2UUBL

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a guu-codon in the a-site and paromomycin.
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
124
structure length
124
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S Ribosomal RNA
publication title Mechanism for Expanding the Decoding Capacity of Transfer Rnas by Modification of Uridines
pubmed doi rcsb
total genus 17
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2uubL00
3I4NG 5IYDH 1Z47A 4JI3L 3NENA 1HNWL 3U58A 5M3FG 2HHHL 1VQHA 1KD1C 3JAMc 4NXNL 4DV2L 2UXBQ 4DV6L 4Y7NH 4IPHA 3GTMH 1I6HH 2OTLA 1Y1VG 4AQYQ 1E1OA 4DR5L 4X65Q 3STBD 3BZCA 1AE3A 5JEAG 4OX9Q 1OXUA 3PSIA 4JI5Q 3F2BA 2UXCL 3AFQA 2R93H 5K36G 1LUZA 5FJ8G 3F2CA 1Q8KA 2D62A 5IE8A 4KLKA 4B3RQ 3HOWH 3J7ZC 1VQCA 1HZBA 2NN6I 3TQYA 2VW9A 4A3IH 2UUBQ 4IFDI 2OTJA 5C0XI 3H0GH 4P73A 2R92G 4HIDA 2VQEL 2RHSB 1RIPA 2KCTA 3EBEA 1EOVA 4H02A 4JI3Q 4A3GG 2EQSA 4JYAL 2Y0SG 1HNWQ 3HKZE 4EQ5A 1YJ9A 2AWOA 2FXQA 1VQ5A 2PQAB 2E5LL 4JOIA 4QJFA 4DV6Q 1N36L 1I50H 3GTPH 4WJ4A 4IJHA 2N78A 3PF5A 2Z6KC 3I7FA 2RF4A 4DV7Q 4A3LG 4LFBL 3S1QH 3NELA 4LUVA 4LUZA 5J3BA 4GLAC 4LF5Q 2A8VA 3CP0A 3J81c 4GOPB 4A3JH 4DR4Q 1YHQA 1WCMG 2R6GA 2GVBA 3NBHB 2L15A 2PNHA 1HJPA 2UU9L 4X62L 1AH9A 2K5VA 5C44G 1X56A 3KYHC 4X6AH 1Q1BA 4JYAQ 2NVXH 4DR2L 3M85A 2E5LQ 3GD7A 2RCNA 3KJPA 3JAMi 4IPGA 4UP9A 4DPGA 4DUZL 2JA5H 3RLOA 1XPUA 3PIPA 1K9MC 3HOXG 3I56A 4LFBQ 2GN5A 1N32L 1YI2A 4JI4L 3T1YL 2WAQE 1KXLA 4A3KG 2IHFA 4JI8Q 3A0JA 3W1GA 2AWNA 4YWMA 3S1MH 2CFMA 1HZCA 2EXDA 2PQAA 3UE0A 1CKMA 1VQLA 2UU9Q 4X62Q 1I5FA 4JBJA 4L5SA 4IOAA 4JV5Q 2VUMH 5C4XH 3M3YH 1VQJA 4QY7A 1N34L 3G4SA 4MTNA 1U0LA 3GTKH 3BZKA 4BY1G 3GDEA 1X9NA 5HGQA 4UP8A 1SE8A 3K7UC 3TEHB 2ZJPA 4GOPA 5JJIA 2YV5A 1HR0W 3HOZG 3KJOA 1N32Q 3S16H 3HOVG 4A3MG 3FP9A 4PZ6A 5IYDG 4JI4Q 1JJCB 5GAGC 2ES2A 1CKOA 1LYLA 4A4IA 1EYGA 3J81i 4L5TA 4UY8C 1D8LA 3PF4A 1VQEA 5GQOA 1PH9A 1L2FA 1V43A 4UPAA 5IYBH 1N9WA 2QGQA 1N8RC 1XNRL 3NEMA 2F3IA 5LMNW 3KLWA 1A8VA 1KL9A 1G51A 4YWKA 2ZTDA 3EIVA 2B29A 5HY6A 1VQAA 1TWFH 2ZM6Q 3H3VI 1D7QA 1AE2A 4P71A 3ULJA 1VQIA 1IL2A 2ASBA 2Q2IA 3H0GG 3K81C 3UDIA 3ULPA 1PH7A 1PHJA 2NZHA 1VCIA 4DV1L 3I2ZA 4JI0L 1LM0A 2AKWB 5C4JH 1EQQA 1CUKA 4LF8Q 3KFUA 4DR6Q 5M5YH 4X65L 2JA9A 3BU2A 3K8AA 3J80i 3RZDH 4LF7L 1XNRQ 2JA6G 4MZ9A 2F4VQ 2JEBI 2UUAQ 2IT1A 2WB1G 3STBC 1Y1WH 1T9HA 2NVQH 3G48A 4YCVA 3A5UA 4DV0Q 4TQUS 4L5QA 4X66Q 4AYBE 3CPWA 5FLMH 3PUVA 1Q82C 1ASZA 1UE1A 1XJVA 2Q2UA 3J81j 3J7A5 4PG3A 3PV0A 1OTCA 1B7YB 4GNXC 4IO9A 4NXML 4HJ5A 3VDYA 2BH8A 1SRUA 4A3EH 2GVAA 2VY3A 4BA1I 3F8TA 4HJAA 4APVA 2R7ZG 1Q46A 4DV1Q 4JI0Q 1YVCA 4DUYL 1YHAA 3AFPA 4DKAC 3E9IA 4YY3L 4DV7L 1BBWA 1NMFA 1HNZL 2OQKA 4A76A 3S2HH 4LF5L 4LF7Q 1L0WA 2VNUD 1VQGA 1HZ9A 1VQDA 3CPFA 4DR4L 2JA8H 2AHOB 2AMCB 4POFA 3AEVA 4IFDJ 4HIKA 5IT9c 1Q12A 5EAYA 5C0XJ 3I4MG 4Y52H 4JG2A 1L1OC 4GS3A 1E1TA 4NXMQ 2JA7H 2NZOA 1PH4A 1YHBA 2KHJA 4A3DG 2UUCQ 5IY0A 3A5ZB 2VUMG 4BBSH 4DUYQ 1S40A 3UDXA 1KIXA 1KAWA 2BA1A 2H5XA 4YY3Q 4JOIC 1HNZQ 1PFSA 1J6QA 1YEZA 3MEFA 4HIOA 1PH6A 1A63A 2LXJA 2N8NA 4YCWA 4PMWA 1UE5A 2K4KA 1C9OA 1KRSA 4QQBX 3M9BA 1SFOH 1PV4A 3RN5A 4JI8L 1QZHA 2CQOA 4LF9L 2Y0SE 5ELOA 1JT8A 4ALPA 1X6OA 2VS1A 2E2JH 1E7ZA 4JV5L 4XIGS 1EFWA 1IBLL 4C3JH 1Q1EA 3GTJH 1HR0L 2HT1A 3S2DH 2MO1A 4P75A 1MJEA 5IYBG 1WFQA 4TVAB 3OW2A 1YZ6A 4C2MH 1GD7A 1UEBA 4O0AA 5BR8Q 2CWAA 3CQZH 1X3EA 1CKNB 1TWAH 4R4QA 3DLLA 4OO1G 1GVPA 4A3FH 1NY4A 1JMCA 3CCEA 4YHHL 2JEAI 5IYCH 3TS2A 4A3BG 3UE1A 2B63H 3GTLH 1I94Q 5M3MH 3CXCA 4LF4Q 1K73C 5M3FH 1CSPA 4LF9Q 1QZGA 4DR7L 3FKIH 4BBRG 3IRBA 1VQKA 1JJ2A 1NTGA 3HOUG 1VQ7A 1KHIA 2WP8J 2KHIA 1E24A 1Y1VH 2OQ0A 1IBLQ 1SN8A 1HR0Q 4AIMA 4GLVB 2ZJRA 1K8GA 3PUWA 2E8GA 3PO3G 4DK6C 2ZM6L 2JQOA 1YNXA 1E22A 2JE6I 4JC0A 4YWLA 5FJ8H 1Y1WG 1VQ9A 2YTVA 5C3EG 3PCOB 1NBWA 5M5WH 1CSQA 5FLMG 2PI2A 4YHHQ 3MXNB 4GOPC 4C3HH 2BH2A 1XPRA 5LMNQ 1PH1A 4OWWB 4DR6L 1YIJA 4LF8L 2QEXA 1X3GA 4BY7H 4DV3L 1M90C 3S15H 4A3GH 2N3SA 3F2DA 4DR7Q 3CCQA 1G291 1V1QA 2YTXA 3K0XA 2EIFA 2HIVA 2F4VL 2UUAL 1JE5A 2ZTEA 1CKNA 1PH2A 3GTGH 2OWOA 3M4OH 4A3LH 3S17H 4MNOA 4DV0L 1MIUA 1W3SA 2CKZB 4X66L 1UE7A 5FLXc 2R93G 2E2HH 3H3VH 4A75A 3T1HL 1Q7YC 1A0IA 1U5KA 1PYSB 1XMOQ 1PH5A 4A3CH 3HOWG 4DAMA 2NN6G 2RHQB 3KF8B 3Q8DA 1YJNA 3I55A 1MKHA 1WCMH 3TS0A 2BA0A 5C0XG 4A3IG 2JA8G 3M4QA 4R1JA 3HOYH 5GADC 5IWAQ 1RL2A 4FDBA 2WFWA 3L0OA 1QVGA 1GM5A 1K3RA 2HIXA 5M5XH 1X3FA 4ME3A 4OXPA 4DAYB 1XPOA 3S14H 3PUXA 4DV3Q 3L2PA 1TXYA 3W1BA 1KC8C 1VQMA 1ASYA 3CMAA 4K0KQ 1QVCA 1E3PA 2KBNA 2UXDQ 1G6PA 1SMXA 2ALYB 2C35B 3E9HA 4GKJL 2CWPA 4JBKA 1X55A 1JB7A 1N33Q 4OO1I 1TWHH 2R7FA 3RN2A 4RG1A 4KHPL 1NMGA 4UP7A 3T1HQ 5DLQE 4A93H 4A3JG 4B3TQ 1VQPA 4R4CA 1WOCA 5AJ3L 1Q81C 5LMUL 1L1OB 1TWCH 1IYJB 3HKSA 1VQBA 4DNIA 1FJGL 2UUCL 1OXXK 2JJQA 1XTDA 5JJLA 2IX0A 3TRZA 3PGZA 1WJJA 5GAEC 2QA4A 2WB1E 3I4OA 3G71A 2R7DA 3KDFB 4J15A 2VQFL 4OONA 3DM3A 4IOCA 1VQOA 1PH8A 3CC7A 4DV5Q 4HJ8A 1IZ6A 2JA5G 2ID0A 1HNXQ 4OWTB 4BY1H 1C0AA 3KOJA 2OCEA 1VQ4A 4GKJQ 4PZ7A 1DGSA 3HOZH 4BXXH 4KHPQ 4JI6Q 3HOVH 3CCJA 4A3MH 2B63G 3H15A 5M3MG 1X54A 2D0PA 3CCLA 4LNQA 3S24A 3CCMA 3E0EA 5AJ3Q 5H1SE 3EN2A 5LMUQ 1Y14B 1FJGQ 3WWVA 3FKIG 1UE6A 5IP7H 5ELNA 2I5LX 4GN4B 3CMEA 4B3ML 5C4XG 2F52A 1KRTA 5BR8L 1YITA 3HKZG 3RLNA 4R4OA 3RNUA 3KF6B 1J5EL 2JK8A 4JCVE 2Q2TA 4JI7L 2VQFQ 2NVTH 1VQFA 2MFIA 5IP9H 4LFAL 1SLJA 3PUZA 1I94L 2K5NA 3B6YA 1L1OA 3FHWA 4RMFA 1OXVA 4LF4L 2ZTCA 2KCMA 2XGTA 4DR1L 4DV4L 2CCZA 3CD6A 4BY7G 2XTIA 2MQHA 4L5RC 2HHHQ 2DGYA 3KDFA 2Z6KA 2YU9H 4HJ9A 4DV2Q 4NXNQ 2YYZA 2JA6H 5E7NA 3K7AH 4B3MQ 4IFDG 4NB3A 3JC66 3RLFA 4DK3C 4DR5Q 3U50C 3PO2H 3CCRA 1LTLA 1P8LA 3UDFA 1J5EQ 3CF5A 4R4TA 3AQQA 1PH3A 4JI7Q 1YBYA 3GTOH 1O7IA 2UXCQ 4GKKL 4A3CG 4LFAQ 2UUBL 4QGUA 3U4ZA 2ZJQA 5LMNL 3I4NH 3AYHB 4X64L 3HOYG 2B3GA 1R9TH 3M7NA 2N49A 1IXRA 4WJ3M 1IBKL 1TWGH 2I5MX 2WAQG 2K14A 4IPDA 4KHZA 3SGIA 2VQEQ 3ER0A 4DR1Q 3PIOA 1S72A 1HH2P 4DV4Q 2ATWA 2R7ZH 2IX1A 1MJCA 1PYBA 2KENA 3KF6A 1NE3A 3BJUA 3D0FA 1KQSA 3HFZB 3CCVA 2DUDA 2Z0SA 3LGJA 4LFCL 5GROA 5JEAJ 4GN3B 1N36Q 1S3OA 1VQ6A 1XNQL 1HZAA 1QUQB 2D0OA 3CW2C 1XMOL 1B8AA 1VS0A 2K75A 1IBML 1B70B 3G6EA 4GLXA 3PUYA 4A93G 4R4IA 5IWAL 4GKKQ 4JBWA 2R92H 4POGA 3I4MH 1OXSC 3J80c 3M4PA 2PI2E 4X64Q 1PVOA 4JI2L 1EIYB 4PZ8A 4A3EG 1X65A 2VL6A 3D31A 2MNAA 4A3DH 4AH6A 1IBKQ 4BA2I 1Z9FA 4EX5A 1PA6A 2V1CC 4K0KL 2UXDL 2LSSA 1M1KC 2K50A 1EIFA 2IY5B 3GO5A 4DR3L 4DR2Q 1GKHA 3W5OA 5GAHC 1N33L 4JBMA 2HQLA 4HJ7A 3A74A 1SROA 2K52A 2I0QA 4LFCQ 3CC4A 1K83H 4DUZQ 1XNQQ 3RR5A 3TREA 4B3TL 2A1AA 3ICEA 4BXXG 4LF6L 4YCUA 1IBMQ 2LXKA 3OYYA 4GNXB 1Q86C 1GO3E 4IPCA 3T1YQ 1VQNA 4IJLA 5C44H 2JA7G 2I5HA 4JI2Q 1A62A 4XTCS 4OWXB 1YJWA 4C3IH 5IP7G 2PMZE 3GTQH 5JJKA 1WI5A 1SR3A 3S1RH 2VZAA 4JI1L 4BBSG 1K0RA 1FL0A 4DV5L 1I3QH 1QUQA 1HNXL 3L7ZC 3RZOH 1N34Q 1OXTA 3CAMA 1EWIA 1VQ8A 4DR3Q 3F1ZA 3HOXH 4GN5A 5IP9G 3K80C 3OTOL 4P72A 1BVSA 3CCUA 1V9PA 1XMQL 2E2IH 4B3SL 4O2DA 4JI6L 1EQRA 4LUOA 4A3BH 2MO0A 1QVFA 4A3KH 3ERSX 4LWCA 3ULLA 4AYBG 4LF6Q 4KI0A 1EUJA 2NVYH 1H95A 4P74A 1NJIC 2UXBL 2A19A 2IHEA 4QL5A 3U4VA 4BBRH 1P16A 4NPSA 3HOUH 4AQYL 1W2BA 1K8AC 4OX9L 3ZJYC 4JI5L 1C7YA 2Q2HA 3S1NH 3CCSA 3PO3H 1FGUA 4JI1Q 3CC2A 4LW1A 1UWVA 4QIWE 3UDGA 3PO2G 1BKBA 4HIMA 2K5HA 4B3RL 1BBUA 4A3FG 5C3EH 4GNXA 5IYCG 1JJGA 2YTYA 3OTOQ 4B3SQ 1XMQQ 1FVIA 1WYDA
chains in the Genus database with same CATH superfamily
4CDEC 4JI3L 4KKUA 4ZQ3A 3TP7A 1RDPD 3QB3A 1HNWL 1AN8A 2V4DA 1MGSA 3MXPA 5C5LA 4IPHA 1XX8A 1CZGA 3I73A 1OXUA 5FJ8G 2PZUA 3HOYB 1JR0D 4B3RQ 3HOWH 1HZBA 4UDUC 2R92G 3EBEA 3MWYW 4JI3Q 4H02A 3SXHA 1SEBD 2Y0SG 1HNWQ 1YJ9A 1VQ5A 3OPOA 2E5LL 4QJFA 1N36L 3GTPH 4IJHA 1TQOA 3I7FA 1J9OA 3EA6A 4A93B 4LUZA 4GLAC 1X32A 4LF5Q 4KJNA 2R6GA 2LMCB 5FK9C 1J8IA 1PRTC 3KYHC 4X6AH 1KDAA 4G4KA 4L6TB 4DR2L 2E5LQ 2RCNA 3HOZB 1UUPA 1BUVT 4IPGA 4UP9A 2JA5H 4A3MB 4XT1B 3HOXG 1LTRD 1YI2A 3NBIA 1WTVA 1EYCA 4ZUIA 2I46A 1KXLA 4YWMA 3PIO3 4E6IA 3AMUA 2IWHA 1BDOA 2L4NA 2VB3X 1I5FA 4JBJA 4L5SA 4XDXA 3SVMA 4QY7A 1N34L 3K5MA 3G4SA 3Q23A 1EU4A 3GTKH 4BY1G 1CK1A 1EQTA 4UP8A 4GOPA 2ZJPA 4ME5A 1RHPA 2MGSA 3KJOA 3DHQA 3E0JA 2ES2A 1EYGA 4L5TA 4UY8C 3K7AB 4WFN3 4UPAA 1CI3M 2PNRC 3J7AV 2EYHA 3KLWA 1A8VA 3BDLA 2IL8A 1G51A 5HY6A 2ZT9C 3H3VI 1H9RA 3QO2A 1G8ZD 1GHJA 3H0GG 1PHJA 5BN3A 2NZHA 2NVXB 1VCIA 4DV1L 3A56A 3I2ZA 3A54A 1EQQA 4DR6Q 1CUKA 3VYTA 3TMEA 3RZDH 3SEBA 3TP8A 3L3OC 1HUMA 4OIJA 2JA6G 4MZ9A 1JQYD 1Q3LA 3TP6A 4MTKA 2UUAQ 5IGGA 2IT1A 2F0DA 5CV6A 2NVQH 2J0TD 4YCVA 4K8IA 1VDZA 3A5UA 4TQUS 4L5QA 4DV0Q 2UUBL 3I4MB 4FYDA 2Q2UA 1XJVA 4PG3A 2BOSA 4NXML 2KEDA 4MHEA 1CM9A 1SNOA 1STGA 4KV6A 4DV1Q 3KLRA 1T5EA 1K83B 4FXGC 4EQPA 4DV7L 2OQKA 3N52A 1L0WA 2VNUD 1DD2A 3OMCA 4O1NA 3K5LA 5IT9E 1VQGA 1EEID 1HZ9A 4DR4L 1SNMA 4K5VA 2AHOB 5C44B 4HIKA 2HDLA 3GTQB 2SOBA 3LNNA 4NXMQ 1E1TA 2A6HD 3A5ZB 4DXFA 1RJTA 2RCFA 1HFGA 2BA1A 3IFDA 3J81E 1TS4A 1PFSA 1ENCA 3MEFA 1PH6A 3HEJA 1W6JA 2K4KA 3Q22A 1C9OA 3M9BA 2FMCA 1SFOH 1DCZA 4JI8L 5ELOA 1JWMD 1H9SA 5CV7A 2F0JA 4XIGS 5FOBB 3FEWX 4C3JH 3PO3B 2HT1A 3MFYA 2MO1A 5KNCA 2QDLA 3CQZH 5I2YA 1TWAH 4TSSA 4BWGB 4A3FH 1B4OA 5BN4A 3AB9A 2FHTA 1AFPA 4Y7NB 4LF4Q 1K73C 1CSPA 2J4XA 5NUCA 3VYUA 1RF2D 4KK7A 3FKIH 1VQKA 2QCPX 3NTIA 1EY9A 2KHIA 2K28A 2ZJRA 3BYYB 3N6RA 4DK6C 2F0UA 2ZM6L 2JQOA 4YWLA 3BVZA 1Y1WG 1TT2A 5C3EG 3OIPA 2PI2A 2WACA 4GOPC 4HR7B 2CVRA 4KKSA 4RGNA 1XPRA 4OWWB 1PH1A 1YIJA 4LF8L 1B3AA 3S15H 1I50B 2Q8RE 1G291 1EYDA 3MEHA 1K8MA 5EBCA 4QIWB 2OWOA 1STYA 2HDMA 3K5OA 1W3SA 4A3JB 1UE7A 3H3VH 1U5KA 1XMOQ 3OSOA 4A3CH 4IFDG 4A3IG 5C0XG 3HOYH 2Q8IB 5IWAQ 1GM5A 1G2TA 1F2ZA 2A6EC 5KNBA 2WV6D 3D6CA 2J7ZA 3NPPA 1HQMC 1QVCA 2HUGA 3OMGA 1FNWA 1GUSA 2C35B 2QKIC 2CWPA 4JBKA 3K0YA 4KHPL 4RG1A 1IW7D 1U4RA 1NMGA 1EYAA 5JPMC 3J81L 4A93H 4CKCA 2H4OA 5JJZA 4DXGA 5C4XB 2UUCL 3LWEA 1GUGA 1JWSD 5KEEA 3PGZA 3TRZA 1QNKA 3WOEA 1DXMA 5GAEC 2QA4A 1ENAA 4J15A 3DM3A 4IOCA 2B2WC 4DV5Q 4HJ8A 2NBFA 4JK1C 2RVLA 1VQ4A 1SNDA 1SDFA 3HOZH 3IKJA 4KHPQ 3H91A 4A3MH 3MVVA 4K14A 4CDCC 1DM0B 3S24A 3CCMA 3E0EA 4DAYA 3R8BA 3WWVA 5IP7H 2NZ1D 1ESFA 2PPBC 3EVQA 2CH4A 1YITA 1TWFB 3HKZG 4FF1A 2EY6A 3CRKC 3PUZA 1C48A 1I94L 2WAQB 1L1OA 5JVH3 1EY0A 2HQEA 1ZYRC 2L5TA 5C4JB 5KGUA 5C5MA 3VR2A 2CCZA 4BY7G 5E4WC 2MQHA 4L5RC 2PYKA 5CR3A 2MJ8A 4EQOA 3KDFA 4DV2Q 2E2DC 3K7AH 3JC66 4JVZA 1LTLA 3URYA 2EYOA 4A3EB 3MXUA 3AYHB 1ONLA 1IXRA 1IBKL 4RCNA 2I5MX 4IPDA 3ER0A 4NKLA 3NWTA 2IJ0A 5J1ZA 2P5ZX 4HCSA 3KF6A 1NE3A 3BJUA 3D0FA 3I70A 3HFZB 3S9WA 3LGJA 4GN3B 1XNQL 1BO0A 3QIAA 5ELDA 1QUQB 2DY7A 1SYCA 3D8GA 1KAAA 2JA7B 2N55A 1FD7D 1BF4A 3NP8A 1KDBA 4POGA 3I4MH 2Z1CA 1LV9A 1PVOA 1PFBA 4PZ8A 4G7OC 2VL6A 1WTWA 3D31A 2MNAA 4AH6A 1IBKQ 4BA2I 1SSOA 3SHLA 1PA6A 1FYCA 2IY5B 4DNRB 1B44D 4KY7A 2I0QA 3CC4A 1K83H 4AYBB 1XNQQ 4HSPA 4IURA 3ICEA 3BG3A 4GNXB 1GO3E 4FXKC 4IPCA 5C44H 3FVQA 4RWSC 1A62A 4XTCS 1WTHA 3GTQH 1WI5A 4JI1L 4BBSG 1JICA 2PW7A 1IKLA 1FL0A 1XYIA 2K7VA 2EY1A 3CAMA 2RSOA 3TZUA 5DM63 4GN5A 5A2QL 1BVSA 2EJGC 1EQRA 4RGMA 4FF2A 1QVFA 1EUJA 1NJIC 3U4VA 5G3LF 3VR5A 5DAUA 2PW5A 4NPSA 2FMMA 3P20A 5E1FA 1II3A 4OX9L 2MHVA 1SYDA 4JI5L 3PO3H 1EZ8A 1FGUA 4JI1Q 2NTTA 4QIWE 1KDCA 2F0IA 3H09A 4C3HB 1JJGA 2RA4A 3JAME 1FVIA 3UDXA 2Y0SB 5IYDH 1HA5A 1VQHA 1KD1C 1XWEA 1PZID 4Y7NH 4B08A 1LACA 5CC4A 4DR5L 1LT5D 4QUFA 3STBD 4X65Q 5JEAG 4OX9Q 2ZXRA 4JI5Q 2O4XA 1B2TA 2UXCL 5K36G 3NWSA 1LUZA 2N88A 1Q8KA 4XQJA 2D62A 2F4IA 4KLKA 1SJED 3J7ZC 3X3MA 1C8CA 1F9RA 1SYBA 3TQYA 5F2DA 4HIDA 2VQEL 1EOVA 2EQSA 1E2WA 1RCVD 2AWOA 4J8QA 2R61A 1F9PA 1FGBD 1TWHB 1I50H 4WJ4A 1V1OA 2KOLA 3PF5A 4A3LG 5IOCA 3ERQA 2A8VA 1TWCB 3J81c 4NW2A 4A3JH 2B8FA 4F8MA 2GVBA 3NBHB 2L15A 1WTQA 1K0SA 1HJPA 3LWUA 2K5VA 3QWNA 4BY1B 3M85A 1F2LA 1D5ZC 1CTMA 2F0PA 3GD7A 3OHXC 3KJPA 4J1MA 3JAMi 4RKBA 4DPGA 3KBGA 1ESRA 3PIPA 1O7YA 4IZ8A 4B9WA 1JE4A 2WAQE 2KUMA 4K2KA 3W1GA 1VF5C 2L11A 3C1FA 1HZCA 4IOAA 4JV5Q 2GA4B 5C4XH 1U0LA 2F0HA 1MSGA 2ICEC 1U4PA 1F2YA 1X9NA 3ZYYX 3FDTA 3K7UC 1HXYD 3P1HA 2D9UA 1KTKA 5GAGC 4R8NA 1CKOA 2RSNA 2L0CA 2EYFA 4A4IA 5LHY1 2JA6B 4RH6A 4QMGA 1D8LA 1VF7A 1XNRL 1N8RC 1RTNA 3KK7A 2B2UA 1PRTF 1D1KA 4YWKA 2B8GA 2K1BA 3I4NB 1TWFH 2D5DA 3MAQA 1CA6A 1AE2A 1TWGB 1KLUD 2ASBA 3NXWA 2Q2IA 3I3CA 3UDIA 3OW7A 3FPUB 4CKBA 1I6VC 1LM0A 5C4JH 5CV5A 3D4WA 5BN5A 2C5CA 3K8AA 3T16A 2EYMA 1XNRQ 2F4VQ 4OL7A 1T9HA 5I6WA 4RAUC 4DK1A 4AYBE 5FLMH 1ASZA 1UE1A 3J81j 2QDBA 1JOOA 3PV0A 3NK9A 1SRUA 1F9QA 4A3EH 2GVAA 2VY3A 4MN3A 1EY7A 1A2UA 4X3TA 1ILPA 1LLRD 4DN4M 4OIKA 2A6HC 1EY6A 3E9IA 5HURA 5KYIA 3S2HH 3DWPA 1WTOA 5COYA 4LF5L 1JORA 4ZAIA 1LTGD 1BXTA 2KA7A 3CPFA 1U4MA 4ABNA 3NTHA 4POFA 1F9SA 1BOSA 1Q12A 4C3IB 1A3UA 4JG2A 3S1RB 4GS3A 2JA7H 2XRSD 1PH4A 3GV3A 1I3QB 4DF7A 5IY0A 4XQNA 3VYSA 4BS9A 2RDFA 3VR6A 1F77A 5IGDA 2E2IB 1KAWA 2OXPA 4A3KB 2LXJA 5E3FA 4PMWA 2NVYB 1GUTA 3NTKA 4UHVA 1PV4A 3BDCA 2WIIB 5I4DA 1ET9A 3V05A 2CQOA 2Y0SE 1JT8A 2C9OA 3FMCA 2IX3A 2VS1A 3S1NB 1IBLL 1MI2A 1Q1EA 4LK1C 2LKVA 1HR0L 1BR9A 1MJEA 4P75A 4ID6A 4TVAB 3OW2A 3TBIB 5C3EB 1YZ6A 3H3VC 5BR8Q 3Q0AA 1CKNB 4R4QA 3P7JA 4OO1G 1A6XA 1NY4A 3CCEA 1K3BC 2F0GA 1JOQA 4DA2A 2B2TC 1YNJD 5JAVA 3V96A 2PO4A 3W2DA 4BBRG 1FNUA 2WP8J 1IBLQ 1E24A 1E0BA 1SN8A 1HR0Q 4AIMA 4GLVB 1K8GA 2E8GA 1SE4A 2F3WA 3PIP3 5FJ8H 1E22A 2JE6I 4A3IB 3C46A 2YTVA 3PCOB 2DY8A 4WORA 3MXNB 2O2LD 1HTPA 1WD1A 4C3HH 4RGOS 1A15A 1TS3A 2DJGC 2XVSA 3DUZA 2BH2A 4DR6L 3R3OA 2QEXA 1X3GA 5EBDA 3CCQA 1V1QA 1OO9B 4P2CB 5FLXE 2K04A 3S1QB 1K8OA 4HN7A 1CQFA 1JE5A 1H9MA 2UUAL 1PH2A 4MNOA 4DV0L 1LT3D 2OT2A 2R93G 1WTRA 1PYSB 1PH8A 3KF8B 1S5BD 2RHQB 3I55A 1MKHA 1SNCA 4NMZA 1SE2A 3M4QA 4R1JA 4ZCKA 1LT6D 5CORA 1QVGA 1K3RA 2HIXA 4IUPA 1V1PB 4OELB 3MTSA 3QOLA 3PUXA 4FO2A 1O7LA 1RD9D 1VQMA 3CMAA 1ASYA 1E3PA 4N8FA 4B9XA 4PMBA 1G6PA 2ALYB 4GKJL 1X55A 1TWHH 2R7FA 4KMUC 2PZWA 1A2TA 1PMRA 3S1MB 4IUVA 4B3TQ 4R4CA 1WOCA 1Q81C 1GUNA 1TWCH 1DOMA 1VQBA 1LO5D 2VUMB 1YNND 5T1GA 3HKZB 1NCVA 2LY7A 4DAPA 4C3JG 3DXJC 2D2CC 2ZXOA 2Z6BA 3G71A 4KD3A 2VQFL 1VQOA 2F3VA 4QUCA 1Z6HA 2F0FA 2Z4HA 4BY1H 4OWTB 1C0AA 2OCEA 3BZDB 4GKJQ 1GHKA 4PZ7A 3SK4A 4JI6Q 1JC7A 1QOHA 2XWBB 2L9HA 3MHBA 1STAA 4IUTA 1Y14B 3FKIG 1UE6A 2KCNA 2FINB 5ELNA 2I5LX 1SMYD 3CMEA 2EOTA 1KRTA 5CBAE 3RNUA 2O5IC 1KNAA 4R4OA 3SDZA 2Q2TA 2VQFQ 2BE5D 4LFAL 2K5NA 3B6YA 4S3SA 4QCLA 4LF4L 1MSHA 2KCMA 1JOKA 1HUNA 1I4RA 2XTIA 3EQLC 4F87A 2HHHQ 2DGYA 2Z6KA 4NXNQ 3ND9A 1S5ED 1RTOA 2JA6H 1MBYA 4NB3A 3RLFA 2RQXA 3CCRA 3OIQA 3CF5A 1YBYA 4JPBW 1WTXA 2PCFB 4A3CG 4LFAQ 4KTAA 3I4NH 4X64L 4HTHA 3HOYG 2B3GA 4YIJA 1TWGH 2K14A 1S72A 1GJXA 3NSWA 1PYBA 5FO7B 2KENA 1U9RA 1SYEA 1KQSA 3CCVA 2HCCA 2Z0SA 2XN9C 5IGBA 1VQ6A 2JA8B 2NUCA 1HZAA 1XMOL 1B8AA 1VS0A 5E4XA 4TRDA 4ILWA 1IBML 5I6YA 2K5QA 3G6EA 3D4RA 2OF1A 3A8KE 4A93G 4R4IA 5IWAL 3E5SA 4RHRA 4F88A 4X64Q 4JI2L 2LS01 4BBSB 3D4DA 2K05A 1G2SA 2F0OA 5ELCA 4RHSA 3KLSA 4K5WA 1M1KC 1NNXA 2K50A 3GO5A 4DR3L 3RMHA 4X3KA 4FVMA 5J39A 4HJ7A 2K52A 1IYUA 4DUZQ 4LF6L 2E2JB 1IBMQ 3OYYA 5IT9L 3T1YQ 1VQNA 3S2DB 4IJLA 2I5HA 4JI2Q 4C2MB 1YJWA 4C3IH 5IP7G 1LTSD 1SR3A 1STEA 1S5FD 2VZAA 3S1RH 1K0RA 4DV5L 1I3QH 1QUQA 1DOKA 1OXTA 1EWIA 5KIXA 4DR3Q 2B63B 3R2TA 5M3MB 1XMQL 2E2IH 2CW0D 4LUOA 4M8AA 3K57A 4A3KH 4LWCA 3J7AF 3MA2B 4LF6Q 5EPLA 1HQRD 4M1UB 2NVYH 2KJXA 1LTTD 4LJZC 1SNPA 5DM73 4AQYL 3DM1A 3S1NH 2DJFC 4LW1A 3SE0A 5M5WB 1LTBD 3UDGA 1BKBA 5JOBA 5C3EH 4PMCA 4GNXA 5IYCG 2Z8LA 1XMQQ 1WYDA 2F0NA 1QILA 4RKLA 3NENA 5M3FG 4K2LA 3GTGB 4DV2L 3M4OB 4CHTB 3S17B 2EPBA 1Y1VG 4AQYQ 1TKWB 2F0MA 3PSIA 1WVLA 3F2BA 2K01A 3AFQA 1ICWA 5C3WA 3F2CA 2VXWA 4C1NI 1PTOB 1V8QA 2NN6I 2VW9A 4A3IH 1TS2A 3BYTB 4P73A 4RFBA 2HD3A 1RIPA 2KCTA 1NR4A 1CHQD 4A3GG 3HKZE 4EQ5A 2FXQA 4IALA 2PQAB 4JOIA 5IGCA 2N78A 2Z6KC 4LFBL 3LX0A 4CKEA 3S1QH 4LUVA 5J3BA 5HGTA 2IW3A 4LMQD 1YHQA 1WCMG 1GOZA 2PNHA 3D6WA 1SYFA 4X62L 1AH9A 1G6ZA 5C44G 4K6DA 5ELFA 1X56A 3QG1A 1Q1BA 2NVXH 4FF4A 5IGEA 3WOFA 4DNTB 1XPUA 3RLOA 4C1NK 2CQAA 4LFBQ 3I56A 1PDQA 1SJHD 4I7ZC 1TR5A 1PFNA 2IHFA 3A0JA 2AWNA 3S1MH 2CFMA 2EXDA 5ISRA 4X62Q 3C2PA 2VUMH 2NVTB 2EJFC 1SAPA 3I4LA 1MD2D 3BZKA 5HGQA 3TEHB 5CYUA 5M9OA 1U4LA 2KCCA 5JJIA 2JYOA 2YV5A 1HR0W 3NBHA 4XXEA 1M8AA 3HOVG 3DEOA 4PZ6A 3NE5B 5IYDG 1JJCB 1VMPA 2X69A 5IIFA 1ZKOA 4HSVA 3PF4A 1VQEA 5GQOA 3D3RA 3PO2B 5IYBH 1N9WA 2QGQA 4ZUJA 3GTOB 1KL9A 2ZTDA 2B29A 4K8JA 1R9TB 4DK0A 2O5JC 3ULJA 2XSCA 1IL2A 3K81C 5CBEE 1PH7A 2L12A 2F0WA 1IKMA 3W3AA 4JI0L 4X65L 2JA9A 3TP5A 4ZK9B 2JEBI 3GV6A 2WB1G 4ZRZA 3NQIA 1D1IA 2R92B 4X66Q 3CPWA 1Q82C 1EU3A 3PUVA 2XNAC 3KLSX 4GNXC 4IO9A 1HHVA 2B39A 1EIHA 4BA1I 4HJAA 1BCPB 4CDFC 1Q46A 2R7ZG 2SNSA 2MP1A 4JI0Q 1YHAA 1BBWA 1NMFA 2CH4W 4R9WA 3TZDA 4ZKCB 4U673 5A35A 1BBXC 5T1IA 1HCZA 2NN6H 2JA8H 2AMCB 4IFDJ 5IT9c 5C0XJ 5EAYA 2HCIA 4DFAA 4Y52H 2DNCA 2WKCA 1L1OC 3MC0B 1YHBA 2KHJA 4A3DG 3RZOB 3NUCA 1ZEQX 4FP5D 4BBSH 1TVXA 2K32A 3DMUA 3HOXB 1Q8IA 1WTPA 2H5XA 4JOIC 4XT3B 2JN4A 1J6QA 4EGVA 1EL0A 1UE5A 4N9PA 3RD4A 4QQBX 1AEXA 1KABA 3RN5A 3P75A 4BBRB 1SE3A 1QB5D 1XTCD 1KNEA 2E2JH 1E7ZA 5D14A 4JV5L 1EFWA 1TIID 3S2DH 3K59A 2A68D 5EKLA 4C2MH 1UEBA 4O0AA 2CWAA 1EEFD 1X3EA 3DLLA 2VB2X 3TS2A 4YHHL 4A3BG 1ZYRD 5ELBA 3UE1A 4WJWA 2B63H 1D5MC 5M3MH 3GTMB 1I6HB 1QZGA 3CKIB 5JPNC 3IRBA 2PMZB 3HP3A 3HOUG 1GUWA 4RCOA 3HGBA 2E76C 2OQ0A 2R93B 2JSOA 3Q6SA 5JEAH 1GUOA 3DEPA 4H44C 1A3VA 3Q24A 1YNXA 5K36H 1PTOD 3H0GB 4NDXA 5M5WH 2A5HA 1CSQA 5FLMG 4YHHQ 4ZYSA 1O80A 1UAPA 3SK6A 5LMNQ 5EPJA 1M90C 2N3SA 3JAML 3EFXD 5I9PA 3K0XA 2HIVA 2F4VL 2G9HD 3GTGH 1CKNA 3M4OH 4A3LH 3S17H 4XYOA 2SEBD 1AZQA 2CKZB 5IODA 1HTLD 1PH5A 5C3XA 1IHZA 3HOWG 3Q8DA 1YJNA 3TS0A 2BA0A 4K6LA 1PTOH 4XYQA 5GADC 3U9OA 2MUYA 4FDBA 2WFWA 3L0OA 5KRUA 4H7BA 1XPOA 1X3FA 4OXPA 1EQVA 3W1BA 1KC8C 4K0KQ 3KUPA 2UXDQ 1SMXA 2A74C 1JB7A 3G6JB 1N33Q 4OO1I 1PXUA 3A7LA 3RN2A 3MXNA 4ZKBB 1EIGA 1STBA 3K6OA 5DLQE 1VQPA 1S5CD 4DNIA 1XXGA 3M3YB 1XTDA 5JJLA 2IX0A 4ULLA 1B3QA 4OONA 1SMYC 3SK5A 3CC7A 3A7AB 4LAAA 1IZ6A 1AW7A 1CT1D 2JA5G 3S16B 1HNXQ 3KF8A 2R3ZA 3KOJA 4Q5VA 3A55A 4BXXH 3CCJA 4O42A 3H15A 2A69D 2D0PA 5KYLA 4JW0A 4KHVA 2EY5A 5EKKA 1PRTB 1V1PA 1B1ZA 3EN2A 2ICIA 2G5DA 1R4PB 4B3ML 4PQXA 2F1MA 5BR8L 4IQZA 3HG9A 1KLGD 4CJ1B 1J5EL 2NVTH 1NSNS 1AP0A 5IP9H 4N8X1 1SLJA 4DGZA 4RMFA 5CV4A 4FXDA 4C3HG 2KVMA 1JWUD 5M5YB 1IYVA 4DV4L 3CD6A 2SDFA 4HMJA 1LTAD 1RKNA 2E74C 4IUQA 1EOTA 2YYZA 1Y1WB 4B3MQ 1PZJD 4DK3C 3U50C 3PO2H 1AZPA 3UDFA 3I72A 1J5EQ 1PH3A 2AUKA 3GTOH 2ENBA 2DNEA 1EFID 4GKKL 3U4ZA 5C6AA 1R9TH 2N49A 4WJ3M 5J22A 1BCPD 3SGIA 1TU2B 2G9DA 1HH2P 2F0KA 4DV4Q 2IX1A 1MJCA 3E6ZX 1UEAB 3A8JE 5JEAJ 1N36Q 2D0OA 2AUJD 1B70B 4GLXA 4CJ0B 5D65A 4GKKQ 2R92H 4HAEA 1EIYB 3BVMA 2V1CC 2B2YA 5EJWA 3PQIA 1EIFA 4HCEA 4DR2Q 5GAHC 1ET6A 4QF4A 5G3LD 4L8JA 4JBMA 2HQLA 3A74A 1QJOA 2XIWA 5LL6X 1S5DD 2B2UC 3TREA 4B3TL 3DWQA 2A1AA 3NQTA 4EQNA 1IW7C 2CW0C 1Q86C 2EVBA 4KN4C 3GTJB 2EYJA 1A3TA 3I91A 4OWXB 3MXGA 2PMZE 2FJ2A 2RDHA 3RZOH 1N34Q 2AQ3B 4OO1H 4J6HA 3F1ZA 3GTLB 3HOXH 3CCUA 1R4QB 4B3SL 2I07B 4JI6L 4U68A 1V9PA 3CU7A 4O2DA 4OEMB 1QE6A 2MO0A 5M3FB 3ERSX 3T13A 3HZXA 1H95A 1FNVA 4P74A 3VR3A 2UXBL 2IHEA 1Y1VB 4QL5A 2WKDA 4BBRH 1P16A 2F0TA 1W6KA 2EY2A 3O13A 3KBXA 1LTID 2QW7A 5C4ZA 3GQBA 1CZWA 1W2BA 4DAVA 1K8AC 3VYRA 2Q2HA 2EZVA 4V190 3CCSA 5EGTA 1UWVA 1SXTA 2F0SA 4HIMA 2K5HA 2KECA 4A3FG 2YTYA 4B3SQ 1TY2A 4KN7C 4BY7B 4A3GB 3K58A 3I4NG 1Z47A 5TSSA 2EE1A 5IGFA 4IUUA 3U58A 2HHHL 4ZLTF 5I2XA 2L1BA 4NXNL 3JAMc 2UXBQ 4DV6L 2B2WA 3GTMH 1I6HH 2KQ3A 1QCBD 2OTLA 1EWCA 3CHBD 1E1OA 2E2HB 3J7YW 3BZCA 1AE3A 3UI2A 5EPKA 3IAYA 2A73B 1UNSA 1JCKB 1EY4A 1EZ6A 2R93H 1WCMB 4F7XA 5IE8A 1SBBB 2K5DA 3R2IA 1VQCA 2NTSA 3R93A 2UUBQ 4IFDI 2RKSA 1CFMA 2F0QA 2QEJC 3H0GH 5C0XI 5M5XB 2OTJA 4DU9A 3S14B 2RHSB 4X3SA 2F0LA 1H9KA 4JYAL 3F2UA 3FPPA 3HS0C 4DV6Q 4PNYA 2Z4IA 5D3DA 3C3LA 2RF4A 4H0LC 4DV7Q 3NELA 5FLXL 2H1EA 5CMDA 4OGQC 5C4HA 3CP0A 3VA5A 2EDGA 4GOPB 4DR4Q 1ENFA 3T56B 1PFMA 4UAIA 2UU9L 3MFGA 3TN2A 4C3IG 4JYAQ 1Y8OB 3I8ZA 2K5WA 4PV1C 3RUZA 4DUZL 5DEHA 5EKIA 3I90A 3HRZC 3HOVB 5D3IB 1K9MC 1N32L 2GN5A 2TMPA 3J80E 1HRJA 1CQVA 3A8IE 2NWGA 4JI4L 3T1YL 4A3KG 1PRTD 4JI8Q 3TDQA 3IFTA 2PQAA 3UE0A 1CKMA 1VQLA 1PYWD 2UU9Q 3M7GA 5LL6S 2TSSA 1EY8A 4G57A 3M3YH 1VQJA 3VR4A 1HPCA 4MTNA 5FO9B 1I4XA 2B2YC 3GDEA 1SE8A 1Y8NB 3V2TA 3HOZG 1N32Q 3S16H 1VMCA 3FP9A 4A3MG 1ML0D 2DN8A 3CRLC 4JI4Q 2WINB 2YU9B 1LYLA 3J81i 4K5XA 2F0EA 4CDDC 1PH9A 1L2FA 1NUCA 1V43A 2WB1B 3NEMA 2F3IA 5LMNW 1Y69U 2CHBD 2F03A 2EXZA 2NYZD 3EIVA 1VQAA 2XWJB 2ZM6Q 1D7QA 4P71A 5K5PA 2R7ZB 1VQIA 2E75C 3ULPA 4V0BA 2QILA 2EYLA 2AKWB 4LF8Q 1PTOF 3KFUA 2KEEA 5M5YH 5CV8A 3BU2A 2K33A 3J80i 4LF7L 4FNFA 3VA7A 3MZ5A 1FR3A 3STBC 1Y1WH 3G48A 5JVG3 1DONA 2ZXPA 3J7A5 4C56C 1OTCA 1B7YB 4MIUA 4A3DB 3H94A 4CGYB 4HJ5A 3VDYA 3BVGA 2BH8A 4EVOA 2Z9HA 3F8TA 1L0XB 4APVA 4X3UA 4I65A 1H9SB 1YVCA 4DUYL 3AFPA 2EJMA 4DKAC 3BDOA 4YY3L 2K6AA 1HNZL 4A76A 4LF7Q 1T5XD 2FFKB 4H13C 3QR8A 1TY0A 2XRQD 1VQDA 3PMFA 4IUNA 1ZXTA 1DOLA 4IN3A 4IFDH 3AEVA 5C0XH 2AQ2B 2BCOA 3I4MG 3J80L 1M4VA 1DJRD 2NZOA 4XQQA 1MHWC 2UUCQ 2VUMG 5A2QE 1EY5A 2L55A 2Q8TA 4DUYQ 1S40A 4A3BB 1KIXA 4YY3Q 2B2VA 1HNZQ 2JXMB 2A68C 1YEZA 4HIOA 1A63A 2N8NA 4YCWA 2M00A 1KRSA 4L63B 1QG7A 1DYQA 1QZHA 4LF9L 3HOUB 4ALPA 1X6OA 1D2BA 1JB3A 3GTJH 4WRDA 4KY5A 5IYBG 1WFQA 4KJOA 5FO8B 1GD7A 2AQ1B 4OHJA 1PZKD 1GVPA 3L9AX 1JMCA 4NP5A 2JEAI 5IYCH 1RODA 1PTOC 3GTLH 3FRPB 1I94Q 1F2MA 3CXCA 3H6MA 5M3FH 4LF9Q 4DR7L 1E2ZA 1JJ2A 1NTGA 2LFNA 3S2HB 1VQ7A 1KHIA 1Y1VH 4GZYC 3OOCA 1H9JA 3PO3G 3PUWA 3HOWB 4QB4A 4JC0A 1O7ZA 1VQ9A 2M2LA 1NBWA 1ICFB 5CV9A 3TSSA 2IPKD 4BY7H 4A3GH 4DV3L 4RA8A 1WD0A 3GTPB 3F2DA 4DR7Q 4KY6A 2YTXA 1E2VA 2EIFA 3M4YA 2ZTEA 5I9OA 2RBMA 1MIUA 4X66L 5FLXc 2E2HH 1BCPF 4A75A 1Y8PB 3T1HL 1Q7YC 1A0IA 4ODGA 1STNA 4DAMA 2NN6G 3U9SA 2JA8G 1WCMH 1B9NA 5AFWA 1RL2A 1Q90A 4TKOB 5M5XH 4ME3A 1NAPA 4DAYB 3S14H 4DV3Q 5ELEA 2JA5B 3L2PA 1TXYA 1X3PA 2KBNA 3E9HA 1K28A 1BNZA 4UP7A 1CHPD 3AU7A 3T1HQ 5KNDA 4A3JG 5L37A 2EYPA 5AJ3L 5LMUL 1L1OB 3K5NA 1IYJB 2A6ED 3HKSA 1FJGL 2MPMA 1G91A 2A69C 1OXXK 2JJQA 1B53A 1WJJA 1HFNA 3GTKB 4G7HC 2WB1E 3I4OA 2R7DA 3KDFB 1QWYA 4G7ZC 3NHHA 1Z7TA 1I4PA 2ID0A 4Q0FA 1DGSA 4FF3A 1SNQA 3HOVH 2B63G 5M3MG 1X54A 1CA5A 3CCLA 4LNQA 1IL8A 3ONAB 5AJ3Q 5H1SE 5LMUQ 1GXDC 1FJGQ 1EWHA 2BDNA 4GN4B 1BQQT 1QNUA 5C4XG 2F52A 3RLNA 3KF6B 2JK8A 4JCVE 4JI7L 1I4QA 1VQFA 2MFIA 1LABA 3QOJA 3WDNA 2B2VC 3FHWA 1OXVA 3DWAA 2ZTCA 4KD4A 2XGTA 4DR1L 2QF7A 3RZDB 1X3QA 1YNJC 1STHA 1BCPC 3EJIA 2YU9H 4HJ9A 2NVQB 5E7NA 4KKTA 4DR5Q 3X3NA 1P8LA 3T51B 2JP1A 4R4TA 3AQQA 4JI7Q 2PQEA 2UXCQ 1B50A 1O7IA 3OWEB 4QGUA 1L0YB 2ZJQA 5LMNL 1O78A 2X6LA 3M7NA 2F0VA 2WAQG 4KHZA 5EQ0A 2VQEQ 2ATWA 4DR1Q 2R7ZH 3PIOA 3EROA 2DUDA 4LFCL 5GROA 1S3OA 3SK8A 3CW2C 2K75A 2RDGA 4HMIA 2B2TA 3PUYA 1D6EC 4RGTA 4JBWA 2X6GA 1OXSC 3J80c 3M4PA 2PI2E 4A3EG 1X65A 2KHSA 4A3DH 1HA6A 1Z9FA 2BDOA 4EX5A 2M9VA 4K0KL 2UXDL 1I4GA 2LSSA 4N9TA 4CJ2C 1I4HA 3IL8A 1GKHA 3W5OA 1N33L 1SFOB 1SROA 3E3XA 4R8IA 4LFCQ 1ILQA 5DNFA 3RR5A 4BXXG 3QJYA 1NR2A 4YCUA 2LXKA 3G7LA 2NB0A 4CBVA 4C3JB 2JA7G 1DZ1A 3ITPA 4I7AA 2K03A 5FKAC 5JJKA 1YNNC 2PZTA 3CQZB 2SNMA 1TWAB 4A3FB 1PLFA 1HNXL 3L7ZC 1VQ8A 3T53B 5IP9G 3K80C 3OTOL 1LT4D 4P72A 4A3BH 4HEDA 3FKIB 3GP7A 3ULLA 4AYBG 4KI0A 4Z9CB 1SYGA 2A19A 3HOUH 1S4ZA 1B9MA 1TS5A 3ZJYC 1D5XC 1C7YA 2OEOA 3C1EA 3BS1A 3CC2A 3ND8A 3T4AC 3PO2G 4B3RL 3OWFA 1BBUA 3SR1A 1C4QA 2BE5C 3OTOQ 5CGKA 3S15B
chains in the Genus database with same CATH topology
3I4NG 5IYDH 1Z47A 4JI3L 3NENA 1HNWL 3U58A 5M3FG 2HHHL 1VQHA 1KD1C 3JAMc 4NXNL 4DV2L 2UXBQ 4DV6L 4Y7NH 4IPHA 3GTMH 1I6HH 2OTLA 1Y1VG 4AQYQ 1E1OA 4DR5L 4X65Q 3STBD 3BZCA 1AE3A 5JEAG 4OX9Q 1OXUA 3PSIA 4JI5Q 3F2BA 2UXCL 3AFQA 2R93H 5K36G 1LUZA 5FJ8G 3F2CA 1Q8KA 2D62A 5IE8A 4KLKA 4B3RQ 3HOWH 3J7ZC 1VQCA 1HZBA 2NN6I 3TQYA 2VW9A 4A3IH 2UUBQ 4IFDI 2OTJA 5C0XI 3H0GH 4P73A 2R92G 4HIDA 2VQEL 2RHSB 1RIPA 2KCTA 3EBEA 1EOVA 4H02A 4JI3Q 4A3GG 2EQSA 4JYAL 2Y0SG 1HNWQ 3HKZE 4EQ5A 1YJ9A 2AWOA 2FXQA 1VQ5A 2PQAB 2E5LL 4JOIA 4QJFA 4DV6Q 1N36L 1I50H 3GTPH 4WJ4A 4IJHA 2N78A 3PF5A 2Z6KC 3I7FA 2RF4A 4DV7Q 4A3LG 4LFBL 3S1QH 3NELA 4LUVA 4LUZA 5J3BA 4GLAC 4LF5Q 2A8VA 3CP0A 3J81c 4GOPB 4A3JH 4DR4Q 1YHQA 1WCMG 2R6GA 2GVBA 3NBHB 2L15A 2PNHA 1HJPA 2UU9L 4X62L 1AH9A 2K5VA 5C44G 1X56A 3KYHC 4X6AH 1Q1BA 4JYAQ 2NVXH 4DR2L 3M85A 2E5LQ 3GD7A 2RCNA 3KJPA 3JAMi 4IPGA 4UP9A 4DPGA 4DUZL 2JA5H 3RLOA 1XPUA 3PIPA 1K9MC 3HOXG 3I56A 4LFBQ 2GN5A 1N32L 1YI2A 4JI4L 3T1YL 2WAQE 1KXLA 4A3KG 2IHFA 4JI8Q 3A0JA 3W1GA 2AWNA 4YWMA 3S1MH 2CFMA 1HZCA 2EXDA 2PQAA 3UE0A 1CKMA 1VQLA 2UU9Q 4X62Q 1I5FA 4JBJA 4L5SA 4IOAA 4JV5Q 2VUMH 5C4XH 3M3YH 1VQJA 4QY7A 1N34L 3G4SA 4MTNA 1U0LA 3GTKH 3BZKA 4BY1G 3GDEA 1X9NA 5HGQA 4UP8A 1SE8A 3K7UC 3TEHB 2ZJPA 4GOPA 5JJIA 2YV5A 1HR0W 3HOZG 3KJOA 1N32Q 3S16H 3HOVG 4A3MG 3FP9A 4PZ6A 5IYDG 4JI4Q 1JJCB 5GAGC 2ES2A 1CKOA 1LYLA 4A4IA 1EYGA 3J81i 4L5TA 4UY8C 1D8LA 3PF4A 1VQEA 5GQOA 1PH9A 1L2FA 1V43A 4UPAA 5IYBH 1N9WA 2QGQA 1N8RC 1XNRL 3NEMA 2F3IA 5LMNW 3KLWA 1A8VA 1KL9A 1G51A 4YWKA 2ZTDA 3EIVA 2B29A 5HY6A 1VQAA 1TWFH 2ZM6Q 3H3VI 1D7QA 1AE2A 4P71A 3ULJA 1VQIA 1IL2A 2ASBA 2Q2IA 3H0GG 3K81C 3UDIA 3ULPA 1PH7A 1PHJA 2NZHA 1VCIA 4DV1L 3I2ZA 4JI0L 1LM0A 2AKWB 5C4JH 1EQQA 1CUKA 4LF8Q 3KFUA 4DR6Q 5M5YH 4X65L 2JA9A 3BU2A 3K8AA 3J80i 3RZDH 4LF7L 1XNRQ 2JA6G 4MZ9A 2F4VQ 2JEBI 2UUAQ 2IT1A 2WB1G 3STBC 1Y1WH 1T9HA 2NVQH 3G48A 4YCVA 3A5UA 4DV0Q 4TQUS 4L5QA 4X66Q 4AYBE 3CPWA 5FLMH 3PUVA 1Q82C 1ASZA 1UE1A 1XJVA 2Q2UA 3J81j 3J7A5 4PG3A 3PV0A 1OTCA 1B7YB 4GNXC 4IO9A 4NXML 4HJ5A 3VDYA 2BH8A 1SRUA 4A3EH 2GVAA 2VY3A 4BA1I 3F8TA 4HJAA 4APVA 2R7ZG 1Q46A 4DV1Q 4JI0Q 1YVCA 4DUYL 1YHAA 3AFPA 4DKAC 3E9IA 4YY3L 4DV7L 1BBWA 1NMFA 1HNZL 2OQKA 4A76A 3S2HH 4LF5L 4LF7Q 1L0WA 2VNUD 1VQGA 1HZ9A 1VQDA 3CPFA 4DR4L 2JA8H 2AHOB 2AMCB 4POFA 3AEVA 4IFDJ 4HIKA 5IT9c 1Q12A 5EAYA 5C0XJ 3I4MG 4Y52H 4JG2A 1L1OC 4GS3A 1E1TA 4NXMQ 2JA7H 2NZOA 1PH4A 1YHBA 2KHJA 4A3DG 2UUCQ 5IY0A 3A5ZB 2VUMG 4BBSH 4DUYQ 1S40A 3UDXA 1KIXA 1KAWA 2BA1A 2H5XA 4YY3Q 4JOIC 1HNZQ 1PFSA 1J6QA 1YEZA 3MEFA 4HIOA 1PH6A 1A63A 2LXJA 2N8NA 4YCWA 4PMWA 1UE5A 2K4KA 1C9OA 1KRSA 4QQBX 3M9BA 1SFOH 1PV4A 3RN5A 4JI8L 1QZHA 2CQOA 4LF9L 2Y0SE 5ELOA 1JT8A 4ALPA 1X6OA 2VS1A 2E2JH 1E7ZA 4JV5L 4XIGS 1EFWA 1IBLL 4C3JH 1Q1EA 3GTJH 1HR0L 2HT1A 3S2DH 2MO1A 4P75A 1MJEA 5IYBG 1WFQA 4TVAB 3OW2A 1YZ6A 4C2MH 1GD7A 1UEBA 4O0AA 5BR8Q 2CWAA 3CQZH 1X3EA 1CKNB 1TWAH 4R4QA 3DLLA 4OO1G 1GVPA 4A3FH 1NY4A 1JMCA 3CCEA 4YHHL 2JEAI 5IYCH 3TS2A 4A3BG 3UE1A 2B63H 3GTLH 1I94Q 5M3MH 3CXCA 4LF4Q 1K73C 5M3FH 1CSPA 4LF9Q 1QZGA 4DR7L 3FKIH 4BBRG 3IRBA 1VQKA 1JJ2A 1NTGA 3HOUG 1VQ7A 1KHIA 2WP8J 2KHIA 1E24A 1Y1VH 2OQ0A 1IBLQ 1SN8A 1HR0Q 4AIMA 4GLVB 2ZJRA 1K8GA 3PUWA 2E8GA 3PO3G 4DK6C 2ZM6L 2JQOA 1YNXA 1E22A 2JE6I 4JC0A 4YWLA 5FJ8H 1Y1WG 1VQ9A 2YTVA 5C3EG 3PCOB 1NBWA 5M5WH 1CSQA 5FLMG 2PI2A 4YHHQ 3MXNB 4GOPC 4C3HH 2BH2A 1XPRA 5LMNQ 1PH1A 4OWWB 4DR6L 1YIJA 4LF8L 2QEXA 1X3GA 4BY7H 4DV3L 1M90C 3S15H 4A3GH 2N3SA 3F2DA 4DR7Q 3CCQA 1G291 1V1QA 2YTXA 3K0XA 2EIFA 2HIVA 2F4VL 2UUAL 1JE5A 2ZTEA 1CKNA 1PH2A 3GTGH 2OWOA 3M4OH 4A3LH 3S17H 4MNOA 4DV0L 1MIUA 1W3SA 2CKZB 4X66L 1UE7A 5FLXc 2R93G 2E2HH 3H3VH 4A75A 3T1HL 1Q7YC 1A0IA 1U5KA 1PYSB 1XMOQ 1PH5A 4A3CH 3HOWG 4DAMA 2NN6G 2RHQB 3KF8B 3Q8DA 1YJNA 3I55A 1MKHA 1WCMH 3TS0A 2BA0A 5C0XG 4A3IG 2JA8G 3M4QA 4R1JA 3HOYH 5GADC 5IWAQ 1RL2A 4FDBA 2WFWA 3L0OA 1QVGA 1GM5A 1K3RA 2HIXA 5M5XH 1X3FA 4ME3A 4OXPA 4DAYB 1XPOA 3S14H 3PUXA 4DV3Q 3L2PA 1TXYA 3W1BA 1KC8C 1VQMA 1ASYA 3CMAA 4K0KQ 1QVCA 1E3PA 2KBNA 2UXDQ 1G6PA 1SMXA 2ALYB 2C35B 3E9HA 4GKJL 2CWPA 4JBKA 1X55A 1JB7A 1N33Q 4OO1I 1TWHH 2R7FA 3RN2A 4RG1A 4KHPL 1NMGA 4UP7A 3T1HQ 5DLQE 4A93H 4A3JG 4B3TQ 1VQPA 4R4CA 1WOCA 5AJ3L 1Q81C 5LMUL 1L1OB 1TWCH 1IYJB 3HKSA 1VQBA 4DNIA 1FJGL 2UUCL 1OXXK 2JJQA 1XTDA 5JJLA 2IX0A 3TRZA 3PGZA 1WJJA 5GAEC 2QA4A 2WB1E 3I4OA 3G71A 2R7DA 3KDFB 4J15A 2VQFL 4OONA 3DM3A 4IOCA 1VQOA 1PH8A 3CC7A 4DV5Q 4HJ8A 1IZ6A 2JA5G 2ID0A 1HNXQ 4OWTB 4BY1H 1C0AA 3KOJA 2OCEA 1VQ4A 4GKJQ 4PZ7A 1DGSA 3HOZH 4BXXH 4KHPQ 4JI6Q 3HOVH 3CCJA 4A3MH 2B63G 3H15A 5M3MG 1X54A 2D0PA 3CCLA 4LNQA 3S24A 3CCMA 3E0EA 5AJ3Q 5H1SE 3EN2A 5LMUQ 1Y14B 1FJGQ 3WWVA 3FKIG 1UE6A 5IP7H 5ELNA 2I5LX 4GN4B 3CMEA 4B3ML 5C4XG 2F52A 1KRTA 5BR8L 1YITA 3HKZG 3RLNA 4R4OA 3RNUA 3KF6B 1J5EL 2JK8A 4JCVE 2Q2TA 4JI7L 2VQFQ 2NVTH 1VQFA 2MFIA 5IP9H 4LFAL 1SLJA 3PUZA 1I94L 2K5NA 3B6YA 1L1OA 3FHWA 4RMFA 1OXVA 4LF4L 2ZTCA 2KCMA 2XGTA 4DR1L 4DV4L 2CCZA 3CD6A 4BY7G 2XTIA 2MQHA 4L5RC 2HHHQ 2DGYA 3KDFA 2Z6KA 2YU9H 4HJ9A 4DV2Q 4NXNQ 2YYZA 2JA6H 5E7NA 3K7AH 4B3MQ 4IFDG 4NB3A 3JC66 3RLFA 4DK3C 4DR5Q 3U50C 3PO2H 3CCRA 1LTLA 1P8LA 3UDFA 1J5EQ 3CF5A 4R4TA 3AQQA 1PH3A 4JI7Q 1YBYA 3GTOH 1O7IA 2UXCQ 4GKKL 4A3CG 4LFAQ 2UUBL 4QGUA 3U4ZA 2ZJQA 5LMNL 3I4NH 3AYHB 4X64L 3HOYG 2B3GA 1R9TH 3M7NA 2N49A 1IXRA 4WJ3M 1IBKL 1TWGH 2I5MX 2WAQG 2K14A 4IPDA 4KHZA 3SGIA 2VQEQ 3ER0A 4DR1Q 3PIOA 1S72A 1HH2P 4DV4Q 2ATWA 2R7ZH 2IX1A 1MJCA 1PYBA 2KENA 3KF6A 1NE3A 3BJUA 3D0FA 1KQSA 3HFZB 3CCVA 2DUDA 2Z0SA 3LGJA 4LFCL 5GROA 5JEAJ 4GN3B 1N36Q 1S3OA 1VQ6A 1XNQL 1HZAA 1QUQB 2D0OA 3CW2C 1XMOL 1B8AA 1VS0A 2K75A 1IBML 1B70B 3G6EA 4GLXA 3PUYA 4A93G 4R4IA 5IWAL 4GKKQ 4JBWA 2R92H 4POGA 3I4MH 1OXSC 3J80c 3M4PA 2PI2E 4X64Q 1PVOA 4JI2L 1EIYB 4PZ8A 4A3EG 1X65A 2VL6A 3D31A 2MNAA 4A3DH 4AH6A 1IBKQ 4BA2I 1Z9FA 4EX5A 1PA6A 2V1CC 4K0KL 2UXDL 2LSSA 1M1KC 2K50A 1EIFA 2IY5B 3GO5A 4DR3L 4DR2Q 1GKHA 3W5OA 5GAHC 1N33L 4JBMA 2HQLA 4HJ7A 3A74A 1SROA 2K52A 2I0QA 4LFCQ 3CC4A 1K83H 4DUZQ 1XNQQ 3RR5A 3TREA 4B3TL 2A1AA 3ICEA 4BXXG 4LF6L 4YCUA 1IBMQ 2LXKA 3OYYA 4GNXB 1Q86C 1GO3E 4IPCA 3T1YQ 1VQNA 4IJLA 5C44H 2JA7G 2I5HA 4JI2Q 1A62A 4XTCS 4OWXB 1YJWA 4C3IH 5IP7G 2PMZE 3GTQH 5JJKA 1WI5A 1SR3A 3S1RH 2VZAA 4JI1L 4BBSG 1K0RA 1FL0A 4DV5L 1I3QH 1QUQA 1HNXL 3L7ZC 3RZOH 1N34Q 1OXTA 3CAMA 1EWIA 1VQ8A 4DR3Q 3F1ZA 3HOXH 4GN5A 5IP9G 3K80C 3OTOL 4P72A 1BVSA 3CCUA 1V9PA 1XMQL 2E2IH 4B3SL 4O2DA 4JI6L 1EQRA 4LUOA 4A3BH 2MO0A 1QVFA 4A3KH 3ERSX 4LWCA 3ULLA 4AYBG 4LF6Q 4KI0A 1EUJA 2NVYH 1H95A 4P74A 1NJIC 2UXBL 2A19A 2IHEA 4QL5A 3U4VA 4BBRH 1P16A 4NPSA 3HOUH 4AQYL 1W2BA 1K8AC 4OX9L 3ZJYC 4JI5L 1C7YA 2Q2HA 3S1NH 3CCSA 3PO3H 1FGUA 4JI1Q 3CC2A 4LW1A 1UWVA 4QIWE 3UDGA 3PO2G 1BKBA 4HIMA 2K5HA 4B3RL 1BBUA 4A3FG 5C3EH 4GNXA 5IYCG 1JJGA 2YTYA 3OTOQ 4B3SQ 1XMQQ 1FVIA 1WYDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I4N G;  5IYD H;  1Z47 A;  4JI3 L;  3NEN A;  1HNW L;  3U58 A;  5M3F G;  2HHH L;  1VQH A;  1KD1 C;  3JAM c;  4NXN L;  4DV2 L;  2UXB Q;  4DV6 L;  4Y7N H;  4IPH A;  3GTM H;  1I6H H;  2OTL A;  1Y1V G;  4AQY Q;  1E1O A;  4DR5 L;  4X65 Q;  3STB D;  3BZC A;  1AE3 A;  5JEA G;  4OX9 Q;  1OXU A;  3PSI A;  4JI5 Q;  3F2B A;  2UXC L;  3AFQ A;  2R93 H;  5K36 G;  1LUZ A;  5FJ8 G;  3F2C A;  1Q8K A;  2D62 A;  5IE8 A;  4KLK A;  4B3R Q;  3HOW H;  3J7Z C;  1VQC A;  1HZB A;  2NN6 I;  3TQY A;  2VW9 A;  4A3I H;  2UUB Q;  4IFD I;  2OTJ A;  5C0X I;  3H0G H;  4P73 A;  2R92 G;  4HID A;  2VQE L;  2RHS B;  1RIP A;  2KCT A;  3EBE A;  1EOV A;  4H02 A;  4JI3 Q;  4A3G G;  2EQS A;  4JYA L;  2Y0S G;  1HNW Q;  3HKZ E;  4EQ5 A;  1YJ9 A;  2AWO A;  2FXQ A;  1VQ5 A;  2PQA B;  2E5L L;  4JOI A;  4QJF A;  4DV6 Q;  1N36 L;  1I50 H;  3GTP H;  4WJ4 A;  4IJH A;  2N78 A;  3PF5 A;  2Z6K C;  3I7F A;  2RF4 A;  4DV7 Q;  4A3L G;  4LFB L;  3S1Q H;  3NEL A;  4LUV A;  4LUZ A;  5J3B A;  4GLA C;  4LF5 Q;  2A8V A;  3CP0 A;  3J81 c;  4GOP B;  4A3J H;  4DR4 Q;  1YHQ A;  1WCM G;  2R6G A;  2GVB A;  3NBH B;  2L15 A;  2PNH A;  1HJP A;  2UU9 L;  4X62 L;  1AH9 A;  2K5V A;  5C44 G;  1X56 A;  3KYH C;  4X6A H;  1Q1B A;  4JYA Q;  2NVX H;  4DR2 L;  3M85 A;  2E5L Q;  3GD7 A;  2RCN A;  3KJP A;  3JAM i;  4IPG A;  4UP9 A;  4DPG A;  4DUZ L;  2JA5 H;  3RLO A;  1XPU A;  3PIP A;  1K9M C;  3HOX G;  3I56 A;  4LFB Q;  2GN5 A;  1N32 L;  1YI2 A;  4JI4 L;  3T1Y L;  2WAQ E;  1KXL A;  4A3K G;  2IHF A;  4JI8 Q;  3A0J A;  3W1G A;  2AWN A;  4YWM A;  3S1M H;  2CFM A;  1HZC A;  2EXD A;  2PQA A;  3UE0 A;  1CKM A;  1VQL A;  2UU9 Q;  4X62 Q;  1I5F A;  4JBJ A;  4L5S A;  4IOA A;  4JV5 Q;  2VUM H;  5C4X H;  3M3Y H;  1VQJ A;  4QY7 A;  1N34 L;  3G4S A;  4MTN A;  1U0L A;  3GTK H;  3BZK A;  4BY1 G;  3GDE A;  1X9N A;  5HGQ A;  4UP8 A;  1SE8 A;  3K7U C;  3TEH B;  2ZJP A;  4GOP A;  5JJI A;  2YV5 A;  1HR0 W;  3HOZ G;  3KJO A;  1N32 Q;  3S16 H;  3HOV G;  4A3M G;  3FP9 A;  4PZ6 A;  5IYD G;  4JI4 Q;  1JJC B;  5GAG C;  2ES2 A;  1CKO A;  1LYL A;  4A4I A;  1EYG A;  3J81 i;  4L5T A;  4UY8 C;  1D8L A;  3PF4 A;  1VQE A;  5GQO A;  1PH9 A;  1L2F A;  1V43 A;  4UPA A;  5IYB H;  1N9W A;  2QGQ A;  1N8R C;  1XNR L;  3NEM A;  2F3I A;  5LMN W;  3KLW A;  1A8V A;  1KL9 A;  1G51 A;  4YWK A;  2ZTD A;  3EIV A;  2B29 A;  5HY6 A;  1VQA A;  1TWF H;  2ZM6 Q;  3H3V I;  1D7Q A;  1AE2 A;  4P71 A;  3ULJ A;  1VQI A;  1IL2 A;  2ASB A;  2Q2I A;  3H0G G;  3K81 C;  3UDI A;  3ULP A;  1PH7 A;  1PHJ A;  2NZH A;  1VCI A;  4DV1 L;  3I2Z A;  4JI0 L;  1LM0 A;  2AKW B;  5C4J H;  1EQQ A;  1CUK A;  4LF8 Q;  3KFU A;  4DR6 Q;  5M5Y H;  4X65 L;  2JA9 A;  3BU2 A;  3K8A A;  3J80 i;  3RZD H;  4LF7 L;  1XNR Q;  2JA6 G;  4MZ9 A;  2F4V Q;  2JEB I;  2UUA Q;  2IT1 A;  2WB1 G;  3STB C;  1Y1W H;  1T9H A;  2NVQ H;  3G48 A;  4YCV A;  3A5U A;  4DV0 Q;  4TQU S;  4L5Q A;  4X66 Q;  4AYB E;  3CPW A;  5FLM H;  3PUV A;  1Q82 C;  1ASZ A;  1UE1 A;  1XJV A;  2Q2U A;  3J81 j;  3J7A 5;  4PG3 A;  3PV0 A;  1OTC A;  1B7Y B;  4GNX C;  4IO9 A;  4NXM L;  4HJ5 A;  3VDY A;  2BH8 A;  1SRU A;  4A3E H;  2GVA A;  2VY3 A;  4BA1 I;  3F8T A;  4HJA A;  4APV A;  2R7Z G;  1Q46 A;  4DV1 Q;  4JI0 Q;  1YVC A;  4DUY L;  1YHA A;  3AFP A;  4DKA C;  3E9I A;  4YY3 L;  4DV7 L;  1BBW A;  1NMF A;  1HNZ L;  2OQK A;  4A76 A;  3S2H H;  4LF5 L;  4LF7 Q;  1L0W A;  2VNU D;  1VQG A;  1HZ9 A;  1VQD A;  3CPF A;  4DR4 L;  2JA8 H;  2AHO B;  2AMC B;  4POF A;  3AEV A;  4IFD J;  4HIK A;  5IT9 c;  1Q12 A;  5EAY A;  5C0X J;  3I4M G;  4Y52 H;  4JG2 A;  1L1O C;  4GS3 A;  1E1T A;  4NXM Q;  2JA7 H;  2NZO A;  1PH4 A;  1YHB A;  2KHJ A;  4A3D G;  2UUC Q;  5IY0 A;  3A5Z B;  2VUM G;  4BBS H;  4DUY Q;  1S40 A;  3UDX A;  1KIX A;  1KAW A;  2BA1 A;  2H5X A;  4YY3 Q;  4JOI C;  1HNZ Q;  1PFS A;  1J6Q A;  1YEZ A;  3MEF A;  4HIO A;  1PH6 A;  1A63 A;  2LXJ A;  2N8N A;  4YCW A;  4PMW A;  1UE5 A;  2K4K A;  1C9O A;  1KRS A;  4QQB X;  3M9B A;  1SFO H;  1PV4 A;  3RN5 A;  4JI8 L;  1QZH A;  2CQO A;  4LF9 L;  2Y0S E;  5ELO A;  1JT8 A;  4ALP A;  1X6O A;  2VS1 A;  2E2J H;  1E7Z A;  4JV5 L;  4XIG S;  1EFW A;  1IBL L;  4C3J H;  1Q1E A;  3GTJ H;  1HR0 L;  2HT1 A;  3S2D H;  2MO1 A;  4P75 A;  1MJE A;  5IYB G;  1WFQ A;  4TVA B;  3OW2 A;  1YZ6 A;  4C2M H;  1GD7 A;  1UEB A;  4O0A A;  5BR8 Q;  2CWA A;  3CQZ H;  1X3E A;  1CKN B;  1TWA H;  4R4Q A;  3DLL A;  4OO1 G;  1GVP A;  4A3F H;  1NY4 A;  1JMC A;  3CCE A;  4YHH L;  2JEA I;  5IYC H;  3TS2 A;  4A3B G;  3UE1 A;  2B63 H;  3GTL H;  1I94 Q;  5M3M H;  3CXC A;  4LF4 Q;  1K73 C;  5M3F H;  1CSP A;  4LF9 Q;  1QZG A;  4DR7 L;  3FKI H;  4BBR G;  3IRB A;  1VQK A;  1JJ2 A;  1NTG A;  3HOU G;  1VQ7 A;  1KHI A;  2WP8 J;  2KHI A;  1E24 A;  1Y1V H;  2OQ0 A;  1IBL Q;  1SN8 A;  1HR0 Q;  4AIM A;  4GLV B;  2ZJR A;  1K8G A;  3PUW A;  2E8G A;  3PO3 G;  4DK6 C;  2ZM6 L;  2JQO A;  1YNX A;  1E22 A;  2JE6 I;  4JC0 A;  4YWL A;  5FJ8 H;  1Y1W G;  1VQ9 A;  2YTV A;  5C3E G;  3PCO B;  1NBW A;  5M5W H;  1CSQ A;  5FLM G;  2PI2 A;  4YHH Q;  3MXN B;  4GOP C;  4C3H H;  2BH2 A;  1XPR A;  5LMN Q;  1PH1 A;  4OWW B;  4DR6 L;  1YIJ A;  4LF8 L;  2QEX A;  1X3G A;  4BY7 H;  4DV3 L;  1M90 C;  3S15 H;  4A3G H;  2N3S A;  3F2D A;  4DR7 Q;  3CCQ A;  1G29 1;  1V1Q A;  2YTX A;  3K0X A;  2EIF A;  2HIV A;  2F4V L;  2UUA L;  1JE5 A;  2ZTE A;  1CKN A;  1PH2 A;  3GTG H;  2OWO A;  3M4O H;  4A3L H;  3S17 H;  4MNO A;  4DV0 L;  1MIU A;  1W3S A;  2CKZ B;  4X66 L;  1UE7 A;  5FLX c;  2R93 G;  2E2H H;  3H3V H;  4A75 A;  3T1H L;  1Q7Y C;  1A0I A;  1U5K A;  1PYS B;  1XMO Q;  1PH5 A;  4A3C H;  3HOW G;  4DAM A;  2NN6 G;  2RHQ B;  3KF8 B;  3Q8D A;  1YJN A;  3I55 A;  1MKH A;  1WCM H;  3TS0 A;  2BA0 A;  5C0X G;  4A3I G;  2JA8 G;  3M4Q A;  4R1J A;  3HOY H;  5GAD C;  5IWA Q;  1RL2 A;  4FDB A;  2WFW A;  3L0O A;  1QVG A;  1GM5 A;  1K3R A;  2HIX A;  5M5X H;  1X3F A;  4ME3 A;  4OXP A;  4DAY B;  1XPO A;  3S14 H;  3PUX A;  4DV3 Q;  3L2P A;  1TXY A;  3W1B A;  1KC8 C;  1VQM A;  1ASY A;  3CMA A;  4K0K Q;  1QVC A;  1E3P A;  2KBN A;  2UXD Q;  1G6P A;  1SMX A;  2ALY B;  2C35 B;  3E9H A;  4GKJ L;  2CWP A;  4JBK A;  1X55 A;  1JB7 A;  1N33 Q;  4OO1 I;  1TWH H;  2R7F A;  3RN2 A;  4RG1 A;  4KHP L;  1NMG A;  4UP7 A;  3T1H Q;  5DLQ E;  4A93 H;  4A3J G;  4B3T Q;  1VQP A;  4R4C A;  1WOC A;  5AJ3 L;  1Q81 C;  5LMU L;  1L1O B;  1TWC H;  1IYJ B;  3HKS A;  1VQB A;  4DNI A;  1FJG L;  2UUC L;  1OXX K;  2JJQ A;  1XTD A;  5JJL A;  2IX0 A;  3TRZ A;  3PGZ A;  1WJJ A;  5GAE C;  2QA4 A;  2WB1 E;  3I4O A;  3G71 A;  2R7D A;  3KDF B;  4J15 A;  2VQF L;  4OON A;  3DM3 A;  4IOC A;  1VQO A;  1PH8 A;  3CC7 A;  4DV5 Q;  4HJ8 A;  1IZ6 A;  2JA5 G;  2ID0 A;  1HNX Q;  4OWT B;  4BY1 H;  1C0A A;  3KOJ A;  2OCE A;  1VQ4 A;  4GKJ Q;  4PZ7 A;  1DGS A;  3HOZ H;  4BXX H;  4KHP Q;  4JI6 Q;  3HOV H;  3CCJ A;  4A3M H;  2B63 G;  3H15 A;  5M3M G;  1X54 A;  2D0P A;  3CCL A;  4LNQ A;  3S24 A;  3CCM A;  3E0E A;  5AJ3 Q;  5H1S E;  3EN2 A;  5LMU Q;  1Y14 B;  1FJG Q;  3WWV A;  3FKI G;  1UE6 A;  5IP7 H;  5ELN A;  2I5L X;  4GN4 B;  3CME A;  4B3M L;  5C4X G;  2F52 A;  1KRT A;  5BR8 L;  1YIT A;  3HKZ G;  3RLN A;  4R4O A;  3RNU A;  3KF6 B;  1J5E L;  2JK8 A;  4JCV E;  2Q2T A;  4JI7 L;  2VQF Q;  2NVT H;  1VQF A;  2MFI A;  5IP9 H;  4LFA L;  1SLJ A;  3PUZ A;  1I94 L;  2K5N A;  3B6Y A;  1L1O A;  3FHW A;  4RMF A;  1OXV A;  4LF4 L;  2ZTC A;  2KCM A;  2XGT A;  4DR1 L;  4DV4 L;  2CCZ A;  3CD6 A;  4BY7 G;  2XTI A;  2MQH A;  4L5R C;  2HHH Q;  2DGY A;  3KDF A;  2Z6K A;  2YU9 H;  4HJ9 A;  4DV2 Q;  4NXN Q;  2YYZ A;  2JA6 H;  5E7N A;  3K7A H;  4B3M Q;  4IFD G;  4NB3 A;  3JC6 6;  3RLF A;  4DK3 C;  4DR5 Q;  3U50 C;  3PO2 H;  3CCR A;  1LTL A;  1P8L A;  3UDF A;  1J5E Q;  3CF5 A;  4R4T A;  3AQQ A;  1PH3 A;  4JI7 Q;  1YBY A;  3GTO H;  1O7I A;  2UXC Q;  4GKK L;  4A3C G;  4LFA Q;  2UUB L;  4QGU A;  3U4Z A;  2ZJQ A;  5LMN L;  3I4N H;  3AYH B;  4X64 L;  3HOY G;  2B3G A;  1R9T H;  3M7N A;  2N49 A;  1IXR A;  4WJ3 M;  1IBK L;  1TWG H;  2I5M X;  2WAQ G;  2K14 A;  4IPD A;  4KHZ A;  3SGI A;  2VQE Q;  3ER0 A;  4DR1 Q;  3PIO A;  1S72 A;  1HH2 P;  4DV4 Q;  2ATW A;  2R7Z H;  2IX1 A;  1MJC A;  1PYB A;  2KEN A;  3KF6 A;  1NE3 A;  3BJU A;  3D0F A;  1KQS A;  3HFZ B;  3CCV A;  2DUD A;  2Z0S A;  3LGJ A;  4LFC L;  5GRO A;  5JEA J;  4GN3 B;  1N36 Q;  1S3O A;  1VQ6 A;  1XNQ L;  1HZA A;  1QUQ B;  2D0O A;  3CW2 C;  1XMO L;  1B8A A;  1VS0 A;  2K75 A;  1IBM L;  1B70 B;  3G6E A;  4GLX A;  3PUY A;  4A93 G;  4R4I A;  5IWA L;  4GKK Q;  4JBW A;  2R92 H;  4POG A;  3I4M H;  1OXS C;  3J80 c;  3M4P A;  2PI2 E;  4X64 Q;  1PVO A;  4JI2 L;  1EIY B;  4PZ8 A;  4A3E G;  1X65 A;  2VL6 A;  3D31 A;  2MNA A;  4A3D H;  4AH6 A;  1IBK Q;  4BA2 I;  1Z9F A;  4EX5 A;  1PA6 A;  2V1C C;  4K0K L;  2UXD L;  2LSS A;  1M1K C;  2K50 A;  1EIF A;  2IY5 B;  3GO5 A;  4DR3 L;  4DR2 Q;  1GKH A;  3W5O A;  5GAH C;  1N33 L;  4JBM A;  2HQL A;  4HJ7 A;  3A74 A;  1SRO A;  2K52 A;  2I0Q A;  4LFC Q;  3CC4 A;  1K83 H;  4DUZ Q;  1XNQ Q;  3RR5 A;  3TRE A;  4B3T L;  2A1A A;  3ICE A;  4BXX G;  4LF6 L;  4YCU A;  1IBM Q;  2LXK A;  3OYY A;  4GNX B;  1Q86 C;  1GO3 E;  4IPC A;  3T1Y Q;  1VQN A;  4IJL A;  5C44 H;  2JA7 G;  2I5H A;  4JI2 Q;  1A62 A;  4XTC S;  4OWX B;  1YJW A;  4C3I H;  5IP7 G;  2PMZ E;  3GTQ H;  5JJK A;  1WI5 A;  1SR3 A;  3S1R H;  2VZA A;  4JI1 L;  4BBS G;  1K0R A;  1FL0 A;  4DV5 L;  1I3Q H;  1QUQ A;  1HNX L;  3L7Z C;  3RZO H;  1N34 Q;  1OXT A;  3CAM A;  1EWI A;  1VQ8 A;  4DR3 Q;  3F1Z A;  3HOX H;  4GN5 A;  5IP9 G;  3K80 C;  3OTO L;  4P72 A;  1BVS A;  3CCU A;  1V9P A;  1XMQ L;  2E2I H;  4B3S L;  4O2D A;  4JI6 L;  1EQR A;  4LUO A;  4A3B H;  2MO0 A;  1QVF A;  4A3K H;  3ERS X;  4LWC A;  3ULL A;  4AYB G;  4LF6 Q;  4KI0 A;  1EUJ A;  2NVY H;  1H95 A;  4P74 A;  1NJI C;  2UXB L;  2A19 A;  2IHE A;  4QL5 A;  3U4V A;  4BBR H;  1P16 A;  4NPS A;  3HOU H;  4AQY L;  1W2B A;  1K8A C;  4OX9 L;  3ZJY C;  4JI5 L;  1C7Y A;  2Q2H A;  3S1N H;  3CCS A;  3PO3 H;  1FGU A;  4JI1 Q;  3CC2 A;  4LW1 A;  1UWV A;  4QIW E;  3UDG A;  3PO2 G;  1BKB A;  4HIM A;  2K5H A;  4B3R L;  1BBU A;  4A3F G;  5C3E H;  4GNX A;  5IYC G;  1JJG A;  2YTY A;  3OTO Q;  4B3S Q;  1XMQ Q;  1FVI A;  1WYD A; 
#chains in the Genus database with same CATH topology
 4CDE C;  4JI3 L;  4KKU A;  4ZQ3 A;  3TP7 A;  1RDP D;  3QB3 A;  1HNW L;  1AN8 A;  2V4D A;  1MGS A;  3MXP A;  5C5L A;  4IPH A;  1XX8 A;  1CZG A;  3I73 A;  1OXU A;  5FJ8 G;  2PZU A;  3HOY B;  1JR0 D;  4B3R Q;  3HOW H;  1HZB A;  4UDU C;  2R92 G;  3EBE A;  3MWY W;  4JI3 Q;  4H02 A;  3SXH A;  1SEB D;  2Y0S G;  1HNW Q;  1YJ9 A;  1VQ5 A;  3OPO A;  2E5L L;  4QJF A;  1N36 L;  3GTP H;  4IJH A;  1TQO A;  3I7F A;  1J9O A;  3EA6 A;  4A93 B;  4LUZ A;  4GLA C;  1X32 A;  4LF5 Q;  4KJN A;  2R6G A;  2LMC B;  5FK9 C;  1J8I A;  1PRT C;  3KYH C;  4X6A H;  1KDA A;  4G4K A;  4L6T B;  4DR2 L;  2E5L Q;  2RCN A;  3HOZ B;  1UUP A;  1BUV T;  4IPG A;  4UP9 A;  2JA5 H;  4A3M B;  4XT1 B;  3HOX G;  1LTR D;  1YI2 A;  3NBI A;  1WTV A;  1EYC A;  4ZUI A;  2I46 A;  1KXL A;  4YWM A;  3PIO 3;  4E6I A;  3AMU A;  2IWH A;  1BDO A;  2L4N A;  2VB3 X;  1I5F A;  4JBJ A;  4L5S A;  4XDX A;  3SVM A;  4QY7 A;  1N34 L;  3K5M A;  3G4S A;  3Q23 A;  1EU4 A;  3GTK H;  4BY1 G;  1CK1 A;  1EQT A;  4UP8 A;  4GOP A;  2ZJP A;  4ME5 A;  1RHP A;  2MGS A;  3KJO A;  3DHQ A;  3E0J A;  2ES2 A;  1EYG A;  4L5T A;  4UY8 C;  3K7A B;  4WFN 3;  4UPA A;  1CI3 M;  2PNR C;  3J7A V;  2EYH A;  3KLW A;  1A8V A;  3BDL A;  2IL8 A;  1G51 A;  5HY6 A;  2ZT9 C;  3H3V I;  1H9R A;  3QO2 A;  1G8Z D;  1GHJ A;  3H0G G;  1PHJ A;  5BN3 A;  2NZH A;  2NVX B;  1VCI A;  4DV1 L;  3A56 A;  3I2Z A;  3A54 A;  1EQQ A;  4DR6 Q;  1CUK A;  3VYT A;  3TME A;  3RZD H;  3SEB A;  3TP8 A;  3L3O C;  1HUM A;  4OIJ A;  2JA6 G;  4MZ9 A;  1JQY D;  1Q3L A;  3TP6 A;  4MTK A;  2UUA Q;  5IGG A;  2IT1 A;  2F0D A;  5CV6 A;  2NVQ H;  2J0T D;  4YCV A;  4K8I A;  1VDZ A;  3A5U A;  4TQU S;  4L5Q A;  4DV0 Q;  2UUB L;  3I4M B;  4FYD A;  2Q2U A;  1XJV A;  4PG3 A;  2BOS A;  4NXM L;  2KED A;  4MHE A;  1CM9 A;  1SNO A;  1STG A;  4KV6 A;  4DV1 Q;  3KLR A;  1T5E A;  1K83 B;  4FXG C;  4EQP A;  4DV7 L;  2OQK A;  3N52 A;  1L0W A;  2VNU D;  1DD2 A;  3OMC A;  4O1N A;  3K5L A;  5IT9 E;  1VQG A;  1EEI D;  1HZ9 A;  4DR4 L;  1SNM A;  4K5V A;  2AHO B;  5C44 B;  4HIK A;  2HDL A;  3GTQ B;  2SOB A;  3LNN A;  4NXM Q;  1E1T A;  2A6H D;  3A5Z B;  4DXF A;  1RJT A;  2RCF A;  1HFG A;  2BA1 A;  3IFD A;  3J81 E;  1TS4 A;  1PFS A;  1ENC A;  3MEF A;  1PH6 A;  3HEJ A;  1W6J A;  2K4K A;  3Q22 A;  1C9O A;  3M9B A;  2FMC A;  1SFO H;  1DCZ A;  4JI8 L;  5ELO A;  1JWM D;  1H9S A;  5CV7 A;  2F0J A;  4XIG S;  5FOB B;  3FEW X;  4C3J H;  3PO3 B;  2HT1 A;  3MFY A;  2MO1 A;  5KNC A;  2QDL A;  3CQZ H;  5I2Y A;  1TWA H;  4TSS A;  4BWG B;  4A3F H;  1B4O A;  5BN4 A;  3AB9 A;  2FHT A;  1AFP A;  4Y7N B;  4LF4 Q;  1K73 C;  1CSP A;  2J4X A;  5NUC A;  3VYU A;  1RF2 D;  4KK7 A;  3FKI H;  1VQK A;  2QCP X;  3NTI A;  1EY9 A;  2KHI A;  2K28 A;  2ZJR A;  3BYY B;  3N6R A;  4DK6 C;  2F0U A;  2ZM6 L;  2JQO A;  4YWL A;  3BVZ A;  1Y1W G;  1TT2 A;  5C3E G;  3OIP A;  2PI2 A;  2WAC A;  4GOP C;  4HR7 B;  2CVR A;  4KKS A;  4RGN A;  1XPR A;  4OWW B;  1PH1 A;  1YIJ A;  4LF8 L;  1B3A A;  3S15 H;  1I50 B;  2Q8R E;  1G29 1;  1EYD A;  3MEH A;  1K8M A;  5EBC A;  4QIW B;  2OWO A;  1STY A;  2HDM A;  3K5O A;  1W3S A;  4A3J B;  1UE7 A;  3H3V H;  1U5K A;  1XMO Q;  3OSO A;  4A3C H;  4IFD G;  4A3I G;  5C0X G;  3HOY H;  2Q8I B;  5IWA Q;  1GM5 A;  1G2T A;  1F2Z A;  2A6E C;  5KNB A;  2WV6 D;  3D6C A;  2J7Z A;  3NPP A;  1HQM C;  1QVC A;  2HUG A;  3OMG A;  1FNW A;  1GUS A;  2C35 B;  2QKI C;  2CWP A;  4JBK A;  3K0Y A;  4KHP L;  4RG1 A;  1IW7 D;  1U4R A;  1NMG A;  1EYA A;  5JPM C;  3J81 L;  4A93 H;  4CKC A;  2H4O A;  5JJZ A;  4DXG A;  5C4X B;  2UUC L;  3LWE A;  1GUG A;  1JWS D;  5KEE A;  3PGZ A;  3TRZ A;  1QNK A;  3WOE A;  1DXM A;  5GAE C;  2QA4 A;  1ENA A;  4J15 A;  3DM3 A;  4IOC A;  2B2W C;  4DV5 Q;  4HJ8 A;  2NBF A;  4JK1 C;  2RVL A;  1VQ4 A;  1SND A;  1SDF A;  3HOZ H;  3IKJ A;  4KHP Q;  3H91 A;  4A3M H;  3MVV A;  4K14 A;  4CDC C;  1DM0 B;  3S24 A;  3CCM A;  3E0E A;  4DAY A;  3R8B A;  3WWV A;  5IP7 H;  2NZ1 D;  1ESF A;  2PPB C;  3EVQ A;  2CH4 A;  1YIT A;  1TWF B;  3HKZ G;  4FF1 A;  2EY6 A;  3CRK C;  3PUZ A;  1C48 A;  1I94 L;  2WAQ B;  1L1O A;  5JVH 3;  1EY0 A;  2HQE A;  1ZYR C;  2L5T A;  5C4J B;  5KGU A;  5C5M A;  3VR2 A;  2CCZ A;  4BY7 G;  5E4W C;  2MQH A;  4L5R C;  2PYK A;  5CR3 A;  2MJ8 A;  4EQO A;  3KDF A;  4DV2 Q;  2E2D C;  3K7A H;  3JC6 6;  4JVZ A;  1LTL A;  3URY A;  2EYO A;  4A3E B;  3MXU A;  3AYH B;  1ONL A;  1IXR A;  1IBK L;  4RCN A;  2I5M X;  4IPD A;  3ER0 A;  4NKL A;  3NWT A;  2IJ0 A;  5J1Z A;  2P5Z X;  4HCS A;  3KF6 A;  1NE3 A;  3BJU A;  3D0F A;  3I70 A;  3HFZ B;  3S9W A;  3LGJ A;  4GN3 B;  1XNQ L;  1BO0 A;  3QIA A;  5ELD A;  1QUQ B;  2DY7 A;  1SYC A;  3D8G A;  1KAA A;  2JA7 B;  2N55 A;  1FD7 D;  1BF4 A;  3NP8 A;  1KDB A;  4POG A;  3I4M H;  2Z1C A;  1LV9 A;  1PVO A;  1PFB A;  4PZ8 A;  4G7O C;  2VL6 A;  1WTW A;  3D31 A;  2MNA A;  4AH6 A;  1IBK Q;  4BA2 I;  1SSO A;  3SHL A;  1PA6 A;  1FYC A;  2IY5 B;  4DNR B;  1B44 D;  4KY7 A;  2I0Q A;  3CC4 A;  1K83 H;  4AYB B;  1XNQ Q;  4HSP A;  4IUR A;  3ICE A;  3BG3 A;  4GNX B;  1GO3 E;  4FXK C;  4IPC A;  5C44 H;  3FVQ A;  4RWS C;  1A62 A;  4XTC S;  1WTH A;  3GTQ H;  1WI5 A;  4JI1 L;  4BBS G;  1JIC A;  2PW7 A;  1IKL A;  1FL0 A;  1XYI A;  2K7V A;  2EY1 A;  3CAM A;  2RSO A;  3TZU A;  5DM6 3;  4GN5 A;  5A2Q L;  1BVS A;  2EJG C;  1EQR A;  4RGM A;  4FF2 A;  1QVF A;  1EUJ A;  1NJI C;  3U4V A;  5G3L F;  3VR5 A;  5DAU A;  2PW5 A;  4NPS A;  2FMM A;  3P20 A;  5E1F A;  1II3 A;  4OX9 L;  2MHV A;  1SYD A;  4JI5 L;  3PO3 H;  1EZ8 A;  1FGU A;  4JI1 Q;  2NTT A;  4QIW E;  1KDC A;  2F0I A;  3H09 A;  4C3H B;  1JJG A;  2RA4 A;  3JAM E;  1FVI A;  3UDX A;  2Y0S B;  5IYD H;  1HA5 A;  1VQH A;  1KD1 C;  1XWE A;  1PZI D;  4Y7N H;  4B08 A;  1LAC A;  5CC4 A;  4DR5 L;  1LT5 D;  4QUF A;  3STB D;  4X65 Q;  5JEA G;  4OX9 Q;  2ZXR A;  4JI5 Q;  2O4X A;  1B2T A;  2UXC L;  5K36 G;  3NWS A;  1LUZ A;  2N88 A;  1Q8K A;  4XQJ A;  2D62 A;  2F4I A;  4KLK A;  1SJE D;  3J7Z C;  3X3M A;  1C8C A;  1F9R A;  1SYB A;  3TQY A;  5F2D A;  4HID A;  2VQE L;  1EOV A;  2EQS A;  1E2W A;  1RCV D;  2AWO A;  4J8Q A;  2R61 A;  1F9P A;  1FGB D;  1TWH B;  1I50 H;  4WJ4 A;  1V1O A;  2KOL A;  3PF5 A;  4A3L G;  5IOC A;  3ERQ A;  2A8V A;  1TWC B;  3J81 c;  4NW2 A;  4A3J H;  2B8F A;  4F8M A;  2GVB A;  3NBH B;  2L15 A;  1WTQ A;  1K0S A;  1HJP A;  3LWU A;  2K5V A;  3QWN A;  4BY1 B;  3M85 A;  1F2L A;  1D5Z C;  1CTM A;  2F0P A;  3GD7 A;  3OHX C;  3KJP A;  4J1M A;  3JAM i;  4RKB A;  4DPG A;  3KBG A;  1ESR A;  3PIP A;  1O7Y A;  4IZ8 A;  4B9W A;  1JE4 A;  2WAQ E;  2KUM A;  4K2K A;  3W1G A;  1VF5 C;  2L11 A;  3C1F A;  1HZC A;  4IOA A;  4JV5 Q;  2GA4 B;  5C4X H;  1U0L A;  2F0H A;  1MSG A;  2ICE C;  1U4P A;  1F2Y A;  1X9N A;  3ZYY X;  3FDT A;  3K7U C;  1HXY D;  3P1H A;  2D9U A;  1KTK A;  5GAG C;  4R8N A;  1CKO A;  2RSN A;  2L0C A;  2EYF A;  4A4I A;  5LHY 1;  2JA6 B;  4RH6 A;  4QMG A;  1D8L A;  1VF7 A;  1XNR L;  1N8R C;  1RTN A;  3KK7 A;  2B2U A;  1PRT F;  1D1K A;  4YWK A;  2B8G A;  2K1B A;  3I4N B;  1TWF H;  2D5D A;  3MAQ A;  1CA6 A;  1AE2 A;  1TWG B;  1KLU D;  2ASB A;  3NXW A;  2Q2I A;  3I3C A;  3UDI A;  3OW7 A;  3FPU B;  4CKB A;  1I6V C;  1LM0 A;  5C4J H;  5CV5 A;  3D4W A;  5BN5 A;  2C5C A;  3K8A A;  3T16 A;  2EYM A;  1XNR Q;  2F4V Q;  4OL7 A;  1T9H A;  5I6W A;  4RAU C;  4DK1 A;  4AYB E;  5FLM H;  1ASZ A;  1UE1 A;  3J81 j;  2QDB A;  1JOO A;  3PV0 A;  3NK9 A;  1SRU A;  1F9Q A;  4A3E H;  2GVA A;  2VY3 A;  4MN3 A;  1EY7 A;  1A2U A;  4X3T A;  1ILP A;  1LLR D;  4DN4 M;  4OIK A;  2A6H C;  1EY6 A;  3E9I A;  5HUR A;  5KYI A;  3S2H H;  3DWP A;  1WTO A;  5COY A;  4LF5 L;  1JOR A;  4ZAI A;  1LTG D;  1BXT A;  2KA7 A;  3CPF A;  1U4M A;  4ABN A;  3NTH A;  4POF A;  1F9S A;  1BOS A;  1Q12 A;  4C3I B;  1A3U A;  4JG2 A;  3S1R B;  4GS3 A;  2JA7 H;  2XRS D;  1PH4 A;  3GV3 A;  1I3Q B;  4DF7 A;  5IY0 A;  4XQN A;  3VYS A;  4BS9 A;  2RDF A;  3VR6 A;  1F77 A;  5IGD A;  2E2I B;  1KAW A;  2OXP A;  4A3K B;  2LXJ A;  5E3F A;  4PMW A;  2NVY B;  1GUT A;  3NTK A;  4UHV A;  1PV4 A;  3BDC A;  2WII B;  5I4D A;  1ET9 A;  3V05 A;  2CQO A;  2Y0S E;  1JT8 A;  2C9O A;  3FMC A;  2IX3 A;  2VS1 A;  3S1N B;  1IBL L;  1MI2 A;  1Q1E A;  4LK1 C;  2LKV A;  1HR0 L;  1BR9 A;  1MJE A;  4P75 A;  4ID6 A;  4TVA B;  3OW2 A;  3TBI B;  5C3E B;  1YZ6 A;  3H3V C;  5BR8 Q;  3Q0A A;  1CKN B;  4R4Q A;  3P7J A;  4OO1 G;  1A6X A;  1NY4 A;  3CCE A;  1K3B C;  2F0G A;  1JOQ A;  4DA2 A;  2B2T C;  1YNJ D;  5JAV A;  3V96 A;  2PO4 A;  3W2D A;  4BBR G;  1FNU A;  2WP8 J;  1IBL Q;  1E24 A;  1E0B A;  1SN8 A;  1HR0 Q;  4AIM A;  4GLV B;  1K8G A;  2E8G A;  1SE4 A;  2F3W A;  3PIP 3;  5FJ8 H;  1E22 A;  2JE6 I;  4A3I B;  3C46 A;  2YTV A;  3PCO B;  2DY8 A;  4WOR A;  3MXN B;  2O2L D;  1HTP A;  1WD1 A;  4C3H H;  4RGO S;  1A15 A;  1TS3 A;  2DJG C;  2XVS A;  3DUZ A;  2BH2 A;  4DR6 L;  3R3O A;  2QEX A;  1X3G A;  5EBD A;  3CCQ A;  1V1Q A;  1OO9 B;  4P2C B;  5FLX E;  2K04 A;  3S1Q B;  1K8O A;  4HN7 A;  1CQF A;  1JE5 A;  1H9M A;  2UUA L;  1PH2 A;  4MNO A;  4DV0 L;  1LT3 D;  2OT2 A;  2R93 G;  1WTR A;  1PYS B;  1PH8 A;  3KF8 B;  1S5B D;  2RHQ B;  3I55 A;  1MKH A;  1SNC A;  4NMZ A;  1SE2 A;  3M4Q A;  4R1J A;  4ZCK A;  1LT6 D;  5COR A;  1QVG A;  1K3R A;  2HIX A;  4IUP A;  1V1P B;  4OEL B;  3MTS A;  3QOL A;  3PUX A;  4FO2 A;  1O7L A;  1RD9 D;  1VQM A;  3CMA A;  1ASY A;  1E3P A;  4N8F A;  4B9X A;  4PMB A;  1G6P A;  2ALY B;  4GKJ L;  1X55 A;  1TWH H;  2R7F A;  4KMU C;  2PZW A;  1A2T A;  1PMR A;  3S1M B;  4IUV A;  4B3T Q;  4R4C A;  1WOC A;  1Q81 C;  1GUN A;  1TWC H;  1DOM A;  1VQB A;  1LO5 D;  2VUM B;  1YNN D;  5T1G A;  3HKZ B;  1NCV A;  2LY7 A;  4DAP A;  4C3J G;  3DXJ C;  2D2C C;  2ZXO A;  2Z6B A;  3G71 A;  4KD3 A;  2VQF L;  1VQO A;  2F3V A;  4QUC A;  1Z6H A;  2F0F A;  2Z4H A;  4BY1 H;  4OWT B;  1C0A A;  2OCE A;  3BZD B;  4GKJ Q;  1GHK A;  4PZ7 A;  3SK4 A;  4JI6 Q;  1JC7 A;  1QOH A;  2XWB B;  2L9H A;  3MHB A;  1STA A;  4IUT A;  1Y14 B;  3FKI G;  1UE6 A;  2KCN A;  2FIN B;  5ELN A;  2I5L X;  1SMY D;  3CME A;  2EOT A;  1KRT A;  5CBA E;  3RNU A;  2O5I C;  1KNA A;  4R4O A;  3SDZ A;  2Q2T A;  2VQF Q;  2BE5 D;  4LFA L;  2K5N A;  3B6Y A;  4S3S A;  4QCL A;  4LF4 L;  1MSH A;  2KCM A;  1JOK A;  1HUN A;  1I4R A;  2XTI A;  3EQL C;  4F87 A;  2HHH Q;  2DGY A;  2Z6K A;  4NXN Q;  3ND9 A;  1S5E D;  1RTO A;  2JA6 H;  1MBY A;  4NB3 A;  3RLF A;  2RQX A;  3CCR A;  3OIQ A;  3CF5 A;  1YBY A;  4JPB W;  1WTX A;  2PCF B;  4A3C G;  4LFA Q;  4KTA A;  3I4N H;  4X64 L;  4HTH A;  3HOY G;  2B3G A;  4YIJ A;  1TWG H;  2K14 A;  1S72 A;  1GJX A;  3NSW A;  1PYB A;  5FO7 B;  2KEN A;  1U9R A;  1SYE A;  1KQS A;  3CCV A;  2HCC A;  2Z0S A;  2XN9 C;  5IGB A;  1VQ6 A;  2JA8 B;  2NUC A;  1HZA A;  1XMO L;  1B8A A;  1VS0 A;  5E4X A;  4TRD A;  4ILW A;  1IBM L;  5I6Y A;  2K5Q A;  3G6E A;  3D4R A;  2OF1 A;  3A8K E;  4A93 G;  4R4I A;  5IWA L;  3E5S A;  4RHR A;  4F88 A;  4X64 Q;  4JI2 L;  2LS0 1;  4BBS B;  3D4D A;  2K05 A;  1G2S A;  2F0O A;  5ELC A;  4RHS A;  3KLS A;  4K5W A;  1M1K C;  1NNX A;  2K50 A;  3GO5 A;  4DR3 L;  3RMH A;  4X3K A;  4FVM A;  5J39 A;  4HJ7 A;  2K52 A;  1IYU A;  4DUZ Q;  4LF6 L;  2E2J B;  1IBM Q;  3OYY A;  5IT9 L;  3T1Y Q;  1VQN A;  3S2D B;  4IJL A;  2I5H A;  4JI2 Q;  4C2M B;  1YJW A;  4C3I H;  5IP7 G;  1LTS D;  1SR3 A;  1STE A;  1S5F D;  2VZA A;  3S1R H;  1K0R A;  4DV5 L;  1I3Q H;  1QUQ A;  1DOK A;  1OXT A;  1EWI A;  5KIX A;  4DR3 Q;  2B63 B;  3R2T A;  5M3M B;  1XMQ L;  2E2I H;  2CW0 D;  4LUO A;  4M8A A;  3K57 A;  4A3K H;  4LWC A;  3J7A F;  3MA2 B;  4LF6 Q;  5EPL A;  1HQR D;  4M1U B;  2NVY H;  2KJX A;  1LTT D;  4LJZ C;  1SNP A;  5DM7 3;  4AQY L;  3DM1 A;  3S1N H;  2DJF C;  4LW1 A;  3SE0 A;  5M5W B;  1LTB D;  3UDG A;  1BKB A;  5JOB A;  5C3E H;  4PMC A;  4GNX A;  5IYC G;  2Z8L A;  1XMQ Q;  1WYD A;  2F0N A;  1QIL A;  4RKL A;  3NEN A;  5M3F G;  4K2L A;  3GTG B;  4DV2 L;  3M4O B;  4CHT B;  3S17 B;  2EPB A;  1Y1V G;  4AQY Q;  1TKW B;  2F0M A;  3PSI A;  1WVL A;  3F2B A;  2K01 A;  3AFQ A;  1ICW A;  5C3W A;  3F2C A;  2VXW A;  4C1N I;  1PTO B;  1V8Q A;  2NN6 I;  2VW9 A;  4A3I H;  1TS2 A;  3BYT B;  4P73 A;  4RFB A;  2HD3 A;  1RIP A;  2KCT A;  1NR4 A;  1CHQ D;  4A3G G;  3HKZ E;  4EQ5 A;  2FXQ A;  4IAL A;  2PQA B;  4JOI A;  5IGC A;  2N78 A;  2Z6K C;  4LFB L;  3LX0 A;  4CKE A;  3S1Q H;  4LUV A;  5J3B A;  5HGT A;  2IW3 A;  4LMQ D;  1YHQ A;  1WCM G;  1GOZ A;  2PNH A;  3D6W A;  1SYF A;  4X62 L;  1AH9 A;  1G6Z A;  5C44 G;  4K6D A;  5ELF A;  1X56 A;  3QG1 A;  1Q1B A;  2NVX H;  4FF4 A;  5IGE A;  3WOF A;  4DNT B;  1XPU A;  3RLO A;  4C1N K;  2CQA A;  4LFB Q;  3I56 A;  1PDQ A;  1SJH D;  4I7Z C;  1TR5 A;  1PFN A;  2IHF A;  3A0J A;  2AWN A;  3S1M H;  2CFM A;  2EXD A;  5ISR A;  4X62 Q;  3C2P A;  2VUM H;  2NVT B;  2EJF C;  1SAP A;  3I4L A;  1MD2 D;  3BZK A;  5HGQ A;  3TEH B;  5CYU A;  5M9O A;  1U4L A;  2KCC A;  5JJI A;  2JYO A;  2YV5 A;  1HR0 W;  3NBH A;  4XXE A;  1M8A A;  3HOV G;  3DEO A;  4PZ6 A;  3NE5 B;  5IYD G;  1JJC B;  1VMP A;  2X69 A;  5IIF A;  1ZKO A;  4HSV A;  3PF4 A;  1VQE A;  5GQO A;  3D3R A;  3PO2 B;  5IYB H;  1N9W A;  2QGQ A;  4ZUJ A;  3GTO B;  1KL9 A;  2ZTD A;  2B29 A;  4K8J A;  1R9T B;  4DK0 A;  2O5J C;  3ULJ A;  2XSC A;  1IL2 A;  3K81 C;  5CBE E;  1PH7 A;  2L12 A;  2F0W A;  1IKM A;  3W3A A;  4JI0 L;  4X65 L;  2JA9 A;  3TP5 A;  4ZK9 B;  2JEB I;  3GV6 A;  2WB1 G;  4ZRZ A;  3NQI A;  1D1I A;  2R92 B;  4X66 Q;  3CPW A;  1Q82 C;  1EU3 A;  3PUV A;  2XNA C;  3KLS X;  4GNX C;  4IO9 A;  1HHV A;  2B39 A;  1EIH A;  4BA1 I;  4HJA A;  1BCP B;  4CDF C;  1Q46 A;  2R7Z G;  2SNS A;  2MP1 A;  4JI0 Q;  1YHA A;  1BBW A;  1NMF A;  2CH4 W;  4R9W A;  3TZD A;  4ZKC B;  4U67 3;  5A35 A;  1BBX C;  5T1I A;  1HCZ A;  2NN6 H;  2JA8 H;  2AMC B;  4IFD J;  5IT9 c;  5C0X J;  5EAY A;  2HCI A;  4DFA A;  4Y52 H;  2DNC A;  2WKC A;  1L1O C;  3MC0 B;  1YHB A;  2KHJ A;  4A3D G;  3RZO B;  3NUC A;  1ZEQ X;  4FP5 D;  4BBS H;  1TVX A;  2K32 A;  3DMU A;  3HOX B;  1Q8I A;  1WTP A;  2H5X A;  4JOI C;  4XT3 B;  2JN4 A;  1J6Q A;  4EGV A;  1EL0 A;  1UE5 A;  4N9P A;  3RD4 A;  4QQB X;  1AEX A;  1KAB A;  3RN5 A;  3P75 A;  4BBR B;  1SE3 A;  1QB5 D;  1XTC D;  1KNE A;  2E2J H;  1E7Z A;  5D14 A;  4JV5 L;  1EFW A;  1TII D;  3S2D H;  3K59 A;  2A68 D;  5EKL A;  4C2M H;  1UEB A;  4O0A A;  2CWA A;  1EEF D;  1X3E A;  3DLL A;  2VB2 X;  3TS2 A;  4YHH L;  4A3B G;  1ZYR D;  5ELB A;  3UE1 A;  4WJW A;  2B63 H;  1D5M C;  5M3M H;  3GTM B;  1I6H B;  1QZG A;  3CKI B;  5JPN C;  3IRB A;  2PMZ B;  3HP3 A;  3HOU G;  1GUW A;  4RCO A;  3HGB A;  2E76 C;  2OQ0 A;  2R93 B;  2JSO A;  3Q6S A;  5JEA H;  1GUO A;  3DEP A;  4H44 C;  1A3V A;  3Q24 A;  1YNX A;  5K36 H;  1PTO D;  3H0G B;  4NDX A;  5M5W H;  2A5H A;  1CSQ A;  5FLM G;  4YHH Q;  4ZYS A;  1O80 A;  1UAP A;  3SK6 A;  5LMN Q;  5EPJ A;  1M90 C;  2N3S A;  3JAM L;  3EFX D;  5I9P A;  3K0X A;  2HIV A;  2F4V L;  2G9H D;  3GTG H;  1CKN A;  3M4O H;  4A3L H;  3S17 H;  4XYO A;  2SEB D;  1AZQ A;  2CKZ B;  5IOD A;  1HTL D;  1PH5 A;  5C3X A;  1IHZ A;  3HOW G;  3Q8D A;  1YJN A;  3TS0 A;  2BA0 A;  4K6L A;  1PTO H;  4XYQ A;  5GAD C;  3U9O A;  2MUY A;  4FDB A;  2WFW A;  3L0O A;  5KRU A;  4H7B A;  1XPO A;  1X3F A;  4OXP A;  1EQV A;  3W1B A;  1KC8 C;  4K0K Q;  3KUP A;  2UXD Q;  1SMX A;  2A74 C;  1JB7 A;  3G6J B;  1N33 Q;  4OO1 I;  1PXU A;  3A7L A;  3RN2 A;  3MXN A;  4ZKB B;  1EIG A;  1STB A;  3K6O A;  5DLQ E;  1VQP A;  1S5C D;  4DNI A;  1XXG A;  3M3Y B;  1XTD A;  5JJL A;  2IX0 A;  4ULL A;  1B3Q A;  4OON A;  1SMY C;  3SK5 A;  3CC7 A;  3A7A B;  4LAA A;  1IZ6 A;  1AW7 A;  1CT1 D;  2JA5 G;  3S16 B;  1HNX Q;  3KF8 A;  2R3Z A;  3KOJ A;  4Q5V A;  3A55 A;  4BXX H;  3CCJ A;  4O42 A;  3H15 A;  2A69 D;  2D0P A;  5KYL A;  4JW0 A;  4KHV A;  2EY5 A;  5EKK A;  1PRT B;  1V1P A;  1B1Z A;  3EN2 A;  2ICI A;  2G5D A;  1R4P B;  4B3M L;  4PQX A;  2F1M A;  5BR8 L;  4IQZ A;  3HG9 A;  1KLG D;  4CJ1 B;  1J5E L;  2NVT H;  1NSN S;  1AP0 A;  5IP9 H;  4N8X 1;  1SLJ A;  4DGZ A;  4RMF A;  5CV4 A;  4FXD A;  4C3H G;  2KVM A;  1JWU D;  5M5Y B;  1IYV A;  4DV4 L;  3CD6 A;  2SDF A;  4HMJ A;  1LTA D;  1RKN A;  2E74 C;  4IUQ A;  1EOT A;  2YYZ A;  1Y1W B;  4B3M Q;  1PZJ D;  4DK3 C;  3U50 C;  3PO2 H;  1AZP A;  3UDF A;  3I72 A;  1J5E Q;  1PH3 A;  2AUK A;  3GTO H;  2ENB A;  2DNE A;  1EFI D;  4GKK L;  3U4Z A;  5C6A A;  1R9T H;  2N49 A;  4WJ3 M;  5J22 A;  1BCP D;  3SGI A;  1TU2 B;  2G9D A;  1HH2 P;  2F0K A;  4DV4 Q;  2IX1 A;  1MJC A;  3E6Z X;  1UEA B;  3A8J E;  5JEA J;  1N36 Q;  2D0O A;  2AUJ D;  1B70 B;  4GLX A;  4CJ0 B;  5D65 A;  4GKK Q;  2R92 H;  4HAE A;  1EIY B;  3BVM A;  2V1C C;  2B2Y A;  5EJW A;  3PQI A;  1EIF A;  4HCE A;  4DR2 Q;  5GAH C;  1ET6 A;  4QF4 A;  5G3L D;  4L8J A;  4JBM A;  2HQL A;  3A74 A;  1QJO A;  2XIW A;  5LL6 X;  1S5D D;  2B2U C;  3TRE A;  4B3T L;  3DWQ A;  2A1A A;  3NQT A;  4EQN A;  1IW7 C;  2CW0 C;  1Q86 C;  2EVB A;  4KN4 C;  3GTJ B;  2EYJ A;  1A3T A;  3I91 A;  4OWX B;  3MXG A;  2PMZ E;  2FJ2 A;  2RDH A;  3RZO H;  1N34 Q;  2AQ3 B;  4OO1 H;  4J6H A;  3F1Z A;  3GTL B;  3HOX H;  3CCU A;  1R4Q B;  4B3S L;  2I07 B;  4JI6 L;  4U68 A;  1V9P A;  3CU7 A;  4O2D A;  4OEM B;  1QE6 A;  2MO0 A;  5M3F B;  3ERS X;  3T13 A;  3HZX A;  1H95 A;  1FNV A;  4P74 A;  3VR3 A;  2UXB L;  2IHE A;  1Y1V B;  4QL5 A;  2WKD A;  4BBR H;  1P16 A;  2F0T A;  1W6K A;  2EY2 A;  3O13 A;  3KBX A;  1LTI D;  2QW7 A;  5C4Z A;  3GQB A;  1CZW A;  1W2B A;  4DAV A;  1K8A C;  3VYR A;  2Q2H A;  2EZV A;  4V19 0;  3CCS A;  5EGT A;  1UWV A;  1SXT A;  2F0S A;  4HIM A;  2K5H A;  2KEC A;  4A3F G;  2YTY A;  4B3S Q;  1TY2 A;  4KN7 C;  4BY7 B;  4A3G B;  3K58 A;  3I4N G;  1Z47 A;  5TSS A;  2EE1 A;  5IGF A;  4IUU A;  3U58 A;  2HHH L;  4ZLT F;  5I2X A;  2L1B A;  4NXN L;  3JAM c;  2UXB Q;  4DV6 L;  2B2W A;  3GTM H;  1I6H H;  2KQ3 A;  1QCB D;  2OTL A;  1EWC A;  3CHB D;  1E1O A;  2E2H B;  3J7Y W;  3BZC A;  1AE3 A;  3UI2 A;  5EPK A;  3IAY A;  2A73 B;  1UNS A;  1JCK B;  1EY4 A;  1EZ6 A;  2R93 H;  1WCM B;  4F7X A;  5IE8 A;  1SBB B;  2K5D A;  3R2I A;  1VQC A;  2NTS A;  3R93 A;  2UUB Q;  4IFD I;  2RKS A;  1CFM A;  2F0Q A;  2QEJ C;  3H0G H;  5C0X I;  5M5X B;  2OTJ A;  4DU9 A;  3S14 B;  2RHS B;  4X3S A;  2F0L A;  1H9K A;  4JYA L;  3F2U A;  3FPP A;  3HS0 C;  4DV6 Q;  4PNY A;  2Z4I A;  5D3D A;  3C3L A;  2RF4 A;  4H0L C;  4DV7 Q;  3NEL A;  5FLX L;  2H1E A;  5CMD A;  4OGQ C;  5C4H A;  3CP0 A;  3VA5 A;  2EDG A;  4GOP B;  4DR4 Q;  1ENF A;  3T56 B;  1PFM A;  4UAI A;  2UU9 L;  3MFG A;  3TN2 A;  4C3I G;  4JYA Q;  1Y8O B;  3I8Z A;  2K5W A;  4PV1 C;  3RUZ A;  4DUZ L;  5DEH A;  5EKI A;  3I90 A;  3HRZ C;  3HOV B;  5D3I B;  1K9M C;  1N32 L;  2GN5 A;  2TMP A;  3J80 E;  1HRJ A;  1CQV A;  3A8I E;  2NWG A;  4JI4 L;  3T1Y L;  4A3K G;  1PRT D;  4JI8 Q;  3TDQ A;  3IFT A;  2PQA A;  3UE0 A;  1CKM A;  1VQL A;  1PYW D;  2UU9 Q;  3M7G A;  5LL6 S;  2TSS A;  1EY8 A;  4G57 A;  3M3Y H;  1VQJ A;  3VR4 A;  1HPC A;  4MTN A;  5FO9 B;  1I4X A;  2B2Y C;  3GDE A;  1SE8 A;  1Y8N B;  3V2T A;  3HOZ G;  1N32 Q;  3S16 H;  1VMC A;  3FP9 A;  4A3M G;  1ML0 D;  2DN8 A;  3CRL C;  4JI4 Q;  2WIN B;  2YU9 B;  1LYL A;  3J81 i;  4K5X A;  2F0E A;  4CDD C;  1PH9 A;  1L2F A;  1NUC A;  1V43 A;  2WB1 B;  3NEM A;  2F3I A;  5LMN W;  1Y69 U;  2CHB D;  2F03 A;  2EXZ A;  2NYZ D;  3EIV A;  1VQA A;  2XWJ B;  2ZM6 Q;  1D7Q A;  4P71 A;  5K5P A;  2R7Z B;  1VQI A;  2E75 C;  3ULP A;  4V0B A;  2QIL A;  2EYL A;  2AKW B;  4LF8 Q;  1PTO F;  3KFU A;  2KEE A;  5M5Y H;  5CV8 A;  3BU2 A;  2K33 A;  3J80 i;  4LF7 L;  4FNF A;  3VA7 A;  3MZ5 A;  1FR3 A;  3STB C;  1Y1W H;  3G48 A;  5JVG 3;  1DON A;  2ZXP A;  3J7A 5;  4C56 C;  1OTC A;  1B7Y B;  4MIU A;  4A3D B;  3H94 A;  4CGY B;  4HJ5 A;  3VDY A;  3BVG A;  2BH8 A;  4EVO A;  2Z9H A;  3F8T A;  1L0X B;  4APV A;  4X3U A;  4I65 A;  1H9S B;  1YVC A;  4DUY L;  3AFP A;  2EJM A;  4DKA C;  3BDO A;  4YY3 L;  2K6A A;  1HNZ L;  4A76 A;  4LF7 Q;  1T5X D;  2FFK B;  4H13 C;  3QR8 A;  1TY0 A;  2XRQ D;  1VQD A;  3PMF A;  4IUN A;  1ZXT A;  1DOL A;  4IN3 A;  4IFD H;  3AEV A;  5C0X H;  2AQ2 B;  2BCO A;  3I4M G;  3J80 L;  1M4V A;  1DJR D;  2NZO A;  4XQQ A;  1MHW C;  2UUC Q;  2VUM G;  5A2Q E;  1EY5 A;  2L55 A;  2Q8T A;  4DUY Q;  1S40 A;  4A3B B;  1KIX A;  4YY3 Q;  2B2V A;  1HNZ Q;  2JXM B;  2A68 C;  1YEZ A;  4HIO A;  1A63 A;  2N8N A;  4YCW A;  2M00 A;  1KRS A;  4L63 B;  1QG7 A;  1DYQ A;  1QZH A;  4LF9 L;  3HOU B;  4ALP A;  1X6O A;  1D2B A;  1JB3 A;  3GTJ H;  4WRD A;  4KY5 A;  5IYB G;  1WFQ A;  4KJO A;  5FO8 B;  1GD7 A;  2AQ1 B;  4OHJ A;  1PZK D;  1GVP A;  3L9A X;  1JMC A;  4NP5 A;  2JEA I;  5IYC H;  1ROD A;  1PTO C;  3GTL H;  3FRP B;  1I94 Q;  1F2M A;  3CXC A;  3H6M A;  5M3F H;  4LF9 Q;  4DR7 L;  1E2Z A;  1JJ2 A;  1NTG A;  2LFN A;  3S2H B;  1VQ7 A;  1KHI A;  1Y1V H;  4GZY C;  3OOC A;  1H9J A;  3PO3 G;  3PUW A;  3HOW B;  4QB4 A;  4JC0 A;  1O7Z A;  1VQ9 A;  2M2L A;  1NBW A;  1ICF B;  5CV9 A;  3TSS A;  2IPK D;  4BY7 H;  4A3G H;  4DV3 L;  4RA8 A;  1WD0 A;  3GTP B;  3F2D A;  4DR7 Q;  4KY6 A;  2YTX A;  1E2V A;  2EIF A;  3M4Y A;  2ZTE A;  5I9O A;  2RBM A;  1MIU A;  4X66 L;  5FLX c;  2E2H H;  1BCP F;  4A75 A;  1Y8P B;  3T1H L;  1Q7Y C;  1A0I A;  4ODG A;  1STN A;  4DAM A;  2NN6 G;  3U9S A;  2JA8 G;  1WCM H;  1B9N A;  5AFW A;  1RL2 A;  1Q90 A;  4TKO B;  5M5X H;  4ME3 A;  1NAP A;  4DAY B;  3S14 H;  4DV3 Q;  5ELE A;  2JA5 B;  3L2P A;  1TXY A;  1X3P A;  2KBN A;  3E9H A;  1K28 A;  1BNZ A;  4UP7 A;  1CHP D;  3AU7 A;  3T1H Q;  5KND A;  4A3J G;  5L37 A;  2EYP A;  5AJ3 L;  5LMU L;  1L1O B;  3K5N A;  1IYJ B;  2A6E D;  3HKS A;  1FJG L;  2MPM A;  1G91 A;  2A69 C;  1OXX K;  2JJQ A;  1B53 A;  1WJJ A;  1HFN A;  3GTK B;  4G7H C;  2WB1 E;  3I4O A;  2R7D A;  3KDF B;  1QWY A;  4G7Z C;  3NHH A;  1Z7T A;  1I4P A;  2ID0 A;  4Q0F A;  1DGS A;  4FF3 A;  1SNQ A;  3HOV H;  2B63 G;  5M3M G;  1X54 A;  1CA5 A;  3CCL A;  4LNQ A;  1IL8 A;  3ONA B;  5AJ3 Q;  5H1S E;  5LMU Q;  1GXD C;  1FJG Q;  1EWH A;  2BDN A;  4GN4 B;  1BQQ T;  1QNU A;  5C4X G;  2F52 A;  3RLN A;  3KF6 B;  2JK8 A;  4JCV E;  4JI7 L;  1I4Q A;  1VQF A;  2MFI A;  1LAB A;  3QOJ A;  3WDN A;  2B2V C;  3FHW A;  1OXV A;  3DWA A;  2ZTC A;  4KD4 A;  2XGT A;  4DR1 L;  2QF7 A;  3RZD B;  1X3Q A;  1YNJ C;  1STH A;  1BCP C;  3EJI A;  2YU9 H;  4HJ9 A;  2NVQ B;  5E7N A;  4KKT A;  4DR5 Q;  3X3N A;  1P8L A;  3T51 B;  2JP1 A;  4R4T A;  3AQQ A;  4JI7 Q;  2PQE A;  2UXC Q;  1B50 A;  1O7I A;  3OWE B;  4QGU A;  1L0Y B;  2ZJQ A;  5LMN L;  1O78 A;  2X6L A;  3M7N A;  2F0V A;  2WAQ G;  4KHZ A;  5EQ0 A;  2VQE Q;  2ATW A;  4DR1 Q;  2R7Z H;  3PIO A;  3ERO A;  2DUD A;  4LFC L;  5GRO A;  1S3O A;  3SK8 A;  3CW2 C;  2K75 A;  2RDG A;  4HMI A;  2B2T A;  3PUY A;  1D6E C;  4RGT A;  4JBW A;  2X6G A;  1OXS C;  3J80 c;  3M4P A;  2PI2 E;  4A3E G;  1X65 A;  2KHS A;  4A3D H;  1HA6 A;  1Z9F A;  2BDO A;  4EX5 A;  2M9V A;  4K0K L;  2UXD L;  1I4G A;  2LSS A;  4N9T A;  4CJ2 C;  1I4H A;  3IL8 A;  1GKH A;  3W5O A;  1N33 L;  1SFO B;  1SRO A;  3E3X A;  4R8I A;  4LFC Q;  1ILQ A;  5DNF A;  3RR5 A;  4BXX G;  3QJY A;  1NR2 A;  4YCU A;  2LXK A;  3G7L A;  2NB0 A;  4CBV A;  4C3J B;  2JA7 G;  1DZ1 A;  3ITP A;  4I7A A;  2K03 A;  5FKA C;  5JJK A;  1YNN C;  2PZT A;  3CQZ B;  2SNM A;  1TWA B;  4A3F B;  1PLF A;  1HNX L;  3L7Z C;  1VQ8 A;  3T53 B;  5IP9 G;  3K80 C;  3OTO L;  1LT4 D;  4P72 A;  4A3B H;  4HED A;  3FKI B;  3GP7 A;  3ULL A;  4AYB G;  4KI0 A;  4Z9C B;  1SYG A;  2A19 A;  3HOU H;  1S4Z A;  1B9M A;  1TS5 A;  3ZJY C;  1D5X C;  1C7Y A;  2OEO A;  3C1E A;  3BS1 A;  3CC2 A;  3ND8 A;  3T4A C;  3PO2 G;  4B3R L;  3OWF A;  1BBU A;  3SR1 A;  1C4Q A;  2BE5 C;  3OTO Q;  5CGK A;  3S15 B; 
#chains in the Genus database with same CATH homology
 3I4N G;  5IYD H;  1Z47 A;  4JI3 L;  3NEN A;  1HNW L;  3U58 A;  5M3F G;  2HHH L;  1VQH A;  1KD1 C;  3JAM c;  4NXN L;  4DV2 L;  2UXB Q;  4DV6 L;  4Y7N H;  4IPH A;  3GTM H;  1I6H H;  2OTL A;  1Y1V G;  4AQY Q;  1E1O A;  4DR5 L;  4X65 Q;  3STB D;  3BZC A;  1AE3 A;  5JEA G;  4OX9 Q;  1OXU A;  3PSI A;  4JI5 Q;  3F2B A;  2UXC L;  3AFQ A;  2R93 H;  5K36 G;  1LUZ A;  5FJ8 G;  3F2C A;  1Q8K A;  2D62 A;  5IE8 A;  4KLK A;  4B3R Q;  3HOW H;  3J7Z C;  1VQC A;  1HZB A;  2NN6 I;  3TQY A;  2VW9 A;  4A3I H;  2UUB Q;  4IFD I;  2OTJ A;  5C0X I;  3H0G H;  4P73 A;  2R92 G;  4HID A;  2VQE L;  2RHS B;  1RIP A;  2KCT A;  3EBE A;  1EOV A;  4H02 A;  4JI3 Q;  4A3G G;  2EQS A;  4JYA L;  2Y0S G;  1HNW Q;  3HKZ E;  4EQ5 A;  1YJ9 A;  2AWO A;  2FXQ A;  1VQ5 A;  2PQA B;  2E5L L;  4JOI A;  4QJF A;  4DV6 Q;  1N36 L;  1I50 H;  3GTP H;  4WJ4 A;  4IJH A;  2N78 A;  3PF5 A;  2Z6K C;  3I7F A;  2RF4 A;  4DV7 Q;  4A3L G;  4LFB L;  3S1Q H;  3NEL A;  4LUV A;  4LUZ A;  5J3B A;  4GLA C;  4LF5 Q;  2A8V A;  3CP0 A;  3J81 c;  4GOP B;  4A3J H;  4DR4 Q;  1YHQ A;  1WCM G;  2R6G A;  2GVB A;  3NBH B;  2L15 A;  2PNH A;  1HJP A;  2UU9 L;  4X62 L;  1AH9 A;  2K5V A;  5C44 G;  1X56 A;  3KYH C;  4X6A H;  1Q1B A;  4JYA Q;  2NVX H;  4DR2 L;  3M85 A;  2E5L Q;  3GD7 A;  2RCN A;  3KJP A;  3JAM i;  4IPG A;  4UP9 A;  4DPG A;  4DUZ L;  2JA5 H;  3RLO A;  1XPU A;  3PIP A;  1K9M C;  3HOX G;  3I56 A;  4LFB Q;  2GN5 A;  1N32 L;  1YI2 A;  4JI4 L;  3T1Y L;  2WAQ E;  1KXL A;  4A3K G;  2IHF A;  4JI8 Q;  3A0J A;  3W1G A;  2AWN A;  4YWM A;  3S1M H;  2CFM A;  1HZC A;  2EXD A;  2PQA A;  3UE0 A;  1CKM A;  1VQL A;  2UU9 Q;  4X62 Q;  1I5F A;  4JBJ A;  4L5S A;  4IOA A;  4JV5 Q;  2VUM H;  5C4X H;  3M3Y H;  1VQJ A;  4QY7 A;  1N34 L;  3G4S A;  4MTN A;  1U0L A;  3GTK H;  3BZK A;  4BY1 G;  3GDE A;  1X9N A;  5HGQ A;  4UP8 A;  1SE8 A;  3K7U C;  3TEH B;  2ZJP A;  4GOP A;  5JJI A;  2YV5 A;  1HR0 W;  3HOZ G;  3KJO A;  1N32 Q;  3S16 H;  3HOV G;  4A3M G;  3FP9 A;  4PZ6 A;  5IYD G;  4JI4 Q;  1JJC B;  5GAG C;  2ES2 A;  1CKO A;  1LYL A;  4A4I A;  1EYG A;  3J81 i;  4L5T A;  4UY8 C;  1D8L A;  3PF4 A;  1VQE A;  5GQO A;  1PH9 A;  1L2F A;  1V43 A;  4UPA A;  5IYB H;  1N9W A;  2QGQ A;  1N8R C;  1XNR L;  3NEM A;  2F3I A;  5LMN W;  3KLW A;  1A8V A;  1KL9 A;  1G51 A;  4YWK A;  2ZTD A;  3EIV A;  2B29 A;  5HY6 A;  1VQA A;  1TWF H;  2ZM6 Q;  3H3V I;  1D7Q A;  1AE2 A;  4P71 A;  3ULJ A;  1VQI A;  1IL2 A;  2ASB A;  2Q2I A;  3H0G G;  3K81 C;  3UDI A;  3ULP A;  1PH7 A;  1PHJ A;  2NZH A;  1VCI A;  4DV1 L;  3I2Z A;  4JI0 L;  1LM0 A;  2AKW B;  5C4J H;  1EQQ A;  1CUK A;  4LF8 Q;  3KFU A;  4DR6 Q;  5M5Y H;  4X65 L;  2JA9 A;  3BU2 A;  3K8A A;  3J80 i;  3RZD H;  4LF7 L;  1XNR Q;  2JA6 G;  4MZ9 A;  2F4V Q;  2JEB I;  2UUA Q;  2IT1 A;  2WB1 G;  3STB C;  1Y1W H;  1T9H A;  2NVQ H;  3G48 A;  4YCV A;  3A5U A;  4DV0 Q;  4TQU S;  4L5Q A;  4X66 Q;  4AYB E;  3CPW A;  5FLM H;  3PUV A;  1Q82 C;  1ASZ A;  1UE1 A;  1XJV A;  2Q2U A;  3J81 j;  3J7A 5;  4PG3 A;  3PV0 A;  1OTC A;  1B7Y B;  4GNX C;  4IO9 A;  4NXM L;  4HJ5 A;  3VDY A;  2BH8 A;  1SRU A;  4A3E H;  2GVA A;  2VY3 A;  4BA1 I;  3F8T A;  4HJA A;  4APV A;  2R7Z G;  1Q46 A;  4DV1 Q;  4JI0 Q;  1YVC A;  4DUY L;  1YHA A;  3AFP A;  4DKA C;  3E9I A;  4YY3 L;  4DV7 L;  1BBW A;  1NMF A;  1HNZ L;  2OQK A;  4A76 A;  3S2H H;  4LF5 L;  4LF7 Q;  1L0W A;  2VNU D;  1VQG A;  1HZ9 A;  1VQD A;  3CPF A;  4DR4 L;  2JA8 H;  2AHO B;  2AMC B;  4POF A;  3AEV A;  4IFD J;  4HIK A;  5IT9 c;  1Q12 A;  5EAY A;  5C0X J;  3I4M G;  4Y52 H;  4JG2 A;  1L1O C;  4GS3 A;  1E1T A;  4NXM Q;  2JA7 H;  2NZO A;  1PH4 A;  1YHB A;  2KHJ A;  4A3D G;  2UUC Q;  5IY0 A;  3A5Z B;  2VUM G;  4BBS H;  4DUY Q;  1S40 A;  3UDX A;  1KIX A;  1KAW A;  2BA1 A;  2H5X A;  4YY3 Q;  4JOI C;  1HNZ Q;  1PFS A;  1J6Q A;  1YEZ A;  3MEF A;  4HIO A;  1PH6 A;  1A63 A;  2LXJ A;  2N8N A;  4YCW A;  4PMW A;  1UE5 A;  2K4K A;  1C9O A;  1KRS A;  4QQB X;  3M9B A;  1SFO H;  1PV4 A;  3RN5 A;  4JI8 L;  1QZH A;  2CQO A;  4LF9 L;  2Y0S E;  5ELO A;  1JT8 A;  4ALP A;  1X6O A;  2VS1 A;  2E2J H;  1E7Z A;  4JV5 L;  4XIG S;  1EFW A;  1IBL L;  4C3J H;  1Q1E A;  3GTJ H;  1HR0 L;  2HT1 A;  3S2D H;  2MO1 A;  4P75 A;  1MJE A;  5IYB G;  1WFQ A;  4TVA B;  3OW2 A;  1YZ6 A;  4C2M H;  1GD7 A;  1UEB A;  4O0A A;  5BR8 Q;  2CWA A;  3CQZ H;  1X3E A;  1CKN B;  1TWA H;  4R4Q A;  3DLL A;  4OO1 G;  1GVP A;  4A3F H;  1NY4 A;  1JMC A;  3CCE A;  4YHH L;  2JEA I;  5IYC H;  3TS2 A;  4A3B G;  3UE1 A;  2B63 H;  3GTL H;  1I94 Q;  5M3M H;  3CXC A;  4LF4 Q;  1K73 C;  5M3F H;  1CSP A;  4LF9 Q;  1QZG A;  4DR7 L;  3FKI H;  4BBR G;  3IRB A;  1VQK A;  1JJ2 A;  1NTG A;  3HOU G;  1VQ7 A;  1KHI A;  2WP8 J;  2KHI A;  1E24 A;  1Y1V H;  2OQ0 A;  1IBL Q;  1SN8 A;  1HR0 Q;  4AIM A;  4GLV B;  2ZJR A;  1K8G A;  3PUW A;  2E8G A;  3PO3 G;  4DK6 C;  2ZM6 L;  2JQO A;  1YNX A;  1E22 A;  2JE6 I;  4JC0 A;  4YWL A;  5FJ8 H;  1Y1W G;  1VQ9 A;  2YTV A;  5C3E G;  3PCO B;  1NBW A;  5M5W H;  1CSQ A;  5FLM G;  2PI2 A;  4YHH Q;  3MXN B;  4GOP C;  4C3H H;  2BH2 A;  1XPR A;  5LMN Q;  1PH1 A;  4OWW B;  4DR6 L;  1YIJ A;  4LF8 L;  2QEX A;  1X3G A;  4BY7 H;  4DV3 L;  1M90 C;  3S15 H;  4A3G H;  2N3S A;  3F2D A;  4DR7 Q;  3CCQ A;  1G29 1;  1V1Q A;  2YTX A;  3K0X A;  2EIF A;  2HIV A;  2F4V L;  2UUA L;  1JE5 A;  2ZTE A;  1CKN A;  1PH2 A;  3GTG H;  2OWO A;  3M4O H;  4A3L H;  3S17 H;  4MNO A;  4DV0 L;  1MIU A;  1W3S A;  2CKZ B;  4X66 L;  1UE7 A;  5FLX c;  2R93 G;  2E2H H;  3H3V H;  4A75 A;  3T1H L;  1Q7Y C;  1A0I A;  1U5K A;  1PYS B;  1XMO Q;  1PH5 A;  4A3C H;  3HOW G;  4DAM A;  2NN6 G;  2RHQ B;  3KF8 B;  3Q8D A;  1YJN A;  3I55 A;  1MKH A;  1WCM H;  3TS0 A;  2BA0 A;  5C0X G;  4A3I G;  2JA8 G;  3M4Q A;  4R1J A;  3HOY H;  5GAD C;  5IWA Q;  1RL2 A;  4FDB A;  2WFW A;  3L0O A;  1QVG A;  1GM5 A;  1K3R A;  2HIX A;  5M5X H;  1X3F A;  4ME3 A;  4OXP A;  4DAY B;  1XPO A;  3S14 H;  3PUX A;  4DV3 Q;  3L2P A;  1TXY A;  3W1B A;  1KC8 C;  1VQM A;  1ASY A;  3CMA A;  4K0K Q;  1QVC A;  1E3P A;  2KBN A;  2UXD Q;  1G6P A;  1SMX A;  2ALY B;  2C35 B;  3E9H A;  4GKJ L;  2CWP A;  4JBK A;  1X55 A;  1JB7 A;  1N33 Q;  4OO1 I;  1TWH H;  2R7F A;  3RN2 A;  4RG1 A;  4KHP L;  1NMG A;  4UP7 A;  3T1H Q;  5DLQ E;  4A93 H;  4A3J G;  4B3T Q;  1VQP A;  4R4C A;  1WOC A;  5AJ3 L;  1Q81 C;  5LMU L;  1L1O B;  1TWC H;  1IYJ B;  3HKS A;  1VQB A;  4DNI A;  1FJG L;  2UUC L;  1OXX K;  2JJQ A;  1XTD A;  5JJL A;  2IX0 A;  3TRZ A;  3PGZ A;  1WJJ A;  5GAE C;  2QA4 A;  2WB1 E;  3I4O A;  3G71 A;  2R7D A;  3KDF B;  4J15 A;  2VQF L;  4OON A;  3DM3 A;  4IOC A;  1VQO A;  1PH8 A;  3CC7 A;  4DV5 Q;  4HJ8 A;  1IZ6 A;  2JA5 G;  2ID0 A;  1HNX Q;  4OWT B;  4BY1 H;  1C0A A;  3KOJ A;  2OCE A;  1VQ4 A;  4GKJ Q;  4PZ7 A;  1DGS A;  3HOZ H;  4BXX H;  4KHP Q;  4JI6 Q;  3HOV H;  3CCJ A;  4A3M H;  2B63 G;  3H15 A;  5M3M G;  1X54 A;  2D0P A;  3CCL A;  4LNQ A;  3S24 A;  3CCM A;  3E0E A;  5AJ3 Q;  5H1S E;  3EN2 A;  5LMU Q;  1Y14 B;  1FJG Q;  3WWV A;  3FKI G;  1UE6 A;  5IP7 H;  5ELN A;  2I5L X;  4GN4 B;  3CME A;  4B3M L;  5C4X G;  2F52 A;  1KRT A;  5BR8 L;  1YIT A;  3HKZ G;  3RLN A;  4R4O A;  3RNU A;  3KF6 B;  1J5E L;  2JK8 A;  4JCV E;  2Q2T A;  4JI7 L;  2VQF Q;  2NVT H;  1VQF A;  2MFI A;  5IP9 H;  4LFA L;  1SLJ A;  3PUZ A;  1I94 L;  2K5N A;  3B6Y A;  1L1O A;  3FHW A;  4RMF A;  1OXV A;  4LF4 L;  2ZTC A;  2KCM A;  2XGT A;  4DR1 L;  4DV4 L;  2CCZ A;  3CD6 A;  4BY7 G;  2XTI A;  2MQH A;  4L5R C;  2HHH Q;  2DGY A;  3KDF A;  2Z6K A;  2YU9 H;  4HJ9 A;  4DV2 Q;  4NXN Q;  2YYZ A;  2JA6 H;  5E7N A;  3K7A H;  4B3M Q;  4IFD G;  4NB3 A;  3JC6 6;  3RLF A;  4DK3 C;  4DR5 Q;  3U50 C;  3PO2 H;  3CCR A;  1LTL A;  1P8L A;  3UDF A;  1J5E Q;  3CF5 A;  4R4T A;  3AQQ A;  1PH3 A;  4JI7 Q;  1YBY A;  3GTO H;  1O7I A;  2UXC Q;  4GKK L;  4A3C G;  4LFA Q;  2UUB L;  4QGU A;  3U4Z A;  2ZJQ A;  5LMN L;  3I4N H;  3AYH B;  4X64 L;  3HOY G;  2B3G A;  1R9T H;  3M7N A;  2N49 A;  1IXR A;  4WJ3 M;  1IBK L;  1TWG H;  2I5M X;  2WAQ G;  2K14 A;  4IPD A;  4KHZ A;  3SGI A;  2VQE Q;  3ER0 A;  4DR1 Q;  3PIO A;  1S72 A;  1HH2 P;  4DV4 Q;  2ATW A;  2R7Z H;  2IX1 A;  1MJC A;  1PYB A;  2KEN A;  3KF6 A;  1NE3 A;  3BJU A;  3D0F A;  1KQS A;  3HFZ B;  3CCV A;  2DUD A;  2Z0S A;  3LGJ A;  4LFC L;  5GRO A;  5JEA J;  4GN3 B;  1N36 Q;  1S3O A;  1VQ6 A;  1XNQ L;  1HZA A;  1QUQ B;  2D0O A;  3CW2 C;  1XMO L;  1B8A A;  1VS0 A;  2K75 A;  1IBM L;  1B70 B;  3G6E A;  4GLX A;  3PUY A;  4A93 G;  4R4I A;  5IWA L;  4GKK Q;  4JBW A;  2R92 H;  4POG A;  3I4M H;  1OXS C;  3J80 c;  3M4P A;  2PI2 E;  4X64 Q;  1PVO A;  4JI2 L;  1EIY B;  4PZ8 A;  4A3E G;  1X65 A;  2VL6 A;  3D31 A;  2MNA A;  4A3D H;  4AH6 A;  1IBK Q;  4BA2 I;  1Z9F A;  4EX5 A;  1PA6 A;  2V1C C;  4K0K L;  2UXD L;  2LSS A;  1M1K C;  2K50 A;  1EIF A;  2IY5 B;  3GO5 A;  4DR3 L;  4DR2 Q;  1GKH A;  3W5O A;  5GAH C;  1N33 L;  4JBM A;  2HQL A;  4HJ7 A;  3A74 A;  1SRO A;  2K52 A;  2I0Q A;  4LFC Q;  3CC4 A;  1K83 H;  4DUZ Q;  1XNQ Q;  3RR5 A;  3TRE A;  4B3T L;  2A1A A;  3ICE A;  4BXX G;  4LF6 L;  4YCU A;  1IBM Q;  2LXK A;  3OYY A;  4GNX B;  1Q86 C;  1GO3 E;  4IPC A;  3T1Y Q;  1VQN A;  4IJL A;  5C44 H;  2JA7 G;  2I5H A;  4JI2 Q;  1A62 A;  4XTC S;  4OWX B;  1YJW A;  4C3I H;  5IP7 G;  2PMZ E;  3GTQ H;  5JJK A;  1WI5 A;  1SR3 A;  3S1R H;  2VZA A;  4JI1 L;  4BBS G;  1K0R A;  1FL0 A;  4DV5 L;  1I3Q H;  1QUQ A;  1HNX L;  3L7Z C;  3RZO H;  1N34 Q;  1OXT A;  3CAM A;  1EWI A;  1VQ8 A;  4DR3 Q;  3F1Z A;  3HOX H;  4GN5 A;  5IP9 G;  3K80 C;  3OTO L;  4P72 A;  1BVS A;  3CCU A;  1V9P A;  1XMQ L;  2E2I H;  4B3S L;  4O2D A;  4JI6 L;  1EQR A;  4LUO A;  4A3B H;  2MO0 A;  1QVF A;  4A3K H;  3ERS X;  4LWC A;  3ULL A;  4AYB G;  4LF6 Q;  4KI0 A;  1EUJ A;  2NVY H;  1H95 A;  4P74 A;  1NJI C;  2UXB L;  2A19 A;  2IHE A;  4QL5 A;  3U4V A;  4BBR H;  1P16 A;  4NPS A;  3HOU H;  4AQY L;  1W2B A;  1K8A C;  4OX9 L;  3ZJY C;  4JI5 L;  1C7Y A;  2Q2H A;  3S1N H;  3CCS A;  3PO3 H;  1FGU A;  4JI1 Q;  3CC2 A;  4LW1 A;  1UWV A;  4QIW E;  3UDG A;  3PO2 G;  1BKB A;  4HIM A;  2K5H A;  4B3R L;  1BBU A;  4A3F G;  5C3E H;  4GNX A;  5IYC G;  1JJG A;  2YTY A;  3OTO Q;  4B3S Q;  1XMQ Q;  1FVI A;  1WYD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...