1R9TH

Rna polymerase ii strand separated elongation complex, mismatched nucleotide
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
145
structure length
133
Chain Sequence
b'SNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLTRSWRPPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA strand
publication title Structural basis of transcription: nucleotide selection by rotation in the RNA polymerase II active center.
pubmed doi rcsb
molecule tags Transcription/dna-rna hybrid
total genus 15
structure length 133
sequence length 145
ec nomenclature
pdb deposition date 2003-10-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF03870 RNA_pol_Rpb8 RNA polymerase Rpb8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1r9tH00
2RHQB 4DR5Q 4UP7A 4LF8L 1BKBA 5IYDG 1Q1EA 5H1SE 5IYCG 2UXBQ 1I94L 3ZJYC 4UY8C 3CC7A 4YCWA 2B3GA 4R4IA 4JV5Q 4BXXH 2CWPA 3H3VI 3E9HA 2PNHA 5IP9G 3JAMi 5BR8Q 1NBWA 3W1GA 2R7ZH 2ASBA 2YYZA 4OWWB 4JI3L 1MIUA 1CKNA 1HR0Q 3FHWA 1YIJA 1C9OA 2A19A 4DR2L 3CCLA 3FP9A 3NBHB 1S72A 2JA7G 4DR3Q 3CCVA 1HZBA 1VQKA 1XNRL 1RIPA 5C3EH 3RN5A 1Y14B 3PGZA 4LW1A 2DUDA 2R93H 2LSSA 1VS0A 3BU2A 2NVQH 1YEZA 2YU9H 4IJLA 4NXNQ 3RLOA 4KHPQ 4L5RC 1EYGA 1LYLA 1G51A 4X64Q 3BJUA 1IBMQ 2IHEA 4BY1H 4GNXB 1KQSA 4LF9L 3GTLH 1QUQB 2VY3A 1E1OA 3OTOL 1VQBA 4JI4L 3TS2A 3S24A 3JAMc 4K0KQ 1TWHH 1VQFA 1O7IA 1OTCA 1E3PA 4JI6Q 3PO2G 1HZCA 2F3IA 2NZOA 1NMGA 1U0LA 3I4MG 3A74A 4OWTB 4A3IH 2JEAI 2ZTEA 5C0XI 1XMQQ 4KHZA 2EXDA 4A3CH 3UE0A 1EUJA 4A3JG 4LF5Q 1QVGA 3ICEA 1N34Q 4DNIA 1A0IA 4LUVA 4P74A 1S40A 4DR4Q 3TQYA 1QVFA 4LF8Q 2AWOA 5M5WH 1YHAA 5HY6A 1I94Q 2B29A 4BBSH 3S14H 3STBC 2CCZA 2I5MX 3M3YH 1XJVA 2N78A 4NPSA 4IFDJ 3AQQA 4OXPA 1KD1C 4DR7L 4DV5L 1IZ6A 4A3DG 4AYBE 1UEBA 1G291 5ELNA 3F2CA 2VQFL 4YWMA 1PH2A 4JI3Q 1HNWL 2FXQA 3CQZH 4DR2Q 3GTKH 3TS0A 2E2HH 5M3FG 1Q81C 1XNRQ 4A3FG 1M90C 1WYDA 4BBRH 4DK6C 3GTQH 1YZ6A 2HT1A 3G71A 3CPFA 1IYJB 1X3FA 1BVSA 1FL0A 1SMXA 1WCMH 2KCTA 3UDXA 3I4NH 4X65L 1NTGA 1XPOA 3J7A5 5FLXc 4LF9Q 1YBYA 4LUZA 4JI4Q 2JJQA 4GNXA 2HQLA 1SN8A 1QUQA 2ALYB 1E1TA 1MJEA 3I7FA 4XIGS 1IXRA 3TRZA 1C7YA 1YJNA 2UU9L 1J6QA 1VQ8A 3L0OA 1TXYA 3F1ZA 2K75A 1LTLA 3PIPA 4H02A 4LF7L 1K0RA 1GO3E 1FJGL 3PF4A 2YTXA 2GVAA 2K5HA 5GAEC 4DR1L 3KDFB 5E7NA 2B63H 3H0GG 4L5TA 1VQEA 2RHSB 1HZ9A 1CKMA 1GKHA 1UE7A 4PG3A 3HOXG 4A3EG 2JA9A 5LMUQ 1VQ9A 2K14A 1KRSA 2I5LX 2K5NA 3I2ZA 2JA8G 1PH1A 4DV5Q 1WJJA 4HJ9A 1EQQA 4PZ7A 4LNQA 4YY3Q 4DUYL 2JE6I 4DV1L 3M4QA 4R4QA 3HOZH 5M5XH 3W1BA 5JEAJ 1B70B 4YHHL 4A3LH 1D8LA 1VQHA 5C4XH 1Y1VG 5GQOA 2NVXH 1B7YB 1V1QA 4IFDG 1HNXL 4C3JH 4POFA 5C44H 3Q8DA 1MKHA 4AH6A 4A75A 1OXSC 4JI0L 5JJKA 3ULJA 3FKIG 4LF4L 3S16H 3GTOH 1P16A 3K0XA 3U4VA 5IP7H 3H3VH 3S1NH 4B3RL 4OO1G 1Y1WG 2MO1A 4JBMA 4LUOA 2UU9Q 4A3GH 2Z0SA 1YJ9A 4B3SL 4DV0Q 5IYBG 2RF4A 3K80C 4GLXA 1N8RC 4Y52H 3LGJA 4L5SA 2EIFA 4DK3C 4LF7Q 3KJOA 3GTJH 3F2BA 4A76A 3KOJA 1VQ4A 1L1OB 4QQBX 2IT1A 2WB1E 4DR1Q 2A8VA 3KF6B 4HJ7A 2VUMG 4DR6L 4A3BH 1I3QH 1T9HA 3M4PA 3T1YQ 5JJIA 3KDFA 3ULLA 3RN2A 1PH6A 2NVTH 1SLJA 2ZTDA 1Q46A 3K7AH 3UE1A 2ATWA 2NN6G 4TVAB 3U58A 1HNZL 1M1KC 4B3ML 1YHBA 2NZHA 1XNQL 3S2HH 4GKKL 3EBEA 2VQEL 4R4OA 4DUYQ 4DV1Q 1AE2A 1KC8C 4JG2A 1L1OC 1U5KA 1Q1BA 2WAQG 4PMWA 1IBLL 4OX9Q 5DLQE 1PH7A 4YHHQ 1R9TH 1J5EL 5IWAL 2JA5H 2BA1A 4MZ9A 2ES2A 3NEMA 3T1HQ 3CC2A 3HKSA 1JJCB 3RLNA 1HNXQ 3VDYA 3PO3H 2MQHA 2RCNA 3NELA 4JI0Q 4ME3A 2CWAA 4LF4Q 4LFCL 4DUZL 2YTVA 2VZAA 4YWKA 1X55A 3KF8B 5FJ8H 4OONA 4DV6L 1K8AC 3HOVH 4AQYL 2LXKA 3M7NA 4B3RQ 3K7UC 3KLWA 4A3MG 2UUBL 5EAYA 2DGYA 3J81i 4ALPA 4B3SQ 4A3KH 3BZKA 4KI0A 2AKWB 1X9NA 3S1QH 1JT8A 3HOYH 4A93H 1Z47A 4OWXB 5HGQA 5FLMG 3K81C 2QGQA 1L1OA 1XMOL 3PV0A 1X54A 1S3OA 4P75A 3KF6A 1Q12A 1YI2A 1UE1A 3CCEA 1VQ5A 4BXXG 1I5FA 1HNZQ 4B3MQ 2WP8J 3CMEA 2R7ZG 3J81c 1YHQA 4GKKQ 2Q2UA 2VQEQ 2IY5B 2EQSA 3TEHB 1JE5A 1K9MC 4PZ6A 2ID0A 1IBLQ 2Z6KC 4P73A 3D31A 4DPGA 2K50A 4GLVB 4HIMA 1K73C 3HOUH 3S17H 1N32L 5C3EG 1J5EQ 4IPDA 5IWAQ 5GAGC 5AJ3L 2R93G 2N8NA 1PHJA 3OTOQ 3GDEA 4JI7L 3HOWH 4BY1G 1WI5A 1OXTA 2XGTA 3UDIA 2OWOA 1C0AA 4LFCQ 1KIXA 4DUZQ 2I5HA 2CFMA 1PV4A 2WFWA 4DV3L 4DV6Q 3A0JA 1YNXA 2Q2IA 1NE3A 4GN3B 2UUBQ 5M3MH 3PF5A 4LF6L 4BY7H 1HH2P 1EOVA 2VL6A 3ERSX 2D62A 4NB3A 1K83H 2HIVA 1V43A 3RLFA 2KENA 3SGIA 1YJWA 2E2IH 2R92H 3E9IA 3I55A 3CXCA 4HIDA 4A3IG 3GTGH 1CSQA 4YWLA 1MJCA 1OXUA 4JC0A 4A3CG 2JA6H 2CKZB 2E2JH 2BA0A 5ELOA 3CCUA 3F8TA 2JEBI 1I6HH 2Z6KA 2OQ0A 1N33L 1VQGA 4AYBG 4DR7Q 4QIWE 4RG1A 4BBSG 4IFDI 5IYDH 5IYCH 4HJAA 4APVA 5LMNL 2VQFQ 1HNWQ 3PUWA 1BBUA 1UE6A 2C35B 4JI8L 3J81j 4QY7A 1LM0A 4JBJA 4JI5L 4IPHA 3D0FA 3CCSA 5IP9H 4OO1I 3PUVA 1A62A 5LMNW 2VW9A 4JV5L 2UXCL 2E8GA 3CAMA 2OQKA 1SFOH 3CCMA 4BBRG 1UWVA 2JA7H 1JMCA 2JK8A 4X65Q 1VQCA 1ASZA 2OTJA 4B3TL 3AYHB 1WCMG 4JOIC 4JI7Q 1VQAA 4Y7NH 3I4NG 4POGA 3AFPA 1GD7A 3HKZG 2ZJRA 4LFBL 3DM3A 1OXVA 4IJHA 1LUZA 2K4KA 1OXXK 2K52A 4HIKA 1JJ2A 5GADC 1XTDA 1AH9A 4IPCA 4JI1L 4DV3Q 1PH9A 4NXNL 3S1MH 2PMZE 2NN6I 4KHPL 3L7ZC 1IBML 1VQLA 3PO2H 1G6PA 1P8LA 1VQOA 1FJGQ 1PA6A 1RL2A 3GTMH 3RR5A 2QEXA 1WFQA 2ZTCA 2Y0SG 3I4MH 3M9BA 4R1JA 1JJGA 1FGUA 1L0WA 4X6AH 3CPWA 4DV2L 1IBKL 4WJ4A 3A5UA 3IRBA 4A3JH 1TWFH 2B63G 5C0XJ 1N33Q 1YITA 2PI2E 3BZCA 1SE8A 4IO9A 1NMFA 3EN2A 1VQ6A 3PIOA 3CF5A 4MTNA 4X66L 2KBNA 4JI8Q 4AIMA 3I56A 4JBKA 2H5XA 1X3GA 1KRTA 4JI5Q 1KL9A 3KJPA 4FDBA 1NY4A 4A3DH 2KHIA 1HJPA 3HOZG 2L15A 3J7ZC 3W5OA 2UXCQ 4WJ3M 1CKOA 2K5VA 4XTCS 1WOCA 2N49A 4LWCA 1XPRA 4A3LG 5M3FH 5C4XG 1VQPA 4A3FH 2GN5A 5JJLA 4HJ5A 1SROA 4DV7L 4GLAC 2ZJQA 1A63A 1PFSA 4B3TQ 4GS3A 4JBWA 2ZM6L 2GVBA 3AFQA 3PCOB 5IT9c 3H15A 4NXML 1E7ZA 3F2DA 1K8GA 5C44G 1JB7A 3PUXA 4LFBQ 3ULPA 3CCJA 5JEAG 3PUZA 3OW2A 2BH2A 4QJFA 3RZOH 1FVIA 5IP7G 4JI1Q 1EIFA 5IE8A 4EX5A 2UUCL 5GAHC 3CW2C 2I0QA 4QGUA 2WB1G 4A3GG 4O0AA 1Q82C 3CC4A 1KHIA 5J3BA 4GKJL 1X56A 2UUAL 3PUYA 2UXDL 1BBWA 1B8AA 1Q8KA 4DR6Q 4YCVA 4P71A 3KFUA 4C3HH 1TWGH 3J80i 3CCQA 4DV2Q 2IX0A 4DAMA 1IBKQ 1SRUA 1N36L 2A1AA 4A3BG 3L2PA 1QZHA 1CUKA 1H95A 1XNQQ 4L5QA 3HFZB 3H0GH 1X65A 4C2MH 4X62L 3S15H 3HOXH 4A3EH 4X66Q 2E5LL 4GNXC 1PH5A 1VQIA 4GOPB 2JA8H 1PH3A 1N9WA 1V9PA 2IHFA 1PH8A 1UE5A 5LMUL 2F4VL 1ASYA 4DKAC 4C3IH 5C0XG 4P72A 3J80c 2XTIA 2JA5G 1QZGA 3PSIA 4LFAL 4R4CA 3CCRA 4DV7Q 3OYYA 4PZ8A 4YY3L 2IX1A 2ZM6Q 5M5YH 2JQOA 3CMAA 3K8AA 1Y1VH 3S1RH 4NXMQ 3PO3G 3M4OH 1EIYB 2PQAB 4AQYQ 2KCMA 2MFIA 1I50H 4GOPC 3G4SA 1VQNA 4TQUS 5FJ8G 3HOVG 3RNUA 1Q86C 3FKIH 4JCVE 1VQJA 4MNOA 1PH4A 1VQ7A 2HHHL 2OTLA 1VQDA 2UUCQ 1VQMA 4DV4L 4YCUA 3ER0A 1Y1WH 2AMCB 4GKJQ 1TWAH 4UPAA 4A3KG 2UUAQ 3G6EA 2UXDQ 2HIXA 1XMOQ 2BH8A 5IYBH 4JYAL 1TWCH 3GO5A 3DLLA 2MO0A 1EFWA 3HOYG 4A93G 1VCIA 2AWNA 2R7DA 3HKZE 2AHOB 1N36Q 4JI2L 1KAWA 4R4TA 3UDFA 4DV0L 4IPGA 1GM5A 1HZAA 3G48A 1PVOA 4DAYB 1K3RA 4DR5L 2UXBL 4KLKA 2VUMH 4GN4B 4QL5A 4X62Q 3U4ZA 3RZDH 2LXJA 5C4JH 1IL2A 2E5LQ 3WWVA 1PYSB 4IOAA 1QVCA 4A4IA 3E0EA 1PYBA 1N32Q 3U50C 3T1YL 5K36G 1CKNB 5BR8L 5IY0A 2Y0SE 5AJ3Q 2ZJPA 4GOPA 1XPUA 3STBD 2F4VQ 1HR0L 3EIVA 4EQ5A 1E22A 2D0OA 2V1CC 2KHJA 4DR3L 1SR3A 2D0PA 2VS1A 4LFAQ 1W2BA 1Z9FA 1EQRA 4BA2I 2Q2HA 1W3SA 2R6GA 4HJ8A 1EWIA 1HR0W 2PI2A 3M85A 4OX9L 1YVCA 3GD7A 3HOWG 3S2DH 3CP0A 5GROA 3GTPH 2Q2TA 1AE3A 2VNUD 2WAQE 3NENA 2PQAA 2YTYA 4GN5A 4BA1I 4X64L 4HIOA 4LF6Q 1L2FA 3MEFA 3T1HL 3CD6A 1D7QA 2HHHQ 4J15A 4O2DA 4RMFA 1NJIC 1X6OA 5M3MG 4DV4Q 2N3SA 4IOCA 4BY7G 4K0KL 4JI6L 1KXLA 1X3EA 3UDGA 2YV5A 3HOUG 2R7FA 4A3MH 1A8VA 3TREA 2R92G 4UP9A 1GVPA 4UP8A 3KYHC 3I4OA 2CQOA 2NVYH 4JYAQ 1DGSA 2JA6G 3MXNB 1XMQL 2OCEA 2MNAA 2QA4A 1CSPA 3B6YA 3A5ZB 4JI2Q 5LMNQ 3JC66 1Q7YC 1N34L 1E24A 4LF5L 3AEVA 4DR4L 2F52A 4JOIA 5FLMH
chains in the Genus database with same CATH superfamily
2UXBQ 5CC4A 5M5YB 1E2WA 4K6DA 5FLXE 3F2UA 3QG1A 1D1IA 1TT2A 3FVQA 4R4IA 2A5HA 4BXXH 3H3VI 5IP9G 3H09A 3W1GA 2ASBA 4OWWB 1C9OA 2A19A 2J4XA 5IODA 5HGTA 3CCVA 2WIIB 5CR3A 3TSSA 1BCPF 2K01A 1SYDA 3PGZA 4LW1A 1TKWB 1YEZA 4NXNQ 3RLOA 4RGMA 1IBMQ 2RDHA 3KBGA 1KQSA 4LF9L 3BDOA 3SEBA 1QUQB 4JI4L 2VUMB 2RVLA 1VQFA 2A6HD 2F0SA 2MUYA 4K8JA 2KEEA 1EY5A 4OL7A 1WTPA 2F3IA 1U0LA 3I4MG 1IW7D 1BUVT 5C0XI 1XMQQ 2EXDA 3MXNA 1A0IA 3J7AF 4LUVA 2AUJD 3QO2A 1HPCA 1B9MA 1SMYC 1RTOA 2F0WA 2L9HA 5G3LF 3STBC 2CCZA 3S2DB 1DONA 3M3YH 2NYZD 3AQQA 1F77A 1XX8A 4AYBE 2VQFL 1G291 2K05A 3F2CA 1A3UA 1KNEA 1WYDA 4BBRH 3NBHA 4K8IA 1QNUA 2TMPA 3G71A 4NDXA 2QCPX 2KCTA 1QWYA 4RCNA 4X65L 1XPOA 3J7A5 1U4MA 1U4PA 2K28A 2B2UA 1PFNA 3SXHA 1CA5A 3I7FA 4C1NI 2N88A 2KJXA 1J6QA 4KN4C 3L0OA 4RKBA 1STAA 2K75A 4LF7L 1GO3E 1VMCA 5CV9A 2GA4B 2GVAA 5E7NA 1MGSA 2PYKA 1PZID 2B63H 1L0YB 1O7ZA 1VQEA 4WJWA 2NVQB 1HZ9A 1CKMA 2E2DC 4A3EG 1SMYD 2PQEA 3I2ZA 2VB2X 1PYWD 2JA8G 1PH1A 4BY1B 1MI2A 2E75C 2XN9C 4DUYL 2RBMA 2JE6I 4EQNA 4IUNA 4DK1A 1AEXA 3OWEB 1J8IA 2MJ8A 4A3LH 2F0QA 4A3IB 5EJWA 1HNXL 4JI0L 4AH6A 1MKHA 1OXSC 4JW0A 3S16H 1II3A 1SNQA 2D9UA 5JVH3 4B3RL 3DHQA 1RTNA 3CRLC 2MO1A 2UU9Q 4B3SL 4KKSA 1EU4A 3N6RA 2E2HB 3LWEA 4DR1Q 3J80E 3GTQB 1FGBD 2VUMG 3D6CA 2K04A 3ULLA 1YNJD 3U9OA 2NVTH 1LT3D 1Q46A 2ZTDA 2DJFC 5IGBA 1YHBA 4TSSA 1PTOF 2VQEL 1F9RA 5FO7B 4HR7B 1STHA 4DV1Q 4JG2A 1Q1BA 1IBLL 1HCZA 3R2TA 1PH7A 4ZLTF 2JA5H 3T1HQ 2DN8A 4PMBA 1J9OA 2ZXOA 4CJ0B 2JYOA 3RLNA 1I4PA 2MQHA 2RCNA 3NELA 3T56B 3DWPA 4LF4Q 4DUZL 5FJ8H 3KF8B 4DV6L 4OONA 3KLWA 5T1GA 2UUBL 5EAYA 3J81i 1PDQA 3NXWA 1MSGA 1TS5A 4A3KH 4K2KA 5KNCA 5LHY1 4KI0A 2AKWB 3HOYH 1Z47A 1EY9A 1F9QA 4IALA 3C46A 2VB3X 2F0GA 3KF6A 3P20A 4HTHA 1UE1A 1V8QA 4KY5A 2L4NA 3OIPA 3TMEA 3I90A 3CMEA 3J81c 1YHQA 4DNRB 2Q2UA 3D6WA 5CORA 3PIO3 1MHWC 3S1NB 1JE5A 4PZ6A 4RWSC 2Z6KC 4HIMA 2K50A 2WB1B 1J5EQ 5GAGC 2B2WC 5AJ3L 2EY6A 1KDCA 3OTOQ 3IL8A 3TP6A 4BY1G 2FMCA 1X3PA 2LKVA 2MP1A 2I5HA 3Q0AA 2CFMA 1PV4A 2WFWA 4DV3L 1Q3LA 4U673 2HD3A 2D5DA 4BY7H 1SJHD 1EOVA 2SEBD 2D62A 1YJWA 1EYCA 1K83H 1JWUD 3S2HB 2E2IH 5T1IA 4A3IG 1OXUA 4A3CG 2BA0A 3I4LA 5EKLA 3F8TA 2Z6KA 1VQGA 1EL0A 1EYDA 5M9OA 2B2WA 4HN7A 4MHEA 2KHSA 4APVA 1BBUA 3BS1A 3J81j 2B8FA 4G7HC 4JBJA 5JPNC 5IP9H 5LMNW 4JV5L 1CFMA 3CAMA 3CCMA 4X3SA 1WTQA 1VQCA 4KTAA 1PXUA 2OTJA 4B3TL 4RA8A 4JI7Q 4Y7NH 1TY2A 5D65A 1EZ6A 1AH9A 1A2UA 1PH9A 2PMZE 4KHPL 1G6PA 1F2LA 1O80A 1RL2A 5EBDA 3GTMH 5FO8B 2QEXA 2KQ3A 3I4MH 4R1JA 5LL6X 1IBKL 3A5UA 3PMFA 4F7XA 1SYBA 5CYUA 2X6GA 1HA6A 1SE8A 4ZAIA 1HQMC 3PIOA 3HOWB 3I56A 2KBNA 1EIGA 1TU2B 4WORA 3S1RB 2L15A 2WKCA 3W5OA 1WTOA 2K5VA 1CZGA 1A63A 2GN5A 3GTGB 2R92B 4QF4A 3SK4A 4GLAC 2ZJQA 2LMCB 1PFSA 4JBWA 2ZM6L 2GVBA 3PCOB 5IT9c 3VR2A 3F2DA 3ND9A 1K8GA 3T16A 3PUXA 4LFBQ 5JEAG 3PUZA 2F0DA 5EKIA 1GOZA 4QJFA 5IE8A 4EX5A 4RFBA 5GAHC 2UUCL 3V2TA 2WB1G 3T51B 3CC4A 2A74C 4L63B 2UUAL 1Q8KA 4DR6Q 4YCVA 4DV2Q 1F9SA 1E2VA 3KLRA 2FJ2A 1EY8A 3PQIA 1O78A 1S5FD 4UAIA 4GZYC 2PO4A 2F0TA 4C2MH 1G2SA 4A3EH 1PH5A 1SYGA 3Q6SA 2EJGC 2EJFC 2XRSD 2JA8H 3UI2A 1UE5A 4IUTA 3S1MB 4KY6A 1IKLA 4DKAC 3A7AB 3PO2B 4P72A 4LFAL 5FOBB 5M5YH 3QIAA 3CMAA 2PQAB 1PRTB 3D8GA 1TWFB 3R3OA 5ELCA 2BDOA 4GOPC 5A2QE 1D5XC 3RNUA 2HHHL 2EYFA 1H9RA 1VQDA 2RDFA 4V0BA 1EOTA 3L9AX 1QCBD 3ER0A 1QB5D 2Q8RE 1A6XA 2HIXA 3ERQA 3TN2A 4ZKBB 3DLLA 2MO0A 2AWNA 4EGVA 3IAYA 3UDFA 4R4TA 4DV0L 1NR2A 1HZAA 3G48A 5M3FB 1K3RA 4DR5L 4KLKA 2VUMH 4X62Q 5J1ZA 2M2LA 4A4IA 1N32Q 3U50C 4HEDA 3RZOB 5K36G 5BR8L 4GOPA 3OMGA 2F4VQ 1PFMA 3MC0B 2J0TD 1VDZA 1UEAB 3J81L 1E2ZA 4KK7A 1Z9FA 4BA2I 1TWHB 1W3SA 4OX9L 1CQVA 1YVCA 4FXGC 3HOWG 3S2DH 1YNND 4HSPA 1AE3A 3NENA 3MFGA 1D7QA 3MEFA 4K14A 3U9SA 2HUGA 2PZWA 1HQRD 4J15A 1X6OA 2A68C 4DV4Q 4K0KL 1H9SA 5DAUA 1X3EA 1KXLA 2YV5A 1CI3M 2R7FA 3TREA 2R92G 5JJZA 1IYUA 1O7LA 3I4OA 5JAVA 1IL8A 1JR0D 1DGSA 4FYDA 3MXNB 1GHKA 5LMNQ 5CV5A 3A5ZB 4DXGA 2L1BA 3PIP3 3EJIA 2Q8IB 4JOIA 1JOQA 1BKBA 3M4OB 2LS01 2CW0C 4BWGB 3E9HA 5E4XA 2B2TC 4YIJA 3FHWA 3G7LA 3NBHB 1S72A 1Y1WB 2J7ZA 1VQKA 1XNRL 1RIPA 2QEJC 2EYJA 2NVQH 3BU2A 3H94A 5CV7A 4IJLA 3HS0C 4KN7C 1HFNA 4IZ8A 1EYGA 1LYLA 4X64Q 1FD7D 4CKBA 4BY1H 2A68D 3PO2G 2PW7A 3MWYW 4B08A 5ISRA 3VYRA 2NZOA 4DF7A 1A2TA 1ICFB 3BVGA 3W3AA 4A3IH 1ML0D 2IJ0A 4KHZA 4A3CH 4B9XA 4LF5Q 1N34Q 4P74A 3TQYA 1AW7A 2DJGC 1DYQA 2AWOA 1YHAA 1EY0A 2CW0D 2I5MX 2JSOA 4IFDJ 4OXPA 4DR7L 4DV5L 1IZ6A 1NSNS 4ZCKA 2NVXB 3KBXA 1HNWL 1SE3A 5C3WA 1CK1A 4OIKA 3TS0A 2E2HH 3C1EA 5M3FG 5C5MA 5I2XA 4DK6C 3GTQH 1YZ6A 2AUKA 5A2QL 1CA6A 3CPFA 1KDBA 3AU7A 1PTOH 3UDXA 1BOSA 1MBYA 1NTGA 5FLXc 4LF9Q 3G6JB 1S5ED 4JI4Q 4S3SA 4GNXA 3VA7A 1M4VA 3NTHA 4DA2A 2QILA 4I7ZC 2AQ3B 5IIFA 4XIGS 4K5XA 3TRZA 3WOEA 1C7YA 1FNWA 2SOBA 1TXYA 4JPBW 1QJOA 1LTLA 3PIPA 5IGCA 4H02A 3MAQA 4J6HA 1K0RA 2KCNA 2YTXA 5GAEC 3P75A 2DNCA 3NTIA 4FXDA 1UE7A 4PG3A 1VQ9A 5DNFA 3DUZA 2K14A 2K5NA 1AN8A 1WJJA 3I3CA 1I4RA 1RCVD 2Z1CA 1K8MA 1G6ZA 2MGSA 3TDQA 3W1BA 1D8LA 1U4RA 1Z7TA 2B2VC 4FNFA 3FRPB 1V1QA 4IFDG 2WINB 4OIJA 2E74C 2A6HC 3T4AC 3BDCA 4KV6A 4L8JA 5JEAH 3K0XA 3S1NH 5IGEA 1Y1WG 1IW7C 3S14B 2ZXPA 1B3AA 2K5DA 4GLXA 3LGJA 3VR6A 4L5SA 4LF7Q 4XYQA 3CQZB 3KOJA 3GTKB 5D3IB 5BN4A 1JOKA 2WB1E 4IUPA 2A8VA 3KF6B 1I3QH 3M4PA 1OO9B 3T1YQ 2B2VA 1WCMB 3GP7A 1EFID 3UE1A 4FF4A 1HNZL 2ATWA 4B3ML 2NZHA 1SNPA 1XNQL 3S2HH 4GKKL 3EBEA 1SXTA 5KGUA 4DUYQ 2Z8LA 1L1OC 2F03A 5IWAL 2HDLA 2BA1A 5BN3A 3NEMA 3CC2A 2EYMA 1KDAA 1HNXQ 4JI0Q 1LTID 4LFCL 3Q23A 1K8AC 4B3RQ 4AQYL 2V4DA 4G4KA 2RA4A 1TY0A 2DGYA 1F2MA 4B3SQ 3EVQA 3H6MA 3BZKA 1RKNA 2B2YC 1Y8OB 4OWXB 3K81C 4K2LA 4DNTB 1LTAD 1L1OA 1XMOL 3PV0A 1X54A 5C4XB 2BCOA 1LO5D 3CCEA 1VQ5A 1I5FA 3K6OA 2WP8J 2VQEQ 3GTOB 5K36H 2IY5B 2EQSA 3TEHB 2DY7A 1IBLQ 3D31A 1K73C 3NBIA 2OEOA 1TR5A 4IPDA 2N8NA 3D3RA 3HOWH 2B2YA 1WI5A 1CZWA 2XGTA 3UDIA 1FNUA 2PZUA 1KIXA 4DUZQ 3Q24A 3LX0A 3H3VC 2QKIC 4DV6Q 3OOCA 3A0JA 5CBEE 2Q2IA 1NE3A 4GN3B 2UUBQ 1H9KA 2VL6A 3ONAB 3GTGH 2R92H 3I55A 5AFWA 2A69C 1CSQA 4YWLA 1MJCA 3J7YW 1YNJC 4N9TA 1GUWA 3CCUA 2JN4A 1I4QA 1ENFA 4RG1A 2XWBB 3PO3B 1BXTA 3GV6A 3LNNA 4IPHA 3D0FA 3CCSA 2A6ED 1ENAA 3NTKA 3HOVB 1BO0A 2DNEA 1C4QA 2OQKA 1JMCA 2JK8A 2K32A 3V05A 3OSOA 3AYHB 1WCMG 3S1QB 1VQAA 1ESRA 1GD7A 4IJHA 3SK8A 1LUZA 3X3MA 1JJ2A 4HIKA 3K59A 3O13A 4IPCA 4DV3Q 3S1MH 4NXNL 1SJED 1IBML 2RCFA 3PO2H 1FJGQ 5FLXL 1PA6A 2A69D 2PZTA 2M00A 4ZUJA 1LT4D 3M9BA 2FMMA 1JJGA 1L0WA 4X6AH 4K5WA 3CPWA 5CBAE 1TWFH 2BDNA 4IO9A 2IPKD 4CJ2C 2SNSA 4R8IA 2EOTA 4X66L 4AIMA 1KTKA 3DWQA 1KRTA 1KL9A 3KJPA 1NY4A 2KHIA 3VYSA 4RH6A 4XYOA 4CDCC 3M7GA 3J7ZC 5I4DA 5K5PA 3C2PA 4WJ3M 5M3MB 1CKOA 1I50B 2F0JA 1V1PA 1WOCA 2K33A 4LWCA 3HOUB 4TKOB 5M3FH 1VQPA 5C4XG 5JJLA 1SROA 4B3TQ 4GS3A 3AFQA 1TQOA 2JA6B 1JB7A 3ULPA 3CCJA 3OW2A 2BH2A 3RZOH 3NWSA 1STYA 4XT3B 1G91A 1CT1D 2K1BA 4GKJL 2EE1A 1RF2D 3PUYA 3T53B 1BCPC 5KNDA 5CV8A 1TWGH 4IQZA 3CCQA 1IBKQ 1DOMA 3FPPA 5IGFA 1B2TA 3L2PA 1QZHA 1CUKA 2TSSA 4L5QA 2D2CC 1X65A 2EY5A 5HURA 3S15H 3VYUA 4J8QA 3SR1A 3SVMA 4HSVA 5EPLA 1WD1A 5I2YA 4GOPB 2H4OA 2NTSA 1V9PA 2RKSA 5E4WC 1MD2D 3CCRA 1STBA 4PZ8A 2ZM6Q 2JQOA 3M4OH 2EDGA 3PO3G 1EIYB 3Q22A 4A3JB 4IFDH 2L12A 2MPMA 4KD3A 3G4SA 3HOVG 3D4WA 1D5ZC 1Q86C 1H9SB 3FMCA 3KUPA 3TP5A 1BNZA 1VQ7A 2OTLA 2UUCQ 1DD2A 4JVZA 1Y1WH 4DXFA 2UUAQ 2Z4IA 2BH8A 1BCPD 3SDZA 4A3DB 4QMGA 1RHPA 2PPBC 2R7DA 1NCVA 3HKZE 2AHOB 4JI2L 2K7VA 1GM5A 3ND8A 4A3FB 1JWSD 4PV1C 4GN4B 1TIID 3U4ZA 1S5CD 1K3BC 3VR5A 4FF1A 1AZQA 3E0EA 3JAME 1PYBA 2I07B 2Y0SE 1DOLA 1HR0L 4EQ5A 1K28A 4DAVA 3K57A 4DR3L 2F0LA 4LFAQ 1RODA 1EIHA 4E6IA 4FXKC 3TZUA 2Q2HA 2C9OA 1EWIA 3A8IE 2PI2A 1ZEQX 2NWGA 3GD7A 4RGOS 5G3LD 1FR3A 4GN5A 3RD4A 4NW2A 2YTYA 2EXZA 4QB4A 4LF6Q 1L2FA 4ZK9B 3T1HL 2HQEA 2HHHQ 2OF1A 1BDOA 3J80L 5M3MG 2L0CA 4JI6L 3BDLA 5IGDA 3HOUG 1A8VA 3I8ZA 1GVPA 1EU3A 2JA6G 2MNAA 3CU7A 1CSPA 3RUZA 4ABNA 1E24A 4DR4L 2DY8A 2RHQB 4DR5Q 4UP7A 4LF8L 5IYDG 1HHVA 1Q1EA 5IYCG 1I94L 4DAYA 3CC7A 1Y1VB 1LT5D 1NAPA 1U9RA 1H9MA 3A8KE 3N52A 4P2CB 3OWFA 5BR8Q 1X32A 1NBWA 1SNDA 2YYZA 3GQBA 2NUCA 4JI3L 1MIUA 1CKNA 1U4LA 3OW7A 5IOCA 1YIJA 4IURA 4DR2L 1R4PB 2E76C 1TWAB 1XYIA 1LABA 3RN5A 1TWCB 2VXWA 3WDNA 4O42A 1VS0A 5ELEA 2YU9H 3HRZC 3WOFA 2X69A 2PCFB 4HCSA 4GNXB 4OELB 1E1OA 3OTOL 3TS2A 1PTOC 4K0KQ 3RZDB 5C4JB 4ZUIA 1HZCA 2B63B 1SNMA 3EA6A 2F0VA 2XNAC 2JEAI 2ZTEA 3R93A 4RAUC 1EUJA 2XRQD 4A3JG 4CKEA 2WAQB 3TP7A 1LTGD 1QVFA 1JOOA 1Y69U 5HY6A 1ET9A 2B29A 3A56A 3S14H 3MEHA 1XJVA 1HTLD 1B3QA 1L0XB 2K03A 4OEMB 4IUQA 4RCOA 4A3DG 1UEBA 2N55A 5IGGA 2L5TA 3CQZH 3GTKH 3K5OA 1Q81C 1XNRQ 4A3FG 1YNNC 1M90C 3S16B 1K8OA 4K6LA 2HT1A 3HEJA 4X3KA 5CMDA 1IYJB 1X3FA 1PRTF 1BVSA 1FL0A 1SMXA 1WCMH 1ESFA 1HUNA 1JE4A 1SYCA 1YBYA 1HRJA 1PTOD 1R4QB 2HQLA 2CHBD 1RD9D 3K5MA 4RHSA 4KMUC 2WACA 2R7ZB 5DEHA 3PF4A 3I91A 2K5QA 1CTMA 2KUMA 3CRKC 3S9WA 3JAML 3A54A 3NSWA 5C3EB 2R93B 2RHSB 5LMUQ 5IT9E 3KLSA 4DV5Q 2SDFA 4HJ9A 3GTLB 4PZ7A 4LNQA 4YY3Q 1G2TA 1D6EC 4UHVA 3M4QA 4R4QA 2F0NA 1DCZA 1TVXA 4YHHL 1B70B 1KNAA 1WTWA 1VQHA 5C4XH 1Y1VG 3W2DA 1HA5A 5GQOA 1B7YB 3MFYA 4I7AA 1BR9A 1WTXA 4O1NA 3Q8DA 1HTPA 2FFKB 2F0IA 1KAAA 4ULLA 3X3NA 1QNKA 3GTOH 5M5WB 1C48A 3U4VA 1LACA 2Z6BA 3OMCA 1FNVA 3HP3A 3URYA 4OO1G 4BBSB 1KLGD 1YJ9A 5IYBG 3K80C 1AP0A 1N8RC 4Y52H 1IKMA 2EIFA 4DK3C 1QG7A 4A76A 3F2BA 1L1OB 4QQBX 3SHLA 2IT1A 4CDDC 4DR6L 1T9HA 3KDFA 3NK9A 3RN2A 1PH6A 1HXYD 1SLJA 3DM1A 3I4NB 2NN6G 3HKZB 3C1FA 1X3QA 3E6ZX 1KC8C 4PMWA 2WAQG 4F88A 4WFN3 5DLQE 5JOBA 5BN5A 2CQAA 2Y0SB 1ZKOA 3PO3H 1F9PA 5TSSA 4FF2A 4ME3A 2CWAA 2KECA 3P7JA 2EY1A 2YTVA 2JP1A 4YWKA 1X55A 3HOVH 3M7NA 2LXKA 3K7UC 4CKCA 3MA2B 1VMPA 2B2TA 4ALPA 3ITPA 3L3OC 4CHTB 4MIUA 3S1QH 2F0PA 3HOZB 5M5XB 2FHTA 2RDGA 1B4OA 2EJMA 2QGQA 2L55A 1S3OA 4NMZA 4P75A 1Q12A 1AFPA 3H91A 1HNZQ 5EKKA 4C3JB 5C44B 4B3MQ 3K0YA 2R7ZG 4GKKQ 2AQ2B 5KYIA 4Y7NB 1KLUD 1K9MC 2ID0A 3QOJA 1WTVA 1N32L 4GLVB 4ZQ3A 4A3GB 5C3EG 1EY7A 5IWAQ 3NE5B 1LT6D 2R93G 2EVBA 1PHJA 3GTJB 3I73A 2IX3A 2OWOA 4KHVA 4LFCQ 3I72A 4A3BB 5D14A 4KD4A 2Z9HA 3K7AB 5M3MH 3PF5A 5KNBA 3ERSX 1SYEA 3RLFA 3HOUH 1V43A 2KENA 1ET6A 3MXPA 3E9IA 4HIDA 3E5SA 1EWCA 4JC0A 5EPKA 1PFBA 2JA6H 2CKZB 5ELOA 4XDXA 4H0LC 1R9TB 1ZYRC 1N33L 4PQXA 1RDPD 3K58A 1CHPD 2XSCA 4BBSG 4IFDI 4C56C 5IYCH 4HJAA 5IYDH 5LMNL 2VQFQ 3PUWA 1UUPA 2C35B 1S4ZA 4JI8L 5KEEA 1LM0A 4JI5L 3DEPA 3PUVA 2VW9A 1V1PB 2RSNA 2UXCL 4X65Q 1ASZA 3D4RA 3I4NG 4POGA 4A93B 3HKZG 2WV6D 5CV6A 1OXXK 2K52A 2G9DA 1XTDA 5GADC 4OHJA 4JI1L 3MXGA 5ELBA 3OIQA 1SE4A 5I6YA 3EROA 3E3XA 1VQLA 1P8LA 1VQOA 1Y8NB 4R9WA 2F0EA 3RR5A 4EQOA 3FDTA 2K6AA 2Y0SG 2R61A 4PMCA 4A3EB 4WJ4A 3IRBA 3S17B 4A3JH 4C1NK 5C0XJ 1ZYRD 3BZCA 1VQ6A 1NMFA 2OT2A 1EWHA 3EN2A 3M4YA 1SBBB 1EQVA 3CF5A 1S5DD 1B1ZA 4FDBA 4A3DH 1HJPA 3HOZG 2F4IA 1JORA 1A3TA 4A3FH 2XWJB 5E3FA 4FP5D 4QIWB 4DV7L 5EGTA 2EYPA 3C3LA 1BCPB 4QUCA 4NXML 4C3JG 2HDMA 5C44G 2E2JB 3HG9A 5KYLA 1D2BA 2XIWA 3MXUA 2P5ZX 1I6HB 1FVIA 5IP7G 1T5EA 2EYOA 4NKLA 4A3GG 4O0AA 2K5WA 3NHHA 1Q82C 1KHIA 2IWHA 5C4HA 1LTBD 2UXDL 1B8AA 4P71A 3KFUA 3J80i 1SFOB 1N36L 3VR4A 2JA7B 4A3BG 5F2DA 3HFZB 4L6TB 1ZXTA 2A6EC 1ICWA 2E5LL 4X66Q 3MTSA 1QOHA 2RQXA 1DXMA 2B2UC 2F1MA 1VQIA 2KA7A 4U68A 3SE0A 2O4XA 2IHFA 5ELFA 1B9NA 1ASYA 5C0XG 3J80c 2XTIA 1HUMA 1QZGA 1WTHA 3PSIA 2PNRC 3BVMA 2IX1A 1EEID 2PW5A 3K8AA 1Y1VH 4HCEA 1XWEA 3S1RH 2KCMA 1LTTD 3OHXC 1VQJA 1SE2A 3T13A 1VQMA 3QOLA 4OO1H 2LY7A 1RJTA 4GKJQ 1TWAH 5IYBH 4JYAL 1TWCH 2KCCA 3GO5A 4A93G 1SNCA 1VCIA 2M9VA 1M8AA 4WRDA 4IPGA 1PVOA 4RHRA 1K0SA 3DXJC 4DAYB 2UXBL 4EQPA 3RZDH 2F0KA 2LXJA 5C4JH 1IL2A 3WWVA 1QVCA 4XQJA 2NN6H 3T1YL 5NUCA 1CKNB 5IY0A 5AJ3Q 2ICIA 4ME5A 2Q8TA 3STBD 1Q8IA 2RSOA 2D0OA 4M1UB 3SK6A 4JK1C 2VS1A 1EZ8A 3NQTA 1IHZA 5C3XA 4C3HB 3M85A 3R8BA 3CP0A 2G9HD 4F87A 1G8ZD 2WAQE 2VNUD 4HIOA 4BA1I 3NPPA 4O2DA 3H0GB 1NJIC 2N3SA 3HOXB 3UDGA 4UP9A 1GUSA 4UP8A 3KYHC 1XMQL 2OCEA 4C3IB 4CJ1B 3B6YA 4JI2Q 1WTRA 3JC66 3AEVA 1IYVA 1SAPA 5H1SE 4UY8C 3ZJYC 1I4XA 1ENCA 2B3GA 4YCWA 4JV5Q 2CWPA 4BS9A 2PNHA 3JAMi 1GUOA 2R7ZH 3FKIB 1NNXA 4M8AA 4OGQC 1PTOB 3VR3A 4XQQA 1HR0Q 1GXDC 3KK7A 3CCLA 3FP9A 2JA7G 4DR3Q 1HZBA 5D3DA 5C3EH 3TP8A 1Y14B 2DUDA 2EYLA 2R93H 2LSSA 1AZPA 3J7AV 5C4ZA 4KHPQ 4L5RC 1G51A 3BJUA 2IHEA 2NTTA 1JB3A 2VY3A 3GTLH 1NR4A 1VQBA 4EVOA 3S24A 3JAMc 2BE5C 1TWHH 5J39A 1O7IA 1OTCA 1E3PA 1ONLA 4H7BA 4JI6Q 1EQTA 1NMGA 4FVMA 1PMRA 1HFGA 3A74A 4OWTB 5EPJA 1LV9A 3UE0A 2F3WA 1QVGA 3ICEA 3MHBA 4DNIA 4DR4Q 1S40A 3CKIB 1EEFD 4LF8Q 4G7OC 5M5WH 1JCKB 1I94Q 5I9OA 4BBSH 3GTPB 2N78A 4NPSA 1KD1C 4CGYB 4JI3Q 5ELNA 1A3VA 4YWMA 1PH2A 2FXQA 4DR2Q 3TBIB 4A3MB 4IUUA 1QE6A 4ILWA 1PZJD 2NVYB 4ODGA 1D1KA 3FEWX 5KRUA 3DWAA 3K5NA 1TS2A 3I4NH 5FKAC 2C5CA 1CQFA 3SK5A 4MTKA 4CDFC 5A35A 3KLSX 4LUZA 4RGTA 2JJQA 1SN8A 2G5DA 2BE5D 1QUQA 2ALYB 2IL8A 1E1TA 1MJEA 2HCCA 3BYTB 1IXRA 5C5LA 5DM73 1YJNA 3BG3A 5FO9B 1A15A 1I3QB 1VQ8A 2UU9L 4V190 3F1ZA 4C3HG 4ZRZA 1EYAA 2SNMA 4B9WA 1JQYD 1FJGL 2LFNA 4FO2A 2K5HA 1NUCA 4DR1L 1VF5C 3KDFB 4Q5VA 3H0GG 4L5TA 3IKJA 1GKHA 3HOXG 1SDFA 2NBFA 2JA9A 2KOLA 2H1EA 3EQLC 3BVZA 1KRSA 2I5LX 1TS3A 2HCIA 1EQQA 5COYA 1V1OA 4C3IG 5I6WA 4DV1L 2F0UA 2QDLA 3HOZH 3I70A 4XQNA 5M5XH 3HGBA 5JEAJ 4Q0FA 2NVXH 1SEBD 4C3JH 4POFA 5C44H 4A75A 5JJKA 3ULJA 3FKIG 4Z9CB 4LF4L 1P16A 4AYBB 5IP7H 3H3VH 1GUNA 3J81E 4JBMA 4LUOA 3M3YB 4A3GH 4K5VA 2Z0SA 4DV0Q 2RF4A 1WD0A 4DAPA 1Q90A 3QR8A 3KJOA 3GTJH 2I46A 1VQ4A 2BOSA 4N8X1 4BBRB 1BQQT 4HJ7A 2JXMB 5JJIA 4A3BH 2F3VA 4ZKCB 3K7AH 4TVAB 3U58A 4H44C 1M1KC 4PNYA 3QWNA 4X3UA 1LLRD 4R4OA 1AE2A 1U5KA 3V96A 4OX9Q 3FPUB 4RKLA 1JICA 2F0OA 5C0XH 4YHHQ 1R9TH 1J5EL 4MZ9A 2ES2A 3HKSA 1JJCB 1I4HA 3VDYA 4J1MA 4IN3A 2VZAA 3NQIA 2Z4HA 4RGNA 1D5MC 2FINB 3DMUA 3GV3A 2CVRA 4A3MG 1STEA 1B44D 2EPBA 1SNOA 2F0MA 1X9NA 1JWMD 1CM9A 1JT8A 4A93H 5HGQA 5FLMG 4HMJA 1DOKA 5ELDA 1EY4A 1YI2A 2EYHA 4BXXG 1ILQA 1DM0B 2ZXRA 3NP8A 4ID6A 3K5LA 4P73A 4DPGA 3S17H 1E0BA 3QJYA 3GDEA 1GHJA 3VYTA 4JI7L 1UAPA 1OXTA 1C0AA 2ENBA 3HZXA 3AMUA 4XXEA 1UNSA 1YNXA 2NVTB 3KF8A 4LF6L 4QCLA 1HH2P 4NB3A 2HIVA 3SGIA 1F2YA 3CXCA 4DK0A 3AB9A 2AQ1B 2E2JH 2NZ1D 4QUFA 3D4DA 3OPOA 4G7ZC 2JEBI 1I6HH 2OQ0A 5LL6S 2JA5B 4LK1C 1SYFA 4AYBG 4F8MA 1GUTA 4QIWE 4DR7Q 1I6VC 3A55A 1HNWQ 1B53A 1UE6A 3ZYYX 4QY7A 4X3TA 1TS4A 2CH4A 3TZDA 4OO1I 1A62A 2MHVA 1LTSD 2KEDA 4MN3A 2E8GA 1SFOH 3MZ5A 4BBRG 4CBVA 1UWVA 3IFTA 2JA7H 4A3KB 1DJRD 4KJNA 3DEOA 4JOIC 3HOYB 3AFPA 5JPMC 2O5JC 2ZJRA 4LFBL 3DM3A 1OXVA 2K4KA 1S5BD 1W6JA 1TWGB 2NN6I 3L7ZC 2A73B 2CH4W 3IFDA 3NUCA 4I65A 1WFQA 2ZTCA 3S15B 4UDUC 3BZDB 1FGUA 1C8CA 4DV2L 5E1FA 3E0JA 2B63G 1N33Q 1YITA 2L11A 2PI2E 4LAAA 2OXPA 5C6AA 3A8JE 1LTRD 1PZKD 2WKDA 5EQ0A 4JBKA 4MTNA 4JI8Q 1O7YA 2H5XA 1X3GA 1ILPA 1T5XD 4JI5Q 1B50A 2UXCQ 2R3ZA 1EY6A 1FYCA 4XTCS 1BF4A 3CHBD 4BY7B 4A3LG 2N49A 1K83B 1XPRA 2E2IB 4HJ5A 2F0HA 3H15A 1E7ZA 4CDEC 1H9JA 2B39A 1SSOA 4KJOA 5FK9C 4N9PA 1MSHA 1F2ZA 4JI1Q 1EIFA 3R2IA 3CW2C 2I0QA 4QGUA 1I4GA 5KIXA 2O2LD 5J3BA 1X56A 1DZ1A 1BBWA 1GJXA 1PLFA 1STGA 1XXGA 5I9PA 5L37A 4C3HH 2IX0A 4DAMA 2O5IC 2XVSA 1VF7A 1SRUA 2A1AA 2EZVA 1H95A 4FF3A 1XNQQ 3H0GH 2PMZB 4X62L 3HOXH 4GNXC 4HMIA 1Z6HA 4HAEA 1Y8PB 5CGKA 1N9WA 1PH3A 1PH8A 5LMUL 1QILA 3MVVA 4ZYSA 2F4VL 2QF7A 2QDBA 4C3IH 2NB0A 2IW3A 2ZT9C 2JA5G 3GTMB 3QB3A 4R4CA 4KY7A 4DV7Q 3OYYA 4YY3L 5DM63 3I4MB 2ICEC 4NXMQ 3P1HA 4KKTA 1WVLA 1XTCD 4AQYQ 2MFIA 1I50H 3RMHA 1VQNA 4TQUS 5FJ8G 1BBXC 3FKIH 4JCVE 1PH4A 4MNOA 4DV4L 3BYYB 4IUVA 4KKUA 4YCUA 2AMCB 4UPAA 4A3KG 3G6EA 5IT9L 2B8GA 2UXDQ 1XMOQ 3HOYG 4H13C 1EFWA 4DU9A 1PRTC 1N36Q 1KAWA 4N8FA 4R8NA 4NP5A 3A7LA 1W6KA 4QL5A 2E5LQ 4DN4M 1PYSB 4IOAA 4LJZC 4TRDA 2ZJPA 2YU9B 1XPUA 3EIVA 4DFAA 1E22A 5J22A 2V1CC 2KHJA 1SR3A 2D0PA 1W2BA 1STNA 1EQRA 4LMQD 4HJ8A 2R6GA 4G57A 1HR0W 4DGZA 5GROA 2F0FA 3GTPH 2Q2TA 4X64L 2PQAA 3CD6A 4RMFA 5CV4A 4C2MB 5JVG3 5EBCA 3EFXD 4IOCA 4BY7G 3NWTA 1JC7A 4A3MH 1GUGA 3VA5A 1KABA 2JA8B 2KVMA 1CHQD 2CQOA 2NVYH 4JYAQ 2QA4A 2QW7A 1PRTD 4LF5L 3LWUA 1Q7YC 2X6LA 1N34L 2EY2A 4XT1B 2F52A 5FLMH
chains in the Genus database with same CATH topology
2RHQB 4DR5Q 4UP7A 4LF8L 1BKBA 5IYDG 1Q1EA 5H1SE 5IYCG 2UXBQ 1I94L 3ZJYC 4UY8C 3CC7A 4YCWA 2B3GA 4R4IA 4JV5Q 4BXXH 2CWPA 3H3VI 3E9HA 2PNHA 5IP9G 3JAMi 5BR8Q 1NBWA 3W1GA 2R7ZH 2ASBA 2YYZA 4OWWB 4JI3L 1MIUA 1CKNA 1HR0Q 3FHWA 1YIJA 1C9OA 2A19A 4DR2L 3CCLA 3FP9A 3NBHB 1S72A 2JA7G 4DR3Q 3CCVA 1HZBA 1VQKA 1XNRL 1RIPA 5C3EH 3RN5A 1Y14B 3PGZA 4LW1A 2DUDA 2R93H 2LSSA 1VS0A 3BU2A 2NVQH 1YEZA 2YU9H 4IJLA 4NXNQ 3RLOA 4KHPQ 4L5RC 1EYGA 1LYLA 1G51A 4X64Q 3BJUA 1IBMQ 2IHEA 4BY1H 4GNXB 1KQSA 4LF9L 3GTLH 1QUQB 2VY3A 1E1OA 3OTOL 1VQBA 4JI4L 3TS2A 3S24A 3JAMc 4K0KQ 1TWHH 1VQFA 1O7IA 1OTCA 1E3PA 4JI6Q 3PO2G 1HZCA 2F3IA 2NZOA 1NMGA 1U0LA 3I4MG 3A74A 4OWTB 4A3IH 2JEAI 2ZTEA 5C0XI 1XMQQ 4KHZA 2EXDA 4A3CH 3UE0A 1EUJA 4A3JG 4LF5Q 1QVGA 3ICEA 1N34Q 4DNIA 1A0IA 4LUVA 4P74A 1S40A 4DR4Q 3TQYA 1QVFA 4LF8Q 2AWOA 5M5WH 1YHAA 5HY6A 1I94Q 2B29A 4BBSH 3S14H 3STBC 2CCZA 2I5MX 3M3YH 1XJVA 2N78A 4NPSA 4IFDJ 3AQQA 4OXPA 1KD1C 4DR7L 4DV5L 1IZ6A 4A3DG 4AYBE 1UEBA 1G291 5ELNA 3F2CA 2VQFL 4YWMA 1PH2A 4JI3Q 1HNWL 2FXQA 3CQZH 4DR2Q 3GTKH 3TS0A 2E2HH 5M3FG 1Q81C 1XNRQ 4A3FG 1M90C 1WYDA 4BBRH 4DK6C 3GTQH 1YZ6A 2HT1A 3G71A 3CPFA 1IYJB 1X3FA 1BVSA 1FL0A 1SMXA 1WCMH 2KCTA 3UDXA 3I4NH 4X65L 1NTGA 1XPOA 3J7A5 5FLXc 4LF9Q 1YBYA 4LUZA 4JI4Q 2JJQA 4GNXA 2HQLA 1SN8A 1QUQA 2ALYB 1E1TA 1MJEA 3I7FA 4XIGS 1IXRA 3TRZA 1C7YA 1YJNA 2UU9L 1J6QA 1VQ8A 3L0OA 1TXYA 3F1ZA 2K75A 1LTLA 3PIPA 4H02A 4LF7L 1K0RA 1GO3E 1FJGL 3PF4A 2YTXA 2GVAA 2K5HA 5GAEC 4DR1L 3KDFB 5E7NA 2B63H 3H0GG 4L5TA 1VQEA 2RHSB 1HZ9A 1CKMA 1GKHA 1UE7A 4PG3A 3HOXG 4A3EG 2JA9A 5LMUQ 1VQ9A 2K14A 1KRSA 2I5LX 2K5NA 3I2ZA 2JA8G 1PH1A 4DV5Q 1WJJA 4HJ9A 1EQQA 4PZ7A 4LNQA 4YY3Q 4DUYL 2JE6I 4DV1L 3M4QA 4R4QA 3HOZH 5M5XH 3W1BA 5JEAJ 1B70B 4YHHL 4A3LH 1D8LA 1VQHA 5C4XH 1Y1VG 5GQOA 2NVXH 1B7YB 1V1QA 4IFDG 1HNXL 4C3JH 4POFA 5C44H 3Q8DA 1MKHA 4AH6A 4A75A 1OXSC 4JI0L 5JJKA 3ULJA 3FKIG 4LF4L 3S16H 3GTOH 1P16A 3K0XA 3U4VA 5IP7H 3H3VH 3S1NH 4B3RL 4OO1G 1Y1WG 2MO1A 4JBMA 4LUOA 2UU9Q 4A3GH 2Z0SA 1YJ9A 4B3SL 4DV0Q 5IYBG 2RF4A 3K80C 4GLXA 1N8RC 4Y52H 3LGJA 4L5SA 2EIFA 4DK3C 4LF7Q 3KJOA 3GTJH 3F2BA 4A76A 3KOJA 1VQ4A 1L1OB 4QQBX 2IT1A 2WB1E 4DR1Q 2A8VA 3KF6B 4HJ7A 2VUMG 4DR6L 4A3BH 1I3QH 1T9HA 3M4PA 3T1YQ 5JJIA 3KDFA 3ULLA 3RN2A 1PH6A 2NVTH 1SLJA 2ZTDA 1Q46A 3K7AH 3UE1A 2ATWA 2NN6G 4TVAB 3U58A 1HNZL 1M1KC 4B3ML 1YHBA 2NZHA 1XNQL 3S2HH 4GKKL 3EBEA 2VQEL 4R4OA 4DUYQ 4DV1Q 1AE2A 1KC8C 4JG2A 1L1OC 1U5KA 1Q1BA 2WAQG 4PMWA 1IBLL 4OX9Q 5DLQE 1PH7A 4YHHQ 1R9TH 1J5EL 5IWAL 2JA5H 2BA1A 4MZ9A 2ES2A 3NEMA 3T1HQ 3CC2A 3HKSA 1JJCB 3RLNA 1HNXQ 3VDYA 3PO3H 2MQHA 2RCNA 3NELA 4JI0Q 4ME3A 2CWAA 4LF4Q 4LFCL 4DUZL 2YTVA 2VZAA 4YWKA 1X55A 3KF8B 5FJ8H 4OONA 4DV6L 1K8AC 3HOVH 4AQYL 2LXKA 3M7NA 4B3RQ 3K7UC 3KLWA 4A3MG 2UUBL 5EAYA 2DGYA 3J81i 4ALPA 4B3SQ 4A3KH 3BZKA 4KI0A 2AKWB 1X9NA 3S1QH 1JT8A 3HOYH 4A93H 1Z47A 4OWXB 5HGQA 5FLMG 3K81C 2QGQA 1L1OA 1XMOL 3PV0A 1X54A 1S3OA 4P75A 3KF6A 1Q12A 1YI2A 1UE1A 3CCEA 1VQ5A 4BXXG 1I5FA 1HNZQ 4B3MQ 2WP8J 3CMEA 2R7ZG 3J81c 1YHQA 4GKKQ 2Q2UA 2VQEQ 2IY5B 2EQSA 3TEHB 1JE5A 1K9MC 4PZ6A 2ID0A 1IBLQ 2Z6KC 4P73A 3D31A 4DPGA 2K50A 4GLVB 4HIMA 1K73C 3HOUH 3S17H 1N32L 5C3EG 1J5EQ 4IPDA 5IWAQ 5GAGC 5AJ3L 2R93G 2N8NA 1PHJA 3OTOQ 3GDEA 4JI7L 3HOWH 4BY1G 1WI5A 1OXTA 2XGTA 3UDIA 2OWOA 1C0AA 4LFCQ 1KIXA 4DUZQ 2I5HA 2CFMA 1PV4A 2WFWA 4DV3L 4DV6Q 3A0JA 1YNXA 2Q2IA 1NE3A 4GN3B 2UUBQ 5M3MH 3PF5A 4LF6L 4BY7H 1HH2P 1EOVA 2VL6A 3ERSX 2D62A 4NB3A 1K83H 2HIVA 1V43A 3RLFA 2KENA 3SGIA 1YJWA 2E2IH 2R92H 3E9IA 3I55A 3CXCA 4HIDA 4A3IG 3GTGH 1CSQA 4YWLA 1MJCA 1OXUA 4JC0A 4A3CG 2JA6H 2CKZB 2E2JH 2BA0A 5ELOA 3CCUA 3F8TA 2JEBI 1I6HH 2Z6KA 2OQ0A 1N33L 1VQGA 4AYBG 4DR7Q 4QIWE 4RG1A 4BBSG 4IFDI 5IYDH 5IYCH 4HJAA 4APVA 5LMNL 2VQFQ 1HNWQ 3PUWA 1BBUA 1UE6A 2C35B 4JI8L 3J81j 4QY7A 1LM0A 4JBJA 4JI5L 4IPHA 3D0FA 3CCSA 5IP9H 4OO1I 3PUVA 1A62A 5LMNW 2VW9A 4JV5L 2UXCL 2E8GA 3CAMA 2OQKA 1SFOH 3CCMA 4BBRG 1UWVA 2JA7H 1JMCA 2JK8A 4X65Q 1VQCA 1ASZA 2OTJA 4B3TL 3AYHB 1WCMG 4JOIC 4JI7Q 1VQAA 4Y7NH 3I4NG 4POGA 3AFPA 1GD7A 3HKZG 2ZJRA 4LFBL 3DM3A 1OXVA 4IJHA 1LUZA 2K4KA 1OXXK 2K52A 4HIKA 1JJ2A 5GADC 1XTDA 1AH9A 4IPCA 4JI1L 4DV3Q 1PH9A 4NXNL 3S1MH 2PMZE 2NN6I 4KHPL 3L7ZC 1IBML 1VQLA 3PO2H 1G6PA 1P8LA 1VQOA 1FJGQ 1PA6A 1RL2A 3GTMH 3RR5A 2QEXA 1WFQA 2ZTCA 2Y0SG 3I4MH 3M9BA 4R1JA 1JJGA 1FGUA 1L0WA 4X6AH 3CPWA 4DV2L 1IBKL 4WJ4A 3A5UA 3IRBA 4A3JH 1TWFH 2B63G 5C0XJ 1N33Q 1YITA 2PI2E 3BZCA 1SE8A 4IO9A 1NMFA 3EN2A 1VQ6A 3PIOA 3CF5A 4MTNA 4X66L 2KBNA 4JI8Q 4AIMA 3I56A 4JBKA 2H5XA 1X3GA 1KRTA 4JI5Q 1KL9A 3KJPA 4FDBA 1NY4A 4A3DH 2KHIA 1HJPA 3HOZG 2L15A 3J7ZC 3W5OA 2UXCQ 4WJ3M 1CKOA 2K5VA 4XTCS 1WOCA 2N49A 4LWCA 1XPRA 4A3LG 5M3FH 5C4XG 1VQPA 4A3FH 2GN5A 5JJLA 4HJ5A 1SROA 4DV7L 4GLAC 2ZJQA 1A63A 1PFSA 4B3TQ 4GS3A 4JBWA 2ZM6L 2GVBA 3AFQA 3PCOB 5IT9c 3H15A 4NXML 1E7ZA 3F2DA 1K8GA 5C44G 1JB7A 3PUXA 4LFBQ 3ULPA 3CCJA 5JEAG 3PUZA 3OW2A 2BH2A 4QJFA 3RZOH 1FVIA 5IP7G 4JI1Q 1EIFA 5IE8A 4EX5A 2UUCL 5GAHC 3CW2C 2I0QA 4QGUA 2WB1G 4A3GG 4O0AA 1Q82C 3CC4A 1KHIA 5J3BA 4GKJL 1X56A 2UUAL 3PUYA 2UXDL 1BBWA 1B8AA 1Q8KA 4DR6Q 4YCVA 4P71A 3KFUA 4C3HH 1TWGH 3J80i 3CCQA 4DV2Q 2IX0A 4DAMA 1IBKQ 1SRUA 1N36L 2A1AA 4A3BG 3L2PA 1QZHA 1CUKA 1H95A 1XNQQ 4L5QA 3HFZB 3H0GH 1X65A 4C2MH 4X62L 3S15H 3HOXH 4A3EH 4X66Q 2E5LL 4GNXC 1PH5A 1VQIA 4GOPB 2JA8H 1PH3A 1N9WA 1V9PA 2IHFA 1PH8A 1UE5A 5LMUL 2F4VL 1ASYA 4DKAC 4C3IH 5C0XG 4P72A 3J80c 2XTIA 2JA5G 1QZGA 3PSIA 4LFAL 4R4CA 3CCRA 4DV7Q 3OYYA 4PZ8A 4YY3L 2IX1A 2ZM6Q 5M5YH 2JQOA 3CMAA 3K8AA 1Y1VH 3S1RH 4NXMQ 3PO3G 3M4OH 1EIYB 2PQAB 4AQYQ 2KCMA 2MFIA 1I50H 4GOPC 3G4SA 1VQNA 4TQUS 5FJ8G 3HOVG 3RNUA 1Q86C 3FKIH 4JCVE 1VQJA 4MNOA 1PH4A 1VQ7A 2HHHL 2OTLA 1VQDA 2UUCQ 1VQMA 4DV4L 4YCUA 3ER0A 1Y1WH 2AMCB 4GKJQ 1TWAH 4UPAA 4A3KG 2UUAQ 3G6EA 2UXDQ 2HIXA 1XMOQ 2BH8A 5IYBH 4JYAL 1TWCH 3GO5A 3DLLA 2MO0A 1EFWA 3HOYG 4A93G 1VCIA 2AWNA 2R7DA 3HKZE 2AHOB 1N36Q 4JI2L 1KAWA 4R4TA 3UDFA 4DV0L 4IPGA 1GM5A 1HZAA 3G48A 1PVOA 4DAYB 1K3RA 4DR5L 2UXBL 4KLKA 2VUMH 4GN4B 4QL5A 4X62Q 3U4ZA 3RZDH 2LXJA 5C4JH 1IL2A 2E5LQ 3WWVA 1PYSB 4IOAA 1QVCA 4A4IA 3E0EA 1PYBA 1N32Q 3U50C 3T1YL 5K36G 1CKNB 5BR8L 5IY0A 2Y0SE 5AJ3Q 2ZJPA 4GOPA 1XPUA 3STBD 2F4VQ 1HR0L 3EIVA 4EQ5A 1E22A 2D0OA 2V1CC 2KHJA 4DR3L 1SR3A 2D0PA 2VS1A 4LFAQ 1W2BA 1Z9FA 1EQRA 4BA2I 2Q2HA 1W3SA 2R6GA 4HJ8A 1EWIA 1HR0W 2PI2A 3M85A 4OX9L 1YVCA 3GD7A 3HOWG 3S2DH 3CP0A 5GROA 3GTPH 2Q2TA 1AE3A 2VNUD 2WAQE 3NENA 2PQAA 2YTYA 4GN5A 4BA1I 4X64L 4HIOA 4LF6Q 1L2FA 3MEFA 3T1HL 3CD6A 1D7QA 2HHHQ 4J15A 4O2DA 4RMFA 1NJIC 1X6OA 5M3MG 4DV4Q 2N3SA 4IOCA 4BY7G 4K0KL 4JI6L 1KXLA 1X3EA 3UDGA 2YV5A 3HOUG 2R7FA 4A3MH 1A8VA 3TREA 2R92G 4UP9A 1GVPA 4UP8A 3KYHC 3I4OA 2CQOA 2NVYH 4JYAQ 1DGSA 2JA6G 3MXNB 1XMQL 2OCEA 2MNAA 2QA4A 1CSPA 3B6YA 3A5ZB 4JI2Q 5LMNQ 3JC66 1Q7YC 1N34L 1E24A 4LF5L 3AEVA 4DR4L 2F52A 4JOIA 5FLMH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RHQ B;  4DR5 Q;  4UP7 A;  4LF8 L;  1BKB A;  5IYD G;  1Q1E A;  5H1S E;  5IYC G;  2UXB Q;  1I94 L;  3ZJY C;  4UY8 C;  3CC7 A;  4YCW A;  2B3G A;  4R4I A;  4JV5 Q;  4BXX H;  2CWP A;  3H3V I;  3E9H A;  2PNH A;  5IP9 G;  3JAM i;  5BR8 Q;  1NBW A;  3W1G A;  2R7Z H;  2ASB A;  2YYZ A;  4OWW B;  4JI3 L;  1MIU A;  1CKN A;  1HR0 Q;  3FHW A;  1YIJ A;  1C9O A;  2A19 A;  4DR2 L;  3CCL A;  3FP9 A;  3NBH B;  1S72 A;  2JA7 G;  4DR3 Q;  3CCV A;  1HZB A;  1VQK A;  1XNR L;  1RIP A;  5C3E H;  3RN5 A;  1Y14 B;  3PGZ A;  4LW1 A;  2DUD A;  2R93 H;  2LSS A;  1VS0 A;  3BU2 A;  2NVQ H;  1YEZ A;  2YU9 H;  4IJL A;  4NXN Q;  3RLO A;  4KHP Q;  4L5R C;  1EYG A;  1LYL A;  1G51 A;  4X64 Q;  3BJU A;  1IBM Q;  2IHE A;  4BY1 H;  4GNX B;  1KQS A;  4LF9 L;  3GTL H;  1QUQ B;  2VY3 A;  1E1O A;  3OTO L;  1VQB A;  4JI4 L;  3TS2 A;  3S24 A;  3JAM c;  4K0K Q;  1TWH H;  1VQF A;  1O7I A;  1OTC A;  1E3P A;  4JI6 Q;  3PO2 G;  1HZC A;  2F3I A;  2NZO A;  1NMG A;  1U0L A;  3I4M G;  3A74 A;  4OWT B;  4A3I H;  2JEA I;  2ZTE A;  5C0X I;  1XMQ Q;  4KHZ A;  2EXD A;  4A3C H;  3UE0 A;  1EUJ A;  4A3J G;  4LF5 Q;  1QVG A;  3ICE A;  1N34 Q;  4DNI A;  1A0I A;  4LUV A;  4P74 A;  1S40 A;  4DR4 Q;  3TQY A;  1QVF A;  4LF8 Q;  2AWO A;  5M5W H;  1YHA A;  5HY6 A;  1I94 Q;  2B29 A;  4BBS H;  3S14 H;  3STB C;  2CCZ A;  2I5M X;  3M3Y H;  1XJV A;  2N78 A;  4NPS A;  4IFD J;  3AQQ A;  4OXP A;  1KD1 C;  4DR7 L;  4DV5 L;  1IZ6 A;  4A3D G;  4AYB E;  1UEB A;  1G29 1;  5ELN A;  3F2C A;  2VQF L;  4YWM A;  1PH2 A;  4JI3 Q;  1HNW L;  2FXQ A;  3CQZ H;  4DR2 Q;  3GTK H;  3TS0 A;  2E2H H;  5M3F G;  1Q81 C;  1XNR Q;  4A3F G;  1M90 C;  1WYD A;  4BBR H;  4DK6 C;  3GTQ H;  1YZ6 A;  2HT1 A;  3G71 A;  3CPF A;  1IYJ B;  1X3F A;  1BVS A;  1FL0 A;  1SMX A;  1WCM H;  2KCT A;  3UDX A;  3I4N H;  4X65 L;  1NTG A;  1XPO A;  3J7A 5;  5FLX c;  4LF9 Q;  1YBY A;  4LUZ A;  4JI4 Q;  2JJQ A;  4GNX A;  2HQL A;  1SN8 A;  1QUQ A;  2ALY B;  1E1T A;  1MJE A;  3I7F A;  4XIG S;  1IXR A;  3TRZ A;  1C7Y A;  1YJN A;  2UU9 L;  1J6Q A;  1VQ8 A;  3L0O A;  1TXY A;  3F1Z A;  2K75 A;  1LTL A;  3PIP A;  4H02 A;  4LF7 L;  1K0R A;  1GO3 E;  1FJG L;  3PF4 A;  2YTX A;  2GVA A;  2K5H A;  5GAE C;  4DR1 L;  3KDF B;  5E7N A;  2B63 H;  3H0G G;  4L5T A;  1VQE A;  2RHS B;  1HZ9 A;  1CKM A;  1GKH A;  1UE7 A;  4PG3 A;  3HOX G;  4A3E G;  2JA9 A;  5LMU Q;  1VQ9 A;  2K14 A;  1KRS A;  2I5L X;  2K5N A;  3I2Z A;  2JA8 G;  1PH1 A;  4DV5 Q;  1WJJ A;  4HJ9 A;  1EQQ A;  4PZ7 A;  4LNQ A;  4YY3 Q;  4DUY L;  2JE6 I;  4DV1 L;  3M4Q A;  4R4Q A;  3HOZ H;  5M5X H;  3W1B A;  5JEA J;  1B70 B;  4YHH L;  4A3L H;  1D8L A;  1VQH A;  5C4X H;  1Y1V G;  5GQO A;  2NVX H;  1B7Y B;  1V1Q A;  4IFD G;  1HNX L;  4C3J H;  4POF A;  5C44 H;  3Q8D A;  1MKH A;  4AH6 A;  4A75 A;  1OXS C;  4JI0 L;  5JJK A;  3ULJ A;  3FKI G;  4LF4 L;  3S16 H;  3GTO H;  1P16 A;  3K0X A;  3U4V A;  5IP7 H;  3H3V H;  3S1N H;  4B3R L;  4OO1 G;  1Y1W G;  2MO1 A;  4JBM A;  4LUO A;  2UU9 Q;  4A3G H;  2Z0S A;  1YJ9 A;  4B3S L;  4DV0 Q;  5IYB G;  2RF4 A;  3K80 C;  4GLX A;  1N8R C;  4Y52 H;  3LGJ A;  4L5S A;  2EIF A;  4DK3 C;  4LF7 Q;  3KJO A;  3GTJ H;  3F2B A;  4A76 A;  3KOJ A;  1VQ4 A;  1L1O B;  4QQB X;  2IT1 A;  2WB1 E;  4DR1 Q;  2A8V A;  3KF6 B;  4HJ7 A;  2VUM G;  4DR6 L;  4A3B H;  1I3Q H;  1T9H A;  3M4P A;  3T1Y Q;  5JJI A;  3KDF A;  3ULL A;  3RN2 A;  1PH6 A;  2NVT H;  1SLJ A;  2ZTD A;  1Q46 A;  3K7A H;  3UE1 A;  2ATW A;  2NN6 G;  4TVA B;  3U58 A;  1HNZ L;  1M1K C;  4B3M L;  1YHB A;  2NZH A;  1XNQ L;  3S2H H;  4GKK L;  3EBE A;  2VQE L;  4R4O A;  4DUY Q;  4DV1 Q;  1AE2 A;  1KC8 C;  4JG2 A;  1L1O C;  1U5K A;  1Q1B A;  2WAQ G;  4PMW A;  1IBL L;  4OX9 Q;  5DLQ E;  1PH7 A;  4YHH Q;  1R9T H;  1J5E L;  5IWA L;  2JA5 H;  2BA1 A;  4MZ9 A;  2ES2 A;  3NEM A;  3T1H Q;  3CC2 A;  3HKS A;  1JJC B;  3RLN A;  1HNX Q;  3VDY A;  3PO3 H;  2MQH A;  2RCN A;  3NEL A;  4JI0 Q;  4ME3 A;  2CWA A;  4LF4 Q;  4LFC L;  4DUZ L;  2YTV A;  2VZA A;  4YWK A;  1X55 A;  3KF8 B;  5FJ8 H;  4OON A;  4DV6 L;  1K8A C;  3HOV H;  4AQY L;  2LXK A;  3M7N A;  4B3R Q;  3K7U C;  3KLW A;  4A3M G;  2UUB L;  5EAY A;  2DGY A;  3J81 i;  4ALP A;  4B3S Q;  4A3K H;  3BZK A;  4KI0 A;  2AKW B;  1X9N A;  3S1Q H;  1JT8 A;  3HOY H;  4A93 H;  1Z47 A;  4OWX B;  5HGQ A;  5FLM G;  3K81 C;  2QGQ A;  1L1O A;  1XMO L;  3PV0 A;  1X54 A;  1S3O A;  4P75 A;  3KF6 A;  1Q12 A;  1YI2 A;  1UE1 A;  3CCE A;  1VQ5 A;  4BXX G;  1I5F A;  1HNZ Q;  4B3M Q;  2WP8 J;  3CME A;  2R7Z G;  3J81 c;  1YHQ A;  4GKK Q;  2Q2U A;  2VQE Q;  2IY5 B;  2EQS A;  3TEH B;  1JE5 A;  1K9M C;  4PZ6 A;  2ID0 A;  1IBL Q;  2Z6K C;  4P73 A;  3D31 A;  4DPG A;  2K50 A;  4GLV B;  4HIM A;  1K73 C;  3HOU H;  3S17 H;  1N32 L;  5C3E G;  1J5E Q;  4IPD A;  5IWA Q;  5GAG C;  5AJ3 L;  2R93 G;  2N8N A;  1PHJ A;  3OTO Q;  3GDE A;  4JI7 L;  3HOW H;  4BY1 G;  1WI5 A;  1OXT A;  2XGT A;  3UDI A;  2OWO A;  1C0A A;  4LFC Q;  1KIX A;  4DUZ Q;  2I5H A;  2CFM A;  1PV4 A;  2WFW A;  4DV3 L;  4DV6 Q;  3A0J A;  1YNX A;  2Q2I A;  1NE3 A;  4GN3 B;  2UUB Q;  5M3M H;  3PF5 A;  4LF6 L;  4BY7 H;  1HH2 P;  1EOV A;  2VL6 A;  3ERS X;  2D62 A;  4NB3 A;  1K83 H;  2HIV A;  1V43 A;  3RLF A;  2KEN A;  3SGI A;  1YJW A;  2E2I H;  2R92 H;  3E9I A;  3I55 A;  3CXC A;  4HID A;  4A3I G;  3GTG H;  1CSQ A;  4YWL A;  1MJC A;  1OXU A;  4JC0 A;  4A3C G;  2JA6 H;  2CKZ B;  2E2J H;  2BA0 A;  5ELO A;  3CCU A;  3F8T A;  2JEB I;  1I6H H;  2Z6K A;  2OQ0 A;  1N33 L;  1VQG A;  4AYB G;  4DR7 Q;  4QIW E;  4RG1 A;  4BBS G;  4IFD I;  5IYD H;  5IYC H;  4HJA A;  4APV A;  5LMN L;  2VQF Q;  1HNW Q;  3PUW A;  1BBU A;  1UE6 A;  2C35 B;  4JI8 L;  3J81 j;  4QY7 A;  1LM0 A;  4JBJ A;  4JI5 L;  4IPH A;  3D0F A;  3CCS A;  5IP9 H;  4OO1 I;  3PUV A;  1A62 A;  5LMN W;  2VW9 A;  4JV5 L;  2UXC L;  2E8G A;  3CAM A;  2OQK A;  1SFO H;  3CCM A;  4BBR G;  1UWV A;  2JA7 H;  1JMC A;  2JK8 A;  4X65 Q;  1VQC A;  1ASZ A;  2OTJ A;  4B3T L;  3AYH B;  1WCM G;  4JOI C;  4JI7 Q;  1VQA A;  4Y7N H;  3I4N G;  4POG A;  3AFP A;  1GD7 A;  3HKZ G;  2ZJR A;  4LFB L;  3DM3 A;  1OXV A;  4IJH A;  1LUZ A;  2K4K A;  1OXX K;  2K52 A;  4HIK A;  1JJ2 A;  5GAD C;  1XTD A;  1AH9 A;  4IPC A;  4JI1 L;  4DV3 Q;  1PH9 A;  4NXN L;  3S1M H;  2PMZ E;  2NN6 I;  4KHP L;  3L7Z C;  1IBM L;  1VQL A;  3PO2 H;  1G6P A;  1P8L A;  1VQO A;  1FJG Q;  1PA6 A;  1RL2 A;  3GTM H;  3RR5 A;  2QEX A;  1WFQ A;  2ZTC A;  2Y0S G;  3I4M H;  3M9B A;  4R1J A;  1JJG A;  1FGU A;  1L0W A;  4X6A H;  3CPW A;  4DV2 L;  1IBK L;  4WJ4 A;  3A5U A;  3IRB A;  4A3J H;  1TWF H;  2B63 G;  5C0X J;  1N33 Q;  1YIT A;  2PI2 E;  3BZC A;  1SE8 A;  4IO9 A;  1NMF A;  3EN2 A;  1VQ6 A;  3PIO A;  3CF5 A;  4MTN A;  4X66 L;  2KBN A;  4JI8 Q;  4AIM A;  3I56 A;  4JBK A;  2H5X A;  1X3G A;  1KRT A;  4JI5 Q;  1KL9 A;  3KJP A;  4FDB A;  1NY4 A;  4A3D H;  2KHI A;  1HJP A;  3HOZ G;  2L15 A;  3J7Z C;  3W5O A;  2UXC Q;  4WJ3 M;  1CKO A;  2K5V A;  4XTC S;  1WOC A;  2N49 A;  4LWC A;  1XPR A;  4A3L G;  5M3F H;  5C4X G;  1VQP A;  4A3F H;  2GN5 A;  5JJL A;  4HJ5 A;  1SRO A;  4DV7 L;  4GLA C;  2ZJQ A;  1A63 A;  1PFS A;  4B3T Q;  4GS3 A;  4JBW A;  2ZM6 L;  2GVB A;  3AFQ A;  3PCO B;  5IT9 c;  3H15 A;  4NXM L;  1E7Z A;  3F2D A;  1K8G A;  5C44 G;  1JB7 A;  3PUX A;  4LFB Q;  3ULP A;  3CCJ A;  5JEA G;  3PUZ A;  3OW2 A;  2BH2 A;  4QJF A;  3RZO H;  1FVI A;  5IP7 G;  4JI1 Q;  1EIF A;  5IE8 A;  4EX5 A;  2UUC L;  5GAH C;  3CW2 C;  2I0Q A;  4QGU A;  2WB1 G;  4A3G G;  4O0A A;  1Q82 C;  3CC4 A;  1KHI A;  5J3B A;  4GKJ L;  1X56 A;  2UUA L;  3PUY A;  2UXD L;  1BBW A;  1B8A A;  1Q8K A;  4DR6 Q;  4YCV A;  4P71 A;  3KFU A;  4C3H H;  1TWG H;  3J80 i;  3CCQ A;  4DV2 Q;  2IX0 A;  4DAM A;  1IBK Q;  1SRU A;  1N36 L;  2A1A A;  4A3B G;  3L2P A;  1QZH A;  1CUK A;  1H95 A;  1XNQ Q;  4L5Q A;  3HFZ B;  3H0G H;  1X65 A;  4C2M H;  4X62 L;  3S15 H;  3HOX H;  4A3E H;  4X66 Q;  2E5L L;  4GNX C;  1PH5 A;  1VQI A;  4GOP B;  2JA8 H;  1PH3 A;  1N9W A;  1V9P A;  2IHF A;  1PH8 A;  1UE5 A;  5LMU L;  2F4V L;  1ASY A;  4DKA C;  4C3I H;  5C0X G;  4P72 A;  3J80 c;  2XTI A;  2JA5 G;  1QZG A;  3PSI A;  4LFA L;  4R4C A;  3CCR A;  4DV7 Q;  3OYY A;  4PZ8 A;  4YY3 L;  2IX1 A;  2ZM6 Q;  5M5Y H;  2JQO A;  3CMA A;  3K8A A;  1Y1V H;  3S1R H;  4NXM Q;  3PO3 G;  3M4O H;  1EIY B;  2PQA B;  4AQY Q;  2KCM A;  2MFI A;  1I50 H;  4GOP C;  3G4S A;  1VQN A;  4TQU S;  5FJ8 G;  3HOV G;  3RNU A;  1Q86 C;  3FKI H;  4JCV E;  1VQJ A;  4MNO A;  1PH4 A;  1VQ7 A;  2HHH L;  2OTL A;  1VQD A;  2UUC Q;  1VQM A;  4DV4 L;  4YCU A;  3ER0 A;  1Y1W H;  2AMC B;  4GKJ Q;  1TWA H;  4UPA A;  4A3K G;  2UUA Q;  3G6E A;  2UXD Q;  2HIX A;  1XMO Q;  2BH8 A;  5IYB H;  4JYA L;  1TWC H;  3GO5 A;  3DLL A;  2MO0 A;  1EFW A;  3HOY G;  4A93 G;  1VCI A;  2AWN A;  2R7D A;  3HKZ E;  2AHO B;  1N36 Q;  4JI2 L;  1KAW A;  4R4T A;  3UDF A;  4DV0 L;  4IPG A;  1GM5 A;  1HZA A;  3G48 A;  1PVO A;  4DAY B;  1K3R A;  4DR5 L;  2UXB L;  4KLK A;  2VUM H;  4GN4 B;  4QL5 A;  4X62 Q;  3U4Z A;  3RZD H;  2LXJ A;  5C4J H;  1IL2 A;  2E5L Q;  3WWV A;  1PYS B;  4IOA A;  1QVC A;  4A4I A;  3E0E A;  1PYB A;  1N32 Q;  3U50 C;  3T1Y L;  5K36 G;  1CKN B;  5BR8 L;  5IY0 A;  2Y0S E;  5AJ3 Q;  2ZJP A;  4GOP A;  1XPU A;  3STB D;  2F4V Q;  1HR0 L;  3EIV A;  4EQ5 A;  1E22 A;  2D0O A;  2V1C C;  2KHJ A;  4DR3 L;  1SR3 A;  2D0P A;  2VS1 A;  4LFA Q;  1W2B A;  1Z9F A;  1EQR A;  4BA2 I;  2Q2H A;  1W3S A;  2R6G A;  4HJ8 A;  1EWI A;  1HR0 W;  2PI2 A;  3M85 A;  4OX9 L;  1YVC A;  3GD7 A;  3HOW G;  3S2D H;  3CP0 A;  5GRO A;  3GTP H;  2Q2T A;  1AE3 A;  2VNU D;  2WAQ E;  3NEN A;  2PQA A;  2YTY A;  4GN5 A;  4BA1 I;  4X64 L;  4HIO A;  4LF6 Q;  1L2F A;  3MEF A;  3T1H L;  3CD6 A;  1D7Q A;  2HHH Q;  4J15 A;  4O2D A;  4RMF A;  1NJI C;  1X6O A;  5M3M G;  4DV4 Q;  2N3S A;  4IOC A;  4BY7 G;  4K0K L;  4JI6 L;  1KXL A;  1X3E A;  3UDG A;  2YV5 A;  3HOU G;  2R7F A;  4A3M H;  1A8V A;  3TRE A;  2R92 G;  4UP9 A;  1GVP A;  4UP8 A;  3KYH C;  3I4O A;  2CQO A;  2NVY H;  4JYA Q;  1DGS A;  2JA6 G;  3MXN B;  1XMQ L;  2OCE A;  2MNA A;  2QA4 A;  1CSP A;  3B6Y A;  3A5Z B;  4JI2 Q;  5LMN Q;  3JC6 6;  1Q7Y C;  1N34 L;  1E24 A;  4LF5 L;  3AEV A;  4DR4 L;  2F52 A;  4JOI A;  5FLM H; 
#chains in the Genus database with same CATH topology
 2UXB Q;  5CC4 A;  5M5Y B;  1E2W A;  4K6D A;  5FLX E;  3F2U A;  3QG1 A;  1D1I A;  1TT2 A;  3FVQ A;  4R4I A;  2A5H A;  4BXX H;  3H3V I;  5IP9 G;  3H09 A;  3W1G A;  2ASB A;  4OWW B;  1C9O A;  2A19 A;  2J4X A;  5IOD A;  5HGT A;  3CCV A;  2WII B;  5CR3 A;  3TSS A;  1BCP F;  2K01 A;  1SYD A;  3PGZ A;  4LW1 A;  1TKW B;  1YEZ A;  4NXN Q;  3RLO A;  4RGM A;  1IBM Q;  2RDH A;  3KBG A;  1KQS A;  4LF9 L;  3BDO A;  3SEB A;  1QUQ B;  4JI4 L;  2VUM B;  2RVL A;  1VQF A;  2A6H D;  2F0S A;  2MUY A;  4K8J A;  2KEE A;  1EY5 A;  4OL7 A;  1WTP A;  2F3I A;  1U0L A;  3I4M G;  1IW7 D;  1BUV T;  5C0X I;  1XMQ Q;  2EXD A;  3MXN A;  1A0I A;  3J7A F;  4LUV A;  2AUJ D;  3QO2 A;  1HPC A;  1B9M A;  1SMY C;  1RTO A;  2F0W A;  2L9H A;  5G3L F;  3STB C;  2CCZ A;  3S2D B;  1DON A;  3M3Y H;  2NYZ D;  3AQQ A;  1F77 A;  1XX8 A;  4AYB E;  2VQF L;  1G29 1;  2K05 A;  3F2C A;  1A3U A;  1KNE A;  1WYD A;  4BBR H;  3NBH A;  4K8I A;  1QNU A;  2TMP A;  3G71 A;  4NDX A;  2QCP X;  2KCT A;  1QWY A;  4RCN A;  4X65 L;  1XPO A;  3J7A 5;  1U4M A;  1U4P A;  2K28 A;  2B2U A;  1PFN A;  3SXH A;  1CA5 A;  3I7F A;  4C1N I;  2N88 A;  2KJX A;  1J6Q A;  4KN4 C;  3L0O A;  4RKB A;  1STA A;  2K75 A;  4LF7 L;  1GO3 E;  1VMC A;  5CV9 A;  2GA4 B;  2GVA A;  5E7N A;  1MGS A;  2PYK A;  1PZI D;  2B63 H;  1L0Y B;  1O7Z A;  1VQE A;  4WJW A;  2NVQ B;  1HZ9 A;  1CKM A;  2E2D C;  4A3E G;  1SMY D;  2PQE A;  3I2Z A;  2VB2 X;  1PYW D;  2JA8 G;  1PH1 A;  4BY1 B;  1MI2 A;  2E75 C;  2XN9 C;  4DUY L;  2RBM A;  2JE6 I;  4EQN A;  4IUN A;  4DK1 A;  1AEX A;  3OWE B;  1J8I A;  2MJ8 A;  4A3L H;  2F0Q A;  4A3I B;  5EJW A;  1HNX L;  4JI0 L;  4AH6 A;  1MKH A;  1OXS C;  4JW0 A;  3S16 H;  1II3 A;  1SNQ A;  2D9U A;  5JVH 3;  4B3R L;  3DHQ A;  1RTN A;  3CRL C;  2MO1 A;  2UU9 Q;  4B3S L;  4KKS A;  1EU4 A;  3N6R A;  2E2H B;  3LWE A;  4DR1 Q;  3J80 E;  3GTQ B;  1FGB D;  2VUM G;  3D6C A;  2K04 A;  3ULL A;  1YNJ D;  3U9O A;  2NVT H;  1LT3 D;  1Q46 A;  2ZTD A;  2DJF C;  5IGB A;  1YHB A;  4TSS A;  1PTO F;  2VQE L;  1F9R A;  5FO7 B;  4HR7 B;  1STH A;  4DV1 Q;  4JG2 A;  1Q1B A;  1IBL L;  1HCZ A;  3R2T A;  1PH7 A;  4ZLT F;  2JA5 H;  3T1H Q;  2DN8 A;  4PMB A;  1J9O A;  2ZXO A;  4CJ0 B;  2JYO A;  3RLN A;  1I4P A;  2MQH A;  2RCN A;  3NEL A;  3T56 B;  3DWP A;  4LF4 Q;  4DUZ L;  5FJ8 H;  3KF8 B;  4DV6 L;  4OON A;  3KLW A;  5T1G A;  2UUB L;  5EAY A;  3J81 i;  1PDQ A;  3NXW A;  1MSG A;  1TS5 A;  4A3K H;  4K2K A;  5KNC A;  5LHY 1;  4KI0 A;  2AKW B;  3HOY H;  1Z47 A;  1EY9 A;  1F9Q A;  4IAL A;  3C46 A;  2VB3 X;  2F0G A;  3KF6 A;  3P20 A;  4HTH A;  1UE1 A;  1V8Q A;  4KY5 A;  2L4N A;  3OIP A;  3TME A;  3I90 A;  3CME A;  3J81 c;  1YHQ A;  4DNR B;  2Q2U A;  3D6W A;  5COR A;  3PIO 3;  1MHW C;  3S1N B;  1JE5 A;  4PZ6 A;  4RWS C;  2Z6K C;  4HIM A;  2K50 A;  2WB1 B;  1J5E Q;  5GAG C;  2B2W C;  5AJ3 L;  2EY6 A;  1KDC A;  3OTO Q;  3IL8 A;  3TP6 A;  4BY1 G;  2FMC A;  1X3P A;  2LKV A;  2MP1 A;  2I5H A;  3Q0A A;  2CFM A;  1PV4 A;  2WFW A;  4DV3 L;  1Q3L A;  4U67 3;  2HD3 A;  2D5D A;  4BY7 H;  1SJH D;  1EOV A;  2SEB D;  2D62 A;  1YJW A;  1EYC A;  1K83 H;  1JWU D;  3S2H B;  2E2I H;  5T1I A;  4A3I G;  1OXU A;  4A3C G;  2BA0 A;  3I4L A;  5EKL A;  3F8T A;  2Z6K A;  1VQG A;  1EL0 A;  1EYD A;  5M9O A;  2B2W A;  4HN7 A;  4MHE A;  2KHS A;  4APV A;  1BBU A;  3BS1 A;  3J81 j;  2B8F A;  4G7H C;  4JBJ A;  5JPN C;  5IP9 H;  5LMN W;  4JV5 L;  1CFM A;  3CAM A;  3CCM A;  4X3S A;  1WTQ A;  1VQC A;  4KTA A;  1PXU A;  2OTJ A;  4B3T L;  4RA8 A;  4JI7 Q;  4Y7N H;  1TY2 A;  5D65 A;  1EZ6 A;  1AH9 A;  1A2U A;  1PH9 A;  2PMZ E;  4KHP L;  1G6P A;  1F2L A;  1O80 A;  1RL2 A;  5EBD A;  3GTM H;  5FO8 B;  2QEX A;  2KQ3 A;  3I4M H;  4R1J A;  5LL6 X;  1IBK L;  3A5U A;  3PMF A;  4F7X A;  1SYB A;  5CYU A;  2X6G A;  1HA6 A;  1SE8 A;  4ZAI A;  1HQM C;  3PIO A;  3HOW B;  3I56 A;  2KBN A;  1EIG A;  1TU2 B;  4WOR A;  3S1R B;  2L15 A;  2WKC A;  3W5O A;  1WTO A;  2K5V A;  1CZG A;  1A63 A;  2GN5 A;  3GTG B;  2R92 B;  4QF4 A;  3SK4 A;  4GLA C;  2ZJQ A;  2LMC B;  1PFS A;  4JBW A;  2ZM6 L;  2GVB A;  3PCO B;  5IT9 c;  3VR2 A;  3F2D A;  3ND9 A;  1K8G A;  3T16 A;  3PUX A;  4LFB Q;  5JEA G;  3PUZ A;  2F0D A;  5EKI A;  1GOZ A;  4QJF A;  5IE8 A;  4EX5 A;  4RFB A;  5GAH C;  2UUC L;  3V2T A;  2WB1 G;  3T51 B;  3CC4 A;  2A74 C;  4L63 B;  2UUA L;  1Q8K A;  4DR6 Q;  4YCV A;  4DV2 Q;  1F9S A;  1E2V A;  3KLR A;  2FJ2 A;  1EY8 A;  3PQI A;  1O78 A;  1S5F D;  4UAI A;  4GZY C;  2PO4 A;  2F0T A;  4C2M H;  1G2S A;  4A3E H;  1PH5 A;  1SYG A;  3Q6S A;  2EJG C;  2EJF C;  2XRS D;  2JA8 H;  3UI2 A;  1UE5 A;  4IUT A;  3S1M B;  4KY6 A;  1IKL A;  4DKA C;  3A7A B;  3PO2 B;  4P72 A;  4LFA L;  5FOB B;  5M5Y H;  3QIA A;  3CMA A;  2PQA B;  1PRT B;  3D8G A;  1TWF B;  3R3O A;  5ELC A;  2BDO A;  4GOP C;  5A2Q E;  1D5X C;  3RNU A;  2HHH L;  2EYF A;  1H9R A;  1VQD A;  2RDF A;  4V0B A;  1EOT A;  3L9A X;  1QCB D;  3ER0 A;  1QB5 D;  2Q8R E;  1A6X A;  2HIX A;  3ERQ A;  3TN2 A;  4ZKB B;  3DLL A;  2MO0 A;  2AWN A;  4EGV A;  3IAY A;  3UDF A;  4R4T A;  4DV0 L;  1NR2 A;  1HZA A;  3G48 A;  5M3F B;  1K3R A;  4DR5 L;  4KLK A;  2VUM H;  4X62 Q;  5J1Z A;  2M2L A;  4A4I A;  1N32 Q;  3U50 C;  4HED A;  3RZO B;  5K36 G;  5BR8 L;  4GOP A;  3OMG A;  2F4V Q;  1PFM A;  3MC0 B;  2J0T D;  1VDZ A;  1UEA B;  3J81 L;  1E2Z A;  4KK7 A;  1Z9F A;  4BA2 I;  1TWH B;  1W3S A;  4OX9 L;  1CQV A;  1YVC A;  4FXG C;  3HOW G;  3S2D H;  1YNN D;  4HSP A;  1AE3 A;  3NEN A;  3MFG A;  1D7Q A;  3MEF A;  4K14 A;  3U9S A;  2HUG A;  2PZW A;  1HQR D;  4J15 A;  1X6O A;  2A68 C;  4DV4 Q;  4K0K L;  1H9S A;  5DAU A;  1X3E A;  1KXL A;  2YV5 A;  1CI3 M;  2R7F A;  3TRE A;  2R92 G;  5JJZ A;  1IYU A;  1O7L A;  3I4O A;  5JAV A;  1IL8 A;  1JR0 D;  1DGS A;  4FYD A;  3MXN B;  1GHK A;  5LMN Q;  5CV5 A;  3A5Z B;  4DXG A;  2L1B A;  3PIP 3;  3EJI A;  2Q8I B;  4JOI A;  1JOQ A;  1BKB A;  3M4O B;  2LS0 1;  2CW0 C;  4BWG B;  3E9H A;  5E4X A;  2B2T C;  4YIJ A;  3FHW A;  3G7L A;  3NBH B;  1S72 A;  1Y1W B;  2J7Z A;  1VQK A;  1XNR L;  1RIP A;  2QEJ C;  2EYJ A;  2NVQ H;  3BU2 A;  3H94 A;  5CV7 A;  4IJL A;  3HS0 C;  4KN7 C;  1HFN A;  4IZ8 A;  1EYG A;  1LYL A;  4X64 Q;  1FD7 D;  4CKB A;  4BY1 H;  2A68 D;  3PO2 G;  2PW7 A;  3MWY W;  4B08 A;  5ISR A;  3VYR A;  2NZO A;  4DF7 A;  1A2T A;  1ICF B;  3BVG A;  3W3A A;  4A3I H;  1ML0 D;  2IJ0 A;  4KHZ A;  4A3C H;  4B9X A;  4LF5 Q;  1N34 Q;  4P74 A;  3TQY A;  1AW7 A;  2DJG C;  1DYQ A;  2AWO A;  1YHA A;  1EY0 A;  2CW0 D;  2I5M X;  2JSO A;  4IFD J;  4OXP A;  4DR7 L;  4DV5 L;  1IZ6 A;  1NSN S;  4ZCK A;  2NVX B;  3KBX A;  1HNW L;  1SE3 A;  5C3W A;  1CK1 A;  4OIK A;  3TS0 A;  2E2H H;  3C1E A;  5M3F G;  5C5M A;  5I2X A;  4DK6 C;  3GTQ H;  1YZ6 A;  2AUK A;  5A2Q L;  1CA6 A;  3CPF A;  1KDB A;  3AU7 A;  1PTO H;  3UDX A;  1BOS A;  1MBY A;  1NTG A;  5FLX c;  4LF9 Q;  3G6J B;  1S5E D;  4JI4 Q;  4S3S A;  4GNX A;  3VA7 A;  1M4V A;  3NTH A;  4DA2 A;  2QIL A;  4I7Z C;  2AQ3 B;  5IIF A;  4XIG S;  4K5X A;  3TRZ A;  3WOE A;  1C7Y A;  1FNW A;  2SOB A;  1TXY A;  4JPB W;  1QJO A;  1LTL A;  3PIP A;  5IGC A;  4H02 A;  3MAQ A;  4J6H A;  1K0R A;  2KCN A;  2YTX A;  5GAE C;  3P75 A;  2DNC A;  3NTI A;  4FXD A;  1UE7 A;  4PG3 A;  1VQ9 A;  5DNF A;  3DUZ A;  2K14 A;  2K5N A;  1AN8 A;  1WJJ A;  3I3C A;  1I4R A;  1RCV D;  2Z1C A;  1K8M A;  1G6Z A;  2MGS A;  3TDQ A;  3W1B A;  1D8L A;  1U4R A;  1Z7T A;  2B2V C;  4FNF A;  3FRP B;  1V1Q A;  4IFD G;  2WIN B;  4OIJ A;  2E74 C;  2A6H C;  3T4A C;  3BDC A;  4KV6 A;  4L8J A;  5JEA H;  3K0X A;  3S1N H;  5IGE A;  1Y1W G;  1IW7 C;  3S14 B;  2ZXP A;  1B3A A;  2K5D A;  4GLX A;  3LGJ A;  3VR6 A;  4L5S A;  4LF7 Q;  4XYQ A;  3CQZ B;  3KOJ A;  3GTK B;  5D3I B;  5BN4 A;  1JOK A;  2WB1 E;  4IUP A;  2A8V A;  3KF6 B;  1I3Q H;  3M4P A;  1OO9 B;  3T1Y Q;  2B2V A;  1WCM B;  3GP7 A;  1EFI D;  3UE1 A;  4FF4 A;  1HNZ L;  2ATW A;  4B3M L;  2NZH A;  1SNP A;  1XNQ L;  3S2H H;  4GKK L;  3EBE A;  1SXT A;  5KGU A;  4DUY Q;  2Z8L A;  1L1O C;  2F03 A;  5IWA L;  2HDL A;  2BA1 A;  5BN3 A;  3NEM A;  3CC2 A;  2EYM A;  1KDA A;  1HNX Q;  4JI0 Q;  1LTI D;  4LFC L;  3Q23 A;  1K8A C;  4B3R Q;  4AQY L;  2V4D A;  4G4K A;  2RA4 A;  1TY0 A;  2DGY A;  1F2M A;  4B3S Q;  3EVQ A;  3H6M A;  3BZK A;  1RKN A;  2B2Y C;  1Y8O B;  4OWX B;  3K81 C;  4K2L A;  4DNT B;  1LTA D;  1L1O A;  1XMO L;  3PV0 A;  1X54 A;  5C4X B;  2BCO A;  1LO5 D;  3CCE A;  1VQ5 A;  1I5F A;  3K6O A;  2WP8 J;  2VQE Q;  3GTO B;  5K36 H;  2IY5 B;  2EQS A;  3TEH B;  2DY7 A;  1IBL Q;  3D31 A;  1K73 C;  3NBI A;  2OEO A;  1TR5 A;  4IPD A;  2N8N A;  3D3R A;  3HOW H;  2B2Y A;  1WI5 A;  1CZW A;  2XGT A;  3UDI A;  1FNU A;  2PZU A;  1KIX A;  4DUZ Q;  3Q24 A;  3LX0 A;  3H3V C;  2QKI C;  4DV6 Q;  3OOC A;  3A0J A;  5CBE E;  2Q2I A;  1NE3 A;  4GN3 B;  2UUB Q;  1H9K A;  2VL6 A;  3ONA B;  3GTG H;  2R92 H;  3I55 A;  5AFW A;  2A69 C;  1CSQ A;  4YWL A;  1MJC A;  3J7Y W;  1YNJ C;  4N9T A;  1GUW A;  3CCU A;  2JN4 A;  1I4Q A;  1ENF A;  4RG1 A;  2XWB B;  3PO3 B;  1BXT A;  3GV6 A;  3LNN A;  4IPH A;  3D0F A;  3CCS A;  2A6E D;  1ENA A;  3NTK A;  3HOV B;  1BO0 A;  2DNE A;  1C4Q A;  2OQK A;  1JMC A;  2JK8 A;  2K32 A;  3V05 A;  3OSO A;  3AYH B;  1WCM G;  3S1Q B;  1VQA A;  1ESR A;  1GD7 A;  4IJH A;  3SK8 A;  1LUZ A;  3X3M A;  1JJ2 A;  4HIK A;  3K59 A;  3O13 A;  4IPC A;  4DV3 Q;  3S1M H;  4NXN L;  1SJE D;  1IBM L;  2RCF A;  3PO2 H;  1FJG Q;  5FLX L;  1PA6 A;  2A69 D;  2PZT A;  2M00 A;  4ZUJ A;  1LT4 D;  3M9B A;  2FMM A;  1JJG A;  1L0W A;  4X6A H;  4K5W A;  3CPW A;  5CBA E;  1TWF H;  2BDN A;  4IO9 A;  2IPK D;  4CJ2 C;  2SNS A;  4R8I A;  2EOT A;  4X66 L;  4AIM A;  1KTK A;  3DWQ A;  1KRT A;  1KL9 A;  3KJP A;  1NY4 A;  2KHI A;  3VYS A;  4RH6 A;  4XYO A;  4CDC C;  3M7G A;  3J7Z C;  5I4D A;  5K5P A;  3C2P A;  4WJ3 M;  5M3M B;  1CKO A;  1I50 B;  2F0J A;  1V1P A;  1WOC A;  2K33 A;  4LWC A;  3HOU B;  4TKO B;  5M3F H;  1VQP A;  5C4X G;  5JJL A;  1SRO A;  4B3T Q;  4GS3 A;  3AFQ A;  1TQO A;  2JA6 B;  1JB7 A;  3ULP A;  3CCJ A;  3OW2 A;  2BH2 A;  3RZO H;  3NWS A;  1STY A;  4XT3 B;  1G91 A;  1CT1 D;  2K1B A;  4GKJ L;  2EE1 A;  1RF2 D;  3PUY A;  3T53 B;  1BCP C;  5KND A;  5CV8 A;  1TWG H;  4IQZ A;  3CCQ A;  1IBK Q;  1DOM A;  3FPP A;  5IGF A;  1B2T A;  3L2P A;  1QZH A;  1CUK A;  2TSS A;  4L5Q A;  2D2C C;  1X65 A;  2EY5 A;  5HUR A;  3S15 H;  3VYU A;  4J8Q A;  3SR1 A;  3SVM A;  4HSV A;  5EPL A;  1WD1 A;  5I2Y A;  4GOP B;  2H4O A;  2NTS A;  1V9P A;  2RKS A;  5E4W C;  1MD2 D;  3CCR A;  1STB A;  4PZ8 A;  2ZM6 Q;  2JQO A;  3M4O H;  2EDG A;  3PO3 G;  1EIY B;  3Q22 A;  4A3J B;  4IFD H;  2L12 A;  2MPM A;  4KD3 A;  3G4S A;  3HOV G;  3D4W A;  1D5Z C;  1Q86 C;  1H9S B;  3FMC A;  3KUP A;  3TP5 A;  1BNZ A;  1VQ7 A;  2OTL A;  2UUC Q;  1DD2 A;  4JVZ A;  1Y1W H;  4DXF A;  2UUA Q;  2Z4I A;  2BH8 A;  1BCP D;  3SDZ A;  4A3D B;  4QMG A;  1RHP A;  2PPB C;  2R7D A;  1NCV A;  3HKZ E;  2AHO B;  4JI2 L;  2K7V A;  1GM5 A;  3ND8 A;  4A3F B;  1JWS D;  4PV1 C;  4GN4 B;  1TII D;  3U4Z A;  1S5C D;  1K3B C;  3VR5 A;  4FF1 A;  1AZQ A;  3E0E A;  3JAM E;  1PYB A;  2I07 B;  2Y0S E;  1DOL A;  1HR0 L;  4EQ5 A;  1K28 A;  4DAV A;  3K57 A;  4DR3 L;  2F0L A;  4LFA Q;  1ROD A;  1EIH A;  4E6I A;  4FXK C;  3TZU A;  2Q2H A;  2C9O A;  1EWI A;  3A8I E;  2PI2 A;  1ZEQ X;  2NWG A;  3GD7 A;  4RGO S;  5G3L D;  1FR3 A;  4GN5 A;  3RD4 A;  4NW2 A;  2YTY A;  2EXZ A;  4QB4 A;  4LF6 Q;  1L2F A;  4ZK9 B;  3T1H L;  2HQE A;  2HHH Q;  2OF1 A;  1BDO A;  3J80 L;  5M3M G;  2L0C A;  4JI6 L;  3BDL A;  5IGD A;  3HOU G;  1A8V A;  3I8Z A;  1GVP A;  1EU3 A;  2JA6 G;  2MNA A;  3CU7 A;  1CSP A;  3RUZ A;  4ABN A;  1E24 A;  4DR4 L;  2DY8 A;  2RHQ B;  4DR5 Q;  4UP7 A;  4LF8 L;  5IYD G;  1HHV A;  1Q1E A;  5IYC G;  1I94 L;  4DAY A;  3CC7 A;  1Y1V B;  1LT5 D;  1NAP A;  1U9R A;  1H9M A;  3A8K E;  3N52 A;  4P2C B;  3OWF A;  5BR8 Q;  1X32 A;  1NBW A;  1SND A;  2YYZ A;  3GQB A;  2NUC A;  4JI3 L;  1MIU A;  1CKN A;  1U4L A;  3OW7 A;  5IOC A;  1YIJ A;  4IUR A;  4DR2 L;  1R4P B;  2E76 C;  1TWA B;  1XYI A;  1LAB A;  3RN5 A;  1TWC B;  2VXW A;  3WDN A;  4O42 A;  1VS0 A;  5ELE A;  2YU9 H;  3HRZ C;  3WOF A;  2X69 A;  2PCF B;  4HCS A;  4GNX B;  4OEL B;  1E1O A;  3OTO L;  3TS2 A;  1PTO C;  4K0K Q;  3RZD B;  5C4J B;  4ZUI A;  1HZC A;  2B63 B;  1SNM A;  3EA6 A;  2F0V A;  2XNA C;  2JEA I;  2ZTE A;  3R93 A;  4RAU C;  1EUJ A;  2XRQ D;  4A3J G;  4CKE A;  2WAQ B;  3TP7 A;  1LTG D;  1QVF A;  1JOO A;  1Y69 U;  5HY6 A;  1ET9 A;  2B29 A;  3A56 A;  3S14 H;  3MEH A;  1XJV A;  1HTL D;  1B3Q A;  1L0X B;  2K03 A;  4OEM B;  4IUQ A;  4RCO A;  4A3D G;  1UEB A;  2N55 A;  5IGG A;  2L5T A;  3CQZ H;  3GTK H;  3K5O A;  1Q81 C;  1XNR Q;  4A3F G;  1YNN C;  1M90 C;  3S16 B;  1K8O A;  4K6L A;  2HT1 A;  3HEJ A;  4X3K A;  5CMD A;  1IYJ B;  1X3F A;  1PRT F;  1BVS A;  1FL0 A;  1SMX A;  1WCM H;  1ESF A;  1HUN A;  1JE4 A;  1SYC A;  1YBY A;  1HRJ A;  1PTO D;  1R4Q B;  2HQL A;  2CHB D;  1RD9 D;  3K5M A;  4RHS A;  4KMU C;  2WAC A;  2R7Z B;  5DEH A;  3PF4 A;  3I91 A;  2K5Q A;  1CTM A;  2KUM A;  3CRK C;  3S9W A;  3JAM L;  3A54 A;  3NSW A;  5C3E B;  2R93 B;  2RHS B;  5LMU Q;  5IT9 E;  3KLS A;  4DV5 Q;  2SDF A;  4HJ9 A;  3GTL B;  4PZ7 A;  4LNQ A;  4YY3 Q;  1G2T A;  1D6E C;  4UHV A;  3M4Q A;  4R4Q A;  2F0N A;  1DCZ A;  1TVX A;  4YHH L;  1B70 B;  1KNA A;  1WTW A;  1VQH A;  5C4X H;  1Y1V G;  3W2D A;  1HA5 A;  5GQO A;  1B7Y B;  3MFY A;  4I7A A;  1BR9 A;  1WTX A;  4O1N A;  3Q8D A;  1HTP A;  2FFK B;  2F0I A;  1KAA A;  4ULL A;  3X3N A;  1QNK A;  3GTO H;  5M5W B;  1C48 A;  3U4V A;  1LAC A;  2Z6B A;  3OMC A;  1FNV A;  3HP3 A;  3URY A;  4OO1 G;  4BBS B;  1KLG D;  1YJ9 A;  5IYB G;  3K80 C;  1AP0 A;  1N8R C;  4Y52 H;  1IKM A;  2EIF A;  4DK3 C;  1QG7 A;  4A76 A;  3F2B A;  1L1O B;  4QQB X;  3SHL A;  2IT1 A;  4CDD C;  4DR6 L;  1T9H A;  3KDF A;  3NK9 A;  3RN2 A;  1PH6 A;  1HXY D;  1SLJ A;  3DM1 A;  3I4N B;  2NN6 G;  3HKZ B;  3C1F A;  1X3Q A;  3E6Z X;  1KC8 C;  4PMW A;  2WAQ G;  4F88 A;  4WFN 3;  5DLQ E;  5JOB A;  5BN5 A;  2CQA A;  2Y0S B;  1ZKO A;  3PO3 H;  1F9P A;  5TSS A;  4FF2 A;  4ME3 A;  2CWA A;  2KEC A;  3P7J A;  2EY1 A;  2YTV A;  2JP1 A;  4YWK A;  1X55 A;  3HOV H;  3M7N A;  2LXK A;  3K7U C;  4CKC A;  3MA2 B;  1VMP A;  2B2T A;  4ALP A;  3ITP A;  3L3O C;  4CHT B;  4MIU A;  3S1Q H;  2F0P A;  3HOZ B;  5M5X B;  2FHT A;  2RDG A;  1B4O A;  2EJM A;  2QGQ A;  2L55 A;  1S3O A;  4NMZ A;  4P75 A;  1Q12 A;  1AFP A;  3H91 A;  1HNZ Q;  5EKK A;  4C3J B;  5C44 B;  4B3M Q;  3K0Y A;  2R7Z G;  4GKK Q;  2AQ2 B;  5KYI A;  4Y7N B;  1KLU D;  1K9M C;  2ID0 A;  3QOJ A;  1WTV A;  1N32 L;  4GLV B;  4ZQ3 A;  4A3G B;  5C3E G;  1EY7 A;  5IWA Q;  3NE5 B;  1LT6 D;  2R93 G;  2EVB A;  1PHJ A;  3GTJ B;  3I73 A;  2IX3 A;  2OWO A;  4KHV A;  4LFC Q;  3I72 A;  4A3B B;  5D14 A;  4KD4 A;  2Z9H A;  3K7A B;  5M3M H;  3PF5 A;  5KNB A;  3ERS X;  1SYE A;  3RLF A;  3HOU H;  1V43 A;  2KEN A;  1ET6 A;  3MXP A;  3E9I A;  4HID A;  3E5S A;  1EWC A;  4JC0 A;  5EPK A;  1PFB A;  2JA6 H;  2CKZ B;  5ELO A;  4XDX A;  4H0L C;  1R9T B;  1ZYR C;  1N33 L;  4PQX A;  1RDP D;  3K58 A;  1CHP D;  2XSC A;  4BBS G;  4IFD I;  4C56 C;  5IYC H;  4HJA A;  5IYD H;  5LMN L;  2VQF Q;  3PUW A;  1UUP A;  2C35 B;  1S4Z A;  4JI8 L;  5KEE A;  1LM0 A;  4JI5 L;  3DEP A;  3PUV A;  2VW9 A;  1V1P B;  2RSN A;  2UXC L;  4X65 Q;  1ASZ A;  3D4R A;  3I4N G;  4POG A;  4A93 B;  3HKZ G;  2WV6 D;  5CV6 A;  1OXX K;  2K52 A;  2G9D A;  1XTD A;  5GAD C;  4OHJ A;  4JI1 L;  3MXG A;  5ELB A;  3OIQ A;  1SE4 A;  5I6Y A;  3ERO A;  3E3X A;  1VQL A;  1P8L A;  1VQO A;  1Y8N B;  4R9W A;  2F0E A;  3RR5 A;  4EQO A;  3FDT A;  2K6A A;  2Y0S G;  2R61 A;  4PMC A;  4A3E B;  4WJ4 A;  3IRB A;  3S17 B;  4A3J H;  4C1N K;  5C0X J;  1ZYR D;  3BZC A;  1VQ6 A;  1NMF A;  2OT2 A;  1EWH A;  3EN2 A;  3M4Y A;  1SBB B;  1EQV A;  3CF5 A;  1S5D D;  1B1Z A;  4FDB A;  4A3D H;  1HJP A;  3HOZ G;  2F4I A;  1JOR A;  1A3T A;  4A3F H;  2XWJ B;  5E3F A;  4FP5 D;  4QIW B;  4DV7 L;  5EGT A;  2EYP A;  3C3L A;  1BCP B;  4QUC A;  4NXM L;  4C3J G;  2HDM A;  5C44 G;  2E2J B;  3HG9 A;  5KYL A;  1D2B A;  2XIW A;  3MXU A;  2P5Z X;  1I6H B;  1FVI A;  5IP7 G;  1T5E A;  2EYO A;  4NKL A;  4A3G G;  4O0A A;  2K5W A;  3NHH A;  1Q82 C;  1KHI A;  2IWH A;  5C4H A;  1LTB D;  2UXD L;  1B8A A;  4P71 A;  3KFU A;  3J80 i;  1SFO B;  1N36 L;  3VR4 A;  2JA7 B;  4A3B G;  5F2D A;  3HFZ B;  4L6T B;  1ZXT A;  2A6E C;  1ICW A;  2E5L L;  4X66 Q;  3MTS A;  1QOH A;  2RQX A;  1DXM A;  2B2U C;  2F1M A;  1VQI A;  2KA7 A;  4U68 A;  3SE0 A;  2O4X A;  2IHF A;  5ELF A;  1B9N A;  1ASY A;  5C0X G;  3J80 c;  2XTI A;  1HUM A;  1QZG A;  1WTH A;  3PSI A;  2PNR C;  3BVM A;  2IX1 A;  1EEI D;  2PW5 A;  3K8A A;  1Y1V H;  4HCE A;  1XWE A;  3S1R H;  2KCM A;  1LTT D;  3OHX C;  1VQJ A;  1SE2 A;  3T13 A;  1VQM A;  3QOL A;  4OO1 H;  2LY7 A;  1RJT A;  4GKJ Q;  1TWA H;  5IYB H;  4JYA L;  1TWC H;  2KCC A;  3GO5 A;  4A93 G;  1SNC A;  1VCI A;  2M9V A;  1M8A A;  4WRD A;  4IPG A;  1PVO A;  4RHR A;  1K0S A;  3DXJ C;  4DAY B;  2UXB L;  4EQP A;  3RZD H;  2F0K A;  2LXJ A;  5C4J H;  1IL2 A;  3WWV A;  1QVC A;  4XQJ A;  2NN6 H;  3T1Y L;  5NUC A;  1CKN B;  5IY0 A;  5AJ3 Q;  2ICI A;  4ME5 A;  2Q8T A;  3STB D;  1Q8I A;  2RSO A;  2D0O A;  4M1U B;  3SK6 A;  4JK1 C;  2VS1 A;  1EZ8 A;  3NQT A;  1IHZ A;  5C3X A;  4C3H B;  3M85 A;  3R8B A;  3CP0 A;  2G9H D;  4F87 A;  1G8Z D;  2WAQ E;  2VNU D;  4HIO A;  4BA1 I;  3NPP A;  4O2D A;  3H0G B;  1NJI C;  2N3S A;  3HOX B;  3UDG A;  4UP9 A;  1GUS A;  4UP8 A;  3KYH C;  1XMQ L;  2OCE A;  4C3I B;  4CJ1 B;  3B6Y A;  4JI2 Q;  1WTR A;  3JC6 6;  3AEV A;  1IYV A;  1SAP A;  5H1S E;  4UY8 C;  3ZJY C;  1I4X A;  1ENC A;  2B3G A;  4YCW A;  4JV5 Q;  2CWP A;  4BS9 A;  2PNH A;  3JAM i;  1GUO A;  2R7Z H;  3FKI B;  1NNX A;  4M8A A;  4OGQ C;  1PTO B;  3VR3 A;  4XQQ A;  1HR0 Q;  1GXD C;  3KK7 A;  3CCL A;  3FP9 A;  2JA7 G;  4DR3 Q;  1HZB A;  5D3D A;  5C3E H;  3TP8 A;  1Y14 B;  2DUD A;  2EYL A;  2R93 H;  2LSS A;  1AZP A;  3J7A V;  5C4Z A;  4KHP Q;  4L5R C;  1G51 A;  3BJU A;  2IHE A;  2NTT A;  1JB3 A;  2VY3 A;  3GTL H;  1NR4 A;  1VQB A;  4EVO A;  3S24 A;  3JAM c;  2BE5 C;  1TWH H;  5J39 A;  1O7I A;  1OTC A;  1E3P A;  1ONL A;  4H7B A;  4JI6 Q;  1EQT A;  1NMG A;  4FVM A;  1PMR A;  1HFG A;  3A74 A;  4OWT B;  5EPJ A;  1LV9 A;  3UE0 A;  2F3W A;  1QVG A;  3ICE A;  3MHB A;  4DNI A;  4DR4 Q;  1S40 A;  3CKI B;  1EEF D;  4LF8 Q;  4G7O C;  5M5W H;  1JCK B;  1I94 Q;  5I9O A;  4BBS H;  3GTP B;  2N78 A;  4NPS A;  1KD1 C;  4CGY B;  4JI3 Q;  5ELN A;  1A3V A;  4YWM A;  1PH2 A;  2FXQ A;  4DR2 Q;  3TBI B;  4A3M B;  4IUU A;  1QE6 A;  4ILW A;  1PZJ D;  2NVY B;  4ODG A;  1D1K A;  3FEW X;  5KRU A;  3DWA A;  3K5N A;  1TS2 A;  3I4N H;  5FKA C;  2C5C A;  1CQF A;  3SK5 A;  4MTK A;  4CDF C;  5A35 A;  3KLS X;  4LUZ A;  4RGT A;  2JJQ A;  1SN8 A;  2G5D A;  2BE5 D;  1QUQ A;  2ALY B;  2IL8 A;  1E1T A;  1MJE A;  2HCC A;  3BYT B;  1IXR A;  5C5L A;  5DM7 3;  1YJN A;  3BG3 A;  5FO9 B;  1A15 A;  1I3Q B;  1VQ8 A;  2UU9 L;  4V19 0;  3F1Z A;  4C3H G;  4ZRZ A;  1EYA A;  2SNM A;  4B9W A;  1JQY D;  1FJG L;  2LFN A;  4FO2 A;  2K5H A;  1NUC A;  4DR1 L;  1VF5 C;  3KDF B;  4Q5V A;  3H0G G;  4L5T A;  3IKJ A;  1GKH A;  3HOX G;  1SDF A;  2NBF A;  2JA9 A;  2KOL A;  2H1E A;  3EQL C;  3BVZ A;  1KRS A;  2I5L X;  1TS3 A;  2HCI A;  1EQQ A;  5COY A;  1V1O A;  4C3I G;  5I6W A;  4DV1 L;  2F0U A;  2QDL A;  3HOZ H;  3I70 A;  4XQN A;  5M5X H;  3HGB A;  5JEA J;  4Q0F A;  2NVX H;  1SEB D;  4C3J H;  4POF A;  5C44 H;  4A75 A;  5JJK A;  3ULJ A;  3FKI G;  4Z9C B;  4LF4 L;  1P16 A;  4AYB B;  5IP7 H;  3H3V H;  1GUN A;  3J81 E;  4JBM A;  4LUO A;  3M3Y B;  4A3G H;  4K5V A;  2Z0S A;  4DV0 Q;  2RF4 A;  1WD0 A;  4DAP A;  1Q90 A;  3QR8 A;  3KJO A;  3GTJ H;  2I46 A;  1VQ4 A;  2BOS A;  4N8X 1;  4BBR B;  1BQQ T;  4HJ7 A;  2JXM B;  5JJI A;  4A3B H;  2F3V A;  4ZKC B;  3K7A H;  4TVA B;  3U58 A;  4H44 C;  1M1K C;  4PNY A;  3QWN A;  4X3U A;  1LLR D;  4R4O A;  1AE2 A;  1U5K A;  3V96 A;  4OX9 Q;  3FPU B;  4RKL A;  1JIC A;  2F0O A;  5C0X H;  4YHH Q;  1R9T H;  1J5E L;  4MZ9 A;  2ES2 A;  3HKS A;  1JJC B;  1I4H A;  3VDY A;  4J1M A;  4IN3 A;  2VZA A;  3NQI A;  2Z4H A;  4RGN A;  1D5M C;  2FIN B;  3DMU A;  3GV3 A;  2CVR A;  4A3M G;  1STE A;  1B44 D;  2EPB A;  1SNO A;  2F0M A;  1X9N A;  1JWM D;  1CM9 A;  1JT8 A;  4A93 H;  5HGQ A;  5FLM G;  4HMJ A;  1DOK A;  5ELD A;  1EY4 A;  1YI2 A;  2EYH A;  4BXX G;  1ILQ A;  1DM0 B;  2ZXR A;  3NP8 A;  4ID6 A;  3K5L A;  4P73 A;  4DPG A;  3S17 H;  1E0B A;  3QJY A;  3GDE A;  1GHJ A;  3VYT A;  4JI7 L;  1UAP A;  1OXT A;  1C0A A;  2ENB A;  3HZX A;  3AMU A;  4XXE A;  1UNS A;  1YNX A;  2NVT B;  3KF8 A;  4LF6 L;  4QCL A;  1HH2 P;  4NB3 A;  2HIV A;  3SGI A;  1F2Y A;  3CXC A;  4DK0 A;  3AB9 A;  2AQ1 B;  2E2J H;  2NZ1 D;  4QUF A;  3D4D A;  3OPO A;  4G7Z C;  2JEB I;  1I6H H;  2OQ0 A;  5LL6 S;  2JA5 B;  4LK1 C;  1SYF A;  4AYB G;  4F8M A;  1GUT A;  4QIW E;  4DR7 Q;  1I6V C;  3A55 A;  1HNW Q;  1B53 A;  1UE6 A;  3ZYY X;  4QY7 A;  4X3T A;  1TS4 A;  2CH4 A;  3TZD A;  4OO1 I;  1A62 A;  2MHV A;  1LTS D;  2KED A;  4MN3 A;  2E8G A;  1SFO H;  3MZ5 A;  4BBR G;  4CBV A;  1UWV A;  3IFT A;  2JA7 H;  4A3K B;  1DJR D;  4KJN A;  3DEO A;  4JOI C;  3HOY B;  3AFP A;  5JPM C;  2O5J C;  2ZJR A;  4LFB L;  3DM3 A;  1OXV A;  2K4K A;  1S5B D;  1W6J A;  1TWG B;  2NN6 I;  3L7Z C;  2A73 B;  2CH4 W;  3IFD A;  3NUC A;  4I65 A;  1WFQ A;  2ZTC A;  3S15 B;  4UDU C;  3BZD B;  1FGU A;  1C8C A;  4DV2 L;  5E1F A;  3E0J A;  2B63 G;  1N33 Q;  1YIT A;  2L11 A;  2PI2 E;  4LAA A;  2OXP A;  5C6A A;  3A8J E;  1LTR D;  1PZK D;  2WKD A;  5EQ0 A;  4JBK A;  4MTN A;  4JI8 Q;  1O7Y A;  2H5X A;  1X3G A;  1ILP A;  1T5X D;  4JI5 Q;  1B50 A;  2UXC Q;  2R3Z A;  1EY6 A;  1FYC A;  4XTC S;  1BF4 A;  3CHB D;  4BY7 B;  4A3L G;  2N49 A;  1K83 B;  1XPR A;  2E2I B;  4HJ5 A;  2F0H A;  3H15 A;  1E7Z A;  4CDE C;  1H9J A;  2B39 A;  1SSO A;  4KJO A;  5FK9 C;  4N9P A;  1MSH A;  1F2Z A;  4JI1 Q;  1EIF A;  3R2I A;  3CW2 C;  2I0Q A;  4QGU A;  1I4G A;  5KIX A;  2O2L D;  5J3B A;  1X56 A;  1DZ1 A;  1BBW A;  1GJX A;  1PLF A;  1STG A;  1XXG A;  5I9P A;  5L37 A;  4C3H H;  2IX0 A;  4DAM A;  2O5I C;  2XVS A;  1VF7 A;  1SRU A;  2A1A A;  2EZV A;  1H95 A;  4FF3 A;  1XNQ Q;  3H0G H;  2PMZ B;  4X62 L;  3HOX H;  4GNX C;  4HMI A;  1Z6H A;  4HAE A;  1Y8P B;  5CGK A;  1N9W A;  1PH3 A;  1PH8 A;  5LMU L;  1QIL A;  3MVV A;  4ZYS A;  2F4V L;  2QF7 A;  2QDB A;  4C3I H;  2NB0 A;  2IW3 A;  2ZT9 C;  2JA5 G;  3GTM B;  3QB3 A;  4R4C A;  4KY7 A;  4DV7 Q;  3OYY A;  4YY3 L;  5DM6 3;  3I4M B;  2ICE C;  4NXM Q;  3P1H A;  4KKT A;  1WVL A;  1XTC D;  4AQY Q;  2MFI A;  1I50 H;  3RMH A;  1VQN A;  4TQU S;  5FJ8 G;  1BBX C;  3FKI H;  4JCV E;  1PH4 A;  4MNO A;  4DV4 L;  3BYY B;  4IUV A;  4KKU A;  4YCU A;  2AMC B;  4UPA A;  4A3K G;  3G6E A;  5IT9 L;  2B8G A;  2UXD Q;  1XMO Q;  3HOY G;  4H13 C;  1EFW A;  4DU9 A;  1PRT C;  1N36 Q;  1KAW A;  4N8F A;  4R8N A;  4NP5 A;  3A7L A;  1W6K A;  4QL5 A;  2E5L Q;  4DN4 M;  1PYS B;  4IOA A;  4LJZ C;  4TRD A;  2ZJP A;  2YU9 B;  1XPU A;  3EIV A;  4DFA A;  1E22 A;  5J22 A;  2V1C C;  2KHJ A;  1SR3 A;  2D0P A;  1W2B A;  1STN A;  1EQR A;  4LMQ D;  4HJ8 A;  2R6G A;  4G57 A;  1HR0 W;  4DGZ A;  5GRO A;  2F0F A;  3GTP H;  2Q2T A;  4X64 L;  2PQA A;  3CD6 A;  4RMF A;  5CV4 A;  4C2M B;  5JVG 3;  5EBC A;  3EFX D;  4IOC A;  4BY7 G;  3NWT A;  1JC7 A;  4A3M H;  1GUG A;  3VA5 A;  1KAB A;  2JA8 B;  2KVM A;  1CHQ D;  2CQO A;  2NVY H;  4JYA Q;  2QA4 A;  2QW7 A;  1PRT D;  4LF5 L;  3LWU A;  1Q7Y C;  2X6L A;  1N34 L;  2EY2 A;  4XT1 B;  2F52 A;  5FLM H; 
#chains in the Genus database with same CATH homology
 2RHQ B;  4DR5 Q;  4UP7 A;  4LF8 L;  1BKB A;  5IYD G;  1Q1E A;  5H1S E;  5IYC G;  2UXB Q;  1I94 L;  3ZJY C;  4UY8 C;  3CC7 A;  4YCW A;  2B3G A;  4R4I A;  4JV5 Q;  4BXX H;  2CWP A;  3H3V I;  3E9H A;  2PNH A;  5IP9 G;  3JAM i;  5BR8 Q;  1NBW A;  3W1G A;  2R7Z H;  2ASB A;  2YYZ A;  4OWW B;  4JI3 L;  1MIU A;  1CKN A;  1HR0 Q;  3FHW A;  1YIJ A;  1C9O A;  2A19 A;  4DR2 L;  3CCL A;  3FP9 A;  3NBH B;  1S72 A;  2JA7 G;  4DR3 Q;  3CCV A;  1HZB A;  1VQK A;  1XNR L;  1RIP A;  5C3E H;  3RN5 A;  1Y14 B;  3PGZ A;  4LW1 A;  2DUD A;  2R93 H;  2LSS A;  1VS0 A;  3BU2 A;  2NVQ H;  1YEZ A;  2YU9 H;  4IJL A;  4NXN Q;  3RLO A;  4KHP Q;  4L5R C;  1EYG A;  1LYL A;  1G51 A;  4X64 Q;  3BJU A;  1IBM Q;  2IHE A;  4BY1 H;  4GNX B;  1KQS A;  4LF9 L;  3GTL H;  1QUQ B;  2VY3 A;  1E1O A;  3OTO L;  1VQB A;  4JI4 L;  3TS2 A;  3S24 A;  3JAM c;  4K0K Q;  1TWH H;  1VQF A;  1O7I A;  1OTC A;  1E3P A;  4JI6 Q;  3PO2 G;  1HZC A;  2F3I A;  2NZO A;  1NMG A;  1U0L A;  3I4M G;  3A74 A;  4OWT B;  4A3I H;  2JEA I;  2ZTE A;  5C0X I;  1XMQ Q;  4KHZ A;  2EXD A;  4A3C H;  3UE0 A;  1EUJ A;  4A3J G;  4LF5 Q;  1QVG A;  3ICE A;  1N34 Q;  4DNI A;  1A0I A;  4LUV A;  4P74 A;  1S40 A;  4DR4 Q;  3TQY A;  1QVF A;  4LF8 Q;  2AWO A;  5M5W H;  1YHA A;  5HY6 A;  1I94 Q;  2B29 A;  4BBS H;  3S14 H;  3STB C;  2CCZ A;  2I5M X;  3M3Y H;  1XJV A;  2N78 A;  4NPS A;  4IFD J;  3AQQ A;  4OXP A;  1KD1 C;  4DR7 L;  4DV5 L;  1IZ6 A;  4A3D G;  4AYB E;  1UEB A;  1G29 1;  5ELN A;  3F2C A;  2VQF L;  4YWM A;  1PH2 A;  4JI3 Q;  1HNW L;  2FXQ A;  3CQZ H;  4DR2 Q;  3GTK H;  3TS0 A;  2E2H H;  5M3F G;  1Q81 C;  1XNR Q;  4A3F G;  1M90 C;  1WYD A;  4BBR H;  4DK6 C;  3GTQ H;  1YZ6 A;  2HT1 A;  3G71 A;  3CPF A;  1IYJ B;  1X3F A;  1BVS A;  1FL0 A;  1SMX A;  1WCM H;  2KCT A;  3UDX A;  3I4N H;  4X65 L;  1NTG A;  1XPO A;  3J7A 5;  5FLX c;  4LF9 Q;  1YBY A;  4LUZ A;  4JI4 Q;  2JJQ A;  4GNX A;  2HQL A;  1SN8 A;  1QUQ A;  2ALY B;  1E1T A;  1MJE A;  3I7F A;  4XIG S;  1IXR A;  3TRZ A;  1C7Y A;  1YJN A;  2UU9 L;  1J6Q A;  1VQ8 A;  3L0O A;  1TXY A;  3F1Z A;  2K75 A;  1LTL A;  3PIP A;  4H02 A;  4LF7 L;  1K0R A;  1GO3 E;  1FJG L;  3PF4 A;  2YTX A;  2GVA A;  2K5H A;  5GAE C;  4DR1 L;  3KDF B;  5E7N A;  2B63 H;  3H0G G;  4L5T A;  1VQE A;  2RHS B;  1HZ9 A;  1CKM A;  1GKH A;  1UE7 A;  4PG3 A;  3HOX G;  4A3E G;  2JA9 A;  5LMU Q;  1VQ9 A;  2K14 A;  1KRS A;  2I5L X;  2K5N A;  3I2Z A;  2JA8 G;  1PH1 A;  4DV5 Q;  1WJJ A;  4HJ9 A;  1EQQ A;  4PZ7 A;  4LNQ A;  4YY3 Q;  4DUY L;  2JE6 I;  4DV1 L;  3M4Q A;  4R4Q A;  3HOZ H;  5M5X H;  3W1B A;  5JEA J;  1B70 B;  4YHH L;  4A3L H;  1D8L A;  1VQH A;  5C4X H;  1Y1V G;  5GQO A;  2NVX H;  1B7Y B;  1V1Q A;  4IFD G;  1HNX L;  4C3J H;  4POF A;  5C44 H;  3Q8D A;  1MKH A;  4AH6 A;  4A75 A;  1OXS C;  4JI0 L;  5JJK A;  3ULJ A;  3FKI G;  4LF4 L;  3S16 H;  3GTO H;  1P16 A;  3K0X A;  3U4V A;  5IP7 H;  3H3V H;  3S1N H;  4B3R L;  4OO1 G;  1Y1W G;  2MO1 A;  4JBM A;  4LUO A;  2UU9 Q;  4A3G H;  2Z0S A;  1YJ9 A;  4B3S L;  4DV0 Q;  5IYB G;  2RF4 A;  3K80 C;  4GLX A;  1N8R C;  4Y52 H;  3LGJ A;  4L5S A;  2EIF A;  4DK3 C;  4LF7 Q;  3KJO A;  3GTJ H;  3F2B A;  4A76 A;  3KOJ A;  1VQ4 A;  1L1O B;  4QQB X;  2IT1 A;  2WB1 E;  4DR1 Q;  2A8V A;  3KF6 B;  4HJ7 A;  2VUM G;  4DR6 L;  4A3B H;  1I3Q H;  1T9H A;  3M4P A;  3T1Y Q;  5JJI A;  3KDF A;  3ULL A;  3RN2 A;  1PH6 A;  2NVT H;  1SLJ A;  2ZTD A;  1Q46 A;  3K7A H;  3UE1 A;  2ATW A;  2NN6 G;  4TVA B;  3U58 A;  1HNZ L;  1M1K C;  4B3M L;  1YHB A;  2NZH A;  1XNQ L;  3S2H H;  4GKK L;  3EBE A;  2VQE L;  4R4O A;  4DUY Q;  4DV1 Q;  1AE2 A;  1KC8 C;  4JG2 A;  1L1O C;  1U5K A;  1Q1B A;  2WAQ G;  4PMW A;  1IBL L;  4OX9 Q;  5DLQ E;  1PH7 A;  4YHH Q;  1R9T H;  1J5E L;  5IWA L;  2JA5 H;  2BA1 A;  4MZ9 A;  2ES2 A;  3NEM A;  3T1H Q;  3CC2 A;  3HKS A;  1JJC B;  3RLN A;  1HNX Q;  3VDY A;  3PO3 H;  2MQH A;  2RCN A;  3NEL A;  4JI0 Q;  4ME3 A;  2CWA A;  4LF4 Q;  4LFC L;  4DUZ L;  2YTV A;  2VZA A;  4YWK A;  1X55 A;  3KF8 B;  5FJ8 H;  4OON A;  4DV6 L;  1K8A C;  3HOV H;  4AQY L;  2LXK A;  3M7N A;  4B3R Q;  3K7U C;  3KLW A;  4A3M G;  2UUB L;  5EAY A;  2DGY A;  3J81 i;  4ALP A;  4B3S Q;  4A3K H;  3BZK A;  4KI0 A;  2AKW B;  1X9N A;  3S1Q H;  1JT8 A;  3HOY H;  4A93 H;  1Z47 A;  4OWX B;  5HGQ A;  5FLM G;  3K81 C;  2QGQ A;  1L1O A;  1XMO L;  3PV0 A;  1X54 A;  1S3O A;  4P75 A;  3KF6 A;  1Q12 A;  1YI2 A;  1UE1 A;  3CCE A;  1VQ5 A;  4BXX G;  1I5F A;  1HNZ Q;  4B3M Q;  2WP8 J;  3CME A;  2R7Z G;  3J81 c;  1YHQ A;  4GKK Q;  2Q2U A;  2VQE Q;  2IY5 B;  2EQS A;  3TEH B;  1JE5 A;  1K9M C;  4PZ6 A;  2ID0 A;  1IBL Q;  2Z6K C;  4P73 A;  3D31 A;  4DPG A;  2K50 A;  4GLV B;  4HIM A;  1K73 C;  3HOU H;  3S17 H;  1N32 L;  5C3E G;  1J5E Q;  4IPD A;  5IWA Q;  5GAG C;  5AJ3 L;  2R93 G;  2N8N A;  1PHJ A;  3OTO Q;  3GDE A;  4JI7 L;  3HOW H;  4BY1 G;  1WI5 A;  1OXT A;  2XGT A;  3UDI A;  2OWO A;  1C0A A;  4LFC Q;  1KIX A;  4DUZ Q;  2I5H A;  2CFM A;  1PV4 A;  2WFW A;  4DV3 L;  4DV6 Q;  3A0J A;  1YNX A;  2Q2I A;  1NE3 A;  4GN3 B;  2UUB Q;  5M3M H;  3PF5 A;  4LF6 L;  4BY7 H;  1HH2 P;  1EOV A;  2VL6 A;  3ERS X;  2D62 A;  4NB3 A;  1K83 H;  2HIV A;  1V43 A;  3RLF A;  2KEN A;  3SGI A;  1YJW A;  2E2I H;  2R92 H;  3E9I A;  3I55 A;  3CXC A;  4HID A;  4A3I G;  3GTG H;  1CSQ A;  4YWL A;  1MJC A;  1OXU A;  4JC0 A;  4A3C G;  2JA6 H;  2CKZ B;  2E2J H;  2BA0 A;  5ELO A;  3CCU A;  3F8T A;  2JEB I;  1I6H H;  2Z6K A;  2OQ0 A;  1N33 L;  1VQG A;  4AYB G;  4DR7 Q;  4QIW E;  4RG1 A;  4BBS G;  4IFD I;  5IYD H;  5IYC H;  4HJA A;  4APV A;  5LMN L;  2VQF Q;  1HNW Q;  3PUW A;  1BBU A;  1UE6 A;  2C35 B;  4JI8 L;  3J81 j;  4QY7 A;  1LM0 A;  4JBJ A;  4JI5 L;  4IPH A;  3D0F A;  3CCS A;  5IP9 H;  4OO1 I;  3PUV A;  1A62 A;  5LMN W;  2VW9 A;  4JV5 L;  2UXC L;  2E8G A;  3CAM A;  2OQK A;  1SFO H;  3CCM A;  4BBR G;  1UWV A;  2JA7 H;  1JMC A;  2JK8 A;  4X65 Q;  1VQC A;  1ASZ A;  2OTJ A;  4B3T L;  3AYH B;  1WCM G;  4JOI C;  4JI7 Q;  1VQA A;  4Y7N H;  3I4N G;  4POG A;  3AFP A;  1GD7 A;  3HKZ G;  2ZJR A;  4LFB L;  3DM3 A;  1OXV A;  4IJH A;  1LUZ A;  2K4K A;  1OXX K;  2K52 A;  4HIK A;  1JJ2 A;  5GAD C;  1XTD A;  1AH9 A;  4IPC A;  4JI1 L;  4DV3 Q;  1PH9 A;  4NXN L;  3S1M H;  2PMZ E;  2NN6 I;  4KHP L;  3L7Z C;  1IBM L;  1VQL A;  3PO2 H;  1G6P A;  1P8L A;  1VQO A;  1FJG Q;  1PA6 A;  1RL2 A;  3GTM H;  3RR5 A;  2QEX A;  1WFQ A;  2ZTC A;  2Y0S G;  3I4M H;  3M9B A;  4R1J A;  1JJG A;  1FGU A;  1L0W A;  4X6A H;  3CPW A;  4DV2 L;  1IBK L;  4WJ4 A;  3A5U A;  3IRB A;  4A3J H;  1TWF H;  2B63 G;  5C0X J;  1N33 Q;  1YIT A;  2PI2 E;  3BZC A;  1SE8 A;  4IO9 A;  1NMF A;  3EN2 A;  1VQ6 A;  3PIO A;  3CF5 A;  4MTN A;  4X66 L;  2KBN A;  4JI8 Q;  4AIM A;  3I56 A;  4JBK A;  2H5X A;  1X3G A;  1KRT A;  4JI5 Q;  1KL9 A;  3KJP A;  4FDB A;  1NY4 A;  4A3D H;  2KHI A;  1HJP A;  3HOZ G;  2L15 A;  3J7Z C;  3W5O A;  2UXC Q;  4WJ3 M;  1CKO A;  2K5V A;  4XTC S;  1WOC A;  2N49 A;  4LWC A;  1XPR A;  4A3L G;  5M3F H;  5C4X G;  1VQP A;  4A3F H;  2GN5 A;  5JJL A;  4HJ5 A;  1SRO A;  4DV7 L;  4GLA C;  2ZJQ A;  1A63 A;  1PFS A;  4B3T Q;  4GS3 A;  4JBW A;  2ZM6 L;  2GVB A;  3AFQ A;  3PCO B;  5IT9 c;  3H15 A;  4NXM L;  1E7Z A;  3F2D A;  1K8G A;  5C44 G;  1JB7 A;  3PUX A;  4LFB Q;  3ULP A;  3CCJ A;  5JEA G;  3PUZ A;  3OW2 A;  2BH2 A;  4QJF A;  3RZO H;  1FVI A;  5IP7 G;  4JI1 Q;  1EIF A;  5IE8 A;  4EX5 A;  2UUC L;  5GAH C;  3CW2 C;  2I0Q A;  4QGU A;  2WB1 G;  4A3G G;  4O0A A;  1Q82 C;  3CC4 A;  1KHI A;  5J3B A;  4GKJ L;  1X56 A;  2UUA L;  3PUY A;  2UXD L;  1BBW A;  1B8A A;  1Q8K A;  4DR6 Q;  4YCV A;  4P71 A;  3KFU A;  4C3H H;  1TWG H;  3J80 i;  3CCQ A;  4DV2 Q;  2IX0 A;  4DAM A;  1IBK Q;  1SRU A;  1N36 L;  2A1A A;  4A3B G;  3L2P A;  1QZH A;  1CUK A;  1H95 A;  1XNQ Q;  4L5Q A;  3HFZ B;  3H0G H;  1X65 A;  4C2M H;  4X62 L;  3S15 H;  3HOX H;  4A3E H;  4X66 Q;  2E5L L;  4GNX C;  1PH5 A;  1VQI A;  4GOP B;  2JA8 H;  1PH3 A;  1N9W A;  1V9P A;  2IHF A;  1PH8 A;  1UE5 A;  5LMU L;  2F4V L;  1ASY A;  4DKA C;  4C3I H;  5C0X G;  4P72 A;  3J80 c;  2XTI A;  2JA5 G;  1QZG A;  3PSI A;  4LFA L;  4R4C A;  3CCR A;  4DV7 Q;  3OYY A;  4PZ8 A;  4YY3 L;  2IX1 A;  2ZM6 Q;  5M5Y H;  2JQO A;  3CMA A;  3K8A A;  1Y1V H;  3S1R H;  4NXM Q;  3PO3 G;  3M4O H;  1EIY B;  2PQA B;  4AQY Q;  2KCM A;  2MFI A;  1I50 H;  4GOP C;  3G4S A;  1VQN A;  4TQU S;  5FJ8 G;  3HOV G;  3RNU A;  1Q86 C;  3FKI H;  4JCV E;  1VQJ A;  4MNO A;  1PH4 A;  1VQ7 A;  2HHH L;  2OTL A;  1VQD A;  2UUC Q;  1VQM A;  4DV4 L;  4YCU A;  3ER0 A;  1Y1W H;  2AMC B;  4GKJ Q;  1TWA H;  4UPA A;  4A3K G;  2UUA Q;  3G6E A;  2UXD Q;  2HIX A;  1XMO Q;  2BH8 A;  5IYB H;  4JYA L;  1TWC H;  3GO5 A;  3DLL A;  2MO0 A;  1EFW A;  3HOY G;  4A93 G;  1VCI A;  2AWN A;  2R7D A;  3HKZ E;  2AHO B;  1N36 Q;  4JI2 L;  1KAW A;  4R4T A;  3UDF A;  4DV0 L;  4IPG A;  1GM5 A;  1HZA A;  3G48 A;  1PVO A;  4DAY B;  1K3R A;  4DR5 L;  2UXB L;  4KLK A;  2VUM H;  4GN4 B;  4QL5 A;  4X62 Q;  3U4Z A;  3RZD H;  2LXJ A;  5C4J H;  1IL2 A;  2E5L Q;  3WWV A;  1PYS B;  4IOA A;  1QVC A;  4A4I A;  3E0E A;  1PYB A;  1N32 Q;  3U50 C;  3T1Y L;  5K36 G;  1CKN B;  5BR8 L;  5IY0 A;  2Y0S E;  5AJ3 Q;  2ZJP A;  4GOP A;  1XPU A;  3STB D;  2F4V Q;  1HR0 L;  3EIV A;  4EQ5 A;  1E22 A;  2D0O A;  2V1C C;  2KHJ A;  4DR3 L;  1SR3 A;  2D0P A;  2VS1 A;  4LFA Q;  1W2B A;  1Z9F A;  1EQR A;  4BA2 I;  2Q2H A;  1W3S A;  2R6G A;  4HJ8 A;  1EWI A;  1HR0 W;  2PI2 A;  3M85 A;  4OX9 L;  1YVC A;  3GD7 A;  3HOW G;  3S2D H;  3CP0 A;  5GRO A;  3GTP H;  2Q2T A;  1AE3 A;  2VNU D;  2WAQ E;  3NEN A;  2PQA A;  2YTY A;  4GN5 A;  4BA1 I;  4X64 L;  4HIO A;  4LF6 Q;  1L2F A;  3MEF A;  3T1H L;  3CD6 A;  1D7Q A;  2HHH Q;  4J15 A;  4O2D A;  4RMF A;  1NJI C;  1X6O A;  5M3M G;  4DV4 Q;  2N3S A;  4IOC A;  4BY7 G;  4K0K L;  4JI6 L;  1KXL A;  1X3E A;  3UDG A;  2YV5 A;  3HOU G;  2R7F A;  4A3M H;  1A8V A;  3TRE A;  2R92 G;  4UP9 A;  1GVP A;  4UP8 A;  3KYH C;  3I4O A;  2CQO A;  2NVY H;  4JYA Q;  1DGS A;  2JA6 G;  3MXN B;  1XMQ L;  2OCE A;  2MNA A;  2QA4 A;  1CSP A;  3B6Y A;  3A5Z B;  4JI2 Q;  5LMN Q;  3JC6 6;  1Q7Y C;  1N34 L;  1E24 A;  4LF5 L;  3AEV A;  4DR4 L;  2F52 A;  4JOI A;  5FLM H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...