1R9TH

Rna polymerase ii strand separated elongation complex, mismatched nucleotide
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA strand
publication title Structural basis of transcription: nucleotide selection by rotation in the RNA polymerase II active center.
pubmed doi rcsb
molecule tags Transcription/dna-rna hybrid
total genus 15
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2003-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1r9tH00
5GQOA 4HJ9A 1IBML 1XNRL 1WYDA 2NVQH 2YTVA 4RG1A 4DR3L 4C2MH 4AH6A 4BY1H 1G6PA 3HOYH 3KYHC 2VUMG 1SR3A 4GN5A 1OXUA 4IJHA 1N9WA 4DV5L 2NVXH 3PO2G 1E24A 1PH4A 4BBSG 4DR6Q 2DGYA 2HIXA 1LM0A 2PI2A 3KOJA 5M5YH 2JA8H 3RLFA 5M3FG 4HJAA 1E1TA 1YHQA 1VQLA 4B3SQ 3U50C 4QGUA 1Q1EA 3I4NH 4DV4Q 1VQMA 4A3DG 3E9HA 1TWCH 1EQQA 4LFCQ 5IYCH 1L0WA 3KF8B 2JA9A 1XPOA 1HJPA 4AIMA 4BBRH 2D0OA 2OTLA 2Y0SG 4BA1I 2UUAQ 1X3EA 4JI5Q 3ERSX 1J5EL 1L1OA 4YY3L 1K0RA 3ULPA 1VQGA 2QEXA 2UUBQ 2JA6G 4JV5L 5IP9H 2KHIA 3H3VH 4DR2L 1MJCA 4KLKA 3FKIG 1EQRA 4APVA 3BU2A 3A5UA 2ALYB 3S1MH 1MIUA 2FXQA 2RCNA 3GTLH 1JJCB 3M85A 2KBNA 3H3VI 3CD6A 2BA1A 5FJ8G 3A5ZB 3F2BA 4IOCA 2ES2A 3KJOA 4DV0Q 1PH3A 4WJ4A 4R4IA 5C0XG 4A3MG 4QY7A 4LF9L 4LFBQ 1ASZA 4GLXA 5ELOA 3S24A 4P75A 3GD7A 3STBC 2XGTA 2VS1A 3A0JA 1CKNB 1N34L 1Q86C 2GN5A 1XMQQ 5IYDG 5GROA 4A3KH 4QJFA 3FP9A 3S15H 4JI7L 2Q2HA 1NMFA 4DUZL 3L7ZC 1IYJB 1VQBA 2R7FA 4R4QA 3F1ZA 5JJKA 4GNXA 4A3CH 5GAHC 4NPSA 3HOUG 1XNQL 1K9MC 3CC7A 1DGSA 4GLVB 3UDXA 2CFMA 3H0GH 5JJIA 2WAQE 3J81i 5H1SE 2LSSA 5IP7H 1VQ7A 3RN5A 1D7QA 4LFAL 3TS2A 4LF5Q 1QZHA 4JI3L 1G291 3T1YL 3UDIA 1Q1BA 3HKZG 4P71A 1C7YA 4DR1L 4YHHQ 2NZOA 1XJVA 3EN2A 2AMCB 4LNQA 4A3BG 4POFA 5M3MH 1XMOL 2HHHQ 2D62A 3TRZA 3AEVA 4GOPC 3RNUA 1N36L 5DLQE 4DR6L 2B63H 2QA4A 3UE1A 3S17H 1N33L 1A62A 1KQSA 4BXXG 3TREA 4JBJA 5GADC 4JI8Q 1VQCA 2CCZA 1R9TH 3KF6B 1VS0A 2EQSA 1NY4A 5GAEC 2VNUD 1HZAA 4LFCL 3U4ZA 1BKBA 3PUWA 1YBYA 3Q8DA 3CXCA 2K50A 5BR8L 1PVOA 1VQ4A 1VQKA 2ZTDA 2UXBQ 3STBD 2UUAL 4JI0L 3I4MG 3K7UC 5EAYA 4GKJL 2AWNA 1NJIC 1YEZA 5JEAG 1YJNA 2E2HH 5FLMG 2F52A 1YJWA 1P16A 1HNXQ 1FJGQ 4A3GG 2N49A 4JI6Q 1GO3E 2NZHA 4DNIA 5E7NA 1L2FA 4OX9Q 3CCRA 1SN8A 2XTIA 3T1HQ 1I3QH 2ZM6Q 3HOVH 1H95A 4X66L 1Y1WH 2IHFA 1HZ9A 3CMEA 3KDFB 4DR4Q 3BZKA 4B3RQ 3S16H 4LUOA 3OYYA 2JA5H 1RIPA 1EOVA 3PIPA 2VZAA 3S2DH 2DUDA 4BY7G 2B29A 2NN6G 3M4OH 1Q8KA 4UP9A 3PF5A 1IXRA 2JE6I 4DK3C 4DV3Q 4LF4L 1CUKA 2JEBI 5C44G 1Q82C 2K5VA 3KDFA 1XMQL 1QVFA 5C0XJ 2UXDL 1JE5A 1MKHA 1FVIA 5IY0A 4A3FG 1N8RC 1OXSC 1EFWA 3G4SA 2OTJA 4HJ7A 1SFOH 4EX5A 3UDFA 4AYBE 1PH9A 2PQAB 2YV5A 3D31A 3PSIA 4YWMA 2VQFQ 4HIOA 1VQ8A 5IT9c 2C35B 3HOZG 5M5XH 1IBLQ 1X54A 1S72A 3PO3H 2YTXA 3H15A 1TWGH 2R6GA 1EUJA 1K3RA 3GTJH 3S14H 2Z6KC 2UU9Q 5IWAL 4LF5L 3HKSA 4X62L 1B70B 1A63A 5AJ3Q 1OXTA 2YYZA 1X9NA 1V1QA 1VQPA 3S1NH 1SROA 4DV1Q 2UXCQ 2E2JH 3RLOA 4UY8C 4JI4L 4A93G 4IPHA 1GM5A 4HIDA 2LXJA 2QGQA 3PV0A 4OXPA 1UWVA 1WFQA 1LUZA 4KHPL 3MEFA 3E0EA 4TQUS 1UEBA 3AQQA 5IE8A 3CMAA 3CF5A 4GKKL 4J15A 1AE2A 3W1GA 2R7ZG 4HJ5A 4R1JA 2VQEQ 4JI8L 1IZ6A 5C4XH 3OTOQ 2R92G 1PH7A 1GD7A 3DM3A 4QL5A 3CP0A 3UE0A 1VQOA 2A1AA 1PV4A 1NBWA 4C3HH 2VW9A 1U5KA 1KL9A 2OQ0A 2JA7G 3K7AH 5IYBG 3S1QH 2E5LQ 2R93H 4MZ9A 5HGQA 4YCUA 2K75A 1HNXL 1Z47A 1FJGL 5LMNQ 1K83H 4DV6L 2UUCL 3AFQA 4DR5Q 4OX9L 4LF8L 3CCSA 3HOWH 1YHBA 4YCWA 5JEAJ 4DR7Q 5J3BA 4LF6Q 4B3RL 1I6HH 4AQYL 1L1OC 1JMCA 1EWIA 4NXNL 1QVCA 2IT1A 1TWFH 4A3IH 3CC4A 1I5FA 4BY1G 1VQ9A 5JJLA 3HOYG 4OONA 4X65Q 4PZ8A 4R4TA 2BA0A 1VQAA 4YWLA 2PI2E 1IL2A 3AFPA 3J80c 4DUYL 2K4KA 1YZ6A 5FLXc 1NE3A 1CKNA 1KRTA 1K73C 4PMWA 1WJJA 1MJEA 2BH8A 1I94L 1VCIA 4JBKA 2JA8G 2EIFA 4X6AH 4MNOA 4BA2I 1PYSB 3GTGH 2OCEA 1P8LA 3K81C 3I4NG 2EXDA 4IFDI 3B6YA 4P74A 2IX0A 4A3LH 3M3YH 1HNZQ 5IYCG 1PFSA 2CWPA 3CW2C 2VQFL 4GOPB 4BBRG 3I2ZA 1IBLL 3EIVA 1FGUA 4IJLA 1GVPA 3F2DA 1HR0Q 4L5RC 2UU9L 1HH2P 3CCLA 3K0XA 5IP9G 3F2CA 1UE5A 2WB1G 5LMUQ 4GNXC 4B3TQ 5C3EG 1PH1A 4A3JH 2UXBL 4DV1L 2UXCL 1W3SA 2BH2A 1YVCA 3ULLA 4A4IA 4OO1G 2CQOA 1VQFA 3TS0A 2VY3A 1IBMQ 1Q7YC 2JEAI 2ZTCA 4C3JH 4HIMA 4B3SL 4JYAQ 4JI2Q 1OTCA 2LXKA 4MTNA 4DV4L 2HQLA 4AYBG 4P72A 2WP8J 1KRSA 2RF4A 3NENA 1B8AA 1B7YB 4UP7A 3PGZA 2VQEL 4JOIA 4JI5L 2CWAA 1YIJA 4LF7Q 3JAMc 4JG2A 1X55A 4A3KG 1E3PA 1WCMH 1E1OA 3KF6A 1G51A 3M4QA 2KENA 3KJPA 1SMXA 2UUBL 3HFZB 4KI0A 2AHOB 1VQNA 4A3EH 2GVAA 4QIWE 3ULJA 3JC66 1GKHA 2E5LL 4NXMQ 1X65A 1E7ZA 4A3CG 2N3SA 2RHQB 4PZ7A 2B3GA 1K8GA 4DPGA 1J6QA 3H0GG 1J5EQ 4JC0A 4DV0L 5IP7G 1BVSA 1V43A 1U0LA 1Q81C 4JV5Q 2VUMH 3CCVA 4DR5L 4OO1I 2I5LX 4H02A 4BBSH 3CAMA 3PO2H 4LFBL 1SLJA 2ID0A 4DR7L 1CSQA 2F3IA 4JOIC 1QUQB 4EQ5A 4DV7Q 4P73A 3M4PA 3LGJA 1BBUA 2I5HA 4IPCA 5M3MG 5M3FH 1BBWA 1A8VA 4GS3A 4HJ8A 4IOAA 2KCMA 4A3DH 2MO0A 1Z9FA 2MFIA 3J80i 3GTOH 4LF9Q 3W1BA 2B63G 1V9PA 3PIOA 1QVGA 2K52A 3OW2A 1N34Q 1IBKQ 3HKZE 4L5QA 4JBMA 3RZOH 5GAGC 1UE7A 3TEHB 3WWVA 1T9HA 2N78A 2JA6H 3K80C 4JI7Q 1YNXA 4DUZQ 5K36G 3FKIH 3IRBA 3I55A 3CPFA 3UDGA 1WI5A 3AYHB 2ZJQA 2PNHA 2PQAA 2RHSB 4GN4B 3ICEA 4YHHL 1A0IA 3F8TA 3D0FA 3G48A 4LUZA 5FJ8H 3HOXG 1W2BA 4HIKA 4DV2Q 1HR0L 4JCVE 4LWCA 2HHHL 3FHWA 4A3MH 2Z0SA 5ELNA 4B3TL 1QZGA 3EBEA 1VQ6A 1KXLA 4JI1Q 2F4VQ 1X3GA 3HOVG 5C0XI 1Y1WG 4DR1Q 4DKAC 2WAQG 2IY5B 5IYDH 4ME3A 4R4OA 1AE3A 2JA5G 4B3MQ 3GTMH 1JT8A 1YJ9A 1XMOQ 4JYAL 4JI2L 1VQDA 4DK6C 3RZDH 2HIVA 2JJQA 2L15A 1N36Q 3TQYA 3HOUH 1S40A 5M5WH 4K0KQ 4LF7L 3S2HH 3JAMi 1N33Q 2ZTEA 2MNAA 4LUVA 1L1OB 1C9OA 3CC2A 4O0AA 1HNWQ 1Y1VG 3GO5A 4TVAB 4X64Q 4JI6L 1CSPA 3A74A 3RR5A 4KHZA 2E8GA 4NXML 2Q2TA 1N32Q 3T1HL 5BR8Q 2ZM6L 1HR0W 2K14A 3CPWA 4JI0Q 1XTDA 4YCVA 2YTYA 1KC8C 1KD1C 4DR4L 4DAYB 4A3BH 2YU9H 4GLAC 1JB7A 4GKJQ 3PO3G 3K8AA 4L5TA 4OWTB 1UE1A 2D0PA 4NB3A 3GTQH 1M90C 1YITA 4IFDJ 2K5HA 5C3EH 2NVYH 4LW1A 2E2IH 1JJGA 4DV3L 1EIYB 3PUZA 3M9BA 1I50H 4PG3A 4X66Q 4RMFA 4DV7L 4BXXH 1PH2A 2H5XA 3I7FA 2IHEA 3PUYA 3G71A 2Q2UA 3CCJA 3RLNA 4O2DA 4GNXB 3S1RH 4LF4Q 1IBKL 3I4MH 1SE8A 1O7IA 1TWAH 4L5SA 2UXDQ 1TXYA 4ALPA 4UPAA 5C4XG 5FLMH 4A3GH 1OXVA 2R7DA 1S3OA 1X6OA 1PH8A 1JJ2A 3L0OA 5AJ3L 4A75A 3I56A 4UP8A 5HY6A 1RL2A 4GOPA 3RN2A 2GVBA 3J81j 2WFWA 3GTKH 1X3FA 4YWKA 2R93G 1Q46A 4XTCS 2Y0SE 1M1KC 1XNRQ 1VQ5A 4XIGS 4DV2L 3M7NA 1VQHA 1C0AA 4DR3Q 4BY7H 1EYGA 2OQKA 3ZJYC 1SRUA 5IWAQ 3L2PA 4X62Q 2I0QA 4OWXB 3HOWG 4DV5Q 3PCOB 5C44H 4JI1L 2F4VL 2ZJPA 2NN6I 1NTGA 4JI4Q 1Y14B 4OWWB 3OTOL 1OXXK 2IX1A 4B3ML 4A3FH 1PA6A 4IPDA 2ZJRA 4A3IG 1FL0A 2MO1A 1ASYA 4FDBA 4IPGA 3U4VA 4KHPQ 3I4OA 2I5MX 2N8NA 4K0KL 4GKKQ 2JQOA 4IFDG 3HOZH 1EIFA 2A19A 2KHJA 1WOCA 1HNWL 2OWOA 1HZBA 4X64L 5LMNL 1AH9A 4YY3Q 1LTLA 3GTPH 3DLLA 2AKWB 3G6EA 4DR2Q 4A76A 4R4CA 1N32L 3U58A 4A3LG 1VQEA 4GN3B 3NELA 2Q2IA 3MXNB 4LF6L 4A93H 1D8LA 5C4JH 2JK8A 3NEMA 3SGIA 3HOXH 4WJ3M 1X56A 2MQHA 2ASBA 2PMZE 3BZCA 1TWHH 1K8AC 4DV6Q 2UUCQ 4X65L 1E22A 1KHIA 2K5NA 1KAWA 3PUVA 4PZ6A 4C3IH 1YI2A 4LF8Q 1NMGA 3NBHB 1CKOA 4A3JG 1XPRA 2ATWA 2A8VA 3KFUA 2KCTA 2R7ZH 1QUQA 3J7ZC 2R92H 1PH5A 4IO9A 4AQYQ 3CCQA 1PYBA 2CKZB 4NXNQ 1Q12A 4POGA 1HZCA 3J7A5 3PUXA 1CKMA 2Z6KA 2NVTH 3W5OA 3CCMA 2JA7H 1HNZL 5IYBH 2WB1E 1YHAA 3CCUA 4DUYQ 2VL6A 2AWOA 1LYLA 3GDEA 4DAMA 5LMNW 1PHJA 1XNQQ 1XPUA 2HT1A 1VQIA 1I94Q 1Y1VH 3PF4A 4JBWA 3E9IA 1VQJA 1WCMG 3J81c 2V1CC 1UE6A 3ER0A 1KIXA 5LMUL 4LFAQ 4A3EG 4Y7NH 4JI3Q 3VDYA 1PH6A 3KLWA 4Y52H 3BJUA 3T1YQ 3CQZH 3CCEA 4QQBX
chains in the Genus database with same CATH superfamily
2NTTA 1XNRL 2NVQH 1AN8A 4RG1A 4AH6A 3KYHC 1O80A 4BBSG 2UXBQ 4IJHA 2NVXH 2EOTA 5HURA 1LM0A 5M5YH 2PYKA 2VUMB 2M9VA 2JA8H 4DA2A 4HJAA 4B3SQ 2EYOA 3U50C 4QGUA 5C4JB 4DV4Q 1EQQA 2EY1A 2JA9A 2B2WA 3U9SA 3ERSX 4YY3L 2JA6G 2EVBA 2Y0SB 3RMHA 3EVQA 3A5UA 3ND8A 4DNRB 1DXMA 2K28A 1LABA 2KBNA 4RAUC 3KK7A 3LWEA 1K0SA 4WJ4A 2A6HD 4A3MG 4QY7A 4LF9L 3Q24A 4QIWB 2PZWA 1Q86C 3I91A 1TU2B 3FP9A 5CV4A 1I4HA 1ENCA 3GTMB 4GNXA 5GAHC 1S4ZA 1XNQL 3CC7A 2X6GA 4G7OC 3Q0AA 5JJIA 3V96A 2WAQE 3HOUB 2VB3X 2LSSA 5COYA 5IP7H 5H1SE 1QG7A 2PMZB 4LFAL 2M2LA 1QZHA 2F0EA 1EZ6A 3UDIA 3HKZG 1WTXA 1HA6A 3P75A 4YHHQ 1TWCB 2JXMB 3EN2A 4QCLA 1STAA 1ILPA 2HHHQ 2D62A 1HQRD 3EA6A 3RNUA 4M1UB 3UE1A 3OSOA 3TREA 4JI8Q 3Q22A 3H6MA 4LFCL 1II3A 2K50A 5BR8L 1RD9D 2ZTDA 5CYUA 3BG3A 2UUAL 2Q8RE 3I4MG 5DAUA 5EAYA 2EPBA 1YEZA 1CQVA 5CMDA 3S1RB 5KIXA 5FLMG 3VYUA 1GO3E 2NZHA 3KLRA 1TWAB 5E7NA 3FDTA 1LLRD 1DOMA 2XTIA 2ZT9C 2FMCA 2MHVA 4U673 3T1HQ 3CMEA 3G7LA 4DR4Q 3ND9A 4LUOA 1RIPA 3J80L 2VZAA 5FLXL 1B4OA 4CDFC 5KNCA 1FGBD 1WTWA 2EDGA 3PF5A 1J8IA 3OIPA 4H0LC 4DK1A 4LF4L 2JEBI 3TN2A 1Q82C 1MSHA 3E6ZX 1H9JA 1SSOA 4Q0FA 5C44B 2X6LA 3R8BA 1PZID 5DEHA 2EYHA 1RTNA 3PSIA 2B8FA 5FO9B 2C35B 4F87A 1D6EC 5M5XH 2KJXA 1EYAA 2YTXA 2R6GA 3GTJH 2A6EC 2Z6KC 5IWAL 2G5DA 1B70B 1X9NA 1VQPA 2UXCQ 3RLOA 4OGQC 3I8ZA 2DN8A 2VXWA 5E1FA 1PTOD 3MZ5A 4HMIA 1SYBA 3PV0A 5J1ZA 3E0EA 3CMAA 3AQQA 5BN4A 5IE8A 2WKDA 3SVMA 1BOSA 1H9SB 2R92G 3OTOQ 3DM3A 1I3QB 3PIP3 4HR7B 1PV4A 1VQOA 1NBWA 1KL9A 2OT2A 1MSGA 2OQ0A 3D4DA 2JA7G 3KF8A 2E5LQ 2R93H 1UNSA 2PW5A 4YCUA 1HNXL 2DNCA 4CJ2C 1NSNS 1CFMA 4X3UA 2Z4HA 4DR5Q 4OX9L 3RD4A 4LF8L 3HOWH 4IUTA 1DZ1A 3NP8A 4R8NA 3IKJA 4EVOA 1SFOB 1JMCA 3VA5A 1QVCA 4KHVA 2IT1A 1TWFH 4A3IH 1I5FA 1VQ9A 3HOYG 4X65Q 2D5DA 4ZLTF 1SYGA 4X3TA 3PO3B 3I72A 1OO9B 3AFPA 4C2MB 1YZ6A 2KUMA 2WIIB 1WJJA 3S1NB 1PDQA 4IQZA 4MNOA 2NYZD 4RHRA 4KN7C 1P8LA 4IFDI 4DXGA 3K0YA 2IX0A 4K8JA 2F0FA 5IYCG 1PFSA 2CWPA 2VQFL 1YNJC 4BBRG 4J6HA 4DFAA 3I4NB 1WTQA 4RGTA 1H9RA 3D3RA 3BVGA 4IJLA 1Z6HA 3K0XA 1UE5A 4ZUIA 2UXBL 2BH2A 3ULLA 2AQ3B 1H9KA 1O7LA 1ONLA 2K5DA 4F88A 1SXTA 1ML0D 4FO2A 4B3SL 1OTCA 4DV4L 1KLGD 1F2LA 2BOSA 4PMBA 2RF4A 2F4IA 3HS0C 4UP7A 3PGZA 4AYBB 2VQEL 1SNQA 1YNND 4JG2A 4ME5A 1X55A 3MWYW 4RHSA 1G51A 1GXDC 4QF4A 4KI0A 2AHOB 1VQNA 2Z1CA 1MD2D 1X32A 2F0MA 1X65A 2N3SA 4NKLA 1IW7C 4DPGA 1ESRA 4LK1C 5C6AA 1WD0A 5E4WC 1BVSA 2EZVA 1Q81C 2VUMH 3MC0B 4H02A 3PO2H 3DWQA 4YIJA 4DR7L 4JOIC 2SOBA 4DV7Q 5M3FH 4EQNA 1BQQT 2B2VC 4GS3A 2KCMA 3MFYA 3J80i 3TZDA 3GTOH 2LKVA 2B2UC 2NUCA 3DM1A 5M3MB 5CV9A 1EYDA 1I6VC 3RZOH 1DONA 1UE7A 1T9HA 2N78A 2B63B 2CW0C 3EROA 2L4NA 4C3JB 1Z7TA 3K5NA 3ICEA 1EQVA 1A0IA 4YHHL 4V0BA 2RQXA 3F8TA 3G48A 4LUZA 5FJ8H 1HR0L 3SE0A 4HIKA 2HHHL 2F0DA 4LWCA 5C0XH 3FHWA 4FXGC 2Z0SA 5ELNA 1Y8OB 1QZGA 3JAML 3FEWX 1VQ6A 1KXLA 1KAAA 1S5ED 5C0XI 4DR1Q 4DAPA 4ME3A 1SYFA 4HEDA 4R4OA 3GTMH 4JYAL 1VQDA 1Y1WB 4DK6C 3S16B 2HIVA 1I4GA 1N36Q 3TQYA 1G91A 2F0PA 3HOUH 1EOTA 4K0KQ 5ELDA 4LF7L 1SNPA 1PTOH 2ZTEA 1WTOA 3QWNA 1L1OB 4EGVA 1CSPA 2RBMA 3RR5A 4KHZA 2Q2TA 1N32Q 3T1HL 1E2WA 1U4LA 1HR0W 2K14A 4JI0Q 1XTDA 4YCVA 2YTYA 1KD1C 4DR4L 1JWMD 4DAYB 4A3BH 2YU9H 2L9HA 4GLAC 5ISRA 3PO3G 1QB5D 1UE1A 2D0PA 2NZ1D 3OHXC 3PMFA 2EE1A 2IPKD 2NVYH 3R3OA 1EIYB 3T53B 1A3TA 2NWGA 4BXXH 4KN4C 2DJGC 4K14A 3AU7A 3PUYA 3G71A 4O2DA 3S1RH 3AB9A 4BS9A 4HCEA 1IBKL 1SE8A 1O7IA 5DM63 1TWAH 5JEAH 5C4XG 2J0TD 3UI2A 2B2YC 1S3OA 2F0OA 1JJ2A 2RDHA 3QG1A 3I56A 4UP8A 3V2TA 5HY6A 5D3IB 4C3HB 2JP1A 2Q8TA 2WFWA 1X3FA 3C46A 1Q46A 3NHHA 1PZKD 1XNRQ 1VQ5A 2OQKA 3L2PA 2EYMA 3PCOB 5C44H 5FOBB 2F4VL 2OF1A 1GUWA 2NBFA 5EPKA 3QOLA 4JI4Q 2ICEC 1PRTF 3DWAA 3OTOL 1FR3A 1D5MC 1EL0A 5E3FA 4A3FH 3W2DA 5HGTA 1I6HB 5ELFA 1TQOA 2N8NA 5IOCA 4GKKQ 1CHQD 3VA7A 2JQOA 2AUKA 1BO0A 3HOZH 1EIFA 1HNWL 4XT3B 1AH9A 4HTHA 4IZ8A 4YY3Q 1CA5A 3DLLA 2AKWB 3BS1A 3U58A 1VQEA 2L5TA 1QOHA 2KOLA 2Q2IA 3NELA 3GTGB 4KTAA 3SGIA 2MQHA 2K04A 3BZCA 1VMCA 3Q23A 5IGFA 1TWHH 5A2QE 4X65L 1E22A 3P20A 1W6KA 4A3JG 1LTSD 1E2ZA 2KCTA 3T51B 1PH5A 4K5WA 3CCQA 3VR6A 4C3JG 1FNVA 3J7A5 2NVTH 2Z6KA 3W5OA 3CCMA 2KQ3A 2WB1E 5JOBA 3CCUA 4DUYQ 4BY7B 1PHJA 1CI3M 2O2LD 1GHKA 1XNQQ 1XPUA 4PMCA 5CC4A 1BF4A 2HT1A 1VQIA 3NK9A 1I94Q 1BCPD 1IYUA 1XWEA 1UE6A 2CVRA 3ER0A 3LX0A 2RA4A 4LFAQ 4A3EG 3M7GA 3VDYA 4OO1G 3NBIA 4HJ9A 4K6LA 1B3AA 4C2MH 1VF7A 3SK4A 3KLSA 1JOOA 2OEOA 4B9XA 2NTSA 4GN5A 1OXUA 3GTPB 5L37A 2DGYA 3KOJA 2PI2A 5FO7B 3X3MA 3C1EA 1ZKOA 2E76C 2ENBA 4A93B 3S9WA 1HTPA 3I4NH 4A3DG 3BVMA 4LFCQ 1HJPA 5KNBA 2OTLA 2NB0A 2UUAQ 1X3EA 4EQOA 2CHBD 2KHIA 4WRDA 3H3VH 1MJCA 3BU2A 3S1MH 2FXQA 2K7VA 2RCNA 4DXFA 1C48A 1JJCB 3H3VI 2DNEA 5G3LF 5IGGA 1PFMA 4H44C 1LT4D 4R4IA 5ELEA 2F0NA 3STBC 2XGTA 2VS1A 4KD3A 1CKNB 4CJ1B 4A3MB 3OWFA 2GN5A 3OMGA 4IUVA 5GROA 1JOQA 2A6ED 3J7YW 3FMCA 1MGSA 3CRKC 1KNEA 1VQBA 2R7FA 4R4QA 5JJKA 3J81E 4A3CH 2Z8LA 4BY1B 4NPSA 3P7JA 1SEBD 3QO2A 1K9MC 1A6XA 4TRDA 3UDXA 2R3ZA 4F8MA 1ESFA 1VQ7A 5M5WB 3BYYB 3RN5A 3L9AX 1G291 2F0HA 4DR1L 2MP1A 1XJVA 4L63B 4C1NI 5M3MH 3E3XA 2FJ2A 3DHQA 4FF2A 4KKTA 1N36L 2F3WA 1G2SA 2B63H 1SYDA 3NWTA 1A62A 4WFN3 1AZQA 5C3EB 4JBJA 1V1OA 3R2IA 1VS0A 1I50B 2F0SA 2VNUD 1SNCA 1HZAA 4KK7A 3U4ZA 3IFTA 3PUWA 1PVOA 4CBVA 2E74C 3D6WA 3GQBA 4JI0L 2HQEA 2EY6A 2AWNA 2HDLA 2AUJD 3FPPA 1YJNA 1HNXQ 2F52A 3TP7A 3I4MB 5K5PA 1F9PA 4DNIA 2B2VA 4A3KB 2CH4A 4OX9Q 3BDCA 2F3VA 1SN8A 5EKKA 2Z6BA 5I6YA 3I4LA 2B2UA 3A54A 3MHBA 4MN3A 1H95A 1Y1WH 2IHFA 2XVSA 3KDFB 3S16H 1CK1A 4KY7A 5I6WA 3S2DH 4BY7G 2NN6G 3M4OH 2QW7A 1EWCA 2L55A 4XYQA 2JE6I 1YNJD 1CM9A 2L1BA 3MAQA 2MPMA 3KDFA 1XMQL 1EYCA 2KECA 4FNFA 2PW7A 3URYA 4RCOA 3VR4A 1FVIA 1EFWA 4UAIA 4HIOA 2VQFQ 1VF5C 3BYTB 1EUJA 1EEID 3QB3A 1GJXA 4LF5L 4Q5VA 1HHVA 3FVQA 3G6JB 5AJ3Q 3D8GA 1V1QA 1R9TB 2N55A 1DJRD 1TS4A 2EXZA 5IODA 4A93G 4JI4L 3NTHA 3K57A 2EJFC 4IUUA 1V1PB 2LXJA 2SDFA 2TMPA 1WFQA 1SJHD 1UEBA 4GKKL 1C8CA 1IW7D 1AE2A 3V05A 1GUNA 1IZ6A 5KYLA 2VQEQ 5TSSA 4QL5A 3CP0A 3UE0A 3HOVB 4C3HH 2WAQB 1U5KA 2R92B 1JR0D 3IAYA 3K7AH 5IYBG 1VDZA 2LS01 1KABA 4MTKA 4FYDA 2JA7B 2K75A 5EQ0A 1AP0A 1HUNA 1LT3D 3CCSA 2F0KA 5IGBA 1YHBA 4YCWA 2QCPX 2DY7A 4DR7Q 5J3BA 1I6HH 1L1OC 2IJ0A 3ZYYX 5CGKA 3VR3A 2CW0D 3CQZB 4BY1G 5JJLA 2B2YA 4R4TA 1VQAA 2L11A 4ZCKA 4DUYL 3HOYB 5A35A 1K73C 4PMWA 4QUCA 1MJEA 1I94L 1VCIA 2EIFA 5IT9E 2LMCB 4BA2I 3GTGH 2F0IA 2OCEA 1PTOF 2EXDA 4H7BA 3EQLC 4A3LH 1HNZQ 4GOPB 3CW2C 2LY7A 1MHWC 2GA4B 4DGZA 1IBLL 4OEMB 1HR0Q 4BBRB 2UU9L 1TY0A 1F2ZA 3CCLA 5IP9G 3F2CA 1L0YB 1DCZA 3OMCA 5C3EG 2KCNA 1YVCA 4A4IA 2CQOA 1VQFA 2PCFB 1LT5D 1IBMQ 4FF1A 2QDBA 4OIJA 4RA8A 4M8AA 1NUCA 3GTLB 4JYAQ 2EY2A 4CDDC 4P72A 2WP8J 4CDCC 1K83B 1B8AA 3BZDB 4R9WA 4LF7Q 2CWAA 1SMYD 1TS2A 4XDXA 4A3KG 3M4QA 1E1OA 5T1IA 5BN3A 2EYLA 4KJNA 4QIWE 4PZ7A 2B3GA 3H0GG 4JC0A 1VMPA 4BBSH 3MTSA 1SLJA 1CSQA 1D5ZC 2F3IA 1I4PA 1LTGD 3H91A 4EQ5A 4P73A 2K33A 1BBUA 3U9OA 2F0JA 4G7HC 2KEEA 2ICIA 2MO0A 1Z9FA 2MFIA 1Q8IA 1PRTC 1QVGA 5D14A 1N34Q 1IBKQ 5LL6X 4L5QA 1LV9A 3WWVA 2JA6H 1U4PA 4JI7Q 3S17B 4K8IA 4DUZQ 5K36G 2J7ZA 1RKNA 1EIHA 3UDGA 1WI5A 4OL7A 2IWHA 1IKMA 1CZGA 5CORA 4A3MH 4X3SA 1WCMB 2EYFA 2N88A 3HOVG 2F4VQ 2JYOA 4QUFA 2F0GA 4DKAC 2WAQG 1AE3A 1WTPA 2JA5G 1JT8A 1YJ9A 1XMOQ 3JAME 4TSSA 2IX3A 2AQ2B 3TZUA 3MXGA 1UUPA 2L15A 5M5WH 1H9SA 3CC2A 1HNWQ 2CH4W 3GO5A 4TVAB 1EFID 3A74A 1EU4A 2SNSA 5J39A 4NXML 3PIO3 1JB7A 4L5TA 1I4QA 4H13C 3QIAA 4IFDJ 2K5HA 5C3EH 4LW1A 3S14B 1TWGB 2D9UA 3PUZA 3J7AV 3SK8A 2EY5A 1I50H 4X66Q 1A3UA 5FKAC 3I7FA 1TS3A 5ELBA 3TP5A 2KCCA 2Q2UA 4JW0A 4HCSA 3RLNA 3GV6A 3H94A 3I4MH 2UXDQ 1TXYA 4ALPA 5FLMH 1A2TA 1RODA 2R7DA 1M8AA 4EQPA 1KLUD 5AJ3L 5C4XB 1QWYA 3QJYA 1ZYRC 3RZDB 1GOZA 4F7XA 3S1QB 1EYGA 2BDOA 2I0QA 1AEXA 1GUTA 3TSSA 1Y14B 2FHTA 1T5XD 4ILWA 4B3ML 2IX1A 2FFKB 3OOCA 4XQQA 2MO1A 4DU9A 3D4RA 4IPGA 4KHPQ 2I5MX 2XWJB 1JORA 1F9RA 4CKEA 2KHJA 5IGCA 1EY5A 2OWOA 4X64L 3G6EA 1KTKA 4ID6A 3MXNB 1QILA 5C4JH 2JK8A 3NEMA 4CKBA 4WJ3M 2ASBA 5T1GA 1DOKA 4DV6Q 1B44D 4BWGB 4PZ6A 1YI2A 1K8OA 3NBHB 4KMUC 2R92H 1O78A 4AQYQ 3OWEB 1PYBA 4A3JB 4NXNQ 1Q12A 1GUSA 1HZCA 3K58A 1CKMA 2JA7H 3NBHA 1HNZL 1YHAA 2AWOA 1B1ZA 4DAMA 1EY9A 3A8IE 4RFBA 4L6TB 4JBWA 3E9IA 1WCMG 4FXKC 3J81c 1PXUA 1JWUD 4Y52H 3KLWA 3BJUA 1PMRA 3CQZH 1IBML 4A3EB 1WYDA 1WVLA 2YTVA 4DR3L 1G6PA 3HOYH 1SR3A 2A69C 1B9MA 5C3XA 2HIXA 1GUGA 3OIQA 3QOJA 3TMEA 3C3LA 1K3BC 1TWCH 5CR3A 5IYCH 1L0WA 1XPOA 1TS5A 1U9RA 4BBRH 2L12A 2D0OA 4N9PA 2EYJA 4BA1I 4A3DB 4LMQD 4JI5Q 1PFBA 1L1OA 2FINB 3ULPA 1K0RA 5KGUA 2XN9C 1XTCD 2UUBQ 3FKIG 5LL6S 2PO4A 2I46A 1JE4A 1MIUA 3GTLH 4UDUC 3M85A 2WACA 3CD6A 4DAYA 2O5IC 4K2LA 3F2BA 1EIGA 4V190 4DV0Q 4CHTB 1PH3A 1Y8NB 1LTID 1BCPF 1ASZA 4GLXA 5ELOA 3S24A 1AW7A 3GD7A 1N34L 3A0JA 2HCCA 1HFNA 1V8QA 4Y7NB 1XMQQ 5IYDG 4JI7L 1NMFA 4DUZL 3L7ZC 1IYJB 4KV6A 2F0QA 3CRLC 1JQYD 3CHBD 4K5XA 1SJED 2F0UA 3S2HB 2JA8B 3HEJA 4LF5Q 3KLSX 5JJZA 3AMUA 1IYVA 5DNFA 1QCBD 4IN3A 4LNQA 2NZOA 2AMCB 3D4WA 1I4XA 1XMOL 1HUMA 1BXTA 4GOPC 5DLQE 4DR6L 3GTQB 1EQTA 3J7AF 3S17H 3NQTA 2V4DA 1WD1A 2E2IB 1VQCA 1DM0B 1SNMA 3KF6B 3DUZA 2EQSA 4PNYA 1NY4A 1S5CD 4NP5A 3CXCA 1YBYA 3Q8DA 1SYCA 1VQKA 3K7UC 1PRTB 4QMGA 5FK9C 4HAEA 1NJIC 1YJWA 1TKWB 4A3GG 1P16A 1B53A 2N49A 1HA5A 1F2MA 3LNNA 1B50A 4RKLA 3CCRA 1I3QH 1CZWA 3EFXD 4JK1C 4X66L 1HZ9A 3SHLA 3BZKA 1Y69U 3OYYA 1F77A 1EOVA 3PIPA 2B29A 3K6OA 1Q8KA 1IXRA 1BBXC 4DK3C 4DV3Q 1QVFA 2UXDL 3T4AC 1JE5A 1MKHA 5IY0A 2HUGA 1N8RC 1OXSC 3G4SA 2RCFA 4HJ7A 1SFOH 4EX5A 3UDFA 1STGA 1PH9A 2PQAB 3D31A 1QE6A 1VQ8A 5IT9c 3OW7A 1IBLQ 1G8ZD 1X54A 1S72A 1X3QA 3S14H 3PO3H 1TWGH 1K3RA 3TDQA 4DF7A 2UU9Q 4ZKBB 3K59A 3HKSA 1EEFD 2K03A 1A63A 2YYZA 3S1NH 1SROA 5C4ZA 3LWUA 4KY6A 4UY8C 4IPHA 1HCZA 4LJZC 2XWBB 1CT1D 4ZUJA 1KDAA 3HOXB 1TT2A 4OXPA 4C3IG 1LUZA 4KHPL 4TQUS 3CF5A 4JPBW 5AFWA 3W1GA 3RUZA 5I2YA 2R7ZG 2XRSD 4R1JA 4HJ5A 5C4XH 1PH7A 2A1AA 3MVVA 4C56C 5M9OA 4J8QA 3S1QH 4G7ZC 3T16A 4ZK9B 5HGQA 5I9OA 1Z47A 1FJGL 5LMNQ 4RCNA 4DV6L 2H4OA 4K2KA 1R4QB 1SE4A 2J4XA 1AZPA 4N8FA 1B9NA 2XIWA 4B3RL 1NCVA 4DK0A 4AQYL 1EWIA 1YNNC 4NXNL 1XX8A 1DD2A 2OXPA 3CC4A 1UAPA 3NTKA 4OONA 3HG9A 1ILQA 4YWLA 2PI2E 3GTJB 3NSWA 2K4KA 3HP3A 2DY8A 1NE3A 4J1MA 1CKNA 1KRTA 2WINB 1EY8A 1S5FD 2BH8A 2JA8G 2K01A 3B6YA 4P74A 3A56A 2FMMA 3I2ZA 3EIVA 2L0CA 1RDPD 3F2DA 4L5RC 1HH2P 2PPBC 3ERQA 1TIID 5EPJA 2WB1G 5LMUQ 1FNUA 4A3JH 4DV1L 1J9OA 3EJIA 2KHSA 1W3SA 2F1MA 3TS0A 2VY3A 2Z9HA 1S5DD 1X3PA 4C3JH 4HIMA 2R93B 3SR1A 1W6JA 1JCKB 2LXKA 4MTNA 2HQLA 1TR5A 2A5HA 1KRSA 4JOIA 4JI5L 3HOWB 3JAMc 1G6ZA 1M4VA 2UUBL 4ZRZA 3HFZB 4A3EH 2GVAA 3ULJA 4NXMQ 4RGMA 4OO1H 3S15B 2RHQB 2PZUA 3I73A 5D65A 5I4DA 1K8GA 1KDBA 1WTVA 1J6QA 3K5OA 1J5EQ 2K5WA 4DV0L 5IP7G 1V43A 4OO1I 4JV5Q 1SBBB 3CCVA 2G9HD 3CAMA 3H0GB 1QUQB 1RTOA 4ZQ3A 3J80E 2X69A 1BUVT 3M4PA 5FLXE 2I5HA 4IPCA 1BBWA 1A8VA 4ULLA 4HJ8A 4A3DH 5IGDA 4WORA 2BE5C 4I7AA 5KYIA 3R2TA 1V9PA 1ZYRD 3CKIB 2K52A 3HKZE 3TEHB 1LO5D 4XXEA 1YNXA 1CHPD 3WOFA 4S3SA 3IRBA 3I55A 1A2UA 3T13A 2ZJQA 2PNHA 3OPOA 2RHSB 3HOXG 1MI2A 1D2BA 4JCVE 2Z4IA 2E2DC 4L8JA 1FD7D 4B3TL 2SEBD 4IUPA 3EBEA 1HRJA 2E2HB 1U4RA 1X3GA 1K28A 3T56B 2IY5B 1F9SA 4B3MQ 2K5QA 4JI2L 1V1PA 1MBYA 4KKSA 2JA5B 1S40A 3BDLA 2MGSA 3S2HH 4NDXA 1N33Q 3PO2B 3W3AA 4O0AA 4X64Q 4DAVA 5M3FB 2VB2X 4RGNA 1B3QA 3CPWA 1KC8C 3GTOB 4GKJQ 3KBGA 3NXWA 1ET6A 3GTQH 1L0XB 4NMZA 3VYRA 3RZOB 2E2IH 1JJGA 4DV3L 5ELCA 1GHJA 3TP8A 4PG3A 1PH2A 2RSOA 2H5XA 4ZKCB 1RHPA 4FXDA 3SK6A 2E2JB 3CCJA 1ZEQX 5CV8A 2K1BA 4GNXB 3L3OC 3J81L 4IUNA 4UPAA 1JB3A 1OXVA 2A69D 3L0OA 1EY0A 5BN5A 3NE5B 1RL2A 4GOPA 5D3DA 3RN2A 2GVBA 2R93G 4YWKA 4XTCS 1M1KC 2Y0SE 3IFDA 3M7NA 4XIGS 4DV2L 1VQHA 4DR3Q 4BY7H 2QKIC 4QB4A 4G4KA 2NN6H 1PTOB 1SRUA 3ZJYC 1SDFA 2A74C 4IALA 4X62Q 1LTRD 4TKOB 3WDNA 4OWXB 3HOWG 4JI1L 1K8MA 3BDOA 3SEBA 2NN6I 4O1NA 5JVG3 3HRZC 1OXXK 4CGYB 2EJGC 1PA6A 4IPDA 2ZJRA 1BCPC 4A3IG 2EYPA 1FL0A 1ASYA 4A3BB 2YU9B 3U4VA 5JPMC 4IFDG 2NVYB 4NW2A 1WOCA 1HZBA 5LMNL 1RJTA 1FNWA 3GTPH 4RWSC 3C2PA 2BCOA 1DOLA 2BDNA 4GN3B 4A93H 5JPNC 4RH6A 1D8LA 3HOXH 5CV7A 3M3YB 1X56A 2PMZE 3A8JE 1WTRA 4DNTB 2UUCQ 1KHIA 4O42A 1NMGA 4CJ0B 2E75C 3HZXA 2A68C 4POGA 3X3NA 4LAAA 3PUXA 5IYBH 2RVLA 4R8IA 1HTLD 1LYLA 1S5BD 5LMNW 5KEEA 2F0LA 5C3WA 3PF4A 1DYQA 1E2VA 2F0TA 3TBIB 1KIXA 5LMUL 2C9OA 4A3FB 5EBCA 1PH6A 2QILA 3CCEA 5GQOA 1EZ8A 4IUQA 3QR8A 1C4QA 3VR2A 1O7YA 5FO8B 4BY1H 3HOZB 2VUMG 1NR2A 4DV5L 3PO2G 1N9WA 1HQMC 1E24A 1PH4A 5C4HA 4DR6Q 3GP7A 3TP6A 1ENFA 3ITPA 3RLFA 5M3FG 1YHQA 1E1TA 1VQLA 1Q1EA 1VQMA 3E9HA 2P5ZX 3KF8B 4AIMA 1TWHB 2Y0SG 4HSVA 3A7AB 3VYTA 1J5EL 1D1KA 3I70A 2AQ1B 1STNA 1VQGA 2QEXA 2ZXPA 5IP9H 4JV5L 4DR2L 4X3KA 4KLKA 4APVA 1EQRA 1RCVD 2ALYB 5CBAE 5CV5A 2NVTB 1SAPA 3FKIB 2RKSA 1G2TA 2BA1A 1NAPA 5FJ8G 1IHZA 3A5ZB 4IOCA 2ES2A 1STBA 3KJOA 5C0XG 4KKUA 4PQXA 4LFBQ 2R61A 4P75A 1ICFB 2B2TC 1EU3A 1EY7A 4QJFA 4CKCA 4A3KH 3S15H 2Q2HA 3NUCA 5IT9L 4CDEC 3F1ZA 3H09A 3HOUG 4IFDH 3MFGA 4KJOA 2QEJC 1DGSA 4GLVB 2CFMA 3H0GH 2IW3A 3J81i 2A73B 1D7QA 1HXYD 3TS2A 4FP5D 4JI3L 3T1YL 1Q1BA 4P71A 1C7YA 2B8GA 1CQFA 3MXPA 4A3BG 4POFA 2D2CC 3TRZA 3AEVA 1ENAA 5NUCA 2QA4A 1N33L 1KQSA 4BXXG 3S1MB 5GADC 2CCZA 1LT6D 2XSCA 1R9TH 5K36H 3N52A 5GAEC 1BKBA 2IL8A 1PFNA 1VQ4A 3STBD 4GKJL 1LTBD 5JEAG 1F9QA 2E2HH 1FJGQ 4JI6Q 4B08A 1L2FA 4FVMA 4A3GB 1CTMA 2ZM6Q 3MXNA 3HOVH 4B3RQ 2F0WA 2JA5H 3C1FA 4RKBA 5CV6A 2DUDA 3FPUB 3GTKB 4UP9A 1JC7A 1CUKA 1LACA 5C44G 2PZTA 2O5JC 2K5VA 1H9MA 5C0XJ 1NNXA 3DEPA 4A3FG 2OTJA 2A6HC 1I4RA 4AYBE 2YV5A 3DXJC 2C5CA 4YWMA 4XQJA 3R93A 3HOZG 2F0VA 4ABNA 3H15A 1B2TA 5EKLA 2QDLA 1JOKA 4X62L 2K05A 1OXTA 3KBXA 1PLFA 3PQIA 4DV1Q 2E2JH 4FF4A 1GM5A 2HCIA 3DEOA 1Q3LA 4N9TA 4HIDA 3KUPA 3P1HA 5EJWA 1E0BA 2QGQA 4FF3A 1UWVA 3SDZA 3MEFA 4E6IA 1SE3A 4J15A 5EPLA 4C3IB 4JI8L 3MXUA 5LHY1 1GD7A 3K5LA 2R7ZB 2VW9A 5E4XA 2H1EA 3WOEA 3S2DB 3M4OB 4MZ9A 4GZYC 3BVZA 1LTTD 1K83H 2UUCL 3A8KE 1BR9A 3AFQA 1NR4A 2JSOA 3A55A 2BE5D 1Y1VB 2B2WC 2XNAC 5JEAJ 4HSPA 4LF6Q 1SE2A 2K6AA 1SMYC 1PYWD 2KA7A 4ZYSA 5I2XA 4PZ8A 2BA0A 2NVQB 3CU7A 1IL2A 4K5VA 3J80c 1F2YA 4XT1B 5FLXc 3FRPB 2PNRC 2NVXB 4JBKA 1JWSD 4X6AH 1PYSB 3GV3A 5M5YB 4JVZA 3K81C 1BCPB 3I4NG 5C5LA 3M3YH 1TY2A 4KD4A 1FGUA 1GVPA 5IIFA 1EY6A 2Q8IB 1IKLA 4GNXC 4B3TQ 4DN4M 1PH1A 2UXCL 4U68A 5EGTA 5DM73 2WB1B 4HN7A 1Q7YC 2JEAI 3K7AB 4ODGA 1O7ZA 1Q90A 2ZTCA 3NQIA 2WV6D 3M4YA 2LFNA 4JI2Q 4AYBG 4UHVA 3NENA 3ONAB 5JAVA 1B7YB 2TSSA 4OELB 1YIJA 1ET9A 3F2UA 1E3PA 1WCMH 1PTOC 3KF6A 3KJPA 2KENA 1SMXA 3NTIA 3DWPA 3JC66 1GKHA 2E5LL 4A3CG 1E7ZA 2SNMA 4HMJA 1CA6A 1XXGA 1GUOA 1U0LA 4DR5L 2I5LX 4LFBL 2ID0A 1HFGA 1PZJD 1U4MA 3SXHA 3LGJA 5M3MG 2RDFA 4IOAA 1HPCA 4LF9Q 5EKIA 4K6DA 5IGEA 3W1BA 2B63G 3PIOA 3OW2A 2QF7A 4JBMA 5GAGC 3K80C 5KNDA 1LTAD 3FKIH 2CQAA 2DJFC 3CPFA 3AYHB 2M00A 2PQAA 5J22A 4GN4B 1JICA 3DMUA 3D0FA 1W2BA 4DV2Q 3MEHA 1FYCA 3Q6SA 4JI1Q 1Y1WG 5IYDH 3IL8A 3NPPA 3RZDH 2JJQA 3E5SA 3VR5A 3JAMi 2MNAA 4BBSB 2HDMA 1STHA 4LUVA 1C9OA 1Y1VG 4JI6L 2MJ8A 2E8GA 1EY4A 5KRUA 5EBDA 5BR8Q 1PRTD 2ZM6L 4N8X1 2I07B 2B2TA 2XRQD 4OHJA 2A68D 3K8AA 4OWTB 1Y8PB 4NB3A 1T5EA 1M90C 1YITA 5M5XB 1D5XC 4IURA 2JA6B 2JN4A 1D1IA 3M9BA 1QNUA 2WKCA 4RMFA 4DV7L 2K32A 2IHEA 1KNAA 2G9DA 4KY5A 1UEAB 4LF4Q 4OIKA 4L5SA 3D6CA 4MHEA 5F2DA 1XYIA 4MIUA 4A3GH 2RDGA 1X6OA 4C3HG 1PH8A 4A75A 3SK5A 3J81j 3GTKH 3HGBA 1C0AA 1SYEA 5IWAQ 1STYA 1ZXTA 3N6RA 3O13A 4DV5Q 1BNZA 2KVMA 2ZJPA 1QJOA 1NTGA 4OWWB 1TVXA 2ZXRA 3HKZB 2B39A 4FDBA 1A15A 4XQNA 2RSNA 3I4OA 3MA2B 1TWFB 4A3IB 4K0KL 1ICWA 2A19A 4WJWA 4Z9CB 3NWSA 1LTLA 1R4PB 1QNKA 4XYOA 4C1NK 1RF2D 1AFPA 3VYSA 4DR2Q 4A76A 4R4CA 5I9PA 1EWHA 1N32L 5A2QL 3E0JA 4A3LG 3H3VC 4LF6L 3K5MA 1STEA 5JVH3 2PQEA 5CBEE 1BDOA 1A3VA 1K8AC 2K5NA 4I65A 4ZAIA 1KAWA 3PUVA 4C3IH 4LF8Q 4PV1C 2ATWA 1CKOA 3KFUA 1XPRA 2MUYA 2ZXOA 2A8VA 2F03A 1SNOA 1IL8A 2R7ZH 1QUQA 4RGOS 3J7ZC 4IO9A 4P2CB 2CKZB 2KEDA 1WTHA 3I3CA 5C5MA 1KDCA 3A7LA 2VL6A 3GDEA 4I7ZC 5G3LD 4B9WA 3I90A 2O4XA 1Y1VH 1VQJA 1SNDA 2V1CC 2EJMA 4Y7NH 4JI3Q 2HD3A 4G57A 3T1YQ 4QQBX
chains in the Genus database with same CATH topology
5GQOA 4HJ9A 1IBML 1XNRL 1WYDA 2NVQH 2YTVA 4RG1A 4DR3L 4C2MH 4AH6A 4BY1H 1G6PA 3HOYH 3KYHC 2VUMG 1SR3A 4GN5A 1OXUA 4IJHA 1N9WA 4DV5L 2NVXH 3PO2G 1E24A 1PH4A 4BBSG 4DR6Q 2DGYA 2HIXA 1LM0A 2PI2A 3KOJA 5M5YH 2JA8H 3RLFA 5M3FG 4HJAA 1E1TA 1YHQA 1VQLA 4B3SQ 3U50C 4QGUA 1Q1EA 3I4NH 4DV4Q 1VQMA 4A3DG 3E9HA 1TWCH 1EQQA 4LFCQ 5IYCH 1L0WA 3KF8B 2JA9A 1XPOA 1HJPA 4AIMA 4BBRH 2D0OA 2OTLA 2Y0SG 4BA1I 2UUAQ 1X3EA 4JI5Q 3ERSX 1J5EL 1L1OA 4YY3L 1K0RA 3ULPA 1VQGA 2QEXA 2UUBQ 2JA6G 4JV5L 5IP9H 2KHIA 3H3VH 4DR2L 1MJCA 4KLKA 3FKIG 1EQRA 4APVA 3BU2A 3A5UA 2ALYB 3S1MH 1MIUA 2FXQA 2RCNA 3GTLH 1JJCB 3M85A 2KBNA 3H3VI 3CD6A 2BA1A 5FJ8G 3A5ZB 3F2BA 4IOCA 2ES2A 3KJOA 4DV0Q 1PH3A 4WJ4A 4R4IA 5C0XG 4A3MG 4QY7A 4LF9L 4LFBQ 1ASZA 4GLXA 5ELOA 3S24A 4P75A 3GD7A 3STBC 2XGTA 2VS1A 3A0JA 1CKNB 1N34L 1Q86C 2GN5A 1XMQQ 5IYDG 5GROA 4A3KH 4QJFA 3FP9A 3S15H 4JI7L 2Q2HA 1NMFA 4DUZL 3L7ZC 1IYJB 1VQBA 2R7FA 4R4QA 3F1ZA 5JJKA 4GNXA 4A3CH 5GAHC 4NPSA 3HOUG 1XNQL 1K9MC 3CC7A 1DGSA 4GLVB 3UDXA 2CFMA 3H0GH 5JJIA 2WAQE 3J81i 5H1SE 2LSSA 5IP7H 1VQ7A 3RN5A 1D7QA 4LFAL 3TS2A 4LF5Q 1QZHA 4JI3L 1G291 3T1YL 3UDIA 1Q1BA 3HKZG 4P71A 1C7YA 4DR1L 4YHHQ 2NZOA 1XJVA 3EN2A 2AMCB 4LNQA 4A3BG 4POFA 5M3MH 1XMOL 2HHHQ 2D62A 3TRZA 3AEVA 4GOPC 3RNUA 1N36L 5DLQE 4DR6L 2B63H 2QA4A 3UE1A 3S17H 1N33L 1A62A 1KQSA 4BXXG 3TREA 4JBJA 5GADC 4JI8Q 1VQCA 2CCZA 1R9TH 3KF6B 1VS0A 2EQSA 1NY4A 5GAEC 2VNUD 1HZAA 4LFCL 3U4ZA 1BKBA 3PUWA 1YBYA 3Q8DA 3CXCA 2K50A 5BR8L 1PVOA 1VQ4A 1VQKA 2ZTDA 2UXBQ 3STBD 2UUAL 4JI0L 3I4MG 3K7UC 5EAYA 4GKJL 2AWNA 1NJIC 1YEZA 5JEAG 1YJNA 2E2HH 5FLMG 2F52A 1YJWA 1P16A 1HNXQ 1FJGQ 4A3GG 2N49A 4JI6Q 1GO3E 2NZHA 4DNIA 5E7NA 1L2FA 4OX9Q 3CCRA 1SN8A 2XTIA 3T1HQ 1I3QH 2ZM6Q 3HOVH 1H95A 4X66L 1Y1WH 2IHFA 1HZ9A 3CMEA 3KDFB 4DR4Q 3BZKA 4B3RQ 3S16H 4LUOA 3OYYA 2JA5H 1RIPA 1EOVA 3PIPA 2VZAA 3S2DH 2DUDA 4BY7G 2B29A 2NN6G 3M4OH 1Q8KA 4UP9A 3PF5A 1IXRA 2JE6I 4DK3C 4DV3Q 4LF4L 1CUKA 2JEBI 5C44G 1Q82C 2K5VA 3KDFA 1XMQL 1QVFA 5C0XJ 2UXDL 1JE5A 1MKHA 1FVIA 5IY0A 4A3FG 1N8RC 1OXSC 1EFWA 3G4SA 2OTJA 4HJ7A 1SFOH 4EX5A 3UDFA 4AYBE 1PH9A 2PQAB 2YV5A 3D31A 3PSIA 4YWMA 2VQFQ 4HIOA 1VQ8A 5IT9c 2C35B 3HOZG 5M5XH 1IBLQ 1X54A 1S72A 3PO3H 2YTXA 3H15A 1TWGH 2R6GA 1EUJA 1K3RA 3GTJH 3S14H 2Z6KC 2UU9Q 5IWAL 4LF5L 3HKSA 4X62L 1B70B 1A63A 5AJ3Q 1OXTA 2YYZA 1X9NA 1V1QA 1VQPA 3S1NH 1SROA 4DV1Q 2UXCQ 2E2JH 3RLOA 4UY8C 4JI4L 4A93G 4IPHA 1GM5A 4HIDA 2LXJA 2QGQA 3PV0A 4OXPA 1UWVA 1WFQA 1LUZA 4KHPL 3MEFA 3E0EA 4TQUS 1UEBA 3AQQA 5IE8A 3CMAA 3CF5A 4GKKL 4J15A 1AE2A 3W1GA 2R7ZG 4HJ5A 4R1JA 2VQEQ 4JI8L 1IZ6A 5C4XH 3OTOQ 2R92G 1PH7A 1GD7A 3DM3A 4QL5A 3CP0A 3UE0A 1VQOA 2A1AA 1PV4A 1NBWA 4C3HH 2VW9A 1U5KA 1KL9A 2OQ0A 2JA7G 3K7AH 5IYBG 3S1QH 2E5LQ 2R93H 4MZ9A 5HGQA 4YCUA 2K75A 1HNXL 1Z47A 1FJGL 5LMNQ 1K83H 4DV6L 2UUCL 3AFQA 4DR5Q 4OX9L 4LF8L 3CCSA 3HOWH 1YHBA 4YCWA 5JEAJ 4DR7Q 5J3BA 4LF6Q 4B3RL 1I6HH 4AQYL 1L1OC 1JMCA 1EWIA 4NXNL 1QVCA 2IT1A 1TWFH 4A3IH 3CC4A 1I5FA 4BY1G 1VQ9A 5JJLA 3HOYG 4OONA 4X65Q 4PZ8A 4R4TA 2BA0A 1VQAA 4YWLA 2PI2E 1IL2A 3AFPA 3J80c 4DUYL 2K4KA 1YZ6A 5FLXc 1NE3A 1CKNA 1KRTA 1K73C 4PMWA 1WJJA 1MJEA 2BH8A 1I94L 1VCIA 4JBKA 2JA8G 2EIFA 4X6AH 4MNOA 4BA2I 1PYSB 3GTGH 2OCEA 1P8LA 3K81C 3I4NG 2EXDA 4IFDI 3B6YA 4P74A 2IX0A 4A3LH 3M3YH 1HNZQ 5IYCG 1PFSA 2CWPA 3CW2C 2VQFL 4GOPB 4BBRG 3I2ZA 1IBLL 3EIVA 1FGUA 4IJLA 1GVPA 3F2DA 1HR0Q 4L5RC 2UU9L 1HH2P 3CCLA 3K0XA 5IP9G 3F2CA 1UE5A 2WB1G 5LMUQ 4GNXC 4B3TQ 5C3EG 1PH1A 4A3JH 2UXBL 4DV1L 2UXCL 1W3SA 2BH2A 1YVCA 3ULLA 4A4IA 4OO1G 2CQOA 1VQFA 3TS0A 2VY3A 1IBMQ 1Q7YC 2JEAI 2ZTCA 4C3JH 4HIMA 4B3SL 4JYAQ 4JI2Q 1OTCA 2LXKA 4MTNA 4DV4L 2HQLA 4AYBG 4P72A 2WP8J 1KRSA 2RF4A 3NENA 1B8AA 1B7YB 4UP7A 3PGZA 2VQEL 4JOIA 4JI5L 2CWAA 1YIJA 4LF7Q 3JAMc 4JG2A 1X55A 4A3KG 1E3PA 1WCMH 1E1OA 3KF6A 1G51A 3M4QA 2KENA 3KJPA 1SMXA 2UUBL 3HFZB 4KI0A 2AHOB 1VQNA 4A3EH 2GVAA 4QIWE 3ULJA 3JC66 1GKHA 2E5LL 4NXMQ 1X65A 1E7ZA 4A3CG 2N3SA 2RHQB 4PZ7A 2B3GA 1K8GA 4DPGA 1J6QA 3H0GG 1J5EQ 4JC0A 4DV0L 5IP7G 1BVSA 1V43A 1U0LA 1Q81C 4JV5Q 2VUMH 3CCVA 4DR5L 4OO1I 2I5LX 4H02A 4BBSH 3CAMA 3PO2H 4LFBL 1SLJA 2ID0A 4DR7L 1CSQA 2F3IA 4JOIC 1QUQB 4EQ5A 4DV7Q 4P73A 3M4PA 3LGJA 1BBUA 2I5HA 4IPCA 5M3MG 5M3FH 1BBWA 1A8VA 4GS3A 4HJ8A 4IOAA 2KCMA 4A3DH 2MO0A 1Z9FA 2MFIA 3J80i 3GTOH 4LF9Q 3W1BA 2B63G 1V9PA 3PIOA 1QVGA 2K52A 3OW2A 1N34Q 1IBKQ 3HKZE 4L5QA 4JBMA 3RZOH 5GAGC 1UE7A 3TEHB 3WWVA 1T9HA 2N78A 2JA6H 3K80C 4JI7Q 1YNXA 4DUZQ 5K36G 3FKIH 3IRBA 3I55A 3CPFA 3UDGA 1WI5A 3AYHB 2ZJQA 2PNHA 2PQAA 2RHSB 4GN4B 3ICEA 4YHHL 1A0IA 3F8TA 3D0FA 3G48A 4LUZA 5FJ8H 3HOXG 1W2BA 4HIKA 4DV2Q 1HR0L 4JCVE 4LWCA 2HHHL 3FHWA 4A3MH 2Z0SA 5ELNA 4B3TL 1QZGA 3EBEA 1VQ6A 1KXLA 4JI1Q 2F4VQ 1X3GA 3HOVG 5C0XI 1Y1WG 4DR1Q 4DKAC 2WAQG 2IY5B 5IYDH 4ME3A 4R4OA 1AE3A 2JA5G 4B3MQ 3GTMH 1JT8A 1YJ9A 1XMOQ 4JYAL 4JI2L 1VQDA 4DK6C 3RZDH 2HIVA 2JJQA 2L15A 1N36Q 3TQYA 3HOUH 1S40A 5M5WH 4K0KQ 4LF7L 3S2HH 3JAMi 1N33Q 2ZTEA 2MNAA 4LUVA 1L1OB 1C9OA 3CC2A 4O0AA 1HNWQ 1Y1VG 3GO5A 4TVAB 4X64Q 4JI6L 1CSPA 3A74A 3RR5A 4KHZA 2E8GA 4NXML 2Q2TA 1N32Q 3T1HL 5BR8Q 2ZM6L 1HR0W 2K14A 3CPWA 4JI0Q 1XTDA 4YCVA 2YTYA 1KC8C 1KD1C 4DR4L 4DAYB 4A3BH 2YU9H 4GLAC 1JB7A 4GKJQ 3PO3G 3K8AA 4L5TA 4OWTB 1UE1A 2D0PA 4NB3A 3GTQH 1M90C 1YITA 4IFDJ 2K5HA 5C3EH 2NVYH 4LW1A 2E2IH 1JJGA 4DV3L 1EIYB 3PUZA 3M9BA 1I50H 4PG3A 4X66Q 4RMFA 4DV7L 4BXXH 1PH2A 2H5XA 3I7FA 2IHEA 3PUYA 3G71A 2Q2UA 3CCJA 3RLNA 4O2DA 4GNXB 3S1RH 4LF4Q 1IBKL 3I4MH 1SE8A 1O7IA 1TWAH 4L5SA 2UXDQ 1TXYA 4ALPA 4UPAA 5C4XG 5FLMH 4A3GH 1OXVA 2R7DA 1S3OA 1X6OA 1PH8A 1JJ2A 3L0OA 5AJ3L 4A75A 3I56A 4UP8A 5HY6A 1RL2A 4GOPA 3RN2A 2GVBA 3J81j 2WFWA 3GTKH 1X3FA 4YWKA 2R93G 1Q46A 4XTCS 2Y0SE 1M1KC 1XNRQ 1VQ5A 4XIGS 4DV2L 3M7NA 1VQHA 1C0AA 4DR3Q 4BY7H 1EYGA 2OQKA 3ZJYC 1SRUA 5IWAQ 3L2PA 4X62Q 2I0QA 4OWXB 3HOWG 4DV5Q 3PCOB 5C44H 4JI1L 2F4VL 2ZJPA 2NN6I 1NTGA 4JI4Q 1Y14B 4OWWB 3OTOL 1OXXK 2IX1A 4B3ML 4A3FH 1PA6A 4IPDA 2ZJRA 4A3IG 1FL0A 2MO1A 1ASYA 4FDBA 4IPGA 3U4VA 4KHPQ 3I4OA 2I5MX 2N8NA 4K0KL 4GKKQ 2JQOA 4IFDG 3HOZH 1EIFA 2A19A 2KHJA 1WOCA 1HNWL 2OWOA 1HZBA 4X64L 5LMNL 1AH9A 4YY3Q 1LTLA 3GTPH 3DLLA 2AKWB 3G6EA 4DR2Q 4A76A 4R4CA 1N32L 3U58A 4A3LG 1VQEA 4GN3B 3NELA 2Q2IA 3MXNB 4LF6L 4A93H 1D8LA 5C4JH 2JK8A 3NEMA 3SGIA 3HOXH 4WJ3M 1X56A 2MQHA 2ASBA 2PMZE 3BZCA 1TWHH 1K8AC 4DV6Q 2UUCQ 4X65L 1E22A 1KHIA 2K5NA 1KAWA 3PUVA 4PZ6A 4C3IH 1YI2A 4LF8Q 1NMGA 3NBHB 1CKOA 4A3JG 1XPRA 2ATWA 2A8VA 3KFUA 2KCTA 2R7ZH 1QUQA 3J7ZC 2R92H 1PH5A 4IO9A 4AQYQ 3CCQA 1PYBA 2CKZB 4NXNQ 1Q12A 4POGA 1HZCA 3J7A5 3PUXA 1CKMA 2Z6KA 2NVTH 3W5OA 3CCMA 2JA7H 1HNZL 5IYBH 2WB1E 1YHAA 3CCUA 4DUYQ 2VL6A 2AWOA 1LYLA 3GDEA 4DAMA 5LMNW 1PHJA 1XNQQ 1XPUA 2HT1A 1VQIA 1I94Q 1Y1VH 3PF4A 4JBWA 3E9IA 1VQJA 1WCMG 3J81c 2V1CC 1UE6A 3ER0A 1KIXA 5LMUL 4LFAQ 4A3EG 4Y7NH 4JI3Q 3VDYA 1PH6A 3KLWA 4Y52H 3BJUA 3T1YQ 3CQZH 3CCEA 4QQBX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GQO A;  4HJ9 A;  1IBM L;  1XNR L;  1WYD A;  2NVQ H;  2YTV A;  4RG1 A;  4DR3 L;  4C2M H;  4AH6 A;  4BY1 H;  1G6P A;  3HOY H;  3KYH C;  2VUM G;  1SR3 A;  4GN5 A;  1OXU A;  4IJH A;  1N9W A;  4DV5 L;  2NVX H;  3PO2 G;  1E24 A;  1PH4 A;  4BBS G;  4DR6 Q;  2DGY A;  2HIX A;  1LM0 A;  2PI2 A;  3KOJ A;  5M5Y H;  2JA8 H;  3RLF A;  5M3F G;  4HJA A;  1E1T A;  1YHQ A;  1VQL A;  4B3S Q;  3U50 C;  4QGU A;  1Q1E A;  3I4N H;  4DV4 Q;  1VQM A;  4A3D G;  3E9H A;  1TWC H;  1EQQ A;  4LFC Q;  5IYC H;  1L0W A;  3KF8 B;  2JA9 A;  1XPO A;  1HJP A;  4AIM A;  4BBR H;  2D0O A;  2OTL A;  2Y0S G;  4BA1 I;  2UUA Q;  1X3E A;  4JI5 Q;  3ERS X;  1J5E L;  1L1O A;  4YY3 L;  1K0R A;  3ULP A;  1VQG A;  2QEX A;  2UUB Q;  2JA6 G;  4JV5 L;  5IP9 H;  2KHI A;  3H3V H;  4DR2 L;  1MJC A;  4KLK A;  3FKI G;  1EQR A;  4APV A;  3BU2 A;  3A5U A;  2ALY B;  3S1M H;  1MIU A;  2FXQ A;  2RCN A;  3GTL H;  1JJC B;  3M85 A;  2KBN A;  3H3V I;  3CD6 A;  2BA1 A;  5FJ8 G;  3A5Z B;  3F2B A;  4IOC A;  2ES2 A;  3KJO A;  4DV0 Q;  1PH3 A;  4WJ4 A;  4R4I A;  5C0X G;  4A3M G;  4QY7 A;  4LF9 L;  4LFB Q;  1ASZ A;  4GLX A;  5ELO A;  3S24 A;  4P75 A;  3GD7 A;  3STB C;  2XGT A;  2VS1 A;  3A0J A;  1CKN B;  1N34 L;  1Q86 C;  2GN5 A;  1XMQ Q;  5IYD G;  5GRO A;  4A3K H;  4QJF A;  3FP9 A;  3S15 H;  4JI7 L;  2Q2H A;  1NMF A;  4DUZ L;  3L7Z C;  1IYJ B;  1VQB A;  2R7F A;  4R4Q A;  3F1Z A;  5JJK A;  4GNX A;  4A3C H;  5GAH C;  4NPS A;  3HOU G;  1XNQ L;  1K9M C;  3CC7 A;  1DGS A;  4GLV B;  3UDX A;  2CFM A;  3H0G H;  5JJI A;  2WAQ E;  3J81 i;  5H1S E;  2LSS A;  5IP7 H;  1VQ7 A;  3RN5 A;  1D7Q A;  4LFA L;  3TS2 A;  4LF5 Q;  1QZH A;  4JI3 L;  1G29 1;  3T1Y L;  3UDI A;  1Q1B A;  3HKZ G;  4P71 A;  1C7Y A;  4DR1 L;  4YHH Q;  2NZO A;  1XJV A;  3EN2 A;  2AMC B;  4LNQ A;  4A3B G;  4POF A;  5M3M H;  1XMO L;  2HHH Q;  2D62 A;  3TRZ A;  3AEV A;  4GOP C;  3RNU A;  1N36 L;  5DLQ E;  4DR6 L;  2B63 H;  2QA4 A;  3UE1 A;  3S17 H;  1N33 L;  1A62 A;  1KQS A;  4BXX G;  3TRE A;  4JBJ A;  5GAD C;  4JI8 Q;  1VQC A;  2CCZ A;  1R9T H;  3KF6 B;  1VS0 A;  2EQS A;  1NY4 A;  5GAE C;  2VNU D;  1HZA A;  4LFC L;  3U4Z A;  1BKB A;  3PUW A;  1YBY A;  3Q8D A;  3CXC A;  2K50 A;  5BR8 L;  1PVO A;  1VQ4 A;  1VQK A;  2ZTD A;  2UXB Q;  3STB D;  2UUA L;  4JI0 L;  3I4M G;  3K7U C;  5EAY A;  4GKJ L;  2AWN A;  1NJI C;  1YEZ A;  5JEA G;  1YJN A;  2E2H H;  5FLM G;  2F52 A;  1YJW A;  1P16 A;  1HNX Q;  1FJG Q;  4A3G G;  2N49 A;  4JI6 Q;  1GO3 E;  2NZH A;  4DNI A;  5E7N A;  1L2F A;  4OX9 Q;  3CCR A;  1SN8 A;  2XTI A;  3T1H Q;  1I3Q H;  2ZM6 Q;  3HOV H;  1H95 A;  4X66 L;  1Y1W H;  2IHF A;  1HZ9 A;  3CME A;  3KDF B;  4DR4 Q;  3BZK A;  4B3R Q;  3S16 H;  4LUO A;  3OYY A;  2JA5 H;  1RIP A;  1EOV A;  3PIP A;  2VZA A;  3S2D H;  2DUD A;  4BY7 G;  2B29 A;  2NN6 G;  3M4O H;  1Q8K A;  4UP9 A;  3PF5 A;  1IXR A;  2JE6 I;  4DK3 C;  4DV3 Q;  4LF4 L;  1CUK A;  2JEB I;  5C44 G;  1Q82 C;  2K5V A;  3KDF A;  1XMQ L;  1QVF A;  5C0X J;  2UXD L;  1JE5 A;  1MKH A;  1FVI A;  5IY0 A;  4A3F G;  1N8R C;  1OXS C;  1EFW A;  3G4S A;  2OTJ A;  4HJ7 A;  1SFO H;  4EX5 A;  3UDF A;  4AYB E;  1PH9 A;  2PQA B;  2YV5 A;  3D31 A;  3PSI A;  4YWM A;  2VQF Q;  4HIO A;  1VQ8 A;  5IT9 c;  2C35 B;  3HOZ G;  5M5X H;  1IBL Q;  1X54 A;  1S72 A;  3PO3 H;  2YTX A;  3H15 A;  1TWG H;  2R6G A;  1EUJ A;  1K3R A;  3GTJ H;  3S14 H;  2Z6K C;  2UU9 Q;  5IWA L;  4LF5 L;  3HKS A;  4X62 L;  1B70 B;  1A63 A;  5AJ3 Q;  1OXT A;  2YYZ A;  1X9N A;  1V1Q A;  1VQP A;  3S1N H;  1SRO A;  4DV1 Q;  2UXC Q;  2E2J H;  3RLO A;  4UY8 C;  4JI4 L;  4A93 G;  4IPH A;  1GM5 A;  4HID A;  2LXJ A;  2QGQ A;  3PV0 A;  4OXP A;  1UWV A;  1WFQ A;  1LUZ A;  4KHP L;  3MEF A;  3E0E A;  4TQU S;  1UEB A;  3AQQ A;  5IE8 A;  3CMA A;  3CF5 A;  4GKK L;  4J15 A;  1AE2 A;  3W1G A;  2R7Z G;  4HJ5 A;  4R1J A;  2VQE Q;  4JI8 L;  1IZ6 A;  5C4X H;  3OTO Q;  2R92 G;  1PH7 A;  1GD7 A;  3DM3 A;  4QL5 A;  3CP0 A;  3UE0 A;  1VQO A;  2A1A A;  1PV4 A;  1NBW A;  4C3H H;  2VW9 A;  1U5K A;  1KL9 A;  2OQ0 A;  2JA7 G;  3K7A H;  5IYB G;  3S1Q H;  2E5L Q;  2R93 H;  4MZ9 A;  5HGQ A;  4YCU A;  2K75 A;  1HNX L;  1Z47 A;  1FJG L;  5LMN Q;  1K83 H;  4DV6 L;  2UUC L;  3AFQ A;  4DR5 Q;  4OX9 L;  4LF8 L;  3CCS A;  3HOW H;  1YHB A;  4YCW A;  5JEA J;  4DR7 Q;  5J3B A;  4LF6 Q;  4B3R L;  1I6H H;  4AQY L;  1L1O C;  1JMC A;  1EWI A;  4NXN L;  1QVC A;  2IT1 A;  1TWF H;  4A3I H;  3CC4 A;  1I5F A;  4BY1 G;  1VQ9 A;  5JJL A;  3HOY G;  4OON A;  4X65 Q;  4PZ8 A;  4R4T A;  2BA0 A;  1VQA A;  4YWL A;  2PI2 E;  1IL2 A;  3AFP A;  3J80 c;  4DUY L;  2K4K A;  1YZ6 A;  5FLX c;  1NE3 A;  1CKN A;  1KRT A;  1K73 C;  4PMW A;  1WJJ A;  1MJE A;  2BH8 A;  1I94 L;  1VCI A;  4JBK A;  2JA8 G;  2EIF A;  4X6A H;  4MNO A;  4BA2 I;  1PYS B;  3GTG H;  2OCE A;  1P8L A;  3K81 C;  3I4N G;  2EXD A;  4IFD I;  3B6Y A;  4P74 A;  2IX0 A;  4A3L H;  3M3Y H;  1HNZ Q;  5IYC G;  1PFS A;  2CWP A;  3CW2 C;  2VQF L;  4GOP B;  4BBR G;  3I2Z A;  1IBL L;  3EIV A;  1FGU A;  4IJL A;  1GVP A;  3F2D A;  1HR0 Q;  4L5R C;  2UU9 L;  1HH2 P;  3CCL A;  3K0X A;  5IP9 G;  3F2C A;  1UE5 A;  2WB1 G;  5LMU Q;  4GNX C;  4B3T Q;  5C3E G;  1PH1 A;  4A3J H;  2UXB L;  4DV1 L;  2UXC L;  1W3S A;  2BH2 A;  1YVC A;  3ULL A;  4A4I A;  4OO1 G;  2CQO A;  1VQF A;  3TS0 A;  2VY3 A;  1IBM Q;  1Q7Y C;  2JEA I;  2ZTC A;  4C3J H;  4HIM A;  4B3S L;  4JYA Q;  4JI2 Q;  1OTC A;  2LXK A;  4MTN A;  4DV4 L;  2HQL A;  4AYB G;  4P72 A;  2WP8 J;  1KRS A;  2RF4 A;  3NEN A;  1B8A A;  1B7Y B;  4UP7 A;  3PGZ A;  2VQE L;  4JOI A;  4JI5 L;  2CWA A;  1YIJ A;  4LF7 Q;  3JAM c;  4JG2 A;  1X55 A;  4A3K G;  1E3P A;  1WCM H;  1E1O A;  3KF6 A;  1G51 A;  3M4Q A;  2KEN A;  3KJP A;  1SMX A;  2UUB L;  3HFZ B;  4KI0 A;  2AHO B;  1VQN A;  4A3E H;  2GVA A;  4QIW E;  3ULJ A;  3JC6 6;  1GKH A;  2E5L L;  4NXM Q;  1X65 A;  1E7Z A;  4A3C G;  2N3S A;  2RHQ B;  4PZ7 A;  2B3G A;  1K8G A;  4DPG A;  1J6Q A;  3H0G G;  1J5E Q;  4JC0 A;  4DV0 L;  5IP7 G;  1BVS A;  1V43 A;  1U0L A;  1Q81 C;  4JV5 Q;  2VUM H;  3CCV A;  4DR5 L;  4OO1 I;  2I5L X;  4H02 A;  4BBS H;  3CAM A;  3PO2 H;  4LFB L;  1SLJ A;  2ID0 A;  4DR7 L;  1CSQ A;  2F3I A;  4JOI C;  1QUQ B;  4EQ5 A;  4DV7 Q;  4P73 A;  3M4P A;  3LGJ A;  1BBU A;  2I5H A;  4IPC A;  5M3M G;  5M3F H;  1BBW A;  1A8V A;  4GS3 A;  4HJ8 A;  4IOA A;  2KCM A;  4A3D H;  2MO0 A;  1Z9F A;  2MFI A;  3J80 i;  3GTO H;  4LF9 Q;  3W1B A;  2B63 G;  1V9P A;  3PIO A;  1QVG A;  2K52 A;  3OW2 A;  1N34 Q;  1IBK Q;  3HKZ E;  4L5Q A;  4JBM A;  3RZO H;  5GAG C;  1UE7 A;  3TEH B;  3WWV A;  1T9H A;  2N78 A;  2JA6 H;  3K80 C;  4JI7 Q;  1YNX A;  4DUZ Q;  5K36 G;  3FKI H;  3IRB A;  3I55 A;  3CPF A;  3UDG A;  1WI5 A;  3AYH B;  2ZJQ A;  2PNH A;  2PQA A;  2RHS B;  4GN4 B;  3ICE A;  4YHH L;  1A0I A;  3F8T A;  3D0F A;  3G48 A;  4LUZ A;  5FJ8 H;  3HOX G;  1W2B A;  4HIK A;  4DV2 Q;  1HR0 L;  4JCV E;  4LWC A;  2HHH L;  3FHW A;  4A3M H;  2Z0S A;  5ELN A;  4B3T L;  1QZG A;  3EBE A;  1VQ6 A;  1KXL A;  4JI1 Q;  2F4V Q;  1X3G A;  3HOV G;  5C0X I;  1Y1W G;  4DR1 Q;  4DKA C;  2WAQ G;  2IY5 B;  5IYD H;  4ME3 A;  4R4O A;  1AE3 A;  2JA5 G;  4B3M Q;  3GTM H;  1JT8 A;  1YJ9 A;  1XMO Q;  4JYA L;  4JI2 L;  1VQD A;  4DK6 C;  3RZD H;  2HIV A;  2JJQ A;  2L15 A;  1N36 Q;  3TQY A;  3HOU H;  1S40 A;  5M5W H;  4K0K Q;  4LF7 L;  3S2H H;  3JAM i;  1N33 Q;  2ZTE A;  2MNA A;  4LUV A;  1L1O B;  1C9O A;  3CC2 A;  4O0A A;  1HNW Q;  1Y1V G;  3GO5 A;  4TVA B;  4X64 Q;  4JI6 L;  1CSP A;  3A74 A;  3RR5 A;  4KHZ A;  2E8G A;  4NXM L;  2Q2T A;  1N32 Q;  3T1H L;  5BR8 Q;  2ZM6 L;  1HR0 W;  2K14 A;  3CPW A;  4JI0 Q;  1XTD A;  4YCV A;  2YTY A;  1KC8 C;  1KD1 C;  4DR4 L;  4DAY B;  4A3B H;  2YU9 H;  4GLA C;  1JB7 A;  4GKJ Q;  3PO3 G;  3K8A A;  4L5T A;  4OWT B;  1UE1 A;  2D0P A;  4NB3 A;  3GTQ H;  1M90 C;  1YIT A;  4IFD J;  2K5H A;  5C3E H;  2NVY H;  4LW1 A;  2E2I H;  1JJG A;  4DV3 L;  1EIY B;  3PUZ A;  3M9B A;  1I50 H;  4PG3 A;  4X66 Q;  4RMF A;  4DV7 L;  4BXX H;  1PH2 A;  2H5X A;  3I7F A;  2IHE A;  3PUY A;  3G71 A;  2Q2U A;  3CCJ A;  3RLN A;  4O2D A;  4GNX B;  3S1R H;  4LF4 Q;  1IBK L;  3I4M H;  1SE8 A;  1O7I A;  1TWA H;  4L5S A;  2UXD Q;  1TXY A;  4ALP A;  4UPA A;  5C4X G;  5FLM H;  4A3G H;  1OXV A;  2R7D A;  1S3O A;  1X6O A;  1PH8 A;  1JJ2 A;  3L0O A;  5AJ3 L;  4A75 A;  3I56 A;  4UP8 A;  5HY6 A;  1RL2 A;  4GOP A;  3RN2 A;  2GVB A;  3J81 j;  2WFW A;  3GTK H;  1X3F A;  4YWK A;  2R93 G;  1Q46 A;  4XTC S;  2Y0S E;  1M1K C;  1XNR Q;  1VQ5 A;  4XIG S;  4DV2 L;  3M7N A;  1VQH A;  1C0A A;  4DR3 Q;  4BY7 H;  1EYG A;  2OQK A;  3ZJY C;  1SRU A;  5IWA Q;  3L2P A;  4X62 Q;  2I0Q A;  4OWX B;  3HOW G;  4DV5 Q;  3PCO B;  5C44 H;  4JI1 L;  2F4V L;  2ZJP A;  2NN6 I;  1NTG A;  4JI4 Q;  1Y14 B;  4OWW B;  3OTO L;  1OXX K;  2IX1 A;  4B3M L;  4A3F H;  1PA6 A;  4IPD A;  2ZJR A;  4A3I G;  1FL0 A;  2MO1 A;  1ASY A;  4FDB A;  4IPG A;  3U4V A;  4KHP Q;  3I4O A;  2I5M X;  2N8N A;  4K0K L;  4GKK Q;  2JQO A;  4IFD G;  3HOZ H;  1EIF A;  2A19 A;  2KHJ A;  1WOC A;  1HNW L;  2OWO A;  1HZB A;  4X64 L;  5LMN L;  1AH9 A;  4YY3 Q;  1LTL A;  3GTP H;  3DLL A;  2AKW B;  3G6E A;  4DR2 Q;  4A76 A;  4R4C A;  1N32 L;  3U58 A;  4A3L G;  1VQE A;  4GN3 B;  3NEL A;  2Q2I A;  3MXN B;  4LF6 L;  4A93 H;  1D8L A;  5C4J H;  2JK8 A;  3NEM A;  3SGI A;  3HOX H;  4WJ3 M;  1X56 A;  2MQH A;  2ASB A;  2PMZ E;  3BZC A;  1TWH H;  1K8A C;  4DV6 Q;  2UUC Q;  4X65 L;  1E22 A;  1KHI A;  2K5N A;  1KAW A;  3PUV A;  4PZ6 A;  4C3I H;  1YI2 A;  4LF8 Q;  1NMG A;  3NBH B;  1CKO A;  4A3J G;  1XPR A;  2ATW A;  2A8V A;  3KFU A;  2KCT A;  2R7Z H;  1QUQ A;  3J7Z C;  2R92 H;  1PH5 A;  4IO9 A;  4AQY Q;  3CCQ A;  1PYB A;  2CKZ B;  4NXN Q;  1Q12 A;  4POG A;  1HZC A;  3J7A 5;  3PUX A;  1CKM A;  2Z6K A;  2NVT H;  3W5O A;  3CCM A;  2JA7 H;  1HNZ L;  5IYB H;  2WB1 E;  1YHA A;  3CCU A;  4DUY Q;  2VL6 A;  2AWO A;  1LYL A;  3GDE A;  4DAM A;  5LMN W;  1PHJ A;  1XNQ Q;  1XPU A;  2HT1 A;  1VQI A;  1I94 Q;  1Y1V H;  3PF4 A;  4JBW A;  3E9I A;  1VQJ A;  1WCM G;  3J81 c;  2V1C C;  1UE6 A;  3ER0 A;  1KIX A;  5LMU L;  4LFA Q;  4A3E G;  4Y7N H;  4JI3 Q;  3VDY A;  1PH6 A;  3KLW A;  4Y52 H;  3BJU A;  3T1Y Q;  3CQZ H;  3CCE A;  4QQB X; 
#chains in the Genus database with same CATH topology
 2NTT A;  1XNR L;  2NVQ H;  1AN8 A;  4RG1 A;  4AH6 A;  3KYH C;  1O80 A;  4BBS G;  2UXB Q;  4IJH A;  2NVX H;  2EOT A;  5HUR A;  1LM0 A;  5M5Y H;  2PYK A;  2VUM B;  2M9V A;  2JA8 H;  4DA2 A;  4HJA A;  4B3S Q;  2EYO A;  3U50 C;  4QGU A;  5C4J B;  4DV4 Q;  1EQQ A;  2EY1 A;  2JA9 A;  2B2W A;  3U9S A;  3ERS X;  4YY3 L;  2JA6 G;  2EVB A;  2Y0S B;  3RMH A;  3EVQ A;  3A5U A;  3ND8 A;  4DNR B;  1DXM A;  2K28 A;  1LAB A;  2KBN A;  4RAU C;  3KK7 A;  3LWE A;  1K0S A;  4WJ4 A;  2A6H D;  4A3M G;  4QY7 A;  4LF9 L;  3Q24 A;  4QIW B;  2PZW A;  1Q86 C;  3I91 A;  1TU2 B;  3FP9 A;  5CV4 A;  1I4H A;  1ENC A;  3GTM B;  4GNX A;  5GAH C;  1S4Z A;  1XNQ L;  3CC7 A;  2X6G A;  4G7O C;  3Q0A A;  5JJI A;  3V96 A;  2WAQ E;  3HOU B;  2VB3 X;  2LSS A;  5COY A;  5IP7 H;  5H1S E;  1QG7 A;  2PMZ B;  4LFA L;  2M2L A;  1QZH A;  2F0E A;  1EZ6 A;  3UDI A;  3HKZ G;  1WTX A;  1HA6 A;  3P75 A;  4YHH Q;  1TWC B;  2JXM B;  3EN2 A;  4QCL A;  1STA A;  1ILP A;  2HHH Q;  2D62 A;  1HQR D;  3EA6 A;  3RNU A;  4M1U B;  3UE1 A;  3OSO A;  3TRE A;  4JI8 Q;  3Q22 A;  3H6M A;  4LFC L;  1II3 A;  2K50 A;  5BR8 L;  1RD9 D;  2ZTD A;  5CYU A;  3BG3 A;  2UUA L;  2Q8R E;  3I4M G;  5DAU A;  5EAY A;  2EPB A;  1YEZ A;  1CQV A;  5CMD A;  3S1R B;  5KIX A;  5FLM G;  3VYU A;  1GO3 E;  2NZH A;  3KLR A;  1TWA B;  5E7N A;  3FDT A;  1LLR D;  1DOM A;  2XTI A;  2ZT9 C;  2FMC A;  2MHV A;  4U67 3;  3T1H Q;  3CME A;  3G7L A;  4DR4 Q;  3ND9 A;  4LUO A;  1RIP A;  3J80 L;  2VZA A;  5FLX L;  1B4O A;  4CDF C;  5KNC A;  1FGB D;  1WTW A;  2EDG A;  3PF5 A;  1J8I A;  3OIP A;  4H0L C;  4DK1 A;  4LF4 L;  2JEB I;  3TN2 A;  1Q82 C;  1MSH A;  3E6Z X;  1H9J A;  1SSO A;  4Q0F A;  5C44 B;  2X6L A;  3R8B A;  1PZI D;  5DEH A;  2EYH A;  1RTN A;  3PSI A;  2B8F A;  5FO9 B;  2C35 B;  4F87 A;  1D6E C;  5M5X H;  2KJX A;  1EYA A;  2YTX A;  2R6G A;  3GTJ H;  2A6E C;  2Z6K C;  5IWA L;  2G5D A;  1B70 B;  1X9N A;  1VQP A;  2UXC Q;  3RLO A;  4OGQ C;  3I8Z A;  2DN8 A;  2VXW A;  5E1F A;  1PTO D;  3MZ5 A;  4HMI A;  1SYB A;  3PV0 A;  5J1Z A;  3E0E A;  3CMA A;  3AQQ A;  5BN4 A;  5IE8 A;  2WKD A;  3SVM A;  1BOS A;  1H9S B;  2R92 G;  3OTO Q;  3DM3 A;  1I3Q B;  3PIP 3;  4HR7 B;  1PV4 A;  1VQO A;  1NBW A;  1KL9 A;  2OT2 A;  1MSG A;  2OQ0 A;  3D4D A;  2JA7 G;  3KF8 A;  2E5L Q;  2R93 H;  1UNS A;  2PW5 A;  4YCU A;  1HNX L;  2DNC A;  4CJ2 C;  1NSN S;  1CFM A;  4X3U A;  2Z4H A;  4DR5 Q;  4OX9 L;  3RD4 A;  4LF8 L;  3HOW H;  4IUT A;  1DZ1 A;  3NP8 A;  4R8N A;  3IKJ A;  4EVO A;  1SFO B;  1JMC A;  3VA5 A;  1QVC A;  4KHV A;  2IT1 A;  1TWF H;  4A3I H;  1I5F A;  1VQ9 A;  3HOY G;  4X65 Q;  2D5D A;  4ZLT F;  1SYG A;  4X3T A;  3PO3 B;  3I72 A;  1OO9 B;  3AFP A;  4C2M B;  1YZ6 A;  2KUM A;  2WII B;  1WJJ A;  3S1N B;  1PDQ A;  4IQZ A;  4MNO A;  2NYZ D;  4RHR A;  4KN7 C;  1P8L A;  4IFD I;  4DXG A;  3K0Y A;  2IX0 A;  4K8J A;  2F0F A;  5IYC G;  1PFS A;  2CWP A;  2VQF L;  1YNJ C;  4BBR G;  4J6H A;  4DFA A;  3I4N B;  1WTQ A;  4RGT A;  1H9R A;  3D3R A;  3BVG A;  4IJL A;  1Z6H A;  3K0X A;  1UE5 A;  4ZUI A;  2UXB L;  2BH2 A;  3ULL A;  2AQ3 B;  1H9K A;  1O7L A;  1ONL A;  2K5D A;  4F88 A;  1SXT A;  1ML0 D;  4FO2 A;  4B3S L;  1OTC A;  4DV4 L;  1KLG D;  1F2L A;  2BOS A;  4PMB A;  2RF4 A;  2F4I A;  3HS0 C;  4UP7 A;  3PGZ A;  4AYB B;  2VQE L;  1SNQ A;  1YNN D;  4JG2 A;  4ME5 A;  1X55 A;  3MWY W;  4RHS A;  1G51 A;  1GXD C;  4QF4 A;  4KI0 A;  2AHO B;  1VQN A;  2Z1C A;  1MD2 D;  1X32 A;  2F0M A;  1X65 A;  2N3S A;  4NKL A;  1IW7 C;  4DPG A;  1ESR A;  4LK1 C;  5C6A A;  1WD0 A;  5E4W C;  1BVS A;  2EZV A;  1Q81 C;  2VUM H;  3MC0 B;  4H02 A;  3PO2 H;  3DWQ A;  4YIJ A;  4DR7 L;  4JOI C;  2SOB A;  4DV7 Q;  5M3F H;  4EQN A;  1BQQ T;  2B2V C;  4GS3 A;  2KCM A;  3MFY A;  3J80 i;  3TZD A;  3GTO H;  2LKV A;  2B2U C;  2NUC A;  3DM1 A;  5M3M B;  5CV9 A;  1EYD A;  1I6V C;  3RZO H;  1DON A;  1UE7 A;  1T9H A;  2N78 A;  2B63 B;  2CW0 C;  3ERO A;  2L4N A;  4C3J B;  1Z7T A;  3K5N A;  3ICE A;  1EQV A;  1A0I A;  4YHH L;  4V0B A;  2RQX A;  3F8T A;  3G48 A;  4LUZ A;  5FJ8 H;  1HR0 L;  3SE0 A;  4HIK A;  2HHH L;  2F0D A;  4LWC A;  5C0X H;  3FHW A;  4FXG C;  2Z0S A;  5ELN A;  1Y8O B;  1QZG A;  3JAM L;  3FEW X;  1VQ6 A;  1KXL A;  1KAA A;  1S5E D;  5C0X I;  4DR1 Q;  4DAP A;  4ME3 A;  1SYF A;  4HED A;  4R4O A;  3GTM H;  4JYA L;  1VQD A;  1Y1W B;  4DK6 C;  3S16 B;  2HIV A;  1I4G A;  1N36 Q;  3TQY A;  1G91 A;  2F0P A;  3HOU H;  1EOT A;  4K0K Q;  5ELD A;  4LF7 L;  1SNP A;  1PTO H;  2ZTE A;  1WTO A;  3QWN A;  1L1O B;  4EGV A;  1CSP A;  2RBM A;  3RR5 A;  4KHZ A;  2Q2T A;  1N32 Q;  3T1H L;  1E2W A;  1U4L A;  1HR0 W;  2K14 A;  4JI0 Q;  1XTD A;  4YCV A;  2YTY A;  1KD1 C;  4DR4 L;  1JWM D;  4DAY B;  4A3B H;  2YU9 H;  2L9H A;  4GLA C;  5ISR A;  3PO3 G;  1QB5 D;  1UE1 A;  2D0P A;  2NZ1 D;  3OHX C;  3PMF A;  2EE1 A;  2IPK D;  2NVY H;  3R3O A;  1EIY B;  3T53 B;  1A3T A;  2NWG A;  4BXX H;  4KN4 C;  2DJG C;  4K14 A;  3AU7 A;  3PUY A;  3G71 A;  4O2D A;  3S1R H;  3AB9 A;  4BS9 A;  4HCE A;  1IBK L;  1SE8 A;  1O7I A;  5DM6 3;  1TWA H;  5JEA H;  5C4X G;  2J0T D;  3UI2 A;  2B2Y C;  1S3O A;  2F0O A;  1JJ2 A;  2RDH A;  3QG1 A;  3I56 A;  4UP8 A;  3V2T A;  5HY6 A;  5D3I B;  4C3H B;  2JP1 A;  2Q8T A;  2WFW A;  1X3F A;  3C46 A;  1Q46 A;  3NHH A;  1PZK D;  1XNR Q;  1VQ5 A;  2OQK A;  3L2P A;  2EYM A;  3PCO B;  5C44 H;  5FOB B;  2F4V L;  2OF1 A;  1GUW A;  2NBF A;  5EPK A;  3QOL A;  4JI4 Q;  2ICE C;  1PRT F;  3DWA A;  3OTO L;  1FR3 A;  1D5M C;  1EL0 A;  5E3F A;  4A3F H;  3W2D A;  5HGT A;  1I6H B;  5ELF A;  1TQO A;  2N8N A;  5IOC A;  4GKK Q;  1CHQ D;  3VA7 A;  2JQO A;  2AUK A;  1BO0 A;  3HOZ H;  1EIF A;  1HNW L;  4XT3 B;  1AH9 A;  4HTH A;  4IZ8 A;  4YY3 Q;  1CA5 A;  3DLL A;  2AKW B;  3BS1 A;  3U58 A;  1VQE A;  2L5T A;  1QOH A;  2KOL A;  2Q2I A;  3NEL A;  3GTG B;  4KTA A;  3SGI A;  2MQH A;  2K04 A;  3BZC A;  1VMC A;  3Q23 A;  5IGF A;  1TWH H;  5A2Q E;  4X65 L;  1E22 A;  3P20 A;  1W6K A;  4A3J G;  1LTS D;  1E2Z A;  2KCT A;  3T51 B;  1PH5 A;  4K5W A;  3CCQ A;  3VR6 A;  4C3J G;  1FNV A;  3J7A 5;  2NVT H;  2Z6K A;  3W5O A;  3CCM A;  2KQ3 A;  2WB1 E;  5JOB A;  3CCU A;  4DUY Q;  4BY7 B;  1PHJ A;  1CI3 M;  2O2L D;  1GHK A;  1XNQ Q;  1XPU A;  4PMC A;  5CC4 A;  1BF4 A;  2HT1 A;  1VQI A;  3NK9 A;  1I94 Q;  1BCP D;  1IYU A;  1XWE A;  1UE6 A;  2CVR A;  3ER0 A;  3LX0 A;  2RA4 A;  4LFA Q;  4A3E G;  3M7G A;  3VDY A;  4OO1 G;  3NBI A;  4HJ9 A;  4K6L A;  1B3A A;  4C2M H;  1VF7 A;  3SK4 A;  3KLS A;  1JOO A;  2OEO A;  4B9X A;  2NTS A;  4GN5 A;  1OXU A;  3GTP B;  5L37 A;  2DGY A;  3KOJ A;  2PI2 A;  5FO7 B;  3X3M A;  3C1E A;  1ZKO A;  2E76 C;  2ENB A;  4A93 B;  3S9W A;  1HTP A;  3I4N H;  4A3D G;  3BVM A;  4LFC Q;  1HJP A;  5KNB A;  2OTL A;  2NB0 A;  2UUA Q;  1X3E A;  4EQO A;  2CHB D;  2KHI A;  4WRD A;  3H3V H;  1MJC A;  3BU2 A;  3S1M H;  2FXQ A;  2K7V A;  2RCN A;  4DXF A;  1C48 A;  1JJC B;  3H3V I;  2DNE A;  5G3L F;  5IGG A;  1PFM A;  4H44 C;  1LT4 D;  4R4I A;  5ELE A;  2F0N A;  3STB C;  2XGT A;  2VS1 A;  4KD3 A;  1CKN B;  4CJ1 B;  4A3M B;  3OWF A;  2GN5 A;  3OMG A;  4IUV A;  5GRO A;  1JOQ A;  2A6E D;  3J7Y W;  3FMC A;  1MGS A;  3CRK C;  1KNE A;  1VQB A;  2R7F A;  4R4Q A;  5JJK A;  3J81 E;  4A3C H;  2Z8L A;  4BY1 B;  4NPS A;  3P7J A;  1SEB D;  3QO2 A;  1K9M C;  1A6X A;  4TRD A;  3UDX A;  2R3Z A;  4F8M A;  1ESF A;  1VQ7 A;  5M5W B;  3BYY B;  3RN5 A;  3L9A X;  1G29 1;  2F0H A;  4DR1 L;  2MP1 A;  1XJV A;  4L63 B;  4C1N I;  5M3M H;  3E3X A;  2FJ2 A;  3DHQ A;  4FF2 A;  4KKT A;  1N36 L;  2F3W A;  1G2S A;  2B63 H;  1SYD A;  3NWT A;  1A62 A;  4WFN 3;  1AZQ A;  5C3E B;  4JBJ A;  1V1O A;  3R2I A;  1VS0 A;  1I50 B;  2F0S A;  2VNU D;  1SNC A;  1HZA A;  4KK7 A;  3U4Z A;  3IFT A;  3PUW A;  1PVO A;  4CBV A;  2E74 C;  3D6W A;  3GQB A;  4JI0 L;  2HQE A;  2EY6 A;  2AWN A;  2HDL A;  2AUJ D;  3FPP A;  1YJN A;  1HNX Q;  2F52 A;  3TP7 A;  3I4M B;  5K5P A;  1F9P A;  4DNI A;  2B2V A;  4A3K B;  2CH4 A;  4OX9 Q;  3BDC A;  2F3V A;  1SN8 A;  5EKK A;  2Z6B A;  5I6Y A;  3I4L A;  2B2U A;  3A54 A;  3MHB A;  4MN3 A;  1H95 A;  1Y1W H;  2IHF A;  2XVS A;  3KDF B;  3S16 H;  1CK1 A;  4KY7 A;  5I6W A;  3S2D H;  4BY7 G;  2NN6 G;  3M4O H;  2QW7 A;  1EWC A;  2L55 A;  4XYQ A;  2JE6 I;  1YNJ D;  1CM9 A;  2L1B A;  3MAQ A;  2MPM A;  3KDF A;  1XMQ L;  1EYC A;  2KEC A;  4FNF A;  2PW7 A;  3URY A;  4RCO A;  3VR4 A;  1FVI A;  1EFW A;  4UAI A;  4HIO A;  2VQF Q;  1VF5 C;  3BYT B;  1EUJ A;  1EEI D;  3QB3 A;  1GJX A;  4LF5 L;  4Q5V A;  1HHV A;  3FVQ A;  3G6J B;  5AJ3 Q;  3D8G A;  1V1Q A;  1R9T B;  2N55 A;  1DJR D;  1TS4 A;  2EXZ A;  5IOD A;  4A93 G;  4JI4 L;  3NTH A;  3K57 A;  2EJF C;  4IUU A;  1V1P B;  2LXJ A;  2SDF A;  2TMP A;  1WFQ A;  1SJH D;  1UEB A;  4GKK L;  1C8C A;  1IW7 D;  1AE2 A;  3V05 A;  1GUN A;  1IZ6 A;  5KYL A;  2VQE Q;  5TSS A;  4QL5 A;  3CP0 A;  3UE0 A;  3HOV B;  4C3H H;  2WAQ B;  1U5K A;  2R92 B;  1JR0 D;  3IAY A;  3K7A H;  5IYB G;  1VDZ A;  2LS0 1;  1KAB A;  4MTK A;  4FYD A;  2JA7 B;  2K75 A;  5EQ0 A;  1AP0 A;  1HUN A;  1LT3 D;  3CCS A;  2F0K A;  5IGB A;  1YHB A;  4YCW A;  2QCP X;  2DY7 A;  4DR7 Q;  5J3B A;  1I6H H;  1L1O C;  2IJ0 A;  3ZYY X;  5CGK A;  3VR3 A;  2CW0 D;  3CQZ B;  4BY1 G;  5JJL A;  2B2Y A;  4R4T A;  1VQA A;  2L11 A;  4ZCK A;  4DUY L;  3HOY B;  5A35 A;  1K73 C;  4PMW A;  4QUC A;  1MJE A;  1I94 L;  1VCI A;  2EIF A;  5IT9 E;  2LMC B;  4BA2 I;  3GTG H;  2F0I A;  2OCE A;  1PTO F;  2EXD A;  4H7B A;  3EQL C;  4A3L H;  1HNZ Q;  4GOP B;  3CW2 C;  2LY7 A;  1MHW C;  2GA4 B;  4DGZ A;  1IBL L;  4OEM B;  1HR0 Q;  4BBR B;  2UU9 L;  1TY0 A;  1F2Z A;  3CCL A;  5IP9 G;  3F2C A;  1L0Y B;  1DCZ A;  3OMC A;  5C3E G;  2KCN A;  1YVC A;  4A4I A;  2CQO A;  1VQF A;  2PCF B;  1LT5 D;  1IBM Q;  4FF1 A;  2QDB A;  4OIJ A;  4RA8 A;  4M8A A;  1NUC A;  3GTL B;  4JYA Q;  2EY2 A;  4CDD C;  4P72 A;  2WP8 J;  4CDC C;  1K83 B;  1B8A A;  3BZD B;  4R9W A;  4LF7 Q;  2CWA A;  1SMY D;  1TS2 A;  4XDX A;  4A3K G;  3M4Q A;  1E1O A;  5T1I A;  5BN3 A;  2EYL A;  4KJN A;  4QIW E;  4PZ7 A;  2B3G A;  3H0G G;  4JC0 A;  1VMP A;  4BBS H;  3MTS A;  1SLJ A;  1CSQ A;  1D5Z C;  2F3I A;  1I4P A;  1LTG D;  3H91 A;  4EQ5 A;  4P73 A;  2K33 A;  1BBU A;  3U9O A;  2F0J A;  4G7H C;  2KEE A;  2ICI A;  2MO0 A;  1Z9F A;  2MFI A;  1Q8I A;  1PRT C;  1QVG A;  5D14 A;  1N34 Q;  1IBK Q;  5LL6 X;  4L5Q A;  1LV9 A;  3WWV A;  2JA6 H;  1U4P A;  4JI7 Q;  3S17 B;  4K8I A;  4DUZ Q;  5K36 G;  2J7Z A;  1RKN A;  1EIH A;  3UDG A;  1WI5 A;  4OL7 A;  2IWH A;  1IKM A;  1CZG A;  5COR A;  4A3M H;  4X3S A;  1WCM B;  2EYF A;  2N88 A;  3HOV G;  2F4V Q;  2JYO A;  4QUF A;  2F0G A;  4DKA C;  2WAQ G;  1AE3 A;  1WTP A;  2JA5 G;  1JT8 A;  1YJ9 A;  1XMO Q;  3JAM E;  4TSS A;  2IX3 A;  2AQ2 B;  3TZU A;  3MXG A;  1UUP A;  2L15 A;  5M5W H;  1H9S A;  3CC2 A;  1HNW Q;  2CH4 W;  3GO5 A;  4TVA B;  1EFI D;  3A74 A;  1EU4 A;  2SNS A;  5J39 A;  4NXM L;  3PIO 3;  1JB7 A;  4L5T A;  1I4Q A;  4H13 C;  3QIA A;  4IFD J;  2K5H A;  5C3E H;  4LW1 A;  3S14 B;  1TWG B;  2D9U A;  3PUZ A;  3J7A V;  3SK8 A;  2EY5 A;  1I50 H;  4X66 Q;  1A3U A;  5FKA C;  3I7F A;  1TS3 A;  5ELB A;  3TP5 A;  2KCC A;  2Q2U A;  4JW0 A;  4HCS A;  3RLN A;  3GV6 A;  3H94 A;  3I4M H;  2UXD Q;  1TXY A;  4ALP A;  5FLM H;  1A2T A;  1ROD A;  2R7D A;  1M8A A;  4EQP A;  1KLU D;  5AJ3 L;  5C4X B;  1QWY A;  3QJY A;  1ZYR C;  3RZD B;  1GOZ A;  4F7X A;  3S1Q B;  1EYG A;  2BDO A;  2I0Q A;  1AEX A;  1GUT A;  3TSS A;  1Y14 B;  2FHT A;  1T5X D;  4ILW A;  4B3M L;  2IX1 A;  2FFK B;  3OOC A;  4XQQ A;  2MO1 A;  4DU9 A;  3D4R A;  4IPG A;  4KHP Q;  2I5M X;  2XWJ B;  1JOR A;  1F9R A;  4CKE A;  2KHJ A;  5IGC A;  1EY5 A;  2OWO A;  4X64 L;  3G6E A;  1KTK A;  4ID6 A;  3MXN B;  1QIL A;  5C4J H;  2JK8 A;  3NEM A;  4CKB A;  4WJ3 M;  2ASB A;  5T1G A;  1DOK A;  4DV6 Q;  1B44 D;  4BWG B;  4PZ6 A;  1YI2 A;  1K8O A;  3NBH B;  4KMU C;  2R92 H;  1O78 A;  4AQY Q;  3OWE B;  1PYB A;  4A3J B;  4NXN Q;  1Q12 A;  1GUS A;  1HZC A;  3K58 A;  1CKM A;  2JA7 H;  3NBH A;  1HNZ L;  1YHA A;  2AWO A;  1B1Z A;  4DAM A;  1EY9 A;  3A8I E;  4RFB A;  4L6T B;  4JBW A;  3E9I A;  1WCM G;  4FXK C;  3J81 c;  1PXU A;  1JWU D;  4Y52 H;  3KLW A;  3BJU A;  1PMR A;  3CQZ H;  1IBM L;  4A3E B;  1WYD A;  1WVL A;  2YTV A;  4DR3 L;  1G6P A;  3HOY H;  1SR3 A;  2A69 C;  1B9M A;  5C3X A;  2HIX A;  1GUG A;  3OIQ A;  3QOJ A;  3TME A;  3C3L A;  1K3B C;  1TWC H;  5CR3 A;  5IYC H;  1L0W A;  1XPO A;  1TS5 A;  1U9R A;  4BBR H;  2L12 A;  2D0O A;  4N9P A;  2EYJ A;  4BA1 I;  4A3D B;  4LMQ D;  4JI5 Q;  1PFB A;  1L1O A;  2FIN B;  3ULP A;  1K0R A;  5KGU A;  2XN9 C;  1XTC D;  2UUB Q;  3FKI G;  5LL6 S;  2PO4 A;  2I46 A;  1JE4 A;  1MIU A;  3GTL H;  4UDU C;  3M85 A;  2WAC A;  3CD6 A;  4DAY A;  2O5I C;  4K2L A;  3F2B A;  1EIG A;  4V19 0;  4DV0 Q;  4CHT B;  1PH3 A;  1Y8N B;  1LTI D;  1BCP F;  1ASZ A;  4GLX A;  5ELO A;  3S24 A;  1AW7 A;  3GD7 A;  1N34 L;  3A0J A;  2HCC A;  1HFN A;  1V8Q A;  4Y7N B;  1XMQ Q;  5IYD G;  4JI7 L;  1NMF A;  4DUZ L;  3L7Z C;  1IYJ B;  4KV6 A;  2F0Q A;  3CRL C;  1JQY D;  3CHB D;  4K5X A;  1SJE D;  2F0U A;  3S2H B;  2JA8 B;  3HEJ A;  4LF5 Q;  3KLS X;  5JJZ A;  3AMU A;  1IYV A;  5DNF A;  1QCB D;  4IN3 A;  4LNQ A;  2NZO A;  2AMC B;  3D4W A;  1I4X A;  1XMO L;  1HUM A;  1BXT A;  4GOP C;  5DLQ E;  4DR6 L;  3GTQ B;  1EQT A;  3J7A F;  3S17 H;  3NQT A;  2V4D A;  1WD1 A;  2E2I B;  1VQC A;  1DM0 B;  1SNM A;  3KF6 B;  3DUZ A;  2EQS A;  4PNY A;  1NY4 A;  1S5C D;  4NP5 A;  3CXC A;  1YBY A;  3Q8D A;  1SYC A;  1VQK A;  3K7U C;  1PRT B;  4QMG A;  5FK9 C;  4HAE A;  1NJI C;  1YJW A;  1TKW B;  4A3G G;  1P16 A;  1B53 A;  2N49 A;  1HA5 A;  1F2M A;  3LNN A;  1B50 A;  4RKL A;  3CCR A;  1I3Q H;  1CZW A;  3EFX D;  4JK1 C;  4X66 L;  1HZ9 A;  3SHL A;  3BZK A;  1Y69 U;  3OYY A;  1F77 A;  1EOV A;  3PIP A;  2B29 A;  3K6O A;  1Q8K A;  1IXR A;  1BBX C;  4DK3 C;  4DV3 Q;  1QVF A;  2UXD L;  3T4A C;  1JE5 A;  1MKH A;  5IY0 A;  2HUG A;  1N8R C;  1OXS C;  3G4S A;  2RCF A;  4HJ7 A;  1SFO H;  4EX5 A;  3UDF A;  1STG A;  1PH9 A;  2PQA B;  3D31 A;  1QE6 A;  1VQ8 A;  5IT9 c;  3OW7 A;  1IBL Q;  1G8Z D;  1X54 A;  1S72 A;  1X3Q A;  3S14 H;  3PO3 H;  1TWG H;  1K3R A;  3TDQ A;  4DF7 A;  2UU9 Q;  4ZKB B;  3K59 A;  3HKS A;  1EEF D;  2K03 A;  1A63 A;  2YYZ A;  3S1N H;  1SRO A;  5C4Z A;  3LWU A;  4KY6 A;  4UY8 C;  4IPH A;  1HCZ A;  4LJZ C;  2XWB B;  1CT1 D;  4ZUJ A;  1KDA A;  3HOX B;  1TT2 A;  4OXP A;  4C3I G;  1LUZ A;  4KHP L;  4TQU S;  3CF5 A;  4JPB W;  5AFW A;  3W1G A;  3RUZ A;  5I2Y A;  2R7Z G;  2XRS D;  4R1J A;  4HJ5 A;  5C4X H;  1PH7 A;  2A1A A;  3MVV A;  4C56 C;  5M9O A;  4J8Q A;  3S1Q H;  4G7Z C;  3T16 A;  4ZK9 B;  5HGQ A;  5I9O A;  1Z47 A;  1FJG L;  5LMN Q;  4RCN A;  4DV6 L;  2H4O A;  4K2K A;  1R4Q B;  1SE4 A;  2J4X A;  1AZP A;  4N8F A;  1B9N A;  2XIW A;  4B3R L;  1NCV A;  4DK0 A;  4AQY L;  1EWI A;  1YNN C;  4NXN L;  1XX8 A;  1DD2 A;  2OXP A;  3CC4 A;  1UAP A;  3NTK A;  4OON A;  3HG9 A;  1ILQ A;  4YWL A;  2PI2 E;  3GTJ B;  3NSW A;  2K4K A;  3HP3 A;  2DY8 A;  1NE3 A;  4J1M A;  1CKN A;  1KRT A;  2WIN B;  1EY8 A;  1S5F D;  2BH8 A;  2JA8 G;  2K01 A;  3B6Y A;  4P74 A;  3A56 A;  2FMM A;  3I2Z A;  3EIV A;  2L0C A;  1RDP D;  3F2D A;  4L5R C;  1HH2 P;  2PPB C;  3ERQ A;  1TII D;  5EPJ A;  2WB1 G;  5LMU Q;  1FNU A;  4A3J H;  4DV1 L;  1J9O A;  3EJI A;  2KHS A;  1W3S A;  2F1M A;  3TS0 A;  2VY3 A;  2Z9H A;  1S5D D;  1X3P A;  4C3J H;  4HIM A;  2R93 B;  3SR1 A;  1W6J A;  1JCK B;  2LXK A;  4MTN A;  2HQL A;  1TR5 A;  2A5H A;  1KRS A;  4JOI A;  4JI5 L;  3HOW B;  3JAM c;  1G6Z A;  1M4V A;  2UUB L;  4ZRZ A;  3HFZ B;  4A3E H;  2GVA A;  3ULJ A;  4NXM Q;  4RGM A;  4OO1 H;  3S15 B;  2RHQ B;  2PZU A;  3I73 A;  5D65 A;  5I4D A;  1K8G A;  1KDB A;  1WTV A;  1J6Q A;  3K5O A;  1J5E Q;  2K5W A;  4DV0 L;  5IP7 G;  1V43 A;  4OO1 I;  4JV5 Q;  1SBB B;  3CCV A;  2G9H D;  3CAM A;  3H0G B;  1QUQ B;  1RTO A;  4ZQ3 A;  3J80 E;  2X69 A;  1BUV T;  3M4P A;  5FLX E;  2I5H A;  4IPC A;  1BBW A;  1A8V A;  4ULL A;  4HJ8 A;  4A3D H;  5IGD A;  4WOR A;  2BE5 C;  4I7A A;  5KYI A;  3R2T A;  1V9P A;  1ZYR D;  3CKI B;  2K52 A;  3HKZ E;  3TEH B;  1LO5 D;  4XXE A;  1YNX A;  1CHP D;  3WOF A;  4S3S A;  3IRB A;  3I55 A;  1A2U A;  3T13 A;  2ZJQ A;  2PNH A;  3OPO A;  2RHS B;  3HOX G;  1MI2 A;  1D2B A;  4JCV E;  2Z4I A;  2E2D C;  4L8J A;  1FD7 D;  4B3T L;  2SEB D;  4IUP A;  3EBE A;  1HRJ A;  2E2H B;  1U4R A;  1X3G A;  1K28 A;  3T56 B;  2IY5 B;  1F9S A;  4B3M Q;  2K5Q A;  4JI2 L;  1V1P A;  1MBY A;  4KKS A;  2JA5 B;  1S40 A;  3BDL A;  2MGS A;  3S2H H;  4NDX A;  1N33 Q;  3PO2 B;  3W3A A;  4O0A A;  4X64 Q;  4DAV A;  5M3F B;  2VB2 X;  4RGN A;  1B3Q A;  3CPW A;  1KC8 C;  3GTO B;  4GKJ Q;  3KBG A;  3NXW A;  1ET6 A;  3GTQ H;  1L0X B;  4NMZ A;  3VYR A;  3RZO B;  2E2I H;  1JJG A;  4DV3 L;  5ELC A;  1GHJ A;  3TP8 A;  4PG3 A;  1PH2 A;  2RSO A;  2H5X A;  4ZKC B;  1RHP A;  4FXD A;  3SK6 A;  2E2J B;  3CCJ A;  1ZEQ X;  5CV8 A;  2K1B A;  4GNX B;  3L3O C;  3J81 L;  4IUN A;  4UPA A;  1JB3 A;  1OXV A;  2A69 D;  3L0O A;  1EY0 A;  5BN5 A;  3NE5 B;  1RL2 A;  4GOP A;  5D3D A;  3RN2 A;  2GVB A;  2R93 G;  4YWK A;  4XTC S;  1M1K C;  2Y0S E;  3IFD A;  3M7N A;  4XIG S;  4DV2 L;  1VQH A;  4DR3 Q;  4BY7 H;  2QKI C;  4QB4 A;  4G4K A;  2NN6 H;  1PTO B;  1SRU A;  3ZJY C;  1SDF A;  2A74 C;  4IAL A;  4X62 Q;  1LTR D;  4TKO B;  3WDN A;  4OWX B;  3HOW G;  4JI1 L;  1K8M A;  3BDO A;  3SEB A;  2NN6 I;  4O1N A;  5JVG 3;  3HRZ C;  1OXX K;  4CGY B;  2EJG C;  1PA6 A;  4IPD A;  2ZJR A;  1BCP C;  4A3I G;  2EYP A;  1FL0 A;  1ASY A;  4A3B B;  2YU9 B;  3U4V A;  5JPM C;  4IFD G;  2NVY B;  4NW2 A;  1WOC A;  1HZB A;  5LMN L;  1RJT A;  1FNW A;  3GTP H;  4RWS C;  3C2P A;  2BCO A;  1DOL A;  2BDN A;  4GN3 B;  4A93 H;  5JPN C;  4RH6 A;  1D8L A;  3HOX H;  5CV7 A;  3M3Y B;  1X56 A;  2PMZ E;  3A8J E;  1WTR A;  4DNT B;  2UUC Q;  1KHI A;  4O42 A;  1NMG A;  4CJ0 B;  2E75 C;  3HZX A;  2A68 C;  4POG A;  3X3N A;  4LAA A;  3PUX A;  5IYB H;  2RVL A;  4R8I A;  1HTL D;  1LYL A;  1S5B D;  5LMN W;  5KEE A;  2F0L A;  5C3W A;  3PF4 A;  1DYQ A;  1E2V A;  2F0T A;  3TBI B;  1KIX A;  5LMU L;  2C9O A;  4A3F B;  5EBC A;  1PH6 A;  2QIL A;  3CCE A;  5GQO A;  1EZ8 A;  4IUQ A;  3QR8 A;  1C4Q A;  3VR2 A;  1O7Y A;  5FO8 B;  4BY1 H;  3HOZ B;  2VUM G;  1NR2 A;  4DV5 L;  3PO2 G;  1N9W A;  1HQM C;  1E24 A;  1PH4 A;  5C4H A;  4DR6 Q;  3GP7 A;  3TP6 A;  1ENF A;  3ITP A;  3RLF A;  5M3F G;  1YHQ A;  1E1T A;  1VQL A;  1Q1E A;  1VQM A;  3E9H A;  2P5Z X;  3KF8 B;  4AIM A;  1TWH B;  2Y0S G;  4HSV A;  3A7A B;  3VYT A;  1J5E L;  1D1K A;  3I70 A;  2AQ1 B;  1STN A;  1VQG A;  2QEX A;  2ZXP A;  5IP9 H;  4JV5 L;  4DR2 L;  4X3K A;  4KLK A;  4APV A;  1EQR A;  1RCV D;  2ALY B;  5CBA E;  5CV5 A;  2NVT B;  1SAP A;  3FKI B;  2RKS A;  1G2T A;  2BA1 A;  1NAP A;  5FJ8 G;  1IHZ A;  3A5Z B;  4IOC A;  2ES2 A;  1STB A;  3KJO A;  5C0X G;  4KKU A;  4PQX A;  4LFB Q;  2R61 A;  4P75 A;  1ICF B;  2B2T C;  1EU3 A;  1EY7 A;  4QJF A;  4CKC A;  4A3K H;  3S15 H;  2Q2H A;  3NUC A;  5IT9 L;  4CDE C;  3F1Z A;  3H09 A;  3HOU G;  4IFD H;  3MFG A;  4KJO A;  2QEJ C;  1DGS A;  4GLV B;  2CFM A;  3H0G H;  2IW3 A;  3J81 i;  2A73 B;  1D7Q A;  1HXY D;  3TS2 A;  4FP5 D;  4JI3 L;  3T1Y L;  1Q1B A;  4P71 A;  1C7Y A;  2B8G A;  1CQF A;  3MXP A;  4A3B G;  4POF A;  2D2C C;  3TRZ A;  3AEV A;  1ENA A;  5NUC A;  2QA4 A;  1N33 L;  1KQS A;  4BXX G;  3S1M B;  5GAD C;  2CCZ A;  1LT6 D;  2XSC A;  1R9T H;  5K36 H;  3N52 A;  5GAE C;  1BKB A;  2IL8 A;  1PFN A;  1VQ4 A;  3STB D;  4GKJ L;  1LTB D;  5JEA G;  1F9Q A;  2E2H H;  1FJG Q;  4JI6 Q;  4B08 A;  1L2F A;  4FVM A;  4A3G B;  1CTM A;  2ZM6 Q;  3MXN A;  3HOV H;  4B3R Q;  2F0W A;  2JA5 H;  3C1F A;  4RKB A;  5CV6 A;  2DUD A;  3FPU B;  3GTK B;  4UP9 A;  1JC7 A;  1CUK A;  1LAC A;  5C44 G;  2PZT A;  2O5J C;  2K5V A;  1H9M A;  5C0X J;  1NNX A;  3DEP A;  4A3F G;  2OTJ A;  2A6H C;  1I4R A;  4AYB E;  2YV5 A;  3DXJ C;  2C5C A;  4YWM A;  4XQJ A;  3R93 A;  3HOZ G;  2F0V A;  4ABN A;  3H15 A;  1B2T A;  5EKL A;  2QDL A;  1JOK A;  4X62 L;  2K05 A;  1OXT A;  3KBX A;  1PLF A;  3PQI A;  4DV1 Q;  2E2J H;  4FF4 A;  1GM5 A;  2HCI A;  3DEO A;  1Q3L A;  4N9T A;  4HID A;  3KUP A;  3P1H A;  5EJW A;  1E0B A;  2QGQ A;  4FF3 A;  1UWV A;  3SDZ A;  3MEF A;  4E6I A;  1SE3 A;  4J15 A;  5EPL A;  4C3I B;  4JI8 L;  3MXU A;  5LHY 1;  1GD7 A;  3K5L A;  2R7Z B;  2VW9 A;  5E4X A;  2H1E A;  3WOE A;  3S2D B;  3M4O B;  4MZ9 A;  4GZY C;  3BVZ A;  1LTT D;  1K83 H;  2UUC L;  3A8K E;  1BR9 A;  3AFQ A;  1NR4 A;  2JSO A;  3A55 A;  2BE5 D;  1Y1V B;  2B2W C;  2XNA C;  5JEA J;  4HSP A;  4LF6 Q;  1SE2 A;  2K6A A;  1SMY C;  1PYW D;  2KA7 A;  4ZYS A;  5I2X A;  4PZ8 A;  2BA0 A;  2NVQ B;  3CU7 A;  1IL2 A;  4K5V A;  3J80 c;  1F2Y A;  4XT1 B;  5FLX c;  3FRP B;  2PNR C;  2NVX B;  4JBK A;  1JWS D;  4X6A H;  1PYS B;  3GV3 A;  5M5Y B;  4JVZ A;  3K81 C;  1BCP B;  3I4N G;  5C5L A;  3M3Y H;  1TY2 A;  4KD4 A;  1FGU A;  1GVP A;  5IIF A;  1EY6 A;  2Q8I B;  1IKL A;  4GNX C;  4B3T Q;  4DN4 M;  1PH1 A;  2UXC L;  4U68 A;  5EGT A;  5DM7 3;  2WB1 B;  4HN7 A;  1Q7Y C;  2JEA I;  3K7A B;  4ODG A;  1O7Z A;  1Q90 A;  2ZTC A;  3NQI A;  2WV6 D;  3M4Y A;  2LFN A;  4JI2 Q;  4AYB G;  4UHV A;  3NEN A;  3ONA B;  5JAV A;  1B7Y B;  2TSS A;  4OEL B;  1YIJ A;  1ET9 A;  3F2U A;  1E3P A;  1WCM H;  1PTO C;  3KF6 A;  3KJP A;  2KEN A;  1SMX A;  3NTI A;  3DWP A;  3JC6 6;  1GKH A;  2E5L L;  4A3C G;  1E7Z A;  2SNM A;  4HMJ A;  1CA6 A;  1XXG A;  1GUO A;  1U0L A;  4DR5 L;  2I5L X;  4LFB L;  2ID0 A;  1HFG A;  1PZJ D;  1U4M A;  3SXH A;  3LGJ A;  5M3M G;  2RDF A;  4IOA A;  1HPC A;  4LF9 Q;  5EKI A;  4K6D A;  5IGE A;  3W1B A;  2B63 G;  3PIO A;  3OW2 A;  2QF7 A;  4JBM A;  5GAG C;  3K80 C;  5KND A;  1LTA D;  3FKI H;  2CQA A;  2DJF C;  3CPF A;  3AYH B;  2M00 A;  2PQA A;  5J22 A;  4GN4 B;  1JIC A;  3DMU A;  3D0F A;  1W2B A;  4DV2 Q;  3MEH A;  1FYC A;  3Q6S A;  4JI1 Q;  1Y1W G;  5IYD H;  3IL8 A;  3NPP A;  3RZD H;  2JJQ A;  3E5S A;  3VR5 A;  3JAM i;  2MNA A;  4BBS B;  2HDM A;  1STH A;  4LUV A;  1C9O A;  1Y1V G;  4JI6 L;  2MJ8 A;  2E8G A;  1EY4 A;  5KRU A;  5EBD A;  5BR8 Q;  1PRT D;  2ZM6 L;  4N8X 1;  2I07 B;  2B2T A;  2XRQ D;  4OHJ A;  2A68 D;  3K8A A;  4OWT B;  1Y8P B;  4NB3 A;  1T5E A;  1M90 C;  1YIT A;  5M5X B;  1D5X C;  4IUR A;  2JA6 B;  2JN4 A;  1D1I A;  3M9B A;  1QNU A;  2WKC A;  4RMF A;  4DV7 L;  2K32 A;  2IHE A;  1KNA A;  2G9D A;  4KY5 A;  1UEA B;  4LF4 Q;  4OIK A;  4L5S A;  3D6C A;  4MHE A;  5F2D A;  1XYI A;  4MIU A;  4A3G H;  2RDG A;  1X6O A;  4C3H G;  1PH8 A;  4A75 A;  3SK5 A;  3J81 j;  3GTK H;  3HGB A;  1C0A A;  1SYE A;  5IWA Q;  1STY A;  1ZXT A;  3N6R A;  3O13 A;  4DV5 Q;  1BNZ A;  2KVM A;  2ZJP A;  1QJO A;  1NTG A;  4OWW B;  1TVX A;  2ZXR A;  3HKZ B;  2B39 A;  4FDB A;  1A15 A;  4XQN A;  2RSN A;  3I4O A;  3MA2 B;  1TWF B;  4A3I B;  4K0K L;  1ICW A;  2A19 A;  4WJW A;  4Z9C B;  3NWS A;  1LTL A;  1R4P B;  1QNK A;  4XYO A;  4C1N K;  1RF2 D;  1AFP A;  3VYS A;  4DR2 Q;  4A76 A;  4R4C A;  5I9P A;  1EWH A;  1N32 L;  5A2Q L;  3E0J A;  4A3L G;  3H3V C;  4LF6 L;  3K5M A;  1STE A;  5JVH 3;  2PQE A;  5CBE E;  1BDO A;  1A3V A;  1K8A C;  2K5N A;  4I65 A;  4ZAI A;  1KAW A;  3PUV A;  4C3I H;  4LF8 Q;  4PV1 C;  2ATW A;  1CKO A;  3KFU A;  1XPR A;  2MUY A;  2ZXO A;  2A8V A;  2F03 A;  1SNO A;  1IL8 A;  2R7Z H;  1QUQ A;  4RGO S;  3J7Z C;  4IO9 A;  4P2C B;  2CKZ B;  2KED A;  1WTH A;  3I3C A;  5C5M A;  1KDC A;  3A7L A;  2VL6 A;  3GDE A;  4I7Z C;  5G3L D;  4B9W A;  3I90 A;  2O4X A;  1Y1V H;  1VQJ A;  1SND A;  2V1C C;  2EJM A;  4Y7N H;  4JI3 Q;  2HD3 A;  4G57 A;  3T1Y Q;  4QQB X; 
#chains in the Genus database with same CATH homology
 5GQO A;  4HJ9 A;  1IBM L;  1XNR L;  1WYD A;  2NVQ H;  2YTV A;  4RG1 A;  4DR3 L;  4C2M H;  4AH6 A;  4BY1 H;  1G6P A;  3HOY H;  3KYH C;  2VUM G;  1SR3 A;  4GN5 A;  1OXU A;  4IJH A;  1N9W A;  4DV5 L;  2NVX H;  3PO2 G;  1E24 A;  1PH4 A;  4BBS G;  4DR6 Q;  2DGY A;  2HIX A;  1LM0 A;  2PI2 A;  3KOJ A;  5M5Y H;  2JA8 H;  3RLF A;  5M3F G;  4HJA A;  1E1T A;  1YHQ A;  1VQL A;  4B3S Q;  3U50 C;  4QGU A;  1Q1E A;  3I4N H;  4DV4 Q;  1VQM A;  4A3D G;  3E9H A;  1TWC H;  1EQQ A;  4LFC Q;  5IYC H;  1L0W A;  3KF8 B;  2JA9 A;  1XPO A;  1HJP A;  4AIM A;  4BBR H;  2D0O A;  2OTL A;  2Y0S G;  4BA1 I;  2UUA Q;  1X3E A;  4JI5 Q;  3ERS X;  1J5E L;  1L1O A;  4YY3 L;  1K0R A;  3ULP A;  1VQG A;  2QEX A;  2UUB Q;  2JA6 G;  4JV5 L;  5IP9 H;  2KHI A;  3H3V H;  4DR2 L;  1MJC A;  4KLK A;  3FKI G;  1EQR A;  4APV A;  3BU2 A;  3A5U A;  2ALY B;  3S1M H;  1MIU A;  2FXQ A;  2RCN A;  3GTL H;  1JJC B;  3M85 A;  2KBN A;  3H3V I;  3CD6 A;  2BA1 A;  5FJ8 G;  3A5Z B;  3F2B A;  4IOC A;  2ES2 A;  3KJO A;  4DV0 Q;  1PH3 A;  4WJ4 A;  4R4I A;  5C0X G;  4A3M G;  4QY7 A;  4LF9 L;  4LFB Q;  1ASZ A;  4GLX A;  5ELO A;  3S24 A;  4P75 A;  3GD7 A;  3STB C;  2XGT A;  2VS1 A;  3A0J A;  1CKN B;  1N34 L;  1Q86 C;  2GN5 A;  1XMQ Q;  5IYD G;  5GRO A;  4A3K H;  4QJF A;  3FP9 A;  3S15 H;  4JI7 L;  2Q2H A;  1NMF A;  4DUZ L;  3L7Z C;  1IYJ B;  1VQB A;  2R7F A;  4R4Q A;  3F1Z A;  5JJK A;  4GNX A;  4A3C H;  5GAH C;  4NPS A;  3HOU G;  1XNQ L;  1K9M C;  3CC7 A;  1DGS A;  4GLV B;  3UDX A;  2CFM A;  3H0G H;  5JJI A;  2WAQ E;  3J81 i;  5H1S E;  2LSS A;  5IP7 H;  1VQ7 A;  3RN5 A;  1D7Q A;  4LFA L;  3TS2 A;  4LF5 Q;  1QZH A;  4JI3 L;  1G29 1;  3T1Y L;  3UDI A;  1Q1B A;  3HKZ G;  4P71 A;  1C7Y A;  4DR1 L;  4YHH Q;  2NZO A;  1XJV A;  3EN2 A;  2AMC B;  4LNQ A;  4A3B G;  4POF A;  5M3M H;  1XMO L;  2HHH Q;  2D62 A;  3TRZ A;  3AEV A;  4GOP C;  3RNU A;  1N36 L;  5DLQ E;  4DR6 L;  2B63 H;  2QA4 A;  3UE1 A;  3S17 H;  1N33 L;  1A62 A;  1KQS A;  4BXX G;  3TRE A;  4JBJ A;  5GAD C;  4JI8 Q;  1VQC A;  2CCZ A;  1R9T H;  3KF6 B;  1VS0 A;  2EQS A;  1NY4 A;  5GAE C;  2VNU D;  1HZA A;  4LFC L;  3U4Z A;  1BKB A;  3PUW A;  1YBY A;  3Q8D A;  3CXC A;  2K50 A;  5BR8 L;  1PVO A;  1VQ4 A;  1VQK A;  2ZTD A;  2UXB Q;  3STB D;  2UUA L;  4JI0 L;  3I4M G;  3K7U C;  5EAY A;  4GKJ L;  2AWN A;  1NJI C;  1YEZ A;  5JEA G;  1YJN A;  2E2H H;  5FLM G;  2F52 A;  1YJW A;  1P16 A;  1HNX Q;  1FJG Q;  4A3G G;  2N49 A;  4JI6 Q;  1GO3 E;  2NZH A;  4DNI A;  5E7N A;  1L2F A;  4OX9 Q;  3CCR A;  1SN8 A;  2XTI A;  3T1H Q;  1I3Q H;  2ZM6 Q;  3HOV H;  1H95 A;  4X66 L;  1Y1W H;  2IHF A;  1HZ9 A;  3CME A;  3KDF B;  4DR4 Q;  3BZK A;  4B3R Q;  3S16 H;  4LUO A;  3OYY A;  2JA5 H;  1RIP A;  1EOV A;  3PIP A;  2VZA A;  3S2D H;  2DUD A;  4BY7 G;  2B29 A;  2NN6 G;  3M4O H;  1Q8K A;  4UP9 A;  3PF5 A;  1IXR A;  2JE6 I;  4DK3 C;  4DV3 Q;  4LF4 L;  1CUK A;  2JEB I;  5C44 G;  1Q82 C;  2K5V A;  3KDF A;  1XMQ L;  1QVF A;  5C0X J;  2UXD L;  1JE5 A;  1MKH A;  1FVI A;  5IY0 A;  4A3F G;  1N8R C;  1OXS C;  1EFW A;  3G4S A;  2OTJ A;  4HJ7 A;  1SFO H;  4EX5 A;  3UDF A;  4AYB E;  1PH9 A;  2PQA B;  2YV5 A;  3D31 A;  3PSI A;  4YWM A;  2VQF Q;  4HIO A;  1VQ8 A;  5IT9 c;  2C35 B;  3HOZ G;  5M5X H;  1IBL Q;  1X54 A;  1S72 A;  3PO3 H;  2YTX A;  3H15 A;  1TWG H;  2R6G A;  1EUJ A;  1K3R A;  3GTJ H;  3S14 H;  2Z6K C;  2UU9 Q;  5IWA L;  4LF5 L;  3HKS A;  4X62 L;  1B70 B;  1A63 A;  5AJ3 Q;  1OXT A;  2YYZ A;  1X9N A;  1V1Q A;  1VQP A;  3S1N H;  1SRO A;  4DV1 Q;  2UXC Q;  2E2J H;  3RLO A;  4UY8 C;  4JI4 L;  4A93 G;  4IPH A;  1GM5 A;  4HID A;  2LXJ A;  2QGQ A;  3PV0 A;  4OXP A;  1UWV A;  1WFQ A;  1LUZ A;  4KHP L;  3MEF A;  3E0E A;  4TQU S;  1UEB A;  3AQQ A;  5IE8 A;  3CMA A;  3CF5 A;  4GKK L;  4J15 A;  1AE2 A;  3W1G A;  2R7Z G;  4HJ5 A;  4R1J A;  2VQE Q;  4JI8 L;  1IZ6 A;  5C4X H;  3OTO Q;  2R92 G;  1PH7 A;  1GD7 A;  3DM3 A;  4QL5 A;  3CP0 A;  3UE0 A;  1VQO A;  2A1A A;  1PV4 A;  1NBW A;  4C3H H;  2VW9 A;  1U5K A;  1KL9 A;  2OQ0 A;  2JA7 G;  3K7A H;  5IYB G;  3S1Q H;  2E5L Q;  2R93 H;  4MZ9 A;  5HGQ A;  4YCU A;  2K75 A;  1HNX L;  1Z47 A;  1FJG L;  5LMN Q;  1K83 H;  4DV6 L;  2UUC L;  3AFQ A;  4DR5 Q;  4OX9 L;  4LF8 L;  3CCS A;  3HOW H;  1YHB A;  4YCW A;  5JEA J;  4DR7 Q;  5J3B A;  4LF6 Q;  4B3R L;  1I6H H;  4AQY L;  1L1O C;  1JMC A;  1EWI A;  4NXN L;  1QVC A;  2IT1 A;  1TWF H;  4A3I H;  3CC4 A;  1I5F A;  4BY1 G;  1VQ9 A;  5JJL A;  3HOY G;  4OON A;  4X65 Q;  4PZ8 A;  4R4T A;  2BA0 A;  1VQA A;  4YWL A;  2PI2 E;  1IL2 A;  3AFP A;  3J80 c;  4DUY L;  2K4K A;  1YZ6 A;  5FLX c;  1NE3 A;  1CKN A;  1KRT A;  1K73 C;  4PMW A;  1WJJ A;  1MJE A;  2BH8 A;  1I94 L;  1VCI A;  4JBK A;  2JA8 G;  2EIF A;  4X6A H;  4MNO A;  4BA2 I;  1PYS B;  3GTG H;  2OCE A;  1P8L A;  3K81 C;  3I4N G;  2EXD A;  4IFD I;  3B6Y A;  4P74 A;  2IX0 A;  4A3L H;  3M3Y H;  1HNZ Q;  5IYC G;  1PFS A;  2CWP A;  3CW2 C;  2VQF L;  4GOP B;  4BBR G;  3I2Z A;  1IBL L;  3EIV A;  1FGU A;  4IJL A;  1GVP A;  3F2D A;  1HR0 Q;  4L5R C;  2UU9 L;  1HH2 P;  3CCL A;  3K0X A;  5IP9 G;  3F2C A;  1UE5 A;  2WB1 G;  5LMU Q;  4GNX C;  4B3T Q;  5C3E G;  1PH1 A;  4A3J H;  2UXB L;  4DV1 L;  2UXC L;  1W3S A;  2BH2 A;  1YVC A;  3ULL A;  4A4I A;  4OO1 G;  2CQO A;  1VQF A;  3TS0 A;  2VY3 A;  1IBM Q;  1Q7Y C;  2JEA I;  2ZTC A;  4C3J H;  4HIM A;  4B3S L;  4JYA Q;  4JI2 Q;  1OTC A;  2LXK A;  4MTN A;  4DV4 L;  2HQL A;  4AYB G;  4P72 A;  2WP8 J;  1KRS A;  2RF4 A;  3NEN A;  1B8A A;  1B7Y B;  4UP7 A;  3PGZ A;  2VQE L;  4JOI A;  4JI5 L;  2CWA A;  1YIJ A;  4LF7 Q;  3JAM c;  4JG2 A;  1X55 A;  4A3K G;  1E3P A;  1WCM H;  1E1O A;  3KF6 A;  1G51 A;  3M4Q A;  2KEN A;  3KJP A;  1SMX A;  2UUB L;  3HFZ B;  4KI0 A;  2AHO B;  1VQN A;  4A3E H;  2GVA A;  4QIW E;  3ULJ A;  3JC6 6;  1GKH A;  2E5L L;  4NXM Q;  1X65 A;  1E7Z A;  4A3C G;  2N3S A;  2RHQ B;  4PZ7 A;  2B3G A;  1K8G A;  4DPG A;  1J6Q A;  3H0G G;  1J5E Q;  4JC0 A;  4DV0 L;  5IP7 G;  1BVS A;  1V43 A;  1U0L A;  1Q81 C;  4JV5 Q;  2VUM H;  3CCV A;  4DR5 L;  4OO1 I;  2I5L X;  4H02 A;  4BBS H;  3CAM A;  3PO2 H;  4LFB L;  1SLJ A;  2ID0 A;  4DR7 L;  1CSQ A;  2F3I A;  4JOI C;  1QUQ B;  4EQ5 A;  4DV7 Q;  4P73 A;  3M4P A;  3LGJ A;  1BBU A;  2I5H A;  4IPC A;  5M3M G;  5M3F H;  1BBW A;  1A8V A;  4GS3 A;  4HJ8 A;  4IOA A;  2KCM A;  4A3D H;  2MO0 A;  1Z9F A;  2MFI A;  3J80 i;  3GTO H;  4LF9 Q;  3W1B A;  2B63 G;  1V9P A;  3PIO A;  1QVG A;  2K52 A;  3OW2 A;  1N34 Q;  1IBK Q;  3HKZ E;  4L5Q A;  4JBM A;  3RZO H;  5GAG C;  1UE7 A;  3TEH B;  3WWV A;  1T9H A;  2N78 A;  2JA6 H;  3K80 C;  4JI7 Q;  1YNX A;  4DUZ Q;  5K36 G;  3FKI H;  3IRB A;  3I55 A;  3CPF A;  3UDG A;  1WI5 A;  3AYH B;  2ZJQ A;  2PNH A;  2PQA A;  2RHS B;  4GN4 B;  3ICE A;  4YHH L;  1A0I A;  3F8T A;  3D0F A;  3G48 A;  4LUZ A;  5FJ8 H;  3HOX G;  1W2B A;  4HIK A;  4DV2 Q;  1HR0 L;  4JCV E;  4LWC A;  2HHH L;  3FHW A;  4A3M H;  2Z0S A;  5ELN A;  4B3T L;  1QZG A;  3EBE A;  1VQ6 A;  1KXL A;  4JI1 Q;  2F4V Q;  1X3G A;  3HOV G;  5C0X I;  1Y1W G;  4DR1 Q;  4DKA C;  2WAQ G;  2IY5 B;  5IYD H;  4ME3 A;  4R4O A;  1AE3 A;  2JA5 G;  4B3M Q;  3GTM H;  1JT8 A;  1YJ9 A;  1XMO Q;  4JYA L;  4JI2 L;  1VQD A;  4DK6 C;  3RZD H;  2HIV A;  2JJQ A;  2L15 A;  1N36 Q;  3TQY A;  3HOU H;  1S40 A;  5M5W H;  4K0K Q;  4LF7 L;  3S2H H;  3JAM i;  1N33 Q;  2ZTE A;  2MNA A;  4LUV A;  1L1O B;  1C9O A;  3CC2 A;  4O0A A;  1HNW Q;  1Y1V G;  3GO5 A;  4TVA B;  4X64 Q;  4JI6 L;  1CSP A;  3A74 A;  3RR5 A;  4KHZ A;  2E8G A;  4NXM L;  2Q2T A;  1N32 Q;  3T1H L;  5BR8 Q;  2ZM6 L;  1HR0 W;  2K14 A;  3CPW A;  4JI0 Q;  1XTD A;  4YCV A;  2YTY A;  1KC8 C;  1KD1 C;  4DR4 L;  4DAY B;  4A3B H;  2YU9 H;  4GLA C;  1JB7 A;  4GKJ Q;  3PO3 G;  3K8A A;  4L5T A;  4OWT B;  1UE1 A;  2D0P A;  4NB3 A;  3GTQ H;  1M90 C;  1YIT A;  4IFD J;  2K5H A;  5C3E H;  2NVY H;  4LW1 A;  2E2I H;  1JJG A;  4DV3 L;  1EIY B;  3PUZ A;  3M9B A;  1I50 H;  4PG3 A;  4X66 Q;  4RMF A;  4DV7 L;  4BXX H;  1PH2 A;  2H5X A;  3I7F A;  2IHE A;  3PUY A;  3G71 A;  2Q2U A;  3CCJ A;  3RLN A;  4O2D A;  4GNX B;  3S1R H;  4LF4 Q;  1IBK L;  3I4M H;  1SE8 A;  1O7I A;  1TWA H;  4L5S A;  2UXD Q;  1TXY A;  4ALP A;  4UPA A;  5C4X G;  5FLM H;  4A3G H;  1OXV A;  2R7D A;  1S3O A;  1X6O A;  1PH8 A;  1JJ2 A;  3L0O A;  5AJ3 L;  4A75 A;  3I56 A;  4UP8 A;  5HY6 A;  1RL2 A;  4GOP A;  3RN2 A;  2GVB A;  3J81 j;  2WFW A;  3GTK H;  1X3F A;  4YWK A;  2R93 G;  1Q46 A;  4XTC S;  2Y0S E;  1M1K C;  1XNR Q;  1VQ5 A;  4XIG S;  4DV2 L;  3M7N A;  1VQH A;  1C0A A;  4DR3 Q;  4BY7 H;  1EYG A;  2OQK A;  3ZJY C;  1SRU A;  5IWA Q;  3L2P A;  4X62 Q;  2I0Q A;  4OWX B;  3HOW G;  4DV5 Q;  3PCO B;  5C44 H;  4JI1 L;  2F4V L;  2ZJP A;  2NN6 I;  1NTG A;  4JI4 Q;  1Y14 B;  4OWW B;  3OTO L;  1OXX K;  2IX1 A;  4B3M L;  4A3F H;  1PA6 A;  4IPD A;  2ZJR A;  4A3I G;  1FL0 A;  2MO1 A;  1ASY A;  4FDB A;  4IPG A;  3U4V A;  4KHP Q;  3I4O A;  2I5M X;  2N8N A;  4K0K L;  4GKK Q;  2JQO A;  4IFD G;  3HOZ H;  1EIF A;  2A19 A;  2KHJ A;  1WOC A;  1HNW L;  2OWO A;  1HZB A;  4X64 L;  5LMN L;  1AH9 A;  4YY3 Q;  1LTL A;  3GTP H;  3DLL A;  2AKW B;  3G6E A;  4DR2 Q;  4A76 A;  4R4C A;  1N32 L;  3U58 A;  4A3L G;  1VQE A;  4GN3 B;  3NEL A;  2Q2I A;  3MXN B;  4LF6 L;  4A93 H;  1D8L A;  5C4J H;  2JK8 A;  3NEM A;  3SGI A;  3HOX H;  4WJ3 M;  1X56 A;  2MQH A;  2ASB A;  2PMZ E;  3BZC A;  1TWH H;  1K8A C;  4DV6 Q;  2UUC Q;  4X65 L;  1E22 A;  1KHI A;  2K5N A;  1KAW A;  3PUV A;  4PZ6 A;  4C3I H;  1YI2 A;  4LF8 Q;  1NMG A;  3NBH B;  1CKO A;  4A3J G;  1XPR A;  2ATW A;  2A8V A;  3KFU A;  2KCT A;  2R7Z H;  1QUQ A;  3J7Z C;  2R92 H;  1PH5 A;  4IO9 A;  4AQY Q;  3CCQ A;  1PYB A;  2CKZ B;  4NXN Q;  1Q12 A;  4POG A;  1HZC A;  3J7A 5;  3PUX A;  1CKM A;  2Z6K A;  2NVT H;  3W5O A;  3CCM A;  2JA7 H;  1HNZ L;  5IYB H;  2WB1 E;  1YHA A;  3CCU A;  4DUY Q;  2VL6 A;  2AWO A;  1LYL A;  3GDE A;  4DAM A;  5LMN W;  1PHJ A;  1XNQ Q;  1XPU A;  2HT1 A;  1VQI A;  1I94 Q;  1Y1V H;  3PF4 A;  4JBW A;  3E9I A;  1VQJ A;  1WCM G;  3J81 c;  2V1C C;  1UE6 A;  3ER0 A;  1KIX A;  5LMU L;  4LFA Q;  4A3E G;  4Y7N H;  4JI3 Q;  3VDY A;  1PH6 A;  3KLW A;  4Y52 H;  3BJU A;  3T1Y Q;  3CQZ H;  3CCE A;  4QQB X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...