4K2LA

Crystal structure of staphylococcal nuclease variant delta+phs i92q at cryogenic temperature
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYQYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Cavity hydration in proteins
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 33
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2013-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4k2lA00
2PZWA 3R3OA 2F0FA 4KTAA 3SK4A 1STAA 2ENBA 1SYDA 2F0WA 1EZ6A 1EY9A 4I65A 2EY2A 4KY5A 2PYKA 2F0IA 1II3A 3HZXA 3NUCA 4WORA 4RKLA 2EYHA 1EQVA 4K2LA 5E1FA 4ME5A 1SNQA 5JOBA 3SK8A 5J39A 4PMCA 1JOKA 4J6HA 2F0KA 4HTHA 4IUNA 1F2ZA 1SYGA 3DHQA 5DAUA 5C5LA 5ISRA 3MZ5A 1JOOA 2OF1A 2PW5A 2F0JA 3VA5A 1KDCA 1SYEA 4KJOA 3D8GA 5CR3A 2QDBA 4QB4A 3E5SA 1A3VA 4EQNA 3DMUA 3C1FA 3H6MA 4HMJA 4EQPA 2NUCA 3SXHA 5C4HA 2RDFA 3TP6A 1EY0A 5EKKA 4K8JA 1A3TA 5C3XA 4IZ8A 3OMGA 3NQTA 1A2UA 3NHHA 4IALA 1SYCA 1ENCA 4QF4A 5CV8A 4ZUJA 5K5PA 5KGUA 1JOQA 5KIXA 3MXPA 2F0OA 1SNOA 2LKVA 3D4WA 1KDBA 5IODA 5CV6A 4F8MA 4KY7A 3SR1A 1AEXA 3NK9A 1STHA 1SNMA 4QMGA 1EY8A 2EY6A 2F0HA 1STYA 4YIJA 5KYLA 2EYLA 1SNDA 2EXZA 2OXPA 1SNPA 3ITPA 4KJNA 4PNYA 2KQ3A 4K6DA 2EYJA 4G57A 5EKLA 5IOCA 3TP5A 4K14A 4K5XA 2EYOA 4NKLA 1STGA 1SYBA 1A3UA 2F0EA 4MIUA 2EYPA 2F0SA 4KHVA 4NP5A 4R8NA 4DGZA 1EYCA 2F0MA 1RKNA 4HMIA 2SOBA 3MEHA 3T13A 5I6WA 3OMCA 3TMEA 5IGEA 4B9WA 4DFAA 2M00A 2F0UA 1F2MA 2WACA 4ODGA 1STNA 2HQEA 3P75A 4K5WA 4ZUIA 3TP7A 1TR5A 1EY5A 4KV6A 3C1EA 5KYIA 5EGTA 4J1MA 2EY1A 3T16A 3OWFA 2F0GA 4KD3A 4RKBA 3SK6A 2PW7A 4K5VA 3MVVA 3MHBA 5IGFA 4S3SA 3U9OA 1EY6A 1EYDA 1NSNS 1NUCA 2F3VA 2KHSA 3NP8A 3NXWA 3QB3A 4DF7A 1EZ8A 3D4DA 5IGDA 1KDAA 5DEHA 2OEOA 4ZQ3A 4EVOA 3S9WA 2SNSA 3OSOA 5I9PA 5J22A 5J1ZA 2PZTA 3RUZA 5CV9A 1KABA 5E3FA 1EYAA 1ENAA 3BDLA 4H7BA 3V2TA 3SHLA 2F3WA 3QOLA 2F0PA 2F0QA 2F0LA 1U9RA 1TT2A 2F0VA 3BDCA 5NUCA 5JAVA 5M9OA 5IGBA 2F0DA 2EYMA 4K2KA 5C5MA 3HEJA 1SNCA 5F2DA 2O4XA 3SK5A 4K8IA 4PMBA 5CV5A 3TP8A 4N9PA 2F0NA 5I6YA 4NMZA 5CGKA 1F2YA 4WRDA 4F7XA 3LX0A 3EVQA 1KAAA 5CC4A 4OL7A 5KRUA 3EROA 2RKSA 5C4ZA 1A2TA 2PQEA 4TRDA 1JORA 4DU9A 1EY4A 2EYFA 2F0TA 4KY6A 3P1HA 4N9TA 1EY7A 5I9OA 2PZUA 4B9XA 5C6AA 5CV7A 2SNMA 3EJIA 4ID6A 4NDXA 1TQOA 4EQOA 3PMFA 4KD4A 5HURA 5IIFA 1IHZA 5HGTA 5IGCA 3ERQA 1SYFA 5C3WA 5CV4A 2RBMA 2EY5A 3D6CA 4E6IA 1STBA 4LAAA 5IGGA 5KEEA 3QOJA
chains in the Genus database with same CATH superfamily
4LW1A 3U9SA 5EKIA 4I65A 3PCOB 4WFN3 2N78A 3BYTB 2ZTEA 1HR0Q 4PMCA 2L4NA 2R93H 1G6ZA 1SN8A 3DHQA 4A76A 5D65A 2BE5D 2NZ1D 1X3EA 2VUMG 2K03A 4R4QA 2NVYH 1EY0A 2KECA 3CRLC 4R1JA 3SHLA 1WFQA 4JI6Q 1Y8PB 3NTKA 3MXUA 1IL8A 1SMYD 3KJOA 3LWEA 4HJ9A 1CHPD 1DZ1A 1H9MA 3URYA 4J15A 2VUMH 1T9HA 3HKSA 4IFDJ 4G7OC 2Z1CA 1TIID 1LYLA 2JA5H 2Z4HA 3CHBD 2SOBA 3MEHA 1Y1VH 3OMCA 2BOSA 4LNQA 1F2MA 1KNEA 1LLRD 5BN4A 4ZUIA 1HR0W 2EY1A 4KKTA 3SK6A 4QL5A 1G91A 2F3VA 5IYDG 1PTOD 5BR8L 5E4XA 4DV4L 1UE1A 4GN5A 5M5XH 5C0XH 3CCMA 2AMCB 5LMUL 2NTSA 3L2PA 3J80c 2BH8A 2SEBD 4JI5L 1WTQA 3CCRA 4LF5Q 5JAVA 3V96A 3KYHC 4ZKBB 1G2TA 5IYDH 1VDZA 1PHJA 4JI7L 2UXBL 2JEAI 1A15A 4B3RQ 1EQQA 1CSPA 5KRUA 3KUPA 2A8VA 2R93B 3AYHB 3RNUA 4TRDA 2AUJD 2XRSD 2YTVA 1F2LA 2MNAA 2KA7A 1K3BC 4C56C 2R7DA 2QCPX 3TRZA 1UNSA 1LUZA 2XRQD 1HNXQ 2NVYB 4DNTB 4Y52H 4IURA 4A3MH 2IJ0A 1S5DD 1ENFA 3R3OA 2F0FA 3U4VA 1SYDA 3N52A 1SE4A 2NZOA 3L3OC 3CMEA 3CAMA 2Z6BA 1U0LA 1EQVA 1SE2A 4K2LA 1CI3M 3I73A 3T1HL 4FF1A 1XTCD 1IKLA 2OF1A 2VUMB 2IX0A 5CR3A 4EQNA 4OELB 2KJXA 3SEBA 3IRBA 3PV0A 1MSHA 2JA5B 3PO3H 1Y1VB 3S1NH 1VQEA 1ENCA 3PF4A 1AE3A 1V1OA 4YHHL 1PLFA 4LFAL 5C4JH 2E2JH 1YVCA 5IE8A 2B8GA 3SR1A 4U673 5GQOA 2WP8J 3CU7A 5LMNL 4QUCA 1H9KA 4DUYL 1IYVA 2KHJA 1BOSA 3IFTA 1QG7A 1X6OA 2K5VA 5M3FG 3G7LA 3LWUA 3A8IE 2FXQA 5FO8B 1DONA 2ZXRA 1Q8IA 4Q5VA 5M5XB 1AE2A 1PH3A 2V1CC 4PZ7A 1STGA 3VA7A 1N32L 2KHIA 2F0SA 3CC4A 3ICEA 2AHOB 4A3BG 1IBLQ 5EJWA 1L0XB 3VYSA 1Z7TA 2C35B 4ZKCB 4KV6A 1I6HH 2K33A 1IL2A 4J1MA 5JEAG 1YJ9A 3K5MA 3MVVA 3CKIB 1FL0A 2LFNA 3AQQA 5FLXL 1WYDA 2DUDA 4DR4Q 3F1ZA 1K3RA 4B3ML 1Q81C 5HY6A 4FP5D 1KC8C 1HA5A 5DEHA 1FD7D 3NSWA 1VQMA 2F1MA 4A3BH 3D6WA 5KNDA 1YITA 4CJ1B 4G4KA 1Q8KA 2R7ZG 4GN3B 1WTOA 2MFIA 1D5XC 5AFWA 5JEAH 1TT2A 2K1BA 4JI1L 4A3MB 1EWHA 4BY1G 4U68A 3SGIA 1HNZQ 1WTXA 1SNCA 2MPMA 1VMPA 2CWAA 2AQ2B 3DLLA 4LK1C 4A3LG 1X32A 2IY5B 2E2DC 3BS1A 1EY4A 1GUSA 5L37A 2R7ZH 4A3EH 2AWOA 2TMPA 5CV7A 4QUFA 4KD4A 2ZT9C 5GAEC 1QVGA 4BY1H 3KLSX 1W2BA 3PO3B 3K5NA 1Q3LA 1E2ZA 4FF4A 4LMQD 3S1NB 1STAA 3OIQA 4DUZQ 1YHAA 3ZYYX 2PO4A 4QY7A 5C4JB 4KMUC 4LFBL 2E2JB 4DR2Q 4JW0A 4OEMB 2HCCA 2N55A 3I4MH 3BZDB 1PH1A 1RCVD 3Q6SA 3P20A 1SROA 1N36L 1KQSA 4A3GH 3C1FA 4GOPB 3J80i 3LNNA 2HHHQ 4UPAA 2MJ8A 1LTAD 1I4QA 3GP7A 2DJGC 3DUZA 3HKZE 3VDYA 2K05A 2PQAA 4XQQA 1I6HB 2Q2IA 2B39A 3NENA 4TVAB 1NCVA 3X3NA 2D2CC 2Z6KC 1EY8A 4GZYC 3W1GA 2EYLA 5FJ8G 2OXPA 4G7ZC 1H9SB 4WJ4A 1JCKB 5EKLA 3CP0A 4A3BB 1D7QA 1PDQA 3M7NA 1A3UA 4DGZA 4KHVA 3PUXA 4LUOA 5I6WA 5A35A 5IGEA 3TMEA 3CPFA 4L6TB 1NTGA 1H9RA 3HOYG 4A3IG 1GM5A 1FGBD 2GVBA 2HCIA 4DK1A 3RZDH 1C7YA 2IHFA 1SDFA 4A3JH 4CKEA 3H0GG 2CH4W 4IOCA 4MTNA 2OT2A 5IT9c 4EVOA 3CCSA 2EOTA 4RAUC 5E3FA 2R7ZB 4A3EB 1HZBA 1YHBA 2VB2X 2RDGA 2R3ZA 4V0BA 4A3IH 3H15A 4BY1B 1U9RA 3M4OH 4P2CB 3I90A 1YHQA 1B53A 3IKJA 4KKSA 4K8IA 3H0GH 4P75A 5CGKA 1WCMG 1YBYA 2X6GA 4NB3A 2MGSA 4IFDG 2R7FA 1OXXK 2RKSA 3E9IA 3I4MB 1B44D 4CKCA 1PYWD 1TKWB 3R93A 3WOEA 5K36H 2KEEA 1RTNA 1K0SA 2OQ0A 4A3GB 4JI8Q 1I3QH 4HIKA 1WTVA 3EIVA 1HZ9A 5T1GA 2XWJB 4CDFC 1I4RA 3KF8B 1CUKA 1GUGA 1WCMH 4JBJA 4K6LA 3I2ZA 4AYBE 3KBXA 4IFDH 3M4YA 3GV3A 1D8LA 4MNOA 5J39A 3CXCA 3S2DH 1PZID 2CQOA 1CKOA 3G48A 4YCVA 3NEMA 4KN7C 3PIP3 1IKMA 1G8ZD 1CZGA 3TP6A 3FKIH 1ILQA 5EKKA 4HIOA 3M9BA 1KXLA 1IBKL 1JOQA 3SE0A 1J6QA 3W3AA 3JAML 4LF5L 1HQRD 2QKIC 4F8MA 3RZDB 1ML0D 3H94A 5IP9G 5BR8Q 4DV4Q 4A3JB 1DOLA 2F0HA 1EIGA 1JT8A 4B3RL 1ZXTA 1JC7A 5LMUQ 2RQXA 1J8IA 4JI5Q 1UE7A 3E0JA 2O5JC 3NQIA 3HOWG 4OWXB 5FO9B 4MZ9A 4A3IB 3KK7A 1L0WA 4B9WA 1BKBA 2F0UA 3M4OB 4M8AA 1E24A 4UP9A 4JV5Q 4DV3Q 1HNXL 3R8BA 5IP9H 3T16A 3S1MH 2UXBQ 1HXYD 2F0GA 1XXGA 1MHWC 1XTDA 5CORA 4LF8L 1QB5D 3T51B 3MXNB 3A74A 3H0GB 4UAIA 1B4OA 3H3VI 1GKHA 3TBIB 3L9AX 3UI2A 1XJVA 1ICFB 3OW2A 5J1ZA 3HOWH 4DR1Q 2JA8G 3F8TA 3CCVA 1TS4A 4ZAIA 3K0YA 1JMCA 1I3QB 1CQFA 3KLSA 4BY7G 4X3KA 5ELFA 2I5HA 1WCMB 3D4RA 1VQ6A 3TP8A 1PRTF 4LJZC 1VQHA 3S2DB 4TQUS 1I94Q 3NE5B 2Z6KA 1JB3A 2EJGC 4GLAC 1K83H 1K8MA 2EYFA 3Q8DA 4CDDC 2K5QA 1PRTB 4B9XA 3S9WA 1B8AA 2SNMA 4ID6A 4NDXA 3E0EA 4BY7H 1ET9A 4OIKA 1DOKA 1TWAH 3FKIB 4YHHQ 3DXJC 3KLRA 4XIGS 4KY5A 3GTOH 1WOCA 2EYHA 4LWCA 3CD6A 1B50A 2NYZD 3MZ5A 1YNNC 3LGJA 4DR4L 2F0JA 3RLNA 1XPRA 1N32Q 2A69C 1LV9A 1T5XD 3H91A 2E75C 3DMUA 3KDFB 4X3UA 4O2DA 2L9HA 2LXJA 4JYAQ 3KLWA 2NWGA 1UEAB 3OMGA 3IL8A 4CJ0B 2N8NA 4NXML 5K5PA 5T1IA 2LKVA 3CCUA 3S1MB 4DK3C 1K73C 5C4XG 1CA6A 1U5KA 4HCEA 3NBHA 3V05A 1PH7A 1U4LA 3O13A 4H0LC 2EYJA 4YY3L 5GAHC 1C0AA 4X62Q 1S4ZA 3HOWB 2FMMA 1X3PA 2DNCA 2HUGA 4RMFA 5CYUA 4JI1Q 4OGQC 4DV2Q 4OO1H 3GTPH 5LMNW 3BVGA 3TP7A 3HOXG 2CKZB 4BXXG 2E2HH 1B9MA 5C4XH 1TWGH 3AB9A 2Q2HA 4CKBA 2VNUD 3KF6B 4S3SA 4FF3A 1A6XA 2H5XA 1EFWA 2AUKA 1K83B 1TY0A 4R4CA 3VR2A 1VQNA 4DR5L 4L5QA 1G2SA 2WB1G 3EFXD 4BY7B 4OX9L 1OXUA 4BXXH 1TWAB 4DAPA 1TVXA 2A73B 1LT4D 2G9HD 3B6YA 1WD1A 1O7LA 2AQ1B 3GTOB 3FEWX 1EQTA 5CV5A 5I6YA 4YWMA 2XVSA 2WAQG 1F2YA 1B3QA 3W2DA 3UDXA 5D3IB 4OL7A 1Q1BA 3G6EA 1J9OA 2PQEA 4R4OA 3A5UA 3J81i 4HEDA 2EE1A 3E9HA 1XYIA 1K9MC 5IWAL 2UUCQ 3ER0A 5HGTA 1VQJA 2MUYA 3CCJA 1JE5A 3MA2B 1Y1WG 3K5OA 3CW2C 1ESRA 2JA9A 3W5OA 2UU9Q 3M85A 2AQ3B 1AN8A 1GUNA 3K5LA 5DLQE 4BA2I 3RLOA 1F2ZA 3MEFA 3I91A 4AYBB 4ABNA 2K14A 1IBML 3S2HH 1W6KA 1WTPA 3J7ZC 2N49A 1HHVA 1Y1WH 4EQPA 2B2TA 2AKWB 1MKHA 4DV5L 5EQ0A 2LSSA 4C3IG 3NQTA 3CCEA 4M1UB 4DAYB 4RWSC 4DK0A 4RGOS 3GTPB 2F0OA 2E2HB 2N3SA 4CDEC 1CKMA 5C4XB 1TWGB 1U4RA 5J3BA 2FJ2A 4C1NI 1M4VA 1PZKD 3UE1A 3R2IA 4HCSA 3RMHA 5I4DA 1YNND 1VF5C 3GTQB 4GNXB 2A69D 4IJLA 5IOCA 1XNRQ 2EYOA 1IXRA 3JAMi 4GKKL 4H02A 4RCNA 5ELOA 4OWTB 2JE6I 1A63A 3T13A 1HA6A 4A3DG 4FXGC 3G4SA 4JI8L 4WJ3M 1QOHA 2L15A 5LHY1 5DNFA 1EY6A 4JBMA 5FO7B 2PNRC 2ATWA 4ZLTF 2WB1B 4A3DH 1GUOA 3VR3A 1B3AA 4HSPA 1QUQB 2NTTA 1QNUA 2EZVA 4L8JA 1Z47A 3BDCA 4A4IA 4R9WA 3HEJA 2WAQB 2O4XA 4A3KG 3S14H 2B3GA 5EPKA 4CDCC 1KL9A 3LX0A 4JBKA 3PGZA 1E1OA 1Q82C 1YNJC 1TU2B 3EBEA 3S2HB 2WKDA 3T1YL 4FNFA 3HOUG 4Y7NH 3EJIA 1GVPA 5IIFA 1Y1WB 1IBKQ 2Z8LA 3I7FA 2K4KA 1Q12A 2JXMB 4DR7L 1Q46A 4A3KH 4ZRZA 1QVFA 3J7A5 1EYGA 1PFSA 5A2QL 1QZHA 3NUCA 2NVQH 4JV5L 1QNKA 2G9DA 1YI2A 4DV3L 5E1FA 1SNQA 1D2BA 1MD2D 3A0JA 4IUNA 1SYGA 3HOUH 2D9UA 3ONAB 1Q1EA 4KJOA 4QB4A 4R4IA 3J7AV 4RGNA 3T4AC 2RSOA 3S17H 4DR1L 3K80C 2K28A 3DWAA 1JICA 4IZ8A 5C3XA 2B2VC 1SYCA 3C46A 3E3XA 4LF8Q 4WJWA 1VF7A 3UDFA 1NY4A 2DY8A 1I5FA 4HAEA 3C3LA 1RJTA 4KY7A 4A3CG 4H44C 1QUQA 4CHTB 2ZJPA 2IW3A 3I72A 2EXZA 1D1IA 2J4XA 3ITPA 1O7ZA 2SDFA 1I94L 1E1TA 2IPKD 2OWOA 1BCPF 3WOFA 4F88A 1VQAA 2B2UC 4A3DB 1SYBA 4UHVA 3RZOH 1EIYB 1BVSA 1MJCA 1A0IA 3GTJH 1BCPB 2HIVA 1NR4A 1JJGA 3I3CA 1LT6D 1I4GA 2AWNA 1TXYA 1DOMA 4GOPC 3H3VH 3S14B 1HTLD 1CHQD 4RGMA 4B3TL 4FDBA 3HGBA 1R4PB 1B9NA 3RLFA 2OEOA 3OSOA 3RUZA 2PZTA 4AH6A 4Y7NB 2CHBD 1MSGA 4LF7Q 4KHPQ 5IYBG 3SDZA 1CT1D 2MP1A 2F0LA 2V4DA 3MFGA 4JYAL 4K2KA 3DM3A 4A3KB 3GQBA 5EPJA 2OQKA 3SK5A 3PUYA 2F0NA 2NVQB 3VR5A 2ALYB 1UUPA 2LXKA 5M3FH 1PZJD 4O1NA 3HOUB 5IYBH 2HDLA 1ET6A 1EEID 4MN3A 4DV6L 1IYUA 1IHZA 1RD9D 5I2XA 5IGCA 1VMCA 5CV4A 4X62L 3S17B 4NXMQ 1RDPD 2VQEQ 1V9PA 1XMOL 2DGYA 2UUAL 2F0WA 4DV2L 1EZ6A 2JN4A 4A93G 5EBDA 3HZXA 1G291 1BXTA 1Q86C 2VXWA 1E0BA 4YY3Q 3RD4A 2CWPA 4KKUA 1YNJD 3D8GA 4HJAA 2QEJC 4IPCA 1YNXA 3RR5A 1X55A 2LS01 1PH9A 4AQYQ 3SXHA 5C4HA 2PPBC 4X6AH 3RZOB 4A93H 4J8QA 4LF4L 2R61A 2NB0A 3GTJB 3QJYA 3BU2A 4DK6C 5KGUA 5KIXA 1SR3A 1EFID 4RGTA 4GN4B 5IODA 1KDBA 4A3LH 4RG1A 2CVRA 4RCOA 4K0KL 3CCQA 2JJQA 4B3SQ 4RFBA 1WTWA 3U4ZA 4P72A 2IWHA 4DR5Q 2K5NA 4G57A 1LTBD 4OX9Q 3T53B 2F0EA 3K7AH 1N34Q 2D62A 4X64L 4DFAA 2UUCL 4XYQA 2B63G 2HQEA 1A8VA 1EY5A 5KYIA 5FLXc 2RDHA 2A1AA 1SJED 1UEBA 1I50H 1LTSD 1BBWA 4DXGA 2VY3A 2UU9L 5M3FB 1GOZA 3D4DA 3STBC 5JPMC 2QDLA 4HR7B 5IWAQ 1E2VA 2LMCB 3NWSA 1BNZA 2FHTA 2B63H 1W3SA 4DV0Q 3A54A 3FP9A 3IAYA 2B2VA 2R92G 1E22A 5IGBA 1C48A 1BQQT 5F2DA 1Q90A 3PO2G 2F4IA 5FJ8H 4F7XA 3EVQA 1IBMQ 1Y8OB 1F9SA 2DNEA 3E6ZX 4JCVE 4DKAC 2I5LX 2F0TA 4N9TA 1EY7A 1SE8A 2X6LA 1IYJB 5C44G 4DV5Q 2B2UA 1AZQA 4R4TA 2IHEA 2R92H 3ERQA 1XNRL 2EY5A 3HOYH 1CKNB 1NR2A 1AH9A 1R9TH 4A93B 2PZWA 3SK4A 4X3TA 2MQHA 2PYKA 2F0IA 1X65A 3I4OA 1C8CA 4IUTA 4GOPA 4N8FA 1EWCA 2KENA 1TS3A 2F0KA 3I56A 2K7VA 5ISRA 2GN5A 2BA0A 4GKKQ 1WD0A 1J5EQ 1NMGA 1V1QA 2NUCA 3PIOA 2XWBB 3K7AB 3TN2A 3VYUA 4PV1C 4KK7A 3PQIA 4JC0A 1M1KC 1TY2A 2B2YC 4ZUJA 2K01A 4PG3A 4OXPA 4C2MH 1H9SA 5JVG3 2VB3X 3U50C 2A5HA 1NMFA 1PRTC 5G3LF 5BN3A 1I50B 3TZDA 4YIJA 3U58A 4ILWA 3HS0C 3A8JE 3DWPA 4K6DA 3J80E 1AW7A 2UXCQ 3MXGA 1PYBA 5ELDA 5C0XI 2JQOA 3OW7A 1N33Q 1EYCA 3M7GA 2B63B 2RHQB 4Q0FA 1JWMD 4FYDA 2VW9A 1ZKOA 4UP7A 1VQDA 5ELCA 2VZAA 2M2LA 2NVTH 1BDOA 4BBRG 1HH2P 5IYCG 4DAMA 1OTCA 3OHXC 1SEBD 4APVA 1HTPA 5KNBA 2KHSA 4HJ8A 1STEA 4BBSG 5COYA 3T1YQ 5FKAC 2DN8A 4C3JG 3EN2A 5JJLA 4O0AA 2YV5A 2YTXA 4DR7Q 3V2TA 3S1RH 2XNAC 1C4QA 3J81c 3QOLA 4POFA 1EIFA 3MWYW 2JK8A 4DXFA 2R92B 1HJPA 2BA1A 1IW7C 3HOYB 1R9TB 5M9OA 1L1OB 5IYCH 4DAVA 2PCFB 4V190 1FGUA 3JC66 3HOVG 3A55A 4XXEA 1WI5A 4C3JH 5KNCA 3TDQA 1NBWA 1HZAA 4BWGB 2WB1E 1F9QA 2ZM6Q 2CFMA 3AFQA 4H13C 4JVZA 3STBD 2FFKB 1EU3A 3SVMA 3K7UC 4IUUA 2PZUA 5C6AA 3KF8A 1RL2A 1LM0A 2K5DA 2B2TC 2IX1A 2KBNA 1STBA 4E6IA 5KEEA 2WAQE 4CJ2C 3NPPA 4UDUC 3CPWA 4C2MB 1II3A 1CZWA 2ZTDA 4WORA 2K50A 4NXNL 1OXSC 1EEFD 1RTOA 2NBFA 3TREA 2JA8H 3KOJA 1JWSD 3OIPA 1OO9B 4POGA 2NZHA 5E4WC 1VQBA 3JAMc 1EL0A 1FR3A 4LF7L 4KHPL 4GLXA 1JJ2A 2K52A 3R2TA 3D4WA 5CV6A 2Z9HA 2NVTB 4B3TQ 1SNMA 1EU4A 3F2UA 4DR3Q 1HFNA 4ALPA 3OYYA 3VR4A 4KJNA 1PFNA 4GKJQ 2WV6D 4MIUA 4P73A 4LUVA 2WKCA 5EBCA 2F03A 3S1RB 4KN4C 3MXNA 3FMCA 1O78A 1PYSB 3Q0AA 3Q22A 1M90C 4BBRB 4DV1Q 4O42A 2VQEL 3I8ZA 1PRTD 3ULJA 3EA6A 4DF7A 4C3JB 4XT1B 4C3HG 2Y0SG 2Q8RE 5M5WH 2MO1A 2ZJQA 5ELBA 2K75A 4DV6Q 2M9VA 4PQXA 2ICIA 2RHSB 3MAQA 3A56A 3PUVA 1SAPA 1LT5D 1HZCA 2KVMA 1XMOQ 2UUAQ 4FVMA 1LTRD 2KCMA 3K59A 4AQYL 4JI2L 2B2YA 1SMXA 1Y8NB 2RA4A 1TWCH 4GNXC 1TS2A 5TSSA 3KBGA 3BYYB 3G71A 4IUVA 2L12A 1N8RC 1FNUA 1K8AC 4DNIA 1LO5D 3K81C 1JORA 4KY6A 3S24A 3WWVA 3GTQH 2JA8B 2EJMA 4B3SL 3NELA 5ELEA 5HURA 1DXMA 1LT3D 4X66L 4LF4Q 2GVAA 3OPOA 5FLXE 1NJIC 2RBMA 3UE0A 3HOXH 4HJ7A 4GLVB 1IW7D 1BUVT 1N34L 2IX3A 4IPDA 4IPGA 2JSOA 5JPNC 1K28A 5CBAE 2EY2A 1AZPA 3MFYA 4K0KQ 2OTLA 3KDFA 4RH6A 1UWVA 3CCLA 1LABA 3QO2A 2HT1A 3F2CA 5GROA 1VQ5A 1MGSA 1RODA 1SFOH 1P16A 4HSVA 3W1BA 4EGVA 5BN5A 2RCFA 1PTOH 4IN3A 2D5DA 1BR9A 4X64Q 2RDFA 3I4NG 1X9NA 5D14A 4K8JA 1QILA 3GTMH 4XYOA 4DV0L 1G6PA 3MXPA 3IFDA 1OXVA 3DEOA 3L0OA 1AEXA 2XGTA 4LUZA 5IT9E 1U4PA 2NVXH 3ULPA 5M5WB 1SNDA 4YCWA 1MI2A 3I4NH 4LF9L 4K14A 3AMUA 4AIMA 2XIWA 1SJHD 2EVBA 1RKNA 1XMQL 3KF6A 3HOZG 4R8IA 1TR5A 3KJPA 4L5RC 4FF2A 2CH4A 3OWFA 4KD3A 1TWCB 4Z9CB 2JA6G 2Y0SB 1GUWA 4IUQA 1EYDA 3DEPA 1Y69U 4X65L 4DV7Q 1KDAA 4L63B 1JR0D 1KABA 1ENAA 2F3IA 1S72A 3HOZH 4C3IH 2ASBA 3M3YH 2K04A 2VQFQ 3HOXB 2JA6H 3J80L 2H4OA 2P5ZX 1PH8A 1SSOA 1S40A 4IFDI 1PTOF 1LACA 2JA7G 3AU7A 2I07B 1BCPC 2QA4A 1SFOB 3HP3A 3F2DA 1PH6A 3TQYA 1PTOB 4HJ5A 5M5YH 1ILPA 5C3WA 4HIMA 2F52A 1XX8A 2UXCL 3D6CA 2JA5G 3GTMB 1N33L 1Y1VG 2LY7A 3QIAA 2DY7A 1EY9A 2JP1A 1PFMA 2YYZA 2L5TA 1GO3E 2JA7H 1HCZA 2WFWA 1UE5A 1AFPA 1KHIA 5C5LA 1JOOA 3J81E 2NVXB 1Z9FA 3VA5A 1MJEA 4DAYA 2ZXOA 3HRZC 3FPUB 3I4NB 1CA5A 4HMJA 1EOVA 1FVIA 4ZK9B 1VQ7A 3G6JB 5C0XG 2K6AA 1WJJA 3K8AA 1A3TA 2I46A 1KLUD 3GTGH 2K5WA 2QW7A 4QIWB 5JVH3 3S1QH 3A7LA 1TWHH 3TEHB 4JBWA 4GNXA 2L55A 1R4QB 2RF4A 5IY0A 3H09A 3GTKH 3P7JA 2NN6I 4XTCS 5KYLA 3VYRA 4N8X1 4NPSA 3TP5A 2J0TD 2ZM6L 1FJGL 4JPBW 3HOZB 2RVLA 4DR6L 4C3IB 3M3YB 1NAPA 1STNA 2DJFC 3MC0B 4GS3A 5EGTA 3ULLA 2JA6B 4A3MG 4QGUA 1XPUA 4PZ6A 3U9OA 1JJCB 1Z6HA 5JJIA 3GV6A 4OONA 1E7ZA 4ZQ3A 1EUJA 2PMZE 2MO0A 3JAME 1DGSA 2EDGA 5CV9A 2VL6A 3BDLA 4JI3L 4ME3A 1D5ZC 3HG9A 4RHRA 2O5IC 5M5YB 4PZ8A 3PUZA 3H3VC 1H95A 1HUNA 3PO3G 4YCUA 4NXNQ 3BVZA 4A3CH 3NBIA 4PMBA 1F9PA 1HRJA 2KUMA 2JA7B 4WRDA 1KTKA 2QILA 3FRPB 2XSCA 2GA4B 1D6EC 4DR3L 1VQFA 3Q23A 1KRTA 3OOCA 3BJUA 1ASYA 2L1BA 4GKJL 4UP8A 4C1NK 1VQKA 1PVOA 1NNXA 1Q7YC 1HNWL 2UXDQ 3GTGB 2QGQA 3S1QB 4KHZA 1TWHB 2EPBA 4KLKA 3F2BA 5C3EG 4RKLA 3S16H 4DV1L 3GTKB 1JOKA 1V8QA 4HTHA 4XT3B 5DAUA 1QE6A 2PW5A 2QDBA 1BCPD 3E5SA 4DN4M 2CCZA 1GXDC 1X3QA 2BDNA 3DWQA 4EX5A 2Z0SA 2C9OA 4IALA 3NHHA 2B29A 5C3EH 4OO1I 1BBXC 1SNOA 2D0OA 3CC2A 4QCLA 3NK9A 1STHA 2A68C 5DM73 2ID0A 1RIPA 1S5BD 2PQAB 2PI2E 2KOLA 4JI0L 1EWIA 3FVQA 1JWUD 4JOIC 1X56A 2I5MX 3DM1A 4NP5A 4A3EG 4JI2Q 5CBEE 1ZYRC 3OTOL 2M00A 4ODGA 1VQ4A 2QEXA 3VR6A 1ESFA 4IO9A 1S5FD 1BO0A 1NE3A 4IUPA 1IZ6A 2UUBQ 1GJXA 4XQJA 2B2WC 3NWTA 4IJHA 3MHBA 1MBYA 4OHJA 1T5EA 3T56B 5AJ3Q 1G51A 1SXTA 1C9OA 1NSNS 3NP8A 1CTMA 3BVMA 2CW0C 1PH4A 3I4MG 3RN5A 2SNSA 4X66Q 5J22A 4MHEA 1EYAA 3L7ZC 5IT9L 3PIO3 4A3GG 2TSSA 2HDMA 2F0VA 4XDXA 1PV4A 1JE4A 4JI4L 2F0DA 5C5MA 1M8AA 1VQLA 2HQLA 4MTKA 2A19A 4N9PA 3K58A 3S16B 1XNQQ 1CQVA 1PH5A 1KLGD 1O7YA 4LFCQ 4DU9A 2K5HA 5I9OA 1PFBA 4EQOA 2RSNA 4IPHA 1CK1A 4YWKA 3PMFA 2ES2A 3CF5A 2F4VQ 1S5ED 1UAPA 1RHPA 3FPPA 1F77A 5JJKA 3MTSA 2CQAA 4LAAA 5IGGA 3QOJA 1WTRA 4KTAA 5C3EB 4TSSA 4UY8C 2X69A 3D31A 1ICWA 4J6HA 4LF9Q 4A3JG 1P8LA 1CM9A 1SYEA 4PMWA 1L1OC 4DV7L 1XMQQ 3GO5A 1YZ6A 2E76C 5LL6S 1X3GA 3WDNA 4DA2A 2OTJA 4QF4A 1YEZA 3K0XA 3PO2H 2E5LQ 2VQFL 3TSSA 2A74C 1H9JA 4X65Q 1S3OA 1HR0L 2BH2A 4RHSA 1SNPA 3GDEA 4LF6Q 2WINB 5C44H 1W6JA 1VQ8A 1I6VC 3BZCA 5M3MG 4R8NA 1QWYA 4I7ZC 2E8GA 5K36G 4JG2A 2XTIA 2F0MA 1JQYD 1KRSA 3J81L 2WACA 1SBBB 1VCIA 4CBVA 3Q24A 2Q8IB 3J7YW 1RF2D 2E2IH 1B1ZA 2I0QA 4EQ5A 4JI6L 4RKBA 4A3FG 5CMDA 4QJFA 1D5MC 2A68D 3QB3A 1AP0A 2J7ZA 5IGDA 4P74A 5M3MH 1TWFH 3A5ZB 3BDOA 5I9PA 5JJZA 2L11A 3UDIA 1PXUA 2PMZB 3PUWA 5FOBB 2F0QA 5LL6X 4IOAA 1ZYRD 4OWWB 3PF5A 1E3PA 3FKIG 3M4QA 1YIJA 4A3FH 2EIFA 2Y0SE 2A6EC 2A6HC 1HQMC 3TS2A 4JK1C 4NMZA 2KEDA 2H1EA 2OCEA 1U4MA 5CC4A 4FXDA 1CKNA 2L0CA 4HIDA 4ZCKA 2CW0D 5I2YA 4JOIA 4G7HC 1QVCA 4BS9A 3HFZB 2PNHA 1VQIA 2Q8TA 3K57A 5C0XJ 2O2LD 4A75A 1WVLA 2ENBA 2MHVA 4BBRH 3PO2B 2B8FA 3I4LA 1DYQA 1XPOA 5G3LD 2B2WA 3TZUA 4BBSH 4ME5A 2RCNA 3HKZG 1B70B 1LTGD 2NN6G 1D1KA 4FO2A 4XQNA 1KDCA 1I4HA 3A7AB 3CMAA 1FJGQ 5C44B 1A3VA 4CGYB 4DR6Q 3S15H 2Q2TA 1JB7A 3ND9A 1VQOA 1A2UA 3K6OA 5CV8A 2EJFC 3RN2A 4JI7Q 3HOVH 2E2IB 1QCBD 3QG1A 1DM0B 4OIJA 4ZYSA 1EIHA 2NN6H 1LTID 4TKOB 2R6GA 3OWEB 4QMGA 1K8OA 5HGQA 1YJWA 2EY6A 1STYA 4IQZA 2N88A 4DNRB 1KNAA 5M3MB 4PNYA 5E7NA 4JI3Q 1TWFB 3QWNA 3A8KE 5A2QE 4K5XA 4X3SA 3C2PA 3NBHB 1DCZA 4HMIA 4QIWE 4DPGA 3P75A 1GD7A 4A3FB 1L0YB 1S5CD 2ZJRA 2FMCA 3GTLH 2UXDL 2PW7A 3T1HQ 4NW2A 1CFMA 1F9RA 1UE6A 2BDOA 3NXWA 2IL8A 1EZ8A 2YU9H 3ERSX 3PIPA 3QR8A 3J81j 1KIXA 1L1OA 3J7AF 3CQZH 1GHKA 1HNWQ 3KFUA 1ONLA 4LFAQ 1IBLL 2ICEC 1VS0A 5LMNQ 4DUYQ 1YJNA 1QJOA 1VQCA 2KCTA 5GADC 2KCNA 4BBSB 1KAAA 1V1PB 3EROA 3NTIA 1L2FA 1A2TA 1SE3A 2BE5C 4FXKC 4AYBG 1O80A 1TQOA 4L5SA 3ZJYC 2VS1A 1LTLA 3S15B 1VQGA 1FNWA 1MIUA 3PSIA 2K32A 4HN7A 1SMYC 4OO1G 3I70A 1ZEQX 2A6ED 1V43A 2KCCA 1WTHA 1X3FA 1N9WA 2A6HD 3HKZB 1BF4A 1HNZL 4B3MQ 3HOVB 4C3HH 5JEAJ 3D0FA 3SK8A 2PI2A 5JOBA 4KI0A 1A62A 1EQRA 2UUBL 1J5EL 1BBUA 4JI0Q 5AJ3L 4QQBX 3H6MA 3OTOQ 1PH2A 3X3MA 5D3DA 2E74C 3BZKA 1HUMA 5DM63 1DD2A 3EQLC 1XWEA 3CRKC 3GD7A 1K0RA 4BA1I 1OXTA 1HPCA 2FINB 5H1SE 1HFGA 3UDGA 3GTLB 4DUZL 3FHWA 1SLJA 1PTOC 5EAYA 4DR2L 4B08A 1XNQL 2YU9B 2KQ3A 2BCOA 2XN9C 2QF7A 5FK9C 4NKLA 1PA6A 4LFCL 3CQZB 2EYPA 3D3RA 2Z4IA 3VYTA 3AEVA 4I7AA 4JI4Q 1GHJA 2HHHL 2JYOA 2F4VL 1KD1C 2G5DA 1V1PA 4P71A 5IP7G 4LFBQ 4K5WA 1I4PA 3C1EA 1PMRA 1E2WA 1O7IA 5GAGC 1B2TA 1TS5A 1LTTD 2IT1A 4K5VA 2D0PA 5EPLA 1Y14B 5FLMG 5IGFA 1X54A 1N36Q 1NUCA 1GUTA 3CC7A 1DJRD 3TS0A 2EQSA 1VQPA 1FYCA 4H7BA 1SRUA 2F3WA 4F87A 5IP7H 2F0PA 3I55A 1QZGA 5NUCA 2HIXA 3N6RA 4RA8A 5ELNA 5FLMH 2EYMA 2YTYA 2Q2UA 1VQ9A 2JEBI 1B7YB 1CSQA 3AFPA 4C3HB 2E5LL 1K8GA 4YWLA 5C4ZA 2WIIB 1KAWA 3FDTA 2R93G 3P1HA 2EXDA 1EOTA 2C5CA 3ND8A 1ASZA 3BG3A 4LF6L 1FNVA 1I4XA 3NTHA 1SYFA 2ZTCA 2HD3A 2ZXPA 4ULLA 3M4PA 4L5TA
chains in the Genus database with same CATH topology
3U9SA 5EKIA 4I65A 4WFN3 3BYTB 4PMCA 2L4NA 1G6ZA 3DHQA 5D65A 2BE5D 2NZ1D 2K03A 1EY0A 2KECA 3CRLC 3SHLA 1Y8PB 3NTKA 3MXUA 1IL8A 1SMYD 3LWEA 1CHPD 1DZ1A 1H9MA 3URYA 4IFDJ 4G7OC 2Z1CA 1TIID 2Z4HA 3CHBD 2SOBA 3MEHA 3OMCA 2BOSA 1F2MA 1KNEA 1LLRD 5BN4A 4ZUIA 2EY1A 4KKTA 3SK6A 1G91A 2F3VA 1PTOD 5E4XA 5C0XH 2NTSA 2SEBD 1WTQA 5JAVA 3V96A 4ZKBB 1G2TA 1VDZA 2JEAI 1A15A 5KRUA 3KUPA 2R93B 4TRDA 2AUJD 2XRSD 1F2LA 2KA7A 4C56C 2QCPX 1UNSA 2XRQD 2NVYB 4DNTB 4IURA 2IJ0A 1S5DD 1ENFA 3R3OA 2F0FA 1SYDA 3N52A 1SE4A 3L3OC 1EQVA 1SE2A 4K2LA 1CI3M 3I73A 4FF1A 1XTCD 1IKLA 2OF1A 2VUMB 2IX0A 5CR3A 4EQNA 2KJXA 3SEBA 3PV0A 1MSHA 2JA5B 1Y1VB 1ENCA 1V1OA 1PLFA 2B8GA 3SR1A 4U673 2WP8J 3CU7A 4QUCA 1H9KA 1IYVA 1BOSA 3IFTA 1QG7A 3G7LA 3LWUA 3A8IE 5FO8B 1DONA 2ZXRA 1Q8IA 4Q5VA 5M5XB 1STGA 3VA7A 2F0SA 5EJWA 1L0XB 3VYSA 1Z7TA 4ZKCB 4KV6A 2K33A 4J1MA 5JEAG 3K5MA 3MVVA 3CKIB 2LFNA 5FLXL 4FP5D 1HA5A 5DEHA 1FD7D 3NSWA 2F1MA 3D6WA 5KNDA 4CJ1B 4G4KA 1WTOA 1D5XC 5AFWA 5JEAH 1TT2A 2K1BA 4A3MB 1EWHA 4U68A 1WTXA 1SNCA 2MPMA 1VMPA 2AQ2B 4LK1C 1X32A 2E2DC 3BS1A 1EY4A 1GUSA 2AWOA 2TMPA 5CV7A 4QUFA 4KD4A 2ZT9C 3KLSX 3PO3B 3K5NA 1Q3LA 1E2ZA 4FF4A 4LMQD 3S1NB 1STAA 3OIQA 3ZYYX 2PO4A 5C4JB 4KMUC 2E2JB 2HCCA 2N55A 3BZDB 1RCVD 3Q6SA 3P20A 3C1FA 3LNNA 2MJ8A 1LTAD 1I4QA 3GP7A 3DUZA 2K05A 4XQQA 1I6HB 2B39A 1NCVA 3X3NA 2D2CC 1EY8A 4GZYC 2EYLA 4G7ZC 2OXPA 1H9SB 1JCKB 5EKLA 4A3BB 1PDQA 3M7NA 1A3UA 4DGZA 4KHVA 3PUXA 5I6WA 5A35A 5IGEA 3TMEA 4L6TB 1H9RA 1FGBD 2HCIA 4DK1A 1SDFA 4CKEA 2OT2A 4EVOA 2EOTA 4RAUC 5E3FA 2R7ZB 4A3EB 2VB2X 2RDGA 2R3ZA 4V0BA 4BY1B 1U9RA 4P2CB 3I90A 1B53A 3IKJA 4KKSA 4K8IA 5CGKA 2X6GA 2MGSA 4IFDG 2RKSA 1OXXK 3I4MB 1B44D 4CKCA 1PYWD 1TKWB 3R93A 3WOEA 5K36H 2KEEA 1RTNA 4A3GB 1WTVA 5T1GA 2XWJB 1I4RA 1GUGA 4K6LA 3KBXA 4IFDH 3M4YA 3GV3A 5J39A 1PZID 4KN7C 3PIP3 1IKMA 1G8ZD 1CZGA 3TP6A 1ILQA 5EKKA 1JOQA 3SE0A 3W3AA 3JAML 1HQRD 2QKIC 4F8MA 3RZDB 1ML0D 3H94A 4A3JB 1DOLA 2F0HA 1EIGA 1ZXTA 1JC7A 2RQXA 1J8IA 3E0JA 2O5JC 3NQIA 5FO9B 4A3IB 3KK7A 4B9WA 2F0UA 3M4OB 4M8AA 3R8BA 3T16A 1HXYD 2F0GA 1XXGA 5CORA 1QB5D 3T51B 3H0GB 4UAIA 1B4OA 3TBIB 3L9AX 3UI2A 5J1ZA 1TS4A 4ZAIA 3K0YA 1I3QB 1CQFA 3KLSA 4X3KA 5ELFA 1WCMB 3D4RA 3TP8A 1PRTF 4LJZC 3S2DB 4TQUS 3NE5B 1JB3A 2EJGC 1K8MA 2EYFA 2K5QA 1PRTB 4B9XA 3S9WA 2SNMA 4ID6A 4NDXA 1ET9A 4OIKA 1DOKA 3FKIB 3DXJC 3KLRA 4XIGS 4KY5A 2EYHA 1B50A 2NYZD 3MZ5A 1YNNC 2F0JA 2A69C 1LV9A 1T5XD 3H91A 2E75C 3DMUA 4X3UA 2L9HA 2NWGA 1UEAB 3OMGA 3IL8A 4CJ0B 5K5PA 5T1IA 2LKVA 3S1MB 1CA6A 4HCEA 3NBHA 3V05A 1U4LA 3O13A 4H0LC 2EYJA 1S4ZA 3HOWB 2FMMA 1X3PA 2DNCA 2HUGA 5CYUA 4OGQC 4OO1H 3BVGA 3TP7A 1B9MA 3AB9A 4CKBA 2VNUD 4S3SA 4FF3A 1A6XA 2AUKA 1K83B 1TY0A 3VR2A 1G2SA 3EFXD 4BY7B 1OXUA 1TWAB 4DAPA 1TVXA 2A73B 1LT4D 2G9HD 1WD1A 1O7LA 2AQ1B 3GTOB 3FEWX 1EQTA 5CV5A 5I6YA 2XVSA 1F2YA 3W2DA 5D3IB 4OL7A 1Q1BA 1J9OA 2PQEA 4HEDA 2EE1A 1XYIA 5HGTA 2MUYA 3MA2B 3K5OA 1ESRA 3M85A 2AQ3B 1AN8A 1GUNA 3K5LA 4BA2I 1F2ZA 3I91A 4AYBB 4ABNA 1W6KA 1WTPA 1HHVA 4EQPA 2B2TA 5EQ0A 4C3IG 3NQTA 4M1UB 4RWSC 4DK0A 4RGOS 3GTPB 2F0OA 2E2HB 5C4XB 1TWGB 1U4RA 2FJ2A 4C1NI 1M4VA 1PZKD 3R2IA 4HCSA 3RMHA 5I4DA 1YNND 1VF5C 3GTQB 2A69D 5IOCA 2EYOA 4RCNA 2JE6I 3T13A 1HA6A 4FXGC 1QOHA 5LHY1 5DNFA 1EY6A 5FO7B 2PNRC 4ZLTF 2WB1B 1GUOA 3VR3A 1B3AA 4HSPA 2NTTA 1QNUA 2EZVA 4L8JA 1Z47A 3BDCA 4R9WA 3HEJA 2WAQB 2O4XA 5EPKA 3LX0A 1YNJC 1TU2B 3S2HB 2WKDA 4FNFA 3EJIA 5IIFA 1Y1WB 2Z8LA 1Q12A 2JXMB 4ZRZA 5A2QL 3NUCA 1QNKA 2G9DA 5E1FA 1SNQA 1D2BA 1MD2D 4IUNA 1SYGA 2D9UA 3ONAB 1Q1EA 4KJOA 4QB4A 3J7AV 4RGNA 3T4AC 2RSOA 2K28A 3DWAA 1JICA 4IZ8A 5C3XA 2B2VC 1SYCA 3C46A 4WJWA 1VF7A 2DY8A 4HAEA 3C3LA 1RJTA 4KY7A 4H44C 4CHTB 2IW3A 3I72A 2EXZA 1D1IA 2J4XA 3ITPA 1O7ZA 2SDFA 2IPKD 1BCPF 3WOFA 4F88A 2B2UC 4A3DB 1SYBA 1BCPB 1NR4A 3I3CA 1LT6D 1I4GA 2AWNA 3S14B 1DOMA 1HTLD 1CHQD 4RGMA 3HGBA 1R4PB 1B9NA 3RLFA 2OEOA 3OSOA 3RUZA 2PZTA 4Y7NB 2CHBD 1MSGA 3SDZA 1CT1D 2MP1A 2F0LA 2V4DA 3MFGA 4K2KA 4A3KB 3GQBA 5EPJA 3SK5A 3PUYA 2F0NA 2NVQB 3VR5A 1UUPA 1PZJD 4O1NA 3HOUB 2HDLA 1ET6A 1EEID 4MN3A 1IYUA 1IHZA 1RD9D 5I2XA 5IGCA 1VMCA 5CV4A 3S17B 1RDPD 2F0WA 1EZ6A 5EBDA 3HZXA 1G291 1BXTA 2VXWA 1E0BA 3RD4A 4KKUA 1YNJD 3D8GA 2QEJC 2LS01 3SXHA 5C4HA 2PPBC 3RZOB 4J8QA 2R61A 2NB0A 3GTJB 3QJYA 5KGUA 5KIXA 1EFID 4RGTA 5IODA 1KDBA 2CVRA 4RCOA 4RFBA 1WTWA 2IWHA 4G57A 1LTBD 3T53B 2F0EA 2D62A 4DFAA 4XYQA 2HQEA 1EY5A 5KYIA 2RDHA 1SJED 1LTSD 4DXGA 5M3FB 1GOZA 3D4DA 5JPMC 4HR7B 1E2VA 2LMCB 3NWSA 1BNZA 2FHTA 3A54A 3IAYA 2B2VA 5IGBA 1C48A 1BQQT 5F2DA 1Q90A 2F4IA 4F7XA 3EVQA 1Y8OB 1F9SA 2DNEA 3E6ZX 2F0TA 4N9TA 1EY7A 2X6LA 1AZQA 2B2UA 3ERQA 2EY5A 1NR2A 4A93B 2PZWA 3SK4A 4X3TA 2PYKA 2F0IA 1C8CA 4IUTA 1EWCA 1TS3A 2F0KA 2K7VA 5ISRA 2BA0A 1WD0A 2NUCA 2XWBB 3K7AB 3TN2A 3VYUA 4PV1C 4KK7A 1TY2A 2B2YC 4ZUJA 2K01A 5JVG3 1H9SA 2VB3X 2A5HA 1PRTC 5G3LF 5BN3A 1I50B 3TZDA 4YIJA 4ILWA 3HS0C 3A8JE 3DWPA 4K6DA 3J80E 1AW7A 3MXGA 5ELDA 5C0XI 3OW7A 1EYCA 3M7GA 2B63B 4Q0FA 1JWMD 4FYDA 1ZKOA 5ELCA 2M2LA 1BDOA 3OHXC 1SEBD 1HTPA 5KNBA 2KHSA 1STEA 5COYA 5FKAC 2DN8A 4C3JG 3V2TA 2XNAC 1C4QA 3QOLA 3MWYW 4DXFA 2R92B 2BA1A 1IW7C 3HOYB 1R9TB 5M9OA 4DAVA 2PCFB 4V190 3A55A 4XXEA 5KNCA 3TDQA 4BWGB 1F9QA 4H13C 2FFKB 1EU3A 3SVMA 4IUUA 2PZUA 5C6AA 3KF8A 2K5DA 2B2TC 2IX1A 4E6IA 1STBA 5KEEA 4CJ2C 3NPPA 4UDUC 4C2MB 1II3A 1CZWA 4WORA 1OXSC 1EEFD 1RTOA 2NBFA 1JWSD 3OIPA 1OO9B 5E4WC 1EL0A 1FR3A 3R2TA 3D4WA 5CV6A 2NVTB 1SNMA 1EU4A 3F2UA 1HFNA 3VR4A 4KJNA 1PFNA 2WV6D 4MIUA 2WKCA 5EBCA 2F03A 3S1RB 4KN4C 3MXNA 3FMCA 1O78A 3Q0AA 3Q22A 4BBRB 4O42A 3I8ZA 1PRTD 3EA6A 4DF7A 4C3JB 4XT1B 4C3HG 2Q8RE 5ELBA 2M9VA 4PQXA 2ICIA 3MAQA 3A56A 3PUVA 1SAPA 1LT5D 2KVMA 4FVMA 1LTRD 3K59A 2B2YA 1Y8NB 2RA4A 1TS2A 5TSSA 3KBGA 3BYYB 4IUVA 2L12A 1FNUA 1LO5D 1JORA 4KY6A 2JA8B 2EJMA 5ELEA 5HURA 1DXMA 1LT3D 3OPOA 5FLXE 2RBMA 1BUVT 1IW7D 2IX3A 2JSOA 5JPNC 5CBAE 2EY2A 1AZPA 3MFYA 4RH6A 1LABA 3QO2A 1MGSA 1RODA 4HSVA 5BN5A 4EGVA 1PTOH 4IN3A 2D5DA 1BR9A 2RDFA 5D14A 4K8JA 1QILA 4XYOA 3MXPA 3IFDA 1OXVA 3DEOA 1AEXA 5IT9E 1U4PA 5M5WB 1SNDA 1MI2A 4K14A 3AMUA 2XIWA 1SJHD 2EVBA 1RKNA 4R8IA 1TR5A 4FF2A 3OWFA 4KD3A 1TWCB 4Z9CB 2Y0SB 1GUWA 4IUQA 1EYDA 3DEPA 1Y69U 1KDAA 4L63B 1JR0D 1KABA 1ENAA 2K04A 3HOXB 3J80L 2H4OA 1SSOA 4IFDI 1PTOF 1LACA 3AU7A 2I07B 1BCPC 1SFOB 3HP3A 1PTOB 1ILPA 5C3WA 1XX8A 3D6CA 3GTMB 2LY7A 3QIAA 2DY7A 1EY9A 2JP1A 1PFMA 2YYZA 2L5TA 1HCZA 1AFPA 5C5LA 1JOOA 3J81E 2NVXB 3VA5A 4DAYA 2ZXOA 3HRZC 3FPUB 3I4NB 1CA5A 4HMJA 4ZK9B 3G6JB 5C0XG 2K6AA 1A3TA 2I46A 1KLUD 2K5WA 4QIWB 5JVH3 3A7LA 4JBWA 2L55A 1R4QB 3H09A 3P7JA 2NN6I 4XTCS 5KYLA 3VYRA 3TP5A 2J0TD 3HOZB 2RVLA 4C3IB 3M3YB 1NAPA 1STNA 3MC0B 5EGTA 2JA6B 3U9OA 1Z6HA 3GV6A 4ZQ3A 3JAME 2EDGA 5CV9A 3BDLA 1D5ZC 3HG9A 4RHRA 2O5IC 5M5YB 3PUZA 3H3VC 1HUNA 3BVZA 3NBIA 4PMBA 1F9PA 1HRJA 2KUMA 2JA7B 4WRDA 1KTKA 2QILA 3FRPB 2XSCA 2GA4B 1D6EC 3Q23A 3OOCA 2L1BA 4C1NK 3GTGB 3S1QB 4KHZA 1TWHB 2EPBA 4RKLA 3GTKB 1JOKA 1V8QA 4HTHA 4XT3B 5DAUA 1QE6A 2PW5A 2QDBA 1BCPD 3E5SA 4DN4M 1GXDC 1X3QA 2BDNA 3DWQA 2C9OA 4IALA 3NHHA 4OO1I 1BBXC 1SNOA 4QCLA 3NK9A 1STHA 2A68C 5DM73 2ID0A 1S5BD 2KOLA 3FVQA 1JWUD 3DM1A 4NP5A 5CBEE 1ZYRC 2M00A 4ODGA 3VR6A 1ESFA 1S5FD 1BO0A 4IUPA 1GJXA 4XQJA 2B2WC 3NWTA 4OHJA 3MHBA 1MBYA 3T56B 1T5EA 1SXTA 1NSNS 3NP8A 1CTMA 3BVMA 2CW0C 2SNSA 5J22A 4MHEA 1EYAA 3L7ZC 5IT9L 3PIO3 2TSSA 2HDMA 2F0VA 4XDXA 1JE4A 2F0DA 5C5MA 1M8AA 4N9PA 3K58A 3S16B 1CQVA 1KLGD 1O7YA 4DU9A 5I9OA 1PFBA 4EQOA 2RSNA 1CK1A 3PMFA 1S5ED 1UAPA 1RHPA 3FPPA 1F77A 3MTSA 2CQAA 4LAAA 5IGGA 3QOJA 1WTRA 4KTAA 5C3EB 4TSSA 2X69A 3D31A 1ICWA 4J6HA 1CM9A 1SYEA 4PMWA 3GO5A 5LL6S 2E76C 3WDNA 4DA2A 4QF4A 3TSSA 2A74C 1H9JA 4RHSA 1SNPA 2WINB 1W6JA 1I6VC 4R8NA 1QWYA 4I7ZC 5K36G 2F0MA 1JQYD 3J81L 2WACA 1SBBB 1VCIA 4CBVA 3Q24A 2Q8IB 3J7YW 1RF2D 1B1ZA 4RKBA 5CMDA 1D5MC 2A68D 3QB3A 1AP0A 2J7ZA 5IGDA 3BDOA 5I9PA 5JJZA 2L11A 1PXUA 5FOBB 2PMZB 3PUWA 2F0QA 5LL6X 1ZYRD 2A6EC 2A6HC 1HQMC 4JK1C 4NMZA 2KEDA 2H1EA 1U4MA 5CC4A 4FXDA 2L0CA 2CW0D 5I2YA 4G7HC 4BS9A 2Q8TA 3K57A 5C0XJ 2O2LD 1WVLA 2ENBA 2MHVA 3PO2B 2B8FA 3I4LA 1DYQA 5G3LD 2B2WA 3TZUA 4ME5A 1LTGD 2NN6G 1D1KA 4FO2A 4XQNA 1KDCA 1I4HA 3A7AB 5C44B 1A3VA 4CGYB 3ND9A 1A2UA 3K6OA 5CV8A 2EJFC 2E2IB 1QCBD 3QG1A 1DM0B 4OIJA 4ZYSA 1EIHA 2NN6H 1LTID 4TKOB 2R6GA 3OWEB 4QMGA 1K8OA 2EY6A 1STYA 4IQZA 2N88A 4DNRB 1KNAA 5M3MB 4PNYA 1TWFB 3QWNA 3A8KE 5A2QE 4K5XA 4X3SA 3C2PA 1DCZA 4HMIA 3P75A 4A3FB 1L0YB 1S5CD 2FMCA 2PW7A 4NW2A 1CFMA 1F9RA 2BDOA 3NXWA 2IL8A 1EZ8A 3J7AF 1GHKA 1ONLA 2ICEC 1QJOA 2KCNA 4BBSB 1KAAA 1V1PB 3EROA 3NTIA 1A2TA 1SE3A 2BE5C 4FXKC 1O80A 1TQOA 3S15B 1FNWA 2K32A 4HN7A 1SMYC 4OO1G 3I70A 1ZEQX 2A6ED 1V43A 2KCCA 3HKZB 2A6HD 3HOVB 1BF4A 5JEAJ 3SK8A 5JOBA 4KI0A 3H6MA 3X3MA 5D3DA 2E74C 1HUMA 5DM63 1DD2A 3EQLC 1XWEA 3CRKC 3GD7A 4BA1I 1OXTA 1HPCA 2FINB 1HFGA 3GTLB 1PTOC 4B08A 2YU9B 2KQ3A 2BCOA 2XN9C 2QF7A 5FK9C 4NKLA 3CQZB 2EYPA 3D3RA 2Z4IA 3VYTA 1GHJA 2JYOA 1V1PA 4K5WA 1I4PA 3C1EA 1PMRA 1E2WA 1B2TA 1TS5A 1LTTD 2IT1A 4K5VA 5EPLA 5IGFA 1NUCA 1GUTA 1DJRD 1FYCA 4H7BA 2F3WA 4F87A 2F0PA 5NUCA 3N6RA 4RA8A 2EYMA 2JEBI 4C3HB 5C4ZA 2WIIB 3FDTA 3P1HA 1EOTA 2C5CA 3ND8A 3BG3A 1FNVA 1I4XA 3NTHA 1SYFA 2ZXPA 4ULLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PZW A;  3R3O A;  2F0F A;  4KTA A;  3SK4 A;  1STA A;  2ENB A;  1SYD A;  2F0W A;  1EZ6 A;  1EY9 A;  4I65 A;  2EY2 A;  4KY5 A;  2PYK A;  2F0I A;  1II3 A;  3HZX A;  3NUC A;  4WOR A;  4RKL A;  2EYH A;  1EQV A;  4K2L A;  5E1F A;  4ME5 A;  1SNQ A;  5JOB A;  3SK8 A;  5J39 A;  4PMC A;  1JOK A;  4J6H A;  2F0K A;  4HTH A;  4IUN A;  1F2Z A;  1SYG A;  3DHQ A;  5DAU A;  5C5L A;  5ISR A;  3MZ5 A;  1JOO A;  2OF1 A;  2PW5 A;  2F0J A;  3VA5 A;  1KDC A;  1SYE A;  4KJO A;  3D8G A;  5CR3 A;  2QDB A;  4QB4 A;  3E5S A;  1A3V A;  4EQN A;  3DMU A;  3C1F A;  3H6M A;  4HMJ A;  4EQP A;  2NUC A;  3SXH A;  5C4H A;  2RDF A;  3TP6 A;  1EY0 A;  5EKK A;  4K8J A;  1A3T A;  5C3X A;  4IZ8 A;  3OMG A;  3NQT A;  1A2U A;  3NHH A;  4IAL A;  1SYC A;  1ENC A;  4QF4 A;  5CV8 A;  4ZUJ A;  5K5P A;  5KGU A;  1JOQ A;  5KIX A;  3MXP A;  2F0O A;  1SNO A;  2LKV A;  3D4W A;  1KDB A;  5IOD A;  5CV6 A;  4F8M A;  4KY7 A;  3SR1 A;  1AEX A;  3NK9 A;  1STH A;  1SNM A;  4QMG A;  1EY8 A;  2EY6 A;  2F0H A;  1STY A;  4YIJ A;  5KYL A;  2EYL A;  1SND A;  2EXZ A;  2OXP A;  1SNP A;  3ITP A;  4KJN A;  4PNY A;  2KQ3 A;  4K6D A;  2EYJ A;  4G57 A;  5EKL A;  5IOC A;  3TP5 A;  4K14 A;  4K5X A;  2EYO A;  4NKL A;  1STG A;  1SYB A;  1A3U A;  2F0E A;  4MIU A;  2EYP A;  2F0S A;  4KHV A;  4NP5 A;  4R8N A;  4DGZ A;  1EYC A;  2F0M A;  1RKN A;  4HMI A;  2SOB A;  3MEH A;  3T13 A;  5I6W A;  3OMC A;  3TME A;  5IGE A;  4B9W A;  4DFA A;  2M00 A;  2F0U A;  1F2M A;  2WAC A;  4ODG A;  1STN A;  2HQE A;  3P75 A;  4K5W A;  4ZUI A;  3TP7 A;  1TR5 A;  1EY5 A;  4KV6 A;  3C1E A;  5KYI A;  5EGT A;  4J1M A;  2EY1 A;  3T16 A;  3OWF A;  2F0G A;  4KD3 A;  4RKB A;  3SK6 A;  2PW7 A;  4K5V A;  3MVV A;  3MHB A;  5IGF A;  4S3S A;  3U9O A;  1EY6 A;  1EYD A;  1NSN S;  1NUC A;  2F3V A;  2KHS A;  3NP8 A;  3NXW A;  3QB3 A;  4DF7 A;  1EZ8 A;  3D4D A;  5IGD A;  1KDA A;  5DEH A;  2OEO A;  4ZQ3 A;  4EVO A;  3S9W A;  2SNS A;  3OSO A;  5I9P A;  5J22 A;  5J1Z A;  2PZT A;  3RUZ A;  5CV9 A;  1KAB A;  5E3F A;  1EYA A;  1ENA A;  3BDL A;  4H7B A;  3V2T A;  3SHL A;  2F3W A;  3QOL A;  2F0P A;  2F0Q A;  2F0L A;  1U9R A;  1TT2 A;  2F0V A;  3BDC A;  5NUC A;  5JAV A;  5M9O A;  5IGB A;  2F0D A;  2EYM A;  4K2K A;  5C5M A;  3HEJ A;  1SNC A;  5F2D A;  2O4X A;  3SK5 A;  4K8I A;  4PMB A;  5CV5 A;  3TP8 A;  4N9P A;  2F0N A;  5I6Y A;  4NMZ A;  5CGK A;  1F2Y A;  4WRD A;  4F7X A;  3LX0 A;  3EVQ A;  1KAA A;  5CC4 A;  4OL7 A;  5KRU A;  3ERO A;  2RKS A;  5C4Z A;  1A2T A;  2PQE A;  4TRD A;  1JOR A;  4DU9 A;  1EY4 A;  2EYF A;  2F0T A;  4KY6 A;  3P1H A;  4N9T A;  1EY7 A;  5I9O A;  2PZU A;  4B9X A;  5C6A A;  5CV7 A;  2SNM A;  3EJI A;  4ID6 A;  4NDX A;  1TQO A;  4EQO A;  3PMF A;  4KD4 A;  5HUR A;  5IIF A;  1IHZ A;  5HGT A;  5IGC A;  3ERQ A;  1SYF A;  5C3W A;  5CV4 A;  2RBM A;  2EY5 A;  3D6C A;  4E6I A;  1STB A;  4LAA A;  5IGG A;  5KEE A;  3QOJ A; 
#chains in the Genus database with same CATH topology
 4LW1 A;  3U9S A;  5EKI A;  4I65 A;  3PCO B;  4WFN 3;  2N78 A;  3BYT B;  2ZTE A;  1HR0 Q;  4PMC A;  2L4N A;  2R93 H;  1G6Z A;  1SN8 A;  3DHQ A;  4A76 A;  5D65 A;  2BE5 D;  2NZ1 D;  1X3E A;  2VUM G;  2K03 A;  4R4Q A;  2NVY H;  1EY0 A;  2KEC A;  3CRL C;  4R1J A;  3SHL A;  1WFQ A;  4JI6 Q;  1Y8P B;  3NTK A;  3MXU A;  1IL8 A;  1SMY D;  3KJO A;  3LWE A;  4HJ9 A;  1CHP D;  1DZ1 A;  1H9M A;  3URY A;  4J15 A;  2VUM H;  1T9H A;  3HKS A;  4IFD J;  4G7O C;  2Z1C A;  1TII D;  1LYL A;  2JA5 H;  2Z4H A;  3CHB D;  2SOB A;  3MEH A;  1Y1V H;  3OMC A;  2BOS A;  4LNQ A;  1F2M A;  1KNE A;  1LLR D;  5BN4 A;  4ZUI A;  1HR0 W;  2EY1 A;  4KKT A;  3SK6 A;  4QL5 A;  1G91 A;  2F3V A;  5IYD G;  1PTO D;  5BR8 L;  5E4X A;  4DV4 L;  1UE1 A;  4GN5 A;  5M5X H;  5C0X H;  3CCM A;  2AMC B;  5LMU L;  2NTS A;  3L2P A;  3J80 c;  2BH8 A;  2SEB D;  4JI5 L;  1WTQ A;  3CCR A;  4LF5 Q;  5JAV A;  3V96 A;  3KYH C;  4ZKB B;  1G2T A;  5IYD H;  1VDZ A;  1PHJ A;  4JI7 L;  2UXB L;  2JEA I;  1A15 A;  4B3R Q;  1EQQ A;  1CSP A;  5KRU A;  3KUP A;  2A8V A;  2R93 B;  3AYH B;  3RNU A;  4TRD A;  2AUJ D;  2XRS D;  2YTV A;  1F2L A;  2MNA A;  2KA7 A;  1K3B C;  4C56 C;  2R7D A;  2QCP X;  3TRZ A;  1UNS A;  1LUZ A;  2XRQ D;  1HNX Q;  2NVY B;  4DNT B;  4Y52 H;  4IUR A;  4A3M H;  2IJ0 A;  1S5D D;  1ENF A;  3R3O A;  2F0F A;  3U4V A;  1SYD A;  3N52 A;  1SE4 A;  2NZO A;  3L3O C;  3CME A;  3CAM A;  2Z6B A;  1U0L A;  1EQV A;  1SE2 A;  4K2L A;  1CI3 M;  3I73 A;  3T1H L;  4FF1 A;  1XTC D;  1IKL A;  2OF1 A;  2VUM B;  2IX0 A;  5CR3 A;  4EQN A;  4OEL B;  2KJX A;  3SEB A;  3IRB A;  3PV0 A;  1MSH A;  2JA5 B;  3PO3 H;  1Y1V B;  3S1N H;  1VQE A;  1ENC A;  3PF4 A;  1AE3 A;  1V1O A;  4YHH L;  1PLF A;  4LFA L;  5C4J H;  2E2J H;  1YVC A;  5IE8 A;  2B8G A;  3SR1 A;  4U67 3;  5GQO A;  2WP8 J;  3CU7 A;  5LMN L;  4QUC A;  1H9K A;  4DUY L;  1IYV A;  2KHJ A;  1BOS A;  3IFT A;  1QG7 A;  1X6O A;  2K5V A;  5M3F G;  3G7L A;  3LWU A;  3A8I E;  2FXQ A;  5FO8 B;  1DON A;  2ZXR A;  1Q8I A;  4Q5V A;  5M5X B;  1AE2 A;  1PH3 A;  2V1C C;  4PZ7 A;  1STG A;  3VA7 A;  1N32 L;  2KHI A;  2F0S A;  3CC4 A;  3ICE A;  2AHO B;  4A3B G;  1IBL Q;  5EJW A;  1L0X B;  3VYS A;  1Z7T A;  2C35 B;  4ZKC B;  4KV6 A;  1I6H H;  2K33 A;  1IL2 A;  4J1M A;  5JEA G;  1YJ9 A;  3K5M A;  3MVV A;  3CKI B;  1FL0 A;  2LFN A;  3AQQ A;  5FLX L;  1WYD A;  2DUD A;  4DR4 Q;  3F1Z A;  1K3R A;  4B3M L;  1Q81 C;  5HY6 A;  4FP5 D;  1KC8 C;  1HA5 A;  5DEH A;  1FD7 D;  3NSW A;  1VQM A;  2F1M A;  4A3B H;  3D6W A;  5KND A;  1YIT A;  4CJ1 B;  4G4K A;  1Q8K A;  2R7Z G;  4GN3 B;  1WTO A;  2MFI A;  1D5X C;  5AFW A;  5JEA H;  1TT2 A;  2K1B A;  4JI1 L;  4A3M B;  1EWH A;  4BY1 G;  4U68 A;  3SGI A;  1HNZ Q;  1WTX A;  1SNC A;  2MPM A;  1VMP A;  2CWA A;  2AQ2 B;  3DLL A;  4LK1 C;  4A3L G;  1X32 A;  2IY5 B;  2E2D C;  3BS1 A;  1EY4 A;  1GUS A;  5L37 A;  2R7Z H;  4A3E H;  2AWO A;  2TMP A;  5CV7 A;  4QUF A;  4KD4 A;  2ZT9 C;  5GAE C;  1QVG A;  4BY1 H;  3KLS X;  1W2B A;  3PO3 B;  3K5N A;  1Q3L A;  1E2Z A;  4FF4 A;  4LMQ D;  3S1N B;  1STA A;  3OIQ A;  4DUZ Q;  1YHA A;  3ZYY X;  2PO4 A;  4QY7 A;  5C4J B;  4KMU C;  4LFB L;  2E2J B;  4DR2 Q;  4JW0 A;  4OEM B;  2HCC A;  2N55 A;  3I4M H;  3BZD B;  1PH1 A;  1RCV D;  3Q6S A;  3P20 A;  1SRO A;  1N36 L;  1KQS A;  4A3G H;  3C1F A;  4GOP B;  3J80 i;  3LNN A;  2HHH Q;  4UPA A;  2MJ8 A;  1LTA D;  1I4Q A;  3GP7 A;  2DJG C;  3DUZ A;  3HKZ E;  3VDY A;  2K05 A;  2PQA A;  4XQQ A;  1I6H B;  2Q2I A;  2B39 A;  3NEN A;  4TVA B;  1NCV A;  3X3N A;  2D2C C;  2Z6K C;  1EY8 A;  4GZY C;  3W1G A;  2EYL A;  5FJ8 G;  2OXP A;  4G7Z C;  1H9S B;  4WJ4 A;  1JCK B;  5EKL A;  3CP0 A;  4A3B B;  1D7Q A;  1PDQ A;  3M7N A;  1A3U A;  4DGZ A;  4KHV A;  3PUX A;  4LUO A;  5I6W A;  5A35 A;  5IGE A;  3TME A;  3CPF A;  4L6T B;  1NTG A;  1H9R A;  3HOY G;  4A3I G;  1GM5 A;  1FGB D;  2GVB A;  2HCI A;  4DK1 A;  3RZD H;  1C7Y A;  2IHF A;  1SDF A;  4A3J H;  4CKE A;  3H0G G;  2CH4 W;  4IOC A;  4MTN A;  2OT2 A;  5IT9 c;  4EVO A;  3CCS A;  2EOT A;  4RAU C;  5E3F A;  2R7Z B;  4A3E B;  1HZB A;  1YHB A;  2VB2 X;  2RDG A;  2R3Z A;  4V0B A;  4A3I H;  3H15 A;  4BY1 B;  1U9R A;  3M4O H;  4P2C B;  3I90 A;  1YHQ A;  1B53 A;  3IKJ A;  4KKS A;  4K8I A;  3H0G H;  4P75 A;  5CGK A;  1WCM G;  1YBY A;  2X6G A;  4NB3 A;  2MGS A;  4IFD G;  2R7F A;  1OXX K;  2RKS A;  3E9I A;  3I4M B;  1B44 D;  4CKC A;  1PYW D;  1TKW B;  3R93 A;  3WOE A;  5K36 H;  2KEE A;  1RTN A;  1K0S A;  2OQ0 A;  4A3G B;  4JI8 Q;  1I3Q H;  4HIK A;  1WTV A;  3EIV A;  1HZ9 A;  5T1G A;  2XWJ B;  4CDF C;  1I4R A;  3KF8 B;  1CUK A;  1GUG A;  1WCM H;  4JBJ A;  4K6L A;  3I2Z A;  4AYB E;  3KBX A;  4IFD H;  3M4Y A;  3GV3 A;  1D8L A;  4MNO A;  5J39 A;  3CXC A;  3S2D H;  1PZI D;  2CQO A;  1CKO A;  3G48 A;  4YCV A;  3NEM A;  4KN7 C;  3PIP 3;  1IKM A;  1G8Z D;  1CZG A;  3TP6 A;  3FKI H;  1ILQ A;  5EKK A;  4HIO A;  3M9B A;  1KXL A;  1IBK L;  1JOQ A;  3SE0 A;  1J6Q A;  3W3A A;  3JAM L;  4LF5 L;  1HQR D;  2QKI C;  4F8M A;  3RZD B;  1ML0 D;  3H94 A;  5IP9 G;  5BR8 Q;  4DV4 Q;  4A3J B;  1DOL A;  2F0H A;  1EIG A;  1JT8 A;  4B3R L;  1ZXT A;  1JC7 A;  5LMU Q;  2RQX A;  1J8I A;  4JI5 Q;  1UE7 A;  3E0J A;  2O5J C;  3NQI A;  3HOW G;  4OWX B;  5FO9 B;  4MZ9 A;  4A3I B;  3KK7 A;  1L0W A;  4B9W A;  1BKB A;  2F0U A;  3M4O B;  4M8A A;  1E24 A;  4UP9 A;  4JV5 Q;  4DV3 Q;  1HNX L;  3R8B A;  5IP9 H;  3T16 A;  3S1M H;  2UXB Q;  1HXY D;  2F0G A;  1XXG A;  1MHW C;  1XTD A;  5COR A;  4LF8 L;  1QB5 D;  3T51 B;  3MXN B;  3A74 A;  3H0G B;  4UAI A;  1B4O A;  3H3V I;  1GKH A;  3TBI B;  3L9A X;  3UI2 A;  1XJV A;  1ICF B;  3OW2 A;  5J1Z A;  3HOW H;  4DR1 Q;  2JA8 G;  3F8T A;  3CCV A;  1TS4 A;  4ZAI A;  3K0Y A;  1JMC A;  1I3Q B;  1CQF A;  3KLS A;  4BY7 G;  4X3K A;  5ELF A;  2I5H A;  1WCM B;  3D4R A;  1VQ6 A;  3TP8 A;  1PRT F;  4LJZ C;  1VQH A;  3S2D B;  4TQU S;  1I94 Q;  3NE5 B;  2Z6K A;  1JB3 A;  2EJG C;  4GLA C;  1K83 H;  1K8M A;  2EYF A;  3Q8D A;  4CDD C;  2K5Q A;  1PRT B;  4B9X A;  3S9W A;  1B8A A;  2SNM A;  4ID6 A;  4NDX A;  3E0E A;  4BY7 H;  1ET9 A;  4OIK A;  1DOK A;  1TWA H;  3FKI B;  4YHH Q;  3DXJ C;  3KLR A;  4XIG S;  4KY5 A;  3GTO H;  1WOC A;  2EYH A;  4LWC A;  3CD6 A;  1B50 A;  2NYZ D;  3MZ5 A;  1YNN C;  3LGJ A;  4DR4 L;  2F0J A;  3RLN A;  1XPR A;  1N32 Q;  2A69 C;  1LV9 A;  1T5X D;  3H91 A;  2E75 C;  3DMU A;  3KDF B;  4X3U A;  4O2D A;  2L9H A;  2LXJ A;  4JYA Q;  3KLW A;  2NWG A;  1UEA B;  3OMG A;  3IL8 A;  4CJ0 B;  2N8N A;  4NXM L;  5K5P A;  5T1I A;  2LKV A;  3CCU A;  3S1M B;  4DK3 C;  1K73 C;  5C4X G;  1CA6 A;  1U5K A;  4HCE A;  3NBH A;  3V05 A;  1PH7 A;  1U4L A;  3O13 A;  4H0L C;  2EYJ A;  4YY3 L;  5GAH C;  1C0A A;  4X62 Q;  1S4Z A;  3HOW B;  2FMM A;  1X3P A;  2DNC A;  2HUG A;  4RMF A;  5CYU A;  4JI1 Q;  4OGQ C;  4DV2 Q;  4OO1 H;  3GTP H;  5LMN W;  3BVG A;  3TP7 A;  3HOX G;  2CKZ B;  4BXX G;  2E2H H;  1B9M A;  5C4X H;  1TWG H;  3AB9 A;  2Q2H A;  4CKB A;  2VNU D;  3KF6 B;  4S3S A;  4FF3 A;  1A6X A;  2H5X A;  1EFW A;  2AUK A;  1K83 B;  1TY0 A;  4R4C A;  3VR2 A;  1VQN A;  4DR5 L;  4L5Q A;  1G2S A;  2WB1 G;  3EFX D;  4BY7 B;  4OX9 L;  1OXU A;  4BXX H;  1TWA B;  4DAP A;  1TVX A;  2A73 B;  1LT4 D;  2G9H D;  3B6Y A;  1WD1 A;  1O7L A;  2AQ1 B;  3GTO B;  3FEW X;  1EQT A;  5CV5 A;  5I6Y A;  4YWM A;  2XVS A;  2WAQ G;  1F2Y A;  1B3Q A;  3W2D A;  3UDX A;  5D3I B;  4OL7 A;  1Q1B A;  3G6E A;  1J9O A;  2PQE A;  4R4O A;  3A5U A;  3J81 i;  4HED A;  2EE1 A;  3E9H A;  1XYI A;  1K9M C;  5IWA L;  2UUC Q;  3ER0 A;  5HGT A;  1VQJ A;  2MUY A;  3CCJ A;  1JE5 A;  3MA2 B;  1Y1W G;  3K5O A;  3CW2 C;  1ESR A;  2JA9 A;  3W5O A;  2UU9 Q;  3M85 A;  2AQ3 B;  1AN8 A;  1GUN A;  3K5L A;  5DLQ E;  4BA2 I;  3RLO A;  1F2Z A;  3MEF A;  3I91 A;  4AYB B;  4ABN A;  2K14 A;  1IBM L;  3S2H H;  1W6K A;  1WTP A;  3J7Z C;  2N49 A;  1HHV A;  1Y1W H;  4EQP A;  2B2T A;  2AKW B;  1MKH A;  4DV5 L;  5EQ0 A;  2LSS A;  4C3I G;  3NQT A;  3CCE A;  4M1U B;  4DAY B;  4RWS C;  4DK0 A;  4RGO S;  3GTP B;  2F0O A;  2E2H B;  2N3S A;  4CDE C;  1CKM A;  5C4X B;  1TWG B;  1U4R A;  5J3B A;  2FJ2 A;  4C1N I;  1M4V A;  1PZK D;  3UE1 A;  3R2I A;  4HCS A;  3RMH A;  5I4D A;  1YNN D;  1VF5 C;  3GTQ B;  4GNX B;  2A69 D;  4IJL A;  5IOC A;  1XNR Q;  2EYO A;  1IXR A;  3JAM i;  4GKK L;  4H02 A;  4RCN A;  5ELO A;  4OWT B;  2JE6 I;  1A63 A;  3T13 A;  1HA6 A;  4A3D G;  4FXG C;  3G4S A;  4JI8 L;  4WJ3 M;  1QOH A;  2L15 A;  5LHY 1;  5DNF A;  1EY6 A;  4JBM A;  5FO7 B;  2PNR C;  2ATW A;  4ZLT F;  2WB1 B;  4A3D H;  1GUO A;  3VR3 A;  1B3A A;  4HSP A;  1QUQ B;  2NTT A;  1QNU A;  2EZV A;  4L8J A;  1Z47 A;  3BDC A;  4A4I A;  4R9W A;  3HEJ A;  2WAQ B;  2O4X A;  4A3K G;  3S14 H;  2B3G A;  5EPK A;  4CDC C;  1KL9 A;  3LX0 A;  4JBK A;  3PGZ A;  1E1O A;  1Q82 C;  1YNJ C;  1TU2 B;  3EBE A;  3S2H B;  2WKD A;  3T1Y L;  4FNF A;  3HOU G;  4Y7N H;  3EJI A;  1GVP A;  5IIF A;  1Y1W B;  1IBK Q;  2Z8L A;  3I7F A;  2K4K A;  1Q12 A;  2JXM B;  4DR7 L;  1Q46 A;  4A3K H;  4ZRZ A;  1QVF A;  3J7A 5;  1EYG A;  1PFS A;  5A2Q L;  1QZH A;  3NUC A;  2NVQ H;  4JV5 L;  1QNK A;  2G9D A;  1YI2 A;  4DV3 L;  5E1F A;  1SNQ A;  1D2B A;  1MD2 D;  3A0J A;  4IUN A;  1SYG A;  3HOU H;  2D9U A;  3ONA B;  1Q1E A;  4KJO A;  4QB4 A;  4R4I A;  3J7A V;  4RGN A;  3T4A C;  2RSO A;  3S17 H;  4DR1 L;  3K80 C;  2K28 A;  3DWA A;  1JIC A;  4IZ8 A;  5C3X A;  2B2V C;  1SYC A;  3C46 A;  3E3X A;  4LF8 Q;  4WJW A;  1VF7 A;  3UDF A;  1NY4 A;  2DY8 A;  1I5F A;  4HAE A;  3C3L A;  1RJT A;  4KY7 A;  4A3C G;  4H44 C;  1QUQ A;  4CHT B;  2ZJP A;  2IW3 A;  3I72 A;  2EXZ A;  1D1I A;  2J4X A;  3ITP A;  1O7Z A;  2SDF A;  1I94 L;  1E1T A;  2IPK D;  2OWO A;  1BCP F;  3WOF A;  4F88 A;  1VQA A;  2B2U C;  4A3D B;  1SYB A;  4UHV A;  3RZO H;  1EIY B;  1BVS A;  1MJC A;  1A0I A;  3GTJ H;  1BCP B;  2HIV A;  1NR4 A;  1JJG A;  3I3C A;  1LT6 D;  1I4G A;  2AWN A;  1TXY A;  1DOM A;  4GOP C;  3H3V H;  3S14 B;  1HTL D;  1CHQ D;  4RGM A;  4B3T L;  4FDB A;  3HGB A;  1R4P B;  1B9N A;  3RLF A;  2OEO A;  3OSO A;  3RUZ A;  2PZT A;  4AH6 A;  4Y7N B;  2CHB D;  1MSG A;  4LF7 Q;  4KHP Q;  5IYB G;  3SDZ A;  1CT1 D;  2MP1 A;  2F0L A;  2V4D A;  3MFG A;  4JYA L;  4K2K A;  3DM3 A;  4A3K B;  3GQB A;  5EPJ A;  2OQK A;  3SK5 A;  3PUY A;  2F0N A;  2NVQ B;  3VR5 A;  2ALY B;  1UUP A;  2LXK A;  5M3F H;  1PZJ D;  4O1N A;  3HOU B;  5IYB H;  2HDL A;  1ET6 A;  1EEI D;  4MN3 A;  4DV6 L;  1IYU A;  1IHZ A;  1RD9 D;  5I2X A;  5IGC A;  1VMC A;  5CV4 A;  4X62 L;  3S17 B;  4NXM Q;  1RDP D;  2VQE Q;  1V9P A;  1XMO L;  2DGY A;  2UUA L;  2F0W A;  4DV2 L;  1EZ6 A;  2JN4 A;  4A93 G;  5EBD A;  3HZX A;  1G29 1;  1BXT A;  1Q86 C;  2VXW A;  1E0B A;  4YY3 Q;  3RD4 A;  2CWP A;  4KKU A;  1YNJ D;  3D8G A;  4HJA A;  2QEJ C;  4IPC A;  1YNX A;  3RR5 A;  1X55 A;  2LS0 1;  1PH9 A;  4AQY Q;  3SXH A;  5C4H A;  2PPB C;  4X6A H;  3RZO B;  4A93 H;  4J8Q A;  4LF4 L;  2R61 A;  2NB0 A;  3GTJ B;  3QJY A;  3BU2 A;  4DK6 C;  5KGU A;  5KIX A;  1SR3 A;  1EFI D;  4RGT A;  4GN4 B;  5IOD A;  1KDB A;  4A3L H;  4RG1 A;  2CVR A;  4RCO A;  4K0K L;  3CCQ A;  2JJQ A;  4B3S Q;  4RFB A;  1WTW A;  3U4Z A;  4P72 A;  2IWH A;  4DR5 Q;  2K5N A;  4G57 A;  1LTB D;  4OX9 Q;  3T53 B;  2F0E A;  3K7A H;  1N34 Q;  2D62 A;  4X64 L;  4DFA A;  2UUC L;  4XYQ A;  2B63 G;  2HQE A;  1A8V A;  1EY5 A;  5KYI A;  5FLX c;  2RDH A;  2A1A A;  1SJE D;  1UEB A;  1I50 H;  1LTS D;  1BBW A;  4DXG A;  2VY3 A;  2UU9 L;  5M3F B;  1GOZ A;  3D4D A;  3STB C;  5JPM C;  2QDL A;  4HR7 B;  5IWA Q;  1E2V A;  2LMC B;  3NWS A;  1BNZ A;  2FHT A;  2B63 H;  1W3S A;  4DV0 Q;  3A54 A;  3FP9 A;  3IAY A;  2B2V A;  2R92 G;  1E22 A;  5IGB A;  1C48 A;  1BQQ T;  5F2D A;  1Q90 A;  3PO2 G;  2F4I A;  5FJ8 H;  4F7X A;  3EVQ A;  1IBM Q;  1Y8O B;  1F9S A;  2DNE A;  3E6Z X;  4JCV E;  4DKA C;  2I5L X;  2F0T A;  4N9T A;  1EY7 A;  1SE8 A;  2X6L A;  1IYJ B;  5C44 G;  4DV5 Q;  2B2U A;  1AZQ A;  4R4T A;  2IHE A;  2R92 H;  3ERQ A;  1XNR L;  2EY5 A;  3HOY H;  1CKN B;  1NR2 A;  1AH9 A;  1R9T H;  4A93 B;  2PZW A;  3SK4 A;  4X3T A;  2MQH A;  2PYK A;  2F0I A;  1X65 A;  3I4O A;  1C8C A;  4IUT A;  4GOP A;  4N8F A;  1EWC A;  2KEN A;  1TS3 A;  2F0K A;  3I56 A;  2K7V A;  5ISR A;  2GN5 A;  2BA0 A;  4GKK Q;  1WD0 A;  1J5E Q;  1NMG A;  1V1Q A;  2NUC A;  3PIO A;  2XWB B;  3K7A B;  3TN2 A;  3VYU A;  4PV1 C;  4KK7 A;  3PQI A;  4JC0 A;  1M1K C;  1TY2 A;  2B2Y C;  4ZUJ A;  2K01 A;  4PG3 A;  4OXP A;  4C2M H;  1H9S A;  5JVG 3;  2VB3 X;  3U50 C;  2A5H A;  1NMF A;  1PRT C;  5G3L F;  5BN3 A;  1I50 B;  3TZD A;  4YIJ A;  3U58 A;  4ILW A;  3HS0 C;  3A8J E;  3DWP A;  4K6D A;  3J80 E;  1AW7 A;  2UXC Q;  3MXG A;  1PYB A;  5ELD A;  5C0X I;  2JQO A;  3OW7 A;  1N33 Q;  1EYC A;  3M7G A;  2B63 B;  2RHQ B;  4Q0F A;  1JWM D;  4FYD A;  2VW9 A;  1ZKO A;  4UP7 A;  1VQD A;  5ELC A;  2VZA A;  2M2L A;  2NVT H;  1BDO A;  4BBR G;  1HH2 P;  5IYC G;  4DAM A;  1OTC A;  3OHX C;  1SEB D;  4APV A;  1HTP A;  5KNB A;  2KHS A;  4HJ8 A;  1STE A;  4BBS G;  5COY A;  3T1Y Q;  5FKA C;  2DN8 A;  4C3J G;  3EN2 A;  5JJL A;  4O0A A;  2YV5 A;  2YTX A;  4DR7 Q;  3V2T A;  3S1R H;  2XNA C;  1C4Q A;  3J81 c;  3QOL A;  4POF A;  1EIF A;  3MWY W;  2JK8 A;  4DXF A;  2R92 B;  1HJP A;  2BA1 A;  1IW7 C;  3HOY B;  1R9T B;  5M9O A;  1L1O B;  5IYC H;  4DAV A;  2PCF B;  4V19 0;  1FGU A;  3JC6 6;  3HOV G;  3A55 A;  4XXE A;  1WI5 A;  4C3J H;  5KNC A;  3TDQ A;  1NBW A;  1HZA A;  4BWG B;  2WB1 E;  1F9Q A;  2ZM6 Q;  2CFM A;  3AFQ A;  4H13 C;  4JVZ A;  3STB D;  2FFK B;  1EU3 A;  3SVM A;  3K7U C;  4IUU A;  2PZU A;  5C6A A;  3KF8 A;  1RL2 A;  1LM0 A;  2K5D A;  2B2T C;  2IX1 A;  2KBN A;  1STB A;  4E6I A;  5KEE A;  2WAQ E;  4CJ2 C;  3NPP A;  4UDU C;  3CPW A;  4C2M B;  1II3 A;  1CZW A;  2ZTD A;  4WOR A;  2K50 A;  4NXN L;  1OXS C;  1EEF D;  1RTO A;  2NBF A;  3TRE A;  2JA8 H;  3KOJ A;  1JWS D;  3OIP A;  1OO9 B;  4POG A;  2NZH A;  5E4W C;  1VQB A;  3JAM c;  1EL0 A;  1FR3 A;  4LF7 L;  4KHP L;  4GLX A;  1JJ2 A;  2K52 A;  3R2T A;  3D4W A;  5CV6 A;  2Z9H A;  2NVT B;  4B3T Q;  1SNM A;  1EU4 A;  3F2U A;  4DR3 Q;  1HFN A;  4ALP A;  3OYY A;  3VR4 A;  4KJN A;  1PFN A;  4GKJ Q;  2WV6 D;  4MIU A;  4P73 A;  4LUV A;  2WKC A;  5EBC A;  2F03 A;  3S1R B;  4KN4 C;  3MXN A;  3FMC A;  1O78 A;  1PYS B;  3Q0A A;  3Q22 A;  1M90 C;  4BBR B;  4DV1 Q;  4O42 A;  2VQE L;  3I8Z A;  1PRT D;  3ULJ A;  3EA6 A;  4DF7 A;  4C3J B;  4XT1 B;  4C3H G;  2Y0S G;  2Q8R E;  5M5W H;  2MO1 A;  2ZJQ A;  5ELB A;  2K75 A;  4DV6 Q;  2M9V A;  4PQX A;  2ICI A;  2RHS B;  3MAQ A;  3A56 A;  3PUV A;  1SAP A;  1LT5 D;  1HZC A;  2KVM A;  1XMO Q;  2UUA Q;  4FVM A;  1LTR D;  2KCM A;  3K59 A;  4AQY L;  4JI2 L;  2B2Y A;  1SMX A;  1Y8N B;  2RA4 A;  1TWC H;  4GNX C;  1TS2 A;  5TSS A;  3KBG A;  3BYY B;  3G71 A;  4IUV A;  2L12 A;  1N8R C;  1FNU A;  1K8A C;  4DNI A;  1LO5 D;  3K81 C;  1JOR A;  4KY6 A;  3S24 A;  3WWV A;  3GTQ H;  2JA8 B;  2EJM A;  4B3S L;  3NEL A;  5ELE A;  5HUR A;  1DXM A;  1LT3 D;  4X66 L;  4LF4 Q;  2GVA A;  3OPO A;  5FLX E;  1NJI C;  2RBM A;  3UE0 A;  3HOX H;  4HJ7 A;  4GLV B;  1IW7 D;  1BUV T;  1N34 L;  2IX3 A;  4IPD A;  4IPG A;  2JSO A;  5JPN C;  1K28 A;  5CBA E;  2EY2 A;  1AZP A;  3MFY A;  4K0K Q;  2OTL A;  3KDF A;  4RH6 A;  1UWV A;  3CCL A;  1LAB A;  3QO2 A;  2HT1 A;  3F2C A;  5GRO A;  1VQ5 A;  1MGS A;  1ROD A;  1SFO H;  1P16 A;  4HSV A;  3W1B A;  4EGV A;  5BN5 A;  2RCF A;  1PTO H;  4IN3 A;  2D5D A;  1BR9 A;  4X64 Q;  2RDF A;  3I4N G;  1X9N A;  5D14 A;  4K8J A;  1QIL A;  3GTM H;  4XYO A;  4DV0 L;  1G6P A;  3MXP A;  3IFD A;  1OXV A;  3DEO A;  3L0O A;  1AEX A;  2XGT A;  4LUZ A;  5IT9 E;  1U4P A;  2NVX H;  3ULP A;  5M5W B;  1SND A;  4YCW A;  1MI2 A;  3I4N H;  4LF9 L;  4K14 A;  3AMU A;  4AIM A;  2XIW A;  1SJH D;  2EVB A;  1RKN A;  1XMQ L;  3KF6 A;  3HOZ G;  4R8I A;  1TR5 A;  3KJP A;  4L5R C;  4FF2 A;  2CH4 A;  3OWF A;  4KD3 A;  1TWC B;  4Z9C B;  2JA6 G;  2Y0S B;  1GUW A;  4IUQ A;  1EYD A;  3DEP A;  1Y69 U;  4X65 L;  4DV7 Q;  1KDA A;  4L63 B;  1JR0 D;  1KAB A;  1ENA A;  2F3I A;  1S72 A;  3HOZ H;  4C3I H;  2ASB A;  3M3Y H;  2K04 A;  2VQF Q;  3HOX B;  2JA6 H;  3J80 L;  2H4O A;  2P5Z X;  1PH8 A;  1SSO A;  1S40 A;  4IFD I;  1PTO F;  1LAC A;  2JA7 G;  3AU7 A;  2I07 B;  1BCP C;  2QA4 A;  1SFO B;  3HP3 A;  3F2D A;  1PH6 A;  3TQY A;  1PTO B;  4HJ5 A;  5M5Y H;  1ILP A;  5C3W A;  4HIM A;  2F52 A;  1XX8 A;  2UXC L;  3D6C A;  2JA5 G;  3GTM B;  1N33 L;  1Y1V G;  2LY7 A;  3QIA A;  2DY7 A;  1EY9 A;  2JP1 A;  1PFM A;  2YYZ A;  2L5T A;  1GO3 E;  2JA7 H;  1HCZ A;  2WFW A;  1UE5 A;  1AFP A;  1KHI A;  5C5L A;  1JOO A;  3J81 E;  2NVX B;  1Z9F A;  3VA5 A;  1MJE A;  4DAY A;  2ZXO A;  3HRZ C;  3FPU B;  3I4N B;  1CA5 A;  4HMJ A;  1EOV A;  1FVI A;  4ZK9 B;  1VQ7 A;  3G6J B;  5C0X G;  2K6A A;  1WJJ A;  3K8A A;  1A3T A;  2I46 A;  1KLU D;  3GTG H;  2K5W A;  2QW7 A;  4QIW B;  5JVH 3;  3S1Q H;  3A7L A;  1TWH H;  3TEH B;  4JBW A;  4GNX A;  2L55 A;  1R4Q B;  2RF4 A;  5IY0 A;  3H09 A;  3GTK H;  3P7J A;  2NN6 I;  4XTC S;  5KYL A;  3VYR A;  4N8X 1;  4NPS A;  3TP5 A;  2J0T D;  2ZM6 L;  1FJG L;  4JPB W;  3HOZ B;  2RVL A;  4DR6 L;  4C3I B;  3M3Y B;  1NAP A;  1STN A;  2DJF C;  3MC0 B;  4GS3 A;  5EGT A;  3ULL A;  2JA6 B;  4A3M G;  4QGU A;  1XPU A;  4PZ6 A;  3U9O A;  1JJC B;  1Z6H A;  5JJI A;  3GV6 A;  4OON A;  1E7Z A;  4ZQ3 A;  1EUJ A;  2PMZ E;  2MO0 A;  3JAM E;  1DGS A;  2EDG A;  5CV9 A;  2VL6 A;  3BDL A;  4JI3 L;  4ME3 A;  1D5Z C;  3HG9 A;  4RHR A;  2O5I C;  5M5Y B;  4PZ8 A;  3PUZ A;  3H3V C;  1H95 A;  1HUN A;  3PO3 G;  4YCU A;  4NXN Q;  3BVZ A;  4A3C H;  3NBI A;  4PMB A;  1F9P A;  1HRJ A;  2KUM A;  2JA7 B;  4WRD A;  1KTK A;  2QIL A;  3FRP B;  2XSC A;  2GA4 B;  1D6E C;  4DR3 L;  1VQF A;  3Q23 A;  1KRT A;  3OOC A;  3BJU A;  1ASY A;  2L1B A;  4GKJ L;  4UP8 A;  4C1N K;  1VQK A;  1PVO A;  1NNX A;  1Q7Y C;  1HNW L;  2UXD Q;  3GTG B;  2QGQ A;  3S1Q B;  4KHZ A;  1TWH B;  2EPB A;  4KLK A;  3F2B A;  5C3E G;  4RKL A;  3S16 H;  4DV1 L;  3GTK B;  1JOK A;  1V8Q A;  4HTH A;  4XT3 B;  5DAU A;  1QE6 A;  2PW5 A;  2QDB A;  1BCP D;  3E5S A;  4DN4 M;  2CCZ A;  1GXD C;  1X3Q A;  2BDN A;  3DWQ A;  4EX5 A;  2Z0S A;  2C9O A;  4IAL A;  3NHH A;  2B29 A;  5C3E H;  4OO1 I;  1BBX C;  1SNO A;  2D0O A;  3CC2 A;  4QCL A;  3NK9 A;  1STH A;  2A68 C;  5DM7 3;  2ID0 A;  1RIP A;  1S5B D;  2PQA B;  2PI2 E;  2KOL A;  4JI0 L;  1EWI A;  3FVQ A;  1JWU D;  4JOI C;  1X56 A;  2I5M X;  3DM1 A;  4NP5 A;  4A3E G;  4JI2 Q;  5CBE E;  1ZYR C;  3OTO L;  2M00 A;  4ODG A;  1VQ4 A;  2QEX A;  3VR6 A;  1ESF A;  4IO9 A;  1S5F D;  1BO0 A;  1NE3 A;  4IUP A;  1IZ6 A;  2UUB Q;  1GJX A;  4XQJ A;  2B2W C;  3NWT A;  4IJH A;  3MHB A;  1MBY A;  4OHJ A;  1T5E A;  3T56 B;  5AJ3 Q;  1G51 A;  1SXT A;  1C9O A;  1NSN S;  3NP8 A;  1CTM A;  3BVM A;  2CW0 C;  1PH4 A;  3I4M G;  3RN5 A;  2SNS A;  4X66 Q;  5J22 A;  4MHE A;  1EYA A;  3L7Z C;  5IT9 L;  3PIO 3;  4A3G G;  2TSS A;  2HDM A;  2F0V A;  4XDX A;  1PV4 A;  1JE4 A;  4JI4 L;  2F0D A;  5C5M A;  1M8A A;  1VQL A;  2HQL A;  4MTK A;  2A19 A;  4N9P A;  3K58 A;  3S16 B;  1XNQ Q;  1CQV A;  1PH5 A;  1KLG D;  1O7Y A;  4LFC Q;  4DU9 A;  2K5H A;  5I9O A;  1PFB A;  4EQO A;  2RSN A;  4IPH A;  1CK1 A;  4YWK A;  3PMF A;  2ES2 A;  3CF5 A;  2F4V Q;  1S5E D;  1UAP A;  1RHP A;  3FPP A;  1F77 A;  5JJK A;  3MTS A;  2CQA A;  4LAA A;  5IGG A;  3QOJ A;  1WTR A;  4KTA A;  5C3E B;  4TSS A;  4UY8 C;  2X69 A;  3D31 A;  1ICW A;  4J6H A;  4LF9 Q;  4A3J G;  1P8L A;  1CM9 A;  1SYE A;  4PMW A;  1L1O C;  4DV7 L;  1XMQ Q;  3GO5 A;  1YZ6 A;  2E76 C;  5LL6 S;  1X3G A;  3WDN A;  4DA2 A;  2OTJ A;  4QF4 A;  1YEZ A;  3K0X A;  3PO2 H;  2E5L Q;  2VQF L;  3TSS A;  2A74 C;  1H9J A;  4X65 Q;  1S3O A;  1HR0 L;  2BH2 A;  4RHS A;  1SNP A;  3GDE A;  4LF6 Q;  2WIN B;  5C44 H;  1W6J A;  1VQ8 A;  1I6V C;  3BZC A;  5M3M G;  4R8N A;  1QWY A;  4I7Z C;  2E8G A;  5K36 G;  4JG2 A;  2XTI A;  2F0M A;  1JQY D;  1KRS A;  3J81 L;  2WAC A;  1SBB B;  1VCI A;  4CBV A;  3Q24 A;  2Q8I B;  3J7Y W;  1RF2 D;  2E2I H;  1B1Z A;  2I0Q A;  4EQ5 A;  4JI6 L;  4RKB A;  4A3F G;  5CMD A;  4QJF A;  1D5M C;  2A68 D;  3QB3 A;  1AP0 A;  2J7Z A;  5IGD A;  4P74 A;  5M3M H;  1TWF H;  3A5Z B;  3BDO A;  5I9P A;  5JJZ A;  2L11 A;  3UDI A;  1PXU A;  2PMZ B;  3PUW A;  5FOB B;  2F0Q A;  5LL6 X;  4IOA A;  1ZYR D;  4OWW B;  3PF5 A;  1E3P A;  3FKI G;  3M4Q A;  1YIJ A;  4A3F H;  2EIF A;  2Y0S E;  2A6E C;  2A6H C;  1HQM C;  3TS2 A;  4JK1 C;  4NMZ A;  2KED A;  2H1E A;  2OCE A;  1U4M A;  5CC4 A;  4FXD A;  1CKN A;  2L0C A;  4HID A;  4ZCK A;  2CW0 D;  5I2Y A;  4JOI A;  4G7H C;  1QVC A;  4BS9 A;  3HFZ B;  2PNH A;  1VQI A;  2Q8T A;  3K57 A;  5C0X J;  2O2L D;  4A75 A;  1WVL A;  2ENB A;  2MHV A;  4BBR H;  3PO2 B;  2B8F A;  3I4L A;  1DYQ A;  1XPO A;  5G3L D;  2B2W A;  3TZU A;  4BBS H;  4ME5 A;  2RCN A;  3HKZ G;  1B70 B;  1LTG D;  2NN6 G;  1D1K A;  4FO2 A;  4XQN A;  1KDC A;  1I4H A;  3A7A B;  3CMA A;  1FJG Q;  5C44 B;  1A3V A;  4CGY B;  4DR6 Q;  3S15 H;  2Q2T A;  1JB7 A;  3ND9 A;  1VQO A;  1A2U A;  3K6O A;  5CV8 A;  2EJF C;  3RN2 A;  4JI7 Q;  3HOV H;  2E2I B;  1QCB D;  3QG1 A;  1DM0 B;  4OIJ A;  4ZYS A;  1EIH A;  2NN6 H;  1LTI D;  4TKO B;  2R6G A;  3OWE B;  4QMG A;  1K8O A;  5HGQ A;  1YJW A;  2EY6 A;  1STY A;  4IQZ A;  2N88 A;  4DNR B;  1KNA A;  5M3M B;  4PNY A;  5E7N A;  4JI3 Q;  1TWF B;  3QWN A;  3A8K E;  5A2Q E;  4K5X A;  4X3S A;  3C2P A;  3NBH B;  1DCZ A;  4HMI A;  4QIW E;  4DPG A;  3P75 A;  1GD7 A;  4A3F B;  1L0Y B;  1S5C D;  2ZJR A;  2FMC A;  3GTL H;  2UXD L;  2PW7 A;  3T1H Q;  4NW2 A;  1CFM A;  1F9R A;  1UE6 A;  2BDO A;  3NXW A;  2IL8 A;  1EZ8 A;  2YU9 H;  3ERS X;  3PIP A;  3QR8 A;  3J81 j;  1KIX A;  1L1O A;  3J7A F;  3CQZ H;  1GHK A;  1HNW Q;  3KFU A;  1ONL A;  4LFA Q;  1IBL L;  2ICE C;  1VS0 A;  5LMN Q;  4DUY Q;  1YJN A;  1QJO A;  1VQC A;  2KCT A;  5GAD C;  2KCN A;  4BBS B;  1KAA A;  1V1P B;  3ERO A;  3NTI A;  1L2F A;  1A2T A;  1SE3 A;  2BE5 C;  4FXK C;  4AYB G;  1O80 A;  1TQO A;  4L5S A;  3ZJY C;  2VS1 A;  1LTL A;  3S15 B;  1VQG A;  1FNW A;  1MIU A;  3PSI A;  2K32 A;  4HN7 A;  1SMY C;  4OO1 G;  3I70 A;  1ZEQ X;  2A6E D;  1V43 A;  2KCC A;  1WTH A;  1X3F A;  1N9W A;  2A6H D;  3HKZ B;  1BF4 A;  1HNZ L;  4B3M Q;  3HOV B;  4C3H H;  5JEA J;  3D0F A;  3SK8 A;  2PI2 A;  5JOB A;  4KI0 A;  1A62 A;  1EQR A;  2UUB L;  1J5E L;  1BBU A;  4JI0 Q;  5AJ3 L;  4QQB X;  3H6M A;  3OTO Q;  1PH2 A;  3X3M A;  5D3D A;  2E74 C;  3BZK A;  1HUM A;  5DM6 3;  1DD2 A;  3EQL C;  1XWE A;  3CRK C;  3GD7 A;  1K0R A;  4BA1 I;  1OXT A;  1HPC A;  2FIN B;  5H1S E;  1HFG A;  3UDG A;  3GTL B;  4DUZ L;  3FHW A;  1SLJ A;  1PTO C;  5EAY A;  4DR2 L;  4B08 A;  1XNQ L;  2YU9 B;  2KQ3 A;  2BCO A;  2XN9 C;  2QF7 A;  5FK9 C;  4NKL A;  1PA6 A;  4LFC L;  3CQZ B;  2EYP A;  3D3R A;  2Z4I A;  3VYT A;  3AEV A;  4I7A A;  4JI4 Q;  1GHJ A;  2HHH L;  2JYO A;  2F4V L;  1KD1 C;  2G5D A;  1V1P A;  4P71 A;  5IP7 G;  4LFB Q;  4K5W A;  1I4P A;  3C1E A;  1PMR A;  1E2W A;  1O7I A;  5GAG C;  1B2T A;  1TS5 A;  1LTT D;  2IT1 A;  4K5V A;  2D0P A;  5EPL A;  1Y14 B;  5FLM G;  5IGF A;  1X54 A;  1N36 Q;  1NUC A;  1GUT A;  3CC7 A;  1DJR D;  3TS0 A;  2EQS A;  1VQP A;  1FYC A;  4H7B A;  1SRU A;  2F3W A;  4F87 A;  5IP7 H;  2F0P A;  3I55 A;  1QZG A;  5NUC A;  2HIX A;  3N6R A;  4RA8 A;  5ELN A;  5FLM H;  2EYM A;  2YTY A;  2Q2U A;  1VQ9 A;  2JEB I;  1B7Y B;  1CSQ A;  3AFP A;  4C3H B;  2E5L L;  1K8G A;  4YWL A;  5C4Z A;  2WII B;  1KAW A;  3FDT A;  2R93 G;  3P1H A;  2EXD A;  1EOT A;  2C5C A;  3ND8 A;  1ASZ A;  3BG3 A;  4LF6 L;  1FNV A;  1I4X A;  3NTH A;  1SYF A;  2ZTC A;  2HD3 A;  2ZXP A;  4ULL A;  3M4P A;  4L5T A; 
#chains in the Genus database with same CATH homology
 3U9S A;  5EKI A;  4I65 A;  4WFN 3;  3BYT B;  4PMC A;  2L4N A;  1G6Z A;  3DHQ A;  5D65 A;  2BE5 D;  2NZ1 D;  2K03 A;  1EY0 A;  2KEC A;  3CRL C;  3SHL A;  1Y8P B;  3NTK A;  3MXU A;  1IL8 A;  1SMY D;  3LWE A;  1CHP D;  1DZ1 A;  1H9M A;  3URY A;  4IFD J;  4G7O C;  2Z1C A;  1TII D;  2Z4H A;  3CHB D;  2SOB A;  3MEH A;  3OMC A;  2BOS A;  1F2M A;  1KNE A;  1LLR D;  5BN4 A;  4ZUI A;  2EY1 A;  4KKT A;  3SK6 A;  1G91 A;  2F3V A;  1PTO D;  5E4X A;  5C0X H;  2NTS A;  2SEB D;  1WTQ A;  5JAV A;  3V96 A;  4ZKB B;  1G2T A;  1VDZ A;  2JEA I;  1A15 A;  5KRU A;  3KUP A;  2R93 B;  4TRD A;  2AUJ D;  2XRS D;  1F2L A;  2KA7 A;  4C56 C;  2QCP X;  1UNS A;  2XRQ D;  2NVY B;  4DNT B;  4IUR A;  2IJ0 A;  1S5D D;  1ENF A;  3R3O A;  2F0F A;  1SYD A;  3N52 A;  1SE4 A;  3L3O C;  1EQV A;  1SE2 A;  4K2L A;  1CI3 M;  3I73 A;  4FF1 A;  1XTC D;  1IKL A;  2OF1 A;  2VUM B;  2IX0 A;  5CR3 A;  4EQN A;  2KJX A;  3SEB A;  3PV0 A;  1MSH A;  2JA5 B;  1Y1V B;  1ENC A;  1V1O A;  1PLF A;  2B8G A;  3SR1 A;  4U67 3;  2WP8 J;  3CU7 A;  4QUC A;  1H9K A;  1IYV A;  1BOS A;  3IFT A;  1QG7 A;  3G7L A;  3LWU A;  3A8I E;  5FO8 B;  1DON A;  2ZXR A;  1Q8I A;  4Q5V A;  5M5X B;  1STG A;  3VA7 A;  2F0S A;  5EJW A;  1L0X B;  3VYS A;  1Z7T A;  4ZKC B;  4KV6 A;  2K33 A;  4J1M A;  5JEA G;  3K5M A;  3MVV A;  3CKI B;  2LFN A;  5FLX L;  4FP5 D;  1HA5 A;  5DEH A;  1FD7 D;  3NSW A;  2F1M A;  3D6W A;  5KND A;  4CJ1 B;  4G4K A;  1WTO A;  1D5X C;  5AFW A;  5JEA H;  1TT2 A;  2K1B A;  4A3M B;  1EWH A;  4U68 A;  1WTX A;  1SNC A;  2MPM A;  1VMP A;  2AQ2 B;  4LK1 C;  1X32 A;  2E2D C;  3BS1 A;  1EY4 A;  1GUS A;  2AWO A;  2TMP A;  5CV7 A;  4QUF A;  4KD4 A;  2ZT9 C;  3KLS X;  3PO3 B;  3K5N A;  1Q3L A;  1E2Z A;  4FF4 A;  4LMQ D;  3S1N B;  1STA A;  3OIQ A;  3ZYY X;  2PO4 A;  5C4J B;  4KMU C;  2E2J B;  2HCC A;  2N55 A;  3BZD B;  1RCV D;  3Q6S A;  3P20 A;  3C1F A;  3LNN A;  2MJ8 A;  1LTA D;  1I4Q A;  3GP7 A;  3DUZ A;  2K05 A;  4XQQ A;  1I6H B;  2B39 A;  1NCV A;  3X3N A;  2D2C C;  1EY8 A;  4GZY C;  2EYL A;  4G7Z C;  2OXP A;  1H9S B;  1JCK B;  5EKL A;  4A3B B;  1PDQ A;  3M7N A;  1A3U A;  4DGZ A;  4KHV A;  3PUX A;  5I6W A;  5A35 A;  5IGE A;  3TME A;  4L6T B;  1H9R A;  1FGB D;  2HCI A;  4DK1 A;  1SDF A;  4CKE A;  2OT2 A;  4EVO A;  2EOT A;  4RAU C;  5E3F A;  2R7Z B;  4A3E B;  2VB2 X;  2RDG A;  2R3Z A;  4V0B A;  4BY1 B;  1U9R A;  4P2C B;  3I90 A;  1B53 A;  3IKJ A;  4KKS A;  4K8I A;  5CGK A;  2X6G A;  2MGS A;  4IFD G;  2RKS A;  1OXX K;  3I4M B;  1B44 D;  4CKC A;  1PYW D;  1TKW B;  3R93 A;  3WOE A;  5K36 H;  2KEE A;  1RTN A;  4A3G B;  1WTV A;  5T1G A;  2XWJ B;  1I4R A;  1GUG A;  4K6L A;  3KBX A;  4IFD H;  3M4Y A;  3GV3 A;  5J39 A;  1PZI D;  4KN7 C;  3PIP 3;  1IKM A;  1G8Z D;  1CZG A;  3TP6 A;  1ILQ A;  5EKK A;  1JOQ A;  3SE0 A;  3W3A A;  3JAM L;  1HQR D;  2QKI C;  4F8M A;  3RZD B;  1ML0 D;  3H94 A;  4A3J B;  1DOL A;  2F0H A;  1EIG A;  1ZXT A;  1JC7 A;  2RQX A;  1J8I A;  3E0J A;  2O5J C;  3NQI A;  5FO9 B;  4A3I B;  3KK7 A;  4B9W A;  2F0U A;  3M4O B;  4M8A A;  3R8B A;  3T16 A;  1HXY D;  2F0G A;  1XXG A;  5COR A;  1QB5 D;  3T51 B;  3H0G B;  4UAI A;  1B4O A;  3TBI B;  3L9A X;  3UI2 A;  5J1Z A;  1TS4 A;  4ZAI A;  3K0Y A;  1I3Q B;  1CQF A;  3KLS A;  4X3K A;  5ELF A;  1WCM B;  3D4R A;  3TP8 A;  1PRT F;  4LJZ C;  3S2D B;  4TQU S;  3NE5 B;  1JB3 A;  2EJG C;  1K8M A;  2EYF A;  2K5Q A;  1PRT B;  4B9X A;  3S9W A;  2SNM A;  4ID6 A;  4NDX A;  1ET9 A;  4OIK A;  1DOK A;  3FKI B;  3DXJ C;  3KLR A;  4XIG S;  4KY5 A;  2EYH A;  1B50 A;  2NYZ D;  3MZ5 A;  1YNN C;  2F0J A;  2A69 C;  1LV9 A;  1T5X D;  3H91 A;  2E75 C;  3DMU A;  4X3U A;  2L9H A;  2NWG A;  1UEA B;  3OMG A;  3IL8 A;  4CJ0 B;  5K5P A;  5T1I A;  2LKV A;  3S1M B;  1CA6 A;  4HCE A;  3NBH A;  3V05 A;  1U4L A;  3O13 A;  4H0L C;  2EYJ A;  1S4Z A;  3HOW B;  2FMM A;  1X3P A;  2DNC A;  2HUG A;  5CYU A;  4OGQ C;  4OO1 H;  3BVG A;  3TP7 A;  1B9M A;  3AB9 A;  4CKB A;  2VNU D;  4S3S A;  4FF3 A;  1A6X A;  2AUK A;  1K83 B;  1TY0 A;  3VR2 A;  1G2S A;  3EFX D;  4BY7 B;  1OXU A;  1TWA B;  4DAP A;  1TVX A;  2A73 B;  1LT4 D;  2G9H D;  1WD1 A;  1O7L A;  2AQ1 B;  3GTO B;  3FEW X;  1EQT A;  5CV5 A;  5I6Y A;  2XVS A;  1F2Y A;  3W2D A;  5D3I B;  4OL7 A;  1Q1B A;  1J9O A;  2PQE A;  4HED A;  2EE1 A;  1XYI A;  5HGT A;  2MUY A;  3MA2 B;  3K5O A;  1ESR A;  3M85 A;  2AQ3 B;  1AN8 A;  1GUN A;  3K5L A;  4BA2 I;  1F2Z A;  3I91 A;  4AYB B;  4ABN A;  1W6K A;  1WTP A;  1HHV A;  4EQP A;  2B2T A;  5EQ0 A;  4C3I G;  3NQT A;  4M1U B;  4RWS C;  4DK0 A;  4RGO S;  3GTP B;  2F0O A;  2E2H B;  5C4X B;  1TWG B;  1U4R A;  2FJ2 A;  4C1N I;  1M4V A;  1PZK D;  3R2I A;  4HCS A;  3RMH A;  5I4D A;  1YNN D;  1VF5 C;  3GTQ B;  2A69 D;  5IOC A;  2EYO A;  4RCN A;  2JE6 I;  3T13 A;  1HA6 A;  4FXG C;  1QOH A;  5LHY 1;  5DNF A;  1EY6 A;  5FO7 B;  2PNR C;  4ZLT F;  2WB1 B;  1GUO A;  3VR3 A;  1B3A A;  4HSP A;  2NTT A;  1QNU A;  2EZV A;  4L8J A;  1Z47 A;  3BDC A;  4R9W A;  3HEJ A;  2WAQ B;  2O4X A;  5EPK A;  3LX0 A;  1YNJ C;  1TU2 B;  3S2H B;  2WKD A;  4FNF A;  3EJI A;  5IIF A;  1Y1W B;  2Z8L A;  1Q12 A;  2JXM B;  4ZRZ A;  5A2Q L;  3NUC A;  1QNK A;  2G9D A;  5E1F A;  1SNQ A;  1D2B A;  1MD2 D;  4IUN A;  1SYG A;  2D9U A;  3ONA B;  1Q1E A;  4KJO A;  4QB4 A;  3J7A V;  4RGN A;  3T4A C;  2RSO A;  2K28 A;  3DWA A;  1JIC A;  4IZ8 A;  5C3X A;  2B2V C;  1SYC A;  3C46 A;  4WJW A;  1VF7 A;  2DY8 A;  4HAE A;  3C3L A;  1RJT A;  4KY7 A;  4H44 C;  4CHT B;  2IW3 A;  3I72 A;  2EXZ A;  1D1I A;  2J4X A;  3ITP A;  1O7Z A;  2SDF A;  2IPK D;  1BCP F;  3WOF A;  4F88 A;  2B2U C;  4A3D B;  1SYB A;  1BCP B;  1NR4 A;  3I3C A;  1LT6 D;  1I4G A;  2AWN A;  3S14 B;  1DOM A;  1HTL D;  1CHQ D;  4RGM A;  3HGB A;  1R4P B;  1B9N A;  3RLF A;  2OEO A;  3OSO A;  3RUZ A;  2PZT A;  4Y7N B;  2CHB D;  1MSG A;  3SDZ A;  1CT1 D;  2MP1 A;  2F0L A;  2V4D A;  3MFG A;  4K2K A;  4A3K B;  3GQB A;  5EPJ A;  3SK5 A;  3PUY A;  2F0N A;  2NVQ B;  3VR5 A;  1UUP A;  1PZJ D;  4O1N A;  3HOU B;  2HDL A;  1ET6 A;  1EEI D;  4MN3 A;  1IYU A;  1IHZ A;  1RD9 D;  5I2X A;  5IGC A;  1VMC A;  5CV4 A;  3S17 B;  1RDP D;  2F0W A;  1EZ6 A;  5EBD A;  3HZX A;  1G29 1;  1BXT A;  2VXW A;  1E0B A;  3RD4 A;  4KKU A;  1YNJ D;  3D8G A;  2QEJ C;  2LS0 1;  3SXH A;  5C4H A;  2PPB C;  3RZO B;  4J8Q A;  2R61 A;  2NB0 A;  3GTJ B;  3QJY A;  5KGU A;  5KIX A;  1EFI D;  4RGT A;  5IOD A;  1KDB A;  2CVR A;  4RCO A;  4RFB A;  1WTW A;  2IWH A;  4G57 A;  1LTB D;  3T53 B;  2F0E A;  2D62 A;  4DFA A;  4XYQ A;  2HQE A;  1EY5 A;  5KYI A;  2RDH A;  1SJE D;  1LTS D;  4DXG A;  5M3F B;  1GOZ A;  3D4D A;  5JPM C;  4HR7 B;  1E2V A;  2LMC B;  3NWS A;  1BNZ A;  2FHT A;  3A54 A;  3IAY A;  2B2V A;  5IGB A;  1C48 A;  1BQQ T;  5F2D A;  1Q90 A;  2F4I A;  4F7X A;  3EVQ A;  1Y8O B;  1F9S A;  2DNE A;  3E6Z X;  2F0T A;  4N9T A;  1EY7 A;  2X6L A;  1AZQ A;  2B2U A;  3ERQ A;  2EY5 A;  1NR2 A;  4A93 B;  2PZW A;  3SK4 A;  4X3T A;  2PYK A;  2F0I A;  1C8C A;  4IUT A;  1EWC A;  1TS3 A;  2F0K A;  2K7V A;  5ISR A;  2BA0 A;  1WD0 A;  2NUC A;  2XWB B;  3K7A B;  3TN2 A;  3VYU A;  4PV1 C;  4KK7 A;  1TY2 A;  2B2Y C;  4ZUJ A;  2K01 A;  5JVG 3;  1H9S A;  2VB3 X;  2A5H A;  1PRT C;  5G3L F;  5BN3 A;  1I50 B;  3TZD A;  4YIJ A;  4ILW A;  3HS0 C;  3A8J E;  3DWP A;  4K6D A;  3J80 E;  1AW7 A;  3MXG A;  5ELD A;  5C0X I;  3OW7 A;  1EYC A;  3M7G A;  2B63 B;  4Q0F A;  1JWM D;  4FYD A;  1ZKO A;  5ELC A;  2M2L A;  1BDO A;  3OHX C;  1SEB D;  1HTP A;  5KNB A;  2KHS A;  1STE A;  5COY A;  5FKA C;  2DN8 A;  4C3J G;  3V2T A;  2XNA C;  1C4Q A;  3QOL A;  3MWY W;  4DXF A;  2R92 B;  2BA1 A;  1IW7 C;  3HOY B;  1R9T B;  5M9O A;  4DAV A;  2PCF B;  4V19 0;  3A55 A;  4XXE A;  5KNC A;  3TDQ A;  4BWG B;  1F9Q A;  4H13 C;  2FFK B;  1EU3 A;  3SVM A;  4IUU A;  2PZU A;  5C6A A;  3KF8 A;  2K5D A;  2B2T C;  2IX1 A;  4E6I A;  1STB A;  5KEE A;  4CJ2 C;  3NPP A;  4UDU C;  4C2M B;  1II3 A;  1CZW A;  4WOR A;  1OXS C;  1EEF D;  1RTO A;  2NBF A;  1JWS D;  3OIP A;  1OO9 B;  5E4W C;  1EL0 A;  1FR3 A;  3R2T A;  3D4W A;  5CV6 A;  2NVT B;  1SNM A;  1EU4 A;  3F2U A;  1HFN A;  3VR4 A;  4KJN A;  1PFN A;  2WV6 D;  4MIU A;  2WKC A;  5EBC A;  2F03 A;  3S1R B;  4KN4 C;  3MXN A;  3FMC A;  1O78 A;  3Q0A A;  3Q22 A;  4BBR B;  4O42 A;  3I8Z A;  1PRT D;  3EA6 A;  4DF7 A;  4C3J B;  4XT1 B;  4C3H G;  2Q8R E;  5ELB A;  2M9V A;  4PQX A;  2ICI A;  3MAQ A;  3A56 A;  3PUV A;  1SAP A;  1LT5 D;  2KVM A;  4FVM A;  1LTR D;  3K59 A;  2B2Y A;  1Y8N B;  2RA4 A;  1TS2 A;  5TSS A;  3KBG A;  3BYY B;  4IUV A;  2L12 A;  1FNU A;  1LO5 D;  1JOR A;  4KY6 A;  2JA8 B;  2EJM A;  5ELE A;  5HUR A;  1DXM A;  1LT3 D;  3OPO A;  5FLX E;  2RBM A;  1BUV T;  1IW7 D;  2IX3 A;  2JSO A;  5JPN C;  5CBA E;  2EY2 A;  1AZP A;  3MFY A;  4RH6 A;  1LAB A;  3QO2 A;  1MGS A;  1ROD A;  4HSV A;  5BN5 A;  4EGV A;  1PTO H;  4IN3 A;  2D5D A;  1BR9 A;  2RDF A;  5D14 A;  4K8J A;  1QIL A;  4XYO A;  3MXP A;  3IFD A;  1OXV A;  3DEO A;  1AEX A;  5IT9 E;  1U4P A;  5M5W B;  1SND A;  1MI2 A;  4K14 A;  3AMU A;  2XIW A;  1SJH D;  2EVB A;  1RKN A;  4R8I A;  1TR5 A;  4FF2 A;  3OWF A;  4KD3 A;  1TWC B;  4Z9C B;  2Y0S B;  1GUW A;  4IUQ A;  1EYD A;  3DEP A;  1Y69 U;  1KDA A;  4L63 B;  1JR0 D;  1KAB A;  1ENA A;  2K04 A;  3HOX B;  3J80 L;  2H4O A;  1SSO A;  4IFD I;  1PTO F;  1LAC A;  3AU7 A;  2I07 B;  1BCP C;  1SFO B;  3HP3 A;  1PTO B;  1ILP A;  5C3W A;  1XX8 A;  3D6C A;  3GTM B;  2LY7 A;  3QIA A;  2DY7 A;  1EY9 A;  2JP1 A;  1PFM A;  2YYZ A;  2L5T A;  1HCZ A;  1AFP A;  5C5L A;  1JOO A;  3J81 E;  2NVX B;  3VA5 A;  4DAY A;  2ZXO A;  3HRZ C;  3FPU B;  3I4N B;  1CA5 A;  4HMJ A;  4ZK9 B;  3G6J B;  5C0X G;  2K6A A;  1A3T A;  2I46 A;  1KLU D;  2K5W A;  4QIW B;  5JVH 3;  3A7L A;  4JBW A;  2L55 A;  1R4Q B;  3H09 A;  3P7J A;  2NN6 I;  4XTC S;  5KYL A;  3VYR A;  3TP5 A;  2J0T D;  3HOZ B;  2RVL A;  4C3I B;  3M3Y B;  1NAP A;  1STN A;  3MC0 B;  5EGT A;  2JA6 B;  3U9O A;  1Z6H A;  3GV6 A;  4ZQ3 A;  3JAM E;  2EDG A;  5CV9 A;  3BDL A;  1D5Z C;  3HG9 A;  4RHR A;  2O5I C;  5M5Y B;  3PUZ A;  3H3V C;  1HUN A;  3BVZ A;  3NBI A;  4PMB A;  1F9P A;  1HRJ A;  2KUM A;  2JA7 B;  4WRD A;  1KTK A;  2QIL A;  3FRP B;  2XSC A;  2GA4 B;  1D6E C;  3Q23 A;  3OOC A;  2L1B A;  4C1N K;  3GTG B;  3S1Q B;  4KHZ A;  1TWH B;  2EPB A;  4RKL A;  3GTK B;  1JOK A;  1V8Q A;  4HTH A;  4XT3 B;  5DAU A;  1QE6 A;  2PW5 A;  2QDB A;  1BCP D;  3E5S A;  4DN4 M;  1GXD C;  1X3Q A;  2BDN A;  3DWQ A;  2C9O A;  4IAL A;  3NHH A;  4OO1 I;  1BBX C;  1SNO A;  4QCL A;  3NK9 A;  1STH A;  2A68 C;  5DM7 3;  2ID0 A;  1S5B D;  2KOL A;  3FVQ A;  1JWU D;  3DM1 A;  4NP5 A;  5CBE E;  1ZYR C;  2M00 A;  4ODG A;  3VR6 A;  1ESF A;  1S5F D;  1BO0 A;  4IUP A;  1GJX A;  4XQJ A;  2B2W C;  3NWT A;  4OHJ A;  3MHB A;  1MBY A;  3T56 B;  1T5E A;  1SXT A;  1NSN S;  3NP8 A;  1CTM A;  3BVM A;  2CW0 C;  2SNS A;  5J22 A;  4MHE A;  1EYA A;  3L7Z C;  5IT9 L;  3PIO 3;  2TSS A;  2HDM A;  2F0V A;  4XDX A;  1JE4 A;  2F0D A;  5C5M A;  1M8A A;  4N9P A;  3K58 A;  3S16 B;  1CQV A;  1KLG D;  1O7Y A;  4DU9 A;  5I9O A;  1PFB A;  4EQO A;  2RSN A;  1CK1 A;  3PMF A;  1S5E D;  1UAP A;  1RHP A;  3FPP A;  1F77 A;  3MTS A;  2CQA A;  4LAA A;  5IGG A;  3QOJ A;  1WTR A;  4KTA A;  5C3E B;  4TSS A;  2X69 A;  3D31 A;  1ICW A;  4J6H A;  1CM9 A;  1SYE A;  4PMW A;  3GO5 A;  5LL6 S;  2E76 C;  3WDN A;  4DA2 A;  4QF4 A;  3TSS A;  2A74 C;  1H9J A;  4RHS A;  1SNP A;  2WIN B;  1W6J A;  1I6V C;  4R8N A;  1QWY A;  4I7Z C;  5K36 G;  2F0M A;  1JQY D;  3J81 L;  2WAC A;  1SBB B;  1VCI A;  4CBV A;  3Q24 A;  2Q8I B;  3J7Y W;  1RF2 D;  1B1Z A;  4RKB A;  5CMD A;  1D5M C;  2A68 D;  3QB3 A;  1AP0 A;  2J7Z A;  5IGD A;  3BDO A;  5I9P A;  5JJZ A;  2L11 A;  1PXU A;  5FOB B;  2PMZ B;  3PUW A;  2F0Q A;  5LL6 X;  1ZYR D;  2A6E C;  2A6H C;  1HQM C;  4JK1 C;  4NMZ A;  2KED A;  2H1E A;  1U4M A;  5CC4 A;  4FXD A;  2L0C A;  2CW0 D;  5I2Y A;  4G7H C;  4BS9 A;  2Q8T A;  3K57 A;  5C0X J;  2O2L D;  1WVL A;  2ENB A;  2MHV A;  3PO2 B;  2B8F A;  3I4L A;  1DYQ A;  5G3L D;  2B2W A;  3TZU A;  4ME5 A;  1LTG D;  2NN6 G;  1D1K A;  4FO2 A;  4XQN A;  1KDC A;  1I4H A;  3A7A B;  5C44 B;  1A3V A;  4CGY B;  3ND9 A;  1A2U A;  3K6O A;  5CV8 A;  2EJF C;  2E2I B;  1QCB D;  3QG1 A;  1DM0 B;  4OIJ A;  4ZYS A;  1EIH A;  2NN6 H;  1LTI D;  4TKO B;  2R6G A;  3OWE B;  4QMG A;  1K8O A;  2EY6 A;  1STY A;  4IQZ A;  2N88 A;  4DNR B;  1KNA A;  5M3M B;  4PNY A;  1TWF B;  3QWN A;  3A8K E;  5A2Q E;  4K5X A;  4X3S A;  3C2P A;  1DCZ A;  4HMI A;  3P75 A;  4A3F B;  1L0Y B;  1S5C D;  2FMC A;  2PW7 A;  4NW2 A;  1CFM A;  1F9R A;  2BDO A;  3NXW A;  2IL8 A;  1EZ8 A;  3J7A F;  1GHK A;  1ONL A;  2ICE C;  1QJO A;  2KCN A;  4BBS B;  1KAA A;  1V1P B;  3ERO A;  3NTI A;  1A2T A;  1SE3 A;  2BE5 C;  4FXK C;  1O80 A;  1TQO A;  3S15 B;  1FNW A;  2K32 A;  4HN7 A;  1SMY C;  4OO1 G;  3I70 A;  1ZEQ X;  2A6E D;  1V43 A;  2KCC A;  3HKZ B;  2A6H D;  3HOV B;  1BF4 A;  5JEA J;  3SK8 A;  5JOB A;  4KI0 A;  3H6M A;  3X3M A;  5D3D A;  2E74 C;  1HUM A;  5DM6 3;  1DD2 A;  3EQL C;  1XWE A;  3CRK C;  3GD7 A;  4BA1 I;  1OXT A;  1HPC A;  2FIN B;  1HFG A;  3GTL B;  1PTO C;  4B08 A;  2YU9 B;  2KQ3 A;  2BCO A;  2XN9 C;  2QF7 A;  5FK9 C;  4NKL A;  3CQZ B;  2EYP A;  3D3R A;  2Z4I A;  3VYT A;  1GHJ A;  2JYO A;  1V1P A;  4K5W A;  1I4P A;  3C1E A;  1PMR A;  1E2W A;  1B2T A;  1TS5 A;  1LTT D;  2IT1 A;  4K5V A;  5EPL A;  5IGF A;  1NUC A;  1GUT A;  1DJR D;  1FYC A;  4H7B A;  2F3W A;  4F87 A;  2F0P A;  5NUC A;  3N6R A;  4RA8 A;  2EYM A;  2JEB I;  4C3H B;  5C4Z A;  2WII B;  3FDT A;  3P1H A;  1EOT A;  2C5C A;  3ND8 A;  3BG3 A;  1FNV A;  1I4X A;  3NTH A;  1SYF A;  2ZXP A;  4ULL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...