1ENAA

Crystal structures of the binary ca2+ and pdtp complexes and the ternary complex of the asp 21->glu mutant of staphylococcal nuclease. implications for catalysis and ligand binding
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
135
structure length
135
Chain Sequence
LHKEPATLIKAIDGETVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STAPHYLOCOCCAL NUCLEASE
publication title Crystal structures of the binary Ca2+ and pdTp complexes and the ternary complex of the Asp21-->Glu mutant of staphylococcal nuclease. Implications for catalysis and ligand binding.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase(phosphoric diester)
total genus 32
structure length 135
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 1994-02-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1enaA00
1SYCA 5IIFA 5IODA 5IGGA 5IGCA 1EY4A 3NP8A 3QB3A 1KDBA 1KDAA 1JORA 4N9PA 3MXPA 2EYMA 5EKLA 5KYLA 3E5SA 5I9OA 5C5LA 3D6CA 3P75A 4NP5A 2F0EA 3SK5A 1F2MA 4KY6A 5IOCA 5J39A 4OL7A 1AEXA 1SNDA 1EY6A 5CV7A 3T13A 3TP6A 3TP8A 3OMCA 4K5XA 3SK6A 1STAA 4KHVA 3TMEA 2F0FA 4KV6A 5CV6A 4S3SA 2F0GA 3TP5A 3LX0A 3H6MA 3MVVA 1SYFA 1EY0A 2KQ3A 3OMGA 1NUCA 2EY5A 2F0QA 4HMJA 1JOOA 4K6DA 4TRDA 5F2DA 5I6WA 4IZ8A 1A3UA 1EZ8A 3EVQA 2RBMA 4EQNA 5C4HA 2F0KA 4KY7A 2F0TA 3MEHA 5CV5A 4ZUJA 4J6HA 1ENAA 1KDCA 4E6IA 5HURA 4EQOA 5IGBA 2F3VA 3ITPA 4KD4A 3SK4A 5CGKA 5KIXA 3SHLA 3QOJA 1KABA 2O4XA 4NDXA 1SNMA 4K2LA 5J1ZA 5CV8A 1SNPA 2PZUA 1SNOA 5IGFA 2NUCA 3U9OA 1JOQA 4ID6A 2F0JA 4HMIA 5CV9A 3NK9A 3DMUA 3RUZA 2OEOA 3PMFA 5JOBA 4DFAA 1EY9A 1EY7A 1F2ZA 3EROA 3QOLA 4KJNA 4MIUA 4KTAA 4ZQ3A 1ENCA 5IGEA 3BDLA 2EY2A 5C4ZA 1EQVA 5KEEA 3D4WA 2F0UA 5CC4A 4R8NA 1SNQA 2PW7A 3EJIA 3R3OA 2F0HA 4KD3A 4F7XA 4RKBA 3OSOA 4G57A 1EYCA 5EGTA 5EKKA 2PZWA 3V2TA 3VA5A 5E1FA 2PQEA 1U9RA 1EYAA 3NQTA 3NXWA 1A2UA 1EZ6A 3ERQA 2OXPA 1IHZA 2EYPA 4I65A 4WRDA 3P1HA 2F0LA 4K14A 4ODGA 4YIJA 4K5WA 1II3A 3MHBA 1STGA 4EQPA 3MZ5A 5E3FA 1F2YA 2EY6A 1EY5A 2F0VA 3BDCA 4ME5A 2PYKA 1NSNS 2ENBA 5I9PA 2F0DA 5K5PA 2SOBA 4EVOA 5ISRA 1SYGA 1A3TA 2EYHA 2F3WA 3NUCA 4K8JA 4ZUIA 5NUCA 3TP7A 4PMBA 4QMGA 1JOKA 3S9WA 2F0PA 1SYBA 3C1EA 4B9XA 3D8GA 5CR3A 1KAAA 1TR5A 4HTHA 2OF1A 3SR1A 5M9OA 5C3XA 4KY5A 4K2KA 5IGDA 1STYA 2EYFA 2F0SA 2PW5A 4QB4A 5KRUA 2WACA 2F0WA 4PNYA 4B9WA 2PZTA 2RDFA 3OWFA 4PMCA 5C3WA 5DAUA 3DHQA 3SXHA 4QF4A 2SNSA 4KJOA 3SK8A 4DGZA 1SYEA 2RKSA 2SNMA 4IUNA 4F8MA 1A3VA 2F0NA 2F0OA 1STNA 2F0MA 5CV4A 5HGTA 4NMZA 3C1FA 1SYDA 2EY1A 1EY8A 1TQOA 3T16A 5C5MA 5JAVA 1STBA 4K8IA 2EXZA 1A2TA 2EYOA 4WORA 5KYIA 1SNCA 2HQEA 4IALA 4K5VA 5J22A 1RKNA 5DEHA 4LAAA 3D4DA 3NHHA 2KHSA 5KGUA 2EYJA 2M00A 4RKLA 3HEJA 1STHA 4DF7A 5I6YA 5C6AA 4H7BA 4DU9A 2F0IA 2EYLA 1EYDA 4J1MA 2QDBA 1TT2A 3HZXA 4NKLA 4N9TA 2LKVA
chains in the Genus database with same CATH superfamily
2F4IA 1VF7A 1WFQA 3S17H 1DCZA 1J5EQ 2VQFQ 4CBVA 1N33Q 3K7UC 3OIPA 1B2TA 1ZYRC 2QGQA 3LWEA 4KHVA 1ONLA 4KV6A 2MO0A 5KRUA 4IOCA 5ELEA 2JJQA 3CC7A 1LO5D 3W1GA 2RBMA 4BBRB 1W6JA 1I50H 1YVCA 2BE5D 1ENAA 2G5DA 1QVGA 2NZOA 1GKHA 2Z8LA 4O42A 4G7OC 1G8ZD 2CFMA 1HR0L 1BR9A 5J1ZA 1ML0D 5A2QL 2PNRC 1IYVA 1FJGQ 1K0RA 1BCPF 4MTKA 1VMPA 3A8IE 4DXFA 1GJXA 5IP9H 1TVXA 1GUTA 1UE5A 1PA6A 4IURA 1S3OA 4LF9L 3PUZA 1Q86C 4JI5Q 3MFGA 3AQQA 4G7HC 1QVCA 1VQIA 1I94Q 5LMNW 1IHZA 3VR5A 4X64Q 2HIXA 4WRDA 2DN8A 5CMDA 1EEID 1QWYA 2B29A 1Q8KA 1CTMA 5ISRA 3I4LA 1SYGA 2K14A 4ZUIA 2O2LD 3BYYB 3ER0A 1JOKA 3NEMA 3KFUA 5M9OA 4AYBE 1ZYRD 4KY5A 3CCMA 4AYBG 1SR3A 1I4QA 1KNAA 2UUCQ 1L1OA 4NXML 1PFNA 1G91A 1NCVA 5FLXE 3HRZC 4BBSG 1CKNB 1SN8A 5HGTA 3GTMB 1HZ9A 2XSCA 4DV3Q 4YCVA 1TY2A 5JAVA 1TS4A 3S16B 3CCQA 4DR4Q 2OWOA 3MA2B 4WJWA 4EGVA 4HCSA 1S5CD 3UDFA 3GTOB 1S4ZA 2QDBA 2VUMB 1PFBA 5ELCA 3HZXA 4FVMA 1HFNA 1HNXQ 1Y1WH 3GP7A 3S14H 3RZOH 4O0AA 4V0BA 3CKIB 2BOSA 2NZHA 2EYMA 1XJVA 4H0LC 3HFZB 4R8IA 1E1TA 3I2ZA 1JB7A 4KHPQ 3F2BA 5CBEE 1S40A 5I4DA 5GROA 5C3EH 2BA0A 4HJ8A 2GN5A 3IFDA 1K83H 3H3VH 4DK6C 5JEAG 2VB2X 4DV6Q 2N55A 3HOUB 3RR5A 1G51A 5C4HA 1CZWA 3HOXB 1VQHA 2CW0C 1AE2A 4GOPB 4XXEA 5CV5A 3FDTA 2IT1A 3SK4A 4A3EG 4BBSH 3SHLA 2E2IB 4B3RL 1TWHB 4PMWA 3QOJA 3ULLA 4N8X1 2H1EA 1R4QB 2O4XA 3DLLA 2R93B 4X62L 1YHAA 1X56A 2IPKD 3TZDA 5IWAL 4BY1H 4HR7B 1WD0A 1VQ6A 1O7LA 1V1PA 3NSWA 2B63B 1PZKD 4A93B 3T53B 1GM5A 5KEEA 1WCMG 4A3LG 4R8NA 3PIPA 3FKIB 5DNFA 2J0TD 2K5VA 3M85A 1VQLA 4RKBA 4P2CB 3K58A 1FL0A 3NQTA 4FXKC 2Z6KA 4LFAL 3HOVB 1Y8NB 1ASZA 1XYIA 5ELFA 4IUPA 1Q82C 5JEAH 1CKOA 2PQAA 3DM1A 2K52A 2V4DA 1BO0A 1Q1EA 1CI3M 3B6YA 4DPGA 1XTCD 4A3EH 3I72A 3NWTA 2OF1A 1QB5D 3URYA 1K3BC 5C0XH 1WOCA 4C3HB 4YWKA 3I4MH 1F9SA 4RGOS 3J80E 2IX1A 2WV6D 1MJEA 5D3DA 1IBLQ 4JBMA 4BBRG 2F0OA 3I73A 1BQQT 1STNA 4HAEA 1ET6A 3HGBA 1WCMH 4GN4B 1UAPA 3UDXA 4DV0Q 3FRPB 2N88A 1AZPA 1SJED 4IUUA 4Q0FA 1Y14B 5KNBA 1PRTB 4IUQA 4DU9A 3S1QH 2F0IA 4ZKBB 1QVFA 1OXVA 1B1ZA 2M2LA 2MJ8A 1EQTA 2H5XA 2KHIA 1LTSD 4OWTB 3K7AB 2I5HA 3FPUB 3TEHB 4A3GB 4CDCC 4KY6A 4PQXA 2KCCA 5CV7A 3DWAA 3OMCA 5IT9L 4B3ML 4JI3L 3H09A 4ME3A 3SK6A 2F0GA 2VZAA 1EY0A 5KYIA 4ZRZA 2Q2IA 4YY3Q 1TU2B 3J81L 2H4OA 4CDEC 4A3BB 2RSOA 2PI2E 1NBWA 1OXSC 1IYUA 5A2QE 1SAPA 3PO2B 4C3IB 1RODA 3ERSX 4BXXG 1ENFA 3MXUA 1J5EL 3U9OA 2UXBQ 2VQFL 1N33L 2HD3A 2RDHA 5EBCA 3VYRA 4FF1A 1M4VA 2OQ0A 5FJ8G 4DR1L 2ZXPA 3RLFA 3V96A 3EJIA 3PSIA 4NPSA 2B2VA 3K5NA 4H02A 5E1FA 4DR6Q 2AQ2B 4A3FB 1KC8C 1PH2A 1U4PA 4O1NA 4HN7A 4DR3Q 1UE7A 2MUYA 2VW9A 1HPCA 1FJGL 3CCSA 1VQ8A 2K5WA 2VUMG 4FDBA 1HUNA 1PLFA 1ZKOA 2FMMA 3BDCA 3MEFA 4ME5A 3M4OB 4EVOA 1W6KA 2I07B 5M3FH 1WTWA 1LM0A 2PNHA 4B3TQ 2A8VA 4CKCA 1QOHA 4BWGB 1IXRA 1VQCA 3WWVA 2L12A 1X65A 2L9HA 4FP5D 4BXXH 1JQYD 2MGSA 4JI5L 1AE3A 4JBKA 4DA2A 2RDFA 1I94L 5JPNC 5DM63 4X64L 1L1OB 1NMFA 2NTSA 3KUPA 4G7ZC 3HOUG 3HOXG 1GUSA 2YYZA 4DV2Q 2F0MA 2NVYB 5C5MA 1CSPA 4OO1I 4GLAC 2K04A 2WKCA 1MSGA 1CQVA 1P8LA 5DEHA 2R93G 3U50C 3CRKC 2Z9HA 2A19A 3MTSA 3CPFA 1E2ZA 4ALPA 2B63G 2KENA 1E24A 5FLMG 5IIFA 1VMCA 4A93G 1GHKA 1AFPA 2MPMA 5KYLA 3F2UA 2Z1CA 3E5SA 2OTLA 3FKIG 2RHQB 1B9MA 1EY6A 1LT6D 3K6OA 3SDZA 1Y1VH 4DR4L 1KTKA 1MBYA 2X6LA 3HOVG 1E2WA 1PTOH 2K5NA 4M1UB 1R9TH 2G9HD 3E3XA 1SROA 1A8VA 2QILA 3DWQA 4NB3A 2AHOB 2N78A 2O5IC 3HOXH 3J81j 4KD4A 5KIXA 4QL5A 3A8JE 3NQIA 1J6QA 3RN5A 4LWCA 2E76C 4YWLA 5IYBG 2B39A 1HR0Q 1HXYD 2F0JA 2QA4A 1F77A 1QILA 4KKUA 5IT9c 3PIO3 4C3HG 2B2UC 3W5OA 1EY7A 1E0BA 1V1PB 2R92H 2JA6H 3VR2A 3GTLH 1V8QA 3X3MA 1ENCA 3A5ZB 3OTOQ 3CCUA 1BKBA 3BVMA 4JBJA 4DV6L 4JI2L 5BR8Q 3J81c 3VYUA 3HKZB 5FLMH 4KKTA 2RQXA 2IHEA 4RMFA 3OW2A 3S1RH 5LL6X 4U673 2HT1A 4C56C 1I4RA 2R61A 1LTRD 4DNTB 4L6TB 4K5WA 4OIJA 4G4KA 1S72A 1STGA 4QIWB 2PQAB 2F0VA 1FVIA 3NUCA 2CQOA 5NUCA 1I6VC 4PMBA 4FXDA 4XTCS 2EJGC 4A3GG 1BBWA 4IN3A 2VS1A 5JJIA 3TDQA 5IYBH 4HIDA 1PTOC 3MXNA 2D5DA 5JVH3 3Q23A 2R7FA 4JI4Q 4JI1Q 1CA6A 1I4GA 2DNEA 3EBEA 2Q8TA 3GTGH 3OPOA 1JJ2A 4A3BG 1SFOH 1T9HA 4GOPC 1PTOF 1X9NA 2A6HC 2Z4IA 1STBA 1QNUA 4R4CA 4ZYSA 1MIUA 4IALA 4C3IG 3PO2G 2E2HH 1YIJA 2VXWA 1RKNA 5J22A 1NR2A 3NHHA 2B2YC 3BDOA 4DF7A 4TVAB 1Y8OB 5C4XB 2XTIA 1O78A 2JA5H 4DV7L 1CFMA 1XTDA 2J4XA 5IGCA 3C2PA 4A3MB 3PUYA 4CGYB 1IBLL 2Y0SB 2K1BA 3BVGA 3CAMA 3K7AH 5J39A 1F9RA 5IT9E 2NVQB 1GUGA 4A3GH 2F1MA 3UE1A 1TWAH 4A3FG 1EU3A 3J80i 4DV0L 3FEWX 4HJAA 1S5ED 5CC4A 4NXNQ 3J81E 3GO5A 4A76A 2KUMA 1NMGA 2R6GA 3CF5A 2LXKA 1NE3A 2XWBB 4WJ3M 4DNIA 4HCEA 2NN6H 1I6HB 4C2MB 3G6JB 1FNUA 2K05A 5E4XA 1SE2A 1PTOD 1S5BD 3RUZA 3DMUA 2OEOA 2B2TA 4R4QA 1CKMA 3BDLA 2X69A 3CHBD 4YY3L 2KA7A 5ELNA 3RZDB 1HTPA 3NE5B 1HH2P 4F7XA 3TS2A 4N8FA 5EGTA 3TS0A 1U9RA 2N3SA 3PCOB 4IPGA 2OXPA 2FMCA 2SDFA 2Q8RE 2UXBL 1D5XC 2K28A 2PYKA 2ZTDA 1A3TA 3FMCA 4J8QA 5CR3A 1E3PA 4A3JB 1D5ZC 1CA5A 4HJ5A 3S1MH 5DM73 4K2KA 4QB4A 2KVMA 4DR6L 2N8NA 1SE8A 2A5HA 3I7FA 4X66Q 4IJLA 3MC0B 4R9WA 4A75A 2E5LL 3SXHA 4KJOA 4DGZA 2AWOA 2CH4A 2GA4B 4DR2Q 3HOZB 2F0NA 4RG1A 3KOJA 2ZTEA 4B3SL 1JWSD 5IYCG 4WORA 2EYOA 1XPUA 1FD7D 2NVYH 3QWNA 5C44B 2UUAQ 2BE5C 3H0GH 2VNUD 1LV9A 3S2DB 1STEA 1PHJA 2LS01 3ICEA 1WI5A 1BVSA 2ASBA 1LT5D 4N9TA 4NKLA 3HS0C 4C3JB 3T1HL 1EY4A 1EQQA 1VQJA 4HIMA 5M5YB 2KHJA 1HHVA 2R7ZH 2E74C 4DV2L 1K3RA 3H91A 4LF4Q 5I9OA 3SK5A 3P75A 2IJ0A 4KK7A 1JJCB 3QO2A 3BJUA 4OL7A 1SNDA 2NVXB 1DOLA 2B2WA 2RSNA 3T13A 5M3MH 2KCMA 3BZCA 1E1OA 2DY8A 3KJPA 1KD1C 1CM9A 2ZJQA 2AKWB 4QIWE 2IW3A 1A3UA 1CT1D 5EBDA 3HOYB 3M3YH 4GLXA 3QIAA 4ZUJA 3GTJH 1MKHA 4P73A 1N32Q 3G48A 4LMQD 1GOZA 5IYCH 4ABNA 4NDXA 4K2LA 1SE3A 3UDGA 2ALYB 4A3DB 1B70B 1E22A 1PYSB 1NTGA 2L55A 3GTQB 3EROA 4JI0Q 4DR1Q 2IWHA 1F9QA 1E2VA 3R3OA 3HP3A 4DV1Q 4LF7Q 1D1KA 3V2TA 5ELDA 4DR7Q 4HIOA 2K50A 2FJ2A 1F9PA 1I4XA 4IUVA 5C4XG 4MTNA 1RCVD 5E7NA 5FO9B 4IUTA 1PH6A 4OO1G 1BUVT 3UE0A 3AU7A 3IKJA 1UWVA 4DAVA 1EQRA 4MHEA 2SOBA 3OTOL 3A7LA 4JOIA 5BR8L 1GVPA 1CSQA 1SBBB 4DR5Q 1M8AA 1H9JA 1SLJA 2JXMB 3MXNB 4IFDJ 3I8ZA 3NBIA 5TSSA 1SYEA 4IUNA 3HG9A 5K36G 3C1FA 1SYDA 4CKBA 3T16A 3G6EA 4K8IA 2HQEA 4RAUC 4EX5A 5JVG3 4JI8L 1Q12A 1AP0A 3J7AV 1JMCA 2X6GA 4POFA 1JE4A 4JCVE 4OO1H 4JI4L 4JI1L 4BY7B 3E9IA 1N9WA 3CD6A 1SDFA 4UY8C 1A62A 3TREA 1H9MA 2J7ZA 1JWMD 2C9OA 2PMZB 5EKLA 3K5MA 1X3PA 5GAHC 1B50A 2QCPX 1BDOA 3D6CA 4NP5A 3P7JA 4IFDI 3PUWA 4FXGC 3SVMA 1IKLA 5LMUQ 1CK1A 1YI2A 1TWGB 1K28A 4CJ0B 1VQBA 4DXGA 4DUYQ 2Z6KC 1Z47A 4K6DA 2NVTH 5F2DA 1JOOA 2WB1B 1TWFB 3PIOA 4EQNA 2EJFC 1LTID 4ZKCB 4LK1C 3DM3A 3S15H 1MHWC 1TWCH 2N49A 4GNXC 2UU9L 1V9PA 5K36H 1UEBA 1WTPA 5IGFA 4A3JG 1JOQA 3A54A 3CCRA 4C2MH 1T5EA 2VY3A 5JOBA 5IE8A 1WVLA 2DNCA 1PYWD 3R93A 4GLVB 3QOLA 3GV6A 1H9SA 1WTRA 3S2HH 2CVRA 1X32A 4NXNL 4DKAC 3WOFA 2EXDA 2B3GA 3HOZG 1BBXC 4JI2Q 3N6RA 1NJIC 3GQBA 5C4JB 1C48A 3CQZB 5D14A 3FPPA 5C44G 4P72A 3E0EA 4CHTB 4MZ9A 3J81i 3GTKB 2NBFA 2LFNA 1VQOA 4C3JG 4FNFA 4DAPA 3GTPB 3FP9A 5HGQA 5M5WH 4AQYQ 1RTOA 1Z9FA 1Q7YC 1STYA 2EYFA 4X3UA 3M4PA 2K33A 4KN7C 5DAUA 3DHQA 3SK8A 2RKSA 1WTHA 2I5LX 3HOYG 2D62A 1U4MA 3QJYA 1YHBA 4A3KB 2O5JC 2SEBD 1MD2D 1KL9A 4POGA 3AYHB 3E6ZX 1XMQQ 4HJ9A 2AUJD 4LAAA 2YU9B 2YV5A 4JW0A 2QDLA 4LUZA 4CDDC 4A3DG 1RTNA 1EYDA 2PCFB 4X66L 1Y69U 4DV7Q 2K01A 3G71A 3BG3A 2EDGA 4OELB 3KBGA 3MXPA 4O2DA 1FR3A 4DR2L 3C46A 1DD2A 1B8AA 1BF4A 2JA9A 3JAML 1TKWB 4B08A 3ULJA 4A3LH 2B2VC 4YHHQ 3A56A 2UUAL 2CKZB 4JC0A 1BBUA 3Q8DA 2NB0A 2KQ3A 2R7DA 4TRDA 1O7YA 1GUOA 3P20A 3M7GA 4UP8A 4QY7A 2AQ1B 3HOWB 1HNWL 1Q90A 3ITPA 3UI2A 1PVOA 1IKMA 4LF4L 1SNMA 2VB3X 1X3QA 2ZXOA 1JJGA 4LJZC 5FOBB 1JORA 1P16A 4TKOB 3DEPA 1H95A 1C0AA 3GTQH 2JA8B 2RA4A 2EZVA 1CQFA 2K7VA 1XNRQ 1DOKA 4G57A 1N32L 3J7ZC 2PQEA 3K0YA 1N36L 4BBRH 1LUZA 3RN2A 3Q24A 3AFQA 1GO3E 2E2DC 4LUOA 3RLNA 3W2DA 2PO4A 5BN4A 3PF5A 4Y7NB 5GAGC 1VQNA 3MZ5A 1CUKA 5E3FA 2EY6A 2PMZE 3BS1A 1NSNS 1NY4A 2JP1A 2P5ZX 4JI0L 5A35A 1U4RA 2HHHQ 4QMGA 1K73C 3K80C 1HRJA 4DV1L 1IBML 4GKJQ 4KHZA 1A6XA 4LF7L 2F03A 1WTXA 4DR7L 4PG3A 4HIKA 2WB1E 1XPRA 3OWFA 1EWIA 3KF8A 1IBKQ 4IO9A 1L0XB 2WB1G 2E5LQ 1K0SA 2EJMA 1A15A 1V43A 3TBIB 1TS5A 4B3SQ 3V05A 1A2TA 1SNCA 1IYJB 3I56A 4NW2A 1X3GA 4DR5L 3HEJA 1PH5A 4AIMA 3VR3A 5G3LF 1EUJA 2WIIB 1U0LA 3G4SA 2KBNA 2PPBC 3LNNA 1DM0B 3QB3A 3MFYA 1LYLA 3Q0AA 3T1HQ 1XMOL 2G9DA 1I3QB 2KCNA 4MN3A 1EWCA 5FJ8H 1U5KA 1LTTD 3TP8A 1XPOA 1SEBD 4L5QA 1STAA 3CMAA 3GTMH 2I0QA 1BNZA 1WJJA 3S16H 2Q8IB 1X3EA 1YEZA 2F0KA 4P75A 2WINB 4I7ZC 3MEHA 2EOTA 3BZKA 4HEDA 4E6IA 4PV1C 3GTOH 3K81C 2VUMH 2Z0SA 1X3FA 1R4PB 3JAMc 2NTTA 1WTQA 4JI6L 1BCPB 2BCOA 3F8TA 4LF5L 5LMUL 1KAWA 2HDLA 3KF6A 4DUYL 4CDFC 4ZQ3A 4KTAA 1RJTA 2MNAA 1H9SB 4JYAQ 2I5MX 1VQEA 1EQVA 3CXCA 1VQPA 4FYDA 5G3LD 4BA1I 1G2TA 3T1YQ 5ELBA 2F0HA 1Z6HA 3OSOA 4A3KG 4QUCA 3HOUH 4DNRB 4P74A 3NXWA 1EZ6A 3KBXA 2EYPA 1ZXTA 1JB3A 2JA7B 4XQNA 2E2JB 3DWPA 2KECA 1QZHA 3NTKA 3K0XA 3PV0A 2E2IH 1TWHH 5M5XB 1NNXA 4EQPA 2R93H 3UDIA 1EY5A 1FNVA 2IHFA 4K6LA 5EJWA 3E9HA 4JK1C 2AQ3B 1JR0D 2A6EC 4FF2A 3GTPH 4HJ7A 2B63H 4A93H 4L63B 3RMHA 3F2DA 1EIYB 2F0WA 2XWJB 1K8AC 3S17B 3FKIH 3H3VI 1PZID 4DK1A 3VYTA 2KOLA 4IFDG 2LY7A 1S5DD 5ELOA 3HOVH 1A3VA 3VR6A 1YZ6A 2NYZD 3CMEA 3HOWG 4RFBA 4KN4C 5IY0A 3U9SA 4AQYL 4OWWB 1YBYA 1I50B 2K6AA 3D4DA 3CPWA 3RLOA 2EYJA 1M90C 1RHPA 4JI8Q 4ZLTF 3E0JA 1TS3A 3KDFA 5LHY1 3L7ZC 1MGSA 3J7A5 1SYCA 5C0XJ 5IGGA 1HQRD 1Y8PB 4C3HH 1K8GA 4OONA 2JA8G 5C5LA 3JAME 1PYBA 2CHBD 3NELA 1F2LA 4X65Q 2HDMA 5EKIA 4JPBW 1XMQL 2DY7A 2NZ1D 5T1GA 2F4VQ 1VQ7A 2VQEL 2F0TA 4IFDH 2ES2A 1RL2A 5JPMC 2A6ED 1LLRD 1L2FA 1HR0W 2GVAA 2UU9Q 3NPPA 3STBC 4F88A 4OIKA 5CV8A 5IYDG 2L1BA 4DFAA 1C8CA 1JC7A 4RGTA 5C0XI 2ZJPA 4YHHL 1XX8A 5KNDA 3K5OA 3W1BA 3CCEA 3TN2A 1B4OA 1SNQA 4KD3A 3CCLA 4BS9A 3WDNA 4QCLA 3VA5A 2LMCB 1EIFA 3D31A 4A3BH 3ERQA 1I4PA 1AZQA 5FK9C 2C5CA 3P1HA 4UAIA 3EN2A 4QJFA 4K14A 5FLXL 3PO2H 4C3IH 3AEVA 4OX9Q 5I2YA 2ENBA 3SGIA 5IP7G 2CQAA 4K8JA 2E8GA 2WKDA 3S9WA 4XQQA 2DGYA 2F0PA 1SYBA 4B9XA 1Q3LA 3A7AB 4XT3B 1TR5A 3SR1A 1Y1WB 1XNRL 3VR4A 3S14B 3RZOB 5IGDA 4XYOA 2PW5A 3VDYA 1JT8A 4H13C 1PH3A 2B2WC 1XNQQ 2XVSA 2K5DA 3KF8B 4JV5Q 4A3FH 5CV4A 5C3EB 3BVZA 2EE1A 1PRTC 2EY1A 1K83B 2EVBA 4XIGS 4P71A 3SE0A 4Y52H 4TQUS 4LFCQ 2EXZA 3EFXD 1NR4A 3STBD 2HHHL 3PO3B 5CORA 4RGMA 3AMUA 3KLWA 4MNOA 4GKJL 2L15A 3M4OH 5C6AA 3A0JA 1HQMC 4LW1A 2ZT9C 3TSSA 1PRTF 1HTLD 4R4OA 1TT2A 4ULLA 1IBKL 2B2YA 4BY1B 4KKSA 1WYDA 1C4QA 4A3CG 3L3OC 1Q8IA 5IP7H 2F0EA 4WJ4A 5IOCA 5FKAC 3M4YA 4LF6Q 4K5XA 4RWSC 1QJOA 4EQ5A 3H6MA 2JA7G 3TP6A 1OTCA 2WAQB 4OXPA 1X6OA 1YNXA 3DEOA 2A68D 1VS0A 1GUNA 1KRSA 3L9AX 5IGBA 3U4ZA 5FO8B 5CGKA 4RCOA 3HKZE 4KMUC 1HNWQ 1KABA 1DJRD 4LUVA 4C1NI 4V190 4JOIC 2PZUA 2XGTA 1SNOA 3HKZG 1D2BA 3PMFA 1QUQA 5LL6S 1ICWA 1ET9A 1B3QA 1SRUA 3KF6B 3ND8A 4FF3A 1PRTD 3D4WA 3I4MB 2PW7A 4RHSA 4JG2A 2OCEA 2ZM6Q 2K75A 4A3CH 4C1NK 2JQOA 2IL8A 2Z6BA 1EU4A 1A2UA 2RCNA 1LTAD 3S24A 3J80L 3BU2A 1N36Q 2XRQD 1WCMB 3D4RA 1DGSA 3CC4A 5LMNQ 5KNCA 4YIJA 1WTVA 2JN4A 3VYSA 2K4KA 3FHWA 5M5XH 4JYAL 3S1QB 1L1OC 3T1YL 3NBHA 1KAAA 1Q46A 2FXQA 1EL0A 1ILQA 1K8MA 1B3AA 1IBMQ 2WACA 5IP9G 4PNYA 2PZTA 5DLQE 2JE6I 2MHVA 5FLXc 3S1NB 2RF4A 1YJNA 1EY8A 3GD7A 2Y0SE 1SXTA 4A4IA 1EYGA 1ASYA 4A3MG 1PMRA 3A5UA 2Y0SG 2KHSA 1EOVA 2M00A 5D3IB 5EPLA 4WFN3 1BCPC 2EYLA 2ID0A 4J1MA 4TSSA 1B53A 2MQHA 2A69C 3KDFB 2LKVA 2D0PA 1LTLA 5IODA 5AFWA 2K03A 1KDAA 4YCUA 4JI7Q 4R1JA 1RD9D 5BN5A 1XMOQ 1F2MA 2WFWA 1UE1A 2K32A 4GKKQ 3SEBA 3TMEA 3MVVA 1VQDA 2F0QA 3C3LA 2L4NA 3GV3A 3EVQA 4DAMA 3KK7A 4KY7A 2HCIA 3DUZA 1M1KC 4OEMB 4DN4M 4U68A 1KDCA 5C4XH 3D6WA 2I46A 1S5FD 1C9OA 2CWPA 1SJHD 2DJFC 3JC66 4OWXB 4RHRA 1JE5A 3IFTA 4CKEA 1MI2A 2IY5B 4IPHA 2NUCA 1LT4D 4DAYA 4ID6A 1Y1WG 4X65L 4A3MH 2L5TA 1PH9A 3I4NB 5M3FB 2ATWA 1YHQA 4JI6Q 2ICEC 1YJ9A 3L0OA 4LF5Q 2AWNA 4ZCKA 5D65A 2NVQH 1Q1BA 2QKIC 4DUZQ 5E4WC 3ONAB 2F4VL 3JAMi 5C3EG 1AN8A 3PO3G 4L8JA 1ESFA 1CHPD 3A55A 1ICFB 1BCPD 4DV4Q 2A69D 3ZJYC 1MJCA 2VL6A 1I6HH 4IJHA 1XXGA 2F0DA 4L5TA 4X3KA 4BY1G 3NTHA 4AH6A 3OHXC 3CP0A 4LF8L 1TIID 3J7AF 1D1IA 3D8GA 3OW7A 1GD7A 1SE4A 5C3XA 5CYUA 2F52A 1HZAA 1ZEQX 2F0SA 3RZDH 1QNKA 2WAQE 3J80c 4CJ1B 3U58A 2WAQG 1WTOA 5I2XA 1HA6A 2Q2UA 5GQOA 4GS3A 1Y1VB 1KNEA 1VQKA 2ZJRA 4OX9L 1PTOB 1VQFA 1R9TB 1T5XD 1EEFD 1E7ZA 2NN6I 1YJWA 3KYHC 3ULPA 4YWMA 3PO3H 5T1IA 1QE6A 4Z9CB 4OHJA 4PZ7A 1YITA 1O7IA 4A3JH 1XNQL 1B44D 5H1SE 1KDBA 3ZYYX 1FGUA 4JV5L 1L0YB 1K8OA 4KI0A 1KRTA 5C0XG 3FVQA 3K57A 3I4MG 2EQSA 1HZBA 2R92B 2JA6B 3GTLB 4LFCL 5GADC 3HOZH 1X55A 4S3SA 1KQSA 1VQMA 4RGNA 5I6WA 4L5RC 2RDGA 3S1RB 1EZ8A 5C44H 3M9BA 2D2CC 3PGZA 1G6PA 3F2CA 3S2DH 1RF2D 4J6HA 2VQEQ 1G6ZA 2JYOA 2L0CA 4X6AH 3EA6A 4C3JH 2RCFA 1JICA 5M5YH 3NK9A 3J7YW 1FNWA 4GNXA 4LF6L 1QUQB 2A1AA 2JK8A 1F2ZA 4KJNA 4MIUA 2HQLA 1FGBD 2Q2HA 2NVXH 2BH2A 3OIQA 2R3ZA 3H3VC 1PV4A 3TQYA 4LFBQ 4DK0A 3GTGB 3HOYH 4R4IA 1EYAA 2EPBA 1SFOB 5AJ3Q 3NENA 4IQZA 2CW0D 5L37A 4ODGA 1II3A 3CW2C 1JCKB 5COYA 2E2HB 5I9PA 3KLSX 3CRLC 4A3DH 1UE6A 4UPAA 1N34Q 3O13A 5GAEC 2JA5B 3R2IA 3C1EA 2RVLA 1VQGA 5FO7B 3NBHB 2ZM6L 4QUFA 3EQLC 4PMCA 5C3WA 4APVA 3RD4A 4DV5L 1BOSA 4L5SA 1KLUD 3I55A 1I5FA 3QR8A 1EOTA 5LMNL 1TWAB 3S1NH 2JEAI 1LABA 1TQOA 2JEBI 1D7QA 4XDXA 4BY7G 3KLSA 3AB9A 3I4NG 1RIPA 3BYTB 5M3FG 2F3IA 4M8AA 3G7LA 4N9PA 4X3TA 3KLRA 1LACA 1AEXA 2QEXA 1K9MC 1VQ4A 1VDZA 1LT3D 3TRZA 1UNSA 3LX0A 4IZ8A 4HMJA 4QQBX 1NUCA 1EIHA 4K0KQ 5CBAE 4Q5VA 1HUMA 3M4QA 3H94A 5HURA 1B9NA 1LTGD 1SSOA 1N8RC 1PXUA 4JI7L 1CZGA 3T56B 2KEDA 2MO1A 1H9KA 4BY7H 1VQ9A 1O7ZA 4DAYB 1Q81C 4XYQA 2HIVA 4GKKL 3I4NH 3T4AC 3MAQA 3MXGA 3S1MB 2EY2A 2UUBQ 1Y1VG 1TWGH 4RH6A 1EIGA 1ESRA 2KCTA 4OGQC 4A3IB 1EYCA 2TSSA 1TWFH 2BH8A 2OTJA 4LNQA 2F0LA 1W3SA 1V1QA 3H0GB 2A73B 1DONA 1A0IA 1TXYA 2EYHA 4DUZL 1EFID 2UXDQ 1C7YA 3CCVA 3PUXA 3A74A 4GZYC 5EQ0A 4UHVA 3U4VA 1HNZQ 2R92G 2JA6G 3NTIA 1KLGD 2UUCL 2R7ZB 5EAYA 4B9WA 4XT1B 5BN3A 2UXCQ 5C4JH 3CQZH 5M3MB 4DV4L 4ZAIA 2SNMA 4DV3L 3I4OA 1PDQA 3F1ZA 3GTKH 2M9VA 2MP1A 5EPKA 1G291 1I4HA 2HCCA 3CC2A 3M3YB 3X3NA 3GTJB 4H7BA 1DOMA 1VCIA 1AH9A 1QZGA 1HNXL 1UEAB 2BDNA 2TMPA 1IW7C 1TS2A 3NWSA 4KHPL 3WOEA 3Q22A 1OXUA 4GN5A 4H44C 3ND9A 1PH4A 5JEAJ 3K5LA 2B8FA 1GUWA 3EIVA 2F0FA 5CV6A 1D5MC 4A3KH 2L11A 2EY5A 1VQ5A 4F87A 5J3BA 4JVZA 2OT2A 2YU9H 4LF9Q 2XIWA 4EQOA 2F3VA 2B2TC 4YCWA 1UUPA 2K5QA 3LWUA 2DJGC 1EWHA 1GXDC 2JA5G 4J15A 1TY0A 3R2TA 1SNPA 3IAYA 2AMCB 1YNNC 3D3RA 4HMIA 5CV9A 1YNJC 3RNUA 4QGUA 1VQAA 2ZXRA 2RHSB 1EY9A 1D6EC 4GNXB 1HA5A 4ZK9B 1X54A 3DXJC 1DYQA 3CCJA 1DZ1A 2V1CC 2ICIA 2F0UA 2EIFA 1NAPA 1PH7A 2FINB 4KLKA 2QF7A 2PZWA 1A63A 3M7NA 1RDPD 2KEEA 2BA1A 5EPJA 4NXMQ 1PH8A 3HOWH 1PZJD 3MWYW 1L0WA 1FYCA 2LSSA 4UDUC 2NN6G 2NWGA 3MHBA 3PIP3 3I3CA 1IW7D 2D9UA 2XNAC 1KHIA 2QEJC 2PI2A 1W2BA 3W3AA 2YTXA 4GN3B 4HTHA 4LF8Q 3LGJA 1HCZA 4ILWA 4LFBL 2B2UA 2JA8H 2GVBA 1V1OA 2WP8J 3K8AA 3OYYA 1XWEA 5AJ3L 4BA2I 4QF4A 2SNSA 2KJXA 1CKNA 1KIXA 2OQKA 2D0OA 5JJLA 2C35B 2NVTB 2A68C 1BXTA 5HY6A 1B7YB 4Y7NH 1N34L 3Q6SA 4K5VA 2IX0A 1WD1A 1YNND 3S15B 1YNJD 5KGUA 4RKLA 1TWCB 1STHA 3TZUA 5I6YA 1PFSA 3GDEA 2CCZA 1OXTA 1G2SA 1JWUD 1IZ6A 1HJPA 5IYDH 3NP8A 1SMYC 4B3RQ 2JSOA 1KXLA 1U4LA 4X62Q 1GHJA 1EFWA 3IRBA 3A8KE 5IWAQ 4A3IG 3S2HB 1J9OA 2XN9C 4AYBB 2YTYA 3D0FA 1VF5C 3R8BA 5JJZA 3I91A 3TP5A 1SYFA 3OMGA 1QG7A 2A6HD 4GOPA 3AFPA 4BBSB 3QG1A 3H0GG 1ILPA 3CU7A 3VA7A 1CHQD 2E75C 1IL2A 4LFAQ 2K5HA 1SMXA 2HUGA 2QW7A 4IPCA 3IL8A 3N52A 2DUDA 3I90A 3OOCA 5M5WB 2R7ZG 3H15A 1IL8A 1H9RA 1I3QH 2CWAA 4X3SA 5IGEA 5M3MG 4I7AA 2CH4W 5C4ZA 2AUKA 2YTVA 4K0KL 3K59A 4FF4A 3PF4A 5EKKA 4HSPA 1O80A 4A3IH 4DK3C 4DR3L 4JBWA 1PH1A 4I65A 2B8GA 2A74C 2FFKB 2XRSD 3PQIA 1F2YA 1SMYD 1J8IA 1MSHA 1OXXK 1DXMA 5K5PA 4B3TL 4A3EB 2F3WA 2Z4HA 3TP7A 2UUBL 3OWEB 4PZ6A 4XQJA 2ZTCA 1OO9B 2LXJA 4RCNA 3L2PA 2BDOA 1LTBD 4RA8A 2Q2TA 4UP9A 1QCBD 4F8MA 4DV5Q 3I70A 1D8LA 4R4TA 4NMZA 4HSVA 2JA7H 3T51B 3KJOA 2E2JH 4CJ2C 3PUVA 1HFGA 4B3MQ 2UXDL 4JI3Q 4FO2A 1Z7TA 4UP7A 1HNZL 1PFMA 4IOAA 5JJKA 3BZDB 1HZCA 1AW7A 2FHTA 4IPDA 4PZ8A 2MFIA 2IX3A 3HKSA 2UXCL
chains in the Genus database with same CATH topology
2F4IA 1VF7A 1DCZA 4CBVA 1B2TA 3OIPA 1ZYRC 3LWEA 4KHVA 1ONLA 4KV6A 5KRUA 5ELEA 1LO5D 2RBMA 4BBRB 1W6JA 2BE5D 1ENAA 2Z8LA 4O42A 4G7OC 1G8ZD 1BR9A 5J1ZA 1ML0D 5A2QL 2PNRC 1IYVA 1BCPF 1VMPA 3A8IE 4DXFA 1GJXA 1TVXA 1GUTA 4IURA 3PUZA 3MFGA 4G7HC 1IHZA 3VR5A 4WRDA 2DN8A 5CMDA 1EEID 1QWYA 1CTMA 5ISRA 3I4LA 1SYGA 4ZUIA 2O2LD 3BYYB 1JOKA 5M9OA 1ZYRD 4KY5A 1I4QA 1KNAA 1PFNA 1G91A 1NCVA 5FLXE 3HRZC 5HGTA 3GTMB 2XSCA 1TY2A 5JAVA 1TS4A 3S16B 3MA2B 4WJWA 4EGVA 4HCSA 1S5CD 3GTOB 1S4ZA 2QDBA 2VUMB 1PFBA 5ELCA 3HZXA 4FVMA 1HFNA 3GP7A 4V0BA 3CKIB 2BOSA 2EYMA 4H0LC 4R8IA 5CBEE 5I4DA 2BA0A 3IFDA 5JEAG 2VB2X 2N55A 3HOUB 3HOXB 5C4HA 1CZWA 2CW0C 4XXEA 5CV5A 3FDTA 2IT1A 3SK4A 3SHLA 2E2IB 1TWHB 4PMWA 3QOJA 2H1EA 1R4QB 2O4XA 2R93B 2IPKD 3TZDA 4HR7B 1WD0A 1O7LA 1V1PA 3NSWA 2B63B 1PZKD 4A93B 3T53B 5KEEA 4R8NA 3FKIB 5DNFA 2J0TD 3M85A 4RKBA 4P2CB 3K58A 3NQTA 3HOVB 4FXKC 1Y8NB 1XYIA 5ELFA 4IUPA 5JEAH 3DM1A 2V4DA 1BO0A 1Q1EA 1CI3M 1XTCD 3I72A 3NWTA 2OF1A 1QB5D 3URYA 5C0XH 4C3HB 1F9SA 4RGOS 3J80E 2IX1A 2WV6D 5D3DA 2F0OA 3I73A 1BQQT 1STNA 4HAEA 1ET6A 3HGBA 1UAPA 3FRPB 2N88A 1AZPA 1SJED 4IUUA 4Q0FA 5KNBA 1PRTB 4IUQA 4DU9A 2F0IA 4ZKBB 1OXVA 1B1ZA 2M2LA 2MJ8A 1EQTA 1LTSD 3K7AB 3FPUB 4A3GB 4KY6A 4PQXA 2KCCA 5CV7A 3DWAA 3OMCA 5IT9L 3H09A 3SK6A 2F0GA 1EY0A 5KYIA 4ZRZA 1TU2B 3J81L 2H4OA 4A3BB 2RSOA 1OXSC 1IYUA 5A2QE 1SAPA 3PO2B 4C3IB 1RODA 1ENFA 3MXUA 3U9OA 2RDHA 5EBCA 3VYRA 4FF1A 1M4VA 2ZXPA 3RLFA 3V96A 3EJIA 2B2VA 3K5NA 5E1FA 2AQ2B 4A3FB 1U4PA 4O1NA 4HN7A 2MUYA 1HPCA 2K5WA 1HUNA 1PLFA 1ZKOA 2FMMA 3BDCA 4ME5A 3M4OB 4EVOA 1W6KA 2I07B 1WTWA 4CKCA 1QOHA 4BWGB 2L12A 2L9HA 4FP5D 1JQYD 2MGSA 4DA2A 2RDFA 5JPNC 5DM63 3KUPA 2NTSA 4G7ZC 1GUSA 2YYZA 2F0MA 2NVYB 5C5MA 4OO1I 2K04A 2WKCA 1MSGA 1CQVA 5DEHA 3CRKC 3MTSA 1E2ZA 5IIFA 1VMCA 1GHKA 1AFPA 2MPMA 5KYLA 3F2UA 2Z1CA 3E5SA 1B9MA 1EY6A 1LT6D 3K6OA 3SDZA 1KTKA 1MBYA 2X6LA 1E2WA 1PTOH 4M1UB 2G9HD 3DWQA 2QILA 2O5IC 4KD4A 5KIXA 3A8JE 3NQIA 2E76C 2B39A 1HXYD 2F0JA 1F77A 1QILA 4KKUA 3PIO3 4C3HG 2B2UC 1EY7A 1E0BA 1V1PB 3VR2A 1V8QA 3X3MA 1ENCA 3BVMA 3VYUA 3HKZB 4KKTA 2RQXA 5LL6X 4U673 4C56C 1I4RA 2R61A 1LTRD 4DNTB 4L6TB 4K5WA 4OIJA 4G4KA 1STGA 4QIWB 2F0VA 3NUCA 5NUCA 1I6VC 4PMBA 4FXDA 4XTCS 2EJGC 4IN3A 3TDQA 1PTOC 3MXNA 2D5DA 5JVH3 3Q23A 1CA6A 1I4GA 2DNEA 2Q8TA 3OPOA 1PTOF 2A6HC 2Z4IA 1STBA 1QNUA 4ZYSA 4IALA 4C3IG 2VXWA 1RKNA 5J22A 1NR2A 3NHHA 2B2YC 3BDOA 4DF7A 5C4XB 1Y8OB 1O78A 1CFMA 2J4XA 5IGCA 3C2PA 4A3MB 3PUYA 4CGYB 2Y0SB 2K1BA 3BVGA 5J39A 1F9RA 5IT9E 2NVQB 1GUGA 2F1MA 1EU3A 3FEWX 1S5ED 5CC4A 3J81E 3GO5A 2KUMA 2R6GA 2XWBB 4HCEA 2NN6H 1I6HB 4C2MB 3G6JB 1FNUA 2K05A 5E4XA 1SE2A 1PTOD 1S5BD 3RUZA 3DMUA 2OEOA 2B2TA 3BDLA 2X69A 3CHBD 2KA7A 3RZDB 1HTPA 3NE5B 4F7XA 5EGTA 1U9RA 2OXPA 2FMCA 2SDFA 2Q8RE 1D5XC 2K28A 2PYKA 1A3TA 3FMCA 4J8QA 5CR3A 4A3JB 1D5ZC 1CA5A 5DM73 4K2KA 4QB4A 2KVMA 2A5HA 3MC0B 4R9WA 3SXHA 4KJOA 4DGZA 2AWOA 2GA4B 3HOZB 2F0NA 1JWSD 4WORA 2EYOA 1FD7D 3QWNA 5C44B 2BE5C 2VNUD 1LV9A 3S2DB 1STEA 2LS01 1LT5D 4N9TA 4NKLA 3HS0C 4C3JB 1EY4A 5M5YB 1HHVA 2E74C 3H91A 5I9OA 3SK5A 3P75A 2IJ0A 4KK7A 3QO2A 4OL7A 1SNDA 2NVXB 1DOLA 2B2WA 2RSNA 3T13A 2DY8A 1CM9A 2IW3A 1A3UA 1CT1D 5EBDA 3HOYB 3QIAA 4ZUJA 4LMQD 1GOZA 4ABNA 4NDXA 4K2LA 1SE3A 4A3DB 2L55A 3GTQB 3EROA 2IWHA 1F9QA 1E2VA 3R3OA 3HP3A 1D1KA 3V2TA 5ELDA 2FJ2A 1F9PA 1I4XA 4IUVA 1RCVD 5FO9B 4IUTA 4OO1G 1BUVT 3AU7A 3IKJA 4DAVA 4MHEA 2SOBA 3A7LA 1SBBB 1M8AA 1H9JA 2JXMB 4IFDJ 3I8ZA 3NBIA 5TSSA 1SYEA 4IUNA 3HG9A 5K36G 3C1FA 1SYDA 4CKBA 3T16A 4K8IA 2HQEA 4RAUC 5JVG3 1Q12A 1AP0A 3J7AV 2X6GA 1JE4A 4OO1H 4BY7B 1SDFA 3K5MA 1JORA 1H9MA 2J7ZA 1JWMD 2C9OA 2PMZB 5EKLA 1X3PA 1B50A 2QCPX 1BDOA 3D6CA 4NP5A 3P7JA 4IFDI 3PUWA 4FXGC 3SVMA 1IKLA 1CK1A 1TWGB 4CJ0B 4DXGA 4K6DA 1Z47A 5F2DA 1JOOA 2WB1B 1TWFB 4EQNA 2EJFC 1LTID 4ZKCB 4LK1C 5K36H 1WTPA 5IGFA 1JOQA 3A54A 1T5EA 5JOBA 1WVLA 2DNCA 1PYWD 3R93A 3GV6A 3QOLA 1WTRA 1H9SA 2CVRA 1X32A 3WOFA 1BBXC 3N6RA 3GQBA 5C4JB 1C48A 3CQZB 5D14A 3FPPA 4CHTB 3GTKB 2NBFA 2LFNA 4C3JG 4FNFA 4DAPA 3GTPB 1RTOA 1STYA 2EYFA 4X3UA 2K33A 4KN7C 5DAUA 3DHQA 3SK8A 2RKSA 2D62A 1U4MA 3QJYA 4A3KB 2O5JC 2SEBD 1MD2D 3E6ZX 2AUJD 4LAAA 2YU9B 1RTNA 1EYDA 2PCFB 1Y69U 2K01A 3BG3A 2EDGA 3KBGA 3MXPA 1FR3A 3C46A 1DD2A 1BF4A 3JAML 1TKWB 4B08A 2B2VC 3A56A 2NB0A 2KQ3A 4TRDA 1O7YA 1GUOA 3P20A 3M7GA 2AQ1B 3HOWB 1Q90A 3ITPA 3UI2A 1IKMA 1SNMA 2VB3X 1X3QA 2ZXOA 4LJZC 5FOBB 4TKOB 3DEPA 2JA8B 2RA4A 2EZVA 1CQFA 2K7VA 1DOKA 4G57A 2PQEA 3K0YA 3Q24A 2E2DC 3W2DA 2PO4A 5BN4A 4Y7NB 3MZ5A 5E3FA 2EY6A 3BS1A 1NSNS 2JP1A 5A35A 1U4RA 4QMGA 1HRJA 4KHZA 1A6XA 2F03A 1WTXA 3OWFA 3KF8A 1L0XB 2EJMA 1A15A 1V43A 3TBIB 1TS5A 3V05A 1A2TA 1SNCA 4NW2A 3HEJA 3VR3A 5G3LF 2WIIB 2PPBC 3LNNA 1DM0B 3QB3A 3MFYA 3Q0AA 2G9DA 1I3QB 2KCNA 4MN3A 1EWCA 1LTTD 3TP8A 1SEBD 1STAA 1BNZA 2Q8IB 2F0KA 2WINB 4I7ZC 3MEHA 2EOTA 4HEDA 4E6IA 4PV1C 1R4PB 2NTTA 1WTQA 1BCPB 2BCOA 2HDLA 4ZQ3A 4KTAA 1RJTA 1H9SB 1EQVA 4FYDA 5G3LD 4BA1I 1G2TA 5ELBA 2F0HA 1Z6HA 3OSOA 4QUCA 4DNRB 3NXWA 1EZ6A 3KBXA 2EYPA 1ZXTA 1JB3A 2JA7B 4XQNA 2E2JB 3DWPA 2KECA 3NTKA 3PV0A 5M5XB 4EQPA 1EY5A 1FNVA 4K6LA 5EJWA 4JK1C 2AQ3B 1JR0D 2A6EC 4FF2A 4L63B 3RMHA 2F0WA 2XWJB 3S17B 1PZID 4DK1A 3VYTA 2KOLA 4IFDG 2LY7A 1S5DD 1A3VA 3VR6A 2NYZD 4RFBA 4KN4C 3U9SA 1I50B 2K6AA 3D4DA 2EYJA 1RHPA 4ZLTF 3E0JA 1TS3A 5LHY1 3L7ZC 1MGSA 1SYCA 5C0XJ 5IGGA 1HQRD 1Y8PB 5C5LA 3JAME 2CHBD 1F2LA 2HDMA 5EKIA 2DY7A 2NZ1D 5T1GA 2F0TA 4IFDH 5JPMC 2A6ED 1LLRD 3NPPA 4F88A 4OIKA 5CV8A 2L1BA 4DFAA 1C8CA 1JC7A 4RGTA 5C0XI 1XX8A 5KNDA 3K5OA 3TN2A 1B4OA 1SNQA 4KD3A 4BS9A 3WDNA 4QCLA 3VA5A 2LMCB 3D31A 3ERQA 1I4PA 1AZQA 5FK9C 2C5CA 3P1HA 4UAIA 4K14A 5FLXL 5I2YA 2ENBA 2CQAA 4K8JA 2WKDA 3S9WA 4XQQA 2F0PA 1SYBA 4B9XA 1Q3LA 3A7AB 4XT3B 1TR5A 3SR1A 1Y1WB 3S14B 3VR4A 3RZOB 5IGDA 4XYOA 2PW5A 4H13C 2B2WC 2XVSA 2K5DA 5CV4A 5C3EB 3BVZA 2EE1A 1PRTC 2EY1A 1K83B 2EVBA 4XIGS 3SE0A 4TQUS 2EXZA 3EFXD 1NR4A 3PO3B 5CORA 4RGMA 3AMUA 5C6AA 1HQMC 2ZT9C 3TSSA 1PRTF 1HTLD 1TT2A 4ULLA 2B2YA 4BY1B 4KKSA 1C4QA 3L3OC 1Q8IA 2F0EA 5IOCA 5FKAC 3M4YA 4K5XA 4RWSC 1QJOA 3H6MA 3TP6A 2WAQB 3DEOA 2A68D 1GUNA 3L9AX 5IGBA 5FO8B 5CGKA 4RCOA 4KMUC 1KABA 1DJRD 4C1NI 4V190 2PZUA 1SNOA 1D2BA 3PMFA 5LL6S 1ICWA 1ET9A 3ND8A 4FF3A 1PRTD 3D4WA 3I4MB 2PW7A 4RHSA 4C1NK 2IL8A 1EU4A 1A2UA 1LTAD 3J80L 2XRQD 1WCMB 3D4RA 5KNCA 4YIJA 1WTVA 3VYSA 3S1QB 3NBHA 1KAAA 1EL0A 1ILQA 1K8MA 1B3AA 2WACA 4PNYA 2PZTA 2JE6I 2MHVA 3S1NB 1EY8A 3GD7A 1SXTA 1PMRA 2KHSA 2M00A 5EPLA 5D3IB 4WFN3 1BCPC 2EYLA 2ID0A 4J1MA 4TSSA 1B53A 2A69C 2LKVA 5IODA 5AFWA 2K03A 1KDAA 1RD9D 5BN5A 1F2MA 2K32A 3SEBA 3TMEA 3MVVA 2F0QA 3C3LA 2L4NA 3GV3A 3EVQA 3KK7A 4KY7A 2HCIA 3DUZA 4DN4M 4U68A 1KDCA 3D6WA 2I46A 1S5FD 1SJHD 4RHRA 3IFTA 4CKEA 1MI2A 2NUCA 1LT4D 4DAYA 4ID6A 3I4NB 2L5TA 5M3FB 2ICEC 2AWNA 5D65A 1Q1BA 2QKIC 5E4WC 3ONAB 1AN8A 4L8JA 1ESFA 1CHPD 3A55A 1BCPD 2A69D 1XXGA 2F0DA 4X3KA 3NTHA 3OHXC 3J7AF 1TIID 1D1IA 3D8GA 3OW7A 1SE4A 5C3XA 5CYUA 1ZEQX 2F0SA 1QNKA 4CJ1B 1WTOA 5I2XA 1HA6A 1Y1VB 1KNEA 1PTOB 1R9TB 1T5XD 1EEFD 2NN6I 5T1IA 1QE6A 4Z9CB 4OHJA 1B44D 1KDBA 3ZYYX 1L0YB 1K8OA 4KI0A 5C0XG 3FVQA 3K57A 2R92B 2JA6B 3GTLB 4S3SA 4RGNA 5I6WA 2RDGA 3S1RB 1EZ8A 2D2CC 1RF2D 4J6HA 1G6ZA 2JYOA 2L0CA 3EA6A 1JICA 3J7YW 3NK9A 1FNWA 1F2ZA 4KJNA 4MIUA 1FGBD 3OIQA 2R3ZA 3H3VC 4DK0A 3GTGB 1EYAA 2EPBA 1SFOB 4IQZA 2CW0D 4ODGA 1II3A 1JCKB 5COYA 2E2HB 5I9PA 3KLSX 3CRLC 3O13A 2JA5B 3R2IA 3C1EA 2RVLA 5FO7B 4QUFA 3EQLC 4PMCA 5C3WA 3RD4A 1BOSA 1KLUD 1EOTA 1TWAB 2JEAI 1LABA 1TQOA 2JEBI 4XDXA 3KLSA 3AB9A 3BYTB 4M8AA 3G7LA 4N9PA 4X3TA 3KLRA 1LACA 1AEXA 1VDZA 1LT3D 1UNSA 3LX0A 4IZ8A 4HMJA 1NUCA 1EIHA 5CBAE 4Q5VA 1HUMA 3H94A 5HURA 1B9NA 1LTGD 1SSOA 1PXUA 1CZGA 3T56B 2KEDA 1H9KA 1O7ZA 4XYQA 3T4AC 3MAQA 3MXGA 3S1MB 2EY2A 4RH6A 1EIGA 1ESRA 4OGQC 4A3IB 1EYCA 2TSSA 2F0LA 3H0GB 2A73B 1DONA 2EYHA 1EFID 3PUXA 4GZYC 5EQ0A 3NTIA 1KLGD 2R7ZB 4B9WA 4XT1B 5BN3A 5M3MB 4ZAIA 2SNMA 1PDQA 2M9VA 2MP1A 5EPKA 1G291 1I4HA 2HCCA 3M3YB 3X3NA 3GTJB 4H7BA 1DOMA 1VCIA 1UEAB 2BDNA 2TMPA 1IW7C 1TS2A 3NWSA 3WOEA 3Q22A 1OXUA 4H44C 3ND9A 5JEAJ 3K5LA 2B8FA 1GUWA 2F0FA 5CV6A 1D5MC 2L11A 2EY5A 4F87A 2OT2A 2XIWA 4EQOA 2F3VA 2B2TC 1UUPA 2K5QA 3LWUA 1EWHA 1GXDC 1TY0A 3R2TA 1SNPA 3IAYA 1YNNC 3D3RA 4HMIA 5CV9A 1YNJC 2ZXRA 1EY9A 1D6EC 1HA5A 4ZK9B 3DXJC 1DYQA 1DZ1A 2ICIA 2F0UA 1NAPA 2FINB 2QF7A 2PZWA 3M7NA 1RDPD 2KEEA 2BA1A 5EPJA 1PZJD 3MWYW 1FYCA 4UDUC 2NN6G 2NWGA 3MHBA 3PIP3 3I3CA 1IW7D 2D9UA 2XNAC 2QEJC 3W3AA 4HTHA 1HCZA 4ILWA 2B2UA 1V1OA 2WP8J 1XWEA 4BA2I 4QF4A 2SNSA 2KJXA 2NVTB 2A68C 1BXTA 3Q6SA 4K5VA 2IX0A 1WD1A 1YNND 3S15B 1YNJD 5KGUA 4RKLA 1TWCB 1STHA 3TZUA 5I6YA 1OXTA 1G2SA 1JWUD 3NP8A 1SMYC 2JSOA 1U4LA 1GHJA 3A8KE 3S2HB 1J9OA 2XN9C 4AYBB 1VF5C 3R8BA 5JJZA 3I91A 3TP5A 1SYFA 3OMGA 1QG7A 2A6HD 4BBSB 3QG1A 1ILPA 3CU7A 3VA7A 1CHQD 2E75C 2HUGA 3IL8A 3N52A 3I90A 3OOCA 5M5WB 1IL8A 1H9RA 4X3SA 5IGEA 5C4ZA 2AUKA 3K59A 4FF4A 5EKKA 4HSPA 1O80A 4JBWA 4I65A 2B8GA 2A74C 2FFKB 2XRSD 1F2YA 1SMYD 1J8IA 1MSHA 1OXXK 1DXMA 5K5PA 4A3EB 2F3WA 2Z4HA 3TP7A 3OWEB 4XQJA 1OO9B 4RCNA 2BDOA 1LTBD 4RA8A 1QCBD 4F8MA 3I70A 4NMZA 4HSVA 3T51B 4CJ2C 3PUVA 1HFGA 4FO2A 1Z7TA 1PFMA 3BZDB 1AW7A 2FHTA 2IX3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SYC A;  5IIF A;  5IOD A;  5IGG A;  5IGC A;  1EY4 A;  3NP8 A;  3QB3 A;  1KDB A;  1KDA A;  1JOR A;  4N9P A;  3MXP A;  2EYM A;  5EKL A;  5KYL A;  3E5S A;  5I9O A;  5C5L A;  3D6C A;  3P75 A;  4NP5 A;  2F0E A;  3SK5 A;  1F2M A;  4KY6 A;  5IOC A;  5J39 A;  4OL7 A;  1AEX A;  1SND A;  1EY6 A;  5CV7 A;  3T13 A;  3TP6 A;  3TP8 A;  3OMC A;  4K5X A;  3SK6 A;  1STA A;  4KHV A;  3TME A;  2F0F A;  4KV6 A;  5CV6 A;  4S3S A;  2F0G A;  3TP5 A;  3LX0 A;  3H6M A;  3MVV A;  1SYF A;  1EY0 A;  2KQ3 A;  3OMG A;  1NUC A;  2EY5 A;  2F0Q A;  4HMJ A;  1JOO A;  4K6D A;  4TRD A;  5F2D A;  5I6W A;  4IZ8 A;  1A3U A;  1EZ8 A;  3EVQ A;  2RBM A;  4EQN A;  5C4H A;  2F0K A;  4KY7 A;  2F0T A;  3MEH A;  5CV5 A;  4ZUJ A;  4J6H A;  1ENA A;  1KDC A;  4E6I A;  5HUR A;  4EQO A;  5IGB A;  2F3V A;  3ITP A;  4KD4 A;  3SK4 A;  5CGK A;  5KIX A;  3SHL A;  3QOJ A;  1KAB A;  2O4X A;  4NDX A;  1SNM A;  4K2L A;  5J1Z A;  5CV8 A;  1SNP A;  2PZU A;  1SNO A;  5IGF A;  2NUC A;  3U9O A;  1JOQ A;  4ID6 A;  2F0J A;  4HMI A;  5CV9 A;  3NK9 A;  3DMU A;  3RUZ A;  2OEO A;  3PMF A;  5JOB A;  4DFA A;  1EY9 A;  1EY7 A;  1F2Z A;  3ERO A;  3QOL A;  4KJN A;  4MIU A;  4KTA A;  4ZQ3 A;  1ENC A;  5IGE A;  3BDL A;  2EY2 A;  5C4Z A;  1EQV A;  5KEE A;  3D4W A;  2F0U A;  5CC4 A;  4R8N A;  1SNQ A;  2PW7 A;  3EJI A;  3R3O A;  2F0H A;  4KD3 A;  4F7X A;  4RKB A;  3OSO A;  4G57 A;  1EYC A;  5EGT A;  5EKK A;  2PZW A;  3V2T A;  3VA5 A;  5E1F A;  2PQE A;  1U9R A;  1EYA A;  3NQT A;  3NXW A;  1A2U A;  1EZ6 A;  3ERQ A;  2OXP A;  1IHZ A;  2EYP A;  4I65 A;  4WRD A;  3P1H A;  2F0L A;  4K14 A;  4ODG A;  4YIJ A;  4K5W A;  1II3 A;  3MHB A;  1STG A;  4EQP A;  3MZ5 A;  5E3F A;  1F2Y A;  2EY6 A;  1EY5 A;  2F0V A;  3BDC A;  4ME5 A;  2PYK A;  1NSN S;  2ENB A;  5I9P A;  2F0D A;  5K5P A;  2SOB A;  4EVO A;  5ISR A;  1SYG A;  1A3T A;  2EYH A;  2F3W A;  3NUC A;  4K8J A;  4ZUI A;  5NUC A;  3TP7 A;  4PMB A;  4QMG A;  1JOK A;  3S9W A;  2F0P A;  1SYB A;  3C1E A;  4B9X A;  3D8G A;  5CR3 A;  1KAA A;  1TR5 A;  4HTH A;  2OF1 A;  3SR1 A;  5M9O A;  5C3X A;  4KY5 A;  4K2K A;  5IGD A;  1STY A;  2EYF A;  2F0S A;  2PW5 A;  4QB4 A;  5KRU A;  2WAC A;  2F0W A;  4PNY A;  4B9W A;  2PZT A;  2RDF A;  3OWF A;  4PMC A;  5C3W A;  5DAU A;  3DHQ A;  3SXH A;  4QF4 A;  2SNS A;  4KJO A;  3SK8 A;  4DGZ A;  1SYE A;  2RKS A;  2SNM A;  4IUN A;  4F8M A;  1A3V A;  2F0N A;  2F0O A;  1STN A;  2F0M A;  5CV4 A;  5HGT A;  4NMZ A;  3C1F A;  1SYD A;  2EY1 A;  1EY8 A;  1TQO A;  3T16 A;  5C5M A;  5JAV A;  1STB A;  4K8I A;  2EXZ A;  1A2T A;  2EYO A;  4WOR A;  5KYI A;  1SNC A;  2HQE A;  4IAL A;  4K5V A;  5J22 A;  1RKN A;  5DEH A;  4LAA A;  3D4D A;  3NHH A;  2KHS A;  5KGU A;  2EYJ A;  2M00 A;  4RKL A;  3HEJ A;  1STH A;  4DF7 A;  5I6Y A;  5C6A A;  4H7B A;  4DU9 A;  2F0I A;  2EYL A;  1EYD A;  4J1M A;  2QDB A;  1TT2 A;  3HZX A;  4NKL A;  4N9T A;  2LKV A; 
#chains in the Genus database with same CATH topology
 2F4I A;  1VF7 A;  1WFQ A;  3S17 H;  1DCZ A;  1J5E Q;  2VQF Q;  4CBV A;  1N33 Q;  3K7U C;  3OIP A;  1B2T A;  1ZYR C;  2QGQ A;  3LWE A;  4KHV A;  1ONL A;  4KV6 A;  2MO0 A;  5KRU A;  4IOC A;  5ELE A;  2JJQ A;  3CC7 A;  1LO5 D;  3W1G A;  2RBM A;  4BBR B;  1W6J A;  1I50 H;  1YVC A;  2BE5 D;  1ENA A;  2G5D A;  1QVG A;  2NZO A;  1GKH A;  2Z8L A;  4O42 A;  4G7O C;  1G8Z D;  2CFM A;  1HR0 L;  1BR9 A;  5J1Z A;  1ML0 D;  5A2Q L;  2PNR C;  1IYV A;  1FJG Q;  1K0R A;  1BCP F;  4MTK A;  1VMP A;  3A8I E;  4DXF A;  1GJX A;  5IP9 H;  1TVX A;  1GUT A;  1UE5 A;  1PA6 A;  4IUR A;  1S3O A;  4LF9 L;  3PUZ A;  1Q86 C;  4JI5 Q;  3MFG A;  3AQQ A;  4G7H C;  1QVC A;  1VQI A;  1I94 Q;  5LMN W;  1IHZ A;  3VR5 A;  4X64 Q;  2HIX A;  4WRD A;  2DN8 A;  5CMD A;  1EEI D;  1QWY A;  2B29 A;  1Q8K A;  1CTM A;  5ISR A;  3I4L A;  1SYG A;  2K14 A;  4ZUI A;  2O2L D;  3BYY B;  3ER0 A;  1JOK A;  3NEM A;  3KFU A;  5M9O A;  4AYB E;  1ZYR D;  4KY5 A;  3CCM A;  4AYB G;  1SR3 A;  1I4Q A;  1KNA A;  2UUC Q;  1L1O A;  4NXM L;  1PFN A;  1G91 A;  1NCV A;  5FLX E;  3HRZ C;  4BBS G;  1CKN B;  1SN8 A;  5HGT A;  3GTM B;  1HZ9 A;  2XSC A;  4DV3 Q;  4YCV A;  1TY2 A;  5JAV A;  1TS4 A;  3S16 B;  3CCQ A;  4DR4 Q;  2OWO A;  3MA2 B;  4WJW A;  4EGV A;  4HCS A;  1S5C D;  3UDF A;  3GTO B;  1S4Z A;  2QDB A;  2VUM B;  1PFB A;  5ELC A;  3HZX A;  4FVM A;  1HFN A;  1HNX Q;  1Y1W H;  3GP7 A;  3S14 H;  3RZO H;  4O0A A;  4V0B A;  3CKI B;  2BOS A;  2NZH A;  2EYM A;  1XJV A;  4H0L C;  3HFZ B;  4R8I A;  1E1T A;  3I2Z A;  1JB7 A;  4KHP Q;  3F2B A;  5CBE E;  1S40 A;  5I4D A;  5GRO A;  5C3E H;  2BA0 A;  4HJ8 A;  2GN5 A;  3IFD A;  1K83 H;  3H3V H;  4DK6 C;  5JEA G;  2VB2 X;  4DV6 Q;  2N55 A;  3HOU B;  3RR5 A;  1G51 A;  5C4H A;  1CZW A;  3HOX B;  1VQH A;  2CW0 C;  1AE2 A;  4GOP B;  4XXE A;  5CV5 A;  3FDT A;  2IT1 A;  3SK4 A;  4A3E G;  4BBS H;  3SHL A;  2E2I B;  4B3R L;  1TWH B;  4PMW A;  3QOJ A;  3ULL A;  4N8X 1;  2H1E A;  1R4Q B;  2O4X A;  3DLL A;  2R93 B;  4X62 L;  1YHA A;  1X56 A;  2IPK D;  3TZD A;  5IWA L;  4BY1 H;  4HR7 B;  1WD0 A;  1VQ6 A;  1O7L A;  1V1P A;  3NSW A;  2B63 B;  1PZK D;  4A93 B;  3T53 B;  1GM5 A;  5KEE A;  1WCM G;  4A3L G;  4R8N A;  3PIP A;  3FKI B;  5DNF A;  2J0T D;  2K5V A;  3M85 A;  1VQL A;  4RKB A;  4P2C B;  3K58 A;  1FL0 A;  3NQT A;  4FXK C;  2Z6K A;  4LFA L;  3HOV B;  1Y8N B;  1ASZ A;  1XYI A;  5ELF A;  4IUP A;  1Q82 C;  5JEA H;  1CKO A;  2PQA A;  3DM1 A;  2K52 A;  2V4D A;  1BO0 A;  1Q1E A;  1CI3 M;  3B6Y A;  4DPG A;  1XTC D;  4A3E H;  3I72 A;  3NWT A;  2OF1 A;  1QB5 D;  3URY A;  1K3B C;  5C0X H;  1WOC A;  4C3H B;  4YWK A;  3I4M H;  1F9S A;  4RGO S;  3J80 E;  2IX1 A;  2WV6 D;  1MJE A;  5D3D A;  1IBL Q;  4JBM A;  4BBR G;  2F0O A;  3I73 A;  1BQQ T;  1STN A;  4HAE A;  1ET6 A;  3HGB A;  1WCM H;  4GN4 B;  1UAP A;  3UDX A;  4DV0 Q;  3FRP B;  2N88 A;  1AZP A;  1SJE D;  4IUU A;  4Q0F A;  1Y14 B;  5KNB A;  1PRT B;  4IUQ A;  4DU9 A;  3S1Q H;  2F0I A;  4ZKB B;  1QVF A;  1OXV A;  1B1Z A;  2M2L A;  2MJ8 A;  1EQT A;  2H5X A;  2KHI A;  1LTS D;  4OWT B;  3K7A B;  2I5H A;  3FPU B;  3TEH B;  4A3G B;  4CDC C;  4KY6 A;  4PQX A;  2KCC A;  5CV7 A;  3DWA A;  3OMC A;  5IT9 L;  4B3M L;  4JI3 L;  3H09 A;  4ME3 A;  3SK6 A;  2F0G A;  2VZA A;  1EY0 A;  5KYI A;  4ZRZ A;  2Q2I A;  4YY3 Q;  1TU2 B;  3J81 L;  2H4O A;  4CDE C;  4A3B B;  2RSO A;  2PI2 E;  1NBW A;  1OXS C;  1IYU A;  5A2Q E;  1SAP A;  3PO2 B;  4C3I B;  1ROD A;  3ERS X;  4BXX G;  1ENF A;  3MXU A;  1J5E L;  3U9O A;  2UXB Q;  2VQF L;  1N33 L;  2HD3 A;  2RDH A;  5EBC A;  3VYR A;  4FF1 A;  1M4V A;  2OQ0 A;  5FJ8 G;  4DR1 L;  2ZXP A;  3RLF A;  3V96 A;  3EJI A;  3PSI A;  4NPS A;  2B2V A;  3K5N A;  4H02 A;  5E1F A;  4DR6 Q;  2AQ2 B;  4A3F B;  1KC8 C;  1PH2 A;  1U4P A;  4O1N A;  4HN7 A;  4DR3 Q;  1UE7 A;  2MUY A;  2VW9 A;  1HPC A;  1FJG L;  3CCS A;  1VQ8 A;  2K5W A;  2VUM G;  4FDB A;  1HUN A;  1PLF A;  1ZKO A;  2FMM A;  3BDC A;  3MEF A;  4ME5 A;  3M4O B;  4EVO A;  1W6K A;  2I07 B;  5M3F H;  1WTW A;  1LM0 A;  2PNH A;  4B3T Q;  2A8V A;  4CKC A;  1QOH A;  4BWG B;  1IXR A;  1VQC A;  3WWV A;  2L12 A;  1X65 A;  2L9H A;  4FP5 D;  4BXX H;  1JQY D;  2MGS A;  4JI5 L;  1AE3 A;  4JBK A;  4DA2 A;  2RDF A;  1I94 L;  5JPN C;  5DM6 3;  4X64 L;  1L1O B;  1NMF A;  2NTS A;  3KUP A;  4G7Z C;  3HOU G;  3HOX G;  1GUS A;  2YYZ A;  4DV2 Q;  2F0M A;  2NVY B;  5C5M A;  1CSP A;  4OO1 I;  4GLA C;  2K04 A;  2WKC A;  1MSG A;  1CQV A;  1P8L A;  5DEH A;  2R93 G;  3U50 C;  3CRK C;  2Z9H A;  2A19 A;  3MTS A;  3CPF A;  1E2Z A;  4ALP A;  2B63 G;  2KEN A;  1E24 A;  5FLM G;  5IIF A;  1VMC A;  4A93 G;  1GHK A;  1AFP A;  2MPM A;  5KYL A;  3F2U A;  2Z1C A;  3E5S A;  2OTL A;  3FKI G;  2RHQ B;  1B9M A;  1EY6 A;  1LT6 D;  3K6O A;  3SDZ A;  1Y1V H;  4DR4 L;  1KTK A;  1MBY A;  2X6L A;  3HOV G;  1E2W A;  1PTO H;  2K5N A;  4M1U B;  1R9T H;  2G9H D;  3E3X A;  1SRO A;  1A8V A;  2QIL A;  3DWQ A;  4NB3 A;  2AHO B;  2N78 A;  2O5I C;  3HOX H;  3J81 j;  4KD4 A;  5KIX A;  4QL5 A;  3A8J E;  3NQI A;  1J6Q A;  3RN5 A;  4LWC A;  2E76 C;  4YWL A;  5IYB G;  2B39 A;  1HR0 Q;  1HXY D;  2F0J A;  2QA4 A;  1F77 A;  1QIL A;  4KKU A;  5IT9 c;  3PIO 3;  4C3H G;  2B2U C;  3W5O A;  1EY7 A;  1E0B A;  1V1P B;  2R92 H;  2JA6 H;  3VR2 A;  3GTL H;  1V8Q A;  3X3M A;  1ENC A;  3A5Z B;  3OTO Q;  3CCU A;  1BKB A;  3BVM A;  4JBJ A;  4DV6 L;  4JI2 L;  5BR8 Q;  3J81 c;  3VYU A;  3HKZ B;  5FLM H;  4KKT A;  2RQX A;  2IHE A;  4RMF A;  3OW2 A;  3S1R H;  5LL6 X;  4U67 3;  2HT1 A;  4C56 C;  1I4R A;  2R61 A;  1LTR D;  4DNT B;  4L6T B;  4K5W A;  4OIJ A;  4G4K A;  1S72 A;  1STG A;  4QIW B;  2PQA B;  2F0V A;  1FVI A;  3NUC A;  2CQO A;  5NUC A;  1I6V C;  4PMB A;  4FXD A;  4XTC S;  2EJG C;  4A3G G;  1BBW A;  4IN3 A;  2VS1 A;  5JJI A;  3TDQ A;  5IYB H;  4HID A;  1PTO C;  3MXN A;  2D5D A;  5JVH 3;  3Q23 A;  2R7F A;  4JI4 Q;  4JI1 Q;  1CA6 A;  1I4G A;  2DNE A;  3EBE A;  2Q8T A;  3GTG H;  3OPO A;  1JJ2 A;  4A3B G;  1SFO H;  1T9H A;  4GOP C;  1PTO F;  1X9N A;  2A6H C;  2Z4I A;  1STB A;  1QNU A;  4R4C A;  4ZYS A;  1MIU A;  4IAL A;  4C3I G;  3PO2 G;  2E2H H;  1YIJ A;  2VXW A;  1RKN A;  5J22 A;  1NR2 A;  3NHH A;  2B2Y C;  3BDO A;  4DF7 A;  4TVA B;  1Y8O B;  5C4X B;  2XTI A;  1O78 A;  2JA5 H;  4DV7 L;  1CFM A;  1XTD A;  2J4X A;  5IGC A;  3C2P A;  4A3M B;  3PUY A;  4CGY B;  1IBL L;  2Y0S B;  2K1B A;  3BVG A;  3CAM A;  3K7A H;  5J39 A;  1F9R A;  5IT9 E;  2NVQ B;  1GUG A;  4A3G H;  2F1M A;  3UE1 A;  1TWA H;  4A3F G;  1EU3 A;  3J80 i;  4DV0 L;  3FEW X;  4HJA A;  1S5E D;  5CC4 A;  4NXN Q;  3J81 E;  3GO5 A;  4A76 A;  2KUM A;  1NMG A;  2R6G A;  3CF5 A;  2LXK A;  1NE3 A;  2XWB B;  4WJ3 M;  4DNI A;  4HCE A;  2NN6 H;  1I6H B;  4C2M B;  3G6J B;  1FNU A;  2K05 A;  5E4X A;  1SE2 A;  1PTO D;  1S5B D;  3RUZ A;  3DMU A;  2OEO A;  2B2T A;  4R4Q A;  1CKM A;  3BDL A;  2X69 A;  3CHB D;  4YY3 L;  2KA7 A;  5ELN A;  3RZD B;  1HTP A;  3NE5 B;  1HH2 P;  4F7X A;  3TS2 A;  4N8F A;  5EGT A;  3TS0 A;  1U9R A;  2N3S A;  3PCO B;  4IPG A;  2OXP A;  2FMC A;  2SDF A;  2Q8R E;  2UXB L;  1D5X C;  2K28 A;  2PYK A;  2ZTD A;  1A3T A;  3FMC A;  4J8Q A;  5CR3 A;  1E3P A;  4A3J B;  1D5Z C;  1CA5 A;  4HJ5 A;  3S1M H;  5DM7 3;  4K2K A;  4QB4 A;  2KVM A;  4DR6 L;  2N8N A;  1SE8 A;  2A5H A;  3I7F A;  4X66 Q;  4IJL A;  3MC0 B;  4R9W A;  4A75 A;  2E5L L;  3SXH A;  4KJO A;  4DGZ A;  2AWO A;  2CH4 A;  2GA4 B;  4DR2 Q;  3HOZ B;  2F0N A;  4RG1 A;  3KOJ A;  2ZTE A;  4B3S L;  1JWS D;  5IYC G;  4WOR A;  2EYO A;  1XPU A;  1FD7 D;  2NVY H;  3QWN A;  5C44 B;  2UUA Q;  2BE5 C;  3H0G H;  2VNU D;  1LV9 A;  3S2D B;  1STE A;  1PHJ A;  2LS0 1;  3ICE A;  1WI5 A;  1BVS A;  2ASB A;  1LT5 D;  4N9T A;  4NKL A;  3HS0 C;  4C3J B;  3T1H L;  1EY4 A;  1EQQ A;  1VQJ A;  4HIM A;  5M5Y B;  2KHJ A;  1HHV A;  2R7Z H;  2E74 C;  4DV2 L;  1K3R A;  3H91 A;  4LF4 Q;  5I9O A;  3SK5 A;  3P75 A;  2IJ0 A;  4KK7 A;  1JJC B;  3QO2 A;  3BJU A;  4OL7 A;  1SND A;  2NVX B;  1DOL A;  2B2W A;  2RSN A;  3T13 A;  5M3M H;  2KCM A;  3BZC A;  1E1O A;  2DY8 A;  3KJP A;  1KD1 C;  1CM9 A;  2ZJQ A;  2AKW B;  4QIW E;  2IW3 A;  1A3U A;  1CT1 D;  5EBD A;  3HOY B;  3M3Y H;  4GLX A;  3QIA A;  4ZUJ A;  3GTJ H;  1MKH A;  4P73 A;  1N32 Q;  3G48 A;  4LMQ D;  1GOZ A;  5IYC H;  4ABN A;  4NDX A;  4K2L A;  1SE3 A;  3UDG A;  2ALY B;  4A3D B;  1B70 B;  1E22 A;  1PYS B;  1NTG A;  2L55 A;  3GTQ B;  3ERO A;  4JI0 Q;  4DR1 Q;  2IWH A;  1F9Q A;  1E2V A;  3R3O A;  3HP3 A;  4DV1 Q;  4LF7 Q;  1D1K A;  3V2T A;  5ELD A;  4DR7 Q;  4HIO A;  2K50 A;  2FJ2 A;  1F9P A;  1I4X A;  4IUV A;  5C4X G;  4MTN A;  1RCV D;  5E7N A;  5FO9 B;  4IUT A;  1PH6 A;  4OO1 G;  1BUV T;  3UE0 A;  3AU7 A;  3IKJ A;  1UWV A;  4DAV A;  1EQR A;  4MHE A;  2SOB A;  3OTO L;  3A7L A;  4JOI A;  5BR8 L;  1GVP A;  1CSQ A;  1SBB B;  4DR5 Q;  1M8A A;  1H9J A;  1SLJ A;  2JXM B;  3MXN B;  4IFD J;  3I8Z A;  3NBI A;  5TSS A;  1SYE A;  4IUN A;  3HG9 A;  5K36 G;  3C1F A;  1SYD A;  4CKB A;  3T16 A;  3G6E A;  4K8I A;  2HQE A;  4RAU C;  4EX5 A;  5JVG 3;  4JI8 L;  1Q12 A;  1AP0 A;  3J7A V;  1JMC A;  2X6G A;  4POF A;  1JE4 A;  4JCV E;  4OO1 H;  4JI4 L;  4JI1 L;  4BY7 B;  3E9I A;  1N9W A;  3CD6 A;  1SDF A;  4UY8 C;  1A62 A;  3TRE A;  1H9M A;  2J7Z A;  1JWM D;  2C9O A;  2PMZ B;  5EKL A;  3K5M A;  1X3P A;  5GAH C;  1B50 A;  2QCP X;  1BDO A;  3D6C A;  4NP5 A;  3P7J A;  4IFD I;  3PUW A;  4FXG C;  3SVM A;  1IKL A;  5LMU Q;  1CK1 A;  1YI2 A;  1TWG B;  1K28 A;  4CJ0 B;  1VQB A;  4DXG A;  4DUY Q;  2Z6K C;  1Z47 A;  4K6D A;  2NVT H;  5F2D A;  1JOO A;  2WB1 B;  1TWF B;  3PIO A;  4EQN A;  2EJF C;  1LTI D;  4ZKC B;  4LK1 C;  3DM3 A;  3S15 H;  1MHW C;  1TWC H;  2N49 A;  4GNX C;  2UU9 L;  1V9P A;  5K36 H;  1UEB A;  1WTP A;  5IGF A;  4A3J G;  1JOQ A;  3A54 A;  3CCR A;  4C2M H;  1T5E A;  2VY3 A;  5JOB A;  5IE8 A;  1WVL A;  2DNC A;  1PYW D;  3R93 A;  4GLV B;  3QOL A;  3GV6 A;  1H9S A;  1WTR A;  3S2H H;  2CVR A;  1X32 A;  4NXN L;  4DKA C;  3WOF A;  2EXD A;  2B3G A;  3HOZ G;  1BBX C;  4JI2 Q;  3N6R A;  1NJI C;  3GQB A;  5C4J B;  1C48 A;  3CQZ B;  5D14 A;  3FPP A;  5C44 G;  4P72 A;  3E0E A;  4CHT B;  4MZ9 A;  3J81 i;  3GTK B;  2NBF A;  2LFN A;  1VQO A;  4C3J G;  4FNF A;  4DAP A;  3GTP B;  3FP9 A;  5HGQ A;  5M5W H;  4AQY Q;  1RTO A;  1Z9F A;  1Q7Y C;  1STY A;  2EYF A;  4X3U A;  3M4P A;  2K33 A;  4KN7 C;  5DAU A;  3DHQ A;  3SK8 A;  2RKS A;  1WTH A;  2I5L X;  3HOY G;  2D62 A;  1U4M A;  3QJY A;  1YHB A;  4A3K B;  2O5J C;  2SEB D;  1MD2 D;  1KL9 A;  4POG A;  3AYH B;  3E6Z X;  1XMQ Q;  4HJ9 A;  2AUJ D;  4LAA A;  2YU9 B;  2YV5 A;  4JW0 A;  2QDL A;  4LUZ A;  4CDD C;  4A3D G;  1RTN A;  1EYD A;  2PCF B;  4X66 L;  1Y69 U;  4DV7 Q;  2K01 A;  3G71 A;  3BG3 A;  2EDG A;  4OEL B;  3KBG A;  3MXP A;  4O2D A;  1FR3 A;  4DR2 L;  3C46 A;  1DD2 A;  1B8A A;  1BF4 A;  2JA9 A;  3JAM L;  1TKW B;  4B08 A;  3ULJ A;  4A3L H;  2B2V C;  4YHH Q;  3A56 A;  2UUA L;  2CKZ B;  4JC0 A;  1BBU A;  3Q8D A;  2NB0 A;  2KQ3 A;  2R7D A;  4TRD A;  1O7Y A;  1GUO A;  3P20 A;  3M7G A;  4UP8 A;  4QY7 A;  2AQ1 B;  3HOW B;  1HNW L;  1Q90 A;  3ITP A;  3UI2 A;  1PVO A;  1IKM A;  4LF4 L;  1SNM A;  2VB3 X;  1X3Q A;  2ZXO A;  1JJG A;  4LJZ C;  5FOB B;  1JOR A;  1P16 A;  4TKO B;  3DEP A;  1H95 A;  1C0A A;  3GTQ H;  2JA8 B;  2RA4 A;  2EZV A;  1CQF A;  2K7V A;  1XNR Q;  1DOK A;  4G57 A;  1N32 L;  3J7Z C;  2PQE A;  3K0Y A;  1N36 L;  4BBR H;  1LUZ A;  3RN2 A;  3Q24 A;  3AFQ A;  1GO3 E;  2E2D C;  4LUO A;  3RLN A;  3W2D A;  2PO4 A;  5BN4 A;  3PF5 A;  4Y7N B;  5GAG C;  1VQN A;  3MZ5 A;  1CUK A;  5E3F A;  2EY6 A;  2PMZ E;  3BS1 A;  1NSN S;  1NY4 A;  2JP1 A;  2P5Z X;  4JI0 L;  5A35 A;  1U4R A;  2HHH Q;  4QMG A;  1K73 C;  3K80 C;  1HRJ A;  4DV1 L;  1IBM L;  4GKJ Q;  4KHZ A;  1A6X A;  4LF7 L;  2F03 A;  1WTX A;  4DR7 L;  4PG3 A;  4HIK A;  2WB1 E;  1XPR A;  3OWF A;  1EWI A;  3KF8 A;  1IBK Q;  4IO9 A;  1L0X B;  2WB1 G;  2E5L Q;  1K0S A;  2EJM A;  1A15 A;  1V43 A;  3TBI B;  1TS5 A;  4B3S Q;  3V05 A;  1A2T A;  1SNC A;  1IYJ B;  3I56 A;  4NW2 A;  1X3G A;  4DR5 L;  3HEJ A;  1PH5 A;  4AIM A;  3VR3 A;  5G3L F;  1EUJ A;  2WII B;  1U0L A;  3G4S A;  2KBN A;  2PPB C;  3LNN A;  1DM0 B;  3QB3 A;  3MFY A;  1LYL A;  3Q0A A;  3T1H Q;  1XMO L;  2G9D A;  1I3Q B;  2KCN A;  4MN3 A;  1EWC A;  5FJ8 H;  1U5K A;  1LTT D;  3TP8 A;  1XPO A;  1SEB D;  4L5Q A;  1STA A;  3CMA A;  3GTM H;  2I0Q A;  1BNZ A;  1WJJ A;  3S16 H;  2Q8I B;  1X3E A;  1YEZ A;  2F0K A;  4P75 A;  2WIN B;  4I7Z C;  3MEH A;  2EOT A;  3BZK A;  4HED A;  4E6I A;  4PV1 C;  3GTO H;  3K81 C;  2VUM H;  2Z0S A;  1X3F A;  1R4P B;  3JAM c;  2NTT A;  1WTQ A;  4JI6 L;  1BCP B;  2BCO A;  3F8T A;  4LF5 L;  5LMU L;  1KAW A;  2HDL A;  3KF6 A;  4DUY L;  4CDF C;  4ZQ3 A;  4KTA A;  1RJT A;  2MNA A;  1H9S B;  4JYA Q;  2I5M X;  1VQE A;  1EQV A;  3CXC A;  1VQP A;  4FYD A;  5G3L D;  4BA1 I;  1G2T A;  3T1Y Q;  5ELB A;  2F0H A;  1Z6H A;  3OSO A;  4A3K G;  4QUC A;  3HOU H;  4DNR B;  4P74 A;  3NXW A;  1EZ6 A;  3KBX A;  2EYP A;  1ZXT A;  1JB3 A;  2JA7 B;  4XQN A;  2E2J B;  3DWP A;  2KEC A;  1QZH A;  3NTK A;  3K0X A;  3PV0 A;  2E2I H;  1TWH H;  5M5X B;  1NNX A;  4EQP A;  2R93 H;  3UDI A;  1EY5 A;  1FNV A;  2IHF A;  4K6L A;  5EJW A;  3E9H A;  4JK1 C;  2AQ3 B;  1JR0 D;  2A6E C;  4FF2 A;  3GTP H;  4HJ7 A;  2B63 H;  4A93 H;  4L63 B;  3RMH A;  3F2D A;  1EIY B;  2F0W A;  2XWJ B;  1K8A C;  3S17 B;  3FKI H;  3H3V I;  1PZI D;  4DK1 A;  3VYT A;  2KOL A;  4IFD G;  2LY7 A;  1S5D D;  5ELO A;  3HOV H;  1A3V A;  3VR6 A;  1YZ6 A;  2NYZ D;  3CME A;  3HOW G;  4RFB A;  4KN4 C;  5IY0 A;  3U9S A;  4AQY L;  4OWW B;  1YBY A;  1I50 B;  2K6A A;  3D4D A;  3CPW A;  3RLO A;  2EYJ A;  1M90 C;  1RHP A;  4JI8 Q;  4ZLT F;  3E0J A;  1TS3 A;  3KDF A;  5LHY 1;  3L7Z C;  1MGS A;  3J7A 5;  1SYC A;  5C0X J;  5IGG A;  1HQR D;  1Y8P B;  4C3H H;  1K8G A;  4OON A;  2JA8 G;  5C5L A;  3JAM E;  1PYB A;  2CHB D;  3NEL A;  1F2L A;  4X65 Q;  2HDM A;  5EKI A;  4JPB W;  1XMQ L;  2DY7 A;  2NZ1 D;  5T1G A;  2F4V Q;  1VQ7 A;  2VQE L;  2F0T A;  4IFD H;  2ES2 A;  1RL2 A;  5JPM C;  2A6E D;  1LLR D;  1L2F A;  1HR0 W;  2GVA A;  2UU9 Q;  3NPP A;  3STB C;  4F88 A;  4OIK A;  5CV8 A;  5IYD G;  2L1B A;  4DFA A;  1C8C A;  1JC7 A;  4RGT A;  5C0X I;  2ZJP A;  4YHH L;  1XX8 A;  5KND A;  3K5O A;  3W1B A;  3CCE A;  3TN2 A;  1B4O A;  1SNQ A;  4KD3 A;  3CCL A;  4BS9 A;  3WDN A;  4QCL A;  3VA5 A;  2LMC B;  1EIF A;  3D31 A;  4A3B H;  3ERQ A;  1I4P A;  1AZQ A;  5FK9 C;  2C5C A;  3P1H A;  4UAI A;  3EN2 A;  4QJF A;  4K14 A;  5FLX L;  3PO2 H;  4C3I H;  3AEV A;  4OX9 Q;  5I2Y A;  2ENB A;  3SGI A;  5IP7 G;  2CQA A;  4K8J A;  2E8G A;  2WKD A;  3S9W A;  4XQQ A;  2DGY A;  2F0P A;  1SYB A;  4B9X A;  1Q3L A;  3A7A B;  4XT3 B;  1TR5 A;  3SR1 A;  1Y1W B;  1XNR L;  3VR4 A;  3S14 B;  3RZO B;  5IGD A;  4XYO A;  2PW5 A;  3VDY A;  1JT8 A;  4H13 C;  1PH3 A;  2B2W C;  1XNQ Q;  2XVS A;  2K5D A;  3KF8 B;  4JV5 Q;  4A3F H;  5CV4 A;  5C3E B;  3BVZ A;  2EE1 A;  1PRT C;  2EY1 A;  1K83 B;  2EVB A;  4XIG S;  4P71 A;  3SE0 A;  4Y52 H;  4TQU S;  4LFC Q;  2EXZ A;  3EFX D;  1NR4 A;  3STB D;  2HHH L;  3PO3 B;  5COR A;  4RGM A;  3AMU A;  3KLW A;  4MNO A;  4GKJ L;  2L15 A;  3M4O H;  5C6A A;  3A0J A;  1HQM C;  4LW1 A;  2ZT9 C;  3TSS A;  1PRT F;  1HTL D;  4R4O A;  1TT2 A;  4ULL A;  1IBK L;  2B2Y A;  4BY1 B;  4KKS A;  1WYD A;  1C4Q A;  4A3C G;  3L3O C;  1Q8I A;  5IP7 H;  2F0E A;  4WJ4 A;  5IOC A;  5FKA C;  3M4Y A;  4LF6 Q;  4K5X A;  4RWS C;  1QJO A;  4EQ5 A;  3H6M A;  2JA7 G;  3TP6 A;  1OTC A;  2WAQ B;  4OXP A;  1X6O A;  1YNX A;  3DEO A;  2A68 D;  1VS0 A;  1GUN A;  1KRS A;  3L9A X;  5IGB A;  3U4Z A;  5FO8 B;  5CGK A;  4RCO A;  3HKZ E;  4KMU C;  1HNW Q;  1KAB A;  1DJR D;  4LUV A;  4C1N I;  4V19 0;  4JOI C;  2PZU A;  2XGT A;  1SNO A;  3HKZ G;  1D2B A;  3PMF A;  1QUQ A;  5LL6 S;  1ICW A;  1ET9 A;  1B3Q A;  1SRU A;  3KF6 B;  3ND8 A;  4FF3 A;  1PRT D;  3D4W A;  3I4M B;  2PW7 A;  4RHS A;  4JG2 A;  2OCE A;  2ZM6 Q;  2K75 A;  4A3C H;  4C1N K;  2JQO A;  2IL8 A;  2Z6B A;  1EU4 A;  1A2U A;  2RCN A;  1LTA D;  3S24 A;  3J80 L;  3BU2 A;  1N36 Q;  2XRQ D;  1WCM B;  3D4R A;  1DGS A;  3CC4 A;  5LMN Q;  5KNC A;  4YIJ A;  1WTV A;  2JN4 A;  3VYS A;  2K4K A;  3FHW A;  5M5X H;  4JYA L;  3S1Q B;  1L1O C;  3T1Y L;  3NBH A;  1KAA A;  1Q46 A;  2FXQ A;  1EL0 A;  1ILQ A;  1K8M A;  1B3A A;  1IBM Q;  2WAC A;  5IP9 G;  4PNY A;  2PZT A;  5DLQ E;  2JE6 I;  2MHV A;  5FLX c;  3S1N B;  2RF4 A;  1YJN A;  1EY8 A;  3GD7 A;  2Y0S E;  1SXT A;  4A4I A;  1EYG A;  1ASY A;  4A3M G;  1PMR A;  3A5U A;  2Y0S G;  2KHS A;  1EOV A;  2M00 A;  5D3I B;  5EPL A;  4WFN 3;  1BCP C;  2EYL A;  2ID0 A;  4J1M A;  4TSS A;  1B53 A;  2MQH A;  2A69 C;  3KDF B;  2LKV A;  2D0P A;  1LTL A;  5IOD A;  5AFW A;  2K03 A;  1KDA A;  4YCU A;  4JI7 Q;  4R1J A;  1RD9 D;  5BN5 A;  1XMO Q;  1F2M A;  2WFW A;  1UE1 A;  2K32 A;  4GKK Q;  3SEB A;  3TME A;  3MVV A;  1VQD A;  2F0Q A;  3C3L A;  2L4N A;  3GV3 A;  3EVQ A;  4DAM A;  3KK7 A;  4KY7 A;  2HCI A;  3DUZ A;  1M1K C;  4OEM B;  4DN4 M;  4U68 A;  1KDC A;  5C4X H;  3D6W A;  2I46 A;  1S5F D;  1C9O A;  2CWP A;  1SJH D;  2DJF C;  3JC6 6;  4OWX B;  4RHR A;  1JE5 A;  3IFT A;  4CKE A;  1MI2 A;  2IY5 B;  4IPH A;  2NUC A;  1LT4 D;  4DAY A;  4ID6 A;  1Y1W G;  4X65 L;  4A3M H;  2L5T A;  1PH9 A;  3I4N B;  5M3F B;  2ATW A;  1YHQ A;  4JI6 Q;  2ICE C;  1YJ9 A;  3L0O A;  4LF5 Q;  2AWN A;  4ZCK A;  5D65 A;  2NVQ H;  1Q1B A;  2QKI C;  4DUZ Q;  5E4W C;  3ONA B;  2F4V L;  3JAM i;  5C3E G;  1AN8 A;  3PO3 G;  4L8J A;  1ESF A;  1CHP D;  3A55 A;  1ICF B;  1BCP D;  4DV4 Q;  2A69 D;  3ZJY C;  1MJC A;  2VL6 A;  1I6H H;  4IJH A;  1XXG A;  2F0D A;  4L5T A;  4X3K A;  4BY1 G;  3NTH A;  4AH6 A;  3OHX C;  3CP0 A;  4LF8 L;  1TII D;  3J7A F;  1D1I A;  3D8G A;  3OW7 A;  1GD7 A;  1SE4 A;  5C3X A;  5CYU A;  2F52 A;  1HZA A;  1ZEQ X;  2F0S A;  3RZD H;  1QNK A;  2WAQ E;  3J80 c;  4CJ1 B;  3U58 A;  2WAQ G;  1WTO A;  5I2X A;  1HA6 A;  2Q2U A;  5GQO A;  4GS3 A;  1Y1V B;  1KNE A;  1VQK A;  2ZJR A;  4OX9 L;  1PTO B;  1VQF A;  1R9T B;  1T5X D;  1EEF D;  1E7Z A;  2NN6 I;  1YJW A;  3KYH C;  3ULP A;  4YWM A;  3PO3 H;  5T1I A;  1QE6 A;  4Z9C B;  4OHJ A;  4PZ7 A;  1YIT A;  1O7I A;  4A3J H;  1XNQ L;  1B44 D;  5H1S E;  1KDB A;  3ZYY X;  1FGU A;  4JV5 L;  1L0Y B;  1K8O A;  4KI0 A;  1KRT A;  5C0X G;  3FVQ A;  3K57 A;  3I4M G;  2EQS A;  1HZB A;  2R92 B;  2JA6 B;  3GTL B;  4LFC L;  5GAD C;  3HOZ H;  1X55 A;  4S3S A;  1KQS A;  1VQM A;  4RGN A;  5I6W A;  4L5R C;  2RDG A;  3S1R B;  1EZ8 A;  5C44 H;  3M9B A;  2D2C C;  3PGZ A;  1G6P A;  3F2C A;  3S2D H;  1RF2 D;  4J6H A;  2VQE Q;  1G6Z A;  2JYO A;  2L0C A;  4X6A H;  3EA6 A;  4C3J H;  2RCF A;  1JIC A;  5M5Y H;  3NK9 A;  3J7Y W;  1FNW A;  4GNX A;  4LF6 L;  1QUQ B;  2A1A A;  2JK8 A;  1F2Z A;  4KJN A;  4MIU A;  2HQL A;  1FGB D;  2Q2H A;  2NVX H;  2BH2 A;  3OIQ A;  2R3Z A;  3H3V C;  1PV4 A;  3TQY A;  4LFB Q;  4DK0 A;  3GTG B;  3HOY H;  4R4I A;  1EYA A;  2EPB A;  1SFO B;  5AJ3 Q;  3NEN A;  4IQZ A;  2CW0 D;  5L37 A;  4ODG A;  1II3 A;  3CW2 C;  1JCK B;  5COY A;  2E2H B;  5I9P A;  3KLS X;  3CRL C;  4A3D H;  1UE6 A;  4UPA A;  1N34 Q;  3O13 A;  5GAE C;  2JA5 B;  3R2I A;  3C1E A;  2RVL A;  1VQG A;  5FO7 B;  3NBH B;  2ZM6 L;  4QUF A;  3EQL C;  4PMC A;  5C3W A;  4APV A;  3RD4 A;  4DV5 L;  1BOS A;  4L5S A;  1KLU D;  3I55 A;  1I5F A;  3QR8 A;  1EOT A;  5LMN L;  1TWA B;  3S1N H;  2JEA I;  1LAB A;  1TQO A;  2JEB I;  1D7Q A;  4XDX A;  4BY7 G;  3KLS A;  3AB9 A;  3I4N G;  1RIP A;  3BYT B;  5M3F G;  2F3I A;  4M8A A;  3G7L A;  4N9P A;  4X3T A;  3KLR A;  1LAC A;  1AEX A;  2QEX A;  1K9M C;  1VQ4 A;  1VDZ A;  1LT3 D;  3TRZ A;  1UNS A;  3LX0 A;  4IZ8 A;  4HMJ A;  4QQB X;  1NUC A;  1EIH A;  4K0K Q;  5CBA E;  4Q5V A;  1HUM A;  3M4Q A;  3H94 A;  5HUR A;  1B9N A;  1LTG D;  1SSO A;  1N8R C;  1PXU A;  4JI7 L;  1CZG A;  3T56 B;  2KED A;  2MO1 A;  1H9K A;  4BY7 H;  1VQ9 A;  1O7Z A;  4DAY B;  1Q81 C;  4XYQ A;  2HIV A;  4GKK L;  3I4N H;  3T4A C;  3MAQ A;  3MXG A;  3S1M B;  2EY2 A;  2UUB Q;  1Y1V G;  1TWG H;  4RH6 A;  1EIG A;  1ESR A;  2KCT A;  4OGQ C;  4A3I B;  1EYC A;  2TSS A;  1TWF H;  2BH8 A;  2OTJ A;  4LNQ A;  2F0L A;  1W3S A;  1V1Q A;  3H0G B;  2A73 B;  1DON A;  1A0I A;  1TXY A;  2EYH A;  4DUZ L;  1EFI D;  2UXD Q;  1C7Y A;  3CCV A;  3PUX A;  3A74 A;  4GZY C;  5EQ0 A;  4UHV A;  3U4V A;  1HNZ Q;  2R92 G;  2JA6 G;  3NTI A;  1KLG D;  2UUC L;  2R7Z B;  5EAY A;  4B9W A;  4XT1 B;  5BN3 A;  2UXC Q;  5C4J H;  3CQZ H;  5M3M B;  4DV4 L;  4ZAI A;  2SNM A;  4DV3 L;  3I4O A;  1PDQ A;  3F1Z A;  3GTK H;  2M9V A;  2MP1 A;  5EPK A;  1G29 1;  1I4H A;  2HCC A;  3CC2 A;  3M3Y B;  3X3N A;  3GTJ B;  4H7B A;  1DOM A;  1VCI A;  1AH9 A;  1QZG A;  1HNX L;  1UEA B;  2BDN A;  2TMP A;  1IW7 C;  1TS2 A;  3NWS A;  4KHP L;  3WOE A;  3Q22 A;  1OXU A;  4GN5 A;  4H44 C;  3ND9 A;  1PH4 A;  5JEA J;  3K5L A;  2B8F A;  1GUW A;  3EIV A;  2F0F A;  5CV6 A;  1D5M C;  4A3K H;  2L11 A;  2EY5 A;  1VQ5 A;  4F87 A;  5J3B A;  4JVZ A;  2OT2 A;  2YU9 H;  4LF9 Q;  2XIW A;  4EQO A;  2F3V A;  2B2T C;  4YCW A;  1UUP A;  2K5Q A;  3LWU A;  2DJG C;  1EWH A;  1GXD C;  2JA5 G;  4J15 A;  1TY0 A;  3R2T A;  1SNP A;  3IAY A;  2AMC B;  1YNN C;  3D3R A;  4HMI A;  5CV9 A;  1YNJ C;  3RNU A;  4QGU A;  1VQA A;  2ZXR A;  2RHS B;  1EY9 A;  1D6E C;  4GNX B;  1HA5 A;  4ZK9 B;  1X54 A;  3DXJ C;  1DYQ A;  3CCJ A;  1DZ1 A;  2V1C C;  2ICI A;  2F0U A;  2EIF A;  1NAP A;  1PH7 A;  2FIN B;  4KLK A;  2QF7 A;  2PZW A;  1A63 A;  3M7N A;  1RDP D;  2KEE A;  2BA1 A;  5EPJ A;  4NXM Q;  1PH8 A;  3HOW H;  1PZJ D;  3MWY W;  1L0W A;  1FYC A;  2LSS A;  4UDU C;  2NN6 G;  2NWG A;  3MHB A;  3PIP 3;  3I3C A;  1IW7 D;  2D9U A;  2XNA C;  1KHI A;  2QEJ C;  2PI2 A;  1W2B A;  3W3A A;  2YTX A;  4GN3 B;  4HTH A;  4LF8 Q;  3LGJ A;  1HCZ A;  4ILW A;  4LFB L;  2B2U A;  2JA8 H;  2GVB A;  1V1O A;  2WP8 J;  3K8A A;  3OYY A;  1XWE A;  5AJ3 L;  4BA2 I;  4QF4 A;  2SNS A;  2KJX A;  1CKN A;  1KIX A;  2OQK A;  2D0O A;  5JJL A;  2C35 B;  2NVT B;  2A68 C;  1BXT A;  5HY6 A;  1B7Y B;  4Y7N H;  1N34 L;  3Q6S A;  4K5V A;  2IX0 A;  1WD1 A;  1YNN D;  3S15 B;  1YNJ D;  5KGU A;  4RKL A;  1TWC B;  1STH A;  3TZU A;  5I6Y A;  1PFS A;  3GDE A;  2CCZ A;  1OXT A;  1G2S A;  1JWU D;  1IZ6 A;  1HJP A;  5IYD H;  3NP8 A;  1SMY C;  4B3R Q;  2JSO A;  1KXL A;  1U4L A;  4X62 Q;  1GHJ A;  1EFW A;  3IRB A;  3A8K E;  5IWA Q;  4A3I G;  3S2H B;  1J9O A;  2XN9 C;  4AYB B;  2YTY A;  3D0F A;  1VF5 C;  3R8B A;  5JJZ A;  3I91 A;  3TP5 A;  1SYF A;  3OMG A;  1QG7 A;  2A6H D;  4GOP A;  3AFP A;  4BBS B;  3QG1 A;  3H0G G;  1ILP A;  3CU7 A;  3VA7 A;  1CHQ D;  2E75 C;  1IL2 A;  4LFA Q;  2K5H A;  1SMX A;  2HUG A;  2QW7 A;  4IPC A;  3IL8 A;  3N52 A;  2DUD A;  3I90 A;  3OOC A;  5M5W B;  2R7Z G;  3H15 A;  1IL8 A;  1H9R A;  1I3Q H;  2CWA A;  4X3S A;  5IGE A;  5M3M G;  4I7A A;  2CH4 W;  5C4Z A;  2AUK A;  2YTV A;  4K0K L;  3K59 A;  4FF4 A;  3PF4 A;  5EKK A;  4HSP A;  1O80 A;  4A3I H;  4DK3 C;  4DR3 L;  4JBW A;  1PH1 A;  4I65 A;  2B8G A;  2A74 C;  2FFK B;  2XRS D;  3PQI A;  1F2Y A;  1SMY D;  1J8I A;  1MSH A;  1OXX K;  1DXM A;  5K5P A;  4B3T L;  4A3E B;  2F3W A;  2Z4H A;  3TP7 A;  2UUB L;  3OWE B;  4PZ6 A;  4XQJ A;  2ZTC A;  1OO9 B;  2LXJ A;  4RCN A;  3L2P A;  2BDO A;  1LTB D;  4RA8 A;  2Q2T A;  4UP9 A;  1QCB D;  4F8M A;  4DV5 Q;  3I70 A;  1D8L A;  4R4T A;  4NMZ A;  4HSV A;  2JA7 H;  3T51 B;  3KJO A;  2E2J H;  4CJ2 C;  3PUV A;  1HFG A;  4B3M Q;  2UXD L;  4JI3 Q;  4FO2 A;  1Z7T A;  4UP7 A;  1HNZ L;  1PFM A;  4IOA A;  5JJK A;  3BZD B;  1HZC A;  1AW7 A;  2FHT A;  4IPD A;  4PZ8 A;  2MFI A;  2IX3 A;  3HKS A;  2UXC L; 
#chains in the Genus database with same CATH homology
 2F4I A;  1VF7 A;  1DCZ A;  4CBV A;  1B2T A;  3OIP A;  1ZYR C;  3LWE A;  4KHV A;  1ONL A;  4KV6 A;  5KRU A;  5ELE A;  1LO5 D;  2RBM A;  4BBR B;  1W6J A;  2BE5 D;  1ENA A;  2Z8L A;  4O42 A;  4G7O C;  1G8Z D;  1BR9 A;  5J1Z A;  1ML0 D;  5A2Q L;  2PNR C;  1IYV A;  1BCP F;  1VMP A;  3A8I E;  4DXF A;  1GJX A;  1TVX A;  1GUT A;  4IUR A;  3PUZ A;  3MFG A;  4G7H C;  1IHZ A;  3VR5 A;  4WRD A;  2DN8 A;  5CMD A;  1EEI D;  1QWY A;  1CTM A;  5ISR A;  3I4L A;  1SYG A;  4ZUI A;  2O2L D;  3BYY B;  1JOK A;  5M9O A;  1ZYR D;  4KY5 A;  1I4Q A;  1KNA A;  1PFN A;  1G91 A;  1NCV A;  5FLX E;  3HRZ C;  5HGT A;  3GTM B;  2XSC A;  1TY2 A;  5JAV A;  1TS4 A;  3S16 B;  3MA2 B;  4WJW A;  4EGV A;  4HCS A;  1S5C D;  3GTO B;  1S4Z A;  2QDB A;  2VUM B;  1PFB A;  5ELC A;  3HZX A;  4FVM A;  1HFN A;  3GP7 A;  4V0B A;  3CKI B;  2BOS A;  2EYM A;  4H0L C;  4R8I A;  5CBE E;  5I4D A;  2BA0 A;  3IFD A;  5JEA G;  2VB2 X;  2N55 A;  3HOU B;  3HOX B;  5C4H A;  1CZW A;  2CW0 C;  4XXE A;  5CV5 A;  3FDT A;  2IT1 A;  3SK4 A;  3SHL A;  2E2I B;  1TWH B;  4PMW A;  3QOJ A;  2H1E A;  1R4Q B;  2O4X A;  2R93 B;  2IPK D;  3TZD A;  4HR7 B;  1WD0 A;  1O7L A;  1V1P A;  3NSW A;  2B63 B;  1PZK D;  4A93 B;  3T53 B;  5KEE A;  4R8N A;  3FKI B;  5DNF A;  2J0T D;  3M85 A;  4RKB A;  4P2C B;  3K58 A;  3NQT A;  3HOV B;  4FXK C;  1Y8N B;  1XYI A;  5ELF A;  4IUP A;  5JEA H;  3DM1 A;  2V4D A;  1BO0 A;  1Q1E A;  1CI3 M;  1XTC D;  3I72 A;  3NWT A;  2OF1 A;  1QB5 D;  3URY A;  5C0X H;  4C3H B;  1F9S A;  4RGO S;  3J80 E;  2IX1 A;  2WV6 D;  5D3D A;  2F0O A;  3I73 A;  1BQQ T;  1STN A;  4HAE A;  1ET6 A;  3HGB A;  1UAP A;  3FRP B;  2N88 A;  1AZP A;  1SJE D;  4IUU A;  4Q0F A;  5KNB A;  1PRT B;  4IUQ A;  4DU9 A;  2F0I A;  4ZKB B;  1OXV A;  1B1Z A;  2M2L A;  2MJ8 A;  1EQT A;  1LTS D;  3K7A B;  3FPU B;  4A3G B;  4KY6 A;  4PQX A;  2KCC A;  5CV7 A;  3DWA A;  3OMC A;  5IT9 L;  3H09 A;  3SK6 A;  2F0G A;  1EY0 A;  5KYI A;  4ZRZ A;  1TU2 B;  3J81 L;  2H4O A;  4A3B B;  2RSO A;  1OXS C;  1IYU A;  5A2Q E;  1SAP A;  3PO2 B;  4C3I B;  1ROD A;  1ENF A;  3MXU A;  3U9O A;  2RDH A;  5EBC A;  3VYR A;  4FF1 A;  1M4V A;  2ZXP A;  3RLF A;  3V96 A;  3EJI A;  2B2V A;  3K5N A;  5E1F A;  2AQ2 B;  4A3F B;  1U4P A;  4O1N A;  4HN7 A;  2MUY A;  1HPC A;  2K5W A;  1HUN A;  1PLF A;  1ZKO A;  2FMM A;  3BDC A;  4ME5 A;  3M4O B;  4EVO A;  1W6K A;  2I07 B;  1WTW A;  4CKC A;  1QOH A;  4BWG B;  2L12 A;  2L9H A;  4FP5 D;  1JQY D;  2MGS A;  4DA2 A;  2RDF A;  5JPN C;  5DM6 3;  3KUP A;  2NTS A;  4G7Z C;  1GUS A;  2YYZ A;  2F0M A;  2NVY B;  5C5M A;  4OO1 I;  2K04 A;  2WKC A;  1MSG A;  1CQV A;  5DEH A;  3CRK C;  3MTS A;  1E2Z A;  5IIF A;  1VMC A;  1GHK A;  1AFP A;  2MPM A;  5KYL A;  3F2U A;  2Z1C A;  3E5S A;  1B9M A;  1EY6 A;  1LT6 D;  3K6O A;  3SDZ A;  1KTK A;  1MBY A;  2X6L A;  1E2W A;  1PTO H;  4M1U B;  2G9H D;  3DWQ A;  2QIL A;  2O5I C;  4KD4 A;  5KIX A;  3A8J E;  3NQI A;  2E76 C;  2B39 A;  1HXY D;  2F0J A;  1F77 A;  1QIL A;  4KKU A;  3PIO 3;  4C3H G;  2B2U C;  1EY7 A;  1E0B A;  1V1P B;  3VR2 A;  1V8Q A;  3X3M A;  1ENC A;  3BVM A;  3VYU A;  3HKZ B;  4KKT A;  2RQX A;  5LL6 X;  4U67 3;  4C56 C;  1I4R A;  2R61 A;  1LTR D;  4DNT B;  4L6T B;  4K5W A;  4OIJ A;  4G4K A;  1STG A;  4QIW B;  2F0V A;  3NUC A;  5NUC A;  1I6V C;  4PMB A;  4FXD A;  4XTC S;  2EJG C;  4IN3 A;  3TDQ A;  1PTO C;  3MXN A;  2D5D A;  5JVH 3;  3Q23 A;  1CA6 A;  1I4G A;  2DNE A;  2Q8T A;  3OPO A;  1PTO F;  2A6H C;  2Z4I A;  1STB A;  1QNU A;  4ZYS A;  4IAL A;  4C3I G;  2VXW A;  1RKN A;  5J22 A;  1NR2 A;  3NHH A;  2B2Y C;  3BDO A;  4DF7 A;  5C4X B;  1Y8O B;  1O78 A;  1CFM A;  2J4X A;  5IGC A;  3C2P A;  4A3M B;  3PUY A;  4CGY B;  2Y0S B;  2K1B A;  3BVG A;  5J39 A;  1F9R A;  5IT9 E;  2NVQ B;  1GUG A;  2F1M A;  1EU3 A;  3FEW X;  1S5E D;  5CC4 A;  3J81 E;  3GO5 A;  2KUM A;  2R6G A;  2XWB B;  4HCE A;  2NN6 H;  1I6H B;  4C2M B;  3G6J B;  1FNU A;  2K05 A;  5E4X A;  1SE2 A;  1PTO D;  1S5B D;  3RUZ A;  3DMU A;  2OEO A;  2B2T A;  3BDL A;  2X69 A;  3CHB D;  2KA7 A;  3RZD B;  1HTP A;  3NE5 B;  4F7X A;  5EGT A;  1U9R A;  2OXP A;  2FMC A;  2SDF A;  2Q8R E;  1D5X C;  2K28 A;  2PYK A;  1A3T A;  3FMC A;  4J8Q A;  5CR3 A;  4A3J B;  1D5Z C;  1CA5 A;  5DM7 3;  4K2K A;  4QB4 A;  2KVM A;  2A5H A;  3MC0 B;  4R9W A;  3SXH A;  4KJO A;  4DGZ A;  2AWO A;  2GA4 B;  3HOZ B;  2F0N A;  1JWS D;  4WOR A;  2EYO A;  1FD7 D;  3QWN A;  5C44 B;  2BE5 C;  2VNU D;  1LV9 A;  3S2D B;  1STE A;  2LS0 1;  1LT5 D;  4N9T A;  4NKL A;  3HS0 C;  4C3J B;  1EY4 A;  5M5Y B;  1HHV A;  2E74 C;  3H91 A;  5I9O A;  3SK5 A;  3P75 A;  2IJ0 A;  4KK7 A;  3QO2 A;  4OL7 A;  1SND A;  2NVX B;  1DOL A;  2B2W A;  2RSN A;  3T13 A;  2DY8 A;  1CM9 A;  2IW3 A;  1A3U A;  1CT1 D;  5EBD A;  3HOY B;  3QIA A;  4ZUJ A;  4LMQ D;  1GOZ A;  4ABN A;  4NDX A;  4K2L A;  1SE3 A;  4A3D B;  2L55 A;  3GTQ B;  3ERO A;  2IWH A;  1F9Q A;  1E2V A;  3R3O A;  3HP3 A;  1D1K A;  3V2T A;  5ELD A;  2FJ2 A;  1F9P A;  1I4X A;  4IUV A;  1RCV D;  5FO9 B;  4IUT A;  4OO1 G;  1BUV T;  3AU7 A;  3IKJ A;  4DAV A;  4MHE A;  2SOB A;  3A7L A;  1SBB B;  1M8A A;  1H9J A;  2JXM B;  4IFD J;  3I8Z A;  3NBI A;  5TSS A;  1SYE A;  4IUN A;  3HG9 A;  5K36 G;  3C1F A;  1SYD A;  4CKB A;  3T16 A;  4K8I A;  2HQE A;  4RAU C;  5JVG 3;  1Q12 A;  1AP0 A;  3J7A V;  2X6G A;  1JE4 A;  4OO1 H;  4BY7 B;  1SDF A;  3K5M A;  1JOR A;  1H9M A;  2J7Z A;  1JWM D;  2C9O A;  2PMZ B;  5EKL A;  1X3P A;  1B50 A;  2QCP X;  1BDO A;  3D6C A;  4NP5 A;  3P7J A;  4IFD I;  3PUW A;  4FXG C;  3SVM A;  1IKL A;  1CK1 A;  1TWG B;  4CJ0 B;  4DXG A;  4K6D A;  1Z47 A;  5F2D A;  1JOO A;  2WB1 B;  1TWF B;  4EQN A;  2EJF C;  1LTI D;  4ZKC B;  4LK1 C;  5K36 H;  1WTP A;  5IGF A;  1JOQ A;  3A54 A;  1T5E A;  5JOB A;  1WVL A;  2DNC A;  1PYW D;  3R93 A;  3GV6 A;  3QOL A;  1WTR A;  1H9S A;  2CVR A;  1X32 A;  3WOF A;  1BBX C;  3N6R A;  3GQB A;  5C4J B;  1C48 A;  3CQZ B;  5D14 A;  3FPP A;  4CHT B;  3GTK B;  2NBF A;  2LFN A;  4C3J G;  4FNF A;  4DAP A;  3GTP B;  1RTO A;  1STY A;  2EYF A;  4X3U A;  2K33 A;  4KN7 C;  5DAU A;  3DHQ A;  3SK8 A;  2RKS A;  2D62 A;  1U4M A;  3QJY A;  4A3K B;  2O5J C;  2SEB D;  1MD2 D;  3E6Z X;  2AUJ D;  4LAA A;  2YU9 B;  1RTN A;  1EYD A;  2PCF B;  1Y69 U;  2K01 A;  3BG3 A;  2EDG A;  3KBG A;  3MXP A;  1FR3 A;  3C46 A;  1DD2 A;  1BF4 A;  3JAM L;  1TKW B;  4B08 A;  2B2V C;  3A56 A;  2NB0 A;  2KQ3 A;  4TRD A;  1O7Y A;  1GUO A;  3P20 A;  3M7G A;  2AQ1 B;  3HOW B;  1Q90 A;  3ITP A;  3UI2 A;  1IKM A;  1SNM A;  2VB3 X;  1X3Q A;  2ZXO A;  4LJZ C;  5FOB B;  4TKO B;  3DEP A;  2JA8 B;  2RA4 A;  2EZV A;  1CQF A;  2K7V A;  1DOK A;  4G57 A;  2PQE A;  3K0Y A;  3Q24 A;  2E2D C;  3W2D A;  2PO4 A;  5BN4 A;  4Y7N B;  3MZ5 A;  5E3F A;  2EY6 A;  3BS1 A;  1NSN S;  2JP1 A;  5A35 A;  1U4R A;  4QMG A;  1HRJ A;  4KHZ A;  1A6X A;  2F03 A;  1WTX A;  3OWF A;  3KF8 A;  1L0X B;  2EJM A;  1A15 A;  1V43 A;  3TBI B;  1TS5 A;  3V05 A;  1A2T A;  1SNC A;  4NW2 A;  3HEJ A;  3VR3 A;  5G3L F;  2WII B;  2PPB C;  3LNN A;  1DM0 B;  3QB3 A;  3MFY A;  3Q0A A;  2G9D A;  1I3Q B;  2KCN A;  4MN3 A;  1EWC A;  1LTT D;  3TP8 A;  1SEB D;  1STA A;  1BNZ A;  2Q8I B;  2F0K A;  2WIN B;  4I7Z C;  3MEH A;  2EOT A;  4HED A;  4E6I A;  4PV1 C;  1R4P B;  2NTT A;  1WTQ A;  1BCP B;  2BCO A;  2HDL A;  4ZQ3 A;  4KTA A;  1RJT A;  1H9S B;  1EQV A;  4FYD A;  5G3L D;  4BA1 I;  1G2T A;  5ELB A;  2F0H A;  1Z6H A;  3OSO A;  4QUC A;  4DNR B;  3NXW A;  1EZ6 A;  3KBX A;  2EYP A;  1ZXT A;  1JB3 A;  2JA7 B;  4XQN A;  2E2J B;  3DWP A;  2KEC A;  3NTK A;  3PV0 A;  5M5X B;  4EQP A;  1EY5 A;  1FNV A;  4K6L A;  5EJW A;  4JK1 C;  2AQ3 B;  1JR0 D;  2A6E C;  4FF2 A;  4L63 B;  3RMH A;  2F0W A;  2XWJ B;  3S17 B;  1PZI D;  4DK1 A;  3VYT A;  2KOL A;  4IFD G;  2LY7 A;  1S5D D;  1A3V A;  3VR6 A;  2NYZ D;  4RFB A;  4KN4 C;  3U9S A;  1I50 B;  2K6A A;  3D4D A;  2EYJ A;  1RHP A;  4ZLT F;  3E0J A;  1TS3 A;  5LHY 1;  3L7Z C;  1MGS A;  1SYC A;  5C0X J;  5IGG A;  1HQR D;  1Y8P B;  5C5L A;  3JAM E;  2CHB D;  1F2L A;  2HDM A;  5EKI A;  2DY7 A;  2NZ1 D;  5T1G A;  2F0T A;  4IFD H;  5JPM C;  2A6E D;  1LLR D;  3NPP A;  4F88 A;  4OIK A;  5CV8 A;  2L1B A;  4DFA A;  1C8C A;  1JC7 A;  4RGT A;  5C0X I;  1XX8 A;  5KND A;  3K5O A;  3TN2 A;  1B4O A;  1SNQ A;  4KD3 A;  4BS9 A;  3WDN A;  4QCL A;  3VA5 A;  2LMC B;  3D31 A;  3ERQ A;  1I4P A;  1AZQ A;  5FK9 C;  2C5C A;  3P1H A;  4UAI A;  4K14 A;  5FLX L;  5I2Y A;  2ENB A;  2CQA A;  4K8J A;  2WKD A;  3S9W A;  4XQQ A;  2F0P A;  1SYB A;  4B9X A;  1Q3L A;  3A7A B;  4XT3 B;  1TR5 A;  3SR1 A;  1Y1W B;  3S14 B;  3VR4 A;  3RZO B;  5IGD A;  4XYO A;  2PW5 A;  4H13 C;  2B2W C;  2XVS A;  2K5D A;  5CV4 A;  5C3E B;  3BVZ A;  2EE1 A;  1PRT C;  2EY1 A;  1K83 B;  2EVB A;  4XIG S;  3SE0 A;  4TQU S;  2EXZ A;  3EFX D;  1NR4 A;  3PO3 B;  5COR A;  4RGM A;  3AMU A;  5C6A A;  1HQM C;  2ZT9 C;  3TSS A;  1PRT F;  1HTL D;  1TT2 A;  4ULL A;  2B2Y A;  4BY1 B;  4KKS A;  1C4Q A;  3L3O C;  1Q8I A;  2F0E A;  5IOC A;  5FKA C;  3M4Y A;  4K5X A;  4RWS C;  1QJO A;  3H6M A;  3TP6 A;  2WAQ B;  3DEO A;  2A68 D;  1GUN A;  3L9A X;  5IGB A;  5FO8 B;  5CGK A;  4RCO A;  4KMU C;  1KAB A;  1DJR D;  4C1N I;  4V19 0;  2PZU A;  1SNO A;  1D2B A;  3PMF A;  5LL6 S;  1ICW A;  1ET9 A;  3ND8 A;  4FF3 A;  1PRT D;  3D4W A;  3I4M B;  2PW7 A;  4RHS A;  4C1N K;  2IL8 A;  1EU4 A;  1A2U A;  1LTA D;  3J80 L;  2XRQ D;  1WCM B;  3D4R A;  5KNC A;  4YIJ A;  1WTV A;  3VYS A;  3S1Q B;  3NBH A;  1KAA A;  1EL0 A;  1ILQ A;  1K8M A;  1B3A A;  2WAC A;  4PNY A;  2PZT A;  2JE6 I;  2MHV A;  3S1N B;  1EY8 A;  3GD7 A;  1SXT A;  1PMR A;  2KHS A;  2M00 A;  5EPL A;  5D3I B;  4WFN 3;  1BCP C;  2EYL A;  2ID0 A;  4J1M A;  4TSS A;  1B53 A;  2A69 C;  2LKV A;  5IOD A;  5AFW A;  2K03 A;  1KDA A;  1RD9 D;  5BN5 A;  1F2M A;  2K32 A;  3SEB A;  3TME A;  3MVV A;  2F0Q A;  3C3L A;  2L4N A;  3GV3 A;  3EVQ A;  3KK7 A;  4KY7 A;  2HCI A;  3DUZ A;  4DN4 M;  4U68 A;  1KDC A;  3D6W A;  2I46 A;  1S5F D;  1SJH D;  4RHR A;  3IFT A;  4CKE A;  1MI2 A;  2NUC A;  1LT4 D;  4DAY A;  4ID6 A;  3I4N B;  2L5T A;  5M3F B;  2ICE C;  2AWN A;  5D65 A;  1Q1B A;  2QKI C;  5E4W C;  3ONA B;  1AN8 A;  4L8J A;  1ESF A;  1CHP D;  3A55 A;  1BCP D;  2A69 D;  1XXG A;  2F0D A;  4X3K A;  3NTH A;  3OHX C;  3J7A F;  1TII D;  1D1I A;  3D8G A;  3OW7 A;  1SE4 A;  5C3X A;  5CYU A;  1ZEQ X;  2F0S A;  1QNK A;  4CJ1 B;  1WTO A;  5I2X A;  1HA6 A;  1Y1V B;  1KNE A;  1PTO B;  1R9T B;  1T5X D;  1EEF D;  2NN6 I;  5T1I A;  1QE6 A;  4Z9C B;  4OHJ A;  1B44 D;  1KDB A;  3ZYY X;  1L0Y B;  1K8O A;  4KI0 A;  5C0X G;  3FVQ A;  3K57 A;  2R92 B;  2JA6 B;  3GTL B;  4S3S A;  4RGN A;  5I6W A;  2RDG A;  3S1R B;  1EZ8 A;  2D2C C;  1RF2 D;  4J6H A;  1G6Z A;  2JYO A;  2L0C A;  3EA6 A;  1JIC A;  3J7Y W;  3NK9 A;  1FNW A;  1F2Z A;  4KJN A;  4MIU A;  1FGB D;  3OIQ A;  2R3Z A;  3H3V C;  4DK0 A;  3GTG B;  1EYA A;  2EPB A;  1SFO B;  4IQZ A;  2CW0 D;  4ODG A;  1II3 A;  1JCK B;  5COY A;  2E2H B;  5I9P A;  3KLS X;  3CRL C;  3O13 A;  2JA5 B;  3R2I A;  3C1E A;  2RVL A;  5FO7 B;  4QUF A;  3EQL C;  4PMC A;  5C3W A;  3RD4 A;  1BOS A;  1KLU D;  1EOT A;  1TWA B;  2JEA I;  1LAB A;  1TQO A;  2JEB I;  4XDX A;  3KLS A;  3AB9 A;  3BYT B;  4M8A A;  3G7L A;  4N9P A;  4X3T A;  3KLR A;  1LAC A;  1AEX A;  1VDZ A;  1LT3 D;  1UNS A;  3LX0 A;  4IZ8 A;  4HMJ A;  1NUC A;  1EIH A;  5CBA E;  4Q5V A;  1HUM A;  3H94 A;  5HUR A;  1B9N A;  1LTG D;  1SSO A;  1PXU A;  1CZG A;  3T56 B;  2KED A;  1H9K A;  1O7Z A;  4XYQ A;  3T4A C;  3MAQ A;  3MXG A;  3S1M B;  2EY2 A;  4RH6 A;  1EIG A;  1ESR A;  4OGQ C;  4A3I B;  1EYC A;  2TSS A;  2F0L A;  3H0G B;  2A73 B;  1DON A;  2EYH A;  1EFI D;  3PUX A;  4GZY C;  5EQ0 A;  3NTI A;  1KLG D;  2R7Z B;  4B9W A;  4XT1 B;  5BN3 A;  5M3M B;  4ZAI A;  2SNM A;  1PDQ A;  2M9V A;  2MP1 A;  5EPK A;  1G29 1;  1I4H A;  2HCC A;  3M3Y B;  3X3N A;  3GTJ B;  4H7B A;  1DOM A;  1VCI A;  1UEA B;  2BDN A;  2TMP A;  1IW7 C;  1TS2 A;  3NWS A;  3WOE A;  3Q22 A;  1OXU A;  4H44 C;  3ND9 A;  5JEA J;  3K5L A;  2B8F A;  1GUW A;  2F0F A;  5CV6 A;  1D5M C;  2L11 A;  2EY5 A;  4F87 A;  2OT2 A;  2XIW A;  4EQO A;  2F3V A;  2B2T C;  1UUP A;  2K5Q A;  3LWU A;  1EWH A;  1GXD C;  1TY0 A;  3R2T A;  1SNP A;  3IAY A;  1YNN C;  3D3R A;  4HMI A;  5CV9 A;  1YNJ C;  2ZXR A;  1EY9 A;  1D6E C;  1HA5 A;  4ZK9 B;  3DXJ C;  1DYQ A;  1DZ1 A;  2ICI A;  2F0U A;  1NAP A;  2FIN B;  2QF7 A;  2PZW A;  3M7N A;  1RDP D;  2KEE A;  2BA1 A;  5EPJ A;  1PZJ D;  3MWY W;  1FYC A;  4UDU C;  2NN6 G;  2NWG A;  3MHB A;  3PIP 3;  3I3C A;  1IW7 D;  2D9U A;  2XNA C;  2QEJ C;  3W3A A;  4HTH A;  1HCZ A;  4ILW A;  2B2U A;  1V1O A;  2WP8 J;  1XWE A;  4BA2 I;  4QF4 A;  2SNS A;  2KJX A;  2NVT B;  2A68 C;  1BXT A;  3Q6S A;  4K5V A;  2IX0 A;  1WD1 A;  1YNN D;  3S15 B;  1YNJ D;  5KGU A;  4RKL A;  1TWC B;  1STH A;  3TZU A;  5I6Y A;  1OXT A;  1G2S A;  1JWU D;  3NP8 A;  1SMY C;  2JSO A;  1U4L A;  1GHJ A;  3A8K E;  3S2H B;  1J9O A;  2XN9 C;  4AYB B;  1VF5 C;  3R8B A;  5JJZ A;  3I91 A;  3TP5 A;  1SYF A;  3OMG A;  1QG7 A;  2A6H D;  4BBS B;  3QG1 A;  1ILP A;  3CU7 A;  3VA7 A;  1CHQ D;  2E75 C;  2HUG A;  3IL8 A;  3N52 A;  3I90 A;  3OOC A;  5M5W B;  1IL8 A;  1H9R A;  4X3S A;  5IGE A;  5C4Z A;  2AUK A;  3K59 A;  4FF4 A;  5EKK A;  4HSP A;  1O80 A;  4JBW A;  4I65 A;  2B8G A;  2A74 C;  2FFK B;  2XRS D;  1F2Y A;  1SMY D;  1J8I A;  1MSH A;  1OXX K;  1DXM A;  5K5P A;  4A3E B;  2F3W A;  2Z4H A;  3TP7 A;  3OWE B;  4XQJ A;  1OO9 B;  4RCN A;  2BDO A;  1LTB D;  4RA8 A;  1QCB D;  4F8M A;  3I70 A;  4NMZ A;  4HSV A;  3T51 B;  4CJ2 C;  3PUV A;  1HFG A;  4FO2 A;  1Z7T A;  1PFM A;  3BZD B;  1AW7 A;  2FHT A;  2IX3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...