4K2LA

Crystal structure of staphylococcal nuclease variant delta+phs i92q at cryogenic temperature
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
129
structure length
129
Chain Sequence
LHKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYQYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Cavity hydration in proteins
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 33
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2013-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4k2lA00
4ZUIA 4E6IA 3SK4A 1EYCA 2F0MA 2O4XA 2F0NA 2F0GA 3E5SA 3QOLA 4TRDA 3HZXA 5DEHA 1SNOA 4EQOA 3QB3A 2QDBA 1SYEA 4MIUA 5IGFA 4K5VA 5CV4A 5DAUA 1IHZA 4IUNA 3NUCA 4ID6A 1SNMA 2KQ3A 2F0KA 1SYDA 2M00A 3BDCA 2F3VA 2EY1A 2KHSA 5HGTA 2EYFA 4LAAA 5I9PA 1SYCA 5EKLA 2EYHA 5JOBA 1STHA 5EGTA 2SNMA 4PMBA 1STYA 3ITPA 5C3XA 1KDBA 2OEOA 3EROA 1F2MA 3EJIA 4K2KA 4QB4A 1STAA 2F0JA 3SK8A 4ZQ3A 3SHLA 4KY5A 1ENAA 1KABA 1A2TA 1EZ6A 2EY2A 1NSNS 3MVVA 2F0OA 2EYPA 1EZ8A 2WACA 5IGBA 2F0PA 2PZTA 5ISRA 2SOBA 2PYKA 2PQEA 3MZ5A 3OMGA 1JOOA 2F0QA 3P1HA 4J6HA 4KV6A 4IALA 3TP8A 4DU9A 4EQNA 5EKKA 3NXWA 3SXHA 5E1FA 5CV7A 1TR5A 2F0TA 1TT2A 1A3UA 3BDLA 1U9RA 3DMUA 5KIXA 2F0IA 5KRUA 2F0HA 3QOJA 2F0UA 3EVQA 1KAAA 5CV8A 4OL7A 2EY5A 5CV5A 5NUCA 4EQPA 1A3TA 2EY6A 1STBA 2F0DA 3D6CA 1EY0A 2RDFA 3OMCA 3NQTA 4DFAA 4DF7A 5I9OA 5J22A 4N9PA 3SK5A 4NP5A 5CV6A 5IGGA 1EY9A 3NK9A 5K5PA 2PZWA 2SNSA 5J39A 4WORA 5IODA 1SYFA 5M9OA 4K6DA 5CR3A 4RKLA 5IOCA 5C6AA 2EYLA 1EY7A 2EXZA 1SNCA 2NUCA 5IGEA 1EY8A 3OSOA 4KTAA 3MXPA 5F2DA 2F0VA 4NDXA 3S9WA 1EY5A 3R3OA 1SYBA 4KHVA 3C1FA 2ENBA 1JOKA 4HMIA 1EY6A 2PW5A 3H6MA 1EY4A 2F0SA 1ENCA 4KJOA 4PNYA 4K14A 1EYAA 4DGZA 3NP8A 5KGUA 4PMCA 4R8NA 3VA5A 5C3WA 4ZUJA 5C4HA 4B9XA 5CC4A 1JOQA 3D4DA 3T16A 1STGA 4QMGA 5JAVA 5KYIA 1II3A 4I65A 3TP5A 1EQVA 1F2ZA 4K5WA 3D8GA 3D4WA 4K5XA 3RUZA 4KD3A 1KDAA 1TQOA 2RKSA 5E3FA 4KY6A 4KJNA 3TMEA 5I6YA 2EYJA 1EYDA 4K2LA 4IZ8A 2OF1A 4N9TA 4NKLA 4ODGA 1STNA 1NUCA 3T13A 4F7XA 2EYOA 2OXPA 4KD4A 3V2TA 5J1ZA 2PZUA 1SNQA 4S3SA 5C5LA 1A2UA 5C5MA 3MEHA 4NMZA 3TP6A 1SNPA 3LX0A 5IGCA 3P75A 5IGDA 2F0EA 1SYGA 4B9WA 2PW7A 5C4ZA 4WRDA 3SR1A 3DHQA 3OWFA 1JORA 1F2YA 4H7BA 2HQEA 2F0FA 5CGKA 3U9OA 2F3WA 1KDCA 4K8JA 3TP7A 1RKNA 2RBMA 5IIFA 1SNDA 2F0WA 3MHBA 5KYLA 3PMFA 4YIJA 5KEEA 1AEXA 2LKVA 1A3VA 5I6WA 3C1EA 4G57A 3HEJA 4HMJA 2F0LA 4K8IA 5CV9A 4HTHA 3SK6A 4EVOA 3NHHA 4RKBA 4ME5A 5HURA 3ERQA 4F8MA 4KY7A 2EYMA 4QF4A 4J1MA
chains in the Genus database with same CATH superfamily
3LWEA 2EPBA 1QUQA 3AQQA 4IUPA 1JC7A 4LF6L 3W2DA 4JYAL 4FP5D 1B7YB 5EBCA 1YJWA 5JEAH 3KDFA 4MIUA 2UXDL 2NVQB 4DV4Q 2M00A 1R4QB 2F0KA 4F88A 2B2UA 4L6TB 2D5DA 4GLXA 4PMBA 5IE8A 3TREA 1DOKA 4JI8Q 4PZ7A 2OEOA 4H0LC 1A2TA 3ND9A 1RODA 2F0OA 4JBKA 4BXXH 1I4QA 4UHVA 1EIGA 4BBRH 3DEPA 5C44H 2IHFA 3CP0A 4RG1A 1JOOA 2RHSB 1Z47A 1Q8KA 2ZTEA 3BDLA 3DMUA 2PNHA 3CCRA 4RHSA 1Y8NB 2N49A 2F0DA 1TU2B 3PF4A 4CDDC 2IX3A 2B2UC 2CH4W 4NP5A 4YHHL 2K50A 5IGGA 3BZKA 1WTVA 4A93H 4IURA 1WTQA 1HQRD 5GROA 2HT1A 2MNAA 1YITA 1H9SA 2KHJA 2SDFA 2E2IB 3UI2A 4EX5A 1HNZQ 4YWMA 4BS9A 2X6GA 4PZ6A 1Q12A 4DV7Q 5DM73 3F1ZA 3TQYA 1PH3A 3HOYG 5IP7G 2C5CA 4QMGA 3BZCA 1LUZA 3U9SA 5KYIA 2I07B 1PYWD 1G6PA 4K5XA 1Z7TA 2XGTA 5C4XG 2RSOA 1KDAA 4M8AA 2KUMA 4J15A 3TN2A 1PH8A 2B2TC 4ODGA 1JR0D 2F3IA 1ZYRC 2IT1A 2I5LX 4GN3B 3R2TA 2I5MX 2OXPA 1PMRA 4C3HG 4C3JB 1K83B 3F2BA 4NXNQ 1A2UA 2XNAC 4NMZA 3ULPA 3LX0A 3S2HB 4RFBA 3D31A 4DXGA 5T1GA 5EQ0A 2HQEA 2JEAI 4A3EH 2PCFB 4PMWA 3HS0C 3EN2A 1KDCA 1B50A 3TP7A 2RBMA 1I94Q 1O7LA 3HOUB 4GNXA 4A3JH 1A3VA 1RHPA 1KXLA 4MZ9A 4DNRB 5FLMH 1S5CD 1D5XC 4QIWE 2B39A 3NHHA 4ME5A 4UP9A 5JEAG 1XMOQ 4ZUIA 3FPPA 1HNXL 2R7ZG 4IQZA 1PH5A 3N52A 2JE6I 3W1BA 2NZOA 3VR2A 4X62L 2JA8B 4YY3L 3R8BA 4A3KB 5IWAL 3NUCA 5IGFA 1Z9FA 1O78A 5M3MB 2PI2A 3K5NA 1JE5A 3A7AB 5C44G 3MEFA 1B2TA 5J39A 4RAUC 2CW0C 1CT1D 3GDEA 1KABA 1VQ7A 1QB5D 4DV2Q 3ER0A 2ZJRA 2EYPA 2BCOA 3KLWA 4UDUC 2IW3A 1CQVA 1LTBD 1LTSD 2H5XA 3RLFA 3OTOL 3A56A 3E0EA 2Z8LA 4DNIA 3J80E 1PA6A 2BOSA 3EVQA 1X6OA 4A93G 2YU9H 2HCIA 2FJ2A 2MO0A 2RQXA 4C2MB 2QA4A 2PO4A 1MJCA 3NK9A 4RCNA 1BQQT 4P2CB 3T4AC 1HTPA 2QW7A 5C0XJ 3M4PA 1KRSA 4BY7G 2MO1A 1EY7A 3PIPA 2FINB 2EXZA 1HZAA 4XIGS 1EU4A 1EY8A 2OQ0A 5A2QE 3EBEA 3DM1A 2HIXA 1PRTD 1SYBA 4HMIA 2D2CC 4DGZA 4K14A 4ZLTF 1YNXA 1BBWA 1ENFA 2Y0SG 4P71A 1H9RA 1WCMB 5JPMC 1JOQA 1MGSA 1K0RA 1II3A 4DA2A 5M3FB 2RCNA 4XQQA 4POFA 4BA2I 3D4WA 1PH9A 3BYYB 2KVMA 3HP3A 1RL2A 4A3LG 4YWKA 4FF4A 2WAQG 4TQUS 4KD4A 4J8QA 1TWAH 1B3QA 1X56A 5KNBA 3HG9A 4A3EG 3K7AH 2C35B 5C5LA 1HA5A 1UNSA 3J81E 4A3JG 2PW7A 4WRDA 1TS5A 2MJ8A 2VUMH 2F0FA 5FLMG 3G71A 4JI8L 1B70B 2N88A 1IYJB 5FLXE 3CKIB 1L0YB 3T51B 1NMGA 3FRPB 1NAPA 5IT9c 4K0KQ 1UE6A 2TMPA 4E6IA 3GTMB 2K03A 1CHQD 2VQFQ 3EA6A 3HKZG 3EQLC 1XX8A 3M4YA 2A68C 4PZ8A 1TKWB 1SE4A 4OHJA 1QOHA 1SYDA 2VNUD 1PH1A 2WKDA 5JOBA 3ZYYX 2CWPA 4JI5Q 2ZTDA 1LABA 4HIMA 4C3JH 1K83H 1G51A 1HNZL 4DAVA 3S2HH 2XRQD 4DV7L 4FNFA 3HOUH 4X3SA 1SE3A 1VQFA 2AQ1B 1AP0A 4Y7NH 1RIPA 2PZWA 1BBXC 4DPGA 2CW0D 2P5ZX 4CDCC 4NXNL 1KAWA 3FKIH 1KL9A 1JB3A 3S9WA 2B63B 4X66Q 4QQBX 2JA8H 3C1FA 4A3KH 2PW5A 4FF1A 3JAMc 3Q8DA 1K28A 1GOZA 5C3WA 1QCBD 1TVXA 1I94L 1EWIA 3M4QA 5M5XB 1K8MA 5CORA 1N36Q 3TP5A 1IYUA 3IRBA 3BVGA 1I5FA 4ZRZA 1XMOL 4X6AH 2R93B 3BS1A 1TS4A 1C9OA 2AKWB 1NBWA 4B3RQ 4KKUA 1RTNA 1YEZA 2F0EA 1JORA 3T56B 4C2MH 4L5QA 1VQCA 2RVLA 1UE7A 1ET6A 1KTKA 1PTOB 3IL8A 2LKVA 4V190 4QJFA 4DV2L 3A5UA 1S5ED 1Q3LA 1FYCA 4F8MA 1KNAA 2ATWA 4BY1H 1FJGQ 4OEMB 4DR7Q 3E5SA 3ERSX 4LK1C 1WCMH 1S5DD 5JJZA 5M3FH 4NXML 2L12A 3A8JE 5HGTA 1NJIC 5M5WB 5I9PA 1EQTA 4ZAIA 3R2IA 3QWNA 1A62A 2AWNA 4FF3A 2NTSA 3OYYA 1VQ5A 2XVSA 4KHZA 4GN4B 1RD9D 3HOXB 3CCJA 3M9BA 4IUQA 3GTOB 1A3UA 5JVG3 1Q81C 2JA7B 1F9PA 2A68D 3RLOA 5I9OA 3S1QB 1STBA 1GHJA 3D3RA 2FFKB 1U5KA 3DWPA 4JC0A 1E1OA 4HCEA 5JPNC 4HN7A 5H1SE 4A3KG 3F2CA 1E2ZA 4DV6Q 4KN7C 3H09A 5M3MG 2IWHA 1I6HB 1DM0B 1N8RC 5FOBB 3MA2B 4FXGC 4PQXA 2VXWA 1EYAA 1I50B 1CA6A 4U68A 3LNNA 5C4XB 1N9WA 5KGUA 1HZCA 3VA5A 1E2WA 1K73C 1JT8A 4OO1H 3U50C 4XQNA 2RDHA 1WJJA 4C3HB 4K0KL 1FNWA 4KD3A 4KY6A 2JSOA 1CZWA 1KHIA 3I4NB 2VQFL 1BO0A 3A8KE 3KF6B 3S15H 4A76A 3V2TA 1EWCA 2X6LA 3C2PA 4S3SA 2WKCA 2LSSA 3TP6A 3GV6A 2QCPX 3CRKC 1E24A 1OXSC 1MD2D 5DLQE 5CGKA 4JI5L 3G48A 4OO1I 3HOVB 4K8JA 1IL8A 5EBDA 3PO2B 2SEBD 5DM63 2DY7A 5I6WA 4DR4Q 3HEJA 2CFMA 4RKBA 2B63H 3U4ZA 1WCMG 3OW7A 1D8LA 2WP8J 2Q8IB 1LYLA 3CCVA 2NN6H 2F0GA 2OTLA 3J80L 5CV4A 4X64L 1HCZA 1L1OB 2F3VA 3NBHB 2PQAB 5LMNL 4JBJA 1TWCB 2R93H 3KLSX 1DYQA 1HH2P 1QWYA 2XWJB 1I4XA 1QG7A 2EY2A 4HIOA 3PIOA 2ID0A 1WOCA 4X66L 1CTMA 2AHOB 3I56A 3A74A 3IKJA 2PZTA 2PYKA 3I4MB 1IXRA 2NN6I 1TWGB 1LTLA 2A19A 1TR5A 3JAMi 4ZYSA 5KIXA 2AUKA 1N36L 4LFBQ 1BXTA 1HR0Q 1IYVA 3E3XA 4QIWB 1SAPA 2ASBA 1L0XB 2EY6A 4G4KA 1J8IA 3P20A 2FMMA 2CCZA 1V1PA 4QCLA 5AFWA 4B3RL 1VQEA 5IOCA 2L4NA 2A1AA 1SROA 3CF5A 2CWAA 3CPWA 3PUXA 4FDBA 1ICFB 1VQOA 2QEXA 3J81L 4DV5Q 5M5WH 1DOMA 4JOIA 1RCVD 3DUZA 2UUAQ 5I2XA 2IY5B 3VR3A 4K5WA 1ILPA 1Y14B 3F8TA 3HOXH 1JB7A 4K2LA 1EYDA 3T13A 1FJGL 2KEEA 4R4OA 4RGMA 4DR7L 3GTOH 1F9SA 2JA7H 4C1NK 1SN8A 5C5MA 1L0WA 3P75A 3S1QH 4GS3A 2KCMA 5BN5A 2Z4IA 4I7ZC 5EJWA 5LL6X 5GAEC 3UE0A 2HQLA 2KJXA 4RMFA 2B63G 2D9UA 2R6GA 4JOIC 1F9RA 3PSIA 2NN6G 4JI0L 3FHWA 4G7OC 1I6HH 3S14H 3HOYH 1VQIA 5IP7H 1AN8A 5G3LD 4J1MA 4KLKA 4POGA 4RCOA 2A6HD 3K6OA 2D62A 5EPKA 1I50H 3TDQA 5C4XH 4DUZQ 1U4PA 3GTLH 3KOJA 3M7GA 4B3SQ 3QB3A 1B44D 2CVRA 1O7YA 1EOTA 2E8GA 3WDNA 4C3HH 2UUBQ 2E2JB 1GUTA 1OXUA 3FDTA 1MBYA 3D6WA 2EYHA 4H13C 1XMQQ 2KBNA 4DV6L 1CM9A 3EROA 4IOCA 3I4NH 1SEBD 2OWOA 1WTOA 4ZK9B 3G6EA 4DNTB 3KFUA 1ONLA 3H3VC 1PH4A 4C3IG 2VY3A 3KF8B 4Y52H 3RN5A 2ZM6Q 1NMFA 1TT2A 3PV0A 3HOVH 3STBC 2F0UA 5K5PA 2R7ZH 3L3OC 1EQRA 4HIDA 3PO2H 3HFZB 1HFGA 3OMCA 1GUOA 1PXUA 5C4JB 4XT3B 1H95A 4GKKQ 1P8LA 4C1NI 3C3LA 2MGSA 3FEWX 4P74A 5JJKA 1PRTC 1I3QH 4HSVA 1K9MC 5LL6S 3I55A 3CCUA 1EY4A 2PPBC 4FO2A 1ML0D 4GOPB 1W6KA 3HOXG 3MTSA 1TWCH 4XTCS 4DR4L 1CA5A 4P73A 2AQ2B 2JA7G 2RKSA 1C48A 2B2TA 3TMEA 1LTRD 2DGYA 3I4MH 5ELOA 1TWGH 3PUVA 1R9TB 5LHY1 5J1ZA 1N32Q 1UE1A 2I5HA 4OX9Q 1SYGA 2Q8RE 4BY7H 3AFQA 1QVFA 1B3AA 2KEDA 3TZDA 1PFBA 2PMZE 3GTGB 1AW7A 4H02A 1Y1VB 3E6ZX 4M1UB 3SGIA 3Q23A 1PYBA 4UP7A 1VQLA 3AFPA 3IAYA 2ZT9C 2L9HA 1D7QA 1K0SA 1WD0A 1GM5A 1EYGA 1SR3A 5DEHA 4LFBL 1HR0L 1XNQQ 4P72A 4A3LH 1U4LA 3A54A 4LF4Q 3I4NG 1G2SA 2Z9HA 3QJYA 1ZEQX 5L37A 1BVSA 4DN4M 3CD6A 1M8AA 3ITPA 1JQYD 1Q8IA 4QL5A 3CCLA 3TS0A 1S72A 3NTHA 1G6ZA 1S5BD 4DV1L 3WOFA 4NW2A 2V1CC 1HQMC 1SMYC 2VS1A 5CBEE 3AYHB 2CQOA 3HOVG 1XPOA 2SOBA 3PO2G 2TSSA 4DV5L 4TKOB 1X3PA 3SVMA 5E1FA 4LNQA 5JJLA 1PV4A 2CKZB 3AU7A 1VMPA 2UUAL 2JA6B 1PRTF 2EXDA 3RNUA 4TSSA 1PHJA 4CKCA 5ELFA 3M3YB 3RZOB 4FVMA 4R4QA 1D1KA 3CQZB 2K5QA 3M85A 4LW1A 3SDZA 1ESFA 1EU3A 4ILWA 4BA1I 1W2BA 4KTAA 3TRZA 2DUDA 4NDXA 1CI3M 2IX1A 2E75C 3R3OA 3S2DB 1A0IA 2K01A 4Z9CB 1HUMA 1QVCA 4EQ5A 4PNYA 2E2JH 1JWSD 3BVMA 2J0TD 2R92B 3UDFA 5CC4A 3STBD 1EFID 3I4MG 1STGA 2N78A 5KNDA 4G7HC 4I65A 4ALPA 4O1NA 4NXMQ 1F2ZA 4HJ5A 1OXXK 3CRLC 2QEJC 4OONA 4ABNA 2WAQE 3KUPA 4DK0A 4NKLA 1QJOA 4DUZL 1SXTA 2KHIA 3CAMA 2PZUA 1SFOB 3I4LA 4B3SL 4JPBW 2EZVA 1EL0A 1CSPA 2UUCQ 2NVQH 1K3RA 2PI2E 2UUBL 5IP9G 5EKIA 1XMQL 4IUUA 5C4JH 3A7LA 1M1KC 3U9OA 4FXDA 5FO8B 4KN4C 1RKNA 1WTPA 1DJRD 5KYLA 4EGVA 3PF5A 4LJZC 5GQOA 2KCTA 5E4XA 1IBLQ 1D2BA 2K5WA 3W3AA 3OIPA 2ZM6L 2QKIC 4LF5Q 1HTLD 2RSNA 4KK7A 2QDBA 1VMCA 2QF7A 3TBIB 2EY1A 2KHSA 5EKLA 4GKKL 4ME3A 3TZUA 2R3ZA 2RF4A 1YI2A 2ZJPA 1T9HA 4ZQ3A 1R9TH 3QO2A 4MHEA 1MKHA 3X3NA 3K59A 1YHAA 3MVVA 2E2IH 1EZ8A 1RJTA 1XXGA 3C46A 5CMDA 1KIXA 2JK8A 1IBKQ 4LWCA 2VW9A 3VYSA 2PQEA 3MZ5A 4KV6A 5EPLA 1SDFA 2F0QA 1XYIA 3W1GA 1U9RA 1VQMA 3GTGH 2E74C 2F0HA 4OL7A 3D6CA 3VA7A 3L7ZC 1Y1VH 4RGTA 2GA4B 2NBFA 4QY7A 2C9OA 3ONAB 2K1BA 1WD1A 4A3CH 1FL0A 3CPFA 1N32L 5FJ8H 4OX9L 1SMYD 2JQOA 2K5NA 3NWTA 5BR8Q 1AZQA 1ASZA 1LT3D 2F0SA 1O80A 2Q2IA 4IPGA 4GN5A 4IUVA 5I2YA 4OIJA 4R8NA 3H0GB 3J7ZC 5C4HA 2CH4A 1F2LA 1VQNA 1SRUA 3GTPB 4X64Q 2Z4HA 2HIVA 2EIFA 2NWGA 4IFDJ 4X3KA 1KC8C 5ELDA 1CFMA 5LMNQ 4N9TA 2OF1A 1YIJA 3I7FA 1XNQL 2B2VA 1BCPB 4LF4L 4YWLA 3K7UC 4KKSA 1F2YA 4H7BA 5M3MH 1QZGA 4O2DA 1XNRQ 1L2FA 3OPOA 3S16B 1UEAB 3RZOH 3V96A 1IZ6A 1PH7A 5IIFA 1FGUA 3M4OB 4IOAA 5KEEA 1GUSA 4CDEC 3DWQA 2I46A 3EIVA 1HZBA 2CQAA 1F9QA 4QB4A 3S2DH 3RZDB 4KY7A 1GO3E 4NB3A 2F0NA 3HZXA 1DXMA 5ELCA 2B2VC 4A4IA 4QUFA 1VQ9A 2WB1B 4K5VA 4IUNA 2LXKA 2KQ3A 3Q6SA 4C3IB 1TIID 1KDBA 3PO3B 2XSCA 3MXNB 1KLGD 1F2MA 4K2KA 1KQSA 4A3GB 1TWHB 3SHLA 1GXDC 3CHBD 2L5TA 3A0JA 2RA4A 1SBBB 1ASYA 4BBSB 2NVTB 2HCCA 1SFOH 1MI2A 1HRJA 3VR4A 3H94A 2N55A 2DY8A 2JA9A 4DXFA 1J9OA 2VQEL 4DUYQ 5EKKA 4DAYB 4L5SA 1C0AA 1I4HA 1Y1VG 1V43A 3BU2A 4DV0L 1PZKD 3T1HQ 1PH6A 2EQSA 4HJ8A 3PCOB 4A3CG 3NQTA 3PIP3 3SK5A 1UAPA 2ZXOA 2BA1A 2F52A 5HGQA 5FJ8G 3I8ZA 1WVLA 4X3TA 2UU9Q 1DONA 4HCSA 2KCCA 4RKLA 1XPRA 3HOZG 2A8VA 1ICWA 3OSOA 3MXPA 4YCVA 4JI0Q 4LFCQ 5IYBG 2UUCL 1EY5A 3UDGA 1IKMA 2JEBI 4HJ9A 4QGUA 3P7JA 5COYA 3BG3A 4B9XA 1AH9A 1VQGA 4X3UA 2EDGA 1LTID 5JAVA 2F4VQ 1IBLL 1AE2A 1V1QA 4DR6Q 2J4XA 4RWSC 2K7VA 4KKTA 2K5DA 5C0XH 3GTMH 5IYDH 1PZJD 3I91A 1YNND 1DCZA 4LF5L 2JA6G 3OHXC 2Q8TA 2KCNA 4RH6A 5I4DA 1PVOA 5JEAJ 1YHQA 2R7DA 1ESRA 4B9WA 1I6VC 3OWFA 2IPKD 4A3DB 5D3DA 3K80C 1C7YA 2G9HD 4DV3Q 1JWUD 4RGOS 3S1RB 1J5EQ 3C1EA 3K5MA 1TXYA 5D65A 1VDZA 3VR5A 4B3TQ 1IBKL 5C0XI 4OWTB 2JJQA 3VYRA 5HURA 2R92G 1XTDA 2A6HC 2RHQB 1A8VA 3I90A 2BE5C 4K6LA 4XT1B 2L1BA 4HEDA 4AQYQ 1R4PB 2NTTA 1X3EA 2L0CA 3H0GH 4TRDA 1QNKA 1FNVA 2Q2UA 3GTPH 1EIFA 1A63A 2ICIA 1IHZA 3A55A 2JN4A 1QUQB 1UE5A 1SNMA 4XDXA 3MWYW 5K36H 2UXCQ 1MHWC 2YTVA 4IJLA 4UP8A 1LV9A 1A15A 1S40A 2KECA 2BDOA 1VQ6A 4MTNA 1TS2A 2ZTCA 3D0FA 3KDFB 1LT5D 5BN4A 2WIIB 4AH6A 4A3FB 1HZ9A 4O0AA 5BR8L 3HOWB 3TP8A 3I2ZA 2K52A 3PUYA 4DK3C 1EUJA 2V4DA 5C3EB 5M5XH 2RCFA 1D5MC 1KAAA 3M4OH 3S17B 2X69A 1PFNA 4CKEA 4JBMA 1XTCD 1GVPA 3RZDH 1WTXA 5IODA 2H1EA 2N8NA 3CC2A 2EYLA 3MC0B 1FVIA 3GTQB 3T53B 3U58A 4BBRB 2K5HA 1EFWA 3H6MA 4JI2Q 2EE1A 1XNRL 2MQHA 3CCMA 1H9SB 5HY6A 4PMCA 4ZUJA 3KBXA 4OXPA 4C3IH 1PTOH 2OQKA 4JG2A 3PO3H 5C0XG 2Q2TA 5IYDG 1ZKOA 4A3GH 1GJXA 2FMCA 1TWHH 4Q0FA 4BBSH 3MFYA 1EQVA 1Q82C 2NVTH 1MIUA 3CC7A 4CKBA 3DLLA 1Y1WB 1PYSB 2Z6BA 2JP1A 4DV1Q 3A5ZB 4AYBE 1HJPA 2F4IA 2XRSD 3QIAA 3K58A 5G3LF 1UEBA 2D0OA 2GN5A 2H4OA 3U4VA 1SNDA 2F0WA 3MHBA 1GUWA 4H44C 4FYDA 4L5TA 4LUOA 1A6XA 4LF8Q 4HTHA 3H0GG 1GUGA 3G6JB 3ERQA 4DUYL 3GV3A 4GNXB 4L8JA 3SK4A 1ZXTA 4PV1C 3I70A 5K36G 3MXGA 2PNRC 1DD2A 3T1HL 1SNOA 1VF5C 2IJ0A 2A6EC 1W6JA 3I73A 3T1YQ 1PTOC 4LFAQ 4JI6Q 2BH8A 3Q22A 4GLVB 3DWAA 1STHA 2UU9L 4CJ2C 2Z0SA 2F0JA 1VQJA 2IX0A 5FO7B 4LFCL 1E1TA 2JA5B 3B6YA 4WJ3M 1C8CA 1Q86C 5CYUA 5ISRA 2K6AA 3J81j 4DU9A 4J6HA 2BDNA 4JBWA 2OCEA 4A3DH 1E22A 2BE5D 5IT9L 1EEID 5IYCH 2UXBQ 2XWBB 2F4VL 5NUCA 1E2VA 4DR6L 3S1RH 2B3GA 1PFMA 1PFSA 4UPAA 3PUZA 2BA0A 1MSGA 4A3IB 2WB1G 5JVH3 4JCVE 2EJMA 1O7IA 3K8AA 1KD1C 3BVZA 1LT4D 2VL6A 4HSPA 3PO3G 4A3GG 4A3BB 3FVQA 4BBSG 3PUWA 4RA8A 4DV3L 1QZHA 4MNOA 1J5EL 3KF6A 2LMCB 1TWFB 2CHBD 2Z1CA 3DXJC 4B3TL 4A3FH 2A69C 3K5LA 1YJ9A 4ULLA 1I4RA 4DAPA 2IL8A 4AQYL 5ELEA 4FXKC 1AE3A 4IPCA 5C3EH 3GO5A 3KLRA 3NPPA 3S17H 1Q46A 2UXCL 1IW7C 2Z6KC 1X3GA 2LS01 3LGJA 4OIKA 5AJ3Q 1NTGA 3ZJYC 1VF7A 3TS2A 1BF4A 3JAML 5CBAE 1PTOF 3SK6A 3H15A 1HFNA 3GTQH 1Y8OB 4C56C 3SR1A 1BCPD 3X3MA 4R4TA 1L1OA 1K8GA 3NBHA 3Q0AA 1TWAB 2PQAA 1WTWA 1U4RA 3K7AB 3F2UA 3CMAA 1SYEA 1DGSA 4YCWA 4APVA 3OWEB 3NTIA 1YZ6A 2XIWA 2VUMB 3PIO3 4L5RC 5EGTA 2SNMA 3IFDA 1STYA 3BYTB 1Y1WH 3EJIA 5IP9H 1EQQA 4GKJQ 1D5ZC 4KY5A 4A3DG 2D0PA 1YVCA 4CBVA 2YV5A 5IYCG 3DEOA 3OMGA 4JI2L 3URYA 3P1HA 4EQNA 4F87A 4IALA 1YBYA 4PG3A 1L1OC 5CV7A 3CU7A 4OGQC 1QILA 3V05A 2KA7A 3VYTA 1Q1EA 2A6ED 2EY5A 2OTJA 3HOZB 2HHHQ 1PTOD 1UUPA 4OWWB 1V8QA 1VCIA 5J22A 1NCVA 1HXYD 1JCKB 3ULJA 4N8FA 1JJGA 1U0LA 1BKBA 1G2TA 1S5FD 1SMXA 2MUYA 3UE1A 2VB2X 1G291 1CKOA 1JOKA 1EY6A 2YYZA 1BNZA 4LMQD 3BZDB 3JC66 2IHEA 4A3FG 1LTAD 3GP7A 1EIYB 3HOWG 3E0JA 5E4WC 1Y8PB 2LY7A 3KJPA 3E9IA 4FF2A 4LF8L 1YHBA 1LM0A 1Z6HA 3D8GA 2JA5H 1HR0W 4Y7NB 5C3EG 1DOLA 3J7YW 1AZPA 4L63B 5M9OA 2K05A 3J80c 2MP1A 5M5YB 1E0BA 1H9MA 3KYHC 3RMHA 1SNQA 3IFTA 1FD7D 3FKIB 4HR7B 3T1YL 4LFAL 4JI6L 3J7AV 2ALYB 1X54A 4NPSA 2Y0SE 4CJ0B 2VQEQ 2E76C 4DV0Q 1IL2A 3KJOA 4BXXG 1JWMD 4A3IH 4BBRG 3MXUA 3PMFA 3RN2A 4GNXC 2NVXB 2E5LQ 2NYZD 1CSQA 4X65Q 4A3MB 4G57A 4EVOA 4B08A 1SE8A 3NTKA 4QF4A 1GKHA 2A69D 4A3BH 1SLJA 3FMCA 2F0MA 1SJED 2HD3A 2UXBL 1T5EA 1FGBD 4CJ1B 1EWHA 2I0QA 1Y1WG 1TWFH 1C4QA 4BWGB 3HGBA 1IW7D 3NE5B 4LAAA 1SYCA 3WWVA 3K57A 4KHPQ 1VQAA 3WOEA 1D1IA 2VZAA 3KF8A 3BJUA 5T1IA 1XJVA 3SK8A 1WTRA 1ENAA 4AIMA 3J81c 1PLFA 3QG1A 3L0OA 3CC4A 2E2HB 3E9HA 4U673 1STEA 2EJGC 3HKZE 3ICEA 2JXMB 2O2LD 5A35A 3NENA 4OELB 3HKSA 4MN3A 4BY1B 2F0TA 5FLXc 4IO9A 1B1ZA 2AQ3B 1VQPA 1LACA 3EFXD 3L9AX 2LFNA 1B53A 1X3QA 3CCEA 1RF2D 1WYDA 4JK1C 4K6DA 4GOPA 3NEMA 4GZYC 1YNJC 2NVYB 3FPUB 5IGEA 2XN9C 3NWSA 2WFWA 2F0VA 2LXJA 4XYQA 3CMEA 2L11A 4DV4L 1OTCA 1CQFA 2M2LA 5FO9B 2JA5G 1I4PA 4RHRA 5AJ3L 2L55A 3D4DA 3BDOA 2KOLA 2F1MA 3RD4A 4HJAA 1JJ2A 1VQ8A 4R4IA 4ZKBB 3O13A 1YNNC 4KJNA 2K4KA 2EYOA 4GOPC 1ZYRD 4JI7Q 1ILQA 3MEHA 4A3IG 5IGDA 5IT9E 3HOZH 4LUZA 1RDPD 5IYBH 4JI3Q 2Q2HA 1VQHA 1X65A 4JV5Q 1B8AA 3I4OA 4GKJL 1JICA 3S1MB 4A3BG 1FNUA 3SE0A 4K8IA 4HMJA 1KRTA 2F0LA 5EPJA 3KK7A 1BUVT 1K8AC 1FR3A 4XXEA 1Q7YC 2EYMA 2ZJQA 1K8OA 1KLUD 3TEHB 1EYCA 4DR1Q 3S15B 3QOLA 2GVAA 3OOCA 1Q1BA 4DAMA 4EQOA 1CK1A 4MTKA 5ELBA 5IY0A 2DNEA 2HHHL 2JA6H 4LF7Q 4ID6A 3BDCA 4JI4Q 2EYFA 3M3YH 3CQZH 3NQIA 3G4SA 3K0YA 1JE4A 1QNUA 1NR4A 4AYBB 1STAA 1IBMQ 2EVBA 1ET9A 1LTGD 5M5YH 2EJFC 1EZ6A 2K5VA 4ZCKA 4RGNA 2WACA 1YJNA 3ULLA 2WINB 3UDIA 4IJHA 1PDQA 4XYOA 2R92H 1QE6A 5KRUA 1BBUA 5CV8A 2NVXH 1NY4A 4A3MH 1SJHD 3ND8A 1EOVA 1VQDA 4XQJA 4HIKA 5FK9C 3JAME 3S1NB 4O42A 3DM3A 5EAYA 3J80i 2VUMG 1W3SA 5F2DA 3GTJB 2B2YA 2AWOA 2RDGA 2ENBA 1V1PB 4UAIA 2XTIA 4KJOA 2DJFC 3SEBA 4DR2Q 2AUJD 3NP8A 2B8GA 1NNXA 2K14A 4JW0A 2E5LL 3N6RA 3K81C 2L15A 4X65L 1JJCB 3M7NA 4IPHA 1N33Q 5GAGC 4LUVA 4DK1A 1N34Q 2E2HH 1TQOA 4YCUA 2ZXRA 5GAHC 2ICEC 5I6YA 3F2DA 4F7XA 4JI1Q 5DNFA 3RR5A 2NZHA 1YNJD 2B2YC 1SNPA 2N3SA 3KLSA 1NR2A 4DR3Q 3AEVA 4B3MQ 5D14A 2MFIA 4KHPL 2F3WA 4C3JG 1MJEA 5LMUQ 1PZID 4YIJA 1AEXA 2G5DA 4LF9Q 3L2PA 3GQBA 2NVYH 1VS0A 4P75A 4DKAC 1BR9A 3J81i 1Y69U 3S24A 2B29A 3HOUG 1E7ZA 1CKNB 2E2DC 1K3BC 3GTKB 3PQIA 3FP9A 4IPDA 3LWUA 4V0BA 2K33A 1H9KA 2EOTA 3CCQA 4CGYB 3FKIG 5C3XA 1GHKA 1G91A 1HNWQ 2JA8G 2K75A 1RTOA 1B9NA 1NSNS 1X3FA 5IGBA 1T5XD 1CHPD 1TS3A 3J7A5 1LTTD 2F0PA 4QUCA 3S14B 3HOYB 3H91A 4DR5Q 4A3MG 3NXWA 2FHTA 1GUNA 3SXHA 2NZ1D 4LF6Q 1LLRD 1PRTB 4JYAQ 1VQBA 3GTLB 3QOJA 2JYOA 5CV5A 3S1MH 1EY0A 2RDFA 4DFAA 4DF7A 2UXDQ 1SE2A 3RLNA 1EY9A 1HHVA 3AB9A 2SNSA 4WORA 5JJIA 5CR3A 1CKMA 5C6AA 3CXCA 4JI7L 1HA6A 1V9PA 1OO9B 2MHVA 3K0XA 1KNEA 2O5JC 4TVAB 4KHVA 4OWXB 4ZKCB 2DNCA 4CDFC 1ENCA 2PMZB 3Q24A 3S16H 4JI3L 2WV6D 1DZ1A 1X55A 4JV5L 5KNCA 1H9JA 3T16A 2NB0A 2R7ZB 1VQ4A 4BY1G 1BOSA 3MFGA 5ELNA 4YHHQ 3MAQA 4IN3A 4N8X1 4IZ8A 1O7ZA 1NUCA 1STNA 4DR1L 2ES2A 5M3FG 1I3QB 1P16A 3I72A 5IGCA 1NE3A 5C44B 4WJWA 4LF7L 3PGZA 4JI4L 5C4ZA 3W5OA 3DHQA 3NSWA 4UY8C 1OXTA 3UDXA 1TY2A 1CUKA 2M9VA 3S1NH 4I7AA 4R4CA 1IBML 2QGQA 5FKAC 1I4GA 1HUNA 4IFDH 3GTJH 5J3BA 1BCPC 1TY0A 1PH2A 5A2QL 3K5OA 4A93B 2R61A 1D6EC 2KENA 2O5IC 3G7LA 2A5HA 1B9MA 2O4XA 5LMNW 2OT2A 2DJGC 3MXNA 5DAUA 4BY7B 5BN3A 1X32A 4GLAC 1GD7A 3OW2A 3VR6A 1V1OA 4CHTB 4R8IA 1X9NA 4DAYA 2MPMA 2K32A 4IFDI 5GADC 4R9WA 2Y0SB 2VB3X 2R7FA 1WFQA 4DK6C 4OO1G 3VYUA 2QILA 2K04A 1LT6D 4DR2L 1HNXQ 1EEFD 2B2WA 2BH2A 1E3PA 1UWVA 1Q90A 2F0IA 3I3CA 1S3OA 3R93A 4G7ZC 4HAEA 4WJ4A 3A8IE 4EQPA 4KMUC 1A3TA 4X62Q 2WAQB 3HRZC 1XWEA 1F77A 5D3IB 4YY3Q 2F03A 1N33L 4N9PA 5IWAQ 5FLXL 1BDOA 5CV6A 1N34L 3NBIA 4Q5VA 2WB1E 4A3EB 3J7AF 4JI1L 1J6QA 4A3JB 2A74C 1S4ZA 1B4OA 1SYFA 3GD7A 1XPUA 3GTKH 2ZXPA 2HUGA 1CZGA 1SNCA 2NUCA 4JVZA 4IUTA 3H3VH 1OXVA 3AMUA 4DR3L 4AYBG 4B3ML 1MSHA 3TSSA 2AMCB 3OTOQ 2B2WC 4WFN3 5LMUL 3D4RA 4LF9L 2FXQA 1CKNA 1EIHA 2K28A 3HKZB 3RUZA 1AFPA 2HDMA 1U4MA 1LO5D 1M4VA 5E3FA 2YTYA 3NELA 2EYJA 1SSOA 2QDLA 4KI0A 4R1JA 1IKLA 1WI5A 5E7NA 3H3VI 4HJ7A 3VDYA 2HDLA 3KBGA 2A73B 2R93G 2GVBA 2J7ZA 5TSSA 2Z6KA 1BCPF 1WTHA 4A75A 1VQKA 4IFDG 1HPCA 3QR8A 2G9DA 1JMCA 1QVGA 1HNWL 1M90C 3CCSA 2YU9B 5CV9A 1G8ZD 2DN8A 2B8FA 3HOWH 2YTXA 3CW2C 3OIQA 4DR5L
chains in the Genus database with same CATH topology
3LWEA 2EPBA 4IUPA 1JC7A 3W2DA 4FP5D 5EBCA 5JEAH 4MIUA 2NVQB 2M00A 1R4QB 2F0KA 4F88A 2B2UA 4L6TB 2D5DA 4PMBA 1DOKA 2OEOA 4H0LC 1A2TA 3ND9A 1RODA 2F0OA 1I4QA 1EIGA 3DEPA 1JOOA 1Z47A 3DMUA 3BDLA 4RHSA 1Y8NB 2F0DA 1TU2B 2IX3A 2B2UC 4NP5A 5IGGA 1WTVA 4IURA 1WTQA 1HQRD 1H9SA 2SDFA 2E2IB 3UI2A 4BS9A 2X6GA 1Q12A 5DM73 2C5CA 4QMGA 3U9SA 5KYIA 2I07B 1PYWD 4K5XA 1Z7TA 2RSOA 1KDAA 4M8AA 2KUMA 3TN2A 4ODGA 2B2TC 1JR0D 2IT1A 1ZYRC 3R2TA 2OXPA 1PMRA 4C3HG 4C3JB 1K83B 1A2UA 2XNAC 4NMZA 3LX0A 3S2HB 4RFBA 3D31A 4DXGA 5T1GA 5EQ0A 2HQEA 2JEAI 2PCFB 4PMWA 3HS0C 1B50A 1KDCA 3TP7A 2RBMA 1O7LA 3HOUB 1A3VA 1RHPA 4DNRB 1S5CD 1D5XC 2B39A 3NHHA 4ME5A 5JEAG 4ZUIA 3FPPA 4IQZA 3N52A 2JE6I 3VR2A 2JA8B 4A3KB 3R8BA 3NUCA 5IGFA 1O78A 5M3MB 3K5NA 3A7AB 1B2TA 5J39A 4RAUC 2CW0C 1CT1D 1KABA 1QB5D 2EYPA 2BCOA 4UDUC 2IW3A 1CQVA 1LTBD 1LTSD 3RLFA 3A56A 2Z8LA 3J80E 2BOSA 3EVQA 2HCIA 2FJ2A 2RQXA 4C2MB 2PO4A 3NK9A 4RCNA 1BQQT 4P2CB 3T4AC 1HTPA 5C0XJ 1EY7A 2FINB 2EXZA 4XIGS 1EU4A 1EY8A 5A2QE 3DM1A 1PRTD 1SYBA 4HMIA 2D2CC 4DGZA 4K14A 4ZLTF 1ENFA 1H9RA 1WCMB 5JPMC 1JOQA 1MGSA 1II3A 4DA2A 5M3FB 4BA2I 4XQQA 3D4WA 3BYYB 2KVMA 3HP3A 4FF4A 4TQUS 4KD4A 4J8QA 5KNBA 3HG9A 5C5LA 1HA5A 1UNSA 3J81E 2PW7A 4WRDA 1TS5A 2MJ8A 2F0FA 2N88A 5FLXE 3CKIB 1L0YB 3T51B 3FRPB 1NAPA 2TMPA 4E6IA 3GTMB 2K03A 1CHQD 3EA6A 3EQLC 1XX8A 3M4YA 2A68C 1TKWB 1SE4A 4OHJA 1QOHA 1SYDA 2VNUD 2WKDA 5JOBA 3ZYYX 1LABA 4DAVA 2XRQD 4FNFA 4X3SA 1SE3A 2AQ1B 1AP0A 2PZWA 1BBXC 2CW0D 1JB3A 3S9WA 2B63B 3C1FA 2PW5A 4FF1A 1GOZA 5C3WA 1QCBD 1TVXA 5M5XB 1K8MA 5CORA 3TP5A 1IYUA 3BVGA 4ZRZA 2R93B 3BS1A 1TS4A 4KKUA 1RTNA 2F0EA 1JORA 3T56B 2RVLA 1ET6A 1KTKA 1PTOB 3IL8A 2LKVA 4V190 1S5ED 1Q3LA 1FYCA 4F8MA 1KNAA 3E5SA 4LK1C 1S5DD 5JJZA 2L12A 3A8JE 5HGTA 5M5WB 5I9PA 1EQTA 4ZAIA 3R2IA 3QWNA 2AWNA 4FF3A 2NTSA 2XVSA 4KHZA 1RD9D 3HOXB 4IUQA 3GTOB 1A3UA 5JVG3 2JA7B 1F9PA 2A68D 5I9OA 3S1QB 1STBA 1GHJA 3D3RA 2FFKB 3DWPA 4HCEA 5JPNC 4HN7A 1E2ZA 4KN7C 3H09A 2IWHA 1I6HB 1DM0B 5FOBB 3MA2B 4FXGC 4PQXA 2VXWA 1EYAA 1I50B 1CA6A 4U68A 3LNNA 5C4XB 5KGUA 3VA5A 1E2WA 4OO1H 4XQNA 2RDHA 4C3HB 1FNWA 4KD3A 4KY6A 2JSOA 1CZWA 3I4NB 1BO0A 3A8KE 3V2TA 1EWCA 2X6LA 3C2PA 4S3SA 2WKCA 3TP6A 3GV6A 2QCPX 3CRKC 1OXSC 1MD2D 5CGKA 4OO1I 3HOVB 4K8JA 1IL8A 5EBDA 3PO2B 2SEBD 5DM63 2DY7A 5I6WA 3HEJA 4RKBA 3OW7A 2WP8J 2Q8IB 2NN6H 2F0GA 3J80L 5CV4A 1HCZA 2F3VA 1TWCB 3KLSX 1DYQA 1QWYA 2XWJB 1I4XA 1QG7A 2EY2A 2ID0A 1CTMA 3IKJA 2PZTA 2PYKA 3I4MB 2NN6I 1TWGB 1TR5A 4ZYSA 5KIXA 2AUKA 1BXTA 1IYVA 4QIWB 1SAPA 1L0XB 2EY6A 4G4KA 1J8IA 3P20A 2FMMA 1V1PA 4QCLA 5AFWA 5IOCA 2L4NA 3PUXA 3J81L 1DOMA 1RCVD 3DUZA 5I2XA 3VR3A 4K5WA 1ILPA 4K2LA 1EYDA 3T13A 2KEEA 4RGMA 1F9SA 4C1NK 5C5MA 3P75A 5BN5A 2Z4IA 4I7ZC 5EJWA 5LL6X 2KJXA 2D9UA 2R6GA 1F9RA 2NN6G 4G7OC 1AN8A 5G3LD 4J1MA 4RCOA 2A6HD 3K6OA 2D62A 5EPKA 3TDQA 1U4PA 3M7GA 3QB3A 1B44D 2CVRA 1O7YA 1EOTA 3WDNA 2E2JB 1GUTA 1OXUA 3FDTA 1MBYA 3D6WA 2EYHA 4H13C 1CM9A 3EROA 1SEBD 1WTOA 4ZK9B 4DNTB 1ONLA 3H3VC 4C3IG 1TT2A 3PV0A 2F0UA 5K5PA 3L3OC 1HFGA 3OMCA 1GUOA 1PXUA 5C4JB 4XT3B 4C1NI 3C3LA 2MGSA 3FEWX 1PRTC 4HSVA 5LL6S 1EY4A 2PPBC 4FO2A 1ML0D 1W6KA 3MTSA 4XTCS 1CA5A 2AQ2B 2RKSA 1C48A 2B2TA 3TMEA 1LTRD 3PUVA 1R9TB 5LHY1 5J1ZA 1SYGA 2Q8RE 1B3AA 2KEDA 3TZDA 1PFBA 3GTGB 1AW7A 1Y1VB 3E6ZX 4M1UB 3Q23A 3IAYA 2ZT9C 2L9HA 1WD0A 5DEHA 1U4LA 3A54A 1G2SA 3QJYA 1ZEQX 4DN4M 1M8AA 3ITPA 1JQYD 1Q8IA 3NTHA 1G6ZA 1S5BD 3WOFA 4NW2A 1HQMC 1SMYC 5CBEE 2SOBA 2TSSA 4TKOB 1X3PA 3SVMA 5E1FA 3AU7A 1VMPA 2JA6B 1PRTF 4TSSA 4CKCA 5ELFA 3M3YB 3RZOB 4FVMA 1D1KA 3CQZB 2K5QA 3M85A 3SDZA 1ESFA 1EU3A 4ILWA 4BA1I 4KTAA 4NDXA 1CI3M 2IX1A 2E75C 3R3OA 3S2DB 2K01A 4Z9CB 1HUMA 4PNYA 1JWSD 3BVMA 2J0TD 2R92B 5CC4A 1EFID 1STGA 5KNDA 4G7HC 4I65A 4O1NA 1F2ZA 1OXXK 3CRLC 2QEJC 4ABNA 3KUPA 4DK0A 4NKLA 1QJOA 1SXTA 2PZUA 1SFOB 3I4LA 2EZVA 1EL0A 5EKIA 4IUUA 3A7LA 3U9OA 4FXDA 5FO8B 4KN4C 1RKNA 1WTPA 1DJRD 5KYLA 4EGVA 4LJZC 5E4XA 1D2BA 2K5WA 3W3AA 3OIPA 2QKIC 1HTLD 2RSNA 4KK7A 2QDBA 1VMCA 2QF7A 3TBIB 2EY1A 2KHSA 5EKLA 3TZUA 2R3ZA 4ZQ3A 3QO2A 4MHEA 3X3NA 3K59A 3MVVA 1EZ8A 1RJTA 1XXGA 3C46A 5CMDA 3VYSA 2PQEA 3MZ5A 4KV6A 5EPLA 1SDFA 2F0QA 1XYIA 1U9RA 2E74C 2F0HA 4OL7A 3D6CA 3VA7A 3L7ZC 4RGTA 2GA4B 2NBFA 2C9OA 3ONAB 2K1BA 1WD1A 1SMYD 3NWTA 1AZQA 1LT3D 2F0SA 1O80A 4IUVA 5I2YA 4OIJA 4R8NA 3H0GB 5C4HA 1F2LA 3GTPB 2Z4HA 2NWGA 4IFDJ 4X3KA 5ELDA 1CFMA 4N9TA 2OF1A 2B2VA 1BCPB 4KKSA 1F2YA 4H7BA 3OPOA 3S16B 1UEAB 3V96A 5IIFA 3M4OB 5KEEA 1GUSA 3DWQA 2I46A 2CQAA 1F9QA 4QB4A 3RZDB 4KY7A 2F0NA 3HZXA 1DXMA 5ELCA 2B2VC 4QUFA 2WB1B 4K5VA 4IUNA 2KQ3A 3Q6SA 4C3IB 1TIID 1KDBA 3PO3B 2XSCA 1KLGD 1F2MA 4K2KA 4A3GB 1TWHB 3SHLA 1GXDC 3CHBD 2L5TA 4BBSB 2RA4A 1SBBB 2NVTB 2HCCA 1MI2A 1HRJA 3VR4A 3H94A 2N55A 2DY8A 4DXFA 1J9OA 5EKKA 1I4HA 1V43A 1PZKD 3NQTA 3PIP3 3SK5A 1UAPA 2ZXOA 2BA1A 3I8ZA 1WVLA 4X3TA 1DONA 4HCSA 2KCCA 4RKLA 1ICWA 3OSOA 3MXPA 1EY5A 1IKMA 2JEBI 3P7JA 5COYA 3BG3A 4B9XA 4X3UA 2EDGA 1LTID 5JAVA 2J4XA 4RWSC 2K7VA 4KKTA 2K5DA 5C0XH 1PZJD 3I91A 1YNND 1DCZA 3OHXC 2Q8TA 2KCNA 4RH6A 5I4DA 5JEAJ 1ESRA 4B9WA 1I6VC 3OWFA 2IPKD 4A3DB 5D3DA 2G9HD 1JWUD 4RGOS 3S1RB 3C1EA 3K5MA 5D65A 1VDZA 3VR5A 5C0XI 3VYRA 5HURA 2A6HC 3I90A 4XT1B 2BE5C 4K6LA 2L1BA 4HEDA 1R4PB 2NTTA 2L0CA 4TRDA 1QNKA 1FNVA 2ICIA 1IHZA 3A55A 1SNMA 4XDXA 3MWYW 5K36H 1LV9A 1A15A 2KECA 2BDOA 1TS2A 1LT5D 5BN4A 2WIIB 4A3FB 3HOWB 3TP8A 3PUYA 2V4DA 5C3EB 1D5MC 1KAAA 3S17B 2X69A 1PFNA 4CKEA 1XTCD 1WTXA 5IODA 2H1EA 2EYLA 3MC0B 3GTQB 3T53B 4BBRB 3H6MA 2EE1A 1H9SB 4PMCA 4ZUJA 3KBXA 1PTOH 5C0XG 1ZKOA 1GJXA 2FMCA 4Q0FA 3MFYA 1EQVA 4CKBA 1Y1WB 2JP1A 2F4IA 2XRSD 3QIAA 3K58A 5G3LF 2H4OA 1SNDA 2F0WA 3MHBA 1GUWA 4H44C 4FYDA 1A6XA 4HTHA 1GUGA 3G6JB 3ERQA 3GV3A 4L8JA 3SK4A 1ZXTA 4PV1C 3I70A 5K36G 3MXGA 2PNRC 1DD2A 1SNOA 1VF5C 2IJ0A 2A6EC 1W6JA 3I73A 1PTOC 3Q22A 3DWAA 1STHA 4CJ2C 2F0JA 2IX0A 5FO7B 2JA5B 1C8CA 5CYUA 5ISRA 2K6AA 4DU9A 4J6HA 2BDNA 4JBWA 2BE5D 5IT9L 1EEID 2XWBB 5NUCA 1E2VA 1PFMA 3PUZA 2BA0A 1MSGA 4A3IB 5JVH3 2EJMA 3BVZA 1LT4D 4HSPA 4A3BB 3FVQA 3PUWA 4RA8A 2LMCB 1TWFB 2CHBD 2Z1CA 3DXJC 2A69C 3K5LA 4ULLA 1I4RA 4DAPA 2IL8A 5ELEA 4FXKC 3GO5A 3KLRA 3NPPA 1IW7C 2LS01 4OIKA 1VF7A 1BF4A 3JAML 5CBAE 1PTOF 3SK6A 1HFNA 1Y8OB 4C56C 3SR1A 1BCPD 3X3MA 3NBHA 3Q0AA 1TWAB 1WTWA 1U4RA 3K7AB 3F2UA 1SYEA 3OWEB 3NTIA 2XIWA 2VUMB 3PIO3 5EGTA 2SNMA 3IFDA 1STYA 3BYTB 3EJIA 1D5ZC 4KY5A 4CBVA 3DEOA 3OMGA 3URYA 4EQNA 3P1HA 4F87A 4IALA 5CV7A 3CU7A 4OGQC 1QILA 3V05A 2KA7A 3VYTA 1Q1EA 2A6ED 2EY5A 3HOZB 1PTOD 1UUPA 1V8QA 1VCIA 5J22A 1NCVA 1HXYD 1JCKB 1G2TA 1S5FD 2MUYA 2VB2X 1G291 1JOKA 1EY6A 2YYZA 1BNZA 4LMQD 3BZDB 1LTAD 3GP7A 3E0JA 5E4WC 1Y8PB 2LY7A 4FF2A 3D8GA 1Z6HA 4Y7NB 1DOLA 3J7YW 1AZPA 4L63B 5M9OA 2K05A 2MP1A 5M5YB 1E0BA 1H9MA 3RMHA 1SNQA 3IFTA 1FD7D 3FKIB 4HR7B 3J7AV 4CJ0B 2E76C 1JWMD 3MXUA 3PMFA 2NVXB 2NYZD 4A3MB 4G57A 4EVOA 4B08A 3NTKA 4QF4A 2A69D 3FMCA 2F0MA 1SJED 1T5EA 1FGBD 4CJ1B 1EWHA 1C4QA 4BWGB 3HGBA 1IW7D 3NE5B 4LAAA 1SYCA 3K57A 3WOEA 1D1IA 3KF8A 5T1IA 3SK8A 1WTRA 1ENAA 1PLFA 3QG1A 2E2HB 4U673 1STEA 2EJGC 2JXMB 2O2LD 5A35A 4MN3A 4BY1B 2F0TA 1B1ZA 2AQ3B 1LACA 3EFXD 3L9AX 2LFNA 1B53A 1X3QA 1RF2D 4JK1C 4K6DA 4GZYC 1YNJC 2NVYB 3FPUB 5IGEA 2XN9C 3NWSA 2F0VA 4XYQA 2L11A 1CQFA 2M2LA 5FO9B 1I4PA 4RHRA 2L55A 3D4DA 3BDOA 2KOLA 2F1MA 3RD4A 4ZKBB 3O13A 1YNNC 4KJNA 2EYOA 1ZYRD 1ILQA 3MEHA 5IGDA 5IT9E 1RDPD 1JICA 3S1MB 1FNUA 3SE0A 4K8IA 4HMJA 2F0LA 5EPJA 3KK7A 1BUVT 1FR3A 4XXEA 2EYMA 1K8OA 1KLUD 1EYCA 3S15B 3QOLA 3OOCA 1Q1BA 4EQOA 1CK1A 5ELBA 2DNEA 4ID6A 3BDCA 2EYFA 3NQIA 3K0YA 1JE4A 1QNUA 1NR4A 4AYBB 1STAA 2EVBA 1ET9A 1LTGD 2EJFC 1EZ6A 4RGNA 2WACA 2WINB 1PDQA 4XYOA 1QE6A 5KRUA 5CV8A 1SJHD 3ND8A 4XQJA 5FK9C 3JAME 3S1NB 4O42A 5F2DA 3GTJB 2B2YA 2AWOA 2RDGA 2ENBA 1V1PB 4UAIA 4KJOA 3SEBA 2AUJD 3NP8A 2B8GA 3N6RA 3M7NA 4DK1A 1TQOA 2ZXRA 2ICEC 5I6YA 4F7XA 5DNFA 1YNJD 2B2YC 1SNPA 3KLSA 1NR2A 5D14A 2F3WA 4C3JG 1PZID 4YIJA 1AEXA 3GQBA 1BR9A 1Y69U 2E2DC 3GTKB 3LWUA 4V0BA 2K33A 1H9KA 2EOTA 4CGYB 5C3XA 1GHKA 1G91A 1RTOA 1B9NA 1NSNS 5IGBA 1T5XD 1CHPD 1TS3A 1LTTD 2F0PA 4QUCA 3S14B 3HOYB 3H91A 3NXWA 2FHTA 1GUNA 3SXHA 2NZ1D 1LLRD 1PRTB 3GTLB 3QOJA 2JYOA 5CV5A 1EY0A 2RDFA 4DFAA 4DF7A 1SE2A 1EY9A 1HHVA 3AB9A 2SNSA 4WORA 5CR3A 5C6AA 1HA6A 1OO9B 2MHVA 1KNEA 2O5JC 4KHVA 4ZKCB 2DNCA 1ENCA 2PMZB 3Q24A 2WV6D 1DZ1A 5KNCA 1H9JA 3T16A 2NB0A 2R7ZB 1BOSA 3MFGA 3MAQA 4IN3A 4IZ8A 1O7ZA 1NUCA 1STNA 1I3QB 3I72A 5IGCA 5C44B 4WJWA 5C4ZA 3DHQA 3NSWA 1OXTA 1TY2A 2M9VA 5FKAC 1I4GA 1HUNA 4IFDH 1BCPC 1TY0A 5A2QL 3K5OA 4A93B 2R61A 1D6EC 2O5IC 3G7LA 2A5HA 1B9MA 2O4XA 2OT2A 3MXNA 5DAUA 4BY7B 5BN3A 1X32A 3VR6A 1V1OA 4CHTB 4R8IA 4DAYA 2MPMA 2K32A 4IFDI 4R9WA 2Y0SB 2VB3X 4OO1G 3VYUA 2QILA 2K04A 1LT6D 1EEFD 2B2WA 1Q90A 2F0IA 3I3CA 3R93A 4G7ZC 4HAEA 3A8IE 4EQPA 4KMUC 1A3TA 2WAQB 3HRZC 5D3IB 1F77A 1XWEA 2F03A 4N9PA 5FLXL 1BDOA 5CV6A 3NBIA 4Q5VA 4A3EB 3J7AF 4A3JB 2A74C 1S4ZA 1B4OA 1SYFA 3GD7A 2ZXPA 2HUGA 1CZGA 1SNCA 2NUCA 4IUTA 1OXVA 3AMUA 1MSHA 3TSSA 2B2WC 4WFN3 3D4RA 1EIHA 2K28A 3HKZB 3RUZA 1AFPA 2HDMA 1U4MA 1LO5D 1M4VA 5E3FA 2EYJA 1SSOA 4KI0A 1IKLA 2HDLA 3KBGA 2A73B 2J7ZA 5TSSA 1BCPF 4IFDG 1HPCA 2G9DA 2YU9B 5CV9A 1G8ZD 2DN8A 2B8FA 3OIQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZUI A;  4E6I A;  3SK4 A;  1EYC A;  2F0M A;  2O4X A;  2F0N A;  2F0G A;  3E5S A;  3QOL A;  4TRD A;  3HZX A;  5DEH A;  1SNO A;  4EQO A;  3QB3 A;  2QDB A;  1SYE A;  4MIU A;  5IGF A;  4K5V A;  5CV4 A;  5DAU A;  1IHZ A;  4IUN A;  3NUC A;  4ID6 A;  1SNM A;  2KQ3 A;  2F0K A;  1SYD A;  2M00 A;  3BDC A;  2F3V A;  2EY1 A;  2KHS A;  5HGT A;  2EYF A;  4LAA A;  5I9P A;  1SYC A;  5EKL A;  2EYH A;  5JOB A;  1STH A;  5EGT A;  2SNM A;  4PMB A;  1STY A;  3ITP A;  5C3X A;  1KDB A;  2OEO A;  3ERO A;  1F2M A;  3EJI A;  4K2K A;  4QB4 A;  1STA A;  2F0J A;  3SK8 A;  4ZQ3 A;  3SHL A;  4KY5 A;  1ENA A;  1KAB A;  1A2T A;  1EZ6 A;  2EY2 A;  1NSN S;  3MVV A;  2F0O A;  2EYP A;  1EZ8 A;  2WAC A;  5IGB A;  2F0P A;  2PZT A;  5ISR A;  2SOB A;  2PYK A;  2PQE A;  3MZ5 A;  3OMG A;  1JOO A;  2F0Q A;  3P1H A;  4J6H A;  4KV6 A;  4IAL A;  3TP8 A;  4DU9 A;  4EQN A;  5EKK A;  3NXW A;  3SXH A;  5E1F A;  5CV7 A;  1TR5 A;  2F0T A;  1TT2 A;  1A3U A;  3BDL A;  1U9R A;  3DMU A;  5KIX A;  2F0I A;  5KRU A;  2F0H A;  3QOJ A;  2F0U A;  3EVQ A;  1KAA A;  5CV8 A;  4OL7 A;  2EY5 A;  5CV5 A;  5NUC A;  4EQP A;  1A3T A;  2EY6 A;  1STB A;  2F0D A;  3D6C A;  1EY0 A;  2RDF A;  3OMC A;  3NQT A;  4DFA A;  4DF7 A;  5I9O A;  5J22 A;  4N9P A;  3SK5 A;  4NP5 A;  5CV6 A;  5IGG A;  1EY9 A;  3NK9 A;  5K5P A;  2PZW A;  2SNS A;  5J39 A;  4WOR A;  5IOD A;  1SYF A;  5M9O A;  4K6D A;  5CR3 A;  4RKL A;  5IOC A;  5C6A A;  2EYL A;  1EY7 A;  2EXZ A;  1SNC A;  2NUC A;  5IGE A;  1EY8 A;  3OSO A;  4KTA A;  3MXP A;  5F2D A;  2F0V A;  4NDX A;  3S9W A;  1EY5 A;  3R3O A;  1SYB A;  4KHV A;  3C1F A;  2ENB A;  1JOK A;  4HMI A;  1EY6 A;  2PW5 A;  3H6M A;  1EY4 A;  2F0S A;  1ENC A;  4KJO A;  4PNY A;  4K14 A;  1EYA A;  4DGZ A;  3NP8 A;  5KGU A;  4PMC A;  4R8N A;  3VA5 A;  5C3W A;  4ZUJ A;  5C4H A;  4B9X A;  5CC4 A;  1JOQ A;  3D4D A;  3T16 A;  1STG A;  4QMG A;  5JAV A;  5KYI A;  1II3 A;  4I65 A;  3TP5 A;  1EQV A;  1F2Z A;  4K5W A;  3D8G A;  3D4W A;  4K5X A;  3RUZ A;  4KD3 A;  1KDA A;  1TQO A;  2RKS A;  5E3F A;  4KY6 A;  4KJN A;  3TME A;  5I6Y A;  2EYJ A;  1EYD A;  4K2L A;  4IZ8 A;  2OF1 A;  4N9T A;  4NKL A;  4ODG A;  1STN A;  1NUC A;  3T13 A;  4F7X A;  2EYO A;  2OXP A;  4KD4 A;  3V2T A;  5J1Z A;  2PZU A;  1SNQ A;  4S3S A;  5C5L A;  1A2U A;  5C5M A;  3MEH A;  4NMZ A;  3TP6 A;  1SNP A;  3LX0 A;  5IGC A;  3P75 A;  5IGD A;  2F0E A;  1SYG A;  4B9W A;  2PW7 A;  5C4Z A;  4WRD A;  3SR1 A;  3DHQ A;  3OWF A;  1JOR A;  1F2Y A;  4H7B A;  2HQE A;  2F0F A;  5CGK A;  3U9O A;  2F3W A;  1KDC A;  4K8J A;  3TP7 A;  1RKN A;  2RBM A;  5IIF A;  1SND A;  2F0W A;  3MHB A;  5KYL A;  3PMF A;  4YIJ A;  5KEE A;  1AEX A;  2LKV A;  1A3V A;  5I6W A;  3C1E A;  4G57 A;  3HEJ A;  4HMJ A;  2F0L A;  4K8I A;  5CV9 A;  4HTH A;  3SK6 A;  4EVO A;  3NHH A;  4RKB A;  4ME5 A;  5HUR A;  3ERQ A;  4F8M A;  4KY7 A;  2EYM A;  4QF4 A;  4J1M A; 
#chains in the Genus database with same CATH topology
 3LWE A;  2EPB A;  1QUQ A;  3AQQ A;  4IUP A;  1JC7 A;  4LF6 L;  3W2D A;  4JYA L;  4FP5 D;  1B7Y B;  5EBC A;  1YJW A;  5JEA H;  3KDF A;  4MIU A;  2UXD L;  2NVQ B;  4DV4 Q;  2M00 A;  1R4Q B;  2F0K A;  4F88 A;  2B2U A;  4L6T B;  2D5D A;  4GLX A;  4PMB A;  5IE8 A;  3TRE A;  1DOK A;  4JI8 Q;  4PZ7 A;  2OEO A;  4H0L C;  1A2T A;  3ND9 A;  1ROD A;  2F0O A;  4JBK A;  4BXX H;  1I4Q A;  4UHV A;  1EIG A;  4BBR H;  3DEP A;  5C44 H;  2IHF A;  3CP0 A;  4RG1 A;  1JOO A;  2RHS B;  1Z47 A;  1Q8K A;  2ZTE A;  3BDL A;  3DMU A;  2PNH A;  3CCR A;  4RHS A;  1Y8N B;  2N49 A;  2F0D A;  1TU2 B;  3PF4 A;  4CDD C;  2IX3 A;  2B2U C;  2CH4 W;  4NP5 A;  4YHH L;  2K50 A;  5IGG A;  3BZK A;  1WTV A;  4A93 H;  4IUR A;  1WTQ A;  1HQR D;  5GRO A;  2HT1 A;  2MNA A;  1YIT A;  1H9S A;  2KHJ A;  2SDF A;  2E2I B;  3UI2 A;  4EX5 A;  1HNZ Q;  4YWM A;  4BS9 A;  2X6G A;  4PZ6 A;  1Q12 A;  4DV7 Q;  5DM7 3;  3F1Z A;  3TQY A;  1PH3 A;  3HOY G;  5IP7 G;  2C5C A;  4QMG A;  3BZC A;  1LUZ A;  3U9S A;  5KYI A;  2I07 B;  1PYW D;  1G6P A;  4K5X A;  1Z7T A;  2XGT A;  5C4X G;  2RSO A;  1KDA A;  4M8A A;  2KUM A;  4J15 A;  3TN2 A;  1PH8 A;  2B2T C;  4ODG A;  1JR0 D;  2F3I A;  1ZYR C;  2IT1 A;  2I5L X;  4GN3 B;  3R2T A;  2I5M X;  2OXP A;  1PMR A;  4C3H G;  4C3J B;  1K83 B;  3F2B A;  4NXN Q;  1A2U A;  2XNA C;  4NMZ A;  3ULP A;  3LX0 A;  3S2H B;  4RFB A;  3D31 A;  4DXG A;  5T1G A;  5EQ0 A;  2HQE A;  2JEA I;  4A3E H;  2PCF B;  4PMW A;  3HS0 C;  3EN2 A;  1KDC A;  1B50 A;  3TP7 A;  2RBM A;  1I94 Q;  1O7L A;  3HOU B;  4GNX A;  4A3J H;  1A3V A;  1RHP A;  1KXL A;  4MZ9 A;  4DNR B;  5FLM H;  1S5C D;  1D5X C;  4QIW E;  2B39 A;  3NHH A;  4ME5 A;  4UP9 A;  5JEA G;  1XMO Q;  4ZUI A;  3FPP A;  1HNX L;  2R7Z G;  4IQZ A;  1PH5 A;  3N52 A;  2JE6 I;  3W1B A;  2NZO A;  3VR2 A;  4X62 L;  2JA8 B;  4YY3 L;  3R8B A;  4A3K B;  5IWA L;  3NUC A;  5IGF A;  1Z9F A;  1O78 A;  5M3M B;  2PI2 A;  3K5N A;  1JE5 A;  3A7A B;  5C44 G;  3MEF A;  1B2T A;  5J39 A;  4RAU C;  2CW0 C;  1CT1 D;  3GDE A;  1KAB A;  1VQ7 A;  1QB5 D;  4DV2 Q;  3ER0 A;  2ZJR A;  2EYP A;  2BCO A;  3KLW A;  4UDU C;  2IW3 A;  1CQV A;  1LTB D;  1LTS D;  2H5X A;  3RLF A;  3OTO L;  3A56 A;  3E0E A;  2Z8L A;  4DNI A;  3J80 E;  1PA6 A;  2BOS A;  3EVQ A;  1X6O A;  4A93 G;  2YU9 H;  2HCI A;  2FJ2 A;  2MO0 A;  2RQX A;  4C2M B;  2QA4 A;  2PO4 A;  1MJC A;  3NK9 A;  4RCN A;  1BQQ T;  4P2C B;  3T4A C;  1HTP A;  2QW7 A;  5C0X J;  3M4P A;  1KRS A;  4BY7 G;  2MO1 A;  1EY7 A;  3PIP A;  2FIN B;  2EXZ A;  1HZA A;  4XIG S;  1EU4 A;  1EY8 A;  2OQ0 A;  5A2Q E;  3EBE A;  3DM1 A;  2HIX A;  1PRT D;  1SYB A;  4HMI A;  2D2C C;  4DGZ A;  4K14 A;  4ZLT F;  1YNX A;  1BBW A;  1ENF A;  2Y0S G;  4P71 A;  1H9R A;  1WCM B;  5JPM C;  1JOQ A;  1MGS A;  1K0R A;  1II3 A;  4DA2 A;  5M3F B;  2RCN A;  4XQQ A;  4POF A;  4BA2 I;  3D4W A;  1PH9 A;  3BYY B;  2KVM A;  3HP3 A;  1RL2 A;  4A3L G;  4YWK A;  4FF4 A;  2WAQ G;  4TQU S;  4KD4 A;  4J8Q A;  1TWA H;  1B3Q A;  1X56 A;  5KNB A;  3HG9 A;  4A3E G;  3K7A H;  2C35 B;  5C5L A;  1HA5 A;  1UNS A;  3J81 E;  4A3J G;  2PW7 A;  4WRD A;  1TS5 A;  2MJ8 A;  2VUM H;  2F0F A;  5FLM G;  3G71 A;  4JI8 L;  1B70 B;  2N88 A;  1IYJ B;  5FLX E;  3CKI B;  1L0Y B;  3T51 B;  1NMG A;  3FRP B;  1NAP A;  5IT9 c;  4K0K Q;  1UE6 A;  2TMP A;  4E6I A;  3GTM B;  2K03 A;  1CHQ D;  2VQF Q;  3EA6 A;  3HKZ G;  3EQL C;  1XX8 A;  3M4Y A;  2A68 C;  4PZ8 A;  1TKW B;  1SE4 A;  4OHJ A;  1QOH A;  1SYD A;  2VNU D;  1PH1 A;  2WKD A;  5JOB A;  3ZYY X;  2CWP A;  4JI5 Q;  2ZTD A;  1LAB A;  4HIM A;  4C3J H;  1K83 H;  1G51 A;  1HNZ L;  4DAV A;  3S2H H;  2XRQ D;  4DV7 L;  4FNF A;  3HOU H;  4X3S A;  1SE3 A;  1VQF A;  2AQ1 B;  1AP0 A;  4Y7N H;  1RIP A;  2PZW A;  1BBX C;  4DPG A;  2CW0 D;  2P5Z X;  4CDC C;  4NXN L;  1KAW A;  3FKI H;  1KL9 A;  1JB3 A;  3S9W A;  2B63 B;  4X66 Q;  4QQB X;  2JA8 H;  3C1F A;  4A3K H;  2PW5 A;  4FF1 A;  3JAM c;  3Q8D A;  1K28 A;  1GOZ A;  5C3W A;  1QCB D;  1TVX A;  1I94 L;  1EWI A;  3M4Q A;  5M5X B;  1K8M A;  5COR A;  1N36 Q;  3TP5 A;  1IYU A;  3IRB A;  3BVG A;  1I5F A;  4ZRZ A;  1XMO L;  4X6A H;  2R93 B;  3BS1 A;  1TS4 A;  1C9O A;  2AKW B;  1NBW A;  4B3R Q;  4KKU A;  1RTN A;  1YEZ A;  2F0E A;  1JOR A;  3T56 B;  4C2M H;  4L5Q A;  1VQC A;  2RVL A;  1UE7 A;  1ET6 A;  1KTK A;  1PTO B;  3IL8 A;  2LKV A;  4V19 0;  4QJF A;  4DV2 L;  3A5U A;  1S5E D;  1Q3L A;  1FYC A;  4F8M A;  1KNA A;  2ATW A;  4BY1 H;  1FJG Q;  4OEM B;  4DR7 Q;  3E5S A;  3ERS X;  4LK1 C;  1WCM H;  1S5D D;  5JJZ A;  5M3F H;  4NXM L;  2L12 A;  3A8J E;  5HGT A;  1NJI C;  5M5W B;  5I9P A;  1EQT A;  4ZAI A;  3R2I A;  3QWN A;  1A62 A;  2AWN A;  4FF3 A;  2NTS A;  3OYY A;  1VQ5 A;  2XVS A;  4KHZ A;  4GN4 B;  1RD9 D;  3HOX B;  3CCJ A;  3M9B A;  4IUQ A;  3GTO B;  1A3U A;  5JVG 3;  1Q81 C;  2JA7 B;  1F9P A;  2A68 D;  3RLO A;  5I9O A;  3S1Q B;  1STB A;  1GHJ A;  3D3R A;  2FFK B;  1U5K A;  3DWP A;  4JC0 A;  1E1O A;  4HCE A;  5JPN C;  4HN7 A;  5H1S E;  4A3K G;  3F2C A;  1E2Z A;  4DV6 Q;  4KN7 C;  3H09 A;  5M3M G;  2IWH A;  1I6H B;  1DM0 B;  1N8R C;  5FOB B;  3MA2 B;  4FXG C;  4PQX A;  2VXW A;  1EYA A;  1I50 B;  1CA6 A;  4U68 A;  3LNN A;  5C4X B;  1N9W A;  5KGU A;  1HZC A;  3VA5 A;  1E2W A;  1K73 C;  1JT8 A;  4OO1 H;  3U50 C;  4XQN A;  2RDH A;  1WJJ A;  4C3H B;  4K0K L;  1FNW A;  4KD3 A;  4KY6 A;  2JSO A;  1CZW A;  1KHI A;  3I4N B;  2VQF L;  1BO0 A;  3A8K E;  3KF6 B;  3S15 H;  4A76 A;  3V2T A;  1EWC A;  2X6L A;  3C2P A;  4S3S A;  2WKC A;  2LSS A;  3TP6 A;  3GV6 A;  2QCP X;  3CRK C;  1E24 A;  1OXS C;  1MD2 D;  5DLQ E;  5CGK A;  4JI5 L;  3G48 A;  4OO1 I;  3HOV B;  4K8J A;  1IL8 A;  5EBD A;  3PO2 B;  2SEB D;  5DM6 3;  2DY7 A;  5I6W A;  4DR4 Q;  3HEJ A;  2CFM A;  4RKB A;  2B63 H;  3U4Z A;  1WCM G;  3OW7 A;  1D8L A;  2WP8 J;  2Q8I B;  1LYL A;  3CCV A;  2NN6 H;  2F0G A;  2OTL A;  3J80 L;  5CV4 A;  4X64 L;  1HCZ A;  1L1O B;  2F3V A;  3NBH B;  2PQA B;  5LMN L;  4JBJ A;  1TWC B;  2R93 H;  3KLS X;  1DYQ A;  1HH2 P;  1QWY A;  2XWJ B;  1I4X A;  1QG7 A;  2EY2 A;  4HIO A;  3PIO A;  2ID0 A;  1WOC A;  4X66 L;  1CTM A;  2AHO B;  3I56 A;  3A74 A;  3IKJ A;  2PZT A;  2PYK A;  3I4M B;  1IXR A;  2NN6 I;  1TWG B;  1LTL A;  2A19 A;  1TR5 A;  3JAM i;  4ZYS A;  5KIX A;  2AUK A;  1N36 L;  4LFB Q;  1BXT A;  1HR0 Q;  1IYV A;  3E3X A;  4QIW B;  1SAP A;  2ASB A;  1L0X B;  2EY6 A;  4G4K A;  1J8I A;  3P20 A;  2FMM A;  2CCZ A;  1V1P A;  4QCL A;  5AFW A;  4B3R L;  1VQE A;  5IOC A;  2L4N A;  2A1A A;  1SRO A;  3CF5 A;  2CWA A;  3CPW A;  3PUX A;  4FDB A;  1ICF B;  1VQO A;  2QEX A;  3J81 L;  4DV5 Q;  5M5W H;  1DOM A;  4JOI A;  1RCV D;  3DUZ A;  2UUA Q;  5I2X A;  2IY5 B;  3VR3 A;  4K5W A;  1ILP A;  1Y14 B;  3F8T A;  3HOX H;  1JB7 A;  4K2L A;  1EYD A;  3T13 A;  1FJG L;  2KEE A;  4R4O A;  4RGM A;  4DR7 L;  3GTO H;  1F9S A;  2JA7 H;  4C1N K;  1SN8 A;  5C5M A;  1L0W A;  3P75 A;  3S1Q H;  4GS3 A;  2KCM A;  5BN5 A;  2Z4I A;  4I7Z C;  5EJW A;  5LL6 X;  5GAE C;  3UE0 A;  2HQL A;  2KJX A;  4RMF A;  2B63 G;  2D9U A;  2R6G A;  4JOI C;  1F9R A;  3PSI A;  2NN6 G;  4JI0 L;  3FHW A;  4G7O C;  1I6H H;  3S14 H;  3HOY H;  1VQI A;  5IP7 H;  1AN8 A;  5G3L D;  4J1M A;  4KLK A;  4POG A;  4RCO A;  2A6H D;  3K6O A;  2D62 A;  5EPK A;  1I50 H;  3TDQ A;  5C4X H;  4DUZ Q;  1U4P A;  3GTL H;  3KOJ A;  3M7G A;  4B3S Q;  3QB3 A;  1B44 D;  2CVR A;  1O7Y A;  1EOT A;  2E8G A;  3WDN A;  4C3H H;  2UUB Q;  2E2J B;  1GUT A;  1OXU A;  3FDT A;  1MBY A;  3D6W A;  2EYH A;  4H13 C;  1XMQ Q;  2KBN A;  4DV6 L;  1CM9 A;  3ERO A;  4IOC A;  3I4N H;  1SEB D;  2OWO A;  1WTO A;  4ZK9 B;  3G6E A;  4DNT B;  3KFU A;  1ONL A;  3H3V C;  1PH4 A;  4C3I G;  2VY3 A;  3KF8 B;  4Y52 H;  3RN5 A;  2ZM6 Q;  1NMF A;  1TT2 A;  3PV0 A;  3HOV H;  3STB C;  2F0U A;  5K5P A;  2R7Z H;  3L3O C;  1EQR A;  4HID A;  3PO2 H;  3HFZ B;  1HFG A;  3OMC A;  1GUO A;  1PXU A;  5C4J B;  4XT3 B;  1H95 A;  4GKK Q;  1P8L A;  4C1N I;  3C3L A;  2MGS A;  3FEW X;  4P74 A;  5JJK A;  1PRT C;  1I3Q H;  4HSV A;  1K9M C;  5LL6 S;  3I55 A;  3CCU A;  1EY4 A;  2PPB C;  4FO2 A;  1ML0 D;  4GOP B;  1W6K A;  3HOX G;  3MTS A;  1TWC H;  4XTC S;  4DR4 L;  1CA5 A;  4P73 A;  2AQ2 B;  2JA7 G;  2RKS A;  1C48 A;  2B2T A;  3TME A;  1LTR D;  2DGY A;  3I4M H;  5ELO A;  1TWG H;  3PUV A;  1R9T B;  5LHY 1;  5J1Z A;  1N32 Q;  1UE1 A;  2I5H A;  4OX9 Q;  1SYG A;  2Q8R E;  4BY7 H;  3AFQ A;  1QVF A;  1B3A A;  2KED A;  3TZD A;  1PFB A;  2PMZ E;  3GTG B;  1AW7 A;  4H02 A;  1Y1V B;  3E6Z X;  4M1U B;  3SGI A;  3Q23 A;  1PYB A;  4UP7 A;  1VQL A;  3AFP A;  3IAY A;  2ZT9 C;  2L9H A;  1D7Q A;  1K0S A;  1WD0 A;  1GM5 A;  1EYG A;  1SR3 A;  5DEH A;  4LFB L;  1HR0 L;  1XNQ Q;  4P72 A;  4A3L H;  1U4L A;  3A54 A;  4LF4 Q;  3I4N G;  1G2S A;  2Z9H A;  3QJY A;  1ZEQ X;  5L37 A;  1BVS A;  4DN4 M;  3CD6 A;  1M8A A;  3ITP A;  1JQY D;  1Q8I A;  4QL5 A;  3CCL A;  3TS0 A;  1S72 A;  3NTH A;  1G6Z A;  1S5B D;  4DV1 L;  3WOF A;  4NW2 A;  2V1C C;  1HQM C;  1SMY C;  2VS1 A;  5CBE E;  3AYH B;  2CQO A;  3HOV G;  1XPO A;  2SOB A;  3PO2 G;  2TSS A;  4DV5 L;  4TKO B;  1X3P A;  3SVM A;  5E1F A;  4LNQ A;  5JJL A;  1PV4 A;  2CKZ B;  3AU7 A;  1VMP A;  2UUA L;  2JA6 B;  1PRT F;  2EXD A;  3RNU A;  4TSS A;  1PHJ A;  4CKC A;  5ELF A;  3M3Y B;  3RZO B;  4FVM A;  4R4Q A;  1D1K A;  3CQZ B;  2K5Q A;  3M85 A;  4LW1 A;  3SDZ A;  1ESF A;  1EU3 A;  4ILW A;  4BA1 I;  1W2B A;  4KTA A;  3TRZ A;  2DUD A;  4NDX A;  1CI3 M;  2IX1 A;  2E75 C;  3R3O A;  3S2D B;  1A0I A;  2K01 A;  4Z9C B;  1HUM A;  1QVC A;  4EQ5 A;  4PNY A;  2E2J H;  1JWS D;  3BVM A;  2J0T D;  2R92 B;  3UDF A;  5CC4 A;  3STB D;  1EFI D;  3I4M G;  1STG A;  2N78 A;  5KND A;  4G7H C;  4I65 A;  4ALP A;  4O1N A;  4NXM Q;  1F2Z A;  4HJ5 A;  1OXX K;  3CRL C;  2QEJ C;  4OON A;  4ABN A;  2WAQ E;  3KUP A;  4DK0 A;  4NKL A;  1QJO A;  4DUZ L;  1SXT A;  2KHI A;  3CAM A;  2PZU A;  1SFO B;  3I4L A;  4B3S L;  4JPB W;  2EZV A;  1EL0 A;  1CSP A;  2UUC Q;  2NVQ H;  1K3R A;  2PI2 E;  2UUB L;  5IP9 G;  5EKI A;  1XMQ L;  4IUU A;  5C4J H;  3A7L A;  1M1K C;  3U9O A;  4FXD A;  5FO8 B;  4KN4 C;  1RKN A;  1WTP A;  1DJR D;  5KYL A;  4EGV A;  3PF5 A;  4LJZ C;  5GQO A;  2KCT A;  5E4X A;  1IBL Q;  1D2B A;  2K5W A;  3W3A A;  3OIP A;  2ZM6 L;  2QKI C;  4LF5 Q;  1HTL D;  2RSN A;  4KK7 A;  2QDB A;  1VMC A;  2QF7 A;  3TBI B;  2EY1 A;  2KHS A;  5EKL A;  4GKK L;  4ME3 A;  3TZU A;  2R3Z A;  2RF4 A;  1YI2 A;  2ZJP A;  1T9H A;  4ZQ3 A;  1R9T H;  3QO2 A;  4MHE A;  1MKH A;  3X3N A;  3K59 A;  1YHA A;  3MVV A;  2E2I H;  1EZ8 A;  1RJT A;  1XXG A;  3C46 A;  5CMD A;  1KIX A;  2JK8 A;  1IBK Q;  4LWC A;  2VW9 A;  3VYS A;  2PQE A;  3MZ5 A;  4KV6 A;  5EPL A;  1SDF A;  2F0Q A;  1XYI A;  3W1G A;  1U9R A;  1VQM A;  3GTG H;  2E74 C;  2F0H A;  4OL7 A;  3D6C A;  3VA7 A;  3L7Z C;  1Y1V H;  4RGT A;  2GA4 B;  2NBF A;  4QY7 A;  2C9O A;  3ONA B;  2K1B A;  1WD1 A;  4A3C H;  1FL0 A;  3CPF A;  1N32 L;  5FJ8 H;  4OX9 L;  1SMY D;  2JQO A;  2K5N A;  3NWT A;  5BR8 Q;  1AZQ A;  1ASZ A;  1LT3 D;  2F0S A;  1O80 A;  2Q2I A;  4IPG A;  4GN5 A;  4IUV A;  5I2Y A;  4OIJ A;  4R8N A;  3H0G B;  3J7Z C;  5C4H A;  2CH4 A;  1F2L A;  1VQN A;  1SRU A;  3GTP B;  4X64 Q;  2Z4H A;  2HIV A;  2EIF A;  2NWG A;  4IFD J;  4X3K A;  1KC8 C;  5ELD A;  1CFM A;  5LMN Q;  4N9T A;  2OF1 A;  1YIJ A;  3I7F A;  1XNQ L;  2B2V A;  1BCP B;  4LF4 L;  4YWL A;  3K7U C;  4KKS A;  1F2Y A;  4H7B A;  5M3M H;  1QZG A;  4O2D A;  1XNR Q;  1L2F A;  3OPO A;  3S16 B;  1UEA B;  3RZO H;  3V96 A;  1IZ6 A;  1PH7 A;  5IIF A;  1FGU A;  3M4O B;  4IOA A;  5KEE A;  1GUS A;  4CDE C;  3DWQ A;  2I46 A;  3EIV A;  1HZB A;  2CQA A;  1F9Q A;  4QB4 A;  3S2D H;  3RZD B;  4KY7 A;  1GO3 E;  4NB3 A;  2F0N A;  3HZX A;  1DXM A;  5ELC A;  2B2V C;  4A4I A;  4QUF A;  1VQ9 A;  2WB1 B;  4K5V A;  4IUN A;  2LXK A;  2KQ3 A;  3Q6S A;  4C3I B;  1TII D;  1KDB A;  3PO3 B;  2XSC A;  3MXN B;  1KLG D;  1F2M A;  4K2K A;  1KQS A;  4A3G B;  1TWH B;  3SHL A;  1GXD C;  3CHB D;  2L5T A;  3A0J A;  2RA4 A;  1SBB B;  1ASY A;  4BBS B;  2NVT B;  2HCC A;  1SFO H;  1MI2 A;  1HRJ A;  3VR4 A;  3H94 A;  2N55 A;  2DY8 A;  2JA9 A;  4DXF A;  1J9O A;  2VQE L;  4DUY Q;  5EKK A;  4DAY B;  4L5S A;  1C0A A;  1I4H A;  1Y1V G;  1V43 A;  3BU2 A;  4DV0 L;  1PZK D;  3T1H Q;  1PH6 A;  2EQS A;  4HJ8 A;  3PCO B;  4A3C G;  3NQT A;  3PIP 3;  3SK5 A;  1UAP A;  2ZXO A;  2BA1 A;  2F52 A;  5HGQ A;  5FJ8 G;  3I8Z A;  1WVL A;  4X3T A;  2UU9 Q;  1DON A;  4HCS A;  2KCC A;  4RKL A;  1XPR A;  3HOZ G;  2A8V A;  1ICW A;  3OSO A;  3MXP A;  4YCV A;  4JI0 Q;  4LFC Q;  5IYB G;  2UUC L;  1EY5 A;  3UDG A;  1IKM A;  2JEB I;  4HJ9 A;  4QGU A;  3P7J A;  5COY A;  3BG3 A;  4B9X A;  1AH9 A;  1VQG A;  4X3U A;  2EDG A;  1LTI D;  5JAV A;  2F4V Q;  1IBL L;  1AE2 A;  1V1Q A;  4DR6 Q;  2J4X A;  4RWS C;  2K7V A;  4KKT A;  2K5D A;  5C0X H;  3GTM H;  5IYD H;  1PZJ D;  3I91 A;  1YNN D;  1DCZ A;  4LF5 L;  2JA6 G;  3OHX C;  2Q8T A;  2KCN A;  4RH6 A;  5I4D A;  1PVO A;  5JEA J;  1YHQ A;  2R7D A;  1ESR A;  4B9W A;  1I6V C;  3OWF A;  2IPK D;  4A3D B;  5D3D A;  3K80 C;  1C7Y A;  2G9H D;  4DV3 Q;  1JWU D;  4RGO S;  3S1R B;  1J5E Q;  3C1E A;  3K5M A;  1TXY A;  5D65 A;  1VDZ A;  3VR5 A;  4B3T Q;  1IBK L;  5C0X I;  4OWT B;  2JJQ A;  3VYR A;  5HUR A;  2R92 G;  1XTD A;  2A6H C;  2RHQ B;  1A8V A;  3I90 A;  2BE5 C;  4K6L A;  4XT1 B;  2L1B A;  4HED A;  4AQY Q;  1R4P B;  2NTT A;  1X3E A;  2L0C A;  3H0G H;  4TRD A;  1QNK A;  1FNV A;  2Q2U A;  3GTP H;  1EIF A;  1A63 A;  2ICI A;  1IHZ A;  3A55 A;  2JN4 A;  1QUQ B;  1UE5 A;  1SNM A;  4XDX A;  3MWY W;  5K36 H;  2UXC Q;  1MHW C;  2YTV A;  4IJL A;  4UP8 A;  1LV9 A;  1A15 A;  1S40 A;  2KEC A;  2BDO A;  1VQ6 A;  4MTN A;  1TS2 A;  2ZTC A;  3D0F A;  3KDF B;  1LT5 D;  5BN4 A;  2WII B;  4AH6 A;  4A3F B;  1HZ9 A;  4O0A A;  5BR8 L;  3HOW B;  3TP8 A;  3I2Z A;  2K52 A;  3PUY A;  4DK3 C;  1EUJ A;  2V4D A;  5C3E B;  5M5X H;  2RCF A;  1D5M C;  1KAA A;  3M4O H;  3S17 B;  2X69 A;  1PFN A;  4CKE A;  4JBM A;  1XTC D;  1GVP A;  3RZD H;  1WTX A;  5IOD A;  2H1E A;  2N8N A;  3CC2 A;  2EYL A;  3MC0 B;  1FVI A;  3GTQ B;  3T53 B;  3U58 A;  4BBR B;  2K5H A;  1EFW A;  3H6M A;  4JI2 Q;  2EE1 A;  1XNR L;  2MQH A;  3CCM A;  1H9S B;  5HY6 A;  4PMC A;  4ZUJ A;  3KBX A;  4OXP A;  4C3I H;  1PTO H;  2OQK A;  4JG2 A;  3PO3 H;  5C0X G;  2Q2T A;  5IYD G;  1ZKO A;  4A3G H;  1GJX A;  2FMC A;  1TWH H;  4Q0F A;  4BBS H;  3MFY A;  1EQV A;  1Q82 C;  2NVT H;  1MIU A;  3CC7 A;  4CKB A;  3DLL A;  1Y1W B;  1PYS B;  2Z6B A;  2JP1 A;  4DV1 Q;  3A5Z B;  4AYB E;  1HJP A;  2F4I A;  2XRS D;  3QIA A;  3K58 A;  5G3L F;  1UEB A;  2D0O A;  2GN5 A;  2H4O A;  3U4V A;  1SND A;  2F0W A;  3MHB A;  1GUW A;  4H44 C;  4FYD A;  4L5T A;  4LUO A;  1A6X A;  4LF8 Q;  4HTH A;  3H0G G;  1GUG A;  3G6J B;  3ERQ A;  4DUY L;  3GV3 A;  4GNX B;  4L8J A;  3SK4 A;  1ZXT A;  4PV1 C;  3I70 A;  5K36 G;  3MXG A;  2PNR C;  1DD2 A;  3T1H L;  1SNO A;  1VF5 C;  2IJ0 A;  2A6E C;  1W6J A;  3I73 A;  3T1Y Q;  1PTO C;  4LFA Q;  4JI6 Q;  2BH8 A;  3Q22 A;  4GLV B;  3DWA A;  1STH A;  2UU9 L;  4CJ2 C;  2Z0S A;  2F0J A;  1VQJ A;  2IX0 A;  5FO7 B;  4LFC L;  1E1T A;  2JA5 B;  3B6Y A;  4WJ3 M;  1C8C A;  1Q86 C;  5CYU A;  5ISR A;  2K6A A;  3J81 j;  4DU9 A;  4J6H A;  2BDN A;  4JBW A;  2OCE A;  4A3D H;  1E22 A;  2BE5 D;  5IT9 L;  1EEI D;  5IYC H;  2UXB Q;  2XWB B;  2F4V L;  5NUC A;  1E2V A;  4DR6 L;  3S1R H;  2B3G A;  1PFM A;  1PFS A;  4UPA A;  3PUZ A;  2BA0 A;  1MSG A;  4A3I B;  2WB1 G;  5JVH 3;  4JCV E;  2EJM A;  1O7I A;  3K8A A;  1KD1 C;  3BVZ A;  1LT4 D;  2VL6 A;  4HSP A;  3PO3 G;  4A3G G;  4A3B B;  3FVQ A;  4BBS G;  3PUW A;  4RA8 A;  4DV3 L;  1QZH A;  4MNO A;  1J5E L;  3KF6 A;  2LMC B;  1TWF B;  2CHB D;  2Z1C A;  3DXJ C;  4B3T L;  4A3F H;  2A69 C;  3K5L A;  1YJ9 A;  4ULL A;  1I4R A;  4DAP A;  2IL8 A;  4AQY L;  5ELE A;  4FXK C;  1AE3 A;  4IPC A;  5C3E H;  3GO5 A;  3KLR A;  3NPP A;  3S17 H;  1Q46 A;  2UXC L;  1IW7 C;  2Z6K C;  1X3G A;  2LS0 1;  3LGJ A;  4OIK A;  5AJ3 Q;  1NTG A;  3ZJY C;  1VF7 A;  3TS2 A;  1BF4 A;  3JAM L;  5CBA E;  1PTO F;  3SK6 A;  3H15 A;  1HFN A;  3GTQ H;  1Y8O B;  4C56 C;  3SR1 A;  1BCP D;  3X3M A;  4R4T A;  1L1O A;  1K8G A;  3NBH A;  3Q0A A;  1TWA B;  2PQA A;  1WTW A;  1U4R A;  3K7A B;  3F2U A;  3CMA A;  1SYE A;  1DGS A;  4YCW A;  4APV A;  3OWE B;  3NTI A;  1YZ6 A;  2XIW A;  2VUM B;  3PIO 3;  4L5R C;  5EGT A;  2SNM A;  3IFD A;  1STY A;  3BYT B;  1Y1W H;  3EJI A;  5IP9 H;  1EQQ A;  4GKJ Q;  1D5Z C;  4KY5 A;  4A3D G;  2D0P A;  1YVC A;  4CBV A;  2YV5 A;  5IYC G;  3DEO A;  3OMG A;  4JI2 L;  3URY A;  3P1H A;  4EQN A;  4F87 A;  4IAL A;  1YBY A;  4PG3 A;  1L1O C;  5CV7 A;  3CU7 A;  4OGQ C;  1QIL A;  3V05 A;  2KA7 A;  3VYT A;  1Q1E A;  2A6E D;  2EY5 A;  2OTJ A;  3HOZ B;  2HHH Q;  1PTO D;  1UUP A;  4OWW B;  1V8Q A;  1VCI A;  5J22 A;  1NCV A;  1HXY D;  1JCK B;  3ULJ A;  4N8F A;  1JJG A;  1U0L A;  1BKB A;  1G2T A;  1S5F D;  1SMX A;  2MUY A;  3UE1 A;  2VB2 X;  1G29 1;  1CKO A;  1JOK A;  1EY6 A;  2YYZ A;  1BNZ A;  4LMQ D;  3BZD B;  3JC6 6;  2IHE A;  4A3F G;  1LTA D;  3GP7 A;  1EIY B;  3HOW G;  3E0J A;  5E4W C;  1Y8P B;  2LY7 A;  3KJP A;  3E9I A;  4FF2 A;  4LF8 L;  1YHB A;  1LM0 A;  1Z6H A;  3D8G A;  2JA5 H;  1HR0 W;  4Y7N B;  5C3E G;  1DOL A;  3J7Y W;  1AZP A;  4L63 B;  5M9O A;  2K05 A;  3J80 c;  2MP1 A;  5M5Y B;  1E0B A;  1H9M A;  3KYH C;  3RMH A;  1SNQ A;  3IFT A;  1FD7 D;  3FKI B;  4HR7 B;  3T1Y L;  4LFA L;  4JI6 L;  3J7A V;  2ALY B;  1X54 A;  4NPS A;  2Y0S E;  4CJ0 B;  2VQE Q;  2E76 C;  4DV0 Q;  1IL2 A;  3KJO A;  4BXX G;  1JWM D;  4A3I H;  4BBR G;  3MXU A;  3PMF A;  3RN2 A;  4GNX C;  2NVX B;  2E5L Q;  2NYZ D;  1CSQ A;  4X65 Q;  4A3M B;  4G57 A;  4EVO A;  4B08 A;  1SE8 A;  3NTK A;  4QF4 A;  1GKH A;  2A69 D;  4A3B H;  1SLJ A;  3FMC A;  2F0M A;  1SJE D;  2HD3 A;  2UXB L;  1T5E A;  1FGB D;  4CJ1 B;  1EWH A;  2I0Q A;  1Y1W G;  1TWF H;  1C4Q A;  4BWG B;  3HGB A;  1IW7 D;  3NE5 B;  4LAA A;  1SYC A;  3WWV A;  3K57 A;  4KHP Q;  1VQA A;  3WOE A;  1D1I A;  2VZA A;  3KF8 A;  3BJU A;  5T1I A;  1XJV A;  3SK8 A;  1WTR A;  1ENA A;  4AIM A;  3J81 c;  1PLF A;  3QG1 A;  3L0O A;  3CC4 A;  2E2H B;  3E9H A;  4U67 3;  1STE A;  2EJG C;  3HKZ E;  3ICE A;  2JXM B;  2O2L D;  5A35 A;  3NEN A;  4OEL B;  3HKS A;  4MN3 A;  4BY1 B;  2F0T A;  5FLX c;  4IO9 A;  1B1Z A;  2AQ3 B;  1VQP A;  1LAC A;  3EFX D;  3L9A X;  2LFN A;  1B53 A;  1X3Q A;  3CCE A;  1RF2 D;  1WYD A;  4JK1 C;  4K6D A;  4GOP A;  3NEM A;  4GZY C;  1YNJ C;  2NVY B;  3FPU B;  5IGE A;  2XN9 C;  3NWS A;  2WFW A;  2F0V A;  2LXJ A;  4XYQ A;  3CME A;  2L11 A;  4DV4 L;  1OTC A;  1CQF A;  2M2L A;  5FO9 B;  2JA5 G;  1I4P A;  4RHR A;  5AJ3 L;  2L55 A;  3D4D A;  3BDO A;  2KOL A;  2F1M A;  3RD4 A;  4HJA A;  1JJ2 A;  1VQ8 A;  4R4I A;  4ZKB B;  3O13 A;  1YNN C;  4KJN A;  2K4K A;  2EYO A;  4GOP C;  1ZYR D;  4JI7 Q;  1ILQ A;  3MEH A;  4A3I G;  5IGD A;  5IT9 E;  3HOZ H;  4LUZ A;  1RDP D;  5IYB H;  4JI3 Q;  2Q2H A;  1VQH A;  1X65 A;  4JV5 Q;  1B8A A;  3I4O A;  4GKJ L;  1JIC A;  3S1M B;  4A3B G;  1FNU A;  3SE0 A;  4K8I A;  4HMJ A;  1KRT A;  2F0L A;  5EPJ A;  3KK7 A;  1BUV T;  1K8A C;  1FR3 A;  4XXE A;  1Q7Y C;  2EYM A;  2ZJQ A;  1K8O A;  1KLU D;  3TEH B;  1EYC A;  4DR1 Q;  3S15 B;  3QOL A;  2GVA A;  3OOC A;  1Q1B A;  4DAM A;  4EQO A;  1CK1 A;  4MTK A;  5ELB A;  5IY0 A;  2DNE A;  2HHH L;  2JA6 H;  4LF7 Q;  4ID6 A;  3BDC A;  4JI4 Q;  2EYF A;  3M3Y H;  3CQZ H;  3NQI A;  3G4S A;  3K0Y A;  1JE4 A;  1QNU A;  1NR4 A;  4AYB B;  1STA A;  1IBM Q;  2EVB A;  1ET9 A;  1LTG D;  5M5Y H;  2EJF C;  1EZ6 A;  2K5V A;  4ZCK A;  4RGN A;  2WAC A;  1YJN A;  3ULL A;  2WIN B;  3UDI A;  4IJH A;  1PDQ A;  4XYO A;  2R92 H;  1QE6 A;  5KRU A;  1BBU A;  5CV8 A;  2NVX H;  1NY4 A;  4A3M H;  1SJH D;  3ND8 A;  1EOV A;  1VQD A;  4XQJ A;  4HIK A;  5FK9 C;  3JAM E;  3S1N B;  4O42 A;  3DM3 A;  5EAY A;  3J80 i;  2VUM G;  1W3S A;  5F2D A;  3GTJ B;  2B2Y A;  2AWO A;  2RDG A;  2ENB A;  1V1P B;  4UAI A;  2XTI A;  4KJO A;  2DJF C;  3SEB A;  4DR2 Q;  2AUJ D;  3NP8 A;  2B8G A;  1NNX A;  2K14 A;  4JW0 A;  2E5L L;  3N6R A;  3K81 C;  2L15 A;  4X65 L;  1JJC B;  3M7N A;  4IPH A;  1N33 Q;  5GAG C;  4LUV A;  4DK1 A;  1N34 Q;  2E2H H;  1TQO A;  4YCU A;  2ZXR A;  5GAH C;  2ICE C;  5I6Y A;  3F2D A;  4F7X A;  4JI1 Q;  5DNF A;  3RR5 A;  2NZH A;  1YNJ D;  2B2Y C;  1SNP A;  2N3S A;  3KLS A;  1NR2 A;  4DR3 Q;  3AEV A;  4B3M Q;  5D14 A;  2MFI A;  4KHP L;  2F3W A;  4C3J G;  1MJE A;  5LMU Q;  1PZI D;  4YIJ A;  1AEX A;  2G5D A;  4LF9 Q;  3L2P A;  3GQB A;  2NVY H;  1VS0 A;  4P75 A;  4DKA C;  1BR9 A;  3J81 i;  1Y69 U;  3S24 A;  2B29 A;  3HOU G;  1E7Z A;  1CKN B;  2E2D C;  1K3B C;  3GTK B;  3PQI A;  3FP9 A;  4IPD A;  3LWU A;  4V0B A;  2K33 A;  1H9K A;  2EOT A;  3CCQ A;  4CGY B;  3FKI G;  5C3X A;  1GHK A;  1G91 A;  1HNW Q;  2JA8 G;  2K75 A;  1RTO A;  1B9N A;  1NSN S;  1X3F A;  5IGB A;  1T5X D;  1CHP D;  1TS3 A;  3J7A 5;  1LTT D;  2F0P A;  4QUC A;  3S14 B;  3HOY B;  3H91 A;  4DR5 Q;  4A3M G;  3NXW A;  2FHT A;  1GUN A;  3SXH A;  2NZ1 D;  4LF6 Q;  1LLR D;  1PRT B;  4JYA Q;  1VQB A;  3GTL B;  3QOJ A;  2JYO A;  5CV5 A;  3S1M H;  1EY0 A;  2RDF A;  4DFA A;  4DF7 A;  2UXD Q;  1SE2 A;  3RLN A;  1EY9 A;  1HHV A;  3AB9 A;  2SNS A;  4WOR A;  5JJI A;  5CR3 A;  1CKM A;  5C6A A;  3CXC A;  4JI7 L;  1HA6 A;  1V9P A;  1OO9 B;  2MHV A;  3K0X A;  1KNE A;  2O5J C;  4TVA B;  4KHV A;  4OWX B;  4ZKC B;  2DNC A;  4CDF C;  1ENC A;  2PMZ B;  3Q24 A;  3S16 H;  4JI3 L;  2WV6 D;  1DZ1 A;  1X55 A;  4JV5 L;  5KNC A;  1H9J A;  3T16 A;  2NB0 A;  2R7Z B;  1VQ4 A;  4BY1 G;  1BOS A;  3MFG A;  5ELN A;  4YHH Q;  3MAQ A;  4IN3 A;  4N8X 1;  4IZ8 A;  1O7Z A;  1NUC A;  1STN A;  4DR1 L;  2ES2 A;  5M3F G;  1I3Q B;  1P16 A;  3I72 A;  5IGC A;  1NE3 A;  5C44 B;  4WJW A;  4LF7 L;  3PGZ A;  4JI4 L;  5C4Z A;  3W5O A;  3DHQ A;  3NSW A;  4UY8 C;  1OXT A;  3UDX A;  1TY2 A;  1CUK A;  2M9V A;  3S1N H;  4I7A A;  4R4C A;  1IBM L;  2QGQ A;  5FKA C;  1I4G A;  1HUN A;  4IFD H;  3GTJ H;  5J3B A;  1BCP C;  1TY0 A;  1PH2 A;  5A2Q L;  3K5O A;  4A93 B;  2R61 A;  1D6E C;  2KEN A;  2O5I C;  3G7L A;  2A5H A;  1B9M A;  2O4X A;  5LMN W;  2OT2 A;  2DJG C;  3MXN A;  5DAU A;  4BY7 B;  5BN3 A;  1X32 A;  4GLA C;  1GD7 A;  3OW2 A;  3VR6 A;  1V1O A;  4CHT B;  4R8I A;  1X9N A;  4DAY A;  2MPM A;  2K32 A;  4IFD I;  5GAD C;  4R9W A;  2Y0S B;  2VB3 X;  2R7F A;  1WFQ A;  4DK6 C;  4OO1 G;  3VYU A;  2QIL A;  2K04 A;  1LT6 D;  4DR2 L;  1HNX Q;  1EEF D;  2B2W A;  2BH2 A;  1E3P A;  1UWV A;  1Q90 A;  2F0I A;  3I3C A;  1S3O A;  3R93 A;  4G7Z C;  4HAE A;  4WJ4 A;  3A8I E;  4EQP A;  4KMU C;  1A3T A;  4X62 Q;  2WAQ B;  3HRZ C;  1XWE A;  1F77 A;  5D3I B;  4YY3 Q;  2F03 A;  1N33 L;  4N9P A;  5IWA Q;  5FLX L;  1BDO A;  5CV6 A;  1N34 L;  3NBI A;  4Q5V A;  2WB1 E;  4A3E B;  3J7A F;  4JI1 L;  1J6Q A;  4A3J B;  2A74 C;  1S4Z A;  1B4O A;  1SYF A;  3GD7 A;  1XPU A;  3GTK H;  2ZXP A;  2HUG A;  1CZG A;  1SNC A;  2NUC A;  4JVZ A;  4IUT A;  3H3V H;  1OXV A;  3AMU A;  4DR3 L;  4AYB G;  4B3M L;  1MSH A;  3TSS A;  2AMC B;  3OTO Q;  2B2W C;  4WFN 3;  5LMU L;  3D4R A;  4LF9 L;  2FXQ A;  1CKN A;  1EIH A;  2K28 A;  3HKZ B;  3RUZ A;  1AFP A;  2HDM A;  1U4M A;  1LO5 D;  1M4V A;  5E3F A;  2YTY A;  3NEL A;  2EYJ A;  1SSO A;  2QDL A;  4KI0 A;  4R1J A;  1IKL A;  1WI5 A;  5E7N A;  3H3V I;  4HJ7 A;  3VDY A;  2HDL A;  3KBG A;  2A73 B;  2R93 G;  2GVB A;  2J7Z A;  5TSS A;  2Z6K A;  1BCP F;  1WTH A;  4A75 A;  1VQK A;  4IFD G;  1HPC A;  3QR8 A;  2G9D A;  1JMC A;  1QVG A;  1HNW L;  1M90 C;  3CCS A;  2YU9 B;  5CV9 A;  1G8Z D;  2DN8 A;  2B8F A;  3HOW H;  2YTX A;  3CW2 C;  3OIQ A;  4DR5 L; 
#chains in the Genus database with same CATH homology
 3LWE A;  2EPB A;  4IUP A;  1JC7 A;  3W2D A;  4FP5 D;  5EBC A;  5JEA H;  4MIU A;  2NVQ B;  2M00 A;  1R4Q B;  2F0K A;  4F88 A;  2B2U A;  4L6T B;  2D5D A;  4PMB A;  1DOK A;  2OEO A;  4H0L C;  1A2T A;  3ND9 A;  1ROD A;  2F0O A;  1I4Q A;  1EIG A;  3DEP A;  1JOO A;  1Z47 A;  3DMU A;  3BDL A;  4RHS A;  1Y8N B;  2F0D A;  1TU2 B;  2IX3 A;  2B2U C;  4NP5 A;  5IGG A;  1WTV A;  4IUR A;  1WTQ A;  1HQR D;  1H9S A;  2SDF A;  2E2I B;  3UI2 A;  4BS9 A;  2X6G A;  1Q12 A;  5DM7 3;  2C5C A;  4QMG A;  3U9S A;  5KYI A;  2I07 B;  1PYW D;  4K5X A;  1Z7T A;  2RSO A;  1KDA A;  4M8A A;  2KUM A;  3TN2 A;  4ODG A;  2B2T C;  1JR0 D;  2IT1 A;  1ZYR C;  3R2T A;  2OXP A;  1PMR A;  4C3H G;  4C3J B;  1K83 B;  1A2U A;  2XNA C;  4NMZ A;  3LX0 A;  3S2H B;  4RFB A;  3D31 A;  4DXG A;  5T1G A;  5EQ0 A;  2HQE A;  2JEA I;  2PCF B;  4PMW A;  3HS0 C;  1B50 A;  1KDC A;  3TP7 A;  2RBM A;  1O7L A;  3HOU B;  1A3V A;  1RHP A;  4DNR B;  1S5C D;  1D5X C;  2B39 A;  3NHH A;  4ME5 A;  5JEA G;  4ZUI A;  3FPP A;  4IQZ A;  3N52 A;  2JE6 I;  3VR2 A;  2JA8 B;  4A3K B;  3R8B A;  3NUC A;  5IGF A;  1O78 A;  5M3M B;  3K5N A;  3A7A B;  1B2T A;  5J39 A;  4RAU C;  2CW0 C;  1CT1 D;  1KAB A;  1QB5 D;  2EYP A;  2BCO A;  4UDU C;  2IW3 A;  1CQV A;  1LTB D;  1LTS D;  3RLF A;  3A56 A;  2Z8L A;  3J80 E;  2BOS A;  3EVQ A;  2HCI A;  2FJ2 A;  2RQX A;  4C2M B;  2PO4 A;  3NK9 A;  4RCN A;  1BQQ T;  4P2C B;  3T4A C;  1HTP A;  5C0X J;  1EY7 A;  2FIN B;  2EXZ A;  4XIG S;  1EU4 A;  1EY8 A;  5A2Q E;  3DM1 A;  1PRT D;  1SYB A;  4HMI A;  2D2C C;  4DGZ A;  4K14 A;  4ZLT F;  1ENF A;  1H9R A;  1WCM B;  5JPM C;  1JOQ A;  1MGS A;  1II3 A;  4DA2 A;  5M3F B;  4BA2 I;  4XQQ A;  3D4W A;  3BYY B;  2KVM A;  3HP3 A;  4FF4 A;  4TQU S;  4KD4 A;  4J8Q A;  5KNB A;  3HG9 A;  5C5L A;  1HA5 A;  1UNS A;  3J81 E;  2PW7 A;  4WRD A;  1TS5 A;  2MJ8 A;  2F0F A;  2N88 A;  5FLX E;  3CKI B;  1L0Y B;  3T51 B;  3FRP B;  1NAP A;  2TMP A;  4E6I A;  3GTM B;  2K03 A;  1CHQ D;  3EA6 A;  3EQL C;  1XX8 A;  3M4Y A;  2A68 C;  1TKW B;  1SE4 A;  4OHJ A;  1QOH A;  1SYD A;  2VNU D;  2WKD A;  5JOB A;  3ZYY X;  1LAB A;  4DAV A;  2XRQ D;  4FNF A;  4X3S A;  1SE3 A;  2AQ1 B;  1AP0 A;  2PZW A;  1BBX C;  2CW0 D;  1JB3 A;  3S9W A;  2B63 B;  3C1F A;  2PW5 A;  4FF1 A;  1GOZ A;  5C3W A;  1QCB D;  1TVX A;  5M5X B;  1K8M A;  5COR A;  3TP5 A;  1IYU A;  3BVG A;  4ZRZ A;  2R93 B;  3BS1 A;  1TS4 A;  4KKU A;  1RTN A;  2F0E A;  1JOR A;  3T56 B;  2RVL A;  1ET6 A;  1KTK A;  1PTO B;  3IL8 A;  2LKV A;  4V19 0;  1S5E D;  1Q3L A;  1FYC A;  4F8M A;  1KNA A;  3E5S A;  4LK1 C;  1S5D D;  5JJZ A;  2L12 A;  3A8J E;  5HGT A;  5M5W B;  5I9P A;  1EQT A;  4ZAI A;  3R2I A;  3QWN A;  2AWN A;  4FF3 A;  2NTS A;  2XVS A;  4KHZ A;  1RD9 D;  3HOX B;  4IUQ A;  3GTO B;  1A3U A;  5JVG 3;  2JA7 B;  1F9P A;  2A68 D;  5I9O A;  3S1Q B;  1STB A;  1GHJ A;  3D3R A;  2FFK B;  3DWP A;  4HCE A;  5JPN C;  4HN7 A;  1E2Z A;  4KN7 C;  3H09 A;  2IWH A;  1I6H B;  1DM0 B;  5FOB B;  3MA2 B;  4FXG C;  4PQX A;  2VXW A;  1EYA A;  1I50 B;  1CA6 A;  4U68 A;  3LNN A;  5C4X B;  5KGU A;  3VA5 A;  1E2W A;  4OO1 H;  4XQN A;  2RDH A;  4C3H B;  1FNW A;  4KD3 A;  4KY6 A;  2JSO A;  1CZW A;  3I4N B;  1BO0 A;  3A8K E;  3V2T A;  1EWC A;  2X6L A;  3C2P A;  4S3S A;  2WKC A;  3TP6 A;  3GV6 A;  2QCP X;  3CRK C;  1OXS C;  1MD2 D;  5CGK A;  4OO1 I;  3HOV B;  4K8J A;  1IL8 A;  5EBD A;  3PO2 B;  2SEB D;  5DM6 3;  2DY7 A;  5I6W A;  3HEJ A;  4RKB A;  3OW7 A;  2WP8 J;  2Q8I B;  2NN6 H;  2F0G A;  3J80 L;  5CV4 A;  1HCZ A;  2F3V A;  1TWC B;  3KLS X;  1DYQ A;  1QWY A;  2XWJ B;  1I4X A;  1QG7 A;  2EY2 A;  2ID0 A;  1CTM A;  3IKJ A;  2PZT A;  2PYK A;  3I4M B;  2NN6 I;  1TWG B;  1TR5 A;  4ZYS A;  5KIX A;  2AUK A;  1BXT A;  1IYV A;  4QIW B;  1SAP A;  1L0X B;  2EY6 A;  4G4K A;  1J8I A;  3P20 A;  2FMM A;  1V1P A;  4QCL A;  5AFW A;  5IOC A;  2L4N A;  3PUX A;  3J81 L;  1DOM A;  1RCV D;  3DUZ A;  5I2X A;  3VR3 A;  4K5W A;  1ILP A;  4K2L A;  1EYD A;  3T13 A;  2KEE A;  4RGM A;  1F9S A;  4C1N K;  5C5M A;  3P75 A;  5BN5 A;  2Z4I A;  4I7Z C;  5EJW A;  5LL6 X;  2KJX A;  2D9U A;  2R6G A;  1F9R A;  2NN6 G;  4G7O C;  1AN8 A;  5G3L D;  4J1M A;  4RCO A;  2A6H D;  3K6O A;  2D62 A;  5EPK A;  3TDQ A;  1U4P A;  3M7G A;  3QB3 A;  1B44 D;  2CVR A;  1O7Y A;  1EOT A;  3WDN A;  2E2J B;  1GUT A;  1OXU A;  3FDT A;  1MBY A;  3D6W A;  2EYH A;  4H13 C;  1CM9 A;  3ERO A;  1SEB D;  1WTO A;  4ZK9 B;  4DNT B;  1ONL A;  3H3V C;  4C3I G;  1TT2 A;  3PV0 A;  2F0U A;  5K5P A;  3L3O C;  1HFG A;  3OMC A;  1GUO A;  1PXU A;  5C4J B;  4XT3 B;  4C1N I;  3C3L A;  2MGS A;  3FEW X;  1PRT C;  4HSV A;  5LL6 S;  1EY4 A;  2PPB C;  4FO2 A;  1ML0 D;  1W6K A;  3MTS A;  4XTC S;  1CA5 A;  2AQ2 B;  2RKS A;  1C48 A;  2B2T A;  3TME A;  1LTR D;  3PUV A;  1R9T B;  5LHY 1;  5J1Z A;  1SYG A;  2Q8R E;  1B3A A;  2KED A;  3TZD A;  1PFB A;  3GTG B;  1AW7 A;  1Y1V B;  3E6Z X;  4M1U B;  3Q23 A;  3IAY A;  2ZT9 C;  2L9H A;  1WD0 A;  5DEH A;  1U4L A;  3A54 A;  1G2S A;  3QJY A;  1ZEQ X;  4DN4 M;  1M8A A;  3ITP A;  1JQY D;  1Q8I A;  3NTH A;  1G6Z A;  1S5B D;  3WOF A;  4NW2 A;  1HQM C;  1SMY C;  5CBE E;  2SOB A;  2TSS A;  4TKO B;  1X3P A;  3SVM A;  5E1F A;  3AU7 A;  1VMP A;  2JA6 B;  1PRT F;  4TSS A;  4CKC A;  5ELF A;  3M3Y B;  3RZO B;  4FVM A;  1D1K A;  3CQZ B;  2K5Q A;  3M85 A;  3SDZ A;  1ESF A;  1EU3 A;  4ILW A;  4BA1 I;  4KTA A;  4NDX A;  1CI3 M;  2IX1 A;  2E75 C;  3R3O A;  3S2D B;  2K01 A;  4Z9C B;  1HUM A;  4PNY A;  1JWS D;  3BVM A;  2J0T D;  2R92 B;  5CC4 A;  1EFI D;  1STG A;  5KND A;  4G7H C;  4I65 A;  4O1N A;  1F2Z A;  1OXX K;  3CRL C;  2QEJ C;  4ABN A;  3KUP A;  4DK0 A;  4NKL A;  1QJO A;  1SXT A;  2PZU A;  1SFO B;  3I4L A;  2EZV A;  1EL0 A;  5EKI A;  4IUU A;  3A7L A;  3U9O A;  4FXD A;  5FO8 B;  4KN4 C;  1RKN A;  1WTP A;  1DJR D;  5KYL A;  4EGV A;  4LJZ C;  5E4X A;  1D2B A;  2K5W A;  3W3A A;  3OIP A;  2QKI C;  1HTL D;  2RSN A;  4KK7 A;  2QDB A;  1VMC A;  2QF7 A;  3TBI B;  2EY1 A;  2KHS A;  5EKL A;  3TZU A;  2R3Z A;  4ZQ3 A;  3QO2 A;  4MHE A;  3X3N A;  3K59 A;  3MVV A;  1EZ8 A;  1RJT A;  1XXG A;  3C46 A;  5CMD A;  3VYS A;  2PQE A;  3MZ5 A;  4KV6 A;  5EPL A;  1SDF A;  2F0Q A;  1XYI A;  1U9R A;  2E74 C;  2F0H A;  4OL7 A;  3D6C A;  3VA7 A;  3L7Z C;  4RGT A;  2GA4 B;  2NBF A;  2C9O A;  3ONA B;  2K1B A;  1WD1 A;  1SMY D;  3NWT A;  1AZQ A;  1LT3 D;  2F0S A;  1O80 A;  4IUV A;  5I2Y A;  4OIJ A;  4R8N A;  3H0G B;  5C4H A;  1F2L A;  3GTP B;  2Z4H A;  2NWG A;  4IFD J;  4X3K A;  5ELD A;  1CFM A;  4N9T A;  2OF1 A;  2B2V A;  1BCP B;  4KKS A;  1F2Y A;  4H7B A;  3OPO A;  3S16 B;  1UEA B;  3V96 A;  5IIF A;  3M4O B;  5KEE A;  1GUS A;  3DWQ A;  2I46 A;  2CQA A;  1F9Q A;  4QB4 A;  3RZD B;  4KY7 A;  2F0N A;  3HZX A;  1DXM A;  5ELC A;  2B2V C;  4QUF A;  2WB1 B;  4K5V A;  4IUN A;  2KQ3 A;  3Q6S A;  4C3I B;  1TII D;  1KDB A;  3PO3 B;  2XSC A;  1KLG D;  1F2M A;  4K2K A;  4A3G B;  1TWH B;  3SHL A;  1GXD C;  3CHB D;  2L5T A;  4BBS B;  2RA4 A;  1SBB B;  2NVT B;  2HCC A;  1MI2 A;  1HRJ A;  3VR4 A;  3H94 A;  2N55 A;  2DY8 A;  4DXF A;  1J9O A;  5EKK A;  1I4H A;  1V43 A;  1PZK D;  3NQT A;  3PIP 3;  3SK5 A;  1UAP A;  2ZXO A;  2BA1 A;  3I8Z A;  1WVL A;  4X3T A;  1DON A;  4HCS A;  2KCC A;  4RKL A;  1ICW A;  3OSO A;  3MXP A;  1EY5 A;  1IKM A;  2JEB I;  3P7J A;  5COY A;  3BG3 A;  4B9X A;  4X3U A;  2EDG A;  1LTI D;  5JAV A;  2J4X A;  4RWS C;  2K7V A;  4KKT A;  2K5D A;  5C0X H;  1PZJ D;  3I91 A;  1YNN D;  1DCZ A;  3OHX C;  2Q8T A;  2KCN A;  4RH6 A;  5I4D A;  5JEA J;  1ESR A;  4B9W A;  1I6V C;  3OWF A;  2IPK D;  4A3D B;  5D3D A;  2G9H D;  1JWU D;  4RGO S;  3S1R B;  3C1E A;  3K5M A;  5D65 A;  1VDZ A;  3VR5 A;  5C0X I;  3VYR A;  5HUR A;  2A6H C;  3I90 A;  4XT1 B;  2BE5 C;  4K6L A;  2L1B A;  4HED A;  1R4P B;  2NTT A;  2L0C A;  4TRD A;  1QNK A;  1FNV A;  2ICI A;  1IHZ A;  3A55 A;  1SNM A;  4XDX A;  3MWY W;  5K36 H;  1LV9 A;  1A15 A;  2KEC A;  2BDO A;  1TS2 A;  1LT5 D;  5BN4 A;  2WII B;  4A3F B;  3HOW B;  3TP8 A;  3PUY A;  2V4D A;  5C3E B;  1D5M C;  1KAA A;  3S17 B;  2X69 A;  1PFN A;  4CKE A;  1XTC D;  1WTX A;  5IOD A;  2H1E A;  2EYL A;  3MC0 B;  3GTQ B;  3T53 B;  4BBR B;  3H6M A;  2EE1 A;  1H9S B;  4PMC A;  4ZUJ A;  3KBX A;  1PTO H;  5C0X G;  1ZKO A;  1GJX A;  2FMC A;  4Q0F A;  3MFY A;  1EQV A;  4CKB A;  1Y1W B;  2JP1 A;  2F4I A;  2XRS D;  3QIA A;  3K58 A;  5G3L F;  2H4O A;  1SND A;  2F0W A;  3MHB A;  1GUW A;  4H44 C;  4FYD A;  1A6X A;  4HTH A;  1GUG A;  3G6J B;  3ERQ A;  3GV3 A;  4L8J A;  3SK4 A;  1ZXT A;  4PV1 C;  3I70 A;  5K36 G;  3MXG A;  2PNR C;  1DD2 A;  1SNO A;  1VF5 C;  2IJ0 A;  2A6E C;  1W6J A;  3I73 A;  1PTO C;  3Q22 A;  3DWA A;  1STH A;  4CJ2 C;  2F0J A;  2IX0 A;  5FO7 B;  2JA5 B;  1C8C A;  5CYU A;  5ISR A;  2K6A A;  4DU9 A;  4J6H A;  2BDN A;  4JBW A;  2BE5 D;  5IT9 L;  1EEI D;  2XWB B;  5NUC A;  1E2V A;  1PFM A;  3PUZ A;  2BA0 A;  1MSG A;  4A3I B;  5JVH 3;  2EJM A;  3BVZ A;  1LT4 D;  4HSP A;  4A3B B;  3FVQ A;  3PUW A;  4RA8 A;  2LMC B;  1TWF B;  2CHB D;  2Z1C A;  3DXJ C;  2A69 C;  3K5L A;  4ULL A;  1I4R A;  4DAP A;  2IL8 A;  5ELE A;  4FXK C;  3GO5 A;  3KLR A;  3NPP A;  1IW7 C;  2LS0 1;  4OIK A;  1VF7 A;  1BF4 A;  3JAM L;  5CBA E;  1PTO F;  3SK6 A;  1HFN A;  1Y8O B;  4C56 C;  3SR1 A;  1BCP D;  3X3M A;  3NBH A;  3Q0A A;  1TWA B;  1WTW A;  1U4R A;  3K7A B;  3F2U A;  1SYE A;  3OWE B;  3NTI A;  2XIW A;  2VUM B;  3PIO 3;  5EGT A;  2SNM A;  3IFD A;  1STY A;  3BYT B;  3EJI A;  1D5Z C;  4KY5 A;  4CBV A;  3DEO A;  3OMG A;  3URY A;  4EQN A;  3P1H A;  4F87 A;  4IAL A;  5CV7 A;  3CU7 A;  4OGQ C;  1QIL A;  3V05 A;  2KA7 A;  3VYT A;  1Q1E A;  2A6E D;  2EY5 A;  3HOZ B;  1PTO D;  1UUP A;  1V8Q A;  1VCI A;  5J22 A;  1NCV A;  1HXY D;  1JCK B;  1G2T A;  1S5F D;  2MUY A;  2VB2 X;  1G29 1;  1JOK A;  1EY6 A;  2YYZ A;  1BNZ A;  4LMQ D;  3BZD B;  1LTA D;  3GP7 A;  3E0J A;  5E4W C;  1Y8P B;  2LY7 A;  4FF2 A;  3D8G A;  1Z6H A;  4Y7N B;  1DOL A;  3J7Y W;  1AZP A;  4L63 B;  5M9O A;  2K05 A;  2MP1 A;  5M5Y B;  1E0B A;  1H9M A;  3RMH A;  1SNQ A;  3IFT A;  1FD7 D;  3FKI B;  4HR7 B;  3J7A V;  4CJ0 B;  2E76 C;  1JWM D;  3MXU A;  3PMF A;  2NVX B;  2NYZ D;  4A3M B;  4G57 A;  4EVO A;  4B08 A;  3NTK A;  4QF4 A;  2A69 D;  3FMC A;  2F0M A;  1SJE D;  1T5E A;  1FGB D;  4CJ1 B;  1EWH A;  1C4Q A;  4BWG B;  3HGB A;  1IW7 D;  3NE5 B;  4LAA A;  1SYC A;  3K57 A;  3WOE A;  1D1I A;  3KF8 A;  5T1I A;  3SK8 A;  1WTR A;  1ENA A;  1PLF A;  3QG1 A;  2E2H B;  4U67 3;  1STE A;  2EJG C;  2JXM B;  2O2L D;  5A35 A;  4MN3 A;  4BY1 B;  2F0T A;  1B1Z A;  2AQ3 B;  1LAC A;  3EFX D;  3L9A X;  2LFN A;  1B53 A;  1X3Q A;  1RF2 D;  4JK1 C;  4K6D A;  4GZY C;  1YNJ C;  2NVY B;  3FPU B;  5IGE A;  2XN9 C;  3NWS A;  2F0V A;  4XYQ A;  2L11 A;  1CQF A;  2M2L A;  5FO9 B;  1I4P A;  4RHR A;  2L55 A;  3D4D A;  3BDO A;  2KOL A;  2F1M A;  3RD4 A;  4ZKB B;  3O13 A;  1YNN C;  4KJN A;  2EYO A;  1ZYR D;  1ILQ A;  3MEH A;  5IGD A;  5IT9 E;  1RDP D;  1JIC A;  3S1M B;  1FNU A;  3SE0 A;  4K8I A;  4HMJ A;  2F0L A;  5EPJ A;  3KK7 A;  1BUV T;  1FR3 A;  4XXE A;  2EYM A;  1K8O A;  1KLU D;  1EYC A;  3S15 B;  3QOL A;  3OOC A;  1Q1B A;  4EQO A;  1CK1 A;  5ELB A;  2DNE A;  4ID6 A;  3BDC A;  2EYF A;  3NQI A;  3K0Y A;  1JE4 A;  1QNU A;  1NR4 A;  4AYB B;  1STA A;  2EVB A;  1ET9 A;  1LTG D;  2EJF C;  1EZ6 A;  4RGN A;  2WAC A;  2WIN B;  1PDQ A;  4XYO A;  1QE6 A;  5KRU A;  5CV8 A;  1SJH D;  3ND8 A;  4XQJ A;  5FK9 C;  3JAM E;  3S1N B;  4O42 A;  5F2D A;  3GTJ B;  2B2Y A;  2AWO A;  2RDG A;  2ENB A;  1V1P B;  4UAI A;  4KJO A;  3SEB A;  2AUJ D;  3NP8 A;  2B8G A;  3N6R A;  3M7N A;  4DK1 A;  1TQO A;  2ZXR A;  2ICE C;  5I6Y A;  4F7X A;  5DNF A;  1YNJ D;  2B2Y C;  1SNP A;  3KLS A;  1NR2 A;  5D14 A;  2F3W A;  4C3J G;  1PZI D;  4YIJ A;  1AEX A;  3GQB A;  1BR9 A;  1Y69 U;  2E2D C;  3GTK B;  3LWU A;  4V0B A;  2K33 A;  1H9K A;  2EOT A;  4CGY B;  5C3X A;  1GHK A;  1G91 A;  1RTO A;  1B9N A;  1NSN S;  5IGB A;  1T5X D;  1CHP D;  1TS3 A;  1LTT D;  2F0P A;  4QUC A;  3S14 B;  3HOY B;  3H91 A;  3NXW A;  2FHT A;  1GUN A;  3SXH A;  2NZ1 D;  1LLR D;  1PRT B;  3GTL B;  3QOJ A;  2JYO A;  5CV5 A;  1EY0 A;  2RDF A;  4DFA A;  4DF7 A;  1SE2 A;  1EY9 A;  1HHV A;  3AB9 A;  2SNS A;  4WOR A;  5CR3 A;  5C6A A;  1HA6 A;  1OO9 B;  2MHV A;  1KNE A;  2O5J C;  4KHV A;  4ZKC B;  2DNC A;  1ENC A;  2PMZ B;  3Q24 A;  2WV6 D;  1DZ1 A;  5KNC A;  1H9J A;  3T16 A;  2NB0 A;  2R7Z B;  1BOS A;  3MFG A;  3MAQ A;  4IN3 A;  4IZ8 A;  1O7Z A;  1NUC A;  1STN A;  1I3Q B;  3I72 A;  5IGC A;  5C44 B;  4WJW A;  5C4Z A;  3DHQ A;  3NSW A;  1OXT A;  1TY2 A;  2M9V A;  5FKA C;  1I4G A;  1HUN A;  4IFD H;  1BCP C;  1TY0 A;  5A2Q L;  3K5O A;  4A93 B;  2R61 A;  1D6E C;  2O5I C;  3G7L A;  2A5H A;  1B9M A;  2O4X A;  2OT2 A;  3MXN A;  5DAU A;  4BY7 B;  5BN3 A;  1X32 A;  3VR6 A;  1V1O A;  4CHT B;  4R8I A;  4DAY A;  2MPM A;  2K32 A;  4IFD I;  4R9W A;  2Y0S B;  2VB3 X;  4OO1 G;  3VYU A;  2QIL A;  2K04 A;  1LT6 D;  1EEF D;  2B2W A;  1Q90 A;  2F0I A;  3I3C A;  3R93 A;  4G7Z C;  4HAE A;  3A8I E;  4EQP A;  4KMU C;  1A3T A;  2WAQ B;  3HRZ C;  5D3I B;  1F77 A;  1XWE A;  2F03 A;  4N9P A;  5FLX L;  1BDO A;  5CV6 A;  3NBI A;  4Q5V A;  4A3E B;  3J7A F;  4A3J B;  2A74 C;  1S4Z A;  1B4O A;  1SYF A;  3GD7 A;  2ZXP A;  2HUG A;  1CZG A;  1SNC A;  2NUC A;  4IUT A;  1OXV A;  3AMU A;  1MSH A;  3TSS A;  2B2W C;  4WFN 3;  3D4R A;  1EIH A;  2K28 A;  3HKZ B;  3RUZ A;  1AFP A;  2HDM A;  1U4M A;  1LO5 D;  1M4V A;  5E3F A;  2EYJ A;  1SSO A;  4KI0 A;  1IKL A;  2HDL A;  3KBG A;  2A73 B;  2J7Z A;  5TSS A;  1BCP F;  4IFD G;  1HPC A;  2G9D A;  2YU9 B;  5CV9 A;  1G8Z D;  2DN8 A;  2B8F A;  3OIQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...