4DR2L

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with multiple copies of paromomycin molecules bound
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
124
structure length
123
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
total genus 14
structure length 123
sequence length 124
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4dr2L00
4YY3Q 3UE1A 4A3LH 3S1RH 3HKZE 2R7ZG 1X6OA 4OO1G 1XPOA 4LF6Q 1VQAA 4L5RC 2MFIA 4UP9A 4MNOA 3KFUA 1OXVA 3M7NA 4DR1L 3CCMA 1YHAA 4A3CG 4JC0A 2YYZA 1T9HA 1UE5A 4LF9L 4LFAQ 4DV3Q 4BBSH 3NELA 4DR3Q 2K75A 3RN2A 4A3DH 4JI1L 1I94Q 4A3LG 1N9WA 1OXXK 1GM5A 1HNWQ 4RG1A 3JAMi 4A3FH 1VQBA 3HOXH 5JJIA 1D7QA 4KHPQ 4LF4Q 4ME3A 2R7DA 1V1QA 3PUVA 1K83H 3Q8DA 4GNXC 1QZGA 2UU9Q 1XNRL 1A0IA 1JE5A 3BZCA 1OTCA 3K7UC 4JBWA 4J15A 3PGZA 4GS3A 1VQIA 4BA1I 4GKJQ 1CKOA 3ERSX 1Q82C 1PH3A 1XNQQ 2IHFA 1E7ZA 4X62L 4YHHQ 4IPDA 4LF9Q 5IE8A 2ZTDA 5M5XH 1L1OB 4JI4L 1YHBA 3OW2A 3I4NH 2V1CC 1N34Q 1YJ9A 2ZTEA 4BY1H 4DK3C 1VQCA 3NENA 4POGA 4IFDJ 4NXMQ 4IO9A 1I50H 1X65A 1XJVA 5AJ3Q 4GN5A 5IYCH 4OWXB 3PSIA 2MNAA 4JI0Q 1IXRA 4QY7A 1HR0W 5IYBG 1UEBA 3A0JA 4UP7A 1NBWA 5GAGC 4BY7H 4C3JH 5LMNL 4DV4Q 1PV4A 3PO2H 1VQFA 1YJNA 4JYAL 1AE2A 1HR0Q 3HOUH 1Q1EA 1J5EQ 1E1TA 2HHHQ 1JJGA 2C35B 4X6AH 1SROA 2PI2A 4DV0Q 1D8LA 1MIUA 4QIWE 3OTOQ 4DUYQ 2Q2TA 2K4KA 3HOYH 4LW1A 4BXXH 4LF8L 1PFSA 2ZM6Q 2OWOA 2LSSA 3KJPA 2F4VL 4DR4L 2PNHA 1QVGA 1YJWA 5AJ3L 4L5SA 2UXCL 2UXDQ 3EN2A 4IPCA 3F8TA 4R4TA 4X64L 2ID0A 1A62A 1WJJA 1X3GA 3I2ZA 4BY7G 2ZJPA 4RMFA 2UU9L 4GOPB 1NMFA 1XNRQ 4OX9L 1A8VA 1M1KC 2B63H 2JA8G 1C0AA 3ULLA 3BJUA 1ASZA 5BR8L 1PH8A 3J81j 2OTLA 2BH2A 1HNWL 3FP9A 1N33Q 4A4IA 3F2CA 3H0GH 3UDFA 3S17H 1HH2P 1JJ2A 3CPWA 2AKWB 3A5UA 4HJ7A 3G4SA 1N32L 2NZOA 2H5XA 2KBNA 1RL2A 3U4ZA 2JQOA 3CPFA 3PF4A 2KCMA 4JI2L 5HGQA 1Q8KA 5GROA 1KRSA 4GLAC 3F1ZA 1EIFA 1L1OC 1EQRA 3JAMc 1CKNA 2DGYA 2JE6I 4Y7NH 3AFPA 1PH9A 1TWHH 1TWCH 2I5MX 4DV3L 1EWIA 1FJGL 4OO1I 3TREA 4BBRG 4NXML 1G6PA 5ELNA 2IY5B 2I5LX 1MJEA 1X3EA 2CKZB 4A3MG 2N78A 1UE1A 3T1YL 3S15H 4A3GH 1VCIA 3I4OA 2OQKA 1VQKA 4HJ9A 1N34L 4JI8Q 4A3MH 1CSQA 4P73A 3S24A 4HJ5A 3F2DA 3RZOH 4JYAQ 4A3CH 3TS0A 5K36G 2VW9A 1JT8A 2JA5H 4PZ6A 4A3KH 1VQDA 1PH7A 4GKJL 4LUVA 3AYHB 2VQEQ 4NPSA 1VQLA 1QUQA 4BBRH 1NY4A 4P75A 1E22A 4LNQA 5FLMH 3HOWG 5IY0A 4UP8A 4A3FG 3RZDH 1C9OA 1VQMA 4DUZQ 2MO0A 4LF5Q 5FLMG 1KQSA 3KDFB 1K0RA 2UUAQ 1KIXA 4LFCQ 3U58A 4LF7L 4OWTB 4A3BH 4XIGS 2PI2E 4A3BG 1SLJA 2OTJA 2VY3A 4TQUS 1E3PA 5EAYA 4JOIC 4OX9Q 1SFOH 1LM0A 1IBMQ 3HOZH 4DNIA 2FXQA 4HIDA 2VL6A 4GKKL 1QUQB 1X3FA 2AHOB 1S3OA 1X56A 3CP0A 1EOVA 4YCUA 3CD6A 4A3DG 1BVSA 2JA9A 4GOPC 3A74A 4LFBL 3PUXA 1ASYA 3PUZA 4EX5A 3KLWA 4JI5Q 2ATWA 2HIVA 2HIXA 4UY8C 5M3FH 2VUMG 3FKIG 3GD7A 4A76A 1I3QH 3GTPH 3D31A 3AFQA 1UWVA 4O0AA 5GAEC 3CC7A 3RN5A 4A3GG 4HJ8A 4IJLA 4DAYB 3K0XA 4QJFA 2CCZA 1KL9A 3HKZG 2E2HH 5C0XJ 2E5LQ 1VQ6A 3H3VI 3ICEA 4IFDI 4IFDG 4DR6L 1Y1WH 5M5YH 4QGUA 5C44H 1KC8C 3S14H 2Z6KA 2HQLA 1XNQL 3CCSA 1VQGA 4LFBQ 4Y52H 1B8AA 2BA0A 2E2IH 1HNXL 1L0WA 5M3FG 2EXDA 2R6GA 3J80i 4HIOA 4WJ4A 4YWMA 5IWAL 2JEAI 3RLFA 1FVIA 5M5WH 5IYCG 4JI2Q 2ALYB 2BH8A 3J81c 3STBD 1KD1C 2WB1G 2R92H 3GTKH 2Q2IA 1SRUA 1QZHA 1G51A 1Z9FA 1P16A 4JG2A 5HY6A 1K3RA 2ZTCA 4LUOA 3CF5A 4JI3Q 3MXNB 3KF6B 4JI1Q 1H95A 2EQSA 4HIKA 1Y1VH 2B3GA 4A3IH 1VQ7A 1I5FA 5JEAG 1XMQL 4JOIA 3FHWA 3J80c 2I5HA 1PH6A 3DM3A 4LFCL 2ASBA 4AYBE 3J7ZC 2YTVA 4IOCA 1PYBA 2WAQG 1A63A 4DUZL 1Q46A 2A1AA 4JCVE 3T1HL 5J3BA 4GNXB 4LF4L 2A8VA 1JJCB 1Q1BA 2RHQB 4APVA 5IWAQ 2VZAA 4MTNA 1GD7A 4QQBX 3KJOA 4PZ8A 4UPAA 2NN6I 3GTGH 5FJ8H 1YIJA 3L7ZC 1G291 1TXYA 1K9MC 2F4VQ 2K52A 2E5LL 4DR2Q 4QL5A 1O7IA 3UDIA 3F2BA 2NVXH 4DR5L 4YCVA 4JI7L 4A3JG 5H1SE 2IX1A 3PO2G 3H0GG 3U50C 2UUCL 1EUJA 1HZBA 4YCWA 4DR7L 4YWLA 2I0QA 4R4OA 2UUAL 5C4XG 1PYSB 2XTIA 4GN3B 3CCLA 2JA7H 2Z6KC 1IBKL 4B3MQ 1EQQA 2UXBQ 2IX0A 3KDFA 3I7FA 2YU9H 2MO1A 4JI5L 3RLOA 4A93H 3UDXA 4LFAL 4HIMA 3SGIA 5C3EG 1YNXA 4P72A 4DPGA 4DV7L 3L2PA 2OCEA 4DV5L 2N3SA 1LYLA 3VDYA 1VQ9A 4KHZA 3ULPA 1Q86C 4JI7Q 3GTJH 4YHHL 4LWCA 2NVQH 4GOPA 1PH4A 1EIYB 1NE3A 3M85A 3HOYG 2ZJQA 3CQZH 1TWAH 1KRTA 3CCJA 4POFA 2QGQA 1VQ4A 3PO3G 3CMEA 4DR3L 2NVTH 2KHJA 1Y14B 3TS2A 3S2DH 4JBJA 3DLLA 3I4MG 5JEAJ 3W1BA 3KOJA 1W3SA 4A93G 1HZAA 1WFQA 5C4JH 2YV5A 4KHPL 5LMUL 4B3RQ 2UXCQ 4X64Q 4C3HH 4OXPA 4A3KG 4JI3L 2CWPA 1Y1VG 2JA5G 4JV5L 4BA2I 2IT1A 4GLVB 2R7FA 2AMCB 4AYBG 3PCOB 1C7YA 3K81C 1HZCA 1PH1A 1CKNB 1WOCA 4PZ7A 3OTOL 1TWGH 2JJQA 2KCTA 1R9TH 1MJCA 2PMZE 1SR3A 4IPGA 4K0KL 2UUCQ 3PO3H 3GO5A 1B70B 2KHIA 1RIPA 1KAWA 1PH2A 2UUBQ 1L2FA 2JA6G 3HOVH 3NEMA 1E24A 3WWVA 2UXDL 1IBKQ 4B3ML 1FL0A 2VUMH 3ER0A 1VQEA 3HOVG 2K5VA 2GN5A 2B29A 2L15A 4YY3L 1S72A 4JI0L 1FJGQ 5C3EH 1QVFA 5IYDH 3UDGA 2K50A 1Q12A 4DR5Q 5M3MH 2Q2UA 4DR7Q 5JJKA 4JBMA 4AQYL 1VQOA 4OWWB 4DR6Q 2Q2HA 3TQYA 2OQ0A 4DV1L 4JBKA 1IBLQ 4R1JA 1VQPA 1YI2A 4P74A 3RNUA 4BBSG 2CWAA 4KLKA 4BY1G 3PUWA 1WCMG 1BBWA 2KENA 3L0OA 3J7A5 5FJ8G 1UE6A 4KI0A 3GTLH 3KF6A 1K73C 2JEBI 5LMUQ 4B3RL 4B3SQ 4DK6C 3M9BA 3CCEA 2HT1A 1Y1WG 5DLQE 1I6HH 3CCUA 3G48A 2VQEL 4GKKQ 2CQOA 1SE8A 1SN8A 4R4IA 1N8RC 2R93H 4IOAA 1I94L 5FLXc 3UE0A 1Q81C 2RCNA 4EQ5A 2F3IA 3EBEA 4O2DA 4DUYL 2Y0SG 2D0PA 4C2MH 2E2JH 4LF7Q 2ZJRA 3ZJYC 4B3SL 3CMAA 1NTGA 2QEXA 4DV7Q 2CFMA 3IRBA 3PV0A 1V43A 2YTXA 2B63G 1HZ9A 3MEFA 1J5EL 3PIPA 4DKAC 4R4QA 1XTDA 4NXNL 1QVCA 1HNZQ 1YHQA 3S2HH 2RHSB 4JI6Q 5C44G 3CCQA 1IBLL 2UUBL 4A3JH 4L5TA 3T1YQ 5GADC 3CW2C 4TVAB 1AH9A 1YEZA 2ES2A 3HKSA 2NN6G 3PF5A 1IL2A 2VQFQ 2VNUD 3G71A 5IYDG 4DV6L 5ELOA 1VQ8A 2MQHA 1Z47A 3S16H 3W1GA 3S1MH 4JV5Q 1GO3E 2PQAB 4A75A 4NXNQ 1M90C 2RF4A 2WB1E 4AIMA 1JB7A 4ALPA 4X66Q 1L1OA 2D62A 3EIVA 3M4QA 5JJLA 1TWFH 4GLXA 3CXCA 4K0KQ 3I4MH 4PMWA 2JA7G 4JI4Q 2IHEA 4HJAA 1PH5A 1KHIA 2NZHA 4X65L 5C0XI 3K80C 1NMGA 1DGSA 5C0XG 4B3TL 1OXTA 2WAQE 3LGJA 4GNXA 1N33L 3H15A 4DR4Q 5IP9G 3GDEA 1OXSC 3E0EA 1FGUA 3S1NH 3GTMH 4MZ9A 4AH6A 3TRZA 4FDBA 2JK8A 1W2BA 1EFWA 3A5ZB 1HR0L 4DV5Q 1UE7A 5M3MG 1P8LA 2D0OA 4IJHA 1GVPA 2VS1A 3ULJA 1E1OA 2XGTA 1VQ5A 4DV2L 5IT9c 1XMQQ 2BA1A 4X66L 2Y0SE 3RLNA 2Z0SA 1HNXQ 3M4PA 2QA4A 2JA6H 1XMOL 1SMXA 5IP7G 1IYJB 4A3EH 2LXJA 1K8AC 4C3IH 4GN4B 1PA6A 3HOXG 5C4XH 1HNZL 4LF5L 3M4OH 5IYBH 1GKHA 1WCMH 4JI8L 4LF8Q 3CC2A 1CSPA 2DUDA 3CAMA 3FKIH 3J81i 1B7YB 1CUKA 2VQFL 2R92G 1VQJA 4P71A 3HOUG 3KYHC 3STBC 4DAMA 1IZ6A 1OXUA 2K14A 4NB3A 4L5QA 4LF6L 1U5KA 1PHJA 2JA8H 1PVOA 3BZKA 4X62Q 1WI5A 3S1QH 4PG3A 4YWKA 3KF8B 2UXBL 2YTYA 4A3EG 2N49A 1XMOQ 5IP7H 5LMNW 1XPUA 3I4NG 4WJ3M 1EYGA 1VQHA 1N36L 2WFWA 3K8AA 3HFZB 2WP8J 3PUYA 3E9IA 1Q7YC 3W5OA 3D0FA 4BXXG 1N32Q 4XTCS 1X55A 1JMCA 1LTLA 1V9PA 1IBML 1KXLA 3K7AH 1LUZA 4DR2L 4A3IG 2AWNA 2AWOA 2NVYH 3TEHB 3JC66 5GQOA 2F52A 2R93G 5BR8Q 3H3VH 1AE3A 3OYYA 2N8NA 3G6EA 1S40A 2GVBA 3AQQA 1VS0A 3RR5A 4DV2Q 4B3TQ 3T1HQ 3M3YH 4DV0L 1X9NA 1N36Q 1K8GA 4X65Q 1YVCA 4OONA 4DV1Q 1NJIC 1BBUA 2E8GA 3E9HA 5IP9H 2ZM6L 2R7ZH 5GAHC 3AEVA 2A19A 3BU2A 1X54A 4DV6Q 3B6YA 1BKBA 2K5NA 3HOZG 4LUZA 1HJPA 1U0LA 3GTQH 4DR1Q 3NBHB 2PQAA 4AQYQ 3U4VA 3I55A 4R4CA 1J6QA 1VQNA 1WYDA 3CCRA 3GTOH 1MKHA 2HHHL 2GVAA 5LMNQ 1YBYA 4DV4L 1YITA 3CC4A 1YZ6A 2K5HA 1CKMA 2LXKA 4IPHA 3PIOA 4JI6L 3HOWH 3CCVA 3I56A 4H02A 2EIFA 5E7NA 1XPRA
chains in the Genus database with same CATH superfamily
1WTHA 2HCIA 1BCPC 4CJ1B 1XPOA 2XWBB 4LF6Q 1BUVT 2FJ2A 3EROA 1UE5A 3D8GA 4DV3Q 2ICIA 3I72A 2K75A 2K1BA 2DY7A 1YNJD 1N9WA 1R4PB 3R93A 3SVMA 4KHPQ 3S17B 3H0GB 2IX3A 4LF4Q 3I8ZA 4TKOB 1OTCA 3I4LA 3PGZA 1VQIA 2L55A 4FF3A 4ZYSA 1CKOA 1Q82C 1XNQQ 5E3FA 5CV9A 2LKVA 4O1NA 5E4WC 5EPLA 1ML0D 1N34Q 1VMCA 4BY1H 3CRKC 1VQCA 4DK3C 4IFDJ 1WTWA 4NXMQ 3BDLA 3RD4A 1XJVA 4GN5A 4NMZA 5IYBG 3EJIA 4RKBA 3A0JA 4UP7A 5GAGC 2PCFB 4DV4Q 1DJRD 1JJGA 2F1MA 1J5EQ 3F2UA 1D2BA 1SYGA 4X6AH 2F0EA 4DV0Q 2N55A 1V1PB 4KN7C 3KJPA 5COYA 2F4VL 4DR4L 1YJWA 3T16A 2UXCL 4IPCA 4PMBA 2L5TA 1WJJA 2B8GA 5KGUA 1A2TA 5JEAH 1XWEA 2ZJPA 1WTPA 1KDBA 3HOUB 1NMFA 4BY7G 1KABA 1M1KC 4OX9L 2JA8G 1PXUA 1O80A 3ULLA 3C3LA 1ASZA 3SE0A 2EXZA 2BH2A 3J7AV 1AEXA 4KD3A 4C1NI 1MI2A 2FMMA 2NZOA 2H5XA 2NN6H 3KBXA 2KUMA 1RL2A 3HOZB 4JI2L 5HGQA 2RKSA 5GROA 1TT2A 1F2YA 1SE3A 4L8JA 1XTCD 3AFPA 1TWHH 4F88A 5J22A 4OO1I 3TREA 3K0YA 3LWEA 5ELNA 2IY5B 4KV6A 2ZXRA 1UE1A 4HSVA 2ICEC 1K28A 1N34L 2D5DA 1CSQA 3RZOH 4HJ5A 3F2DA 4JYAQ 2NVYB 4A3CH 5K36G 2NVXB 4PZ6A 1PH7A 3LWUA 2C9OA 1EQTA 4A3EB 1YNJC 2CH4W 4LNQA 4A3FG 1G2TA 4DUZQ 1L0YB 4HSPA 5KYLA 1K0RA 4LF7L 4FXKC 4XIGS 3NWTA 3BVGA 4XDXA 4UAIA 4A3BG 1E3PA 1LM0A 1IBMQ 2FXQA 2VL6A 4GKKL 1QUQB 3FRPB 4M8AA 3RZDB 3KBGA 4GOPC 3A74A 1LV9A 4ZRZA 4RA8A 1JQYD 3KLWA 5C3XA 2PZUA 2A6ED 3R2TA 2KECA 1LT3D 3N6RA 2F0WA 4DAYB 3K0XA 2E2HH 3MFGA 4IFDI 1STYA 1GHJA 2BE5C 1KAAA 1VF7A 2J7ZA 3K6OA 5CYUA 4Y52H 2BA0A 2E2IH 2EXDA 4HIOA 4WJ4A 4YWMA 2QDBA 1GUNA 4JI2Q 2BH8A 4DNRB 5FO8B 1M4VA 4RGNA 4JG2A 4LUOA 1U4LA 4BS9A 1Y1VH 2B3GA 4HIKA 2F0OA 1I5FA 1H9SB 2NYZD 3KK7A 1LO5D 1PH6A 3S15B 2YTVA 1BCPB 4IOCA 3IFTA 4JCVE 1U4PA 2RHQB 4APVA 4MTNA 1GD7A 2MP1A 1SXTA 2F4VQ 1TXYA 3FPUB 2EZVA 2K52A 1XYIA 3W3AA 1II3A 1O7IA 3SK8A 2NVXH 2A6HC 4DR5L 4JI7L 1RD9D 2B2TA 4CHTB 2L1BA 1HZBA 1DCZA 1K3BC 3K57A 2UUAL 2SEBD 5C4XG 4Q5VA 1B44D 3MXGA 4MN3A 1IBKL 4B3MQ 5DM63 2MO1A 4A93H 5C4XB 4IUNA 4KTAA 3UDXA 1SSOA 4QF4A 4DV5L 2OCEA 3EA6A 1VQ9A 4KHZA 3GTJH 3PIP3 2IWHA 1EIYB 2ZJQA 4H44C 3CQZH 5T1IA 4POFA 2QGQA 1VQ4A 1Y14B 3TZUA 2G9HD 1FYCA 3Q22A 5EQ0A 3S1MB 1W3SA 1HZAA 1QB5D 4KHPL 5LMUL 4B3RQ 2UXCQ 1BXTA 1JB3A 1DD2A 2CWPA 3H09A 2K32A 1EOTA 1HZCA 5C5MA 1CKNB 3J7YW 1GHKA 2K5DA 1CQFA 2CW0C 2KCTA 1ZYRD 1MJCA 2PMZE 1EIHA 2UUCQ 3GO5A 2KOLA 2UUBQ 2JA6G 2UXDL 2VUMH 3ER0A 3DWPA 2GN5A 1FJGQ 3CRLC 1PZJD 1JE4A 4DR7Q 5IGDA 2Q2HA 4JBKA 1H9KA 4R1JA 1VQPA 2EYOA 2CWAA 4BY1G 2X6GA 4X3UA 3PUWA 4U673 2KENA 1NCVA 1V1OA 1NR2A 1UE6A 3GTLH 3KF6A 1GUGA 5LMUQ 4B3RL 3U9SA 2FINB 4HTHA 4JVZA 1Y1WG 5DLQE 2NVTB 1CI3M 2VQEL 3CCUA 3IAYA 1CHQD 2JA7B 1A3TA 1I94L 5FLXc 3QB3A 2F3IA 4O2DA 2D0PA 3HG9A 2F3VA 1HCZA 2B2UC 3C46A 1EYDA 1G2SA 1NTGA 3IRBA 3PV0A 2B63G 5C3WA 1MSHA 4DKAC 4R4QA 1YHQA 2RHSB 5EKLA 3CCQA 2UUBL 1AZQA 1FGBD 4RGOS 2B2VC 3S1QB 1EWCA 3I4MB 1VDZA 2VQFQ 1EL0A 1NAPA 2XSCA 1F9PA 3VR2A 2K5WA 2EYMA 3QG1A 4K5VA 4DV6L 3S1MH 4E6IA 1GO3E 1RDPD 2PQAB 1TWGB 1F2LA 3GTMB 4AIMA 1ZEQX 2O2LD 5T1GA 4GLXA 3DXJC 2XNAC 5HURA 4K0KQ 3GTPB 2EYFA 4JI4Q 2IHEA 4HJAA 1PH5A 2HDLA 1H9MA 1DGSA 4B3TL 1HFGA 1SMYC 1OXTA 2WAQE 3DUZA 4DR4Q 1I6HB 2P5ZX 2MHVA 3J80E 3GTMH 2F0JA 3TRZA 1I6VC 1HR0L 4DV5Q 1S5BD 4OIKA 1UE7A 5D3DA 2D0OA 3ULJA 2VS1A 2LY7A 3D4WA 2BA1A 3A8IE 3RLNA 3M4PA 2LXJA 1PA6A 1XX8A 2A73B 1JR0D 2F0MA 4LF5L 4LF8Q 5JJZA 3CC2A 1CSPA 3CAMA 3JAML 1B3AA 1TIID 2E76C 4K8IA 2IJ0A 3KYHC 4ZUIA 3STBC 4DAMA 3ZYYX 4CJ0B 4ZKCB 4LF6L 2F0TA 3HKZB 1S4ZA 4PG3A 5KEEA 1EY5A 2F0UA 5IP7H 2Z4IA 5FO9B 5DEHA 3I4NG 4WJ3M 1VQHA 4NW2A 2SNSA 3SK5A 2WV6D 1N36L 2WFWA 2F03A 1YNNC 4QMGA 3MXUA 4XTCS 1EZ8A 1JMCA 1PRTD 2EYHA 2B8FA 2AWOA 3S2HB 3H3VH 1AE3A 3OYYA 2I07B 2N8NA 4DK0A 2GVBA 3AQQA 1VS0A 4DV2Q 4BBRB 3M3YH 4C3IB 1YVCA 1IYUA 1BBUA 3E6ZX 3E9HA 1S5DD 4I7AA 2ZM6L 2QF7A 1EY8A 2F0SA 3T13A 2B2WA 3B6YA 2K5NA 1I4RA 1W6KA 4LUZA 2EYPA 4R4CA 2XN9C 4XYQA 4K14A 1YZ6A 2K5HA 4IPHA 3PIOA 3MAQA 4ZAIA 1B2TA 3I56A 4H02A 1TWFB 2EIFA 5C4JB 3UE1A 3BVZA 1D5MC 4OO1G 5AFWA 2L0CA 2MFIA 1SYBA 3MFYA 3MVVA 4UP9A 3KFUA 2O4XA 4DR1L 3HRZC 1YHAA 4JC0A 2YYZA 3OHXC 4TSSA 3NELA 5ELDA 4CKBA 4A3LG 1GM5A 2JSOA 1HNWQ 3J81L 3HOXH 5JJIA 4ME3A 2R7DA 3PUVA 1K83H 1QZGA 5E1FA 2UU9Q 1XNRL 1JE5A 4FO2A 3R2IA 4J15A 4JBWA 4KY6A 3TZDA 4BA1I 1PH3A 3ERSX 4ODGA 1E7ZA 1AN8A 2ZTDA 4R8IA 3URYA 1STBA 4JI4L 1BCPD 3OW2A 4EQNA 2V1CC 4DA2A 4ZLTF 3T56B 3K7AB 5IOCA 4IO9A 1STAA 4KD4A 5JVG3 4YIJA 3PSIA 2QKIC 4DAPA 1UEBA 1TS4A 3I90A 5LMNL 1MD2D 3PO2H 1YJNA 3HOUH 1HR0Q 3FPPA 1E1TA 4UHVA 2C35B 1SROA 1DONA 4DUYQ 4H0LC 3HOYH 4DU9A 1PRTC 3OSOA 3SR1A 2EY5A 1QVGA 1G6ZA 4L5SA 1X32A 4R4TA 1E2VA 2ID0A 3I2ZA 3QJYA 2UU9L 4GOPB 1XNRQ 3H3VC 1SYFA 1JOOA 5BR8L 1PH8A 2B2VA 3J81j 1HNWL 4HN7A 3KF8A 1ET6A 4K8JA 4A4IA 1JJ2A 3CPWA 2CW0D 2WKCA 3BYTB 1UNSA 3S16B 1QNKA 3U4ZA 2JQOA 3CPFA 1KRSA 1Y1VB 1EQRA 3VA7A 2JE6I 2NTTA 2ZT9C 3RZOB 5LL6X 1J9OA 4FF4A 5CBEE 4DV3L 1EWIA 1GUTA 4FP5D 4BBRG 1CM9A 4NXML 4ILWA 1G6PA 3A7LA 3TDQA 3PO2B 1X3EA 1R4QB 3T1YL 4A3GH 1VCIA 2OQKA 1EY4A 4A3MH 3S24A 4P73A 1IHZA 1SNMA 3TS0A 1JT8A 2VW9A 4ME5A 5EBDA 1GUWA 2JA5H 4C3HG 5IGCA 3FVQA 3NWSA 4G7ZC 3AYHB 1EWHA 2F0QA 2VQEQ 4FYDA 1QUQA 3SXHA 5EBCA 2PPBC 1NY4A 4P75A 1CTMA 4N8FA 4EVOA 1WTRA 3RZDH 4RKLA 4LFCQ 4WORA 4J8QA 4K6LA 1B4OA 2EY1A 2NTSA 1PTOB 3GV3A 1RODA 1SFOH 1C48A 3HOZH 4C3JG 3X3NA 3CD6A 1EOVA 1BVSA 3C2PA 4LFBL 3PUZA 4JI5Q 4FF2A 2HIXA 1AP0A 3FKIG 2K5QA 3GD7A 1I3QH 3HEJA 3D31A 3AFQA 4O0AA 4A3GG 4V190 4A3KB 2Z1CA 5C4HA 1VQ6A 1E2WA 3ICEA 4N9PA 3DM1A 4F8MA 3S14H 1QILA 2Z6KA 2HQLA 3LX0A 4U68A 1L0WA 4N8X1 2A6HD 2EY6A 1D1IA 3TSSA 5IWAL 1B9NA 2JEAI 5IYCG 4OELB 2ALYB 3MHBA 4DFAA 3J81c 1SRUA 4LFAL 1P16A 3CF5A 3H91A 4JI1Q 1IKLA 1O7LA 3J80c 3DM3A 2ASBA 5F2DA 1PYBA 3T1HL 4HR7B 4NKLA 4LF4L 2A8VA 4L6TB 5IWAQ 2A74C 3L9AX 3KJOA 4UPAA 1YIJA 3A56A 1G291 2BCOA 2Z4HA 3L7ZC 5LHY1 4IQZA 2E5LL 4DR2Q 4QL5A 3UDIA 2KEDA 1S5ED 1PRTF 3U50C 4G7OC 1A3UA 4DR7L 4YWLA 5IGFA 3QR8A 2R93B 2UXBQ 4JI5L 3RLOA 3BVMA 4HIMA 2E2IB 1YNXA 4KHVA 4P72A 5IODA 2VUMB 2F0LA 3VDYA 2AQ1B 1C8CA 3ULPA 2NVQH 4LWCA 1CA5A 3M85A 4X3SA 3HOYG 1TWAH 3PO3G 3MWYW 4LJZC 3S2DH 1ENAA 3GTGB 2JXMB 3W1BA 4MHEA 5D14A 4A93G 2KJXA 3NTIA 4HMJA 4A3KG 1Y1VG 2RQXA 2RSOA 1EYCA 1PH1A 1HA6A 3A8JE 3BZDB 4IPGA 3K59A 3NQTA 5I6WA 2O5JC 4CDCC 2K5VA 2B29A 1S72A 3LNNA 1QVFA 2K50A 1H95A 5M3MH 2BDNA 1ZXTA 4AQYL 1MHWC 4OWWB 3MTSA 4DR6Q 2KHSA 2M2LA 1L0XB 1IBLQ 5ISRA 2NBFA 2B2YA 1TU2B 4P74A 2HUGA 4KLKA 1WCMG 3I4NB 5BN5A 5FJ8G 1I4PA 2ENBA 3ERQA 3CCEA 3A8KE 2B2TC 2CQOA 4R4IA 1SN8A 1N8RC 1D6EC 2MPMA 3J81E 2RDFA 2RCNA 1HTPA 3DEPA 3EBEA 2E2JH 1HHVA 3T53B 1BOSA 2DNEA 4KJOA 4WFN3 1C4QA 2ZJRA 5D65A 4B3SL 1PTOC 2CFMA 1V43A 3CU7A 3PIPA 1XTDA 2K6AA 1HNZQ 4TRDA 1A2UA 3T4AC 1F2MA 4A3JH 1HRJA 1BR9A 1HPCA 3EQLC 1YEZA 2QEJC 3HKSA 3PF5A 4ABNA 3D3RA 3BDOA 4NDXA 4X3TA 4JV5Q 4RHSA 1F9RA 2WINB 4RGTA 4X66Q 1BF4A 2NZ1D 1STHA 1TWFH 4Y7NB 1AFPA 4IUVA 3CXCA 5DNFA 2Q8TA 3K80C 1NMGA 3D4DA 5C0XG 1H9RA 3M3YB 3E0EA 1FGUA 4IN3A 3NK9A 4CDFC 1TR5A 2Z9HA 1D5XC 1W2BA 1EFWA 2B2UA 4KKSA 4IJHA 3I3CA 1E1OA 1SJHD 2DNCA 5IT9c 2JN4A 2JA6H 1SMXA 1V1PA 5IP7G 1IYJB 1K8AC 4C3IH 1BO0A 2B2WC 3HS0C 5C4XH 4JI8L 2R7ZB 1HFNA 1B7YB 3A55A 2R92G 2PYKA 4P71A 3HOUG 3FMCA 4NB3A 1IKMA 1EEFD 4L5QA 3MXNA 2JA8H 3BZKA 4X62Q 1RJTA 3KF8B 2UXBL 1XPUA 4I65A 3E0JA 3HFZB 2F0FA 2WP8J 2H1EA 3W5OA 2KCNA 1IBML 1KXLA 4DR2L 2NVYH 1IYVA 2PQEA 5BR8Q 2RBMA 4I7ZC 2O5IC 1X9NA 3NSWA 2E8GA 4G57A 5FKAC 2LFNA 5FLXE 2E75C 2A19A 2NVQB 3HOZG 4XT1B 1HJPA 2XVSA 3NBHB 1TWAB 3PQIA 2PQAA 5I2YA 3I55A 1U4MA 1PFNA 3DWQA 1VQNA 3D4RA 3S2DB 3K5LA 1YBYA 4PV1C 3HOWH 4ZQ3A 3BG3A 5CBAE 4LF5Q 2UUAQ 4YY3Q 4IUPA 4A3LH 4IALA 3S1RH 3HKZE 1X6OA 1CQVA 1RF2D 2DN8A 3M7NA 2WACA 2OEOA 5A35A 4LF9L 4K2KA 5KIXA 4BBSH 4JI1L 1E2ZA 1I94Q 4NP5A 1XXGA 5IIFA 1SNQA 3W2DA 4K6DA 3ONAB 5D3IB 1D7QA 2TSSA 2JA5B 2RDGA 3D6WA 3NHHA 3Q8DA 1QWYA 4CBVA 3QOJA 3BZCA 4IURA 4C56C 2A68C 3VR5A 4FNFA 4KKUA 4GKJQ 1RCVD 4IFDH 1WVLA 4YHHQ 4LF9Q 5IE8A 5M5XH 4A3IB 1L1OB 1KNEA 1UUPA 5JOBA 3MA2B 4JW0A 2ZTEA 4POGA 1ESRA 3NQIA 3AU7A 5LL6S 1I50H 5DAUA 3E3XA 2F0NA 5AJ3Q 1X3QA 2MNAA 4OWXB 1LTRD 1HR0W 2WIIB 5JAVA 1NBWA 5M5XB 1PV4A 4QCLA 1AE2A 2HHHQ 1TWHB 4A3DB 1CA6A 3M4YA 1D8LA 3IFDA 4QIWE 3OTOQ 2Q2TA 1RHPA 2K4KA 4XQJA 1PTOF 1PFSA 2ZM6Q 2OWOA 2LSSA 3GTQB 3H94A 1K0SA 1IW7C 3EN2A 5FOBB 5M5YB 1X3GA 2LMCB 4RMFA 1C0AA 4ZUJA 1I4QA 2OTLA 3FP9A 1N33Q 3F2CA 4JK1C 1SMYD 1H9SA 5CV4A 2VB3X 1EYAA 3UDFA 2F0GA 3G4SA 4XYOA 1EQVA 1Q8KA 1EIFA 1L1OC 2V4DA 3VR3A 1CKNA 1PH9A 4RFBA 1TWCH 3NTHA 2I5MX 1FJGL 4EQPA 4XQQA 3HOXB 2SNMA 2I5LX 1MJEA 3S15H 5IGEA 5KNDA 1SNDA 3I4OA 1VQKA 4HJ9A 2VXWA 4JI8Q 5JVH3 3JAME 1VQDA 4GKJL 4LUVA 1VMPA 2KEEA 5G3LD 1PTOH 4BBRH 5CV7A 3HOWG 5IY0A 1EEID 4UP8A 1PYWD 1T5XD 2PW7A 3P7JA 1VQMA 4OEMB 4A3BH 4OWTB 4FXDA 2PI2E 1SLJA 1U9RA 2MUYA 4A93B 5EAYA 2DJGC 4F7XA 4OX9Q 1Y8OB 4HIDA 4K5XA 2A69D 1X56A 4YCUA 2HDMA 4EX5A 2ATWA 4UY8C 2L4NA 1ZYRC 4A76A 1KLGD 4RWSC 1ICWA 1UWVA 1YNND 5EKKA 3RUZA 3UI2A 4IJLA 3OIQA 2E5LQ 3H3VI 3C1EA 3I70A 5EJWA 4IFDG 4DR6L 5CV5A 3S9WA 3VYUA 5M5YH 2B2YC 2EE1A 3QIAA 1Y1WH 4CKCA 1KC8C 3CCSA 1RTOA 1VQGA 4ZK9B 1HNXL 1LACA 2XRSD 5M3FG 1ILPA 1SNOA 4ZCKA 3RLFA 1FVIA 2M9VA 1KD1C 2WB1G 2R92H 3GTKH 2Q2IA 1Z9FA 3KUPA 4JI3Q 3MXNB 2EQSA 5ELCA 2EOTA 1WTQA 1XMQL 1LTAD 3FHWA 4JOIA 4LFCL 3J7ZC 2A1AA 5ELEA 4GNXB 1JJCB 2CVRA 4OHJA 2F0IA 5J39A 4QQBX 1B53A 2L9HA 2K05A 2AQ3B 2HD3A 3IL8A 3NXWA 1K9MC 1O7YA 2F3WA 1D5ZC 4K5WA 1S5CD 1QCBD 4A3JG 4DF7A 3PO2G 1EUJA 4YCWA 1SEBD 2I0QA 4R4OA 2OXPA 4H13C 2XTIA 5ELBA 1I4XA 3TN2A 3CCLA 2Z6KC 5M5WB 1LTGD 2IX0A 3SK6A 2IPKD 2EJMA 2D9UA 1SFOB 5C3EG 2DY8A 4DPGA 4XXEA 2XRQD 1Q86C 1QE6A 2RCFA 1EFID 3K5OA 4OL7A 1PH4A 1ENFA 1NE3A 3TMEA 1KRTA 3CCJA 3DEOA 3CMEA 4DR3L 2NVTH 2KHJA 3OMCA 3GTOB 1FR3A 1SE4A 1R9TB 3DLLA 3I4MG 1NNXA 2J0TD 4OXPA 5IGGA 1PFMA 4JI3L 2JA5G 1ICFB 2IT1A 2R7FA 2AMCB 1C7YA 3K81C 4IUUA 4BWGB 4PZ7A 3OTOL 1TWGH 1PZID 3GV6A 1R9TH 1SR3A 3PO3H 1SBBB 3NBIA 1RIPA 1KAWA 3HOVH 1DOLA 3WWVA 4C3HB 1IBKQ 4XT3B 4C3IG 4B3ML 3TP6A 1FL0A 1VQEA 3OMGA 3HOVG 4KKTA 4YY3L 1QNUA 5C3EH 1Q12A 4DR5Q 5JJKA 1G91A 4JBMA 3WOEA 5A2QE 1VQOA 1RKNA 2OQ0A 3TQYA 5EGTA 4DV1L 3NP8A 3TP8A 1GUOA 1KDAA 1DM0B 3R3OA 4ULLA 1BBWA 1I4HA 1FNVA 2JEBI 4B3SQ 4DK6C 1B9MA 3TP5A 1I6HH 2ZXOA 2A68D 2SOBA 2R93H 1JICA 5CV8A 1IL8A 4EQ5A 3S1NB 4DUYL 2Y0SG 4C2MH 4Z9CB 1EY9A 2JA6B 3HZXA 3SDZA 3CMAA 2X6LA 2QEXA 3KLSA 2IL8A 3CHBD 4R8NA 2YTXA 2K04A 1HZ9A 1J5EL 5K36H 2F4IA 3G7LA 1JC7A 4MIUA 4NXNL 1A15A 4C2MB 5C44G 4O42A 1KNAA 4JI6Q 4J6HA 1IBLL 1CFMA 1O78A 2Q8IB 2XWJB 3OW7A 2NN6G 1IL2A 1S5FD 3G71A 5IYDG 1OO9B 3N52A 1CHPD 4NXNQ 2RF4A 5C4ZA 2QCPX 5JJLA 3EIVA 3M4QA 3PMFA 1I3QB 4RHRA 5C5LA 4PMWA 1KHIA 2NZHA 1MSGA 3ND9A 1N33L 1KDCA 2PZTA 3H15A 4HCEA 1SAPA 2RA4A 3S1NH 1M8AA 4MZ9A 4AH6A 3MZ5A 4FDBA 1Q3LA 3A5ZB 3S14B 5KRUA 1P8LA 4HAEA 2XGTA 4DV2L 1XMQQ 4X66L 2Y0SE 1HNXQ 4IUQA 3H6MA 4FVMA 1XMOL 1GUSA 1LTID 4GN4B 3HOXG 1HNZL 3M4OH 5IYBH 4N9TA 3J81i 1CUKA 1LTTD 1VQJA 2I46A 1B3QA 2F0HA 5NUCA 2K14A 3E5SA 1PHJA 1PVOA 1WI5A 4YWKA 1EY0A 4A3EG 2JP1A 2N49A 1U4RA 5LMNW 2J4XA 1TY0A 3PUYA 3E9IA 1Q7YC 3D0FA 4C1NK 1HQRD 1X55A 1F9QA 4G4KA 3K7AH 4A3IG 2AWNA 4UDUC 3TEHB 5GQOA 2F52A 2KA7A 4KY7A 1S40A 3G6EA 2E2HB 1W6JA 3RR5A 4B3TQ 3T1HQ 1N36Q 1HUMA 3C1FA 4IUTA 4OONA 2CHBD 5C0XH 2C5CA 4DV1Q 1JOQA 3QOLA 3VYTA 3VYRA 5IP9H 3HOYB 1JOKA 4Q0FA 3BU2A 5CGKA 5A2QL 3BYYB 3NPPA 1BKBA 3S1RB 1U0LA 3QWNA 5M3MB 4FXGC 1I4GA 1J6QA 5I2XA 1WYDA 3GTOH 1MKHA 2GVAA 5LMNQ 3CC4A 3I73A 1XPRA 2HCCA 3TBIB 2R7ZG 1LT6D 2EY2A 2Q8RE 2OF1A 1KLUD 1ZKOA 1VQAA 4QIWB 4L5RC 2IW3A 4MNOA 1OXVA 5CC4A 3CCMA 4A3CG 3BDCA 1T9HA 4KJNA 1SNPA 4LFAQ 4DR3Q 3RN2A 4A3DH 3EVQA 2NWGA 2E2JB 2PW5A 3P1HA 3GQBA 1OXXK 5EKIA 4RG1A 3JAMi 4A3FH 1VQBA 2VB2X 1V1QA 1PZKD 4GNXC 2FFKB 1A0IA 5JPMC 3K7UC 4GS3A 2D2CC 2MGSA 1IW7D 2IHFA 4X62L 4IPDA 3X3MA 2AUKA 4CDDC 1YHBA 3I4NH 4FF1A 1YJ9A 5I9PA 1SYCA 3NENA 1D1KA 3TP7A 3AMUA 1X65A 5EPJA 5IYCH 2XIWA 1WTVA 4JI0Q 1IXRA 4QY7A 4KMUC 4A3GB 4BY7H 4KK7A 4C3JH 1SYEA 1VQFA 4JYAL 1Q1EA 2RVLA 3K58A 1K8OA 2PI2A 5L37A 1MIUA 4LW1A 4BXXH 4V0BA 4LF8L 4RCOA 4G7HC 3OWEB 2PNHA 4B08A 1LTBD 2F0KA 5AJ3L 4C3JB 1NSNS 4DAYA 3OIPA 2UXDQ 3F8TA 4X64L 1A62A 1ESFA 2HQEA 5M9OA 4KY5A 1ET9A 2F0DA 1A8VA 2B63H 1DZ1A 1STNA 3BJUA 1FD7D 3G6JB 1Z7TA 3HOWB 2JYOA 1SYDA 4CJ2C 1F2ZA 3QO2A 5IGBA 3S17H 3H0GH 1HH2P 2K03A 2AKWB 3A5UA 4HJ7A 1N32L 2KBNA 3PF4A 4DK1A 4HEDA 2KCMA 2FMCA 4PQXA 4GLAC 4OO1H 3F1ZA 1NUCA 1TY2A 4AYBB 4CGYB 1PFBA 3JAMc 2DGYA 4Y7NH 5FK9C 4BY1B 3R8BA 2ZXPA 1WTOA 5FLXL 5CV6A 2E2DC 2EYJA 1Y1WB 2CKZB 4A3MG 2N78A 3Q24A 3KLRA 4QUCA 1UEAB 1A3VA 1EU3A 1B50A 5IT9E 4A3KH 1EZ6A 4NPSA 1VQLA 4EQOA 1O7ZA 1E22A 5FLMH 1MGSA 4DN4M 4CKEA 1TS3A 3M4OB 1C9OA 2MO0A 5FLMG 1KQSA 3KDFB 1DYQA 1KIXA 3U58A 1HTLD 1PMRA 3SEBA 1TQOA 1HUNA 2OTJA 5J1ZA 2VY3A 4TQUS 4JOIC 1Y69U 3VR4A 4HCSA 4PMCA 3A7AB 4DNIA 1X3FA 1SJED 2AHOB 1S3OA 3CP0A 1GXDC 4A3DG 2N88A 3GTJB 2JA9A 2L12A 4QB4A 1WD0A 3PUXA 1ASYA 1EY6A 3DHQA 2G9DA 2HIVA 3ND8A 1V8QA 2VUMG 5M3FH 3GTPH 2NB0A 1VF5C 2K01A 4ZKBB 3CC7A 5GAEC 3RN5A 4HJ8A 2A5HA 3EFXD 4QJFA 2CCZA 1KL9A 3HKZG 5C0XJ 1HQMC 4QGUA 2EVBA 5C44H 1FNWA 2B63B 1XNQL 1LABA 2M00A 1WTXA 3WOFA 4LFBQ 1B8AA 1F77A 4LAAA 2R6GA 3J80i 2R3ZA 3BS1A 4F87A 1X3PA 2AQ2B 3DWAA 5M5WH 5I4DA 1K83B 3M7GA 2A69C 3O13A 3L3OC 3STBD 1ENCA 1TWCB 1QZHA 4A3BB 1G51A 5HY6A 1K3RA 2ZTCA 1CT1D 3KF6B 1QJOA 1SNCA 5JPNC 4A3IH 2EJFC 1VQ7A 5JEAG 4M1UB 3Q0AA 5I9OA 1JCKB 2A6EC 2I5HA 2AUJD 4AYBE 1A63A 2WAQG 4DXGA 5KNBA 1Q46A 4DUZL 3FEWX 5J3BA 1Q1BA 2VZAA 4PZ8A 2NN6I 3GTGH 2EPBA 5FJ8H 1GJXA 2YU9B 5IT9L 1EIGA 5BN4A 1Z6HA 1PTOD 4R9WA 2IX1A 3F2BA 3P75A 4YCVA 4CDEC 1TKWB 5H1SE 1B1ZA 5CMDA 3H0GG 2UUCL 1E0BA 3A54A 4X3KA 1Y8NB 4B9WA 1PYSB 1ONLA 4GN3B 2JA7H 1EQQA 3KDFA 3I7FA 2YU9H 1LLRD 3FDTA 1JORA 3SGIA 4DV7L 2KQ3A 3L2PA 2N3SA 3MXPA 1LYLA 4JI7Q 4YHHL 5C3EB 2K28A 4MTKA 1BQQT 4GOPA 1LT5D 4IZ8A 5BN3A 4RH6A 3GTLB 3TS2A 1TVXA 4JBJA 3PO3B 1MBYA 1DOKA 5JEAJ 3K5MA 4A3JB 1T5EA 1JWMD 3KOJA 5EPKA 4DNTB 1WFQA 5C4JH 2YV5A 4BY7B 1HXYD 4X64Q 4C3HH 4J1MA 4JV5L 4BA2I 4GLVB 4JPBW 4AYBG 3PCOB 1H9JA 5E4XA 1WOCA 4ID6A 2JJQA 4PNYA 5CORA 4K0KL 1B70B 1F9SA 2KHIA 1PH2A 2FHTA 1L2FA 2E74C 3NEMA 1E24A 3GTKB 2R92B 3T51B 1WD1A 4LK1C 2RDHA 4S3SA 2QILA 2L15A 1EY7A 4JI0L 1LTSD 5IYDH 2G5DA 3UDGA 3VR6A 2Q2UA 5C6AA 1A6XA 1YI2A 3ITPA 3V05A 3RNUA 4BBSG 1BDOA 2PZWA 3FKIB 2PMZB 3L0OA 3J7A5 1DXMA 4WJWA 5FO7B 4KI0A 3RMHA 5KNCA 4XQNA 2QW7A 1K73C 1QOHA 3M9BA 2HT1A 1Y8PB 4GKKQ 3G48A 1GOZA 1SE8A 3U9OA 1PLFA 1SE2A 4IOAA 3UE0A 1Q81C 1NR4A 4RAUC 1J8IA 2PO4A 2EYLA 1DOMA 4LF7Q 3OOCA 2F0PA 3VYSA 3ZJYC 2LS01 1TS5A 2Y0SB 4DV7Q 1UAPA 3KLSX 4WRDA 2TMPA 3MEFA 4OIJA 4GZYC 2SDFA 2F0VA 3VA5A 5I6YA 2Z8LA 1QVCA 3HP3A 3NBHA 3V96A 3S2HH 1EU4A 1ILQA 4L5TA 3T1YQ 5GADC 3CW2C 2L11A 2JA8B 3NTKA 3CQZB 5G3LF 4TVAB 1K8MA 1AH9A 3V2TA 4EGVA 2ES2A 3MEHA 2KVMA 2VNUD 1VQ8A 5ELOA 2MQHA 2DJFC 1Z47A 1PRTB 1STEA 2BE5D 1AW7A 2Z6BA 3W1GA 3S16H 4H7BA 4A75A 4L63B 3IKJA 1M90C 2WB1E 5TSSA 5DM73 1JB7A 4ALPA 1L1OA 2D62A 4P2CB 2PNRC 5M3FB 2CQAA 1CK1A 3NE5B 3I4MH 4RCNA 2JA7G 1Q90A 1JWUD 4X65L 3K5NA 5C0XI 1BBXC 4B9XA 2X69A 4GNXA 3LGJA 1PDQA 3NUCA 5IP9G 1OXSC 3GDEA 2QDLA 3DMUA 4DGZA 1WCMB 2JK8A 5C44B 2K33A 2B39A 3MC0B 5HGTA 1AZPA 5M3MG 1GVPA 1VQ5A 2EDGA 1JWSD 2K7VA 2Z0SA 1RTNA 1BNZA 2QA4A 3AB9A 4DXFA 4RGMA 4A3EH 5K5PA 1BCPF 1GKHA 1WCMH 2KCCA 2DUDA 2VQFL 1SDFA 2GA4B 3FKIH 2WAQB 4HMIA 5ELFA 1LT4D 1IZ6A 4KN4C 1OXUA 2BOSA 4QUFA 5KYIA 3Q6SA 1U5KA 4DAVA 3S1QH 1KTKA 1G8ZD 2YTYA 5CR3A 1XMOQ 1TS2A 1EYGA 1FNUA 3I91A 1QG7A 3K8AA 4OGQC 4BBSB 3OWFA 2EJGC 3Q23A 4BXXG 1N32Q 1LTLA 1V9PA 4A3MB 1I50B 1LUZA 2MJ8A 1CZGA 3JC66 2R93G 3GP7A 3WDNA 3HGBA 4K2LA 2BDOA 4DV0L 3PIO3 1K8GA 4X65Q 1NJIC 3HOVB 2H4OA 2R7ZH 4LMQD 5GAHC 3CKIB 3AEVA 1CZWA 1HA5A 2OT2A 4A3FB 1X54A 4DV6Q 3P20A 2R61A 2CH4A 2WKDA 3OPOA 3GTQH 4DR1Q 2RSNA 1STGA 4AQYQ 3U4VA 3J80L 2NUCA 3SK4A 2HHHL 1Q8IA 3J7AF 4DV4L 1YITA 3SHLA 3D6CA 2LXKA 1CKMA 4JI6L 2WB1B 3CCVA 3CCRA 5E7NA
chains in the Genus database with same CATH topology
4YY3Q 3UE1A 4A3LH 3S1RH 3HKZE 2R7ZG 1X6OA 4OO1G 1XPOA 4LF6Q 1VQAA 4L5RC 2MFIA 4UP9A 4MNOA 3KFUA 1OXVA 3M7NA 4DR1L 3CCMA 1YHAA 4A3CG 4JC0A 2YYZA 1T9HA 1UE5A 4LF9L 4LFAQ 4DV3Q 4BBSH 3NELA 4DR3Q 2K75A 3RN2A 4A3DH 4JI1L 1I94Q 4A3LG 1N9WA 1OXXK 1GM5A 1HNWQ 4RG1A 3JAMi 4A3FH 1VQBA 3HOXH 5JJIA 1D7QA 4KHPQ 4LF4Q 4ME3A 2R7DA 1V1QA 3PUVA 1K83H 3Q8DA 4GNXC 1QZGA 2UU9Q 1XNRL 1A0IA 1JE5A 3BZCA 1OTCA 3K7UC 4JBWA 4J15A 3PGZA 4GS3A 1VQIA 4BA1I 4GKJQ 1CKOA 3ERSX 1Q82C 1PH3A 1XNQQ 2IHFA 1E7ZA 4X62L 4YHHQ 4IPDA 4LF9Q 5IE8A 2ZTDA 5M5XH 1L1OB 4JI4L 1YHBA 3OW2A 3I4NH 2V1CC 1N34Q 1YJ9A 2ZTEA 4BY1H 4DK3C 1VQCA 3NENA 4POGA 4IFDJ 4NXMQ 4IO9A 1I50H 1X65A 1XJVA 5AJ3Q 4GN5A 5IYCH 4OWXB 3PSIA 2MNAA 4JI0Q 1IXRA 4QY7A 1HR0W 5IYBG 1UEBA 3A0JA 4UP7A 1NBWA 5GAGC 4BY7H 4C3JH 5LMNL 4DV4Q 1PV4A 3PO2H 1VQFA 1YJNA 4JYAL 1AE2A 1HR0Q 3HOUH 1Q1EA 1J5EQ 1E1TA 2HHHQ 1JJGA 2C35B 4X6AH 1SROA 2PI2A 4DV0Q 1D8LA 1MIUA 4QIWE 3OTOQ 4DUYQ 2Q2TA 2K4KA 3HOYH 4LW1A 4BXXH 4LF8L 1PFSA 2ZM6Q 2OWOA 2LSSA 3KJPA 2F4VL 4DR4L 2PNHA 1QVGA 1YJWA 5AJ3L 4L5SA 2UXCL 2UXDQ 3EN2A 4IPCA 3F8TA 4R4TA 4X64L 2ID0A 1A62A 1WJJA 1X3GA 3I2ZA 4BY7G 2ZJPA 4RMFA 2UU9L 4GOPB 1NMFA 1XNRQ 4OX9L 1A8VA 1M1KC 2B63H 2JA8G 1C0AA 3ULLA 3BJUA 1ASZA 5BR8L 1PH8A 3J81j 2OTLA 2BH2A 1HNWL 3FP9A 1N33Q 4A4IA 3F2CA 3H0GH 3UDFA 3S17H 1HH2P 1JJ2A 3CPWA 2AKWB 3A5UA 4HJ7A 3G4SA 1N32L 2NZOA 2H5XA 2KBNA 1RL2A 3U4ZA 2JQOA 3CPFA 3PF4A 2KCMA 4JI2L 5HGQA 1Q8KA 5GROA 1KRSA 4GLAC 3F1ZA 1EIFA 1L1OC 1EQRA 3JAMc 1CKNA 2DGYA 2JE6I 4Y7NH 3AFPA 1PH9A 1TWHH 1TWCH 2I5MX 4DV3L 1EWIA 1FJGL 4OO1I 3TREA 4BBRG 4NXML 1G6PA 5ELNA 2IY5B 2I5LX 1MJEA 1X3EA 2CKZB 4A3MG 2N78A 1UE1A 3T1YL 3S15H 4A3GH 1VCIA 3I4OA 2OQKA 1VQKA 4HJ9A 1N34L 4JI8Q 4A3MH 1CSQA 4P73A 3S24A 4HJ5A 3F2DA 3RZOH 4JYAQ 4A3CH 3TS0A 5K36G 2VW9A 1JT8A 2JA5H 4PZ6A 4A3KH 1VQDA 1PH7A 4GKJL 4LUVA 3AYHB 2VQEQ 4NPSA 1VQLA 1QUQA 4BBRH 1NY4A 4P75A 1E22A 4LNQA 5FLMH 3HOWG 5IY0A 4UP8A 4A3FG 3RZDH 1C9OA 1VQMA 4DUZQ 2MO0A 4LF5Q 5FLMG 1KQSA 3KDFB 1K0RA 2UUAQ 1KIXA 4LFCQ 3U58A 4LF7L 4OWTB 4A3BH 4XIGS 2PI2E 4A3BG 1SLJA 2OTJA 2VY3A 4TQUS 1E3PA 5EAYA 4JOIC 4OX9Q 1SFOH 1LM0A 1IBMQ 3HOZH 4DNIA 2FXQA 4HIDA 2VL6A 4GKKL 1QUQB 1X3FA 2AHOB 1S3OA 1X56A 3CP0A 1EOVA 4YCUA 3CD6A 4A3DG 1BVSA 2JA9A 4GOPC 3A74A 4LFBL 3PUXA 1ASYA 3PUZA 4EX5A 3KLWA 4JI5Q 2ATWA 2HIVA 2HIXA 4UY8C 5M3FH 2VUMG 3FKIG 3GD7A 4A76A 1I3QH 3GTPH 3D31A 3AFQA 1UWVA 4O0AA 5GAEC 3CC7A 3RN5A 4A3GG 4HJ8A 4IJLA 4DAYB 3K0XA 4QJFA 2CCZA 1KL9A 3HKZG 2E2HH 5C0XJ 2E5LQ 1VQ6A 3H3VI 3ICEA 4IFDI 4IFDG 4DR6L 1Y1WH 5M5YH 4QGUA 5C44H 1KC8C 3S14H 2Z6KA 2HQLA 1XNQL 3CCSA 1VQGA 4LFBQ 4Y52H 1B8AA 2BA0A 2E2IH 1HNXL 1L0WA 5M3FG 2EXDA 2R6GA 3J80i 4HIOA 4WJ4A 4YWMA 5IWAL 2JEAI 3RLFA 1FVIA 5M5WH 5IYCG 4JI2Q 2ALYB 2BH8A 3J81c 3STBD 1KD1C 2WB1G 2R92H 3GTKH 2Q2IA 1SRUA 1QZHA 1G51A 1Z9FA 1P16A 4JG2A 5HY6A 1K3RA 2ZTCA 4LUOA 3CF5A 4JI3Q 3MXNB 3KF6B 4JI1Q 1H95A 2EQSA 4HIKA 1Y1VH 2B3GA 4A3IH 1VQ7A 1I5FA 5JEAG 1XMQL 4JOIA 3FHWA 3J80c 2I5HA 1PH6A 3DM3A 4LFCL 2ASBA 4AYBE 3J7ZC 2YTVA 4IOCA 1PYBA 2WAQG 1A63A 4DUZL 1Q46A 2A1AA 4JCVE 3T1HL 5J3BA 4GNXB 4LF4L 2A8VA 1JJCB 1Q1BA 2RHQB 4APVA 5IWAQ 2VZAA 4MTNA 1GD7A 4QQBX 3KJOA 4PZ8A 4UPAA 2NN6I 3GTGH 5FJ8H 1YIJA 3L7ZC 1G291 1TXYA 1K9MC 2F4VQ 2K52A 2E5LL 4DR2Q 4QL5A 1O7IA 3UDIA 3F2BA 2NVXH 4DR5L 4YCVA 4JI7L 4A3JG 5H1SE 2IX1A 3PO2G 3H0GG 3U50C 2UUCL 1EUJA 1HZBA 4YCWA 4DR7L 4YWLA 2I0QA 4R4OA 2UUAL 5C4XG 1PYSB 2XTIA 4GN3B 3CCLA 2JA7H 2Z6KC 1IBKL 4B3MQ 1EQQA 2UXBQ 2IX0A 3KDFA 3I7FA 2YU9H 2MO1A 4JI5L 3RLOA 4A93H 3UDXA 4LFAL 4HIMA 3SGIA 5C3EG 1YNXA 4P72A 4DPGA 4DV7L 3L2PA 2OCEA 4DV5L 2N3SA 1LYLA 3VDYA 1VQ9A 4KHZA 3ULPA 1Q86C 4JI7Q 3GTJH 4YHHL 4LWCA 2NVQH 4GOPA 1PH4A 1EIYB 1NE3A 3M85A 3HOYG 2ZJQA 3CQZH 1TWAH 1KRTA 3CCJA 4POFA 2QGQA 1VQ4A 3PO3G 3CMEA 4DR3L 2NVTH 2KHJA 1Y14B 3TS2A 3S2DH 4JBJA 3DLLA 3I4MG 5JEAJ 3W1BA 3KOJA 1W3SA 4A93G 1HZAA 1WFQA 5C4JH 2YV5A 4KHPL 5LMUL 4B3RQ 2UXCQ 4X64Q 4C3HH 4OXPA 4A3KG 4JI3L 2CWPA 1Y1VG 2JA5G 4JV5L 4BA2I 2IT1A 4GLVB 2R7FA 2AMCB 4AYBG 3PCOB 1C7YA 3K81C 1HZCA 1PH1A 1CKNB 1WOCA 4PZ7A 3OTOL 1TWGH 2JJQA 2KCTA 1R9TH 1MJCA 2PMZE 1SR3A 4IPGA 4K0KL 2UUCQ 3PO3H 3GO5A 1B70B 2KHIA 1RIPA 1KAWA 1PH2A 2UUBQ 1L2FA 2JA6G 3HOVH 3NEMA 1E24A 3WWVA 2UXDL 1IBKQ 4B3ML 1FL0A 2VUMH 3ER0A 1VQEA 3HOVG 2K5VA 2GN5A 2B29A 2L15A 4YY3L 1S72A 4JI0L 1FJGQ 5C3EH 1QVFA 5IYDH 3UDGA 2K50A 1Q12A 4DR5Q 5M3MH 2Q2UA 4DR7Q 5JJKA 4JBMA 4AQYL 1VQOA 4OWWB 4DR6Q 2Q2HA 3TQYA 2OQ0A 4DV1L 4JBKA 1IBLQ 4R1JA 1VQPA 1YI2A 4P74A 3RNUA 4BBSG 2CWAA 4KLKA 4BY1G 3PUWA 1WCMG 1BBWA 2KENA 3L0OA 3J7A5 5FJ8G 1UE6A 4KI0A 3GTLH 3KF6A 1K73C 2JEBI 5LMUQ 4B3RL 4B3SQ 4DK6C 3M9BA 3CCEA 2HT1A 1Y1WG 5DLQE 1I6HH 3CCUA 3G48A 2VQEL 4GKKQ 2CQOA 1SE8A 1SN8A 4R4IA 1N8RC 2R93H 4IOAA 1I94L 5FLXc 3UE0A 1Q81C 2RCNA 4EQ5A 2F3IA 3EBEA 4O2DA 4DUYL 2Y0SG 2D0PA 4C2MH 2E2JH 4LF7Q 2ZJRA 3ZJYC 4B3SL 3CMAA 1NTGA 2QEXA 4DV7Q 2CFMA 3IRBA 3PV0A 1V43A 2YTXA 2B63G 1HZ9A 3MEFA 1J5EL 3PIPA 4DKAC 4R4QA 1XTDA 4NXNL 1QVCA 1HNZQ 1YHQA 3S2HH 2RHSB 4JI6Q 5C44G 3CCQA 1IBLL 2UUBL 4A3JH 4L5TA 3T1YQ 5GADC 3CW2C 4TVAB 1AH9A 1YEZA 2ES2A 3HKSA 2NN6G 3PF5A 1IL2A 2VQFQ 2VNUD 3G71A 5IYDG 4DV6L 5ELOA 1VQ8A 2MQHA 1Z47A 3S16H 3W1GA 3S1MH 4JV5Q 1GO3E 2PQAB 4A75A 4NXNQ 1M90C 2RF4A 2WB1E 4AIMA 1JB7A 4ALPA 4X66Q 1L1OA 2D62A 3EIVA 3M4QA 5JJLA 1TWFH 4GLXA 3CXCA 4K0KQ 3I4MH 4PMWA 2JA7G 4JI4Q 2IHEA 4HJAA 1PH5A 1KHIA 2NZHA 4X65L 5C0XI 3K80C 1NMGA 1DGSA 5C0XG 4B3TL 1OXTA 2WAQE 3LGJA 4GNXA 1N33L 3H15A 4DR4Q 5IP9G 3GDEA 1OXSC 3E0EA 1FGUA 3S1NH 3GTMH 4MZ9A 4AH6A 3TRZA 4FDBA 2JK8A 1W2BA 1EFWA 3A5ZB 1HR0L 4DV5Q 1UE7A 5M3MG 1P8LA 2D0OA 4IJHA 1GVPA 2VS1A 3ULJA 1E1OA 2XGTA 1VQ5A 4DV2L 5IT9c 1XMQQ 2BA1A 4X66L 2Y0SE 3RLNA 2Z0SA 1HNXQ 3M4PA 2QA4A 2JA6H 1XMOL 1SMXA 5IP7G 1IYJB 4A3EH 2LXJA 1K8AC 4C3IH 4GN4B 1PA6A 3HOXG 5C4XH 1HNZL 4LF5L 3M4OH 5IYBH 1GKHA 1WCMH 4JI8L 4LF8Q 3CC2A 1CSPA 2DUDA 3CAMA 3FKIH 3J81i 1B7YB 1CUKA 2VQFL 2R92G 1VQJA 4P71A 3HOUG 3KYHC 3STBC 4DAMA 1IZ6A 1OXUA 2K14A 4NB3A 4L5QA 4LF6L 1U5KA 1PHJA 2JA8H 1PVOA 3BZKA 4X62Q 1WI5A 3S1QH 4PG3A 4YWKA 3KF8B 2UXBL 2YTYA 4A3EG 2N49A 1XMOQ 5IP7H 5LMNW 1XPUA 3I4NG 4WJ3M 1EYGA 1VQHA 1N36L 2WFWA 3K8AA 3HFZB 2WP8J 3PUYA 3E9IA 1Q7YC 3W5OA 3D0FA 4BXXG 1N32Q 4XTCS 1X55A 1JMCA 1LTLA 1V9PA 1IBML 1KXLA 3K7AH 1LUZA 4DR2L 4A3IG 2AWNA 2AWOA 2NVYH 3TEHB 3JC66 5GQOA 2F52A 2R93G 5BR8Q 3H3VH 1AE3A 3OYYA 2N8NA 3G6EA 1S40A 2GVBA 3AQQA 1VS0A 3RR5A 4DV2Q 4B3TQ 3T1HQ 3M3YH 4DV0L 1X9NA 1N36Q 1K8GA 4X65Q 1YVCA 4OONA 4DV1Q 1NJIC 1BBUA 2E8GA 3E9HA 5IP9H 2ZM6L 2R7ZH 5GAHC 3AEVA 2A19A 3BU2A 1X54A 4DV6Q 3B6YA 1BKBA 2K5NA 3HOZG 4LUZA 1HJPA 1U0LA 3GTQH 4DR1Q 3NBHB 2PQAA 4AQYQ 3U4VA 3I55A 4R4CA 1J6QA 1VQNA 1WYDA 3CCRA 3GTOH 1MKHA 2HHHL 2GVAA 5LMNQ 1YBYA 4DV4L 1YITA 3CC4A 1YZ6A 2K5HA 1CKMA 2LXKA 4IPHA 3PIOA 4JI6L 3HOWH 3CCVA 3I56A 4H02A 2EIFA 5E7NA 1XPRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YY3 Q;  3UE1 A;  4A3L H;  3S1R H;  3HKZ E;  2R7Z G;  1X6O A;  4OO1 G;  1XPO A;  4LF6 Q;  1VQA A;  4L5R C;  2MFI A;  4UP9 A;  4MNO A;  3KFU A;  1OXV A;  3M7N A;  4DR1 L;  3CCM A;  1YHA A;  4A3C G;  4JC0 A;  2YYZ A;  1T9H A;  1UE5 A;  4LF9 L;  4LFA Q;  4DV3 Q;  4BBS H;  3NEL A;  4DR3 Q;  2K75 A;  3RN2 A;  4A3D H;  4JI1 L;  1I94 Q;  4A3L G;  1N9W A;  1OXX K;  1GM5 A;  1HNW Q;  4RG1 A;  3JAM i;  4A3F H;  1VQB A;  3HOX H;  5JJI A;  1D7Q A;  4KHP Q;  4LF4 Q;  4ME3 A;  2R7D A;  1V1Q A;  3PUV A;  1K83 H;  3Q8D A;  4GNX C;  1QZG A;  2UU9 Q;  1XNR L;  1A0I A;  1JE5 A;  3BZC A;  1OTC A;  3K7U C;  4JBW A;  4J15 A;  3PGZ A;  4GS3 A;  1VQI A;  4BA1 I;  4GKJ Q;  1CKO A;  3ERS X;  1Q82 C;  1PH3 A;  1XNQ Q;  2IHF A;  1E7Z A;  4X62 L;  4YHH Q;  4IPD A;  4LF9 Q;  5IE8 A;  2ZTD A;  5M5X H;  1L1O B;  4JI4 L;  1YHB A;  3OW2 A;  3I4N H;  2V1C C;  1N34 Q;  1YJ9 A;  2ZTE A;  4BY1 H;  4DK3 C;  1VQC A;  3NEN A;  4POG A;  4IFD J;  4NXM Q;  4IO9 A;  1I50 H;  1X65 A;  1XJV A;  5AJ3 Q;  4GN5 A;  5IYC H;  4OWX B;  3PSI A;  2MNA A;  4JI0 Q;  1IXR A;  4QY7 A;  1HR0 W;  5IYB G;  1UEB A;  3A0J A;  4UP7 A;  1NBW A;  5GAG C;  4BY7 H;  4C3J H;  5LMN L;  4DV4 Q;  1PV4 A;  3PO2 H;  1VQF A;  1YJN A;  4JYA L;  1AE2 A;  1HR0 Q;  3HOU H;  1Q1E A;  1J5E Q;  1E1T A;  2HHH Q;  1JJG A;  2C35 B;  4X6A H;  1SRO A;  2PI2 A;  4DV0 Q;  1D8L A;  1MIU A;  4QIW E;  3OTO Q;  4DUY Q;  2Q2T A;  2K4K A;  3HOY H;  4LW1 A;  4BXX H;  4LF8 L;  1PFS A;  2ZM6 Q;  2OWO A;  2LSS A;  3KJP A;  2F4V L;  4DR4 L;  2PNH A;  1QVG A;  1YJW A;  5AJ3 L;  4L5S A;  2UXC L;  2UXD Q;  3EN2 A;  4IPC A;  3F8T A;  4R4T A;  4X64 L;  2ID0 A;  1A62 A;  1WJJ A;  1X3G A;  3I2Z A;  4BY7 G;  2ZJP A;  4RMF A;  2UU9 L;  4GOP B;  1NMF A;  1XNR Q;  4OX9 L;  1A8V A;  1M1K C;  2B63 H;  2JA8 G;  1C0A A;  3ULL A;  3BJU A;  1ASZ A;  5BR8 L;  1PH8 A;  3J81 j;  2OTL A;  2BH2 A;  1HNW L;  3FP9 A;  1N33 Q;  4A4I A;  3F2C A;  3H0G H;  3UDF A;  3S17 H;  1HH2 P;  1JJ2 A;  3CPW A;  2AKW B;  3A5U A;  4HJ7 A;  3G4S A;  1N32 L;  2NZO A;  2H5X A;  2KBN A;  1RL2 A;  3U4Z A;  2JQO A;  3CPF A;  3PF4 A;  2KCM A;  4JI2 L;  5HGQ A;  1Q8K A;  5GRO A;  1KRS A;  4GLA C;  3F1Z A;  1EIF A;  1L1O C;  1EQR A;  3JAM c;  1CKN A;  2DGY A;  2JE6 I;  4Y7N H;  3AFP A;  1PH9 A;  1TWH H;  1TWC H;  2I5M X;  4DV3 L;  1EWI A;  1FJG L;  4OO1 I;  3TRE A;  4BBR G;  4NXM L;  1G6P A;  5ELN A;  2IY5 B;  2I5L X;  1MJE A;  1X3E A;  2CKZ B;  4A3M G;  2N78 A;  1UE1 A;  3T1Y L;  3S15 H;  4A3G H;  1VCI A;  3I4O A;  2OQK A;  1VQK A;  4HJ9 A;  1N34 L;  4JI8 Q;  4A3M H;  1CSQ A;  4P73 A;  3S24 A;  4HJ5 A;  3F2D A;  3RZO H;  4JYA Q;  4A3C H;  3TS0 A;  5K36 G;  2VW9 A;  1JT8 A;  2JA5 H;  4PZ6 A;  4A3K H;  1VQD A;  1PH7 A;  4GKJ L;  4LUV A;  3AYH B;  2VQE Q;  4NPS A;  1VQL A;  1QUQ A;  4BBR H;  1NY4 A;  4P75 A;  1E22 A;  4LNQ A;  5FLM H;  3HOW G;  5IY0 A;  4UP8 A;  4A3F G;  3RZD H;  1C9O A;  1VQM A;  4DUZ Q;  2MO0 A;  4LF5 Q;  5FLM G;  1KQS A;  3KDF B;  1K0R A;  2UUA Q;  1KIX A;  4LFC Q;  3U58 A;  4LF7 L;  4OWT B;  4A3B H;  4XIG S;  2PI2 E;  4A3B G;  1SLJ A;  2OTJ A;  2VY3 A;  4TQU S;  1E3P A;  5EAY A;  4JOI C;  4OX9 Q;  1SFO H;  1LM0 A;  1IBM Q;  3HOZ H;  4DNI A;  2FXQ A;  4HID A;  2VL6 A;  4GKK L;  1QUQ B;  1X3F A;  2AHO B;  1S3O A;  1X56 A;  3CP0 A;  1EOV A;  4YCU A;  3CD6 A;  4A3D G;  1BVS A;  2JA9 A;  4GOP C;  3A74 A;  4LFB L;  3PUX A;  1ASY A;  3PUZ A;  4EX5 A;  3KLW A;  4JI5 Q;  2ATW A;  2HIV A;  2HIX A;  4UY8 C;  5M3F H;  2VUM G;  3FKI G;  3GD7 A;  4A76 A;  1I3Q H;  3GTP H;  3D31 A;  3AFQ A;  1UWV A;  4O0A A;  5GAE C;  3CC7 A;  3RN5 A;  4A3G G;  4HJ8 A;  4IJL A;  4DAY B;  3K0X A;  4QJF A;  2CCZ A;  1KL9 A;  3HKZ G;  2E2H H;  5C0X J;  2E5L Q;  1VQ6 A;  3H3V I;  3ICE A;  4IFD I;  4IFD G;  4DR6 L;  1Y1W H;  5M5Y H;  4QGU A;  5C44 H;  1KC8 C;  3S14 H;  2Z6K A;  2HQL A;  1XNQ L;  3CCS A;  1VQG A;  4LFB Q;  4Y52 H;  1B8A A;  2BA0 A;  2E2I H;  1HNX L;  1L0W A;  5M3F G;  2EXD A;  2R6G A;  3J80 i;  4HIO A;  4WJ4 A;  4YWM A;  5IWA L;  2JEA I;  3RLF A;  1FVI A;  5M5W H;  5IYC G;  4JI2 Q;  2ALY B;  2BH8 A;  3J81 c;  3STB D;  1KD1 C;  2WB1 G;  2R92 H;  3GTK H;  2Q2I A;  1SRU A;  1QZH A;  1G51 A;  1Z9F A;  1P16 A;  4JG2 A;  5HY6 A;  1K3R A;  2ZTC A;  4LUO A;  3CF5 A;  4JI3 Q;  3MXN B;  3KF6 B;  4JI1 Q;  1H95 A;  2EQS A;  4HIK A;  1Y1V H;  2B3G A;  4A3I H;  1VQ7 A;  1I5F A;  5JEA G;  1XMQ L;  4JOI A;  3FHW A;  3J80 c;  2I5H A;  1PH6 A;  3DM3 A;  4LFC L;  2ASB A;  4AYB E;  3J7Z C;  2YTV A;  4IOC A;  1PYB A;  2WAQ G;  1A63 A;  4DUZ L;  1Q46 A;  2A1A A;  4JCV E;  3T1H L;  5J3B A;  4GNX B;  4LF4 L;  2A8V A;  1JJC B;  1Q1B A;  2RHQ B;  4APV A;  5IWA Q;  2VZA A;  4MTN A;  1GD7 A;  4QQB X;  3KJO A;  4PZ8 A;  4UPA A;  2NN6 I;  3GTG H;  5FJ8 H;  1YIJ A;  3L7Z C;  1G29 1;  1TXY A;  1K9M C;  2F4V Q;  2K52 A;  2E5L L;  4DR2 Q;  4QL5 A;  1O7I A;  3UDI A;  3F2B A;  2NVX H;  4DR5 L;  4YCV A;  4JI7 L;  4A3J G;  5H1S E;  2IX1 A;  3PO2 G;  3H0G G;  3U50 C;  2UUC L;  1EUJ A;  1HZB A;  4YCW A;  4DR7 L;  4YWL A;  2I0Q A;  4R4O A;  2UUA L;  5C4X G;  1PYS B;  2XTI A;  4GN3 B;  3CCL A;  2JA7 H;  2Z6K C;  1IBK L;  4B3M Q;  1EQQ A;  2UXB Q;  2IX0 A;  3KDF A;  3I7F A;  2YU9 H;  2MO1 A;  4JI5 L;  3RLO A;  4A93 H;  3UDX A;  4LFA L;  4HIM A;  3SGI A;  5C3E G;  1YNX A;  4P72 A;  4DPG A;  4DV7 L;  3L2P A;  2OCE A;  4DV5 L;  2N3S A;  1LYL A;  3VDY A;  1VQ9 A;  4KHZ A;  3ULP A;  1Q86 C;  4JI7 Q;  3GTJ H;  4YHH L;  4LWC A;  2NVQ H;  4GOP A;  1PH4 A;  1EIY B;  1NE3 A;  3M85 A;  3HOY G;  2ZJQ A;  3CQZ H;  1TWA H;  1KRT A;  3CCJ A;  4POF A;  2QGQ A;  1VQ4 A;  3PO3 G;  3CME A;  4DR3 L;  2NVT H;  2KHJ A;  1Y14 B;  3TS2 A;  3S2D H;  4JBJ A;  3DLL A;  3I4M G;  5JEA J;  3W1B A;  3KOJ A;  1W3S A;  4A93 G;  1HZA A;  1WFQ A;  5C4J H;  2YV5 A;  4KHP L;  5LMU L;  4B3R Q;  2UXC Q;  4X64 Q;  4C3H H;  4OXP A;  4A3K G;  4JI3 L;  2CWP A;  1Y1V G;  2JA5 G;  4JV5 L;  4BA2 I;  2IT1 A;  4GLV B;  2R7F A;  2AMC B;  4AYB G;  3PCO B;  1C7Y A;  3K81 C;  1HZC A;  1PH1 A;  1CKN B;  1WOC A;  4PZ7 A;  3OTO L;  1TWG H;  2JJQ A;  2KCT A;  1R9T H;  1MJC A;  2PMZ E;  1SR3 A;  4IPG A;  4K0K L;  2UUC Q;  3PO3 H;  3GO5 A;  1B70 B;  2KHI A;  1RIP A;  1KAW A;  1PH2 A;  2UUB Q;  1L2F A;  2JA6 G;  3HOV H;  3NEM A;  1E24 A;  3WWV A;  2UXD L;  1IBK Q;  4B3M L;  1FL0 A;  2VUM H;  3ER0 A;  1VQE A;  3HOV G;  2K5V A;  2GN5 A;  2B29 A;  2L15 A;  4YY3 L;  1S72 A;  4JI0 L;  1FJG Q;  5C3E H;  1QVF A;  5IYD H;  3UDG A;  2K50 A;  1Q12 A;  4DR5 Q;  5M3M H;  2Q2U A;  4DR7 Q;  5JJK A;  4JBM A;  4AQY L;  1VQO A;  4OWW B;  4DR6 Q;  2Q2H A;  3TQY A;  2OQ0 A;  4DV1 L;  4JBK A;  1IBL Q;  4R1J A;  1VQP A;  1YI2 A;  4P74 A;  3RNU A;  4BBS G;  2CWA A;  4KLK A;  4BY1 G;  3PUW A;  1WCM G;  1BBW A;  2KEN A;  3L0O A;  3J7A 5;  5FJ8 G;  1UE6 A;  4KI0 A;  3GTL H;  3KF6 A;  1K73 C;  2JEB I;  5LMU Q;  4B3R L;  4B3S Q;  4DK6 C;  3M9B A;  3CCE A;  2HT1 A;  1Y1W G;  5DLQ E;  1I6H H;  3CCU A;  3G48 A;  2VQE L;  4GKK Q;  2CQO A;  1SE8 A;  1SN8 A;  4R4I A;  1N8R C;  2R93 H;  4IOA A;  1I94 L;  5FLX c;  3UE0 A;  1Q81 C;  2RCN A;  4EQ5 A;  2F3I A;  3EBE A;  4O2D A;  4DUY L;  2Y0S G;  2D0P A;  4C2M H;  2E2J H;  4LF7 Q;  2ZJR A;  3ZJY C;  4B3S L;  3CMA A;  1NTG A;  2QEX A;  4DV7 Q;  2CFM A;  3IRB A;  3PV0 A;  1V43 A;  2YTX A;  2B63 G;  1HZ9 A;  3MEF A;  1J5E L;  3PIP A;  4DKA C;  4R4Q A;  1XTD A;  4NXN L;  1QVC A;  1HNZ Q;  1YHQ A;  3S2H H;  2RHS B;  4JI6 Q;  5C44 G;  3CCQ A;  1IBL L;  2UUB L;  4A3J H;  4L5T A;  3T1Y Q;  5GAD C;  3CW2 C;  4TVA B;  1AH9 A;  1YEZ A;  2ES2 A;  3HKS A;  2NN6 G;  3PF5 A;  1IL2 A;  2VQF Q;  2VNU D;  3G71 A;  5IYD G;  4DV6 L;  5ELO A;  1VQ8 A;  2MQH A;  1Z47 A;  3S16 H;  3W1G A;  3S1M H;  4JV5 Q;  1GO3 E;  2PQA B;  4A75 A;  4NXN Q;  1M90 C;  2RF4 A;  2WB1 E;  4AIM A;  1JB7 A;  4ALP A;  4X66 Q;  1L1O A;  2D62 A;  3EIV A;  3M4Q A;  5JJL A;  1TWF H;  4GLX A;  3CXC A;  4K0K Q;  3I4M H;  4PMW A;  2JA7 G;  4JI4 Q;  2IHE A;  4HJA A;  1PH5 A;  1KHI A;  2NZH A;  4X65 L;  5C0X I;  3K80 C;  1NMG A;  1DGS A;  5C0X G;  4B3T L;  1OXT A;  2WAQ E;  3LGJ A;  4GNX A;  1N33 L;  3H15 A;  4DR4 Q;  5IP9 G;  3GDE A;  1OXS C;  3E0E A;  1FGU A;  3S1N H;  3GTM H;  4MZ9 A;  4AH6 A;  3TRZ A;  4FDB A;  2JK8 A;  1W2B A;  1EFW A;  3A5Z B;  1HR0 L;  4DV5 Q;  1UE7 A;  5M3M G;  1P8L A;  2D0O A;  4IJH A;  1GVP A;  2VS1 A;  3ULJ A;  1E1O A;  2XGT A;  1VQ5 A;  4DV2 L;  5IT9 c;  1XMQ Q;  2BA1 A;  4X66 L;  2Y0S E;  3RLN A;  2Z0S A;  1HNX Q;  3M4P A;  2QA4 A;  2JA6 H;  1XMO L;  1SMX A;  5IP7 G;  1IYJ B;  4A3E H;  2LXJ A;  1K8A C;  4C3I H;  4GN4 B;  1PA6 A;  3HOX G;  5C4X H;  1HNZ L;  4LF5 L;  3M4O H;  5IYB H;  1GKH A;  1WCM H;  4JI8 L;  4LF8 Q;  3CC2 A;  1CSP A;  2DUD A;  3CAM A;  3FKI H;  3J81 i;  1B7Y B;  1CUK A;  2VQF L;  2R92 G;  1VQJ A;  4P71 A;  3HOU G;  3KYH C;  3STB C;  4DAM A;  1IZ6 A;  1OXU A;  2K14 A;  4NB3 A;  4L5Q A;  4LF6 L;  1U5K A;  1PHJ A;  2JA8 H;  1PVO A;  3BZK A;  4X62 Q;  1WI5 A;  3S1Q H;  4PG3 A;  4YWK A;  3KF8 B;  2UXB L;  2YTY A;  4A3E G;  2N49 A;  1XMO Q;  5IP7 H;  5LMN W;  1XPU A;  3I4N G;  4WJ3 M;  1EYG A;  1VQH A;  1N36 L;  2WFW A;  3K8A A;  3HFZ B;  2WP8 J;  3PUY A;  3E9I A;  1Q7Y C;  3W5O A;  3D0F A;  4BXX G;  1N32 Q;  4XTC S;  1X55 A;  1JMC A;  1LTL A;  1V9P A;  1IBM L;  1KXL A;  3K7A H;  1LUZ A;  4DR2 L;  4A3I G;  2AWN A;  2AWO A;  2NVY H;  3TEH B;  3JC6 6;  5GQO A;  2F52 A;  2R93 G;  5BR8 Q;  3H3V H;  1AE3 A;  3OYY A;  2N8N A;  3G6E A;  1S40 A;  2GVB A;  3AQQ A;  1VS0 A;  3RR5 A;  4DV2 Q;  4B3T Q;  3T1H Q;  3M3Y H;  4DV0 L;  1X9N A;  1N36 Q;  1K8G A;  4X65 Q;  1YVC A;  4OON A;  4DV1 Q;  1NJI C;  1BBU A;  2E8G A;  3E9H A;  5IP9 H;  2ZM6 L;  2R7Z H;  5GAH C;  3AEV A;  2A19 A;  3BU2 A;  1X54 A;  4DV6 Q;  3B6Y A;  1BKB A;  2K5N A;  3HOZ G;  4LUZ A;  1HJP A;  1U0L A;  3GTQ H;  4DR1 Q;  3NBH B;  2PQA A;  4AQY Q;  3U4V A;  3I55 A;  4R4C A;  1J6Q A;  1VQN A;  1WYD A;  3CCR A;  3GTO H;  1MKH A;  2HHH L;  2GVA A;  5LMN Q;  1YBY A;  4DV4 L;  1YIT A;  3CC4 A;  1YZ6 A;  2K5H A;  1CKM A;  2LXK A;  4IPH A;  3PIO A;  4JI6 L;  3HOW H;  3CCV A;  3I56 A;  4H02 A;  2EIF A;  5E7N A;  1XPR A; 
#chains in the Genus database with same CATH topology
 1WTH A;  2HCI A;  1BCP C;  4CJ1 B;  1XPO A;  2XWB B;  4LF6 Q;  1BUV T;  2FJ2 A;  3ERO A;  1UE5 A;  3D8G A;  4DV3 Q;  2ICI A;  3I72 A;  2K75 A;  2K1B A;  2DY7 A;  1YNJ D;  1N9W A;  1R4P B;  3R93 A;  3SVM A;  4KHP Q;  3S17 B;  3H0G B;  2IX3 A;  4LF4 Q;  3I8Z A;  4TKO B;  1OTC A;  3I4L A;  3PGZ A;  1VQI A;  2L55 A;  4FF3 A;  4ZYS A;  1CKO A;  1Q82 C;  1XNQ Q;  5E3F A;  5CV9 A;  2LKV A;  4O1N A;  5E4W C;  5EPL A;  1ML0 D;  1N34 Q;  1VMC A;  4BY1 H;  3CRK C;  1VQC A;  4DK3 C;  4IFD J;  1WTW A;  4NXM Q;  3BDL A;  3RD4 A;  1XJV A;  4GN5 A;  4NMZ A;  5IYB G;  3EJI A;  4RKB A;  3A0J A;  4UP7 A;  5GAG C;  2PCF B;  4DV4 Q;  1DJR D;  1JJG A;  2F1M A;  1J5E Q;  3F2U A;  1D2B A;  1SYG A;  4X6A H;  2F0E A;  4DV0 Q;  2N55 A;  1V1P B;  4KN7 C;  3KJP A;  5COY A;  2F4V L;  4DR4 L;  1YJW A;  3T16 A;  2UXC L;  4IPC A;  4PMB A;  2L5T A;  1WJJ A;  2B8G A;  5KGU A;  1A2T A;  5JEA H;  1XWE A;  2ZJP A;  1WTP A;  1KDB A;  3HOU B;  1NMF A;  4BY7 G;  1KAB A;  1M1K C;  4OX9 L;  2JA8 G;  1PXU A;  1O80 A;  3ULL A;  3C3L A;  1ASZ A;  3SE0 A;  2EXZ A;  2BH2 A;  3J7A V;  1AEX A;  4KD3 A;  4C1N I;  1MI2 A;  2FMM A;  2NZO A;  2H5X A;  2NN6 H;  3KBX A;  2KUM A;  1RL2 A;  3HOZ B;  4JI2 L;  5HGQ A;  2RKS A;  5GRO A;  1TT2 A;  1F2Y A;  1SE3 A;  4L8J A;  1XTC D;  3AFP A;  1TWH H;  4F88 A;  5J22 A;  4OO1 I;  3TRE A;  3K0Y A;  3LWE A;  5ELN A;  2IY5 B;  4KV6 A;  2ZXR A;  1UE1 A;  4HSV A;  2ICE C;  1K28 A;  1N34 L;  2D5D A;  1CSQ A;  3RZO H;  4HJ5 A;  3F2D A;  4JYA Q;  2NVY B;  4A3C H;  5K36 G;  2NVX B;  4PZ6 A;  1PH7 A;  3LWU A;  2C9O A;  1EQT A;  4A3E B;  1YNJ C;  2CH4 W;  4LNQ A;  4A3F G;  1G2T A;  4DUZ Q;  1L0Y B;  4HSP A;  5KYL A;  1K0R A;  4LF7 L;  4FXK C;  4XIG S;  3NWT A;  3BVG A;  4XDX A;  4UAI A;  4A3B G;  1E3P A;  1LM0 A;  1IBM Q;  2FXQ A;  2VL6 A;  4GKK L;  1QUQ B;  3FRP B;  4M8A A;  3RZD B;  3KBG A;  4GOP C;  3A74 A;  1LV9 A;  4ZRZ A;  4RA8 A;  1JQY D;  3KLW A;  5C3X A;  2PZU A;  2A6E D;  3R2T A;  2KEC A;  1LT3 D;  3N6R A;  2F0W A;  4DAY B;  3K0X A;  2E2H H;  3MFG A;  4IFD I;  1STY A;  1GHJ A;  2BE5 C;  1KAA A;  1VF7 A;  2J7Z A;  3K6O A;  5CYU A;  4Y52 H;  2BA0 A;  2E2I H;  2EXD A;  4HIO A;  4WJ4 A;  4YWM A;  2QDB A;  1GUN A;  4JI2 Q;  2BH8 A;  4DNR B;  5FO8 B;  1M4V A;  4RGN A;  4JG2 A;  4LUO A;  1U4L A;  4BS9 A;  1Y1V H;  2B3G A;  4HIK A;  2F0O A;  1I5F A;  1H9S B;  2NYZ D;  3KK7 A;  1LO5 D;  1PH6 A;  3S15 B;  2YTV A;  1BCP B;  4IOC A;  3IFT A;  4JCV E;  1U4P A;  2RHQ B;  4APV A;  4MTN A;  1GD7 A;  2MP1 A;  1SXT A;  2F4V Q;  1TXY A;  3FPU B;  2EZV A;  2K52 A;  1XYI A;  3W3A A;  1II3 A;  1O7I A;  3SK8 A;  2NVX H;  2A6H C;  4DR5 L;  4JI7 L;  1RD9 D;  2B2T A;  4CHT B;  2L1B A;  1HZB A;  1DCZ A;  1K3B C;  3K57 A;  2UUA L;  2SEB D;  5C4X G;  4Q5V A;  1B44 D;  3MXG A;  4MN3 A;  1IBK L;  4B3M Q;  5DM6 3;  2MO1 A;  4A93 H;  5C4X B;  4IUN A;  4KTA A;  3UDX A;  1SSO A;  4QF4 A;  4DV5 L;  2OCE A;  3EA6 A;  1VQ9 A;  4KHZ A;  3GTJ H;  3PIP 3;  2IWH A;  1EIY B;  2ZJQ A;  4H44 C;  3CQZ H;  5T1I A;  4POF A;  2QGQ A;  1VQ4 A;  1Y14 B;  3TZU A;  2G9H D;  1FYC A;  3Q22 A;  5EQ0 A;  3S1M B;  1W3S A;  1HZA A;  1QB5 D;  4KHP L;  5LMU L;  4B3R Q;  2UXC Q;  1BXT A;  1JB3 A;  1DD2 A;  2CWP A;  3H09 A;  2K32 A;  1EOT A;  1HZC A;  5C5M A;  1CKN B;  3J7Y W;  1GHK A;  2K5D A;  1CQF A;  2CW0 C;  2KCT A;  1ZYR D;  1MJC A;  2PMZ E;  1EIH A;  2UUC Q;  3GO5 A;  2KOL A;  2UUB Q;  2JA6 G;  2UXD L;  2VUM H;  3ER0 A;  3DWP A;  2GN5 A;  1FJG Q;  3CRL C;  1PZJ D;  1JE4 A;  4DR7 Q;  5IGD A;  2Q2H A;  4JBK A;  1H9K A;  4R1J A;  1VQP A;  2EYO A;  2CWA A;  4BY1 G;  2X6G A;  4X3U A;  3PUW A;  4U67 3;  2KEN A;  1NCV A;  1V1O A;  1NR2 A;  1UE6 A;  3GTL H;  3KF6 A;  1GUG A;  5LMU Q;  4B3R L;  3U9S A;  2FIN B;  4HTH A;  4JVZ A;  1Y1W G;  5DLQ E;  2NVT B;  1CI3 M;  2VQE L;  3CCU A;  3IAY A;  1CHQ D;  2JA7 B;  1A3T A;  1I94 L;  5FLX c;  3QB3 A;  2F3I A;  4O2D A;  2D0P A;  3HG9 A;  2F3V A;  1HCZ A;  2B2U C;  3C46 A;  1EYD A;  1G2S A;  1NTG A;  3IRB A;  3PV0 A;  2B63 G;  5C3W A;  1MSH A;  4DKA C;  4R4Q A;  1YHQ A;  2RHS B;  5EKL A;  3CCQ A;  2UUB L;  1AZQ A;  1FGB D;  4RGO S;  2B2V C;  3S1Q B;  1EWC A;  3I4M B;  1VDZ A;  2VQF Q;  1EL0 A;  1NAP A;  2XSC A;  1F9P A;  3VR2 A;  2K5W A;  2EYM A;  3QG1 A;  4K5V A;  4DV6 L;  3S1M H;  4E6I A;  1GO3 E;  1RDP D;  2PQA B;  1TWG B;  1F2L A;  3GTM B;  4AIM A;  1ZEQ X;  2O2L D;  5T1G A;  4GLX A;  3DXJ C;  2XNA C;  5HUR A;  4K0K Q;  3GTP B;  2EYF A;  4JI4 Q;  2IHE A;  4HJA A;  1PH5 A;  2HDL A;  1H9M A;  1DGS A;  4B3T L;  1HFG A;  1SMY C;  1OXT A;  2WAQ E;  3DUZ A;  4DR4 Q;  1I6H B;  2P5Z X;  2MHV A;  3J80 E;  3GTM H;  2F0J A;  3TRZ A;  1I6V C;  1HR0 L;  4DV5 Q;  1S5B D;  4OIK A;  1UE7 A;  5D3D A;  2D0O A;  3ULJ A;  2VS1 A;  2LY7 A;  3D4W A;  2BA1 A;  3A8I E;  3RLN A;  3M4P A;  2LXJ A;  1PA6 A;  1XX8 A;  2A73 B;  1JR0 D;  2F0M A;  4LF5 L;  4LF8 Q;  5JJZ A;  3CC2 A;  1CSP A;  3CAM A;  3JAM L;  1B3A A;  1TII D;  2E76 C;  4K8I A;  2IJ0 A;  3KYH C;  4ZUI A;  3STB C;  4DAM A;  3ZYY X;  4CJ0 B;  4ZKC B;  4LF6 L;  2F0T A;  3HKZ B;  1S4Z A;  4PG3 A;  5KEE A;  1EY5 A;  2F0U A;  5IP7 H;  2Z4I A;  5FO9 B;  5DEH A;  3I4N G;  4WJ3 M;  1VQH A;  4NW2 A;  2SNS A;  3SK5 A;  2WV6 D;  1N36 L;  2WFW A;  2F03 A;  1YNN C;  4QMG A;  3MXU A;  4XTC S;  1EZ8 A;  1JMC A;  1PRT D;  2EYH A;  2B8F A;  2AWO A;  3S2H B;  3H3V H;  1AE3 A;  3OYY A;  2I07 B;  2N8N A;  4DK0 A;  2GVB A;  3AQQ A;  1VS0 A;  4DV2 Q;  4BBR B;  3M3Y H;  4C3I B;  1YVC A;  1IYU A;  1BBU A;  3E6Z X;  3E9H A;  1S5D D;  4I7A A;  2ZM6 L;  2QF7 A;  1EY8 A;  2F0S A;  3T13 A;  2B2W A;  3B6Y A;  2K5N A;  1I4R A;  1W6K A;  4LUZ A;  2EYP A;  4R4C A;  2XN9 C;  4XYQ A;  4K14 A;  1YZ6 A;  2K5H A;  4IPH A;  3PIO A;  3MAQ A;  4ZAI A;  1B2T A;  3I56 A;  4H02 A;  1TWF B;  2EIF A;  5C4J B;  3UE1 A;  3BVZ A;  1D5M C;  4OO1 G;  5AFW A;  2L0C A;  2MFI A;  1SYB A;  3MFY A;  3MVV A;  4UP9 A;  3KFU A;  2O4X A;  4DR1 L;  3HRZ C;  1YHA A;  4JC0 A;  2YYZ A;  3OHX C;  4TSS A;  3NEL A;  5ELD A;  4CKB A;  4A3L G;  1GM5 A;  2JSO A;  1HNW Q;  3J81 L;  3HOX H;  5JJI A;  4ME3 A;  2R7D A;  3PUV A;  1K83 H;  1QZG A;  5E1F A;  2UU9 Q;  1XNR L;  1JE5 A;  4FO2 A;  3R2I A;  4J15 A;  4JBW A;  4KY6 A;  3TZD A;  4BA1 I;  1PH3 A;  3ERS X;  4ODG A;  1E7Z A;  1AN8 A;  2ZTD A;  4R8I A;  3URY A;  1STB A;  4JI4 L;  1BCP D;  3OW2 A;  4EQN A;  2V1C C;  4DA2 A;  4ZLT F;  3T56 B;  3K7A B;  5IOC A;  4IO9 A;  1STA A;  4KD4 A;  5JVG 3;  4YIJ A;  3PSI A;  2QKI C;  4DAP A;  1UEB A;  1TS4 A;  3I90 A;  5LMN L;  1MD2 D;  3PO2 H;  1YJN A;  3HOU H;  1HR0 Q;  3FPP A;  1E1T A;  4UHV A;  2C35 B;  1SRO A;  1DON A;  4DUY Q;  4H0L C;  3HOY H;  4DU9 A;  1PRT C;  3OSO A;  3SR1 A;  2EY5 A;  1QVG A;  1G6Z A;  4L5S A;  1X32 A;  4R4T A;  1E2V A;  2ID0 A;  3I2Z A;  3QJY A;  2UU9 L;  4GOP B;  1XNR Q;  3H3V C;  1SYF A;  1JOO A;  5BR8 L;  1PH8 A;  2B2V A;  3J81 j;  1HNW L;  4HN7 A;  3KF8 A;  1ET6 A;  4K8J A;  4A4I A;  1JJ2 A;  3CPW A;  2CW0 D;  2WKC A;  3BYT B;  1UNS A;  3S16 B;  1QNK A;  3U4Z A;  2JQO A;  3CPF A;  1KRS A;  1Y1V B;  1EQR A;  3VA7 A;  2JE6 I;  2NTT A;  2ZT9 C;  3RZO B;  5LL6 X;  1J9O A;  4FF4 A;  5CBE E;  4DV3 L;  1EWI A;  1GUT A;  4FP5 D;  4BBR G;  1CM9 A;  4NXM L;  4ILW A;  1G6P A;  3A7L A;  3TDQ A;  3PO2 B;  1X3E A;  1R4Q B;  3T1Y L;  4A3G H;  1VCI A;  2OQK A;  1EY4 A;  4A3M H;  3S24 A;  4P73 A;  1IHZ A;  1SNM A;  3TS0 A;  1JT8 A;  2VW9 A;  4ME5 A;  5EBD A;  1GUW A;  2JA5 H;  4C3H G;  5IGC A;  3FVQ A;  3NWS A;  4G7Z C;  3AYH B;  1EWH A;  2F0Q A;  2VQE Q;  4FYD A;  1QUQ A;  3SXH A;  5EBC A;  2PPB C;  1NY4 A;  4P75 A;  1CTM A;  4N8F A;  4EVO A;  1WTR A;  3RZD H;  4RKL A;  4LFC Q;  4WOR A;  4J8Q A;  4K6L A;  1B4O A;  2EY1 A;  2NTS A;  1PTO B;  3GV3 A;  1ROD A;  1SFO H;  1C48 A;  3HOZ H;  4C3J G;  3X3N A;  3CD6 A;  1EOV A;  1BVS A;  3C2P A;  4LFB L;  3PUZ A;  4JI5 Q;  4FF2 A;  2HIX A;  1AP0 A;  3FKI G;  2K5Q A;  3GD7 A;  1I3Q H;  3HEJ A;  3D31 A;  3AFQ A;  4O0A A;  4A3G G;  4V19 0;  4A3K B;  2Z1C A;  5C4H A;  1VQ6 A;  1E2W A;  3ICE A;  4N9P A;  3DM1 A;  4F8M A;  3S14 H;  1QIL A;  2Z6K A;  2HQL A;  3LX0 A;  4U68 A;  1L0W A;  4N8X 1;  2A6H D;  2EY6 A;  1D1I A;  3TSS A;  5IWA L;  1B9N A;  2JEA I;  5IYC G;  4OEL B;  2ALY B;  3MHB A;  4DFA A;  3J81 c;  1SRU A;  4LFA L;  1P16 A;  3CF5 A;  3H91 A;  4JI1 Q;  1IKL A;  1O7L A;  3J80 c;  3DM3 A;  2ASB A;  5F2D A;  1PYB A;  3T1H L;  4HR7 B;  4NKL A;  4LF4 L;  2A8V A;  4L6T B;  5IWA Q;  2A74 C;  3L9A X;  3KJO A;  4UPA A;  1YIJ A;  3A56 A;  1G29 1;  2BCO A;  2Z4H A;  3L7Z C;  5LHY 1;  4IQZ A;  2E5L L;  4DR2 Q;  4QL5 A;  3UDI A;  2KED A;  1S5E D;  1PRT F;  3U50 C;  4G7O C;  1A3U A;  4DR7 L;  4YWL A;  5IGF A;  3QR8 A;  2R93 B;  2UXB Q;  4JI5 L;  3RLO A;  3BVM A;  4HIM A;  2E2I B;  1YNX A;  4KHV A;  4P72 A;  5IOD A;  2VUM B;  2F0L A;  3VDY A;  2AQ1 B;  1C8C A;  3ULP A;  2NVQ H;  4LWC A;  1CA5 A;  3M85 A;  4X3S A;  3HOY G;  1TWA H;  3PO3 G;  3MWY W;  4LJZ C;  3S2D H;  1ENA A;  3GTG B;  2JXM B;  3W1B A;  4MHE A;  5D14 A;  4A93 G;  2KJX A;  3NTI A;  4HMJ A;  4A3K G;  1Y1V G;  2RQX A;  2RSO A;  1EYC A;  1PH1 A;  1HA6 A;  3A8J E;  3BZD B;  4IPG A;  3K59 A;  3NQT A;  5I6W A;  2O5J C;  4CDC C;  2K5V A;  2B29 A;  1S72 A;  3LNN A;  1QVF A;  2K50 A;  1H95 A;  5M3M H;  2BDN A;  1ZXT A;  4AQY L;  1MHW C;  4OWW B;  3MTS A;  4DR6 Q;  2KHS A;  2M2L A;  1L0X B;  1IBL Q;  5ISR A;  2NBF A;  2B2Y A;  1TU2 B;  4P74 A;  2HUG A;  4KLK A;  1WCM G;  3I4N B;  5BN5 A;  5FJ8 G;  1I4P A;  2ENB A;  3ERQ A;  3CCE A;  3A8K E;  2B2T C;  2CQO A;  4R4I A;  1SN8 A;  1N8R C;  1D6E C;  2MPM A;  3J81 E;  2RDF A;  2RCN A;  1HTP A;  3DEP A;  3EBE A;  2E2J H;  1HHV A;  3T53 B;  1BOS A;  2DNE A;  4KJO A;  4WFN 3;  1C4Q A;  2ZJR A;  5D65 A;  4B3S L;  1PTO C;  2CFM A;  1V43 A;  3CU7 A;  3PIP A;  1XTD A;  2K6A A;  1HNZ Q;  4TRD A;  1A2U A;  3T4A C;  1F2M A;  4A3J H;  1HRJ A;  1BR9 A;  1HPC A;  3EQL C;  1YEZ A;  2QEJ C;  3HKS A;  3PF5 A;  4ABN A;  3D3R A;  3BDO A;  4NDX A;  4X3T A;  4JV5 Q;  4RHS A;  1F9R A;  2WIN B;  4RGT A;  4X66 Q;  1BF4 A;  2NZ1 D;  1STH A;  1TWF H;  4Y7N B;  1AFP A;  4IUV A;  3CXC A;  5DNF A;  2Q8T A;  3K80 C;  1NMG A;  3D4D A;  5C0X G;  1H9R A;  3M3Y B;  3E0E A;  1FGU A;  4IN3 A;  3NK9 A;  4CDF C;  1TR5 A;  2Z9H A;  1D5X C;  1W2B A;  1EFW A;  2B2U A;  4KKS A;  4IJH A;  3I3C A;  1E1O A;  1SJH D;  2DNC A;  5IT9 c;  2JN4 A;  2JA6 H;  1SMX A;  1V1P A;  5IP7 G;  1IYJ B;  1K8A C;  4C3I H;  1BO0 A;  2B2W C;  3HS0 C;  5C4X H;  4JI8 L;  2R7Z B;  1HFN A;  1B7Y B;  3A55 A;  2R92 G;  2PYK A;  4P71 A;  3HOU G;  3FMC A;  4NB3 A;  1IKM A;  1EEF D;  4L5Q A;  3MXN A;  2JA8 H;  3BZK A;  4X62 Q;  1RJT A;  3KF8 B;  2UXB L;  1XPU A;  4I65 A;  3E0J A;  3HFZ B;  2F0F A;  2WP8 J;  2H1E A;  3W5O A;  2KCN A;  1IBM L;  1KXL A;  4DR2 L;  2NVY H;  1IYV A;  2PQE A;  5BR8 Q;  2RBM A;  4I7Z C;  2O5I C;  1X9N A;  3NSW A;  2E8G A;  4G57 A;  5FKA C;  2LFN A;  5FLX E;  2E75 C;  2A19 A;  2NVQ B;  3HOZ G;  4XT1 B;  1HJP A;  2XVS A;  3NBH B;  1TWA B;  3PQI A;  2PQA A;  5I2Y A;  3I55 A;  1U4M A;  1PFN A;  3DWQ A;  1VQN A;  3D4R A;  3S2D B;  3K5L A;  1YBY A;  4PV1 C;  3HOW H;  4ZQ3 A;  3BG3 A;  5CBA E;  4LF5 Q;  2UUA Q;  4YY3 Q;  4IUP A;  4A3L H;  4IAL A;  3S1R H;  3HKZ E;  1X6O A;  1CQV A;  1RF2 D;  2DN8 A;  3M7N A;  2WAC A;  2OEO A;  5A35 A;  4LF9 L;  4K2K A;  5KIX A;  4BBS H;  4JI1 L;  1E2Z A;  1I94 Q;  4NP5 A;  1XXG A;  5IIF A;  1SNQ A;  3W2D A;  4K6D A;  3ONA B;  5D3I B;  1D7Q A;  2TSS A;  2JA5 B;  2RDG A;  3D6W A;  3NHH A;  3Q8D A;  1QWY A;  4CBV A;  3QOJ A;  3BZC A;  4IUR A;  4C56 C;  2A68 C;  3VR5 A;  4FNF A;  4KKU A;  4GKJ Q;  1RCV D;  4IFD H;  1WVL A;  4YHH Q;  4LF9 Q;  5IE8 A;  5M5X H;  4A3I B;  1L1O B;  1KNE A;  1UUP A;  5JOB A;  3MA2 B;  4JW0 A;  2ZTE A;  4POG A;  1ESR A;  3NQI A;  3AU7 A;  5LL6 S;  1I50 H;  5DAU A;  3E3X A;  2F0N A;  5AJ3 Q;  1X3Q A;  2MNA A;  4OWX B;  1LTR D;  1HR0 W;  2WII B;  5JAV A;  1NBW A;  5M5X B;  1PV4 A;  4QCL A;  1AE2 A;  2HHH Q;  1TWH B;  4A3D B;  1CA6 A;  3M4Y A;  1D8L A;  3IFD A;  4QIW E;  3OTO Q;  2Q2T A;  1RHP A;  2K4K A;  4XQJ A;  1PTO F;  1PFS A;  2ZM6 Q;  2OWO A;  2LSS A;  3GTQ B;  3H94 A;  1K0S A;  1IW7 C;  3EN2 A;  5FOB B;  5M5Y B;  1X3G A;  2LMC B;  4RMF A;  1C0A A;  4ZUJ A;  1I4Q A;  2OTL A;  3FP9 A;  1N33 Q;  3F2C A;  4JK1 C;  1SMY D;  1H9S A;  5CV4 A;  2VB3 X;  1EYA A;  3UDF A;  2F0G A;  3G4S A;  4XYO A;  1EQV A;  1Q8K A;  1EIF A;  1L1O C;  2V4D A;  3VR3 A;  1CKN A;  1PH9 A;  4RFB A;  1TWC H;  3NTH A;  2I5M X;  1FJG L;  4EQP A;  4XQQ A;  3HOX B;  2SNM A;  2I5L X;  1MJE A;  3S15 H;  5IGE A;  5KND A;  1SND A;  3I4O A;  1VQK A;  4HJ9 A;  2VXW A;  4JI8 Q;  5JVH 3;  3JAM E;  1VQD A;  4GKJ L;  4LUV A;  1VMP A;  2KEE A;  5G3L D;  1PTO H;  4BBR H;  5CV7 A;  3HOW G;  5IY0 A;  1EEI D;  4UP8 A;  1PYW D;  1T5X D;  2PW7 A;  3P7J A;  1VQM A;  4OEM B;  4A3B H;  4OWT B;  4FXD A;  2PI2 E;  1SLJ A;  1U9R A;  2MUY A;  4A93 B;  5EAY A;  2DJG C;  4F7X A;  4OX9 Q;  1Y8O B;  4HID A;  4K5X A;  2A69 D;  1X56 A;  4YCU A;  2HDM A;  4EX5 A;  2ATW A;  4UY8 C;  2L4N A;  1ZYR C;  4A76 A;  1KLG D;  4RWS C;  1ICW A;  1UWV A;  1YNN D;  5EKK A;  3RUZ A;  3UI2 A;  4IJL A;  3OIQ A;  2E5L Q;  3H3V I;  3C1E A;  3I70 A;  5EJW A;  4IFD G;  4DR6 L;  5CV5 A;  3S9W A;  3VYU A;  5M5Y H;  2B2Y C;  2EE1 A;  3QIA A;  1Y1W H;  4CKC A;  1KC8 C;  3CCS A;  1RTO A;  1VQG A;  4ZK9 B;  1HNX L;  1LAC A;  2XRS D;  5M3F G;  1ILP A;  1SNO A;  4ZCK A;  3RLF A;  1FVI A;  2M9V A;  1KD1 C;  2WB1 G;  2R92 H;  3GTK H;  2Q2I A;  1Z9F A;  3KUP A;  4JI3 Q;  3MXN B;  2EQS A;  5ELC A;  2EOT A;  1WTQ A;  1XMQ L;  1LTA D;  3FHW A;  4JOI A;  4LFC L;  3J7Z C;  2A1A A;  5ELE A;  4GNX B;  1JJC B;  2CVR A;  4OHJ A;  2F0I A;  5J39 A;  4QQB X;  1B53 A;  2L9H A;  2K05 A;  2AQ3 B;  2HD3 A;  3IL8 A;  3NXW A;  1K9M C;  1O7Y A;  2F3W A;  1D5Z C;  4K5W A;  1S5C D;  1QCB D;  4A3J G;  4DF7 A;  3PO2 G;  1EUJ A;  4YCW A;  1SEB D;  2I0Q A;  4R4O A;  2OXP A;  4H13 C;  2XTI A;  5ELB A;  1I4X A;  3TN2 A;  3CCL A;  2Z6K C;  5M5W B;  1LTG D;  2IX0 A;  3SK6 A;  2IPK D;  2EJM A;  2D9U A;  1SFO B;  5C3E G;  2DY8 A;  4DPG A;  4XXE A;  2XRQ D;  1Q86 C;  1QE6 A;  2RCF A;  1EFI D;  3K5O A;  4OL7 A;  1PH4 A;  1ENF A;  1NE3 A;  3TME A;  1KRT A;  3CCJ A;  3DEO A;  3CME A;  4DR3 L;  2NVT H;  2KHJ A;  3OMC A;  3GTO B;  1FR3 A;  1SE4 A;  1R9T B;  3DLL A;  3I4M G;  1NNX A;  2J0T D;  4OXP A;  5IGG A;  1PFM A;  4JI3 L;  2JA5 G;  1ICF B;  2IT1 A;  2R7F A;  2AMC B;  1C7Y A;  3K81 C;  4IUU A;  4BWG B;  4PZ7 A;  3OTO L;  1TWG H;  1PZI D;  3GV6 A;  1R9T H;  1SR3 A;  3PO3 H;  1SBB B;  3NBI A;  1RIP A;  1KAW A;  3HOV H;  1DOL A;  3WWV A;  4C3H B;  1IBK Q;  4XT3 B;  4C3I G;  4B3M L;  3TP6 A;  1FL0 A;  1VQE A;  3OMG A;  3HOV G;  4KKT A;  4YY3 L;  1QNU A;  5C3E H;  1Q12 A;  4DR5 Q;  5JJK A;  1G91 A;  4JBM A;  3WOE A;  5A2Q E;  1VQO A;  1RKN A;  2OQ0 A;  3TQY A;  5EGT A;  4DV1 L;  3NP8 A;  3TP8 A;  1GUO A;  1KDA A;  1DM0 B;  3R3O A;  4ULL A;  1BBW A;  1I4H A;  1FNV A;  2JEB I;  4B3S Q;  4DK6 C;  1B9M A;  3TP5 A;  1I6H H;  2ZXO A;  2A68 D;  2SOB A;  2R93 H;  1JIC A;  5CV8 A;  1IL8 A;  4EQ5 A;  3S1N B;  4DUY L;  2Y0S G;  4C2M H;  4Z9C B;  1EY9 A;  2JA6 B;  3HZX A;  3SDZ A;  3CMA A;  2X6L A;  2QEX A;  3KLS A;  2IL8 A;  3CHB D;  4R8N A;  2YTX A;  2K04 A;  1HZ9 A;  1J5E L;  5K36 H;  2F4I A;  3G7L A;  1JC7 A;  4MIU A;  4NXN L;  1A15 A;  4C2M B;  5C44 G;  4O42 A;  1KNA A;  4JI6 Q;  4J6H A;  1IBL L;  1CFM A;  1O78 A;  2Q8I B;  2XWJ B;  3OW7 A;  2NN6 G;  1IL2 A;  1S5F D;  3G71 A;  5IYD G;  1OO9 B;  3N52 A;  1CHP D;  4NXN Q;  2RF4 A;  5C4Z A;  2QCP X;  5JJL A;  3EIV A;  3M4Q A;  3PMF A;  1I3Q B;  4RHR A;  5C5L A;  4PMW A;  1KHI A;  2NZH A;  1MSG A;  3ND9 A;  1N33 L;  1KDC A;  2PZT A;  3H15 A;  4HCE A;  1SAP A;  2RA4 A;  3S1N H;  1M8A A;  4MZ9 A;  4AH6 A;  3MZ5 A;  4FDB A;  1Q3L A;  3A5Z B;  3S14 B;  5KRU A;  1P8L A;  4HAE A;  2XGT A;  4DV2 L;  1XMQ Q;  4X66 L;  2Y0S E;  1HNX Q;  4IUQ A;  3H6M A;  4FVM A;  1XMO L;  1GUS A;  1LTI D;  4GN4 B;  3HOX G;  1HNZ L;  3M4O H;  5IYB H;  4N9T A;  3J81 i;  1CUK A;  1LTT D;  1VQJ A;  2I46 A;  1B3Q A;  2F0H A;  5NUC A;  2K14 A;  3E5S A;  1PHJ A;  1PVO A;  1WI5 A;  4YWK A;  1EY0 A;  4A3E G;  2JP1 A;  2N49 A;  1U4R A;  5LMN W;  2J4X A;  1TY0 A;  3PUY A;  3E9I A;  1Q7Y C;  3D0F A;  4C1N K;  1HQR D;  1X55 A;  1F9Q A;  4G4K A;  3K7A H;  4A3I G;  2AWN A;  4UDU C;  3TEH B;  5GQO A;  2F52 A;  2KA7 A;  4KY7 A;  1S40 A;  3G6E A;  2E2H B;  1W6J A;  3RR5 A;  4B3T Q;  3T1H Q;  1N36 Q;  1HUM A;  3C1F A;  4IUT A;  4OON A;  2CHB D;  5C0X H;  2C5C A;  4DV1 Q;  1JOQ A;  3QOL A;  3VYT A;  3VYR A;  5IP9 H;  3HOY B;  1JOK A;  4Q0F A;  3BU2 A;  5CGK A;  5A2Q L;  3BYY B;  3NPP A;  1BKB A;  3S1R B;  1U0L A;  3QWN A;  5M3M B;  4FXG C;  1I4G A;  1J6Q A;  5I2X A;  1WYD A;  3GTO H;  1MKH A;  2GVA A;  5LMN Q;  3CC4 A;  3I73 A;  1XPR A;  2HCC A;  3TBI B;  2R7Z G;  1LT6 D;  2EY2 A;  2Q8R E;  2OF1 A;  1KLU D;  1ZKO A;  1VQA A;  4QIW B;  4L5R C;  2IW3 A;  4MNO A;  1OXV A;  5CC4 A;  3CCM A;  4A3C G;  3BDC A;  1T9H A;  4KJN A;  1SNP A;  4LFA Q;  4DR3 Q;  3RN2 A;  4A3D H;  3EVQ A;  2NWG A;  2E2J B;  2PW5 A;  3P1H A;  3GQB A;  1OXX K;  5EKI A;  4RG1 A;  3JAM i;  4A3F H;  1VQB A;  2VB2 X;  1V1Q A;  1PZK D;  4GNX C;  2FFK B;  1A0I A;  5JPM C;  3K7U C;  4GS3 A;  2D2C C;  2MGS A;  1IW7 D;  2IHF A;  4X62 L;  4IPD A;  3X3M A;  2AUK A;  4CDD C;  1YHB A;  3I4N H;  4FF1 A;  1YJ9 A;  5I9P A;  1SYC A;  3NEN A;  1D1K A;  3TP7 A;  3AMU A;  1X65 A;  5EPJ A;  5IYC H;  2XIW A;  1WTV A;  4JI0 Q;  1IXR A;  4QY7 A;  4KMU C;  4A3G B;  4BY7 H;  4KK7 A;  4C3J H;  1SYE A;  1VQF A;  4JYA L;  1Q1E A;  2RVL A;  3K58 A;  1K8O A;  2PI2 A;  5L37 A;  1MIU A;  4LW1 A;  4BXX H;  4V0B A;  4LF8 L;  4RCO A;  4G7H C;  3OWE B;  2PNH A;  4B08 A;  1LTB D;  2F0K A;  5AJ3 L;  4C3J B;  1NSN S;  4DAY A;  3OIP A;  2UXD Q;  3F8T A;  4X64 L;  1A62 A;  1ESF A;  2HQE A;  5M9O A;  4KY5 A;  1ET9 A;  2F0D A;  1A8V A;  2B63 H;  1DZ1 A;  1STN A;  3BJU A;  1FD7 D;  3G6J B;  1Z7T A;  3HOW B;  2JYO A;  1SYD A;  4CJ2 C;  1F2Z A;  3QO2 A;  5IGB A;  3S17 H;  3H0G H;  1HH2 P;  2K03 A;  2AKW B;  3A5U A;  4HJ7 A;  1N32 L;  2KBN A;  3PF4 A;  4DK1 A;  4HED A;  2KCM A;  2FMC A;  4PQX A;  4GLA C;  4OO1 H;  3F1Z A;  1NUC A;  1TY2 A;  4AYB B;  4CGY B;  1PFB A;  3JAM c;  2DGY A;  4Y7N H;  5FK9 C;  4BY1 B;  3R8B A;  2ZXP A;  1WTO A;  5FLX L;  5CV6 A;  2E2D C;  2EYJ A;  1Y1W B;  2CKZ B;  4A3M G;  2N78 A;  3Q24 A;  3KLR A;  4QUC A;  1UEA B;  1A3V A;  1EU3 A;  1B50 A;  5IT9 E;  4A3K H;  1EZ6 A;  4NPS A;  1VQL A;  4EQO A;  1O7Z A;  1E22 A;  5FLM H;  1MGS A;  4DN4 M;  4CKE A;  1TS3 A;  3M4O B;  1C9O A;  2MO0 A;  5FLM G;  1KQS A;  3KDF B;  1DYQ A;  1KIX A;  3U58 A;  1HTL D;  1PMR A;  3SEB A;  1TQO A;  1HUN A;  2OTJ A;  5J1Z A;  2VY3 A;  4TQU S;  4JOI C;  1Y69 U;  3VR4 A;  4HCS A;  4PMC A;  3A7A B;  4DNI A;  1X3F A;  1SJE D;  2AHO B;  1S3O A;  3CP0 A;  1GXD C;  4A3D G;  2N88 A;  3GTJ B;  2JA9 A;  2L12 A;  4QB4 A;  1WD0 A;  3PUX A;  1ASY A;  1EY6 A;  3DHQ A;  2G9D A;  2HIV A;  3ND8 A;  1V8Q A;  2VUM G;  5M3F H;  3GTP H;  2NB0 A;  1VF5 C;  2K01 A;  4ZKB B;  3CC7 A;  5GAE C;  3RN5 A;  4HJ8 A;  2A5H A;  3EFX D;  4QJF A;  2CCZ A;  1KL9 A;  3HKZ G;  5C0X J;  1HQM C;  4QGU A;  2EVB A;  5C44 H;  1FNW A;  2B63 B;  1XNQ L;  1LAB A;  2M00 A;  1WTX A;  3WOF A;  4LFB Q;  1B8A A;  1F77 A;  4LAA A;  2R6G A;  3J80 i;  2R3Z A;  3BS1 A;  4F87 A;  1X3P A;  2AQ2 B;  3DWA A;  5M5W H;  5I4D A;  1K83 B;  3M7G A;  2A69 C;  3O13 A;  3L3O C;  3STB D;  1ENC A;  1TWC B;  1QZH A;  4A3B B;  1G51 A;  5HY6 A;  1K3R A;  2ZTC A;  1CT1 D;  3KF6 B;  1QJO A;  1SNC A;  5JPN C;  4A3I H;  2EJF C;  1VQ7 A;  5JEA G;  4M1U B;  3Q0A A;  5I9O A;  1JCK B;  2A6E C;  2I5H A;  2AUJ D;  4AYB E;  1A63 A;  2WAQ G;  4DXG A;  5KNB A;  1Q46 A;  4DUZ L;  3FEW X;  5J3B A;  1Q1B A;  2VZA A;  4PZ8 A;  2NN6 I;  3GTG H;  2EPB A;  5FJ8 H;  1GJX A;  2YU9 B;  5IT9 L;  1EIG A;  5BN4 A;  1Z6H A;  1PTO D;  4R9W A;  2IX1 A;  3F2B A;  3P75 A;  4YCV A;  4CDE C;  1TKW B;  5H1S E;  1B1Z A;  5CMD A;  3H0G G;  2UUC L;  1E0B A;  3A54 A;  4X3K A;  1Y8N B;  4B9W A;  1PYS B;  1ONL A;  4GN3 B;  2JA7 H;  1EQQ A;  3KDF A;  3I7F A;  2YU9 H;  1LLR D;  3FDT A;  1JOR A;  3SGI A;  4DV7 L;  2KQ3 A;  3L2P A;  2N3S A;  3MXP A;  1LYL A;  4JI7 Q;  4YHH L;  5C3E B;  2K28 A;  4MTK A;  1BQQ T;  4GOP A;  1LT5 D;  4IZ8 A;  5BN3 A;  4RH6 A;  3GTL B;  3TS2 A;  1TVX A;  4JBJ A;  3PO3 B;  1MBY A;  1DOK A;  5JEA J;  3K5M A;  4A3J B;  1T5E A;  1JWM D;  3KOJ A;  5EPK A;  4DNT B;  1WFQ A;  5C4J H;  2YV5 A;  4BY7 B;  1HXY D;  4X64 Q;  4C3H H;  4J1M A;  4JV5 L;  4BA2 I;  4GLV B;  4JPB W;  4AYB G;  3PCO B;  1H9J A;  5E4X A;  1WOC A;  4ID6 A;  2JJQ A;  4PNY A;  5COR A;  4K0K L;  1B70 B;  1F9S A;  2KHI A;  1PH2 A;  2FHT A;  1L2F A;  2E74 C;  3NEM A;  1E24 A;  3GTK B;  2R92 B;  3T51 B;  1WD1 A;  4LK1 C;  2RDH A;  4S3S A;  2QIL A;  2L15 A;  1EY7 A;  4JI0 L;  1LTS D;  5IYD H;  2G5D A;  3UDG A;  3VR6 A;  2Q2U A;  5C6A A;  1A6X A;  1YI2 A;  3ITP A;  3V05 A;  3RNU A;  4BBS G;  1BDO A;  2PZW A;  3FKI B;  2PMZ B;  3L0O A;  3J7A 5;  1DXM A;  4WJW A;  5FO7 B;  4KI0 A;  3RMH A;  5KNC A;  4XQN A;  2QW7 A;  1K73 C;  1QOH A;  3M9B A;  2HT1 A;  1Y8P B;  4GKK Q;  3G48 A;  1GOZ A;  1SE8 A;  3U9O A;  1PLF A;  1SE2 A;  4IOA A;  3UE0 A;  1Q81 C;  1NR4 A;  4RAU C;  1J8I A;  2PO4 A;  2EYL A;  1DOM A;  4LF7 Q;  3OOC A;  2F0P A;  3VYS A;  3ZJY C;  2LS0 1;  1TS5 A;  2Y0S B;  4DV7 Q;  1UAP A;  3KLS X;  4WRD A;  2TMP A;  3MEF A;  4OIJ A;  4GZY C;  2SDF A;  2F0V A;  3VA5 A;  5I6Y A;  2Z8L A;  1QVC A;  3HP3 A;  3NBH A;  3V96 A;  3S2H H;  1EU4 A;  1ILQ A;  4L5T A;  3T1Y Q;  5GAD C;  3CW2 C;  2L11 A;  2JA8 B;  3NTK A;  3CQZ B;  5G3L F;  4TVA B;  1K8M A;  1AH9 A;  3V2T A;  4EGV A;  2ES2 A;  3MEH A;  2KVM A;  2VNU D;  1VQ8 A;  5ELO A;  2MQH A;  2DJF C;  1Z47 A;  1PRT B;  1STE A;  2BE5 D;  1AW7 A;  2Z6B A;  3W1G A;  3S16 H;  4H7B A;  4A75 A;  4L63 B;  3IKJ A;  1M90 C;  2WB1 E;  5TSS A;  5DM7 3;  1JB7 A;  4ALP A;  1L1O A;  2D62 A;  4P2C B;  2PNR C;  5M3F B;  2CQA A;  1CK1 A;  3NE5 B;  3I4M H;  4RCN A;  2JA7 G;  1Q90 A;  1JWU D;  4X65 L;  3K5N A;  5C0X I;  1BBX C;  4B9X A;  2X69 A;  4GNX A;  3LGJ A;  1PDQ A;  3NUC A;  5IP9 G;  1OXS C;  3GDE A;  2QDL A;  3DMU A;  4DGZ A;  1WCM B;  2JK8 A;  5C44 B;  2K33 A;  2B39 A;  3MC0 B;  5HGT A;  1AZP A;  5M3M G;  1GVP A;  1VQ5 A;  2EDG A;  1JWS D;  2K7V A;  2Z0S A;  1RTN A;  1BNZ A;  2QA4 A;  3AB9 A;  4DXF A;  4RGM A;  4A3E H;  5K5P A;  1BCP F;  1GKH A;  1WCM H;  2KCC A;  2DUD A;  2VQF L;  1SDF A;  2GA4 B;  3FKI H;  2WAQ B;  4HMI A;  5ELF A;  1LT4 D;  1IZ6 A;  4KN4 C;  1OXU A;  2BOS A;  4QUF A;  5KYI A;  3Q6S A;  1U5K A;  4DAV A;  3S1Q H;  1KTK A;  1G8Z D;  2YTY A;  5CR3 A;  1XMO Q;  1TS2 A;  1EYG A;  1FNU A;  3I91 A;  1QG7 A;  3K8A A;  4OGQ C;  4BBS B;  3OWF A;  2EJG C;  3Q23 A;  4BXX G;  1N32 Q;  1LTL A;  1V9P A;  4A3M B;  1I50 B;  1LUZ A;  2MJ8 A;  1CZG A;  3JC6 6;  2R93 G;  3GP7 A;  3WDN A;  3HGB A;  4K2L A;  2BDO A;  4DV0 L;  3PIO 3;  1K8G A;  4X65 Q;  1NJI C;  3HOV B;  2H4O A;  2R7Z H;  4LMQ D;  5GAH C;  3CKI B;  3AEV A;  1CZW A;  1HA5 A;  2OT2 A;  4A3F B;  1X54 A;  4DV6 Q;  3P20 A;  2R61 A;  2CH4 A;  2WKD A;  3OPO A;  3GTQ H;  4DR1 Q;  2RSN A;  1STG A;  4AQY Q;  3U4V A;  3J80 L;  2NUC A;  3SK4 A;  2HHH L;  1Q8I A;  3J7A F;  4DV4 L;  1YIT A;  3SHL A;  3D6C A;  2LXK A;  1CKM A;  4JI6 L;  2WB1 B;  3CCV A;  3CCR A;  5E7N A; 
#chains in the Genus database with same CATH homology
 4YY3 Q;  3UE1 A;  4A3L H;  3S1R H;  3HKZ E;  2R7Z G;  1X6O A;  4OO1 G;  1XPO A;  4LF6 Q;  1VQA A;  4L5R C;  2MFI A;  4UP9 A;  4MNO A;  3KFU A;  1OXV A;  3M7N A;  4DR1 L;  3CCM A;  1YHA A;  4A3C G;  4JC0 A;  2YYZ A;  1T9H A;  1UE5 A;  4LF9 L;  4LFA Q;  4DV3 Q;  4BBS H;  3NEL A;  4DR3 Q;  2K75 A;  3RN2 A;  4A3D H;  4JI1 L;  1I94 Q;  4A3L G;  1N9W A;  1OXX K;  1GM5 A;  1HNW Q;  4RG1 A;  3JAM i;  4A3F H;  1VQB A;  3HOX H;  5JJI A;  1D7Q A;  4KHP Q;  4LF4 Q;  4ME3 A;  2R7D A;  1V1Q A;  3PUV A;  1K83 H;  3Q8D A;  4GNX C;  1QZG A;  2UU9 Q;  1XNR L;  1A0I A;  1JE5 A;  3BZC A;  1OTC A;  3K7U C;  4JBW A;  4J15 A;  3PGZ A;  4GS3 A;  1VQI A;  4BA1 I;  4GKJ Q;  1CKO A;  3ERS X;  1Q82 C;  1PH3 A;  1XNQ Q;  2IHF A;  1E7Z A;  4X62 L;  4YHH Q;  4IPD A;  4LF9 Q;  5IE8 A;  2ZTD A;  5M5X H;  1L1O B;  4JI4 L;  1YHB A;  3OW2 A;  3I4N H;  2V1C C;  1N34 Q;  1YJ9 A;  2ZTE A;  4BY1 H;  4DK3 C;  1VQC A;  3NEN A;  4POG A;  4IFD J;  4NXM Q;  4IO9 A;  1I50 H;  1X65 A;  1XJV A;  5AJ3 Q;  4GN5 A;  5IYC H;  4OWX B;  3PSI A;  2MNA A;  4JI0 Q;  1IXR A;  4QY7 A;  1HR0 W;  5IYB G;  1UEB A;  3A0J A;  4UP7 A;  1NBW A;  5GAG C;  4BY7 H;  4C3J H;  5LMN L;  4DV4 Q;  1PV4 A;  3PO2 H;  1VQF A;  1YJN A;  4JYA L;  1AE2 A;  1HR0 Q;  3HOU H;  1Q1E A;  1J5E Q;  1E1T A;  2HHH Q;  1JJG A;  2C35 B;  4X6A H;  1SRO A;  2PI2 A;  4DV0 Q;  1D8L A;  1MIU A;  4QIW E;  3OTO Q;  4DUY Q;  2Q2T A;  2K4K A;  3HOY H;  4LW1 A;  4BXX H;  4LF8 L;  1PFS A;  2ZM6 Q;  2OWO A;  2LSS A;  3KJP A;  2F4V L;  4DR4 L;  2PNH A;  1QVG A;  1YJW A;  5AJ3 L;  4L5S A;  2UXC L;  2UXD Q;  3EN2 A;  4IPC A;  3F8T A;  4R4T A;  4X64 L;  2ID0 A;  1A62 A;  1WJJ A;  1X3G A;  3I2Z A;  4BY7 G;  2ZJP A;  4RMF A;  2UU9 L;  4GOP B;  1NMF A;  1XNR Q;  4OX9 L;  1A8V A;  1M1K C;  2B63 H;  2JA8 G;  1C0A A;  3ULL A;  3BJU A;  1ASZ A;  5BR8 L;  1PH8 A;  3J81 j;  2OTL A;  2BH2 A;  1HNW L;  3FP9 A;  1N33 Q;  4A4I A;  3F2C A;  3H0G H;  3UDF A;  3S17 H;  1HH2 P;  1JJ2 A;  3CPW A;  2AKW B;  3A5U A;  4HJ7 A;  3G4S A;  1N32 L;  2NZO A;  2H5X A;  2KBN A;  1RL2 A;  3U4Z A;  2JQO A;  3CPF A;  3PF4 A;  2KCM A;  4JI2 L;  5HGQ A;  1Q8K A;  5GRO A;  1KRS A;  4GLA C;  3F1Z A;  1EIF A;  1L1O C;  1EQR A;  3JAM c;  1CKN A;  2DGY A;  2JE6 I;  4Y7N H;  3AFP A;  1PH9 A;  1TWH H;  1TWC H;  2I5M X;  4DV3 L;  1EWI A;  1FJG L;  4OO1 I;  3TRE A;  4BBR G;  4NXM L;  1G6P A;  5ELN A;  2IY5 B;  2I5L X;  1MJE A;  1X3E A;  2CKZ B;  4A3M G;  2N78 A;  1UE1 A;  3T1Y L;  3S15 H;  4A3G H;  1VCI A;  3I4O A;  2OQK A;  1VQK A;  4HJ9 A;  1N34 L;  4JI8 Q;  4A3M H;  1CSQ A;  4P73 A;  3S24 A;  4HJ5 A;  3F2D A;  3RZO H;  4JYA Q;  4A3C H;  3TS0 A;  5K36 G;  2VW9 A;  1JT8 A;  2JA5 H;  4PZ6 A;  4A3K H;  1VQD A;  1PH7 A;  4GKJ L;  4LUV A;  3AYH B;  2VQE Q;  4NPS A;  1VQL A;  1QUQ A;  4BBR H;  1NY4 A;  4P75 A;  1E22 A;  4LNQ A;  5FLM H;  3HOW G;  5IY0 A;  4UP8 A;  4A3F G;  3RZD H;  1C9O A;  1VQM A;  4DUZ Q;  2MO0 A;  4LF5 Q;  5FLM G;  1KQS A;  3KDF B;  1K0R A;  2UUA Q;  1KIX A;  4LFC Q;  3U58 A;  4LF7 L;  4OWT B;  4A3B H;  4XIG S;  2PI2 E;  4A3B G;  1SLJ A;  2OTJ A;  2VY3 A;  4TQU S;  1E3P A;  5EAY A;  4JOI C;  4OX9 Q;  1SFO H;  1LM0 A;  1IBM Q;  3HOZ H;  4DNI A;  2FXQ A;  4HID A;  2VL6 A;  4GKK L;  1QUQ B;  1X3F A;  2AHO B;  1S3O A;  1X56 A;  3CP0 A;  1EOV A;  4YCU A;  3CD6 A;  4A3D G;  1BVS A;  2JA9 A;  4GOP C;  3A74 A;  4LFB L;  3PUX A;  1ASY A;  3PUZ A;  4EX5 A;  3KLW A;  4JI5 Q;  2ATW A;  2HIV A;  2HIX A;  4UY8 C;  5M3F H;  2VUM G;  3FKI G;  3GD7 A;  4A76 A;  1I3Q H;  3GTP H;  3D31 A;  3AFQ A;  1UWV A;  4O0A A;  5GAE C;  3CC7 A;  3RN5 A;  4A3G G;  4HJ8 A;  4IJL A;  4DAY B;  3K0X A;  4QJF A;  2CCZ A;  1KL9 A;  3HKZ G;  2E2H H;  5C0X J;  2E5L Q;  1VQ6 A;  3H3V I;  3ICE A;  4IFD I;  4IFD G;  4DR6 L;  1Y1W H;  5M5Y H;  4QGU A;  5C44 H;  1KC8 C;  3S14 H;  2Z6K A;  2HQL A;  1XNQ L;  3CCS A;  1VQG A;  4LFB Q;  4Y52 H;  1B8A A;  2BA0 A;  2E2I H;  1HNX L;  1L0W A;  5M3F G;  2EXD A;  2R6G A;  3J80 i;  4HIO A;  4WJ4 A;  4YWM A;  5IWA L;  2JEA I;  3RLF A;  1FVI A;  5M5W H;  5IYC G;  4JI2 Q;  2ALY B;  2BH8 A;  3J81 c;  3STB D;  1KD1 C;  2WB1 G;  2R92 H;  3GTK H;  2Q2I A;  1SRU A;  1QZH A;  1G51 A;  1Z9F A;  1P16 A;  4JG2 A;  5HY6 A;  1K3R A;  2ZTC A;  4LUO A;  3CF5 A;  4JI3 Q;  3MXN B;  3KF6 B;  4JI1 Q;  1H95 A;  2EQS A;  4HIK A;  1Y1V H;  2B3G A;  4A3I H;  1VQ7 A;  1I5F A;  5JEA G;  1XMQ L;  4JOI A;  3FHW A;  3J80 c;  2I5H A;  1PH6 A;  3DM3 A;  4LFC L;  2ASB A;  4AYB E;  3J7Z C;  2YTV A;  4IOC A;  1PYB A;  2WAQ G;  1A63 A;  4DUZ L;  1Q46 A;  2A1A A;  4JCV E;  3T1H L;  5J3B A;  4GNX B;  4LF4 L;  2A8V A;  1JJC B;  1Q1B A;  2RHQ B;  4APV A;  5IWA Q;  2VZA A;  4MTN A;  1GD7 A;  4QQB X;  3KJO A;  4PZ8 A;  4UPA A;  2NN6 I;  3GTG H;  5FJ8 H;  1YIJ A;  3L7Z C;  1G29 1;  1TXY A;  1K9M C;  2F4V Q;  2K52 A;  2E5L L;  4DR2 Q;  4QL5 A;  1O7I A;  3UDI A;  3F2B A;  2NVX H;  4DR5 L;  4YCV A;  4JI7 L;  4A3J G;  5H1S E;  2IX1 A;  3PO2 G;  3H0G G;  3U50 C;  2UUC L;  1EUJ A;  1HZB A;  4YCW A;  4DR7 L;  4YWL A;  2I0Q A;  4R4O A;  2UUA L;  5C4X G;  1PYS B;  2XTI A;  4GN3 B;  3CCL A;  2JA7 H;  2Z6K C;  1IBK L;  4B3M Q;  1EQQ A;  2UXB Q;  2IX0 A;  3KDF A;  3I7F A;  2YU9 H;  2MO1 A;  4JI5 L;  3RLO A;  4A93 H;  3UDX A;  4LFA L;  4HIM A;  3SGI A;  5C3E G;  1YNX A;  4P72 A;  4DPG A;  4DV7 L;  3L2P A;  2OCE A;  4DV5 L;  2N3S A;  1LYL A;  3VDY A;  1VQ9 A;  4KHZ A;  3ULP A;  1Q86 C;  4JI7 Q;  3GTJ H;  4YHH L;  4LWC A;  2NVQ H;  4GOP A;  1PH4 A;  1EIY B;  1NE3 A;  3M85 A;  3HOY G;  2ZJQ A;  3CQZ H;  1TWA H;  1KRT A;  3CCJ A;  4POF A;  2QGQ A;  1VQ4 A;  3PO3 G;  3CME A;  4DR3 L;  2NVT H;  2KHJ A;  1Y14 B;  3TS2 A;  3S2D H;  4JBJ A;  3DLL A;  3I4M G;  5JEA J;  3W1B A;  3KOJ A;  1W3S A;  4A93 G;  1HZA A;  1WFQ A;  5C4J H;  2YV5 A;  4KHP L;  5LMU L;  4B3R Q;  2UXC Q;  4X64 Q;  4C3H H;  4OXP A;  4A3K G;  4JI3 L;  2CWP A;  1Y1V G;  2JA5 G;  4JV5 L;  4BA2 I;  2IT1 A;  4GLV B;  2R7F A;  2AMC B;  4AYB G;  3PCO B;  1C7Y A;  3K81 C;  1HZC A;  1PH1 A;  1CKN B;  1WOC A;  4PZ7 A;  3OTO L;  1TWG H;  2JJQ A;  2KCT A;  1R9T H;  1MJC A;  2PMZ E;  1SR3 A;  4IPG A;  4K0K L;  2UUC Q;  3PO3 H;  3GO5 A;  1B70 B;  2KHI A;  1RIP A;  1KAW A;  1PH2 A;  2UUB Q;  1L2F A;  2JA6 G;  3HOV H;  3NEM A;  1E24 A;  3WWV A;  2UXD L;  1IBK Q;  4B3M L;  1FL0 A;  2VUM H;  3ER0 A;  1VQE A;  3HOV G;  2K5V A;  2GN5 A;  2B29 A;  2L15 A;  4YY3 L;  1S72 A;  4JI0 L;  1FJG Q;  5C3E H;  1QVF A;  5IYD H;  3UDG A;  2K50 A;  1Q12 A;  4DR5 Q;  5M3M H;  2Q2U A;  4DR7 Q;  5JJK A;  4JBM A;  4AQY L;  1VQO A;  4OWW B;  4DR6 Q;  2Q2H A;  3TQY A;  2OQ0 A;  4DV1 L;  4JBK A;  1IBL Q;  4R1J A;  1VQP A;  1YI2 A;  4P74 A;  3RNU A;  4BBS G;  2CWA A;  4KLK A;  4BY1 G;  3PUW A;  1WCM G;  1BBW A;  2KEN A;  3L0O A;  3J7A 5;  5FJ8 G;  1UE6 A;  4KI0 A;  3GTL H;  3KF6 A;  1K73 C;  2JEB I;  5LMU Q;  4B3R L;  4B3S Q;  4DK6 C;  3M9B A;  3CCE A;  2HT1 A;  1Y1W G;  5DLQ E;  1I6H H;  3CCU A;  3G48 A;  2VQE L;  4GKK Q;  2CQO A;  1SE8 A;  1SN8 A;  4R4I A;  1N8R C;  2R93 H;  4IOA A;  1I94 L;  5FLX c;  3UE0 A;  1Q81 C;  2RCN A;  4EQ5 A;  2F3I A;  3EBE A;  4O2D A;  4DUY L;  2Y0S G;  2D0P A;  4C2M H;  2E2J H;  4LF7 Q;  2ZJR A;  3ZJY C;  4B3S L;  3CMA A;  1NTG A;  2QEX A;  4DV7 Q;  2CFM A;  3IRB A;  3PV0 A;  1V43 A;  2YTX A;  2B63 G;  1HZ9 A;  3MEF A;  1J5E L;  3PIP A;  4DKA C;  4R4Q A;  1XTD A;  4NXN L;  1QVC A;  1HNZ Q;  1YHQ A;  3S2H H;  2RHS B;  4JI6 Q;  5C44 G;  3CCQ A;  1IBL L;  2UUB L;  4A3J H;  4L5T A;  3T1Y Q;  5GAD C;  3CW2 C;  4TVA B;  1AH9 A;  1YEZ A;  2ES2 A;  3HKS A;  2NN6 G;  3PF5 A;  1IL2 A;  2VQF Q;  2VNU D;  3G71 A;  5IYD G;  4DV6 L;  5ELO A;  1VQ8 A;  2MQH A;  1Z47 A;  3S16 H;  3W1G A;  3S1M H;  4JV5 Q;  1GO3 E;  2PQA B;  4A75 A;  4NXN Q;  1M90 C;  2RF4 A;  2WB1 E;  4AIM A;  1JB7 A;  4ALP A;  4X66 Q;  1L1O A;  2D62 A;  3EIV A;  3M4Q A;  5JJL A;  1TWF H;  4GLX A;  3CXC A;  4K0K Q;  3I4M H;  4PMW A;  2JA7 G;  4JI4 Q;  2IHE A;  4HJA A;  1PH5 A;  1KHI A;  2NZH A;  4X65 L;  5C0X I;  3K80 C;  1NMG A;  1DGS A;  5C0X G;  4B3T L;  1OXT A;  2WAQ E;  3LGJ A;  4GNX A;  1N33 L;  3H15 A;  4DR4 Q;  5IP9 G;  3GDE A;  1OXS C;  3E0E A;  1FGU A;  3S1N H;  3GTM H;  4MZ9 A;  4AH6 A;  3TRZ A;  4FDB A;  2JK8 A;  1W2B A;  1EFW A;  3A5Z B;  1HR0 L;  4DV5 Q;  1UE7 A;  5M3M G;  1P8L A;  2D0O A;  4IJH A;  1GVP A;  2VS1 A;  3ULJ A;  1E1O A;  2XGT A;  1VQ5 A;  4DV2 L;  5IT9 c;  1XMQ Q;  2BA1 A;  4X66 L;  2Y0S E;  3RLN A;  2Z0S A;  1HNX Q;  3M4P A;  2QA4 A;  2JA6 H;  1XMO L;  1SMX A;  5IP7 G;  1IYJ B;  4A3E H;  2LXJ A;  1K8A C;  4C3I H;  4GN4 B;  1PA6 A;  3HOX G;  5C4X H;  1HNZ L;  4LF5 L;  3M4O H;  5IYB H;  1GKH A;  1WCM H;  4JI8 L;  4LF8 Q;  3CC2 A;  1CSP A;  2DUD A;  3CAM A;  3FKI H;  3J81 i;  1B7Y B;  1CUK A;  2VQF L;  2R92 G;  1VQJ A;  4P71 A;  3HOU G;  3KYH C;  3STB C;  4DAM A;  1IZ6 A;  1OXU A;  2K14 A;  4NB3 A;  4L5Q A;  4LF6 L;  1U5K A;  1PHJ A;  2JA8 H;  1PVO A;  3BZK A;  4X62 Q;  1WI5 A;  3S1Q H;  4PG3 A;  4YWK A;  3KF8 B;  2UXB L;  2YTY A;  4A3E G;  2N49 A;  1XMO Q;  5IP7 H;  5LMN W;  1XPU A;  3I4N G;  4WJ3 M;  1EYG A;  1VQH A;  1N36 L;  2WFW A;  3K8A A;  3HFZ B;  2WP8 J;  3PUY A;  3E9I A;  1Q7Y C;  3W5O A;  3D0F A;  4BXX G;  1N32 Q;  4XTC S;  1X55 A;  1JMC A;  1LTL A;  1V9P A;  1IBM L;  1KXL A;  3K7A H;  1LUZ A;  4DR2 L;  4A3I G;  2AWN A;  2AWO A;  2NVY H;  3TEH B;  3JC6 6;  5GQO A;  2F52 A;  2R93 G;  5BR8 Q;  3H3V H;  1AE3 A;  3OYY A;  2N8N A;  3G6E A;  1S40 A;  2GVB A;  3AQQ A;  1VS0 A;  3RR5 A;  4DV2 Q;  4B3T Q;  3T1H Q;  3M3Y H;  4DV0 L;  1X9N A;  1N36 Q;  1K8G A;  4X65 Q;  1YVC A;  4OON A;  4DV1 Q;  1NJI C;  1BBU A;  2E8G A;  3E9H A;  5IP9 H;  2ZM6 L;  2R7Z H;  5GAH C;  3AEV A;  2A19 A;  3BU2 A;  1X54 A;  4DV6 Q;  3B6Y A;  1BKB A;  2K5N A;  3HOZ G;  4LUZ A;  1HJP A;  1U0L A;  3GTQ H;  4DR1 Q;  3NBH B;  2PQA A;  4AQY Q;  3U4V A;  3I55 A;  4R4C A;  1J6Q A;  1VQN A;  1WYD A;  3CCR A;  3GTO H;  1MKH A;  2HHH L;  2GVA A;  5LMN Q;  1YBY A;  4DV4 L;  1YIT A;  3CC4 A;  1YZ6 A;  2K5H A;  1CKM A;  2LXK A;  4IPH A;  3PIO A;  4JI6 L;  3HOW H;  3CCV A;  3I56 A;  4H02 A;  2EIF A;  5E7N A;  1XPR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...