1ENAA

Crystal structures of the binary ca2+ and pdtp complexes and the ternary complex of the asp 21->glu mutant of staphylococcal nuclease. implications for catalysis and ligand binding
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
135
structure length
135
Chain Sequence
b'LHKEPATLIKAIDGETVKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STAPHYLOCOCCAL NUCLEASE
publication title Crystal structures of the binary Ca2+ and pdTp complexes and the ternary complex of the Asp21-->Glu mutant of staphylococcal nuclease. Implications for catalysis and ligand binding.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase(phosphoric diester)
total genus 32
structure length 135
sequence length 135
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 1994-02-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1enaA00
2EYMA 2F3WA 3ERQA 3H6MA 4J1MA 4KD3A 2RBMA 1F2YA 2EY1A 5IGDA 4N9TA 5IGEA 1TT2A 1EQVA 5J1ZA 1TQOA 5IODA 1KDAA 1EY8A 1STHA 3OWFA 5CV8A 1ENAA 3ITPA 5EKKA 5I9OA 5ISRA 5IGFA 4KY6A 5E1FA 3HEJA 1SNDA 4EQNA 5CV5A 3D4WA 1STGA 2F0NA 2F0HA 1EY4A 4B9WA 1A3TA 5E3FA 5IGCA 2ENBA 4IALA 2F0EA 4K6DA 4KTAA 3SK8A 3NHHA 2EYHA 4DF7A 3C1EA 5IGGA 2EY5A 3MEHA 1KABA 2F0VA 3SXHA 1SYGA 3SR1A 1RKNA 5C5MA 5EKLA 2F0SA 2NUCA 2OXPA 3SK6A 3T13A 4ZUJA 3QOJA 3BDLA 2PW5A 3EVQA 3NXWA 1SYDA 2F0LA 2OEOA 4HMIA 5HURA 4ID6A 4DFAA 4RKLA 1EY6A 1ENCA 3D8GA 1EZ8A 2SNMA 4NDXA 4NKLA 1SYCA 5K5PA 4KHVA 4NMZA 2EYPA 2HQEA 3EROA 4QB4A 5NUCA 4PMBA 1II3A 4IUNA 3TMEA 4K5WA 4WRDA 3TP7A 1KDBA 3D6CA 2F3VA 1SNCA 3P1HA 5M9OA 3NP8A 1EY7A 5IIFA 3NUCA 2F0JA 1A2UA 2EY6A 4EQPA 3TP6A 1AEXA 2EYLA 2PW7A 3MHBA 2F0MA 4G57A 4QMGA 4RKBA 1STAA 1A3UA 1KDCA 5CV4A 5DEHA 4N9PA 4K2KA 3LX0A 2F0FA 5C6AA 5I6YA 5IOCA 4HTHA 2F0UA 4KY7A 3QB3A 2EXZA 1SNOA 4WORA 4LAAA 4K14A 4E6IA 4TRDA 2EYOA 1KAAA 4I65A 5I9PA 3QOLA 4KV6A 1A2TA 4ODGA 2WACA 5KYIA 4ME5A 1EY5A 2QDBA 4EQOA 5CR3A 5KEEA 3DMUA 5JAVA 2F0QA 1IHZA 2OF1A 1F2ZA 5KIXA 4PMCA 1SNMA 4ZUIA 5I6WA 2EY2A 2PYKA 1EY0A 1SNQA 5CV9A 5C3WA 5C3XA 3OSOA 4OL7A 2F0DA 4DU9A 2M00A 5J22A 3NQTA 3OMGA 4NP5A 4QF4A 2PZTA 3C1FA 4K8JA 5CV7A 2EYJA 1STBA 4ZQ3A 2SOBA 2SNSA 2F0OA 4DGZA 5C4HA 2PZUA 2O4XA 1TR5A 2LKVA 5C5LA 3OMCA 1NSNS 3R3OA 4H7BA 4KD4A 4YIJA 3SK5A 3MZ5A 1STNA 2RDFA 2KQ3A 5F2DA 4S3SA 4F8MA 1JORA 5EGTA 4F7XA 1JOKA 1SYBA 1EZ6A 3VA5A 4EVOA 2EYFA 2F0IA 4IZ8A 4KY5A 5DAUA 4K5VA 1SNPA 5JOBA 3TP8A 2F0TA 1SYEA 1NUCA 5KGUA 3EJIA 3NK9A 4KJNA 4B9XA 4HMJA 5C4ZA 5HGTA 5J39A 1JOOA 5CV6A 3P75A 3BDCA 4J6HA 3MXPA 5CGKA 3SHLA 1JOQA 1U9RA 1EY9A 3T16A 4KJOA 2F0WA 3SK4A 3MVVA 2PQEA 3RUZA 3TP5A 2F0KA 2KHSA 1EYDA 1F2MA 2PZWA 2RKSA 4K5XA 3U9OA 5KRUA 1STYA 1A3VA 2F0GA 3DHQA 3V2TA 4PNYA 5IGBA 1SYFA 3D4DA 3E5SA 3S9WA 4K2LA 4K8IA 4R8NA 1EYCA 1EYAA 5CC4A 4MIUA 3PMFA 2F0PA 3HZXA 5KYLA
chains in the Genus database with same CATH superfamily
3H3VH 3G4SA 3GTGH 3IL8A 1J8IA 3KBXA 5M5XB 3X3MA 4OXPA 2OQ0A 1PZKD 1K3RA 5EPLA 2B2UC 1JWSD 2BDNA 2B63H 2VQFQ 1RDPD 4BY7G 3HOVB 4B3SL 2H5XA 3I73A 3SR1A 3SGIA 2NUCA 2JK8A 3E0JA 4GNXB 3J81j 4JBMA 2KJXA 1S5DD 1OXSC 1EY6A 2B2UA 1I4QA 1C8CA 1FNWA 2EIFA 4DV6Q 1MJCA 1ML0D 3HG9A 1C48A 1AE2A 3S1QB 4N8FA 1T5XD 1QB5D 1PMRA 3I90A 4B3RQ 2PI2E 3LX0A 1FD7D 3PIP3 2EXZA 2IW3A 3A55A 3BVZA 1ET9A 3Q6SA 1JJ2A 1FYCA 1T9HA 1KNEA 5IYCG 2XGTA 5IT9c 1HQMC 3GTMB 3VR2A 3CP0A 3DMUA 1BBUA 5JAVA 5JEAH 3CCMA 4YWLA 5C3WA 1HNZL 3I4NG 1N36Q 4X62Q 1BCPF 1SMXA 1MD2D 2ZJPA 2BE5C 1XJVA 1PRTF 3R3OA 4A3CG 4KD4A 4RHRA 4C1NI 5GAHC 1NTGA 3TP8A 1SNPA 2CFMA 5C44B 4R4QA 4A3DB 4CJ0B 5M3MB 1XPOA 4RA8A 1AE3A 1RODA 2D62A 2NN6I 5A35A 3KUPA 1VQFA 4RFBA 3I70A 5DM73 3T16A 4NB3A 2PZWA 4X3UA 3E6ZX 3K57A 2ICIA 1H95A 3TRZA 2XNAC 3GD7A 2R6GA 4Y52H 1Z6HA 2Y0SE 3BU2A 4DV3Q 5EAYA 1SJHD 5CBAE 2JA8B 5C0XG 1N33L 3GTQB 3DWAA 3R8BA 2Z8LA 2WINB 3E0EA 2DY8A 3NBHB 2A6EC 3I4MB 1BKBA 1V1PA 4H0LC 4A3EB 3RZDH 3HEJA 1A6XA 1STGA 3S1RB 1QJOA 2AMCB 3J81c 1QILA 1EUJA 1EYGA 3A5ZB 3J7AF 3MEHA 4NW2A 1G6PA 1M4VA 5IP9G 3UI2A 3T1HQ 3LWEA 5GROA 1LUZA 4AYBE 1X65A 2DJGC 1HA5A 2F1MA 3GQBA 3VA7A 1Y1WG 3CCRA 2HUGA 2XRSD 3SVMA 3CMEA 3D8GA 1ZKOA 2R92H 4DR3Q 1K9MC 2SNMA 5EJWA 1B3AA 1SYCA 5IYBH 2KBNA 1L2FA 2KOLA 1F77A 4JG2A 2K5WA 1ASZA 2CH4W 2ZTCA 4IOAA 1LM0A 2K50A 2H1EA 4C2MB 3PUXA 1SAPA 4R4CA 5FLMH 4U673 1C0AA 2A1AA 4DNRB 3CCEA 2Q2TA 4HTHA 2HIVA 1SRUA 5ELOA 4I65A 4BS9A 4G7HC 3CRKC 4DK0A 1WTOA 4ME5A 4X66Q 4IUVA 4TQUS 4QL5A 1BCPB 4FF3A 4A3BH 2HDLA 3D6WA 1ESFA 3NQIA 1VQ7A 4CJ1B 3HOUH 1HZCA 1PRTB 4QCLA 4ZQ3A 5C4HA 2EYJA 4RAUC 3FMCA 4IURA 3VYSA 4U68A 2Y0SB 4DR2L 2J0TD 2LFNA 5C5LA 1V9PA 5A2QL 5BN4A 1L1OB 2B2WC 2VB3X 4A3FG 2KQ3A 1KQSA 3KF8A 5JVG3 1ILPA 1CI3M 4DR5Q 1HNWQ 2F0TA 1SYEA 1CZWA 3J81i 1LT5D 3JAMc 4R8IA 1C7YA 1VF5C 3TDQA 2CW0D 2X6LA 3TP5A 3U9OA 4K5XA 2F0GA 5EPKA 4FNFA 1VQ5A 4DNIA 3A74A 2C9OA 1S4ZA 4AYBB 1NMGA 1XMOQ 3CC4A 4MIUA 2IPKD 3KJPA 1N34Q 2IHEA 2Z6KA 5IT9L 1F2YA 3KDFA 3E3XA 4FYDA 4X3KA 1SFOH 3RZOB 2FMCA 3DUZA 4HIKA 1WJJA 5E1FA 4K0KQ 4DV7L 2WKCA 2F0NA 1J6QA 2K01A 4QUCA 4CBVA 3PO2G 5EPJA 3A56A 3FHWA 4R1JA 1DZ1A 3J80c 1AN8A 3SK6A 2G9HD 2QEXA 3QOJA 3EVQA 2KECA 1FNUA 3HS0C 3KLSX 4A4IA 4RKLA 4OWTB 4DK1A 4HJ7A 1WOCA 2UXBL 1KLUD 4QUFA 2CWPA 2OCEA 2IY5B 3EROA 3OWEB 4HIMA 2UUBL 4IUNA 4OIJA 1E2ZA 3TS2A 2F3VA 5LMNQ 5IIFA 1LT4D 3MWYW 4DUYQ 1S72A 1BCPC 1STAA 4TVAB 4GLAC 4DR4L 3P20A 2JJQA 1HA6A 1BCPD 1PRTC 2ZXRA 1G2TA 2JSOA 1HZAA 4MTKA 1PRTD 4FVMA 4QY7A 2F4VL 1UE7A 5C0XJ 2O2LD 1SROA 1D5ZC 2NN6H 5JVH3 3I4LA 1L1OC 4LK1C 4CKEA 2HHHQ 5CBEE 1SNMA 2VB2X 1PFSA 2VUMH 3J81L 5LMUQ 3DWQA 4ZKBB 3S1QH 2RDGA 4DK3C 1CQVA 4KN7C 2PZTA 1HNZQ 2G5DA 4R4TA 2F0OA 4J8QA 4JOIA 1Z9FA 4YCWA 4HJ9A 1A0IA 3OMCA 1YEZA 1EWCA 1OXTA 4LUOA 1S3OA 2A19A 3Q24A 4DN4M 3M3YB 2N78A 4ZAIA 4L5RC 1K8GA 4OONA 3AB9A 1SJED 5KNBA 4FDBA 3EFXD 3RMHA 5C4ZA 5HGTA 1G51A 3PUVA 1QG7A 2Z6BA 3W5OA 2A6HC 3OW7A 3IAYA 1VQMA 1XTDA 5FO9B 2F0WA 4XQJA 2B8FA 5KRUA 1PTOF 4JI8L 1A3VA 2A6HD 1JICA 1SYFA 4IFDI 3D0FA 4JI7Q 3ONAB 3D31A 3NTHA 5C44H 2K5QA 1KRTA 4A3DH 5IGEA 5M3MH 3GTGB 1R9TH 4GKJL 1TQOA 3T4AC 2PQAA 1IBKL 1EOVA 1YI2A 5ISRA 1STHA 3U4VA 3H15A 4YWKA 3FDTA 1K8MA 3BYTB 2TSSA 2ENBA 2B63B 1B2TA 2UUCL 2MNAA 4DF7A 2JA6G 2EQSA 4HAEA 2F0SA 2K6AA 3MXNA 2JE6I 2EZVA 3NXWA 4JI5L 3GTQH 4A3IG 3A54A 5HURA 3C46A 1I4HA 1ENCA 1UAPA 2JA9A 4LFAL 1QE6A 3I4MH 2GA4B 2KHIA 3I7FA 4A3MB 5K5PA 4A3EH 3MFYA 3S1NB 4NMZA 2JN4A 3RN2A 1S5ED 2RVLA 4PZ8A 4DUZL 4A3GB 4JI0L 1CKNA 3STBC 1X3EA 1X32A 1E2WA 4KY7A 2EOTA 2QW7A 4DR7L 4OGQC 5J3BA 4RCOA 5BR8Q 4FXDA 3GTJB 1F2ZA 4PMCA 4C2MH 1ZYRC 3AFPA 2L9HA 2QEJC 4A3JG 1TU2B 2JEBI 3NTKA 1ZYRD 1HJPA 2LKVA 1EU4A 1NSNS 1HQRD 2HCCA 3SK5A 5A2QE 4CDEC 3I91A 4DR2Q 1TWAB 3CPWA 2A68C 5ELFA 3M7NA 3RNUA 3KF6B 5JOBA 3DEPA 2A68D 1PTOB 1R4PB 5CV6A 4GS3A 4LF8L 2E76C 4XT3B 5LL6S 1NR4A 2F0KA 3CRLC 4A3KB 3DEOA 1XPUA 3L3OC 2PPBC 1CHPD 4ALPA 4Y7NH 4R8NA 4KHPQ 2FXQA 2L4NA 1Q46A 3CCUA 3H6MA 4QIWE 1PH2A 4A93B 4RG1A 4JK1C 2N8NA 5IT9E 1H9SB 1EQVA 3VYRA 2E2DC 4DV1L 1G6ZA 1TS2A 3AMUA 2LS01 1E22A 2I0QA 4GOPA 3CQZB 4O0AA 1MJEA 4BXXG 3HKSA 4B9WA 1EY4A 5E3FA 3RZDB 4B3TQ 1GHJA 1YIJA 1IL8A 1B9MA 3HKZE 1E1TA 1QUQA 4DV7Q 2WIIB 4HEDA 2K33A 5EKLA 3WDNA 3S14H 4ZUJA 1WTQA 1D7QA 1YBYA 2L1BA 2F0LA 4AIMA 2V1CC 5HY6A 1EFID 3B6YA 3VYTA 3M85A 3RZOH 1K8OA 4NKLA 2R92B 2K32A 3NEMA 4NPSA 2UXBQ 2XIWA 3P1HA 1SBBB 4JC0A 4OX9L 4LNQA 5BN3A 3N52A 5FJ8H 3O13A 4KK7A 5C6AA 2ATWA 4DKAC 2UXDL 3I72A 5IYDG 2KVMA 1A2TA 4DR4Q 3R93A 4KKTA 2K5HA 1H9JA 1EEFD 1F9SA 1I6VC 1LTBD 2F0QA 5C3EB 2E2JH 1LTTD 4ZUIA 1LT3D 2F4VQ 1DGSA 3HOZB 1X54A 3J81E 2RF4A 1EIFA 1JWUD 4C56C 1PYSB 3HOUB 4HJAA 1KRSA 4IUPA 3H91A 1N32L 2KEEA 1PTOC 5M3FH 1GUTA 4IFDH 4X64L 1Q90A 2XN9C 3W1GA 1PTOD 1UWVA 4QIWB 3IFTA 1VQLA 1WTHA 2PCFB 2KENA 3MC0B 2RSOA 4J15A 4BBSG 1I4PA 1DCZA 3U9SA 5KNDA 1HH2P 1HTLD 4YHHL 4IUTA 3BDCA 4DXGA 3MXPA 1K0RA 3I56A 3PO3B 3AYHB 2MUYA 4AQYQ 1XYIA 3KLRA 1PLFA 5I4DA 2EJFC 3MTSA 4P74A 3M3YH 1PFBA 1W6KA 4KD3A 1TWGH 3BVGA 3EIVA 5IYBG 1Y8PB 1MI2A 2BCOA 5FOBB 4ZRZA 4ZYSA 5IY0A 4EQNA 4A76A 2YYZA 3MFGA 2O5JC 1IBKQ 3U50C 5G3LD 3C1EA 1SE3A 2AUKA 4IPCA 1K0SA 1PZJD 4JW0A 3F2UA 1RKNA 3VR4A 1GUGA 4RCNA 2CHBD 1XMQL 2UUCQ 2I5MX 2PW5A 1PDQA 3K7UC 1BO0A 4IOCA 1V1QA 1L0XB 2A8VA 1QZHA 4WJ4A 3A7AB 5C4XG 5ELEA 1W3SA 1XNRL 4JI5Q 1TWFH 1V1PB 1VQEA 1D1KA 3HFZB 4A3BG 3A0JA 2CH4A 3I4NB 4WRDA 1SSOA 2WB1G 4R9WA 1TIID 2YU9H 1E3PA 2RDHA 3S1MB 1FGUA 4BBRB 1VDZA 1O7IA 4DUZQ 4RKBA 4CJ2C 1KDCA 5DEHA 4N9PA 2G9DA 1EIGA 1XNQL 2M2LA 4L5TA 5LL6X 4IUQA 4YWMA 3L9AX 4KV6A 2I5HA 2QDBA 4ULLA 4A3MH 3EA6A 3VDYA 3FPPA 3FPUB 4FXKC 2JA5H 1IHZA 3S1NH 1IZ6A 5LMNW 3PIO3 1M1KC 1SNQA 4A3GH 3HKZG 2K05A 2VUMB 3CXCA 5JJLA 1SR3A 1PH1A 4BWGB 1STNA 1X3PA 3E9HA 1ZEQX 4S3SA 2D5DA 2WKDA 4DAVA 3VA5A 2K75A 1I4GA 4KY5A 5GADC 3NENA 3GTJH 4MHEA 4HMJA 1I5FA 1EY9A 4RHSA 2NTTA 2M9VA 4LF8Q 1STYA 3ULJA 3DHQA 2VQEL 1O7YA 3S9WA 3OHXC 1EIHA 1AZQA 3I4OA 1TWAH 3UE1A 2F0PA 3KF8B 4J1MA 2NVQB 2BE5D 2K7VA 4HN7A 1NJIC 1J9OA 1FGBD 5J1ZA 1PTOH 3HOWH 1ZXTA 4KLKA 1IYUA 5AFWA 5IODA 1R9TB 3M9BA 2LSSA 4Q5VA 1UEAB 2ZXPA 1I4RA 3RN5A 3K59A 4A3KH 4DR6Q 4LF4Q 3SK8A 4DV5L 4XQQA 3HOVG 3T1YL 3U4ZA 3UE0A 1X3GA 3H0GH 4A75A 2F0VA 2L0CA 3HP3A 3ND8A 1VQNA 4LFBQ 2OXPA 3PUYA 2ZM6L 5C0XI 4A93H 1SYDA 5FO8B 1BVSA 2E2IH 1WFQA 4DFAA 2KCTA 3G6EA 1MKHA 1LO5D 4JI1L 1HNXQ 1BBXC 3LNNA 2IX3A 2HQEA 3CQZH 4C3HG 4X65L 3RLNA 5K36G 1FVIA 2A6ED 5M9OA 3H94A 3GV3A 1OXUA 2HDMA 1AP0A 3TP6A 1F9RA 4Q0FA 1BNZA 3DLLA 3C2PA 3LGJA 2CQAA 2A69C 4WORA 4OX9Q 3MEFA 4A3FB 1QVGA 1KL9A 2JA7H 3Q23A 2A69D 1PH5A 1IL2A 5ELBA 3I55A 4L8JA 5CR3A 1SE4A 1U4RA 4NXNL 1E24A 3NPPA 1UUPA 1OO9B 5JPMC 4X3SA 1E1OA 2IHFA 1IW7C 2R7DA 4BY1H 3V96A 4OO1G 1B53A 2O4XA 2Z1CA 4GNXA 3FKIH 2NYZD 4DV2L 4X64Q 1T5EA 3MXUA 3K58A 2BDOA 3OIPA 2UU9Q 1LABA 4A3DG 1FL0A 5M3MG 5C3EH 1IYJB 1PH9A 1G291 3EBEA 1YHAA 1YHBA 2LXKA 3HOZH 4Z9CB 5CGKA 1JOQA 2RHSB 3OW2A 3PIOA 2NZOA 5IP7H 4YHHQ 3TSSA 1CZGA 1LV9A 5FO7B 1X9NA 1AFPA 4PNYA 2ZJRA 3OOCA 4FP5D 2IL8A 5JJKA 2JEAI 3GTOH 4Y7NB 1GUNA 2JA8G 1B3QA 5GQOA 3D4RA 4GKKL 4IO9A 3S15B 1NNXA 3CKIB 4K6LA 5IGDA 4RGMA 3I4MG 3TQYA 4DXFA 4A3EG 5CV8A 5DNFA 3ITPA 2K52A 2Z6KC 2AQ3B 3PO3H 1U0LA 4DV0Q 4BY7H 3NWSA 1HR0Q 3U58A 4HCEA 4JBJA 4DAMA 4TSSA 4LF6L 2HD3A 4JYAL 1B9NA 2XSCA 1WCMG 3S14B 4QJFA 1Q1BA 4YCUA 1CHQD 3G7LA 2PQAB 4LF7L 4HIDA 1R4QB 4LF5L 2WP8J 2R93G 1XNRQ 1X3FA 2HIXA 3CPFA 4K5WA 3VR5A 3NP8A 1EY7A 2WFWA 1HZ9A 3BZCA 2MQHA 4G57A 4QMGA 2CCZA 2F0MA 2I5LX 2F0FA 3NTIA 4RGTA 3MXNB 1KC8C 4B3ML 3QB3A 1IKLA 1SNOA 1W6JA 2KA7A 3QWNA 1B1ZA 1KAAA 4B3SQ 5JJZA 5IYCH 1M90C 1LYLA 2WACA 1XNQQ 1PH4A 4LMQD 3T51B 5D3IB 1A8VA 1MGSA 2B2YA 3I4NH 2E2JB 4DA2A 3IFDA 1PH7A 3R2IA 2I07B 3OSOA 4IN3A 1P16A 2M00A 3S1MH 4BBRH 1ET6A 1CKMA 2PI2A 2SOBA 1EEID 4RGOS 1U4MA 2Y0SG 1WD1A 4V0BA 1VS0A 4A3CH 5M3FB 2NVYB 5DLQE 4HSPA 3MZ5A 4H13C 3TREA 1QOHA 3PF5A 3QIAA 3UDXA 1JORA 4LF9L 3CMAA 3J7A5 4CDDC 4JOIC 2KCMA 1GD7A 1PFNA 3JAMi 1HXYD 2MHVA 4UP8A 3K0XA 3OYYA 3M4OH 2D9UA 5J39A 1NMFA 2UXCL 2QCPX 1STEA 2BH8A 2XTIA 1U9RA 4JPBW 1SE8A 3Q0AA 1ENFA 3N6RA 2BOSA 2DUDA 3IKJA 4FO2A 4AYBG 1J5EL 1ASYA 5EQ0A 5C0XH 1WTPA 5M5YB 5CC4A 5KYLA 2VQEQ 2RBMA 1K3BC 1TT2A 3GTPH 1TWGB 2P5ZX 4RMFA 1EY8A 3CC7A 1TS5A 4LFCL 4JI6L 1W2BA 1S5FD 3J80i 4WFN3 5JPNC 3L2PA 1VF7A 5IP9H 1YJ9A 4RH6A 1Y1WH 4OWXB 1RD9D 2NVQH 1SDFA 4A3LH 1TWHH 3DM3A 3WWVA 1MHWC 1H9MA 1EZ8A 1S5CD 1N33Q 3PSIA 1TWFB 3HGBA 1DOLA 3J7AV 4P73A 3F2CA 1XTCD 4JI1Q 4C3IB 1EQQA 2K4KA 1K73C 4ABNA 4A3JB 2F0JA 2SDFA 3OIQA 2YU9B 4X65Q 2EYLA 1HZBA 1LTRD 1Z7TA 1FJGL 1HCZA 4FF4A 5I6YA 2RCFA 4P71A 1KD1C 3CCVA 1EY5A 1V1OA 1Y8NB 2N3SA 2R7ZB 5ELCA 3JAML 1SXTA 3ZYYX 5KIXA 2ZXOA 2JA5B 3I3CA 4NXNQ 4DR1L 3DM1A 1SEBD 2IX1A 3EQLC 1G2SA 1HFGA 3C3LA 2F03A 4A3FH 3STBD 4JBWA 4F7XA 1Q12A 1JOKA 2LY7A 5CMDA 4IZ8A 3F2BA 1YNJC 2OWOA 1LTAD 2VQFL 5M5WH 3EJIA 4HR7B 2WAQE 3KK7A 5E7NA 1GO3E 3SHLA 1CK1A 4C1NK 2PQEA 1I50H 4MTNA 2SEBD 1TWCH 1Y1VB 2NZ1D 1VQ9A 2WV6D 1DYQA 1YNNC 2DN8A 3V2TA 5IGBA 3J80L 2B2TA 3KJOA 2Q8TA 5EKIA 4F88A 1YNND 2E74C 2ALYB 4APVA 1RF2D 3GTKH 4DV6L 2VW9A 3MA2B 1VQPA 3S2DH 1V43A 1PH8A 2JP1A 3HOWB 4B3RL 3D4WA 3NELA 1UE5A 3OTOL 2B63G 2CWAA 2ES2A 1PH6A 1NAPA 4KKUA 1HPCA 1KABA 4GOPC 4POFA 3H0GB 1I4XA 1ESRA 1JB7A 3S15H 4DV4L 1GVPA 4HMIA 1G91A 1CUKA 4ID6A 4LF6Q 4JYAQ 1NR2A 2E2IB 2F4IA 5FKAC 4IPDA 4WJ3M 2HT1A 3BYYB 2KHJA 3BZKA 2F3IA 5T1IA 1CA6A 3TP7A 3D6CA 4LF5Q 1IXRA 3R2TA 1A2UA 4EQ5A 4EQPA 1AEXA 1TY0A 4C3JB 4K2KA 1D5MC 2NVTH 3W2DA 1BUVT 1QVCA 2Q8RE 3ULPA 4B3MQ 2JA7B 2JXMB 4BBSB 4I7ZC 1B7YB 2CQOA 4X6AH 3HOXB 2WAQB 4EGVA 3HOYB 5JEAG 1JE5A 4O1NA 5CORA 3OMGA 4NXML 2H4OA 2LXJA 4HJ8A 4TKOB 2UUBQ 1TR5A 4BY1B 3CD6A 1JCKB 1VQCA 3FKIB 1RTOA 4EVOA 3G71A 2EYFA 5DAUA 1IBLL 4HIOA 1KIXA 1NUCA 4B9XA 4ZCKA 3URYA 3P75A 1VQ4A 3PV0A 1KTKA 3S24A 4KJOA 4F87A 1Q82C 1EL0A 2Q8IB 4P72A 1F2MA 2QGQA 4I7AA 2NVYH 4K8IA 1EYAA 2EJMA 4KI0A 4A93G 1VQGA 3GTOB 2IJ0A 5C4XB 4L5SA 1CT1D 1BXTA 3OWFA 5C4JB 2AQ2B 1Q7YC 2UUAL 3K5MA 1D6EC 2X69A 1HUMA 1SMYC 2FFKB 4ZLTF 4IALA 4K6DA 2R61A 1JB3A 1VQHA 3IRBA 1S40A 5ELDA 4BY7B 2EYHA 1RTNA 3SE0A 2PO4A 1RJTA 5M5YH 3T13A 2R7FA 4X66L 1YJNA 4JI8Q 4A3IH 1HRJA 2Q2HA 3TN2A 1Y8OB 3KF6A 2L15A 2ZTEA 1O80A 4CDCC 2AWNA 4GN5A 4MN3A 2R92G 1EWHA 1L0WA 2OQKA 1HR0W 1II3A 4UHVA 4XYOA 4JV5L 3G48A 4GKJQ 4ME3A 1BR9A 1HTPA 2L5TA 2MFIA 3L7ZC 1TXYA 2V4DA 1Z47A 3AU7A 5IOCA 5FLMG 4AH6A 2MPMA 4PZ6A 3NSWA 1PXUA 1F9PA 2N88A 1PVOA 5KYIA 4OWWB 3PUZA 5KEEA 3NE5B 1I6HH 2B2VA 1HHVA 5C3EG 3K7AH 2K1BA 3QO2A 3JAME 4LFAQ 5C3XA 4C3IH 3ULLA 4UY8C 4A3JH 3HOUG 5J22A 4KHZA 1XMOL 2NVXH 4DGZA 2SNSA 3AQQA 1Q81C 4XIGS 2PMZB 4DR1Q 4YCVA 4JI0Q 4H7BA 2Z9HA 1HUNA 4P75A 2I46A 1DOMA 4F8MA 1K8AC 3ZJYC 1SYBA 2GVBA 3GTLH 4P2CB 1IYVA 1BBWA 3LWUA 4K0KL 2R7ZH 2DJFC 4DR7Q 3I8ZA 2FMMA 1PH3A 1HFNA 3M4OB 1LTSD 1FR3A 5FLXc 2FJ2A 3PO3G 1X56A 2KHSA 1U4PA 2RCNA 5AJ3L 3J80E 1EWIA 2HQLA 1VQDA 3PUWA 4BA2I 2NZHA 1PHJA 2HCIA 2F3WA 4LWCA 1WTWA 1Q8IA 2B3GA 2EJGC 3SDZA 1D2BA 1B44D 2KCCA 5LMNL 3GTPB 1Q8KA 4DUYL 4C3HB 4BXXH 4V190 1SNDA 1NY4A 4GN4B 1Y1VH 5IGCA 3RLOA 1JJCB 2F0EA 4KTAA 5JEAJ 4POGA 1IKMA 1I94L 4R4OA 1VQKA 5TSSA 1TS3A 2A73B 3GO5A 3OTOQ 2DNEA 1U5KA 1LTGD 5T1GA 4L6TB 1Y1WB 2HHHL 4CGYB 3TZUA 4QGUA 5LMUL 1XX8A 4G7OC 4DV4Q 2E5LL 1TWHB 1VMPA 1KLGD 2IX0A 2EPBA 1YHQA 3A8IE 1JT8A 2XWJB 3E9IA 4DV1Q 1YZ6A 1NCVA 3S2HB 4BBRG 1UE6A 2N49A 1S5BD 1K28A 4CHTB 1WVLA 1CM9A 1DM0B 3A5UA 5IYDH 2EYOA 1JJGA 1UE1A 4ODGA 1SLJA 3KDFB 1JC7A 4PG3A 3CHBD 5LHY1 2E2HB 1PFMA 2QILA 2NN6G 4DAYA 1M8AA 1F9QA 2VUMG 2NTSA 3DWPA 4JI7L 3QG1A 3JC66 1C4QA 1TY2A 3A8JE 2RA4A 4C3JH 2VZAA 1CQFA 1AZPA 4NXMQ 4YIJA 2XVSA 4XT1B 2EXDA 3ERSX 1ICFB 4GZYC 1UNSA 4BBSH 1GUOA 1F2LA 3WOFA 5ELNA 1A63A 2UXDQ 3HOXH 4GNXC 5D65A 1B8AA 5KGUA 3HOYH 1X6OA 3QR8A 1IBLQ 5M5WB 3M7GA 4J6HA 1GKHA 4UDUC 4PQXA 3CAMA 3RUZA 2IWHA 4HCSA 1EYDA 2EE1A 1CSPA 2AQ1B 1I50B 4JI2L 4X3TA 4OO1I 1TWCB 1WTRA 4EX5A 2NBFA 3EN2A 5IWAL 1IW7D 4L63B 2MP1A 4XXEA 2ID0A 1N32Q 2BA1A 1WCMB 1UEBA 4XDXA 3ERQA 4A3LG 1OXXK 3GTKB 1QZGA 1LLRD 1SE2A 1DOKA 5C44G 4IPHA 3S2DB 1Q86C 3S16B 3D3RA 1KDAA 4IUUA 2R93B 3CC2A 5IGFA 1YITA 1O78A 3PO2B 3PGZA 2UUAQ 3NHHA 2PNRC 3PCOB 3S17B 2DNCA 1BQQT 1CA5A 3M4PA 4DK6C 5D14A 5BR8L 3BDLA 1NBWA 4LUZA 5C4XH 2ZTDA 5EBDA 2Z4IA 2VNUD 2JYOA 5C4JH 4KHVA 4QQBX 5FLXL 2L11A 4QB4A 1O7ZA 3CU7A 2KUMA 3K8AA 4JV5Q 5E4WC 1A3UA 4OEMB 4LW1A 4FF1A 4K14A 2AHOB 1CKOA 1I3QB 2NVTB 3KBGA 3PIPA 1XMQQ 2VL6A 4GN3B 4CKBA 2GVAA 4O42A 1ICWA 2CW0C 2OF1A 4M8AA 2EY2A 4YY3L 3BJUA 2XWBB 4DU9A 3BS1A 4PZ7A 4G7ZC 1XWEA 2B2WA 2A5HA 4KHPL 5CV7A 5I2XA 3UDIA 1STBA 3Q8DA 1JWMD 2B2YC 3RLFA 3T56B 2RDFA 5F2DA 1CFMA 4DPGA 3HRZC 2Q2IA 4UPAA 2EVBA 1WTVA 1YJWA 4B3TL 3NBHA 4KJNA 2CKZB 2MGSA 3WOEA 5GAGC 1VQOA 2B8GA 1GUWA 1D8LA 2D2CC 1VQIA 1CKNB 1GJXA 3PF4A 1Y14B 4IJLA 3VR6A 5E4XA 3VR3A 3CW2C 1VQ8A 1EYCA 5AJ3Q 1Q1EA 2O5IC 3PMFA 3BG3A 2OTLA 1B50A 5M5XH 2EYMA 1FNVA 2Z4HA 2EY1A 1BF4A 5EKKA 4UAIA 2E75C 5I9OA 5L37A 3UDGA 3M4QA 2FINB 4UP7A 4LUVA 3X3NA 5I9PA 2F0HA 5JJIA 2F52A 1A3TA 2Q2UA 3HOVH 4JCVE 2C35B 3NWTA 4H02A 2JA6B 5IE8A 1WTXA 1V8QA 1PZID 1SYGA 2YTYA 1I94Q 3KFUA 5I2YA 4JI4L 2AKWB 2Z0SA 3F1ZA 4A3IB 1QVFA 4O2DA 3K81C 2VY3A 4DAPA 4HSVA 4NDXA 4CKCA 4C3HH 5K36H 2K5VA 5NUCA 5BN5A 2E5LQ 5DM63 1LACA 1B4OA 2PW7A 4KMUC 2YTXA 1LTID 3K5OA 4RGNA 2RHQB 5EBCA 1EOTA 5FJ8G 4DV5Q 1ONLA 1QNUA 3T1YQ 1L1OA 2XRQD 3I2ZA 3AEVA 3TS0A 1RHPA 3GTMH 4PMWA 2ZM6Q 2B39A 4N8X1 1C9OA 1I6HB 2QDLA 1GXDC 2K5DA 3K7AB 3FP9A 4AQYL 5CV9A 1N8RC 4GOPB 3S2HH 2LMCB 1KXLA 3OPOA 1A62A 1YNXA 4OO1H 2RSNA 4K8JA 4LJZC 4DNTB 3V05A 1QUQB 3J7ZC 2PZUA 2NVXB 1DONA 5M3FG 4IFDG 3G6JB 5COYA 2C5CA 1K83B 3BDOA 1EZ6A 3QJYA 3RR5A 3CF5A 2K04A 4JI3L 3GTLB 2E2HH 3MXGA 3W3AA 1JOOA 4OIKA 1GM5A 5FK9C 1IBML 3DXJC 3MVVA 5GAEC 4XQNA 3FRPB 1N9WA 1DJRD 3GDEA 3E5SA 4HJ5A 4K2LA 3K80C 2JA8H 2L55A 4JI2Q 4ZKCB 3HZXA 1TS4A 1O7LA 5IWAQ 2B2TC 3GP7A 4DV2Q 3UDFA 5G3LF 3S1RH 1GUSA 1YNJD 4KY6A 5CV5A 1LTLA 4UP9A 1VQAA 5H1SE 1MBYA 2E8GA 4G4KA 1VCIA 2B29A 2IT1A 5IGGA 3J7YW 1PV4A 5HGQA 3M4YA 1WCMH 1JQYD 4RWSC 3K5NA 4IJHA 3CCLA 1EQTA 2AWOA 1VQ6A 3H3VI 4IPGA 1NE3A 1CSQA 3S16H 4WJWA 2R93H 1Y69U 4GKKQ 2EYPA 2NWGA 4JVZA 1G8ZD 2QF7A 5FLXE 4C3IG 1EIYB 2DGYA 1KDBA 1SNCA 3PO2H 2J4XA 3K6OA 3FVQA 1KAWA 3RD4A 2A74C 2D0OA 3NUCA 2KCNA 3S17H 3ND9A 1RL2A 2FHTA 3SEBA 1B70B 1GOZA 1E7ZA 1P8LA 4LAAA 2YV5A 4E6IA 4TRDA 1ILQA 5CYUA 3QOLA 1DXMA 3P7JA 1OXVA 4EQOA 2CVRA 4KKSA 2R7ZG 4A3MG 2EDGA 2JA5G 4ILWA 1N36L 4X62L 3BVMA 2N55A 4L5QA 3H3VC 4LF7Q 3PQIA 3K0YA 2K28A 2F0DA 4OL7A 4A3GG 1KHIA 1YVCA 2WB1E 4YY3Q 1VMCA 3KYHC 3TBIB 3A7LA 3F2DA 1I3QH 1TKWB 1JMCA 3ICEA 3KLWA 4XYQA 3TZDA 4BA1I 2D0PA 4DR6L 4LF4L 3T53B 3F8TA 1X55A 4KN4C 1WD0A 3CCJA 1JE4A 3SK4A 4LFBL 4B08A 1Y1VG 2RKSA 1H9KA 4DV3L 1E2VA 2OTJA 1KNAA 3GV6A 1EU3A 3Q22A 2K03A 2YTVA 2VXWA 1E0BA 1EFWA 1HNXL 3W1BA 1AW7A 4OHJA 4N9TA 1LT6D 2BA0A 1SN8A 3HOWG 2ASBA 4LF9Q 1ENAA 1A15A 3CCQA 2GN5A 3H09A 4IQZA 4OELB 3ER0A 4JBKA 4MZ9A 3T1HL 3FEWX 4A3KG 2UXCQ 3CCSA 4XTCS 4CDFC 2TMPA 2EY5A 2ZJQA 3SXHA 2QA4A 2AUJD 5C5MA 3H0GG 2PMZE 3TEHB 4DR3L 1Q3LA 1VQBA 2OEOA 4IFDJ 3VYUA 1JR0D 1CTMA 1DD2A 1J5EQ 2PNHA 1U4LA 2JQOA 4JI4Q 1L0YB 3AFQA 4A3BB 4PMBA 2MO1A 2R3ZA 3TMEA 2J7ZA 2WB1B 1PYWD 2QKIC 5D3DA 2EY6A 2ZT9C 4FXGC 2VS1A 2JA6H 1PYBA 3MHBA 4LFCQ 3KLSA 4JI6Q 4C3JG 5CV4A 1SMYD 2DY7A 2UU9L 3A8KE 2F0UA 1VQJA 3MAQA 2X6GA 3BZDB 2JA7G 4R4IA 1RCVD 1AH9A 2NB0A 3NBIA 1WI5A 3HOXG 2WAQG 3HOYG 5I6WA 2PYKA 1EY0A 1EQRA 1RIPA 1D5XC 3HKZB 1D1IA 1BOSA 2B2VC 4GLXA 3NQTA 4NP5A 4QF4A 1QNKA 3C1FA 2RQXA 4M1UB 4BY1G 4ZK9B 2K14A 4GLVB 2L12A 3K5LA 4H44C 4DR5L 1HNWL 1MIUA 3FKIG 5EGTA 4FF2A 1FJGQ 4PV1C 1PA6A 1MSGA 1OTCA 2F0IA 4K5VA 1X3QA 1BDOA 3KOJA 3L0OA 1H9SA 5KNCA 1QWYA 1XPRA 4DV0L 2ICEC 1SFOB 3NK9A 1HR0L 1MSHA 4DAYB 2KEDA 2MO0A 4JI3Q 2K5NA 3HOZG 2OT2A 5IP7G 1H9RA 1IBMQ 3D4DA 1N34L 1QCBD 2BH2A 1WYDA 1K83H 1XXGA 2MJ8A 1GHKA 4MNOA 1TVXA
chains in the Genus database with same CATH topology
3IL8A 1J8IA 3KBXA 5M5XB 3X3MA 1PZKD 5EPLA 2B2UC 1JWSD 2BDNA 1RDPD 3HOVB 3I73A 3SR1A 2NUCA 3E0JA 2KJXA 1S5DD 1OXSC 1EY6A 2B2UA 1I4QA 1C8CA 1FNWA 1ML0D 3HG9A 1C48A 3S1QB 1T5XD 1QB5D 1PMRA 3I90A 3LX0A 1FD7D 3PIP3 2EXZA 2IW3A 3A55A 3BVZA 1ET9A 3Q6SA 1FYCA 1KNEA 1HQMC 3GTMB 3VR2A 3DMUA 5JAVA 5JEAH 5C3WA 1BCPF 1MD2D 2BE5C 1PRTF 3R3OA 4KD4A 4RHRA 4C1NI 3TP8A 1SNPA 5C44B 4A3DB 4CJ0B 5M3MB 4RA8A 2D62A 1RODA 2NN6I 5A35A 3KUPA 4RFBA 3I70A 5DM73 3T16A 2PZWA 4X3UA 3E6ZX 3K57A 2ICIA 2XNAC 3GD7A 2R6GA 1Z6HA 5CBAE 1SJHD 2JA8B 5C0XG 3GTQB 3DWAA 3R8BA 2Z8LA 2WINB 2DY8A 3I4MB 2A6EC 1V1PA 4H0LC 4A3EB 3HEJA 1A6XA 1STGA 3S1RB 1QJOA 1QILA 3J7AF 3MEHA 4NW2A 1M4VA 3UI2A 3LWEA 3VA7A 1HA5A 2F1MA 3GQBA 2HUGA 2XRSD 3SVMA 3D8GA 1ZKOA 2SNMA 5EJWA 1B3AA 1SYCA 2KOLA 1F77A 2K5WA 4C2MB 2H1EA 3PUXA 1SAPA 4U673 4DNRB 4HTHA 4I65A 4BS9A 4G7HC 3CRKC 4DK0A 1WTOA 4ME5A 4IUVA 4TQUS 1BCPB 4FF3A 2HDLA 3D6WA 1ESFA 3NQIA 4CJ1B 1PRTB 4QCLA 4ZQ3A 5C4HA 2EYJA 4RAUC 3FMCA 4IURA 3VYSA 4U68A 2Y0SB 2J0TD 2LFNA 5C5LA 5A2QL 5BN4A 2VB3X 2B2WC 2KQ3A 3KF8A 5JVG3 1ILPA 1CI3M 2F0TA 1SYEA 1CZWA 1LT5D 4R8IA 1VF5C 3TDQA 2CW0D 2X6LA 3TP5A 3U9OA 4K5XA 2F0GA 5EPKA 4FNFA 2C9OA 1S4ZA 4AYBB 4MIUA 2IPKD 5IT9L 1F2YA 4FYDA 4X3KA 3RZOB 2FMCA 3DUZA 5E1FA 2WKCA 2F0NA 2K01A 4QUCA 4CBVA 5EPJA 3A56A 1DZ1A 1AN8A 3SK6A 2G9HD 3QOJA 3EVQA 2KECA 1FNUA 3HS0C 3KLSX 4RKLA 4DK1A 1KLUD 4QUFA 3EROA 3OWEB 4IUNA 4OIJA 1E2ZA 2F3VA 5IIFA 1LT4D 3MWYW 1BCPC 1STAA 3P20A 1HA6A 1BCPD 1PRTC 2ZXRA 1G2TA 2JSOA 1PRTD 4FVMA 5C0XJ 2O2LD 1D5ZC 2NN6H 5JVH3 3I4LA 4LK1C 4CKEA 5CBEE 1SNMA 2VB2X 3J81L 3DWQA 4ZKBB 2RDGA 1CQVA 4KN7C 2PZTA 2F0OA 4J8QA 3OMCA 1EWCA 1OXTA 3Q24A 4DN4M 3M3YB 4ZAIA 3AB9A 1SJED 5KNBA 3EFXD 3RMHA 5C4ZA 5HGTA 3PUVA 1QG7A 2A6HC 3OW7A 3IAYA 5FO9B 2F0WA 4XQJA 2B8FA 5KRUA 1PTOF 1A3VA 2A6HD 1JICA 1SYFA 4IFDI 3ONAB 3D31A 3NTHA 2K5QA 5IGEA 3GTGB 1TQOA 3T4AC 5ISRA 1STHA 3FDTA 1K8MA 3BYTB 2TSSA 2ENBA 2B63B 1B2TA 4DF7A 4HAEA 2F0SA 2K6AA 3MXNA 2JE6I 2EZVA 3NXWA 3A54A 5HURA 3C46A 1I4HA 1ENCA 1UAPA 1QE6A 2GA4B 4A3MB 5K5PA 3MFYA 3S1NB 4NMZA 1S5ED 2RVLA 4A3GB 1X32A 1E2WA 4KY7A 2EOTA 4OGQC 4RCOA 4FXDA 3GTJB 1F2ZA 4PMCA 1ZYRC 2L9HA 2QEJC 1TU2B 2JEBI 3NTKA 1ZYRD 2LKVA 1EU4A 1NSNS 1HQRD 2HCCA 3SK5A 5A2QE 3I91A 1TWAB 2A68C 5ELFA 3M7NA 5JOBA 3DEPA 2A68D 1PTOB 1R4PB 5CV6A 2E76C 4XT3B 5LL6S 1NR4A 2F0KA 3CRLC 4A3KB 3DEOA 3L3OC 2PPBC 1CHPD 4R8NA 2L4NA 3H6MA 4A93B 4JK1C 5IT9E 1H9SB 1EQVA 3VYRA 2E2DC 1G6ZA 1TS2A 3AMUA 2LS01 3CQZB 4B9WA 1EY4A 5E3FA 3RZDB 1GHJA 1IL8A 1B9MA 2WIIB 4HEDA 2K33A 5EKLA 3WDNA 4ZUJA 1WTQA 2L1BA 2F0LA 1EFID 3VYTA 3M85A 1K8OA 4NKLA 2R92B 2K32A 2XIWA 3P1HA 1SBBB 5BN3A 3N52A 3O13A 4KK7A 5C6AA 3I72A 2KVMA 1A2TA 3R93A 4KKTA 1H9JA 1EEFD 1F9SA 1I6VC 1LTBD 2F0QA 5C3EB 1LTTD 4ZUIA 1LT3D 3HOZB 3J81E 1JWUD 4C56C 3HOUB 4IUPA 3H91A 2KEEA 1PTOC 1GUTA 4IFDH 1Q90A 2XN9C 1PTOD 4QIWB 3IFTA 2PCFB 3MC0B 2RSOA 1I4PA 1DCZA 3U9SA 5KNDA 1HTLD 4IUTA 3BDCA 4DXGA 3MXPA 3PO3B 2MUYA 1XYIA 3KLRA 1PLFA 5I4DA 2EJFC 3MTSA 1PFBA 1W6KA 4KD3A 3BVGA 1Y8PB 1MI2A 2BCOA 5FOBB 4ZRZA 4ZYSA 4EQNA 2YYZA 3MFGA 2O5JC 5G3LD 3C1EA 1SE3A 2AUKA 1PZJD 3F2UA 1RKNA 3VR4A 1GUGA 4RCNA 2CHBD 2PW5A 1PDQA 1BO0A 1L0XB 3A7AB 5ELEA 1V1PB 1D1KA 3I4NB 4WRDA 1SSOA 4R9WA 1TIID 2RDHA 3S1MB 4BBRB 1VDZA 4RKBA 4CJ2C 1KDCA 5DEHA 4N9PA 2G9DA 1EIGA 2M2LA 5LL6X 4IUQA 3L9AX 4KV6A 2QDBA 4ULLA 3EA6A 3FPPA 3FPUB 4FXKC 1IHZA 3PIO3 1SNQA 2K05A 2VUMB 4BWGB 1STNA 1X3PA 1ZEQX 4S3SA 2D5DA 2WKDA 4DAVA 3VA5A 1I4GA 4KY5A 4MHEA 4HMJA 4RHSA 1EY9A 2NTTA 2M9VA 1STYA 3DHQA 1O7YA 3S9WA 3OHXC 1EIHA 1AZQA 2F0PA 4J1MA 2NVQB 2BE5D 2K7VA 4HN7A 1J9OA 1FGBD 5J1ZA 1PTOH 1ZXTA 5AFWA 1IYUA 5IODA 1R9TB 4Q5VA 1UEAB 2ZXPA 1I4RA 3K59A 3SK8A 4XQQA 2F0VA 2L0CA 3HP3A 3ND8A 2OXPA 3PUYA 5C0XI 1SYDA 5FO8B 4DFAA 1LO5D 1BBXC 3LNNA 2IX3A 2HQEA 4C3HG 5K36G 5M9OA 2A6ED 3H94A 3GV3A 1OXUA 2HDMA 1AP0A 3TP6A 1F9RA 4Q0FA 1BNZA 3C2PA 2CQAA 2A69C 4WORA 4A3FB 3Q23A 2A69D 5ELBA 4L8JA 5CR3A 1SE4A 1U4RA 3NPPA 1UUPA 1OO9B 5JPMC 4X3SA 1IW7C 3V96A 4OO1G 1B53A 2O4XA 2Z1CA 2NYZD 1T5EA 3MXUA 3K58A 2BDOA 3OIPA 1LABA 1G291 4Z9CB 5CGKA 1JOQA 3TSSA 1CZGA 1LV9A 5FO7B 1AFPA 4PNYA 3OOCA 4FP5D 2IL8A 2JEAI 4Y7NB 1GUNA 3D4RA 3S15B 3CKIB 4K6LA 5IGDA 4RGMA 4DXFA 5CV8A 5DNFA 3ITPA 2AQ3B 3NWSA 4HCEA 4TSSA 1B9NA 2XSCA 3S14B 1Q1BA 1CHQD 3G7LA 1R4QB 2WP8J 4K5WA 3VR5A 3NP8A 1EY7A 4G57A 4QMGA 2F0MA 2F0FA 3NTIA 4RGTA 3QB3A 1IKLA 1SNOA 1W6JA 2KA7A 3QWNA 1B1ZA 1KAAA 5JJZA 2WACA 4LMQD 3T51B 5D3IB 1MGSA 2B2YA 2E2JB 4DA2A 3IFDA 2I07B 3OSOA 3R2IA 4IN3A 2M00A 1ET6A 2SOBA 4RGOS 1EEID 1U4MA 1WD1A 4V0BA 5M3FB 2NVYB 4HSPA 3MZ5A 4H13C 1QOHA 3QIAA 1JORA 1PFNA 1HXYD 2MHVA 2D9UA 5J39A 2QCPX 1STEA 1U9RA 3Q0AA 1ENFA 3N6RA 2BOSA 3IKJA 4FO2A 5EQ0A 5C0XH 1WTPA 5M5YB 5CC4A 5KYLA 2RBMA 1TT2A 1TWGB 1EY8A 1TS5A 1S5FD 4WFN3 5JPNC 1VF7A 4RH6A 1RD9D 1SDFA 1H9MA 1EZ8A 1S5CD 1TWFB 3HGBA 1DOLA 3J7AV 1XTCD 4C3IB 4ABNA 4A3JB 2F0JA 2SDFA 3OIQA 2YU9B 2EYLA 1LTRD 1Z7TA 1HCZA 4FF4A 5I6YA 1EY5A 1V1OA 1Y8NB 2R7ZB 5ELCA 3JAML 1SXTA 3ZYYX 5KIXA 2ZXOA 2JA5B 3I3CA 3DM1A 1SEBD 2IX1A 3EQLC 1G2SA 1HFGA 3C3LA 2F03A 4JBWA 4F7XA 1Q12A 1JOKA 2LY7A 5CMDA 4IZ8A 1YNJC 1LTAD 3EJIA 4HR7B 3KK7A 3SHLA 1CK1A 4C1NK 2PQEA 2SEBD 2NZ1D 1Y1VB 2WV6D 1DYQA 1YNNC 2DN8A 3V2TA 5IGBA 3J80L 2B2TA 2Q8TA 5EKIA 4F88A 1YNND 2E74C 1RF2D 3MA2B 1V43A 2JP1A 3HOWB 3D4WA 1NAPA 4KKUA 1HPCA 1KABA 3H0GB 1I4XA 1ESRA 4HMIA 1G91A 4ID6A 1NR2A 2E2IB 2F4IA 5FKAC 3BYYB 5T1IA 1CA6A 3TP7A 3D6CA 3R2TA 1A2UA 4EQPA 1AEXA 1TY0A 4C3JB 4K2KA 1D5MC 3W2DA 1BUVT 2Q8RE 2JA7B 2JXMB 4BBSB 4I7ZC 3HOXB 2WAQB 4EGVA 3HOYB 5JEAG 4O1NA 5CORA 3OMGA 2H4OA 4TKOB 1TR5A 4BY1B 1JCKB 3FKIB 1RTOA 4EVOA 2EYFA 5DAUA 1NUCA 4B9XA 3URYA 3P75A 3PV0A 1KTKA 4KJOA 4F87A 1EL0A 2Q8IB 1F2MA 4K8IA 1EYAA 2EJMA 4KI0A 3GTOB 2IJ0A 5C4XB 1CT1D 1BXTA 3OWFA 5C4JB 2AQ2B 3K5MA 1D6EC 2X69A 1HUMA 1SMYC 2FFKB 4ZLTF 4IALA 4K6DA 2R61A 1JB3A 5ELDA 4BY7B 2EYHA 1RTNA 3SE0A 2PO4A 1RJTA 3T13A 1HRJA 3TN2A 1Y8OB 1O80A 2AWNA 4MN3A 1EWHA 1II3A 4XYOA 1BR9A 1HTPA 2L5TA 3L7ZC 2V4DA 1Z47A 3AU7A 5IOCA 2MPMA 3NSWA 1PXUA 1F9PA 2N88A 5KYIA 3PUZA 5KEEA 3NE5B 2B2VA 1HHVA 2K1BA 3QO2A 3JAME 5C3XA 5J22A 4KHZA 4DGZA 2SNSA 4XIGS 2PMZB 4H7BA 1HUNA 2I46A 1DOMA 4F8MA 1SYBA 4P2CB 1IYVA 3LWUA 3I8ZA 2FMMA 1HFNA 3M4OB 1LTSD 1FR3A 2FJ2A 2KHSA 1U4PA 3J80E 3PUWA 4BA2I 2HCIA 2F3WA 1WTWA 1Q8IA 2EJGC 3SDZA 1D2BA 1B44D 2KCCA 3GTPB 4C3HB 4V190 1SNDA 5IGCA 4KTAA 2F0EA 5JEAJ 1IKMA 5TSSA 1TS3A 2A73B 3GO5A 2DNEA 1LTGD 5T1GA 4L6TB 1Y1WB 4CGYB 3TZUA 1XX8A 4G7OC 1TWHB 1VMPA 1KLGD 2IX0A 2EPBA 3A8IE 2XWJB 1NCVA 3S2HB 1S5BD 4CHTB 1WVLA 1CM9A 1DM0B 2EYOA 4ODGA 1JC7A 3CHBD 5LHY1 2E2HB 1PFMA 2QILA 2NN6G 4DAYA 1M8AA 1F9QA 2NTSA 3DWPA 3QG1A 1TY2A 1C4QA 3A8JE 2RA4A 1CQFA 1AZPA 4YIJA 2XVSA 4XT1B 4GZYC 1UNSA 1GUOA 1F2LA 3WOFA 5D65A 5KGUA 5M5WB 3M7GA 4J6HA 4UDUC 4PQXA 3RUZA 2IWHA 4HCSA 1EYDA 2EE1A 4OO1I 2AQ1B 1I50B 4X3TA 1TWCB 1WTRA 2NBFA 1IW7D 4L63B 2MP1A 4XXEA 2ID0A 2BA1A 1WCMB 4XDXA 3ERQA 1OXXK 3GTKB 1LLRD 1SE2A 1DOKA 3S2DB 3S16B 3D3RA 1KDAA 4IUUA 2R93B 5IGFA 1O78A 3PO2B 3NHHA 2PNRC 3S17B 2DNCA 1BQQT 1CA5A 5D14A 3BDLA 5EBDA 2Z4IA 2VNUD 2JYOA 4KHVA 5FLXL 2L11A 4QB4A 1O7ZA 3CU7A 2KUMA 5E4WC 1A3UA 4FF1A 4K14A 1I3QB 2NVTB 3KBGA 4CKBA 4O42A 1ICWA 2CW0C 2OF1A 4M8AA 2EY2A 2XWBB 4DU9A 3BS1A 4G7ZC 1XWEA 2B2WA 2A5HA 5CV7A 5I2XA 1STBA 1JWMD 2B2YC 3RLFA 3T56B 2RDFA 5F2DA 1CFMA 3HRZC 2EVBA 1WTVA 3NBHA 4KJNA 2MGSA 3WOEA 2B8GA 1GUWA 2D2CC 1GJXA 3VR6A 5E4XA 3VR3A 1EYCA 1Q1EA 2O5IC 3PMFA 3BG3A 1B50A 2EYMA 1FNVA 2Z4HA 2EY1A 1BF4A 5EKKA 4UAIA 2E75C 5I9OA 2FINB 3X3NA 5I9PA 2F0HA 1A3TA 3NWTA 2JA6B 1WTXA 1V8QA 1PZID 1SYGA 5I2YA 4A3IB 4DAPA 4HSVA 4NDXA 4CKCA 5K36H 5NUCA 5BN5A 5DM63 1LACA 1B4OA 2PW7A 4KMUC 1LTID 3K5OA 4RGNA 5EBCA 1EOTA 1ONLA 1QNUA 2XRQD 1RHPA 4PMWA 2B39A 1I6HB 1GXDC 2K5DA 3K7AB 5CV9A 2LMCB 3OPOA 4OO1H 2RSNA 4K8JA 4LJZC 4DNTB 3V05A 2PZUA 2NVXB 1DONA 4IFDG 3G6JB 5COYA 2C5CA 1K83B 3BDOA 1EZ6A 3QJYA 2K04A 3GTLB 3MXGA 3W3AA 1JOOA 4OIKA 5FK9C 3DXJC 3MVVA 4XQNA 3FRPB 1DJRD 3E5SA 4K2LA 2L55A 4ZKCB 3HZXA 1TS4A 1O7LA 2B2TC 3GP7A 5G3LF 1GUSA 1YNJD 4KY6A 5CV5A 1MBYA 4G4KA 1VCIA 2IT1A 3J7YW 5IGGA 3M4YA 1JQYD 4RWSC 3K5NA 1EQTA 2AWOA 4WJWA 1Y69U 2EYPA 2NWGA 1G8ZD 2QF7A 5FLXE 4C3IG 1KDBA 1SNCA 2J4XA 3K6OA 3FVQA 3RD4A 2A74C 3NUCA 2KCNA 3ND9A 2FHTA 3SEBA 1GOZA 4LAAA 4E6IA 4TRDA 1ILQA 5CYUA 3QOLA 1DXMA 3P7JA 1OXVA 4EQOA 2CVRA 4KKSA 2EDGA 4ILWA 3BVMA 2N55A 3H3VC 3K0YA 2K28A 2F0DA 4OL7A 1VMCA 3TBIB 3A7LA 1TKWB 4XYQA 3TZDA 4BA1I 3T53B 4KN4C 1WD0A 1JE4A 3SK4A 4B08A 2RKSA 1H9KA 1E2VA 1KNAA 3GV6A 1EU3A 3Q22A 2K03A 2VXWA 1E0BA 1AW7A 4OHJA 4N9TA 1LT6D 2BA0A 1ENAA 1A15A 3H09A 4IQZA 3FEWX 4XTCS 2TMPA 2EY5A 3SXHA 2AUJD 5C5MA 1Q3LA 2OEOA 4IFDJ 3VYUA 1JR0D 1CTMA 1DD2A 1U4LA 1L0YB 4A3BB 4PMBA 2R3ZA 3TMEA 2J7ZA 2WB1B 1PYWD 2QKIC 5D3DA 2EY6A 2ZT9C 4FXGC 3MHBA 3KLSA 4C3JG 5CV4A 1SMYD 2DY7A 3A8KE 2F0UA 3MAQA 2X6GA 3BZDB 1RCVD 2NB0A 3NBIA 5I6WA 2PYKA 1EY0A 1D5XC 3HKZB 1D1IA 1BOSA 2B2VC 3NQTA 4QF4A 4NP5A 1QNKA 3C1FA 2RQXA 4M1UB 4ZK9B 3K5LA 2L12A 4H44C 5EGTA 4FF2A 4PV1C 1MSGA 2F0IA 4K5VA 1X3QA 1BDOA 5KNCA 1H9SA 1QWYA 2ICEC 1SFOB 3NK9A 1MSHA 2KEDA 2OT2A 1H9RA 3D4DA 1QCBD 1XXGA 2MJ8A 1GHKA 1TVXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EYM A;  2F3W A;  3ERQ A;  3H6M A;  4J1M A;  4KD3 A;  2RBM A;  1F2Y A;  2EY1 A;  5IGD A;  4N9T A;  5IGE A;  1TT2 A;  1EQV A;  5J1Z A;  1TQO A;  5IOD A;  1KDA A;  1EY8 A;  1STH A;  3OWF A;  5CV8 A;  1ENA A;  3ITP A;  5EKK A;  5I9O A;  5ISR A;  5IGF A;  4KY6 A;  5E1F A;  3HEJ A;  1SND A;  4EQN A;  5CV5 A;  3D4W A;  1STG A;  2F0N A;  2F0H A;  1EY4 A;  4B9W A;  1A3T A;  5E3F A;  5IGC A;  2ENB A;  4IAL A;  2F0E A;  4K6D A;  4KTA A;  3SK8 A;  3NHH A;  2EYH A;  4DF7 A;  3C1E A;  5IGG A;  2EY5 A;  3MEH A;  1KAB A;  2F0V A;  3SXH A;  1SYG A;  3SR1 A;  1RKN A;  5C5M A;  5EKL A;  2F0S A;  2NUC A;  2OXP A;  3SK6 A;  3T13 A;  4ZUJ A;  3QOJ A;  3BDL A;  2PW5 A;  3EVQ A;  3NXW A;  1SYD A;  2F0L A;  2OEO A;  4HMI A;  5HUR A;  4ID6 A;  4DFA A;  4RKL A;  1EY6 A;  1ENC A;  3D8G A;  1EZ8 A;  2SNM A;  4NDX A;  4NKL A;  1SYC A;  5K5P A;  4KHV A;  4NMZ A;  2EYP A;  2HQE A;  3ERO A;  4QB4 A;  5NUC A;  4PMB A;  1II3 A;  4IUN A;  3TME A;  4K5W A;  4WRD A;  3TP7 A;  1KDB A;  3D6C A;  2F3V A;  1SNC A;  3P1H A;  5M9O A;  3NP8 A;  1EY7 A;  5IIF A;  3NUC A;  2F0J A;  1A2U A;  2EY6 A;  4EQP A;  3TP6 A;  1AEX A;  2EYL A;  2PW7 A;  3MHB A;  2F0M A;  4G57 A;  4QMG A;  4RKB A;  1STA A;  1A3U A;  1KDC A;  5CV4 A;  5DEH A;  4N9P A;  4K2K A;  3LX0 A;  2F0F A;  5C6A A;  5I6Y A;  5IOC A;  4HTH A;  2F0U A;  4KY7 A;  3QB3 A;  2EXZ A;  1SNO A;  4WOR A;  4LAA A;  4K14 A;  4E6I A;  4TRD A;  2EYO A;  1KAA A;  4I65 A;  5I9P A;  3QOL A;  4KV6 A;  1A2T A;  4ODG A;  2WAC A;  5KYI A;  4ME5 A;  1EY5 A;  2QDB A;  4EQO A;  5CR3 A;  5KEE A;  3DMU A;  5JAV A;  2F0Q A;  1IHZ A;  2OF1 A;  1F2Z A;  5KIX A;  4PMC A;  1SNM A;  4ZUI A;  5I6W A;  2EY2 A;  2PYK A;  1EY0 A;  1SNQ A;  5CV9 A;  5C3W A;  5C3X A;  3OSO A;  4OL7 A;  2F0D A;  4DU9 A;  2M00 A;  5J22 A;  3NQT A;  3OMG A;  4NP5 A;  4QF4 A;  2PZT A;  3C1F A;  4K8J A;  5CV7 A;  2EYJ A;  1STB A;  4ZQ3 A;  2SOB A;  2SNS A;  2F0O A;  4DGZ A;  5C4H A;  2PZU A;  2O4X A;  1TR5 A;  2LKV A;  5C5L A;  3OMC A;  1NSN S;  3R3O A;  4H7B A;  4KD4 A;  4YIJ A;  3SK5 A;  3MZ5 A;  1STN A;  2RDF A;  2KQ3 A;  5F2D A;  4S3S A;  4F8M A;  1JOR A;  5EGT A;  4F7X A;  1JOK A;  1SYB A;  1EZ6 A;  3VA5 A;  4EVO A;  2EYF A;  2F0I A;  4IZ8 A;  4KY5 A;  5DAU A;  4K5V A;  1SNP A;  5JOB A;  3TP8 A;  2F0T A;  1SYE A;  1NUC A;  5KGU A;  3EJI A;  3NK9 A;  4KJN A;  4B9X A;  4HMJ A;  5C4Z A;  5HGT A;  5J39 A;  1JOO A;  5CV6 A;  3P75 A;  3BDC A;  4J6H A;  3MXP A;  5CGK A;  3SHL A;  1JOQ A;  1U9R A;  1EY9 A;  3T16 A;  4KJO A;  2F0W A;  3SK4 A;  3MVV A;  2PQE A;  3RUZ A;  3TP5 A;  2F0K A;  2KHS A;  1EYD A;  1F2M A;  2PZW A;  2RKS A;  4K5X A;  3U9O A;  5KRU A;  1STY A;  1A3V A;  2F0G A;  3DHQ A;  3V2T A;  4PNY A;  5IGB A;  1SYF A;  3D4D A;  3E5S A;  3S9W A;  4K2L A;  4K8I A;  4R8N A;  1EYC A;  1EYA A;  5CC4 A;  4MIU A;  3PMF A;  2F0P A;  3HZX A;  5KYL A; 
#chains in the Genus database with same CATH topology
 3H3V H;  3G4S A;  3GTG H;  3IL8 A;  1J8I A;  3KBX A;  5M5X B;  3X3M A;  4OXP A;  2OQ0 A;  1PZK D;  1K3R A;  5EPL A;  2B2U C;  1JWS D;  2BDN A;  2B63 H;  2VQF Q;  1RDP D;  4BY7 G;  3HOV B;  4B3S L;  2H5X A;  3I73 A;  3SR1 A;  3SGI A;  2NUC A;  2JK8 A;  3E0J A;  4GNX B;  3J81 j;  4JBM A;  2KJX A;  1S5D D;  1OXS C;  1EY6 A;  2B2U A;  1I4Q A;  1C8C A;  1FNW A;  2EIF A;  4DV6 Q;  1MJC A;  1ML0 D;  3HG9 A;  1C48 A;  1AE2 A;  3S1Q B;  4N8F A;  1T5X D;  1QB5 D;  1PMR A;  3I90 A;  4B3R Q;  2PI2 E;  3LX0 A;  1FD7 D;  3PIP 3;  2EXZ A;  2IW3 A;  3A55 A;  3BVZ A;  1ET9 A;  3Q6S A;  1JJ2 A;  1FYC A;  1T9H A;  1KNE A;  5IYC G;  2XGT A;  5IT9 c;  1HQM C;  3GTM B;  3VR2 A;  3CP0 A;  3DMU A;  1BBU A;  5JAV A;  5JEA H;  3CCM A;  4YWL A;  5C3W A;  1HNZ L;  3I4N G;  1N36 Q;  4X62 Q;  1BCP F;  1SMX A;  1MD2 D;  2ZJP A;  2BE5 C;  1XJV A;  1PRT F;  3R3O A;  4A3C G;  4KD4 A;  4RHR A;  4C1N I;  5GAH C;  1NTG A;  3TP8 A;  1SNP A;  2CFM A;  5C44 B;  4R4Q A;  4A3D B;  4CJ0 B;  5M3M B;  1XPO A;  4RA8 A;  1AE3 A;  1ROD A;  2D62 A;  2NN6 I;  5A35 A;  3KUP A;  1VQF A;  4RFB A;  3I70 A;  5DM7 3;  3T16 A;  4NB3 A;  2PZW A;  4X3U A;  3E6Z X;  3K57 A;  2ICI A;  1H95 A;  3TRZ A;  2XNA C;  3GD7 A;  2R6G A;  4Y52 H;  1Z6H A;  2Y0S E;  3BU2 A;  4DV3 Q;  5EAY A;  1SJH D;  5CBA E;  2JA8 B;  5C0X G;  1N33 L;  3GTQ B;  3DWA A;  3R8B A;  2Z8L A;  2WIN B;  3E0E A;  2DY8 A;  3NBH B;  2A6E C;  3I4M B;  1BKB A;  1V1P A;  4H0L C;  4A3E B;  3RZD H;  3HEJ A;  1A6X A;  1STG A;  3S1R B;  1QJO A;  2AMC B;  3J81 c;  1QIL A;  1EUJ A;  1EYG A;  3A5Z B;  3J7A F;  3MEH A;  4NW2 A;  1G6P A;  1M4V A;  5IP9 G;  3UI2 A;  3T1H Q;  3LWE A;  5GRO A;  1LUZ A;  4AYB E;  1X65 A;  2DJG C;  1HA5 A;  2F1M A;  3GQB A;  3VA7 A;  1Y1W G;  3CCR A;  2HUG A;  2XRS D;  3SVM A;  3CME A;  3D8G A;  1ZKO A;  2R92 H;  4DR3 Q;  1K9M C;  2SNM A;  5EJW A;  1B3A A;  1SYC A;  5IYB H;  2KBN A;  1L2F A;  2KOL A;  1F77 A;  4JG2 A;  2K5W A;  1ASZ A;  2CH4 W;  2ZTC A;  4IOA A;  1LM0 A;  2K50 A;  2H1E A;  4C2M B;  3PUX A;  1SAP A;  4R4C A;  5FLM H;  4U67 3;  1C0A A;  2A1A A;  4DNR B;  3CCE A;  2Q2T A;  4HTH A;  2HIV A;  1SRU A;  5ELO A;  4I65 A;  4BS9 A;  4G7H C;  3CRK C;  4DK0 A;  1WTO A;  4ME5 A;  4X66 Q;  4IUV A;  4TQU S;  4QL5 A;  1BCP B;  4FF3 A;  4A3B H;  2HDL A;  3D6W A;  1ESF A;  3NQI A;  1VQ7 A;  4CJ1 B;  3HOU H;  1HZC A;  1PRT B;  4QCL A;  4ZQ3 A;  5C4H A;  2EYJ A;  4RAU C;  3FMC A;  4IUR A;  3VYS A;  4U68 A;  2Y0S B;  4DR2 L;  2J0T D;  2LFN A;  5C5L A;  1V9P A;  5A2Q L;  5BN4 A;  1L1O B;  2B2W C;  2VB3 X;  4A3F G;  2KQ3 A;  1KQS A;  3KF8 A;  5JVG 3;  1ILP A;  1CI3 M;  4DR5 Q;  1HNW Q;  2F0T A;  1SYE A;  1CZW A;  3J81 i;  1LT5 D;  3JAM c;  4R8I A;  1C7Y A;  1VF5 C;  3TDQ A;  2CW0 D;  2X6L A;  3TP5 A;  3U9O A;  4K5X A;  2F0G A;  5EPK A;  4FNF A;  1VQ5 A;  4DNI A;  3A74 A;  2C9O A;  1S4Z A;  4AYB B;  1NMG A;  1XMO Q;  3CC4 A;  4MIU A;  2IPK D;  3KJP A;  1N34 Q;  2IHE A;  2Z6K A;  5IT9 L;  1F2Y A;  3KDF A;  3E3X A;  4FYD A;  4X3K A;  1SFO H;  3RZO B;  2FMC A;  3DUZ A;  4HIK A;  1WJJ A;  5E1F A;  4K0K Q;  4DV7 L;  2WKC A;  2F0N A;  1J6Q A;  2K01 A;  4QUC A;  4CBV A;  3PO2 G;  5EPJ A;  3A56 A;  3FHW A;  4R1J A;  1DZ1 A;  3J80 c;  1AN8 A;  3SK6 A;  2G9H D;  2QEX A;  3QOJ A;  3EVQ A;  2KEC A;  1FNU A;  3HS0 C;  3KLS X;  4A4I A;  4RKL A;  4OWT B;  4DK1 A;  4HJ7 A;  1WOC A;  2UXB L;  1KLU D;  4QUF A;  2CWP A;  2OCE A;  2IY5 B;  3ERO A;  3OWE B;  4HIM A;  2UUB L;  4IUN A;  4OIJ A;  1E2Z A;  3TS2 A;  2F3V A;  5LMN Q;  5IIF A;  1LT4 D;  3MWY W;  4DUY Q;  1S72 A;  1BCP C;  1STA A;  4TVA B;  4GLA C;  4DR4 L;  3P20 A;  2JJQ A;  1HA6 A;  1BCP D;  1PRT C;  2ZXR A;  1G2T A;  2JSO A;  1HZA A;  4MTK A;  1PRT D;  4FVM A;  4QY7 A;  2F4V L;  1UE7 A;  5C0X J;  2O2L D;  1SRO A;  1D5Z C;  2NN6 H;  5JVH 3;  3I4L A;  1L1O C;  4LK1 C;  4CKE A;  2HHH Q;  5CBE E;  1SNM A;  2VB2 X;  1PFS A;  2VUM H;  3J81 L;  5LMU Q;  3DWQ A;  4ZKB B;  3S1Q H;  2RDG A;  4DK3 C;  1CQV A;  4KN7 C;  2PZT A;  1HNZ Q;  2G5D A;  4R4T A;  2F0O A;  4J8Q A;  4JOI A;  1Z9F A;  4YCW A;  4HJ9 A;  1A0I A;  3OMC A;  1YEZ A;  1EWC A;  1OXT A;  4LUO A;  1S3O A;  2A19 A;  3Q24 A;  4DN4 M;  3M3Y B;  2N78 A;  4ZAI A;  4L5R C;  1K8G A;  4OON A;  3AB9 A;  1SJE D;  5KNB A;  4FDB A;  3EFX D;  3RMH A;  5C4Z A;  5HGT A;  1G51 A;  3PUV A;  1QG7 A;  2Z6B A;  3W5O A;  2A6H C;  3OW7 A;  3IAY A;  1VQM A;  1XTD A;  5FO9 B;  2F0W A;  4XQJ A;  2B8F A;  5KRU A;  1PTO F;  4JI8 L;  1A3V A;  2A6H D;  1JIC A;  1SYF A;  4IFD I;  3D0F A;  4JI7 Q;  3ONA B;  3D31 A;  3NTH A;  5C44 H;  2K5Q A;  1KRT A;  4A3D H;  5IGE A;  5M3M H;  3GTG B;  1R9T H;  4GKJ L;  1TQO A;  3T4A C;  2PQA A;  1IBK L;  1EOV A;  1YI2 A;  5ISR A;  1STH A;  3U4V A;  3H15 A;  4YWK A;  3FDT A;  1K8M A;  3BYT B;  2TSS A;  2ENB A;  2B63 B;  1B2T A;  2UUC L;  2MNA A;  4DF7 A;  2JA6 G;  2EQS A;  4HAE A;  2F0S A;  2K6A A;  3MXN A;  2JE6 I;  2EZV A;  3NXW A;  4JI5 L;  3GTQ H;  4A3I G;  3A54 A;  5HUR A;  3C46 A;  1I4H A;  1ENC A;  1UAP A;  2JA9 A;  4LFA L;  1QE6 A;  3I4M H;  2GA4 B;  2KHI A;  3I7F A;  4A3M B;  5K5P A;  4A3E H;  3MFY A;  3S1N B;  4NMZ A;  2JN4 A;  3RN2 A;  1S5E D;  2RVL A;  4PZ8 A;  4DUZ L;  4A3G B;  4JI0 L;  1CKN A;  3STB C;  1X3E A;  1X32 A;  1E2W A;  4KY7 A;  2EOT A;  2QW7 A;  4DR7 L;  4OGQ C;  5J3B A;  4RCO A;  5BR8 Q;  4FXD A;  3GTJ B;  1F2Z A;  4PMC A;  4C2M H;  1ZYR C;  3AFP A;  2L9H A;  2QEJ C;  4A3J G;  1TU2 B;  2JEB I;  3NTK A;  1ZYR D;  1HJP A;  2LKV A;  1EU4 A;  1NSN S;  1HQR D;  2HCC A;  3SK5 A;  5A2Q E;  4CDE C;  3I91 A;  4DR2 Q;  1TWA B;  3CPW A;  2A68 C;  5ELF A;  3M7N A;  3RNU A;  3KF6 B;  5JOB A;  3DEP A;  2A68 D;  1PTO B;  1R4P B;  5CV6 A;  4GS3 A;  4LF8 L;  2E76 C;  4XT3 B;  5LL6 S;  1NR4 A;  2F0K A;  3CRL C;  4A3K B;  3DEO A;  1XPU A;  3L3O C;  2PPB C;  1CHP D;  4ALP A;  4Y7N H;  4R8N A;  4KHP Q;  2FXQ A;  2L4N A;  1Q46 A;  3CCU A;  3H6M A;  4QIW E;  1PH2 A;  4A93 B;  4RG1 A;  4JK1 C;  2N8N A;  5IT9 E;  1H9S B;  1EQV A;  3VYR A;  2E2D C;  4DV1 L;  1G6Z A;  1TS2 A;  3AMU A;  2LS0 1;  1E22 A;  2I0Q A;  4GOP A;  3CQZ B;  4O0A A;  1MJE A;  4BXX G;  3HKS A;  4B9W A;  1EY4 A;  5E3F A;  3RZD B;  4B3T Q;  1GHJ A;  1YIJ A;  1IL8 A;  1B9M A;  3HKZ E;  1E1T A;  1QUQ A;  4DV7 Q;  2WII B;  4HED A;  2K33 A;  5EKL A;  3WDN A;  3S14 H;  4ZUJ A;  1WTQ A;  1D7Q A;  1YBY A;  2L1B A;  2F0L A;  4AIM A;  2V1C C;  5HY6 A;  1EFI D;  3B6Y A;  3VYT A;  3M85 A;  3RZO H;  1K8O A;  4NKL A;  2R92 B;  2K32 A;  3NEM A;  4NPS A;  2UXB Q;  2XIW A;  3P1H A;  1SBB B;  4JC0 A;  4OX9 L;  4LNQ A;  5BN3 A;  3N52 A;  5FJ8 H;  3O13 A;  4KK7 A;  5C6A A;  2ATW A;  4DKA C;  2UXD L;  3I72 A;  5IYD G;  2KVM A;  1A2T A;  4DR4 Q;  3R93 A;  4KKT A;  2K5H A;  1H9J A;  1EEF D;  1F9S A;  1I6V C;  1LTB D;  2F0Q A;  5C3E B;  2E2J H;  1LTT D;  4ZUI A;  1LT3 D;  2F4V Q;  1DGS A;  3HOZ B;  1X54 A;  3J81 E;  2RF4 A;  1EIF A;  1JWU D;  4C56 C;  1PYS B;  3HOU B;  4HJA A;  1KRS A;  4IUP A;  3H91 A;  1N32 L;  2KEE A;  1PTO C;  5M3F H;  1GUT A;  4IFD H;  4X64 L;  1Q90 A;  2XN9 C;  3W1G A;  1PTO D;  1UWV A;  4QIW B;  3IFT A;  1VQL A;  1WTH A;  2PCF B;  2KEN A;  3MC0 B;  2RSO A;  4J15 A;  4BBS G;  1I4P A;  1DCZ A;  3U9S A;  5KND A;  1HH2 P;  1HTL D;  4YHH L;  4IUT A;  3BDC A;  4DXG A;  3MXP A;  1K0R A;  3I56 A;  3PO3 B;  3AYH B;  2MUY A;  4AQY Q;  1XYI A;  3KLR A;  1PLF A;  5I4D A;  2EJF C;  3MTS A;  4P74 A;  3M3Y H;  1PFB A;  1W6K A;  4KD3 A;  1TWG H;  3BVG A;  3EIV A;  5IYB G;  1Y8P B;  1MI2 A;  2BCO A;  5FOB B;  4ZRZ A;  4ZYS A;  5IY0 A;  4EQN A;  4A76 A;  2YYZ A;  3MFG A;  2O5J C;  1IBK Q;  3U50 C;  5G3L D;  3C1E A;  1SE3 A;  2AUK A;  4IPC A;  1K0S A;  1PZJ D;  4JW0 A;  3F2U A;  1RKN A;  3VR4 A;  1GUG A;  4RCN A;  2CHB D;  1XMQ L;  2UUC Q;  2I5M X;  2PW5 A;  1PDQ A;  3K7U C;  1BO0 A;  4IOC A;  1V1Q A;  1L0X B;  2A8V A;  1QZH A;  4WJ4 A;  3A7A B;  5C4X G;  5ELE A;  1W3S A;  1XNR L;  4JI5 Q;  1TWF H;  1V1P B;  1VQE A;  1D1K A;  3HFZ B;  4A3B G;  3A0J A;  2CH4 A;  3I4N B;  4WRD A;  1SSO A;  2WB1 G;  4R9W A;  1TII D;  2YU9 H;  1E3P A;  2RDH A;  3S1M B;  1FGU A;  4BBR B;  1VDZ A;  1O7I A;  4DUZ Q;  4RKB A;  4CJ2 C;  1KDC A;  5DEH A;  4N9P A;  2G9D A;  1EIG A;  1XNQ L;  2M2L A;  4L5T A;  5LL6 X;  4IUQ A;  4YWM A;  3L9A X;  4KV6 A;  2I5H A;  2QDB A;  4ULL A;  4A3M H;  3EA6 A;  3VDY A;  3FPP A;  3FPU B;  4FXK C;  2JA5 H;  1IHZ A;  3S1N H;  1IZ6 A;  5LMN W;  3PIO 3;  1M1K C;  1SNQ A;  4A3G H;  3HKZ G;  2K05 A;  2VUM B;  3CXC A;  5JJL A;  1SR3 A;  1PH1 A;  4BWG B;  1STN A;  1X3P A;  3E9H A;  1ZEQ X;  4S3S A;  2D5D A;  2WKD A;  4DAV A;  3VA5 A;  2K75 A;  1I4G A;  4KY5 A;  5GAD C;  3NEN A;  3GTJ H;  4MHE A;  4HMJ A;  1I5F A;  1EY9 A;  4RHS A;  2NTT A;  2M9V A;  4LF8 Q;  1STY A;  3ULJ A;  3DHQ A;  2VQE L;  1O7Y A;  3S9W A;  3OHX C;  1EIH A;  1AZQ A;  3I4O A;  1TWA H;  3UE1 A;  2F0P A;  3KF8 B;  4J1M A;  2NVQ B;  2BE5 D;  2K7V A;  4HN7 A;  1NJI C;  1J9O A;  1FGB D;  5J1Z A;  1PTO H;  3HOW H;  1ZXT A;  4KLK A;  1IYU A;  5AFW A;  5IOD A;  1R9T B;  3M9B A;  2LSS A;  4Q5V A;  1UEA B;  2ZXP A;  1I4R A;  3RN5 A;  3K59 A;  4A3K H;  4DR6 Q;  4LF4 Q;  3SK8 A;  4DV5 L;  4XQQ A;  3HOV G;  3T1Y L;  3U4Z A;  3UE0 A;  1X3G A;  3H0G H;  4A75 A;  2F0V A;  2L0C A;  3HP3 A;  3ND8 A;  1VQN A;  4LFB Q;  2OXP A;  3PUY A;  2ZM6 L;  5C0X I;  4A93 H;  1SYD A;  5FO8 B;  1BVS A;  2E2I H;  1WFQ A;  4DFA A;  2KCT A;  3G6E A;  1MKH A;  1LO5 D;  4JI1 L;  1HNX Q;  1BBX C;  3LNN A;  2IX3 A;  2HQE A;  3CQZ H;  4C3H G;  4X65 L;  3RLN A;  5K36 G;  1FVI A;  2A6E D;  5M9O A;  3H94 A;  3GV3 A;  1OXU A;  2HDM A;  1AP0 A;  3TP6 A;  1F9R A;  4Q0F A;  1BNZ A;  3DLL A;  3C2P A;  3LGJ A;  2CQA A;  2A69 C;  4WOR A;  4OX9 Q;  3MEF A;  4A3F B;  1QVG A;  1KL9 A;  2JA7 H;  3Q23 A;  2A69 D;  1PH5 A;  1IL2 A;  5ELB A;  3I55 A;  4L8J A;  5CR3 A;  1SE4 A;  1U4R A;  4NXN L;  1E24 A;  3NPP A;  1UUP A;  1OO9 B;  5JPM C;  4X3S A;  1E1O A;  2IHF A;  1IW7 C;  2R7D A;  4BY1 H;  3V96 A;  4OO1 G;  1B53 A;  2O4X A;  2Z1C A;  4GNX A;  3FKI H;  2NYZ D;  4DV2 L;  4X64 Q;  1T5E A;  3MXU A;  3K58 A;  2BDO A;  3OIP A;  2UU9 Q;  1LAB A;  4A3D G;  1FL0 A;  5M3M G;  5C3E H;  1IYJ B;  1PH9 A;  1G29 1;  3EBE A;  1YHA A;  1YHB A;  2LXK A;  3HOZ H;  4Z9C B;  5CGK A;  1JOQ A;  2RHS B;  3OW2 A;  3PIO A;  2NZO A;  5IP7 H;  4YHH Q;  3TSS A;  1CZG A;  1LV9 A;  5FO7 B;  1X9N A;  1AFP A;  4PNY A;  2ZJR A;  3OOC A;  4FP5 D;  2IL8 A;  5JJK A;  2JEA I;  3GTO H;  4Y7N B;  1GUN A;  2JA8 G;  1B3Q A;  5GQO A;  3D4R A;  4GKK L;  4IO9 A;  3S15 B;  1NNX A;  3CKI B;  4K6L A;  5IGD A;  4RGM A;  3I4M G;  3TQY A;  4DXF A;  4A3E G;  5CV8 A;  5DNF A;  3ITP A;  2K52 A;  2Z6K C;  2AQ3 B;  3PO3 H;  1U0L A;  4DV0 Q;  4BY7 H;  3NWS A;  1HR0 Q;  3U58 A;  4HCE A;  4JBJ A;  4DAM A;  4TSS A;  4LF6 L;  2HD3 A;  4JYA L;  1B9N A;  2XSC A;  1WCM G;  3S14 B;  4QJF A;  1Q1B A;  4YCU A;  1CHQ D;  3G7L A;  2PQA B;  4LF7 L;  4HID A;  1R4Q B;  4LF5 L;  2WP8 J;  2R93 G;  1XNR Q;  1X3F A;  2HIX A;  3CPF A;  4K5W A;  3VR5 A;  3NP8 A;  1EY7 A;  2WFW A;  1HZ9 A;  3BZC A;  2MQH A;  4G57 A;  4QMG A;  2CCZ A;  2F0M A;  2I5L X;  2F0F A;  3NTI A;  4RGT A;  3MXN B;  1KC8 C;  4B3M L;  3QB3 A;  1IKL A;  1SNO A;  1W6J A;  2KA7 A;  3QWN A;  1B1Z A;  1KAA A;  4B3S Q;  5JJZ A;  5IYC H;  1M90 C;  1LYL A;  2WAC A;  1XNQ Q;  1PH4 A;  4LMQ D;  3T51 B;  5D3I B;  1A8V A;  1MGS A;  2B2Y A;  3I4N H;  2E2J B;  4DA2 A;  3IFD A;  1PH7 A;  3R2I A;  2I07 B;  3OSO A;  4IN3 A;  1P16 A;  2M00 A;  3S1M H;  4BBR H;  1ET6 A;  1CKM A;  2PI2 A;  2SOB A;  1EEI D;  4RGO S;  1U4M A;  2Y0S G;  1WD1 A;  4V0B A;  1VS0 A;  4A3C H;  5M3F B;  2NVY B;  5DLQ E;  4HSP A;  3MZ5 A;  4H13 C;  3TRE A;  1QOH A;  3PF5 A;  3QIA A;  3UDX A;  1JOR A;  4LF9 L;  3CMA A;  3J7A 5;  4CDD C;  4JOI C;  2KCM A;  1GD7 A;  1PFN A;  3JAM i;  1HXY D;  2MHV A;  4UP8 A;  3K0X A;  3OYY A;  3M4O H;  2D9U A;  5J39 A;  1NMF A;  2UXC L;  2QCP X;  1STE A;  2BH8 A;  2XTI A;  1U9R A;  4JPB W;  1SE8 A;  3Q0A A;  1ENF A;  3N6R A;  2BOS A;  2DUD A;  3IKJ A;  4FO2 A;  4AYB G;  1J5E L;  1ASY A;  5EQ0 A;  5C0X H;  1WTP A;  5M5Y B;  5CC4 A;  5KYL A;  2VQE Q;  2RBM A;  1K3B C;  1TT2 A;  3GTP H;  1TWG B;  2P5Z X;  4RMF A;  1EY8 A;  3CC7 A;  1TS5 A;  4LFC L;  4JI6 L;  1W2B A;  1S5F D;  3J80 i;  4WFN 3;  5JPN C;  3L2P A;  1VF7 A;  5IP9 H;  1YJ9 A;  4RH6 A;  1Y1W H;  4OWX B;  1RD9 D;  2NVQ H;  1SDF A;  4A3L H;  1TWH H;  3DM3 A;  3WWV A;  1MHW C;  1H9M A;  1EZ8 A;  1S5C D;  1N33 Q;  3PSI A;  1TWF B;  3HGB A;  1DOL A;  3J7A V;  4P73 A;  3F2C A;  1XTC D;  4JI1 Q;  4C3I B;  1EQQ A;  2K4K A;  1K73 C;  4ABN A;  4A3J B;  2F0J A;  2SDF A;  3OIQ A;  2YU9 B;  4X65 Q;  2EYL A;  1HZB A;  1LTR D;  1Z7T A;  1FJG L;  1HCZ A;  4FF4 A;  5I6Y A;  2RCF A;  4P71 A;  1KD1 C;  3CCV A;  1EY5 A;  1V1O A;  1Y8N B;  2N3S A;  2R7Z B;  5ELC A;  3JAM L;  1SXT A;  3ZYY X;  5KIX A;  2ZXO A;  2JA5 B;  3I3C A;  4NXN Q;  4DR1 L;  3DM1 A;  1SEB D;  2IX1 A;  3EQL C;  1G2S A;  1HFG A;  3C3L A;  2F03 A;  4A3F H;  3STB D;  4JBW A;  4F7X A;  1Q12 A;  1JOK A;  2LY7 A;  5CMD A;  4IZ8 A;  3F2B A;  1YNJ C;  2OWO A;  1LTA D;  2VQF L;  5M5W H;  3EJI A;  4HR7 B;  2WAQ E;  3KK7 A;  5E7N A;  1GO3 E;  3SHL A;  1CK1 A;  4C1N K;  2PQE A;  1I50 H;  4MTN A;  2SEB D;  1TWC H;  1Y1V B;  2NZ1 D;  1VQ9 A;  2WV6 D;  1DYQ A;  1YNN C;  2DN8 A;  3V2T A;  5IGB A;  3J80 L;  2B2T A;  3KJO A;  2Q8T A;  5EKI A;  4F88 A;  1YNN D;  2E74 C;  2ALY B;  4APV A;  1RF2 D;  3GTK H;  4DV6 L;  2VW9 A;  3MA2 B;  1VQP A;  3S2D H;  1V43 A;  1PH8 A;  2JP1 A;  3HOW B;  4B3R L;  3D4W A;  3NEL A;  1UE5 A;  3OTO L;  2B63 G;  2CWA A;  2ES2 A;  1PH6 A;  1NAP A;  4KKU A;  1HPC A;  1KAB A;  4GOP C;  4POF A;  3H0G B;  1I4X A;  1ESR A;  1JB7 A;  3S15 H;  4DV4 L;  1GVP A;  4HMI A;  1G91 A;  1CUK A;  4ID6 A;  4LF6 Q;  4JYA Q;  1NR2 A;  2E2I B;  2F4I A;  5FKA C;  4IPD A;  4WJ3 M;  2HT1 A;  3BYY B;  2KHJ A;  3BZK A;  2F3I A;  5T1I A;  1CA6 A;  3TP7 A;  3D6C A;  4LF5 Q;  1IXR A;  3R2T A;  1A2U A;  4EQ5 A;  4EQP A;  1AEX A;  1TY0 A;  4C3J B;  4K2K A;  1D5M C;  2NVT H;  3W2D A;  1BUV T;  1QVC A;  2Q8R E;  3ULP A;  4B3M Q;  2JA7 B;  2JXM B;  4BBS B;  4I7Z C;  1B7Y B;  2CQO A;  4X6A H;  3HOX B;  2WAQ B;  4EGV A;  3HOY B;  5JEA G;  1JE5 A;  4O1N A;  5COR A;  3OMG A;  4NXM L;  2H4O A;  2LXJ A;  4HJ8 A;  4TKO B;  2UUB Q;  1TR5 A;  4BY1 B;  3CD6 A;  1JCK B;  1VQC A;  3FKI B;  1RTO A;  4EVO A;  3G71 A;  2EYF A;  5DAU A;  1IBL L;  4HIO A;  1KIX A;  1NUC A;  4B9X A;  4ZCK A;  3URY A;  3P75 A;  1VQ4 A;  3PV0 A;  1KTK A;  3S24 A;  4KJO A;  4F87 A;  1Q82 C;  1EL0 A;  2Q8I B;  4P72 A;  1F2M A;  2QGQ A;  4I7A A;  2NVY H;  4K8I A;  1EYA A;  2EJM A;  4KI0 A;  4A93 G;  1VQG A;  3GTO B;  2IJ0 A;  5C4X B;  4L5S A;  1CT1 D;  1BXT A;  3OWF A;  5C4J B;  2AQ2 B;  1Q7Y C;  2UUA L;  3K5M A;  1D6E C;  2X69 A;  1HUM A;  1SMY C;  2FFK B;  4ZLT F;  4IAL A;  4K6D A;  2R61 A;  1JB3 A;  1VQH A;  3IRB A;  1S40 A;  5ELD A;  4BY7 B;  2EYH A;  1RTN A;  3SE0 A;  2PO4 A;  1RJT A;  5M5Y H;  3T13 A;  2R7F A;  4X66 L;  1YJN A;  4JI8 Q;  4A3I H;  1HRJ A;  2Q2H A;  3TN2 A;  1Y8O B;  3KF6 A;  2L15 A;  2ZTE A;  1O80 A;  4CDC C;  2AWN A;  4GN5 A;  4MN3 A;  2R92 G;  1EWH A;  1L0W A;  2OQK A;  1HR0 W;  1II3 A;  4UHV A;  4XYO A;  4JV5 L;  3G48 A;  4GKJ Q;  4ME3 A;  1BR9 A;  1HTP A;  2L5T A;  2MFI A;  3L7Z C;  1TXY A;  2V4D A;  1Z47 A;  3AU7 A;  5IOC A;  5FLM G;  4AH6 A;  2MPM A;  4PZ6 A;  3NSW A;  1PXU A;  1F9P A;  2N88 A;  1PVO A;  5KYI A;  4OWW B;  3PUZ A;  5KEE A;  3NE5 B;  1I6H H;  2B2V A;  1HHV A;  5C3E G;  3K7A H;  2K1B A;  3QO2 A;  3JAM E;  4LFA Q;  5C3X A;  4C3I H;  3ULL A;  4UY8 C;  4A3J H;  3HOU G;  5J22 A;  4KHZ A;  1XMO L;  2NVX H;  4DGZ A;  2SNS A;  3AQQ A;  1Q81 C;  4XIG S;  2PMZ B;  4DR1 Q;  4YCV A;  4JI0 Q;  4H7B A;  2Z9H A;  1HUN A;  4P75 A;  2I46 A;  1DOM A;  4F8M A;  1K8A C;  3ZJY C;  1SYB A;  2GVB A;  3GTL H;  4P2C B;  1IYV A;  1BBW A;  3LWU A;  4K0K L;  2R7Z H;  2DJF C;  4DR7 Q;  3I8Z A;  2FMM A;  1PH3 A;  1HFN A;  3M4O B;  1LTS D;  1FR3 A;  5FLX c;  2FJ2 A;  3PO3 G;  1X56 A;  2KHS A;  1U4P A;  2RCN A;  5AJ3 L;  3J80 E;  1EWI A;  2HQL A;  1VQD A;  3PUW A;  4BA2 I;  2NZH A;  1PHJ A;  2HCI A;  2F3W A;  4LWC A;  1WTW A;  1Q8I A;  2B3G A;  2EJG C;  3SDZ A;  1D2B A;  1B44 D;  2KCC A;  5LMN L;  3GTP B;  1Q8K A;  4DUY L;  4C3H B;  4BXX H;  4V19 0;  1SND A;  1NY4 A;  4GN4 B;  1Y1V H;  5IGC A;  3RLO A;  1JJC B;  2F0E A;  4KTA A;  5JEA J;  4POG A;  1IKM A;  1I94 L;  4R4O A;  1VQK A;  5TSS A;  1TS3 A;  2A73 B;  3GO5 A;  3OTO Q;  2DNE A;  1U5K A;  1LTG D;  5T1G A;  4L6T B;  1Y1W B;  2HHH L;  4CGY B;  3TZU A;  4QGU A;  5LMU L;  1XX8 A;  4G7O C;  4DV4 Q;  2E5L L;  1TWH B;  1VMP A;  1KLG D;  2IX0 A;  2EPB A;  1YHQ A;  3A8I E;  1JT8 A;  2XWJ B;  3E9I A;  4DV1 Q;  1YZ6 A;  1NCV A;  3S2H B;  4BBR G;  1UE6 A;  2N49 A;  1S5B D;  1K28 A;  4CHT B;  1WVL A;  1CM9 A;  1DM0 B;  3A5U A;  5IYD H;  2EYO A;  1JJG A;  1UE1 A;  4ODG A;  1SLJ A;  3KDF B;  1JC7 A;  4PG3 A;  3CHB D;  5LHY 1;  2E2H B;  1PFM A;  2QIL A;  2NN6 G;  4DAY A;  1M8A A;  1F9Q A;  2VUM G;  2NTS A;  3DWP A;  4JI7 L;  3QG1 A;  3JC6 6;  1C4Q A;  1TY2 A;  3A8J E;  2RA4 A;  4C3J H;  2VZA A;  1CQF A;  1AZP A;  4NXM Q;  4YIJ A;  2XVS A;  4XT1 B;  2EXD A;  3ERS X;  1ICF B;  4GZY C;  1UNS A;  4BBS H;  1GUO A;  1F2L A;  3WOF A;  5ELN A;  1A63 A;  2UXD Q;  3HOX H;  4GNX C;  5D65 A;  1B8A A;  5KGU A;  3HOY H;  1X6O A;  3QR8 A;  1IBL Q;  5M5W B;  3M7G A;  4J6H A;  1GKH A;  4UDU C;  4PQX A;  3CAM A;  3RUZ A;  2IWH A;  4HCS A;  1EYD A;  2EE1 A;  1CSP A;  2AQ1 B;  1I50 B;  4JI2 L;  4X3T A;  4OO1 I;  1TWC B;  1WTR A;  4EX5 A;  2NBF A;  3EN2 A;  5IWA L;  1IW7 D;  4L63 B;  2MP1 A;  4XXE A;  2ID0 A;  1N32 Q;  2BA1 A;  1WCM B;  1UEB A;  4XDX A;  3ERQ A;  4A3L G;  1OXX K;  3GTK B;  1QZG A;  1LLR D;  1SE2 A;  1DOK A;  5C44 G;  4IPH A;  3S2D B;  1Q86 C;  3S16 B;  3D3R A;  1KDA A;  4IUU A;  2R93 B;  3CC2 A;  5IGF A;  1YIT A;  1O78 A;  3PO2 B;  3PGZ A;  2UUA Q;  3NHH A;  2PNR C;  3PCO B;  3S17 B;  2DNC A;  1BQQ T;  1CA5 A;  3M4P A;  4DK6 C;  5D14 A;  5BR8 L;  3BDL A;  1NBW A;  4LUZ A;  5C4X H;  2ZTD A;  5EBD A;  2Z4I A;  2VNU D;  2JYO A;  5C4J H;  4KHV A;  4QQB X;  5FLX L;  2L11 A;  4QB4 A;  1O7Z A;  3CU7 A;  2KUM A;  3K8A A;  4JV5 Q;  5E4W C;  1A3U A;  4OEM B;  4LW1 A;  4FF1 A;  4K14 A;  2AHO B;  1CKO A;  1I3Q B;  2NVT B;  3KBG A;  3PIP A;  1XMQ Q;  2VL6 A;  4GN3 B;  4CKB A;  2GVA A;  4O42 A;  1ICW A;  2CW0 C;  2OF1 A;  4M8A A;  2EY2 A;  4YY3 L;  3BJU A;  2XWB B;  4DU9 A;  3BS1 A;  4PZ7 A;  4G7Z C;  1XWE A;  2B2W A;  2A5H A;  4KHP L;  5CV7 A;  5I2X A;  3UDI A;  1STB A;  3Q8D A;  1JWM D;  2B2Y C;  3RLF A;  3T56 B;  2RDF A;  5F2D A;  1CFM A;  4DPG A;  3HRZ C;  2Q2I A;  4UPA A;  2EVB A;  1WTV A;  1YJW A;  4B3T L;  3NBH A;  4KJN A;  2CKZ B;  2MGS A;  3WOE A;  5GAG C;  1VQO A;  2B8G A;  1GUW A;  1D8L A;  2D2C C;  1VQI A;  1CKN B;  1GJX A;  3PF4 A;  1Y14 B;  4IJL A;  3VR6 A;  5E4X A;  3VR3 A;  3CW2 C;  1VQ8 A;  1EYC A;  5AJ3 Q;  1Q1E A;  2O5I C;  3PMF A;  3BG3 A;  2OTL A;  1B50 A;  5M5X H;  2EYM A;  1FNV A;  2Z4H A;  2EY1 A;  1BF4 A;  5EKK A;  4UAI A;  2E75 C;  5I9O A;  5L37 A;  3UDG A;  3M4Q A;  2FIN B;  4UP7 A;  4LUV A;  3X3N A;  5I9P A;  2F0H A;  5JJI A;  2F52 A;  1A3T A;  2Q2U A;  3HOV H;  4JCV E;  2C35 B;  3NWT A;  4H02 A;  2JA6 B;  5IE8 A;  1WTX A;  1V8Q A;  1PZI D;  1SYG A;  2YTY A;  1I94 Q;  3KFU A;  5I2Y A;  4JI4 L;  2AKW B;  2Z0S A;  3F1Z A;  4A3I B;  1QVF A;  4O2D A;  3K81 C;  2VY3 A;  4DAP A;  4HSV A;  4NDX A;  4CKC A;  4C3H H;  5K36 H;  2K5V A;  5NUC A;  5BN5 A;  2E5L Q;  5DM6 3;  1LAC A;  1B4O A;  2PW7 A;  4KMU C;  2YTX A;  1LTI D;  3K5O A;  4RGN A;  2RHQ B;  5EBC A;  1EOT A;  5FJ8 G;  4DV5 Q;  1ONL A;  1QNU A;  3T1Y Q;  1L1O A;  2XRQ D;  3I2Z A;  3AEV A;  3TS0 A;  1RHP A;  3GTM H;  4PMW A;  2ZM6 Q;  2B39 A;  4N8X 1;  1C9O A;  1I6H B;  2QDL A;  1GXD C;  2K5D A;  3K7A B;  3FP9 A;  4AQY L;  5CV9 A;  1N8R C;  4GOP B;  3S2H H;  2LMC B;  1KXL A;  3OPO A;  1A62 A;  1YNX A;  4OO1 H;  2RSN A;  4K8J A;  4LJZ C;  4DNT B;  3V05 A;  1QUQ B;  3J7Z C;  2PZU A;  2NVX B;  1DON A;  5M3F G;  4IFD G;  3G6J B;  5COY A;  2C5C A;  1K83 B;  3BDO A;  1EZ6 A;  3QJY A;  3RR5 A;  3CF5 A;  2K04 A;  4JI3 L;  3GTL B;  2E2H H;  3MXG A;  3W3A A;  1JOO A;  4OIK A;  1GM5 A;  5FK9 C;  1IBM L;  3DXJ C;  3MVV A;  5GAE C;  4XQN A;  3FRP B;  1N9W A;  1DJR D;  3GDE A;  3E5S A;  4HJ5 A;  4K2L A;  3K80 C;  2JA8 H;  2L55 A;  4JI2 Q;  4ZKC B;  3HZX A;  1TS4 A;  1O7L A;  5IWA Q;  2B2T C;  3GP7 A;  4DV2 Q;  3UDF A;  5G3L F;  3S1R H;  1GUS A;  1YNJ D;  4KY6 A;  5CV5 A;  1LTL A;  4UP9 A;  1VQA A;  5H1S E;  1MBY A;  2E8G A;  4G4K A;  1VCI A;  2B29 A;  2IT1 A;  5IGG A;  3J7Y W;  1PV4 A;  5HGQ A;  3M4Y A;  1WCM H;  1JQY D;  4RWS C;  3K5N A;  4IJH A;  3CCL A;  1EQT A;  2AWO A;  1VQ6 A;  3H3V I;  4IPG A;  1NE3 A;  1CSQ A;  3S16 H;  4WJW A;  2R93 H;  1Y69 U;  4GKK Q;  2EYP A;  2NWG A;  4JVZ A;  1G8Z D;  2QF7 A;  5FLX E;  4C3I G;  1EIY B;  2DGY A;  1KDB A;  1SNC A;  3PO2 H;  2J4X A;  3K6O A;  3FVQ A;  1KAW A;  3RD4 A;  2A74 C;  2D0O A;  3NUC A;  2KCN A;  3S17 H;  3ND9 A;  1RL2 A;  2FHT A;  3SEB A;  1B70 B;  1GOZ A;  1E7Z A;  1P8L A;  4LAA A;  2YV5 A;  4E6I A;  4TRD A;  1ILQ A;  5CYU A;  3QOL A;  1DXM A;  3P7J A;  1OXV A;  4EQO A;  2CVR A;  4KKS A;  2R7Z G;  4A3M G;  2EDG A;  2JA5 G;  4ILW A;  1N36 L;  4X62 L;  3BVM A;  2N55 A;  4L5Q A;  3H3V C;  4LF7 Q;  3PQI A;  3K0Y A;  2K28 A;  2F0D A;  4OL7 A;  4A3G G;  1KHI A;  1YVC A;  2WB1 E;  4YY3 Q;  1VMC A;  3KYH C;  3TBI B;  3A7L A;  3F2D A;  1I3Q H;  1TKW B;  1JMC A;  3ICE A;  3KLW A;  4XYQ A;  3TZD A;  4BA1 I;  2D0P A;  4DR6 L;  4LF4 L;  3T53 B;  3F8T A;  1X55 A;  4KN4 C;  1WD0 A;  3CCJ A;  1JE4 A;  3SK4 A;  4LFB L;  4B08 A;  1Y1V G;  2RKS A;  1H9K A;  4DV3 L;  1E2V A;  2OTJ A;  1KNA A;  3GV6 A;  1EU3 A;  3Q22 A;  2K03 A;  2YTV A;  2VXW A;  1E0B A;  1EFW A;  1HNX L;  3W1B A;  1AW7 A;  4OHJ A;  4N9T A;  1LT6 D;  2BA0 A;  1SN8 A;  3HOW G;  2ASB A;  4LF9 Q;  1ENA A;  1A15 A;  3CCQ A;  2GN5 A;  3H09 A;  4IQZ A;  4OEL B;  3ER0 A;  4JBK A;  4MZ9 A;  3T1H L;  3FEW X;  4A3K G;  2UXC Q;  3CCS A;  4XTC S;  4CDF C;  2TMP A;  2EY5 A;  2ZJQ A;  3SXH A;  2QA4 A;  2AUJ D;  5C5M A;  3H0G G;  2PMZ E;  3TEH B;  4DR3 L;  1Q3L A;  1VQB A;  2OEO A;  4IFD J;  3VYU A;  1JR0 D;  1CTM A;  1DD2 A;  1J5E Q;  2PNH A;  1U4L A;  2JQO A;  4JI4 Q;  1L0Y B;  3AFQ A;  4A3B B;  4PMB A;  2MO1 A;  2R3Z A;  3TME A;  2J7Z A;  2WB1 B;  1PYW D;  2QKI C;  5D3D A;  2EY6 A;  2ZT9 C;  4FXG C;  2VS1 A;  2JA6 H;  1PYB A;  3MHB A;  4LFC Q;  3KLS A;  4JI6 Q;  4C3J G;  5CV4 A;  1SMY D;  2DY7 A;  2UU9 L;  3A8K E;  2F0U A;  1VQJ A;  3MAQ A;  2X6G A;  3BZD B;  2JA7 G;  4R4I A;  1RCV D;  1AH9 A;  2NB0 A;  3NBI A;  1WI5 A;  3HOX G;  2WAQ G;  3HOY G;  5I6W A;  2PYK A;  1EY0 A;  1EQR A;  1RIP A;  1D5X C;  3HKZ B;  1D1I A;  1BOS A;  2B2V C;  4GLX A;  3NQT A;  4NP5 A;  4QF4 A;  1QNK A;  3C1F A;  2RQX A;  4M1U B;  4BY1 G;  4ZK9 B;  2K14 A;  4GLV B;  2L12 A;  3K5L A;  4H44 C;  4DR5 L;  1HNW L;  1MIU A;  3FKI G;  5EGT A;  4FF2 A;  1FJG Q;  4PV1 C;  1PA6 A;  1MSG A;  1OTC A;  2F0I A;  4K5V A;  1X3Q A;  1BDO A;  3KOJ A;  3L0O A;  1H9S A;  5KNC A;  1QWY A;  1XPR A;  4DV0 L;  2ICE C;  1SFO B;  3NK9 A;  1HR0 L;  1MSH A;  4DAY B;  2KED A;  2MO0 A;  4JI3 Q;  2K5N A;  3HOZ G;  2OT2 A;  5IP7 G;  1H9R A;  1IBM Q;  3D4D A;  1N34 L;  1QCB D;  2BH2 A;  1WYD A;  1K83 H;  1XXG A;  2MJ8 A;  1GHK A;  4MNO A;  1TVX A; 
#chains in the Genus database with same CATH homology
 3IL8 A;  1J8I A;  3KBX A;  5M5X B;  3X3M A;  1PZK D;  5EPL A;  2B2U C;  1JWS D;  2BDN A;  1RDP D;  3HOV B;  3I73 A;  3SR1 A;  2NUC A;  3E0J A;  2KJX A;  1S5D D;  1OXS C;  1EY6 A;  2B2U A;  1I4Q A;  1C8C A;  1FNW A;  1ML0 D;  3HG9 A;  1C48 A;  3S1Q B;  1T5X D;  1QB5 D;  1PMR A;  3I90 A;  3LX0 A;  1FD7 D;  3PIP 3;  2EXZ A;  2IW3 A;  3A55 A;  3BVZ A;  1ET9 A;  3Q6S A;  1FYC A;  1KNE A;  1HQM C;  3GTM B;  3VR2 A;  3DMU A;  5JAV A;  5JEA H;  5C3W A;  1BCP F;  1MD2 D;  2BE5 C;  1PRT F;  3R3O A;  4KD4 A;  4RHR A;  4C1N I;  3TP8 A;  1SNP A;  5C44 B;  4A3D B;  4CJ0 B;  5M3M B;  4RA8 A;  2D62 A;  1ROD A;  2NN6 I;  5A35 A;  3KUP A;  4RFB A;  3I70 A;  5DM7 3;  3T16 A;  2PZW A;  4X3U A;  3E6Z X;  3K57 A;  2ICI A;  2XNA C;  3GD7 A;  2R6G A;  1Z6H A;  5CBA E;  1SJH D;  2JA8 B;  5C0X G;  3GTQ B;  3DWA A;  3R8B A;  2Z8L A;  2WIN B;  2DY8 A;  3I4M B;  2A6E C;  1V1P A;  4H0L C;  4A3E B;  3HEJ A;  1A6X A;  1STG A;  3S1R B;  1QJO A;  1QIL A;  3J7A F;  3MEH A;  4NW2 A;  1M4V A;  3UI2 A;  3LWE A;  3VA7 A;  1HA5 A;  2F1M A;  3GQB A;  2HUG A;  2XRS D;  3SVM A;  3D8G A;  1ZKO A;  2SNM A;  5EJW A;  1B3A A;  1SYC A;  2KOL A;  1F77 A;  2K5W A;  4C2M B;  2H1E A;  3PUX A;  1SAP A;  4U67 3;  4DNR B;  4HTH A;  4I65 A;  4BS9 A;  4G7H C;  3CRK C;  4DK0 A;  1WTO A;  4ME5 A;  4IUV A;  4TQU S;  1BCP B;  4FF3 A;  2HDL A;  3D6W A;  1ESF A;  3NQI A;  4CJ1 B;  1PRT B;  4QCL A;  4ZQ3 A;  5C4H A;  2EYJ A;  4RAU C;  3FMC A;  4IUR A;  3VYS A;  4U68 A;  2Y0S B;  2J0T D;  2LFN A;  5C5L A;  5A2Q L;  5BN4 A;  2VB3 X;  2B2W C;  2KQ3 A;  3KF8 A;  5JVG 3;  1ILP A;  1CI3 M;  2F0T A;  1SYE A;  1CZW A;  1LT5 D;  4R8I A;  1VF5 C;  3TDQ A;  2CW0 D;  2X6L A;  3TP5 A;  3U9O A;  4K5X A;  2F0G A;  5EPK A;  4FNF A;  2C9O A;  1S4Z A;  4AYB B;  4MIU A;  2IPK D;  5IT9 L;  1F2Y A;  4FYD A;  4X3K A;  3RZO B;  2FMC A;  3DUZ A;  5E1F A;  2WKC A;  2F0N A;  2K01 A;  4QUC A;  4CBV A;  5EPJ A;  3A56 A;  1DZ1 A;  1AN8 A;  3SK6 A;  2G9H D;  3QOJ A;  3EVQ A;  2KEC A;  1FNU A;  3HS0 C;  3KLS X;  4RKL A;  4DK1 A;  1KLU D;  4QUF A;  3ERO A;  3OWE B;  4IUN A;  4OIJ A;  1E2Z A;  2F3V A;  5IIF A;  1LT4 D;  3MWY W;  1BCP C;  1STA A;  3P20 A;  1HA6 A;  1BCP D;  1PRT C;  2ZXR A;  1G2T A;  2JSO A;  1PRT D;  4FVM A;  5C0X J;  2O2L D;  1D5Z C;  2NN6 H;  5JVH 3;  3I4L A;  4LK1 C;  4CKE A;  5CBE E;  1SNM A;  2VB2 X;  3J81 L;  3DWQ A;  4ZKB B;  2RDG A;  1CQV A;  4KN7 C;  2PZT A;  2F0O A;  4J8Q A;  3OMC A;  1EWC A;  1OXT A;  3Q24 A;  4DN4 M;  3M3Y B;  4ZAI A;  3AB9 A;  1SJE D;  5KNB A;  3EFX D;  3RMH A;  5C4Z A;  5HGT A;  3PUV A;  1QG7 A;  2A6H C;  3OW7 A;  3IAY A;  5FO9 B;  2F0W A;  4XQJ A;  2B8F A;  5KRU A;  1PTO F;  1A3V A;  2A6H D;  1JIC A;  1SYF A;  4IFD I;  3ONA B;  3D31 A;  3NTH A;  2K5Q A;  5IGE A;  3GTG B;  1TQO A;  3T4A C;  5ISR A;  1STH A;  3FDT A;  1K8M A;  3BYT B;  2TSS A;  2ENB A;  2B63 B;  1B2T A;  4DF7 A;  4HAE A;  2F0S A;  2K6A A;  3MXN A;  2JE6 I;  2EZV A;  3NXW A;  3A54 A;  5HUR A;  3C46 A;  1I4H A;  1ENC A;  1UAP A;  1QE6 A;  2GA4 B;  4A3M B;  5K5P A;  3MFY A;  3S1N B;  4NMZ A;  1S5E D;  2RVL A;  4A3G B;  1X32 A;  1E2W A;  4KY7 A;  2EOT A;  4OGQ C;  4RCO A;  4FXD A;  3GTJ B;  1F2Z A;  4PMC A;  1ZYR C;  2L9H A;  2QEJ C;  1TU2 B;  2JEB I;  3NTK A;  1ZYR D;  2LKV A;  1EU4 A;  1NSN S;  1HQR D;  2HCC A;  3SK5 A;  5A2Q E;  3I91 A;  1TWA B;  2A68 C;  5ELF A;  3M7N A;  5JOB A;  3DEP A;  2A68 D;  1PTO B;  1R4P B;  5CV6 A;  2E76 C;  4XT3 B;  5LL6 S;  1NR4 A;  2F0K A;  3CRL C;  4A3K B;  3DEO A;  3L3O C;  2PPB C;  1CHP D;  4R8N A;  2L4N A;  3H6M A;  4A93 B;  4JK1 C;  5IT9 E;  1H9S B;  1EQV A;  3VYR A;  2E2D C;  1G6Z A;  1TS2 A;  3AMU A;  2LS0 1;  3CQZ B;  4B9W A;  1EY4 A;  5E3F A;  3RZD B;  1GHJ A;  1IL8 A;  1B9M A;  2WII B;  4HED A;  2K33 A;  5EKL A;  3WDN A;  4ZUJ A;  1WTQ A;  2L1B A;  2F0L A;  1EFI D;  3VYT A;  3M85 A;  1K8O A;  4NKL A;  2R92 B;  2K32 A;  2XIW A;  3P1H A;  1SBB B;  5BN3 A;  3N52 A;  3O13 A;  4KK7 A;  5C6A A;  3I72 A;  2KVM A;  1A2T A;  3R93 A;  4KKT A;  1H9J A;  1EEF D;  1F9S A;  1I6V C;  1LTB D;  2F0Q A;  5C3E B;  1LTT D;  4ZUI A;  1LT3 D;  3HOZ B;  3J81 E;  1JWU D;  4C56 C;  3HOU B;  4IUP A;  3H91 A;  2KEE A;  1PTO C;  1GUT A;  4IFD H;  1Q90 A;  2XN9 C;  1PTO D;  4QIW B;  3IFT A;  2PCF B;  3MC0 B;  2RSO A;  1I4P A;  1DCZ A;  3U9S A;  5KND A;  1HTL D;  4IUT A;  3BDC A;  4DXG A;  3MXP A;  3PO3 B;  2MUY A;  1XYI A;  3KLR A;  1PLF A;  5I4D A;  2EJF C;  3MTS A;  1PFB A;  1W6K A;  4KD3 A;  3BVG A;  1Y8P B;  1MI2 A;  2BCO A;  5FOB B;  4ZRZ A;  4ZYS A;  4EQN A;  2YYZ A;  3MFG A;  2O5J C;  5G3L D;  3C1E A;  1SE3 A;  2AUK A;  1PZJ D;  3F2U A;  1RKN A;  3VR4 A;  1GUG A;  4RCN A;  2CHB D;  2PW5 A;  1PDQ A;  1BO0 A;  1L0X B;  3A7A B;  5ELE A;  1V1P B;  1D1K A;  3I4N B;  4WRD A;  1SSO A;  4R9W A;  1TII D;  2RDH A;  3S1M B;  4BBR B;  1VDZ A;  4RKB A;  4CJ2 C;  1KDC A;  5DEH A;  4N9P A;  2G9D A;  1EIG A;  2M2L A;  5LL6 X;  4IUQ A;  3L9A X;  4KV6 A;  2QDB A;  4ULL A;  3EA6 A;  3FPP A;  3FPU B;  4FXK C;  1IHZ A;  3PIO 3;  1SNQ A;  2K05 A;  2VUM B;  4BWG B;  1STN A;  1X3P A;  1ZEQ X;  4S3S A;  2D5D A;  2WKD A;  4DAV A;  3VA5 A;  1I4G A;  4KY5 A;  4MHE A;  4HMJ A;  4RHS A;  1EY9 A;  2NTT A;  2M9V A;  1STY A;  3DHQ A;  1O7Y A;  3S9W A;  3OHX C;  1EIH A;  1AZQ A;  2F0P A;  4J1M A;  2NVQ B;  2BE5 D;  2K7V A;  4HN7 A;  1J9O A;  1FGB D;  5J1Z A;  1PTO H;  1ZXT A;  5AFW A;  1IYU A;  5IOD A;  1R9T B;  4Q5V A;  1UEA B;  2ZXP A;  1I4R A;  3K59 A;  3SK8 A;  4XQQ A;  2F0V A;  2L0C A;  3HP3 A;  3ND8 A;  2OXP A;  3PUY A;  5C0X I;  1SYD A;  5FO8 B;  4DFA A;  1LO5 D;  1BBX C;  3LNN A;  2IX3 A;  2HQE A;  4C3H G;  5K36 G;  5M9O A;  2A6E D;  3H94 A;  3GV3 A;  1OXU A;  2HDM A;  1AP0 A;  3TP6 A;  1F9R A;  4Q0F A;  1BNZ A;  3C2P A;  2CQA A;  2A69 C;  4WOR A;  4A3F B;  3Q23 A;  2A69 D;  5ELB A;  4L8J A;  5CR3 A;  1SE4 A;  1U4R A;  3NPP A;  1UUP A;  1OO9 B;  5JPM C;  4X3S A;  1IW7 C;  3V96 A;  4OO1 G;  1B53 A;  2O4X A;  2Z1C A;  2NYZ D;  1T5E A;  3MXU A;  3K58 A;  2BDO A;  3OIP A;  1LAB A;  1G29 1;  4Z9C B;  5CGK A;  1JOQ A;  3TSS A;  1CZG A;  1LV9 A;  5FO7 B;  1AFP A;  4PNY A;  3OOC A;  4FP5 D;  2IL8 A;  2JEA I;  4Y7N B;  1GUN A;  3D4R A;  3S15 B;  3CKI B;  4K6L A;  5IGD A;  4RGM A;  4DXF A;  5CV8 A;  5DNF A;  3ITP A;  2AQ3 B;  3NWS A;  4HCE A;  4TSS A;  1B9N A;  2XSC A;  3S14 B;  1Q1B A;  1CHQ D;  3G7L A;  1R4Q B;  2WP8 J;  4K5W A;  3VR5 A;  3NP8 A;  1EY7 A;  4G57 A;  4QMG A;  2F0M A;  2F0F A;  3NTI A;  4RGT A;  3QB3 A;  1IKL A;  1SNO A;  1W6J A;  2KA7 A;  3QWN A;  1B1Z A;  1KAA A;  5JJZ A;  2WAC A;  4LMQ D;  3T51 B;  5D3I B;  1MGS A;  2B2Y A;  2E2J B;  4DA2 A;  3IFD A;  2I07 B;  3OSO A;  3R2I A;  4IN3 A;  2M00 A;  1ET6 A;  2SOB A;  4RGO S;  1EEI D;  1U4M A;  1WD1 A;  4V0B A;  5M3F B;  2NVY B;  4HSP A;  3MZ5 A;  4H13 C;  1QOH A;  3QIA A;  1JOR A;  1PFN A;  1HXY D;  2MHV A;  2D9U A;  5J39 A;  2QCP X;  1STE A;  1U9R A;  3Q0A A;  1ENF A;  3N6R A;  2BOS A;  3IKJ A;  4FO2 A;  5EQ0 A;  5C0X H;  1WTP A;  5M5Y B;  5CC4 A;  5KYL A;  2RBM A;  1TT2 A;  1TWG B;  1EY8 A;  1TS5 A;  1S5F D;  4WFN 3;  5JPN C;  1VF7 A;  4RH6 A;  1RD9 D;  1SDF A;  1H9M A;  1EZ8 A;  1S5C D;  1TWF B;  3HGB A;  1DOL A;  3J7A V;  1XTC D;  4C3I B;  4ABN A;  4A3J B;  2F0J A;  2SDF A;  3OIQ A;  2YU9 B;  2EYL A;  1LTR D;  1Z7T A;  1HCZ A;  4FF4 A;  5I6Y A;  1EY5 A;  1V1O A;  1Y8N B;  2R7Z B;  5ELC A;  3JAM L;  1SXT A;  3ZYY X;  5KIX A;  2ZXO A;  2JA5 B;  3I3C A;  3DM1 A;  1SEB D;  2IX1 A;  3EQL C;  1G2S A;  1HFG A;  3C3L A;  2F03 A;  4JBW A;  4F7X A;  1Q12 A;  1JOK A;  2LY7 A;  5CMD A;  4IZ8 A;  1YNJ C;  1LTA D;  3EJI A;  4HR7 B;  3KK7 A;  3SHL A;  1CK1 A;  4C1N K;  2PQE A;  2SEB D;  2NZ1 D;  1Y1V B;  2WV6 D;  1DYQ A;  1YNN C;  2DN8 A;  3V2T A;  5IGB A;  3J80 L;  2B2T A;  2Q8T A;  5EKI A;  4F88 A;  1YNN D;  2E74 C;  1RF2 D;  3MA2 B;  1V43 A;  2JP1 A;  3HOW B;  3D4W A;  1NAP A;  4KKU A;  1HPC A;  1KAB A;  3H0G B;  1I4X A;  1ESR A;  4HMI A;  1G91 A;  4ID6 A;  1NR2 A;  2E2I B;  2F4I A;  5FKA C;  3BYY B;  5T1I A;  1CA6 A;  3TP7 A;  3D6C A;  3R2T A;  1A2U A;  4EQP A;  1AEX A;  1TY0 A;  4C3J B;  4K2K A;  1D5M C;  3W2D A;  1BUV T;  2Q8R E;  2JA7 B;  2JXM B;  4BBS B;  4I7Z C;  3HOX B;  2WAQ B;  4EGV A;  3HOY B;  5JEA G;  4O1N A;  5COR A;  3OMG A;  2H4O A;  4TKO B;  1TR5 A;  4BY1 B;  1JCK B;  3FKI B;  1RTO A;  4EVO A;  2EYF A;  5DAU A;  1NUC A;  4B9X A;  3URY A;  3P75 A;  3PV0 A;  1KTK A;  4KJO A;  4F87 A;  1EL0 A;  2Q8I B;  1F2M A;  4K8I A;  1EYA A;  2EJM A;  4KI0 A;  3GTO B;  2IJ0 A;  5C4X B;  1CT1 D;  1BXT A;  3OWF A;  5C4J B;  2AQ2 B;  3K5M A;  1D6E C;  2X69 A;  1HUM A;  1SMY C;  2FFK B;  4ZLT F;  4IAL A;  4K6D A;  2R61 A;  1JB3 A;  5ELD A;  4BY7 B;  2EYH A;  1RTN A;  3SE0 A;  2PO4 A;  1RJT A;  3T13 A;  1HRJ A;  3TN2 A;  1Y8O B;  1O80 A;  2AWN A;  4MN3 A;  1EWH A;  1II3 A;  4XYO A;  1BR9 A;  1HTP A;  2L5T A;  3L7Z C;  2V4D A;  1Z47 A;  3AU7 A;  5IOC A;  2MPM A;  3NSW A;  1PXU A;  1F9P A;  2N88 A;  5KYI A;  3PUZ A;  5KEE A;  3NE5 B;  2B2V A;  1HHV A;  2K1B A;  3QO2 A;  3JAM E;  5C3X A;  5J22 A;  4KHZ A;  4DGZ A;  2SNS A;  4XIG S;  2PMZ B;  4H7B A;  1HUN A;  2I46 A;  1DOM A;  4F8M A;  1SYB A;  4P2C B;  1IYV A;  3LWU A;  3I8Z A;  2FMM A;  1HFN A;  3M4O B;  1LTS D;  1FR3 A;  2FJ2 A;  2KHS A;  1U4P A;  3J80 E;  3PUW A;  4BA2 I;  2HCI A;  2F3W A;  1WTW A;  1Q8I A;  2EJG C;  3SDZ A;  1D2B A;  1B44 D;  2KCC A;  3GTP B;  4C3H B;  4V19 0;  1SND A;  5IGC A;  4KTA A;  2F0E A;  5JEA J;  1IKM A;  5TSS A;  1TS3 A;  2A73 B;  3GO5 A;  2DNE A;  1LTG D;  5T1G A;  4L6T B;  1Y1W B;  4CGY B;  3TZU A;  1XX8 A;  4G7O C;  1TWH B;  1VMP A;  1KLG D;  2IX0 A;  2EPB A;  3A8I E;  2XWJ B;  1NCV A;  3S2H B;  1S5B D;  4CHT B;  1WVL A;  1CM9 A;  1DM0 B;  2EYO A;  4ODG A;  1JC7 A;  3CHB D;  5LHY 1;  2E2H B;  1PFM A;  2QIL A;  2NN6 G;  4DAY A;  1M8A A;  1F9Q A;  2NTS A;  3DWP A;  3QG1 A;  1TY2 A;  1C4Q A;  3A8J E;  2RA4 A;  1CQF A;  1AZP A;  4YIJ A;  2XVS A;  4XT1 B;  4GZY C;  1UNS A;  1GUO A;  1F2L A;  3WOF A;  5D65 A;  5KGU A;  5M5W B;  3M7G A;  4J6H A;  4UDU C;  4PQX A;  3RUZ A;  2IWH A;  4HCS A;  1EYD A;  2EE1 A;  4OO1 I;  2AQ1 B;  1I50 B;  4X3T A;  1TWC B;  1WTR A;  2NBF A;  1IW7 D;  4L63 B;  2MP1 A;  4XXE A;  2ID0 A;  2BA1 A;  1WCM B;  4XDX A;  3ERQ A;  1OXX K;  3GTK B;  1LLR D;  1SE2 A;  1DOK A;  3S2D B;  3S16 B;  3D3R A;  1KDA A;  4IUU A;  2R93 B;  5IGF A;  1O78 A;  3PO2 B;  3NHH A;  2PNR C;  3S17 B;  2DNC A;  1BQQ T;  1CA5 A;  5D14 A;  3BDL A;  5EBD A;  2Z4I A;  2VNU D;  2JYO A;  4KHV A;  5FLX L;  2L11 A;  4QB4 A;  1O7Z A;  3CU7 A;  2KUM A;  5E4W C;  1A3U A;  4FF1 A;  4K14 A;  1I3Q B;  2NVT B;  3KBG A;  4CKB A;  4O42 A;  1ICW A;  2CW0 C;  2OF1 A;  4M8A A;  2EY2 A;  2XWB B;  4DU9 A;  3BS1 A;  4G7Z C;  1XWE A;  2B2W A;  2A5H A;  5CV7 A;  5I2X A;  1STB A;  1JWM D;  2B2Y C;  3RLF A;  3T56 B;  2RDF A;  5F2D A;  1CFM A;  3HRZ C;  2EVB A;  1WTV A;  3NBH A;  4KJN A;  2MGS A;  3WOE A;  2B8G A;  1GUW A;  2D2C C;  1GJX A;  3VR6 A;  5E4X A;  3VR3 A;  1EYC A;  1Q1E A;  2O5I C;  3PMF A;  3BG3 A;  1B50 A;  2EYM A;  1FNV A;  2Z4H A;  2EY1 A;  1BF4 A;  5EKK A;  4UAI A;  2E75 C;  5I9O A;  2FIN B;  3X3N A;  5I9P A;  2F0H A;  1A3T A;  3NWT A;  2JA6 B;  1WTX A;  1V8Q A;  1PZI D;  1SYG A;  5I2Y A;  4A3I B;  4DAP A;  4HSV A;  4NDX A;  4CKC A;  5K36 H;  5NUC A;  5BN5 A;  5DM6 3;  1LAC A;  1B4O A;  2PW7 A;  4KMU C;  1LTI D;  3K5O A;  4RGN A;  5EBC A;  1EOT A;  1ONL A;  1QNU A;  2XRQ D;  1RHP A;  4PMW A;  2B39 A;  1I6H B;  1GXD C;  2K5D A;  3K7A B;  5CV9 A;  2LMC B;  3OPO A;  4OO1 H;  2RSN A;  4K8J A;  4LJZ C;  4DNT B;  3V05 A;  2PZU A;  2NVX B;  1DON A;  4IFD G;  3G6J B;  5COY A;  2C5C A;  1K83 B;  3BDO A;  1EZ6 A;  3QJY A;  2K04 A;  3GTL B;  3MXG A;  3W3A A;  1JOO A;  4OIK A;  5FK9 C;  3DXJ C;  3MVV A;  4XQN A;  3FRP B;  1DJR D;  3E5S A;  4K2L A;  2L55 A;  4ZKC B;  3HZX A;  1TS4 A;  1O7L A;  2B2T C;  3GP7 A;  5G3L F;  1GUS A;  1YNJ D;  4KY6 A;  5CV5 A;  1MBY A;  4G4K A;  1VCI A;  2IT1 A;  3J7Y W;  5IGG A;  3M4Y A;  1JQY D;  4RWS C;  3K5N A;  1EQT A;  2AWO A;  4WJW A;  1Y69 U;  2EYP A;  2NWG A;  1G8Z D;  2QF7 A;  5FLX E;  4C3I G;  1KDB A;  1SNC A;  2J4X A;  3K6O A;  3FVQ A;  3RD4 A;  2A74 C;  3NUC A;  2KCN A;  3ND9 A;  2FHT A;  3SEB A;  1GOZ A;  4LAA A;  4E6I A;  4TRD A;  1ILQ A;  5CYU A;  3QOL A;  1DXM A;  3P7J A;  1OXV A;  4EQO A;  2CVR A;  4KKS A;  2EDG A;  4ILW A;  3BVM A;  2N55 A;  3H3V C;  3K0Y A;  2K28 A;  2F0D A;  4OL7 A;  1VMC A;  3TBI B;  3A7L A;  1TKW B;  4XYQ A;  3TZD A;  4BA1 I;  3T53 B;  4KN4 C;  1WD0 A;  1JE4 A;  3SK4 A;  4B08 A;  2RKS A;  1H9K A;  1E2V A;  1KNA A;  3GV6 A;  1EU3 A;  3Q22 A;  2K03 A;  2VXW A;  1E0B A;  1AW7 A;  4OHJ A;  4N9T A;  1LT6 D;  2BA0 A;  1ENA A;  1A15 A;  3H09 A;  4IQZ A;  3FEW X;  4XTC S;  2TMP A;  2EY5 A;  3SXH A;  2AUJ D;  5C5M A;  1Q3L A;  2OEO A;  4IFD J;  3VYU A;  1JR0 D;  1CTM A;  1DD2 A;  1U4L A;  1L0Y B;  4A3B B;  4PMB A;  2R3Z A;  3TME A;  2J7Z A;  2WB1 B;  1PYW D;  2QKI C;  5D3D A;  2EY6 A;  2ZT9 C;  4FXG C;  3MHB A;  3KLS A;  4C3J G;  5CV4 A;  1SMY D;  2DY7 A;  3A8K E;  2F0U A;  3MAQ A;  2X6G A;  3BZD B;  1RCV D;  2NB0 A;  3NBI A;  5I6W A;  2PYK A;  1EY0 A;  1D5X C;  3HKZ B;  1D1I A;  1BOS A;  2B2V C;  3NQT A;  4QF4 A;  4NP5 A;  1QNK A;  3C1F A;  2RQX A;  4M1U B;  4ZK9 B;  3K5L A;  2L12 A;  4H44 C;  5EGT A;  4FF2 A;  4PV1 C;  1MSG A;  2F0I A;  4K5V A;  1X3Q A;  1BDO A;  5KNC A;  1H9S A;  1QWY A;  2ICE C;  1SFO B;  3NK9 A;  1MSH A;  2KED A;  2OT2 A;  1H9R A;  3D4D A;  1QCB D;  1XXG A;  2MJ8 A;  1GHK A;  1TVX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...