4DR2L

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with multiple copies of paromomycin molecules bound
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
124
structure length
123
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 14
structure length 123
sequence length 124
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4dr2L00
4JI8Q 3CCSA 2JA6H 1EOVA 2JA5H 2E5LL 3CCRA 3HOWH 4P74A 1VQCA 1XMOL 2WB1G 3S1MH 2FXQA 2ZJPA 1HNWL 1KXLA 3CC4A 3JAMc 5FLXc 1P16A 3SGIA 1KC8C 1PH1A 2NVYH 2E2JH 4L5QA 5DLQE 4LNQA 3HOVG 3OTOQ 3CCVA 1EYGA 1UWVA 4AIMA 1VCIA 4GKKQ 3S15H 1O7IA 2E8GA 3TS2A 5C3EH 3I56A 1VQJA 2ID0A 1YHAA 3PUXA 4C2MH 5C0XI 2VW9A 4ALPA 3T1YQ 3F1ZA 3KF8B 4Y52H 2CKZB 5FLMH 4HIDA 4LUOA 4HJ8A 4X6AH 1N8RC 2JJQA 4DR3L 1QVCA 1AE3A 4JG2A 4POGA 2UXBQ 4JI5Q 2NZOA 1GM5A 1UE6A 1CSPA 2BA1A 4DV5Q 4LFBQ 4A3JG 4YCVA 1K8GA 4B3SQ 4LF7Q 3A5ZB 4LF8L 3PO2G 3CMEA 2Z6KC 4R1JA 4AH6A 3KDFA 3DLLA 2A8VA 1A63A 1X65A 2VQEL 2HHHQ 2Z6KA 1UE5A 2K75A 3KF6B 1PH9A 4LW1A 2JEBI 4DNIA 3HOVH 4GNXB 3MEFA 2CQOA 2R7FA 1Q81C 2K5HA 5IWAL 3A5UA 1G291 3FKIG 1JB7A 2OTJA 2VY3A 1L0WA 3H15A 3UDGA 3TEHB 4NXMQ 1RL2A 3K7AH 1VQ9A 4A3IG 2DGYA 3FHWA 4UY8C 2RHSB 1OXXK 1Q7YC 3KFUA 3RN2A 4UPAA 4A3JH 3PO2H 4DK6C 4DR2L 1HH2P 2I5MX 1CKNB 4A3EG 1XJVA 1A0IA 3CCEA 1DGSA 4LF5L 2B29A 3ER0A 3W1GA 4JI0L 1K83H 4IJLA 4JI7L 3I4OA 4DR7Q 4IOCA 1KQSA 2YTYA 1PH7A 3BZCA 4JCVE 4PG3A 3FKIH 4GKJQ 1YJNA 4H02A 1WCMG 2MO0A 2V1CC 3ICEA 4A3IH 4C3IH 3UE0A 1YEZA 3KDFB 1GO3E 4A4IA 1IBLQ 2F52A 1ASZA 2VUMG 1EUJA 4JYAL 4KHPQ 3ULLA 2HT1A 3GTMH 3NEMA 4A3EH 1HNZQ 4X64L 4IO9A 4GOPB 2B63G 4DUYQ 4HIMA 1PYBA 3I7FA 2WFWA 2DUDA 3AQQA 5IYCG 5C4XH 1UE1A 2KBNA 3GTKH 1BBWA 2OQ0A 2UUAL 1HR0W 2AHOB 1I94L 4A3GG 3CQZH 1WCMH 1I3QH 4DV1L 4HJAA 4A3LG 4OWTB 4QL5A 1W2BA 2IY5B 2ATWA 4R4CA 1XNQL 4DAMA 4AYBE 4JOIC 2VUMH 2VQFL 2Q2UA 1Q12A 2L15A 1UE7A 4UP8A 3PSIA 3J81i 3PUZA 4JOIA 1G51A 3F2BA 4JC0A 4DR1Q 2B63H 1YHQA 2K14A 3HKZG 1SR3A 1Z47A 1Q82C 1C7YA 4IFDG 3T1HQ 2NN6I 2YTVA 2JA9A 3STBC 4JI2Q 5ELOA 3U4VA 5IYCH 1J5EQ 4KI0A 3S2HH 1HJPA 3Q8DA 1YI2A 1SFOH 5C0XG 1HNXL 1S3OA 4JI3L 4MNOA 3RLFA 1S40A 4K0KL 4A3GH 4HJ9A 1AH9A 4P73A 4A3LH 1VQFA 4B3RQ 2N8NA 3GTJH 1XNRL 4GN4B 2QA4A 4DR6L 1X54A 3I55A 4LF9Q 2ZTEA 1HZ9A 3GD7A 3J80i 1Q1EA 2K50A 1QZHA 2JA5G 1FJGL 2Q2IA 3A0JA 5AJ3Q 1PH2A 2I5LX 2ZM6Q 3RLNA 4B3TL 2N49A 1N33Q 4JBKA 1IXRA 3GTPH 2UUCL 3RZDH 1CKMA 3S24A 2VNUD 3K80C 3NELA 4DPGA 4IPHA 1MJEA 3I4NG 3HOXG 4GLXA 4DV6Q 3CCJA 1Z9FA 5GROA 2UXCQ 1XPRA 1MKHA 3T1YL 3KYHC 1HZAA 3L2PA 1PVOA 4LFCL 4A76A 3VDYA 1HR0L 1UEBA 1YNXA 4YWMA 2GVBA 3IRBA 4YHHQ 4AQYL 1PH5A 2UXBL 2UXDQ 2GVAA 1K8AC 5BR8Q 1PV4A 2YU9H 4R4TA 1YZ6A 1XMQQ 1VQEA 4R4IA 4IFDI 1PH8A 4LF6Q 3UE1A 1NMFA 3I4NH 3HOXH 3F2CA 4APVA 4BY1G 4JI4L 1TWAH 3HOYG 2Q2HA 2NZHA 1A8VA 3PIPA 1L1OC 2OWOA 3H3VH 1IBKQ 1L1OA 3BZKA 4EQ5A 1SRUA 3M9BA 3GTGH 1K0RA 3K8AA 3E9HA 4DV0L 2Z0SA 5IYDG 2UUBL 3HKSA 4LFAQ 3CF5A 4DV4Q 2ZJQA 3CC2A 5LMNW 3ULPA 1X3GA 2JA8G 4MTNA 1NJIC 1KD1C 1IBMQ 3K81C 3PGZA 3PV0A 1PFSA 3KJPA 4DV2L 3PF5A 1B7YB 4GS3A 3J7ZC 3ULJA 4JI6L 1SE8A 1E1TA 4X65L 4R4QA 4BY1H 1XPUA 2WAQG 3HOYH 2JA7G 4P72A 3I4MG 1N34L 4NXNQ 4NB3A 5C4JH 4OO1G 1N32L 2E5LQ 2HIXA 3CPWA 1XMOQ 5JJIA 2YV5A 1Y14B 1KHIA 2NN6G 5M5WH 3CMAA 1HNWQ 1SROA 1VQAA 4TVAB 3RLOA 4BA2I 3KJOA 2EXDA 4OX9L 5IYDH 2R6GA 3H3VI 3CD6A 2N78A 1V9PA 3D31A 2JA8H 4LF4L 3LGJA 1HNZL 1C9OA 4AYBG 4Y7NH 4JI1Q 2IT1A 5C4XG 3G71A 1YJWA 4YWKA 1QVGA 3GDEA 3M4PA 1Q1BA 4O2DA 3PUYA 1CSQA 2YTXA 1YITA 2JA7H 3W5OA 3I4MH 1NMGA 4J15A 3J81c 4DR3Q 1VQ5A 2ALYB 2K4KA 1E3PA 1IZ6A 4DUZL 1WFQA 1XPOA 4YY3L 4BXXH 4UP9A 1T9HA 1MJCA 1V43A 4LF8Q 1EIYB 1N36Q 3G48A 3DM3A 4A93G 2E2HH 1X3EA 4A3KG 2Y0SE 2CCZA 1NTGA 1JT8A 4GLAC 2VQEQ 4ME3A 4A3BG 4X62L 2LXJA 1EWIA 3U50C 5IY0A 4BBRG 2OQKA 5IWAQ 4XTCS 1KRTA 3AFQA 2HQLA 3BU2A 1OXVA 1AE2A 2EIFA 4PZ6A 3WWVA 1WYDA 1X9NA 4JBMA 3UDXA 1CUKA 1U0LA 4PZ8A 2XTIA 5IYBG 5LMNL 5HY6A 4DAYB 2IX0A 3TRZA 2AMCB 2RHQB 4DR2Q 1X55A 4A93H 1EFWA 4X66L 4OO1I 5FJ8G 4A3KH 4XIGS 1C0AA 2F4VL 1D7QA 2VS1A 4DR5L 4A3DG 4A3BH 4JV5L 1WOCA 4LF5Q 2XGTA 4JI0Q 3OYYA 1D8LA 3PUVA 4JI7Q 4BBRH 3OW2A 2R7ZG 4GN5A 4DV7L 4BBSG 3S14H 4DR4L 1GD7A 5IP7G 4LWCA 5LMUL 1QUQA 1YIJA 1KIXA 3CW2C 1E22A 1KL9A 3M85A 2RF4A 5IYBH 1Y1WG 4L5TA 2ZTDA 1XTDA 3PIOA 5C44H 1A62A 1VQMA 4JYAQ 3ERSX 3K0XA 1JJ2A 4DV3L 3PO3G 3NBHB 3CCUA 4X64Q 4B3ML 3HOZG 3GO5A 5FJ8H 4A3FG 5M5YH 2GN5A 4LUVA 4IFDJ 5GAEC 4IJHA 1HZBA 4A3DH 4JI8L 5JEAJ 1I6HH 1S72A 3MXNB 1JE5A 2UUAQ 1K3RA 2R7ZH 5C0XJ 3TREA 4BBSH 1I94Q 4NPSA 5IP7H 4A3MG 4RG1A 3F8TA 2K5VA 4IPGA 4DV1Q 4KLKA 1IL2A 3CP0A 1Y1WH 4TQUS 5HGQA 1XNQQ 3OTOL 3UDIA 2VQFQ 1VQLA 2IHFA 3PO3H 1I5FA 1VQOA 3PF4A 3HOZH 3U58A 4A3FH 2BH2A 1NE3A 4OONA 4KHZA 2VL6A 1VQHA 1VQBA 4JI5L 5JJLA 2MNAA 3CXCA 5EAYA 4YCUA 1BVSA 1EIFA 4DV5L 1HNXQ 4LFBL 4K0KQ 1KAWA 2JQOA 2KENA 3A74A 3CC7A 2UU9Q 2WP8J 4B3SL 1Q8KA 2D0OA 4LF7L 4A3MH 2AKWB 2N3SA 1WJJA 3JC66 2KCMA 3BJUA 5ELNA 3M7NA 1FGUA 2HHHL 5J3BA 1XNRQ 1N9WA 1VQNA 1TWFH 2C35B 4DR6Q 1CKOA 3D0FA 4GNXC 1WI5A 3PUWA 1M1KC 4BY7G 1FJGQ 4GNXA 4A3CG 2ZJRA 1PH6A 1I50H 4B3TQ 1VQ7A 4DK3C 1PH3A 3EN2A 3NENA 5IP9G 3TS0A 4L5SA 4NXML 4QQBX 3W1BA 1ASYA 1SN8A 2IX1A 4QIWE 2BA0A 2UUCQ 2R92G 2KHIA 3CPFA 2CWPA 1SLJA 2MFIA 1VQKA 1K9MC 4EX5A 1M90C 2K52A 4IPDA 1YHBA 2PI2A 5GQOA 1CKNA 2Y0SG 4JBJA 1X6OA 4JI1L 4HJ5A 3S1RH 4DR7L 2QGQA 4BY7H 5GADC 3RN5A 4LFCQ 1HR0Q 4GKJL 2OCEA 3H0GG 4AQYQ 1PH4A 4BXXG 3HOUG 4A3CH 3B6YA 2ES2A 4JBWA 2VZAA 4QY7A 1EQQA 1TXYA 3UDFA 5IP9H 5JJKA 1YJ9A 1OXUA 4DKAC 3RZOH 1RIPA 1IYJB 1IBLL 4P71A 1N36L 2R92H 4KHPL 1TWCH 2KCTA 3GTOH 4QJFA 3S1NH 4DUYL 1FL0A 4GOPC 4C3JH 1V1QA 4JI4Q 2LSSA 3KOJA 2KHJA 3RNUA 1L1OB 1JJCB 1VQGA 5IE8A 5GAHC 4GOPA 2WB1E 2PQAA 3JAMi 3M4QA 2Q2TA 2NVQH 1QVFA 2AWOA 2IHEA 5E7NA 4LUZA 3AYHB 3M4OH 2JE6I 3H0GH 1GVPA 3HOUH 4OXPA 4DV0Q 3CCMA 3RR5A 2UUBQ 1G6PA 1VQIA 1PYSB 2JK8A 4IOAA 2CFMA 1NY4A 3STBD 1K73C 4R4OA 2MQHA 3CAMA 1JMCA 1X56A 4UP7A 4P75A 4DV2Q 2PNHA 1SMXA 4DR1L 4GKKL 4JI6Q 2YYZA 1LUZA 4X65Q 4HIOA 4YWLA 3T1HL 2PMZE 1J5EL 4JI2L 1N34Q 4GLVB 5GAGC 3KLWA 2R93G 4L5RC 3J80c 3M3YH 1N32Q 1EQRA 2ASBA 3CCLA 2B3GA 2QEXA 1B8AA 3F2DA 3AEVA 5C44G 2F3IA 4B3RL 2I0QA 1LM0A 4OX9Q 1OXTA 4FDBA 5K36G 3J7A5 4HJ7A 1VS0A 4LF4Q 3GTQH 4LF9L 2NVTH 2WAQE 3EIVA 1VQ4A 2PQAB 1TWGH 1Q86C 5M3FG 3PCOB 2H5XA 5AJ3L 2ZTCA 2E2IH 1GKHA 1HZCA 1NBWA 2ZM6L 1H95A 4PZ7A 1TWHH 2R7DA 4GN3B 1Y1VG 1LTLA 1N33L 1KRSA 1OTCA 2R93H 1MIUA 1YVCA 4DUZQ 2HIVA 3G4SA 4YY3Q 1QZGA 2AWNA 1P8LA 4WJ3M 4WJ4A 1BKBA 2MO1A 4DV6L 1PHJA 3S16H 4BA1I 1YBYA 4QGUA 2JEAI 2UXCL 4X62Q 2LXKA 3GTLH 3S2DH 4RMFA 3I2ZA 2NVXH 1J6QA 1W3SA 2K5NA 5M3FH 4C3HH 4YHHL 1U5KA 5JEAG 1PA6A 1VQPA 2UXDL 3S17H 5M3MG 2EQSA 4POFA 5BR8L 3AFPA 1L2FA 2PI2E 3S1QH 1Y1VH 3EBEA 1XMQL 2UU9L 3J81j 5LMNQ 5H1SE 3HFZB 5M5XH 4A75A 1E7ZA 3ZJYC 4LF6L 4PMWA 4X66Q 2A19A 2OTLA 3E0EA 4O0AA 2F4VQ 4DR5Q 4JV5Q 4OWWB 1BBUA 1Q46A 2JA6G 3FP9A 1IBKL 5IT9c 4OWXB 3HOWG 1QUQB 3TQYA 4DV7Q 1VQDA 3CCQA 4HIKA 1VQ8A 4DR4Q 4JI3Q 2D0PA 5LMUQ 3L0OA 5M3MH 1LYLA 4LFAL 4DV4L 3E9IA 3L7ZC 3G6EA 1E1OA 1VQ6A 2RCNA 1R9TH 3K7UC 1IBML 4MZ9A 1B70B 1E24A 1OXSC 2I5HA 2A1AA 2BH8A 3HKZE 5C3EG 4DV3Q 1FVIA 4B3MQ 1X3FA 4IPCA 3U4ZA 1JJGA 4YCWA 3KF6A 5FLMG 2CWAA 2D62A 4NXNL
chains in the Genus database with same CATH superfamily
4JI8Q 3CCSA 2JA6H 2WB1G 2RCFA 3M4YA 3K7AB 3NWTA 5CGKA 5FLXc 3OW7A 1BCPF 3DEOA 3W2DA 1PH1A 2NVYH 4RFBA 5DLQE 4LNQA 1K0SA 4AIMA 1VCIA 3S15H 1O7IA 4C2MH 5C0XI 4U68A 5FLMH 3EVQA 4HIDA 4HJ8A 4DR3L 3HEJA 3FKIB 2NZOA 1PRTD 1GM5A 3RUZA 2BA1A 1ET9A 1PFMA 3T56B 1K8GA 1SNMA 4IUVA 2JN4A 3CMEA 2Z6KC 5IT9E 2F0KA 5CV8A 3DLLA 3GTMB 3HRZC 1TS4A 1UE5A 2XNAC 4DNIA 4KKUA 1CI3M 2KHSA 1G291 2KCNA 4QF4A 3GV6A 1F9PA 3P1HA 4DXGA 3TEHB 3UDGA 1VQ9A 3FHWA 5COYA 3NBIA 3QIAA 2RHSB 1OXXK 5IODA 5KGUA 3PO2H 2I5MX 1CKNB 1A0IA 1RTNA 1DGSA 5ELCA 5FKAC 3DMUA 3I4OA 1E2WA 3BZCA 4PG3A 3MXUA 1YJNA 4H02A 3S14B 1LT4D 1SNOA 3Q23A 3FMCA 2CVRA 5I2XA 4DFAA 2BCOA 3NQTA 4Q0FA 1EUJA 4Z9CB 4JYAL 2HT1A 1LTSD 2VB2X 3CHBD 3NEMA 1JICA 2MP1A 3V2TA 2TSSA 4X64L 4GOPB 4A3EH 4DUYQ 1HNZQ 4HIMA 1PYBA 3I7FA 5M5YB 4KY7A 1X3QA 1EEID 1UE1A 3HKZB 1AW7A 1HR0W 1C48A 3CQZH 4BBSB 1Z6HA 4KD3A 1I3QH 1IHZA 4HJAA 3LWEA 1W2BA 2E2DC 3WOEA 1CT1D 4AYBE 4KY6A 2VUMH 2VQFL 4UP8A 3J81i 3F2BA 2F3VA 4JOIA 3J7A5 4JC0A 1EZ6A 1SR3A 1Q82C 4A3FB 2NN6I 2YTVA 5IYCH 3Q8DA 4NKLA 1SFOH 4K0KL 2F0IA 1AH9A 1QWYA 4HCEA 1TS5A 4H44C 2N8NA 3OMCA 1LTBD 4XXEA 3I4NB 3J81E 4LF9Q 2ZTEA 4OL7A 1HZ9A 1TWAB 3J80i 4K2KA 1Q1EA 3MFGA 3D4RA 4MIUA 3A0JA 5AJ3Q 4N8FA 3RLNA 1JOKA 4XT1B 4IFDH 1VDZA 2CH4A 3OHXC 4IUNA 5C0XH 3S24A 3K80C 3NELA 4DPGA 1WTRA 3CU7A 1DYQA 3HOXG 1Z9FA 1AN8A 1XPRA 2J7ZA 1HR0L 1YNXA 4AQYL 4YHHQ 4BY7B 2UXDQ 1HPCA 1C4QA 2DJFC 1VQEA 1KTKA 1VF7A 2EY6A 1NMFA 1STYA 3HOYG 1BQQT 1IBKQ 2JA7B 3BZKA 5FK9C 3K8AA 5CBEE 3E9HA 4DV4Q 2ZJQA 3NP8A 1X3GA 4IUPA 4MTNA 4ZK9B 1NJIC 1KD1C 3K81C 3PGZA 3QOLA 2LFNA 4KN4C 1D6EC 3MFYA 4R4QA 4AYBB 2WAQG 1XPUA 1N34L 4NB3A 1N32L 4ZUJA 2E5LQ 1XMOQ 1V8QA 3A8JE 1Y14B 5M5WH 1VQAA 5IYDH 2EXDA 4WFN3 4ZKBB 3H3VI 1D5ZC 1V9PA 4RHSA 5I6WA 3D31A 3TN2A 1C9OA 1D2BA 5C4XG 3G71A 1YJWA 4A3BB 4CBVA 1QVGA 3GDEA 3M4PA 1CSQA 1DCZA 4J15A 1PTOH 1SNQA 4HTHA 4DUZL 4O1NA 1XPOA 4BXXH 4XT3B 2NN6H 2KA7A 1M4VA 1N36Q 3OPOA 3DM3A 3ND8A 5C44B 1NTGA 4WJWA 4ME3A 1WTVA 1DOKA 2RBMA 5G3LF 4ZYSA 1NUCA 1I6HB 4ID6A 1SXTA 3MXNA 5CC4A 4RGMA 5KEEA 3Q24A 2DNCA 1Y1WB 2IX0A 3LWUA 1DJRD 3VR6A 4A93H 4X66L 1LACA 1D7QA 1ENCA 4DR5L 5JJZA 3HOZB 2HD3A 4JI0Q 5FOBB 2F0QA 4JI7Q 5EKLA 1TU2B 4DR4L 3BDLA 5LMUL 4N8X1 3CW2C 1E22A 1KL9A 5M3MB 5IYBH 4FO2A 4L5TA 2ZTDA 1EY4A 1VQMA 2ZT9C 4CKEA 4DV3L 4QIWB 3X3MA 2EY1A 3CCUA 1D1IA 3GO5A 3KLSX 5FJ8H 2K28A 4IFDJ 5GAEC 1FR3A 5JEAJ 3T51B 3K58A 1JE5A 2UUAQ 2R7ZH 5C0XJ 3HOWB 4NPSA 1ILQA 2L55A 1A15A 4IPGA 3OWFA 3CP0A 2B2YA 2IHFA 1DOLA 3PO3H 1I5FA 2F0LA 1W6JA 2B2UA 1NE3A 4X3UA 5A2QL 2VL6A 1D5XC 3CXCA 3KF8A 1LT5D 1PTOC 5DAUA 4DV5L 1KAWA 2JQOA 4NDXA 2WP8J 1DD2A 4A3MH 2O4XA 1Y69U 3BJUA 2HHHL 1N9WA 1VQNA 3N6RA 1TWFH 2C35B 2EJFC 4DR6Q 1QNKA 3D0FA 4GNXC 1S4ZA 1FJGQ 4XYQA 4A3CG 1I50H 4NXML 4DK3C 4I7AA 1GXDC 2DNEA 2EYHA 2BA0A 4RAUC 2KHIA 5T1GA 2RDFA 1ESFA 2D5DA 4C3JG 4IUTA 3ONAB 4JI1L 2OEOA 2L9HA 4RA8A 4IALA 5I9OA 1EFID 5GADC 3RN5A 4GKJL 3H0GG 5ISRA 3HOUG 3B6YA 1GUWA 2VZAA 5C5MA 3TP5A 1EQQA 1B2TA 1YJ9A 3RZOH 1RIPA 1IYJB 2R92H 3BVGA 2KCTA 3S1NH 1FL0A 3QWNA 4JI4Q 4V0BA 1JJCB 5GAHC 4JW0A 5IOCA 2AWOA 3GTKB 4NW2A 3JAML 1TWHB 3MVVA 1V1PA 2JE6I 4OXPA 1E2ZA 1VQIA 3GV3A 2VB3X 1QNUA 1JMCA 4UP7A 4B08A 4GKKL 4DR1L 2PNHA 3HS0C 4JI6Q 3MXPA 2YYZA 4KHVA 4X65Q 4HIOA 2NVXB 2PMZE 1J5EL 4GLVB 4L5RC 3S2HB 1LTRD 4HMIA 2B3GA 3AEVA 3BS1A 4XQJA 4B3RL 5C5LA 4OX9Q 1G2TA 1UAPA 3Q0AA 2EYPA 3GTQH 1F2MA 2WAQE 1TWGH 2XRQD 5M3FG 3H3VC 1GKHA 1PZID 1H95A 2F0NA 1GUNA 3OIPA 4GN3B 1MIUA 2OT2A 2A68D 3U9OA 1QZGA 2AWNA 3N52A 2FJ2A 4NP5A 5FO8B 1TY0A 2MO1A 1PHJA 2UXCL 1XXGA 2LXKA 2XWBB 4DXFA 3I2ZA 3SK8A 1W6KA 1J6QA 2K5NA 2FINB 5ELDA 4C3HH 2ENBA 1PA6A 3S17H 2EQSA 4POFA 5BR8L 1XWEA 3S1QH 1Y1VH 3EFXD 2P5ZX 4DAVA 5M5XH 4A75A 4E6IA 2NWGA 2E2JB 2IWHA 4PMWA 2F4VQ 2AUKA 4JV5Q 2R61A 4KMUC 5K5PA 2JA6G 4DV7Q 2QF7A 1PZKD 3DHQA 2F0WA 3E9IA 1PTOF 5ELBA 5EPKA 3TP8A 4KY5A 2CW0C 1IBML 4MZ9A 3CKIB 4XDXA 3U4ZA 1BR9A 5CR3A 4YCWA 3VR4A 5FLMG 1KQSA 3HOYB 2JA5H 1STNA 2K1BA 3S1MH 2FXQA 2PMZB 2ZJPA 1HNWL 4UHVA 3JAMc 5E1FA 3SGIA 3SK5A 3E6ZX 5JPNC 1OO9B 4L5QA 3CCVA 1TR5A 5IT9L 1EYGA 1VF5C 3TS2A 1GUGA 5C3EH 3I56A 1VQJA 2VW9A 3T1YQ 3F1ZA 3KF8B 2L12A 2JJQA 2WAQB 1QVCA 1NAPA 1CSPA 3QG1A 4B3SQ 4YCVA 4LF8L 4O42A 3PO2G 4C3IB 4R1JA 2I46A 2F0TA 2A8VA 2L11A 2VQEL 2Z6KA 3KF6B 1PH9A 4LW1A 3HOVH 3Q6SA 4OHJA 2R7FA 3WOFA 5L37A 4OELB 5C4XB 1JB7A 1H9KA 1STAA 2VY3A 3H15A 1BCPB 2L5TA 3K7AH 1WCMB 3WDNA 4UY8C 1Q7YC 4OEMB 3V96A 1GJXA 3O13A 4DR2L 4A3EG 5HGTA 2B29A 1B9NA 3W1GA 2B63B 1B3AA 2YTYA 3I4LA 4JCVE 3D6WA 3FKIH 2V1CC 3A56A 3ICEA 3R2IA 3UE0A 3KDFB 2J0TD 3A7LA 2VUMG 4KHPQ 3GTMH 1TQOA 2PZUA 2LY7A 4UAIA 2WFWA 3P75A 5IYCG 1A3UA 1V1PB 1STBA 1I94L 4DU9A 3ERQA 5J1ZA 2IY5B 1UEAB 3SVMA 1AEXA 2ATWA 4DAMA 1Q12A 3T16A 3PUZA 1Q3LA 1Q8IA 3J81L 1Z47A 4IFDG 5E4WC 3T1HQ 2K32A 3STBC 1MGSA 5ELOA 4JI2Q 4X3TA 3VR3A 1HJPA 4KV6A 5C0XG 2G9DA 2YU9B 4A3GH 4A3LH 5D3DA 1ICFB 1A3VA 1G91A 4GN4B 2QA4A 1X54A 3I55A 1BCPD 3SR1A 1SMYD 1GUOA 1EQVA 1PH2A 2ZM6Q 4EGVA 4CJ2C 1IYUA 4CJ1B 4P2CB 4K8IA 4JBKA 1I4XA 2UUCL 3R8BA 1CKMA 3HG9A 4IPHA 4ULLA 1MJEA 4LAAA 4GLXA 3W3AA 1IKLA 2BOSA 5GROA 2CH4W 1MKHA 4BY1B 3QR8A 5IGEA 4A76A 3FPPA 5I6YA 2GVBA 3IRBA 3KBGA 4WORA 1U9RA 1TIID 2GVAA 1J9OA 4C1NK 4R4TA 1XMQQ 1SYDA 3OWEB 4IFDI 1CTMA 2JA8B 4LF6Q 2X69A 3NUCA 3I4NH 1S5BD 4APVA 1TWAH 4C3JB 2Q2HA 2NZHA 2A6EC 5DNFA 1L1OC 2OWOA 1HCZA 2EXZA 1DONA 3C1FA 2NVQB 4EQ5A 3GTGH 5CV5A 2WACA 2F0VA 5IYDG 3HKSA 3HOUB 5IGBA 3CF5A 3CC2A 5LMNW 1VMPA 3DEPA 3ULPA 4ZQ3A 2E2HB 1B7YB 4GS3A 1SE8A 4ZRZA 4P72A 4HAEA 1AP0A 3QO2A 2HIXA 3R2TA 5JJIA 1YNNC 1L0XB 2NN6G 4H7BA 1SROA 2K5DA 4TVAB 2F0JA 4QCLA 4LF4L 1SAPA 3LGJA 2HQEA 4A3KB 1HNZL 4Y7NH 2IT1A 4PQXA 1BXTA 1Q1BA 3T4AC 4BBRB 1EWHA 2JA7H 3I4MH 4RGNA 3J81c 1TKWB 4DR3Q 4OO1H 2ALYB 2K4KA 4BWGB 4PMCA 1MJCA 1WTXA 1EIYB 2Z4IA 3G48A 4A93G 5I9PA 1X3EA 4G4KA 2B8GA 2Y0SE 2F4IA 1IW7D 2CCZA 1JT8A 2LXJA 2GA4B 3C2PA 3BYTB 1EWIA 5KYLA 4RCNA 3GTLB 4A3DB 3NXWA 3I72A 3AFQA 3TP6A 2X6LA 4PZ6A 1X9NA 1WYDA 4JBMA 1JB3A 3UDXA 1CUKA 5IYBG 1LTAD 1QJOA 5LMNL 1NR4A 1U4MA 4PMBA 1SE4A 3TRZA 2AMCB 1G6ZA 5FJ8G 1C0AA 4A3BH 3OYYA 1D8LA 2R7ZG 4K5XA 1KLGD 1LT6D 3NTHA 5EBDA 2IX3A 1B44D 4K5VA 5C44H 4JYAQ 3ERSX 3PO3G 4X64Q 2GN5A 2IJ0A 2KEDA 1HFNA 1II3A 5IIFA 1ENFA 1I6HH 1U4LA 1K3RA 2JA6B 4A3MG 2K5VA 5JVH3 1Y1WH 2NVYB 2F0SA 3OTOL 2VQFQ 1ONLA 3J80E 1J8IA 2OXPA 1VQOA 3S15B 1ZYRC 4L6TB 3HOZH 4C2MB 4IUUA 1LT3D 3EA6A 4KHZA 2HCCA 4XQQA 1U4PA 4JI5L 1BVSA 4LFBL 4K0KQ 4EQNA 2KENA 2NYZD 3A74A 4NMZA 3CC7A 1XYIA 4LF7L 1V1OA 1PYWD 2KCMA 2N55A 3HGBA 1PFNA 5ELNA 1KAAA 1NCVA 2B2VC 2XRSD 4IN3A 2O5IC 3NK9A 4FF4A 2Y0SB 3OOCA 1SYCA 4CDFC 2Z1CA 3DUZA 4GNXA 1DXMA 4DAPA 3NENA 3TS0A 3D3RA 3W1BA 1WD0A 3BVMA 2PCFB 3E0JA 4QIWE 2R92G 4F87A 1EU3A 4FF3A 1M90C 4IPDA 2M00A 2WV6D 3E3XA 5GQOA 3S1RH 4DR7L 1ZEQX 1HR0Q 2OCEA 1I4HA 3VYUA 4AQYQ 1PH4A 1A2TA 2EDGA 5G3LD 3TZDA 4PNYA 3UDFA 1B1ZA 1OXUA 4ZLTF 2KUMA 4K14A 1TT2A 1IBLL 1N36L 1PZJD 3GTOH 1JOQA 5JAVA 1FYCA 3I73A 4A3EB 4X3KA 3K59A 2LSSA 3KOJA 5IE8A 3FRPB 4JPBW 2E2IB 2WB1E 5DM73 3M4QA 2Q2TA 1QVFA 2H1EA 1CK1A 3M4OH 2R93B 2LMCB 3CQZB 3CCMA 1G6PA 1I3QB 2BDNA 3CAMA 4EQPA 3S16B 1X56A 2X6GA 1SMXA 2EOTA 2JXMB 1T5EA 2PYKA 1O7LA 5M9OA 1JCKB 2E74C 1WD1A 5DEHA 1N34Q 3KLWA 3M3YH 5HURA 1N32Q 1NNXA 1KDCA 2RDGA 1WTPA 2I0QA 1LM0A 1OXTA 4FDBA 2NVTH 3EIVA 4IUQA 1VQ4A 1B50A 2PQAB 3BG3A 4G7ZC 4K6LA 4C3HG 3VR5A 1UUPA 5EKKA 1TWHH 2E75C 1A3TA 1Y1VG 1N33L 1KRSA 1OTCA 4DUZQ 3G4SA 1BO0A 1WTQA 3I8ZA 4HR7B 2F0HA 1R9TB 4FYDA 4DV6L 5CV7A 5K36H 4BA1I 2JEAI 2FFKB 3S2DH 4ABNA 3VYRA 3J7AF 4ZCKA 2NVXH 4DK0A 1O7YA 1U5KA 1L2FA 3CRLC 2DY7A 3ZJYC 2MJ8A 4MTKA 4X66Q 2OTLA 4DR5Q 4OWWB 4K2LA 1BBUA 1RF2D 2EY2A 5DM63 2F03A 3TQYA 1STGA 1VQ8A 4DR4Q 4JI3Q 5LMUQ 3L0OA 2Z8LA 2WB1B 4LFAL 1RCVD 3G6EA 1VQ6A 1I4RA 2F0PA 3A8IE 1OXSC 1E24A 5KYIA 1E0BA 2F3WA 5C3EG 2JSOA 4DV3Q 4FXDA 4IPCA 4XYOA 2B39A 3KF6A 1IKMA 4NXNL 3TP7A 3D4WA 4P74A 1VQCA 2K5QA 1XX8A 2NTTA 2A73B 4RCOA 5LHY1 2FHTA 3V05A 1KXLA 1FD7D 3P7JA 4QMGA 5M5WB 2F0DA 1KNAA 4KKSA 2E2JH 3HOVG 4ALPA 1O78A 2ID0A 3PUXA 1I4GA 2PZTA 4Y52H 2QDLA 4RHRA 2MGSA 4X6AH 5BN3A 4POGA 2UXBQ 4ME5A 1PTOB 1UE6A 4DV5Q 1GOZA 2BE5C 2FMCA 5TSSA 5BN4A 2L4NA 2D2CC 3KLSA 4AH6A 1PXUA 3KDFA 1A63A 3DWQA 3NHHA 2HHHQ 1GUSA 2JEBI 1EY5A 4GNXB 3MEFA 2K5HA 5IWAL 3BZDB 5CV6A 3A5UA 4RKLA 3FKIG 4FXKC 1FGBD 2R3ZA 4NXMQ 2EJMA 2RSNA 2DGYA 2NTSA 4M1UB 3KFUA 1GHKA 1GHJA 1SYEA 3RN2A 1LABA 4A3JH 1XJVA 5CV9A 4DAYA 4A93B 4LF5L 2B2WC 2QILA 1WVLA 1K83H 1S5FD 4IOCA 2G9HD 4H13C 4S3SA 2G5DA 4GKJQ 1HXYD 5LL6X 4A3IH 4C3IH 4A4IA 2F52A 2WKDA 3D6CA 3ULLA 3GTJB 2F0UA 4IO9A 1RD9D 1SNCA 2DUDA 1I4QA 3ZYYX 5C4XH 2KBNA 1BBWA 3MXGA 2HDLA 1HUMA 4A3GG 4JVZA 3K5MA 1WCMH 3GTPB 4DV1L 3RZDB 4A3LG 4OWTB 1O7ZA 3EROA 4XQNA 4N9PA 1XNQL 4LJZC 1SJHD 2CHBD 4F8MA 1PTOD 3PSIA 1KLUD 4DR1Q 4GKKQ 2B63H 2LKVA 3HKZG 2F0MA 4FP5D 1J5EQ 1YI2A 3G7LA 1HNXL 1RJTA 1S3OA 1S40A 2B8FA 5CYUA 5I4DA 2JYOA 1BOSA 4A3MB 1TS2A 4B3RQ 3NE5B 3QJYA 1XNRL 4I65A 4RGOS 3HOXB 3P20A 2QDBA 1JORA 2K50A 4TKOB 2SNMA 4TSSA 1SYFA 4B3TL 4CJ0B 2N49A 1EQTA 4BS9A 1D5MC 4J8QA 3OMGA 4YIJA 1K8OA 2B2YC 1CHQD 3I4NG 1ICWA 1CQFA 1DOMA 1T5XD 3CCJA 2UXCQ 2Z6BA 2BE5D 1CFMA 3T1YL 1HZAA 2C9OA 3L2PA 1PVOA 4G7OC 4LFCL 5C4JB 3VDYA 2DN8A 1PH5A 5BR8Q 2YU9H 1HTLD 3RZOB 4KJOA 2R92B 1HUNA 3UE1A 2NUCA 2IL8A 3F2CA 3NTIA 1A8VA 3R3OA 2BDOA 1JQYD 1A2UA 1L1OA 4FF2A 1SRUA 3A55A 3M9BA 4DV0L 2Z0SA 2UUBL 4J1MA 3PIP3 2PPBC 1UNSA 1IBMQ 2EYJA 4K6DA 3PV0A 4DV2L 3J7ZC 4BY1H 2JA7G 1Q90A 3L9AX 3I4MG 4OO1G 1Y8NB 4C56C 3AB9A 3HZXA 1HRJA 2O2LD 1RHPA 2YV5A 3IAYA 3CMAA 1HNWQ 2KJXA 2L1BA 4FNFA 4TRDA 3KJOA 4BA2I 2N78A 5FO9B 2JA8H 2PZWA 1WTHA 4AYBG 3VYTA 2K03A 1S5CD 1QE6A 1SBBB 3OSOA 1YITA 2DJGC 3W5OA 3J7YW 1SJED 5T1IA 1VQ5A 1GUTA 4CKBA 3SK6A 4YY3L 4LF8Q 1RTOA 2E2HH 1PRTC 4GLAC 4RGTA 2VQEQ 4A3BG 4X62L 3U50C 5IY0A 1EY7A 1SDFA 1MSGA 1OXVA 1QCBD 2EIFA 1LV9A 1U0LA 4PZ8A 2XTIA 5J39A 3X3NA 3S1QB 1Y1VB 2NZ1D 1BBXC 4X3SA 4HSVA 3VA5A 2A6HC 4DAYB 5LL6S 2QEJC 4DR2Q 3T13A 1EFWA 4OO1I 4A3KH 4HCSA 4ZKCB 2RQXA 2VS1A 2IPKD 2XGTA 4BBRH 2CW0D 3OW2A 4GN5A 1BDOA 3S14H 1GD7A 4LWCA 1QUQA 1C8CA 3M85A 3D8GA 1Y1WG 1XTDA 1A62A 3K0XA 3CRKC 4B3ML 3HOZG 3VYSA 4LUVA 2Q8TA 5M5YH 3AMUA 3QOJA 1Y8OB 3J80L 4A3DH 4JI8L 2O5JC 2A5HA 4G7HC 3MC0B 4BBSH 1I94Q 5IP7H 2B2TC 3F8TA 1IL2A 1Y8PB 5EBCA 2XSCA 5HGQA 2EYLA 1MBYA 5C3EB 4A3FH 1CHPD 1VQHA 2MNAA 4LK1C 1VMCA 2PW5A 2KOLA 4YCUA 1EIFA 5EAYA 3MAQA 3K57A 2UU9Q 2D0OA 2AKWB 3JC66 2A69C 1TWCB 3DM1A 3M7NA 1EIGA 1FGUA 5KRUA 5J3BA 1SE3A 1WI5A 4ODGA 3NWSA 1PH6A 1VQ7A 1PH3A 3EN2A 3FPUB 3H0GB 2UUCQ 4KN7C 1X3PA 3CPFA 4K5WA 1LLRD 2CWPA 3FEWX 2MFIA 1VQKA 1K9MC 2K52A 4R9WA 1CZWA 2PI2A 4HJ5A 1RKNA 2LS01 1X6OA 3H09A 1FNVA 4BY7H 4FXGC 2HCIA 4BXXG 4JBWA 1KDBA 3MTSA 5IP9H 5JJKA 2J4XA 2MPMA 3VR2A 4P71A 4KTAA 5KNBA 1WTOA 2F0EA 4QJFA 4DUYL 4GOPC 3RNUA 1L1OB 1VQGA 1G2SA 4UDUC 2PQAA 4DA2A 2N88A 2A6HD 2RSOA 2Z4HA 2WKCA 3AYHB 1EU4A 1BNZA 1JC7A 4R8NA 1PYSB 2JK8A 1F9RA 2CFMA 1NY4A 2C5CA 3STBD 1K73C 3L3OC 4R4OA 1AZQA 3DXJC 5ELEA 4QB4A 4KJNA 1H9JA 1PRTF 1LUZA 3SXHA 3IFTA 4YWLA 5FLXE 5M3FB 5CBAE 3MHBA 3J80c 2ASBA 1B9MA 2QEXA 1B8AA 3R93A 3F2DA 4A3GB 1QG7A 2F3IA 2RA4A 1H9SA 2K6AA 5K36G 4KD4A 1EL0A 1VS0A 1D1KA 5EKIA 4LF4Q 4LF9L 5JOBA 1HTPA 5CMDA 5AJ3L 2E2IH 1HZCA 1NBWA 4RWSC 1LO5D 1LTLA 3K5NA 2R93H 1YVCA 2QKIC 2HIVA 3MWYW 4EVOA 1K28A 4WJ4A 1BKBA 3S16H 1KNEA 1YBYA 4N9TA 2QCPX 4CKCA 4KK7A 4YHHL 2A69D 2UXDL 1SNPA 4L63B 1VQPA 1S5ED 3OIQA 1NSNS 3AFPA 2PI2E 5EPJA 3J81j 2K7VA 2A6ED 5LMNQ 5H1SE 1AZPA 2ZXRA 4HSPA 1H9RA 2A19A 4IZ8A 3E0EA 4O0AA 2KQ3A 4U673 2K5WA 4B9XA 3FP9A 1IBKL 1IL8A 1QUQB 4HIKA 2RDHA 1M8AA 5JEAH 3GTGB 5M3MH 1LYLA 4DV4L 3TSSA 2Q8IB 2WIIB 1E1OA 4WRDA 1HFGA 2K01A 3DWPA 1R9TH 2SOBA 2I5HA 3IL8A 2TMPA 5J22A 1YNND 1X3FA 1R4PB 1JJGA 1ML0D 3U9SA 3G6JB 3I90A 1EOVA 4QUCA 2E5LL 3CCRA 3HOWH 3I70A 1XMOL 1RDPD 3T53B 3A54A 3CC4A 1P16A 1KC8C 3PO2B 3FVQA 3OTOQ 1UWVA 3NQIA 5AFWA 2EJGC 3ITPA 2E8GA 4Y7NB 2EE1A 1X32A 1YHAA 1YNJC 3GQBA 2CKZB 4LUOA 1N8RC 1R4QB 2EPBA 1AE3A 4JG2A 4JI5Q 3I4MB 1F77A 4LFBQ 3SHLA 4A3JG 4LF7Q 3A5ZB 1WTWA 4G57A 1X65A 3RMHA 4J6HA 2K75A 5KNCA 2CQOA 1Q81C 4DGZA 1PLFA 3AU7A 2OTJA 1L0WA 3RD4A 1AFPA 1RL2A 1EY9A 4OIJA 2I07B 4C3IG 5ELFA 4A3IG 1B53A 3HP3A 5EGTA 1CZGA 2OF1A 4UPAA 2MUYA 4DK6C 1F2ZA 1HH2P 2VUMB 3CCEA 2HUGA 3ER0A 4JI0L 4IJLA 4JI7L 4DR7Q 3SDZA 1PH7A 2B2WA 4PV1C 2M9VA 1WCMG 2MO0A 1SFOB 2AQ1B 5JPMC 1LTGD 1YEZA 1GO3E 3TMEA 1IBLQ 1ASZA 3H94A 3C3LA 2E76C 2B63G 4FF1A 3BYYB 3NBHA 1XTCD 2ICIA 3AQQA 2D9UA 4V190 1SYBA 3GTKH 1ET6A 2OQ0A 2UUAL 2AHOB 5IGFA 3MA2B 2JP1A 3MZ5A 5C4ZA 2KECA 1ZYRD 4QL5A 1SEBD 4R4CA 3IKJA 4EQOA 3S9WA 4JOIC 5JVG3 2Q2UA 2L15A 1UE7A 2NBFA 1G51A 1YHQA 2K14A 1C7YA 3H91A 2JA9A 1JWMD 3U4VA 4KI0A 5BN5A 3S2HH 4JI3L 1LTID 4MNOA 3RLFA 1H9SB 1PDQA 4HJ9A 1MSHA 3K5OA 4P73A 1STHA 1VQFA 3NSWA 3GTJH 4C1NI 4DR6L 2XVSA 4QUFA 1F9SA 3PQIA 2SNSA 3GD7A 1SYGA 1QZHA 2JA5G 1FJGL 1PMRA 2Q2IA 2I5LX 2MHVA 1CM9A 1EYAA 1N33Q 3BDCA 3GTPH 1IXRA 3RZDH 3SEBA 3K5LA 2VNUD 1YNJD 1EY0A 1KDAA 2K04A 3KBXA 3VA7A 1MD2D 3C1EA 2F1MA 2L0CA 4DV6Q 1EOTA 2A68C 1I6VC 2M2LA 5CORA 3NTKA 3KYHC 3S1RB 4DK1A 4DN4M 1UEBA 4YWMA 1U4RA 2UXBL 1STEA 1K8AC 1PV4A 1FNUA 1YZ6A 1F2YA 5FO7B 4CDCC 2XIWA 2PO4A 4R4IA 1PH8A 2EZVA 3GTOB 3HOXH 4BY1G 4JI4L 1DM0B 3QB3A 3PIPA 1I4PA 3H3VH 2KCCA 3EJIA 1K0RA 3TZUA 1S5DD 3M4OB 2RVLA 4LFAQ 2EVBA 3MEHA 3FDTA 2H4OA 2JA8G 3KUPA 3TDQA 1JWUD 3KJPA 3PF5A 1PFSA 1QOHA 1ZXTA 4JI6L 3ULJA 1E1TA 4X65L 5D65A 2F0GA 3HOYH 4NXNQ 4MN3A 5C4JH 4Q5VA 4H0LC 3CPWA 5CV4A 3M3YB 1KHIA 3RLOA 4OX9L 2R6GA 3I91A 3CD6A 2KVMA 5IGCA 4ZAIA 3EQLC 4JI1Q 1SNDA 2EYOA 2NVTB 2IW3A 2WINB 4YWKA 4FVMA 4IURA 4O2DA 3PUYA 2YTXA 1NMGA 3NPPA 2NB0A 1E3PA 1IZ6A 1WFQA 5C3XA 4UP9A 1T9HA 1V43A 5E4XA 1F9QA 2AQ3B 4A3KG 1LTTD 1F2LA 1MI2A 4RH6A 2F0FA 3F2UA 1B3QA 4BBRG 3S2DB 1A6XA 2OQKA 5IWAQ 4XTCS 1KRTA 5D14A 3BU2A 2HQLA 4ILWA 3BVZA 1AE2A 3WWVA 2FMMA 1K8MA 2R7ZB 1EEFD 2KEEA 5EQ0A 5HY6A 3IFDA 4MHEA 2RHQB 1X55A 4HEDA 1Z7TA 4XIGS 2F4VL 2CQAA 3PO3B 4A3DG 4JV5L 1WOCA 4LF5Q 1KABA 3PUVA 4K8JA 4DV7L 4BBSG 5IP7G 1QILA 3DWAA 1YIJA 1KIXA 2SEBD 2RKSA 2RF4A 1EYCA 1EZ8A 3PIOA 5KIXA 4DF7A 4R8IA 1HA6A 1JJ2A 1BF4A 1TWFB 3NBHB 1RODA 4A3FG 1EY8A 4IJHA 1HZBA 1S72A 3MXNB 1B4OA 1I50B 2VXWA 1HQMC 3TREA 1FNWA 1DZ1A 4OGQC 2DY8A 3E5SA 3C46A 4RG1A 4B9WA 4DV1Q 4KLKA 2B2TA 5E3FA 4TQUS 1XNQQ 4GZYC 1IYVA 4JK1C 2B2UC 3UDIA 1VQLA 4DNTB 3PF4A 1EIHA 3GP7A 3U58A 2BH2A 2F0OA 4OONA 2ZXPA 1VQBA 3URYA 5JJLA 1ILPA 1HNXQ 4B3SL 5IGGA 2EY5A 1Q8KA 5IGDA 4CGYB 2N3SA 1WJJA 1CQVA 1XNRQ 2EYMA 2HDMA 2AQ2B 3S1NB 1CA6A 1CKOA 5A2QE 3PUWA 1M1KC 1SE2A 4BY7G 5C6AA 2K33A 2ZJRA 4B3TQ 4QQBX 4L5SA 5IP9G 1BCPC 1H9MA 1SMYC 1ASYA 1SN8A 2IX1A 5C4HA 5I2YA 1SLJA 4A3JB 1TS3A 4EX5A 4HMJA 4DNRB 1YHBA 1CKNA 2Y0SG 4JBJA 5KNDA 1ESRA 1K83B 2QGQA 4L8JA 4CHTB 1CA5A 4F7XA 4LFCQ 1TY2A 4A3CH 1EWCA 2XWJB 1ZKOA 2ES2A 4KKTA 2K05A 2ZXOA 4OIKA 1TXYA 4QY7A 4I7ZC 3Q22A 4DKAC 1MHWC 4A3IB 4IQZA 4KHPL 1TWCH 3TBIB 3GTQB 4C3JH 1V1QA 1HA5A 1JR0D 2PQEA 1JOOA 1TWGB 2KHJA 4GOPA 3SE0A 1BUVT 3JAMi 2NVQH 5FLXL 2IHEA 1G8ZD 4LUZA 5E7NA 3H0GH 1GVPA 3HOUH 4DV0Q 3H6MA 3RR5A 2UUBQ 2XN9C 4IOAA 2MQHA 4P75A 4DV2Q 1NR2A 3T1HL 3JAME 4JI2L 2ICEC 4C3HB 2A74C 5GAGC 2R93G 3S17B 1EQRA 3CCLA 5NUCA 1QB5D 1JWSD 5C44G 1EY6A 5M5XB 2PW7A 4HJ7A 4CDEC 5C3WA 3PMFA 1Q86C 3PCOB 2H5XA 2ZTCA 2ZM6L 3SK4A 4PZ7A 1TVXA 2R7DA 2SDFA 4CDDC 5EPLA 3LNNA 4RKBA 4F88A 3I3CA 4YY3Q 3UI2A 1P8LA 2PNRC 2Q8RE 3M7GA 3J7AV 3D4DA 4WJ3M 3KK7A 5F2DA 3K6OA 1PRTB 3KLRA 4QGUA 4X62Q 3GTLH 4RMFA 1W3SA 5M3FH 3PIO3 5JEAG 2JA5B 1IW7C 1K3BC 5M3MG 3S1MB 5EJWA 3BDOA 3K0YA 4M8AA 3EBEA 1XMQL 1ENAA 2UU9L 4ZUIA 1L0YB 3HFZB 1E7ZA 3LX0A 4LF6L 1EYDA 2Z9HA 1HHVA 2V4DA 2AUJD 1Q46A 5IT9c 1JE4A 4OWXB 3HOWG 1VQDA 3CCQA 4HN7A 2D0PA 1E2VA 1SSOA 2QW7A 3L7ZC 2RCNA 3K7UC 2EYFA 3A7AB 1B70B 1HQRD 5A35A 2A1AA 2BH8A 3A8KE 3HKZE 3ND9A 3HOVB 1FVIA 4B3MQ 1PFBA 2B2VA 2CWAA 2D62A 4LMQD 1O80A 5D3IB
chains in the Genus database with same CATH topology
4JI8Q 3CCSA 2JA6H 1EOVA 2JA5H 2E5LL 3CCRA 3HOWH 4P74A 1VQCA 1XMOL 2WB1G 3S1MH 2FXQA 2ZJPA 1HNWL 1KXLA 3CC4A 3JAMc 5FLXc 1P16A 3SGIA 1KC8C 1PH1A 2NVYH 2E2JH 4L5QA 5DLQE 4LNQA 3HOVG 3OTOQ 3CCVA 1EYGA 1UWVA 4AIMA 1VCIA 4GKKQ 3S15H 1O7IA 2E8GA 3TS2A 5C3EH 3I56A 1VQJA 2ID0A 1YHAA 3PUXA 4C2MH 5C0XI 2VW9A 4ALPA 3T1YQ 3F1ZA 3KF8B 4Y52H 2CKZB 5FLMH 4HIDA 4LUOA 4HJ8A 4X6AH 1N8RC 2JJQA 4DR3L 1QVCA 1AE3A 4JG2A 4POGA 2UXBQ 4JI5Q 2NZOA 1GM5A 1UE6A 1CSPA 2BA1A 4DV5Q 4LFBQ 4A3JG 4YCVA 1K8GA 4B3SQ 4LF7Q 3A5ZB 4LF8L 3PO2G 3CMEA 2Z6KC 4R1JA 4AH6A 3KDFA 3DLLA 2A8VA 1A63A 1X65A 2VQEL 2HHHQ 2Z6KA 1UE5A 2K75A 3KF6B 1PH9A 4LW1A 2JEBI 4DNIA 3HOVH 4GNXB 3MEFA 2CQOA 2R7FA 1Q81C 2K5HA 5IWAL 3A5UA 1G291 3FKIG 1JB7A 2OTJA 2VY3A 1L0WA 3H15A 3UDGA 3TEHB 4NXMQ 1RL2A 3K7AH 1VQ9A 4A3IG 2DGYA 3FHWA 4UY8C 2RHSB 1OXXK 1Q7YC 3KFUA 3RN2A 4UPAA 4A3JH 3PO2H 4DK6C 4DR2L 1HH2P 2I5MX 1CKNB 4A3EG 1XJVA 1A0IA 3CCEA 1DGSA 4LF5L 2B29A 3ER0A 3W1GA 4JI0L 1K83H 4IJLA 4JI7L 3I4OA 4DR7Q 4IOCA 1KQSA 2YTYA 1PH7A 3BZCA 4JCVE 4PG3A 3FKIH 4GKJQ 1YJNA 4H02A 1WCMG 2MO0A 2V1CC 3ICEA 4A3IH 4C3IH 3UE0A 1YEZA 3KDFB 1GO3E 4A4IA 1IBLQ 2F52A 1ASZA 2VUMG 1EUJA 4JYAL 4KHPQ 3ULLA 2HT1A 3GTMH 3NEMA 4A3EH 1HNZQ 4X64L 4IO9A 4GOPB 2B63G 4DUYQ 4HIMA 1PYBA 3I7FA 2WFWA 2DUDA 3AQQA 5IYCG 5C4XH 1UE1A 2KBNA 3GTKH 1BBWA 2OQ0A 2UUAL 1HR0W 2AHOB 1I94L 4A3GG 3CQZH 1WCMH 1I3QH 4DV1L 4HJAA 4A3LG 4OWTB 4QL5A 1W2BA 2IY5B 2ATWA 4R4CA 1XNQL 4DAMA 4AYBE 4JOIC 2VUMH 2VQFL 2Q2UA 1Q12A 2L15A 1UE7A 4UP8A 3PSIA 3J81i 3PUZA 4JOIA 1G51A 3F2BA 4JC0A 4DR1Q 2B63H 1YHQA 2K14A 3HKZG 1SR3A 1Z47A 1Q82C 1C7YA 4IFDG 3T1HQ 2NN6I 2YTVA 2JA9A 3STBC 4JI2Q 5ELOA 3U4VA 5IYCH 1J5EQ 4KI0A 3S2HH 1HJPA 3Q8DA 1YI2A 1SFOH 5C0XG 1HNXL 1S3OA 4JI3L 4MNOA 3RLFA 1S40A 4K0KL 4A3GH 4HJ9A 1AH9A 4P73A 4A3LH 1VQFA 4B3RQ 2N8NA 3GTJH 1XNRL 4GN4B 2QA4A 4DR6L 1X54A 3I55A 4LF9Q 2ZTEA 1HZ9A 3GD7A 3J80i 1Q1EA 2K50A 1QZHA 2JA5G 1FJGL 2Q2IA 3A0JA 5AJ3Q 1PH2A 2I5LX 2ZM6Q 3RLNA 4B3TL 2N49A 1N33Q 4JBKA 1IXRA 3GTPH 2UUCL 3RZDH 1CKMA 3S24A 2VNUD 3K80C 3NELA 4DPGA 4IPHA 1MJEA 3I4NG 3HOXG 4GLXA 4DV6Q 3CCJA 1Z9FA 5GROA 2UXCQ 1XPRA 1MKHA 3T1YL 3KYHC 1HZAA 3L2PA 1PVOA 4LFCL 4A76A 3VDYA 1HR0L 1UEBA 1YNXA 4YWMA 2GVBA 3IRBA 4YHHQ 4AQYL 1PH5A 2UXBL 2UXDQ 2GVAA 1K8AC 5BR8Q 1PV4A 2YU9H 4R4TA 1YZ6A 1XMQQ 1VQEA 4R4IA 4IFDI 1PH8A 4LF6Q 3UE1A 1NMFA 3I4NH 3HOXH 3F2CA 4APVA 4BY1G 4JI4L 1TWAH 3HOYG 2Q2HA 2NZHA 1A8VA 3PIPA 1L1OC 2OWOA 3H3VH 1IBKQ 1L1OA 3BZKA 4EQ5A 1SRUA 3M9BA 3GTGH 1K0RA 3K8AA 3E9HA 4DV0L 2Z0SA 5IYDG 2UUBL 3HKSA 4LFAQ 3CF5A 4DV4Q 2ZJQA 3CC2A 5LMNW 3ULPA 1X3GA 2JA8G 4MTNA 1NJIC 1KD1C 1IBMQ 3K81C 3PGZA 3PV0A 1PFSA 3KJPA 4DV2L 3PF5A 1B7YB 4GS3A 3J7ZC 3ULJA 4JI6L 1SE8A 1E1TA 4X65L 4R4QA 4BY1H 1XPUA 2WAQG 3HOYH 2JA7G 4P72A 3I4MG 1N34L 4NXNQ 4NB3A 5C4JH 4OO1G 1N32L 2E5LQ 2HIXA 3CPWA 1XMOQ 5JJIA 2YV5A 1Y14B 1KHIA 2NN6G 5M5WH 3CMAA 1HNWQ 1SROA 1VQAA 4TVAB 3RLOA 4BA2I 3KJOA 2EXDA 4OX9L 5IYDH 2R6GA 3H3VI 3CD6A 2N78A 1V9PA 3D31A 2JA8H 4LF4L 3LGJA 1HNZL 1C9OA 4AYBG 4Y7NH 4JI1Q 2IT1A 5C4XG 3G71A 1YJWA 4YWKA 1QVGA 3GDEA 3M4PA 1Q1BA 4O2DA 3PUYA 1CSQA 2YTXA 1YITA 2JA7H 3W5OA 3I4MH 1NMGA 4J15A 3J81c 4DR3Q 1VQ5A 2ALYB 2K4KA 1E3PA 1IZ6A 4DUZL 1WFQA 1XPOA 4YY3L 4BXXH 4UP9A 1T9HA 1MJCA 1V43A 4LF8Q 1EIYB 1N36Q 3G48A 3DM3A 4A93G 2E2HH 1X3EA 4A3KG 2Y0SE 2CCZA 1NTGA 1JT8A 4GLAC 2VQEQ 4ME3A 4A3BG 4X62L 2LXJA 1EWIA 3U50C 5IY0A 4BBRG 2OQKA 5IWAQ 4XTCS 1KRTA 3AFQA 2HQLA 3BU2A 1OXVA 1AE2A 2EIFA 4PZ6A 3WWVA 1WYDA 1X9NA 4JBMA 3UDXA 1CUKA 1U0LA 4PZ8A 2XTIA 5IYBG 5LMNL 5HY6A 4DAYB 2IX0A 3TRZA 2AMCB 2RHQB 4DR2Q 1X55A 4A93H 1EFWA 4X66L 4OO1I 5FJ8G 4A3KH 4XIGS 1C0AA 2F4VL 1D7QA 2VS1A 4DR5L 4A3DG 4A3BH 4JV5L 1WOCA 4LF5Q 2XGTA 4JI0Q 3OYYA 1D8LA 3PUVA 4JI7Q 4BBRH 3OW2A 2R7ZG 4GN5A 4DV7L 4BBSG 3S14H 4DR4L 1GD7A 5IP7G 4LWCA 5LMUL 1QUQA 1YIJA 1KIXA 3CW2C 1E22A 1KL9A 3M85A 2RF4A 5IYBH 1Y1WG 4L5TA 2ZTDA 1XTDA 3PIOA 5C44H 1A62A 1VQMA 4JYAQ 3ERSX 3K0XA 1JJ2A 4DV3L 3PO3G 3NBHB 3CCUA 4X64Q 4B3ML 3HOZG 3GO5A 5FJ8H 4A3FG 5M5YH 2GN5A 4LUVA 4IFDJ 5GAEC 4IJHA 1HZBA 4A3DH 4JI8L 5JEAJ 1I6HH 1S72A 3MXNB 1JE5A 2UUAQ 1K3RA 2R7ZH 5C0XJ 3TREA 4BBSH 1I94Q 4NPSA 5IP7H 4A3MG 4RG1A 3F8TA 2K5VA 4IPGA 4DV1Q 4KLKA 1IL2A 3CP0A 1Y1WH 4TQUS 5HGQA 1XNQQ 3OTOL 3UDIA 2VQFQ 1VQLA 2IHFA 3PO3H 1I5FA 1VQOA 3PF4A 3HOZH 3U58A 4A3FH 2BH2A 1NE3A 4OONA 4KHZA 2VL6A 1VQHA 1VQBA 4JI5L 5JJLA 2MNAA 3CXCA 5EAYA 4YCUA 1BVSA 1EIFA 4DV5L 1HNXQ 4LFBL 4K0KQ 1KAWA 2JQOA 2KENA 3A74A 3CC7A 2UU9Q 2WP8J 4B3SL 1Q8KA 2D0OA 4LF7L 4A3MH 2AKWB 2N3SA 1WJJA 3JC66 2KCMA 3BJUA 5ELNA 3M7NA 1FGUA 2HHHL 5J3BA 1XNRQ 1N9WA 1VQNA 1TWFH 2C35B 4DR6Q 1CKOA 3D0FA 4GNXC 1WI5A 3PUWA 1M1KC 4BY7G 1FJGQ 4GNXA 4A3CG 2ZJRA 1PH6A 1I50H 4B3TQ 1VQ7A 4DK3C 1PH3A 3EN2A 3NENA 5IP9G 3TS0A 4L5SA 4NXML 4QQBX 3W1BA 1ASYA 1SN8A 2IX1A 4QIWE 2BA0A 2UUCQ 2R92G 2KHIA 3CPFA 2CWPA 1SLJA 2MFIA 1VQKA 1K9MC 4EX5A 1M90C 2K52A 4IPDA 1YHBA 2PI2A 5GQOA 1CKNA 2Y0SG 4JBJA 1X6OA 4JI1L 4HJ5A 3S1RH 4DR7L 2QGQA 4BY7H 5GADC 3RN5A 4LFCQ 1HR0Q 4GKJL 2OCEA 3H0GG 4AQYQ 1PH4A 4BXXG 3HOUG 4A3CH 3B6YA 2ES2A 4JBWA 2VZAA 4QY7A 1EQQA 1TXYA 3UDFA 5IP9H 5JJKA 1YJ9A 1OXUA 4DKAC 3RZOH 1RIPA 1IYJB 1IBLL 4P71A 1N36L 2R92H 4KHPL 1TWCH 2KCTA 3GTOH 4QJFA 3S1NH 4DUYL 1FL0A 4GOPC 4C3JH 1V1QA 4JI4Q 2LSSA 3KOJA 2KHJA 3RNUA 1L1OB 1JJCB 1VQGA 5IE8A 5GAHC 4GOPA 2WB1E 2PQAA 3JAMi 3M4QA 2Q2TA 2NVQH 1QVFA 2AWOA 2IHEA 5E7NA 4LUZA 3AYHB 3M4OH 2JE6I 3H0GH 1GVPA 3HOUH 4OXPA 4DV0Q 3CCMA 3RR5A 2UUBQ 1G6PA 1VQIA 1PYSB 2JK8A 4IOAA 2CFMA 1NY4A 3STBD 1K73C 4R4OA 2MQHA 3CAMA 1JMCA 1X56A 4UP7A 4P75A 4DV2Q 2PNHA 1SMXA 4DR1L 4GKKL 4JI6Q 2YYZA 1LUZA 4X65Q 4HIOA 4YWLA 3T1HL 2PMZE 1J5EL 4JI2L 1N34Q 4GLVB 5GAGC 3KLWA 2R93G 4L5RC 3J80c 3M3YH 1N32Q 1EQRA 2ASBA 3CCLA 2B3GA 2QEXA 1B8AA 3F2DA 3AEVA 5C44G 2F3IA 4B3RL 2I0QA 1LM0A 4OX9Q 1OXTA 4FDBA 5K36G 3J7A5 4HJ7A 1VS0A 4LF4Q 3GTQH 4LF9L 2NVTH 2WAQE 3EIVA 1VQ4A 2PQAB 1TWGH 1Q86C 5M3FG 3PCOB 2H5XA 5AJ3L 2ZTCA 2E2IH 1GKHA 1HZCA 1NBWA 2ZM6L 1H95A 4PZ7A 1TWHH 2R7DA 4GN3B 1Y1VG 1LTLA 1N33L 1KRSA 1OTCA 2R93H 1MIUA 1YVCA 4DUZQ 2HIVA 3G4SA 4YY3Q 1QZGA 2AWNA 1P8LA 4WJ3M 4WJ4A 1BKBA 2MO1A 4DV6L 1PHJA 3S16H 4BA1I 1YBYA 4QGUA 2JEAI 2UXCL 4X62Q 2LXKA 3GTLH 3S2DH 4RMFA 3I2ZA 2NVXH 1J6QA 1W3SA 2K5NA 5M3FH 4C3HH 4YHHL 1U5KA 5JEAG 1PA6A 1VQPA 2UXDL 3S17H 5M3MG 2EQSA 4POFA 5BR8L 3AFPA 1L2FA 2PI2E 3S1QH 1Y1VH 3EBEA 1XMQL 2UU9L 3J81j 5LMNQ 5H1SE 3HFZB 5M5XH 4A75A 1E7ZA 3ZJYC 4LF6L 4PMWA 4X66Q 2A19A 2OTLA 3E0EA 4O0AA 2F4VQ 4DR5Q 4JV5Q 4OWWB 1BBUA 1Q46A 2JA6G 3FP9A 1IBKL 5IT9c 4OWXB 3HOWG 1QUQB 3TQYA 4DV7Q 1VQDA 3CCQA 4HIKA 1VQ8A 4DR4Q 4JI3Q 2D0PA 5LMUQ 3L0OA 5M3MH 1LYLA 4LFAL 4DV4L 3E9IA 3L7ZC 3G6EA 1E1OA 1VQ6A 2RCNA 1R9TH 3K7UC 1IBML 4MZ9A 1B70B 1E24A 1OXSC 2I5HA 2A1AA 2BH8A 3HKZE 5C3EG 4DV3Q 1FVIA 4B3MQ 1X3FA 4IPCA 3U4ZA 1JJGA 4YCWA 3KF6A 5FLMG 2CWAA 2D62A 4NXNL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI8 Q;  3CCS A;  2JA6 H;  1EOV A;  2JA5 H;  2E5L L;  3CCR A;  3HOW H;  4P74 A;  1VQC A;  1XMO L;  2WB1 G;  3S1M H;  2FXQ A;  2ZJP A;  1HNW L;  1KXL A;  3CC4 A;  3JAM c;  5FLX c;  1P16 A;  3SGI A;  1KC8 C;  1PH1 A;  2NVY H;  2E2J H;  4L5Q A;  5DLQ E;  4LNQ A;  3HOV G;  3OTO Q;  3CCV A;  1EYG A;  1UWV A;  4AIM A;  1VCI A;  4GKK Q;  3S15 H;  1O7I A;  2E8G A;  3TS2 A;  5C3E H;  3I56 A;  1VQJ A;  2ID0 A;  1YHA A;  3PUX A;  4C2M H;  5C0X I;  2VW9 A;  4ALP A;  3T1Y Q;  3F1Z A;  3KF8 B;  4Y52 H;  2CKZ B;  5FLM H;  4HID A;  4LUO A;  4HJ8 A;  4X6A H;  1N8R C;  2JJQ A;  4DR3 L;  1QVC A;  1AE3 A;  4JG2 A;  4POG A;  2UXB Q;  4JI5 Q;  2NZO A;  1GM5 A;  1UE6 A;  1CSP A;  2BA1 A;  4DV5 Q;  4LFB Q;  4A3J G;  4YCV A;  1K8G A;  4B3S Q;  4LF7 Q;  3A5Z B;  4LF8 L;  3PO2 G;  3CME A;  2Z6K C;  4R1J A;  4AH6 A;  3KDF A;  3DLL A;  2A8V A;  1A63 A;  1X65 A;  2VQE L;  2HHH Q;  2Z6K A;  1UE5 A;  2K75 A;  3KF6 B;  1PH9 A;  4LW1 A;  2JEB I;  4DNI A;  3HOV H;  4GNX B;  3MEF A;  2CQO A;  2R7F A;  1Q81 C;  2K5H A;  5IWA L;  3A5U A;  1G29 1;  3FKI G;  1JB7 A;  2OTJ A;  2VY3 A;  1L0W A;  3H15 A;  3UDG A;  3TEH B;  4NXM Q;  1RL2 A;  3K7A H;  1VQ9 A;  4A3I G;  2DGY A;  3FHW A;  4UY8 C;  2RHS B;  1OXX K;  1Q7Y C;  3KFU A;  3RN2 A;  4UPA A;  4A3J H;  3PO2 H;  4DK6 C;  4DR2 L;  1HH2 P;  2I5M X;  1CKN B;  4A3E G;  1XJV A;  1A0I A;  3CCE A;  1DGS A;  4LF5 L;  2B29 A;  3ER0 A;  3W1G A;  4JI0 L;  1K83 H;  4IJL A;  4JI7 L;  3I4O A;  4DR7 Q;  4IOC A;  1KQS A;  2YTY A;  1PH7 A;  3BZC A;  4JCV E;  4PG3 A;  3FKI H;  4GKJ Q;  1YJN A;  4H02 A;  1WCM G;  2MO0 A;  2V1C C;  3ICE A;  4A3I H;  4C3I H;  3UE0 A;  1YEZ A;  3KDF B;  1GO3 E;  4A4I A;  1IBL Q;  2F52 A;  1ASZ A;  2VUM G;  1EUJ A;  4JYA L;  4KHP Q;  3ULL A;  2HT1 A;  3GTM H;  3NEM A;  4A3E H;  1HNZ Q;  4X64 L;  4IO9 A;  4GOP B;  2B63 G;  4DUY Q;  4HIM A;  1PYB A;  3I7F A;  2WFW A;  2DUD A;  3AQQ A;  5IYC G;  5C4X H;  1UE1 A;  2KBN A;  3GTK H;  1BBW A;  2OQ0 A;  2UUA L;  1HR0 W;  2AHO B;  1I94 L;  4A3G G;  3CQZ H;  1WCM H;  1I3Q H;  4DV1 L;  4HJA A;  4A3L G;  4OWT B;  4QL5 A;  1W2B A;  2IY5 B;  2ATW A;  4R4C A;  1XNQ L;  4DAM A;  4AYB E;  4JOI C;  2VUM H;  2VQF L;  2Q2U A;  1Q12 A;  2L15 A;  1UE7 A;  4UP8 A;  3PSI A;  3J81 i;  3PUZ A;  4JOI A;  1G51 A;  3F2B A;  4JC0 A;  4DR1 Q;  2B63 H;  1YHQ A;  2K14 A;  3HKZ G;  1SR3 A;  1Z47 A;  1Q82 C;  1C7Y A;  4IFD G;  3T1H Q;  2NN6 I;  2YTV A;  2JA9 A;  3STB C;  4JI2 Q;  5ELO A;  3U4V A;  5IYC H;  1J5E Q;  4KI0 A;  3S2H H;  1HJP A;  3Q8D A;  1YI2 A;  1SFO H;  5C0X G;  1HNX L;  1S3O A;  4JI3 L;  4MNO A;  3RLF A;  1S40 A;  4K0K L;  4A3G H;  4HJ9 A;  1AH9 A;  4P73 A;  4A3L H;  1VQF A;  4B3R Q;  2N8N A;  3GTJ H;  1XNR L;  4GN4 B;  2QA4 A;  4DR6 L;  1X54 A;  3I55 A;  4LF9 Q;  2ZTE A;  1HZ9 A;  3GD7 A;  3J80 i;  1Q1E A;  2K50 A;  1QZH A;  2JA5 G;  1FJG L;  2Q2I A;  3A0J A;  5AJ3 Q;  1PH2 A;  2I5L X;  2ZM6 Q;  3RLN A;  4B3T L;  2N49 A;  1N33 Q;  4JBK A;  1IXR A;  3GTP H;  2UUC L;  3RZD H;  1CKM A;  3S24 A;  2VNU D;  3K80 C;  3NEL A;  4DPG A;  4IPH A;  1MJE A;  3I4N G;  3HOX G;  4GLX A;  4DV6 Q;  3CCJ A;  1Z9F A;  5GRO A;  2UXC Q;  1XPR A;  1MKH A;  3T1Y L;  3KYH C;  1HZA A;  3L2P A;  1PVO A;  4LFC L;  4A76 A;  3VDY A;  1HR0 L;  1UEB A;  1YNX A;  4YWM A;  2GVB A;  3IRB A;  4YHH Q;  4AQY L;  1PH5 A;  2UXB L;  2UXD Q;  2GVA A;  1K8A C;  5BR8 Q;  1PV4 A;  2YU9 H;  4R4T A;  1YZ6 A;  1XMQ Q;  1VQE A;  4R4I A;  4IFD I;  1PH8 A;  4LF6 Q;  3UE1 A;  1NMF A;  3I4N H;  3HOX H;  3F2C A;  4APV A;  4BY1 G;  4JI4 L;  1TWA H;  3HOY G;  2Q2H A;  2NZH A;  1A8V A;  3PIP A;  1L1O C;  2OWO A;  3H3V H;  1IBK Q;  1L1O A;  3BZK A;  4EQ5 A;  1SRU A;  3M9B A;  3GTG H;  1K0R A;  3K8A A;  3E9H A;  4DV0 L;  2Z0S A;  5IYD G;  2UUB L;  3HKS A;  4LFA Q;  3CF5 A;  4DV4 Q;  2ZJQ A;  3CC2 A;  5LMN W;  3ULP A;  1X3G A;  2JA8 G;  4MTN A;  1NJI C;  1KD1 C;  1IBM Q;  3K81 C;  3PGZ A;  3PV0 A;  1PFS A;  3KJP A;  4DV2 L;  3PF5 A;  1B7Y B;  4GS3 A;  3J7Z C;  3ULJ A;  4JI6 L;  1SE8 A;  1E1T A;  4X65 L;  4R4Q A;  4BY1 H;  1XPU A;  2WAQ G;  3HOY H;  2JA7 G;  4P72 A;  3I4M G;  1N34 L;  4NXN Q;  4NB3 A;  5C4J H;  4OO1 G;  1N32 L;  2E5L Q;  2HIX A;  3CPW A;  1XMO Q;  5JJI A;  2YV5 A;  1Y14 B;  1KHI A;  2NN6 G;  5M5W H;  3CMA A;  1HNW Q;  1SRO A;  1VQA A;  4TVA B;  3RLO A;  4BA2 I;  3KJO A;  2EXD A;  4OX9 L;  5IYD H;  2R6G A;  3H3V I;  3CD6 A;  2N78 A;  1V9P A;  3D31 A;  2JA8 H;  4LF4 L;  3LGJ A;  1HNZ L;  1C9O A;  4AYB G;  4Y7N H;  4JI1 Q;  2IT1 A;  5C4X G;  3G71 A;  1YJW A;  4YWK A;  1QVG A;  3GDE A;  3M4P A;  1Q1B A;  4O2D A;  3PUY A;  1CSQ A;  2YTX A;  1YIT A;  2JA7 H;  3W5O A;  3I4M H;  1NMG A;  4J15 A;  3J81 c;  4DR3 Q;  1VQ5 A;  2ALY B;  2K4K A;  1E3P A;  1IZ6 A;  4DUZ L;  1WFQ A;  1XPO A;  4YY3 L;  4BXX H;  4UP9 A;  1T9H A;  1MJC A;  1V43 A;  4LF8 Q;  1EIY B;  1N36 Q;  3G48 A;  3DM3 A;  4A93 G;  2E2H H;  1X3E A;  4A3K G;  2Y0S E;  2CCZ A;  1NTG A;  1JT8 A;  4GLA C;  2VQE Q;  4ME3 A;  4A3B G;  4X62 L;  2LXJ A;  1EWI A;  3U50 C;  5IY0 A;  4BBR G;  2OQK A;  5IWA Q;  4XTC S;  1KRT A;  3AFQ A;  2HQL A;  3BU2 A;  1OXV A;  1AE2 A;  2EIF A;  4PZ6 A;  3WWV A;  1WYD A;  1X9N A;  4JBM A;  3UDX A;  1CUK A;  1U0L A;  4PZ8 A;  2XTI A;  5IYB G;  5LMN L;  5HY6 A;  4DAY B;  2IX0 A;  3TRZ A;  2AMC B;  2RHQ B;  4DR2 Q;  1X55 A;  4A93 H;  1EFW A;  4X66 L;  4OO1 I;  5FJ8 G;  4A3K H;  4XIG S;  1C0A A;  2F4V L;  1D7Q A;  2VS1 A;  4DR5 L;  4A3D G;  4A3B H;  4JV5 L;  1WOC A;  4LF5 Q;  2XGT A;  4JI0 Q;  3OYY A;  1D8L A;  3PUV A;  4JI7 Q;  4BBR H;  3OW2 A;  2R7Z G;  4GN5 A;  4DV7 L;  4BBS G;  3S14 H;  4DR4 L;  1GD7 A;  5IP7 G;  4LWC A;  5LMU L;  1QUQ A;  1YIJ A;  1KIX A;  3CW2 C;  1E22 A;  1KL9 A;  3M85 A;  2RF4 A;  5IYB H;  1Y1W G;  4L5T A;  2ZTD A;  1XTD A;  3PIO A;  5C44 H;  1A62 A;  1VQM A;  4JYA Q;  3ERS X;  3K0X A;  1JJ2 A;  4DV3 L;  3PO3 G;  3NBH B;  3CCU A;  4X64 Q;  4B3M L;  3HOZ G;  3GO5 A;  5FJ8 H;  4A3F G;  5M5Y H;  2GN5 A;  4LUV A;  4IFD J;  5GAE C;  4IJH A;  1HZB A;  4A3D H;  4JI8 L;  5JEA J;  1I6H H;  1S72 A;  3MXN B;  1JE5 A;  2UUA Q;  1K3R A;  2R7Z H;  5C0X J;  3TRE A;  4BBS H;  1I94 Q;  4NPS A;  5IP7 H;  4A3M G;  4RG1 A;  3F8T A;  2K5V A;  4IPG A;  4DV1 Q;  4KLK A;  1IL2 A;  3CP0 A;  1Y1W H;  4TQU S;  5HGQ A;  1XNQ Q;  3OTO L;  3UDI A;  2VQF Q;  1VQL A;  2IHF A;  3PO3 H;  1I5F A;  1VQO A;  3PF4 A;  3HOZ H;  3U58 A;  4A3F H;  2BH2 A;  1NE3 A;  4OON A;  4KHZ A;  2VL6 A;  1VQH A;  1VQB A;  4JI5 L;  5JJL A;  2MNA A;  3CXC A;  5EAY A;  4YCU A;  1BVS A;  1EIF A;  4DV5 L;  1HNX Q;  4LFB L;  4K0K Q;  1KAW A;  2JQO A;  2KEN A;  3A74 A;  3CC7 A;  2UU9 Q;  2WP8 J;  4B3S L;  1Q8K A;  2D0O A;  4LF7 L;  4A3M H;  2AKW B;  2N3S A;  1WJJ A;  3JC6 6;  2KCM A;  3BJU A;  5ELN A;  3M7N A;  1FGU A;  2HHH L;  5J3B A;  1XNR Q;  1N9W A;  1VQN A;  1TWF H;  2C35 B;  4DR6 Q;  1CKO A;  3D0F A;  4GNX C;  1WI5 A;  3PUW A;  1M1K C;  4BY7 G;  1FJG Q;  4GNX A;  4A3C G;  2ZJR A;  1PH6 A;  1I50 H;  4B3T Q;  1VQ7 A;  4DK3 C;  1PH3 A;  3EN2 A;  3NEN A;  5IP9 G;  3TS0 A;  4L5S A;  4NXM L;  4QQB X;  3W1B A;  1ASY A;  1SN8 A;  2IX1 A;  4QIW E;  2BA0 A;  2UUC Q;  2R92 G;  2KHI A;  3CPF A;  2CWP A;  1SLJ A;  2MFI A;  1VQK A;  1K9M C;  4EX5 A;  1M90 C;  2K52 A;  4IPD A;  1YHB A;  2PI2 A;  5GQO A;  1CKN A;  2Y0S G;  4JBJ A;  1X6O A;  4JI1 L;  4HJ5 A;  3S1R H;  4DR7 L;  2QGQ A;  4BY7 H;  5GAD C;  3RN5 A;  4LFC Q;  1HR0 Q;  4GKJ L;  2OCE A;  3H0G G;  4AQY Q;  1PH4 A;  4BXX G;  3HOU G;  4A3C H;  3B6Y A;  2ES2 A;  4JBW A;  2VZA A;  4QY7 A;  1EQQ A;  1TXY A;  3UDF A;  5IP9 H;  5JJK A;  1YJ9 A;  1OXU A;  4DKA C;  3RZO H;  1RIP A;  1IYJ B;  1IBL L;  4P71 A;  1N36 L;  2R92 H;  4KHP L;  1TWC H;  2KCT A;  3GTO H;  4QJF A;  3S1N H;  4DUY L;  1FL0 A;  4GOP C;  4C3J H;  1V1Q A;  4JI4 Q;  2LSS A;  3KOJ A;  2KHJ A;  3RNU A;  1L1O B;  1JJC B;  1VQG A;  5IE8 A;  5GAH C;  4GOP A;  2WB1 E;  2PQA A;  3JAM i;  3M4Q A;  2Q2T A;  2NVQ H;  1QVF A;  2AWO A;  2IHE A;  5E7N A;  4LUZ A;  3AYH B;  3M4O H;  2JE6 I;  3H0G H;  1GVP A;  3HOU H;  4OXP A;  4DV0 Q;  3CCM A;  3RR5 A;  2UUB Q;  1G6P A;  1VQI A;  1PYS B;  2JK8 A;  4IOA A;  2CFM A;  1NY4 A;  3STB D;  1K73 C;  4R4O A;  2MQH A;  3CAM A;  1JMC A;  1X56 A;  4UP7 A;  4P75 A;  4DV2 Q;  2PNH A;  1SMX A;  4DR1 L;  4GKK L;  4JI6 Q;  2YYZ A;  1LUZ A;  4X65 Q;  4HIO A;  4YWL A;  3T1H L;  2PMZ E;  1J5E L;  4JI2 L;  1N34 Q;  4GLV B;  5GAG C;  3KLW A;  2R93 G;  4L5R C;  3J80 c;  3M3Y H;  1N32 Q;  1EQR A;  2ASB A;  3CCL A;  2B3G A;  2QEX A;  1B8A A;  3F2D A;  3AEV A;  5C44 G;  2F3I A;  4B3R L;  2I0Q A;  1LM0 A;  4OX9 Q;  1OXT A;  4FDB A;  5K36 G;  3J7A 5;  4HJ7 A;  1VS0 A;  4LF4 Q;  3GTQ H;  4LF9 L;  2NVT H;  2WAQ E;  3EIV A;  1VQ4 A;  2PQA B;  1TWG H;  1Q86 C;  5M3F G;  3PCO B;  2H5X A;  5AJ3 L;  2ZTC A;  2E2I H;  1GKH A;  1HZC A;  1NBW A;  2ZM6 L;  1H95 A;  4PZ7 A;  1TWH H;  2R7D A;  4GN3 B;  1Y1V G;  1LTL A;  1N33 L;  1KRS A;  1OTC A;  2R93 H;  1MIU A;  1YVC A;  4DUZ Q;  2HIV A;  3G4S A;  4YY3 Q;  1QZG A;  2AWN A;  1P8L A;  4WJ3 M;  4WJ4 A;  1BKB A;  2MO1 A;  4DV6 L;  1PHJ A;  3S16 H;  4BA1 I;  1YBY A;  4QGU A;  2JEA I;  2UXC L;  4X62 Q;  2LXK A;  3GTL H;  3S2D H;  4RMF A;  3I2Z A;  2NVX H;  1J6Q A;  1W3S A;  2K5N A;  5M3F H;  4C3H H;  4YHH L;  1U5K A;  5JEA G;  1PA6 A;  1VQP A;  2UXD L;  3S17 H;  5M3M G;  2EQS A;  4POF A;  5BR8 L;  3AFP A;  1L2F A;  2PI2 E;  3S1Q H;  1Y1V H;  3EBE A;  1XMQ L;  2UU9 L;  3J81 j;  5LMN Q;  5H1S E;  3HFZ B;  5M5X H;  4A75 A;  1E7Z A;  3ZJY C;  4LF6 L;  4PMW A;  4X66 Q;  2A19 A;  2OTL A;  3E0E A;  4O0A A;  2F4V Q;  4DR5 Q;  4JV5 Q;  4OWW B;  1BBU A;  1Q46 A;  2JA6 G;  3FP9 A;  1IBK L;  5IT9 c;  4OWX B;  3HOW G;  1QUQ B;  3TQY A;  4DV7 Q;  1VQD A;  3CCQ A;  4HIK A;  1VQ8 A;  4DR4 Q;  4JI3 Q;  2D0P A;  5LMU Q;  3L0O A;  5M3M H;  1LYL A;  4LFA L;  4DV4 L;  3E9I A;  3L7Z C;  3G6E A;  1E1O A;  1VQ6 A;  2RCN A;  1R9T H;  3K7U C;  1IBM L;  4MZ9 A;  1B70 B;  1E24 A;  1OXS C;  2I5H A;  2A1A A;  2BH8 A;  3HKZ E;  5C3E G;  4DV3 Q;  1FVI A;  4B3M Q;  1X3F A;  4IPC A;  3U4Z A;  1JJG A;  4YCW A;  3KF6 A;  5FLM G;  2CWA A;  2D62 A;  4NXN L; 
#chains in the Genus database with same CATH topology
 4JI8 Q;  3CCS A;  2JA6 H;  2WB1 G;  2RCF A;  3M4Y A;  3K7A B;  3NWT A;  5CGK A;  5FLX c;  3OW7 A;  1BCP F;  3DEO A;  3W2D A;  1PH1 A;  2NVY H;  4RFB A;  5DLQ E;  4LNQ A;  1K0S A;  4AIM A;  1VCI A;  3S15 H;  1O7I A;  4C2M H;  5C0X I;  4U68 A;  5FLM H;  3EVQ A;  4HID A;  4HJ8 A;  4DR3 L;  3HEJ A;  3FKI B;  2NZO A;  1PRT D;  1GM5 A;  3RUZ A;  2BA1 A;  1ET9 A;  1PFM A;  3T56 B;  1K8G A;  1SNM A;  4IUV A;  2JN4 A;  3CME A;  2Z6K C;  5IT9 E;  2F0K A;  5CV8 A;  3DLL A;  3GTM B;  3HRZ C;  1TS4 A;  1UE5 A;  2XNA C;  4DNI A;  4KKU A;  1CI3 M;  2KHS A;  1G29 1;  2KCN A;  4QF4 A;  3GV6 A;  1F9P A;  3P1H A;  4DXG A;  3TEH B;  3UDG A;  1VQ9 A;  3FHW A;  5COY A;  3NBI A;  3QIA A;  2RHS B;  1OXX K;  5IOD A;  5KGU A;  3PO2 H;  2I5M X;  1CKN B;  1A0I A;  1RTN A;  1DGS A;  5ELC A;  5FKA C;  3DMU A;  3I4O A;  1E2W A;  3BZC A;  4PG3 A;  3MXU A;  1YJN A;  4H02 A;  3S14 B;  1LT4 D;  1SNO A;  3Q23 A;  3FMC A;  2CVR A;  5I2X A;  4DFA A;  2BCO A;  3NQT A;  4Q0F A;  1EUJ A;  4Z9C B;  4JYA L;  2HT1 A;  1LTS D;  2VB2 X;  3CHB D;  3NEM A;  1JIC A;  2MP1 A;  3V2T A;  2TSS A;  4X64 L;  4GOP B;  4A3E H;  4DUY Q;  1HNZ Q;  4HIM A;  1PYB A;  3I7F A;  5M5Y B;  4KY7 A;  1X3Q A;  1EEI D;  1UE1 A;  3HKZ B;  1AW7 A;  1HR0 W;  1C48 A;  3CQZ H;  4BBS B;  1Z6H A;  4KD3 A;  1I3Q H;  1IHZ A;  4HJA A;  3LWE A;  1W2B A;  2E2D C;  3WOE A;  1CT1 D;  4AYB E;  4KY6 A;  2VUM H;  2VQF L;  4UP8 A;  3J81 i;  3F2B A;  2F3V A;  4JOI A;  3J7A 5;  4JC0 A;  1EZ6 A;  1SR3 A;  1Q82 C;  4A3F B;  2NN6 I;  2YTV A;  5IYC H;  3Q8D A;  4NKL A;  1SFO H;  4K0K L;  2F0I A;  1AH9 A;  1QWY A;  4HCE A;  1TS5 A;  4H44 C;  2N8N A;  3OMC A;  1LTB D;  4XXE A;  3I4N B;  3J81 E;  4LF9 Q;  2ZTE A;  4OL7 A;  1HZ9 A;  1TWA B;  3J80 i;  4K2K A;  1Q1E A;  3MFG A;  3D4R A;  4MIU A;  3A0J A;  5AJ3 Q;  4N8F A;  3RLN A;  1JOK A;  4XT1 B;  4IFD H;  1VDZ A;  2CH4 A;  3OHX C;  4IUN A;  5C0X H;  3S24 A;  3K80 C;  3NEL A;  4DPG A;  1WTR A;  3CU7 A;  1DYQ A;  3HOX G;  1Z9F A;  1AN8 A;  1XPR A;  2J7Z A;  1HR0 L;  1YNX A;  4AQY L;  4YHH Q;  4BY7 B;  2UXD Q;  1HPC A;  1C4Q A;  2DJF C;  1VQE A;  1KTK A;  1VF7 A;  2EY6 A;  1NMF A;  1STY A;  3HOY G;  1BQQ T;  1IBK Q;  2JA7 B;  3BZK A;  5FK9 C;  3K8A A;  5CBE E;  3E9H A;  4DV4 Q;  2ZJQ A;  3NP8 A;  1X3G A;  4IUP A;  4MTN A;  4ZK9 B;  1NJI C;  1KD1 C;  3K81 C;  3PGZ A;  3QOL A;  2LFN A;  4KN4 C;  1D6E C;  3MFY A;  4R4Q A;  4AYB B;  2WAQ G;  1XPU A;  1N34 L;  4NB3 A;  1N32 L;  4ZUJ A;  2E5L Q;  1XMO Q;  1V8Q A;  3A8J E;  1Y14 B;  5M5W H;  1VQA A;  5IYD H;  2EXD A;  4WFN 3;  4ZKB B;  3H3V I;  1D5Z C;  1V9P A;  4RHS A;  5I6W A;  3D31 A;  3TN2 A;  1C9O A;  1D2B A;  5C4X G;  3G71 A;  1YJW A;  4A3B B;  4CBV A;  1QVG A;  3GDE A;  3M4P A;  1CSQ A;  1DCZ A;  4J15 A;  1PTO H;  1SNQ A;  4HTH A;  4DUZ L;  4O1N A;  1XPO A;  4BXX H;  4XT3 B;  2NN6 H;  2KA7 A;  1M4V A;  1N36 Q;  3OPO A;  3DM3 A;  3ND8 A;  5C44 B;  1NTG A;  4WJW A;  4ME3 A;  1WTV A;  1DOK A;  2RBM A;  5G3L F;  4ZYS A;  1NUC A;  1I6H B;  4ID6 A;  1SXT A;  3MXN A;  5CC4 A;  4RGM A;  5KEE A;  3Q24 A;  2DNC A;  1Y1W B;  2IX0 A;  3LWU A;  1DJR D;  3VR6 A;  4A93 H;  4X66 L;  1LAC A;  1D7Q A;  1ENC A;  4DR5 L;  5JJZ A;  3HOZ B;  2HD3 A;  4JI0 Q;  5FOB B;  2F0Q A;  4JI7 Q;  5EKL A;  1TU2 B;  4DR4 L;  3BDL A;  5LMU L;  4N8X 1;  3CW2 C;  1E22 A;  1KL9 A;  5M3M B;  5IYB H;  4FO2 A;  4L5T A;  2ZTD A;  1EY4 A;  1VQM A;  2ZT9 C;  4CKE A;  4DV3 L;  4QIW B;  3X3M A;  2EY1 A;  3CCU A;  1D1I A;  3GO5 A;  3KLS X;  5FJ8 H;  2K28 A;  4IFD J;  5GAE C;  1FR3 A;  5JEA J;  3T51 B;  3K58 A;  1JE5 A;  2UUA Q;  2R7Z H;  5C0X J;  3HOW B;  4NPS A;  1ILQ A;  2L55 A;  1A15 A;  4IPG A;  3OWF A;  3CP0 A;  2B2Y A;  2IHF A;  1DOL A;  3PO3 H;  1I5F A;  2F0L A;  1W6J A;  2B2U A;  1NE3 A;  4X3U A;  5A2Q L;  2VL6 A;  1D5X C;  3CXC A;  3KF8 A;  1LT5 D;  1PTO C;  5DAU A;  4DV5 L;  1KAW A;  2JQO A;  4NDX A;  2WP8 J;  1DD2 A;  4A3M H;  2O4X A;  1Y69 U;  3BJU A;  2HHH L;  1N9W A;  1VQN A;  3N6R A;  1TWF H;  2C35 B;  2EJF C;  4DR6 Q;  1QNK A;  3D0F A;  4GNX C;  1S4Z A;  1FJG Q;  4XYQ A;  4A3C G;  1I50 H;  4NXM L;  4DK3 C;  4I7A A;  1GXD C;  2DNE A;  2EYH A;  2BA0 A;  4RAU C;  2KHI A;  5T1G A;  2RDF A;  1ESF A;  2D5D A;  4C3J G;  4IUT A;  3ONA B;  4JI1 L;  2OEO A;  2L9H A;  4RA8 A;  4IAL A;  5I9O A;  1EFI D;  5GAD C;  3RN5 A;  4GKJ L;  3H0G G;  5ISR A;  3HOU G;  3B6Y A;  1GUW A;  2VZA A;  5C5M A;  3TP5 A;  1EQQ A;  1B2T A;  1YJ9 A;  3RZO H;  1RIP A;  1IYJ B;  2R92 H;  3BVG A;  2KCT A;  3S1N H;  1FL0 A;  3QWN A;  4JI4 Q;  4V0B A;  1JJC B;  5GAH C;  4JW0 A;  5IOC A;  2AWO A;  3GTK B;  4NW2 A;  3JAM L;  1TWH B;  3MVV A;  1V1P A;  2JE6 I;  4OXP A;  1E2Z A;  1VQI A;  3GV3 A;  2VB3 X;  1QNU A;  1JMC A;  4UP7 A;  4B08 A;  4GKK L;  4DR1 L;  2PNH A;  3HS0 C;  4JI6 Q;  3MXP A;  2YYZ A;  4KHV A;  4X65 Q;  4HIO A;  2NVX B;  2PMZ E;  1J5E L;  4GLV B;  4L5R C;  3S2H B;  1LTR D;  4HMI A;  2B3G A;  3AEV A;  3BS1 A;  4XQJ A;  4B3R L;  5C5L A;  4OX9 Q;  1G2T A;  1UAP A;  3Q0A A;  2EYP A;  3GTQ H;  1F2M A;  2WAQ E;  1TWG H;  2XRQ D;  5M3F G;  3H3V C;  1GKH A;  1PZI D;  1H95 A;  2F0N A;  1GUN A;  3OIP A;  4GN3 B;  1MIU A;  2OT2 A;  2A68 D;  3U9O A;  1QZG A;  2AWN A;  3N52 A;  2FJ2 A;  4NP5 A;  5FO8 B;  1TY0 A;  2MO1 A;  1PHJ A;  2UXC L;  1XXG A;  2LXK A;  2XWB B;  4DXF A;  3I2Z A;  3SK8 A;  1W6K A;  1J6Q A;  2K5N A;  2FIN B;  5ELD A;  4C3H H;  2ENB A;  1PA6 A;  3S17 H;  2EQS A;  4POF A;  5BR8 L;  1XWE A;  3S1Q H;  1Y1V H;  3EFX D;  2P5Z X;  4DAV A;  5M5X H;  4A75 A;  4E6I A;  2NWG A;  2E2J B;  2IWH A;  4PMW A;  2F4V Q;  2AUK A;  4JV5 Q;  2R61 A;  4KMU C;  5K5P A;  2JA6 G;  4DV7 Q;  2QF7 A;  1PZK D;  3DHQ A;  2F0W A;  3E9I A;  1PTO F;  5ELB A;  5EPK A;  3TP8 A;  4KY5 A;  2CW0 C;  1IBM L;  4MZ9 A;  3CKI B;  4XDX A;  3U4Z A;  1BR9 A;  5CR3 A;  4YCW A;  3VR4 A;  5FLM G;  1KQS A;  3HOY B;  2JA5 H;  1STN A;  2K1B A;  3S1M H;  2FXQ A;  2PMZ B;  2ZJP A;  1HNW L;  4UHV A;  3JAM c;  5E1F A;  3SGI A;  3SK5 A;  3E6Z X;  5JPN C;  1OO9 B;  4L5Q A;  3CCV A;  1TR5 A;  5IT9 L;  1EYG A;  1VF5 C;  3TS2 A;  1GUG A;  5C3E H;  3I56 A;  1VQJ A;  2VW9 A;  3T1Y Q;  3F1Z A;  3KF8 B;  2L12 A;  2JJQ A;  2WAQ B;  1QVC A;  1NAP A;  1CSP A;  3QG1 A;  4B3S Q;  4YCV A;  4LF8 L;  4O42 A;  3PO2 G;  4C3I B;  4R1J A;  2I46 A;  2F0T A;  2A8V A;  2L11 A;  2VQE L;  2Z6K A;  3KF6 B;  1PH9 A;  4LW1 A;  3HOV H;  3Q6S A;  4OHJ A;  2R7F A;  3WOF A;  5L37 A;  4OEL B;  5C4X B;  1JB7 A;  1H9K A;  1STA A;  2VY3 A;  3H15 A;  1BCP B;  2L5T A;  3K7A H;  1WCM B;  3WDN A;  4UY8 C;  1Q7Y C;  4OEM B;  3V96 A;  1GJX A;  3O13 A;  4DR2 L;  4A3E G;  5HGT A;  2B29 A;  1B9N A;  3W1G A;  2B63 B;  1B3A A;  2YTY A;  3I4L A;  4JCV E;  3D6W A;  3FKI H;  2V1C C;  3A56 A;  3ICE A;  3R2I A;  3UE0 A;  3KDF B;  2J0T D;  3A7L A;  2VUM G;  4KHP Q;  3GTM H;  1TQO A;  2PZU A;  2LY7 A;  4UAI A;  2WFW A;  3P75 A;  5IYC G;  1A3U A;  1V1P B;  1STB A;  1I94 L;  4DU9 A;  3ERQ A;  5J1Z A;  2IY5 B;  1UEA B;  3SVM A;  1AEX A;  2ATW A;  4DAM A;  1Q12 A;  3T16 A;  3PUZ A;  1Q3L A;  1Q8I A;  3J81 L;  1Z47 A;  4IFD G;  5E4W C;  3T1H Q;  2K32 A;  3STB C;  1MGS A;  5ELO A;  4JI2 Q;  4X3T A;  3VR3 A;  1HJP A;  4KV6 A;  5C0X G;  2G9D A;  2YU9 B;  4A3G H;  4A3L H;  5D3D A;  1ICF B;  1A3V A;  1G91 A;  4GN4 B;  2QA4 A;  1X54 A;  3I55 A;  1BCP D;  3SR1 A;  1SMY D;  1GUO A;  1EQV A;  1PH2 A;  2ZM6 Q;  4EGV A;  4CJ2 C;  1IYU A;  4CJ1 B;  4P2C B;  4K8I A;  4JBK A;  1I4X A;  2UUC L;  3R8B A;  1CKM A;  3HG9 A;  4IPH A;  4ULL A;  1MJE A;  4LAA A;  4GLX A;  3W3A A;  1IKL A;  2BOS A;  5GRO A;  2CH4 W;  1MKH A;  4BY1 B;  3QR8 A;  5IGE A;  4A76 A;  3FPP A;  5I6Y A;  2GVB A;  3IRB A;  3KBG A;  4WOR A;  1U9R A;  1TII D;  2GVA A;  1J9O A;  4C1N K;  4R4T A;  1XMQ Q;  1SYD A;  3OWE B;  4IFD I;  1CTM A;  2JA8 B;  4LF6 Q;  2X69 A;  3NUC A;  3I4N H;  1S5B D;  4APV A;  1TWA H;  4C3J B;  2Q2H A;  2NZH A;  2A6E C;  5DNF A;  1L1O C;  2OWO A;  1HCZ A;  2EXZ A;  1DON A;  3C1F A;  2NVQ B;  4EQ5 A;  3GTG H;  5CV5 A;  2WAC A;  2F0V A;  5IYD G;  3HKS A;  3HOU B;  5IGB A;  3CF5 A;  3CC2 A;  5LMN W;  1VMP A;  3DEP A;  3ULP A;  4ZQ3 A;  2E2H B;  1B7Y B;  4GS3 A;  1SE8 A;  4ZRZ A;  4P72 A;  4HAE A;  1AP0 A;  3QO2 A;  2HIX A;  3R2T A;  5JJI A;  1YNN C;  1L0X B;  2NN6 G;  4H7B A;  1SRO A;  2K5D A;  4TVA B;  2F0J A;  4QCL A;  4LF4 L;  1SAP A;  3LGJ A;  2HQE A;  4A3K B;  1HNZ L;  4Y7N H;  2IT1 A;  4PQX A;  1BXT A;  1Q1B A;  3T4A C;  4BBR B;  1EWH A;  2JA7 H;  3I4M H;  4RGN A;  3J81 c;  1TKW B;  4DR3 Q;  4OO1 H;  2ALY B;  2K4K A;  4BWG B;  4PMC A;  1MJC A;  1WTX A;  1EIY B;  2Z4I A;  3G48 A;  4A93 G;  5I9P A;  1X3E A;  4G4K A;  2B8G A;  2Y0S E;  2F4I A;  1IW7 D;  2CCZ A;  1JT8 A;  2LXJ A;  2GA4 B;  3C2P A;  3BYT B;  1EWI A;  5KYL A;  4RCN A;  3GTL B;  4A3D B;  3NXW A;  3I72 A;  3AFQ A;  3TP6 A;  2X6L A;  4PZ6 A;  1X9N A;  1WYD A;  4JBM A;  1JB3 A;  3UDX A;  1CUK A;  5IYB G;  1LTA D;  1QJO A;  5LMN L;  1NR4 A;  1U4M A;  4PMB A;  1SE4 A;  3TRZ A;  2AMC B;  1G6Z A;  5FJ8 G;  1C0A A;  4A3B H;  3OYY A;  1D8L A;  2R7Z G;  4K5X A;  1KLG D;  1LT6 D;  3NTH A;  5EBD A;  2IX3 A;  1B44 D;  4K5V A;  5C44 H;  4JYA Q;  3ERS X;  3PO3 G;  4X64 Q;  2GN5 A;  2IJ0 A;  2KED A;  1HFN A;  1II3 A;  5IIF A;  1ENF A;  1I6H H;  1U4L A;  1K3R A;  2JA6 B;  4A3M G;  2K5V A;  5JVH 3;  1Y1W H;  2NVY B;  2F0S A;  3OTO L;  2VQF Q;  1ONL A;  3J80 E;  1J8I A;  2OXP A;  1VQO A;  3S15 B;  1ZYR C;  4L6T B;  3HOZ H;  4C2M B;  4IUU A;  1LT3 D;  3EA6 A;  4KHZ A;  2HCC A;  4XQQ A;  1U4P A;  4JI5 L;  1BVS A;  4LFB L;  4K0K Q;  4EQN A;  2KEN A;  2NYZ D;  3A74 A;  4NMZ A;  3CC7 A;  1XYI A;  4LF7 L;  1V1O A;  1PYW D;  2KCM A;  2N55 A;  3HGB A;  1PFN A;  5ELN A;  1KAA A;  1NCV A;  2B2V C;  2XRS D;  4IN3 A;  2O5I C;  3NK9 A;  4FF4 A;  2Y0S B;  3OOC A;  1SYC A;  4CDF C;  2Z1C A;  3DUZ A;  4GNX A;  1DXM A;  4DAP A;  3NEN A;  3TS0 A;  3D3R A;  3W1B A;  1WD0 A;  3BVM A;  2PCF B;  3E0J A;  4QIW E;  2R92 G;  4F87 A;  1EU3 A;  4FF3 A;  1M90 C;  4IPD A;  2M00 A;  2WV6 D;  3E3X A;  5GQO A;  3S1R H;  4DR7 L;  1ZEQ X;  1HR0 Q;  2OCE A;  1I4H A;  3VYU A;  4AQY Q;  1PH4 A;  1A2T A;  2EDG A;  5G3L D;  3TZD A;  4PNY A;  3UDF A;  1B1Z A;  1OXU A;  4ZLT F;  2KUM A;  4K14 A;  1TT2 A;  1IBL L;  1N36 L;  1PZJ D;  3GTO H;  1JOQ A;  5JAV A;  1FYC A;  3I73 A;  4A3E B;  4X3K A;  3K59 A;  2LSS A;  3KOJ A;  5IE8 A;  3FRP B;  4JPB W;  2E2I B;  2WB1 E;  5DM7 3;  3M4Q A;  2Q2T A;  1QVF A;  2H1E A;  1CK1 A;  3M4O H;  2R93 B;  2LMC B;  3CQZ B;  3CCM A;  1G6P A;  1I3Q B;  2BDN A;  3CAM A;  4EQP A;  3S16 B;  1X56 A;  2X6G A;  1SMX A;  2EOT A;  2JXM B;  1T5E A;  2PYK A;  1O7L A;  5M9O A;  1JCK B;  2E74 C;  1WD1 A;  5DEH A;  1N34 Q;  3KLW A;  3M3Y H;  5HUR A;  1N32 Q;  1NNX A;  1KDC A;  2RDG A;  1WTP A;  2I0Q A;  1LM0 A;  1OXT A;  4FDB A;  2NVT H;  3EIV A;  4IUQ A;  1VQ4 A;  1B50 A;  2PQA B;  3BG3 A;  4G7Z C;  4K6L A;  4C3H G;  3VR5 A;  1UUP A;  5EKK A;  1TWH H;  2E75 C;  1A3T A;  1Y1V G;  1N33 L;  1KRS A;  1OTC A;  4DUZ Q;  3G4S A;  1BO0 A;  1WTQ A;  3I8Z A;  4HR7 B;  2F0H A;  1R9T B;  4FYD A;  4DV6 L;  5CV7 A;  5K36 H;  4BA1 I;  2JEA I;  2FFK B;  3S2D H;  4ABN A;  3VYR A;  3J7A F;  4ZCK A;  2NVX H;  4DK0 A;  1O7Y A;  1U5K A;  1L2F A;  3CRL C;  2DY7 A;  3ZJY C;  2MJ8 A;  4MTK A;  4X66 Q;  2OTL A;  4DR5 Q;  4OWW B;  4K2L A;  1BBU A;  1RF2 D;  2EY2 A;  5DM6 3;  2F03 A;  3TQY A;  1STG A;  1VQ8 A;  4DR4 Q;  4JI3 Q;  5LMU Q;  3L0O A;  2Z8L A;  2WB1 B;  4LFA L;  1RCV D;  3G6E A;  1VQ6 A;  1I4R A;  2F0P A;  3A8I E;  1OXS C;  1E24 A;  5KYI A;  1E0B A;  2F3W A;  5C3E G;  2JSO A;  4DV3 Q;  4FXD A;  4IPC A;  4XYO A;  2B39 A;  3KF6 A;  1IKM A;  4NXN L;  3TP7 A;  3D4W A;  4P74 A;  1VQC A;  2K5Q A;  1XX8 A;  2NTT A;  2A73 B;  4RCO A;  5LHY 1;  2FHT A;  3V05 A;  1KXL A;  1FD7 D;  3P7J A;  4QMG A;  5M5W B;  2F0D A;  1KNA A;  4KKS A;  2E2J H;  3HOV G;  4ALP A;  1O78 A;  2ID0 A;  3PUX A;  1I4G A;  2PZT A;  4Y52 H;  2QDL A;  4RHR A;  2MGS A;  4X6A H;  5BN3 A;  4POG A;  2UXB Q;  4ME5 A;  1PTO B;  1UE6 A;  4DV5 Q;  1GOZ A;  2BE5 C;  2FMC A;  5TSS A;  5BN4 A;  2L4N A;  2D2C C;  3KLS A;  4AH6 A;  1PXU A;  3KDF A;  1A63 A;  3DWQ A;  3NHH A;  2HHH Q;  1GUS A;  2JEB I;  1EY5 A;  4GNX B;  3MEF A;  2K5H A;  5IWA L;  3BZD B;  5CV6 A;  3A5U A;  4RKL A;  3FKI G;  4FXK C;  1FGB D;  2R3Z A;  4NXM Q;  2EJM A;  2RSN A;  2DGY A;  2NTS A;  4M1U B;  3KFU A;  1GHK A;  1GHJ A;  1SYE A;  3RN2 A;  1LAB A;  4A3J H;  1XJV A;  5CV9 A;  4DAY A;  4A93 B;  4LF5 L;  2B2W C;  2QIL A;  1WVL A;  1K83 H;  1S5F D;  4IOC A;  2G9H D;  4H13 C;  4S3S A;  2G5D A;  4GKJ Q;  1HXY D;  5LL6 X;  4A3I H;  4C3I H;  4A4I A;  2F52 A;  2WKD A;  3D6C A;  3ULL A;  3GTJ B;  2F0U A;  4IO9 A;  1RD9 D;  1SNC A;  2DUD A;  1I4Q A;  3ZYY X;  5C4X H;  2KBN A;  1BBW A;  3MXG A;  2HDL A;  1HUM A;  4A3G G;  4JVZ A;  3K5M A;  1WCM H;  3GTP B;  4DV1 L;  3RZD B;  4A3L G;  4OWT B;  1O7Z A;  3ERO A;  4XQN A;  4N9P A;  1XNQ L;  4LJZ C;  1SJH D;  2CHB D;  4F8M A;  1PTO D;  3PSI A;  1KLU D;  4DR1 Q;  4GKK Q;  2B63 H;  2LKV A;  3HKZ G;  2F0M A;  4FP5 D;  1J5E Q;  1YI2 A;  3G7L A;  1HNX L;  1RJT A;  1S3O A;  1S40 A;  2B8F A;  5CYU A;  5I4D A;  2JYO A;  1BOS A;  4A3M B;  1TS2 A;  4B3R Q;  3NE5 B;  3QJY A;  1XNR L;  4I65 A;  4RGO S;  3HOX B;  3P20 A;  2QDB A;  1JOR A;  2K50 A;  4TKO B;  2SNM A;  4TSS A;  1SYF A;  4B3T L;  4CJ0 B;  2N49 A;  1EQT A;  4BS9 A;  1D5M C;  4J8Q A;  3OMG A;  4YIJ A;  1K8O A;  2B2Y C;  1CHQ D;  3I4N G;  1ICW A;  1CQF A;  1DOM A;  1T5X D;  3CCJ A;  2UXC Q;  2Z6B A;  2BE5 D;  1CFM A;  3T1Y L;  1HZA A;  2C9O A;  3L2P A;  1PVO A;  4G7O C;  4LFC L;  5C4J B;  3VDY A;  2DN8 A;  1PH5 A;  5BR8 Q;  2YU9 H;  1HTL D;  3RZO B;  4KJO A;  2R92 B;  1HUN A;  3UE1 A;  2NUC A;  2IL8 A;  3F2C A;  3NTI A;  1A8V A;  3R3O A;  2BDO A;  1JQY D;  1A2U A;  1L1O A;  4FF2 A;  1SRU A;  3A55 A;  3M9B A;  4DV0 L;  2Z0S A;  2UUB L;  4J1M A;  3PIP 3;  2PPB C;  1UNS A;  1IBM Q;  2EYJ A;  4K6D A;  3PV0 A;  4DV2 L;  3J7Z C;  4BY1 H;  2JA7 G;  1Q90 A;  3L9A X;  3I4M G;  4OO1 G;  1Y8N B;  4C56 C;  3AB9 A;  3HZX A;  1HRJ A;  2O2L D;  1RHP A;  2YV5 A;  3IAY A;  3CMA A;  1HNW Q;  2KJX A;  2L1B A;  4FNF A;  4TRD A;  3KJO A;  4BA2 I;  2N78 A;  5FO9 B;  2JA8 H;  2PZW A;  1WTH A;  4AYB G;  3VYT A;  2K03 A;  1S5C D;  1QE6 A;  1SBB B;  3OSO A;  1YIT A;  2DJG C;  3W5O A;  3J7Y W;  1SJE D;  5T1I A;  1VQ5 A;  1GUT A;  4CKB A;  3SK6 A;  4YY3 L;  4LF8 Q;  1RTO A;  2E2H H;  1PRT C;  4GLA C;  4RGT A;  2VQE Q;  4A3B G;  4X62 L;  3U50 C;  5IY0 A;  1EY7 A;  1SDF A;  1MSG A;  1OXV A;  1QCB D;  2EIF A;  1LV9 A;  1U0L A;  4PZ8 A;  2XTI A;  5J39 A;  3X3N A;  3S1Q B;  1Y1V B;  2NZ1 D;  1BBX C;  4X3S A;  4HSV A;  3VA5 A;  2A6H C;  4DAY B;  5LL6 S;  2QEJ C;  4DR2 Q;  3T13 A;  1EFW A;  4OO1 I;  4A3K H;  4HCS A;  4ZKC B;  2RQX A;  2VS1 A;  2IPK D;  2XGT A;  4BBR H;  2CW0 D;  3OW2 A;  4GN5 A;  1BDO A;  3S14 H;  1GD7 A;  4LWC A;  1QUQ A;  1C8C A;  3M85 A;  3D8G A;  1Y1W G;  1XTD A;  1A62 A;  3K0X A;  3CRK C;  4B3M L;  3HOZ G;  3VYS A;  4LUV A;  2Q8T A;  5M5Y H;  3AMU A;  3QOJ A;  1Y8O B;  3J80 L;  4A3D H;  4JI8 L;  2O5J C;  2A5H A;  4G7H C;  3MC0 B;  4BBS H;  1I94 Q;  5IP7 H;  2B2T C;  3F8T A;  1IL2 A;  1Y8P B;  5EBC A;  2XSC A;  5HGQ A;  2EYL A;  1MBY A;  5C3E B;  4A3F H;  1CHP D;  1VQH A;  2MNA A;  4LK1 C;  1VMC A;  2PW5 A;  2KOL A;  4YCU A;  1EIF A;  5EAY A;  3MAQ A;  3K57 A;  2UU9 Q;  2D0O A;  2AKW B;  3JC6 6;  2A69 C;  1TWC B;  3DM1 A;  3M7N A;  1EIG A;  1FGU A;  5KRU A;  5J3B A;  1SE3 A;  1WI5 A;  4ODG A;  3NWS A;  1PH6 A;  1VQ7 A;  1PH3 A;  3EN2 A;  3FPU B;  3H0G B;  2UUC Q;  4KN7 C;  1X3P A;  3CPF A;  4K5W A;  1LLR D;  2CWP A;  3FEW X;  2MFI A;  1VQK A;  1K9M C;  2K52 A;  4R9W A;  1CZW A;  2PI2 A;  4HJ5 A;  1RKN A;  2LS0 1;  1X6O A;  3H09 A;  1FNV A;  4BY7 H;  4FXG C;  2HCI A;  4BXX G;  4JBW A;  1KDB A;  3MTS A;  5IP9 H;  5JJK A;  2J4X A;  2MPM A;  3VR2 A;  4P71 A;  4KTA A;  5KNB A;  1WTO A;  2F0E A;  4QJF A;  4DUY L;  4GOP C;  3RNU A;  1L1O B;  1VQG A;  1G2S A;  4UDU C;  2PQA A;  4DA2 A;  2N88 A;  2A6H D;  2RSO A;  2Z4H A;  2WKC A;  3AYH B;  1EU4 A;  1BNZ A;  1JC7 A;  4R8N A;  1PYS B;  2JK8 A;  1F9R A;  2CFM A;  1NY4 A;  2C5C A;  3STB D;  1K73 C;  3L3O C;  4R4O A;  1AZQ A;  3DXJ C;  5ELE A;  4QB4 A;  4KJN A;  1H9J A;  1PRT F;  1LUZ A;  3SXH A;  3IFT A;  4YWL A;  5FLX E;  5M3F B;  5CBA E;  3MHB A;  3J80 c;  2ASB A;  1B9M A;  2QEX A;  1B8A A;  3R93 A;  3F2D A;  4A3G B;  1QG7 A;  2F3I A;  2RA4 A;  1H9S A;  2K6A A;  5K36 G;  4KD4 A;  1EL0 A;  1VS0 A;  1D1K A;  5EKI A;  4LF4 Q;  4LF9 L;  5JOB A;  1HTP A;  5CMD A;  5AJ3 L;  2E2I H;  1HZC A;  1NBW A;  4RWS C;  1LO5 D;  1LTL A;  3K5N A;  2R93 H;  1YVC A;  2QKI C;  2HIV A;  3MWY W;  4EVO A;  1K28 A;  4WJ4 A;  1BKB A;  3S16 H;  1KNE A;  1YBY A;  4N9T A;  2QCP X;  4CKC A;  4KK7 A;  4YHH L;  2A69 D;  2UXD L;  1SNP A;  4L63 B;  1VQP A;  1S5E D;  3OIQ A;  1NSN S;  3AFP A;  2PI2 E;  5EPJ A;  3J81 j;  2K7V A;  2A6E D;  5LMN Q;  5H1S E;  1AZP A;  2ZXR A;  4HSP A;  1H9R A;  2A19 A;  4IZ8 A;  3E0E A;  4O0A A;  2KQ3 A;  4U67 3;  2K5W A;  4B9X A;  3FP9 A;  1IBK L;  1IL8 A;  1QUQ B;  4HIK A;  2RDH A;  1M8A A;  5JEA H;  3GTG B;  5M3M H;  1LYL A;  4DV4 L;  3TSS A;  2Q8I B;  2WII B;  1E1O A;  4WRD A;  1HFG A;  2K01 A;  3DWP A;  1R9T H;  2SOB A;  2I5H A;  3IL8 A;  2TMP A;  5J22 A;  1YNN D;  1X3F A;  1R4P B;  1JJG A;  1ML0 D;  3U9S A;  3G6J B;  3I90 A;  1EOV A;  4QUC A;  2E5L L;  3CCR A;  3HOW H;  3I70 A;  1XMO L;  1RDP D;  3T53 B;  3A54 A;  3CC4 A;  1P16 A;  1KC8 C;  3PO2 B;  3FVQ A;  3OTO Q;  1UWV A;  3NQI A;  5AFW A;  2EJG C;  3ITP A;  2E8G A;  4Y7N B;  2EE1 A;  1X32 A;  1YHA A;  1YNJ C;  3GQB A;  2CKZ B;  4LUO A;  1N8R C;  1R4Q B;  2EPB A;  1AE3 A;  4JG2 A;  4JI5 Q;  3I4M B;  1F77 A;  4LFB Q;  3SHL A;  4A3J G;  4LF7 Q;  3A5Z B;  1WTW A;  4G57 A;  1X65 A;  3RMH A;  4J6H A;  2K75 A;  5KNC A;  2CQO A;  1Q81 C;  4DGZ A;  1PLF A;  3AU7 A;  2OTJ A;  1L0W A;  3RD4 A;  1AFP A;  1RL2 A;  1EY9 A;  4OIJ A;  2I07 B;  4C3I G;  5ELF A;  4A3I G;  1B53 A;  3HP3 A;  5EGT A;  1CZG A;  2OF1 A;  4UPA A;  2MUY A;  4DK6 C;  1F2Z A;  1HH2 P;  2VUM B;  3CCE A;  2HUG A;  3ER0 A;  4JI0 L;  4IJL A;  4JI7 L;  4DR7 Q;  3SDZ A;  1PH7 A;  2B2W A;  4PV1 C;  2M9V A;  1WCM G;  2MO0 A;  1SFO B;  2AQ1 B;  5JPM C;  1LTG D;  1YEZ A;  1GO3 E;  3TME A;  1IBL Q;  1ASZ A;  3H94 A;  3C3L A;  2E76 C;  2B63 G;  4FF1 A;  3BYY B;  3NBH A;  1XTC D;  2ICI A;  3AQQ A;  2D9U A;  4V19 0;  1SYB A;  3GTK H;  1ET6 A;  2OQ0 A;  2UUA L;  2AHO B;  5IGF A;  3MA2 B;  2JP1 A;  3MZ5 A;  5C4Z A;  2KEC A;  1ZYR D;  4QL5 A;  1SEB D;  4R4C A;  3IKJ A;  4EQO A;  3S9W A;  4JOI C;  5JVG 3;  2Q2U A;  2L15 A;  1UE7 A;  2NBF A;  1G51 A;  1YHQ A;  2K14 A;  1C7Y A;  3H91 A;  2JA9 A;  1JWM D;  3U4V A;  4KI0 A;  5BN5 A;  3S2H H;  4JI3 L;  1LTI D;  4MNO A;  3RLF A;  1H9S B;  1PDQ A;  4HJ9 A;  1MSH A;  3K5O A;  4P73 A;  1STH A;  1VQF A;  3NSW A;  3GTJ H;  4C1N I;  4DR6 L;  2XVS A;  4QUF A;  1F9S A;  3PQI A;  2SNS A;  3GD7 A;  1SYG A;  1QZH A;  2JA5 G;  1FJG L;  1PMR A;  2Q2I A;  2I5L X;  2MHV A;  1CM9 A;  1EYA A;  1N33 Q;  3BDC A;  3GTP H;  1IXR A;  3RZD H;  3SEB A;  3K5L A;  2VNU D;  1YNJ D;  1EY0 A;  1KDA A;  2K04 A;  3KBX A;  3VA7 A;  1MD2 D;  3C1E A;  2F1M A;  2L0C A;  4DV6 Q;  1EOT A;  2A68 C;  1I6V C;  2M2L A;  5COR A;  3NTK A;  3KYH C;  3S1R B;  4DK1 A;  4DN4 M;  1UEB A;  4YWM A;  1U4R A;  2UXB L;  1STE A;  1K8A C;  1PV4 A;  1FNU A;  1YZ6 A;  1F2Y A;  5FO7 B;  4CDC C;  2XIW A;  2PO4 A;  4R4I A;  1PH8 A;  2EZV A;  3GTO B;  3HOX H;  4BY1 G;  4JI4 L;  1DM0 B;  3QB3 A;  3PIP A;  1I4P A;  3H3V H;  2KCC A;  3EJI A;  1K0R A;  3TZU A;  1S5D D;  3M4O B;  2RVL A;  4LFA Q;  2EVB A;  3MEH A;  3FDT A;  2H4O A;  2JA8 G;  3KUP A;  3TDQ A;  1JWU D;  3KJP A;  3PF5 A;  1PFS A;  1QOH A;  1ZXT A;  4JI6 L;  3ULJ A;  1E1T A;  4X65 L;  5D65 A;  2F0G A;  3HOY H;  4NXN Q;  4MN3 A;  5C4J H;  4Q5V A;  4H0L C;  3CPW A;  5CV4 A;  3M3Y B;  1KHI A;  3RLO A;  4OX9 L;  2R6G A;  3I91 A;  3CD6 A;  2KVM A;  5IGC A;  4ZAI A;  3EQL C;  4JI1 Q;  1SND A;  2EYO A;  2NVT B;  2IW3 A;  2WIN B;  4YWK A;  4FVM A;  4IUR A;  4O2D A;  3PUY A;  2YTX A;  1NMG A;  3NPP A;  2NB0 A;  1E3P A;  1IZ6 A;  1WFQ A;  5C3X A;  4UP9 A;  1T9H A;  1V43 A;  5E4X A;  1F9Q A;  2AQ3 B;  4A3K G;  1LTT D;  1F2L A;  1MI2 A;  4RH6 A;  2F0F A;  3F2U A;  1B3Q A;  4BBR G;  3S2D B;  1A6X A;  2OQK A;  5IWA Q;  4XTC S;  1KRT A;  5D14 A;  3BU2 A;  2HQL A;  4ILW A;  3BVZ A;  1AE2 A;  3WWV A;  2FMM A;  1K8M A;  2R7Z B;  1EEF D;  2KEE A;  5EQ0 A;  5HY6 A;  3IFD A;  4MHE A;  2RHQ B;  1X55 A;  4HED A;  1Z7T A;  4XIG S;  2F4V L;  2CQA A;  3PO3 B;  4A3D G;  4JV5 L;  1WOC A;  4LF5 Q;  1KAB A;  3PUV A;  4K8J A;  4DV7 L;  4BBS G;  5IP7 G;  1QIL A;  3DWA A;  1YIJ A;  1KIX A;  2SEB D;  2RKS A;  2RF4 A;  1EYC A;  1EZ8 A;  3PIO A;  5KIX A;  4DF7 A;  4R8I A;  1HA6 A;  1JJ2 A;  1BF4 A;  1TWF B;  3NBH B;  1ROD A;  4A3F G;  1EY8 A;  4IJH A;  1HZB A;  1S72 A;  3MXN B;  1B4O A;  1I50 B;  2VXW A;  1HQM C;  3TRE A;  1FNW A;  1DZ1 A;  4OGQ C;  2DY8 A;  3E5S A;  3C46 A;  4RG1 A;  4B9W A;  4DV1 Q;  4KLK A;  2B2T A;  5E3F A;  4TQU S;  1XNQ Q;  4GZY C;  1IYV A;  4JK1 C;  2B2U C;  3UDI A;  1VQL A;  4DNT B;  3PF4 A;  1EIH A;  3GP7 A;  3U58 A;  2BH2 A;  2F0O A;  4OON A;  2ZXP A;  1VQB A;  3URY A;  5JJL A;  1ILP A;  1HNX Q;  4B3S L;  5IGG A;  2EY5 A;  1Q8K A;  5IGD A;  4CGY B;  2N3S A;  1WJJ A;  1CQV A;  1XNR Q;  2EYM A;  2HDM A;  2AQ2 B;  3S1N B;  1CA6 A;  1CKO A;  5A2Q E;  3PUW A;  1M1K C;  1SE2 A;  4BY7 G;  5C6A A;  2K33 A;  2ZJR A;  4B3T Q;  4QQB X;  4L5S A;  5IP9 G;  1BCP C;  1H9M A;  1SMY C;  1ASY A;  1SN8 A;  2IX1 A;  5C4H A;  5I2Y A;  1SLJ A;  4A3J B;  1TS3 A;  4EX5 A;  4HMJ A;  4DNR B;  1YHB A;  1CKN A;  2Y0S G;  4JBJ A;  5KND A;  1ESR A;  1K83 B;  2QGQ A;  4L8J A;  4CHT B;  1CA5 A;  4F7X A;  4LFC Q;  1TY2 A;  4A3C H;  1EWC A;  2XWJ B;  1ZKO A;  2ES2 A;  4KKT A;  2K05 A;  2ZXO A;  4OIK A;  1TXY A;  4QY7 A;  4I7Z C;  3Q22 A;  4DKA C;  1MHW C;  4A3I B;  4IQZ A;  4KHP L;  1TWC H;  3TBI B;  3GTQ B;  4C3J H;  1V1Q A;  1HA5 A;  1JR0 D;  2PQE A;  1JOO A;  1TWG B;  2KHJ A;  4GOP A;  3SE0 A;  1BUV T;  3JAM i;  2NVQ H;  5FLX L;  2IHE A;  1G8Z D;  4LUZ A;  5E7N A;  3H0G H;  1GVP A;  3HOU H;  4DV0 Q;  3H6M A;  3RR5 A;  2UUB Q;  2XN9 C;  4IOA A;  2MQH A;  4P75 A;  4DV2 Q;  1NR2 A;  3T1H L;  3JAM E;  4JI2 L;  2ICE C;  4C3H B;  2A74 C;  5GAG C;  2R93 G;  3S17 B;  1EQR A;  3CCL A;  5NUC A;  1QB5 D;  1JWS D;  5C44 G;  1EY6 A;  5M5X B;  2PW7 A;  4HJ7 A;  4CDE C;  5C3W A;  3PMF A;  1Q86 C;  3PCO B;  2H5X A;  2ZTC A;  2ZM6 L;  3SK4 A;  4PZ7 A;  1TVX A;  2R7D A;  2SDF A;  4CDD C;  5EPL A;  3LNN A;  4RKB A;  4F88 A;  3I3C A;  4YY3 Q;  3UI2 A;  1P8L A;  2PNR C;  2Q8R E;  3M7G A;  3J7A V;  3D4D A;  4WJ3 M;  3KK7 A;  5F2D A;  3K6O A;  1PRT B;  3KLR A;  4QGU A;  4X62 Q;  3GTL H;  4RMF A;  1W3S A;  5M3F H;  3PIO 3;  5JEA G;  2JA5 B;  1IW7 C;  1K3B C;  5M3M G;  3S1M B;  5EJW A;  3BDO A;  3K0Y A;  4M8A A;  3EBE A;  1XMQ L;  1ENA A;  2UU9 L;  4ZUI A;  1L0Y B;  3HFZ B;  1E7Z A;  3LX0 A;  4LF6 L;  1EYD A;  2Z9H A;  1HHV A;  2V4D A;  2AUJ D;  1Q46 A;  5IT9 c;  1JE4 A;  4OWX B;  3HOW G;  1VQD A;  3CCQ A;  4HN7 A;  2D0P A;  1E2V A;  1SSO A;  2QW7 A;  3L7Z C;  2RCN A;  3K7U C;  2EYF A;  3A7A B;  1B70 B;  1HQR D;  5A35 A;  2A1A A;  2BH8 A;  3A8K E;  3HKZ E;  3ND9 A;  3HOV B;  1FVI A;  4B3M Q;  1PFB A;  2B2V A;  2CWA A;  2D62 A;  4LMQ D;  1O80 A;  5D3I B; 
#chains in the Genus database with same CATH homology
 4JI8 Q;  3CCS A;  2JA6 H;  1EOV A;  2JA5 H;  2E5L L;  3CCR A;  3HOW H;  4P74 A;  1VQC A;  1XMO L;  2WB1 G;  3S1M H;  2FXQ A;  2ZJP A;  1HNW L;  1KXL A;  3CC4 A;  3JAM c;  5FLX c;  1P16 A;  3SGI A;  1KC8 C;  1PH1 A;  2NVY H;  2E2J H;  4L5Q A;  5DLQ E;  4LNQ A;  3HOV G;  3OTO Q;  3CCV A;  1EYG A;  1UWV A;  4AIM A;  1VCI A;  4GKK Q;  3S15 H;  1O7I A;  2E8G A;  3TS2 A;  5C3E H;  3I56 A;  1VQJ A;  2ID0 A;  1YHA A;  3PUX A;  4C2M H;  5C0X I;  2VW9 A;  4ALP A;  3T1Y Q;  3F1Z A;  3KF8 B;  4Y52 H;  2CKZ B;  5FLM H;  4HID A;  4LUO A;  4HJ8 A;  4X6A H;  1N8R C;  2JJQ A;  4DR3 L;  1QVC A;  1AE3 A;  4JG2 A;  4POG A;  2UXB Q;  4JI5 Q;  2NZO A;  1GM5 A;  1UE6 A;  1CSP A;  2BA1 A;  4DV5 Q;  4LFB Q;  4A3J G;  4YCV A;  1K8G A;  4B3S Q;  4LF7 Q;  3A5Z B;  4LF8 L;  3PO2 G;  3CME A;  2Z6K C;  4R1J A;  4AH6 A;  3KDF A;  3DLL A;  2A8V A;  1A63 A;  1X65 A;  2VQE L;  2HHH Q;  2Z6K A;  1UE5 A;  2K75 A;  3KF6 B;  1PH9 A;  4LW1 A;  2JEB I;  4DNI A;  3HOV H;  4GNX B;  3MEF A;  2CQO A;  2R7F A;  1Q81 C;  2K5H A;  5IWA L;  3A5U A;  1G29 1;  3FKI G;  1JB7 A;  2OTJ A;  2VY3 A;  1L0W A;  3H15 A;  3UDG A;  3TEH B;  4NXM Q;  1RL2 A;  3K7A H;  1VQ9 A;  4A3I G;  2DGY A;  3FHW A;  4UY8 C;  2RHS B;  1OXX K;  1Q7Y C;  3KFU A;  3RN2 A;  4UPA A;  4A3J H;  3PO2 H;  4DK6 C;  4DR2 L;  1HH2 P;  2I5M X;  1CKN B;  4A3E G;  1XJV A;  1A0I A;  3CCE A;  1DGS A;  4LF5 L;  2B29 A;  3ER0 A;  3W1G A;  4JI0 L;  1K83 H;  4IJL A;  4JI7 L;  3I4O A;  4DR7 Q;  4IOC A;  1KQS A;  2YTY A;  1PH7 A;  3BZC A;  4JCV E;  4PG3 A;  3FKI H;  4GKJ Q;  1YJN A;  4H02 A;  1WCM G;  2MO0 A;  2V1C C;  3ICE A;  4A3I H;  4C3I H;  3UE0 A;  1YEZ A;  3KDF B;  1GO3 E;  4A4I A;  1IBL Q;  2F52 A;  1ASZ A;  2VUM G;  1EUJ A;  4JYA L;  4KHP Q;  3ULL A;  2HT1 A;  3GTM H;  3NEM A;  4A3E H;  1HNZ Q;  4X64 L;  4IO9 A;  4GOP B;  2B63 G;  4DUY Q;  4HIM A;  1PYB A;  3I7F A;  2WFW A;  2DUD A;  3AQQ A;  5IYC G;  5C4X H;  1UE1 A;  2KBN A;  3GTK H;  1BBW A;  2OQ0 A;  2UUA L;  1HR0 W;  2AHO B;  1I94 L;  4A3G G;  3CQZ H;  1WCM H;  1I3Q H;  4DV1 L;  4HJA A;  4A3L G;  4OWT B;  4QL5 A;  1W2B A;  2IY5 B;  2ATW A;  4R4C A;  1XNQ L;  4DAM A;  4AYB E;  4JOI C;  2VUM H;  2VQF L;  2Q2U A;  1Q12 A;  2L15 A;  1UE7 A;  4UP8 A;  3PSI A;  3J81 i;  3PUZ A;  4JOI A;  1G51 A;  3F2B A;  4JC0 A;  4DR1 Q;  2B63 H;  1YHQ A;  2K14 A;  3HKZ G;  1SR3 A;  1Z47 A;  1Q82 C;  1C7Y A;  4IFD G;  3T1H Q;  2NN6 I;  2YTV A;  2JA9 A;  3STB C;  4JI2 Q;  5ELO A;  3U4V A;  5IYC H;  1J5E Q;  4KI0 A;  3S2H H;  1HJP A;  3Q8D A;  1YI2 A;  1SFO H;  5C0X G;  1HNX L;  1S3O A;  4JI3 L;  4MNO A;  3RLF A;  1S40 A;  4K0K L;  4A3G H;  4HJ9 A;  1AH9 A;  4P73 A;  4A3L H;  1VQF A;  4B3R Q;  2N8N A;  3GTJ H;  1XNR L;  4GN4 B;  2QA4 A;  4DR6 L;  1X54 A;  3I55 A;  4LF9 Q;  2ZTE A;  1HZ9 A;  3GD7 A;  3J80 i;  1Q1E A;  2K50 A;  1QZH A;  2JA5 G;  1FJG L;  2Q2I A;  3A0J A;  5AJ3 Q;  1PH2 A;  2I5L X;  2ZM6 Q;  3RLN A;  4B3T L;  2N49 A;  1N33 Q;  4JBK A;  1IXR A;  3GTP H;  2UUC L;  3RZD H;  1CKM A;  3S24 A;  2VNU D;  3K80 C;  3NEL A;  4DPG A;  4IPH A;  1MJE A;  3I4N G;  3HOX G;  4GLX A;  4DV6 Q;  3CCJ A;  1Z9F A;  5GRO A;  2UXC Q;  1XPR A;  1MKH A;  3T1Y L;  3KYH C;  1HZA A;  3L2P A;  1PVO A;  4LFC L;  4A76 A;  3VDY A;  1HR0 L;  1UEB A;  1YNX A;  4YWM A;  2GVB A;  3IRB A;  4YHH Q;  4AQY L;  1PH5 A;  2UXB L;  2UXD Q;  2GVA A;  1K8A C;  5BR8 Q;  1PV4 A;  2YU9 H;  4R4T A;  1YZ6 A;  1XMQ Q;  1VQE A;  4R4I A;  4IFD I;  1PH8 A;  4LF6 Q;  3UE1 A;  1NMF A;  3I4N H;  3HOX H;  3F2C A;  4APV A;  4BY1 G;  4JI4 L;  1TWA H;  3HOY G;  2Q2H A;  2NZH A;  1A8V A;  3PIP A;  1L1O C;  2OWO A;  3H3V H;  1IBK Q;  1L1O A;  3BZK A;  4EQ5 A;  1SRU A;  3M9B A;  3GTG H;  1K0R A;  3K8A A;  3E9H A;  4DV0 L;  2Z0S A;  5IYD G;  2UUB L;  3HKS A;  4LFA Q;  3CF5 A;  4DV4 Q;  2ZJQ A;  3CC2 A;  5LMN W;  3ULP A;  1X3G A;  2JA8 G;  4MTN A;  1NJI C;  1KD1 C;  1IBM Q;  3K81 C;  3PGZ A;  3PV0 A;  1PFS A;  3KJP A;  4DV2 L;  3PF5 A;  1B7Y B;  4GS3 A;  3J7Z C;  3ULJ A;  4JI6 L;  1SE8 A;  1E1T A;  4X65 L;  4R4Q A;  4BY1 H;  1XPU A;  2WAQ G;  3HOY H;  2JA7 G;  4P72 A;  3I4M G;  1N34 L;  4NXN Q;  4NB3 A;  5C4J H;  4OO1 G;  1N32 L;  2E5L Q;  2HIX A;  3CPW A;  1XMO Q;  5JJI A;  2YV5 A;  1Y14 B;  1KHI A;  2NN6 G;  5M5W H;  3CMA A;  1HNW Q;  1SRO A;  1VQA A;  4TVA B;  3RLO A;  4BA2 I;  3KJO A;  2EXD A;  4OX9 L;  5IYD H;  2R6G A;  3H3V I;  3CD6 A;  2N78 A;  1V9P A;  3D31 A;  2JA8 H;  4LF4 L;  3LGJ A;  1HNZ L;  1C9O A;  4AYB G;  4Y7N H;  4JI1 Q;  2IT1 A;  5C4X G;  3G71 A;  1YJW A;  4YWK A;  1QVG A;  3GDE A;  3M4P A;  1Q1B A;  4O2D A;  3PUY A;  1CSQ A;  2YTX A;  1YIT A;  2JA7 H;  3W5O A;  3I4M H;  1NMG A;  4J15 A;  3J81 c;  4DR3 Q;  1VQ5 A;  2ALY B;  2K4K A;  1E3P A;  1IZ6 A;  4DUZ L;  1WFQ A;  1XPO A;  4YY3 L;  4BXX H;  4UP9 A;  1T9H A;  1MJC A;  1V43 A;  4LF8 Q;  1EIY B;  1N36 Q;  3G48 A;  3DM3 A;  4A93 G;  2E2H H;  1X3E A;  4A3K G;  2Y0S E;  2CCZ A;  1NTG A;  1JT8 A;  4GLA C;  2VQE Q;  4ME3 A;  4A3B G;  4X62 L;  2LXJ A;  1EWI A;  3U50 C;  5IY0 A;  4BBR G;  2OQK A;  5IWA Q;  4XTC S;  1KRT A;  3AFQ A;  2HQL A;  3BU2 A;  1OXV A;  1AE2 A;  2EIF A;  4PZ6 A;  3WWV A;  1WYD A;  1X9N A;  4JBM A;  3UDX A;  1CUK A;  1U0L A;  4PZ8 A;  2XTI A;  5IYB G;  5LMN L;  5HY6 A;  4DAY B;  2IX0 A;  3TRZ A;  2AMC B;  2RHQ B;  4DR2 Q;  1X55 A;  4A93 H;  1EFW A;  4X66 L;  4OO1 I;  5FJ8 G;  4A3K H;  4XIG S;  1C0A A;  2F4V L;  1D7Q A;  2VS1 A;  4DR5 L;  4A3D G;  4A3B H;  4JV5 L;  1WOC A;  4LF5 Q;  2XGT A;  4JI0 Q;  3OYY A;  1D8L A;  3PUV A;  4JI7 Q;  4BBR H;  3OW2 A;  2R7Z G;  4GN5 A;  4DV7 L;  4BBS G;  3S14 H;  4DR4 L;  1GD7 A;  5IP7 G;  4LWC A;  5LMU L;  1QUQ A;  1YIJ A;  1KIX A;  3CW2 C;  1E22 A;  1KL9 A;  3M85 A;  2RF4 A;  5IYB H;  1Y1W G;  4L5T A;  2ZTD A;  1XTD A;  3PIO A;  5C44 H;  1A62 A;  1VQM A;  4JYA Q;  3ERS X;  3K0X A;  1JJ2 A;  4DV3 L;  3PO3 G;  3NBH B;  3CCU A;  4X64 Q;  4B3M L;  3HOZ G;  3GO5 A;  5FJ8 H;  4A3F G;  5M5Y H;  2GN5 A;  4LUV A;  4IFD J;  5GAE C;  4IJH A;  1HZB A;  4A3D H;  4JI8 L;  5JEA J;  1I6H H;  1S72 A;  3MXN B;  1JE5 A;  2UUA Q;  1K3R A;  2R7Z H;  5C0X J;  3TRE A;  4BBS H;  1I94 Q;  4NPS A;  5IP7 H;  4A3M G;  4RG1 A;  3F8T A;  2K5V A;  4IPG A;  4DV1 Q;  4KLK A;  1IL2 A;  3CP0 A;  1Y1W H;  4TQU S;  5HGQ A;  1XNQ Q;  3OTO L;  3UDI A;  2VQF Q;  1VQL A;  2IHF A;  3PO3 H;  1I5F A;  1VQO A;  3PF4 A;  3HOZ H;  3U58 A;  4A3F H;  2BH2 A;  1NE3 A;  4OON A;  4KHZ A;  2VL6 A;  1VQH A;  1VQB A;  4JI5 L;  5JJL A;  2MNA A;  3CXC A;  5EAY A;  4YCU A;  1BVS A;  1EIF A;  4DV5 L;  1HNX Q;  4LFB L;  4K0K Q;  1KAW A;  2JQO A;  2KEN A;  3A74 A;  3CC7 A;  2UU9 Q;  2WP8 J;  4B3S L;  1Q8K A;  2D0O A;  4LF7 L;  4A3M H;  2AKW B;  2N3S A;  1WJJ A;  3JC6 6;  2KCM A;  3BJU A;  5ELN A;  3M7N A;  1FGU A;  2HHH L;  5J3B A;  1XNR Q;  1N9W A;  1VQN A;  1TWF H;  2C35 B;  4DR6 Q;  1CKO A;  3D0F A;  4GNX C;  1WI5 A;  3PUW A;  1M1K C;  4BY7 G;  1FJG Q;  4GNX A;  4A3C G;  2ZJR A;  1PH6 A;  1I50 H;  4B3T Q;  1VQ7 A;  4DK3 C;  1PH3 A;  3EN2 A;  3NEN A;  5IP9 G;  3TS0 A;  4L5S A;  4NXM L;  4QQB X;  3W1B A;  1ASY A;  1SN8 A;  2IX1 A;  4QIW E;  2BA0 A;  2UUC Q;  2R92 G;  2KHI A;  3CPF A;  2CWP A;  1SLJ A;  2MFI A;  1VQK A;  1K9M C;  4EX5 A;  1M90 C;  2K52 A;  4IPD A;  1YHB A;  2PI2 A;  5GQO A;  1CKN A;  2Y0S G;  4JBJ A;  1X6O A;  4JI1 L;  4HJ5 A;  3S1R H;  4DR7 L;  2QGQ A;  4BY7 H;  5GAD C;  3RN5 A;  4LFC Q;  1HR0 Q;  4GKJ L;  2OCE A;  3H0G G;  4AQY Q;  1PH4 A;  4BXX G;  3HOU G;  4A3C H;  3B6Y A;  2ES2 A;  4JBW A;  2VZA A;  4QY7 A;  1EQQ A;  1TXY A;  3UDF A;  5IP9 H;  5JJK A;  1YJ9 A;  1OXU A;  4DKA C;  3RZO H;  1RIP A;  1IYJ B;  1IBL L;  4P71 A;  1N36 L;  2R92 H;  4KHP L;  1TWC H;  2KCT A;  3GTO H;  4QJF A;  3S1N H;  4DUY L;  1FL0 A;  4GOP C;  4C3J H;  1V1Q A;  4JI4 Q;  2LSS A;  3KOJ A;  2KHJ A;  3RNU A;  1L1O B;  1JJC B;  1VQG A;  5IE8 A;  5GAH C;  4GOP A;  2WB1 E;  2PQA A;  3JAM i;  3M4Q A;  2Q2T A;  2NVQ H;  1QVF A;  2AWO A;  2IHE A;  5E7N A;  4LUZ A;  3AYH B;  3M4O H;  2JE6 I;  3H0G H;  1GVP A;  3HOU H;  4OXP A;  4DV0 Q;  3CCM A;  3RR5 A;  2UUB Q;  1G6P A;  1VQI A;  1PYS B;  2JK8 A;  4IOA A;  2CFM A;  1NY4 A;  3STB D;  1K73 C;  4R4O A;  2MQH A;  3CAM A;  1JMC A;  1X56 A;  4UP7 A;  4P75 A;  4DV2 Q;  2PNH A;  1SMX A;  4DR1 L;  4GKK L;  4JI6 Q;  2YYZ A;  1LUZ A;  4X65 Q;  4HIO A;  4YWL A;  3T1H L;  2PMZ E;  1J5E L;  4JI2 L;  1N34 Q;  4GLV B;  5GAG C;  3KLW A;  2R93 G;  4L5R C;  3J80 c;  3M3Y H;  1N32 Q;  1EQR A;  2ASB A;  3CCL A;  2B3G A;  2QEX A;  1B8A A;  3F2D A;  3AEV A;  5C44 G;  2F3I A;  4B3R L;  2I0Q A;  1LM0 A;  4OX9 Q;  1OXT A;  4FDB A;  5K36 G;  3J7A 5;  4HJ7 A;  1VS0 A;  4LF4 Q;  3GTQ H;  4LF9 L;  2NVT H;  2WAQ E;  3EIV A;  1VQ4 A;  2PQA B;  1TWG H;  1Q86 C;  5M3F G;  3PCO B;  2H5X A;  5AJ3 L;  2ZTC A;  2E2I H;  1GKH A;  1HZC A;  1NBW A;  2ZM6 L;  1H95 A;  4PZ7 A;  1TWH H;  2R7D A;  4GN3 B;  1Y1V G;  1LTL A;  1N33 L;  1KRS A;  1OTC A;  2R93 H;  1MIU A;  1YVC A;  4DUZ Q;  2HIV A;  3G4S A;  4YY3 Q;  1QZG A;  2AWN A;  1P8L A;  4WJ3 M;  4WJ4 A;  1BKB A;  2MO1 A;  4DV6 L;  1PHJ A;  3S16 H;  4BA1 I;  1YBY A;  4QGU A;  2JEA I;  2UXC L;  4X62 Q;  2LXK A;  3GTL H;  3S2D H;  4RMF A;  3I2Z A;  2NVX H;  1J6Q A;  1W3S A;  2K5N A;  5M3F H;  4C3H H;  4YHH L;  1U5K A;  5JEA G;  1PA6 A;  1VQP A;  2UXD L;  3S17 H;  5M3M G;  2EQS A;  4POF A;  5BR8 L;  3AFP A;  1L2F A;  2PI2 E;  3S1Q H;  1Y1V H;  3EBE A;  1XMQ L;  2UU9 L;  3J81 j;  5LMN Q;  5H1S E;  3HFZ B;  5M5X H;  4A75 A;  1E7Z A;  3ZJY C;  4LF6 L;  4PMW A;  4X66 Q;  2A19 A;  2OTL A;  3E0E A;  4O0A A;  2F4V Q;  4DR5 Q;  4JV5 Q;  4OWW B;  1BBU A;  1Q46 A;  2JA6 G;  3FP9 A;  1IBK L;  5IT9 c;  4OWX B;  3HOW G;  1QUQ B;  3TQY A;  4DV7 Q;  1VQD A;  3CCQ A;  4HIK A;  1VQ8 A;  4DR4 Q;  4JI3 Q;  2D0P A;  5LMU Q;  3L0O A;  5M3M H;  1LYL A;  4LFA L;  4DV4 L;  3E9I A;  3L7Z C;  3G6E A;  1E1O A;  1VQ6 A;  2RCN A;  1R9T H;  3K7U C;  1IBM L;  4MZ9 A;  1B70 B;  1E24 A;  1OXS C;  2I5H A;  2A1A A;  2BH8 A;  3HKZ E;  5C3E G;  4DV3 Q;  1FVI A;  4B3M Q;  1X3F A;  4IPC A;  3U4Z A;  1JJG A;  4YCW A;  3KF6 A;  5FLM G;  2CWA A;  2D62 A;  4NXN L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...