4GS3A

Dimeric structure of the n-terminal domain of prib protein from thermoanaerobacter tencongensis solved ab initio
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
98
structure length
90
Chain Sequence
ENNTVTLVGKVFTPLEFSHELYGEKFFNFILEVPRLSETKDYLPITISNRLFEGMNLEVGTRVKIEGQLRSYNRKLILTVFARDISVVPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Single-stranded DNA-binding protein
publication title Dimeric structure of the N-terminal domain of PriB protein from Thermoanaerobacter tengcongensis solved ab initio.
pubmed doi rcsb
source organism Thermoanaerobacter tengcongensis
molecule tags Dna binding protein
total genus 14
structure length 90
sequence length 98
ec nomenclature
pdb deposition date 2012-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00436 SSB Single-strand binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4gs3A00
2QGQA 1NBWA 4OXPA 2IHFA 2OQ0A 5DLQE 4DR2L 1EQRA 4JV5L 1RL2A 4JOIC 4BBRH 1E1OA 3KDFB 3T1HL 3I4NG 3I2ZA 1KAWA 4GN5A 1PYSB 4JOIA 3EN2A 3D31A 1E22A 1U5KA 4LUOA 2EIFA 1L0WA 1C0AA 1KQSA 3K80C 3M85A 1GKHA 1W2BA 2ES2A 4A3JG 3CC4A 4DR1L 3BZCA 3E9IA 1VQOA 3RNUA 4KHPL 4DR4Q 4A3IH 5C3EH 1SMXA 5GAEC 4JI8L 1OXSC 3HOZH 1SROA 1CSPA 1YZ6A 2R7ZG 4YWMA 5FLMH 1X55A 3A5UA 1X65A 1EIYB 3HKSA 3F1ZA 2K14A 1CKNA 1PA6A 3AFPA 2UXCQ 4FDBA 4JBMA 3HFZB 3JAMc 3I56A 3NELA 3JAMi 2GN5A 5J3BA 3KLWA 4DPGA 1Q8KA 3OTOL 1YIJA 2Q2TA 1KHIA 4OWTB 1NJIC 3CQZH 3F2CA 5K36G 4LF4Q 1VQ6A 4JI6L 4AIMA 3EBEA 4DUZL 4BXXG 2YTYA 2VUMG 4JI1Q 1H95A 2C35B 1KC8C 2R92G 5AJ3Q 3S1MH 4JI3L 1VQEA 4LFCQ 1RIPA 1UE7A 4H02A 4L5RC 2R7ZH 1VQAA 2B29A 4B3SL 2UXDQ 1G6PA 3FP9A 4HJ5A 4OX9Q 3A0JA 3GTOH 5IP9H 2AWOA 2F4VL 4RMFA 5GROA 4LF7Q 1HR0W 4OWXB 4BXXH 2DGYA 4JI7L 1PVOA 2Q2IA 3H3VH 1IBKQ 1XMQL 1VQJA 3H0GG 4Y52H 1SR3A 5IP7G 1PH5A 4DV5Q 3E9HA 1A8VA 3UDXA 3STBD 1PH2A 1Q81C 2KENA 1IBML 3DLLA 3F8TA 1KRTA 2A1AA 1Q1EA 2UUAL 4P74A 3PUXA 1Y1VG 2ALYB 1K3RA 4WJ4A 3M7NA 4A3MH 2PI2E 2PI2A 1X3EA 5M3MG 2AWNA 4NXNQ 2OTLA 4C3JH 5JEAG 2CQOA 4X66Q 4R4TA 1Z9FA 2K5NA 4DAMA 2YTXA 5IP7H 2LSSA 3CPWA 2JA5H 3U4VA 1Y1WG 1HNZL 1VS0A 1XJVA 1VQ4A 1CSQA 3CP0A 2N3SA 1YI2A 1HJPA 1I50H 4LF9L 2VQEQ 4LNQA 1PFSA 1N9WA 1LM0A 4O2DA 1IYJB 4LFBL 3IRBA 1SFOH 1GVPA 3OYYA 1MJEA 4B3ML 1QVCA 2UUCL 2UUBL 1WJJA 2R7DA 4JG2A 3U50C 3NEMA 3NBHB 5FJ8H 4JBJA 2E2JH 3KJPA 4LFAQ 2PQAA 2ZM6Q 5JEAJ 1TWCH 5M5XH 3PF4A 3RZOH 5JJKA 4O0AA 4C3HH 1N34Q 1Z47A 1SE8A 1SLJA 1XNQL 4IO9A 4DR5Q 2E5LQ 4MNOA 2I5HA 4AH6A 2JA7G 4LUZA 1QZHA 4LF5Q 2PQAB 2ZTDA 5C44H 3HOUG 2N78A 3W1BA 4DV4Q 4BY7G 4P73A 2ZTEA 4R4IA 4L5TA 1N36L 3PUVA 4UP8A 5E7NA 4A3FH 1LTLA 3J7ZC 4XTCS 4A3BG 3G48A 3RN2A 1UWVA 4DKAC 1J5EQ 4MZ9A 3BU2A 3VDYA 3I4MG 3ERSX 3GO5A 1IZ6A 2JA7H 4DR4L 4IPGA 1PH8A 4L5QA 4R4OA 3UDGA 2WP8J 1HNXL 2H5XA 4IPCA 4DUYL 1I6HH 4YHHQ 3PIOA 1XMOL 3PUYA 4IOAA 3UDIA 3HKZG 3K7UC 1TWFH 1OXXK 3KDFA 3T1YQ 1XPUA 3DM3A 2CWPA 1DGSA 2HHHQ 4ALPA 1AE2A 5IYCH 5IY0A 3J80c 3J80i 3I4MH 4JYAQ 2YU9H 1B8AA 3M3YH 1VQ9A 1I5FA 2Z6KC 3HOZG 4JYAL 3S15H 1HR0Q 5FLMG 2VL6A 4YWLA 2GVBA 2XTIA 2Z6KA 5LMNL 5LMUQ 4A3EH 2JEAI 4BY7H 4BBSG 1XNRQ 4WJ3M 2UXDL 4GN4B 3S14H 1VQGA 1VQDA 1IBLQ 4OX9L 4X62Q 1R9TH 2OCEA 4A75A 1X3GA 4LF6Q 4TQUS 2YTVA 2F52A 2WAQE 1B70B 4P71A 4LF7L 1VQ8A 1LYLA 3FKIH 2V1CC 4IOCA 1WFQA 3K7AH 2NN6I 2VS1A 4JI2Q 3CCRA 4GNXC 1Q86C 1M90C 2N49A 4BBSH 4DV5L 4GNXA 3CD6A 2BA0A 4DK6C 2Y0SE 3STBC 4DR6L 4X64L 3CC2A 4JC0A 5IYBH 3BJUA 5HY6A 3RLOA 4C2MH 5IP9G 5IT9c 1YHBA 1QVGA 3PO2G 1EQQA 1QZGA 1PHJA 3KF8B 1WYDA 1L2FA 3KOJA 4AQYQ 1VQ7A 4DV6Q 1WI5A 1C7YA 4GNXB 1Q1BA 5GQOA 5M3FG 1HNWL 5JJIA 3CMAA 1KL9A 4YCVA 2HIVA 4BA2I 1A63A 4PMWA 4EX5A 2CFMA 2VQFL 3CCJA 1VQ5A 1TWHH 4HIKA 2ZJRA 4JI5Q 1N32L 1CUKA 1P16A 2CKZB 3U4ZA 2I5MX 3PO2H 4A3MG 1MIUA 4X65Q 3HKZE 4RG1A 3RLNA 2Q2UA 1D8LA 1L1OC 4DV1Q 4NXMQ 4GKKL 1E3PA 4R4CA 2JA5G 1L1OA 1I3QH 4J15A 4QQBX 5M3FH 3GTJH 1FVIA 4JI4Q 1VQFA 2JE6I 2RF4A 4LFAL 3CAMA 4YY3Q 1OXTA 1TXYA 4PZ6A 2RHQB 1FJGL 1BVSA 3H3VI 3T1HQ 3PV0A 4KI0A 1N34L 5IYDG 4DV2Q 2E2IH 3CCLA 4GOPB 1N33Q 3E0EA 4JBKA 4PZ8A 2A8VA 1BBUA 1E24A 4IPHA 3W1GA 2IX1A 4A3GH 3KF6A 3CMEA 3WWVA 1L1OB 1XTDA 4DR5L 1Q82C 4B3RL 4KHPQ 4GLXA 2IY5B 5FJ8G 1X3FA 5C4JH 4QGUA 1KD1C 4JI8Q 3S2DH 3G4SA 1ASYA 4LF5L 3PUWA 4DR3L 3PIPA 2KBNA 4IFDG 4DV4L 1HZ9A 1K8GA 1I94L 3KJOA 3ULLA 5BR8Q 1K9MC 2UXBL 2EQSA 3J7A5 4P75A 1QVFA 2AHOB 1VQIA 4PG3A 4DR7L 4A3CH 2RHSB 5IYDH 3KF6B 4DV7Q 1QUQB 4DUZQ 1JT8A 2N8NA 5H1SE 3HOVG 5C44G 3JC66 5IWAQ 2KHJA 3AFQA 4JI3Q 1UE5A 2D62A 4KHZA 1VQLA 4B3TQ 4B3SQ 1AH9A 2WAQG 1NMGA 1YJ9A 2JA8G 1K83H 5C4XG 4K0KL 4QY7A 2MNAA 2IHEA 2WB1E 4BY1H 4IFDJ 5GAHC 4A3FG 3T1YL 1PH4A 2HHHL 2NZHA 2ZJPA 4A93H 4HIOA 2E8GA 4MTNA 3S1RH 1MKHA 3ICEA 2R93H 5LMNW 1AE3A 1ASZA 2IX0A 5ELOA 2Y0SG 3HOVH 2R7FA 1YBYA 3RR5A 4DK3C 1GM5A 1O7IA 3EIVA 3GD7A 1HR0L 2R6GA 4L5SA 3SGIA 3ZJYC 5LMUL 2AKWB 3TQYA 4Y7NH 1IXRA 2JA8H 2HQLA 3M4PA 2BA1A 5C4XH 1S72A 1CKOA 1HZBA 1X9NA 1LUZA 4X62L 4HIDA 1IBLL 4UY8C 1VQNA 2ATWA 5IYCG 3G6EA 1K73C 4NPSA 4HJ7A 1FL0A 2HT1A 2XGTA 3S24A 1BKBA 1J6QA 3MEFA 2MO1A 4POFA 4A3EG 3CCVA 1BBWA 1PH9A 4JI2L 3S16H 1V9PA 2F3IA 1GD7A 3NENA 2UXCL 4DV0Q 1TWAH 3I4OA 3Q8DA 2JQOA 2JJQA 4LF9Q 5GAGC 2VZAA 1NE3A 2B3GA 1PH1A 4LF4L 2K4KA 4B3MQ 1YNXA 3FKIG 4GS3A 4JI1L 1X6OA 2Z0SA 2BH8A 3CXCA 3AYHB 2UUCQ 4DV6L 5AJ3L 2JA6G 4NB3A 4LFCL 3LGJA 2NVYH 2PMZE 1FGUA 1PYBA 4OONA 4YCWA 5IYBG 4IJLA 3PF5A 1KIXA 1SN8A 1YHQA 1EFWA 3CF5A 1MJCA 4KLKA 2OQKA 2FXQA 1JJCB 2NZOA 1B7YB 1XNQQ 1UE6A 2LXKA 3HOYH 4APVA 1V43A 4P72A 1IBKL 2JA6H 1E1TA 3MXNB 1VQHA 4NXML 3CCQA 4AYBE 2VNUD 1TWGH 3TS0A 1JJ2A 4JI0Q 5GADC 1N8RC 1YJNA 4JI4L 4HJ8A 4YY3L 3UE0A 2UU9Q 4PZ7A 3GTQH 3M4OH 3PUZA 1OXVA 1XPOA 1CKMA 4DV2L 1EWIA 2AMCB 1N36Q 1N33L 4NXNL 3U58A 4DAYB 3W5OA 4X66L 1K8AC 4IPDA 3HOXH 3GTMH 1T9HA 3FHWA 3L7ZC 2WB1G 1HNXQ 3KYHC 4DUYQ 4GLAC 1YVCA 3S1NH 4DV3Q 1C9OA 1XMOQ 4R1JA 1GO3E 4DNIA 4GKJQ 5BR8L 2VQEL 2GVAA 1HZAA 4GOPC 3TEHB 4EQ5A 3I4NH 2DUDA 4LF8Q 1UEBA 2VW9A 4GOPA 2VY3A 4A3GG 5JJLA 1XPRA 2I5LX 4A3LG 4DV7L 3H15A 4A3JH 2NVXH 4XIGS 1A0IA 3CCSA 2YV5A 5IWAL 3J81c 4OWWB 3TRZA 3K0XA 3J81i 5LMNQ 1OXUA 2YYZA 2ZM6L 1NY4A 1D7QA 4POGA 1CKNB 1U0LA 4DR2Q 4JV5Q 4B3TL 1M1KC 1HH2P 3PO3G 3GTLH 1A62A 2PNHA 3A5ZB 1EOVA 2QA4A 4A3CG 3ULPA 3BZKA 1S3OA 3KFUA 4DR1Q 2E5LL 4A3LH 1QUQA 2KHIA 3CW2C 4YCUA 4QL5A 2JK8A 2VUMH 3GTPH 1Y14B 4A76A 2D0OA 2R92H 2RCNA 2QEXA 1JJGA 1X54A 2NVQH 1YJWA 3CCMA 4A3DG 3OW2A 1OTCA 1KRSA 2CWAA 1EYGA 4DR6Q 4X64Q 3G71A 2LXJA 3PO3H 4BY1G 3OTOQ 3K8AA 4QIWE 2KCMA 2EXDA 3ULJA 4A93G 3PGZA 2R93G 4JI6Q 1S40A 1J5EL 2HIXA 3S1QH 1JE5A 4A3KG 3PCOB 5C0XG 2JA9A 3HOWG 1Q12A 4YWKA 3H0GH 4ME3A 3M4QA 2ZTCA 2WFWA 3TREA 2JEBI 2K5VA 1HZCA 4UP9A 4A3DH 4YHHL 3CCEA 1HNWQ 1YHAA 1Q7YC 2D0PA 2VQFQ 4DV0L 1N32Q 1VCIA 2ID0A 4OO1G 1V1QA 3CPFA 2K5HA 5ELNA 1X56A 1Y1VH 2F4VQ 1P8LA 1VQMA 3B6YA 4AYBG 2NVTH 4JI7Q 4UP7A 4LW1A 4IFDI 4JBWA 3A74A 1XMQQ 1SRUA 4LF6L 5M3MH 5EAYA 4GKKQ 4A4IA 4A3KH 2OTJA 2KCTA 3HOWH 3CC7A 3GTKH 1YEZA 2MO0A 4HJ9A 1VQBA 1IBMQ 1XNRL 1EIFA 1G291 4X6AH 1G51A 5C0XJ 1Y1WH 2UUAQ 3S17H 3UDFA 3AEVA 1JB7A 1FJGQ 3RN5A 4BA1I 4TVAB 5C0XI 4JCVE 2E2HH 3S2HH 1YITA 1VQCA 3I7FA 3RLFA 4HJAA 3GDEA 1W3SA 4B3RQ 1E7ZA 2I0QA 3K81C 1K0RA 2ASBA 1PH3A 4UPAA 1HNZQ 4DR3Q 4OO1I 2L15A 4LUVA 2CCZA 4JI0L 2K75A 4LWCA 1I94Q 3RZDH 3TS2A 2UU9L 1Q46A 2K52A 2UXBQ 2B63G 4LFBQ 5M5YH 2A19A 4R4QA 5FLXc 3J81j 2K50A 3F2DA 3HOYG 4DR7Q 1KXLA 2IT1A 4AQYL 2UUBQ 1WCMG 2ZJQA 3I55A 5IE8A 3M9BA 5HGQA 1IL2A 3GTGH 4QJFA 3CCUA 4GN3B 3PSIA 3L0OA 3HOUH 3F2BA 2BH2A 1NMFA 3UE1A 4JI5L 1EUJA 4DV3L 4BBRG 2NN6G 4HIMA 4C3IH 2MQHA 1PH6A 1JMCA 1UE1A 3D0FA 1VQKA 4GKJL 4K0KQ 2B63H 1PH7A 4X65L 2OWOA 4LF8L 2Q2HA 5M5WH 3AQQA 1WCMH 1NTGA 3L2PA 1PV4A 4DV1L 4IJHA 2MFIA 3HOXG 4A3BH 4A3IG 4GLVB 5C3EG 3ER0A 1VQPA 1WOCA
chains in the Genus database with same CATH superfamily
2QGQA 3E6ZX 1KLGD 2IHFA 2WIIB 1STNA 1RL2A 1TS3A 2J7ZA 4BBRH 5M5XB 1QNKA 4I7ZC 1KAWA 3MZ5A 4JOIA 3RZOB 1U5KA 4LUOA 1L0WA 1W2BA 2P5ZX 3CU7A 3DWPA 1VQOA 4KHPL 1TS5A 4A3IH 5C3EH 5GAEC 4KTAA 2K04A 1OXSC 3HOZH 2SNSA 4YWMA 5FLMH 3HOVB 1X65A 1HA6A 1CKNA 1DJRD 1SNPA 2A73B 3AFPA 3QIAA 3VYSA 1BDOA 2IWHA 5J3BA 1YIJA 2J0TD 5C4XB 4BXXG 4AIMA 2YTYA 2VUMG 1H95A 3X3NA 1KC8C 4J1MA 3C3LA 2R92G 5AJ3Q 3S1MH 1VQEA 2DJGC 1VQAA 1AEXA 2MPMA 3FP9A 4HJ5A 2L1BA 4OX9Q 1FNUA 4DA2A 3A0JA 3URYA 2AWOA 5ELBA 2F4VL 1U4MA 2K28A 1EY8A 1K3BC 4LF7Q 4BXXH 5EKKA 1PVOA 1XMQL 1VQJA 2YU9B 1I4RA 1PH5A 3M3YB 1A8VA 1STAA 2K5QA 1KTKA 1PZJD 1Q1EA 2UUAL 2KUMA 4V0BA 2ALYB 3M7NA 2BDOA 4JPBW 2PI2E 5I9PA 4NXNQ 2OTLA 2CQOA 1GUWA 2K5NA 3FKIB 1PYWD 5I9OA 1K8OA 1O7ZA 3EQLC 2HD3A 4B08A 1KABA 4N8X1 1N9WA 4O2DA 2B8FA 3IRBA 1SFOH 1GVPA 2NTTA 3OYYA 2UUBL 2R7DA 3TSSA 1JORA 4JBJA 4LFAQ 2PQAA 2DY7A 1RDPD 1F77A 1E2VA 2Z6BA 1E2WA 3V96A 1SNOA 1Z47A 2EYFA 2M9VA 2JA7G 1JC7A 4G57A 3HOUG 1HQMC 2N78A 4L63B 4G7HC 3GTJB 4BY7G 1CZWA 1Y8PB 4P73A 2ZTEA 5C3WA 1RTOA 4A3FH 4XTCS 3G48A 3RN2A 3I4MG 1WTQA 2NTSA 3GO5A 2JA7H 4A3GB 2QF7A 4IPGA 2B2YC 5C4JB 1HNXL 3DMUA 3BYTB 4DUYL 3S2DB 4XYOA 3MTSA 4YHHQ 1BF4A 3SEBA 3K5LA 3HKZG 3KDFA 1LTBD 3SXHA 3I4MH 3D4RA 1VQ9A 5CV6A 4JYAL 1ZKOA 4A3EH 2Z6KA 3DM1A 1SNCA 1U4PA 3SDZA 5IGDA 4WJ3M 4GN4B 3S14H 1DXMA 1EL0A 3H6MA 4TQUS 2F52A 1B70B 4KKSA 3J81E 2DY8A 4A93B 3S1RB 4JI2Q 2VS1A 5ELEA 2PMZB 2BA0A 2O2LD 4DK6C 4PNYA 3BJUA 2L12A 3RLOA 4RFBA 2ENBA 1QVGA 3VR2A 3PO2G 1S5FD 1WTXA 1QZGA 2EY6A 1WYDA 1L2FA 2LY7A 3KF8B 4AQYQ 1LTID 5LHY1 4DV6Q 1C7YA 2BE5C 5JJIA 1KL9A 1U4LA 4BA2I 1A63A 1JQYD 4PMWA 1TWHH 2ZJRA 4JI5Q 3PO2H 2EYHA 1MIUA 3IFTA 1D8LA 1TU2B 1L1OC 4NDXA 1HFNA 1E3PA 2JA5G 1TS2A 1EIGA 2EVBA 1CQFA 2BDNA 4YY3Q 1EY6A 1HA5A 3FDTA 2EOTA 1BVSA 1H9SA 1FJGL 3MXPA 1N34L 5I2XA 4DV2Q 3CCLA 2A8VA 4PZ8A 1ENCA 1W6JA 1BBUA 5CBEE 3KF6A 3CMEA 2EYLA 1L1OB 4DR5L 1Q82C 3HOYB 2IY5B 5FJ8G 1X3FA 4JI8Q 4M1UB 3NBHA 3Q0AA 4LF5L 2KBNA 4FF4A 1TWGB 2PCFB 4LMQD 1TT2A 2E76C 2UXBL 3J7A5 4DR7L 3M4OB 4A3CH 1SAPA 4NMZA 1R4PB 3KLRA 4CDFC 2N8NA 3G7LA 4H7BA 2WACA 3JC66 3AFQA 2X6LA 1WD0A 4B3SQ 4R8IA 5FLXE 4EGVA 4FF1A 1K83H 1NSNS 4QIWB 3S1NB 2MNAA 2IHEA 4DU9A 4IFDJ 3T1YL 2F0PA 2HHHL 3OIPA 4HIOA 4O1NA 2EJGC 4KHVA 1HTPA 2IX0A 2R7FA 1YBYA 4DK3C 2G9HD 1BR9A 3PMFA 3S1MB 1X9NA 3HG9A 4ZAIA 3G6EA 1QOHA 3GTLB 4FVMA 2V4DA 2HT1A 3KBXA 4QUFA 3DUZA 1AN8A 1QWYA 2MO1A 4POFA 2XWJB 3T4AC 2VUMB 3EA6A 1STGA 2R92B 2X69A 4RGMA 3RUZA 3WOFA 4DV0Q 1LTGD 1H9MA 3P20A 4IZ8A 1LTAD 1MSGA 5GAGC 2B3GA 2EYPA 1V8QA 3FEWX 4B3MQ 5EPJA 1YNXA 4P2CB 2UUCQ 2BH8A 3BYYB 5AJ3L 2NVYH 4EQOA 4F87A 3JAME 2PMZE 5ELCA 5KRUA 1D1IA 4OONA 5BN3A 1TS4A 1MJCA 1EZ6A 2O5IC 3A8JE 1PZKD 1JJCB 4KN7C 1STHA 1UE6A 4APVA 1LO5D 4NXML 3CCQA 5HGTA 1D5XC 2VNUD 3TS0A 5GADC 4FXGC 3GTKB 1WTHA 3UE0A 2B2VC 5C4HA 3S17B 1TKWB 1CZGA 2EY2A 1N36Q 1I4QA 4NXNL 2AUJD 3NBIA 5I4DA 1SNDA 5FKAC 3K57A 3GTMH 2ICEC 2Z8LA 3L7ZC 4C56C 4WRDA 4DV3Q 1PTOD 4GKJQ 1DD2A 3TEHB 3I4NH 2DUDA 4LF8Q 4GOPA 2VY3A 1XPRA 4A3LG 5M5YB 3KLSA 2CH4W 3Q6SA 4KKTA 5D3DA 2YV5A 1RHPA 3J81i 3GTGB 4B3TL 1S5BD 4HSPA 3HOUB 5DM63 4BY7B 3ULPA 4A3LH 4HCEA 4I65A 2EJMA 2K5DA 3DWQA 2F03A 3GTPH 1Y14B 1NCVA 2D0OA 2QEXA 3I4MB 4FO2A 3CCMA 2LFNA 1OTCA 1KRSA 1JWMD 4K5VA 1YNJC 3LNNA 1SMYC 3G71A 2LXJA 1LTTD 1X3PA 4QIWE 2Q8TA 3S14B 1KDBA 2MP1A 2R93G 5J22A 3HKZB 4RHRA 4KY5A 3S1QH 1CK1A 1YNND 2JA9A 2BE5D 3SK5A 3BVGA 4ZKBB 2MUYA 2NB0A 3M4QA 2WFWA 3PIP3 2JEBI 4ZUIA 1HZCA 4YHHL 3CCEA 3BS1A 1N32Q 4KK7A 1V1QA 2WINB 2RSOA 2K01A 2F4VQ 1P8LA 1QNUA 1VQMA 4AYBG 2FJ2A 4IFDI 3A74A 1XMQQ 4DAPA 4GKKQ 2OTJA 2F0SA 2E2DC 3H3VC 1DCZA 5TSSA 5C0XJ 1RODA 2VXWA 1Y1WH 2UUAQ 3J80E 1JB7A 3SVMA 4TVAB 4JCVE 4TRDA 3S2HH 1YITA 1VDZA 2OF1A 1VQCA 1W3SA 1ZXTA 1SYBA 5CV8A 2DNCA 1K0RA 4UPAA 4F8MA 5IIFA 1BCPC 4DR3Q 4LUVA 1TY2A 2M00A 1ILQA 4LK1C 3TS2A 1XX8A 1Q46A 1CQVA 4FXDA 2A19A 3F2DA 1A3TA 2SEBD 4AQYL 2UUBQ 2ZJQA 5HGQA 1CI3M 3PSIA 3L0OA 2JA5B 1GUSA 2HDLA 2BH2A 5T1IA 4JI5L 4HIMA 1JWSD 4K0KQ 2HQEA 1PH7A 2Q2HA 4UDUC 2AQ1B 3L2PA 1NTGA 1WTPA 5IGCA 2SNMA 4XT1B 1S5CD 1HHVA 1ZEQX 1NBWA 5E3FA 3T53B 2E75C 2E2JB 2OQ0A 4JV5L 3HP3A 3I2ZA 4GN5A 2KQ3A 3EN2A 3D31A 1E22A 4RGNA 2EIFA 3K80C 3CC4A 1SE4A 3BZCA 3E9IA 3TP8A 1RTNA 5JAVA 1SMXA 4JI8L 3BVMA 2DNEA 4FF3A 3T56B 4K8IA 2R7ZG 1X55A 4OIKA 1EQTA 1E0BA 1EEID 3F1ZA 3I90A 4FDBA 3NELA 3JAMi 2GN5A 4DPGA 3OTOL 3E0JA 4RKBA 1WTVA 2Q2TA 4OWTB 5K36G 3CQZH 1XXGA 2RSNA 1VQ6A 3EBEA 1DOLA 4JI1Q 2KVMA 4ME5A 1UE7A 2R7ZH 3BDCA 4Q0FA 4B3SL 2JXMB 1J8IA 1I6HB 1RJTA 4QB4A 1TWFB 1ICFB 4OWXB 2Q2IA 1EY7A 3E9HA 2N55A 2WV6D 3GP7A 3STBD 2XN9C 5EGTA 3S15B 4KY7A 2NVYB 3K5MA 2A1AA 2D5DA 4FXKC 4P74A 2A69C 1K3RA 3AU7A 1XTCD 3J7YW 1GUTA 2AWNA 1ET9A 2O4XA 4C3JH 1JCKB 4R4TA 1Z9FA 4YIJA 2LSSA 3K7AB 2NWGA 1VS0A 1VQ4A 4BBSB 4F7XA 1GHKA 1YI2A 1LM0A 4C2MB 2AQ2B 3KUPA 4B3ML 1HPCA 1QVCA 2UUCL 1SEBD 1C8CA 4JG2A 3U50C 3NEMA 3J7AF 5IT9L 3EJIA 4G7ZC 5JEAJ 2M2LA 1XWEA 4IFDH 2QDBA 1PTOH 1RD9D 2B2WC 5JJKA 4C3HH 1N34Q 3NXWA 1LABA 1SLJA 4DR5Q 1EEFD 2I5HA 4AH6A 4LUZA 4G7OC 4LF5Q 2ZTDA 5C44H 3W1BA 1ESRA 1SXTA 1YNJD 2JP1A 4R4IA 5ISRA 1N36L 5E7NA 1PTOF 1U9RA 2MGSA 3D8GA 4DN4M 4A3BG 2E2IB 4MZ9A 1NR4A 1PRTC 4IN3A 3UDGA 2WP8J 2B2YA 2H5XA 3ERQA 3GTPB 3PIOA 3PUYA 4IOAA 1DYQA 1OXXK 3T1YQ 1XPUA 1I4XA 3DM3A 1DGSA 2HHHQ 4ALPA 5D14A 5IYCH 1TY0A 2XWBB 3J80i 2F0LA 1II3A 3HOZG 3WDNA 3OMGA 5FLMG 2JEAI 1ZYRD 2F0NA 4HTHA 3NE5B 5D3IB 3R8BA 1R9TH 4OGQC 4HR7B 1LYLA 2V1CC 2R93B 1WFQA 2QEJC 2NN6I 4GNXC 1M90C 2N49A 1V1PB 4ZUJA 1Y8NB 4DV5L 3CD6A 1A6XA 4PQXA 4XQQA 5IYBH 4FP5D 5IT9c 4XQNA 4Y7NB 1YHBA 4HN7A 1STBA 1EQQA 1EYDA 1PHJA 4IUTA 2NVTB 2K5WA 2GA4B 1WI5A 4AYBB 3S2HB 4GNXB 1Q1BA 3NPPA 5M3FG 3R93A 2F0FA 3S16B 1N32L 1LT5D 2A74C 2KCNA 1TWAB 5AFWA 2CKZB 3U4ZA 2I5MX 3I70A 4X65Q 4RG1A 2PW5A 1SNMA 3RLNA 5J1ZA 3OWEB 2F0DA 2B2TA 4DV1Q 1I6VC 4NXMQ 4R4CA 4GKKL 1L1OA 5IODA 1I3QH 5M3FH 1FVIA 2CW0C 4PZ6A 3A55A 2RHQB 1S5DD 2KJXA 3H3VI 5CV7A 3T1HQ 1KNEA 3M4YA 1E24A 3W1GA 1XTDA 3BVZA 2WKDA 1TVXA 2F3WA 1BXTA 1ASYA 4DR3L 3L9AX 4WJWA 2EYMA 4KJNA 3V05A 4DV4L 5LL6S 4Z9CB 2K1BA 2NBFA 4P75A 2AHOB 5KNBA 1QUQB 3I4LA 4DUZQ 1JR0D 4JI3Q 2EDGA 2EYJA 4B3TQ 1AH9A 1PXUA 2WAQG 5IGBA 1YJ9A 2JA8G 4K0KL 4BY1H 5GAHC 4A3FG 3J7AV 5C5MA 2E8GA 5LMNW 1ASZA 2Y0SG 4HMJA 3OHXC 2IL8A 1O7IA 5C0XH 2NVXB 2R6GA 3MFYA 4QMGA 3SGIA 1FYCA 2AKWB 2QW7A 3CHBD 3TQYA 2JA8H 2HQLA 1S72A 2A69D 1HZBA 2F1MA 4X62L 4HIDA 1IBLL 4UY8C 4OO1H 4RA8A 1K73C 1F9RA 4XT3B 1FL0A 1I4GA 3MC0B 1BKBA 1H9RA 3LWEA 4A3EG 3CCVA 4KY6A 3NQTA 3NENA 3Q8DA 5FK9C 1C48A 3U9OA 2PW7A 2VZAA 3PO3B 4B9XA 1G6ZA 4HMIA 4JI1L 1X6OA 2JA6G 1AZQA 4NB3A 3VR4A 4ILWA 1FGUA 1PYBA 4IJLA 3PF5A 4MTKA 1KIXA 1SN8A 4CDDC 1YHQA 1EFWA 1DM0B 4RKLA 1NNXA 4KLKA 3SE0A 1XNQQ 2F4IA 2PYKA 1V43A 2JA6H 5M9OA 3MXNB 3ITPA 4AYBE 3HOWB 3U9SA 1L0XB 1N8RC 4JI4L 4C1NK 4UAIA 3GTQH 2F0HA 2B2VA 2HDMA 5KNCA 4CJ2C 1PTOB 3QOJA 2AMCB 3U58A 3VYUA 1DONA 2E2HB 3W5OA 1K8AC 4X3KA 1PRTD 3HOXH 1MD2D 1VF7A 3I91A 2WB1G 3FRPB 1XMOQ 1C9OA 1H9KA 4R1JA 1GO3E 4DNIA 4RCNA 2PZWA 3RZDB 4KN4C 4IURA 2I5LX 1Q3LA 4PMBA 4A3JH 2RQXA 3CCSA 3J81c 3TRZA 3K0XA 1T5XD 1SNQA 1NY4A 2PPBC 1CKNB 1U0LA 4JV5Q 1GUGA 1EY4A 1IYVA 3I8ZA 3D6CA 1A62A 2PNHA 4R8NA 2QA4A 4A3CG 1EYAA 1PFNA 1ESFA 1S3OA 2B63B 3KFUA 1WCMB 4QL5A 4A3BB 2NVQH 1YJWA 4A3DG 1A3VA 3OW2A 1EYGA 2CWAA 5D65A 4DR6Q 2ZXOA 3OTOQ 1BQQT 2NYZD 2LMCB 3H09A 2EXDA 3OIQA 5NUCA 3ULJA 4BBRB 3G6JB 3PGZA 2O5JC 3IL8A 4A3KG 3PCOB 2RDHA 3H0GH 3UDXA 3FMCA 4A3IB 5C3EB 1HNWQ 3DWAA 4UP9A 4A3DH 1HUMA 3HOZB 4EQNA 4U673 1XYIA 1Q7YC 3IAYA 2D0PA 1VCIA 4MIUA 1JWUD 2K5HA 5ELNA 1Y1VH 1IYUA 2ZT9C 1F2LA 4LW1A 2I07B 4LF6L 5M3MH 2F0MA 4A3KH 3JAML 1WVLA 1YEZA 3Q23A 1EIFA 3CRLC 3UI2A 5CGKA 1G2TA 2Z9HA 1T5EA 4XYQA 4ZYSA 4ID6A 2OT2A 1CTMA 4L6TB 3FVQA 3I7FA 4B3RQ 2XRSD 2EXZA 1B9NA 1LLRD 2N88A 1PH3A 2K75A 4LWCA 5DEHA 1I94Q 4G4KA 1AP0A 2UU9L 2K52A 5FLXc 1KXLA 2C5CA 2F0JA 2IJ0A 1QILA 3MA2B 5IE8A 2CH4A 2J4XA 1NMFA 3UE1A 1JMCA 2QCPX 4C3IH 2MQHA 1SYEA 3D0FA 1UNSA 5CV9A 4X65L 5M5WH 4DV1L 1SFOB 4IJHA 2FMMA 2K32A 4K5WA 5IGGA 4DAYA 1K0SA 3I73A 2QILA 2FHTA 2HCIA 2TSSA 2ZXRA 1K8MA 4OXPA 4DR2L 5DLQE 1EQRA 1FGBD 1E1OA 3KDFB 3VR3A 3T1HL 3I4NG 4H13C 1UAPA 1PYSB 2RDFA 1C0AA 3M85A 1GKHA 2ES2A 4DR1L 2KOLA 2BCOA 5KYLA 5I6WA 3A56A 1BUVT 3A7LA 4DNRB 1YZ6A 4H44C 3A5UA 1EIYB 2LS01 3HKSA 3OMCA 3HFZB 3JAMc 3I56A 3VYRA 1Q8KA 2Z4HA 3H91A 1U4RA 2D2CC 1EU3A 2WAQB 4LF4Q 2ZXPA 4JI6L 4DUZL 3ONAB 4A3FB 2C35B 1FNWA 4JI3L 4H02A 1Z6HA 2JA7B 4L5RC 3VYTA 1JE4A 2B29A 2Y0SB 1G6PA 2IPKD 2C9OA 5CORA 4KJOA 5IP9H 3GTOH 4RMFA 4ZQ3A 1HR0W 2B8GA 4JI7L 4QUCA 3ZYYX 1L0YB 3F2UA 4U68A 3K58A 1SYFA 4DV5Q 1B2TA 1GUOA 1PH2A 3QG1A 1Q81C 2KENA 1D1KA 4A3EB 1IBML 1CHQD 1O80A 1KRTA 5EJWA 3J80L 4WJ4A 1PFBA 5C5LA 4DFAA 4A3MH 2PI2A 2OEOA 1HUNA 5KEEA 4X66Q 4DAMA 4PV1C 1Y1WG 1HNZL 3CP0A 4XDXA 1O78A 4ODGA 1HJPA 1I50H 4LNQA 1IHZA 4Q5VA 1B50A 4BS9A 1MJEA 3P75A 4UHVA 4OL7A 1WJJA 4KD3A 2EPBA 2LKVA 3SR1A 3TZDA 3OSOA 5CV4A 3NBHB 3T16A 2MHVA 3KJPA 4ZK9B 3A7AB 4DF7A 1F9SA 1TWCH 5M5XH 3PF4A 4RGOS 4EQPA 3RZOH 1G8ZD 4O0AA 4V190 5IGFA 2B2WA 1TWHB 1CFMA 2F0UA 1XNQL 3PO2B 4MNOA 2KECA 1QZHA 5KNDA 3E5SA 4XXEA 2PZTA 4DXGA 4DV4Q 2EJFC 4ZRZA 5ELFA 2EE1A 2WB1B 3VA7A 3BDLA 1PDQA 4L5TA 2JYOA 3PUVA 4XQJA 1LTLA 5JOBA 3J7ZC 1SSOA 2XRQD 1X3QA 1D5ZC 3R2TA 4JVZA 3ERSX 2E74C 1IZ6A 2CQAA 1PH8A 4DR4L 4L5QA 1PZID 4R4OA 2KEEA 2PO4A 4IPCA 1FD7D 1XMOL 2A6EC 2NVQB 1EY0A 3C1EA 5F2DA 4RHSA 4HSVA 1AE2A 2A68C 5IY0A 2CHBD 3J80c 4QF4A 2YU9H 3M3YH 3EFXD 3QOLA 1EIHA 2VL6A 4YWLA 2GVBA 5CBAE 3MHBA 1XNRQ 2UXDL 4OEMB 1VQGA 1IBLQ 4X62Q 4A3DB 2OCEA 3D4DA 2L5TA 5A2QE 4MHEA 1K83B 2FMCA 2YTVA 2WAQE 4RGTA 3BDOA 1MHWC 3FKIH 4IOCA 1Q86C 1HRJA 1IKLA 1WTRA 4EVOA 4GNXA 2L0CA 4DR6L 2Y0SE 1TQOA 2XVSA 4ZLTF 1Y8OB 1S5ED 3KOJA 3KBGA 3QJYA 5COYA 3HS0C 4DK1A 5FO8B 5GQOA 4C1NI 1HNWL 3K0YA 4YCVA 4EX5A 2CFMA 3CCJA 1VQ5A 2F0VA 1MI2A 3NSWA 3HKZE 1F9PA 2EY1A 2Q2UA 4C3JG 1C4QA 3M7GA 3GTJH 3OPOA 4JI4Q 2RF4A 4DK0A 3CAMA 1OXTA 3E3XA 2X6GA 5IYDG 4GOPB 3P7JA 4IPHA 4L8JA 2JSOA 4A3GH 3WWVA 4B3RL 4GLXA 5C4JH 2DN8A 4QGUA 1KD1C 3S2DH 3G4SA 3PUWA 3PIPA 3ND8A 4IFDG 1HZ9A 1I94L 4C3HG 3ULLA 2EQSA 1QVFA 1VQIA 5IYDH 2RHSB 2BOSA 3S9WA 1JT8A 5C44G 2KHJA 2WKCA 1UE5A 2D62A 3EROA 4KHZA 1D6EC 4IUNA 3GTMB 3OWFA 4CJ0B 4RCOA 1A15A 1Z7TA 2K33A 2PQEA 1KDCA 1EQVA 4K6LA 4QY7A 4DGZA 2WB1E 5ELDA 1LT3D 5DNFA 1PH4A 4A93H 2NZHA 2ZJPA 4MTNA 3S1RH 3I4NB 3MXUA 3O13A 3MEHA 5ELOA 3VA5A 1BOSA 1HR0L 3EIVA 2R3ZA 5G3LD 5LMUL 1SMYD 3IFDA 1IXRA 3M4PA 3TN2A 1LUZA 3RMHA 5IYCG 4HJ7A 3S24A 2B2UC 1J6QA 4MN3A 1D5MC 4ZCKA 1PH9A 2VB3X 2L9HA 1NR2A 2NZ1D 5CYUA 1V9PA 1GD7A 2Q8IB 1RKNA 2G9DA 2F3VA 2JJQA 4LF9Q 2PNRC 1IL8A 3MFGA 4LF4L 3OW7A 2FINB 2H4OA 2K4KA 3CXCA 4LF6Q 3LGJA 3S1QB 1JOQA 4K8JA 1O7YA 5BN5A 1LACA 5IYBG 3CF5A 5CV5A 5JVH3 1JICA 1I4HA 5DAUA 2FXQA 1B7YB 3HOYH 3KF8A 4PMCA 4P72A 1E1TA 3BG3A 1BCPD 1TWGH 3FPUB 1YJNA 4J8QA 2UU9Q 2XSCA 3NK9A 5EQ0A 3K59A 2RA4A 3M4OH 1Y1WB 1TWCB 3PUZA 1CKMA 1JOOA 3VR5A 1VF5C 4CDEC 1EWIA 1N33L 4CJ1B 5IGEA 4X66L 3TP7A 1WTOA 2XNAC 1GHJA 1EU4A 3FHWA 4GLAC 2FFKB 1YVCA 3S1NH 2A6ED 1MSHA 5BR8L 1SBBB 2A68D 4DXFA 4DV7L 1E2ZA 3T13A 4XIGS 1A0IA 1M4VA 1PLFA 5IWAL 4OWWB 5JPMC 5LMNQ 3K5OA 1D7QA 4IUPA 1O7LA 4DR2Q 3WOEA 1G91A 1HH2P 1BO0A 3GTLH 3OOCA 4BWGB 4X3TA 4I7AA 2AQ3B 4K2LA 5EPLA 4DR1Q 3LX0A 4YCUA 2JK8A 2EY5A 2CVRA 2VUMH 2R92H 1B9MA 2A5HA 4X64Q 4N8FA 1SJHD 4BY1G 3K8AA 5FO9B 1Q90A 2KCMA 4E6IA 2HCCA 3L3OC 3W3AA 4JI6Q 1S40A 5C0XG 1Q12A 5IOCA 2K5VA 1PMRA 5L37A 1YHAA 4HCSA 2VQFQ 4K2KA 1M8AA 4OO1G 2H1EA 3CPFA 4F88A 5JVG3 1X56A 3KK7A 4JI7Q 4UP7A 4JBWA 3CQZB 1SJED 4A4IA 2KCTA 3CC7A 3GTKH 2MO0A 4HJ9A 2TMPA 1IBMQ 1XNRL 3FPPA 2R7ZB 3S17H 3UDFA 3J81L 4IUQA 3RLFA 2K7VA 2SOBA 4HJAA 3GDEA 3NUCA 1E7ZA 2I0QA 5BN4A 4CGYB 2A6HC 4NP5A 1GOZA 1HNZQ 2VB2X 2L15A 4JI0L 5E4WC 1ICWA 5EKIA 5M5YH 3J81j 2IT1A 1ET6A 1MGSA 1GUNA 4K6DA 1QJOA 1W6KA 3I55A 3MVVA 3I72A 5J39A 3M9BA 1EFID 1ILPA 3GTGH 5C4ZA 4C3JB 3CCUA 1TIID 3HOUH 4N9TA 2Z4IA 4BY7H 2NN6G 1V1OA 1UE1A 1PTOC 5CR3A 3AQQA 1SYCA 2K6AA 3W2DA 2MFIA 3HOXG 2RBMA 3GV3A 4IQZA 1VMPA 1LTSD 4JOIC 2NN6H 1CM9A 3DEPA 4C3HB 1B44D 1HCZA 1KQSA 4A3JG 5T1GA 3RNUA 4DR4Q 2K05A 3QR8A 1F2YA 1SROA 1OO9B 1CSPA 4CHTB 5C44B 1PA6A 2K14A 2UXCQ 4JBMA 3KLWA 1KHIA 1NJIC 3F2CA 3GV6A 4J6HA 4IUVA 1KLUD 2RKSA 1Y69U 4LFCQ 1CA5A 1RIPA 1YNNC 2L55A 3NTIA 5FLXL 2UXDQ 2ICIA 1QE6A 3QO2A 2QKIC 5G3LF 3DHQA 5GROA 2B2TC 2DGYA 1CT1D 5KGUA 3H3VH 1IBKQ 3H0GG 4X3SA 4Y52H 1SR3A 5IP7G 1B1ZA 4WFN3 3IKJA 3DLLA 3F8TA 1LTRD 5KYIA 3PUXA 1Y1VG 5JJZA 1R9TB 2SDFA 3K5NA 1X3EA 5M3MG 1GXDC 5JEAG 1ENAA 2JA5H 2YTXA 5IP7H 3CPWA 3U4VA 5K5PA 1XJVA 5DM73 1CSQA 2F0EA 2N3SA 4O42A 1ML0D 4LF9L 2VQEQ 1PFSA 1IYJB 4LFBL 3A54A 3QWNA 5JEAH 1EY9A 5FJ8H 2E2JH 2ZM6Q 1G2SA 2CW0D 1BCPF 1K28A 1SE8A 3V2TA 5KIXA 4IO9A 5JPNC 2E5LQ 2I46A 4K5XA 2PQAB 1I3QB 5M3FB 4C3IG 2IX3A 3QB3A 1B3QA 4UP8A 3A8IE 2KCCA 1J5EQ 1UWVA 4DKAC 3BU2A 3VDYA 2Z1CA 3TP5A 2KEDA 1I6HH 3D6WA 3TMEA 2RCFA 2RVLA 3T51B 3CKIB 3UDIA 4CKCA 3DXJC 1TWFH 3K7UC 2CWPA 3HEJA 4KKUA 3N52A 3TBIB 1B8AA 3C2PA 1I5FA 1SYGA 2Z6KC 3S15H 1HR0Q 1LV9A 5LMNL 2XTIA 5LMUQ 4BBSG 1F2ZA 1WTWA 4JK1C 4H0LC 4CKBA 1WD1A 1SDFA 1VQDA 4OX9L 4A75A 2F0GA 1X3GA 4OIJA 4P71A 4BY1B 4LF7L 3C46A 1VQ8A 4IUUA 4RH6A 3K7AH 3CCRA 4DNTB 2A6HD 2F0QA 4BBSH 5LL6X 4JW0A 3STBC 4X64L 3CC2A 4JC0A 5HY6A 3K6OA 4C2MH 5IP9G 3KLSX 1X32A 2JA8B 4LJZC 3NP8A 1R4QB 3NWTA 1VQ7A 1STEA 4LAAA 3BZDB 1QG7A 2EZVA 3CMAA 1F2MA 4GZYC 2HIVA 2VQFL 1B3AA 4HIKA 1CUKA 1P16A 4A3MG 4S3SA 1NAPA 3TDQA 3VR6A 1ONLA 1QB5D 2QDLA 1IW7C 4KD4A 4FYDA 4J15A 4QQBX 1LT4D 3C1FA 1AFPA 1VQFA 2JE6I 4LFAL 4R9WA 4KV6A 1TXYA 2AUKA 3LWUA 3PV0A 4KI0A 2E2IH 1N33Q 3E0EA 4JBKA 4ABNA 2IX1A 4KHPQ 4B9WA 5E1FA 4KMUC 2JA6B 4ZKCB 1S4ZA 2PZUA 4TSSA 1K8GA 1H9SB 1B4OA 3KJOA 3A8KE 5BR8Q 1K9MC 1A2UA 1A3UA 5FO7B 4NKLA 3GTQB 4PG3A 4N9PA 1EOTA 3KF6B 2NUCA 3MWYW 4DV7Q 3NHHA 5H1SE 3HOVG 5IWAQ 1J9OA 1VQLA 1EWCA 3HOXB 5HURA 1NMGA 2XIWA 5C4XG 2MJ8A 4CDCC 3MAQA 3ICEA 1MKHA 2L4NA 2R93H 1AE3A 4RAUC 3P1HA 2B39A 3HOVH 3RR5A 5CMDA 1GM5A 3GD7A 3R3OA 1DOMA 1SE3A 3AB9A 1PRTF 4CBVA 4A3JB 4L5SA 3ZJYC 1ZYRC 2K03A 4Y7NH 1EWHA 3MXGA 2BA1A 5C4XH 1CKOA 1VQNA 3SK8A 3H94A 5A2QL 2ATWA 2NVTH 5EBDA 2JN4A 4NPSA 2XGTA 3AMUA 4K14A 3X3MA 1F9QA 1I4PA 2F0KA 3MEFA 1MBYA 2B2UA 1BBWA 4JI2L 1AZPA 3S16H 2F3IA 4OELB 2UXCL 1TWAH 4CKEA 3I4OA 2JQOA 3N6RA 3HGBA 1LT6D 1NE3A 1PH1A 3FKIG 4GS3A 1FR3A 2Z0SA 1HXYD 3AYHB 4DV6L 4LFCL 1JOKA 1VMCA 3EVQA 1V1PA 4YCWA 3H0GB 1HFGA 3PIO3 1BCPB 1QCBD 1UEAB 2F0OA 4FF2A 1PFMA 1DOKA 1A2TA 3GQBA 2OQKA 2NZOA 1GJXA 1Y1VB 2LXKA 1JB3A 1IBKL 1VQHA 3DEOA 5M3MB 4M8AA 4A3KB 1JJ2A 4JI0Q 4RWSC 2L11A 4HJ8A 4YY3L 4PZ7A 1DZ1A 1XPOA 1OXVA 4DV2L 1H9JA 2IW3A 1RF2D 4DAYB 2Q8RE 4IPDA 3TP6A 5FOBB 1BNZA 1T9HA 5EBCA 1HQRD 2DJFC 3RD4A 1HNXQ 3KYHC 4DUYQ 1STYA 3TZUA 2VQEL 2GVAA 1HZAA 4GOPC 4EQ5A 4TKOB 2R61A 1UEBA 2VW9A 1NUCA 4A3GG 5JJLA 3H15A 2NVXH 3SK6A 4JYAQ 2KA7A 3NWSA 1OXUA 2YYZA 5A35A 2ZM6L 4POGA 1EYCA 3Q24A 1M1KC 5EPKA 3PO3G 3A5ZB 1EOVA 1TR5A 4C3IB 2OXPA 3BZKA 4X3UA 1CA6A 2E5LL 5K36H 1QUQA 2KHIA 5M5WB 3CW2C 1SYDA 3HZXA 4FNFA 4A76A 1JJGA 2RCNA 1X54A 2G5DA 5CC4A 4IALA 3Q22A 3PO3H 1FNVA 4A93G 1B53A 1KDAA 3PQIA 1J5EL 2HIXA 2F0WA 1JE5A 4OHJA 1SE2A 1Q8IA 3HOWG 3D4WA 4YWKA 4ME3A 3TREA 2ZTCA 5E4XA 1ENFA 1EZ8A 4DV0L 2ID0A 1RCVD 1CHPD 3B6YA 1SRUA 1IW7D 4HEDA 5EAYA 1HTLD 2EYOA 3I3CA 4NW2A 3HOWH 1VQBA 1G291 4X6AH 1G51A 2KHSA 3SHLA 1BBXC 5I2YA 1AW7A 5EKLA 3ND9A 3AEVA 3NQIA 1FJGQ 3RN5A 3NTHA 4BA1I 1KNAA 5C0XI 4DAVA 2F0IA 2E2HH 3GTOB 3K81C 2D9UA 2ASBA 4OO1I 2CCZA 1EY5A 5C3XA 1IKMA 3RZDH 4QCLA 2UXBQ 2F0TA 4HAEA 2B63G 4LFBQ 4R4QA 4DR7Q 3HOYG 2K50A 4ULLA 5C6AA 1WCMG 4A3MB 1D2BA 3HRZC 3MXNA 1IL2A 1KAAA 2RDGA 4QJFA 5IT9E 4GN3B 3NTKA 3F2BA 3D3RA 4DV3L 1EUJA 1UUPA 4BBRG 3SK4A 1PH6A 4GKJL 1VQKA 3R2IA 2B63H 1I50B 2HUGA 2OWOA 4LF8L 1WCMH 1PV4A 5I6YA 4A3BH 4A3IG 4GLVB 4WORA 5C3EG 3CRKC 3ER0A 1VQPA 1WOCA 1PRTB
chains in the Genus database with same CATH topology
2QGQA 1NBWA 4OXPA 2IHFA 2OQ0A 5DLQE 4DR2L 1EQRA 4JV5L 1RL2A 4JOIC 4BBRH 1E1OA 3KDFB 3T1HL 3I4NG 3I2ZA 1KAWA 4GN5A 1PYSB 4JOIA 3EN2A 3D31A 1E22A 1U5KA 4LUOA 2EIFA 1L0WA 1C0AA 1KQSA 3K80C 3M85A 1GKHA 1W2BA 2ES2A 4A3JG 3CC4A 4DR1L 3BZCA 3E9IA 1VQOA 3RNUA 4KHPL 4DR4Q 4A3IH 5C3EH 1SMXA 5GAEC 4JI8L 1OXSC 3HOZH 1SROA 1CSPA 1YZ6A 2R7ZG 4YWMA 5FLMH 1X55A 3A5UA 1X65A 1EIYB 3HKSA 3F1ZA 2K14A 1CKNA 1PA6A 3AFPA 2UXCQ 4FDBA 4JBMA 3HFZB 3JAMc 3I56A 3NELA 3JAMi 2GN5A 5J3BA 3KLWA 4DPGA 1Q8KA 3OTOL 1YIJA 2Q2TA 1KHIA 4OWTB 1NJIC 3CQZH 3F2CA 5K36G 4LF4Q 1VQ6A 4JI6L 4AIMA 3EBEA 4DUZL 4BXXG 2YTYA 2VUMG 4JI1Q 1H95A 2C35B 1KC8C 2R92G 5AJ3Q 3S1MH 4JI3L 1VQEA 4LFCQ 1RIPA 1UE7A 4H02A 4L5RC 2R7ZH 1VQAA 2B29A 4B3SL 2UXDQ 1G6PA 3FP9A 4HJ5A 4OX9Q 3A0JA 3GTOH 5IP9H 2AWOA 2F4VL 4RMFA 5GROA 4LF7Q 1HR0W 4OWXB 4BXXH 2DGYA 4JI7L 1PVOA 2Q2IA 3H3VH 1IBKQ 1XMQL 1VQJA 3H0GG 4Y52H 1SR3A 5IP7G 1PH5A 4DV5Q 3E9HA 1A8VA 3UDXA 3STBD 1PH2A 1Q81C 2KENA 1IBML 3DLLA 3F8TA 1KRTA 2A1AA 1Q1EA 2UUAL 4P74A 3PUXA 1Y1VG 2ALYB 1K3RA 4WJ4A 3M7NA 4A3MH 2PI2E 2PI2A 1X3EA 5M3MG 2AWNA 4NXNQ 2OTLA 4C3JH 5JEAG 2CQOA 4X66Q 4R4TA 1Z9FA 2K5NA 4DAMA 2YTXA 5IP7H 2LSSA 3CPWA 2JA5H 3U4VA 1Y1WG 1HNZL 1VS0A 1XJVA 1VQ4A 1CSQA 3CP0A 2N3SA 1YI2A 1HJPA 1I50H 4LF9L 2VQEQ 4LNQA 1PFSA 1N9WA 1LM0A 4O2DA 1IYJB 4LFBL 3IRBA 1SFOH 1GVPA 3OYYA 1MJEA 4B3ML 1QVCA 2UUCL 2UUBL 1WJJA 2R7DA 4JG2A 3U50C 3NEMA 3NBHB 5FJ8H 4JBJA 2E2JH 3KJPA 4LFAQ 2PQAA 2ZM6Q 5JEAJ 1TWCH 5M5XH 3PF4A 3RZOH 5JJKA 4O0AA 4C3HH 1N34Q 1Z47A 1SE8A 1SLJA 1XNQL 4IO9A 4DR5Q 2E5LQ 4MNOA 2I5HA 4AH6A 2JA7G 4LUZA 1QZHA 4LF5Q 2PQAB 2ZTDA 5C44H 3HOUG 2N78A 3W1BA 4DV4Q 4BY7G 4P73A 2ZTEA 4R4IA 4L5TA 1N36L 3PUVA 4UP8A 5E7NA 4A3FH 1LTLA 3J7ZC 4XTCS 4A3BG 3G48A 3RN2A 1UWVA 4DKAC 1J5EQ 4MZ9A 3BU2A 3VDYA 3I4MG 3ERSX 3GO5A 1IZ6A 2JA7H 4DR4L 4IPGA 1PH8A 4L5QA 4R4OA 3UDGA 2WP8J 1HNXL 2H5XA 4IPCA 4DUYL 1I6HH 4YHHQ 3PIOA 1XMOL 3PUYA 4IOAA 3UDIA 3HKZG 3K7UC 1TWFH 1OXXK 3KDFA 3T1YQ 1XPUA 3DM3A 2CWPA 1DGSA 2HHHQ 4ALPA 1AE2A 5IYCH 5IY0A 3J80c 3J80i 3I4MH 4JYAQ 2YU9H 1B8AA 3M3YH 1VQ9A 1I5FA 2Z6KC 3HOZG 4JYAL 3S15H 1HR0Q 5FLMG 2VL6A 4YWLA 2GVBA 2XTIA 2Z6KA 5LMNL 5LMUQ 4A3EH 2JEAI 4BY7H 4BBSG 1XNRQ 4WJ3M 2UXDL 4GN4B 3S14H 1VQGA 1VQDA 1IBLQ 4OX9L 4X62Q 1R9TH 2OCEA 4A75A 1X3GA 4LF6Q 4TQUS 2YTVA 2F52A 2WAQE 1B70B 4P71A 4LF7L 1VQ8A 1LYLA 3FKIH 2V1CC 4IOCA 1WFQA 3K7AH 2NN6I 2VS1A 4JI2Q 3CCRA 4GNXC 1Q86C 1M90C 2N49A 4BBSH 4DV5L 4GNXA 3CD6A 2BA0A 4DK6C 2Y0SE 3STBC 4DR6L 4X64L 3CC2A 4JC0A 5IYBH 3BJUA 5HY6A 3RLOA 4C2MH 5IP9G 5IT9c 1YHBA 1QVGA 3PO2G 1EQQA 1QZGA 1PHJA 3KF8B 1WYDA 1L2FA 3KOJA 4AQYQ 1VQ7A 4DV6Q 1WI5A 1C7YA 4GNXB 1Q1BA 5GQOA 5M3FG 1HNWL 5JJIA 3CMAA 1KL9A 4YCVA 2HIVA 4BA2I 1A63A 4PMWA 4EX5A 2CFMA 2VQFL 3CCJA 1VQ5A 1TWHH 4HIKA 2ZJRA 4JI5Q 1N32L 1CUKA 1P16A 2CKZB 3U4ZA 2I5MX 3PO2H 4A3MG 1MIUA 4X65Q 3HKZE 4RG1A 3RLNA 2Q2UA 1D8LA 1L1OC 4DV1Q 4NXMQ 4GKKL 1E3PA 4R4CA 2JA5G 1L1OA 1I3QH 4J15A 4QQBX 5M3FH 3GTJH 1FVIA 4JI4Q 1VQFA 2JE6I 2RF4A 4LFAL 3CAMA 4YY3Q 1OXTA 1TXYA 4PZ6A 2RHQB 1FJGL 1BVSA 3H3VI 3T1HQ 3PV0A 4KI0A 1N34L 5IYDG 4DV2Q 2E2IH 3CCLA 4GOPB 1N33Q 3E0EA 4JBKA 4PZ8A 2A8VA 1BBUA 1E24A 4IPHA 3W1GA 2IX1A 4A3GH 3KF6A 3CMEA 3WWVA 1L1OB 1XTDA 4DR5L 1Q82C 4B3RL 4KHPQ 4GLXA 2IY5B 5FJ8G 1X3FA 5C4JH 4QGUA 1KD1C 4JI8Q 3S2DH 3G4SA 1ASYA 4LF5L 3PUWA 4DR3L 3PIPA 2KBNA 4IFDG 4DV4L 1HZ9A 1K8GA 1I94L 3KJOA 3ULLA 5BR8Q 1K9MC 2UXBL 2EQSA 3J7A5 4P75A 1QVFA 2AHOB 1VQIA 4PG3A 4DR7L 4A3CH 2RHSB 5IYDH 3KF6B 4DV7Q 1QUQB 4DUZQ 1JT8A 2N8NA 5H1SE 3HOVG 5C44G 3JC66 5IWAQ 2KHJA 3AFQA 4JI3Q 1UE5A 2D62A 4KHZA 1VQLA 4B3TQ 4B3SQ 1AH9A 2WAQG 1NMGA 1YJ9A 2JA8G 1K83H 5C4XG 4K0KL 4QY7A 2MNAA 2IHEA 2WB1E 4BY1H 4IFDJ 5GAHC 4A3FG 3T1YL 1PH4A 2HHHL 2NZHA 2ZJPA 4A93H 4HIOA 2E8GA 4MTNA 3S1RH 1MKHA 3ICEA 2R93H 5LMNW 1AE3A 1ASZA 2IX0A 5ELOA 2Y0SG 3HOVH 2R7FA 1YBYA 3RR5A 4DK3C 1GM5A 1O7IA 3EIVA 3GD7A 1HR0L 2R6GA 4L5SA 3SGIA 3ZJYC 5LMUL 2AKWB 3TQYA 4Y7NH 1IXRA 2JA8H 2HQLA 3M4PA 2BA1A 5C4XH 1S72A 1CKOA 1HZBA 1X9NA 1LUZA 4X62L 4HIDA 1IBLL 4UY8C 1VQNA 2ATWA 5IYCG 3G6EA 1K73C 4NPSA 4HJ7A 1FL0A 2HT1A 2XGTA 3S24A 1BKBA 1J6QA 3MEFA 2MO1A 4POFA 4A3EG 3CCVA 1BBWA 1PH9A 4JI2L 3S16H 1V9PA 2F3IA 1GD7A 3NENA 2UXCL 4DV0Q 1TWAH 3I4OA 3Q8DA 2JQOA 2JJQA 4LF9Q 5GAGC 2VZAA 1NE3A 2B3GA 1PH1A 4LF4L 2K4KA 4B3MQ 1YNXA 3FKIG 4GS3A 4JI1L 1X6OA 2Z0SA 2BH8A 3CXCA 3AYHB 2UUCQ 4DV6L 5AJ3L 2JA6G 4NB3A 4LFCL 3LGJA 2NVYH 2PMZE 1FGUA 1PYBA 4OONA 4YCWA 5IYBG 4IJLA 3PF5A 1KIXA 1SN8A 1YHQA 1EFWA 3CF5A 1MJCA 4KLKA 2OQKA 2FXQA 1JJCB 2NZOA 1B7YB 1XNQQ 1UE6A 2LXKA 3HOYH 4APVA 1V43A 4P72A 1IBKL 2JA6H 1E1TA 3MXNB 1VQHA 4NXML 3CCQA 4AYBE 2VNUD 1TWGH 3TS0A 1JJ2A 4JI0Q 5GADC 1N8RC 1YJNA 4JI4L 4HJ8A 4YY3L 3UE0A 2UU9Q 4PZ7A 3GTQH 3M4OH 3PUZA 1OXVA 1XPOA 1CKMA 4DV2L 1EWIA 2AMCB 1N36Q 1N33L 4NXNL 3U58A 4DAYB 3W5OA 4X66L 1K8AC 4IPDA 3HOXH 3GTMH 1T9HA 3FHWA 3L7ZC 2WB1G 1HNXQ 3KYHC 4DUYQ 4GLAC 1YVCA 3S1NH 4DV3Q 1C9OA 1XMOQ 4R1JA 1GO3E 4DNIA 4GKJQ 5BR8L 2VQEL 2GVAA 1HZAA 4GOPC 3TEHB 4EQ5A 3I4NH 2DUDA 4LF8Q 1UEBA 2VW9A 4GOPA 2VY3A 4A3GG 5JJLA 1XPRA 2I5LX 4A3LG 4DV7L 3H15A 4A3JH 2NVXH 4XIGS 1A0IA 3CCSA 2YV5A 5IWAL 3J81c 4OWWB 3TRZA 3K0XA 3J81i 5LMNQ 1OXUA 2YYZA 2ZM6L 1NY4A 1D7QA 4POGA 1CKNB 1U0LA 4DR2Q 4JV5Q 4B3TL 1M1KC 1HH2P 3PO3G 3GTLH 1A62A 2PNHA 3A5ZB 1EOVA 2QA4A 4A3CG 3ULPA 3BZKA 1S3OA 3KFUA 4DR1Q 2E5LL 4A3LH 1QUQA 2KHIA 3CW2C 4YCUA 4QL5A 2JK8A 2VUMH 3GTPH 1Y14B 4A76A 2D0OA 2R92H 2RCNA 2QEXA 1JJGA 1X54A 2NVQH 1YJWA 3CCMA 4A3DG 3OW2A 1OTCA 1KRSA 2CWAA 1EYGA 4DR6Q 4X64Q 3G71A 2LXJA 3PO3H 4BY1G 3OTOQ 3K8AA 4QIWE 2KCMA 2EXDA 3ULJA 4A93G 3PGZA 2R93G 4JI6Q 1S40A 1J5EL 2HIXA 3S1QH 1JE5A 4A3KG 3PCOB 5C0XG 2JA9A 3HOWG 1Q12A 4YWKA 3H0GH 4ME3A 3M4QA 2ZTCA 2WFWA 3TREA 2JEBI 2K5VA 1HZCA 4UP9A 4A3DH 4YHHL 3CCEA 1HNWQ 1YHAA 1Q7YC 2D0PA 2VQFQ 4DV0L 1N32Q 1VCIA 2ID0A 4OO1G 1V1QA 3CPFA 2K5HA 5ELNA 1X56A 1Y1VH 2F4VQ 1P8LA 1VQMA 3B6YA 4AYBG 2NVTH 4JI7Q 4UP7A 4LW1A 4IFDI 4JBWA 3A74A 1XMQQ 1SRUA 4LF6L 5M3MH 5EAYA 4GKKQ 4A4IA 4A3KH 2OTJA 2KCTA 3HOWH 3CC7A 3GTKH 1YEZA 2MO0A 4HJ9A 1VQBA 1IBMQ 1XNRL 1EIFA 1G291 4X6AH 1G51A 5C0XJ 1Y1WH 2UUAQ 3S17H 3UDFA 3AEVA 1JB7A 1FJGQ 3RN5A 4BA1I 4TVAB 5C0XI 4JCVE 2E2HH 3S2HH 1YITA 1VQCA 3I7FA 3RLFA 4HJAA 3GDEA 1W3SA 4B3RQ 1E7ZA 2I0QA 3K81C 1K0RA 2ASBA 1PH3A 4UPAA 1HNZQ 4DR3Q 4OO1I 2L15A 4LUVA 2CCZA 4JI0L 2K75A 4LWCA 1I94Q 3RZDH 3TS2A 2UU9L 1Q46A 2K52A 2UXBQ 2B63G 4LFBQ 5M5YH 2A19A 4R4QA 5FLXc 3J81j 2K50A 3F2DA 3HOYG 4DR7Q 1KXLA 2IT1A 4AQYL 2UUBQ 1WCMG 2ZJQA 3I55A 5IE8A 3M9BA 5HGQA 1IL2A 3GTGH 4QJFA 3CCUA 4GN3B 3PSIA 3L0OA 3HOUH 3F2BA 2BH2A 1NMFA 3UE1A 4JI5L 1EUJA 4DV3L 4BBRG 2NN6G 4HIMA 4C3IH 2MQHA 1PH6A 1JMCA 1UE1A 3D0FA 1VQKA 4GKJL 4K0KQ 2B63H 1PH7A 4X65L 2OWOA 4LF8L 2Q2HA 5M5WH 3AQQA 1WCMH 1NTGA 3L2PA 1PV4A 4DV1L 4IJHA 2MFIA 3HOXG 4A3BH 4A3IG 4GLVB 5C3EG 3ER0A 1VQPA 1WOCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QGQ A;  1NBW A;  4OXP A;  2IHF A;  2OQ0 A;  5DLQ E;  4DR2 L;  1EQR A;  4JV5 L;  1RL2 A;  4JOI C;  4BBR H;  1E1O A;  3KDF B;  3T1H L;  3I4N G;  3I2Z A;  1KAW A;  4GN5 A;  1PYS B;  4JOI A;  3EN2 A;  3D31 A;  1E22 A;  1U5K A;  4LUO A;  2EIF A;  1L0W A;  1C0A A;  1KQS A;  3K80 C;  3M85 A;  1GKH A;  1W2B A;  2ES2 A;  4A3J G;  3CC4 A;  4DR1 L;  3BZC A;  3E9I A;  1VQO A;  3RNU A;  4KHP L;  4DR4 Q;  4A3I H;  5C3E H;  1SMX A;  5GAE C;  4JI8 L;  1OXS C;  3HOZ H;  1SRO A;  1CSP A;  1YZ6 A;  2R7Z G;  4YWM A;  5FLM H;  1X55 A;  3A5U A;  1X65 A;  1EIY B;  3HKS A;  3F1Z A;  2K14 A;  1CKN A;  1PA6 A;  3AFP A;  2UXC Q;  4FDB A;  4JBM A;  3HFZ B;  3JAM c;  3I56 A;  3NEL A;  3JAM i;  2GN5 A;  5J3B A;  3KLW A;  4DPG A;  1Q8K A;  3OTO L;  1YIJ A;  2Q2T A;  1KHI A;  4OWT B;  1NJI C;  3CQZ H;  3F2C A;  5K36 G;  4LF4 Q;  1VQ6 A;  4JI6 L;  4AIM A;  3EBE A;  4DUZ L;  4BXX G;  2YTY A;  2VUM G;  4JI1 Q;  1H95 A;  2C35 B;  1KC8 C;  2R92 G;  5AJ3 Q;  3S1M H;  4JI3 L;  1VQE A;  4LFC Q;  1RIP A;  1UE7 A;  4H02 A;  4L5R C;  2R7Z H;  1VQA A;  2B29 A;  4B3S L;  2UXD Q;  1G6P A;  3FP9 A;  4HJ5 A;  4OX9 Q;  3A0J A;  3GTO H;  5IP9 H;  2AWO A;  2F4V L;  4RMF A;  5GRO A;  4LF7 Q;  1HR0 W;  4OWX B;  4BXX H;  2DGY A;  4JI7 L;  1PVO A;  2Q2I A;  3H3V H;  1IBK Q;  1XMQ L;  1VQJ A;  3H0G G;  4Y52 H;  1SR3 A;  5IP7 G;  1PH5 A;  4DV5 Q;  3E9H A;  1A8V A;  3UDX A;  3STB D;  1PH2 A;  1Q81 C;  2KEN A;  1IBM L;  3DLL A;  3F8T A;  1KRT A;  2A1A A;  1Q1E A;  2UUA L;  4P74 A;  3PUX A;  1Y1V G;  2ALY B;  1K3R A;  4WJ4 A;  3M7N A;  4A3M H;  2PI2 E;  2PI2 A;  1X3E A;  5M3M G;  2AWN A;  4NXN Q;  2OTL A;  4C3J H;  5JEA G;  2CQO A;  4X66 Q;  4R4T A;  1Z9F A;  2K5N A;  4DAM A;  2YTX A;  5IP7 H;  2LSS A;  3CPW A;  2JA5 H;  3U4V A;  1Y1W G;  1HNZ L;  1VS0 A;  1XJV A;  1VQ4 A;  1CSQ A;  3CP0 A;  2N3S A;  1YI2 A;  1HJP A;  1I50 H;  4LF9 L;  2VQE Q;  4LNQ A;  1PFS A;  1N9W A;  1LM0 A;  4O2D A;  1IYJ B;  4LFB L;  3IRB A;  1SFO H;  1GVP A;  3OYY A;  1MJE A;  4B3M L;  1QVC A;  2UUC L;  2UUB L;  1WJJ A;  2R7D A;  4JG2 A;  3U50 C;  3NEM A;  3NBH B;  5FJ8 H;  4JBJ A;  2E2J H;  3KJP A;  4LFA Q;  2PQA A;  2ZM6 Q;  5JEA J;  1TWC H;  5M5X H;  3PF4 A;  3RZO H;  5JJK A;  4O0A A;  4C3H H;  1N34 Q;  1Z47 A;  1SE8 A;  1SLJ A;  1XNQ L;  4IO9 A;  4DR5 Q;  2E5L Q;  4MNO A;  2I5H A;  4AH6 A;  2JA7 G;  4LUZ A;  1QZH A;  4LF5 Q;  2PQA B;  2ZTD A;  5C44 H;  3HOU G;  2N78 A;  3W1B A;  4DV4 Q;  4BY7 G;  4P73 A;  2ZTE A;  4R4I A;  4L5T A;  1N36 L;  3PUV A;  4UP8 A;  5E7N A;  4A3F H;  1LTL A;  3J7Z C;  4XTC S;  4A3B G;  3G48 A;  3RN2 A;  1UWV A;  4DKA C;  1J5E Q;  4MZ9 A;  3BU2 A;  3VDY A;  3I4M G;  3ERS X;  3GO5 A;  1IZ6 A;  2JA7 H;  4DR4 L;  4IPG A;  1PH8 A;  4L5Q A;  4R4O A;  3UDG A;  2WP8 J;  1HNX L;  2H5X A;  4IPC A;  4DUY L;  1I6H H;  4YHH Q;  3PIO A;  1XMO L;  3PUY A;  4IOA A;  3UDI A;  3HKZ G;  3K7U C;  1TWF H;  1OXX K;  3KDF A;  3T1Y Q;  1XPU A;  3DM3 A;  2CWP A;  1DGS A;  2HHH Q;  4ALP A;  1AE2 A;  5IYC H;  5IY0 A;  3J80 c;  3J80 i;  3I4M H;  4JYA Q;  2YU9 H;  1B8A A;  3M3Y H;  1VQ9 A;  1I5F A;  2Z6K C;  3HOZ G;  4JYA L;  3S15 H;  1HR0 Q;  5FLM G;  2VL6 A;  4YWL A;  2GVB A;  2XTI A;  2Z6K A;  5LMN L;  5LMU Q;  4A3E H;  2JEA I;  4BY7 H;  4BBS G;  1XNR Q;  4WJ3 M;  2UXD L;  4GN4 B;  3S14 H;  1VQG A;  1VQD A;  1IBL Q;  4OX9 L;  4X62 Q;  1R9T H;  2OCE A;  4A75 A;  1X3G A;  4LF6 Q;  4TQU S;  2YTV A;  2F52 A;  2WAQ E;  1B70 B;  4P71 A;  4LF7 L;  1VQ8 A;  1LYL A;  3FKI H;  2V1C C;  4IOC A;  1WFQ A;  3K7A H;  2NN6 I;  2VS1 A;  4JI2 Q;  3CCR A;  4GNX C;  1Q86 C;  1M90 C;  2N49 A;  4BBS H;  4DV5 L;  4GNX A;  3CD6 A;  2BA0 A;  4DK6 C;  2Y0S E;  3STB C;  4DR6 L;  4X64 L;  3CC2 A;  4JC0 A;  5IYB H;  3BJU A;  5HY6 A;  3RLO A;  4C2M H;  5IP9 G;  5IT9 c;  1YHB A;  1QVG A;  3PO2 G;  1EQQ A;  1QZG A;  1PHJ A;  3KF8 B;  1WYD A;  1L2F A;  3KOJ A;  4AQY Q;  1VQ7 A;  4DV6 Q;  1WI5 A;  1C7Y A;  4GNX B;  1Q1B A;  5GQO A;  5M3F G;  1HNW L;  5JJI A;  3CMA A;  1KL9 A;  4YCV A;  2HIV A;  4BA2 I;  1A63 A;  4PMW A;  4EX5 A;  2CFM A;  2VQF L;  3CCJ A;  1VQ5 A;  1TWH H;  4HIK A;  2ZJR A;  4JI5 Q;  1N32 L;  1CUK A;  1P16 A;  2CKZ B;  3U4Z A;  2I5M X;  3PO2 H;  4A3M G;  1MIU A;  4X65 Q;  3HKZ E;  4RG1 A;  3RLN A;  2Q2U A;  1D8L A;  1L1O C;  4DV1 Q;  4NXM Q;  4GKK L;  1E3P A;  4R4C A;  2JA5 G;  1L1O A;  1I3Q H;  4J15 A;  4QQB X;  5M3F H;  3GTJ H;  1FVI A;  4JI4 Q;  1VQF A;  2JE6 I;  2RF4 A;  4LFA L;  3CAM A;  4YY3 Q;  1OXT A;  1TXY A;  4PZ6 A;  2RHQ B;  1FJG L;  1BVS A;  3H3V I;  3T1H Q;  3PV0 A;  4KI0 A;  1N34 L;  5IYD G;  4DV2 Q;  2E2I H;  3CCL A;  4GOP B;  1N33 Q;  3E0E A;  4JBK A;  4PZ8 A;  2A8V A;  1BBU A;  1E24 A;  4IPH A;  3W1G A;  2IX1 A;  4A3G H;  3KF6 A;  3CME A;  3WWV A;  1L1O B;  1XTD A;  4DR5 L;  1Q82 C;  4B3R L;  4KHP Q;  4GLX A;  2IY5 B;  5FJ8 G;  1X3F A;  5C4J H;  4QGU A;  1KD1 C;  4JI8 Q;  3S2D H;  3G4S A;  1ASY A;  4LF5 L;  3PUW A;  4DR3 L;  3PIP A;  2KBN A;  4IFD G;  4DV4 L;  1HZ9 A;  1K8G A;  1I94 L;  3KJO A;  3ULL A;  5BR8 Q;  1K9M C;  2UXB L;  2EQS A;  3J7A 5;  4P75 A;  1QVF A;  2AHO B;  1VQI A;  4PG3 A;  4DR7 L;  4A3C H;  2RHS B;  5IYD H;  3KF6 B;  4DV7 Q;  1QUQ B;  4DUZ Q;  1JT8 A;  2N8N A;  5H1S E;  3HOV G;  5C44 G;  3JC6 6;  5IWA Q;  2KHJ A;  3AFQ A;  4JI3 Q;  1UE5 A;  2D62 A;  4KHZ A;  1VQL A;  4B3T Q;  4B3S Q;  1AH9 A;  2WAQ G;  1NMG A;  1YJ9 A;  2JA8 G;  1K83 H;  5C4X G;  4K0K L;  4QY7 A;  2MNA A;  2IHE A;  2WB1 E;  4BY1 H;  4IFD J;  5GAH C;  4A3F G;  3T1Y L;  1PH4 A;  2HHH L;  2NZH A;  2ZJP A;  4A93 H;  4HIO A;  2E8G A;  4MTN A;  3S1R H;  1MKH A;  3ICE A;  2R93 H;  5LMN W;  1AE3 A;  1ASZ A;  2IX0 A;  5ELO A;  2Y0S G;  3HOV H;  2R7F A;  1YBY A;  3RR5 A;  4DK3 C;  1GM5 A;  1O7I A;  3EIV A;  3GD7 A;  1HR0 L;  2R6G A;  4L5S A;  3SGI A;  3ZJY C;  5LMU L;  2AKW B;  3TQY A;  4Y7N H;  1IXR A;  2JA8 H;  2HQL A;  3M4P A;  2BA1 A;  5C4X H;  1S72 A;  1CKO A;  1HZB A;  1X9N A;  1LUZ A;  4X62 L;  4HID A;  1IBL L;  4UY8 C;  1VQN A;  2ATW A;  5IYC G;  3G6E A;  1K73 C;  4NPS A;  4HJ7 A;  1FL0 A;  2HT1 A;  2XGT A;  3S24 A;  1BKB A;  1J6Q A;  3MEF A;  2MO1 A;  4POF A;  4A3E G;  3CCV A;  1BBW A;  1PH9 A;  4JI2 L;  3S16 H;  1V9P A;  2F3I A;  1GD7 A;  3NEN A;  2UXC L;  4DV0 Q;  1TWA H;  3I4O A;  3Q8D A;  2JQO A;  2JJQ A;  4LF9 Q;  5GAG C;  2VZA A;  1NE3 A;  2B3G A;  1PH1 A;  4LF4 L;  2K4K A;  4B3M Q;  1YNX A;  3FKI G;  4GS3 A;  4JI1 L;  1X6O A;  2Z0S A;  2BH8 A;  3CXC A;  3AYH B;  2UUC Q;  4DV6 L;  5AJ3 L;  2JA6 G;  4NB3 A;  4LFC L;  3LGJ A;  2NVY H;  2PMZ E;  1FGU A;  1PYB A;  4OON A;  4YCW A;  5IYB G;  4IJL A;  3PF5 A;  1KIX A;  1SN8 A;  1YHQ A;  1EFW A;  3CF5 A;  1MJC A;  4KLK A;  2OQK A;  2FXQ A;  1JJC B;  2NZO A;  1B7Y B;  1XNQ Q;  1UE6 A;  2LXK A;  3HOY H;  4APV A;  1V43 A;  4P72 A;  1IBK L;  2JA6 H;  1E1T A;  3MXN B;  1VQH A;  4NXM L;  3CCQ A;  4AYB E;  2VNU D;  1TWG H;  3TS0 A;  1JJ2 A;  4JI0 Q;  5GAD C;  1N8R C;  1YJN A;  4JI4 L;  4HJ8 A;  4YY3 L;  3UE0 A;  2UU9 Q;  4PZ7 A;  3GTQ H;  3M4O H;  3PUZ A;  1OXV A;  1XPO A;  1CKM A;  4DV2 L;  1EWI A;  2AMC B;  1N36 Q;  1N33 L;  4NXN L;  3U58 A;  4DAY B;  3W5O A;  4X66 L;  1K8A C;  4IPD A;  3HOX H;  3GTM H;  1T9H A;  3FHW A;  3L7Z C;  2WB1 G;  1HNX Q;  3KYH C;  4DUY Q;  4GLA C;  1YVC A;  3S1N H;  4DV3 Q;  1C9O A;  1XMO Q;  4R1J A;  1GO3 E;  4DNI A;  4GKJ Q;  5BR8 L;  2VQE L;  2GVA A;  1HZA A;  4GOP C;  3TEH B;  4EQ5 A;  3I4N H;  2DUD A;  4LF8 Q;  1UEB A;  2VW9 A;  4GOP A;  2VY3 A;  4A3G G;  5JJL A;  1XPR A;  2I5L X;  4A3L G;  4DV7 L;  3H15 A;  4A3J H;  2NVX H;  4XIG S;  1A0I A;  3CCS A;  2YV5 A;  5IWA L;  3J81 c;  4OWW B;  3TRZ A;  3K0X A;  3J81 i;  5LMN Q;  1OXU A;  2YYZ A;  2ZM6 L;  1NY4 A;  1D7Q A;  4POG A;  1CKN B;  1U0L A;  4DR2 Q;  4JV5 Q;  4B3T L;  1M1K C;  1HH2 P;  3PO3 G;  3GTL H;  1A62 A;  2PNH A;  3A5Z B;  1EOV A;  2QA4 A;  4A3C G;  3ULP A;  3BZK A;  1S3O A;  3KFU A;  4DR1 Q;  2E5L L;  4A3L H;  1QUQ A;  2KHI A;  3CW2 C;  4YCU A;  4QL5 A;  2JK8 A;  2VUM H;  3GTP H;  1Y14 B;  4A76 A;  2D0O A;  2R92 H;  2RCN A;  2QEX A;  1JJG A;  1X54 A;  2NVQ H;  1YJW A;  3CCM A;  4A3D G;  3OW2 A;  1OTC A;  1KRS A;  2CWA A;  1EYG A;  4DR6 Q;  4X64 Q;  3G71 A;  2LXJ A;  3PO3 H;  4BY1 G;  3OTO Q;  3K8A A;  4QIW E;  2KCM A;  2EXD A;  3ULJ A;  4A93 G;  3PGZ A;  2R93 G;  4JI6 Q;  1S40 A;  1J5E L;  2HIX A;  3S1Q H;  1JE5 A;  4A3K G;  3PCO B;  5C0X G;  2JA9 A;  3HOW G;  1Q12 A;  4YWK A;  3H0G H;  4ME3 A;  3M4Q A;  2ZTC A;  2WFW A;  3TRE A;  2JEB I;  2K5V A;  1HZC A;  4UP9 A;  4A3D H;  4YHH L;  3CCE A;  1HNW Q;  1YHA A;  1Q7Y C;  2D0P A;  2VQF Q;  4DV0 L;  1N32 Q;  1VCI A;  2ID0 A;  4OO1 G;  1V1Q A;  3CPF A;  2K5H A;  5ELN A;  1X56 A;  1Y1V H;  2F4V Q;  1P8L A;  1VQM A;  3B6Y A;  4AYB G;  2NVT H;  4JI7 Q;  4UP7 A;  4LW1 A;  4IFD I;  4JBW A;  3A74 A;  1XMQ Q;  1SRU A;  4LF6 L;  5M3M H;  5EAY A;  4GKK Q;  4A4I A;  4A3K H;  2OTJ A;  2KCT A;  3HOW H;  3CC7 A;  3GTK H;  1YEZ A;  2MO0 A;  4HJ9 A;  1VQB A;  1IBM Q;  1XNR L;  1EIF A;  1G29 1;  4X6A H;  1G51 A;  5C0X J;  1Y1W H;  2UUA Q;  3S17 H;  3UDF A;  3AEV A;  1JB7 A;  1FJG Q;  3RN5 A;  4BA1 I;  4TVA B;  5C0X I;  4JCV E;  2E2H H;  3S2H H;  1YIT A;  1VQC A;  3I7F A;  3RLF A;  4HJA A;  3GDE A;  1W3S A;  4B3R Q;  1E7Z A;  2I0Q A;  3K81 C;  1K0R A;  2ASB A;  1PH3 A;  4UPA A;  1HNZ Q;  4DR3 Q;  4OO1 I;  2L15 A;  4LUV A;  2CCZ A;  4JI0 L;  2K75 A;  4LWC A;  1I94 Q;  3RZD H;  3TS2 A;  2UU9 L;  1Q46 A;  2K52 A;  2UXB Q;  2B63 G;  4LFB Q;  5M5Y H;  2A19 A;  4R4Q A;  5FLX c;  3J81 j;  2K50 A;  3F2D A;  3HOY G;  4DR7 Q;  1KXL A;  2IT1 A;  4AQY L;  2UUB Q;  1WCM G;  2ZJQ A;  3I55 A;  5IE8 A;  3M9B A;  5HGQ A;  1IL2 A;  3GTG H;  4QJF A;  3CCU A;  4GN3 B;  3PSI A;  3L0O A;  3HOU H;  3F2B A;  2BH2 A;  1NMF A;  3UE1 A;  4JI5 L;  1EUJ A;  4DV3 L;  4BBR G;  2NN6 G;  4HIM A;  4C3I H;  2MQH A;  1PH6 A;  1JMC A;  1UE1 A;  3D0F A;  1VQK A;  4GKJ L;  4K0K Q;  2B63 H;  1PH7 A;  4X65 L;  2OWO A;  4LF8 L;  2Q2H A;  5M5W H;  3AQQ A;  1WCM H;  1NTG A;  3L2P A;  1PV4 A;  4DV1 L;  4IJH A;  2MFI A;  3HOX G;  4A3B H;  4A3I G;  4GLV B;  5C3E G;  3ER0 A;  1VQP A;  1WOC A; 
#chains in the Genus database with same CATH topology
 2QGQ A;  3E6Z X;  1KLG D;  2IHF A;  2WII B;  1STN A;  1RL2 A;  1TS3 A;  2J7Z A;  4BBR H;  5M5X B;  1QNK A;  4I7Z C;  1KAW A;  3MZ5 A;  4JOI A;  3RZO B;  1U5K A;  4LUO A;  1L0W A;  1W2B A;  2P5Z X;  3CU7 A;  3DWP A;  1VQO A;  4KHP L;  1TS5 A;  4A3I H;  5C3E H;  5GAE C;  4KTA A;  2K04 A;  1OXS C;  3HOZ H;  2SNS A;  4YWM A;  5FLM H;  3HOV B;  1X65 A;  1HA6 A;  1CKN A;  1DJR D;  1SNP A;  2A73 B;  3AFP A;  3QIA A;  3VYS A;  1BDO A;  2IWH A;  5J3B A;  1YIJ A;  2J0T D;  5C4X B;  4BXX G;  4AIM A;  2YTY A;  2VUM G;  1H95 A;  3X3N A;  1KC8 C;  4J1M A;  3C3L A;  2R92 G;  5AJ3 Q;  3S1M H;  1VQE A;  2DJG C;  1VQA A;  1AEX A;  2MPM A;  3FP9 A;  4HJ5 A;  2L1B A;  4OX9 Q;  1FNU A;  4DA2 A;  3A0J A;  3URY A;  2AWO A;  5ELB A;  2F4V L;  1U4M A;  2K28 A;  1EY8 A;  1K3B C;  4LF7 Q;  4BXX H;  5EKK A;  1PVO A;  1XMQ L;  1VQJ A;  2YU9 B;  1I4R A;  1PH5 A;  3M3Y B;  1A8V A;  1STA A;  2K5Q A;  1KTK A;  1PZJ D;  1Q1E A;  2UUA L;  2KUM A;  4V0B A;  2ALY B;  3M7N A;  2BDO A;  4JPB W;  2PI2 E;  5I9P A;  4NXN Q;  2OTL A;  2CQO A;  1GUW A;  2K5N A;  3FKI B;  1PYW D;  5I9O A;  1K8O A;  1O7Z A;  3EQL C;  2HD3 A;  4B08 A;  1KAB A;  4N8X 1;  1N9W A;  4O2D A;  2B8F A;  3IRB A;  1SFO H;  1GVP A;  2NTT A;  3OYY A;  2UUB L;  2R7D A;  3TSS A;  1JOR A;  4JBJ A;  4LFA Q;  2PQA A;  2DY7 A;  1RDP D;  1F77 A;  1E2V A;  2Z6B A;  1E2W A;  3V96 A;  1SNO A;  1Z47 A;  2EYF A;  2M9V A;  2JA7 G;  1JC7 A;  4G57 A;  3HOU G;  1HQM C;  2N78 A;  4L63 B;  4G7H C;  3GTJ B;  4BY7 G;  1CZW A;  1Y8P B;  4P73 A;  2ZTE A;  5C3W A;  1RTO A;  4A3F H;  4XTC S;  3G48 A;  3RN2 A;  3I4M G;  1WTQ A;  2NTS A;  3GO5 A;  2JA7 H;  4A3G B;  2QF7 A;  4IPG A;  2B2Y C;  5C4J B;  1HNX L;  3DMU A;  3BYT B;  4DUY L;  3S2D B;  4XYO A;  3MTS A;  4YHH Q;  1BF4 A;  3SEB A;  3K5L A;  3HKZ G;  3KDF A;  1LTB D;  3SXH A;  3I4M H;  3D4R A;  1VQ9 A;  5CV6 A;  4JYA L;  1ZKO A;  4A3E H;  2Z6K A;  3DM1 A;  1SNC A;  1U4P A;  3SDZ A;  5IGD A;  4WJ3 M;  4GN4 B;  3S14 H;  1DXM A;  1EL0 A;  3H6M A;  4TQU S;  2F52 A;  1B70 B;  4KKS A;  3J81 E;  2DY8 A;  4A93 B;  3S1R B;  4JI2 Q;  2VS1 A;  5ELE A;  2PMZ B;  2BA0 A;  2O2L D;  4DK6 C;  4PNY A;  3BJU A;  2L12 A;  3RLO A;  4RFB A;  2ENB A;  1QVG A;  3VR2 A;  3PO2 G;  1S5F D;  1WTX A;  1QZG A;  2EY6 A;  1WYD A;  1L2F A;  2LY7 A;  3KF8 B;  4AQY Q;  1LTI D;  5LHY 1;  4DV6 Q;  1C7Y A;  2BE5 C;  5JJI A;  1KL9 A;  1U4L A;  4BA2 I;  1A63 A;  1JQY D;  4PMW A;  1TWH H;  2ZJR A;  4JI5 Q;  3PO2 H;  2EYH A;  1MIU A;  3IFT A;  1D8L A;  1TU2 B;  1L1O C;  4NDX A;  1HFN A;  1E3P A;  2JA5 G;  1TS2 A;  1EIG A;  2EVB A;  1CQF A;  2BDN A;  4YY3 Q;  1EY6 A;  1HA5 A;  3FDT A;  2EOT A;  1BVS A;  1H9S A;  1FJG L;  3MXP A;  1N34 L;  5I2X A;  4DV2 Q;  3CCL A;  2A8V A;  4PZ8 A;  1ENC A;  1W6J A;  1BBU A;  5CBE E;  3KF6 A;  3CME A;  2EYL A;  1L1O B;  4DR5 L;  1Q82 C;  3HOY B;  2IY5 B;  5FJ8 G;  1X3F A;  4JI8 Q;  4M1U B;  3NBH A;  3Q0A A;  4LF5 L;  2KBN A;  4FF4 A;  1TWG B;  2PCF B;  4LMQ D;  1TT2 A;  2E76 C;  2UXB L;  3J7A 5;  4DR7 L;  3M4O B;  4A3C H;  1SAP A;  4NMZ A;  1R4P B;  3KLR A;  4CDF C;  2N8N A;  3G7L A;  4H7B A;  2WAC A;  3JC6 6;  3AFQ A;  2X6L A;  1WD0 A;  4B3S Q;  4R8I A;  5FLX E;  4EGV A;  4FF1 A;  1K83 H;  1NSN S;  4QIW B;  3S1N B;  2MNA A;  2IHE A;  4DU9 A;  4IFD J;  3T1Y L;  2F0P A;  2HHH L;  3OIP A;  4HIO A;  4O1N A;  2EJG C;  4KHV A;  1HTP A;  2IX0 A;  2R7F A;  1YBY A;  4DK3 C;  2G9H D;  1BR9 A;  3PMF A;  3S1M B;  1X9N A;  3HG9 A;  4ZAI A;  3G6E A;  1QOH A;  3GTL B;  4FVM A;  2V4D A;  2HT1 A;  3KBX A;  4QUF A;  3DUZ A;  1AN8 A;  1QWY A;  2MO1 A;  4POF A;  2XWJ B;  3T4A C;  2VUM B;  3EA6 A;  1STG A;  2R92 B;  2X69 A;  4RGM A;  3RUZ A;  3WOF A;  4DV0 Q;  1LTG D;  1H9M A;  3P20 A;  4IZ8 A;  1LTA D;  1MSG A;  5GAG C;  2B3G A;  2EYP A;  1V8Q A;  3FEW X;  4B3M Q;  5EPJ A;  1YNX A;  4P2C B;  2UUC Q;  2BH8 A;  3BYY B;  5AJ3 L;  2NVY H;  4EQO A;  4F87 A;  3JAM E;  2PMZ E;  5ELC A;  5KRU A;  1D1I A;  4OON A;  5BN3 A;  1TS4 A;  1MJC A;  1EZ6 A;  2O5I C;  3A8J E;  1PZK D;  1JJC B;  4KN7 C;  1STH A;  1UE6 A;  4APV A;  1LO5 D;  4NXM L;  3CCQ A;  5HGT A;  1D5X C;  2VNU D;  3TS0 A;  5GAD C;  4FXG C;  3GTK B;  1WTH A;  3UE0 A;  2B2V C;  5C4H A;  3S17 B;  1TKW B;  1CZG A;  2EY2 A;  1N36 Q;  1I4Q A;  4NXN L;  2AUJ D;  3NBI A;  5I4D A;  1SND A;  5FKA C;  3K57 A;  3GTM H;  2ICE C;  2Z8L A;  3L7Z C;  4C56 C;  4WRD A;  4DV3 Q;  1PTO D;  4GKJ Q;  1DD2 A;  3TEH B;  3I4N H;  2DUD A;  4LF8 Q;  4GOP A;  2VY3 A;  1XPR A;  4A3L G;  5M5Y B;  3KLS A;  2CH4 W;  3Q6S A;  4KKT A;  5D3D A;  2YV5 A;  1RHP A;  3J81 i;  3GTG B;  4B3T L;  1S5B D;  4HSP A;  3HOU B;  5DM6 3;  4BY7 B;  3ULP A;  4A3L H;  4HCE A;  4I65 A;  2EJM A;  2K5D A;  3DWQ A;  2F03 A;  3GTP H;  1Y14 B;  1NCV A;  2D0O A;  2QEX A;  3I4M B;  4FO2 A;  3CCM A;  2LFN A;  1OTC A;  1KRS A;  1JWM D;  4K5V A;  1YNJ C;  3LNN A;  1SMY C;  3G71 A;  2LXJ A;  1LTT D;  1X3P A;  4QIW E;  2Q8T A;  3S14 B;  1KDB A;  2MP1 A;  2R93 G;  5J22 A;  3HKZ B;  4RHR A;  4KY5 A;  3S1Q H;  1CK1 A;  1YNN D;  2JA9 A;  2BE5 D;  3SK5 A;  3BVG A;  4ZKB B;  2MUY A;  2NB0 A;  3M4Q A;  2WFW A;  3PIP 3;  2JEB I;  4ZUI A;  1HZC A;  4YHH L;  3CCE A;  3BS1 A;  1N32 Q;  4KK7 A;  1V1Q A;  2WIN B;  2RSO A;  2K01 A;  2F4V Q;  1P8L A;  1QNU A;  1VQM A;  4AYB G;  2FJ2 A;  4IFD I;  3A74 A;  1XMQ Q;  4DAP A;  4GKK Q;  2OTJ A;  2F0S A;  2E2D C;  3H3V C;  1DCZ A;  5TSS A;  5C0X J;  1ROD A;  2VXW A;  1Y1W H;  2UUA Q;  3J80 E;  1JB7 A;  3SVM A;  4TVA B;  4JCV E;  4TRD A;  3S2H H;  1YIT A;  1VDZ A;  2OF1 A;  1VQC A;  1W3S A;  1ZXT A;  1SYB A;  5CV8 A;  2DNC A;  1K0R A;  4UPA A;  4F8M A;  5IIF A;  1BCP C;  4DR3 Q;  4LUV A;  1TY2 A;  2M00 A;  1ILQ A;  4LK1 C;  3TS2 A;  1XX8 A;  1Q46 A;  1CQV A;  4FXD A;  2A19 A;  3F2D A;  1A3T A;  2SEB D;  4AQY L;  2UUB Q;  2ZJQ A;  5HGQ A;  1CI3 M;  3PSI A;  3L0O A;  2JA5 B;  1GUS A;  2HDL A;  2BH2 A;  5T1I A;  4JI5 L;  4HIM A;  1JWS D;  4K0K Q;  2HQE A;  1PH7 A;  2Q2H A;  4UDU C;  2AQ1 B;  3L2P A;  1NTG A;  1WTP A;  5IGC A;  2SNM A;  4XT1 B;  1S5C D;  1HHV A;  1ZEQ X;  1NBW A;  5E3F A;  3T53 B;  2E75 C;  2E2J B;  2OQ0 A;  4JV5 L;  3HP3 A;  3I2Z A;  4GN5 A;  2KQ3 A;  3EN2 A;  3D31 A;  1E22 A;  4RGN A;  2EIF A;  3K80 C;  3CC4 A;  1SE4 A;  3BZC A;  3E9I A;  3TP8 A;  1RTN A;  5JAV A;  1SMX A;  4JI8 L;  3BVM A;  2DNE A;  4FF3 A;  3T56 B;  4K8I A;  2R7Z G;  1X55 A;  4OIK A;  1EQT A;  1E0B A;  1EEI D;  3F1Z A;  3I90 A;  4FDB A;  3NEL A;  3JAM i;  2GN5 A;  4DPG A;  3OTO L;  3E0J A;  4RKB A;  1WTV A;  2Q2T A;  4OWT B;  5K36 G;  3CQZ H;  1XXG A;  2RSN A;  1VQ6 A;  3EBE A;  1DOL A;  4JI1 Q;  2KVM A;  4ME5 A;  1UE7 A;  2R7Z H;  3BDC A;  4Q0F A;  4B3S L;  2JXM B;  1J8I A;  1I6H B;  1RJT A;  4QB4 A;  1TWF B;  1ICF B;  4OWX B;  2Q2I A;  1EY7 A;  3E9H A;  2N55 A;  2WV6 D;  3GP7 A;  3STB D;  2XN9 C;  5EGT A;  3S15 B;  4KY7 A;  2NVY B;  3K5M A;  2A1A A;  2D5D A;  4FXK C;  4P74 A;  2A69 C;  1K3R A;  3AU7 A;  1XTC D;  3J7Y W;  1GUT A;  2AWN A;  1ET9 A;  2O4X A;  4C3J H;  1JCK B;  4R4T A;  1Z9F A;  4YIJ A;  2LSS A;  3K7A B;  2NWG A;  1VS0 A;  1VQ4 A;  4BBS B;  4F7X A;  1GHK A;  1YI2 A;  1LM0 A;  4C2M B;  2AQ2 B;  3KUP A;  4B3M L;  1HPC A;  1QVC A;  2UUC L;  1SEB D;  1C8C A;  4JG2 A;  3U50 C;  3NEM A;  3J7A F;  5IT9 L;  3EJI A;  4G7Z C;  5JEA J;  2M2L A;  1XWE A;  4IFD H;  2QDB A;  1PTO H;  1RD9 D;  2B2W C;  5JJK A;  4C3H H;  1N34 Q;  3NXW A;  1LAB A;  1SLJ A;  4DR5 Q;  1EEF D;  2I5H A;  4AH6 A;  4LUZ A;  4G7O C;  4LF5 Q;  2ZTD A;  5C44 H;  3W1B A;  1ESR A;  1SXT A;  1YNJ D;  2JP1 A;  4R4I A;  5ISR A;  1N36 L;  5E7N A;  1PTO F;  1U9R A;  2MGS A;  3D8G A;  4DN4 M;  4A3B G;  2E2I B;  4MZ9 A;  1NR4 A;  1PRT C;  4IN3 A;  3UDG A;  2WP8 J;  2B2Y A;  2H5X A;  3ERQ A;  3GTP B;  3PIO A;  3PUY A;  4IOA A;  1DYQ A;  1OXX K;  3T1Y Q;  1XPU A;  1I4X A;  3DM3 A;  1DGS A;  2HHH Q;  4ALP A;  5D14 A;  5IYC H;  1TY0 A;  2XWB B;  3J80 i;  2F0L A;  1II3 A;  3HOZ G;  3WDN A;  3OMG A;  5FLM G;  2JEA I;  1ZYR D;  2F0N A;  4HTH A;  3NE5 B;  5D3I B;  3R8B A;  1R9T H;  4OGQ C;  4HR7 B;  1LYL A;  2V1C C;  2R93 B;  1WFQ A;  2QEJ C;  2NN6 I;  4GNX C;  1M90 C;  2N49 A;  1V1P B;  4ZUJ A;  1Y8N B;  4DV5 L;  3CD6 A;  1A6X A;  4PQX A;  4XQQ A;  5IYB H;  4FP5 D;  5IT9 c;  4XQN A;  4Y7N B;  1YHB A;  4HN7 A;  1STB A;  1EQQ A;  1EYD A;  1PHJ A;  4IUT A;  2NVT B;  2K5W A;  2GA4 B;  1WI5 A;  4AYB B;  3S2H B;  4GNX B;  1Q1B A;  3NPP A;  5M3F G;  3R93 A;  2F0F A;  3S16 B;  1N32 L;  1LT5 D;  2A74 C;  2KCN A;  1TWA B;  5AFW A;  2CKZ B;  3U4Z A;  2I5M X;  3I70 A;  4X65 Q;  4RG1 A;  2PW5 A;  1SNM A;  3RLN A;  5J1Z A;  3OWE B;  2F0D A;  2B2T A;  4DV1 Q;  1I6V C;  4NXM Q;  4R4C A;  4GKK L;  1L1O A;  5IOD A;  1I3Q H;  5M3F H;  1FVI A;  2CW0 C;  4PZ6 A;  3A55 A;  2RHQ B;  1S5D D;  2KJX A;  3H3V I;  5CV7 A;  3T1H Q;  1KNE A;  3M4Y A;  1E24 A;  3W1G A;  1XTD A;  3BVZ A;  2WKD A;  1TVX A;  2F3W A;  1BXT A;  1ASY A;  4DR3 L;  3L9A X;  4WJW A;  2EYM A;  4KJN A;  3V05 A;  4DV4 L;  5LL6 S;  4Z9C B;  2K1B A;  2NBF A;  4P75 A;  2AHO B;  5KNB A;  1QUQ B;  3I4L A;  4DUZ Q;  1JR0 D;  4JI3 Q;  2EDG A;  2EYJ A;  4B3T Q;  1AH9 A;  1PXU A;  2WAQ G;  5IGB A;  1YJ9 A;  2JA8 G;  4K0K L;  4BY1 H;  5GAH C;  4A3F G;  3J7A V;  5C5M A;  2E8G A;  5LMN W;  1ASZ A;  2Y0S G;  4HMJ A;  3OHX C;  2IL8 A;  1O7I A;  5C0X H;  2NVX B;  2R6G A;  3MFY A;  4QMG A;  3SGI A;  1FYC A;  2AKW B;  2QW7 A;  3CHB D;  3TQY A;  2JA8 H;  2HQL A;  1S72 A;  2A69 D;  1HZB A;  2F1M A;  4X62 L;  4HID A;  1IBL L;  4UY8 C;  4OO1 H;  4RA8 A;  1K73 C;  1F9R A;  4XT3 B;  1FL0 A;  1I4G A;  3MC0 B;  1BKB A;  1H9R A;  3LWE A;  4A3E G;  3CCV A;  4KY6 A;  3NQT A;  3NEN A;  3Q8D A;  5FK9 C;  1C48 A;  3U9O A;  2PW7 A;  2VZA A;  3PO3 B;  4B9X A;  1G6Z A;  4HMI A;  4JI1 L;  1X6O A;  2JA6 G;  1AZQ A;  4NB3 A;  3VR4 A;  4ILW A;  1FGU A;  1PYB A;  4IJL A;  3PF5 A;  4MTK A;  1KIX A;  1SN8 A;  4CDD C;  1YHQ A;  1EFW A;  1DM0 B;  4RKL A;  1NNX A;  4KLK A;  3SE0 A;  1XNQ Q;  2F4I A;  2PYK A;  1V43 A;  2JA6 H;  5M9O A;  3MXN B;  3ITP A;  4AYB E;  3HOW B;  3U9S A;  1L0X B;  1N8R C;  4JI4 L;  4C1N K;  4UAI A;  3GTQ H;  2F0H A;  2B2V A;  2HDM A;  5KNC A;  4CJ2 C;  1PTO B;  3QOJ A;  2AMC B;  3U58 A;  3VYU A;  1DON A;  2E2H B;  3W5O A;  1K8A C;  4X3K A;  1PRT D;  3HOX H;  1MD2 D;  1VF7 A;  3I91 A;  2WB1 G;  3FRP B;  1XMO Q;  1C9O A;  1H9K A;  4R1J A;  1GO3 E;  4DNI A;  4RCN A;  2PZW A;  3RZD B;  4KN4 C;  4IUR A;  2I5L X;  1Q3L A;  4PMB A;  4A3J H;  2RQX A;  3CCS A;  3J81 c;  3TRZ A;  3K0X A;  1T5X D;  1SNQ A;  1NY4 A;  2PPB C;  1CKN B;  1U0L A;  4JV5 Q;  1GUG A;  1EY4 A;  1IYV A;  3I8Z A;  3D6C A;  1A62 A;  2PNH A;  4R8N A;  2QA4 A;  4A3C G;  1EYA A;  1PFN A;  1ESF A;  1S3O A;  2B63 B;  3KFU A;  1WCM B;  4QL5 A;  4A3B B;  2NVQ H;  1YJW A;  4A3D G;  1A3V A;  3OW2 A;  1EYG A;  2CWA A;  5D65 A;  4DR6 Q;  2ZXO A;  3OTO Q;  1BQQ T;  2NYZ D;  2LMC B;  3H09 A;  2EXD A;  3OIQ A;  5NUC A;  3ULJ A;  4BBR B;  3G6J B;  3PGZ A;  2O5J C;  3IL8 A;  4A3K G;  3PCO B;  2RDH A;  3H0G H;  3UDX A;  3FMC A;  4A3I B;  5C3E B;  1HNW Q;  3DWA A;  4UP9 A;  4A3D H;  1HUM A;  3HOZ B;  4EQN A;  4U67 3;  1XYI A;  1Q7Y C;  3IAY A;  2D0P A;  1VCI A;  4MIU A;  1JWU D;  2K5H A;  5ELN A;  1Y1V H;  1IYU A;  2ZT9 C;  1F2L A;  4LW1 A;  2I07 B;  4LF6 L;  5M3M H;  2F0M A;  4A3K H;  3JAM L;  1WVL A;  1YEZ A;  3Q23 A;  1EIF A;  3CRL C;  3UI2 A;  5CGK A;  1G2T A;  2Z9H A;  1T5E A;  4XYQ A;  4ZYS A;  4ID6 A;  2OT2 A;  1CTM A;  4L6T B;  3FVQ A;  3I7F A;  4B3R Q;  2XRS D;  2EXZ A;  1B9N A;  1LLR D;  2N88 A;  1PH3 A;  2K75 A;  4LWC A;  5DEH A;  1I94 Q;  4G4K A;  1AP0 A;  2UU9 L;  2K52 A;  5FLX c;  1KXL A;  2C5C A;  2F0J A;  2IJ0 A;  1QIL A;  3MA2 B;  5IE8 A;  2CH4 A;  2J4X A;  1NMF A;  3UE1 A;  1JMC A;  2QCP X;  4C3I H;  2MQH A;  1SYE A;  3D0F A;  1UNS A;  5CV9 A;  4X65 L;  5M5W H;  4DV1 L;  1SFO B;  4IJH A;  2FMM A;  2K32 A;  4K5W A;  5IGG A;  4DAY A;  1K0S A;  3I73 A;  2QIL A;  2FHT A;  2HCI A;  2TSS A;  2ZXR A;  1K8M A;  4OXP A;  4DR2 L;  5DLQ E;  1EQR A;  1FGB D;  1E1O A;  3KDF B;  3VR3 A;  3T1H L;  3I4N G;  4H13 C;  1UAP A;  1PYS B;  2RDF A;  1C0A A;  3M85 A;  1GKH A;  2ES2 A;  4DR1 L;  2KOL A;  2BCO A;  5KYL A;  5I6W A;  3A56 A;  1BUV T;  3A7L A;  4DNR B;  1YZ6 A;  4H44 C;  3A5U A;  1EIY B;  2LS0 1;  3HKS A;  3OMC A;  3HFZ B;  3JAM c;  3I56 A;  3VYR A;  1Q8K A;  2Z4H A;  3H91 A;  1U4R A;  2D2C C;  1EU3 A;  2WAQ B;  4LF4 Q;  2ZXP A;  4JI6 L;  4DUZ L;  3ONA B;  4A3F B;  2C35 B;  1FNW A;  4JI3 L;  4H02 A;  1Z6H A;  2JA7 B;  4L5R C;  3VYT A;  1JE4 A;  2B29 A;  2Y0S B;  1G6P A;  2IPK D;  2C9O A;  5COR A;  4KJO A;  5IP9 H;  3GTO H;  4RMF A;  4ZQ3 A;  1HR0 W;  2B8G A;  4JI7 L;  4QUC A;  3ZYY X;  1L0Y B;  3F2U A;  4U68 A;  3K58 A;  1SYF A;  4DV5 Q;  1B2T A;  1GUO A;  1PH2 A;  3QG1 A;  1Q81 C;  2KEN A;  1D1K A;  4A3E B;  1IBM L;  1CHQ D;  1O80 A;  1KRT A;  5EJW A;  3J80 L;  4WJ4 A;  1PFB A;  5C5L A;  4DFA A;  4A3M H;  2PI2 A;  2OEO A;  1HUN A;  5KEE A;  4X66 Q;  4DAM A;  4PV1 C;  1Y1W G;  1HNZ L;  3CP0 A;  4XDX A;  1O78 A;  4ODG A;  1HJP A;  1I50 H;  4LNQ A;  1IHZ A;  4Q5V A;  1B50 A;  4BS9 A;  1MJE A;  3P75 A;  4UHV A;  4OL7 A;  1WJJ A;  4KD3 A;  2EPB A;  2LKV A;  3SR1 A;  3TZD A;  3OSO A;  5CV4 A;  3NBH B;  3T16 A;  2MHV A;  3KJP A;  4ZK9 B;  3A7A B;  4DF7 A;  1F9S A;  1TWC H;  5M5X H;  3PF4 A;  4RGO S;  4EQP A;  3RZO H;  1G8Z D;  4O0A A;  4V19 0;  5IGF A;  2B2W A;  1TWH B;  1CFM A;  2F0U A;  1XNQ L;  3PO2 B;  4MNO A;  2KEC A;  1QZH A;  5KND A;  3E5S A;  4XXE A;  2PZT A;  4DXG A;  4DV4 Q;  2EJF C;  4ZRZ A;  5ELF A;  2EE1 A;  2WB1 B;  3VA7 A;  3BDL A;  1PDQ A;  4L5T A;  2JYO A;  3PUV A;  4XQJ A;  1LTL A;  5JOB A;  3J7Z C;  1SSO A;  2XRQ D;  1X3Q A;  1D5Z C;  3R2T A;  4JVZ A;  3ERS X;  2E74 C;  1IZ6 A;  2CQA A;  1PH8 A;  4DR4 L;  4L5Q A;  1PZI D;  4R4O A;  2KEE A;  2PO4 A;  4IPC A;  1FD7 D;  1XMO L;  2A6E C;  2NVQ B;  1EY0 A;  3C1E A;  5F2D A;  4RHS A;  4HSV A;  1AE2 A;  2A68 C;  5IY0 A;  2CHB D;  3J80 c;  4QF4 A;  2YU9 H;  3M3Y H;  3EFX D;  3QOL A;  1EIH A;  2VL6 A;  4YWL A;  2GVB A;  5CBA E;  3MHB A;  1XNR Q;  2UXD L;  4OEM B;  1VQG A;  1IBL Q;  4X62 Q;  4A3D B;  2OCE A;  3D4D A;  2L5T A;  5A2Q E;  4MHE A;  1K83 B;  2FMC A;  2YTV A;  2WAQ E;  4RGT A;  3BDO A;  1MHW C;  3FKI H;  4IOC A;  1Q86 C;  1HRJ A;  1IKL A;  1WTR A;  4EVO A;  4GNX A;  2L0C A;  4DR6 L;  2Y0S E;  1TQO A;  2XVS A;  4ZLT F;  1Y8O B;  1S5E D;  3KOJ A;  3KBG A;  3QJY A;  5COY A;  3HS0 C;  4DK1 A;  5FO8 B;  5GQO A;  4C1N I;  1HNW L;  3K0Y A;  4YCV A;  4EX5 A;  2CFM A;  3CCJ A;  1VQ5 A;  2F0V A;  1MI2 A;  3NSW A;  3HKZ E;  1F9P A;  2EY1 A;  2Q2U A;  4C3J G;  1C4Q A;  3M7G A;  3GTJ H;  3OPO A;  4JI4 Q;  2RF4 A;  4DK0 A;  3CAM A;  1OXT A;  3E3X A;  2X6G A;  5IYD G;  4GOP B;  3P7J A;  4IPH A;  4L8J A;  2JSO A;  4A3G H;  3WWV A;  4B3R L;  4GLX A;  5C4J H;  2DN8 A;  4QGU A;  1KD1 C;  3S2D H;  3G4S A;  3PUW A;  3PIP A;  3ND8 A;  4IFD G;  1HZ9 A;  1I94 L;  4C3H G;  3ULL A;  2EQS A;  1QVF A;  1VQI A;  5IYD H;  2RHS B;  2BOS A;  3S9W A;  1JT8 A;  5C44 G;  2KHJ A;  2WKC A;  1UE5 A;  2D62 A;  3ERO A;  4KHZ A;  1D6E C;  4IUN A;  3GTM B;  3OWF A;  4CJ0 B;  4RCO A;  1A15 A;  1Z7T A;  2K33 A;  2PQE A;  1KDC A;  1EQV A;  4K6L A;  4QY7 A;  4DGZ A;  2WB1 E;  5ELD A;  1LT3 D;  5DNF A;  1PH4 A;  4A93 H;  2NZH A;  2ZJP A;  4MTN A;  3S1R H;  3I4N B;  3MXU A;  3O13 A;  3MEH A;  5ELO A;  3VA5 A;  1BOS A;  1HR0 L;  3EIV A;  2R3Z A;  5G3L D;  5LMU L;  1SMY D;  3IFD A;  1IXR A;  3M4P A;  3TN2 A;  1LUZ A;  3RMH A;  5IYC G;  4HJ7 A;  3S24 A;  2B2U C;  1J6Q A;  4MN3 A;  1D5M C;  4ZCK A;  1PH9 A;  2VB3 X;  2L9H A;  1NR2 A;  2NZ1 D;  5CYU A;  1V9P A;  1GD7 A;  2Q8I B;  1RKN A;  2G9D A;  2F3V A;  2JJQ A;  4LF9 Q;  2PNR C;  1IL8 A;  3MFG A;  4LF4 L;  3OW7 A;  2FIN B;  2H4O A;  2K4K A;  3CXC A;  4LF6 Q;  3LGJ A;  3S1Q B;  1JOQ A;  4K8J A;  1O7Y A;  5BN5 A;  1LAC A;  5IYB G;  3CF5 A;  5CV5 A;  5JVH 3;  1JIC A;  1I4H A;  5DAU A;  2FXQ A;  1B7Y B;  3HOY H;  3KF8 A;  4PMC A;  4P72 A;  1E1T A;  3BG3 A;  1BCP D;  1TWG H;  3FPU B;  1YJN A;  4J8Q A;  2UU9 Q;  2XSC A;  3NK9 A;  5EQ0 A;  3K59 A;  2RA4 A;  3M4O H;  1Y1W B;  1TWC B;  3PUZ A;  1CKM A;  1JOO A;  3VR5 A;  1VF5 C;  4CDE C;  1EWI A;  1N33 L;  4CJ1 B;  5IGE A;  4X66 L;  3TP7 A;  1WTO A;  2XNA C;  1GHJ A;  1EU4 A;  3FHW A;  4GLA C;  2FFK B;  1YVC A;  3S1N H;  2A6E D;  1MSH A;  5BR8 L;  1SBB B;  2A68 D;  4DXF A;  4DV7 L;  1E2Z A;  3T13 A;  4XIG S;  1A0I A;  1M4V A;  1PLF A;  5IWA L;  4OWW B;  5JPM C;  5LMN Q;  3K5O A;  1D7Q A;  4IUP A;  1O7L A;  4DR2 Q;  3WOE A;  1G91 A;  1HH2 P;  1BO0 A;  3GTL H;  3OOC A;  4BWG B;  4X3T A;  4I7A A;  2AQ3 B;  4K2L A;  5EPL A;  4DR1 Q;  3LX0 A;  4YCU A;  2JK8 A;  2EY5 A;  2CVR A;  2VUM H;  2R92 H;  1B9M A;  2A5H A;  4X64 Q;  4N8F A;  1SJH D;  4BY1 G;  3K8A A;  5FO9 B;  1Q90 A;  2KCM A;  4E6I A;  2HCC A;  3L3O C;  3W3A A;  4JI6 Q;  1S40 A;  5C0X G;  1Q12 A;  5IOC A;  2K5V A;  1PMR A;  5L37 A;  1YHA A;  4HCS A;  2VQF Q;  4K2K A;  1M8A A;  4OO1 G;  2H1E A;  3CPF A;  4F88 A;  5JVG 3;  1X56 A;  3KK7 A;  4JI7 Q;  4UP7 A;  4JBW A;  3CQZ B;  1SJE D;  4A4I A;  2KCT A;  3CC7 A;  3GTK H;  2MO0 A;  4HJ9 A;  2TMP A;  1IBM Q;  1XNR L;  3FPP A;  2R7Z B;  3S17 H;  3UDF A;  3J81 L;  4IUQ A;  3RLF A;  2K7V A;  2SOB A;  4HJA A;  3GDE A;  3NUC A;  1E7Z A;  2I0Q A;  5BN4 A;  4CGY B;  2A6H C;  4NP5 A;  1GOZ A;  1HNZ Q;  2VB2 X;  2L15 A;  4JI0 L;  5E4W C;  1ICW A;  5EKI A;  5M5Y H;  3J81 j;  2IT1 A;  1ET6 A;  1MGS A;  1GUN A;  4K6D A;  1QJO A;  1W6K A;  3I55 A;  3MVV A;  3I72 A;  5J39 A;  3M9B A;  1EFI D;  1ILP A;  3GTG H;  5C4Z A;  4C3J B;  3CCU A;  1TII D;  3HOU H;  4N9T A;  2Z4I A;  4BY7 H;  2NN6 G;  1V1O A;  1UE1 A;  1PTO C;  5CR3 A;  3AQQ A;  1SYC A;  2K6A A;  3W2D A;  2MFI A;  3HOX G;  2RBM A;  3GV3 A;  4IQZ A;  1VMP A;  1LTS D;  4JOI C;  2NN6 H;  1CM9 A;  3DEP A;  4C3H B;  1B44 D;  1HCZ A;  1KQS A;  4A3J G;  5T1G A;  3RNU A;  4DR4 Q;  2K05 A;  3QR8 A;  1F2Y A;  1SRO A;  1OO9 B;  1CSP A;  4CHT B;  5C44 B;  1PA6 A;  2K14 A;  2UXC Q;  4JBM A;  3KLW A;  1KHI A;  1NJI C;  3F2C A;  3GV6 A;  4J6H A;  4IUV A;  1KLU D;  2RKS A;  1Y69 U;  4LFC Q;  1CA5 A;  1RIP A;  1YNN C;  2L55 A;  3NTI A;  5FLX L;  2UXD Q;  2ICI A;  1QE6 A;  3QO2 A;  2QKI C;  5G3L F;  3DHQ A;  5GRO A;  2B2T C;  2DGY A;  1CT1 D;  5KGU A;  3H3V H;  1IBK Q;  3H0G G;  4X3S A;  4Y52 H;  1SR3 A;  5IP7 G;  1B1Z A;  4WFN 3;  3IKJ A;  3DLL A;  3F8T A;  1LTR D;  5KYI A;  3PUX A;  1Y1V G;  5JJZ A;  1R9T B;  2SDF A;  3K5N A;  1X3E A;  5M3M G;  1GXD C;  5JEA G;  1ENA A;  2JA5 H;  2YTX A;  5IP7 H;  3CPW A;  3U4V A;  5K5P A;  1XJV A;  5DM7 3;  1CSQ A;  2F0E A;  2N3S A;  4O42 A;  1ML0 D;  4LF9 L;  2VQE Q;  1PFS A;  1IYJ B;  4LFB L;  3A54 A;  3QWN A;  5JEA H;  1EY9 A;  5FJ8 H;  2E2J H;  2ZM6 Q;  1G2S A;  2CW0 D;  1BCP F;  1K28 A;  1SE8 A;  3V2T A;  5KIX A;  4IO9 A;  5JPN C;  2E5L Q;  2I46 A;  4K5X A;  2PQA B;  1I3Q B;  5M3F B;  4C3I G;  2IX3 A;  3QB3 A;  1B3Q A;  4UP8 A;  3A8I E;  2KCC A;  1J5E Q;  1UWV A;  4DKA C;  3BU2 A;  3VDY A;  2Z1C A;  3TP5 A;  2KED A;  1I6H H;  3D6W A;  3TME A;  2RCF A;  2RVL A;  3T51 B;  3CKI B;  3UDI A;  4CKC A;  3DXJ C;  1TWF H;  3K7U C;  2CWP A;  3HEJ A;  4KKU A;  3N52 A;  3TBI B;  1B8A A;  3C2P A;  1I5F A;  1SYG A;  2Z6K C;  3S15 H;  1HR0 Q;  1LV9 A;  5LMN L;  2XTI A;  5LMU Q;  4BBS G;  1F2Z A;  1WTW A;  4JK1 C;  4H0L C;  4CKB A;  1WD1 A;  1SDF A;  1VQD A;  4OX9 L;  4A75 A;  2F0G A;  1X3G A;  4OIJ A;  4P71 A;  4BY1 B;  4LF7 L;  3C46 A;  1VQ8 A;  4IUU A;  4RH6 A;  3K7A H;  3CCR A;  4DNT B;  2A6H D;  2F0Q A;  4BBS H;  5LL6 X;  4JW0 A;  3STB C;  4X64 L;  3CC2 A;  4JC0 A;  5HY6 A;  3K6O A;  4C2M H;  5IP9 G;  3KLS X;  1X32 A;  2JA8 B;  4LJZ C;  3NP8 A;  1R4Q B;  3NWT A;  1VQ7 A;  1STE A;  4LAA A;  3BZD B;  1QG7 A;  2EZV A;  3CMA A;  1F2M A;  4GZY C;  2HIV A;  2VQF L;  1B3A A;  4HIK A;  1CUK A;  1P16 A;  4A3M G;  4S3S A;  1NAP A;  3TDQ A;  3VR6 A;  1ONL A;  1QB5 D;  2QDL A;  1IW7 C;  4KD4 A;  4FYD A;  4J15 A;  4QQB X;  1LT4 D;  3C1F A;  1AFP A;  1VQF A;  2JE6 I;  4LFA L;  4R9W A;  4KV6 A;  1TXY A;  2AUK A;  3LWU A;  3PV0 A;  4KI0 A;  2E2I H;  1N33 Q;  3E0E A;  4JBK A;  4ABN A;  2IX1 A;  4KHP Q;  4B9W A;  5E1F A;  4KMU C;  2JA6 B;  4ZKC B;  1S4Z A;  2PZU A;  4TSS A;  1K8G A;  1H9S B;  1B4O A;  3KJO A;  3A8K E;  5BR8 Q;  1K9M C;  1A2U A;  1A3U A;  5FO7 B;  4NKL A;  3GTQ B;  4PG3 A;  4N9P A;  1EOT A;  3KF6 B;  2NUC A;  3MWY W;  4DV7 Q;  3NHH A;  5H1S E;  3HOV G;  5IWA Q;  1J9O A;  1VQL A;  1EWC A;  3HOX B;  5HUR A;  1NMG A;  2XIW A;  5C4X G;  2MJ8 A;  4CDC C;  3MAQ A;  3ICE A;  1MKH A;  2L4N A;  2R93 H;  1AE3 A;  4RAU C;  3P1H A;  2B39 A;  3HOV H;  3RR5 A;  5CMD A;  1GM5 A;  3GD7 A;  3R3O A;  1DOM A;  1SE3 A;  3AB9 A;  1PRT F;  4CBV A;  4A3J B;  4L5S A;  3ZJY C;  1ZYR C;  2K03 A;  4Y7N H;  1EWH A;  3MXG A;  2BA1 A;  5C4X H;  1CKO A;  1VQN A;  3SK8 A;  3H94 A;  5A2Q L;  2ATW A;  2NVT H;  5EBD A;  2JN4 A;  4NPS A;  2XGT A;  3AMU A;  4K14 A;  3X3M A;  1F9Q A;  1I4P A;  2F0K A;  3MEF A;  1MBY A;  2B2U A;  1BBW A;  4JI2 L;  1AZP A;  3S16 H;  2F3I A;  4OEL B;  2UXC L;  1TWA H;  4CKE A;  3I4O A;  2JQO A;  3N6R A;  3HGB A;  1LT6 D;  1NE3 A;  1PH1 A;  3FKI G;  4GS3 A;  1FR3 A;  2Z0S A;  1HXY D;  3AYH B;  4DV6 L;  4LFC L;  1JOK A;  1VMC A;  3EVQ A;  1V1P A;  4YCW A;  3H0G B;  1HFG A;  3PIO 3;  1BCP B;  1QCB D;  1UEA B;  2F0O A;  4FF2 A;  1PFM A;  1DOK A;  1A2T A;  3GQB A;  2OQK A;  2NZO A;  1GJX A;  1Y1V B;  2LXK A;  1JB3 A;  1IBK L;  1VQH A;  3DEO A;  5M3M B;  4M8A A;  4A3K B;  1JJ2 A;  4JI0 Q;  4RWS C;  2L11 A;  4HJ8 A;  4YY3 L;  4PZ7 A;  1DZ1 A;  1XPO A;  1OXV A;  4DV2 L;  1H9J A;  2IW3 A;  1RF2 D;  4DAY B;  2Q8R E;  4IPD A;  3TP6 A;  5FOB B;  1BNZ A;  1T9H A;  5EBC A;  1HQR D;  2DJF C;  3RD4 A;  1HNX Q;  3KYH C;  4DUY Q;  1STY A;  3TZU A;  2VQE L;  2GVA A;  1HZA A;  4GOP C;  4EQ5 A;  4TKO B;  2R61 A;  1UEB A;  2VW9 A;  1NUC A;  4A3G G;  5JJL A;  3H15 A;  2NVX H;  3SK6 A;  4JYA Q;  2KA7 A;  3NWS A;  1OXU A;  2YYZ A;  5A35 A;  2ZM6 L;  4POG A;  1EYC A;  3Q24 A;  1M1K C;  5EPK A;  3PO3 G;  3A5Z B;  1EOV A;  1TR5 A;  4C3I B;  2OXP A;  3BZK A;  4X3U A;  1CA6 A;  2E5L L;  5K36 H;  1QUQ A;  2KHI A;  5M5W B;  3CW2 C;  1SYD A;  3HZX A;  4FNF A;  4A76 A;  1JJG A;  2RCN A;  1X54 A;  2G5D A;  5CC4 A;  4IAL A;  3Q22 A;  3PO3 H;  1FNV A;  4A93 G;  1B53 A;  1KDA A;  3PQI A;  1J5E L;  2HIX A;  2F0W A;  1JE5 A;  4OHJ A;  1SE2 A;  1Q8I A;  3HOW G;  3D4W A;  4YWK A;  4ME3 A;  3TRE A;  2ZTC A;  5E4X A;  1ENF A;  1EZ8 A;  4DV0 L;  2ID0 A;  1RCV D;  1CHP D;  3B6Y A;  1SRU A;  1IW7 D;  4HED A;  5EAY A;  1HTL D;  2EYO A;  3I3C A;  4NW2 A;  3HOW H;  1VQB A;  1G29 1;  4X6A H;  1G51 A;  2KHS A;  3SHL A;  1BBX C;  5I2Y A;  1AW7 A;  5EKL A;  3ND9 A;  3AEV A;  3NQI A;  1FJG Q;  3RN5 A;  3NTH A;  4BA1 I;  1KNA A;  5C0X I;  4DAV A;  2F0I A;  2E2H H;  3GTO B;  3K81 C;  2D9U A;  2ASB A;  4OO1 I;  2CCZ A;  1EY5 A;  5C3X A;  1IKM A;  3RZD H;  4QCL A;  2UXB Q;  2F0T A;  4HAE A;  2B63 G;  4LFB Q;  4R4Q A;  4DR7 Q;  3HOY G;  2K50 A;  4ULL A;  5C6A A;  1WCM G;  4A3M B;  1D2B A;  3HRZ C;  3MXN A;  1IL2 A;  1KAA A;  2RDG A;  4QJF A;  5IT9 E;  4GN3 B;  3NTK A;  3F2B A;  3D3R A;  4DV3 L;  1EUJ A;  1UUP A;  4BBR G;  3SK4 A;  1PH6 A;  4GKJ L;  1VQK A;  3R2I A;  2B63 H;  1I50 B;  2HUG A;  2OWO A;  4LF8 L;  1WCM H;  1PV4 A;  5I6Y A;  4A3B H;  4A3I G;  4GLV B;  4WOR A;  5C3E G;  3CRK C;  3ER0 A;  1VQP A;  1WOC A;  1PRT B; 
#chains in the Genus database with same CATH homology
 2QGQ A;  1NBW A;  4OXP A;  2IHF A;  2OQ0 A;  5DLQ E;  4DR2 L;  1EQR A;  4JV5 L;  1RL2 A;  4JOI C;  4BBR H;  1E1O A;  3KDF B;  3T1H L;  3I4N G;  3I2Z A;  1KAW A;  4GN5 A;  1PYS B;  4JOI A;  3EN2 A;  3D31 A;  1E22 A;  1U5K A;  4LUO A;  2EIF A;  1L0W A;  1C0A A;  1KQS A;  3K80 C;  3M85 A;  1GKH A;  1W2B A;  2ES2 A;  4A3J G;  3CC4 A;  4DR1 L;  3BZC A;  3E9I A;  1VQO A;  3RNU A;  4KHP L;  4DR4 Q;  4A3I H;  5C3E H;  1SMX A;  5GAE C;  4JI8 L;  1OXS C;  3HOZ H;  1SRO A;  1CSP A;  1YZ6 A;  2R7Z G;  4YWM A;  5FLM H;  1X55 A;  3A5U A;  1X65 A;  1EIY B;  3HKS A;  3F1Z A;  2K14 A;  1CKN A;  1PA6 A;  3AFP A;  2UXC Q;  4FDB A;  4JBM A;  3HFZ B;  3JAM c;  3I56 A;  3NEL A;  3JAM i;  2GN5 A;  5J3B A;  3KLW A;  4DPG A;  1Q8K A;  3OTO L;  1YIJ A;  2Q2T A;  1KHI A;  4OWT B;  1NJI C;  3CQZ H;  3F2C A;  5K36 G;  4LF4 Q;  1VQ6 A;  4JI6 L;  4AIM A;  3EBE A;  4DUZ L;  4BXX G;  2YTY A;  2VUM G;  4JI1 Q;  1H95 A;  2C35 B;  1KC8 C;  2R92 G;  5AJ3 Q;  3S1M H;  4JI3 L;  1VQE A;  4LFC Q;  1RIP A;  1UE7 A;  4H02 A;  4L5R C;  2R7Z H;  1VQA A;  2B29 A;  4B3S L;  2UXD Q;  1G6P A;  3FP9 A;  4HJ5 A;  4OX9 Q;  3A0J A;  3GTO H;  5IP9 H;  2AWO A;  2F4V L;  4RMF A;  5GRO A;  4LF7 Q;  1HR0 W;  4OWX B;  4BXX H;  2DGY A;  4JI7 L;  1PVO A;  2Q2I A;  3H3V H;  1IBK Q;  1XMQ L;  1VQJ A;  3H0G G;  4Y52 H;  1SR3 A;  5IP7 G;  1PH5 A;  4DV5 Q;  3E9H A;  1A8V A;  3UDX A;  3STB D;  1PH2 A;  1Q81 C;  2KEN A;  1IBM L;  3DLL A;  3F8T A;  1KRT A;  2A1A A;  1Q1E A;  2UUA L;  4P74 A;  3PUX A;  1Y1V G;  2ALY B;  1K3R A;  4WJ4 A;  3M7N A;  4A3M H;  2PI2 E;  2PI2 A;  1X3E A;  5M3M G;  2AWN A;  4NXN Q;  2OTL A;  4C3J H;  5JEA G;  2CQO A;  4X66 Q;  4R4T A;  1Z9F A;  2K5N A;  4DAM A;  2YTX A;  5IP7 H;  2LSS A;  3CPW A;  2JA5 H;  3U4V A;  1Y1W G;  1HNZ L;  1VS0 A;  1XJV A;  1VQ4 A;  1CSQ A;  3CP0 A;  2N3S A;  1YI2 A;  1HJP A;  1I50 H;  4LF9 L;  2VQE Q;  4LNQ A;  1PFS A;  1N9W A;  1LM0 A;  4O2D A;  1IYJ B;  4LFB L;  3IRB A;  1SFO H;  1GVP A;  3OYY A;  1MJE A;  4B3M L;  1QVC A;  2UUC L;  2UUB L;  1WJJ A;  2R7D A;  4JG2 A;  3U50 C;  3NEM A;  3NBH B;  5FJ8 H;  4JBJ A;  2E2J H;  3KJP A;  4LFA Q;  2PQA A;  2ZM6 Q;  5JEA J;  1TWC H;  5M5X H;  3PF4 A;  3RZO H;  5JJK A;  4O0A A;  4C3H H;  1N34 Q;  1Z47 A;  1SE8 A;  1SLJ A;  1XNQ L;  4IO9 A;  4DR5 Q;  2E5L Q;  4MNO A;  2I5H A;  4AH6 A;  2JA7 G;  4LUZ A;  1QZH A;  4LF5 Q;  2PQA B;  2ZTD A;  5C44 H;  3HOU G;  2N78 A;  3W1B A;  4DV4 Q;  4BY7 G;  4P73 A;  2ZTE A;  4R4I A;  4L5T A;  1N36 L;  3PUV A;  4UP8 A;  5E7N A;  4A3F H;  1LTL A;  3J7Z C;  4XTC S;  4A3B G;  3G48 A;  3RN2 A;  1UWV A;  4DKA C;  1J5E Q;  4MZ9 A;  3BU2 A;  3VDY A;  3I4M G;  3ERS X;  3GO5 A;  1IZ6 A;  2JA7 H;  4DR4 L;  4IPG A;  1PH8 A;  4L5Q A;  4R4O A;  3UDG A;  2WP8 J;  1HNX L;  2H5X A;  4IPC A;  4DUY L;  1I6H H;  4YHH Q;  3PIO A;  1XMO L;  3PUY A;  4IOA A;  3UDI A;  3HKZ G;  3K7U C;  1TWF H;  1OXX K;  3KDF A;  3T1Y Q;  1XPU A;  3DM3 A;  2CWP A;  1DGS A;  2HHH Q;  4ALP A;  1AE2 A;  5IYC H;  5IY0 A;  3J80 c;  3J80 i;  3I4M H;  4JYA Q;  2YU9 H;  1B8A A;  3M3Y H;  1VQ9 A;  1I5F A;  2Z6K C;  3HOZ G;  4JYA L;  3S15 H;  1HR0 Q;  5FLM G;  2VL6 A;  4YWL A;  2GVB A;  2XTI A;  2Z6K A;  5LMN L;  5LMU Q;  4A3E H;  2JEA I;  4BY7 H;  4BBS G;  1XNR Q;  4WJ3 M;  2UXD L;  4GN4 B;  3S14 H;  1VQG A;  1VQD A;  1IBL Q;  4OX9 L;  4X62 Q;  1R9T H;  2OCE A;  4A75 A;  1X3G A;  4LF6 Q;  4TQU S;  2YTV A;  2F52 A;  2WAQ E;  1B70 B;  4P71 A;  4LF7 L;  1VQ8 A;  1LYL A;  3FKI H;  2V1C C;  4IOC A;  1WFQ A;  3K7A H;  2NN6 I;  2VS1 A;  4JI2 Q;  3CCR A;  4GNX C;  1Q86 C;  1M90 C;  2N49 A;  4BBS H;  4DV5 L;  4GNX A;  3CD6 A;  2BA0 A;  4DK6 C;  2Y0S E;  3STB C;  4DR6 L;  4X64 L;  3CC2 A;  4JC0 A;  5IYB H;  3BJU A;  5HY6 A;  3RLO A;  4C2M H;  5IP9 G;  5IT9 c;  1YHB A;  1QVG A;  3PO2 G;  1EQQ A;  1QZG A;  1PHJ A;  3KF8 B;  1WYD A;  1L2F A;  3KOJ A;  4AQY Q;  1VQ7 A;  4DV6 Q;  1WI5 A;  1C7Y A;  4GNX B;  1Q1B A;  5GQO A;  5M3F G;  1HNW L;  5JJI A;  3CMA A;  1KL9 A;  4YCV A;  2HIV A;  4BA2 I;  1A63 A;  4PMW A;  4EX5 A;  2CFM A;  2VQF L;  3CCJ A;  1VQ5 A;  1TWH H;  4HIK A;  2ZJR A;  4JI5 Q;  1N32 L;  1CUK A;  1P16 A;  2CKZ B;  3U4Z A;  2I5M X;  3PO2 H;  4A3M G;  1MIU A;  4X65 Q;  3HKZ E;  4RG1 A;  3RLN A;  2Q2U A;  1D8L A;  1L1O C;  4DV1 Q;  4NXM Q;  4GKK L;  1E3P A;  4R4C A;  2JA5 G;  1L1O A;  1I3Q H;  4J15 A;  4QQB X;  5M3F H;  3GTJ H;  1FVI A;  4JI4 Q;  1VQF A;  2JE6 I;  2RF4 A;  4LFA L;  3CAM A;  4YY3 Q;  1OXT A;  1TXY A;  4PZ6 A;  2RHQ B;  1FJG L;  1BVS A;  3H3V I;  3T1H Q;  3PV0 A;  4KI0 A;  1N34 L;  5IYD G;  4DV2 Q;  2E2I H;  3CCL A;  4GOP B;  1N33 Q;  3E0E A;  4JBK A;  4PZ8 A;  2A8V A;  1BBU A;  1E24 A;  4IPH A;  3W1G A;  2IX1 A;  4A3G H;  3KF6 A;  3CME A;  3WWV A;  1L1O B;  1XTD A;  4DR5 L;  1Q82 C;  4B3R L;  4KHP Q;  4GLX A;  2IY5 B;  5FJ8 G;  1X3F A;  5C4J H;  4QGU A;  1KD1 C;  4JI8 Q;  3S2D H;  3G4S A;  1ASY A;  4LF5 L;  3PUW A;  4DR3 L;  3PIP A;  2KBN A;  4IFD G;  4DV4 L;  1HZ9 A;  1K8G A;  1I94 L;  3KJO A;  3ULL A;  5BR8 Q;  1K9M C;  2UXB L;  2EQS A;  3J7A 5;  4P75 A;  1QVF A;  2AHO B;  1VQI A;  4PG3 A;  4DR7 L;  4A3C H;  2RHS B;  5IYD H;  3KF6 B;  4DV7 Q;  1QUQ B;  4DUZ Q;  1JT8 A;  2N8N A;  5H1S E;  3HOV G;  5C44 G;  3JC6 6;  5IWA Q;  2KHJ A;  3AFQ A;  4JI3 Q;  1UE5 A;  2D62 A;  4KHZ A;  1VQL A;  4B3T Q;  4B3S Q;  1AH9 A;  2WAQ G;  1NMG A;  1YJ9 A;  2JA8 G;  1K83 H;  5C4X G;  4K0K L;  4QY7 A;  2MNA A;  2IHE A;  2WB1 E;  4BY1 H;  4IFD J;  5GAH C;  4A3F G;  3T1Y L;  1PH4 A;  2HHH L;  2NZH A;  2ZJP A;  4A93 H;  4HIO A;  2E8G A;  4MTN A;  3S1R H;  1MKH A;  3ICE A;  2R93 H;  5LMN W;  1AE3 A;  1ASZ A;  2IX0 A;  5ELO A;  2Y0S G;  3HOV H;  2R7F A;  1YBY A;  3RR5 A;  4DK3 C;  1GM5 A;  1O7I A;  3EIV A;  3GD7 A;  1HR0 L;  2R6G A;  4L5S A;  3SGI A;  3ZJY C;  5LMU L;  2AKW B;  3TQY A;  4Y7N H;  1IXR A;  2JA8 H;  2HQL A;  3M4P A;  2BA1 A;  5C4X H;  1S72 A;  1CKO A;  1HZB A;  1X9N A;  1LUZ A;  4X62 L;  4HID A;  1IBL L;  4UY8 C;  1VQN A;  2ATW A;  5IYC G;  3G6E A;  1K73 C;  4NPS A;  4HJ7 A;  1FL0 A;  2HT1 A;  2XGT A;  3S24 A;  1BKB A;  1J6Q A;  3MEF A;  2MO1 A;  4POF A;  4A3E G;  3CCV A;  1BBW A;  1PH9 A;  4JI2 L;  3S16 H;  1V9P A;  2F3I A;  1GD7 A;  3NEN A;  2UXC L;  4DV0 Q;  1TWA H;  3I4O A;  3Q8D A;  2JQO A;  2JJQ A;  4LF9 Q;  5GAG C;  2VZA A;  1NE3 A;  2B3G A;  1PH1 A;  4LF4 L;  2K4K A;  4B3M Q;  1YNX A;  3FKI G;  4GS3 A;  4JI1 L;  1X6O A;  2Z0S A;  2BH8 A;  3CXC A;  3AYH B;  2UUC Q;  4DV6 L;  5AJ3 L;  2JA6 G;  4NB3 A;  4LFC L;  3LGJ A;  2NVY H;  2PMZ E;  1FGU A;  1PYB A;  4OON A;  4YCW A;  5IYB G;  4IJL A;  3PF5 A;  1KIX A;  1SN8 A;  1YHQ A;  1EFW A;  3CF5 A;  1MJC A;  4KLK A;  2OQK A;  2FXQ A;  1JJC B;  2NZO A;  1B7Y B;  1XNQ Q;  1UE6 A;  2LXK A;  3HOY H;  4APV A;  1V43 A;  4P72 A;  1IBK L;  2JA6 H;  1E1T A;  3MXN B;  1VQH A;  4NXM L;  3CCQ A;  4AYB E;  2VNU D;  1TWG H;  3TS0 A;  1JJ2 A;  4JI0 Q;  5GAD C;  1N8R C;  1YJN A;  4JI4 L;  4HJ8 A;  4YY3 L;  3UE0 A;  2UU9 Q;  4PZ7 A;  3GTQ H;  3M4O H;  3PUZ A;  1OXV A;  1XPO A;  1CKM A;  4DV2 L;  1EWI A;  2AMC B;  1N36 Q;  1N33 L;  4NXN L;  3U58 A;  4DAY B;  3W5O A;  4X66 L;  1K8A C;  4IPD A;  3HOX H;  3GTM H;  1T9H A;  3FHW A;  3L7Z C;  2WB1 G;  1HNX Q;  3KYH C;  4DUY Q;  4GLA C;  1YVC A;  3S1N H;  4DV3 Q;  1C9O A;  1XMO Q;  4R1J A;  1GO3 E;  4DNI A;  4GKJ Q;  5BR8 L;  2VQE L;  2GVA A;  1HZA A;  4GOP C;  3TEH B;  4EQ5 A;  3I4N H;  2DUD A;  4LF8 Q;  1UEB A;  2VW9 A;  4GOP A;  2VY3 A;  4A3G G;  5JJL A;  1XPR A;  2I5L X;  4A3L G;  4DV7 L;  3H15 A;  4A3J H;  2NVX H;  4XIG S;  1A0I A;  3CCS A;  2YV5 A;  5IWA L;  3J81 c;  4OWW B;  3TRZ A;  3K0X A;  3J81 i;  5LMN Q;  1OXU A;  2YYZ A;  2ZM6 L;  1NY4 A;  1D7Q A;  4POG A;  1CKN B;  1U0L A;  4DR2 Q;  4JV5 Q;  4B3T L;  1M1K C;  1HH2 P;  3PO3 G;  3GTL H;  1A62 A;  2PNH A;  3A5Z B;  1EOV A;  2QA4 A;  4A3C G;  3ULP A;  3BZK A;  1S3O A;  3KFU A;  4DR1 Q;  2E5L L;  4A3L H;  1QUQ A;  2KHI A;  3CW2 C;  4YCU A;  4QL5 A;  2JK8 A;  2VUM H;  3GTP H;  1Y14 B;  4A76 A;  2D0O A;  2R92 H;  2RCN A;  2QEX A;  1JJG A;  1X54 A;  2NVQ H;  1YJW A;  3CCM A;  4A3D G;  3OW2 A;  1OTC A;  1KRS A;  2CWA A;  1EYG A;  4DR6 Q;  4X64 Q;  3G71 A;  2LXJ A;  3PO3 H;  4BY1 G;  3OTO Q;  3K8A A;  4QIW E;  2KCM A;  2EXD A;  3ULJ A;  4A93 G;  3PGZ A;  2R93 G;  4JI6 Q;  1S40 A;  1J5E L;  2HIX A;  3S1Q H;  1JE5 A;  4A3K G;  3PCO B;  5C0X G;  2JA9 A;  3HOW G;  1Q12 A;  4YWK A;  3H0G H;  4ME3 A;  3M4Q A;  2ZTC A;  2WFW A;  3TRE A;  2JEB I;  2K5V A;  1HZC A;  4UP9 A;  4A3D H;  4YHH L;  3CCE A;  1HNW Q;  1YHA A;  1Q7Y C;  2D0P A;  2VQF Q;  4DV0 L;  1N32 Q;  1VCI A;  2ID0 A;  4OO1 G;  1V1Q A;  3CPF A;  2K5H A;  5ELN A;  1X56 A;  1Y1V H;  2F4V Q;  1P8L A;  1VQM A;  3B6Y A;  4AYB G;  2NVT H;  4JI7 Q;  4UP7 A;  4LW1 A;  4IFD I;  4JBW A;  3A74 A;  1XMQ Q;  1SRU A;  4LF6 L;  5M3M H;  5EAY A;  4GKK Q;  4A4I A;  4A3K H;  2OTJ A;  2KCT A;  3HOW H;  3CC7 A;  3GTK H;  1YEZ A;  2MO0 A;  4HJ9 A;  1VQB A;  1IBM Q;  1XNR L;  1EIF A;  1G29 1;  4X6A H;  1G51 A;  5C0X J;  1Y1W H;  2UUA Q;  3S17 H;  3UDF A;  3AEV A;  1JB7 A;  1FJG Q;  3RN5 A;  4BA1 I;  4TVA B;  5C0X I;  4JCV E;  2E2H H;  3S2H H;  1YIT A;  1VQC A;  3I7F A;  3RLF A;  4HJA A;  3GDE A;  1W3S A;  4B3R Q;  1E7Z A;  2I0Q A;  3K81 C;  1K0R A;  2ASB A;  1PH3 A;  4UPA A;  1HNZ Q;  4DR3 Q;  4OO1 I;  2L15 A;  4LUV A;  2CCZ A;  4JI0 L;  2K75 A;  4LWC A;  1I94 Q;  3RZD H;  3TS2 A;  2UU9 L;  1Q46 A;  2K52 A;  2UXB Q;  2B63 G;  4LFB Q;  5M5Y H;  2A19 A;  4R4Q A;  5FLX c;  3J81 j;  2K50 A;  3F2D A;  3HOY G;  4DR7 Q;  1KXL A;  2IT1 A;  4AQY L;  2UUB Q;  1WCM G;  2ZJQ A;  3I55 A;  5IE8 A;  3M9B A;  5HGQ A;  1IL2 A;  3GTG H;  4QJF A;  3CCU A;  4GN3 B;  3PSI A;  3L0O A;  3HOU H;  3F2B A;  2BH2 A;  1NMF A;  3UE1 A;  4JI5 L;  1EUJ A;  4DV3 L;  4BBR G;  2NN6 G;  4HIM A;  4C3I H;  2MQH A;  1PH6 A;  1JMC A;  1UE1 A;  3D0F A;  1VQK A;  4GKJ L;  4K0K Q;  2B63 H;  1PH7 A;  4X65 L;  2OWO A;  4LF8 L;  2Q2H A;  5M5W H;  3AQQ A;  1WCM H;  1NTG A;  3L2P A;  1PV4 A;  4DV1 L;  4IJH A;  2MFI A;  3HOX G;  4A3B H;  4A3I G;  4GLV B;  5C3E G;  3ER0 A;  1VQP A;  1WOC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...