2AUKA 2DNEA 2IJ0A 5CBEE 5C4JH 4FXDA 1VQ8A 1HZAA 4AYBG 1CZWA 2CQOA 1J8IA 3GTKH 3CCMA 1N33Q 1ESFA 3CCJA 4A75A 4IURA 1XPRA 1O7IA 5IY0A 1TWHH 3I2ZA 5C4ZA 3ULPA 4KN7C 1X56A 5C4HA 1EWCA 3OIPA 1XMOQ 1QZHA 1GXDC 3D4DA 4RHSA 1R9TB 4EGVA 1LACA 1ASZA 5A35A 4LF9Q 2B2YC 1I4HA 1O7ZA 2SNMA 2KCNA 5K5PA 1CUKA 3SK8A 3K5NA 3Q6SA 4FP5D 3L0OA 5IIFA 3IFTA 2LSSA 3J80c 1Q86C 3DMUA 3GTJH 4B3TL 3SE0A 3BYYB 1U4PA 1NSNS 2MGSA 1MSGA 4P73A 3TS0A 5T1IA 4BY1H 3Q0AA 1I4PA 2NN6I 4KKUA 1HCZA 4A76A 4MZ9A 1B4OA 2Z1CA 1I4QA 1WTWA 4O2DA 3PQIA 1QVGA 5C3XA 1AE3A 1TS3A 3BZCA 1HNZL 1Y8PB 3H94A 4IOCA 1M1KC 2K28A 3H0GG 4GN4B 1JJGA 1Y1VG 1HJPA 3IKJA 3Q8DA 2AKWB 4JCVE 1RODA 1IYUA 2J0TD 3CCRA 1SMYC 1FJGL 1ASYA 1TQOA 3A7AB 4QUFA 2F0HA 4POGA 3K0XA 4POFA 1XTDA 2LY7A 4BY1B 4LJZC 3G6EA 1FVIA 5KGUA
chains in the Genus database with same CATH topology
1HHVA 1DYQA 2K1BA 1GHKA 5IGBA 3L9AX 3NUCA 2K5QA 1JWUD 3PUZA 3K5MA 4PV1C 2WB1B 2KJXA 3HOUB 1VF5C 4IFDG 1A2TA 4ILWA 4OHJA 1F9SA 3MHBA 3AU7A 2AWOA 1TWHB 4ULLA 2CHBD 1TS2A 4LAAA 2X69A 1PRTB 1BCPD 3GTKB 2H1EA 1EY6A 3JAME 5M9OA 1IW7C 3BDOA 5C4JB 3GO5A 2ICIA 2PZWA 4XQNA 3BYTB 3TMEA 1Z7TA 2EJGC 2JP1A 2EY2A 2IL8A 3GTQB 3EFXD 3G6JB 3QOLA 2EY1A 4RKLA 2O4XA 2AQ2B 2JEAI 3A55A 1O80A 3NTKA 3HOWB 2FINB 1W6JA 4FVMA 5HGTA 2I07B 2KUMA 3VR3A 1KLUD 3MXUA 5JEAH 5M5YB 1HUMA 3DEOA 3VR5A 5C44B 1SMYD 3BDLA 4FF4A 3FPUB 1LT6D 1RF2D 5I9PA 5K36H 1JWMD 2D9UA 2M2LA 3QO2A 5CR3A 5A2QL 5JJZA 4HSVA 2F0NA 2F0KA 4K2LA 5D65A 1PMRA 2XRQD 1JOOA 2Z8LA 1LT5D 1O7YA 3T16A 2PQEA 1D2BA 3GV6A 1SNPA 1G291 4RCOA 5FK9C 5M3MB 1SEBD 4ZRZA 5DM63 4A3IB 4F88A 4TQUS 2ZXRA 3T53B 1EQVA 4EVOA 5EPKA 3SEBA 3Q23A 4K5VA 5D3DA 1B53A 3KUPA 2AWNA 1KTKA 4TSSA 1FYCA 1SYFA 1R4PB 1HTPA 1Z47A 1OXVA 4C3HB 2F0TA 2WKDA 3P20A 1SNMA 4F87A 2XSCA 3DUZA 4PMBA 4I7ZC 1D6EC 1JQYD 2OT2A 1D5MC 3K58A 2AQ3B 3HOZB 2WV6D 4V0BA 4KN4C 3RZDB 4DK1A 1XWEA 1JICA 2VB2X 4OO1H 4WFN3 1ILQA 1AEXA 1H9RA 4KD4A 5FLXE 2YU9B 1AP0A 3G7LA 2IPKD 4NP5A 4CGYB 5C0XJ 4F8MA 1H9SA 4DAVA 1ENCA 2JEBI 2F0LA 1EY7A 3J80E 1C8CA 3K5LA 4RGNA 5D3IB 4DXFA 5E4XA 1G91A 4KHVA 1EU3A 1EEID 3LWUA 2F0FA 3HOXB 1SYCA 5JEAJ 2EJFC 1KDAA 1L0XB 5IOCA 3FPPA 4HTHA 1PTOC 2PW7A 2FMMA 4RCNA 3NQIA 5CV7A 2WIIB 5CV6A 3KK7A 5KNBA 1SNDA 1AZQA 1J9OA 5BN4A 3C3LA 4EQPA 1ZXTA 4NDXA 2EYFA 3AMUA 4KJOA 3NBHA 4RGOS 3M4OB 1CI3M 2MJ8A 4DN4M 3ERQA 2EYLA 1SJHD 1AN8A 5M5XB 2NVYB 3I72A 1OXXK 1WCMB 2F0QA 2F0VA 3EVQA 1KAAA 4RAUC 3DEPA 1IKMA 3X3MA 3V05A 1TWCB 1BBXC 1ET9A 1FNVA 1IHZA 2ICEC 4A3BB 1SYGA 1S5DD 1Q3LA 3A8JE 2NVXB 1STBA 1EIGA 1SSOA 3C46A 1SNCA 4C1NK 3VA5A 3KLRA 1VCIA 4X3UA 4R8IA 4LK1C 3K0YA 4F7XA 2M9VA 3DHQA 2NYZD 3NTIA 1BNZA 5I9OA 3HG9A 3A8KE 3A54A 4RKBA 4HR7B 3GTPB 3K59A 5IT9L 1K8OA 3O13A 3NE5B 1B1ZA 3Q22A 4OO1I 3PUYA 3S1NB 4RWSC 1BCPB 1JC7A 1VMCA 4KTAA 4PMCA 1DZ1A 2BDOA 4XYQA 1Y8NB 5CC4A 4GZYC 1ONLA 1Q8IA 2QCPX 3FDTA 2KOLA 2EVBA 2EY6A 4ZLTF 1KNAA 4UAIA 2Q8IB 4KKSA 3T4AC 4XYOA 2IX0A 4ABNA 3I70A 5C5MA 3TBIB 2D62A 3HOVB 1CQFA 3RUZA 1G2SA 2XVSA 4KY7A 3JAML 1I4RA 2K7VA 4C2MB 1EY4A 3CQZB 3GD7A 4ZKCB 1OO9B 1DCZA 1PZKD 1Q1EA 1TT2A 2Z4IA 2KECA 2E2HB 1RTNA 3D3RA 3KF8A 1FNUA 2B2WA 1LT3D 5I4DA 2N55A 3NSWA 4CJ0B 1D1IA 1DONA 4H44C 3NWSA 1PXUA 2L5TA 2CW0C 3BVZA 4I65A 4IUUA 3NXWA 1B50A 3QOJA 5NUCA 3HS0C 1WTVA 3U9SA 1WVLA 2WINB 1LTTD 5LL6S 2DY7A 1SYEA 2Y0SB 2F0WA 4AYBB 3Q24A 3WOEA 1CA5A 1ZEQX 2X6LA 4A93B 1EFID 2HCIA 2B39A 5FO8B 4M1UB 2EYPA 4MHEA 4C1NI 3MXPA 1A6XA 1MD2D 3HZXA 2L1BA 5EPJA 4ODGA 2A6HC 3NPPA 5EKLA 1G2TA 2IX3A 2O5IC 3FMCA 5HURA 4C3JB 3VYUA 4PMWA 2A68D 3RD4A 1SYBA 2NVQB 1EYDA 1RJTA 5CV9A 4LMQD 1TS5A 1Q1BA 3H0GB 2D5DA 3GQBA 4HCSA 5C3EB 4DU9A 1FGBD 4P2CB 1BO0A 4Q0FA 4O1NA 4XXEA 4U673 2PW5A 5KNCA 1PRTF 4A3DB 5IGDA 4IUPA 4ZQ3A 3MA2B 4QIWB 3U9OA 5KYIA 5JPMC 2XIWA 4IZ8A 4KKTA 4RA8A 1B9MA 4C3JG 2L0CA 1DOKA 3IFDA 3PUWA 1STNA 4ZKBB 4CKBA 1KDBA 1EYAA 1QCBD 2JA5B 2K01A 1SAPA 2MHVA 4TRDA 4XTCS 2NN6G 1GUSA 3OW7A 4QUCA 2Q8RE 2ZXPA 2JE6I 4DNTB 5F2DA 1HTLD 5EGTA 4X3KA 1EEFD 4DF7A 1GOZA 5J22A 4CJ2C 5IGCA 3BZDB 1QE6A 2LMCB 4C56C 1ENAA 2DY8A 3W2DA 4RGMA 5EJWA 5ELBA 2F0IA 4DXGA 2PPBC 1FNWA 1RDPD 4J6HA 1HRJA 2FJ2A 2QKIC 5C5LA 5JEAG 1IKLA 1U4MA 1NCVA 1MBYA 3TP5A 2F0DA 2PCFB 4ME5A 3GTJB 3FKIB 4HN7A 4HSPA 3IAYA 1ZKOA 3E5SA 3QJYA 3L3OC 1I50B 2EPBA 1DM0B 1ESRA 1YNNC 1R4QB 1L0YB 4DK0A 1SBBB 5CV5A 2NBFA 1MI2A 2VNUD 1LTSD 1UAPA 2XN9C 4IUVA 5FKAC 3PMFA 3R93A 2C5CA 1B2TA 2LKVA 4QF4A 2A6EC 2HCCA 3OIQA 1TU2B 3MEHA 3SXHA 2KCCA 3SR1A 1E0BA 1S5FD 1SDFA 3C1FA 2TSSA 1EWHA 4K5WA 4H7BA 1QJOA 1WTXA 1NAPA 3WOFA 3S17B 1CM9A 2SDFA 2KVMA 3CRKC 2KEDA 3MAQA 2EJMA 1PDQA 1SNOA 1F2YA 2F3WA 5G3LD 4BY7B 1EZ6A 1AFPA 3MC0B 5IGEA 5E3FA 3WDNA 4NMZA 3VYTA 2F1MA 2K05A 1GHJA 2SEBD 2V4DA 3BDCA 1SE2A 5IT9E 5TSSA 3J81E 1LTID 5JVG3 4FF2A 2M00A 3R2TA 4WRDA 2EE1A 3OWFA 2A69D 1A3VA 4ID6A 1F2LA 2EY5A 4BBSB 1JOQA 1UUPA 1KDCA 5G3LF 2A73B 3E6ZX 2XWBB 1PTOB 1ML0D 2D2CC 3KBGA 2F03A 5LHY1 4KY6A 3MZ5A 3HRZC 2B2VA 4XT3B 5M5WB 3S14B 4IFDH 1JORA 4BBRB 2R93B 3EA6A 4IQZA 3E0JA 2KEEA 2BDNA 1GUWA 5IGFA 3S1RB 1KLGD 1QNKA 5KNDA 1EOTA 5C3WA 3UI2A 1VF7A 1STYA 2PO4A 2I46A 2WAQB 2QEJC 4G7OC 3M7NA 3K6OA 2QILA 1VDZA 4PQXA 4K6LA 5I6YA 5E4WC 3OMCA 3TP8A 1F9PA 5ISRA 1A15A 2HQEA 3SVMA 1XX8A 3OWEB 1II3A 4B08A 4HEDA 4RFBA 2OF1A 2K03A 2FMCA 3MWYW 1NUCA 1UEAB 2YYZA 1CHPD 1EZ8A 1YNJC 5C0XH 3X3NA 5BN3A 3TZDA 1PFNA 3P1HA 2KQ3A 3VA7A 2L4NA 2ZT9C 1IW7D 3URYA 2A74C 3A8IE 5EBCA 4XDXA 2OXPA 4RGTA 1HQMC 1H9KA 5K36G 3OHXC 2PYKA 1AW7A 4N9TA 3MFGA 3T56B 3RZOB 4ZAIA 2ID0A 4IUTA 1NR4A 3ONAB 1ENFA 4K8JA 3VR6A 2BCOA 2Z4HA 3TDQA 5E1FA 2R92B 1PZID 1V43A 3V2TA 2EXZA 1I4XA 4FYDA 2F0UA 5FLXL 5COYA 1M4VA 2VUMB 3VYRA 4IFDJ 3S1QB 2VXWA 3EQLC 1QILA 1HQRD 3QWNA 2R3ZA 2N88A 5CORA 4G7ZC 4DA2A 2F0GA 2PZUA 3S15B 1SFOB 5CGKA 1G8ZD 1KABA 3D6CA 1Q90A 1S5BD 2CW0D 2R6GA 2IWHA 5IODA 1HFNA 4G4KA 4JK1C 5LL6X 3KBXA 1Z6HA 2WP8J 3DWAA 4XQQA 3I4MB 2XWJB 1IL8A 1RTOA 4IFDI 1B9NA 2KA7A 3D6WA 2B2UC 1OXTA 4KV6A 1F9QA 3HGBA 1TIID 1STGA 3I4LA 3A56A 3DWPA 3GP7A 5ELEA 2IT1A 2K32A 1QB5D 2K5DA 1SE3A 2DNCA 3MVVA 4A3EB 1JB3A 1U9RA 3QIAA 3M3YB 5EKKA 3BG3A 1BUVT 3S16B 2IX1A 4FNFA 1U4RA 4OGQC 2F0PA 3NK9A 1STHA 2F0MA 3HP3A 5J1ZA 3S1MB 3AB9A 1WTOA 2G9HD 3R8BA 4ZK9B 1X3PA 4IN3A 4YIJA 1SJED 3QB3A 2F0EA 1WTQA 1SE4A 1HA5A 4HMIA 3NHHA 2E2JB 2RSOA 3TSSA 1X32A 3I8ZA 2B8GA 1I6HB 3MXNA 2DN8A 3D4RA 1IYVA 4R8NA 1Y1VB 2L11A 1F2MA 1KNEA 5KYLA 3CHBD 5FO9B 4J8QA 1LV9A 1H9SB 4FF1A 4CHTB 4S3SA 4WORA 1S5CD 3SK4A 1PFMA 2F0JA 3S9WA 2B63B 4A3GB 3K5OA 5EQ0A 3IL8A 3I4NB 3SDZA 5FO7B 4NW2A 2JA8B 3M85A 4X3SA 1V1PB 1Y1WB 3HKZB 3FEWX 3OMGA 1D5ZC 1XTCD 3DWQA 3CU7A 3T13A 2L55A 4L6TB 1A3TA 1JCKB 2NZ1D 4RH6A 3DM1A 3PV0A 1I4GA 1XXGA 3H3VC 2TMPA 5DAUA 2FHTA 1RKNA 3C1EA 3D4WA 4E6IA 2HDMA 2XNAC 3TP7A 1TS4A 1TWFB 4IUNA 1JR0D 4A3MB 5DNFA 3OOCA 4K2KA 2AUJD 1W6KA 1A3UA 1TWGB 2CQAA 1TY0A 1B3AA 2JA6B 2HDLA 4TKOB 1B44D 2A68C 1EIHA 2MPMA 1O7LA 1UNSA 5C0XG 2K6AA 3D31A 3I3CA 2L9HA 2JXMB 4R9WA 1K8MA 3RLFA 3OPOA 1HUNA 2A6ED 3NWTA 4KK7A 4V190 5EPLA 1M8AA 4QMGA 4FXKC 5I2YA 4IUQA 2NUCA 2R7ZB 1DOMA 2B2YA 3T51B 4K14A 2E2DC 1CTMA 1DJRD 4G7HC 5JOBA 1RCVD 2BE5D 4CKCA 3GTGB 4OIJA 1EYCA 1HXYD 2F0SA 2NTSA 3NBIA 4FO2A 5D14A 3QG1A 4XT1B 4FF3A 1C48A 1WD1A 1MGSA 1CT1D 1D1KA 4H0LC 5JVH3 3TZUA 3J7AF 4Q5VA 1Q12A 2F0OA 5ELCA 1CQVA 3BVMA 1XYIA 4EQOA 5C4XB 1GJXA 2RVLA 3LWEA 4A3FB 3R2IA 2F4IA 2RQXA 1MSHA 4CJ1B 5EBDA 1RD9D 1CA6A 3J7AV 3FRPB 4JBWA 3P7JA 4OIKA 1C4QA 3CRLC 4K8IA 2Q8TA 1LT4D 1BXTA 4DNRB 1GUGA 5I2XA 4IALA 4L63B 1JOKA 2EZVA 4X3TA 2F3VA 1LABA 2R61A 1LTGD 2ENBA 2RDHA 3KLSA 5A2QE 4HCEA 4DGZA 5AFWA 1EY8A 2X6GA 1LTBD 4KY5A 3S2HB 1PLFA 3SK5A 1CHQD 3C2PA 3CKIB 2RDFA 1V1OA 2NWGA 1O78A 1JWSD 1T5EA 2SNSA 2NVTB 1LLRD 1V8QA 3M7GA 1OXSC 2EOTA 3PO3B 1QOHA 3V96A 1I3QB 4CBVA 3BVGA 3J7YW 4KJNA 1H9JA 4FXGC 2B2TA 2RA4A 2BA0A 1OXUA 3MTSA 3RMHA 1PRTC 1E2ZA 5CV4A 2BOSA 2C9OA 4OO1G 1YNJD 2EYHA 2SOBA 1HA6A 1LTRD 1GUNA 3NP8A 3GTOB 2NB0A 2EYOA 1F9RA 3K7AB 1TR5A 2WACA 5CYUA 2A6HD 3PIO3 1BQQT 4KD3A 4C3IB 1H9MA 4ZYSA 3D8GA 2E74C 3MFYA 3F2UA 2HUGA 3PUXA 1F2ZA 2K33A 1EY5A 4EQNA 1CZGA 3S2DB 2J7ZA 2KHSA 4QB4A 2VB3X 2NN6H 4B9XA 2E76C 1PRTD 1D5XC 3VYSA 1PFBA 5C6AA 3GTLB 4U68A 1FD7D 2BA1A 4HMJA 3H6MA 1QNUA 2JYOA 3ZYYX 1BDOA 1EY9A 2B8FA 1ET6A 5CMDA 3EJIA 4KMUC 5C0XI 1STAA 1X3QA 2A69C 3SHLA 2AQ1B 2H4OA 1GUOA 3TN2A 1I6VC 1BCPF 5JPNC 4BA1I 1ILPA 1TWAB 3MXGA 4ZUIA 2IW3A 1BOSA 4BS9A 4C3IG 1V1PA 2B2WC 3PO2B 1GUTA 3VR2A 5KEEA 1CFMA 2RSNA 3ITPA 3GTMB 4OL7A 2B2VC 2XRSD 1BCPC 3W3AA 3HEJA 3K57A 2EYJA 2RBMA 2E2IB 4C3HG 3J80L 1Y69U 2ZXOA 2MP1A 1SYDA 2QF7A 2K04A 1STEA 1TY2A 1BR9A 1ZYRC 2JSOA 1QG7A 4M8AA 3J81L 4O42A 4A3KB 4KHZA 1WTRA 1AZPA 3I90A 3FVQA 3PUVA 1QWYA 2MUYA 3A7LA 2NTTA 3ND9A 1F77A 4KI0A 4K5XA 1SXTA 2E75C 1BF4A 2LS01 1E2VA 1HPCA 1DXMA 4ZUJA 2B2UA 3N6RA 4UDUC 4B9WA 1PTOD 1TVXA 5J39A 3N52A 2CVRA 1VMPA 3L7ZC 1EQTA 2PNRC 3DXJC 4PNYA 5T1GA 2K5WA 5I6WA 1NR2A 1S5ED 5ELFA 3H91A 2QDBA 2L12A 3BS1A 3PIP3 5CBAE 5KRUA 4MIUA 3OSOA 1LO5D 3NTHA 3VR4A 5KIXA 3NQTA 1JE4A 1T5XD 1EL0A 4A3JB 2J4XA 3KLSX 1Y8OB 2B2TC 1EY0A 1RHPA 4CKEA 2LFNA 2G9DA 1SNQA 3LX0A 3M4YA 1DOLA 3P75A 1ICWA 1PZJD 1PTOH 2RDGA 4HAEA 3GV3A 5BN5A 1WD0A 3H09A 3LNNA 4NKLA 4WJWA 5FOBB 2O5JC 2EYMA 1FR3A 4DAPA 3SK6A 4DAYA 4G57A 4BWGB 4RHRA 4DFAA 1PTOF 1PYWD 1ZYRD 5M3FB 4BA2I 5DEHA 1E2WA 4XIGS 2RKSA 2PZTA 1YNND 5ELDA 3TP6A 3R3OA 4XQJA 4Y7NB 2EDGA 1DD2A 4MN3A 2PMZB 1K83B 4QCLA 1HFGA 5JAVA 3I73A 2GA4B 4K6DA 1TKWB 1WTPA 5CV8A 5EKIA 3EROA 3ND8A 2WKCA 2A5HA 1S4ZA 1LTAD 4N9PA 2JA7B 2BE5C 4H13C 5DM73 2FFKB 1A2UA 4L8JA 2OEOA 3I91A 1EU4A 5IGGA 4Z9CB 2O2LD 3HOYB 1G6ZA 1U4LA 4J1MA 1CK1A 2AUKA 2DNEA 2IJ0A 5CBEE 4FXDA 1CZWA 1J8IA 1ESFA 4IURA 5C4ZA 4KN7C 5C4HA 1EWCA 3OIPA 1GXDC 3D4DA 4RHSA 1R9TB 4EGVA 1LACA 5A35A 2B2YC 1I4HA 1O7ZA 2SNMA 2KCNA 5K5PA 3SK8A 3K5NA 3Q6SA 4FP5D 5IIFA 3IFTA 3DMUA 3SE0A 3BYYB 1U4PA 1NSNS 2MGSA 1MSGA 5T1IA 3Q0AA 1I4PA 2NN6I 1HCZA 4KKUA 1B4OA 2Z1CA 1I4QA 1WTWA 5C3XA 1TS3A 1Y8PB 3H94A 2K28A 3IKJA 1RODA 1IYUA 2J0TD 1SMYC 1TQOA 3A7AB 4QUFA 2F0HA 2LY7A 4BY1B 4LJZC 5KGUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1STB A;  5E3F A;  4NP5 A;  4NMZ A;  4KV6 A;  4ZUI A;  4F8M A;  5KIX A;  3OMG A;  3TP5 A;  2F0D A;  4ME5 A;  1STG A;  1II3 A;  3NQT A;  1SNC A;  4DU9 A;  3VA5 A;  2F0N A;  1A2U A;  2F0K A;  3T13 A;  2OF1 A;  1A3T A;  1ENC A;  5IGB A;  1NUC A;  4KJN A;  2F0L A;  1EY7 A;  2OEO A;  4F7X A;  1EZ8 A;  2PW5 A;  5IGG A;  3MVV A;  1EY0 A;  3DHQ A;  3NUC A;  4K2L A;  3BDC A;  5DAU A;  1U9R A;  5KEE A;  5IGD A;  5EKK A;  4J1M A;  4ZQ3 A;  5I9O A;  1RKN A;  3P1H A;  1JOO A;  1SNQ A;  3C1E A;  2KQ3 A;  3LX0 A;  3D4W A;  2F0O A;  4E6I A;  4I65 A;  4RKB A;  3P75 A;  3TP7 A;  5CV4 A;  4KHV A;  3ITP A;  2M00 A;  4OL7 A;  3U9O A;  3T16 A;  4EQO A;  5KYI A;  2F0F A;  2PQE A;  1SYC A;  4WRD A;  3NXW A;  2EYH A;  2OXP A;  3QOJ A;  3E5S A;  4IUN A;  4IZ8 A;  2SOB A;  1A2T A;  3OWF A;  2PYK A;  5NUC A;  1KDA A;  1SNP A;  4N9T A;  2F0P A;  3HEJ A;  1A3V A;  3MHB A;  3NK9 A;  1STH A;  5IOC A;  2F0M A;  2EYJ A;  4ID6 A;  2RBM A;  2EY5 A;  1JOQ A;  4HTH A;  4K2K A;  4NKL A;  5J1Z A;  3NP8 A;  1KDC A;  2EYM A;  5C4Z A;  4LAA A;  1STN A;  3SK6 A;  2PW7 A;  1SYE A;  1A3U A;  5C4H A;  1KDB A;  1EYA A;  1SYD A;  2F0W A;  4G57 A;  4K8J A;  1EQV A;  5CV7 A;  5CV5 A;  4N9P A;  4YIJ A;  4TRD A;  1EY6 A;  3D4D A;  4DFA A;  3QB3 A;  5CV6 A;  2EYO A;  5M9O A;  5E1F A;  2F0E A;  1TR5 A;  2WAC A;  3MZ5 A;  3PMF A;  4K8I A;  1SND A;  4KY6 A;  3V2T A;  4EVO A;  2LKV A;  2PZW A;  4QF4 A;  4KD3 A;  2EXZ A;  5KGU A;  5DEH A;  4EQP A;  2SNM A;  4K5V A;  3TME A;  4KTA A;  2F0U A;  3D8G A;  5K5P A;  2EYP A;  3SK8 A;  3MEH A;  4PMC A;  4HMI A;  4NDX A;  2RKS A;  3NHH A;  1JOR A;  2EY2 A;  3SXH A;  2PZT A;  2EYF A;  4IAL A;  5IIF A;  5F2D A;  3SR1 A;  5CC4 A;  1F2Z A;  3MXP A;  1SYF A;  4KJO A;  3QOL A;  5EGT A;  5IGF A;  1JOK A;  1EY5 A;  3DMU A;  2EY1 A;  4RKL A;  4EQN A;  2O4X A;  2F0T A;  2F3V A;  4K5X A;  1NSN S;  1SNM A;  2KHS A;  4DF7 A;  2ENB A;  3C1F A;  4QB4 A;  3TP6 A;  3R3O A;  4DGZ A;  3ERQ A;  3HZX A;  2EYL A;  4B9X A;  4PMB A;  2F0G A;  5J22 A;  5IGC A;  1EY8 A;  2PZU A;  2EY6 A;  4QMG A;  4R8N A;  4ZUJ A;  5C3W A;  5CGK A;  4K5W A;  4H7B A;  4ODG A;  1F2M A;  5C6A A;  4B9W A;  4KY5 A;  2NUC A;  1KAB A;  5EKL A;  5KYL A;  5J39 A;  3D6C A;  1STY A;  1ENA A;  3SK5 A;  5C3X A;  2F0Q A;  4HMJ A;  4S3S A;  4WOR A;  3H6M A;  3SK4 A;  5C5M A;  5HUR A;  5IOD A;  5HGT A;  2F0V A;  3OMC A;  2F0J A;  4K14 A;  1EY9 A;  3EVQ A;  1KAA A;  5JAV A;  3RUZ A;  2F0I A;  2RDF A;  3S9W A;  4PNY A;  3EJI A;  4K6D A;  4KY7 A;  1STA A;  5I6W A;  1SYB A;  5JOB A;  5I6Y A;  1EYD A;  5CV8 A;  3SHL A;  3ERO A;  4J6H A;  5CV9 A;  1SNO A;  1F2Y A;  1EY4 A;  2F3W A;  2QDB A;  1EYC A;  2F0S A;  1TQO A;  2SNS A;  1TT2 A;  3BDL A;  3TP8 A;  1IHZ A;  5ISR A;  5C5L A;  1AEX A;  1EZ6 A;  2F0H A;  4KD4 A;  5I9P A;  1SYG A;  5KRU A;  5IGE A;  4MIU A;  3OSO A;  2HQE A;  5CR3 A; 
#chains in the Genus database with same CATH topology
 1SN8 A;  1VQM A;  2V1C C;  4IO9 A;  1VQ7 A;  4L5T A;  1HHV A;  1DYQ A;  3TEH B;  2K1B A;  1GHK A;  2YTV A;  5IGB A;  1HNX Q;  3L9A X;  3NUC A;  4JI3 Q;  4JW0 A;  2K5Q A;  1JWU D;  3PUZ A;  1VQB A;  4RG1 A;  2KEN A;  3K5M A;  2K52 A;  1IBK L;  4PV1 C;  2WB1 B;  2KJX A;  4BXX G;  3HOU B;  1VF5 C;  4DR2 Q;  4IFD G;  1GKH A;  1A2T A;  1RL2 A;  1WI5 A;  2JA5 G;  4ILW A;  4OHJ A;  1F9S A;  3MHB A;  3AU7 A;  2AWO A;  1TWH B;  4ULL A;  2CHB D;  2UXC L;  1TS2 A;  4LAA A;  1EFW A;  2X69 A;  5C44 G;  1PRT B;  1N36 L;  1BCP D;  3GTK B;  3H3V I;  2H1E A;  2N49 A;  1EY6 A;  3JAM E;  5M9O A;  1IW7 C;  3BDO A;  5C4J B;  2P5Z X;  3GO5 A;  4DPG A;  2ICI A;  2PZW A;  4XQN A;  3FP9 A;  3BYT B;  4MTN A;  3TME A;  1Z7T A;  3HOY H;  4A3D H;  1VQA A;  2EJG C;  2JP1 A;  2EY2 A;  2IL8 A;  2EIF A;  4PG3 A;  5GAE C;  3GTQ B;  2VY3 A;  3EFX D;  3G6J B;  3K81 C;  4LUV A;  3W1G A;  3QOL A;  2EY1 A;  4RKL A;  2O4X A;  4IPC A;  4X6A H;  2AQ2 B;  2JEA I;  5C3E H;  3A55 A;  4YCU A;  1IYJ B;  1O80 A;  1PV4 A;  3NTK A;  4AQY Q;  3IRB A;  3HOW B;  1PH2 A;  2FIN B;  1YVC A;  1W6J A;  4FVM A;  5HGT A;  2NVQ H;  2I07 B;  2KUM A;  2R93 G;  3VR3 A;  1KLU D;  3MXU A;  5JEA H;  4A3B G;  4JPB W;  5M5Y B;  1HUM A;  3DEO A;  3VR5 A;  4DV7 L;  4C3J H;  5C44 B;  1SMY D;  3BDL A;  4FF4 A;  1W2B A;  3FPU B;  2Q2I A;  1LT6 D;  4JC0 A;  1RF2 D;  5I9P A;  5K36 H;  1JWM D;  1EOV A;  2D9U A;  2M2L A;  3QO2 A;  5CR3 A;  5JJZ A;  5A2Q L;  3E9H A;  4LF4 L;  4R4C A;  4UP9 A;  3HOY G;  4HSV A;  2F0N A;  2F0K A;  2I0Q A;  2CKZ B;  4X64 Q;  4K2L A;  5D65 A;  1PMR A;  2XRQ D;  1JOO A;  2RHQ B;  2Z8L A;  4IPD A;  4OON A;  1LT5 D;  1O7Y A;  2JA6 G;  3PO3 G;  3T16 A;  2PQE A;  1D2B A;  3GV6 A;  2LXJ A;  1SNP A;  4DR2 L;  1W3S A;  4X62 Q;  5HY6 A;  1Y1W G;  3HKZ G;  3HOW G;  4DUZ Q;  1G29 1;  4RCO A;  5FK9 C;  5M3M B;  1SEB D;  4ZRZ A;  3STB D;  5DM6 3;  4A3I B;  4F88 A;  4TQU S;  2ZXR A;  3T53 B;  1EQV A;  4LF5 L;  5C3E G;  1NMF A;  1C7Y A;  1J6Q A;  4EVO A;  5EPK A;  3SEB A;  3Q23 A;  4K5V A;  1P16 A;  5D3D A;  1B53 A;  3KUP A;  2AWN A;  1KTK A;  4TSS A;  1FYC A;  3H15 A;  4JYA Q;  4A3J G;  1SYF A;  1R4P B;  2KBN A;  1HTP A;  3G48 A;  1Z47 A;  1OXV A;  4C3H B;  3RLO A;  2F0T A;  2WKD A;  3P20 A;  4LUZ A;  1SNM A;  4F87 A;  4I7A A;  2KHI A;  2XSC A;  2F52 A;  1VQI A;  3DUZ A;  4PMB A;  1NTG A;  4I7Z C;  3T1Y Q;  1D6E C;  2JN4 A;  3PF4 A;  1JQY D;  5JJL A;  1VQJ A;  3EN2 A;  2OT2 A;  1A62 A;  5IYD G;  1D5M C;  3CP0 A;  1YBY A;  4C2M H;  3K58 A;  1VQO A;  1GD7 A;  2AQ3 B;  3HOZ B;  2WV6 D;  4V0B A;  2I5H A;  4KN4 C;  4GKJ L;  1EQQ A;  3RZD B;  4LFC Q;  2ZM6 Q;  4DK1 A;  1XWE A;  1JIC A;  2VB2 X;  4KHP L;  4OO1 H;  2A1A A;  1ICF B;  2UUB Q;  1VQC A;  4WFN 3;  1AE2 A;  2VW9 A;  1ILQ A;  2VQF Q;  1AEX A;  1H9R A;  4KD4 A;  4QY7 A;  5FLX E;  3OTO L;  4JG2 A;  2YU9 B;  3H3V H;  3G7L A;  4YWM A;  1AP0 A;  2IPK D;  4DR7 L;  4NP5 A;  1A8V A;  4CGY B;  3I56 A;  5C0X J;  4F8M A;  2HHH L;  3U58 A;  1VQ9 A;  1H9S A;  2YV5 A;  4DAV A;  3NEL A;  1ENC A;  2JEB I;  2JK8 A;  2F0L A;  1EY7 A;  1QVF A;  3J80 E;  1G51 A;  1C8C A;  2UXB Q;  2ALY B;  3K5L A;  4RGN A;  5D3I B;  4DXF A;  5E4X A;  1G91 A;  4LFB L;  4KHV A;  1EU3 A;  4B3T Q;  1EEI D;  3LWU A;  2F0F A;  3HOX B;  1SYC A;  3PIP A;  1FL0 A;  5JEA J;  2EJF C;  1KDA A;  1L0X B;  5IOC A;  1K3B C;  1EIY B;  3FPP A;  2R92 G;  2N78 A;  4HTH A;  4B3R L;  1XNR Q;  2E2I H;  4LF9 L;  1PTO C;  2PW7 A;  4DR5 L;  2FMM A;  4RCN A;  3NQI A;  3GTP H;  5CV7 A;  2WII B;  2ZTD A;  1T9H A;  2R7Z G;  5CV6 A;  3KK7 A;  5KNB A;  4JI1 L;  3CC7 A;  1SND A;  1AZQ A;  1J9O A;  5BN4 A;  3C3L A;  4EQP A;  2EQS A;  5GRO A;  1VQ4 A;  1ZXT A;  4NDX A;  1KHI A;  2IHE A;  2EYF A;  3AMU A;  4KJO A;  3UDG A;  3NBH A;  4RGO S;  3PCO B;  3CPF A;  3M4O B;  1CI3 M;  2MJ8 A;  4DN4 M;  3ERQ A;  2EYL A;  1SJH D;  1SMX A;  1AN8 A;  3ULJ A;  5M5X B;  2QEX A;  2NVY B;  3I72 A;  4IOA A;  2MNA A;  1OXX K;  1WCM B;  2F0Q A;  4DK3 C;  1MIU A;  2F0V A;  3EVQ A;  1KAA A;  4RAU C;  4OWX B;  4DV2 L;  3DEP A;  1IKM A;  3KYH C;  3X3M A;  1QZG A;  3V05 A;  4A3D G;  1WCM H;  1TWC B;  1BBX C;  1ET9 A;  1IXR A;  1FNV A;  1IHZ A;  2NVY H;  2ICE C;  3E0E A;  4A3B B;  1X6O A;  1SYG A;  1S5D D;  5IP9 G;  1Q3L A;  3A8J E;  2NVX B;  1STB A;  1EIG A;  1SSO A;  3C46 A;  1N34 L;  4DV0 L;  1SNC A;  4C1N K;  3VA5 A;  1WYD A;  3KLR A;  3F8T A;  1VCI A;  4X3U A;  2WFW A;  4R8I A;  4LK1 C;  2UU9 Q;  2ZJQ A;  3K0Y A;  4F7X A;  2M9V A;  3DHQ A;  4DAY B;  1E3P A;  2NYZ D;  3NTI A;  3UE1 A;  1BNZ A;  5I9O A;  3HG9 A;  3A8K E;  3A54 A;  4RKB A;  3J81 c;  4HR7 B;  3G71 A;  1V1Q A;  3GTP B;  3K59 A;  1SR3 A;  3PGZ A;  4RMF A;  2QGQ A;  5IT9 L;  1K8O A;  3O13 A;  2E5L L;  3NE5 B;  1B1Z A;  3Q22 A;  4OO1 I;  3PUY A;  3S1N B;  3CCE A;  4RWS C;  5LMU Q;  1BCP B;  1JC7 A;  1VMC A;  4KTA A;  4PMC A;  1DZ1 A;  2BDO A;  3J7A 5;  4LW1 A;  4XYQ A;  4LWC A;  5BR8 L;  1Y8N B;  5CC4 A;  2OQK A;  3KFU A;  1I3Q H;  4GZY C;  1ONL A;  1Q8I A;  2QCP X;  3FDT A;  2KOL A;  5C4X G;  2EVB A;  1VQP A;  2EY6 A;  4ZLT F;  1KNA A;  4JI3 L;  4UAI A;  3ER0 A;  2Q8I B;  4KKS A;  4CDC C;  3T4A C;  4XYO A;  2IX0 A;  1YHA A;  2YTX A;  3I4N G;  4ABN A;  2B29 A;  1Q7Y C;  3I70 A;  5C5M A;  2B3G A;  3TBI B;  2D62 A;  3HOV B;  1CQF A;  3RUZ A;  1G2S A;  4LNQ A;  2XVS A;  2N8N A;  5IWA Q;  5IYB H;  3RZD H;  4KY7 A;  3JAM L;  1I4R A;  4AYB E;  2OWO A;  3MXN B;  5IYC G;  4ZCK A;  2K7V A;  4C2M B;  1EY4 A;  4A93 G;  3CQZ B;  3GD7 A;  1OO9 B;  1DCZ A;  1PZK D;  1TT2 A;  1Q1E A;  4ZKC B;  2Z4I A;  2KEC A;  2E2H B;  1RTN A;  3D3R A;  3KF8 A;  1B8A A;  1FNU A;  4R4I A;  2B2W A;  3KDF A;  1LT3 D;  2CFM A;  5I4D A;  2N55 A;  1NY4 A;  3NSW A;  2BH2 A;  4CJ0 B;  1D1I A;  4HJ5 A;  1DON A;  4H44 C;  3NWS A;  1PXU A;  2L5T A;  4NXM Q;  1JMC A;  2CW0 C;  2RF4 A;  3BVZ A;  2UXC Q;  1UE7 A;  4JI4 L;  3I7F A;  4I65 A;  3S24 A;  4LF4 Q;  4IUU A;  4LFA Q;  4GLV B;  3NXW A;  1B50 A;  3QOJ A;  2F4V Q;  3U4V A;  5NUC A;  4P74 A;  3HS0 C;  1WTV A;  1HH2 P;  1CKM A;  3U9S A;  1WVL A;  3J81 i;  2WIN B;  1LTT D;  4A3I H;  5LL6 S;  2DY7 A;  3J7Z C;  1SYE A;  2Y0S B;  2F0W A;  4AYB B;  3Q24 A;  3WOE A;  2K5N A;  5C4X H;  1CA5 A;  1ZEQ X;  2X6L A;  1MHW C;  4A93 B;  1EFI D;  2HCI A;  2B39 A;  5FO8 B;  4M1U B;  2EYP A;  4MHE A;  2JJQ A;  1B7Y B;  3A5U A;  4C1N I;  3MXP A;  2RCF A;  1A6X A;  2GVB A;  1MD2 D;  4OWW B;  3HZX A;  3PIO A;  1K0S A;  2L1B A;  1KIX A;  5EPJ A;  3NBH B;  4ODG A;  3I55 A;  2A6H C;  3NPP A;  5EKL A;  1G2T A;  2IX3 A;  4N8F A;  3GTG H;  2O5I C;  3FMC A;  5HUR A;  1PH3 A;  4C3J B;  5C44 H;  4JYA L;  4K0K L;  5M5Y H;  1IBM Q;  3VYU A;  4PMW A;  1OTC A;  2A68 D;  3RD4 A;  3SGI A;  1C0A A;  1SYB A;  2NVQ B;  1EYD A;  1RJT A;  4DR6 Q;  2Y0S E;  5CV9 A;  2R7F A;  4LMQ D;  3KJP A;  1TS5 A;  1Q1B A;  4GOP C;  2AHO B;  2UUC L;  4GN5 A;  3H0G B;  2D5D A;  1PH4 A;  3GQB A;  4DAM A;  4HCS A;  1XPO A;  2PI2 E;  1H95 A;  5C3E B;  3A0J A;  4JBJ A;  4DU9 A;  4UP8 A;  1FGB D;  4P2C B;  1BO0 A;  4Q0F A;  3CCV A;  4O1N A;  4XXE A;  4U67 3;  3GTQ H;  2UU9 L;  2PW5 A;  5KNC A;  1PRT F;  1YJ9 A;  4A3D B;  5IGD A;  4IUP A;  3J81 j;  4ZQ3 A;  3MA2 B;  3BU2 A;  2JQO A;  4JI8 L;  3CCL A;  4WJ3 M;  4YHH L;  4JI4 Q;  2RHS B;  4QIW B;  3U9O A;  5KYI A;  5JPM C;  3MEF A;  2XIW A;  4IZ8 A;  4KKT A;  3TRZ A;  4P72 A;  4RA8 A;  1B9M A;  1TWG H;  1WCM G;  4C3J G;  2L0C A;  1DOK A;  3IFD A;  4DV5 L;  2Q2U A;  3PUW A;  5J3B A;  1STN A;  4ZKB B;  3TS2 A;  4CKB A;  1KDB A;  1EYA A;  1QCB D;  4A3M H;  1KRS A;  2JA5 B;  2K01 A;  1SAP A;  2MHV A;  4TRD A;  4XTC S;  3JAM i;  2NN6 G;  4AH6 A;  3HOU H;  1GUS A;  2WB1 G;  3OW7 A;  4QUC A;  2VL6 A;  1B3Q A;  4A4I A;  3JC6 6;  4JV5 Q;  5IWA L;  1Q46 A;  2Q8R E;  2HHH Q;  2ZXP A;  3EBE A;  2JE6 I;  4DNT B;  1SRO A;  5F2D A;  1HTL D;  4OXP A;  5EGT A;  4X3K A;  5IYD H;  1K8A C;  1EEF D;  4DF7 A;  1GOZ A;  5J22 A;  4CJ2 C;  5IGC A;  1VS0 A;  1Y1W H;  2NVT H;  3BZD B;  5GAD C;  1QE6 A;  2LMC B;  4C56 C;  2JA8 H;  4GS3 A;  1ENA A;  1HZ9 A;  3I4N H;  2DY8 A;  4B3S L;  3W2D A;  4RGM A;  5EJW A;  4A3C H;  5ELB A;  2F0I A;  2K4K A;  4DXG A;  3I4O A;  2PPB C;  1FNW A;  2GN5 A;  4BY7 G;  1RDP D;  1BKB A;  3RN2 A;  1PVO A;  1HR0 W;  4J6H A;  1HRJ A;  2FJ2 A;  2QKI C;  4HJA A;  5C5L A;  5JEA G;  4X65 Q;  1IKL A;  1U4M A;  4LF6 L;  1NCV A;  3UDX A;  1MBY A;  2MQH A;  5IT9 c;  1PH8 A;  1EYG A;  4LFB Q;  3FKI G;  1KAW A;  1LYL A;  3TP5 A;  4ME5 A;  2D0P A;  2F0D A;  2PCF B;  3GTJ B;  3FKI B;  4HN7 A;  5FLM H;  1IL2 A;  4HSP A;  3IAY A;  1HNX L;  2E2J H;  2ZJR A;  4GOP A;  2DGY A;  1LUZ A;  4A3K G;  1ZKO A;  1IBK Q;  1NBW A;  1R9T H;  4DR1 Q;  5L37 A;  4JI7 L;  5GAG C;  3E5S A;  3QJY A;  5FLX c;  3L3O C;  1I50 B;  2EPB A;  1DM0 B;  1K9M C;  1ESR A;  4YHH Q;  1YNN C;  1R4Q B;  2HQL A;  3K80 C;  1L0Y B;  3B6Y A;  3HOZ G;  2I5M X;  1SBB B;  4DK0 A;  1PH5 A;  1NMG A;  5CV5 A;  2NBF A;  1MI2 A;  2VNU D;  2XTI A;  1LTS D;  1UAP A;  4DV5 Q;  4IUV A;  2XN9 C;  1UE6 A;  1YHQ A;  3S16 H;  2E8G A;  5FKA C;  3PMF A;  3R93 A;  2C5C A;  1B2T A;  2LKV A;  4QF4 A;  2A6E C;  2HCC A;  3OIQ A;  4YCW A;  3JAM c;  1KQS A;  3M3Y H;  2JA9 A;  1S72 A;  1TU2 B;  3MEH A;  4GNX A;  1N8R C;  4A3E H;  1YJN A;  3SXH A;  1E24 A;  2KCC A;  3SR1 A;  4CDE C;  2UUA L;  1E0B A;  1S5F D;  1SDF A;  3C1F A;  3CXC A;  2ASB A;  2JA7 H;  2TSS A;  1EWH A;  4K5W A;  3G4S A;  1HNZ Q;  4H7B A;  1QJO A;  1XMQ Q;  3WWV A;  1DGS A;  1NAP A;  1WTX A;  3HOV G;  3BZK A;  5AJ3 Q;  2VS1 A;  3WOF A;  3S17 B;  4B3S Q;  1CM9 A;  4IPG A;  4NPS A;  4HIK A;  2SDF A;  2KVM A;  1XPU A;  1K83 H;  2Y0S G;  2KED A;  3CRK C;  2EJM A;  1PDQ A;  3MAQ A;  1SNO A;  1F2Y A;  2F3W A;  5G3L D;  4BY7 B;  1EZ6 A;  3CME A;  1AFP A;  1SFO H;  2VQE Q;  3MC0 B;  5IGE A;  1Y14 B;  4Y7N H;  5E3F A;  3WDN A;  4NMZ A;  3VYT A;  1PYB A;  2F1M A;  2MO0 A;  2K05 A;  4DV1 Q;  4L5S A;  2IHF A;  3T1H L;  1GHJ A;  2SEB D;  2VUM H;  2V4D A;  3BDC A;  1PH7 A;  1SE2 A;  5IT9 E;  4OWT B;  5TSS A;  3J81 E;  1LTI D;  4R1J A;  4JI8 Q;  5JVG 3;  5M3F H;  4FF2 A;  4A3L H;  3CCS A;  2M00 A;  3R2T A;  1PA6 A;  4WRD A;  2EE1 A;  4R4O A;  3OWF A;  2A69 D;  5LMU L;  1A3V A;  4ID6 A;  1F2L A;  2EY5 A;  4BBS B;  1JOQ A;  1UUP A;  1KDC A;  5G3L F;  3RZO H;  2A73 B;  3E6Z X;  1VQN A;  3E3X A;  4DR7 Q;  2NZO A;  1X65 A;  4O0A A;  4X66 L;  1NJI C;  2XWB B;  1PTO B;  1ML0 D;  2D2C C;  3KBG A;  2F03 A;  5LHY 1;  4KY6 A;  3MZ5 A;  1VQG A;  1I94 L;  3HRZ C;  2B2V A;  4XT3 B;  5M5W B;  1I5F A;  3S14 B;  4IFD H;  1JOR A;  4BBR B;  3K8A A;  2ZM6 L;  3F2C A;  2CWP A;  2R93 B;  3EA6 A;  4JI0 Q;  4A3J H;  4IQZ A;  3E0J A;  2KEE A;  1LM0 A;  2BDN A;  5IGF A;  1GUW A;  3S1R B;  1HR0 L;  4UHV A;  1K8G A;  1KLG D;  1QNK A;  5KND A;  1EQR A;  1EOT A;  2HIV A;  1M90 C;  1JE5 A;  1UE5 A;  4UP7 A;  1K0R A;  5C3W A;  3UI2 A;  1MJC A;  1VF7 A;  2VZA A;  4P71 A;  1STY A;  2PO4 A;  2I46 A;  1CKO A;  2QEJ C;  2WAQ B;  4K0K Q;  4G7O C;  3KLW A;  4DUY L;  3M7N A;  3K6O A;  2QIL A;  1VDZ A;  4PQX A;  2ZJP A;  4K6L A;  5LMN Q;  5I6Y A;  5E4W C;  3OMC A;  5LMN W;  2A8V A;  3TP8 A;  1F9P A;  1YHB A;  5ISR A;  3RN5 A;  2N3S A;  3GDE A;  4LF8 L;  3QR8 A;  1A15 A;  2HQE A;  4JOI A;  3SVM A;  1VQH A;  1XX8 A;  3OWE B;  2PMZ E;  1II3 A;  3S1R H;  4B08 A;  4HED A;  4RFB A;  4YY3 Q;  2OF1 A;  2K03 A;  2FMC A;  3MWY W;  1NUC A;  1UEA B;  2YYZ A;  4EX5 A;  1CHP D;  2R93 H;  1EZ8 A;  4BBR H;  4DKA C;  1YNJ C;  2C35 B;  5C0X H;  2F4V L;  3CD6 A;  4GKK L;  3X3N A;  4TVA B;  5BN3 A;  5M5W H;  3TZD A;  1PFN A;  3P1H A;  2KQ3 A;  3VA7 A;  4A3K H;  2L4N A;  2ZT9 C;  1IW7 D;  2ATW A;  4A3I G;  3URY A;  1YIJ A;  2A74 C;  3A8I E;  5EBC A;  4XDX A;  3AFP A;  2OXP A;  2K75 A;  4RGT A;  1HQM C;  1H9K A;  4LF6 Q;  3OHX C;  2PYK A;  5K36 G;  1AW7 A;  4N9T A;  3MFG A;  4DV4 Q;  3T56 B;  3RZO B;  4ZAI A;  1BVS A;  2ID0 A;  4IUT A;  3EIV A;  1NR4 A;  3ONA B;  4BBS G;  1ENF A;  4K8J A;  5JJK A;  1IBM L;  3VR6 A;  4BY1 G;  2BCO A;  2Z4H A;  2UXB L;  3TDQ A;  5E1F A;  3GTM H;  2R92 B;  1PZI D;  1V43 A;  3V2T A;  4PZ6 A;  4WJ4 A;  2EXZ A;  1I4X A;  4FYD A;  1S3O A;  2F0U A;  5FLX L;  4DUZ L;  5COY A;  4UY8 C;  1M4V A;  1X9N A;  3VYR A;  2VUM B;  4IFD J;  3S1Q B;  3PO2 H;  2OTL A;  2VXW A;  1CKN A;  3NEN A;  3EQL C;  1QIL A;  1HQR D;  3QWN A;  2R7D A;  2R3Z A;  2N88 A;  5COR A;  4G7Z C;  4DA2 A;  1JB7 A;  1TWA H;  2F0G A;  2Z6K C;  2PZU A;  3S15 B;  1JJC B;  1SFO B;  5CGK A;  1KL9 A;  1YZ6 A;  2KHJ A;  3M4P A;  1G8Z D;  1KAB A;  1UWV A;  4QQB X;  3NEM A;  3D6C A;  1Q90 A;  1S5B D;  1KD1 C;  4BY7 H;  2CW0 D;  2FXQ A;  2R6G A;  2OQ0 A;  2IWH A;  5IOD A;  3AYH B;  5GAH C;  1HFN A;  4G4K A;  4JK1 C;  3AFQ A;  5LL6 X;  3KBX A;  1N32 Q;  4YY3 L;  1Z6H A;  2WP8 J;  3DWA A;  1CKN B;  4XQQ A;  3GTL H;  3I4M B;  2XWJ B;  1GO3 E;  1IL8 A;  1RTO A;  4IFD I;  1B9N A;  2KA7 A;  3D6W A;  2B2U C;  1OXT A;  4KV6 A;  1F9Q A;  3HGB A;  5IE8 A;  4DV6 Q;  1HZC A;  1STG A;  1L1O A;  1TII D;  3I4L A;  3S2D H;  3A56 A;  3DWP A;  3GP7 A;  5ELE A;  2IT1 A;  2K32 A;  1QB5 D;  3STB C;  2K5D A;  1SE3 A;  2DNC A;  3MVV A;  4A3E B;  1JB3 A;  3CAM A;  1U9R A;  3W5O A;  3QIA A;  1IBL Q;  3M3Y B;  5EKK A;  3BG3 A;  4C3I H;  1PH6 A;  3K7A H;  4IJH A;  1BUV T;  3S16 B;  4GLX A;  2IX1 A;  4FNF A;  1U4R A;  4DNI A;  4OGQ C;  2F0P A;  3NK9 A;  3GTO H;  1STH A;  2OCE A;  2F0M A;  4FDB A;  3HP3 A;  1UEB A;  3F1Z A;  4JV5 L;  5DLQ E;  2Q2T A;  5J1Z A;  3S1M B;  3AB9 A;  1N34 Q;  1WTO A;  2G9H D;  1RIP A;  2HD3 A;  4JI1 Q;  3R8B A;  4ZK9 B;  1X3P A;  4IN3 A;  1I50 H;  4YIJ A;  1SJE D;  4X66 Q;  3QB3 A;  2F0E A;  2LXK A;  1WTQ A;  2CH4 A;  1I94 Q;  1SE4 A;  4IPH A;  1HA5 A;  4HMI A;  3NHH A;  2E2J B;  2RSO A;  3TSS A;  4A3L G;  1X32 A;  3I8Z A;  4DR5 Q;  2B8G A;  1I6H B;  3FKI H;  1IBL L;  3MXN A;  2DN8 A;  3D4R A;  1VQK A;  1IYV A;  2D0O A;  1NE3 A;  4R8N A;  4GKJ Q;  1Y1V B;  2L11 A;  3PO3 H;  4HJ8 A;  4GNX C;  1F2M A;  1E22 A;  2A19 A;  1KNE A;  5KYL A;  3CHB D;  3OYY A;  5FO9 B;  1GM5 A;  2MO1 A;  4J8Q A;  1LV9 A;  1H9S B;  4NB3 A;  4CHT B;  1YIT A;  4FF1 A;  4S3S A;  4WOR A;  1S5C D;  3SK4 A;  1PFM A;  2F0J A;  4PZ8 A;  4A3G G;  3S9W A;  3TRE A;  1EUJ A;  2B63 B;  3K5O A;  2PQA B;  4A3G B;  2JA8 G;  1NNX A;  1BBW A;  5EQ0 A;  3IL8 A;  3I4N B;  3SDZ A;  5FO7 B;  2Z9H A;  4NW2 A;  2JA8 B;  3M85 A;  3S2H H;  3CC2 A;  4HIO A;  3M9B A;  4X3S A;  1V1P B;  1J5E Q;  1Y1W B;  3HKZ B;  2UUC Q;  2WAQ G;  3FEW X;  3OMG A;  1D5Z C;  1XTC D;  3DWQ A;  3CU7 A;  3T13 A;  2L55 A;  4L6T B;  1A3T A;  1JCK B;  1QUQ B;  2NZ1 D;  4RH6 A;  1KXL A;  3DM1 A;  3PV0 A;  1I4G A;  1XXG A;  3H3V C;  2TMP A;  5DAU A;  2FHT A;  2ZTC A;  1A0I A;  4N8X 1;  1RKN A;  3C1E A;  3D4W A;  4E6I A;  1HZB A;  2HDM A;  2XNA C;  3CF5 A;  3TP7 A;  2UUA Q;  1TS4 A;  1VQE A;  1TWF B;  4LF7 L;  4IUN A;  1JR0 D;  5IP9 H;  4ME3 A;  2JA5 H;  3CC4 A;  4A3M B;  5DNF A;  3RLN A;  3OOC A;  4DV4 L;  3T1H Q;  2RCN A;  4K2K A;  4DV2 Q;  2IY5 B;  2AUJ D;  1W6K A;  1N36 Q;  1A3U A;  4A3F H;  2DJF C;  1TWG B;  4HID A;  2CQA A;  1TY0 A;  1B3A A;  2JA6 B;  2HDL A;  4TKO B;  1B44 D;  2A68 C;  1EIH A;  2MPM A;  1O7L A;  1UNS A;  5C0X G;  5IP7 H;  1VQD A;  3OW2 A;  2HT1 A;  2K6A A;  4DK6 C;  3D31 A;  3I3C A;  3HOX G;  1XNQ L;  3FHW A;  3LGJ A;  2L9H A;  4JI0 L;  2JXM B;  4R9W A;  1K8M A;  3RLF A;  3ZJY C;  3OPO A;  1HUN A;  2A6E D;  3NWT A;  4KK7 A;  2CWA A;  1PH1 A;  2XGT A;  4V19 0;  5EPL A;  1M8A A;  1C9O A;  1WOC A;  1MJE A;  4QMG A;  3KF6 B;  1L0W A;  1XJV A;  4FXK C;  4JOI C;  4QL5 A;  5I2Y A;  3H0G H;  4JI7 Q;  4IUQ A;  2NUC A;  2R7Z B;  1QUQ A;  2K50 A;  3DM3 A;  1DOM A;  4J15 A;  1S40 A;  2B2Y A;  3T51 B;  5BR8 Q;  4K14 A;  2Q2H A;  2F3I A;  3L2P A;  3KF6 A;  2NZH A;  2E2D C;  2VQE L;  1CTM A;  1DJR D;  4G7H C;  5JOB A;  1Q81 C;  1N32 L;  1RCV D;  2BE5 D;  1YJW A;  4CKC A;  3GTG B;  4OIJ A;  1EYC A;  1HXY D;  2F0S A;  2NTS A;  3NBI A;  4FO2 A;  2R7Z H;  5D14 A;  3QG1 A;  1KRT A;  4XT1 B;  4FF3 A;  1HNW Q;  1C48 A;  1WD1 A;  1MGS A;  4X65 L;  3ICE A;  4JVZ A;  1N9W A;  1V9P A;  5IYB G;  3HOU G;  1CT1 D;  1D1K A;  4H0L C;  3PF5 A;  2H5X A;  5JVH 3;  1SE8 A;  3TZU A;  3J7A F;  1HR0 Q;  3CCQ A;  4Q5V A;  1TXY A;  1Q12 A;  2F0O A;  4A93 H;  5ELC A;  1CQV A;  3BVM A;  4EQ5 A;  1XYI A;  3UE0 A;  2JA6 H;  4EQO A;  5C4X B;  1GJX A;  2RVL A;  1X54 A;  3LWE A;  4A3F B;  3R2I A;  2F4I A;  4P75 A;  4ALP A;  2RQX A;  1MSH A;  4CJ1 B;  5EBD A;  1Q82 C;  4DV6 L;  2QA4 A;  1RD9 D;  1CA6 A;  4UPA A;  3J7A V;  4A3M G;  3FRP B;  4X64 L;  4DUY Q;  4JBW A;  1Q8K A;  1TWF H;  3P7J A;  4OIK A;  1C4Q A;  3CRL C;  1X55 A;  4DV0 Q;  4K8I A;  2Q8T A;  5JJI A;  1LT4 D;  4DV7 Q;  1VQL A;  1BXT A;  4DNR B;  4R4T A;  3ULL A;  1GUG A;  1U5K A;  5I2X A;  4IAL A;  4L63 B;  1JOK A;  2EZV A;  2BH8 A;  4JI5 Q;  4X3T A;  4GKK Q;  2F3V A;  1EIF A;  2R61 A;  1LAB A;  2RDH A;  3KLS A;  1LTG D;  1X3E A;  4HCE A;  2ENB A;  5A2Q E;  4DGZ A;  5AFW A;  1EY8 A;  1SLJ A;  3PSI A;  2EXD A;  1PFS A;  2X6G A;  2QDL A;  1LTB D;  4KY5 A;  2E2H H;  3S2H B;  3CQZ H;  1PLF A;  3SK5 A;  1CHQ D;  4LF8 Q;  4QGU A;  3C2P A;  4GNX B;  3A5Z B;  3CKI B;  4A3G H;  2B63 H;  2RDF A;  1V1O A;  2NWG A;  3HOV H;  1O78 A;  1YNX A;  2UUB L;  1PHJ A;  1JWS D;  1T5E A;  4MNO A;  2SNS A;  2NVT B;  1LLR D;  1V8Q A;  1YI2 A;  1E1O A;  3M7G A;  1OXS C;  2EOT A;  3PO3 B;  1QOH A;  1Y1V H;  2Z6B A;  1J5E L;  1WFQ A;  3V96 A;  4NXM L;  1K3R A;  1SRU A;  3DLL A;  1XNR L;  5FJ8 H;  4HIM A;  1I3Q B;  1I6H H;  4CBV A;  3BVG A;  3J7Y W;  4KJN A;  1H9J A;  4FXG C;  2B2T A;  2RA4 A;  2PQA A;  2BA0 A;  1OXU A;  3MTS A;  3RMH A;  1E1T A;  2K5V A;  1PRT C;  1E2Z A;  5CV4 A;  1X3G A;  3ERS X;  2BOS A;  3S1N H;  2C9O A;  3CPW A;  4OO1 G;  1YNJ D;  2EYH A;  4BBR G;  1L2F A;  2SOB A;  1HA6 A;  1LTR D;  3D0F A;  1GUN A;  3NP8 A;  3S1M H;  4L5R C;  3GTO B;  4JI2 L;  3HFZ B;  4A3F G;  2NB0 A;  1WTH A;  4H02 A;  4R4Q A;  3UDF A;  2EYO A;  4DV1 L;  1F9R A;  3K7A B;  1TR5 A;  2WAC A;  5CYU A;  2A6H D;  2L15 A;  3PIO 3;  1BQQ T;  4KD3 A;  2CH4 W;  4C3I B;  3AQQ A;  1H9M A;  4ZYS A;  1KC8 C;  3D8G A;  3UDI A;  4DR1 L;  2B63 G;  2E74 C;  3KF8 B;  3MFY A;  4QJF A;  3F2U A;  1EWI A;  1CSQ A;  5FJ8 G;  2HUG A;  4LUO A;  3PUX A;  1F2Z A;  2K33 A;  1LTL A;  1EY5 A;  4EQN A;  1CZG A;  3S2D B;  2J7Z A;  1IZ6 A;  2KHS A;  4QB4 A;  2VB3 X;  2NN6 H;  5IYC H;  4B9X A;  3CMA A;  2NVX H;  2E76 C;  1PRT D;  2AMC B;  4DR6 L;  1D5X C;  3VYS A;  4A3B H;  1PFB A;  5C6A A;  3I4M H;  3GTL B;  4U68 A;  2UXD Q;  1FD7 D;  2BA1 A;  3K7U C;  4B3M Q;  1TWC H;  1QVC A;  4HMJ A;  3H6M A;  1QNU A;  2JYO A;  3ZYY X;  1BDO A;  1EY9 A;  2B8F A;  2QW7 A;  3TQY A;  1ET6 A;  4DV3 Q;  5CMD A;  1CSP A;  3EJI A;  1XNQ Q;  4KMU C;  5C0X I;  1STA A;  4GOP B;  3RNU A;  1X3Q A;  2A69 C;  3SHL A;  2AQ1 B;  2H4O A;  5E7N A;  4CDF C;  4YCV A;  1GUO A;  3TN2 A;  3F2B A;  1I6V C;  1BCP F;  5M5X H;  5JPN C;  3VDY A;  4BA1 I;  1ILP A;  3S15 H;  1TWA B;  2PNH A;  3MXG A;  4ZUI A;  4OEM B;  2IW3 A;  1BOS A;  1XMQ L;  3M4O H;  3KOJ A;  2G5D A;  4BS9 A;  4C3I G;  1V1P A;  2B2W C;  1XMO L;  1GUT A;  3PO2 B;  3S1Q H;  2VUM G;  3VR2 A;  5KEE A;  4LF7 Q;  1CFM A;  4JI2 Q;  2RSN A;  3ITP A;  2R92 H;  3GTM B;  4OL7 A;  4AQY L;  2B2V C;  3A74 A;  3I4M G;  1VQ6 A;  4B3R Q;  2XRS D;  1BCP C;  1GVP A;  3W3A A;  1N33 L;  3HEJ A;  3K57 A;  4AIM A;  4LFA L;  1FJG Q;  2EYJ A;  5GQO A;  2RBM A;  2E2I B;  4BXX H;  4C3H G;  3J80 L;  1Y69 U;  5FLM G;  2ZXO A;  2MP1 A;  5ELN A;  2E5L Q;  1SYD A;  2QF7 A;  2K04 A;  2KCM A;  1STE A;  1TY2 A;  5IP7 G;  2ES2 A;  1BR9 A;  1ZYR C;  3HOX H;  2JSO A;  2VQF L;  2CCZ A;  1QG7 A;  2I5L X;  4M8A A;  3J81 L;  4O42 A;  4A3K B;  4YWK A;  3E9I A;  4KLK A;  4KHZ A;  1PYS B;  1WTR A;  1AZP A;  3I90 A;  3FVQ A;  3PUV A;  1QWY A;  2MUY A;  3A7L A;  2NTT A;  3ND9 A;  5HGQ A;  1F77 A;  4KI0 A;  3RR5 A;  4K5X A;  1SXT A;  2E75 C;  1BF4 A;  1L1O C;  3PO2 G;  3HKS A;  2LS0 1;  4DR4 L;  1E2V A;  2K14 A;  2WB1 E;  1HPC A;  1DXM A;  4ZUJ A;  2B2U A;  2YU9 H;  3N6R A;  5H1S E;  4UDU C;  4B9W A;  4QIW E;  1PTO D;  1TVX A;  4NXN Q;  5J39 A;  3N52 A;  2KCT A;  2CVR A;  4DR3 L;  1VMP A;  3L7Z C;  1EQT A;  3U50 C;  2PNR C;  3DXJ C;  4A3E G;  3BJU A;  4PNY A;  5T1G A;  2K5W A;  5I6W A;  1NR2 A;  3HOZ H;  1S5E D;  4JI6 L;  5ELF A;  3T1Y L;  3H91 A;  2GVA A;  2QDB A;  2L12 A;  4L5Q A;  3CW2 C;  3BS1 A;  3PIP 3;  1K28 A;  2JA7 G;  2Z6K A;  4GN3 B;  4OX9 Q;  5CBA E;  5KRU A;  4MIU A;  3OSO A;  1LO5 D;  3NTH A;  1FGU A;  4HJ9 A;  3VR4 A;  2WAQ E;  4MTK A;  5KIX A;  3CCU A;  4C3H H;  3NQT A;  1JE4 A;  1T5X D;  2YTY A;  1EL0 A;  2Z0S A;  4A3J B;  3M4Q A;  2J4X A;  4JBK A;  3KLS X;  1Y8O B;  2B2T C;  1EY0 A;  1RHP A;  4CKE A;  2LFN A;  2G9D A;  3U4Z A;  2DUD A;  3S14 H;  1SNQ A;  3LX0 A;  3M4Y A;  4LF5 Q;  1DOL A;  3P75 A;  1ICW A;  1PZJ D;  4NXN L;  4JI5 L;  3J80 i;  1PTO H;  1UE1 A;  2RDG A;  4HAE A;  3GV3 A;  4JBM A;  1D7Q A;  4HJ7 A;  5BN5 A;  1WD0 A;  4X62 L;  3H09 A;  3LNN A;  4NKL A;  4WJW A;  5FOB B;  5M3M H;  2O5J C;  1G6P A;  2EYM A;  1FR3 A;  4KHP Q;  3AEV A;  4BBS H;  1AH9 A;  4DAP A;  3SK6 A;  1A63 A;  1WJJ A;  4DAY A;  1Z9F A;  4G57 A;  4BWG B;  4RHR A;  1B70 B;  5M3F G;  1VQ5 A;  4OX9 L;  4DFA A;  1PTO F;  1PYW D;  1ZYR D;  3HKZ E;  5M3F B;  4GLA C;  2DJG C;  1YEZ A;  5DEH A;  1E2W A;  4BA2 I;  1JT8 A;  1HNW L;  4XIG S;  2RKS A;  2OTJ A;  2HIX A;  1JJ2 A;  2PZT A;  1YNN D;  5ELD A;  1MKH A;  4A3C G;  4APV A;  1D8L A;  1E7Z A;  5EAY A;  3TP6 A;  3R3O A;  4YWL A;  4XQJ A;  4Y7N B;  2EDG A;  4JI6 Q;  4DR4 Q;  1DD2 A;  4MN3 A;  1PH9 A;  4IJL A;  2PMZ B;  2UXD L;  4PZ7 A;  1P8L A;  1L1O B;  3W1B A;  3OTO Q;  4CDD C;  1K83 B;  4QCL A;  4DR3 Q;  1HFG A;  5JAV A;  3I73 A;  2GA4 B;  5M3M G;  4K6D A;  3KJO A;  1TKW B;  1WTP A;  3S17 H;  5CV8 A;  5EKI A;  3ERO A;  2ZTE A;  4LFC L;  3HOW H;  3ND8 A;  2WKC A;  2A5H A;  1S4Z A;  1LTA D;  5AJ3 L;  1K73 C;  1X3F A;  4N9P A;  2JA7 B;  2BE5 C;  2PI2 A;  2MFI A;  3KDF B;  4H13 C;  3F2D A;  5DM7 3;  2FFK B;  1A2U A;  4B3M L;  4Y52 H;  5LMN L;  4L8J A;  2OEO A;  3I91 A;  1U0L A;  1EU4 A;  5IGG A;  5ELO A;  2K5H A;  4Z9C B;  4DV3 L;  1VQF A;  2O2L D;  3HOY B;  4OEL B;  1G6Z A;  1U4L A;  4J1M A;  1BBU A;  1CK1 A;  2AUK A;  2DNE A;  2IJ0 A;  5CBE E;  5C4J H;  4FXD A;  1VQ8 A;  1HZA A;  4AYB G;  1CZW A;  2CQO A;  1J8I A;  3GTK H;  3CCM A;  1N33 Q;  1ESF A;  3CCJ A;  4A75 A;  4IUR A;  1XPR A;  1O7I A;  5IY0 A;  1TWH H;  3I2Z A;  5C4Z A;  3ULP A;  4KN7 C;  1X56 A;  5C4H A;  1EWC A;  3OIP A;  1XMO Q;  1QZH A;  1GXD C;  3D4D A;  4RHS A;  1R9T B;  4EGV A;  1LAC A;  1ASZ A;  5A35 A;  4LF9 Q;  2B2Y C;  1I4H A;  1O7Z A;  2SNM A;  2KCN A;  5K5P A;  1CUK A;  3SK8 A;  3K5N A;  3Q6S A;  4FP5 D;  3L0O A;  5IIF A;  3IFT A;  2LSS A;  3J80 c;  1Q86 C;  3DMU A;  3GTJ H;  4B3T L;  3SE0 A;  3BYY B;  1U4P A;  1NSN S;  2MGS A;  1MSG A;  4P73 A;  3TS0 A;  5T1I A;  4BY1 H;  3Q0A A;  1I4P A;  2NN6 I;  4KKU A;  1HCZ A;  4A76 A;  4MZ9 A;  1B4O A;  2Z1C A;  1I4Q A;  1WTW A;  4O2D A;  3PQI A;  1QVG A;  5C3X A;  1AE3 A;  1TS3 A;  3BZC A;  1HNZ L;  1Y8P B;  3H94 A;  4IOC A;  1M1K C;  2K28 A;  3H0G G;  4GN4 B;  1JJG A;  1Y1V G;  1HJP A;  3IKJ A;  3Q8D A;  2AKW B;  4JCV E;  1ROD A;  1IYU A;  2J0T D;  3CCR A;  1SMY C;  1FJG L;  1ASY A;  1TQO A;  3A7A B;  4QUF A;  2F0H A;  4POG A;  3K0X A;  4POF A;  1XTD A;  2LY7 A;  4BY1 B;  4LJZ C;  3G6E A;  1FVI A;  5KGU A; 
#chains in the Genus database with same CATH homology
 1HHV A;  1DYQ A;  2K1B A;  1GHK A;  5IGB A;  3L9A X;  3NUC A;  2K5Q A;  1JWU D;  3PUZ A;  3K5M A;  4PV1 C;  2WB1 B;  2KJX A;  3HOU B;  1VF5 C;  4IFD G;  1A2T A;  4ILW A;  4OHJ A;  1F9S A;  3MHB A;  3AU7 A;  2AWO A;  1TWH B;  4ULL A;  2CHB D;  1TS2 A;  4LAA A;  2X69 A;  1PRT B;  1BCP D;  3GTK B;  2H1E A;  1EY6 A;  3JAM E;  5M9O A;  1IW7 C;  3BDO A;  5C4J B;  3GO5 A;  2ICI A;  2PZW A;  4XQN A;  3BYT B;  3TME A;  1Z7T A;  2EJG C;  2JP1 A;  2EY2 A;  2IL8 A;  3GTQ B;  3EFX D;  3G6J B;  3QOL A;  2EY1 A;  4RKL A;  2O4X A;  2AQ2 B;  2JEA I;  3A55 A;  1O80 A;  3NTK A;  3HOW B;  2FIN B;  1W6J A;  4FVM A;  5HGT A;  2I07 B;  2KUM A;  3VR3 A;  1KLU D;  3MXU A;  5JEA H;  5M5Y B;  1HUM A;  3DEO A;  3VR5 A;  5C44 B;  1SMY D;  3BDL A;  4FF4 A;  3FPU B;  1LT6 D;  1RF2 D;  5I9P A;  5K36 H;  1JWM D;  2D9U A;  2M2L A;  3QO2 A;  5CR3 A;  5A2Q L;  5JJZ A;  4HSV A;  2F0N A;  2F0K A;  4K2L A;  5D65 A;  1PMR A;  2XRQ D;  1JOO A;  2Z8L A;  1LT5 D;  1O7Y A;  3T16 A;  2PQE A;  1D2B A;  3GV6 A;  1SNP A;  1G29 1;  4RCO A;  5FK9 C;  5M3M B;  1SEB D;  4ZRZ A;  5DM6 3;  4A3I B;  4F88 A;  4TQU S;  2ZXR A;  3T53 B;  1EQV A;  4EVO A;  5EPK A;  3SEB A;  3Q23 A;  4K5V A;  5D3D A;  1B53 A;  3KUP A;  2AWN A;  1KTK A;  4TSS A;  1FYC A;  1SYF A;  1R4P B;  1HTP A;  1Z47 A;  1OXV A;  4C3H B;  2F0T A;  2WKD A;  3P20 A;  1SNM A;  4F87 A;  2XSC A;  3DUZ A;  4PMB A;  4I7Z C;  1D6E C;  1JQY D;  2OT2 A;  1D5M C;  3K58 A;  2AQ3 B;  3HOZ B;  2WV6 D;  4V0B A;  4KN4 C;  3RZD B;  4DK1 A;  1XWE A;  1JIC A;  2VB2 X;  4OO1 H;  4WFN 3;  1ILQ A;  1AEX A;  1H9R A;  4KD4 A;  5FLX E;  2YU9 B;  1AP0 A;  3G7L A;  2IPK D;  4NP5 A;  4CGY B;  5C0X J;  4F8M A;  1H9S A;  4DAV A;  1ENC A;  2JEB I;  2F0L A;  1EY7 A;  3J80 E;  1C8C A;  3K5L A;  4RGN A;  5D3I B;  4DXF A;  5E4X A;  1G91 A;  4KHV A;  1EU3 A;  1EEI D;  3LWU A;  2F0F A;  3HOX B;  1SYC A;  5JEA J;  2EJF C;  1KDA A;  1L0X B;  5IOC A;  3FPP A;  4HTH A;  1PTO C;  2PW7 A;  2FMM A;  4RCN A;  3NQI A;  5CV7 A;  2WII B;  5CV6 A;  3KK7 A;  5KNB A;  1SND A;  1AZQ A;  1J9O A;  5BN4 A;  3C3L A;  4EQP A;  1ZXT A;  4NDX A;  2EYF A;  3AMU A;  4KJO A;  3NBH A;  4RGO S;  3M4O B;  1CI3 M;  2MJ8 A;  4DN4 M;  3ERQ A;  2EYL A;  1SJH D;  1AN8 A;  5M5X B;  2NVY B;  3I72 A;  1OXX K;  1WCM B;  2F0Q A;  2F0V A;  3EVQ A;  1KAA A;  4RAU C;  3DEP A;  1IKM A;  3X3M A;  3V05 A;  1TWC B;  1BBX C;  1ET9 A;  1FNV A;  1IHZ A;  2ICE C;  4A3B B;  1SYG A;  1S5D D;  1Q3L A;  3A8J E;  2NVX B;  1STB A;  1EIG A;  1SSO A;  3C46 A;  1SNC A;  4C1N K;  3VA5 A;  3KLR A;  1VCI A;  4X3U A;  4R8I A;  4LK1 C;  3K0Y A;  4F7X A;  2M9V A;  3DHQ A;  2NYZ D;  3NTI A;  1BNZ A;  5I9O A;  3HG9 A;  3A8K E;  3A54 A;  4RKB A;  4HR7 B;  3GTP B;  3K59 A;  5IT9 L;  1K8O A;  3O13 A;  3NE5 B;  1B1Z A;  3Q22 A;  4OO1 I;  3PUY A;  3S1N B;  4RWS C;  1BCP B;  1JC7 A;  1VMC A;  4KTA A;  4PMC A;  1DZ1 A;  2BDO A;  4XYQ A;  1Y8N B;  5CC4 A;  4GZY C;  1ONL A;  1Q8I A;  2QCP X;  3FDT A;  2KOL A;  2EVB A;  2EY6 A;  4ZLT F;  1KNA A;  4UAI A;  2Q8I B;  4KKS A;  3T4A C;  4XYO A;  2IX0 A;  4ABN A;  3I70 A;  5C5M A;  3TBI B;  2D62 A;  3HOV B;  1CQF A;  3RUZ A;  1G2S A;  2XVS A;  4KY7 A;  3JAM L;  1I4R A;  2K7V A;  4C2M B;  1EY4 A;  3CQZ B;  3GD7 A;  4ZKC B;  1OO9 B;  1DCZ A;  1PZK D;  1Q1E A;  1TT2 A;  2Z4I A;  2KEC A;  2E2H B;  1RTN A;  3D3R A;  3KF8 A;  1FNU A;  2B2W A;  1LT3 D;  5I4D A;  2N55 A;  3NSW A;  4CJ0 B;  1D1I A;  1DON A;  4H44 C;  3NWS A;  1PXU A;  2L5T A;  2CW0 C;  3BVZ A;  4I65 A;  4IUU A;  3NXW A;  1B50 A;  3QOJ A;  5NUC A;  3HS0 C;  1WTV A;  3U9S A;  1WVL A;  2WIN B;  1LTT D;  5LL6 S;  2DY7 A;  1SYE A;  2Y0S B;  2F0W A;  4AYB B;  3Q24 A;  3WOE A;  1CA5 A;  1ZEQ X;  2X6L A;  4A93 B;  1EFI D;  2HCI A;  2B39 A;  5FO8 B;  4M1U B;  2EYP A;  4MHE A;  4C1N I;  3MXP A;  1A6X A;  1MD2 D;  3HZX A;  2L1B A;  5EPJ A;  4ODG A;  2A6H C;  3NPP A;  5EKL A;  1G2T A;  2IX3 A;  2O5I C;  3FMC A;  5HUR A;  4C3J B;  3VYU A;  4PMW A;  2A68 D;  3RD4 A;  1SYB A;  2NVQ B;  1EYD A;  1RJT A;  5CV9 A;  4LMQ D;  1TS5 A;  1Q1B A;  3H0G B;  2D5D A;  3GQB A;  4HCS A;  5C3E B;  4DU9 A;  1FGB D;  4P2C B;  1BO0 A;  4Q0F A;  4O1N A;  4XXE A;  4U67 3;  2PW5 A;  5KNC A;  1PRT F;  4A3D B;  5IGD A;  4IUP A;  4ZQ3 A;  3MA2 B;  4QIW B;  3U9O A;  5KYI A;  5JPM C;  2XIW A;  4IZ8 A;  4KKT A;  4RA8 A;  1B9M A;  4C3J G;  2L0C A;  1DOK A;  3IFD A;  3PUW A;  1STN A;  4ZKB B;  4CKB A;  1KDB A;  1EYA A;  1QCB D;  2JA5 B;  2K01 A;  1SAP A;  2MHV A;  4TRD A;  4XTC S;  2NN6 G;  1GUS A;  3OW7 A;  4QUC A;  2Q8R E;  2ZXP A;  2JE6 I;  4DNT B;  5F2D A;  1HTL D;  5EGT A;  4X3K A;  1EEF D;  4DF7 A;  1GOZ A;  5J22 A;  4CJ2 C;  5IGC A;  3BZD B;  1QE6 A;  2LMC B;  4C56 C;  1ENA A;  2DY8 A;  3W2D A;  4RGM A;  5EJW A;  5ELB A;  2F0I A;  4DXG A;  2PPB C;  1FNW A;  1RDP D;  4J6H A;  1HRJ A;  2FJ2 A;  2QKI C;  5C5L A;  5JEA G;  1IKL A;  1U4M A;  1NCV A;  1MBY A;  3TP5 A;  2F0D A;  2PCF B;  4ME5 A;  3GTJ B;  3FKI B;  4HN7 A;  4HSP A;  3IAY A;  1ZKO A;  3E5S A;  3QJY A;  3L3O C;  1I50 B;  2EPB A;  1DM0 B;  1ESR A;  1YNN C;  1R4Q B;  1L0Y B;  4DK0 A;  1SBB B;  5CV5 A;  2NBF A;  1MI2 A;  2VNU D;  1LTS D;  1UAP A;  2XN9 C;  4IUV A;  5FKA C;  3PMF A;  3R93 A;  2C5C A;  1B2T A;  2LKV A;  4QF4 A;  2A6E C;  2HCC A;  3OIQ A;  1TU2 B;  3MEH A;  3SXH A;  2KCC A;  3SR1 A;  1E0B A;  1S5F D;  1SDF A;  3C1F A;  2TSS A;  1EWH A;  4K5W A;  4H7B A;  1QJO A;  1WTX A;  1NAP A;  3WOF A;  3S17 B;  1CM9 A;  2SDF A;  2KVM A;  3CRK C;  2KED A;  3MAQ A;  2EJM A;  1PDQ A;  1SNO A;  1F2Y A;  2F3W A;  5G3L D;  4BY7 B;  1EZ6 A;  1AFP A;  3MC0 B;  5IGE A;  5E3F A;  3WDN A;  4NMZ A;  3VYT A;  2F1M A;  2K05 A;  1GHJ A;  2SEB D;  2V4D A;  3BDC A;  1SE2 A;  5IT9 E;  5TSS A;  3J81 E;  1LTI D;  5JVG 3;  4FF2 A;  2M00 A;  3R2T A;  4WRD A;  2EE1 A;  3OWF A;  2A69 D;  1A3V A;  4ID6 A;  1F2L A;  2EY5 A;  4BBS B;  1JOQ A;  1UUP A;  1KDC A;  5G3L F;  2A73 B;  3E6Z X;  2XWB B;  1PTO B;  1ML0 D;  2D2C C;  3KBG A;  2F03 A;  5LHY 1;  4KY6 A;  3MZ5 A;  3HRZ C;  2B2V A;  4XT3 B;  5M5W B;  3S14 B;  4IFD H;  1JOR A;  4BBR B;  2R93 B;  3EA6 A;  4IQZ A;  3E0J A;  2KEE A;  2BDN A;  1GUW A;  5IGF A;  3S1R B;  1KLG D;  1QNK A;  5KND A;  1EOT A;  5C3W A;  3UI2 A;  1VF7 A;  1STY A;  2PO4 A;  2I46 A;  2WAQ B;  2QEJ C;  4G7O C;  3M7N A;  3K6O A;  2QIL A;  1VDZ A;  4PQX A;  4K6L A;  5I6Y A;  5E4W C;  3OMC A;  3TP8 A;  1F9P A;  5ISR A;  1A15 A;  2HQE A;  3SVM A;  1XX8 A;  3OWE B;  1II3 A;  4B08 A;  4HED A;  4RFB A;  2OF1 A;  2K03 A;  2FMC A;  3MWY W;  1NUC A;  1UEA B;  2YYZ A;  1CHP D;  1EZ8 A;  1YNJ C;  5C0X H;  3X3N A;  5BN3 A;  3TZD A;  1PFN A;  3P1H A;  2KQ3 A;  3VA7 A;  2L4N A;  2ZT9 C;  1IW7 D;  3URY A;  2A74 C;  3A8I E;  5EBC A;  4XDX A;  2OXP A;  4RGT A;  1HQM C;  1H9K A;  5K36 G;  3OHX C;  2PYK A;  1AW7 A;  4N9T A;  3MFG A;  3T56 B;  3RZO B;  4ZAI A;  2ID0 A;  4IUT A;  1NR4 A;  3ONA B;  1ENF A;  4K8J A;  3VR6 A;  2BCO A;  2Z4H A;  3TDQ A;  5E1F A;  2R92 B;  1PZI D;  1V43 A;  3V2T A;  2EXZ A;  1I4X A;  4FYD A;  2F0U A;  5FLX L;  5COY A;  1M4V A;  2VUM B;  3VYR A;  4IFD J;  3S1Q B;  2VXW A;  3EQL C;  1QIL A;  1HQR D;  3QWN A;  2R3Z A;  2N88 A;  5COR A;  4G7Z C;  4DA2 A;  2F0G A;  2PZU A;  3S15 B;  1SFO B;  5CGK A;  1G8Z D;  1KAB A;  3D6C A;  1Q90 A;  1S5B D;  2CW0 D;  2R6G A;  2IWH A;  5IOD A;  1HFN A;  4G4K A;  4JK1 C;  5LL6 X;  3KBX A;  1Z6H A;  2WP8 J;  3DWA A;  4XQQ A;  3I4M B;  2XWJ B;  1IL8 A;  1RTO A;  4IFD I;  1B9N A;  2KA7 A;  3D6W A;  2B2U C;  1OXT A;  4KV6 A;  1F9Q A;  3HGB A;  1TII D;  1STG A;  3I4L A;  3A56 A;  3DWP A;  3GP7 A;  5ELE A;  2IT1 A;  2K32 A;  1QB5 D;  2K5D A;  1SE3 A;  2DNC A;  3MVV A;  4A3E B;  1JB3 A;  1U9R A;  3QIA A;  3M3Y B;  5EKK A;  3BG3 A;  1BUV T;  3S16 B;  2IX1 A;  4FNF A;  1U4R A;  4OGQ C;  2F0P A;  3NK9 A;  1STH A;  2F0M A;  3HP3 A;  5J1Z A;  3S1M B;  3AB9 A;  1WTO A;  2G9H D;  3R8B A;  4ZK9 B;  1X3P A;  4IN3 A;  4YIJ A;  1SJE D;  3QB3 A;  2F0E A;  1WTQ A;  1SE4 A;  1HA5 A;  4HMI A;  3NHH A;  2E2J B;  2RSO A;  3TSS A;  1X32 A;  3I8Z A;  2B8G A;  1I6H B;  3MXN A;  2DN8 A;  3D4R A;  1IYV A;  4R8N A;  1Y1V B;  2L11 A;  1F2M A;  1KNE A;  5KYL A;  3CHB D;  5FO9 B;  4J8Q A;  1LV9 A;  1H9S B;  4FF1 A;  4CHT B;  4S3S A;  4WOR A;  1S5C D;  3SK4 A;  1PFM A;  2F0J A;  3S9W A;  2B63 B;  4A3G B;  3K5O A;  5EQ0 A;  3IL8 A;  3I4N B;  3SDZ A;  5FO7 B;  4NW2 A;  2JA8 B;  3M85 A;  4X3S A;  1V1P B;  1Y1W B;  3HKZ B;  3FEW X;  3OMG A;  1D5Z C;  1XTC D;  3DWQ A;  3CU7 A;  3T13 A;  2L55 A;  4L6T B;  1A3T A;  1JCK B;  2NZ1 D;  4RH6 A;  3DM1 A;  3PV0 A;  1I4G A;  1XXG A;  3H3V C;  2TMP A;  5DAU A;  2FHT A;  1RKN A;  3C1E A;  3D4W A;  4E6I A;  2HDM A;  2XNA C;  3TP7 A;  1TS4 A;  1TWF B;  4IUN A;  1JR0 D;  4A3M B;  5DNF A;  3OOC A;  4K2K A;  2AUJ D;  1W6K A;  1A3U A;  1TWG B;  2CQA A;  1TY0 A;  1B3A A;  2JA6 B;  2HDL A;  4TKO B;  1B44 D;  2A68 C;  1EIH A;  2MPM A;  1O7L A;  1UNS A;  5C0X G;  2K6A A;  3D31 A;  3I3C A;  2L9H A;  2JXM B;  4R9W A;  1K8M A;  3RLF A;  3OPO A;  1HUN A;  2A6E D;  3NWT A;  4KK7 A;  4V19 0;  5EPL A;  1M8A A;  4QMG A;  4FXK C;  5I2Y A;  4IUQ A;  2NUC A;  2R7Z B;  1DOM A;  2B2Y A;  3T51 B;  4K14 A;  2E2D C;  1CTM A;  1DJR D;  4G7H C;  5JOB A;  1RCV D;  2BE5 D;  4CKC A;  3GTG B;  4OIJ A;  1EYC A;  1HXY D;  2F0S A;  2NTS A;  3NBI A;  4FO2 A;  5D14 A;  3QG1 A;  4XT1 B;  4FF3 A;  1C48 A;  1WD1 A;  1MGS A;  1CT1 D;  1D1K A;  4H0L C;  5JVH 3;  3TZU A;  3J7A F;  4Q5V A;  1Q12 A;  2F0O A;  5ELC A;  1CQV A;  3BVM A;  1XYI A;  4EQO A;  5C4X B;  1GJX A;  2RVL A;  3LWE A;  4A3F B;  3R2I A;  2F4I A;  2RQX A;  1MSH A;  4CJ1 B;  5EBD A;  1RD9 D;  1CA6 A;  3J7A V;  3FRP B;  4JBW A;  3P7J A;  4OIK A;  1C4Q A;  3CRL C;  4K8I A;  2Q8T A;  1LT4 D;  1BXT A;  4DNR B;  1GUG A;  5I2X A;  4IAL A;  4L63 B;  1JOK A;  2EZV A;  4X3T A;  2F3V A;  1LAB A;  2R61 A;  1LTG D;  2ENB A;  2RDH A;  3KLS A;  5A2Q E;  4HCE A;  4DGZ A;  5AFW A;  1EY8 A;  2X6G A;  1LTB D;  4KY5 A;  3S2H B;  1PLF A;  3SK5 A;  1CHQ D;  3C2P A;  3CKI B;  2RDF A;  1V1O A;  2NWG A;  1O78 A;  1JWS D;  1T5E A;  2SNS A;  2NVT B;  1LLR D;  1V8Q A;  3M7G A;  1OXS C;  2EOT A;  3PO3 B;  1QOH A;  3V96 A;  1I3Q B;  4CBV A;  3BVG A;  3J7Y W;  4KJN A;  1H9J A;  4FXG C;  2B2T A;  2RA4 A;  2BA0 A;  1OXU A;  3MTS A;  3RMH A;  1PRT C;  1E2Z A;  5CV4 A;  2BOS A;  2C9O A;  4OO1 G;  1YNJ D;  2EYH A;  2SOB A;  1HA6 A;  1LTR D;  1GUN A;  3NP8 A;  3GTO B;  2NB0 A;  2EYO A;  1F9R A;  3K7A B;  1TR5 A;  2WAC A;  5CYU A;  2A6H D;  3PIO 3;  1BQQ T;  4KD3 A;  4C3I B;  1H9M A;  4ZYS A;  3D8G A;  2E74 C;  3MFY A;  3F2U A;  2HUG A;  3PUX A;  1F2Z A;  2K33 A;  1EY5 A;  4EQN A;  1CZG A;  3S2D B;  2J7Z A;  2KHS A;  4QB4 A;  2VB3 X;  2NN6 H;  4B9X A;  2E76 C;  1PRT D;  1D5X C;  3VYS A;  1PFB A;  5C6A A;  3GTL B;  4U68 A;  1FD7 D;  2BA1 A;  4HMJ A;  3H6M A;  1QNU A;  2JYO A;  3ZYY X;  1BDO A;  1EY9 A;  2B8F A;  1ET6 A;  5CMD A;  3EJI A;  4KMU C;  5C0X I;  1STA A;  1X3Q A;  2A69 C;  3SHL A;  2AQ1 B;  2H4O A;  1GUO A;  3TN2 A;  1I6V C;  1BCP F;  5JPN C;  4BA1 I;  1ILP A;  1TWA B;  3MXG A;  4ZUI A;  2IW3 A;  1BOS A;  4BS9 A;  4C3I G;  1V1P A;  2B2W C;  3PO2 B;  1GUT A;  3VR2 A;  5KEE A;  1CFM A;  2RSN A;  3ITP A;  3GTM B;  4OL7 A;  2B2V C;  2XRS D;  1BCP C;  3W3A A;  3HEJ A;  3K57 A;  2EYJ A;  2RBM A;  2E2I B;  4C3H G;  3J80 L;  1Y69 U;  2ZXO A;  2MP1 A;  1SYD A;  2QF7 A;  2K04 A;  1STE A;  1TY2 A;  1BR9 A;  1ZYR C;  2JSO A;  1QG7 A;  4M8A A;  3J81 L;  4O42 A;  4A3K B;  4KHZ A;  1WTR A;  1AZP A;  3I90 A;  3FVQ A;  3PUV A;  1QWY A;  2MUY A;  3A7L A;  2NTT A;  3ND9 A;  1F77 A;  4KI0 A;  4K5X A;  1SXT A;  2E75 C;  1BF4 A;  2LS0 1;  1E2V A;  1HPC A;  1DXM A;  4ZUJ A;  2B2U A;  3N6R A;  4UDU C;  4B9W A;  1PTO D;  1TVX A;  5J39 A;  3N52 A;  2CVR A;  1VMP A;  3L7Z C;  1EQT A;  2PNR C;  3DXJ C;  4PNY A;  5T1G A;  2K5W A;  5I6W A;  1NR2 A;  1S5E D;  5ELF A;  3H91 A;  2QDB A;  2L12 A;  3BS1 A;  3PIP 3;  5CBA E;  5KRU A;  4MIU A;  3OSO A;  1LO5 D;  3NTH A;  3VR4 A;  5KIX A;  3NQT A;  1JE4 A;  1T5X D;  1EL0 A;  4A3J B;  2J4X A;  3KLS X;  1Y8O B;  2B2T C;  1EY0 A;  1RHP A;  4CKE A;  2LFN A;  2G9D A;  1SNQ A;  3LX0 A;  3M4Y A;  1DOL A;  3P75 A;  1ICW A;  1PZJ D;  1PTO H;  2RDG A;  4HAE A;  3GV3 A;  5BN5 A;  1WD0 A;  3H09 A;  3LNN A;  4NKL A;  4WJW A;  5FOB B;  2O5J C;  2EYM A;  1FR3 A;  4DAP A;  3SK6 A;  4DAY A;  4G57 A;  4BWG B;  4RHR A;  4DFA A;  1PTO F;  1PYW D;  1ZYR D;  5M3F B;  4BA2 I;  5DEH A;  1E2W A;  4XIG S;  2RKS A;  2PZT A;  1YNN D;  5ELD A;  3TP6 A;  3R3O A;  4XQJ A;  4Y7N B;  2EDG A;  1DD2 A;  4MN3 A;  2PMZ B;  1K83 B;  4QCL A;  1HFG A;  5JAV A;  3I73 A;  2GA4 B;  4K6D A;  1TKW B;  1WTP A;  5CV8 A;  5EKI A;  3ERO A;  3ND8 A;  2WKC A;  2A5H A;  1S4Z A;  1LTA D;  4N9P A;  2JA7 B;  2BE5 C;  4H13 C;  5DM7 3;  2FFK B;  1A2U A;  4L8J A;  2OEO A;  3I91 A;  1EU4 A;  5IGG A;  4Z9C B;  2O2L D;  3HOY B;  1G6Z A;  1U4L A;  4J1M A;  1CK1 A;  2AUK A;  2DNE A;  2IJ0 A;  5CBE E;  4FXD A;  1CZW A;  1J8I A;  1ESF A;  4IUR A;  5C4Z A;  4KN7 C;  5C4H A;  1EWC A;  3OIP A;  1GXD C;  3D4D A;  4RHS A;  1R9T B;  4EGV A;  1LAC A;  5A35 A;  2B2Y C;  1I4H A;  1O7Z A;  2SNM A;  2KCN A;  5K5P A;  3SK8 A;  3K5N A;  3Q6S A;  4FP5 D;  5IIF A;  3IFT A;  3DMU A;  3SE0 A;  3BYY B;  1U4P A;  1NSN S;  2MGS A;  1MSG A;  5T1I A;  3Q0A A;  1I4P A;  2NN6 I;  1HCZ A;  4KKU A;  1B4O A;  2Z1C A;  1I4Q A;  1WTW A;  5C3X A;  1TS3 A;  1Y8P B;  3H94 A;  2K28 A;  3IKJ A;  1ROD A;  1IYU A;  2J0T D;  1SMY C;  1TQO A;  3A7A B;  4QUF A;  2F0H A;  2LY7 A;  4BY1 B;  4LJZ C;  5KGU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...