1DM0B

Shiga toxin
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
69
structure length
69
Chain Sequence
TPDCVTGKVEYTKYNDDDTFTVKVGDKELFTNRWNLQSLLLSAQITGMTVTIKTNACHNGGGFSEVIFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SHIGA TOXIN A SUBUNIT
publication title Crystal structure of the holotoxin from Shigella dysenteriae at 2.5 A resolution.
pubmed doi rcsb
source organism Shigella dysenteriae
molecule tags Toxin
total genus 15
structure length 69
sequence length 69
chains with identical sequence C, D, E, F, G, H, I, J, K
ec nomenclature
pdb deposition date 1999-12-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.70 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1dm0B00
2BOSA 4P2CB 1CQFA 2GA4B 1C48A 2C5CA 4M1UB 1D1KA 3MXGA 1DM0B 1QNUA 1QOHA 1CZWA 1CZGA 1R4QB 1C4QA 2XSCA 4ULLA 1D1IA 1BOSA 1R4PB
chains in the Genus database with same CATH superfamily
1XX8A 2ZXPA 5C4HA 3AQQA 4QCLA 1O7LA 2L0CA 4MZ9A 3CF5A 2JA6H 3DM3A 3H3VI 1VQHA 4IQZA 1GUTA 1U4RA 4ABNA 1M4VA 5C4XG 3RZOB 1X54A 4DV5L 3DHQA 2EJGC 4NP5A 5IIFA 3U50C 1I4QA 2K7VA 4DK1A 3J81L 4Q5VA 1QVCA 3CCSA 1TWFB 4C3HG 2SNSA 1U4MA 3SK4A 2R7ZH 1G2SA 4GKJQ 5FLMG 3BVMA 1BVSA 1GUSA 4A3MB 1VQNA 4ZUIA 2VUMH 2PO4A 4L6TB 1Q8KA 2MQHA 4XT3B 1HRJA 2JN4A 2KJXA 3HOZH 1SNCA 3MC0B 5IY0A 2Z8LA 3CCUA 1LT4D 5C3XA 1VQAA 4XXEA 4LF7L 4A3BH 2G5DA 2DUDA 1BCPD 4LF5Q 1Z7TA 2LSSA 1Z9FA 1VQDA 4XQNA 1VF7A 2ALYB 2K32A 4IZ8A 3NEMA 1KIXA 3ERQA 4IURA 1SMXA 3H0GH 1LT6D 3R8BA 1Y14B 4K6DA 4JYAQ 2LKVA 3HOWG 2EYFA 2GVBA 2N88A 4RWSC 2Z4HA 1UEAB 2J4XA 5FO8B 1CTMA 1D2BA 4FNFA 1GHKA 1KRSA 4CKEA 2HUGA 4Y52H 2KQ3A 4PMCA 1QZGA 4I7ZC 1GOZA 4X66Q 3HKSA 1EFID 4NPSA 3F8TA 1Q8IA 3UE1A 3D4WA 5HY6A 1VQ7A 1EY5A 1CHQD 5J39A 1IBKL 1EZ6A 3VR2A 4Q0FA 1E2ZA 1W6JA 5CBEE 4UHVA 4F88A 4A3FB 4DV0L 2Z4IA 3WOFA 1E1OA 1BUVT 1I3QH 2B2YA 2BCOA 3KLSA 2AQ2B 2HCIA 2MJ8A 5FJ8H 3JC66 1EU3A 2CH4W 2ZM6Q 2BH2A 1HQRD 1D7QA 1IYUA 2P5ZX 3HOXH 1X3QA 4PG3A 5EBCA 3A56A 5FOBB 2B39A 1HNWL 4A3EB 4KJOA 3Q8DA 2B63B 2RHQB 4DK6C 1S5DD 1BBUA 3W2DA 1I50B 4B3RL 1C0AA 1QCBD 1EY6A 1NR2A 2PNRC 1YNXA 1PH9A 4K0KQ 1K3BC 4H0LC 3J81c 4EQPA 4DV7L 3PMFA 4JI2Q 2NTTA 3PF5A 1R4QB 4GNXA 2IJ0A 2HD3A 2L12A 1WTQA 2ID0A 3VYRA 4LFAQ 4HJ7A 2Z6KC 5ELNA 3ZYYX 4DV6Q 1CA5A 4R4IA 3PO2G 1HZAA 1CI3M 2O5JC 5AJ3L 3CCQA 3I73A 1SNMA 5LL6S 1V1OA 4LF8L 1VQ4A 3DXJC 1PMRA 2F0DA 2F0MA 1SE4A 3DWQA 5IT9E 4A3GH 4WJWA 2RDFA 2VB3X 1MSGA 5CYUA 2K01A 4TVAB 4JV5Q 5C44G 4A3DH 4A3KB 5KNBA 2KCMA 4WFN3 4HJAA 3M3YB 2FJ2A 5LHY1 2D0OA 3BZCA 2B2YC 5C5MA 3KLRA 1VMCA 1WI5A 2NVYH 1HHVA 3HOUH 3H15A 4LNQA 1XPRA 4DR6L 1WCMH 4DF7A 5LMUQ 3BZDB 2Y0SE 2UUAQ 1A0IA 3BDOA 1EQRA 4IUQA 3KDFA 2AKWB 2RDHA 1TXYA 4DR7Q 1HUNA 1E7ZA 2VY3A 3FDTA 1QJOA 4CKCA 3SVMA 3TS0A 1XJVA 1FJGQ 3HOYH 4GKKQ 3OHXC 5C4XB 1STEA 2IW3A 4DK3C 3S17B 5DM73 3K58A 2QKIC 2NZHA 4A3CH 3M7GA 3S1QH 4BXXG 2JK8A 2F0SA 1A2TA 1JJCB 1YEZA 2Q8RE 1JWUD 5EPKA 4NB3A 4DR4Q 4BBRH 4JI5L 5C3WA 5L37A 3S24A 1C4QA 4X6AH 4C3HB 1MKHA 1EUJA 1Z47A 5IGFA 2RDGA 1I4PA 3T1YL 3HOVH 3QIAA 1TT2A 3ULPA 2V4DA 4DV5Q 3BYYB 3NWTA 1CKNB 2EYJA 2D62A 2KEDA 4B3SL 2PW7A 3PQIA 2QF7A 4O1NA 1KHIA 3F2BA 4QB4A 4CHTB 5G3LF 4LF9Q 2B2WA 4C3JH 5JEAJ 2K4KA 1STHA 3W5OA 2DNCA 5C0XG 4GN3B 2NVXH 2BA1A 3HKZG 4G7HC 1BDOA 1JJGA 2R3ZA 2EE1A 2F0QA 5EPJA 5C4JH 5JJLA 2CQAA 1F9RA 2A5HA 1SYBA 1WTRA 1HR0L 3I4NG 1JOQA 5KNDA 2NUCA 1D1KA 1SBBB 3HOWB 4ZKBB 1L2FA 5IGEA 1K8AC 5LMNW 2UXBL 1BCPC 3S9WA 4XQQA 5LL6X 2IX3A 4CKBA 1UE7A 1XMOQ 4C2MB 4DUYQ 3DWAA 1ONLA 5BN5A 3WOEA 4DAPA 4APVA 4S3SA 3S15B 1IBLL 4MN3A 2FMMA 4KHZA 2B8GA 4K2LA 1CT1D 5M3MH 2F0NA 5C0XI 5KRUA 2IHFA 4GNXB 2NVQB 3K8AA 4LUOA 2FHTA 2IX1A 5GQOA 2XGTA 3CW2C 2WKDA 3K5LA 2CCZA 2E2HH 1IW7C 4XIGS 1CK1A 1BO0A 4OWXB 3M4OH 1J8IA 2XIWA 1TS2A 3KF6A 5M5YH 1XTDA 3JAME 1WTXA 1BCPF 4A93H 1F2ZA 2ZJRA 5LMNL 4JI3L 1K83H 3BJUA 1N33Q 1TU2B 2CW0C 1EYAA 3CPFA 1CSQA 4LWCA 3HRZC 2LMCB 5A2QE 4IFDH 3SHLA 2IX0A 2PYKA 1HNWQ 1ASYA 5I2YA 1TVXA 1EQVA 1LTGD 1CKMA 2Z0SA 3PO2B 3RN5A 3OMGA 4JBJA 1LTAD 1C8CA 4DA2A 4LFBL 2PI2E 4YWKA 1CQFA 4QGUA 4OWTB 5K36H 4A3IH 1XNQQ 4LF4L 2I5MX 3IFTA 1AEXA 1EIYB 1RCVD 4ZQ3A 1LV9A 3EVQA 1N8RC 3NQTA 4FP5D 1K73C 3FP9A 1AE2A 4EQ5A 5C44B 3S14H 4P73A 1G291 3EIVA 1E22A 3A7AB 5AJ3Q 2F0UA 1BXTA 3BVZA 5FLXc 4ME5A 1OXVA 3KOJA 2Z9HA 3R93A 2E8GA 4DV2Q 1A3UA 2VW9A 1EIFA 3A5UA 2F0IA 3NTKA 2B2TC 3BDLA 1KQSA 4ZLTF 3UDIA 2LFNA 3P7JA 3TMEA 1F9PA 1L1OC 1G6ZA 1ZYRC 3RLFA 5M5XB 2RBMA 3K6OA 3GDEA 1RHPA 1PTOC 1STBA 3PF4A 5IP9H 1S72A 2NN6G 2ICEC 1EWCA 3PCOB 2EYHA 1KDCA 2PPBC 2K52A 1NUCA 4YWLA 2AWOA 4G7OC 3Q0AA 4DV1Q 2E5LL 2JA5G 4L5QA 4A3LG 5CV7A 1QB5D 3CCRA 5J3BA 1TWGH 3BZKA 3H6MA 5IT9L 4JI7L 3K59A 1ZXTA 3TDQA 1HH2P 1PFBA 1PDQA 1NR4A 2F0WA 2ENBA 1JWSD 4QL5A 1K8OA 2AUKA 3FHWA 3A8JE 4GOPA 1STNA 4KY5A 3J81i 1NMGA 1JT8A 1I6HH 4J8QA 4AYBE 3OIPA 4KJNA 2RA4A 1Y69U 2EJFC 4A3MG 3W1BA 5C3EG 3T1YQ 1YBYA 3MFGA 3A5ZB 1WYDA 3U58A 3ULJA 2O5IC 3HKZB 4B9XA 4GN5A 1G2TA 1N32L 1PH2A 4RGOS 2E2IH 4B3SQ 1U4LA 1CM9A 1X3PA 4BS9A 1CFMA 1U5KA 2JXMB 4CDFC 4K2KA 2NN6I 4UY8C 2MO0A 3S1MH 1AH9A 1SMYC 1WTWA 1HNZQ 3I4NB 1Y1VG 3I7FA 3PSIA 2D0PA 2JQOA 1B4OA 2AQ3B 2F4VL 4BWGB 4P74A 4TQUS 3LX0A 3CP0A 4IUTA 1D6EC 1RTNA 4X3TA 5DEHA 2RSOA 1NMFA 2UXDQ 4Y7NH 1YNND 3GTLH 2BE5D 1LTTD 3J80E 1YZ6A 1CKOA 4DR2L 3KFUA 1PYSB 4JW0A 3TN2A 1HR0Q 4BBSH 3QOJA 2WAQE 3S2DB 4DAYA 1DJRD 4CJ1B 2JA8G 2EJMA 3KF6B 2XRSD 4H13C 4HMJA 1ML0D 1KXLA 1PLFA 2MO1A 2HCCA 3NELA 4QIWE 2PQAB 1CZGA 3T51B 4C3IH 4ZKCB 3EROA 2L9HA 1KAWA 4TKOB 1IBLQ 2Z1CA 3CU7A 4DUZL 4DR4L 2I46A 4HIKA 3GTOH 1F9QA 2OTLA 2EOTA 1WJJA 1EOTA 2K50A 2A73B 2UXCL 5CC4A 3QR8A 1HJPA 1NNXA 5JEAG 4HN7A 5IT9c 1WTVA 1JCKB 4PZ8A 2RKSA 2K75A 4RGTA 4X3UA 1VQ8A 1PFSA 4TSSA 1KC8C 3TP7A 3OW2A 3OOCA 4RGNA 3QO2A 1JORA 4IPCA 1LTBD 3CC4A 4YCVA 3I4MG 4KY7A 3D31A 1O78A 1PH4A 4DXGA 4CGYB 3GTJH 1SDFA 1WVLA 2OQ0A 5I9OA 2I07B 3C2PA 1HCZA 1U9RA 1IBML 3D6CA 3GD7A 1N34Q 5C4ZA 4NMZA 4X3KA 1G8ZD 1FNUA 2B2UC 3ULLA 4JI4Q 3NE5B 3K5MA 4OIJA 1YHAA 4X64L 4PZ7A 3L0OA 2DJFC 3GV3A 1AE3A 1R9TB 5I6YA 5JPMC 3JAML 3DMUA 3SE0A 2R93G 1V1PA 1RF2D 1SNPA 3EFXD 2N55A 1QUQB 2NBFA 4KHVA 4OX9L 5BR8Q 2HIXA 2OXPA 3ITPA 4GOPB 5GAHC 4KY6A 4UP9A 4LJZC 3NHHA 4NXNL 1X3GA 2F0JA 2JA5B 4H02A 4DR5L 1XPOA 5EKLA 3DLLA 1YNJD 4EGVA 2VB2X 1TY0A 4G57A 2JA9A 1B50A 1GXDC 2F0VA 4PMBA 1G91A 2YU9B 1G51A 2A8VA 4EX5A 2K5WA 5JOBA 2N3SA 3AB9A 1BBXC 1I4GA 4U68A 5JPNC 2E5LQ 2F0HA 1TWCH 3I90A 4IOCA 1GHJA 2UUCQ 3M9BA 4JI7Q 2CVRA 4AYBG 4OEMB 3NQIA 5GAEC 5C3EB 1V43A 4A3JH 2ATWA 1OXUA 1JC7A 3URYA 2VQEL 3S1NB 3CCLA 3NSWA 3MEFA 5GAGC 4B3ML 1IYVA 5FO7B 3MTSA 1TS3A 4DAYB 1STYA 1T9HA 1MGSA 1Y1VB 2XWBB 3D4DA 2A6HD 2QEJC 3H3VC 4XQJA 3F2DA 4E6IA 1N36L 3V96A 4BA1I 4YHHQ 1Q7YC 1CA6A 2MP1A 1KRTA 1D5MC 1A62A 1CKNA 1V9PA 3FKIH 3BU2A 4JI8Q 4RKBA 3M85A 3BDCA 5AFWA 5M3FG 3PO3G 4JI1L 4CDEC 3CRLC 2QDLA 3SDZA 4DR3L 1X9NA 4BY7G 1X6OA 5KYLA 2JA8B 3R3OA 4MIUA 1X65A 3S16B 2AWNA 1LTSD 3S1RH 1VMPA 5D14A 5IYBG 4FF1A 1Q12A 1WFQA 2BE5C 3HGBA 5CMDA 4U673 3K7UC 1WOCA 2EY5A 1EIHA 2JSOA 2ZJQA 2OF1A 4X65L 5M5WH 3UE0A 1QE6A 3VR3A 1LT5D 5IP7H 3GO5A 4J1MA 2NYZD 2D5DA 3DWPA 3TEHB 4P72A 1GM5A 2A6ED 1A8VA 1NE3A 2KECA 4BY1G 1VDZA 1PV4A 2Q8IB 2CQOA 2F3IA 1JMCA 1VQLA 1L0WA 2R92H 4R4CA 2ZJPA 4CJ0B 4PMWA 4LK1C 4ME3A 2JEAI 1K0RA 3BS1A 2EYOA 4DUZQ 4HIDA 2CH4A 4LMQD 4YIJA 1I4HA 3IL8A 1PTOH 1GUOA 3I4MB 3ICEA 1VQEA 3OTOQ 3GTKB 4QMGA 4IALA 3PUZA 4FVMA 1CSPA 1JB7A 1SR3A 3MXNB 3TP5A 1PH3A 1MHWC 2DY7A 3OSOA 2K5HA 1ENAA 4JI0Q 1WTPA 3F2CA 1V1PB 3TP8A 4QUFA 1Y1WG 3CQZB 2JA7G 2NZOA 2QCPX 1B9NA 4MTNA 3I56A 5HGQA 4O42A 1QVFA 3G6JB 4I7AA 3MFYA 3CC7A 5IWAL 3NBIA 4O2DA 3O13A 1PRTD 1JB3A 2A68D 2NTSA 1TR5A 2IWHA 1VQPA 3UDGA 1VQKA 1PZJD 1IBMQ 4JK1C 2R93B 4DKAC 1N9WA 1PH5A 3GTGB 1SJED 4PQXA 1E24A 4AQYQ 1J5EQ 2KHSA 4B3TL 4RKLA 4N8FA 3AFQA 3UDFA 5KIXA 1YI2A 1EYDA 4LF6Q 1AP0A 4JOIA 1IYJB 2CWAA 3MHBA 2NB0A 4X64Q 1KDAA 1H9KA 4K5XA 4LAAA 2BA0A 2EPBA 4DV4Q 4DAMA 2OWOA 2JA6G 1VS0A 1YVCA 2YTYA 3RLNA 4WRDA 2RVLA 1DXMA 4P75A 1J6QA 1OXSC 4H7BA 3CCJA 2UUBQ 3NENA 5IYDH 4OX9Q 4GNXC 3RZDH 2OCEA 1EY8A 2IPKD 3HS0C 4N9TA 3GTMH 4NXNQ 1R9TH 2R7ZG 3NP8A 1S3OA 2ZXRA 3NBHA 1BQQT 1FNVA 1EWHA 1R4PB 1YNJC 2VUMG 5NUCA 4AYBB 1UE1A 5CR3A 2O2LD 3U9SA 3VYSA 4PZ6A 4UDUC 4ZYSA 3OIQA 3HOZG 2DN8A 2K04A 1XNRL 4A3BG 4G7ZC 3HZXA 5FK9C 3FPPA 4JBWA 1VF5C 4QF4A 3WWVA 1VQOA 2F0KA 1RJTA 4ULLA 1X3EA 3NTHA 3ONAB 4FYDA 1ILPA 3I72A 1RDPD 3RZOH 2HDLA 3E9HA 3L7ZC 4HCSA 5I2XA 1QG7A 3H0GG 4PNYA 1HZ9A 3VA7A 3NUCA 2TMPA 4JBKA 1SFOB 3KJPA 1OO9B 3QWNA 1TWFH 5GROA 5M3FB 3TSSA 3KLSX 2OEOA 3PUWA 4LF7Q 3PO3B 4BY7B 4A3MH 2VXWA 2A6HC 1GUGA 4M8AA 3SGIA 1EWIA 5IGGA 3Q23A 2E2JB 3T53B 4HCEA 2M00A 1BF4A 3OYYA 4HIMA 3SEBA 1HQMC 5CBAE 3MXPA 4YY3L 4A76A 1YITA 1NCVA 1EYGA 1KL9A 2KCNA 4JI1Q 1EQQA 4UP7A 4R9WA 1SN8A 3CRKC 4QIWB 3EA6A 1IL2A 1HZBA 1EY0A 5FJ8G 1SYDA 1TWHB 3HOXG 3S2HB 2F52A 1KNEA 3RLOA 1IBKQ 2EY6A 4BY1B 5JJIA 5ELEA 3HP3A 3CHBD 3X3NA 3BG3A 1VCIA 3MXUA 4ZK9B 5HGTA 4DV0Q 3GTPB 2B2WC 1X32A 1RD9D 3E0JA 1STGA 2RQXA 2C9OA 2F0GA 4KD3A 2K14A 1X55A 1LTID 5EKIA 1SLJA 2DGYA 1I94L 3GTQB 4R4OA 1PH7A 3VA5A 2PQAA 3M4PA 4A3FH 1BOSA 1VQIA 4B3RQ 3K7AB 4N9PA 5ELFA 1JICA 3H91A 3CC2A 5IYCH 1Y1WB 4A3GG 1KLUD 3N6RA 2K03A 2KVMA 4DV7Q 2JA7B 5CV4A 3TREA 4EQOA 2K28A 4I65A 2QDBA 1EFWA 1VQBA 4A3DG 3KUPA 4KKUA 1KAAA 1IKLA 4A3EH 3C46A 3I8ZA 1NAPA 2WB1E 2B63H 1S5BD 2E2DC 4AIMA 1XPUA 1I50H 1PHJA 1ASZA 3G71A 3HOUG 1TWAB 4MHEA 4WJ4A 3NWSA 4NKLA 4LF8Q 2KA7A 4NXML 3M7NA 1WCMG 4X62L 4OO1H 1QILA 2HQLA 1T5EA 3D0FA 1SSOA 4L5RC 2IHEA 3AMUA 3JAMi 2SDFA 1XTCD 3SK6A 5IGCA 2R61A 1JQYD 2A68C 1SYEA 2Y0SG 4OELB 1SYFA 1BR9A 3TZUA 3WDNA 5CGKA 1M90C 3NBHB 2JA6B 3H3VH 2EDGA 3HOYG 4XDXA 4B3TQ 1IHZA 3J7AF 4KI0A 5T1GA 1W3SA 3PGZA 4KN4C 1P16A 4DR6Q 4A3CG 4L5TA 4B9WA 4PV1C 3MEHA 4FF3A 1FYCA 4BBRG 1GUWA 4HMIA 2VZAA 4JVZA 4A3KH 3K57A 3M3YH 5J22A 1CUKA 2PMZE 4XYOA 2R7ZB 1QUQA 1ET9A 5IOCA 1RTOA 2N8NA 3HOVG 2Q8TA 3VR6A 2MHVA 4HR7B 3H09A 1MD2D 4IOAA 2XSCA 2HQEA 2VUMB 4O0AA 5EPLA 4LUZA 4R8IA 1Y8NB 3ND9A 3N52A 3ND8A 1PRTF 1UE6A 3HOZB 4C3JG 2D2CC 4LW1A 5TSSA 3I55A 1T5XD 2WINB 3U9OA 4JI5Q 1EY4A 3K80C 4A3BB 2LS01 2H5XA 1QNUA 2K5VA 4DNRB 4GKJL 4FXDA 3KF8B 1F2YA 1KNAA 1DZ1A 1EEID 4JPBW 1SRUA 2CKZB 1F2MA 5C4XH 1PYWD 4GLXA 3S17H 1KTKA 3C1FA 3H0GB 3QOLA 4ODGA 1XNRQ 2GN5A 2N78A 3L2PA 2Q2TA 4C56C 4UAIA 4POGA 4LF5L 4C3HH 1Q1EA 4C1NI 5FLMH 4G4KA 1E1TA 1JR0D 2SNMA 1LM0A 5IODA 1JE4A 5H1SE 2X6LA 5BN3A 3QJYA 1H9RA 3HFZB 4KD4A 4OONA 3PUXA 1PRTB 3L9AX 2SOBA 1I3QB 5ELDA 1XWEA 5M3MG 1NSNS 3AFPA 1LABA 2GVAA 2H1EA 3CAMA 4X66L 2UXBQ 1DCZA 4RA8A 4POFA 1VQ5A 3CPWA 3CMEA 3CCMA 1DYQA 2B2VA 3HOXB 4GOPC 2YTXA 2Q2UA 1Y8OB 1FR3A 4YY3Q 1SE2A 1B2TA 5KYIA 4A93G 3HOWH 2G9DA 1U4PA 1KABA 4KHPL 2NVTB 4HEDA 2PQEA 2K05A 2AHOB 3NPPA 2DY8A 1GKHA 2Q2HA 2IL8A 2AQ1B 3MA2B 2PNHA 3L3OC 1ZEQX 4IFDG 3J7ZC 1RIPA 4C2MH 3PV0A 2MGSA 1CHPD 3ER0A 4HSPA 4J15A 3S15H 2ICIA 1EIGA 2XN9C 2L15A 5K36G 4A3IG 3SR1A 1M1KC 5LMNQ 1ICFB 4A3GB 1H95A 2KUMA 4JI3Q 4LFCL 2NVQH 1XXGA 1I94Q 1S40A 1OTCA 2F3VA 2ZTDA 3KBXA 2K5QA 4LFAL 4A3DB 3I4LA 1MJEA 4DV6L 3J81j 4IO9A 1XMQL 1IXRA 1UEBA 2KCCA 4AH6A 1HXYD 1Q3LA 5EKKA 5CV9A 1YJWA 3RMHA 5I4DA 1B9MA 1A15A 5EJWA 1LLRD 4LFBQ 2WB1G 1K8GA 2NVYB 3KLWA 4DPGA 3HOUB 1O7ZA 1D1IA 3I3CA 4LF4Q 4RHSA 1WCMB 5IE8A 3Q22A 2D9UA 2PI2A 1WTHA 4FXGC 2K5DA 2B2VC 2EVBA 3F2UA 4N8X1 3MXNA 4JV5L 4IFDI 3VR5A 2PZUA 5C5LA 2QW7A 3ZJYC 1VQ9A 4R4QA 3PO2H 1X56A 3OWEB 2Y0SB 3BYTB 4RCOA 1HFGA 2NWGA 1I4XA 1B8AA 1BBWA 4QUCA 2X69A 1V8QA 5IP9G 4NXMQ 1Q1BA 2QEXA 4X62Q 1F9SA 5A2QL 3HOYB 4X3SA 5LMUL 2L5TA 4JG2A 2UUAL 3S1QB 3M4QA 1X3FA 3RNUA 1Q82C 1A2UA 4BBRB 5C44H 3A8IE 4OGQC 4RG1A 4DR7L 1MI2A 3HOVB 4LUVA 2Z6BA 2F0PA 1AZPA 4DAVA 4GKKL 1JOKA 1Y8PB 4KK7A 3TBIB 4RAUC 4CJ2C 2QILA 1V1QA 2KBNA 1S5ED 5EBDA 2XTIA 2XNAC 2I5HA 3FEWX 4IUPA 1M8AA 3FMCA 4C3JB 5FLXE 1AW7A 2RHSB 2NVXB 5HURA 4IUNA 5M5XH 2YYZA 1TQOA 1UAPA 1HA5A 2VQFL 4K5WA 5C4JB 3R2TA 3B6YA 3I70A 4YCWA 1K8MA 4GN4B 4BXXH 3VYUA 4LF9L 1EEFD 2QA4A 1Q86C 1H9SB 4DNTB 3Q24A 4RCNA 4XT1B 4KKSA 2PZWA 2EYLA 2FFKB 3PIO3 1YIJA 2YV5A 4UP8A 2C5CA 5BN4A 3G6EA 3K81C 2RCFA 1A3TA 2B29A 1Q46A 1N32Q 1PXUA 4BBSG 1C9OA 1K3RA 3D4RA 2E74C 2F03A 1BKBA 3D6WA 1LTLA 3R2IA 3HKZE 4IJHA 1PYBA 1W2BA 2KHJA 2WAQG 2X6GA 3GP7A 2I0QA 2F4VQ 5M3MB 1F2LA 5JAVA 3JAMc 5C0XH 3TS2A 2NZ1D 1YHQA 3IAYA 2KCTA 4DR2Q 1XMOL 3HG9A 1YNNC 1VQGA 2Z6KA 4C3IG 4DUYL 1PZKD 1HZCA 1TS5A 4P71A 3LWEA 2E75C 2E2HB 4DR1L 3I4NH 2OQKA 4KMUC 4ZRZA 3M4OB 3T1HL 3QG1A 5M5YB 3DEOA 4A93B 1DOMA 1PZID 2A19A 3U4ZA 3E9IA 4L63B 4K6LA 2DNEA 5DAUA 1CQVA 1K83B 4WJ3M 5EQ0A 1UNSA 2CFMA 1WTOA 1E2VA 4YCUA 3A54A 1G6PA 1YHBA 3UI2A 1S5FD 1IW7D 1ENCA 3S2DH 5E3FA 2O4XA 5EGTA 4OL7A 1RL2A 2KENA 1PVOA 1KLGD 4KHPQ 2CW0D 1SE8A 2F0TA 2Q2IA 3TQYA 3ERSX 5ISRA 2R7FA 3J80L 3G4SA 4RFBA 4A3IB 2UXCQ 4OIKA 3TP6A 4ALPA 3AU7A 3EBEA 1N33L 4NDXA 1LYLA 1PH6A 3FPUB 2LY7A 2BDOA 4JC0A 1L0YB 3S14B 1K28A 3MAQA 3OMCA 2LXKA 4EVOA 1D5ZC 5D65A 2NVTH 2WB1B 1XNQL 2JYOA 2HHHL 1GO3E 3LNNA 5KEEA 5FKAC 4LFCQ 4HJ5A 4V190 4ZUJA 1B53A 4IUVA 2I5LX 2QGQA 1QVGA 1XMQQ 4EQNA 3CKIB 4FXKC 1HPCA 2IY5B 1EOVA 1QWYA 1O80A 3FVQA 3UDXA 4DV2L 5JVH3 4DFAA 4K5VA 3HEJA 1DONA 2L55A 2F4IA 3I91A 1ET6A 4KV6A 5K5PA 3CXCA 3LGJA 5COYA 4CDCC 3VYTA 1ZYRD 1QNKA 3RN2A 1UUPA 1FVIA 3F1ZA 1TWGB 1GVPA 2AMCB 5A35A 4P2CB 1PTOD 2ASBA 1PH8A 1ESFA 4KN7C 2EXDA 3K0XA 3DUZA 1ESRA 1LUZA 2PMZB 3MXGA 1S4ZA 3I2ZA 1CZWA 3A0JA 1I6HB 4DV1L 2VL6A 4R8NA 1PFNA 2EY1A 2MFIA 1ENFA 3K5OA 1I4RA 1FNWA 1SNDA 3AYHB 4DR5Q 2EQSA 3T56B 5ELBA 4A3JG 4C1NK 2VS1A 3RD4A 5CV6A 4HSVA 1YJ9A 3C1EA 2JE6I 2E2IB 4GLVB 4DV3L 3T16A 2NN6H 1RODA 3J80c 1H9JA 1HR0W 4IPDA 3S1MB 2EIFA 5KGUA 2PW5A 3PUVA 4A3LH 2JA5H 4IFDJ 4K8JA 4DK0A 1SYGA 5I6WA 3CCVA 1HNXL 2L1BA 1B1ZA 1PA6A 1GD7A 3FKIG 4Y7NB 2VQFQ 3GTLB 1QZHA 2VQEQ 1DD2A 4HJ8A 3P1HA 1SMYD 3G7LA 5F2DA 3KBGA 4JOIC 1TKWB 1JJ2A 2WP8J 2YU9H 4BBSB 1NJIC 4B3MQ 3DEPA 4RGMA 1HNZL 3DM1A 2A69D 1EU4A 5T1IA 3J7YW 1EY7A 1MBYA 2B8FA 4HAEA 3SK8A 3KF8A 1N36Q 2WAQB 1MSHA 2SEBD 2F0FA 2F1MA 1I6VC 4RMFA 1P8LA 5C3EH 2UXDL 1JOOA 5DLQE 3S1NH 4QJFA 5E4WC 2EYMA 2JJQA 5JVG3 1HUMA 4A75A 2VNUD 5FLXL 4C3IB 1FL0A 2XRQD 4WORA 1SAPA 5IP7G 1EL0A 4OXPA 4DR3Q 4KLKA 1Y1VH 1DM0B 3GTOB 1EQTA 1YJNA 5DM63 5D3IB 3X3MA 2HIVA 4YWMA 1HTLD 2XWJB 1STAA 4HTHA 2H4OA 2R92G 4DU9A 1EY9A 2M2LA 1HTPA 2R7DA 1ILQA 2A74C 2AUJD 4DR1Q 1Q81C 2EYPA 4X65Q 3T1HQ 1UWVA 3MVVA 1Z6HA 1NBWA 2JA8H 2WIIB 4R1JA 2CWPA 2IT1A 4JCVE 2BH8A 3S16H 1DGSA 1O7YA 4DXFA 2EXZA 2OT2A 4HJ9A 2JP1A 1VQCA 5M9OA 1EYCA 5D3DA 2A6EC 3GTJB 2B2TA 2FXQA 4IUUA 2KEEA 1L1OA 3K5NA 2RCNA 3A7LA 3STBD 5JJKA 4IJLA 1NTGA 4FO2A 1E3PA 2HDMA 1KDBA 2ES2A 1SXTA 5JEAH 2UU9L 1SYCA 4HIOA 1JWMD 1FD7D 2L4NA 3C3LA 3RUZA 2EZVA 4L8JA 1B3QA 1ZKOA 1TY2A 2E76C 3I4OA 2ZTEA 3J7A5 1N34L 1NY4A 2EY2A 2HHHQ 3PUYA 1B3AA 3I4MH 4IPHA 4JI4L 5JJZA 4H44C 5IWAQ 4MTKA 3GTKH 3E5SA 1PRTC 2OTJA 1II3A 5CV5A 2R6GA 2YTVA 3KDFB 4IPGA 3J81E 1A63A 1LO5D 5IYDG 3CQZH 2PCFB 1GJXA 1BCPB 5BR8L 4JI6L 4QY7A 3K0YA 4F87A 5CV8A 3E6ZX 3U4VA 5FO9B 1U0LA 1EZ8A 1A3VA 4IN3A 4MNOA 4RH6A 1TWCB 2R93H 2KHIA 3T4AC 2JEBI 3GTGH 3SXHA 1O7IA 4A4IA 2N49A 5ELCA 4V0BA 4A3JB 2WFWA 2WV6D 2BOSA 3TZDA 3KK7A 1B44D 2ZT9C 3W3AA 1ICWA 4F8MA 1DOKA 2UUCL 4L5SA 1B7YB 5ELOA 1IL8A 2ZXOA 3OW7A 1SROA 2J0TD 3SK5A 2LXJA 3FKIB 1LACA 3V05A 4FF4A 3A74A 4DV3Q 2MUYA 5KNCA 5E7NA 3A55A 2MPMA 5DNFA 4JBMA 3EN2A 1C48A 3RR5A 5E1FA 1AFPA 1VQJA 1D5XC 1SNOA 1VQMA 1FGUA 1PTOF 4YHHL 1HNXQ 2A1AA 2KOLA 3S1RB 3MZ5A 4XTCS 3M4YA 1IZ6A 1Q90A 2K6AA 1TIID 4ZAIA 1HA6A 4JI8L 2V1CC 1OXXK 3EJIA 4K14A 2ZTCA 4JYAL 1A6XA 2M9VA 4KTAA 4DGZA 1SNQA 5M5WB 1H9SA 2J7ZA 2F0EA 5J1ZA 4ZCKA 4R4TA 1SEBD 3CMAA 2A69C 2GA4B 1K0SA 4K8IA 3NTIA 4M1UB 2RSNA 1E0BA 3Q6SA 3PIPA 2F3WA 2PZTA 1SE3A 4GLAC 1XYIA 1OXTA 1K9MC 1W6KA 4FDBA 2CHBD 2R92B 2K5NA 4J6HA 1LT3D 2TSSA 2MNAA 3OPOA 3E0EA 1SFOH 5CORA 1L1OB 1HFNA 3CD6A 5M3FH 3J7AV 3PO3H 1WD0A 4BY7H 4B08A 1DOLA 1PTOB 2B2UA 1WD1A 4F7XA 2E2JH 2ZM6L 1E2WA 4CBVA 3OWFA 3KJOA 3D8GA 1I5FA 1FGBD 5IYBH 4NW2A 3PIP3 4A3FG 1S5CD 4DNIA 3NK9A 1L0XB 4ID6A 3J80i 5IYCG 1TS4A 1RKNA 3D3RA 4K0KL 1J9OA 4UPAA 2BDNA 4JI2L 4XYQA 2DJGC 4TRDA 1LTRD 2L11A 1TWHH 3BVGA 3G48A 3S2HH 2WKCA 2F0OA 3OTOL 3VR4A 4A3EG 2K1BA 4OHJA 2B63G 4BY1H 1BNZA 4CDDC 2RF4A 3NXWA 4JI0L 5GADC 3GTPH 2WACA 3E3XA 4OO1G 3CCEA 3STBC 3VDYA 3LWUA 1AZQA 3P20A 3A8KE 1C7YA 3GTQH 5I9PA 1UE5A 2UU9Q 4QQBX 4FF2A 1VQFA 4ILWA 3IFDA 1B70B 1SJHD 3P75A 5E4XA 1PH1A 1MIUA 1VQ6A 2F0LA 5C6AA 1QOHA 3K7AH 5EAYA 1GUNA 1J5EL 4AQYL 1Y1WH 4OWWB 3IRBA 3QB3A 2JA7H 1H9MA 3RZDB 4LF6L 4BA2I 3KYHC 1PFMA 3TRZA 5IGBA 4GZYC 1KD1C 2K33A 5C0XJ 4A3KG 4DV4L 3GTMB 5G3LD 3EQLC 2B3GA 3GQBA 3W1GA 4KKTA 1IKMA 2UUBL 3FRPB 5IGDA 1TWAH 1MJCA 2FINB 4GS3A 3V2TA 4Z9CB 4JI6Q 1JE5A 1FJGL 4RHRA 1D8LA 4OO1I 1F77A 3AEVA 2HT1A 3T13A 2FMCA 3GV6A 4DN4M 2G9HD 3IKJA 1AN8A 3H94A 2XVSA 3PIOA 3MWYW 2C35B
chains in the Genus database with same CATH topology
1XX8A 2ZXPA 5C4HA 4QCLA 1O7LA 2L0CA 4IQZA 1GUTA 1U4RA 4ABNA 1M4VA 3RZOB 3DHQA 2EJGC 4NP5A 5IIFA 1I4QA 2K7VA 4DK1A 3J81L 4Q5VA 1TWFB 4C3HG 2SNSA 1U4MA 3SK4A 1G2SA 3BVMA 1GUSA 4A3MB 4ZUIA 2PO4A 4L6TB 4XT3B 1HRJA 2KJXA 1SNCA 3MC0B 2Z8LA 1LT4D 5C3XA 4XXEA 1BCPD 1Z7TA 4XQNA 1VF7A 2K32A 4IZ8A 3ERQA 4IURA 1LT6D 3R8BA 4K6DA 2LKVA 2EYFA 2N88A 4RWSC 2Z4HA 1UEAB 2J4XA 5FO8B 1CTMA 1D2BA 4FNFA 1GHKA 4CKEA 2HUGA 2KQ3A 4PMCA 4I7ZC 1GOZA 1EFID 1Q8IA 3D4WA 1EY5A 1CHQD 5J39A 1EZ6A 3VR2A 4Q0FA 1E2ZA 1W6JA 5CBEE 4F88A 4A3FB 2Z4IA 3WOFA 1BUVT 2B2YA 2BCOA 3KLSA 2AQ2B 2HCIA 2MJ8A 1EU3A 1HQRD 1IYUA 1X3QA 5FOBB 5EBCA 3A56A 2B39A 4A3EB 4KJOA 2B63B 1S5DD 3W2DA 1I50B 1QCBD 1EY6A 1NR2A 2PNRC 4H0LC 4EQPA 3PMFA 2NTTA 1R4QB 2IJ0A 1WTQA 2L12A 2ID0A 3VYRA 3ZYYX 1CA5A 1CI3M 2O5JC 3I73A 1SNMA 5LL6S 1V1OA 3DXJC 1PMRA 2F0DA 2F0MA 1SE4A 3DWQA 5IT9E 4WJWA 2RDFA 2VB3X 1MSGA 5CYUA 2K01A 4A3KB 5KNBA 4WFN3 3M3YB 2FJ2A 5LHY1 2B2YC 5C5MA 3KLRA 1VMCA 1HHVA 4DF7A 3BZDB 3BDOA 4IUQA 2RDHA 1HUNA 3FDTA 1QJOA 4CKCA 3SVMA 3OHXC 5C4XB 1STEA 2IW3A 3S17B 5DM73 3K58A 2QKIC 3M7GA 2F0SA 1A2TA 2Q8RE 1JWUD 5EPKA 5C3WA 1C4QA 4C3HB 1Z47A 5IGFA 2RDGA 1I4PA 3QIAA 1TT2A 2V4DA 3BYYB 3NWTA 2EYJA 2D62A 2KEDA 2PW7A 2QF7A 4O1NA 4QB4A 4CHTB 5G3LF 2B2WA 5JEAJ 1STHA 2DNCA 5C0XG 2BA1A 4G7HC 1BDOA 2R3ZA 2EE1A 2F0QA 5EPJA 2CQAA 1F9RA 2A5HA 1SYBA 1WTRA 1JOQA 5KNDA 2NUCA 1D1KA 1SBBB 3HOWB 4ZKBB 5IGEA 1BCPC 3S9WA 4XQQA 5LL6X 2IX3A 4CKBA 4C2MB 3DWAA 1ONLA 5BN5A 3WOEA 4DAPA 3S15B 4S3SA 4MN3A 2FMMA 4KHZA 2B8GA 4K2LA 1CT1D 2F0NA 5C0XI 5KRUA 2NVQB 2FHTA 2IX1A 2WKDA 3K5LA 1IW7C 4XIGS 1CK1A 1BO0A 1J8IA 2XIWA 1TS2A 3JAME 1WTXA 1BCPF 1F2ZA 1TU2B 2CW0C 1EYAA 3HRZC 2LMCB 5A2QE 4IFDH 3SHLA 2IX0A 2PYKA 5I2YA 1TVXA 1EQVA 1LTGD 3PO2B 3OMGA 1C8CA 1LTAD 4DA2A 1CQFA 5K36H 3IFTA 1AEXA 1RCVD 4ZQ3A 1LV9A 3EVQA 3NQTA 4FP5D 5C44B 1G291 3A7AB 2F0UA 1BXTA 3BVZA 4ME5A 1OXVA 3R93A 1A3UA 2F0IA 3NTKA 2B2TC 3BDLA 4ZLTF 2LFNA 3P7JA 3TMEA 1F9PA 1G6ZA 1ZYRC 3RLFA 5M5XB 2RBMA 3K6OA 1RHPA 1PTOC 1STBA 2NN6G 2ICEC 1EWCA 2EYHA 1KDCA 2PPBC 1NUCA 2AWOA 4G7OC 3Q0AA 5CV7A 1QB5D 3H6MA 5IT9L 3K59A 1ZXTA 3TDQA 1PFBA 1PDQA 1NR4A 2F0WA 2ENBA 1JWSD 1K8OA 2AUKA 3A8JE 1STNA 4KY5A 4J8QA 3OIPA 4KJNA 2RA4A 1Y69U 2EJFC 3MFGA 2O5IC 3HKZB 4B9XA 1G2TA 4RGOS 4BS9A 1CM9A 1U4LA 1X3PA 1CFMA 2JXMB 4K2KA 2NN6I 1SMYC 1WTWA 3I4NB 1B4OA 2AQ3B 4BWGB 4TQUS 3LX0A 4IUTA 1D6EC 1RTNA 4X3TA 5DEHA 2RSOA 1YNND 2BE5D 1LTTD 3J80E 3TN2A 3QOJA 3S2DB 4DAYA 1DJRD 4CJ1B 2EJMA 2XRSD 4H13C 4HMJA 1ML0D 1PLFA 2HCCA 1CZGA 3T51B 4ZKCB 3EROA 2L9HA 4TKOB 2Z1CA 3CU7A 2I46A 1F9QA 2EOTA 1EOTA 2A73B 5CC4A 5JEAG 4HN7A 1WTVA 1JCKB 2RKSA 4RGTA 4X3UA 4TSSA 3TP7A 3OOCA 4RGNA 3QO2A 1JORA 1LTBD 4KY7A 3D31A 1O78A 4DXGA 4CGYB 1SDFA 1WVLA 5I9OA 2I07B 3C2PA 1HCZA 1U9RA 3D6CA 3GD7A 5C4ZA 4NMZA 4X3KA 1G8ZD 1FNUA 2B2UC 3NE5B 3K5MA 4OIJA 3GV3A 1R9TB 5I6YA 5JPMC 3JAML 3DMUA 3SE0A 1V1PA 1RF2D 1SNPA 3EFXD 2N55A 2NBFA 4KHVA 2OXPA 3ITPA 4KY6A 4LJZC 3NHHA 2F0JA 2JA5B 5EKLA 1YNJD 4EGVA 2VB2X 1TY0A 4G57A 1B50A 1GXDC 2F0VA 4PMBA 1G91A 2YU9B 2K5WA 5JOBA 3AB9A 1BBXC 1I4GA 4U68A 5JPNC 2F0HA 3I90A 1GHJA 2CVRA 3NQIA 5C3EB 1V43A 1OXUA 1JC7A 3URYA 3S1NB 3NSWA 1IYVA 5FO7B 3MTSA 1TS3A 1STYA 1MGSA 1Y1VB 2XWBB 3D4DA 2A6HD 2QEJC 3H3VC 4XQJA 4E6IA 3V96A 4BA1I 1CA6A 2MP1A 1D5MC 4RKBA 3M85A 3BDCA 5AFWA 3CRLC 3SDZA 5KYLA 2JA8B 3R3OA 4MIUA 3S16B 2AWNA 1LTSD 1VMPA 5D14A 4FF1A 1Q12A 2BE5C 3HGBA 4U673 5CMDA 2EY5A 1EIHA 2JSOA 2OF1A 1QE6A 3VR3A 1LT5D 3GO5A 4J1MA 2NYZD 2D5DA 3DWPA 2A6ED 2KECA 1VDZA 2Q8IB 4CJ0B 4PMWA 4LK1C 2JEAI 3BS1A 2EYOA 4LMQD 4YIJA 1I4HA 3IL8A 1PTOH 1GUOA 3I4MB 3GTKB 4QMGA 4IALA 3PUZA 4FVMA 3TP5A 2DY7A 3OSOA 1ENAA 1WTPA 1V1PB 3TP8A 4QUFA 3CQZB 2QCPX 1B9NA 4O42A 3G6JB 3MFYA 3NBIA 3O13A 1PRTD 1JB3A 2A68D 2NTSA 1TR5A 2IWHA 1PZJD 4JK1C 2R93B 3GTGB 1SJED 4PQXA 2KHSA 4RKLA 5KIXA 1EYDA 1AP0A 2NB0A 3MHBA 1KDAA 1H9KA 4K5XA 4LAAA 2BA0A 2EPBA 4WRDA 2RVLA 1DXMA 1OXSC 4H7BA 1EY8A 2IPKD 3HS0C 4N9TA 3NP8A 2ZXRA 3NBHA 1BQQT 1FNVA 1EWHA 1R4PB 1YNJC 5NUCA 4AYBB 5CR3A 2O2LD 3U9SA 3VYSA 4ZYSA 4UDUC 3OIQA 2DN8A 2K04A 4G7ZC 3HZXA 5FK9C 3FPPA 4JBWA 1VF5C 4QF4A 2F0KA 1RJTA 4ULLA 3ONAB 3NTHA 4FYDA 1ILPA 3I72A 1RDPD 2HDLA 3L7ZC 4HCSA 5I2XA 1QG7A 4PNYA 3VA7A 3NUCA 2TMPA 1SFOB 1OO9B 3QWNA 5M3FB 3TSSA 3KLSX 2OEOA 3PUWA 3PO3B 4BY7B 2VXWA 2A6HC 1GUGA 4M8AA 5IGGA 3Q23A 2E2JB 3T53B 4HCEA 2M00A 1BF4A 3SEBA 1HQMC 5CBAE 3MXPA 1NCVA 2KCNA 4R9WA 3CRKC 4QIWB 3EA6A 1EY0A 1SYDA 1TWHB 3S2HB 1KNEA 2EY6A 4BY1B 5ELEA 3HP3A 3CHBD 3X3NA 3BG3A 1VCIA 3MXUA 4ZK9B 5HGTA 3GTPB 2B2WC 1X32A 1RD9D 3E0JA 1STGA 2RQXA 2C9OA 2F0GA 4KD3A 1LTID 5EKIA 3GTQB 3VA5A 1BOSA 3K7AB 4N9PA 5ELFA 1JICA 3H91A 1Y1WB 1KLUD 3N6RA 2K03A 2KVMA 2JA7B 5CV4A 4EQOA 2K28A 4I65A 2QDBA 3KUPA 4KKUA 1KAAA 1IKLA 3C46A 3I8ZA 1NAPA 1S5BD 2E2DC 1TWAB 4MHEA 3NWSA 4NKLA 2KA7A 3M7NA 4OO1H 1QILA 1T5EA 1SSOA 3AMUA 2SDFA 1XTCD 3SK6A 5IGCA 2R61A 1JQYD 2A68C 1SYEA 3WDNA 1SYFA 1BR9A 3TZUA 5CGKA 2JA6B 2EDGA 4XDXA 1IHZA 3J7AF 4KI0A 5T1GA 4KN4C 4B9WA 4PV1C 3MEHA 4FF3A 1FYCA 1GUWA 4HMIA 3K57A 5J22A 4XYOA 2R7ZB 1ET9A 5IOCA 1RTOA 2Q8TA 3VR6A 2MHVA 4HR7B 3H09A 1MD2D 2XSCA 2HQEA 2VUMB 5EPLA 4R8IA 1Y8NB 3ND9A 3N52A 3ND8A 1PRTF 3HOZB 4C3JG 2D2CC 5TSSA 1T5XD 2WINB 3U9OA 1EY4A 4A3BB 2LS01 1QNUA 4DNRB 4FXDA 1F2YA 1KNAA 1DZ1A 1EEID 1F2MA 1PYWD 1KTKA 3C1FA 3H0GB 3QOLA 4ODGA 4C56C 4UAIA 1Q1EA 4C1NI 4G4KA 1JR0D 2SNMA 5IODA 1JE4A 2X6LA 5BN3A 3QJYA 1H9RA 4KD4A 3PUXA 1PRTB 3L9AX 2SOBA 1I3QB 5ELDA 1XWEA 1NSNS 1LABA 2H1EA 1DCZA 4RA8A 1DYQA 2B2VA 3HOXB 1Y8OB 1FR3A 1SE2A 1B2TA 5KYIA 2G9DA 1U4PA 1KABA 2NVTB 4HEDA 2PQEA 2K05A 3NPPA 2DY8A 2IL8A 2AQ1B 3MA2B 4IFDG 3L3OC 1ZEQX 3PV0A 2MGSA 1CHPD 4HSPA 2ICIA 1EIGA 2XN9C 5K36G 3SR1A 4A3GB 2KUMA 1XXGA 2F3VA 3KBXA 4A3DB 2K5QA 3I4LA 2KCCA 1HXYD 1Q3LA 5EKKA 5CV9A 5I4DA 3RMHA 1B9MA 1A15A 5EJWA 1LLRD 2NVYB 3HOUB 1O7ZA 1D1IA 3I3CA 4RHSA 1WCMB 3Q22A 2D9UA 2K5DA 4FXGC 2B2VC 2EVBA 3F2UA 3MXNA 4IFDI 3VR5A 2PZUA 5C5LA 3OWEB 2Y0SB 3BYTB 4RCOA 1HFGA 2NWGA 1I4XA 4QUCA 2X69A 1V8QA 1Q1BA 1F9SA 5A2QL 3HOYB 4X3SA 2L5TA 3S1QB 1A2UA 4BBRB 3A8IE 4OGQC 1MI2A 3HOVB 2F0PA 1AZPA 4DAVA 1JOKA 1Y8PB 4KK7A 3TBIB 4RAUC 4CJ2C 2QILA 5EBDA 1S5ED 2XNAC 3FEWX 4IUPA 1M8AA 3FMCA 4C3JB 5FLXE 1AW7A 2NVXB 5HURA 4IUNA 2YYZA 1TQOA 1UAPA 1HA5A 4K5WA 5C4JB 3R2TA 3I70A 1K8MA 3VYUA 1EEFD 1H9SB 4DNTB 3Q24A 4RCNA 4XT1B 4KKSA 2PZWA 2EYLA 2FFKB 3PIO3 2C5CA 5BN4A 1A3TA 1PXUA 3D4RA 2E74C 2F03A 3D6WA 3R2IA 2X6GA 3GP7A 5M3MB 1F2LA 5JAVA 5C0XH 2NZ1D 3IAYA 3HG9A 1YNNC 4C3IG 1PZKD 1TS5A 3LWEA 2E75C 2E2HB 4KMUC 4ZRZA 3M4OB 3QG1A 5M5YB 3DEOA 4A93B 1DOMA 1PZID 4L63B 4K6LA 2DNEA 5DAUA 1CQVA 1K83B 5EQ0A 1UNSA 1WTOA 1E2VA 3A54A 3UI2A 1S5FD 1IW7D 1ENCA 5E3FA 2O4XA 5EGTA 4OL7A 1KLGD 2CW0D 2F0TA 5ISRA 3J80L 4A3IB 4RFBA 4OIKA 3TP6A 3AU7A 4NDXA 3FPUB 2LY7A 2BDOA 1L0YB 3S14B 3MAQA 3OMCA 4EVOA 1D5ZC 5D65A 2WB1B 2JYOA 3LNNA 5KEEA 5FKAC 4V190 4ZUJA 1B53A 4IUVA 4EQNA 3CKIB 4FXKC 1HPCA 1QWYA 1O80A 3FVQA 5JVH3 4DFAA 4K5VA 3HEJA 1DONA 2L55A 2F4IA 3I91A 1ET6A 4KV6A 5K5PA 5COYA 3VYTA 1ZYRD 1QNKA 1UUPA 1TWGB 5A35A 4P2CB 1PTOD 1ESFA 4KN7C 3DUZA 1ESRA 2PMZB 3MXGA 1S4ZA 1CZWA 1I6HB 4R8NA 1PFNA 2EY1A 1ENFA 3K5OA 1I4RA 1FNWA 1SNDA 3T56B 5ELBA 4C1NK 3RD4A 5CV6A 4HSVA 3C1EA 2JE6I 2E2IB 3T16A 2NN6H 1RODA 1H9JA 3S1MB 5KGUA 2PW5A 3PUVA 4IFDJ 4K8JA 4DK0A 1SYGA 5I6WA 2L1BA 1B1ZA 4Y7NB 3GTLB 1DD2A 3P1HA 1SMYD 3G7LA 5F2DA 3KBGA 1TKWB 2WP8J 4BBSB 3DEPA 4RGMA 3DM1A 2A69D 1EU4A 5T1IA 3J7YW 1EY7A 1MBYA 2B8FA 4HAEA 3SK8A 3KF8A 2WAQB 1MSHA 2SEBD 2F0FA 2F1MA 1I6VC 1JOOA 5E4WC 2EYMA 5JVG3 1HUMA 2VNUD 5FLXL 4C3IB 2XRQD 4WORA 1SAPA 1EL0A 1DM0B 3GTOB 1EQTA 5DM63 5D3IB 3X3MA 1HTLD 2XWJB 1STAA 4HTHA 2H4OA 4DU9A 1EY9A 2M2LA 1HTPA 1ILQA 2A74C 2AUJD 2EYPA 3MVVA 1Z6HA 2WIIB 2IT1A 1O7YA 4DXFA 2EXZA 2OT2A 2JP1A 5M9OA 1EYCA 5D3DA 2A6EC 3GTJB 2B2TA 4IUUA 2KEEA 3K5NA 3A7LA 4FO2A 2HDMA 1KDBA 1SXTA 5JEAH 1SYCA 1JWMD 1FD7D 2L4NA 3C3LA 3RUZA 2EZVA 4L8JA 1ZKOA 1TY2A 2E76C 2EY2A 3PUYA 1B3AA 5JJZA 4H44C 3E5SA 1PRTC 1II3A 5CV5A 2R6GA 3J81E 1LO5D 2PCFB 1GJXA 1BCPB 3K0YA 4F87A 5CV8A 3E6ZX 5FO9B 1EZ8A 1A3VA 4IN3A 4RH6A 1TWCB 3T4AC 2JEBI 3SXHA 5ELCA 4V0BA 4A3JB 2WV6D 2BOSA 3TZDA 3KK7A 1B44D 2ZT9C 3W3AA 1ICWA 4F8MA 1DOKA 1IL8A 2ZXOA 3OW7A 2J0TD 3SK5A 3FKIB 1LACA 3V05A 4FF4A 2MUYA 5KNCA 3A55A 2MPMA 5DNFA 1C48A 5E1FA 1AFPA 1D5XC 1SNOA 1PTOF 2KOLA 3S1RB 3MZ5A 4XTCS 3M4YA 1Q90A 2K6AA 1TIID 4ZAIA 1HA6A 1OXXK 3EJIA 4K14A 1A6XA 2M9VA 4KTAA 4DGZA 1SNQA 5M5WB 1H9SA 2J7ZA 2F0EA 5J1ZA 1SEBD 2A69C 2GA4B 4K8IA 3NTIA 4M1UB 2RSNA 1E0BA 3Q6SA 2F3WA 2PZTA 1SE3A 1XYIA 1OXTA 1W6KA 2CHBD 2R92B 4J6HA 1LT3D 2TSSA 3OPOA 5CORA 1HFNA 3J7AV 1WD0A 4B08A 1DOLA 1PTOB 2B2UA 1WD1A 4F7XA 1E2WA 4CBVA 3OWFA 3D8GA 1FGBD 4NW2A 3PIP3 1S5CD 3NK9A 1L0XB 4ID6A 1TS4A 1RKNA 3D3RA 1J9OA 2BDNA 4XYQA 4TRDA 1LTRD 2L11A 3BVGA 2WKCA 2F0OA 3VR4A 2K1BA 4OHJA 1BNZA 3NXWA 2WACA 4OO1G 3LWUA 1AZQA 3P20A 3A8KE 5I9PA 4FF2A 4ILWA 3IFDA 1SJHD 3P75A 5E4XA 2F0LA 5C6AA 1QOHA 1GUNA 3QB3A 1H9MA 3RZDB 4BA2I 1PFMA 5IGBA 4GZYC 2K33A 5C0XJ 3GTMB 5G3LD 3EQLC 3GQBA 4KKTA 1IKMA 3FRPB 5IGDA 2FINB 3V2TA 4Z9CB 4RHRA 4OO1I 1F77A 3T13A 2FMCA 3GV6A 4DN4M 2G9HD 3IKJA 1AN8A 3H94A 2XVSA 3MWYW
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BOS A;  4P2C B;  1CQF A;  2GA4 B;  1C48 A;  2C5C A;  4M1U B;  1D1K A;  3MXG A;  1DM0 B;  1QNU A;  1QOH A;  1CZW A;  1CZG A;  1R4Q B;  1C4Q A;  2XSC A;  4ULL A;  1D1I A;  1BOS A;  1R4P B; 
#chains in the Genus database with same CATH topology
 1XX8 A;  2ZXP A;  5C4H A;  3AQQ A;  4QCL A;  1O7L A;  2L0C A;  4MZ9 A;  3CF5 A;  2JA6 H;  3DM3 A;  3H3V I;  1VQH A;  4IQZ A;  1GUT A;  1U4R A;  4ABN A;  1M4V A;  5C4X G;  3RZO B;  1X54 A;  4DV5 L;  3DHQ A;  2EJG C;  4NP5 A;  5IIF A;  3U50 C;  1I4Q A;  2K7V A;  4DK1 A;  3J81 L;  4Q5V A;  1QVC A;  3CCS A;  1TWF B;  4C3H G;  2SNS A;  1U4M A;  3SK4 A;  2R7Z H;  1G2S A;  4GKJ Q;  5FLM G;  3BVM A;  1BVS A;  1GUS A;  4A3M B;  1VQN A;  4ZUI A;  2VUM H;  2PO4 A;  4L6T B;  1Q8K A;  2MQH A;  4XT3 B;  1HRJ A;  2JN4 A;  2KJX A;  3HOZ H;  1SNC A;  3MC0 B;  5IY0 A;  2Z8L A;  3CCU A;  1LT4 D;  5C3X A;  1VQA A;  4XXE A;  4LF7 L;  4A3B H;  2G5D A;  2DUD A;  1BCP D;  4LF5 Q;  1Z7T A;  2LSS A;  1Z9F A;  1VQD A;  4XQN A;  1VF7 A;  2ALY B;  2K32 A;  4IZ8 A;  3NEM A;  1KIX A;  3ERQ A;  4IUR A;  1SMX A;  3H0G H;  1LT6 D;  3R8B A;  1Y14 B;  4K6D A;  4JYA Q;  2LKV A;  3HOW G;  2EYF A;  2GVB A;  2N88 A;  4RWS C;  2Z4H A;  1UEA B;  2J4X A;  5FO8 B;  1CTM A;  1D2B A;  4FNF A;  1GHK A;  1KRS A;  4CKE A;  2HUG A;  4Y52 H;  2KQ3 A;  4PMC A;  1QZG A;  4I7Z C;  1GOZ A;  4X66 Q;  3HKS A;  1EFI D;  4NPS A;  3F8T A;  1Q8I A;  3UE1 A;  3D4W A;  5HY6 A;  1VQ7 A;  1EY5 A;  1CHQ D;  5J39 A;  1IBK L;  1EZ6 A;  3VR2 A;  4Q0F A;  1E2Z A;  1W6J A;  5CBE E;  4UHV A;  4F88 A;  4A3F B;  4DV0 L;  2Z4I A;  3WOF A;  1E1O A;  1BUV T;  1I3Q H;  2B2Y A;  2BCO A;  3KLS A;  2AQ2 B;  2HCI A;  2MJ8 A;  5FJ8 H;  3JC6 6;  1EU3 A;  2CH4 W;  2ZM6 Q;  2BH2 A;  1HQR D;  1D7Q A;  1IYU A;  2P5Z X;  3HOX H;  1X3Q A;  4PG3 A;  5EBC A;  3A56 A;  5FOB B;  2B39 A;  1HNW L;  4A3E B;  4KJO A;  3Q8D A;  2B63 B;  2RHQ B;  4DK6 C;  1S5D D;  1BBU A;  3W2D A;  1I50 B;  4B3R L;  1C0A A;  1QCB D;  1EY6 A;  1NR2 A;  2PNR C;  1YNX A;  1PH9 A;  4K0K Q;  1K3B C;  4H0L C;  3J81 c;  4EQP A;  4DV7 L;  3PMF A;  4JI2 Q;  2NTT A;  3PF5 A;  1R4Q B;  4GNX A;  2IJ0 A;  2HD3 A;  2L12 A;  1WTQ A;  2ID0 A;  3VYR A;  4LFA Q;  4HJ7 A;  2Z6K C;  5ELN A;  3ZYY X;  4DV6 Q;  1CA5 A;  4R4I A;  3PO2 G;  1HZA A;  1CI3 M;  2O5J C;  5AJ3 L;  3CCQ A;  3I73 A;  1SNM A;  5LL6 S;  1V1O A;  4LF8 L;  1VQ4 A;  3DXJ C;  1PMR A;  2F0D A;  2F0M A;  1SE4 A;  3DWQ A;  5IT9 E;  4A3G H;  4WJW A;  2RDF A;  2VB3 X;  1MSG A;  5CYU A;  2K01 A;  4TVA B;  4JV5 Q;  5C44 G;  4A3D H;  4A3K B;  5KNB A;  2KCM A;  4WFN 3;  4HJA A;  3M3Y B;  2FJ2 A;  5LHY 1;  2D0O A;  3BZC A;  2B2Y C;  5C5M A;  3KLR A;  1VMC A;  1WI5 A;  2NVY H;  1HHV A;  3HOU H;  3H15 A;  4LNQ A;  1XPR A;  4DR6 L;  1WCM H;  4DF7 A;  5LMU Q;  3BZD B;  2Y0S E;  2UUA Q;  1A0I A;  3BDO A;  1EQR A;  4IUQ A;  3KDF A;  2AKW B;  2RDH A;  1TXY A;  4DR7 Q;  1HUN A;  1E7Z A;  2VY3 A;  3FDT A;  1QJO A;  4CKC A;  3SVM A;  3TS0 A;  1XJV A;  1FJG Q;  3HOY H;  4GKK Q;  3OHX C;  5C4X B;  1STE A;  2IW3 A;  4DK3 C;  3S17 B;  5DM7 3;  3K58 A;  2QKI C;  2NZH A;  4A3C H;  3M7G A;  3S1Q H;  4BXX G;  2JK8 A;  2F0S A;  1A2T A;  1JJC B;  1YEZ A;  2Q8R E;  1JWU D;  5EPK A;  4NB3 A;  4DR4 Q;  4BBR H;  4JI5 L;  5C3W A;  5L37 A;  3S24 A;  1C4Q A;  4X6A H;  4C3H B;  1MKH A;  1EUJ A;  1Z47 A;  5IGF A;  2RDG A;  1I4P A;  3T1Y L;  3HOV H;  3QIA A;  1TT2 A;  3ULP A;  2V4D A;  4DV5 Q;  3BYY B;  3NWT A;  1CKN B;  2EYJ A;  2D62 A;  2KED A;  4B3S L;  2PW7 A;  3PQI A;  2QF7 A;  4O1N A;  1KHI A;  3F2B A;  4QB4 A;  4CHT B;  5G3L F;  4LF9 Q;  2B2W A;  4C3J H;  5JEA J;  2K4K A;  1STH A;  3W5O A;  2DNC A;  5C0X G;  4GN3 B;  2NVX H;  2BA1 A;  3HKZ G;  4G7H C;  1BDO A;  1JJG A;  2R3Z A;  2EE1 A;  2F0Q A;  5EPJ A;  5C4J H;  5JJL A;  2CQA A;  1F9R A;  2A5H A;  1SYB A;  1WTR A;  1HR0 L;  3I4N G;  1JOQ A;  5KND A;  2NUC A;  1D1K A;  1SBB B;  3HOW B;  4ZKB B;  1L2F A;  5IGE A;  1K8A C;  5LMN W;  2UXB L;  1BCP C;  3S9W A;  4XQQ A;  5LL6 X;  2IX3 A;  4CKB A;  1UE7 A;  1XMO Q;  4C2M B;  4DUY Q;  3DWA A;  1ONL A;  5BN5 A;  3WOE A;  4DAP A;  4APV A;  4S3S A;  3S15 B;  1IBL L;  4MN3 A;  2FMM A;  4KHZ A;  2B8G A;  4K2L A;  1CT1 D;  5M3M H;  2F0N A;  5C0X I;  5KRU A;  2IHF A;  4GNX B;  2NVQ B;  3K8A A;  4LUO A;  2FHT A;  2IX1 A;  5GQO A;  2XGT A;  3CW2 C;  2WKD A;  3K5L A;  2CCZ A;  2E2H H;  1IW7 C;  4XIG S;  1CK1 A;  1BO0 A;  4OWX B;  3M4O H;  1J8I A;  2XIW A;  1TS2 A;  3KF6 A;  5M5Y H;  1XTD A;  3JAM E;  1WTX A;  1BCP F;  4A93 H;  1F2Z A;  2ZJR A;  5LMN L;  4JI3 L;  1K83 H;  3BJU A;  1N33 Q;  1TU2 B;  2CW0 C;  1EYA A;  3CPF A;  1CSQ A;  4LWC A;  3HRZ C;  2LMC B;  5A2Q E;  4IFD H;  3SHL A;  2IX0 A;  2PYK A;  1HNW Q;  1ASY A;  5I2Y A;  1TVX A;  1EQV A;  1LTG D;  1CKM A;  2Z0S A;  3PO2 B;  3RN5 A;  3OMG A;  4JBJ A;  1LTA D;  1C8C A;  4DA2 A;  4LFB L;  2PI2 E;  4YWK A;  1CQF A;  4QGU A;  4OWT B;  5K36 H;  4A3I H;  1XNQ Q;  4LF4 L;  2I5M X;  3IFT A;  1AEX A;  1EIY B;  1RCV D;  4ZQ3 A;  1LV9 A;  3EVQ A;  1N8R C;  3NQT A;  4FP5 D;  1K73 C;  3FP9 A;  1AE2 A;  4EQ5 A;  5C44 B;  3S14 H;  4P73 A;  1G29 1;  3EIV A;  1E22 A;  3A7A B;  5AJ3 Q;  2F0U A;  1BXT A;  3BVZ A;  5FLX c;  4ME5 A;  1OXV A;  3KOJ A;  2Z9H A;  3R93 A;  2E8G A;  4DV2 Q;  1A3U A;  2VW9 A;  1EIF A;  3A5U A;  2F0I A;  3NTK A;  2B2T C;  3BDL A;  1KQS A;  4ZLT F;  3UDI A;  2LFN A;  3P7J A;  3TME A;  1F9P A;  1L1O C;  1G6Z A;  1ZYR C;  3RLF A;  5M5X B;  2RBM A;  3K6O A;  3GDE A;  1RHP A;  1PTO C;  1STB A;  3PF4 A;  5IP9 H;  1S72 A;  2NN6 G;  2ICE C;  1EWC A;  3PCO B;  2EYH A;  1KDC A;  2PPB C;  2K52 A;  1NUC A;  4YWL A;  2AWO A;  4G7O C;  3Q0A A;  4DV1 Q;  2E5L L;  2JA5 G;  4L5Q A;  4A3L G;  5CV7 A;  1QB5 D;  3CCR A;  5J3B A;  1TWG H;  3BZK A;  3H6M A;  5IT9 L;  4JI7 L;  3K59 A;  1ZXT A;  3TDQ A;  1HH2 P;  1PFB A;  1PDQ A;  1NR4 A;  2F0W A;  2ENB A;  1JWS D;  4QL5 A;  1K8O A;  2AUK A;  3FHW A;  3A8J E;  4GOP A;  1STN A;  4KY5 A;  3J81 i;  1NMG A;  1JT8 A;  1I6H H;  4J8Q A;  4AYB E;  3OIP A;  4KJN A;  2RA4 A;  1Y69 U;  2EJF C;  4A3M G;  3W1B A;  5C3E G;  3T1Y Q;  1YBY A;  3MFG A;  3A5Z B;  1WYD A;  3U58 A;  3ULJ A;  2O5I C;  3HKZ B;  4B9X A;  4GN5 A;  1G2T A;  1N32 L;  1PH2 A;  4RGO S;  2E2I H;  4B3S Q;  1U4L A;  1CM9 A;  1X3P A;  4BS9 A;  1CFM A;  1U5K A;  2JXM B;  4CDF C;  4K2K A;  2NN6 I;  4UY8 C;  2MO0 A;  3S1M H;  1AH9 A;  1SMY C;  1WTW A;  1HNZ Q;  3I4N B;  1Y1V G;  3I7F A;  3PSI A;  2D0P A;  2JQO A;  1B4O A;  2AQ3 B;  2F4V L;  4BWG B;  4P74 A;  4TQU S;  3LX0 A;  3CP0 A;  4IUT A;  1D6E C;  1RTN A;  4X3T A;  5DEH A;  2RSO A;  1NMF A;  2UXD Q;  4Y7N H;  1YNN D;  3GTL H;  2BE5 D;  1LTT D;  3J80 E;  1YZ6 A;  1CKO A;  4DR2 L;  3KFU A;  1PYS B;  4JW0 A;  3TN2 A;  1HR0 Q;  4BBS H;  3QOJ A;  2WAQ E;  3S2D B;  4DAY A;  1DJR D;  4CJ1 B;  2JA8 G;  2EJM A;  3KF6 B;  2XRS D;  4H13 C;  4HMJ A;  1ML0 D;  1KXL A;  1PLF A;  2MO1 A;  2HCC A;  3NEL A;  4QIW E;  2PQA B;  1CZG A;  3T51 B;  4C3I H;  4ZKC B;  3ERO A;  2L9H A;  1KAW A;  4TKO B;  1IBL Q;  2Z1C A;  3CU7 A;  4DUZ L;  4DR4 L;  2I46 A;  4HIK A;  3GTO H;  1F9Q A;  2OTL A;  2EOT A;  1WJJ A;  1EOT A;  2K50 A;  2A73 B;  2UXC L;  5CC4 A;  3QR8 A;  1HJP A;  1NNX A;  5JEA G;  4HN7 A;  5IT9 c;  1WTV A;  1JCK B;  4PZ8 A;  2RKS A;  2K75 A;  4RGT A;  4X3U A;  1VQ8 A;  1PFS A;  4TSS A;  1KC8 C;  3TP7 A;  3OW2 A;  3OOC A;  4RGN A;  3QO2 A;  1JOR A;  4IPC A;  1LTB D;  3CC4 A;  4YCV A;  3I4M G;  4KY7 A;  3D31 A;  1O78 A;  1PH4 A;  4DXG A;  4CGY B;  3GTJ H;  1SDF A;  1WVL A;  2OQ0 A;  5I9O A;  2I07 B;  3C2P A;  1HCZ A;  1U9R A;  1IBM L;  3D6C A;  3GD7 A;  1N34 Q;  5C4Z A;  4NMZ A;  4X3K A;  1G8Z D;  1FNU A;  2B2U C;  3ULL A;  4JI4 Q;  3NE5 B;  3K5M A;  4OIJ A;  1YHA A;  4X64 L;  4PZ7 A;  3L0O A;  2DJF C;  3GV3 A;  1AE3 A;  1R9T B;  5I6Y A;  5JPM C;  3JAM L;  3DMU A;  3SE0 A;  2R93 G;  1V1P A;  1RF2 D;  1SNP A;  3EFX D;  2N55 A;  1QUQ B;  2NBF A;  4KHV A;  4OX9 L;  5BR8 Q;  2HIX A;  2OXP A;  3ITP A;  4GOP B;  5GAH C;  4KY6 A;  4UP9 A;  4LJZ C;  3NHH A;  4NXN L;  1X3G A;  2F0J A;  2JA5 B;  4H02 A;  4DR5 L;  1XPO A;  5EKL A;  3DLL A;  1YNJ D;  4EGV A;  2VB2 X;  1TY0 A;  4G57 A;  2JA9 A;  1B50 A;  1GXD C;  2F0V A;  4PMB A;  1G91 A;  2YU9 B;  1G51 A;  2A8V A;  4EX5 A;  2K5W A;  5JOB A;  2N3S A;  3AB9 A;  1BBX C;  1I4G A;  4U68 A;  5JPN C;  2E5L Q;  2F0H A;  1TWC H;  3I90 A;  4IOC A;  1GHJ A;  2UUC Q;  3M9B A;  4JI7 Q;  2CVR A;  4AYB G;  4OEM B;  3NQI A;  5GAE C;  5C3E B;  1V43 A;  4A3J H;  2ATW A;  1OXU A;  1JC7 A;  3URY A;  2VQE L;  3S1N B;  3CCL A;  3NSW A;  3MEF A;  5GAG C;  4B3M L;  1IYV A;  5FO7 B;  3MTS A;  1TS3 A;  4DAY B;  1STY A;  1T9H A;  1MGS A;  1Y1V B;  2XWB B;  3D4D A;  2A6H D;  2QEJ C;  3H3V C;  4XQJ A;  3F2D A;  4E6I A;  1N36 L;  3V96 A;  4BA1 I;  4YHH Q;  1Q7Y C;  1CA6 A;  2MP1 A;  1KRT A;  1D5M C;  1A62 A;  1CKN A;  1V9P A;  3FKI H;  3BU2 A;  4JI8 Q;  4RKB A;  3M85 A;  3BDC A;  5AFW A;  5M3F G;  3PO3 G;  4JI1 L;  4CDE C;  3CRL C;  2QDL A;  3SDZ A;  4DR3 L;  1X9N A;  4BY7 G;  1X6O A;  5KYL A;  2JA8 B;  3R3O A;  4MIU A;  1X65 A;  3S16 B;  2AWN A;  1LTS D;  3S1R H;  1VMP A;  5D14 A;  5IYB G;  4FF1 A;  1Q12 A;  1WFQ A;  2BE5 C;  3HGB A;  5CMD A;  4U67 3;  3K7U C;  1WOC A;  2EY5 A;  1EIH A;  2JSO A;  2ZJQ A;  2OF1 A;  4X65 L;  5M5W H;  3UE0 A;  1QE6 A;  3VR3 A;  1LT5 D;  5IP7 H;  3GO5 A;  4J1M A;  2NYZ D;  2D5D A;  3DWP A;  3TEH B;  4P72 A;  1GM5 A;  2A6E D;  1A8V A;  1NE3 A;  2KEC A;  4BY1 G;  1VDZ A;  1PV4 A;  2Q8I B;  2CQO A;  2F3I A;  1JMC A;  1VQL A;  1L0W A;  2R92 H;  4R4C A;  2ZJP A;  4CJ0 B;  4PMW A;  4LK1 C;  4ME3 A;  2JEA I;  1K0R A;  3BS1 A;  2EYO A;  4DUZ Q;  4HID A;  2CH4 A;  4LMQ D;  4YIJ A;  1I4H A;  3IL8 A;  1PTO H;  1GUO A;  3I4M B;  3ICE A;  1VQE A;  3OTO Q;  3GTK B;  4QMG A;  4IAL A;  3PUZ A;  4FVM A;  1CSP A;  1JB7 A;  1SR3 A;  3MXN B;  3TP5 A;  1PH3 A;  1MHW C;  2DY7 A;  3OSO A;  2K5H A;  1ENA A;  4JI0 Q;  1WTP A;  3F2C A;  1V1P B;  3TP8 A;  4QUF A;  1Y1W G;  3CQZ B;  2JA7 G;  2NZO A;  2QCP X;  1B9N A;  4MTN A;  3I56 A;  5HGQ A;  4O42 A;  1QVF A;  3G6J B;  4I7A A;  3MFY A;  3CC7 A;  5IWA L;  3NBI A;  4O2D A;  3O13 A;  1PRT D;  1JB3 A;  2A68 D;  2NTS A;  1TR5 A;  2IWH A;  1VQP A;  3UDG A;  1VQK A;  1PZJ D;  1IBM Q;  4JK1 C;  2R93 B;  4DKA C;  1N9W A;  1PH5 A;  3GTG B;  1SJE D;  4PQX A;  1E24 A;  4AQY Q;  1J5E Q;  2KHS A;  4B3T L;  4RKL A;  4N8F A;  3AFQ A;  3UDF A;  5KIX A;  1YI2 A;  1EYD A;  4LF6 Q;  1AP0 A;  4JOI A;  1IYJ B;  2CWA A;  3MHB A;  2NB0 A;  4X64 Q;  1KDA A;  1H9K A;  4K5X A;  4LAA A;  2BA0 A;  2EPB A;  4DV4 Q;  4DAM A;  2OWO A;  2JA6 G;  1VS0 A;  1YVC A;  2YTY A;  3RLN A;  4WRD A;  2RVL A;  1DXM A;  4P75 A;  1J6Q A;  1OXS C;  4H7B A;  3CCJ A;  2UUB Q;  3NEN A;  5IYD H;  4OX9 Q;  4GNX C;  3RZD H;  2OCE A;  1EY8 A;  2IPK D;  3HS0 C;  4N9T A;  3GTM H;  4NXN Q;  1R9T H;  2R7Z G;  3NP8 A;  1S3O A;  2ZXR A;  3NBH A;  1BQQ T;  1FNV A;  1EWH A;  1R4P B;  1YNJ C;  2VUM G;  5NUC A;  4AYB B;  1UE1 A;  5CR3 A;  2O2L D;  3U9S A;  3VYS A;  4PZ6 A;  4UDU C;  4ZYS A;  3OIQ A;  3HOZ G;  2DN8 A;  2K04 A;  1XNR L;  4A3B G;  4G7Z C;  3HZX A;  5FK9 C;  3FPP A;  4JBW A;  1VF5 C;  4QF4 A;  3WWV A;  1VQO A;  2F0K A;  1RJT A;  4ULL A;  1X3E A;  3NTH A;  3ONA B;  4FYD A;  1ILP A;  3I72 A;  1RDP D;  3RZO H;  2HDL A;  3E9H A;  3L7Z C;  4HCS A;  5I2X A;  1QG7 A;  3H0G G;  4PNY A;  1HZ9 A;  3VA7 A;  3NUC A;  2TMP A;  4JBK A;  1SFO B;  3KJP A;  1OO9 B;  3QWN A;  1TWF H;  5GRO A;  5M3F B;  3TSS A;  3KLS X;  2OEO A;  3PUW A;  4LF7 Q;  3PO3 B;  4BY7 B;  4A3M H;  2VXW A;  2A6H C;  1GUG A;  4M8A A;  3SGI A;  1EWI A;  5IGG A;  3Q23 A;  2E2J B;  3T53 B;  4HCE A;  2M00 A;  1BF4 A;  3OYY A;  4HIM A;  3SEB A;  1HQM C;  5CBA E;  3MXP A;  4YY3 L;  4A76 A;  1YIT A;  1NCV A;  1EYG A;  1KL9 A;  2KCN A;  4JI1 Q;  1EQQ A;  4UP7 A;  4R9W A;  1SN8 A;  3CRK C;  4QIW B;  3EA6 A;  1IL2 A;  1HZB A;  1EY0 A;  5FJ8 G;  1SYD A;  1TWH B;  3HOX G;  3S2H B;  2F52 A;  1KNE A;  3RLO A;  1IBK Q;  2EY6 A;  4BY1 B;  5JJI A;  5ELE A;  3HP3 A;  3CHB D;  3X3N A;  3BG3 A;  1VCI A;  3MXU A;  4ZK9 B;  5HGT A;  4DV0 Q;  3GTP B;  2B2W C;  1X32 A;  1RD9 D;  3E0J A;  1STG A;  2RQX A;  2C9O A;  2F0G A;  4KD3 A;  2K14 A;  1X55 A;  1LTI D;  5EKI A;  1SLJ A;  2DGY A;  1I94 L;  3GTQ B;  4R4O A;  1PH7 A;  3VA5 A;  2PQA A;  3M4P A;  4A3F H;  1BOS A;  1VQI A;  4B3R Q;  3K7A B;  4N9P A;  5ELF A;  1JIC A;  3H91 A;  3CC2 A;  5IYC H;  1Y1W B;  4A3G G;  1KLU D;  3N6R A;  2K03 A;  2KVM A;  4DV7 Q;  2JA7 B;  5CV4 A;  3TRE A;  4EQO A;  2K28 A;  4I65 A;  2QDB A;  1EFW A;  1VQB A;  4A3D G;  3KUP A;  4KKU A;  1KAA A;  1IKL A;  4A3E H;  3C46 A;  3I8Z A;  1NAP A;  2WB1 E;  2B63 H;  1S5B D;  2E2D C;  4AIM A;  1XPU A;  1I50 H;  1PHJ A;  1ASZ A;  3G71 A;  3HOU G;  1TWA B;  4MHE A;  4WJ4 A;  3NWS A;  4NKL A;  4LF8 Q;  2KA7 A;  4NXM L;  3M7N A;  1WCM G;  4X62 L;  4OO1 H;  1QIL A;  2HQL A;  1T5E A;  3D0F A;  1SSO A;  4L5R C;  2IHE A;  3AMU A;  3JAM i;  2SDF A;  1XTC D;  3SK6 A;  5IGC A;  2R61 A;  1JQY D;  2A68 C;  1SYE A;  2Y0S G;  4OEL B;  1SYF A;  1BR9 A;  3TZU A;  3WDN A;  5CGK A;  1M90 C;  3NBH B;  2JA6 B;  3H3V H;  2EDG A;  3HOY G;  4XDX A;  4B3T Q;  1IHZ A;  3J7A F;  4KI0 A;  5T1G A;  1W3S A;  3PGZ A;  4KN4 C;  1P16 A;  4DR6 Q;  4A3C G;  4L5T A;  4B9W A;  4PV1 C;  3MEH A;  4FF3 A;  1FYC A;  4BBR G;  1GUW A;  4HMI A;  2VZA A;  4JVZ A;  4A3K H;  3K57 A;  3M3Y H;  5J22 A;  1CUK A;  2PMZ E;  4XYO A;  2R7Z B;  1QUQ A;  1ET9 A;  5IOC A;  1RTO A;  2N8N A;  3HOV G;  2Q8T A;  3VR6 A;  2MHV A;  4HR7 B;  3H09 A;  1MD2 D;  4IOA A;  2XSC A;  2HQE A;  2VUM B;  4O0A A;  5EPL A;  4LUZ A;  4R8I A;  1Y8N B;  3ND9 A;  3N52 A;  3ND8 A;  1PRT F;  1UE6 A;  3HOZ B;  4C3J G;  2D2C C;  4LW1 A;  5TSS A;  3I55 A;  1T5X D;  2WIN B;  3U9O A;  4JI5 Q;  1EY4 A;  3K80 C;  4A3B B;  2LS0 1;  2H5X A;  1QNU A;  2K5V A;  4DNR B;  4GKJ L;  4FXD A;  3KF8 B;  1F2Y A;  1KNA A;  1DZ1 A;  1EEI D;  4JPB W;  1SRU A;  2CKZ B;  1F2M A;  5C4X H;  1PYW D;  4GLX A;  3S17 H;  1KTK A;  3C1F A;  3H0G B;  3QOL A;  4ODG A;  1XNR Q;  2GN5 A;  2N78 A;  3L2P A;  2Q2T A;  4C56 C;  4UAI A;  4POG A;  4LF5 L;  4C3H H;  1Q1E A;  4C1N I;  5FLM H;  4G4K A;  1E1T A;  1JR0 D;  2SNM A;  1LM0 A;  5IOD A;  1JE4 A;  5H1S E;  2X6L A;  5BN3 A;  3QJY A;  1H9R A;  3HFZ B;  4KD4 A;  4OON A;  3PUX A;  1PRT B;  3L9A X;  2SOB A;  1I3Q B;  5ELD A;  1XWE A;  5M3M G;  1NSN S;  3AFP A;  1LAB A;  2GVA A;  2H1E A;  3CAM A;  4X66 L;  2UXB Q;  1DCZ A;  4RA8 A;  4POF A;  1VQ5 A;  3CPW A;  3CME A;  3CCM A;  1DYQ A;  2B2V A;  3HOX B;  4GOP C;  2YTX A;  2Q2U A;  1Y8O B;  1FR3 A;  4YY3 Q;  1SE2 A;  1B2T A;  5KYI A;  4A93 G;  3HOW H;  2G9D A;  1U4P A;  1KAB A;  4KHP L;  2NVT B;  4HED A;  2PQE A;  2K05 A;  2AHO B;  3NPP A;  2DY8 A;  1GKH A;  2Q2H A;  2IL8 A;  2AQ1 B;  3MA2 B;  2PNH A;  3L3O C;  1ZEQ X;  4IFD G;  3J7Z C;  1RIP A;  4C2M H;  3PV0 A;  2MGS A;  1CHP D;  3ER0 A;  4HSP A;  4J15 A;  3S15 H;  2ICI A;  1EIG A;  2XN9 C;  2L15 A;  5K36 G;  4A3I G;  3SR1 A;  1M1K C;  5LMN Q;  1ICF B;  4A3G B;  1H95 A;  2KUM A;  4JI3 Q;  4LFC L;  2NVQ H;  1XXG A;  1I94 Q;  1S40 A;  1OTC A;  2F3V A;  2ZTD A;  3KBX A;  2K5Q A;  4LFA L;  4A3D B;  3I4L A;  1MJE A;  4DV6 L;  3J81 j;  4IO9 A;  1XMQ L;  1IXR A;  1UEB A;  2KCC A;  4AH6 A;  1HXY D;  1Q3L A;  5EKK A;  5CV9 A;  1YJW A;  3RMH A;  5I4D A;  1B9M A;  1A15 A;  5EJW A;  1LLR D;  4LFB Q;  2WB1 G;  1K8G A;  2NVY B;  3KLW A;  4DPG A;  3HOU B;  1O7Z A;  1D1I A;  3I3C A;  4LF4 Q;  4RHS A;  1WCM B;  5IE8 A;  3Q22 A;  2D9U A;  2PI2 A;  1WTH A;  4FXG C;  2K5D A;  2B2V C;  2EVB A;  3F2U A;  4N8X 1;  3MXN A;  4JV5 L;  4IFD I;  3VR5 A;  2PZU A;  5C5L A;  2QW7 A;  3ZJY C;  1VQ9 A;  4R4Q A;  3PO2 H;  1X56 A;  3OWE B;  2Y0S B;  3BYT B;  4RCO A;  1HFG A;  2NWG A;  1I4X A;  1B8A A;  1BBW A;  4QUC A;  2X69 A;  1V8Q A;  5IP9 G;  4NXM Q;  1Q1B A;  2QEX A;  4X62 Q;  1F9S A;  5A2Q L;  3HOY B;  4X3S A;  5LMU L;  2L5T A;  4JG2 A;  2UUA L;  3S1Q B;  3M4Q A;  1X3F A;  3RNU A;  1Q82 C;  1A2U A;  4BBR B;  5C44 H;  3A8I E;  4OGQ C;  4RG1 A;  4DR7 L;  1MI2 A;  3HOV B;  4LUV A;  2Z6B A;  2F0P A;  1AZP A;  4DAV A;  4GKK L;  1JOK A;  1Y8P B;  4KK7 A;  3TBI B;  4RAU C;  4CJ2 C;  2QIL A;  1V1Q A;  2KBN A;  1S5E D;  5EBD A;  2XTI A;  2XNA C;  2I5H A;  3FEW X;  4IUP A;  1M8A A;  3FMC A;  4C3J B;  5FLX E;  1AW7 A;  2RHS B;  2NVX B;  5HUR A;  4IUN A;  5M5X H;  2YYZ A;  1TQO A;  1UAP A;  1HA5 A;  2VQF L;  4K5W A;  5C4J B;  3R2T A;  3B6Y A;  3I70 A;  4YCW A;  1K8M A;  4GN4 B;  4BXX H;  3VYU A;  4LF9 L;  1EEF D;  2QA4 A;  1Q86 C;  1H9S B;  4DNT B;  3Q24 A;  4RCN A;  4XT1 B;  4KKS A;  2PZW A;  2EYL A;  2FFK B;  3PIO 3;  1YIJ A;  2YV5 A;  4UP8 A;  2C5C A;  5BN4 A;  3G6E A;  3K81 C;  2RCF A;  1A3T A;  2B29 A;  1Q46 A;  1N32 Q;  1PXU A;  4BBS G;  1C9O A;  1K3R A;  3D4R A;  2E74 C;  2F03 A;  1BKB A;  3D6W A;  1LTL A;  3R2I A;  3HKZ E;  4IJH A;  1PYB A;  1W2B A;  2KHJ A;  2WAQ G;  2X6G A;  3GP7 A;  2I0Q A;  2F4V Q;  5M3M B;  1F2L A;  5JAV A;  3JAM c;  5C0X H;  3TS2 A;  2NZ1 D;  1YHQ A;  3IAY A;  2KCT A;  4DR2 Q;  1XMO L;  3HG9 A;  1YNN C;  1VQG A;  2Z6K A;  4C3I G;  4DUY L;  1PZK D;  1HZC A;  1TS5 A;  4P71 A;  3LWE A;  2E75 C;  2E2H B;  4DR1 L;  3I4N H;  2OQK A;  4KMU C;  4ZRZ A;  3M4O B;  3T1H L;  3QG1 A;  5M5Y B;  3DEO A;  4A93 B;  1DOM A;  1PZI D;  2A19 A;  3U4Z A;  3E9I A;  4L63 B;  4K6L A;  2DNE A;  5DAU A;  1CQV A;  1K83 B;  4WJ3 M;  5EQ0 A;  1UNS A;  2CFM A;  1WTO A;  1E2V A;  4YCU A;  3A54 A;  1G6P A;  1YHB A;  3UI2 A;  1S5F D;  1IW7 D;  1ENC A;  3S2D H;  5E3F A;  2O4X A;  5EGT A;  4OL7 A;  1RL2 A;  2KEN A;  1PVO A;  1KLG D;  4KHP Q;  2CW0 D;  1SE8 A;  2F0T A;  2Q2I A;  3TQY A;  3ERS X;  5ISR A;  2R7F A;  3J80 L;  3G4S A;  4RFB A;  4A3I B;  2UXC Q;  4OIK A;  3TP6 A;  4ALP A;  3AU7 A;  3EBE A;  1N33 L;  4NDX A;  1LYL A;  1PH6 A;  3FPU B;  2LY7 A;  2BDO A;  4JC0 A;  1L0Y B;  3S14 B;  1K28 A;  3MAQ A;  3OMC A;  2LXK A;  4EVO A;  1D5Z C;  5D65 A;  2NVT H;  2WB1 B;  1XNQ L;  2JYO A;  2HHH L;  1GO3 E;  3LNN A;  5KEE A;  5FKA C;  4LFC Q;  4HJ5 A;  4V19 0;  4ZUJ A;  1B53 A;  4IUV A;  2I5L X;  2QGQ A;  1QVG A;  1XMQ Q;  4EQN A;  3CKI B;  4FXK C;  1HPC A;  2IY5 B;  1EOV A;  1QWY A;  1O80 A;  3FVQ A;  3UDX A;  4DV2 L;  5JVH 3;  4DFA A;  4K5V A;  3HEJ A;  1DON A;  2L55 A;  2F4I A;  3I91 A;  1ET6 A;  4KV6 A;  5K5P A;  3CXC A;  3LGJ A;  5COY A;  4CDC C;  3VYT A;  1ZYR D;  1QNK A;  3RN2 A;  1UUP A;  1FVI A;  3F1Z A;  1TWG B;  1GVP A;  2AMC B;  5A35 A;  4P2C B;  1PTO D;  2ASB A;  1PH8 A;  1ESF A;  4KN7 C;  2EXD A;  3K0X A;  3DUZ A;  1ESR A;  1LUZ A;  2PMZ B;  3MXG A;  1S4Z A;  3I2Z A;  1CZW A;  3A0J A;  1I6H B;  4DV1 L;  2VL6 A;  4R8N A;  1PFN A;  2EY1 A;  2MFI A;  1ENF A;  3K5O A;  1I4R A;  1FNW A;  1SND A;  3AYH B;  4DR5 Q;  2EQS A;  3T56 B;  5ELB A;  4A3J G;  4C1N K;  2VS1 A;  3RD4 A;  5CV6 A;  4HSV A;  1YJ9 A;  3C1E A;  2JE6 I;  2E2I B;  4GLV B;  4DV3 L;  3T16 A;  2NN6 H;  1ROD A;  3J80 c;  1H9J A;  1HR0 W;  4IPD A;  3S1M B;  2EIF A;  5KGU A;  2PW5 A;  3PUV A;  4A3L H;  2JA5 H;  4IFD J;  4K8J A;  4DK0 A;  1SYG A;  5I6W A;  3CCV A;  1HNX L;  2L1B A;  1B1Z A;  1PA6 A;  1GD7 A;  3FKI G;  4Y7N B;  2VQF Q;  3GTL B;  1QZH A;  2VQE Q;  1DD2 A;  4HJ8 A;  3P1H A;  1SMY D;  3G7L A;  5F2D A;  3KBG A;  4JOI C;  1TKW B;  1JJ2 A;  2WP8 J;  2YU9 H;  4BBS B;  1NJI C;  4B3M Q;  3DEP A;  4RGM A;  1HNZ L;  3DM1 A;  2A69 D;  1EU4 A;  5T1I A;  3J7Y W;  1EY7 A;  1MBY A;  2B8F A;  4HAE A;  3SK8 A;  3KF8 A;  1N36 Q;  2WAQ B;  1MSH A;  2SEB D;  2F0F A;  2F1M A;  1I6V C;  4RMF A;  1P8L A;  5C3E H;  2UXD L;  1JOO A;  5DLQ E;  3S1N H;  4QJF A;  5E4W C;  2EYM A;  2JJQ A;  5JVG 3;  1HUM A;  4A75 A;  2VNU D;  5FLX L;  4C3I B;  1FL0 A;  2XRQ D;  4WOR A;  1SAP A;  5IP7 G;  1EL0 A;  4OXP A;  4DR3 Q;  4KLK A;  1Y1V H;  1DM0 B;  3GTO B;  1EQT A;  1YJN A;  5DM6 3;  5D3I B;  3X3M A;  2HIV A;  4YWM A;  1HTL D;  2XWJ B;  1STA A;  4HTH A;  2H4O A;  2R92 G;  4DU9 A;  1EY9 A;  2M2L A;  1HTP A;  2R7D A;  1ILQ A;  2A74 C;  2AUJ D;  4DR1 Q;  1Q81 C;  2EYP A;  4X65 Q;  3T1H Q;  1UWV A;  3MVV A;  1Z6H A;  1NBW A;  2JA8 H;  2WII B;  4R1J A;  2CWP A;  2IT1 A;  4JCV E;  2BH8 A;  3S16 H;  1DGS A;  1O7Y A;  4DXF A;  2EXZ A;  2OT2 A;  4HJ9 A;  2JP1 A;  1VQC A;  5M9O A;  1EYC A;  5D3D A;  2A6E C;  3GTJ B;  2B2T A;  2FXQ A;  4IUU A;  2KEE A;  1L1O A;  3K5N A;  2RCN A;  3A7L A;  3STB D;  5JJK A;  4IJL A;  1NTG A;  4FO2 A;  1E3P A;  2HDM A;  1KDB A;  2ES2 A;  1SXT A;  5JEA H;  2UU9 L;  1SYC A;  4HIO A;  1JWM D;  1FD7 D;  2L4N A;  3C3L A;  3RUZ A;  2EZV A;  4L8J A;  1B3Q A;  1ZKO A;  1TY2 A;  2E76 C;  3I4O A;  2ZTE A;  3J7A 5;  1N34 L;  1NY4 A;  2EY2 A;  2HHH Q;  3PUY A;  1B3A A;  3I4M H;  4IPH A;  4JI4 L;  5JJZ A;  4H44 C;  5IWA Q;  4MTK A;  3GTK H;  3E5S A;  1PRT C;  2OTJ A;  1II3 A;  5CV5 A;  2R6G A;  2YTV A;  3KDF B;  4IPG A;  3J81 E;  1A63 A;  1LO5 D;  5IYD G;  3CQZ H;  2PCF B;  1GJX A;  1BCP B;  5BR8 L;  4JI6 L;  4QY7 A;  3K0Y A;  4F87 A;  5CV8 A;  3E6Z X;  3U4V A;  5FO9 B;  1U0L A;  1EZ8 A;  1A3V A;  4IN3 A;  4MNO A;  4RH6 A;  1TWC B;  2R93 H;  2KHI A;  3T4A C;  2JEB I;  3GTG H;  3SXH A;  1O7I A;  4A4I A;  2N49 A;  5ELC A;  4V0B A;  4A3J B;  2WFW A;  2WV6 D;  2BOS A;  3TZD A;  3KK7 A;  1B44 D;  2ZT9 C;  3W3A A;  1ICW A;  4F8M A;  1DOK A;  2UUC L;  4L5S A;  1B7Y B;  5ELO A;  1IL8 A;  2ZXO A;  3OW7 A;  1SRO A;  2J0T D;  3SK5 A;  2LXJ A;  3FKI B;  1LAC A;  3V05 A;  4FF4 A;  3A74 A;  4DV3 Q;  2MUY A;  5KNC A;  5E7N A;  3A55 A;  2MPM A;  5DNF A;  4JBM A;  3EN2 A;  1C48 A;  3RR5 A;  5E1F A;  1AFP A;  1VQJ A;  1D5X C;  1SNO A;  1VQM A;  1FGU A;  1PTO F;  4YHH L;  1HNX Q;  2A1A A;  2KOL A;  3S1R B;  3MZ5 A;  4XTC S;  3M4Y A;  1IZ6 A;  1Q90 A;  2K6A A;  1TII D;  4ZAI A;  1HA6 A;  4JI8 L;  2V1C C;  1OXX K;  3EJI A;  4K14 A;  2ZTC A;  4JYA L;  1A6X A;  2M9V A;  4KTA A;  4DGZ A;  1SNQ A;  5M5W B;  1H9S A;  2J7Z A;  2F0E A;  5J1Z A;  4ZCK A;  4R4T A;  1SEB D;  3CMA A;  2A69 C;  2GA4 B;  1K0S A;  4K8I A;  3NTI A;  4M1U B;  2RSN A;  1E0B A;  3Q6S A;  3PIP A;  2F3W A;  2PZT A;  1SE3 A;  4GLA C;  1XYI A;  1OXT A;  1K9M C;  1W6K A;  4FDB A;  2CHB D;  2R92 B;  2K5N A;  4J6H A;  1LT3 D;  2TSS A;  2MNA A;  3OPO A;  3E0E A;  1SFO H;  5COR A;  1L1O B;  1HFN A;  3CD6 A;  5M3F H;  3J7A V;  3PO3 H;  1WD0 A;  4BY7 H;  4B08 A;  1DOL A;  1PTO B;  2B2U A;  1WD1 A;  4F7X A;  2E2J H;  2ZM6 L;  1E2W A;  4CBV A;  3OWF A;  3KJO A;  3D8G A;  1I5F A;  1FGB D;  5IYB H;  4NW2 A;  3PIP 3;  4A3F G;  1S5C D;  4DNI A;  3NK9 A;  1L0X B;  4ID6 A;  3J80 i;  5IYC G;  1TS4 A;  1RKN A;  3D3R A;  4K0K L;  1J9O A;  4UPA A;  2BDN A;  4JI2 L;  4XYQ A;  2DJG C;  4TRD A;  1LTR D;  2L11 A;  1TWH H;  3BVG A;  3G48 A;  3S2H H;  2WKC A;  2F0O A;  3OTO L;  3VR4 A;  4A3E G;  2K1B A;  4OHJ A;  2B63 G;  4BY1 H;  1BNZ A;  4CDD C;  2RF4 A;  3NXW A;  4JI0 L;  5GAD C;  3GTP H;  2WAC A;  3E3X A;  4OO1 G;  3CCE A;  3STB C;  3VDY A;  3LWU A;  1AZQ A;  3P20 A;  3A8K E;  1C7Y A;  3GTQ H;  5I9P A;  1UE5 A;  2UU9 Q;  4QQB X;  4FF2 A;  1VQF A;  4ILW A;  3IFD A;  1B70 B;  1SJH D;  3P75 A;  5E4X A;  1PH1 A;  1MIU A;  1VQ6 A;  2F0L A;  5C6A A;  1QOH A;  3K7A H;  5EAY A;  1GUN A;  1J5E L;  4AQY L;  1Y1W H;  4OWW B;  3IRB A;  3QB3 A;  2JA7 H;  1H9M A;  3RZD B;  4LF6 L;  4BA2 I;  3KYH C;  1PFM A;  3TRZ A;  5IGB A;  4GZY C;  1KD1 C;  2K33 A;  5C0X J;  4A3K G;  4DV4 L;  3GTM B;  5G3L D;  3EQL C;  2B3G A;  3GQB A;  3W1G A;  4KKT A;  1IKM A;  2UUB L;  3FRP B;  5IGD A;  1TWA H;  1MJC A;  2FIN B;  4GS3 A;  3V2T A;  4Z9C B;  4JI6 Q;  1JE5 A;  1FJG L;  4RHR A;  1D8L A;  4OO1 I;  1F77 A;  3AEV A;  2HT1 A;  3T13 A;  2FMC A;  3GV6 A;  4DN4 M;  2G9H D;  3IKJ A;  1AN8 A;  3H94 A;  2XVS A;  3PIO A;  3MWY W;  2C35 B; 
#chains in the Genus database with same CATH homology
 1XX8 A;  2ZXP A;  5C4H A;  4QCL A;  1O7L A;  2L0C A;  4IQZ A;  1GUT A;  1U4R A;  4ABN A;  1M4V A;  3RZO B;  3DHQ A;  2EJG C;  4NP5 A;  5IIF A;  1I4Q A;  2K7V A;  4DK1 A;  3J81 L;  4Q5V A;  1TWF B;  4C3H G;  2SNS A;  1U4M A;  3SK4 A;  1G2S A;  3BVM A;  1GUS A;  4A3M B;  4ZUI A;  2PO4 A;  4L6T B;  4XT3 B;  1HRJ A;  2KJX A;  1SNC A;  3MC0 B;  2Z8L A;  1LT4 D;  5C3X A;  4XXE A;  1BCP D;  1Z7T A;  4XQN A;  1VF7 A;  2K32 A;  4IZ8 A;  3ERQ A;  4IUR A;  1LT6 D;  3R8B A;  4K6D A;  2LKV A;  2EYF A;  2N88 A;  4RWS C;  2Z4H A;  1UEA B;  2J4X A;  5FO8 B;  1CTM A;  1D2B A;  4FNF A;  1GHK A;  4CKE A;  2HUG A;  2KQ3 A;  4PMC A;  4I7Z C;  1GOZ A;  1EFI D;  1Q8I A;  3D4W A;  1EY5 A;  1CHQ D;  5J39 A;  1EZ6 A;  3VR2 A;  4Q0F A;  1E2Z A;  1W6J A;  5CBE E;  4F88 A;  4A3F B;  2Z4I A;  3WOF A;  1BUV T;  2B2Y A;  2BCO A;  3KLS A;  2AQ2 B;  2HCI A;  2MJ8 A;  1EU3 A;  1HQR D;  1IYU A;  1X3Q A;  5FOB B;  5EBC A;  3A56 A;  2B39 A;  4A3E B;  4KJO A;  2B63 B;  1S5D D;  3W2D A;  1I50 B;  1QCB D;  1EY6 A;  1NR2 A;  2PNR C;  4H0L C;  4EQP A;  3PMF A;  2NTT A;  1R4Q B;  2IJ0 A;  1WTQ A;  2L12 A;  2ID0 A;  3VYR A;  3ZYY X;  1CA5 A;  1CI3 M;  2O5J C;  3I73 A;  1SNM A;  5LL6 S;  1V1O A;  3DXJ C;  1PMR A;  2F0D A;  2F0M A;  1SE4 A;  3DWQ A;  5IT9 E;  4WJW A;  2RDF A;  2VB3 X;  1MSG A;  5CYU A;  2K01 A;  4A3K B;  5KNB A;  4WFN 3;  3M3Y B;  2FJ2 A;  5LHY 1;  2B2Y C;  5C5M A;  3KLR A;  1VMC A;  1HHV A;  4DF7 A;  3BZD B;  3BDO A;  4IUQ A;  2RDH A;  1HUN A;  3FDT A;  1QJO A;  4CKC A;  3SVM A;  3OHX C;  5C4X B;  1STE A;  2IW3 A;  3S17 B;  5DM7 3;  3K58 A;  2QKI C;  3M7G A;  2F0S A;  1A2T A;  2Q8R E;  1JWU D;  5EPK A;  5C3W A;  1C4Q A;  4C3H B;  1Z47 A;  5IGF A;  2RDG A;  1I4P A;  3QIA A;  1TT2 A;  2V4D A;  3BYY B;  3NWT A;  2EYJ A;  2D62 A;  2KED A;  2PW7 A;  2QF7 A;  4O1N A;  4QB4 A;  4CHT B;  5G3L F;  2B2W A;  5JEA J;  1STH A;  2DNC A;  5C0X G;  2BA1 A;  4G7H C;  1BDO A;  2R3Z A;  2EE1 A;  2F0Q A;  5EPJ A;  2CQA A;  1F9R A;  2A5H A;  1SYB A;  1WTR A;  1JOQ A;  5KND A;  2NUC A;  1D1K A;  1SBB B;  3HOW B;  4ZKB B;  5IGE A;  1BCP C;  3S9W A;  4XQQ A;  5LL6 X;  2IX3 A;  4CKB A;  4C2M B;  3DWA A;  1ONL A;  5BN5 A;  3WOE A;  4DAP A;  3S15 B;  4S3S A;  4MN3 A;  2FMM A;  4KHZ A;  2B8G A;  4K2L A;  1CT1 D;  2F0N A;  5C0X I;  5KRU A;  2NVQ B;  2FHT A;  2IX1 A;  2WKD A;  3K5L A;  1IW7 C;  4XIG S;  1CK1 A;  1BO0 A;  1J8I A;  2XIW A;  1TS2 A;  3JAM E;  1WTX A;  1BCP F;  1F2Z A;  1TU2 B;  2CW0 C;  1EYA A;  3HRZ C;  2LMC B;  5A2Q E;  4IFD H;  3SHL A;  2IX0 A;  2PYK A;  5I2Y A;  1TVX A;  1EQV A;  1LTG D;  3PO2 B;  3OMG A;  1C8C A;  1LTA D;  4DA2 A;  1CQF A;  5K36 H;  3IFT A;  1AEX A;  1RCV D;  4ZQ3 A;  1LV9 A;  3EVQ A;  3NQT A;  4FP5 D;  5C44 B;  1G29 1;  3A7A B;  2F0U A;  1BXT A;  3BVZ A;  4ME5 A;  1OXV A;  3R93 A;  1A3U A;  2F0I A;  3NTK A;  2B2T C;  3BDL A;  4ZLT F;  2LFN A;  3P7J A;  3TME A;  1F9P A;  1G6Z A;  1ZYR C;  3RLF A;  5M5X B;  2RBM A;  3K6O A;  1RHP A;  1PTO C;  1STB A;  2NN6 G;  2ICE C;  1EWC A;  2EYH A;  1KDC A;  2PPB C;  1NUC A;  2AWO A;  4G7O C;  3Q0A A;  5CV7 A;  1QB5 D;  3H6M A;  5IT9 L;  3K59 A;  1ZXT A;  3TDQ A;  1PFB A;  1PDQ A;  1NR4 A;  2F0W A;  2ENB A;  1JWS D;  1K8O A;  2AUK A;  3A8J E;  1STN A;  4KY5 A;  4J8Q A;  3OIP A;  4KJN A;  2RA4 A;  1Y69 U;  2EJF C;  3MFG A;  2O5I C;  3HKZ B;  4B9X A;  1G2T A;  4RGO S;  4BS9 A;  1CM9 A;  1U4L A;  1X3P A;  1CFM A;  2JXM B;  4K2K A;  2NN6 I;  1SMY C;  1WTW A;  3I4N B;  1B4O A;  2AQ3 B;  4BWG B;  4TQU S;  3LX0 A;  4IUT A;  1D6E C;  1RTN A;  4X3T A;  5DEH A;  2RSO A;  1YNN D;  2BE5 D;  1LTT D;  3J80 E;  3TN2 A;  3QOJ A;  3S2D B;  4DAY A;  1DJR D;  4CJ1 B;  2EJM A;  2XRS D;  4H13 C;  4HMJ A;  1ML0 D;  1PLF A;  2HCC A;  1CZG A;  3T51 B;  4ZKC B;  3ERO A;  2L9H A;  4TKO B;  2Z1C A;  3CU7 A;  2I46 A;  1F9Q A;  2EOT A;  1EOT A;  2A73 B;  5CC4 A;  5JEA G;  4HN7 A;  1WTV A;  1JCK B;  2RKS A;  4RGT A;  4X3U A;  4TSS A;  3TP7 A;  3OOC A;  4RGN A;  3QO2 A;  1JOR A;  1LTB D;  4KY7 A;  3D31 A;  1O78 A;  4DXG A;  4CGY B;  1SDF A;  1WVL A;  5I9O A;  2I07 B;  3C2P A;  1HCZ A;  1U9R A;  3D6C A;  3GD7 A;  5C4Z A;  4NMZ A;  4X3K A;  1G8Z D;  1FNU A;  2B2U C;  3NE5 B;  3K5M A;  4OIJ A;  3GV3 A;  1R9T B;  5I6Y A;  5JPM C;  3JAM L;  3DMU A;  3SE0 A;  1V1P A;  1RF2 D;  1SNP A;  3EFX D;  2N55 A;  2NBF A;  4KHV A;  2OXP A;  3ITP A;  4KY6 A;  4LJZ C;  3NHH A;  2F0J A;  2JA5 B;  5EKL A;  1YNJ D;  4EGV A;  2VB2 X;  1TY0 A;  4G57 A;  1B50 A;  1GXD C;  2F0V A;  4PMB A;  1G91 A;  2YU9 B;  2K5W A;  5JOB A;  3AB9 A;  1BBX C;  1I4G A;  4U68 A;  5JPN C;  2F0H A;  3I90 A;  1GHJ A;  2CVR A;  3NQI A;  5C3E B;  1V43 A;  1OXU A;  1JC7 A;  3URY A;  3S1N B;  3NSW A;  1IYV A;  5FO7 B;  3MTS A;  1TS3 A;  1STY A;  1MGS A;  1Y1V B;  2XWB B;  3D4D A;  2A6H D;  2QEJ C;  3H3V C;  4XQJ A;  4E6I A;  3V96 A;  4BA1 I;  1CA6 A;  2MP1 A;  1D5M C;  4RKB A;  3M85 A;  3BDC A;  5AFW A;  3CRL C;  3SDZ A;  5KYL A;  2JA8 B;  3R3O A;  4MIU A;  3S16 B;  2AWN A;  1LTS D;  1VMP A;  5D14 A;  4FF1 A;  1Q12 A;  2BE5 C;  3HGB A;  4U67 3;  5CMD A;  2EY5 A;  1EIH A;  2JSO A;  2OF1 A;  1QE6 A;  3VR3 A;  1LT5 D;  3GO5 A;  4J1M A;  2NYZ D;  2D5D A;  3DWP A;  2A6E D;  2KEC A;  1VDZ A;  2Q8I B;  4CJ0 B;  4PMW A;  4LK1 C;  2JEA I;  3BS1 A;  2EYO A;  4LMQ D;  4YIJ A;  1I4H A;  3IL8 A;  1PTO H;  1GUO A;  3I4M B;  3GTK B;  4QMG A;  4IAL A;  3PUZ A;  4FVM A;  3TP5 A;  2DY7 A;  3OSO A;  1ENA A;  1WTP A;  1V1P B;  3TP8 A;  4QUF A;  3CQZ B;  2QCP X;  1B9N A;  4O42 A;  3G6J B;  3MFY A;  3NBI A;  3O13 A;  1PRT D;  1JB3 A;  2A68 D;  2NTS A;  1TR5 A;  2IWH A;  1PZJ D;  4JK1 C;  2R93 B;  3GTG B;  1SJE D;  4PQX A;  2KHS A;  4RKL A;  5KIX A;  1EYD A;  1AP0 A;  2NB0 A;  3MHB A;  1KDA A;  1H9K A;  4K5X A;  4LAA A;  2BA0 A;  2EPB A;  4WRD A;  2RVL A;  1DXM A;  1OXS C;  4H7B A;  1EY8 A;  2IPK D;  3HS0 C;  4N9T A;  3NP8 A;  2ZXR A;  3NBH A;  1BQQ T;  1FNV A;  1EWH A;  1R4P B;  1YNJ C;  5NUC A;  4AYB B;  5CR3 A;  2O2L D;  3U9S A;  3VYS A;  4ZYS A;  4UDU C;  3OIQ A;  2DN8 A;  2K04 A;  4G7Z C;  3HZX A;  5FK9 C;  3FPP A;  4JBW A;  1VF5 C;  4QF4 A;  2F0K A;  1RJT A;  4ULL A;  3ONA B;  3NTH A;  4FYD A;  1ILP A;  3I72 A;  1RDP D;  2HDL A;  3L7Z C;  4HCS A;  5I2X A;  1QG7 A;  4PNY A;  3VA7 A;  3NUC A;  2TMP A;  1SFO B;  1OO9 B;  3QWN A;  5M3F B;  3TSS A;  3KLS X;  2OEO A;  3PUW A;  3PO3 B;  4BY7 B;  2VXW A;  2A6H C;  1GUG A;  4M8A A;  5IGG A;  3Q23 A;  2E2J B;  3T53 B;  4HCE A;  2M00 A;  1BF4 A;  3SEB A;  1HQM C;  5CBA E;  3MXP A;  1NCV A;  2KCN A;  4R9W A;  3CRK C;  4QIW B;  3EA6 A;  1EY0 A;  1SYD A;  1TWH B;  3S2H B;  1KNE A;  2EY6 A;  4BY1 B;  5ELE A;  3HP3 A;  3CHB D;  3X3N A;  3BG3 A;  1VCI A;  3MXU A;  4ZK9 B;  5HGT A;  3GTP B;  2B2W C;  1X32 A;  1RD9 D;  3E0J A;  1STG A;  2RQX A;  2C9O A;  2F0G A;  4KD3 A;  1LTI D;  5EKI A;  3GTQ B;  3VA5 A;  1BOS A;  3K7A B;  4N9P A;  5ELF A;  1JIC A;  3H91 A;  1Y1W B;  1KLU D;  3N6R A;  2K03 A;  2KVM A;  2JA7 B;  5CV4 A;  4EQO A;  2K28 A;  4I65 A;  2QDB A;  3KUP A;  4KKU A;  1KAA A;  1IKL A;  3C46 A;  3I8Z A;  1NAP A;  1S5B D;  2E2D C;  1TWA B;  4MHE A;  3NWS A;  4NKL A;  2KA7 A;  3M7N A;  4OO1 H;  1QIL A;  1T5E A;  1SSO A;  3AMU A;  2SDF A;  1XTC D;  3SK6 A;  5IGC A;  2R61 A;  1JQY D;  2A68 C;  1SYE A;  3WDN A;  1SYF A;  1BR9 A;  3TZU A;  5CGK A;  2JA6 B;  2EDG A;  4XDX A;  1IHZ A;  3J7A F;  4KI0 A;  5T1G A;  4KN4 C;  4B9W A;  4PV1 C;  3MEH A;  4FF3 A;  1FYC A;  1GUW A;  4HMI A;  3K57 A;  5J22 A;  4XYO A;  2R7Z B;  1ET9 A;  5IOC A;  1RTO A;  2Q8T A;  3VR6 A;  2MHV A;  4HR7 B;  3H09 A;  1MD2 D;  2XSC A;  2HQE A;  2VUM B;  5EPL A;  4R8I A;  1Y8N B;  3ND9 A;  3N52 A;  3ND8 A;  1PRT F;  3HOZ B;  4C3J G;  2D2C C;  5TSS A;  1T5X D;  2WIN B;  3U9O A;  1EY4 A;  4A3B B;  2LS0 1;  1QNU A;  4DNR B;  4FXD A;  1F2Y A;  1KNA A;  1DZ1 A;  1EEI D;  1F2M A;  1PYW D;  1KTK A;  3C1F A;  3H0G B;  3QOL A;  4ODG A;  4C56 C;  4UAI A;  1Q1E A;  4C1N I;  4G4K A;  1JR0 D;  2SNM A;  5IOD A;  1JE4 A;  2X6L A;  5BN3 A;  3QJY A;  1H9R A;  4KD4 A;  3PUX A;  1PRT B;  3L9A X;  2SOB A;  1I3Q B;  5ELD A;  1XWE A;  1NSN S;  1LAB A;  2H1E A;  1DCZ A;  4RA8 A;  1DYQ A;  2B2V A;  3HOX B;  1Y8O B;  1FR3 A;  1SE2 A;  1B2T A;  5KYI A;  2G9D A;  1U4P A;  1KAB A;  2NVT B;  4HED A;  2PQE A;  2K05 A;  3NPP A;  2DY8 A;  2IL8 A;  2AQ1 B;  3MA2 B;  4IFD G;  3L3O C;  1ZEQ X;  3PV0 A;  2MGS A;  1CHP D;  4HSP A;  2ICI A;  1EIG A;  2XN9 C;  5K36 G;  3SR1 A;  4A3G B;  2KUM A;  1XXG A;  2F3V A;  3KBX A;  4A3D B;  2K5Q A;  3I4L A;  2KCC A;  1HXY D;  1Q3L A;  5EKK A;  5CV9 A;  5I4D A;  3RMH A;  1B9M A;  1A15 A;  5EJW A;  1LLR D;  2NVY B;  3HOU B;  1O7Z A;  1D1I A;  3I3C A;  4RHS A;  1WCM B;  3Q22 A;  2D9U A;  2K5D A;  4FXG C;  2B2V C;  2EVB A;  3F2U A;  3MXN A;  4IFD I;  3VR5 A;  2PZU A;  5C5L A;  3OWE B;  2Y0S B;  3BYT B;  4RCO A;  1HFG A;  2NWG A;  1I4X A;  4QUC A;  2X69 A;  1V8Q A;  1Q1B A;  1F9S A;  5A2Q L;  3HOY B;  4X3S A;  2L5T A;  3S1Q B;  1A2U A;  4BBR B;  3A8I E;  4OGQ C;  1MI2 A;  3HOV B;  2F0P A;  1AZP A;  4DAV A;  1JOK A;  1Y8P B;  4KK7 A;  3TBI B;  4RAU C;  4CJ2 C;  2QIL A;  5EBD A;  1S5E D;  2XNA C;  3FEW X;  4IUP A;  1M8A A;  3FMC A;  4C3J B;  5FLX E;  1AW7 A;  2NVX B;  5HUR A;  4IUN A;  2YYZ A;  1TQO A;  1UAP A;  1HA5 A;  4K5W A;  5C4J B;  3R2T A;  3I70 A;  1K8M A;  3VYU A;  1EEF D;  1H9S B;  4DNT B;  3Q24 A;  4RCN A;  4XT1 B;  4KKS A;  2PZW A;  2EYL A;  2FFK B;  3PIO 3;  2C5C A;  5BN4 A;  1A3T A;  1PXU A;  3D4R A;  2E74 C;  2F03 A;  3D6W A;  3R2I A;  2X6G A;  3GP7 A;  5M3M B;  1F2L A;  5JAV A;  5C0X H;  2NZ1 D;  3IAY A;  3HG9 A;  1YNN C;  4C3I G;  1PZK D;  1TS5 A;  3LWE A;  2E75 C;  2E2H B;  4KMU C;  4ZRZ A;  3M4O B;  3QG1 A;  5M5Y B;  3DEO A;  4A93 B;  1DOM A;  1PZI D;  4L63 B;  4K6L A;  2DNE A;  5DAU A;  1CQV A;  1K83 B;  5EQ0 A;  1UNS A;  1WTO A;  1E2V A;  3A54 A;  3UI2 A;  1S5F D;  1IW7 D;  1ENC A;  5E3F A;  2O4X A;  5EGT A;  4OL7 A;  1KLG D;  2CW0 D;  2F0T A;  5ISR A;  3J80 L;  4A3I B;  4RFB A;  4OIK A;  3TP6 A;  3AU7 A;  4NDX A;  3FPU B;  2LY7 A;  2BDO A;  1L0Y B;  3S14 B;  3MAQ A;  3OMC A;  4EVO A;  1D5Z C;  5D65 A;  2WB1 B;  2JYO A;  3LNN A;  5KEE A;  5FKA C;  4V19 0;  4ZUJ A;  1B53 A;  4IUV A;  4EQN A;  3CKI B;  4FXK C;  1HPC A;  1QWY A;  1O80 A;  3FVQ A;  5JVH 3;  4DFA A;  4K5V A;  3HEJ A;  1DON A;  2L55 A;  2F4I A;  3I91 A;  1ET6 A;  4KV6 A;  5K5P A;  5COY A;  3VYT A;  1ZYR D;  1QNK A;  1UUP A;  1TWG B;  5A35 A;  4P2C B;  1PTO D;  1ESF A;  4KN7 C;  3DUZ A;  1ESR A;  2PMZ B;  3MXG A;  1S4Z A;  1CZW A;  1I6H B;  4R8N A;  1PFN A;  2EY1 A;  1ENF A;  3K5O A;  1I4R A;  1FNW A;  1SND A;  3T56 B;  5ELB A;  4C1N K;  3RD4 A;  5CV6 A;  4HSV A;  3C1E A;  2JE6 I;  2E2I B;  3T16 A;  2NN6 H;  1ROD A;  1H9J A;  3S1M B;  5KGU A;  2PW5 A;  3PUV A;  4IFD J;  4K8J A;  4DK0 A;  1SYG A;  5I6W A;  2L1B A;  1B1Z A;  4Y7N B;  3GTL B;  1DD2 A;  3P1H A;  1SMY D;  3G7L A;  5F2D A;  3KBG A;  1TKW B;  2WP8 J;  4BBS B;  3DEP A;  4RGM A;  3DM1 A;  2A69 D;  1EU4 A;  5T1I A;  3J7Y W;  1EY7 A;  1MBY A;  2B8F A;  4HAE A;  3SK8 A;  3KF8 A;  2WAQ B;  1MSH A;  2SEB D;  2F0F A;  2F1M A;  1I6V C;  1JOO A;  5E4W C;  2EYM A;  5JVG 3;  1HUM A;  2VNU D;  5FLX L;  4C3I B;  2XRQ D;  4WOR A;  1SAP A;  1EL0 A;  1DM0 B;  3GTO B;  1EQT A;  5DM6 3;  5D3I B;  3X3M A;  1HTL D;  2XWJ B;  1STA A;  4HTH A;  2H4O A;  4DU9 A;  1EY9 A;  2M2L A;  1HTP A;  1ILQ A;  2A74 C;  2AUJ D;  2EYP A;  3MVV A;  1Z6H A;  2WII B;  2IT1 A;  1O7Y A;  4DXF A;  2EXZ A;  2OT2 A;  2JP1 A;  5M9O A;  1EYC A;  5D3D A;  2A6E C;  3GTJ B;  2B2T A;  4IUU A;  2KEE A;  3K5N A;  3A7L A;  4FO2 A;  2HDM A;  1KDB A;  1SXT A;  5JEA H;  1SYC A;  1JWM D;  1FD7 D;  2L4N A;  3C3L A;  3RUZ A;  2EZV A;  4L8J A;  1ZKO A;  1TY2 A;  2E76 C;  2EY2 A;  3PUY A;  1B3A A;  5JJZ A;  4H44 C;  3E5S A;  1PRT C;  1II3 A;  5CV5 A;  2R6G A;  3J81 E;  1LO5 D;  2PCF B;  1GJX A;  1BCP B;  3K0Y A;  4F87 A;  5CV8 A;  3E6Z X;  5FO9 B;  1EZ8 A;  1A3V A;  4IN3 A;  4RH6 A;  1TWC B;  3T4A C;  2JEB I;  3SXH A;  5ELC A;  4V0B A;  4A3J B;  2WV6 D;  2BOS A;  3TZD A;  3KK7 A;  1B44 D;  2ZT9 C;  3W3A A;  1ICW A;  4F8M A;  1DOK A;  1IL8 A;  2ZXO A;  3OW7 A;  2J0T D;  3SK5 A;  3FKI B;  1LAC A;  3V05 A;  4FF4 A;  2MUY A;  5KNC A;  3A55 A;  2MPM A;  5DNF A;  1C48 A;  5E1F A;  1AFP A;  1D5X C;  1SNO A;  1PTO F;  2KOL A;  3S1R B;  3MZ5 A;  4XTC S;  3M4Y A;  1Q90 A;  2K6A A;  1TII D;  4ZAI A;  1HA6 A;  1OXX K;  3EJI A;  4K14 A;  1A6X A;  2M9V A;  4KTA A;  4DGZ A;  1SNQ A;  5M5W B;  1H9S A;  2J7Z A;  2F0E A;  5J1Z A;  1SEB D;  2A69 C;  2GA4 B;  4K8I A;  3NTI A;  4M1U B;  2RSN A;  1E0B A;  3Q6S A;  2F3W A;  2PZT A;  1SE3 A;  1XYI A;  1OXT A;  1W6K A;  2CHB D;  2R92 B;  4J6H A;  1LT3 D;  2TSS A;  3OPO A;  5COR A;  1HFN A;  3J7A V;  1WD0 A;  4B08 A;  1DOL A;  1PTO B;  2B2U A;  1WD1 A;  4F7X A;  1E2W A;  4CBV A;  3OWF A;  3D8G A;  1FGB D;  4NW2 A;  3PIP 3;  1S5C D;  3NK9 A;  1L0X B;  4ID6 A;  1TS4 A;  1RKN A;  3D3R A;  1J9O A;  2BDN A;  4XYQ A;  4TRD A;  1LTR D;  2L11 A;  3BVG A;  2WKC A;  2F0O A;  3VR4 A;  2K1B A;  4OHJ A;  1BNZ A;  3NXW A;  2WAC A;  4OO1 G;  3LWU A;  1AZQ A;  3P20 A;  3A8K E;  5I9P A;  4FF2 A;  4ILW A;  3IFD A;  1SJH D;  3P75 A;  5E4X A;  2F0L A;  5C6A A;  1QOH A;  1GUN A;  3QB3 A;  1H9M A;  3RZD B;  4BA2 I;  1PFM A;  5IGB A;  4GZY C;  2K33 A;  5C0X J;  3GTM B;  5G3L D;  3EQL C;  3GQB A;  4KKT A;  1IKM A;  3FRP B;  5IGD A;  2FIN B;  3V2T A;  4Z9C B;  4RHR A;  4OO1 I;  1F77 A;  3T13 A;  2FMC A;  3GV6 A;  4DN4 M;  2G9H D;  3IKJ A;  1AN8 A;  3H94 A;  2XVS A;  3MWY W; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...