4GS3A

Dimeric structure of the n-terminal domain of prib protein from thermoanaerobacter tencongensis solved ab initio
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
98
structure length
90
Chain Sequence
b'ENNTVTLVGKVFTPLEFSHELYGEKFFNFILEVPRLSETKDYLPITISNRLFEGMNLEVGTRVKIEGQLRSYNRKLILTVFARDISVVPE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Single-stranded DNA-binding protein
publication title Dimeric structure of the N-terminal domain of PriB protein from Thermoanaerobacter tengcongensis solved ab initio.
pubmed doi rcsb
source organism Thermoanaerobacter tengcongensis
molecule tags Dna binding protein
total genus 14
structure length 90
sequence length 98
ec nomenclature
pdb deposition date 2012-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00436 SSB Single-strand binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4gs3A00
5GQOA 5IY0A 1KRTA 1BBUA 3GTLH 1X3GA 3G48A 4DUYL 4DV2Q 3PF4A 2I0QA 4DAYB 2WB1E 3CF5A 2Z0SA 3NELA 4DUZQ 1S40A 4JI0Q 4JI4L 3GTKH 2ZJPA 3HOUH 1HZ9A 2JQOA 2UU9L 2VNUD 2MFIA 4A3CH 5ELNA 2EXDA 1UEBA 3KLWA 4X66L 1XJVA 2ZJQA 1GVPA 1X56A 5GAHC 1WFQA 2BH8A 1QVFA 4B3SQ 3S2DH 4JCVE 1X65A 2IT1A 3UDXA 2WB1G 4RG1A 4JYAQ 2R7ZG 4DUZL 4JI0L 4A3FG 1HR0W 4KHPQ 2JA8H 1E3PA 1PH6A 1L2FA 1WOCA 2AWNA 4QGUA 1VQLA 1TWGH 1NE3A 1L1OC 1TXYA 3IRBA 4B3SL 5K36G 1V43A 2A1AA 4UP9A 3CCQA 1OTCA 2JA7G 1PH1A 4A4IA 5C0XJ 1MJEA 1VQDA 4GNXB 4DR1Q 1HH2P 1G291 2V1CC 4AIMA 2JA5G 3HOYH 3CC4A 1FVIA 3PO2G 3CCLA 4GKKQ 4DR5L 4XIGS 2DGYA 5IP7G 4OX9Q 1C9OA 3CMEA 3JC66 1NJIC 1GD7A 4DR1L 5C4XG 2DUDA 4A3IG 4JG2A 2RHSB 3PIOA 4BY1H 4JV5Q 4Y7NH 2RHQB 4K0KQ 4HIKA 3ERSX 4YCUA 1QZHA 1HNXQ 1YHAA 2YTVA 3HOXH 3HOVH 4NPSA 4GLVB 4L5SA 5C3EH 2KBNA 4BY7G 3TEHB 1N36Q 1Q46A 4R4CA 2K5VA 5FLXc 1BBWA 4KHZA 3RNUA 1N32L 1Q7YC 2CQOA 2OQKA 4DV5Q 3KFUA 2E5LQ 5J3BA 5ELOA 3FKIH 2KHIA 4OWWB 4OO1G 4LWCA 4GNXC 4A3JG 5HY6A 1PFSA 3OTOQ 4MZ9A 1IBLQ 1FL0A 3CPWA 1N36L 5FJ8G 2JEAI 1JMCA 4X65Q 4LFCQ 4B3TQ 3J81c 4LF8Q 2IHEA 2N8NA 3PCOB 3K81C 2A8VA 4DR4Q 3AYHB 5M3MG 2Z6KA 4R4QA 1IBKQ 3T1YL 1VQPA 2NVXH 3L2PA 2UUCQ 2B29A 2BA0A 1X9NA 4LFAL 1CSQA 1D8LA 1JJ2A 4WJ4A 1IBLL 2BA1A 5C0XG 2MQHA 4DR3L 5H1SE 1IYJB 4YY3Q 2IHFA 3PGZA 2PMZE 3L0OA 5IYBG 2NN6I 3RN5A 4JBKA 3CXCA 4LF9L 2UUCL 4A75A 4A3LH 3M9BA 4NXNL 3W1BA 1VS0A 1VQOA 1LTLA 1QUQA 5JEAG 1W2BA 4B3ML 3BU2A 3CCRA 2F4VL 1XMOL 2YV5A 4AYBE 2VQFQ 2OCEA 4DV3L 2MO1A 4DV6L 1VQ6A 4GOPB 4A3GG 1VQBA 4A3BG 4GNXA 2AKWB 4C3HH 1PH3A 3W5OA 4A93H 2K5NA 3GD7A 4WJ3M 1PHJA 5M5WH 3BZCA 3D0FA 4GS3A 1VQ9A 4AYBG 4JI2L 1XPUA 4C3JH 3UE1A 2ZM6L 2ZTCA 4JI3L 1UE1A 2EQSA 2GVAA 4O0AA 1YJNA 2Y0SG 1MIUA 4YHHQ 5M3FH 2JK8A 3GDEA 4HIMA 3S1RH 1ASZA 1PH9A 1PYBA 5LMUQ 4JI5L 1IBMQ 4AH6A 1PH2A 1XNRL 4X6AH 2K14A 4X64Q 1PH5A 1R9TH 3G4SA 4P72A 1HR0Q 5JJKA 1UWVA 1TWCH 4FDBA 3CCSA 1PH4A 4A3IH 3TS2A 1Q82C 1Z9FA 3K80C 1E22A 4R4IA 2KCTA 3TS0A 4A3KH 3I7FA 2YYZA 5LMUL 4DNIA 1E24A 4DV0L 1KAWA 4JI4Q 3GTOH 1TWHH 2JA6H 3M4PA 4GOPC 2D0PA 2KHJA 2UU9Q 4LNQA 2CWAA 3J7A5 1NMFA 3AEVA 1P8LA 4DR7L 1VQEA 4X66Q 3AFQA 3BJUA 1XMQL 1GO3E 2BH2A 4IPCA 3HOWG 1I6HH 2N78A 2UUAL 4EX5A 4BXXG 2R7ZH 4JI6L 4LW1A 1JJGA 4A3FH 1X54A 1VQFA 3PUVA 2ZTEA 2CKZB 1G6PA 2NZOA 4IFDJ 1YNXA 4A3EH 5IWAL 2JEBI 4C2MH 2UXDL 3ICEA 3F1ZA 2WFWA 4X62L 3RZDH 1VCIA 1U5KA 3MXNB 1LUZA 4PG3A 3KJPA 2JA7H 4HIDA 4JI7Q 4YWKA 2RCNA 4MNOA 1VQGA 1CKOA 1S3OA 2QGQA 4OONA 4O2DA 3HKSA 1QUQB 1UE6A 3PO2H 4DR5Q 1VQMA 3DM3A 2NZHA 4OXPA 2VUMG 4GOPA 1I5FA 3CCUA 5IP7H 4IOCA 4JI7L 4IOAA 1Q8KA 1HNWL 1VQIA 2NVQH 1EIYB 4BA2I 2OTJA 2Z6KC 3B6YA 4JI8L 1S72A 3UDFA 2NVTH 1WJJA 1J6QA 4LF7Q 2AHOB 2I5LX 1SN8A 3NENA 1K3RA 3FP9A 4BY7H 1Q12A 2QEXA 2PQAB 1N32Q 4JC0A 1KL9A 1YIJA 1NY4A 3PIPA 4BBRG 1BKBA 4JBJA 2HQLA 1VQHA 1X55A 2JE6I 4IPDA 4JI1L 4LF7L 1FJGQ 5FLMG 3PUYA 1C0AA 1OXUA 1HZAA 4GKJL 5FJ8H 3E0EA 1K8GA 2OTLA 1LM0A 2R92G 5M3MH 1OXXK 2UUBL 1J5EL 3T1YQ 4B3RL 3KJOA 5C44G 3A5UA 2E2JH 1FJGL 2B63G 3CPFA 1PVOA 1CUKA 2K75A 4LUVA 4LFAQ 3I4NG 1Y1VH 3HOZG 2E2IH 1QZGA 2VZAA 1YHBA 4DK3C 4DR3Q 3CQZH 2MNAA 1Q1BA 2R7FA 3U4VA 3CCMA 1Y1WG 1VQ8A 1EYGA 2ES2A 4LF9Q 5IYBH 3K0XA 5IT9c 5HGQA 2NVYH 4QIWE 4NXNQ 4YCWA 3G71A 4DR2L 3GO5A 1SR3A 1VQCA 2VS1A 4B3MQ 3M4QA 1SE8A 2HHHL 2VQEQ 2F4VQ 1XMOQ 1D7QA 4DV3Q 4P74A 3M3YH 4DV6Q 1M1KC 4R4TA 3UE0A 4A3GH 4A3BH 3K8AA 1SMXA 2XGTA 1Q86C 1HZBA 4C3IH 4AQYQ 3KF6B 1W3SA 3STBC 1Q81C 3M4OH 4JI2Q 2VQEL 3EIVA 3GTGH 2EIFA 2ZM6Q 4UY8C 3PO3G 1SFOH 5LMNL 4JI3Q 1TWFH 3CW2C 3GTPH 1NMGA 1Q1EA 1T9HA 2Y0SE 1JB7A 4DV7L 3I4MG 1I94L 3CD6A 4HJ9A 1CKNA 5GADC 2UXCQ 1EWIA 4JI5Q 3GTJH 4AQYL 1XNRQ 3ULJA 3F2DA 2GVBA 4DV1L 2K50A 4IJLA 5E7NA 3HOUG 1PH8A 1JE5A 4KLKA 1N9WA 1WCMG 3U4ZA 4LF5L 1VQNA 4IJHA 3M7NA 1E1TA 3S17H 4BBSG 4P75A 2FXQA 2PQAA 2UXCL 4DV0Q 1GKHA 4A3DG 2KCMA 3MEFA 5LMNW 3STBD 3KYHC 1XPOA 3CP0A 3PV0A 1O7IA 4KI0A 4DR7Q 3A0JA 1JJCB 1V1QA 3KDFA 1XMQQ 2IX0A 1VQKA 1RL2A 1K0RA 1OXSC 1KC8C 2YTXA 1PYSB 2I5HA 4LF6L 2PI2A 1I3QH 2UUAQ 4JBMA 3HOWH 2MO0A 3H0GG 2E2HH 2K5HA 4JI6Q 4BXXH 3CC7A 3ULPA 1XPRA 3I55A 3L7ZC 2Q2TA 1IZ6A 2PI2E 4L5TA 1AE2A 1EQRA 4LUZA 5BR8L 5IWAQ 1UE5A 3T1HQ 1HNZQ 3H3VH 2JJQA 2UXDQ 4ALPA 1G51A 4IPGA 4X62Q 3PUWA 4LUOA 3F8TA 4UP8A 1U0LA 3CCEA 3I4OA 4HIOA 4A3MG 5IYCG 3U50C 4LF4L 5IYDG 2Q2IA 4LFBL 2R7DA 4YWMA 5C4JH 1IL2A 4IPHA 4GN4B 3Q8DA 1B8AA 3KOJA 4GLXA 3T1HL 1HNZL 4NXML 5AJ3L 3S1NH 4OO1I 2CCZA 3AQQA 2ATWA 4J15A 3OW2A 3S24A 2VUMH 1YZ6A 2NN6G 4TQUS 4POGA 4A3KG 1N33L 1HNWQ 3RN2A 1A63A 2JA5H 4JI8Q 3KF6A 2Q2UA 3S1MH 3PUXA 4JOIA 1KXLA 2JA6G 4DR6L 2VW9A 4P73A 4PZ6A 1K73C 5IP9G 4HJ7A 2R93G 4HJAA 4QJFA 3AFPA 2R6GA 5C0XI 1FGUA 2ZJRA 2OQ0A 1CKNB 5C4XH 3S16H 1CSPA 1KD1C 4DV2L 1E1OA 1VQAA 1X3EA 2CWPA 4UPAA 1TWAH 3J80i 4DAMA 4HJ5A 1WI5A 4JI1Q 2ALYB 2KENA 2L15A 2XTIA 3NBHB 3TQYA 1K83H 3UDIA 1SLJA 4BBRH 4A3CG 2B3GA 1XNQQ 1Y14B 2I5MX 2VY3A 1KIXA 1HR0L 5FLMH 4A3EG 4NB3A 4GKJQ 1A0IA 1MKHA 2ID0A 3EN2A 4EQ5A 3J81i 2QA4A 2IX1A 3A5ZB 1SRUA 4DV4Q 1RIPA 4JYAL 2UUBQ 2C35B 1J5EQ 2HT1A 1EIFA 1SROA 2R92H 1AE3A 4B3RQ 2JA8G 1H95A 4KHPL 5M5YH 5JJLA 2RF4A 1X3FA 1A62A 3A74A 2WP8J 1MJCA 5C44H 4HJ8A 3UDGA 4A3JH 1GM5A 1XNQL 1YBYA 2B63H 3I4NH 3KDFB 4PMWA 1PA6A 1NBWA 3RZOH 3S15H 3HOZH 1DGSA 2K4KA 4DV4L 3U58A 1B70B 3S1QH 4IFDG 3K7AH 2HIVA 1Y1WH 1VQ5A 2AWOA 5JEAJ 1N34Q 4QL5A 3HOYG 1EQQA 2F3IA 3I2ZA 3RLNA 1HJPA 3CCJA 4DR2Q 3HFZB 1OXTA 2HHHQ 3F2BA 1XTDA 4GKKL 2GN5A 3F2CA 3CMAA 3FHWA 4YWLA 2ZTDA 3PF5A 4OX9L 1E7ZA 4GLAC 5EAYA 3J7ZC 1N34L 1B7YB 4TVAB 4BY1G 4OWXB 1UE7A 2K52A 4DKAC 2PNHA 4JV5L 1L1OA 3CC2A 3J80c 4K0KL 3S2HH 4APVA 3HOXG 3HOVG 3VDYA 3OYYA 1HNXL 2VL6A 5M5XH 5LMNQ 4ME3A 3M85A 5C3EG 3ER0A 3TRZA 3PO3H 1LYLA 2AMCB 4DV7Q 1I94Q 2YU9H 3I4MH 4UP7A 3RR5A 3J81j 1A8VA 2HIXA 2OWOA 1KHIA 4R4OA 3K7UC 5GAGC 1YITA 1OXVA 5JJIA 1BVSA 4DV5L 3FKIG 3EBEA 4DV1Q 2E5LL 3PSIA 3DLLA 4DK6C 4P71A 1VQJA 2N3SA 5DLQE 4GN3B 1Y1VG 4LF5Q 2WAQE 3JAMi 3OTOL 3H3VI 1QVGA 1WCMH 2CFMA 4BBSH 1ASYA 3PUZA 4LFCL 4X65L 4PZ7A 3I56A 4B3TL 4LF8L 3H15A 4DR4L 2UXBQ 3ULLA 1V9PA 4PZ8A 3D31A 3SGIA 4A3DH 1IXRA 2YTYA 4YCVA 3E9HA 4JBWA 1IBKL 4RMFA 2Q2HA 1C7YA 2WAQG 3NEMA 1YEZA 1Z47A 3S14H 1NTGA 1K9MC 3LGJA 4QY7A 1P16A 1EFWA 3RLFA 4LF6Q 2LXJA 2LXKA 1KQSA 2UXBL 1HZCA 1L0WA 3HKZE 3KF8B 3WWVA 4YY3L 1K8AC 3GTMH 3GTQH 3H0GH 2IY5B 2JA9A 2N49A 4A3LG 4OWTB 5BR8Q 4JOIC 1VQ7A 1PH7A 1QVCA 3CAMA 3W1GA 5GAEC 4A76A 2F52A 2A19A 2D0OA 4DPGA 3HKZG 4QQBX 4XTCS 2H5XA 1VQ4A 2VQFL 3ZJYC 3G6EA 1YJWA 4MTNA 4L5RC 4A3MH 1X6OA 4LF4Q 1M90C 3RLOA 5IYCH 4LFBQ 4A93G 1YVCA 5IYDH 1YI2A 4Y52H 4NXMQ 1EUJA 2D62A 5AJ3Q 1PV4A 1JT8A 4POFA 1CKMA 4IO9A 3TREA 5IE8A 1I50H 1KRSA 4BA1I 1N33Q 4GN5A 3JAMc 5M3FG 4L5QA 4YHHL 5GROA 1YHQA 4DUYQ 1AH9A 1IBML 4R1JA 4DR6Q 1L1OB 4IFDI 3BZKA 2ASBA 3CCVA 1YJ9A 1N8RC 3E9IA 1EOVA 4H02A 4X64L 2R93H 5IP9H 2E8GA 2LSSA 1WYDA
chains in the Genus database with same CATH superfamily
5GQOA 4DUYL 3PF4A 2I0QA 2NVXB 2B2TA 2WB1E 3A7LA 4B9WA 1LTTD 4JI4L 3GTKH 1MD2D 1K3BC 1D7QA 1VF5C 1QVFA 1GVPA 3S2DH 1WFQA 3M3YB 1QB5D 4B3SQ 4JCVE 3UDXA 2R7ZG 4A3GB 4DUZL 4A3FG 1HR0W 5EPKA 1HXYD 4FF1A 2MPMA 1PTOD 5HURA 4RGMA 4QGUA 4IALA 3GTGB 3IL8A 1CHQD 3GTPB 2A1AA 3CCQA 4MN3A 4KKSA 4A4IA 1BO0A 3GTJB 1TKWB 1JWMD 1HH2P 2V1CC 4AIMA 3CC4A 4HR7B 3KLRA 1UNSA 4DR5L 1H9RA 5M3FB 4XIGS 2DGYA 1GUOA 4OX9Q 3NQIA 2B2UC 2MJ8A 1ZKOA 1HQRD 1GUSA 3OMGA 3I90A 4K0KQ 1RHPA 3NP8A 2YTVA 3HOVH 5C3EH 3HGBA 4BY7G 2L1BA 4R4CA 2K5VA 1B3AA 3PIO3 5KNDA 4FO2A 4RA8A 4CDFC 3FKIH 1EY0A 4OWWB 4OO1G 5COYA 4J1MA 2FINB 1B44D 1FL0A 2EOTA 1N36L 2WB1B 5FJ8G 2IHEA 3K5LA 5FO8B 4LMQD 2KVMA 2Z6KA 3FPPA 4X3KA 1IBKQ 1PYWD 1BUVT 2B29A 2FHTA 4LFAL 2EYHA 2B2UA 3RZDB 5D3IB 3P75A 1LTRD 3WOEA 5H1SE 3PGZA 2PMZE 1BBXC 1ML0D 2HCCA 3CXCA 1RD9D 3I70A 3BZDB 1D2BA 4B3ML 1HHVA 3BU2A 3CCRA 2DY7A 2NBFA 4AYBE 1QWYA 2OCEA 3A7AB 4DV3L 5C4XB 4FXGC 4GOPB 4A3GG 1VQBA 2FFKB 4DF7A 1PH3A 3GD7A 1XTCD 1XPUA 1VQ9A 2EPBA 4JI2L 4C3JH 1V1PB 3UE1A 2VB2X 3E0JA 5T1IA 4YHHQ 4WRDA 3MFGA 4AH6A 3FEWX 4X64Q 3G4SA 3HOZB 1CZWA 2KQ3A 4ZQ3A 1BQQT 2PO4A 3K80C 5CYUA 2ENBA 5LMUL 4DNIA 1E24A 2X6GA 5ELBA 2XWBB 4KK7A 3GTOH 1TWHH 2UU9Q 2CWAA 4DR7L 2BOSA 1SYFA 1H9SB 4HCEA 4G7ZC 1RKNA 2BH2A 3J7AV 1I6HH 2N78A 4XT1B 3QIAA 4KD3A 4LW1A 2VXWA 2ZTEA 5ELDA 1EWCA 4LAAA 4H44C 5IT9E 3ICEA 1U5KA 3T16A 4YWKA 5D65A 2QGQA 1RODA 3C1EA 3P1HA 1QUQB 1UE6A 1EZ6A 4OXPA 1WCMB 1STGA 2KECA 3LX0A 2SEBD 3KLSA 1Q8IA 3K58A 3CCUA 5IP7H 1Q8KA 2D5DA 1HNWL 1WTQA 1D5ZC 1EIYB 3B6YA 3EA6A 5D3DA 3A54A 3VR2A 1PTOH 4R9WA 5E3FA 3S14B 1KLUD 4KKTA 2J7ZA 2F0MA 3VR3A 4QMGA 3NTHA 3URYA 1K3RA 3FP9A 2WACA 1Q12A 1LTAD 3MEHA 1NY4A 1TY0A 3PIPA 4XQJA 4O1NA 1FJGQ 5FLMG 2EXZA 5KIXA 3E0EA 4O42A 3JAML 2OTLA 5M3MH 1OXXK 2F1MA 2UUBL 3T1YQ 1DCZA 3IFDA 1V8QA 4LUVA 1Y1VH 3HOZG 1SNPA 1YHBA 1Z6HA 3I3CA 4IUPA 4CHTB 4C1NI 5C3WA 5HGQA 5DM73 3DUZA 5JEAH 1CFMA 4P74A 5T1GA 1M1KC 4MTKA 4G4KA 2EYPA 1HZBA 4RH6A 1Z7TA 4C3IH 3EIVA 1JCKB 1T5EA 4OL7A 1SFOH 5LMNL 4JI3Q 2Y0SE 3CD6A 4HMIA 5GADC 1SE2A 1SYGA 2JA8B 3N52A 4DV1L 2C9OA 3G7LA 3DHQA 1N9WA 1WCMG 5C4HA 3NE5B 1E1TA 4P75A 1QCBD 4CKBA 2PQAA 2KCMA 5LMNW 3STBD 3KYHC 3ONAB 2IL8A 1O7IA 4KI0A 2NWGA 3A0JA 1V1QA 2F0KA 3A56A 1FNVA 1RL2A 1VQKA 1PYSB 2I5HA 5IGCA 1E0BA 2LY7A 2MO0A 2E2HH 4BXXH 3CC7A 2K5WA 3I55A 4EQNA 2ZXPA 1UE5A 1HNZQ 4KKUA 4FNFA 4C3JG 3DMUA 3I4OA 4LJZC 1O7LA 3U50C 2Q8RE 3OWFA 5IYDG 4LFBL 2QDLA 5M5XB 1XWEA 5J1ZA 3T1HL 4NXML 3Q8DA 1G8ZD 2XSCA 1DD2A 1STEA 5FLXE 3G6JB 3KBGA 1QOHA 2F0LA 4J6HA 4KJOA 2JA5H 3H09A 1WTOA 4DR6L 2VW9A 3J81E 1LV9A 4QJFA 2E76C 3AFPA 2ZJRA 4DK1A 4A3DB 2OQ0A 3S16H 1EY9A 1X3EA 3V96A 1SE3A 3U9OA 4K2LA 1RTOA 1B9NA 2XTIA 3TQYA 2RDFA 2I5MX 5A2QL 4XXEA 1PZKD 4NB3A 1AW7A 1KTKA 4GKJQ 3HKZB 1MKHA 3Q6SA 4DV4Q 3Q24A 2C35B 1J5EQ 2F0QA 1JOOA 1SROA 2R92H 1AE3A 4C3HB 2JA8G 4ZAIA 1LTSD 2P5ZX 2WP8J 5C44H 4EQPA 1XNQL 2B63H 1HA6A 3I4NH 3KDFB 4PMWA 1PA6A 3S15H 1UEAB 1F9PA 4DK0A 2HD3A 3KUPA 3BYYB 3U58A 1IL8A 3S1RB 3K7AH 2EVBA 1G6ZA 2AWOA 3CRLC 3CCJA 3I2ZA 3RLNA 4RGTA 3DWPA 5C0XH 2K5QA 4KJNA 1JOQA 1I4RA 4OX9L 2RVLA 5EAYA 3VR4A 2K52A 3CC2A 1DM0B 2PW5A 4K0KL 4HAEA 4APVA 1QJOA 3ER0A 3QO2A 1LYLA 3HZXA 2L4NA 5EKIA 3TP8A 3I4MH 4UP7A 3TP6A 3J81j 3SDZA 3EJIA 3EBEA 3D6WA 3DLLA 2O5JC 1VQJA 2TMPA 2A6ED 1ZEQX 1Y1VG 5I6YA 4C2MB 4LF5Q 1KLGD 4U673 4BBSH 3PUZA 3VYRA 1T5XD 2JA7B 3H15A 3ULLA 1TS5A 3D31A 2EY1A 2K5DA 2F0DA 1IXRA 1IBKL 4RMFA 3NEMA 2XNAC 4CJ2C 3AMUA 3LGJA 1U4PA 2LXKA 1KQSA 2UXBL 1HZCA 1FYCA 1K8AC 1F2ZA 2NVQB 3H0GH 3ND9A 2PQEA 4H7BA 4A3LG 1TU2B 2A19A 2D0OA 3HKZG 1EL0A 4G57A 3ZJYC 1C4QA 3G6EA 3C1FA 4C3HG 3E6ZX 3RLOA 1GUTA 2F0NA 5FO9B 3BDOA 1DYQA 1ENFA 4TSSA 3TREA 3MXUA 1CM9A 1I50H 1ET6A 5IE8A 3ITPA 4GN5A 3JAMc 1HFNA 2NN6H 4YHHL 1L0XB 1YHQA 1AH9A 5IT9L 1QE6A 4RHRA 1N8RC 3E9IA 3I91A 2E2IB 4X64L 5IP9H 2E8GA 1PTOC 4M1UB 4DXGA 3BYTB 3CRKC 1S40A 4JI0Q 1EWHA 3HOUH 2HDMA 4CGYB 2ZJPA 2UU9L 2VNUD 2K1BA 2MFIA 2ZXRA 4A3CH 2KUMA 1J8IA 5ELNA 3KLWA 1JE4A 1XJVA 2ZJQA 1X56A 1H9MA 5D14A 5GAHC 1S4ZA 1X65A 2Z4HA 1W6KA 2FMCA 5J22A 4A3BB 3SEBA 4IN3A 4JVZA 2AWNA 1TWGH 3T4AC 1TXYA 3IRBA 3I4LA 1V43A 2M2LA 3WDNA 3HS0C 2JA7G 4IFDH 1VQDA 4DR1Q 2E74C 2B8FA 2CH4W 3HOYH 2JA5G 1HPCA 4NKLA 3RUZA 1TVXA 3HEJA 3S17B 3TBIB 4DAPA 2D2CC 3QB3A 1C9OA 1CQFA 3CMEA 3JC66 2RHSB 4KY7A 4RGOS 4BY1H 2EY6A 4HIKA 4HCSA 4YCUA 1HNXQ 3HOXH 5EQ0A 1I3QB 4ID6A 1DXMA 1BBWA 4ABNA 1B3QA 1MSGA 1JQYD 5HY6A 1PFSA 3OTOQ 4C56C 1IBLQ 2JEAI 2EJMA 5BN4A 4B3TQ 4LF8Q 2A8VA 3PCOB 3K81C 4DR4Q 1ESFA 4R4QA 3FRPB 3T1YL 1VQPA 2NVXH 3DEPA 2BA0A 3S1NB 4WJ4A 1C48A 1JJ2A 5EPLA 5C0XG 1QNKA 2K04A 1LTBD 2VUMB 3LNNA 1QILA 2IHFA 4YY3Q 5IYBG 2NN6I 1WTHA 2CQAA 2UUCL 3H94A 1CZGA 2J4XA 1AP0A 5M9OA 1DOLA 2OT2A 1WTRA 2BDOA 2VQFQ 4RHSA 4G7HC 1NR2A 4F8MA 4A3BG 5CV4A 2H1EA 4A93H 4BBRB 2K5NA 4GZYC 5M5WH 4K8JA 1XX8A 5CBAE 4K6DA 2ZTCA 4JI3L 2EQSA 2GVAA 1YJNA 2RQXA 5M3FH 3GDEA 1O78A 4HIMA 5E1FA 3FMCA 3L9AX 2K14A 3NTKA 4P72A 1UWVA 3OSOA 3CCSA 3TS2A 3S1QB 2CHBD 1E22A 4A3KH 2KCTA 3I7FA 5JAVA 4IURA 1Y1WB 1KAWA 1SDFA 2MP1A 1ILPA 4CJ1B 2JA6H 2D0PA 1DZ1A 1NMFA 2FMMA 2DJGC 2A73B 2DY8A 2DNCA 5EPJA 2H4OA 2L12A 3ERQA 2OEOA 4IPCA 2RDHA 2NVYB 2E75C 2LKVA 4FYDA 1VQFA 3PUVA 2A6HD 1YNXA 2JEBI 3R93A 5K36H 3M7GA 1EU3A 2WFWA 3RZDH 2GA4B 1VCIA 5L37A 3OWEB 1C8CA 4JI7Q 2JSOA 1O7YA 1CKOA 4O2DA 4X3SA 3X3MA 1NUCA 2K7VA 3U9SA 3PO2H 3K6OA 4KMUC 1TR5A 2VUMG 4IOCA 2Z4IA 2G9DA 2Z6KC 3UI2A 1WJJA 1J6QA 2F03A 3Q0AA 4LF7Q 4V190 1NNXA 2NUCA 1MGSA 2QEJC 1F9QA 1TS4A 3GTQB 2PQAB 1N32Q 4DA2A 1KL9A 1YIJA 1MI2A 4WORA 4BBRG 1JWSD 2HQLA 4IPDA 1X55A 4IUUA 1I4GA 3LWEA 3MXGA 2PPBC 3DXJC 1OXUA 2NYZD 4GKJL 1F9RA 3PIP3 4A3MB 1Q90A 1ENCA 3GP7A 5IGBA 1J5EL 1JORA 3LWUA 1I4PA 1M4VA 2E2JH 3VR5A 4IQZA 4DK3C 2K33A 3CQZH 2MNAA 3K5MA 2R7FA 1EEFD 3CCMA 1Y1WG 2ES2A 2A69D 3K5OA 2F0FA 5IT9c 2L9HA 2R3ZA 1PFNA 4YCWA 3GO5A 1A2UA 1SR3A 5TSSA 1IKLA 4NMZA 2F4VQ 1VMPA 1U4LA 1L0YB 3MXNA 2F0EA 1B50A 2EJFC 4PV1C 1A2TA 4R4TA 3SVMA 1E2ZA 2K05A 3K8AA 2QCPX 2XGTA 3SE0A 1CA6A 3STBC 3M4OH 2VQEL 2EIFA 4UY8C 2JXMB 4XDXA 3H3VC 2B8GA 1TWFH 3CW2C 4R8NA 2XN9C 1TWAB 3ND8A 3TZDA 3TDQA 1CKNA 2UXCQ 4AQYL 1XNRQ 4RCNA 1RJTA 2GVBA 4IJLA 5E7NA 4XQQA 3U4ZA 4LF5L 4FF4A 3M7NA 5KEEA 5M5YB 2B2VA 3MEFA 3Q23A 1BCPD 4J8QA 3A8JE 1LLRD 1UAPA 1XMQQ 1M8AA 1OXSC 1HA5A 2PI2A 5C4ZA 2UUAQ 3HOWH 2PNRC 2K5HA 1CQVA 3D3RA 1XPRA 3L7ZC 1AE2A 2ICEC 5KGUA 3HOVB 1F77A 3TN2A 2JJQA 5C3EB 4ALPA 1EFID 4IPGA 4X62Q 3PUWA 4LUOA 4UP8A 1U0LA 1A3TA 3CCEA 4A3MG 1LO5D 5C4JH 3FKIB 4GN4B 4S3SA 4GLXA 1STBA 2NZ1D 3MZ5A 3AQQA 2DJFC 4M8AA 3J80E 1YZ6A 4POGA 2L11A 4A3KG 1A63A 1IW7D 2MUYA 5BN5A 2KEDA 5CMDA 3S1MH 3KF6A 4JOIA 1HUMA 2JA6G 3EVQA 4PZ6A 1K73C 4HJ7A 3SHLA 2EY2A 2EYJA 2EE1A 1WVLA 4FF3A 3O13A 1BNZA 4ILWA 4UPAA 3CKIB 1PZID 2ALYB 1KNEA 2KENA 4JI1Q 3UDIA 3EFXD 1K83H 2Q2UA 3X3NA 1KIXA 2VY3A 4NP5A 1HR0L 2XRQD 5G3LF 4KTAA 1A0IA 3PQIA 2ID0A 3EN2A 3OMCA 4K6LA 4CKEA 1RIPA 4KN4C 3KF8A 2HT1A 4B3RQ 4HJ8A 4A3JH 1YBYA 4C3JB 3RZOH 3VA7A 2KA7A 3C3LA 2AUKA 3MVVA 3CHBD 4ZKCB 2O5IC 1VDZA 4HMJA 1EYDA 5JEAJ 4QL5A 3I72A 4NDXA 1EQQA 2A68D 4DR2Q 1I4QA 1SJED 1HJPA 1PRTD 1SSOA 1STYA 5EGTA 5IOCA 2HHHQ 1LT4D 3D4RA 2A6EC 2KJXA 3WOFA 4TRDA 3PF5A 3EQLC 1N34L 1B7YB 2A74C 3GTOB 1TWHB 2OXPA 1VF7A 1L1OA 3S2HH 3HOVG 3E3XA 3I8ZA 1HNXL 5M5XH 3M85A 5C3EG 3PO3H 3MTSA 2AMCB 3A55A 1I94Q 4TKOB 2YU9H 1I6HB 4R4OA 4XT3B 5GAGC 1OXVA 3NWTA 1BVSA 1G2SA 2K03A 3FKIG 4DK6C 4P71A 1NAPA 2N3SA 5DLQE 4GN3B 2PYKA 3P7JA 3JAMi 1D1IA 3OTOL 1PXUA 3GQBA 2JN4A 4B3TL 4LF8L 4DR4L 1V9PA 1JC7A 3SGIA 4A3DH 2YTYA 4YCVA 3E9HA 4JBWA 1SNQA 5I9PA 2WAQG 1K8MA 4QCLA 1Z47A 3SK4A 1K9MC 4QY7A 5DM63 1EFWA 2LXJA 1L0WA 3HKZE 3WWVA 4YY3L 3GTMH 2IY5B 4OWTB 5BR8Q 4JPBW 1PTOB 1A6XA 4DAVA 2F52A 4XTCS 2VQFL 4L5RC 4LF4Q 1M90C 1BOSA 5IYCH 2EYLA 1EUJA 1PV4A 5AJ3Q 1SYCA 5F2DA 4DXFA 1KRSA 4BA1I 3HP3A 1N33Q 1K8OA 4B9XA 4CDEC 1YNJD 5M3MB 5GROA 1PMRA 1BXTA 4DUYQ 2HDLA 1DOMA 4LK1C 4R1JA 2ASBA 1Y1VB 1EOVA 2CW0D 2M9VA 2R93H 2LSSA 4JC0A 1VQLA 3IFTA 5IY0A 4ZUJA 3GTLH 2F0OA 1LTGD 1X3GA 3G48A 4DV2Q 4DUZQ 1EY6A 3A8IE 1HZ9A 4QUCA 2EXDA 4CDCC 1FGBD 2DNEA 2BH8A 1MBYA 2IT1A 4RG1A 4JYAQ 4DGZA 2O2LD 1E3PA 1PH6A 1L2FA 1WOCA 2TSSA 1NE3A 1Y8OB 1SFOB 1CI3M 4B3SL 4KN7C 5I4DA 2WKCA 1OTCA 4EQOA 4PQXA 1PH1A 5C0XJ 3NK9A 2BE5D 3TZUA 1G291 2WINB 4K5VA 5CV6A 1DOKA 4L6TB 1SNDA 3VA5A 1I4XA 5IP7G 1GD7A 3NWSA 2KEEA 1RF2D 4FXKC 4Y7NH 2RHQB 3ERSX 3S9WA 1QZHA 1YHAA 2PCFB 4GLVB 3TEHB 1PTOF 1N36Q 1D6EC 3RNUA 1N32L 2CQOA 2OQKA 4DV5Q 3KFUA 3GV6A 3SK6A 4RKBA 2WIIB 4N9PA 4LWCA 4GNXC 4A3JG 4P2CB 3E5SA 4RWSC 3CPWA 4LFCQ 4X65Q 3AYHB 4N8FA 4DAYA 5DNFA 5M3MG 4IUNA 1JR0D 1X9NA 1D8LA 5CORA 2BA1A 4K5WA 1EQTA 1IYJB 3L0OA 3RN5A 4BWGB 4OHJA 2JA5B 1H9JA 3R8BA 5IGGA 3I73A 1VQOA 1G2TA 2F0WA 4N8X1 1QUQA 2D9UA 5JEAG 1W2BA 2F4VL 1EYAA 2YV5A 3NTIA 3S16B 4GNXA 2AKWB 2NVTB 3W5OA 4C3IG 1PHJA 4GS3A 5J39A 1B2TA 5I9OA 1UE1A 4O0AA 2Y0SG 1MIUA 2JK8A 2R92B 1PYBA 5LMUQ 1A3UA 1IBMQ 1PH2A 1SMYD 1XNRL 5C44B 2B63B 2NTTA 1PH5A 3I4NB 1R9TH 3S15B 1TWCH 4FDBA 2A6HC 4A3IH 4IUTA 3K7AB 2B39A 1R4PB 2QF7A 1GXDC 3M4PA 4LNQA 2KHJA 3J7A5 3RMHA 3IKJA 1VQEA 4X66Q 1XMQL 1GO3E 5IGDA 1EQVA 3DWAA 1GOZA 2UUAL 3R3OA 4BXXG 4QIWB 2R7ZH 1EU4A 1AZPA 4ME5A 4A3FH 1G6PA 2CKZB 4IFDJ 4A3EH 1B1ZA 3KK7A 5I2XA 2F0SA 2X69A 3HRZC 3F1ZA 1TS3A 4X62L 1B4OA 3MXNB 1LUZA 4PG3A 2KCCA 5C5MA 4CKCA 1VQGA 3C46A 1HUNA 1B9MA 1VQMA 1EY5A 4DNTB 1NR4A 2HUGA 4BBSB 3EROA 2CH4A 2F4IA 3T13A 4IOAA 4JW0A 2OTJA 1S72A 1CK1A 1AN8A 2AHOB 2I5LX 1SN8A 1SNOA 4BY7H 2PZTA 5EKKA 3H0GB 4RGNA 5E4WC 1BKBA 2A69C 4JI1L 1VQHA 2JE6I 2Z8LA 3H91A 4Q5VA 4OO1H 3PUYA 3MC0B 2M00A 1C0AA 1ICWA 1HZAA 5DEHA 5FJ8H 4HEDA 3OIPA 4I65A 4FP5D 2R92G 1HQMC 5CV9A 4B3RL 1SNCA 3RD4A 3VR6A 5C44G 3A5UA 1FJGL 2B63G 2PZUA 3CPFA 1PVOA 1CUKA 2K75A 1XYIA 3I4NG 4F7XA 4DR3Q 3W3AA 1Q1BA 4H13C 3U4VA 3CU7A 4LF9Q 3MXPA 4NW2A 1ZYRD 1S5DD 2NVYH 4NXNQ 3W2DA 4DR2L 1Y8PB 1VQCA 1V1OA 2VS1A 3SK8A 1SE8A 2HHHL 1XMOQ 3M3YH 1S5CD 2F3WA 4DV6Q 1BF4A 3UE0A 4A3GH 3HOUB 1SMXA 1Q86C 3KF6B 2L55A 3GTGH 1W6JA 2ZM6Q 1BCPC 5CC4A 3GTPH 1G91A 1NMGA 1HRJA 1Q1EA 1T9HA 2PZWA 3I4MG 1GUGA 1I94L 1STNA 1KDCA 2QILA 1IHZA 4JI5Q 3GTJH 2SNSA 3ULJA 3V2TA 1TWGB 2RCFA 1PH8A 4KLKA 4I7ZC 1VQNA 2IX3A 1Y8NB 2KCNA 4BBSG 2FXQA 1R4QB 1HFGA 1MHWC 4DV0Q 1GKHA 5ELFA 4FXDA 2PW7A 3HOYB 1XPOA 3PV0A 5CBEE 4QUFA 4UHVA 3KDFA 4RCOA 3KLSX 2JYOA 2XVSA 4FVMA 3H0GG 5FLXL 4JI6Q 3TMEA 3ULPA 4BY1B 2BDNA 1EIHA 1EQRA 4LUZA 5C3XA 5BR8L 1WTWA 2KHSA 3IAYA 5EKLA 5IWAQ 1E2WA 3T1HQ 2UXDQ 1X32A 1HCZA 3J81L 4HIOA 1AFPA 1IKMA 3H6MA 1PZJD 4LF4L 2IPKD 2Q2IA 2R7DA 2EYOA 1HNZL 1B8AA 3KOJA 5AJ3L 4OO1I 2CCZA 5ELEA 2ATWA 1RTNA 4J15A 4RFBA 2NN6G 4TQUS 4DN4M 5BN3A 1N33L 5CV8A 4KD4A 2K01A 2K28A 4JI8Q 3PUXA 1KXLA 4P73A 5IP9G 2EDGA 2R6GA 1FGUA 1U4RA 4CDDC 5C4XH 1CSPA 1KD1C 4DV2L 3HOUG 1GHJA 1VQAA 4DAMA 1TWAH 3TP5A 1WI5A 2OWOA 2L15A 4A3CG 2B3GA 1XNQQ 1Y14B 2A68C 4YIJA 5CGKA 5FLMH 1JWUD 4A3EG 1PRTC 1QNUA 3NSWA 4EQ5A 3TP7A 3J81i 2QA4A 3N6RA 2IX1A 3A5ZB 5IGFA 4JYAL 1Q3LA 1EIFA 2IWHA 1H95A 4A93B 1IYUA 5M5YH 2RF4A 1X3FA 1A62A 4ZLTF 3UDGA 5JJLA 5M5WB 1GM5A 3SK5A 2ZT9C 4F88A 4ZCKA 1NBWA 1U4MA 3HOZH 3M4YA 1DGSA 2AQ2B 2K4KA 4L8JA 4DV4L 1CTMA 1B70B 1KDAA 4IFDG 2HIVA 4K8IA 1VQ5A 5A2QE 3D8GA 3HOYG 3VYTA 4DU9A 4PNYA 2SDFA 4Q0FA 3HFZB 1OXTA 1ENAA 3F2BA 1XTDA 2GN5A 2R61A 3F2CA 4A3KB 4YWLA 3MA2B 2DN8A 4BY1G 2JA6B 1E2VA 2B2VC 3J80c 4HSPA 3HOXG 5IGEA 3VDYA 2VL6A 4ME3A 1GHKA 1EY8A 2K6AA 1SXTA 4DV7Q 3GTKB 4X3UA 3RR5A 2HIXA 5FOBB 2F0IA 4DV5L 2ICIA 2L5TA 4MHEA 4EGVA 3S2DB 1A3VA 2WAQE 1WCMH 4ZUIA 1ASYA 4LFCL 4X65L 1ONLA 2RA4A 3D6CA 4PZ7A 1YNND 2QW7A 2UXBQ 4PZ8A 3NBHA 2Q2HA 5FK9C 1EY4A 3PO2B 2NTSA 3S14H 3F2UA 4V0BA 1P16A 3RLFA 4LF6Q 1LACA 1PDQA 1FNWA 2JA9A 1YNJC 2N49A 2F0UA 4JOIC 1PH7A 4N9TA 1QVCA 3W1GA 5GAEC 4QQBX 2CW0C 1WTXA 1TT2A 3R2IA 4JK1C 3HG9A 1X6OA 4EVOA 4A93G 1YVCA 5IYDH 4DFAA 4Y52H 2D62A 1JT8A 4POFA 1GUNA 1IYVA 4IO9A 5ELCA 1ZXTA 1FD7D 5LL6S 4C1NK 5M3FG 4K2KA 4L5QA 2EJGC 1DJRD 1OO9B 4MIUA 5IIFA 1IBML 2E2JB 2JP1A 3GV3A 3CCVA 4KY6A 1S5FD 4HTHA 1AEXA 1WYDA 3OIQA 3CQZB 3V05A 1KRTA 1BBUA 3OW7A 1LT5D 4DAYB 3CF5A 2Z0SA 3NELA 4U68A 2WAQB 2BE5C 2JQOA 4E6IA 1UEBA 4X66L 4PMBA 2PMZB 4CBVA 2WB1G 4ZKBB 4JI0L 1O80A 4KHPQ 1A15A 2JA8H 5JVH3 2A5HA 3M4OB 2OF1A 2MHVA 1D5MC 1EEID 1L1OC 4AYBB 1WD1A 5K36G 1TWFB 5JPNC 4UP9A 2X6LA 1ESRA 1F2MA 1MJEA 3MHBA 2B2YC 4WFN3 2AQ3B 4IZ8A 4GNXB 5JVG3 1SE4A 1FVIA 1KDBA 3PO2G 3CCLA 4GKKQ 4IUVA 4HSVA 1NJIC 1LT6D 4DR1L 5C4XG 2DUDA 4JG2A 3PIOA 4JV5Q 4KHVA 1PFMA 4NPSA 2VB3X 2XWJB 3Q22A 2KBNA 4L5SA 2F0VA 1Q46A 3HOWB 5FLXc 4KHZA 2IJ0A 1Q7YC 3BVGA 5C6AA 2E5LQ 5J3BA 5JPMC 5ELOA 3AU7A 2KHIA 1EIGA 4MZ9A 2B2YA 1JMCA 1RDPD 3J81c 2N8NA 3SXHA 3DWQA 4HN7A 1JOKA 3QR8A 5C5LA 5C4JB 2UUCQ 3L2PA 3NHHA 1CSQA 1IBLL 1TY2A 5KNBA 2MQHA 5IODA 4DR3L 3OPOA 1F2YA 5KRUA 4Z9CB 4JBKA 4LF9L 3DEOA 3S1MB 4A75A 4A3LH 3M9BA 4NXNL 1SYDA 5CR3A 3W1BA 1VS0A 1SMYC 1LTLA 2E2DC 1XMOL 2HQEA 2F0TA 4QB4A 2MO1A 4DV6L 2AUJD 1VQ6A 3C2PA 4C3HH 1K83B 4OIKA 4FF2A 4WJ3M 2WKDA 3BZCA 3D0FA 4AYBG 1B53A 2ZM6L 2AQ1B 5KYIA 3S1RH 1ASZA 2RSNA 1PH9A 2NB0A 4JI5L 3T53B 4X6AH 4A3JB 1STAA 5JJKA 1HR0Q 3RZOB 1CA5A 1NCVA 2RSOA 1PH4A 1Q82C 1Z9FA 2EY5A 4R4IA 2RDGA 3TS0A 2YYZA 4DV0L 1MSHA 4JI4Q 5LL6X 4GOPC 2EZVA 2XRSD 3AEVA 1P8LA 4KV6A 3AFQA 3BJUA 5DAUA 5KNCA 4X3TA 3FVQA 4PMCA 1WTPA 3HOWG 1STHA 4EX5A 3K5NA 4JI6L 3QG1A 5K5PA 1JJGA 1AZQA 1X54A 3MFYA 3S2HB 2NZOA 4K14A 5IWAL 1K28A 3PO3B 4C2MH 2UXDL 1SJHD 2YU9B 3KJPA 2JA7H 4HIDA 4I7AA 4C3IB 2RCNA 4MNOA 4XYOA 1S3OA 3MWYW 4OONA 3HKSA 3NQTA 3FDTA 1S5ED 4DR5Q 2O4XA 3DM3A 5LHY1 2NZHA 2Y0SB 4GOPA 1I5FA 4JI7L 1VQIA 2NVQH 4BA2I 4L63B 2I07B 3T51B 2V4DA 1PFBA 4JI8L 3UDFA 2NVTH 4G7OC 2F3VA 4BS9A 1V1PA 1EY7A 3NENA 3NUCA 3GTMB 2QEXA 2N55A 1EOTA 4JBJA 1SNMA 4LF7L 1ZYRC 4DNRB 1I4HA 4XQNA 3BVZA 5KYLA 2E2HB 3QJYA 1Y69U 1K8GA 1LM0A 4OEMB 3KJOA 5EBCA 1BCPB 4LFAQ 1JB3A 4XYQA 2I46A 2E2IH 1QZGA 4ODGA 1H9SA 2VZAA 1SAPA 1LABA 1LT3D 3QOJA 2G5DA 2RBMA 3PMFA 3K59A 1LTID 1VQ8A 3BS1A 1EYGA 5IYBH 3K0XA 1ET9A 5I2YA 4QIWE 5HGTA 3G71A 1D5XC 3A8KE 2R93B 4B3MQ 3VYSA 3M4QA 2F0JA 2VQEQ 2ZXOA 4DV3Q 1UUPA 1KABA 3GTLB 4F87A 4A3BH 1BR9A 4AQYQ 1W3SA 2KOLA 2K32A 1Q81C 4JI2Q 2L0CA 4WJWA 2N88A 3PO3G 1TIID 3OOCA 1JB7A 4DV7L 1KNAA 2CVRA 4HJ9A 1TS2A 2Z1CA 1EWIA 2Q8IB 3F2DA 2K50A 2SOBA 2XIWA 1JE5A 3K0YA 2F0HA 5A35A 3S17H 1II3A 4IJHA 1F9SA 1FR3A 2QDBA 2UXCL 4A3DG 3CP0A 4DR7Q 3KBXA 1JJCB 4QF4A 1WTVA 1I6VC 2IX0A 3QOLA 1K0RA 1RCVD 1KC8C 4IUQA 2YTXA 4LF6L 1I3QH 4JBMA 5EBDA 2IW3A 2Q2TA 1IZ6A 2MGSA 2PI2E 2BCOA 4L5TA 3J80L 4Y7NB 4RKLA 1JICA 3H3VH 3VYUA 3R2TA 4KY5A 1G51A 3F8TA 1GUWA 5IYCG 3BDCA 3D4WA 5AFWA 2LS01 5G3LD 3AB9A 4YWMA 1IL2A 1PRTB 4IPHA 3S1NH 2HCIA 2Z6BA 3NPPA 3BG3A 3I4MB 3D4DA 2QKIC 1BCPF 3S24A 4R8IA 3OW2A 1EYCA 2VUMH 1HNWQ 3RN2A 4ZRZA 5NUCA 3K57A 1ILQA 2R93G 2EYMA 4HJAA 2Z9HA 1FNUA 5C0XI 1SBBB 1CKNB 1VMCA 1GJXA 2EYFA 1E1OA 2CWPA 3J80i 4HJ5A 3OHXC 5JJZA 3NBHB 1QG7A 4OELB 4OIJA 4BBRH 1DONA 1SLJA 1X3PA 5EJWA 3SR1A 2RKSA 2B2WC 1SRUA 2UUBQ 1CT1D 1X3QA 4OGQC 4KHPL 2SNMA 3A74A 3FPUB 1MJCA 1F2LA 5E4XA 4ZK9B 3S1QH 2F0GA 3TSSA 3MAQA 4UAIA 1Y1WH 1KAAA 1XXGA 1N34Q 2F3IA 1R9TB 2J0TD 1I50B 1TWCB 4A3IB 4GKKL 4K5XA 5I6WA 3CMAA 3L3OC 3FHWA 2ZTDA 4CJ0B 1E7ZA 4GLAC 3J7ZC 1NSNS 4TVAB 4OWXB 1UE7A 1YNNC 4DKAC 2PNHA 3JAME 4JV5L 3T56B 2B2WA 3OYYA 5LMNQ 3TRZA 5FO7B 5CV5A 2F0PA 1A8VA 2R7ZB 1KHIA 4A3FB 3K7UC 1YITA 5JJIA 4DV1Q 2E5LL 3PSIA 4ZYSA 4A3EB 3J7YW 1H9KA 2C5CA 3QWNA 4RAUC 3H3VI 1TQOA 2WV6D 1QVGA 2CFMA 1PLFA 3I56A 1PRTF 5CV7A 1HTLD 1CHPD 3P20A 1S5BD 1C7YA 1SYBA 3NXWA 1YEZA 1WD0A 1ICFB 1NTGA 2G9HD 3DM1A 3GTQH 3KF8B 4ULLA 3ZYYX 4B08A 1VQ7A 2B2TC 3J7AF 3CAMA 4A76A 1SYEA 4DPGA 2H5XA 1VQ4A 1YJWA 4BY7B 4MTNA 1SEBD 4A3MH 1IW7C 4LFBQ 2FJ2A 1YI2A 3HOXB 5FKAC 4NXMQ 1K0SA 1BDOA 2LMCB 1D1KA 1CKMA 1HTPA 5ISRA 2LFNA 1U9RA 3BVMA 1EZ8A 4H0LC 5JOBA 4IFDI 4DR6Q 1L1OB 2Q8TA 3BZKA 3NBIA 4UDUC 1O7ZA 1YJ9A 3BDLA 4H02A 4A3IG 1J9OA
chains in the Genus database with same CATH topology
5GQOA 5IY0A 1KRTA 1BBUA 3GTLH 1X3GA 3G48A 4DUYL 4DV2Q 3PF4A 2I0QA 4DAYB 2WB1E 3CF5A 2Z0SA 3NELA 4DUZQ 1S40A 4JI0Q 4JI4L 3GTKH 2ZJPA 3HOUH 1HZ9A 2JQOA 2UU9L 2VNUD 2MFIA 4A3CH 5ELNA 2EXDA 1UEBA 3KLWA 4X66L 1XJVA 2ZJQA 1GVPA 1X56A 5GAHC 1WFQA 2BH8A 1QVFA 4B3SQ 3S2DH 4JCVE 1X65A 2IT1A 3UDXA 2WB1G 4RG1A 4JYAQ 2R7ZG 4DUZL 4JI0L 4A3FG 1HR0W 4KHPQ 2JA8H 1E3PA 1PH6A 1L2FA 1WOCA 2AWNA 4QGUA 1VQLA 1TWGH 1NE3A 1L1OC 1TXYA 3IRBA 4B3SL 5K36G 1V43A 2A1AA 4UP9A 3CCQA 1OTCA 2JA7G 1PH1A 4A4IA 5C0XJ 1MJEA 1VQDA 4GNXB 4DR1Q 1HH2P 1G291 2V1CC 4AIMA 2JA5G 3HOYH 3CC4A 1FVIA 3PO2G 3CCLA 4GKKQ 4DR5L 4XIGS 2DGYA 5IP7G 4OX9Q 1C9OA 3CMEA 3JC66 1NJIC 1GD7A 4DR1L 5C4XG 2DUDA 4A3IG 4JG2A 2RHSB 3PIOA 4BY1H 4JV5Q 4Y7NH 2RHQB 4K0KQ 4HIKA 3ERSX 4YCUA 1QZHA 1HNXQ 1YHAA 2YTVA 3HOXH 3HOVH 4NPSA 4GLVB 4L5SA 5C3EH 2KBNA 4BY7G 3TEHB 1N36Q 1Q46A 4R4CA 2K5VA 5FLXc 1BBWA 4KHZA 3RNUA 1N32L 1Q7YC 2CQOA 2OQKA 4DV5Q 3KFUA 2E5LQ 5J3BA 5ELOA 3FKIH 2KHIA 4OWWB 4OO1G 4LWCA 4GNXC 4A3JG 5HY6A 1PFSA 3OTOQ 4MZ9A 1IBLQ 1FL0A 3CPWA 1N36L 5FJ8G 2JEAI 1JMCA 4X65Q 4LFCQ 4B3TQ 3J81c 4LF8Q 2IHEA 2N8NA 3PCOB 3K81C 2A8VA 4DR4Q 3AYHB 5M3MG 2Z6KA 4R4QA 1IBKQ 3T1YL 1VQPA 2NVXH 3L2PA 2UUCQ 2B29A 2BA0A 1X9NA 4LFAL 1CSQA 1D8LA 1JJ2A 4WJ4A 1IBLL 2BA1A 5C0XG 2MQHA 4DR3L 5H1SE 1IYJB 4YY3Q 2IHFA 3PGZA 2PMZE 3L0OA 5IYBG 2NN6I 3RN5A 4JBKA 3CXCA 4LF9L 2UUCL 4A75A 4A3LH 3M9BA 4NXNL 3W1BA 1VS0A 1VQOA 1LTLA 1QUQA 5JEAG 1W2BA 4B3ML 3BU2A 3CCRA 2F4VL 1XMOL 2YV5A 4AYBE 2VQFQ 2OCEA 4DV3L 2MO1A 4DV6L 1VQ6A 4GOPB 4A3GG 1VQBA 4A3BG 4GNXA 2AKWB 4C3HH 1PH3A 3W5OA 4A93H 2K5NA 3GD7A 4WJ3M 1PHJA 5M5WH 3BZCA 3D0FA 4GS3A 1VQ9A 4AYBG 4JI2L 1XPUA 4C3JH 3UE1A 2ZM6L 2ZTCA 4JI3L 1UE1A 2EQSA 2GVAA 4O0AA 1YJNA 2Y0SG 1MIUA 4YHHQ 5M3FH 2JK8A 3GDEA 4HIMA 3S1RH 1ASZA 1PH9A 1PYBA 5LMUQ 4JI5L 1IBMQ 4AH6A 1PH2A 1XNRL 4X6AH 2K14A 4X64Q 1PH5A 1R9TH 3G4SA 4P72A 1HR0Q 5JJKA 1UWVA 1TWCH 4FDBA 3CCSA 1PH4A 4A3IH 3TS2A 1Q82C 1Z9FA 3K80C 1E22A 4R4IA 2KCTA 3TS0A 4A3KH 3I7FA 2YYZA 5LMUL 4DNIA 1E24A 4DV0L 1KAWA 4JI4Q 3GTOH 1TWHH 2JA6H 3M4PA 4GOPC 2D0PA 2KHJA 2UU9Q 4LNQA 2CWAA 3J7A5 1NMFA 3AEVA 1P8LA 4DR7L 1VQEA 4X66Q 3AFQA 3BJUA 1XMQL 1GO3E 2BH2A 4IPCA 3HOWG 1I6HH 2N78A 2UUAL 4EX5A 4BXXG 2R7ZH 4JI6L 4LW1A 1JJGA 4A3FH 1X54A 1VQFA 3PUVA 2ZTEA 2CKZB 1G6PA 2NZOA 4IFDJ 1YNXA 4A3EH 5IWAL 2JEBI 4C2MH 2UXDL 3ICEA 3F1ZA 2WFWA 4X62L 3RZDH 1VCIA 1U5KA 3MXNB 1LUZA 4PG3A 3KJPA 2JA7H 4HIDA 4JI7Q 4YWKA 2RCNA 4MNOA 1VQGA 1CKOA 1S3OA 2QGQA 4OONA 4O2DA 3HKSA 1QUQB 1UE6A 3PO2H 4DR5Q 1VQMA 3DM3A 2NZHA 4OXPA 2VUMG 4GOPA 1I5FA 3CCUA 5IP7H 4IOCA 4JI7L 4IOAA 1Q8KA 1HNWL 1VQIA 2NVQH 1EIYB 4BA2I 2OTJA 2Z6KC 3B6YA 4JI8L 1S72A 3UDFA 2NVTH 1WJJA 1J6QA 4LF7Q 2AHOB 2I5LX 1SN8A 3NENA 1K3RA 3FP9A 4BY7H 1Q12A 2QEXA 2PQAB 1N32Q 4JC0A 1KL9A 1YIJA 1NY4A 3PIPA 4BBRG 1BKBA 4JBJA 2HQLA 1VQHA 1X55A 2JE6I 4IPDA 4JI1L 4LF7L 1FJGQ 5FLMG 3PUYA 1C0AA 1OXUA 1HZAA 4GKJL 5FJ8H 3E0EA 1K8GA 2OTLA 1LM0A 2R92G 5M3MH 1OXXK 2UUBL 1J5EL 3T1YQ 4B3RL 3KJOA 5C44G 3A5UA 2E2JH 1FJGL 2B63G 3CPFA 1PVOA 1CUKA 2K75A 4LUVA 4LFAQ 3I4NG 1Y1VH 3HOZG 2E2IH 1QZGA 2VZAA 1YHBA 4DK3C 4DR3Q 3CQZH 2MNAA 1Q1BA 2R7FA 3U4VA 3CCMA 1Y1WG 1VQ8A 1EYGA 2ES2A 4LF9Q 5IYBH 3K0XA 5IT9c 5HGQA 2NVYH 4QIWE 4NXNQ 4YCWA 3G71A 4DR2L 3GO5A 1SR3A 1VQCA 2VS1A 4B3MQ 3M4QA 1SE8A 2HHHL 2VQEQ 2F4VQ 1XMOQ 1D7QA 4DV3Q 4P74A 3M3YH 4DV6Q 1M1KC 4R4TA 3UE0A 4A3GH 4A3BH 3K8AA 1SMXA 2XGTA 1Q86C 1HZBA 4C3IH 4AQYQ 3KF6B 1W3SA 3STBC 1Q81C 3M4OH 4JI2Q 2VQEL 3EIVA 3GTGH 2EIFA 2ZM6Q 4UY8C 3PO3G 1SFOH 5LMNL 4JI3Q 1TWFH 3CW2C 3GTPH 1NMGA 1Q1EA 1T9HA 2Y0SE 1JB7A 4DV7L 3I4MG 1I94L 3CD6A 4HJ9A 1CKNA 5GADC 2UXCQ 1EWIA 4JI5Q 3GTJH 4AQYL 1XNRQ 3ULJA 3F2DA 2GVBA 4DV1L 2K50A 4IJLA 5E7NA 3HOUG 1PH8A 1JE5A 4KLKA 1N9WA 1WCMG 3U4ZA 4LF5L 1VQNA 4IJHA 3M7NA 1E1TA 3S17H 4BBSG 4P75A 2FXQA 2PQAA 2UXCL 4DV0Q 1GKHA 4A3DG 2KCMA 3MEFA 5LMNW 3STBD 3KYHC 1XPOA 3CP0A 3PV0A 1O7IA 4KI0A 4DR7Q 3A0JA 1JJCB 1V1QA 3KDFA 1XMQQ 2IX0A 1VQKA 1RL2A 1K0RA 1OXSC 1KC8C 2YTXA 1PYSB 2I5HA 4LF6L 2PI2A 1I3QH 2UUAQ 4JBMA 3HOWH 2MO0A 3H0GG 2E2HH 2K5HA 4JI6Q 4BXXH 3CC7A 3ULPA 1XPRA 3I55A 3L7ZC 2Q2TA 1IZ6A 2PI2E 4L5TA 1AE2A 1EQRA 4LUZA 5BR8L 5IWAQ 1UE5A 3T1HQ 1HNZQ 3H3VH 2JJQA 2UXDQ 4ALPA 1G51A 4IPGA 4X62Q 3PUWA 4LUOA 3F8TA 4UP8A 1U0LA 3CCEA 3I4OA 4HIOA 4A3MG 5IYCG 3U50C 4LF4L 5IYDG 2Q2IA 4LFBL 2R7DA 4YWMA 5C4JH 1IL2A 4IPHA 4GN4B 3Q8DA 1B8AA 3KOJA 4GLXA 3T1HL 1HNZL 4NXML 5AJ3L 3S1NH 4OO1I 2CCZA 3AQQA 2ATWA 4J15A 3OW2A 3S24A 2VUMH 1YZ6A 2NN6G 4TQUS 4POGA 4A3KG 1N33L 1HNWQ 3RN2A 1A63A 2JA5H 4JI8Q 3KF6A 2Q2UA 3S1MH 3PUXA 4JOIA 1KXLA 2JA6G 4DR6L 2VW9A 4P73A 4PZ6A 1K73C 5IP9G 4HJ7A 2R93G 4HJAA 4QJFA 3AFPA 2R6GA 5C0XI 1FGUA 2ZJRA 2OQ0A 1CKNB 5C4XH 3S16H 1CSPA 1KD1C 4DV2L 1E1OA 1VQAA 1X3EA 2CWPA 4UPAA 1TWAH 3J80i 4DAMA 4HJ5A 1WI5A 4JI1Q 2ALYB 2KENA 2L15A 2XTIA 3NBHB 3TQYA 1K83H 3UDIA 1SLJA 4BBRH 4A3CG 2B3GA 1XNQQ 1Y14B 2I5MX 2VY3A 1KIXA 1HR0L 5FLMH 4A3EG 4NB3A 4GKJQ 1A0IA 1MKHA 2ID0A 3EN2A 4EQ5A 3J81i 2QA4A 2IX1A 3A5ZB 1SRUA 4DV4Q 1RIPA 4JYAL 2UUBQ 2C35B 1J5EQ 2HT1A 1EIFA 1SROA 2R92H 1AE3A 4B3RQ 2JA8G 1H95A 4KHPL 5M5YH 5JJLA 2RF4A 1X3FA 1A62A 3A74A 2WP8J 1MJCA 5C44H 4HJ8A 3UDGA 4A3JH 1GM5A 1XNQL 1YBYA 2B63H 3I4NH 3KDFB 4PMWA 1PA6A 1NBWA 3RZOH 3S15H 3HOZH 1DGSA 2K4KA 4DV4L 3U58A 1B70B 3S1QH 4IFDG 3K7AH 2HIVA 1Y1WH 1VQ5A 2AWOA 5JEAJ 1N34Q 4QL5A 3HOYG 1EQQA 2F3IA 3I2ZA 3RLNA 1HJPA 3CCJA 4DR2Q 3HFZB 1OXTA 2HHHQ 3F2BA 1XTDA 4GKKL 2GN5A 3F2CA 3CMAA 3FHWA 4YWLA 2ZTDA 3PF5A 4OX9L 1E7ZA 4GLAC 5EAYA 3J7ZC 1N34L 1B7YB 4TVAB 4BY1G 4OWXB 1UE7A 2K52A 4DKAC 2PNHA 4JV5L 1L1OA 3CC2A 3J80c 4K0KL 3S2HH 4APVA 3HOXG 3HOVG 3VDYA 3OYYA 1HNXL 2VL6A 5M5XH 5LMNQ 4ME3A 3M85A 5C3EG 3ER0A 3TRZA 3PO3H 1LYLA 2AMCB 4DV7Q 1I94Q 2YU9H 3I4MH 4UP7A 3RR5A 3J81j 1A8VA 2HIXA 2OWOA 1KHIA 4R4OA 3K7UC 5GAGC 1YITA 1OXVA 5JJIA 1BVSA 4DV5L 3FKIG 3EBEA 4DV1Q 2E5LL 3PSIA 3DLLA 4DK6C 4P71A 1VQJA 2N3SA 5DLQE 4GN3B 1Y1VG 4LF5Q 2WAQE 3JAMi 3OTOL 3H3VI 1QVGA 1WCMH 2CFMA 4BBSH 1ASYA 3PUZA 4LFCL 4X65L 4PZ7A 3I56A 4B3TL 4LF8L 3H15A 4DR4L 2UXBQ 3ULLA 1V9PA 4PZ8A 3D31A 3SGIA 4A3DH 1IXRA 2YTYA 4YCVA 3E9HA 4JBWA 1IBKL 4RMFA 2Q2HA 1C7YA 2WAQG 3NEMA 1YEZA 1Z47A 3S14H 1NTGA 1K9MC 3LGJA 4QY7A 1P16A 1EFWA 3RLFA 4LF6Q 2LXJA 2LXKA 1KQSA 2UXBL 1HZCA 1L0WA 3HKZE 3KF8B 3WWVA 4YY3L 1K8AC 3GTMH 3GTQH 3H0GH 2IY5B 2JA9A 2N49A 4A3LG 4OWTB 5BR8Q 4JOIC 1VQ7A 1PH7A 1QVCA 3CAMA 3W1GA 5GAEC 4A76A 2F52A 2A19A 2D0OA 4DPGA 3HKZG 4QQBX 4XTCS 2H5XA 1VQ4A 2VQFL 3ZJYC 3G6EA 1YJWA 4MTNA 4L5RC 4A3MH 1X6OA 4LF4Q 1M90C 3RLOA 5IYCH 4LFBQ 4A93G 1YVCA 5IYDH 1YI2A 4Y52H 4NXMQ 1EUJA 2D62A 5AJ3Q 1PV4A 1JT8A 4POFA 1CKMA 4IO9A 3TREA 5IE8A 1I50H 1KRSA 4BA1I 1N33Q 4GN5A 3JAMc 5M3FG 4L5QA 4YHHL 5GROA 1YHQA 4DUYQ 1AH9A 1IBML 4R1JA 4DR6Q 1L1OB 4IFDI 3BZKA 2ASBA 3CCVA 1YJ9A 1N8RC 3E9IA 1EOVA 4H02A 4X64L 2R93H 5IP9H 2E8GA 2LSSA 1WYDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GQO A;  5IY0 A;  1KRT A;  1BBU A;  3GTL H;  1X3G A;  3G48 A;  4DUY L;  4DV2 Q;  3PF4 A;  2I0Q A;  4DAY B;  2WB1 E;  3CF5 A;  2Z0S A;  3NEL A;  4DUZ Q;  1S40 A;  4JI0 Q;  4JI4 L;  3GTK H;  2ZJP A;  3HOU H;  1HZ9 A;  2JQO A;  2UU9 L;  2VNU D;  2MFI A;  4A3C H;  5ELN A;  2EXD A;  1UEB A;  3KLW A;  4X66 L;  1XJV A;  2ZJQ A;  1GVP A;  1X56 A;  5GAH C;  1WFQ A;  2BH8 A;  1QVF A;  4B3S Q;  3S2D H;  4JCV E;  1X65 A;  2IT1 A;  3UDX A;  2WB1 G;  4RG1 A;  4JYA Q;  2R7Z G;  4DUZ L;  4JI0 L;  4A3F G;  1HR0 W;  4KHP Q;  2JA8 H;  1E3P A;  1PH6 A;  1L2F A;  1WOC A;  2AWN A;  4QGU A;  1VQL A;  1TWG H;  1NE3 A;  1L1O C;  1TXY A;  3IRB A;  4B3S L;  5K36 G;  1V43 A;  2A1A A;  4UP9 A;  3CCQ A;  1OTC A;  2JA7 G;  1PH1 A;  4A4I A;  5C0X J;  1MJE A;  1VQD A;  4GNX B;  4DR1 Q;  1HH2 P;  1G29 1;  2V1C C;  4AIM A;  2JA5 G;  3HOY H;  3CC4 A;  1FVI A;  3PO2 G;  3CCL A;  4GKK Q;  4DR5 L;  4XIG S;  2DGY A;  5IP7 G;  4OX9 Q;  1C9O A;  3CME A;  3JC6 6;  1NJI C;  1GD7 A;  4DR1 L;  5C4X G;  2DUD A;  4A3I G;  4JG2 A;  2RHS B;  3PIO A;  4BY1 H;  4JV5 Q;  4Y7N H;  2RHQ B;  4K0K Q;  4HIK A;  3ERS X;  4YCU A;  1QZH A;  1HNX Q;  1YHA A;  2YTV A;  3HOX H;  3HOV H;  4NPS A;  4GLV B;  4L5S A;  5C3E H;  2KBN A;  4BY7 G;  3TEH B;  1N36 Q;  1Q46 A;  4R4C A;  2K5V A;  5FLX c;  1BBW A;  4KHZ A;  3RNU A;  1N32 L;  1Q7Y C;  2CQO A;  2OQK A;  4DV5 Q;  3KFU A;  2E5L Q;  5J3B A;  5ELO A;  3FKI H;  2KHI A;  4OWW B;  4OO1 G;  4LWC A;  4GNX C;  4A3J G;  5HY6 A;  1PFS A;  3OTO Q;  4MZ9 A;  1IBL Q;  1FL0 A;  3CPW A;  1N36 L;  5FJ8 G;  2JEA I;  1JMC A;  4X65 Q;  4LFC Q;  4B3T Q;  3J81 c;  4LF8 Q;  2IHE A;  2N8N A;  3PCO B;  3K81 C;  2A8V A;  4DR4 Q;  3AYH B;  5M3M G;  2Z6K A;  4R4Q A;  1IBK Q;  3T1Y L;  1VQP A;  2NVX H;  3L2P A;  2UUC Q;  2B29 A;  2BA0 A;  1X9N A;  4LFA L;  1CSQ A;  1D8L A;  1JJ2 A;  4WJ4 A;  1IBL L;  2BA1 A;  5C0X G;  2MQH A;  4DR3 L;  5H1S E;  1IYJ B;  4YY3 Q;  2IHF A;  3PGZ A;  2PMZ E;  3L0O A;  5IYB G;  2NN6 I;  3RN5 A;  4JBK A;  3CXC A;  4LF9 L;  2UUC L;  4A75 A;  4A3L H;  3M9B A;  4NXN L;  3W1B A;  1VS0 A;  1VQO A;  1LTL A;  1QUQ A;  5JEA G;  1W2B A;  4B3M L;  3BU2 A;  3CCR A;  2F4V L;  1XMO L;  2YV5 A;  4AYB E;  2VQF Q;  2OCE A;  4DV3 L;  2MO1 A;  4DV6 L;  1VQ6 A;  4GOP B;  4A3G G;  1VQB A;  4A3B G;  4GNX A;  2AKW B;  4C3H H;  1PH3 A;  3W5O A;  4A93 H;  2K5N A;  3GD7 A;  4WJ3 M;  1PHJ A;  5M5W H;  3BZC A;  3D0F A;  4GS3 A;  1VQ9 A;  4AYB G;  4JI2 L;  1XPU A;  4C3J H;  3UE1 A;  2ZM6 L;  2ZTC A;  4JI3 L;  1UE1 A;  2EQS A;  2GVA A;  4O0A A;  1YJN A;  2Y0S G;  1MIU A;  4YHH Q;  5M3F H;  2JK8 A;  3GDE A;  4HIM A;  3S1R H;  1ASZ A;  1PH9 A;  1PYB A;  5LMU Q;  4JI5 L;  1IBM Q;  4AH6 A;  1PH2 A;  1XNR L;  4X6A H;  2K14 A;  4X64 Q;  1PH5 A;  1R9T H;  3G4S A;  4P72 A;  1HR0 Q;  5JJK A;  1UWV A;  1TWC H;  4FDB A;  3CCS A;  1PH4 A;  4A3I H;  3TS2 A;  1Q82 C;  1Z9F A;  3K80 C;  1E22 A;  4R4I A;  2KCT A;  3TS0 A;  4A3K H;  3I7F A;  2YYZ A;  5LMU L;  4DNI A;  1E24 A;  4DV0 L;  1KAW A;  4JI4 Q;  3GTO H;  1TWH H;  2JA6 H;  3M4P A;  4GOP C;  2D0P A;  2KHJ A;  2UU9 Q;  4LNQ A;  2CWA A;  3J7A 5;  1NMF A;  3AEV A;  1P8L A;  4DR7 L;  1VQE A;  4X66 Q;  3AFQ A;  3BJU A;  1XMQ L;  1GO3 E;  2BH2 A;  4IPC A;  3HOW G;  1I6H H;  2N78 A;  2UUA L;  4EX5 A;  4BXX G;  2R7Z H;  4JI6 L;  4LW1 A;  1JJG A;  4A3F H;  1X54 A;  1VQF A;  3PUV A;  2ZTE A;  2CKZ B;  1G6P A;  2NZO A;  4IFD J;  1YNX A;  4A3E H;  5IWA L;  2JEB I;  4C2M H;  2UXD L;  3ICE A;  3F1Z A;  2WFW A;  4X62 L;  3RZD H;  1VCI A;  1U5K A;  3MXN B;  1LUZ A;  4PG3 A;  3KJP A;  2JA7 H;  4HID A;  4JI7 Q;  4YWK A;  2RCN A;  4MNO A;  1VQG A;  1CKO A;  1S3O A;  2QGQ A;  4OON A;  4O2D A;  3HKS A;  1QUQ B;  1UE6 A;  3PO2 H;  4DR5 Q;  1VQM A;  3DM3 A;  2NZH A;  4OXP A;  2VUM G;  4GOP A;  1I5F A;  3CCU A;  5IP7 H;  4IOC A;  4JI7 L;  4IOA A;  1Q8K A;  1HNW L;  1VQI A;  2NVQ H;  1EIY B;  4BA2 I;  2OTJ A;  2Z6K C;  3B6Y A;  4JI8 L;  1S72 A;  3UDF A;  2NVT H;  1WJJ A;  1J6Q A;  4LF7 Q;  2AHO B;  2I5L X;  1SN8 A;  3NEN A;  1K3R A;  3FP9 A;  4BY7 H;  1Q12 A;  2QEX A;  2PQA B;  1N32 Q;  4JC0 A;  1KL9 A;  1YIJ A;  1NY4 A;  3PIP A;  4BBR G;  1BKB A;  4JBJ A;  2HQL A;  1VQH A;  1X55 A;  2JE6 I;  4IPD A;  4JI1 L;  4LF7 L;  1FJG Q;  5FLM G;  3PUY A;  1C0A A;  1OXU A;  1HZA A;  4GKJ L;  5FJ8 H;  3E0E A;  1K8G A;  2OTL A;  1LM0 A;  2R92 G;  5M3M H;  1OXX K;  2UUB L;  1J5E L;  3T1Y Q;  4B3R L;  3KJO A;  5C44 G;  3A5U A;  2E2J H;  1FJG L;  2B63 G;  3CPF A;  1PVO A;  1CUK A;  2K75 A;  4LUV A;  4LFA Q;  3I4N G;  1Y1V H;  3HOZ G;  2E2I H;  1QZG A;  2VZA A;  1YHB A;  4DK3 C;  4DR3 Q;  3CQZ H;  2MNA A;  1Q1B A;  2R7F A;  3U4V A;  3CCM A;  1Y1W G;  1VQ8 A;  1EYG A;  2ES2 A;  4LF9 Q;  5IYB H;  3K0X A;  5IT9 c;  5HGQ A;  2NVY H;  4QIW E;  4NXN Q;  4YCW A;  3G71 A;  4DR2 L;  3GO5 A;  1SR3 A;  1VQC A;  2VS1 A;  4B3M Q;  3M4Q A;  1SE8 A;  2HHH L;  2VQE Q;  2F4V Q;  1XMO Q;  1D7Q A;  4DV3 Q;  4P74 A;  3M3Y H;  4DV6 Q;  1M1K C;  4R4T A;  3UE0 A;  4A3G H;  4A3B H;  3K8A A;  1SMX A;  2XGT A;  1Q86 C;  1HZB A;  4C3I H;  4AQY Q;  3KF6 B;  1W3S A;  3STB C;  1Q81 C;  3M4O H;  4JI2 Q;  2VQE L;  3EIV A;  3GTG H;  2EIF A;  2ZM6 Q;  4UY8 C;  3PO3 G;  1SFO H;  5LMN L;  4JI3 Q;  1TWF H;  3CW2 C;  3GTP H;  1NMG A;  1Q1E A;  1T9H A;  2Y0S E;  1JB7 A;  4DV7 L;  3I4M G;  1I94 L;  3CD6 A;  4HJ9 A;  1CKN A;  5GAD C;  2UXC Q;  1EWI A;  4JI5 Q;  3GTJ H;  4AQY L;  1XNR Q;  3ULJ A;  3F2D A;  2GVB A;  4DV1 L;  2K50 A;  4IJL A;  5E7N A;  3HOU G;  1PH8 A;  1JE5 A;  4KLK A;  1N9W A;  1WCM G;  3U4Z A;  4LF5 L;  1VQN A;  4IJH A;  3M7N A;  1E1T A;  3S17 H;  4BBS G;  4P75 A;  2FXQ A;  2PQA A;  2UXC L;  4DV0 Q;  1GKH A;  4A3D G;  2KCM A;  3MEF A;  5LMN W;  3STB D;  3KYH C;  1XPO A;  3CP0 A;  3PV0 A;  1O7I A;  4KI0 A;  4DR7 Q;  3A0J A;  1JJC B;  1V1Q A;  3KDF A;  1XMQ Q;  2IX0 A;  1VQK A;  1RL2 A;  1K0R A;  1OXS C;  1KC8 C;  2YTX A;  1PYS B;  2I5H A;  4LF6 L;  2PI2 A;  1I3Q H;  2UUA Q;  4JBM A;  3HOW H;  2MO0 A;  3H0G G;  2E2H H;  2K5H A;  4JI6 Q;  4BXX H;  3CC7 A;  3ULP A;  1XPR A;  3I55 A;  3L7Z C;  2Q2T A;  1IZ6 A;  2PI2 E;  4L5T A;  1AE2 A;  1EQR A;  4LUZ A;  5BR8 L;  5IWA Q;  1UE5 A;  3T1H Q;  1HNZ Q;  3H3V H;  2JJQ A;  2UXD Q;  4ALP A;  1G51 A;  4IPG A;  4X62 Q;  3PUW A;  4LUO A;  3F8T A;  4UP8 A;  1U0L A;  3CCE A;  3I4O A;  4HIO A;  4A3M G;  5IYC G;  3U50 C;  4LF4 L;  5IYD G;  2Q2I A;  4LFB L;  2R7D A;  4YWM A;  5C4J H;  1IL2 A;  4IPH A;  4GN4 B;  3Q8D A;  1B8A A;  3KOJ A;  4GLX A;  3T1H L;  1HNZ L;  4NXM L;  5AJ3 L;  3S1N H;  4OO1 I;  2CCZ A;  3AQQ A;  2ATW A;  4J15 A;  3OW2 A;  3S24 A;  2VUM H;  1YZ6 A;  2NN6 G;  4TQU S;  4POG A;  4A3K G;  1N33 L;  1HNW Q;  3RN2 A;  1A63 A;  2JA5 H;  4JI8 Q;  3KF6 A;  2Q2U A;  3S1M H;  3PUX A;  4JOI A;  1KXL A;  2JA6 G;  4DR6 L;  2VW9 A;  4P73 A;  4PZ6 A;  1K73 C;  5IP9 G;  4HJ7 A;  2R93 G;  4HJA A;  4QJF A;  3AFP A;  2R6G A;  5C0X I;  1FGU A;  2ZJR A;  2OQ0 A;  1CKN B;  5C4X H;  3S16 H;  1CSP A;  1KD1 C;  4DV2 L;  1E1O A;  1VQA A;  1X3E A;  2CWP A;  4UPA A;  1TWA H;  3J80 i;  4DAM A;  4HJ5 A;  1WI5 A;  4JI1 Q;  2ALY B;  2KEN A;  2L15 A;  2XTI A;  3NBH B;  3TQY A;  1K83 H;  3UDI A;  1SLJ A;  4BBR H;  4A3C G;  2B3G A;  1XNQ Q;  1Y14 B;  2I5M X;  2VY3 A;  1KIX A;  1HR0 L;  5FLM H;  4A3E G;  4NB3 A;  4GKJ Q;  1A0I A;  1MKH A;  2ID0 A;  3EN2 A;  4EQ5 A;  3J81 i;  2QA4 A;  2IX1 A;  3A5Z B;  1SRU A;  4DV4 Q;  1RIP A;  4JYA L;  2UUB Q;  2C35 B;  1J5E Q;  2HT1 A;  1EIF A;  1SRO A;  2R92 H;  1AE3 A;  4B3R Q;  2JA8 G;  1H95 A;  4KHP L;  5M5Y H;  5JJL A;  2RF4 A;  1X3F A;  1A62 A;  3A74 A;  2WP8 J;  1MJC A;  5C44 H;  4HJ8 A;  3UDG A;  4A3J H;  1GM5 A;  1XNQ L;  1YBY A;  2B63 H;  3I4N H;  3KDF B;  4PMW A;  1PA6 A;  1NBW A;  3RZO H;  3S15 H;  3HOZ H;  1DGS A;  2K4K A;  4DV4 L;  3U58 A;  1B70 B;  3S1Q H;  4IFD G;  3K7A H;  2HIV A;  1Y1W H;  1VQ5 A;  2AWO A;  5JEA J;  1N34 Q;  4QL5 A;  3HOY G;  1EQQ A;  2F3I A;  3I2Z A;  3RLN A;  1HJP A;  3CCJ A;  4DR2 Q;  3HFZ B;  1OXT A;  2HHH Q;  3F2B A;  1XTD A;  4GKK L;  2GN5 A;  3F2C A;  3CMA A;  3FHW A;  4YWL A;  2ZTD A;  3PF5 A;  4OX9 L;  1E7Z A;  4GLA C;  5EAY A;  3J7Z C;  1N34 L;  1B7Y B;  4TVA B;  4BY1 G;  4OWX B;  1UE7 A;  2K52 A;  4DKA C;  2PNH A;  4JV5 L;  1L1O A;  3CC2 A;  3J80 c;  4K0K L;  3S2H H;  4APV A;  3HOX G;  3HOV G;  3VDY A;  3OYY A;  1HNX L;  2VL6 A;  5M5X H;  5LMN Q;  4ME3 A;  3M85 A;  5C3E G;  3ER0 A;  3TRZ A;  3PO3 H;  1LYL A;  2AMC B;  4DV7 Q;  1I94 Q;  2YU9 H;  3I4M H;  4UP7 A;  3RR5 A;  3J81 j;  1A8V A;  2HIX A;  2OWO A;  1KHI A;  4R4O A;  3K7U C;  5GAG C;  1YIT A;  1OXV A;  5JJI A;  1BVS A;  4DV5 L;  3FKI G;  3EBE A;  4DV1 Q;  2E5L L;  3PSI A;  3DLL A;  4DK6 C;  4P71 A;  1VQJ A;  2N3S A;  5DLQ E;  4GN3 B;  1Y1V G;  4LF5 Q;  2WAQ E;  3JAM i;  3OTO L;  3H3V I;  1QVG A;  1WCM H;  2CFM A;  4BBS H;  1ASY A;  3PUZ A;  4LFC L;  4X65 L;  4PZ7 A;  3I56 A;  4B3T L;  4LF8 L;  3H15 A;  4DR4 L;  2UXB Q;  3ULL A;  1V9P A;  4PZ8 A;  3D31 A;  3SGI A;  4A3D H;  1IXR A;  2YTY A;  4YCV A;  3E9H A;  4JBW A;  1IBK L;  4RMF A;  2Q2H A;  1C7Y A;  2WAQ G;  3NEM A;  1YEZ A;  1Z47 A;  3S14 H;  1NTG A;  1K9M C;  3LGJ A;  4QY7 A;  1P16 A;  1EFW A;  3RLF A;  4LF6 Q;  2LXJ A;  2LXK A;  1KQS A;  2UXB L;  1HZC A;  1L0W A;  3HKZ E;  3KF8 B;  3WWV A;  4YY3 L;  1K8A C;  3GTM H;  3GTQ H;  3H0G H;  2IY5 B;  2JA9 A;  2N49 A;  4A3L G;  4OWT B;  5BR8 Q;  4JOI C;  1VQ7 A;  1PH7 A;  1QVC A;  3CAM A;  3W1G A;  5GAE C;  4A76 A;  2F52 A;  2A19 A;  2D0O A;  4DPG A;  3HKZ G;  4QQB X;  4XTC S;  2H5X A;  1VQ4 A;  2VQF L;  3ZJY C;  3G6E A;  1YJW A;  4MTN A;  4L5R C;  4A3M H;  1X6O A;  4LF4 Q;  1M90 C;  3RLO A;  5IYC H;  4LFB Q;  4A93 G;  1YVC A;  5IYD H;  1YI2 A;  4Y52 H;  4NXM Q;  1EUJ A;  2D62 A;  5AJ3 Q;  1PV4 A;  1JT8 A;  4POF A;  1CKM A;  4IO9 A;  3TRE A;  5IE8 A;  1I50 H;  1KRS A;  4BA1 I;  1N33 Q;  4GN5 A;  3JAM c;  5M3F G;  4L5Q A;  4YHH L;  5GRO A;  1YHQ A;  4DUY Q;  1AH9 A;  1IBM L;  4R1J A;  4DR6 Q;  1L1O B;  4IFD I;  3BZK A;  2ASB A;  3CCV A;  1YJ9 A;  1N8R C;  3E9I A;  1EOV A;  4H02 A;  4X64 L;  2R93 H;  5IP9 H;  2E8G A;  2LSS A;  1WYD A; 
#chains in the Genus database with same CATH topology
 5GQO A;  4DUY L;  3PF4 A;  2I0Q A;  2NVX B;  2B2T A;  2WB1 E;  3A7L A;  4B9W A;  1LTT D;  4JI4 L;  3GTK H;  1MD2 D;  1K3B C;  1D7Q A;  1VF5 C;  1QVF A;  1GVP A;  3S2D H;  1WFQ A;  3M3Y B;  1QB5 D;  4B3S Q;  4JCV E;  3UDX A;  2R7Z G;  4A3G B;  4DUZ L;  4A3F G;  1HR0 W;  5EPK A;  1HXY D;  4FF1 A;  2MPM A;  1PTO D;  5HUR A;  4RGM A;  4QGU A;  4IAL A;  3GTG B;  3IL8 A;  1CHQ D;  3GTP B;  2A1A A;  3CCQ A;  4MN3 A;  4KKS A;  4A4I A;  1BO0 A;  3GTJ B;  1TKW B;  1JWM D;  1HH2 P;  2V1C C;  4AIM A;  3CC4 A;  4HR7 B;  3KLR A;  1UNS A;  4DR5 L;  1H9R A;  5M3F B;  4XIG S;  2DGY A;  1GUO A;  4OX9 Q;  3NQI A;  2B2U C;  2MJ8 A;  1ZKO A;  1HQR D;  1GUS A;  3OMG A;  3I90 A;  4K0K Q;  1RHP A;  3NP8 A;  2YTV A;  3HOV H;  5C3E H;  3HGB A;  4BY7 G;  2L1B A;  4R4C A;  2K5V A;  1B3A A;  3PIO 3;  5KND A;  4FO2 A;  4RA8 A;  4CDF C;  3FKI H;  1EY0 A;  4OWW B;  4OO1 G;  5COY A;  4J1M A;  2FIN B;  1B44 D;  1FL0 A;  2EOT A;  1N36 L;  2WB1 B;  5FJ8 G;  2IHE A;  3K5L A;  5FO8 B;  4LMQ D;  2KVM A;  2Z6K A;  3FPP A;  4X3K A;  1IBK Q;  1PYW D;  1BUV T;  2B29 A;  2FHT A;  4LFA L;  2EYH A;  2B2U A;  3RZD B;  5D3I B;  3P75 A;  1LTR D;  3WOE A;  5H1S E;  3PGZ A;  2PMZ E;  1BBX C;  1ML0 D;  2HCC A;  3CXC A;  1RD9 D;  3I70 A;  3BZD B;  1D2B A;  4B3M L;  1HHV A;  3BU2 A;  3CCR A;  2DY7 A;  2NBF A;  4AYB E;  1QWY A;  2OCE A;  3A7A B;  4DV3 L;  5C4X B;  4FXG C;  4GOP B;  4A3G G;  1VQB A;  2FFK B;  4DF7 A;  1PH3 A;  3GD7 A;  1XTC D;  1XPU A;  1VQ9 A;  2EPB A;  4JI2 L;  4C3J H;  1V1P B;  3UE1 A;  2VB2 X;  3E0J A;  5T1I A;  4YHH Q;  4WRD A;  3MFG A;  4AH6 A;  3FEW X;  4X64 Q;  3G4S A;  3HOZ B;  1CZW A;  2KQ3 A;  4ZQ3 A;  1BQQ T;  2PO4 A;  3K80 C;  5CYU A;  2ENB A;  5LMU L;  4DNI A;  1E24 A;  2X6G A;  5ELB A;  2XWB B;  4KK7 A;  3GTO H;  1TWH H;  2UU9 Q;  2CWA A;  4DR7 L;  2BOS A;  1SYF A;  1H9S B;  4HCE A;  4G7Z C;  1RKN A;  2BH2 A;  3J7A V;  1I6H H;  2N78 A;  4XT1 B;  3QIA A;  4KD3 A;  4LW1 A;  2VXW A;  2ZTE A;  5ELD A;  1EWC A;  4LAA A;  4H44 C;  5IT9 E;  3ICE A;  1U5K A;  3T16 A;  4YWK A;  5D65 A;  2QGQ A;  1ROD A;  3C1E A;  3P1H A;  1QUQ B;  1UE6 A;  1EZ6 A;  4OXP A;  1WCM B;  1STG A;  2KEC A;  3LX0 A;  2SEB D;  3KLS A;  1Q8I A;  3K58 A;  3CCU A;  5IP7 H;  1Q8K A;  2D5D A;  1HNW L;  1WTQ A;  1D5Z C;  1EIY B;  3B6Y A;  3EA6 A;  5D3D A;  3A54 A;  3VR2 A;  1PTO H;  4R9W A;  5E3F A;  3S14 B;  1KLU D;  4KKT A;  2J7Z A;  2F0M A;  3VR3 A;  4QMG A;  3NTH A;  3URY A;  1K3R A;  3FP9 A;  2WAC A;  1Q12 A;  1LTA D;  3MEH A;  1NY4 A;  1TY0 A;  3PIP A;  4XQJ A;  4O1N A;  1FJG Q;  5FLM G;  2EXZ A;  5KIX A;  3E0E A;  4O42 A;  3JAM L;  2OTL A;  5M3M H;  1OXX K;  2F1M A;  2UUB L;  3T1Y Q;  1DCZ A;  3IFD A;  1V8Q A;  4LUV A;  1Y1V H;  3HOZ G;  1SNP A;  1YHB A;  1Z6H A;  3I3C A;  4IUP A;  4CHT B;  4C1N I;  5C3W A;  5HGQ A;  5DM7 3;  3DUZ A;  5JEA H;  1CFM A;  4P74 A;  5T1G A;  1M1K C;  4MTK A;  4G4K A;  2EYP A;  1HZB A;  4RH6 A;  1Z7T A;  4C3I H;  3EIV A;  1JCK B;  1T5E A;  4OL7 A;  1SFO H;  5LMN L;  4JI3 Q;  2Y0S E;  3CD6 A;  4HMI A;  5GAD C;  1SE2 A;  1SYG A;  2JA8 B;  3N52 A;  4DV1 L;  2C9O A;  3G7L A;  3DHQ A;  1N9W A;  1WCM G;  5C4H A;  3NE5 B;  1E1T A;  4P75 A;  1QCB D;  4CKB A;  2PQA A;  2KCM A;  5LMN W;  3STB D;  3KYH C;  3ONA B;  2IL8 A;  1O7I A;  4KI0 A;  2NWG A;  3A0J A;  1V1Q A;  2F0K A;  3A56 A;  1FNV A;  1RL2 A;  1VQK A;  1PYS B;  2I5H A;  5IGC A;  1E0B A;  2LY7 A;  2MO0 A;  2E2H H;  4BXX H;  3CC7 A;  2K5W A;  3I55 A;  4EQN A;  2ZXP A;  1UE5 A;  1HNZ Q;  4KKU A;  4FNF A;  4C3J G;  3DMU A;  3I4O A;  4LJZ C;  1O7L A;  3U50 C;  2Q8R E;  3OWF A;  5IYD G;  4LFB L;  2QDL A;  5M5X B;  1XWE A;  5J1Z A;  3T1H L;  4NXM L;  3Q8D A;  1G8Z D;  2XSC A;  1DD2 A;  1STE A;  5FLX E;  3G6J B;  3KBG A;  1QOH A;  2F0L A;  4J6H A;  4KJO A;  2JA5 H;  3H09 A;  1WTO A;  4DR6 L;  2VW9 A;  3J81 E;  1LV9 A;  4QJF A;  2E76 C;  3AFP A;  2ZJR A;  4DK1 A;  4A3D B;  2OQ0 A;  3S16 H;  1EY9 A;  1X3E A;  3V96 A;  1SE3 A;  3U9O A;  4K2L A;  1RTO A;  1B9N A;  2XTI A;  3TQY A;  2RDF A;  2I5M X;  5A2Q L;  4XXE A;  1PZK D;  4NB3 A;  1AW7 A;  1KTK A;  4GKJ Q;  3HKZ B;  1MKH A;  3Q6S A;  4DV4 Q;  3Q24 A;  2C35 B;  1J5E Q;  2F0Q A;  1JOO A;  1SRO A;  2R92 H;  1AE3 A;  4C3H B;  2JA8 G;  4ZAI A;  1LTS D;  2P5Z X;  2WP8 J;  5C44 H;  4EQP A;  1XNQ L;  2B63 H;  1HA6 A;  3I4N H;  3KDF B;  4PMW A;  1PA6 A;  3S15 H;  1UEA B;  1F9P A;  4DK0 A;  2HD3 A;  3KUP A;  3BYY B;  3U58 A;  1IL8 A;  3S1R B;  3K7A H;  2EVB A;  1G6Z A;  2AWO A;  3CRL C;  3CCJ A;  3I2Z A;  3RLN A;  4RGT A;  3DWP A;  5C0X H;  2K5Q A;  4KJN A;  1JOQ A;  1I4R A;  4OX9 L;  2RVL A;  5EAY A;  3VR4 A;  2K52 A;  3CC2 A;  1DM0 B;  2PW5 A;  4K0K L;  4HAE A;  4APV A;  1QJO A;  3ER0 A;  3QO2 A;  1LYL A;  3HZX A;  2L4N A;  5EKI A;  3TP8 A;  3I4M H;  4UP7 A;  3TP6 A;  3J81 j;  3SDZ A;  3EJI A;  3EBE A;  3D6W A;  3DLL A;  2O5J C;  1VQJ A;  2TMP A;  2A6E D;  1ZEQ X;  1Y1V G;  5I6Y A;  4C2M B;  4LF5 Q;  1KLG D;  4U67 3;  4BBS H;  3PUZ A;  3VYR A;  1T5X D;  2JA7 B;  3H15 A;  3ULL A;  1TS5 A;  3D31 A;  2EY1 A;  2K5D A;  2F0D A;  1IXR A;  1IBK L;  4RMF A;  3NEM A;  2XNA C;  4CJ2 C;  3AMU A;  3LGJ A;  1U4P A;  2LXK A;  1KQS A;  2UXB L;  1HZC A;  1FYC A;  1K8A C;  1F2Z A;  2NVQ B;  3H0G H;  3ND9 A;  2PQE A;  4H7B A;  4A3L G;  1TU2 B;  2A19 A;  2D0O A;  3HKZ G;  1EL0 A;  4G57 A;  3ZJY C;  1C4Q A;  3G6E A;  3C1F A;  4C3H G;  3E6Z X;  3RLO A;  1GUT A;  2F0N A;  5FO9 B;  3BDO A;  1DYQ A;  1ENF A;  4TSS A;  3TRE A;  3MXU A;  1CM9 A;  1I50 H;  1ET6 A;  5IE8 A;  3ITP A;  4GN5 A;  3JAM c;  1HFN A;  2NN6 H;  4YHH L;  1L0X B;  1YHQ A;  1AH9 A;  5IT9 L;  1QE6 A;  4RHR A;  1N8R C;  3E9I A;  3I91 A;  2E2I B;  4X64 L;  5IP9 H;  2E8G A;  1PTO C;  4M1U B;  4DXG A;  3BYT B;  3CRK C;  1S40 A;  4JI0 Q;  1EWH A;  3HOU H;  2HDM A;  4CGY B;  2ZJP A;  2UU9 L;  2VNU D;  2K1B A;  2MFI A;  2ZXR A;  4A3C H;  2KUM A;  1J8I A;  5ELN A;  3KLW A;  1JE4 A;  1XJV A;  2ZJQ A;  1X56 A;  1H9M A;  5D14 A;  5GAH C;  1S4Z A;  1X65 A;  2Z4H A;  1W6K A;  2FMC A;  5J22 A;  4A3B B;  3SEB A;  4IN3 A;  4JVZ A;  2AWN A;  1TWG H;  3T4A C;  1TXY A;  3IRB A;  3I4L A;  1V43 A;  2M2L A;  3WDN A;  3HS0 C;  2JA7 G;  4IFD H;  1VQD A;  4DR1 Q;  2E74 C;  2B8F A;  2CH4 W;  3HOY H;  2JA5 G;  1HPC A;  4NKL A;  3RUZ A;  1TVX A;  3HEJ A;  3S17 B;  3TBI B;  4DAP A;  2D2C C;  3QB3 A;  1C9O A;  1CQF A;  3CME A;  3JC6 6;  2RHS B;  4KY7 A;  4RGO S;  4BY1 H;  2EY6 A;  4HIK A;  4HCS A;  4YCU A;  1HNX Q;  3HOX H;  5EQ0 A;  1I3Q B;  4ID6 A;  1DXM A;  1BBW A;  4ABN A;  1B3Q A;  1MSG A;  1JQY D;  5HY6 A;  1PFS A;  3OTO Q;  4C56 C;  1IBL Q;  2JEA I;  2EJM A;  5BN4 A;  4B3T Q;  4LF8 Q;  2A8V A;  3PCO B;  3K81 C;  4DR4 Q;  1ESF A;  4R4Q A;  3FRP B;  3T1Y L;  1VQP A;  2NVX H;  3DEP A;  2BA0 A;  3S1N B;  4WJ4 A;  1C48 A;  1JJ2 A;  5EPL A;  5C0X G;  1QNK A;  2K04 A;  1LTB D;  2VUM B;  3LNN A;  1QIL A;  2IHF A;  4YY3 Q;  5IYB G;  2NN6 I;  1WTH A;  2CQA A;  2UUC L;  3H94 A;  1CZG A;  2J4X A;  1AP0 A;  5M9O A;  1DOL A;  2OT2 A;  1WTR A;  2BDO A;  2VQF Q;  4RHS A;  4G7H C;  1NR2 A;  4F8M A;  4A3B G;  5CV4 A;  2H1E A;  4A93 H;  4BBR B;  2K5N A;  4GZY C;  5M5W H;  4K8J A;  1XX8 A;  5CBA E;  4K6D A;  2ZTC A;  4JI3 L;  2EQS A;  2GVA A;  1YJN A;  2RQX A;  5M3F H;  3GDE A;  1O78 A;  4HIM A;  5E1F A;  3FMC A;  3L9A X;  2K14 A;  3NTK A;  4P72 A;  1UWV A;  3OSO A;  3CCS A;  3TS2 A;  3S1Q B;  2CHB D;  1E22 A;  4A3K H;  2KCT A;  3I7F A;  5JAV A;  4IUR A;  1Y1W B;  1KAW A;  1SDF A;  2MP1 A;  1ILP A;  4CJ1 B;  2JA6 H;  2D0P A;  1DZ1 A;  1NMF A;  2FMM A;  2DJG C;  2A73 B;  2DY8 A;  2DNC A;  5EPJ A;  2H4O A;  2L12 A;  3ERQ A;  2OEO A;  4IPC A;  2RDH A;  2NVY B;  2E75 C;  2LKV A;  4FYD A;  1VQF A;  3PUV A;  2A6H D;  1YNX A;  2JEB I;  3R93 A;  5K36 H;  3M7G A;  1EU3 A;  2WFW A;  3RZD H;  2GA4 B;  1VCI A;  5L37 A;  3OWE B;  1C8C A;  4JI7 Q;  2JSO A;  1O7Y A;  1CKO A;  4O2D A;  4X3S A;  3X3M A;  1NUC A;  2K7V A;  3U9S A;  3PO2 H;  3K6O A;  4KMU C;  1TR5 A;  2VUM G;  4IOC A;  2Z4I A;  2G9D A;  2Z6K C;  3UI2 A;  1WJJ A;  1J6Q A;  2F03 A;  3Q0A A;  4LF7 Q;  4V19 0;  1NNX A;  2NUC A;  1MGS A;  2QEJ C;  1F9Q A;  1TS4 A;  3GTQ B;  2PQA B;  1N32 Q;  4DA2 A;  1KL9 A;  1YIJ A;  1MI2 A;  4WOR A;  4BBR G;  1JWS D;  2HQL A;  4IPD A;  1X55 A;  4IUU A;  1I4G A;  3LWE A;  3MXG A;  2PPB C;  3DXJ C;  1OXU A;  2NYZ D;  4GKJ L;  1F9R A;  3PIP 3;  4A3M B;  1Q90 A;  1ENC A;  3GP7 A;  5IGB A;  1J5E L;  1JOR A;  3LWU A;  1I4P A;  1M4V A;  2E2J H;  3VR5 A;  4IQZ A;  4DK3 C;  2K33 A;  3CQZ H;  2MNA A;  3K5M A;  2R7F A;  1EEF D;  3CCM A;  1Y1W G;  2ES2 A;  2A69 D;  3K5O A;  2F0F A;  5IT9 c;  2L9H A;  2R3Z A;  1PFN A;  4YCW A;  3GO5 A;  1A2U A;  1SR3 A;  5TSS A;  1IKL A;  4NMZ A;  2F4V Q;  1VMP A;  1U4L A;  1L0Y B;  3MXN A;  2F0E A;  1B50 A;  2EJF C;  4PV1 C;  1A2T A;  4R4T A;  3SVM A;  1E2Z A;  2K05 A;  3K8A A;  2QCP X;  2XGT A;  3SE0 A;  1CA6 A;  3STB C;  3M4O H;  2VQE L;  2EIF A;  4UY8 C;  2JXM B;  4XDX A;  3H3V C;  2B8G A;  1TWF H;  3CW2 C;  4R8N A;  2XN9 C;  1TWA B;  3ND8 A;  3TZD A;  3TDQ A;  1CKN A;  2UXC Q;  4AQY L;  1XNR Q;  4RCN A;  1RJT A;  2GVB A;  4IJL A;  5E7N A;  4XQQ A;  3U4Z A;  4LF5 L;  4FF4 A;  3M7N A;  5KEE A;  5M5Y B;  2B2V A;  3MEF A;  3Q23 A;  1BCP D;  4J8Q A;  3A8J E;  1LLR D;  1UAP A;  1XMQ Q;  1M8A A;  1OXS C;  1HA5 A;  2PI2 A;  5C4Z A;  2UUA Q;  3HOW H;  2PNR C;  2K5H A;  1CQV A;  3D3R A;  1XPR A;  3L7Z C;  1AE2 A;  2ICE C;  5KGU A;  3HOV B;  1F77 A;  3TN2 A;  2JJQ A;  5C3E B;  4ALP A;  1EFI D;  4IPG A;  4X62 Q;  3PUW A;  4LUO A;  4UP8 A;  1U0L A;  1A3T A;  3CCE A;  4A3M G;  1LO5 D;  5C4J H;  3FKI B;  4GN4 B;  4S3S A;  4GLX A;  1STB A;  2NZ1 D;  3MZ5 A;  3AQQ A;  2DJF C;  4M8A A;  3J80 E;  1YZ6 A;  4POG A;  2L11 A;  4A3K G;  1A63 A;  1IW7 D;  2MUY A;  5BN5 A;  2KED A;  5CMD A;  3S1M H;  3KF6 A;  4JOI A;  1HUM A;  2JA6 G;  3EVQ A;  4PZ6 A;  1K73 C;  4HJ7 A;  3SHL A;  2EY2 A;  2EYJ A;  2EE1 A;  1WVL A;  4FF3 A;  3O13 A;  1BNZ A;  4ILW A;  4UPA A;  3CKI B;  1PZI D;  2ALY B;  1KNE A;  2KEN A;  4JI1 Q;  3UDI A;  3EFX D;  1K83 H;  2Q2U A;  3X3N A;  1KIX A;  2VY3 A;  4NP5 A;  1HR0 L;  2XRQ D;  5G3L F;  4KTA A;  1A0I A;  3PQI A;  2ID0 A;  3EN2 A;  3OMC A;  4K6L A;  4CKE A;  1RIP A;  4KN4 C;  3KF8 A;  2HT1 A;  4B3R Q;  4HJ8 A;  4A3J H;  1YBY A;  4C3J B;  3RZO H;  3VA7 A;  2KA7 A;  3C3L A;  2AUK A;  3MVV A;  3CHB D;  4ZKC B;  2O5I C;  1VDZ A;  4HMJ A;  1EYD A;  5JEA J;  4QL5 A;  3I72 A;  4NDX A;  1EQQ A;  2A68 D;  4DR2 Q;  1I4Q A;  1SJE D;  1HJP A;  1PRT D;  1SSO A;  1STY A;  5EGT A;  5IOC A;  2HHH Q;  1LT4 D;  3D4R A;  2A6E C;  2KJX A;  3WOF A;  4TRD A;  3PF5 A;  3EQL C;  1N34 L;  1B7Y B;  2A74 C;  3GTO B;  1TWH B;  2OXP A;  1VF7 A;  1L1O A;  3S2H H;  3HOV G;  3E3X A;  3I8Z A;  1HNX L;  5M5X H;  3M85 A;  5C3E G;  3PO3 H;  3MTS A;  2AMC B;  3A55 A;  1I94 Q;  4TKO B;  2YU9 H;  1I6H B;  4R4O A;  4XT3 B;  5GAG C;  1OXV A;  3NWT A;  1BVS A;  1G2S A;  2K03 A;  3FKI G;  4DK6 C;  4P71 A;  1NAP A;  2N3S A;  5DLQ E;  4GN3 B;  2PYK A;  3P7J A;  3JAM i;  1D1I A;  3OTO L;  1PXU A;  3GQB A;  2JN4 A;  4B3T L;  4LF8 L;  4DR4 L;  1V9P A;  1JC7 A;  3SGI A;  4A3D H;  2YTY A;  4YCV A;  3E9H A;  4JBW A;  1SNQ A;  5I9P A;  2WAQ G;  1K8M A;  4QCL A;  1Z47 A;  3SK4 A;  1K9M C;  4QY7 A;  5DM6 3;  1EFW A;  2LXJ A;  1L0W A;  3HKZ E;  3WWV A;  4YY3 L;  3GTM H;  2IY5 B;  4OWT B;  5BR8 Q;  4JPB W;  1PTO B;  1A6X A;  4DAV A;  2F52 A;  4XTC S;  2VQF L;  4L5R C;  4LF4 Q;  1M90 C;  1BOS A;  5IYC H;  2EYL A;  1EUJ A;  1PV4 A;  5AJ3 Q;  1SYC A;  5F2D A;  4DXF A;  1KRS A;  4BA1 I;  3HP3 A;  1N33 Q;  1K8O A;  4B9X A;  4CDE C;  1YNJ D;  5M3M B;  5GRO A;  1PMR A;  1BXT A;  4DUY Q;  2HDL A;  1DOM A;  4LK1 C;  4R1J A;  2ASB A;  1Y1V B;  1EOV A;  2CW0 D;  2M9V A;  2R93 H;  2LSS A;  4JC0 A;  1VQL A;  3IFT A;  5IY0 A;  4ZUJ A;  3GTL H;  2F0O A;  1LTG D;  1X3G A;  3G48 A;  4DV2 Q;  4DUZ Q;  1EY6 A;  3A8I E;  1HZ9 A;  4QUC A;  2EXD A;  4CDC C;  1FGB D;  2DNE A;  2BH8 A;  1MBY A;  2IT1 A;  4RG1 A;  4JYA Q;  4DGZ A;  2O2L D;  1E3P A;  1PH6 A;  1L2F A;  1WOC A;  2TSS A;  1NE3 A;  1Y8O B;  1SFO B;  1CI3 M;  4B3S L;  4KN7 C;  5I4D A;  2WKC A;  1OTC A;  4EQO A;  4PQX A;  1PH1 A;  5C0X J;  3NK9 A;  2BE5 D;  3TZU A;  1G29 1;  2WIN B;  4K5V A;  5CV6 A;  1DOK A;  4L6T B;  1SND A;  3VA5 A;  1I4X A;  5IP7 G;  1GD7 A;  3NWS A;  2KEE A;  1RF2 D;  4FXK C;  4Y7N H;  2RHQ B;  3ERS X;  3S9W A;  1QZH A;  1YHA A;  2PCF B;  4GLV B;  3TEH B;  1PTO F;  1N36 Q;  1D6E C;  3RNU A;  1N32 L;  2CQO A;  2OQK A;  4DV5 Q;  3KFU A;  3GV6 A;  3SK6 A;  4RKB A;  2WII B;  4N9P A;  4LWC A;  4GNX C;  4A3J G;  4P2C B;  3E5S A;  4RWS C;  3CPW A;  4LFC Q;  4X65 Q;  3AYH B;  4N8F A;  4DAY A;  5DNF A;  5M3M G;  4IUN A;  1JR0 D;  1X9N A;  1D8L A;  5COR A;  2BA1 A;  4K5W A;  1EQT A;  1IYJ B;  3L0O A;  3RN5 A;  4BWG B;  4OHJ A;  2JA5 B;  1H9J A;  3R8B A;  5IGG A;  3I73 A;  1VQO A;  1G2T A;  2F0W A;  4N8X 1;  1QUQ A;  2D9U A;  5JEA G;  1W2B A;  2F4V L;  1EYA A;  2YV5 A;  3NTI A;  3S16 B;  4GNX A;  2AKW B;  2NVT B;  3W5O A;  4C3I G;  1PHJ A;  4GS3 A;  5J39 A;  1B2T A;  5I9O A;  1UE1 A;  4O0A A;  2Y0S G;  1MIU A;  2JK8 A;  2R92 B;  1PYB A;  5LMU Q;  1A3U A;  1IBM Q;  1PH2 A;  1SMY D;  1XNR L;  5C44 B;  2B63 B;  2NTT A;  1PH5 A;  3I4N B;  1R9T H;  3S15 B;  1TWC H;  4FDB A;  2A6H C;  4A3I H;  4IUT A;  3K7A B;  2B39 A;  1R4P B;  2QF7 A;  1GXD C;  3M4P A;  4LNQ A;  2KHJ A;  3J7A 5;  3RMH A;  3IKJ A;  1VQE A;  4X66 Q;  1XMQ L;  1GO3 E;  5IGD A;  1EQV A;  3DWA A;  1GOZ A;  2UUA L;  3R3O A;  4BXX G;  4QIW B;  2R7Z H;  1EU4 A;  1AZP A;  4ME5 A;  4A3F H;  1G6P A;  2CKZ B;  4IFD J;  4A3E H;  1B1Z A;  3KK7 A;  5I2X A;  2F0S A;  2X69 A;  3HRZ C;  3F1Z A;  1TS3 A;  4X62 L;  1B4O A;  3MXN B;  1LUZ A;  4PG3 A;  2KCC A;  5C5M A;  4CKC A;  1VQG A;  3C46 A;  1HUN A;  1B9M A;  1VQM A;  1EY5 A;  4DNT B;  1NR4 A;  2HUG A;  4BBS B;  3ERO A;  2CH4 A;  2F4I A;  3T13 A;  4IOA A;  4JW0 A;  2OTJ A;  1S72 A;  1CK1 A;  1AN8 A;  2AHO B;  2I5L X;  1SN8 A;  1SNO A;  4BY7 H;  2PZT A;  5EKK A;  3H0G B;  4RGN A;  5E4W C;  1BKB A;  2A69 C;  4JI1 L;  1VQH A;  2JE6 I;  2Z8L A;  3H91 A;  4Q5V A;  4OO1 H;  3PUY A;  3MC0 B;  2M00 A;  1C0A A;  1ICW A;  1HZA A;  5DEH A;  5FJ8 H;  4HED A;  3OIP A;  4I65 A;  4FP5 D;  2R92 G;  1HQM C;  5CV9 A;  4B3R L;  1SNC A;  3RD4 A;  3VR6 A;  5C44 G;  3A5U A;  1FJG L;  2B63 G;  2PZU A;  3CPF A;  1PVO A;  1CUK A;  2K75 A;  1XYI A;  3I4N G;  4F7X A;  4DR3 Q;  3W3A A;  1Q1B A;  4H13 C;  3U4V A;  3CU7 A;  4LF9 Q;  3MXP A;  4NW2 A;  1ZYR D;  1S5D D;  2NVY H;  4NXN Q;  3W2D A;  4DR2 L;  1Y8P B;  1VQC A;  1V1O A;  2VS1 A;  3SK8 A;  1SE8 A;  2HHH L;  1XMO Q;  3M3Y H;  1S5C D;  2F3W A;  4DV6 Q;  1BF4 A;  3UE0 A;  4A3G H;  3HOU B;  1SMX A;  1Q86 C;  3KF6 B;  2L55 A;  3GTG H;  1W6J A;  2ZM6 Q;  1BCP C;  5CC4 A;  3GTP H;  1G91 A;  1NMG A;  1HRJ A;  1Q1E A;  1T9H A;  2PZW A;  3I4M G;  1GUG A;  1I94 L;  1STN A;  1KDC A;  2QIL A;  1IHZ A;  4JI5 Q;  3GTJ H;  2SNS A;  3ULJ A;  3V2T A;  1TWG B;  2RCF A;  1PH8 A;  4KLK A;  4I7Z C;  1VQN A;  2IX3 A;  1Y8N B;  2KCN A;  4BBS G;  2FXQ A;  1R4Q B;  1HFG A;  1MHW C;  4DV0 Q;  1GKH A;  5ELF A;  4FXD A;  2PW7 A;  3HOY B;  1XPO A;  3PV0 A;  5CBE E;  4QUF A;  4UHV A;  3KDF A;  4RCO A;  3KLS X;  2JYO A;  2XVS A;  4FVM A;  3H0G G;  5FLX L;  4JI6 Q;  3TME A;  3ULP A;  4BY1 B;  2BDN A;  1EIH A;  1EQR A;  4LUZ A;  5C3X A;  5BR8 L;  1WTW A;  2KHS A;  3IAY A;  5EKL A;  5IWA Q;  1E2W A;  3T1H Q;  2UXD Q;  1X32 A;  1HCZ A;  3J81 L;  4HIO A;  1AFP A;  1IKM A;  3H6M A;  1PZJ D;  4LF4 L;  2IPK D;  2Q2I A;  2R7D A;  2EYO A;  1HNZ L;  1B8A A;  3KOJ A;  5AJ3 L;  4OO1 I;  2CCZ A;  5ELE A;  2ATW A;  1RTN A;  4J15 A;  4RFB A;  2NN6 G;  4TQU S;  4DN4 M;  5BN3 A;  1N33 L;  5CV8 A;  4KD4 A;  2K01 A;  2K28 A;  4JI8 Q;  3PUX A;  1KXL A;  4P73 A;  5IP9 G;  2EDG A;  2R6G A;  1FGU A;  1U4R A;  4CDD C;  5C4X H;  1CSP A;  1KD1 C;  4DV2 L;  3HOU G;  1GHJ A;  1VQA A;  4DAM A;  1TWA H;  3TP5 A;  1WI5 A;  2OWO A;  2L15 A;  4A3C G;  2B3G A;  1XNQ Q;  1Y14 B;  2A68 C;  4YIJ A;  5CGK A;  5FLM H;  1JWU D;  4A3E G;  1PRT C;  1QNU A;  3NSW A;  4EQ5 A;  3TP7 A;  3J81 i;  2QA4 A;  3N6R A;  2IX1 A;  3A5Z B;  5IGF A;  4JYA L;  1Q3L A;  1EIF A;  2IWH A;  1H95 A;  4A93 B;  1IYU A;  5M5Y H;  2RF4 A;  1X3F A;  1A62 A;  4ZLT F;  3UDG A;  5JJL A;  5M5W B;  1GM5 A;  3SK5 A;  2ZT9 C;  4F88 A;  4ZCK A;  1NBW A;  1U4M A;  3HOZ H;  3M4Y A;  1DGS A;  2AQ2 B;  2K4K A;  4L8J A;  4DV4 L;  1CTM A;  1B70 B;  1KDA A;  4IFD G;  2HIV A;  4K8I A;  1VQ5 A;  5A2Q E;  3D8G A;  3HOY G;  3VYT A;  4DU9 A;  4PNY A;  2SDF A;  4Q0F A;  3HFZ B;  1OXT A;  1ENA A;  3F2B A;  1XTD A;  2GN5 A;  2R61 A;  3F2C A;  4A3K B;  4YWL A;  3MA2 B;  2DN8 A;  4BY1 G;  2JA6 B;  1E2V A;  2B2V C;  3J80 c;  4HSP A;  3HOX G;  5IGE A;  3VDY A;  2VL6 A;  4ME3 A;  1GHK A;  1EY8 A;  2K6A A;  1SXT A;  4DV7 Q;  3GTK B;  4X3U A;  3RR5 A;  2HIX A;  5FOB B;  2F0I A;  4DV5 L;  2ICI A;  2L5T A;  4MHE A;  4EGV A;  3S2D B;  1A3V A;  2WAQ E;  1WCM H;  4ZUI A;  1ASY A;  4LFC L;  4X65 L;  1ONL A;  2RA4 A;  3D6C A;  4PZ7 A;  1YNN D;  2QW7 A;  2UXB Q;  4PZ8 A;  3NBH A;  2Q2H A;  5FK9 C;  1EY4 A;  3PO2 B;  2NTS A;  3S14 H;  3F2U A;  4V0B A;  1P16 A;  3RLF A;  4LF6 Q;  1LAC A;  1PDQ A;  1FNW A;  2JA9 A;  1YNJ C;  2N49 A;  2F0U A;  4JOI C;  1PH7 A;  4N9T A;  1QVC A;  3W1G A;  5GAE C;  4QQB X;  2CW0 C;  1WTX A;  1TT2 A;  3R2I A;  4JK1 C;  3HG9 A;  1X6O A;  4EVO A;  4A93 G;  1YVC A;  5IYD H;  4DFA A;  4Y52 H;  2D62 A;  1JT8 A;  4POF A;  1GUN A;  1IYV A;  4IO9 A;  5ELC A;  1ZXT A;  1FD7 D;  5LL6 S;  4C1N K;  5M3F G;  4K2K A;  4L5Q A;  2EJG C;  1DJR D;  1OO9 B;  4MIU A;  5IIF A;  1IBM L;  2E2J B;  2JP1 A;  3GV3 A;  3CCV A;  4KY6 A;  1S5F D;  4HTH A;  1AEX A;  1WYD A;  3OIQ A;  3CQZ B;  3V05 A;  1KRT A;  1BBU A;  3OW7 A;  1LT5 D;  4DAY B;  3CF5 A;  2Z0S A;  3NEL A;  4U68 A;  2WAQ B;  2BE5 C;  2JQO A;  4E6I A;  1UEB A;  4X66 L;  4PMB A;  2PMZ B;  4CBV A;  2WB1 G;  4ZKB B;  4JI0 L;  1O80 A;  4KHP Q;  1A15 A;  2JA8 H;  5JVH 3;  2A5H A;  3M4O B;  2OF1 A;  2MHV A;  1D5M C;  1EEI D;  1L1O C;  4AYB B;  1WD1 A;  5K36 G;  1TWF B;  5JPN C;  4UP9 A;  2X6L A;  1ESR A;  1F2M A;  1MJE A;  3MHB A;  2B2Y C;  4WFN 3;  2AQ3 B;  4IZ8 A;  4GNX B;  5JVG 3;  1SE4 A;  1FVI A;  1KDB A;  3PO2 G;  3CCL A;  4GKK Q;  4IUV A;  4HSV A;  1NJI C;  1LT6 D;  4DR1 L;  5C4X G;  2DUD A;  4JG2 A;  3PIO A;  4JV5 Q;  4KHV A;  1PFM A;  4NPS A;  2VB3 X;  2XWJ B;  3Q22 A;  2KBN A;  4L5S A;  2F0V A;  1Q46 A;  3HOW B;  5FLX c;  4KHZ A;  2IJ0 A;  1Q7Y C;  3BVG A;  5C6A A;  2E5L Q;  5J3B A;  5JPM C;  5ELO A;  3AU7 A;  2KHI A;  1EIG A;  4MZ9 A;  2B2Y A;  1JMC A;  1RDP D;  3J81 c;  2N8N A;  3SXH A;  3DWQ A;  4HN7 A;  1JOK A;  3QR8 A;  5C5L A;  5C4J B;  2UUC Q;  3L2P A;  3NHH A;  1CSQ A;  1IBL L;  1TY2 A;  5KNB A;  2MQH A;  5IOD A;  4DR3 L;  3OPO A;  1F2Y A;  5KRU A;  4Z9C B;  4JBK A;  4LF9 L;  3DEO A;  3S1M B;  4A75 A;  4A3L H;  3M9B A;  4NXN L;  1SYD A;  5CR3 A;  3W1B A;  1VS0 A;  1SMY C;  1LTL A;  2E2D C;  1XMO L;  2HQE A;  2F0T A;  4QB4 A;  2MO1 A;  4DV6 L;  2AUJ D;  1VQ6 A;  3C2P A;  4C3H H;  1K83 B;  4OIK A;  4FF2 A;  4WJ3 M;  2WKD A;  3BZC A;  3D0F A;  4AYB G;  1B53 A;  2ZM6 L;  2AQ1 B;  5KYI A;  3S1R H;  1ASZ A;  2RSN A;  1PH9 A;  2NB0 A;  4JI5 L;  3T53 B;  4X6A H;  4A3J B;  1STA A;  5JJK A;  1HR0 Q;  3RZO B;  1CA5 A;  1NCV A;  2RSO A;  1PH4 A;  1Q82 C;  1Z9F A;  2EY5 A;  4R4I A;  2RDG A;  3TS0 A;  2YYZ A;  4DV0 L;  1MSH A;  4JI4 Q;  5LL6 X;  4GOP C;  2EZV A;  2XRS D;  3AEV A;  1P8L A;  4KV6 A;  3AFQ A;  3BJU A;  5DAU A;  5KNC A;  4X3T A;  3FVQ A;  4PMC A;  1WTP A;  3HOW G;  1STH A;  4EX5 A;  3K5N A;  4JI6 L;  3QG1 A;  5K5P A;  1JJG A;  1AZQ A;  1X54 A;  3MFY A;  3S2H B;  2NZO A;  4K14 A;  5IWA L;  1K28 A;  3PO3 B;  4C2M H;  2UXD L;  1SJH D;  2YU9 B;  3KJP A;  2JA7 H;  4HID A;  4I7A A;  4C3I B;  2RCN A;  4MNO A;  4XYO A;  1S3O A;  3MWY W;  4OON A;  3HKS A;  3NQT A;  3FDT A;  1S5E D;  4DR5 Q;  2O4X A;  3DM3 A;  5LHY 1;  2NZH A;  2Y0S B;  4GOP A;  1I5F A;  4JI7 L;  1VQI A;  2NVQ H;  4BA2 I;  4L63 B;  2I07 B;  3T51 B;  2V4D A;  1PFB A;  4JI8 L;  3UDF A;  2NVT H;  4G7O C;  2F3V A;  4BS9 A;  1V1P A;  1EY7 A;  3NEN A;  3NUC A;  3GTM B;  2QEX A;  2N55 A;  1EOT A;  4JBJ A;  1SNM A;  4LF7 L;  1ZYR C;  4DNR B;  1I4H A;  4XQN A;  3BVZ A;  5KYL A;  2E2H B;  3QJY A;  1Y69 U;  1K8G A;  1LM0 A;  4OEM B;  3KJO A;  5EBC A;  1BCP B;  4LFA Q;  1JB3 A;  4XYQ A;  2I46 A;  2E2I H;  1QZG A;  4ODG A;  1H9S A;  2VZA A;  1SAP A;  1LAB A;  1LT3 D;  3QOJ A;  2G5D A;  2RBM A;  3PMF A;  3K59 A;  1LTI D;  1VQ8 A;  3BS1 A;  1EYG A;  5IYB H;  3K0X A;  1ET9 A;  5I2Y A;  4QIW E;  5HGT A;  3G71 A;  1D5X C;  3A8K E;  2R93 B;  4B3M Q;  3VYS A;  3M4Q A;  2F0J A;  2VQE Q;  2ZXO A;  4DV3 Q;  1UUP A;  1KAB A;  3GTL B;  4F87 A;  4A3B H;  1BR9 A;  4AQY Q;  1W3S A;  2KOL A;  2K32 A;  1Q81 C;  4JI2 Q;  2L0C A;  4WJW A;  2N88 A;  3PO3 G;  1TII D;  3OOC A;  1JB7 A;  4DV7 L;  1KNA A;  2CVR A;  4HJ9 A;  1TS2 A;  2Z1C A;  1EWI A;  2Q8I B;  3F2D A;  2K50 A;  2SOB A;  2XIW A;  1JE5 A;  3K0Y A;  2F0H A;  5A35 A;  3S17 H;  1II3 A;  4IJH A;  1F9S A;  1FR3 A;  2QDB A;  2UXC L;  4A3D G;  3CP0 A;  4DR7 Q;  3KBX A;  1JJC B;  4QF4 A;  1WTV A;  1I6V C;  2IX0 A;  3QOL A;  1K0R A;  1RCV D;  1KC8 C;  4IUQ A;  2YTX A;  4LF6 L;  1I3Q H;  4JBM A;  5EBD A;  2IW3 A;  2Q2T A;  1IZ6 A;  2MGS A;  2PI2 E;  2BCO A;  4L5T A;  3J80 L;  4Y7N B;  4RKL A;  1JIC A;  3H3V H;  3VYU A;  3R2T A;  4KY5 A;  1G51 A;  3F8T A;  1GUW A;  5IYC G;  3BDC A;  3D4W A;  5AFW A;  2LS0 1;  5G3L D;  3AB9 A;  4YWM A;  1IL2 A;  1PRT B;  4IPH A;  3S1N H;  2HCI A;  2Z6B A;  3NPP A;  3BG3 A;  3I4M B;  3D4D A;  2QKI C;  1BCP F;  3S24 A;  4R8I A;  3OW2 A;  1EYC A;  2VUM H;  1HNW Q;  3RN2 A;  4ZRZ A;  5NUC A;  3K57 A;  1ILQ A;  2R93 G;  2EYM A;  4HJA A;  2Z9H A;  1FNU A;  5C0X I;  1SBB B;  1CKN B;  1VMC A;  1GJX A;  2EYF A;  1E1O A;  2CWP A;  3J80 i;  4HJ5 A;  3OHX C;  5JJZ A;  3NBH B;  1QG7 A;  4OEL B;  4OIJ A;  4BBR H;  1DON A;  1SLJ A;  1X3P A;  5EJW A;  3SR1 A;  2RKS A;  2B2W C;  1SRU A;  2UUB Q;  1CT1 D;  1X3Q A;  4OGQ C;  4KHP L;  2SNM A;  3A74 A;  3FPU B;  1MJC A;  1F2L A;  5E4X A;  4ZK9 B;  3S1Q H;  2F0G A;  3TSS A;  3MAQ A;  4UAI A;  1Y1W H;  1KAA A;  1XXG A;  1N34 Q;  2F3I A;  1R9T B;  2J0T D;  1I50 B;  1TWC B;  4A3I B;  4GKK L;  4K5X A;  5I6W A;  3CMA A;  3L3O C;  3FHW A;  2ZTD A;  4CJ0 B;  1E7Z A;  4GLA C;  3J7Z C;  1NSN S;  4TVA B;  4OWX B;  1UE7 A;  1YNN C;  4DKA C;  2PNH A;  3JAM E;  4JV5 L;  3T56 B;  2B2W A;  3OYY A;  5LMN Q;  3TRZ A;  5FO7 B;  5CV5 A;  2F0P A;  1A8V A;  2R7Z B;  1KHI A;  4A3F B;  3K7U C;  1YIT A;  5JJI A;  4DV1 Q;  2E5L L;  3PSI A;  4ZYS A;  4A3E B;  3J7Y W;  1H9K A;  2C5C A;  3QWN A;  4RAU C;  3H3V I;  1TQO A;  2WV6 D;  1QVG A;  2CFM A;  1PLF A;  3I56 A;  1PRT F;  5CV7 A;  1HTL D;  1CHP D;  3P20 A;  1S5B D;  1C7Y A;  1SYB A;  3NXW A;  1YEZ A;  1WD0 A;  1ICF B;  1NTG A;  2G9H D;  3DM1 A;  3GTQ H;  3KF8 B;  4ULL A;  3ZYY X;  4B08 A;  1VQ7 A;  2B2T C;  3J7A F;  3CAM A;  4A76 A;  1SYE A;  4DPG A;  2H5X A;  1VQ4 A;  1YJW A;  4BY7 B;  4MTN A;  1SEB D;  4A3M H;  1IW7 C;  4LFB Q;  2FJ2 A;  1YI2 A;  3HOX B;  5FKA C;  4NXM Q;  1K0S A;  1BDO A;  2LMC B;  1D1K A;  1CKM A;  1HTP A;  5ISR A;  2LFN A;  1U9R A;  3BVM A;  1EZ8 A;  4H0L C;  5JOB A;  4IFD I;  4DR6 Q;  1L1O B;  2Q8T A;  3BZK A;  3NBI A;  4UDU C;  1O7Z A;  1YJ9 A;  3BDL A;  4H02 A;  4A3I G;  1J9O A; 
#chains in the Genus database with same CATH homology
 5GQO A;  5IY0 A;  1KRT A;  1BBU A;  3GTL H;  1X3G A;  3G48 A;  4DUY L;  4DV2 Q;  3PF4 A;  2I0Q A;  4DAY B;  2WB1 E;  3CF5 A;  2Z0S A;  3NEL A;  4DUZ Q;  1S40 A;  4JI0 Q;  4JI4 L;  3GTK H;  2ZJP A;  3HOU H;  1HZ9 A;  2JQO A;  2UU9 L;  2VNU D;  2MFI A;  4A3C H;  5ELN A;  2EXD A;  1UEB A;  3KLW A;  4X66 L;  1XJV A;  2ZJQ A;  1GVP A;  1X56 A;  5GAH C;  1WFQ A;  2BH8 A;  1QVF A;  4B3S Q;  3S2D H;  4JCV E;  1X65 A;  2IT1 A;  3UDX A;  2WB1 G;  4RG1 A;  4JYA Q;  2R7Z G;  4DUZ L;  4JI0 L;  4A3F G;  1HR0 W;  4KHP Q;  2JA8 H;  1E3P A;  1PH6 A;  1L2F A;  1WOC A;  2AWN A;  4QGU A;  1VQL A;  1TWG H;  1NE3 A;  1L1O C;  1TXY A;  3IRB A;  4B3S L;  5K36 G;  1V43 A;  2A1A A;  4UP9 A;  3CCQ A;  1OTC A;  2JA7 G;  1PH1 A;  4A4I A;  5C0X J;  1MJE A;  1VQD A;  4GNX B;  4DR1 Q;  1HH2 P;  1G29 1;  2V1C C;  4AIM A;  2JA5 G;  3HOY H;  3CC4 A;  1FVI A;  3PO2 G;  3CCL A;  4GKK Q;  4DR5 L;  4XIG S;  2DGY A;  5IP7 G;  4OX9 Q;  1C9O A;  3CME A;  3JC6 6;  1NJI C;  1GD7 A;  4DR1 L;  5C4X G;  2DUD A;  4A3I G;  4JG2 A;  2RHS B;  3PIO A;  4BY1 H;  4JV5 Q;  4Y7N H;  2RHQ B;  4K0K Q;  4HIK A;  3ERS X;  4YCU A;  1QZH A;  1HNX Q;  1YHA A;  2YTV A;  3HOX H;  3HOV H;  4NPS A;  4GLV B;  4L5S A;  5C3E H;  2KBN A;  4BY7 G;  3TEH B;  1N36 Q;  1Q46 A;  4R4C A;  2K5V A;  5FLX c;  1BBW A;  4KHZ A;  3RNU A;  1N32 L;  1Q7Y C;  2CQO A;  2OQK A;  4DV5 Q;  3KFU A;  2E5L Q;  5J3B A;  5ELO A;  3FKI H;  2KHI A;  4OWW B;  4OO1 G;  4LWC A;  4GNX C;  4A3J G;  5HY6 A;  1PFS A;  3OTO Q;  4MZ9 A;  1IBL Q;  1FL0 A;  3CPW A;  1N36 L;  5FJ8 G;  2JEA I;  1JMC A;  4X65 Q;  4LFC Q;  4B3T Q;  3J81 c;  4LF8 Q;  2IHE A;  2N8N A;  3PCO B;  3K81 C;  2A8V A;  4DR4 Q;  3AYH B;  5M3M G;  2Z6K A;  4R4Q A;  1IBK Q;  3T1Y L;  1VQP A;  2NVX H;  3L2P A;  2UUC Q;  2B29 A;  2BA0 A;  1X9N A;  4LFA L;  1CSQ A;  1D8L A;  1JJ2 A;  4WJ4 A;  1IBL L;  2BA1 A;  5C0X G;  2MQH A;  4DR3 L;  5H1S E;  1IYJ B;  4YY3 Q;  2IHF A;  3PGZ A;  2PMZ E;  3L0O A;  5IYB G;  2NN6 I;  3RN5 A;  4JBK A;  3CXC A;  4LF9 L;  2UUC L;  4A75 A;  4A3L H;  3M9B A;  4NXN L;  3W1B A;  1VS0 A;  1VQO A;  1LTL A;  1QUQ A;  5JEA G;  1W2B A;  4B3M L;  3BU2 A;  3CCR A;  2F4V L;  1XMO L;  2YV5 A;  4AYB E;  2VQF Q;  2OCE A;  4DV3 L;  2MO1 A;  4DV6 L;  1VQ6 A;  4GOP B;  4A3G G;  1VQB A;  4A3B G;  4GNX A;  2AKW B;  4C3H H;  1PH3 A;  3W5O A;  4A93 H;  2K5N A;  3GD7 A;  4WJ3 M;  1PHJ A;  5M5W H;  3BZC A;  3D0F A;  4GS3 A;  1VQ9 A;  4AYB G;  4JI2 L;  1XPU A;  4C3J H;  3UE1 A;  2ZM6 L;  2ZTC A;  4JI3 L;  1UE1 A;  2EQS A;  2GVA A;  4O0A A;  1YJN A;  2Y0S G;  1MIU A;  4YHH Q;  5M3F H;  2JK8 A;  3GDE A;  4HIM A;  3S1R H;  1ASZ A;  1PH9 A;  1PYB A;  5LMU Q;  4JI5 L;  1IBM Q;  4AH6 A;  1PH2 A;  1XNR L;  4X6A H;  2K14 A;  4X64 Q;  1PH5 A;  1R9T H;  3G4S A;  4P72 A;  1HR0 Q;  5JJK A;  1UWV A;  1TWC H;  4FDB A;  3CCS A;  1PH4 A;  4A3I H;  3TS2 A;  1Q82 C;  1Z9F A;  3K80 C;  1E22 A;  4R4I A;  2KCT A;  3TS0 A;  4A3K H;  3I7F A;  2YYZ A;  5LMU L;  4DNI A;  1E24 A;  4DV0 L;  1KAW A;  4JI4 Q;  3GTO H;  1TWH H;  2JA6 H;  3M4P A;  4GOP C;  2D0P A;  2KHJ A;  2UU9 Q;  4LNQ A;  2CWA A;  3J7A 5;  1NMF A;  3AEV A;  1P8L A;  4DR7 L;  1VQE A;  4X66 Q;  3AFQ A;  3BJU A;  1XMQ L;  1GO3 E;  2BH2 A;  4IPC A;  3HOW G;  1I6H H;  2N78 A;  2UUA L;  4EX5 A;  4BXX G;  2R7Z H;  4JI6 L;  4LW1 A;  1JJG A;  4A3F H;  1X54 A;  1VQF A;  3PUV A;  2ZTE A;  2CKZ B;  1G6P A;  2NZO A;  4IFD J;  1YNX A;  4A3E H;  5IWA L;  2JEB I;  4C2M H;  2UXD L;  3ICE A;  3F1Z A;  2WFW A;  4X62 L;  3RZD H;  1VCI A;  1U5K A;  3MXN B;  1LUZ A;  4PG3 A;  3KJP A;  2JA7 H;  4HID A;  4JI7 Q;  4YWK A;  2RCN A;  4MNO A;  1VQG A;  1CKO A;  1S3O A;  2QGQ A;  4OON A;  4O2D A;  3HKS A;  1QUQ B;  1UE6 A;  3PO2 H;  4DR5 Q;  1VQM A;  3DM3 A;  2NZH A;  4OXP A;  2VUM G;  4GOP A;  1I5F A;  3CCU A;  5IP7 H;  4IOC A;  4JI7 L;  4IOA A;  1Q8K A;  1HNW L;  1VQI A;  2NVQ H;  1EIY B;  4BA2 I;  2OTJ A;  2Z6K C;  3B6Y A;  4JI8 L;  1S72 A;  3UDF A;  2NVT H;  1WJJ A;  1J6Q A;  4LF7 Q;  2AHO B;  2I5L X;  1SN8 A;  3NEN A;  1K3R A;  3FP9 A;  4BY7 H;  1Q12 A;  2QEX A;  2PQA B;  1N32 Q;  4JC0 A;  1KL9 A;  1YIJ A;  1NY4 A;  3PIP A;  4BBR G;  1BKB A;  4JBJ A;  2HQL A;  1VQH A;  1X55 A;  2JE6 I;  4IPD A;  4JI1 L;  4LF7 L;  1FJG Q;  5FLM G;  3PUY A;  1C0A A;  1OXU A;  1HZA A;  4GKJ L;  5FJ8 H;  3E0E A;  1K8G A;  2OTL A;  1LM0 A;  2R92 G;  5M3M H;  1OXX K;  2UUB L;  1J5E L;  3T1Y Q;  4B3R L;  3KJO A;  5C44 G;  3A5U A;  2E2J H;  1FJG L;  2B63 G;  3CPF A;  1PVO A;  1CUK A;  2K75 A;  4LUV A;  4LFA Q;  3I4N G;  1Y1V H;  3HOZ G;  2E2I H;  1QZG A;  2VZA A;  1YHB A;  4DK3 C;  4DR3 Q;  3CQZ H;  2MNA A;  1Q1B A;  2R7F A;  3U4V A;  3CCM A;  1Y1W G;  1VQ8 A;  1EYG A;  2ES2 A;  4LF9 Q;  5IYB H;  3K0X A;  5IT9 c;  5HGQ A;  2NVY H;  4QIW E;  4NXN Q;  4YCW A;  3G71 A;  4DR2 L;  3GO5 A;  1SR3 A;  1VQC A;  2VS1 A;  4B3M Q;  3M4Q A;  1SE8 A;  2HHH L;  2VQE Q;  2F4V Q;  1XMO Q;  1D7Q A;  4DV3 Q;  4P74 A;  3M3Y H;  4DV6 Q;  1M1K C;  4R4T A;  3UE0 A;  4A3G H;  4A3B H;  3K8A A;  1SMX A;  2XGT A;  1Q86 C;  1HZB A;  4C3I H;  4AQY Q;  3KF6 B;  1W3S A;  3STB C;  1Q81 C;  3M4O H;  4JI2 Q;  2VQE L;  3EIV A;  3GTG H;  2EIF A;  2ZM6 Q;  4UY8 C;  3PO3 G;  1SFO H;  5LMN L;  4JI3 Q;  1TWF H;  3CW2 C;  3GTP H;  1NMG A;  1Q1E A;  1T9H A;  2Y0S E;  1JB7 A;  4DV7 L;  3I4M G;  1I94 L;  3CD6 A;  4HJ9 A;  1CKN A;  5GAD C;  2UXC Q;  1EWI A;  4JI5 Q;  3GTJ H;  4AQY L;  1XNR Q;  3ULJ A;  3F2D A;  2GVB A;  4DV1 L;  2K50 A;  4IJL A;  5E7N A;  3HOU G;  1PH8 A;  1JE5 A;  4KLK A;  1N9W A;  1WCM G;  3U4Z A;  4LF5 L;  1VQN A;  4IJH A;  3M7N A;  1E1T A;  3S17 H;  4BBS G;  4P75 A;  2FXQ A;  2PQA A;  2UXC L;  4DV0 Q;  1GKH A;  4A3D G;  2KCM A;  3MEF A;  5LMN W;  3STB D;  3KYH C;  1XPO A;  3CP0 A;  3PV0 A;  1O7I A;  4KI0 A;  4DR7 Q;  3A0J A;  1JJC B;  1V1Q A;  3KDF A;  1XMQ Q;  2IX0 A;  1VQK A;  1RL2 A;  1K0R A;  1OXS C;  1KC8 C;  2YTX A;  1PYS B;  2I5H A;  4LF6 L;  2PI2 A;  1I3Q H;  2UUA Q;  4JBM A;  3HOW H;  2MO0 A;  3H0G G;  2E2H H;  2K5H A;  4JI6 Q;  4BXX H;  3CC7 A;  3ULP A;  1XPR A;  3I55 A;  3L7Z C;  2Q2T A;  1IZ6 A;  2PI2 E;  4L5T A;  1AE2 A;  1EQR A;  4LUZ A;  5BR8 L;  5IWA Q;  1UE5 A;  3T1H Q;  1HNZ Q;  3H3V H;  2JJQ A;  2UXD Q;  4ALP A;  1G51 A;  4IPG A;  4X62 Q;  3PUW A;  4LUO A;  3F8T A;  4UP8 A;  1U0L A;  3CCE A;  3I4O A;  4HIO A;  4A3M G;  5IYC G;  3U50 C;  4LF4 L;  5IYD G;  2Q2I A;  4LFB L;  2R7D A;  4YWM A;  5C4J H;  1IL2 A;  4IPH A;  4GN4 B;  3Q8D A;  1B8A A;  3KOJ A;  4GLX A;  3T1H L;  1HNZ L;  4NXM L;  5AJ3 L;  3S1N H;  4OO1 I;  2CCZ A;  3AQQ A;  2ATW A;  4J15 A;  3OW2 A;  3S24 A;  2VUM H;  1YZ6 A;  2NN6 G;  4TQU S;  4POG A;  4A3K G;  1N33 L;  1HNW Q;  3RN2 A;  1A63 A;  2JA5 H;  4JI8 Q;  3KF6 A;  2Q2U A;  3S1M H;  3PUX A;  4JOI A;  1KXL A;  2JA6 G;  4DR6 L;  2VW9 A;  4P73 A;  4PZ6 A;  1K73 C;  5IP9 G;  4HJ7 A;  2R93 G;  4HJA A;  4QJF A;  3AFP A;  2R6G A;  5C0X I;  1FGU A;  2ZJR A;  2OQ0 A;  1CKN B;  5C4X H;  3S16 H;  1CSP A;  1KD1 C;  4DV2 L;  1E1O A;  1VQA A;  1X3E A;  2CWP A;  4UPA A;  1TWA H;  3J80 i;  4DAM A;  4HJ5 A;  1WI5 A;  4JI1 Q;  2ALY B;  2KEN A;  2L15 A;  2XTI A;  3NBH B;  3TQY A;  1K83 H;  3UDI A;  1SLJ A;  4BBR H;  4A3C G;  2B3G A;  1XNQ Q;  1Y14 B;  2I5M X;  2VY3 A;  1KIX A;  1HR0 L;  5FLM H;  4A3E G;  4NB3 A;  4GKJ Q;  1A0I A;  1MKH A;  2ID0 A;  3EN2 A;  4EQ5 A;  3J81 i;  2QA4 A;  2IX1 A;  3A5Z B;  1SRU A;  4DV4 Q;  1RIP A;  4JYA L;  2UUB Q;  2C35 B;  1J5E Q;  2HT1 A;  1EIF A;  1SRO A;  2R92 H;  1AE3 A;  4B3R Q;  2JA8 G;  1H95 A;  4KHP L;  5M5Y H;  5JJL A;  2RF4 A;  1X3F A;  1A62 A;  3A74 A;  2WP8 J;  1MJC A;  5C44 H;  4HJ8 A;  3UDG A;  4A3J H;  1GM5 A;  1XNQ L;  1YBY A;  2B63 H;  3I4N H;  3KDF B;  4PMW A;  1PA6 A;  1NBW A;  3RZO H;  3S15 H;  3HOZ H;  1DGS A;  2K4K A;  4DV4 L;  3U58 A;  1B70 B;  3S1Q H;  4IFD G;  3K7A H;  2HIV A;  1Y1W H;  1VQ5 A;  2AWO A;  5JEA J;  1N34 Q;  4QL5 A;  3HOY G;  1EQQ A;  2F3I A;  3I2Z A;  3RLN A;  1HJP A;  3CCJ A;  4DR2 Q;  3HFZ B;  1OXT A;  2HHH Q;  3F2B A;  1XTD A;  4GKK L;  2GN5 A;  3F2C A;  3CMA A;  3FHW A;  4YWL A;  2ZTD A;  3PF5 A;  4OX9 L;  1E7Z A;  4GLA C;  5EAY A;  3J7Z C;  1N34 L;  1B7Y B;  4TVA B;  4BY1 G;  4OWX B;  1UE7 A;  2K52 A;  4DKA C;  2PNH A;  4JV5 L;  1L1O A;  3CC2 A;  3J80 c;  4K0K L;  3S2H H;  4APV A;  3HOX G;  3HOV G;  3VDY A;  3OYY A;  1HNX L;  2VL6 A;  5M5X H;  5LMN Q;  4ME3 A;  3M85 A;  5C3E G;  3ER0 A;  3TRZ A;  3PO3 H;  1LYL A;  2AMC B;  4DV7 Q;  1I94 Q;  2YU9 H;  3I4M H;  4UP7 A;  3RR5 A;  3J81 j;  1A8V A;  2HIX A;  2OWO A;  1KHI A;  4R4O A;  3K7U C;  5GAG C;  1YIT A;  1OXV A;  5JJI A;  1BVS A;  4DV5 L;  3FKI G;  3EBE A;  4DV1 Q;  2E5L L;  3PSI A;  3DLL A;  4DK6 C;  4P71 A;  1VQJ A;  2N3S A;  5DLQ E;  4GN3 B;  1Y1V G;  4LF5 Q;  2WAQ E;  3JAM i;  3OTO L;  3H3V I;  1QVG A;  1WCM H;  2CFM A;  4BBS H;  1ASY A;  3PUZ A;  4LFC L;  4X65 L;  4PZ7 A;  3I56 A;  4B3T L;  4LF8 L;  3H15 A;  4DR4 L;  2UXB Q;  3ULL A;  1V9P A;  4PZ8 A;  3D31 A;  3SGI A;  4A3D H;  1IXR A;  2YTY A;  4YCV A;  3E9H A;  4JBW A;  1IBK L;  4RMF A;  2Q2H A;  1C7Y A;  2WAQ G;  3NEM A;  1YEZ A;  1Z47 A;  3S14 H;  1NTG A;  1K9M C;  3LGJ A;  4QY7 A;  1P16 A;  1EFW A;  3RLF A;  4LF6 Q;  2LXJ A;  2LXK A;  1KQS A;  2UXB L;  1HZC A;  1L0W A;  3HKZ E;  3KF8 B;  3WWV A;  4YY3 L;  1K8A C;  3GTM H;  3GTQ H;  3H0G H;  2IY5 B;  2JA9 A;  2N49 A;  4A3L G;  4OWT B;  5BR8 Q;  4JOI C;  1VQ7 A;  1PH7 A;  1QVC A;  3CAM A;  3W1G A;  5GAE C;  4A76 A;  2F52 A;  2A19 A;  2D0O A;  4DPG A;  3HKZ G;  4QQB X;  4XTC S;  2H5X A;  1VQ4 A;  2VQF L;  3ZJY C;  3G6E A;  1YJW A;  4MTN A;  4L5R C;  4A3M H;  1X6O A;  4LF4 Q;  1M90 C;  3RLO A;  5IYC H;  4LFB Q;  4A93 G;  1YVC A;  5IYD H;  1YI2 A;  4Y52 H;  4NXM Q;  1EUJ A;  2D62 A;  5AJ3 Q;  1PV4 A;  1JT8 A;  4POF A;  1CKM A;  4IO9 A;  3TRE A;  5IE8 A;  1I50 H;  1KRS A;  4BA1 I;  1N33 Q;  4GN5 A;  3JAM c;  5M3F G;  4L5Q A;  4YHH L;  5GRO A;  1YHQ A;  4DUY Q;  1AH9 A;  1IBM L;  4R1J A;  4DR6 Q;  1L1O B;  4IFD I;  3BZK A;  2ASB A;  3CCV A;  1YJ9 A;  1N8R C;  3E9I A;  1EOV A;  4H02 A;  4X64 L;  2R93 H;  5IP9 H;  2E8G A;  2LSS A;  1WYD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...