2UUBL

Structure of the thermus thermophilus 30s ribosomal subunit complexed with a valine-asl with cmo5u in position 34 bound to an mrna with a guu-codon in the a-site and paromomycin.
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
124
structure length
124
Chain Sequence
b'PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S Ribosomal RNA
publication title Mechanism for Expanding the Decoding Capacity of Transfer Rnas by Modification of Uridines
pubmed doi rcsb
molecule tags Ribosome
total genus 17
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2007-03-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2uubL00
1VQPA 3I55A 2ZM6Q 1AE3A 5FJ8H 4MNOA 4JI6Q 4LF7Q 3HFZB 2HIXA 5M3MH 4MTNA 3TRZA 4AH6A 4DV7L 3HOUG 3S2DH 5IWAQ 3NBHB 2QA4A 4GNXA 1YHQA 3CW2C 4GN5A 3U58A 3CD6A 4L5RC 4IFDJ 4JCVE 4H02A 2Z6KA 2VZAA 1VQ7A 1XNQL 3K80C 1HNXL 2XGTA 1NY4A 2ZM6L 2EXDA 1BKBA 2E5LL 3CPFA 5LMNW 4JI6L 1Y1WG 4LF7L 2HHHQ 1MIUA 4AYBE 5JEAJ 3W1BA 4JI7L 1Y14B 4JYAQ 4LUOA 4X65L 1PHJA 3AEVA 1HNWL 1K8GA 3ICEA 4B3ML 3F2BA 4IOAA 1RL2A 1A62A 4GLVB 4DV4Q 5GADC 1JJ2A 4IPGA 4BBSH 3KJOA 4KHZA 4JBJA 4A3LG 4PZ8A 4IPHA 3HOZH 4A3CH 2F52A 2R6GA 5M5WH 4R4CA 5FLMG 4JI3Q 1IZ6A 1L1OC 1KAWA 4C3IH 1XPRA 2HHHL 2Y0SE 5HY6A 3CPWA 2NZOA 4DV5Q 4JYAL 2B63G 4UP7A 1GVPA 3DM3A 1PH8A 2JEAI 2F3IA 4DUYL 2KHIA 3ULJA 1EFWA 4BA1I 4DR1L 4GN3B 1A0IA 5IYCG 2DUDA 2PQAA 1VS0A 1HJPA 4LF5L 2VUMH 1PYBA 4JI3L 3GTKH 4EX5A 2YYZA 3TREA 4HIMA 4HIDA 4GNXC 1WFQA 1PH5A 4A3MG 4YWMA 1HZAA 2B29A 5GROA 2Z6KC 4BY1H 1VQ9A 2Q2HA 4AIMA 1JJCB 4LFBQ 4GOPB 3BZCA 2D62A 3STBC 4QL5A 4DR7L 2CQOA 2OCEA 2I5MX 1KRTA 4B3RQ 3UDIA 2I5LX 1QVCA 3HOXG 3HKSA 5HGQA 1VQGA 2JA7H 1JJGA 3S1NH 3E0EA 4DV1Q 4O2DA 5M5XH 1PH2A 4JI0Q 1P8LA 3J81i 4BBRG 3HOZG 1SR3A 2FXQA 1YEZA 4DV3L 2UXCQ 3RLOA 4LFBL 1K73C 1W2BA 3JC66 3Q8DA 1NTGA 1Q82C 4POFA 3HKZG 4B3RL 1TWAH 4HJAA 4OO1I 3CF5A 1KRSA 1U5KA 2AMCB 2QGQA 2YTVA 4OX9Q 3F2DA 1YJNA 1N33Q 3CC7A 2ATWA 1GO3E 4QJFA 3A5ZB 3M4OH 4JI0L 4NXML 1CSQA 2PNHA 2NVYH 3CCMA 4A3EH 1VQOA 1X55A 3HOVH 1IBMQ 1XMQQ 2AHOB 1Q7YC 3E9HA 4DV0L 1LM0A 3IRBA 3F2CA 3L2PA 2MNAA 1L1OB 2OTJA 5LMUQ 1GM5A 4RG1A 1T9HA 2C35B 1CKNA 2MO1A 2LXKA 4R1JA 1O7IA 2CWPA 1UE6A 2JJQA 3H0GH 5J3BA 1VQBA 2WP8J 2JA5H 3I4MH 3S17H 1VQHA 5IYBH 3AFQA 1IBML 3PO3H 1UEBA 2EQSA 1AE2A 4LUZA 4IO9A 5AJ3Q 5GAGC 3PO2G 1EIYB 4YHHQ 3CCEA 2JA8G 1AH9A 2K5VA 2IX0A 1K83H 4X66Q 2GVBA 1KXLA 1EIFA 1XTDA 2PMZE 1LTLA 1PFSA 3CAMA 4P75A 4JI2Q 2LSSA 5LMUL 4LF4L 1Q1BA 2YTYA 5IP7G 5FJ8G 1A8VA 4AQYQ 3FKIH 1N36L 1NMGA 5M3MG 5GAHC 2HT1A 5AJ3L 3KJPA 1G51A 2A19A 2YTXA 1GD7A 2JQOA 4ME3A 3U4VA 4YHHL 1WJJA 4OO1G 4C3JH 2R93H 1B8AA 2R92H 1JB7A 3AFPA 4JI2L 4QGUA 1BBWA 1X56A 4XTCS 1HZBA 1HR0L 3CCQA 1YBYA 3PIOA 4JI4L 3I4OA 4GOPC 4R4QA 4OWXB 2E2HH 1C9OA 2PI2E 2RF4A 3S1QH 2A8VA 4A3LH 4BBSG 1KD1C 1HR0W 4A3CG 4DV2L 1ASZA 1E24A 4AYBG 2I0QA 1WYDA 1KIXA 2K4KA 2PQAB 2UUCQ 3AQQA 3J80i 4KHPQ 1B70B 1NBWA 1XJVA 3S16H 1LUZA 2WAQE 1QUQA 4C2MH 2GVAA 4A3BH 2ZTDA 2KENA 3B6YA 3NEMA 3M85A 2VL6A 4L5QA 4PG3A 2VQEQ 5JJLA 4P73A 4JC0A 1E1OA 2KCMA 2Y0SG 4A3IH 5IWAL 5IP9H 1IBKQ 2UUCL 3GTMH 3HOWH 4YY3Q 4LW1A 4BY1G 3KDFA 1WI5A 5C4JH 2N78A 1CUKA 3BZKA 2NN6I 1A63A 1Q81C 3S24A 2ZJRA 3T1HQ 3I4NH 3KF6A 1MKHA 1X3GA 3UDFA 2Q2IA 4DNIA 2BA0A 1FJGQ 4JBWA 2RHQB 1OXVA 4OWWB 3A74A 3RN2A 4JOIA 2JA7G 4Y52H 2L15A 3M7NA 4DV4L 1KHIA 2I5HA 3GTLH 1OXXK 3PUZA 2PI2A 3K0XA 4GS3A 4PZ7A 1WCMH 2VY3A 2YV5A 3J7ZC 3T1HL 1YJ9A 1UE7A 3VDYA 2AWNA 2UUBQ 3PGZA 1FJGL 3G6EA 1N34Q 5JJIA 3EIVA 1OXUA 1LYLA 1CKOA 1PH1A 1XNRQ 3HOYH 4DV5L 4A3DH 2EIFA 3GTPH 1Y1VH 3HOUH 1IBLQ 1KC8C 1M1KC 1R9TH 2UUAQ 4HJ8A 2DGYA 4A3EG 3GD7A 2OWOA 2BH8A 4LFAQ 2WFWA 1CKNB 3HOVG 3JAMi 1QZGA 1EOVA 4TVAB 4QY7A 2ALYB 4YCUA 1SN8A 2NVXH 4POGA 2UUBL 2N8NA 1Q1EA 5IE8A 1JMCA 2BA1A 1Z47A 5C3EH 2WB1G 4JV5Q 2VS1A 1VQ4A 1SFOH 3PF5A 2UUAL 4A93G 4DR3Q 1Q86C 3H0GG 1I5FA 1SRUA 3I4MG 4BXXH 2CCZA 1HZCA 5IYBG 3PO3G 4JOIC 4R4IA 2K50A 4GKKQ 4RMFA 2Q2UA 1IYJB 2QEXA 4P74A 4DV1L 4JI8Q 3CCSA 2UXCL 1P16A 2IT1A 1PH7A 2B63H 3PCOB 2AWOA 4A3GG 2ID0A 2N3SA 3NELA 4GN4B 4PZ6A 4QIWE 3W5OA 3FKIG 3UE0A 3GTOH 4B3SQ 3CP0A 2VQFQ 4LF6Q 2RHSB 1UE5A 1M90C 3FP9A 4OX9L 4GKKL 4NPSA 2NVQH 2CFMA 2XTIA 4A3KH 2N49A 1HH2P 4DUZQ 1PV4A 1N33L 3RZOH 2R93G 4JI8L 1V43A 5C0XI 5JJKA 2R92G 4GLXA 1QVGA 5M3FH 1SLJA 1H95A 1N9WA 4X62Q 1XMQL 3M9BA 5BR8Q 1G291 4LFCQ 4GKJQ 3H15A 1J6QA 1E1TA 4BA2I 2JK8A 1TWGH 2MQHA 3A0JA 4UP9A 2VQFL 1X9NA 4LF6L 1JE5A 5IYDH 3HKZE 4DUZL 1QUQB 4A3JH 1VQEA 1D8LA 1EWIA 1OXTA 1Z9FA 4LF8Q 4DR4Q 4DAMA 3L7ZC 4YCWA 3RLNA 1Q46A 5IY0A 3RZDH 2K5HA 4X62L 2BH2A 3K7AH 4IJLA 4LFCL 1HNZQ 1V9PA 4YCVA 3ZJYC 5M5YH 3T1YQ 2D0PA 2IHEA 3I2ZA 4O0AA 3BJUA 1YIJA 1QVFA 3TS2A 4DR5Q 2LXJA 2OQ0A 4X66L 1VQCA 1YHBA 1X3EA 4A4IA 4L5SA 1X6OA 3KDFB 4A3BG 3ULPA 1TWHH 4L5TA 1YHAA 4B3TQ 4DR4L 1BBUA 2UXBQ 2B3GA 4AQYL 3KF6B 4K0KQ 5ELNA 4WJ4A 2JA6H 4EQ5A 4DV6Q 2ZTCA 2A1AA 3M4QA 1K0RA 5IP9G 4A3IG 3HOWG 5DLQE 3GDEA 2OQKA 1XPUA 1UE1A 3KOJA 2ZJPA 2JEBI 3T1YL 1HZ9A 4XIGS 4DR5L 2R7FA 5GQOA 3PF4A 3M4PA 3J81j 1XMOQ 5C0XG 3I4NG 4B3TL 4BY7H 1K3RA 3ER0A 4HJ9A 5K36G 4K0KL 1J5EQ 3PSIA 4JBMA 4DK3C 3GTGH 3U50C 4DV7Q 1Q12A 1VQIA 5LMNQ 1IL2A 4A75A 5C4XH 3OW2A 2JA8H 1EQRA 3PO2H 1DGSA 3OTOQ 4DKAC 3KF8B 3S14H 4UPAA 1NJIC 1V1QA 4A3FH 1WCMG 2R7ZH 3J81c 3G4SA 1NE3A 3E9IA 1YJWA 1XMOL 1I94Q 2VUMG 1HNXQ 3MXNB 4KHPL 4GLAC 5IP7H 2E5LQ 5C44H 1CKMA 1VQNA 1J5EL 4JI7Q 2JE6I 3HOYG 1S72A 4A3DG 3PUVA 3CCUA 4X65Q 1WOCA 1CSPA 1Y1VG 2K52A 5LMNL 1VQ8A 4B3MQ 2YU9H 4NXNQ 1HNWQ 1C0AA 1VQDA 2KCTA 3OTOL 4KI0A 1I3QH 3PUWA 1PH6A 3NENA 2VQEL 4OWTB 1K8AC 1MJEA 4IJHA 4JI1Q 1GKHA 1I94L 3LGJA 1C7YA 1IBKL 4MZ9A 4APVA 1YITA 1N8RC 2GN5A 4TQUS 2V1CC 4DAYB 2RCNA 4LUVA 4YY3L 4P71A 2NZHA 4R4OA 3RR5A 4X6AH 5C3EG 3KLWA 1VQAA 2MFIA 4NXNL 3WWVA 1TWFH 3EBEA 4DUYQ 2IHFA 4ALPA 4BXXG 4DR1Q 4HIOA 5C0XJ 3BU2A 4LF5Q 1RIPA 1E3PA 2HIVA 4JI1L 1ASYA 2K5NA 4X64Q 2JA9A 1SMXA 3EN2A 1PYSB 1L2FA 4HJ7A 4UY8C 4DK6C 3SGIA 1VQJA 4Y7NH 4HIKA 1PH3A 1VQFA 2KBNA 3D0FA 4YWLA 2AKWB 3K81C 3G71A 1OXSC 1N32Q 4DR7Q 1G6PA 5GAEC 1PA6A 3PIPA 3A5UA 1Y1WH 1N34L 2NVTH 2IY5B 4IPDA 2E2JH 1XNRL 4QQBX 4PMWA 1VQ6A 2E8GA 4X64L 1PH9A 4A3KG 1IBLL 2Z0SA 1OTCA 4LF9Q 2D0OA 1PH4A 3H3VH 2NN6G 3RLFA 3UDGA 4LFAL 5M3FG 2JA5G 4DV3Q 3TEHB 5IT9c 3U4ZA 4JI5Q 1E7ZA 1YZ6A 3MEFA 4A76A 1UWVA 5FLMH 1VQLA 1N32L 2UXDQ 4IFDI 1VQ5A 2CWAA 3PUYA 3K7UC 3STBD 3PUXA 1VCIA 4LWCA 5IYDG 4JV5L 1X54A 3G48A 4A3JG 4DR3L 4LF9L 1SROA 4LNQA 3CMEA 4NXMQ 3S2HH 3I56A 5IYCH 3RN5A 4JI5L 4JBKA 2VW9A 2HQLA 2UXDL 1EQQA 4DR2Q 2E2IH 1XPOA 4DV0Q 4A3MH 3M3YH 1U0LA 1K9MC 3J80c 1Q8KA 1IXRA 1SE8A 1TXYA 5ELOA 1JT8A 3AYHB 1W3SA 4J15A 3CXCA 2VNUD 4IOCA 2WB1E 3CQZH 4B3SL 3UDXA 4KLKA 2JA6G 3GTJH 3HOXH 3CCVA 3S1RH 2UU9Q 4DR2L 1VQMA 3F8TA 3CC2A 1YVCA 5FLXc 3CCLA 4GOPA 3CC4A 3TS0A 1E22A 4BBRH 2K14A 2Q2TA 2ASBA 4DR6Q 2ZTEA 4P72A 3RNUA 1KQSA 3W1GA 5BR8L 4LF4Q 4A93H 4BY7G 4GKJL 1KL9A 1VQKA 3L0OA 1YNXA 1N36Q 1L0WA 3CMAA 2ES2A 2OTLA 1FGUA 2MO0A 1QZHA 3ULLA 2UU9L 2KHJA 3GTQH 1X3FA 3S1MH 4FDBA 4IFDG 5C4XG 1YI2A 4LF8L 4NB3A 4WJ3M 4IPCA 1FVIA 2K75A 3KYHC 3OYYA 4C3HH 4GNXB 3KFUA 1X65A 3DLLA 4A3FG 2R7ZG 1TWCH 4DR6L 2WAQG 1HNZL 4A3GH 5E7NA 5H1SE 5JEAG 1HR0Q 2F4VQ 5C44G 3I7FA 3F1ZA 1I6HH 1MJCA 4JI4Q 4R4TA 3GO5A 3H3VI 1BVSA 2IX1A 4HJ5A 1B7YB 1I50H 3K8AA 4OONA 3CCRA 1D7QA 1FL0A 2ZJQA 1S3OA 2R7DA 3D31A 2UXBL 4YWKA 3FHWA 1EYGA 4JG2A 1PVOA 1EUJA 4UP8A 5EAYA 4DV2Q 2CKZB 3UE1A 4DV6L 3PV0A 3JAMc 2F4VL 3S15H 3CCJA 1L1OA 4OXPA 3TQYA 3J7A5 3ERSX 1S40A 1XNQQ 2H5XA 4DPGA 1NMFA
chains in the Genus database with same CATH superfamily
4O1NA 1AE3A 3D4WA 2NYZD 3BVMA 1YHQA 4GNXA 2KEEA 2L1BA 1IW7D 3U58A 3R93A 4IFDJ 3P20A 1NR2A 4JCVE 1D2BA 5AFWA 2VZAA 5JVG3 1HFGA 1VQ7A 1FYCA 1HNXL 2XGTA 2ZM6L 2EXDA 2PYKA 1BKBA 3BVZA 1MIUA 1PXUA 4KD4A 1IYVA 5I6YA 4JYAQ 3K58A 3F2BA 4IOAA 1A62A 4GLVB 4DV4Q 5JOBA 1JJ2A 3R2TA 1LT6D 1QG7A 4JBJA 3TSSA 3KJOA 3HOYB 3DXJC 4K2KA 4IPHA 3HOUB 1C8CA 5M5WH 4JI3Q 2F0VA 1CFMA 1U4LA 3CPWA 4DV5Q 3K5LA 4UP7A 1GVPA 3DM3A 1PH8A 1STNA 2KHIA 5E4WC 1SYGA 4DR1L 4GN3B 1WD0A 1VS0A 1HJPA 3A8KE 1PYBA 3GTKH 1WTPA 2Z6KC 2E74C 4BY1H 1VQ9A 3K57A 3LNNA 5LL6S 2D62A 4IUTA 4MTKA 5ELCA 1I4RA 1QVCA 2JA7H 3OIQA 3EQLC 4DV1Q 4O2DA 5M5XH 1PH2A 3HOZG 5CV6A 1RTNA 4A3MB 5FLXL 1W2BA 2K6AA 3JC66 1NTGA 1Q82C 1F77A 4POFA 4OO1I 3SK8A 1PDQA 2QGQA 3Q24A 1YJNA 4OL7A 3K5MA 1D6EC 2JSOA 3CQZB 1K3BC 2PNHA 1EY5A 3EJIA 1TU2B 1PFNA 1Q7YC 5IT9E 2Z8LA 2WACA 4BBRB 4XQJA 3L2PA 4PMBA 1F2YA 3Q6SA 5CV9A 3K7AB 4B9WA 1GM5A 1T9HA 1SYEA 4R1JA 3HKZB 1JOQA 2WP8J 2JA5H 1PYWD 1UNSA 4OGQC 2Z6BA 3S17H 1VQHA 5IYBH 3AFQA 5C5MA 5C3XA 1LTID 2AQ3B 1KLGD 1EIYB 4YHHQ 2K5VA 2Q8RE 2VB3X 4KHVA 3T4AC 1TWCB 1R4QB 4X66Q 3JAML 1XTDA 2PMZE 5LMUL 4JI2Q 4KKSA 4LF4L 5IP7G 1LTRD 4AQYQ 3FKIH 5M3MG 2CW0C 2EVBA 2HT1A 3E6ZX 1TS3A 2BOSA 5AJ3L 1CI3M 1G51A 1F9RA 2XRQD 2JQOA 3R2IA 1LT3D 3U4VA 1EY8A 4C3JH 1HA6A 3AFPA 2RDHA 1BBWA 1X56A 4K2LA 2JA8B 1LO5D 3CCQA 4GOPC 4R4QA 4I65A 3U9OA 1UUPA 2A8VA 4A3LH 1HR0W 4J6HA 5FO9B 1U4PA 3S2DB 5KNBA 1ASZA 1TVXA 2I0QA 2QCPX 2FHTA 2K5QA 3AQQA 1NBWA 4ILWA 1VMCA 2F0IA 4RGNA 4C2MH 4A3BH 2ZTDA 3NEMA 4C1NI 3W3AA 2VL6A 1LV9A 5JJLA 1HTPA 5IWAL 5IP9H 2UUCL 3HOWH 1HFNA 1STAA 4BBSB 1PRTF 1TKWB 2BDOA 4LW1A 3KDFA 1EWHA 3BZKA 1Z7TA 5A2QE 3TN2A 3S24A 2ZJRA 3I4NH 1X3GA 4DNIA 5K36H 2RHQB 1EFID 4OWWB 3MAQA 3A74A 4Y52H 1MSGA 3M7NA 2HCCA 2NVTB 4XYOA 3GTLH 1K8OA 4PZ7A 2LMCB 1WCMH 2YV5A 3T1HL 2B2UA 2QDBA 4M8AA 1KAAA 5KNDA 3NXWA 1FJGL 5JJIA 1OXUA 1PH1A 2ZXOA 3I90A 4DXFA 3HOYH 2KQ3A 2EIFA 2KVMA 3HOUH 2UUAQ 1DOMA 2DGYA 5KNCA 5JVH3 3HOVG 3JAMi 1QZGA 1SN8A 4KJOA 3S1NB 2UUBL 2N8NA 3S2HB 4ZQ3A 2WB1G 3MXGA 4A93G 3M3YB 1Q86C 3H0GG 1SRUA 1SYCA 4U673 5E3FA 4R4IA 4GKKQ 3M4OB 4RMFA 1IYJB 2O2LD 1XTCD 1EL0A 2UXCL 3C1EA 4RGOS 3W2DA 1HUNA 1NR4A 2RHSB 3FP9A 3NK9A 4A3KH 1N33L 2SNSA 1SJED 2B2VA 3DWQA 3IL8A 1ET6A 4ZKBB 2M2LA 1PRTC 1PMRA 2XNAC 3M9BA 4IUNA 1J6QA 1ESFA 2PW5A 1E1TA 4KN4C 1FGBD 3VYSA 5KYIA 1JE5A 5IYDH 4K5WA 4A3GB 2EYMA 3RUZA 3KBXA 1EZ6A 1HXYD 1D1IA 1U4MA 3RLNA 3MZ5A 4C56C 2BH2A 4ZUIA 3K7AH 1HNZQ 4LFCL 2R93B 1CZGA 5EBCA 5M5YH 2IHEA 3BJUA 3V96A 2LXJA 5NUCA 1X3EA 4A4IA 2HDLA 4B3TQ 1YHAA 1I4PA 2UXBQ 2B3GA 2JA6H 2HCIA 4A3IG 4RA8A 3KOJA 3T1YL 1VF7A 3KK7A 4DR5L 2R7FA 3PF4A 2HUGA 3NTKA 3MFGA 4KMUC 1XMOQ 5C0XG 1CA6A 5C3WA 2DN8A 4JBMA 4K8IA 2B39A 3MA2B 2R61A 1ENAA 1Q12A 1IL2A 2JA8H 4CBVA 3KF8B 4CJ2C 1DOKA 1V1QA 1YJWA 3E9IA 1I94Q 2IL8A 4KHPL 5JEAH 4ZUJA 5I9PA 2EY2A 2NZ1D 1LTTD 1SAPA 4X65Q 1WOCA 1Y1VG 2K52A 2O4XA 5LMNL 4B3MQ 2YU9H 1PTOF 1C0AA 1VQDA 5I2XA 3OTOL 4CJ0B 3N52A 3URYA 2F0SA 1GKHA 3M7GA 3LGJA 4ZAIA 1KNEA 2GN5A 4R4OA 1F9PA 2VUMB 4KN7C 1VQAA 4NXNL 1S5CD 1TWFH 1L0YB 5EJWA 4CDEC 4BXXG 4A3DB 4LF5Q 1YNND 3GTPB 1E3PA 1S5DD 2HIVA 1ASYA 1W6KA 2K33A 1PYSB 1L2FA 2F0FA 3NWSA 4DK6C 3OMCA 1WD1A 1VQJA 2KBNA 4ZKCB 3K81C 3VR4A 5DEHA 4G57A 1N34L 2NVTH 4KY7A 1JR0D 1EZ8A 2QDLA 4X64L 1PH9A 2KHSA 2Z0SA 1OTCA 1PH4A 4QF4A 3A54A 3SK5A 3UDGA 5IIFA 5M3FG 2BE5D 5IT9c 3MEFA 3G6JB 5FLMH 1N32L 1VQ5A 1E2ZA 4V0BA 1EWCA 3R8BA 1VCIA 5C6AA 4LWCA 1EU3A 1X32A 4DR3L 3GTOB 3S2HH 3RN5A 1O7YA 4CJ1B 4JBKA 2K01A 2RDFA 4N9TA 1QILA 4DR2Q 3PIO3 2E2IH 3M3YH 3J80c 1IXRA 2KECA 2Z4IA 3A7LA 4J15A 3IAYA 3MFYA 1LT4D 1PTOC 1PTOD 3T56B 4ME5A 1STEA 3CCLA 1IHZA 4DR6Q 2LS01 2ZTEA 3W1GA 5BR8L 1G6ZA 4MN3A 3H91A 3L0OA 5BN4A 2A5HA 4IFDG 2KHJA 3S1MH 1HPCA 1H9SB 1YI2A 4LF8L 3N6RA 5EKLA 3VA5A 1FVIA 3I3CA 3OYYA 3BZDB 3KFUA 2EPBA 2R7ZG 4L63B 2OT2A 4A3GH 2L4NA 3SXHA 5C44G 3I7FA 2B2VC 1BVSA 4QCLA 2IX1A 5IGFA 4HJ5A 4BY7B 3CCRA 1QWYA 3D31A 5BN3A 3NPPA 3FHWA 1EYGA 1JOOA 4JK1C 2XIWA 3TQYA 1GHJA 5DNFA 3GTMB 1NMFA 1ESRA 4NDXA 2OEOA 4JI6Q 4LF7Q 5LHY1 2HIXA 1H9SA 5JPNC 4HN7A 2MPMA 3NBHB 1ML0D 3NQTA 3CW2C 4GN5A 3CD6A 2FMMA 4L5RC 4H02A 2Z6KA 1F2ZA 1XNQL 1STGA 3K80C 4HEDA 1NY4A 2SDFA 5COYA 5LMNW 1JORA 5JEAJ 4JI7L 3QWNA 4LUOA 1PHJA 3AEVA 1HNWL 1K8GA 4MHEA 1QNUA 3VR5A 1DXMA 3SK4A 1AZQA 1IZ6A 4FF2A 1KAWA 2L5TA 1XPRA 3FMCA 1Q3LA 4JYAL 2ZXRA 2B63G 3DM1A 1EFWA 1AN8A 5EPJA 5IYCG 2PQAA 1HQMC 3HEJA 2VUMH 4JI3L 1SYBA 3ZYYX 2YYZA 2M00A 4EX5A 4HIDA 2L9HA 1SDFA 1ICFB 4YWMA 3BDOA 1GUNA 4LFBQ 1TQOA 3BZCA 3X3MA 4GOPB 3NTHA 4KKTA 4DR7L 3EA6A 1WTVA 2PZTA 2I5MX 2DY8A 4B3RQ 2I5LX 3HOXG 1VQGA 3DEPA 1JJGA 2ICIA 4JI0Q 1RCVD 5IGEA 3RLOA 1K73C 1EEFD 5E1FA 3Q8DA 5CV5A 3CF5A 2TSSA 1U5KA 3NSWA 4CDFC 2YTVA 3F2DA 3CC7A 2F0MA 4QJFA 4NKLA 2PZUA 3GTJB 2EE1A 4KKUA 5G3LD 1IBMQ 1XMQQ 4A3JB 4RGMA 3E9HA 2F0TA 1BXTA 3O13A 3HOZB 4DV0L 3IRBA 3IFTA 1L1OB 3I91A 2EJGC 2C35B 1K28A 3C46A 2MO1A 1L0XB 1SE2A 2CWPA 2JJQA 2NN6H 3I4MH 1JICA 1Y8OB 3PO3H 1UEBA 4LUZA 2PQEA 3CCEA 1AH9A 5DAUA 4NMZA 2CHBD 5J22A 2GVBA 3MWYW 4RHSA 1D5MC 1PFSA 2CH4A 1FNVA 5L37A 2LSSA 1I6VC 2YTYA 1A8VA 5CORA 1NMGA 2ICEC 4HMIA 2YTXA 4YHHL 1GD7A 2R92H 1JB7A 2J0TD 1JWUD 3LWUA 4K8JA 4JI2L 3VYRA 5C4XB 4XTCS 4Z9CB 1HR0L 4LK1C 2E2DC 4JI4L 1QCBD 3I4OA 1NAPA 5FO8B 2PI2E 4M1UB 3WOFA 4RKBA 5BN5A 2F0OA 4DGZA 5M3MB 2K32A 4DV2L 1IW7C 4J1MA 3GV3A 5TSSA 1KIXA 3SEBA 2KCNA 2AUKA 1B70B 5DM63 1XXGA 4OEMB 5EGTA 2WAQE 4CKBA 2F0PA 1RJTA 4NW2A 2B8GA 1SNOA 4X3UA 2KENA 3B6YA 2EYOA 3M85A 4RCOA 1SE3A 4L5QA 2VQEQ 2KCMA 3GTMH 2LY7A 1PRTB 4YY3Q 4FF3A 3JAME 1SNMA 4BY1G 1WI5A 1BCPF 2Q2IA 1SXTA 2BA0A 1PZJD 4JBWA 2L0CA 1ENCA 1NSNS 2JA7G 4DF7A 1B1ZA 1STHA 3K5OA 1Y1WB 2I5HA 4GS3A 2PI2A 3VYTA 5EBDA 3NE5B 1UE7A 2B2WA 3VDYA 2AWNA 2CVRA 4MIUA 3G6EA 3EIVA 1XNRQ 3SDZA 1IBLQ 1R9TH 1LABA 3GD7A 3P75A 2OWOA 3FPUB 2WFWA 1EOVA 4QY7A 1M4VA 2B8FA 2G5DA 4XT1B 5IE8A 5T1GA 5C3EH 2B2YA 1EY9A 2UUAL 1TS4A 1GHKA 4H7BA 5IYBG 4JOIC 2E75C 2D9UA 4CHTB 4DFAA 2MJ8A 4OHJA 3P7JA 3HOVB 2FINB 2XWBB 1SSOA 5C4ZA 3S1RB 1O7ZA 1PH7A 2AWOA 4GN4B 1I4GA 2N3SA 3NELA 2TMPA 3FKIG 3W5OA 2HD3A 2WB1B 2Z9HA 4XYQA 3QJYA 1M90C 4LF6Q 4OX9L 4A93B 4GKKL 3WDNA 2CFMA 2XTIA 3VYUA 4DUZQ 3H0GB 3RZOH 5C0XI 4C3JG 1GOZA 4GLXA 2QW7A 2A69D 3GTQB 4GKJQ 3H15A 4IN3A 1BCPC 1K83B 2JK8A 4C3HB 1TWGH 5LL6X 3A0JA 2Q8IB 1BCPD 1FNWA 3J80E 3HKZE 1B50A 4A3JH 1D8LA 4DR4Q 1OXTA 3KBGA 3L7ZC 1H9JA 5IGDA 4IJLA 1WTHA 2PMZB 4N8FA 4I7AA 3ZJYC 3I2ZA 1YIJA 2F0QA 1ZEQX 1YHBA 4A3BG 1X6OA 3KDFB 1DOLA 3ULPA 2R3ZA 2XVSA 5ELDA 4K0KQ 5ELNA 4DN4M 4EQ5A 3D6WA 4DV6Q 2ZTCA 4HSVA 1K0RA 5IP9G 4E6IA 3HOWG 3S1QB 2X69A 1E2VA 3TZUA 2JYOA 4DNRB 4IUVA 2L11A 3I4NG 4B3TL 1QJOA 3S16B 3TZDA 1K3RA 4C3IG 3PIP3 5K36G 1J5EQ 5CGKA 3NUCA 2ZT9C 3U50C 3RD4A 3E0JA 4A75A 5C4XH 3OW2A 3IKJA 5CBEE 4A3FH 1WCMG 4A3IB 2RSNA 1NE3A 2A74C 1XMOL 1HNXQ 4GLAC 5IP7H 1G91A 2MGSA 2JE6I 3HOYG 4CKCA 1S72A 3PUVA 4AYBB 1PTOB 1VQ8A 2KCTA 4IALA 4KK7A 3PUWA 1PH6A 4OWTB 1K8AC 1MJEA 1VDZA 1I94L 4IZ8A 1IBKL 5ISRA 1U9RA 2V1CC 4TQUS 4WJ3M 4LUVA 4P71A 4X6AH 4ZK9B 1G2TA 2Y0SB 4UAIA 4DR1Q 4HIOA 3BU2A 1K0SA 1Y1VB 2K5NA 2JA9A 3EN2A 3ND9A 4HJ7A 4EQOA 2JP1A 4HIKA 2NVXB 3K6OA 3D0FA 4ZYSA 1PA6A 3PIPA 1Y1WH 4QQBX 2E8GA 3MXPA 2XRSD 4A3KG 1BO0A 4LF9Q 2D0OA 3H3VH 1TWAB 2RCFA 4LFAL 4C1NK 2K7VA 5HURA 1YZ6A 1UWVA 3D4RA 2RQXA 4IFDI 4A3EB 3K7UC 3STBD 2M9VA 4K14A 4N9PA 5IYDG 1KNAA 4JV5L 2B2WC 1MD2D 3MXUA 4LNQA 1IKLA 2EYPA 1B2TA 5EQ0A 3I56A 3FRPB 2NVQB 3VR2A 1CHQD 1EQQA 1HQRD 4A3MH 1EY7A 3A8IE 4B08A 1Q8KA 1SE8A 1FD7D 1JT8A 4H44C 1W3SA 4OELB 4CGYB 3CQZH 1U4RA 3FVQA 3OWEB 4B3SL 4KLKA 2JA6G 2B2YC 3S1RH 2VB2X 2PPBC 1FNUA 1V1PA 2EY6A 4F87A 4DR2L 1VQMA 1RTOA 1YVCA 5FLXc 2KJXA 2ASBA 1H95A 1E22A 4BBRH 3RNUA 4P72A 1AFPA 1WVLA 4JPBW 4LF4Q 4A93H 1KL9A 2DY7A 2ES2A 2OTLA 1FGUA 3ULLA 3GTQH 5KIXA 2HQEA 2K75A 4C3HH 4DR6L 1Q8IA 1TWCH 2J7ZA 2F3WA 1D5ZC 2H1EA 4FO2A 5D65A 1F2MA 5JEAG 4HTHA 2F4VQ 3J81L 2IJ0A 3K8AA 3J7AV 2B2TA 5M9OA 1FL0A 4YWKA 4ZCKA 2XSCA 3GTGB 2FMCA 1EUJA 4UP8A 3JAMc 1TY0A 2WINB 2KOLA 3J7A5 5JPMC 3ERSX 3VR6A 3U4ZA 1VQPA 2F0JA 5FJ8H 4MNOA 1JWSD 3TRZA 1DM0B 4FP5D 3I4LA 4DV7L 3S2DH 5IWAQ 1STYA 4OO1H 2N55A 1JQYD 1VF5C 4ZLTF 1ZYRC 5FO7B 3KLSX 5IODA 1XWEA 2E5LL 1ZYRD 4JI6L 4LF7L 2HHHQ 3W1BA 1G2SA 1Y14B 5K5PA 2SOBA 5I6WA 3ICEA 2F0WA 5GADC 1YNNC 4IPGA 4BBSH 4A3CH 2R6GA 5FLMG 4Y7NB 5HY6A 1MSHA 2IPKD 2NZOA 1HRJA 2FJ2A 2F3IA 4S3SA 4DUYL 2OF1A 3ULJA 4UDUC 4BA1I 2E2JB 5JAVA 3T13A 3NBIA 2IWHA 3TREA 1RODA 2G9HD 4PV1C 4HIMA 4GZYC 2B29A 2BE5C 5GROA 3TP5A 3QO2A 1HUMA 4XDXA 3DWPA 1EYDA 1H9KA 1EIGA 4IUPA 2CQOA 2RBMA 1M8AA 3UDIA 2B63B 5HGQA 1TT2A 3S1NH 1E2WA 2ENBA 3D6CA 3J81i 1SR3A 1CQFA 1YEZA 4ULLA 5IGBA 3ND8A 4DV3L 2UXCQ 4LFBL 4UHVA 3NHHA 4RAUC 3DUZA 1EY0A 4B3RL 1TWAH 4QIWB 2O5JC 1O78A 1N33Q 3VR3A 1WTWA 3M4OH 4JI0L 4NXML 4A3EH 4RKLA 3SK6A 1Z6HA 2I07B 2PCFB 1PLFA 3QG1A 1QB5D 1LM0A 3F2CA 2MNAA 2SNMA 4LJZC 4IUUA 2OTJA 1F9SA 1G8ZD 4RG1A 1CKNA 1CM9A 4WORA 1VQBA 3ERQA 2VXWA 1D5XC 1IBML 4IO9A 1TWHB 2EQSA 3U9SA 1RDPD 3PO2G 2F4IA 2IX0A 3CRKC 1KXLA 1EIFA 3D4DA 3CAMA 2L55A 3CRLC 1CZWA 4KTAA 1N36L 1DJRD 4HMJA 1AZPA 4BS9A 2A19A 1SYDA 2R93H 4ME3A 1WJJA 1HTLD 4QGUA 1HZBA 4TSSA 2F03A 3PIOA 1Q90A 4OWXB 1C9OA 3CHBD 1LLRD 2RF4A 2RKSA 1TIID 4R9WA 1F2LA 4WRDA 4XT3B 5EKIA 1KD1C 4HAEA 1Y8NB 2EYJA 1WTOA 1E24A 4HCEA 1EY4A 1WYDA 2K4KA 2PQAB 5G3LF 1I3QB 4KHPQ 4FXDA 1XJVA 1QUQA 1QE6A 2GVAA 3OMGA 3QIAA 4PG3A 3OPOA 5J1ZA 2B2TC 1TY2A 2XWJB 2NTTA 4IURA 1F9QA 5C5LA 5M5WB 1Q81C 1BCPB 4YIJA 3KF6A 1MKHA 3UDFA 2AUJD 1SNCA 2I46A 3MHBA 3RN2A 3QR8A 4JOIA 3HGBA 1S4ZA 1UAPA 1PFBA 2L15A 3C1FA 3OW7A 4DV4L 1OXXK 2H4OA 3GTKB 3J7ZC 2KCCA 2VY3A 1YJ9A 1LTBD 4BY1B 1N34Q 3I70A 1LYLA 4XQNA 4DV5L 4A3DH 3GTPH 2K1BA 1BF4A 3QOJA 1KC8C 2EZVA 2BH8A 1II3A 1SMYD 3MXNA 1R4PB 2JA7B 1ILQA 4YCUA 5I2YA 4POGA 4G7HC 5M5XB 1Q1EA 3VA7A 2V4DA 1AEXA 5JJZA 4RGTA 1Z47A 1VQ4A 4DR3Q 1LT5D 5KRUA 1I5FA 3I4MG 5E4XA 2CCZA 2PZWA 1HZCA 3PO3G 4DAYA 4PQXA 2K50A 2Q2UA 4DV1L 4JI8Q 3CCSA 1B9NA 1P16A 2IT1A 2B63H 4K5XA 2PNRC 4PZ6A 1ICWA 3GTOH 4R8IA 3CP0A 2VQFQ 1UE5A 4U68A 4NPSA 4FNFA 4L6TB 3T16A 1V43A 5JJKA 3S17B 2R92G 2K03A 2Z1CA 2NTSA 1QVGA 2MUYA 5HGTA 1N9WA 4X62Q 2EY1A 5BR8Q 1G291 4K5VA 4ZRZA 1KABA 4BA2I 3FDTA 4PNYA 2RSOA 4LF6L 1D1KA 4DUZL 1VQEA 1Z9FA 3FKIB 1I6HB 4LF8Q 1B3QA 3MC0B 1EEID 4DAMA 5IOCA 4YCWA 4EGVA 3LWEA 3KLSA 1I50B 4C3JB 3GV6A 5KYLA 1CHPD 3BYYB 4O0AA 3TS2A 2OQ0A 3I73A 4X66L 5FLXE 2EXZA 1ZXTA 3S15B 1TWHH 4DR4L 4AQYL 4H0LC 2A1AA 1HCZA 3ONAB 1XPUA 3GDEA 2OQKA 1UE1A 3MTSA 1HZ9A 4XIGS 3E3XA 3J81j 5I4DA 4BY7H 5CC4A 3Q23A 3ER0A 4K0KL 3PSIA 4A3BB 4LMQD 1STBA 2HDMA 1EQRA 1DGSA 2MHVA 4UPAA 4H13C 3S9WA 1NJIC 5FKAC 1CKMA 1VQNA 1J5EL 3DWAA 4F7XA 1GXDC 4JI7Q 3I72A 4KY6A 3CCUA 2C5CA 3I4NB 3P1HA 1HNWQ 4IUQA 4C3IB 3GP7A 4N8X1 1I3QH 2DJGC 3NENA 4I7ZC 2AQ2B 3BYTB 1GJXA 4IJHA 2NB0A 4JI1Q 3X3NA 4MZ9A 4APVA 1N8RC 3GTLB 1C4QA 2NZHA 3RR5A 5DM73 1WCMB 5C3EG 3KLWA 2MFIA 1OO9B 1WTQA 2IHFA 3AB9A 2A68C 1RIPA 3M4YA 1Y69U 1XYIA 4P2CB 2A68D 1SMXA 3SGIA 1PH3A 1VQFA 4YWLA 4ABNA 2EOTA 1SNPA 4CDCC 3G71A 3MVVA 4WJWA 1OXSC 4DR7Q 1GUOA 4DXGA 4FXKC 1ENFA 4IPDA 4QMGA 4PMWA 1B9MA 4HSPA 3FPPA 3HS0C 2EJFC 3RLFA 2JA5G 3BDCA 4JI5Q 2UXDQ 2WIIB 2F0GA 2K5DA 2CWAA 2NVYB 3Q22A 4HR7B 1X54A 1T5XD 3G48A 4A3JG 4LF9L 1SROA 4J8QA 1TS2A 1J8IA 3TP6A 4FXGC 2D5DA 2HQLA 4A3KB 1XPOA 4DV0Q 1U0LA 3H09A 1K9MC 2A69C 3IFDA 4KY5A 1DZ1A 1TXYA 5ELOA 1A2UA 3AYHB 2ZXPA 3D3RA 3CXCA 3WOEA 1JWMD 2WB1E 3HP3A 4IQZA 3UDXA 4PMCA 3GTJH 2UU9Q 2QKIC 2QF7A 1BDOA 3CC2A 3T53B 3HOZH 1CQVA 4A3LG 2EYLA 2K14A 2A73B 1KQSA 3NP8A 4K6LA 4DA2A 3HRZC 5M5YB 1YNXA 4RCNA 1H9MA 1QZHA 1H9RA 4OIJA 1X3FA 5C4XG 3L3OC 4NB3A 2E2HB 2JA6B 3KYHC 4A3FG 5EKKA 2WAQG 1HNZL 5E7NA 5H1SE 1HR0Q 3F1ZA 1I6HH 1MJCA 4JI4Q 3GO5A 1B7YB 2MP1A 2CW0D 1I50H 3V05A 1IL8A 2EY5A 2ZJQA 2F0LA 2R7DA 4CKEA 2UXBL 1D7QA 2A6EC 4JG2A 2SEBD 2EYFA 1PVOA 4DV2Q 2CKZB 2A6ED 3UE1A 2F4VL 3S15H 3CCJA 4OXPA 1Y8PB 1MBYA 3OWFA 4DPGA 3HZXA 1ONLA 3I55A 2ZM6Q 3C3LA 5C4JB 1HHVA 2OXPA 2EYHA 3HFZB 4ODGA 5M3MH 4MTNA 4AH6A 2YU9B 1B3AA 3HOUG 2QA4A 4BWGB 2CQAA 1EYCA 3CPFA 3TP8A 1Y1WG 1EIHA 1O7LA 3BDLA 4QB4A 4RWSC 1PZKD 1JB3A 1TWFB 4AYBE 2CH4W 4X65L 3BS1A 4B3ML 3I8ZA 3QOLA 1RL2A 3K0YA 2WV6D 1JCKB 3J7YW 4KHZA 1PZID 1A15A 4PZ8A 1A2TA 2F52A 4R4CA 2NUCA 2F0UA 3J81E 1L1OC 4B9XA 1I4HA 4C3IH 2LKVA 2HHHL 5IT9L 2Y0SE 3NWTA 1DYQA 1SBBB 2JEAI 2O5IC 3BVGA 4EQPA 1A0IA 2DUDA 5J39A 4LF5L 4QUFA 1SFOB 4GNXC 1WFQA 1PH5A 4A3MG 1HZAA 4ID6A 3L9AX 4JVZA 1V1PB 4R8NA 2IW3A 2Q2HA 4AIMA 1JJCB 1NUCA 5IGGA 3NQIA 3STBC 4QL5A 3J80L 4F88A 2OCEA 3BG3A 1KRTA 1JC7A 3HKSA 4DNTB 1C48A 3E0EA 1P8LA 4BBRG 2FXQA 3NTIA 2E2IB 5EPLA 3GQBA 2BCOA 4XXEA 1I4XA 1WTXA 5M3FB 3HKZG 4HJAA 1KRSA 2K5WA 2AMCB 4OX9Q 3EROA 1S5BD 2ATWA 1GO3E 3A5ZB 1A3TA 1CSQA 2NVYH 3CCMA 4HCSA 4C3HG 1VQOA 1BQQT 1X55A 3HOVH 4WFN3 2AHOB 2NBFA 3DHQA 3RZDB 1KTKA 5LMUQ 2DNCA 3TMEA 1J9OA 2LXKA 1O7IA 1UE6A 3H0GH 5J3BA 3S1MB 1AE2A 1PRTD 5AJ3Q 5GAGC 3K5NA 2JA8G 1K83H 1W6JA 4G4KA 1LTLA 3KUPA 4P75A 1DONA 5A2QL 3CU7A 1NCVA 1Q1BA 5D3DA 5FJ8G 3FEWX 5GAHC 4X3KA 1A3VA 5IGCA 1EYAA 3KJPA 4OO1G 4DK1A 1ILPA 3DMUA 3TDQA 1B8AA 3H3VC 3OOCA 2E76C 2F0KA 3PO2B 2PW7A 3S14B 3SE0A 1CK1A 1YBYA 1AW7A 3EFXD 1BBXC 2E2HH 2R7ZB 4K6DA 5C44B 3S1QH 4BBSG 1GUWA 4A3CG 3H94A 2RA4A 4AYBG 4DK0A 2UUCQ 3A8JE 3J80i 3S16H 1LUZA 1X3QA 4G7OC 2X6GA 1B53A 1QOHA 2QILA 4P73A 4JC0A 1E1OA 4TRDA 2Y0SG 3Q0AA 4A3IH 4FF4A 1IBKQ 5EPKA 1QNKA 3R3OA 3LX0A 1S5FD 5C4JH 2N78A 1CUKA 2NN6I 1A63A 4G7ZC 1SE4A 3T1HQ 4LAAA 5C0XH 2C9OA 1PTOH 2F1MA 1FJGQ 1OXVA 4X3SA 2L12A 1YNJC 4OIKA 1KHIA 1YNJD 1IYUA 3PUZA 3K0XA 1MI2A 1HA5A 2UUBQ 3OSOA 3PGZA 1LTAD 1PFMA 1CKOA 1BUVT 1CT1D 3KF8A 1Y1VH 5KGUA 1M1KC 4HJ8A 4A3EG 4LFAQ 1CKNB 1GUSA 4TVAB 2ALYB 2NVXH 4F8MA 1SNDA 5CMDA 1JMCA 2BA1A 4JV5Q 2VS1A 2DNEA 4NP5A 1SFOH 3PF5A 4JW0A 1AP0A 4BXXH 3ITPA 3A7AB 2NWGA 4EQNA 2QEXA 4P74A 3F2UA 4TKOB 3HOXB 2B2UC 3PCOB 1LACA 4A3GG 2WKDA 1JOKA 2ID0A 4QIWE 3A56A 3UE0A 4B3SQ 1EQVA 1DD2A 2NVQH 1CA5A 1PV4A 2N49A 1BR9A 1HH2P 1K8MA 3I4MB 1B44D 5CV7A 4JI8L 2R93G 1VMPA 3E5SA 3PO3B 5M3FH 1SLJA 1XMQL 1RD9D 4LFCQ 1SYFA 4RFBA 1RKNA 1LTGD 2MQHA 4UP9A 2VQFL 1X9NA 1GUGA 2DJFC 1EOTA 2RDGA 1QUQB 3AMUA 1EWIA 5C4HA 1Q46A 1BOSA 5FOBB 2K5HA 5IY0A 3RZDH 3DEOA 1EY6A 1XX8A 4X62L 1V9PA 1KDCA 4YCVA 2R92B 5CV4A 2KA7A 3T1YQ 2D0PA 1QVFA 4X3TA 5D14A 4DR5Q 4L5SA 1VQCA 4KV6A 3RMHA 4L5TA 1BBUA 3AU7A 1DCZA 2K04A 3KF6B 4WJ4A 2JN4A 2JXMB 1S5ED 3M4QA 4KD3A 2WKCA 4RH6A 5DLQE 2ZJPA 2JEBI 5F2DA 2EDGA 2Z4HA 5D3IB 4XQQA 3SVMA 5GQOA 1FR3A 2G9DA 3M4PA 4Q0FA 5CR3A 3G7LA 3PQIA 2J4XA 1KLUD 4HJ9A 5T1IA 1O80A 3CKIB 4DK3C 3GTGH 4IFDH 4DV7Q 4DAPA 1VQIA 5LMNQ 3PO2H 3S14H 3OTOQ 4DKAC 1WTRA 1A6XA 2R7ZH 1UEAB 3J81c 3G4SA 2VUMG 3T51B 3MXNB 2E5LQ 2BDNA 5C44H 4A3DG 3OIPA 4NXNQ 1CSPA 1T5EA 1TR5A 3A55A 3TP7A 4KI0A 5CYUA 2VQEL 3K59A 1C7YA 1YITA 4DAYB 4YY3L 1EQTA 4IOCA 2RCNA 1SJHD 3TBIB 3WWVA 3EBEA 4DUYQ 2N88A 1SNQA 4ALPA 1NNXA 3QB3A 5C0XJ 1A3UA 2P5ZX 4JI1L 4X64Q 2IX3A 1R9TB 2EJMA 4UY8C 1SMYC 2KUMA 2F0HA 1B4OA 1V1OA 2F3VA 1ZKOA 4Y7NH 4V190 5ELBA 2AKWB 4FF1A 3H6MA 1N32Q 3V2TA 1G6PA 5GAEC 3A5UA 2IY5B 5C3EB 3NBHA 2E2JH 1XNRL 1VQ6A 1X3PA 2F0EA 1IBLL 2AQ1B 2F0NA 2NN6G 1I4QA 2XN9C 2FFKB 4DV3Q 3TEHB 1E7ZA 4A76A 1VQLA 1CTMA 1ET9A 3OHXC 2K05A 3PUYA 3PUXA 4CDDC 2RVLA 5I9OA 3CMEA 2PO4A 2Q8TA 4NXMQ 1V8QA 2K28A 5KEEA 5IYCH 4JI5L 2VW9A 2UXDL 3RZOB 3D8GA 3UI2A 1JE4A 2JA5B 1TS5A 2QEJC 3J7AF 4FYDA 2A6HC 5ELFA 2VNUD 2A6HD 1TWGB 3MEHA 4FVMA 5A35A 2X6LA 3HOXH 3CCVA 4O42A 4L8JA 3F8TA 2F0DA 5FK9C 1RF2D 4GOPA 3PMFA 3TS0A 3CC4A 2Q2TA 4EVOA 4BY7G 1BNZA 4GKJL 1MGSA 1VQKA 1N36Q 1L0WA 1KDAA 3CMAA 1KDBA 2UU9L 2LFNA 2MO0A 5CBAE 4FDBA 1SEBD 3SR1A 1LTSD 3HG9A 4IPCA 4GNXB 1X65A 3DLLA 1MHWC 1RHPA 3KLRA 2D2CC 4Q5VA 4QUCA 5CV8A 4R4TA 3H3VI 2GA4B 2KEDA 3EVQA 4OONA 3C2PA 3SHLA 1S3OA 5ELEA 1IKMA 1GUTA 4C2MB 5EAYA 1E0BA 4DV6L 3PV0A 1L1OA 4RHRA 4KJNA 4DU9A 4A3FB 1EU4A 1S40A 2WAQB 2H5XA 1XNQQ 4DAVA 3HOWB
chains in the Genus database with same CATH topology
1VQPA 3I55A 2ZM6Q 1AE3A 5FJ8H 4MNOA 4JI6Q 4LF7Q 3HFZB 2HIXA 5M3MH 4MTNA 3TRZA 4AH6A 4DV7L 3HOUG 3S2DH 5IWAQ 3NBHB 2QA4A 4GNXA 1YHQA 3CW2C 4GN5A 3U58A 3CD6A 4L5RC 4IFDJ 4JCVE 4H02A 2Z6KA 2VZAA 1VQ7A 1XNQL 3K80C 1HNXL 2XGTA 1NY4A 2ZM6L 2EXDA 1BKBA 2E5LL 3CPFA 5LMNW 4JI6L 1Y1WG 4LF7L 2HHHQ 1MIUA 4AYBE 5JEAJ 3W1BA 4JI7L 1Y14B 4JYAQ 4LUOA 4X65L 1PHJA 3AEVA 1HNWL 1K8GA 3ICEA 4B3ML 3F2BA 4IOAA 1RL2A 1A62A 4GLVB 4DV4Q 5GADC 1JJ2A 4IPGA 4BBSH 3KJOA 4KHZA 4JBJA 4A3LG 4PZ8A 4IPHA 3HOZH 4A3CH 2F52A 2R6GA 5M5WH 4R4CA 5FLMG 4JI3Q 1IZ6A 1L1OC 1KAWA 4C3IH 1XPRA 2HHHL 2Y0SE 5HY6A 3CPWA 2NZOA 4DV5Q 4JYAL 2B63G 4UP7A 1GVPA 3DM3A 1PH8A 2JEAI 2F3IA 4DUYL 2KHIA 3ULJA 1EFWA 4BA1I 4DR1L 4GN3B 1A0IA 5IYCG 2DUDA 2PQAA 1VS0A 1HJPA 4LF5L 2VUMH 1PYBA 4JI3L 3GTKH 4EX5A 2YYZA 3TREA 4HIMA 4HIDA 4GNXC 1WFQA 1PH5A 4A3MG 4YWMA 1HZAA 2B29A 5GROA 2Z6KC 4BY1H 1VQ9A 2Q2HA 4AIMA 1JJCB 4LFBQ 4GOPB 3BZCA 2D62A 3STBC 4QL5A 4DR7L 2CQOA 2OCEA 2I5MX 1KRTA 4B3RQ 3UDIA 2I5LX 1QVCA 3HOXG 3HKSA 5HGQA 1VQGA 2JA7H 1JJGA 3S1NH 3E0EA 4DV1Q 4O2DA 5M5XH 1PH2A 4JI0Q 1P8LA 3J81i 4BBRG 3HOZG 1SR3A 2FXQA 1YEZA 4DV3L 2UXCQ 3RLOA 4LFBL 1K73C 1W2BA 3JC66 3Q8DA 1NTGA 1Q82C 4POFA 3HKZG 4B3RL 1TWAH 4HJAA 4OO1I 3CF5A 1KRSA 1U5KA 2AMCB 2QGQA 2YTVA 4OX9Q 3F2DA 1YJNA 1N33Q 3CC7A 2ATWA 1GO3E 4QJFA 3A5ZB 3M4OH 4JI0L 4NXML 1CSQA 2PNHA 2NVYH 3CCMA 4A3EH 1VQOA 1X55A 3HOVH 1IBMQ 1XMQQ 2AHOB 1Q7YC 3E9HA 4DV0L 1LM0A 3IRBA 3F2CA 3L2PA 2MNAA 1L1OB 2OTJA 5LMUQ 1GM5A 4RG1A 1T9HA 2C35B 1CKNA 2MO1A 2LXKA 4R1JA 1O7IA 2CWPA 1UE6A 2JJQA 3H0GH 5J3BA 1VQBA 2WP8J 2JA5H 3I4MH 3S17H 1VQHA 5IYBH 3AFQA 1IBML 3PO3H 1UEBA 2EQSA 1AE2A 4LUZA 4IO9A 5AJ3Q 5GAGC 3PO2G 1EIYB 4YHHQ 3CCEA 2JA8G 1AH9A 2K5VA 2IX0A 1K83H 4X66Q 2GVBA 1KXLA 1EIFA 1XTDA 2PMZE 1LTLA 1PFSA 3CAMA 4P75A 4JI2Q 2LSSA 5LMUL 4LF4L 1Q1BA 2YTYA 5IP7G 5FJ8G 1A8VA 4AQYQ 3FKIH 1N36L 1NMGA 5M3MG 5GAHC 2HT1A 5AJ3L 3KJPA 1G51A 2A19A 2YTXA 1GD7A 2JQOA 4ME3A 3U4VA 4YHHL 1WJJA 4OO1G 4C3JH 2R93H 1B8AA 2R92H 1JB7A 3AFPA 4JI2L 4QGUA 1BBWA 1X56A 4XTCS 1HZBA 1HR0L 3CCQA 1YBYA 3PIOA 4JI4L 3I4OA 4GOPC 4R4QA 4OWXB 2E2HH 1C9OA 2PI2E 2RF4A 3S1QH 2A8VA 4A3LH 4BBSG 1KD1C 1HR0W 4A3CG 4DV2L 1ASZA 1E24A 4AYBG 2I0QA 1WYDA 1KIXA 2K4KA 2PQAB 2UUCQ 3AQQA 3J80i 4KHPQ 1B70B 1NBWA 1XJVA 3S16H 1LUZA 2WAQE 1QUQA 4C2MH 2GVAA 4A3BH 2ZTDA 2KENA 3B6YA 3NEMA 3M85A 2VL6A 4L5QA 4PG3A 2VQEQ 5JJLA 4P73A 4JC0A 1E1OA 2KCMA 2Y0SG 4A3IH 5IWAL 5IP9H 1IBKQ 2UUCL 3GTMH 3HOWH 4YY3Q 4LW1A 4BY1G 3KDFA 1WI5A 5C4JH 2N78A 1CUKA 3BZKA 2NN6I 1A63A 1Q81C 3S24A 2ZJRA 3T1HQ 3I4NH 3KF6A 1MKHA 1X3GA 3UDFA 2Q2IA 4DNIA 2BA0A 1FJGQ 4JBWA 2RHQB 1OXVA 4OWWB 3A74A 3RN2A 4JOIA 2JA7G 4Y52H 2L15A 3M7NA 4DV4L 1KHIA 2I5HA 3GTLH 1OXXK 3PUZA 2PI2A 3K0XA 4GS3A 4PZ7A 1WCMH 2VY3A 2YV5A 3J7ZC 3T1HL 1YJ9A 1UE7A 3VDYA 2AWNA 2UUBQ 3PGZA 1FJGL 3G6EA 1N34Q 5JJIA 3EIVA 1OXUA 1LYLA 1CKOA 1PH1A 1XNRQ 3HOYH 4DV5L 4A3DH 2EIFA 3GTPH 1Y1VH 3HOUH 1IBLQ 1KC8C 1M1KC 1R9TH 2UUAQ 4HJ8A 2DGYA 4A3EG 3GD7A 2OWOA 2BH8A 4LFAQ 2WFWA 1CKNB 3HOVG 3JAMi 1QZGA 1EOVA 4TVAB 4QY7A 2ALYB 4YCUA 1SN8A 2NVXH 4POGA 2UUBL 2N8NA 1Q1EA 5IE8A 1JMCA 2BA1A 1Z47A 5C3EH 2WB1G 4JV5Q 2VS1A 1VQ4A 1SFOH 3PF5A 2UUAL 4A93G 4DR3Q 1Q86C 3H0GG 1I5FA 1SRUA 3I4MG 4BXXH 2CCZA 1HZCA 5IYBG 3PO3G 4JOIC 4R4IA 2K50A 4GKKQ 4RMFA 2Q2UA 1IYJB 2QEXA 4P74A 4DV1L 4JI8Q 3CCSA 2UXCL 1P16A 2IT1A 1PH7A 2B63H 3PCOB 2AWOA 4A3GG 2ID0A 2N3SA 3NELA 4GN4B 4PZ6A 4QIWE 3W5OA 3FKIG 3UE0A 3GTOH 4B3SQ 3CP0A 2VQFQ 4LF6Q 2RHSB 1UE5A 1M90C 3FP9A 4OX9L 4GKKL 4NPSA 2NVQH 2CFMA 2XTIA 4A3KH 2N49A 1HH2P 4DUZQ 1PV4A 1N33L 3RZOH 2R93G 4JI8L 1V43A 5C0XI 5JJKA 2R92G 4GLXA 1QVGA 5M3FH 1SLJA 1H95A 1N9WA 4X62Q 1XMQL 3M9BA 5BR8Q 1G291 4LFCQ 4GKJQ 3H15A 1J6QA 1E1TA 4BA2I 2JK8A 1TWGH 2MQHA 3A0JA 4UP9A 2VQFL 1X9NA 4LF6L 1JE5A 5IYDH 3HKZE 4DUZL 1QUQB 4A3JH 1VQEA 1D8LA 1EWIA 1OXTA 1Z9FA 4LF8Q 4DR4Q 4DAMA 3L7ZC 4YCWA 3RLNA 1Q46A 5IY0A 3RZDH 2K5HA 4X62L 2BH2A 3K7AH 4IJLA 4LFCL 1HNZQ 1V9PA 4YCVA 3ZJYC 5M5YH 3T1YQ 2D0PA 2IHEA 3I2ZA 4O0AA 3BJUA 1YIJA 1QVFA 3TS2A 4DR5Q 2LXJA 2OQ0A 4X66L 1VQCA 1YHBA 1X3EA 4A4IA 4L5SA 1X6OA 3KDFB 4A3BG 3ULPA 1TWHH 4L5TA 1YHAA 4B3TQ 4DR4L 1BBUA 2UXBQ 2B3GA 4AQYL 3KF6B 4K0KQ 5ELNA 4WJ4A 2JA6H 4EQ5A 4DV6Q 2ZTCA 2A1AA 3M4QA 1K0RA 5IP9G 4A3IG 3HOWG 5DLQE 3GDEA 2OQKA 1XPUA 1UE1A 3KOJA 2ZJPA 2JEBI 3T1YL 1HZ9A 4XIGS 4DR5L 2R7FA 5GQOA 3PF4A 3M4PA 3J81j 1XMOQ 5C0XG 3I4NG 4B3TL 4BY7H 1K3RA 3ER0A 4HJ9A 5K36G 4K0KL 1J5EQ 3PSIA 4JBMA 4DK3C 3GTGH 3U50C 4DV7Q 1Q12A 1VQIA 5LMNQ 1IL2A 4A75A 5C4XH 3OW2A 2JA8H 1EQRA 3PO2H 1DGSA 3OTOQ 4DKAC 3KF8B 3S14H 4UPAA 1NJIC 1V1QA 4A3FH 1WCMG 2R7ZH 3J81c 3G4SA 1NE3A 3E9IA 1YJWA 1XMOL 1I94Q 2VUMG 1HNXQ 3MXNB 4KHPL 4GLAC 5IP7H 2E5LQ 5C44H 1CKMA 1VQNA 1J5EL 4JI7Q 2JE6I 3HOYG 1S72A 4A3DG 3PUVA 3CCUA 4X65Q 1WOCA 1CSPA 1Y1VG 2K52A 5LMNL 1VQ8A 4B3MQ 2YU9H 4NXNQ 1HNWQ 1C0AA 1VQDA 2KCTA 3OTOL 4KI0A 1I3QH 3PUWA 1PH6A 3NENA 2VQEL 4OWTB 1K8AC 1MJEA 4IJHA 4JI1Q 1GKHA 1I94L 3LGJA 1C7YA 1IBKL 4MZ9A 4APVA 1YITA 1N8RC 2GN5A 4TQUS 2V1CC 4DAYB 2RCNA 4LUVA 4YY3L 4P71A 2NZHA 4R4OA 3RR5A 4X6AH 5C3EG 3KLWA 1VQAA 2MFIA 4NXNL 3WWVA 1TWFH 3EBEA 4DUYQ 2IHFA 4ALPA 4BXXG 4DR1Q 4HIOA 5C0XJ 3BU2A 4LF5Q 1RIPA 1E3PA 2HIVA 4JI1L 1ASYA 2K5NA 4X64Q 2JA9A 1SMXA 3EN2A 1PYSB 1L2FA 4HJ7A 4UY8C 4DK6C 3SGIA 1VQJA 4Y7NH 4HIKA 1PH3A 1VQFA 2KBNA 3D0FA 4YWLA 2AKWB 3K81C 3G71A 1OXSC 1N32Q 4DR7Q 1G6PA 5GAEC 1PA6A 3PIPA 3A5UA 1Y1WH 1N34L 2NVTH 2IY5B 4IPDA 2E2JH 1XNRL 4QQBX 4PMWA 1VQ6A 2E8GA 4X64L 1PH9A 4A3KG 1IBLL 2Z0SA 1OTCA 4LF9Q 2D0OA 1PH4A 3H3VH 2NN6G 3RLFA 3UDGA 4LFAL 5M3FG 2JA5G 4DV3Q 3TEHB 5IT9c 3U4ZA 4JI5Q 1E7ZA 1YZ6A 3MEFA 4A76A 1UWVA 5FLMH 1VQLA 1N32L 2UXDQ 4IFDI 1VQ5A 2CWAA 3PUYA 3K7UC 3STBD 3PUXA 1VCIA 4LWCA 5IYDG 4JV5L 1X54A 3G48A 4A3JG 4DR3L 4LF9L 1SROA 4LNQA 3CMEA 4NXMQ 3S2HH 3I56A 5IYCH 3RN5A 4JI5L 4JBKA 2VW9A 2HQLA 2UXDL 1EQQA 4DR2Q 2E2IH 1XPOA 4DV0Q 4A3MH 3M3YH 1U0LA 1K9MC 3J80c 1Q8KA 1IXRA 1SE8A 1TXYA 5ELOA 1JT8A 3AYHB 1W3SA 4J15A 3CXCA 2VNUD 4IOCA 2WB1E 3CQZH 4B3SL 3UDXA 4KLKA 2JA6G 3GTJH 3HOXH 3CCVA 3S1RH 2UU9Q 4DR2L 1VQMA 3F8TA 3CC2A 1YVCA 5FLXc 3CCLA 4GOPA 3CC4A 3TS0A 1E22A 4BBRH 2K14A 2Q2TA 2ASBA 4DR6Q 2ZTEA 4P72A 3RNUA 1KQSA 3W1GA 5BR8L 4LF4Q 4A93H 4BY7G 4GKJL 1KL9A 1VQKA 3L0OA 1YNXA 1N36Q 1L0WA 3CMAA 2ES2A 2OTLA 1FGUA 2MO0A 1QZHA 3ULLA 2UU9L 2KHJA 3GTQH 1X3FA 3S1MH 4FDBA 4IFDG 5C4XG 1YI2A 4LF8L 4NB3A 4WJ3M 4IPCA 1FVIA 2K75A 3KYHC 3OYYA 4C3HH 4GNXB 3KFUA 1X65A 3DLLA 4A3FG 2R7ZG 1TWCH 4DR6L 2WAQG 1HNZL 4A3GH 5E7NA 5H1SE 5JEAG 1HR0Q 2F4VQ 5C44G 3I7FA 3F1ZA 1I6HH 1MJCA 4JI4Q 4R4TA 3GO5A 3H3VI 1BVSA 2IX1A 4HJ5A 1B7YB 1I50H 3K8AA 4OONA 3CCRA 1D7QA 1FL0A 2ZJQA 1S3OA 2R7DA 3D31A 2UXBL 4YWKA 3FHWA 1EYGA 4JG2A 1PVOA 1EUJA 4UP8A 5EAYA 4DV2Q 2CKZB 3UE1A 4DV6L 3PV0A 3JAMc 2F4VL 3S15H 3CCJA 1L1OA 4OXPA 3TQYA 3J7A5 3ERSX 1S40A 1XNQQ 2H5XA 4DPGA 1NMFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQP A;  3I55 A;  2ZM6 Q;  1AE3 A;  5FJ8 H;  4MNO A;  4JI6 Q;  4LF7 Q;  3HFZ B;  2HIX A;  5M3M H;  4MTN A;  3TRZ A;  4AH6 A;  4DV7 L;  3HOU G;  3S2D H;  5IWA Q;  3NBH B;  2QA4 A;  4GNX A;  1YHQ A;  3CW2 C;  4GN5 A;  3U58 A;  3CD6 A;  4L5R C;  4IFD J;  4JCV E;  4H02 A;  2Z6K A;  2VZA A;  1VQ7 A;  1XNQ L;  3K80 C;  1HNX L;  2XGT A;  1NY4 A;  2ZM6 L;  2EXD A;  1BKB A;  2E5L L;  3CPF A;  5LMN W;  4JI6 L;  1Y1W G;  4LF7 L;  2HHH Q;  1MIU A;  4AYB E;  5JEA J;  3W1B A;  4JI7 L;  1Y14 B;  4JYA Q;  4LUO A;  4X65 L;  1PHJ A;  3AEV A;  1HNW L;  1K8G A;  3ICE A;  4B3M L;  3F2B A;  4IOA A;  1RL2 A;  1A62 A;  4GLV B;  4DV4 Q;  5GAD C;  1JJ2 A;  4IPG A;  4BBS H;  3KJO A;  4KHZ A;  4JBJ A;  4A3L G;  4PZ8 A;  4IPH A;  3HOZ H;  4A3C H;  2F52 A;  2R6G A;  5M5W H;  4R4C A;  5FLM G;  4JI3 Q;  1IZ6 A;  1L1O C;  1KAW A;  4C3I H;  1XPR A;  2HHH L;  2Y0S E;  5HY6 A;  3CPW A;  2NZO A;  4DV5 Q;  4JYA L;  2B63 G;  4UP7 A;  1GVP A;  3DM3 A;  1PH8 A;  2JEA I;  2F3I A;  4DUY L;  2KHI A;  3ULJ A;  1EFW A;  4BA1 I;  4DR1 L;  4GN3 B;  1A0I A;  5IYC G;  2DUD A;  2PQA A;  1VS0 A;  1HJP A;  4LF5 L;  2VUM H;  1PYB A;  4JI3 L;  3GTK H;  4EX5 A;  2YYZ A;  3TRE A;  4HIM A;  4HID A;  4GNX C;  1WFQ A;  1PH5 A;  4A3M G;  4YWM A;  1HZA A;  2B29 A;  5GRO A;  2Z6K C;  4BY1 H;  1VQ9 A;  2Q2H A;  4AIM A;  1JJC B;  4LFB Q;  4GOP B;  3BZC A;  2D62 A;  3STB C;  4QL5 A;  4DR7 L;  2CQO A;  2OCE A;  2I5M X;  1KRT A;  4B3R Q;  3UDI A;  2I5L X;  1QVC A;  3HOX G;  3HKS A;  5HGQ A;  1VQG A;  2JA7 H;  1JJG A;  3S1N H;  3E0E A;  4DV1 Q;  4O2D A;  5M5X H;  1PH2 A;  4JI0 Q;  1P8L A;  3J81 i;  4BBR G;  3HOZ G;  1SR3 A;  2FXQ A;  1YEZ A;  4DV3 L;  2UXC Q;  3RLO A;  4LFB L;  1K73 C;  1W2B A;  3JC6 6;  3Q8D A;  1NTG A;  1Q82 C;  4POF A;  3HKZ G;  4B3R L;  1TWA H;  4HJA A;  4OO1 I;  3CF5 A;  1KRS A;  1U5K A;  2AMC B;  2QGQ A;  2YTV A;  4OX9 Q;  3F2D A;  1YJN A;  1N33 Q;  3CC7 A;  2ATW A;  1GO3 E;  4QJF A;  3A5Z B;  3M4O H;  4JI0 L;  4NXM L;  1CSQ A;  2PNH A;  2NVY H;  3CCM A;  4A3E H;  1VQO A;  1X55 A;  3HOV H;  1IBM Q;  1XMQ Q;  2AHO B;  1Q7Y C;  3E9H A;  4DV0 L;  1LM0 A;  3IRB A;  3F2C A;  3L2P A;  2MNA A;  1L1O B;  2OTJ A;  5LMU Q;  1GM5 A;  4RG1 A;  1T9H A;  2C35 B;  1CKN A;  2MO1 A;  2LXK A;  4R1J A;  1O7I A;  2CWP A;  1UE6 A;  2JJQ A;  3H0G H;  5J3B A;  1VQB A;  2WP8 J;  2JA5 H;  3I4M H;  3S17 H;  1VQH A;  5IYB H;  3AFQ A;  1IBM L;  3PO3 H;  1UEB A;  2EQS A;  1AE2 A;  4LUZ A;  4IO9 A;  5AJ3 Q;  5GAG C;  3PO2 G;  1EIY B;  4YHH Q;  3CCE A;  2JA8 G;  1AH9 A;  2K5V A;  2IX0 A;  1K83 H;  4X66 Q;  2GVB A;  1KXL A;  1EIF A;  1XTD A;  2PMZ E;  1LTL A;  1PFS A;  3CAM A;  4P75 A;  4JI2 Q;  2LSS A;  5LMU L;  4LF4 L;  1Q1B A;  2YTY A;  5IP7 G;  5FJ8 G;  1A8V A;  4AQY Q;  3FKI H;  1N36 L;  1NMG A;  5M3M G;  5GAH C;  2HT1 A;  5AJ3 L;  3KJP A;  1G51 A;  2A19 A;  2YTX A;  1GD7 A;  2JQO A;  4ME3 A;  3U4V A;  4YHH L;  1WJJ A;  4OO1 G;  4C3J H;  2R93 H;  1B8A A;  2R92 H;  1JB7 A;  3AFP A;  4JI2 L;  4QGU A;  1BBW A;  1X56 A;  4XTC S;  1HZB A;  1HR0 L;  3CCQ A;  1YBY A;  3PIO A;  4JI4 L;  3I4O A;  4GOP C;  4R4Q A;  4OWX B;  2E2H H;  1C9O A;  2PI2 E;  2RF4 A;  3S1Q H;  2A8V A;  4A3L H;  4BBS G;  1KD1 C;  1HR0 W;  4A3C G;  4DV2 L;  1ASZ A;  1E24 A;  4AYB G;  2I0Q A;  1WYD A;  1KIX A;  2K4K A;  2PQA B;  2UUC Q;  3AQQ A;  3J80 i;  4KHP Q;  1B70 B;  1NBW A;  1XJV A;  3S16 H;  1LUZ A;  2WAQ E;  1QUQ A;  4C2M H;  2GVA A;  4A3B H;  2ZTD A;  2KEN A;  3B6Y A;  3NEM A;  3M85 A;  2VL6 A;  4L5Q A;  4PG3 A;  2VQE Q;  5JJL A;  4P73 A;  4JC0 A;  1E1O A;  2KCM A;  2Y0S G;  4A3I H;  5IWA L;  5IP9 H;  1IBK Q;  2UUC L;  3GTM H;  3HOW H;  4YY3 Q;  4LW1 A;  4BY1 G;  3KDF A;  1WI5 A;  5C4J H;  2N78 A;  1CUK A;  3BZK A;  2NN6 I;  1A63 A;  1Q81 C;  3S24 A;  2ZJR A;  3T1H Q;  3I4N H;  3KF6 A;  1MKH A;  1X3G A;  3UDF A;  2Q2I A;  4DNI A;  2BA0 A;  1FJG Q;  4JBW A;  2RHQ B;  1OXV A;  4OWW B;  3A74 A;  3RN2 A;  4JOI A;  2JA7 G;  4Y52 H;  2L15 A;  3M7N A;  4DV4 L;  1KHI A;  2I5H A;  3GTL H;  1OXX K;  3PUZ A;  2PI2 A;  3K0X A;  4GS3 A;  4PZ7 A;  1WCM H;  2VY3 A;  2YV5 A;  3J7Z C;  3T1H L;  1YJ9 A;  1UE7 A;  3VDY A;  2AWN A;  2UUB Q;  3PGZ A;  1FJG L;  3G6E A;  1N34 Q;  5JJI A;  3EIV A;  1OXU A;  1LYL A;  1CKO A;  1PH1 A;  1XNR Q;  3HOY H;  4DV5 L;  4A3D H;  2EIF A;  3GTP H;  1Y1V H;  3HOU H;  1IBL Q;  1KC8 C;  1M1K C;  1R9T H;  2UUA Q;  4HJ8 A;  2DGY A;  4A3E G;  3GD7 A;  2OWO A;  2BH8 A;  4LFA Q;  2WFW A;  1CKN B;  3HOV G;  3JAM i;  1QZG A;  1EOV A;  4TVA B;  4QY7 A;  2ALY B;  4YCU A;  1SN8 A;  2NVX H;  4POG A;  2UUB L;  2N8N A;  1Q1E A;  5IE8 A;  1JMC A;  2BA1 A;  1Z47 A;  5C3E H;  2WB1 G;  4JV5 Q;  2VS1 A;  1VQ4 A;  1SFO H;  3PF5 A;  2UUA L;  4A93 G;  4DR3 Q;  1Q86 C;  3H0G G;  1I5F A;  1SRU A;  3I4M G;  4BXX H;  2CCZ A;  1HZC A;  5IYB G;  3PO3 G;  4JOI C;  4R4I A;  2K50 A;  4GKK Q;  4RMF A;  2Q2U A;  1IYJ B;  2QEX A;  4P74 A;  4DV1 L;  4JI8 Q;  3CCS A;  2UXC L;  1P16 A;  2IT1 A;  1PH7 A;  2B63 H;  3PCO B;  2AWO A;  4A3G G;  2ID0 A;  2N3S A;  3NEL A;  4GN4 B;  4PZ6 A;  4QIW E;  3W5O A;  3FKI G;  3UE0 A;  3GTO H;  4B3S Q;  3CP0 A;  2VQF Q;  4LF6 Q;  2RHS B;  1UE5 A;  1M90 C;  3FP9 A;  4OX9 L;  4GKK L;  4NPS A;  2NVQ H;  2CFM A;  2XTI A;  4A3K H;  2N49 A;  1HH2 P;  4DUZ Q;  1PV4 A;  1N33 L;  3RZO H;  2R93 G;  4JI8 L;  1V43 A;  5C0X I;  5JJK A;  2R92 G;  4GLX A;  1QVG A;  5M3F H;  1SLJ A;  1H95 A;  1N9W A;  4X62 Q;  1XMQ L;  3M9B A;  5BR8 Q;  1G29 1;  4LFC Q;  4GKJ Q;  3H15 A;  1J6Q A;  1E1T A;  4BA2 I;  2JK8 A;  1TWG H;  2MQH A;  3A0J A;  4UP9 A;  2VQF L;  1X9N A;  4LF6 L;  1JE5 A;  5IYD H;  3HKZ E;  4DUZ L;  1QUQ B;  4A3J H;  1VQE A;  1D8L A;  1EWI A;  1OXT A;  1Z9F A;  4LF8 Q;  4DR4 Q;  4DAM A;  3L7Z C;  4YCW A;  3RLN A;  1Q46 A;  5IY0 A;  3RZD H;  2K5H A;  4X62 L;  2BH2 A;  3K7A H;  4IJL A;  4LFC L;  1HNZ Q;  1V9P A;  4YCV A;  3ZJY C;  5M5Y H;  3T1Y Q;  2D0P A;  2IHE A;  3I2Z A;  4O0A A;  3BJU A;  1YIJ A;  1QVF A;  3TS2 A;  4DR5 Q;  2LXJ A;  2OQ0 A;  4X66 L;  1VQC A;  1YHB A;  1X3E A;  4A4I A;  4L5S A;  1X6O A;  3KDF B;  4A3B G;  3ULP A;  1TWH H;  4L5T A;  1YHA A;  4B3T Q;  4DR4 L;  1BBU A;  2UXB Q;  2B3G A;  4AQY L;  3KF6 B;  4K0K Q;  5ELN A;  4WJ4 A;  2JA6 H;  4EQ5 A;  4DV6 Q;  2ZTC A;  2A1A A;  3M4Q A;  1K0R A;  5IP9 G;  4A3I G;  3HOW G;  5DLQ E;  3GDE A;  2OQK A;  1XPU A;  1UE1 A;  3KOJ A;  2ZJP A;  2JEB I;  3T1Y L;  1HZ9 A;  4XIG S;  4DR5 L;  2R7F A;  5GQO A;  3PF4 A;  3M4P A;  3J81 j;  1XMO Q;  5C0X G;  3I4N G;  4B3T L;  4BY7 H;  1K3R A;  3ER0 A;  4HJ9 A;  5K36 G;  4K0K L;  1J5E Q;  3PSI A;  4JBM A;  4DK3 C;  3GTG H;  3U50 C;  4DV7 Q;  1Q12 A;  1VQI A;  5LMN Q;  1IL2 A;  4A75 A;  5C4X H;  3OW2 A;  2JA8 H;  1EQR A;  3PO2 H;  1DGS A;  3OTO Q;  4DKA C;  3KF8 B;  3S14 H;  4UPA A;  1NJI C;  1V1Q A;  4A3F H;  1WCM G;  2R7Z H;  3J81 c;  3G4S A;  1NE3 A;  3E9I A;  1YJW A;  1XMO L;  1I94 Q;  2VUM G;  1HNX Q;  3MXN B;  4KHP L;  4GLA C;  5IP7 H;  2E5L Q;  5C44 H;  1CKM A;  1VQN A;  1J5E L;  4JI7 Q;  2JE6 I;  3HOY G;  1S72 A;  4A3D G;  3PUV A;  3CCU A;  4X65 Q;  1WOC A;  1CSP A;  1Y1V G;  2K52 A;  5LMN L;  1VQ8 A;  4B3M Q;  2YU9 H;  4NXN Q;  1HNW Q;  1C0A A;  1VQD A;  2KCT A;  3OTO L;  4KI0 A;  1I3Q H;  3PUW A;  1PH6 A;  3NEN A;  2VQE L;  4OWT B;  1K8A C;  1MJE A;  4IJH A;  4JI1 Q;  1GKH A;  1I94 L;  3LGJ A;  1C7Y A;  1IBK L;  4MZ9 A;  4APV A;  1YIT A;  1N8R C;  2GN5 A;  4TQU S;  2V1C C;  4DAY B;  2RCN A;  4LUV A;  4YY3 L;  4P71 A;  2NZH A;  4R4O A;  3RR5 A;  4X6A H;  5C3E G;  3KLW A;  1VQA A;  2MFI A;  4NXN L;  3WWV A;  1TWF H;  3EBE A;  4DUY Q;  2IHF A;  4ALP A;  4BXX G;  4DR1 Q;  4HIO A;  5C0X J;  3BU2 A;  4LF5 Q;  1RIP A;  1E3P A;  2HIV A;  4JI1 L;  1ASY A;  2K5N A;  4X64 Q;  2JA9 A;  1SMX A;  3EN2 A;  1PYS B;  1L2F A;  4HJ7 A;  4UY8 C;  4DK6 C;  3SGI A;  1VQJ A;  4Y7N H;  4HIK A;  1PH3 A;  1VQF A;  2KBN A;  3D0F A;  4YWL A;  2AKW B;  3K81 C;  3G71 A;  1OXS C;  1N32 Q;  4DR7 Q;  1G6P A;  5GAE C;  1PA6 A;  3PIP A;  3A5U A;  1Y1W H;  1N34 L;  2NVT H;  2IY5 B;  4IPD A;  2E2J H;  1XNR L;  4QQB X;  4PMW A;  1VQ6 A;  2E8G A;  4X64 L;  1PH9 A;  4A3K G;  1IBL L;  2Z0S A;  1OTC A;  4LF9 Q;  2D0O A;  1PH4 A;  3H3V H;  2NN6 G;  3RLF A;  3UDG A;  4LFA L;  5M3F G;  2JA5 G;  4DV3 Q;  3TEH B;  5IT9 c;  3U4Z A;  4JI5 Q;  1E7Z A;  1YZ6 A;  3MEF A;  4A76 A;  1UWV A;  5FLM H;  1VQL A;  1N32 L;  2UXD Q;  4IFD I;  1VQ5 A;  2CWA A;  3PUY A;  3K7U C;  3STB D;  3PUX A;  1VCI A;  4LWC A;  5IYD G;  4JV5 L;  1X54 A;  3G48 A;  4A3J G;  4DR3 L;  4LF9 L;  1SRO A;  4LNQ A;  3CME A;  4NXM Q;  3S2H H;  3I56 A;  5IYC H;  3RN5 A;  4JI5 L;  4JBK A;  2VW9 A;  2HQL A;  2UXD L;  1EQQ A;  4DR2 Q;  2E2I H;  1XPO A;  4DV0 Q;  4A3M H;  3M3Y H;  1U0L A;  1K9M C;  3J80 c;  1Q8K A;  1IXR A;  1SE8 A;  1TXY A;  5ELO A;  1JT8 A;  3AYH B;  1W3S A;  4J15 A;  3CXC A;  2VNU D;  4IOC A;  2WB1 E;  3CQZ H;  4B3S L;  3UDX A;  4KLK A;  2JA6 G;  3GTJ H;  3HOX H;  3CCV A;  3S1R H;  2UU9 Q;  4DR2 L;  1VQM A;  3F8T A;  3CC2 A;  1YVC A;  5FLX c;  3CCL A;  4GOP A;  3CC4 A;  3TS0 A;  1E22 A;  4BBR H;  2K14 A;  2Q2T A;  2ASB A;  4DR6 Q;  2ZTE A;  4P72 A;  3RNU A;  1KQS A;  3W1G A;  5BR8 L;  4LF4 Q;  4A93 H;  4BY7 G;  4GKJ L;  1KL9 A;  1VQK A;  3L0O A;  1YNX A;  1N36 Q;  1L0W A;  3CMA A;  2ES2 A;  2OTL A;  1FGU A;  2MO0 A;  1QZH A;  3ULL A;  2UU9 L;  2KHJ A;  3GTQ H;  1X3F A;  3S1M H;  4FDB A;  4IFD G;  5C4X G;  1YI2 A;  4LF8 L;  4NB3 A;  4WJ3 M;  4IPC A;  1FVI A;  2K75 A;  3KYH C;  3OYY A;  4C3H H;  4GNX B;  3KFU A;  1X65 A;  3DLL A;  4A3F G;  2R7Z G;  1TWC H;  4DR6 L;  2WAQ G;  1HNZ L;  4A3G H;  5E7N A;  5H1S E;  5JEA G;  1HR0 Q;  2F4V Q;  5C44 G;  3I7F A;  3F1Z A;  1I6H H;  1MJC A;  4JI4 Q;  4R4T A;  3GO5 A;  3H3V I;  1BVS A;  2IX1 A;  4HJ5 A;  1B7Y B;  1I50 H;  3K8A A;  4OON A;  3CCR A;  1D7Q A;  1FL0 A;  2ZJQ A;  1S3O A;  2R7D A;  3D31 A;  2UXB L;  4YWK A;  3FHW A;  1EYG A;  4JG2 A;  1PVO A;  1EUJ A;  4UP8 A;  5EAY A;  4DV2 Q;  2CKZ B;  3UE1 A;  4DV6 L;  3PV0 A;  3JAM c;  2F4V L;  3S15 H;  3CCJ A;  1L1O A;  4OXP A;  3TQY A;  3J7A 5;  3ERS X;  1S40 A;  1XNQ Q;  2H5X A;  4DPG A;  1NMF A; 
#chains in the Genus database with same CATH topology
 4O1N A;  1AE3 A;  3D4W A;  2NYZ D;  3BVM A;  1YHQ A;  4GNX A;  2KEE A;  2L1B A;  1IW7 D;  3U58 A;  3R93 A;  4IFD J;  3P20 A;  1NR2 A;  4JCV E;  1D2B A;  5AFW A;  2VZA A;  5JVG 3;  1HFG A;  1VQ7 A;  1FYC A;  1HNX L;  2XGT A;  2ZM6 L;  2EXD A;  2PYK A;  1BKB A;  3BVZ A;  1MIU A;  1PXU A;  4KD4 A;  1IYV A;  5I6Y A;  4JYA Q;  3K58 A;  3F2B A;  4IOA A;  1A62 A;  4GLV B;  4DV4 Q;  5JOB A;  1JJ2 A;  3R2T A;  1LT6 D;  1QG7 A;  4JBJ A;  3TSS A;  3KJO A;  3HOY B;  3DXJ C;  4K2K A;  4IPH A;  3HOU B;  1C8C A;  5M5W H;  4JI3 Q;  2F0V A;  1CFM A;  1U4L A;  3CPW A;  4DV5 Q;  3K5L A;  4UP7 A;  1GVP A;  3DM3 A;  1PH8 A;  1STN A;  2KHI A;  5E4W C;  1SYG A;  4DR1 L;  4GN3 B;  1WD0 A;  1VS0 A;  1HJP A;  3A8K E;  1PYB A;  3GTK H;  1WTP A;  2Z6K C;  2E74 C;  4BY1 H;  1VQ9 A;  3K57 A;  3LNN A;  5LL6 S;  2D62 A;  4IUT A;  4MTK A;  5ELC A;  1I4R A;  1QVC A;  2JA7 H;  3OIQ A;  3EQL C;  4DV1 Q;  4O2D A;  5M5X H;  1PH2 A;  3HOZ G;  5CV6 A;  1RTN A;  4A3M B;  5FLX L;  1W2B A;  2K6A A;  3JC6 6;  1NTG A;  1Q82 C;  1F77 A;  4POF A;  4OO1 I;  3SK8 A;  1PDQ A;  2QGQ A;  3Q24 A;  1YJN A;  4OL7 A;  3K5M A;  1D6E C;  2JSO A;  3CQZ B;  1K3B C;  2PNH A;  1EY5 A;  3EJI A;  1TU2 B;  1PFN A;  1Q7Y C;  5IT9 E;  2Z8L A;  2WAC A;  4BBR B;  4XQJ A;  3L2P A;  4PMB A;  1F2Y A;  3Q6S A;  5CV9 A;  3K7A B;  4B9W A;  1GM5 A;  1T9H A;  1SYE A;  4R1J A;  3HKZ B;  1JOQ A;  2WP8 J;  2JA5 H;  1PYW D;  1UNS A;  4OGQ C;  2Z6B A;  3S17 H;  1VQH A;  5IYB H;  3AFQ A;  5C5M A;  5C3X A;  1LTI D;  2AQ3 B;  1KLG D;  1EIY B;  4YHH Q;  2K5V A;  2Q8R E;  2VB3 X;  4KHV A;  3T4A C;  1TWC B;  1R4Q B;  4X66 Q;  3JAM L;  1XTD A;  2PMZ E;  5LMU L;  4JI2 Q;  4KKS A;  4LF4 L;  5IP7 G;  1LTR D;  4AQY Q;  3FKI H;  5M3M G;  2CW0 C;  2EVB A;  2HT1 A;  3E6Z X;  1TS3 A;  2BOS A;  5AJ3 L;  1CI3 M;  1G51 A;  1F9R A;  2XRQ D;  2JQO A;  3R2I A;  1LT3 D;  3U4V A;  1EY8 A;  4C3J H;  1HA6 A;  3AFP A;  2RDH A;  1BBW A;  1X56 A;  4K2L A;  2JA8 B;  1LO5 D;  3CCQ A;  4GOP C;  4R4Q A;  4I65 A;  3U9O A;  1UUP A;  2A8V A;  4A3L H;  1HR0 W;  4J6H A;  5FO9 B;  1U4P A;  3S2D B;  5KNB A;  1ASZ A;  1TVX A;  2I0Q A;  2QCP X;  2FHT A;  2K5Q A;  3AQQ A;  1NBW A;  4ILW A;  1VMC A;  2F0I A;  4RGN A;  4C2M H;  4A3B H;  2ZTD A;  3NEM A;  4C1N I;  3W3A A;  2VL6 A;  1LV9 A;  5JJL A;  1HTP A;  5IWA L;  5IP9 H;  2UUC L;  3HOW H;  1HFN A;  1STA A;  4BBS B;  1PRT F;  1TKW B;  2BDO A;  4LW1 A;  3KDF A;  1EWH A;  3BZK A;  1Z7T A;  5A2Q E;  3TN2 A;  3S24 A;  2ZJR A;  3I4N H;  1X3G A;  4DNI A;  5K36 H;  2RHQ B;  1EFI D;  4OWW B;  3MAQ A;  3A74 A;  4Y52 H;  1MSG A;  3M7N A;  2HCC A;  2NVT B;  4XYO A;  3GTL H;  1K8O A;  4PZ7 A;  2LMC B;  1WCM H;  2YV5 A;  3T1H L;  2B2U A;  2QDB A;  4M8A A;  1KAA A;  5KND A;  3NXW A;  1FJG L;  5JJI A;  1OXU A;  1PH1 A;  2ZXO A;  3I90 A;  4DXF A;  3HOY H;  2KQ3 A;  2EIF A;  2KVM A;  3HOU H;  2UUA Q;  1DOM A;  2DGY A;  5KNC A;  5JVH 3;  3HOV G;  3JAM i;  1QZG A;  1SN8 A;  4KJO A;  3S1N B;  2UUB L;  2N8N A;  3S2H B;  4ZQ3 A;  2WB1 G;  3MXG A;  4A93 G;  3M3Y B;  1Q86 C;  3H0G G;  1SRU A;  1SYC A;  4U67 3;  5E3F A;  4R4I A;  4GKK Q;  3M4O B;  4RMF A;  1IYJ B;  2O2L D;  1XTC D;  1EL0 A;  2UXC L;  3C1E A;  4RGO S;  3W2D A;  1HUN A;  1NR4 A;  2RHS B;  3FP9 A;  3NK9 A;  4A3K H;  1N33 L;  2SNS A;  1SJE D;  2B2V A;  3DWQ A;  3IL8 A;  1ET6 A;  4ZKB B;  2M2L A;  1PRT C;  1PMR A;  2XNA C;  3M9B A;  4IUN A;  1J6Q A;  1ESF A;  2PW5 A;  1E1T A;  4KN4 C;  1FGB D;  3VYS A;  5KYI A;  1JE5 A;  5IYD H;  4K5W A;  4A3G B;  2EYM A;  3RUZ A;  3KBX A;  1EZ6 A;  1HXY D;  1D1I A;  1U4M A;  3RLN A;  3MZ5 A;  4C56 C;  2BH2 A;  4ZUI A;  3K7A H;  1HNZ Q;  4LFC L;  2R93 B;  1CZG A;  5EBC A;  5M5Y H;  2IHE A;  3BJU A;  3V96 A;  2LXJ A;  5NUC A;  1X3E A;  4A4I A;  2HDL A;  4B3T Q;  1YHA A;  1I4P A;  2UXB Q;  2B3G A;  2JA6 H;  2HCI A;  4A3I G;  4RA8 A;  3KOJ A;  3T1Y L;  1VF7 A;  3KK7 A;  4DR5 L;  2R7F A;  3PF4 A;  2HUG A;  3NTK A;  3MFG A;  4KMU C;  1XMO Q;  5C0X G;  1CA6 A;  5C3W A;  2DN8 A;  4JBM A;  4K8I A;  2B39 A;  3MA2 B;  2R61 A;  1ENA A;  1Q12 A;  1IL2 A;  2JA8 H;  4CBV A;  3KF8 B;  4CJ2 C;  1DOK A;  1V1Q A;  1YJW A;  3E9I A;  1I94 Q;  2IL8 A;  4KHP L;  5JEA H;  4ZUJ A;  5I9P A;  2EY2 A;  2NZ1 D;  1LTT D;  1SAP A;  4X65 Q;  1WOC A;  1Y1V G;  2K52 A;  2O4X A;  5LMN L;  4B3M Q;  2YU9 H;  1PTO F;  1C0A A;  1VQD A;  5I2X A;  3OTO L;  4CJ0 B;  3N52 A;  3URY A;  2F0S A;  1GKH A;  3M7G A;  3LGJ A;  4ZAI A;  1KNE A;  2GN5 A;  4R4O A;  1F9P A;  2VUM B;  4KN7 C;  1VQA A;  4NXN L;  1S5C D;  1TWF H;  1L0Y B;  5EJW A;  4CDE C;  4BXX G;  4A3D B;  4LF5 Q;  1YNN D;  3GTP B;  1E3P A;  1S5D D;  2HIV A;  1ASY A;  1W6K A;  2K33 A;  1PYS B;  1L2F A;  2F0F A;  3NWS A;  4DK6 C;  3OMC A;  1WD1 A;  1VQJ A;  2KBN A;  4ZKC B;  3K81 C;  3VR4 A;  5DEH A;  4G57 A;  1N34 L;  2NVT H;  4KY7 A;  1JR0 D;  1EZ8 A;  2QDL A;  4X64 L;  1PH9 A;  2KHS A;  2Z0S A;  1OTC A;  1PH4 A;  4QF4 A;  3A54 A;  3SK5 A;  3UDG A;  5IIF A;  5M3F G;  2BE5 D;  5IT9 c;  3MEF A;  3G6J B;  5FLM H;  1N32 L;  1VQ5 A;  1E2Z A;  4V0B A;  1EWC A;  3R8B A;  1VCI A;  5C6A A;  4LWC A;  1EU3 A;  1X32 A;  4DR3 L;  3GTO B;  3S2H H;  3RN5 A;  1O7Y A;  4CJ1 B;  4JBK A;  2K01 A;  2RDF A;  4N9T A;  1QIL A;  4DR2 Q;  3PIO 3;  2E2I H;  3M3Y H;  3J80 c;  1IXR A;  2KEC A;  2Z4I A;  3A7L A;  4J15 A;  3IAY A;  3MFY A;  1LT4 D;  1PTO C;  1PTO D;  3T56 B;  4ME5 A;  1STE A;  3CCL A;  1IHZ A;  4DR6 Q;  2LS0 1;  2ZTE A;  3W1G A;  5BR8 L;  1G6Z A;  4MN3 A;  3H91 A;  3L0O A;  5BN4 A;  2A5H A;  4IFD G;  2KHJ A;  3S1M H;  1HPC A;  1H9S B;  1YI2 A;  4LF8 L;  3N6R A;  5EKL A;  3VA5 A;  1FVI A;  3I3C A;  3OYY A;  3BZD B;  3KFU A;  2EPB A;  2R7Z G;  4L63 B;  2OT2 A;  4A3G H;  2L4N A;  3SXH A;  5C44 G;  3I7F A;  2B2V C;  1BVS A;  4QCL A;  2IX1 A;  5IGF A;  4HJ5 A;  4BY7 B;  3CCR A;  1QWY A;  3D31 A;  5BN3 A;  3NPP A;  3FHW A;  1EYG A;  1JOO A;  4JK1 C;  2XIW A;  3TQY A;  1GHJ A;  5DNF A;  3GTM B;  1NMF A;  1ESR A;  4NDX A;  2OEO A;  4JI6 Q;  4LF7 Q;  5LHY 1;  2HIX A;  1H9S A;  5JPN C;  4HN7 A;  2MPM A;  3NBH B;  1ML0 D;  3NQT A;  3CW2 C;  4GN5 A;  3CD6 A;  2FMM A;  4L5R C;  4H02 A;  2Z6K A;  1F2Z A;  1XNQ L;  1STG A;  3K80 C;  4HED A;  1NY4 A;  2SDF A;  5COY A;  5LMN W;  1JOR A;  5JEA J;  4JI7 L;  3QWN A;  4LUO A;  1PHJ A;  3AEV A;  1HNW L;  1K8G A;  4MHE A;  1QNU A;  3VR5 A;  1DXM A;  3SK4 A;  1AZQ A;  1IZ6 A;  4FF2 A;  1KAW A;  2L5T A;  1XPR A;  3FMC A;  1Q3L A;  4JYA L;  2ZXR A;  2B63 G;  3DM1 A;  1EFW A;  1AN8 A;  5EPJ A;  5IYC G;  2PQA A;  1HQM C;  3HEJ A;  2VUM H;  4JI3 L;  1SYB A;  3ZYY X;  2YYZ A;  2M00 A;  4EX5 A;  4HID A;  2L9H A;  1SDF A;  1ICF B;  4YWM A;  3BDO A;  1GUN A;  4LFB Q;  1TQO A;  3BZC A;  3X3M A;  4GOP B;  3NTH A;  4KKT A;  4DR7 L;  3EA6 A;  1WTV A;  2PZT A;  2I5M X;  2DY8 A;  4B3R Q;  2I5L X;  3HOX G;  1VQG A;  3DEP A;  1JJG A;  2ICI A;  4JI0 Q;  1RCV D;  5IGE A;  3RLO A;  1K73 C;  1EEF D;  5E1F A;  3Q8D A;  5CV5 A;  3CF5 A;  2TSS A;  1U5K A;  3NSW A;  4CDF C;  2YTV A;  3F2D A;  3CC7 A;  2F0M A;  4QJF A;  4NKL A;  2PZU A;  3GTJ B;  2EE1 A;  4KKU A;  5G3L D;  1IBM Q;  1XMQ Q;  4A3J B;  4RGM A;  3E9H A;  2F0T A;  1BXT A;  3O13 A;  3HOZ B;  4DV0 L;  3IRB A;  3IFT A;  1L1O B;  3I91 A;  2EJG C;  2C35 B;  1K28 A;  3C46 A;  2MO1 A;  1L0X B;  1SE2 A;  2CWP A;  2JJQ A;  2NN6 H;  3I4M H;  1JIC A;  1Y8O B;  3PO3 H;  1UEB A;  4LUZ A;  2PQE A;  3CCE A;  1AH9 A;  5DAU A;  4NMZ A;  2CHB D;  5J22 A;  2GVB A;  3MWY W;  4RHS A;  1D5M C;  1PFS A;  2CH4 A;  1FNV A;  5L37 A;  2LSS A;  1I6V C;  2YTY A;  1A8V A;  5COR A;  1NMG A;  2ICE C;  4HMI A;  2YTX A;  4YHH L;  1GD7 A;  2R92 H;  1JB7 A;  2J0T D;  1JWU D;  3LWU A;  4K8J A;  4JI2 L;  3VYR A;  5C4X B;  4XTC S;  4Z9C B;  1HR0 L;  4LK1 C;  2E2D C;  4JI4 L;  1QCB D;  3I4O A;  1NAP A;  5FO8 B;  2PI2 E;  4M1U B;  3WOF A;  4RKB A;  5BN5 A;  2F0O A;  4DGZ A;  5M3M B;  2K32 A;  4DV2 L;  1IW7 C;  4J1M A;  3GV3 A;  5TSS A;  1KIX A;  3SEB A;  2KCN A;  2AUK A;  1B70 B;  5DM6 3;  1XXG A;  4OEM B;  5EGT A;  2WAQ E;  4CKB A;  2F0P A;  1RJT A;  4NW2 A;  2B8G A;  1SNO A;  4X3U A;  2KEN A;  3B6Y A;  2EYO A;  3M85 A;  4RCO A;  1SE3 A;  4L5Q A;  2VQE Q;  2KCM A;  3GTM H;  2LY7 A;  1PRT B;  4YY3 Q;  4FF3 A;  3JAM E;  1SNM A;  4BY1 G;  1WI5 A;  1BCP F;  2Q2I A;  1SXT A;  2BA0 A;  1PZJ D;  4JBW A;  2L0C A;  1ENC A;  1NSN S;  2JA7 G;  4DF7 A;  1B1Z A;  1STH A;  3K5O A;  1Y1W B;  2I5H A;  4GS3 A;  2PI2 A;  3VYT A;  5EBD A;  3NE5 B;  1UE7 A;  2B2W A;  3VDY A;  2AWN A;  2CVR A;  4MIU A;  3G6E A;  3EIV A;  1XNR Q;  3SDZ A;  1IBL Q;  1R9T H;  1LAB A;  3GD7 A;  3P75 A;  2OWO A;  3FPU B;  2WFW A;  1EOV A;  4QY7 A;  1M4V A;  2B8F A;  2G5D A;  4XT1 B;  5IE8 A;  5T1G A;  5C3E H;  2B2Y A;  1EY9 A;  2UUA L;  1TS4 A;  1GHK A;  4H7B A;  5IYB G;  4JOI C;  2E75 C;  2D9U A;  4CHT B;  4DFA A;  2MJ8 A;  4OHJ A;  3P7J A;  3HOV B;  2FIN B;  2XWB B;  1SSO A;  5C4Z A;  3S1R B;  1O7Z A;  1PH7 A;  2AWO A;  4GN4 B;  1I4G A;  2N3S A;  3NEL A;  2TMP A;  3FKI G;  3W5O A;  2HD3 A;  2WB1 B;  2Z9H A;  4XYQ A;  3QJY A;  1M90 C;  4LF6 Q;  4OX9 L;  4A93 B;  4GKK L;  3WDN A;  2CFM A;  2XTI A;  3VYU A;  4DUZ Q;  3H0G B;  3RZO H;  5C0X I;  4C3J G;  1GOZ A;  4GLX A;  2QW7 A;  2A69 D;  3GTQ B;  4GKJ Q;  3H15 A;  4IN3 A;  1BCP C;  1K83 B;  2JK8 A;  4C3H B;  1TWG H;  5LL6 X;  3A0J A;  2Q8I B;  1BCP D;  1FNW A;  3J80 E;  3HKZ E;  1B50 A;  4A3J H;  1D8L A;  4DR4 Q;  1OXT A;  3KBG A;  3L7Z C;  1H9J A;  5IGD A;  4IJL A;  1WTH A;  2PMZ B;  4N8F A;  4I7A A;  3ZJY C;  3I2Z A;  1YIJ A;  2F0Q A;  1ZEQ X;  1YHB A;  4A3B G;  1X6O A;  3KDF B;  1DOL A;  3ULP A;  2R3Z A;  2XVS A;  5ELD A;  4K0K Q;  5ELN A;  4DN4 M;  4EQ5 A;  3D6W A;  4DV6 Q;  2ZTC A;  4HSV A;  1K0R A;  5IP9 G;  4E6I A;  3HOW G;  3S1Q B;  2X69 A;  1E2V A;  3TZU A;  2JYO A;  4DNR B;  4IUV A;  2L11 A;  3I4N G;  4B3T L;  1QJO A;  3S16 B;  3TZD A;  1K3R A;  4C3I G;  3PIP 3;  5K36 G;  1J5E Q;  5CGK A;  3NUC A;  2ZT9 C;  3U50 C;  3RD4 A;  3E0J A;  4A75 A;  5C4X H;  3OW2 A;  3IKJ A;  5CBE E;  4A3F H;  1WCM G;  4A3I B;  2RSN A;  1NE3 A;  2A74 C;  1XMO L;  1HNX Q;  4GLA C;  5IP7 H;  1G91 A;  2MGS A;  2JE6 I;  3HOY G;  4CKC A;  1S72 A;  3PUV A;  4AYB B;  1PTO B;  1VQ8 A;  2KCT A;  4IAL A;  4KK7 A;  3PUW A;  1PH6 A;  4OWT B;  1K8A C;  1MJE A;  1VDZ A;  1I94 L;  4IZ8 A;  1IBK L;  5ISR A;  1U9R A;  2V1C C;  4TQU S;  4WJ3 M;  4LUV A;  4P71 A;  4X6A H;  4ZK9 B;  1G2T A;  2Y0S B;  4UAI A;  4DR1 Q;  4HIO A;  3BU2 A;  1K0S A;  1Y1V B;  2K5N A;  2JA9 A;  3EN2 A;  3ND9 A;  4HJ7 A;  4EQO A;  2JP1 A;  4HIK A;  2NVX B;  3K6O A;  3D0F A;  4ZYS A;  1PA6 A;  3PIP A;  1Y1W H;  4QQB X;  2E8G A;  3MXP A;  2XRS D;  4A3K G;  1BO0 A;  4LF9 Q;  2D0O A;  3H3V H;  1TWA B;  2RCF A;  4LFA L;  4C1N K;  2K7V A;  5HUR A;  1YZ6 A;  1UWV A;  3D4R A;  2RQX A;  4IFD I;  4A3E B;  3K7U C;  3STB D;  2M9V A;  4K14 A;  4N9P A;  5IYD G;  1KNA A;  4JV5 L;  2B2W C;  1MD2 D;  3MXU A;  4LNQ A;  1IKL A;  2EYP A;  1B2T A;  5EQ0 A;  3I56 A;  3FRP B;  2NVQ B;  3VR2 A;  1CHQ D;  1EQQ A;  1HQR D;  4A3M H;  1EY7 A;  3A8I E;  4B08 A;  1Q8K A;  1SE8 A;  1FD7 D;  1JT8 A;  4H44 C;  1W3S A;  4OEL B;  4CGY B;  3CQZ H;  1U4R A;  3FVQ A;  3OWE B;  4B3S L;  4KLK A;  2JA6 G;  2B2Y C;  3S1R H;  2VB2 X;  2PPB C;  1FNU A;  1V1P A;  2EY6 A;  4F87 A;  4DR2 L;  1VQM A;  1RTO A;  1YVC A;  5FLX c;  2KJX A;  2ASB A;  1H95 A;  1E22 A;  4BBR H;  3RNU A;  4P72 A;  1AFP A;  1WVL A;  4JPB W;  4LF4 Q;  4A93 H;  1KL9 A;  2DY7 A;  2ES2 A;  2OTL A;  1FGU A;  3ULL A;  3GTQ H;  5KIX A;  2HQE A;  2K75 A;  4C3H H;  4DR6 L;  1Q8I A;  1TWC H;  2J7Z A;  2F3W A;  1D5Z C;  2H1E A;  4FO2 A;  5D65 A;  1F2M A;  5JEA G;  4HTH A;  2F4V Q;  3J81 L;  2IJ0 A;  3K8A A;  3J7A V;  2B2T A;  5M9O A;  1FL0 A;  4YWK A;  4ZCK A;  2XSC A;  3GTG B;  2FMC A;  1EUJ A;  4UP8 A;  3JAM c;  1TY0 A;  2WIN B;  2KOL A;  3J7A 5;  5JPM C;  3ERS X;  3VR6 A;  3U4Z A;  1VQP A;  2F0J A;  5FJ8 H;  4MNO A;  1JWS D;  3TRZ A;  1DM0 B;  4FP5 D;  3I4L A;  4DV7 L;  3S2D H;  5IWA Q;  1STY A;  4OO1 H;  2N55 A;  1JQY D;  1VF5 C;  4ZLT F;  1ZYR C;  5FO7 B;  3KLS X;  5IOD A;  1XWE A;  2E5L L;  1ZYR D;  4JI6 L;  4LF7 L;  2HHH Q;  3W1B A;  1G2S A;  1Y14 B;  5K5P A;  2SOB A;  5I6W A;  3ICE A;  2F0W A;  5GAD C;  1YNN C;  4IPG A;  4BBS H;  4A3C H;  2R6G A;  5FLM G;  4Y7N B;  5HY6 A;  1MSH A;  2IPK D;  2NZO A;  1HRJ A;  2FJ2 A;  2F3I A;  4S3S A;  4DUY L;  2OF1 A;  3ULJ A;  4UDU C;  4BA1 I;  2E2J B;  5JAV A;  3T13 A;  3NBI A;  2IWH A;  3TRE A;  1ROD A;  2G9H D;  4PV1 C;  4HIM A;  4GZY C;  2B29 A;  2BE5 C;  5GRO A;  3TP5 A;  3QO2 A;  1HUM A;  4XDX A;  3DWP A;  1EYD A;  1H9K A;  1EIG A;  4IUP A;  2CQO A;  2RBM A;  1M8A A;  3UDI A;  2B63 B;  5HGQ A;  1TT2 A;  3S1N H;  1E2W A;  2ENB A;  3D6C A;  3J81 i;  1SR3 A;  1CQF A;  1YEZ A;  4ULL A;  5IGB A;  3ND8 A;  4DV3 L;  2UXC Q;  4LFB L;  4UHV A;  3NHH A;  4RAU C;  3DUZ A;  1EY0 A;  4B3R L;  1TWA H;  4QIW B;  2O5J C;  1O78 A;  1N33 Q;  3VR3 A;  1WTW A;  3M4O H;  4JI0 L;  4NXM L;  4A3E H;  4RKL A;  3SK6 A;  1Z6H A;  2I07 B;  2PCF B;  1PLF A;  3QG1 A;  1QB5 D;  1LM0 A;  3F2C A;  2MNA A;  2SNM A;  4LJZ C;  4IUU A;  2OTJ A;  1F9S A;  1G8Z D;  4RG1 A;  1CKN A;  1CM9 A;  4WOR A;  1VQB A;  3ERQ A;  2VXW A;  1D5X C;  1IBM L;  4IO9 A;  1TWH B;  2EQS A;  3U9S A;  1RDP D;  3PO2 G;  2F4I A;  2IX0 A;  3CRK C;  1KXL A;  1EIF A;  3D4D A;  3CAM A;  2L55 A;  3CRL C;  1CZW A;  4KTA A;  1N36 L;  1DJR D;  4HMJ A;  1AZP A;  4BS9 A;  2A19 A;  1SYD A;  2R93 H;  4ME3 A;  1WJJ A;  1HTL D;  4QGU A;  1HZB A;  4TSS A;  2F03 A;  3PIO A;  1Q90 A;  4OWX B;  1C9O A;  3CHB D;  1LLR D;  2RF4 A;  2RKS A;  1TII D;  4R9W A;  1F2L A;  4WRD A;  4XT3 B;  5EKI A;  1KD1 C;  4HAE A;  1Y8N B;  2EYJ A;  1WTO A;  1E24 A;  4HCE A;  1EY4 A;  1WYD A;  2K4K A;  2PQA B;  5G3L F;  1I3Q B;  4KHP Q;  4FXD A;  1XJV A;  1QUQ A;  1QE6 A;  2GVA A;  3OMG A;  3QIA A;  4PG3 A;  3OPO A;  5J1Z A;  2B2T C;  1TY2 A;  2XWJ B;  2NTT A;  4IUR A;  1F9Q A;  5C5L A;  5M5W B;  1Q81 C;  1BCP B;  4YIJ A;  3KF6 A;  1MKH A;  3UDF A;  2AUJ D;  1SNC A;  2I46 A;  3MHB A;  3RN2 A;  3QR8 A;  4JOI A;  3HGB A;  1S4Z A;  1UAP A;  1PFB A;  2L15 A;  3C1F A;  3OW7 A;  4DV4 L;  1OXX K;  2H4O A;  3GTK B;  3J7Z C;  2KCC A;  2VY3 A;  1YJ9 A;  1LTB D;  4BY1 B;  1N34 Q;  3I70 A;  1LYL A;  4XQN A;  4DV5 L;  4A3D H;  3GTP H;  2K1B A;  1BF4 A;  3QOJ A;  1KC8 C;  2EZV A;  2BH8 A;  1II3 A;  1SMY D;  3MXN A;  1R4P B;  2JA7 B;  1ILQ A;  4YCU A;  5I2Y A;  4POG A;  4G7H C;  5M5X B;  1Q1E A;  3VA7 A;  2V4D A;  1AEX A;  5JJZ A;  4RGT A;  1Z47 A;  1VQ4 A;  4DR3 Q;  1LT5 D;  5KRU A;  1I5F A;  3I4M G;  5E4X A;  2CCZ A;  2PZW A;  1HZC A;  3PO3 G;  4DAY A;  4PQX A;  2K50 A;  2Q2U A;  4DV1 L;  4JI8 Q;  3CCS A;  1B9N A;  1P16 A;  2IT1 A;  2B63 H;  4K5X A;  2PNR C;  4PZ6 A;  1ICW A;  3GTO H;  4R8I A;  3CP0 A;  2VQF Q;  1UE5 A;  4U68 A;  4NPS A;  4FNF A;  4L6T B;  3T16 A;  1V43 A;  5JJK A;  3S17 B;  2R92 G;  2K03 A;  2Z1C A;  2NTS A;  1QVG A;  2MUY A;  5HGT A;  1N9W A;  4X62 Q;  2EY1 A;  5BR8 Q;  1G29 1;  4K5V A;  4ZRZ A;  1KAB A;  4BA2 I;  3FDT A;  4PNY A;  2RSO A;  4LF6 L;  1D1K A;  4DUZ L;  1VQE A;  1Z9F A;  3FKI B;  1I6H B;  4LF8 Q;  1B3Q A;  3MC0 B;  1EEI D;  4DAM A;  5IOC A;  4YCW A;  4EGV A;  3LWE A;  3KLS A;  1I50 B;  4C3J B;  3GV6 A;  5KYL A;  1CHP D;  3BYY B;  4O0A A;  3TS2 A;  2OQ0 A;  3I73 A;  4X66 L;  5FLX E;  2EXZ A;  1ZXT A;  3S15 B;  1TWH H;  4DR4 L;  4AQY L;  4H0L C;  2A1A A;  1HCZ A;  3ONA B;  1XPU A;  3GDE A;  2OQK A;  1UE1 A;  3MTS A;  1HZ9 A;  4XIG S;  3E3X A;  3J81 j;  5I4D A;  4BY7 H;  5CC4 A;  3Q23 A;  3ER0 A;  4K0K L;  3PSI A;  4A3B B;  4LMQ D;  1STB A;  2HDM A;  1EQR A;  1DGS A;  2MHV A;  4UPA A;  4H13 C;  3S9W A;  1NJI C;  5FKA C;  1CKM A;  1VQN A;  1J5E L;  3DWA A;  4F7X A;  1GXD C;  4JI7 Q;  3I72 A;  4KY6 A;  3CCU A;  2C5C A;  3I4N B;  3P1H A;  1HNW Q;  4IUQ A;  4C3I B;  3GP7 A;  4N8X 1;  1I3Q H;  2DJG C;  3NEN A;  4I7Z C;  2AQ2 B;  3BYT B;  1GJX A;  4IJH A;  2NB0 A;  4JI1 Q;  3X3N A;  4MZ9 A;  4APV A;  1N8R C;  3GTL B;  1C4Q A;  2NZH A;  3RR5 A;  5DM7 3;  1WCM B;  5C3E G;  3KLW A;  2MFI A;  1OO9 B;  1WTQ A;  2IHF A;  3AB9 A;  2A68 C;  1RIP A;  3M4Y A;  1Y69 U;  1XYI A;  4P2C B;  2A68 D;  1SMX A;  3SGI A;  1PH3 A;  1VQF A;  4YWL A;  4ABN A;  2EOT A;  1SNP A;  4CDC C;  3G71 A;  3MVV A;  4WJW A;  1OXS C;  4DR7 Q;  1GUO A;  4DXG A;  4FXK C;  1ENF A;  4IPD A;  4QMG A;  4PMW A;  1B9M A;  4HSP A;  3FPP A;  3HS0 C;  2EJF C;  3RLF A;  2JA5 G;  3BDC A;  4JI5 Q;  2UXD Q;  2WII B;  2F0G A;  2K5D A;  2CWA A;  2NVY B;  3Q22 A;  4HR7 B;  1X54 A;  1T5X D;  3G48 A;  4A3J G;  4LF9 L;  1SRO A;  4J8Q A;  1TS2 A;  1J8I A;  3TP6 A;  4FXG C;  2D5D A;  2HQL A;  4A3K B;  1XPO A;  4DV0 Q;  1U0L A;  3H09 A;  1K9M C;  2A69 C;  3IFD A;  4KY5 A;  1DZ1 A;  1TXY A;  5ELO A;  1A2U A;  3AYH B;  2ZXP A;  3D3R A;  3CXC A;  3WOE A;  1JWM D;  2WB1 E;  3HP3 A;  4IQZ A;  3UDX A;  4PMC A;  3GTJ H;  2UU9 Q;  2QKI C;  2QF7 A;  1BDO A;  3CC2 A;  3T53 B;  3HOZ H;  1CQV A;  4A3L G;  2EYL A;  2K14 A;  2A73 B;  1KQS A;  3NP8 A;  4K6L A;  4DA2 A;  3HRZ C;  5M5Y B;  1YNX A;  4RCN A;  1H9M A;  1QZH A;  1H9R A;  4OIJ A;  1X3F A;  5C4X G;  3L3O C;  4NB3 A;  2E2H B;  2JA6 B;  3KYH C;  4A3F G;  5EKK A;  2WAQ G;  1HNZ L;  5E7N A;  5H1S E;  1HR0 Q;  3F1Z A;  1I6H H;  1MJC A;  4JI4 Q;  3GO5 A;  1B7Y B;  2MP1 A;  2CW0 D;  1I50 H;  3V05 A;  1IL8 A;  2EY5 A;  2ZJQ A;  2F0L A;  2R7D A;  4CKE A;  2UXB L;  1D7Q A;  2A6E C;  4JG2 A;  2SEB D;  2EYF A;  1PVO A;  4DV2 Q;  2CKZ B;  2A6E D;  3UE1 A;  2F4V L;  3S15 H;  3CCJ A;  4OXP A;  1Y8P B;  1MBY A;  3OWF A;  4DPG A;  3HZX A;  1ONL A;  3I55 A;  2ZM6 Q;  3C3L A;  5C4J B;  1HHV A;  2OXP A;  2EYH A;  3HFZ B;  4ODG A;  5M3M H;  4MTN A;  4AH6 A;  2YU9 B;  1B3A A;  3HOU G;  2QA4 A;  4BWG B;  2CQA A;  1EYC A;  3CPF A;  3TP8 A;  1Y1W G;  1EIH A;  1O7L A;  3BDL A;  4QB4 A;  4RWS C;  1PZK D;  1JB3 A;  1TWF B;  4AYB E;  2CH4 W;  4X65 L;  3BS1 A;  4B3M L;  3I8Z A;  3QOL A;  1RL2 A;  3K0Y A;  2WV6 D;  1JCK B;  3J7Y W;  4KHZ A;  1PZI D;  1A15 A;  4PZ8 A;  1A2T A;  2F52 A;  4R4C A;  2NUC A;  2F0U A;  3J81 E;  1L1O C;  4B9X A;  1I4H A;  4C3I H;  2LKV A;  2HHH L;  5IT9 L;  2Y0S E;  3NWT A;  1DYQ A;  1SBB B;  2JEA I;  2O5I C;  3BVG A;  4EQP A;  1A0I A;  2DUD A;  5J39 A;  4LF5 L;  4QUF A;  1SFO B;  4GNX C;  1WFQ A;  1PH5 A;  4A3M G;  1HZA A;  4ID6 A;  3L9A X;  4JVZ A;  1V1P B;  4R8N A;  2IW3 A;  2Q2H A;  4AIM A;  1JJC B;  1NUC A;  5IGG A;  3NQI A;  3STB C;  4QL5 A;  3J80 L;  4F88 A;  2OCE A;  3BG3 A;  1KRT A;  1JC7 A;  3HKS A;  4DNT B;  1C48 A;  3E0E A;  1P8L A;  4BBR G;  2FXQ A;  3NTI A;  2E2I B;  5EPL A;  3GQB A;  2BCO A;  4XXE A;  1I4X A;  1WTX A;  5M3F B;  3HKZ G;  4HJA A;  1KRS A;  2K5W A;  2AMC B;  4OX9 Q;  3ERO A;  1S5B D;  2ATW A;  1GO3 E;  3A5Z B;  1A3T A;  1CSQ A;  2NVY H;  3CCM A;  4HCS A;  4C3H G;  1VQO A;  1BQQ T;  1X55 A;  3HOV H;  4WFN 3;  2AHO B;  2NBF A;  3DHQ A;  3RZD B;  1KTK A;  5LMU Q;  2DNC A;  3TME A;  1J9O A;  2LXK A;  1O7I A;  1UE6 A;  3H0G H;  5J3B A;  3S1M B;  1AE2 A;  1PRT D;  5AJ3 Q;  5GAG C;  3K5N A;  2JA8 G;  1K83 H;  1W6J A;  4G4K A;  1LTL A;  3KUP A;  4P75 A;  1DON A;  5A2Q L;  3CU7 A;  1NCV A;  1Q1B A;  5D3D A;  5FJ8 G;  3FEW X;  5GAH C;  4X3K A;  1A3V A;  5IGC A;  1EYA A;  3KJP A;  4OO1 G;  4DK1 A;  1ILP A;  3DMU A;  3TDQ A;  1B8A A;  3H3V C;  3OOC A;  2E76 C;  2F0K A;  3PO2 B;  2PW7 A;  3S14 B;  3SE0 A;  1CK1 A;  1YBY A;  1AW7 A;  3EFX D;  1BBX C;  2E2H H;  2R7Z B;  4K6D A;  5C44 B;  3S1Q H;  4BBS G;  1GUW A;  4A3C G;  3H94 A;  2RA4 A;  4AYB G;  4DK0 A;  2UUC Q;  3A8J E;  3J80 i;  3S16 H;  1LUZ A;  1X3Q A;  4G7O C;  2X6G A;  1B53 A;  1QOH A;  2QIL A;  4P73 A;  4JC0 A;  1E1O A;  4TRD A;  2Y0S G;  3Q0A A;  4A3I H;  4FF4 A;  1IBK Q;  5EPK A;  1QNK A;  3R3O A;  3LX0 A;  1S5F D;  5C4J H;  2N78 A;  1CUK A;  2NN6 I;  1A63 A;  4G7Z C;  1SE4 A;  3T1H Q;  4LAA A;  5C0X H;  2C9O A;  1PTO H;  2F1M A;  1FJG Q;  1OXV A;  4X3S A;  2L12 A;  1YNJ C;  4OIK A;  1KHI A;  1YNJ D;  1IYU A;  3PUZ A;  3K0X A;  1MI2 A;  1HA5 A;  2UUB Q;  3OSO A;  3PGZ A;  1LTA D;  1PFM A;  1CKO A;  1BUV T;  1CT1 D;  3KF8 A;  1Y1V H;  5KGU A;  1M1K C;  4HJ8 A;  4A3E G;  4LFA Q;  1CKN B;  1GUS A;  4TVA B;  2ALY B;  2NVX H;  4F8M A;  1SND A;  5CMD A;  1JMC A;  2BA1 A;  4JV5 Q;  2VS1 A;  2DNE A;  4NP5 A;  1SFO H;  3PF5 A;  4JW0 A;  1AP0 A;  4BXX H;  3ITP A;  3A7A B;  2NWG A;  4EQN A;  2QEX A;  4P74 A;  3F2U A;  4TKO B;  3HOX B;  2B2U C;  3PCO B;  1LAC A;  4A3G G;  2WKD A;  1JOK A;  2ID0 A;  4QIW E;  3A56 A;  3UE0 A;  4B3S Q;  1EQV A;  1DD2 A;  2NVQ H;  1CA5 A;  1PV4 A;  2N49 A;  1BR9 A;  1HH2 P;  1K8M A;  3I4M B;  1B44 D;  5CV7 A;  4JI8 L;  2R93 G;  1VMP A;  3E5S A;  3PO3 B;  5M3F H;  1SLJ A;  1XMQ L;  1RD9 D;  4LFC Q;  1SYF A;  4RFB A;  1RKN A;  1LTG D;  2MQH A;  4UP9 A;  2VQF L;  1X9N A;  1GUG A;  2DJF C;  1EOT A;  2RDG A;  1QUQ B;  3AMU A;  1EWI A;  5C4H A;  1Q46 A;  1BOS A;  5FOB B;  2K5H A;  5IY0 A;  3RZD H;  3DEO A;  1EY6 A;  1XX8 A;  4X62 L;  1V9P A;  1KDC A;  4YCV A;  2R92 B;  5CV4 A;  2KA7 A;  3T1Y Q;  2D0P A;  1QVF A;  4X3T A;  5D14 A;  4DR5 Q;  4L5S A;  1VQC A;  4KV6 A;  3RMH A;  4L5T A;  1BBU A;  3AU7 A;  1DCZ A;  2K04 A;  3KF6 B;  4WJ4 A;  2JN4 A;  2JXM B;  1S5E D;  3M4Q A;  4KD3 A;  2WKC A;  4RH6 A;  5DLQ E;  2ZJP A;  2JEB I;  5F2D A;  2EDG A;  2Z4H A;  5D3I B;  4XQQ A;  3SVM A;  5GQO A;  1FR3 A;  2G9D A;  3M4P A;  4Q0F A;  5CR3 A;  3G7L A;  3PQI A;  2J4X A;  1KLU D;  4HJ9 A;  5T1I A;  1O80 A;  3CKI B;  4DK3 C;  3GTG H;  4IFD H;  4DV7 Q;  4DAP A;  1VQI A;  5LMN Q;  3PO2 H;  3S14 H;  3OTO Q;  4DKA C;  1WTR A;  1A6X A;  2R7Z H;  1UEA B;  3J81 c;  3G4S A;  2VUM G;  3T51 B;  3MXN B;  2E5L Q;  2BDN A;  5C44 H;  4A3D G;  3OIP A;  4NXN Q;  1CSP A;  1T5E A;  1TR5 A;  3A55 A;  3TP7 A;  4KI0 A;  5CYU A;  2VQE L;  3K59 A;  1C7Y A;  1YIT A;  4DAY B;  4YY3 L;  1EQT A;  4IOC A;  2RCN A;  1SJH D;  3TBI B;  3WWV A;  3EBE A;  4DUY Q;  2N88 A;  1SNQ A;  4ALP A;  1NNX A;  3QB3 A;  5C0X J;  1A3U A;  2P5Z X;  4JI1 L;  4X64 Q;  2IX3 A;  1R9T B;  2EJM A;  4UY8 C;  1SMY C;  2KUM A;  2F0H A;  1B4O A;  1V1O A;  2F3V A;  1ZKO A;  4Y7N H;  4V19 0;  5ELB A;  2AKW B;  4FF1 A;  3H6M A;  1N32 Q;  3V2T A;  1G6P A;  5GAE C;  3A5U A;  2IY5 B;  5C3E B;  3NBH A;  2E2J H;  1XNR L;  1VQ6 A;  1X3P A;  2F0E A;  1IBL L;  2AQ1 B;  2F0N A;  2NN6 G;  1I4Q A;  2XN9 C;  2FFK B;  4DV3 Q;  3TEH B;  1E7Z A;  4A76 A;  1VQL A;  1CTM A;  1ET9 A;  3OHX C;  2K05 A;  3PUY A;  3PUX A;  4CDD C;  2RVL A;  5I9O A;  3CME A;  2PO4 A;  2Q8T A;  4NXM Q;  1V8Q A;  2K28 A;  5KEE A;  5IYC H;  4JI5 L;  2VW9 A;  2UXD L;  3RZO B;  3D8G A;  3UI2 A;  1JE4 A;  2JA5 B;  1TS5 A;  2QEJ C;  3J7A F;  4FYD A;  2A6H C;  5ELF A;  2VNU D;  2A6H D;  1TWG B;  3MEH A;  4FVM A;  5A35 A;  2X6L A;  3HOX H;  3CCV A;  4O42 A;  4L8J A;  3F8T A;  2F0D A;  5FK9 C;  1RF2 D;  4GOP A;  3PMF A;  3TS0 A;  3CC4 A;  2Q2T A;  4EVO A;  4BY7 G;  1BNZ A;  4GKJ L;  1MGS A;  1VQK A;  1N36 Q;  1L0W A;  1KDA A;  3CMA A;  1KDB A;  2UU9 L;  2LFN A;  2MO0 A;  5CBA E;  4FDB A;  1SEB D;  3SR1 A;  1LTS D;  3HG9 A;  4IPC A;  4GNX B;  1X65 A;  3DLL A;  1MHW C;  1RHP A;  3KLR A;  2D2C C;  4Q5V A;  4QUC A;  5CV8 A;  4R4T A;  3H3V I;  2GA4 B;  2KED A;  3EVQ A;  4OON A;  3C2P A;  3SHL A;  1S3O A;  5ELE A;  1IKM A;  1GUT A;  4C2M B;  5EAY A;  1E0B A;  4DV6 L;  3PV0 A;  1L1O A;  4RHR A;  4KJN A;  4DU9 A;  4A3F B;  1EU4 A;  1S40 A;  2WAQ B;  2H5X A;  1XNQ Q;  4DAV A;  3HOW B; 
#chains in the Genus database with same CATH homology
 1VQP A;  3I55 A;  2ZM6 Q;  1AE3 A;  5FJ8 H;  4MNO A;  4JI6 Q;  4LF7 Q;  3HFZ B;  2HIX A;  5M3M H;  4MTN A;  3TRZ A;  4AH6 A;  4DV7 L;  3HOU G;  3S2D H;  5IWA Q;  3NBH B;  2QA4 A;  4GNX A;  1YHQ A;  3CW2 C;  4GN5 A;  3U58 A;  3CD6 A;  4L5R C;  4IFD J;  4JCV E;  4H02 A;  2Z6K A;  2VZA A;  1VQ7 A;  1XNQ L;  3K80 C;  1HNX L;  2XGT A;  1NY4 A;  2ZM6 L;  2EXD A;  1BKB A;  2E5L L;  3CPF A;  5LMN W;  4JI6 L;  1Y1W G;  4LF7 L;  2HHH Q;  1MIU A;  4AYB E;  5JEA J;  3W1B A;  4JI7 L;  1Y14 B;  4JYA Q;  4LUO A;  4X65 L;  1PHJ A;  3AEV A;  1HNW L;  1K8G A;  3ICE A;  4B3M L;  3F2B A;  4IOA A;  1RL2 A;  1A62 A;  4GLV B;  4DV4 Q;  5GAD C;  1JJ2 A;  4IPG A;  4BBS H;  3KJO A;  4KHZ A;  4JBJ A;  4A3L G;  4PZ8 A;  4IPH A;  3HOZ H;  4A3C H;  2F52 A;  2R6G A;  5M5W H;  4R4C A;  5FLM G;  4JI3 Q;  1IZ6 A;  1L1O C;  1KAW A;  4C3I H;  1XPR A;  2HHH L;  2Y0S E;  5HY6 A;  3CPW A;  2NZO A;  4DV5 Q;  4JYA L;  2B63 G;  4UP7 A;  1GVP A;  3DM3 A;  1PH8 A;  2JEA I;  2F3I A;  4DUY L;  2KHI A;  3ULJ A;  1EFW A;  4BA1 I;  4DR1 L;  4GN3 B;  1A0I A;  5IYC G;  2DUD A;  2PQA A;  1VS0 A;  1HJP A;  4LF5 L;  2VUM H;  1PYB A;  4JI3 L;  3GTK H;  4EX5 A;  2YYZ A;  3TRE A;  4HIM A;  4HID A;  4GNX C;  1WFQ A;  1PH5 A;  4A3M G;  4YWM A;  1HZA A;  2B29 A;  5GRO A;  2Z6K C;  4BY1 H;  1VQ9 A;  2Q2H A;  4AIM A;  1JJC B;  4LFB Q;  4GOP B;  3BZC A;  2D62 A;  3STB C;  4QL5 A;  4DR7 L;  2CQO A;  2OCE A;  2I5M X;  1KRT A;  4B3R Q;  3UDI A;  2I5L X;  1QVC A;  3HOX G;  3HKS A;  5HGQ A;  1VQG A;  2JA7 H;  1JJG A;  3S1N H;  3E0E A;  4DV1 Q;  4O2D A;  5M5X H;  1PH2 A;  4JI0 Q;  1P8L A;  3J81 i;  4BBR G;  3HOZ G;  1SR3 A;  2FXQ A;  1YEZ A;  4DV3 L;  2UXC Q;  3RLO A;  4LFB L;  1K73 C;  1W2B A;  3JC6 6;  3Q8D A;  1NTG A;  1Q82 C;  4POF A;  3HKZ G;  4B3R L;  1TWA H;  4HJA A;  4OO1 I;  3CF5 A;  1KRS A;  1U5K A;  2AMC B;  2QGQ A;  2YTV A;  4OX9 Q;  3F2D A;  1YJN A;  1N33 Q;  3CC7 A;  2ATW A;  1GO3 E;  4QJF A;  3A5Z B;  3M4O H;  4JI0 L;  4NXM L;  1CSQ A;  2PNH A;  2NVY H;  3CCM A;  4A3E H;  1VQO A;  1X55 A;  3HOV H;  1IBM Q;  1XMQ Q;  2AHO B;  1Q7Y C;  3E9H A;  4DV0 L;  1LM0 A;  3IRB A;  3F2C A;  3L2P A;  2MNA A;  1L1O B;  2OTJ A;  5LMU Q;  1GM5 A;  4RG1 A;  1T9H A;  2C35 B;  1CKN A;  2MO1 A;  2LXK A;  4R1J A;  1O7I A;  2CWP A;  1UE6 A;  2JJQ A;  3H0G H;  5J3B A;  1VQB A;  2WP8 J;  2JA5 H;  3I4M H;  3S17 H;  1VQH A;  5IYB H;  3AFQ A;  1IBM L;  3PO3 H;  1UEB A;  2EQS A;  1AE2 A;  4LUZ A;  4IO9 A;  5AJ3 Q;  5GAG C;  3PO2 G;  1EIY B;  4YHH Q;  3CCE A;  2JA8 G;  1AH9 A;  2K5V A;  2IX0 A;  1K83 H;  4X66 Q;  2GVB A;  1KXL A;  1EIF A;  1XTD A;  2PMZ E;  1LTL A;  1PFS A;  3CAM A;  4P75 A;  4JI2 Q;  2LSS A;  5LMU L;  4LF4 L;  1Q1B A;  2YTY A;  5IP7 G;  5FJ8 G;  1A8V A;  4AQY Q;  3FKI H;  1N36 L;  1NMG A;  5M3M G;  5GAH C;  2HT1 A;  5AJ3 L;  3KJP A;  1G51 A;  2A19 A;  2YTX A;  1GD7 A;  2JQO A;  4ME3 A;  3U4V A;  4YHH L;  1WJJ A;  4OO1 G;  4C3J H;  2R93 H;  1B8A A;  2R92 H;  1JB7 A;  3AFP A;  4JI2 L;  4QGU A;  1BBW A;  1X56 A;  4XTC S;  1HZB A;  1HR0 L;  3CCQ A;  1YBY A;  3PIO A;  4JI4 L;  3I4O A;  4GOP C;  4R4Q A;  4OWX B;  2E2H H;  1C9O A;  2PI2 E;  2RF4 A;  3S1Q H;  2A8V A;  4A3L H;  4BBS G;  1KD1 C;  1HR0 W;  4A3C G;  4DV2 L;  1ASZ A;  1E24 A;  4AYB G;  2I0Q A;  1WYD A;  1KIX A;  2K4K A;  2PQA B;  2UUC Q;  3AQQ A;  3J80 i;  4KHP Q;  1B70 B;  1NBW A;  1XJV A;  3S16 H;  1LUZ A;  2WAQ E;  1QUQ A;  4C2M H;  2GVA A;  4A3B H;  2ZTD A;  2KEN A;  3B6Y A;  3NEM A;  3M85 A;  2VL6 A;  4L5Q A;  4PG3 A;  2VQE Q;  5JJL A;  4P73 A;  4JC0 A;  1E1O A;  2KCM A;  2Y0S G;  4A3I H;  5IWA L;  5IP9 H;  1IBK Q;  2UUC L;  3GTM H;  3HOW H;  4YY3 Q;  4LW1 A;  4BY1 G;  3KDF A;  1WI5 A;  5C4J H;  2N78 A;  1CUK A;  3BZK A;  2NN6 I;  1A63 A;  1Q81 C;  3S24 A;  2ZJR A;  3T1H Q;  3I4N H;  3KF6 A;  1MKH A;  1X3G A;  3UDF A;  2Q2I A;  4DNI A;  2BA0 A;  1FJG Q;  4JBW A;  2RHQ B;  1OXV A;  4OWW B;  3A74 A;  3RN2 A;  4JOI A;  2JA7 G;  4Y52 H;  2L15 A;  3M7N A;  4DV4 L;  1KHI A;  2I5H A;  3GTL H;  1OXX K;  3PUZ A;  2PI2 A;  3K0X A;  4GS3 A;  4PZ7 A;  1WCM H;  2VY3 A;  2YV5 A;  3J7Z C;  3T1H L;  1YJ9 A;  1UE7 A;  3VDY A;  2AWN A;  2UUB Q;  3PGZ A;  1FJG L;  3G6E A;  1N34 Q;  5JJI A;  3EIV A;  1OXU A;  1LYL A;  1CKO A;  1PH1 A;  1XNR Q;  3HOY H;  4DV5 L;  4A3D H;  2EIF A;  3GTP H;  1Y1V H;  3HOU H;  1IBL Q;  1KC8 C;  1M1K C;  1R9T H;  2UUA Q;  4HJ8 A;  2DGY A;  4A3E G;  3GD7 A;  2OWO A;  2BH8 A;  4LFA Q;  2WFW A;  1CKN B;  3HOV G;  3JAM i;  1QZG A;  1EOV A;  4TVA B;  4QY7 A;  2ALY B;  4YCU A;  1SN8 A;  2NVX H;  4POG A;  2UUB L;  2N8N A;  1Q1E A;  5IE8 A;  1JMC A;  2BA1 A;  1Z47 A;  5C3E H;  2WB1 G;  4JV5 Q;  2VS1 A;  1VQ4 A;  1SFO H;  3PF5 A;  2UUA L;  4A93 G;  4DR3 Q;  1Q86 C;  3H0G G;  1I5F A;  1SRU A;  3I4M G;  4BXX H;  2CCZ A;  1HZC A;  5IYB G;  3PO3 G;  4JOI C;  4R4I A;  2K50 A;  4GKK Q;  4RMF A;  2Q2U A;  1IYJ B;  2QEX A;  4P74 A;  4DV1 L;  4JI8 Q;  3CCS A;  2UXC L;  1P16 A;  2IT1 A;  1PH7 A;  2B63 H;  3PCO B;  2AWO A;  4A3G G;  2ID0 A;  2N3S A;  3NEL A;  4GN4 B;  4PZ6 A;  4QIW E;  3W5O A;  3FKI G;  3UE0 A;  3GTO H;  4B3S Q;  3CP0 A;  2VQF Q;  4LF6 Q;  2RHS B;  1UE5 A;  1M90 C;  3FP9 A;  4OX9 L;  4GKK L;  4NPS A;  2NVQ H;  2CFM A;  2XTI A;  4A3K H;  2N49 A;  1HH2 P;  4DUZ Q;  1PV4 A;  1N33 L;  3RZO H;  2R93 G;  4JI8 L;  1V43 A;  5C0X I;  5JJK A;  2R92 G;  4GLX A;  1QVG A;  5M3F H;  1SLJ A;  1H95 A;  1N9W A;  4X62 Q;  1XMQ L;  3M9B A;  5BR8 Q;  1G29 1;  4LFC Q;  4GKJ Q;  3H15 A;  1J6Q A;  1E1T A;  4BA2 I;  2JK8 A;  1TWG H;  2MQH A;  3A0J A;  4UP9 A;  2VQF L;  1X9N A;  4LF6 L;  1JE5 A;  5IYD H;  3HKZ E;  4DUZ L;  1QUQ B;  4A3J H;  1VQE A;  1D8L A;  1EWI A;  1OXT A;  1Z9F A;  4LF8 Q;  4DR4 Q;  4DAM A;  3L7Z C;  4YCW A;  3RLN A;  1Q46 A;  5IY0 A;  3RZD H;  2K5H A;  4X62 L;  2BH2 A;  3K7A H;  4IJL A;  4LFC L;  1HNZ Q;  1V9P A;  4YCV A;  3ZJY C;  5M5Y H;  3T1Y Q;  2D0P A;  2IHE A;  3I2Z A;  4O0A A;  3BJU A;  1YIJ A;  1QVF A;  3TS2 A;  4DR5 Q;  2LXJ A;  2OQ0 A;  4X66 L;  1VQC A;  1YHB A;  1X3E A;  4A4I A;  4L5S A;  1X6O A;  3KDF B;  4A3B G;  3ULP A;  1TWH H;  4L5T A;  1YHA A;  4B3T Q;  4DR4 L;  1BBU A;  2UXB Q;  2B3G A;  4AQY L;  3KF6 B;  4K0K Q;  5ELN A;  4WJ4 A;  2JA6 H;  4EQ5 A;  4DV6 Q;  2ZTC A;  2A1A A;  3M4Q A;  1K0R A;  5IP9 G;  4A3I G;  3HOW G;  5DLQ E;  3GDE A;  2OQK A;  1XPU A;  1UE1 A;  3KOJ A;  2ZJP A;  2JEB I;  3T1Y L;  1HZ9 A;  4XIG S;  4DR5 L;  2R7F A;  5GQO A;  3PF4 A;  3M4P A;  3J81 j;  1XMO Q;  5C0X G;  3I4N G;  4B3T L;  4BY7 H;  1K3R A;  3ER0 A;  4HJ9 A;  5K36 G;  4K0K L;  1J5E Q;  3PSI A;  4JBM A;  4DK3 C;  3GTG H;  3U50 C;  4DV7 Q;  1Q12 A;  1VQI A;  5LMN Q;  1IL2 A;  4A75 A;  5C4X H;  3OW2 A;  2JA8 H;  1EQR A;  3PO2 H;  1DGS A;  3OTO Q;  4DKA C;  3KF8 B;  3S14 H;  4UPA A;  1NJI C;  1V1Q A;  4A3F H;  1WCM G;  2R7Z H;  3J81 c;  3G4S A;  1NE3 A;  3E9I A;  1YJW A;  1XMO L;  1I94 Q;  2VUM G;  1HNX Q;  3MXN B;  4KHP L;  4GLA C;  5IP7 H;  2E5L Q;  5C44 H;  1CKM A;  1VQN A;  1J5E L;  4JI7 Q;  2JE6 I;  3HOY G;  1S72 A;  4A3D G;  3PUV A;  3CCU A;  4X65 Q;  1WOC A;  1CSP A;  1Y1V G;  2K52 A;  5LMN L;  1VQ8 A;  4B3M Q;  2YU9 H;  4NXN Q;  1HNW Q;  1C0A A;  1VQD A;  2KCT A;  3OTO L;  4KI0 A;  1I3Q H;  3PUW A;  1PH6 A;  3NEN A;  2VQE L;  4OWT B;  1K8A C;  1MJE A;  4IJH A;  4JI1 Q;  1GKH A;  1I94 L;  3LGJ A;  1C7Y A;  1IBK L;  4MZ9 A;  4APV A;  1YIT A;  1N8R C;  2GN5 A;  4TQU S;  2V1C C;  4DAY B;  2RCN A;  4LUV A;  4YY3 L;  4P71 A;  2NZH A;  4R4O A;  3RR5 A;  4X6A H;  5C3E G;  3KLW A;  1VQA A;  2MFI A;  4NXN L;  3WWV A;  1TWF H;  3EBE A;  4DUY Q;  2IHF A;  4ALP A;  4BXX G;  4DR1 Q;  4HIO A;  5C0X J;  3BU2 A;  4LF5 Q;  1RIP A;  1E3P A;  2HIV A;  4JI1 L;  1ASY A;  2K5N A;  4X64 Q;  2JA9 A;  1SMX A;  3EN2 A;  1PYS B;  1L2F A;  4HJ7 A;  4UY8 C;  4DK6 C;  3SGI A;  1VQJ A;  4Y7N H;  4HIK A;  1PH3 A;  1VQF A;  2KBN A;  3D0F A;  4YWL A;  2AKW B;  3K81 C;  3G71 A;  1OXS C;  1N32 Q;  4DR7 Q;  1G6P A;  5GAE C;  1PA6 A;  3PIP A;  3A5U A;  1Y1W H;  1N34 L;  2NVT H;  2IY5 B;  4IPD A;  2E2J H;  1XNR L;  4QQB X;  4PMW A;  1VQ6 A;  2E8G A;  4X64 L;  1PH9 A;  4A3K G;  1IBL L;  2Z0S A;  1OTC A;  4LF9 Q;  2D0O A;  1PH4 A;  3H3V H;  2NN6 G;  3RLF A;  3UDG A;  4LFA L;  5M3F G;  2JA5 G;  4DV3 Q;  3TEH B;  5IT9 c;  3U4Z A;  4JI5 Q;  1E7Z A;  1YZ6 A;  3MEF A;  4A76 A;  1UWV A;  5FLM H;  1VQL A;  1N32 L;  2UXD Q;  4IFD I;  1VQ5 A;  2CWA A;  3PUY A;  3K7U C;  3STB D;  3PUX A;  1VCI A;  4LWC A;  5IYD G;  4JV5 L;  1X54 A;  3G48 A;  4A3J G;  4DR3 L;  4LF9 L;  1SRO A;  4LNQ A;  3CME A;  4NXM Q;  3S2H H;  3I56 A;  5IYC H;  3RN5 A;  4JI5 L;  4JBK A;  2VW9 A;  2HQL A;  2UXD L;  1EQQ A;  4DR2 Q;  2E2I H;  1XPO A;  4DV0 Q;  4A3M H;  3M3Y H;  1U0L A;  1K9M C;  3J80 c;  1Q8K A;  1IXR A;  1SE8 A;  1TXY A;  5ELO A;  1JT8 A;  3AYH B;  1W3S A;  4J15 A;  3CXC A;  2VNU D;  4IOC A;  2WB1 E;  3CQZ H;  4B3S L;  3UDX A;  4KLK A;  2JA6 G;  3GTJ H;  3HOX H;  3CCV A;  3S1R H;  2UU9 Q;  4DR2 L;  1VQM A;  3F8T A;  3CC2 A;  1YVC A;  5FLX c;  3CCL A;  4GOP A;  3CC4 A;  3TS0 A;  1E22 A;  4BBR H;  2K14 A;  2Q2T A;  2ASB A;  4DR6 Q;  2ZTE A;  4P72 A;  3RNU A;  1KQS A;  3W1G A;  5BR8 L;  4LF4 Q;  4A93 H;  4BY7 G;  4GKJ L;  1KL9 A;  1VQK A;  3L0O A;  1YNX A;  1N36 Q;  1L0W A;  3CMA A;  2ES2 A;  2OTL A;  1FGU A;  2MO0 A;  1QZH A;  3ULL A;  2UU9 L;  2KHJ A;  3GTQ H;  1X3F A;  3S1M H;  4FDB A;  4IFD G;  5C4X G;  1YI2 A;  4LF8 L;  4NB3 A;  4WJ3 M;  4IPC A;  1FVI A;  2K75 A;  3KYH C;  3OYY A;  4C3H H;  4GNX B;  3KFU A;  1X65 A;  3DLL A;  4A3F G;  2R7Z G;  1TWC H;  4DR6 L;  2WAQ G;  1HNZ L;  4A3G H;  5E7N A;  5H1S E;  5JEA G;  1HR0 Q;  2F4V Q;  5C44 G;  3I7F A;  3F1Z A;  1I6H H;  1MJC A;  4JI4 Q;  4R4T A;  3GO5 A;  3H3V I;  1BVS A;  2IX1 A;  4HJ5 A;  1B7Y B;  1I50 H;  3K8A A;  4OON A;  3CCR A;  1D7Q A;  1FL0 A;  2ZJQ A;  1S3O A;  2R7D A;  3D31 A;  2UXB L;  4YWK A;  3FHW A;  1EYG A;  4JG2 A;  1PVO A;  1EUJ A;  4UP8 A;  5EAY A;  4DV2 Q;  2CKZ B;  3UE1 A;  4DV6 L;  3PV0 A;  3JAM c;  2F4V L;  3S15 H;  3CCJ A;  1L1O A;  4OXP A;  3TQY A;  3J7A 5;  3ERS X;  1S40 A;  1XNQ Q;  2H5X A;  4DPG A;  1NMF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...