1DM0B

Shiga toxin
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
69
structure length
69
Chain Sequence
TPDCVTGKVEYTKYNDDDTFTVKVGDKELFTNRWNLQSLLLSAQITGMTVTIKTNACHNGGGFSEVIFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords SHIGA TOXIN A SUBUNIT
publication title Crystal structure of the holotoxin from Shigella dysenteriae at 2.5 A resolution.
pubmed doi rcsb
source organism Shigella dysenteriae
total genus 15
structure length 69
sequence length 69
chains with identical sequence C, D, E, F, G, H, I, J, K
ec nomenclature
pdb deposition date 1999-12-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.70 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1dm0B00
1D1KA 1QOHA 1C4QA 2XSCA 1BOSA 2C5CA 2BOSA 1DM0B 1D1IA 1R4PB 1C48A 1R4QB 2GA4B 4ULLA 3MXGA 1CZGA 1QNUA 1CZWA 4P2CB 4M1UB 1CQFA
chains in the Genus database with same CATH superfamily
5C0XJ 2CWPA 4A3JH 4DR5L 4DN4M 1H9RA 2F0FA 4DA2A 3D4DA 1A2UA 3T16A 2IHEA 1AN8A 1PTOD 1Q7YC 1IBLQ 1HTLD 4LFBL 2I0QA 2JEBI 2GA4B 1SMXA 1YBYA 3E3XA 1GOZA 3CMAA 3CU7A 3M3YH 5HGTA 2WKCA 4YHHL 3R2TA 2KEEA 1K8AC 4K6DA 4JV5Q 2VXWA 3VR5A 4RH6A 4C3HG 1Y1VH 4DR1L 4X65L 2PZWA 2YYZA 3HOWH 2R61A 4EQOA 5C4XH 1FNUA 2KECA 3WWVA 2VB3X 1EY6A 5JVG3 1LO5D 2NZ1D 3CHBD 2K05A 1HNWL 2ZTEA 3VR2A 3HKSA 5M3MH 3VA7A 2B2TC 3NE5B 3MC0B 4K2KA 1AP0A 2K50A 1HZCA 2M00A 5LMNQ 2AUKA 3B6YA 3PUVA 2K6AA 2RDHA 3LX0A 5KYLA 5FLMG 1FVIA 4IURA 4OWTB 1LTGD 1VQIA 1KLUD 3QG1A 4FXKC 1K8GA 1B9MA 1YITA 2A6EC 2C35B 2CQOA 2EYLA 4Q5VA 2L55A 4RHSA 3KDFB 1TWCH 4R4CA 1GO3E 3HFZB 3BDLA 1MKHA 3BDCA 4GOPB 2ZXOA 3CP0A 4WORA 1VQ7A 4KD3A 3EJIA 5G3LD 5JEAG 2E74C 4X3SA 3HS0C 5BN3A 3PIO3 5KGUA 4K0KQ 4H02A 3TSSA 4V190 1VQFA 4IPHA 1S5FD 3W1GA 3A5UA 4F7XA 4QUFA 3I73A 4A3BH 1RODA 3U58A 1QCBD 4R4OA 3HZXA 1QVCA 2XIWA 1SNCA 1EQTA 3W5OA 3CPFA 5EJWA 3S1NB 4DV6Q 1X55A 4GNXC 1LTID 3HGBA 1G2SA 1UNSA 5C4JB 2BE5C 5C5MA 3LNNA 4F8MA 3V96A 5ELFA 1HZBA 3NTHA 4G57A 2F0QA 3G7LA 1WTQA 3KYHC 4X3KA 1X3EA 3ND9A 3OIPA 1YNJC 1G8ZD 4DR3L 2EDGA 1ENCA 3M3YB 1EY7A 2PQAB 2N78A 2O2LD 1N32Q 1TT2A 3NTIA 1M8AA 1Y69U 2K5HA 5IWAL 2B8GA 1IW7D 3HOWB 1JB7A 1Q86C 1WVLA 3H91A 4P2CB 3TZUA 5JJKA 3TRZA 3K5OA 2X6LA 2IX3A 4HTHA 2EZVA 4ZCKA 1GKHA 1NE3A 2L9HA 2SNSA 4ILWA 5I4DA 3CW2C 3QIAA 1TQOA 5M3MB 3PV0A 1K83H 4B3TQ 2QILA 4HJ9A 4JI7Q 2VB2X 1SLJA 4CJ1B 1PH4A 3I4MB 1C7YA 1V1QA 1CZGA 4IZ8A 3J81i 1HCZA 1Q81C 2CWAA 5IYCH 4L5SA 3A7AB 1RTNA 2JA6G 1YHBA 3BVMA 2NVQH 2MP1A 4HIDA 1I4HA 1RDPD 1KTKA 1JOKA 1W6KA 4LF9L 3PO2G 1EOTA 1F9QA 2Z1CA 1TWCB 2ICIA 3NXWA 1QUQA 1WCMH 5TSSA 2EXDA 3UI2A 4B9XA 4P75A 1FYCA 1TY2A 3I4OA 4OGQC 1XNRL 1WTOA 1IBKL 3KF6A 1OXSC 3BG3A 1OXTA 1H9SB 3CCLA 1SYDA 4DV2L 2QA4A 3CQZH 1EYGA 1TWGB 1HA5A 5IP9G 1PRTD 1CKMA 1EY5A 2LFNA 1SBBB 2OWOA 2PO4A 5E3FA 1STAA 1BNZA 1GHKA 2RSOA 4DR1Q 4GN3B 1I6VC 4U673 3A7LA 3ZJYC 5ELOA 1UE1A 2JN4A 4IPGA 3PQIA 5EGTA 1WTPA 4P72A 5FLXL 4A76A 2WV6D 3H6MA 4B3ML 1AFPA 4ULLA 4DR2L 1HNWQ 3S2DH 4RFBA 4CDEC 1QNKA 3H3VH 4GKJL 4FVMA 2HDMA 3MXPA 3NENA 4BBSH 3S1NH 1O80A 5C6AA 4EGVA 2R7ZH 4PZ7A 3J81j 1A0IA 3FPPA 2EOTA 4PMCA 2K52A 3HOZG 3MA2B 4RAUC 2EPBA 1IBMQ 1B3AA 4KLKA 1L0XB 2DNEA 4IPCA 1HHVA 1D1IA 4LF8Q 4C3HB 3QWNA 2A73B 4HJ7A 1DJRD 5CV4A 5C4ZA 2XGTA 1YNNC 4LFAL 1HXYD 3URYA 5LHY1 5J3BA 4N8FA 3GTKH 2J7ZA 2PZTA 1Q8KA 3F2DA 1E3PA 1STBA 1PTOB 1I50H 3J80i 1K83B 2N49A 1QVFA 1A6XA 4KHZA 1HPCA 1PTOF 1F9RA 1D8LA 1AW7A 3UDIA 3KK7A 1QJOA 5C3WA 2ICEC 1PH2A 3AYHB 1H9SA 4IFDH 5T1IA 1MI2A 2EQSA 4ZRZA 3GTGH 1Q82C 2FINB 4KHVA 2NWGA 4A3CG 3GTPH 2IY5B 5ELEA 1AE3A 4A3IH 2Z4IA 2WB1G 5DM73 5A2QL 4BY7H 3FDTA 4NPSA 2YTXA 4DV0L 3E0JA 3A8JE 1WTHA 1EY0A 3VYSA 3PF5A 1G6ZA 1STGA 1WCMB 2F1MA 1ILPA 1XNQL 1U4PA 2ID0A 3NQIA 2Q8IB 1I4XA 4RKBA 5JPMC 3MXUA 4DV7Q 2UXDL 1E0BA 3SEBA 1A3VA 1TS3A 3E5SA 3U4VA 1AE2A 4HJ8A 2E76C 2HUGA 2R7DA 2BH2A 1E2VA 3S1RH 1GUOA 2Q2HA 3DWPA 1QZGA 3E6ZX 2QDLA 5E7NA 4DR7L 3OMCA 4R8NA 4RHRA 4CJ0B 5IOCA 1HR0Q 3OYYA 1FL0A 3OHXC 5ELCA 3S2DB 5G3LF 1XPRA 2UUCL 4DXFA 3J81L 1EEFD 2DY8A 5JAVA 3Q22A 1LTRD 1KAWA 2ZTCA 3UE1A 3JAML 2Q8RE 3HOUH 2Z0SA 1HNZL 1F9PA 1MBYA 2JYOA 2MO1A 2JA5G 1SE8A 2A74C 4R4QA 4CBVA 1CTMA 1QOHA 5J39A 5FO9B 3A0JA 1IL8A 4JI3Q 1YZ6A 4ZKCB 1F2YA 4CJ2C 5E1FA 5LL6X 4A75A 1K28A 1TIID 4O42A 1TWFH 4X3TA 2K5WA 3GTKB 5C0XH 2B2UC 4IUQA 2R93H 2CHBD 2Z6BA 3RLOA 1SMYC 4A4IA 1BKBA 2JA7H 4KI0A 4M8AA 2A68D 2UUAQ 4QJFA 4NXNL 1A3UA 4DAYA 4OELB 1V1PA 5ELNA 1AEXA 1SE2A 1TY0A 3GTGB 1PFNA 3QB3A 4X62L 3A8IE 3K7AB 2MHVA 3VYRA 2NZHA 3GTPB 2QKIC 3T56B 1VF7A 4G7ZC 1FR3A 3ITPA 4A3IB 2UUBQ 5K36H 4DV1Q 1VQKA 2K04A 4UP7A 5ELDA 1EYAA 4JVZA 2XVSA 1H9JA 4FF2A 2IX1A 1Z47A 5FJ8H 4OIJA 3D6CA 3J80E 4AYBE 2UXCQ 1KNAA 4S3SA 2VS1A 4XXEA 3X3NA 4JCVE 4AYBG 4PMBA 4ZK9B 3BZCA 4C3JH 3P1HA 2MQHA 4NXML 2NN6H 1DXMA 4KKSA 3S1RB 4OXPA 2LXJA 1MIUA 4JI2L 4DAPA 4KN4C 1AZQA 1KQSA 3I4LA 4PG3A 1GVPA 4GN4B 2B63H 1CUKA 1KDCA 1VQHA 1SRUA 1I94Q 4K5XA 5JVH3 2EJMA 1PMRA 4BS9A 3SK6A 2VW9A 4JI0Q 1PRTB 1TWHH 3KLSA 3M85A 2F0SA 4G7HC 3CCJA 1LM0A 2IW3A 4DV4L 3HOUB 2EYMA 1C48A 4ZKBB 1PRTF 4L6TB 1IL2A 2R7FA 3BYYB 3S15H 2UU9L 2DN8A 2KENA 1T9HA 5LL6S 1PHJA 2K32A 2N8NA 3I70A 4KKTA 3LWEA 3S2HB 5EAYA 3NHHA 1M90C 3QR8A 2PNHA 2WP8J 1YI2A 2GVBA 1XNQQ 1PZJD 2ZJRA 4OL7A 4A3FG 2R93B 4PV1C 1EOVA 1X3GA 5IYBG 3VR3A 1A8VA 4POGA 3D6WA 1R4QB 4JC0A 3JAMc 3EQLC 2JA7B 1DGSA 2HIXA 4GNXB 1HA6A 3DWAA 1YIJA 2C9OA 2XRSD 4XIGS 1KD1C 3DUZA 4HR7B 2XWJB 1DYQA 3G6EA 1SNPA 4LF6Q 2N3SA 2EVBA 1ZEQX 1SMYD 2WB1B 4TRDA 2WKDA 3PIOA 4DR7Q 2K03A 3DEPA 1GUGA 3BJUA 3KJOA 1EEID 1YHAA 5C44H 4A3JG 3TP5A 1R4PB 2VUMH 3GTQB 2K4KA 4IUVA 2I5MX 2IPKD 2FHTA 2ZJPA 1G6PA 5NUCA 2EIFA 4C3JB 4FP5D 1E22A 1K0SA 1SYGA 1JJ2A 3KLSX 4FXDA 4POFA 1HNZQ 1KHIA 4DV3Q 3MAQA 3MZ5A 4E6IA 1H9MA 2I5LX 3I90A 3T51B 2VQFL 5L37A 1J8IA 1Y1VG 1PYWD 3HOWG 3VYTA 1Q8IA 4MN3A 4BWGB 2LMCB 3RN2A 5C4XG 4A3EH 4MTNA 5COYA 2KCTA 1KRSA 2KBNA 3M7NA 4KD4A 2AMCB 3NBIA 5M3MG 2L5TA 4RGMA 4A3LH 1TWHB 2MO0A 2NVYB 1U9RA 1B3QA 3SK4A 4NW2A 2K5DA 2A69D 1PDQA 4O0AA 3S15B 3D4WA 2LY7A 3K5LA 3CMEA 2M9VA 2RA4A 3VA5A 1E2ZA 2JJQA 2SEBD 3PUYA 3K0YA 3OOCA 1NTGA 2IT1A 1GUTA 1C9OA 1O7ZA 4PZ6A 1JWUD 1NMFA 3CF5A 2KA7A 1K73C 4BA1I 4A3KH 4HMIA 4A3MH 4AQYL 2HCIA 1JICA 4H7BA 4Z9CB 5CC4A 1D5MC 2OT2A 1EQQA 4DUYL 4JBJA 4A3BG 2I07B 1U4LA 5LMNW 4UHVA 4JI5L 4JOIA 4CDCC 1VMPA 2F0PA 1VMCA 2X6GA 4LUZA 5C44B 4KJNA 4KJOA 1O78A 5M5XH 4LF7L 2MUYA 2SNMA 4DR4L 1VQ5A 4AYBB 1Z7TA 1RF2D 3HEJA 5C3EH 1EY8A 5CORA 4DV4Q 2F4VL 1LTLA 2KUMA 1N36L 4BBRH 1JJCB 2QGQA 3T13A 1ZYRC 5M5WB 2BA1A 1C4QA 1TWAH 1LABA 2F3IA 3I72A 2VQEQ 4HJAA 1M4VA 4PMWA 3PCOB 2XWBB 4B3RL 1SROA 2Z6KA 1XMOQ 1YVCA 2KVMA 3RD4A 5KNBA 1JJGA 1CSQA 3DWQA 5AFWA 5CV8A 5J22A 3WOEA 4G4KA 1WTVA 5AJ3L 4K5WA 3VR4A 5IGFA 4DKAC 4PNYA 2RHSB 5IYCG 3L0OA 2RQXA 4C2MB 1G51A 2A19A 5CV6A 1S3OA 2ASBA 5GAGC 4LUVA 3UDGA 5D3DA 2X69A 2LS01 1TS5A 3R8BA 3TS2A 1NBWA 2F0WA 1WCMG 2VNUD 4A3FB 4FF3A 5BR8L 3STBC 1SNOA 4H0LC 1JE4A 3MFYA 4A3KB 3FP9A 2IX0A 5KEEA 3GD7A 3CCRA 4UDUC 1EQRA 3WDNA 3KF8B 4CGYB 1D6EC 4DK6C 1LT4D 1EYDA 2HDLA 5I2YA 3RNUA 4L5TA 4DR6Q 1JMCA 2AUJD 1KL9A 4RA8A 1ENFA 4GLXA 3BYTB 3RN5A 1SFOH 4JI1L 4A3JB 4OO1I 1I4RA 5M5XB 3I8ZA 4R4TA 2SOBA 1T5XD 3EIVA 2NUCA 1B50A 4BBSG 5C3EB 1I4PA 4DAMA 1F77A 2R7ZG 1DD2A 2Z9HA 4RGTA 1L1OC 2WINB 4BBRB 3G6JB 2UXBL 1X6OA 1PFMA 3SR1A 1KDBA 1ICWA 2WFWA 1Y1VB 1PH1A 1DZ1A 1TWAB 2EY2A 2MPMA 4I7ZC 2A1AA 4LW1A 2F0UA 1D1KA 1SN8A 1EY9A 1GD7A 5C4XB 5ELBA 3KDFA 3TDQA 2LSSA 3E9IA 2B2YA 4F87A 4GOPA 1W2BA 2ZM6L 4JBKA 4L63B 5IGDA 3I55A 3D31A 1I4GA 4ID6A 4YIJA 3CRKC 4DUYQ 3Q8DA 1LT3D 2RF4A 4DV5Q 1JE5A 2IJ0A 2JK8A 1HRJA 4IFDG 1HFNA 2B39A 2ENBA 3F1ZA 3T1YQ 3KF8A 2QEXA 1NJIC 3F2BA 1X3PA 3JAMi 1XPUA 1O7IA 1U4MA 3NBHB 2B2VA 1DONA 1DOMA 4A3IG 2PYKA 4WJ4A 4DPGA 3S1QH 4DR5Q 1WYDA 4BY7G 1LYLA 3W3AA 1YNXA 3ZYYX 1DOKA 4L5RC 2F0OA 5FLXE 1HQMC 4IOAA 1O7LA 2F4VQ 1VQ4A 2A6ED 4LFBQ 4UY8C 2A8VA 3PF4A 4BXXH 1BXTA 1E1TA 4YHHQ 4XYQA 4A3BB 2OTLA 3QJYA 3CCQA 1IKLA 1EWHA 1QE6A 1J9OA 4N9TA 4EQNA 4X65Q 1ENAA 3STBD 1K9MC 1UE6A 2PQAA 1JOQA 1BCPC 1FGUA 1GUWA 1X32A 1AH9A 2Z4HA 1SFOB 4QF4A 2K28A 2EJFC 1PYBA 2FMCA 4HCEA 4ZYSA 1QWYA 2K01A 3KUPA 1B53A 3HOXH 3A54A 2L0CA 1FJGL 2RCFA 4JG2A 3CKIB 2BDOA 1Y8PB 3H3VI 4DF7A 4IQZA 4ALPA 2FFKB 3HOUG 2HCCA 3PO3H 1DM0B 2BE5D 1J6QA 3OIQA 3KJPA 2KCNA 2L12A 1K8OA 1CM9A 1UE7A 1L0WA 1X3QA 5CMDA 1Y14B 3SHLA 2KCCA 5IYDH 4JI4L 1PH5A 3NBHA 2XRQD 1I6HH 1XPOA 4B9WA 5HY6A 1YNJD 2HHHL 1FNVA 5C0XG 5A2QE 1HR0W 2R93G 2Q2IA 4EQ5A 5I9OA 1YHQA 4UAIA 2DGYA 1RHPA 2JA7G 4MTKA 4KTAA 1CFMA 2KJXA 4K2LA 1GUNA 2F0NA 4KY6A 4RMFA 3M7GA 1TKWB 5LMUL 2B29A 4DK3C 2NVQB 3CPWA 4YWMA 1D5ZC 4FF4A 1QVGA 2V1CC 5IP7H 2SDFA 2F0IA 4PZ8A 1Q1EA 5KNDA 3S1MH 2D5DA 3I56A 5K36G 1IXRA 1EZ6A 3PSIA 5KYIA 5JOBA 2RBMA 3A74A 2J4XA 4NMZA 5C5LA 3HRZC 4JYAL 4FXGC 3J7AV 5FJ8G 1N33L 3HOYH 4X6AH 2K5VA 4RCNA 4C3JG 4HMJA 1SSOA 3CQZB 1V1OA 4DR3Q 3J81E 2UXBQ 3TMEA 2OQ0A 2R3ZA 2NN6G 1HUNA 3AMUA 3JAME 4YY3L 4DUZL 5IWAQ 2PI2E 1SYEA 5EKLA 3K80C 5IT9L 1VQAA 4ME5A 4LF5L 4A3DH 4GKKL 1VQ6A 3LGJA 4OEMB 2BA0A 3CRLC 1STNA 3NWSA 1Q46A 2M2LA 5CGKA 4C1NI 2B63G 5HGQA 4QQBX 1OXVA 2PMZE 1G91A 4TSSA 1PLFA 1VF5C 2ZM6Q 3HOXB 1P8LA 4A3GH 1S40A 2JA8H 4BBSB 1EFWA 2R7ZB 3Q0AA 1BCPD 5GROA 3PUWA 4B3SL 2RDGA 1OO9B 4J1MA 4LF9Q 3IKJA 1SJHD 3MVVA 2ZT9C 1LTSD 1JORA 3MTSA 3VR6A 5IODA 3HKZE 3RZOH 1I6HB 5E4WC 1PVOA 1NCVA 3HKZG 5D65A 4YCVA 1A3TA 1XNRQ 1SJED 1I50B 3R2IA 1IBKQ 4GLAC 1VQ9A 2Y0SE 4DV2Q 2R92H 3I3CA 5CBEE 4KY5A 1YNND 3NK9A 4FO2A 3U50C 3OTOL 3T1HL 1DOLA 1HNXL 2F0LA 5KNCA 1L2FA 1SYFA 4RGNA 2HQLA 1KRTA 3S1MB 1KAAA 2ZXRA 1C0AA 4BY7B 1SE4A 4B3MQ 3F8TA 5C44G 4DU9A 4QY7A 3GP7A 1EZ8A 4DR2Q 2K5QA 2VUMG 2L15A 1ASYA 1EU4A 3NQTA 1C8CA 3RR5A 4GKJQ 1EWIA 4FDBA 1PA6A 1VQLA 3GTOH 1Y1WH 2Z8LA 1XTDA 4JI6L 2E2JH 3HOVH 4GZYC 5M5YH 1IYUA 3TREA 2HQEA 2F52A 2QF7A 1XXGA 3I2ZA 4XTCS 4X66L 1BF4A 3TZDA 2DNCA 4OX9L 4C3IH 1LV9A 2NN6I 1K0RA 1CKNB 4FNFA 1QB5D 1F2ZA 3I7FA 4LFAQ 4A3DB 1HJPA 4JI4Q 2MGSA 1Q12A 2CQAA 2HHHQ 4GLVB 4A3EG 2JA9A 3AU7A 3K81C 4CKEA 1BQQT 2C5CA 3FMCA 4K6LA 4A3GB 4A3LG 2B2WA 4A93H 2D0OA 4WRDA 3TEHB 1B9NA 5EPKA 2LKVA 5EKKA 3QOJA 1ASZA 2Q8TA 4U68A 1SE3A 1VQEA 1JC7A 4Y52H 4XT1B 2E75C 3T53B 2CH4W 3RLFA 2D62A 4RG1A 5IT9c 3J7AF 4QB4A 1W6JA 3T4AC 4DFAA 3S14H 1CHPD 3NEMA 5HURA 3F2UA 2CKZB 1DCZA 2XSCA 4DV0Q 4K8IA 5JJLA 5E4XA 1HTPA 3BS1A 3FPUB 2BOSA 1TWFB 4KK7A 3V2TA 5FKAC 4KHPL 5CV9A 2KHSA 4P74A 2QW7A 2F0VA 2F0HA 1N34L 1RIPA 4EVOA 4A3KG 1VQCA 2CW0C 3NTKA 4A3MG 2UXDQ 2R92B 4JV5L 3Q24A 3K7UC 2KEDA 1KXLA 3TP8A 4RWSC 4YCUA 3K59A 5D3IB 1KDAA 1IZ6A 1X56A 3A56A 4YY3Q 1MSHA 1P16A 3E0EA 3K5MA 1STYA 5F2DA 4LF5Q 3CC7A 1L1OB 4I7AA 3CCUA 2WIIB 3GO5A 1UE5A 1CKNA 2B2TA 3SXHA 3UE0A 5DNFA 1KC8C 2I46A 2UUCQ 3AQQA 5JPNC 1ET6A 3GTOB 5LMNL 4HAEA 1Y1WB 1NSNS 3ND8A 3L2PA 1UEAB 2A5HA 5M5YB 5C3EG 2AQ3B 1PTOC 2FJ2A 1VDZA 1NAPA 3RUZA 4B3SQ 2NTTA 1TS2A 4EQPA 2R6GA 3GTMH 4JPBW 2NVXH 3MXNB 1ESRA 4BBRG 4JBMA 3U4ZA 3ONAB 1CI3M 5GQOA 1E2WA 2BH8A 2AQ2B 4C3IB 4QIWE 1XJVA 1X54A 5H1SE 2EY5A 4TQUS 1QILA 2DJFC 3OWFA 2L1BA 1B1ZA 1BO0A 2RDFA 3AEVA 3A8KE 2B63B 4LWCA 4K0KL 3GQBA 4IALA 1CA6A 1PFSA 2N55A 3N6RA 2H4OA 4F88A 1ZKOA 2OEOA 5M3FH 4R4IA 3GTLH 4NXNQ 3UDFA 2EY6A 3T1HQ 4GNXA 4X62Q 2G9DA 4DV6L 3NWTA 2EYPA 3H94A 1CZWA 1VCIA 4HEDA 3IFTA 4ME3A 3HKZB 3ERQA 2Q2TA 1EIFA 4IO9A 1VQJA 1BCPB 3UDXA 3KLWA 4K8JA 4NXMQ 3MWYW 3H3VC 1SYBA 2Y0SB 1EL0A 4ZLTF 1VQDA 1XMQL 2F0JA 3I4NH 3CCEA 4XT3B 2PCFB 1QNUA 5KRUA 3MXNA 3OW7A 2ATWA 1Z9FA 4JI2Q 1K3RA 4J8QA 4LNQA 4KY7A 1B2TA 2CW0D 4BY1H 4HJ5A 4B3TL 2TSSA 1JWSD 4IPDA 4JI7L 1S4ZA 2PI2A 3ULPA 1A15A 2VUMB 2CH4A 2KHJA 2N88A 1G291 5EKIA 1K8MA 1EYCA 3M9BA 5CYUA 2B2WC 3PUZA 3GTMB 4IN3A 3J7A5 2NVXB 3RMHA 2UU9Q 1YJ9A 3A5ZB 3H0GH 1CKOA 5FO8B 5C4JH 4J6HA 4DK1A 2JEAI 2F0GA 1LUZA 2YTVA 5EBCA 3E9HA 5GADC 5FOBB 1IW7C 1A2TA 2O5JC 1UUPA 2HIVA 3FHWA 4KHPQ 4LMQD 4A3EB 1N34Q 3K6OA 3ICEA 5I6WA 4HIOA 4WFN3 4TKOB 1YJWA 5M3FB 2GVAA 3CD6A 3FKIH 3GTLB 4TVAB 4N8X1 4KV6A 5FO7B 2K5NA 1NUCA 4C1NK 1U0LA 3CC2A 4LUOA 4K5VA 1YJNA 3PIPA 2E2IH 1LT5D 4R9WA 3ERSX 3BVGA 1WJJA 2D0PA 5A35A 5K5PA 1MSGA 3AFPA 3TN2A 1J5EL 3ULJA 3TBIB 1IBML 1AZPA 3I4MH 2KHIA 1RJTA 1JT8A 3W1BA 1O7YA 1Z6HA 4A3MB 3H09A 1MGSA 3CCSA 4WJ3M 1BOSA 3P20A 4LF8L 3C46A 4FYDA 4BXXG 1XX8A 4DK0A 1PRTC 1F9SA 4NB3A 3I4NB 5C4HA 2VQFQ 4RGOS 3H15A 5EPLA 1GUSA 3DM3A 3NPPA 4BY1B 2NZOA 5JJIA 1QZHA 3V05A 1OXUA 4X64L 3L7ZC 5GAHC 4N9PA 3TP7A 1PZID 1TWGH 4XQJA 4Y7NH 1SYCA 2I5HA 3HOXG 3PGZA 3R93A 3GV3A 4XYOA 3OW2A 4OHJA 4OONA 4IOCA 1N9WA 1YEZA 4OO1H 1QUQB 1LTTD 3PO3G 2GN5A 2MFIA 3H0GB 3OPOA 1ESFA 3OMGA 1CT1D 1W3SA 3KF6B 4QL5A 3M4PA 1V43A 4AIMA 4QIWB 1MJCA 1UWVA 3WOFA 1PV4A 1PYSB 3SK8A 5IYDG 4QMGA 2E2HH 1B8AA 1K3BC 4DV7L 5BN4A 4RKLA 3EBEA 5IY0A 1ZYRD 2BDNA 4AQYQ 3DHQA 3DM1A 3EFXD 3FKIB 4C3HH 5T1GA 1HQRD 2NYZD 1XMQQ 3K5NA 1S72A 4QCLA 2BCOA 4M1UB 4KKUA 4XQNA 2CCZA 4O2DA 5DM63 2D9UA 2KQ3A 5M9OA 1HR0L 4JI5Q 5IP7G 5EPJA 4JOIC 3CCVA 1IYVA 3S24A 1PTOH 4LAAA 5IIFA 2E2IB 5FK9C 1BR9A 4XQQA 1G2TA 5GAEC 1HZ9A 4LF7Q 3HG9A 4DR4Q 5I2XA 2WAQE 1JOOA 3K0XA 2QCPX 1NR4A 2WAQG 5FLMH 2F0TA 4MNOA 4UP9A 3HOYG 5BN5A 1N36Q 2YV5A 4JI3L 3U9SA 3MHBA 2YTYA 1L0YB 1SNDA 1EWCA 2V4DA 1M1KC 2B2UA 3M4QA 4ABNA 3A55A 5JEAH 2RSNA 4A3DG 1D7QA 3SK5A 4B3RQ 1D5XC 1LACA 5CV7A 2Z6KC 4R1JA 2UUAL 5IGGA 4Y7NB 1STHA 1D2BA 1JCKB 4A3GG 2JA8G 1LTAD 3C2PA 1IKMA 1KNEA 1SDFA 1SXTA 4LJZC 5AJ3Q 3RZDH 4FF1A 1WFQA 2ZXPA 2UUBL 2ZTDA 5KIXA 3S16H 5IE8A 4JBWA 4DV1L 2AHOB 4YCWA 1UAPA 2NTSA 3D8GA 3TP6A 1JR0D 1A62A 1VS0A 4KN7C 2UXCL 5IGCA 1PH7A 1S5BD 2E2HB 3D4RA 3CAMA 1J5EQ 2EJGC 1EIHA 5BR8Q 2ZJQA 1HZAA 3K58A 2L4NA 3O13A 3C1EA 4DAVA 3L9AX 2O4XA 3PIP3 2R92G 2FXQA 3NUCA 1HH2P 3CXCA 4P73A 1IYJB 4LFCL 2A68C 2PQEA 3W2DA 1TR5A 3G4SA 1JQYD 2CFMA 2JSOA 4IFDI 3P7JA 1X65A 1TS4A 1U4RA 3OWEB 5DEHA 1I94L 4HIKA 4JI1Q 2WACA 3S1QB 4X64Q 1ET9A 2HD3A 4YWKA 4X3UA 4H44C 5IT9E 1Y8OB 4JI0L 2H1EA 1NNXA 1PH8A 3M4OH 3P75A 1A63A 1Y1WG 2JA6H 2Q2UA 3IAYA 2PNRC 1LTBD 1WTWA 1MJEA 2D2CC 4JW0A 1V9PA 3HOVG 3BZKA 3IFDA 2WB1E 3K7AH 4ODGA 1ONLA 4K14A 2EY1A 3PO2H 1Q90A 3SGIA 2OQKA 3SDZA 4IUUA 3DLLA 3I91A 5DAUA 1PZKD 4C3IG 3VDYA 2E5LL 2F0DA 1RL2A 4DNRB 4DAYB 2AWNA 5CV5A 4HSPA 1RTOA 3NP8A 1FGBD 1V1PB 3TQYA 2PW5A 3L3OC 1S5CD 3C3LA 2EYOA 5IP9H 2OXPA 4CDDC 2B2YC 4GOPC 5CR3A 4NDXA 1SR3A 1H9KA 3MXGA 4A93G 1XWEA 4YWLA 4UP8A 4LF6L 5EQ0A 2EYFA 3BU2A 3RZDB 3OSOA 2H5XA 1LT6D 5C3XA 3J7ZC 3PO3B 3S16B 1WD0A 3LWUA 2ES2A 2JQOA 4MZ9A 4IJHA 1E24A 5IGBA 2B2VC 3N52A 3U9OA 2AKWB 3BVZA 3DEOA 3HOZH 2F0KA 4ZUIA 4DV3L 3PMFA 3IL8A 5C0XI 2FMMA 1EIGA 1CHQD 2NBFA 2MNAA 2F3WA 2Y0SG 4PQXA 4LF4L 3S2HH 5FLXc 2K14A 1BUVT 4DNTB 3CCMA 3PUXA 1I4QA 1I5FA 3D0FA 4ZAIA 3G48A 2EYJA 1ICFB 1SNQA 4CKCA 4MIUA 2NVTH 2XTIA 2PZUA 2TMPA 1B70B 2MJ8A 3AFQA 3M4OB 2WAQB 1FJGQ 3EN2A 3KBXA 2JA6B 3HOYB 4I65A 2QEJC 2DUDA 1FD7D 1S5DD 3K57A 2E8GA 2YU9H 4A3CH 5ISRA 3C1FA 1V8QA 3GV6A 3PO2B 4XDXA 1WTXA 2O5IC 2RKSA 3EA6A 1H95A 2LXKA 1WOCA 5CBAE 4KMUC 3D3RA 3GTQH 1I3QH 1WD1A 1U5KA 1E7ZA 2J0TD 2OF1A 3FVQA 4HIMA 1QG7A 4WJWA 2B3GA 3S17H 1E1OA 4AH6A 1VQNA 2A6HC 3FRPB 4QUCA 3MEHA 3QO2A 4BA2I 2JA8B 2K33A 4JI8L 2IHFA 3FEWX 5M3FG 2VZAA 1ZXTA 4LFCQ 2RVLA 3J7YW 1MD2D 5LMUQ 1PH3A 1EY4A 1CSPA 4O1NA 2CVRA 2G5DA 3J80L 4IJLA 2L11A 3RLNA 2A69C 5JEAJ 5I9PA 1CQFA 2F03A 1GJXA 3QOLA 1OXXK 4ZQ3A 2IL8A 1GM5A 2JP1A 3R3OA 2DJGC 2K75A 2HT1A 2NB0A 3RZOB 3X3MA 4LK1C 1FNWA 2NVYH 1S5ED 4JYAQ 1EQVA 1IBLL 1N33Q 2P5ZX 3HOZB 5DLQE 2JA5H 3BZDB 1Q1BA 1KIXA 1SNMA 4NKLA 3ULLA 2G9HD 1CA5A 1F2MA 2JXMB 4P71A 1WI5A 3NELA 1B44D 1NY4A 3Q23A 3GDEA 1Y8NB 1KLGD 4RCOA 4NP5A 1KABA 5JJZA 3MEFA 3I4NG 3ER0A 2VQEL 1X3FA 4B08A 2F3VA 4MHEA 4DUZQ 1R9TH 2PPBC 2RCNA 2E5LQ 4H13C 2KOLA 1VQ8A 3J81c 4GKKQ 1XMOL 1CQVA 3SE0A 1RCVD 1SAPA 2JE6I 4Q0FA 4BY1G 2QDBA 1EFID 2NVTB 2F0MA 1NR2A 4ZUJA 2AQ1B 1BBXC 3GTJH 2VL6A 1VQPA 1JWMD 3DXJC 1X9NA 4OWWB 3HOVB 2E2JB 3CC4A 1GXDC 2YU9B 1PFBA 4IUTA 3G71A 2ALYB 3F2CA 2IWHA 4HCSA 1BDOA 1B4OA 2F4IA 4IUPA 3H0GG 3DMUA 1BBUA 1EU3A 1VQGA 1I3QB 1TXYA 4DXGA 2VY3A 1RKNA 5D14A 3KLRA 2EYHA 2XNAC 3K8AA 2EE1A 2B8FA 4IFDJ 1OTCA 4L5QA 3S17B 1IHZA 2PW7A 1SEBD 2PMZB 4CDFC 5I6YA 5IGEA 4QGUA 1N8RC 4A93B 1XTCD 3S9WA 2DY7A 4JK1C 1WTRA 5M5WH 4DR6L 3FKIG 1HFGA 4LF4Q 4UPAA 3EROA 3IRBA 1VQOA 3KOJA 3OTOQ 1MHWC 2K1BA 5EBDA 1HNXQ 4EX5A 1PXUA 4R8IA 2K7VA 2A6HD 5J1ZA 3S14B 2OCEA 4L8JA 2RHQB 3Q6SA 2F0EA 1Q3LA 3MFGA 4OWXB 1EUJA 1LLRD 1T5EA 1L1OA 1TVXA 3EVQA 4GN5A 2OTJA 2JA5B 4IUNA 4J15A 1B7YB 3I4MG 4JI6Q 4HSVA 4C2MH 4APVA 1N32L 1II3A 4CHTB 3J80c 1ML0D 1BCPF 3VYUA 4DGZA 4X66Q 4G7OC 2EXZA 2KCMA 4DNIA 1R9TB 3BDOA 1GHJA 1EIYB 4OX9Q 3NSWA 3KBGA 1VQMA 4A3FH 3HP3A 1NMGA 1ILQA 2XN9C 5IYBH 4CKBA 3TS0A 1F2LA 3KFUA 1UEBA 4OIKA 3M4YA 4HN7A 4C56C 2E2DC 1BVSA 1HUMA 3GTJB 4JI8Q 1TU2B 4DV5L 1XYIA 1PH6A 2AWOA 4GS3A 4V0BA 1PH9A 3T1YL 1BBWA 1VQBA 1RD9D 1STEA 3AB9A 1CK1A 3JC66 3SVMA 4OO1G 1JB3A
chains in the Genus database with same CATH topology
5C0XJ 4DN4M 1H9RA 2F0FA 4DA2A 3D4DA 1A2UA 3T16A 1AN8A 1PTOD 1HTLD 2JEBI 2GA4B 1GOZA 3CU7A 5HGTA 2WKCA 3R2TA 2KEEA 4K6DA 2VXWA 3VR5A 4RH6A 4C3HG 2PZWA 2YYZA 2R61A 4EQOA 1FNUA 2KECA 2VB3X 1EY6A 5JVG3 1LO5D 2NZ1D 3CHBD 2K05A 3VR2A 3VA7A 2B2TC 3NE5B 3MC0B 4K2KA 1AP0A 2M00A 2AUKA 3PUVA 2K6AA 2RDHA 3LX0A 5KYLA 4IURA 1LTGD 3QG1A 1KLUD 4FXKC 1B9MA 2A6EC 4Q5VA 2EYLA 2L55A 4RHSA 3BDLA 3BDCA 2ZXOA 4WORA 4KD3A 3EJIA 5G3LD 5JEAG 2E74C 4X3SA 3HS0C 5BN3A 3PIO3 5KGUA 3TSSA 4V190 1S5FD 4F7XA 4QUFA 3I73A 1RODA 1QCBD 3HZXA 2XIWA 1SNCA 1EQTA 5EJWA 3S1NB 1LTID 3HGBA 1G2SA 1UNSA 5C4JB 2BE5C 5C5MA 3LNNA 4F8MA 3V96A 5ELFA 3NTHA 4G57A 2F0QA 3G7LA 1WTQA 4X3KA 3ND9A 3OIPA 1YNJC 1G8ZD 2EDGA 1ENCA 3M3YB 1EY7A 2O2LD 1TT2A 3NTIA 1M8AA 1Y69U 2B8GA 1IW7D 3HOWB 1WVLA 3H91A 4P2CB 3TZUA 3K5OA 2X6LA 2IX3A 4HTHA 2EZVA 2L9HA 2SNSA 4ILWA 5I4DA 3QIAA 1TQOA 5M3MB 3PV0A 2QILA 2VB2X 4CJ1B 3I4MB 4IZ8A 1CZGA 1DONA 1HCZA 3A7AB 1RTNA 3BVMA 2MP1A 1I4HA 1RDPD 1KTKA 1JOKA 1W6KA 1EOTA 1F9QA 2Z1CA 1TWCB 2ICIA 3NXWA 3UI2A 5TSSA 4B9XA 1FYCA 1TY2A 4OGQC 1WTOA 1OXSC 3BG3A 1OXTA 1H9SB 1SYDA 1TWGB 1HA5A 1PRTD 1EY5A 2LFNA 1SBBB 2PO4A 5E3FA 1STAA 1BNZA 1GHKA 2RSOA 1I6VC 4U673 3A7LA 5EGTA 1WTPA 5FLXL 2WV6D 3H6MA 1AFPA 4ULLA 4RFBA 1QNKA 4FVMA 2HDMA 3MXPA 1O80A 5C6AA 4EGVA 3FPPA 2EOTA 4PMCA 3MA2B 4RAUC 2EPBA 1B3AA 1L0XB 2DNEA 1HHVA 1D1IA 4C3HB 3QWNA 2A73B 1DJRD 5CV4A 5C4ZA 1YNNC 1HXYD 3URYA 5LHY1 2J7ZA 2PZTA 1STBA 1PTOB 1K83B 1A6XA 4KHZA 1HPCA 1PTOF 1F9RA 1AW7A 3KK7A 1QJOA 5C3WA 2ICEC 1H9SA 4IFDH 5T1IA 1MI2A 4ZRZA 2FINB 4KHVA 2NWGA 5ELEA 2Z4IA 5DM73 5A2QL 3FDTA 3E0JA 3A8JE 1EY0A 3VYSA 1G6ZA 1STGA 1WCMB 2F1MA 1ILPA 1U4PA 2ID0A 3NQIA 2Q8IB 1I4XA 4RKBA 5JPMC 3MXUA 1E0BA 3SEBA 1A3VA 1TS3A 3E5SA 2E76C 2HUGA 1E2VA 1GUOA 3DWPA 3E6ZX 3OMCA 4R8NA 4RHRA 4CJ0B 5IOCA 3OHXC 5ELCA 3S2DB 5G3LF 4DXFA 3J81L 1EEFD 2DY8A 5JAVA 3Q22A 1LTRD 3JAML 2Q8RE 1F9PA 1MBYA 2JYOA 2A74C 4CBVA 1CTMA 1QOHA 5J39A 5FO9B 1IL8A 4ZKCB 1F2YA 4CJ2C 5E1FA 5LL6X 1TIID 4O42A 4X3TA 2K5WA 3GTKB 5C0XH 2B2UC 4IUQA 2CHBD 1SMYC 4KI0A 4M8AA 2A68D 1A3UA 4DAYA 1V1PA 1AEXA 1SE2A 1TY0A 3GTGB 1PFNA 3QB3A 3A8IE 3K7AB 2MHVA 3VYRA 3GTPB 2QKIC 3T56B 1VF7A 4G7ZC 1FR3A 3ITPA 4A3IB 5K36H 2K04A 5ELDA 1EYAA 2XVSA 1H9JA 4FF2A 2IX1A 1Z47A 4OIJA 3D6CA 3J80E 1KNAA 4S3SA 4XXEA 3X3NA 4PMBA 4ZK9B 3P1HA 2NN6H 1DXMA 4KKSA 3S1RB 4DAPA 4KN4C 1AZQA 3I4LA 1KDCA 4K5XA 5JVH3 2EJMA 1PMRA 4BS9A 3SK6A 1PRTB 3KLSA 3M85A 2F0SA 4G7HC 2IW3A 3HOUB 2EYMA 1C48A 4ZKBB 1PRTF 4L6TB 3BYYB 2DN8A 5LL6S 2K32A 3I70A 4KKTA 3LWEA 3S2HB 3NHHA 2WP8J 1PZJD 4OL7A 2R93B 4PV1C 3VR3A 3D6WA 1R4QB 2JA7B 3EQLC 1HA6A 3DWAA 2C9OA 2XRSD 4XIGS 3DUZA 4HR7B 2XWJB 1DYQA 1SNPA 2EVBA 1ZEQX 1SMYD 2WB1B 4TRDA 2WKDA 2K03A 3DEPA 1GUGA 1EEID 3TP5A 1R4PB 3GTQB 4IUVA 2IPKD 2FHTA 5NUCA 4C3JB 4FP5D 1SYGA 3KLSX 4FXDA 3MAQA 3MZ5A 4E6IA 1H9MA 3I90A 3T51B 1J8IA 1PYWD 3VYTA 1Q8IA 4MN3A 4BWGB 2LMCB 5COYA 3M7NA 4KD4A 3NBIA 2L5TA 4RGMA 1TWHB 2NVYB 1U9RA 3SK4A 4NW2A 2K5DA 2A69D 1PDQA 3S15B 3D4WA 2LY7A 3K5LA 2M9VA 2RA4A 3VA5A 1E2ZA 2SEBD 3PUYA 3K0YA 3OOCA 2IT1A 1GUTA 1O7ZA 1JWUD 2KA7A 4BA1I 4HMIA 2HCIA 1JICA 4H7BA 4Z9CB 5CC4A 1D5MC 2OT2A 2I07B 1U4LA 1VMPA 2F0PA 1VMCA 2X6GA 5C44B 4KJNA 4KJOA 1O78A 2MUYA 2SNMA 4AYBB 1Z7TA 1RF2D 3HEJA 1EY8A 5CORA 2KUMA 3T13A 1ZYRC 5M5WB 2BA1A 1C4QA 1LABA 3I72A 1M4VA 4PMWA 2XWBB 2KVMA 3RD4A 5KNBA 3DWQA 5AFWA 5CV8A 5J22A 3WOEA 4G4KA 1WTVA 4K5WA 3VR4A 5IGFA 4PNYA 2RQXA 4C2MB 5CV6A 5D3DA 2X69A 2LS01 1TS5A 3R8BA 2F0WA 2VNUD 4A3FB 4FF3A 1SNOA 4H0LC 1JE4A 3MFYA 4A3KB 2IX0A 5KEEA 3GD7A 4UDUC 3WDNA 4CGYB 1D6EC 1LT4D 1EYDA 2HDLA 5I2YA 2AUJD 4RA8A 1ENFA 3BYTB 4A3JB 4OO1I 1I4RA 5M5XB 3I8ZA 2SOBA 1T5XD 2NUCA 1B50A 5C3EB 1I4PA 1F77A 1DD2A 4RGTA 2WINB 4BBRB 3G6JB 1PFMA 3SR1A 1KDBA 1ICWA 1Y1VB 1DZ1A 1TWAB 2EY2A 2MPMA 4I7ZC 2F0UA 1D1KA 1EY9A 5C4XB 5ELBA 3TDQA 2B2YA 4F87A 4L63B 5IGDA 3D31A 1I4GA 4ID6A 4YIJA 3CRKC 1LT3D 2IJ0A 1HRJA 4IFDG 1HFNA 2B39A 2ENBA 3KF8A 1X3PA 1U4MA 2B2VA 1DOMA 2PYKA 3W3AA 3ZYYX 1DOKA 2F0OA 5FLXE 1HQMC 1O7LA 2A6ED 1BXTA 4XYQA 4A3BB 3QJYA 1IKLA 1EWHA 1QE6A 1J9OA 4N9TA 4EQNA 1ENAA 1JOQA 1BCPC 1GUWA 1X32A 2Z4HA 1SFOB 4QF4A 2K28A 2EJFC 2FMCA 4HCEA 4ZYSA 1QWYA 2K01A 3KUPA 1B53A 3A54A 2L0CA 3CKIB 2BDOA 1Y8PB 4DF7A 4IQZA 2FFKB 2HCCA 1DM0B 2BE5D 3OIQA 2KCNA 2L12A 1K8OA 1CM9A 1X3QA 5CMDA 3SHLA 2KCCA 3NBHA 2XRQD 4B9WA 1YNJD 1FNVA 5C0XG 5A2QE 5I9OA 4UAIA 1RHPA 4KTAA 1CFMA 2KJXA 4K2LA 1GUNA 2F0NA 4KY6A 3M7GA 1TKWB 2NVQB 1D5ZC 4FF4A 2SDFA 2F0IA 1Q1EA 5KNDA 2D5DA 5K36G 1EZ6A 5KYIA 5JOBA 2RBMA 2J4XA 4NMZA 5C5LA 3HRZC 4FXGC 3J7AV 4RCNA 4C3JG 4HMJA 1SSOA 3CQZB 1V1OA 3J81E 3TMEA 2R3ZA 2NN6G 1HUNA 3AMUA 3JAME 1SYEA 5EKLA 5IT9L 4ME5A 2BA0A 3CRLC 1STNA 3NWSA 2M2LA 5CGKA 4C1NI 1OXVA 1G91A 4TSSA 1PLFA 1VF5C 3HOXB 4BBSB 2R7ZB 3Q0AA 1BCPD 3PUWA 2RDGA 1OO9B 4J1MA 3IKJA 1SJHD 3MVVA 2ZT9C 1LTSD 1JORA 3MTSA 3VR6A 5IODA 1I6HB 5E4WC 1NCVA 5D65A 1A3TA 1SJED 1I50B 3R2IA 3I3CA 5CBEE 4KY5A 1YNND 3NK9A 4FO2A 1DOLA 2F0LA 5KNCA 1SYFA 4RGNA 3S1MB 1KAAA 2ZXRA 4BY7B 1SE4A 4DU9A 3GP7A 1EZ8A 2K5QA 1EU4A 3NQTA 1C8CA 2Z8LA 4GZYC 1IYUA 2HQEA 2QF7A 1XXGA 4XTCS 1BF4A 3TZDA 2DNCA 1LV9A 2NN6I 4FNFA 1QB5D 1F2ZA 4A3DB 2MGSA 1Q12A 2CQAA 3AU7A 4CKEA 1BQQT 2C5CA 3FMCA 4K6LA 4A3GB 2B2WA 4WRDA 1B9NA 5EPKA 2LKVA 5EKKA 3QOJA 2Q8TA 4U68A 1SE3A 1JC7A 4XT1B 2E75C 3T53B 3RLFA 2D62A 3J7AF 4QB4A 1W6JA 3T4AC 4DFAA 1CHPD 5HURA 3F2UA 1DCZA 2XSCA 4K8IA 5E4XA 1HTPA 3BS1A 3FPUB 2BOSA 1TWFB 4KK7A 3V2TA 5FKAC 5CV9A 2KHSA 2F0VA 2F0HA 4EVOA 2CW0C 3NTKA 2R92B 3Q24A 2KEDA 3TP8A 4RWSC 3K59A 5D3IB 1KDAA 3A56A 1MSHA 3K5MA 1STYA 5F2DA 2WIIB 3GO5A 2B2TA 3SXHA 5DNFA 2I46A 5JPNC 1ET6A 3GTOB 4HAEA 1Y1WB 1NSNS 3ND8A 1UEAB 2A5HA 5M5YB 2AQ3B 1PTOC 2FJ2A 1VDZA 3RUZA 1NAPA 2NTTA 1TS2A 4EQPA 2R6GA 1ESRA 3ONAB 1CI3M 1E2WA 2AQ2B 4C3IB 2EY5A 4TQUS 1QILA 3OWFA 2L1BA 1B1ZA 1BO0A 2RDFA 3A8KE 2B63B 3GQBA 4IALA 1CA6A 3N6RA 2N55A 2H4OA 4F88A 1ZKOA 2OEOA 2EY6A 2G9DA 3NWTA 2EYPA 3H94A 1CZWA 1VCIA 4HEDA 3IFTA 3HKZB 3ERQA 1BCPB 4K8JA 3MWYW 3H3VC 1SYBA 2Y0SB 1EL0A 4ZLTF 2F0JA 4XT3B 2PCFB 1QNUA 5KRUA 3MXNA 3OW7A 4J8QA 4KY7A 1B2TA 2CW0D 2TSSA 1JWSD 1S4ZA 1A15A 2VUMB 2N88A 1G291 5EKIA 1K8MA 1EYCA 5CYUA 2B2WC 3PUZA 3GTMB 4IN3A 2NVXB 3RMHA 5FO8B 4J6HA 4DK1A 2JEAI 2F0GA 5EBCA 5FOBB 1IW7C 1A2TA 2O5JC 1UUPA 4LMQD 4A3EB 3K6OA 5I6WA 4WFN3 4TKOB 5M3FB 3GTLB 4KV6A 5FO7B 1NUCA 4C1NK 4K5VA 1LT5D 4R9WA 3BVGA 5A35A 5K5PA 1MSGA 3TN2A 3TBIB 1AZPA 1RJTA 1O7YA 1Z6HA 4A3MB 3H09A 1MGSA 1BOSA 3P20A 3C46A 4FYDA 1XX8A 4DK0A 1PRTC 1F9SA 3I4NB 5C4HA 4RGOS 5EPLA 1GUSA 3NPPA 4BY1B 3V05A 1OXUA 3L7ZC 4N9PA 3TP7A 1PZID 4XQJA 1SYCA 3R93A 3GV3A 4XYOA 4OHJA 4OO1H 1LTTD 3H0GB 3OPOA 1ESFA 3OMGA 1CT1D 1V43A 4QIWB 3WOFA 3SK8A 4QMGA 5BN4A 4RKLA 1ZYRD 2BDNA 3DHQA 3DM1A 3EFXD 3FKIB 5T1GA 1HQRD 2NYZD 3K5NA 4QCLA 2BCOA 4M1UB 4KKUA 4XQNA 5DM63 2D9UA 2KQ3A 5M9OA 5EPJA 1IYVA 1PTOH 4LAAA 5IIFA 2E2IB 5FK9C 1BR9A 4XQQA 1G2TA 3HG9A 5I2XA 1JOOA 2QCPX 1NR4A 2F0TA 5BN5A 3U9SA 3MHBA 1L0YB 1SNDA 1EWCA 2V4DA 2B2UA 4ABNA 3A55A 5JEAH 2RSNA 3SK5A 1D5XC 1LACA 5CV7A 5IGGA 4Y7NB 1STHA 1D2BA 1JCKB 1LTAD 3C2PA 1IKMA 1KNEA 1SDFA 1SXTA 4LJZC 4FF1A 2ZXPA 5KIXA 4JBWA 1UAPA 2NTSA 3D8GA 3TP6A 1JR0D 4KN7C 5IGCA 1S5BD 2E2HB 3D4RA 2EJGC 1EIHA 3K58A 2L4NA 3O13A 3C1EA 4DAVA 3L9AX 2O4XA 3PIP3 3NUCA 2A68C 2PQEA 3W2DA 1TR5A 1JQYD 2JSOA 4IFDI 3P7JA 1TS4A 1U4RA 3OWEB 5DEHA 2WACA 3S1QB 1ET9A 4X3UA 4H44C 5IT9E 1Y8OB 2H1EA 3P75A 3IAYA 2PNRC 1LTBD 1WTWA 2D2CC 3IFDA 4ODGA 1ONLA 4K14A 2EY1A 1Q90A 3SDZA 4IUUA 3I91A 5DAUA 1PZKD 4C3IG 2F0DA 4DNRB 2AWNA 5CV5A 4HSPA 1RTOA 3NP8A 1FGBD 1V1PB 2PW5A 3L3OC 1S5CD 3C3LA 2EYOA 2OXPA 2B2YC 5CR3A 4NDXA 1H9KA 3MXGA 1XWEA 5EQ0A 2EYFA 3RZDB 3OSOA 1LT6D 5C3XA 3PO3B 3S16B 1WD0A 3LWUA 5IGBA 2B2VC 3N52A 3U9OA 3BVZA 3DEOA 2F0KA 4ZUIA 3PMFA 3IL8A 5C0XI 2FMMA 1EIGA 1CHQD 2NBFA 2F3WA 4PQXA 1BUVT 4DNTB 3PUXA 1I4QA 4ZAIA 2EYJA 1SNQA 4CKCA 4MIUA 2PZUA 2TMPA 2MJ8A 3M4OB 2WAQB 3KBXA 2JA6B 3HOYB 4I65A 2QEJC 1FD7D 1S5DD 3K57A 5ISRA 3C1FA 1V8QA 3GV6A 3PO2B 4XDXA 1WTXA 2O5IC 2RKSA 3EA6A 5CBAE 4KMUC 3D3RA 1WD1A 2J0TD 2OF1A 3FVQA 1QG7A 4WJWA 2A6HC 3FRPB 4QUCA 3MEHA 3QO2A 4BA2I 2JA8B 2K33A 3FEWX 1ZXTA 2RVLA 3J7YW 1MD2D 1EY4A 4O1NA 2CVRA 3J80L 2L11A 2A69C 5I9PA 5JEAJ 1CQFA 2F03A 1GJXA 3QOLA 1OXXK 4ZQ3A 2IL8A 2JP1A 3R3OA 2NB0A 3RZOB 3X3MA 4LK1C 1FNWA 1S5ED 1EQVA 3HOZB 3BZDB 1Q1BA 1SNMA 4NKLA 1CA5A 2G9HD 1F2MA 2JXMB 1B44D 3Q23A 1Y8NB 1KLGD 4RCOA 4NP5A 1KABA 5JJZA 4B08A 2F3VA 4MHEA 2PPBC 4H13C 2KOLA 1CQVA 3SE0A 1RCVD 1SAPA 2JE6I 4Q0FA 2QDBA 1EFID 2NVTB 2F0MA 1NR2A 4ZUJA 2AQ1B 1BBXC 1JWMD 3DXJC 2E2JB 3HOVB 1GXDC 2YU9B 1PFBA 4IUTA 2IWHA 4HCSA 1BDOA 1B4OA 2F4IA 4IUPA 3DMUA 1EU3A 1I3QB 4DXGA 1RKNA 5D14A 3KLRA 2EYHA 2XNAC 2EE1A 2B8FA 4IFDJ 3S17B 1IHZA 2PW7A 1SEBD 2PMZB 5I6YA 5IGEA 4A93B 1XTCD 3S9WA 2DY7A 4JK1C 1WTRA 1HFGA 3EROA 2K1BA 5EBDA 1PXUA 4R8IA 2K7VA 2A6HD 5J1ZA 3S14B 4L8JA 3Q6SA 2F0EA 1Q3LA 3MFGA 1LLRD 1T5EA 1TVXA 3EVQA 2JA5B 4IUNA 4HSVA 1II3A 4CHTB 1ML0D 1BCPF 3VYUA 4DGZA 4G7OC 2EXZA 1R9TB 3BDOA 1GHJA 3NSWA 3KBGA 3HP3A 1ILQA 2XN9C 4CKBA 1F2LA 4OIKA 3M4YA 4HN7A 4C56C 2E2DC 1HUMA 3GTJB 1XYIA 1TU2B 2AWOA 4V0BA 1RD9D 1STEA 3AB9A 1CK1A 3SVMA 4OO1G 1JB3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1D1K A;  1QOH A;  1C4Q A;  2XSC A;  1BOS A;  2C5C A;  2BOS A;  1DM0 B;  1D1I A;  1R4P B;  1C48 A;  1R4Q B;  2GA4 B;  4ULL A;  3MXG A;  1CZG A;  1QNU A;  1CZW A;  4P2C B;  4M1U B;  1CQF A; 
#chains in the Genus database with same CATH topology
 5C0X J;  2CWP A;  4A3J H;  4DR5 L;  4DN4 M;  1H9R A;  2F0F A;  4DA2 A;  3D4D A;  1A2U A;  3T16 A;  2IHE A;  1AN8 A;  1PTO D;  1Q7Y C;  1IBL Q;  1HTL D;  4LFB L;  2I0Q A;  2JEB I;  2GA4 B;  1SMX A;  1YBY A;  3E3X A;  1GOZ A;  3CMA A;  3CU7 A;  3M3Y H;  5HGT A;  2WKC A;  4YHH L;  3R2T A;  2KEE A;  1K8A C;  4K6D A;  4JV5 Q;  2VXW A;  3VR5 A;  4RH6 A;  4C3H G;  1Y1V H;  4DR1 L;  4X65 L;  2PZW A;  2YYZ A;  3HOW H;  2R61 A;  4EQO A;  5C4X H;  1FNU A;  2KEC A;  3WWV A;  2VB3 X;  1EY6 A;  5JVG 3;  1LO5 D;  2NZ1 D;  3CHB D;  2K05 A;  1HNW L;  2ZTE A;  3VR2 A;  3HKS A;  5M3M H;  3VA7 A;  2B2T C;  3NE5 B;  3MC0 B;  4K2K A;  1AP0 A;  2K50 A;  1HZC A;  2M00 A;  5LMN Q;  2AUK A;  3B6Y A;  3PUV A;  2K6A A;  2RDH A;  3LX0 A;  5KYL A;  5FLM G;  1FVI A;  4IUR A;  4OWT B;  1LTG D;  1VQI A;  1KLU D;  3QG1 A;  4FXK C;  1K8G A;  1B9M A;  1YIT A;  2A6E C;  2C35 B;  2CQO A;  2EYL A;  4Q5V A;  2L55 A;  4RHS A;  3KDF B;  1TWC H;  4R4C A;  1GO3 E;  3HFZ B;  3BDL A;  1MKH A;  3BDC A;  4GOP B;  2ZXO A;  3CP0 A;  4WOR A;  1VQ7 A;  4KD3 A;  3EJI A;  5G3L D;  5JEA G;  2E74 C;  4X3S A;  3HS0 C;  5BN3 A;  3PIO 3;  5KGU A;  4K0K Q;  4H02 A;  3TSS A;  4V19 0;  1VQF A;  4IPH A;  1S5F D;  3W1G A;  3A5U A;  4F7X A;  4QUF A;  3I73 A;  4A3B H;  1ROD A;  3U58 A;  1QCB D;  4R4O A;  3HZX A;  1QVC A;  2XIW A;  1SNC A;  1EQT A;  3W5O A;  3CPF A;  5EJW A;  3S1N B;  4DV6 Q;  1X55 A;  4GNX C;  1LTI D;  3HGB A;  1G2S A;  1UNS A;  5C4J B;  2BE5 C;  5C5M A;  3LNN A;  4F8M A;  3V96 A;  5ELF A;  1HZB A;  3NTH A;  4G57 A;  2F0Q A;  3G7L A;  1WTQ A;  3KYH C;  4X3K A;  1X3E A;  3ND9 A;  3OIP A;  1YNJ C;  1G8Z D;  4DR3 L;  2EDG A;  1ENC A;  3M3Y B;  1EY7 A;  2PQA B;  2N78 A;  2O2L D;  1N32 Q;  1TT2 A;  3NTI A;  1M8A A;  1Y69 U;  2K5H A;  5IWA L;  2B8G A;  1IW7 D;  3HOW B;  1JB7 A;  1Q86 C;  1WVL A;  3H91 A;  4P2C B;  3TZU A;  5JJK A;  3TRZ A;  3K5O A;  2X6L A;  2IX3 A;  4HTH A;  2EZV A;  4ZCK A;  1GKH A;  1NE3 A;  2L9H A;  2SNS A;  4ILW A;  5I4D A;  3CW2 C;  3QIA A;  1TQO A;  5M3M B;  3PV0 A;  1K83 H;  4B3T Q;  2QIL A;  4HJ9 A;  4JI7 Q;  2VB2 X;  1SLJ A;  4CJ1 B;  1PH4 A;  3I4M B;  1C7Y A;  1V1Q A;  1CZG A;  4IZ8 A;  3J81 i;  1HCZ A;  1Q81 C;  2CWA A;  5IYC H;  4L5S A;  3A7A B;  1RTN A;  2JA6 G;  1YHB A;  3BVM A;  2NVQ H;  2MP1 A;  4HID A;  1I4H A;  1RDP D;  1KTK A;  1JOK A;  1W6K A;  4LF9 L;  3PO2 G;  1EOT A;  1F9Q A;  2Z1C A;  1TWC B;  2ICI A;  3NXW A;  1QUQ A;  1WCM H;  5TSS A;  2EXD A;  3UI2 A;  4B9X A;  4P75 A;  1FYC A;  1TY2 A;  3I4O A;  4OGQ C;  1XNR L;  1WTO A;  1IBK L;  3KF6 A;  1OXS C;  3BG3 A;  1OXT A;  1H9S B;  3CCL A;  1SYD A;  4DV2 L;  2QA4 A;  3CQZ H;  1EYG A;  1TWG B;  1HA5 A;  5IP9 G;  1PRT D;  1CKM A;  1EY5 A;  2LFN A;  1SBB B;  2OWO A;  2PO4 A;  5E3F A;  1STA A;  1BNZ A;  1GHK A;  2RSO A;  4DR1 Q;  4GN3 B;  1I6V C;  4U67 3;  3A7L A;  3ZJY C;  5ELO A;  1UE1 A;  2JN4 A;  4IPG A;  3PQI A;  5EGT A;  1WTP A;  4P72 A;  5FLX L;  4A76 A;  2WV6 D;  3H6M A;  4B3M L;  1AFP A;  4ULL A;  4DR2 L;  1HNW Q;  3S2D H;  4RFB A;  4CDE C;  1QNK A;  3H3V H;  4GKJ L;  4FVM A;  2HDM A;  3MXP A;  3NEN A;  4BBS H;  3S1N H;  1O80 A;  5C6A A;  4EGV A;  2R7Z H;  4PZ7 A;  3J81 j;  1A0I A;  3FPP A;  2EOT A;  4PMC A;  2K52 A;  3HOZ G;  3MA2 B;  4RAU C;  2EPB A;  1IBM Q;  1B3A A;  4KLK A;  1L0X B;  2DNE A;  4IPC A;  1HHV A;  1D1I A;  4LF8 Q;  4C3H B;  3QWN A;  2A73 B;  4HJ7 A;  1DJR D;  5CV4 A;  5C4Z A;  2XGT A;  1YNN C;  4LFA L;  1HXY D;  3URY A;  5LHY 1;  5J3B A;  4N8F A;  3GTK H;  2J7Z A;  2PZT A;  1Q8K A;  3F2D A;  1E3P A;  1STB A;  1PTO B;  1I50 H;  3J80 i;  1K83 B;  2N49 A;  1QVF A;  1A6X A;  4KHZ A;  1HPC A;  1PTO F;  1F9R A;  1D8L A;  1AW7 A;  3UDI A;  3KK7 A;  1QJO A;  5C3W A;  2ICE C;  1PH2 A;  3AYH B;  1H9S A;  4IFD H;  5T1I A;  1MI2 A;  2EQS A;  4ZRZ A;  3GTG H;  1Q82 C;  2FIN B;  4KHV A;  2NWG A;  4A3C G;  3GTP H;  2IY5 B;  5ELE A;  1AE3 A;  4A3I H;  2Z4I A;  2WB1 G;  5DM7 3;  5A2Q L;  4BY7 H;  3FDT A;  4NPS A;  2YTX A;  4DV0 L;  3E0J A;  3A8J E;  1WTH A;  1EY0 A;  3VYS A;  3PF5 A;  1G6Z A;  1STG A;  1WCM B;  2F1M A;  1ILP A;  1XNQ L;  1U4P A;  2ID0 A;  3NQI A;  2Q8I B;  1I4X A;  4RKB A;  5JPM C;  3MXU A;  4DV7 Q;  2UXD L;  1E0B A;  3SEB A;  1A3V A;  1TS3 A;  3E5S A;  3U4V A;  1AE2 A;  4HJ8 A;  2E76 C;  2HUG A;  2R7D A;  2BH2 A;  1E2V A;  3S1R H;  1GUO A;  2Q2H A;  3DWP A;  1QZG A;  3E6Z X;  2QDL A;  5E7N A;  4DR7 L;  3OMC A;  4R8N A;  4RHR A;  4CJ0 B;  5IOC A;  1HR0 Q;  3OYY A;  1FL0 A;  3OHX C;  5ELC A;  3S2D B;  5G3L F;  1XPR A;  2UUC L;  4DXF A;  3J81 L;  1EEF D;  2DY8 A;  5JAV A;  3Q22 A;  1LTR D;  1KAW A;  2ZTC A;  3UE1 A;  3JAM L;  2Q8R E;  3HOU H;  2Z0S A;  1HNZ L;  1F9P A;  1MBY A;  2JYO A;  2MO1 A;  2JA5 G;  1SE8 A;  2A74 C;  4R4Q A;  4CBV A;  1CTM A;  1QOH A;  5J39 A;  5FO9 B;  3A0J A;  1IL8 A;  4JI3 Q;  1YZ6 A;  4ZKC B;  1F2Y A;  4CJ2 C;  5E1F A;  5LL6 X;  4A75 A;  1K28 A;  1TII D;  4O42 A;  1TWF H;  4X3T A;  2K5W A;  3GTK B;  5C0X H;  2B2U C;  4IUQ A;  2R93 H;  2CHB D;  2Z6B A;  3RLO A;  1SMY C;  4A4I A;  1BKB A;  2JA7 H;  4KI0 A;  4M8A A;  2A68 D;  2UUA Q;  4QJF A;  4NXN L;  1A3U A;  4DAY A;  4OEL B;  1V1P A;  5ELN A;  1AEX A;  1SE2 A;  1TY0 A;  3GTG B;  1PFN A;  3QB3 A;  4X62 L;  3A8I E;  3K7A B;  2MHV A;  3VYR A;  2NZH A;  3GTP B;  2QKI C;  3T56 B;  1VF7 A;  4G7Z C;  1FR3 A;  3ITP A;  4A3I B;  2UUB Q;  5K36 H;  4DV1 Q;  1VQK A;  2K04 A;  4UP7 A;  5ELD A;  1EYA A;  4JVZ A;  2XVS A;  1H9J A;  4FF2 A;  2IX1 A;  1Z47 A;  5FJ8 H;  4OIJ A;  3D6C A;  3J80 E;  4AYB E;  2UXC Q;  1KNA A;  4S3S A;  2VS1 A;  4XXE A;  3X3N A;  4JCV E;  4AYB G;  4PMB A;  4ZK9 B;  3BZC A;  4C3J H;  3P1H A;  2MQH A;  4NXM L;  2NN6 H;  1DXM A;  4KKS A;  3S1R B;  4OXP A;  2LXJ A;  1MIU A;  4JI2 L;  4DAP A;  4KN4 C;  1AZQ A;  1KQS A;  3I4L A;  4PG3 A;  1GVP A;  4GN4 B;  2B63 H;  1CUK A;  1KDC A;  1VQH A;  1SRU A;  1I94 Q;  4K5X A;  5JVH 3;  2EJM A;  1PMR A;  4BS9 A;  3SK6 A;  2VW9 A;  4JI0 Q;  1PRT B;  1TWH H;  3KLS A;  3M85 A;  2F0S A;  4G7H C;  3CCJ A;  1LM0 A;  2IW3 A;  4DV4 L;  3HOU B;  2EYM A;  1C48 A;  4ZKB B;  1PRT F;  4L6T B;  1IL2 A;  2R7F A;  3BYY B;  3S15 H;  2UU9 L;  2DN8 A;  2KEN A;  1T9H A;  5LL6 S;  1PHJ A;  2K32 A;  2N8N A;  3I70 A;  4KKT A;  3LWE A;  3S2H B;  5EAY A;  3NHH A;  1M90 C;  3QR8 A;  2PNH A;  2WP8 J;  1YI2 A;  2GVB A;  1XNQ Q;  1PZJ D;  2ZJR A;  4OL7 A;  4A3F G;  2R93 B;  4PV1 C;  1EOV A;  1X3G A;  5IYB G;  3VR3 A;  1A8V A;  4POG A;  3D6W A;  1R4Q B;  4JC0 A;  3JAM c;  3EQL C;  2JA7 B;  1DGS A;  2HIX A;  4GNX B;  1HA6 A;  3DWA A;  1YIJ A;  2C9O A;  2XRS D;  4XIG S;  1KD1 C;  3DUZ A;  4HR7 B;  2XWJ B;  1DYQ A;  3G6E A;  1SNP A;  4LF6 Q;  2N3S A;  2EVB A;  1ZEQ X;  1SMY D;  2WB1 B;  4TRD A;  2WKD A;  3PIO A;  4DR7 Q;  2K03 A;  3DEP A;  1GUG A;  3BJU A;  3KJO A;  1EEI D;  1YHA A;  5C44 H;  4A3J G;  3TP5 A;  1R4P B;  2VUM H;  3GTQ B;  2K4K A;  4IUV A;  2I5M X;  2IPK D;  2FHT A;  2ZJP A;  1G6P A;  5NUC A;  2EIF A;  4C3J B;  4FP5 D;  1E22 A;  1K0S A;  1SYG A;  1JJ2 A;  3KLS X;  4FXD A;  4POF A;  1HNZ Q;  1KHI A;  4DV3 Q;  3MAQ A;  3MZ5 A;  4E6I A;  1H9M A;  2I5L X;  3I90 A;  3T51 B;  2VQF L;  5L37 A;  1J8I A;  1Y1V G;  1PYW D;  3HOW G;  3VYT A;  1Q8I A;  4MN3 A;  4BWG B;  2LMC B;  3RN2 A;  5C4X G;  4A3E H;  4MTN A;  5COY A;  2KCT A;  1KRS A;  2KBN A;  3M7N A;  4KD4 A;  2AMC B;  3NBI A;  5M3M G;  2L5T A;  4RGM A;  4A3L H;  1TWH B;  2MO0 A;  2NVY B;  1U9R A;  1B3Q A;  3SK4 A;  4NW2 A;  2K5D A;  2A69 D;  1PDQ A;  4O0A A;  3S15 B;  3D4W A;  2LY7 A;  3K5L A;  3CME A;  2M9V A;  2RA4 A;  3VA5 A;  1E2Z A;  2JJQ A;  2SEB D;  3PUY A;  3K0Y A;  3OOC A;  1NTG A;  2IT1 A;  1GUT A;  1C9O A;  1O7Z A;  4PZ6 A;  1JWU D;  1NMF A;  3CF5 A;  2KA7 A;  1K73 C;  4BA1 I;  4A3K H;  4HMI A;  4A3M H;  4AQY L;  2HCI A;  1JIC A;  4H7B A;  4Z9C B;  5CC4 A;  1D5M C;  2OT2 A;  1EQQ A;  4DUY L;  4JBJ A;  4A3B G;  2I07 B;  1U4L A;  5LMN W;  4UHV A;  4JI5 L;  4JOI A;  4CDC C;  1VMP A;  2F0P A;  1VMC A;  2X6G A;  4LUZ A;  5C44 B;  4KJN A;  4KJO A;  1O78 A;  5M5X H;  4LF7 L;  2MUY A;  2SNM A;  4DR4 L;  1VQ5 A;  4AYB B;  1Z7T A;  1RF2 D;  3HEJ A;  5C3E H;  1EY8 A;  5COR A;  4DV4 Q;  2F4V L;  1LTL A;  2KUM A;  1N36 L;  4BBR H;  1JJC B;  2QGQ A;  3T13 A;  1ZYR C;  5M5W B;  2BA1 A;  1C4Q A;  1TWA H;  1LAB A;  2F3I A;  3I72 A;  2VQE Q;  4HJA A;  1M4V A;  4PMW A;  3PCO B;  2XWB B;  4B3R L;  1SRO A;  2Z6K A;  1XMO Q;  1YVC A;  2KVM A;  3RD4 A;  5KNB A;  1JJG A;  1CSQ A;  3DWQ A;  5AFW A;  5CV8 A;  5J22 A;  3WOE A;  4G4K A;  1WTV A;  5AJ3 L;  4K5W A;  3VR4 A;  5IGF A;  4DKA C;  4PNY A;  2RHS B;  5IYC G;  3L0O A;  2RQX A;  4C2M B;  1G51 A;  2A19 A;  5CV6 A;  1S3O A;  2ASB A;  5GAG C;  4LUV A;  3UDG A;  5D3D A;  2X69 A;  2LS0 1;  1TS5 A;  3R8B A;  3TS2 A;  1NBW A;  2F0W A;  1WCM G;  2VNU D;  4A3F B;  4FF3 A;  5BR8 L;  3STB C;  1SNO A;  4H0L C;  1JE4 A;  3MFY A;  4A3K B;  3FP9 A;  2IX0 A;  5KEE A;  3GD7 A;  3CCR A;  4UDU C;  1EQR A;  3WDN A;  3KF8 B;  4CGY B;  1D6E C;  4DK6 C;  1LT4 D;  1EYD A;  2HDL A;  5I2Y A;  3RNU A;  4L5T A;  4DR6 Q;  1JMC A;  2AUJ D;  1KL9 A;  4RA8 A;  1ENF A;  4GLX A;  3BYT B;  3RN5 A;  1SFO H;  4JI1 L;  4A3J B;  4OO1 I;  1I4R A;  5M5X B;  3I8Z A;  4R4T A;  2SOB A;  1T5X D;  3EIV A;  2NUC A;  1B50 A;  4BBS G;  5C3E B;  1I4P A;  4DAM A;  1F77 A;  2R7Z G;  1DD2 A;  2Z9H A;  4RGT A;  1L1O C;  2WIN B;  4BBR B;  3G6J B;  2UXB L;  1X6O A;  1PFM A;  3SR1 A;  1KDB A;  1ICW A;  2WFW A;  1Y1V B;  1PH1 A;  1DZ1 A;  1TWA B;  2EY2 A;  2MPM A;  4I7Z C;  2A1A A;  4LW1 A;  2F0U A;  1D1K A;  1SN8 A;  1EY9 A;  1GD7 A;  5C4X B;  5ELB A;  3KDF A;  3TDQ A;  2LSS A;  3E9I A;  2B2Y A;  4F87 A;  4GOP A;  1W2B A;  2ZM6 L;  4JBK A;  4L63 B;  5IGD A;  3I55 A;  3D31 A;  1I4G A;  4ID6 A;  4YIJ A;  3CRK C;  4DUY Q;  3Q8D A;  1LT3 D;  2RF4 A;  4DV5 Q;  1JE5 A;  2IJ0 A;  2JK8 A;  1HRJ A;  4IFD G;  1HFN A;  2B39 A;  2ENB A;  3F1Z A;  3T1Y Q;  3KF8 A;  2QEX A;  1NJI C;  3F2B A;  1X3P A;  3JAM i;  1XPU A;  1O7I A;  1U4M A;  3NBH B;  2B2V A;  1DON A;  1DOM A;  4A3I G;  2PYK A;  4WJ4 A;  4DPG A;  3S1Q H;  4DR5 Q;  1WYD A;  4BY7 G;  1LYL A;  3W3A A;  1YNX A;  3ZYY X;  1DOK A;  4L5R C;  2F0O A;  5FLX E;  1HQM C;  4IOA A;  1O7L A;  2F4V Q;  1VQ4 A;  2A6E D;  4LFB Q;  4UY8 C;  2A8V A;  3PF4 A;  4BXX H;  1BXT A;  1E1T A;  4YHH Q;  4XYQ A;  4A3B B;  2OTL A;  3QJY A;  3CCQ A;  1IKL A;  1EWH A;  1QE6 A;  1J9O A;  4N9T A;  4EQN A;  4X65 Q;  1ENA A;  3STB D;  1K9M C;  1UE6 A;  2PQA A;  1JOQ A;  1BCP C;  1FGU A;  1GUW A;  1X32 A;  1AH9 A;  2Z4H A;  1SFO B;  4QF4 A;  2K28 A;  2EJF C;  1PYB A;  2FMC A;  4HCE A;  4ZYS A;  1QWY A;  2K01 A;  3KUP A;  1B53 A;  3HOX H;  3A54 A;  2L0C A;  1FJG L;  2RCF A;  4JG2 A;  3CKI B;  2BDO A;  1Y8P B;  3H3V I;  4DF7 A;  4IQZ A;  4ALP A;  2FFK B;  3HOU G;  2HCC A;  3PO3 H;  1DM0 B;  2BE5 D;  1J6Q A;  3OIQ A;  3KJP A;  2KCN A;  2L12 A;  1K8O A;  1CM9 A;  1UE7 A;  1L0W A;  1X3Q A;  5CMD A;  1Y14 B;  3SHL A;  2KCC A;  5IYD H;  4JI4 L;  1PH5 A;  3NBH A;  2XRQ D;  1I6H H;  1XPO A;  4B9W A;  5HY6 A;  1YNJ D;  2HHH L;  1FNV A;  5C0X G;  5A2Q E;  1HR0 W;  2R93 G;  2Q2I A;  4EQ5 A;  5I9O A;  1YHQ A;  4UAI A;  2DGY A;  1RHP A;  2JA7 G;  4MTK A;  4KTA A;  1CFM A;  2KJX A;  4K2L A;  1GUN A;  2F0N A;  4KY6 A;  4RMF A;  3M7G A;  1TKW B;  5LMU L;  2B29 A;  4DK3 C;  2NVQ B;  3CPW A;  4YWM A;  1D5Z C;  4FF4 A;  1QVG A;  2V1C C;  5IP7 H;  2SDF A;  2F0I A;  4PZ8 A;  1Q1E A;  5KND A;  3S1M H;  2D5D A;  3I56 A;  5K36 G;  1IXR A;  1EZ6 A;  3PSI A;  5KYI A;  5JOB A;  2RBM A;  3A74 A;  2J4X A;  4NMZ A;  5C5L A;  3HRZ C;  4JYA L;  4FXG C;  3J7A V;  5FJ8 G;  1N33 L;  3HOY H;  4X6A H;  2K5V A;  4RCN A;  4C3J G;  4HMJ A;  1SSO A;  3CQZ B;  1V1O A;  4DR3 Q;  3J81 E;  2UXB Q;  3TME A;  2OQ0 A;  2R3Z A;  2NN6 G;  1HUN A;  3AMU A;  3JAM E;  4YY3 L;  4DUZ L;  5IWA Q;  2PI2 E;  1SYE A;  5EKL A;  3K80 C;  5IT9 L;  1VQA A;  4ME5 A;  4LF5 L;  4A3D H;  4GKK L;  1VQ6 A;  3LGJ A;  4OEM B;  2BA0 A;  3CRL C;  1STN A;  3NWS A;  1Q46 A;  2M2L A;  5CGK A;  4C1N I;  2B63 G;  5HGQ A;  4QQB X;  1OXV A;  2PMZ E;  1G91 A;  4TSS A;  1PLF A;  1VF5 C;  2ZM6 Q;  3HOX B;  1P8L A;  4A3G H;  1S40 A;  2JA8 H;  4BBS B;  1EFW A;  2R7Z B;  3Q0A A;  1BCP D;  5GRO A;  3PUW A;  4B3S L;  2RDG A;  1OO9 B;  4J1M A;  4LF9 Q;  3IKJ A;  1SJH D;  3MVV A;  2ZT9 C;  1LTS D;  1JOR A;  3MTS A;  3VR6 A;  5IOD A;  3HKZ E;  3RZO H;  1I6H B;  5E4W C;  1PVO A;  1NCV A;  3HKZ G;  5D65 A;  4YCV A;  1A3T A;  1XNR Q;  1SJE D;  1I50 B;  3R2I A;  1IBK Q;  4GLA C;  1VQ9 A;  2Y0S E;  4DV2 Q;  2R92 H;  3I3C A;  5CBE E;  4KY5 A;  1YNN D;  3NK9 A;  4FO2 A;  3U50 C;  3OTO L;  3T1H L;  1DOL A;  1HNX L;  2F0L A;  5KNC A;  1L2F A;  1SYF A;  4RGN A;  2HQL A;  1KRT A;  3S1M B;  1KAA A;  2ZXR A;  1C0A A;  4BY7 B;  1SE4 A;  4B3M Q;  3F8T A;  5C44 G;  4DU9 A;  4QY7 A;  3GP7 A;  1EZ8 A;  4DR2 Q;  2K5Q A;  2VUM G;  2L15 A;  1ASY A;  1EU4 A;  3NQT A;  1C8C A;  3RR5 A;  4GKJ Q;  1EWI A;  4FDB A;  1PA6 A;  1VQL A;  3GTO H;  1Y1W H;  2Z8L A;  1XTD A;  4JI6 L;  2E2J H;  3HOV H;  4GZY C;  5M5Y H;  1IYU A;  3TRE A;  2HQE A;  2F52 A;  2QF7 A;  1XXG A;  3I2Z A;  4XTC S;  4X66 L;  1BF4 A;  3TZD A;  2DNC A;  4OX9 L;  4C3I H;  1LV9 A;  2NN6 I;  1K0R A;  1CKN B;  4FNF A;  1QB5 D;  1F2Z A;  3I7F A;  4LFA Q;  4A3D B;  1HJP A;  4JI4 Q;  2MGS A;  1Q12 A;  2CQA A;  2HHH Q;  4GLV B;  4A3E G;  2JA9 A;  3AU7 A;  3K81 C;  4CKE A;  1BQQ T;  2C5C A;  3FMC A;  4K6L A;  4A3G B;  4A3L G;  2B2W A;  4A93 H;  2D0O A;  4WRD A;  3TEH B;  1B9N A;  5EPK A;  2LKV A;  5EKK A;  3QOJ A;  1ASZ A;  2Q8T A;  4U68 A;  1SE3 A;  1VQE A;  1JC7 A;  4Y52 H;  4XT1 B;  2E75 C;  3T53 B;  2CH4 W;  3RLF A;  2D62 A;  4RG1 A;  5IT9 c;  3J7A F;  4QB4 A;  1W6J A;  3T4A C;  4DFA A;  3S14 H;  1CHP D;  3NEM A;  5HUR A;  3F2U A;  2CKZ B;  1DCZ A;  2XSC A;  4DV0 Q;  4K8I A;  5JJL A;  5E4X A;  1HTP A;  3BS1 A;  3FPU B;  2BOS A;  1TWF B;  4KK7 A;  3V2T A;  5FKA C;  4KHP L;  5CV9 A;  2KHS A;  4P74 A;  2QW7 A;  2F0V A;  2F0H A;  1N34 L;  1RIP A;  4EVO A;  4A3K G;  1VQC A;  2CW0 C;  3NTK A;  4A3M G;  2UXD Q;  2R92 B;  4JV5 L;  3Q24 A;  3K7U C;  2KED A;  1KXL A;  3TP8 A;  4RWS C;  4YCU A;  3K59 A;  5D3I B;  1KDA A;  1IZ6 A;  1X56 A;  3A56 A;  4YY3 Q;  1MSH A;  1P16 A;  3E0E A;  3K5M A;  1STY A;  5F2D A;  4LF5 Q;  3CC7 A;  1L1O B;  4I7A A;  3CCU A;  2WII B;  3GO5 A;  1UE5 A;  1CKN A;  2B2T A;  3SXH A;  3UE0 A;  5DNF A;  1KC8 C;  2I46 A;  2UUC Q;  3AQQ A;  5JPN C;  1ET6 A;  3GTO B;  5LMN L;  4HAE A;  1Y1W B;  1NSN S;  3ND8 A;  3L2P A;  1UEA B;  2A5H A;  5M5Y B;  5C3E G;  2AQ3 B;  1PTO C;  2FJ2 A;  1VDZ A;  1NAP A;  3RUZ A;  4B3S Q;  2NTT A;  1TS2 A;  4EQP A;  2R6G A;  3GTM H;  4JPB W;  2NVX H;  3MXN B;  1ESR A;  4BBR G;  4JBM A;  3U4Z A;  3ONA B;  1CI3 M;  5GQO A;  1E2W A;  2BH8 A;  2AQ2 B;  4C3I B;  4QIW E;  1XJV A;  1X54 A;  5H1S E;  2EY5 A;  4TQU S;  1QIL A;  2DJF C;  3OWF A;  2L1B A;  1B1Z A;  1BO0 A;  2RDF A;  3AEV A;  3A8K E;  2B63 B;  4LWC A;  4K0K L;  3GQB A;  4IAL A;  1CA6 A;  1PFS A;  2N55 A;  3N6R A;  2H4O A;  4F88 A;  1ZKO A;  2OEO A;  5M3F H;  4R4I A;  3GTL H;  4NXN Q;  3UDF A;  2EY6 A;  3T1H Q;  4GNX A;  4X62 Q;  2G9D A;  4DV6 L;  3NWT A;  2EYP A;  3H94 A;  1CZW A;  1VCI A;  4HED A;  3IFT A;  4ME3 A;  3HKZ B;  3ERQ A;  2Q2T A;  1EIF A;  4IO9 A;  1VQJ A;  1BCP B;  3UDX A;  3KLW A;  4K8J A;  4NXM Q;  3MWY W;  3H3V C;  1SYB A;  2Y0S B;  1EL0 A;  4ZLT F;  1VQD A;  1XMQ L;  2F0J A;  3I4N H;  3CCE A;  4XT3 B;  2PCF B;  1QNU A;  5KRU A;  3MXN A;  3OW7 A;  2ATW A;  1Z9F A;  4JI2 Q;  1K3R A;  4J8Q A;  4LNQ A;  4KY7 A;  1B2T A;  2CW0 D;  4BY1 H;  4HJ5 A;  4B3T L;  2TSS A;  1JWS D;  4IPD A;  4JI7 L;  1S4Z A;  2PI2 A;  3ULP A;  1A15 A;  2VUM B;  2CH4 A;  2KHJ A;  2N88 A;  1G29 1;  5EKI A;  1K8M A;  1EYC A;  3M9B A;  5CYU A;  2B2W C;  3PUZ A;  3GTM B;  4IN3 A;  3J7A 5;  2NVX B;  3RMH A;  2UU9 Q;  1YJ9 A;  3A5Z B;  3H0G H;  1CKO A;  5FO8 B;  5C4J H;  4J6H A;  4DK1 A;  2JEA I;  2F0G A;  1LUZ A;  2YTV A;  5EBC A;  3E9H A;  5GAD C;  5FOB B;  1IW7 C;  1A2T A;  2O5J C;  1UUP A;  2HIV A;  3FHW A;  4KHP Q;  4LMQ D;  4A3E B;  1N34 Q;  3K6O A;  3ICE A;  5I6W A;  4HIO A;  4WFN 3;  4TKO B;  1YJW A;  5M3F B;  2GVA A;  3CD6 A;  3FKI H;  3GTL B;  4TVA B;  4N8X 1;  4KV6 A;  5FO7 B;  2K5N A;  1NUC A;  4C1N K;  1U0L A;  3CC2 A;  4LUO A;  4K5V A;  1YJN A;  3PIP A;  2E2I H;  1LT5 D;  4R9W A;  3ERS X;  3BVG A;  1WJJ A;  2D0P A;  5A35 A;  5K5P A;  1MSG A;  3AFP A;  3TN2 A;  1J5E L;  3ULJ A;  3TBI B;  1IBM L;  1AZP A;  3I4M H;  2KHI A;  1RJT A;  1JT8 A;  3W1B A;  1O7Y A;  1Z6H A;  4A3M B;  3H09 A;  1MGS A;  3CCS A;  4WJ3 M;  1BOS A;  3P20 A;  4LF8 L;  3C46 A;  4FYD A;  4BXX G;  1XX8 A;  4DK0 A;  1PRT C;  1F9S A;  4NB3 A;  3I4N B;  5C4H A;  2VQF Q;  4RGO S;  3H15 A;  5EPL A;  1GUS A;  3DM3 A;  3NPP A;  4BY1 B;  2NZO A;  5JJI A;  1QZH A;  3V05 A;  1OXU A;  4X64 L;  3L7Z C;  5GAH C;  4N9P A;  3TP7 A;  1PZI D;  1TWG H;  4XQJ A;  4Y7N H;  1SYC A;  2I5H A;  3HOX G;  3PGZ A;  3R93 A;  3GV3 A;  4XYO A;  3OW2 A;  4OHJ A;  4OON A;  4IOC A;  1N9W A;  1YEZ A;  4OO1 H;  1QUQ B;  1LTT D;  3PO3 G;  2GN5 A;  2MFI A;  3H0G B;  3OPO A;  1ESF A;  3OMG A;  1CT1 D;  1W3S A;  3KF6 B;  4QL5 A;  3M4P A;  1V43 A;  4AIM A;  4QIW B;  1MJC A;  1UWV A;  3WOF A;  1PV4 A;  1PYS B;  3SK8 A;  5IYD G;  4QMG A;  2E2H H;  1B8A A;  1K3B C;  4DV7 L;  5BN4 A;  4RKL A;  3EBE A;  5IY0 A;  1ZYR D;  2BDN A;  4AQY Q;  3DHQ A;  3DM1 A;  3EFX D;  3FKI B;  4C3H H;  5T1G A;  1HQR D;  2NYZ D;  1XMQ Q;  3K5N A;  1S72 A;  4QCL A;  2BCO A;  4M1U B;  4KKU A;  4XQN A;  2CCZ A;  4O2D A;  5DM6 3;  2D9U A;  2KQ3 A;  5M9O A;  1HR0 L;  4JI5 Q;  5IP7 G;  5EPJ A;  4JOI C;  3CCV A;  1IYV A;  3S24 A;  1PTO H;  4LAA A;  5IIF A;  2E2I B;  5FK9 C;  1BR9 A;  4XQQ A;  1G2T A;  5GAE C;  1HZ9 A;  4LF7 Q;  3HG9 A;  4DR4 Q;  5I2X A;  2WAQ E;  1JOO A;  3K0X A;  2QCP X;  1NR4 A;  2WAQ G;  5FLM H;  2F0T A;  4MNO A;  4UP9 A;  3HOY G;  5BN5 A;  1N36 Q;  2YV5 A;  4JI3 L;  3U9S A;  3MHB A;  2YTY A;  1L0Y B;  1SND A;  1EWC A;  2V4D A;  1M1K C;  2B2U A;  3M4Q A;  4ABN A;  3A55 A;  5JEA H;  2RSN A;  4A3D G;  1D7Q A;  3SK5 A;  4B3R Q;  1D5X C;  1LAC A;  5CV7 A;  2Z6K C;  4R1J A;  2UUA L;  5IGG A;  4Y7N B;  1STH A;  1D2B A;  1JCK B;  4A3G G;  2JA8 G;  1LTA D;  3C2P A;  1IKM A;  1KNE A;  1SDF A;  1SXT A;  4LJZ C;  5AJ3 Q;  3RZD H;  4FF1 A;  1WFQ A;  2ZXP A;  2UUB L;  2ZTD A;  5KIX A;  3S16 H;  5IE8 A;  4JBW A;  4DV1 L;  2AHO B;  4YCW A;  1UAP A;  2NTS A;  3D8G A;  3TP6 A;  1JR0 D;  1A62 A;  1VS0 A;  4KN7 C;  2UXC L;  5IGC A;  1PH7 A;  1S5B D;  2E2H B;  3D4R A;  3CAM A;  1J5E Q;  2EJG C;  1EIH A;  5BR8 Q;  2ZJQ A;  1HZA A;  3K58 A;  2L4N A;  3O13 A;  3C1E A;  4DAV A;  3L9A X;  2O4X A;  3PIP 3;  2R92 G;  2FXQ A;  3NUC A;  1HH2 P;  3CXC A;  4P73 A;  1IYJ B;  4LFC L;  2A68 C;  2PQE A;  3W2D A;  1TR5 A;  3G4S A;  1JQY D;  2CFM A;  2JSO A;  4IFD I;  3P7J A;  1X65 A;  1TS4 A;  1U4R A;  3OWE B;  5DEH A;  1I94 L;  4HIK A;  4JI1 Q;  2WAC A;  3S1Q B;  4X64 Q;  1ET9 A;  2HD3 A;  4YWK A;  4X3U A;  4H44 C;  5IT9 E;  1Y8O B;  4JI0 L;  2H1E A;  1NNX A;  1PH8 A;  3M4O H;  3P75 A;  1A63 A;  1Y1W G;  2JA6 H;  2Q2U A;  3IAY A;  2PNR C;  1LTB D;  1WTW A;  1MJE A;  2D2C C;  4JW0 A;  1V9P A;  3HOV G;  3BZK A;  3IFD A;  2WB1 E;  3K7A H;  4ODG A;  1ONL A;  4K14 A;  2EY1 A;  3PO2 H;  1Q90 A;  3SGI A;  2OQK A;  3SDZ A;  4IUU A;  3DLL A;  3I91 A;  5DAU A;  1PZK D;  4C3I G;  3VDY A;  2E5L L;  2F0D A;  1RL2 A;  4DNR B;  4DAY B;  2AWN A;  5CV5 A;  4HSP A;  1RTO A;  3NP8 A;  1FGB D;  1V1P B;  3TQY A;  2PW5 A;  3L3O C;  1S5C D;  3C3L A;  2EYO A;  5IP9 H;  2OXP A;  4CDD C;  2B2Y C;  4GOP C;  5CR3 A;  4NDX A;  1SR3 A;  1H9K A;  3MXG A;  4A93 G;  1XWE A;  4YWL A;  4UP8 A;  4LF6 L;  5EQ0 A;  2EYF A;  3BU2 A;  3RZD B;  3OSO A;  2H5X A;  1LT6 D;  5C3X A;  3J7Z C;  3PO3 B;  3S16 B;  1WD0 A;  3LWU A;  2ES2 A;  2JQO A;  4MZ9 A;  4IJH A;  1E24 A;  5IGB A;  2B2V C;  3N52 A;  3U9O A;  2AKW B;  3BVZ A;  3DEO A;  3HOZ H;  2F0K A;  4ZUI A;  4DV3 L;  3PMF A;  3IL8 A;  5C0X I;  2FMM A;  1EIG A;  1CHQ D;  2NBF A;  2MNA A;  2F3W A;  2Y0S G;  4PQX A;  4LF4 L;  3S2H H;  5FLX c;  2K14 A;  1BUV T;  4DNT B;  3CCM A;  3PUX A;  1I4Q A;  1I5F A;  3D0F A;  4ZAI A;  3G48 A;  2EYJ A;  1ICF B;  1SNQ A;  4CKC A;  4MIU A;  2NVT H;  2XTI A;  2PZU A;  2TMP A;  1B70 B;  2MJ8 A;  3AFQ A;  3M4O B;  2WAQ B;  1FJG Q;  3EN2 A;  3KBX A;  2JA6 B;  3HOY B;  4I65 A;  2QEJ C;  2DUD A;  1FD7 D;  1S5D D;  3K57 A;  2E8G A;  2YU9 H;  4A3C H;  5ISR A;  3C1F A;  1V8Q A;  3GV6 A;  3PO2 B;  4XDX A;  1WTX A;  2O5I C;  2RKS A;  3EA6 A;  1H95 A;  2LXK A;  1WOC A;  5CBA E;  4KMU C;  3D3R A;  3GTQ H;  1I3Q H;  1WD1 A;  1U5K A;  1E7Z A;  2J0T D;  2OF1 A;  3FVQ A;  4HIM A;  1QG7 A;  4WJW A;  2B3G A;  3S17 H;  1E1O A;  4AH6 A;  1VQN A;  2A6H C;  3FRP B;  4QUC A;  3MEH A;  3QO2 A;  4BA2 I;  2JA8 B;  2K33 A;  4JI8 L;  2IHF A;  3FEW X;  5M3F G;  2VZA A;  1ZXT A;  4LFC Q;  2RVL A;  3J7Y W;  1MD2 D;  5LMU Q;  1PH3 A;  1EY4 A;  1CSP A;  4O1N A;  2CVR A;  2G5D A;  3J80 L;  4IJL A;  2L11 A;  3RLN A;  2A69 C;  5JEA J;  5I9P A;  1CQF A;  2F03 A;  1GJX A;  3QOL A;  1OXX K;  4ZQ3 A;  2IL8 A;  1GM5 A;  2JP1 A;  3R3O A;  2DJG C;  2K75 A;  2HT1 A;  2NB0 A;  3RZO B;  3X3M A;  4LK1 C;  1FNW A;  2NVY H;  1S5E D;  4JYA Q;  1EQV A;  1IBL L;  1N33 Q;  2P5Z X;  3HOZ B;  5DLQ E;  2JA5 H;  3BZD B;  1Q1B A;  1KIX A;  1SNM A;  4NKL A;  3ULL A;  2G9H D;  1CA5 A;  1F2M A;  2JXM B;  4P71 A;  1WI5 A;  3NEL A;  1B44 D;  1NY4 A;  3Q23 A;  3GDE A;  1Y8N B;  1KLG D;  4RCO A;  4NP5 A;  1KAB A;  5JJZ A;  3MEF A;  3I4N G;  3ER0 A;  2VQE L;  1X3F A;  4B08 A;  2F3V A;  4MHE A;  4DUZ Q;  1R9T H;  2PPB C;  2RCN A;  2E5L Q;  4H13 C;  2KOL A;  1VQ8 A;  3J81 c;  4GKK Q;  1XMO L;  1CQV A;  3SE0 A;  1RCV D;  1SAP A;  2JE6 I;  4Q0F A;  4BY1 G;  2QDB A;  1EFI D;  2NVT B;  2F0M A;  1NR2 A;  4ZUJ A;  2AQ1 B;  1BBX C;  3GTJ H;  2VL6 A;  1VQP A;  1JWM D;  3DXJ C;  1X9N A;  4OWW B;  3HOV B;  2E2J B;  3CC4 A;  1GXD C;  2YU9 B;  1PFB A;  4IUT A;  3G71 A;  2ALY B;  3F2C A;  2IWH A;  4HCS A;  1BDO A;  1B4O A;  2F4I A;  4IUP A;  3H0G G;  3DMU A;  1BBU A;  1EU3 A;  1VQG A;  1I3Q B;  1TXY A;  4DXG A;  2VY3 A;  1RKN A;  5D14 A;  3KLR A;  2EYH A;  2XNA C;  3K8A A;  2EE1 A;  2B8F A;  4IFD J;  1OTC A;  4L5Q A;  3S17 B;  1IHZ A;  2PW7 A;  1SEB D;  2PMZ B;  4CDF C;  5I6Y A;  5IGE A;  4QGU A;  1N8R C;  4A93 B;  1XTC D;  3S9W A;  2DY7 A;  4JK1 C;  1WTR A;  5M5W H;  4DR6 L;  3FKI G;  1HFG A;  4LF4 Q;  4UPA A;  3ERO A;  3IRB A;  1VQO A;  3KOJ A;  3OTO Q;  1MHW C;  2K1B A;  5EBD A;  1HNX Q;  4EX5 A;  1PXU A;  4R8I A;  2K7V A;  2A6H D;  5J1Z A;  3S14 B;  2OCE A;  4L8J A;  2RHQ B;  3Q6S A;  2F0E A;  1Q3L A;  3MFG A;  4OWX B;  1EUJ A;  1LLR D;  1T5E A;  1L1O A;  1TVX A;  3EVQ A;  4GN5 A;  2OTJ A;  2JA5 B;  4IUN A;  4J15 A;  1B7Y B;  3I4M G;  4JI6 Q;  4HSV A;  4C2M H;  4APV A;  1N32 L;  1II3 A;  4CHT B;  3J80 c;  1ML0 D;  1BCP F;  3VYU A;  4DGZ A;  4X66 Q;  4G7O C;  2EXZ A;  2KCM A;  4DNI A;  1R9T B;  3BDO A;  1GHJ A;  1EIY B;  4OX9 Q;  3NSW A;  3KBG A;  1VQM A;  4A3F H;  3HP3 A;  1NMG A;  1ILQ A;  2XN9 C;  5IYB H;  4CKB A;  3TS0 A;  1F2L A;  3KFU A;  1UEB A;  4OIK A;  3M4Y A;  4HN7 A;  4C56 C;  2E2D C;  1BVS A;  1HUM A;  3GTJ B;  4JI8 Q;  1TU2 B;  4DV5 L;  1XYI A;  1PH6 A;  2AWO A;  4GS3 A;  4V0B A;  1PH9 A;  3T1Y L;  1BBW A;  1VQB A;  1RD9 D;  1STE A;  3AB9 A;  1CK1 A;  3JC6 6;  3SVM A;  4OO1 G;  1JB3 A; 
#chains in the Genus database with same CATH homology
 5C0X J;  4DN4 M;  1H9R A;  2F0F A;  4DA2 A;  3D4D A;  1A2U A;  3T16 A;  1AN8 A;  1PTO D;  1HTL D;  2JEB I;  2GA4 B;  1GOZ A;  3CU7 A;  5HGT A;  2WKC A;  3R2T A;  2KEE A;  4K6D A;  2VXW A;  3VR5 A;  4RH6 A;  4C3H G;  2PZW A;  2YYZ A;  2R61 A;  4EQO A;  1FNU A;  2KEC A;  2VB3 X;  1EY6 A;  5JVG 3;  1LO5 D;  2NZ1 D;  3CHB D;  2K05 A;  3VR2 A;  3VA7 A;  2B2T C;  3NE5 B;  3MC0 B;  4K2K A;  1AP0 A;  2M00 A;  2AUK A;  3PUV A;  2K6A A;  2RDH A;  3LX0 A;  5KYL A;  4IUR A;  1LTG D;  3QG1 A;  1KLU D;  4FXK C;  1B9M A;  2A6E C;  4Q5V A;  2EYL A;  2L55 A;  4RHS A;  3BDL A;  3BDC A;  2ZXO A;  4WOR A;  4KD3 A;  3EJI A;  5G3L D;  5JEA G;  2E74 C;  4X3S A;  3HS0 C;  5BN3 A;  3PIO 3;  5KGU A;  3TSS A;  4V19 0;  1S5F D;  4F7X A;  4QUF A;  3I73 A;  1ROD A;  1QCB D;  3HZX A;  2XIW A;  1SNC A;  1EQT A;  5EJW A;  3S1N B;  1LTI D;  3HGB A;  1G2S A;  1UNS A;  5C4J B;  2BE5 C;  5C5M A;  3LNN A;  4F8M A;  3V96 A;  5ELF A;  3NTH A;  4G57 A;  2F0Q A;  3G7L A;  1WTQ A;  4X3K A;  3ND9 A;  3OIP A;  1YNJ C;  1G8Z D;  2EDG A;  1ENC A;  3M3Y B;  1EY7 A;  2O2L D;  1TT2 A;  3NTI A;  1M8A A;  1Y69 U;  2B8G A;  1IW7 D;  3HOW B;  1WVL A;  3H91 A;  4P2C B;  3TZU A;  3K5O A;  2X6L A;  2IX3 A;  4HTH A;  2EZV A;  2L9H A;  2SNS A;  4ILW A;  5I4D A;  3QIA A;  1TQO A;  5M3M B;  3PV0 A;  2QIL A;  2VB2 X;  4CJ1 B;  3I4M B;  4IZ8 A;  1CZG A;  1DON A;  1HCZ A;  3A7A B;  1RTN A;  3BVM A;  2MP1 A;  1I4H A;  1RDP D;  1KTK A;  1JOK A;  1W6K A;  1EOT A;  1F9Q A;  2Z1C A;  1TWC B;  2ICI A;  3NXW A;  3UI2 A;  5TSS A;  4B9X A;  1FYC A;  1TY2 A;  4OGQ C;  1WTO A;  1OXS C;  3BG3 A;  1OXT A;  1H9S B;  1SYD A;  1TWG B;  1HA5 A;  1PRT D;  1EY5 A;  2LFN A;  1SBB B;  2PO4 A;  5E3F A;  1STA A;  1BNZ A;  1GHK A;  2RSO A;  1I6V C;  4U67 3;  3A7L A;  5EGT A;  1WTP A;  5FLX L;  2WV6 D;  3H6M A;  1AFP A;  4ULL A;  4RFB A;  1QNK A;  4FVM A;  2HDM A;  3MXP A;  1O80 A;  5C6A A;  4EGV A;  3FPP A;  2EOT A;  4PMC A;  3MA2 B;  4RAU C;  2EPB A;  1B3A A;  1L0X B;  2DNE A;  1HHV A;  1D1I A;  4C3H B;  3QWN A;  2A73 B;  1DJR D;  5CV4 A;  5C4Z A;  1YNN C;  1HXY D;  3URY A;  5LHY 1;  2J7Z A;  2PZT A;  1STB A;  1PTO B;  1K83 B;  1A6X A;  4KHZ A;  1HPC A;  1PTO F;  1F9R A;  1AW7 A;  3KK7 A;  1QJO A;  5C3W A;  2ICE C;  1H9S A;  4IFD H;  5T1I A;  1MI2 A;  4ZRZ A;  2FIN B;  4KHV A;  2NWG A;  5ELE A;  2Z4I A;  5DM7 3;  5A2Q L;  3FDT A;  3E0J A;  3A8J E;  1EY0 A;  3VYS A;  1G6Z A;  1STG A;  1WCM B;  2F1M A;  1ILP A;  1U4P A;  2ID0 A;  3NQI A;  2Q8I B;  1I4X A;  4RKB A;  5JPM C;  3MXU A;  1E0B A;  3SEB A;  1A3V A;  1TS3 A;  3E5S A;  2E76 C;  2HUG A;  1E2V A;  1GUO A;  3DWP A;  3E6Z X;  3OMC A;  4R8N A;  4RHR A;  4CJ0 B;  5IOC A;  3OHX C;  5ELC A;  3S2D B;  5G3L F;  4DXF A;  3J81 L;  1EEF D;  2DY8 A;  5JAV A;  3Q22 A;  1LTR D;  3JAM L;  2Q8R E;  1F9P A;  1MBY A;  2JYO A;  2A74 C;  4CBV A;  1CTM A;  1QOH A;  5J39 A;  5FO9 B;  1IL8 A;  4ZKC B;  1F2Y A;  4CJ2 C;  5E1F A;  5LL6 X;  1TII D;  4O42 A;  4X3T A;  2K5W A;  3GTK B;  5C0X H;  2B2U C;  4IUQ A;  2CHB D;  1SMY C;  4KI0 A;  4M8A A;  2A68 D;  1A3U A;  4DAY A;  1V1P A;  1AEX A;  1SE2 A;  1TY0 A;  3GTG B;  1PFN A;  3QB3 A;  3A8I E;  3K7A B;  2MHV A;  3VYR A;  3GTP B;  2QKI C;  3T56 B;  1VF7 A;  4G7Z C;  1FR3 A;  3ITP A;  4A3I B;  5K36 H;  2K04 A;  5ELD A;  1EYA A;  2XVS A;  1H9J A;  4FF2 A;  2IX1 A;  1Z47 A;  4OIJ A;  3D6C A;  3J80 E;  1KNA A;  4S3S A;  4XXE A;  3X3N A;  4PMB A;  4ZK9 B;  3P1H A;  2NN6 H;  1DXM A;  4KKS A;  3S1R B;  4DAP A;  4KN4 C;  1AZQ A;  3I4L A;  1KDC A;  4K5X A;  5JVH 3;  2EJM A;  1PMR A;  4BS9 A;  3SK6 A;  1PRT B;  3KLS A;  3M85 A;  2F0S A;  4G7H C;  2IW3 A;  3HOU B;  2EYM A;  1C48 A;  4ZKB B;  1PRT F;  4L6T B;  3BYY B;  2DN8 A;  5LL6 S;  2K32 A;  3I70 A;  4KKT A;  3LWE A;  3S2H B;  3NHH A;  2WP8 J;  1PZJ D;  4OL7 A;  2R93 B;  4PV1 C;  3VR3 A;  3D6W A;  1R4Q B;  2JA7 B;  3EQL C;  1HA6 A;  3DWA A;  2C9O A;  2XRS D;  4XIG S;  3DUZ A;  4HR7 B;  2XWJ B;  1DYQ A;  1SNP A;  2EVB A;  1ZEQ X;  1SMY D;  2WB1 B;  4TRD A;  2WKD A;  2K03 A;  3DEP A;  1GUG A;  1EEI D;  3TP5 A;  1R4P B;  3GTQ B;  4IUV A;  2IPK D;  2FHT A;  5NUC A;  4C3J B;  4FP5 D;  1SYG A;  3KLS X;  4FXD A;  3MAQ A;  3MZ5 A;  4E6I A;  1H9M A;  3I90 A;  3T51 B;  1J8I A;  1PYW D;  3VYT A;  1Q8I A;  4MN3 A;  4BWG B;  2LMC B;  5COY A;  3M7N A;  4KD4 A;  3NBI A;  2L5T A;  4RGM A;  1TWH B;  2NVY B;  1U9R A;  3SK4 A;  4NW2 A;  2K5D A;  2A69 D;  1PDQ A;  3S15 B;  3D4W A;  2LY7 A;  3K5L A;  2M9V A;  2RA4 A;  3VA5 A;  1E2Z A;  2SEB D;  3PUY A;  3K0Y A;  3OOC A;  2IT1 A;  1GUT A;  1O7Z A;  1JWU D;  2KA7 A;  4BA1 I;  4HMI A;  2HCI A;  1JIC A;  4H7B A;  4Z9C B;  5CC4 A;  1D5M C;  2OT2 A;  2I07 B;  1U4L A;  1VMP A;  2F0P A;  1VMC A;  2X6G A;  5C44 B;  4KJN A;  4KJO A;  1O78 A;  2MUY A;  2SNM A;  4AYB B;  1Z7T A;  1RF2 D;  3HEJ A;  1EY8 A;  5COR A;  2KUM A;  3T13 A;  1ZYR C;  5M5W B;  2BA1 A;  1C4Q A;  1LAB A;  3I72 A;  1M4V A;  4PMW A;  2XWB B;  2KVM A;  3RD4 A;  5KNB A;  3DWQ A;  5AFW A;  5CV8 A;  5J22 A;  3WOE A;  4G4K A;  1WTV A;  4K5W A;  3VR4 A;  5IGF A;  4PNY A;  2RQX A;  4C2M B;  5CV6 A;  5D3D A;  2X69 A;  2LS0 1;  1TS5 A;  3R8B A;  2F0W A;  2VNU D;  4A3F B;  4FF3 A;  1SNO A;  4H0L C;  1JE4 A;  3MFY A;  4A3K B;  2IX0 A;  5KEE A;  3GD7 A;  4UDU C;  3WDN A;  4CGY B;  1D6E C;  1LT4 D;  1EYD A;  2HDL A;  5I2Y A;  2AUJ D;  4RA8 A;  1ENF A;  3BYT B;  4A3J B;  4OO1 I;  1I4R A;  5M5X B;  3I8Z A;  2SOB A;  1T5X D;  2NUC A;  1B50 A;  5C3E B;  1I4P A;  1F77 A;  1DD2 A;  4RGT A;  2WIN B;  4BBR B;  3G6J B;  1PFM A;  3SR1 A;  1KDB A;  1ICW A;  1Y1V B;  1DZ1 A;  1TWA B;  2EY2 A;  2MPM A;  4I7Z C;  2F0U A;  1D1K A;  1EY9 A;  5C4X B;  5ELB A;  3TDQ A;  2B2Y A;  4F87 A;  4L63 B;  5IGD A;  3D31 A;  1I4G A;  4ID6 A;  4YIJ A;  3CRK C;  1LT3 D;  2IJ0 A;  1HRJ A;  4IFD G;  1HFN A;  2B39 A;  2ENB A;  3KF8 A;  1X3P A;  1U4M A;  2B2V A;  1DOM A;  2PYK A;  3W3A A;  3ZYY X;  1DOK A;  2F0O A;  5FLX E;  1HQM C;  1O7L A;  2A6E D;  1BXT A;  4XYQ A;  4A3B B;  3QJY A;  1IKL A;  1EWH A;  1QE6 A;  1J9O A;  4N9T A;  4EQN A;  1ENA A;  1JOQ A;  1BCP C;  1GUW A;  1X32 A;  2Z4H A;  1SFO B;  4QF4 A;  2K28 A;  2EJF C;  2FMC A;  4HCE A;  4ZYS A;  1QWY A;  2K01 A;  3KUP A;  1B53 A;  3A54 A;  2L0C A;  3CKI B;  2BDO A;  1Y8P B;  4DF7 A;  4IQZ A;  2FFK B;  2HCC A;  1DM0 B;  2BE5 D;  3OIQ A;  2KCN A;  2L12 A;  1K8O A;  1CM9 A;  1X3Q A;  5CMD A;  3SHL A;  2KCC A;  3NBH A;  2XRQ D;  4B9W A;  1YNJ D;  1FNV A;  5C0X G;  5A2Q E;  5I9O A;  4UAI A;  1RHP A;  4KTA A;  1CFM A;  2KJX A;  4K2L A;  1GUN A;  2F0N A;  4KY6 A;  3M7G A;  1TKW B;  2NVQ B;  1D5Z C;  4FF4 A;  2SDF A;  2F0I A;  1Q1E A;  5KND A;  2D5D A;  5K36 G;  1EZ6 A;  5KYI A;  5JOB A;  2RBM A;  2J4X A;  4NMZ A;  5C5L A;  3HRZ C;  4FXG C;  3J7A V;  4RCN A;  4C3J G;  4HMJ A;  1SSO A;  3CQZ B;  1V1O A;  3J81 E;  3TME A;  2R3Z A;  2NN6 G;  1HUN A;  3AMU A;  3JAM E;  1SYE A;  5EKL A;  5IT9 L;  4ME5 A;  2BA0 A;  3CRL C;  1STN A;  3NWS A;  2M2L A;  5CGK A;  4C1N I;  1OXV A;  1G91 A;  4TSS A;  1PLF A;  1VF5 C;  3HOX B;  4BBS B;  2R7Z B;  3Q0A A;  1BCP D;  3PUW A;  2RDG A;  1OO9 B;  4J1M A;  3IKJ A;  1SJH D;  3MVV A;  2ZT9 C;  1LTS D;  1JOR A;  3MTS A;  3VR6 A;  5IOD A;  1I6H B;  5E4W C;  1NCV A;  5D65 A;  1A3T A;  1SJE D;  1I50 B;  3R2I A;  3I3C A;  5CBE E;  4KY5 A;  1YNN D;  3NK9 A;  4FO2 A;  1DOL A;  2F0L A;  5KNC A;  1SYF A;  4RGN A;  3S1M B;  1KAA A;  2ZXR A;  4BY7 B;  1SE4 A;  4DU9 A;  3GP7 A;  1EZ8 A;  2K5Q A;  1EU4 A;  3NQT A;  1C8C A;  2Z8L A;  4GZY C;  1IYU A;  2HQE A;  2QF7 A;  1XXG A;  4XTC S;  1BF4 A;  3TZD A;  2DNC A;  1LV9 A;  2NN6 I;  4FNF A;  1QB5 D;  1F2Z A;  4A3D B;  2MGS A;  1Q12 A;  2CQA A;  3AU7 A;  4CKE A;  1BQQ T;  2C5C A;  3FMC A;  4K6L A;  4A3G B;  2B2W A;  4WRD A;  1B9N A;  5EPK A;  2LKV A;  5EKK A;  3QOJ A;  2Q8T A;  4U68 A;  1SE3 A;  1JC7 A;  4XT1 B;  2E75 C;  3T53 B;  3RLF A;  2D62 A;  3J7A F;  4QB4 A;  1W6J A;  3T4A C;  4DFA A;  1CHP D;  5HUR A;  3F2U A;  1DCZ A;  2XSC A;  4K8I A;  5E4X A;  1HTP A;  3BS1 A;  3FPU B;  2BOS A;  1TWF B;  4KK7 A;  3V2T A;  5FKA C;  5CV9 A;  2KHS A;  2F0V A;  2F0H A;  4EVO A;  2CW0 C;  3NTK A;  2R92 B;  3Q24 A;  2KED A;  3TP8 A;  4RWS C;  3K59 A;  5D3I B;  1KDA A;  3A56 A;  1MSH A;  3K5M A;  1STY A;  5F2D A;  2WII B;  3GO5 A;  2B2T A;  3SXH A;  5DNF A;  2I46 A;  5JPN C;  1ET6 A;  3GTO B;  4HAE A;  1Y1W B;  1NSN S;  3ND8 A;  1UEA B;  2A5H A;  5M5Y B;  2AQ3 B;  1PTO C;  2FJ2 A;  1VDZ A;  3RUZ A;  1NAP A;  2NTT A;  1TS2 A;  4EQP A;  2R6G A;  1ESR A;  3ONA B;  1CI3 M;  1E2W A;  2AQ2 B;  4C3I B;  2EY5 A;  4TQU S;  1QIL A;  3OWF A;  2L1B A;  1B1Z A;  1BO0 A;  2RDF A;  3A8K E;  2B63 B;  3GQB A;  4IAL A;  1CA6 A;  3N6R A;  2N55 A;  2H4O A;  4F88 A;  1ZKO A;  2OEO A;  2EY6 A;  2G9D A;  3NWT A;  2EYP A;  3H94 A;  1CZW A;  1VCI A;  4HED A;  3IFT A;  3HKZ B;  3ERQ A;  1BCP B;  4K8J A;  3MWY W;  3H3V C;  1SYB A;  2Y0S B;  1EL0 A;  4ZLT F;  2F0J A;  4XT3 B;  2PCF B;  1QNU A;  5KRU A;  3MXN A;  3OW7 A;  4J8Q A;  4KY7 A;  1B2T A;  2CW0 D;  2TSS A;  1JWS D;  1S4Z A;  1A15 A;  2VUM B;  2N88 A;  1G29 1;  5EKI A;  1K8M A;  1EYC A;  5CYU A;  2B2W C;  3PUZ A;  3GTM B;  4IN3 A;  2NVX B;  3RMH A;  5FO8 B;  4J6H A;  4DK1 A;  2JEA I;  2F0G A;  5EBC A;  5FOB B;  1IW7 C;  1A2T A;  2O5J C;  1UUP A;  4LMQ D;  4A3E B;  3K6O A;  5I6W A;  4WFN 3;  4TKO B;  5M3F B;  3GTL B;  4KV6 A;  5FO7 B;  1NUC A;  4C1N K;  4K5V A;  1LT5 D;  4R9W A;  3BVG A;  5A35 A;  5K5P A;  1MSG A;  3TN2 A;  3TBI B;  1AZP A;  1RJT A;  1O7Y A;  1Z6H A;  4A3M B;  3H09 A;  1MGS A;  1BOS A;  3P20 A;  3C46 A;  4FYD A;  1XX8 A;  4DK0 A;  1PRT C;  1F9S A;  3I4N B;  5C4H A;  4RGO S;  5EPL A;  1GUS A;  3NPP A;  4BY1 B;  3V05 A;  1OXU A;  3L7Z C;  4N9P A;  3TP7 A;  1PZI D;  4XQJ A;  1SYC A;  3R93 A;  3GV3 A;  4XYO A;  4OHJ A;  4OO1 H;  1LTT D;  3H0G B;  3OPO A;  1ESF A;  3OMG A;  1CT1 D;  1V43 A;  4QIW B;  3WOF A;  3SK8 A;  4QMG A;  5BN4 A;  4RKL A;  1ZYR D;  2BDN A;  3DHQ A;  3DM1 A;  3EFX D;  3FKI B;  5T1G A;  1HQR D;  2NYZ D;  3K5N A;  4QCL A;  2BCO A;  4M1U B;  4KKU A;  4XQN A;  5DM6 3;  2D9U A;  2KQ3 A;  5M9O A;  5EPJ A;  1IYV A;  1PTO H;  4LAA A;  5IIF A;  2E2I B;  5FK9 C;  1BR9 A;  4XQQ A;  1G2T A;  3HG9 A;  5I2X A;  1JOO A;  2QCP X;  1NR4 A;  2F0T A;  5BN5 A;  3U9S A;  3MHB A;  1L0Y B;  1SND A;  1EWC A;  2V4D A;  2B2U A;  4ABN A;  3A55 A;  5JEA H;  2RSN A;  3SK5 A;  1D5X C;  1LAC A;  5CV7 A;  5IGG A;  4Y7N B;  1STH A;  1D2B A;  1JCK B;  1LTA D;  3C2P A;  1IKM A;  1KNE A;  1SDF A;  1SXT A;  4LJZ C;  4FF1 A;  2ZXP A;  5KIX A;  4JBW A;  1UAP A;  2NTS A;  3D8G A;  3TP6 A;  1JR0 D;  4KN7 C;  5IGC A;  1S5B D;  2E2H B;  3D4R A;  2EJG C;  1EIH A;  3K58 A;  2L4N A;  3O13 A;  3C1E A;  4DAV A;  3L9A X;  2O4X A;  3PIP 3;  3NUC A;  2A68 C;  2PQE A;  3W2D A;  1TR5 A;  1JQY D;  2JSO A;  4IFD I;  3P7J A;  1TS4 A;  1U4R A;  3OWE B;  5DEH A;  2WAC A;  3S1Q B;  1ET9 A;  4X3U A;  4H44 C;  5IT9 E;  1Y8O B;  2H1E A;  3P75 A;  3IAY A;  2PNR C;  1LTB D;  1WTW A;  2D2C C;  3IFD A;  4ODG A;  1ONL A;  4K14 A;  2EY1 A;  1Q90 A;  3SDZ A;  4IUU A;  3I91 A;  5DAU A;  1PZK D;  4C3I G;  2F0D A;  4DNR B;  2AWN A;  5CV5 A;  4HSP A;  1RTO A;  3NP8 A;  1FGB D;  1V1P B;  2PW5 A;  3L3O C;  1S5C D;  3C3L A;  2EYO A;  2OXP A;  2B2Y C;  5CR3 A;  4NDX A;  1H9K A;  3MXG A;  1XWE A;  5EQ0 A;  2EYF A;  3RZD B;  3OSO A;  1LT6 D;  5C3X A;  3PO3 B;  3S16 B;  1WD0 A;  3LWU A;  5IGB A;  2B2V C;  3N52 A;  3U9O A;  3BVZ A;  3DEO A;  2F0K A;  4ZUI A;  3PMF A;  3IL8 A;  5C0X I;  2FMM A;  1EIG A;  1CHQ D;  2NBF A;  2F3W A;  4PQX A;  1BUV T;  4DNT B;  3PUX A;  1I4Q A;  4ZAI A;  2EYJ A;  1SNQ A;  4CKC A;  4MIU A;  2PZU A;  2TMP A;  2MJ8 A;  3M4O B;  2WAQ B;  3KBX A;  2JA6 B;  3HOY B;  4I65 A;  2QEJ C;  1FD7 D;  1S5D D;  3K57 A;  5ISR A;  3C1F A;  1V8Q A;  3GV6 A;  3PO2 B;  4XDX A;  1WTX A;  2O5I C;  2RKS A;  3EA6 A;  5CBA E;  4KMU C;  3D3R A;  1WD1 A;  2J0T D;  2OF1 A;  3FVQ A;  1QG7 A;  4WJW A;  2A6H C;  3FRP B;  4QUC A;  3MEH A;  3QO2 A;  4BA2 I;  2JA8 B;  2K33 A;  3FEW X;  1ZXT A;  2RVL A;  3J7Y W;  1MD2 D;  1EY4 A;  4O1N A;  2CVR A;  3J80 L;  2L11 A;  2A69 C;  5I9P A;  5JEA J;  1CQF A;  2F03 A;  1GJX A;  3QOL A;  1OXX K;  4ZQ3 A;  2IL8 A;  2JP1 A;  3R3O A;  2NB0 A;  3RZO B;  3X3M A;  4LK1 C;  1FNW A;  1S5E D;  1EQV A;  3HOZ B;  3BZD B;  1Q1B A;  1SNM A;  4NKL A;  1CA5 A;  2G9H D;  1F2M A;  2JXM B;  1B44 D;  3Q23 A;  1Y8N B;  1KLG D;  4RCO A;  4NP5 A;  1KAB A;  5JJZ A;  4B08 A;  2F3V A;  4MHE A;  2PPB C;  4H13 C;  2KOL A;  1CQV A;  3SE0 A;  1RCV D;  1SAP A;  2JE6 I;  4Q0F A;  2QDB A;  1EFI D;  2NVT B;  2F0M A;  1NR2 A;  4ZUJ A;  2AQ1 B;  1BBX C;  1JWM D;  3DXJ C;  2E2J B;  3HOV B;  1GXD C;  2YU9 B;  1PFB A;  4IUT A;  2IWH A;  4HCS A;  1BDO A;  1B4O A;  2F4I A;  4IUP A;  3DMU A;  1EU3 A;  1I3Q B;  4DXG A;  1RKN A;  5D14 A;  3KLR A;  2EYH A;  2XNA C;  2EE1 A;  2B8F A;  4IFD J;  3S17 B;  1IHZ A;  2PW7 A;  1SEB D;  2PMZ B;  5I6Y A;  5IGE A;  4A93 B;  1XTC D;  3S9W A;  2DY7 A;  4JK1 C;  1WTR A;  1HFG A;  3ERO A;  2K1B A;  5EBD A;  1PXU A;  4R8I A;  2K7V A;  2A6H D;  5J1Z A;  3S14 B;  4L8J A;  3Q6S A;  2F0E A;  1Q3L A;  3MFG A;  1LLR D;  1T5E A;  1TVX A;  3EVQ A;  2JA5 B;  4IUN A;  4HSV A;  1II3 A;  4CHT B;  1ML0 D;  1BCP F;  3VYU A;  4DGZ A;  4G7O C;  2EXZ A;  1R9T B;  3BDO A;  1GHJ A;  3NSW A;  3KBG A;  3HP3 A;  1ILQ A;  2XN9 C;  4CKB A;  1F2L A;  4OIK A;  3M4Y A;  4HN7 A;  4C56 C;  2E2D C;  1HUM A;  3GTJ B;  1XYI A;  1TU2 B;  2AWO A;  4V0B A;  1RD9 D;  1STE A;  3AB9 A;  1CK1 A;  3SVM A;  4OO1 G;  1JB3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...