4DR2L

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with multiple copies of paromomycin molecules bound
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
124
structure length
123
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
total genus 14
structure length 123
sequence length 124
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4dr2L00
1WOCA 1N36L 1RL2A 5K36G 4X62Q 1IBKQ 3PF5A 1N9WA 2CQOA 5LMNL 4DK6C 4OXPA 4NB3A 1QVFA 3KLWA 2JJQA 4DPGA 2UUBQ 3KJOA 1VCIA 4GNXA 1X54A 4DV2Q 2UXCL 4YY3L 4LF6Q 2YYZA 3CMAA 1K9MC 1HR0L 3TEHB 1X56A 2C35B 4QL5A 4DV7L 1YHBA 2Z6KC 4X64L 4R4OA 3TS0A 3I4MG 4PZ8A 5M3MH 4DR3L 1Q81C 1PH3A 2I5LX 1L1OA 1NE3A 3D31A 3CCMA 2CCZA 4IFDI 1E22A 1WI5A 3CMEA 1FJGQ 2NZHA 1EIFA 3U58A 1K8AC 4HJ7A 1HNZL 4LFBQ 3KF8B 3H0GH 1IBLQ 4HIKA 1H95A 2R6GA 1SLJA 4K0KL 3U4VA 4BA1I 1WYDA 5ELNA 4HIDA 4J15A 4NXNQ 3W5OA 3KJPA 4HIOA 1Y1VH 5C3EH 3S2DH 1Z9FA 2K5NA 1VQFA 4IJHA 2Q2HA 3ULJA 4X62L 1IBKL 5GAGC 5IT9c 2VQFQ 4JOIA 1YNXA 1JJGA 1PV4A 4X6AH 1IBMQ 2UUBL 2D0PA 4DV2L 5JEAG 2H5XA 3NBHB 4IOCA 4LF6L 4DK3C 2K50A 1JB7A 2CKZB 4L5SA 2NVYH 1XNRQ 4JBJA 4NPSA 2Y0SE 4YWMA 2CWAA 2VUMH 4DR7Q 5IP9G 2HQLA 2L15A 4OO1I 2JEAI 4JC0A 2JQOA 2YTVA 1X3EA 1FJGL 3PUYA 1VQHA 4LFBL 1XPOA 4A3EH 4JG2A 4O2DA 1IBLL 1MJCA 3F1ZA 3K81C 5M5XH 1D8LA 1E7ZA 1PH8A 3H3VH 4NXNL 3OW2A 4YWKA 3PUVA 2IY5B 2AWNA 4C3HH 1OXVA 4A3IG 4DR2Q 2BH8A 2UU9Q 3S14H 1YHAA 2VQFL 1W3SA 2A8VA 1KIXA 2PQAB 2D0OA 2VS1A 1IBML 1A63A 3G6EA 4JI5L 1VQLA 1EOVA 3RLFA 4DUZL 1P8LA 3GTPH 3CXCA 4A3JH 4LF5Q 2JA7H 3M4OH 4WJ3M 3ZJYC 1XNRL 4RG1A 4IO9A 5IE8A 4DR7L 3FKIH 4B3MQ 3T1YQ 2JA9A 1HZAA 4NXMQ 1G6PA 4IPDA 3GTLH 1LM0A 4BY7G 5C4XG 1A0IA 1WCMH 5C44G 5FLMG 2GVAA 1CKOA 4LF4Q 4LW1A 4A93H 1AH9A 4MNOA 3HOUH 2N3SA 2ZTCA 4A3KH 1HZBA 1G291 1LYLA 4UPAA 2XGTA 4RMFA 5H1SE 4DV0L 4HJ8A 3M3YH 5M3FH 3SGIA 5FLXc 4DR2L 1B7YB 3GD7A 3DLLA 2UU9L 3D0FA 3J80c 3TRZA 2K4KA 4XIGS 4JV5Q 1XPRA 2HHHQ 2OQKA 2VZAA 3KYHC 1QUQB 4A3CH 3CD6A 3F2DA 4C2MH 4IPHA 2GVBA 3AEVA 3HOXG 3L0OA 2R92G 3PV0A 5C0XG 1VQJA 1LUZA 3K7AH 3OYYA 3HKZE 4LF5L 5LMNW 5IYDH 1AE3A 2NZOA 1PYBA 3ER0A 4B3ML 5C0XJ 3HOZH 3T1YL 4NXML 2KBNA 3CP0A 4YWLA 1X3FA 5FJ8H 1NBWA 2IHFA 4JI7Q 1QZGA 1HZCA 5JJIA 1NMGA 1Z47A 4R4TA 4DR5Q 3VDYA 4A3GG 2XTIA 1HR0W 2HIVA 1N33L 1M90C 4LF4L 3U50C 2F4VQ 2E2HH 4L5TA 3GTQH 4B3RL 1CSQA 1MKHA 2KHJA 3BZCA 3HOYG 1AE2A 4GS3A 1B70B 1JMCA 2NVQH 1OXUA 2JA5H 4OONA 3CCQA 2AHOB 2VUMG 5IYBG 4X65Q 4QQBX 4LUOA 4JV5L 1KQSA 1WFQA 2HHHL 4WJ4A 3FHWA 3MEFA 1T9HA 1UWVA 2F3IA 3J7A5 3J80i 1U5KA 3H15A 1NMFA 3ERSX 3ULLA 2ZJRA 2UUCQ 4A3MH 5DLQE 5IP7G 4LFCQ 4DV5Q 2B63H 1VQGA 3ICEA 5M5YH 4C3IH 4DR5L 1J6QA 2AMCB 2KENA 4KLKA 3K7UC 3B6YA 3U4ZA 2ES2A 2F4VL 4GKJQ 1ASZA 1X9NA 1M1KC 4POGA 4GN5A 1PH6A 4PG3A 4LUVA 4A4IA 2V1CC 3CCVA 1N8RC 3L7ZC 1Q46A 4X65L 4A76A 1EWIA 4IOAA 1O7IA 5E7NA 3PIPA 4HJAA 1HJPA 4UP9A 1YJ9A 4A3GH 2JEBI 1Y1WH 1Q12A 1WCMG 4QGUA 4L5RC 2Q2TA 1HZ9A 1SN8A 1S3OA 3M4QA 2JA6G 2WB1G 4GOPC 2K5VA 1OXTA 4FDBA 4DNIA 2OTJA 3KF6A 1JE5A 1XMOQ 2YV5A 2UUCL 4DV4Q 3T1HQ 4TVAB 2ID0A 3HOVG 4Y52H 1I6HH 4LFCL 2GN5A 4DV5L 1CUKA 5HY6A 5IYCH 3PCOB 2OQ0A 3BJUA 2I0QA 3CC2A 2E8GA 4A3FH 3PO3G 2Z0SA 4BY1G 1GD7A 1GKHA 3FP9A 3S24A 2KHIA 4X66Q 3JAMc 1YBYA 2E5LQ 2JA8H 3S17H 4A3CG 4GKJL 4BBRG 3A5UA 4PZ6A 4JI1Q 4R4IA 2BA0A 4IJLA 2IX1A 4GN4B 3S1QH 1U0LA 1VQ6A 1K0RA 3F2CA 3PO2H 4A3DH 1YJNA 1EIYB 1PH7A 3I4NG 1SE8A 2R93H 1KAWA 1SFOH 4ALPA 1PVOA 3TREA 1N32Q 4JCVE 2CFMA 5FJ8G 4GNXC 3TS2A 2R7ZH 1C0AA 2JE6I 2FXQA 2PI2A 2RHQB 4QJFA 4IPGA 3J7ZC 1PYSB 4HIMA 3MXNB 1VQBA 3UE1A 1VQ7A 3W1GA 2ZTEA 3I2ZA 4A3BH 4GLVB 1TWHH 3PUWA 1XMOL 4DV4L 3T1HL 1EFWA 1L1OC 1Q8KA 3STBC 5C0XI 3TQYA 3CF5A 3HOWH 4BBSH 1K8GA 3CW2C 4DR6Q 3M85A 4YCVA 4GOPB 2E5LL 1TWGH 2MO1A 4X66L 1IYJB 4LNQA 1XPUA 4IFDJ 4JBKA 2F52A 4JI1L 2ATWA 2WB1E 2YU9H 3BU2A 1XJVA 4UY8C 3NENA 4QY7A 2KCTA 4JI0Q 3JAMi 1KL9A 1W2BA 3CCSA 3RZOH 1V1QA 1CKNB 2MNAA 4JOIC 1YZ6A 2ZTDA 1X6OA 2OWOA 4DV3Q 3I4MH 1N32L 3KOJA 1XTDA 1K3RA 1VQOA 2Q2UA 4DUYQ 3KDFB 1GVPA 2Q2IA 4GLAC 4UP7A 1IZ6A 5M3MG 1DGSA 4KI0A 2A1AA 3A0JA 1UE5A 1ASYA 3GTMH 2VNUD 1BVSA 1VQNA 4GNXB 4C3JH 3NEMA 1Q7YC 3H0GG 4DR6L 1S72A 3RLNA 3H3VI 3S16H 2LSSA 3K0XA 2NN6I 3BZKA 1X55A 1L0WA 1Y1VG 5C3EG 4DR4Q 1Y1WG 4GKKQ 2UXBQ 3PIOA 2VY3A 3CC4A 1L1OB 5JJKA 3GDEA 3G71A 4AYBG 1QVCA 2BH2A 2Z6KA 2OCEA 3PSIA 4MTNA 4JI0L 1PFSA 2BA1A 4DKAC 4OWWB 1XNQQ 2NVTH 1UE6A 1NJIC 2WP8J 3E0EA 3JC66 4P72A 4LFAQ 5IP9H 1RIPA 3UE0A 4DV3L 1EYGA 3CCLA 4LF9Q 1E1OA 3A5ZB 5IYCG 2VW9A 2LXKA 4BXXH 1HH2P 1G51A 2MO0A 5ELOA 4A3FG 1YI2A 3CCEA 1QZHA 3PUXA 4P75A 4L5QA 4LUZA 5IWAQ 2DUDA 2QGQA 3S1RH 2AKWB 2PQAA 3DM3A 1PH2A 1P16A 1IXRA 1I5FA 1X65A 1CSPA 4YY3Q 2IX0A 3UDFA 4B3SQ 1VQ8A 4A3EG 4KHPQ 3HKSA 1A8VA 1J5EQ 1OXSC 4X64Q 3J81j 4A3IH 4LF8Q 5M5WH 3HOWG 1HNXQ 4AQYQ 4MZ9A 1MJEA 1PH1A 2QA4A 2NN6G 2R7ZG 4DR4L 4GKKL 1KC8C 2UXBL 1I3QH 1YEZA 3EBEA 3AFPA 4JI7L 2HT1A 2RHSB 4JYAQ 5GAHC 1X3GA 2YTYA 3CC7A 1KHIA 2K5HA 1XMQQ 4JI6Q 3GTKH 2WFWA 1YHQA 2WAQG 1XNQL 2ZJPA 2MFIA 3CPFA 3I4OA 4YCWA 3IRBA 4PZ7A 1R9TH 2HIXA 5GQOA 2CWPA 2RCNA 4DAMA 2R7DA 4A3JG 1JJ2A 1VQ9A 4LF9L 5C4XH 1VQ5A 2JA7G 4BY7H 1Q1EA 2B29A 5C44H 5FLMH 3FKIG 5IWAL 4DV1Q 1QUQA 1Y14B 4DV6Q 1CKMA 4AYBE 3A74A 4POFA 4O0AA 5GADC 2K52A 3CCJA 3CCUA 3KFUA 4B3SL 3J81c 4KHPL 2ALYB 3E9IA 4JBWA 1J5EL 1E3PA 4A93G 4LF8L 3HOUG 3M4PA 2OTLA 1VQIA 4A3KG 4P74A 4AQYL 1HNXL 1SROA 3AQQA 4Y7NH 3G4SA 3I56A 1Q86C 1VQCA 4EQ5A 4JYAL 3L2PA 5M3FG 3CAMA 2N8NA 1JT8A 2JK8A 1VQ4A 4JI6L 4A3LH 4R1JA 1C9OA 3HOXH 2ZM6Q 1XMQL 2R92H 4DAYB 1TWAH 4A75A 1WJJA 3UDGA 1UE1A 4JI3Q 1KRTA 1JJCB 1K73C 1UEBA 2KCMA 3RNUA 4B3TQ 3GTOH 3PUZA 2E2IH 2ZJQA 5GAEC 1SR3A 1NY4A 1FGUA 2UUAQ 5IYDG 2UXDQ 3AFQA 3HOZG 5BR8Q 4DV1L 4DR1Q 3S2HH 4DV6L 4OWTB 3GO5A 2MQHA 1EQRA 3K8AA 1BKBA 2WAQE 1LTLA 4JI2Q 4JI5Q 4DUZQ 2IHEA 1Q82C 3WWVA 1OXXK 4OX9Q 3HOYH 4BA2I 3OTOQ 2RF4A 2I5MX 1MIUA 2D62A 4P71A 5JEAJ 1EQQA 1VS0A 1TXYA 1K83H 1V43A 2LXJA 3AYHB 5IYBH 1TWFH 1EUJA 1SMXA 1PH9A 1GM5A 1OTCA 3J81i 2K75A 4BXXG 5HGQA 2JA5G 3K80C 1B8AA 5EAYA 4IFDG 1PH4A 3PGZA 2ZM6L 4HJ5A 1FL0A 4JI3L 1KRSA 1N34Q 1QVGA 4LF7Q 1HNWQ 1A62A 3HKZG 3RLOA 4B3TL 3Q8DA 5LMUQ 5IY0A 4DV0Q 5IP7H 5GROA 2EQSA 3UDXA 3ULPA 2ASBA 2UUAL 5AJ3Q 2IT1A 2UXDL 4ME3A 1D7QA 5BR8L 4A3MG 4DR1L 3I55A 2VQEQ 4OWXB 4KHZA 1BBWA 2B63G 4JI2L 3GTJH 3LGJA 2EXDA 1FVIA 4XTCS 4OX9L 1VQPA 2R7FA 3EIVA 2N49A 3OTOL 1VQKA 4H02A 3M7NA 4AIMA 2VL6A 3W1BA 1YIJA 3STBD 4GLXA 4OO1G 2PI2E 4EX5A 4R4CA 4GN3B 5J3BA 4JBMA 1IL2A 2JA6H 1S40A 1N33Q 3NELA 1VQEA 4YHHQ 3CCRA 1PHJA 4JI8Q 1YITA 1N34L 1Q1BA 2YTXA 4LF7L 3HFZB 2N78A 3CQZH 2E2JH 4B3RQ 1HNWL 2AWOA 4PMWA 5LMUL 3HOVH 1I94Q 4JI4Q 2I5HA 3F2BA 1YJWA 4YCUA 1GO3E 3S1MH 5AJ3L 2NVXH 2B3GA 3PO3H 1BBUA 4BY1H 2A19A 4LWCA 1VQMA 1E24A 4BBRH 2VQEL 1VQDA 3F8TA 4DUYL 1N36Q 4AH6A 4A3LG 3RR5A 1TWCH 2EIFA 5LMNQ 3M9BA 3CPWA 2JA8G 3I4NH 1NTGA 3GTGH 2PNHA 1SRUA 3KF6B 4IPCA 2UXCQ 5JJLA 3PO2G 3G48A 1KD1C 2DGYA 4QIWE 4A3DG 3EN2A 1HR0Q 2QEXA 1KXLA 2R93G 3PF4A 1V9PA 4DV7Q 4GOPA 2K14A 3RN5A 4DR3Q 4YHHL 1L2FA 3S15H 4JI8L 4APVA 3I7FA 5C4JH 1E1TA 3S1NH 1I94L 1PH5A 3E9HA 4HJ9A 1I50H 1PA6A 3UDIA 1HNZQ 4JI4L 1C7YA 3RN2A 1CKNA 1UE7A 4A3BG 2PMZE 4K0KQ 1VQAA 4P73A 4UP8A 4LFAL 4TQUS 4R4QA 3RZDH 1YVCA 2Y0SG 3KDFA 4BBSG
chains in the Genus database with same CATH superfamily
1RL2A 3MEHA 5K36G 2PZTA 4X62Q 5LMNL 4OXPA 3KLWA 1VCIA 2DNCA 2ZXOA 1K9MC 3S9WA 1HR0L 3V2TA 1ILPA 2K32A 3TS0A 1I50B 4XQNA 3VA5A 1F9QA 1NE3A 5G3LD 1FJGQ 1EIFA 3U58A 1K8AC 3KF8B 3H0GH 2R6GA 4MIUA 1WYDA 4HIDA 4EQOA 1HFGA 2K5NA 5CGKA 4RA8A 4QIWB 4LK1C 2Q2HA 3AMUA 4HMIA 2VQFQ 2N55A 3R93A 3C1FA 5M5YB 4X6AH 1IBMQ 2UUBL 3BYTB 2H5XA 2BDNA 4LF6L 2K50A 1KTKA 4L5SA 4QMGA 1XNRQ 4JBJA 2F0QA 4K8IA 2F0WA 1F9SA 2B2WC 4XQQA 2JEAI 3K6OA 2JQOA 3CRLC 2K5WA 3PUYA 4A3GB 3I3CA 1EOTA 4EQPA 1BBXC 2EYFA 2N88A 4NXNL 4HCSA 3O13A 1ENAA 1MGSA 2AWNA 1IW7D 4DR2Q 5NUCA 2UU9Q 1YHAA 3JAML 2PW7A 2M2LA 2NVYB 1ZYRC 2PQAB 4C1NI 2KCCA 3RLFA 1HRJA 2JA8B 1P8LA 3GTPH 3NWSA 5D3IB 4RG1A 4ZAIA 1CTMA 5IE8A 2WKCA 4IO9A 4DR7L 3T1YQ 2JA9A 1HZAA 5E4XA 4N8X1 4IPDA 1G6PA 1LM0A 4BY7G 4DAYA 2R7ZB 3RMHA 4MNOA 4GZYC 3OW7A 3I72A 4HN7A 1G291 2DJGC 4ILWA 1B7YB 1EEID 1B2TA 3J80c 4G57A 1D2BA 1XPRA 4BBSB 2OQKA 2A74C 2VZAA 4A3JB 3KYHC 1QUQB 4A3CH 3SK4A 3F2DA 2E74C 1BCPC 3LWUA 1I4PA 1QILA 2BCOA 1AE3A 2NZOA 1X3FA 1NBWA 1HZCA 5FLXL 1WTHA 2JN4A 5CV9A 2F4VQ 4X3TA 1TVXA 3U50C 4L5TA 3TSSA 1O80A 4KY7A 1JMCA 2NVQH 1OXUA 2JA5H 1NUCA 4IFDH 1T5XD 4C3JB 2ENBA 4BWGB 4QQBX 5FKAC 1A3UA 4WJ4A 3FHWA 1T9HA 1CQVA 5COYA 1F9PA 3S16B 3J80i 5J22A 1Q8IA 3H15A 1NMFA 1HHVA 5IP7G 4LFCQ 5A2QE 2J4XA 1PRTF 3ICEA 4C3IH 1EZ8A 4DR5L 2AMCB 2KENA 2Q8RE 5I4DA 2ES2A 2MUYA 3PIP3 4LUVA 2RVLA 1N8RC 2F3VA 1WD1A 4OELB 4FVMA 1O7IA 4ZCKA 4UP9A 1Y1WH 1SNQA 1WCMG 2C5CA 5M5WB 1AP0A 2Q2TA 1HZ9A 4OEMB 4JPBW 4KMUC 3KUPA 2B2YA 2B63B 2EYMA 2UUCL 3HOVG 1GUGA 2GN5A 1CUKA 3PCOB 1R9TB 4PNYA 2I0QA 4BY1G 1GKHA 3FP9A 3JAMc 1ILQA 4GKJL 1H9RA 3HG9A 1Y8NB 2BE5D 3D4RA 4BBRG 4JI1Q 1PTOD 2EOTA 5C44B 3S1QH 1U0LA 1K0RA 1HQMC 2K6AA 4DN4M 3J81L 4CKCA 3I4NG 3W3AA 4MHEA 2R93H 3RUZA 1SFOH 4ALPA 4JCVE 1SYFA 3J7ZC 3I2ZA 4KD3A 4A3BH 4Z9CB 1XMOL 4K14A 3HOXB 3T1HL 1Q8KA 3GV3A 5C0XI 1T5EA 5K36H 4GOPB 2E5LL 3PO2B 4LNQA 3ERQA 2ATWA 2WB1E 2LS01 3S2HB 3JAMi 2DN8A 2MNAA 3HOYB 3DUZA 5CV4A 1STEA 1K3RA 2CW0D 3KDFB 1TWHB 4DF7A 2F4IA 1IZ6A 3HP3A 1U4MA 4XDXA 3E3XA 5CR3A 2A1AA 1YNJD 5CBEE 2VNUD 3HZXA 1I4RA 5JAVA 3H3VI 3SK5A 3OSOA 4DR4Q 4FYDA 2WINB 5ELDA 2F0OA 2MP1A 2Z6BA 3F2UA 4IN3A 2OCEA 5G3LF 4DKAC 1J9OA 3NUCA 1F2MA 3E0EA 1JOQA 1RIPA 2F0TA 5A35A 3L9AX 2MO0A 4ZKCB 3PUXA 3S1RH 4LUZA 1B4OA 1JWUD 2JA6B 5BN4A 2PYKA 2EJMA 1IYVA 4K5XA 5CV5A 1BR9A 3BDCA 1GUTA 4K6LA 5FOBB 1WTWA 2L11A 4HAEA 4AQYQ 1TU2B 4G4KA 1F2YA 1B3AA 4RGNA 2R7ZG 3S1MB 2UXBL 4JYAQ 3PO3B 2RHSB 3CC7A 1X3GA 2K5HA 1HA6A 3VR4A 3GTKH 1YHQA 2WAQG 2ZJPA 4IUUA 1Q90A 1SXTA 1SDFA 5GQOA 4A3JG 4DAMA 2R7DA 4BY7H 1VQ9A 5EKLA 1Q1EA 3NXWA 4X3SA 2QKIC 3A74A 3CCUA 4B3SL 3J81c 4KHPL 4IUVA 3E9IA 4JBWA 3BVMA 1F77A 5C4JB 3HOUG 1HNXL 3A56A 2IX3A 1Q86C 1EQVA 5M3FG 5KGUA 1D1IA 4JI6L 4R1JA 3RZDB 1EY5A 4A75A 1UE1A 4JI3Q 4IQZA 4DAPA 1K73C 1UEBA 2KCMA 5CBAE 3OMGA 5C4XB 4RAUC 2E2IH 2HCCA 1MD2D 4OIKA 1NY4A 2UUAQ 5IYDG 3CKIB 1YNNC 1V1PB 4DV1L 5ELBA 3DWAA 4DV6L 3E6ZX 3KK7A 4OWTB 1AEXA 2KEEA 1EQRA 2MQHA 1LTLA 4I7ZC 5M3MB 3QG1A 2IHEA 5FO9B 3DM1A 2A6EC 2I5MX 2B2TA 5JEAJ 4OGQC 1EQQA 3FPUB 4CDFC 1V43A 2B8GA 5BN3A 3P7JA 3J81i 4BXXG 3DEOA 1EWCA 1SSOA 3PGZA 1PH4A 3GTOB 2PZWA 4XYQA 3BZDB 5C3EB 1KRSA 4LF7Q 1A62A 4B3TL 4K2KA 3OWEB 5IY0A 5IP7H 2EQSA 2F0LA 5AJ3Q 2JYOA 4ME3A 2B2YC 1LTID 4H44C 3SDZA 4DR1L 1SYDA 4OWXB 2ICEC 4KHZA 2B63G 4JI2L 3GTJH 2B8FA 2LFNA 1VQPA 5KNBA 1RDPD 3A55A 2EYJA 3W1BA 2NUCA 3Q22A 2CVRA 3PIO3 4GLXA 4EX5A 4R4CA 2K5QA 2F0DA 5J3BA 1FNUA 4JBMA 1IL2A 1S40A 1N33Q 1VQEA 3V96A 4YHHQ 4C3HB 3J7AV 3HFZB 3CQZH 3S14B 4PMWA 3HOVH 1BNZA 3K57A 3F2BA 2B3GA 4BY1H 1H9SA 1SNOA 4LWCA 1VQMA 1EQTA 2VQEL 4BBRH 2I07B 1TWCH 2Q8TA 4PQXA 2EIFA 2WACA 3M9BA 3A7AB 5LMNQ 3I4NH 4RGOS 1K8MA 1LTSD 1I4QA 2PNHA 3KF6B 4IPCA 3PO2G 3G48A 4A93B 1HR0Q 3A8JE 1HXYD 1V9PA 3H6MA 2K14A 3CRKC 1XX8A 1MI2A 3RN5A 1ENCA 4CDCC 4APVA 1FGBD 2KJXA 1W6JA 1PH5A 2L0CA 1I50H 1DOLA 4JI4L 1PTOF 1CQFA 2F0IA 4ZUIA 5A2QL 2PMZE 2OF1A 4XQJA 4KK7A 4GN3B 1G2SA 3HOWG 1A15A 1WOCA 1HTLD 1N36L 4ZYSA 2SNMA 3VR5A 3PF5A 3QIAA 4HSVA 1QCBD 1UEAB 4DPGA 1AZPA 2UUBQ 4GNXA 1GXDC 5I9PA 4LF6Q 3CMAA 3TEHB 5EPLA 4DV7L 1YHBA 5D65A 1V1OA 1Z7TA 4NDXA 1L1OA 2CCZA 4IFDI 1WI5A 4HJ7A 3NP8A 4HIKA 4OL7A 3U4VA 5ELNA 5DM73 3KJPA 4HIOA 4NXNQ 3S2DH 1WTRA 4IJHA 3ULJA 1IBKL 5GAGC 3WDNA 1YNXA 1JJGA 3CU7A 1PV4A 2D0PA 4DV2L 3NBHB 4IOCA 4CJ1B 2EXZA 4DK3C 4MN3A 2CKZB 2NVYH 2VUMH 3I91A 2CWAA 2PMZB 5J1ZA 4DR7Q 1A6XA 2HQLA 2L15A 2A68C 2L4NA 1SNCA 4JC0A 3D6WA 1LLRD 3D4WA 1LO5D 4HR7B 4LFBL 1XPOA 4JG2A 4O2DA 2AUKA 3F1ZA 3K81C 3DMUA 5M5XH 1PH8A 3H3VH 3E0JA 3LX0A 3OW2A 1LT4D 1JQYD 2BH8A 4DNRB 1KLUD 3TMEA 1I6HB 4R8NA 2A8VA 4HCEA 4IUQA 2D0OA 1A63A 1VQLA 3NTKA 4A3JH 3M4OH 1XTCD 4WJ3M 5KIXA 4A3DB 3VR6A 3GTLH 1V8QA 2G9HD 5C4XG 2Z9HA 4DK1A 3QR8A 5I9OA 1AH9A 3HOUH 1ESFA 1LYLA 4RGTA 4HJ8A 1IL8A 2G9DA 2H1EA 5M3FH 2BOSA 3I4LA 3D0FA 2K4KA 2K5DA 3Q24A 3NQTA 4IPHA 2GVBA 1CT1D 3AEVA 1STGA 2KHSA 1VQJA 5EKKA 4LF5L 2K04A 3HKZE 5FO8B 1HTPA 1KDAA 5IYDH 3ER0A 2EYLA 1G6ZA 5FK9C 4YWLA 4JI7Q 1QZGA 1Z47A 4R4TA 3T51B 1E2WA 4DR5Q 1O7YA 1N33L 1M90C 4LF4L 2E2HH 3K59A 1CSQA 1AE2A 1K8OA 4YIJA 3OIPA 3BDOA 2F1MA 4I7AA 4JV5L 1WFQA 3A54A 3K7AB 2RSNA 1EIGA 3SR1A 2A69D 1PFNA 3ULLA 2UUCQ 5E1FA 1O78A 5DLQE 2NVTB 3HRZC 4C3HG 1BCPB 2B63H 3GTQB 4WJWA 1IYUA 2PCFB 3B6YA 4IURA 4GKJQ 1FR3A 1JORA 1X9NA 4GN5A 1PH6A 3P20A 2D5DA 4KY5A 2V1CC 3CCVA 2E76C 4V0BA 3EA6A 5I2XA 5EPKA 3HKZB 3W2DA 4A76A 1GOZA 1YJ9A 4HJAA 3TZUA 2HUGA 2A6HC 1FNVA 4QGUA 4A3MB 1OXTA 1PTOH 3SEBA 1NR4A 4LJZC 1XMOQ 1DOMA 1SMYD 3T1HQ 1PRTC 5IYCH 3DWPA 3I8ZA 4A3FH 1HUNA 2Z0SA 4K5WA 2E5LQ 2KHIA 3KLRA 1PDQA 1S5ED 4R4IA 2BA0A 2IX1A 1SYCA 3U9SA 3PO2H 2EY6A 1YJNA 1SE8A 5IGBA 1KAWA 4CKBA 3TREA 2M9VA 5FJ8G 4GNXC 3TS2A 2FXQA 2PI2A 4QJFA 5LL6S 3UE1A 1VQBA 4Y7NB 4K5VA 4WRDA 4HMJA 1TWHH 3T53B 4ME5A 1L1OC 1D1KA 1EFWA 1TWAB 3S17B 3HOWH 4FO2A 1K8GA 3CW2C 1KDCA 1K3BC 2RDFA 2MO1A 2KUMA 1IYJB 4IFDJ 2YU9H 5BN5A 5I6WA 1KAAA 3RZOH 1YZ6A 3H91A 1BXTA 1X6OA 1MSGA 1PMRA 1GJXA 1N32L 2Q2UA 4F7XA 1TWFB 4UP7A 2F0JA 3SK6A 3GTMH 5KRUA 1TWGB 1H9JA 2EVBA 1Y8OB 3DEPA 3FMCA 2HQEA 2JP1A 1S72A 4RCNA 3RLNA 1SYBA 3K0XA 1LTAD 3BZKA 1NAPA 1LV9A 4N9TA 2UXBQ 1EU4A 5JJKA 1LTRD 3PIOA 2VY3A 2SEBD 4N9PA 3I4MB 1QVCA 1R4PB 4JI0L 4OWWB 1I4XA 1QOHA 2DJFC 2F0HA 4LFAQ 1Q3LA 1E1OA 1SYEA 4PV1C 5DM63 2VW9A 3BYYB 1HH2P 5ELOA 3VYRA 1YI2A 3IAYA 1KLGD 1MHWC 2AKWB 3Q23A 2J0TD 2IX0A 3NHHA 4TRDA 4B3SQ 4A3EG 1I6VC 4KHPQ 3HKSA 2E2JB 3P75A 3QOLA 1Y69U 4IUTA 1HNXQ 3PMFA 4MZ9A 4GKKL 1I3QH 2CH4A 3GQBA 4JI7L 2HT1A 2NVXB 1DZ1A 1CM9A 5GAHC 2YTYA 2P5ZX 4JI6Q 3R8BA 1QNUA 2WFWA 2K33A 1XNQL 4DXGA 2NB0A 5AFWA 4FP5D 3T4AC 4BS9A 4ODGA 5EPJA 2M00A 2HIXA 4LF9L 2JA7G 2CQAA 5C4XH 3GTGB 2B29A 3FKIG 3PQIA 5IWAL 4DV1Q 5IGEA 4DV6Q 1CKMA 4AYBE 1DM0B 5GADC 3SXHA 4C56C 3KFUA 3S15B 2ALYB 4RH6A 1TY2A 1E3PA 4LF8L 2OTLA 3S1NB 4A3KG 2MJ8A 4P74A 2EJFC 3AQQA 3I56A 2K1BA 1JOKA 3L2PA 2N8NA 2JK8A 1VQ4A 4DAYB 1KABA 1WJJA 2SDFA 3Q6SA 1KRTA 1JJCB 4B3TQ 3GTOH 3PUZA 2ZJQA 1SR3A 1IW7C 1FGUA 1PXUA 3AFQA 2WKDA 3IL8A 2IJ0A 1BOSA 4DR1Q 2EZVA 1SNMA 1NSNS 3GO5A 1LT5D 4JI2Q 4DUZQ 3SVMA 3MWYW 3H3VC 2D62A 1K83H 1PZJD 2LMCB 1DONA 1SMXA 3H0GB 5KNDA 1PH9A 2K75A 3EVQA 1B8AA 4RKLA 5EAYA 5C5MA 3D4DA 2ZM6L 1STYA 3MVVA 5HGTA 3HKZG 4AYBB 3Q8DA 3TP5A 4DV0Q 5CV7A 3UDXA 3ULPA 1WTVA 1WTXA 2ASBA 1E2ZA 2IT1A 5KNCA 2UXDL 5JPNC 3C2PA 5BR8L 3NPPA 4A3MG 2VQEQ 2PZUA 3GV6A 4MTKA 1CHQD 4XTCS 2EY5A 2N49A 1VQKA 2EYPA 3ZYYX 3K5MA 4H02A 3M7NA 1CZWA 3STBD 1SEBD 1EZ6A 1H9KA 4OO1G 1JB3A 2EJGC 1HUMA 3CCRA 1PHJA 4A3GG 1YITA 1N34L 1Q1BA 2YTXA 3QB3A 5C6AA 2AWOA 4CDDC 2B39A 2OXPA 1LT6D 4JI4Q 3K5OA 1S5BD 3VYUA 3QJYA 3P1HA 3AB9A 1B1ZA 1VQDA 3F8TA 1N36Q 4A3LG 3MXNA 3CPWA 2FMMA 2JA8G 4IALA 1NTGA 2RSOA 4NP5A 1HA5A 2LKVA 4F87A 3L3OC 1SRUA 2O4XA 3LNNA 2QDBA 2WB1B 2DGYA 3EN2A 2QEXA 1EY0A 1TY0A 2E75C 4DV7Q 1IKMA 2CH4W 2CHBD 4L6TB 1RTNA 1E1TA 4ZLTF 3E9HA 2TSSA 5D3DA 1CKNA 2IPKD 1VQAA 1UAPA 4LFAL 1RODA 4BBSG 2L55A 1TS3A 4KKSA 3TP6A 1IBKQ 2CQOA 4DK6C 1QVFA 1UNSA 4DV2Q 1CK1A 1EYCA 2QF7A 1X56A 2C35B 4QL5A 1LT3D 1HFNA 3I4MG 1ENFA 2R3ZA 2NVQB 2BE5C 5EJWA 2I5LX 3U9OA 1EYAA 3D31A 5EBCA 1ZEQX 3CCMA 1PTOC 3V05A 3VYSA 4DA2A 2NZHA 1HNZL 2XN9C 4LFBQ 4ULLA 1H95A 3D3RA 5L37A 4K0KL 3NTHA 4C3JG 4PMCA 2I46A 3VA7A 1VMPA 1VMCA 4JOIA 3A8KE 2DY8A 4C3IB 1CZGA 4NPSA 2Y0SE 1H9MA 1NCVA 2KOLA 3GP7A 1EYDA 1S5CD 1STBA 2YTVA 1AN8A 1X3EA 3KBGA 2ZT9C 4J8QA 4A3EH 1Y1VB 1Y1WB 1IBLL 1MJCA 1E7ZA 3A7LA 1D5XC 2IY5B 3PUVA 2CW0C 1OXVA 5M9OA 4HEDA 1W3SA 1YNJC 1KIXA 2VS1A 3G6EA 5IT9E 3LWEA 1EOVA 1STHA 4DUZL 3CXCA 3R2TA 2F0FA 4LF5Q 2JA7H 3ZJYC 3S1QB 3FKIH 4KD4A 2AQ1B 2Z4IA 2ZXRA 2R93B 1SFOB 1WCMH 1G8ZD 1FYCA 5C44G 2GVAA 2MHVA 4LF4Q 1O7LA 1MBYA 2L5TA 2O5JC 1VF7A 2N3SA 2ZTCA 4A3KH 2KA7A 4UPAA 5H1SE 2XGTA 4DV0L 4A3BB 3C3LA 1CA5A 3SGIA 1STNA 5DEHA 1SYGA 3GD7A 3TRZA 2Y0SB 1I4GA 4XIGS 4JV5Q 5DAUA 3NBHA 4C2MH 4RWSC 2XWJB 1SAPA 3HOXG 3PV0A 3K7AH 4ZRZA 5LMNW 1PYBA 4UHVA 4B3ML 1M4VA 5C0XJ 2O5IC 4NXML 2KBNA 3CP0A 2A73B 2IHFA 5JJIA 1NMGA 1HR0W 2HIVA 1A3VA 1EY9A 3M3YB 4FF4A 3GTQH 1MKHA 2KHJA 3BZCA 4ZK9B 3HOYG 3QWNA 5JJZA 3NWTA 2RBMA 1KQSA 1EL0A 2HHHL 3MEFA 3NK9A 1UWVA 1LTGD 4JK1C 2F3IA 3J7A5 3HOZB 5E3FA 3OIQA 3ERSX 2KEDA 2K7VA 4A3MH 1B9NA 1DD2A 5EKIA 5M5YH 1G91A 3TN2A 3X3NA 4KLKA 3T13A 2F0MA 3C1EA 2B2UA 4POGA 4OO1H 4EGVA 4DGZA 2Q8IB 1Q46A 4X65L 2RCFA 1EWIA 5E7NA 3PIPA 4A3GH 1HJPA 5EQ0A 2JEBI 4L5RC 3M4QA 1SN8A 1S3OA 2JA6G 2WB1G 4FDBA 4DNIA 2F03A 2NYZD 2YV5A 3GTKB 1W6KA 2ID0A 4TVAB 1NR2A 4Y52H 1WTOA 4DV5L 5HY6A 2EYOA 3CC2A 1RD9D 2E8GA 3PO3G 3S24A 5IGGA 2DNEA 3S17H 2JA8H 4A3CG 4DNTB 4BY7B 1VDZA 4PZ6A 2MGSA 4CHTB 1VQ6A 1X32A 4KTAA 1EIYB 5TSSA 3H94A 5CC4A 2LY7A 1J8IA 1PVOA 1H9SB 1N32Q 2CFMA 1C0AA 2R7ZH 2JE6I 1AZQA 2V4DA 4IPGA 3ND9A 2IL8A 1NNXA 1VQ7A 4XT1B 2ZTEA 3CHBD 4H13C 1C8CA 2Z8LA 4WORA 4DV4L 2G5DA 5D14A 3TQYA 3CF5A 1PFMA 4BBSH 4RFBA 3NSWA 1DXMA 3M85A 1XWEA 2J7ZA 4YCVA 3X3MA 1TWGH 4X66L 2E2IB 4JBKA 4R8IA 1PRTB 1JR0D 3BU2A 1XJVA 4UY8C 3NENA 1F9RA 4QY7A 2KCTA 3KF8A 4JI0Q 1W2BA 1V1QA 4JOIC 2RDHA 3I4MH 1XTDA 4DUYQ 1GVPA 3MXGA 2Q2IA 4GLAC 2KECA 2B2TC 1DGSA 5M3MG 3K0YA 1U4RA 4KI0A 1EIHA 3A0JA 1ZYRD 1BVSA 3HS0C 1VQNA 4GNXB 4C3JH 4JVZA 1Q7YC 4DR6L 1SNDA 4J1MA 3S16H 2NN6I 1X55A 1Y1VG 5C3EG 4GKKQ 1Y1WG 3CC4A 1L1OB 3GDEA 3AU7A 2Z6KA 3PSIA 3NTIA 4S3SA 1XNQQ 1PFSA 2BA1A 3GTJB 1UE6A 2WP8J 4DV3L 4P72A 1ML0D 3UE0A 3CCLA 2EY2A 4LF9Q 4JW0A 2LXKA 4BXXH 1DOKA 1G51A 5DNFA 2FHTA 4HTHA 2NTTA 1TT2A 2GA4B 4L5QA 5IWAQ 1WD0A 1Y8PB 2DUDA 2QGQA 4B9WA 2PQAA 3UI2A 1P16A 1CSPA 2Z1CA 1BCPD 2F0KA 1SBBB 4YY3Q 5JOBA 3UDFA 3CQZB 4CGYB 4X64Q 4LF8Q 3HOVB 5M5WH 3MHBA 3BS1A 2PPBC 3RD4A 1MJEA 1QB5D 1PH1A 1TS2A 2NN6G 1KC8C 1YEZA 3AFPA 2F0NA 2X6GA 1XYIA 2MFIA 1A2TA 5EBDA 4YCWA 3IRBA 4PZ7A 1WTPA 1TWCB 1R9TH 3HGBA 4L63B 1RF2D 2RA4A 2XSCA 2CWPA 2RCNA 1JJ2A 1VQ5A 2ICIA 3R2IA 5C44H 4OHJA 2F0UA 2E2DC 1QUQA 4UDUC 4POFA 4A3IB 2WV6D 4O0AA 3CCJA 5FO7B 1PLFA 1J5EL 4A93G 3M4PA 2WIIB 4XXEA 5EGTA 2MPMA 4RGMA 3G4SA 4EQ5A 2XNAC 3CAMA 2ZM6Q 1XMQL 3HOXH 4QUFA 1S4ZA 4QUCA 2QEJC 5CYUA 3UDGA 3RNUA 2HCIA 5KYIA 1KNAA 3OOCA 4M1UB 2UXDQ 3R3OA 3HOZG 5BR8Q 3S2HH 2L9HA 4JI5Q 3K8AA 2WAQE 2Z4HA 4Q0FA 5T1GA 3HOYH 2XRSD 4BA2I 1OXXK 4L8JA 3G6JB 2XWBB 4P71A 1TXYA 2LXJA 4LMQD 2R92B 1OTCA 2B2UC 1GM5A 1B44D 3SE0A 1FD7D 1JOOA 2NWGA 3MFGA 4HJ5A 5IT9L 3NE5B 3S2DB 3OHXC 3SK8A 1N34Q 1TQOA 3KBXA 3RLOA 1JE4A 4M8AA 5GROA 5LHY1 3G7LA 3J7AF 4ZKBB 3TP7A 3I55A 1DYQA 2L1BA 4NMZA 1BBWA 2VUMB 3FPPA 1SE3A 2EXDA 1FVIA 2EYHA 5E4WC 1X3QA 4OX9L 2R7FA 3OTOL 2DY7A 5K5PA 3EFXD 1SNPA 4AIMA 2VL6A 2PI2E 5M5XB 2PQEA 2JA6H 1RJTA 3NELA 4B3RQ 1HNWL 1F2ZA 5LMUL 2WAQB 1D6EC 3IFDA 2I5HA 1BF4A 4RKBA 1GO3E 3S1MH 3PO3H 1BO0A 3J7YW 1QJOA 1HPCA 3M4OB 3M7GA 2AQ2B 4DUYL 3FDTA 5JVG3 1DCZA 3GTLB 2A69C 2VB2X 4DXFA 4HSPA 1KD1C 1A3TA 4A3DG 1CFMA 3HOUB 3PF4A 1TS5A 4GOPA 4B08A 1E0BA 1C48A 3QO2A 3FEWX 1L2FA 4JI8L 5M3FB 1FNWA 5C4JH 4R9WA 2K05A 1M8AA 1I94L 4F88A 3FVQA 1HNZQ 3OMCA 3TBIB 3RN2A 4QF4A 2F0SA 4K0KQ 4P73A 1MSHA 3RZDH 1QVGA 5CV8A 3KDFA 3TP8A 1SJHD 1N9WA 1LTTD 4NB3A 2JJQA 5HURA 3KJOA 1SMYC 1X54A 4N8FA 2UXCL 4YY3L 3T56B 2YYZA 2E2HB 2Z6KC 4X64L 1OO9B 4R4OA 2EDGA 4PZ8A 5M3MH 4DR3L 1Q81C 3BG3A 1PH3A 2KQ3A 1U9RA 1E22A 2VXWA 3CMEA 2K01A 1IBLQ 1SLJA 4BA1I 1GHJA 1IHZA 4J15A 4CJ0B 3W5OA 1E2VA 1Y1VH 5C3EH 1Z9FA 1UUPA 1VQFA 3ONAB 4X62L 4C1NK 5IT9c 3SHLA 5JPMC 2FMCA 1GUWA 5JEAG 1TKWB 1JB7A 3N52A 4YWMA 1ET6A 5IP9G 4OO1I 1EY7A 5KEEA 1FJGL 1VQHA 1D8LA 1RCVD 5ELFA 1ESRA 4ABNA 1G2TA 2NN6H 1PTOB 4YWKA 4C3HH 3VR2A 4A3IG 4K2LA 4F8MA 3S14H 1YNND 2VQFL 4KN7C 3E5SA 1IBML 4A3FB 4JI5L 1Z6HA 2HDMA 2A6ED 4EVOA 1BCPF 1EY4A 1XNRL 3I90A 4B3MQ 4NXMQ 2VB3X 1A0IA 5FLMG 1EWHA 1CKOA 4LW1A 4A93H 2OEOA 1VF5C 4X3UA 1HZBA 2EY1A 4RMFA 1JWSD 3OWFA 3M3YH 2NZ1D 5FLXc 4DR2L 3DLLA 4QB4A 1V1PA 2UU9L 4G7OC 3HOWB 5IOCA 2HHHQ 3GTPB 3CD6A 2H4OA 5CMDA 3L0OA 2R92G 5C0XG 2TMPA 1LUZA 3OYYA 3MAQA 1QWYA 1LACA 2YU9B 2QW7A 2D2CC 4CBVA 3HOZH 1DJRD 3T1YL 3RZOB 5I2YA 1C4QA 4ZUJA 5FJ8H 4IUNA 3VDYA 2XTIA 2HDLA 1B3QA 3DHQA 4IUPA 4KV6A 4B3RL 4PMBA 2NTSA 4GS3A 1B70B 1KDBA 4FF2A 3GTMB 4OONA 3CCQA 2AHOB 2VUMG 1S5FD 5IYBG 4X65Q 4LUOA 2F0PA 4RHSA 3J80E 2X6LA 1U5KA 4NW2A 1PZID 1S5DD 3ITPA 1K28A 4EQNA 2ZJRA 3C46A 4DV5Q 1QNKA 1VQGA 4XYOA 3BVZA 1J6QA 3K58A 4O1NA 3K7UC 2SOBA 2F4VL 3U4ZA 2A5HA 1ASZA 1XXGA 4CKEA 2JA5B 3MZ5A 1M1KC 4PG3A 4A4IA 3EQLC 3L7ZC 4G7HC 2K28A 3MC0B 1AW7A 2OT2A 4IOAA 1K0SA 5LL6X 1Q12A 3DXJC 4G7ZC 3MXPA 1JC7A 2JSOA 4GOPC 2K5VA 1I3QB 4TKOB 4DAVA 2OTJA 4U673 3KF6A 2F3WA 1JE5A 3K5NA 3I70A 5ELEA 4DV4Q 1BDOA 1I6HH 4LFCL 1RTOA 4IZ8A 4B9XA 5ELCA 4DU9A 1TIID 2OQ0A 3BJUA 1GD7A 4X66Q 1YBYA 3A5UA 4IJLA 2KVMA 4GN4B 3F2CA 4A3DH 1PH7A 2BDOA 1GUSA 1F2LA 1L0YB 5C5LA 2QILA 3Q0AA 4DK0A 3ND8A 1CA6A 2RHQB 4HIMA 4KN4C 1PYSB 3MXNB 1TR5A 3W1GA 2B2VA 4GLVB 1HQRD 3PUWA 4TSSA 1U4LA 5IIFA 3STBC 5C3WA 4DR6Q 2F0EA 2PNRC 3BVGA 1SE4A 1EY8A 4LAAA 1XPUA 3IFTA 2A68D 2F52A 4JI1L 1HCZA 3EROA 3EJIA 3JAME 2HD3A 1X3PA 1O7ZA 1KL9A 3CCSA 5I6YA 1CKNB 1EU3A 2ZTDA 2PW5A 1RKNA 4DV3Q 2OWOA 1JWMD 3KOJA 2XIWA 2IWHA 1VQOA 3OPOA 1A2UA 1K83B 4V190 2C9OA 3T16A 2XRQD 4KJNA 3I73A 1UE5A 1ASYA 2RQXA 1PFBA 1JCKB 5ISRA 1GUOA 1JICA 3NEMA 1EEFD 1U4PA 5C3XA 3H0GG 2XVSA 3N6RA 4J6HA 2LSSA 2IW3A 2FJ2A 1B53A 1L0WA 3VR3A 3D8GA 1R4QB 5JEAH 3G71A 4AYBG 4H0LC 3QOJA 2BH2A 4MTNA 2NVTH 4E6IA 1NJIC 3JC66 1ICFB 1L0XB 1EYGA 5IP9H 3VYTA 2EPBA 3A5ZB 5IYCG 4A3FG 2RDGA 4Q5VA 3CCEA 2R61A 1QZHA 4P75A 1BUVT 4X3KA 1PH2A 5FLXE 3DM3A 2X69A 1IXRA 1I5FA 1X65A 5KYLA 1LTBD 1VQ8A 1A8VA 1J5EQ 1OXSC 3J81j 4A3IH 4OIJA 3WOEA 2QA4A 4DR4L 3EBEA 2F0VA 1KHIA 1XMQQ 4I65A 3CPFA 3I4OA 1STAA 4KJOA 5CORA 3BDLA 4WFN3 2AQ3B 2B2WA 1II3A 4XT3B 1EY6A 4FXDA 3S1RB 1WTQA 1LABA 2K03A 3HEJA 1CI3M 1QE6A 5FLMH 2KCNA 2F0GA 1ZKOA 1Y14B 3M4YA 5JVH3 1D5MC 2K52A 1GHKA 4RHRA 2EE1A 1BQQT 1ONLA 1WVLA 4QCLA 4H7BA 1VQIA 4AQYL 2FINB 1SROA 4Y7NH 3DWQA 4KHVA 1VQCA 1B50A 4JYAL 3KLSX 1JT8A 4A3LH 4CJ2C 1C9OA 2R92H 1TWAH 5C0XH 1CHPD 3MFYA 4FNFA 1KNEA 5J39A 4NKLA 1PZKD 5GAEC 4ZQ3A 2QCPX 5IGCA 2D9UA 2A6HD 1BKBA 4O42A 4CDEC 1Q82C 3WWVA 4OX9Q 5IODA 3OTOQ 2RF4A 1MIUA 1VS0A 3TDQA 5IYBH 3AYHB 5CV6A 1RHPA 1PRTD 1QG7A 1EUJA 1SJED 1TWFH 5F2DA 3J81E 1ZXTA 5HGQA 2JA5G 3K80C 4IFDG 5C4ZA 1FL0A 3NQIA 4JI3L 3MTSA 5C4HA 1HNWQ 2NBFA 5IGFA 5LMUQ 3KLSA 2RKSA 2JXMB 2UUAL 1D7QA 2PO4A 2AUJD 4FF1A 4C3IG 3LGJA 3EIVA 3MXUA 1ET9A 2ZXPA 3IKJA 1YIJA 4A3EB 4K8JA 1SE2A 2FFKB 3WOFA 4JI8Q 1ICWA 1PYWD 3MA2B 4LF7L 2E2JH 2L12A 2N78A 1GUNA 4P2CB 1I94Q 3URYA 1AFPA 1YJWA 4YCUA 1TS4A 4RCOA 5AJ3L 4KKUA 2B2VC 2NVXH 1BBUA 2A19A 3D6CA 2JA7B 1E24A 4FF3A 4ID6A 3A8IE 4AH6A 3RR5A 1IKLA 3FKIB 3H09A 3NBIA 5T1IA 1I4HA 1WCMB 5IGDA 3GTGH 2UXCQ 4DFAA 4K6DA 5JJLA 2SNSA 4QIWE 1KXLA 2R93G 4A3KB 1EFID 3J80L 4FXKC 2O2LD 4DR3Q 4YHHL 3S15H 3I7FA 4KY6A 4UAIA 3S1NH 4BY1B 4HJ9A 1PA6A 3UDIA 1D5ZC 1C7YA 4BBRB 1UE7A 4A3BG 2QDLA 4U68A 4C2MB 1B9MA 3FRPB 4FXGC 4UP8A 3K5LA 4TQUS 4R4QA 1YVCA 2Y0SG 4KKTA 3I4NB 3TZDA
chains in the Genus database with same CATH topology
1WOCA 1N36L 1RL2A 5K36G 4X62Q 1IBKQ 3PF5A 1N9WA 2CQOA 5LMNL 4DK6C 4OXPA 4NB3A 1QVFA 3KLWA 2JJQA 4DPGA 2UUBQ 3KJOA 1VCIA 4GNXA 1X54A 4DV2Q 2UXCL 4YY3L 4LF6Q 2YYZA 3CMAA 1K9MC 1HR0L 3TEHB 1X56A 2C35B 4QL5A 4DV7L 1YHBA 2Z6KC 4X64L 4R4OA 3TS0A 3I4MG 4PZ8A 5M3MH 4DR3L 1Q81C 1PH3A 2I5LX 1L1OA 1NE3A 3D31A 3CCMA 2CCZA 4IFDI 1E22A 1WI5A 3CMEA 1FJGQ 2NZHA 1EIFA 3U58A 1K8AC 4HJ7A 1HNZL 4LFBQ 3KF8B 3H0GH 1IBLQ 4HIKA 1H95A 2R6GA 1SLJA 4K0KL 3U4VA 4BA1I 1WYDA 5ELNA 4HIDA 4J15A 4NXNQ 3W5OA 3KJPA 4HIOA 1Y1VH 5C3EH 3S2DH 1Z9FA 2K5NA 1VQFA 4IJHA 2Q2HA 3ULJA 4X62L 1IBKL 5GAGC 5IT9c 2VQFQ 4JOIA 1YNXA 1JJGA 1PV4A 4X6AH 1IBMQ 2UUBL 2D0PA 4DV2L 5JEAG 2H5XA 3NBHB 4IOCA 4LF6L 4DK3C 2K50A 1JB7A 2CKZB 4L5SA 2NVYH 1XNRQ 4JBJA 4NPSA 2Y0SE 4YWMA 2CWAA 2VUMH 4DR7Q 5IP9G 2HQLA 2L15A 4OO1I 2JEAI 4JC0A 2JQOA 2YTVA 1X3EA 1FJGL 3PUYA 1VQHA 4LFBL 1XPOA 4A3EH 4JG2A 4O2DA 1IBLL 1MJCA 3F1ZA 3K81C 5M5XH 1D8LA 1E7ZA 1PH8A 3H3VH 4NXNL 3OW2A 4YWKA 3PUVA 2IY5B 2AWNA 4C3HH 1OXVA 4A3IG 4DR2Q 2BH8A 2UU9Q 3S14H 1YHAA 2VQFL 1W3SA 2A8VA 1KIXA 2PQAB 2D0OA 2VS1A 1IBML 1A63A 3G6EA 4JI5L 1VQLA 1EOVA 3RLFA 4DUZL 1P8LA 3GTPH 3CXCA 4A3JH 4LF5Q 2JA7H 3M4OH 4WJ3M 3ZJYC 1XNRL 4RG1A 4IO9A 5IE8A 4DR7L 3FKIH 4B3MQ 3T1YQ 2JA9A 1HZAA 4NXMQ 1G6PA 4IPDA 3GTLH 1LM0A 4BY7G 5C4XG 1A0IA 1WCMH 5C44G 5FLMG 2GVAA 1CKOA 4LF4Q 4LW1A 4A93H 1AH9A 4MNOA 3HOUH 2N3SA 2ZTCA 4A3KH 1HZBA 1G291 1LYLA 4UPAA 2XGTA 4RMFA 5H1SE 4DV0L 4HJ8A 3M3YH 5M3FH 3SGIA 5FLXc 4DR2L 1B7YB 3GD7A 3DLLA 2UU9L 3D0FA 3J80c 3TRZA 2K4KA 4XIGS 4JV5Q 1XPRA 2HHHQ 2OQKA 2VZAA 3KYHC 1QUQB 4A3CH 3CD6A 3F2DA 4C2MH 4IPHA 2GVBA 3AEVA 3HOXG 3L0OA 2R92G 3PV0A 5C0XG 1VQJA 1LUZA 3K7AH 3OYYA 3HKZE 4LF5L 5LMNW 5IYDH 1AE3A 2NZOA 1PYBA 3ER0A 4B3ML 5C0XJ 3HOZH 3T1YL 4NXML 2KBNA 3CP0A 4YWLA 1X3FA 5FJ8H 1NBWA 2IHFA 4JI7Q 1QZGA 1HZCA 5JJIA 1NMGA 1Z47A 4R4TA 4DR5Q 3VDYA 4A3GG 2XTIA 1HR0W 2HIVA 1N33L 1M90C 4LF4L 3U50C 2F4VQ 2E2HH 4L5TA 3GTQH 4B3RL 1CSQA 1MKHA 2KHJA 3BZCA 3HOYG 1AE2A 4GS3A 1B70B 1JMCA 2NVQH 1OXUA 2JA5H 4OONA 3CCQA 2AHOB 2VUMG 5IYBG 4X65Q 4QQBX 4LUOA 4JV5L 1KQSA 1WFQA 2HHHL 4WJ4A 3FHWA 3MEFA 1T9HA 1UWVA 2F3IA 3J7A5 3J80i 1U5KA 3H15A 1NMFA 3ERSX 3ULLA 2ZJRA 2UUCQ 4A3MH 5DLQE 5IP7G 4LFCQ 4DV5Q 2B63H 1VQGA 3ICEA 5M5YH 4C3IH 4DR5L 1J6QA 2AMCB 2KENA 4KLKA 3K7UC 3B6YA 3U4ZA 2ES2A 2F4VL 4GKJQ 1ASZA 1X9NA 1M1KC 4POGA 4GN5A 1PH6A 4PG3A 4LUVA 4A4IA 2V1CC 3CCVA 1N8RC 3L7ZC 1Q46A 4X65L 4A76A 1EWIA 4IOAA 1O7IA 5E7NA 3PIPA 4HJAA 1HJPA 4UP9A 1YJ9A 4A3GH 2JEBI 1Y1WH 1Q12A 1WCMG 4QGUA 4L5RC 2Q2TA 1HZ9A 1SN8A 1S3OA 3M4QA 2JA6G 2WB1G 4GOPC 2K5VA 1OXTA 4FDBA 4DNIA 2OTJA 3KF6A 1JE5A 1XMOQ 2YV5A 2UUCL 4DV4Q 3T1HQ 4TVAB 2ID0A 3HOVG 4Y52H 1I6HH 4LFCL 2GN5A 4DV5L 1CUKA 5HY6A 5IYCH 3PCOB 2OQ0A 3BJUA 2I0QA 3CC2A 2E8GA 4A3FH 3PO3G 2Z0SA 4BY1G 1GD7A 1GKHA 3FP9A 3S24A 2KHIA 4X66Q 3JAMc 1YBYA 2E5LQ 2JA8H 3S17H 4A3CG 4GKJL 4BBRG 3A5UA 4PZ6A 4JI1Q 4R4IA 2BA0A 4IJLA 2IX1A 4GN4B 3S1QH 1U0LA 1VQ6A 1K0RA 3F2CA 3PO2H 4A3DH 1YJNA 1EIYB 1PH7A 3I4NG 1SE8A 2R93H 1KAWA 1SFOH 4ALPA 1PVOA 3TREA 1N32Q 4JCVE 2CFMA 5FJ8G 4GNXC 3TS2A 2R7ZH 1C0AA 2JE6I 2FXQA 2PI2A 2RHQB 4QJFA 4IPGA 3J7ZC 1PYSB 4HIMA 3MXNB 1VQBA 3UE1A 1VQ7A 3W1GA 2ZTEA 3I2ZA 4A3BH 4GLVB 1TWHH 3PUWA 1XMOL 4DV4L 3T1HL 1EFWA 1L1OC 1Q8KA 3STBC 5C0XI 3TQYA 3CF5A 3HOWH 4BBSH 1K8GA 3CW2C 4DR6Q 3M85A 4YCVA 4GOPB 2E5LL 1TWGH 2MO1A 4X66L 1IYJB 4LNQA 1XPUA 4IFDJ 4JBKA 2F52A 4JI1L 2ATWA 2WB1E 2YU9H 3BU2A 1XJVA 4UY8C 3NENA 4QY7A 2KCTA 4JI0Q 3JAMi 1KL9A 1W2BA 3CCSA 3RZOH 1V1QA 1CKNB 2MNAA 4JOIC 1YZ6A 2ZTDA 1X6OA 2OWOA 4DV3Q 3I4MH 1N32L 3KOJA 1XTDA 1K3RA 1VQOA 2Q2UA 4DUYQ 3KDFB 1GVPA 2Q2IA 4GLAC 4UP7A 1IZ6A 5M3MG 1DGSA 4KI0A 2A1AA 3A0JA 1UE5A 1ASYA 3GTMH 2VNUD 1BVSA 1VQNA 4GNXB 4C3JH 3NEMA 1Q7YC 3H0GG 4DR6L 1S72A 3RLNA 3H3VI 3S16H 2LSSA 3K0XA 2NN6I 3BZKA 1X55A 1L0WA 1Y1VG 5C3EG 4DR4Q 1Y1WG 4GKKQ 2UXBQ 3PIOA 2VY3A 3CC4A 1L1OB 5JJKA 3GDEA 3G71A 4AYBG 1QVCA 2BH2A 2Z6KA 2OCEA 3PSIA 4MTNA 4JI0L 1PFSA 2BA1A 4DKAC 4OWWB 1XNQQ 2NVTH 1UE6A 1NJIC 2WP8J 3E0EA 3JC66 4P72A 4LFAQ 5IP9H 1RIPA 3UE0A 4DV3L 1EYGA 3CCLA 4LF9Q 1E1OA 3A5ZB 5IYCG 2VW9A 2LXKA 4BXXH 1HH2P 1G51A 2MO0A 5ELOA 4A3FG 1YI2A 3CCEA 1QZHA 3PUXA 4P75A 4L5QA 4LUZA 5IWAQ 2DUDA 2QGQA 3S1RH 2AKWB 2PQAA 3DM3A 1PH2A 1P16A 1IXRA 1I5FA 1X65A 1CSPA 4YY3Q 2IX0A 3UDFA 4B3SQ 1VQ8A 4A3EG 4KHPQ 3HKSA 1A8VA 1J5EQ 1OXSC 4X64Q 3J81j 4A3IH 4LF8Q 5M5WH 3HOWG 1HNXQ 4AQYQ 4MZ9A 1MJEA 1PH1A 2QA4A 2NN6G 2R7ZG 4DR4L 4GKKL 1KC8C 2UXBL 1I3QH 1YEZA 3EBEA 3AFPA 4JI7L 2HT1A 2RHSB 4JYAQ 5GAHC 1X3GA 2YTYA 3CC7A 1KHIA 2K5HA 1XMQQ 4JI6Q 3GTKH 2WFWA 1YHQA 2WAQG 1XNQL 2ZJPA 2MFIA 3CPFA 3I4OA 4YCWA 3IRBA 4PZ7A 1R9TH 2HIXA 5GQOA 2CWPA 2RCNA 4DAMA 2R7DA 4A3JG 1JJ2A 1VQ9A 4LF9L 5C4XH 1VQ5A 2JA7G 4BY7H 1Q1EA 2B29A 5C44H 5FLMH 3FKIG 5IWAL 4DV1Q 1QUQA 1Y14B 4DV6Q 1CKMA 4AYBE 3A74A 4POFA 4O0AA 5GADC 2K52A 3CCJA 3CCUA 3KFUA 4B3SL 3J81c 4KHPL 2ALYB 3E9IA 4JBWA 1J5EL 1E3PA 4A93G 4LF8L 3HOUG 3M4PA 2OTLA 1VQIA 4A3KG 4P74A 4AQYL 1HNXL 1SROA 3AQQA 4Y7NH 3G4SA 3I56A 1Q86C 1VQCA 4EQ5A 4JYAL 3L2PA 5M3FG 3CAMA 2N8NA 1JT8A 2JK8A 1VQ4A 4JI6L 4A3LH 4R1JA 1C9OA 3HOXH 2ZM6Q 1XMQL 2R92H 4DAYB 1TWAH 4A75A 1WJJA 3UDGA 1UE1A 4JI3Q 1KRTA 1JJCB 1K73C 1UEBA 2KCMA 3RNUA 4B3TQ 3GTOH 3PUZA 2E2IH 2ZJQA 5GAEC 1SR3A 1NY4A 1FGUA 2UUAQ 5IYDG 2UXDQ 3AFQA 3HOZG 5BR8Q 4DV1L 4DR1Q 3S2HH 4DV6L 4OWTB 3GO5A 2MQHA 1EQRA 3K8AA 1BKBA 2WAQE 1LTLA 4JI2Q 4JI5Q 4DUZQ 2IHEA 1Q82C 3WWVA 1OXXK 4OX9Q 3HOYH 4BA2I 3OTOQ 2RF4A 2I5MX 1MIUA 2D62A 4P71A 5JEAJ 1EQQA 1VS0A 1TXYA 1K83H 1V43A 2LXJA 3AYHB 5IYBH 1TWFH 1EUJA 1SMXA 1PH9A 1GM5A 1OTCA 3J81i 2K75A 4BXXG 5HGQA 2JA5G 3K80C 1B8AA 5EAYA 4IFDG 1PH4A 3PGZA 2ZM6L 4HJ5A 1FL0A 4JI3L 1KRSA 1N34Q 1QVGA 4LF7Q 1HNWQ 1A62A 3HKZG 3RLOA 4B3TL 3Q8DA 5LMUQ 5IY0A 4DV0Q 5IP7H 5GROA 2EQSA 3UDXA 3ULPA 2ASBA 2UUAL 5AJ3Q 2IT1A 2UXDL 4ME3A 1D7QA 5BR8L 4A3MG 4DR1L 3I55A 2VQEQ 4OWXB 4KHZA 1BBWA 2B63G 4JI2L 3GTJH 3LGJA 2EXDA 1FVIA 4XTCS 4OX9L 1VQPA 2R7FA 3EIVA 2N49A 3OTOL 1VQKA 4H02A 3M7NA 4AIMA 2VL6A 3W1BA 1YIJA 3STBD 4GLXA 4OO1G 2PI2E 4EX5A 4R4CA 4GN3B 5J3BA 4JBMA 1IL2A 2JA6H 1S40A 1N33Q 3NELA 1VQEA 4YHHQ 3CCRA 1PHJA 4JI8Q 1YITA 1N34L 1Q1BA 2YTXA 4LF7L 3HFZB 2N78A 3CQZH 2E2JH 4B3RQ 1HNWL 2AWOA 4PMWA 5LMUL 3HOVH 1I94Q 4JI4Q 2I5HA 3F2BA 1YJWA 4YCUA 1GO3E 3S1MH 5AJ3L 2NVXH 2B3GA 3PO3H 1BBUA 4BY1H 2A19A 4LWCA 1VQMA 1E24A 4BBRH 2VQEL 1VQDA 3F8TA 4DUYL 1N36Q 4AH6A 4A3LG 3RR5A 1TWCH 2EIFA 5LMNQ 3M9BA 3CPWA 2JA8G 3I4NH 1NTGA 3GTGH 2PNHA 1SRUA 3KF6B 4IPCA 2UXCQ 5JJLA 3PO2G 3G48A 1KD1C 2DGYA 4QIWE 4A3DG 3EN2A 1HR0Q 2QEXA 1KXLA 2R93G 3PF4A 1V9PA 4DV7Q 4GOPA 2K14A 3RN5A 4DR3Q 4YHHL 1L2FA 3S15H 4JI8L 4APVA 3I7FA 5C4JH 1E1TA 3S1NH 1I94L 1PH5A 3E9HA 4HJ9A 1I50H 1PA6A 3UDIA 1HNZQ 4JI4L 1C7YA 3RN2A 1CKNA 1UE7A 4A3BG 2PMZE 4K0KQ 1VQAA 4P73A 4UP8A 4LFAL 4TQUS 4R4QA 3RZDH 1YVCA 2Y0SG 3KDFA 4BBSG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WOC A;  1N36 L;  1RL2 A;  5K36 G;  4X62 Q;  1IBK Q;  3PF5 A;  1N9W A;  2CQO A;  5LMN L;  4DK6 C;  4OXP A;  4NB3 A;  1QVF A;  3KLW A;  2JJQ A;  4DPG A;  2UUB Q;  3KJO A;  1VCI A;  4GNX A;  1X54 A;  4DV2 Q;  2UXC L;  4YY3 L;  4LF6 Q;  2YYZ A;  3CMA A;  1K9M C;  1HR0 L;  3TEH B;  1X56 A;  2C35 B;  4QL5 A;  4DV7 L;  1YHB A;  2Z6K C;  4X64 L;  4R4O A;  3TS0 A;  3I4M G;  4PZ8 A;  5M3M H;  4DR3 L;  1Q81 C;  1PH3 A;  2I5L X;  1L1O A;  1NE3 A;  3D31 A;  3CCM A;  2CCZ A;  4IFD I;  1E22 A;  1WI5 A;  3CME A;  1FJG Q;  2NZH A;  1EIF A;  3U58 A;  1K8A C;  4HJ7 A;  1HNZ L;  4LFB Q;  3KF8 B;  3H0G H;  1IBL Q;  4HIK A;  1H95 A;  2R6G A;  1SLJ A;  4K0K L;  3U4V A;  4BA1 I;  1WYD A;  5ELN A;  4HID A;  4J15 A;  4NXN Q;  3W5O A;  3KJP A;  4HIO A;  1Y1V H;  5C3E H;  3S2D H;  1Z9F A;  2K5N A;  1VQF A;  4IJH A;  2Q2H A;  3ULJ A;  4X62 L;  1IBK L;  5GAG C;  5IT9 c;  2VQF Q;  4JOI A;  1YNX A;  1JJG A;  1PV4 A;  4X6A H;  1IBM Q;  2UUB L;  2D0P A;  4DV2 L;  5JEA G;  2H5X A;  3NBH B;  4IOC A;  4LF6 L;  4DK3 C;  2K50 A;  1JB7 A;  2CKZ B;  4L5S A;  2NVY H;  1XNR Q;  4JBJ A;  4NPS A;  2Y0S E;  4YWM A;  2CWA A;  2VUM H;  4DR7 Q;  5IP9 G;  2HQL A;  2L15 A;  4OO1 I;  2JEA I;  4JC0 A;  2JQO A;  2YTV A;  1X3E A;  1FJG L;  3PUY A;  1VQH A;  4LFB L;  1XPO A;  4A3E H;  4JG2 A;  4O2D A;  1IBL L;  1MJC A;  3F1Z A;  3K81 C;  5M5X H;  1D8L A;  1E7Z A;  1PH8 A;  3H3V H;  4NXN L;  3OW2 A;  4YWK A;  3PUV A;  2IY5 B;  2AWN A;  4C3H H;  1OXV A;  4A3I G;  4DR2 Q;  2BH8 A;  2UU9 Q;  3S14 H;  1YHA A;  2VQF L;  1W3S A;  2A8V A;  1KIX A;  2PQA B;  2D0O A;  2VS1 A;  1IBM L;  1A63 A;  3G6E A;  4JI5 L;  1VQL A;  1EOV A;  3RLF A;  4DUZ L;  1P8L A;  3GTP H;  3CXC A;  4A3J H;  4LF5 Q;  2JA7 H;  3M4O H;  4WJ3 M;  3ZJY C;  1XNR L;  4RG1 A;  4IO9 A;  5IE8 A;  4DR7 L;  3FKI H;  4B3M Q;  3T1Y Q;  2JA9 A;  1HZA A;  4NXM Q;  1G6P A;  4IPD A;  3GTL H;  1LM0 A;  4BY7 G;  5C4X G;  1A0I A;  1WCM H;  5C44 G;  5FLM G;  2GVA A;  1CKO A;  4LF4 Q;  4LW1 A;  4A93 H;  1AH9 A;  4MNO A;  3HOU H;  2N3S A;  2ZTC A;  4A3K H;  1HZB A;  1G29 1;  1LYL A;  4UPA A;  2XGT A;  4RMF A;  5H1S E;  4DV0 L;  4HJ8 A;  3M3Y H;  5M3F H;  3SGI A;  5FLX c;  4DR2 L;  1B7Y B;  3GD7 A;  3DLL A;  2UU9 L;  3D0F A;  3J80 c;  3TRZ A;  2K4K A;  4XIG S;  4JV5 Q;  1XPR A;  2HHH Q;  2OQK A;  2VZA A;  3KYH C;  1QUQ B;  4A3C H;  3CD6 A;  3F2D A;  4C2M H;  4IPH A;  2GVB A;  3AEV A;  3HOX G;  3L0O A;  2R92 G;  3PV0 A;  5C0X G;  1VQJ A;  1LUZ A;  3K7A H;  3OYY A;  3HKZ E;  4LF5 L;  5LMN W;  5IYD H;  1AE3 A;  2NZO A;  1PYB A;  3ER0 A;  4B3M L;  5C0X J;  3HOZ H;  3T1Y L;  4NXM L;  2KBN A;  3CP0 A;  4YWL A;  1X3F A;  5FJ8 H;  1NBW A;  2IHF A;  4JI7 Q;  1QZG A;  1HZC A;  5JJI A;  1NMG A;  1Z47 A;  4R4T A;  4DR5 Q;  3VDY A;  4A3G G;  2XTI A;  1HR0 W;  2HIV A;  1N33 L;  1M90 C;  4LF4 L;  3U50 C;  2F4V Q;  2E2H H;  4L5T A;  3GTQ H;  4B3R L;  1CSQ A;  1MKH A;  2KHJ A;  3BZC A;  3HOY G;  1AE2 A;  4GS3 A;  1B70 B;  1JMC A;  2NVQ H;  1OXU A;  2JA5 H;  4OON A;  3CCQ A;  2AHO B;  2VUM G;  5IYB G;  4X65 Q;  4QQB X;  4LUO A;  4JV5 L;  1KQS A;  1WFQ A;  2HHH L;  4WJ4 A;  3FHW A;  3MEF A;  1T9H A;  1UWV A;  2F3I A;  3J7A 5;  3J80 i;  1U5K A;  3H15 A;  1NMF A;  3ERS X;  3ULL A;  2ZJR A;  2UUC Q;  4A3M H;  5DLQ E;  5IP7 G;  4LFC Q;  4DV5 Q;  2B63 H;  1VQG A;  3ICE A;  5M5Y H;  4C3I H;  4DR5 L;  1J6Q A;  2AMC B;  2KEN A;  4KLK A;  3K7U C;  3B6Y A;  3U4Z A;  2ES2 A;  2F4V L;  4GKJ Q;  1ASZ A;  1X9N A;  1M1K C;  4POG A;  4GN5 A;  1PH6 A;  4PG3 A;  4LUV A;  4A4I A;  2V1C C;  3CCV A;  1N8R C;  3L7Z C;  1Q46 A;  4X65 L;  4A76 A;  1EWI A;  4IOA A;  1O7I A;  5E7N A;  3PIP A;  4HJA A;  1HJP A;  4UP9 A;  1YJ9 A;  4A3G H;  2JEB I;  1Y1W H;  1Q12 A;  1WCM G;  4QGU A;  4L5R C;  2Q2T A;  1HZ9 A;  1SN8 A;  1S3O A;  3M4Q A;  2JA6 G;  2WB1 G;  4GOP C;  2K5V A;  1OXT A;  4FDB A;  4DNI A;  2OTJ A;  3KF6 A;  1JE5 A;  1XMO Q;  2YV5 A;  2UUC L;  4DV4 Q;  3T1H Q;  4TVA B;  2ID0 A;  3HOV G;  4Y52 H;  1I6H H;  4LFC L;  2GN5 A;  4DV5 L;  1CUK A;  5HY6 A;  5IYC H;  3PCO B;  2OQ0 A;  3BJU A;  2I0Q A;  3CC2 A;  2E8G A;  4A3F H;  3PO3 G;  2Z0S A;  4BY1 G;  1GD7 A;  1GKH A;  3FP9 A;  3S24 A;  2KHI A;  4X66 Q;  3JAM c;  1YBY A;  2E5L Q;  2JA8 H;  3S17 H;  4A3C G;  4GKJ L;  4BBR G;  3A5U A;  4PZ6 A;  4JI1 Q;  4R4I A;  2BA0 A;  4IJL A;  2IX1 A;  4GN4 B;  3S1Q H;  1U0L A;  1VQ6 A;  1K0R A;  3F2C A;  3PO2 H;  4A3D H;  1YJN A;  1EIY B;  1PH7 A;  3I4N G;  1SE8 A;  2R93 H;  1KAW A;  1SFO H;  4ALP A;  1PVO A;  3TRE A;  1N32 Q;  4JCV E;  2CFM A;  5FJ8 G;  4GNX C;  3TS2 A;  2R7Z H;  1C0A A;  2JE6 I;  2FXQ A;  2PI2 A;  2RHQ B;  4QJF A;  4IPG A;  3J7Z C;  1PYS B;  4HIM A;  3MXN B;  1VQB A;  3UE1 A;  1VQ7 A;  3W1G A;  2ZTE A;  3I2Z A;  4A3B H;  4GLV B;  1TWH H;  3PUW A;  1XMO L;  4DV4 L;  3T1H L;  1EFW A;  1L1O C;  1Q8K A;  3STB C;  5C0X I;  3TQY A;  3CF5 A;  3HOW H;  4BBS H;  1K8G A;  3CW2 C;  4DR6 Q;  3M85 A;  4YCV A;  4GOP B;  2E5L L;  1TWG H;  2MO1 A;  4X66 L;  1IYJ B;  4LNQ A;  1XPU A;  4IFD J;  4JBK A;  2F52 A;  4JI1 L;  2ATW A;  2WB1 E;  2YU9 H;  3BU2 A;  1XJV A;  4UY8 C;  3NEN A;  4QY7 A;  2KCT A;  4JI0 Q;  3JAM i;  1KL9 A;  1W2B A;  3CCS A;  3RZO H;  1V1Q A;  1CKN B;  2MNA A;  4JOI C;  1YZ6 A;  2ZTD A;  1X6O A;  2OWO A;  4DV3 Q;  3I4M H;  1N32 L;  3KOJ A;  1XTD A;  1K3R A;  1VQO A;  2Q2U A;  4DUY Q;  3KDF B;  1GVP A;  2Q2I A;  4GLA C;  4UP7 A;  1IZ6 A;  5M3M G;  1DGS A;  4KI0 A;  2A1A A;  3A0J A;  1UE5 A;  1ASY A;  3GTM H;  2VNU D;  1BVS A;  1VQN A;  4GNX B;  4C3J H;  3NEM A;  1Q7Y C;  3H0G G;  4DR6 L;  1S72 A;  3RLN A;  3H3V I;  3S16 H;  2LSS A;  3K0X A;  2NN6 I;  3BZK A;  1X55 A;  1L0W A;  1Y1V G;  5C3E G;  4DR4 Q;  1Y1W G;  4GKK Q;  2UXB Q;  3PIO A;  2VY3 A;  3CC4 A;  1L1O B;  5JJK A;  3GDE A;  3G71 A;  4AYB G;  1QVC A;  2BH2 A;  2Z6K A;  2OCE A;  3PSI A;  4MTN A;  4JI0 L;  1PFS A;  2BA1 A;  4DKA C;  4OWW B;  1XNQ Q;  2NVT H;  1UE6 A;  1NJI C;  2WP8 J;  3E0E A;  3JC6 6;  4P72 A;  4LFA Q;  5IP9 H;  1RIP A;  3UE0 A;  4DV3 L;  1EYG A;  3CCL A;  4LF9 Q;  1E1O A;  3A5Z B;  5IYC G;  2VW9 A;  2LXK A;  4BXX H;  1HH2 P;  1G51 A;  2MO0 A;  5ELO A;  4A3F G;  1YI2 A;  3CCE A;  1QZH A;  3PUX A;  4P75 A;  4L5Q A;  4LUZ A;  5IWA Q;  2DUD A;  2QGQ A;  3S1R H;  2AKW B;  2PQA A;  3DM3 A;  1PH2 A;  1P16 A;  1IXR A;  1I5F A;  1X65 A;  1CSP A;  4YY3 Q;  2IX0 A;  3UDF A;  4B3S Q;  1VQ8 A;  4A3E G;  4KHP Q;  3HKS A;  1A8V A;  1J5E Q;  1OXS C;  4X64 Q;  3J81 j;  4A3I H;  4LF8 Q;  5M5W H;  3HOW G;  1HNX Q;  4AQY Q;  4MZ9 A;  1MJE A;  1PH1 A;  2QA4 A;  2NN6 G;  2R7Z G;  4DR4 L;  4GKK L;  1KC8 C;  2UXB L;  1I3Q H;  1YEZ A;  3EBE A;  3AFP A;  4JI7 L;  2HT1 A;  2RHS B;  4JYA Q;  5GAH C;  1X3G A;  2YTY A;  3CC7 A;  1KHI A;  2K5H A;  1XMQ Q;  4JI6 Q;  3GTK H;  2WFW A;  1YHQ A;  2WAQ G;  1XNQ L;  2ZJP A;  2MFI A;  3CPF A;  3I4O A;  4YCW A;  3IRB A;  4PZ7 A;  1R9T H;  2HIX A;  5GQO A;  2CWP A;  2RCN A;  4DAM A;  2R7D A;  4A3J G;  1JJ2 A;  1VQ9 A;  4LF9 L;  5C4X H;  1VQ5 A;  2JA7 G;  4BY7 H;  1Q1E A;  2B29 A;  5C44 H;  5FLM H;  3FKI G;  5IWA L;  4DV1 Q;  1QUQ A;  1Y14 B;  4DV6 Q;  1CKM A;  4AYB E;  3A74 A;  4POF A;  4O0A A;  5GAD C;  2K52 A;  3CCJ A;  3CCU A;  3KFU A;  4B3S L;  3J81 c;  4KHP L;  2ALY B;  3E9I A;  4JBW A;  1J5E L;  1E3P A;  4A93 G;  4LF8 L;  3HOU G;  3M4P A;  2OTL A;  1VQI A;  4A3K G;  4P74 A;  4AQY L;  1HNX L;  1SRO A;  3AQQ A;  4Y7N H;  3G4S A;  3I56 A;  1Q86 C;  1VQC A;  4EQ5 A;  4JYA L;  3L2P A;  5M3F G;  3CAM A;  2N8N A;  1JT8 A;  2JK8 A;  1VQ4 A;  4JI6 L;  4A3L H;  4R1J A;  1C9O A;  3HOX H;  2ZM6 Q;  1XMQ L;  2R92 H;  4DAY B;  1TWA H;  4A75 A;  1WJJ A;  3UDG A;  1UE1 A;  4JI3 Q;  1KRT A;  1JJC B;  1K73 C;  1UEB A;  2KCM A;  3RNU A;  4B3T Q;  3GTO H;  3PUZ A;  2E2I H;  2ZJQ A;  5GAE C;  1SR3 A;  1NY4 A;  1FGU A;  2UUA Q;  5IYD G;  2UXD Q;  3AFQ A;  3HOZ G;  5BR8 Q;  4DV1 L;  4DR1 Q;  3S2H H;  4DV6 L;  4OWT B;  3GO5 A;  2MQH A;  1EQR A;  3K8A A;  1BKB A;  2WAQ E;  1LTL A;  4JI2 Q;  4JI5 Q;  4DUZ Q;  2IHE A;  1Q82 C;  3WWV A;  1OXX K;  4OX9 Q;  3HOY H;  4BA2 I;  3OTO Q;  2RF4 A;  2I5M X;  1MIU A;  2D62 A;  4P71 A;  5JEA J;  1EQQ A;  1VS0 A;  1TXY A;  1K83 H;  1V43 A;  2LXJ A;  3AYH B;  5IYB H;  1TWF H;  1EUJ A;  1SMX A;  1PH9 A;  1GM5 A;  1OTC A;  3J81 i;  2K75 A;  4BXX G;  5HGQ A;  2JA5 G;  3K80 C;  1B8A A;  5EAY A;  4IFD G;  1PH4 A;  3PGZ A;  2ZM6 L;  4HJ5 A;  1FL0 A;  4JI3 L;  1KRS A;  1N34 Q;  1QVG A;  4LF7 Q;  1HNW Q;  1A62 A;  3HKZ G;  3RLO A;  4B3T L;  3Q8D A;  5LMU Q;  5IY0 A;  4DV0 Q;  5IP7 H;  5GRO A;  2EQS A;  3UDX A;  3ULP A;  2ASB A;  2UUA L;  5AJ3 Q;  2IT1 A;  2UXD L;  4ME3 A;  1D7Q A;  5BR8 L;  4A3M G;  4DR1 L;  3I55 A;  2VQE Q;  4OWX B;  4KHZ A;  1BBW A;  2B63 G;  4JI2 L;  3GTJ H;  3LGJ A;  2EXD A;  1FVI A;  4XTC S;  4OX9 L;  1VQP A;  2R7F A;  3EIV A;  2N49 A;  3OTO L;  1VQK A;  4H02 A;  3M7N A;  4AIM A;  2VL6 A;  3W1B A;  1YIJ A;  3STB D;  4GLX A;  4OO1 G;  2PI2 E;  4EX5 A;  4R4C A;  4GN3 B;  5J3B A;  4JBM A;  1IL2 A;  2JA6 H;  1S40 A;  1N33 Q;  3NEL A;  1VQE A;  4YHH Q;  3CCR A;  1PHJ A;  4JI8 Q;  1YIT A;  1N34 L;  1Q1B A;  2YTX A;  4LF7 L;  3HFZ B;  2N78 A;  3CQZ H;  2E2J H;  4B3R Q;  1HNW L;  2AWO A;  4PMW A;  5LMU L;  3HOV H;  1I94 Q;  4JI4 Q;  2I5H A;  3F2B A;  1YJW A;  4YCU A;  1GO3 E;  3S1M H;  5AJ3 L;  2NVX H;  2B3G A;  3PO3 H;  1BBU A;  4BY1 H;  2A19 A;  4LWC A;  1VQM A;  1E24 A;  4BBR H;  2VQE L;  1VQD A;  3F8T A;  4DUY L;  1N36 Q;  4AH6 A;  4A3L G;  3RR5 A;  1TWC H;  2EIF A;  5LMN Q;  3M9B A;  3CPW A;  2JA8 G;  3I4N H;  1NTG A;  3GTG H;  2PNH A;  1SRU A;  3KF6 B;  4IPC A;  2UXC Q;  5JJL A;  3PO2 G;  3G48 A;  1KD1 C;  2DGY A;  4QIW E;  4A3D G;  3EN2 A;  1HR0 Q;  2QEX A;  1KXL A;  2R93 G;  3PF4 A;  1V9P A;  4DV7 Q;  4GOP A;  2K14 A;  3RN5 A;  4DR3 Q;  4YHH L;  1L2F A;  3S15 H;  4JI8 L;  4APV A;  3I7F A;  5C4J H;  1E1T A;  3S1N H;  1I94 L;  1PH5 A;  3E9H A;  4HJ9 A;  1I50 H;  1PA6 A;  3UDI A;  1HNZ Q;  4JI4 L;  1C7Y A;  3RN2 A;  1CKN A;  1UE7 A;  4A3B G;  2PMZ E;  4K0K Q;  1VQA A;  4P73 A;  4UP8 A;  4LFA L;  4TQU S;  4R4Q A;  3RZD H;  1YVC A;  2Y0S G;  3KDF A;  4BBS G; 
#chains in the Genus database with same CATH topology
 1RL2 A;  3MEH A;  5K36 G;  2PZT A;  4X62 Q;  5LMN L;  4OXP A;  3KLW A;  1VCI A;  2DNC A;  2ZXO A;  1K9M C;  3S9W A;  1HR0 L;  3V2T A;  1ILP A;  2K32 A;  3TS0 A;  1I50 B;  4XQN A;  3VA5 A;  1F9Q A;  1NE3 A;  5G3L D;  1FJG Q;  1EIF A;  3U58 A;  1K8A C;  3KF8 B;  3H0G H;  2R6G A;  4MIU A;  1WYD A;  4HID A;  4EQO A;  1HFG A;  2K5N A;  5CGK A;  4RA8 A;  4QIW B;  4LK1 C;  2Q2H A;  3AMU A;  4HMI A;  2VQF Q;  2N55 A;  3R93 A;  3C1F A;  5M5Y B;  4X6A H;  1IBM Q;  2UUB L;  3BYT B;  2H5X A;  2BDN A;  4LF6 L;  2K50 A;  1KTK A;  4L5S A;  4QMG A;  1XNR Q;  4JBJ A;  2F0Q A;  4K8I A;  2F0W A;  1F9S A;  2B2W C;  4XQQ A;  2JEA I;  3K6O A;  2JQO A;  3CRL C;  2K5W A;  3PUY A;  4A3G B;  3I3C A;  1EOT A;  4EQP A;  1BBX C;  2EYF A;  2N88 A;  4NXN L;  4HCS A;  3O13 A;  1ENA A;  1MGS A;  2AWN A;  1IW7 D;  4DR2 Q;  5NUC A;  2UU9 Q;  1YHA A;  3JAM L;  2PW7 A;  2M2L A;  2NVY B;  1ZYR C;  2PQA B;  4C1N I;  2KCC A;  3RLF A;  1HRJ A;  2JA8 B;  1P8L A;  3GTP H;  3NWS A;  5D3I B;  4RG1 A;  4ZAI A;  1CTM A;  5IE8 A;  2WKC A;  4IO9 A;  4DR7 L;  3T1Y Q;  2JA9 A;  1HZA A;  5E4X A;  4N8X 1;  4IPD A;  1G6P A;  1LM0 A;  4BY7 G;  4DAY A;  2R7Z B;  3RMH A;  4MNO A;  4GZY C;  3OW7 A;  3I72 A;  4HN7 A;  1G29 1;  2DJG C;  4ILW A;  1B7Y B;  1EEI D;  1B2T A;  3J80 c;  4G57 A;  1D2B A;  1XPR A;  4BBS B;  2OQK A;  2A74 C;  2VZA A;  4A3J B;  3KYH C;  1QUQ B;  4A3C H;  3SK4 A;  3F2D A;  2E74 C;  1BCP C;  3LWU A;  1I4P A;  1QIL A;  2BCO A;  1AE3 A;  2NZO A;  1X3F A;  1NBW A;  1HZC A;  5FLX L;  1WTH A;  2JN4 A;  5CV9 A;  2F4V Q;  4X3T A;  1TVX A;  3U50 C;  4L5T A;  3TSS A;  1O80 A;  4KY7 A;  1JMC A;  2NVQ H;  1OXU A;  2JA5 H;  1NUC A;  4IFD H;  1T5X D;  4C3J B;  2ENB A;  4BWG B;  4QQB X;  5FKA C;  1A3U A;  4WJ4 A;  3FHW A;  1T9H A;  1CQV A;  5COY A;  1F9P A;  3S16 B;  3J80 i;  5J22 A;  1Q8I A;  3H15 A;  1NMF A;  1HHV A;  5IP7 G;  4LFC Q;  5A2Q E;  2J4X A;  1PRT F;  3ICE A;  4C3I H;  1EZ8 A;  4DR5 L;  2AMC B;  2KEN A;  2Q8R E;  5I4D A;  2ES2 A;  2MUY A;  3PIP 3;  4LUV A;  2RVL A;  1N8R C;  2F3V A;  1WD1 A;  4OEL B;  4FVM A;  1O7I A;  4ZCK A;  4UP9 A;  1Y1W H;  1SNQ A;  1WCM G;  2C5C A;  5M5W B;  1AP0 A;  2Q2T A;  1HZ9 A;  4OEM B;  4JPB W;  4KMU C;  3KUP A;  2B2Y A;  2B63 B;  2EYM A;  2UUC L;  3HOV G;  1GUG A;  2GN5 A;  1CUK A;  3PCO B;  1R9T B;  4PNY A;  2I0Q A;  4BY1 G;  1GKH A;  3FP9 A;  3JAM c;  1ILQ A;  4GKJ L;  1H9R A;  3HG9 A;  1Y8N B;  2BE5 D;  3D4R A;  4BBR G;  4JI1 Q;  1PTO D;  2EOT A;  5C44 B;  3S1Q H;  1U0L A;  1K0R A;  1HQM C;  2K6A A;  4DN4 M;  3J81 L;  4CKC A;  3I4N G;  3W3A A;  4MHE A;  2R93 H;  3RUZ A;  1SFO H;  4ALP A;  4JCV E;  1SYF A;  3J7Z C;  3I2Z A;  4KD3 A;  4A3B H;  4Z9C B;  1XMO L;  4K14 A;  3HOX B;  3T1H L;  1Q8K A;  3GV3 A;  5C0X I;  1T5E A;  5K36 H;  4GOP B;  2E5L L;  3PO2 B;  4LNQ A;  3ERQ A;  2ATW A;  2WB1 E;  2LS0 1;  3S2H B;  3JAM i;  2DN8 A;  2MNA A;  3HOY B;  3DUZ A;  5CV4 A;  1STE A;  1K3R A;  2CW0 D;  3KDF B;  1TWH B;  4DF7 A;  2F4I A;  1IZ6 A;  3HP3 A;  1U4M A;  4XDX A;  3E3X A;  5CR3 A;  2A1A A;  1YNJ D;  5CBE E;  2VNU D;  3HZX A;  1I4R A;  5JAV A;  3H3V I;  3SK5 A;  3OSO A;  4DR4 Q;  4FYD A;  2WIN B;  5ELD A;  2F0O A;  2MP1 A;  2Z6B A;  3F2U A;  4IN3 A;  2OCE A;  5G3L F;  4DKA C;  1J9O A;  3NUC A;  1F2M A;  3E0E A;  1JOQ A;  1RIP A;  2F0T A;  5A35 A;  3L9A X;  2MO0 A;  4ZKC B;  3PUX A;  3S1R H;  4LUZ A;  1B4O A;  1JWU D;  2JA6 B;  5BN4 A;  2PYK A;  2EJM A;  1IYV A;  4K5X A;  5CV5 A;  1BR9 A;  3BDC A;  1GUT A;  4K6L A;  5FOB B;  1WTW A;  2L11 A;  4HAE A;  4AQY Q;  1TU2 B;  4G4K A;  1F2Y A;  1B3A A;  4RGN A;  2R7Z G;  3S1M B;  2UXB L;  4JYA Q;  3PO3 B;  2RHS B;  3CC7 A;  1X3G A;  2K5H A;  1HA6 A;  3VR4 A;  3GTK H;  1YHQ A;  2WAQ G;  2ZJP A;  4IUU A;  1Q90 A;  1SXT A;  1SDF A;  5GQO A;  4A3J G;  4DAM A;  2R7D A;  4BY7 H;  1VQ9 A;  5EKL A;  1Q1E A;  3NXW A;  4X3S A;  2QKI C;  3A74 A;  3CCU A;  4B3S L;  3J81 c;  4KHP L;  4IUV A;  3E9I A;  4JBW A;  3BVM A;  1F77 A;  5C4J B;  3HOU G;  1HNX L;  3A56 A;  2IX3 A;  1Q86 C;  1EQV A;  5M3F G;  5KGU A;  1D1I A;  4JI6 L;  4R1J A;  3RZD B;  1EY5 A;  4A75 A;  1UE1 A;  4JI3 Q;  4IQZ A;  4DAP A;  1K73 C;  1UEB A;  2KCM A;  5CBA E;  3OMG A;  5C4X B;  4RAU C;  2E2I H;  2HCC A;  1MD2 D;  4OIK A;  1NY4 A;  2UUA Q;  5IYD G;  3CKI B;  1YNN C;  1V1P B;  4DV1 L;  5ELB A;  3DWA A;  4DV6 L;  3E6Z X;  3KK7 A;  4OWT B;  1AEX A;  2KEE A;  1EQR A;  2MQH A;  1LTL A;  4I7Z C;  5M3M B;  3QG1 A;  2IHE A;  5FO9 B;  3DM1 A;  2A6E C;  2I5M X;  2B2T A;  5JEA J;  4OGQ C;  1EQQ A;  3FPU B;  4CDF C;  1V43 A;  2B8G A;  5BN3 A;  3P7J A;  3J81 i;  4BXX G;  3DEO A;  1EWC A;  1SSO A;  3PGZ A;  1PH4 A;  3GTO B;  2PZW A;  4XYQ A;  3BZD B;  5C3E B;  1KRS A;  4LF7 Q;  1A62 A;  4B3T L;  4K2K A;  3OWE B;  5IY0 A;  5IP7 H;  2EQS A;  2F0L A;  5AJ3 Q;  2JYO A;  4ME3 A;  2B2Y C;  1LTI D;  4H44 C;  3SDZ A;  4DR1 L;  1SYD A;  4OWX B;  2ICE C;  4KHZ A;  2B63 G;  4JI2 L;  3GTJ H;  2B8F A;  2LFN A;  1VQP A;  5KNB A;  1RDP D;  3A55 A;  2EYJ A;  3W1B A;  2NUC A;  3Q22 A;  2CVR A;  3PIO 3;  4GLX A;  4EX5 A;  4R4C A;  2K5Q A;  2F0D A;  5J3B A;  1FNU A;  4JBM A;  1IL2 A;  1S40 A;  1N33 Q;  1VQE A;  3V96 A;  4YHH Q;  4C3H B;  3J7A V;  3HFZ B;  3CQZ H;  3S14 B;  4PMW A;  3HOV H;  1BNZ A;  3K57 A;  3F2B A;  2B3G A;  4BY1 H;  1H9S A;  1SNO A;  4LWC A;  1VQM A;  1EQT A;  2VQE L;  4BBR H;  2I07 B;  1TWC H;  2Q8T A;  4PQX A;  2EIF A;  2WAC A;  3M9B A;  3A7A B;  5LMN Q;  3I4N H;  4RGO S;  1K8M A;  1LTS D;  1I4Q A;  2PNH A;  3KF6 B;  4IPC A;  3PO2 G;  3G48 A;  4A93 B;  1HR0 Q;  3A8J E;  1HXY D;  1V9P A;  3H6M A;  2K14 A;  3CRK C;  1XX8 A;  1MI2 A;  3RN5 A;  1ENC A;  4CDC C;  4APV A;  1FGB D;  2KJX A;  1W6J A;  1PH5 A;  2L0C A;  1I50 H;  1DOL A;  4JI4 L;  1PTO F;  1CQF A;  2F0I A;  4ZUI A;  5A2Q L;  2PMZ E;  2OF1 A;  4XQJ A;  4KK7 A;  4GN3 B;  1G2S A;  3HOW G;  1A15 A;  1WOC A;  1HTL D;  1N36 L;  4ZYS A;  2SNM A;  3VR5 A;  3PF5 A;  3QIA A;  4HSV A;  1QCB D;  1UEA B;  4DPG A;  1AZP A;  2UUB Q;  4GNX A;  1GXD C;  5I9P A;  4LF6 Q;  3CMA A;  3TEH B;  5EPL A;  4DV7 L;  1YHB A;  5D65 A;  1V1O A;  1Z7T A;  4NDX A;  1L1O A;  2CCZ A;  4IFD I;  1WI5 A;  4HJ7 A;  3NP8 A;  4HIK A;  4OL7 A;  3U4V A;  5ELN A;  5DM7 3;  3KJP A;  4HIO A;  4NXN Q;  3S2D H;  1WTR A;  4IJH A;  3ULJ A;  1IBK L;  5GAG C;  3WDN A;  1YNX A;  1JJG A;  3CU7 A;  1PV4 A;  2D0P A;  4DV2 L;  3NBH B;  4IOC A;  4CJ1 B;  2EXZ A;  4DK3 C;  4MN3 A;  2CKZ B;  2NVY H;  2VUM H;  3I91 A;  2CWA A;  2PMZ B;  5J1Z A;  4DR7 Q;  1A6X A;  2HQL A;  2L15 A;  2A68 C;  2L4N A;  1SNC A;  4JC0 A;  3D6W A;  1LLR D;  3D4W A;  1LO5 D;  4HR7 B;  4LFB L;  1XPO A;  4JG2 A;  4O2D A;  2AUK A;  3F1Z A;  3K81 C;  3DMU A;  5M5X H;  1PH8 A;  3H3V H;  3E0J A;  3LX0 A;  3OW2 A;  1LT4 D;  1JQY D;  2BH8 A;  4DNR B;  1KLU D;  3TME A;  1I6H B;  4R8N A;  2A8V A;  4HCE A;  4IUQ A;  2D0O A;  1A63 A;  1VQL A;  3NTK A;  4A3J H;  3M4O H;  1XTC D;  4WJ3 M;  5KIX A;  4A3D B;  3VR6 A;  3GTL H;  1V8Q A;  2G9H D;  5C4X G;  2Z9H A;  4DK1 A;  3QR8 A;  5I9O A;  1AH9 A;  3HOU H;  1ESF A;  1LYL A;  4RGT A;  4HJ8 A;  1IL8 A;  2G9D A;  2H1E A;  5M3F H;  2BOS A;  3I4L A;  3D0F A;  2K4K A;  2K5D A;  3Q24 A;  3NQT A;  4IPH A;  2GVB A;  1CT1 D;  3AEV A;  1STG A;  2KHS A;  1VQJ A;  5EKK A;  4LF5 L;  2K04 A;  3HKZ E;  5FO8 B;  1HTP A;  1KDA A;  5IYD H;  3ER0 A;  2EYL A;  1G6Z A;  5FK9 C;  4YWL A;  4JI7 Q;  1QZG A;  1Z47 A;  4R4T A;  3T51 B;  1E2W A;  4DR5 Q;  1O7Y A;  1N33 L;  1M90 C;  4LF4 L;  2E2H H;  3K59 A;  1CSQ A;  1AE2 A;  1K8O A;  4YIJ A;  3OIP A;  3BDO A;  2F1M A;  4I7A A;  4JV5 L;  1WFQ A;  3A54 A;  3K7A B;  2RSN A;  1EIG A;  3SR1 A;  2A69 D;  1PFN A;  3ULL A;  2UUC Q;  5E1F A;  1O78 A;  5DLQ E;  2NVT B;  3HRZ C;  4C3H G;  1BCP B;  2B63 H;  3GTQ B;  4WJW A;  1IYU A;  2PCF B;  3B6Y A;  4IUR A;  4GKJ Q;  1FR3 A;  1JOR A;  1X9N A;  4GN5 A;  1PH6 A;  3P20 A;  2D5D A;  4KY5 A;  2V1C C;  3CCV A;  2E76 C;  4V0B A;  3EA6 A;  5I2X A;  5EPK A;  3HKZ B;  3W2D A;  4A76 A;  1GOZ A;  1YJ9 A;  4HJA A;  3TZU A;  2HUG A;  2A6H C;  1FNV A;  4QGU A;  4A3M B;  1OXT A;  1PTO H;  3SEB A;  1NR4 A;  4LJZ C;  1XMO Q;  1DOM A;  1SMY D;  3T1H Q;  1PRT C;  5IYC H;  3DWP A;  3I8Z A;  4A3F H;  1HUN A;  2Z0S A;  4K5W A;  2E5L Q;  2KHI A;  3KLR A;  1PDQ A;  1S5E D;  4R4I A;  2BA0 A;  2IX1 A;  1SYC A;  3U9S A;  3PO2 H;  2EY6 A;  1YJN A;  1SE8 A;  5IGB A;  1KAW A;  4CKB A;  3TRE A;  2M9V A;  5FJ8 G;  4GNX C;  3TS2 A;  2FXQ A;  2PI2 A;  4QJF A;  5LL6 S;  3UE1 A;  1VQB A;  4Y7N B;  4K5V A;  4WRD A;  4HMJ A;  1TWH H;  3T53 B;  4ME5 A;  1L1O C;  1D1K A;  1EFW A;  1TWA B;  3S17 B;  3HOW H;  4FO2 A;  1K8G A;  3CW2 C;  1KDC A;  1K3B C;  2RDF A;  2MO1 A;  2KUM A;  1IYJ B;  4IFD J;  2YU9 H;  5BN5 A;  5I6W A;  1KAA A;  3RZO H;  1YZ6 A;  3H91 A;  1BXT A;  1X6O A;  1MSG A;  1PMR A;  1GJX A;  1N32 L;  2Q2U A;  4F7X A;  1TWF B;  4UP7 A;  2F0J A;  3SK6 A;  3GTM H;  5KRU A;  1TWG B;  1H9J A;  2EVB A;  1Y8O B;  3DEP A;  3FMC A;  2HQE A;  2JP1 A;  1S72 A;  4RCN A;  3RLN A;  1SYB A;  3K0X A;  1LTA D;  3BZK A;  1NAP A;  1LV9 A;  4N9T A;  2UXB Q;  1EU4 A;  5JJK A;  1LTR D;  3PIO A;  2VY3 A;  2SEB D;  4N9P A;  3I4M B;  1QVC A;  1R4P B;  4JI0 L;  4OWW B;  1I4X A;  1QOH A;  2DJF C;  2F0H A;  4LFA Q;  1Q3L A;  1E1O A;  1SYE A;  4PV1 C;  5DM6 3;  2VW9 A;  3BYY B;  1HH2 P;  5ELO A;  3VYR A;  1YI2 A;  3IAY A;  1KLG D;  1MHW C;  2AKW B;  3Q23 A;  2J0T D;  2IX0 A;  3NHH A;  4TRD A;  4B3S Q;  4A3E G;  1I6V C;  4KHP Q;  3HKS A;  2E2J B;  3P75 A;  3QOL A;  1Y69 U;  4IUT A;  1HNX Q;  3PMF A;  4MZ9 A;  4GKK L;  1I3Q H;  2CH4 A;  3GQB A;  4JI7 L;  2HT1 A;  2NVX B;  1DZ1 A;  1CM9 A;  5GAH C;  2YTY A;  2P5Z X;  4JI6 Q;  3R8B A;  1QNU A;  2WFW A;  2K33 A;  1XNQ L;  4DXG A;  2NB0 A;  5AFW A;  4FP5 D;  3T4A C;  4BS9 A;  4ODG A;  5EPJ A;  2M00 A;  2HIX A;  4LF9 L;  2JA7 G;  2CQA A;  5C4X H;  3GTG B;  2B29 A;  3FKI G;  3PQI A;  5IWA L;  4DV1 Q;  5IGE A;  4DV6 Q;  1CKM A;  4AYB E;  1DM0 B;  5GAD C;  3SXH A;  4C56 C;  3KFU A;  3S15 B;  2ALY B;  4RH6 A;  1TY2 A;  1E3P A;  4LF8 L;  2OTL A;  3S1N B;  4A3K G;  2MJ8 A;  4P74 A;  2EJF C;  3AQQ A;  3I56 A;  2K1B A;  1JOK A;  3L2P A;  2N8N A;  2JK8 A;  1VQ4 A;  4DAY B;  1KAB A;  1WJJ A;  2SDF A;  3Q6S A;  1KRT A;  1JJC B;  4B3T Q;  3GTO H;  3PUZ A;  2ZJQ A;  1SR3 A;  1IW7 C;  1FGU A;  1PXU A;  3AFQ A;  2WKD A;  3IL8 A;  2IJ0 A;  1BOS A;  4DR1 Q;  2EZV A;  1SNM A;  1NSN S;  3GO5 A;  1LT5 D;  4JI2 Q;  4DUZ Q;  3SVM A;  3MWY W;  3H3V C;  2D62 A;  1K83 H;  1PZJ D;  2LMC B;  1DON A;  1SMX A;  3H0G B;  5KND A;  1PH9 A;  2K75 A;  3EVQ A;  1B8A A;  4RKL A;  5EAY A;  5C5M A;  3D4D A;  2ZM6 L;  1STY A;  3MVV A;  5HGT A;  3HKZ G;  4AYB B;  3Q8D A;  3TP5 A;  4DV0 Q;  5CV7 A;  3UDX A;  3ULP A;  1WTV A;  1WTX A;  2ASB A;  1E2Z A;  2IT1 A;  5KNC A;  2UXD L;  5JPN C;  3C2P A;  5BR8 L;  3NPP A;  4A3M G;  2VQE Q;  2PZU A;  3GV6 A;  4MTK A;  1CHQ D;  4XTC S;  2EY5 A;  2N49 A;  1VQK A;  2EYP A;  3ZYY X;  3K5M A;  4H02 A;  3M7N A;  1CZW A;  3STB D;  1SEB D;  1EZ6 A;  1H9K A;  4OO1 G;  1JB3 A;  2EJG C;  1HUM A;  3CCR A;  1PHJ A;  4A3G G;  1YIT A;  1N34 L;  1Q1B A;  2YTX A;  3QB3 A;  5C6A A;  2AWO A;  4CDD C;  2B39 A;  2OXP A;  1LT6 D;  4JI4 Q;  3K5O A;  1S5B D;  3VYU A;  3QJY A;  3P1H A;  3AB9 A;  1B1Z A;  1VQD A;  3F8T A;  1N36 Q;  4A3L G;  3MXN A;  3CPW A;  2FMM A;  2JA8 G;  4IAL A;  1NTG A;  2RSO A;  4NP5 A;  1HA5 A;  2LKV A;  4F87 A;  3L3O C;  1SRU A;  2O4X A;  3LNN A;  2QDB A;  2WB1 B;  2DGY A;  3EN2 A;  2QEX A;  1EY0 A;  1TY0 A;  2E75 C;  4DV7 Q;  1IKM A;  2CH4 W;  2CHB D;  4L6T B;  1RTN A;  1E1T A;  4ZLT F;  3E9H A;  2TSS A;  5D3D A;  1CKN A;  2IPK D;  1VQA A;  1UAP A;  4LFA L;  1ROD A;  4BBS G;  2L55 A;  1TS3 A;  4KKS A;  3TP6 A;  1IBK Q;  2CQO A;  4DK6 C;  1QVF A;  1UNS A;  4DV2 Q;  1CK1 A;  1EYC A;  2QF7 A;  1X56 A;  2C35 B;  4QL5 A;  1LT3 D;  1HFN A;  3I4M G;  1ENF A;  2R3Z A;  2NVQ B;  2BE5 C;  5EJW A;  2I5L X;  3U9O A;  1EYA A;  3D31 A;  5EBC A;  1ZEQ X;  3CCM A;  1PTO C;  3V05 A;  3VYS A;  4DA2 A;  2NZH A;  1HNZ L;  2XN9 C;  4LFB Q;  4ULL A;  1H95 A;  3D3R A;  5L37 A;  4K0K L;  3NTH A;  4C3J G;  4PMC A;  2I46 A;  3VA7 A;  1VMP A;  1VMC A;  4JOI A;  3A8K E;  2DY8 A;  4C3I B;  1CZG A;  4NPS A;  2Y0S E;  1H9M A;  1NCV A;  2KOL A;  3GP7 A;  1EYD A;  1S5C D;  1STB A;  2YTV A;  1AN8 A;  1X3E A;  3KBG A;  2ZT9 C;  4J8Q A;  4A3E H;  1Y1V B;  1Y1W B;  1IBL L;  1MJC A;  1E7Z A;  3A7L A;  1D5X C;  2IY5 B;  3PUV A;  2CW0 C;  1OXV A;  5M9O A;  4HED A;  1W3S A;  1YNJ C;  1KIX A;  2VS1 A;  3G6E A;  5IT9 E;  3LWE A;  1EOV A;  1STH A;  4DUZ L;  3CXC A;  3R2T A;  2F0F A;  4LF5 Q;  2JA7 H;  3ZJY C;  3S1Q B;  3FKI H;  4KD4 A;  2AQ1 B;  2Z4I A;  2ZXR A;  2R93 B;  1SFO B;  1WCM H;  1G8Z D;  1FYC A;  5C44 G;  2GVA A;  2MHV A;  4LF4 Q;  1O7L A;  1MBY A;  2L5T A;  2O5J C;  1VF7 A;  2N3S A;  2ZTC A;  4A3K H;  2KA7 A;  4UPA A;  5H1S E;  2XGT A;  4DV0 L;  4A3B B;  3C3L A;  1CA5 A;  3SGI A;  1STN A;  5DEH A;  1SYG A;  3GD7 A;  3TRZ A;  2Y0S B;  1I4G A;  4XIG S;  4JV5 Q;  5DAU A;  3NBH A;  4C2M H;  4RWS C;  2XWJ B;  1SAP A;  3HOX G;  3PV0 A;  3K7A H;  4ZRZ A;  5LMN W;  1PYB A;  4UHV A;  4B3M L;  1M4V A;  5C0X J;  2O5I C;  4NXM L;  2KBN A;  3CP0 A;  2A73 B;  2IHF A;  5JJI A;  1NMG A;  1HR0 W;  2HIV A;  1A3V A;  1EY9 A;  3M3Y B;  4FF4 A;  3GTQ H;  1MKH A;  2KHJ A;  3BZC A;  4ZK9 B;  3HOY G;  3QWN A;  5JJZ A;  3NWT A;  2RBM A;  1KQS A;  1EL0 A;  2HHH L;  3MEF A;  3NK9 A;  1UWV A;  1LTG D;  4JK1 C;  2F3I A;  3J7A 5;  3HOZ B;  5E3F A;  3OIQ A;  3ERS X;  2KED A;  2K7V A;  4A3M H;  1B9N A;  1DD2 A;  5EKI A;  5M5Y H;  1G91 A;  3TN2 A;  3X3N A;  4KLK A;  3T13 A;  2F0M A;  3C1E A;  2B2U A;  4POG A;  4OO1 H;  4EGV A;  4DGZ A;  2Q8I B;  1Q46 A;  4X65 L;  2RCF A;  1EWI A;  5E7N A;  3PIP A;  4A3G H;  1HJP A;  5EQ0 A;  2JEB I;  4L5R C;  3M4Q A;  1SN8 A;  1S3O A;  2JA6 G;  2WB1 G;  4FDB A;  4DNI A;  2F03 A;  2NYZ D;  2YV5 A;  3GTK B;  1W6K A;  2ID0 A;  4TVA B;  1NR2 A;  4Y52 H;  1WTO A;  4DV5 L;  5HY6 A;  2EYO A;  3CC2 A;  1RD9 D;  2E8G A;  3PO3 G;  3S24 A;  5IGG A;  2DNE A;  3S17 H;  2JA8 H;  4A3C G;  4DNT B;  4BY7 B;  1VDZ A;  4PZ6 A;  2MGS A;  4CHT B;  1VQ6 A;  1X32 A;  4KTA A;  1EIY B;  5TSS A;  3H94 A;  5CC4 A;  2LY7 A;  1J8I A;  1PVO A;  1H9S B;  1N32 Q;  2CFM A;  1C0A A;  2R7Z H;  2JE6 I;  1AZQ A;  2V4D A;  4IPG A;  3ND9 A;  2IL8 A;  1NNX A;  1VQ7 A;  4XT1 B;  2ZTE A;  3CHB D;  4H13 C;  1C8C A;  2Z8L A;  4WOR A;  4DV4 L;  2G5D A;  5D14 A;  3TQY A;  3CF5 A;  1PFM A;  4BBS H;  4RFB A;  3NSW A;  1DXM A;  3M85 A;  1XWE A;  2J7Z A;  4YCV A;  3X3M A;  1TWG H;  4X66 L;  2E2I B;  4JBK A;  4R8I A;  1PRT B;  1JR0 D;  3BU2 A;  1XJV A;  4UY8 C;  3NEN A;  1F9R A;  4QY7 A;  2KCT A;  3KF8 A;  4JI0 Q;  1W2B A;  1V1Q A;  4JOI C;  2RDH A;  3I4M H;  1XTD A;  4DUY Q;  1GVP A;  3MXG A;  2Q2I A;  4GLA C;  2KEC A;  2B2T C;  1DGS A;  5M3M G;  3K0Y A;  1U4R A;  4KI0 A;  1EIH A;  3A0J A;  1ZYR D;  1BVS A;  3HS0 C;  1VQN A;  4GNX B;  4C3J H;  4JVZ A;  1Q7Y C;  4DR6 L;  1SND A;  4J1M A;  3S16 H;  2NN6 I;  1X55 A;  1Y1V G;  5C3E G;  4GKK Q;  1Y1W G;  3CC4 A;  1L1O B;  3GDE A;  3AU7 A;  2Z6K A;  3PSI A;  3NTI A;  4S3S A;  1XNQ Q;  1PFS A;  2BA1 A;  3GTJ B;  1UE6 A;  2WP8 J;  4DV3 L;  4P72 A;  1ML0 D;  3UE0 A;  3CCL A;  2EY2 A;  4LF9 Q;  4JW0 A;  2LXK A;  4BXX H;  1DOK A;  1G51 A;  5DNF A;  2FHT A;  4HTH A;  2NTT A;  1TT2 A;  2GA4 B;  4L5Q A;  5IWA Q;  1WD0 A;  1Y8P B;  2DUD A;  2QGQ A;  4B9W A;  2PQA A;  3UI2 A;  1P16 A;  1CSP A;  2Z1C A;  1BCP D;  2F0K A;  1SBB B;  4YY3 Q;  5JOB A;  3UDF A;  3CQZ B;  4CGY B;  4X64 Q;  4LF8 Q;  3HOV B;  5M5W H;  3MHB A;  3BS1 A;  2PPB C;  3RD4 A;  1MJE A;  1QB5 D;  1PH1 A;  1TS2 A;  2NN6 G;  1KC8 C;  1YEZ A;  3AFP A;  2F0N A;  2X6G A;  1XYI A;  2MFI A;  1A2T A;  5EBD A;  4YCW A;  3IRB A;  4PZ7 A;  1WTP A;  1TWC B;  1R9T H;  3HGB A;  4L63 B;  1RF2 D;  2RA4 A;  2XSC A;  2CWP A;  2RCN A;  1JJ2 A;  1VQ5 A;  2ICI A;  3R2I A;  5C44 H;  4OHJ A;  2F0U A;  2E2D C;  1QUQ A;  4UDU C;  4POF A;  4A3I B;  2WV6 D;  4O0A A;  3CCJ A;  5FO7 B;  1PLF A;  1J5E L;  4A93 G;  3M4P A;  2WII B;  4XXE A;  5EGT A;  2MPM A;  4RGM A;  3G4S A;  4EQ5 A;  2XNA C;  3CAM A;  2ZM6 Q;  1XMQ L;  3HOX H;  4QUF A;  1S4Z A;  4QUC A;  2QEJ C;  5CYU A;  3UDG A;  3RNU A;  2HCI A;  5KYI A;  1KNA A;  3OOC A;  4M1U B;  2UXD Q;  3R3O A;  3HOZ G;  5BR8 Q;  3S2H H;  2L9H A;  4JI5 Q;  3K8A A;  2WAQ E;  2Z4H A;  4Q0F A;  5T1G A;  3HOY H;  2XRS D;  4BA2 I;  1OXX K;  4L8J A;  3G6J B;  2XWB B;  4P71 A;  1TXY A;  2LXJ A;  4LMQ D;  2R92 B;  1OTC A;  2B2U C;  1GM5 A;  1B44 D;  3SE0 A;  1FD7 D;  1JOO A;  2NWG A;  3MFG A;  4HJ5 A;  5IT9 L;  3NE5 B;  3S2D B;  3OHX C;  3SK8 A;  1N34 Q;  1TQO A;  3KBX A;  3RLO A;  1JE4 A;  4M8A A;  5GRO A;  5LHY 1;  3G7L A;  3J7A F;  4ZKB B;  3TP7 A;  3I55 A;  1DYQ A;  2L1B A;  4NMZ A;  1BBW A;  2VUM B;  3FPP A;  1SE3 A;  2EXD A;  1FVI A;  2EYH A;  5E4W C;  1X3Q A;  4OX9 L;  2R7F A;  3OTO L;  2DY7 A;  5K5P A;  3EFX D;  1SNP A;  4AIM A;  2VL6 A;  2PI2 E;  5M5X B;  2PQE A;  2JA6 H;  1RJT A;  3NEL A;  4B3R Q;  1HNW L;  1F2Z A;  5LMU L;  2WAQ B;  1D6E C;  3IFD A;  2I5H A;  1BF4 A;  4RKB A;  1GO3 E;  3S1M H;  3PO3 H;  1BO0 A;  3J7Y W;  1QJO A;  1HPC A;  3M4O B;  3M7G A;  2AQ2 B;  4DUY L;  3FDT A;  5JVG 3;  1DCZ A;  3GTL B;  2A69 C;  2VB2 X;  4DXF A;  4HSP A;  1KD1 C;  1A3T A;  4A3D G;  1CFM A;  3HOU B;  3PF4 A;  1TS5 A;  4GOP A;  4B08 A;  1E0B A;  1C48 A;  3QO2 A;  3FEW X;  1L2F A;  4JI8 L;  5M3F B;  1FNW A;  5C4J H;  4R9W A;  2K05 A;  1M8A A;  1I94 L;  4F88 A;  3FVQ A;  1HNZ Q;  3OMC A;  3TBI B;  3RN2 A;  4QF4 A;  2F0S A;  4K0K Q;  4P73 A;  1MSH A;  3RZD H;  1QVG A;  5CV8 A;  3KDF A;  3TP8 A;  1SJH D;  1N9W A;  1LTT D;  4NB3 A;  2JJQ A;  5HUR A;  3KJO A;  1SMY C;  1X54 A;  4N8F A;  2UXC L;  4YY3 L;  3T56 B;  2YYZ A;  2E2H B;  2Z6K C;  4X64 L;  1OO9 B;  4R4O A;  2EDG A;  4PZ8 A;  5M3M H;  4DR3 L;  1Q81 C;  3BG3 A;  1PH3 A;  2KQ3 A;  1U9R A;  1E22 A;  2VXW A;  3CME A;  2K01 A;  1IBL Q;  1SLJ A;  4BA1 I;  1GHJ A;  1IHZ A;  4J15 A;  4CJ0 B;  3W5O A;  1E2V A;  1Y1V H;  5C3E H;  1Z9F A;  1UUP A;  1VQF A;  3ONA B;  4X62 L;  4C1N K;  5IT9 c;  3SHL A;  5JPM C;  2FMC A;  1GUW A;  5JEA G;  1TKW B;  1JB7 A;  3N52 A;  4YWM A;  1ET6 A;  5IP9 G;  4OO1 I;  1EY7 A;  5KEE A;  1FJG L;  1VQH A;  1D8L A;  1RCV D;  5ELF A;  1ESR A;  4ABN A;  1G2T A;  2NN6 H;  1PTO B;  4YWK A;  4C3H H;  3VR2 A;  4A3I G;  4K2L A;  4F8M A;  3S14 H;  1YNN D;  2VQF L;  4KN7 C;  3E5S A;  1IBM L;  4A3F B;  4JI5 L;  1Z6H A;  2HDM A;  2A6E D;  4EVO A;  1BCP F;  1EY4 A;  1XNR L;  3I90 A;  4B3M Q;  4NXM Q;  2VB3 X;  1A0I A;  5FLM G;  1EWH A;  1CKO A;  4LW1 A;  4A93 H;  2OEO A;  1VF5 C;  4X3U A;  1HZB A;  2EY1 A;  4RMF A;  1JWS D;  3OWF A;  3M3Y H;  2NZ1 D;  5FLX c;  4DR2 L;  3DLL A;  4QB4 A;  1V1P A;  2UU9 L;  4G7O C;  3HOW B;  5IOC A;  2HHH Q;  3GTP B;  3CD6 A;  2H4O A;  5CMD A;  3L0O A;  2R92 G;  5C0X G;  2TMP A;  1LUZ A;  3OYY A;  3MAQ A;  1QWY A;  1LAC A;  2YU9 B;  2QW7 A;  2D2C C;  4CBV A;  3HOZ H;  1DJR D;  3T1Y L;  3RZO B;  5I2Y A;  1C4Q A;  4ZUJ A;  5FJ8 H;  4IUN A;  3VDY A;  2XTI A;  2HDL A;  1B3Q A;  3DHQ A;  4IUP A;  4KV6 A;  4B3R L;  4PMB A;  2NTS A;  4GS3 A;  1B70 B;  1KDB A;  4FF2 A;  3GTM B;  4OON A;  3CCQ A;  2AHO B;  2VUM G;  1S5F D;  5IYB G;  4X65 Q;  4LUO A;  2F0P A;  4RHS A;  3J80 E;  2X6L A;  1U5K A;  4NW2 A;  1PZI D;  1S5D D;  3ITP A;  1K28 A;  4EQN A;  2ZJR A;  3C46 A;  4DV5 Q;  1QNK A;  1VQG A;  4XYO A;  3BVZ A;  1J6Q A;  3K58 A;  4O1N A;  3K7U C;  2SOB A;  2F4V L;  3U4Z A;  2A5H A;  1ASZ A;  1XXG A;  4CKE A;  2JA5 B;  3MZ5 A;  1M1K C;  4PG3 A;  4A4I A;  3EQL C;  3L7Z C;  4G7H C;  2K28 A;  3MC0 B;  1AW7 A;  2OT2 A;  4IOA A;  1K0S A;  5LL6 X;  1Q12 A;  3DXJ C;  4G7Z C;  3MXP A;  1JC7 A;  2JSO A;  4GOP C;  2K5V A;  1I3Q B;  4TKO B;  4DAV A;  2OTJ A;  4U67 3;  3KF6 A;  2F3W A;  1JE5 A;  3K5N A;  3I70 A;  5ELE A;  4DV4 Q;  1BDO A;  1I6H H;  4LFC L;  1RTO A;  4IZ8 A;  4B9X A;  5ELC A;  4DU9 A;  1TII D;  2OQ0 A;  3BJU A;  1GD7 A;  4X66 Q;  1YBY A;  3A5U A;  4IJL A;  2KVM A;  4GN4 B;  3F2C A;  4A3D H;  1PH7 A;  2BDO A;  1GUS A;  1F2L A;  1L0Y B;  5C5L A;  2QIL A;  3Q0A A;  4DK0 A;  3ND8 A;  1CA6 A;  2RHQ B;  4HIM A;  4KN4 C;  1PYS B;  3MXN B;  1TR5 A;  3W1G A;  2B2V A;  4GLV B;  1HQR D;  3PUW A;  4TSS A;  1U4L A;  5IIF A;  3STB C;  5C3W A;  4DR6 Q;  2F0E A;  2PNR C;  3BVG A;  1SE4 A;  1EY8 A;  4LAA A;  1XPU A;  3IFT A;  2A68 D;  2F52 A;  4JI1 L;  1HCZ A;  3ERO A;  3EJI A;  3JAM E;  2HD3 A;  1X3P A;  1O7Z A;  1KL9 A;  3CCS A;  5I6Y A;  1CKN B;  1EU3 A;  2ZTD A;  2PW5 A;  1RKN A;  4DV3 Q;  2OWO A;  1JWM D;  3KOJ A;  2XIW A;  2IWH A;  1VQO A;  3OPO A;  1A2U A;  1K83 B;  4V19 0;  2C9O A;  3T16 A;  2XRQ D;  4KJN A;  3I73 A;  1UE5 A;  1ASY A;  2RQX A;  1PFB A;  1JCK B;  5ISR A;  1GUO A;  1JIC A;  3NEM A;  1EEF D;  1U4P A;  5C3X A;  3H0G G;  2XVS A;  3N6R A;  4J6H A;  2LSS A;  2IW3 A;  2FJ2 A;  1B53 A;  1L0W A;  3VR3 A;  3D8G A;  1R4Q B;  5JEA H;  3G71 A;  4AYB G;  4H0L C;  3QOJ A;  2BH2 A;  4MTN A;  2NVT H;  4E6I A;  1NJI C;  3JC6 6;  1ICF B;  1L0X B;  1EYG A;  5IP9 H;  3VYT A;  2EPB A;  3A5Z B;  5IYC G;  4A3F G;  2RDG A;  4Q5V A;  3CCE A;  2R61 A;  1QZH A;  4P75 A;  1BUV T;  4X3K A;  1PH2 A;  5FLX E;  3DM3 A;  2X69 A;  1IXR A;  1I5F A;  1X65 A;  5KYL A;  1LTB D;  1VQ8 A;  1A8V A;  1J5E Q;  1OXS C;  3J81 j;  4A3I H;  4OIJ A;  3WOE A;  2QA4 A;  4DR4 L;  3EBE A;  2F0V A;  1KHI A;  1XMQ Q;  4I65 A;  3CPF A;  3I4O A;  1STA A;  4KJO A;  5COR A;  3BDL A;  4WFN 3;  2AQ3 B;  2B2W A;  1II3 A;  4XT3 B;  1EY6 A;  4FXD A;  3S1R B;  1WTQ A;  1LAB A;  2K03 A;  3HEJ A;  1CI3 M;  1QE6 A;  5FLM H;  2KCN A;  2F0G A;  1ZKO A;  1Y14 B;  3M4Y A;  5JVH 3;  1D5M C;  2K52 A;  1GHK A;  4RHR A;  2EE1 A;  1BQQ T;  1ONL A;  1WVL A;  4QCL A;  4H7B A;  1VQI A;  4AQY L;  2FIN B;  1SRO A;  4Y7N H;  3DWQ A;  4KHV A;  1VQC A;  1B50 A;  4JYA L;  3KLS X;  1JT8 A;  4A3L H;  4CJ2 C;  1C9O A;  2R92 H;  1TWA H;  5C0X H;  1CHP D;  3MFY A;  4FNF A;  1KNE A;  5J39 A;  4NKL A;  1PZK D;  5GAE C;  4ZQ3 A;  2QCP X;  5IGC A;  2D9U A;  2A6H D;  1BKB A;  4O42 A;  4CDE C;  1Q82 C;  3WWV A;  4OX9 Q;  5IOD A;  3OTO Q;  2RF4 A;  1MIU A;  1VS0 A;  3TDQ A;  5IYB H;  3AYH B;  5CV6 A;  1RHP A;  1PRT D;  1QG7 A;  1EUJ A;  1SJE D;  1TWF H;  5F2D A;  3J81 E;  1ZXT A;  5HGQ A;  2JA5 G;  3K80 C;  4IFD G;  5C4Z A;  1FL0 A;  3NQI A;  4JI3 L;  3MTS A;  5C4H A;  1HNW Q;  2NBF A;  5IGF A;  5LMU Q;  3KLS A;  2RKS A;  2JXM B;  2UUA L;  1D7Q A;  2PO4 A;  2AUJ D;  4FF1 A;  4C3I G;  3LGJ A;  3EIV A;  3MXU A;  1ET9 A;  2ZXP A;  3IKJ A;  1YIJ A;  4A3E B;  4K8J A;  1SE2 A;  2FFK B;  3WOF A;  4JI8 Q;  1ICW A;  1PYW D;  3MA2 B;  4LF7 L;  2E2J H;  2L12 A;  2N78 A;  1GUN A;  4P2C B;  1I94 Q;  3URY A;  1AFP A;  1YJW A;  4YCU A;  1TS4 A;  4RCO A;  5AJ3 L;  4KKU A;  2B2V C;  2NVX H;  1BBU A;  2A19 A;  3D6C A;  2JA7 B;  1E24 A;  4FF3 A;  4ID6 A;  3A8I E;  4AH6 A;  3RR5 A;  1IKL A;  3FKI B;  3H09 A;  3NBI A;  5T1I A;  1I4H A;  1WCM B;  5IGD A;  3GTG H;  2UXC Q;  4DFA A;  4K6D A;  5JJL A;  2SNS A;  4QIW E;  1KXL A;  2R93 G;  4A3K B;  1EFI D;  3J80 L;  4FXK C;  2O2L D;  4DR3 Q;  4YHH L;  3S15 H;  3I7F A;  4KY6 A;  4UAI A;  3S1N H;  4BY1 B;  4HJ9 A;  1PA6 A;  3UDI A;  1D5Z C;  1C7Y A;  4BBR B;  1UE7 A;  4A3B G;  2QDL A;  4U68 A;  4C2M B;  1B9M A;  3FRP B;  4FXG C;  4UP8 A;  3K5L A;  4TQU S;  4R4Q A;  1YVC A;  2Y0S G;  4KKT A;  3I4N B;  3TZD A; 
#chains in the Genus database with same CATH homology
 1WOC A;  1N36 L;  1RL2 A;  5K36 G;  4X62 Q;  1IBK Q;  3PF5 A;  1N9W A;  2CQO A;  5LMN L;  4DK6 C;  4OXP A;  4NB3 A;  1QVF A;  3KLW A;  2JJQ A;  4DPG A;  2UUB Q;  3KJO A;  1VCI A;  4GNX A;  1X54 A;  4DV2 Q;  2UXC L;  4YY3 L;  4LF6 Q;  2YYZ A;  3CMA A;  1K9M C;  1HR0 L;  3TEH B;  1X56 A;  2C35 B;  4QL5 A;  4DV7 L;  1YHB A;  2Z6K C;  4X64 L;  4R4O A;  3TS0 A;  3I4M G;  4PZ8 A;  5M3M H;  4DR3 L;  1Q81 C;  1PH3 A;  2I5L X;  1L1O A;  1NE3 A;  3D31 A;  3CCM A;  2CCZ A;  4IFD I;  1E22 A;  1WI5 A;  3CME A;  1FJG Q;  2NZH A;  1EIF A;  3U58 A;  1K8A C;  4HJ7 A;  1HNZ L;  4LFB Q;  3KF8 B;  3H0G H;  1IBL Q;  4HIK A;  1H95 A;  2R6G A;  1SLJ A;  4K0K L;  3U4V A;  4BA1 I;  1WYD A;  5ELN A;  4HID A;  4J15 A;  4NXN Q;  3W5O A;  3KJP A;  4HIO A;  1Y1V H;  5C3E H;  3S2D H;  1Z9F A;  2K5N A;  1VQF A;  4IJH A;  2Q2H A;  3ULJ A;  4X62 L;  1IBK L;  5GAG C;  5IT9 c;  2VQF Q;  4JOI A;  1YNX A;  1JJG A;  1PV4 A;  4X6A H;  1IBM Q;  2UUB L;  2D0P A;  4DV2 L;  5JEA G;  2H5X A;  3NBH B;  4IOC A;  4LF6 L;  4DK3 C;  2K50 A;  1JB7 A;  2CKZ B;  4L5S A;  2NVY H;  1XNR Q;  4JBJ A;  4NPS A;  2Y0S E;  4YWM A;  2CWA A;  2VUM H;  4DR7 Q;  5IP9 G;  2HQL A;  2L15 A;  4OO1 I;  2JEA I;  4JC0 A;  2JQO A;  2YTV A;  1X3E A;  1FJG L;  3PUY A;  1VQH A;  4LFB L;  1XPO A;  4A3E H;  4JG2 A;  4O2D A;  1IBL L;  1MJC A;  3F1Z A;  3K81 C;  5M5X H;  1D8L A;  1E7Z A;  1PH8 A;  3H3V H;  4NXN L;  3OW2 A;  4YWK A;  3PUV A;  2IY5 B;  2AWN A;  4C3H H;  1OXV A;  4A3I G;  4DR2 Q;  2BH8 A;  2UU9 Q;  3S14 H;  1YHA A;  2VQF L;  1W3S A;  2A8V A;  1KIX A;  2PQA B;  2D0O A;  2VS1 A;  1IBM L;  1A63 A;  3G6E A;  4JI5 L;  1VQL A;  1EOV A;  3RLF A;  4DUZ L;  1P8L A;  3GTP H;  3CXC A;  4A3J H;  4LF5 Q;  2JA7 H;  3M4O H;  4WJ3 M;  3ZJY C;  1XNR L;  4RG1 A;  4IO9 A;  5IE8 A;  4DR7 L;  3FKI H;  4B3M Q;  3T1Y Q;  2JA9 A;  1HZA A;  4NXM Q;  1G6P A;  4IPD A;  3GTL H;  1LM0 A;  4BY7 G;  5C4X G;  1A0I A;  1WCM H;  5C44 G;  5FLM G;  2GVA A;  1CKO A;  4LF4 Q;  4LW1 A;  4A93 H;  1AH9 A;  4MNO A;  3HOU H;  2N3S A;  2ZTC A;  4A3K H;  1HZB A;  1G29 1;  1LYL A;  4UPA A;  2XGT A;  4RMF A;  5H1S E;  4DV0 L;  4HJ8 A;  3M3Y H;  5M3F H;  3SGI A;  5FLX c;  4DR2 L;  1B7Y B;  3GD7 A;  3DLL A;  2UU9 L;  3D0F A;  3J80 c;  3TRZ A;  2K4K A;  4XIG S;  4JV5 Q;  1XPR A;  2HHH Q;  2OQK A;  2VZA A;  3KYH C;  1QUQ B;  4A3C H;  3CD6 A;  3F2D A;  4C2M H;  4IPH A;  2GVB A;  3AEV A;  3HOX G;  3L0O A;  2R92 G;  3PV0 A;  5C0X G;  1VQJ A;  1LUZ A;  3K7A H;  3OYY A;  3HKZ E;  4LF5 L;  5LMN W;  5IYD H;  1AE3 A;  2NZO A;  1PYB A;  3ER0 A;  4B3M L;  5C0X J;  3HOZ H;  3T1Y L;  4NXM L;  2KBN A;  3CP0 A;  4YWL A;  1X3F A;  5FJ8 H;  1NBW A;  2IHF A;  4JI7 Q;  1QZG A;  1HZC A;  5JJI A;  1NMG A;  1Z47 A;  4R4T A;  4DR5 Q;  3VDY A;  4A3G G;  2XTI A;  1HR0 W;  2HIV A;  1N33 L;  1M90 C;  4LF4 L;  3U50 C;  2F4V Q;  2E2H H;  4L5T A;  3GTQ H;  4B3R L;  1CSQ A;  1MKH A;  2KHJ A;  3BZC A;  3HOY G;  1AE2 A;  4GS3 A;  1B70 B;  1JMC A;  2NVQ H;  1OXU A;  2JA5 H;  4OON A;  3CCQ A;  2AHO B;  2VUM G;  5IYB G;  4X65 Q;  4QQB X;  4LUO A;  4JV5 L;  1KQS A;  1WFQ A;  2HHH L;  4WJ4 A;  3FHW A;  3MEF A;  1T9H A;  1UWV A;  2F3I A;  3J7A 5;  3J80 i;  1U5K A;  3H15 A;  1NMF A;  3ERS X;  3ULL A;  2ZJR A;  2UUC Q;  4A3M H;  5DLQ E;  5IP7 G;  4LFC Q;  4DV5 Q;  2B63 H;  1VQG A;  3ICE A;  5M5Y H;  4C3I H;  4DR5 L;  1J6Q A;  2AMC B;  2KEN A;  4KLK A;  3K7U C;  3B6Y A;  3U4Z A;  2ES2 A;  2F4V L;  4GKJ Q;  1ASZ A;  1X9N A;  1M1K C;  4POG A;  4GN5 A;  1PH6 A;  4PG3 A;  4LUV A;  4A4I A;  2V1C C;  3CCV A;  1N8R C;  3L7Z C;  1Q46 A;  4X65 L;  4A76 A;  1EWI A;  4IOA A;  1O7I A;  5E7N A;  3PIP A;  4HJA A;  1HJP A;  4UP9 A;  1YJ9 A;  4A3G H;  2JEB I;  1Y1W H;  1Q12 A;  1WCM G;  4QGU A;  4L5R C;  2Q2T A;  1HZ9 A;  1SN8 A;  1S3O A;  3M4Q A;  2JA6 G;  2WB1 G;  4GOP C;  2K5V A;  1OXT A;  4FDB A;  4DNI A;  2OTJ A;  3KF6 A;  1JE5 A;  1XMO Q;  2YV5 A;  2UUC L;  4DV4 Q;  3T1H Q;  4TVA B;  2ID0 A;  3HOV G;  4Y52 H;  1I6H H;  4LFC L;  2GN5 A;  4DV5 L;  1CUK A;  5HY6 A;  5IYC H;  3PCO B;  2OQ0 A;  3BJU A;  2I0Q A;  3CC2 A;  2E8G A;  4A3F H;  3PO3 G;  2Z0S A;  4BY1 G;  1GD7 A;  1GKH A;  3FP9 A;  3S24 A;  2KHI A;  4X66 Q;  3JAM c;  1YBY A;  2E5L Q;  2JA8 H;  3S17 H;  4A3C G;  4GKJ L;  4BBR G;  3A5U A;  4PZ6 A;  4JI1 Q;  4R4I A;  2BA0 A;  4IJL A;  2IX1 A;  4GN4 B;  3S1Q H;  1U0L A;  1VQ6 A;  1K0R A;  3F2C A;  3PO2 H;  4A3D H;  1YJN A;  1EIY B;  1PH7 A;  3I4N G;  1SE8 A;  2R93 H;  1KAW A;  1SFO H;  4ALP A;  1PVO A;  3TRE A;  1N32 Q;  4JCV E;  2CFM A;  5FJ8 G;  4GNX C;  3TS2 A;  2R7Z H;  1C0A A;  2JE6 I;  2FXQ A;  2PI2 A;  2RHQ B;  4QJF A;  4IPG A;  3J7Z C;  1PYS B;  4HIM A;  3MXN B;  1VQB A;  3UE1 A;  1VQ7 A;  3W1G A;  2ZTE A;  3I2Z A;  4A3B H;  4GLV B;  1TWH H;  3PUW A;  1XMO L;  4DV4 L;  3T1H L;  1EFW A;  1L1O C;  1Q8K A;  3STB C;  5C0X I;  3TQY A;  3CF5 A;  3HOW H;  4BBS H;  1K8G A;  3CW2 C;  4DR6 Q;  3M85 A;  4YCV A;  4GOP B;  2E5L L;  1TWG H;  2MO1 A;  4X66 L;  1IYJ B;  4LNQ A;  1XPU A;  4IFD J;  4JBK A;  2F52 A;  4JI1 L;  2ATW A;  2WB1 E;  2YU9 H;  3BU2 A;  1XJV A;  4UY8 C;  3NEN A;  4QY7 A;  2KCT A;  4JI0 Q;  3JAM i;  1KL9 A;  1W2B A;  3CCS A;  3RZO H;  1V1Q A;  1CKN B;  2MNA A;  4JOI C;  1YZ6 A;  2ZTD A;  1X6O A;  2OWO A;  4DV3 Q;  3I4M H;  1N32 L;  3KOJ A;  1XTD A;  1K3R A;  1VQO A;  2Q2U A;  4DUY Q;  3KDF B;  1GVP A;  2Q2I A;  4GLA C;  4UP7 A;  1IZ6 A;  5M3M G;  1DGS A;  4KI0 A;  2A1A A;  3A0J A;  1UE5 A;  1ASY A;  3GTM H;  2VNU D;  1BVS A;  1VQN A;  4GNX B;  4C3J H;  3NEM A;  1Q7Y C;  3H0G G;  4DR6 L;  1S72 A;  3RLN A;  3H3V I;  3S16 H;  2LSS A;  3K0X A;  2NN6 I;  3BZK A;  1X55 A;  1L0W A;  1Y1V G;  5C3E G;  4DR4 Q;  1Y1W G;  4GKK Q;  2UXB Q;  3PIO A;  2VY3 A;  3CC4 A;  1L1O B;  5JJK A;  3GDE A;  3G71 A;  4AYB G;  1QVC A;  2BH2 A;  2Z6K A;  2OCE A;  3PSI A;  4MTN A;  4JI0 L;  1PFS A;  2BA1 A;  4DKA C;  4OWW B;  1XNQ Q;  2NVT H;  1UE6 A;  1NJI C;  2WP8 J;  3E0E A;  3JC6 6;  4P72 A;  4LFA Q;  5IP9 H;  1RIP A;  3UE0 A;  4DV3 L;  1EYG A;  3CCL A;  4LF9 Q;  1E1O A;  3A5Z B;  5IYC G;  2VW9 A;  2LXK A;  4BXX H;  1HH2 P;  1G51 A;  2MO0 A;  5ELO A;  4A3F G;  1YI2 A;  3CCE A;  1QZH A;  3PUX A;  4P75 A;  4L5Q A;  4LUZ A;  5IWA Q;  2DUD A;  2QGQ A;  3S1R H;  2AKW B;  2PQA A;  3DM3 A;  1PH2 A;  1P16 A;  1IXR A;  1I5F A;  1X65 A;  1CSP A;  4YY3 Q;  2IX0 A;  3UDF A;  4B3S Q;  1VQ8 A;  4A3E G;  4KHP Q;  3HKS A;  1A8V A;  1J5E Q;  1OXS C;  4X64 Q;  3J81 j;  4A3I H;  4LF8 Q;  5M5W H;  3HOW G;  1HNX Q;  4AQY Q;  4MZ9 A;  1MJE A;  1PH1 A;  2QA4 A;  2NN6 G;  2R7Z G;  4DR4 L;  4GKK L;  1KC8 C;  2UXB L;  1I3Q H;  1YEZ A;  3EBE A;  3AFP A;  4JI7 L;  2HT1 A;  2RHS B;  4JYA Q;  5GAH C;  1X3G A;  2YTY A;  3CC7 A;  1KHI A;  2K5H A;  1XMQ Q;  4JI6 Q;  3GTK H;  2WFW A;  1YHQ A;  2WAQ G;  1XNQ L;  2ZJP A;  2MFI A;  3CPF A;  3I4O A;  4YCW A;  3IRB A;  4PZ7 A;  1R9T H;  2HIX A;  5GQO A;  2CWP A;  2RCN A;  4DAM A;  2R7D A;  4A3J G;  1JJ2 A;  1VQ9 A;  4LF9 L;  5C4X H;  1VQ5 A;  2JA7 G;  4BY7 H;  1Q1E A;  2B29 A;  5C44 H;  5FLM H;  3FKI G;  5IWA L;  4DV1 Q;  1QUQ A;  1Y14 B;  4DV6 Q;  1CKM A;  4AYB E;  3A74 A;  4POF A;  4O0A A;  5GAD C;  2K52 A;  3CCJ A;  3CCU A;  3KFU A;  4B3S L;  3J81 c;  4KHP L;  2ALY B;  3E9I A;  4JBW A;  1J5E L;  1E3P A;  4A93 G;  4LF8 L;  3HOU G;  3M4P A;  2OTL A;  1VQI A;  4A3K G;  4P74 A;  4AQY L;  1HNX L;  1SRO A;  3AQQ A;  4Y7N H;  3G4S A;  3I56 A;  1Q86 C;  1VQC A;  4EQ5 A;  4JYA L;  3L2P A;  5M3F G;  3CAM A;  2N8N A;  1JT8 A;  2JK8 A;  1VQ4 A;  4JI6 L;  4A3L H;  4R1J A;  1C9O A;  3HOX H;  2ZM6 Q;  1XMQ L;  2R92 H;  4DAY B;  1TWA H;  4A75 A;  1WJJ A;  3UDG A;  1UE1 A;  4JI3 Q;  1KRT A;  1JJC B;  1K73 C;  1UEB A;  2KCM A;  3RNU A;  4B3T Q;  3GTO H;  3PUZ A;  2E2I H;  2ZJQ A;  5GAE C;  1SR3 A;  1NY4 A;  1FGU A;  2UUA Q;  5IYD G;  2UXD Q;  3AFQ A;  3HOZ G;  5BR8 Q;  4DV1 L;  4DR1 Q;  3S2H H;  4DV6 L;  4OWT B;  3GO5 A;  2MQH A;  1EQR A;  3K8A A;  1BKB A;  2WAQ E;  1LTL A;  4JI2 Q;  4JI5 Q;  4DUZ Q;  2IHE A;  1Q82 C;  3WWV A;  1OXX K;  4OX9 Q;  3HOY H;  4BA2 I;  3OTO Q;  2RF4 A;  2I5M X;  1MIU A;  2D62 A;  4P71 A;  5JEA J;  1EQQ A;  1VS0 A;  1TXY A;  1K83 H;  1V43 A;  2LXJ A;  3AYH B;  5IYB H;  1TWF H;  1EUJ A;  1SMX A;  1PH9 A;  1GM5 A;  1OTC A;  3J81 i;  2K75 A;  4BXX G;  5HGQ A;  2JA5 G;  3K80 C;  1B8A A;  5EAY A;  4IFD G;  1PH4 A;  3PGZ A;  2ZM6 L;  4HJ5 A;  1FL0 A;  4JI3 L;  1KRS A;  1N34 Q;  1QVG A;  4LF7 Q;  1HNW Q;  1A62 A;  3HKZ G;  3RLO A;  4B3T L;  3Q8D A;  5LMU Q;  5IY0 A;  4DV0 Q;  5IP7 H;  5GRO A;  2EQS A;  3UDX A;  3ULP A;  2ASB A;  2UUA L;  5AJ3 Q;  2IT1 A;  2UXD L;  4ME3 A;  1D7Q A;  5BR8 L;  4A3M G;  4DR1 L;  3I55 A;  2VQE Q;  4OWX B;  4KHZ A;  1BBW A;  2B63 G;  4JI2 L;  3GTJ H;  3LGJ A;  2EXD A;  1FVI A;  4XTC S;  4OX9 L;  1VQP A;  2R7F A;  3EIV A;  2N49 A;  3OTO L;  1VQK A;  4H02 A;  3M7N A;  4AIM A;  2VL6 A;  3W1B A;  1YIJ A;  3STB D;  4GLX A;  4OO1 G;  2PI2 E;  4EX5 A;  4R4C A;  4GN3 B;  5J3B A;  4JBM A;  1IL2 A;  2JA6 H;  1S40 A;  1N33 Q;  3NEL A;  1VQE A;  4YHH Q;  3CCR A;  1PHJ A;  4JI8 Q;  1YIT A;  1N34 L;  1Q1B A;  2YTX A;  4LF7 L;  3HFZ B;  2N78 A;  3CQZ H;  2E2J H;  4B3R Q;  1HNW L;  2AWO A;  4PMW A;  5LMU L;  3HOV H;  1I94 Q;  4JI4 Q;  2I5H A;  3F2B A;  1YJW A;  4YCU A;  1GO3 E;  3S1M H;  5AJ3 L;  2NVX H;  2B3G A;  3PO3 H;  1BBU A;  4BY1 H;  2A19 A;  4LWC A;  1VQM A;  1E24 A;  4BBR H;  2VQE L;  1VQD A;  3F8T A;  4DUY L;  1N36 Q;  4AH6 A;  4A3L G;  3RR5 A;  1TWC H;  2EIF A;  5LMN Q;  3M9B A;  3CPW A;  2JA8 G;  3I4N H;  1NTG A;  3GTG H;  2PNH A;  1SRU A;  3KF6 B;  4IPC A;  2UXC Q;  5JJL A;  3PO2 G;  3G48 A;  1KD1 C;  2DGY A;  4QIW E;  4A3D G;  3EN2 A;  1HR0 Q;  2QEX A;  1KXL A;  2R93 G;  3PF4 A;  1V9P A;  4DV7 Q;  4GOP A;  2K14 A;  3RN5 A;  4DR3 Q;  4YHH L;  1L2F A;  3S15 H;  4JI8 L;  4APV A;  3I7F A;  5C4J H;  1E1T A;  3S1N H;  1I94 L;  1PH5 A;  3E9H A;  4HJ9 A;  1I50 H;  1PA6 A;  3UDI A;  1HNZ Q;  4JI4 L;  1C7Y A;  3RN2 A;  1CKN A;  1UE7 A;  4A3B G;  2PMZ E;  4K0K Q;  1VQA A;  4P73 A;  4UP8 A;  4LFA L;  4TQU S;  4R4Q A;  3RZD H;  1YVC A;  2Y0S G;  3KDF A;  4BBS G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...