1DM0B

Shiga toxin
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
69
structure length
69
Chain Sequence
b'TPDCVTGKVEYTKYNDDDTFTVKVGDKELFTNRWNLQSLLLSAQITGMTVTIKTNACHNGGGFSEVIFR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SHIGA TOXIN A SUBUNIT
publication title Crystal structure of the holotoxin from Shigella dysenteriae at 2.5 A resolution.
pubmed doi rcsb
source organism Shigella dysenteriae
molecule tags Toxin
total genus 15
structure length 69
sequence length 69
chains with identical sequence C, D, E, F, G, H, I, J, K
ec nomenclature
pdb deposition date 1999-12-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.70 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1dm0B00
4M1UB 1DM0B 1QNUA 1BOSA 1CZWA 1R4QB 1CQFA 1C4QA 2GA4B 1QOHA 1CZGA 1D1KA 1C48A 1R4PB 2XSCA 3MXGA 4ULLA 1D1IA 4P2CB 2BOSA 2C5CA
chains in the Genus database with same CATH superfamily
4X65L 3CQZB 1PXUA 4YCUA 2QILA 4JBKA 4X6AH 1SN8A 4LF7Q 4HJ8A 1STEA 2F0UA 1IBML 2MHVA 2K5WA 2PZTA 1PYBA 2EYOA 1TS2A 2AWNA 4L6TB 4NXNL 1EOTA 4OIKA 1U4MA 1XMOQ 1C4QA 5CC4A 4GKJQ 2EQSA 4ZK9B 3BDCA 1DGSA 2JN4A 2XSCA 4WJ3M 1C7YA 3QO2A 3NSWA 4FYDA 1HRJA 2UU9L 2CH4W 2K01A 1G6ZA 2KHJA 4DV4L 1EY0A 4CDEC 4CDDC 1SLJA 2MPMA 1TWHH 1WTHA 1KLGD 3S2DB 5M5WB 5G3LF 3TQYA 1G291 1RDPD 3I72A 3I2ZA 2ID0A 4K14A 4OHJA 5CV7A 3G71A 1ENCA 2NVYH 3NHHA 4YWLA 3TREA 2F0QA 3J80E 5CBAE 3U50C 1QZHA 4IUVA 2R93B 3KLSX 4OWXB 4OXPA 1E2VA 2KBNA 4FVMA 1KRTA 5M5YH 1JORA 4ULLA 2B2YC 2EJFC 5D3DA 2OXPA 4V190 5J1ZA 3HOWH 1I3QB 3E0EA 3BZDB 2B39A 4JCVE 3OW7A 1HXYD 3HOZB 1S5ED 2TMPA 3GTJH 1VQFA 5CV8A 5H1SE 1VQ9A 4XT1B 1Q1EA 1U4LA 1CQFA 1EU3A 4C3JH 4JYAQ 1ENAA 4YY3Q 4DUYQ 4DUZL 4JI6L 2VS1A 2NVXH 4XYOA 3OTOQ 1JOOA 1WTQA 2VUMH 2HIXA 1B7YB 1GJXA 1EY8A 1LTAD 2L15A 1JCKB 1TWFB 1TVXA 1Q1BA 4RKBA 3NPPA 4OEMB 3FP9A 2HQEA 3OYYA 2WAQG 1U0LA 3QJYA 3I73A 5CV5A 3WOFA 1HR0Q 3HOVH 3NQIA 2UUBQ 4K8IA 3HKZE 3QOJA 2ENBA 1ESRA 3TSSA 2VQFL 2JA8B 4IUPA 1STHA 2KHIA 3GP7A 3RZOH 3H0GH 1L0WA 3RR5A 3SDZA 5KGUA 3GTQH 1F9QA 1B50A 2QA4A 2G9HD 2F0NA 1EWHA 1H9SA 4WJ4A 3TZUA 4BBRB 3O13A 3NXWA 2IT1A 3VYUA 3MAQA 5IWAL 4GLXA 2JYOA 4LF6L 3OMCA 3P1HA 5AJ3L 2EIFA 4U673 1X6OA 3I56A 4DR3L 4B3RQ 2JA5G 3H3VC 2F0FA 4RH6A 3KLWA 3A55A 4IALA 1N9WA 1B9NA 3BVZA 1FD7D 1OXUA 4KTAA 3AU7A 1KNEA 4L5TA 2ZM6L 1MJCA 1X9NA 1EU4A 1PTOD 1HNWQ 1N32Q 4UP7A 4ID6A 4OELB 1EUJA 2E74C 1SNPA 2D2CC 1O7ZA 4CBVA 1FL0A 3M4QA 4K0KQ 3GTGH 1TT2A 2AWOA 1PH8A 3NELA 1A3TA 1TU2B 2EY5A 3JAME 1K73C 2RCNA 3MWYW 2B2TA 4X65Q 1SNMA 3GQBA 2WIIB 4IOAA 4JPBW 1BCPB 4DV7Q 3RUZA 4R4QA 2DY7A 3D6CA 4PZ7A 4R4CA 4NXNQ 1WCMH 4KK7A 4C3IH 2EXZA 1IBLL 2K52A 4I7AA 5KNDA 4K8JA 2WAQB 4XIGS 2UU9Q 4DXGA 3B6YA 3SK8A 3D3RA 2PNRC 1EYAA 1X3QA 2K32A 5C3WA 2CWAA 1E22A 1M1KC 5IYCH 1HZAA 2RBMA 2HIVA 1Z6HA 2A6EC 2F0TA 2KEDA 1KAWA 2MQHA 3BVMA 1UE5A 2MO1A 1TWGB 2Z0SA 2F0KA 1EY5A 4A3FH 3V96A 3A8JE 2JA6B 2R3ZA 2BOSA 5EGTA 4OWTB 1HNXL 5C3EH 2VNUD 1H9RA 2JA5B 1PH5A 4H02A 5I9OA 3BDLA 1X55A 4H7BA 5JOBA 5CR3A 3J80L 3HOWG 5C4JH 4AYBB 5C3XA 2PI2E 3KFUA 1IYJB 5K36G 4DUZQ 2K05A 4JI6Q 2KJXA 1STAA 1S4ZA 3SK5A 1Q81C 4JI7Q 4KKUA 3JAMi 4FDBA 3SXHA 3EN2A 3J7ZC 4DV5Q 3CCLA 3TEHB 4KV6A 1WTOA 2PO4A 1FGBD 3M9BA 1VQJA 2B3GA 1IBKQ 4HEDA 2PNHA 1JE4A 2M00A 4K6DA 1LACA 4UHVA 3J81E 5I4DA 4DAPA 3HOXG 2VQFQ 5T1IA 1VQPA 4PMCA 4DR6L 2K5DA 3GTLH 2E2DC 2EDGA 4PNYA 3HOVG 2K5HA 1C9OA 1WOCA 2L0CA 4GN5A 2YYZA 4OWWB 1ILPA 1JJCB 4O2DA 4JBJA 1PV4A 1IHZA 5DAUA 5IYBH 3S17H 1G2SA 4NB3A 2XGTA 2B2VC 5IWAQ 4A3IG 4OGQC 3HP3A 5AJ3Q 4FXGC 5LMNW 3BDOA 1L1OC 1Y8OB 1VDZA 1WD1A 2IJ0A 5BN5A 2R7DA 4BY1B 3KOJA 1LT6D 1ESFA 1RHPA 1SE2A 4X3KA 5CV6A 3TBIB 1EZ6A 1LTBD 2ZM6Q 1XYIA 1AP0A 2QDLA 4K2LA 2R92H 5M3MH 3CKIB 3I8ZA 4GOPB 1LTSD 2NVYB 4DAVA 1B2TA 3K7AH 1EFID 3ER0A 1YNXA 2RF4A 4F88A 5M5YB 2WKDA 4IUTA 4B3SL 4A3BB 2E5LQ 3L2PA 3HOWB 5FLXE 1VQGA 3KK7A 1OO9B 1X32A 1MHWC 3SE0A 2B2YA 2F4IA 3GTJB 3ICEA 3BZCA 4DK3C 1CKNA 1I4GA 4C3JB 2LY7A 4FF4A 2VB2X 2NTSA 4HSVA 4DAMA 1IBLQ 3TP8A 4ALPA 5IGEA 2V1CC 2BCOA 4QIWE 4DR4L 4IFDH 2VUMB 2K50A 3KF6A 5LL6X 2SNSA 2IHFA 4JI8L 1WCMG 2DJFC 1J8IA 4ZCKA 2F0WA 2PZWA 2KHSA 2R93H 4B9XA 5DM73 1Q90A 2M2LA 3MEHA 1AEXA 2NZ1D 4C1NK 3BJUA 1QNUA 2K33A 3RZOB 2QDBA 3H0GB 4GNXC 1LT5D 1HUNA 3CC2A 3TN2A 3K5OA 5IYCG 5D14A 5AFWA 2UXDL 1I4HA 4AH6A 5M9OA 4A76A 4R4IA 3AFPA 2I46A 4KN7C 5I2XA 4YWMA 3U4ZA 1HNXQ 3C46A 3T4AC 1FYCA 4QQBX 4DV2L 2JXMB 2KCTA 3ULJA 1YJWA 2Z4IA 3KLSA 4POFA 2B2UA 1VMCA 4QUCA 5C0XJ 5A2QE 3BG3A 4C3HB 3K8AA 4X3TA 2K04A 1W2BA 3HZXA 4ZQ3A 4KLKA 1XMQQ 1YNJC 1HQMC 3NQTA 1JMCA 4YHHL 2F03A 1TWCH 2Z6KA 1Q8IA 5IP9H 5KIXA 1SAPA 1MI2A 3FHWA 2QCPX 1KDAA 2J4XA 3SGIA 4FF3A 3GTGB 1D2BA 2NBFA 2F0DA 2XIWA 3J80c 1PH7A 2GA4B 2K03A 1JWMD 4LMQD 1SMYD 4GKJL 2XRSD 3FDTA 4LF4Q 4O0AA 1OTCA 3Q23A 4OX9L 1U5KA 3J81L 1T5EA 4OO1G 1WCMB 1X3EA 4C3IB 2PW7A 1UEBA 5LMNL 3S14H 2K5QA 4A3LG 1NR2A 1GD7A 2KEEA 2Q2TA 4HJ7A 2RSOA 5GROA 3A7AB 1STBA 1MSHA 3A8KE 5IIFA 4N8FA 1SYFA 2B2TC 5JJZA 2OQKA 5C4XH 5J39A 3R3OA 1DYQA 1Q82C 1K83H 1CI3M 1YEZA 1JJGA 4A3DG 4KKSA 2R92G 5M3MG 3CMAA 1WTWA 2A8VA 1ICFB 2RVLA 3OPOA 2MP1A 5C4HA 4A3FB 2WB1B 1HPCA 2AQ1B 4B3SQ 3I3CA 1VS0A 1KAAA 5HY6A 4QUFA 1SFOH 5C3EB 1EQQA 3S2HH 4L63B 2JJQA 1RKNA 1PTOH 1XPOA 2NN6H 5LMUQ 3CRKC 3S16H 4H44C 3U58A 5C4JB 2GN5A 1KNAA 1SMXA 1SRUA 3CF5A 2R7ZH 3S9WA 5IP7H 2OEOA 4LWCA 4WJWA 1O78A 3GTMH 1ENFA 3K5MA 4P74A 2MUYA 3K5LA 5KNCA 4DR4Q 1JB3A 4P71A 2CWPA 5FLXL 1BKBA 4IFDJ 4POGA 4JI8Q 4EQOA 3HRZC 2L12A 2K4KA 1EYDA 1BR9A 1PHJA 2NWGA 4A3CG 4DV0Q 5FLMH 1WD0A 1V1PB 4CDFC 2ATWA 3HOUH 3RLOA 4DGZA 2V4DA 3A5ZB 2IWHA 1FVIA 2JA6H 3TP6A 2D9UA 4LAAA 3CC7A 4RG1A 1BCPF 2R93G 3MHBA 5NUCA 2ZTDA 3T56B 4GLVB 1RF2D 2ZJQA 4JI0Q 1L2FA 4ABNA 1EQTA 1Z7TA 2UXDQ 4QGUA 2F0SA 2XNAC 1S5DD 4DV2Q 4Q5VA 3S17B 5IOCA 3KYHC 2KENA 2PPBC 4OO1I 3GV6A 4ZUJA 4FXDA 1EYGA 4JVZA 1QCBD 4YWKA 2Q8IB 1Q3LA 1B9MA 3PUWA 1D8LA 3D0FA 3T13A 1A3VA 2EY2A 4KD4A 4JI4L 1IYUA 1L1OA 3W5OA 5C4ZA 4YHHQ 4K0KL 2HUGA 2L5TA 3H91A 3V05A 3CCQA 2JA8G 5A2QL 1AZPA 4B3TQ 1VQEA 4M1UB 1SNQA 3K7AB 4R4OA 3F2UA 1S5CD 3EVQA 5IP9G 4JV5Q 3BZKA 1KRSA 4DV7L 3L7ZC 2L11A 3D6WA 4R9WA 1QVCA 4A3KH 2UXCQ 4RCNA 4BBRG 4LF9L 4OX9Q 2JK8A 1KDCA 4BS9A 4X62L 2BDOA 2F52A 4BXXH 3C1EA 1YITA 1PFNA 1K0RA 1TIID 2IY5B 3DXJC 1LUZA 1YNND 4BY1H 5LMNQ 1ZYRD 1X3GA 3VR3A 1QE6A 1BNZA 2WKCA 3I7FA 2RQXA 3E9IA 1NSNS 1GM5A 1ICWA 3GD7A 4KHZA 4NPSA 5IY0A 4Z9CB 1LO5D 2A6ED 5IYDG 2LXKA 5TSSA 5JPNC 4QF4A 3V2TA 5HGTA 3CCVA 2F0EA 4A3BH 2MNAA 2MJ8A 4RAUC 5C5LA 2BA1A 1N33L 1G6PA 4UDUC 3L3OC 4GNXA 4O42A 1VQOA 1K8AC 1I50H 2QGQA 1KC8C 3EBEA 4JOIA 1GHJA 4J15A 1VF7A 4JI7L 1G91A 1NBWA 4XXEA 4DV5L 1EEID 1WTXA 1EEFD 1V1QA 4IN3A 2NN6G 1QILA 1SNDA 1IBKL 3S1QH 5JJIA 1VQLA 1WFQA 1BDOA 2SNMA 1RJTA 5KRUA 4RGNA 2F1MA 2PCFB 4L5QA 2R7ZG 5IP7G 4KHPL 4R8IA 3W3AA 3P75A 1HZCA 1TWCB 1FGUA 2BA0A 1HFNA 1HA5A 1PRTC 4XTCS 1TS4A 1VQAA 2KVMA 4ODGA 4H13C 4KJNA 1CTMA 2A68C 2N78A 4RHSA 2B2UC 5FLMG 3CCRA 1VQKA 2RA4A 2R6GA 2FFKB 4BA1I 4S3SA 1NE3A 3IAYA 2JA6G 1TY0A 2X6GA 2ES2A 2NUCA 1VQBA 1SE8A 1O7LA 2WAQE 3CPFA 4K6LA 1VQ7A 4Y7NH 2ZXRA 1IL2A 5FLXc 4C3HH 2E8GA 2Z6KC 4AYBG 1Q86C 2E2IH 2D0OA 2PI2A 3S14B 1PH6A 1KL9A 3E9HA 3DUZA 3A0JA 5I6WA 4EQ5A 5HURA 4JI4Q 1WYDA 1HA6A 1SJED 1S72A 1E24A 1C8CA 1K3BC 2I5HA 1SBBB 4TQUS 1AE2A 3EQLC 3TRZA 3G4SA 3S15H 4HIOA 5C4XB 1IKMA 4NMZA 3PF4A 2E5LL 1K83B 3RNUA 2B8GA 1NTGA 1G51A 2NTTA 3VR6A 1NUCA 3D4WA 3CXCA 2IHEA 4EGVA 4ME3A 2Q8RE 5BN3A 4HMIA 2RHSB 1CZWA 1M8AA 4J6HA 1BXTA 1BUVT 1SFOB 1FJGL 4A3EH 1EL0A 4WFN3 3STBC 4DAYB 3S2HB 1G2TA 1XXGA 3HKZB 5EJWA 1HJPA 5ELBA 3Q0AA 3GV3A 1EWIA 1PTOB 1A8VA 4LF9Q 3UDIA 3S16B 2KA7A 5FJ8H 2L55A 4X62Q 3OW2A 2R7ZB 5ELDA 3GTMB 2JSOA 1PZKD 4MHEA 4PZ8A 1A15A 1DM0B 2FMCA 4MN3A 4BXXG 4B9WA 5C44H 4BY1G 1AN8A 1QJOA 4NDXA 4GKKL 5BN4A 4K2KA 3H09A 3HOUB 1QB5D 4UP8A 1XJVA 3HGBA 3G48A 2UXBQ 4RMFA 1TKWB 3F8TA 5LL6S 2Z1CA 2N88A 3VYTA 1T5XD 1Z9FA 2Z6BA 3K59A 2PQAA 2DUDA 4A3GH 2F3WA 1N33Q 4A3BG 1FNVA 5C0XH 3K5NA 3PCOB 3J7AV 4K5XA 3A5UA 4JI5L 4H0LC 4N8X1 5FO9B 4C3JG 2LKVA 1HZ9A 5G3LD 4KY7A 1GUGA 1XMQL 5GAEC 2NZOA 4LFBQ 1YNJD 2FINB 4KY5A 4JG2A 1D6EC 3NWTA 4RFBA 2VUMG 1CSPA 4LF5L 4XDXA 3QOLA 2EE1A 3FKIB 4NXMQ 4GS3A 5E4XA 3PO2H 1IL8A 1S5FD 1B8AA 4KHPQ 5EPLA 3A8IE 4L5RC 2IX1A 1R4PB 5E7NA 5GADC 2OWOA 3GO5A 2EYPA 4FXKC 3HFZB 4LF4L 4ZAIA 3H0GG 4OL7A 2HDMA 3CD6A 4OONA 1HH2P 3Q6SA 1CFMA 2F0JA 3SR1A 1KABA 1QG7A 4PQXA 3MXUA 1PZJD 1GO3E 2Q8TA 4HJ9A 2EZVA 1PFBA 4A3KB 4ILWA 2A5HA 2NYZD 1TS5A 2FHTA 4IURA 1H9SB 2NVQB 4RA8A 1MGSA 4JBMA 1YIJA 1E0BA 1A3UA 1PFSA 1D5MC 3M3YB 3LGJA 2JQOA 4UY8C 4C3HG 2A69D 3WDNA 4EQPA 1G8ZD 5CGKA 4MIUA 1AZQA 4MZ9A 1VMPA 1UE6A 2GVBA 4N9PA 4QJFA 5LHY1 1HNZL 2AQ2B 1H9JA 4GN3B 3H3VH 3ITPA 1PH4A 2Z4HA 4OIJA 4DK1A 2K28A 1BCPC 3PF5A 2HDLA 3MZ5A 3H15A 2DGYA 4G7ZC 2BE5D 1N36L 2F0GA 3I55A 1QZGA 4LJZC 3K7UC 1X3FA 1LYLA 5LMUL 1STGA 4JBWA 3C2PA 3E3XA 4DFAA 3I91A 3DEPA 4C2MH 3NTHA 1FJGQ 2JEBI 1I50B 3DM3A 3F2CA 1STYA 2KOLA 4I65A 3JAML 2O5JC 2ALYB 1TY2A 3AYHB 1NR4A 3CHBD 4C3IG 1I5FA 5CV9A 2MO0A 5JVH3 2B2WA 2K5NA 4DV0L 3ONAB 3S1QB 1DD2A 1I4RA 4M8AA 2DNEA 3IRBA 4KI0A 2JA7H 3F2BA 3HOYH 1W3SA 2CKZB 1PVOA 2N55A 4YCWA 1BOSA 2ICEC 4A3JH 2LSSA 4ZYSA 1A62A 1V1OA 2VL6A 5C5MA 4GKKQ 3AFQA 3LWEA 1X54A 2JA9A 1J5EQ 4JI0L 5J3BA 1QUQB 3PIP3 4APVA 4BY7H 3PQIA 4JOIC 3KBGA 3IL8A 1LT4D 1EY6A 2Y0SB 3S1RB 1UEAB 5CBEE 3J81j 4A93B 2Q2IA 4A3FG 1KD1C 3TMEA 1WJJA 2WB1G 5JPMC 5C3EG 4Y52H 4DNRB 4Y7NB 2CQAA 3CAMA 2K14A 4JI5Q 1JWSD 4A3GG 1Y8NB 2NZHA 3MXNB 1O7IA 2SOBA 1BBUA 3S1MH 4KMUC 3WOEA 4QCLA 4IPCA 5C0XG 1NY4A 2ZT9C 3GTPH 2E2IB 4JC0A 4DR1L 2XVSA 1A2UA 4I7ZC 4P2CB 2UUCL 3ZYYX 2J0TD 4XQJA 1ASYA 3X3NA 3NBIA 4LUOA 3OOCA 2C5CA 4CKBA 4B3ML 4LF5Q 4BBSH 2EYLA 1KQSA 3DM1A 4ZKBB 1LTTD 2YV5A 2AUKA 4B3TL 5D3IB 2ZJPA 2NVTH 1KDBA 3BU2A 4P75A 2WB1E 5GAHC 3KUPA 3OWFA 5BR8L 4L5SA 3S15B 2B63H 4JV5L 3Q8DA 4X64L 1V43A 3PUYA 1RTOA 1STNA 1P16A 3PV0A 3PO2G 1YZ6A 3M4OH 3OMGA 1TQOA 3PUZA 2UUAQ 2EYHA 3CC4A 2UXCL 2BDNA 1Q12A 1DOKA 3TS0A 3AB9A 3UE0A 2JP1A 1F2ZA 2SDFA 1AH9A 4GLAC 2CQOA 2XWBB 4A3EB 4DR7L 1Q8KA 1SE3A 3KDFB 1BBXC 2L1BA 2OTJA 5IYBG 1S5BD 4GOPC 1EY9A 1F9PA 2B29A 5JVG3 3S1NB 1C48A 4IZ8A 3I4LA 4LFCL 3PO3H 1JOQA 2A6HC 1I4XA 5IGCA 5M3FB 1H95A 4NW2A 2AUJD 1E3PA 2XN9C 5C44B 3CCUA 1VQHA 4X66L 1M90C 4HR7B 1SYEA 1HNZQ 4KN4C 3I4OA 2IX0A 2WFWA 1GHKA 1EYCA 1QWYA 3H6MA 1B53A 1WTVA 1SXTA 2IX3A 2ZJRA 4GN4B 4IQZA 3CCSA 3MVVA 1VQ4A 1N36Q 3CMEA 4A3GB 2BH8A 1VQ6A 4DV6L 3I4MB 1L0YB 5JJKA 2AHOB 2PYKA 2RDGA 4AQYL 1ML0D 4DK0A 1B3AA 4LUVA 2F3VA 1TXYA 1V8QA 3DWPA 4R4TA 4EQNA 2VQEL 2G5DA 3AMUA 3J7A5 3QWNA 2E75C 4C56C 1D1KA 3KF8B 3JC66 2X69A 3SHLA 3DWQA 3W1GA 4IFDG 1KHIA 4CKEA 3F2DA 4HAEA 4HTHA 1PRTD 3M85A 2I0QA 3PO2B 4G7OC 2N3SA 2PW5A 1WTRA 5DM63 1SYDA 2A68D 1DXMA 4FO2A 3BVGA 1DJRD 2JA7G 1MKHA 4P72A 1SNOA 4RCOA 1ZKOA 1QOHA 1PTOF 1CA6A 1II3A 1XTDA 2EJGC 4RGOS 1A2TA 2WACA 4CGYB 1F2LA 5IGFA 4A3MB 4KHVA 3JAMc 1CM9A 3CCJA 1E1OA 5T1GA 4DA2A 1LV9A 4IUQA 3PUVA 4JI2L 5I6YA 2F0VA 2IW3A 5E3FA 3KJPA 1CT1D 4FNFA 3U9OA 4KY6A 2EY1A 3FVQA 3EA6A 2F4VL 3TS2A 1XNRL 3FKIH 3R2IA 1YI2A 3D4RA 3IKJA 4LFAL 5FO7B 3FRPB 1SNCA 1SROA 5JEAJ 4DR1Q 2VZAA 1E2WA 1N8RC 1CQVA 3QIAA 5F2DA 1I94L 2UUCQ 4HIKA 3OWEB 2EYJA 4B3MQ 5KYIA 1IXRA 1JOKA 3A54A 3NBHB 1SYBA 3MXPA 1YHQA 4R1JA 4LF8L 4BBSG 4QY7A 5BR8Q 3DLLA 2HHHQ 2PQEA 5E1FA 4X64Q 1MBYA 1O80A 1O7YA 1GUWA 2CCZA 3I90A 3RLFA 3QG1A 4RKLA 3STBD 2WP8J 4QMGA 2CW0C 3CW2C 3RMHA 1NNXA 4DAYA 5KYLA 2PMZB 1FNUA 1QVFA 2NVQH 4CJ2C 2XRQD 4MTNA 2E2HH 4C2MB 3I70A 1VQDA 4DR7Q 1HTLD 5ELOA 4F87A 3M3YH 1Z47A 2F0IA 3SVMA 1Q46A 1N34L 5KEEA 1SMYC 1EQVA 3F1ZA 3FPUB 1XTCD 5IT9E 4WRDA 1J6QA 4IFDI 4LFCQ 2OCEA 1S3OA 2KUMA 1FNWA 4CJ0B 5EAYA 2JA7B 3HOYB 1PFMA 2UXBL 4HJ5A 1K8OA 3VR2A 4A3JB 4X66Q 2OF1A 4IUUA 3PO3G 1UE7A 1YJNA 2EPBA 1IZ6A 3J81c 2VXWA 5C4XG 1I4QA 4O1NA 4BY7B 2KQ3A 1XPRA 1CHQD 3EROA 4BA2I 5DNFA 2Q2HA 5M5XH 5FK9C 5FOBB 1JT8A 1I6HH 2N49A 2LXJA 5CV4A 1VQ5A 1Y1VB 2EY6A 2B2WC 1PH2A 3T53B 1IW7C 4G57A 4DV6Q 3FMCA 4LFBL 4N9TA 3M7NA 1EIHA 3ULLA 3DEOA 5K36H 3HKZG 4AQYQ 3RLNA 4JI3L 1R4QB 4DNIA 2BH2A 4NXML 1VQ8A 3S1MB 2VQEQ 5EQ0A 4XQNA 3GTPB 4KKTA 4DR5Q 1CK1A 4V0BA 4NP5A 3G6JB 3MFYA 3RN2A 3ND8A 1UUPA 3L0OA 1YHAA 2N8NA 4BBSB 1WTPA 1MSGA 1JQYD 4F7XA 1VQCA 1RL2A 4Q0FA 2O4XA 2ZXOA 2LS01 4QL5A 4HN7A 3HOXH 3E6ZX 4BWGB 2G9DA 2VW9A 2NVTB 1ZEQX 4PMWA 4E6IA 1EOVA 1NJIC 2EOTA 3S1RH 3HOUG 2B63B 1VCIA 1A0IA 3QR8A 4A93H 1EWCA 3M4OB 4X3SA 5ELCA 1ET6A 4U68A 3ERSX 2IL8A 1PA6A 3GTOB 2DY8A 3HS0C 3CCMA 1OXSC 4A3IH 4JI2Q 3CPWA 1TWAB 3PIO3 4DPGA 1FR3A 3GDEA 1X3PA 3NWSA 2ZXPA 3T1YQ 3SEBA 4PMBA 4L8JA 2F4VQ 1B3QA 2HQLA 4ZRZA 3K80C 1XNRQ 2QKIC 3J80i 4LFAQ 4MNOA 1JB7A 1B44D 2ZTCA 2QEXA 5CMDA 3PO3B 4GOPA 4DKAC 1I94Q 2LMCB 1BCPD 3E0JA 3FKIG 1B1ZA 4ZUIA 3U4VA 3VYSA 3FPPA 2K75A 2K6AA 5HGQA 3UDFA 5A35A 1KXLA 4IOCA 5EPJA 5EKIA 2ZTEA 3ERQA 1L1OB 4LF8Q 2O5IC 4AYBE 1AFPA 3MA2B 1VF5C 1UAPA 4IO9A 4RWSC 1IYVA 3X3MA 1LTLA 3QB3A 2J7ZA 1QNKA 2HCIA 1Y1WH 3MTSA 4TSSA 1UE1A 3I4NH 2X6LA 1JWUD 1BF4A 1NMFA 2AKWB 3W1BA 5GAGC 1P8LA 4A3KG 3S1NH 1CUKA 4CHTB 2HT1A 1PDQA 2YTVA 1IBMQ 1ONLA 1SE4A 3T1HL 2NN6I 3VR4A 5M3FH 1N34Q 1U9RA 2WV6D 1SSOA 2FMMA 1D5XC 3D8GA 3HKSA 3LWUA 5CYUA 2OT2A 1JE5A 1DOMA 4YCVA 1J5EL 3AEVA 1CZGA 4K5VA 2JE6I 4UP9A 1F2MA 4FF1A 1SEBD 1OXTA 4EVOA 4DV1L 1YNNC 4DV4Q 2MFIA 4YIJA 1D5ZC 1ZYRC 2IPKD 1QUQA 5I9PA 1UWVA 1HHVA 5IGDA 1KLUD 4A75A 5IT9L 3DWAA 3KJOA 1ET9A 3I4MH 1GUTA 2PZUA 4ZLTF 1K8GA 1U4RA 1EQRA 2H5XA 1LTID 3VDYA 3K0YA 4PZ6A 1K9MC 2HD3A 2K5VA 4J1MA 3VA7A 1F9SA 5ISRA 3K0XA 3VA5A 3MXNA 4LK1C 4GNXB 1HCZA 4DXFA 2RHQB 1PH9A 1XX8A 3RZDH 4JI3Q 1H9MA 2O2LD 3PIPA 1ASZA 1VQNA 1LLRD 2ICIA 3CP0A 1A63A 2D62A 3DHQA 2DN8A 1D7QA 2P5ZX 1K28A 2OTLA 1OXXK 4NKLA 1D1IA 2A1AA 3L9AX 2UUAL 2KCCA 2FJ2A 1F77A 4X3UA 4HIDA 2Q2UA 3OHXC 4A3MH 1LM0A 1HQRD 1YJ9A 2CFMA 4HMJA 4TRDA 1VQMA 1EY4A 3FEWX 5COYA 2I5LX 2Y0SG 5EBDA 2L4NA 3SK6A 3T16A 4TVAB 1JR0D 5EKKA 4HIMA 2RDHA 1M4VA 4J8QA 4A93G 1MIUA 1BO0A 3KDFA 3KLRA 1VQIA 1LTRD 4OO1H 2QEJC 2E2HB 4DV3L 3H94A 5D65A 4XYQA 4AIMA 3N52A 4A3LH 1GKHA 3R2TA 3C3LA 3GTKH 1ILQA 1CSQA 2A6HD 4LF6Q 2B8FA 1R9TH 4DR3Q 4DR2L 4JW0A 2ASBA 1I4PA 3K6OA 2XTIA 3NK9A 4XQQA 1L0XB 1RTNA 2YTYA 2Y0SE 1NCVA 3PUXA 3PGZA 3NE5B 2A73B 3ZJYC 2YU9H 1Q7YC 1TWHB 1E1TA 4A3DH 1K8MA 1YBYA 2E2JH 2VB3X 1PTOC 3U9SA 2HCCA 5K5PA 3VR5A 2FXQA 4R8NA 3RN5A 2EVBA 2EYMA 5EPKA 2EXDA 5GQOA 4B08A 3CQZH 5M5XB 1PRTF 5ELNA 4ZKCB 2NB0A 1I6HB 3IFDA 2F0PA 1F2YA 4RGTA 1W6KA 5C6AA 1HTPA 1UNSA 5IGGA 4A3EG 1EIYB 1U4PA 2CVRA 1Y1WG 1E7ZA 4C1NI 2Z8LA 1I6VC 1PZID 3ULPA 1Y8PB 3OIPA 3I4NG 2WINB 5E4WC 3EIVA 1XNQL 3J81i 3KF8A 3T1HQ 1RD9D 2DNCA 1F9RA 5FJ8G 3TDQA 4IPDA 3N6RA 3G6EA 2NVXB 1V1PA 2Z9HA 4HCEA 1PYWD 4CDCC 1A6XA 3M4PA 4A3CH 3S2DH 5M5WH 1LT3D 1NAPA 5M3FG 5ELEA 2KCMA 5JAVA 1BBWA 3G7LA 3PSIA 1HR0W 5C44G 3AQQA 2H1EA 5EBCA 2RSNA 5FO8B 3BS1A 4DV1Q 3HOXB 1LTGD 1OXVA 2C35B 2OQ0A 4RHRA 3PMFA 3HOVB 2LFNA 1Y1VH 2DJGC 3HEJA 3EFXD 1BVSA 1PMRA 3P20A 1B4OA 2KECA 1I3QH 2L9HA 1PH1A 1KIXA 1GUOA 2YTXA 5J22A 3HOZH 2D5DA 4JI1L 3GTQB 2EYFA 4KJOA 1GVPA 1PH3A 2PQAB 3I4MG 1HZBA 2I5MX 1W6JA 1SJHD 3MXGA 2D0PA 5JEAH 4A3IB 2F0OA 2GVAA 1XPUA 2R7FA 3MEFA 1DCZA 4PV1C 1KTKA 2VY3A 4HCSA 1RODA 1SYCA 1TWFH 2F0HA 2RKSA 2SEBD 4GZYC 1E2ZA 3K57A 4G7HC 2TSSA 4HSPA 1H9KA 4HJAA 2HHHL 3NBHA 3TP5A 5IT9c 4A4IA 1CKMA 4QIWB 2F0MA 1IKLA 2JA8H 3EJIA 3HG9A 3DMUA 2AMCB 3P7JA 1CA5A 3J7YW 3TZDA 2CW0D 2QF7A 2RDFA 5EKLA 2K7VA 3GTOH 4K5WA 1NMGA 1TR5A 1J9OA 1K3RA 4LF7L 4LW1A 1TWAH 4DR6Q 1Y1WB 4BBRH 3I4NB 4A3MG 2K1BA 4IUNA 1XMOL 1PYSB 1AW7A 3A74A 3MC0B 1EZ8A 1WI5A 1Y14B 4IPHA 4EX5A 4DV3Q 4DNTB 1ZXTA 2MGSA 3OIQA 4ME5A 4LUZA 1JC7A 4MTKA 4IJHA 2C9OA 1B70B 4LNQA 2JEAI 3TP7A 1MD2D 4DR2Q 5IYDH 1XWEA 3BYTB 3E5SA 3UE1A 3BYYB 4IPGA 5DEHA 4F8MA 1S40A 3Q24A 3NTIA 1T9HA 1LABA 1C0AA 3NUCA 4RGMA 1BQQT 3S24A 1X56A 2KCNA 2A69C 4UAIA 1DZ1A 2H4OA 4IJLA 2CHBD 1SYGA 1IW7D 3R8BA 1AE3A 1GXDC 1RIPA 4TKOB 1EIGA 1K0SA 4DF7A 4JYAL 1QVGA 4YY3L 2F0LA 4DUYL 2CH4A 5C0XI 4DR5L 3UI2A 2AQ3B 2BE5C 3OTOL 3LX0A 1CKNB 3NTKA 5FKAC 5IODA 3RZDB 2RCFA 1XNQQ 1X65A 4P73A 1DONA 3CRLC 3ND9A 3MFGA 3KF6B 3VYRA 1EIFA 3D31A 3K81C 3SK4A 4DU9A 3UDXA 4KD3A 4FF2A 2R61A 1HR0L 2UUBL 1MJEA 1EY7A 5I2YA 3HOYG 2EJMA 5JJLA 4CJ1B 4A3JG 3LNNA 2PMZE 1RCVD 1WVLA 1EFWA 3M7GA 1TWGH 3URYA 3K58A 3IFTA 1GUSA 1GUNA 3J7AF 5IGBA 2QW7A 1GOZA 2E76C 3CU7A 3WWVA 4BY7G 3KBXA 4XT3B 1V9PA 2A74C 3M4YA 3T51B 5L37A 3UDGA 1SR3A 2JA5H 3GTLB 4DN4M 1DOLA 4JI1Q 1PRTB 1HFGA 1Y1VG 3Q22A 1HUMA 3T1YL 4G4KA 3NP8A 4B3RL 4DK6C 3HOZG 3CCEA 4FP5D 1YVCA 3GTKB 1JJ2A 3R93A 3W2DA 4WORA 1CHPD 5IE8A 1TS3A 3NENA 5JEAG 2XWJB 5ELFA 1R9TB 2F3IA 4UPAA 1PLFA 3RD4A 3A56A 1JICA 4QB4A 1SDFA 2M9VA 1HNWL 1N32L 4JK1C 3D4DA 2B2VA 3C1FA 4CKCA 2YU9B 2I07B 4PG3A 1Y69U 3H3VI 2A19A 3OSOA 4A3DB 3PIOA 2R92B 2E2JB 5M3MB 1CKOA 2B63G 5KNBA 3NEMA 3A7LA 5DLQE 1YHBA 5CORA
chains in the Genus database with same CATH topology
3CQZB 1PXUA 2QILA 1STEA 2F0UA 2MHVA 2K5WA 2PZTA 2EYOA 1TS2A 2AWNA 4L6TB 1EOTA 4OIKA 1U4MA 1C4QA 5CC4A 4ZK9B 3BDCA 2XSCA 3QO2A 3NSWA 4FYDA 1HRJA 2K01A 1G6ZA 1EY0A 2MPMA 1KLGD 3S2DB 5M5WB 5G3LF 1G291 1RDPD 3I72A 2ID0A 4K14A 4OHJA 5CV7A 1ENCA 3NHHA 2F0QA 3J80E 5CBAE 2R93B 4IUVA 3KLSX 1JORA 1E2VA 4FVMA 4ULLA 2B2YC 2EJFC 5D3DA 2OXPA 4V190 1I3QB 3BZDB 2B39A 3HOZB 3OW7A 1HXYD 1S5ED 2TMPA 5CV8A 4XT1B 1Q1EA 1U4LA 1CQFA 1EU3A 1ENAA 4XYOA 1WTQA 1JOOA 1GJXA 1EY8A 1LTAD 1JCKB 1TWFB 1TVXA 1Q1BA 4RKBA 3NPPA 2HQEA 3QJYA 3I73A 5CV5A 3WOFA 3NQIA 4K8IA 3QOJA 2ENBA 1ESRA 3TSSA 2JA8B 4IUPA 1STHA 3GP7A 3SDZA 5KGUA 1F9QA 1B50A 2G9HD 2F0NA 1EWHA 1H9SA 3TZUA 4BBRB 3O13A 3NXWA 2IT1A 3VYUA 3MAQA 2JYOA 3OMCA 3P1HA 4U673 3H3VC 2F0FA 4RH6A 4IALA 3A55A 1B9NA 3BVZA 1FD7D 1OXUA 4KTAA 3AU7A 1KNEA 1EU4A 1PTOD 4ID6A 2E74C 1SNPA 2D2CC 1O7ZA 4CBVA 1TT2A 2AWOA 1A3TA 1TU2B 2EY5A 3JAME 3MWYW 2B2TA 1SNMA 3GQBA 2WIIB 1BCPB 3RUZA 2DY7A 3D6CA 4KK7A 2EXZA 5KNDA 4K8JA 2WAQB 4XIGS 4DXGA 3SK8A 3D3RA 2PNRC 1EYAA 1X3QA 2K32A 5C3WA 2RBMA 1Z6HA 2A6EC 2F0TA 2KEDA 3BVMA 1TWGB 2F0KA 1EY5A 3V96A 3A8JE 2JA6B 2R3ZA 2BOSA 5EGTA 2VNUD 1H9RA 2JA5B 5I9OA 3BDLA 4H7BA 5JOBA 5CR3A 3J80L 4AYBB 5C3XA 5K36G 2K05A 2KJXA 1STAA 1S4ZA 3SK5A 4KKUA 3SXHA 4KV6A 1WTOA 2PO4A 1FGBD 4HEDA 1JE4A 2M00A 4K6DA 1LACA 3J81E 5I4DA 4DAPA 5T1IA 4PMCA 2K5DA 2E2DC 2EDGA 4PNYA 2L0CA 2YYZA 1ILPA 1IHZA 5DAUA 1G2SA 2B2VC 4OGQC 3HP3A 4FXGC 3BDOA 1Y8OB 1VDZA 1WD1A 2IJ0A 5BN5A 4BY1B 1RHPA 3TBIB 1ESFA 4X3KA 1SE2A 1LT6D 5CV6A 1EZ6A 1LTBD 1XYIA 1AP0A 4K2LA 3CKIB 3I8ZA 1LTSD 2NVYB 4DAVA 1B2TA 1EFID 4F88A 5M5YB 2WKDA 4IUTA 4A3BB 3HOWB 5FLXE 3KK7A 1OO9B 1X32A 3SE0A 2B2YA 2F4IA 3GTJB 1I4GA 4C3JB 2LY7A 4FF4A 2VB2X 2NTSA 4HSVA 3TP8A 5IGEA 2BCOA 4IFDH 2VUMB 5LL6X 2SNSA 1J8IA 2F0WA 2PZWA 2KHSA 4B9XA 5DM73 1Q90A 2M2LA 3MEHA 1AEXA 2NZ1D 4C1NK 1QNUA 2K33A 3RZOB 2QDBA 3H0GB 1LT5D 1HUNA 3TN2A 3K5OA 5D14A 5AFWA 1I4HA 5M9OA 2I46A 4KN7C 5I2XA 3C46A 3T4AC 1FYCA 2JXMB 5CORA 2Z4IA 3KLSA 2B2UA 1VMCA 4QUCA 5C0XJ 5A2QE 3BG3A 4C3HB 4X3TA 2K04A 3HZXA 4ZQ3A 1YNJC 1HQMC 3NQTA 2F03A 1Q8IA 5KIXA 1SAPA 1MI2A 2QCPX 1KDAA 2J4XA 4FF3A 3GTGB 1D2BA 2NBFA 2F0DA 2XIWA 2GA4B 2K03A 1JWMD 4LMQD 1SMYD 2XRSD 3FDTA 3Q23A 3J81L 1T5EA 4OO1G 1WCMB 4C3IB 2PW7A 2K5QA 1NR2A 2KEEA 2RSOA 3A7AB 1STBA 1MSHA 3A8KE 5IIFA 1SYFA 2B2TC 5JJZA 5J39A 3R3OA 1DYQA 1CI3M 4KKSA 1WTWA 2RVLA 3OPOA 2MP1A 5C4HA 4A3FB 2WB1B 1HPCA 2AQ1B 3I3CA 4QUFA 1KAAA 5C3EB 4L63B 1RKNA 1PTOH 2NN6H 3CRKC 4H44C 5C4JB 1KNAA 3S9WA 2OEOA 4WJWA 1O78A 1ENFA 3K5MA 3K5LA 2MUYA 5KNCA 1JB3A 5FLXL 4IFDJ 4EQOA 3HRZC 2L12A 1EYDA 1BR9A 2NWGA 1WD0A 1V1PB 4DGZA 2V4DA 2IWHA 3TP6A 2D9UA 4LAAA 1BCPF 3MHBA 5NUCA 3T56B 1RF2D 4ABNA 1EQTA 1Z7TA 2F0SA 2XNAC 1S5DD 4Q5VA 3S17B 5IOCA 2PPBC 4OO1I 3GV6A 4ZUJA 4FXDA 1QCBD 2Q8IB 1Q3LA 1B9MA 3PUWA 3T13A 1A3VA 2EY2A 4KD4A 1IYUA 5C4ZA 2HUGA 2L5TA 3H91A 3V05A 5A2QL 1AZPA 4M1UB 1SNQA 3K7AB 3F2UA 1S5CD 3EVQA 3L7ZC 2L11A 3D6WA 4R9WA 4RCNA 1KDCA 4BS9A 2BDOA 3C1EA 1PFNA 1TIID 3DXJC 1YNND 1ZYRD 3VR3A 1BNZA 1QE6A 2WKCA 2RQXA 1NSNS 1ICWA 3GD7A 4KHZA 4Z9CB 1LO5D 2A6ED 5TSSA 5JPNC 4QF4A 3V2TA 5HGTA 2F0EA 2MJ8A 4RAUC 5C5LA 2BA1A 4UDUC 3L3OC 4O42A 1GHJA 1VF7A 1G91A 4XXEA 1EEID 1WTXA 4IN3A 1EEFD 2NN6G 1QILA 1SNDA 2SNMA 1BDOA 1RJTA 5KRUA 4RGNA 2F1MA 2PCFB 4R8IA 3W3AA 3P75A 1TWCB 2BA0A 1HFNA 1HA5A 1PRTC 4XTCS 1TS4A 2KVMA 4ODGA 4H13C 4KJNA 1CTMA 2A68C 4RHSA 2B2UC 2RA4A 2R6GA 2FFKB 4BA1I 4S3SA 3IAYA 1TY0A 2X6GA 2NUCA 1O7LA 4K6LA 2ZXRA 3S14B 3DUZA 5I6WA 5HURA 1HA6A 1SJED 1C8CA 1SBBB 4TQUS 3EQLC 5C4XB 1IKMA 4NMZA 1K83B 2B8GA 2NTTA 3VR6A 1NUCA 3D4WA 4EGVA 2Q8RE 5BN3A 4HMIA 1CZWA 1M8AA 4J6HA 1BXTA 1BUVT 1SFOB 1EL0A 4WFN3 3S2HB 1G2TA 1XXGA 3HKZB 5EJWA 5ELBA 3Q0AA 3GV3A 1PTOB 3S16B 2KA7A 2L55A 2R7ZB 5ELDA 3GTMB 2JSOA 1PZKD 4MHEA 1A15A 1DM0B 2FMCA 4MN3A 4B9WA 1AN8A 1QJOA 4NDXA 5BN4A 4K2KA 3H09A 3HOUB 1QB5D 3HGBA 1TKWB 5LL6S 2Z1CA 2N88A 3VYTA 1T5XD 3K59A 2F3WA 1FNVA 5C0XH 3K5NA 3J7AV 4K5XA 4H0LC 5FO9B 4C3JG 2LKVA 5G3LD 4KY7A 1GUGA 1YNJD 2FINB 4KY5A 1D6EC 3NWTA 4RFBA 4XDXA 3QOLA 2EE1A 3FKIB 5E4XA 1IL8A 1S5FD 5EPLA 3A8IE 2IX1A 1R4PB 3GO5A 2EYPA 4FXKC 4ZAIA 4OL7A 2HDMA 3Q6SA 1CFMA 2F0JA 3SR1A 1KABA 4PQXA 1QG7A 3MXUA 1PZJD 2EZVA 2Q8TA 1PFBA 4A3KB 4ILWA 2A5HA 2NYZD 1TS5A 2FHTA 4IURA 1H9SB 2NVQB 4RA8A 1MGSA 1E0BA 1A3UA 1D5MC 3M3YB 4C3HG 2A69D 3WDNA 4EQPA 1G8ZD 5CGKA 4MIUA 1AZQA 1VMPA 4N9PA 5LHY1 2AQ2B 1H9JA 3ITPA 2Z4HA 4OIJA 4DK1A 2K28A 1BCPC 2HDLA 3MZ5A 4G7ZC 2BE5D 2F0GA 4LJZC 1STGA 4JBWA 3C2PA 4DFAA 3I91A 3DEPA 3NTHA 2JEBI 1I50B 1STYA 2KOLA 4I65A 3JAML 2O5JC 1TY2A 1NR4A 3CHBD 4C3IG 5CV9A 5JVH3 2B2WA 3ONAB 3S1QB 1DD2A 1I4RA 4M8AA 2DNEA 4KI0A 2N55A 1BOSA 2ICEC 4ZYSA 1V1OA 5C5MA 3LWEA 3PIP3 3KBGA 3IL8A 1LT4D 1EY6A 2Y0SB 3S1RB 1UEAB 5CBEE 4A93B 3TMEA 5JPMC 4DNRB 4Y7NB 2CQAA 1JWSD 1Y8NB 2SOBA 4KMUC 3WOEA 4QCLA 5C0XG 2ZT9C 2E2IB 2XVSA 1A2UA 4I7ZC 4P2CB 3ZYYX 2J0TD 4XQJA 3X3NA 3NBIA 3OOCA 2C5CA 4CKBA 2EYLA 3DM1A 4ZKBB 1LTTD 2AUKA 5D3IB 1KDBA 3KUPA 3OWFA 3S15B 1V43A 3PUYA 1RTOA 1STNA 3PV0A 3OMGA 1TQOA 3PUZA 2EYHA 2BDNA 1Q12A 1DOKA 3AB9A 2JP1A 1F2ZA 2SDFA 2XWBB 4A3EB 1SE3A 1BBXC 2L1BA 1S5BD 1EY9A 1F9PA 5JVG3 3S1NB 1C48A 4IZ8A 3I4LA 1JOQA 2A6HC 1I4XA 5IGCA 5M3FB 4NW2A 2AUJD 2XN9C 5C44B 4HR7B 1SYEA 4KN4C 2IX0A 1GHKA 1EYCA 1QWYA 3H6MA 1B53A 1WTVA 1SXTA 2IX3A 4IQZA 3MVVA 4A3GB 3I4MB 1L0YB 2PYKA 2RDGA 1ML0D 4DK0A 1B3AA 2F3VA 1V8QA 3DWPA 4EQNA 3AMUA 3QWNA 2E75C 4C56C 1D1KA 2X69A 3SHLA 3DWQA 4IFDG 4CKEA 4HAEA 4HTHA 1PRTD 3M85A 3PO2B 4G7OC 2PW5A 1WTRA 5DM63 1SYDA 2A68D 1DXMA 4FO2A 3BVGA 1DJRD 1SNOA 4RCOA 1ZKOA 1QOHA 1PTOF 1CA6A 1II3A 2EJGC 4RGOS 1A2TA 2WACA 4CGYB 1F2LA 5IGFA 4A3MB 4KHVA 1CM9A 5T1GA 4DA2A 1LV9A 4IUQA 3PUVA 5I6YA 2F0VA 2IW3A 5E3FA 1CT1D 4FNFA 3U9OA 4KY6A 2EY1A 3FVQA 3EA6A 3R2IA 3D4RA 3IKJA 5FO7B 3FRPB 1SNCA 5JEAJ 1E2WA 1CQVA 3QIAA 5F2DA 3OWEB 2EYJA 5KYIA 1JOKA 3A54A 1SYBA 3MXPA 2PQEA 5E1FA 1MBYA 1O80A 1O7YA 1GUWA 3I90A 3RLFA 3QG1A 4RKLA 2WP8J 4QMGA 2CW0C 3RMHA 4DAYA 5KYLA 2PMZB 1FNUA 4CJ2C 2XRQD 4C2MB 3I70A 1HTLD 4F87A 1Z47A 2F0IA 3SVMA 5KEEA 1SMYC 1EQVA 3FPUB 1XTCD 5IT9E 4WRDA 4IFDI 2KUMA 1FNWA 4CJ0B 2JA7B 3HOYB 1PFMA 1K8OA 3VR2A 4A3JB 2OF1A 4IUUA 2EPBA 2VXWA 1I4QA 4O1NA 4BY7B 2KQ3A 1CHQD 3EROA 4BA2I 5DNFA 5FK9C 5FOBB 5CV4A 1Y1VB 2EY6A 2B2WC 3T53B 1IW7C 4G57A 3FMCA 4N9TA 3M7NA 1EIHA 3DEOA 5K36H 1R4QB 3S1MB 5EQ0A 4XQNA 3GTPB 4KKTA 1CK1A 4V0BA 4NP5A 3G6JB 3MFYA 3ND8A 1UUPA 4BBSB 1WTPA 1MSGA 1JQYD 4F7XA 4Q0FA 2O4XA 2ZXOA 2LS01 4HN7A 3E6ZX 4BWGB 2G9DA 2NVTB 1ZEQX 4PMWA 4E6IA 2EOTA 2B63B 1VCIA 1EWCA 3M4OB 4X3SA 5ELCA 1ET6A 4U68A 2IL8A 3GTOB 2DY8A 3HS0C 1OXSC 1TWAB 3PIO3 1FR3A 1X3PA 3NWSA 2ZXPA 3SEBA 4PMBA 4L8JA 4ZRZA 2QKIC 1B44D 5CMDA 3PO3B 2LMCB 1BCPD 3E0JA 1B1ZA 4ZUIA 3VYSA 3FPPA 2K6AA 5A35A 5EPJA 5EKIA 3ERQA 2O5IC 1AFPA 3MA2B 1VF5C 1UAPA 4RWSC 1IYVA 3X3MA 3QB3A 2J7ZA 1QNKA 2HCIA 3MTSA 4TSSA 2X6LA 1JWUD 1BF4A 4CHTB 1PDQA 1ONLA 1SE4A 2NN6I 3VR4A 1U9RA 2WV6D 1SSOA 2FMMA 1D5XC 3D8GA 3LWUA 5CYUA 2OT2A 1DOMA 1CZGA 4K5VA 2JE6I 1F2MA 4FF1A 1SEBD 1OXTA 4EVOA 1YNNC 4YIJA 1D5ZC 1ZYRC 2IPKD 5I9PA 1HHVA 5IGDA 1KLUD 5IT9L 3DWAA 1ET9A 1GUTA 2PZUA 4ZLTF 1U4RA 1LTID 3K0YA 4J1MA 3VA7A 1F9SA 5ISRA 3VA5A 3MXNA 4LK1C 1HCZA 4DXFA 1XX8A 1H9MA 2O2LD 1LLRD 2ICIA 2D62A 3DHQA 2DN8A 1OXXK 4NKLA 1D1IA 3L9AX 2KCCA 2FJ2A 1F77A 4X3UA 3OHXC 1HQRD 4HMJA 4TRDA 1EY4A 3FEWX 5EBDA 5COYA 3SK6A 2L4NA 3T16A 1JR0D 5EKKA 2RDHA 1M4VA 4J8QA 1BO0A 3KLRA 1LTRD 4OO1H 2QEJC 2E2HB 3H94A 5D65A 4XYQA 3N52A 3R2TA 3C3LA 1ILQA 2A6HD 2B8FA 1I4PA 3K6OA 3NK9A 4XQQA 1L0XB 1RTNA 1NCVA 3PUXA 3NE5B 2A73B 1TWHB 1K8MA 2VB3X 1PTOC 3U9SA 2HCCA 5K5PA 3VR5A 4R8NA 2EVBA 2EYMA 5EPKA 4B08A 5M5XB 1PRTF 4ZKCB 2NB0A 1I6HB 3IFDA 2F0PA 1F2YA 4RGTA 1W6KA 5C6AA 1HTPA 1UNSA 5IGGA 1U4PA 2CVRA 4C1NI 2Z8LA 1I6VC 1PZID 1Y8PB 3OIPA 2WINB 5E4WC 3KF8A 1RD9D 2DNCA 1F9RA 3TDQA 3N6RA 2NVXB 1V1PA 4HCEA 1PYWD 1A6XA 1LT3D 1NAPA 5ELEA 5JAVA 3G7LA 2H1EA 5EBCA 2RSNA 5FO8B 3BS1A 3HOXB 1LTGD 1OXVA 4RHRA 3PMFA 3HOVB 2LFNA 3HEJA 3EFXD 1PMRA 3P20A 1B4OA 2KECA 2L9HA 1GUOA 5J22A 2D5DA 3GTQB 2EYFA 4KJOA 1W6JA 1SJHD 3MXGA 5JEAH 4A3IB 2F0OA 1DCZA 4PV1C 1KTKA 4HCSA 1RODA 1SYCA 2F0HA 2RKSA 2SEBD 4GZYC 1E2ZA 3K57A 4G7HC 2TSSA 4HSPA 1H9KA 3NBHA 3TP5A 4QIWB 2F0MA 1IKLA 3EJIA 3HG9A 3DMUA 3P7JA 1CA5A 3J7YW 3TZDA 2CW0D 2QF7A 2RDFA 5EKLA 2K7VA 4K5WA 1TR5A 1J9OA 1Y1WB 3I4NB 2K1BA 4IUNA 1AW7A 3MC0B 1EZ8A 4DNTB 1ZXTA 2MGSA 3OIQA 4ME5A 1JC7A 2C9OA 2JEAI 3TP7A 1MD2D 1XWEA 3BYTB 3E5SA 3BYYB 5DEHA 4F8MA 3Q24A 3NTIA 1LABA 3NUCA 4RGMA 1BQQT 2KCNA 2A69C 4UAIA 1DZ1A 2H4OA 2CHBD 1SYGA 1IW7D 3R8BA 1GXDC 4TKOB 1EIGA 4DF7A 2F0LA 5C0XI 3UI2A 2AQ3B 2BE5C 3LX0A 3NTKA 5FKAC 5IODA 3RZDB 1DONA 3CRLC 3ND9A 3MFGA 3VYRA 3D31A 3SK4A 4DU9A 4KD3A 4FF2A 2R61A 1EY7A 5I2YA 2EJMA 4CJ1B 3LNNA 1RCVD 1WVLA 3M7GA 3URYA 3K58A 3IFTA 1GUSA 1GUNA 3J7AF 5IGBA 1GOZA 2E76C 3CU7A 3KBXA 4XT3B 2A74C 3M4YA 3T51B 3GTLB 4DN4M 1DOLA 1PRTB 1HFGA 3Q22A 1HUMA 4G4KA 3NP8A 4FP5D 3GTKB 3R93A 3W2DA 4WORA 1CHPD 1TS3A 5JEAG 2XWJB 5ELFA 1R9TB 1PLFA 3RD4A 3A56A 1JICA 4QB4A 1SDFA 2M9VA 4JK1C 3D4DA 2B2VA 3C1FA 4CKCA 2YU9B 2I07B 1Y69U 3OSOA 4A3DB 2R92B 2E2JB 5M3MB 5KNBA 3A7LA 5J1ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M1U B;  1DM0 B;  1QNU A;  1BOS A;  1CZW A;  1R4Q B;  1CQF A;  1C4Q A;  2GA4 B;  1QOH A;  1CZG A;  1D1K A;  1C48 A;  1R4P B;  2XSC A;  3MXG A;  4ULL A;  1D1I A;  4P2C B;  2BOS A;  2C5C A; 
#chains in the Genus database with same CATH topology
 4X65 L;  3CQZ B;  1PXU A;  4YCU A;  2QIL A;  4JBK A;  4X6A H;  1SN8 A;  4LF7 Q;  4HJ8 A;  1STE A;  2F0U A;  1IBM L;  2MHV A;  2K5W A;  2PZT A;  1PYB A;  2EYO A;  1TS2 A;  2AWN A;  4L6T B;  4NXN L;  1EOT A;  4OIK A;  1U4M A;  1XMO Q;  1C4Q A;  5CC4 A;  4GKJ Q;  2EQS A;  4ZK9 B;  3BDC A;  1DGS A;  2JN4 A;  2XSC A;  4WJ3 M;  1C7Y A;  3QO2 A;  3NSW A;  4FYD A;  1HRJ A;  2UU9 L;  2CH4 W;  2K01 A;  1G6Z A;  2KHJ A;  4DV4 L;  1EY0 A;  4CDE C;  4CDD C;  1SLJ A;  2MPM A;  1TWH H;  1WTH A;  1KLG D;  3S2D B;  5M5W B;  5G3L F;  3TQY A;  1G29 1;  1RDP D;  3I72 A;  3I2Z A;  2ID0 A;  4K14 A;  4OHJ A;  5CV7 A;  3G71 A;  1ENC A;  2NVY H;  3NHH A;  4YWL A;  3TRE A;  2F0Q A;  3J80 E;  5CBA E;  3U50 C;  1QZH A;  4IUV A;  2R93 B;  3KLS X;  4OWX B;  4OXP A;  1E2V A;  2KBN A;  4FVM A;  1KRT A;  5M5Y H;  1JOR A;  4ULL A;  2B2Y C;  2EJF C;  5D3D A;  2OXP A;  4V19 0;  5J1Z A;  3HOW H;  1I3Q B;  3E0E A;  3BZD B;  2B39 A;  4JCV E;  3OW7 A;  1HXY D;  3HOZ B;  1S5E D;  2TMP A;  3GTJ H;  1VQF A;  5CV8 A;  5H1S E;  1VQ9 A;  4XT1 B;  1Q1E A;  1U4L A;  1CQF A;  1EU3 A;  4C3J H;  4JYA Q;  1ENA A;  4YY3 Q;  4DUY Q;  4DUZ L;  4JI6 L;  2VS1 A;  2NVX H;  4XYO A;  3OTO Q;  1JOO A;  1WTQ A;  2VUM H;  2HIX A;  1B7Y B;  1GJX A;  1EY8 A;  1LTA D;  2L15 A;  1JCK B;  1TWF B;  1TVX A;  1Q1B A;  4RKB A;  3NPP A;  4OEM B;  3FP9 A;  2HQE A;  3OYY A;  2WAQ G;  1U0L A;  3QJY A;  3I73 A;  5CV5 A;  3WOF A;  1HR0 Q;  3HOV H;  3NQI A;  2UUB Q;  4K8I A;  3HKZ E;  3QOJ A;  2ENB A;  1ESR A;  3TSS A;  2VQF L;  2JA8 B;  4IUP A;  1STH A;  2KHI A;  3GP7 A;  3RZO H;  3H0G H;  1L0W A;  3RR5 A;  3SDZ A;  5KGU A;  3GTQ H;  1F9Q A;  1B50 A;  2QA4 A;  2G9H D;  2F0N A;  1EWH A;  1H9S A;  4WJ4 A;  3TZU A;  4BBR B;  3O13 A;  3NXW A;  2IT1 A;  3VYU A;  3MAQ A;  5IWA L;  4GLX A;  2JYO A;  4LF6 L;  3OMC A;  3P1H A;  5AJ3 L;  2EIF A;  4U67 3;  1X6O A;  3I56 A;  4DR3 L;  4B3R Q;  2JA5 G;  3H3V C;  2F0F A;  4RH6 A;  3KLW A;  3A55 A;  4IAL A;  1N9W A;  1B9N A;  3BVZ A;  1FD7 D;  1OXU A;  4KTA A;  3AU7 A;  1KNE A;  4L5T A;  2ZM6 L;  1MJC A;  1X9N A;  1EU4 A;  1PTO D;  1HNW Q;  1N32 Q;  4UP7 A;  4ID6 A;  4OEL B;  1EUJ A;  2E74 C;  1SNP A;  2D2C C;  1O7Z A;  4CBV A;  1FL0 A;  3M4Q A;  4K0K Q;  3GTG H;  1TT2 A;  2AWO A;  1PH8 A;  3NEL A;  1A3T A;  1TU2 B;  2EY5 A;  3JAM E;  1K73 C;  2RCN A;  3MWY W;  2B2T A;  4X65 Q;  1SNM A;  3GQB A;  2WII B;  4IOA A;  4JPB W;  1BCP B;  4DV7 Q;  3RUZ A;  4R4Q A;  2DY7 A;  3D6C A;  4PZ7 A;  4R4C A;  4NXN Q;  1WCM H;  4KK7 A;  4C3I H;  2EXZ A;  1IBL L;  2K52 A;  4I7A A;  5KND A;  4K8J A;  2WAQ B;  4XIG S;  2UU9 Q;  4DXG A;  3B6Y A;  3SK8 A;  3D3R A;  2PNR C;  1EYA A;  1X3Q A;  2K32 A;  5C3W A;  2CWA A;  1E22 A;  1M1K C;  5IYC H;  1HZA A;  2RBM A;  2HIV A;  1Z6H A;  2A6E C;  2F0T A;  2KED A;  1KAW A;  2MQH A;  3BVM A;  1UE5 A;  2MO1 A;  1TWG B;  2Z0S A;  2F0K A;  1EY5 A;  4A3F H;  3V96 A;  3A8J E;  2JA6 B;  2R3Z A;  2BOS A;  5EGT A;  4OWT B;  1HNX L;  5C3E H;  2VNU D;  1H9R A;  2JA5 B;  1PH5 A;  4H02 A;  5I9O A;  3BDL A;  1X55 A;  4H7B A;  5JOB A;  5CR3 A;  3J80 L;  3HOW G;  5C4J H;  4AYB B;  5C3X A;  2PI2 E;  3KFU A;  1IYJ B;  5K36 G;  4DUZ Q;  2K05 A;  4JI6 Q;  2KJX A;  1STA A;  1S4Z A;  3SK5 A;  1Q81 C;  4JI7 Q;  4KKU A;  3JAM i;  4FDB A;  3SXH A;  3EN2 A;  3J7Z C;  4DV5 Q;  3CCL A;  3TEH B;  4KV6 A;  1WTO A;  2PO4 A;  1FGB D;  3M9B A;  1VQJ A;  2B3G A;  1IBK Q;  4HED A;  2PNH A;  1JE4 A;  2M00 A;  4K6D A;  1LAC A;  4UHV A;  3J81 E;  5I4D A;  4DAP A;  3HOX G;  2VQF Q;  5T1I A;  1VQP A;  4PMC A;  4DR6 L;  2K5D A;  3GTL H;  2E2D C;  2EDG A;  4PNY A;  3HOV G;  2K5H A;  1C9O A;  1WOC A;  2L0C A;  4GN5 A;  2YYZ A;  4OWW B;  1ILP A;  1JJC B;  4O2D A;  4JBJ A;  1PV4 A;  1IHZ A;  5DAU A;  5IYB H;  3S17 H;  1G2S A;  4NB3 A;  2XGT A;  2B2V C;  5IWA Q;  4A3I G;  4OGQ C;  3HP3 A;  5AJ3 Q;  4FXG C;  5LMN W;  3BDO A;  1L1O C;  1Y8O B;  1VDZ A;  1WD1 A;  2IJ0 A;  5BN5 A;  2R7D A;  4BY1 B;  3KOJ A;  1LT6 D;  1ESF A;  1RHP A;  1SE2 A;  4X3K A;  5CV6 A;  3TBI B;  1EZ6 A;  1LTB D;  2ZM6 Q;  1XYI A;  1AP0 A;  2QDL A;  4K2L A;  2R92 H;  5M3M H;  3CKI B;  3I8Z A;  4GOP B;  1LTS D;  2NVY B;  4DAV A;  1B2T A;  3K7A H;  1EFI D;  3ER0 A;  1YNX A;  2RF4 A;  4F88 A;  5M5Y B;  2WKD A;  4IUT A;  4B3S L;  4A3B B;  2E5L Q;  3L2P A;  3HOW B;  5FLX E;  1VQG A;  3KK7 A;  1OO9 B;  1X32 A;  1MHW C;  3SE0 A;  2B2Y A;  2F4I A;  3GTJ B;  3ICE A;  3BZC A;  4DK3 C;  1CKN A;  1I4G A;  4C3J B;  2LY7 A;  4FF4 A;  2VB2 X;  2NTS A;  4HSV A;  4DAM A;  1IBL Q;  3TP8 A;  4ALP A;  5IGE A;  2V1C C;  2BCO A;  4QIW E;  4DR4 L;  4IFD H;  2VUM B;  2K50 A;  3KF6 A;  5LL6 X;  2SNS A;  2IHF A;  4JI8 L;  1WCM G;  2DJF C;  1J8I A;  4ZCK A;  2F0W A;  2PZW A;  2KHS A;  2R93 H;  4B9X A;  5DM7 3;  1Q90 A;  2M2L A;  3MEH A;  1AEX A;  2NZ1 D;  4C1N K;  3BJU A;  1QNU A;  2K33 A;  3RZO B;  2QDB A;  3H0G B;  4GNX C;  1LT5 D;  1HUN A;  3CC2 A;  3TN2 A;  3K5O A;  5IYC G;  5D14 A;  5AFW A;  2UXD L;  1I4H A;  4AH6 A;  5M9O A;  4A76 A;  4R4I A;  3AFP A;  2I46 A;  4KN7 C;  5I2X A;  4YWM A;  3U4Z A;  1HNX Q;  3C46 A;  3T4A C;  1FYC A;  4QQB X;  4DV2 L;  2JXM B;  2KCT A;  3ULJ A;  1YJW A;  2Z4I A;  3KLS A;  4POF A;  2B2U A;  1VMC A;  4QUC A;  5C0X J;  5A2Q E;  3BG3 A;  4C3H B;  3K8A A;  4X3T A;  2K04 A;  1W2B A;  3HZX A;  4ZQ3 A;  4KLK A;  1XMQ Q;  1YNJ C;  1HQM C;  3NQT A;  1JMC A;  4YHH L;  2F03 A;  1TWC H;  2Z6K A;  1Q8I A;  5IP9 H;  5KIX A;  1SAP A;  1MI2 A;  3FHW A;  2QCP X;  1KDA A;  2J4X A;  3SGI A;  4FF3 A;  3GTG B;  1D2B A;  2NBF A;  2F0D A;  2XIW A;  3J80 c;  1PH7 A;  2GA4 B;  2K03 A;  1JWM D;  4LMQ D;  1SMY D;  4GKJ L;  2XRS D;  3FDT A;  4LF4 Q;  4O0A A;  1OTC A;  3Q23 A;  4OX9 L;  1U5K A;  3J81 L;  1T5E A;  4OO1 G;  1WCM B;  1X3E A;  4C3I B;  2PW7 A;  1UEB A;  5LMN L;  3S14 H;  2K5Q A;  4A3L G;  1NR2 A;  1GD7 A;  2KEE A;  2Q2T A;  4HJ7 A;  2RSO A;  5GRO A;  3A7A B;  1STB A;  1MSH A;  3A8K E;  5IIF A;  4N8F A;  1SYF A;  2B2T C;  5JJZ A;  2OQK A;  5C4X H;  5J39 A;  3R3O A;  1DYQ A;  1Q82 C;  1K83 H;  1CI3 M;  1YEZ A;  1JJG A;  4A3D G;  4KKS A;  2R92 G;  5M3M G;  3CMA A;  1WTW A;  2A8V A;  1ICF B;  2RVL A;  3OPO A;  2MP1 A;  5C4H A;  4A3F B;  2WB1 B;  1HPC A;  2AQ1 B;  4B3S Q;  3I3C A;  1VS0 A;  1KAA A;  5HY6 A;  4QUF A;  1SFO H;  5C3E B;  1EQQ A;  3S2H H;  4L63 B;  2JJQ A;  1RKN A;  1PTO H;  1XPO A;  2NN6 H;  5LMU Q;  3CRK C;  3S16 H;  4H44 C;  3U58 A;  5C4J B;  2GN5 A;  1KNA A;  1SMX A;  1SRU A;  3CF5 A;  2R7Z H;  3S9W A;  5IP7 H;  2OEO A;  4LWC A;  4WJW A;  1O78 A;  3GTM H;  1ENF A;  3K5M A;  4P74 A;  2MUY A;  3K5L A;  5KNC A;  4DR4 Q;  1JB3 A;  4P71 A;  2CWP A;  5FLX L;  1BKB A;  4IFD J;  4POG A;  4JI8 Q;  4EQO A;  3HRZ C;  2L12 A;  2K4K A;  1EYD A;  1BR9 A;  1PHJ A;  2NWG A;  4A3C G;  4DV0 Q;  5FLM H;  1WD0 A;  1V1P B;  4CDF C;  2ATW A;  3HOU H;  3RLO A;  4DGZ A;  2V4D A;  3A5Z B;  2IWH A;  1FVI A;  2JA6 H;  3TP6 A;  2D9U A;  4LAA A;  3CC7 A;  4RG1 A;  1BCP F;  2R93 G;  3MHB A;  5NUC A;  2ZTD A;  3T56 B;  4GLV B;  1RF2 D;  2ZJQ A;  4JI0 Q;  1L2F A;  4ABN A;  1EQT A;  1Z7T A;  2UXD Q;  4QGU A;  2F0S A;  2XNA C;  1S5D D;  4DV2 Q;  4Q5V A;  3S17 B;  5IOC A;  3KYH C;  2KEN A;  2PPB C;  4OO1 I;  3GV6 A;  4ZUJ A;  4FXD A;  1EYG A;  4JVZ A;  1QCB D;  4YWK A;  2Q8I B;  1Q3L A;  1B9M A;  3PUW A;  1D8L A;  3D0F A;  3T13 A;  1A3V A;  2EY2 A;  4KD4 A;  4JI4 L;  1IYU A;  1L1O A;  3W5O A;  5C4Z A;  4YHH Q;  4K0K L;  2HUG A;  2L5T A;  3H91 A;  3V05 A;  3CCQ A;  2JA8 G;  5A2Q L;  1AZP A;  4B3T Q;  1VQE A;  4M1U B;  1SNQ A;  3K7A B;  4R4O A;  3F2U A;  1S5C D;  3EVQ A;  5IP9 G;  4JV5 Q;  3BZK A;  1KRS A;  4DV7 L;  3L7Z C;  2L11 A;  3D6W A;  4R9W A;  1QVC A;  4A3K H;  2UXC Q;  4RCN A;  4BBR G;  4LF9 L;  4OX9 Q;  2JK8 A;  1KDC A;  4BS9 A;  4X62 L;  2BDO A;  2F52 A;  4BXX H;  3C1E A;  1YIT A;  1PFN A;  1K0R A;  1TII D;  2IY5 B;  3DXJ C;  1LUZ A;  1YNN D;  4BY1 H;  5LMN Q;  1ZYR D;  1X3G A;  3VR3 A;  1QE6 A;  1BNZ A;  2WKC A;  3I7F A;  2RQX A;  3E9I A;  1NSN S;  1GM5 A;  1ICW A;  3GD7 A;  4KHZ A;  4NPS A;  5IY0 A;  4Z9C B;  1LO5 D;  2A6E D;  5IYD G;  2LXK A;  5TSS A;  5JPN C;  4QF4 A;  3V2T A;  5HGT A;  3CCV A;  2F0E A;  4A3B H;  2MNA A;  2MJ8 A;  4RAU C;  5C5L A;  2BA1 A;  1N33 L;  1G6P A;  4UDU C;  3L3O C;  4GNX A;  4O42 A;  1VQO A;  1K8A C;  1I50 H;  2QGQ A;  1KC8 C;  3EBE A;  4JOI A;  1GHJ A;  4J15 A;  1VF7 A;  4JI7 L;  1G91 A;  1NBW A;  4XXE A;  4DV5 L;  1EEI D;  1WTX A;  1EEF D;  1V1Q A;  4IN3 A;  2NN6 G;  1QIL A;  1SND A;  1IBK L;  3S1Q H;  5JJI A;  1VQL A;  1WFQ A;  1BDO A;  2SNM A;  1RJT A;  5KRU A;  4RGN A;  2F1M A;  2PCF B;  4L5Q A;  2R7Z G;  5IP7 G;  4KHP L;  4R8I A;  3W3A A;  3P75 A;  1HZC A;  1TWC B;  1FGU A;  2BA0 A;  1HFN A;  1HA5 A;  1PRT C;  4XTC S;  1TS4 A;  1VQA A;  2KVM A;  4ODG A;  4H13 C;  4KJN A;  1CTM A;  2A68 C;  2N78 A;  4RHS A;  2B2U C;  5FLM G;  3CCR A;  1VQK A;  2RA4 A;  2R6G A;  2FFK B;  4BA1 I;  4S3S A;  1NE3 A;  3IAY A;  2JA6 G;  1TY0 A;  2X6G A;  2ES2 A;  2NUC A;  1VQB A;  1SE8 A;  1O7L A;  2WAQ E;  3CPF A;  4K6L A;  1VQ7 A;  4Y7N H;  2ZXR A;  1IL2 A;  5FLX c;  4C3H H;  2E8G A;  2Z6K C;  4AYB G;  1Q86 C;  2E2I H;  2D0O A;  2PI2 A;  3S14 B;  1PH6 A;  1KL9 A;  3E9H A;  3DUZ A;  3A0J A;  5I6W A;  4EQ5 A;  5HUR A;  4JI4 Q;  1WYD A;  1HA6 A;  1SJE D;  1S72 A;  1E24 A;  1C8C A;  1K3B C;  2I5H A;  1SBB B;  4TQU S;  1AE2 A;  3EQL C;  3TRZ A;  3G4S A;  3S15 H;  4HIO A;  5C4X B;  1IKM A;  4NMZ A;  3PF4 A;  2E5L L;  1K83 B;  3RNU A;  2B8G A;  1NTG A;  1G51 A;  2NTT A;  3VR6 A;  1NUC A;  3D4W A;  3CXC A;  2IHE A;  4EGV A;  4ME3 A;  2Q8R E;  5BN3 A;  4HMI A;  2RHS B;  1CZW A;  1M8A A;  4J6H A;  1BXT A;  1BUV T;  1SFO B;  1FJG L;  4A3E H;  1EL0 A;  4WFN 3;  3STB C;  4DAY B;  3S2H B;  1G2T A;  1XXG A;  3HKZ B;  5EJW A;  1HJP A;  5ELB A;  3Q0A A;  3GV3 A;  1EWI A;  1PTO B;  1A8V A;  4LF9 Q;  3UDI A;  3S16 B;  2KA7 A;  5FJ8 H;  2L55 A;  4X62 Q;  3OW2 A;  2R7Z B;  5ELD A;  3GTM B;  2JSO A;  1PZK D;  4MHE A;  4PZ8 A;  1A15 A;  1DM0 B;  2FMC A;  4MN3 A;  4BXX G;  4B9W A;  5C44 H;  4BY1 G;  1AN8 A;  1QJO A;  4NDX A;  4GKK L;  5BN4 A;  4K2K A;  3H09 A;  3HOU B;  1QB5 D;  4UP8 A;  1XJV A;  3HGB A;  3G48 A;  2UXB Q;  4RMF A;  1TKW B;  3F8T A;  5LL6 S;  2Z1C A;  2N88 A;  3VYT A;  1T5X D;  1Z9F A;  2Z6B A;  3K59 A;  2PQA A;  2DUD A;  4A3G H;  2F3W A;  1N33 Q;  4A3B G;  1FNV A;  5C0X H;  3K5N A;  3PCO B;  3J7A V;  4K5X A;  3A5U A;  4JI5 L;  4H0L C;  4N8X 1;  5FO9 B;  4C3J G;  2LKV A;  1HZ9 A;  5G3L D;  4KY7 A;  1GUG A;  1XMQ L;  5GAE C;  2NZO A;  4LFB Q;  1YNJ D;  2FIN B;  4KY5 A;  4JG2 A;  1D6E C;  3NWT A;  4RFB A;  2VUM G;  1CSP A;  4LF5 L;  4XDX A;  3QOL A;  2EE1 A;  3FKI B;  4NXM Q;  4GS3 A;  5E4X A;  3PO2 H;  1IL8 A;  1S5F D;  1B8A A;  4KHP Q;  5EPL A;  3A8I E;  4L5R C;  2IX1 A;  1R4P B;  5E7N A;  5GAD C;  2OWO A;  3GO5 A;  2EYP A;  4FXK C;  3HFZ B;  4LF4 L;  4ZAI A;  3H0G G;  4OL7 A;  2HDM A;  3CD6 A;  4OON A;  1HH2 P;  3Q6S A;  1CFM A;  2F0J A;  3SR1 A;  1KAB A;  1QG7 A;  4PQX A;  3MXU A;  1PZJ D;  1GO3 E;  2Q8T A;  4HJ9 A;  2EZV A;  1PFB A;  4A3K B;  4ILW A;  2A5H A;  2NYZ D;  1TS5 A;  2FHT A;  4IUR A;  1H9S B;  2NVQ B;  4RA8 A;  1MGS A;  4JBM A;  1YIJ A;  1E0B A;  1A3U A;  1PFS A;  1D5M C;  3M3Y B;  3LGJ A;  2JQO A;  4UY8 C;  4C3H G;  2A69 D;  3WDN A;  4EQP A;  1G8Z D;  5CGK A;  4MIU A;  1AZQ A;  4MZ9 A;  1VMP A;  1UE6 A;  2GVB A;  4N9P A;  4QJF A;  5LHY 1;  1HNZ L;  2AQ2 B;  1H9J A;  4GN3 B;  3H3V H;  3ITP A;  1PH4 A;  2Z4H A;  4OIJ A;  4DK1 A;  2K28 A;  1BCP C;  3PF5 A;  2HDL A;  3MZ5 A;  3H15 A;  2DGY A;  4G7Z C;  2BE5 D;  1N36 L;  2F0G A;  3I55 A;  1QZG A;  4LJZ C;  3K7U C;  1X3F A;  1LYL A;  5LMU L;  1STG A;  4JBW A;  3C2P A;  3E3X A;  4DFA A;  3I91 A;  3DEP A;  4C2M H;  3NTH A;  1FJG Q;  2JEB I;  1I50 B;  3DM3 A;  3F2C A;  1STY A;  2KOL A;  4I65 A;  3JAM L;  2O5J C;  2ALY B;  1TY2 A;  3AYH B;  1NR4 A;  3CHB D;  4C3I G;  1I5F A;  5CV9 A;  2MO0 A;  5JVH 3;  2B2W A;  2K5N A;  4DV0 L;  3ONA B;  3S1Q B;  1DD2 A;  1I4R A;  4M8A A;  2DNE A;  3IRB A;  4KI0 A;  2JA7 H;  3F2B A;  3HOY H;  1W3S A;  2CKZ B;  1PVO A;  2N55 A;  4YCW A;  1BOS A;  2ICE C;  4A3J H;  2LSS A;  4ZYS A;  1A62 A;  1V1O A;  2VL6 A;  5C5M A;  4GKK Q;  3AFQ A;  3LWE A;  1X54 A;  2JA9 A;  1J5E Q;  4JI0 L;  5J3B A;  1QUQ B;  3PIP 3;  4APV A;  4BY7 H;  3PQI A;  4JOI C;  3KBG A;  3IL8 A;  1LT4 D;  1EY6 A;  2Y0S B;  3S1R B;  1UEA B;  5CBE E;  3J81 j;  4A93 B;  2Q2I A;  4A3F G;  1KD1 C;  3TME A;  1WJJ A;  2WB1 G;  5JPM C;  5C3E G;  4Y52 H;  4DNR B;  4Y7N B;  2CQA A;  3CAM A;  2K14 A;  4JI5 Q;  1JWS D;  4A3G G;  1Y8N B;  2NZH A;  3MXN B;  1O7I A;  2SOB A;  1BBU A;  3S1M H;  4KMU C;  3WOE A;  4QCL A;  4IPC A;  5C0X G;  1NY4 A;  2ZT9 C;  3GTP H;  2E2I B;  4JC0 A;  4DR1 L;  2XVS A;  1A2U A;  4I7Z C;  4P2C B;  2UUC L;  3ZYY X;  2J0T D;  4XQJ A;  1ASY A;  3X3N A;  3NBI A;  4LUO A;  3OOC A;  2C5C A;  4CKB A;  4B3M L;  4LF5 Q;  4BBS H;  2EYL A;  1KQS A;  3DM1 A;  4ZKB B;  1LTT D;  2YV5 A;  2AUK A;  4B3T L;  5D3I B;  2ZJP A;  2NVT H;  1KDB A;  3BU2 A;  4P75 A;  2WB1 E;  5GAH C;  3KUP A;  3OWF A;  5BR8 L;  4L5S A;  3S15 B;  2B63 H;  4JV5 L;  3Q8D A;  4X64 L;  1V43 A;  3PUY A;  1RTO A;  1STN A;  1P16 A;  3PV0 A;  3PO2 G;  1YZ6 A;  3M4O H;  3OMG A;  1TQO A;  3PUZ A;  2UUA Q;  2EYH A;  3CC4 A;  2UXC L;  2BDN A;  1Q12 A;  1DOK A;  3TS0 A;  3AB9 A;  3UE0 A;  2JP1 A;  1F2Z A;  2SDF A;  1AH9 A;  4GLA C;  2CQO A;  2XWB B;  4A3E B;  4DR7 L;  1Q8K A;  1SE3 A;  3KDF B;  1BBX C;  2L1B A;  2OTJ A;  5IYB G;  1S5B D;  4GOP C;  1EY9 A;  1F9P A;  2B29 A;  5JVG 3;  3S1N B;  1C48 A;  4IZ8 A;  3I4L A;  4LFC L;  3PO3 H;  1JOQ A;  2A6H C;  1I4X A;  5IGC A;  5M3F B;  1H95 A;  4NW2 A;  2AUJ D;  1E3P A;  2XN9 C;  5C44 B;  3CCU A;  1VQH A;  4X66 L;  1M90 C;  4HR7 B;  1SYE A;  1HNZ Q;  4KN4 C;  3I4O A;  2IX0 A;  2WFW A;  1GHK A;  1EYC A;  1QWY A;  3H6M A;  1B53 A;  1WTV A;  1SXT A;  2IX3 A;  2ZJR A;  4GN4 B;  4IQZ A;  3CCS A;  3MVV A;  1VQ4 A;  1N36 Q;  3CME A;  4A3G B;  2BH8 A;  1VQ6 A;  4DV6 L;  3I4M B;  1L0Y B;  5JJK A;  2AHO B;  2PYK A;  2RDG A;  4AQY L;  1ML0 D;  4DK0 A;  1B3A A;  4LUV A;  2F3V A;  1TXY A;  1V8Q A;  3DWP A;  4R4T A;  4EQN A;  2VQE L;  2G5D A;  3AMU A;  3J7A 5;  3QWN A;  2E75 C;  4C56 C;  1D1K A;  3KF8 B;  3JC6 6;  2X69 A;  3SHL A;  3DWQ A;  3W1G A;  4IFD G;  1KHI A;  4CKE A;  3F2D A;  4HAE A;  4HTH A;  1PRT D;  3M85 A;  2I0Q A;  3PO2 B;  4G7O C;  2N3S A;  2PW5 A;  1WTR A;  5DM6 3;  1SYD A;  2A68 D;  1DXM A;  4FO2 A;  3BVG A;  1DJR D;  2JA7 G;  1MKH A;  4P72 A;  1SNO A;  4RCO A;  1ZKO A;  1QOH A;  1PTO F;  1CA6 A;  1II3 A;  1XTD A;  2EJG C;  4RGO S;  1A2T A;  2WAC A;  4CGY B;  1F2L A;  5IGF A;  4A3M B;  4KHV A;  3JAM c;  1CM9 A;  3CCJ A;  1E1O A;  5T1G A;  4DA2 A;  1LV9 A;  4IUQ A;  3PUV A;  4JI2 L;  5I6Y A;  2F0V A;  2IW3 A;  5E3F A;  3KJP A;  1CT1 D;  4FNF A;  3U9O A;  4KY6 A;  2EY1 A;  3FVQ A;  3EA6 A;  2F4V L;  3TS2 A;  1XNR L;  3FKI H;  3R2I A;  1YI2 A;  3D4R A;  3IKJ A;  4LFA L;  5FO7 B;  3FRP B;  1SNC A;  1SRO A;  5JEA J;  4DR1 Q;  2VZA A;  1E2W A;  1N8R C;  1CQV A;  3QIA A;  5F2D A;  1I94 L;  2UUC Q;  4HIK A;  3OWE B;  2EYJ A;  4B3M Q;  5KYI A;  1IXR A;  1JOK A;  3A54 A;  3NBH B;  1SYB A;  3MXP A;  1YHQ A;  4R1J A;  4LF8 L;  4BBS G;  4QY7 A;  5BR8 Q;  3DLL A;  2HHH Q;  2PQE A;  5E1F A;  4X64 Q;  1MBY A;  1O80 A;  1O7Y A;  1GUW A;  2CCZ A;  3I90 A;  3RLF A;  3QG1 A;  4RKL A;  3STB D;  2WP8 J;  4QMG A;  2CW0 C;  3CW2 C;  3RMH A;  1NNX A;  4DAY A;  5KYL A;  2PMZ B;  1FNU A;  1QVF A;  2NVQ H;  4CJ2 C;  2XRQ D;  4MTN A;  2E2H H;  4C2M B;  3I70 A;  1VQD A;  4DR7 Q;  1HTL D;  5ELO A;  4F87 A;  3M3Y H;  1Z47 A;  2F0I A;  3SVM A;  1Q46 A;  1N34 L;  5KEE A;  1SMY C;  1EQV A;  3F1Z A;  3FPU B;  1XTC D;  5IT9 E;  4WRD A;  1J6Q A;  4IFD I;  4LFC Q;  2OCE A;  1S3O A;  2KUM A;  1FNW A;  4CJ0 B;  5EAY A;  2JA7 B;  3HOY B;  1PFM A;  2UXB L;  4HJ5 A;  1K8O A;  3VR2 A;  4A3J B;  4X66 Q;  2OF1 A;  4IUU A;  3PO3 G;  1UE7 A;  1YJN A;  2EPB A;  1IZ6 A;  3J81 c;  2VXW A;  5C4X G;  1I4Q A;  4O1N A;  4BY7 B;  2KQ3 A;  1XPR A;  1CHQ D;  3ERO A;  4BA2 I;  5DNF A;  2Q2H A;  5M5X H;  5FK9 C;  5FOB B;  1JT8 A;  1I6H H;  2N49 A;  2LXJ A;  5CV4 A;  1VQ5 A;  1Y1V B;  2EY6 A;  2B2W C;  1PH2 A;  3T53 B;  1IW7 C;  4G57 A;  4DV6 Q;  3FMC A;  4LFB L;  4N9T A;  3M7N A;  1EIH A;  3ULL A;  3DEO A;  5K36 H;  3HKZ G;  4AQY Q;  3RLN A;  4JI3 L;  1R4Q B;  4DNI A;  2BH2 A;  4NXM L;  1VQ8 A;  3S1M B;  2VQE Q;  5EQ0 A;  4XQN A;  3GTP B;  4KKT A;  4DR5 Q;  1CK1 A;  4V0B A;  4NP5 A;  3G6J B;  3MFY A;  3RN2 A;  3ND8 A;  1UUP A;  3L0O A;  1YHA A;  2N8N A;  4BBS B;  1WTP A;  1MSG A;  1JQY D;  4F7X A;  1VQC A;  1RL2 A;  4Q0F A;  2O4X A;  2ZXO A;  2LS0 1;  4QL5 A;  4HN7 A;  3HOX H;  3E6Z X;  4BWG B;  2G9D A;  2VW9 A;  2NVT B;  1ZEQ X;  4PMW A;  4E6I A;  1EOV A;  1NJI C;  2EOT A;  3S1R H;  3HOU G;  2B63 B;  1VCI A;  1A0I A;  3QR8 A;  4A93 H;  1EWC A;  3M4O B;  4X3S A;  5ELC A;  1ET6 A;  4U68 A;  3ERS X;  2IL8 A;  1PA6 A;  3GTO B;  2DY8 A;  3HS0 C;  3CCM A;  1OXS C;  4A3I H;  4JI2 Q;  3CPW A;  1TWA B;  3PIO 3;  4DPG A;  1FR3 A;  3GDE A;  1X3P A;  3NWS A;  2ZXP A;  3T1Y Q;  3SEB A;  4PMB A;  4L8J A;  2F4V Q;  1B3Q A;  2HQL A;  4ZRZ A;  3K80 C;  1XNR Q;  2QKI C;  3J80 i;  4LFA Q;  4MNO A;  1JB7 A;  1B44 D;  2ZTC A;  2QEX A;  5CMD A;  3PO3 B;  4GOP A;  4DKA C;  1I94 Q;  2LMC B;  1BCP D;  3E0J A;  3FKI G;  1B1Z A;  4ZUI A;  3U4V A;  3VYS A;  3FPP A;  2K75 A;  2K6A A;  5HGQ A;  3UDF A;  5A35 A;  1KXL A;  4IOC A;  5EPJ A;  5EKI A;  2ZTE A;  3ERQ A;  1L1O B;  4LF8 Q;  2O5I C;  4AYB E;  1AFP A;  3MA2 B;  1VF5 C;  1UAP A;  4IO9 A;  4RWS C;  1IYV A;  3X3M A;  1LTL A;  3QB3 A;  2J7Z A;  1QNK A;  2HCI A;  1Y1W H;  3MTS A;  4TSS A;  1UE1 A;  3I4N H;  2X6L A;  1JWU D;  1BF4 A;  1NMF A;  2AKW B;  3W1B A;  5GAG C;  1P8L A;  4A3K G;  3S1N H;  1CUK A;  4CHT B;  2HT1 A;  1PDQ A;  2YTV A;  1IBM Q;  1ONL A;  1SE4 A;  3T1H L;  2NN6 I;  3VR4 A;  5M3F H;  1N34 Q;  1U9R A;  2WV6 D;  1SSO A;  2FMM A;  1D5X C;  3D8G A;  3HKS A;  3LWU A;  5CYU A;  2OT2 A;  1JE5 A;  1DOM A;  4YCV A;  1J5E L;  3AEV A;  1CZG A;  4K5V A;  2JE6 I;  4UP9 A;  1F2M A;  4FF1 A;  1SEB D;  1OXT A;  4EVO A;  4DV1 L;  1YNN C;  4DV4 Q;  2MFI A;  4YIJ A;  1D5Z C;  1ZYR C;  2IPK D;  1QUQ A;  5I9P A;  1UWV A;  1HHV A;  5IGD A;  1KLU D;  4A75 A;  5IT9 L;  3DWA A;  3KJO A;  1ET9 A;  3I4M H;  1GUT A;  2PZU A;  4ZLT F;  1K8G A;  1U4R A;  1EQR A;  2H5X A;  1LTI D;  3VDY A;  3K0Y A;  4PZ6 A;  1K9M C;  2HD3 A;  2K5V A;  4J1M A;  3VA7 A;  1F9S A;  5ISR A;  3K0X A;  3VA5 A;  3MXN A;  4LK1 C;  4GNX B;  1HCZ A;  4DXF A;  2RHQ B;  1PH9 A;  1XX8 A;  3RZD H;  4JI3 Q;  1H9M A;  2O2L D;  3PIP A;  1ASZ A;  1VQN A;  1LLR D;  2ICI A;  3CP0 A;  1A63 A;  2D62 A;  3DHQ A;  2DN8 A;  1D7Q A;  2P5Z X;  1K28 A;  2OTL A;  1OXX K;  4NKL A;  1D1I A;  2A1A A;  3L9A X;  2UUA L;  2KCC A;  2FJ2 A;  1F77 A;  4X3U A;  4HID A;  2Q2U A;  3OHX C;  4A3M H;  1LM0 A;  1HQR D;  1YJ9 A;  2CFM A;  4HMJ A;  4TRD A;  1VQM A;  1EY4 A;  3FEW X;  5COY A;  2I5L X;  2Y0S G;  5EBD A;  2L4N A;  3SK6 A;  3T16 A;  4TVA B;  1JR0 D;  5EKK A;  4HIM A;  2RDH A;  1M4V A;  4J8Q A;  4A93 G;  1MIU A;  1BO0 A;  3KDF A;  3KLR A;  1VQI A;  1LTR D;  4OO1 H;  2QEJ C;  2E2H B;  4DV3 L;  3H94 A;  5D65 A;  4XYQ A;  4AIM A;  3N52 A;  4A3L H;  1GKH A;  3R2T A;  3C3L A;  3GTK H;  1ILQ A;  1CSQ A;  2A6H D;  4LF6 Q;  2B8F A;  1R9T H;  4DR3 Q;  4DR2 L;  4JW0 A;  2ASB A;  1I4P A;  3K6O A;  2XTI A;  3NK9 A;  4XQQ A;  1L0X B;  1RTN A;  2YTY A;  2Y0S E;  1NCV A;  3PUX A;  3PGZ A;  3NE5 B;  2A73 B;  3ZJY C;  2YU9 H;  1Q7Y C;  1TWH B;  1E1T A;  4A3D H;  1K8M A;  1YBY A;  2E2J H;  2VB3 X;  1PTO C;  3U9S A;  2HCC A;  5K5P A;  3VR5 A;  2FXQ A;  4R8N A;  3RN5 A;  2EVB A;  2EYM A;  5EPK A;  2EXD A;  5GQO A;  4B08 A;  3CQZ H;  5M5X B;  1PRT F;  5ELN A;  4ZKC B;  2NB0 A;  1I6H B;  3IFD A;  2F0P A;  1F2Y A;  4RGT A;  1W6K A;  5C6A A;  1HTP A;  1UNS A;  5IGG A;  4A3E G;  1EIY B;  1U4P A;  2CVR A;  1Y1W G;  1E7Z A;  4C1N I;  2Z8L A;  1I6V C;  1PZI D;  3ULP A;  1Y8P B;  3OIP A;  3I4N G;  2WIN B;  5E4W C;  3EIV A;  1XNQ L;  3J81 i;  3KF8 A;  3T1H Q;  1RD9 D;  2DNC A;  1F9R A;  5FJ8 G;  3TDQ A;  4IPD A;  3N6R A;  3G6E A;  2NVX B;  1V1P A;  2Z9H A;  4HCE A;  1PYW D;  4CDC C;  1A6X A;  3M4P A;  4A3C H;  3S2D H;  5M5W H;  1LT3 D;  1NAP A;  5M3F G;  5ELE A;  2KCM A;  5JAV A;  1BBW A;  3G7L A;  3PSI A;  1HR0 W;  5C44 G;  3AQQ A;  2H1E A;  5EBC A;  2RSN A;  5FO8 B;  3BS1 A;  4DV1 Q;  3HOX B;  1LTG D;  1OXV A;  2C35 B;  2OQ0 A;  4RHR A;  3PMF A;  3HOV B;  2LFN A;  1Y1V H;  2DJG C;  3HEJ A;  3EFX D;  1BVS A;  1PMR A;  3P20 A;  1B4O A;  2KEC A;  1I3Q H;  2L9H A;  1PH1 A;  1KIX A;  1GUO A;  2YTX A;  5J22 A;  3HOZ H;  2D5D A;  4JI1 L;  3GTQ B;  2EYF A;  4KJO A;  1GVP A;  1PH3 A;  2PQA B;  3I4M G;  1HZB A;  2I5M X;  1W6J A;  1SJH D;  3MXG A;  2D0P A;  5JEA H;  4A3I B;  2F0O A;  2GVA A;  1XPU A;  2R7F A;  3MEF A;  1DCZ A;  4PV1 C;  1KTK A;  2VY3 A;  4HCS A;  1ROD A;  1SYC A;  1TWF H;  2F0H A;  2RKS A;  2SEB D;  4GZY C;  1E2Z A;  3K57 A;  4G7H C;  2TSS A;  4HSP A;  1H9K A;  4HJA A;  2HHH L;  3NBH A;  3TP5 A;  5IT9 c;  4A4I A;  1CKM A;  4QIW B;  2F0M A;  1IKL A;  2JA8 H;  3EJI A;  3HG9 A;  3DMU A;  2AMC B;  3P7J A;  1CA5 A;  3J7Y W;  3TZD A;  2CW0 D;  2QF7 A;  2RDF A;  5EKL A;  2K7V A;  3GTO H;  4K5W A;  1NMG A;  1TR5 A;  1J9O A;  1K3R A;  4LF7 L;  4LW1 A;  1TWA H;  4DR6 Q;  1Y1W B;  4BBR H;  3I4N B;  4A3M G;  2K1B A;  4IUN A;  1XMO L;  1PYS B;  1AW7 A;  3A74 A;  3MC0 B;  1EZ8 A;  1WI5 A;  1Y14 B;  4IPH A;  4EX5 A;  4DV3 Q;  4DNT B;  1ZXT A;  2MGS A;  3OIQ A;  4ME5 A;  4LUZ A;  1JC7 A;  4MTK A;  4IJH A;  2C9O A;  1B70 B;  4LNQ A;  2JEA I;  3TP7 A;  1MD2 D;  4DR2 Q;  5IYD H;  1XWE A;  3BYT B;  3E5S A;  3UE1 A;  3BYY B;  4IPG A;  5DEH A;  4F8M A;  1S40 A;  3Q24 A;  3NTI A;  1T9H A;  1LAB A;  1C0A A;  3NUC A;  4RGM A;  1BQQ T;  3S24 A;  1X56 A;  2KCN A;  2A69 C;  4UAI A;  1DZ1 A;  2H4O A;  4IJL A;  2CHB D;  1SYG A;  1IW7 D;  3R8B A;  1AE3 A;  1GXD C;  1RIP A;  4TKO B;  1EIG A;  1K0S A;  4DF7 A;  4JYA L;  1QVG A;  4YY3 L;  2F0L A;  4DUY L;  2CH4 A;  5C0X I;  4DR5 L;  3UI2 A;  2AQ3 B;  2BE5 C;  3OTO L;  3LX0 A;  1CKN B;  3NTK A;  5FKA C;  5IOD A;  3RZD B;  2RCF A;  1XNQ Q;  1X65 A;  4P73 A;  1DON A;  3CRL C;  3ND9 A;  3MFG A;  3KF6 B;  3VYR A;  1EIF A;  3D31 A;  3K81 C;  3SK4 A;  4DU9 A;  3UDX A;  4KD3 A;  4FF2 A;  2R61 A;  1HR0 L;  2UUB L;  1MJE A;  1EY7 A;  5I2Y A;  3HOY G;  2EJM A;  5JJL A;  4CJ1 B;  4A3J G;  3LNN A;  2PMZ E;  1RCV D;  1WVL A;  1EFW A;  3M7G A;  1TWG H;  3URY A;  3K58 A;  3IFT A;  1GUS A;  1GUN A;  3J7A F;  5IGB A;  2QW7 A;  1GOZ A;  2E76 C;  3CU7 A;  3WWV A;  4BY7 G;  3KBX A;  4XT3 B;  1V9P A;  2A74 C;  3M4Y A;  3T51 B;  5L37 A;  3UDG A;  1SR3 A;  2JA5 H;  3GTL B;  4DN4 M;  1DOL A;  4JI1 Q;  1PRT B;  1HFG A;  1Y1V G;  3Q22 A;  1HUM A;  3T1Y L;  4G4K A;  3NP8 A;  4B3R L;  4DK6 C;  3HOZ G;  3CCE A;  4FP5 D;  1YVC A;  3GTK B;  1JJ2 A;  3R93 A;  3W2D A;  4WOR A;  1CHP D;  5IE8 A;  1TS3 A;  3NEN A;  5JEA G;  2XWJ B;  5ELF A;  1R9T B;  2F3I A;  4UPA A;  1PLF A;  3RD4 A;  3A56 A;  1JIC A;  4QB4 A;  1SDF A;  2M9V A;  1HNW L;  1N32 L;  4JK1 C;  3D4D A;  2B2V A;  3C1F A;  4CKC A;  2YU9 B;  2I07 B;  4PG3 A;  1Y69 U;  3H3V I;  2A19 A;  3OSO A;  4A3D B;  3PIO A;  2R92 B;  2E2J B;  5M3M B;  1CKO A;  2B63 G;  5KNB A;  3NEM A;  3A7L A;  5DLQ E;  1YHB A;  5COR A; 
#chains in the Genus database with same CATH homology
 3CQZ B;  1PXU A;  2QIL A;  1STE A;  2F0U A;  2MHV A;  2K5W A;  2PZT A;  2EYO A;  1TS2 A;  2AWN A;  4L6T B;  1EOT A;  4OIK A;  1U4M A;  1C4Q A;  5CC4 A;  4ZK9 B;  3BDC A;  2XSC A;  3QO2 A;  3NSW A;  4FYD A;  1HRJ A;  2K01 A;  1G6Z A;  1EY0 A;  2MPM A;  1KLG D;  3S2D B;  5M5W B;  5G3L F;  1G29 1;  1RDP D;  3I72 A;  2ID0 A;  4K14 A;  4OHJ A;  5CV7 A;  1ENC A;  3NHH A;  2F0Q A;  3J80 E;  5CBA E;  2R93 B;  4IUV A;  3KLS X;  1JOR A;  1E2V A;  4FVM A;  4ULL A;  2B2Y C;  2EJF C;  5D3D A;  2OXP A;  4V19 0;  1I3Q B;  3BZD B;  2B39 A;  3HOZ B;  3OW7 A;  1HXY D;  1S5E D;  2TMP A;  5CV8 A;  4XT1 B;  1Q1E A;  1U4L A;  1CQF A;  1EU3 A;  1ENA A;  4XYO A;  1WTQ A;  1JOO A;  1GJX A;  1EY8 A;  1LTA D;  1JCK B;  1TWF B;  1TVX A;  1Q1B A;  4RKB A;  3NPP A;  2HQE A;  3QJY A;  3I73 A;  5CV5 A;  3WOF A;  3NQI A;  4K8I A;  3QOJ A;  2ENB A;  1ESR A;  3TSS A;  2JA8 B;  4IUP A;  1STH A;  3GP7 A;  3SDZ A;  5KGU A;  1F9Q A;  1B50 A;  2G9H D;  2F0N A;  1EWH A;  1H9S A;  3TZU A;  4BBR B;  3O13 A;  3NXW A;  2IT1 A;  3VYU A;  3MAQ A;  2JYO A;  3OMC A;  3P1H A;  4U67 3;  3H3V C;  2F0F A;  4RH6 A;  4IAL A;  3A55 A;  1B9N A;  3BVZ A;  1FD7 D;  1OXU A;  4KTA A;  3AU7 A;  1KNE A;  1EU4 A;  1PTO D;  4ID6 A;  2E74 C;  1SNP A;  2D2C C;  1O7Z A;  4CBV A;  1TT2 A;  2AWO A;  1A3T A;  1TU2 B;  2EY5 A;  3JAM E;  3MWY W;  2B2T A;  1SNM A;  3GQB A;  2WII B;  1BCP B;  3RUZ A;  2DY7 A;  3D6C A;  4KK7 A;  2EXZ A;  5KND A;  4K8J A;  2WAQ B;  4XIG S;  4DXG A;  3SK8 A;  3D3R A;  2PNR C;  1EYA A;  1X3Q A;  2K32 A;  5C3W A;  2RBM A;  1Z6H A;  2A6E C;  2F0T A;  2KED A;  3BVM A;  1TWG B;  2F0K A;  1EY5 A;  3V96 A;  3A8J E;  2JA6 B;  2R3Z A;  2BOS A;  5EGT A;  2VNU D;  1H9R A;  2JA5 B;  5I9O A;  3BDL A;  4H7B A;  5JOB A;  5CR3 A;  3J80 L;  4AYB B;  5C3X A;  5K36 G;  2K05 A;  2KJX A;  1STA A;  1S4Z A;  3SK5 A;  4KKU A;  3SXH A;  4KV6 A;  1WTO A;  2PO4 A;  1FGB D;  4HED A;  1JE4 A;  2M00 A;  4K6D A;  1LAC A;  3J81 E;  5I4D A;  4DAP A;  5T1I A;  4PMC A;  2K5D A;  2E2D C;  2EDG A;  4PNY A;  2L0C A;  2YYZ A;  1ILP A;  1IHZ A;  5DAU A;  1G2S A;  2B2V C;  4OGQ C;  3HP3 A;  4FXG C;  3BDO A;  1Y8O B;  1VDZ A;  1WD1 A;  2IJ0 A;  5BN5 A;  4BY1 B;  1RHP A;  3TBI B;  1ESF A;  4X3K A;  1SE2 A;  1LT6 D;  5CV6 A;  1EZ6 A;  1LTB D;  1XYI A;  1AP0 A;  4K2L A;  3CKI B;  3I8Z A;  1LTS D;  2NVY B;  4DAV A;  1B2T A;  1EFI D;  4F88 A;  5M5Y B;  2WKD A;  4IUT A;  4A3B B;  3HOW B;  5FLX E;  3KK7 A;  1OO9 B;  1X32 A;  3SE0 A;  2B2Y A;  2F4I A;  3GTJ B;  1I4G A;  4C3J B;  2LY7 A;  4FF4 A;  2VB2 X;  2NTS A;  4HSV A;  3TP8 A;  5IGE A;  2BCO A;  4IFD H;  2VUM B;  5LL6 X;  2SNS A;  1J8I A;  2F0W A;  2PZW A;  2KHS A;  4B9X A;  5DM7 3;  1Q90 A;  2M2L A;  3MEH A;  1AEX A;  2NZ1 D;  4C1N K;  1QNU A;  2K33 A;  3RZO B;  2QDB A;  3H0G B;  1LT5 D;  1HUN A;  3TN2 A;  3K5O A;  5D14 A;  5AFW A;  1I4H A;  5M9O A;  2I46 A;  4KN7 C;  5I2X A;  3C46 A;  3T4A C;  1FYC A;  2JXM B;  5COR A;  2Z4I A;  3KLS A;  2B2U A;  1VMC A;  4QUC A;  5C0X J;  5A2Q E;  3BG3 A;  4C3H B;  4X3T A;  2K04 A;  3HZX A;  4ZQ3 A;  1YNJ C;  1HQM C;  3NQT A;  2F03 A;  1Q8I A;  5KIX A;  1SAP A;  1MI2 A;  2QCP X;  1KDA A;  2J4X A;  4FF3 A;  3GTG B;  1D2B A;  2NBF A;  2F0D A;  2XIW A;  2GA4 B;  2K03 A;  1JWM D;  4LMQ D;  1SMY D;  2XRS D;  3FDT A;  3Q23 A;  3J81 L;  1T5E A;  4OO1 G;  1WCM B;  4C3I B;  2PW7 A;  2K5Q A;  1NR2 A;  2KEE A;  2RSO A;  3A7A B;  1STB A;  1MSH A;  3A8K E;  5IIF A;  1SYF A;  2B2T C;  5JJZ A;  5J39 A;  3R3O A;  1DYQ A;  1CI3 M;  4KKS A;  1WTW A;  2RVL A;  3OPO A;  2MP1 A;  5C4H A;  4A3F B;  2WB1 B;  1HPC A;  2AQ1 B;  3I3C A;  4QUF A;  1KAA A;  5C3E B;  4L63 B;  1RKN A;  1PTO H;  2NN6 H;  3CRK C;  4H44 C;  5C4J B;  1KNA A;  3S9W A;  2OEO A;  4WJW A;  1O78 A;  1ENF A;  3K5M A;  3K5L A;  2MUY A;  5KNC A;  1JB3 A;  5FLX L;  4IFD J;  4EQO A;  3HRZ C;  2L12 A;  1EYD A;  1BR9 A;  2NWG A;  1WD0 A;  1V1P B;  4DGZ A;  2V4D A;  2IWH A;  3TP6 A;  2D9U A;  4LAA A;  1BCP F;  3MHB A;  5NUC A;  3T56 B;  1RF2 D;  4ABN A;  1EQT A;  1Z7T A;  2F0S A;  2XNA C;  1S5D D;  4Q5V A;  3S17 B;  5IOC A;  2PPB C;  4OO1 I;  3GV6 A;  4ZUJ A;  4FXD A;  1QCB D;  2Q8I B;  1Q3L A;  1B9M A;  3PUW A;  3T13 A;  1A3V A;  2EY2 A;  4KD4 A;  1IYU A;  5C4Z A;  2HUG A;  2L5T A;  3H91 A;  3V05 A;  5A2Q L;  1AZP A;  4M1U B;  1SNQ A;  3K7A B;  3F2U A;  1S5C D;  3EVQ A;  3L7Z C;  2L11 A;  3D6W A;  4R9W A;  4RCN A;  1KDC A;  4BS9 A;  2BDO A;  3C1E A;  1PFN A;  1TII D;  3DXJ C;  1YNN D;  1ZYR D;  3VR3 A;  1BNZ A;  1QE6 A;  2WKC A;  2RQX A;  1NSN S;  1ICW A;  3GD7 A;  4KHZ A;  4Z9C B;  1LO5 D;  2A6E D;  5TSS A;  5JPN C;  4QF4 A;  3V2T A;  5HGT A;  2F0E A;  2MJ8 A;  4RAU C;  5C5L A;  2BA1 A;  4UDU C;  3L3O C;  4O42 A;  1GHJ A;  1VF7 A;  1G91 A;  4XXE A;  1EEI D;  1WTX A;  4IN3 A;  1EEF D;  2NN6 G;  1QIL A;  1SND A;  2SNM A;  1BDO A;  1RJT A;  5KRU A;  4RGN A;  2F1M A;  2PCF B;  4R8I A;  3W3A A;  3P75 A;  1TWC B;  2BA0 A;  1HFN A;  1HA5 A;  1PRT C;  4XTC S;  1TS4 A;  2KVM A;  4ODG A;  4H13 C;  4KJN A;  1CTM A;  2A68 C;  4RHS A;  2B2U C;  2RA4 A;  2R6G A;  2FFK B;  4BA1 I;  4S3S A;  3IAY A;  1TY0 A;  2X6G A;  2NUC A;  1O7L A;  4K6L A;  2ZXR A;  3S14 B;  3DUZ A;  5I6W A;  5HUR A;  1HA6 A;  1SJE D;  1C8C A;  1SBB B;  4TQU S;  3EQL C;  5C4X B;  1IKM A;  4NMZ A;  1K83 B;  2B8G A;  2NTT A;  3VR6 A;  1NUC A;  3D4W A;  4EGV A;  2Q8R E;  5BN3 A;  4HMI A;  1CZW A;  1M8A A;  4J6H A;  1BXT A;  1BUV T;  1SFO B;  1EL0 A;  4WFN 3;  3S2H B;  1G2T A;  1XXG A;  3HKZ B;  5EJW A;  5ELB A;  3Q0A A;  3GV3 A;  1PTO B;  3S16 B;  2KA7 A;  2L55 A;  2R7Z B;  5ELD A;  3GTM B;  2JSO A;  1PZK D;  4MHE A;  1A15 A;  1DM0 B;  2FMC A;  4MN3 A;  4B9W A;  1AN8 A;  1QJO A;  4NDX A;  5BN4 A;  4K2K A;  3H09 A;  3HOU B;  1QB5 D;  3HGB A;  1TKW B;  5LL6 S;  2Z1C A;  2N88 A;  3VYT A;  1T5X D;  3K59 A;  2F3W A;  1FNV A;  5C0X H;  3K5N A;  3J7A V;  4K5X A;  4H0L C;  5FO9 B;  4C3J G;  2LKV A;  5G3L D;  4KY7 A;  1GUG A;  1YNJ D;  2FIN B;  4KY5 A;  1D6E C;  3NWT A;  4RFB A;  4XDX A;  3QOL A;  2EE1 A;  3FKI B;  5E4X A;  1IL8 A;  1S5F D;  5EPL A;  3A8I E;  2IX1 A;  1R4P B;  3GO5 A;  2EYP A;  4FXK C;  4ZAI A;  4OL7 A;  2HDM A;  3Q6S A;  1CFM A;  2F0J A;  3SR1 A;  1KAB A;  4PQX A;  1QG7 A;  3MXU A;  1PZJ D;  2EZV A;  2Q8T A;  1PFB A;  4A3K B;  4ILW A;  2A5H A;  2NYZ D;  1TS5 A;  2FHT A;  4IUR A;  1H9S B;  2NVQ B;  4RA8 A;  1MGS A;  1E0B A;  1A3U A;  1D5M C;  3M3Y B;  4C3H G;  2A69 D;  3WDN A;  4EQP A;  1G8Z D;  5CGK A;  4MIU A;  1AZQ A;  1VMP A;  4N9P A;  5LHY 1;  2AQ2 B;  1H9J A;  3ITP A;  2Z4H A;  4OIJ A;  4DK1 A;  2K28 A;  1BCP C;  2HDL A;  3MZ5 A;  4G7Z C;  2BE5 D;  2F0G A;  4LJZ C;  1STG A;  4JBW A;  3C2P A;  4DFA A;  3I91 A;  3DEP A;  3NTH A;  2JEB I;  1I50 B;  1STY A;  2KOL A;  4I65 A;  3JAM L;  2O5J C;  1TY2 A;  1NR4 A;  3CHB D;  4C3I G;  5CV9 A;  5JVH 3;  2B2W A;  3ONA B;  3S1Q B;  1DD2 A;  1I4R A;  4M8A A;  2DNE A;  4KI0 A;  2N55 A;  1BOS A;  2ICE C;  4ZYS A;  1V1O A;  5C5M A;  3LWE A;  3PIP 3;  3KBG A;  3IL8 A;  1LT4 D;  1EY6 A;  2Y0S B;  3S1R B;  1UEA B;  5CBE E;  4A93 B;  3TME A;  5JPM C;  4DNR B;  4Y7N B;  2CQA A;  1JWS D;  1Y8N B;  2SOB A;  4KMU C;  3WOE A;  4QCL A;  5C0X G;  2ZT9 C;  2E2I B;  2XVS A;  1A2U A;  4I7Z C;  4P2C B;  3ZYY X;  2J0T D;  4XQJ A;  3X3N A;  3NBI A;  3OOC A;  2C5C A;  4CKB A;  2EYL A;  3DM1 A;  4ZKB B;  1LTT D;  2AUK A;  5D3I B;  1KDB A;  3KUP A;  3OWF A;  3S15 B;  1V43 A;  3PUY A;  1RTO A;  1STN A;  3PV0 A;  3OMG A;  1TQO A;  3PUZ A;  2EYH A;  2BDN A;  1Q12 A;  1DOK A;  3AB9 A;  2JP1 A;  1F2Z A;  2SDF A;  2XWB B;  4A3E B;  1SE3 A;  1BBX C;  2L1B A;  1S5B D;  1EY9 A;  1F9P A;  5JVG 3;  3S1N B;  1C48 A;  4IZ8 A;  3I4L A;  1JOQ A;  2A6H C;  1I4X A;  5IGC A;  5M3F B;  4NW2 A;  2AUJ D;  2XN9 C;  5C44 B;  4HR7 B;  1SYE A;  4KN4 C;  2IX0 A;  1GHK A;  1EYC A;  1QWY A;  3H6M A;  1B53 A;  1WTV A;  1SXT A;  2IX3 A;  4IQZ A;  3MVV A;  4A3G B;  3I4M B;  1L0Y B;  2PYK A;  2RDG A;  1ML0 D;  4DK0 A;  1B3A A;  2F3V A;  1V8Q A;  3DWP A;  4EQN A;  3AMU A;  3QWN A;  2E75 C;  4C56 C;  1D1K A;  2X69 A;  3SHL A;  3DWQ A;  4IFD G;  4CKE A;  4HAE A;  4HTH A;  1PRT D;  3M85 A;  3PO2 B;  4G7O C;  2PW5 A;  1WTR A;  5DM6 3;  1SYD A;  2A68 D;  1DXM A;  4FO2 A;  3BVG A;  1DJR D;  1SNO A;  4RCO A;  1ZKO A;  1QOH A;  1PTO F;  1CA6 A;  1II3 A;  2EJG C;  4RGO S;  1A2T A;  2WAC A;  4CGY B;  1F2L A;  5IGF A;  4A3M B;  4KHV A;  1CM9 A;  5T1G A;  4DA2 A;  1LV9 A;  4IUQ A;  3PUV A;  5I6Y A;  2F0V A;  2IW3 A;  5E3F A;  1CT1 D;  4FNF A;  3U9O A;  4KY6 A;  2EY1 A;  3FVQ A;  3EA6 A;  3R2I A;  3D4R A;  3IKJ A;  5FO7 B;  3FRP B;  1SNC A;  5JEA J;  1E2W A;  1CQV A;  3QIA A;  5F2D A;  3OWE B;  2EYJ A;  5KYI A;  1JOK A;  3A54 A;  1SYB A;  3MXP A;  2PQE A;  5E1F A;  1MBY A;  1O80 A;  1O7Y A;  1GUW A;  3I90 A;  3RLF A;  3QG1 A;  4RKL A;  2WP8 J;  4QMG A;  2CW0 C;  3RMH A;  4DAY A;  5KYL A;  2PMZ B;  1FNU A;  4CJ2 C;  2XRQ D;  4C2M B;  3I70 A;  1HTL D;  4F87 A;  1Z47 A;  2F0I A;  3SVM A;  5KEE A;  1SMY C;  1EQV A;  3FPU B;  1XTC D;  5IT9 E;  4WRD A;  4IFD I;  2KUM A;  1FNW A;  4CJ0 B;  2JA7 B;  3HOY B;  1PFM A;  1K8O A;  3VR2 A;  4A3J B;  2OF1 A;  4IUU A;  2EPB A;  2VXW A;  1I4Q A;  4O1N A;  4BY7 B;  2KQ3 A;  1CHQ D;  3ERO A;  4BA2 I;  5DNF A;  5FK9 C;  5FOB B;  5CV4 A;  1Y1V B;  2EY6 A;  2B2W C;  3T53 B;  1IW7 C;  4G57 A;  3FMC A;  4N9T A;  3M7N A;  1EIH A;  3DEO A;  5K36 H;  1R4Q B;  3S1M B;  5EQ0 A;  4XQN A;  3GTP B;  4KKT A;  1CK1 A;  4V0B A;  4NP5 A;  3G6J B;  3MFY A;  3ND8 A;  1UUP A;  4BBS B;  1WTP A;  1MSG A;  1JQY D;  4F7X A;  4Q0F A;  2O4X A;  2ZXO A;  2LS0 1;  4HN7 A;  3E6Z X;  4BWG B;  2G9D A;  2NVT B;  1ZEQ X;  4PMW A;  4E6I A;  2EOT A;  2B63 B;  1VCI A;  1EWC A;  3M4O B;  4X3S A;  5ELC A;  1ET6 A;  4U68 A;  2IL8 A;  3GTO B;  2DY8 A;  3HS0 C;  1OXS C;  1TWA B;  3PIO 3;  1FR3 A;  1X3P A;  3NWS A;  2ZXP A;  3SEB A;  4PMB A;  4L8J A;  4ZRZ A;  2QKI C;  1B44 D;  5CMD A;  3PO3 B;  2LMC B;  1BCP D;  3E0J A;  1B1Z A;  4ZUI A;  3VYS A;  3FPP A;  2K6A A;  5A35 A;  5EPJ A;  5EKI A;  3ERQ A;  2O5I C;  1AFP A;  3MA2 B;  1VF5 C;  1UAP A;  4RWS C;  1IYV A;  3X3M A;  3QB3 A;  2J7Z A;  1QNK A;  2HCI A;  3MTS A;  4TSS A;  2X6L A;  1JWU D;  1BF4 A;  4CHT B;  1PDQ A;  1ONL A;  1SE4 A;  2NN6 I;  3VR4 A;  1U9R A;  2WV6 D;  1SSO A;  2FMM A;  1D5X C;  3D8G A;  3LWU A;  5CYU A;  2OT2 A;  1DOM A;  1CZG A;  4K5V A;  2JE6 I;  1F2M A;  4FF1 A;  1SEB D;  1OXT A;  4EVO A;  1YNN C;  4YIJ A;  1D5Z C;  1ZYR C;  2IPK D;  5I9P A;  1HHV A;  5IGD A;  1KLU D;  5IT9 L;  3DWA A;  1ET9 A;  1GUT A;  2PZU A;  4ZLT F;  1U4R A;  1LTI D;  3K0Y A;  4J1M A;  3VA7 A;  1F9S A;  5ISR A;  3VA5 A;  3MXN A;  4LK1 C;  1HCZ A;  4DXF A;  1XX8 A;  1H9M A;  2O2L D;  1LLR D;  2ICI A;  2D62 A;  3DHQ A;  2DN8 A;  1OXX K;  4NKL A;  1D1I A;  3L9A X;  2KCC A;  2FJ2 A;  1F77 A;  4X3U A;  3OHX C;  1HQR D;  4HMJ A;  4TRD A;  1EY4 A;  3FEW X;  5EBD A;  5COY A;  3SK6 A;  2L4N A;  3T16 A;  1JR0 D;  5EKK A;  2RDH A;  1M4V A;  4J8Q A;  1BO0 A;  3KLR A;  1LTR D;  4OO1 H;  2QEJ C;  2E2H B;  3H94 A;  5D65 A;  4XYQ A;  3N52 A;  3R2T A;  3C3L A;  1ILQ A;  2A6H D;  2B8F A;  1I4P A;  3K6O A;  3NK9 A;  4XQQ A;  1L0X B;  1RTN A;  1NCV A;  3PUX A;  3NE5 B;  2A73 B;  1TWH B;  1K8M A;  2VB3 X;  1PTO C;  3U9S A;  2HCC A;  5K5P A;  3VR5 A;  4R8N A;  2EVB A;  2EYM A;  5EPK A;  4B08 A;  5M5X B;  1PRT F;  4ZKC B;  2NB0 A;  1I6H B;  3IFD A;  2F0P A;  1F2Y A;  4RGT A;  1W6K A;  5C6A A;  1HTP A;  1UNS A;  5IGG A;  1U4P A;  2CVR A;  4C1N I;  2Z8L A;  1I6V C;  1PZI D;  1Y8P B;  3OIP A;  2WIN B;  5E4W C;  3KF8 A;  1RD9 D;  2DNC A;  1F9R A;  3TDQ A;  3N6R A;  2NVX B;  1V1P A;  4HCE A;  1PYW D;  1A6X A;  1LT3 D;  1NAP A;  5ELE A;  5JAV A;  3G7L A;  2H1E A;  5EBC A;  2RSN A;  5FO8 B;  3BS1 A;  3HOX B;  1LTG D;  1OXV A;  4RHR A;  3PMF A;  3HOV B;  2LFN A;  3HEJ A;  3EFX D;  1PMR A;  3P20 A;  1B4O A;  2KEC A;  2L9H A;  1GUO A;  5J22 A;  2D5D A;  3GTQ B;  2EYF A;  4KJO A;  1W6J A;  1SJH D;  3MXG A;  5JEA H;  4A3I B;  2F0O A;  1DCZ A;  4PV1 C;  1KTK A;  4HCS A;  1ROD A;  1SYC A;  2F0H A;  2RKS A;  2SEB D;  4GZY C;  1E2Z A;  3K57 A;  4G7H C;  2TSS A;  4HSP A;  1H9K A;  3NBH A;  3TP5 A;  4QIW B;  2F0M A;  1IKL A;  3EJI A;  3HG9 A;  3DMU A;  3P7J A;  1CA5 A;  3J7Y W;  3TZD A;  2CW0 D;  2QF7 A;  2RDF A;  5EKL A;  2K7V A;  4K5W A;  1TR5 A;  1J9O A;  1Y1W B;  3I4N B;  2K1B A;  4IUN A;  1AW7 A;  3MC0 B;  1EZ8 A;  4DNT B;  1ZXT A;  2MGS A;  3OIQ A;  4ME5 A;  1JC7 A;  2C9O A;  2JEA I;  3TP7 A;  1MD2 D;  1XWE A;  3BYT B;  3E5S A;  3BYY B;  5DEH A;  4F8M A;  3Q24 A;  3NTI A;  1LAB A;  3NUC A;  4RGM A;  1BQQ T;  2KCN A;  2A69 C;  4UAI A;  1DZ1 A;  2H4O A;  2CHB D;  1SYG A;  1IW7 D;  3R8B A;  1GXD C;  4TKO B;  1EIG A;  4DF7 A;  2F0L A;  5C0X I;  3UI2 A;  2AQ3 B;  2BE5 C;  3LX0 A;  3NTK A;  5FKA C;  5IOD A;  3RZD B;  1DON A;  3CRL C;  3ND9 A;  3MFG A;  3VYR A;  3D31 A;  3SK4 A;  4DU9 A;  4KD3 A;  4FF2 A;  2R61 A;  1EY7 A;  5I2Y A;  2EJM A;  4CJ1 B;  3LNN A;  1RCV D;  1WVL A;  3M7G A;  3URY A;  3K58 A;  3IFT A;  1GUS A;  1GUN A;  3J7A F;  5IGB A;  1GOZ A;  2E76 C;  3CU7 A;  3KBX A;  4XT3 B;  2A74 C;  3M4Y A;  3T51 B;  3GTL B;  4DN4 M;  1DOL A;  1PRT B;  1HFG A;  3Q22 A;  1HUM A;  4G4K A;  3NP8 A;  4FP5 D;  3GTK B;  3R93 A;  3W2D A;  4WOR A;  1CHP D;  1TS3 A;  5JEA G;  2XWJ B;  5ELF A;  1R9T B;  1PLF A;  3RD4 A;  3A56 A;  1JIC A;  4QB4 A;  1SDF A;  2M9V A;  4JK1 C;  3D4D A;  2B2V A;  3C1F A;  4CKC A;  2YU9 B;  2I07 B;  1Y69 U;  3OSO A;  4A3D B;  2R92 B;  2E2J B;  5M3M B;  5KNB A;  3A7L A;  5J1Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...