4K2LA

Crystal structure of staphylococcal nuclease variant delta+phs i92q at cryogenic temperature
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYQYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Cavity hydration in proteins
rcsb
source organism Staphylococcus aureus
total genus 33
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2013-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4k2lA00
2F0OA 1EQVA 1EYAA 2F0QA 5IGGA 5IOCA 1TQOA 2F3VA 5CV5A 5C5LA 4KY7A 2PQEA 3NXWA 1IHZA 2EXZA 4NKLA 1ENCA 3SXHA 5I6YA 1II3A 2F0WA 4K14A 4N9TA 4WORA 5CV8A 4IUNA 5JOBA 3OSOA 5IGCA 3SR1A 4PMCA 4KV6A 1SYDA 3LX0A 4F8MA 1STYA 1NUCA 5ISRA 3V2TA 3C1EA 3D4DA 4K6DA 5HURA 1EY5A 4K8JA 5I9PA 1RKNA 2F0NA 3E5SA 1TR5A 5NUCA 3SK6A 5IGDA 5EKLA 4YIJA 1SNQA 4ODGA 2F0LA 5KYLA 2F0EA 2PZUA 4HMJA 4K5XA 3U9OA 1SNDA 3NQTA 3VA5A 1JORA 1SYFA 5HGTA 2EYMA 3ERQA 4RKBA 1EY7A 5CV7A 2F0DA 2EY1A 2WACA 1EY4A 3T13A 3MZ5A 1EY8A 5J1ZA 2F0MA 1EY6A 1SNOA 4ZUIA 5CV4A 3SK4A 1SYGA 2EYLA 4IZ8A 2F0IA 5DEHA 5I9OA 4KJNA 2EYFA 5EGTA 4ID6A 3H6MA 4DGZA 4K2LA 5CR3A 2ENBA 3BDCA 1A3TA 2EY6A 3TMEA 4B9XA 3D6CA 2LKVA 5IIFA 4IALA 4I65A 5F2DA 4EQPA 1F2YA 5IGBA 1STAA 1F2ZA 5DAUA 4EVOA 4J6HA 4K5VA 1EYCA 2QDBA 1STBA 3NP8A 4K5WA 2PYKA 4KHVA 5KGUA 2SNSA 3D8GA 1EY0A 4LAAA 2F0SA 4PNYA 4K2KA 1KABA 4NP5A 4EQOA 3EROA 3OWFA 5KRUA 2PZTA 3ITPA 1SYBA 5IGFA 4KY5A 3BDLA 4S3SA 2OXPA 5KIXA 5EKKA 3SHLA 1SYEA 5C5MA 2F0UA 5JAVA 1SNPA 2OEOA 3D4WA 3PMFA 4ME5A 4N9PA 1EYDA 4MIUA 4QMGA 2EYOA 1JOKA 1SYCA 4OL7A 4WRDA 3SK8A 1STNA 4KJOA 5M9OA 4G57A 2F0HA 3DMUA 3P75A 3TP5A 4KD3A 4KTAA 3NK9A 5C4HA 1AEXA 2OF1A 1KAAA 1EZ8A 5K5PA 1EY9A 2EY2A 2F0VA 4RKLA 2EYJA 5KYIA 2PW5A 2EYHA 4QF4A 3TP8A 2F0JA 2PZWA 3EVQA 3MXPA 4ZQ3A 5CGKA 3MEHA 2EY5A 2RBMA 2SNMA 3RUZA 3TP6A 4R8NA 2M00A 4NMZA 3C1FA 5J39A 4NDXA 1STGA 5J22A 2F0KA 1KDAA 3QB3A 3NHHA 3R3OA 4F7XA 3HEJA 4KD4A 5CV9A 1A3UA 2NUCA 4J1MA 4KY6A 4TRDA 4B9WA 5IGEA 3OMCA 3S9WA 4DFAA 2RDFA 2HQEA 3MVVA 4H7BA 1SNMA 2F0FA 2F0GA 4HMIA 1U9RA 3DHQA 3HZXA 1STHA 4EQNA 4DF7A 2SOBA 5KEEA 3QOLA 1JOOA 2PW7A 2RKSA 3NUCA 1KDBA 4HTHA 1F2MA 4K8IA 1SNCA 4PMBA 3SK5A 5I6WA 4ZUJA 2O4XA 5C4ZA 5E3FA 5C3WA 2KHSA 3EJIA 3MHBA 3P1HA 5CV6A 3TP7A 1A2UA 4E6IA 5C6AA 3T16A 1KDCA 2F3WA 1NSNS 3OMGA 3QOJA 4QB4A 4DU9A 5C3XA 1JOQA 5CC4A 1ENAA 2EYPA 1TT2A 1A2TA 2KQ3A 1A3VA 2F0TA 5E1FA 2F0PA 5IODA 1EZ6A
chains in the Genus database with same CATH superfamily
1YI2A 1TQOA 3A55A 2CVRA 1AZQA 2E2HH 3Q0AA 3M7NA 3JAMc 2KEDA 2MO0A 4ULLA 4DXGA 2KCTA 1SJED 4PMCA 1QNKA 3U9SA 1YITA 4K6DA 4OGQC 1TWHH 3SE0A 1RKNA 2R92B 1CKMA 2RSOA 4HMJA 5I4DA 1SNDA 1CSPA 2PQAB 4DAYB 2RQXA 3HOYB 4WJWA 1CQVA 3TDQA 4AH6A 1V8QA 2JA8B 2A69D 2PI2A 3KF8A 4C3JG 1O7YA 1VQFA 2AQ1B 2MP1A 4IQZA 3UDXA 1HFNA 3HOWB 5D65A 1PTOB 2R6GA 3KUPA 3TS2A 1UUPA 3URYA 4QGUA 1HCZA 1CSQA 3GO5A 4GLAC 4IJLA 3M4PA 3GTGB 1E2ZA 5DAUA 1UEAB 4A3KB 3J80E 1SFOH 1PTOC 1KABA 1EFID 2NVYB 1C8CA 1W6KA 1ZXTA 1GUSA 3S16H 4DR6L 3EA6A 2UUBL 1QOHA 4OL7A 2L5TA 4XTCS 4PMWA 2BCOA 4QY7A 3KDFA 1BVSA 1EQQA 4A3DG 4C3HH 3F2BA 1FVIA 2E2DC 4Z9CB 4DR4Q 2DY8A 1PDQA 3MXPA 1FNWA 2Z4HA 3GV6A 3EN2A 4BY7G 3FP9A 2G9DA 4NDXA 3I4MB 5C44H 3CP0A 2FFKB 4LMQD 1BCPB 2NBFA 4QIWE 3NTIA 3Q22A 1WVLA 3HKZB 4JI3L 4B3TL 4L6TB 1S5DD 2PW7A 3D4RA 2OCEA 1TVXA 2O4XA 1HR0W 1VQHA 2NYZD 4ZRZA 2OWOA 4LNQA 4E6IA 3CCQA 2XVSA 1BCPC 1DOKA 3S15H 1Y69U 1TT2A 1A2TA 1B44D 2A19A 5KIXA 2QEXA 2DNEA 4DR6Q 4OWWB 1VQ8A 1F2LA 3S1QB 1LABA 1GUNA 1XNQQ 1VQJA 1PV4A 1C0AA 3SR1A 4GKJQ 2VW9A 4X65L 1HXYD 2IJ0A 2L11A 3RZDB 1SSOA 2VQEQ 1SE4A 3CQZH 2HUGA 5C4XB 1DOMA 2F0LA 3U9OA 3VA5A 3NQTA 1ML0D 3E0EA 1HZAA 5A2QL 4DV4L 2F0MA 3BZKA 2M9VA 1KQSA 1Q8KA 3SGIA 1BKBA 3FPPA 3I4OA 5CR3A 4IJHA 3BDCA 4JI3Q 5IYCG 4BY1B 4B3TQ 4ZK9B 3G71A 1XJVA 4HCEA 2IY5B 3PO3H 4MZ9A 1HNWL 1EYCA 1STBA 4PNYA 1HPCA 4Q0FA 2PZTA 4UP7A 3VR2A 3BDLA 1Q3LA 2YTXA 3K5LA 1F9QA 5M3FB 4WRDA 5IP7H 1M8AA 1STNA 4QIWB 1DD2A 1D1KA 1VQOA 1NAPA 1AEXA 4AQYL 5BN4A 1EZ8A 3GV3A 3A8JE 3MEFA 1JQYD 3GTJB 1A15A 2K14A 3H0GG 3OOCA 3OWEB 4OO1H 2IX0A 2K7VA 1VCIA 4DNTB 1STGA 1IBKQ 1ZYRC 3F2CA 3HEJA 3J80i 4DV4Q 1PZID 1RHPA 2NUCA 1Y1VB 3H91A 2R92H 2CCZA 2HQEA 1WCMG 4ZAIA 3I70A 3V96A 3S1NB 1Q1BA 3QIAA 4LFAL 3HZXA 2JA5G 4OIJA 3HOYH 2JA8H 1XTDA 1PTOH 2F3WA 3L2PA 3Q24A 2RDHA 1C9OA 2Z6KA 2BH8A 3GTOB 2VUMB 3DWAA 4GKKQ 4NPSA 1YJ9A 2ES2A 3GTGH 3D31A 3BU2A 5EBCA 5IGGA 5LMNW 2F3VA 3KOJA 1V9PA 2D5DA 1E2VA 2Y0SG 3R8BA 1LV9A 2K5VA 4NB3A 1FGBD 1DXMA 4PG3A 2K5QA 2NVYH 1STYA 1PRTB 2IT1A 1JB3A 4HJ7A 3OW2A 3AU7A 4XQQA 4AQYQ 2UXDL 3ULPA 3PUXA 4A93H 5NUCA 5I2XA 1MIUA 4FXKC 1O78A 3CRLC 4P2CB 1VQ7A 2Q8IB 3IRBA 2JE6I 4DR7L 4K6LA 3KYHC 1VQCA 3W3AA 1PRTC 1S72A 4HEDA 1WTXA 1S40A 1QVGA 1FR3A 3M85A 2MJ8A 4LFAQ 4B9XA 4R4QA 1ILPA 3I4MH 4DNRB 4V0BA 4K5VA 5G3LF 3GDEA 3MWYW 4K2KA 1EFWA 3EROA 4L63B 3ITPA 2EVBA 2FHTA 4KI0A 1XMQL 4S3SA 1N34L 1YIJA 2PO4A 1RL2A 4QQBX 2WAQG 3NTKA 3BJUA 4IOAA 3PMFA 2OQKA 2ID0A 4RGTA 1FGUA 1JC7A 4QMGA 1A6XA 1GVPA 2L15A 3S14B 1PFNA 2KA7A 4IURA 4A3FG 3NK9A 2MQHA 3CCLA 5JPNC 1N36L 2UXDQ 3M3YB 4HN7A 4FYDA 3NELA 1XYIA 3S1QH 4KKTA 4NMZA 2I07B 4BA2I 5BN5A 2A68C 3TQYA 1OXVA 1WD1A 4FF1A 4RCOA 3RZDH 1XNRL 1WTPA 2ZJQA 4HAEA 1JICA 2A1AA 1VQ5A 3T1HL 4HMIA 5EJWA 1AE2A 3A0JA 4FNFA 1S3OA 1K8MA 2KHJA 1F2MA 3QR8A 4DV1L 4DV6L 2KHSA 2B2UA 2KEEA 5EAYA 1A2UA 2NVQB 1V1OA 4C3HG 4DU9A 3M4QA 2D62A 3NBIA 1ENAA 4QCLA 1TWGH 4JC0A 4MHEA 4TQUS 5C44G 1H9KA 4NKLA 5I6YA 1C7YA 3A56A 1SRUA 1Q8IA 3KBGA 3CKIB 1V1PA 3J81i 1GUTA 4WJ3M 1N36Q 2JA7B 3MXUA 5M3FH 5JPMC 4CDFC 2A6HD 3IFDA 2FXQA 3I4NH 1ASYA 1B70B 5E4XA 1XNRQ 5EKIA 1OXUA 2I5MX 1P16A 4JBMA 5ELCA 2WV6D 3NBHA 1A3TA 4CJ2C 1HZ9A 2Z9HA 1L0YB 4DA2A 1Y8OB 3PO2B 4DV1Q 3I73A 3NENA 3RR5A 1Y1VH 4DV6Q 4OO1I 1EY0A 2BA1A 1LTRD 3I91A 4RFBA 3PSIA 5GQOA 1EWHA 4NP5A 2YU9B 3FRPB 3S1NH 4H44C 1Y1WH 1JJCB 5IY0A 4CGYB 1IW7D 4GNXA 4JI1Q 2BH2A 5EKKA 2OTJA 4DV0L 5JAVA 3FEWX 1VQEA 1L2FA 3SEBA 1LYLA 1WTVA 1PMRA 1S5CD 3DMUA 4RMFA 4KD3A 3U58A 1NR4A 4DN4M 2E74C 3DWPA 4KKSA 3RZOB 3CCVA 1HRJA 3PIOA 1Q46A 4ZQ3A 2EY5A 3PO3G 4J15A 4Y52H 4N8X1 3U4VA 2E5LL 1M1KC 2ZTDA 4KD4A 3FMCA 2ZT9C 2MUYA 2RHQB 5C0XH 2C35B 3OMCA 4KK7A 3K59A 3U4ZA 1YNXA 5JJIA 3LGJA 1FYCA 4ABNA 5GAHC 1K9MC 3TSSA 5IP7G 4A3EG 1ZEQX 5IP9H 4F87A 1BUVT 3QOJA 1D5MC 2KQ3A 1I94Q 1U4LA 2ZJPA 4OO1G 1T9HA 4RAUC 4DV0Q 3KF6A 1IHZA 5A2QE 4LF8Q 2R92G 1SYDA 4TKOB 4KKUA 1N9WA 1QZHA 4DPGA 2RHSB 4JI8L 1KNEA 3C1EA 1OO9B 3E5SA 5IGDA 3HOYG 5FLXL 4ODGA 2ZXPA 5ELOA 2A6EC 1VMPA 4DR3Q 4X3KA 5T1GA 3S14H 3T13A 2B29A 1EY8A 5E7NA 3T4AC 4K0KQ 4ZUIA 2ZM6L 2HDMA 4UY8C 1ESFA 1EEID 2EYFA 1QUQB 2ENBA 4C2MB 4GN4B 3TMEA 3CU7A 3OIQA 3HOUB 1TS5A 1D2BA 1HJPA 4NXMQ 4EVOA 3HRZC 3NEMA 3N52A 3N6RA 2WB1E 2XWJB 2PNRC 1GXDC 4A93G 5KRUA 3K7AH 1XXGA 2KUMA 1EIYB 4B3ML 1KXLA 1E1OA 3AFPA 3OTOQ 2F3IA 4LF6L 1X65A 2E2JB 2EPBA 2KECA 4MTNA 2NVQH 2NVTB 1SDFA 2HCCA 4X64L 3S1MB 2XRQD 1IKLA 1YHBA 3MXNB 1DYQA 3ONAB 1BOSA 3HS0C 2EYJA 4JI8Q 5BR8Q 1VDZA 1SMXA 1Y14B 4DNIA 1N8RC 1VF7A 4BS9A 5L37A 3I4MG 4UAIA 1J5EQ 2CQAA 2IX1A 1GUWA 4GLXA 2Z8LA 1WI5A 3DXJC 3R3OA 1ASZA 4A3MH 3EQLC 2RDGA 2J7ZA 2YTYA 2FJ2A 2ZM6Q 2Z1CA 3MVVA 3DHQA 1KRTA 2HD3A 1U0LA 2AQ3B 3NUCA 3GTPB 1K0RA 2BE5D 1Q81C 3OMGA 4IPHA 4RG1A 1XPOA 1MKHA 1PZKD 1AP0A 1D8LA 1B50A 2F0OA 1LLRD 4JBKA 1HUNA 1L0XB 3PUVA 3J80c 3HOXB 3PO2H 4L5SA 4KY7A 4LF6Q 1Q7YC 3K7UC 1BBWA 1X6OA 1E24A 3HG9A 2YU9H 3S17B 1I3QB 1LO5D 4X64Q 4A75A 1TS3A 1M90C 3W1GA 5KNBA 2N49A 4X3SA 5H1SE 3VR6A 1TR5A 1Q86C 3BYYB 1EIGA 5M3MB 2WB1B 4AIMA 1SYFA 1CKOA 3ERQA 2K5HA 1F9RA 3MAQA 4KN7C 1PFSA 2R61A 3D6WA 1WTWA 3RZOH 2B2YC 3HKZE 3GD7A 4BBRH 5IT9c 1E3PA 1ICFB 2ICIA 2KCMA 1E22A 4C3IB 4XYOA 2ZTCA 4DR4L 1UEBA 1JE4A 4O0AA 4KHVA 1MGSA 1R4QB 2JQOA 3FKIB 2GA4B 2K04A 2PMZE 5M3FG 3HOZG 5C0XI 1I4QA 3MA2B 3I4NG 5CMDA 4FF2A 3SK8A 1YNJD 2B2WC 1V43A 2WP8J 1SMYC 3HGBA 4OWTB 1EOVA 2F0HA 3KK7A 4PZ7A 3TP5A 4X66Q 1BF4A 2EY2A 3MC0B 1XPUA 5FO8B 5CBAE 3CCSA 1W6JA 2SDFA 5DLQE 3CAMA 3L3OC 2M00A 1Y1VG 4XQNA 2CWAA 3QB3A 4QUCA 1FJGQ 2QCPX 1PLFA 1VQIA 1Y1WG 3RLFA 3UE1A 3CC2A 2CQOA 4DFAA 1XNQL 4DAPA 2K4KA 4HIDA 5BN3A 1SNMA 4IPGA 1AFPA 4GKJL 3ULJA 1OXSC 1FD7D 3T1YL 1QE6A 1CUKA 3STBD 2X6LA 3AMUA 5GAEC 5IYBH 5C3WA 2VQEL 5D3IB 1LTID 3MHBA 4PZ6A 5ELBA 1I4RA 1NMFA 1I4PA 4POGA 2A69C 2D9UA 3A7LA 4U673 1UAPA 2XWBB 2CW0D 1X54A 1ONLA 4BXXH 2WFWA 1K28A 2F0QA 3OW7A 3D0FA 2AWNA 1HZBA 2L12A 5C0XG 4DR1L 2K28A 3GTMH 3DEOA 1A62A 2N88A 3QG1A 2VB3X 3OHXC 4K8JA 3PIO3 2A74C 2A5HA 2PNHA 3JAME 4K5XA 2E2JH 4LF7L 2K01A 5IP9G 2NVTH 2VZAA 5HY6A 3S1MH 2UUCL 1IBLL 3MZ5A 1MD2D 2ZXRA 2TMPA 3I72A 2H4OA 5J1ZA 2PMZB 1A0IA 3K5MA 1LTLA 4KN4C 2I5HA 2Z4IA 4ID6A 2RSNA 1PH6A 2JK8A 1PH5A 4I7ZC 4XT3B 1N33L 3T1YQ 2DJFC 3T56B 2X69A 1JR0D 3J81c 1STAA 1IKMA 1ICWA 1G91A 4XXEA 3I56A 1PVOA 2DY7A 1UE1A 4ZYSA 4LF9Q 2E2IB 2MNAA 4A3IB 3KF8B 3FVQA 5FK9C 1IBKL 1ENFA 3P7JA 3J81j 1QILA 2VNUD 3DEPA 2KJXA 1SE8A 1TWAH 2EJMA 1SNPA 2F0UA 2OEOA 3WOFA 1YHQA 3GTPH 4MIUA 1UNSA 4DR1Q 2AHOB 1HNXQ 5C4HA 3CCEA 1I4GA 1MSGA 2QF7A 2YV5A 2BDNA 4UPAA 2WIIB 3CCUA 4LF7Q 1EUJA 3RNUA 1BO0A 3S17H 2R7ZB 3CC4A 4JPBW 4GKKL 1B1ZA 2UUCQ 1IBLQ 3HOVB 4GOPA 1NE3A 2WKDA 4WJ4A 1VQGA 1HA6A 4H7BA 3VDYA 3KDFB 5TSSA 2K52A 2GVAA 2SOBA 3EBEA 4UDUC 1PH7A 5EPKA 3CXCA 2DN8A 1KDBA 1N33Q 3GTLB 3RD4A 5E3FA 1DZ1A 1LT4D 2OT2A 2O5IC 5KEEA 3VR3A 1JOQA 2KCNA 1TIID 1IL8A 1A3VA 1K0SA 1VQKA 5IODA 5FLXE 2VY3A 1GUOA 2NZ1D 1EQVA 4C3IH 4C3JB 2EXZA 4A3MG 3SXHA 1SBBB 1WTOA 4EQ5A 4KV6A 2KVMA 3K6OA 1YNND 1HR0L 1EY5A 2F0NA 4HJ5A 3JC66 3C2PA 1EL0A 4CHTB 3HOWH 1YEZA 1L1OA 2XRSD 4YWKA 4CKBA 4A3CG 1EY4A 1I50B 1J9OA 2IHFA 4OX9Q 4IFDH 2XGTA 1SYGA 4A3KH 2JYOA 5DEHA 5I9OA 1IZ6A 2HDLA 3PO2G 2E76C 4O1NA 4A3DB 1WYDA 4J6HA 4GLVB 5JJZA 4C56C 3K5OA 1MHWC 4LAAA 2F0SA 4EQOA 4G7ZC 1CT1D 4NW2A 3T53B 2EXDA 3M4YA 2LSSA 1TS2A 3DM3A 3I4LA 5JEAH 4KMUC 3CRKC 1GD7A 2RVLA 1RDPD 4P71A 4FVMA 4ME3A 1AE3A 1VQMA 1SYCA 3W1BA 3F8TA 3P75A 3EFXD 1G8ZD 3TZDA 3CMEA 3NQIA 3F1ZA 4BBRG 4OHJA 1E0BA 5M5WB 1YBYA 4CJ0B 5KYIA 4IPCA 1HR0Q 2F52A 4LWCA 3ZJYC 3C3LA 2SNMA 4V190 2MGSA 1JWUD 4XDXA 4QL5A 2IPKD 2F03A 5CV9A 4TRDA 3CCJA 3CPFA 3S9WA 2JP1A 3VA7A 3GTKB 1U9RA 4NXNQ 3A54A 4ILWA 4FF3A 1EIFA 5C0XJ 1QG7A 1JT8A 4K8IA 3Q23A 4JI0Q 3G6JB 3CW2C 4PV1C 2H5XA 4DV7Q 4XIGS 1CZGA 3T16A 1I6VC 2MFIA 4RGNA 4L5RC 1Y8PB 2YYZA 1PHJA 1PZJD 5IOCA 1VQ9A 1V1QA 3BZCA 4O42A 3RLNA 3UE0A 2LFNA 4WORA 5C4XH 3LX0A 2UXBQ 3V2TA 1B9MA 5JJLA 3MFGA 3R2TA 4L5QA 1D6EC 3DLLA 4ALPA 3B6YA 5EPJA 5DM73 2B63B 3GTQB 3BYTB 2F0EA 1BQQT 4Y7NB 1VQAA 5IYBG 2EYMA 1PXUA 2F0DA 1X3PA 1J8IA 4JI1L 4BY1H 4GN5A 2E8GA 1EY6A 4CDCC 5LMNL 4JI2L 1SR3A 4BXXG 2F0IA 4P73A 3VR4A 3AQQA 3PGZA 2B2VA 3ERSX 4MN3A 2R7ZH 5IGBA 1PH8A 1RF2D 2B2TC 4K5WA 4UP8A 1WD0A 3ND8A 1GM5A 3H0GB 1SYBA 4H13C 4HIMA 3GTLH 1B2TA 3GTJH 1HTLD 1HQRD 2AUKA 1TKWB 1CKNB 3JAML 1GOZA 1HFGA 4DR2Q 3PIPA 2OF1A 4WFN3 4X6AH 2AUJD 1IL2A 5IT9L 2PW5A 2EYHA 3EVQA 1LT5D 1B9NA 1DCZA 1FNVA 3HP3A 1K8GA 4R8IA 1PH4A 4LFBL 4BBSB 1I94L 1KDAA 1MI2A 1TWFB 4IO9A 3R2IA 3SDZA 3DWQA 1TWCB 2LS01 4LF4L 4JI2Q 2RDFA 5LMNQ 5D14A 3WOEA 1VQNA 4LF8L 1K3RA 2A73B 2Q2IA 4P74A 1XPRA 5IE8A 2Y0SB 3I90A 4X62Q 3GTOH 2VUMH 2Z6BA 2JSOA 2KOLA 2B8FA 1IXRA 3V05A 3BVMA 5CV6A 2A6HC 1XTCD 2UU9L 4DR3L 5FO9B 3K80C 3LNNA 4DV2Q 2VQFL 4K0KL 1CQFA 2QGQA 1K8AC 1RTOA 4A3DH 1NY4A 3LWEA 1WFQA 3NSWA 3E9HA 2F0WA 4K14A 4IUNA 1Q1EA 4YCVA 5EBDA 3HKSA 1UWVA 2DNCA 4YCUA 2K32A 2WB1G 4NXML 1GJXA 4DK1A 4P72A 5I9PA 4DUYQ 1E7ZA 5FLMH 5EKLA 1YZ6A 3KLSA 4TVAB 3AEVA 1IW7C 4FP5D 1GHKA 3S1RB 4LFBQ 3T51B 2L0CA 5M5WH 3OTOL 2K5NA 2R93B 4LF4Q 2WAQB 3E6ZX 3H6MA 2Q8TA 4KLKA 4C3IG 1V1PB 1Z7TA 2Q8RE 3PCOB 2B39A 4AYBB 1VS0A 2EY6A 2F4VL 3G7LA 1LT6D 4M1UB 4ZKCB 1AN8A 1WJJA 3CD6A 5BR8L 4A3FB 5C3EB 1J5EL 2JA8G 5C4JB 2JJQA 2UU9Q 1IYUA 2TSSA 4B08A 3HOWG 4LUZA 4R4TA 2PCFB 2O5JC 2D2CC 4RCNA 2VQFQ 1Y8NB 2ZJRA 1SFOB 3VYRA 1SEBD 3M3YH 3NBHB 1XMOQ 1QJOA 4IFDG 3PUZA 4YWLA 3KJOA 2XIWA 4A3KG 2JXMB 4JOIC 5FJ8H 4RWSC 3A5ZB 3TREA 1U4PA 2B2YA 2VB2X 2AMCB 3K5NA 3PV0A 1J6QA 3J81L 3K58A 3VR5A 1RD9D 5M5XB 4R8NA 1H9SB 5J39A 4GNXB 1JCKB 3I8ZA 4C3HB 3HFZB 4G7HC 4LW1A 2CWPA 1A3UA 4KY6A 1CA5A 4CJ1B 4CDEC 4XYQA 3TN2A 5JEAG 3M4OB 2LXKA 1Q82C 2B63H 3GTQH 2IHEA 1I4HA 4DR5L 1PFBA 4QJFA 5C44B 4HIOA 2F4VQ 1PH1A 2RKSA 1B3QA 4PMBA 3SK5A 1BNZA 1EWIA 4N8FA 4GNXC 5ELFA 1LTSD 1X56A 4C1NI 1JWSD 2Z0SA 4BWGB 5M5YB 1SE2A 5CORA 2PQAA 4DAYA 1DGSA 2F0PA 5K36H 5DM63 1CHQD 1NBWA 1L0WA 1RODA 3HKZG 2FMCA 4DUZL 1KD1C 1MBYA 2K50A 1BDOA 3PQIA 2JA7H 1D7QA 5IYDH 5ISRA 2R3ZA 1SROA 4P75A 3SK6A 4IUVA 1K8OA 1WTQA 3MTSA 5CV7A 4LF5L 4ZLTF 4HCSA 2BDOA 1K83B 1SNOA 1U4RA 3KF6B 5GADC 1TY2A 1G6PA 4DGZA 4MTKA 1B8AA 4IUPA 2K33A 4DR5Q 4BBSH 3D6CA 5C4XG 4X66L 4HJAA 4IUTA 3H15A 4I65A 5F2DA 1WTRA 2V4DA 1QZGA 3L9AX 4YCWA 2I5LX 1TWCH 3CC7A 3M7GA 3RLOA 3QO2A 2JA6B 1JMCA 5EQ0A 1QCBD 1TY0A 2C5CA 1UE6A 1VMCA 4OIKA 4KY5A 1MJCA 1FJGL 2Q2UA 4HIKA 1GHJA 1HZCA 3NE5B 2X6GA 4DUZQ 4BY1G 4A3JB 1LM0A 3MFYA 4KJOA 2K03A 4U68A 4DK6C 4KTAA 4GS3A 2F0VA 2BE5C 1HA5A 1X3GA 2XNAC 2L55A 2F4IA 3K8AA 1KLUD 1QWYA 2R7ZG 5HGQA 3MEHA 2EQSA 3EIVA 4A3EB 4GN3B 1W2BA 4XQJA 1PTOD 1KAWA 4LF5Q 3NHHA 1TU2B 4A3BB 4KHZA 4J1MA 2DGYA 1PA6A 2KENA 1S5BD 1UE5A 1CFMA 1K73C 2I46A 5J3BA 4OWXB 2XSCA 2UUAL 1S5ED 3M9BA 4RGOS 3S1RH 3FPUB 2K75A 2JEAI 3ULLA 1EWCA 3TP7A 2DJGC 2R93H 4L5TA 1HHVA 1RIPA 4YWMA 2PI2E 3VYUA 2EYPA 2B3GA 3GP7A 4PQXA 4RA8A 4KHPQ 3L7ZC 1PH2A 3UDIA 1BBUA 5C5LA 2LMCB 2PQEA 2H1EA 5C3EH 4A3FH 3ND9A 5CV8A 1YHAA 1F9PA 2SEBD 4F88A 5IGCA 2Q2TA 3PIP3 5C4JH 2G5DA 1HNZQ 1PYBA 1QB5D 2PPBC 1OXXK 3W5OA 5AJ3Q 2VUMG 4A3GB 2HIXA 4LF9L 1VF5C 3SVMA 1BCPD 4C2MH 3S24A 4A93B 1KLGD 1R9TB 1E2WA 3HOUH 1S5FD 2VXWA 3TBIB 1YNJC 2J0TD 3SK4A 4APVA 2EIFA 4H0LC 3UDGA 4KJNA 4K2LA 1H9RA 5M5XH 4IFDJ 1BR9A 1HNXL 1C4QA 2UUAQ 2LKVA 5IIFA 4XT1B 2EJGC 4EQPA 1PH3A 1EQRA 1HUMA 3M4OH 4RHSA 1E1TA 3Q8DA 3OWFA 5FKAC 1VQBA 5FLMG 3H3VC 2KCCA 2ZTEA 3CHBD 5IT9E 1VQPA 4HR7B 5T1IA 1AW7A 2OXPA 2N78A 2EDGA 5CBEE 3SHLA 1Q12A 4I7AA 3RN5A 3UDFA 1EEFD 2VS1A 2R7FA 3D4WA 4ME5A 3IFTA 2NZHA 5JEAJ 5M5YH 4LUOA 3STBC 2LY7A 1SE3A 5FLXc 1VQ6A 3LWUA 1EY9A 2QKIC 5LL6S 3BVZA 3WDNA 1N32L 3UI2A 3AFQA 1FL0A 3OIPA 3ZYYX 5CGKA 1QVCA 3CCMA 2CW0C 1ET6A 2XTIA 2G9HD 1SN8A 2K6AA 1HTPA 5IGEA 2V1CC 2UUBQ 3PF4A 2F0FA 1CK1A 1CHPD 1O7LA 2K5WA 4DAVA 1SXTA 2OQ0A 3E9IA 1K83H 5C4ZA 3E3XA 4O2DA 2BA0A 3EJIA 4G4KA 5FJ8G 1JWMD 2GVBA 3HOXH 3F2DA 3VYTA 1I6HB 5E1FA 1I3QH 4OX9L 1ZYRD 3S2HB 1QVFA 5KNCA 3FDTA 4Q5VA 4RGMA 2JA6H 3KFUA 5M3MH 5IWAL 1TWGB 5A35A 4FF4A 2B63G 1S4ZA 3J7AF 2AKWB 1N32Q 1Q90A 2FMMA 1JORA 4A3JH 1EY7A 2NN6H 2RA4A 2RF4A 2N55A 3KLWA 1JJ2A 1B3AA 4LUVA 3DM1A 4TSSA 4JV5L 5LMUL 4PZ8A 5JVH3 3HOZB 5K36G 4IZ8A 1G2TA 2EZVA 4IPDA 4A3EH 4X65Q 2NB0A 3I4NB 4A3LH 3FKIH 1VQLA 3I55A 3A7AB 4IALA 2JA7G 2RCNA 1F2YA 4A3BH 5JJKA 1F2ZA 5IYDG 1EU4A 1O7ZA 3H09A 4CDDC 4X3TA 1MJEA 2JEBI 3J81E 3VYSA 3G4SA 4G7OC 2LXJA 2AQ2B 1PRTD 1G2SA 2EYOA 1NNXA 4R9WA 2CFMA 1Y1WB 4JCVE 4NXNL 1PYWD 2F1MA 2YTVA 2Q2HA 2L9HA 5IWAQ 1KAAA 4JI0L 2K5DA 5D3DA 1WTHA 4DV7L 3PF5A 4BBSG 1HNWQ 2C9OA 4X3UA 4UP9A 3TP6A 2N3SA 2VL6A 4C1NK 2F0KA 2B2TA 5GROA 4F7XA 3JAMi 4GZYC 4BY7B 1AH9A 4B9WA 4JV5Q 5LMUQ 3KBXA 1FNUA 3J7ZC 1X3FA 3AYHB 4A3GH 4DAMA 1STHA 1CA6A 1A63A 1YNNC 2R7DA 2HQLA 2UXBL 1SNCA 1Z6HA 1R9TH 1ESRA 1RTNA 2FINB 5FO7B 4DV5L 3H3VH 3A74A 4LK1C 4LFCL 4GOPB 1F77A 2A68D 3CPWA 4IOCA 5CV5A 1PFMA 3NXWA 1II3A 4B3SL 2CKZB 1X55A 1CKNA 3IAYA 4RHRA 4F8MA 1TS4A 4CKEA 3D4DA 1LTGD 5HURA 1KRSA 1ILQA 3NTHA 3I3CA 4YIJA 5KYLA 4GOPC 1HQMC 1IYVA 2QDLA 1LT3D 5HGTA 2EY1A 2M2LA 4JYAL 1EU3A 3NPPA 4JI5L 2R93G 2IX3A 1GKHA 4HSPA 4AYBG 1LTTD 2L1BA 4JVZA 1XX8A 2QEJC 5EGTA 3J7YW 1U5KA 3DUZA 1GO3E 2Y0SE 5C3EG 4DR2L 4ZCKA 1CTMA 2E2IH 4A3IH 5ELNA 1T5XD 5AFWA 1X3EA 3NP8A 4DV5Q 1L1OB 2PYKA 2SNSA 3D8GA 2IL8A 4JBWA 1VQDA 5IGFA 4DR7Q 1T5EA 5EPLA 4LFCQ 3J7A5 4JI7L 4IUUA 1KIXA 3TS0A 1G291 4OEMB 4N9PA 1EYDA 2KHIA 3K7AB 5FOBB 2ASBA 4IUQA 3HOUG 1D5XC 2CH4A 1L1OC 3J80L 4B3SQ 1JE5A 1SJHD 4ZKBB 1I6HH 1YJNA 4X62L 2EE1A 2Z6KC 3HOVH 3BDOA 3S2HH 3OPOA 4JI6L 4R4IA 3RUZA 2NVXB 1RJTA 1B7YB 2NZOA 3C1FA 2ALYB 4A4IA 4DV2L 1XMQQ 1N34Q 2BOSA 4JI5Q 4JYAQ 3C46A 1U4MA 2UXCL 4CBVA 1X9NA 1PTOF 1AZPA 1QNUA 2WAQE 4AYBE 1MSHA 5ELEA 3BVGA 1PYSB 3QOLA 1JOOA 4EGVA 4A3MB 1P8LA 1WCMB 2NWGA 4HTHA 3PUWA 3MXGA 4JBJA 2JA5B 4DUYL 1WOCA 1STEA 2D0PA 2N8NA 1GUGA 3BS1A 5C6AA 3HOZH 1NSNS 4QB4A 5C3XA 4C3JH 3RMHA 3ICEA 2NN6I 4JOIA 1G6ZA 3CF5A 3X3MA 2K05A 4QUFA 2F0TA 1EZ6A 1IBML 1EYAA 2ZXOA 1UE7A 1K3BC 2O2LD 1IYJB 1W3SA 1X32A 2I0QA 4JI7Q 3S2DB 3IL8A 3RN2A 5GAGC 4N9TA 5JOBA 1D1IA 1OXTA 2WKCA 3T1HQ 2J4XA 1Z47A 2L4NA 1QUQA 1F9SA 3TZUA 1NUCA 1I50H 3CCRA 1SNQA 3I2ZA 1H9SA 4OONA 4JI6Q 4H02A 2WACA 4FDBA 1O80A 3BZDB 3HOXG 3G48A 1EOTA 4IFDI 1BCPF 3O13A 2UXCQ 2EYLA 1XMOL 3IKJA 3Q6SA 4FXGC 1KC8C 3MXNA 2JA6G 5M3MG 2E2HB 1B53A 1O7IA 3I7FA 4BY7H 2QDBA 4BBRB 1R4PB 1EIHA 3K0YA 3G6EA 3NWTA 2A6ED 2A8VA 1DOLA 4A3JG 1TWHB 2EJFC 5DNFA 5C5MA 2NN6G 1IBMQ 4JI4L 4YHHL 5ELDA 3K57A 2MPMA 4R4CA 3E0JA 4YY3L 2JN4A 2B2UC 5CYUA 5I2YA 5M9OA 1PH9A 4G57A 2EOTA 1LACA 1NTGA 5K5PA 4A76A 3R93A 4DK0A 4RKLA 5E4WC 4A3LG 3FKIG 3BG3A 3TP8A 3H3VI 2WINB 4FXDA 4HSVA 1NR2A 4A3BG 1X3QA 4HJ8A 3A8KE 3GTKH 2B2VC 5J22A 3A8IE 1NCVA 4R4OA 4DV3L 3P20A 3OYYA 4L8JA 4R1JA 1CI3M 1I4XA 1XWEA 1DM0B 3NWSA 4EQNA 4DF7A 2K1BA 2D0OA 3CMAA 4JK1C 3F2UA 3S16B 1KNAA 2QW7A 5I6WA 1NMGA 1JB7A 3A5UA 4BA1I 1KDCA 4RH6A 1ET9A 5CC4A 2AWOA 2IWHA 1B4OA 1CZWA 2ATWA 3ER0A 2HHHL 2IW3A 2E5LQ 2HT1A 1EQTA 1KTKA 3KLSX 4B3RL 5IYCH 4YHHQ 4JI4Q 1ENCA 1KL9A 3AB9A 1OTCA 3TRZA 3OSOA 2DUDA 4POFA 4YY3Q 4Y7NH 1LUZA 1H95A 3K0XA 5JVG3 1SAPA 4A3GG 1D5ZC 4EX5A 4HJ9A 2B2WA 2PZUA 4IN3A 3GTMB 2GN5A 1Z9FA 2NTSA 4RKBA 2QILA 2CH4W 4OXPA 5CV4A 3H94A 4DV3Q 1RCVD 3S15B 1A8VA 3KJPA 1VQ4A 1KHIA 1TXYA 2P5ZX 1BBXC 2ICEC 1C48A 2NVXH 5G3LD 3H0GH 2HCIA 4JG2A 5LL6X 5KGUA 1JJGA 4MNOA 1EYGA 2B8GA 3J7AV 1BXTA 5LHY1 3TEHB 3U50C 3W2DA 4LJZC 1WCMH 2HHHQ 3X3NA 2MO1A 1SYEA 3CQZB 2E75C 2JA5H 4B3RQ 1JOKA 2RCFA 4J8QA 1I5FA 4DKAC 5COYA 1DJRD 2MHVA 4CKCA 4DXFA 1PRTF 1ZKOA 4UHVA 1TWAB 1LTAD 2CHBD 2HIVA 5KNDA 4A3CH 1TWFH 4DK3C 4QF4A 1SLJA 2F0JA 2QA4A 3S2DH 2PZWA 3L0OA 4A3IG 2RBMA 4OELB 1NJIC 4B3MQ 4KHPL 3PO3B 3GQBA 1HH2P 3PUYA 4M8AA 1YVCA 2JA9A 3QWNA 1DONA 2XN9C 2KBNA 2F0GA 1LTBD 1H9MA 3KLRA 1M4VA 3FHWA 1YJWA 4FO2A 1HNZL 1SMYD 1G51A 4ZUJA 3QJYA 1CM9A 3P1HA 5AJ3L 2OTLA 3HOVG 2NTTA 1H9JA 4JW0A 3K81C 3WWVA 3D3RA
chains in the Genus database with same CATH topology
1TQOA 3A55A 2CVRA 1AZQA 3M7NA 3Q0AA 2KEDA 4ULLA 4DXGA 1SJED 4PMCA 1QNKA 3U9SA 4K6DA 4OGQC 3SE0A 1RKNA 2R92B 2RSOA 4HMJA 5I4DA 1SNDA 2RQXA 3HOYB 4WJWA 1CQVA 3TDQA 1V8QA 2JA8B 2A69D 3KF8A 4C3JG 1O7YA 2AQ1B 2MP1A 4IQZA 1HFNA 3HOWB 5D65A 1PTOB 2R6GA 3KUPA 1UUPA 3URYA 1HCZA 3GO5A 3GTGB 1E2ZA 5DAUA 1UEAB 4A3KB 3J80E 1PTOC 1KABA 1EFID 2NVYB 1C8CA 1W6KA 1ZXTA 1GUSA 3EA6A 1QOHA 4OL7A 2L5TA 4XTCS 4PMWA 2BCOA 2E2DC 4Z9CB 2DY8A 1PDQA 3MXPA 1FNWA 2Z4HA 3GV6A 2G9DA 4NDXA 3I4MB 2FFKB 4LMQD 1BCPB 2NBFA 3NTIA 3Q22A 1WVLA 3HKZB 4L6TB 1S5DD 2PW7A 3D4RA 1TVXA 2O4XA 2NYZD 4ZRZA 4E6IA 2XVSA 1BCPC 1DOKA 1Y69U 1TT2A 1A2TA 1B44D 5KIXA 2DNEA 1F2LA 3S1QB 1LABA 1GUNA 3SR1A 1HXYD 2IJ0A 2L11A 3RZDB 1SSOA 1SE4A 5C4XB 2HUGA 1DOMA 2F0LA 3U9OA 3VA5A 3NQTA 1ML0D 5A2QL 2F0MA 2M9VA 3FPPA 5CR3A 3BDCA 4BY1B 4ZK9B 4HCEA 1EYCA 1STBA 4PNYA 1HPCA 4Q0FA 2PZTA 3VR2A 3BDLA 1Q3LA 3K5LA 1F9QA 5M3FB 4WRDA 1M8AA 1STNA 4QIWB 1DD2A 1D1KA 1NAPA 1AEXA 5BN4A 1EZ8A 3GV3A 3A8JE 1JQYD 3GTJB 1A15A 3OOCA 3OWEB 4OO1H 2IX0A 2K7VA 1VCIA 4DNTB 1STGA 1ZYRC 3HEJA 1PZID 1RHPA 2NUCA 1Y1VB 3H91A 2HQEA 4ZAIA 3I70A 3V96A 3S1NB 1Q1BA 3QIAA 3HZXA 4OIJA 1PTOH 2F3WA 3Q24A 2RDHA 3GTOB 2VUMB 3DWAA 3D31A 5EBCA 5IGGA 2F3VA 2D5DA 1E2VA 3R8BA 1LV9A 1FGBD 1DXMA 2K5QA 1STYA 1PRTB 2IT1A 1JB3A 3AU7A 4XQQA 3PUXA 5NUCA 5I2XA 4FXKC 1O78A 3CRLC 4P2CB 2Q8IB 2JE6I 4K6LA 3W3AA 1PRTC 4HEDA 1WTXA 1FR3A 3M85A 2MJ8A 4B9XA 1ILPA 4DNRB 4V0BA 4K5VA 5G3LF 3MWYW 4K2KA 3EROA 4L63B 3ITPA 2EVBA 2FHTA 4KI0A 4S3SA 2PO4A 3NTKA 3PMFA 2ID0A 4RGTA 1JC7A 4QMGA 1A6XA 3S14B 1PFNA 2KA7A 4IURA 3NK9A 5JPNC 3M3YB 4HN7A 4FYDA 1XYIA 4KKTA 4NMZA 2I07B 4BA2I 5BN5A 2A68C 4FF1A 1OXVA 1WD1A 4RCOA 1WTPA 4HAEA 1JICA 4HMIA 5EJWA 4FNFA 1K8MA 1F2MA 2KHSA 2B2UA 2KEEA 1A2UA 2NVQB 1V1OA 4C3HG 4DU9A 2D62A 3NBIA 1ENAA 4QCLA 4MHEA 4TQUS 1H9KA 4NKLA 5I6YA 3A56A 1Q8IA 3KBGA 3CKIB 1V1PA 1GUTA 2JA7B 3MXUA 5JPMC 2A6HD 3IFDA 5E4XA 5EKIA 1OXUA 5ELCA 2WV6D 3NBHA 1A3TA 4CJ2C 1L0YB 4DA2A 1Y8OB 3PO2B 3I73A 4OO1I 1EY0A 2BA1A 1LTRD 3I91A 4RFBA 2YU9B 1EWHA 4NP5A 3FRPB 4H44C 4CGYB 1IW7D 5EKKA 5JAVA 3FEWX 3SEBA 1WTVA 1PMRA 1S5CD 3DMUA 4KD3A 1NR4A 4DN4M 2E74C 3DWPA 4KKSA 3RZOB 1HRJA 4ZQ3A 2EY5A 4KD4A 3FMCA 2ZT9C 2MUYA 5C0XH 3OMCA 4KK7A 3K59A 1FYCA 4ABNA 3TSSA 1ZEQX 4F87A 1BUVT 3QOJA 1D5MC 2KQ3A 1U4LA 4OO1G 4RAUC 1IHZA 5A2QE 1SYDA 4TKOB 4KKUA 1KNEA 3C1EA 1OO9B 3E5SA 5IGDA 5FLXL 4ODGA 2ZXPA 2A6EC 1VMPA 4X3KA 5T1GA 3T13A 1EY8A 3T4AC 4ZUIA 2HDMA 1ESFA 1EEID 2EYFA 2ENBA 4C2MB 3TMEA 3CU7A 3OIQA 3HOUB 1TS5A 1D2BA 4EVOA 3HRZC 3N52A 3N6RA 2XWJB 2PNRC 1GXDC 5KRUA 1XXGA 2KUMA 2E2JB 2EPBA 2KECA 2NVTB 1SDFA 2HCCA 3S1MB 2XRQD 1IKLA 1DYQA 3ONAB 1BOSA 3HS0C 2EYJA 1VDZA 1VF7A 4BS9A 4UAIA 2CQAA 2IX1A 1GUWA 2Z8LA 3DXJC 3R3OA 3EQLC 2RDGA 2J7ZA 2FJ2A 2Z1CA 3MVVA 3DHQA 2AQ3B 3NUCA 3GTPB 2BE5D 3OMGA 1PZKD 1AP0A 1B50A 2F0OA 1LLRD 1HUNA 1L0XB 3PUVA 3HOXB 4KY7A 3HG9A 3S17B 1I3QB 1LO5D 1TS3A 5KNBA 4X3SA 3VR6A 1TR5A 3BYYB 1EIGA 5M3MB 2WB1B 1SYFA 3ERQA 1F9RA 3MAQA 4KN7C 3D6WA 2R61A 1WTWA 2B2YC 3GD7A 2ICIA 4C3IB 4XYOA 1JE4A 4KHVA 1MGSA 1R4QB 3FKIB 2GA4B 2K04A 5C0XI 1I4QA 3MA2B 5CMDA 4FF2A 3SK8A 1YNJD 2B2WC 1V43A 2WP8J 1SMYC 3HGBA 2F0HA 3KK7A 3TP5A 1BF4A 2EY2A 3MC0B 5FO8B 5CBAE 1W6JA 2SDFA 3L3OC 2M00A 4XQNA 3QB3A 4QUCA 2QCPX 1PLFA 3RLFA 4DFAA 4DAPA 5BN3A 1SNMA 1AFPA 1OXSC 1FD7D 1QE6A 2X6LA 3AMUA 5C3WA 5D3IB 1LTID 3MHBA 5ELBA 1I4RA 1I4PA 2A69C 2D9UA 3A7LA 4U673 1UAPA 2XWBB 2CW0D 1ONLA 2F0QA 3OW7A 2AWNA 2L12A 5C0XG 2K28A 3DEOA 2N88A 3QG1A 2VB3X 3OHXC 4K8JA 3PIO3 2A74C 2A5HA 3JAME 4K5XA 2K01A 3MZ5A 1MD2D 2ZXRA 2TMPA 3I72A 2H4OA 5J1ZA 2PMZB 3K5MA 4KN4C 2Z4IA 4ID6A 2RSNA 4I7ZC 4XT3B 3T56B 2X69A 1JR0D 1STAA 1IKMA 1ICWA 1G91A 4XXEA 2DY7A 4ZYSA 2E2IB 4A3IB 3FVQA 5FK9C 1ENFA 3P7JA 1QILA 2VNUD 3DEPA 2KJXA 2F0UA 2EJMA 1SNPA 2OEOA 3WOFA 4MIUA 1UNSA 5C4HA 1I4GA 1MSGA 2QF7A 2BDNA 2WIIB 1BO0A 2R7ZB 1B1ZA 3HOVB 2WKDA 1HA6A 4H7BA 5TSSA 2SOBA 4UDUC 5EPKA 2DN8A 1KDBA 3GTLB 3RD4A 5E3FA 1DZ1A 1LT4D 2OT2A 2O5IC 5KEEA 3VR3A 1JOQA 2KCNA 1TIID 1IL8A 1A3VA 5IODA 5FLXE 1GUOA 2NZ1D 1EQVA 4C3JB 2EXZA 3SXHA 1SBBB 1WTOA 4KV6A 2KVMA 3K6OA 1YNND 1EY5A 2F0NA 3C2PA 1EL0A 4CHTB 2XRSD 4CKBA 1EY4A 1I50B 1J9OA 4IFDH 1SYGA 2JYOA 5DEHA 5I9OA 2HDLA 2E76C 4O1NA 4A3DB 5JJZA 4J6HA 4C56C 3K5OA 4LAAA 2F0SA 4EQOA 4G7ZC 1CT1D 4NW2A 3T53B 3M4YA 1TS2A 3I4LA 5JEAH 4KMUC 3CRKC 2RVLA 1RDPD 4FVMA 1SYCA 3P75A 3EFXD 1G8ZD 3TZDA 3NQIA 5M5WB 4OHJA 1E0BA 4CJ0B 5KYIA 3C3LA 2SNMA 4V190 2MGSA 1JWUD 4XDXA 2IPKD 2F03A 5CV9A 4TRDA 3S9WA 2JP1A 3VA7A 3GTKB 1U9RA 3A54A 4ILWA 4FF3A 5C0XJ 1QG7A 4K8IA 3Q23A 3G6JB 4PV1C 4XIGS 1CZGA 3T16A 1I6VC 4RGNA 1Y8PB 2YYZA 1PZJD 5IOCA 4O42A 2LFNA 4WORA 3LX0A 3V2TA 1B9MA 3MFGA 3R2TA 1D6EC 5EPJA 5DM73 2B63B 3GTQB 3BYTB 2F0EA 1BQQT 4Y7NB 2EYMA 1PXUA 2F0DA 1X3PA 1J8IA 1EY6A 2F0IA 3VR4A 2B2VA 4MN3A 5IGBA 1RF2D 2B2TC 4K5WA 1WD0A 3ND8A 3H0GB 1SYBA 4H13C 1B2TA 1HTLD 1HQRD 2AUKA 1TKWB 3JAML 1GOZA 1HFGA 2OF1A 4WFN3 2AUJD 5IT9L 2PW5A 2EYHA 3EVQA 1LT5D 1B9NA 1DCZA 1FNVA 3HP3A 4R8IA 4BBSB 1KDAA 1MI2A 1TWFB 3R2IA 3SDZA 3DWQA 1TWCB 2LS01 2RDFA 5D14A 3WOEA 2A73B 2Y0SB 3I90A 2JSOA 2KOLA 2B8FA 3V05A 3BVMA 5CV6A 2A6HC 1XTCD 5FO9B 3LNNA 1CQFA 1RTOA 3LWEA 3NSWA 4K14A 2F0WA 4IUNA 1Q1EA 5EBDA 2DNCA 2K32A 1GJXA 4DK1A 5I9PA 5EKLA 3KLSA 1IW7C 4FP5D 1GHKA 3S1RB 3T51B 2L0CA 2R93B 2WAQB 3E6ZX 3H6MA 2Q8TA 4C3IG 1V1PB 1Z7TA 2Q8RE 4AYBB 2B39A 2EY6A 3G7LA 1LT6D 4M1UB 4ZKCB 1AN8A 4A3FB 5C3EB 5C4JB 1IYUA 2TSSA 4B08A 2PCFB 2O5JC 2D2CC 4RCNA 1Y8NB 1SFOB 3VYRA 1SEBD 1QJOA 4IFDG 3PUZA 2XIWA 2JXMB 4RWSC 1U4PA 2B2YA 2VB2X 3K5NA 3PV0A 3J81L 3K58A 3VR5A 1RD9D 5M5XB 4R8NA 1H9SB 5J39A 1JCKB 3I8ZA 4C3HB 4G7HC 1A3UA 4KY6A 1CA5A 4CJ1B 4XYQA 3TN2A 5JEAG 3M4OB 1I4HA 1PFBA 5C44B 2RKSA 3SK5A 4PMBA 1BNZA 5ELFA 1LTSD 4C1NI 1JWSD 4BWGB 5M5YB 1SE2A 5CORA 4DAYA 2F0PA 5K36H 5DM63 1CHQD 1RODA 2FMCA 1MBYA 1BDOA 5ISRA 2R3ZA 3SK6A 4IUVA 1K8OA 1WTQA 3MTSA 5CV7A 4ZLTF 4HCSA 2BDOA 1K83B 1SNOA 1U4RA 1TY2A 4DGZA 4IUPA 2K33A 3D6CA 4IUTA 4I65A 5F2DA 1WTRA 2V4DA 3L9AX 3M7GA 3QO2A 2JA6B 5EQ0A 1QCBD 1TY0A 2C5CA 1VMCA 4OIKA 4KY5A 1GHJA 3NE5B 2X6GA 4A3JB 3MFYA 4KJOA 2K03A 4U68A 4KTAA 2F0VA 2BE5C 1HA5A 2XNAC 2L55A 2F4IA 1KLUD 1QWYA 3MEHA 4A3EB 4XQJA 1PTOD 3NHHA 1TU2B 4A3BB 4KHZA 4J1MA 1S5BD 1CFMA 2I46A 2XSCA 1S5ED 4RGOS 3FPUB 2JEAI 1EWCA 3TP7A 1HHVA 3VYUA 2EYPA 3GP7A 4PQXA 4RA8A 3L7ZC 5C5LA 2LMCB 2PQEA 2H1EA 3ND9A 5CV8A 2SEBD 1F9PA 5IGCA 4F88A 3PIP3 1QB5D 2PPBC 1OXXK 4A3GB 1VF5C 3SVMA 1BCPD 4A93B 1KLGD 1R9TB 1E2WA 1S5FD 2VXWA 3TBIB 1YNJC 2J0TD 3SK4A 4H0LC 4KJNA 4K2LA 1H9RA 4IFDJ 1BR9A 1C4QA 2LKVA 5IIFA 4XT1B 2EJGC 4EQPA 1HUMA 4RHSA 3OWFA 5FKAC 3H3VC 2KCCA 3CHBD 5IT9E 4HR7B 5T1IA 1AW7A 2OXPA 5CBEE 2EDGA 3SHLA 1Q12A 1EEFD 3D4WA 4ME5A 3IFTA 5JEAJ 2LY7A 1SE3A 3LWUA 1EY9A 2QKIC 5LL6S 3BVZA 3WDNA 3UI2A 3OIPA 3ZYYX 5CGKA 2CW0C 1ET6A 2G9HD 2K6AA 1HTPA 5IGEA 2F0FA 1CK1A 1CHPD 1O7LA 2K5WA 4DAVA 1SXTA 5C4ZA 2BA0A 3EJIA 4G4KA 1JWMD 3VYTA 1I6HB 5E1FA 1ZYRD 3S2HB 5KNCA 3FDTA 4Q5VA 4RGMA 1TWGB 5A35A 4FF4A 1S4ZA 3J7AF 1Q90A 2FMMA 1JORA 1EY7A 2NN6H 2RA4A 2N55A 1B3AA 3DM1A 4TSSA 5JVH3 3HOZB 5K36G 4IZ8A 1G2TA 2EZVA 2NB0A 3I4NB 3A7AB 4IALA 1F2YA 1F2ZA 1EU4A 1O7ZA 3H09A 4X3TA 2JEBI 3J81E 3VYSA 4G7OC 2AQ2B 1PRTD 1G2SA 2EYOA 4R9WA 1Y1WB 1PYWD 2F1MA 2L9HA 1KAAA 2K5DA 5D3DA 2C9OA 4X3UA 3TP6A 4C1NK 2F0KA 2B2TA 4F7XA 4GZYC 4BY7B 4B9WA 3KBXA 1FNUA 1STHA 1CA6A 1YNNC 1SNCA 1Z6HA 1ESRA 1RTNA 2FINB 5FO7B 4LK1C 1F77A 2A68D 5CV5A 1PFMA 3NXWA 1II3A 3IAYA 4RHRA 4F8MA 1TS4A 4CKEA 3D4DA 1LTGD 5HURA 1ILQA 3NTHA 3I3CA 4YIJA 5KYLA 1HQMC 1IYVA 1LT3D 5HGTA 2EY1A 2M2LA 1EU3A 3NPPA 2IX3A 4HSPA 1LTTD 2L1BA 1XX8A 2QEJC 5EGTA 3J7YW 3DUZA 1CTMA 1T5XD 5AFWA 3NP8A 2PYKA 2SNSA 3D8GA 2IL8A 4JBWA 5IGFA 1T5EA 5EPLA 4IUUA 1G291 4N9PA 1EYDA 3K7AB 5FOBB 4IUQA 1D5XC 3J80L 1SJHD 4ZKBB 2EE1A 3BDOA 3OPOA 3RUZA 2NVXB 1RJTA 3C1FA 2BOSA 3C46A 1U4MA 4CBVA 1PTOF 1AZPA 1QNUA 1MSHA 5ELEA 3BVGA 3QOLA 4A3MB 1JOOA 4EGVA 2NWGA 1WCMB 4HTHA 3PUWA 3MXGA 2JA5B 1STEA 1GUGA 3BS1A 5C6AA 1NSNS 4QB4A 5C3XA 3RMHA 2NN6I 1G6ZA 3X3MA 2K05A 4QUFA 2F0TA 1EZ6A 1EYAA 2ZXOA 2O2LD 1X32A 3S2DB 3IL8A 4N9TA 5JOBA 1D1IA 1OXTA 2WKCA 2J4XA 1Z47A 2L4NA 1F9SA 3TZUA 1NUCA 1SNQA 1H9SA 2WACA 1O80A 3BZDB 1EOTA 4IFDI 1BCPF 3O13A 2EYLA 3IKJA 3Q6SA 4FXGC 3MXNA 2E2HB 1B53A 2QDBA 4BBRB 1R4PB 1EIHA 3K0YA 3NWTA 2A6ED 1DOLA 1TWHB 2EJFC 5DNFA 5C5MA 2NN6G 5ELDA 3K57A 2MPMA 3E0JA 2B2UC 5CYUA 5I2YA 5M9OA 4G57A 2EOTA 1LACA 5K5PA 3R93A 4DK0A 4RKLA 5E4WC 3BG3A 3TP8A 2WINB 4FXDA 4HSVA 1NR2A 1X3QA 3A8KE 2B2VC 5J22A 3A8IE 1NCVA 3P20A 4L8JA 1CI3M 1I4XA 1XWEA 1DM0B 3NWSA 4EQNA 4DF7A 2K1BA 4JK1C 3F2UA 3S16B 1KNAA 5I6WA 4BA1I 1KDCA 4RH6A 1ET9A 5CC4A 2AWOA 2IWHA 1B4OA 1CZWA 2IW3A 1EQTA 1KTKA 3KLSX 1ENCA 3AB9A 3OSOA 5JVG3 1SAPA 1D5ZC 2B2WA 2PZUA 4IN3A 3GTMB 2NTSA 4RKBA 2QILA 5CV4A 3H94A 1RCVD 3S15B 1BBXC 2ICEC 1C48A 5G3LD 2HCIA 5LL6X 5KGUA 2B8GA 3J7AV 1BXTA 5LHY1 3W2DA 4LJZC 3X3NA 1SYEA 3CQZB 2E75C 1JOKA 4J8QA 5COYA 1DJRD 4CKCA 2MHVA 4DXFA 1PRTF 1ZKOA 1TWAB 1LTAD 2CHBD 5KNDA 4QF4A 2F0JA 2PZWA 2RBMA 3PO3B 3GQBA 3PUYA 4M8AA 3QWNA 1DONA 2XN9C 2F0GA 1LTBD 1H9MA 3KLRA 1M4VA 4FO2A 1SMYD 4ZUJA 3QJYA 1CM9A 3P1HA 2NTTA 1H9JA 3D3RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F0O A;  1EQV A;  1EYA A;  2F0Q A;  5IGG A;  5IOC A;  1TQO A;  2F3V A;  5CV5 A;  5C5L A;  4KY7 A;  2PQE A;  3NXW A;  1IHZ A;  2EXZ A;  4NKL A;  1ENC A;  3SXH A;  5I6Y A;  1II3 A;  2F0W A;  4K14 A;  4N9T A;  4WOR A;  5CV8 A;  4IUN A;  5JOB A;  3OSO A;  5IGC A;  3SR1 A;  4PMC A;  4KV6 A;  1SYD A;  3LX0 A;  4F8M A;  1STY A;  1NUC A;  5ISR A;  3V2T A;  3C1E A;  3D4D A;  4K6D A;  5HUR A;  1EY5 A;  4K8J A;  5I9P A;  1RKN A;  2F0N A;  3E5S A;  1TR5 A;  5NUC A;  3SK6 A;  5IGD A;  5EKL A;  4YIJ A;  1SNQ A;  4ODG A;  2F0L A;  5KYL A;  2F0E A;  2PZU A;  4HMJ A;  4K5X A;  3U9O A;  1SND A;  3NQT A;  3VA5 A;  1JOR A;  1SYF A;  5HGT A;  2EYM A;  3ERQ A;  4RKB A;  1EY7 A;  5CV7 A;  2F0D A;  2EY1 A;  2WAC A;  1EY4 A;  3T13 A;  3MZ5 A;  1EY8 A;  5J1Z A;  2F0M A;  1EY6 A;  1SNO A;  4ZUI A;  5CV4 A;  3SK4 A;  1SYG A;  2EYL A;  4IZ8 A;  2F0I A;  5DEH A;  5I9O A;  4KJN A;  2EYF A;  5EGT A;  4ID6 A;  3H6M A;  4DGZ A;  4K2L A;  5CR3 A;  2ENB A;  3BDC A;  1A3T A;  2EY6 A;  3TME A;  4B9X A;  3D6C A;  2LKV A;  5IIF A;  4IAL A;  4I65 A;  5F2D A;  4EQP A;  1F2Y A;  5IGB A;  1STA A;  1F2Z A;  5DAU A;  4EVO A;  4J6H A;  4K5V A;  1EYC A;  2QDB A;  1STB A;  3NP8 A;  4K5W A;  2PYK A;  4KHV A;  5KGU A;  2SNS A;  3D8G A;  1EY0 A;  4LAA A;  2F0S A;  4PNY A;  4K2K A;  1KAB A;  4NP5 A;  4EQO A;  3ERO A;  3OWF A;  5KRU A;  2PZT A;  3ITP A;  1SYB A;  5IGF A;  4KY5 A;  3BDL A;  4S3S A;  2OXP A;  5KIX A;  5EKK A;  3SHL A;  1SYE A;  5C5M A;  2F0U A;  5JAV A;  1SNP A;  2OEO A;  3D4W A;  3PMF A;  4ME5 A;  4N9P A;  1EYD A;  4MIU A;  4QMG A;  2EYO A;  1JOK A;  1SYC A;  4OL7 A;  4WRD A;  3SK8 A;  1STN A;  4KJO A;  5M9O A;  4G57 A;  2F0H A;  3DMU A;  3P75 A;  3TP5 A;  4KD3 A;  4KTA A;  3NK9 A;  5C4H A;  1AEX A;  2OF1 A;  1KAA A;  1EZ8 A;  5K5P A;  1EY9 A;  2EY2 A;  2F0V A;  4RKL A;  2EYJ A;  5KYI A;  2PW5 A;  2EYH A;  4QF4 A;  3TP8 A;  2F0J A;  2PZW A;  3EVQ A;  3MXP A;  4ZQ3 A;  5CGK A;  3MEH A;  2EY5 A;  2RBM A;  2SNM A;  3RUZ A;  3TP6 A;  4R8N A;  2M00 A;  4NMZ A;  3C1F A;  5J39 A;  4NDX A;  1STG A;  5J22 A;  2F0K A;  1KDA A;  3QB3 A;  3NHH A;  3R3O A;  4F7X A;  3HEJ A;  4KD4 A;  5CV9 A;  1A3U A;  2NUC A;  4J1M A;  4KY6 A;  4TRD A;  4B9W A;  5IGE A;  3OMC A;  3S9W A;  4DFA A;  2RDF A;  2HQE A;  3MVV A;  4H7B A;  1SNM A;  2F0F A;  2F0G A;  4HMI A;  1U9R A;  3DHQ A;  3HZX A;  1STH A;  4EQN A;  4DF7 A;  2SOB A;  5KEE A;  3QOL A;  1JOO A;  2PW7 A;  2RKS A;  3NUC A;  1KDB A;  4HTH A;  1F2M A;  4K8I A;  1SNC A;  4PMB A;  3SK5 A;  5I6W A;  4ZUJ A;  2O4X A;  5C4Z A;  5E3F A;  5C3W A;  2KHS A;  3EJI A;  3MHB A;  3P1H A;  5CV6 A;  3TP7 A;  1A2U A;  4E6I A;  5C6A A;  3T16 A;  1KDC A;  2F3W A;  1NSN S;  3OMG A;  3QOJ A;  4QB4 A;  4DU9 A;  5C3X A;  1JOQ A;  5CC4 A;  1ENA A;  2EYP A;  1TT2 A;  1A2T A;  2KQ3 A;  1A3V A;  2F0T A;  5E1F A;  2F0P A;  5IOD A;  1EZ6 A; 
#chains in the Genus database with same CATH topology
 1YI2 A;  1TQO A;  3A55 A;  2CVR A;  1AZQ A;  2E2H H;  3Q0A A;  3M7N A;  3JAM c;  2KED A;  2MO0 A;  4ULL A;  4DXG A;  2KCT A;  1SJE D;  4PMC A;  1QNK A;  3U9S A;  1YIT A;  4K6D A;  4OGQ C;  1TWH H;  3SE0 A;  1RKN A;  2R92 B;  1CKM A;  2RSO A;  4HMJ A;  5I4D A;  1SND A;  1CSP A;  2PQA B;  4DAY B;  2RQX A;  3HOY B;  4WJW A;  1CQV A;  3TDQ A;  4AH6 A;  1V8Q A;  2JA8 B;  2A69 D;  2PI2 A;  3KF8 A;  4C3J G;  1O7Y A;  1VQF A;  2AQ1 B;  2MP1 A;  4IQZ A;  3UDX A;  1HFN A;  3HOW B;  5D65 A;  1PTO B;  2R6G A;  3KUP A;  3TS2 A;  1UUP A;  3URY A;  4QGU A;  1HCZ A;  1CSQ A;  3GO5 A;  4GLA C;  4IJL A;  3M4P A;  3GTG B;  1E2Z A;  5DAU A;  1UEA B;  4A3K B;  3J80 E;  1SFO H;  1PTO C;  1KAB A;  1EFI D;  2NVY B;  1C8C A;  1W6K A;  1ZXT A;  1GUS A;  3S16 H;  4DR6 L;  3EA6 A;  2UUB L;  1QOH A;  4OL7 A;  2L5T A;  4XTC S;  4PMW A;  2BCO A;  4QY7 A;  3KDF A;  1BVS A;  1EQQ A;  4A3D G;  4C3H H;  3F2B A;  1FVI A;  2E2D C;  4Z9C B;  4DR4 Q;  2DY8 A;  1PDQ A;  3MXP A;  1FNW A;  2Z4H A;  3GV6 A;  3EN2 A;  4BY7 G;  3FP9 A;  2G9D A;  4NDX A;  3I4M B;  5C44 H;  3CP0 A;  2FFK B;  4LMQ D;  1BCP B;  2NBF A;  4QIW E;  3NTI A;  3Q22 A;  1WVL A;  3HKZ B;  4JI3 L;  4B3T L;  4L6T B;  1S5D D;  2PW7 A;  3D4R A;  2OCE A;  1TVX A;  2O4X A;  1HR0 W;  1VQH A;  2NYZ D;  4ZRZ A;  2OWO A;  4LNQ A;  4E6I A;  3CCQ A;  2XVS A;  1BCP C;  1DOK A;  3S15 H;  1Y69 U;  1TT2 A;  1A2T A;  1B44 D;  2A19 A;  5KIX A;  2QEX A;  2DNE A;  4DR6 Q;  4OWW B;  1VQ8 A;  1F2L A;  3S1Q B;  1LAB A;  1GUN A;  1XNQ Q;  1VQJ A;  1PV4 A;  1C0A A;  3SR1 A;  4GKJ Q;  2VW9 A;  4X65 L;  1HXY D;  2IJ0 A;  2L11 A;  3RZD B;  1SSO A;  2VQE Q;  1SE4 A;  3CQZ H;  2HUG A;  5C4X B;  1DOM A;  2F0L A;  3U9O A;  3VA5 A;  3NQT A;  1ML0 D;  3E0E A;  1HZA A;  5A2Q L;  4DV4 L;  2F0M A;  3BZK A;  2M9V A;  1KQS A;  1Q8K A;  3SGI A;  1BKB A;  3FPP A;  3I4O A;  5CR3 A;  4IJH A;  3BDC A;  4JI3 Q;  5IYC G;  4BY1 B;  4B3T Q;  4ZK9 B;  3G71 A;  1XJV A;  4HCE A;  2IY5 B;  3PO3 H;  4MZ9 A;  1HNW L;  1EYC A;  1STB A;  4PNY A;  1HPC A;  4Q0F A;  2PZT A;  4UP7 A;  3VR2 A;  3BDL A;  1Q3L A;  2YTX A;  3K5L A;  1F9Q A;  5M3F B;  4WRD A;  5IP7 H;  1M8A A;  1STN A;  4QIW B;  1DD2 A;  1D1K A;  1VQO A;  1NAP A;  1AEX A;  4AQY L;  5BN4 A;  1EZ8 A;  3GV3 A;  3A8J E;  3MEF A;  1JQY D;  3GTJ B;  1A15 A;  2K14 A;  3H0G G;  3OOC A;  3OWE B;  4OO1 H;  2IX0 A;  2K7V A;  1VCI A;  4DNT B;  1STG A;  1IBK Q;  1ZYR C;  3F2C A;  3HEJ A;  3J80 i;  4DV4 Q;  1PZI D;  1RHP A;  2NUC A;  1Y1V B;  3H91 A;  2R92 H;  2CCZ A;  2HQE A;  1WCM G;  4ZAI A;  3I70 A;  3V96 A;  3S1N B;  1Q1B A;  3QIA A;  4LFA L;  3HZX A;  2JA5 G;  4OIJ A;  3HOY H;  2JA8 H;  1XTD A;  1PTO H;  2F3W A;  3L2P A;  3Q24 A;  2RDH A;  1C9O A;  2Z6K A;  2BH8 A;  3GTO B;  2VUM B;  3DWA A;  4GKK Q;  4NPS A;  1YJ9 A;  2ES2 A;  3GTG H;  3D31 A;  3BU2 A;  5EBC A;  5IGG A;  5LMN W;  2F3V A;  3KOJ A;  1V9P A;  2D5D A;  1E2V A;  2Y0S G;  3R8B A;  1LV9 A;  2K5V A;  4NB3 A;  1FGB D;  1DXM A;  4PG3 A;  2K5Q A;  2NVY H;  1STY A;  1PRT B;  2IT1 A;  1JB3 A;  4HJ7 A;  3OW2 A;  3AU7 A;  4XQQ A;  4AQY Q;  2UXD L;  3ULP A;  3PUX A;  4A93 H;  5NUC A;  5I2X A;  1MIU A;  4FXK C;  1O78 A;  3CRL C;  4P2C B;  1VQ7 A;  2Q8I B;  3IRB A;  2JE6 I;  4DR7 L;  4K6L A;  3KYH C;  1VQC A;  3W3A A;  1PRT C;  1S72 A;  4HED A;  1WTX A;  1S40 A;  1QVG A;  1FR3 A;  3M85 A;  2MJ8 A;  4LFA Q;  4B9X A;  4R4Q A;  1ILP A;  3I4M H;  4DNR B;  4V0B A;  4K5V A;  5G3L F;  3GDE A;  3MWY W;  4K2K A;  1EFW A;  3ERO A;  4L63 B;  3ITP A;  2EVB A;  2FHT A;  4KI0 A;  1XMQ L;  4S3S A;  1N34 L;  1YIJ A;  2PO4 A;  1RL2 A;  4QQB X;  2WAQ G;  3NTK A;  3BJU A;  4IOA A;  3PMF A;  2OQK A;  2ID0 A;  4RGT A;  1FGU A;  1JC7 A;  4QMG A;  1A6X A;  1GVP A;  2L15 A;  3S14 B;  1PFN A;  2KA7 A;  4IUR A;  4A3F G;  3NK9 A;  2MQH A;  3CCL A;  5JPN C;  1N36 L;  2UXD Q;  3M3Y B;  4HN7 A;  4FYD A;  3NEL A;  1XYI A;  3S1Q H;  4KKT A;  4NMZ A;  2I07 B;  4BA2 I;  5BN5 A;  2A68 C;  3TQY A;  1OXV A;  1WD1 A;  4FF1 A;  4RCO A;  3RZD H;  1XNR L;  1WTP A;  2ZJQ A;  4HAE A;  1JIC A;  2A1A A;  1VQ5 A;  3T1H L;  4HMI A;  5EJW A;  1AE2 A;  3A0J A;  4FNF A;  1S3O A;  1K8M A;  2KHJ A;  1F2M A;  3QR8 A;  4DV1 L;  4DV6 L;  2KHS A;  2B2U A;  2KEE A;  5EAY A;  1A2U A;  2NVQ B;  1V1O A;  4C3H G;  4DU9 A;  3M4Q A;  2D62 A;  3NBI A;  1ENA A;  4QCL A;  1TWG H;  4JC0 A;  4MHE A;  4TQU S;  5C44 G;  1H9K A;  4NKL A;  5I6Y A;  1C7Y A;  3A56 A;  1SRU A;  1Q8I A;  3KBG A;  3CKI B;  1V1P A;  3J81 i;  1GUT A;  4WJ3 M;  1N36 Q;  2JA7 B;  3MXU A;  5M3F H;  5JPM C;  4CDF C;  2A6H D;  3IFD A;  2FXQ A;  3I4N H;  1ASY A;  1B70 B;  5E4X A;  1XNR Q;  5EKI A;  1OXU A;  2I5M X;  1P16 A;  4JBM A;  5ELC A;  2WV6 D;  3NBH A;  1A3T A;  4CJ2 C;  1HZ9 A;  2Z9H A;  1L0Y B;  4DA2 A;  1Y8O B;  3PO2 B;  4DV1 Q;  3I73 A;  3NEN A;  3RR5 A;  1Y1V H;  4DV6 Q;  4OO1 I;  1EY0 A;  2BA1 A;  1LTR D;  3I91 A;  4RFB A;  3PSI A;  5GQO A;  1EWH A;  4NP5 A;  2YU9 B;  3FRP B;  3S1N H;  4H44 C;  1Y1W H;  1JJC B;  5IY0 A;  4CGY B;  1IW7 D;  4GNX A;  4JI1 Q;  2BH2 A;  5EKK A;  2OTJ A;  4DV0 L;  5JAV A;  3FEW X;  1VQE A;  1L2F A;  3SEB A;  1LYL A;  1WTV A;  1PMR A;  1S5C D;  3DMU A;  4RMF A;  4KD3 A;  3U58 A;  1NR4 A;  4DN4 M;  2E74 C;  3DWP A;  4KKS A;  3RZO B;  3CCV A;  1HRJ A;  3PIO A;  1Q46 A;  4ZQ3 A;  2EY5 A;  3PO3 G;  4J15 A;  4Y52 H;  4N8X 1;  3U4V A;  2E5L L;  1M1K C;  2ZTD A;  4KD4 A;  3FMC A;  2ZT9 C;  2MUY A;  2RHQ B;  5C0X H;  2C35 B;  3OMC A;  4KK7 A;  3K59 A;  3U4Z A;  1YNX A;  5JJI A;  3LGJ A;  1FYC A;  4ABN A;  5GAH C;  1K9M C;  3TSS A;  5IP7 G;  4A3E G;  1ZEQ X;  5IP9 H;  4F87 A;  1BUV T;  3QOJ A;  1D5M C;  2KQ3 A;  1I94 Q;  1U4L A;  2ZJP A;  4OO1 G;  1T9H A;  4RAU C;  4DV0 Q;  3KF6 A;  1IHZ A;  5A2Q E;  4LF8 Q;  2R92 G;  1SYD A;  4TKO B;  4KKU A;  1N9W A;  1QZH A;  4DPG A;  2RHS B;  4JI8 L;  1KNE A;  3C1E A;  1OO9 B;  3E5S A;  5IGD A;  3HOY G;  5FLX L;  4ODG A;  2ZXP A;  5ELO A;  2A6E C;  1VMP A;  4DR3 Q;  4X3K A;  5T1G A;  3S14 H;  3T13 A;  2B29 A;  1EY8 A;  5E7N A;  3T4A C;  4K0K Q;  4ZUI A;  2ZM6 L;  2HDM A;  4UY8 C;  1ESF A;  1EEI D;  2EYF A;  1QUQ B;  2ENB A;  4C2M B;  4GN4 B;  3TME A;  3CU7 A;  3OIQ A;  3HOU B;  1TS5 A;  1D2B A;  1HJP A;  4NXM Q;  4EVO A;  3HRZ C;  3NEM A;  3N52 A;  3N6R A;  2WB1 E;  2XWJ B;  2PNR C;  1GXD C;  4A93 G;  5KRU A;  3K7A H;  1XXG A;  2KUM A;  1EIY B;  4B3M L;  1KXL A;  1E1O A;  3AFP A;  3OTO Q;  2F3I A;  4LF6 L;  1X65 A;  2E2J B;  2EPB A;  2KEC A;  4MTN A;  2NVQ H;  2NVT B;  1SDF A;  2HCC A;  4X64 L;  3S1M B;  2XRQ D;  1IKL A;  1YHB A;  3MXN B;  1DYQ A;  3ONA B;  1BOS A;  3HS0 C;  2EYJ A;  4JI8 Q;  5BR8 Q;  1VDZ A;  1SMX A;  1Y14 B;  4DNI A;  1N8R C;  1VF7 A;  4BS9 A;  5L37 A;  3I4M G;  4UAI A;  1J5E Q;  2CQA A;  2IX1 A;  1GUW A;  4GLX A;  2Z8L A;  1WI5 A;  3DXJ C;  3R3O A;  1ASZ A;  4A3M H;  3EQL C;  2RDG A;  2J7Z A;  2YTY A;  2FJ2 A;  2ZM6 Q;  2Z1C A;  3MVV A;  3DHQ A;  1KRT A;  2HD3 A;  1U0L A;  2AQ3 B;  3NUC A;  3GTP B;  1K0R A;  2BE5 D;  1Q81 C;  3OMG A;  4IPH A;  4RG1 A;  1XPO A;  1MKH A;  1PZK D;  1AP0 A;  1D8L A;  1B50 A;  2F0O A;  1LLR D;  4JBK A;  1HUN A;  1L0X B;  3PUV A;  3J80 c;  3HOX B;  3PO2 H;  4L5S A;  4KY7 A;  4LF6 Q;  1Q7Y C;  3K7U C;  1BBW A;  1X6O A;  1E24 A;  3HG9 A;  2YU9 H;  3S17 B;  1I3Q B;  1LO5 D;  4X64 Q;  4A75 A;  1TS3 A;  1M90 C;  3W1G A;  5KNB A;  2N49 A;  4X3S A;  5H1S E;  3VR6 A;  1TR5 A;  1Q86 C;  3BYY B;  1EIG A;  5M3M B;  2WB1 B;  4AIM A;  1SYF A;  1CKO A;  3ERQ A;  2K5H A;  1F9R A;  3MAQ A;  4KN7 C;  1PFS A;  2R61 A;  3D6W A;  1WTW A;  3RZO H;  2B2Y C;  3HKZ E;  3GD7 A;  4BBR H;  5IT9 c;  1E3P A;  1ICF B;  2ICI A;  2KCM A;  1E22 A;  4C3I B;  4XYO A;  2ZTC A;  4DR4 L;  1UEB A;  1JE4 A;  4O0A A;  4KHV A;  1MGS A;  1R4Q B;  2JQO A;  3FKI B;  2GA4 B;  2K04 A;  2PMZ E;  5M3F G;  3HOZ G;  5C0X I;  1I4Q A;  3MA2 B;  3I4N G;  5CMD A;  4FF2 A;  3SK8 A;  1YNJ D;  2B2W C;  1V43 A;  2WP8 J;  1SMY C;  3HGB A;  4OWT B;  1EOV A;  2F0H A;  3KK7 A;  4PZ7 A;  3TP5 A;  4X66 Q;  1BF4 A;  2EY2 A;  3MC0 B;  1XPU A;  5FO8 B;  5CBA E;  3CCS A;  1W6J A;  2SDF A;  5DLQ E;  3CAM A;  3L3O C;  2M00 A;  1Y1V G;  4XQN A;  2CWA A;  3QB3 A;  4QUC A;  1FJG Q;  2QCP X;  1PLF A;  1VQI A;  1Y1W G;  3RLF A;  3UE1 A;  3CC2 A;  2CQO A;  4DFA A;  1XNQ L;  4DAP A;  2K4K A;  4HID A;  5BN3 A;  1SNM A;  4IPG A;  1AFP A;  4GKJ L;  3ULJ A;  1OXS C;  1FD7 D;  3T1Y L;  1QE6 A;  1CUK A;  3STB D;  2X6L A;  3AMU A;  5GAE C;  5IYB H;  5C3W A;  2VQE L;  5D3I B;  1LTI D;  3MHB A;  4PZ6 A;  5ELB A;  1I4R A;  1NMF A;  1I4P A;  4POG A;  2A69 C;  2D9U A;  3A7L A;  4U67 3;  1UAP A;  2XWB B;  2CW0 D;  1X54 A;  1ONL A;  4BXX H;  2WFW A;  1K28 A;  2F0Q A;  3OW7 A;  3D0F A;  2AWN A;  1HZB A;  2L12 A;  5C0X G;  4DR1 L;  2K28 A;  3GTM H;  3DEO A;  1A62 A;  2N88 A;  3QG1 A;  2VB3 X;  3OHX C;  4K8J A;  3PIO 3;  2A74 C;  2A5H A;  2PNH A;  3JAM E;  4K5X A;  2E2J H;  4LF7 L;  2K01 A;  5IP9 G;  2NVT H;  2VZA A;  5HY6 A;  3S1M H;  2UUC L;  1IBL L;  3MZ5 A;  1MD2 D;  2ZXR A;  2TMP A;  3I72 A;  2H4O A;  5J1Z A;  2PMZ B;  1A0I A;  3K5M A;  1LTL A;  4KN4 C;  2I5H A;  2Z4I A;  4ID6 A;  2RSN A;  1PH6 A;  2JK8 A;  1PH5 A;  4I7Z C;  4XT3 B;  1N33 L;  3T1Y Q;  2DJF C;  3T56 B;  2X69 A;  1JR0 D;  3J81 c;  1STA A;  1IKM A;  1ICW A;  1G91 A;  4XXE A;  3I56 A;  1PVO A;  2DY7 A;  1UE1 A;  4ZYS A;  4LF9 Q;  2E2I B;  2MNA A;  4A3I B;  3KF8 B;  3FVQ A;  5FK9 C;  1IBK L;  1ENF A;  3P7J A;  3J81 j;  1QIL A;  2VNU D;  3DEP A;  2KJX A;  1SE8 A;  1TWA H;  2EJM A;  1SNP A;  2F0U A;  2OEO A;  3WOF A;  1YHQ A;  3GTP H;  4MIU A;  1UNS A;  4DR1 Q;  2AHO B;  1HNX Q;  5C4H A;  3CCE A;  1I4G A;  1MSG A;  2QF7 A;  2YV5 A;  2BDN A;  4UPA A;  2WII B;  3CCU A;  4LF7 Q;  1EUJ A;  3RNU A;  1BO0 A;  3S17 H;  2R7Z B;  3CC4 A;  4JPB W;  4GKK L;  1B1Z A;  2UUC Q;  1IBL Q;  3HOV B;  4GOP A;  1NE3 A;  2WKD A;  4WJ4 A;  1VQG A;  1HA6 A;  4H7B A;  3VDY A;  3KDF B;  5TSS A;  2K52 A;  2GVA A;  2SOB A;  3EBE A;  4UDU C;  1PH7 A;  5EPK A;  3CXC A;  2DN8 A;  1KDB A;  1N33 Q;  3GTL B;  3RD4 A;  5E3F A;  1DZ1 A;  1LT4 D;  2OT2 A;  2O5I C;  5KEE A;  3VR3 A;  1JOQ A;  2KCN A;  1TII D;  1IL8 A;  1A3V A;  1K0S A;  1VQK A;  5IOD A;  5FLX E;  2VY3 A;  1GUO A;  2NZ1 D;  1EQV A;  4C3I H;  4C3J B;  2EXZ A;  4A3M G;  3SXH A;  1SBB B;  1WTO A;  4EQ5 A;  4KV6 A;  2KVM A;  3K6O A;  1YNN D;  1HR0 L;  1EY5 A;  2F0N A;  4HJ5 A;  3JC6 6;  3C2P A;  1EL0 A;  4CHT B;  3HOW H;  1YEZ A;  1L1O A;  2XRS D;  4YWK A;  4CKB A;  4A3C G;  1EY4 A;  1I50 B;  1J9O A;  2IHF A;  4OX9 Q;  4IFD H;  2XGT A;  1SYG A;  4A3K H;  2JYO A;  5DEH A;  5I9O A;  1IZ6 A;  2HDL A;  3PO2 G;  2E76 C;  4O1N A;  4A3D B;  1WYD A;  4J6H A;  4GLV B;  5JJZ A;  4C56 C;  3K5O A;  1MHW C;  4LAA A;  2F0S A;  4EQO A;  4G7Z C;  1CT1 D;  4NW2 A;  3T53 B;  2EXD A;  3M4Y A;  2LSS A;  1TS2 A;  3DM3 A;  3I4L A;  5JEA H;  4KMU C;  3CRK C;  1GD7 A;  2RVL A;  1RDP D;  4P71 A;  4FVM A;  4ME3 A;  1AE3 A;  1VQM A;  1SYC A;  3W1B A;  3F8T A;  3P75 A;  3EFX D;  1G8Z D;  3TZD A;  3CME A;  3NQI A;  3F1Z A;  4BBR G;  4OHJ A;  1E0B A;  5M5W B;  1YBY A;  4CJ0 B;  5KYI A;  4IPC A;  1HR0 Q;  2F52 A;  4LWC A;  3ZJY C;  3C3L A;  2SNM A;  4V19 0;  2MGS A;  1JWU D;  4XDX A;  4QL5 A;  2IPK D;  2F03 A;  5CV9 A;  4TRD A;  3CCJ A;  3CPF A;  3S9W A;  2JP1 A;  3VA7 A;  3GTK B;  1U9R A;  4NXN Q;  3A54 A;  4ILW A;  4FF3 A;  1EIF A;  5C0X J;  1QG7 A;  1JT8 A;  4K8I A;  3Q23 A;  4JI0 Q;  3G6J B;  3CW2 C;  4PV1 C;  2H5X A;  4DV7 Q;  4XIG S;  1CZG A;  3T16 A;  1I6V C;  2MFI A;  4RGN A;  4L5R C;  1Y8P B;  2YYZ A;  1PHJ A;  1PZJ D;  5IOC A;  1VQ9 A;  1V1Q A;  3BZC A;  4O42 A;  3RLN A;  3UE0 A;  2LFN A;  4WOR A;  5C4X H;  3LX0 A;  2UXB Q;  3V2T A;  1B9M A;  5JJL A;  3MFG A;  3R2T A;  4L5Q A;  1D6E C;  3DLL A;  4ALP A;  3B6Y A;  5EPJ A;  5DM7 3;  2B63 B;  3GTQ B;  3BYT B;  2F0E A;  1BQQ T;  4Y7N B;  1VQA A;  5IYB G;  2EYM A;  1PXU A;  2F0D A;  1X3P A;  1J8I A;  4JI1 L;  4BY1 H;  4GN5 A;  2E8G A;  1EY6 A;  4CDC C;  5LMN L;  4JI2 L;  1SR3 A;  4BXX G;  2F0I A;  4P73 A;  3VR4 A;  3AQQ A;  3PGZ A;  2B2V A;  3ERS X;  4MN3 A;  2R7Z H;  5IGB A;  1PH8 A;  1RF2 D;  2B2T C;  4K5W A;  4UP8 A;  1WD0 A;  3ND8 A;  1GM5 A;  3H0G B;  1SYB A;  4H13 C;  4HIM A;  3GTL H;  1B2T A;  3GTJ H;  1HTL D;  1HQR D;  2AUK A;  1TKW B;  1CKN B;  3JAM L;  1GOZ A;  1HFG A;  4DR2 Q;  3PIP A;  2OF1 A;  4WFN 3;  4X6A H;  2AUJ D;  1IL2 A;  5IT9 L;  2PW5 A;  2EYH A;  3EVQ A;  1LT5 D;  1B9N A;  1DCZ A;  1FNV A;  3HP3 A;  1K8G A;  4R8I A;  1PH4 A;  4LFB L;  4BBS B;  1I94 L;  1KDA A;  1MI2 A;  1TWF B;  4IO9 A;  3R2I A;  3SDZ A;  3DWQ A;  1TWC B;  2LS0 1;  4LF4 L;  4JI2 Q;  2RDF A;  5LMN Q;  5D14 A;  3WOE A;  1VQN A;  4LF8 L;  1K3R A;  2A73 B;  2Q2I A;  4P74 A;  1XPR A;  5IE8 A;  2Y0S B;  3I90 A;  4X62 Q;  3GTO H;  2VUM H;  2Z6B A;  2JSO A;  2KOL A;  2B8F A;  1IXR A;  3V05 A;  3BVM A;  5CV6 A;  2A6H C;  1XTC D;  2UU9 L;  4DR3 L;  5FO9 B;  3K80 C;  3LNN A;  4DV2 Q;  2VQF L;  4K0K L;  1CQF A;  2QGQ A;  1K8A C;  1RTO A;  4A3D H;  1NY4 A;  3LWE A;  1WFQ A;  3NSW A;  3E9H A;  2F0W A;  4K14 A;  4IUN A;  1Q1E A;  4YCV A;  5EBD A;  3HKS A;  1UWV A;  2DNC A;  4YCU A;  2K32 A;  2WB1 G;  4NXM L;  1GJX A;  4DK1 A;  4P72 A;  5I9P A;  4DUY Q;  1E7Z A;  5FLM H;  5EKL A;  1YZ6 A;  3KLS A;  4TVA B;  3AEV A;  1IW7 C;  4FP5 D;  1GHK A;  3S1R B;  4LFB Q;  3T51 B;  2L0C A;  5M5W H;  3OTO L;  2K5N A;  2R93 B;  4LF4 Q;  2WAQ B;  3E6Z X;  3H6M A;  2Q8T A;  4KLK A;  4C3I G;  1V1P B;  1Z7T A;  2Q8R E;  3PCO B;  2B39 A;  4AYB B;  1VS0 A;  2EY6 A;  2F4V L;  3G7L A;  1LT6 D;  4M1U B;  4ZKC B;  1AN8 A;  1WJJ A;  3CD6 A;  5BR8 L;  4A3F B;  5C3E B;  1J5E L;  2JA8 G;  5C4J B;  2JJQ A;  2UU9 Q;  1IYU A;  2TSS A;  4B08 A;  3HOW G;  4LUZ A;  4R4T A;  2PCF B;  2O5J C;  2D2C C;  4RCN A;  2VQF Q;  1Y8N B;  2ZJR A;  1SFO B;  3VYR A;  1SEB D;  3M3Y H;  3NBH B;  1XMO Q;  1QJO A;  4IFD G;  3PUZ A;  4YWL A;  3KJO A;  2XIW A;  4A3K G;  2JXM B;  4JOI C;  5FJ8 H;  4RWS C;  3A5Z B;  3TRE A;  1U4P A;  2B2Y A;  2VB2 X;  2AMC B;  3K5N A;  3PV0 A;  1J6Q A;  3J81 L;  3K58 A;  3VR5 A;  1RD9 D;  5M5X B;  4R8N A;  1H9S B;  5J39 A;  4GNX B;  1JCK B;  3I8Z A;  4C3H B;  3HFZ B;  4G7H C;  4LW1 A;  2CWP A;  1A3U A;  4KY6 A;  1CA5 A;  4CJ1 B;  4CDE C;  4XYQ A;  3TN2 A;  5JEA G;  3M4O B;  2LXK A;  1Q82 C;  2B63 H;  3GTQ H;  2IHE A;  1I4H A;  4DR5 L;  1PFB A;  4QJF A;  5C44 B;  4HIO A;  2F4V Q;  1PH1 A;  2RKS A;  1B3Q A;  4PMB A;  3SK5 A;  1BNZ A;  1EWI A;  4N8F A;  4GNX C;  5ELF A;  1LTS D;  1X56 A;  4C1N I;  1JWS D;  2Z0S A;  4BWG B;  5M5Y B;  1SE2 A;  5COR A;  2PQA A;  4DAY A;  1DGS A;  2F0P A;  5K36 H;  5DM6 3;  1CHQ D;  1NBW A;  1L0W A;  1ROD A;  3HKZ G;  2FMC A;  4DUZ L;  1KD1 C;  1MBY A;  2K50 A;  1BDO A;  3PQI A;  2JA7 H;  1D7Q A;  5IYD H;  5ISR A;  2R3Z A;  1SRO A;  4P75 A;  3SK6 A;  4IUV A;  1K8O A;  1WTQ A;  3MTS A;  5CV7 A;  4LF5 L;  4ZLT F;  4HCS A;  2BDO A;  1K83 B;  1SNO A;  1U4R A;  3KF6 B;  5GAD C;  1TY2 A;  1G6P A;  4DGZ A;  4MTK A;  1B8A A;  4IUP A;  2K33 A;  4DR5 Q;  4BBS H;  3D6C A;  5C4X G;  4X66 L;  4HJA A;  4IUT A;  3H15 A;  4I65 A;  5F2D A;  1WTR A;  2V4D A;  1QZG A;  3L9A X;  4YCW A;  2I5L X;  1TWC H;  3CC7 A;  3M7G A;  3RLO A;  3QO2 A;  2JA6 B;  1JMC A;  5EQ0 A;  1QCB D;  1TY0 A;  2C5C A;  1UE6 A;  1VMC A;  4OIK A;  4KY5 A;  1MJC A;  1FJG L;  2Q2U A;  4HIK A;  1GHJ A;  1HZC A;  3NE5 B;  2X6G A;  4DUZ Q;  4BY1 G;  4A3J B;  1LM0 A;  3MFY A;  4KJO A;  2K03 A;  4U68 A;  4DK6 C;  4KTA A;  4GS3 A;  2F0V A;  2BE5 C;  1HA5 A;  1X3G A;  2XNA C;  2L55 A;  2F4I A;  3K8A A;  1KLU D;  1QWY A;  2R7Z G;  5HGQ A;  3MEH A;  2EQS A;  3EIV A;  4A3E B;  4GN3 B;  1W2B A;  4XQJ A;  1PTO D;  1KAW A;  4LF5 Q;  3NHH A;  1TU2 B;  4A3B B;  4KHZ A;  4J1M A;  2DGY A;  1PA6 A;  2KEN A;  1S5B D;  1UE5 A;  1CFM A;  1K73 C;  2I46 A;  5J3B A;  4OWX B;  2XSC A;  2UUA L;  1S5E D;  3M9B A;  4RGO S;  3S1R H;  3FPU B;  2K75 A;  2JEA I;  3ULL A;  1EWC A;  3TP7 A;  2DJG C;  2R93 H;  4L5T A;  1HHV A;  1RIP A;  4YWM A;  2PI2 E;  3VYU A;  2EYP A;  2B3G A;  3GP7 A;  4PQX A;  4RA8 A;  4KHP Q;  3L7Z C;  1PH2 A;  3UDI A;  1BBU A;  5C5L A;  2LMC B;  2PQE A;  2H1E A;  5C3E H;  4A3F H;  3ND9 A;  5CV8 A;  1YHA A;  1F9P A;  2SEB D;  4F88 A;  5IGC A;  2Q2T A;  3PIP 3;  5C4J H;  2G5D A;  1HNZ Q;  1PYB A;  1QB5 D;  2PPB C;  1OXX K;  3W5O A;  5AJ3 Q;  2VUM G;  4A3G B;  2HIX A;  4LF9 L;  1VF5 C;  3SVM A;  1BCP D;  4C2M H;  3S24 A;  4A93 B;  1KLG D;  1R9T B;  1E2W A;  3HOU H;  1S5F D;  2VXW A;  3TBI B;  1YNJ C;  2J0T D;  3SK4 A;  4APV A;  2EIF A;  4H0L C;  3UDG A;  4KJN A;  4K2L A;  1H9R A;  5M5X H;  4IFD J;  1BR9 A;  1HNX L;  1C4Q A;  2UUA Q;  2LKV A;  5IIF A;  4XT1 B;  2EJG C;  4EQP A;  1PH3 A;  1EQR A;  1HUM A;  3M4O H;  4RHS A;  1E1T A;  3Q8D A;  3OWF A;  5FKA C;  1VQB A;  5FLM G;  3H3V C;  2KCC A;  2ZTE A;  3CHB D;  5IT9 E;  1VQP A;  4HR7 B;  5T1I A;  1AW7 A;  2OXP A;  2N78 A;  2EDG A;  5CBE E;  3SHL A;  1Q12 A;  4I7A A;  3RN5 A;  3UDF A;  1EEF D;  2VS1 A;  2R7F A;  3D4W A;  4ME5 A;  3IFT A;  2NZH A;  5JEA J;  5M5Y H;  4LUO A;  3STB C;  2LY7 A;  1SE3 A;  5FLX c;  1VQ6 A;  3LWU A;  1EY9 A;  2QKI C;  5LL6 S;  3BVZ A;  3WDN A;  1N32 L;  3UI2 A;  3AFQ A;  1FL0 A;  3OIP A;  3ZYY X;  5CGK A;  1QVC A;  3CCM A;  2CW0 C;  1ET6 A;  2XTI A;  2G9H D;  1SN8 A;  2K6A A;  1HTP A;  5IGE A;  2V1C C;  2UUB Q;  3PF4 A;  2F0F A;  1CK1 A;  1CHP D;  1O7L A;  2K5W A;  4DAV A;  1SXT A;  2OQ0 A;  3E9I A;  1K83 H;  5C4Z A;  3E3X A;  4O2D A;  2BA0 A;  3EJI A;  4G4K A;  5FJ8 G;  1JWM D;  2GVB A;  3HOX H;  3F2D A;  3VYT A;  1I6H B;  5E1F A;  1I3Q H;  4OX9 L;  1ZYR D;  3S2H B;  1QVF A;  5KNC A;  3FDT A;  4Q5V A;  4RGM A;  2JA6 H;  3KFU A;  5M3M H;  5IWA L;  1TWG B;  5A35 A;  4FF4 A;  2B63 G;  1S4Z A;  3J7A F;  2AKW B;  1N32 Q;  1Q90 A;  2FMM A;  1JOR A;  4A3J H;  1EY7 A;  2NN6 H;  2RA4 A;  2RF4 A;  2N55 A;  3KLW A;  1JJ2 A;  1B3A A;  4LUV A;  3DM1 A;  4TSS A;  4JV5 L;  5LMU L;  4PZ8 A;  5JVH 3;  3HOZ B;  5K36 G;  4IZ8 A;  1G2T A;  2EZV A;  4IPD A;  4A3E H;  4X65 Q;  2NB0 A;  3I4N B;  4A3L H;  3FKI H;  1VQL A;  3I55 A;  3A7A B;  4IAL A;  2JA7 G;  2RCN A;  1F2Y A;  4A3B H;  5JJK A;  1F2Z A;  5IYD G;  1EU4 A;  1O7Z A;  3H09 A;  4CDD C;  4X3T A;  1MJE A;  2JEB I;  3J81 E;  3VYS A;  3G4S A;  4G7O C;  2LXJ A;  2AQ2 B;  1PRT D;  1G2S A;  2EYO A;  1NNX A;  4R9W A;  2CFM A;  1Y1W B;  4JCV E;  4NXN L;  1PYW D;  2F1M A;  2YTV A;  2Q2H A;  2L9H A;  5IWA Q;  1KAA A;  4JI0 L;  2K5D A;  5D3D A;  1WTH A;  4DV7 L;  3PF5 A;  4BBS G;  1HNW Q;  2C9O A;  4X3U A;  4UP9 A;  3TP6 A;  2N3S A;  2VL6 A;  4C1N K;  2F0K A;  2B2T A;  5GRO A;  4F7X A;  3JAM i;  4GZY C;  4BY7 B;  1AH9 A;  4B9W A;  4JV5 Q;  5LMU Q;  3KBX A;  1FNU A;  3J7Z C;  1X3F A;  3AYH B;  4A3G H;  4DAM A;  1STH A;  1CA6 A;  1A63 A;  1YNN C;  2R7D A;  2HQL A;  2UXB L;  1SNC A;  1Z6H A;  1R9T H;  1ESR A;  1RTN A;  2FIN B;  5FO7 B;  4DV5 L;  3H3V H;  3A74 A;  4LK1 C;  4LFC L;  4GOP B;  1F77 A;  2A68 D;  3CPW A;  4IOC A;  5CV5 A;  1PFM A;  3NXW A;  1II3 A;  4B3S L;  2CKZ B;  1X55 A;  1CKN A;  3IAY A;  4RHR A;  4F8M A;  1TS4 A;  4CKE A;  3D4D A;  1LTG D;  5HUR A;  1KRS A;  1ILQ A;  3NTH A;  3I3C A;  4YIJ A;  5KYL A;  4GOP C;  1HQM C;  1IYV A;  2QDL A;  1LT3 D;  5HGT A;  2EY1 A;  2M2L A;  4JYA L;  1EU3 A;  3NPP A;  4JI5 L;  2R93 G;  2IX3 A;  1GKH A;  4HSP A;  4AYB G;  1LTT D;  2L1B A;  4JVZ A;  1XX8 A;  2QEJ C;  5EGT A;  3J7Y W;  1U5K A;  3DUZ A;  1GO3 E;  2Y0S E;  5C3E G;  4DR2 L;  4ZCK A;  1CTM A;  2E2I H;  4A3I H;  5ELN A;  1T5X D;  5AFW A;  1X3E A;  3NP8 A;  4DV5 Q;  1L1O B;  2PYK A;  2SNS A;  3D8G A;  2IL8 A;  4JBW A;  1VQD A;  5IGF A;  4DR7 Q;  1T5E A;  5EPL A;  4LFC Q;  3J7A 5;  4JI7 L;  4IUU A;  1KIX A;  3TS0 A;  1G29 1;  4OEM B;  4N9P A;  1EYD A;  2KHI A;  3K7A B;  5FOB B;  2ASB A;  4IUQ A;  3HOU G;  1D5X C;  2CH4 A;  1L1O C;  3J80 L;  4B3S Q;  1JE5 A;  1SJH D;  4ZKB B;  1I6H H;  1YJN A;  4X62 L;  2EE1 A;  2Z6K C;  3HOV H;  3BDO A;  3S2H H;  3OPO A;  4JI6 L;  4R4I A;  3RUZ A;  2NVX B;  1RJT A;  1B7Y B;  2NZO A;  3C1F A;  2ALY B;  4A4I A;  4DV2 L;  1XMQ Q;  1N34 Q;  2BOS A;  4JI5 Q;  4JYA Q;  3C46 A;  1U4M A;  2UXC L;  4CBV A;  1X9N A;  1PTO F;  1AZP A;  1QNU A;  2WAQ E;  4AYB E;  1MSH A;  5ELE A;  3BVG A;  1PYS B;  3QOL A;  1JOO A;  4EGV A;  4A3M B;  1P8L A;  1WCM B;  2NWG A;  4HTH A;  3PUW A;  3MXG A;  4JBJ A;  2JA5 B;  4DUY L;  1WOC A;  1STE A;  2D0P A;  2N8N A;  1GUG A;  3BS1 A;  5C6A A;  3HOZ H;  1NSN S;  4QB4 A;  5C3X A;  4C3J H;  3RMH A;  3ICE A;  2NN6 I;  4JOI A;  1G6Z A;  3CF5 A;  3X3M A;  2K05 A;  4QUF A;  2F0T A;  1EZ6 A;  1IBM L;  1EYA A;  2ZXO A;  1UE7 A;  1K3B C;  2O2L D;  1IYJ B;  1W3S A;  1X32 A;  2I0Q A;  4JI7 Q;  3S2D B;  3IL8 A;  3RN2 A;  5GAG C;  4N9T A;  5JOB A;  1D1I A;  1OXT A;  2WKC A;  3T1H Q;  2J4X A;  1Z47 A;  2L4N A;  1QUQ A;  1F9S A;  3TZU A;  1NUC A;  1I50 H;  3CCR A;  1SNQ A;  3I2Z A;  1H9S A;  4OON A;  4JI6 Q;  4H02 A;  2WAC A;  4FDB A;  1O80 A;  3BZD B;  3HOX G;  3G48 A;  1EOT A;  4IFD I;  1BCP F;  3O13 A;  2UXC Q;  2EYL A;  1XMO L;  3IKJ A;  3Q6S A;  4FXG C;  1KC8 C;  3MXN A;  2JA6 G;  5M3M G;  2E2H B;  1B53 A;  1O7I A;  3I7F A;  4BY7 H;  2QDB A;  4BBR B;  1R4P B;  1EIH A;  3K0Y A;  3G6E A;  3NWT A;  2A6E D;  2A8V A;  1DOL A;  4A3J G;  1TWH B;  2EJF C;  5DNF A;  5C5M A;  2NN6 G;  1IBM Q;  4JI4 L;  4YHH L;  5ELD A;  3K57 A;  2MPM A;  4R4C A;  3E0J A;  4YY3 L;  2JN4 A;  2B2U C;  5CYU A;  5I2Y A;  5M9O A;  1PH9 A;  4G57 A;  2EOT A;  1LAC A;  1NTG A;  5K5P A;  4A76 A;  3R93 A;  4DK0 A;  4RKL A;  5E4W C;  4A3L G;  3FKI G;  3BG3 A;  3TP8 A;  3H3V I;  2WIN B;  4FXD A;  4HSV A;  1NR2 A;  4A3B G;  1X3Q A;  4HJ8 A;  3A8K E;  3GTK H;  2B2V C;  5J22 A;  3A8I E;  1NCV A;  4R4O A;  4DV3 L;  3P20 A;  3OYY A;  4L8J A;  4R1J A;  1CI3 M;  1I4X A;  1XWE A;  1DM0 B;  3NWS A;  4EQN A;  4DF7 A;  2K1B A;  2D0O A;  3CMA A;  4JK1 C;  3F2U A;  3S16 B;  1KNA A;  2QW7 A;  5I6W A;  1NMG A;  1JB7 A;  3A5U A;  4BA1 I;  1KDC A;  4RH6 A;  1ET9 A;  5CC4 A;  2AWO A;  2IWH A;  1B4O A;  1CZW A;  2ATW A;  3ER0 A;  2HHH L;  2IW3 A;  2E5L Q;  2HT1 A;  1EQT A;  1KTK A;  3KLS X;  4B3R L;  5IYC H;  4YHH Q;  4JI4 Q;  1ENC A;  1KL9 A;  3AB9 A;  1OTC A;  3TRZ A;  3OSO A;  2DUD A;  4POF A;  4YY3 Q;  4Y7N H;  1LUZ A;  1H95 A;  3K0X A;  5JVG 3;  1SAP A;  4A3G G;  1D5Z C;  4EX5 A;  4HJ9 A;  2B2W A;  2PZU A;  4IN3 A;  3GTM B;  2GN5 A;  1Z9F A;  2NTS A;  4RKB A;  2QIL A;  2CH4 W;  4OXP A;  5CV4 A;  3H94 A;  4DV3 Q;  1RCV D;  3S15 B;  1A8V A;  3KJP A;  1VQ4 A;  1KHI A;  1TXY A;  2P5Z X;  1BBX C;  2ICE C;  1C48 A;  2NVX H;  5G3L D;  3H0G H;  2HCI A;  4JG2 A;  5LL6 X;  5KGU A;  1JJG A;  4MNO A;  1EYG A;  2B8G A;  3J7A V;  1BXT A;  5LHY 1;  3TEH B;  3U50 C;  3W2D A;  4LJZ C;  1WCM H;  2HHH Q;  3X3N A;  2MO1 A;  1SYE A;  3CQZ B;  2E75 C;  2JA5 H;  4B3R Q;  1JOK A;  2RCF A;  4J8Q A;  1I5F A;  4DKA C;  5COY A;  1DJR D;  2MHV A;  4CKC A;  4DXF A;  1PRT F;  1ZKO A;  4UHV A;  1TWA B;  1LTA D;  2CHB D;  2HIV A;  5KND A;  4A3C H;  1TWF H;  4DK3 C;  4QF4 A;  1SLJ A;  2F0J A;  2QA4 A;  3S2D H;  2PZW A;  3L0O A;  4A3I G;  2RBM A;  4OEL B;  1NJI C;  4B3M Q;  4KHP L;  3PO3 B;  3GQB A;  1HH2 P;  3PUY A;  4M8A A;  1YVC A;  2JA9 A;  3QWN A;  1DON A;  2XN9 C;  2KBN A;  2F0G A;  1LTB D;  1H9M A;  3KLR A;  1M4V A;  3FHW A;  1YJW A;  4FO2 A;  1HNZ L;  1SMY D;  1G51 A;  4ZUJ A;  3QJY A;  1CM9 A;  3P1H A;  5AJ3 L;  2OTL A;  3HOV G;  2NTT A;  1H9J A;  4JW0 A;  3K81 C;  3WWV A;  3D3R A; 
#chains in the Genus database with same CATH homology
 1TQO A;  3A55 A;  2CVR A;  1AZQ A;  3M7N A;  3Q0A A;  2KED A;  4ULL A;  4DXG A;  1SJE D;  4PMC A;  1QNK A;  3U9S A;  4K6D A;  4OGQ C;  3SE0 A;  1RKN A;  2R92 B;  2RSO A;  4HMJ A;  5I4D A;  1SND A;  2RQX A;  3HOY B;  4WJW A;  1CQV A;  3TDQ A;  1V8Q A;  2JA8 B;  2A69 D;  3KF8 A;  4C3J G;  1O7Y A;  2AQ1 B;  2MP1 A;  4IQZ A;  1HFN A;  3HOW B;  5D65 A;  1PTO B;  2R6G A;  3KUP A;  1UUP A;  3URY A;  1HCZ A;  3GO5 A;  3GTG B;  1E2Z A;  5DAU A;  1UEA B;  4A3K B;  3J80 E;  1PTO C;  1KAB A;  1EFI D;  2NVY B;  1C8C A;  1W6K A;  1ZXT A;  1GUS A;  3EA6 A;  1QOH A;  4OL7 A;  2L5T A;  4XTC S;  4PMW A;  2BCO A;  2E2D C;  4Z9C B;  2DY8 A;  1PDQ A;  3MXP A;  1FNW A;  2Z4H A;  3GV6 A;  2G9D A;  4NDX A;  3I4M B;  2FFK B;  4LMQ D;  1BCP B;  2NBF A;  3NTI A;  3Q22 A;  1WVL A;  3HKZ B;  4L6T B;  1S5D D;  2PW7 A;  3D4R A;  1TVX A;  2O4X A;  2NYZ D;  4ZRZ A;  4E6I A;  2XVS A;  1BCP C;  1DOK A;  1Y69 U;  1TT2 A;  1A2T A;  1B44 D;  5KIX A;  2DNE A;  1F2L A;  3S1Q B;  1LAB A;  1GUN A;  3SR1 A;  1HXY D;  2IJ0 A;  2L11 A;  3RZD B;  1SSO A;  1SE4 A;  5C4X B;  2HUG A;  1DOM A;  2F0L A;  3U9O A;  3VA5 A;  3NQT A;  1ML0 D;  5A2Q L;  2F0M A;  2M9V A;  3FPP A;  5CR3 A;  3BDC A;  4BY1 B;  4ZK9 B;  4HCE A;  1EYC A;  1STB A;  4PNY A;  1HPC A;  4Q0F A;  2PZT A;  3VR2 A;  3BDL A;  1Q3L A;  3K5L A;  1F9Q A;  5M3F B;  4WRD A;  1M8A A;  1STN A;  4QIW B;  1DD2 A;  1D1K A;  1NAP A;  1AEX A;  5BN4 A;  1EZ8 A;  3GV3 A;  3A8J E;  1JQY D;  3GTJ B;  1A15 A;  3OOC A;  3OWE B;  4OO1 H;  2IX0 A;  2K7V A;  1VCI A;  4DNT B;  1STG A;  1ZYR C;  3HEJ A;  1PZI D;  1RHP A;  2NUC A;  1Y1V B;  3H91 A;  2HQE A;  4ZAI A;  3I70 A;  3V96 A;  3S1N B;  1Q1B A;  3QIA A;  3HZX A;  4OIJ A;  1PTO H;  2F3W A;  3Q24 A;  2RDH A;  3GTO B;  2VUM B;  3DWA A;  3D31 A;  5EBC A;  5IGG A;  2F3V A;  2D5D A;  1E2V A;  3R8B A;  1LV9 A;  1FGB D;  1DXM A;  2K5Q A;  1STY A;  1PRT B;  2IT1 A;  1JB3 A;  3AU7 A;  4XQQ A;  3PUX A;  5NUC A;  5I2X A;  4FXK C;  1O78 A;  3CRL C;  4P2C B;  2Q8I B;  2JE6 I;  4K6L A;  3W3A A;  1PRT C;  4HED A;  1WTX A;  1FR3 A;  3M85 A;  2MJ8 A;  4B9X A;  1ILP A;  4DNR B;  4V0B A;  4K5V A;  5G3L F;  3MWY W;  4K2K A;  3ERO A;  4L63 B;  3ITP A;  2EVB A;  2FHT A;  4KI0 A;  4S3S A;  2PO4 A;  3NTK A;  3PMF A;  2ID0 A;  4RGT A;  1JC7 A;  4QMG A;  1A6X A;  3S14 B;  1PFN A;  2KA7 A;  4IUR A;  3NK9 A;  5JPN C;  3M3Y B;  4HN7 A;  4FYD A;  1XYI A;  4KKT A;  4NMZ A;  2I07 B;  4BA2 I;  5BN5 A;  2A68 C;  4FF1 A;  1OXV A;  1WD1 A;  4RCO A;  1WTP A;  4HAE A;  1JIC A;  4HMI A;  5EJW A;  4FNF A;  1K8M A;  1F2M A;  2KHS A;  2B2U A;  2KEE A;  1A2U A;  2NVQ B;  1V1O A;  4C3H G;  4DU9 A;  2D62 A;  3NBI A;  1ENA A;  4QCL A;  4MHE A;  4TQU S;  1H9K A;  4NKL A;  5I6Y A;  3A56 A;  1Q8I A;  3KBG A;  3CKI B;  1V1P A;  1GUT A;  2JA7 B;  3MXU A;  5JPM C;  2A6H D;  3IFD A;  5E4X A;  5EKI A;  1OXU A;  5ELC A;  2WV6 D;  3NBH A;  1A3T A;  4CJ2 C;  1L0Y B;  4DA2 A;  1Y8O B;  3PO2 B;  3I73 A;  4OO1 I;  1EY0 A;  2BA1 A;  1LTR D;  3I91 A;  4RFB A;  2YU9 B;  1EWH A;  4NP5 A;  3FRP B;  4H44 C;  4CGY B;  1IW7 D;  5EKK A;  5JAV A;  3FEW X;  3SEB A;  1WTV A;  1PMR A;  1S5C D;  3DMU A;  4KD3 A;  1NR4 A;  4DN4 M;  2E74 C;  3DWP A;  4KKS A;  3RZO B;  1HRJ A;  4ZQ3 A;  2EY5 A;  4KD4 A;  3FMC A;  2ZT9 C;  2MUY A;  5C0X H;  3OMC A;  4KK7 A;  3K59 A;  1FYC A;  4ABN A;  3TSS A;  1ZEQ X;  4F87 A;  1BUV T;  3QOJ A;  1D5M C;  2KQ3 A;  1U4L A;  4OO1 G;  4RAU C;  1IHZ A;  5A2Q E;  1SYD A;  4TKO B;  4KKU A;  1KNE A;  3C1E A;  1OO9 B;  3E5S A;  5IGD A;  5FLX L;  4ODG A;  2ZXP A;  2A6E C;  1VMP A;  4X3K A;  5T1G A;  3T13 A;  1EY8 A;  3T4A C;  4ZUI A;  2HDM A;  1ESF A;  1EEI D;  2EYF A;  2ENB A;  4C2M B;  3TME A;  3CU7 A;  3OIQ A;  3HOU B;  1TS5 A;  1D2B A;  4EVO A;  3HRZ C;  3N52 A;  3N6R A;  2XWJ B;  2PNR C;  1GXD C;  5KRU A;  1XXG A;  2KUM A;  2E2J B;  2EPB A;  2KEC A;  2NVT B;  1SDF A;  2HCC A;  3S1M B;  2XRQ D;  1IKL A;  1DYQ A;  3ONA B;  1BOS A;  3HS0 C;  2EYJ A;  1VDZ A;  1VF7 A;  4BS9 A;  4UAI A;  2CQA A;  2IX1 A;  1GUW A;  2Z8L A;  3DXJ C;  3R3O A;  3EQL C;  2RDG A;  2J7Z A;  2FJ2 A;  2Z1C A;  3MVV A;  3DHQ A;  2AQ3 B;  3NUC A;  3GTP B;  2BE5 D;  3OMG A;  1PZK D;  1AP0 A;  1B50 A;  2F0O A;  1LLR D;  1HUN A;  1L0X B;  3PUV A;  3HOX B;  4KY7 A;  3HG9 A;  3S17 B;  1I3Q B;  1LO5 D;  1TS3 A;  5KNB A;  4X3S A;  3VR6 A;  1TR5 A;  3BYY B;  1EIG A;  5M3M B;  2WB1 B;  1SYF A;  3ERQ A;  1F9R A;  3MAQ A;  4KN7 C;  3D6W A;  2R61 A;  1WTW A;  2B2Y C;  3GD7 A;  2ICI A;  4C3I B;  4XYO A;  1JE4 A;  4KHV A;  1MGS A;  1R4Q B;  3FKI B;  2GA4 B;  2K04 A;  5C0X I;  1I4Q A;  3MA2 B;  5CMD A;  4FF2 A;  3SK8 A;  1YNJ D;  2B2W C;  1V43 A;  2WP8 J;  1SMY C;  3HGB A;  2F0H A;  3KK7 A;  3TP5 A;  1BF4 A;  2EY2 A;  3MC0 B;  5FO8 B;  5CBA E;  1W6J A;  2SDF A;  3L3O C;  2M00 A;  4XQN A;  3QB3 A;  4QUC A;  2QCP X;  1PLF A;  3RLF A;  4DFA A;  4DAP A;  5BN3 A;  1SNM A;  1AFP A;  1OXS C;  1FD7 D;  1QE6 A;  2X6L A;  3AMU A;  5C3W A;  5D3I B;  1LTI D;  3MHB A;  5ELB A;  1I4R A;  1I4P A;  2A69 C;  2D9U A;  3A7L A;  4U67 3;  1UAP A;  2XWB B;  2CW0 D;  1ONL A;  2F0Q A;  3OW7 A;  2AWN A;  2L12 A;  5C0X G;  2K28 A;  3DEO A;  2N88 A;  3QG1 A;  2VB3 X;  3OHX C;  4K8J A;  3PIO 3;  2A74 C;  2A5H A;  3JAM E;  4K5X A;  2K01 A;  3MZ5 A;  1MD2 D;  2ZXR A;  2TMP A;  3I72 A;  2H4O A;  5J1Z A;  2PMZ B;  3K5M A;  4KN4 C;  2Z4I A;  4ID6 A;  2RSN A;  4I7Z C;  4XT3 B;  3T56 B;  2X69 A;  1JR0 D;  1STA A;  1IKM A;  1ICW A;  1G91 A;  4XXE A;  2DY7 A;  4ZYS A;  2E2I B;  4A3I B;  3FVQ A;  5FK9 C;  1ENF A;  3P7J A;  1QIL A;  2VNU D;  3DEP A;  2KJX A;  2F0U A;  2EJM A;  1SNP A;  2OEO A;  3WOF A;  4MIU A;  1UNS A;  5C4H A;  1I4G A;  1MSG A;  2QF7 A;  2BDN A;  2WII B;  1BO0 A;  2R7Z B;  1B1Z A;  3HOV B;  2WKD A;  1HA6 A;  4H7B A;  5TSS A;  2SOB A;  4UDU C;  5EPK A;  2DN8 A;  1KDB A;  3GTL B;  3RD4 A;  5E3F A;  1DZ1 A;  1LT4 D;  2OT2 A;  2O5I C;  5KEE A;  3VR3 A;  1JOQ A;  2KCN A;  1TII D;  1IL8 A;  1A3V A;  5IOD A;  5FLX E;  1GUO A;  2NZ1 D;  1EQV A;  4C3J B;  2EXZ A;  3SXH A;  1SBB B;  1WTO A;  4KV6 A;  2KVM A;  3K6O A;  1YNN D;  1EY5 A;  2F0N A;  3C2P A;  1EL0 A;  4CHT B;  2XRS D;  4CKB A;  1EY4 A;  1I50 B;  1J9O A;  4IFD H;  1SYG A;  2JYO A;  5DEH A;  5I9O A;  2HDL A;  2E76 C;  4O1N A;  4A3D B;  5JJZ A;  4J6H A;  4C56 C;  3K5O A;  4LAA A;  2F0S A;  4EQO A;  4G7Z C;  1CT1 D;  4NW2 A;  3T53 B;  3M4Y A;  1TS2 A;  3I4L A;  5JEA H;  4KMU C;  3CRK C;  2RVL A;  1RDP D;  4FVM A;  1SYC A;  3P75 A;  3EFX D;  1G8Z D;  3TZD A;  3NQI A;  5M5W B;  4OHJ A;  1E0B A;  4CJ0 B;  5KYI A;  3C3L A;  2SNM A;  4V19 0;  2MGS A;  1JWU D;  4XDX A;  2IPK D;  2F03 A;  5CV9 A;  4TRD A;  3S9W A;  2JP1 A;  3VA7 A;  3GTK B;  1U9R A;  3A54 A;  4ILW A;  4FF3 A;  5C0X J;  1QG7 A;  4K8I A;  3Q23 A;  3G6J B;  4PV1 C;  4XIG S;  1CZG A;  3T16 A;  1I6V C;  4RGN A;  1Y8P B;  2YYZ A;  1PZJ D;  5IOC A;  4O42 A;  2LFN A;  4WOR A;  3LX0 A;  3V2T A;  1B9M A;  3MFG A;  3R2T A;  1D6E C;  5EPJ A;  5DM7 3;  2B63 B;  3GTQ B;  3BYT B;  2F0E A;  1BQQ T;  4Y7N B;  2EYM A;  1PXU A;  2F0D A;  1X3P A;  1J8I A;  1EY6 A;  2F0I A;  3VR4 A;  2B2V A;  4MN3 A;  5IGB A;  1RF2 D;  2B2T C;  4K5W A;  1WD0 A;  3ND8 A;  3H0G B;  1SYB A;  4H13 C;  1B2T A;  1HTL D;  1HQR D;  2AUK A;  1TKW B;  3JAM L;  1GOZ A;  1HFG A;  2OF1 A;  4WFN 3;  2AUJ D;  5IT9 L;  2PW5 A;  2EYH A;  3EVQ A;  1LT5 D;  1B9N A;  1DCZ A;  1FNV A;  3HP3 A;  4R8I A;  4BBS B;  1KDA A;  1MI2 A;  1TWF B;  3R2I A;  3SDZ A;  3DWQ A;  1TWC B;  2LS0 1;  2RDF A;  5D14 A;  3WOE A;  2A73 B;  2Y0S B;  3I90 A;  2JSO A;  2KOL A;  2B8F A;  3V05 A;  3BVM A;  5CV6 A;  2A6H C;  1XTC D;  5FO9 B;  3LNN A;  1CQF A;  1RTO A;  3LWE A;  3NSW A;  4K14 A;  2F0W A;  4IUN A;  1Q1E A;  5EBD A;  2DNC A;  2K32 A;  1GJX A;  4DK1 A;  5I9P A;  5EKL A;  3KLS A;  1IW7 C;  4FP5 D;  1GHK A;  3S1R B;  3T51 B;  2L0C A;  2R93 B;  2WAQ B;  3E6Z X;  3H6M A;  2Q8T A;  4C3I G;  1V1P B;  1Z7T A;  2Q8R E;  4AYB B;  2B39 A;  2EY6 A;  3G7L A;  1LT6 D;  4M1U B;  4ZKC B;  1AN8 A;  4A3F B;  5C3E B;  5C4J B;  1IYU A;  2TSS A;  4B08 A;  2PCF B;  2O5J C;  2D2C C;  4RCN A;  1Y8N B;  1SFO B;  3VYR A;  1SEB D;  1QJO A;  4IFD G;  3PUZ A;  2XIW A;  2JXM B;  4RWS C;  1U4P A;  2B2Y A;  2VB2 X;  3K5N A;  3PV0 A;  3J81 L;  3K58 A;  3VR5 A;  1RD9 D;  5M5X B;  4R8N A;  1H9S B;  5J39 A;  1JCK B;  3I8Z A;  4C3H B;  4G7H C;  1A3U A;  4KY6 A;  1CA5 A;  4CJ1 B;  4XYQ A;  3TN2 A;  5JEA G;  3M4O B;  1I4H A;  1PFB A;  5C44 B;  2RKS A;  3SK5 A;  4PMB A;  1BNZ A;  5ELF A;  1LTS D;  4C1N I;  1JWS D;  4BWG B;  5M5Y B;  1SE2 A;  5COR A;  4DAY A;  2F0P A;  5K36 H;  5DM6 3;  1CHQ D;  1ROD A;  2FMC A;  1MBY A;  1BDO A;  5ISR A;  2R3Z A;  3SK6 A;  4IUV A;  1K8O A;  1WTQ A;  3MTS A;  5CV7 A;  4ZLT F;  4HCS A;  2BDO A;  1K83 B;  1SNO A;  1U4R A;  1TY2 A;  4DGZ A;  4IUP A;  2K33 A;  3D6C A;  4IUT A;  4I65 A;  5F2D A;  1WTR A;  2V4D A;  3L9A X;  3M7G A;  3QO2 A;  2JA6 B;  5EQ0 A;  1QCB D;  1TY0 A;  2C5C A;  1VMC A;  4OIK A;  4KY5 A;  1GHJ A;  3NE5 B;  2X6G A;  4A3J B;  3MFY A;  4KJO A;  2K03 A;  4U68 A;  4KTA A;  2F0V A;  2BE5 C;  1HA5 A;  2XNA C;  2L55 A;  2F4I A;  1KLU D;  1QWY A;  3MEH A;  4A3E B;  4XQJ A;  1PTO D;  3NHH A;  1TU2 B;  4A3B B;  4KHZ A;  4J1M A;  1S5B D;  1CFM A;  2I46 A;  2XSC A;  1S5E D;  4RGO S;  3FPU B;  2JEA I;  1EWC A;  3TP7 A;  1HHV A;  3VYU A;  2EYP A;  3GP7 A;  4PQX A;  4RA8 A;  3L7Z C;  5C5L A;  2LMC B;  2PQE A;  2H1E A;  3ND9 A;  5CV8 A;  2SEB D;  1F9P A;  5IGC A;  4F88 A;  3PIP 3;  1QB5 D;  2PPB C;  1OXX K;  4A3G B;  1VF5 C;  3SVM A;  1BCP D;  4A93 B;  1KLG D;  1R9T B;  1E2W A;  1S5F D;  2VXW A;  3TBI B;  1YNJ C;  2J0T D;  3SK4 A;  4H0L C;  4KJN A;  4K2L A;  1H9R A;  4IFD J;  1BR9 A;  1C4Q A;  2LKV A;  5IIF A;  4XT1 B;  2EJG C;  4EQP A;  1HUM A;  4RHS A;  3OWF A;  5FKA C;  3H3V C;  2KCC A;  3CHB D;  5IT9 E;  4HR7 B;  5T1I A;  1AW7 A;  2OXP A;  5CBE E;  2EDG A;  3SHL A;  1Q12 A;  1EEF D;  3D4W A;  4ME5 A;  3IFT A;  5JEA J;  2LY7 A;  1SE3 A;  3LWU A;  1EY9 A;  2QKI C;  5LL6 S;  3BVZ A;  3WDN A;  3UI2 A;  3OIP A;  3ZYY X;  5CGK A;  2CW0 C;  1ET6 A;  2G9H D;  2K6A A;  1HTP A;  5IGE A;  2F0F A;  1CK1 A;  1CHP D;  1O7L A;  2K5W A;  4DAV A;  1SXT A;  5C4Z A;  2BA0 A;  3EJI A;  4G4K A;  1JWM D;  3VYT A;  1I6H B;  5E1F A;  1ZYR D;  3S2H B;  5KNC A;  3FDT A;  4Q5V A;  4RGM A;  1TWG B;  5A35 A;  4FF4 A;  1S4Z A;  3J7A F;  1Q90 A;  2FMM A;  1JOR A;  1EY7 A;  2NN6 H;  2RA4 A;  2N55 A;  1B3A A;  3DM1 A;  4TSS A;  5JVH 3;  3HOZ B;  5K36 G;  4IZ8 A;  1G2T A;  2EZV A;  2NB0 A;  3I4N B;  3A7A B;  4IAL A;  1F2Y A;  1F2Z A;  1EU4 A;  1O7Z A;  3H09 A;  4X3T A;  2JEB I;  3J81 E;  3VYS A;  4G7O C;  2AQ2 B;  1PRT D;  1G2S A;  2EYO A;  4R9W A;  1Y1W B;  1PYW D;  2F1M A;  2L9H A;  1KAA A;  2K5D A;  5D3D A;  2C9O A;  4X3U A;  3TP6 A;  4C1N K;  2F0K A;  2B2T A;  4F7X A;  4GZY C;  4BY7 B;  4B9W A;  3KBX A;  1FNU A;  1STH A;  1CA6 A;  1YNN C;  1SNC A;  1Z6H A;  1ESR A;  1RTN A;  2FIN B;  5FO7 B;  4LK1 C;  1F77 A;  2A68 D;  5CV5 A;  1PFM A;  3NXW A;  1II3 A;  3IAY A;  4RHR A;  4F8M A;  1TS4 A;  4CKE A;  3D4D A;  1LTG D;  5HUR A;  1ILQ A;  3NTH A;  3I3C A;  4YIJ A;  5KYL A;  1HQM C;  1IYV A;  1LT3 D;  5HGT A;  2EY1 A;  2M2L A;  1EU3 A;  3NPP A;  2IX3 A;  4HSP A;  1LTT D;  2L1B A;  1XX8 A;  2QEJ C;  5EGT A;  3J7Y W;  3DUZ A;  1CTM A;  1T5X D;  5AFW A;  3NP8 A;  2PYK A;  2SNS A;  3D8G A;  2IL8 A;  4JBW A;  5IGF A;  1T5E A;  5EPL A;  4IUU A;  1G29 1;  4N9P A;  1EYD A;  3K7A B;  5FOB B;  4IUQ A;  1D5X C;  3J80 L;  1SJH D;  4ZKB B;  2EE1 A;  3BDO A;  3OPO A;  3RUZ A;  2NVX B;  1RJT A;  3C1F A;  2BOS A;  3C46 A;  1U4M A;  4CBV A;  1PTO F;  1AZP A;  1QNU A;  1MSH A;  5ELE A;  3BVG A;  3QOL A;  4A3M B;  1JOO A;  4EGV A;  2NWG A;  1WCM B;  4HTH A;  3PUW A;  3MXG A;  2JA5 B;  1STE A;  1GUG A;  3BS1 A;  5C6A A;  1NSN S;  4QB4 A;  5C3X A;  3RMH A;  2NN6 I;  1G6Z A;  3X3M A;  2K05 A;  4QUF A;  2F0T A;  1EZ6 A;  1EYA A;  2ZXO A;  2O2L D;  1X32 A;  3S2D B;  3IL8 A;  4N9T A;  5JOB A;  1D1I A;  1OXT A;  2WKC A;  2J4X A;  1Z47 A;  2L4N A;  1F9S A;  3TZU A;  1NUC A;  1SNQ A;  1H9S A;  2WAC A;  1O80 A;  3BZD B;  1EOT A;  4IFD I;  1BCP F;  3O13 A;  2EYL A;  3IKJ A;  3Q6S A;  4FXG C;  3MXN A;  2E2H B;  1B53 A;  2QDB A;  4BBR B;  1R4P B;  1EIH A;  3K0Y A;  3NWT A;  2A6E D;  1DOL A;  1TWH B;  2EJF C;  5DNF A;  5C5M A;  2NN6 G;  5ELD A;  3K57 A;  2MPM A;  3E0J A;  2B2U C;  5CYU A;  5I2Y A;  5M9O A;  4G57 A;  2EOT A;  1LAC A;  5K5P A;  3R93 A;  4DK0 A;  4RKL A;  5E4W C;  3BG3 A;  3TP8 A;  2WIN B;  4FXD A;  4HSV A;  1NR2 A;  1X3Q A;  3A8K E;  2B2V C;  5J22 A;  3A8I E;  1NCV A;  3P20 A;  4L8J A;  1CI3 M;  1I4X A;  1XWE A;  1DM0 B;  3NWS A;  4EQN A;  4DF7 A;  2K1B A;  4JK1 C;  3F2U A;  3S16 B;  1KNA A;  5I6W A;  4BA1 I;  1KDC A;  4RH6 A;  1ET9 A;  5CC4 A;  2AWO A;  2IWH A;  1B4O A;  1CZW A;  2IW3 A;  1EQT A;  1KTK A;  3KLS X;  1ENC A;  3AB9 A;  3OSO A;  5JVG 3;  1SAP A;  1D5Z C;  2B2W A;  2PZU A;  4IN3 A;  3GTM B;  2NTS A;  4RKB A;  2QIL A;  5CV4 A;  3H94 A;  1RCV D;  3S15 B;  1BBX C;  2ICE C;  1C48 A;  5G3L D;  2HCI A;  5LL6 X;  5KGU A;  2B8G A;  3J7A V;  1BXT A;  5LHY 1;  3W2D A;  4LJZ C;  3X3N A;  1SYE A;  3CQZ B;  2E75 C;  1JOK A;  4J8Q A;  5COY A;  1DJR D;  4CKC A;  2MHV A;  4DXF A;  1PRT F;  1ZKO A;  1TWA B;  1LTA D;  2CHB D;  5KND A;  4QF4 A;  2F0J A;  2PZW A;  2RBM A;  3PO3 B;  3GQB A;  3PUY A;  4M8A A;  3QWN A;  1DON A;  2XN9 C;  2F0G A;  1LTB D;  1H9M A;  3KLR A;  1M4V A;  4FO2 A;  1SMY D;  4ZUJ A;  3QJY A;  1CM9 A;  3P1H A;  2NTT A;  1H9J A;  3D3R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...