1R9TH

Rna polymerase ii strand separated elongation complex, mismatched nucleotide
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
145
structure length
133
Chain Sequence
SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna-rna hybrid
molecule keywords RNA strand
publication title Structural basis of transcription: nucleotide selection by rotation in the RNA polymerase II active center.
pubmed doi rcsb
total genus 15
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2003-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1r9tH00
2CWAA 2WFWA 5GAEC 3OW2A 1L1OC 4H02A 3WWVA 1W3SA 2UUBL 3K0XA 2GVBA 1WFQA 5M5WH 4XIGS 3I7FA 4DV7L 5C4XH 1VS0A 1PH5A 4JYAQ 1OXSC 4A3FG 4JI8L 3HOVH 3NENA 1OXTA 3ULJA 4DK3C 3A5UA 2JA8G 1A62A 1MJCA 1JT8A 3F8TA 4DR5Q 3F1ZA 1SFOH 4JI5Q 3RZDH 5IWAL 2B63G 1VQGA 4C3IH 2R7ZG 4IPGA 1G291 1PV4A 2UUAQ 5HY6A 1XMQL 1YHQA 1X9NA 3TS2A 2NVXH 1N32L 2F4VQ 5E7NA 3T1HL 4AYBG 2QA4A 1MJEA 1QUQA 3H15A 3KOJA 3EIVA 3GDEA 4LF8L 1B8AA 4LF9Q 1G6PA 1TWCH 1U5KA 4YCWA 4HIOA 4JI7L 1XNQQ 1TWFH 1N9WA 4JC0A 4TQUS 4A3JH 4OX9L 1UE5A 4BXXG 4DAMA 4QGUA 4OXPA 4P72A 2Z0SA 2ZJPA 4BA1I 2OWOA 3AQQA 1KQSA 3PF4A 3U58A 2HHHL 3STBD 3T1YQ 3BJUA 4GN5A 3K80C 4DPGA 4C2MH 2AWNA 1QVGA 4R4IA 1SLJA 4K0KQ 1HZBA 1Z9FA 4R1JA 3RLFA 1I50H 2A1AA 3S1QH 2VUMH 2MO1A 1YNXA 2KBNA 4QL5A 1I94L 3M85A 1HR0Q 4DR4L 3H0GG 3TREA 1P8LA 3UDFA 3CP0A 3KJPA 2V1CC 2PI2A 2K14A 2GN5A 1K73C 1NJIC 4BY1G 3GTMH 2Q2TA 1XPRA 4GLVB 4PMWA 3CCRA 4A3EG 1YJWA 1VQKA 2ZJQA 3KLWA 4JI6Q 2JA7G 4A3DG 2WP8J 4A3LH 4B3MQ 1Q12A 4DUZQ 1FJGL 2N49A 4DV4Q 1YZ6A 1Q1BA 4YWMA 1VQ5A 1OXVA 1KL9A 4A3MG 4NB3A 4JI4Q 1IXRA 2Q2HA 1IZ6A 1AE3A 3K81C 1Q1EA 1VQBA 1Q46A 2NN6I 4A75A 1KRSA 4GOPA 3S17H 5HGQA 1YJ9A 1IL2A 1WI5A 3JAMc 3PUWA 4X66L 1XJVA 4AH6A 3PV0A 1L1OA 1YHAA 1ASYA 4MZ9A 2R92G 1KXLA 3DLLA 1S72A 2VL6A 3K7AH 3GD7A 3PIOA 2JA6G 1I3QH 3CXCA 4X64L 4X65L 4LFAQ 5FJ8H 1I6HH 1A8VA 4APVA 2EXDA 3M4PA 5FLXc 4DR1L 2OCEA 3PUXA 1FGUA 2CWPA 3HKZG 3K8AA 5IP7H 5C4JH 3UDGA 4BBSH 3S24A 1V1QA 2LSSA 4HJAA 2IY5B 1Q82C 1N36Q 1JE5A 2WAQE 4JI3Q 2D0OA 2OQKA 5C3EG 5JJIA 2I5MX 1GD7A 3NELA 1D7QA 3BZCA 1U0LA 3J7ZC 3E0EA 1X3GA 4XTCS 3GTPH 1NTGA 3I4OA 1PH9A 4A3KG 5IP9G 1LYLA 2H5XA 3PGZA 4B3SQ 4JBJA 2R6GA 4L5QA 5IYCH 5FLMH 3KF6B 5C44G 2VW9A 4A3IH 5JEAG 2JEBI 2JEAI 4A76A 4JBKA 2RF4A 2XGTA 2AHOB 4JYAL 4LFBL 2A8VA 4DUYQ 2R93G 4JBWA 3TS0A 1EIYB 1VQLA 1X55A 3ZJYC 2VQFQ 1PH1A 3MEFA 2K5NA 4DR5L 4JI5L 5C0XG 3HOWG 3KDFA 1W2BA 2IX1A 1HH2P 1K9MC 2E2JH 1QZHA 4MNOA 1VCIA 4UPAA 2UUAL 1TWHH 1PH6A 1UE6A 1EYGA 2VZAA 5M5XH 1EWIA 1X6OA 3ERSX 4GN3B 2YTYA 2F4VL 4YHHQ 2PNHA 5J3BA 3S14H 2N78A 4DV1Q 5AJ3Q 4LF9L 1B7YB 4IPDA 2KENA 3S1NH 3HOXG 1HNZQ 1XNQL 2A19A 5M3MG 3PO3H 1E1TA 4YCVA 1BKBA 2EIFA 4DAYB 4POGA 3CCLA 1X54A 1WCMG 3J81c 4LWCA 4GN4B 4MTNA 2PMZE 4HJ9A 5IYDH 2ZTDA 4R4CA 4GOPC 3T1YL 2OTLA 4LF6Q 1WJJA 2K50A 3GO5A 3PUZA 3BU2A 5IYBG 3OTOQ 4K0KL 2WB1G 4UP9A 1HNXQ 1H95A 2UU9Q 2OQ0A 1EOVA 2PQAA 3J80c 3A5ZB 1A0IA 1L2FA 3JC66 1XPUA 3I4MH 4PZ7A 1Y1WG 2JJQA 3CD6A 4KHPQ 3HOYG 1JJCB 1HR0L 2UUCL 3LGJA 3U4ZA 4DR2Q 1HJPA 2ZTEA 2R7FA 1PH2A 3CMAA 4WJ4A 1YITA 1X65A 1J5EL 1O7IA 3M4OH 2ASBA 3ULPA 4JI6L 4QY7A 1VQMA 3CC7A 4POFA 1JB7A 4B3ML 4L5SA 3KJOA 4DUZL 4A93H 4DV4L 2ZTCA 1BVSA 5GADC 2I0QA 1HR0W 4A3BH 4JI4L 3U4VA 1VQDA 1SRUA 1XNRQ 4B3TQ 4B3RQ 2E8GA 3AYHB 1ASZA 4EQ5A 3PO2G 4LF4L 2ZJRA 3GTKH 1LUZA 3K7UC 4BY7H 4UP8A 2BA1A 3CF5A 4NPSA 5DLQE 3I56A 1NE3A 3TQYA 4DR3Q 4JV5Q 4LFAL 5C4XG 1CSPA 2Y0SG 1UE1A 4Y52H 3CCVA 3HOVG 2I5LX 3DM3A 2E2IH 2MNAA 1Y1VH 4BBRH 1AH9A 4JG2A 4RMFA 1Q7YC 3CC2A 1S40A 3S2DH 3HKZE 1N36L 1K8AC 3GTOH 4JI3L 2K75A 1EIFA 3EBEA 2UXBQ 3G6EA 5LMNQ 2RHQB 1QZGA 2FXQA 1VQJA 2L15A 4B3SL 1E3PA 4C3HH 4IFDG 1CUKA 4QIWE 3RZOH 4JI1L 1E22A 2JE6I 4GNXB 1TWGH 1N8RC 3B6YA 3CW2C 1V9PA 1OTCA 2HT1A 4A3JG 4DUYL 4LUOA 1VQ9A 4NXNQ 1VQOA 4IJHA 1DGSA 2Q2UA 4LF5Q 2ATWA 1LTLA 1K3RA 1UEBA 4KI0A 4A3GG 3AFPA 2YYZA 2VQFL 3GTLH 1IBLQ 1K0RA 1MKHA 2E2HH 4NXMQ 3I4NH 2IT1A 4O0AA 1LM0A 4HJ7A 3UE1A 3FKIH 3GTGH 5IWAQ 1S3OA 4A4IA 4X62Q 4DV3Q 1PH4A 4YHHL 3HOZH 4GKKQ 4YWKA 4WJ3M 4DV1L 1CSQA 2JA5H 3EN2A 4PZ6A 5AJ3L 1YIJA 2VUMG 4P71A 1BBWA 4LFCQ 1HNZL 1A63A 3GTQH 4DR6Q 4ME3A 4GOPB 4DR7Q 3VDYA 4OO1G 1VQAA 5M3FH 3GTJH 2BH2A 2MFIA 1E24A 1L1OB 4L5TA 1VQ7A 5IY0A 1WOCA 3CQZH 4A3LG 1PFSA 4LF6L 4AYBE 3E9HA 1VQEA 2QGQA 5C0XI 1N33Q 4DV2Q 3OTOL 4HJ8A 2D0PA 5GROA 2UU9L 1XMOQ 3HOUH 1IBKQ 4JOIA 2IX0A 3CPWA 4AQYQ 1UE7A 3S2HH 2F52A 2KHIA 4A3CH 3KF6A 4KHPL 1D8LA 4HIDA 3I2ZA 1SROA 4DR2L 5GAGC 4DV0Q 5ELNA 4EX5A 1I94Q 1CKNA 1VQHA 1NBWA 5IT9c 5FJ8G 4HJ5A 2ES2A 5JJKA 5GAHC 3A74A 1V43A 1XTDA 1KD1C 1C7YA 2CQOA 3UDIA 2JK8A 4DKAC 3L7ZC 3NBHB 5IP7G 4BBSG 4OWXB 2CCZA 1J6QA 1NMFA 2I5HA 1YJNA 3KFUA 2ID0A 2YTVA 4B3TL 1VQNA 1XNRL 4IOAA 4IPHA 3W5OA 3G4SA 2B3GA 2JA9A 3G48A 3FP9A 4GS3A 4A3FH 2MQHA 4GKJQ 1Q81C 2C35B 4PG3A 4DV6Q 1EQQA 4X66Q 3KF8B 3PCOB 5FLMG 1KAWA 4DR3L 2JA8H 4A3IG 3PSIA 2UXCQ 1CKMA 1KC8C 2B63H 4KHZA 1X56A 2R7ZH 4OONA 5BR8Q 2K52A 1PH7A 5JJLA 4LW1A 4LUVA 2VQEQ 3JAMi 4BA2I 3H3VI 4JI0Q 2UXBL 2LXJA 5JEAJ 3KYHC 2K5VA 2YU9H 1TWAH 5LMNL 1C0AA 1IBMQ 1YI2A 1Z47A 4JI2Q 1N34Q 4IPCA 3S1RH 2NVYH 4BXXH 2BH8A 3ICEA 1M90C 2UXDQ 1YVCA 1FVIA 2BA0A 4P75A 4P74A 1JMCA 5C0XJ 3HFZB 3CCUA 5IE8A 1VQCA 4HIMA 1JJGA 1YBYA 2HIVA 3PO3G 1M1KC 4NXNL 3F2DA 4LF5L 3HKSA 4JOIC 5LMNW 4LFBQ 1HNWQ 3AFQA 1IBLL 2Q2IA 5IYDG 1SR3A 2ZM6Q 2K4KA 3RNUA 4NXML 3CPFA 4PZ8A 3RN2A 2R7DA 1UWVA 3J7A5 3M9BA 3UDXA 4DNIA 3E9IA 1B70B 4X62L 3BZKA 4DV3L 4DV5Q 5EAYA 4GKKL 3H0GH 2WAQG 1OXXK 1Y14B 3I4MG 1JJ2A 3TEHB 1QUQB 4BY1H 1CKOA 4YY3Q 1VQ8A 4IFDI 3ER0A 4A3EH 4LFCL 4A3DH 1SE8A 2IHFA 1MIUA 3CCSA 2JA7H 2E5LQ 4DR6L 2HQLA 4UY8C 4DR7L 1YEZA 2CKZB 4KLKA 3PIPA 4A3MH 2RHSB 1WYDA 2IHEA 1Q86C 2DGYA 4A93G 1PYBA 1SN8A 4IO9A 3RR5A 4R4QA 5GQOA 4LF7Q 3L2PA 4DV2L 3RN5A 1N33L 4A3GH 5K36G 3S16H 3W1GA 1XMOL 4A3BG 1KHIA 1GVPA 1QVCA 5LMUQ 1IBKL 2R92H 2YV5A 1HZ9A 2Z6KA 4GLAC 4AQYL 1VQPA 1GM5A 2OTJA 4GNXA 2UUBQ 2JA6H 4DV7Q 4BY7G 1PH8A 4DV0L 4JI8Q 3J81i 2UUCQ 3I55A 4OO1I 2WB1E 2GVAA 3TRZA 3D31A 1J5EQ 1E1OA 5C3EH 3J80i 1Y1VG 1OXUA 3MXNB 4BBRG 1XMQQ 3PUYA 3STBC 1N32Q 4GLXA 2PI2E 4JBMA 4IOCA 2XTIA 3T1HQ 2CFMA 2ALYB 5IP9H 4A3KH 3OYYA 2F3IA 4UP7A 5ELOA 4DK6C 5C44H 3CMEA 4QJFA 3CCQA 4LF8Q 3RLNA 3J81j 1RL2A 2KCTA 4JI7Q 2NVTH 3PF5A 1L0WA 4GKJL 4OX9Q 4DV6L 1XPOA 1G51A 4LF4Q 4L5RC 1T9HA 3L0OA 2R93H 4YCUA 4X6AH 1VQFA 2UXCL 2YTXA 4R4OA 1EQRA 1HNXL 2HHHQ 2JQOA 3PUVA 3RLOA 3HOWH 1RIPA 1X3EA 4J15A 4YWLA 5BR8L 1KIXA 3S1MH 1PVOA 3NEMA 4O2DA 1X3FA 4IFDJ 2NN6G 4LNQA 2VQEL 3I4NG 3F2BA 4OWTB 3CC4A 4JI0L 1EUJA 1GO3E 1HZCA 4HIKA 1PHJA 2KHJA 2MO0A 1IBML 2DUDA 3FKIG 1P16A 2B29A 3HOXH 4R4TA 4JI2L 3F2CA 1N34L 3ULLA 5M3MH 2Y0SE 3HOZG 1QVFA 4DR4Q 1VQIA 2JA5G 2QEXA 2UXDL 4TVAB 1C9OA 4RG1A 1WCMH 4P73A 1FL0A 3AEVA 1BBUA 1NMGA 2AWOA 4JI1Q 1I5FA 1FJGQ 4C3JH 5M3FG 5IYBH 1HNWL 2NZHA 4B3RL 1R9TH 2Z6KC 5H1SE 2VS1A 1K8GA 3CCJA 3A0JA 4IJLA 1EFWA 2ZM6L 1K83H 2EQSA 4GNXC 3W1BA 3KDFB 1CKNB 2LXKA 1E7ZA 3SGIA 1Y1WH 3M4QA 3HOYH 4QQBX 4FDBA 3HOUG 3IRBA 5M5YH 1HZAA 5IYCG 2AKWB 2HIXA 4DV5L 3M7NA 4JV5L 1PH3A 1PA6A 1KRTA 4Y7NH 2K5HA 4A3CG 4YY3L 1SMXA 2N3SA 4LUZA 4AIMA 4X64Q 1YHBA 4X65Q 3CCMA 4OWWB 2VNUD 2E5LL 2KCMA 3M3YH 1IYJB 1GKHA 4DR1Q 4ALPA 4JCVE 1PYSB 3UE0A 2VY3A 1NY4A 1TXYA 2NZOA 3H3VH 2AMCB 3CAMA 3D0FA 3FHWA 3G71A 4LF7L 1Q8KA 3S15H 2D62A 1AE2A 3PO2H 3CCEA 2N8NA 1VQ6A 3Q8DA 2NVQH 5LMUL 3U50C 1VQ4A 2RCNA 2PQAB
chains in the Genus database with same CATH superfamily
4FXKC 1V1PA 2WFWA 4I65A 2F0DA 2UUBL 3JAML 3I7FA 2FJ2A 1OXSC 3ONAB 1SNDA 3I4NB 3H6MA 1EQTA 1OXTA 4DK3C 2PW5A 4FF3A 3FKIB 3F8TA 3F1ZA 1ESFA 4K2KA 4CDDC 2JA5B 2A69C 3EQLC 1RTOA 5DNFA 3EIVA 4ZKBB 4HIOA 1EFID 4JI7L 1TWFH 1DJRD 1N9WA 4OX9L 1WTXA 1D1KA 2IJ0A 3PF4A 3U58A 4JK1C 3STBD 3K80C 4LJZC 1DD2A 4QMGA 3T51B 4LK1C 2A1AA 1LT6D 2VUMH 2MO1A 1YNXA 1MSHA 3M85A 4S3SA 2E76C 3TREA 1TWHB 2V1CC 4N8FA 2GN5A 4OO1H 3S14B 4Z9CB 1BXTA 1VQKA 2B2TC 4A3DG 2DY7A 4B3MQ 3MXNA 1YZ6A 1Q1BA 3P20A 3J7AV 1SNCA 1B3AA 4NB3A 3K81C 1LTGD 1Q46A 1NSNS 3S17H 5HGQA 1WI5A 1L1OA 1G91A 2K5QA 1S72A 1I3QH 3CXCA 1QB5D 4LFAQ 1ZYRD 1I6HH 1K28A 2EXDA 2O2LD 4DR1L 1YNJD 2HQEA 1FGUA 1MD2D 2IY5B 1V1QA 2PZUA 1EY6A 1ML0D 3IFDA 4J6HA 5C3EG 4A93B 1LTTD 2AQ3B 1X3GA 5F2DA 3HRZC 4A3BB 4B3SQ 2R6GA 5IYCH 5FLMH 2VW9A 3LWUA 2JEBI 1F77A 3TMEA 4A76A 1MHWC 4DUYQ 1AZPA 1X55A 3ZJYC 1PH1A 4CHTB 1B53A 1HH2P 2E2JH 4UPAA 3NUCA 4A3EB 3ERSX 2F4VL 4XYQA 2PMZB 4IPDA 4WFN3 2XNAC 4NMZA 3T56B 5L37A 5IGCA 5M3MG 3PO3H 2L5TA 1X54A 4LWCA 4DAVA 3RZOB 2ZTDA 2V4DA 1TWGB 4LF6Q 2O5JC 1HUNA 3BS1A 3BU2A 5IYBG 1PZID 3OTOQ 4UP9A 1H95A 3J80c 3A5ZB 1L2FA 1L0YB 3GTLB 2F0PA 4M1UB 4PZ7A 2JJQA 2C5CA 2SEBD 4ZUJA 1HR0L 3LGJA 3U4ZA 1HJPA 4EVOA 3M4OH 4QUFA 3ULPA 4V0BA 3A7LA 4L5SA 1KLGD 4DV4L 1EYDA 5GADC 2I0QA 3BVGA 5K36H 1HR0W 3VR2A 1G6ZA 2E8GA 1ASZA 3CQZB 4IURA 4RH6A 2GA4B 1JOKA 2M2LA 1LUZA 3K7UC 4U68A 4BWGB 4UP8A 1ENAA 2Z1CA 5DAUA 5C4XG 3FDTA 3VYSA 4Y52H 2F0JA 4NDXA 2I5LX 4ME5A 2Z9HA 2E2IH 2MNAA 1Y1VH 2PO4A 4KD4A 1LT4D 4QIWB 1S40A 1STEA 3GTOH 3NK9A 4EGVA 1EIFA 3EBEA 3G6EA 5LMNQ 2EYOA 1X32A 1ZEQX 2PPBC 4X3SA 1E0BA 4ODGA 3VA5A 1N8RC 5FKAC 3R93A 2KUMA 1VQOA 4LF5Q 5I2YA 4KI0A 1K3RA 5EBDA 5JOBA 1BO0A 1K0RA 1TKWB 1V8QA 4NXMQ 4O0AA 1JB3A 1LM0A 1PRTC 5I9OA 1TY2A 4Y7NB 4HCSA 3GTGH 1S3OA 4WJ3M 3I73A 3HOZH 1J9OA 1CSQA 4PZ6A 3O13A 5ELCA 1BBWA 4LFCQ 1HNZL 4GOPB 4DR7Q 1VQAA 3QOLA 2MFIA 2PW7A 1X3PA 1VQ7A 2RQXA 2M00A 1XMOQ 3HOUH 4RHSA 4AQYQ 3CRKC 2L9HA 2K03A 1Y8NB 3KF6A 1JWSD 4HIDA 4DR2L 1U9RA 4DV0Q 4F7XA 1CKNA 1QNUA 4CJ0B 1SYEA 4RCOA 5BN3A 1B50A 1NBWA 2FHTA 1RDPD 1KD1C 2F0SA 1MSGA 1UEAB 2CQOA 4A3DB 3OOCA 3NBHB 5IP7G 4BBSG 3KFUA 1VQNA 4IOAA 2MJ8A 3W5OA 4DNTB 1GUSA 3D4WA 2FMCA 2JA9A 4GS3A 4A3FH 1Y8OB 3S16B 2MQHA 5DEHA 1Q81C 4GKJQ 1JR0D 1SBBB 4A3IG 4J8QA 4IUQA 1IYUA 1SNQA 4KHZA 2B63H 1Y69U 1S5ED 4LW1A 2VQEQ 3JAMi 3H3VI 2UXBL 1IBMQ 1Z47A 5C3EB 1II3A 1S5CD 5G3LD 2BH8A 3N6RA 2UXDQ 3OMCA 4P75A 4CBVA 5C0XJ 3CCUA 2HIVA 1F9SA 2D9UA 1M1KC 4NXNL 3HKSA 3VR6A 1QJOA 4ZQ3A 1IBLL 2Q2IA 5IYDG 1C4QA 3KK7A 2ZM6Q 2K4KA 2R7DA 1UWVA 3J7A5 5I4DA 3M9BA 4LMQD 1B70B 1I3QB 5FLXL 3S1MB 4DV3L 3H0GH 2WAQG 2SOBA 1JJ2A 1LTRD 1FNUA 4XXEA 1C8CA 5CV4A 1M4VA 2B2VC 1H9KA 3ND8A 2RHSB 1WYDA 3RR5A 2KEDA 4LF7Q 4A3GH 3L2PA 1RF2D 3GV6A 3W1GA 1D5ZC 1M8AA 2R92H 3CHBD 2F0QA 4GLAC 1VQPA 2K01A 3MZ5A 2JA6H 5I2XA 2N88A 2EYPA 4PV1C 2R61A 4DV7Q 4BY7G 4XYOA 1I4XA 3FPUB 2GVAA 1F9PA 4F8MA 3D31A 1J5EQ 5BN5A 3PUYA 3FRPB 5T1GA 5CORA 2XTIA 1ENCA 4A3KH 4TSSA 4KKSA 1GUTA 3CMEA 2K04A 3TP8A 1L0WA 2NVQB 2JP1A 2R93H 1O78A 4X6AH 2UXCL 5M5WB 4HTHA 1HNXL 2HHHQ 2JQOA 5FLXE 1KIXA 1PVOA 5BR8L 5ISRA 4N9PA 1PZJD 4O2DA 1X3FA 4HN7A 1SSOA 2G9HD 4IFDJ 2NN6G 4DA2A 1VF7A 2KEEA 2EXZA 4H44C 1K8MA 5KGUA 3F2BA 3CC4A 3I4NG 1BDOA 1EUJA 1HZCA 4HIKA 4EQNA 3FKIG 1I4PA 3HOXH 4JI2L 3QJYA 4R4TA 1JORA 1N34L 1BCPB 3ULLA 4DR4Q 2Y0SE 2JA5G 1PTOB 2QEXA 2RDHA 3OWFA 4TVAB 1J8IA 4RG1A 1WCMH 1SE3A 2EPBA 4C1NK 1ILPA 5A2QE 2NYZD 3R3OA 1PLFA 4OEMB 4CGYB 1I5FA 3DHQA 1K8OA 2A74C 2RSOA 1H9MA 4IJLA 4IQZA 2LS01 2XRQD 4K14A 4QQBX 1KDBA 4DV5L 2AKWB 4C2MB 3M7NA 1EQVA 1PA6A 3T53B 2K5HA 4YY3L 1EYAA 1Y1VB 3TZDA 4G7HC 1FYCA 3S1QB 2VNUD 2E5LL 3NBIA 2KCMA 1IYJB 4YIJA 2OT2A 3GTOB 1VDZA 3GTMB 3BZDB 2VY3A 3IAYA 2B2TA 2Q8IB 2D62A 4K5VA 2N8NA 4IUNA 4U673 3C1FA 2CWAA 3OW2A 3K0XA 2J0TD 2G9DA 1VS0A 1PH5A 1SYCA 4JI8L 3ULJA 2JA8G 2PQEA 1JT8A 3VYUA 1SFOH 1X3QA 3MXPA 3MVVA 1VQGA 2R7ZG 3U9SA 4IPGA 1G291 2UUAQ 1XMQL 4NKLA 4B9WA 5E7NA 4BBSB 3T1HL 4AYBG 1QUQA 4R8IA 3KOJA 3GDEA 4LF8L 1B8AA 1G6PA 4EQPA 1U5KA 1XNQQ 1CA5A 4TQUS 4A3JH 1HPCA 2EYLA 4DAMA 5FOBB 3GTPB 1RKNA 1TIID 4P72A 2Z0SA 1HQMC 4BA1I 1KQSA 2RDGA 4A3IB 1CQFA 2KJXA 3I70A 1BBXC 1JE4A 1QVGA 4R4IA 4K0KQ 1Z9FA 3RLFA 4FP5D 1U4RA 2KBNA 2K1BA 3X3MA 3UDFA 3CP0A 2J4XA 2K14A 1YJWA 4A3EG 3KLWA 2H1EA 3BDLA 4A3LH 4FNFA 1SYDA 1SMYC 1QWYA 2ICEC 1KL9A 4JI4Q 2Q2HA 4RWSC 1ONLA 1Q1EA 3K5MA 1KDCA 2NN6I 1KRSA 1IL2A 3JAMc 1EU3A 2DNEA 2FFKB 4X66L 1XJVA 3PV0A 1YHAA 5BN4A 3DLLA 2B63B 2VL6A 3K7AH 5CV9A 2WAQB 3FVQA 1NUCA 4X64L 3VYTA 2WKDA 1V1OA 2RBMA 3M4PA 5LL6X 4CJ1B 2CWPA 3A55A 3K8AA 5C4JH 2LSSA 1T5XD 1Q82C 1TY0A 4JI3Q 2D0OA 3WOFA 1EWHA 1GD7A 3NELA 4DXGA 1XWEA 1STGA 3E0EA 1IW7D 1I4RA 3I4OA 1LYLA 4L5QA 5JEAG 4EQOA 4LFBL 1PDQA 2F4IA 2A8VA 1BOSA 4HSVA 1EIYB 1WD1A 1VQLA 2VQFQ 5IT9E 2K5NA 1G8ZD 3HOWG 3KDFA 3H0GB 2IX1A 1AN8A 4R9WA 1K9MC 1EYGA 3VR3A 1FNVA 2VZAA 5M5XH 1X6OA 3H94A 3KLSX 1BUVT 4DV1Q 1PMRA 5AJ3Q 1FNWA 2KENA 3Q22A 3S1NH 5C3WA 4G7ZC 1E1TA 2HCIA 1BKBA 4YCVA 2AUJD 5JPNC 4POGA 5IGDA 4GN4B 3H3VC 4FF1A 1NNXA 3GO5A 3P75A 5TSSA 1CT1D 1SNOA 1EIGA 1DXMA 2UU9Q 2EDGA 2MHVA 2OQ0A 4QB4A 3LX0A 3I4MH 2KOLA 1Y1WG 3AB9A 1EY5A 4L8JA 2O5IC 2UUCL 1PH2A 2PZWA 5FO7B 5ELBA 4CDEC 1U4LA 2A68D 1VQMA 3CC7A 2HCCA 4POFA 5JVG3 4B3ML 1BCPC 1BVSA 3MC0B 1PTOC 1O80A 4HEDA 3U4VA 3GTJB 1XNRQ 2JSOA 3R8BA 1AEXA 1WTWA 2R93B 1F2LA 1DM0B 1PFBA 4EQ5A 4LF4L 2ZJRA 1QOHA 3GTKH 4RKLA 1SYGA 5IOCA 3NHHA 4NPSA 3I56A 3TQYA 1CHPD 4DR3Q 4JV5Q 4PMCA 4LFAL 1CSPA 1UE1A 1EY4A 4ZLTF 1W6JA 1AH9A 3SDZA 2FINB 1Q7YC 3CC2A 2K75A 2EYMA 1A6XA 2RHQB 4KTAA 1QZGA 1VQJA 2QILA 4B3SL 1E3PA 1K0SA 1DOLA 4JI1L 1E22A 2JE6I 3U9OA 4GNXB 5EKKA 3B6YA 1V9PA 1AP0A 3TDQA 2DN8A 4DUYL 1VQ9A 1DGSA 1JOOA 1UNSA 3OW7A 3AFPA 3SK8A 3V2TA 1MKHA 3IFTA 4OIJA 2JA8B 1T5EA 2E2HH 5CV5A 2IT1A 5J22A 2R7ZB 4X62Q 4MTKA 3T16A 4GKKQ 3EN2A 1RODA 4ABNA 2VUMG 3R2IA 4AYBB 2HUGA 3RD4A 1TWAB 1SXTA 2K05A 3HGBA 4DR6Q 4IUVA 3VDYA 4OO1G 5M3FH 3S1RB 1E24A 3CRLC 1L1OB 1PRTF 4RCNA 1LABA 4LF6L 1GUOA 1N33Q 3OTOL 4HJ8A 1IBKQ 2IX0A 4ULLA 3CPWA 1UE7A 1MGSA 3QWNA 1SFOB 3J7AF 1VQHA 4HJ5A 5GAHC 4QCLA 1XTDA 3BYTB 2NUCA 4OWXB 3K0YA 1J6QA 2I5HA 2YTVA 2B2VA 1HUMA 3RUZA 2OEOA 4DGZA 5CC4A 1KLUD 1CQVA 3MXGA 4ZKCB 4DV6Q 5FLMG 3EFXD 1QCBD 1CKMA 1KC8C 2BDNA 3MFYA 2NB0A 1IW7C 1PH7A 5JJLA 4LUVA 3KYHC 2YU9H 1C0AA 5LMNL 2BOSA 2MUYA 2NVYH 3GQBA 1D1IA 4BXXH 3ICEA 3BVZA 5D3IB 1JMCA 3BYYB 3M7GA 4DFAA 1YBYA 3PO3G 3F2DA 4LF5L 1JOQA 1B1ZA 4KY5A 5KEEA 5LMNW 1KTKA 1SR3A 4NXML 3CPFA 4PZ8A 3RN2A 3L9AX 4BS9A 4DAPA 3HOWB 4DNIA 3E9IA 5KYLA 3NP8A 4TKOB 3BZKA 4XT1B 3ND9A 3PMFA 4ID6A 5HGTA 4BY1H 1KNAA 2B2WC 1VQ8A 4FVMA 5C4JB 4LFCL 2CH4W 5CGKA 2JA7H 1DYQA 2K33A 4UY8C 4DR7L 2L11A 1A3VA 1HFNA 2HD3A 2TMPA 2HDMA 2CKZB 4KLKA 5EKLA 4A3MH 4K2LA 2IHEA 2DGYA 5JAVA 1NAPA 1PYBA 1WVLA 3MTSA 5GQOA 3RN5A 1LT5D 1WTHA 5K36G 1XMOL 4FYDA 5CV6A 4IUUA 1R9TB 4AQYL 1Q3LA 2A68C 3D6WA 3TP5A 1Y1WB 1F9QA 4DV0L 3J81i 5M5YB 3SHLA 3I55A 4OO1I 2WB1E 2E75C 4G57A 3K5OA 3C3LA 3M3YB 1Y1VG 1N32Q 3STBC 1TT2A 3S1NB 1H9RA 4CDCC 2ALYB 5IP9H 5EJWA 5ELOA 4DK6C 5C44H 1HHVA 5I6YA 2NVTH 2KCTA 3DXJC 4GKJL 1A2TA 1FR3A 1G51A 1PXUA 1VQFA 2K32A 2K5WA 2YTXA 1B2TA 1EQRA 2M9VA 3SK5A 1FGBD 1H9JA 2SNMA 5C0XH 1S5BD 3NEMA 3KBXA 2ENBA 2VQEL 3BG3A 2MPMA 1IBML 1SNMA 2X6GA 5D3DA 3F2CA 3HOZG 1VQIA 1AZQA 2UXDL 2A6HD 1C9OA 2CW0D 4FO2A 1LLRD 1JWMD 2B2YC 5IIFA 1NMGA 2AWOA 2N55A 5EKIA 1FJGQ 1TWFB 4C3JH 3V05A 2NZHA 4B3RL 1ZYRC 2Z6KC 1IHZA 2VS1A 5H1SE 2ZM6L 1K83H 2EQSA 2Z8LA 2KQ3A 4GNXC 1YNJC 2CQAA 1CKNB 2ZXOA 3QIAA 4DAYA 1EY7A 2EE1A 3M4QA 3HOYH 2DNCA 3HOUG 3IRBA 1ET9A 2HIXA 1PH3A 2L12A 1EIHA 1O7YA 5E4XA 4LUZA 4ZAIA 4X65Q 2NZ1D 4OWWB 2VUMB 4DK0A 3A8KE 2RSNA 4JCVE 5FO9B 1RTNA 1NY4A 2F0OA 2F3VA 3D0FA 4R8NA 4LF7L 3S15H 1VF5C 5JVH3 3PO2H 2KHSA 2A6ED 1WTPA 3J80E 1K8GA 1VQ4A 3HKZE 2PQAB 1L1OC 1W3SA 1R4PB 4DV7L 3S17B 4JYAQ 4A3FG 1LTAD 3HOVH 2EJGC 3HS0C 1F2MA 3ERQA 3I91A 1A62A 1HXYD 1MJCA 4DR5Q 4JI5Q 3RZDH 5IWAL 2B63G 3D4RA 4C3IH 1FD7D 1PV4A 1I6HB 3TS2A 2NVXH 4IUTA 2F0HA 1I4HA 1Q8IA 1MJEA 4OELB 2QA4A 3H15A 4G4KA 4IFDH 4L6TB 5M3FB 2IX3A 4LF9Q 1TWCH 4YCWA 2K6AA 1D6EC 2B2UC 2LFNA 4PNYA 4CKBA 4MIUA 2F0NA 5A35A 1O7ZA 1UE5A 4QGUA 2ZT9C 1STYA 4OXPA 1VMCA 3K5LA 2ZJPA 5A2QL 2OWOA 2HHHL 3HEJA 3T1YQ 4ZUIA 1TU2B 2F0FA 3BJUA 3NWSA 4DPGA 5D14A 3VYRA 2AWNA 1SLJA 1KAAA 3KLRA 4R1JA 1I50H 5KIXA 5CR3A 4B9XA 1H9SB 1B9NA 1I94L 2E2JB 2F1MA 1HCZA 4DR4L 3H0GG 4KV6A 1P8LA 3KJPA 5C5MA 2PI2A 2K28A 1K73C 1NCVA 3ZYYX 1XPRA 4GLVB 4PMWA 3CCRA 4JI6Q 2X6LA 2ZJQA 4OGQC 2F0KA 4DUZQ 1WTVA 4YWMA 3A54A 3PO3B 2WV6D 1OXVA 2PCFB 1IXRA 4OL7A 4I7AA 4RGTA 4A75A 1YJ9A 1JC7A 1HRJA 2NN6H 4AH6A 2R92G 4MZ9A 1QILA 2JA6G 4RKBA 5FJ8H 1A8VA 4B08A 2DJFC 3HKZG 2YU9B 1YNND 3UDGA 3S24A 4HJAA 3M4OB 4M8AA 4KJNA 3E3XA 3TSSA 1N36Q 2NVYB 4KY7A 3UI2A 1B3QA 1U0LA 3J7ZC 4HMIA 2E2DC 4JPBW 1SYBA 4XTCS 3HG9A 4RGMA 1PH9A 4A3KG 4JBJA 3D8GA 3QG1A 3T13A 2KCCA 4JBKA 2RF4A 2XGTA 2AHOB 4CDFC 2R93G 4J1MA 4JBWA 3TS0A 3DUZA 1HTLD 3MEFA 2VB3X 2JXMB 1QZHA 2WACA 4MNOA 4BY1B 1ET6A 3KF8A 1TWHH 2UUAL 2XWBB 2E2IB 1EWIA 4X3KA 4GN3B 1GHJA 2YTYA 4YHHQ 2JA7B 1TS5A 5J3BA 2N78A 3S14H 2KVMA 3HOXG 1XNQL 3DWPA 3OMGA 3ITPA 3J81c 1WCMG 2A69D 5CYUA 2PMZE 4HJ9A 4R4CA 4GOPC 2OTLA 1WJJA 3PUZA 4K0KL 2D5DA 1HNXQ 1F2YA 1A0IA 3KLSA 5LL6S 3JC66 1UAPA 4KHPQ 5E1FA 5NUCA 2ZTEA 1VMPA 4KHVA 3CMAA 3GTGB 1X65A 1O7IA 3HOZB 4ZK9B 3K58A 2RVLA 5CV8A 1EOTA 3P7JA 1JB7A 5AFWA 4A93H 3KJOA 4FXGC 4I7ZC 1SJHD 1Z7TA 4KMUC 5C44B 4A3BH 1E2ZA 4JI4L 1VQDA 1SRUA 4B3TQ 1SYFA 2EY5A 2EYFA 3NQIA 5ELEA 5CBEE 2X69A 2BA1A 3HOUB 1NE3A 2KCNA 1BCPF 2Y0SG 3QO2A 3E5SA 1PTOF 4ILWA 1TR5A 3DM3A 4WORA 4BBRH 1B9MA 3DWQA 4JG2A 5IT9L 1K8AC 3NTKA 4JI3L 2EYHA 1DOMA 3DM1A 4PQXA 2LMCB 1I6VC 4H7BA 1A3TA 5IODA 2FXQA 1JQYD 2ZXPA 4C3HH 1CUKA 4QIWE 3RZOH 4C3JB 1G2SA 1TWGH 1DCZA 1OO9B 2L4NA 2Z4HA 4A3JG 1TS2A 5EPJA 2Q2UA 4A3FB 4G7OC 4FXDA 1UEBA 2VQFL 3GTLH 2A73B 4HJ7A 2F3WA 1PH4A 3IL8A 2F03A 3FMCA 4DV1L 2XRSD 5AJ3L 1YIJA 3NQTA 5K5PA 2SDFA 1A63A 3GTQH 1Y8PB 5C4HA 5C3XA 3PO2B 4Q5VA 4L5TA 3S9WA 1WOCA 3CQZH 4A3LG 1PFSA 2BE5D 2QCPX 3E9HA 2QGQA 1LTID 2QW7A 4DV2Q 1QE6A 1HTPA 2D0PA 2UU9L 1CM9A 4K5WA 1GUGA 3HP3A 4CJ2C 3HOVB 3S2HH 2KHIA 4A3CH 1D8LA 5ELFA 3I2ZA 1WTQA 4K6DA 5GAGC 3I90A 1BF4A 4JW0A 4EX5A 4RA8A 2B2WA 2ES2A 5JJKA 3A74A 3K57A 1C7YA 2VB2X 4O42A 3E6ZX 2J7ZA 2CCZA 2BCOA 2ID0A 1XNRL 4XT3B 4A3GB 2B3GA 3G48A 3FP9A 4PG3A 1XYIA 1TS3A 1EQQA 4X66Q 2R92B 4DR3L 1SAPA 3PSIA 2JA6B 5IGBA 4IUPA 4UHVA 4P2CB 4OONA 1TS4A 3DWAA 2K52A 2R3ZA 2H4OA 3HKZB 1SDFA 1Q90A 4JI0Q 5JEAJ 5KNDA 4KY6A 3H09A 4N8X1 3NTHA 1V1PB 2IPKD 3IKJA 2BA0A 4P74A 4A3KB 2OXPA 3MAQA 1VQCA 2QKIC 3OIQA 1JJGA 2I46A 5CBAE 1CZGA 1LV9A 3A8IE 4JOIC 4O1NA 2XWJB 1PRTB 2EJMA 4LFBQ 1HNWQ 4KD3A 3NXWA 1IKLA 3UDXA 4JVZA 1EZ8A 4XDXA 5ELDA 4X62L 5EAYA 4GKKL 1OXXK 3I4MG 1CKOA 4A3DH 4DNRB 2F0EA 1MIUA 3CCSA 4DR6L 2HQLA 3BDOA 3HOXB 2LKVA 3PQIA 1PRTD 3PIPA 2F0GA 4CKEA 5IGFA 1WCMB 1Q86C 2SNSA 1N33L 1STHA 2B2YA 3S16H 1IBKL 1GVPA 1QVCA 4NP5A 5LMUQ 2YV5A 2Z6KA 4IN3A 4GNXA 5EGTA 2UUBQ 1PH8A 2WKCA 4FF4A 2EY1A 2UUCQ 4GZYC 1CTMA 3K6OA 1EEFD 1E1OA 1SE4A 2CVRA 2RCFA 4ZRZA 3TZUA 5EPLA 5C3EH 1OXUA 3MXNB 4RHRA 1LTSD 3MFGA 5EPKA 1SNPA 2PI2E 4JBMA 4IOCA 1S5DD 3OYYA 4UP7A 3JAME 3CCQA 4QJFA 4JI7Q 3PF5A 1TVXA 4OX9Q 4DV6L 1XPOA 4LF4Q 4F87A 4L5RC 4XQNA 3R2TA 1CA6A 1ZKOA 1EZ6A 4J15A 1X3EA 3S1MH 4YWLA 2Y0SB 1DOKA 3DMUA 5JPMC 2EOTA 3KBGA 4HSPA 4L63B 4OWTB 2NBFA 3PIO3 2MO0A 2DUDA 1P16A 2WIIB 1QNKA 5M3MH 1QVFA 1GJXA 2K7VA 4UDUC 2F0LA 1L0XB 4QF4A 4P73A 3CKIB 1MBYA 3W2DA 4KN4C 3AEVA 2RKSA 1GXDC 4K8IA 4JI1Q 2B2UA 5M3FG 2OF1A 1CK1A 5IYBH 4A3JB 1PZKD 1WTRA 1XTCD 4HAEA 2VXWA 3A0JA 5KRUA 3CCJA 1EFWA 2EVBA 5LHY1 3F2UA 2LXKA 4KJOA 3WOEA 3T4AC 5IYCG 3DEOA 4HMJA 1SMXA 2N3SA 3MA2B 4BBRB 2BE5C 4C1NI 4AIMA 3CCMA 1AFPA 1JICA 1D2BA 5CMDA 4DR1Q 3FPPA 1PYSB 1ZXTA 3UE0A 2XIWA 1GUNA 3H3VH 1C48A 2AMCB 3FHWA 1ICWA 3G71A 1Q8KA 4C3HB 1EY0A 1AE2A 1A2UA 1VQ6A 3Q8DA 2TSSA 3E0JA 2NVQH 3D3RA 2RCNA 2EJFC 5GAEC 1RHPA 4H02A 3WWVA 3V96A 3OWEB 5M5WH 2GVBA 1WFQA 4XIGS 3VA7A 5C4XH 3DEPA 1PYWD 4N9TA 2RA4A 3NENA 1DZ1A 4HCEA 3A5UA 2AUKA 4PMBA 3K7AB 3MEHA 5KNCA 1D5MC 5IGGA 5HY6A 2L55A 1YHQA 1X9NA 1N32L 1PTOH 2F4VQ 3GTQB 1PFMA 1TQOA 4X3UA 1ILQA 4X3TA 1ICFB 3MWYW 2KECA 1BQQT 4JC0A 3AU7A 4BXXG 3D6CA 3AQQA 2MP1A 4GN5A 4KN7C 3S2HB 4C2MH 3P1HA 1HZBA 3NPPA 3S1QH 1QG7A 3I4LA 4QL5A 3A56A 1HR0Q 2Z4IA 3NE5B 5M5XB 3L3OC 1NJIC 2QEJC 3GTMH 4BY1G 2Q2TA 2JA7G 1SEBD 2JN4A 2WP8J 2I07B 5EQ0A 1KABA 1Q12A 1FJGL 2N49A 1GOZA 4DV4Q 2NWGA 1RD9D 1VQ5A 1A3UA 4A3MG 1STBA 5EBCA 1IZ6A 4E6IA 3Q23A 1AE3A 2K5DA 1VQBA 4GOPA 4ZCKA 5J1ZA 3TBIB 1A15A 3C46A 4DK1A 3PUWA 3J80L 1I4QA 3NWTA 1GHKA 1KXLA 1ASYA 1EL0A 3GD7A 3PIOA 3Q24A 3I4MB 4X65L 2QDBA 4RAUC 2Z6BA 5DM63 4APVA 5FLXc 2OCEA 3WDNA 3PUXA 2IWHA 5IP7H 2F0MA 4BBSH 1ESRA 5KNBA 1IL8A 1JE5A 2WAQE 4WRDA 2OQKA 5JJIA 2I5MX 1D7QA 2JYOA 3BZCA 1BR9A 3Q0AA 2F0TA 3GTPH 1NTGA 1B4OA 1RCVD 3MXUA 5IP9G 2H5XA 3PGZA 5KYIA 4WJWA 3KF6B 5C44G 4A3IH 2JEAI 3NBHA 4JYAL 5DM73 1CZWA 3GTKB 3AMUA 1ENFA 4DR5L 4JI5L 5C0XG 1W2BA 4K6LA 1VCIA 2PNRC 1PH6A 1UE6A 4DN4M 2PNHA 3EROA 3OPOA 4LF9L 1B7YB 1HNZQ 3SR1A 2A19A 4K5XA 4H0LC 2EIFA 4DAYB 5J39A 3CCLA 2QF7A 4MTNA 1E2VA 1MI2A 5JJZA 5IYDH 3T1YL 4OIKA 3SK6A 2K50A 2B8FA 4C3JG 2WB1G 1EOVA 2PQAA 1HA6A 3W3AA 4RFBA 1XPUA 3CD6A 2E2HB 3HOYG 1JJCB 1KDAA 4DR2Q 3FEWX 2R7FA 3G6JB 4WJ4A 1YITA 2B8GA 1J5EL 2ASBA 4JI6L 4KK7A 4QY7A 1B44D 4DUZL 1UUPA 2ZTCA 5E3FA 4HR7B 4DU9A 4OHJA 4DF7A 4B3RQ 4TRDA 3AYHB 3PO2G 1CHQD 2F0WA 4BY7H 3CF5A 5DLQE 1SMYD 3OHXC 1F9RA 3CCVA 1NR2A 2XSCA 3HOVG 1Z6HA 3C2PA 1AW7A 4RMFA 3S2DH 1U4PA 1N36L 5M3MB 4C3IG 1H9SA 1BNZA 2UXBQ 3SVMA 2EYJA 3I72A 2O4XA 3X3NA 2L15A 5C6AA 5G3LF 4IFDG 1F2ZA 3A7AB 2HDLA 3CW2C 3MHBA 1OTCA 2HT1A 1G2TA 4LUOA 4NXNQ 4IJHA 5HURA 2ATWA 1LTLA 4A3GG 2YYZA 1IBLQ 4NW2A 3I4NH 1STNA 3H91A 1WD0A 2A5HA 3UE1A 3RMHA 3FKIH 2NTTA 2F0UA 5IWAQ 2E74C 2AQ1B 1SJED 2NTSA 4A4IA 4YHHL 4DV3Q 4YWKA 3D4DA 2JA5H 1CFMA 1IYVA 4P71A 4ME3A 5CV7A 4XQJA 3GTJH 2BH2A 3N52A 4C56C 2EY6A 5IY0A 3KUPA 4UAIA 2XVSA 2F0IA 4AYBE 1VQEA 5C0XI 1KNEA 4IZ8A 5GROA 2MGSA 4JOIA 5C4XB 1LO5D 2G5DA 1LT3D 2F52A 3G7LA 4KHPL 2QDLA 1SROA 3SE0A 5E4WC 5ELNA 3OSOA 1I94Q 1HA5A 1K3BC 5IT9c 5FJ8G 1V43A 2AQ2B 5M9OA 1S5FD 3BVMA 3UDIA 2JK8A 4DKAC 3L7ZC 1PFNA 1YJNA 1NMFA 3EJIA 4B3TL 1HFGA 3GV3A 4A3MB 1DONA 4IPHA 3G4SA 5IGEA 1LTBD 1W6KA 2RDFA 2C35B 2Q8TA 3KF8B 3PCOB 2EY2A 2XN9C 1KAWA 2JA8H 3BDCA 1BCPD 3GP7A 2UXCQ 5FO8B 1PTOD 2DJGC 3Q6SA 5T1IA 2A6HC 3SK4A 4ZYSA 1X56A 2R7ZH 5BR8Q 2IL8A 2CW0C 4XQQA 4BA2I 5FK9C 2LXJA 2P5ZX 5C5LA 2K5VA 1TWAH 3VR5A 1YI2A 4JI2Q 4KKTA 1N34Q 4IPCA 3S1RH 4CKCA 4DXFA 1M90C 1YVCA 1FVIA 3OIPA 4KKUA 3HFZB 1IKMA 1EU4A 4K8JA 5IE8A 4HIMA 5COYA 3EVQA 2NVTB 2ICIA 1RJTA 2FMMA 3AFQA 4FF2A 2F0VA 3HZXA 2PZTA 2CHBD 3RNUA 4H13C 3QB3A 4F88A 1EEID 4DV5Q 5I6WA 1Y14B 3TEHB 1QUQB 2A6EC 4YY3Q 4IFDI 3ER0A 4A3EH 4LAAA 4QUCA 1SE8A 2IHFA 2E5LQ 3K5NA 1YEZA 3VR4A 3SXHA 1E2WA 1SN8A 4RGOS 4IO9A 4R4QA 4V190 4A93G 1EY9A 4DV2L 1GUWA 4A3BG 3NTIA 3TN2A 1KHIA 1HZ9A 2WB1B 1GM5A 3PIP3 1STAA 2OTJA 1K83B 4MHEA 1O7LA 3TP7A 3HOYB 4JI8Q 3QOJA 2ZXRA 2KA7A 3TRZA 3C1EA 3J80i 2C9OA 4BBRG 1XMQQ 1XX8A 4GLXA 1EWCA 3T1HQ 2CFMA 2CH4A 3J81L 1EY8A 2F3IA 4LF8Q 3S15B 5JEAH 3I3CA 3RLNA 3J81j 1RL2A 4C3HG 1LACA 1T9HA 2B39A 3L0OA 1R4QB 4YCUA 1WTOA 4R4OA 1SE2A 3J7YW 3CU7A 3HOWH 3PUVA 3RLOA 3QR8A 1RIPA 3M4YA 3LNNA 1XXGA 3URYA 1U4MA 3I8ZA 3NSWA 3A8JE 2WINB 4LNQA 1CI3M 2DY8A 2Q8RE 4JI0L 1GO3E 3RZDB 1PHJA 2KHJA 1D5XC 4Q0FA 4C3IB 2BDOA 2B29A 2NVXB 1HQRD 5D65A 2IW3A 1FL0A 4MN3A 2L0CA 1BBUA 1TWCB 1I4GA 1HNWL 1R9TH 4BY7B 3W1BA 3KDFB 1E7ZA 3SGIA 1YNNC 3LWEA 1Y1WH 5I9PA 3K59A 4FDBA 5M5YH 1HZAA 4JV5L 1KRTA 4Y7NH 3SEBA 2LY7A 4A3CG 1S4ZA 1I50B 4RGNA 2L1BA 4X64Q 1YHBA 5C4ZA 3TP6A 3M3YH 3S2DB 1GKHA 4ALPA 2EZVA 3J81E 1NR4A 1JWUD 1TXYA 2NZOA 1JCKB 3CAMA 3EA6A 2PYKA 1EYCA 3CCEA 4IALA 5LMUL 3U50C 2D2CC
chains in the Genus database with same CATH topology
2CWAA 2WFWA 5GAEC 3OW2A 1L1OC 4H02A 3WWVA 1W3SA 2UUBL 3K0XA 2GVBA 1WFQA 5M5WH 4XIGS 3I7FA 4DV7L 5C4XH 1VS0A 1PH5A 4JYAQ 1OXSC 4A3FG 4JI8L 3HOVH 3NENA 1OXTA 3ULJA 4DK3C 3A5UA 2JA8G 1A62A 1MJCA 1JT8A 3F8TA 4DR5Q 3F1ZA 1SFOH 4JI5Q 3RZDH 5IWAL 2B63G 1VQGA 4C3IH 2R7ZG 4IPGA 1G291 1PV4A 2UUAQ 5HY6A 1XMQL 1YHQA 1X9NA 3TS2A 2NVXH 1N32L 2F4VQ 5E7NA 3T1HL 4AYBG 2QA4A 1MJEA 1QUQA 3H15A 3KOJA 3EIVA 3GDEA 4LF8L 1B8AA 4LF9Q 1G6PA 1TWCH 1U5KA 4YCWA 4HIOA 4JI7L 1XNQQ 1TWFH 1N9WA 4JC0A 4TQUS 4A3JH 4OX9L 1UE5A 4BXXG 4DAMA 4QGUA 4OXPA 4P72A 2Z0SA 2ZJPA 4BA1I 2OWOA 3AQQA 1KQSA 3PF4A 3U58A 2HHHL 3STBD 3T1YQ 3BJUA 4GN5A 3K80C 4DPGA 4C2MH 2AWNA 1QVGA 4R4IA 1SLJA 4K0KQ 1HZBA 1Z9FA 4R1JA 3RLFA 1I50H 2A1AA 3S1QH 2VUMH 2MO1A 1YNXA 2KBNA 4QL5A 1I94L 3M85A 1HR0Q 4DR4L 3H0GG 3TREA 1P8LA 3UDFA 3CP0A 3KJPA 2V1CC 2PI2A 2K14A 2GN5A 1K73C 1NJIC 4BY1G 3GTMH 2Q2TA 1XPRA 4GLVB 4PMWA 3CCRA 4A3EG 1YJWA 1VQKA 2ZJQA 3KLWA 4JI6Q 2JA7G 4A3DG 2WP8J 4A3LH 4B3MQ 1Q12A 4DUZQ 1FJGL 2N49A 4DV4Q 1YZ6A 1Q1BA 4YWMA 1VQ5A 1OXVA 1KL9A 4A3MG 4NB3A 4JI4Q 1IXRA 2Q2HA 1IZ6A 1AE3A 3K81C 1Q1EA 1VQBA 1Q46A 2NN6I 4A75A 1KRSA 4GOPA 3S17H 5HGQA 1YJ9A 1IL2A 1WI5A 3JAMc 3PUWA 4X66L 1XJVA 4AH6A 3PV0A 1L1OA 1YHAA 1ASYA 4MZ9A 2R92G 1KXLA 3DLLA 1S72A 2VL6A 3K7AH 3GD7A 3PIOA 2JA6G 1I3QH 3CXCA 4X64L 4X65L 4LFAQ 5FJ8H 1I6HH 1A8VA 4APVA 2EXDA 3M4PA 5FLXc 4DR1L 2OCEA 3PUXA 1FGUA 2CWPA 3HKZG 3K8AA 5IP7H 5C4JH 3UDGA 4BBSH 3S24A 1V1QA 2LSSA 4HJAA 2IY5B 1Q82C 1N36Q 1JE5A 2WAQE 4JI3Q 2D0OA 2OQKA 5C3EG 5JJIA 2I5MX 1GD7A 3NELA 1D7QA 3BZCA 1U0LA 3J7ZC 3E0EA 1X3GA 4XTCS 3GTPH 1NTGA 3I4OA 1PH9A 4A3KG 5IP9G 1LYLA 2H5XA 3PGZA 4B3SQ 4JBJA 2R6GA 4L5QA 5IYCH 5FLMH 3KF6B 5C44G 2VW9A 4A3IH 5JEAG 2JEBI 2JEAI 4A76A 4JBKA 2RF4A 2XGTA 2AHOB 4JYAL 4LFBL 2A8VA 4DUYQ 2R93G 4JBWA 3TS0A 1EIYB 1VQLA 1X55A 3ZJYC 2VQFQ 1PH1A 3MEFA 2K5NA 4DR5L 4JI5L 5C0XG 3HOWG 3KDFA 1W2BA 2IX1A 1HH2P 1K9MC 2E2JH 1QZHA 4MNOA 1VCIA 4UPAA 2UUAL 1TWHH 1PH6A 1UE6A 1EYGA 2VZAA 5M5XH 1EWIA 1X6OA 3ERSX 4GN3B 2YTYA 2F4VL 4YHHQ 2PNHA 5J3BA 3S14H 2N78A 4DV1Q 5AJ3Q 4LF9L 1B7YB 4IPDA 2KENA 3S1NH 3HOXG 1HNZQ 1XNQL 2A19A 5M3MG 3PO3H 1E1TA 4YCVA 1BKBA 2EIFA 4DAYB 4POGA 3CCLA 1X54A 1WCMG 3J81c 4LWCA 4GN4B 4MTNA 2PMZE 4HJ9A 5IYDH 2ZTDA 4R4CA 4GOPC 3T1YL 2OTLA 4LF6Q 1WJJA 2K50A 3GO5A 3PUZA 3BU2A 5IYBG 3OTOQ 4K0KL 2WB1G 4UP9A 1HNXQ 1H95A 2UU9Q 2OQ0A 1EOVA 2PQAA 3J80c 3A5ZB 1A0IA 1L2FA 3JC66 1XPUA 3I4MH 4PZ7A 1Y1WG 2JJQA 3CD6A 4KHPQ 3HOYG 1JJCB 1HR0L 2UUCL 3LGJA 3U4ZA 4DR2Q 1HJPA 2ZTEA 2R7FA 1PH2A 3CMAA 4WJ4A 1YITA 1X65A 1J5EL 1O7IA 3M4OH 2ASBA 3ULPA 4JI6L 4QY7A 1VQMA 3CC7A 4POFA 1JB7A 4B3ML 4L5SA 3KJOA 4DUZL 4A93H 4DV4L 2ZTCA 1BVSA 5GADC 2I0QA 1HR0W 4A3BH 4JI4L 3U4VA 1VQDA 1SRUA 1XNRQ 4B3TQ 4B3RQ 2E8GA 3AYHB 1ASZA 4EQ5A 3PO2G 4LF4L 2ZJRA 3GTKH 1LUZA 3K7UC 4BY7H 4UP8A 2BA1A 3CF5A 4NPSA 5DLQE 3I56A 1NE3A 3TQYA 4DR3Q 4JV5Q 4LFAL 5C4XG 1CSPA 2Y0SG 1UE1A 4Y52H 3CCVA 3HOVG 2I5LX 3DM3A 2E2IH 2MNAA 1Y1VH 4BBRH 1AH9A 4JG2A 4RMFA 1Q7YC 3CC2A 1S40A 3S2DH 3HKZE 1N36L 1K8AC 3GTOH 4JI3L 2K75A 1EIFA 3EBEA 2UXBQ 3G6EA 5LMNQ 2RHQB 1QZGA 2FXQA 1VQJA 2L15A 4B3SL 1E3PA 4C3HH 4IFDG 1CUKA 4QIWE 3RZOH 4JI1L 1E22A 2JE6I 4GNXB 1TWGH 1N8RC 3B6YA 3CW2C 1V9PA 1OTCA 2HT1A 4A3JG 4DUYL 4LUOA 1VQ9A 4NXNQ 1VQOA 4IJHA 1DGSA 2Q2UA 4LF5Q 2ATWA 1LTLA 1K3RA 1UEBA 4KI0A 4A3GG 3AFPA 2YYZA 2VQFL 3GTLH 1IBLQ 1K0RA 1MKHA 2E2HH 4NXMQ 3I4NH 2IT1A 4O0AA 1LM0A 4HJ7A 3UE1A 3FKIH 3GTGH 5IWAQ 1S3OA 4A4IA 4X62Q 4DV3Q 1PH4A 4YHHL 3HOZH 4GKKQ 4YWKA 4WJ3M 4DV1L 1CSQA 2JA5H 3EN2A 4PZ6A 5AJ3L 1YIJA 2VUMG 4P71A 1BBWA 4LFCQ 1HNZL 1A63A 3GTQH 4DR6Q 4ME3A 4GOPB 4DR7Q 3VDYA 4OO1G 1VQAA 5M3FH 3GTJH 2BH2A 2MFIA 1E24A 1L1OB 4L5TA 1VQ7A 5IY0A 1WOCA 3CQZH 4A3LG 1PFSA 4LF6L 4AYBE 3E9HA 1VQEA 2QGQA 5C0XI 1N33Q 4DV2Q 3OTOL 4HJ8A 2D0PA 5GROA 2UU9L 1XMOQ 3HOUH 1IBKQ 4JOIA 2IX0A 3CPWA 4AQYQ 1UE7A 3S2HH 2F52A 2KHIA 4A3CH 3KF6A 4KHPL 1D8LA 4HIDA 3I2ZA 1SROA 4DR2L 5GAGC 4DV0Q 5ELNA 4EX5A 1I94Q 1CKNA 1VQHA 1NBWA 5IT9c 5FJ8G 4HJ5A 2ES2A 5JJKA 5GAHC 3A74A 1V43A 1XTDA 1KD1C 1C7YA 2CQOA 3UDIA 2JK8A 4DKAC 3L7ZC 3NBHB 5IP7G 4BBSG 4OWXB 2CCZA 1J6QA 1NMFA 2I5HA 1YJNA 3KFUA 2ID0A 2YTVA 4B3TL 1VQNA 1XNRL 4IOAA 4IPHA 3W5OA 3G4SA 2B3GA 2JA9A 3G48A 3FP9A 4GS3A 4A3FH 2MQHA 4GKJQ 1Q81C 2C35B 4PG3A 4DV6Q 1EQQA 4X66Q 3KF8B 3PCOB 5FLMG 1KAWA 4DR3L 2JA8H 4A3IG 3PSIA 2UXCQ 1CKMA 1KC8C 2B63H 4KHZA 1X56A 2R7ZH 4OONA 5BR8Q 2K52A 1PH7A 5JJLA 4LW1A 4LUVA 2VQEQ 3JAMi 4BA2I 3H3VI 4JI0Q 2UXBL 2LXJA 5JEAJ 3KYHC 2K5VA 2YU9H 1TWAH 5LMNL 1C0AA 1IBMQ 1YI2A 1Z47A 4JI2Q 1N34Q 4IPCA 3S1RH 2NVYH 4BXXH 2BH8A 3ICEA 1M90C 2UXDQ 1YVCA 1FVIA 2BA0A 4P75A 4P74A 1JMCA 5C0XJ 3HFZB 3CCUA 5IE8A 1VQCA 4HIMA 1JJGA 1YBYA 2HIVA 3PO3G 1M1KC 4NXNL 3F2DA 4LF5L 3HKSA 4JOIC 5LMNW 4LFBQ 1HNWQ 3AFQA 1IBLL 2Q2IA 5IYDG 1SR3A 2ZM6Q 2K4KA 3RNUA 4NXML 3CPFA 4PZ8A 3RN2A 2R7DA 1UWVA 3J7A5 3M9BA 3UDXA 4DNIA 3E9IA 1B70B 4X62L 3BZKA 4DV3L 4DV5Q 5EAYA 4GKKL 3H0GH 2WAQG 1OXXK 1Y14B 3I4MG 1JJ2A 3TEHB 1QUQB 4BY1H 1CKOA 4YY3Q 1VQ8A 4IFDI 3ER0A 4A3EH 4LFCL 4A3DH 1SE8A 2IHFA 1MIUA 3CCSA 2JA7H 2E5LQ 4DR6L 2HQLA 4UY8C 4DR7L 1YEZA 2CKZB 4KLKA 3PIPA 4A3MH 2RHSB 1WYDA 2IHEA 1Q86C 2DGYA 4A93G 1PYBA 1SN8A 4IO9A 3RR5A 4R4QA 5GQOA 4LF7Q 3L2PA 4DV2L 3RN5A 1N33L 4A3GH 5K36G 3S16H 3W1GA 1XMOL 4A3BG 1KHIA 1GVPA 1QVCA 5LMUQ 1IBKL 2R92H 2YV5A 1HZ9A 2Z6KA 4GLAC 4AQYL 1VQPA 1GM5A 2OTJA 4GNXA 2UUBQ 2JA6H 4DV7Q 4BY7G 1PH8A 4DV0L 4JI8Q 3J81i 2UUCQ 3I55A 4OO1I 2WB1E 2GVAA 3TRZA 3D31A 1J5EQ 1E1OA 5C3EH 3J80i 1Y1VG 1OXUA 3MXNB 4BBRG 1XMQQ 3PUYA 3STBC 1N32Q 4GLXA 2PI2E 4JBMA 4IOCA 2XTIA 3T1HQ 2CFMA 2ALYB 5IP9H 4A3KH 3OYYA 2F3IA 4UP7A 5ELOA 4DK6C 5C44H 3CMEA 4QJFA 3CCQA 4LF8Q 3RLNA 3J81j 1RL2A 2KCTA 4JI7Q 2NVTH 3PF5A 1L0WA 4GKJL 4OX9Q 4DV6L 1XPOA 1G51A 4LF4Q 4L5RC 1T9HA 3L0OA 2R93H 4YCUA 4X6AH 1VQFA 2UXCL 2YTXA 4R4OA 1EQRA 1HNXL 2HHHQ 2JQOA 3PUVA 3RLOA 3HOWH 1RIPA 1X3EA 4J15A 4YWLA 5BR8L 1KIXA 3S1MH 1PVOA 3NEMA 4O2DA 1X3FA 4IFDJ 2NN6G 4LNQA 2VQEL 3I4NG 3F2BA 4OWTB 3CC4A 4JI0L 1EUJA 1GO3E 1HZCA 4HIKA 1PHJA 2KHJA 2MO0A 1IBML 2DUDA 3FKIG 1P16A 2B29A 3HOXH 4R4TA 4JI2L 3F2CA 1N34L 3ULLA 5M3MH 2Y0SE 3HOZG 1QVFA 4DR4Q 1VQIA 2JA5G 2QEXA 2UXDL 4TVAB 1C9OA 4RG1A 1WCMH 4P73A 1FL0A 3AEVA 1BBUA 1NMGA 2AWOA 4JI1Q 1I5FA 1FJGQ 4C3JH 5M3FG 5IYBH 1HNWL 2NZHA 4B3RL 1R9TH 2Z6KC 5H1SE 2VS1A 1K8GA 3CCJA 3A0JA 4IJLA 1EFWA 2ZM6L 1K83H 2EQSA 4GNXC 3W1BA 3KDFB 1CKNB 2LXKA 1E7ZA 3SGIA 1Y1WH 3M4QA 3HOYH 4QQBX 4FDBA 3HOUG 3IRBA 5M5YH 1HZAA 5IYCG 2AKWB 2HIXA 4DV5L 3M7NA 4JV5L 1PH3A 1PA6A 1KRTA 4Y7NH 2K5HA 4A3CG 4YY3L 1SMXA 2N3SA 4LUZA 4AIMA 4X64Q 1YHBA 4X65Q 3CCMA 4OWWB 2VNUD 2E5LL 2KCMA 3M3YH 1IYJB 1GKHA 4DR1Q 4ALPA 4JCVE 1PYSB 3UE0A 2VY3A 1NY4A 1TXYA 2NZOA 3H3VH 2AMCB 3CAMA 3D0FA 3FHWA 3G71A 4LF7L 1Q8KA 3S15H 2D62A 1AE2A 3PO2H 3CCEA 2N8NA 1VQ6A 3Q8DA 2NVQH 5LMUL 3U50C 1VQ4A 2RCNA 2PQAB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CWA A;  2WFW A;  5GAE C;  3OW2 A;  1L1O C;  4H02 A;  3WWV A;  1W3S A;  2UUB L;  3K0X A;  2GVB A;  1WFQ A;  5M5W H;  4XIG S;  3I7F A;  4DV7 L;  5C4X H;  1VS0 A;  1PH5 A;  4JYA Q;  1OXS C;  4A3F G;  4JI8 L;  3HOV H;  3NEN A;  1OXT A;  3ULJ A;  4DK3 C;  3A5U A;  2JA8 G;  1A62 A;  1MJC A;  1JT8 A;  3F8T A;  4DR5 Q;  3F1Z A;  1SFO H;  4JI5 Q;  3RZD H;  5IWA L;  2B63 G;  1VQG A;  4C3I H;  2R7Z G;  4IPG A;  1G29 1;  1PV4 A;  2UUA Q;  5HY6 A;  1XMQ L;  1YHQ A;  1X9N A;  3TS2 A;  2NVX H;  1N32 L;  2F4V Q;  5E7N A;  3T1H L;  4AYB G;  2QA4 A;  1MJE A;  1QUQ A;  3H15 A;  3KOJ A;  3EIV A;  3GDE A;  4LF8 L;  1B8A A;  4LF9 Q;  1G6P A;  1TWC H;  1U5K A;  4YCW A;  4HIO A;  4JI7 L;  1XNQ Q;  1TWF H;  1N9W A;  4JC0 A;  4TQU S;  4A3J H;  4OX9 L;  1UE5 A;  4BXX G;  4DAM A;  4QGU A;  4OXP A;  4P72 A;  2Z0S A;  2ZJP A;  4BA1 I;  2OWO A;  3AQQ A;  1KQS A;  3PF4 A;  3U58 A;  2HHH L;  3STB D;  3T1Y Q;  3BJU A;  4GN5 A;  3K80 C;  4DPG A;  4C2M H;  2AWN A;  1QVG A;  4R4I A;  1SLJ A;  4K0K Q;  1HZB A;  1Z9F A;  4R1J A;  3RLF A;  1I50 H;  2A1A A;  3S1Q H;  2VUM H;  2MO1 A;  1YNX A;  2KBN A;  4QL5 A;  1I94 L;  3M85 A;  1HR0 Q;  4DR4 L;  3H0G G;  3TRE A;  1P8L A;  3UDF A;  3CP0 A;  3KJP A;  2V1C C;  2PI2 A;  2K14 A;  2GN5 A;  1K73 C;  1NJI C;  4BY1 G;  3GTM H;  2Q2T A;  1XPR A;  4GLV B;  4PMW A;  3CCR A;  4A3E G;  1YJW A;  1VQK A;  2ZJQ A;  3KLW A;  4JI6 Q;  2JA7 G;  4A3D G;  2WP8 J;  4A3L H;  4B3M Q;  1Q12 A;  4DUZ Q;  1FJG L;  2N49 A;  4DV4 Q;  1YZ6 A;  1Q1B A;  4YWM A;  1VQ5 A;  1OXV A;  1KL9 A;  4A3M G;  4NB3 A;  4JI4 Q;  1IXR A;  2Q2H A;  1IZ6 A;  1AE3 A;  3K81 C;  1Q1E A;  1VQB A;  1Q46 A;  2NN6 I;  4A75 A;  1KRS A;  4GOP A;  3S17 H;  5HGQ A;  1YJ9 A;  1IL2 A;  1WI5 A;  3JAM c;  3PUW A;  4X66 L;  1XJV A;  4AH6 A;  3PV0 A;  1L1O A;  1YHA A;  1ASY A;  4MZ9 A;  2R92 G;  1KXL A;  3DLL A;  1S72 A;  2VL6 A;  3K7A H;  3GD7 A;  3PIO A;  2JA6 G;  1I3Q H;  3CXC A;  4X64 L;  4X65 L;  4LFA Q;  5FJ8 H;  1I6H H;  1A8V A;  4APV A;  2EXD A;  3M4P A;  5FLX c;  4DR1 L;  2OCE A;  3PUX A;  1FGU A;  2CWP A;  3HKZ G;  3K8A A;  5IP7 H;  5C4J H;  3UDG A;  4BBS H;  3S24 A;  1V1Q A;  2LSS A;  4HJA A;  2IY5 B;  1Q82 C;  1N36 Q;  1JE5 A;  2WAQ E;  4JI3 Q;  2D0O A;  2OQK A;  5C3E G;  5JJI A;  2I5M X;  1GD7 A;  3NEL A;  1D7Q A;  3BZC A;  1U0L A;  3J7Z C;  3E0E A;  1X3G A;  4XTC S;  3GTP H;  1NTG A;  3I4O A;  1PH9 A;  4A3K G;  5IP9 G;  1LYL A;  2H5X A;  3PGZ A;  4B3S Q;  4JBJ A;  2R6G A;  4L5Q A;  5IYC H;  5FLM H;  3KF6 B;  5C44 G;  2VW9 A;  4A3I H;  5JEA G;  2JEB I;  2JEA I;  4A76 A;  4JBK A;  2RF4 A;  2XGT A;  2AHO B;  4JYA L;  4LFB L;  2A8V A;  4DUY Q;  2R93 G;  4JBW A;  3TS0 A;  1EIY B;  1VQL A;  1X55 A;  3ZJY C;  2VQF Q;  1PH1 A;  3MEF A;  2K5N A;  4DR5 L;  4JI5 L;  5C0X G;  3HOW G;  3KDF A;  1W2B A;  2IX1 A;  1HH2 P;  1K9M C;  2E2J H;  1QZH A;  4MNO A;  1VCI A;  4UPA A;  2UUA L;  1TWH H;  1PH6 A;  1UE6 A;  1EYG A;  2VZA A;  5M5X H;  1EWI A;  1X6O A;  3ERS X;  4GN3 B;  2YTY A;  2F4V L;  4YHH Q;  2PNH A;  5J3B A;  3S14 H;  2N78 A;  4DV1 Q;  5AJ3 Q;  4LF9 L;  1B7Y B;  4IPD A;  2KEN A;  3S1N H;  3HOX G;  1HNZ Q;  1XNQ L;  2A19 A;  5M3M G;  3PO3 H;  1E1T A;  4YCV A;  1BKB A;  2EIF A;  4DAY B;  4POG A;  3CCL A;  1X54 A;  1WCM G;  3J81 c;  4LWC A;  4GN4 B;  4MTN A;  2PMZ E;  4HJ9 A;  5IYD H;  2ZTD A;  4R4C A;  4GOP C;  3T1Y L;  2OTL A;  4LF6 Q;  1WJJ A;  2K50 A;  3GO5 A;  3PUZ A;  3BU2 A;  5IYB G;  3OTO Q;  4K0K L;  2WB1 G;  4UP9 A;  1HNX Q;  1H95 A;  2UU9 Q;  2OQ0 A;  1EOV A;  2PQA A;  3J80 c;  3A5Z B;  1A0I A;  1L2F A;  3JC6 6;  1XPU A;  3I4M H;  4PZ7 A;  1Y1W G;  2JJQ A;  3CD6 A;  4KHP Q;  3HOY G;  1JJC B;  1HR0 L;  2UUC L;  3LGJ A;  3U4Z A;  4DR2 Q;  1HJP A;  2ZTE A;  2R7F A;  1PH2 A;  3CMA A;  4WJ4 A;  1YIT A;  1X65 A;  1J5E L;  1O7I A;  3M4O H;  2ASB A;  3ULP A;  4JI6 L;  4QY7 A;  1VQM A;  3CC7 A;  4POF A;  1JB7 A;  4B3M L;  4L5S A;  3KJO A;  4DUZ L;  4A93 H;  4DV4 L;  2ZTC A;  1BVS A;  5GAD C;  2I0Q A;  1HR0 W;  4A3B H;  4JI4 L;  3U4V A;  1VQD A;  1SRU A;  1XNR Q;  4B3T Q;  4B3R Q;  2E8G A;  3AYH B;  1ASZ A;  4EQ5 A;  3PO2 G;  4LF4 L;  2ZJR A;  3GTK H;  1LUZ A;  3K7U C;  4BY7 H;  4UP8 A;  2BA1 A;  3CF5 A;  4NPS A;  5DLQ E;  3I56 A;  1NE3 A;  3TQY A;  4DR3 Q;  4JV5 Q;  4LFA L;  5C4X G;  1CSP A;  2Y0S G;  1UE1 A;  4Y52 H;  3CCV A;  3HOV G;  2I5L X;  3DM3 A;  2E2I H;  2MNA A;  1Y1V H;  4BBR H;  1AH9 A;  4JG2 A;  4RMF A;  1Q7Y C;  3CC2 A;  1S40 A;  3S2D H;  3HKZ E;  1N36 L;  1K8A C;  3GTO H;  4JI3 L;  2K75 A;  1EIF A;  3EBE A;  2UXB Q;  3G6E A;  5LMN Q;  2RHQ B;  1QZG A;  2FXQ A;  1VQJ A;  2L15 A;  4B3S L;  1E3P A;  4C3H H;  4IFD G;  1CUK A;  4QIW E;  3RZO H;  4JI1 L;  1E22 A;  2JE6 I;  4GNX B;  1TWG H;  1N8R C;  3B6Y A;  3CW2 C;  1V9P A;  1OTC A;  2HT1 A;  4A3J G;  4DUY L;  4LUO A;  1VQ9 A;  4NXN Q;  1VQO A;  4IJH A;  1DGS A;  2Q2U A;  4LF5 Q;  2ATW A;  1LTL A;  1K3R A;  1UEB A;  4KI0 A;  4A3G G;  3AFP A;  2YYZ A;  2VQF L;  3GTL H;  1IBL Q;  1K0R A;  1MKH A;  2E2H H;  4NXM Q;  3I4N H;  2IT1 A;  4O0A A;  1LM0 A;  4HJ7 A;  3UE1 A;  3FKI H;  3GTG H;  5IWA Q;  1S3O A;  4A4I A;  4X62 Q;  4DV3 Q;  1PH4 A;  4YHH L;  3HOZ H;  4GKK Q;  4YWK A;  4WJ3 M;  4DV1 L;  1CSQ A;  2JA5 H;  3EN2 A;  4PZ6 A;  5AJ3 L;  1YIJ A;  2VUM G;  4P71 A;  1BBW A;  4LFC Q;  1HNZ L;  1A63 A;  3GTQ H;  4DR6 Q;  4ME3 A;  4GOP B;  4DR7 Q;  3VDY A;  4OO1 G;  1VQA A;  5M3F H;  3GTJ H;  2BH2 A;  2MFI A;  1E24 A;  1L1O B;  4L5T A;  1VQ7 A;  5IY0 A;  1WOC A;  3CQZ H;  4A3L G;  1PFS A;  4LF6 L;  4AYB E;  3E9H A;  1VQE A;  2QGQ A;  5C0X I;  1N33 Q;  4DV2 Q;  3OTO L;  4HJ8 A;  2D0P A;  5GRO A;  2UU9 L;  1XMO Q;  3HOU H;  1IBK Q;  4JOI A;  2IX0 A;  3CPW A;  4AQY Q;  1UE7 A;  3S2H H;  2F52 A;  2KHI A;  4A3C H;  3KF6 A;  4KHP L;  1D8L A;  4HID A;  3I2Z A;  1SRO A;  4DR2 L;  5GAG C;  4DV0 Q;  5ELN A;  4EX5 A;  1I94 Q;  1CKN A;  1VQH A;  1NBW A;  5IT9 c;  5FJ8 G;  4HJ5 A;  2ES2 A;  5JJK A;  5GAH C;  3A74 A;  1V43 A;  1XTD A;  1KD1 C;  1C7Y A;  2CQO A;  3UDI A;  2JK8 A;  4DKA C;  3L7Z C;  3NBH B;  5IP7 G;  4BBS G;  4OWX B;  2CCZ A;  1J6Q A;  1NMF A;  2I5H A;  1YJN A;  3KFU A;  2ID0 A;  2YTV A;  4B3T L;  1VQN A;  1XNR L;  4IOA A;  4IPH A;  3W5O A;  3G4S A;  2B3G A;  2JA9 A;  3G48 A;  3FP9 A;  4GS3 A;  4A3F H;  2MQH A;  4GKJ Q;  1Q81 C;  2C35 B;  4PG3 A;  4DV6 Q;  1EQQ A;  4X66 Q;  3KF8 B;  3PCO B;  5FLM G;  1KAW A;  4DR3 L;  2JA8 H;  4A3I G;  3PSI A;  2UXC Q;  1CKM A;  1KC8 C;  2B63 H;  4KHZ A;  1X56 A;  2R7Z H;  4OON A;  5BR8 Q;  2K52 A;  1PH7 A;  5JJL A;  4LW1 A;  4LUV A;  2VQE Q;  3JAM i;  4BA2 I;  3H3V I;  4JI0 Q;  2UXB L;  2LXJ A;  5JEA J;  3KYH C;  2K5V A;  2YU9 H;  1TWA H;  5LMN L;  1C0A A;  1IBM Q;  1YI2 A;  1Z47 A;  4JI2 Q;  1N34 Q;  4IPC A;  3S1R H;  2NVY H;  4BXX H;  2BH8 A;  3ICE A;  1M90 C;  2UXD Q;  1YVC A;  1FVI A;  2BA0 A;  4P75 A;  4P74 A;  1JMC A;  5C0X J;  3HFZ B;  3CCU A;  5IE8 A;  1VQC A;  4HIM A;  1JJG A;  1YBY A;  2HIV A;  3PO3 G;  1M1K C;  4NXN L;  3F2D A;  4LF5 L;  3HKS A;  4JOI C;  5LMN W;  4LFB Q;  1HNW Q;  3AFQ A;  1IBL L;  2Q2I A;  5IYD G;  1SR3 A;  2ZM6 Q;  2K4K A;  3RNU A;  4NXM L;  3CPF A;  4PZ8 A;  3RN2 A;  2R7D A;  1UWV A;  3J7A 5;  3M9B A;  3UDX A;  4DNI A;  3E9I A;  1B70 B;  4X62 L;  3BZK A;  4DV3 L;  4DV5 Q;  5EAY A;  4GKK L;  3H0G H;  2WAQ G;  1OXX K;  1Y14 B;  3I4M G;  1JJ2 A;  3TEH B;  1QUQ B;  4BY1 H;  1CKO A;  4YY3 Q;  1VQ8 A;  4IFD I;  3ER0 A;  4A3E H;  4LFC L;  4A3D H;  1SE8 A;  2IHF A;  1MIU A;  3CCS A;  2JA7 H;  2E5L Q;  4DR6 L;  2HQL A;  4UY8 C;  4DR7 L;  1YEZ A;  2CKZ B;  4KLK A;  3PIP A;  4A3M H;  2RHS B;  1WYD A;  2IHE A;  1Q86 C;  2DGY A;  4A93 G;  1PYB A;  1SN8 A;  4IO9 A;  3RR5 A;  4R4Q A;  5GQO A;  4LF7 Q;  3L2P A;  4DV2 L;  3RN5 A;  1N33 L;  4A3G H;  5K36 G;  3S16 H;  3W1G A;  1XMO L;  4A3B G;  1KHI A;  1GVP A;  1QVC A;  5LMU Q;  1IBK L;  2R92 H;  2YV5 A;  1HZ9 A;  2Z6K A;  4GLA C;  4AQY L;  1VQP A;  1GM5 A;  2OTJ A;  4GNX A;  2UUB Q;  2JA6 H;  4DV7 Q;  4BY7 G;  1PH8 A;  4DV0 L;  4JI8 Q;  3J81 i;  2UUC Q;  3I55 A;  4OO1 I;  2WB1 E;  2GVA A;  3TRZ A;  3D31 A;  1J5E Q;  1E1O A;  5C3E H;  3J80 i;  1Y1V G;  1OXU A;  3MXN B;  4BBR G;  1XMQ Q;  3PUY A;  3STB C;  1N32 Q;  4GLX A;  2PI2 E;  4JBM A;  4IOC A;  2XTI A;  3T1H Q;  2CFM A;  2ALY B;  5IP9 H;  4A3K H;  3OYY A;  2F3I A;  4UP7 A;  5ELO A;  4DK6 C;  5C44 H;  3CME A;  4QJF A;  3CCQ A;  4LF8 Q;  3RLN A;  3J81 j;  1RL2 A;  2KCT A;  4JI7 Q;  2NVT H;  3PF5 A;  1L0W A;  4GKJ L;  4OX9 Q;  4DV6 L;  1XPO A;  1G51 A;  4LF4 Q;  4L5R C;  1T9H A;  3L0O A;  2R93 H;  4YCU A;  4X6A H;  1VQF A;  2UXC L;  2YTX A;  4R4O A;  1EQR A;  1HNX L;  2HHH Q;  2JQO A;  3PUV A;  3RLO A;  3HOW H;  1RIP A;  1X3E A;  4J15 A;  4YWL A;  5BR8 L;  1KIX A;  3S1M H;  1PVO A;  3NEM A;  4O2D A;  1X3F A;  4IFD J;  2NN6 G;  4LNQ A;  2VQE L;  3I4N G;  3F2B A;  4OWT B;  3CC4 A;  4JI0 L;  1EUJ A;  1GO3 E;  1HZC A;  4HIK A;  1PHJ A;  2KHJ A;  2MO0 A;  1IBM L;  2DUD A;  3FKI G;  1P16 A;  2B29 A;  3HOX H;  4R4T A;  4JI2 L;  3F2C A;  1N34 L;  3ULL A;  5M3M H;  2Y0S E;  3HOZ G;  1QVF A;  4DR4 Q;  1VQI A;  2JA5 G;  2QEX A;  2UXD L;  4TVA B;  1C9O A;  4RG1 A;  1WCM H;  4P73 A;  1FL0 A;  3AEV A;  1BBU A;  1NMG A;  2AWO A;  4JI1 Q;  1I5F A;  1FJG Q;  4C3J H;  5M3F G;  5IYB H;  1HNW L;  2NZH A;  4B3R L;  1R9T H;  2Z6K C;  5H1S E;  2VS1 A;  1K8G A;  3CCJ A;  3A0J A;  4IJL A;  1EFW A;  2ZM6 L;  1K83 H;  2EQS A;  4GNX C;  3W1B A;  3KDF B;  1CKN B;  2LXK A;  1E7Z A;  3SGI A;  1Y1W H;  3M4Q A;  3HOY H;  4QQB X;  4FDB A;  3HOU G;  3IRB A;  5M5Y H;  1HZA A;  5IYC G;  2AKW B;  2HIX A;  4DV5 L;  3M7N A;  4JV5 L;  1PH3 A;  1PA6 A;  1KRT A;  4Y7N H;  2K5H A;  4A3C G;  4YY3 L;  1SMX A;  2N3S A;  4LUZ A;  4AIM A;  4X64 Q;  1YHB A;  4X65 Q;  3CCM A;  4OWW B;  2VNU D;  2E5L L;  2KCM A;  3M3Y H;  1IYJ B;  1GKH A;  4DR1 Q;  4ALP A;  4JCV E;  1PYS B;  3UE0 A;  2VY3 A;  1NY4 A;  1TXY A;  2NZO A;  3H3V H;  2AMC B;  3CAM A;  3D0F A;  3FHW A;  3G71 A;  4LF7 L;  1Q8K A;  3S15 H;  2D62 A;  1AE2 A;  3PO2 H;  3CCE A;  2N8N A;  1VQ6 A;  3Q8D A;  2NVQ H;  5LMU L;  3U50 C;  1VQ4 A;  2RCN A;  2PQA B; 
#chains in the Genus database with same CATH topology
 4FXK C;  1V1P A;  2WFW A;  4I65 A;  2F0D A;  2UUB L;  3JAM L;  3I7F A;  2FJ2 A;  1OXS C;  3ONA B;  1SND A;  3I4N B;  3H6M A;  1EQT A;  1OXT A;  4DK3 C;  2PW5 A;  4FF3 A;  3FKI B;  3F8T A;  3F1Z A;  1ESF A;  4K2K A;  4CDD C;  2JA5 B;  2A69 C;  3EQL C;  1RTO A;  5DNF A;  3EIV A;  4ZKB B;  4HIO A;  1EFI D;  4JI7 L;  1TWF H;  1DJR D;  1N9W A;  4OX9 L;  1WTX A;  1D1K A;  2IJ0 A;  3PF4 A;  3U58 A;  4JK1 C;  3STB D;  3K80 C;  4LJZ C;  1DD2 A;  4QMG A;  3T51 B;  4LK1 C;  2A1A A;  1LT6 D;  2VUM H;  2MO1 A;  1YNX A;  1MSH A;  3M85 A;  4S3S A;  2E76 C;  3TRE A;  1TWH B;  2V1C C;  4N8F A;  2GN5 A;  4OO1 H;  3S14 B;  4Z9C B;  1BXT A;  1VQK A;  2B2T C;  4A3D G;  2DY7 A;  4B3M Q;  3MXN A;  1YZ6 A;  1Q1B A;  3P20 A;  3J7A V;  1SNC A;  1B3A A;  4NB3 A;  3K81 C;  1LTG D;  1Q46 A;  1NSN S;  3S17 H;  5HGQ A;  1WI5 A;  1L1O A;  1G91 A;  2K5Q A;  1S72 A;  1I3Q H;  3CXC A;  1QB5 D;  4LFA Q;  1ZYR D;  1I6H H;  1K28 A;  2EXD A;  2O2L D;  4DR1 L;  1YNJ D;  2HQE A;  1FGU A;  1MD2 D;  2IY5 B;  1V1Q A;  2PZU A;  1EY6 A;  1ML0 D;  3IFD A;  4J6H A;  5C3E G;  4A93 B;  1LTT D;  2AQ3 B;  1X3G A;  5F2D A;  3HRZ C;  4A3B B;  4B3S Q;  2R6G A;  5IYC H;  5FLM H;  2VW9 A;  3LWU A;  2JEB I;  1F77 A;  3TME A;  4A76 A;  1MHW C;  4DUY Q;  1AZP A;  1X55 A;  3ZJY C;  1PH1 A;  4CHT B;  1B53 A;  1HH2 P;  2E2J H;  4UPA A;  3NUC A;  4A3E B;  3ERS X;  2F4V L;  4XYQ A;  2PMZ B;  4IPD A;  4WFN 3;  2XNA C;  4NMZ A;  3T56 B;  5L37 A;  5IGC A;  5M3M G;  3PO3 H;  2L5T A;  1X54 A;  4LWC A;  4DAV A;  3RZO B;  2ZTD A;  2V4D A;  1TWG B;  4LF6 Q;  2O5J C;  1HUN A;  3BS1 A;  3BU2 A;  5IYB G;  1PZI D;  3OTO Q;  4UP9 A;  1H95 A;  3J80 c;  3A5Z B;  1L2F A;  1L0Y B;  3GTL B;  2F0P A;  4M1U B;  4PZ7 A;  2JJQ A;  2C5C A;  2SEB D;  4ZUJ A;  1HR0 L;  3LGJ A;  3U4Z A;  1HJP A;  4EVO A;  3M4O H;  4QUF A;  3ULP A;  4V0B A;  3A7L A;  4L5S A;  1KLG D;  4DV4 L;  1EYD A;  5GAD C;  2I0Q A;  3BVG A;  5K36 H;  1HR0 W;  3VR2 A;  1G6Z A;  2E8G A;  1ASZ A;  3CQZ B;  4IUR A;  4RH6 A;  2GA4 B;  1JOK A;  2M2L A;  1LUZ A;  3K7U C;  4U68 A;  4BWG B;  4UP8 A;  1ENA A;  2Z1C A;  5DAU A;  5C4X G;  3FDT A;  3VYS A;  4Y52 H;  2F0J A;  4NDX A;  2I5L X;  4ME5 A;  2Z9H A;  2E2I H;  2MNA A;  1Y1V H;  2PO4 A;  4KD4 A;  1LT4 D;  4QIW B;  1S40 A;  1STE A;  3GTO H;  3NK9 A;  4EGV A;  1EIF A;  3EBE A;  3G6E A;  5LMN Q;  2EYO A;  1X32 A;  1ZEQ X;  2PPB C;  4X3S A;  1E0B A;  4ODG A;  3VA5 A;  1N8R C;  5FKA C;  3R93 A;  2KUM A;  1VQO A;  4LF5 Q;  5I2Y A;  4KI0 A;  1K3R A;  5EBD A;  5JOB A;  1BO0 A;  1K0R A;  1TKW B;  1V8Q A;  4NXM Q;  4O0A A;  1JB3 A;  1LM0 A;  1PRT C;  5I9O A;  1TY2 A;  4Y7N B;  4HCS A;  3GTG H;  1S3O A;  4WJ3 M;  3I73 A;  3HOZ H;  1J9O A;  1CSQ A;  4PZ6 A;  3O13 A;  5ELC A;  1BBW A;  4LFC Q;  1HNZ L;  4GOP B;  4DR7 Q;  1VQA A;  3QOL A;  2MFI A;  2PW7 A;  1X3P A;  1VQ7 A;  2RQX A;  2M00 A;  1XMO Q;  3HOU H;  4RHS A;  4AQY Q;  3CRK C;  2L9H A;  2K03 A;  1Y8N B;  3KF6 A;  1JWS D;  4HID A;  4DR2 L;  1U9R A;  4DV0 Q;  4F7X A;  1CKN A;  1QNU A;  4CJ0 B;  1SYE A;  4RCO A;  5BN3 A;  1B50 A;  1NBW A;  2FHT A;  1RDP D;  1KD1 C;  2F0S A;  1MSG A;  1UEA B;  2CQO A;  4A3D B;  3OOC A;  3NBH B;  5IP7 G;  4BBS G;  3KFU A;  1VQN A;  4IOA A;  2MJ8 A;  3W5O A;  4DNT B;  1GUS A;  3D4W A;  2FMC A;  2JA9 A;  4GS3 A;  4A3F H;  1Y8O B;  3S16 B;  2MQH A;  5DEH A;  1Q81 C;  4GKJ Q;  1JR0 D;  1SBB B;  4A3I G;  4J8Q A;  4IUQ A;  1IYU A;  1SNQ A;  4KHZ A;  2B63 H;  1Y69 U;  1S5E D;  4LW1 A;  2VQE Q;  3JAM i;  3H3V I;  2UXB L;  1IBM Q;  1Z47 A;  5C3E B;  1II3 A;  1S5C D;  5G3L D;  2BH8 A;  3N6R A;  2UXD Q;  3OMC A;  4P75 A;  4CBV A;  5C0X J;  3CCU A;  2HIV A;  1F9S A;  2D9U A;  1M1K C;  4NXN L;  3HKS A;  3VR6 A;  1QJO A;  4ZQ3 A;  1IBL L;  2Q2I A;  5IYD G;  1C4Q A;  3KK7 A;  2ZM6 Q;  2K4K A;  2R7D A;  1UWV A;  3J7A 5;  5I4D A;  3M9B A;  4LMQ D;  1B70 B;  1I3Q B;  5FLX L;  3S1M B;  4DV3 L;  3H0G H;  2WAQ G;  2SOB A;  1JJ2 A;  1LTR D;  1FNU A;  4XXE A;  1C8C A;  5CV4 A;  1M4V A;  2B2V C;  1H9K A;  3ND8 A;  2RHS B;  1WYD A;  3RR5 A;  2KED A;  4LF7 Q;  4A3G H;  3L2P A;  1RF2 D;  3GV6 A;  3W1G A;  1D5Z C;  1M8A A;  2R92 H;  3CHB D;  2F0Q A;  4GLA C;  1VQP A;  2K01 A;  3MZ5 A;  2JA6 H;  5I2X A;  2N88 A;  2EYP A;  4PV1 C;  2R61 A;  4DV7 Q;  4BY7 G;  4XYO A;  1I4X A;  3FPU B;  2GVA A;  1F9P A;  4F8M A;  3D31 A;  1J5E Q;  5BN5 A;  3PUY A;  3FRP B;  5T1G A;  5COR A;  2XTI A;  1ENC A;  4A3K H;  4TSS A;  4KKS A;  1GUT A;  3CME A;  2K04 A;  3TP8 A;  1L0W A;  2NVQ B;  2JP1 A;  2R93 H;  1O78 A;  4X6A H;  2UXC L;  5M5W B;  4HTH A;  1HNX L;  2HHH Q;  2JQO A;  5FLX E;  1KIX A;  1PVO A;  5BR8 L;  5ISR A;  4N9P A;  1PZJ D;  4O2D A;  1X3F A;  4HN7 A;  1SSO A;  2G9H D;  4IFD J;  2NN6 G;  4DA2 A;  1VF7 A;  2KEE A;  2EXZ A;  4H44 C;  1K8M A;  5KGU A;  3F2B A;  3CC4 A;  3I4N G;  1BDO A;  1EUJ A;  1HZC A;  4HIK A;  4EQN A;  3FKI G;  1I4P A;  3HOX H;  4JI2 L;  3QJY A;  4R4T A;  1JOR A;  1N34 L;  1BCP B;  3ULL A;  4DR4 Q;  2Y0S E;  2JA5 G;  1PTO B;  2QEX A;  2RDH A;  3OWF A;  4TVA B;  1J8I A;  4RG1 A;  1WCM H;  1SE3 A;  2EPB A;  4C1N K;  1ILP A;  5A2Q E;  2NYZ D;  3R3O A;  1PLF A;  4OEM B;  4CGY B;  1I5F A;  3DHQ A;  1K8O A;  2A74 C;  2RSO A;  1H9M A;  4IJL A;  4IQZ A;  2LS0 1;  2XRQ D;  4K14 A;  4QQB X;  1KDB A;  4DV5 L;  2AKW B;  4C2M B;  3M7N A;  1EQV A;  1PA6 A;  3T53 B;  2K5H A;  4YY3 L;  1EYA A;  1Y1V B;  3TZD A;  4G7H C;  1FYC A;  3S1Q B;  2VNU D;  2E5L L;  3NBI A;  2KCM A;  1IYJ B;  4YIJ A;  2OT2 A;  3GTO B;  1VDZ A;  3GTM B;  3BZD B;  2VY3 A;  3IAY A;  2B2T A;  2Q8I B;  2D62 A;  4K5V A;  2N8N A;  4IUN A;  4U67 3;  3C1F A;  2CWA A;  3OW2 A;  3K0X A;  2J0T D;  2G9D A;  1VS0 A;  1PH5 A;  1SYC A;  4JI8 L;  3ULJ A;  2JA8 G;  2PQE A;  1JT8 A;  3VYU A;  1SFO H;  1X3Q A;  3MXP A;  3MVV A;  1VQG A;  2R7Z G;  3U9S A;  4IPG A;  1G29 1;  2UUA Q;  1XMQ L;  4NKL A;  4B9W A;  5E7N A;  4BBS B;  3T1H L;  4AYB G;  1QUQ A;  4R8I A;  3KOJ A;  3GDE A;  4LF8 L;  1B8A A;  1G6P A;  4EQP A;  1U5K A;  1XNQ Q;  1CA5 A;  4TQU S;  4A3J H;  1HPC A;  2EYL A;  4DAM A;  5FOB B;  3GTP B;  1RKN A;  1TII D;  4P72 A;  2Z0S A;  1HQM C;  4BA1 I;  1KQS A;  2RDG A;  4A3I B;  1CQF A;  2KJX A;  3I70 A;  1BBX C;  1JE4 A;  1QVG A;  4R4I A;  4K0K Q;  1Z9F A;  3RLF A;  4FP5 D;  1U4R A;  2KBN A;  2K1B A;  3X3M A;  3UDF A;  3CP0 A;  2J4X A;  2K14 A;  1YJW A;  4A3E G;  3KLW A;  2H1E A;  3BDL A;  4A3L H;  4FNF A;  1SYD A;  1SMY C;  1QWY A;  2ICE C;  1KL9 A;  4JI4 Q;  2Q2H A;  4RWS C;  1ONL A;  1Q1E A;  3K5M A;  1KDC A;  2NN6 I;  1KRS A;  1IL2 A;  3JAM c;  1EU3 A;  2DNE A;  2FFK B;  4X66 L;  1XJV A;  3PV0 A;  1YHA A;  5BN4 A;  3DLL A;  2B63 B;  2VL6 A;  3K7A H;  5CV9 A;  2WAQ B;  3FVQ A;  1NUC A;  4X64 L;  3VYT A;  2WKD A;  1V1O A;  2RBM A;  3M4P A;  5LL6 X;  4CJ1 B;  2CWP A;  3A55 A;  3K8A A;  5C4J H;  2LSS A;  1T5X D;  1Q82 C;  1TY0 A;  4JI3 Q;  2D0O A;  3WOF A;  1EWH A;  1GD7 A;  3NEL A;  4DXG A;  1XWE A;  1STG A;  3E0E A;  1IW7 D;  1I4R A;  3I4O A;  1LYL A;  4L5Q A;  5JEA G;  4EQO A;  4LFB L;  1PDQ A;  2F4I A;  2A8V A;  1BOS A;  4HSV A;  1EIY B;  1WD1 A;  1VQL A;  2VQF Q;  5IT9 E;  2K5N A;  1G8Z D;  3HOW G;  3KDF A;  3H0G B;  2IX1 A;  1AN8 A;  4R9W A;  1K9M C;  1EYG A;  3VR3 A;  1FNV A;  2VZA A;  5M5X H;  1X6O A;  3H94 A;  3KLS X;  1BUV T;  4DV1 Q;  1PMR A;  5AJ3 Q;  1FNW A;  2KEN A;  3Q22 A;  3S1N H;  5C3W A;  4G7Z C;  1E1T A;  2HCI A;  1BKB A;  4YCV A;  2AUJ D;  5JPN C;  4POG A;  5IGD A;  4GN4 B;  3H3V C;  4FF1 A;  1NNX A;  3GO5 A;  3P75 A;  5TSS A;  1CT1 D;  1SNO A;  1EIG A;  1DXM A;  2UU9 Q;  2EDG A;  2MHV A;  2OQ0 A;  4QB4 A;  3LX0 A;  3I4M H;  2KOL A;  1Y1W G;  3AB9 A;  1EY5 A;  4L8J A;  2O5I C;  2UUC L;  1PH2 A;  2PZW A;  5FO7 B;  5ELB A;  4CDE C;  1U4L A;  2A68 D;  1VQM A;  3CC7 A;  2HCC A;  4POF A;  5JVG 3;  4B3M L;  1BCP C;  1BVS A;  3MC0 B;  1PTO C;  1O80 A;  4HED A;  3U4V A;  3GTJ B;  1XNR Q;  2JSO A;  3R8B A;  1AEX A;  1WTW A;  2R93 B;  1F2L A;  1DM0 B;  1PFB A;  4EQ5 A;  4LF4 L;  2ZJR A;  1QOH A;  3GTK H;  4RKL A;  1SYG A;  5IOC A;  3NHH A;  4NPS A;  3I56 A;  3TQY A;  1CHP D;  4DR3 Q;  4JV5 Q;  4PMC A;  4LFA L;  1CSP A;  1UE1 A;  1EY4 A;  4ZLT F;  1W6J A;  1AH9 A;  3SDZ A;  2FIN B;  1Q7Y C;  3CC2 A;  2K75 A;  2EYM A;  1A6X A;  2RHQ B;  4KTA A;  1QZG A;  1VQJ A;  2QIL A;  4B3S L;  1E3P A;  1K0S A;  1DOL A;  4JI1 L;  1E22 A;  2JE6 I;  3U9O A;  4GNX B;  5EKK A;  3B6Y A;  1V9P A;  1AP0 A;  3TDQ A;  2DN8 A;  4DUY L;  1VQ9 A;  1DGS A;  1JOO A;  1UNS A;  3OW7 A;  3AFP A;  3SK8 A;  3V2T A;  1MKH A;  3IFT A;  4OIJ A;  2JA8 B;  1T5E A;  2E2H H;  5CV5 A;  2IT1 A;  5J22 A;  2R7Z B;  4X62 Q;  4MTK A;  3T16 A;  4GKK Q;  3EN2 A;  1ROD A;  4ABN A;  2VUM G;  3R2I A;  4AYB B;  2HUG A;  3RD4 A;  1TWA B;  1SXT A;  2K05 A;  3HGB A;  4DR6 Q;  4IUV A;  3VDY A;  4OO1 G;  5M3F H;  3S1R B;  1E24 A;  3CRL C;  1L1O B;  1PRT F;  4RCN A;  1LAB A;  4LF6 L;  1GUO A;  1N33 Q;  3OTO L;  4HJ8 A;  1IBK Q;  2IX0 A;  4ULL A;  3CPW A;  1UE7 A;  1MGS A;  3QWN A;  1SFO B;  3J7A F;  1VQH A;  4HJ5 A;  5GAH C;  4QCL A;  1XTD A;  3BYT B;  2NUC A;  4OWX B;  3K0Y A;  1J6Q A;  2I5H A;  2YTV A;  2B2V A;  1HUM A;  3RUZ A;  2OEO A;  4DGZ A;  5CC4 A;  1KLU D;  1CQV A;  3MXG A;  4ZKC B;  4DV6 Q;  5FLM G;  3EFX D;  1QCB D;  1CKM A;  1KC8 C;  2BDN A;  3MFY A;  2NB0 A;  1IW7 C;  1PH7 A;  5JJL A;  4LUV A;  3KYH C;  2YU9 H;  1C0A A;  5LMN L;  2BOS A;  2MUY A;  2NVY H;  3GQB A;  1D1I A;  4BXX H;  3ICE A;  3BVZ A;  5D3I B;  1JMC A;  3BYY B;  3M7G A;  4DFA A;  1YBY A;  3PO3 G;  3F2D A;  4LF5 L;  1JOQ A;  1B1Z A;  4KY5 A;  5KEE A;  5LMN W;  1KTK A;  1SR3 A;  4NXM L;  3CPF A;  4PZ8 A;  3RN2 A;  3L9A X;  4BS9 A;  4DAP A;  3HOW B;  4DNI A;  3E9I A;  5KYL A;  3NP8 A;  4TKO B;  3BZK A;  4XT1 B;  3ND9 A;  3PMF A;  4ID6 A;  5HGT A;  4BY1 H;  1KNA A;  2B2W C;  1VQ8 A;  4FVM A;  5C4J B;  4LFC L;  2CH4 W;  5CGK A;  2JA7 H;  1DYQ A;  2K33 A;  4UY8 C;  4DR7 L;  2L11 A;  1A3V A;  1HFN A;  2HD3 A;  2TMP A;  2HDM A;  2CKZ B;  4KLK A;  5EKL A;  4A3M H;  4K2L A;  2IHE A;  2DGY A;  5JAV A;  1NAP A;  1PYB A;  1WVL A;  3MTS A;  5GQO A;  3RN5 A;  1LT5 D;  1WTH A;  5K36 G;  1XMO L;  4FYD A;  5CV6 A;  4IUU A;  1R9T B;  4AQY L;  1Q3L A;  2A68 C;  3D6W A;  3TP5 A;  1Y1W B;  1F9Q A;  4DV0 L;  3J81 i;  5M5Y B;  3SHL A;  3I55 A;  4OO1 I;  2WB1 E;  2E75 C;  4G57 A;  3K5O A;  3C3L A;  3M3Y B;  1Y1V G;  1N32 Q;  3STB C;  1TT2 A;  3S1N B;  1H9R A;  4CDC C;  2ALY B;  5IP9 H;  5EJW A;  5ELO A;  4DK6 C;  5C44 H;  1HHV A;  5I6Y A;  2NVT H;  2KCT A;  3DXJ C;  4GKJ L;  1A2T A;  1FR3 A;  1G51 A;  1PXU A;  1VQF A;  2K32 A;  2K5W A;  2YTX A;  1B2T A;  1EQR A;  2M9V A;  3SK5 A;  1FGB D;  1H9J A;  2SNM A;  5C0X H;  1S5B D;  3NEM A;  3KBX A;  2ENB A;  2VQE L;  3BG3 A;  2MPM A;  1IBM L;  1SNM A;  2X6G A;  5D3D A;  3F2C A;  3HOZ G;  1VQI A;  1AZQ A;  2UXD L;  2A6H D;  1C9O A;  2CW0 D;  4FO2 A;  1LLR D;  1JWM D;  2B2Y C;  5IIF A;  1NMG A;  2AWO A;  2N55 A;  5EKI A;  1FJG Q;  1TWF B;  4C3J H;  3V05 A;  2NZH A;  4B3R L;  1ZYR C;  2Z6K C;  1IHZ A;  2VS1 A;  5H1S E;  2ZM6 L;  1K83 H;  2EQS A;  2Z8L A;  2KQ3 A;  4GNX C;  1YNJ C;  2CQA A;  1CKN B;  2ZXO A;  3QIA A;  4DAY A;  1EY7 A;  2EE1 A;  3M4Q A;  3HOY H;  2DNC A;  3HOU G;  3IRB A;  1ET9 A;  2HIX A;  1PH3 A;  2L12 A;  1EIH A;  1O7Y A;  5E4X A;  4LUZ A;  4ZAI A;  4X65 Q;  2NZ1 D;  4OWW B;  2VUM B;  4DK0 A;  3A8K E;  2RSN A;  4JCV E;  5FO9 B;  1RTN A;  1NY4 A;  2F0O A;  2F3V A;  3D0F A;  4R8N A;  4LF7 L;  3S15 H;  1VF5 C;  5JVH 3;  3PO2 H;  2KHS A;  2A6E D;  1WTP A;  3J80 E;  1K8G A;  1VQ4 A;  3HKZ E;  2PQA B;  1L1O C;  1W3S A;  1R4P B;  4DV7 L;  3S17 B;  4JYA Q;  4A3F G;  1LTA D;  3HOV H;  2EJG C;  3HS0 C;  1F2M A;  3ERQ A;  3I91 A;  1A62 A;  1HXY D;  1MJC A;  4DR5 Q;  4JI5 Q;  3RZD H;  5IWA L;  2B63 G;  3D4R A;  4C3I H;  1FD7 D;  1PV4 A;  1I6H B;  3TS2 A;  2NVX H;  4IUT A;  2F0H A;  1I4H A;  1Q8I A;  1MJE A;  4OEL B;  2QA4 A;  3H15 A;  4G4K A;  4IFD H;  4L6T B;  5M3F B;  2IX3 A;  4LF9 Q;  1TWC H;  4YCW A;  2K6A A;  1D6E C;  2B2U C;  2LFN A;  4PNY A;  4CKB A;  4MIU A;  2F0N A;  5A35 A;  1O7Z A;  1UE5 A;  4QGU A;  2ZT9 C;  1STY A;  4OXP A;  1VMC A;  3K5L A;  2ZJP A;  5A2Q L;  2OWO A;  2HHH L;  3HEJ A;  3T1Y Q;  4ZUI A;  1TU2 B;  2F0F A;  3BJU A;  3NWS A;  4DPG A;  5D14 A;  3VYR A;  2AWN A;  1SLJ A;  1KAA A;  3KLR A;  4R1J A;  1I50 H;  5KIX A;  5CR3 A;  4B9X A;  1H9S B;  1B9N A;  1I94 L;  2E2J B;  2F1M A;  1HCZ A;  4DR4 L;  3H0G G;  4KV6 A;  1P8L A;  3KJP A;  5C5M A;  2PI2 A;  2K28 A;  1K73 C;  1NCV A;  3ZYY X;  1XPR A;  4GLV B;  4PMW A;  3CCR A;  4JI6 Q;  2X6L A;  2ZJQ A;  4OGQ C;  2F0K A;  4DUZ Q;  1WTV A;  4YWM A;  3A54 A;  3PO3 B;  2WV6 D;  1OXV A;  2PCF B;  1IXR A;  4OL7 A;  4I7A A;  4RGT A;  4A75 A;  1YJ9 A;  1JC7 A;  1HRJ A;  2NN6 H;  4AH6 A;  2R92 G;  4MZ9 A;  1QIL A;  2JA6 G;  4RKB A;  5FJ8 H;  1A8V A;  4B08 A;  2DJF C;  3HKZ G;  2YU9 B;  1YNN D;  3UDG A;  3S24 A;  4HJA A;  3M4O B;  4M8A A;  4KJN A;  3E3X A;  3TSS A;  1N36 Q;  2NVY B;  4KY7 A;  3UI2 A;  1B3Q A;  1U0L A;  3J7Z C;  4HMI A;  2E2D C;  4JPB W;  1SYB A;  4XTC S;  3HG9 A;  4RGM A;  1PH9 A;  4A3K G;  4JBJ A;  3D8G A;  3QG1 A;  3T13 A;  2KCC A;  4JBK A;  2RF4 A;  2XGT A;  2AHO B;  4CDF C;  2R93 G;  4J1M A;  4JBW A;  3TS0 A;  3DUZ A;  1HTL D;  3MEF A;  2VB3 X;  2JXM B;  1QZH A;  2WAC A;  4MNO A;  4BY1 B;  1ET6 A;  3KF8 A;  1TWH H;  2UUA L;  2XWB B;  2E2I B;  1EWI A;  4X3K A;  4GN3 B;  1GHJ A;  2YTY A;  4YHH Q;  2JA7 B;  1TS5 A;  5J3B A;  2N78 A;  3S14 H;  2KVM A;  3HOX G;  1XNQ L;  3DWP A;  3OMG A;  3ITP A;  3J81 c;  1WCM G;  2A69 D;  5CYU A;  2PMZ E;  4HJ9 A;  4R4C A;  4GOP C;  2OTL A;  1WJJ A;  3PUZ A;  4K0K L;  2D5D A;  1HNX Q;  1F2Y A;  1A0I A;  3KLS A;  5LL6 S;  3JC6 6;  1UAP A;  4KHP Q;  5E1F A;  5NUC A;  2ZTE A;  1VMP A;  4KHV A;  3CMA A;  3GTG B;  1X65 A;  1O7I A;  3HOZ B;  4ZK9 B;  3K58 A;  2RVL A;  5CV8 A;  1EOT A;  3P7J A;  1JB7 A;  5AFW A;  4A93 H;  3KJO A;  4FXG C;  4I7Z C;  1SJH D;  1Z7T A;  4KMU C;  5C44 B;  4A3B H;  1E2Z A;  4JI4 L;  1VQD A;  1SRU A;  4B3T Q;  1SYF A;  2EY5 A;  2EYF A;  3NQI A;  5ELE A;  5CBE E;  2X69 A;  2BA1 A;  3HOU B;  1NE3 A;  2KCN A;  1BCP F;  2Y0S G;  3QO2 A;  3E5S A;  1PTO F;  4ILW A;  1TR5 A;  3DM3 A;  4WOR A;  4BBR H;  1B9M A;  3DWQ A;  4JG2 A;  5IT9 L;  1K8A C;  3NTK A;  4JI3 L;  2EYH A;  1DOM A;  3DM1 A;  4PQX A;  2LMC B;  1I6V C;  4H7B A;  1A3T A;  5IOD A;  2FXQ A;  1JQY D;  2ZXP A;  4C3H H;  1CUK A;  4QIW E;  3RZO H;  4C3J B;  1G2S A;  1TWG H;  1DCZ A;  1OO9 B;  2L4N A;  2Z4H A;  4A3J G;  1TS2 A;  5EPJ A;  2Q2U A;  4A3F B;  4G7O C;  4FXD A;  1UEB A;  2VQF L;  3GTL H;  2A73 B;  4HJ7 A;  2F3W A;  1PH4 A;  3IL8 A;  2F03 A;  3FMC A;  4DV1 L;  2XRS D;  5AJ3 L;  1YIJ A;  3NQT A;  5K5P A;  2SDF A;  1A63 A;  3GTQ H;  1Y8P B;  5C4H A;  5C3X A;  3PO2 B;  4Q5V A;  4L5T A;  3S9W A;  1WOC A;  3CQZ H;  4A3L G;  1PFS A;  2BE5 D;  2QCP X;  3E9H A;  2QGQ A;  1LTI D;  2QW7 A;  4DV2 Q;  1QE6 A;  1HTP A;  2D0P A;  2UU9 L;  1CM9 A;  4K5W A;  1GUG A;  3HP3 A;  4CJ2 C;  3HOV B;  3S2H H;  2KHI A;  4A3C H;  1D8L A;  5ELF A;  3I2Z A;  1WTQ A;  4K6D A;  5GAG C;  3I90 A;  1BF4 A;  4JW0 A;  4EX5 A;  4RA8 A;  2B2W A;  2ES2 A;  5JJK A;  3A74 A;  3K57 A;  1C7Y A;  2VB2 X;  4O42 A;  3E6Z X;  2J7Z A;  2CCZ A;  2BCO A;  2ID0 A;  1XNR L;  4XT3 B;  4A3G B;  2B3G A;  3G48 A;  3FP9 A;  4PG3 A;  1XYI A;  1TS3 A;  1EQQ A;  4X66 Q;  2R92 B;  4DR3 L;  1SAP A;  3PSI A;  2JA6 B;  5IGB A;  4IUP A;  4UHV A;  4P2C B;  4OON A;  1TS4 A;  3DWA A;  2K52 A;  2R3Z A;  2H4O A;  3HKZ B;  1SDF A;  1Q90 A;  4JI0 Q;  5JEA J;  5KND A;  4KY6 A;  3H09 A;  4N8X 1;  3NTH A;  1V1P B;  2IPK D;  3IKJ A;  2BA0 A;  4P74 A;  4A3K B;  2OXP A;  3MAQ A;  1VQC A;  2QKI C;  3OIQ A;  1JJG A;  2I46 A;  5CBA E;  1CZG A;  1LV9 A;  3A8I E;  4JOI C;  4O1N A;  2XWJ B;  1PRT B;  2EJM A;  4LFB Q;  1HNW Q;  4KD3 A;  3NXW A;  1IKL A;  3UDX A;  4JVZ A;  1EZ8 A;  4XDX A;  5ELD A;  4X62 L;  5EAY A;  4GKK L;  1OXX K;  3I4M G;  1CKO A;  4A3D H;  4DNR B;  2F0E A;  1MIU A;  3CCS A;  4DR6 L;  2HQL A;  3BDO A;  3HOX B;  2LKV A;  3PQI A;  1PRT D;  3PIP A;  2F0G A;  4CKE A;  5IGF A;  1WCM B;  1Q86 C;  2SNS A;  1N33 L;  1STH A;  2B2Y A;  3S16 H;  1IBK L;  1GVP A;  1QVC A;  4NP5 A;  5LMU Q;  2YV5 A;  2Z6K A;  4IN3 A;  4GNX A;  5EGT A;  2UUB Q;  1PH8 A;  2WKC A;  4FF4 A;  2EY1 A;  2UUC Q;  4GZY C;  1CTM A;  3K6O A;  1EEF D;  1E1O A;  1SE4 A;  2CVR A;  2RCF A;  4ZRZ A;  3TZU A;  5EPL A;  5C3E H;  1OXU A;  3MXN B;  4RHR A;  1LTS D;  3MFG A;  5EPK A;  1SNP A;  2PI2 E;  4JBM A;  4IOC A;  1S5D D;  3OYY A;  4UP7 A;  3JAM E;  3CCQ A;  4QJF A;  4JI7 Q;  3PF5 A;  1TVX A;  4OX9 Q;  4DV6 L;  1XPO A;  4LF4 Q;  4F87 A;  4L5R C;  4XQN A;  3R2T A;  1CA6 A;  1ZKO A;  1EZ6 A;  4J15 A;  1X3E A;  3S1M H;  4YWL A;  2Y0S B;  1DOK A;  3DMU A;  5JPM C;  2EOT A;  3KBG A;  4HSP A;  4L63 B;  4OWT B;  2NBF A;  3PIO 3;  2MO0 A;  2DUD A;  1P16 A;  2WII B;  1QNK A;  5M3M H;  1QVF A;  1GJX A;  2K7V A;  4UDU C;  2F0L A;  1L0X B;  4QF4 A;  4P73 A;  3CKI B;  1MBY A;  3W2D A;  4KN4 C;  3AEV A;  2RKS A;  1GXD C;  4K8I A;  4JI1 Q;  2B2U A;  5M3F G;  2OF1 A;  1CK1 A;  5IYB H;  4A3J B;  1PZK D;  1WTR A;  1XTC D;  4HAE A;  2VXW A;  3A0J A;  5KRU A;  3CCJ A;  1EFW A;  2EVB A;  5LHY 1;  3F2U A;  2LXK A;  4KJO A;  3WOE A;  3T4A C;  5IYC G;  3DEO A;  4HMJ A;  1SMX A;  2N3S A;  3MA2 B;  4BBR B;  2BE5 C;  4C1N I;  4AIM A;  3CCM A;  1AFP A;  1JIC A;  1D2B A;  5CMD A;  4DR1 Q;  3FPP A;  1PYS B;  1ZXT A;  3UE0 A;  2XIW A;  1GUN A;  3H3V H;  1C48 A;  2AMC B;  3FHW A;  1ICW A;  3G71 A;  1Q8K A;  4C3H B;  1EY0 A;  1AE2 A;  1A2U A;  1VQ6 A;  3Q8D A;  2TSS A;  3E0J A;  2NVQ H;  3D3R A;  2RCN A;  2EJF C;  5GAE C;  1RHP A;  4H02 A;  3WWV A;  3V96 A;  3OWE B;  5M5W H;  2GVB A;  1WFQ A;  4XIG S;  3VA7 A;  5C4X H;  3DEP A;  1PYW D;  4N9T A;  2RA4 A;  3NEN A;  1DZ1 A;  4HCE A;  3A5U A;  2AUK A;  4PMB A;  3K7A B;  3MEH A;  5KNC A;  1D5M C;  5IGG A;  5HY6 A;  2L55 A;  1YHQ A;  1X9N A;  1N32 L;  1PTO H;  2F4V Q;  3GTQ B;  1PFM A;  1TQO A;  4X3U A;  1ILQ A;  4X3T A;  1ICF B;  3MWY W;  2KEC A;  1BQQ T;  4JC0 A;  3AU7 A;  4BXX G;  3D6C A;  3AQQ A;  2MP1 A;  4GN5 A;  4KN7 C;  3S2H B;  4C2M H;  3P1H A;  1HZB A;  3NPP A;  3S1Q H;  1QG7 A;  3I4L A;  4QL5 A;  3A56 A;  1HR0 Q;  2Z4I A;  3NE5 B;  5M5X B;  3L3O C;  1NJI C;  2QEJ C;  3GTM H;  4BY1 G;  2Q2T A;  2JA7 G;  1SEB D;  2JN4 A;  2WP8 J;  2I07 B;  5EQ0 A;  1KAB A;  1Q12 A;  1FJG L;  2N49 A;  1GOZ A;  4DV4 Q;  2NWG A;  1RD9 D;  1VQ5 A;  1A3U A;  4A3M G;  1STB A;  5EBC A;  1IZ6 A;  4E6I A;  3Q23 A;  1AE3 A;  2K5D A;  1VQB A;  4GOP A;  4ZCK A;  5J1Z A;  3TBI B;  1A15 A;  3C46 A;  4DK1 A;  3PUW A;  3J80 L;  1I4Q A;  3NWT A;  1GHK A;  1KXL A;  1ASY A;  1EL0 A;  3GD7 A;  3PIO A;  3Q24 A;  3I4M B;  4X65 L;  2QDB A;  4RAU C;  2Z6B A;  5DM6 3;  4APV A;  5FLX c;  2OCE A;  3WDN A;  3PUX A;  2IWH A;  5IP7 H;  2F0M A;  4BBS H;  1ESR A;  5KNB A;  1IL8 A;  1JE5 A;  2WAQ E;  4WRD A;  2OQK A;  5JJI A;  2I5M X;  1D7Q A;  2JYO A;  3BZC A;  1BR9 A;  3Q0A A;  2F0T A;  3GTP H;  1NTG A;  1B4O A;  1RCV D;  3MXU A;  5IP9 G;  2H5X A;  3PGZ A;  5KYI A;  4WJW A;  3KF6 B;  5C44 G;  4A3I H;  2JEA I;  3NBH A;  4JYA L;  5DM7 3;  1CZW A;  3GTK B;  3AMU A;  1ENF A;  4DR5 L;  4JI5 L;  5C0X G;  1W2B A;  4K6L A;  1VCI A;  2PNR C;  1PH6 A;  1UE6 A;  4DN4 M;  2PNH A;  3ERO A;  3OPO A;  4LF9 L;  1B7Y B;  1HNZ Q;  3SR1 A;  2A19 A;  4K5X A;  4H0L C;  2EIF A;  4DAY B;  5J39 A;  3CCL A;  2QF7 A;  4MTN A;  1E2V A;  1MI2 A;  5JJZ A;  5IYD H;  3T1Y L;  4OIK A;  3SK6 A;  2K50 A;  2B8F A;  4C3J G;  2WB1 G;  1EOV A;  2PQA A;  1HA6 A;  3W3A A;  4RFB A;  1XPU A;  3CD6 A;  2E2H B;  3HOY G;  1JJC B;  1KDA A;  4DR2 Q;  3FEW X;  2R7F A;  3G6J B;  4WJ4 A;  1YIT A;  2B8G A;  1J5E L;  2ASB A;  4JI6 L;  4KK7 A;  4QY7 A;  1B44 D;  4DUZ L;  1UUP A;  2ZTC A;  5E3F A;  4HR7 B;  4DU9 A;  4OHJ A;  4DF7 A;  4B3R Q;  4TRD A;  3AYH B;  3PO2 G;  1CHQ D;  2F0W A;  4BY7 H;  3CF5 A;  5DLQ E;  1SMY D;  3OHX C;  1F9R A;  3CCV A;  1NR2 A;  2XSC A;  3HOV G;  1Z6H A;  3C2P A;  1AW7 A;  4RMF A;  3S2D H;  1U4P A;  1N36 L;  5M3M B;  4C3I G;  1H9S A;  1BNZ A;  2UXB Q;  3SVM A;  2EYJ A;  3I72 A;  2O4X A;  3X3N A;  2L15 A;  5C6A A;  5G3L F;  4IFD G;  1F2Z A;  3A7A B;  2HDL A;  3CW2 C;  3MHB A;  1OTC A;  2HT1 A;  1G2T A;  4LUO A;  4NXN Q;  4IJH A;  5HUR A;  2ATW A;  1LTL A;  4A3G G;  2YYZ A;  1IBL Q;  4NW2 A;  3I4N H;  1STN A;  3H91 A;  1WD0 A;  2A5H A;  3UE1 A;  3RMH A;  3FKI H;  2NTT A;  2F0U A;  5IWA Q;  2E74 C;  2AQ1 B;  1SJE D;  2NTS A;  4A4I A;  4YHH L;  4DV3 Q;  4YWK A;  3D4D A;  2JA5 H;  1CFM A;  1IYV A;  4P71 A;  4ME3 A;  5CV7 A;  4XQJ A;  3GTJ H;  2BH2 A;  3N52 A;  4C56 C;  2EY6 A;  5IY0 A;  3KUP A;  4UAI A;  2XVS A;  2F0I A;  4AYB E;  1VQE A;  5C0X I;  1KNE A;  4IZ8 A;  5GRO A;  2MGS A;  4JOI A;  5C4X B;  1LO5 D;  2G5D A;  1LT3 D;  2F52 A;  3G7L A;  4KHP L;  2QDL A;  1SRO A;  3SE0 A;  5E4W C;  5ELN A;  3OSO A;  1I94 Q;  1HA5 A;  1K3B C;  5IT9 c;  5FJ8 G;  1V43 A;  2AQ2 B;  5M9O A;  1S5F D;  3BVM A;  3UDI A;  2JK8 A;  4DKA C;  3L7Z C;  1PFN A;  1YJN A;  1NMF A;  3EJI A;  4B3T L;  1HFG A;  3GV3 A;  4A3M B;  1DON A;  4IPH A;  3G4S A;  5IGE A;  1LTB D;  1W6K A;  2RDF A;  2C35 B;  2Q8T A;  3KF8 B;  3PCO B;  2EY2 A;  2XN9 C;  1KAW A;  2JA8 H;  3BDC A;  1BCP D;  3GP7 A;  2UXC Q;  5FO8 B;  1PTO D;  2DJG C;  3Q6S A;  5T1I A;  2A6H C;  3SK4 A;  4ZYS A;  1X56 A;  2R7Z H;  5BR8 Q;  2IL8 A;  2CW0 C;  4XQQ A;  4BA2 I;  5FK9 C;  2LXJ A;  2P5Z X;  5C5L A;  2K5V A;  1TWA H;  3VR5 A;  1YI2 A;  4JI2 Q;  4KKT A;  1N34 Q;  4IPC A;  3S1R H;  4CKC A;  4DXF A;  1M90 C;  1YVC A;  1FVI A;  3OIP A;  4KKU A;  3HFZ B;  1IKM A;  1EU4 A;  4K8J A;  5IE8 A;  4HIM A;  5COY A;  3EVQ A;  2NVT B;  2ICI A;  1RJT A;  2FMM A;  3AFQ A;  4FF2 A;  2F0V A;  3HZX A;  2PZT A;  2CHB D;  3RNU A;  4H13 C;  3QB3 A;  4F88 A;  1EEI D;  4DV5 Q;  5I6W A;  1Y14 B;  3TEH B;  1QUQ B;  2A6E C;  4YY3 Q;  4IFD I;  3ER0 A;  4A3E H;  4LAA A;  4QUC A;  1SE8 A;  2IHF A;  2E5L Q;  3K5N A;  1YEZ A;  3VR4 A;  3SXH A;  1E2W A;  1SN8 A;  4RGO S;  4IO9 A;  4R4Q A;  4V19 0;  4A93 G;  1EY9 A;  4DV2 L;  1GUW A;  4A3B G;  3NTI A;  3TN2 A;  1KHI A;  1HZ9 A;  2WB1 B;  1GM5 A;  3PIP 3;  1STA A;  2OTJ A;  1K83 B;  4MHE A;  1O7L A;  3TP7 A;  3HOY B;  4JI8 Q;  3QOJ A;  2ZXR A;  2KA7 A;  3TRZ A;  3C1E A;  3J80 i;  2C9O A;  4BBR G;  1XMQ Q;  1XX8 A;  4GLX A;  1EWC A;  3T1H Q;  2CFM A;  2CH4 A;  3J81 L;  1EY8 A;  2F3I A;  4LF8 Q;  3S15 B;  5JEA H;  3I3C A;  3RLN A;  3J81 j;  1RL2 A;  4C3H G;  1LAC A;  1T9H A;  2B39 A;  3L0O A;  1R4Q B;  4YCU A;  1WTO A;  4R4O A;  1SE2 A;  3J7Y W;  3CU7 A;  3HOW H;  3PUV A;  3RLO A;  3QR8 A;  1RIP A;  3M4Y A;  3LNN A;  1XXG A;  3URY A;  1U4M A;  3I8Z A;  3NSW A;  3A8J E;  2WIN B;  4LNQ A;  1CI3 M;  2DY8 A;  2Q8R E;  4JI0 L;  1GO3 E;  3RZD B;  1PHJ A;  2KHJ A;  1D5X C;  4Q0F A;  4C3I B;  2BDO A;  2B29 A;  2NVX B;  1HQR D;  5D65 A;  2IW3 A;  1FL0 A;  4MN3 A;  2L0C A;  1BBU A;  1TWC B;  1I4G A;  1HNW L;  1R9T H;  4BY7 B;  3W1B A;  3KDF B;  1E7Z A;  3SGI A;  1YNN C;  3LWE A;  1Y1W H;  5I9P A;  3K59 A;  4FDB A;  5M5Y H;  1HZA A;  4JV5 L;  1KRT A;  4Y7N H;  3SEB A;  2LY7 A;  4A3C G;  1S4Z A;  1I50 B;  4RGN A;  2L1B A;  4X64 Q;  1YHB A;  5C4Z A;  3TP6 A;  3M3Y H;  3S2D B;  1GKH A;  4ALP A;  2EZV A;  3J81 E;  1NR4 A;  1JWU D;  1TXY A;  2NZO A;  1JCK B;  3CAM A;  3EA6 A;  2PYK A;  1EYC A;  3CCE A;  4IAL A;  5LMU L;  3U50 C;  2D2C C; 
#chains in the Genus database with same CATH homology
 2CWA A;  2WFW A;  5GAE C;  3OW2 A;  1L1O C;  4H02 A;  3WWV A;  1W3S A;  2UUB L;  3K0X A;  2GVB A;  1WFQ A;  5M5W H;  4XIG S;  3I7F A;  4DV7 L;  5C4X H;  1VS0 A;  1PH5 A;  4JYA Q;  1OXS C;  4A3F G;  4JI8 L;  3HOV H;  3NEN A;  1OXT A;  3ULJ A;  4DK3 C;  3A5U A;  2JA8 G;  1A62 A;  1MJC A;  1JT8 A;  3F8T A;  4DR5 Q;  3F1Z A;  1SFO H;  4JI5 Q;  3RZD H;  5IWA L;  2B63 G;  1VQG A;  4C3I H;  2R7Z G;  4IPG A;  1G29 1;  1PV4 A;  2UUA Q;  5HY6 A;  1XMQ L;  1YHQ A;  1X9N A;  3TS2 A;  2NVX H;  1N32 L;  2F4V Q;  5E7N A;  3T1H L;  4AYB G;  2QA4 A;  1MJE A;  1QUQ A;  3H15 A;  3KOJ A;  3EIV A;  3GDE A;  4LF8 L;  1B8A A;  4LF9 Q;  1G6P A;  1TWC H;  1U5K A;  4YCW A;  4HIO A;  4JI7 L;  1XNQ Q;  1TWF H;  1N9W A;  4JC0 A;  4TQU S;  4A3J H;  4OX9 L;  1UE5 A;  4BXX G;  4DAM A;  4QGU A;  4OXP A;  4P72 A;  2Z0S A;  2ZJP A;  4BA1 I;  2OWO A;  3AQQ A;  1KQS A;  3PF4 A;  3U58 A;  2HHH L;  3STB D;  3T1Y Q;  3BJU A;  4GN5 A;  3K80 C;  4DPG A;  4C2M H;  2AWN A;  1QVG A;  4R4I A;  1SLJ A;  4K0K Q;  1HZB A;  1Z9F A;  4R1J A;  3RLF A;  1I50 H;  2A1A A;  3S1Q H;  2VUM H;  2MO1 A;  1YNX A;  2KBN A;  4QL5 A;  1I94 L;  3M85 A;  1HR0 Q;  4DR4 L;  3H0G G;  3TRE A;  1P8L A;  3UDF A;  3CP0 A;  3KJP A;  2V1C C;  2PI2 A;  2K14 A;  2GN5 A;  1K73 C;  1NJI C;  4BY1 G;  3GTM H;  2Q2T A;  1XPR A;  4GLV B;  4PMW A;  3CCR A;  4A3E G;  1YJW A;  1VQK A;  2ZJQ A;  3KLW A;  4JI6 Q;  2JA7 G;  4A3D G;  2WP8 J;  4A3L H;  4B3M Q;  1Q12 A;  4DUZ Q;  1FJG L;  2N49 A;  4DV4 Q;  1YZ6 A;  1Q1B A;  4YWM A;  1VQ5 A;  1OXV A;  1KL9 A;  4A3M G;  4NB3 A;  4JI4 Q;  1IXR A;  2Q2H A;  1IZ6 A;  1AE3 A;  3K81 C;  1Q1E A;  1VQB A;  1Q46 A;  2NN6 I;  4A75 A;  1KRS A;  4GOP A;  3S17 H;  5HGQ A;  1YJ9 A;  1IL2 A;  1WI5 A;  3JAM c;  3PUW A;  4X66 L;  1XJV A;  4AH6 A;  3PV0 A;  1L1O A;  1YHA A;  1ASY A;  4MZ9 A;  2R92 G;  1KXL A;  3DLL A;  1S72 A;  2VL6 A;  3K7A H;  3GD7 A;  3PIO A;  2JA6 G;  1I3Q H;  3CXC A;  4X64 L;  4X65 L;  4LFA Q;  5FJ8 H;  1I6H H;  1A8V A;  4APV A;  2EXD A;  3M4P A;  5FLX c;  4DR1 L;  2OCE A;  3PUX A;  1FGU A;  2CWP A;  3HKZ G;  3K8A A;  5IP7 H;  5C4J H;  3UDG A;  4BBS H;  3S24 A;  1V1Q A;  2LSS A;  4HJA A;  2IY5 B;  1Q82 C;  1N36 Q;  1JE5 A;  2WAQ E;  4JI3 Q;  2D0O A;  2OQK A;  5C3E G;  5JJI A;  2I5M X;  1GD7 A;  3NEL A;  1D7Q A;  3BZC A;  1U0L A;  3J7Z C;  3E0E A;  1X3G A;  4XTC S;  3GTP H;  1NTG A;  3I4O A;  1PH9 A;  4A3K G;  5IP9 G;  1LYL A;  2H5X A;  3PGZ A;  4B3S Q;  4JBJ A;  2R6G A;  4L5Q A;  5IYC H;  5FLM H;  3KF6 B;  5C44 G;  2VW9 A;  4A3I H;  5JEA G;  2JEB I;  2JEA I;  4A76 A;  4JBK A;  2RF4 A;  2XGT A;  2AHO B;  4JYA L;  4LFB L;  2A8V A;  4DUY Q;  2R93 G;  4JBW A;  3TS0 A;  1EIY B;  1VQL A;  1X55 A;  3ZJY C;  2VQF Q;  1PH1 A;  3MEF A;  2K5N A;  4DR5 L;  4JI5 L;  5C0X G;  3HOW G;  3KDF A;  1W2B A;  2IX1 A;  1HH2 P;  1K9M C;  2E2J H;  1QZH A;  4MNO A;  1VCI A;  4UPA A;  2UUA L;  1TWH H;  1PH6 A;  1UE6 A;  1EYG A;  2VZA A;  5M5X H;  1EWI A;  1X6O A;  3ERS X;  4GN3 B;  2YTY A;  2F4V L;  4YHH Q;  2PNH A;  5J3B A;  3S14 H;  2N78 A;  4DV1 Q;  5AJ3 Q;  4LF9 L;  1B7Y B;  4IPD A;  2KEN A;  3S1N H;  3HOX G;  1HNZ Q;  1XNQ L;  2A19 A;  5M3M G;  3PO3 H;  1E1T A;  4YCV A;  1BKB A;  2EIF A;  4DAY B;  4POG A;  3CCL A;  1X54 A;  1WCM G;  3J81 c;  4LWC A;  4GN4 B;  4MTN A;  2PMZ E;  4HJ9 A;  5IYD H;  2ZTD A;  4R4C A;  4GOP C;  3T1Y L;  2OTL A;  4LF6 Q;  1WJJ A;  2K50 A;  3GO5 A;  3PUZ A;  3BU2 A;  5IYB G;  3OTO Q;  4K0K L;  2WB1 G;  4UP9 A;  1HNX Q;  1H95 A;  2UU9 Q;  2OQ0 A;  1EOV A;  2PQA A;  3J80 c;  3A5Z B;  1A0I A;  1L2F A;  3JC6 6;  1XPU A;  3I4M H;  4PZ7 A;  1Y1W G;  2JJQ A;  3CD6 A;  4KHP Q;  3HOY G;  1JJC B;  1HR0 L;  2UUC L;  3LGJ A;  3U4Z A;  4DR2 Q;  1HJP A;  2ZTE A;  2R7F A;  1PH2 A;  3CMA A;  4WJ4 A;  1YIT A;  1X65 A;  1J5E L;  1O7I A;  3M4O H;  2ASB A;  3ULP A;  4JI6 L;  4QY7 A;  1VQM A;  3CC7 A;  4POF A;  1JB7 A;  4B3M L;  4L5S A;  3KJO A;  4DUZ L;  4A93 H;  4DV4 L;  2ZTC A;  1BVS A;  5GAD C;  2I0Q A;  1HR0 W;  4A3B H;  4JI4 L;  3U4V A;  1VQD A;  1SRU A;  1XNR Q;  4B3T Q;  4B3R Q;  2E8G A;  3AYH B;  1ASZ A;  4EQ5 A;  3PO2 G;  4LF4 L;  2ZJR A;  3GTK H;  1LUZ A;  3K7U C;  4BY7 H;  4UP8 A;  2BA1 A;  3CF5 A;  4NPS A;  5DLQ E;  3I56 A;  1NE3 A;  3TQY A;  4DR3 Q;  4JV5 Q;  4LFA L;  5C4X G;  1CSP A;  2Y0S G;  1UE1 A;  4Y52 H;  3CCV A;  3HOV G;  2I5L X;  3DM3 A;  2E2I H;  2MNA A;  1Y1V H;  4BBR H;  1AH9 A;  4JG2 A;  4RMF A;  1Q7Y C;  3CC2 A;  1S40 A;  3S2D H;  3HKZ E;  1N36 L;  1K8A C;  3GTO H;  4JI3 L;  2K75 A;  1EIF A;  3EBE A;  2UXB Q;  3G6E A;  5LMN Q;  2RHQ B;  1QZG A;  2FXQ A;  1VQJ A;  2L15 A;  4B3S L;  1E3P A;  4C3H H;  4IFD G;  1CUK A;  4QIW E;  3RZO H;  4JI1 L;  1E22 A;  2JE6 I;  4GNX B;  1TWG H;  1N8R C;  3B6Y A;  3CW2 C;  1V9P A;  1OTC A;  2HT1 A;  4A3J G;  4DUY L;  4LUO A;  1VQ9 A;  4NXN Q;  1VQO A;  4IJH A;  1DGS A;  2Q2U A;  4LF5 Q;  2ATW A;  1LTL A;  1K3R A;  1UEB A;  4KI0 A;  4A3G G;  3AFP A;  2YYZ A;  2VQF L;  3GTL H;  1IBL Q;  1K0R A;  1MKH A;  2E2H H;  4NXM Q;  3I4N H;  2IT1 A;  4O0A A;  1LM0 A;  4HJ7 A;  3UE1 A;  3FKI H;  3GTG H;  5IWA Q;  1S3O A;  4A4I A;  4X62 Q;  4DV3 Q;  1PH4 A;  4YHH L;  3HOZ H;  4GKK Q;  4YWK A;  4WJ3 M;  4DV1 L;  1CSQ A;  2JA5 H;  3EN2 A;  4PZ6 A;  5AJ3 L;  1YIJ A;  2VUM G;  4P71 A;  1BBW A;  4LFC Q;  1HNZ L;  1A63 A;  3GTQ H;  4DR6 Q;  4ME3 A;  4GOP B;  4DR7 Q;  3VDY A;  4OO1 G;  1VQA A;  5M3F H;  3GTJ H;  2BH2 A;  2MFI A;  1E24 A;  1L1O B;  4L5T A;  1VQ7 A;  5IY0 A;  1WOC A;  3CQZ H;  4A3L G;  1PFS A;  4LF6 L;  4AYB E;  3E9H A;  1VQE A;  2QGQ A;  5C0X I;  1N33 Q;  4DV2 Q;  3OTO L;  4HJ8 A;  2D0P A;  5GRO A;  2UU9 L;  1XMO Q;  3HOU H;  1IBK Q;  4JOI A;  2IX0 A;  3CPW A;  4AQY Q;  1UE7 A;  3S2H H;  2F52 A;  2KHI A;  4A3C H;  3KF6 A;  4KHP L;  1D8L A;  4HID A;  3I2Z A;  1SRO A;  4DR2 L;  5GAG C;  4DV0 Q;  5ELN A;  4EX5 A;  1I94 Q;  1CKN A;  1VQH A;  1NBW A;  5IT9 c;  5FJ8 G;  4HJ5 A;  2ES2 A;  5JJK A;  5GAH C;  3A74 A;  1V43 A;  1XTD A;  1KD1 C;  1C7Y A;  2CQO A;  3UDI A;  2JK8 A;  4DKA C;  3L7Z C;  3NBH B;  5IP7 G;  4BBS G;  4OWX B;  2CCZ A;  1J6Q A;  1NMF A;  2I5H A;  1YJN A;  3KFU A;  2ID0 A;  2YTV A;  4B3T L;  1VQN A;  1XNR L;  4IOA A;  4IPH A;  3W5O A;  3G4S A;  2B3G A;  2JA9 A;  3G48 A;  3FP9 A;  4GS3 A;  4A3F H;  2MQH A;  4GKJ Q;  1Q81 C;  2C35 B;  4PG3 A;  4DV6 Q;  1EQQ A;  4X66 Q;  3KF8 B;  3PCO B;  5FLM G;  1KAW A;  4DR3 L;  2JA8 H;  4A3I G;  3PSI A;  2UXC Q;  1CKM A;  1KC8 C;  2B63 H;  4KHZ A;  1X56 A;  2R7Z H;  4OON A;  5BR8 Q;  2K52 A;  1PH7 A;  5JJL A;  4LW1 A;  4LUV A;  2VQE Q;  3JAM i;  4BA2 I;  3H3V I;  4JI0 Q;  2UXB L;  2LXJ A;  5JEA J;  3KYH C;  2K5V A;  2YU9 H;  1TWA H;  5LMN L;  1C0A A;  1IBM Q;  1YI2 A;  1Z47 A;  4JI2 Q;  1N34 Q;  4IPC A;  3S1R H;  2NVY H;  4BXX H;  2BH8 A;  3ICE A;  1M90 C;  2UXD Q;  1YVC A;  1FVI A;  2BA0 A;  4P75 A;  4P74 A;  1JMC A;  5C0X J;  3HFZ B;  3CCU A;  5IE8 A;  1VQC A;  4HIM A;  1JJG A;  1YBY A;  2HIV A;  3PO3 G;  1M1K C;  4NXN L;  3F2D A;  4LF5 L;  3HKS A;  4JOI C;  5LMN W;  4LFB Q;  1HNW Q;  3AFQ A;  1IBL L;  2Q2I A;  5IYD G;  1SR3 A;  2ZM6 Q;  2K4K A;  3RNU A;  4NXM L;  3CPF A;  4PZ8 A;  3RN2 A;  2R7D A;  1UWV A;  3J7A 5;  3M9B A;  3UDX A;  4DNI A;  3E9I A;  1B70 B;  4X62 L;  3BZK A;  4DV3 L;  4DV5 Q;  5EAY A;  4GKK L;  3H0G H;  2WAQ G;  1OXX K;  1Y14 B;  3I4M G;  1JJ2 A;  3TEH B;  1QUQ B;  4BY1 H;  1CKO A;  4YY3 Q;  1VQ8 A;  4IFD I;  3ER0 A;  4A3E H;  4LFC L;  4A3D H;  1SE8 A;  2IHF A;  1MIU A;  3CCS A;  2JA7 H;  2E5L Q;  4DR6 L;  2HQL A;  4UY8 C;  4DR7 L;  1YEZ A;  2CKZ B;  4KLK A;  3PIP A;  4A3M H;  2RHS B;  1WYD A;  2IHE A;  1Q86 C;  2DGY A;  4A93 G;  1PYB A;  1SN8 A;  4IO9 A;  3RR5 A;  4R4Q A;  5GQO A;  4LF7 Q;  3L2P A;  4DV2 L;  3RN5 A;  1N33 L;  4A3G H;  5K36 G;  3S16 H;  3W1G A;  1XMO L;  4A3B G;  1KHI A;  1GVP A;  1QVC A;  5LMU Q;  1IBK L;  2R92 H;  2YV5 A;  1HZ9 A;  2Z6K A;  4GLA C;  4AQY L;  1VQP A;  1GM5 A;  2OTJ A;  4GNX A;  2UUB Q;  2JA6 H;  4DV7 Q;  4BY7 G;  1PH8 A;  4DV0 L;  4JI8 Q;  3J81 i;  2UUC Q;  3I55 A;  4OO1 I;  2WB1 E;  2GVA A;  3TRZ A;  3D31 A;  1J5E Q;  1E1O A;  5C3E H;  3J80 i;  1Y1V G;  1OXU A;  3MXN B;  4BBR G;  1XMQ Q;  3PUY A;  3STB C;  1N32 Q;  4GLX A;  2PI2 E;  4JBM A;  4IOC A;  2XTI A;  3T1H Q;  2CFM A;  2ALY B;  5IP9 H;  4A3K H;  3OYY A;  2F3I A;  4UP7 A;  5ELO A;  4DK6 C;  5C44 H;  3CME A;  4QJF A;  3CCQ A;  4LF8 Q;  3RLN A;  3J81 j;  1RL2 A;  2KCT A;  4JI7 Q;  2NVT H;  3PF5 A;  1L0W A;  4GKJ L;  4OX9 Q;  4DV6 L;  1XPO A;  1G51 A;  4LF4 Q;  4L5R C;  1T9H A;  3L0O A;  2R93 H;  4YCU A;  4X6A H;  1VQF A;  2UXC L;  2YTX A;  4R4O A;  1EQR A;  1HNX L;  2HHH Q;  2JQO A;  3PUV A;  3RLO A;  3HOW H;  1RIP A;  1X3E A;  4J15 A;  4YWL A;  5BR8 L;  1KIX A;  3S1M H;  1PVO A;  3NEM A;  4O2D A;  1X3F A;  4IFD J;  2NN6 G;  4LNQ A;  2VQE L;  3I4N G;  3F2B A;  4OWT B;  3CC4 A;  4JI0 L;  1EUJ A;  1GO3 E;  1HZC A;  4HIK A;  1PHJ A;  2KHJ A;  2MO0 A;  1IBM L;  2DUD A;  3FKI G;  1P16 A;  2B29 A;  3HOX H;  4R4T A;  4JI2 L;  3F2C A;  1N34 L;  3ULL A;  5M3M H;  2Y0S E;  3HOZ G;  1QVF A;  4DR4 Q;  1VQI A;  2JA5 G;  2QEX A;  2UXD L;  4TVA B;  1C9O A;  4RG1 A;  1WCM H;  4P73 A;  1FL0 A;  3AEV A;  1BBU A;  1NMG A;  2AWO A;  4JI1 Q;  1I5F A;  1FJG Q;  4C3J H;  5M3F G;  5IYB H;  1HNW L;  2NZH A;  4B3R L;  1R9T H;  2Z6K C;  5H1S E;  2VS1 A;  1K8G A;  3CCJ A;  3A0J A;  4IJL A;  1EFW A;  2ZM6 L;  1K83 H;  2EQS A;  4GNX C;  3W1B A;  3KDF B;  1CKN B;  2LXK A;  1E7Z A;  3SGI A;  1Y1W H;  3M4Q A;  3HOY H;  4QQB X;  4FDB A;  3HOU G;  3IRB A;  5M5Y H;  1HZA A;  5IYC G;  2AKW B;  2HIX A;  4DV5 L;  3M7N A;  4JV5 L;  1PH3 A;  1PA6 A;  1KRT A;  4Y7N H;  2K5H A;  4A3C G;  4YY3 L;  1SMX A;  2N3S A;  4LUZ A;  4AIM A;  4X64 Q;  1YHB A;  4X65 Q;  3CCM A;  4OWW B;  2VNU D;  2E5L L;  2KCM A;  3M3Y H;  1IYJ B;  1GKH A;  4DR1 Q;  4ALP A;  4JCV E;  1PYS B;  3UE0 A;  2VY3 A;  1NY4 A;  1TXY A;  2NZO A;  3H3V H;  2AMC B;  3CAM A;  3D0F A;  3FHW A;  3G71 A;  4LF7 L;  1Q8K A;  3S15 H;  2D62 A;  1AE2 A;  3PO2 H;  3CCE A;  2N8N A;  1VQ6 A;  3Q8D A;  2NVQ H;  5LMU L;  3U50 C;  1VQ4 A;  2RCN A;  2PQA B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...