1DM0B

Shiga toxin
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
69
structure length
69
Chain Sequence
TPDCVTGKVEYTKYNDDDTFTVKVGDKELFTNRWNLQSLLLSAQITGMTVTIKTNACHNGGGFSEVIFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the holotoxin from Shigella dysenteriae at 2.5 A resolution.
pubmed doi rcsb
source organism Shigella dysenteriae
molecule tags Toxin
molecule keywords SHIGA TOXIN A SUBUNIT
total genus 15
structure length 69
sequence length 69
chains with identical sequence C, D, E, F, G, H, I, J, K
ec nomenclature
pdb deposition date 1999-12-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.70 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1dm0B00
1D1IA 1D1KA 4M1UB 1QOHA 3MXGA 1R4QB 1CZGA 4ULLA 1C4QA 1QNUA 1R4PB 2GA4B 1DM0B 2XSCA 1C48A 1CZWA 2C5CA 2BOSA 1BOSA 1CQFA 4P2CB
chains in the Genus database with same CATH superfamily
2F3VA 3IKJA 4GS3A 2Q2IA 4UDUC 1VQHA 1YNJC 2CWAA 2DJFC 1YJ9A 1W2BA 2XGTA 3KBGA 2XIWA 1JICA 1UE5A 3DEOA 3T51B 3RMHA 1CKOA 2B2YC 3S2HB 4A3DG 1SYCA 3AEVA 3I7FA 4YY3Q 1CUKA 4A3FG 4LFCQ 1HA5A 1X54A 3NPPA 3L9AX 3D6CA 2G9HD 1EQQA 1DJRD 3K0XA 2OQ0A 3GTGH 3M3YB 4DR3Q 3D3RA 4DR3L 3VYSA 1XXGA 2UU9Q 3K81C 1B3AA 2F0LA 1D5ZC 4B3TL 4JV5Q 2QDLA 4N9TA 4BY7G 5EKIA 1PH9A 1KABA 2AUJD 3PF4A 4DAYA 3QIAA 1Q8KA 1LTLA 1WJJA 3FMCA 1EEID 4JI6Q 2AWNA 2FINB 5DNFA 4A3FH 4A3KH 4HTHA 2QEXA 1SEBD 3P7JA 4ZKBB 3HRZC 4HIMA 1BBWA 5D65A 4JPBW 4HAEA 1GUOA 1CHPD 2RDHA 5IWAQ 3EFXD 2CH4W 2B39A 5IE8A 2PZWA 3H6MA 1Y1WH 1EIFA 2KHSA 1I50B 2QILA 4IPHA 5CV5A 2PO4A 1JR0D 1HJPA 1VQDA 2QKIC 3DXJC 4B9XA 3AFPA 1N9WA 4DN4M 2XRSD 3CC4A 3U9SA 1EY9A 1QCBD 5FLMH 3T56B 3GV6A 1SYBA 3VYTA 3NENA 2N55A 4O42A 2EJFC 1Q82C 1B44D 4JI8L 1YNJD 5A2QL 3U4VA 2PQEA 5ELEA 4XT3B 1VF5C 3L2PA 4IFDJ 5JJKA 2A74C 4CGYB 1SMYD 3Q6SA 5COYA 3K5LA 2Z6KA 1O7YA 1TY2A 1XNRQ 1BCPB 1GKHA 5LMUL 2N3SA 4BA1I 3HKSA 2WAQB 5C4XH 1LTBD 1SYFA 4PG3A 4OEMB 3NEMA 4ULLA 4EQOA 2EDGA 4FVMA 3CMEA 2F0JA 4HMIA 4HJ8A 1ZXTA 1Y8PB 1NMGA 5C4JH 4MTKA 1BQQT 3BVMA 4KKSA 2QGQA 5K36H 2CFMA 4K2KA 3BU2A 1PTOF 4AQYL 1STGA 2JYOA 4A93H 4IJLA 2F3WA 1GOZA 1HNXL 5IP9H 4JI7Q 2E2IB 1KTKA 3EQLC 2K01A 1HNZQ 3F2UA 2YTXA 4BY7B 4R4TA 1IKMA 2HD3A 1MSGA 2RHSB 4EVOA 1I4QA 3PUXA 4DUYL 3G6JB 4FO2A 4C3HH 4LF6Q 4Y52H 2L1BA 3HOXB 1J6QA 2KVMA 1KD1C 1SAPA 1WD1A 3V05A 1TT2A 4CHTB 2F0WA 2OTJA 2O5JC 4OX9Q 4A3EG 1MSHA 2CW0D 2E76C 5CV6A 3PCOB 1TU2B 4KY5A 4MIUA 2QDBA 4DV6Q 1JJCB 2K14A 2KCCA 3OOCA 1U0LA 3NTIA 1A6XA 3BZDB 2IW3A 4C3IB 3IFTA 5KNDA 3PIOA 5T1IA 2Q8TA 5NUCA 1XMQQ 2L9HA 4C2MB 1Q81C 1VQBA 1O7LA 4X66Q 3I4MB 1PFMA 3STBD 4OIJA 4FF4A 5AJ3L 1Y14B 2B63H 3R2IA 1BVSA 1L1OA 4IQZA 5GAHC 1GVPA 5KIXA 2Z9HA 3FPUB 4OIKA 1SRUA 5C4HA 1M1KC 3VR3A 2JP1A 2Z6KC 1LUZA 4FYDA 3HOVH 4G7ZC 1VQIA 4JVZA 1G2TA 4XQQA 5I6WA 4PZ7A 2D0OA 4QIWE 1B53A 2QF7A 5EBDA 1SNQA 1E1OA 5JPMC 2EJGC 4LF5Q 4JI5L 1WFQA 4HSPA 1ESRA 1WCMH 1XTCD 2IPKD 1ENAA 2VUMB 2BH2A 1BUVT 2ZXOA 3OWEB 1PA6A 1RODA 1HHVA 4B3SL 4A3MH 1K3BC 4CDEC 3I4OA 1IYJB 4K14A 2I46A 2K4KA 1IBML 1IYUA 2F0OA 4JBKA 1N36Q 1PTOD 1MI2A 2GN5A 1D5MC 2KECA 4IJHA 4NDXA 4EQNA 4A3IB 4YWLA 3I4LA 1STHA 1KAAA 1EQTA 1E7ZA 2N49A 3KF8A 3OW2A 4J6HA 2MO0A 2WV6D 1BR9A 2R92B 1C48A 2PQAB 4A3MG 3IAYA 4L5RC 3I2ZA 4B3MQ 3HZXA 1QILA 4K5XA 1HCZA 1TWFB 2WKDA 4LF8L 4DV7L 2UXBL 3I73A 4R4OA 1Q46A 3NP8A 4AH6A 2HDLA 1HFGA 4ILWA 1XMOQ 2DNEA 5FLMG 1A63A 3W1BA 2ENBA 1K0SA 4JYAQ 4DNRB 5C4XB 4A3GB 2A69C 3M4QA 3PV0A 3F8TA 1BCPC 1PZID 1FNVA 1SR3A 1GUTA 5L37A 1G2SA 4R8NA 3SR1A 4NKLA 1QUQA 4A3JB 3CW2C 2EY6A 3N52A 5DAUA 4JBJA 4O2DA 1F2MA 2KEDA 1X3GA 1YNND 2RBMA 3EN2A 4GLVB 1XNQL 3QWNA 4DU9A 3PQIA 4K0KQ 1D7QA 3I90A 3NELA 3TP7A 4JI0Q 1W3SA 2AMCB 1K83B 4WFN3 3I4NG 4Y7NB 4DUYQ 1XNQQ 3L0OA 4UHVA 5I2YA 1I4HA 2RCFA 3E9HA 3S15H 3SK6A 4CBVA 3K80C 1UE1A 2IJ0A 2VQEL 1XTDA 1E0BA 2ZJRA 3HG9A 3CCUA 2A73B 4DV4Q 1MHWC 1OXXK 1ET6A 1B7YB 3H94A 2XWBB 4ZYSA 1EQVA 3DM3A 3MTSA 4P71A 4O0AA 3S1RH 4R4CA 1HUNA 1VCIA 2CKZB 1TWGB 1VQJA 1VDZA 1SJHD 5KYLA 3IFDA 1E2VA 5J22A 1XMQL 1L0WA 1JB7A 4I7AA 1MKHA 3FKIG 1DZ1A 1IBLQ 4M8AA 1Y1VB 4G57A 1D6EC 5I2XA 4JI4Q 1S5FD 4A3CH 1E2WA 1KDBA 2E2JH 5G3LF 4V190 4BBSH 2RF4A 2L11A 1BNZA 4TVAB 3M7NA 1VQEA 2O4XA 1SNPA 4A3IG 5C4ZA 4JOIC 4QMGA 1WVLA 4BY1H 5E7NA 5IYBG 1LT6D 1NSNS 4K5VA 2DY8A 4A3JH 1TY0A 1SNOA 3I3CA 3F2CA 2EY1A 1KXLA 1N34Q 3ERQA 1SMYC 2BA0A 4A3KG 1TS5A 5IT9E 5GAEC 5JJIA 3AB9A 4UPAA 3MXGA 4MTNA 3J7AV 2UXCQ 4RHRA 2KOLA 2QEJC 4OWWB 2NTSA 2B63G 3NHHA 4N8X1 1JJ2A 3F1ZA 2XRQD 4DV3L 4H44C 3GTKB 4RGOS 1JWMD 1WI5A 1K8AC 3QR8A 1DD2A 1KNEA 3OWFA 1VQ8A 2NVYH 3PO3G 4DK3C 1TKWB 1PTOC 2NN6H 3EBEA 4JI1L 1BXTA 1UE7A 5IYBH 5EBCA 3KFUA 2M00A 1QE6A 4OXPA 2L15A 1XWEA 1KLGD 4GN5A 2YU9H 2F0KA 2MNAA 2KQ3A 3PF5A 2HT1A 2EXDA 1ILPA 1X3PA 5ELBA 3HP3A 2EYLA 1DXMA 2CH4A 1HR0W 4JI6L 3KJPA 1VQAA 4R4QA 2AQ3B 3A56A 4C1NK 5M9OA 1V43A 4OO1G 4DFAA 2ZTDA 3RN2A 4WJ3M 4LUOA 4TSSA 1NR2A 3CHBD 4EX5A 1P8LA 2VNUD 4HIOA 3C3LA 2EZVA 4B3RL 3I56A 1ZKOA 2LS01 4IUTA 4DR1L 1WOCA 2A8VA 4GKKL 4F87A 2JA5G 2KUMA 5C44H 1WTOA 4ZUJA 3M7GA 2PMZB 1YJWA 3G48A 2R6GA 2PNHA 3EVQA 1EOTA 3KF6A 1I94Q 3R3OA 1SFOB 1YJNA 4NP5A 3GTLH 2Y0SG 4POFA 4IUVA 3J81i 1RJTA 1A3UA 1Y1VG 2JSOA 3CRLC 1TVXA 2NN6I 2R7FA 2PI2E 2ALYB 1UEBA 1HZCA 3HKZB 2E5LQ 4PZ6A 4DK0A 3CU7A 2ICEC 2KHJA 4HIKA 2UUBL 2E2HH 5IOCA 3M4YA 1OO9B 2EYJA 4KHZA 3NXWA 2PZTA 2F0NA 3DM1A 1TWCB 4YCWA 4C3HG 1GHJA 2K5NA 5DEHA 1PTOB 2XTIA 2PZUA 3RZDB 2KEEA 1TXYA 4J1MA 2JA6B 2NVQB 3EA6A 2FMMA 3S1NB 2D2CC 1F77A 2A5HA 3GDEA 4KTAA 2Q2HA 1SROA 4P73A 4JW0A 3DMUA 2V4DA 1GD7A 3E0EA 4XYQA 1FNWA 4DAPA 1JMCA 3QO2A 4DXFA 1C0AA 1WTRA 5H1SE 1SE2A 1J8IA 1V8QA 4CDDC 5KNBA 4DV0L 2J4XA 2R7DA 2JA8H 2CQAA 1NR4A 3TRZA 4GOPA 4JYAL 2NVXH 1JOKA 1FJGQ 1ASZA 1B1ZA 3MAQA 2EQSA 1YI2A 1B70B 3H0GG 4LF4Q 5CGKA 1AN8A 1T5XD 4JI2L 3Q23A 2D62A 1K9MC 2LY7A 4KK7A 3A5UA 2ZJPA 4RCNA 3F2DA 2C5CA 1XYIA 1VQLA 2UXBQ 1D8LA 3V2TA 3U4ZA 3HOUB 1OXTA 3NBIA 3HOWB 1STEA 4RAUC 4X3KA 3D4WA 4RG1A 2VL6A 3S17H 2KCTA 4QUFA 2Q8RE 2WFWA 1BO0A 4JI5Q 1QVCA 5M3MH 3RUZA 4A76A 3NQTA 2D5DA 2UUAQ 2JK8A 2B2YA 2PYKA 3FEWX 1F9RA 3TP8A 4LFCL 3HOZH 4A3DB 2JJQA 3NUCA 4KD3A 1CQFA 1B3QA 1RD9D 1TWHH 3AMUA 2F0UA 4B9WA 4DA2A 3SK4A 2NB0A 2DJGC 4IPDA 3BZCA 4OWTB 2L12A 5E4WC 5C3EG 1X32A 2EE1A 4NXMQ 5E1FA 1W6KA 5D3IB 1Q8IA 5M5XB 2IX0A 2B29A 2YV5A 2CVRA 4F88A 3PO2B 2CW0C 1NMFA 5IT9L 4DV0Q 1FYCA 4QCLA 3NWTA 4DV5Q 2UUCQ 4X64Q 3KLSX 4P72A 5M5YH 1UWVA 1TWAH 1Q1BA 5AFWA 1K8MA 1J5EL 4KKTA 4JG2A 1CI3M 3OMGA 3JAMi 1B9NA 2AQ2B 4C3HB 3SK5A 2RSOA 4DR5L 1VQFA 3ICEA 1RF2D 4LMQD 4BY7H 1A15A 4KY6A 3SGIA 1V1OA 3VR6A 4A3BG 3PIO3 1VQNA 1I6VC 2DUDA 2MUYA 4R4IA 1ML0D 4DR6Q 3CRKC 4N9PA 4DK1A 1Q1EA 4C3IH 1BCPD 2K7VA 3NK9A 3CF5A 3M4PA 4IZ8A 1H9SA 2R61A 3HOYG 1SXTA 4ZUIA 2A68C 2HIXA 2RHQB 1LTAD 1CA6A 4ALPA 5ELOA 1Z9FA 4BBRH 3LGJA 2H1EA 2O2LD 3FVQA 1XPRA 3H0GB 2EY5A 1O80A 1ZYRD 2PNRC 3T1YQ 1AE2A 1EY5A 1FR3A 1FL0A 4PQXA 1Z47A 4IUUA 1N33L 1I6HH 2WAQG 2K5HA 4NW2A 1GM5A 1S3OA 4HR7B 3OW7A 4PMBA 5HURA 3TREA 4YIJA 5IGBA 5JEAJ 1KQSA 4JBMA 5IGGA 3RLNA 3HEJA 4OO1I 2F4VQ 1TR5A 2E74C 4K8JA 3S15B 1SE3A 3HFZB 4BBRG 1E3PA 3K7AH 3I4MH 4QF4A 2K50A 4KKUA 3H3VH 2E8GA 1ET9A 5J1ZA 2IT1A 5EQ0A 3S1MH 3H15A 2UUAL 1SE8A 1R4PB 1EYCA 2OTLA 4BXXG 3WDNA 1L0XB 3TP5A 4O1NA 2FHTA 3G71A 4AYBB 3I70A 4MHEA 1TWGH 3CAMA 2JN4A 1BOSA 1NAPA 2RA4A 2QCPX 3Q8DA 5FO7B 3CQZH 1PHJA 3K57A 4GZYC 4BY1G 1PLFA 2B8GA 4DV5L 3MA2B 1DYQA 3J81j 5IYDG 3O13A 1R4QB 2DNCA 3CCRA 1N32L 2NYZD 1LACA 2Z6BA 3F2BA 5LHY1 4A3EB 1VMPA 1K8GA 2X6GA 1CQVA 1HNZL 4XT1B 5IT9c 3SHLA 2F0TA 5FLXE 4BXXH 4EQ5A 1B2TA 3BDOA 3X3NA 2XVSA 2BH8A 5C5MA 2K5QA 2VUMG 2RDGA 1ILQA 4DV6L 4B08A 5C4JB 3UDIA 2PQAA 1DONA 5CV4A 1EU4A 4PNYA 4XXEA 3VA5A 1LM0A 1NY4A 4JI3Q 3S2DB 3EROA 3A7LA 1PDQA 3W2DA 3M85A 5E3FA 4E6IA 4FF1A 4GKKQ 5ELNA 4R1JA 2FXQA 2YTVA 4RA8A 3CCSA 4K0KL 2LFNA 4IUPA 4LWCA 1YNXA 3E5SA 4HJ5A 2RSNA 1QB5D 2AHOB 3T1HL 2ZTCA 1HNWQ 2CCZA 4DR7L 4L5TA 2RVLA 4P74A 3HOWH 3A7AB 1JWSD 5IYCH 1HFNA 1YITA 5C3EH 3Q24A 1YHQA 1S40A 4A3MB 3WOEA 1IW7C 1OXUA 2FJ2A 1CTMA 4JOIA 1Z7TA 2KENA 3T4AC 3OMCA 2JA9A 4A3EH 1IW7D 2PPBC 3K7UC 1AEXA 4LW1A 4GOPB 3U58A 2UU9L 4XIGS 2C35B 4OELB 5GQOA 3GTGB 3M3YH 1QOHA 1G8ZD 1E24A 3ULPA 4JI3L 5JEAH 3GO5A 2ZXPA 4JI1Q 3J80L 4B3RQ 1I50H 1C4QA 1PYSB 4BBRB 3HOVB 2EY2A 2R7ZG 3M4OB 3CCVA 4GNXC 1S72A 4A3GG 1DOKA 3I72A 3W5OA 2Q8IB 1WYDA 2NUCA 1CZWA 3DHQA 3KJOA 2A1AA 4Q0FA 4A3CG 1RTOA 4LFBQ 4LF6L 2MPMA 4H13C 1MBYA 1MGSA 2LSSA 1IBKQ 1H9KA 4DV2Q 1VQ4A 1EYAA 5DLQE 1FGBD 4C2MH 4DR6L 3DWAA 4BS9A 2OWOA 4GNXB 4H7BA 1I5FA 4X66L 3J81L 1N8RC 2RQXA 4DV2L 4ZLTF 3TS0A 2ZXRA 4Q5VA 3OTOL 2SNMA 4GN3B 4K6DA 4MNOA 2LXJA 1UAPA 4L5SA 3DWQA 4DR2L 1YBYA 4HJAA 3A0JA 2I5HA 2EYPA 4JCVE 4KLKA 1N33Q 1QWYA 1SFOH 1ASYA 3CKIB 1RKNA 2V1CC 2L0CA 1JE5A 2IX3A 1D5XC 1PH7A 3JC66 4YCUA 1JOOA 3C46A 2MO1A 4P75A 4BBSG 3VYRA 1IYVA 4ABNA 4GNXA 1LT3D 4J8QA 5LMUQ 1LTSD 1TWFH 4HEDA 1F9SA 2NTTA 3KYHC 1RDPD 3CCJA 3SEBA 1KLUD 4FXKC 3HKZE 2ID0A 5EPLA 4CKCA 5LMNL 3I4NB 2R93G 2YTYA 4X3UA 2HIVA 2JA7G 4YWMA 5AJ3Q 3M4OH 3VA7A 3UE0A 2F0HA 2PCFB 2QW7A 4DAMA 2WIIB 4B3SQ 3E3XA 1H9RA 3HOXH 1E22A 4KY7A 5M3MB 3T1YL 4K8IA 2KCMA 2DY7A 1WTQA 2MQHA 3D4DA 3VR4A 4A3KB 1H95A 2F03A 1SYDA 5G3LD 3DWPA 1NCVA 1YVCA 1PFNA 4YHHL 1PV4A 5IGDA 3GTLB 3TMEA 5C0XI 1V1PA 2A6HC 3RZOB 3J7ZC 2JA5H 2EYMA 4X3SA 3A8KE 3NBHA 3KLWA 2MJ8A 3KUPA 1X56A 5FK9C 4H02A 1QNKA 5CR3A 2B2WA 4CJ1B 3SVMA 3K59A 3A8JE 1M8AA 3GTPB 2RDFA 2LMCB 2SOBA 2F4IA 3KBXA 4KHVA 3P20A 2EIFA 1MIUA 2M2LA 3FHWA 1GUSA 2Z0SA 3H09A 3PSIA 1LV9A 4ME5A 1PMRA 5DM73 5KNCA 4S3SA 3HOZB 1CM9A 4QGUA 1STBA 3SE0A 2B2TA 3ND8A 2Q2UA 1G6ZA 4DAYB 1CT1D 2Q2TA 1CSPA 1ESFA 1PTOH 4KN4C 4LF7Q 4RKLA 1K83H 4N8FA 4DV1Q 1L1OB 3KOJA 2WB1B 1SLJA 1H9MA 3K8AA 2NVTH 2ZJQA 2KBNA 2K5VA 3CXCA 2F4VL 5IYCG 1JORA 1CKNB 1NE3A 3GTKH 4R8IA 4LUZA 3BJUA 5ELCA 1GXDC 3P75A 4GOPC 3SXHA 2RCNA 3G6EA 5F2DA 3J7A5 4OGQC 3LWEA 1D1IA 5HGQA 4B3TQ 1JT8A 4IPGA 1EY0A 5I4DA 4G7HC 1C8CA 3PGZA 3I55A 3ND9A 5EJWA 2F0EA 4JI0L 3WOFA 2X69A 4JI4L 1OTCA 4K6LA 2F1MA 3TZUA 1AZQA 1GUWA 1SNMA 3GV3A 2R7ZH 4XYOA 5FOBB 4FNFA 2VB3X 2OQKA 1HZBA 1BBUA 5FLXL 1WTHA 5JJZA 3C1EA 5LMNQ 1N36L 4U68A 5M3MG 2NBFA 1G91A 3OYYA 3R8BA 3G4SA 1PZJD 1RL2A 5CBAE 2O5IC 3GTOH 3NTKA 1GUNA 3RLFA 1B9MA 2K52A 4X65Q 5GADC 2G5DA 5T1GA 3K5NA 1I4GA 1EU3A 1IBKL 2A68D 4C3JG 2ES2A 1PYWD 2YU9B 3H0GH 1KC8C 1ZEQX 1G51A 2E2IH 2WAQE 4YHHQ 1NBWA 5CBEE 4KV6A 3BS1A 2EVBA 2CWPA 2MHVA 4IOAA 3QOJA 5FKAC 1JWUD 4KHPQ 4G4KA 4ZQ3A 1I4RA 4ZK9B 4I65A 5JOBA 3R2TA 5FLXc 2NWGA 5IYDH 4ID6A 3S24A 2E2DC 1NNXA 2B2VA 3E6ZX 3ULJA 4TQUS 3EIVA 4K2LA 2P5ZX 4DF7A 1E2ZA 5IGCA 3HOZG 4HN7A 4KD4A 3D0FA 1ENCA 1OXVA 1K73C 4JK1C 1A8VA 4RCOA 1O7ZA 1TS2A 1Y1WB 5TSSA 4DV7Q 1HQMC 3GTJH 2XWJB 2JA7H 4RH6A 1HNWL 4A3LG 1Q7YC 1OXSC 3DEPA 4IUQA 1M4VA 1VMCA 3FDTA 4A75A 3SK8A 3HGBA 3K5MA 1YNNC 2F0SA 2A6HD 2L55A 5C44B 3VYUA 2B2WC 3CC7A 4X62L 3RNUA 4WORA 3GP7A 3E9IA 3PO2G 1VQCA 4HCSA 3HOWG 5CV8A 2BCOA 1JCKB 5JAVA 2B8FA 4UP7A 3FKIH 1SYEA 2BDOA 1LT5D 1LTTD 4LF9Q 2JA8G 1CA5A 3T16A 2TSSA 3CCLA 1GUGA 1EZ8A 4P2CB 1EY6A 4A3LH 3D4RA 3OSOA 1S5CD 3S1QB 2EJMA 4OWXB 1QUQB 2IWHA 3S1MB 5K36G 3VR5A 3GTPH 4C56C 3S2DH 1TQOA 2D9UA 3OPOA 4C3IG 3A5ZB 4A93B 1A3VA 5KYIA 3BZKA 5JEAG 4DUZQ 3K7AB 1Y8OB 1B8AA 4EGVA 3HOYH 3MXUA 1EWIA 3I4MG 4NPSA 3G7LA 2EXZA 3BVZA 1H9SB 1X3EA 2AWOA 2SDFA 2NZ1D 5JPNC 5C0XG 3VR2A 1VQOA 4GN4B 3RD4A 3QOLA 4DKAC 4AYBE 2N8NA 1S5DD 3HOYB 5IY0A 3RR5A 4IURA 2R3ZA 4L6TB 2UXCL 4L5QA 2XSCA 1VQ9A 3NE5B 5IIFA 4QIWB 3J7AF 2HQLA 1PH3A 2E75C 1AH9A 1HRJA 4CJ2C 3S1RB 1MJCA 2PI2A 4CKBA 4FXGC 2N78A 4IFDG 4RHSA 4HJ9A 4KI0A 3PUVA 2IHEA 1LT4D 1K3RA 1KDAA 1NJIC 4A3BB 1KNAA 3I91A 1HUMA 2F0MA 3CP0A 4X6AH 1GHKA 4ZCKA 1PRTB 1BDOA 2HHHQ 4HSVA 4RGNA 5E4XA 1IL2A 3TQYA 3MFGA 4LF5L 1Y1WG 2VUMH 2BOSA 3UDFA 3X3MA 1TS3A 4BWGB 4HIDA 4RKBA 1MJEA 2OXPA 2A19A 1A3TA 1AFPA 2NZHA 1VQ5A 1B4OA 2GVBA 1L1OC 3E0JA 1A2TA 1Q90A 1AW7A 1KHIA 1ONLA 2E5LL 2F0FA 4UP9A 2B2UC 1BBXC 4JI2Q 4TRDA 3CMAA 2R92G 2M9VA 5C44G 4AYBG 1PH1A 2L4NA 2I5LX 3H3VI 1YZ6A 1UEAB 1WTPA 4DR7Q 1FGUA 3KLRA 1LLRD 2XNAC 2NZOA 4GLAC 1W6JA 3ZJYC 5M5WB 1QVGA 3OIQA 3TZDA 3PUYA 1WCMB 5C6AA 2JEBI 4H0LC 1EEFD 2BE5C 2ZT9C 4NMZA 3W1GA 1Q3LA 1M90C 1WTXA 1EOVA 1F2YA 2I07B 4YCVA 3KF8B 3GTQH 3S1NH 4B3ML 4A3BH 1K8OA 4BA2I 5ELDA 1X3FA 2I5MX 1Q12A 2VZAA 3ZYYX 2R92H 1KRSA 4APVA 3GTMH 3P1HA 3TEHB 3H3VC 1U4MA 4HCEA 4A3DH 2K75A 5I9OA 4JI8Q 2K6AA 2E2HB 4DGZA 4A3GH 3PUZA 1FD7D 5BR8L 1ICWA 4KJNA 4LUVA 1XMOL 4PV1C 5GAGC 4NB3A 3Q0AA 4DV1L 3S17B 4AQYQ 1VS0A 3ITPA 1QZHA 4TKOB 1AZPA 2JA6H 2WP8J 4LK1C 1II3A 3HOUH 1R9TB 4OONA 1P16A 1CZGA 3BG3A 4RGTA 2HUGA 5EGTA 5C5LA 2HDMA 4X62Q 4Z9CB 3JAML 4WJWA 3NQIA 3C2PA 4X64L 1U4RA 3K5OA 3V96A 3T53B 1PRTD 1H9JA 4MN3A 3LWUA 5CC4A 3S14H 3NWSA 1V1QA 4QJFA 2VB2X 2JQOA 1WTVA 1EY8A 1BCPF 1I4PA 5LMNW 2F0DA 3CPWA 4XTCS 1PH8A 1VQ6A 1IZ6A 3J7YW 2EYHA 4RGMA 3M9BA 4QB4A 2X6LA 4L63B 3KF6B 2UXDL 1YHBA 5M5YB 3GTQB 1IXRA 1SMXA 5IGEA 2R7ZB 3QB3A 5IP7H 4JV5L 3C1FA 5CV9A 2OF1A 1EYGA 1PH6A 1SE4A 2A6ED 2HQEA 1RCVD 1CHQD 1HR0L 2AKWB 4WRDA 4IO9A 1Q86C 1EIYB 1X6OA 3H91A 1CFMA 1KIXA 2C9OA 2F0PA 1O78A 2A69D 1HXYD 5JVG3 4GKJQ 1R9TH 1FNUA 4F7XA 1WD0A 2UXDQ 2J7ZA 4OHJA 3MFYA 4KMUC 3J80c 1WCMG 5IWAL 2K5WA 3UDGA 4U673 4LAAA 1EFWA 4X65L 1K0RA 3HOVG 2LKVA 1PXUA 2B2TC 5BN5A 1JQYD 1HQRD 2OEOA 1EQRA 1CKMA 1QJOA 1DCZA 1I3QH 3U9OA 3W3AA 1YHAA 1T5EA 2K5DA 3MEFA 1D2BA 3J80i 3MC0B 5C3EB 3NBHB 3QJYA 3NSWA 4IFDH 2H5XA 4FF3A 4QY7A 3UDXA 1PRTC 5EPJA 1XJVA 4POGA 1DOMA 2JXMB 3PIPA 1JE4A 2K33A 1TIID 3MEHA 3RZOH 1Y8NB 4IALA 1KL9A 1SN8A 1SYGA 2WINB 2AQ1B 2UUCL 1TWCH 4LFAQ 4A4IA 3HOXG 2F3IA 3CD6A 1B50A 2ZTEA 2KA7A 4PZ8A 2IX1A 1I6HB 2WKCA 5FO9B 4QUCA 1KRTA 2F0IA 4V0BA 5BR8Q 1IHZA 2OCEA 2LXKA 1EYDA 1STNA 3ERSX 2GA4B 3MWYW 4AIMA 2PW7A 3JAME 1LYLA 2B3GA 3TDQA 3URYA 1IKLA 2JE6I 2K28A 5DM63 2F0GA 4BBSB 1RIPA 3L3OC 3A8IE 5CMDA 2I0QA 1YEZA 1X55A 1EWHA 3AFQA 5EAYA 5M5WH 4DUZL 3RN5A 2K05A 4JBWA 1LTRD 3HKZG 3MXNB 1HTLD 3A54A 1PRTF 2R93B 5JVH3 1BF4A 1DM0B 2B2UA 3J81E 1IBLL 1F2LA 3KDFB 1GJXA 3MXPA 2BA1A 4YY3L 1HTPA 1VQPA 3STBC 2K03A 4F8MA 1RTNA 3CQZB 1U9RA 1TWHB 1X65A 1NTGA 1HH2P 1F2ZA 1YIJA 3I4NH 4LF9L 4HJ7A 1NUCA 3TN2A 4DAVA 2H4OA 1IBMQ 4EQPA 1FJGL 1PZKD 4Y7NH 3SDZA 3CPFA 2VQEQ 3J80E 2XN9C 2Z4HA 1QNUA 5D14A 4RWSC 5I9PA 1J9OA 2NVTB 1E1TA 3JAMc 2HCCA 2QA4A 2EYFA 1Y1VH 3BDLA 3FP9A 4UP8A 4LF7L 2CHBD 3IL8A 2FFKB 2DGYA 4IFDI 4JC0A 3EJIA 5BN4A 3K58A 1VQMA 3S16B 2WB1G 4QQBX 3MVVA 1EIHA 3OHXC 1HA6A 2ATWA 3KK7A 5LL6X 1K28A 1PVOA 5J39A 1EL0A 2WACA 4OX9L 4C1NI 2RKSA 1I4XA 1VF7A 5BN3A 2B2VC 3ULLA 1F9QA 4XDXA 1DOLA 4XQNA 1PFBA 1HR0Q 3OTOQ 1UNSA 4ZRZA 1IL8A 1EY4A 2IL8A 3A74A 2N88A 1DGSA 5CORA 1SNDA 5KRUA 3MZ5A 3R93A 4A3IH 5IODA 3GTOB 1XPOA 3S14B 4CDCC 3BYTB 3Q22A 2YYZA 2UUBQ 4JI7L 1U4LA 4KJOA 3CCQA 4NXML 4BY1B 4CDFC 3D8GA 4DNIA 3TS2A 4DR5Q 3S9WA 1U4PA 2A6EC 3BYYB 1VQKA 1WTWA 2NVQH 2KHIA 3VDYA 3AU7A 2VXWA 3RLOA 4DPGA 2VY3A 1LTGD 2F52A 1L0YB 2SNSA 5C4XG 1STYA 1RHPA 1C7YA 1AE3A 1JB3A 3PMFA 2ASBA 4ODGA 2HHHL 3BDCA 3CCMA 3CCEA 1CK1A 4A3JG 5LL6S 1EUJA 3UI2A 1EFID 3TSSA 1L2FA 4DV3Q 3FKIB 2AUKA 2ICIA 3GTMB 4C3JB 4RFBA 3TP6A 2TMPA 3L7ZC 4DR4L 1ICFB 4LF4L 1EZ6A 2PMZE 1PFSA 2K04A 4DV4L 5IP9G 1G6PA 4NXNL 3UE1A 4IUNA 1GO3E 3PIP3 4J15A 1D1KA 5J3BA 1EWCA 2HCIA 3NTHA 4FDBA 3K0YA 2ZM6Q 5EKKA 3OIPA 1N34L 2IHFA 5JJLA 1JJGA 2J0TD 3CC2A 2Y0SE 1PH5A 1I3QB 4ZAIA 5ELFA 4CKEA 5ISRA 4XQJA 5KEEA 1STAA 1V1PB 5EPKA 1UE6A 3KDFA 3GTJB 1JC7A 3AQQA 3N6RA 3MXNA 3ER0A 2Z1CA 4DR2Q 2B63B 1F9PA 2G9DA 5CV7A 3GQBA 4M1UB 4ZKCB 3J81c 4DK6C 1QG7A 1S4ZA 2F0VA 3T13A 3LX0A 1S5ED 3DLLA 1PH2A 1QZGA 3PO3B 5C0XH 4FXDA 4FP5D 2Z8LA 1XX8A 3GD7A 4DXGA 3PO2H 2BE5D 1BKBA 2NVYB 3QG1A 4RMFA 2EPBA 2Z4IA 2CQOA 5CYUA 2KCNA 2EOTA 4FF2A 4KHPL 3D6WA 2FMCA 5IGFA 1J5EQ 1KDCA 1LABA 1ZYRC 3T1HQ 4IN3A 5M3FG 2MFIA 3FRPB 1HZ9A 4IPCA 2MP1A 1Y69U 1A2UA 3I8ZA 3PUWA 1SSOA 1VQ7A 5FJ8H 2JA8B 3KLSA 5GROA 5FO8B 2R93H 1SDFA 5D3DA 2F0QA 2ZM6L 1X9NA 1A62A 4A3FB 3AYHB 2EYOA 2BDNA 4DNTB 2L5TA 2JA5B 1A0IA 1Z6HA 3ONAB 3RZDH 4G7OC 1KAWA 4C3JH 1LO5D 5C0XJ 1AP0A 5M3FH 2E2JB 3B6YA 4IOCA 3PO3H 5IP7G 2NN6G 4GKJL 4WJ4A 1C9OA 5FJ8G 2KJXA 4GLXA 5I6YA 1EY7A 5K5PA 4LFAL 3WWVA 4UY8C 5A35A 3S1QH 2VS1A 5HGTA 2JA7B 1S5BD 2D0PA 1CSQA 4K5WA 5EKLA 2K1BA 3S2HH 1HZAA 4ME3A 1QVFA 2OT2A 1XNRL 5HY6A 3K6OA 1SBBB 4LJZC 4X3TA 4YWKA 5C3XA 1SJED 4A93G 2VQFQ 1XPUA 3S16H 1LTID 2SEBD 4R9WA 2WB1E 1X3QA 1SNCA 4UAIA 3DUZA 3HS0C 2VQFL 2Y0SB 1HNXQ 2MGSA 3LNNA 4OL7A 4DR4Q 1N32Q 3TBIB 4MZ9A 1UUPA 4LFBL 1G291 4LNQA 1PYBA 5M5XH 1VQGA 4PMWA 1T9HA 1O7IA 4LF8Q 1V9PA 2IY5B 3IRBA 1TWAB 3MHBA 4CJ0B 1ENFA 5A2QE 1U5KA 1I94L 3FPPA 4I7ZC 2VW9A 3D31A 3A55A 2NVXB 3U50C 5C3WA 2DN8A 2PW5A 4PMCA 4DR1Q 1HPCA 4L8JA 4HMJA 4QL5A 4OO1H 2JA6G 4KN7C 3HOUG 1FVIA 1CKNA 5KGUA 2JEAI 5M3FB 2K32A 1TS4A 1JOQA 1MD2D 1PH4A 2GVAA 4NXNQ 1EIGA 3BVGA
chains in the Genus database with same CATH topology
2F3VA 3IKJA 4UDUC 1YNJC 3KBGA 2XIWA 1JICA 3DEOA 3T51B 3RMHA 2B2YC 3S2HB 1SYCA 1HA5A 3NPPA 3L9AX 3D6CA 2G9HD 1DJRD 3M3YB 3D3RA 3VYSA 1XXGA 1B3AA 2F0LA 1D5ZC 4N9TA 5EKIA 1KABA 2AUJD 4DAYA 3QIAA 3FMCA 1EEID 2AWNA 2FINB 5DNFA 4HTHA 1SEBD 3P7JA 4ZKBB 3HRZC 5D65A 4HAEA 1GUOA 1CHPD 2RDHA 3EFXD 2B39A 2PZWA 3H6MA 2KHSA 1I50B 2QILA 5CV5A 2PO4A 1JR0D 2QKIC 3DXJC 4B9XA 4DN4M 2XRSD 3U9SA 1EY9A 1QCBD 3T56B 3GV6A 1SYBA 3VYTA 2N55A 4O42A 2EJFC 1B44D 1YNJD 5A2QL 2PQEA 5ELEA 4XT3B 1VF5C 4IFDJ 2A74C 4CGYB 1SMYD 3Q6SA 5COYA 3K5LA 1O7YA 1TY2A 1BCPB 4BA1I 2WAQB 1LTBD 1SYFA 4ULLA 4EQOA 2EDGA 4FVMA 2F0JA 4HMIA 1ZXTA 1Y8PB 1BQQT 3BVMA 4KKSA 5K36H 4K2KA 1PTOF 1STGA 2JYOA 2F3WA 1GOZA 2E2IB 1KTKA 3EQLC 2K01A 3F2UA 4BY7B 1IKMA 1MSGA 4EVOA 1I4QA 3PUXA 3G6JB 4FO2A 2L1BA 3HOXB 2KVMA 1SAPA 1WD1A 3V05A 1TT2A 4CHTB 2F0WA 2O5JC 1MSHA 2CW0D 2E76C 5CV6A 1TU2B 4KY5A 4MIUA 2QDBA 2KCCA 3OOCA 3NTIA 1A6XA 3BZDB 2IW3A 4C3IB 3IFTA 5KNDA 5T1IA 2Q8TA 5NUCA 2L9HA 4C2MB 1O7LA 3I4MB 1PFMA 4OIJA 4FF4A 3R2IA 4IQZA 5KIXA 3FPUB 4OIKA 5C4HA 3VR3A 2JP1A 4FYDA 4G7ZC 1G2TA 4XQQA 5I6WA 1B53A 2QF7A 5EBDA 1SNQA 5JPMC 2EJGC 4HSPA 1ESRA 1XTCD 2IPKD 1ENAA 2VUMB 1BUVT 2ZXOA 3OWEB 1RODA 1HHVA 4K14A 2I46A 1IYUA 2F0OA 1PTOD 1MI2A 1D5MC 2KECA 4NDXA 4EQNA 4A3IB 3I4LA 1STHA 1KAAA 1EQTA 3KF8A 4J6HA 2WV6D 1BR9A 2R92B 1C48A 3IAYA 3HZXA 1QILA 4K5XA 1HCZA 1TWFB 2WKDA 3I73A 3NP8A 2HDLA 1HFGA 4ILWA 2DNEA 2ENBA 4DNRB 5C4XB 4A3GB 2A69C 3PV0A 1BCPC 1PZID 1FNVA 1GUTA 1G2SA 4R8NA 3SR1A 4NKLA 4A3JB 2EY6A 3N52A 5DAUA 1F2MA 2KEDA 1YNND 2RBMA 3QWNA 4DU9A 3I90A 3TP7A 1K83B 4WFN3 4Y7NB 5I2YA 1I4HA 3SK6A 4CBVA 2IJ0A 1E0BA 3HG9A 2A73B 1OXXK 1ET6A 3H94A 2XWBB 4ZYSA 1EQVA 3MTSA 1HUNA 1VCIA 1TWGB 1VDZA 1SJHD 5KYLA 3IFDA 1E2VA 5J22A 1DZ1A 4M8AA 1Y1VB 4G57A 1D6EC 5I2XA 1S5FD 1E2WA 1KDBA 4V190 5G3LF 2L11A 1BNZA 3M7NA 2O4XA 1SNPA 5C4ZA 4QMGA 1WVLA 1LT6D 1NSNS 4K5VA 2DY8A 1TY0A 1SNOA 3I3CA 2EY1A 3ERQA 1SMYC 2BA0A 1TS5A 5IT9E 3AB9A 3MXGA 3J7AV 4RHRA 2KOLA 2QEJC 2NTSA 3NHHA 2XRQD 4H44C 3GTKB 4RGOS 1JWMD 1DD2A 1KNEA 3OWFA 1TKWB 1PTOC 2NN6H 1BXTA 5EBCA 2M00A 1QE6A 1XWEA 1KLGD 2F0KA 2KQ3A 1ILPA 1X3PA 5ELBA 3HP3A 2EYLA 1DXMA 2AQ3B 3A56A 4C1NK 5M9OA 1V43A 4OO1G 4DFAA 4TSSA 1NR2A 3CHBD 2VNUD 3C3LA 2EZVA 1ZKOA 2LS01 4IUTA 4F87A 2KUMA 1WTOA 4ZUJA 3M7GA 2PMZB 2R6GA 3EVQA 1EOTA 3R3OA 1SFOB 4NP5A 4IUVA 1RJTA 1A3UA 2JSOA 3CRLC 1TVXA 2NN6I 3HKZB 4DK0A 3CU7A 2ICEC 5IOCA 3M4YA 1OO9B 2EYJA 2PZTA 3NXWA 4KHZA 2F0NA 3DM1A 1TWCB 4C3HG 1GHJA 5DEHA 1PTOB 2PZUA 3RZDB 2KEEA 4J1MA 2JA6B 2NVQB 3EA6A 2FMMA 3S1NB 2D2CC 1F77A 2A5HA 4KTAA 3DMUA 4XYQA 2V4DA 1FNWA 4DAPA 3QO2A 4DXFA 1WTRA 1SE2A 1J8IA 1V8QA 5KNBA 2J4XA 2CQAA 1NR4A 1JOKA 1B1ZA 3MAQA 5CGKA 1AN8A 1T5XD 3Q23A 2D62A 2LY7A 4KK7A 4RCNA 2C5CA 1XYIA 3V2TA 3HOUB 1OXTA 3NBIA 3HOWB 1STEA 4RAUC 4X3KA 3D4WA 4QUFA 2Q8RE 1BO0A 3RUZA 3NQTA 2D5DA 2B2YA 2PYKA 3FEWX 1F9RA 3TP8A 4A3DB 3NUCA 4KD3A 1CQFA 1RD9D 3AMUA 2F0UA 4B9WA 4DA2A 3SK4A 2NB0A 2L12A 5E4WC 1X32A 2EE1A 5E1FA 1W6KA 5D3IB 1Q8IA 5M5XB 2IX0A 2CVRA 4F88A 3PO2B 2CW0C 5IT9L 1FYCA 4QCLA 3NWTA 3KLSX 5AFWA 1Q1BA 1K8MA 4KKTA 1CI3M 3OMGA 1B9NA 2AQ2B 4C3HB 3SK5A 2RSOA 1RF2D 4LMQD 1A15A 4KY6A 1V1OA 3VR6A 3PIO3 1I6VC 2MUYA 1ML0D 3CRKC 4N9PA 4DK1A 1Q1EA 1BCPD 2K7VA 3NK9A 4IZ8A 1H9SA 2R61A 1SXTA 4ZUIA 2A68C 1LTAD 1CA6A 2H1EA 2O2LD 3FVQA 3H0GB 2EY5A 1O80A 1ZYRD 2PNRC 1EY5A 1FR3A 4PQXA 1Z47A 4IUUA 4NW2A 4HR7B 3OW7A 4PMBA 5HURA 4YIJA 5IGBA 5JEAJ 5IGGA 3HEJA 4OO1I 1TR5A 2E74C 4K8JA 3S15B 1SE3A 4QF4A 4KKUA 1ET9A 5J1ZA 2IT1A 5EQ0A 1R4PB 1EYCA 3WDNA 1L0XB 3TP5A 4O1NA 2FHTA 4AYBB 3I70A 4MHEA 1BOSA 1NAPA 2RA4A 2QCPX 5FO7B 3K57A 4GZYC 1PLFA 2B8GA 3MA2B 1DYQA 3O13A 1R4QB 2DNCA 2NYZD 1LACA 5LHY1 4A3EB 1VMPA 2X6GA 1CQVA 4XT1B 3SHLA 2F0TA 5FLXE 1B2TA 3BDOA 3X3NA 2XVSA 5C5MA 2K5QA 2RDGA 1ILQA 4B08A 5C4JB 1DONA 5CV4A 1EU4A 4PNYA 4XXEA 3VA5A 3S2DB 3EROA 3A7LA 1PDQA 3W2DA 3M85A 5E3FA 4E6IA 4FF1A 4RA8A 2LFNA 4IUPA 3E5SA 2RSNA 1QB5D 2RVLA 3A7AB 1JWSD 1HFNA 3Q24A 4A3MB 3WOEA 1IW7C 1OXUA 2FJ2A 1CTMA 1Z7TA 3T4AC 3OMCA 1IW7D 2PPBC 1AEXA 4XIGS 3GTGB 1QOHA 1G8ZD 5JEAH 3GO5A 2ZXPA 3J80L 1C4QA 3HOVB 4BBRB 2EY2A 3M4OB 1DOKA 3I72A 2Q8IB 2NUCA 1CZWA 3DHQA 4Q0FA 1RTOA 2MPMA 4H13C 1MBYA 1MGSA 1H9KA 1EYAA 1FGBD 3DWAA 4BS9A 4H7BA 3J81L 2RQXA 4ZLTF 2ZXRA 4Q5VA 2SNMA 4K6DA 1UAPA 3DWQA 2EYPA 1QWYA 3CKIB 1RKNA 2L0CA 2IX3A 1D5XC 1JOOA 3C46A 3VYRA 1IYVA 4ABNA 1LT3D 4J8QA 1LTSD 4HEDA 1F9SA 2NTTA 1RDPD 3SEBA 1KLUD 4FXKC 2ID0A 5EPLA 4CKCA 3I4NB 4X3UA 3VA7A 2F0HA 2PCFB 2WIIB 1H9RA 4KY7A 5M3MB 1WTQA 4K8IA 2DY7A 3D4DA 3VR4A 4A3KB 2F03A 1SYDA 5G3LD 3DWPA 1NCVA 1PFNA 3GTLB 5IGDA 3TMEA 5C0XI 1V1PA 2A6HC 3RZOB 2EYMA 4X3SA 3A8KE 3NBHA 2MJ8A 3KUPA 5FK9C 1QNKA 5CR3A 2B2WA 4CJ1B 3SVMA 3K59A 3A8JE 1M8AA 3GTPB 2RDFA 2LMCB 2SOBA 2F4IA 3KBXA 4KHVA 3P20A 2M2LA 1GUSA 3H09A 4ME5A 1LV9A 1PMRA 5DM73 5KNCA 4S3SA 3HOZB 1CM9A 1STBA 3SE0A 2B2TA 3ND8A 1G6ZA 1CT1D 1ESFA 1PTOH 4KN4C 4RKLA 2WB1B 1H9MA 1JORA 4R8IA 5ELCA 1GXDC 3P75A 3SXHA 5F2DA 4OGQC 3LWEA 1D1IA 1EY0A 5I4DA 4G7HC 1C8CA 3ND9A 5EJWA 2F0EA 3WOFA 2X69A 4K6LA 2F1MA 3TZUA 1AZQA 1GUWA 1SNMA 3GV3A 4XYOA 5FOBB 4FNFA 2VB3X 5FLXL 5JJZA 3C1EA 4U68A 2NBFA 1G91A 3R8BA 1PZJD 5CBAE 2O5IC 3NTKA 1GUNA 3RLFA 1B9MA 5T1GA 3K5NA 1I4GA 1EU3A 2A68D 4C3JG 1PYWD 2YU9B 1ZEQX 5CBEE 4KV6A 3BS1A 2EVBA 2MHVA 3QOJA 5FKAC 1JWUD 4G4KA 4ZQ3A 1I4RA 4ZK9B 4I65A 5JOBA 3R2TA 2NWGA 4ID6A 2E2DC 2B2VA 3E6ZX 4TQUS 4K2LA 4DF7A 1E2ZA 5IGCA 4HN7A 4KD4A 1ENCA 1OXVA 4JK1C 4RCOA 1O7ZA 1TS2A 1Y1WB 5TSSA 1HQMC 2XWJB 4RH6A 1OXSC 3DEPA 4IUQA 1M4VA 1VMCA 3FDTA 3SK8A 3HGBA 3K5MA 1YNNC 2F0SA 2A6HD 2L55A 5C44B 3VYUA 2B2WC 4WORA 3GP7A 4HCSA 5CV8A 2BCOA 1JCKB 5JAVA 2B8FA 1SYEA 2BDOA 1LT5D 1LTTD 1CA5A 3T16A 2TSSA 1GUGA 1EZ8A 4P2CB 1EY6A 3D4RA 3OSOA 1S5CD 3S1QB 2EJMA 2IWHA 3S1MB 5K36G 3VR5A 4C56C 1TQOA 2D9UA 3OPOA 4C3IG 4A93B 1A3VA 5KYIA 5JEAG 3K7AB 1Y8OB 4EGVA 3MXUA 3G7LA 2EXZA 3BVZA 1H9SB 2AWOA 2SDFA 2NZ1D 5JPNC 5C0XG 3VR2A 3RD4A 3QOLA 1S5DD 3HOYB 4IURA 2R3ZA 4L6TB 2XSCA 3NE5B 5IIFA 4QIWB 3J7AF 2E75C 1HRJA 4CJ2C 3S1RB 4CKBA 4FXGC 4IFDG 4RHSA 4KI0A 3PUVA 1LT4D 1KDAA 4A3BB 1KNAA 3I91A 1HUMA 2F0MA 1GHKA 1PRTB 1BDOA 4HSVA 4RGNA 5E4XA 3MFGA 2BOSA 3X3MA 1TS3A 4BWGB 4RKBA 2OXPA 1A3TA 1AFPA 1B4OA 3E0JA 1A2TA 1Q90A 1AW7A 1ONLA 2F0FA 2B2UC 1BBXC 4TRDA 2M9VA 2L4NA 1UEAB 1WTPA 3KLRA 1LLRD 2XNAC 5M5WB 1W6JA 3OIQA 3TZDA 3PUYA 1WCMB 5C6AA 2JEBI 4H0LC 1EEFD 2BE5C 2ZT9C 4NMZA 1Q3LA 1WTXA 1F2YA 2I07B 1K8OA 4BA2I 5ELDA 1Q12A 3ZYYX 3P1HA 3H3VC 1U4MA 4HCEA 5I9OA 2K6AA 2E2HB 4DGZA 3PUZA 1FD7D 1ICWA 4KJNA 4PV1C 3S17B 3Q0AA 3ITPA 4TKOB 1AZPA 2WP8J 4LK1C 1II3A 1R9TB 1CZGA 3BG3A 4RGTA 2HUGA 5EGTA 5C5LA 2HDMA 4Z9CB 3JAML 4WJWA 3NQIA 3C2PA 1U4RA 3K5OA 3V96A 3T53B 1PRTD 1H9JA 4MN3A 3LWUA 5CC4A 3NWSA 2VB2X 1WTVA 1EY8A 1BCPF 1I4PA 2F0DA 4XTCS 3J7YW 2EYHA 4RGMA 4QB4A 2X6LA 4L63B 5M5YB 3GTQB 5IGEA 2R7ZB 3QB3A 3C1FA 5CV9A 2OF1A 1SE4A 2A6ED 2HQEA 1RCVD 1CHQD 4WRDA 3H91A 1CFMA 2C9OA 2F0PA 1O78A 2A69D 1HXYD 5JVG3 1FNUA 4F7XA 1WD0A 2J7ZA 4OHJA 3MFYA 4KMUC 2K5WA 4U673 4LAAA 2LKVA 1PXUA 2B2TC 5BN5A 1JQYD 1HQRD 2OEOA 1QJOA 1DCZA 3U9OA 3W3AA 1T5EA 2K5DA 1D2BA 3MC0B 5C3EB 3QJYA 3NSWA 4IFDH 4FF3A 1PRTC 5EPJA 1DOMA 2JXMB 1JE4A 2K33A 1TIID 3MEHA 1Y8NB 4IALA 1SYGA 2WINB 2AQ1B 1B50A 2KA7A 2IX1A 1I6HB 2WKCA 5FO9B 4QUCA 2F0IA 4V0BA 1IHZA 1EYDA 1STNA 3MWYW 2GA4B 2PW7A 3JAME 3TDQA 3URYA 1IKLA 2JE6I 2K28A 5DM63 2F0GA 4BBSB 3L3OC 3A8IE 5CMDA 1EWHA 2K05A 4JBWA 1LTRD 1HTLD 3A54A 1PRTF 2R93B 5JVH3 1BF4A 1DM0B 2B2UA 3J81E 1F2LA 1GJXA 3MXPA 2BA1A 1HTPA 4F8MA 2K03A 1RTNA 3CQZB 1U9RA 1TWHB 1F2ZA 1NUCA 3TN2A 4DAVA 2H4OA 4EQPA 1PZKD 3SDZA 3J80E 2XN9C 2Z4HA 1QNUA 5D14A 4RWSC 5I9PA 1J9OA 2NVTB 2HCCA 2EYFA 3BDLA 2CHBD 3IL8A 2FFKB 4IFDI 3EJIA 5BN4A 3K58A 3S16B 3MVVA 1EIHA 3OHXC 1HA6A 3KK7A 5LL6X 1EL0A 5J39A 2WACA 4C1NI 2RKSA 1I4XA 1VF7A 5BN3A 2B2VC 1F9QA 4XDXA 1DOLA 4XQNA 1PFBA 1UNSA 4ZRZA 1IL8A 1EY4A 2IL8A 2N88A 5CORA 5KRUA 1SNDA 3MZ5A 3R93A 5IODA 3GTOB 3S14B 3BYTB 3Q22A 2YYZA 1U4LA 4KJOA 4BY1B 3D8GA 3S9WA 1U4PA 2A6EC 3BYYB 1WTWA 3AU7A 2VXWA 1LTGD 1L0YB 2SNSA 1STYA 1RHPA 3PMFA 1JB3A 4ODGA 3BDCA 1CK1A 5LL6S 3UI2A 1EFID 3TSSA 3FKIB 2AUKA 2ICIA 3GTMB 4C3JB 4RFBA 3TP6A 2TMPA 3L7ZC 1EZ6A 2K04A 4IUNA 3PIP3 1D1KA 1EWCA 2HCIA 3NTHA 3K0YA 5EKKA 3OIPA 2J0TD 1I3QB 4ZAIA 5ELFA 4XQJA 4CKEA 5ISRA 5KEEA 1STAA 1V1PB 5EPKA 3GTJB 1JC7A 3MXNA 3N6RA 2Z1CA 2B63B 1F9PA 2G9DA 5CV7A 3GQBA 4M1UB 4ZKCB 1QG7A 1S4ZA 2F0VA 3T13A 3LX0A 1S5ED 3PO3B 5C0XH 4FXDA 4FP5D 2Z8LA 4DXGA 1XX8A 3GD7A 2BE5D 2NVYB 3QG1A 2EPBA 2Z4IA 5CYUA 2KCNA 2EOTA 4FF2A 3D6WA 2FMCA 5IGFA 1KDCA 1LABA 1ZYRC 4IN3A 3FRPB 2MP1A 1Y69U 1A2UA 3I8ZA 3PUWA 1SSOA 2JA8B 3KLSA 5FO8B 1SDFA 5D3DA 2F0QA 4A3FB 2EYOA 2BDNA 4DNTB 2L5TA 2JA5B 1Z6HA 3ONAB 4G7OC 1LO5D 5C0XJ 1AP0A 2E2JB 2NN6G 2KJXA 5I6YA 1EY7A 5K5PA 5A35A 5HGTA 2JA7B 1S5BD 4K5WA 5EKLA 2K1BA 2OT2A 3K6OA 1SBBB 4LJZC 4X3TA 5C3XA 1SJED 1LTID 2SEBD 4R9WA 1X3QA 1SNCA 4UAIA 3DUZA 3HS0C 2Y0SB 2MGSA 3LNNA 4OL7A 3TBIB 1UUPA 1G291 4PMWA 1TWAB 3MHBA 4CJ0B 1ENFA 5A2QE 3FPPA 4I7ZC 3D31A 3A55A 2NVXB 5C3WA 2DN8A 2PW5A 4PMCA 1HPCA 4L8JA 4HMJA 4OO1H 4KN7C 5KGUA 2JEAI 5M3FB 2K32A 1TS4A 1JOQA 1MD2D 1EIGA 3BVGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1D1I A;  1D1K A;  4M1U B;  1QOH A;  3MXG A;  1R4Q B;  1CZG A;  4ULL A;  1C4Q A;  1QNU A;  1R4P B;  2GA4 B;  1DM0 B;  2XSC A;  1C48 A;  1CZW A;  2C5C A;  2BOS A;  1BOS A;  1CQF A;  4P2C B; 
#chains in the Genus database with same CATH topology
 2F3V A;  3IKJ A;  4GS3 A;  2Q2I A;  4UDU C;  1VQH A;  1YNJ C;  2CWA A;  2DJF C;  1YJ9 A;  1W2B A;  2XGT A;  3KBG A;  2XIW A;  1JIC A;  1UE5 A;  3DEO A;  3T51 B;  3RMH A;  1CKO A;  2B2Y C;  3S2H B;  4A3D G;  1SYC A;  3AEV A;  3I7F A;  4YY3 Q;  1CUK A;  4A3F G;  4LFC Q;  1HA5 A;  1X54 A;  3NPP A;  3L9A X;  3D6C A;  2G9H D;  1EQQ A;  1DJR D;  3K0X A;  2OQ0 A;  3GTG H;  3M3Y B;  4DR3 Q;  3D3R A;  4DR3 L;  3VYS A;  1XXG A;  2UU9 Q;  3K81 C;  1B3A A;  2F0L A;  1D5Z C;  4B3T L;  4JV5 Q;  2QDL A;  4N9T A;  4BY7 G;  5EKI A;  1PH9 A;  1KAB A;  2AUJ D;  3PF4 A;  4DAY A;  3QIA A;  1Q8K A;  1LTL A;  1WJJ A;  3FMC A;  1EEI D;  4JI6 Q;  2AWN A;  2FIN B;  5DNF A;  4A3F H;  4A3K H;  4HTH A;  2QEX A;  1SEB D;  3P7J A;  4ZKB B;  3HRZ C;  4HIM A;  1BBW A;  5D65 A;  4JPB W;  4HAE A;  1GUO A;  1CHP D;  2RDH A;  5IWA Q;  3EFX D;  2CH4 W;  2B39 A;  5IE8 A;  2PZW A;  3H6M A;  1Y1W H;  1EIF A;  2KHS A;  1I50 B;  2QIL A;  4IPH A;  5CV5 A;  2PO4 A;  1JR0 D;  1HJP A;  1VQD A;  2QKI C;  3DXJ C;  4B9X A;  3AFP A;  1N9W A;  4DN4 M;  2XRS D;  3CC4 A;  3U9S A;  1EY9 A;  1QCB D;  5FLM H;  3T56 B;  3GV6 A;  1SYB A;  3VYT A;  3NEN A;  2N55 A;  4O42 A;  2EJF C;  1Q82 C;  1B44 D;  4JI8 L;  1YNJ D;  5A2Q L;  3U4V A;  2PQE A;  5ELE A;  4XT3 B;  1VF5 C;  3L2P A;  4IFD J;  5JJK A;  2A74 C;  4CGY B;  1SMY D;  3Q6S A;  5COY A;  3K5L A;  2Z6K A;  1O7Y A;  1TY2 A;  1XNR Q;  1BCP B;  1GKH A;  5LMU L;  2N3S A;  4BA1 I;  3HKS A;  2WAQ B;  5C4X H;  1LTB D;  1SYF A;  4PG3 A;  4OEM B;  3NEM A;  4ULL A;  4EQO A;  2EDG A;  4FVM A;  3CME A;  2F0J A;  4HMI A;  4HJ8 A;  1ZXT A;  1Y8P B;  1NMG A;  5C4J H;  4MTK A;  1BQQ T;  3BVM A;  4KKS A;  2QGQ A;  5K36 H;  2CFM A;  4K2K A;  3BU2 A;  1PTO F;  4AQY L;  1STG A;  2JYO A;  4A93 H;  4IJL A;  2F3W A;  1GOZ A;  1HNX L;  5IP9 H;  4JI7 Q;  2E2I B;  1KTK A;  3EQL C;  2K01 A;  1HNZ Q;  3F2U A;  2YTX A;  4BY7 B;  4R4T A;  1IKM A;  2HD3 A;  1MSG A;  2RHS B;  4EVO A;  1I4Q A;  3PUX A;  4DUY L;  3G6J B;  4FO2 A;  4C3H H;  4LF6 Q;  4Y52 H;  2L1B A;  3HOX B;  1J6Q A;  2KVM A;  1KD1 C;  1SAP A;  1WD1 A;  3V05 A;  1TT2 A;  4CHT B;  2F0W A;  2OTJ A;  2O5J C;  4OX9 Q;  4A3E G;  1MSH A;  2CW0 D;  2E76 C;  5CV6 A;  3PCO B;  1TU2 B;  4KY5 A;  4MIU A;  2QDB A;  4DV6 Q;  1JJC B;  2K14 A;  2KCC A;  3OOC A;  1U0L A;  3NTI A;  1A6X A;  3BZD B;  2IW3 A;  4C3I B;  3IFT A;  5KND A;  3PIO A;  5T1I A;  2Q8T A;  5NUC A;  1XMQ Q;  2L9H A;  4C2M B;  1Q81 C;  1VQB A;  1O7L A;  4X66 Q;  3I4M B;  1PFM A;  3STB D;  4OIJ A;  4FF4 A;  5AJ3 L;  1Y14 B;  2B63 H;  3R2I A;  1BVS A;  1L1O A;  4IQZ A;  5GAH C;  1GVP A;  5KIX A;  2Z9H A;  3FPU B;  4OIK A;  1SRU A;  5C4H A;  1M1K C;  3VR3 A;  2JP1 A;  2Z6K C;  1LUZ A;  4FYD A;  3HOV H;  4G7Z C;  1VQI A;  4JVZ A;  1G2T A;  4XQQ A;  5I6W A;  4PZ7 A;  2D0O A;  4QIW E;  1B53 A;  2QF7 A;  5EBD A;  1SNQ A;  1E1O A;  5JPM C;  2EJG C;  4LF5 Q;  4JI5 L;  1WFQ A;  4HSP A;  1ESR A;  1WCM H;  1XTC D;  2IPK D;  1ENA A;  2VUM B;  2BH2 A;  1BUV T;  2ZXO A;  3OWE B;  1PA6 A;  1ROD A;  1HHV A;  4B3S L;  4A3M H;  1K3B C;  4CDE C;  3I4O A;  1IYJ B;  4K14 A;  2I46 A;  2K4K A;  1IBM L;  1IYU A;  2F0O A;  4JBK A;  1N36 Q;  1PTO D;  1MI2 A;  2GN5 A;  1D5M C;  2KEC A;  4IJH A;  4NDX A;  4EQN A;  4A3I B;  4YWL A;  3I4L A;  1STH A;  1KAA A;  1EQT A;  1E7Z A;  2N49 A;  3KF8 A;  3OW2 A;  4J6H A;  2MO0 A;  2WV6 D;  1BR9 A;  2R92 B;  1C48 A;  2PQA B;  4A3M G;  3IAY A;  4L5R C;  3I2Z A;  4B3M Q;  3HZX A;  1QIL A;  4K5X A;  1HCZ A;  1TWF B;  2WKD A;  4LF8 L;  4DV7 L;  2UXB L;  3I73 A;  4R4O A;  1Q46 A;  3NP8 A;  4AH6 A;  2HDL A;  1HFG A;  4ILW A;  1XMO Q;  2DNE A;  5FLM G;  1A63 A;  3W1B A;  2ENB A;  1K0S A;  4JYA Q;  4DNR B;  5C4X B;  4A3G B;  2A69 C;  3M4Q A;  3PV0 A;  3F8T A;  1BCP C;  1PZI D;  1FNV A;  1SR3 A;  1GUT A;  5L37 A;  1G2S A;  4R8N A;  3SR1 A;  4NKL A;  1QUQ A;  4A3J B;  3CW2 C;  2EY6 A;  3N52 A;  5DAU A;  4JBJ A;  4O2D A;  1F2M A;  2KED A;  1X3G A;  1YNN D;  2RBM A;  3EN2 A;  4GLV B;  1XNQ L;  3QWN A;  4DU9 A;  3PQI A;  4K0K Q;  1D7Q A;  3I90 A;  3NEL A;  3TP7 A;  4JI0 Q;  1W3S A;  2AMC B;  1K83 B;  4WFN 3;  3I4N G;  4Y7N B;  4DUY Q;  1XNQ Q;  3L0O A;  4UHV A;  5I2Y A;  1I4H A;  2RCF A;  3E9H A;  3S15 H;  3SK6 A;  4CBV A;  3K80 C;  1UE1 A;  2IJ0 A;  2VQE L;  1XTD A;  1E0B A;  2ZJR A;  3HG9 A;  3CCU A;  2A73 B;  4DV4 Q;  1MHW C;  1OXX K;  1ET6 A;  1B7Y B;  3H94 A;  2XWB B;  4ZYS A;  1EQV A;  3DM3 A;  3MTS A;  4P71 A;  4O0A A;  3S1R H;  4R4C A;  1HUN A;  1VCI A;  2CKZ B;  1TWG B;  1VQJ A;  1VDZ A;  1SJH D;  5KYL A;  3IFD A;  1E2V A;  5J22 A;  1XMQ L;  1L0W A;  1JB7 A;  4I7A A;  1MKH A;  3FKI G;  1DZ1 A;  1IBL Q;  4M8A A;  1Y1V B;  4G57 A;  1D6E C;  5I2X A;  4JI4 Q;  1S5F D;  4A3C H;  1E2W A;  1KDB A;  2E2J H;  5G3L F;  4V19 0;  4BBS H;  2RF4 A;  2L11 A;  1BNZ A;  4TVA B;  3M7N A;  1VQE A;  2O4X A;  1SNP A;  4A3I G;  5C4Z A;  4JOI C;  4QMG A;  1WVL A;  4BY1 H;  5E7N A;  5IYB G;  1LT6 D;  1NSN S;  4K5V A;  2DY8 A;  4A3J H;  1TY0 A;  1SNO A;  3I3C A;  3F2C A;  2EY1 A;  1KXL A;  1N34 Q;  3ERQ A;  1SMY C;  2BA0 A;  4A3K G;  1TS5 A;  5IT9 E;  5GAE C;  5JJI A;  3AB9 A;  4UPA A;  3MXG A;  4MTN A;  3J7A V;  2UXC Q;  4RHR A;  2KOL A;  2QEJ C;  4OWW B;  2NTS A;  2B63 G;  3NHH A;  4N8X 1;  1JJ2 A;  3F1Z A;  2XRQ D;  4DV3 L;  4H44 C;  3GTK B;  4RGO S;  1JWM D;  1WI5 A;  1K8A C;  3QR8 A;  1DD2 A;  1KNE A;  3OWF A;  1VQ8 A;  2NVY H;  3PO3 G;  4DK3 C;  1TKW B;  1PTO C;  2NN6 H;  3EBE A;  4JI1 L;  1BXT A;  1UE7 A;  5IYB H;  5EBC A;  3KFU A;  2M00 A;  1QE6 A;  4OXP A;  2L15 A;  1XWE A;  1KLG D;  4GN5 A;  2YU9 H;  2F0K A;  2MNA A;  2KQ3 A;  3PF5 A;  2HT1 A;  2EXD A;  1ILP A;  1X3P A;  5ELB A;  3HP3 A;  2EYL A;  1DXM A;  2CH4 A;  1HR0 W;  4JI6 L;  3KJP A;  1VQA A;  4R4Q A;  2AQ3 B;  3A56 A;  4C1N K;  5M9O A;  1V43 A;  4OO1 G;  4DFA A;  2ZTD A;  3RN2 A;  4WJ3 M;  4LUO A;  4TSS A;  1NR2 A;  3CHB D;  4EX5 A;  1P8L A;  2VNU D;  4HIO A;  3C3L A;  2EZV A;  4B3R L;  3I56 A;  1ZKO A;  2LS0 1;  4IUT A;  4DR1 L;  1WOC A;  2A8V A;  4GKK L;  4F87 A;  2JA5 G;  2KUM A;  5C44 H;  1WTO A;  4ZUJ A;  3M7G A;  2PMZ B;  1YJW A;  3G48 A;  2R6G A;  2PNH A;  3EVQ A;  1EOT A;  3KF6 A;  1I94 Q;  3R3O A;  1SFO B;  1YJN A;  4NP5 A;  3GTL H;  2Y0S G;  4POF A;  4IUV A;  3J81 i;  1RJT A;  1A3U A;  1Y1V G;  2JSO A;  3CRL C;  1TVX A;  2NN6 I;  2R7F A;  2PI2 E;  2ALY B;  1UEB A;  1HZC A;  3HKZ B;  2E5L Q;  4PZ6 A;  4DK0 A;  3CU7 A;  2ICE C;  2KHJ A;  4HIK A;  2UUB L;  2E2H H;  5IOC A;  3M4Y A;  1OO9 B;  2EYJ A;  4KHZ A;  3NXW A;  2PZT A;  2F0N A;  3DM1 A;  1TWC B;  4YCW A;  4C3H G;  1GHJ A;  2K5N A;  5DEH A;  1PTO B;  2XTI A;  2PZU A;  3RZD B;  2KEE A;  1TXY A;  4J1M A;  2JA6 B;  2NVQ B;  3EA6 A;  2FMM A;  3S1N B;  2D2C C;  1F77 A;  2A5H A;  3GDE A;  4KTA A;  2Q2H A;  1SRO A;  4P73 A;  4JW0 A;  3DMU A;  2V4D A;  1GD7 A;  3E0E A;  4XYQ A;  1FNW A;  4DAP A;  1JMC A;  3QO2 A;  4DXF A;  1C0A A;  1WTR A;  5H1S E;  1SE2 A;  1J8I A;  1V8Q A;  4CDD C;  5KNB A;  4DV0 L;  2J4X A;  2R7D A;  2JA8 H;  2CQA A;  1NR4 A;  3TRZ A;  4GOP A;  4JYA L;  2NVX H;  1JOK A;  1FJG Q;  1ASZ A;  1B1Z A;  3MAQ A;  2EQS A;  1YI2 A;  1B70 B;  3H0G G;  4LF4 Q;  5CGK A;  1AN8 A;  1T5X D;  4JI2 L;  3Q23 A;  2D62 A;  1K9M C;  2LY7 A;  4KK7 A;  3A5U A;  2ZJP A;  4RCN A;  3F2D A;  2C5C A;  1XYI A;  1VQL A;  2UXB Q;  1D8L A;  3V2T A;  3U4Z A;  3HOU B;  1OXT A;  3NBI A;  3HOW B;  1STE A;  4RAU C;  4X3K A;  3D4W A;  4RG1 A;  2VL6 A;  3S17 H;  2KCT A;  4QUF A;  2Q8R E;  2WFW A;  1BO0 A;  4JI5 Q;  1QVC A;  5M3M H;  3RUZ A;  4A76 A;  3NQT A;  2D5D A;  2UUA Q;  2JK8 A;  2B2Y A;  2PYK A;  3FEW X;  1F9R A;  3TP8 A;  4LFC L;  3HOZ H;  4A3D B;  2JJQ A;  3NUC A;  4KD3 A;  1CQF A;  1B3Q A;  1RD9 D;  1TWH H;  3AMU A;  2F0U A;  4B9W A;  4DA2 A;  3SK4 A;  2NB0 A;  2DJG C;  4IPD A;  3BZC A;  4OWT B;  2L12 A;  5E4W C;  5C3E G;  1X32 A;  2EE1 A;  4NXM Q;  5E1F A;  1W6K A;  5D3I B;  1Q8I A;  5M5X B;  2IX0 A;  2B29 A;  2YV5 A;  2CVR A;  4F88 A;  3PO2 B;  2CW0 C;  1NMF A;  5IT9 L;  4DV0 Q;  1FYC A;  4QCL A;  3NWT A;  4DV5 Q;  2UUC Q;  4X64 Q;  3KLS X;  4P72 A;  5M5Y H;  1UWV A;  1TWA H;  1Q1B A;  5AFW A;  1K8M A;  1J5E L;  4KKT A;  4JG2 A;  1CI3 M;  3OMG A;  3JAM i;  1B9N A;  2AQ2 B;  4C3H B;  3SK5 A;  2RSO A;  4DR5 L;  1VQF A;  3ICE A;  1RF2 D;  4LMQ D;  4BY7 H;  1A15 A;  4KY6 A;  3SGI A;  1V1O A;  3VR6 A;  4A3B G;  3PIO 3;  1VQN A;  1I6V C;  2DUD A;  2MUY A;  4R4I A;  1ML0 D;  4DR6 Q;  3CRK C;  4N9P A;  4DK1 A;  1Q1E A;  4C3I H;  1BCP D;  2K7V A;  3NK9 A;  3CF5 A;  3M4P A;  4IZ8 A;  1H9S A;  2R61 A;  3HOY G;  1SXT A;  4ZUI A;  2A68 C;  2HIX A;  2RHQ B;  1LTA D;  1CA6 A;  4ALP A;  5ELO A;  1Z9F A;  4BBR H;  3LGJ A;  2H1E A;  2O2L D;  3FVQ A;  1XPR A;  3H0G B;  2EY5 A;  1O80 A;  1ZYR D;  2PNR C;  3T1Y Q;  1AE2 A;  1EY5 A;  1FR3 A;  1FL0 A;  4PQX A;  1Z47 A;  4IUU A;  1N33 L;  1I6H H;  2WAQ G;  2K5H A;  4NW2 A;  1GM5 A;  1S3O A;  4HR7 B;  3OW7 A;  4PMB A;  5HUR A;  3TRE A;  4YIJ A;  5IGB A;  5JEA J;  1KQS A;  4JBM A;  5IGG A;  3RLN A;  3HEJ A;  4OO1 I;  2F4V Q;  1TR5 A;  2E74 C;  4K8J A;  3S15 B;  1SE3 A;  3HFZ B;  4BBR G;  1E3P A;  3K7A H;  3I4M H;  4QF4 A;  2K50 A;  4KKU A;  3H3V H;  2E8G A;  1ET9 A;  5J1Z A;  2IT1 A;  5EQ0 A;  3S1M H;  3H15 A;  2UUA L;  1SE8 A;  1R4P B;  1EYC A;  2OTL A;  4BXX G;  3WDN A;  1L0X B;  3TP5 A;  4O1N A;  2FHT A;  3G71 A;  4AYB B;  3I70 A;  4MHE A;  1TWG H;  3CAM A;  2JN4 A;  1BOS A;  1NAP A;  2RA4 A;  2QCP X;  3Q8D A;  5FO7 B;  3CQZ H;  1PHJ A;  3K57 A;  4GZY C;  4BY1 G;  1PLF A;  2B8G A;  4DV5 L;  3MA2 B;  1DYQ A;  3J81 j;  5IYD G;  3O13 A;  1R4Q B;  2DNC A;  3CCR A;  1N32 L;  2NYZ D;  1LAC A;  2Z6B A;  3F2B A;  5LHY 1;  4A3E B;  1VMP A;  1K8G A;  2X6G A;  1CQV A;  1HNZ L;  4XT1 B;  5IT9 c;  3SHL A;  2F0T A;  5FLX E;  4BXX H;  4EQ5 A;  1B2T A;  3BDO A;  3X3N A;  2XVS A;  2BH8 A;  5C5M A;  2K5Q A;  2VUM G;  2RDG A;  1ILQ A;  4DV6 L;  4B08 A;  5C4J B;  3UDI A;  2PQA A;  1DON A;  5CV4 A;  1EU4 A;  4PNY A;  4XXE A;  3VA5 A;  1LM0 A;  1NY4 A;  4JI3 Q;  3S2D B;  3ERO A;  3A7L A;  1PDQ A;  3W2D A;  3M85 A;  5E3F A;  4E6I A;  4FF1 A;  4GKK Q;  5ELN A;  4R1J A;  2FXQ A;  2YTV A;  4RA8 A;  3CCS A;  4K0K L;  2LFN A;  4IUP A;  4LWC A;  1YNX A;  3E5S A;  4HJ5 A;  2RSN A;  1QB5 D;  2AHO B;  3T1H L;  2ZTC A;  1HNW Q;  2CCZ A;  4DR7 L;  4L5T A;  2RVL A;  4P74 A;  3HOW H;  3A7A B;  1JWS D;  5IYC H;  1HFN A;  1YIT A;  5C3E H;  3Q24 A;  1YHQ A;  1S40 A;  4A3M B;  3WOE A;  1IW7 C;  1OXU A;  2FJ2 A;  1CTM A;  4JOI A;  1Z7T A;  2KEN A;  3T4A C;  3OMC A;  2JA9 A;  4A3E H;  1IW7 D;  2PPB C;  3K7U C;  1AEX A;  4LW1 A;  4GOP B;  3U58 A;  2UU9 L;  4XIG S;  2C35 B;  4OEL B;  5GQO A;  3GTG B;  3M3Y H;  1QOH A;  1G8Z D;  1E24 A;  3ULP A;  4JI3 L;  5JEA H;  3GO5 A;  2ZXP A;  4JI1 Q;  3J80 L;  4B3R Q;  1I50 H;  1C4Q A;  1PYS B;  4BBR B;  3HOV B;  2EY2 A;  2R7Z G;  3M4O B;  3CCV A;  4GNX C;  1S72 A;  4A3G G;  1DOK A;  3I72 A;  3W5O A;  2Q8I B;  1WYD A;  2NUC A;  1CZW A;  3DHQ A;  3KJO A;  2A1A A;  4Q0F A;  4A3C G;  1RTO A;  4LFB Q;  4LF6 L;  2MPM A;  4H13 C;  1MBY A;  1MGS A;  2LSS A;  1IBK Q;  1H9K A;  4DV2 Q;  1VQ4 A;  1EYA A;  5DLQ E;  1FGB D;  4C2M H;  4DR6 L;  3DWA A;  4BS9 A;  2OWO A;  4GNX B;  4H7B A;  1I5F A;  4X66 L;  3J81 L;  1N8R C;  2RQX A;  4DV2 L;  4ZLT F;  3TS0 A;  2ZXR A;  4Q5V A;  3OTO L;  2SNM A;  4GN3 B;  4K6D A;  4MNO A;  2LXJ A;  1UAP A;  4L5S A;  3DWQ A;  4DR2 L;  1YBY A;  4HJA A;  3A0J A;  2I5H A;  2EYP A;  4JCV E;  4KLK A;  1N33 Q;  1QWY A;  1SFO H;  1ASY A;  3CKI B;  1RKN A;  2V1C C;  2L0C A;  1JE5 A;  2IX3 A;  1D5X C;  1PH7 A;  3JC6 6;  4YCU A;  1JOO A;  3C46 A;  2MO1 A;  4P75 A;  4BBS G;  3VYR A;  1IYV A;  4ABN A;  4GNX A;  1LT3 D;  4J8Q A;  5LMU Q;  1LTS D;  1TWF H;  4HED A;  1F9S A;  2NTT A;  3KYH C;  1RDP D;  3CCJ A;  3SEB A;  1KLU D;  4FXK C;  3HKZ E;  2ID0 A;  5EPL A;  4CKC A;  5LMN L;  3I4N B;  2R93 G;  2YTY A;  4X3U A;  2HIV A;  2JA7 G;  4YWM A;  5AJ3 Q;  3M4O H;  3VA7 A;  3UE0 A;  2F0H A;  2PCF B;  2QW7 A;  4DAM A;  2WII B;  4B3S Q;  3E3X A;  1H9R A;  3HOX H;  1E22 A;  4KY7 A;  5M3M B;  3T1Y L;  4K8I A;  2KCM A;  2DY7 A;  1WTQ A;  2MQH A;  3D4D A;  3VR4 A;  4A3K B;  1H95 A;  2F03 A;  1SYD A;  5G3L D;  3DWP A;  1NCV A;  1YVC A;  1PFN A;  4YHH L;  1PV4 A;  5IGD A;  3GTL B;  3TME A;  5C0X I;  1V1P A;  2A6H C;  3RZO B;  3J7Z C;  2JA5 H;  2EYM A;  4X3S A;  3A8K E;  3NBH A;  3KLW A;  2MJ8 A;  3KUP A;  1X56 A;  5FK9 C;  4H02 A;  1QNK A;  5CR3 A;  2B2W A;  4CJ1 B;  3SVM A;  3K59 A;  3A8J E;  1M8A A;  3GTP B;  2RDF A;  2LMC B;  2SOB A;  2F4I A;  3KBX A;  4KHV A;  3P20 A;  2EIF A;  1MIU A;  2M2L A;  3FHW A;  1GUS A;  2Z0S A;  3H09 A;  3PSI A;  1LV9 A;  4ME5 A;  1PMR A;  5DM7 3;  5KNC A;  4S3S A;  3HOZ B;  1CM9 A;  4QGU A;  1STB A;  3SE0 A;  2B2T A;  3ND8 A;  2Q2U A;  1G6Z A;  4DAY B;  1CT1 D;  2Q2T A;  1CSP A;  1ESF A;  1PTO H;  4KN4 C;  4LF7 Q;  4RKL A;  1K83 H;  4N8F A;  4DV1 Q;  1L1O B;  3KOJ A;  2WB1 B;  1SLJ A;  1H9M A;  3K8A A;  2NVT H;  2ZJQ A;  2KBN A;  2K5V A;  3CXC A;  2F4V L;  5IYC G;  1JOR A;  1CKN B;  1NE3 A;  3GTK H;  4R8I A;  4LUZ A;  3BJU A;  5ELC A;  1GXD C;  3P75 A;  4GOP C;  3SXH A;  2RCN A;  3G6E A;  5F2D A;  3J7A 5;  4OGQ C;  3LWE A;  1D1I A;  5HGQ A;  4B3T Q;  1JT8 A;  4IPG A;  1EY0 A;  5I4D A;  4G7H C;  1C8C A;  3PGZ A;  3I55 A;  3ND9 A;  5EJW A;  2F0E A;  4JI0 L;  3WOF A;  2X69 A;  4JI4 L;  1OTC A;  4K6L A;  2F1M A;  3TZU A;  1AZQ A;  1GUW A;  1SNM A;  3GV3 A;  2R7Z H;  4XYO A;  5FOB B;  4FNF A;  2VB3 X;  2OQK A;  1HZB A;  1BBU A;  5FLX L;  1WTH A;  5JJZ A;  3C1E A;  5LMN Q;  1N36 L;  4U68 A;  5M3M G;  2NBF A;  1G91 A;  3OYY A;  3R8B A;  3G4S A;  1PZJ D;  1RL2 A;  5CBA E;  2O5I C;  3GTO H;  3NTK A;  1GUN A;  3RLF A;  1B9M A;  2K52 A;  4X65 Q;  5GAD C;  2G5D A;  5T1G A;  3K5N A;  1I4G A;  1EU3 A;  1IBK L;  2A68 D;  4C3J G;  2ES2 A;  1PYW D;  2YU9 B;  3H0G H;  1KC8 C;  1ZEQ X;  1G51 A;  2E2I H;  2WAQ E;  4YHH Q;  1NBW A;  5CBE E;  4KV6 A;  3BS1 A;  2EVB A;  2CWP A;  2MHV A;  4IOA A;  3QOJ A;  5FKA C;  1JWU D;  4KHP Q;  4G4K A;  4ZQ3 A;  1I4R A;  4ZK9 B;  4I65 A;  5JOB A;  3R2T A;  5FLX c;  2NWG A;  5IYD H;  4ID6 A;  3S24 A;  2E2D C;  1NNX A;  2B2V A;  3E6Z X;  3ULJ A;  4TQU S;  3EIV A;  4K2L A;  2P5Z X;  4DF7 A;  1E2Z A;  5IGC A;  3HOZ G;  4HN7 A;  4KD4 A;  3D0F A;  1ENC A;  1OXV A;  1K73 C;  4JK1 C;  1A8V A;  4RCO A;  1O7Z A;  1TS2 A;  1Y1W B;  5TSS A;  4DV7 Q;  1HQM C;  3GTJ H;  2XWJ B;  2JA7 H;  4RH6 A;  1HNW L;  4A3L G;  1Q7Y C;  1OXS C;  3DEP A;  4IUQ A;  1M4V A;  1VMC A;  3FDT A;  4A75 A;  3SK8 A;  3HGB A;  3K5M A;  1YNN C;  2F0S A;  2A6H D;  2L55 A;  5C44 B;  3VYU A;  2B2W C;  3CC7 A;  4X62 L;  3RNU A;  4WOR A;  3GP7 A;  3E9I A;  3PO2 G;  1VQC A;  4HCS A;  3HOW G;  5CV8 A;  2BCO A;  1JCK B;  5JAV A;  2B8F A;  4UP7 A;  3FKI H;  1SYE A;  2BDO A;  1LT5 D;  1LTT D;  4LF9 Q;  2JA8 G;  1CA5 A;  3T16 A;  2TSS A;  3CCL A;  1GUG A;  1EZ8 A;  4P2C B;  1EY6 A;  4A3L H;  3D4R A;  3OSO A;  1S5C D;  3S1Q B;  2EJM A;  4OWX B;  1QUQ B;  2IWH A;  3S1M B;  5K36 G;  3VR5 A;  3GTP H;  4C56 C;  3S2D H;  1TQO A;  2D9U A;  3OPO A;  4C3I G;  3A5Z B;  4A93 B;  1A3V A;  5KYI A;  3BZK A;  5JEA G;  4DUZ Q;  3K7A B;  1Y8O B;  1B8A A;  4EGV A;  3HOY H;  3MXU A;  1EWI A;  3I4M G;  4NPS A;  3G7L A;  2EXZ A;  3BVZ A;  1H9S B;  1X3E A;  2AWO A;  2SDF A;  2NZ1 D;  5JPN C;  5C0X G;  3VR2 A;  1VQO A;  4GN4 B;  3RD4 A;  3QOL A;  4DKA C;  4AYB E;  2N8N A;  1S5D D;  3HOY B;  5IY0 A;  3RR5 A;  4IUR A;  2R3Z A;  4L6T B;  2UXC L;  4L5Q A;  2XSC A;  1VQ9 A;  3NE5 B;  5IIF A;  4QIW B;  3J7A F;  2HQL A;  1PH3 A;  2E75 C;  1AH9 A;  1HRJ A;  4CJ2 C;  3S1R B;  1MJC A;  2PI2 A;  4CKB A;  4FXG C;  2N78 A;  4IFD G;  4RHS A;  4HJ9 A;  4KI0 A;  3PUV A;  2IHE A;  1LT4 D;  1K3R A;  1KDA A;  1NJI C;  4A3B B;  1KNA A;  3I91 A;  1HUM A;  2F0M A;  3CP0 A;  4X6A H;  1GHK A;  4ZCK A;  1PRT B;  1BDO A;  2HHH Q;  4HSV A;  4RGN A;  5E4X A;  1IL2 A;  3TQY A;  3MFG A;  4LF5 L;  1Y1W G;  2VUM H;  2BOS A;  3UDF A;  3X3M A;  1TS3 A;  4BWG B;  4HID A;  4RKB A;  1MJE A;  2OXP A;  2A19 A;  1A3T A;  1AFP A;  2NZH A;  1VQ5 A;  1B4O A;  2GVB A;  1L1O C;  3E0J A;  1A2T A;  1Q90 A;  1AW7 A;  1KHI A;  1ONL A;  2E5L L;  2F0F A;  4UP9 A;  2B2U C;  1BBX C;  4JI2 Q;  4TRD A;  3CMA A;  2R92 G;  2M9V A;  5C44 G;  4AYB G;  1PH1 A;  2L4N A;  2I5L X;  3H3V I;  1YZ6 A;  1UEA B;  1WTP A;  4DR7 Q;  1FGU A;  3KLR A;  1LLR D;  2XNA C;  2NZO A;  4GLA C;  1W6J A;  3ZJY C;  5M5W B;  1QVG A;  3OIQ A;  3TZD A;  3PUY A;  1WCM B;  5C6A A;  2JEB I;  4H0L C;  1EEF D;  2BE5 C;  2ZT9 C;  4NMZ A;  3W1G A;  1Q3L A;  1M90 C;  1WTX A;  1EOV A;  1F2Y A;  2I07 B;  4YCV A;  3KF8 B;  3GTQ H;  3S1N H;  4B3M L;  4A3B H;  1K8O A;  4BA2 I;  5ELD A;  1X3F A;  2I5M X;  1Q12 A;  2VZA A;  3ZYY X;  2R92 H;  1KRS A;  4APV A;  3GTM H;  3P1H A;  3TEH B;  3H3V C;  1U4M A;  4HCE A;  4A3D H;  2K75 A;  5I9O A;  4JI8 Q;  2K6A A;  2E2H B;  4DGZ A;  4A3G H;  3PUZ A;  1FD7 D;  5BR8 L;  1ICW A;  4KJN A;  4LUV A;  1XMO L;  4PV1 C;  5GAG C;  4NB3 A;  3Q0A A;  4DV1 L;  3S17 B;  4AQY Q;  1VS0 A;  3ITP A;  1QZH A;  4TKO B;  1AZP A;  2JA6 H;  2WP8 J;  4LK1 C;  1II3 A;  3HOU H;  1R9T B;  4OON A;  1P16 A;  1CZG A;  3BG3 A;  4RGT A;  2HUG A;  5EGT A;  5C5L A;  2HDM A;  4X62 Q;  4Z9C B;  3JAM L;  4WJW A;  3NQI A;  3C2P A;  4X64 L;  1U4R A;  3K5O A;  3V96 A;  3T53 B;  1PRT D;  1H9J A;  4MN3 A;  3LWU A;  5CC4 A;  3S14 H;  3NWS A;  1V1Q A;  4QJF A;  2VB2 X;  2JQO A;  1WTV A;  1EY8 A;  1BCP F;  1I4P A;  5LMN W;  2F0D A;  3CPW A;  4XTC S;  1PH8 A;  1VQ6 A;  1IZ6 A;  3J7Y W;  2EYH A;  4RGM A;  3M9B A;  4QB4 A;  2X6L A;  4L63 B;  3KF6 B;  2UXD L;  1YHB A;  5M5Y B;  3GTQ B;  1IXR A;  1SMX A;  5IGE A;  2R7Z B;  3QB3 A;  5IP7 H;  4JV5 L;  3C1F A;  5CV9 A;  2OF1 A;  1EYG A;  1PH6 A;  1SE4 A;  2A6E D;  2HQE A;  1RCV D;  1CHQ D;  1HR0 L;  2AKW B;  4WRD A;  4IO9 A;  1Q86 C;  1EIY B;  1X6O A;  3H91 A;  1CFM A;  1KIX A;  2C9O A;  2F0P A;  1O78 A;  2A69 D;  1HXY D;  5JVG 3;  4GKJ Q;  1R9T H;  1FNU A;  4F7X A;  1WD0 A;  2UXD Q;  2J7Z A;  4OHJ A;  3MFY A;  4KMU C;  3J80 c;  1WCM G;  5IWA L;  2K5W A;  3UDG A;  4U67 3;  4LAA A;  1EFW A;  4X65 L;  1K0R A;  3HOV G;  2LKV A;  1PXU A;  2B2T C;  5BN5 A;  1JQY D;  1HQR D;  2OEO A;  1EQR A;  1CKM A;  1QJO A;  1DCZ A;  1I3Q H;  3U9O A;  3W3A A;  1YHA A;  1T5E A;  2K5D A;  3MEF A;  1D2B A;  3J80 i;  3MC0 B;  5C3E B;  3NBH B;  3QJY A;  3NSW A;  4IFD H;  2H5X A;  4FF3 A;  4QY7 A;  3UDX A;  1PRT C;  5EPJ A;  1XJV A;  4POG A;  1DOM A;  2JXM B;  3PIP A;  1JE4 A;  2K33 A;  1TII D;  3MEH A;  3RZO H;  1Y8N B;  4IAL A;  1KL9 A;  1SN8 A;  1SYG A;  2WIN B;  2AQ1 B;  2UUC L;  1TWC H;  4LFA Q;  4A4I A;  3HOX G;  2F3I A;  3CD6 A;  1B50 A;  2ZTE A;  2KA7 A;  4PZ8 A;  2IX1 A;  1I6H B;  2WKC A;  5FO9 B;  4QUC A;  1KRT A;  2F0I A;  4V0B A;  5BR8 Q;  1IHZ A;  2OCE A;  2LXK A;  1EYD A;  1STN A;  3ERS X;  2GA4 B;  3MWY W;  4AIM A;  2PW7 A;  3JAM E;  1LYL A;  2B3G A;  3TDQ A;  3URY A;  1IKL A;  2JE6 I;  2K28 A;  5DM6 3;  2F0G A;  4BBS B;  1RIP A;  3L3O C;  3A8I E;  5CMD A;  2I0Q A;  1YEZ A;  1X55 A;  1EWH A;  3AFQ A;  5EAY A;  5M5W H;  4DUZ L;  3RN5 A;  2K05 A;  4JBW A;  1LTR D;  3HKZ G;  3MXN B;  1HTL D;  3A54 A;  1PRT F;  2R93 B;  5JVH 3;  1BF4 A;  1DM0 B;  2B2U A;  3J81 E;  1IBL L;  1F2L A;  3KDF B;  1GJX A;  3MXP A;  2BA1 A;  4YY3 L;  1HTP A;  1VQP A;  3STB C;  2K03 A;  4F8M A;  1RTN A;  3CQZ B;  1U9R A;  1TWH B;  1X65 A;  1NTG A;  1HH2 P;  1F2Z A;  1YIJ A;  3I4N H;  4LF9 L;  4HJ7 A;  1NUC A;  3TN2 A;  4DAV A;  2H4O A;  1IBM Q;  4EQP A;  1FJG L;  1PZK D;  4Y7N H;  3SDZ A;  3CPF A;  2VQE Q;  3J80 E;  2XN9 C;  2Z4H A;  1QNU A;  5D14 A;  4RWS C;  5I9P A;  1J9O A;  2NVT B;  1E1T A;  3JAM c;  2HCC A;  2QA4 A;  2EYF A;  1Y1V H;  3BDL A;  3FP9 A;  4UP8 A;  4LF7 L;  2CHB D;  3IL8 A;  2FFK B;  2DGY A;  4IFD I;  4JC0 A;  3EJI A;  5BN4 A;  3K58 A;  1VQM A;  3S16 B;  2WB1 G;  4QQB X;  3MVV A;  1EIH A;  3OHX C;  1HA6 A;  2ATW A;  3KK7 A;  5LL6 X;  1K28 A;  1PVO A;  5J39 A;  1EL0 A;  2WAC A;  4OX9 L;  4C1N I;  2RKS A;  1I4X A;  1VF7 A;  5BN3 A;  2B2V C;  3ULL A;  1F9Q A;  4XDX A;  1DOL A;  4XQN A;  1PFB A;  1HR0 Q;  3OTO Q;  1UNS A;  4ZRZ A;  1IL8 A;  1EY4 A;  2IL8 A;  3A74 A;  2N88 A;  1DGS A;  5COR A;  1SND A;  5KRU A;  3MZ5 A;  3R93 A;  4A3I H;  5IOD A;  3GTO B;  1XPO A;  3S14 B;  4CDC C;  3BYT B;  3Q22 A;  2YYZ A;  2UUB Q;  4JI7 L;  1U4L A;  4KJO A;  3CCQ A;  4NXM L;  4BY1 B;  4CDF C;  3D8G A;  4DNI A;  3TS2 A;  4DR5 Q;  3S9W A;  1U4P A;  2A6E C;  3BYY B;  1VQK A;  1WTW A;  2NVQ H;  2KHI A;  3VDY A;  3AU7 A;  2VXW A;  3RLO A;  4DPG A;  2VY3 A;  1LTG D;  2F52 A;  1L0Y B;  2SNS A;  5C4X G;  1STY A;  1RHP A;  1C7Y A;  1AE3 A;  1JB3 A;  3PMF A;  2ASB A;  4ODG A;  2HHH L;  3BDC A;  3CCM A;  3CCE A;  1CK1 A;  4A3J G;  5LL6 S;  1EUJ A;  3UI2 A;  1EFI D;  3TSS A;  1L2F A;  4DV3 Q;  3FKI B;  2AUK A;  2ICI A;  3GTM B;  4C3J B;  4RFB A;  3TP6 A;  2TMP A;  3L7Z C;  4DR4 L;  1ICF B;  4LF4 L;  1EZ6 A;  2PMZ E;  1PFS A;  2K04 A;  4DV4 L;  5IP9 G;  1G6P A;  4NXN L;  3UE1 A;  4IUN A;  1GO3 E;  3PIP 3;  4J15 A;  1D1K A;  5J3B A;  1EWC A;  2HCI A;  3NTH A;  4FDB A;  3K0Y A;  2ZM6 Q;  5EKK A;  3OIP A;  1N34 L;  2IHF A;  5JJL A;  1JJG A;  2J0T D;  3CC2 A;  2Y0S E;  1PH5 A;  1I3Q B;  4ZAI A;  5ELF A;  4CKE A;  5ISR A;  4XQJ A;  5KEE A;  1STA A;  1V1P B;  5EPK A;  1UE6 A;  3KDF A;  3GTJ B;  1JC7 A;  3AQQ A;  3N6R A;  3MXN A;  3ER0 A;  2Z1C A;  4DR2 Q;  2B63 B;  1F9P A;  2G9D A;  5CV7 A;  3GQB A;  4M1U B;  4ZKC B;  3J81 c;  4DK6 C;  1QG7 A;  1S4Z A;  2F0V A;  3T13 A;  3LX0 A;  1S5E D;  3DLL A;  1PH2 A;  1QZG A;  3PO3 B;  5C0X H;  4FXD A;  4FP5 D;  2Z8L A;  1XX8 A;  3GD7 A;  4DXG A;  3PO2 H;  2BE5 D;  1BKB A;  2NVY B;  3QG1 A;  4RMF A;  2EPB A;  2Z4I A;  2CQO A;  5CYU A;  2KCN A;  2EOT A;  4FF2 A;  4KHP L;  3D6W A;  2FMC A;  5IGF A;  1J5E Q;  1KDC A;  1LAB A;  1ZYR C;  3T1H Q;  4IN3 A;  5M3F G;  2MFI A;  3FRP B;  1HZ9 A;  4IPC A;  2MP1 A;  1Y69 U;  1A2U A;  3I8Z A;  3PUW A;  1SSO A;  1VQ7 A;  5FJ8 H;  2JA8 B;  3KLS A;  5GRO A;  5FO8 B;  2R93 H;  1SDF A;  5D3D A;  2F0Q A;  2ZM6 L;  1X9N A;  1A62 A;  4A3F B;  3AYH B;  2EYO A;  2BDN A;  4DNT B;  2L5T A;  2JA5 B;  1A0I A;  1Z6H A;  3ONA B;  3RZD H;  4G7O C;  1KAW A;  4C3J H;  1LO5 D;  5C0X J;  1AP0 A;  5M3F H;  2E2J B;  3B6Y A;  4IOC A;  3PO3 H;  5IP7 G;  2NN6 G;  4GKJ L;  4WJ4 A;  1C9O A;  5FJ8 G;  2KJX A;  4GLX A;  5I6Y A;  1EY7 A;  5K5P A;  4LFA L;  3WWV A;  4UY8 C;  5A35 A;  3S1Q H;  2VS1 A;  5HGT A;  2JA7 B;  1S5B D;  2D0P A;  1CSQ A;  4K5W A;  5EKL A;  2K1B A;  3S2H H;  1HZA A;  4ME3 A;  1QVF A;  2OT2 A;  1XNR L;  5HY6 A;  3K6O A;  1SBB B;  4LJZ C;  4X3T A;  4YWK A;  5C3X A;  1SJE D;  4A93 G;  2VQF Q;  1XPU A;  3S16 H;  1LTI D;  2SEB D;  4R9W A;  2WB1 E;  1X3Q A;  1SNC A;  4UAI A;  3DUZ A;  3HS0 C;  2VQF L;  2Y0S B;  1HNX Q;  2MGS A;  3LNN A;  4OL7 A;  4DR4 Q;  1N32 Q;  3TBI B;  4MZ9 A;  1UUP A;  4LFB L;  1G29 1;  4LNQ A;  1PYB A;  5M5X H;  1VQG A;  4PMW A;  1T9H A;  1O7I A;  4LF8 Q;  1V9P A;  2IY5 B;  3IRB A;  1TWA B;  3MHB A;  4CJ0 B;  1ENF A;  5A2Q E;  1U5K A;  1I94 L;  3FPP A;  4I7Z C;  2VW9 A;  3D31 A;  3A55 A;  2NVX B;  3U50 C;  5C3W A;  2DN8 A;  2PW5 A;  4PMC A;  4DR1 Q;  1HPC A;  4L8J A;  4HMJ A;  4QL5 A;  4OO1 H;  2JA6 G;  4KN7 C;  3HOU G;  1FVI A;  1CKN A;  5KGU A;  2JEA I;  5M3F B;  2K32 A;  1TS4 A;  1JOQ A;  1MD2 D;  1PH4 A;  2GVA A;  4NXN Q;  1EIG A;  3BVG A; 
#chains in the Genus database with same CATH homology
 2F3V A;  3IKJ A;  4UDU C;  1YNJ C;  3KBG A;  2XIW A;  1JIC A;  3DEO A;  3T51 B;  3RMH A;  2B2Y C;  3S2H B;  1SYC A;  1HA5 A;  3NPP A;  3L9A X;  3D6C A;  2G9H D;  1DJR D;  3M3Y B;  3D3R A;  3VYS A;  1XXG A;  1B3A A;  2F0L A;  1D5Z C;  4N9T A;  5EKI A;  1KAB A;  2AUJ D;  4DAY A;  3QIA A;  3FMC A;  1EEI D;  2AWN A;  2FIN B;  5DNF A;  4HTH A;  1SEB D;  3P7J A;  4ZKB B;  3HRZ C;  5D65 A;  4HAE A;  1GUO A;  1CHP D;  2RDH A;  3EFX D;  2B39 A;  2PZW A;  3H6M A;  2KHS A;  1I50 B;  2QIL A;  5CV5 A;  2PO4 A;  1JR0 D;  2QKI C;  3DXJ C;  4B9X A;  4DN4 M;  2XRS D;  3U9S A;  1EY9 A;  1QCB D;  3T56 B;  3GV6 A;  1SYB A;  3VYT A;  2N55 A;  4O42 A;  2EJF C;  1B44 D;  1YNJ D;  5A2Q L;  2PQE A;  5ELE A;  4XT3 B;  1VF5 C;  4IFD J;  2A74 C;  4CGY B;  1SMY D;  3Q6S A;  5COY A;  3K5L A;  1O7Y A;  1TY2 A;  1BCP B;  4BA1 I;  2WAQ B;  1LTB D;  1SYF A;  4ULL A;  4EQO A;  2EDG A;  4FVM A;  2F0J A;  4HMI A;  1ZXT A;  1Y8P B;  1BQQ T;  3BVM A;  4KKS A;  5K36 H;  4K2K A;  1PTO F;  1STG A;  2JYO A;  2F3W A;  1GOZ A;  2E2I B;  1KTK A;  3EQL C;  2K01 A;  3F2U A;  4BY7 B;  1IKM A;  1MSG A;  4EVO A;  1I4Q A;  3PUX A;  3G6J B;  4FO2 A;  2L1B A;  3HOX B;  2KVM A;  1SAP A;  1WD1 A;  3V05 A;  1TT2 A;  4CHT B;  2F0W A;  2O5J C;  1MSH A;  2CW0 D;  2E76 C;  5CV6 A;  1TU2 B;  4KY5 A;  4MIU A;  2QDB A;  2KCC A;  3OOC A;  3NTI A;  1A6X A;  3BZD B;  2IW3 A;  4C3I B;  3IFT A;  5KND A;  5T1I A;  2Q8T A;  5NUC A;  2L9H A;  4C2M B;  1O7L A;  3I4M B;  1PFM A;  4OIJ A;  4FF4 A;  3R2I A;  4IQZ A;  5KIX A;  3FPU B;  4OIK A;  5C4H A;  3VR3 A;  2JP1 A;  4FYD A;  4G7Z C;  1G2T A;  4XQQ A;  5I6W A;  1B53 A;  2QF7 A;  5EBD A;  1SNQ A;  5JPM C;  2EJG C;  4HSP A;  1ESR A;  1XTC D;  2IPK D;  1ENA A;  2VUM B;  1BUV T;  2ZXO A;  3OWE B;  1ROD A;  1HHV A;  4K14 A;  2I46 A;  1IYU A;  2F0O A;  1PTO D;  1MI2 A;  1D5M C;  2KEC A;  4NDX A;  4EQN A;  4A3I B;  3I4L A;  1STH A;  1KAA A;  1EQT A;  3KF8 A;  4J6H A;  2WV6 D;  1BR9 A;  2R92 B;  1C48 A;  3IAY A;  3HZX A;  1QIL A;  4K5X A;  1HCZ A;  1TWF B;  2WKD A;  3I73 A;  3NP8 A;  2HDL A;  1HFG A;  4ILW A;  2DNE A;  2ENB A;  4DNR B;  5C4X B;  4A3G B;  2A69 C;  3PV0 A;  1BCP C;  1PZI D;  1FNV A;  1GUT A;  1G2S A;  4R8N A;  3SR1 A;  4NKL A;  4A3J B;  2EY6 A;  3N52 A;  5DAU A;  1F2M A;  2KED A;  1YNN D;  2RBM A;  3QWN A;  4DU9 A;  3I90 A;  3TP7 A;  1K83 B;  4WFN 3;  4Y7N B;  5I2Y A;  1I4H A;  3SK6 A;  4CBV A;  2IJ0 A;  1E0B A;  3HG9 A;  2A73 B;  1OXX K;  1ET6 A;  3H94 A;  2XWB B;  4ZYS A;  1EQV A;  3MTS A;  1HUN A;  1VCI A;  1TWG B;  1VDZ A;  1SJH D;  5KYL A;  3IFD A;  1E2V A;  5J22 A;  1DZ1 A;  4M8A A;  1Y1V B;  4G57 A;  1D6E C;  5I2X A;  1S5F D;  1E2W A;  1KDB A;  4V19 0;  5G3L F;  2L11 A;  1BNZ A;  3M7N A;  2O4X A;  1SNP A;  5C4Z A;  4QMG A;  1WVL A;  1LT6 D;  1NSN S;  4K5V A;  2DY8 A;  1TY0 A;  1SNO A;  3I3C A;  2EY1 A;  3ERQ A;  1SMY C;  2BA0 A;  1TS5 A;  5IT9 E;  3AB9 A;  3MXG A;  3J7A V;  4RHR A;  2KOL A;  2QEJ C;  2NTS A;  3NHH A;  2XRQ D;  4H44 C;  3GTK B;  4RGO S;  1JWM D;  1DD2 A;  1KNE A;  3OWF A;  1TKW B;  1PTO C;  2NN6 H;  1BXT A;  5EBC A;  2M00 A;  1QE6 A;  1XWE A;  1KLG D;  2F0K A;  2KQ3 A;  1ILP A;  1X3P A;  5ELB A;  3HP3 A;  2EYL A;  1DXM A;  2AQ3 B;  3A56 A;  4C1N K;  5M9O A;  1V43 A;  4OO1 G;  4DFA A;  4TSS A;  1NR2 A;  3CHB D;  2VNU D;  3C3L A;  2EZV A;  1ZKO A;  2LS0 1;  4IUT A;  4F87 A;  2KUM A;  1WTO A;  4ZUJ A;  3M7G A;  2PMZ B;  2R6G A;  3EVQ A;  1EOT A;  3R3O A;  1SFO B;  4NP5 A;  4IUV A;  1RJT A;  1A3U A;  2JSO A;  3CRL C;  1TVX A;  2NN6 I;  3HKZ B;  4DK0 A;  3CU7 A;  2ICE C;  5IOC A;  3M4Y A;  1OO9 B;  2EYJ A;  2PZT A;  3NXW A;  4KHZ A;  2F0N A;  3DM1 A;  1TWC B;  4C3H G;  1GHJ A;  5DEH A;  1PTO B;  2PZU A;  3RZD B;  2KEE A;  4J1M A;  2JA6 B;  2NVQ B;  3EA6 A;  2FMM A;  3S1N B;  2D2C C;  1F77 A;  2A5H A;  4KTA A;  3DMU A;  4XYQ A;  2V4D A;  1FNW A;  4DAP A;  3QO2 A;  4DXF A;  1WTR A;  1SE2 A;  1J8I A;  1V8Q A;  5KNB A;  2J4X A;  2CQA A;  1NR4 A;  1JOK A;  1B1Z A;  3MAQ A;  5CGK A;  1AN8 A;  1T5X D;  3Q23 A;  2D62 A;  2LY7 A;  4KK7 A;  4RCN A;  2C5C A;  1XYI A;  3V2T A;  3HOU B;  1OXT A;  3NBI A;  3HOW B;  1STE A;  4RAU C;  4X3K A;  3D4W A;  4QUF A;  2Q8R E;  1BO0 A;  3RUZ A;  3NQT A;  2D5D A;  2B2Y A;  2PYK A;  3FEW X;  1F9R A;  3TP8 A;  4A3D B;  3NUC A;  4KD3 A;  1CQF A;  1RD9 D;  3AMU A;  2F0U A;  4B9W A;  4DA2 A;  3SK4 A;  2NB0 A;  2L12 A;  5E4W C;  1X32 A;  2EE1 A;  5E1F A;  1W6K A;  5D3I B;  1Q8I A;  5M5X B;  2IX0 A;  2CVR A;  4F88 A;  3PO2 B;  2CW0 C;  5IT9 L;  1FYC A;  4QCL A;  3NWT A;  3KLS X;  5AFW A;  1Q1B A;  1K8M A;  4KKT A;  1CI3 M;  3OMG A;  1B9N A;  2AQ2 B;  4C3H B;  3SK5 A;  2RSO A;  1RF2 D;  4LMQ D;  1A15 A;  4KY6 A;  1V1O A;  3VR6 A;  3PIO 3;  1I6V C;  2MUY A;  1ML0 D;  3CRK C;  4N9P A;  4DK1 A;  1Q1E A;  1BCP D;  2K7V A;  3NK9 A;  4IZ8 A;  1H9S A;  2R61 A;  1SXT A;  4ZUI A;  2A68 C;  1LTA D;  1CA6 A;  2H1E A;  2O2L D;  3FVQ A;  3H0G B;  2EY5 A;  1O80 A;  1ZYR D;  2PNR C;  1EY5 A;  1FR3 A;  4PQX A;  1Z47 A;  4IUU A;  4NW2 A;  4HR7 B;  3OW7 A;  4PMB A;  5HUR A;  4YIJ A;  5IGB A;  5JEA J;  5IGG A;  3HEJ A;  4OO1 I;  1TR5 A;  2E74 C;  4K8J A;  3S15 B;  1SE3 A;  4QF4 A;  4KKU A;  1ET9 A;  5J1Z A;  2IT1 A;  5EQ0 A;  1R4P B;  1EYC A;  3WDN A;  1L0X B;  3TP5 A;  4O1N A;  2FHT A;  4AYB B;  3I70 A;  4MHE A;  1BOS A;  1NAP A;  2RA4 A;  2QCP X;  5FO7 B;  3K57 A;  4GZY C;  1PLF A;  2B8G A;  3MA2 B;  1DYQ A;  3O13 A;  1R4Q B;  2DNC A;  2NYZ D;  1LAC A;  5LHY 1;  4A3E B;  1VMP A;  2X6G A;  1CQV A;  4XT1 B;  3SHL A;  2F0T A;  5FLX E;  1B2T A;  3BDO A;  3X3N A;  2XVS A;  5C5M A;  2K5Q A;  2RDG A;  1ILQ A;  4B08 A;  5C4J B;  1DON A;  5CV4 A;  1EU4 A;  4PNY A;  4XXE A;  3VA5 A;  3S2D B;  3ERO A;  3A7L A;  1PDQ A;  3W2D A;  3M85 A;  5E3F A;  4E6I A;  4FF1 A;  4RA8 A;  2LFN A;  4IUP A;  3E5S A;  2RSN A;  1QB5 D;  2RVL A;  3A7A B;  1JWS D;  1HFN A;  3Q24 A;  4A3M B;  3WOE A;  1IW7 C;  1OXU A;  2FJ2 A;  1CTM A;  1Z7T A;  3T4A C;  3OMC A;  1IW7 D;  2PPB C;  1AEX A;  4XIG S;  3GTG B;  1QOH A;  1G8Z D;  5JEA H;  3GO5 A;  2ZXP A;  3J80 L;  1C4Q A;  3HOV B;  4BBR B;  2EY2 A;  3M4O B;  1DOK A;  3I72 A;  2Q8I B;  2NUC A;  1CZW A;  3DHQ A;  4Q0F A;  1RTO A;  2MPM A;  4H13 C;  1MBY A;  1MGS A;  1H9K A;  1EYA A;  1FGB D;  3DWA A;  4BS9 A;  4H7B A;  3J81 L;  2RQX A;  4ZLT F;  2ZXR A;  4Q5V A;  2SNM A;  4K6D A;  1UAP A;  3DWQ A;  2EYP A;  1QWY A;  3CKI B;  1RKN A;  2L0C A;  2IX3 A;  1D5X C;  1JOO A;  3C46 A;  3VYR A;  1IYV A;  4ABN A;  1LT3 D;  4J8Q A;  1LTS D;  4HED A;  1F9S A;  2NTT A;  1RDP D;  3SEB A;  1KLU D;  4FXK C;  2ID0 A;  5EPL A;  4CKC A;  3I4N B;  4X3U A;  3VA7 A;  2F0H A;  2PCF B;  2WII B;  1H9R A;  4KY7 A;  5M3M B;  1WTQ A;  4K8I A;  2DY7 A;  3D4D A;  3VR4 A;  4A3K B;  2F03 A;  1SYD A;  5G3L D;  3DWP A;  1NCV A;  1PFN A;  3GTL B;  5IGD A;  3TME A;  5C0X I;  1V1P A;  2A6H C;  3RZO B;  2EYM A;  4X3S A;  3A8K E;  3NBH A;  2MJ8 A;  3KUP A;  5FK9 C;  1QNK A;  5CR3 A;  2B2W A;  4CJ1 B;  3SVM A;  3K59 A;  3A8J E;  1M8A A;  3GTP B;  2RDF A;  2LMC B;  2SOB A;  2F4I A;  3KBX A;  4KHV A;  3P20 A;  2M2L A;  1GUS A;  3H09 A;  4ME5 A;  1LV9 A;  1PMR A;  5DM7 3;  5KNC A;  4S3S A;  3HOZ B;  1CM9 A;  1STB A;  3SE0 A;  2B2T A;  3ND8 A;  1G6Z A;  1CT1 D;  1ESF A;  1PTO H;  4KN4 C;  4RKL A;  2WB1 B;  1H9M A;  1JOR A;  4R8I A;  5ELC A;  1GXD C;  3P75 A;  3SXH A;  5F2D A;  4OGQ C;  3LWE A;  1D1I A;  1EY0 A;  5I4D A;  4G7H C;  1C8C A;  3ND9 A;  5EJW A;  2F0E A;  3WOF A;  2X69 A;  4K6L A;  2F1M A;  3TZU A;  1AZQ A;  1GUW A;  1SNM A;  3GV3 A;  4XYO A;  5FOB B;  4FNF A;  2VB3 X;  5FLX L;  5JJZ A;  3C1E A;  4U68 A;  2NBF A;  1G91 A;  3R8B A;  1PZJ D;  5CBA E;  2O5I C;  3NTK A;  1GUN A;  3RLF A;  1B9M A;  5T1G A;  3K5N A;  1I4G A;  1EU3 A;  2A68 D;  4C3J G;  1PYW D;  2YU9 B;  1ZEQ X;  5CBE E;  4KV6 A;  3BS1 A;  2EVB A;  2MHV A;  3QOJ A;  5FKA C;  1JWU D;  4G4K A;  4ZQ3 A;  1I4R A;  4ZK9 B;  4I65 A;  5JOB A;  3R2T A;  2NWG A;  4ID6 A;  2E2D C;  2B2V A;  3E6Z X;  4TQU S;  4K2L A;  4DF7 A;  1E2Z A;  5IGC A;  4HN7 A;  4KD4 A;  1ENC A;  1OXV A;  4JK1 C;  4RCO A;  1O7Z A;  1TS2 A;  1Y1W B;  5TSS A;  1HQM C;  2XWJ B;  4RH6 A;  1OXS C;  3DEP A;  4IUQ A;  1M4V A;  1VMC A;  3FDT A;  3SK8 A;  3HGB A;  3K5M A;  1YNN C;  2F0S A;  2A6H D;  2L55 A;  5C44 B;  3VYU A;  2B2W C;  4WOR A;  3GP7 A;  4HCS A;  5CV8 A;  2BCO A;  1JCK B;  5JAV A;  2B8F A;  1SYE A;  2BDO A;  1LT5 D;  1LTT D;  1CA5 A;  3T16 A;  2TSS A;  1GUG A;  1EZ8 A;  4P2C B;  1EY6 A;  3D4R A;  3OSO A;  1S5C D;  3S1Q B;  2EJM A;  2IWH A;  3S1M B;  5K36 G;  3VR5 A;  4C56 C;  1TQO A;  2D9U A;  3OPO A;  4C3I G;  4A93 B;  1A3V A;  5KYI A;  5JEA G;  3K7A B;  1Y8O B;  4EGV A;  3MXU A;  3G7L A;  2EXZ A;  3BVZ A;  1H9S B;  2AWO A;  2SDF A;  2NZ1 D;  5JPN C;  5C0X G;  3VR2 A;  3RD4 A;  3QOL A;  1S5D D;  3HOY B;  4IUR A;  2R3Z A;  4L6T B;  2XSC A;  3NE5 B;  5IIF A;  4QIW B;  3J7A F;  2E75 C;  1HRJ A;  4CJ2 C;  3S1R B;  4CKB A;  4FXG C;  4IFD G;  4RHS A;  4KI0 A;  3PUV A;  1LT4 D;  1KDA A;  4A3B B;  1KNA A;  3I91 A;  1HUM A;  2F0M A;  1GHK A;  1PRT B;  1BDO A;  4HSV A;  4RGN A;  5E4X A;  3MFG A;  2BOS A;  3X3M A;  1TS3 A;  4BWG B;  4RKB A;  2OXP A;  1A3T A;  1AFP A;  1B4O A;  3E0J A;  1A2T A;  1Q90 A;  1AW7 A;  1ONL A;  2F0F A;  2B2U C;  1BBX C;  4TRD A;  2M9V A;  2L4N A;  1UEA B;  1WTP A;  3KLR A;  1LLR D;  2XNA C;  5M5W B;  1W6J A;  3OIQ A;  3TZD A;  3PUY A;  1WCM B;  5C6A A;  2JEB I;  4H0L C;  1EEF D;  2BE5 C;  2ZT9 C;  4NMZ A;  1Q3L A;  1WTX A;  1F2Y A;  2I07 B;  1K8O A;  4BA2 I;  5ELD A;  1Q12 A;  3ZYY X;  3P1H A;  3H3V C;  1U4M A;  4HCE A;  5I9O A;  2K6A A;  2E2H B;  4DGZ A;  3PUZ A;  1FD7 D;  1ICW A;  4KJN A;  4PV1 C;  3S17 B;  3Q0A A;  3ITP A;  4TKO B;  1AZP A;  2WP8 J;  4LK1 C;  1II3 A;  1R9T B;  1CZG A;  3BG3 A;  4RGT A;  2HUG A;  5EGT A;  5C5L A;  2HDM A;  4Z9C B;  3JAM L;  4WJW A;  3NQI A;  3C2P A;  1U4R A;  3K5O A;  3V96 A;  3T53 B;  1PRT D;  1H9J A;  4MN3 A;  3LWU A;  5CC4 A;  3NWS A;  2VB2 X;  1WTV A;  1EY8 A;  1BCP F;  1I4P A;  2F0D A;  4XTC S;  3J7Y W;  2EYH A;  4RGM A;  4QB4 A;  2X6L A;  4L63 B;  5M5Y B;  3GTQ B;  5IGE A;  2R7Z B;  3QB3 A;  3C1F A;  5CV9 A;  2OF1 A;  1SE4 A;  2A6E D;  2HQE A;  1RCV D;  1CHQ D;  4WRD A;  3H91 A;  1CFM A;  2C9O A;  2F0P A;  1O78 A;  2A69 D;  1HXY D;  5JVG 3;  1FNU A;  4F7X A;  1WD0 A;  2J7Z A;  4OHJ A;  3MFY A;  4KMU C;  2K5W A;  4U67 3;  4LAA A;  2LKV A;  1PXU A;  2B2T C;  5BN5 A;  1JQY D;  1HQR D;  2OEO A;  1QJO A;  1DCZ A;  3U9O A;  3W3A A;  1T5E A;  2K5D A;  1D2B A;  3MC0 B;  5C3E B;  3QJY A;  3NSW A;  4IFD H;  4FF3 A;  1PRT C;  5EPJ A;  1DOM A;  2JXM B;  1JE4 A;  2K33 A;  1TII D;  3MEH A;  1Y8N B;  4IAL A;  1SYG A;  2WIN B;  2AQ1 B;  1B50 A;  2KA7 A;  2IX1 A;  1I6H B;  2WKC A;  5FO9 B;  4QUC A;  2F0I A;  4V0B A;  1IHZ A;  1EYD A;  1STN A;  3MWY W;  2GA4 B;  2PW7 A;  3JAM E;  3TDQ A;  3URY A;  1IKL A;  2JE6 I;  2K28 A;  5DM6 3;  2F0G A;  4BBS B;  3L3O C;  3A8I E;  5CMD A;  1EWH A;  2K05 A;  4JBW A;  1LTR D;  1HTL D;  3A54 A;  1PRT F;  2R93 B;  5JVH 3;  1BF4 A;  1DM0 B;  2B2U A;  3J81 E;  1F2L A;  1GJX A;  3MXP A;  2BA1 A;  1HTP A;  4F8M A;  2K03 A;  1RTN A;  3CQZ B;  1U9R A;  1TWH B;  1F2Z A;  1NUC A;  3TN2 A;  4DAV A;  2H4O A;  4EQP A;  1PZK D;  3SDZ A;  3J80 E;  2XN9 C;  2Z4H A;  1QNU A;  5D14 A;  4RWS C;  5I9P A;  1J9O A;  2NVT B;  2HCC A;  2EYF A;  3BDL A;  2CHB D;  3IL8 A;  2FFK B;  4IFD I;  3EJI A;  5BN4 A;  3K58 A;  3S16 B;  3MVV A;  1EIH A;  3OHX C;  1HA6 A;  3KK7 A;  5LL6 X;  1EL0 A;  5J39 A;  2WAC A;  4C1N I;  2RKS A;  1I4X A;  1VF7 A;  5BN3 A;  2B2V C;  1F9Q A;  4XDX A;  1DOL A;  4XQN A;  1PFB A;  1UNS A;  4ZRZ A;  1IL8 A;  1EY4 A;  2IL8 A;  2N88 A;  5COR A;  5KRU A;  1SND A;  3MZ5 A;  3R93 A;  5IOD A;  3GTO B;  3S14 B;  3BYT B;  3Q22 A;  2YYZ A;  1U4L A;  4KJO A;  4BY1 B;  3D8G A;  3S9W A;  1U4P A;  2A6E C;  3BYY B;  1WTW A;  3AU7 A;  2VXW A;  1LTG D;  1L0Y B;  2SNS A;  1STY A;  1RHP A;  3PMF A;  1JB3 A;  4ODG A;  3BDC A;  1CK1 A;  5LL6 S;  3UI2 A;  1EFI D;  3TSS A;  3FKI B;  2AUK A;  2ICI A;  3GTM B;  4C3J B;  4RFB A;  3TP6 A;  2TMP A;  3L7Z C;  1EZ6 A;  2K04 A;  4IUN A;  3PIP 3;  1D1K A;  1EWC A;  2HCI A;  3NTH A;  3K0Y A;  5EKK A;  3OIP A;  2J0T D;  1I3Q B;  4ZAI A;  5ELF A;  4XQJ A;  4CKE A;  5ISR A;  5KEE A;  1STA A;  1V1P B;  5EPK A;  3GTJ B;  1JC7 A;  3MXN A;  3N6R A;  2Z1C A;  2B63 B;  1F9P A;  2G9D A;  5CV7 A;  3GQB A;  4M1U B;  4ZKC B;  1QG7 A;  1S4Z A;  2F0V A;  3T13 A;  3LX0 A;  1S5E D;  3PO3 B;  5C0X H;  4FXD A;  4FP5 D;  2Z8L A;  4DXG A;  1XX8 A;  3GD7 A;  2BE5 D;  2NVY B;  3QG1 A;  2EPB A;  2Z4I A;  5CYU A;  2KCN A;  2EOT A;  4FF2 A;  3D6W A;  2FMC A;  5IGF A;  1KDC A;  1LAB A;  1ZYR C;  4IN3 A;  3FRP B;  2MP1 A;  1Y69 U;  1A2U A;  3I8Z A;  3PUW A;  1SSO A;  2JA8 B;  3KLS A;  5FO8 B;  1SDF A;  5D3D A;  2F0Q A;  4A3F B;  2EYO A;  2BDN A;  4DNT B;  2L5T A;  2JA5 B;  1Z6H A;  3ONA B;  4G7O C;  1LO5 D;  5C0X J;  1AP0 A;  2E2J B;  2NN6 G;  2KJX A;  5I6Y A;  1EY7 A;  5K5P A;  5A35 A;  5HGT A;  2JA7 B;  1S5B D;  4K5W A;  5EKL A;  2K1B A;  2OT2 A;  3K6O A;  1SBB B;  4LJZ C;  4X3T A;  5C3X A;  1SJE D;  1LTI D;  2SEB D;  4R9W A;  1X3Q A;  1SNC A;  4UAI A;  3DUZ A;  3HS0 C;  2Y0S B;  2MGS A;  3LNN A;  4OL7 A;  3TBI B;  1UUP A;  1G29 1;  4PMW A;  1TWA B;  3MHB A;  4CJ0 B;  1ENF A;  5A2Q E;  3FPP A;  4I7Z C;  3D31 A;  3A55 A;  2NVX B;  5C3W A;  2DN8 A;  2PW5 A;  4PMC A;  1HPC A;  4L8J A;  4HMJ A;  4OO1 H;  4KN7 C;  5KGU A;  2JEA I;  5M3F B;  2K32 A;  1TS4 A;  1JOQ A;  1MD2 D;  1EIG A;  3BVG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...