4K2LA

Crystal structure of staphylococcal nuclease variant delta+phs i92q at cryogenic temperature
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYQYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cavity hydration in proteins
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Thermonuclease
total genus 33
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2013-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4k2lA00
5IGCA 5I6YA 4K8IA 3E5SA 4F7XA 5IGEA 5ISRA 2F3WA 2EY5A 1EZ6A 5IGGA 1F2YA 2EYLA 1ENCA 1SNQA 2F3VA 4IALA 5C6AA 3SXHA 1EYCA 2F0OA 4RKLA 2F0QA 5HURA 3H6MA 1EQVA 2WACA 1SNPA 4RKBA 4NDXA 4OL7A 4WORA 3VA5A 2OEOA 4KHVA 4KY6A 4B9XA 4EQOA 1JOQA 3DHQA 5IODA 1SNMA 5C5MA 1STAA 2F0HA 3LX0A 1EYDA 1EZ8A 4KV6A 3TP7A 5C3XA 4KY5A 5I9OA 1RKNA 3EROA 2RBMA 3T16A 5CV7A 2LKVA 3DMUA 2SOBA 4N9TA 5J39A 3NHHA 3TP8A 1STNA 2PZWA 2EYMA 3NK9A 2F0EA 2RKSA 4KTAA 2F0VA 4K5XA 4PMBA 1NUCA 3SK6A 3P1HA 5IGBA 3D4WA 3OWFA 1SNCA 2F0DA 5DEHA 3RUZA 3NP8A 5IGDA 1KDAA 5J1ZA 3C1EA 1JOOA 1U9RA 4N9PA 1EY6A 2F0IA 4WRDA 2F0KA 3NQTA 4KD4A 4QF4A 5EKLA 1EY5A 1KABA 4NMZA 3QOJA 2F0MA 1SNOA 2EYOA 2M00A 3BDLA 3NXWA 3R3OA 2F0LA 4HMIA 4J6HA 4NKLA 4ODGA 4DFAA 3SK4A 4EQNA 5HGTA 4ME5A 5DAUA 4KD3A 1F2ZA 1AEXA 2PW7A 5CV4A 3PMFA 1TT2A 2PQEA 2F0FA 1EY0A 2EY2A 2KQ3A 2PYKA 2EYJA 1STYA 4PMCA 1EY8A 4K2KA 4KJNA 1A2UA 3P75A 1JORA 4KY7A 3OSOA 4H7BA 3D8GA 3EJIA 1II3A 3MXPA 4IZ8A 5KRUA 3MHBA 3TMEA 2HQEA 4KJOA 3SK5A 2F0WA 2PZUA 3QB3A 1KDBA 1A3TA 3MEHA 1TR5A 5NUCA 3TP6A 3TP5A 1SYDA 1KDCA 5EKKA 2KHSA 1SYFA 5CV8A 4NP5A 5I6WA 4K5WA 5CV6A 2RDFA 4ZUIA 3V2TA 2NUCA 5M9OA 1STGA 1A3VA 1TQOA 1A2TA 1SYGA 5E3FA 1JOKA 4K6DA 4DU9A 1EY4A 3NUCA 5CV5A 5IGFA 3S9WA 3HEJA 5JOBA 5CGKA 5J22A 1EY7A 3BDCA 5C4HA 2ENBA 4B9WA 4ID6A 1SYBA 3D4DA 4G57A 2EYPA 2EYFA 3C1FA 3MVVA 4J1MA 1EYAA 4ZQ3A 2F0UA 3SK8A 4E6IA 2F0JA 5JAVA 4PNYA 1KAAA 1F2MA 3SR1A 4EQPA 5IIFA 3EVQA 5KYIA 1ENAA 2F0GA 3U9OA 2EY6A 2SNSA 2PZTA 4K14A 4K2LA 2F0SA 5C5LA 2F0NA 3OMCA 5KEEA 4I65A 1STBA 1A3UA 4MIUA 1STHA 5CV9A 2EY1A 4F8MA 2EXZA 4QB4A 3SHLA 2F0PA 4IUNA 4K5VA 5IOCA 4R8NA 1NSNS 3QOLA 2O4XA 4HTHA 4DGZA 4EVOA 4K8JA 4QMGA 2EYHA 3HZXA 4S3SA 5C4ZA 4LAAA 5CC4A 4ZUJA 2OXPA 1SNDA 4TRDA 5E1FA 1EY9A 2QDBA 2PW5A 3MZ5A 4YIJA 5KGUA 4DF7A 3D6CA 4HMJA 1IHZA 5F2DA 5EGTA 2F0TA 3T13A 5C3WA 2SNMA 3OMGA 1SYEA 2OF1A 5K5PA 1SYCA 5KYLA 3ERQA 3ITPA 5KIXA 5I9PA 5CR3A
chains in the Genus database with same CATH superfamily
2IHEA 4YHHQ 3I4LA 1CKMA 2H1EA 3CXCA 1EZ6A 2E2JB 3A74A 2JP1A 4NPSA 3TS2A 1U0LA 1DGSA 4BY7B 1JCKB 2QF7A 2BH2A 1ZYRD 2XWJB 2IW3A 5M3FH 4OWWB 4H0LC 1SNMA 4A3IG 1PFNA 1DYQA 3K8AA 1Q81C 1RCVD 3PUVA 5C4XB 1B44D 1CSPA 1U5KA 4ALPA 4JI8Q 3K0XA 3A7LA 5IGBA 1EYGA 2F0DA 4GN5A 1SN8A 1SE3A 2E2IH 3NQTA 4KD4A 4C3JH 1N34Q 3H09A 5C4JB 1Q7YC 4P73A 4NKLA 5HGTA 3CF5A 3H0GB 2E2DC 2VQFQ 1KLGD 1KNAA 2R93B 2G9DA 1Q90A 4I7AA 3OHXC 1EY0A 2Y0SG 1O78A 1PXUA 2QCPX 1L0YB 2GVAA 5AFWA 2B2YC 3JAME 1WCMH 1HNZL 1HZ9A 1Y69U 4OX9L 1QJOA 4UP8A 4KJOA 3SGIA 1LTSD 1KDBA 4H44C 4JI5Q 3I3CA 4JOIC 1VQ9A 1O7LA 1OXVA 4IFDH 4XQNA 1IW7D 1HQMC 1C9OA 3HG9A 3HOUG 5IT9L 5C4HA 2JA6B 5EPJA 4G7OC 4JI5L 4BBRG 1HA5A 2EYFA 3RZOB 1F9RA 2QEJC 4WJ3M 4ZKCB 4GN3B 3VYSA 4DV2L 1G2SA 5KYIA 3EBEA 1ENAA 4IPDA 3VR5A 2SNSA 3AMUA 2F0NA 3GP7A 1X55A 3TEHB 2EY1A 5D3DA 4IUNA 1HHVA 1D8LA 4BY1G 3KFUA 1JJCB 2KCTA 2I5LX 1PRTD 2AUJD 1B1ZA 4JVZA 4JI1Q 2AUKA 1E2ZA 2YV5A 2NVQB 1FJGL 2J7ZA 4BA2I 1I4GA 1L0XB 3W3AA 3KDFA 4L5TA 4C3IH 4JW0A 4HJ7A 2JK8A 4GZYC 4X6AH 2B29A 5D3IB 1ENCA 4RKLA 2F0QA 2JSOA 4A3MB 4RKBA 1HUMA 1Q12A 2D9UA 2CFMA 1I4PA 2EPBA 3DM3A 4NB3A 2N78A 2IL8A 1EOTA 1JWMD 4N9TA 4RHSA 3J80c 3PF5A 2E8GA 1PYBA 3A5UA 1NTGA 1WTXA 3PO3H 4DV1L 3RUZA 5DEHA 1S5ED 4EQ5A 3NP8A 1MHWC 2MQHA 2LXKA 2A1AA 3J7AF 4AYBE 2D0OA 2KCCA 4JV5Q 4M8AA 3K5MA 4LF4L 4DXGA 1NMFA 3KOJA 3M85A 3DEOA 2PW7A 4LF6L 1G6PA 4JK1C 3NBHA 1QG7A 4DR5Q 2JA5H 2D5DA 4FF1A 1B7YB 4KJNA 5JPNC 2F3IA 1ONLA 4H7BA 2A6HC 4ZK9B 3ZYYX 1F9PA 1K8GA 4IZ8A 3J7ZC 1GJXA 4B3RQ 2PZUA 2B63G 2KVMA 4OEMB 1CT1D 1KLUD 2I5HA 3E9IA 4OXPA 1P16A 3I70A 3GTJH 1EL0A 4Z9CB 5BR8L 1CKNA 5IY0A 1U4RA 3HOUH 3HOYB 1TXYA 3P20A 3QO2A 1SYGA 2LFNA 2AQ2B 2WAQG 1I3QH 1B4OA 3S2DH 1ESRA 4A3DG 1MD2D 1PTOD 2AKWB 4LF9Q 2VXWA 3K58A 2LY7A 4ZQ3A 1Y8NB 1F2MA 1A8VA 1IYJB 3K5LA 2JJQA 1CKNB 1DM0B 2JA7H 1VQLA 4DR1L 5CV9A 1STHA 4P75A 2RHQB 2EE1A 3KLSX 3BZKA 4A93H 1KC8C 5IOCA 4IFDJ 2RVLA 5CC4A 4CDCC 1X9NA 5EQ0A 1NY4A 5E1FA 3IRBA 3Q23A 4HCEA 3OWEB 4JBKA 3DEPA 2HHHQ 3UDIA 1HTPA 1I50B 1CA6A 1PZKD 3MXUA 4K8IA 1Z7TA 4DV0L 1QZGA 1VF5C 1X6OA 4UP9A 1PH9A 4XXEA 3PUWA 3SE0A 4DK6C 2UXCL 2MO0A 3H6MA 1IBLL 1A62A 1X3GA 3OTOL 4LFAL 2ZT9C 2XTIA 3K7AH 4DK0A 1EZ8A 4L6TB 1V9PA 4HN7A 4ZAIA 5JVH3 2CWPA 4P71A 2R92B 2BDNA 5J39A 1K3RA 2F03A 1F9QA 1BCPD 1MI2A 4R4CA 2FHTA 2CVRA 2K75A 1I6VC 5ELCA 3D4WA 2DY8A 3D4RA 1AP0A 5I2YA 4OWXB 4XYQA 3I7FA 1IW7C 1DD2A 1OO9B 1IBKL 2RQXA 4J6HA 4OWTB 1Q46A 3KLWA 2OCEA 2F52A 1Z47A 3K5OA 2M2LA 4NXMQ 4FYDA 4JI6L 4C3HG 1CSQA 1LUZA 3G6JB 5EPLA 4BY1H 2PYKA 4HJ5A 4HIDA 4ZKBB 2WKDA 4DR5L 4JBMA 3M7GA 1V1QA 3J81i 2C9OA 1Y1VG 2JA8B 3RZOH 1FD7D 2EVBA 3HOWG 3M3YH 1BVSA 3GTOH 3MXNB 1NJIC 2RCNA 4DR6L 3PUXA 1I94L 4A3DH 5ELNA 1QNKA 2NUCA 3Q24A 4LFCL 4JI0Q 4DR2L 1YNJC 4A3LG 5EAYA 3S16H 3CC7A 4A3BH 3J7YW 4AH6A 3D4DA 1EIHA 3M4OB 5BN4A 3S1MB 3HOXG 4C2MB 4X3KA 4X65Q 1I5FA 4BXXH 1R9TH 2XGTA 2X6LA 4F8MA 2R92G 4QUCA 3CCLA 2Z9HA 1J5EQ 2RSOA 3N6RA 4OIKA 3OPOA 1S72A 3GTMH 1GUWA 1KHIA 1OXTA 4UAIA 2WB1G 3AFQA 2KEDA 3MEFA 4O42A 2R7ZG 1GM5A 2P5ZX 1KNEA 2R7ZH 4QCLA 3NSWA 1PH5A 1STEA 2E76C 3KDFB 4C3JB 3RMHA 3D3RA 3E5SA 3VYRA 3URYA 3I56A 5J3BA 4GNXB 4CJ1B 4DR7L 4MZ9A 5IP7G 2YU9H 1BBWA 2KA7A 5M5WH 3NBIA 2E75C 4FXKC 3DHQA 4JI3L 1I6HB 1Y8PB 3KLSA 1K8AC 3IAYA 3KBXA 4A3JB 4X66L 2OQ0A 4NXNL 4TKOB 4GLXA 2F0EA 4GNXA 1X3FA 3CP0A 3GTLB 3K59A 4R8IA 2DNEA 4H02A 2C35B 1WD0A 3EIVA 2I0QA 4YCWA 2I07B 1TWHH 3QOJA 3F2CA 3R2IA 5KNBA 1K8MA 3SK4A 3JAMi 1TS2A 2K32A 4JI4Q 3NE5B 4ZRZA 5CV4A 1YNJD 1ML0D 2E2IB 2KQ3A 1LTAD 4I7ZC 5C3EB 1NNXA 1EEID 4A3KG 1HPCA 2QKIC 3U9SA 4DR4L 4ULLA 1ZXTA 3P75A 1TS5A 1PYWD 1X32A 2HQEA 3IFDA 3OTOQ 1N32Q 5CV8A 4NP5A 1QILA 3E6ZX 2C5CA 1HNWQ 1EU4A 4YHHL 1X3PA 4MTNA 1K3BC 5CGKA 1XNRL 3MVVA 2KECA 1SE8A 4ZYSA 2AMCB 1XTCD 4A3GG 2A69C 2F0GA 1B9MA 4I65A 4LWCA 1YJWA 1PH1A 2VUMH 5IT9c 1PTOF 1QE6A 2UXDL 1NSNS 2WINB 3J7A5 3H3VC 2OTLA 3AB9A 4HMJA 1IHZA 2UUBQ 4DXFA 2AQ1B 1UE1A 3LGJA 3MEHA 1SYCA 3I4MG 3Q6SA 3CC4A 4IFDI 2BE5D 3NWTA 4KKTA 2EY5A 3CCVA 1F2YA 3PCOB 1GHJA 1EUJA 4NDXA 5DLQE 2DUDA 3M3YB 1K83H 1L0WA 3KF6A 4DUZL 1N34L 1QOHA 2PQAA 3NHHA 1M90C 2K5HA 3SEBA 4XYOA 3RD4A 1NUCA 4APVA 1YIJA 4A3BG 5ELFA 4DAMA 2E2JH 4KN4C 3T56B 4BBSH 3S16B 1PLFA 1JOOA 3QJYA 1AN8A 1CHQD 3HOYH 3HOUB 4X64L 4FVMA 3HOWB 4KHPL 5DAUA 4KD3A 4GKKQ 4A3GB 3PMFA 1XTDA 1PH8A 3DWPA 2B3GA 1STYA 1E7ZA 4HIMA 1EQQA 4QL5A 4U68A 4AQYQ 5M3MB 1D7QA 3OSOA 4R1JA 2K6AA 1L1OC 4XDXA 1II3A 4A3IB 1VQ5A 4ABNA 4PQXA 4QIWE 3L9AX 2JXMB 1SYDA 2AWNA 1BOSA 1S5BD 2NN6I 4AIMA 4GKJQ 4PG3A 1HH2P 1G8ZD 3PIOA 3I55A 3N52A 3BG3A 4BBRH 5IP7H 1CKOA 3J80i 5IGFA 2NVXB 1D6EC 2NZOA 2A68D 3KUPA 1E3PA 3BDCA 3QR8A 2ENBA 5BN5A 1YBYA 2ZTDA 1ESFA 4B3MQ 4CKBA 5E4WC 5JAVA 1M4VA 2F1MA 3SR1A 2Q8IB 3EVQA 2DJGC 5M5XB 1MBYA 5JVG3 2L12A 2IX0A 4A3KB 4Y7NB 3FRPB 2G5DA 4DR3Q 3HFZB 1TIID 3BU2A 4S3SA 1QWYA 2OXPA 1FVIA 2QDBA 3FVQA 3MZ5A 3V96A 3H15A 3MWYW 4Q0FA 4RMFA 1FGBD 2WKCA 3TBIB 3DUZA 1N32L 4K0KQ 4RGTA 2RDHA 3KYHC 1H9SB 1EIGA 3AFPA 2MPMA 3UDGA 3GTQB 2F3WA 3RNUA 1LT4D 3S14B 3PO2H 2B2TA 3FDTA 2OWOA 1BKBA 1JR0D 1EEFD 3DM1A 3FKIG 2K52A 4O2DA 5C5MA 2ZTEA 2BE5C 1EYDA 2MNAA 3FKIH 2RBMA 3JAML 3DMUA 5M3MH 3KJPA 3MXNA 3CRLC 1CZWA 3PSIA 5G3LD 2NB0A 2RKSA 1NE3A 3R2TA 3SVMA 1NAPA 4FF3A 5JEAH 1KD1C 1D2BA 1XMQQ 1WD1A 1ENFA 2F0IA 4A3DB 3S24A 4IUUA 3FHWA 2HIXA 2A69D 1HR0W 4ME5A 5IP9H 1IXRA 2FXQA 4G7HC 1D5XC 4GOPC 2Z8LA 4A76A 3T1HL 3GV6A 2IHFA 1G51A 3PO3B 1VQPA 2SEBD 1BCPC 4XQQA 3U58A 3C46A 4R9WA 1TS3A 2JQOA 4GNXC 1VS0A 4KY7A 2DGYA 3IL8A 1Q8IA 3MHBA 2K03A 4EGVA 4AYBG 4WJ4A 1LO5D 1W3SA 3KF8A 1IZ6A 1I94Q 4DK3C 2XVSA 1SYFA 4HCSA 4DUZQ 1N36L 1VMCA 1LT3D 1STGA 4JI8L 2FMCA 1PTOB 1UE5A 1O80A 2RSNA 3HS0C 3CMEA 2XIWA 5FJ8H 3FMCA 4YY3Q 3G48A 1FL0A 5IE8A 3GQBA 1CM9A 4KHPQ 2PZTA 3IFTA 1SMXA 4NXNQ 1A3UA 4LF9L 3SDZA 3T4AC 3T51B 3PUYA 5M5YB 3A8KE 2O4XA 4A93G 2NTSA 4JI6Q 3NTHA 1XPRA 1GUTA 5KGUA 1Q8KA 5FLMH 3D6CA 4UHVA 3J81L 2EDGA 3HOWH 2KHJA 2OT2A 2EOTA 4RAUC 5M5WB 3U4VA 4JI7Q 2UXBL 2ASBA 4F7XA 1H9SA 5CYUA 1SDFA 1S5FD 2RF4A 5C6AA 2KEEA 3BYYB 2WACA 5FKAC 2G9HD 2K4KA 4FP5D 4OO1H 1JC7A 1D5MC 1TWAH 1VQHA 2PQAB 2F4VL 3GTMB 3HKSA 2IX1A 3NBHB 2YTYA 5LMNL 4PZ7A 1VQIA 3CKIB 5GADC 2J4XA 1SNCA 3MAQA 1YITA 1Z6HA 3D31A 2EQSA 4GLVB 1W2BA 5J1ZA 5IT9E 3IKJA 4DV7L 1CK1A 3NWSA 4NMZA 1TS4A 2ATWA 1LTLA 3R3OA 3G7LA 4HMIA 5DM63 1GO3E 3K57A 2NBFA 4TSSA 1B9NA 1C4QA 4JI7L 4Y7NH 3ZJYC 3MFGA 3A55A 4RGNA 3BJUA 4X3UA 4EX5A 3EJIA 2B2WC 3MXPA 2ZM6Q 4KLKA 4OONA 4A3FB 4H13C 1UEBA 3P7JA 3QB3A 3W2DA 3HP3A 5I2XA 1TR5A 1SRUA 1HR0L 1SE4A 3CAMA 3GV3A 1ZEQX 1Q1EA 4HJ8A 4UY8C 3S15B 1HZAA 5E3FA 3UDXA 3ER0A 4FF2A 3GTKH 1K9MC 3S14H 5CV5A 4DUYQ 3HKZG 4XTCS 3PIO3 5HGQA 4A3EH 4JBWA 4BXXG 2FJ2A 2F0UA 5C3EH 4E6IA 3C2PA 4DV4L 3U9OA 3I91A 2EJGC 2PI2A 3CMAA 3L7ZC 3X3NA 3JAMc 5C4XG 4IPGA 1MKHA 4R4QA 3MC0B 3I4NH 1I4QA 5JJLA 3C3LA 2VZAA 4L5RC 1ZYRC 1VQBA 4LF8L 4LFAQ 1PZID 3F1ZA 4X65L 1YNXA 1JB3A 3V05A 4DAYB 1BCPF 2PW5A 1I4XA 1QUQB 2PNRC 3RR5A 2ES2A 1HTLD 1TY0A 4N8FA 1G6ZA 1SJHD 2OF1A 1O7IA 4JI3Q 2E2HB 3AU7A 3R8BA 2JA5G 2HCIA 4QGUA 5G3LF 2Y0SB 1K73C 1SNQA 1PDQA 1SNPA 2H4OA 3HOZH 4OIJA 1Q1BA 1YJNA 4HSPA 2BOSA 1JT8A 1RODA 4C1NI 5I9OA 2HUGA 5FO8B 1H9RA 2EYMA 3NK9A 3I90A 3J81E 4PMBA 2VUMG 5LL6S 4TVAB 1YEZA 2WAQB 4CDFC 4YWMA 1JE4A 1TKWB 1PYSB 1EY5A 2JA6G 1T9HA 5EKLA 1UNSA 3L2PA 1WTPA 1B3AA 1PH3A 3T1HQ 2JA9A 1AEXA 1VQDA 1G2TA 2XRSD 2PQEA 3F2BA 1LTGD 5A2QL 1EIYB 1KL9A 1YZ6A 5M5YH 4GOPB 2YU9B 3K81C 5E4XA 2ZTCA 2A74C 2PMZE 4HR7B 4JG2A 2B2VC 1VQNA 4P72A 1X65A 5IWAQ 3RN2A 4MN3A 1WCMB 2PI2E 1XMQL 3CCSA 3GD7A 4LUOA 4OHJA 1J9OA 2I5MX 1JOKA 1N36Q 3GTLH 3KJOA 3CC2A 4LJZC 2VB3X 2B8GA 4G57A 4QUFA 4IUTA 1BNZA 5M3FB 3EN2A 1MIUA 3WOFA 3AQQA 1RD9D 4RG1A 3VYTA 1TWAB 1SBBB 2L9HA 4FNFA 1XMOL 2UUBL 4CBVA 1C7YA 2L11A 3GDEA 3HKZB 3CCJA 1PTOH 5E7NA 2XSCA 2A6ED 1VQJA 2ALYB 4A3MG 2DY7A 1CA5A 3CRKC 1JICA 5D14A 4MHEA 4X3TA 3ULPA 1L2FA 2CQAA 2EJFC 5K36G 1NR2A 3KK7A 2JN4A 2RA4A 5IYBG 2UU9L 5KYLA 3CHBD 1PH6A 1JMCA 4OX9Q 1QB5D 5CR3A 3VR6A 1YHQA 1IBLQ 4QQBX 1WTHA 2EJMA 4IALA 3LNNA 1J6QA 1EQVA 4A75A 3VA5A 4DR7Q 3M9BA 4OL7A 1OTCA 2JA8H 4FXGC 1IYUA 1V43A 1Y1VB 2JA8G 2K5NA 3S1QB 3VA7A 5LMNQ 2K28A 4RH6A 2LKVA 3BZCA 5FJ8G 1SSOA 3UE1A 2CCZA 1PH4A 4K5XA 1Q86C 1QVGA 3CCEA 1LV9A 4GN4B 1DJRD 1YNND 3FKIB 1E2VA 2L1BA 1F9SA 1FNUA 4LF4Q 1PH2A 1KABA 3MFYA 3BDLA 2YTVA 2F0LA 4DFAA 1SXTA 4RWSC 2O5JC 4CHTB 3EFXD 1Y8OB 1OXUA 3UE0A 1ASZA 5IYCG 3F8TA 4DV3L 1PFMA 2B2YA 4U673 4A3EB 3H94A 2Z1CA 1NMGA 4PZ6A 1XPUA 1TWFH 1SEBD 3TP6A 1R4QB 5EKKA 3NEMA 2XNAC 4A3CG 2HQLA 3PGZA 1A3VA 1D1IA 2O5IC 4CJ2C 5I4DA 3H3VI 3NUCA 1QVCA 3BZDB 1V1PA 4V190 4IFDG 1IKLA 5JJKA 1SYBA 3K6OA 5C0XH 1LT6D 2QDLA 1B3QA 3M7NA 1PMRA 4IO9A 2O2LD 2CW0D 5AJ3L 2L15A 1T5XD 2L4NA 1VQ4A 1CQVA 2K5DA 2HIVA 4R8NA 3VR2A 4GKKL 4IPCA 3I73A 4IPHA 5JEAJ 1D1KA 1G91A 1TWCB 1TWHB 5EBCA 2F0TA 2KJXA 4P74A 1YVCA 2SNMA 4B3TL 3K7UC 3I4NB 5I6YA 1HUNA 2Z6KC 1TU2B 2EYLA 2KENA 5EJWA 1H9KA 2KUMA 3A56A 3BVZA 5HURA 2A68C 1S5CD 1JOQA 2SDFA 4IJHA 1XWEA 1N8RC 2NN6G 1EFID 1KIXA 5GROA 1WTQA 4LNQA 1ET6A 3CU7A 1WYDA 2SOBA 3A0JA 4DN4M 4G4KA 5C4JH 3DLLA 2IX3A 2UUCQ 5JEAG 2F0VA 1IBMQ 1QVFA 3S2DB 3R93A 4IURA 4KKSA 2R92H 2UXCQ 5TSSA 1Y1WG 4PV1C 5C44G 1CTMA 2N3SA 2M00A 4IUPA 1RDPD 1B2TA 3I8ZA 3L3OC 1F2ZA 3ULLA 3TQYA 2MHVA 1A63A 3DWAA 3GTQH 1RIPA 2R7FA 1I3QB 4XT3B 1E22A 4WJWA 1K0RA 4CDEC 4DNRB 1YJ9A 4ZCKA 2VQEL 1RF2D 4TQUS 2DN8A 3TZDA 4BS9A 3HOXB 5IYBH 1U4PA 1VQGA 1U4MA 2D2CC 2H5XA 1JWUD 3FEWX 5CMDA 5M9OA 1VQKA 1A6XA 5IYDH 3PV0A 2RHSB 1HNXL 3S9WA 3AEVA 1EOVA 2KHIA 3HEJA 5LMUQ 4GLAC 3RZDH 1X56A 2IWHA 4PNYA 3H0GG 2JA7G 2CKZB 5IIFA 5D65A 2QEXA 1ILQA 1AW7A 2YYZA 5CBAE 2IT1A 2JA6H 3PO3G 4MIUA 4A3FH 4HSVA 1XNQL 5ELDA 2F0PA 1U4LA 3NTIA 3B6YA 3ULJA 4L5SA 2L0CA 5ELEA 4X62L 4RCNA 2EYHA 4KHZA 4AYBB 1SLJA 3NTKA 5IWAL 4ILWA 5FK9C 1BXTA 1GUOA 1V1OA 1Y1VH 2ICIA 1XYIA 1LTTD 3PQIA 3S1QH 4RA8A 4KKUA 1RTNA 1NCVA 1SYEA 1LTID 2LS01 1BBXC 1WTRA 1N9WA 1IL8A 2K14A 5IGEA 2A5HA 4BY1B 3Q0AA 1C48A 2F4VQ 4QIWB 2B2TC 3JC66 1EYCA 3SXHA 1BF4A 2CH4W 2Q2IA 3QG1A 4DAYA 1DZ1A 5IODA 1UAPA 1ZKOA 1NBWA 5C3XA 5H1SE 3EROA 2BDOA 3HOZB 3A54A 3TN2A 4JPBW 4C56C 4A93B 4XQJA 3K0YA 4DV4Q 4X62Q 4M1UB 2VL6A 3GTGB 4X64Q 3C1EA 2B2UA 2WB1B 2E2HH 4IUQA 1FNWA 3NXWA 1NR4A 5C0XJ 1BUVT 1ASYA 1ICWA 1XMOQ 1UUPA 3UI2A 2E74C 4A3MH 2WP8J 4DA2A 1EIFA 2F0FA 1JJGA 1HR0Q 1IBKQ 2LSSA 2Z4IA 4LFBL 4JI0L 2K01A 5KRUA 4LFCQ 1HA6A 1DOLA 5C0XI 2K5QA 4DV6Q 1A3TA 3H3VH 4IOCA 1WI5A 3FPUB 1HXYD 4K6DA 1KRTA 4DU9A 1AZPA 4V0BA 4BBSG 1HCZA 3OIQA 3C1FA 3VR4A 3SK8A 2NVTB 2KCMA 2A6HD 1TWFB 3GTOB 1YI2A 1YNNC 1G291 3TSSA 1J8IA 1Y1WH 1GUGA 4UPAA 5C5LA 3OMCA 3S1NB 5C3EG 3G71A 2R6GA 4HTHA 1LM0A 1VDZA 4A3BB 4QMGA 4KK7A 1X3QA 3PUZA 2D62A 3AYHB 1K28A 2UUCL 1BDOA 3CPFA 1UEAB 2WAQE 5F2DA 2GA4B 2EXDA 3KF8B 1K0SA 1TY2A 2KCNA 1S5DD 1S3OA 2L5TA 4K0KL 5ISRA 3K80C 3OW7A 5JJIA 3TS0A 1EFWA 2F3VA 1TVXA 2B8FA 3A5ZB 2E5LL 1LLRD 1YHAA 1F77A 2BCOA 4DAVA 2Y0SE 2GN5A 4HJ9A 2XRQD 4YWKA 4RFBA 5CV7A 4DNIA 4DNTB 3TP8A 2FMMA 2TMPA 2K05A 2PZWA 2PNHA 4A3IH 2DNCA 4KTAA 1VQMA 1FR3A 1XPOA 3TRZA 2HCCA 4POGA 3DWQA 1I50H 1EY6A 2Q2TA 2CQOA 1PFSA 1PRTC 4ODGA 4A3FG 4JYAQ 5COYA 1PRTF 3T1YL 1MJEA 3A8JE 3BVMA 2VUMB 2FFKB 1Z9FA 1VQ7A 2NVTH 2BA1A 4CDDC 1N33Q 5JJZA 1AZQA 3S1RB 1IL2A 3S1NH 4A3KH 2JEAI 2ZXRA 2PCFB 3TP5A 2MJ8A 2YTXA 2KHSA 5LHY1 3S2HB 5I6WA 1YHBA 4ZUIA 5FLXL 2PMZB 1DOKA 1MGSA 4CKEA 5BR8Q 4ME3A 1SE2A 1PHJA 1BBUA 5J22A 4DV3Q 2VNUD 1Y14B 2DJFC 1R4PB 1SFOH 2AHOB 3MXGA 4YCUA 3BS1A 4NW2A 3O13A 3BVGA 5KEEA 1VQ6A 1TWCH 1HRJA 1E1TA 1STBA 1K8OA 3RLOA 3M4OH 2EXZA 2NZHA 5C44H 2JA5B 4ZLTF 3E0EA 5C4ZA 3QWNA 1I4HA 1J5EL 1R9TB 3GTGH 1SNDA 1BO0A 4GS3A 4YIJA 1C0AA 2Z4HA 2JEBI 2HHHL 4DF7A 2X6GA 1K83B 1QUQA 4F88A 4FF4A 1IKMA 5C3WA 3STBC 5FLXc 2N8NA 3J7AV 4LF7Q 1W6KA 1I6HH 1VQFA 1HZBA 3L0OA 3ND9A 2NYZD 2ID0A 1EQRA 4BBSB 3I4MH 1C8CA 4B3SQ 1PTOC 3HOVG 3ICEA 1GXDC 1ICFB 2JE6I 1STAA 3W1BA 2BH8A 2MFIA 4KY5A 3H0GH 2K7VA 1KQSA 3HOVH 1DOMA 4YWLA 5L37A 2NN6H 4C3HB 2K5VA 3ND8A 3SK6A 2L55A 3MA2B 3HOXH 4LF5L 3OWFA 2V4DA 4JI2Q 1S4ZA 3NENA 3WDNA 3PF4A 4B3ML 1JWSD 1BCPB 4QF4A 4KN7C 3RLNA 2EYOA 1X3EA 4EQNA 3KF6B 2NTTA 2K04A 1F2LA 1HNWL 1FGUA 5M5XH 2UU9Q 4LW1A 4UDUC 2FINB 1TT2A 2Q2HA 2VY3A 5ELBA 1WCMG 4J15A 5GAGC 5A35A 2EYJA 1GVPA 1H9JA 1I4RA 4PMCA 1KXLA 1E2WA 1S40A 1VQAA 1JORA 3MTSA 1E24A 3U50C 3TMEA 4FXDA 3SK5A 4A3JG 1UE7A 4QY7A 2Z6KA 4JBJA 3HOZG 3EQLC 3RZDB 3A7AB 5GQOA 5FLXE 4DKAC 4B3TQ 1HNZQ 1WFQA 2A73B 1EU3A 1SJED 1IYVA 2MUYA 2N88A 1Q82C 4FO2A 2B39A 1MSHA 4J1MA 2R61A 2B63B 2VW9A 1H9MA 4LF5Q 2NZ1D 3CQZB 2Z0SA 2F0SA 3S17B 3VDYA 3BYTB 3BDOA 1TWGB 3J80L 2HD3A 3U4ZA 4N8X1 3PO2B 2R3ZA 1KRSA 3NPPA 2LXJA 2BA0A 5K36H 1LT5D 1AFPA 3J80E 4CKCA 2WV6D 1UWVA 4JV5L 2XN9C 3PIP3 5KNCA 3T13A 1P8LA 4O0AA 4DUYL 5K5PA 4MTKA 5KIXA 3FP9A 5IGCA 3T53B 1HFGA 3WWVA 1FNVA 4C3IG 5IGGA 2EIFA 5IYDG 2F0OA 1PZJD 4OO1I 4L5QA 1A0IA 2ZXPA 4B9XA 1RTOA 3GO5A 3STBD 2IJ0A 1EWCA 4OELB 4XIGS 4BA1I 3TP7A 4LUVA 4DR6Q 3T16A 4QJFA 3CCUA 2LMCB 3ERSX 3RLFA 5AJ3Q 3OOCA 1STNA 3I2ZA 3E0JA 1PRTB 2N49A 2R93G 4K6LA 4DK1A 3P1HA 4AQYL 1L1OB 5IGDA 1XXGA 4DAPA 4DV5Q 3M4YA 5C4XH 4A3GH 2ZJRA 2K50A 2RCFA 4WRDA 3HRZC 2NWGA 5DNFA 3T1YQ 1RJTA 4JC0A 4RGMA 1H95A 5KNDA 1CZGA 4DV1Q 2JA7B 1FJGQ 2OQKA 2Q8RE 2R7DA 2NVYH 4J8QA 2E5LQ 1PVOA 5LMNW 1VQOA 4Y52H 5EPKA 1BQQT 4LMQD 1VQCA 1SFOB 3NELA 1CHPD 1RHPA 4HJAA 3S17H 2A19A 3OYYA 2TSSA 4DV2Q 4BBRB 2UXDQ 4POFA 3KBGA 4YCVA 1ILPA 4XT1B 4K5WA 4KI0A 4DR2Q 1M8AA 2PPBC 2HT1A 1VCIA 1AH9A 1TQOA 1A2TA 1PH7A 2K5WA 1QZHA 4HAEA 3ONAB 3UDFA 1Y1WB 3H91A 3A8IE 4ID6A 4A4IA 3CD6A 2EYPA 3I72A 1EYAA 5CORA 3W5OA 1SMYD 1LYLA 2VB2X 3CCMA 1B53A 1OXSC 1PA6A 4K14A 3HOYG 3D6WA 3RN5A 5LMUL 1WJJA 4QB4A 3SHLA 3W1GA 2Q8TA 4K5VA 1M1KC 3I4NG 3WOEA 3X3MA 3G4SA 4NXML 2AWOA 2ICEC 4K8JA 2NVQH 2UXBQ 4FDBA 2GVBA 4IN3A 4TRDA 1MSGA 1EY9A 3OW2A 2A8VA 2RDGA 2HDMA 5EGTA 2QILA 3FPPA 3HKZE 4PMWA 1VF7A 2VQEQ 1PV4A 5I9PA 2ZXOA 4B3SL 3PO2G 1VQEA 1DCZA 2VS1A 3KLRA 4A3LH 4WFN3 4WORA 4KHVA 4KY6A 3TDQA 2NVYB 1FYCA 4BWGB 4OO1G 2UUAL 5ELOA 1AE3A 3CCRA 4KV6A 4LUZA 4HIKA 1CUKA 1RKNA 3GTPH 5FOBB 3CCQA 2IY5B 4RCOA 2A6EC 1EWHA 1AE2A 5T1IA 4L8JA 1D5ZC 5CBEE 1O7YA 4JYAL 1CFMA 3PIPA 1SNOA 1XNQQ 1GHKA 3VYUA 4KMUC 4DPGA 2MP1A 1GUSA 3S1RH 2AQ3B 4IJLA 2ZJQA 4GOPA 1A15A 5BN3A 1X54A 4B08A 1WTWA 4BY7H 3EA6A 4K2KA 2OTJA 2Q2UA 2WFWA 3S2HH 1LTRD 4IQZA 1SMYC 1HJPA 3D8GA 3VR3A 1XX8A 5GAEC 1GUNA 2XWBB 2B63H 2UUAQ 3NQIA 3HGBA 4R4TA 5NUCA 5M3FG 2HDLA 4IUVA 4P2CB 3J81c 1KDCA 4IOAA 2R7ZB 1E1OA 2RDFA 1WVLA 3V2TA 3OIPA 2CWAA 1RL2A 2QGQA 2K1BA 2EZVA 4A3EG 4C1NK 3CPWA 5JOBA 1N33L 1ET9A 1EY7A 4DR4Q 1V1PB 4B9WA 3I4OA 5T1GA 1HQRD 2ZJPA 1QCBD 1LABA 1WOCA 2PO4A 1KTKA 5HY6A 4HIOA 1PFBA 4YY3L 1KAWA 4K2LA 2F4IA 1O7ZA 5FO7B 4DR3L 3F2UA 3Q8DA 1B8AA 1E0BA 2CW0C 1JJ2A 3GTKB 4C3JG 1HZCA 3HZXA 2MO1A 3GTPB 4CJ0B 2Z6BA 4G7ZC 3LWUA 3E9HA 2ZM6L 2JYOA 5LL6X 2QW7A 5C44B 3F2DA 3CQZH 1VMPA 1GOZA 4A3JH 2X69A 4JCVE 4LF8Q 1SROA 1L1OA 1TWGH 4O1NA 4F87A 4RGOS 2NVXH 2B2UC 3CW2C 4MNOA 3QIAA 4DV7Q 4EQOA 2OEOA 3LWEA 3Q22A 4A3CH 1CQFA 3TREA 1JE5A 2F0HA 2WB1E 3LX0A 2KOLA 3I4MB 4UP7A 1T5EA 4LK1C 5JPMC 4DR1Q 1WTVA 5EBDA 4LF7L 4R4IA 1KDAA 3M4QA 4JI1L 1IBML 1U9RA 4N9PA 3HOVB 1W6JA 2F0KA 4C3HH 1BR9A 1GKHA 5EKIA 2F0MA 1HNXQ 4L63B 1CI3M 1SR3A 2MGSA 3GTJB 1SAPA 3G6EA 3DXJC 5FLMG 2WIIB 1LACA 4C3IB 4C2MH 1B50A 2M9VA 4BY7G 2I46A 4DV0Q 1EY8A 4OGQC 1A2UA 3E3XA 2D0PA 4JI2L 5DM73 3J81j 4JI4L 1GD7A 1JQYD 1DONA 4PZ8A 4LFBQ 2F0WA 2CH4A 4GKJL 1LTBD 1XNRQ 2K33A 2B2VA 3M4PA 4X3SA 2N55A 4DV6L 3TZUA 5CV6A 2VQFL 1EQTA 1XJVA 1EY4A 4HEDA 5M3MG 5GAHC 2QA4A 4X66Q 2R93H 1JB7A 5A2QE 2F0JA 1KAAA 4Q5VA 4CGYB 4R4OA 4EQPA 2EY6A 5C0XG 5IP9G 1VQ8A 2CHBD 3S1MH 1DXMA 4JOIA 4B3RL 1OXXK 2J0TD 3QOLA 4RHRA 4DGZA 4EVOA 5IYCH 4DV5L 1Q3LA 1WTOA 2KBNA 4LAAA 4ZUJA 3S15H 1UE6A 1EWIA 3K7AB 1V8QA 1QNUA 1HFNA 2IPKD 1B70B 1MJCA 3OMGA 4LF6Q 2V1CC 5FO9B 2B2WA 2EY2A 3K5NA 3ERQA 3ITPA 3D0FA
chains in the Genus database with same CATH topology
3I4LA 2H1EA 1EZ6A 2E2JB 2JP1A 4BY7B 1JCKB 2QF7A 1ZYRD 2XWJB 2IW3A 4H0LC 1SNMA 1PFNA 1DYQA 1RCVD 3PUVA 5C4XB 1B44D 3A7LA 5IGBA 2F0DA 1SE3A 3NQTA 4KD4A 3H09A 5C4JB 4NKLA 5HGTA 3H0GB 2E2DC 1KLGD 1KNAA 2R93B 2G9DA 1Q90A 3OHXC 1EY0A 1O78A 1PXUA 2QCPX 1L0YB 5AFWA 2B2YC 3JAME 1Y69U 1QJOA 4KJOA 1LTSD 1KDBA 4H44C 3I3CA 1O7LA 1OXVA 4IFDH 4XQNA 1IW7D 1HQMC 3HG9A 5IT9L 5C4HA 2JA6B 5EPJA 4G7OC 1HA5A 2EYFA 3RZOB 1F9RA 2QEJC 4ZKCB 3VYSA 1G2SA 5KYIA 1ENAA 3VR5A 2SNSA 3AMUA 2F0NA 3GP7A 2EY1A 5D3DA 4IUNA 1HHVA 1PRTD 2AUJD 1B1ZA 2AUKA 1E2ZA 2NVQB 2J7ZA 4BA2I 1I4GA 1L0XB 3W3AA 4GZYC 5D3IB 1ENCA 4RKLA 2F0QA 2JSOA 4A3MB 4RKBA 1HUMA 1Q12A 2D9UA 1I4PA 2EPBA 2IL8A 1EOTA 1JWMD 4N9TA 4RHSA 1WTXA 3RUZA 5DEHA 1S5ED 3NP8A 3J7AF 2KCCA 4M8AA 3K5MA 4DXGA 3M85A 3DEOA 2PW7A 4JK1C 3NBHA 1QG7A 4FF1A 2D5DA 4KJNA 5JPNC 1ONLA 4H7BA 2A6HC 4ZK9B 3ZYYX 1F9PA 4IZ8A 1GJXA 2PZUA 2KVMA 1CT1D 1KLUD 3I70A 1EL0A 4Z9CB 1U4RA 3HOYB 3P20A 3QO2A 1SYGA 2LFNA 2AQ2B 1B4OA 1ESRA 1MD2D 1PTOD 2VXWA 3K58A 2LY7A 4ZQ3A 1Y8NB 1F2MA 3K5LA 1DM0B 5CV9A 1STHA 2EE1A 3KLSX 5IOCA 4IFDJ 2RVLA 5CC4A 5EQ0A 5E1FA 3Q23A 4HCEA 3OWEB 3DEPA 1HTPA 1I50B 1CA6A 1PZKD 3MXUA 4K8IA 1Z7TA 1VF5C 4XXEA 3PUWA 3SE0A 3H6MA 2ZT9C 4DK0A 1EZ8A 4L6TB 4HN7A 4ZAIA 5JVH3 2R92B 2BDNA 5J39A 2F03A 1F9QA 1BCPD 1MI2A 2FHTA 2CVRA 1I6VC 5ELCA 3D4WA 2DY8A 3D4RA 1AP0A 5I2YA 4XYQA 1DD2A 1IW7C 1OO9B 2RQXA 4J6HA 3K5OA 1Z47A 2M2LA 4FYDA 4C3HG 3G6JB 5EPLA 2PYKA 4ZKBB 2WKDA 3M7GA 2C9OA 2JA8B 1FD7D 2EVBA 3PUXA 1QNKA 2NUCA 3Q24A 1YNJC 3J7YW 3D4DA 1EIHA 3M4OB 5BN4A 3S1MB 4C2MB 4X3KA 2X6LA 4F8MA 4QUCA 2RSOA 3N6RA 4OIKA 3OPOA 1GUWA 1OXTA 4UAIA 2KEDA 4O42A 1KNEA 4QCLA 3NSWA 1STEA 2E76C 4C3JB 3RMHA 3D3RA 3E5SA 3VYRA 3URYA 4CJ1B 2KA7A 3NBIA 2E75C 4FXKC 3DHQA 1I6HB 1Y8PB 3KLSA 3IAYA 3KBXA 4A3JB 4TKOB 2F0EA 3GTLB 3K59A 4R8IA 2DNEA 1WD0A 2I07B 3QOJA 3R2IA 5KNBA 1K8MA 3SK4A 1TS2A 2K32A 3NE5B 4ZRZA 5CV4A 1YNJD 1ML0D 2E2IB 2KQ3A 1LTAD 4I7ZC 5C3EB 1EEID 1HPCA 2QKIC 3U9SA 4ULLA 1ZXTA 3P75A 1TS5A 1PYWD 1X32A 2HQEA 3IFDA 5CV8A 4NP5A 1QILA 3E6ZX 2C5CA 1EU4A 1X3PA 5CGKA 3MVVA 2KECA 4ZYSA 1XTCD 2A69C 2F0GA 1B9MA 4I65A 1PTOF 1QE6A 1NSNS 2WINB 3H3VC 3AB9A 4HMJA 1IHZA 4DXFA 2AQ1B 3MEHA 1SYCA 3Q6SA 4IFDI 2BE5D 3NWTA 4KKTA 2EY5A 1F2YA 1GHJA 4NDXA 3M3YB 1QOHA 3NHHA 3SEBA 4XYOA 3RD4A 1NUCA 5ELFA 4KN4C 3T56B 3S16B 1JOOA 1PLFA 3QJYA 1AN8A 1CHQD 3HOUB 4FVMA 3HOWB 5DAUA 4KD3A 4A3GB 3PMFA 3DWPA 1STYA 4U68A 5M3MB 3OSOA 4XDXA 2K6AA 4A3IB 1II3A 4ABNA 4PQXA 3L9AX 2JXMB 1SYDA 2AWNA 1BOSA 1S5BD 2NN6I 1G8ZD 3N52A 3BG3A 5IGFA 2NVXB 1D6EC 2A68D 3KUPA 3BDCA 5BN5A 2ENBA 1ESFA 4CKBA 5E4WC 5JAVA 1M4VA 2F1MA 3SR1A 2Q8IB 3EVQA 5M5XB 1MBYA 5JVG3 2L12A 2IX0A 4A3KB 4Y7NB 3FRPB 1TIID 4S3SA 1QWYA 2OXPA 3FVQA 2QDBA 3V96A 3MZ5A 3MWYW 4Q0FA 1FGBD 2WKCA 3TBIB 3DUZA 4RGTA 2RDHA 1H9SB 1EIGA 2MPMA 3GTQB 2F3WA 1LT4D 3S14B 2B2TA 3FDTA 1JR0D 1EEFD 3DM1A 5C5MA 2BE5C 1EYDA 2RBMA 3JAML 3DMUA 3MXNA 3CRLC 1CZWA 5G3LD 2NB0A 2RKSA 3R2TA 3SVMA 1NAPA 4FF3A 5JEAH 1D2BA 1WD1A 1ENFA 2F0IA 4A3DB 4IUUA 2A69D 4ME5A 4G7HC 1D5XC 2Z8LA 3GV6A 3PO3B 2SEBD 1BCPC 4XQQA 3C46A 4R9WA 1TS3A 4KY7A 3IL8A 1Q8IA 3MHBA 2K03A 4EGVA 1LO5D 3KF8A 2XVSA 1SYFA 4HCSA 1VMCA 1LT3D 1STGA 2FMCA 1PTOB 1O80A 2RSNA 3HS0C 2XIWA 3FMCA 3GQBA 1CM9A 2PZTA 3IFTA 1A3UA 3SDZA 3T4AC 3T51B 3PUYA 5M5YB 3A8KE 2O4XA 2NTSA 3NTHA 1GUTA 5KGUA 3D6CA 3J81L 2EDGA 2OT2A 2EOTA 4RAUC 5M5WB 4F7XA 1H9SA 5CYUA 1SDFA 1S5FD 5C6AA 2KEEA 3BYYB 2WACA 5FKAC 2G9HD 4FP5D 4OO1H 1JC7A 1D5MC 3GTMB 2IX1A 3CKIB 2J4XA 1SNCA 3MAQA 1Z6HA 3D31A 5J1ZA 5IT9E 3IKJA 1CK1A 3NWSA 4NMZA 1TS4A 3R3OA 4HMIA 3G7LA 5DM63 3K57A 2NBFA 4TSSA 1B9NA 1C4QA 3MFGA 3A55A 4RGNA 4X3UA 3EJIA 2B2WC 3MXPA 4A3FB 4H13C 3P7JA 3QB3A 3W2DA 3HP3A 5I2XA 1TR5A 1SE4A 3GV3A 1ZEQX 1Q1EA 3S15B 5E3FA 4FF2A 5CV5A 4XTCS 3PIO3 4JBWA 2FJ2A 2F0UA 4E6IA 3C2PA 3U9OA 3I91A 2EJGC 3L7ZC 3X3NA 3MC0B 1I4QA 3C3LA 1ZYRC 1PZID 1JB3A 3V05A 1BCPF 2PW5A 1I4XA 2PNRC 1HTLD 1TY0A 1G6ZA 1SJHD 2OF1A 2E2HB 3AU7A 3R8BA 2HCIA 5G3LF 2Y0SB 1SNQA 1PDQA 1SNPA 2H4OA 4OIJA 1Q1BA 4HSPA 2BOSA 1RODA 4C1NI 5I9OA 2HUGA 5FO8B 1H9RA 2EYMA 3NK9A 3I90A 3J81E 4PMBA 5LL6S 2WAQB 1JE4A 1TKWB 1EY5A 5EKLA 1WTPA 1UNSA 1B3AA 1AEXA 1G2TA 2XRSD 2PQEA 1LTGD 5A2QL 2YU9B 5E4XA 2A74C 4HR7B 2B2VC 4MN3A 1WCMB 3GD7A 4OHJA 1J9OA 1JOKA 4LJZC 2VB3X 2B8GA 4G57A 4QUFA 4IUTA 1BNZA 5M3FB 3WOFA 1RD9D 3VYTA 1TWAB 1SBBB 2L9HA 4FNFA 4CBVA 2L11A 3HKZB 1PTOH 2XSCA 2A6ED 2DY7A 1CA5A 3CRKC 1JICA 5D14A 4MHEA 4X3TA 2CQAA 2EJFC 5K36G 1NR2A 3KK7A 2RA4A 5KYLA 3CHBD 3VR6A 1QB5D 5CR3A 2EJMA 4IALA 3LNNA 1EQVA 3VA5A 4OL7A 4FXGC 1IYUA 1V43A 1Y1VB 3S1QB 3VA7A 2K28A 4RH6A 2LKVA 1SSOA 4K5XA 1LV9A 1DJRD 1YNND 3FKIB 1E2VA 2L1BA 1F9SA 1FNUA 1KABA 3MFYA 3BDLA 2F0LA 4DFAA 1SXTA 4RWSC 2O5JC 4CHTB 3EFXD 1Y8OB 1OXUA 1PFMA 2B2YA 4U673 4A3EB 3H94A 2Z1CA 1SEBD 3TP6A 1R4QB 5EKKA 2XNAC 1A3VA 1D1IA 2O5IC 4CJ2C 5I4DA 3NUCA 3BZDB 1V1PA 4V190 4IFDG 1IKLA 1SYBA 3K6OA 5C0XH 1LT6D 3M7NA 1PMRA 2O2LD 2CW0D 1T5XD 2L4NA 1CQVA 2K5DA 4R8NA 3VR2A 3I73A 5JEAJ 1D1KA 1G91A 1TWCB 1TWHB 5EBCA 2F0TA 2KJXA 2SNMA 3I4NB 5I6YA 1HUNA 1TU2B 2EYLA 5EJWA 1H9KA 2KUMA 3A56A 3BVZA 5HURA 2A68C 1S5CD 1JOQA 2SDFA 1XWEA 2NN6G 1EFID 1WTQA 1ET6A 3CU7A 2SOBA 4DN4M 4G4KA 2IX3A 5JEAG 2F0VA 3S2DB 3R93A 4IURA 4KKSA 5TSSA 4PV1C 1CTMA 2M00A 4IUPA 1RDPD 1B2TA 3I8ZA 3L3OC 1F2ZA 2MHVA 3DWAA 1I3QB 4XT3B 4WJWA 4DNRB 1RF2D 4TQUS 2DN8A 3TZDA 4BS9A 3HOXB 1U4PA 1U4MA 2D2CC 1JWUD 3FEWX 5CMDA 5M9OA 1A6XA 3PV0A 3S9WA 3HEJA 2IWHA 4PNYA 5IIFA 5D65A 1ILQA 1AW7A 2YYZA 5CBAE 2IT1A 4MIUA 4HSVA 5ELDA 2F0PA 1U4LA 3NTIA 2L0CA 5ELEA 4RCNA 2EYHA 4KHZA 4AYBB 3NTKA 4ILWA 5FK9C 1BXTA 1GUOA 1V1OA 2ICIA 1XYIA 1LTTD 4RA8A 4KKUA 1RTNA 1NCVA 1SYEA 1LTID 2LS01 1BBXC 1WTRA 1IL8A 5IGEA 4BY1B 2A5HA 3Q0AA 1C48A 4QIWB 2B2TC 3SXHA 1EYCA 1BF4A 3QG1A 4DAYA 1DZ1A 5IODA 1UAPA 1ZKOA 5C3XA 3EROA 2BDOA 3HOZB 3A54A 3TN2A 4A93B 4C56C 4XQJA 3K0YA 4M1UB 3GTGB 3C1EA 2B2UA 2WB1B 4IUQA 1FNWA 3NXWA 1NR4A 5C0XJ 1BUVT 1ICWA 1UUPA 3UI2A 2E74C 2WP8J 4DA2A 2F0FA 2Z4IA 2K01A 5KRUA 1HA6A 1DOLA 5C0XI 2K5QA 1A3TA 3FPUB 1HXYD 4K6DA 4DU9A 1AZPA 4V0BA 1HCZA 3OIQA 3C1FA 3VR4A 3SK8A 2NVTB 2A6HD 1TWFB 3GTOB 1YNNC 1G291 3TSSA 1J8IA 1GUGA 5C5LA 3OMCA 3S1NB 2R6GA 4HTHA 1VDZA 4A3BB 4QMGA 4KK7A 1X3QA 2D62A 3PUZA 1BDOA 1UEAB 5F2DA 2GA4B 1TY2A 2KCNA 1S5DD 2L5TA 5ISRA 3OW7A 2F3VA 1TVXA 2B8FA 1LLRD 1F77A 2BCOA 4DAVA 2XRQD 4RFBA 5CV7A 4DNTB 3TP8A 2FMMA 2TMPA 2K05A 2PZWA 2DNCA 4KTAA 1FR3A 2HCCA 3DWQA 1EY6A 1PRTC 4ODGA 5COYA 1PRTF 3A8JE 3BVMA 2VUMB 2FFKB 2BA1A 5JJZA 1AZQA 3S1RB 2JEAI 2ZXRA 2PCFB 3TP5A 2MJ8A 2KHSA 5LHY1 3S2HB 5I6WA 4ZUIA 5FLXL 2PMZB 1DOKA 1MGSA 4CKEA 1SE2A 5J22A 2VNUD 1R4PB 3MXGA 3BS1A 4NW2A 3O13A 3BVGA 5KEEA 1HRJA 1STBA 1K8OA 2EXZA 2JA5B 4ZLTF 5C4ZA 3QWNA 1I4HA 1R9TB 1SNDA 1BO0A 4YIJA 2Z4HA 2JEBI 4DF7A 2X6GA 1K83B 4F88A 4FF4A 1IKMA 5C3WA 3J7AV 1W6KA 3ND9A 2NYZD 2ID0A 4BBSB 1C8CA 1PTOC 1GXDC 2JE6I 1STAA 4KY5A 2K7VA 1DOMA 2NN6H 4C3HB 3ND8A 3SK6A 2L55A 3MA2B 3OWFA 2V4DA 1S4ZA 3WDNA 1JWSD 1BCPB 4QF4A 4KN7C 2EYOA 4EQNA 2NTTA 2K04A 1F2LA 4UDUC 2FINB 1TT2A 5ELBA 5A35A 2EYJA 1H9JA 1I4RA 4PMCA 1E2WA 1JORA 3MTSA 3TMEA 4FXDA 3SK5A 3EQLC 3RZDB 3A7AB 5FLXE 2A73B 1EU3A 1SJED 1IYVA 2MUYA 2N88A 4FO2A 2B39A 1MSHA 4J1MA 2R61A 2B63B 1H9MA 2NZ1D 3CQZB 2F0SA 3S17B 3BYTB 3BDOA 1TWGB 3J80L 3PO2B 2R3ZA 3NPPA 2BA0A 5K36H 1LT5D 1AFPA 3J80E 4CKCA 2WV6D 2XN9C 3PIP3 5KNCA 3T13A 5K5PA 5KIXA 5IGCA 3T53B 1HFGA 1FNVA 4C3IG 5IGGA 2F0OA 1PZJD 4OO1I 2ZXPA 4B9XA 1RTOA 3GO5A 2IJ0A 1EWCA 4XIGS 4BA1I 3TP7A 3T16A 2LMCB 3RLFA 3OOCA 1STNA 3E0JA 1PRTB 4K6LA 4DK1A 3P1HA 5IGDA 1XXGA 4DAPA 3M4YA 4WRDA 3HRZC 2NWGA 5DNFA 1RJTA 4RGMA 5KNDA 1CZGA 2JA7B 2Q8RE 4J8QA 5EPKA 1BQQT 4LMQD 1SFOB 1CHPD 1RHPA 2TSSA 4BBRB 3KBGA 1ILPA 4XT1B 4K5WA 4KI0A 1M8AA 2PPBC 1VCIA 1TQOA 1A2TA 2K5WA 4HAEA 3ONAB 1Y1WB 3H91A 3A8IE 4ID6A 2EYPA 3I72A 1EYAA 5CORA 1SMYD 2VB2X 1B53A 1OXSC 4K14A 3D6WA 4QB4A 3SHLA 2Q8TA 4K5VA 3WOEA 3X3MA 2AWOA 2ICEC 4K8JA 4IN3A 4TRDA 1MSGA 1EY9A 2RDGA 2HDMA 5EGTA 2QILA 3FPPA 4PMWA 1VF7A 5I9PA 2ZXOA 1DCZA 3KLRA 4WFN3 4WORA 4KHVA 4KY6A 3TDQA 2NVYB 1FYCA 4BWGB 4OO1G 4KV6A 1RKNA 5FOBB 4RCOA 2A6EC 1EWHA 5T1IA 4L8JA 1D5ZC 5CBEE 1O7YA 1CFMA 1SNOA 1GHKA 3VYUA 4KMUC 2MP1A 1GUSA 2AQ3B 1A15A 5BN3A 4B08A 1WTWA 3EA6A 4K2KA 1LTRD 4IQZA 1SMYC 3D8GA 3VR3A 1XX8A 1GUNA 2XWBB 3NQIA 3HGBA 5NUCA 2HDLA 4IUVA 4P2CB 1KDCA 2R7ZB 2RDFA 1WVLA 3V2TA 3OIPA 2K1BA 2EZVA 4C1NK 5JOBA 1ET9A 1EY7A 1V1PB 4B9WA 5T1GA 1HQRD 1QCBD 1LABA 2PO4A 1KTKA 1PFBA 4K2LA 2F4IA 1O7ZA 5FO7B 3F2UA 1E0BA 2CW0C 3GTKB 4C3JG 3HZXA 3GTPB 4CJ0B 4G7ZC 3LWUA 2JYOA 5LL6X 5C44B 1VMPA 1GOZA 2X69A 4O1NA 4F87A 4RGOS 2B2UC 3QIAA 4EQOA 2OEOA 3LWEA 3Q22A 1CQFA 2F0HA 3LX0A 2KOLA 3I4MB 1T5EA 4LK1C 5JPMC 1WTVA 5EBDA 1KDAA 1U9RA 4N9PA 3HOVB 1W6JA 2F0KA 1BR9A 5EKIA 2F0MA 4L63B 1CI3M 2MGSA 3GTJB 1SAPA 3DXJC 2WIIB 1LACA 4C3IB 1B50A 2M9VA 2I46A 1EY8A 4OGQC 1A2UA 5DM73 1JQYD 1DONA 2F0WA 1LTBD 2K33A 2B2VA 4X3SA 2N55A 3TZUA 5CV6A 1EQTA 1EY4A 4HEDA 5A2QE 2F0JA 1KAAA 4Q5VA 4CGYB 4EQPA 2EY6A 5C0XG 2CHBD 1DXMA 1OXXK 2J0TD 3QOLA 4RHRA 4DGZA 4EVOA 1WTOA 1Q3LA 4LAAA 4ZUJA 3K7AB 1V8QA 1QNUA 1HFNA 2IPKD 3OMGA 5FO9B 2B2WA 2EY2A 3K5NA 3ERQA 3ITPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IGC A;  5I6Y A;  4K8I A;  3E5S A;  4F7X A;  5IGE A;  5ISR A;  2F3W A;  2EY5 A;  1EZ6 A;  5IGG A;  1F2Y A;  2EYL A;  1ENC A;  1SNQ A;  2F3V A;  4IAL A;  5C6A A;  3SXH A;  1EYC A;  2F0O A;  4RKL A;  2F0Q A;  5HUR A;  3H6M A;  1EQV A;  2WAC A;  1SNP A;  4RKB A;  4NDX A;  4OL7 A;  4WOR A;  3VA5 A;  2OEO A;  4KHV A;  4KY6 A;  4B9X A;  4EQO A;  1JOQ A;  3DHQ A;  5IOD A;  1SNM A;  5C5M A;  1STA A;  2F0H A;  3LX0 A;  1EYD A;  1EZ8 A;  4KV6 A;  3TP7 A;  5C3X A;  4KY5 A;  5I9O A;  1RKN A;  3ERO A;  2RBM A;  3T16 A;  5CV7 A;  2LKV A;  3DMU A;  2SOB A;  4N9T A;  5J39 A;  3NHH A;  3TP8 A;  1STN A;  2PZW A;  2EYM A;  3NK9 A;  2F0E A;  2RKS A;  4KTA A;  2F0V A;  4K5X A;  4PMB A;  1NUC A;  3SK6 A;  3P1H A;  5IGB A;  3D4W A;  3OWF A;  1SNC A;  2F0D A;  5DEH A;  3RUZ A;  3NP8 A;  5IGD A;  1KDA A;  5J1Z A;  3C1E A;  1JOO A;  1U9R A;  4N9P A;  1EY6 A;  2F0I A;  4WRD A;  2F0K A;  3NQT A;  4KD4 A;  4QF4 A;  5EKL A;  1EY5 A;  1KAB A;  4NMZ A;  3QOJ A;  2F0M A;  1SNO A;  2EYO A;  2M00 A;  3BDL A;  3NXW A;  3R3O A;  2F0L A;  4HMI A;  4J6H A;  4NKL A;  4ODG A;  4DFA A;  3SK4 A;  4EQN A;  5HGT A;  4ME5 A;  5DAU A;  4KD3 A;  1F2Z A;  1AEX A;  2PW7 A;  5CV4 A;  3PMF A;  1TT2 A;  2PQE A;  2F0F A;  1EY0 A;  2EY2 A;  2KQ3 A;  2PYK A;  2EYJ A;  1STY A;  4PMC A;  1EY8 A;  4K2K A;  4KJN A;  1A2U A;  3P75 A;  1JOR A;  4KY7 A;  3OSO A;  4H7B A;  3D8G A;  3EJI A;  1II3 A;  3MXP A;  4IZ8 A;  5KRU A;  3MHB A;  3TME A;  2HQE A;  4KJO A;  3SK5 A;  2F0W A;  2PZU A;  3QB3 A;  1KDB A;  1A3T A;  3MEH A;  1TR5 A;  5NUC A;  3TP6 A;  3TP5 A;  1SYD A;  1KDC A;  5EKK A;  2KHS A;  1SYF A;  5CV8 A;  4NP5 A;  5I6W A;  4K5W A;  5CV6 A;  2RDF A;  4ZUI A;  3V2T A;  2NUC A;  5M9O A;  1STG A;  1A3V A;  1TQO A;  1A2T A;  1SYG A;  5E3F A;  1JOK A;  4K6D A;  4DU9 A;  1EY4 A;  3NUC A;  5CV5 A;  5IGF A;  3S9W A;  3HEJ A;  5JOB A;  5CGK A;  5J22 A;  1EY7 A;  3BDC A;  5C4H A;  2ENB A;  4B9W A;  4ID6 A;  1SYB A;  3D4D A;  4G57 A;  2EYP A;  2EYF A;  3C1F A;  3MVV A;  4J1M A;  1EYA A;  4ZQ3 A;  2F0U A;  3SK8 A;  4E6I A;  2F0J A;  5JAV A;  4PNY A;  1KAA A;  1F2M A;  3SR1 A;  4EQP A;  5IIF A;  3EVQ A;  5KYI A;  1ENA A;  2F0G A;  3U9O A;  2EY6 A;  2SNS A;  2PZT A;  4K14 A;  4K2L A;  2F0S A;  5C5L A;  2F0N A;  3OMC A;  5KEE A;  4I65 A;  1STB A;  1A3U A;  4MIU A;  1STH A;  5CV9 A;  2EY1 A;  4F8M A;  2EXZ A;  4QB4 A;  3SHL A;  2F0P A;  4IUN A;  4K5V A;  5IOC A;  4R8N A;  1NSN S;  3QOL A;  2O4X A;  4HTH A;  4DGZ A;  4EVO A;  4K8J A;  4QMG A;  2EYH A;  3HZX A;  4S3S A;  5C4Z A;  4LAA A;  5CC4 A;  4ZUJ A;  2OXP A;  1SND A;  4TRD A;  5E1F A;  1EY9 A;  2QDB A;  2PW5 A;  3MZ5 A;  4YIJ A;  5KGU A;  4DF7 A;  3D6C A;  4HMJ A;  1IHZ A;  5F2D A;  5EGT A;  2F0T A;  3T13 A;  5C3W A;  2SNM A;  3OMG A;  1SYE A;  2OF1 A;  5K5P A;  1SYC A;  5KYL A;  3ERQ A;  3ITP A;  5KIX A;  5I9P A;  5CR3 A; 
#chains in the Genus database with same CATH topology
 2IHE A;  4YHH Q;  3I4L A;  1CKM A;  2H1E A;  3CXC A;  1EZ6 A;  2E2J B;  3A74 A;  2JP1 A;  4NPS A;  3TS2 A;  1U0L A;  1DGS A;  4BY7 B;  1JCK B;  2QF7 A;  2BH2 A;  1ZYR D;  2XWJ B;  2IW3 A;  5M3F H;  4OWW B;  4H0L C;  1SNM A;  4A3I G;  1PFN A;  1DYQ A;  3K8A A;  1Q81 C;  1RCV D;  3PUV A;  5C4X B;  1B44 D;  1CSP A;  1U5K A;  4ALP A;  4JI8 Q;  3K0X A;  3A7L A;  5IGB A;  1EYG A;  2F0D A;  4GN5 A;  1SN8 A;  1SE3 A;  2E2I H;  3NQT A;  4KD4 A;  4C3J H;  1N34 Q;  3H09 A;  5C4J B;  1Q7Y C;  4P73 A;  4NKL A;  5HGT A;  3CF5 A;  3H0G B;  2E2D C;  2VQF Q;  1KLG D;  1KNA A;  2R93 B;  2G9D A;  1Q90 A;  4I7A A;  3OHX C;  1EY0 A;  2Y0S G;  1O78 A;  1PXU A;  2QCP X;  1L0Y B;  2GVA A;  5AFW A;  2B2Y C;  3JAM E;  1WCM H;  1HNZ L;  1HZ9 A;  1Y69 U;  4OX9 L;  1QJO A;  4UP8 A;  4KJO A;  3SGI A;  1LTS D;  1KDB A;  4H44 C;  4JI5 Q;  3I3C A;  4JOI C;  1VQ9 A;  1O7L A;  1OXV A;  4IFD H;  4XQN A;  1IW7 D;  1HQM C;  1C9O A;  3HG9 A;  3HOU G;  5IT9 L;  5C4H A;  2JA6 B;  5EPJ A;  4G7O C;  4JI5 L;  4BBR G;  1HA5 A;  2EYF A;  3RZO B;  1F9R A;  2QEJ C;  4WJ3 M;  4ZKC B;  4GN3 B;  3VYS A;  4DV2 L;  1G2S A;  5KYI A;  3EBE A;  1ENA A;  4IPD A;  3VR5 A;  2SNS A;  3AMU A;  2F0N A;  3GP7 A;  1X55 A;  3TEH B;  2EY1 A;  5D3D A;  4IUN A;  1HHV A;  1D8L A;  4BY1 G;  3KFU A;  1JJC B;  2KCT A;  2I5L X;  1PRT D;  2AUJ D;  1B1Z A;  4JVZ A;  4JI1 Q;  2AUK A;  1E2Z A;  2YV5 A;  2NVQ B;  1FJG L;  2J7Z A;  4BA2 I;  1I4G A;  1L0X B;  3W3A A;  3KDF A;  4L5T A;  4C3I H;  4JW0 A;  4HJ7 A;  2JK8 A;  4GZY C;  4X6A H;  2B29 A;  5D3I B;  1ENC A;  4RKL A;  2F0Q A;  2JSO A;  4A3M B;  4RKB A;  1HUM A;  1Q12 A;  2D9U A;  2CFM A;  1I4P A;  2EPB A;  3DM3 A;  4NB3 A;  2N78 A;  2IL8 A;  1EOT A;  1JWM D;  4N9T A;  4RHS A;  3J80 c;  3PF5 A;  2E8G A;  1PYB A;  3A5U A;  1NTG A;  1WTX A;  3PO3 H;  4DV1 L;  3RUZ A;  5DEH A;  1S5E D;  4EQ5 A;  3NP8 A;  1MHW C;  2MQH A;  2LXK A;  2A1A A;  3J7A F;  4AYB E;  2D0O A;  2KCC A;  4JV5 Q;  4M8A A;  3K5M A;  4LF4 L;  4DXG A;  1NMF A;  3KOJ A;  3M85 A;  3DEO A;  2PW7 A;  4LF6 L;  1G6P A;  4JK1 C;  3NBH A;  1QG7 A;  4DR5 Q;  2JA5 H;  2D5D A;  4FF1 A;  1B7Y B;  4KJN A;  5JPN C;  2F3I A;  1ONL A;  4H7B A;  2A6H C;  4ZK9 B;  3ZYY X;  1F9P A;  1K8G A;  4IZ8 A;  3J7Z C;  1GJX A;  4B3R Q;  2PZU A;  2B63 G;  2KVM A;  4OEM B;  1CT1 D;  1KLU D;  2I5H A;  3E9I A;  4OXP A;  1P16 A;  3I70 A;  3GTJ H;  1EL0 A;  4Z9C B;  5BR8 L;  1CKN A;  5IY0 A;  1U4R A;  3HOU H;  3HOY B;  1TXY A;  3P20 A;  3QO2 A;  1SYG A;  2LFN A;  2AQ2 B;  2WAQ G;  1I3Q H;  1B4O A;  3S2D H;  1ESR A;  4A3D G;  1MD2 D;  1PTO D;  2AKW B;  4LF9 Q;  2VXW A;  3K58 A;  2LY7 A;  4ZQ3 A;  1Y8N B;  1F2M A;  1A8V A;  1IYJ B;  3K5L A;  2JJQ A;  1CKN B;  1DM0 B;  2JA7 H;  1VQL A;  4DR1 L;  5CV9 A;  1STH A;  4P75 A;  2RHQ B;  2EE1 A;  3KLS X;  3BZK A;  4A93 H;  1KC8 C;  5IOC A;  4IFD J;  2RVL A;  5CC4 A;  4CDC C;  1X9N A;  5EQ0 A;  1NY4 A;  5E1F A;  3IRB A;  3Q23 A;  4HCE A;  3OWE B;  4JBK A;  3DEP A;  2HHH Q;  3UDI A;  1HTP A;  1I50 B;  1CA6 A;  1PZK D;  3MXU A;  4K8I A;  1Z7T A;  4DV0 L;  1QZG A;  1VF5 C;  1X6O A;  4UP9 A;  1PH9 A;  4XXE A;  3PUW A;  3SE0 A;  4DK6 C;  2UXC L;  2MO0 A;  3H6M A;  1IBL L;  1A62 A;  1X3G A;  3OTO L;  4LFA L;  2ZT9 C;  2XTI A;  3K7A H;  4DK0 A;  1EZ8 A;  4L6T B;  1V9P A;  4HN7 A;  4ZAI A;  5JVH 3;  2CWP A;  4P71 A;  2R92 B;  2BDN A;  5J39 A;  1K3R A;  2F03 A;  1F9Q A;  1BCP D;  1MI2 A;  4R4C A;  2FHT A;  2CVR A;  2K75 A;  1I6V C;  5ELC A;  3D4W A;  2DY8 A;  3D4R A;  1AP0 A;  5I2Y A;  4OWX B;  4XYQ A;  3I7F A;  1IW7 C;  1DD2 A;  1OO9 B;  1IBK L;  2RQX A;  4J6H A;  4OWT B;  1Q46 A;  3KLW A;  2OCE A;  2F52 A;  1Z47 A;  3K5O A;  2M2L A;  4NXM Q;  4FYD A;  4JI6 L;  4C3H G;  1CSQ A;  1LUZ A;  3G6J B;  5EPL A;  4BY1 H;  2PYK A;  4HJ5 A;  4HID A;  4ZKB B;  2WKD A;  4DR5 L;  4JBM A;  3M7G A;  1V1Q A;  3J81 i;  2C9O A;  1Y1V G;  2JA8 B;  3RZO H;  1FD7 D;  2EVB A;  3HOW G;  3M3Y H;  1BVS A;  3GTO H;  3MXN B;  1NJI C;  2RCN A;  4DR6 L;  3PUX A;  1I94 L;  4A3D H;  5ELN A;  1QNK A;  2NUC A;  3Q24 A;  4LFC L;  4JI0 Q;  4DR2 L;  1YNJ C;  4A3L G;  5EAY A;  3S16 H;  3CC7 A;  4A3B H;  3J7Y W;  4AH6 A;  3D4D A;  1EIH A;  3M4O B;  5BN4 A;  3S1M B;  3HOX G;  4C2M B;  4X3K A;  4X65 Q;  1I5F A;  4BXX H;  1R9T H;  2XGT A;  2X6L A;  4F8M A;  2R92 G;  4QUC A;  3CCL A;  2Z9H A;  1J5E Q;  2RSO A;  3N6R A;  4OIK A;  3OPO A;  1S72 A;  3GTM H;  1GUW A;  1KHI A;  1OXT A;  4UAI A;  2WB1 G;  3AFQ A;  2KED A;  3MEF A;  4O42 A;  2R7Z G;  1GM5 A;  2P5Z X;  1KNE A;  2R7Z H;  4QCL A;  3NSW A;  1PH5 A;  1STE A;  2E76 C;  3KDF B;  4C3J B;  3RMH A;  3D3R A;  3E5S A;  3VYR A;  3URY A;  3I56 A;  5J3B A;  4GNX B;  4CJ1 B;  4DR7 L;  4MZ9 A;  5IP7 G;  2YU9 H;  1BBW A;  2KA7 A;  5M5W H;  3NBI A;  2E75 C;  4FXK C;  3DHQ A;  4JI3 L;  1I6H B;  1Y8P B;  3KLS A;  1K8A C;  3IAY A;  3KBX A;  4A3J B;  4X66 L;  2OQ0 A;  4NXN L;  4TKO B;  4GLX A;  2F0E A;  4GNX A;  1X3F A;  3CP0 A;  3GTL B;  3K59 A;  4R8I A;  2DNE A;  4H02 A;  2C35 B;  1WD0 A;  3EIV A;  2I0Q A;  4YCW A;  2I07 B;  1TWH H;  3QOJ A;  3F2C A;  3R2I A;  5KNB A;  1K8M A;  3SK4 A;  3JAM i;  1TS2 A;  2K32 A;  4JI4 Q;  3NE5 B;  4ZRZ A;  5CV4 A;  1YNJ D;  1ML0 D;  2E2I B;  2KQ3 A;  1LTA D;  4I7Z C;  5C3E B;  1NNX A;  1EEI D;  4A3K G;  1HPC A;  2QKI C;  3U9S A;  4DR4 L;  4ULL A;  1ZXT A;  3P75 A;  1TS5 A;  1PYW D;  1X32 A;  2HQE A;  3IFD A;  3OTO Q;  1N32 Q;  5CV8 A;  4NP5 A;  1QIL A;  3E6Z X;  2C5C A;  1HNW Q;  1EU4 A;  4YHH L;  1X3P A;  4MTN A;  1K3B C;  5CGK A;  1XNR L;  3MVV A;  2KEC A;  1SE8 A;  4ZYS A;  2AMC B;  1XTC D;  4A3G G;  2A69 C;  2F0G A;  1B9M A;  4I65 A;  4LWC A;  1YJW A;  1PH1 A;  2VUM H;  5IT9 c;  1PTO F;  1QE6 A;  2UXD L;  1NSN S;  2WIN B;  3J7A 5;  3H3V C;  2OTL A;  3AB9 A;  4HMJ A;  1IHZ A;  2UUB Q;  4DXF A;  2AQ1 B;  1UE1 A;  3LGJ A;  3MEH A;  1SYC A;  3I4M G;  3Q6S A;  3CC4 A;  4IFD I;  2BE5 D;  3NWT A;  4KKT A;  2EY5 A;  3CCV A;  1F2Y A;  3PCO B;  1GHJ A;  1EUJ A;  4NDX A;  5DLQ E;  2DUD A;  3M3Y B;  1K83 H;  1L0W A;  3KF6 A;  4DUZ L;  1N34 L;  1QOH A;  2PQA A;  3NHH A;  1M90 C;  2K5H A;  3SEB A;  4XYO A;  3RD4 A;  1NUC A;  4APV A;  1YIJ A;  4A3B G;  5ELF A;  4DAM A;  2E2J H;  4KN4 C;  3T56 B;  4BBS H;  3S16 B;  1PLF A;  1JOO A;  3QJY A;  1AN8 A;  1CHQ D;  3HOY H;  3HOU B;  4X64 L;  4FVM A;  3HOW B;  4KHP L;  5DAU A;  4KD3 A;  4GKK Q;  4A3G B;  3PMF A;  1XTD A;  1PH8 A;  3DWP A;  2B3G A;  1STY A;  1E7Z A;  4HIM A;  1EQQ A;  4QL5 A;  4U68 A;  4AQY Q;  5M3M B;  1D7Q A;  3OSO A;  4R1J A;  2K6A A;  1L1O C;  4XDX A;  1II3 A;  4A3I B;  1VQ5 A;  4ABN A;  4PQX A;  4QIW E;  3L9A X;  2JXM B;  1SYD A;  2AWN A;  1BOS A;  1S5B D;  2NN6 I;  4AIM A;  4GKJ Q;  4PG3 A;  1HH2 P;  1G8Z D;  3PIO A;  3I55 A;  3N52 A;  3BG3 A;  4BBR H;  5IP7 H;  1CKO A;  3J80 i;  5IGF A;  2NVX B;  1D6E C;  2NZO A;  2A68 D;  3KUP A;  1E3P A;  3BDC A;  3QR8 A;  2ENB A;  5BN5 A;  1YBY A;  2ZTD A;  1ESF A;  4B3M Q;  4CKB A;  5E4W C;  5JAV A;  1M4V A;  2F1M A;  3SR1 A;  2Q8I B;  3EVQ A;  2DJG C;  5M5X B;  1MBY A;  5JVG 3;  2L12 A;  2IX0 A;  4A3K B;  4Y7N B;  3FRP B;  2G5D A;  4DR3 Q;  3HFZ B;  1TII D;  3BU2 A;  4S3S A;  1QWY A;  2OXP A;  1FVI A;  2QDB A;  3FVQ A;  3MZ5 A;  3V96 A;  3H15 A;  3MWY W;  4Q0F A;  4RMF A;  1FGB D;  2WKC A;  3TBI B;  3DUZ A;  1N32 L;  4K0K Q;  4RGT A;  2RDH A;  3KYH C;  1H9S B;  1EIG A;  3AFP A;  2MPM A;  3UDG A;  3GTQ B;  2F3W A;  3RNU A;  1LT4 D;  3S14 B;  3PO2 H;  2B2T A;  3FDT A;  2OWO A;  1BKB A;  1JR0 D;  1EEF D;  3DM1 A;  3FKI G;  2K52 A;  4O2D A;  5C5M A;  2ZTE A;  2BE5 C;  1EYD A;  2MNA A;  3FKI H;  2RBM A;  3JAM L;  3DMU A;  5M3M H;  3KJP A;  3MXN A;  3CRL C;  1CZW A;  3PSI A;  5G3L D;  2NB0 A;  2RKS A;  1NE3 A;  3R2T A;  3SVM A;  1NAP A;  4FF3 A;  5JEA H;  1KD1 C;  1D2B A;  1XMQ Q;  1WD1 A;  1ENF A;  2F0I A;  4A3D B;  3S24 A;  4IUU A;  3FHW A;  2HIX A;  2A69 D;  1HR0 W;  4ME5 A;  5IP9 H;  1IXR A;  2FXQ A;  4G7H C;  1D5X C;  4GOP C;  2Z8L A;  4A76 A;  3T1H L;  3GV6 A;  2IHF A;  1G51 A;  3PO3 B;  1VQP A;  2SEB D;  1BCP C;  4XQQ A;  3U58 A;  3C46 A;  4R9W A;  1TS3 A;  2JQO A;  4GNX C;  1VS0 A;  4KY7 A;  2DGY A;  3IL8 A;  1Q8I A;  3MHB A;  2K03 A;  4EGV A;  4AYB G;  4WJ4 A;  1LO5 D;  1W3S A;  3KF8 A;  1IZ6 A;  1I94 Q;  4DK3 C;  2XVS A;  1SYF A;  4HCS A;  4DUZ Q;  1N36 L;  1VMC A;  1LT3 D;  1STG A;  4JI8 L;  2FMC A;  1PTO B;  1UE5 A;  1O80 A;  2RSN A;  3HS0 C;  3CME A;  2XIW A;  5FJ8 H;  3FMC A;  4YY3 Q;  3G48 A;  1FL0 A;  5IE8 A;  3GQB A;  1CM9 A;  4KHP Q;  2PZT A;  3IFT A;  1SMX A;  4NXN Q;  1A3U A;  4LF9 L;  3SDZ A;  3T4A C;  3T51 B;  3PUY A;  5M5Y B;  3A8K E;  2O4X A;  4A93 G;  2NTS A;  4JI6 Q;  3NTH A;  1XPR A;  1GUT A;  5KGU A;  1Q8K A;  5FLM H;  3D6C A;  4UHV A;  3J81 L;  2EDG A;  3HOW H;  2KHJ A;  2OT2 A;  2EOT A;  4RAU C;  5M5W B;  3U4V A;  4JI7 Q;  2UXB L;  2ASB A;  4F7X A;  1H9S A;  5CYU A;  1SDF A;  1S5F D;  2RF4 A;  5C6A A;  2KEE A;  3BYY B;  2WAC A;  5FKA C;  2G9H D;  2K4K A;  4FP5 D;  4OO1 H;  1JC7 A;  1D5M C;  1TWA H;  1VQH A;  2PQA B;  2F4V L;  3GTM B;  3HKS A;  2IX1 A;  3NBH B;  2YTY A;  5LMN L;  4PZ7 A;  1VQI A;  3CKI B;  5GAD C;  2J4X A;  1SNC A;  3MAQ A;  1YIT A;  1Z6H A;  3D31 A;  2EQS A;  4GLV B;  1W2B A;  5J1Z A;  5IT9 E;  3IKJ A;  4DV7 L;  1CK1 A;  3NWS A;  4NMZ A;  1TS4 A;  2ATW A;  1LTL A;  3R3O A;  3G7L A;  4HMI A;  5DM6 3;  1GO3 E;  3K57 A;  2NBF A;  4TSS A;  1B9N A;  1C4Q A;  4JI7 L;  4Y7N H;  3ZJY C;  3MFG A;  3A55 A;  4RGN A;  3BJU A;  4X3U A;  4EX5 A;  3EJI A;  2B2W C;  3MXP A;  2ZM6 Q;  4KLK A;  4OON A;  4A3F B;  4H13 C;  1UEB A;  3P7J A;  3QB3 A;  3W2D A;  3HP3 A;  5I2X A;  1TR5 A;  1SRU A;  1HR0 L;  1SE4 A;  3CAM A;  3GV3 A;  1ZEQ X;  1Q1E A;  4HJ8 A;  4UY8 C;  3S15 B;  1HZA A;  5E3F A;  3UDX A;  3ER0 A;  4FF2 A;  3GTK H;  1K9M C;  3S14 H;  5CV5 A;  4DUY Q;  3HKZ G;  4XTC S;  3PIO 3;  5HGQ A;  4A3E H;  4JBW A;  4BXX G;  2FJ2 A;  2F0U A;  5C3E H;  4E6I A;  3C2P A;  4DV4 L;  3U9O A;  3I91 A;  2EJG C;  2PI2 A;  3CMA A;  3L7Z C;  3X3N A;  3JAM c;  5C4X G;  4IPG A;  1MKH A;  4R4Q A;  3MC0 B;  3I4N H;  1I4Q A;  5JJL A;  3C3L A;  2VZA A;  4L5R C;  1ZYR C;  1VQB A;  4LF8 L;  4LFA Q;  1PZI D;  3F1Z A;  4X65 L;  1YNX A;  1JB3 A;  3V05 A;  4DAY B;  1BCP F;  2PW5 A;  1I4X A;  1QUQ B;  2PNR C;  3RR5 A;  2ES2 A;  1HTL D;  1TY0 A;  4N8F A;  1G6Z A;  1SJH D;  2OF1 A;  1O7I A;  4JI3 Q;  2E2H B;  3AU7 A;  3R8B A;  2JA5 G;  2HCI A;  4QGU A;  5G3L F;  2Y0S B;  1K73 C;  1SNQ A;  1PDQ A;  1SNP A;  2H4O A;  3HOZ H;  4OIJ A;  1Q1B A;  1YJN A;  4HSP A;  2BOS A;  1JT8 A;  1ROD A;  4C1N I;  5I9O A;  2HUG A;  5FO8 B;  1H9R A;  2EYM A;  3NK9 A;  3I90 A;  3J81 E;  4PMB A;  2VUM G;  5LL6 S;  4TVA B;  1YEZ A;  2WAQ B;  4CDF C;  4YWM A;  1JE4 A;  1TKW B;  1PYS B;  1EY5 A;  2JA6 G;  1T9H A;  5EKL A;  1UNS A;  3L2P A;  1WTP A;  1B3A A;  1PH3 A;  3T1H Q;  2JA9 A;  1AEX A;  1VQD A;  1G2T A;  2XRS D;  2PQE A;  3F2B A;  1LTG D;  5A2Q L;  1EIY B;  1KL9 A;  1YZ6 A;  5M5Y H;  4GOP B;  2YU9 B;  3K81 C;  5E4X A;  2ZTC A;  2A74 C;  2PMZ E;  4HR7 B;  4JG2 A;  2B2V C;  1VQN A;  4P72 A;  1X65 A;  5IWA Q;  3RN2 A;  4MN3 A;  1WCM B;  2PI2 E;  1XMQ L;  3CCS A;  3GD7 A;  4LUO A;  4OHJ A;  1J9O A;  2I5M X;  1JOK A;  1N36 Q;  3GTL H;  3KJO A;  3CC2 A;  4LJZ C;  2VB3 X;  2B8G A;  4G57 A;  4QUF A;  4IUT A;  1BNZ A;  5M3F B;  3EN2 A;  1MIU A;  3WOF A;  3AQQ A;  1RD9 D;  4RG1 A;  3VYT A;  1TWA B;  1SBB B;  2L9H A;  4FNF A;  1XMO L;  2UUB L;  4CBV A;  1C7Y A;  2L11 A;  3GDE A;  3HKZ B;  3CCJ A;  1PTO H;  5E7N A;  2XSC A;  2A6E D;  1VQJ A;  2ALY B;  4A3M G;  2DY7 A;  1CA5 A;  3CRK C;  1JIC A;  5D14 A;  4MHE A;  4X3T A;  3ULP A;  1L2F A;  2CQA A;  2EJF C;  5K36 G;  1NR2 A;  3KK7 A;  2JN4 A;  2RA4 A;  5IYB G;  2UU9 L;  5KYL A;  3CHB D;  1PH6 A;  1JMC A;  4OX9 Q;  1QB5 D;  5CR3 A;  3VR6 A;  1YHQ A;  1IBL Q;  4QQB X;  1WTH A;  2EJM A;  4IAL A;  3LNN A;  1J6Q A;  1EQV A;  4A75 A;  3VA5 A;  4DR7 Q;  3M9B A;  4OL7 A;  1OTC A;  2JA8 H;  4FXG C;  1IYU A;  1V43 A;  1Y1V B;  2JA8 G;  2K5N A;  3S1Q B;  3VA7 A;  5LMN Q;  2K28 A;  4RH6 A;  2LKV A;  3BZC A;  5FJ8 G;  1SSO A;  3UE1 A;  2CCZ A;  1PH4 A;  4K5X A;  1Q86 C;  1QVG A;  3CCE A;  1LV9 A;  4GN4 B;  1DJR D;  1YNN D;  3FKI B;  1E2V A;  2L1B A;  1F9S A;  1FNU A;  4LF4 Q;  1PH2 A;  1KAB A;  3MFY A;  3BDL A;  2YTV A;  2F0L A;  4DFA A;  1SXT A;  4RWS C;  2O5J C;  4CHT B;  3EFX D;  1Y8O B;  1OXU A;  3UE0 A;  1ASZ A;  5IYC G;  3F8T A;  4DV3 L;  1PFM A;  2B2Y A;  4U67 3;  4A3E B;  3H94 A;  2Z1C A;  1NMG A;  4PZ6 A;  1XPU A;  1TWF H;  1SEB D;  3TP6 A;  1R4Q B;  5EKK A;  3NEM A;  2XNA C;  4A3C G;  2HQL A;  3PGZ A;  1A3V A;  1D1I A;  2O5I C;  4CJ2 C;  5I4D A;  3H3V I;  3NUC A;  1QVC A;  3BZD B;  1V1P A;  4V19 0;  4IFD G;  1IKL A;  5JJK A;  1SYB A;  3K6O A;  5C0X H;  1LT6 D;  2QDL A;  1B3Q A;  3M7N A;  1PMR A;  4IO9 A;  2O2L D;  2CW0 D;  5AJ3 L;  2L15 A;  1T5X D;  2L4N A;  1VQ4 A;  1CQV A;  2K5D A;  2HIV A;  4R8N A;  3VR2 A;  4GKK L;  4IPC A;  3I73 A;  4IPH A;  5JEA J;  1D1K A;  1G91 A;  1TWC B;  1TWH B;  5EBC A;  2F0T A;  2KJX A;  4P74 A;  1YVC A;  2SNM A;  4B3T L;  3K7U C;  3I4N B;  5I6Y A;  1HUN A;  2Z6K C;  1TU2 B;  2EYL A;  2KEN A;  5EJW A;  1H9K A;  2KUM A;  3A56 A;  3BVZ A;  5HUR A;  2A68 C;  1S5C D;  1JOQ A;  2SDF A;  4IJH A;  1XWE A;  1N8R C;  2NN6 G;  1EFI D;  1KIX A;  5GRO A;  1WTQ A;  4LNQ A;  1ET6 A;  3CU7 A;  1WYD A;  2SOB A;  3A0J A;  4DN4 M;  4G4K A;  5C4J H;  3DLL A;  2IX3 A;  2UUC Q;  5JEA G;  2F0V A;  1IBM Q;  1QVF A;  3S2D B;  3R93 A;  4IUR A;  4KKS A;  2R92 H;  2UXC Q;  5TSS A;  1Y1W G;  4PV1 C;  5C44 G;  1CTM A;  2N3S A;  2M00 A;  4IUP A;  1RDP D;  1B2T A;  3I8Z A;  3L3O C;  1F2Z A;  3ULL A;  3TQY A;  2MHV A;  1A63 A;  3DWA A;  3GTQ H;  1RIP A;  2R7F A;  1I3Q B;  4XT3 B;  1E22 A;  4WJW A;  1K0R A;  4CDE C;  4DNR B;  1YJ9 A;  4ZCK A;  2VQE L;  1RF2 D;  4TQU S;  2DN8 A;  3TZD A;  4BS9 A;  3HOX B;  5IYB H;  1U4P A;  1VQG A;  1U4M A;  2D2C C;  2H5X A;  1JWU D;  3FEW X;  5CMD A;  5M9O A;  1VQK A;  1A6X A;  5IYD H;  3PV0 A;  2RHS B;  1HNX L;  3S9W A;  3AEV A;  1EOV A;  2KHI A;  3HEJ A;  5LMU Q;  4GLA C;  3RZD H;  1X56 A;  2IWH A;  4PNY A;  3H0G G;  2JA7 G;  2CKZ B;  5IIF A;  5D65 A;  2QEX A;  1ILQ A;  1AW7 A;  2YYZ A;  5CBA E;  2IT1 A;  2JA6 H;  3PO3 G;  4MIU A;  4A3F H;  4HSV A;  1XNQ L;  5ELD A;  2F0P A;  1U4L A;  3NTI A;  3B6Y A;  3ULJ A;  4L5S A;  2L0C A;  5ELE A;  4X62 L;  4RCN A;  2EYH A;  4KHZ A;  4AYB B;  1SLJ A;  3NTK A;  5IWA L;  4ILW A;  5FK9 C;  1BXT A;  1GUO A;  1V1O A;  1Y1V H;  2ICI A;  1XYI A;  1LTT D;  3PQI A;  3S1Q H;  4RA8 A;  4KKU A;  1RTN A;  1NCV A;  1SYE A;  1LTI D;  2LS0 1;  1BBX C;  1WTR A;  1N9W A;  1IL8 A;  2K14 A;  5IGE A;  2A5H A;  4BY1 B;  3Q0A A;  1C48 A;  2F4V Q;  4QIW B;  2B2T C;  3JC6 6;  1EYC A;  3SXH A;  1BF4 A;  2CH4 W;  2Q2I A;  3QG1 A;  4DAY A;  1DZ1 A;  5IOD A;  1UAP A;  1ZKO A;  1NBW A;  5C3X A;  5H1S E;  3ERO A;  2BDO A;  3HOZ B;  3A54 A;  3TN2 A;  4JPB W;  4C56 C;  4A93 B;  4XQJ A;  3K0Y A;  4DV4 Q;  4X62 Q;  4M1U B;  2VL6 A;  3GTG B;  4X64 Q;  3C1E A;  2B2U A;  2WB1 B;  2E2H H;  4IUQ A;  1FNW A;  3NXW A;  1NR4 A;  5C0X J;  1BUV T;  1ASY A;  1ICW A;  1XMO Q;  1UUP A;  3UI2 A;  2E74 C;  4A3M H;  2WP8 J;  4DA2 A;  1EIF A;  2F0F A;  1JJG A;  1HR0 Q;  1IBK Q;  2LSS A;  2Z4I A;  4LFB L;  4JI0 L;  2K01 A;  5KRU A;  4LFC Q;  1HA6 A;  1DOL A;  5C0X I;  2K5Q A;  4DV6 Q;  1A3T A;  3H3V H;  4IOC A;  1WI5 A;  3FPU B;  1HXY D;  4K6D A;  1KRT A;  4DU9 A;  1AZP A;  4V0B A;  4BBS G;  1HCZ A;  3OIQ A;  3C1F A;  3VR4 A;  3SK8 A;  2NVT B;  2KCM A;  2A6H D;  1TWF B;  3GTO B;  1YI2 A;  1YNN C;  1G29 1;  3TSS A;  1J8I A;  1Y1W H;  1GUG A;  4UPA A;  5C5L A;  3OMC A;  3S1N B;  5C3E G;  3G71 A;  2R6G A;  4HTH A;  1LM0 A;  1VDZ A;  4A3B B;  4QMG A;  4KK7 A;  1X3Q A;  3PUZ A;  2D62 A;  3AYH B;  1K28 A;  2UUC L;  1BDO A;  3CPF A;  1UEA B;  2WAQ E;  5F2D A;  2GA4 B;  2EXD A;  3KF8 B;  1K0S A;  1TY2 A;  2KCN A;  1S5D D;  1S3O A;  2L5T A;  4K0K L;  5ISR A;  3K80 C;  3OW7 A;  5JJI A;  3TS0 A;  1EFW A;  2F3V A;  1TVX A;  2B8F A;  3A5Z B;  2E5L L;  1LLR D;  1YHA A;  1F77 A;  2BCO A;  4DAV A;  2Y0S E;  2GN5 A;  4HJ9 A;  2XRQ D;  4YWK A;  4RFB A;  5CV7 A;  4DNI A;  4DNT B;  3TP8 A;  2FMM A;  2TMP A;  2K05 A;  2PZW A;  2PNH A;  4A3I H;  2DNC A;  4KTA A;  1VQM A;  1FR3 A;  1XPO A;  3TRZ A;  2HCC A;  4POG A;  3DWQ A;  1I50 H;  1EY6 A;  2Q2T A;  2CQO A;  1PFS A;  1PRT C;  4ODG A;  4A3F G;  4JYA Q;  5COY A;  1PRT F;  3T1Y L;  1MJE A;  3A8J E;  3BVM A;  2VUM B;  2FFK B;  1Z9F A;  1VQ7 A;  2NVT H;  2BA1 A;  4CDD C;  1N33 Q;  5JJZ A;  1AZQ A;  3S1R B;  1IL2 A;  3S1N H;  4A3K H;  2JEA I;  2ZXR A;  2PCF B;  3TP5 A;  2MJ8 A;  2YTX A;  2KHS A;  5LHY 1;  3S2H B;  5I6W A;  1YHB A;  4ZUI A;  5FLX L;  2PMZ B;  1DOK A;  1MGS A;  4CKE A;  5BR8 Q;  4ME3 A;  1SE2 A;  1PHJ A;  1BBU A;  5J22 A;  4DV3 Q;  2VNU D;  1Y14 B;  2DJF C;  1R4P B;  1SFO H;  2AHO B;  3MXG A;  4YCU A;  3BS1 A;  4NW2 A;  3O13 A;  3BVG A;  5KEE A;  1VQ6 A;  1TWC H;  1HRJ A;  1E1T A;  1STB A;  1K8O A;  3RLO A;  3M4O H;  2EXZ A;  2NZH A;  5C44 H;  2JA5 B;  4ZLT F;  3E0E A;  5C4Z A;  3QWN A;  1I4H A;  1J5E L;  1R9T B;  3GTG H;  1SND A;  1BO0 A;  4GS3 A;  4YIJ A;  1C0A A;  2Z4H A;  2JEB I;  2HHH L;  4DF7 A;  2X6G A;  1K83 B;  1QUQ A;  4F88 A;  4FF4 A;  1IKM A;  5C3W A;  3STB C;  5FLX c;  2N8N A;  3J7A V;  4LF7 Q;  1W6K A;  1I6H H;  1VQF A;  1HZB A;  3L0O A;  3ND9 A;  2NYZ D;  2ID0 A;  1EQR A;  4BBS B;  3I4M H;  1C8C A;  4B3S Q;  1PTO C;  3HOV G;  3ICE A;  1GXD C;  1ICF B;  2JE6 I;  1STA A;  3W1B A;  2BH8 A;  2MFI A;  4KY5 A;  3H0G H;  2K7V A;  1KQS A;  3HOV H;  1DOM A;  4YWL A;  5L37 A;  2NN6 H;  4C3H B;  2K5V A;  3ND8 A;  3SK6 A;  2L55 A;  3MA2 B;  3HOX H;  4LF5 L;  3OWF A;  2V4D A;  4JI2 Q;  1S4Z A;  3NEN A;  3WDN A;  3PF4 A;  4B3M L;  1JWS D;  1BCP B;  4QF4 A;  4KN7 C;  3RLN A;  2EYO A;  1X3E A;  4EQN A;  3KF6 B;  2NTT A;  2K04 A;  1F2L A;  1HNW L;  1FGU A;  5M5X H;  2UU9 Q;  4LW1 A;  4UDU C;  2FIN B;  1TT2 A;  2Q2H A;  2VY3 A;  5ELB A;  1WCM G;  4J15 A;  5GAG C;  5A35 A;  2EYJ A;  1GVP A;  1H9J A;  1I4R A;  4PMC A;  1KXL A;  1E2W A;  1S40 A;  1VQA A;  1JOR A;  3MTS A;  1E24 A;  3U50 C;  3TME A;  4FXD A;  3SK5 A;  4A3J G;  1UE7 A;  4QY7 A;  2Z6K A;  4JBJ A;  3HOZ G;  3EQL C;  3RZD B;  3A7A B;  5GQO A;  5FLX E;  4DKA C;  4B3T Q;  1HNZ Q;  1WFQ A;  2A73 B;  1EU3 A;  1SJE D;  1IYV A;  2MUY A;  2N88 A;  1Q82 C;  4FO2 A;  2B39 A;  1MSH A;  4J1M A;  2R61 A;  2B63 B;  2VW9 A;  1H9M A;  4LF5 Q;  2NZ1 D;  3CQZ B;  2Z0S A;  2F0S A;  3S17 B;  3VDY A;  3BYT B;  3BDO A;  1TWG B;  3J80 L;  2HD3 A;  3U4Z A;  4N8X 1;  3PO2 B;  2R3Z A;  1KRS A;  3NPP A;  2LXJ A;  2BA0 A;  5K36 H;  1LT5 D;  1AFP A;  3J80 E;  4CKC A;  2WV6 D;  1UWV A;  4JV5 L;  2XN9 C;  3PIP 3;  5KNC A;  3T13 A;  1P8L A;  4O0A A;  4DUY L;  5K5P A;  4MTK A;  5KIX A;  3FP9 A;  5IGC A;  3T53 B;  1HFG A;  3WWV A;  1FNV A;  4C3I G;  5IGG A;  2EIF A;  5IYD G;  2F0O A;  1PZJ D;  4OO1 I;  4L5Q A;  1A0I A;  2ZXP A;  4B9X A;  1RTO A;  3GO5 A;  3STB D;  2IJ0 A;  1EWC A;  4OEL B;  4XIG S;  4BA1 I;  3TP7 A;  4LUV A;  4DR6 Q;  3T16 A;  4QJF A;  3CCU A;  2LMC B;  3ERS X;  3RLF A;  5AJ3 Q;  3OOC A;  1STN A;  3I2Z A;  3E0J A;  1PRT B;  2N49 A;  2R93 G;  4K6L A;  4DK1 A;  3P1H A;  4AQY L;  1L1O B;  5IGD A;  1XXG A;  4DAP A;  4DV5 Q;  3M4Y A;  5C4X H;  4A3G H;  2ZJR A;  2K50 A;  2RCF A;  4WRD A;  3HRZ C;  2NWG A;  5DNF A;  3T1Y Q;  1RJT A;  4JC0 A;  4RGM A;  1H95 A;  5KND A;  1CZG A;  4DV1 Q;  2JA7 B;  1FJG Q;  2OQK A;  2Q8R E;  2R7D A;  2NVY H;  4J8Q A;  2E5L Q;  1PVO A;  5LMN W;  1VQO A;  4Y52 H;  5EPK A;  1BQQ T;  4LMQ D;  1VQC A;  1SFO B;  3NEL A;  1CHP D;  1RHP A;  4HJA A;  3S17 H;  2A19 A;  3OYY A;  2TSS A;  4DV2 Q;  4BBR B;  2UXD Q;  4POF A;  3KBG A;  4YCV A;  1ILP A;  4XT1 B;  4K5W A;  4KI0 A;  4DR2 Q;  1M8A A;  2PPB C;  2HT1 A;  1VCI A;  1AH9 A;  1TQO A;  1A2T A;  1PH7 A;  2K5W A;  1QZH A;  4HAE A;  3ONA B;  3UDF A;  1Y1W B;  3H91 A;  3A8I E;  4ID6 A;  4A4I A;  3CD6 A;  2EYP A;  3I72 A;  1EYA A;  5COR A;  3W5O A;  1SMY D;  1LYL A;  2VB2 X;  3CCM A;  1B53 A;  1OXS C;  1PA6 A;  4K14 A;  3HOY G;  3D6W A;  3RN5 A;  5LMU L;  1WJJ A;  4QB4 A;  3SHL A;  3W1G A;  2Q8T A;  4K5V A;  1M1K C;  3I4N G;  3WOE A;  3X3M A;  3G4S A;  4NXM L;  2AWO A;  2ICE C;  4K8J A;  2NVQ H;  2UXB Q;  4FDB A;  2GVB A;  4IN3 A;  4TRD A;  1MSG A;  1EY9 A;  3OW2 A;  2A8V A;  2RDG A;  2HDM A;  5EGT A;  2QIL A;  3FPP A;  3HKZ E;  4PMW A;  1VF7 A;  2VQE Q;  1PV4 A;  5I9P A;  2ZXO A;  4B3S L;  3PO2 G;  1VQE A;  1DCZ A;  2VS1 A;  3KLR A;  4A3L H;  4WFN 3;  4WOR A;  4KHV A;  4KY6 A;  3TDQ A;  2NVY B;  1FYC A;  4BWG B;  4OO1 G;  2UUA L;  5ELO A;  1AE3 A;  3CCR A;  4KV6 A;  4LUZ A;  4HIK A;  1CUK A;  1RKN A;  3GTP H;  5FOB B;  3CCQ A;  2IY5 B;  4RCO A;  2A6E C;  1EWH A;  1AE2 A;  5T1I A;  4L8J A;  1D5Z C;  5CBE E;  1O7Y A;  4JYA L;  1CFM A;  3PIP A;  1SNO A;  1XNQ Q;  1GHK A;  3VYU A;  4KMU C;  4DPG A;  2MP1 A;  1GUS A;  3S1R H;  2AQ3 B;  4IJL A;  2ZJQ A;  4GOP A;  1A15 A;  5BN3 A;  1X54 A;  4B08 A;  1WTW A;  4BY7 H;  3EA6 A;  4K2K A;  2OTJ A;  2Q2U A;  2WFW A;  3S2H H;  1LTR D;  4IQZ A;  1SMY C;  1HJP A;  3D8G A;  3VR3 A;  1XX8 A;  5GAE C;  1GUN A;  2XWB B;  2B63 H;  2UUA Q;  3NQI A;  3HGB A;  4R4T A;  5NUC A;  5M3F G;  2HDL A;  4IUV A;  4P2C B;  3J81 c;  1KDC A;  4IOA A;  2R7Z B;  1E1O A;  2RDF A;  1WVL A;  3V2T A;  3OIP A;  2CWA A;  1RL2 A;  2QGQ A;  2K1B A;  2EZV A;  4A3E G;  4C1N K;  3CPW A;  5JOB A;  1N33 L;  1ET9 A;  1EY7 A;  4DR4 Q;  1V1P B;  4B9W A;  3I4O A;  5T1G A;  1HQR D;  2ZJP A;  1QCB D;  1LAB A;  1WOC A;  2PO4 A;  1KTK A;  5HY6 A;  4HIO A;  1PFB A;  4YY3 L;  1KAW A;  4K2L A;  2F4I A;  1O7Z A;  5FO7 B;  4DR3 L;  3F2U A;  3Q8D A;  1B8A A;  1E0B A;  2CW0 C;  1JJ2 A;  3GTK B;  4C3J G;  1HZC A;  3HZX A;  2MO1 A;  3GTP B;  4CJ0 B;  2Z6B A;  4G7Z C;  3LWU A;  3E9H A;  2ZM6 L;  2JYO A;  5LL6 X;  2QW7 A;  5C44 B;  3F2D A;  3CQZ H;  1VMP A;  1GOZ A;  4A3J H;  2X69 A;  4JCV E;  4LF8 Q;  1SRO A;  1L1O A;  1TWG H;  4O1N A;  4F87 A;  4RGO S;  2NVX H;  2B2U C;  3CW2 C;  4MNO A;  3QIA A;  4DV7 Q;  4EQO A;  2OEO A;  3LWE A;  3Q22 A;  4A3C H;  1CQF A;  3TRE A;  1JE5 A;  2F0H A;  2WB1 E;  3LX0 A;  2KOL A;  3I4M B;  4UP7 A;  1T5E A;  4LK1 C;  5JPM C;  4DR1 Q;  1WTV A;  5EBD A;  4LF7 L;  4R4I A;  1KDA A;  3M4Q A;  4JI1 L;  1IBM L;  1U9R A;  4N9P A;  3HOV B;  1W6J A;  2F0K A;  4C3H H;  1BR9 A;  1GKH A;  5EKI A;  2F0M A;  1HNX Q;  4L63 B;  1CI3 M;  1SR3 A;  2MGS A;  3GTJ B;  1SAP A;  3G6E A;  3DXJ C;  5FLM G;  2WII B;  1LAC A;  4C3I B;  4C2M H;  1B50 A;  2M9V A;  4BY7 G;  2I46 A;  4DV0 Q;  1EY8 A;  4OGQ C;  1A2U A;  3E3X A;  2D0P A;  4JI2 L;  5DM7 3;  3J81 j;  4JI4 L;  1GD7 A;  1JQY D;  1DON A;  4PZ8 A;  4LFB Q;  2F0W A;  2CH4 A;  4GKJ L;  1LTB D;  1XNR Q;  2K33 A;  2B2V A;  3M4P A;  4X3S A;  2N55 A;  4DV6 L;  3TZU A;  5CV6 A;  2VQF L;  1EQT A;  1XJV A;  1EY4 A;  4HED A;  5M3M G;  5GAH C;  2QA4 A;  4X66 Q;  2R93 H;  1JB7 A;  5A2Q E;  2F0J A;  1KAA A;  4Q5V A;  4CGY B;  4R4O A;  4EQP A;  2EY6 A;  5C0X G;  5IP9 G;  1VQ8 A;  2CHB D;  3S1M H;  1DXM A;  4JOI A;  4B3R L;  1OXX K;  2J0T D;  3QOL A;  4RHR A;  4DGZ A;  4EVO A;  5IYC H;  4DV5 L;  1Q3L A;  1WTO A;  2KBN A;  4LAA A;  4ZUJ A;  3S15 H;  1UE6 A;  1EWI A;  3K7A B;  1V8Q A;  1QNU A;  1HFN A;  2IPK D;  1B70 B;  1MJC A;  3OMG A;  4LF6 Q;  2V1C C;  5FO9 B;  2B2W A;  2EY2 A;  3K5N A;  3ERQ A;  3ITP A;  3D0F A; 
#chains in the Genus database with same CATH homology
 3I4L A;  2H1E A;  1EZ6 A;  2E2J B;  2JP1 A;  4BY7 B;  1JCK B;  2QF7 A;  1ZYR D;  2XWJ B;  2IW3 A;  4H0L C;  1SNM A;  1PFN A;  1DYQ A;  1RCV D;  3PUV A;  5C4X B;  1B44 D;  3A7L A;  5IGB A;  2F0D A;  1SE3 A;  3NQT A;  4KD4 A;  3H09 A;  5C4J B;  4NKL A;  5HGT A;  3H0G B;  2E2D C;  1KLG D;  1KNA A;  2R93 B;  2G9D A;  1Q90 A;  3OHX C;  1EY0 A;  1O78 A;  1PXU A;  2QCP X;  1L0Y B;  5AFW A;  2B2Y C;  3JAM E;  1Y69 U;  1QJO A;  4KJO A;  1LTS D;  1KDB A;  4H44 C;  3I3C A;  1O7L A;  1OXV A;  4IFD H;  4XQN A;  1IW7 D;  1HQM C;  3HG9 A;  5IT9 L;  5C4H A;  2JA6 B;  5EPJ A;  4G7O C;  1HA5 A;  2EYF A;  3RZO B;  1F9R A;  2QEJ C;  4ZKC B;  3VYS A;  1G2S A;  5KYI A;  1ENA A;  3VR5 A;  2SNS A;  3AMU A;  2F0N A;  3GP7 A;  2EY1 A;  5D3D A;  4IUN A;  1HHV A;  1PRT D;  2AUJ D;  1B1Z A;  2AUK A;  1E2Z A;  2NVQ B;  2J7Z A;  4BA2 I;  1I4G A;  1L0X B;  3W3A A;  4GZY C;  5D3I B;  1ENC A;  4RKL A;  2F0Q A;  2JSO A;  4A3M B;  4RKB A;  1HUM A;  1Q12 A;  2D9U A;  1I4P A;  2EPB A;  2IL8 A;  1EOT A;  1JWM D;  4N9T A;  4RHS A;  1WTX A;  3RUZ A;  5DEH A;  1S5E D;  3NP8 A;  3J7A F;  2KCC A;  4M8A A;  3K5M A;  4DXG A;  3M85 A;  3DEO A;  2PW7 A;  4JK1 C;  3NBH A;  1QG7 A;  4FF1 A;  2D5D A;  4KJN A;  5JPN C;  1ONL A;  4H7B A;  2A6H C;  4ZK9 B;  3ZYY X;  1F9P A;  4IZ8 A;  1GJX A;  2PZU A;  2KVM A;  1CT1 D;  1KLU D;  3I70 A;  1EL0 A;  4Z9C B;  1U4R A;  3HOY B;  3P20 A;  3QO2 A;  1SYG A;  2LFN A;  2AQ2 B;  1B4O A;  1ESR A;  1MD2 D;  1PTO D;  2VXW A;  3K58 A;  2LY7 A;  4ZQ3 A;  1Y8N B;  1F2M A;  3K5L A;  1DM0 B;  5CV9 A;  1STH A;  2EE1 A;  3KLS X;  5IOC A;  4IFD J;  2RVL A;  5CC4 A;  5EQ0 A;  5E1F A;  3Q23 A;  4HCE A;  3OWE B;  3DEP A;  1HTP A;  1I50 B;  1CA6 A;  1PZK D;  3MXU A;  4K8I A;  1Z7T A;  1VF5 C;  4XXE A;  3PUW A;  3SE0 A;  3H6M A;  2ZT9 C;  4DK0 A;  1EZ8 A;  4L6T B;  4HN7 A;  4ZAI A;  5JVH 3;  2R92 B;  2BDN A;  5J39 A;  2F03 A;  1F9Q A;  1BCP D;  1MI2 A;  2FHT A;  2CVR A;  1I6V C;  5ELC A;  3D4W A;  2DY8 A;  3D4R A;  1AP0 A;  5I2Y A;  4XYQ A;  1DD2 A;  1IW7 C;  1OO9 B;  2RQX A;  4J6H A;  3K5O A;  1Z47 A;  2M2L A;  4FYD A;  4C3H G;  3G6J B;  5EPL A;  2PYK A;  4ZKB B;  2WKD A;  3M7G A;  2C9O A;  2JA8 B;  1FD7 D;  2EVB A;  3PUX A;  1QNK A;  2NUC A;  3Q24 A;  1YNJ C;  3J7Y W;  3D4D A;  1EIH A;  3M4O B;  5BN4 A;  3S1M B;  4C2M B;  4X3K A;  2X6L A;  4F8M A;  4QUC A;  2RSO A;  3N6R A;  4OIK A;  3OPO A;  1GUW A;  1OXT A;  4UAI A;  2KED A;  4O42 A;  1KNE A;  4QCL A;  3NSW A;  1STE A;  2E76 C;  4C3J B;  3RMH A;  3D3R A;  3E5S A;  3VYR A;  3URY A;  4CJ1 B;  2KA7 A;  3NBI A;  2E75 C;  4FXK C;  3DHQ A;  1I6H B;  1Y8P B;  3KLS A;  3IAY A;  3KBX A;  4A3J B;  4TKO B;  2F0E A;  3GTL B;  3K59 A;  4R8I A;  2DNE A;  1WD0 A;  2I07 B;  3QOJ A;  3R2I A;  5KNB A;  1K8M A;  3SK4 A;  1TS2 A;  2K32 A;  3NE5 B;  4ZRZ A;  5CV4 A;  1YNJ D;  1ML0 D;  2E2I B;  2KQ3 A;  1LTA D;  4I7Z C;  5C3E B;  1EEI D;  1HPC A;  2QKI C;  3U9S A;  4ULL A;  1ZXT A;  3P75 A;  1TS5 A;  1PYW D;  1X32 A;  2HQE A;  3IFD A;  5CV8 A;  4NP5 A;  1QIL A;  3E6Z X;  2C5C A;  1EU4 A;  1X3P A;  5CGK A;  3MVV A;  2KEC A;  4ZYS A;  1XTC D;  2A69 C;  2F0G A;  1B9M A;  4I65 A;  1PTO F;  1QE6 A;  1NSN S;  2WIN B;  3H3V C;  3AB9 A;  4HMJ A;  1IHZ A;  4DXF A;  2AQ1 B;  3MEH A;  1SYC A;  3Q6S A;  4IFD I;  2BE5 D;  3NWT A;  4KKT A;  2EY5 A;  1F2Y A;  1GHJ A;  4NDX A;  3M3Y B;  1QOH A;  3NHH A;  3SEB A;  4XYO A;  3RD4 A;  1NUC A;  5ELF A;  4KN4 C;  3T56 B;  3S16 B;  1JOO A;  1PLF A;  3QJY A;  1AN8 A;  1CHQ D;  3HOU B;  4FVM A;  3HOW B;  5DAU A;  4KD3 A;  4A3G B;  3PMF A;  3DWP A;  1STY A;  4U68 A;  5M3M B;  3OSO A;  4XDX A;  2K6A A;  4A3I B;  1II3 A;  4ABN A;  4PQX A;  3L9A X;  2JXM B;  1SYD A;  2AWN A;  1BOS A;  1S5B D;  2NN6 I;  1G8Z D;  3N52 A;  3BG3 A;  5IGF A;  2NVX B;  1D6E C;  2A68 D;  3KUP A;  3BDC A;  5BN5 A;  2ENB A;  1ESF A;  4CKB A;  5E4W C;  5JAV A;  1M4V A;  2F1M A;  3SR1 A;  2Q8I B;  3EVQ A;  5M5X B;  1MBY A;  5JVG 3;  2L12 A;  2IX0 A;  4A3K B;  4Y7N B;  3FRP B;  1TII D;  4S3S A;  1QWY A;  2OXP A;  3FVQ A;  2QDB A;  3V96 A;  3MZ5 A;  3MWY W;  4Q0F A;  1FGB D;  2WKC A;  3TBI B;  3DUZ A;  4RGT A;  2RDH A;  1H9S B;  1EIG A;  2MPM A;  3GTQ B;  2F3W A;  1LT4 D;  3S14 B;  2B2T A;  3FDT A;  1JR0 D;  1EEF D;  3DM1 A;  5C5M A;  2BE5 C;  1EYD A;  2RBM A;  3JAM L;  3DMU A;  3MXN A;  3CRL C;  1CZW A;  5G3L D;  2NB0 A;  2RKS A;  3R2T A;  3SVM A;  1NAP A;  4FF3 A;  5JEA H;  1D2B A;  1WD1 A;  1ENF A;  2F0I A;  4A3D B;  4IUU A;  2A69 D;  4ME5 A;  4G7H C;  1D5X C;  2Z8L A;  3GV6 A;  3PO3 B;  2SEB D;  1BCP C;  4XQQ A;  3C46 A;  4R9W A;  1TS3 A;  4KY7 A;  3IL8 A;  1Q8I A;  3MHB A;  2K03 A;  4EGV A;  1LO5 D;  3KF8 A;  2XVS A;  1SYF A;  4HCS A;  1VMC A;  1LT3 D;  1STG A;  2FMC A;  1PTO B;  1O80 A;  2RSN A;  3HS0 C;  2XIW A;  3FMC A;  3GQB A;  1CM9 A;  2PZT A;  3IFT A;  1A3U A;  3SDZ A;  3T4A C;  3T51 B;  3PUY A;  5M5Y B;  3A8K E;  2O4X A;  2NTS A;  3NTH A;  1GUT A;  5KGU A;  3D6C A;  3J81 L;  2EDG A;  2OT2 A;  2EOT A;  4RAU C;  5M5W B;  4F7X A;  1H9S A;  5CYU A;  1SDF A;  1S5F D;  5C6A A;  2KEE A;  3BYY B;  2WAC A;  5FKA C;  2G9H D;  4FP5 D;  4OO1 H;  1JC7 A;  1D5M C;  3GTM B;  2IX1 A;  3CKI B;  2J4X A;  1SNC A;  3MAQ A;  1Z6H A;  3D31 A;  5J1Z A;  5IT9 E;  3IKJ A;  1CK1 A;  3NWS A;  4NMZ A;  1TS4 A;  3R3O A;  4HMI A;  3G7L A;  5DM6 3;  3K57 A;  2NBF A;  4TSS A;  1B9N A;  1C4Q A;  3MFG A;  3A55 A;  4RGN A;  4X3U A;  3EJI A;  2B2W C;  3MXP A;  4A3F B;  4H13 C;  3P7J A;  3QB3 A;  3W2D A;  3HP3 A;  5I2X A;  1TR5 A;  1SE4 A;  3GV3 A;  1ZEQ X;  1Q1E A;  3S15 B;  5E3F A;  4FF2 A;  5CV5 A;  4XTC S;  3PIO 3;  4JBW A;  2FJ2 A;  2F0U A;  4E6I A;  3C2P A;  3U9O A;  3I91 A;  2EJG C;  3L7Z C;  3X3N A;  3MC0 B;  1I4Q A;  3C3L A;  1ZYR C;  1PZI D;  1JB3 A;  3V05 A;  1BCP F;  2PW5 A;  1I4X A;  2PNR C;  1HTL D;  1TY0 A;  1G6Z A;  1SJH D;  2OF1 A;  2E2H B;  3AU7 A;  3R8B A;  2HCI A;  5G3L F;  2Y0S B;  1SNQ A;  1PDQ A;  1SNP A;  2H4O A;  4OIJ A;  1Q1B A;  4HSP A;  2BOS A;  1ROD A;  4C1N I;  5I9O A;  2HUG A;  5FO8 B;  1H9R A;  2EYM A;  3NK9 A;  3I90 A;  3J81 E;  4PMB A;  5LL6 S;  2WAQ B;  1JE4 A;  1TKW B;  1EY5 A;  5EKL A;  1WTP A;  1UNS A;  1B3A A;  1AEX A;  1G2T A;  2XRS D;  2PQE A;  1LTG D;  5A2Q L;  2YU9 B;  5E4X A;  2A74 C;  4HR7 B;  2B2V C;  4MN3 A;  1WCM B;  3GD7 A;  4OHJ A;  1J9O A;  1JOK A;  4LJZ C;  2VB3 X;  2B8G A;  4G57 A;  4QUF A;  4IUT A;  1BNZ A;  5M3F B;  3WOF A;  1RD9 D;  3VYT A;  1TWA B;  1SBB B;  2L9H A;  4FNF A;  4CBV A;  2L11 A;  3HKZ B;  1PTO H;  2XSC A;  2A6E D;  2DY7 A;  1CA5 A;  3CRK C;  1JIC A;  5D14 A;  4MHE A;  4X3T A;  2CQA A;  2EJF C;  5K36 G;  1NR2 A;  3KK7 A;  2RA4 A;  5KYL A;  3CHB D;  3VR6 A;  1QB5 D;  5CR3 A;  2EJM A;  4IAL A;  3LNN A;  1EQV A;  3VA5 A;  4OL7 A;  4FXG C;  1IYU A;  1V43 A;  1Y1V B;  3S1Q B;  3VA7 A;  2K28 A;  4RH6 A;  2LKV A;  1SSO A;  4K5X A;  1LV9 A;  1DJR D;  1YNN D;  3FKI B;  1E2V A;  2L1B A;  1F9S A;  1FNU A;  1KAB A;  3MFY A;  3BDL A;  2F0L A;  4DFA A;  1SXT A;  4RWS C;  2O5J C;  4CHT B;  3EFX D;  1Y8O B;  1OXU A;  1PFM A;  2B2Y A;  4U67 3;  4A3E B;  3H94 A;  2Z1C A;  1SEB D;  3TP6 A;  1R4Q B;  5EKK A;  2XNA C;  1A3V A;  1D1I A;  2O5I C;  4CJ2 C;  5I4D A;  3NUC A;  3BZD B;  1V1P A;  4V19 0;  4IFD G;  1IKL A;  1SYB A;  3K6O A;  5C0X H;  1LT6 D;  3M7N A;  1PMR A;  2O2L D;  2CW0 D;  1T5X D;  2L4N A;  1CQV A;  2K5D A;  4R8N A;  3VR2 A;  3I73 A;  5JEA J;  1D1K A;  1G91 A;  1TWC B;  1TWH B;  5EBC A;  2F0T A;  2KJX A;  2SNM A;  3I4N B;  5I6Y A;  1HUN A;  1TU2 B;  2EYL A;  5EJW A;  1H9K A;  2KUM A;  3A56 A;  3BVZ A;  5HUR A;  2A68 C;  1S5C D;  1JOQ A;  2SDF A;  1XWE A;  2NN6 G;  1EFI D;  1WTQ A;  1ET6 A;  3CU7 A;  2SOB A;  4DN4 M;  4G4K A;  2IX3 A;  5JEA G;  2F0V A;  3S2D B;  3R93 A;  4IUR A;  4KKS A;  5TSS A;  4PV1 C;  1CTM A;  2M00 A;  4IUP A;  1RDP D;  1B2T A;  3I8Z A;  3L3O C;  1F2Z A;  2MHV A;  3DWA A;  1I3Q B;  4XT3 B;  4WJW A;  4DNR B;  1RF2 D;  4TQU S;  2DN8 A;  3TZD A;  4BS9 A;  3HOX B;  1U4P A;  1U4M A;  2D2C C;  1JWU D;  3FEW X;  5CMD A;  5M9O A;  1A6X A;  3PV0 A;  3S9W A;  3HEJ A;  2IWH A;  4PNY A;  5IIF A;  5D65 A;  1ILQ A;  1AW7 A;  2YYZ A;  5CBA E;  2IT1 A;  4MIU A;  4HSV A;  5ELD A;  2F0P A;  1U4L A;  3NTI A;  2L0C A;  5ELE A;  4RCN A;  2EYH A;  4KHZ A;  4AYB B;  3NTK A;  4ILW A;  5FK9 C;  1BXT A;  1GUO A;  1V1O A;  2ICI A;  1XYI A;  1LTT D;  4RA8 A;  4KKU A;  1RTN A;  1NCV A;  1SYE A;  1LTI D;  2LS0 1;  1BBX C;  1WTR A;  1IL8 A;  5IGE A;  4BY1 B;  2A5H A;  3Q0A A;  1C48 A;  4QIW B;  2B2T C;  3SXH A;  1EYC A;  1BF4 A;  3QG1 A;  4DAY A;  1DZ1 A;  5IOD A;  1UAP A;  1ZKO A;  5C3X A;  3ERO A;  2BDO A;  3HOZ B;  3A54 A;  3TN2 A;  4A93 B;  4C56 C;  4XQJ A;  3K0Y A;  4M1U B;  3GTG B;  3C1E A;  2B2U A;  2WB1 B;  4IUQ A;  1FNW A;  3NXW A;  1NR4 A;  5C0X J;  1BUV T;  1ICW A;  1UUP A;  3UI2 A;  2E74 C;  2WP8 J;  4DA2 A;  2F0F A;  2Z4I A;  2K01 A;  5KRU A;  1HA6 A;  1DOL A;  5C0X I;  2K5Q A;  1A3T A;  3FPU B;  1HXY D;  4K6D A;  4DU9 A;  1AZP A;  4V0B A;  1HCZ A;  3OIQ A;  3C1F A;  3VR4 A;  3SK8 A;  2NVT B;  2A6H D;  1TWF B;  3GTO B;  1YNN C;  1G29 1;  3TSS A;  1J8I A;  1GUG A;  5C5L A;  3OMC A;  3S1N B;  2R6G A;  4HTH A;  1VDZ A;  4A3B B;  4QMG A;  4KK7 A;  1X3Q A;  2D62 A;  3PUZ A;  1BDO A;  1UEA B;  5F2D A;  2GA4 B;  1TY2 A;  2KCN A;  1S5D D;  2L5T A;  5ISR A;  3OW7 A;  2F3V A;  1TVX A;  2B8F A;  1LLR D;  1F77 A;  2BCO A;  4DAV A;  2XRQ D;  4RFB A;  5CV7 A;  4DNT B;  3TP8 A;  2FMM A;  2TMP A;  2K05 A;  2PZW A;  2DNC A;  4KTA A;  1FR3 A;  2HCC A;  3DWQ A;  1EY6 A;  1PRT C;  4ODG A;  5COY A;  1PRT F;  3A8J E;  3BVM A;  2VUM B;  2FFK B;  2BA1 A;  5JJZ A;  1AZQ A;  3S1R B;  2JEA I;  2ZXR A;  2PCF B;  3TP5 A;  2MJ8 A;  2KHS A;  5LHY 1;  3S2H B;  5I6W A;  4ZUI A;  5FLX L;  2PMZ B;  1DOK A;  1MGS A;  4CKE A;  1SE2 A;  5J22 A;  2VNU D;  1R4P B;  3MXG A;  3BS1 A;  4NW2 A;  3O13 A;  3BVG A;  5KEE A;  1HRJ A;  1STB A;  1K8O A;  2EXZ A;  2JA5 B;  4ZLT F;  5C4Z A;  3QWN A;  1I4H A;  1R9T B;  1SND A;  1BO0 A;  4YIJ A;  2Z4H A;  2JEB I;  4DF7 A;  2X6G A;  1K83 B;  4F88 A;  4FF4 A;  1IKM A;  5C3W A;  3J7A V;  1W6K A;  3ND9 A;  2NYZ D;  2ID0 A;  4BBS B;  1C8C A;  1PTO C;  1GXD C;  2JE6 I;  1STA A;  4KY5 A;  2K7V A;  1DOM A;  2NN6 H;  4C3H B;  3ND8 A;  3SK6 A;  2L55 A;  3MA2 B;  3OWF A;  2V4D A;  1S4Z A;  3WDN A;  1JWS D;  1BCP B;  4QF4 A;  4KN7 C;  2EYO A;  4EQN A;  2NTT A;  2K04 A;  1F2L A;  4UDU C;  2FIN B;  1TT2 A;  5ELB A;  5A35 A;  2EYJ A;  1H9J A;  1I4R A;  4PMC A;  1E2W A;  1JOR A;  3MTS A;  3TME A;  4FXD A;  3SK5 A;  3EQL C;  3RZD B;  3A7A B;  5FLX E;  2A73 B;  1EU3 A;  1SJE D;  1IYV A;  2MUY A;  2N88 A;  4FO2 A;  2B39 A;  1MSH A;  4J1M A;  2R61 A;  2B63 B;  1H9M A;  2NZ1 D;  3CQZ B;  2F0S A;  3S17 B;  3BYT B;  3BDO A;  1TWG B;  3J80 L;  3PO2 B;  2R3Z A;  3NPP A;  2BA0 A;  5K36 H;  1LT5 D;  1AFP A;  3J80 E;  4CKC A;  2WV6 D;  2XN9 C;  3PIP 3;  5KNC A;  3T13 A;  5K5P A;  5KIX A;  5IGC A;  3T53 B;  1HFG A;  1FNV A;  4C3I G;  5IGG A;  2F0O A;  1PZJ D;  4OO1 I;  2ZXP A;  4B9X A;  1RTO A;  3GO5 A;  2IJ0 A;  1EWC A;  4XIG S;  4BA1 I;  3TP7 A;  3T16 A;  2LMC B;  3RLF A;  3OOC A;  1STN A;  3E0J A;  1PRT B;  4K6L A;  4DK1 A;  3P1H A;  5IGD A;  1XXG A;  4DAP A;  3M4Y A;  4WRD A;  3HRZ C;  2NWG A;  5DNF A;  1RJT A;  4RGM A;  5KND A;  1CZG A;  2JA7 B;  2Q8R E;  4J8Q A;  5EPK A;  1BQQ T;  4LMQ D;  1SFO B;  1CHP D;  1RHP A;  2TSS A;  4BBR B;  3KBG A;  1ILP A;  4XT1 B;  4K5W A;  4KI0 A;  1M8A A;  2PPB C;  1VCI A;  1TQO A;  1A2T A;  2K5W A;  4HAE A;  3ONA B;  1Y1W B;  3H91 A;  3A8I E;  4ID6 A;  2EYP A;  3I72 A;  1EYA A;  5COR A;  1SMY D;  2VB2 X;  1B53 A;  1OXS C;  4K14 A;  3D6W A;  4QB4 A;  3SHL A;  2Q8T A;  4K5V A;  3WOE A;  3X3M A;  2AWO A;  2ICE C;  4K8J A;  4IN3 A;  4TRD A;  1MSG A;  1EY9 A;  2RDG A;  2HDM A;  5EGT A;  2QIL A;  3FPP A;  4PMW A;  1VF7 A;  5I9P A;  2ZXO A;  1DCZ A;  3KLR A;  4WFN 3;  4WOR A;  4KHV A;  4KY6 A;  3TDQ A;  2NVY B;  1FYC A;  4BWG B;  4OO1 G;  4KV6 A;  1RKN A;  5FOB B;  4RCO A;  2A6E C;  1EWH A;  5T1I A;  4L8J A;  1D5Z C;  5CBE E;  1O7Y A;  1CFM A;  1SNO A;  1GHK A;  3VYU A;  4KMU C;  2MP1 A;  1GUS A;  2AQ3 B;  1A15 A;  5BN3 A;  4B08 A;  1WTW A;  3EA6 A;  4K2K A;  1LTR D;  4IQZ A;  1SMY C;  3D8G A;  3VR3 A;  1XX8 A;  1GUN A;  2XWB B;  3NQI A;  3HGB A;  5NUC A;  2HDL A;  4IUV A;  4P2C B;  1KDC A;  2R7Z B;  2RDF A;  1WVL A;  3V2T A;  3OIP A;  2K1B A;  2EZV A;  4C1N K;  5JOB A;  1ET9 A;  1EY7 A;  1V1P B;  4B9W A;  5T1G A;  1HQR D;  1QCB D;  1LAB A;  2PO4 A;  1KTK A;  1PFB A;  4K2L A;  2F4I A;  1O7Z A;  5FO7 B;  3F2U A;  1E0B A;  2CW0 C;  3GTK B;  4C3J G;  3HZX A;  3GTP B;  4CJ0 B;  4G7Z C;  3LWU A;  2JYO A;  5LL6 X;  5C44 B;  1VMP A;  1GOZ A;  2X69 A;  4O1N A;  4F87 A;  4RGO S;  2B2U C;  3QIA A;  4EQO A;  2OEO A;  3LWE A;  3Q22 A;  1CQF A;  2F0H A;  3LX0 A;  2KOL A;  3I4M B;  1T5E A;  4LK1 C;  5JPM C;  1WTV A;  5EBD A;  1KDA A;  1U9R A;  4N9P A;  3HOV B;  1W6J A;  2F0K A;  1BR9 A;  5EKI A;  2F0M A;  4L63 B;  1CI3 M;  2MGS A;  3GTJ B;  1SAP A;  3DXJ C;  2WII B;  1LAC A;  4C3I B;  1B50 A;  2M9V A;  2I46 A;  1EY8 A;  4OGQ C;  1A2U A;  5DM7 3;  1JQY D;  1DON A;  2F0W A;  1LTB D;  2K33 A;  2B2V A;  4X3S A;  2N55 A;  3TZU A;  5CV6 A;  1EQT A;  1EY4 A;  4HED A;  5A2Q E;  2F0J A;  1KAA A;  4Q5V A;  4CGY B;  4EQP A;  2EY6 A;  5C0X G;  2CHB D;  1DXM A;  1OXX K;  2J0T D;  3QOL A;  4RHR A;  4DGZ A;  4EVO A;  1WTO A;  1Q3L A;  4LAA A;  4ZUJ A;  3K7A B;  1V8Q A;  1QNU A;  1HFN A;  2IPK D;  3OMG A;  5FO9 B;  2B2W A;  2EY2 A;  3K5N A;  3ERQ A;  3ITP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...