4GS3A

Dimeric structure of the n-terminal domain of prib protein from thermoanaerobacter tencongensis solved ab initio
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
98
structure length
90
Chain Sequence
ENNTVTLVGKVFTPLEFSHELYGEKFFNFILEVPRLSETKDYLPITISNRLFEGMNLEVGTRVKIEGQLRSYNRKLILTVFARDISVVPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dimeric structure of the N-terminal domain of PriB protein from Thermoanaerobacter tengcongensis solved ab initio.
pubmed doi rcsb
source organism Thermoanaerobacter tengcongensis
molecule tags Dna binding protein
molecule keywords Single-stranded DNA-binding protein
total genus 14
structure length 90
sequence length 98
ec nomenclature
pdb deposition date 2012-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00436 SSB Single-strand binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4gs3A00
3CPFA 4JOIC 2E2HH 1JE5A 1HR0W 4X64L 3CF5A 2HIVA 3BU2A 5IYCH 1VQIA 1IXRA 3UE0A 4DUYQ 1PVOA 1A62A 3E9HA 4DR2Q 5FJ8G 4MZ9A 1I6HH 4PG3A 1PH1A 2B63G 2JQOA 4Y52H 4LFBQ 4OWTB 4GLVB 3J7A5 4DR3L 3S17H 5C44G 4BXXH 2VL6A 3MEFA 4DV1L 2WFWA 4GKJQ 1LYLA 2PI2A 4YHHQ 2PI2E 1XNRQ 1FVIA 1VQAA 1S40A 1Y1WG 4JI1L 3I4NH 2JA6H 2VUMG 4DV4Q 3T1HQ 4R4QA 4FDBA 1TWAH 3KJOA 4PZ6A 3CQZH 4TVAB 4JI8Q 4A76A 2MFIA 4DR6L 4DKAC 2NVQH 1X3EA 3UDFA 3S16H 4P73A 3E9IA 4X64Q 4DR6Q 3DLLA 3HOXH 3KF6B 4JI4Q 1N34Q 4POGA 3CPWA 2BA1A 5J3BA 2E2JH 3PUVA 3BZCA 2F3IA 3D31A 5FLXc 2Q2UA 1W3SA 3HOVG 1PFSA 5LMUL 4OWWB 2Q2IA 3SGIA 1WYDA 4C2MH 3AQQA 1TWFH 2WAQG 3K7AH 1M90C 1TWGH 4LF9Q 2B3GA 1X6OA 4NXML 2E8GA 3W1BA 1XJVA 3G71A 2NVXH 1VS0A 1PH5A 4LF5Q 4DV1Q 4GKJL 1C0AA 1HZAA 1NE3A 2RF4A 3GTMH 3A0JA 2CWAA 3I56A 3J81c 1PV4A 3ULJA 3RNUA 3TS2A 3PUZA 4AIMA 4DR5Q 3I4MG 1EQRA 3AEVA 1E1OA 1NMGA 1VQ4A 4R4CA 2BA0A 4B3TL 3KOJA 3CMAA 1NMFA 4JCVE 1LM0A 2VQFQ 5IP9H 3U58A 2Z6KA 2UXDQ 1GO3E 2CWPA 3CCRA 4UP7A 3WWVA 4B3TQ 2VUMH 3PF5A 4X65Q 1HNWQ 4DV2L 4A3IG 3GTLH 4DV6Q 3HOZH 3NBHB 4JI0Q 1FJGL 4DUZL 3H0GG 4JG2A 3PIOA 4X6AH 1PH4A 2LXKA 3S2DH 1XPUA 1KL9A 4DV5L 1L1OC 5IT9c 2R92H 2IHFA 4A4IA 1PH9A 1QUQB 3PF4A 1WFQA 4YWKA 2N8NA 4C3JH 4A3BG 2QGQA 2YTYA 4PZ7A 1U5KA 1BVSA 4HJ8A 4A3MH 4BBSG 1Q8KA 4A3JH 1HNXQ 3OTOQ 2VNUD 4IFDJ 3PCOB 4DV6L 3UDGA 4H02A 1AE3A 2NN6G 4DUZQ 1VQ9A 3I55A 4LUVA 4UY8C 4GOPB 4IJHA 3A5UA 2UUCL 1XNQQ 1HR0Q 4P75A 4J15A 4A3FG 2CQOA 2VQFL 2A19A 4LWCA 3OW2A 1WJJA 2F4VQ 3F1ZA 2L15A 3TEHB 2IHEA 4QGUA 1XNQL 1U0LA 1SMXA 1KC8C 2YU9H 2I5MX 4LF6L 1NY4A 1MIUA 1VQCA 1T9HA 1YHAA 4DK3C 5IYDG 3KJPA 4GNXA 4LUZA 4UPAA 5E7NA 1CKOA 4IO9A 4LW1A 4YY3Q 4BY7G 1HNXL 3HOWG 1L1OB 3S14H 1Q81C 2GVBA 4A3EG 2LSSA 3J81i 1HNZL 5DLQE 2R7ZG 4B3RQ 1GKHA 2Z0SA 4LFAQ 2OWOA 4LF6Q 4JV5L 1UWVA 1JT8A 4IFDI 4OONA 3GTOH 1P8LA 4R4TA 4DNIA 3PO2G 4LF4L 3M7NA 2JEBI 3BJUA 2ASBA 5JJKA 4KHZA 1K3RA 3PV0A 4YCUA 4GKKL 1CSPA 3G48A 1PYBA 2K50A 5M5WH 1Y14B 4B3MQ 5C3EG 3S1NH 5IP7H 3CAMA 4BA2I 2OTJA 2RHQB 4BBRG 3T1YL 2BH2A 5FJ8H 1QVCA 2R93G 3K7UC 3K0XA 1VQKA 1FL0A 3KFUA 1Y1VG 1FGUA 4GLAC 4DV4L 1KQSA 2NZHA 2PMZE 3CC2A 2VS1A 4HJAA 4L5SA 5M3MG 3U4ZA 3ERSX 1OXTA 2MQHA 1NTGA 4KI0A 1QVGA 1CSQA 4KHPQ 1N32Q 5IE8A 4LF5L 4IFDG 2AHOB 4OWXB 3CC7A 4GLXA 3HOUG 1V9PA 3PSIA 3TRZA 4EX5A 1Q7YC 4X62L 4L5QA 4DR3Q 1Q86C 2UXBQ 1GD7A 3EBEA 1N36Q 4YWMA 1VQ8A 1A0IA 1OXXK 4OO1G 4DV2Q 1IBKL 2KCTA 3J81j 4A3GG 4A3CH 3PO3G 2JA6G 5IYBG 4Y7NH 1S72A 1YZ6A 1EYGA 4XTCS 3HOVH 2JA8G 2ZTDA 3BZKA 3PO2H 4RG1A 2UUAL 5JJIA 1LUZA 4KLKA 1VQFA 4JI8L 2V1CC 5C4JH 3G4SA 2HHHQ 1CKMA 1EIFA 2PQAB 4ALPA 2JA5G 3CC4A 4ME3A 4MTNA 2OQ0A 4P74A 4X62Q 2ZJPA 3HOYG 2E2IH 1N36L 5LMNL 5ELNA 1YHQA 3NELA 4L5TA 1PHJA 4B3SL 4JV5Q 3PUXA 3H3VI 5HGQA 1N33L 1VQEA 3J80i 2B29A 1HZCA 2KCMA 1VQPA 3MXNB 1Y1VH 4HJ9A 1JMCA 1I3QH 2D62A 2DUDA 2ZTCA 4QIWE 1EOVA 1SROA 4IOCA 1N33Q 1HH2P 3FKIH 4HIKA 2JJQA 2E5LQ 5GAEC 2KHIA 3CCEA 1KXLA 4DV0L 4JI3L 1WCMH 4GOPC 4DR1L 5BR8L 2IY5B 1E24A 1OXVA 1J6QA 3VDYA 1V1QA 1Z9FA 2D0OA 4C3HH 2VQEL 3CCQA 1MKHA 4IPGA 1K83H 3L7ZC 3HKZE 1PH3A 3HOZG 3H0GH 2JEAI 4IJLA 2ZTEA 2PQAA 5FLMH 4L5RC 4B3ML 4GOPA 3S1RH 4JI2L 1I94L 1N9WA 4LUOA 4NXNL 1MJCA 2UU9L 2UXCQ 2N49A 3GTKH 1IBLQ 2K5HA 5IP9G 5JJLA 5GROA 2CFMA 3RLFA 1UE5A 4DV3L 1MJEA 1BBWA 3K81C 2E5LL 2UUBL 4P72A 1ASYA 4EQ5A 4LF4Q 4A75A 3AFQA 4A3LH 5M5XH 4JI5Q 2C35B 2R7FA 3IRBA 2IT1A 3GDEA 3GTJH 2ZM6L 3GO5A 3Q8DA 4IPHA 3RR5A 4DV5Q 4K0KL 3EIVA 1QZHA 3DM3A 3K8AA 1O7IA 2AWOA 2YTXA 4A93H 1UE1A 4LF7L 2WB1G 2IX0A 5LMUQ 2I0QA 3M4OH 3S1QH 1S3OA 1E7ZA 1Z47A 2EQSA 1PH7A 4UP8A 4A3BH 1Y1WH 4P71A 4GN3B 1TWCH 1XPOA 2HHHL 3K80C 4BBSH 4HJ5A 4OX9L 3FKIG 2UXDL 1M1KC 2JA9A 3KDFA 2UUCQ 1K9MC 3I4OA 4AYBE 3GTQH 4YWLA 4JI3Q 2NN6I 2VW9A 1G6PA 1WOCA 2EIFA 2NVYH 5GADC 1BBUA 1G51A 1QUQA 4BY1H 4JI7Q 4X66L 4JI1Q 4LF8L 1IZ6A 3OTOL 4JBWA 4LFAL 3I4NG 5K36G 3KYHC 1J5EQ 4LFCQ 3CXCA 1N32L 2K4KA 1JB7A 1G291 3ICEA 3RZOH 4JYAL 1VQ7A 5IYDH 2I5HA 4QQBX 4JBJA 2QEXA 4UP9A 2BH8A 5H1SE 4LF9L 1Q1BA 2Q2HA 2F52A 3CP0A 2H5XA 3M85A 1PH8A 3JAMc 3LGJA 2Y0SG 4A3DG 2CKZB 3CCLA 3NENA 3ZJYC 2R93H 1CKNB 4MNOA 4RMFA 3TQYA 4LNQA 1YJNA 3PUWA 3STBD 4X65L 1HNWL 3UDIA 5M3FG 1H95A 4GNXB 3AFPA 4DR1Q 5C4XH 1SR3A 1A8VA 3U4VA 5JEAJ 2VQEQ 1C7YA 2XTIA 1X56A 1QVFA 2A8VA 4DV7L 2MNAA 1PA6A 4DAYB 1KRTA 1W2BA 2NZOA 2KENA 3HOUH 2LXJA 4OXPA 5IWAQ 4AQYL 1A63A 1L2FA 4O0AA 3I4MH 2VZAA 1TXYA 3FP9A 2ATWA 2N3SA 4QL5A 4AYBG 1HNZQ 5IWAL 3CCVA 1NBWA 3F8TA 3RZDH 4NB3A 2ID0A 2OQKA 4NPSA 1CKNA 4LF8Q 5LMNQ 4JI2Q 5IYBH 2JK8A 1IL2A 4GS3A 3I7FA 4JI0L 2WAQE 1Q1EA 3HKSA 4O2DA 4A3MG 1FJGQ 2F4VL 2JA8H 1UEBA 5C0XG 5HY6A 2UUAQ 3CW2C 2B63H 2WB1E 2HIXA 4DK6C 2AMCB 1KHIA 5C44H 2IX1A 1E22A 3CCUA 2N78A 4A3FH 3S1MH 3JAMi 4A3GH 4OO1I 2Q2TA 4GN5A 1XMOQ 1YHBA 4K0KQ 1E3PA 2GVAA 4BA1I 5IYCG 2R7DA 2JA7G 5GAHC 2UXBL 1K8AC 3J7ZC 4YCWA 2FXQA 1EUJA 1K0RA 4B3RL 1PYSB 1D8LA 1DGSA 1YBYA 3U50C 2YYZA 4AQYQ 4HIMA 4A3JG 1XMQQ 1KIXA 4KHPL 3CCJA 1D7QA 4JI6L 1VQNA 4X66Q 4HJ7A 4BXXG 1WCMG 1Q12A 3I2ZA 3UDXA 1SN8A 5C0XJ 4DV7Q 1YIJA 2ES2A 4B3SQ 2UXCL 1VQGA 2AKWB 3A5ZB 1QZGA 4DUYL 1X9NA 3GD7A 3M4PA 4JBKA 2R7ZH 2XGTA 1UE6A 1UE7A 1YVCA 1IYJB 4QY7A 3HOXG 1YITA 3ER0A 1X3FA 2WP8J 3M4QA 2CCZA 3RN5A 1VQLA 2OTLA 5FLMG 4JI4L 3CD6A 1VCIA 4A3KG 4R1JA 2Z6KC 4DR7L 4HIDA 1X54A 2A1AA 2K5NA 2ZJRA 3PGZA 2DGYA 4GKKQ 1EQQA 1Q46A 2GN5A 4A3EH 5AJ3L 2NVTH 1B70B 5IP7G 4LF7Q 2RHSB 3L0OA 4A3LG 1VQ6A 2K14A 4AH6A 1VQJA 1IBKQ 1HJPA 2KBNA 4DR4Q 3T1HL 3STBC 4R4IA 2K5VA 1EIYB 2Y0SE 5EAYA 3A74A 2OCEA 1P16A 3W5OA 3F2BA 3G6EA 4YCVA 1JJCB 4A93G 3D0FA 3RLNA 4JYAQ 4QJFA 1L1OA 1YEZA 1ASZA 5C3EH 1XMOL 4WJ3M 1YJ9A 4DR2L 3ULPA 2JA7H 4POFA 1IBMQ 3TS0A 1B8AA 4BBRH 5AJ3Q 1KRSA 3KF6A 2AWNA 2RCNA 4GNXC 4NXNQ 4IPCA 4TQUS 3E0EA 5C0XI 4OX9Q 3M9BA 1YNXA 1SE8A 4R4OA 3JC66 1SLJA 4DR7Q 5M3MH 3CMEA 1K73C 1N8RC 1VQBA 3L2PA 1OTCA 3F2CA 1R9TH 1VQ5A 1PH6A 2R92G 1TWHH 3PUYA 4BY1G 3KLWA 1K8GA 1HZ9A 1Q82C 3FHWA 1SFOH 4A3CG 2HT1A 1VQDA 4PMWA 3PIPA 1YJWA 3H3VH 4DR5L 1NJIC 4A3IH 4DAMA 4A3KH 1XNRL 2QA4A 2ALYB 4JI6Q 3H15A 4HIOA 2MO1A 1KD1C 2PNHA 2JA5H 3CCSA 2D0PA 2I5LX 3HOYH 4JI5L 2K52A 2YV5A 1VQMA 4LFBL 3OYYA 3RN2A 1GM5A 1RL2A 4JI7L 3W1GA 3F2DA 2UU9Q 1X65A 4DR4L 1C9OA 1IBLL 4JC0A 2ZJQA 2JE6I 3PO3H 4DV3Q 1SRUA 5M3FH 1I50H 1X55A 2K75A 1CUKA 1RIPA 2YTVA 1EWIA 1V43A 2KHJA 3NEMA 3HFZB 4PZ8A 3RLOA 1N34L 4WJ4A 3S15H 1AE2A 1HZBA 4IPDA 5ELOA 1L0WA 3T1YQ 3ULLA 4GN4B 4JOIA 1HR0L 5GQOA 5GAGC 4DV0Q 3GTPH 2EXDA 4DPGA 5BR8Q 2VY3A 5LMNW 4A3DH 1IBML 1JJGA 3HKZG 4JBMA 1BKBA 3CCMA 1GVPA 2R6GA 3S24A 1XPRA 3GTGH 3S2HH 1OXSC 1B7YB 1YI2A 5C4XG 1OXUA 5IY0A 2ZM6Q 5M5YH 4APVA 1XTDA 4IOAA 1VQOA 1VQHA 4BY7H 1XMQL 1WI5A 4YHHL 3EN2A 4LFCL 3B6YA 3UE1A 4XIGS 1J5EL 4NXMQ 3HOWH 1AH9A 1PH2A 3TREA 2UUBQ 1JJ2A 4C3IH 1X3GA 5JEAG 1KAWA 1EFWA 3AYHB 3J80c 2HQLA 1LTLA 3KF8B 1E1TA 4YY3L 3KDFB 3M3YH 1I94Q 2MO0A 1I5FA
chains in the Genus database with same CATH superfamily
1VDZA 3E0JA 4ME5A 4X64L 3HRZC 3CF5A 3AB9A 5IYCH 3K7AB 1PVOA 4DUYQ 4HAEA 5I2XA 3SK6A 1D1KA 1QWYA 2B63G 2A6EC 1KDCA 4Y52H 4DR3L 5DAUA 4Y7NB 4BXXH 1H9KA 4YIJA 2VL6A 3E6ZX 4DV1L 4GKJQ 4LJZC 1I4GA 1NSNS 1XNRQ 1HUMA 4RHSA 3SE0A 1FVIA 1VQAA 3KBGA 4JI1L 5KIXA 5EPLA 4FDBA 3PO3B 1TWAH 3KJOA 3S17B 3S15B 4DKAC 2NVQH 2LY7A 3E9IA 1B1ZA 3HOXH 3KF6B 2G9HD 2BA1A 2AUJD 3PUVA 2MGSA 2F3IA 1PFSA 1BQQT 1ENAA 4C2MH 2WAQG 1QE6A 5E1FA 5JVH3 4NXML 2B3GA 1X6OA 3EVQA 2E8GA 4G7OC 5C3WA 4AYBB 3G71A 4LF5Q 2QW7A 3I73A 4DV1Q 4GKJL 3A7LA 1Q8IA 4F87A 2E2IB 3P7JA 2RF4A 4DU9A 1WTVA 3WOEA 1I4PA 4HMJA 3BDLA 3I56A 1G2TA 2A6HD 3TS2A 3GTOB 2PNRC 3MFGA 1NMGA 1SNDA 1VQ4A 4B3TL 3CMAA 1NMFA 1GO3E 3WWVA 2VUMH 1LLRD 1HNWQ 2F0TA 3GTLH 2M00A 1QB5D 3H0GG 3PIOA 1X3QA 1E2VA 1TVXA 4DFAA 4DK0A 2RDGA 1XPUA 4DV5L 2VUMB 5IT9c 4X3KA 5BN5A 2IHFA 1EEFD 1PH9A 5J39A 1SYFA 1U5KA 1BVSA 3PCOB 2NVXB 1SJED 1AE3A 5DM63 2UUCL 3S14B 4KD4A 1WD0A 1WJJA 3F1ZA 2L15A 2KCCA 2IHEA 3TEHB 1XNQL 5M9OA 2B39A 2YU9H 4LF6L 1K28A 1NY4A 1MIUA 3KJPA 4DR2Q 5D14A 4GNXA 3IKJA 4UPAA 5E7NA 4CHTB 3HOWG 3L9AX 2F0WA 3U9SA 4A3EG 3J81L 3D8GA 5IODA 1HNZL 1SNPA 1V1PA 4IFDI 1Y1VB 4OONA 1A3VA 1WD1A 2B8FA 3PO2G 3PV0A 3T16A 4H44C 3SDZA 3OIPA 3LX0A 4BA2I 2OTJA 2RHQB 4BBRG 5FJ8H 1ILPA 1VQKA 1FL0A 1FGUA 2OF1A 1KQSA 4L5SA 4F7XA 4JK1C 5M5XB 2MQHA 1FYCA 4KI0A 1QVGA 4IUTA 1SE2A 3BG3A 3CC7A 5COYA 3TP6A 3HOUG 2F0FA 5ELFA 1Q7YC 1ZXTA 2J4XA 4X62L 1N36Q 3HOYB 1IBKL 2KCTA 1H9SB 3J81j 4A3GG 2E2DC 3ZYYX 1Q3LA 4Y7NH 3WOFA 1S72A 1VMPA 1YZ6A 1EYGA 1TKWB 3HOVH 4BBSB 4RG1A 5T1IA 1ML0D 2HHHQ 1VQFA 2HDMA 4JI8L 5C4JH 2G5DA 4TKOB 2PQAB 1EIFA 1R4PB 3BZDB 4X62Q 3J7YW 5LMNL 3HEJA 4OIKA 5D65A 4CBVA 1TWAB 4E6IA 4B3SL 3FEWX 1TS3A 1HZCA 1AZQA 1IYUA 1B9NA 2ZTCA 2D62A 4QIWE 4FF3A 1EOVA 1SROA 3J80E 1N33Q 1HH2P 4HIKA 2JJQA 1DM0B 5CV6A 2KHIA 3RMHA 4JI3L 1WCMH 4DR1L 5BR8L 4IUVA 1LTBD 1J6QA 2TSSA 2VQEL 3HOZG 1MKHA 3L7ZC 1I3QB 2JEAI 4IJLA 2K5WA 2ZTEA 2PQAA 1SNMA 2CW0C 3DWPA 4L5RC 4H7BA 4B3ML 3M4YA 5FKAC 1N9WA 1EZ6A 1I94L 4JI2L 1LACA 2UU9L 2K5HA 5IP9G 5JJLA 5I6WA 4DV3L 2E5LL 4ODGA 3NTKA 4EQNA 4PV1C 5CGKA 2L4NA 4NKLA 5M5XH 2EPBA 2ZM6L 2PO4A 4U673 3TP7A 2NN6H 4DV5Q 3DM3A 1O7IA 2AWOA 1UE1A 2WB1G 1SAPA 2NBFA 3M4OH 3H3VC 5CC4A 3J7AF 1PH7A 4UP8A 3V96A 2DY7A 1QILA 4OX9L 5C5MA 1M1KC 1SNQA 4A3FB 3S1MB 1JQYD 3GTQH 1C4QA 3MC0B 2RA4A 1G6PA 5GADC 4WFN3 1STGA 4JI1Q 3CRKC 3OTOL 4JBWA 5K36G 3HGBA 3KBXA 2K4KA 3PMFA 4QQBX 4KD3A 2XWBB 1W6JA 4JBJA 1LTAD 3J81E 2BH8A 1Q1BA 4I7AA 1HXYD 4MHEA 1PH8A 3BYTB 4A3DG 4G57A 3CCLA 4FNFA 3ZJYC 5C6AA 4BY7B 3STBD 5M5YB 3KK7A 3UDIA 4GNXB 4CDCC 4L8JA 2NYZD 2XVSA 3LNNA 1LT5D 3Q23A 2VQEQ 1C7YA 3IFTA 1BF4A 2WIIB 2QILA 1TS4A 2L55A 1LTTD 4MTKA 2LXJA 4AQYL 1L2FA 5CV4A 4OO1H 4AYBG 4QL5A 2IX3A 1NBWA 3D6WA 3PQIA 4KJOA 1SBBB 3F8TA 2GA4B 4NB3A 4N8X1 5LMNQ 4OL7A 5JPNC 2QF7A 5IYBH 1IL2A 4GS3A 1FJGQ 2XWJB 4A3MG 4IURA 5HY6A 2WB1E 2KCNA 1ONLA 3KLSA 5KNBA 1D5MC 1E22A 2N78A 3JAML 2IL8A 4A3FH 3S1MH 4A3GH 4RA8A 1I4RA 5KRUA 4K0KQ 4BA1I 2OT2A 5IYCG 2JA7G 5GAHC 3TP8A 3EQLC 3QO2A 2F0SA 3D3RA 1YBYA 1DGSA 4DAVA 3U50C 2YYZA 3KF8A 4HIMA 4AQYQ 4KHPL 3CCJA 4XQNA 1VQNA 4BXXG 1BCPD 1Q12A 3MAQA 1YIJA 5C0XJ 2ES2A 2KUMA 4B3SQ 1CHPD 2UXCL 2AKWB 1XX8A 4DUYL 4RAUC 4JBKA 2XGTA 2Q8TA 2K03A 1YITA 1IYJB 2HDLA 2RQXA 1R4QB 3M4QA 2CCZA 4HEDA 4CKEA 1PFMA 3MXUA 4XDXA 4V190 1TWGB 1U4LA 1STNA 4K6LA 2C9OA 2F0GA 2BDNA 3PGZA 5L37A 4GKKQ 1Q46A 2E2HB 2I07B 5C3EB 2L5TA 5DM73 4KY5A 2RHSB 1JWSD 1JB3A 3L0OA 2K14A 4CDEC 1IBKQ 4A3LG 4C56C 3T1HL 2N88A 1PRTF 2BE5C 1ZEQX 2Y0SE 2FMCA 2EYHA 3A74A 3S1QB 1P16A 2JN4A 3F2BA 1EY0A 4A93G 1RF2D 1H9SA 1Y1WB 5M3MB 4QJFA 1L1OA 3QR8A 3A8JE 2EYJA 3FPPA 1ASZA 5CORA 3AMUA 4WJ3M 1VMCA 3ULPA 1IBMQ 3DEPA 4BBRH 4HTHA 3KF6A 4GNXC 4NXNQ 4TQUS 4XT1B 5D3DA 3E0EA 1A15A 1ET9A 3KUPA 3M9BA 3R2IA 3VR5A 4OX9Q 1STYA 3K58A 1HPCA 4A3DB 1VQBA 2LKVA 1R9TH 1VQ5A 4OHJA 2ICIA 4FF4A 2RKSA 2A68D 1HZ9A 3FHWA 3OOCA 2HT1A 3PIPA 3FMCA 2PZTA 4DR5L 4A3IH 4DAMA 4A3KH 4JI6Q 2K05A 2MO1A 3D4DA 2PNHA 3CCSA 2BCOA 5CR3A 4ILWA 5IGDA 3W1GA 5EQ0A 3MA2B 2UU9Q 4DR4L 4HR7B 1JC7A 1DXMA 1C9OA 3K0YA 2ZJQA 3R8BA 4CGYB 5M3FH 2K75A 1ENFA 1CUKA 1RIPA 2YTVA 3NBHA 4PZ8A 1N34L 3M4OB 4WJ4A 1UUPA 1AE2A 2HD3A 4R8IA 2LFNA 1HHVA 5GQOA 2EXDA 3DMUA 1GVPA 2R6GA 3MZ5A 1FD7D 1YI2A 5C4XG 4APVA 3HZXA 3GTKB 1VQHA 5KYIA 4BY7H 4YHHL 3EN2A 3UE1A 3B6YA 3CU7A 1J5EL 1QNKA 5F2DA 4IZ8A 5JEAG 1A2UA 5A2QE 3CRLC 1LTLA 5C0XH 2H4OA 2K28A 1EWHA 1E1TA 4YY3L 3V05A 1G91A 3M3YH 2E2HH 3HS0C 3SK5A 3OIQA 3RUZA 5I9PA 2D5DA 2HIVA 3BU2A 3T4AC 4ZUJA 3I8ZA 4CJ2C 5FJ8G 1M4VA 4OWTB 2K6AA 3S17H 3GTJB 3S9WA 3N52A 1LYLA 2PI2A 1G2SA 4K5XA 4K8JA 5CV7A 2JA6H 4R4QA 4ULLA 1WTXA 1HUNA 4PZ6A 4A76A 4TVAB 1F2YA 4V0BA 3SXHA 5FO8B 5DEHA 2L11A 4X64Q 3MXPA 1C8CA 3CPWA 2EJFC 3BZCA 1GUTA 3D31A 1W3SA 3HOVG 4EQPA 2Q2IA 1RCVD 3OW7A 1HA5A 4LF9Q 1NR4A 1IKLA 2L9HA 3I70A 1CI3M 3A54A 3W1BA 1XJVA 1PH5A 1JCKB 3T13A 4C3IB 4KK7A 1HZAA 3GTMH 2MUYA 2R93B 3DWAA 3ULJA 2A68C 3C1EA 4AIMA 4J1MA 1EQRA 2XN9C 1J8IA 1PYWD 4R4CA 2BA0A 3KOJA 2NWGA 1IW7C 2HCIA 4K14A 5CV8A 2CWPA 4TRDA 1BO0A 4S3SA 4UP7A 1GHJA 2RDFA 4B3TQ 4OIJA 3HOZH 5ELBA 2A74C 2RSNA 4JI0Q 4DUZL 4JG2A 1GUOA 2K5DA 3EA6A 4IUNA 2LXKA 1HFNA 2M2LA 4J6HA 1BOSA 4A4IA 1QUQB 4YWKA 1KLGD 2N8NA 4C3JH 3A8KE 2QGQA 2YTYA 1PMRA 3I4NB 3I91A 2EJMA 4HJ8A 4A3MH 2EDGA 4OELB 3A56A 2JA8B 5J1ZA 3UDGA 5IGCA 1F2ZA 1SNOA 4DUZQ 1AEXA 2NN6G 1VQ9A 4IJHA 1ILQA 2FMMA 4A3KB 2JXMB 3OW2A 5I2YA 3SEBA 3NXWA 1U0LA 1SMXA 2I5MX 1VQCA 1YHAA 3K5MA 1CKOA 1B4OA 4YY3Q 3VYSA 5IGEA 1HNXL 1SMYD 1L1OB 5DLQE 2R7ZG 3FPUB 5JOBA 1JT8A 1DZ1A 4JV5L 1LTSD 1LTRD 2SDFA 1P8LA 4TSSA 2A69C 5D3IB 2F0MA 3E3XA 1ESRA 3ITPA 4YCUA 1CSPA 1SEBD 3SVMA 3SK8A 5C3EG 4B3MQ 2ZT9C 4FF2A 1MSHA 4LK1C 4ZLTF 3WDNA 1TU2B 2F0IA 2R93G 2CHBD 3KFUA 1XTCD 4GLAC 2PMZE 1JOQA 4HJAA 1SFOB 2F0HA 3U4ZA 3BDOA 2DNEA 3W2DA 1NTGA 1V1PB 5IE8A 1SYBA 4KN7C 3K5OA 4GLXA 1JICA 4I7ZC 1ENCA 3TRZA 2IW3A 4EQOA 4EX5A 2KJXA 1FNVA 4HCSA 1OXXK 1MHWC 2A6HC 1A3TA 1SXTA 3TN2A 3Q0AA 3PO3G 5IYBG 2KA7A 2JA8G 2ZTDA 3BZKA 3PO2H 2UUAL 4KLKA 1PTOH 2LS01 1CKMA 4ALPA 3MVVA 4ME3A 2HUGA 2IWHA 1N36L 2RBMA 2MJ8A 1YHQA 1PHJA 4HMIA 5HGQA 3H3VI 3J80i 4MN3A 2K7VA 2KCMA 1VQPA 2F0DA 2RDHA 1XYIA 3MXNB 4HJ9A 1I3QH 2DUDA 3VR4A 4PMCA 3FKIH 5GAEC 1XXGA 1RJTA 5FO7B 1KXLA 4GOPC 1E24A 1V1QA 4RWSC 1KTKA 3H0GH 3UI2A 4QB4A 4GOPA 4LUOA 4NXNL 4J8QA 5J22A 1K0SA 2N49A 1NR2A 1KNEA 1UE5A 1MJEA 4P72A 2E76C 4KV6A 4C3IG 4A3LH 2C35B 2PQEA 2IT1A 2SEBD 3GDEA 1LO5D 3M7GA 4DK1A 3EIVA 3K8AA 3QIAA 2YTXA 4A93H 1Z47A 2OEOA 4P71A 1D5ZC 3QWNA 4UDUC 4ZK9B 1SYEA 4ZKCB 4ZAIA 2UUCQ 1SNCA 4KKUA 1K9MC 4AYBE 4L63B 2NN6I 2VW9A 1WOCA 2NVYH 1IZ6A 4LFCQ 3CXCA 1G291 1VQ7A 3RZDB 2I5HA 1WTRA 1H9MA 1IYVA 3TZDA 4RH6A 2Q2HA 2H5XA 2B2VC 1RODA 3LGJA 2CKZB 4MNOA 4LNQA 3PUWA 5ISRA 4DF7A 4RCOA 4ID6A 3AFPA 1SR3A 4JW0A 5JEAJ 1STHA 1AN8A 2A8VA 4QMGA 2MPMA 1F9QA 2G9DA 4RGTA 2XRSD 1S5FD 1YNND 3C2PA 4OXPA 1DOLA 1Y8PB 2O4XA 4O0AA 3I4MH 2ATWA 1TXYA 2N3SA 1DOMA 1L0XB 3CCVA 1EY6A 3SK4A 2JSOA 2OQKA 3MHBA 5K36H 1V8QA 2JK8A 3S16B 2EYMA 4JI0L 2O5JC 5C0XG 2SOBA 2B63H 1STEA 2NVTB 1AFPA 1CM9A 2CH4A 2HIXA 3OPOA 4DK6C 2IX1A 1D1IA 1A3UA 3CCUA 3JAMi 2Q2TA 4GN5A 4H13C 2UXBL 1BNZA 3J7ZC 2PYKA 1K0RA 4A3JG 1EYCA 1XMQQ 1V1OA 4HJ7A 2QDLA 2OXPA 4K2KA 1ZYRD 1X9NA 1STBA 3D4WA 2QCPX 1YVCA 4QY7A 2RVLA 2XIWA 1X3FA 3RN5A 2OTLA 1STAA 4A3KG 4DR7L 2A1AA 2K5NA 3EJIA 2DGYA 4CKCA 2JA6B 2GN5A 2DJGC 3T51B 5AJ3L 1VQ6A 3GTGB 1VQJA 1BCPF 1F9PA 4KN4C 1JORA 4HCEA 4R4IA 5A35A 2K5VA 5ELDA 1TR5A 3JAME 2E74C 3D4RA 3G6EA 1K8OA 1J9OA 2J7ZA 3X3MA 1CHQD 1YEZA 1BDOA 3VR6A 1YJ9A 1RKNA 4POFA 1O80A 5AJ3Q 1IHZA 1DOKA 1C48A 4FYDA 1SYCA 1QG7A 5C0XI 3CHBD 4OGQC 1YNXA 3VYUA 4G7HC 1Z6HA 3JC66 1SLJA 2DNCA 5C4ZA 1K73C 1N8RC 5CYUA 2FJ2A 3K5LA 2R92G 3GTMB 3QJYA 3KLWA 3NWSA 1Q82C 1LV9A 2F0VA 3I3CA 1YJWA 4QUCA 2ZXRA 1XNRL 2ALYB 2H1EA 5EJWA 3H15A 2PZUA 3TMEA 3OSOA 1VQMA 1EFID 5CV5A 3F2DA 1X65A 3NQTA 2Z8LA 1X55A 2NVYB 3NEMA 4K2LA 3S15H 2TMPA 3T1YQ 2EXZA 1LABA 2EYFA 2FHTA 1HR0L 5FK9C 2HCCA 4DV0Q 3GTPH 4DPGA 5BR8Q 5LMNW 2FFKB 5EKKA 3HOXB 3HKZG 5CMDA 4JBMA 1GJXA 3EFXD 4R9WA 2NZ1D 3GTGH 1GUWA 1VF5C 4C2MB 5M5YH 2ZM6Q 1VQOA 3DWQA 1HA6A 4LFCL 3HP3A 3SR1A 1G6ZA 1RD9D 1JJ2A 1X3GA 1EFWA 3AYHB 3J80c 2HQLA 1PRTD 2NB0A 4RGNA 4C3HB 2WAQB 5C3XA 3VA7A 3PIP3 2EOTA 1WTQA 2MO0A 4X3SA 4XQQA 2VXWA 3CPFA 3TP5A 1HR0W 2K32A 1I6HB 1EIGA 2L1BA 3I4MB 4DAYA 1I4XA 1VQIA 3UE0A 2I46A 3E9HA 4EGVA 1B9MA 4MZ9A 4RKBA 1I6HH 4PG3A 1KDBA 3J7A5 2BDOA 4G4KA 3MEFA 3NTIA 1MGSA 2WFWA 2PI2E 4X3UA 4MIUA 2CQAA 1EQVA 1S40A 5IGGA 4DV4Q 3NPPA 3T1HQ 3NE5B 4QCLA 1LT4D 3CQZH 4DR6L 4DXGA 4O1NA 4ABNA 5FO9B 1X3EA 3UDFA 3VYRA 3S16H 5M5WB 4DR6Q 1A6XA 1ZKOA 4F8MA 4JI4Q 2F0LA 2PMZB 4POGA 4HSVA 3GTQB 4XYOA 2E2JH 4M1UB 4B9WA 5LMUL 4OWWB 3SGIA 1WYDA 1M90C 1TWFH 1BUVT 3K7AH 1TWGH 2QKIC 1PRTC 3U9OA 1E2WA 1UAPA 3FRPB 3J80L 1VS0A 1AP0A 1S5ED 1C0AA 4C1NI 1JOOA 4ZQ3A 1NE3A 2B2WC 3A0JA 2CWAA 2N55A 3J81c 3PUZA 4N8FA 1E1OA 2A5HA 1LTID 2JYOA 1LM0A 4JCVE 5IP9H 2UXDQ 3CCRA 4FXGC 1BCPC 4A3IG 4C3HG 2F0PA 3NBHB 1FJGL 1U4PA 2AQ1B 4XT3B 4X6AH 1PH4A 3R3OA 1KL9A 1EU3A 3C46A 2R92H 2PCFB 1X32A 4A3BG 4PZ7A 4FO2A 3FDTA 1U4MA 4BBSG 1HNXQ 3OTOQ 3NP8A 2VNUD 2SNMA 3GV3A 4DV6L 2F0NA 5CBEE 3I55A 4GOPB 3A5UA 1XNQQ 1HR0Q 4J15A 2VQFL 4RGMA 4FP5D 3VR2A 3RD4A 1T9HA 4DK3C 1PLFA 5C4JB 2A6ED 1GUNA 4LW1A 4QF4A 4BY7G 1CTMA 1GOZA 4B9XA 5C4XB 1GKHA 4LFAQ 2OWOA 1UWVA 4FF1A 1EOTA 3GTOH 4DNIA 3M7NA 2JEBI 2O5IC 4CDFC 3BYYB 4KHZA 4GKKL 2F0JA 3G48A 1PYBA 1TT2A 2K50A 2XRQD 5M5WH 1Y14B 4XQJA 3S1NH 3E5SA 1EWCA 4A3MB 3NWTA 2BH2A 2EJGC 5IT9L 3K7UC 5FLXE 1HTPA 1NUCA 1S5DD 4F88A 1K8MA 2EE1A 1PRTB 3ERSX 3DUZA 4KHPQ 1S5CD 4LF5L 4OWXB 2K01A 4IUPA 3DM1A 2Z1CA 3MXGA 4L5QA 1Q86C 2UXBQ 1GD7A 1HFGA 1VQ8A 1DCZA 3QOJA 5EKIA 1WVLA 3X3NA 3VYTA 2F0EA 4HN7A 1EY5A 4JVZA 3P20A 1S5BD 1ESFA 3NSWA 3G4SA 1SSOA 2JA5G 3CC4A 4MTNA 2OQ0A 2ZJPA 2E2IH 4KMUC 3NELA 1HQRD 1N33L 1VQEA 4DNTB 1Y1VH 1F77A 3QOLA 1JMCA 3H0GB 1EEID 4A3JB 2E5LQ 5E3FA 2PZWA 1RHPA 2IY5B 1M8AA 3VDYA 2KVMA 3CCQA 3S1NB 1SE3A 1IKMA 1K83H 3HKZE 1PH3A 3CQZB 3J7AV 1RTOA 2WB1B 2JP1A 1MJCA 1RDPD 4QUFA 2B2VA 3DHQA 1IBLQ 4GZYC 5GROA 1F9RA 2CFMA 3P75A 3RLFA 2UUBL 2ICEC 4C3JG 1ASYA 1F9SA 1TQOA 4EQ5A 4JI5Q 3IRBA 1TWFB 3IL8A 4IPHA 3RR5A 3T53B 1QZHA 4K6DA 1GXDC 4LF7L 3GV6A 4BS9A 5LMUQ 3S1QH 1PTOC 3R93A 4A3BH 1Y1WH 2B8GA 1XPOA 1YNNC 5C5LA 3K80C 4BBSH 4G7ZC 2E75C 3FKIG 2UXDL 2JA9A 1Q90A 3KDFA 1W6KA 4M8AA 2QEJC 5BN4A 1D2BA 1QUQA 1IW7D 4X66L 1TY2A 2BE5D 3KYHC 1J5EQ 2X6GA 1N32L 3O13A 1KABA 1SYDA 1KDAA 5H1SE 1SE4A 2F1MA 2F52A 4LMQD 5I6YA 3CP0A 1UNSA 3M85A 2R7ZB 3JAMc 2Y0SG 1PDQA 3NENA 3IFDA 2R93H 1CKNB 1YJNA 1HNWL 5KNDA 1PTOF 4A3GB 1H95A 2LMCB 3TDQA 4DR1Q 5C4XH 2MP1A 3I72A 1CFMA 4PMBA 1DJRD 1CK1A 1X56A 1I4QA 1QVFA 4DV7L 2MNAA 4NP5A 4DAYB 2F03A 1KRTA 2KENA 5JEAH 1D5XC 5IWAQ 3VR3A 1A63A 3A8IE 3BS1A 1LT6D 1PTOD 2PPBC 1K3BC 2RCFA 5FOBB 1WTWA 1EYAA 4LF8Q 4C3JB 5C44B 4BBRB 5K5PA 2WAQE 1Q1EA 4O2DA 2F4VL 2JA8H 2E2JB 1UEBA 3CW2C 2MHVA 5JJZA 4BWGB 5C44H 3C3LA 1QOHA 1XMOQ 2NTTA 1E3PA 2GVAA 2R7DA 4CJ0B 5HURA 1B3AA 2ZXOA 4YCWA 1EUJA 1PYSB 2WINB 1KIXA 1OO9B 4JI6L 2WKCA 4H0LC 4ZKBB 4X66Q 3TBIB 3I2ZA 1SN8A 4DV7Q 4LAAA 1VQGA 3GD7A 3M4PA 2R7ZH 4Z9CB 1UE6A 1U4RA 4LF6Q 2WP8J 4KY7A 1VQLA 5FLMG 3CD6A 4PQXA 1VCIA 2Z6KC 1GHKA 4HIDA 1X54A 2ZJRA 3FKIB 3W3AA 1EQQA 3QG1A 1AW7A 4A3EH 4CJ1B 1NCVA 1HQMC 1B70B 5IP7G 4LF7Q 4AH6A 2EVBA 1HJPA 2KBNA 3EROA 4CDDC 3STBC 4Q5VA 4KHVA 1EIYB 5EAYA 2Q8IB 2D9UA 1JJCB 3BVMA 1JWMD 3T56B 2R61A 3URYA 2B2YC 3K6OA 1PZKD 4K5WA 4DR2L 4IFDH 5BN3A 4DNRB 2AWNA 4K8IA 4IPCA 3NTHA 1SE8A 4R4OA 2Y0SB 3M3YB 5EKLA 3IAYA 4DR7Q 1OTCA 3K59A 3OHXC 1ICWA 1TWHH 4BY1G 4RKLA 1K8GA 1SFOH 4A3CG 2DN8A 1VQDA 3A55A 1NNXA 4X3TA 1BBXC 3H3VH 3C1FA 3OWEB 3SHLA 2B2YA 2QA4A 1TWHB 5ELEA 1KD1C 2NUCA 3HOYH 2K52A 2YV5A 4LFBL 3OYYA 4JI7L 2F3WA 1E0BA 1WTOA 2A69D 4JC0A 2JE6I 4DV3Q 1SRUA 1XWEA 3RLOA 1H9RA 1EWIA 2JA5B 4WORA 1HZBA 4IPDA 1L0WA 1O7ZA 3ULLA 4GN4B 2FINB 2WKDA 5EPKA 5GAGC 4FVMA 4A3DH 2ZXPA 3ONAB 4IALA 3CCMA 5E4XA 1ICFB 3S24A 3S2HH 1OXSC 1SYGA 4IOAA 1U9RA 4K5VA 5T1GA 5IGBA 1XMQL 3HOWH 4IN3A 4NXMQ 3G7LA 4XIGS 1AH9A 2EYPA 3TREA 3ERQA 4OEMB 4C3IH 3KF8B 4FXDA 5IIFA 2IPKD 3KDFB 1I94Q 2K04A 1I5FA 1JB7A 1AZPA 4JOIC 1MSGA 4N9TA 1JE5A 1EZ8A 2L12A 1CQVA 3OMCA 4PNYA 2C5CA 1IXRA 1A62A 2CH4W 1CT1D 2Q8RE 5KNCA 1PH1A 2F0UA 2JQOA 2KEEA 4LFBQ 4GLVB 5C44G 4NMZA 5IT9E 3GTPB 3MWYW 4YHHQ 2O2LD 4Q0FA 3HOVB 1Y1WG 1K83B 3NK9A 4U68A 3I4NH 4A93B 3PIO3 2VUMG 4L6TB 1PFBA 2L0CA 2X69A 4CKBA 3MEHA 4JI8Q 2MFIA 2R3ZA 1EY4A 5LL6X 2F0OA 3TZUA 5JPMC 1SDFA 4P73A 3DLLA 1CA5A 1N34Q 5J3BA 1NAPA 1GUSA 5FLXc 2Q2UA 4RCNA 4UHVA 3HG9A 3AQQA 2CVRA 2J0TD 5A2QL 3S2HB 2NVXH 3KLRA 5IGFA 1LTGD 1BR9A 1PV4A 3RNUA 1DONA 4DR5Q 5AFWA 3I4MG 3AEVA 3GQBA 1EY9A 5CBAE 2VQFQ 1JWUD 1ET6A 2Z6KA 5LL6S 3U58A 1EY7A 3LWUA 3PF5A 4X65Q 4DV2L 4DV6Q 1EL0A 2EYOA 2IJ0A 1GUGA 5EPJA 2Z4HA 4IUUA 3S2DH 4O42A 1L1OC 4WJWA 3AU7A 3PF4A 1WFQA 2VB3X 1KAAA 1B2TA 1X3PA 2KECA 3HKZB 1Q8KA 4A3JH 1EIHA 4IFDJ 4BY1B 4QIWB 2M9VA 4H02A 4LUVA 4UY8C 4NW2A 4P75A 4A3FG 1WTHA 2CQOA 2A19A 4LWCA 2F4VQ 1WTPA 4XYQA 3KLSX 4QGUA 5G3LF 1KC8C 5IYDG 4IO9A 3HOUB 4LUZA 3OWFA 3S14H 1Q81C 2GVBA 4EVOA 2LSSA 3J81i 4B3RQ 2Z0SA 4WRDA 4DN4M 1G8ZD 1TIID 4R4TA 4LF4L 2ASBA 2KOLA 3BJUA 3BDCA 5KGUA 1K3RA 2R92B 5JJKA 2VB2X 2F0QA 2P5ZX 4DGZA 5IP7H 1PTOB 3CAMA 4RHRA 1Y8OB 5EBCA 3T1YL 1D6EC 3HOZB 1QVCA 3K0XA 1QJOA 1Y1VG 1MI2A 2WACA 4DV4L 2NZHA 3CC2A 2VS1A 5LHY1 5M3MG 2KQ3A 3MFYA 3DEOA 4ZYSA 1OXTA 1CSQA 1N32Q 3L3OC 3FVQA 2NVQB 4IFDG 2AHOB 4NDXA 4IUQA 1V9PA 2XSCA 3PSIA 5CV9A 2EYLA 5G3LD 4DR3Q 3HOWB 3EBEA 1TS2A 4YWMA 2B2UA 4KKSA 1A0IA 4OO1G 4DV2Q 5IOCA 1YNJC 5M3FB 4A3CH 3K5NA 2JA6G 4R8NA 3ND8A 4XTCS 5JJIA 3S2DB 1LUZA 2V1CC 4P74A 3HOYG 1B3QA 5ELNA 4L5TA 3ND9A 3PUXA 4JV5Q 2B29A 4KJNA 2JA7B 1QCBD 4IOCA 2Z6BA 4IQZA 3CCEA 1IL8A 4HSPA 4DV0L 1EQTA 1OXVA 4ZUIA 1Z9FA 2D0OA 4C3HH 1TS5A 4IPGA 2EY1A 3LWEA 5FLMH 3S1RH 5KYLA 1CA6A 2UXCQ 1I4HA 3GTKH 1BCPB 1WCMB 2NTSA 1MD2D 1BBWA 3K81C 2K33A 4LF4Q 4A75A 3AFQA 4A3BB 1JR0D 2R7FA 3GTJH 1L0YB 1EU4A 3GO5A 3N6RA 3Q8DA 2EZVA 3P1HA 3R2TA 4K0KL 2KEDA 2X6LA 1F2MA 1T5EA 2EY5A 2I0QA 2IX0A 2PW7A 1ZYRC 1S3OA 1E7ZA 2EQSA 4GN3B 1TWCH 4KKTA 5JVG3 3H6MA 2HHHL 4HJ5A 4RFBA 2K5QA 2Z9HA 3I4OA 4YWLA 2B2UC 4ZCKA 4JI3Q 2EIFA 2F3VA 3K57A 1BBUA 1G51A 4BY1H 4JI7Q 4LF8L 2F0KA 2B2WA 4LFAL 3I4NG 3GTLB 3RZOH 5IYDH 1SJHD 3ICEA 4JYAL 2QEXA 1EYDA 4UP9A 4LF9L 1O78A 1S4ZA 1FR3A 5FLXL 3H09A 5DNFA 1Z7TA 4RMFA 3TQYA 4X65L 5M3FG 4C1NK 1A8VA 4ZRZA 5KEEA 3U4VA 3Q6SA 1QNUA 2XTIA 3CKIB 1PA6A 2BOSA 3A7AB 1W2BA 3NHHA 2NZOA 4UAIA 1DYQA 1SMYC 1O7YA 3HOUH 2YU9B 2KHSA 3TSSA 1A2TA 2VZAA 3FP9A 2K1BA 1B53A 1HNZQ 2AQ3B 5IWAL 1CZWA 3H91A 3RZDH 2ID0A 4NPSA 1CKNA 1H9JA 4I65A 4JI2Q 3MXNA 4FXKC 2DY8A 2DJFC 1II3A 1Y8NB 3I7FA 3HKSA 1E2ZA 2UUAQ 1FNUA 2AMCB 1KHIA 2RSOA 4N9PA 4OO1I 1KNAA 1CQFA 1YHBA 1PFNA 2HQEA 5EBDA 1K8AC 5I9OA 1Y69U 2FXQA 1B44D 4B3RL 1D8LA 4DXFA 3NBIA 1D7QA 4RGOS 1HTLD 1WCMG 2B2TC 3UDXA 2AQ2B 3OMGA 3I4LA 4XXEA 3A5ZB 3BVZA 1QZGA 1MBYA 2SNSA 1R9TB 1O7LA 3GP7A 2Z4IA 1UE7A 4JPBW 3HOXG 3ER0A 2AUKA 4JI4L 5ELCA 4DAPA 3H94A 3MTSA 4R1JA 3DXJC 3BVGA 2NVTH 2QDBA 2WV6D 1JOKA 4DR4Q 2ENBA 1KLUD 2OCEA 3W5OA 4YCVA 3D0FA 3RLNA 4JYAQ 1F2LA 3I90A 3NQIA 5C3EH 1HCZA 1XMOL 4P2CB 3V2TA 4KTAA 2JA7H 3TS0A 1B8AA 1HRJA 1KRSA 1UEAB 2RCNA 3D6CA 2B63B 1BXTA 2CW0D 1B50A 5NUCA 5M3MH 3CMEA 1T5XD 4KY6A 3L2PA 3F2CA 1DD2A 1PH6A 2D2CC 3PUYA 3PO2B 3NUCA 4PMWA 3S1RB 1NJIC 2B2TA 1LT3D 4HIOA 2A73B 2V4DA 2JA5H 1FGBD 4A3EB 1TWCB 2D0PA 1JE4A 2I5LX 1I50B 4JI5L 3G6JB 3RN2A 1GM5A 1RL2A 1TY0A 5HGTA 2PW5A 1I6VC 2EY6A 3PO3H 1IBLL 1YNJD 4A3IB 1CZGA 1I50H 5TSSA 1V43A 2KHJA 3HFZB 2EY2A 3F2UA 1PZID 5ELOA 4JOIA 2XNAC 5E4WC 1FNWA 2VY3A 5I4DA 1IBML 1JJGA 1BKBA 5C4HA 1VF7A 1EY8A 4B08A 1XPRA 2F4IA 3VA5A 1B7YB 1PXUA 1OXUA 5IY0A 1XTDA 1WI5A 1RTNA 3Q24A 1PH2A 2UUBQ 3RZOB 1KAWA 5JAVA 5EGTA 3QB3A 3Q22A 1PZJD 4DA2A
chains in the Genus database with same CATH topology
3CPFA 4JOIC 2E2HH 1JE5A 1HR0W 4X64L 3CF5A 2HIVA 3BU2A 5IYCH 1VQIA 1IXRA 3UE0A 4DUYQ 1PVOA 1A62A 3E9HA 4DR2Q 5FJ8G 4MZ9A 1I6HH 4PG3A 1PH1A 2B63G 2JQOA 4Y52H 4LFBQ 4OWTB 4GLVB 3J7A5 4DR3L 3S17H 5C44G 4BXXH 2VL6A 3MEFA 4DV1L 2WFWA 4GKJQ 1LYLA 2PI2A 4YHHQ 2PI2E 1XNRQ 1FVIA 1VQAA 1S40A 1Y1WG 4JI1L 3I4NH 2JA6H 2VUMG 4DV4Q 3T1HQ 4R4QA 4FDBA 1TWAH 3KJOA 4PZ6A 3CQZH 4TVAB 4JI8Q 4A76A 2MFIA 4DR6L 4DKAC 2NVQH 1X3EA 3UDFA 3S16H 4P73A 3E9IA 4X64Q 4DR6Q 3DLLA 3HOXH 3KF6B 4JI4Q 1N34Q 4POGA 3CPWA 2BA1A 5J3BA 2E2JH 3PUVA 3BZCA 2F3IA 3D31A 5FLXc 2Q2UA 1W3SA 3HOVG 1PFSA 5LMUL 4OWWB 2Q2IA 3SGIA 1WYDA 4C2MH 3AQQA 1TWFH 2WAQG 3K7AH 1M90C 1TWGH 4LF9Q 2B3GA 1X6OA 4NXML 2E8GA 3W1BA 1XJVA 3G71A 2NVXH 1VS0A 1PH5A 4LF5Q 4DV1Q 4GKJL 1C0AA 1HZAA 1NE3A 2RF4A 3GTMH 3A0JA 2CWAA 3I56A 3J81c 1PV4A 3ULJA 3RNUA 3TS2A 3PUZA 4AIMA 4DR5Q 3I4MG 1EQRA 3AEVA 1E1OA 1NMGA 1VQ4A 4R4CA 2BA0A 4B3TL 3KOJA 3CMAA 1NMFA 4JCVE 1LM0A 2VQFQ 5IP9H 3U58A 2Z6KA 2UXDQ 1GO3E 2CWPA 3CCRA 4UP7A 3WWVA 4B3TQ 2VUMH 3PF5A 4X65Q 1HNWQ 4DV2L 4A3IG 3GTLH 4DV6Q 3HOZH 3NBHB 4JI0Q 1FJGL 4DUZL 3H0GG 4JG2A 3PIOA 4X6AH 1PH4A 2LXKA 3S2DH 1XPUA 1KL9A 4DV5L 1L1OC 5IT9c 2R92H 2IHFA 4A4IA 1PH9A 1QUQB 3PF4A 1WFQA 4YWKA 2N8NA 4C3JH 4A3BG 2QGQA 2YTYA 4PZ7A 1U5KA 1BVSA 4HJ8A 4A3MH 4BBSG 1Q8KA 4A3JH 1HNXQ 3OTOQ 2VNUD 4IFDJ 3PCOB 4DV6L 3UDGA 4H02A 1AE3A 2NN6G 4DUZQ 1VQ9A 3I55A 4LUVA 4UY8C 4GOPB 4IJHA 3A5UA 2UUCL 1XNQQ 1HR0Q 4P75A 4J15A 4A3FG 2CQOA 2VQFL 2A19A 4LWCA 3OW2A 1WJJA 2F4VQ 3F1ZA 2L15A 3TEHB 2IHEA 4QGUA 1XNQL 1U0LA 1SMXA 1KC8C 2YU9H 2I5MX 4LF6L 1NY4A 1MIUA 1VQCA 1T9HA 1YHAA 4DK3C 5IYDG 3KJPA 4GNXA 4LUZA 4UPAA 5E7NA 1CKOA 4IO9A 4LW1A 4YY3Q 4BY7G 1HNXL 3HOWG 1L1OB 3S14H 1Q81C 2GVBA 4A3EG 2LSSA 3J81i 1HNZL 5DLQE 2R7ZG 4B3RQ 1GKHA 2Z0SA 4LFAQ 2OWOA 4LF6Q 4JV5L 1UWVA 1JT8A 4IFDI 4OONA 3GTOH 1P8LA 4R4TA 4DNIA 3PO2G 4LF4L 3M7NA 2JEBI 3BJUA 2ASBA 5JJKA 4KHZA 1K3RA 3PV0A 4YCUA 4GKKL 1CSPA 3G48A 1PYBA 2K50A 5M5WH 1Y14B 4B3MQ 5C3EG 3S1NH 5IP7H 3CAMA 4BA2I 2OTJA 2RHQB 4BBRG 3T1YL 2BH2A 5FJ8H 1QVCA 2R93G 3K7UC 3K0XA 1VQKA 1FL0A 3KFUA 1Y1VG 1FGUA 4GLAC 4DV4L 1KQSA 2NZHA 2PMZE 3CC2A 2VS1A 4HJAA 4L5SA 5M3MG 3U4ZA 3ERSX 1OXTA 2MQHA 1NTGA 4KI0A 1QVGA 1CSQA 4KHPQ 1N32Q 5IE8A 4LF5L 4IFDG 2AHOB 4OWXB 3CC7A 4GLXA 3HOUG 1V9PA 3PSIA 3TRZA 4EX5A 1Q7YC 4X62L 4L5QA 4DR3Q 1Q86C 2UXBQ 1GD7A 3EBEA 1N36Q 4YWMA 1VQ8A 1A0IA 1OXXK 4OO1G 4DV2Q 1IBKL 2KCTA 3J81j 4A3GG 4A3CH 3PO3G 2JA6G 5IYBG 4Y7NH 1S72A 1YZ6A 1EYGA 4XTCS 3HOVH 2JA8G 2ZTDA 3BZKA 3PO2H 4RG1A 2UUAL 5JJIA 1LUZA 4KLKA 1VQFA 4JI8L 2V1CC 5C4JH 3G4SA 2HHHQ 1CKMA 1EIFA 2PQAB 4ALPA 2JA5G 3CC4A 4ME3A 4MTNA 2OQ0A 4P74A 4X62Q 2ZJPA 3HOYG 2E2IH 1N36L 5LMNL 5ELNA 1YHQA 3NELA 4L5TA 1PHJA 4B3SL 4JV5Q 3PUXA 3H3VI 5HGQA 1N33L 1VQEA 3J80i 2B29A 1HZCA 2KCMA 1VQPA 3MXNB 1Y1VH 4HJ9A 1JMCA 1I3QH 2D62A 2DUDA 2ZTCA 4QIWE 1EOVA 1SROA 4IOCA 1N33Q 1HH2P 3FKIH 4HIKA 2JJQA 2E5LQ 5GAEC 2KHIA 3CCEA 1KXLA 4DV0L 4JI3L 1WCMH 4GOPC 4DR1L 5BR8L 2IY5B 1E24A 1OXVA 1J6QA 3VDYA 1V1QA 1Z9FA 2D0OA 4C3HH 2VQEL 3CCQA 1MKHA 4IPGA 1K83H 3L7ZC 3HKZE 1PH3A 3HOZG 3H0GH 2JEAI 4IJLA 2ZTEA 2PQAA 5FLMH 4L5RC 4B3ML 4GOPA 3S1RH 4JI2L 1I94L 1N9WA 4LUOA 4NXNL 1MJCA 2UU9L 2UXCQ 2N49A 3GTKH 1IBLQ 2K5HA 5IP9G 5JJLA 5GROA 2CFMA 3RLFA 1UE5A 4DV3L 1MJEA 1BBWA 3K81C 2E5LL 2UUBL 4P72A 1ASYA 4EQ5A 4LF4Q 4A75A 3AFQA 4A3LH 5M5XH 4JI5Q 2C35B 2R7FA 3IRBA 2IT1A 3GDEA 3GTJH 2ZM6L 3GO5A 3Q8DA 4IPHA 3RR5A 4DV5Q 4K0KL 3EIVA 1QZHA 3DM3A 3K8AA 1O7IA 2AWOA 2YTXA 4A93H 1UE1A 4LF7L 2WB1G 2IX0A 5LMUQ 2I0QA 3M4OH 3S1QH 1S3OA 1E7ZA 1Z47A 2EQSA 1PH7A 4UP8A 4A3BH 1Y1WH 4P71A 4GN3B 1TWCH 1XPOA 2HHHL 3K80C 4BBSH 4HJ5A 4OX9L 3FKIG 2UXDL 1M1KC 2JA9A 3KDFA 2UUCQ 1K9MC 3I4OA 4AYBE 3GTQH 4YWLA 4JI3Q 2NN6I 2VW9A 1G6PA 1WOCA 2EIFA 2NVYH 5GADC 1BBUA 1G51A 1QUQA 4BY1H 4JI7Q 4X66L 4JI1Q 4LF8L 1IZ6A 3OTOL 4JBWA 4LFAL 3I4NG 5K36G 3KYHC 1J5EQ 4LFCQ 3CXCA 1N32L 2K4KA 1JB7A 1G291 3ICEA 3RZOH 4JYAL 1VQ7A 5IYDH 2I5HA 4QQBX 4JBJA 2QEXA 4UP9A 2BH8A 5H1SE 4LF9L 1Q1BA 2Q2HA 2F52A 3CP0A 2H5XA 3M85A 1PH8A 3JAMc 3LGJA 2Y0SG 4A3DG 2CKZB 3CCLA 3NENA 3ZJYC 2R93H 1CKNB 4MNOA 4RMFA 3TQYA 4LNQA 1YJNA 3PUWA 3STBD 4X65L 1HNWL 3UDIA 5M3FG 1H95A 4GNXB 3AFPA 4DR1Q 5C4XH 1SR3A 1A8VA 3U4VA 5JEAJ 2VQEQ 1C7YA 2XTIA 1X56A 1QVFA 2A8VA 4DV7L 2MNAA 1PA6A 4DAYB 1KRTA 1W2BA 2NZOA 2KENA 3HOUH 2LXJA 4OXPA 5IWAQ 4AQYL 1A63A 1L2FA 4O0AA 3I4MH 2VZAA 1TXYA 3FP9A 2ATWA 2N3SA 4QL5A 4AYBG 1HNZQ 5IWAL 3CCVA 1NBWA 3F8TA 3RZDH 4NB3A 2ID0A 2OQKA 4NPSA 1CKNA 4LF8Q 5LMNQ 4JI2Q 5IYBH 2JK8A 1IL2A 4GS3A 3I7FA 4JI0L 2WAQE 1Q1EA 3HKSA 4O2DA 4A3MG 1FJGQ 2F4VL 2JA8H 1UEBA 5C0XG 5HY6A 2UUAQ 3CW2C 2B63H 2WB1E 2HIXA 4DK6C 2AMCB 1KHIA 5C44H 2IX1A 1E22A 3CCUA 2N78A 4A3FH 3S1MH 3JAMi 4A3GH 4OO1I 2Q2TA 4GN5A 1XMOQ 1YHBA 4K0KQ 1E3PA 2GVAA 4BA1I 5IYCG 2R7DA 2JA7G 5GAHC 2UXBL 1K8AC 3J7ZC 4YCWA 2FXQA 1EUJA 1K0RA 4B3RL 1PYSB 1D8LA 1DGSA 1YBYA 3U50C 2YYZA 4AQYQ 4HIMA 4A3JG 1XMQQ 1KIXA 4KHPL 3CCJA 1D7QA 4JI6L 1VQNA 4X66Q 4HJ7A 4BXXG 1WCMG 1Q12A 3I2ZA 3UDXA 1SN8A 5C0XJ 4DV7Q 1YIJA 2ES2A 4B3SQ 2UXCL 1VQGA 2AKWB 3A5ZB 1QZGA 4DUYL 1X9NA 3GD7A 3M4PA 4JBKA 2R7ZH 2XGTA 1UE6A 1UE7A 1YVCA 1IYJB 4QY7A 3HOXG 1YITA 3ER0A 1X3FA 2WP8J 3M4QA 2CCZA 3RN5A 1VQLA 2OTLA 5FLMG 4JI4L 3CD6A 1VCIA 4A3KG 4R1JA 2Z6KC 4DR7L 4HIDA 1X54A 2A1AA 2K5NA 2ZJRA 3PGZA 2DGYA 4GKKQ 1EQQA 1Q46A 2GN5A 4A3EH 5AJ3L 2NVTH 1B70B 5IP7G 4LF7Q 2RHSB 3L0OA 4A3LG 1VQ6A 2K14A 4AH6A 1VQJA 1IBKQ 1HJPA 2KBNA 4DR4Q 3T1HL 3STBC 4R4IA 2K5VA 1EIYB 2Y0SE 5EAYA 3A74A 2OCEA 1P16A 3W5OA 3F2BA 3G6EA 4YCVA 1JJCB 4A93G 3D0FA 3RLNA 4JYAQ 4QJFA 1L1OA 1YEZA 1ASZA 5C3EH 1XMOL 4WJ3M 1YJ9A 4DR2L 3ULPA 2JA7H 4POFA 1IBMQ 3TS0A 1B8AA 4BBRH 5AJ3Q 1KRSA 3KF6A 2AWNA 2RCNA 4GNXC 4NXNQ 4IPCA 4TQUS 3E0EA 5C0XI 4OX9Q 3M9BA 1YNXA 1SE8A 4R4OA 3JC66 1SLJA 4DR7Q 5M3MH 3CMEA 1K73C 1N8RC 1VQBA 3L2PA 1OTCA 3F2CA 1R9TH 1VQ5A 1PH6A 2R92G 1TWHH 3PUYA 4BY1G 3KLWA 1K8GA 1HZ9A 1Q82C 3FHWA 1SFOH 4A3CG 2HT1A 1VQDA 4PMWA 3PIPA 1YJWA 3H3VH 4DR5L 1NJIC 4A3IH 4DAMA 4A3KH 1XNRL 2QA4A 2ALYB 4JI6Q 3H15A 4HIOA 2MO1A 1KD1C 2PNHA 2JA5H 3CCSA 2D0PA 2I5LX 3HOYH 4JI5L 2K52A 2YV5A 1VQMA 4LFBL 3OYYA 3RN2A 1GM5A 1RL2A 4JI7L 3W1GA 3F2DA 2UU9Q 1X65A 4DR4L 1C9OA 1IBLL 4JC0A 2ZJQA 2JE6I 3PO3H 4DV3Q 1SRUA 5M3FH 1I50H 1X55A 2K75A 1CUKA 1RIPA 2YTVA 1EWIA 1V43A 2KHJA 3NEMA 3HFZB 4PZ8A 3RLOA 1N34L 4WJ4A 3S15H 1AE2A 1HZBA 4IPDA 5ELOA 1L0WA 3T1YQ 3ULLA 4GN4B 4JOIA 1HR0L 5GQOA 5GAGC 4DV0Q 3GTPH 2EXDA 4DPGA 5BR8Q 2VY3A 5LMNW 4A3DH 1IBML 1JJGA 3HKZG 4JBMA 1BKBA 3CCMA 1GVPA 2R6GA 3S24A 1XPRA 3GTGH 3S2HH 1OXSC 1B7YB 1YI2A 5C4XG 1OXUA 5IY0A 2ZM6Q 5M5YH 4APVA 1XTDA 4IOAA 1VQOA 1VQHA 4BY7H 1XMQL 1WI5A 4YHHL 3EN2A 4LFCL 3B6YA 3UE1A 4XIGS 1J5EL 4NXMQ 3HOWH 1AH9A 1PH2A 3TREA 2UUBQ 1JJ2A 4C3IH 1X3GA 5JEAG 1KAWA 1EFWA 3AYHB 3J80c 2HQLA 1LTLA 3KF8B 1E1TA 4YY3L 3KDFB 3M3YH 1I94Q 2MO0A 1I5FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CPF A;  4JOI C;  2E2H H;  1JE5 A;  1HR0 W;  4X64 L;  3CF5 A;  2HIV A;  3BU2 A;  5IYC H;  1VQI A;  1IXR A;  3UE0 A;  4DUY Q;  1PVO A;  1A62 A;  3E9H A;  4DR2 Q;  5FJ8 G;  4MZ9 A;  1I6H H;  4PG3 A;  1PH1 A;  2B63 G;  2JQO A;  4Y52 H;  4LFB Q;  4OWT B;  4GLV B;  3J7A 5;  4DR3 L;  3S17 H;  5C44 G;  4BXX H;  2VL6 A;  3MEF A;  4DV1 L;  2WFW A;  4GKJ Q;  1LYL A;  2PI2 A;  4YHH Q;  2PI2 E;  1XNR Q;  1FVI A;  1VQA A;  1S40 A;  1Y1W G;  4JI1 L;  3I4N H;  2JA6 H;  2VUM G;  4DV4 Q;  3T1H Q;  4R4Q A;  4FDB A;  1TWA H;  3KJO A;  4PZ6 A;  3CQZ H;  4TVA B;  4JI8 Q;  4A76 A;  2MFI A;  4DR6 L;  4DKA C;  2NVQ H;  1X3E A;  3UDF A;  3S16 H;  4P73 A;  3E9I A;  4X64 Q;  4DR6 Q;  3DLL A;  3HOX H;  3KF6 B;  4JI4 Q;  1N34 Q;  4POG A;  3CPW A;  2BA1 A;  5J3B A;  2E2J H;  3PUV A;  3BZC A;  2F3I A;  3D31 A;  5FLX c;  2Q2U A;  1W3S A;  3HOV G;  1PFS A;  5LMU L;  4OWW B;  2Q2I A;  3SGI A;  1WYD A;  4C2M H;  3AQQ A;  1TWF H;  2WAQ G;  3K7A H;  1M90 C;  1TWG H;  4LF9 Q;  2B3G A;  1X6O A;  4NXM L;  2E8G A;  3W1B A;  1XJV A;  3G71 A;  2NVX H;  1VS0 A;  1PH5 A;  4LF5 Q;  4DV1 Q;  4GKJ L;  1C0A A;  1HZA A;  1NE3 A;  2RF4 A;  3GTM H;  3A0J A;  2CWA A;  3I56 A;  3J81 c;  1PV4 A;  3ULJ A;  3RNU A;  3TS2 A;  3PUZ A;  4AIM A;  4DR5 Q;  3I4M G;  1EQR A;  3AEV A;  1E1O A;  1NMG A;  1VQ4 A;  4R4C A;  2BA0 A;  4B3T L;  3KOJ A;  3CMA A;  1NMF A;  4JCV E;  1LM0 A;  2VQF Q;  5IP9 H;  3U58 A;  2Z6K A;  2UXD Q;  1GO3 E;  2CWP A;  3CCR A;  4UP7 A;  3WWV A;  4B3T Q;  2VUM H;  3PF5 A;  4X65 Q;  1HNW Q;  4DV2 L;  4A3I G;  3GTL H;  4DV6 Q;  3HOZ H;  3NBH B;  4JI0 Q;  1FJG L;  4DUZ L;  3H0G G;  4JG2 A;  3PIO A;  4X6A H;  1PH4 A;  2LXK A;  3S2D H;  1XPU A;  1KL9 A;  4DV5 L;  1L1O C;  5IT9 c;  2R92 H;  2IHF A;  4A4I A;  1PH9 A;  1QUQ B;  3PF4 A;  1WFQ A;  4YWK A;  2N8N A;  4C3J H;  4A3B G;  2QGQ A;  2YTY A;  4PZ7 A;  1U5K A;  1BVS A;  4HJ8 A;  4A3M H;  4BBS G;  1Q8K A;  4A3J H;  1HNX Q;  3OTO Q;  2VNU D;  4IFD J;  3PCO B;  4DV6 L;  3UDG A;  4H02 A;  1AE3 A;  2NN6 G;  4DUZ Q;  1VQ9 A;  3I55 A;  4LUV A;  4UY8 C;  4GOP B;  4IJH A;  3A5U A;  2UUC L;  1XNQ Q;  1HR0 Q;  4P75 A;  4J15 A;  4A3F G;  2CQO A;  2VQF L;  2A19 A;  4LWC A;  3OW2 A;  1WJJ A;  2F4V Q;  3F1Z A;  2L15 A;  3TEH B;  2IHE A;  4QGU A;  1XNQ L;  1U0L A;  1SMX A;  1KC8 C;  2YU9 H;  2I5M X;  4LF6 L;  1NY4 A;  1MIU A;  1VQC A;  1T9H A;  1YHA A;  4DK3 C;  5IYD G;  3KJP A;  4GNX A;  4LUZ A;  4UPA A;  5E7N A;  1CKO A;  4IO9 A;  4LW1 A;  4YY3 Q;  4BY7 G;  1HNX L;  3HOW G;  1L1O B;  3S14 H;  1Q81 C;  2GVB A;  4A3E G;  2LSS A;  3J81 i;  1HNZ L;  5DLQ E;  2R7Z G;  4B3R Q;  1GKH A;  2Z0S A;  4LFA Q;  2OWO A;  4LF6 Q;  4JV5 L;  1UWV A;  1JT8 A;  4IFD I;  4OON A;  3GTO H;  1P8L A;  4R4T A;  4DNI A;  3PO2 G;  4LF4 L;  3M7N A;  2JEB I;  3BJU A;  2ASB A;  5JJK A;  4KHZ A;  1K3R A;  3PV0 A;  4YCU A;  4GKK L;  1CSP A;  3G48 A;  1PYB A;  2K50 A;  5M5W H;  1Y14 B;  4B3M Q;  5C3E G;  3S1N H;  5IP7 H;  3CAM A;  4BA2 I;  2OTJ A;  2RHQ B;  4BBR G;  3T1Y L;  2BH2 A;  5FJ8 H;  1QVC A;  2R93 G;  3K7U C;  3K0X A;  1VQK A;  1FL0 A;  3KFU A;  1Y1V G;  1FGU A;  4GLA C;  4DV4 L;  1KQS A;  2NZH A;  2PMZ E;  3CC2 A;  2VS1 A;  4HJA A;  4L5S A;  5M3M G;  3U4Z A;  3ERS X;  1OXT A;  2MQH A;  1NTG A;  4KI0 A;  1QVG A;  1CSQ A;  4KHP Q;  1N32 Q;  5IE8 A;  4LF5 L;  4IFD G;  2AHO B;  4OWX B;  3CC7 A;  4GLX A;  3HOU G;  1V9P A;  3PSI A;  3TRZ A;  4EX5 A;  1Q7Y C;  4X62 L;  4L5Q A;  4DR3 Q;  1Q86 C;  2UXB Q;  1GD7 A;  3EBE A;  1N36 Q;  4YWM A;  1VQ8 A;  1A0I A;  1OXX K;  4OO1 G;  4DV2 Q;  1IBK L;  2KCT A;  3J81 j;  4A3G G;  4A3C H;  3PO3 G;  2JA6 G;  5IYB G;  4Y7N H;  1S72 A;  1YZ6 A;  1EYG A;  4XTC S;  3HOV H;  2JA8 G;  2ZTD A;  3BZK A;  3PO2 H;  4RG1 A;  2UUA L;  5JJI A;  1LUZ A;  4KLK A;  1VQF A;  4JI8 L;  2V1C C;  5C4J H;  3G4S A;  2HHH Q;  1CKM A;  1EIF A;  2PQA B;  4ALP A;  2JA5 G;  3CC4 A;  4ME3 A;  4MTN A;  2OQ0 A;  4P74 A;  4X62 Q;  2ZJP A;  3HOY G;  2E2I H;  1N36 L;  5LMN L;  5ELN A;  1YHQ A;  3NEL A;  4L5T A;  1PHJ A;  4B3S L;  4JV5 Q;  3PUX A;  3H3V I;  5HGQ A;  1N33 L;  1VQE A;  3J80 i;  2B29 A;  1HZC A;  2KCM A;  1VQP A;  3MXN B;  1Y1V H;  4HJ9 A;  1JMC A;  1I3Q H;  2D62 A;  2DUD A;  2ZTC A;  4QIW E;  1EOV A;  1SRO A;  4IOC A;  1N33 Q;  1HH2 P;  3FKI H;  4HIK A;  2JJQ A;  2E5L Q;  5GAE C;  2KHI A;  3CCE A;  1KXL A;  4DV0 L;  4JI3 L;  1WCM H;  4GOP C;  4DR1 L;  5BR8 L;  2IY5 B;  1E24 A;  1OXV A;  1J6Q A;  3VDY A;  1V1Q A;  1Z9F A;  2D0O A;  4C3H H;  2VQE L;  3CCQ A;  1MKH A;  4IPG A;  1K83 H;  3L7Z C;  3HKZ E;  1PH3 A;  3HOZ G;  3H0G H;  2JEA I;  4IJL A;  2ZTE A;  2PQA A;  5FLM H;  4L5R C;  4B3M L;  4GOP A;  3S1R H;  4JI2 L;  1I94 L;  1N9W A;  4LUO A;  4NXN L;  1MJC A;  2UU9 L;  2UXC Q;  2N49 A;  3GTK H;  1IBL Q;  2K5H A;  5IP9 G;  5JJL A;  5GRO A;  2CFM A;  3RLF A;  1UE5 A;  4DV3 L;  1MJE A;  1BBW A;  3K81 C;  2E5L L;  2UUB L;  4P72 A;  1ASY A;  4EQ5 A;  4LF4 Q;  4A75 A;  3AFQ A;  4A3L H;  5M5X H;  4JI5 Q;  2C35 B;  2R7F A;  3IRB A;  2IT1 A;  3GDE A;  3GTJ H;  2ZM6 L;  3GO5 A;  3Q8D A;  4IPH A;  3RR5 A;  4DV5 Q;  4K0K L;  3EIV A;  1QZH A;  3DM3 A;  3K8A A;  1O7I A;  2AWO A;  2YTX A;  4A93 H;  1UE1 A;  4LF7 L;  2WB1 G;  2IX0 A;  5LMU Q;  2I0Q A;  3M4O H;  3S1Q H;  1S3O A;  1E7Z A;  1Z47 A;  2EQS A;  1PH7 A;  4UP8 A;  4A3B H;  1Y1W H;  4P71 A;  4GN3 B;  1TWC H;  1XPO A;  2HHH L;  3K80 C;  4BBS H;  4HJ5 A;  4OX9 L;  3FKI G;  2UXD L;  1M1K C;  2JA9 A;  3KDF A;  2UUC Q;  1K9M C;  3I4O A;  4AYB E;  3GTQ H;  4YWL A;  4JI3 Q;  2NN6 I;  2VW9 A;  1G6P A;  1WOC A;  2EIF A;  2NVY H;  5GAD C;  1BBU A;  1G51 A;  1QUQ A;  4BY1 H;  4JI7 Q;  4X66 L;  4JI1 Q;  4LF8 L;  1IZ6 A;  3OTO L;  4JBW A;  4LFA L;  3I4N G;  5K36 G;  3KYH C;  1J5E Q;  4LFC Q;  3CXC A;  1N32 L;  2K4K A;  1JB7 A;  1G29 1;  3ICE A;  3RZO H;  4JYA L;  1VQ7 A;  5IYD H;  2I5H A;  4QQB X;  4JBJ A;  2QEX A;  4UP9 A;  2BH8 A;  5H1S E;  4LF9 L;  1Q1B A;  2Q2H A;  2F52 A;  3CP0 A;  2H5X A;  3M85 A;  1PH8 A;  3JAM c;  3LGJ A;  2Y0S G;  4A3D G;  2CKZ B;  3CCL A;  3NEN A;  3ZJY C;  2R93 H;  1CKN B;  4MNO A;  4RMF A;  3TQY A;  4LNQ A;  1YJN A;  3PUW A;  3STB D;  4X65 L;  1HNW L;  3UDI A;  5M3F G;  1H95 A;  4GNX B;  3AFP A;  4DR1 Q;  5C4X H;  1SR3 A;  1A8V A;  3U4V A;  5JEA J;  2VQE Q;  1C7Y A;  2XTI A;  1X56 A;  1QVF A;  2A8V A;  4DV7 L;  2MNA A;  1PA6 A;  4DAY B;  1KRT A;  1W2B A;  2NZO A;  2KEN A;  3HOU H;  2LXJ A;  4OXP A;  5IWA Q;  4AQY L;  1A63 A;  1L2F A;  4O0A A;  3I4M H;  2VZA A;  1TXY A;  3FP9 A;  2ATW A;  2N3S A;  4QL5 A;  4AYB G;  1HNZ Q;  5IWA L;  3CCV A;  1NBW A;  3F8T A;  3RZD H;  4NB3 A;  2ID0 A;  2OQK A;  4NPS A;  1CKN A;  4LF8 Q;  5LMN Q;  4JI2 Q;  5IYB H;  2JK8 A;  1IL2 A;  4GS3 A;  3I7F A;  4JI0 L;  2WAQ E;  1Q1E A;  3HKS A;  4O2D A;  4A3M G;  1FJG Q;  2F4V L;  2JA8 H;  1UEB A;  5C0X G;  5HY6 A;  2UUA Q;  3CW2 C;  2B63 H;  2WB1 E;  2HIX A;  4DK6 C;  2AMC B;  1KHI A;  5C44 H;  2IX1 A;  1E22 A;  3CCU A;  2N78 A;  4A3F H;  3S1M H;  3JAM i;  4A3G H;  4OO1 I;  2Q2T A;  4GN5 A;  1XMO Q;  1YHB A;  4K0K Q;  1E3P A;  2GVA A;  4BA1 I;  5IYC G;  2R7D A;  2JA7 G;  5GAH C;  2UXB L;  1K8A C;  3J7Z C;  4YCW A;  2FXQ A;  1EUJ A;  1K0R A;  4B3R L;  1PYS B;  1D8L A;  1DGS A;  1YBY A;  3U50 C;  2YYZ A;  4AQY Q;  4HIM A;  4A3J G;  1XMQ Q;  1KIX A;  4KHP L;  3CCJ A;  1D7Q A;  4JI6 L;  1VQN A;  4X66 Q;  4HJ7 A;  4BXX G;  1WCM G;  1Q12 A;  3I2Z A;  3UDX A;  1SN8 A;  5C0X J;  4DV7 Q;  1YIJ A;  2ES2 A;  4B3S Q;  2UXC L;  1VQG A;  2AKW B;  3A5Z B;  1QZG A;  4DUY L;  1X9N A;  3GD7 A;  3M4P A;  4JBK A;  2R7Z H;  2XGT A;  1UE6 A;  1UE7 A;  1YVC A;  1IYJ B;  4QY7 A;  3HOX G;  1YIT A;  3ER0 A;  1X3F A;  2WP8 J;  3M4Q A;  2CCZ A;  3RN5 A;  1VQL A;  2OTL A;  5FLM G;  4JI4 L;  3CD6 A;  1VCI A;  4A3K G;  4R1J A;  2Z6K C;  4DR7 L;  4HID A;  1X54 A;  2A1A A;  2K5N A;  2ZJR A;  3PGZ A;  2DGY A;  4GKK Q;  1EQQ A;  1Q46 A;  2GN5 A;  4A3E H;  5AJ3 L;  2NVT H;  1B70 B;  5IP7 G;  4LF7 Q;  2RHS B;  3L0O A;  4A3L G;  1VQ6 A;  2K14 A;  4AH6 A;  1VQJ A;  1IBK Q;  1HJP A;  2KBN A;  4DR4 Q;  3T1H L;  3STB C;  4R4I A;  2K5V A;  1EIY B;  2Y0S E;  5EAY A;  3A74 A;  2OCE A;  1P16 A;  3W5O A;  3F2B A;  3G6E A;  4YCV A;  1JJC B;  4A93 G;  3D0F A;  3RLN A;  4JYA Q;  4QJF A;  1L1O A;  1YEZ A;  1ASZ A;  5C3E H;  1XMO L;  4WJ3 M;  1YJ9 A;  4DR2 L;  3ULP A;  2JA7 H;  4POF A;  1IBM Q;  3TS0 A;  1B8A A;  4BBR H;  5AJ3 Q;  1KRS A;  3KF6 A;  2AWN A;  2RCN A;  4GNX C;  4NXN Q;  4IPC A;  4TQU S;  3E0E A;  5C0X I;  4OX9 Q;  3M9B A;  1YNX A;  1SE8 A;  4R4O A;  3JC6 6;  1SLJ A;  4DR7 Q;  5M3M H;  3CME A;  1K73 C;  1N8R C;  1VQB A;  3L2P A;  1OTC A;  3F2C A;  1R9T H;  1VQ5 A;  1PH6 A;  2R92 G;  1TWH H;  3PUY A;  4BY1 G;  3KLW A;  1K8G A;  1HZ9 A;  1Q82 C;  3FHW A;  1SFO H;  4A3C G;  2HT1 A;  1VQD A;  4PMW A;  3PIP A;  1YJW A;  3H3V H;  4DR5 L;  1NJI C;  4A3I H;  4DAM A;  4A3K H;  1XNR L;  2QA4 A;  2ALY B;  4JI6 Q;  3H15 A;  4HIO A;  2MO1 A;  1KD1 C;  2PNH A;  2JA5 H;  3CCS A;  2D0P A;  2I5L X;  3HOY H;  4JI5 L;  2K52 A;  2YV5 A;  1VQM A;  4LFB L;  3OYY A;  3RN2 A;  1GM5 A;  1RL2 A;  4JI7 L;  3W1G A;  3F2D A;  2UU9 Q;  1X65 A;  4DR4 L;  1C9O A;  1IBL L;  4JC0 A;  2ZJQ A;  2JE6 I;  3PO3 H;  4DV3 Q;  1SRU A;  5M3F H;  1I50 H;  1X55 A;  2K75 A;  1CUK A;  1RIP A;  2YTV A;  1EWI A;  1V43 A;  2KHJ A;  3NEM A;  3HFZ B;  4PZ8 A;  3RLO A;  1N34 L;  4WJ4 A;  3S15 H;  1AE2 A;  1HZB A;  4IPD A;  5ELO A;  1L0W A;  3T1Y Q;  3ULL A;  4GN4 B;  4JOI A;  1HR0 L;  5GQO A;  5GAG C;  4DV0 Q;  3GTP H;  2EXD A;  4DPG A;  5BR8 Q;  2VY3 A;  5LMN W;  4A3D H;  1IBM L;  1JJG A;  3HKZ G;  4JBM A;  1BKB A;  3CCM A;  1GVP A;  2R6G A;  3S24 A;  1XPR A;  3GTG H;  3S2H H;  1OXS C;  1B7Y B;  1YI2 A;  5C4X G;  1OXU A;  5IY0 A;  2ZM6 Q;  5M5Y H;  4APV A;  1XTD A;  4IOA A;  1VQO A;  1VQH A;  4BY7 H;  1XMQ L;  1WI5 A;  4YHH L;  3EN2 A;  4LFC L;  3B6Y A;  3UE1 A;  4XIG S;  1J5E L;  4NXM Q;  3HOW H;  1AH9 A;  1PH2 A;  3TRE A;  2UUB Q;  1JJ2 A;  4C3I H;  1X3G A;  5JEA G;  1KAW A;  1EFW A;  3AYH B;  3J80 c;  2HQL A;  1LTL A;  3KF8 B;  1E1T A;  4YY3 L;  3KDF B;  3M3Y H;  1I94 Q;  2MO0 A;  1I5F A; 
#chains in the Genus database with same CATH topology
 1VDZ A;  3E0J A;  4ME5 A;  4X64 L;  3HRZ C;  3CF5 A;  3AB9 A;  5IYC H;  3K7A B;  1PVO A;  4DUY Q;  4HAE A;  5I2X A;  3SK6 A;  1D1K A;  1QWY A;  2B63 G;  2A6E C;  1KDC A;  4Y52 H;  4DR3 L;  5DAU A;  4Y7N B;  4BXX H;  1H9K A;  4YIJ A;  2VL6 A;  3E6Z X;  4DV1 L;  4GKJ Q;  4LJZ C;  1I4G A;  1NSN S;  1XNR Q;  1HUM A;  4RHS A;  3SE0 A;  1FVI A;  1VQA A;  3KBG A;  4JI1 L;  5KIX A;  5EPL A;  4FDB A;  3PO3 B;  1TWA H;  3KJO A;  3S17 B;  3S15 B;  4DKA C;  2NVQ H;  2LY7 A;  3E9I A;  1B1Z A;  3HOX H;  3KF6 B;  2G9H D;  2BA1 A;  2AUJ D;  3PUV A;  2MGS A;  2F3I A;  1PFS A;  1BQQ T;  1ENA A;  4C2M H;  2WAQ G;  1QE6 A;  5E1F A;  5JVH 3;  4NXM L;  2B3G A;  1X6O A;  3EVQ A;  2E8G A;  4G7O C;  5C3W A;  4AYB B;  3G71 A;  4LF5 Q;  2QW7 A;  3I73 A;  4DV1 Q;  4GKJ L;  3A7L A;  1Q8I A;  4F87 A;  2E2I B;  3P7J A;  2RF4 A;  4DU9 A;  1WTV A;  3WOE A;  1I4P A;  4HMJ A;  3BDL A;  3I56 A;  1G2T A;  2A6H D;  3TS2 A;  3GTO B;  2PNR C;  3MFG A;  1NMG A;  1SND A;  1VQ4 A;  4B3T L;  3CMA A;  1NMF A;  1GO3 E;  3WWV A;  2VUM H;  1LLR D;  1HNW Q;  2F0T A;  3GTL H;  2M00 A;  1QB5 D;  3H0G G;  3PIO A;  1X3Q A;  1E2V A;  1TVX A;  4DFA A;  4DK0 A;  2RDG A;  1XPU A;  4DV5 L;  2VUM B;  5IT9 c;  4X3K A;  5BN5 A;  2IHF A;  1EEF D;  1PH9 A;  5J39 A;  1SYF A;  1U5K A;  1BVS A;  3PCO B;  2NVX B;  1SJE D;  1AE3 A;  5DM6 3;  2UUC L;  3S14 B;  4KD4 A;  1WD0 A;  1WJJ A;  3F1Z A;  2L15 A;  2KCC A;  2IHE A;  3TEH B;  1XNQ L;  5M9O A;  2B39 A;  2YU9 H;  4LF6 L;  1K28 A;  1NY4 A;  1MIU A;  3KJP A;  4DR2 Q;  5D14 A;  4GNX A;  3IKJ A;  4UPA A;  5E7N A;  4CHT B;  3HOW G;  3L9A X;  2F0W A;  3U9S A;  4A3E G;  3J81 L;  3D8G A;  5IOD A;  1HNZ L;  1SNP A;  1V1P A;  4IFD I;  1Y1V B;  4OON A;  1A3V A;  1WD1 A;  2B8F A;  3PO2 G;  3PV0 A;  3T16 A;  4H44 C;  3SDZ A;  3OIP A;  3LX0 A;  4BA2 I;  2OTJ A;  2RHQ B;  4BBR G;  5FJ8 H;  1ILP A;  1VQK A;  1FL0 A;  1FGU A;  2OF1 A;  1KQS A;  4L5S A;  4F7X A;  4JK1 C;  5M5X B;  2MQH A;  1FYC A;  4KI0 A;  1QVG A;  4IUT A;  1SE2 A;  3BG3 A;  3CC7 A;  5COY A;  3TP6 A;  3HOU G;  2F0F A;  5ELF A;  1Q7Y C;  1ZXT A;  2J4X A;  4X62 L;  1N36 Q;  3HOY B;  1IBK L;  2KCT A;  1H9S B;  3J81 j;  4A3G G;  2E2D C;  3ZYY X;  1Q3L A;  4Y7N H;  3WOF A;  1S72 A;  1VMP A;  1YZ6 A;  1EYG A;  1TKW B;  3HOV H;  4BBS B;  4RG1 A;  5T1I A;  1ML0 D;  2HHH Q;  1VQF A;  2HDM A;  4JI8 L;  5C4J H;  2G5D A;  4TKO B;  2PQA B;  1EIF A;  1R4P B;  3BZD B;  4X62 Q;  3J7Y W;  5LMN L;  3HEJ A;  4OIK A;  5D65 A;  4CBV A;  1TWA B;  4E6I A;  4B3S L;  3FEW X;  1TS3 A;  1HZC A;  1AZQ A;  1IYU A;  1B9N A;  2ZTC A;  2D62 A;  4QIW E;  4FF3 A;  1EOV A;  1SRO A;  3J80 E;  1N33 Q;  1HH2 P;  4HIK A;  2JJQ A;  1DM0 B;  5CV6 A;  2KHI A;  3RMH A;  4JI3 L;  1WCM H;  4DR1 L;  5BR8 L;  4IUV A;  1LTB D;  1J6Q A;  2TSS A;  2VQE L;  3HOZ G;  1MKH A;  3L7Z C;  1I3Q B;  2JEA I;  4IJL A;  2K5W A;  2ZTE A;  2PQA A;  1SNM A;  2CW0 C;  3DWP A;  4L5R C;  4H7B A;  4B3M L;  3M4Y A;  5FKA C;  1N9W A;  1EZ6 A;  1I94 L;  4JI2 L;  1LAC A;  2UU9 L;  2K5H A;  5IP9 G;  5JJL A;  5I6W A;  4DV3 L;  2E5L L;  4ODG A;  3NTK A;  4EQN A;  4PV1 C;  5CGK A;  2L4N A;  4NKL A;  5M5X H;  2EPB A;  2ZM6 L;  2PO4 A;  4U67 3;  3TP7 A;  2NN6 H;  4DV5 Q;  3DM3 A;  1O7I A;  2AWO A;  1UE1 A;  2WB1 G;  1SAP A;  2NBF A;  3M4O H;  3H3V C;  5CC4 A;  3J7A F;  1PH7 A;  4UP8 A;  3V96 A;  2DY7 A;  1QIL A;  4OX9 L;  5C5M A;  1M1K C;  1SNQ A;  4A3F B;  3S1M B;  1JQY D;  3GTQ H;  1C4Q A;  3MC0 B;  2RA4 A;  1G6P A;  5GAD C;  4WFN 3;  1STG A;  4JI1 Q;  3CRK C;  3OTO L;  4JBW A;  5K36 G;  3HGB A;  3KBX A;  2K4K A;  3PMF A;  4QQB X;  4KD3 A;  2XWB B;  1W6J A;  4JBJ A;  1LTA D;  3J81 E;  2BH8 A;  1Q1B A;  4I7A A;  1HXY D;  4MHE A;  1PH8 A;  3BYT B;  4A3D G;  4G57 A;  3CCL A;  4FNF A;  3ZJY C;  5C6A A;  4BY7 B;  3STB D;  5M5Y B;  3KK7 A;  3UDI A;  4GNX B;  4CDC C;  4L8J A;  2NYZ D;  2XVS A;  3LNN A;  1LT5 D;  3Q23 A;  2VQE Q;  1C7Y A;  3IFT A;  1BF4 A;  2WII B;  2QIL A;  1TS4 A;  2L55 A;  1LTT D;  4MTK A;  2LXJ A;  4AQY L;  1L2F A;  5CV4 A;  4OO1 H;  4AYB G;  4QL5 A;  2IX3 A;  1NBW A;  3D6W A;  3PQI A;  4KJO A;  1SBB B;  3F8T A;  2GA4 B;  4NB3 A;  4N8X 1;  5LMN Q;  4OL7 A;  5JPN C;  2QF7 A;  5IYB H;  1IL2 A;  4GS3 A;  1FJG Q;  2XWJ B;  4A3M G;  4IUR A;  5HY6 A;  2WB1 E;  2KCN A;  1ONL A;  3KLS A;  5KNB A;  1D5M C;  1E22 A;  2N78 A;  3JAM L;  2IL8 A;  4A3F H;  3S1M H;  4A3G H;  4RA8 A;  1I4R A;  5KRU A;  4K0K Q;  4BA1 I;  2OT2 A;  5IYC G;  2JA7 G;  5GAH C;  3TP8 A;  3EQL C;  3QO2 A;  2F0S A;  3D3R A;  1YBY A;  1DGS A;  4DAV A;  3U50 C;  2YYZ A;  3KF8 A;  4HIM A;  4AQY Q;  4KHP L;  3CCJ A;  4XQN A;  1VQN A;  4BXX G;  1BCP D;  1Q12 A;  3MAQ A;  1YIJ A;  5C0X J;  2ES2 A;  2KUM A;  4B3S Q;  1CHP D;  2UXC L;  2AKW B;  1XX8 A;  4DUY L;  4RAU C;  4JBK A;  2XGT A;  2Q8T A;  2K03 A;  1YIT A;  1IYJ B;  2HDL A;  2RQX A;  1R4Q B;  3M4Q A;  2CCZ A;  4HED A;  4CKE A;  1PFM A;  3MXU A;  4XDX A;  4V19 0;  1TWG B;  1U4L A;  1STN A;  4K6L A;  2C9O A;  2F0G A;  2BDN A;  3PGZ A;  5L37 A;  4GKK Q;  1Q46 A;  2E2H B;  2I07 B;  5C3E B;  2L5T A;  5DM7 3;  4KY5 A;  2RHS B;  1JWS D;  1JB3 A;  3L0O A;  2K14 A;  4CDE C;  1IBK Q;  4A3L G;  4C56 C;  3T1H L;  2N88 A;  1PRT F;  2BE5 C;  1ZEQ X;  2Y0S E;  2FMC A;  2EYH A;  3A74 A;  3S1Q B;  1P16 A;  2JN4 A;  3F2B A;  1EY0 A;  4A93 G;  1RF2 D;  1H9S A;  1Y1W B;  5M3M B;  4QJF A;  1L1O A;  3QR8 A;  3A8J E;  2EYJ A;  3FPP A;  1ASZ A;  5COR A;  3AMU A;  4WJ3 M;  1VMC A;  3ULP A;  1IBM Q;  3DEP A;  4BBR H;  4HTH A;  3KF6 A;  4GNX C;  4NXN Q;  4TQU S;  4XT1 B;  5D3D A;  3E0E A;  1A15 A;  1ET9 A;  3KUP A;  3M9B A;  3R2I A;  3VR5 A;  4OX9 Q;  1STY A;  3K58 A;  1HPC A;  4A3D B;  1VQB A;  2LKV A;  1R9T H;  1VQ5 A;  4OHJ A;  2ICI A;  4FF4 A;  2RKS A;  2A68 D;  1HZ9 A;  3FHW A;  3OOC A;  2HT1 A;  3PIP A;  3FMC A;  2PZT A;  4DR5 L;  4A3I H;  4DAM A;  4A3K H;  4JI6 Q;  2K05 A;  2MO1 A;  3D4D A;  2PNH A;  3CCS A;  2BCO A;  5CR3 A;  4ILW A;  5IGD A;  3W1G A;  5EQ0 A;  3MA2 B;  2UU9 Q;  4DR4 L;  4HR7 B;  1JC7 A;  1DXM A;  1C9O A;  3K0Y A;  2ZJQ A;  3R8B A;  4CGY B;  5M3F H;  2K75 A;  1ENF A;  1CUK A;  1RIP A;  2YTV A;  3NBH A;  4PZ8 A;  1N34 L;  3M4O B;  4WJ4 A;  1UUP A;  1AE2 A;  2HD3 A;  4R8I A;  2LFN A;  1HHV A;  5GQO A;  2EXD A;  3DMU A;  1GVP A;  2R6G A;  3MZ5 A;  1FD7 D;  1YI2 A;  5C4X G;  4APV A;  3HZX A;  3GTK B;  1VQH A;  5KYI A;  4BY7 H;  4YHH L;  3EN2 A;  3UE1 A;  3B6Y A;  3CU7 A;  1J5E L;  1QNK A;  5F2D A;  4IZ8 A;  5JEA G;  1A2U A;  5A2Q E;  3CRL C;  1LTL A;  5C0X H;  2H4O A;  2K28 A;  1EWH A;  1E1T A;  4YY3 L;  3V05 A;  1G91 A;  3M3Y H;  2E2H H;  3HS0 C;  3SK5 A;  3OIQ A;  3RUZ A;  5I9P A;  2D5D A;  2HIV A;  3BU2 A;  3T4A C;  4ZUJ A;  3I8Z A;  4CJ2 C;  5FJ8 G;  1M4V A;  4OWT B;  2K6A A;  3S17 H;  3GTJ B;  3S9W A;  3N52 A;  1LYL A;  2PI2 A;  1G2S A;  4K5X A;  4K8J A;  5CV7 A;  2JA6 H;  4R4Q A;  4ULL A;  1WTX A;  1HUN A;  4PZ6 A;  4A76 A;  4TVA B;  1F2Y A;  4V0B A;  3SXH A;  5FO8 B;  5DEH A;  2L11 A;  4X64 Q;  3MXP A;  1C8C A;  3CPW A;  2EJF C;  3BZC A;  1GUT A;  3D31 A;  1W3S A;  3HOV G;  4EQP A;  2Q2I A;  1RCV D;  3OW7 A;  1HA5 A;  4LF9 Q;  1NR4 A;  1IKL A;  2L9H A;  3I70 A;  1CI3 M;  3A54 A;  3W1B A;  1XJV A;  1PH5 A;  1JCK B;  3T13 A;  4C3I B;  4KK7 A;  1HZA A;  3GTM H;  2MUY A;  2R93 B;  3DWA A;  3ULJ A;  2A68 C;  3C1E A;  4AIM A;  4J1M A;  1EQR A;  2XN9 C;  1J8I A;  1PYW D;  4R4C A;  2BA0 A;  3KOJ A;  2NWG A;  1IW7 C;  2HCI A;  4K14 A;  5CV8 A;  2CWP A;  4TRD A;  1BO0 A;  4S3S A;  4UP7 A;  1GHJ A;  2RDF A;  4B3T Q;  4OIJ A;  3HOZ H;  5ELB A;  2A74 C;  2RSN A;  4JI0 Q;  4DUZ L;  4JG2 A;  1GUO A;  2K5D A;  3EA6 A;  4IUN A;  2LXK A;  1HFN A;  2M2L A;  4J6H A;  1BOS A;  4A4I A;  1QUQ B;  4YWK A;  1KLG D;  2N8N A;  4C3J H;  3A8K E;  2QGQ A;  2YTY A;  1PMR A;  3I4N B;  3I91 A;  2EJM A;  4HJ8 A;  4A3M H;  2EDG A;  4OEL B;  3A56 A;  2JA8 B;  5J1Z A;  3UDG A;  5IGC A;  1F2Z A;  1SNO A;  4DUZ Q;  1AEX A;  2NN6 G;  1VQ9 A;  4IJH A;  1ILQ A;  2FMM A;  4A3K B;  2JXM B;  3OW2 A;  5I2Y A;  3SEB A;  3NXW A;  1U0L A;  1SMX A;  2I5M X;  1VQC A;  1YHA A;  3K5M A;  1CKO A;  1B4O A;  4YY3 Q;  3VYS A;  5IGE A;  1HNX L;  1SMY D;  1L1O B;  5DLQ E;  2R7Z G;  3FPU B;  5JOB A;  1JT8 A;  1DZ1 A;  4JV5 L;  1LTS D;  1LTR D;  2SDF A;  1P8L A;  4TSS A;  2A69 C;  5D3I B;  2F0M A;  3E3X A;  1ESR A;  3ITP A;  4YCU A;  1CSP A;  1SEB D;  3SVM A;  3SK8 A;  5C3E G;  4B3M Q;  2ZT9 C;  4FF2 A;  1MSH A;  4LK1 C;  4ZLT F;  3WDN A;  1TU2 B;  2F0I A;  2R93 G;  2CHB D;  3KFU A;  1XTC D;  4GLA C;  2PMZ E;  1JOQ A;  4HJA A;  1SFO B;  2F0H A;  3U4Z A;  3BDO A;  2DNE A;  3W2D A;  1NTG A;  1V1P B;  5IE8 A;  1SYB A;  4KN7 C;  3K5O A;  4GLX A;  1JIC A;  4I7Z C;  1ENC A;  3TRZ A;  2IW3 A;  4EQO A;  4EX5 A;  2KJX A;  1FNV A;  4HCS A;  1OXX K;  1MHW C;  2A6H C;  1A3T A;  1SXT A;  3TN2 A;  3Q0A A;  3PO3 G;  5IYB G;  2KA7 A;  2JA8 G;  2ZTD A;  3BZK A;  3PO2 H;  2UUA L;  4KLK A;  1PTO H;  2LS0 1;  1CKM A;  4ALP A;  3MVV A;  4ME3 A;  2HUG A;  2IWH A;  1N36 L;  2RBM A;  2MJ8 A;  1YHQ A;  1PHJ A;  4HMI A;  5HGQ A;  3H3V I;  3J80 i;  4MN3 A;  2K7V A;  2KCM A;  1VQP A;  2F0D A;  2RDH A;  1XYI A;  3MXN B;  4HJ9 A;  1I3Q H;  2DUD A;  3VR4 A;  4PMC A;  3FKI H;  5GAE C;  1XXG A;  1RJT A;  5FO7 B;  1KXL A;  4GOP C;  1E24 A;  1V1Q A;  4RWS C;  1KTK A;  3H0G H;  3UI2 A;  4QB4 A;  4GOP A;  4LUO A;  4NXN L;  4J8Q A;  5J22 A;  1K0S A;  2N49 A;  1NR2 A;  1KNE A;  1UE5 A;  1MJE A;  4P72 A;  2E76 C;  4KV6 A;  4C3I G;  4A3L H;  2C35 B;  2PQE A;  2IT1 A;  2SEB D;  3GDE A;  1LO5 D;  3M7G A;  4DK1 A;  3EIV A;  3K8A A;  3QIA A;  2YTX A;  4A93 H;  1Z47 A;  2OEO A;  4P71 A;  1D5Z C;  3QWN A;  4UDU C;  4ZK9 B;  1SYE A;  4ZKC B;  4ZAI A;  2UUC Q;  1SNC A;  4KKU A;  1K9M C;  4AYB E;  4L63 B;  2NN6 I;  2VW9 A;  1WOC A;  2NVY H;  1IZ6 A;  4LFC Q;  3CXC A;  1G29 1;  1VQ7 A;  3RZD B;  2I5H A;  1WTR A;  1H9M A;  1IYV A;  3TZD A;  4RH6 A;  2Q2H A;  2H5X A;  2B2V C;  1ROD A;  3LGJ A;  2CKZ B;  4MNO A;  4LNQ A;  3PUW A;  5ISR A;  4DF7 A;  4RCO A;  4ID6 A;  3AFP A;  1SR3 A;  4JW0 A;  5JEA J;  1STH A;  1AN8 A;  2A8V A;  4QMG A;  2MPM A;  1F9Q A;  2G9D A;  4RGT A;  2XRS D;  1S5F D;  1YNN D;  3C2P A;  4OXP A;  1DOL A;  1Y8P B;  2O4X A;  4O0A A;  3I4M H;  2ATW A;  1TXY A;  2N3S A;  1DOM A;  1L0X B;  3CCV A;  1EY6 A;  3SK4 A;  2JSO A;  2OQK A;  3MHB A;  5K36 H;  1V8Q A;  2JK8 A;  3S16 B;  2EYM A;  4JI0 L;  2O5J C;  5C0X G;  2SOB A;  2B63 H;  1STE A;  2NVT B;  1AFP A;  1CM9 A;  2CH4 A;  2HIX A;  3OPO A;  4DK6 C;  2IX1 A;  1D1I A;  1A3U A;  3CCU A;  3JAM i;  2Q2T A;  4GN5 A;  4H13 C;  2UXB L;  1BNZ A;  3J7Z C;  2PYK A;  1K0R A;  4A3J G;  1EYC A;  1XMQ Q;  1V1O A;  4HJ7 A;  2QDL A;  2OXP A;  4K2K A;  1ZYR D;  1X9N A;  1STB A;  3D4W A;  2QCP X;  1YVC A;  4QY7 A;  2RVL A;  2XIW A;  1X3F A;  3RN5 A;  2OTL A;  1STA A;  4A3K G;  4DR7 L;  2A1A A;  2K5N A;  3EJI A;  2DGY A;  4CKC A;  2JA6 B;  2GN5 A;  2DJG C;  3T51 B;  5AJ3 L;  1VQ6 A;  3GTG B;  1VQJ A;  1BCP F;  1F9P A;  4KN4 C;  1JOR A;  4HCE A;  4R4I A;  5A35 A;  2K5V A;  5ELD A;  1TR5 A;  3JAM E;  2E74 C;  3D4R A;  3G6E A;  1K8O A;  1J9O A;  2J7Z A;  3X3M A;  1CHQ D;  1YEZ A;  1BDO A;  3VR6 A;  1YJ9 A;  1RKN A;  4POF A;  1O80 A;  5AJ3 Q;  1IHZ A;  1DOK A;  1C48 A;  4FYD A;  1SYC A;  1QG7 A;  5C0X I;  3CHB D;  4OGQ C;  1YNX A;  3VYU A;  4G7H C;  1Z6H A;  3JC6 6;  1SLJ A;  2DNC A;  5C4Z A;  1K73 C;  1N8R C;  5CYU A;  2FJ2 A;  3K5L A;  2R92 G;  3GTM B;  3QJY A;  3KLW A;  3NWS A;  1Q82 C;  1LV9 A;  2F0V A;  3I3C A;  1YJW A;  4QUC A;  2ZXR A;  1XNR L;  2ALY B;  2H1E A;  5EJW A;  3H15 A;  2PZU A;  3TME A;  3OSO A;  1VQM A;  1EFI D;  5CV5 A;  3F2D A;  1X65 A;  3NQT A;  2Z8L A;  1X55 A;  2NVY B;  3NEM A;  4K2L A;  3S15 H;  2TMP A;  3T1Y Q;  2EXZ A;  1LAB A;  2EYF A;  2FHT A;  1HR0 L;  5FK9 C;  2HCC A;  4DV0 Q;  3GTP H;  4DPG A;  5BR8 Q;  5LMN W;  2FFK B;  5EKK A;  3HOX B;  3HKZ G;  5CMD A;  4JBM A;  1GJX A;  3EFX D;  4R9W A;  2NZ1 D;  3GTG H;  1GUW A;  1VF5 C;  4C2M B;  5M5Y H;  2ZM6 Q;  1VQO A;  3DWQ A;  1HA6 A;  4LFC L;  3HP3 A;  3SR1 A;  1G6Z A;  1RD9 D;  1JJ2 A;  1X3G A;  1EFW A;  3AYH B;  3J80 c;  2HQL A;  1PRT D;  2NB0 A;  4RGN A;  4C3H B;  2WAQ B;  5C3X A;  3VA7 A;  3PIP 3;  2EOT A;  1WTQ A;  2MO0 A;  4X3S A;  4XQQ A;  2VXW A;  3CPF A;  3TP5 A;  1HR0 W;  2K32 A;  1I6H B;  1EIG A;  2L1B A;  3I4M B;  4DAY A;  1I4X A;  1VQI A;  3UE0 A;  2I46 A;  3E9H A;  4EGV A;  1B9M A;  4MZ9 A;  4RKB A;  1I6H H;  4PG3 A;  1KDB A;  3J7A 5;  2BDO A;  4G4K A;  3MEF A;  3NTI A;  1MGS A;  2WFW A;  2PI2 E;  4X3U A;  4MIU A;  2CQA A;  1EQV A;  1S40 A;  5IGG A;  4DV4 Q;  3NPP A;  3T1H Q;  3NE5 B;  4QCL A;  1LT4 D;  3CQZ H;  4DR6 L;  4DXG A;  4O1N A;  4ABN A;  5FO9 B;  1X3E A;  3UDF A;  3VYR A;  3S16 H;  5M5W B;  4DR6 Q;  1A6X A;  1ZKO A;  4F8M A;  4JI4 Q;  2F0L A;  2PMZ B;  4POG A;  4HSV A;  3GTQ B;  4XYO A;  2E2J H;  4M1U B;  4B9W A;  5LMU L;  4OWW B;  3SGI A;  1WYD A;  1M90 C;  1TWF H;  1BUV T;  3K7A H;  1TWG H;  2QKI C;  1PRT C;  3U9O A;  1E2W A;  1UAP A;  3FRP B;  3J80 L;  1VS0 A;  1AP0 A;  1S5E D;  1C0A A;  4C1N I;  1JOO A;  4ZQ3 A;  1NE3 A;  2B2W C;  3A0J A;  2CWA A;  2N55 A;  3J81 c;  3PUZ A;  4N8F A;  1E1O A;  2A5H A;  1LTI D;  2JYO A;  1LM0 A;  4JCV E;  5IP9 H;  2UXD Q;  3CCR A;  4FXG C;  1BCP C;  4A3I G;  4C3H G;  2F0P A;  3NBH B;  1FJG L;  1U4P A;  2AQ1 B;  4XT3 B;  4X6A H;  1PH4 A;  3R3O A;  1KL9 A;  1EU3 A;  3C46 A;  2R92 H;  2PCF B;  1X32 A;  4A3B G;  4PZ7 A;  4FO2 A;  3FDT A;  1U4M A;  4BBS G;  1HNX Q;  3OTO Q;  3NP8 A;  2VNU D;  2SNM A;  3GV3 A;  4DV6 L;  2F0N A;  5CBE E;  3I55 A;  4GOP B;  3A5U A;  1XNQ Q;  1HR0 Q;  4J15 A;  2VQF L;  4RGM A;  4FP5 D;  3VR2 A;  3RD4 A;  1T9H A;  4DK3 C;  1PLF A;  5C4J B;  2A6E D;  1GUN A;  4LW1 A;  4QF4 A;  4BY7 G;  1CTM A;  1GOZ A;  4B9X A;  5C4X B;  1GKH A;  4LFA Q;  2OWO A;  1UWV A;  4FF1 A;  1EOT A;  3GTO H;  4DNI A;  3M7N A;  2JEB I;  2O5I C;  4CDF C;  3BYY B;  4KHZ A;  4GKK L;  2F0J A;  3G48 A;  1PYB A;  1TT2 A;  2K50 A;  2XRQ D;  5M5W H;  1Y14 B;  4XQJ A;  3S1N H;  3E5S A;  1EWC A;  4A3M B;  3NWT A;  2BH2 A;  2EJG C;  5IT9 L;  3K7U C;  5FLX E;  1HTP A;  1NUC A;  1S5D D;  4F88 A;  1K8M A;  2EE1 A;  1PRT B;  3ERS X;  3DUZ A;  4KHP Q;  1S5C D;  4LF5 L;  4OWX B;  2K01 A;  4IUP A;  3DM1 A;  2Z1C A;  3MXG A;  4L5Q A;  1Q86 C;  2UXB Q;  1GD7 A;  1HFG A;  1VQ8 A;  1DCZ A;  3QOJ A;  5EKI A;  1WVL A;  3X3N A;  3VYT A;  2F0E A;  4HN7 A;  1EY5 A;  4JVZ A;  3P20 A;  1S5B D;  1ESF A;  3NSW A;  3G4S A;  1SSO A;  2JA5 G;  3CC4 A;  4MTN A;  2OQ0 A;  2ZJP A;  2E2I H;  4KMU C;  3NEL A;  1HQR D;  1N33 L;  1VQE A;  4DNT B;  1Y1V H;  1F77 A;  3QOL A;  1JMC A;  3H0G B;  1EEI D;  4A3J B;  2E5L Q;  5E3F A;  2PZW A;  1RHP A;  2IY5 B;  1M8A A;  3VDY A;  2KVM A;  3CCQ A;  3S1N B;  1SE3 A;  1IKM A;  1K83 H;  3HKZ E;  1PH3 A;  3CQZ B;  3J7A V;  1RTO A;  2WB1 B;  2JP1 A;  1MJC A;  1RDP D;  4QUF A;  2B2V A;  3DHQ A;  1IBL Q;  4GZY C;  5GRO A;  1F9R A;  2CFM A;  3P75 A;  3RLF A;  2UUB L;  2ICE C;  4C3J G;  1ASY A;  1F9S A;  1TQO A;  4EQ5 A;  4JI5 Q;  3IRB A;  1TWF B;  3IL8 A;  4IPH A;  3RR5 A;  3T53 B;  1QZH A;  4K6D A;  1GXD C;  4LF7 L;  3GV6 A;  4BS9 A;  5LMU Q;  3S1Q H;  1PTO C;  3R93 A;  4A3B H;  1Y1W H;  2B8G A;  1XPO A;  1YNN C;  5C5L A;  3K80 C;  4BBS H;  4G7Z C;  2E75 C;  3FKI G;  2UXD L;  2JA9 A;  1Q90 A;  3KDF A;  1W6K A;  4M8A A;  2QEJ C;  5BN4 A;  1D2B A;  1QUQ A;  1IW7 D;  4X66 L;  1TY2 A;  2BE5 D;  3KYH C;  1J5E Q;  2X6G A;  1N32 L;  3O13 A;  1KAB A;  1SYD A;  1KDA A;  5H1S E;  1SE4 A;  2F1M A;  2F52 A;  4LMQ D;  5I6Y A;  3CP0 A;  1UNS A;  3M85 A;  2R7Z B;  3JAM c;  2Y0S G;  1PDQ A;  3NEN A;  3IFD A;  2R93 H;  1CKN B;  1YJN A;  1HNW L;  5KND A;  1PTO F;  4A3G B;  1H95 A;  2LMC B;  3TDQ A;  4DR1 Q;  5C4X H;  2MP1 A;  3I72 A;  1CFM A;  4PMB A;  1DJR D;  1CK1 A;  1X56 A;  1I4Q A;  1QVF A;  4DV7 L;  2MNA A;  4NP5 A;  4DAY B;  2F03 A;  1KRT A;  2KEN A;  5JEA H;  1D5X C;  5IWA Q;  3VR3 A;  1A63 A;  3A8I E;  3BS1 A;  1LT6 D;  1PTO D;  2PPB C;  1K3B C;  2RCF A;  5FOB B;  1WTW A;  1EYA A;  4LF8 Q;  4C3J B;  5C44 B;  4BBR B;  5K5P A;  2WAQ E;  1Q1E A;  4O2D A;  2F4V L;  2JA8 H;  2E2J B;  1UEB A;  3CW2 C;  2MHV A;  5JJZ A;  4BWG B;  5C44 H;  3C3L A;  1QOH A;  1XMO Q;  2NTT A;  1E3P A;  2GVA A;  2R7D A;  4CJ0 B;  5HUR A;  1B3A A;  2ZXO A;  4YCW A;  1EUJ A;  1PYS B;  2WIN B;  1KIX A;  1OO9 B;  4JI6 L;  2WKC A;  4H0L C;  4ZKB B;  4X66 Q;  3TBI B;  3I2Z A;  1SN8 A;  4DV7 Q;  4LAA A;  1VQG A;  3GD7 A;  3M4P A;  2R7Z H;  4Z9C B;  1UE6 A;  1U4R A;  4LF6 Q;  2WP8 J;  4KY7 A;  1VQL A;  5FLM G;  3CD6 A;  4PQX A;  1VCI A;  2Z6K C;  1GHK A;  4HID A;  1X54 A;  2ZJR A;  3FKI B;  3W3A A;  1EQQ A;  3QG1 A;  1AW7 A;  4A3E H;  4CJ1 B;  1NCV A;  1HQM C;  1B70 B;  5IP7 G;  4LF7 Q;  4AH6 A;  2EVB A;  1HJP A;  2KBN A;  3ERO A;  4CDD C;  3STB C;  4Q5V A;  4KHV A;  1EIY B;  5EAY A;  2Q8I B;  2D9U A;  1JJC B;  3BVM A;  1JWM D;  3T56 B;  2R61 A;  3URY A;  2B2Y C;  3K6O A;  1PZK D;  4K5W A;  4DR2 L;  4IFD H;  5BN3 A;  4DNR B;  2AWN A;  4K8I A;  4IPC A;  3NTH A;  1SE8 A;  4R4O A;  2Y0S B;  3M3Y B;  5EKL A;  3IAY A;  4DR7 Q;  1OTC A;  3K59 A;  3OHX C;  1ICW A;  1TWH H;  4BY1 G;  4RKL A;  1K8G A;  1SFO H;  4A3C G;  2DN8 A;  1VQD A;  3A55 A;  1NNX A;  4X3T A;  1BBX C;  3H3V H;  3C1F A;  3OWE B;  3SHL A;  2B2Y A;  2QA4 A;  1TWH B;  5ELE A;  1KD1 C;  2NUC A;  3HOY H;  2K52 A;  2YV5 A;  4LFB L;  3OYY A;  4JI7 L;  2F3W A;  1E0B A;  1WTO A;  2A69 D;  4JC0 A;  2JE6 I;  4DV3 Q;  1SRU A;  1XWE A;  3RLO A;  1H9R A;  1EWI A;  2JA5 B;  4WOR A;  1HZB A;  4IPD A;  1L0W A;  1O7Z A;  3ULL A;  4GN4 B;  2FIN B;  2WKD A;  5EPK A;  5GAG C;  4FVM A;  4A3D H;  2ZXP A;  3ONA B;  4IAL A;  3CCM A;  5E4X A;  1ICF B;  3S24 A;  3S2H H;  1OXS C;  1SYG A;  4IOA A;  1U9R A;  4K5V A;  5T1G A;  5IGB A;  1XMQ L;  3HOW H;  4IN3 A;  4NXM Q;  3G7L A;  4XIG S;  1AH9 A;  2EYP A;  3TRE A;  3ERQ A;  4OEM B;  4C3I H;  3KF8 B;  4FXD A;  5IIF A;  2IPK D;  3KDF B;  1I94 Q;  2K04 A;  1I5F A;  1JB7 A;  1AZP A;  4JOI C;  1MSG A;  4N9T A;  1JE5 A;  1EZ8 A;  2L12 A;  1CQV A;  3OMC A;  4PNY A;  2C5C A;  1IXR A;  1A62 A;  2CH4 W;  1CT1 D;  2Q8R E;  5KNC A;  1PH1 A;  2F0U A;  2JQO A;  2KEE A;  4LFB Q;  4GLV B;  5C44 G;  4NMZ A;  5IT9 E;  3GTP B;  3MWY W;  4YHH Q;  2O2L D;  4Q0F A;  3HOV B;  1Y1W G;  1K83 B;  3NK9 A;  4U68 A;  3I4N H;  4A93 B;  3PIO 3;  2VUM G;  4L6T B;  1PFB A;  2L0C A;  2X69 A;  4CKB A;  3MEH A;  4JI8 Q;  2MFI A;  2R3Z A;  1EY4 A;  5LL6 X;  2F0O A;  3TZU A;  5JPM C;  1SDF A;  4P73 A;  3DLL A;  1CA5 A;  1N34 Q;  5J3B A;  1NAP A;  1GUS A;  5FLX c;  2Q2U A;  4RCN A;  4UHV A;  3HG9 A;  3AQQ A;  2CVR A;  2J0T D;  5A2Q L;  3S2H B;  2NVX H;  3KLR A;  5IGF A;  1LTG D;  1BR9 A;  1PV4 A;  3RNU A;  1DON A;  4DR5 Q;  5AFW A;  3I4M G;  3AEV A;  3GQB A;  1EY9 A;  5CBA E;  2VQF Q;  1JWU D;  1ET6 A;  2Z6K A;  5LL6 S;  3U58 A;  1EY7 A;  3LWU A;  3PF5 A;  4X65 Q;  4DV2 L;  4DV6 Q;  1EL0 A;  2EYO A;  2IJ0 A;  1GUG A;  5EPJ A;  2Z4H A;  4IUU A;  3S2D H;  4O42 A;  1L1O C;  4WJW A;  3AU7 A;  3PF4 A;  1WFQ A;  2VB3 X;  1KAA A;  1B2T A;  1X3P A;  2KEC A;  3HKZ B;  1Q8K A;  4A3J H;  1EIH A;  4IFD J;  4BY1 B;  4QIW B;  2M9V A;  4H02 A;  4LUV A;  4UY8 C;  4NW2 A;  4P75 A;  4A3F G;  1WTH A;  2CQO A;  2A19 A;  4LWC A;  2F4V Q;  1WTP A;  4XYQ A;  3KLS X;  4QGU A;  5G3L F;  1KC8 C;  5IYD G;  4IO9 A;  3HOU B;  4LUZ A;  3OWF A;  3S14 H;  1Q81 C;  2GVB A;  4EVO A;  2LSS A;  3J81 i;  4B3R Q;  2Z0S A;  4WRD A;  4DN4 M;  1G8Z D;  1TII D;  4R4T A;  4LF4 L;  2ASB A;  2KOL A;  3BJU A;  3BDC A;  5KGU A;  1K3R A;  2R92 B;  5JJK A;  2VB2 X;  2F0Q A;  2P5Z X;  4DGZ A;  5IP7 H;  1PTO B;  3CAM A;  4RHR A;  1Y8O B;  5EBC A;  3T1Y L;  1D6E C;  3HOZ B;  1QVC A;  3K0X A;  1QJO A;  1Y1V G;  1MI2 A;  2WAC A;  4DV4 L;  2NZH A;  3CC2 A;  2VS1 A;  5LHY 1;  5M3M G;  2KQ3 A;  3MFY A;  3DEO A;  4ZYS A;  1OXT A;  1CSQ A;  1N32 Q;  3L3O C;  3FVQ A;  2NVQ B;  4IFD G;  2AHO B;  4NDX A;  4IUQ A;  1V9P A;  2XSC A;  3PSI A;  5CV9 A;  2EYL A;  5G3L D;  4DR3 Q;  3HOW B;  3EBE A;  1TS2 A;  4YWM A;  2B2U A;  4KKS A;  1A0I A;  4OO1 G;  4DV2 Q;  5IOC A;  1YNJ C;  5M3F B;  4A3C H;  3K5N A;  2JA6 G;  4R8N A;  3ND8 A;  4XTC S;  5JJI A;  3S2D B;  1LUZ A;  2V1C C;  4P74 A;  3HOY G;  1B3Q A;  5ELN A;  4L5T A;  3ND9 A;  3PUX A;  4JV5 Q;  2B29 A;  4KJN A;  2JA7 B;  1QCB D;  4IOC A;  2Z6B A;  4IQZ A;  3CCE A;  1IL8 A;  4HSP A;  4DV0 L;  1EQT A;  1OXV A;  4ZUI A;  1Z9F A;  2D0O A;  4C3H H;  1TS5 A;  4IPG A;  2EY1 A;  3LWE A;  5FLM H;  3S1R H;  5KYL A;  1CA6 A;  2UXC Q;  1I4H A;  3GTK H;  1BCP B;  1WCM B;  2NTS A;  1MD2 D;  1BBW A;  3K81 C;  2K33 A;  4LF4 Q;  4A75 A;  3AFQ A;  4A3B B;  1JR0 D;  2R7F A;  3GTJ H;  1L0Y B;  1EU4 A;  3GO5 A;  3N6R A;  3Q8D A;  2EZV A;  3P1H A;  3R2T A;  4K0K L;  2KED A;  2X6L A;  1F2M A;  1T5E A;  2EY5 A;  2I0Q A;  2IX0 A;  2PW7 A;  1ZYR C;  1S3O A;  1E7Z A;  2EQS A;  4GN3 B;  1TWC H;  4KKT A;  5JVG 3;  3H6M A;  2HHH L;  4HJ5 A;  4RFB A;  2K5Q A;  2Z9H A;  3I4O A;  4YWL A;  2B2U C;  4ZCK A;  4JI3 Q;  2EIF A;  2F3V A;  3K57 A;  1BBU A;  1G51 A;  4BY1 H;  4JI7 Q;  4LF8 L;  2F0K A;  2B2W A;  4LFA L;  3I4N G;  3GTL B;  3RZO H;  5IYD H;  1SJH D;  3ICE A;  4JYA L;  2QEX A;  1EYD A;  4UP9 A;  4LF9 L;  1O78 A;  1S4Z A;  1FR3 A;  5FLX L;  3H09 A;  5DNF A;  1Z7T A;  4RMF A;  3TQY A;  4X65 L;  5M3F G;  4C1N K;  1A8V A;  4ZRZ A;  5KEE A;  3U4V A;  3Q6S A;  1QNU A;  2XTI A;  3CKI B;  1PA6 A;  2BOS A;  3A7A B;  1W2B A;  3NHH A;  2NZO A;  4UAI A;  1DYQ A;  1SMY C;  1O7Y A;  3HOU H;  2YU9 B;  2KHS A;  3TSS A;  1A2T A;  2VZA A;  3FP9 A;  2K1B A;  1B53 A;  1HNZ Q;  2AQ3 B;  5IWA L;  1CZW A;  3H91 A;  3RZD H;  2ID0 A;  4NPS A;  1CKN A;  1H9J A;  4I65 A;  4JI2 Q;  3MXN A;  4FXK C;  2DY8 A;  2DJF C;  1II3 A;  1Y8N B;  3I7F A;  3HKS A;  1E2Z A;  2UUA Q;  1FNU A;  2AMC B;  1KHI A;  2RSO A;  4N9P A;  4OO1 I;  1KNA A;  1CQF A;  1YHB A;  1PFN A;  2HQE A;  5EBD A;  1K8A C;  5I9O A;  1Y69 U;  2FXQ A;  1B44 D;  4B3R L;  1D8L A;  4DXF A;  3NBI A;  1D7Q A;  4RGO S;  1HTL D;  1WCM G;  2B2T C;  3UDX A;  2AQ2 B;  3OMG A;  3I4L A;  4XXE A;  3A5Z B;  3BVZ A;  1QZG A;  1MBY A;  2SNS A;  1R9T B;  1O7L A;  3GP7 A;  2Z4I A;  1UE7 A;  4JPB W;  3HOX G;  3ER0 A;  2AUK A;  4JI4 L;  5ELC A;  4DAP A;  3H94 A;  3MTS A;  4R1J A;  3DXJ C;  3BVG A;  2NVT H;  2QDB A;  2WV6 D;  1JOK A;  4DR4 Q;  2ENB A;  1KLU D;  2OCE A;  3W5O A;  4YCV A;  3D0F A;  3RLN A;  4JYA Q;  1F2L A;  3I90 A;  3NQI A;  5C3E H;  1HCZ A;  1XMO L;  4P2C B;  3V2T A;  4KTA A;  2JA7 H;  3TS0 A;  1B8A A;  1HRJ A;  1KRS A;  1UEA B;  2RCN A;  3D6C A;  2B63 B;  1BXT A;  2CW0 D;  1B50 A;  5NUC A;  5M3M H;  3CME A;  1T5X D;  4KY6 A;  3L2P A;  3F2C A;  1DD2 A;  1PH6 A;  2D2C C;  3PUY A;  3PO2 B;  3NUC A;  4PMW A;  3S1R B;  1NJI C;  2B2T A;  1LT3 D;  4HIO A;  2A73 B;  2V4D A;  2JA5 H;  1FGB D;  4A3E B;  1TWC B;  2D0P A;  1JE4 A;  2I5L X;  1I50 B;  4JI5 L;  3G6J B;  3RN2 A;  1GM5 A;  1RL2 A;  1TY0 A;  5HGT A;  2PW5 A;  1I6V C;  2EY6 A;  3PO3 H;  1IBL L;  1YNJ D;  4A3I B;  1CZG A;  1I50 H;  5TSS A;  1V43 A;  2KHJ A;  3HFZ B;  2EY2 A;  3F2U A;  1PZI D;  5ELO A;  4JOI A;  2XNA C;  5E4W C;  1FNW A;  2VY3 A;  5I4D A;  1IBM L;  1JJG A;  1BKB A;  5C4H A;  1VF7 A;  1EY8 A;  4B08 A;  1XPR A;  2F4I A;  3VA5 A;  1B7Y B;  1PXU A;  1OXU A;  5IY0 A;  1XTD A;  1WI5 A;  1RTN A;  3Q24 A;  1PH2 A;  2UUB Q;  3RZO B;  1KAW A;  5JAV A;  5EGT A;  3QB3 A;  3Q22 A;  1PZJ D;  4DA2 A; 
#chains in the Genus database with same CATH homology
 3CPF A;  4JOI C;  2E2H H;  1JE5 A;  1HR0 W;  4X64 L;  3CF5 A;  2HIV A;  3BU2 A;  5IYC H;  1VQI A;  1IXR A;  3UE0 A;  4DUY Q;  1PVO A;  1A62 A;  3E9H A;  4DR2 Q;  5FJ8 G;  4MZ9 A;  1I6H H;  4PG3 A;  1PH1 A;  2B63 G;  2JQO A;  4Y52 H;  4LFB Q;  4OWT B;  4GLV B;  3J7A 5;  4DR3 L;  3S17 H;  5C44 G;  4BXX H;  2VL6 A;  3MEF A;  4DV1 L;  2WFW A;  4GKJ Q;  1LYL A;  2PI2 A;  4YHH Q;  2PI2 E;  1XNR Q;  1FVI A;  1VQA A;  1S40 A;  1Y1W G;  4JI1 L;  3I4N H;  2JA6 H;  2VUM G;  4DV4 Q;  3T1H Q;  4R4Q A;  4FDB A;  1TWA H;  3KJO A;  4PZ6 A;  3CQZ H;  4TVA B;  4JI8 Q;  4A76 A;  2MFI A;  4DR6 L;  4DKA C;  2NVQ H;  1X3E A;  3UDF A;  3S16 H;  4P73 A;  3E9I A;  4X64 Q;  4DR6 Q;  3DLL A;  3HOX H;  3KF6 B;  4JI4 Q;  1N34 Q;  4POG A;  3CPW A;  2BA1 A;  5J3B A;  2E2J H;  3PUV A;  3BZC A;  2F3I A;  3D31 A;  5FLX c;  2Q2U A;  1W3S A;  3HOV G;  1PFS A;  5LMU L;  4OWW B;  2Q2I A;  3SGI A;  1WYD A;  4C2M H;  3AQQ A;  1TWF H;  2WAQ G;  3K7A H;  1M90 C;  1TWG H;  4LF9 Q;  2B3G A;  1X6O A;  4NXM L;  2E8G A;  3W1B A;  1XJV A;  3G71 A;  2NVX H;  1VS0 A;  1PH5 A;  4LF5 Q;  4DV1 Q;  4GKJ L;  1C0A A;  1HZA A;  1NE3 A;  2RF4 A;  3GTM H;  3A0J A;  2CWA A;  3I56 A;  3J81 c;  1PV4 A;  3ULJ A;  3RNU A;  3TS2 A;  3PUZ A;  4AIM A;  4DR5 Q;  3I4M G;  1EQR A;  3AEV A;  1E1O A;  1NMG A;  1VQ4 A;  4R4C A;  2BA0 A;  4B3T L;  3KOJ A;  3CMA A;  1NMF A;  4JCV E;  1LM0 A;  2VQF Q;  5IP9 H;  3U58 A;  2Z6K A;  2UXD Q;  1GO3 E;  2CWP A;  3CCR A;  4UP7 A;  3WWV A;  4B3T Q;  2VUM H;  3PF5 A;  4X65 Q;  1HNW Q;  4DV2 L;  4A3I G;  3GTL H;  4DV6 Q;  3HOZ H;  3NBH B;  4JI0 Q;  1FJG L;  4DUZ L;  3H0G G;  4JG2 A;  3PIO A;  4X6A H;  1PH4 A;  2LXK A;  3S2D H;  1XPU A;  1KL9 A;  4DV5 L;  1L1O C;  5IT9 c;  2R92 H;  2IHF A;  4A4I A;  1PH9 A;  1QUQ B;  3PF4 A;  1WFQ A;  4YWK A;  2N8N A;  4C3J H;  4A3B G;  2QGQ A;  2YTY A;  4PZ7 A;  1U5K A;  1BVS A;  4HJ8 A;  4A3M H;  4BBS G;  1Q8K A;  4A3J H;  1HNX Q;  3OTO Q;  2VNU D;  4IFD J;  3PCO B;  4DV6 L;  3UDG A;  4H02 A;  1AE3 A;  2NN6 G;  4DUZ Q;  1VQ9 A;  3I55 A;  4LUV A;  4UY8 C;  4GOP B;  4IJH A;  3A5U A;  2UUC L;  1XNQ Q;  1HR0 Q;  4P75 A;  4J15 A;  4A3F G;  2CQO A;  2VQF L;  2A19 A;  4LWC A;  3OW2 A;  1WJJ A;  2F4V Q;  3F1Z A;  2L15 A;  3TEH B;  2IHE A;  4QGU A;  1XNQ L;  1U0L A;  1SMX A;  1KC8 C;  2YU9 H;  2I5M X;  4LF6 L;  1NY4 A;  1MIU A;  1VQC A;  1T9H A;  1YHA A;  4DK3 C;  5IYD G;  3KJP A;  4GNX A;  4LUZ A;  4UPA A;  5E7N A;  1CKO A;  4IO9 A;  4LW1 A;  4YY3 Q;  4BY7 G;  1HNX L;  3HOW G;  1L1O B;  3S14 H;  1Q81 C;  2GVB A;  4A3E G;  2LSS A;  3J81 i;  1HNZ L;  5DLQ E;  2R7Z G;  4B3R Q;  1GKH A;  2Z0S A;  4LFA Q;  2OWO A;  4LF6 Q;  4JV5 L;  1UWV A;  1JT8 A;  4IFD I;  4OON A;  3GTO H;  1P8L A;  4R4T A;  4DNI A;  3PO2 G;  4LF4 L;  3M7N A;  2JEB I;  3BJU A;  2ASB A;  5JJK A;  4KHZ A;  1K3R A;  3PV0 A;  4YCU A;  4GKK L;  1CSP A;  3G48 A;  1PYB A;  2K50 A;  5M5W H;  1Y14 B;  4B3M Q;  5C3E G;  3S1N H;  5IP7 H;  3CAM A;  4BA2 I;  2OTJ A;  2RHQ B;  4BBR G;  3T1Y L;  2BH2 A;  5FJ8 H;  1QVC A;  2R93 G;  3K7U C;  3K0X A;  1VQK A;  1FL0 A;  3KFU A;  1Y1V G;  1FGU A;  4GLA C;  4DV4 L;  1KQS A;  2NZH A;  2PMZ E;  3CC2 A;  2VS1 A;  4HJA A;  4L5S A;  5M3M G;  3U4Z A;  3ERS X;  1OXT A;  2MQH A;  1NTG A;  4KI0 A;  1QVG A;  1CSQ A;  4KHP Q;  1N32 Q;  5IE8 A;  4LF5 L;  4IFD G;  2AHO B;  4OWX B;  3CC7 A;  4GLX A;  3HOU G;  1V9P A;  3PSI A;  3TRZ A;  4EX5 A;  1Q7Y C;  4X62 L;  4L5Q A;  4DR3 Q;  1Q86 C;  2UXB Q;  1GD7 A;  3EBE A;  1N36 Q;  4YWM A;  1VQ8 A;  1A0I A;  1OXX K;  4OO1 G;  4DV2 Q;  1IBK L;  2KCT A;  3J81 j;  4A3G G;  4A3C H;  3PO3 G;  2JA6 G;  5IYB G;  4Y7N H;  1S72 A;  1YZ6 A;  1EYG A;  4XTC S;  3HOV H;  2JA8 G;  2ZTD A;  3BZK A;  3PO2 H;  4RG1 A;  2UUA L;  5JJI A;  1LUZ A;  4KLK A;  1VQF A;  4JI8 L;  2V1C C;  5C4J H;  3G4S A;  2HHH Q;  1CKM A;  1EIF A;  2PQA B;  4ALP A;  2JA5 G;  3CC4 A;  4ME3 A;  4MTN A;  2OQ0 A;  4P74 A;  4X62 Q;  2ZJP A;  3HOY G;  2E2I H;  1N36 L;  5LMN L;  5ELN A;  1YHQ A;  3NEL A;  4L5T A;  1PHJ A;  4B3S L;  4JV5 Q;  3PUX A;  3H3V I;  5HGQ A;  1N33 L;  1VQE A;  3J80 i;  2B29 A;  1HZC A;  2KCM A;  1VQP A;  3MXN B;  1Y1V H;  4HJ9 A;  1JMC A;  1I3Q H;  2D62 A;  2DUD A;  2ZTC A;  4QIW E;  1EOV A;  1SRO A;  4IOC A;  1N33 Q;  1HH2 P;  3FKI H;  4HIK A;  2JJQ A;  2E5L Q;  5GAE C;  2KHI A;  3CCE A;  1KXL A;  4DV0 L;  4JI3 L;  1WCM H;  4GOP C;  4DR1 L;  5BR8 L;  2IY5 B;  1E24 A;  1OXV A;  1J6Q A;  3VDY A;  1V1Q A;  1Z9F A;  2D0O A;  4C3H H;  2VQE L;  3CCQ A;  1MKH A;  4IPG A;  1K83 H;  3L7Z C;  3HKZ E;  1PH3 A;  3HOZ G;  3H0G H;  2JEA I;  4IJL A;  2ZTE A;  2PQA A;  5FLM H;  4L5R C;  4B3M L;  4GOP A;  3S1R H;  4JI2 L;  1I94 L;  1N9W A;  4LUO A;  4NXN L;  1MJC A;  2UU9 L;  2UXC Q;  2N49 A;  3GTK H;  1IBL Q;  2K5H A;  5IP9 G;  5JJL A;  5GRO A;  2CFM A;  3RLF A;  1UE5 A;  4DV3 L;  1MJE A;  1BBW A;  3K81 C;  2E5L L;  2UUB L;  4P72 A;  1ASY A;  4EQ5 A;  4LF4 Q;  4A75 A;  3AFQ A;  4A3L H;  5M5X H;  4JI5 Q;  2C35 B;  2R7F A;  3IRB A;  2IT1 A;  3GDE A;  3GTJ H;  2ZM6 L;  3GO5 A;  3Q8D A;  4IPH A;  3RR5 A;  4DV5 Q;  4K0K L;  3EIV A;  1QZH A;  3DM3 A;  3K8A A;  1O7I A;  2AWO A;  2YTX A;  4A93 H;  1UE1 A;  4LF7 L;  2WB1 G;  2IX0 A;  5LMU Q;  2I0Q A;  3M4O H;  3S1Q H;  1S3O A;  1E7Z A;  1Z47 A;  2EQS A;  1PH7 A;  4UP8 A;  4A3B H;  1Y1W H;  4P71 A;  4GN3 B;  1TWC H;  1XPO A;  2HHH L;  3K80 C;  4BBS H;  4HJ5 A;  4OX9 L;  3FKI G;  2UXD L;  1M1K C;  2JA9 A;  3KDF A;  2UUC Q;  1K9M C;  3I4O A;  4AYB E;  3GTQ H;  4YWL A;  4JI3 Q;  2NN6 I;  2VW9 A;  1G6P A;  1WOC A;  2EIF A;  2NVY H;  5GAD C;  1BBU A;  1G51 A;  1QUQ A;  4BY1 H;  4JI7 Q;  4X66 L;  4JI1 Q;  4LF8 L;  1IZ6 A;  3OTO L;  4JBW A;  4LFA L;  3I4N G;  5K36 G;  3KYH C;  1J5E Q;  4LFC Q;  3CXC A;  1N32 L;  2K4K A;  1JB7 A;  1G29 1;  3ICE A;  3RZO H;  4JYA L;  1VQ7 A;  5IYD H;  2I5H A;  4QQB X;  4JBJ A;  2QEX A;  4UP9 A;  2BH8 A;  5H1S E;  4LF9 L;  1Q1B A;  2Q2H A;  2F52 A;  3CP0 A;  2H5X A;  3M85 A;  1PH8 A;  3JAM c;  3LGJ A;  2Y0S G;  4A3D G;  2CKZ B;  3CCL A;  3NEN A;  3ZJY C;  2R93 H;  1CKN B;  4MNO A;  4RMF A;  3TQY A;  4LNQ A;  1YJN A;  3PUW A;  3STB D;  4X65 L;  1HNW L;  3UDI A;  5M3F G;  1H95 A;  4GNX B;  3AFP A;  4DR1 Q;  5C4X H;  1SR3 A;  1A8V A;  3U4V A;  5JEA J;  2VQE Q;  1C7Y A;  2XTI A;  1X56 A;  1QVF A;  2A8V A;  4DV7 L;  2MNA A;  1PA6 A;  4DAY B;  1KRT A;  1W2B A;  2NZO A;  2KEN A;  3HOU H;  2LXJ A;  4OXP A;  5IWA Q;  4AQY L;  1A63 A;  1L2F A;  4O0A A;  3I4M H;  2VZA A;  1TXY A;  3FP9 A;  2ATW A;  2N3S A;  4QL5 A;  4AYB G;  1HNZ Q;  5IWA L;  3CCV A;  1NBW A;  3F8T A;  3RZD H;  4NB3 A;  2ID0 A;  2OQK A;  4NPS A;  1CKN A;  4LF8 Q;  5LMN Q;  4JI2 Q;  5IYB H;  2JK8 A;  1IL2 A;  4GS3 A;  3I7F A;  4JI0 L;  2WAQ E;  1Q1E A;  3HKS A;  4O2D A;  4A3M G;  1FJG Q;  2F4V L;  2JA8 H;  1UEB A;  5C0X G;  5HY6 A;  2UUA Q;  3CW2 C;  2B63 H;  2WB1 E;  2HIX A;  4DK6 C;  2AMC B;  1KHI A;  5C44 H;  2IX1 A;  1E22 A;  3CCU A;  2N78 A;  4A3F H;  3S1M H;  3JAM i;  4A3G H;  4OO1 I;  2Q2T A;  4GN5 A;  1XMO Q;  1YHB A;  4K0K Q;  1E3P A;  2GVA A;  4BA1 I;  5IYC G;  2R7D A;  2JA7 G;  5GAH C;  2UXB L;  1K8A C;  3J7Z C;  4YCW A;  2FXQ A;  1EUJ A;  1K0R A;  4B3R L;  1PYS B;  1D8L A;  1DGS A;  1YBY A;  3U50 C;  2YYZ A;  4AQY Q;  4HIM A;  4A3J G;  1XMQ Q;  1KIX A;  4KHP L;  3CCJ A;  1D7Q A;  4JI6 L;  1VQN A;  4X66 Q;  4HJ7 A;  4BXX G;  1WCM G;  1Q12 A;  3I2Z A;  3UDX A;  1SN8 A;  5C0X J;  4DV7 Q;  1YIJ A;  2ES2 A;  4B3S Q;  2UXC L;  1VQG A;  2AKW B;  3A5Z B;  1QZG A;  4DUY L;  1X9N A;  3GD7 A;  3M4P A;  4JBK A;  2R7Z H;  2XGT A;  1UE6 A;  1UE7 A;  1YVC A;  1IYJ B;  4QY7 A;  3HOX G;  1YIT A;  3ER0 A;  1X3F A;  2WP8 J;  3M4Q A;  2CCZ A;  3RN5 A;  1VQL A;  2OTL A;  5FLM G;  4JI4 L;  3CD6 A;  1VCI A;  4A3K G;  4R1J A;  2Z6K C;  4DR7 L;  4HID A;  1X54 A;  2A1A A;  2K5N A;  2ZJR A;  3PGZ A;  2DGY A;  4GKK Q;  1EQQ A;  1Q46 A;  2GN5 A;  4A3E H;  5AJ3 L;  2NVT H;  1B70 B;  5IP7 G;  4LF7 Q;  2RHS B;  3L0O A;  4A3L G;  1VQ6 A;  2K14 A;  4AH6 A;  1VQJ A;  1IBK Q;  1HJP A;  2KBN A;  4DR4 Q;  3T1H L;  3STB C;  4R4I A;  2K5V A;  1EIY B;  2Y0S E;  5EAY A;  3A74 A;  2OCE A;  1P16 A;  3W5O A;  3F2B A;  3G6E A;  4YCV A;  1JJC B;  4A93 G;  3D0F A;  3RLN A;  4JYA Q;  4QJF A;  1L1O A;  1YEZ A;  1ASZ A;  5C3E H;  1XMO L;  4WJ3 M;  1YJ9 A;  4DR2 L;  3ULP A;  2JA7 H;  4POF A;  1IBM Q;  3TS0 A;  1B8A A;  4BBR H;  5AJ3 Q;  1KRS A;  3KF6 A;  2AWN A;  2RCN A;  4GNX C;  4NXN Q;  4IPC A;  4TQU S;  3E0E A;  5C0X I;  4OX9 Q;  3M9B A;  1YNX A;  1SE8 A;  4R4O A;  3JC6 6;  1SLJ A;  4DR7 Q;  5M3M H;  3CME A;  1K73 C;  1N8R C;  1VQB A;  3L2P A;  1OTC A;  3F2C A;  1R9T H;  1VQ5 A;  1PH6 A;  2R92 G;  1TWH H;  3PUY A;  4BY1 G;  3KLW A;  1K8G A;  1HZ9 A;  1Q82 C;  3FHW A;  1SFO H;  4A3C G;  2HT1 A;  1VQD A;  4PMW A;  3PIP A;  1YJW A;  3H3V H;  4DR5 L;  1NJI C;  4A3I H;  4DAM A;  4A3K H;  1XNR L;  2QA4 A;  2ALY B;  4JI6 Q;  3H15 A;  4HIO A;  2MO1 A;  1KD1 C;  2PNH A;  2JA5 H;  3CCS A;  2D0P A;  2I5L X;  3HOY H;  4JI5 L;  2K52 A;  2YV5 A;  1VQM A;  4LFB L;  3OYY A;  3RN2 A;  1GM5 A;  1RL2 A;  4JI7 L;  3W1G A;  3F2D A;  2UU9 Q;  1X65 A;  4DR4 L;  1C9O A;  1IBL L;  4JC0 A;  2ZJQ A;  2JE6 I;  3PO3 H;  4DV3 Q;  1SRU A;  5M3F H;  1I50 H;  1X55 A;  2K75 A;  1CUK A;  1RIP A;  2YTV A;  1EWI A;  1V43 A;  2KHJ A;  3NEM A;  3HFZ B;  4PZ8 A;  3RLO A;  1N34 L;  4WJ4 A;  3S15 H;  1AE2 A;  1HZB A;  4IPD A;  5ELO A;  1L0W A;  3T1Y Q;  3ULL A;  4GN4 B;  4JOI A;  1HR0 L;  5GQO A;  5GAG C;  4DV0 Q;  3GTP H;  2EXD A;  4DPG A;  5BR8 Q;  2VY3 A;  5LMN W;  4A3D H;  1IBM L;  1JJG A;  3HKZ G;  4JBM A;  1BKB A;  3CCM A;  1GVP A;  2R6G A;  3S24 A;  1XPR A;  3GTG H;  3S2H H;  1OXS C;  1B7Y B;  1YI2 A;  5C4X G;  1OXU A;  5IY0 A;  2ZM6 Q;  5M5Y H;  4APV A;  1XTD A;  4IOA A;  1VQO A;  1VQH A;  4BY7 H;  1XMQ L;  1WI5 A;  4YHH L;  3EN2 A;  4LFC L;  3B6Y A;  3UE1 A;  4XIG S;  1J5E L;  4NXM Q;  3HOW H;  1AH9 A;  1PH2 A;  3TRE A;  2UUB Q;  1JJ2 A;  4C3I H;  1X3G A;  5JEA G;  1KAW A;  1EFW A;  3AYH B;  3J80 c;  2HQL A;  1LTL A;  3KF8 B;  1E1T A;  4YY3 L;  3KDF B;  3M3Y H;  1I94 Q;  2MO0 A;  1I5F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...