4GS3A

Dimeric structure of the n-terminal domain of prib protein from thermoanaerobacter tencongensis solved ab initio
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
98
structure length
90
Chain Sequence
ENNTVTLVGKVFTPLEFSHELYGEKFFNFILEVPRLSETKDYLPITISNRLFEGMNLEVGTRVKIEGQLRSYNRKLILTVFARDISVVPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Single-stranded DNA-binding protein
publication title Dimeric structure of the N-terminal domain of PriB protein from Thermoanaerobacter tengcongensis solved ab initio.
pubmed doi rcsb
source organism Thermoanaerobacter tengcongensis
total genus 14
structure length 90
sequence length 98
ec nomenclature
pdb deposition date 2012-08-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00436 SSB Single-strand binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4gs3A00
3S14H 4YWMA 3M4QA 1TWHH 4O2DA 1N36Q 3RLOA 3CCMA 3PO3H 4IPGA 4PZ7A 4DR3L 1SRUA 2HT1A 3E9IA 2PMZE 4A3MH 3UDIA 1EIYB 4JI4L 3IRBA 1IBLQ 1XNQL 1X55A 4JI0L 3HOYH 4AQYL 5AJ3Q 4JI5Q 2UU9L 1VQHA 1PH2A 2YU9H 1HNWL 4DV4L 3RLNA 1KXLA 1Q7YC 3GTMH 1Q12A 3L7ZC 4R4QA 5E7NA 1HZ9A 4DPGA 1K83H 3CMEA 1YJ9A 4C2MH 4JI7L 1BBWA 1OXUA 3ULLA 3Q8DA 3M4OH 4BA2I 1SROA 1OXVA 2H5XA 4OWWB 5GAEC 3K81C 1N34L 1PYBA 4DR3Q 4DAYB 4DV2L 1KRTA 2CCZA 3E0EA 1VQMA 4K0KL 5IP9G 4LF6L 3F2BA 2NZHA 4JI4Q 1YI2A 4OONA 1WJJA 5M3MH 2BA1A 5C0XJ 3L2PA 1NE3A 2VQFQ 4AQYQ 4JI0Q 3S15H 3K7AH 1B7YB 2MO1A 4BBRH 1UE5A 4OWTB 2VUMG 1EFWA 1HNWQ 1I5FA 5HY6A 4LFBQ 1CKOA 1Y14B 5DLQE 4A3KH 4APVA 4KHPQ 2IT1A 1SR3A 3HOUG 2BH8A 4A3DG 1YZ6A 1TWCH 2B63H 3S1QH 1VQCA 1M90C 3CMAA 4A76A 3NBHB 4X65L 5M5YH 2Q2IA 4DV2Q 1EWIA 3G4SA 1VQ4A 1NBWA 4IPCA 4LF6Q 1PH6A 1QUQB 1V9PA 3VDYA 2NVTH 1KAWA 1Q46A 4HJ8A 2WAQG 3OTOL 4DUYQ 2MFIA 3WWVA 4JBKA 4HIOA 4DK6C 4GOPB 1PH4A 1JJ2A 4DR4L 1N32Q 2R7DA 1E24A 3J81c 4GOPC 1NJIC 4A3GH 3UE0A 4A3LG 3K0XA 2R7ZG 1YJWA 1J6QA 3UE1A 3JAMi 1NMGA 4X64L 2RHQB 3J80i 1VS0A 4A3CH 3ULPA 2OCEA 2ALYB 4X65Q 4DR2L 1Z47A 1SLJA 4JI2L 1Q81C 5LMNL 5IWAL 1MIUA 1KD1C 4LF4Q 4DV1Q 2N8NA 3GTQH 3PUZA 1BBUA 2Z0SA 1BVSA 3OTOQ 4X62Q 1VQ5A 2I0QA 3HOVG 1D8LA 3I4NG 4C3HH 2JA8H 5IYCG 5JJIA 4HJ7A 2N78A 3HFZB 2YTYA 3CCVA 3T1YQ 4B3TL 4IO9A 4BY7G 2VQEL 1IXRA 1K3RA 2GN5A 3K7UC 1DGSA 1GD7A 4X64Q 4A3IH 2OWOA 2WAQE 4IOCA 1X65A 1E22A 1IBML 4QQBX 1WFQA 4A3DH 4DR2Q 4DV7L 5C0XI 2K4KA 4YHHL 4JI2Q 4DNIA 2V1CC 4UY8C 5IWAQ 4HIMA 2HQLA 1TWAH 2NN6G 2XGTA 4AH6A 4JBJA 4DV6Q 1K9MC 2NVXH 1WOCA 3I2ZA 1WCMG 3ZJYC 3GO5A 5C0XG 4L5QA 4LF5L 4DR6L 4MZ9A 4IPHA 2UXCL 2I5HA 2IX0A 4DV3L 1CKNB 4HJ5A 1HR0L 4B3TQ 4JI6Q 4J15A 4LUZA 4NPSA 3PF4A 1L1OB 1XNRL 1PH9A 4QY7A 1IBMQ 1L1OC 5H1SE 3F2DA 1Z9FA 1E7ZA 1YNXA 3S24A 2AWNA 5C44H 3A5UA 3U58A 4GOPA 3AEVA 2JA9A 3CD6A 3HKZG 4FDBA 4QGUA 1GKHA 3MEFA 1OTCA 3GTPH 4PZ8A 1PHJA 4DR6Q 2UXCQ 4A3FG 3RR5A 1LM0A 3CXCA 4DV3Q 1HR0Q 4A3BG 4XIGS 1C0AA 3CPWA 2WP8J 5FJ8H 1KRSA 3I4NH 2IHFA 3ULJA 2CFMA 5IYCH 4DR1L 3S2HH 1RL2A 1V43A 3GTGH 3AYHB 2KBNA 2HHHQ 1X56A 1QZGA 4P72A 4B3SQ 1CSPA 1E1OA 4BXXH 4DKAC 3PGZA 3DLLA 4GLAC 4Y52H 3KDFA 3T1HL 3EBEA 3HOZG 1FVIA 5C3EG 1AH9A 1Q1BA 2LXKA 4TVAB 4LFCL 3PIPA 3U50C 2OTLA 2R7FA 2UXBQ 4POGA 1UEBA 3EIVA 2K75A 1YHBA 2Z6KC 3UDFA 4HJ9A 3W1BA 1WCMH 4JOIC 1P8LA 3S1MH 1IL2A 1HZAA 4DAMA 3HKZE 4OO1G 4UPAA 1AE3A 1X9NA 3KYHC 1ASYA 1N9WA 4MNOA 5IE8A 1I3QH 3OW2A 3T1HQ 4IOAA 5GROA 4LUVA 1IBKL 4A93G 2RHSB 1S40A 4NB3A 1S72A 4QJFA 4LFCQ 4DV0L 3KF6B 1W3SA 4IJHA 3UDGA 5IP7G 1VQBA 1CKNA 1CSQA 3JC66 4OX9L 5JJKA 1VQGA 2PNHA 5M3FH 1YHAA 1L1OA 1G291 1YHQA 4HJAA 4P74A 2A19A 4GLXA 1XNQQ 1FL0A 4BY1H 3I4MH 1PYSB 3BU2A 2ZM6L 4UP9A 4A3FH 2UU9Q 3PCOB 2AHOB 3H0GG 4PMWA 4A3JG 3M85A 4L5SA 4A3BH 3UDXA 5FLMG 4DV4Q 2VW9A 4P71A 2CKZB 1A8VA 2IHEA 4JV5L 3TREA 4JI7Q 3CW2C 1IBKQ 1PV4A 4DV0Q 1JJGA 1N34Q 4A4IA 2E5LL 1Y1WG 2WFWA 4LFAL 4OX9Q 5C3EH 4K0KQ 3CCEA 1VQ8A 1HJPA 3GTLH 1WYDA 3G6EA 1KC8C 3CCRA 3S16H 3M4PA 4GKKL 4HIDA 2ID0A 1PH3A 2UUBL 1Y1VG 2VNUD 2CWPA 3CF5A 3BZCA 2F3IA 1EQQA 3F2CA 3AFQA 1QVCA 4IFDJ 3U4ZA 2Z6KA 3PUVA 3CC7A 2E5LQ 4JOIA 3S1NH 4X66L 3TRZA 3RN2A 2KCMA 1A0IA 3I7FA 1I6HH 3STBD 5BR8L 2ZTCA 3E9HA 4LWCA 4OXPA 5IYDG 5IP9H 3KDFB 2L15A 2UUAL 3GTKH 1QVFA 4DR4Q 4GKKQ 4DK3C 2AWOA 2E2HH 1CKMA 4ALPA 1LTLA 2QEXA 1VQAA 1Q82C 3JAMc 1N8RC 2D0PA 5JEAJ 3J81j 3KF6A 2JA7G 2VUMH 3RNUA 3J80c 4TQUS 1VQKA 1KL9A 3A74A 3GTOH 1OXXK 4RMFA 1UWVA 2NN6I 1SN8A 3HOUH 3KOJA 3GDEA 1VQNA 2RF4A 5GAHC 2WB1E 5LMNQ 1K0RA 2VY3A 3PF5A 2YTVA 2N49A 4BA1I 3M9BA 1EOVA 2ZTEA 3DM3A 2R93G 2B29A 2UUAQ 1VQIA 3ERSX 1PH7A 1PH5A 3CP0A 1FGUA 4R1JA 1QZHA 1ASZA 1EUJA 5ELOA 1VQOA 1TWGH 2JE6I 1HZBA 2VQEQ 4BBSG 2KENA 1UE6A 2R6GA 3CAMA 2Q2UA 2PQAB 3CCUA 1XPOA 2D62A 4JI3L 3RLFA 1J5EL 4POFA 1XMOL 1VQFA 1VQLA 2R7ZH 4DR7L 4A3LH 1PFSA 5J3BA 1A63A 1IZ6A 4DV7Q 2FXQA 1BKBA 2PI2E 4YHHQ 4LF8L 2ZJQA 1Q1EA 1N33L 3J7A5 1YEZA 2F4VL 4LW1A 3K80C 2VS1A 4JI8L 1M1KC 3PO3G 3KF8B 3TS2A 1RIPA 3K8AA 4NXNL 4A3MG 3U4VA 1TWFH 4AYBG 1U5KA 2BA0A 3F1ZA 1VQPA 1KIXA 4LF5Q 4JC0A 1JJCB 3CPFA 1G6PA 2NZOA 3HOVH 2AMCB 4IFDI 4JYAL 1VQDA 4C3JH 4QL5A 4GKJL 2OQ0A 4JCVE 1XNRQ 1XJVA 3I56A 4YCVA 2Y0SG 4GLVB 1XMOQ 2EQSA 5JJLA 2ZTDA 1TXYA 1L2FA 1HNZL 1AE2A 2MNAA 1N33Q 3HOWG 3W5OA 4LF8Q 4IFDG 3PUWA 1XMQL 1WI5A 3PUYA 4DR5L 1K8GA 1GVPA 4A3EG 1O7IA 3I4OA 2JEAI 3GTJH 4P75A 2ES2A 1GM5A 4OO1I 3GD7A 2A1AA 1X6OA 2LXJA 3TQYA 1N36L 1VQ6A 5M3MG 1MJCA 1PVOA 3G48A 3CC2A 2R93H 4BBRG 4JYAQ 2HIXA 2EXDA 2JJQA 4YWLA 3STBC 4DR1Q 2KHIA 3D0FA 3PIOA 4L5TA 3NENA 5AJ3L 3TS0A 3D31A 4A3KG 3BZKA 5JEAG 3FKIG 1HR0W 4LUOA 2GVBA 3HKSA 4AYBE 1KQSA 1HNZQ 1HH2P 5IYBG 2XTIA 2B63G 3J7ZC 3M7NA 3S17H 4DR5Q 1B8AA 4NXML 1W2BA 3F8TA 4EQ5A 2E8GA 4IPDA 1MJEA 2PI2A 4GN5A 4A75A 4B3ML 3H3VI 2MQHA 3A5ZB 2Y0SE 1SFOH 3TEHB 1UE7A 3PO2G 4R4CA 4UP8A 5C4XG 2PQAA 1NMFA 2Q2HA 2ASBA 3W1GA 2JQOA 2I5MX 4XTCS 4LF7L 5HGQA 1X3FA 5FLXc 2VQFL 4GN3B 1VCIA 1YVCA 1HNXL 4A3GG 2IY5B 3PV0A 4KLKA 4LFBL 1NY4A 1XPUA 1U0LA 3KFUA 4A3CG 4PG3A 4KHPL 3MXNB 4NXMQ 3RZOH 3HOWH 4B3MQ 3FP9A 1VQ9A 1X3GA 1OXSC 4GS3A 4A3EH 3HOZH 1MKHA 4YCUA 4JG2A 2ZM6Q 4LF7Q 1E3PA 2NVYH 2JA8G 4HIKA 1S3OA 1CUKA 1PH1A 4KI0A 1P16A 1HNXQ 5K36G 2VL6A 4DUYL 1N32L 2WB1G 1JT8A 2I5LX 4A3IG 4JV5Q 3J81i 1EQRA 3FKIH 4UP7A 3KJOA 1K8AC 4B3RL 4WJ3M 1I50H 4LNQA 5IYBH 4YCWA 4DV5L 2OQKA 1YJNA 1JMCA 2K14A 4LFAQ 4X6AH 2YV5A 4A93H 4YY3L 2AKWB 2ZJRA 1D7QA 5IP7H 4GNXB 2F52A 1C7YA 3G71A 4LF4L 4DV1L 5EAYA 5M5XH 4GNXC 3PO2H 1SE8A 4O0AA 5C4XH 4X62L 2A8VA 3B6YA 2UUBQ 1XPRA 3H3VH 2D0OA 3KLWA 3H0GH 4A3JH 3PUXA 3T1YL 3CCJA 4B3RQ 2JK8A 2YTXA 4IJLA 3CCQA 5FLMH 2Q2TA 2JA5G 4L5RC 2VZAA 4DV5Q 4WJ4A 4X66Q 4YWKA 5C44G 3S2DH 4YY3Q 3CCSA 1C9OA 5IT9c 1IYJB 2K52A 4AIMA 2K5VA 4RG1A 4ME3A 5BR8Q 1Y1WH 2UUCL 1UE1A 3CC4A 1JE5A 4OWXB 1YBYA 2CQOA 3CCLA 3FHWA 4GN4B 1YIJA 2EIFA 1V1QA 2KCTA 2NVQH 4DV6L 3AFPA 5FJ8G 5IY0A 3HOXG 2MO0A 4EX5A 2JA6G 2RCNA 3ER0A 4Y7NH 4JI6L 1Y1VH 4JBMA 4JI1L 2KHJA 2IX1A 4LF9L 2K5NA 3EN2A 2R92G 3BJUA 4BXXG 2N3SA 3L0OA 1L0WA 1E1TA 3PSIA 4C3IH 3I55A 1YITA 1K73C 4DUZL 1Q8KA 3A0JA 4R4OA 1SMXA 2UUCQ 2ZJPA 2DUDA 2B3GA 2K50A 2K5HA 1G51A 2QGQA 3OYYA 5GADC 1X3EA 5LMUL 1LYLA 4KHZA 4H02A 3HOYG 5LMNW 3NELA 2OTJA 3KJPA 1EIFA 4PZ6A 5IYDH 1OXTA 3M3YH 4JI1Q 4LF9Q 1GO3E 2C35B 1KHIA 1J5EQ 4JI3Q 1FJGL 4DR7Q 2JA7H 3AQQA 5M5WH 2HHHL 4GNXA 2JA5H 1JB7A 4P73A 4DUZQ 1EYGA 4B3SL 2UXDL 1QUQA 1VQJA 2F4VQ 2DGYA 2LSSA 4JBWA 4JI8Q 1I94L 2E2JH 1B70B 2GVAA 3LGJA 5M3FG 3H15A 2ATWA 1NTGA 2JEBI 5LMUQ 1Q86C 1QVGA 4NXNQ 3ICEA 1XTDA 3I4MG 2QA4A 5GQOA 2UXBL 4BY1G 1PH8A 1R9TH 1LUZA 1PA6A 1VQEA 2E2IH 1HZCA 5GAGC 2CWAA 1VQ7A 1H95A 3RZDH 1IBLL 4GKJQ 4R4TA 5ELNA 1A62A 4JI5L 3HOXH 1FJGQ 5C4JH 2JA6H 3S1RH 3RN5A 2HIVA 1T9HA 4R4IA 4BBSH 3CQZH 2YYZA 4MTNA 2UXDQ 3SGIA 4QIWE 1XMQQ 2R92H 3NEMA 1X54A 1I94Q 2BH2A 4BY7H
chains in the Genus database with same CATH superfamily
4G4KA 3S14H 1MI2A 3D3RA 2MPMA 1N36Q 1JOKA 3RLOA 4IPGA 1I6VC 1EEID 3S15B 2A6EC 2K05A 4BBRB 5BN5A 1IL8A 4A3MH 4RFBA 4Z9CB 5AJ3Q 1G6ZA 2UU9L 3NSWA 3X3MA 1PH2A 2YU9H 2XRQD 1LTAD 1Q7YC 5E7NA 3MHBA 4DPGA 1BBWA 3Q8DA 4Q0FA 5ELCA 2R61A 1HTLD 4XYOA 5E1FA 3VYTA 1PYBA 3DXJC 4DV2L 1SJHD 3VR3A 3KK7A 1CA5A 3F2BA 5KYIA 4OONA 5L37A 1B7YB 1I5FA 4XDXA 1CKOA 5JEAH 2IT1A 3HOUG 2CW0D 2B63H 1TWCH 1VQCA 1F9RA 1M90C 3CMAA 4A76A 1DONA 4X65L 5M5YH 2Q2IA 1VQ4A 2HQEA 1U4MA 4LF6Q 1HPCA 1PH6A 2NVTH 3VDYA 3JAML 1KAWA 4HJ8A 3UI2A 2IWHA 3WWVA 2A69D 4GOPB 3G7LA 4RHRA 1S5CD 1D6EC 2R7ZG 4A3DB 3UE1A 2DN8A 2QW7A 2B2YA 4KKSA 2RHQB 1TY2A 1KLGD 3NWSA 1FNVA 1CT1D 1Z47A 4GZYC 5KEEA 4JI2L 4LF4Q 4DV1Q 3S9WA 3PIO3 3PUZA 5DM63 2Z0SA 3TP6A 4DXGA 2HD3A 2JA8H 2CH4W 5JJIA 4HJ7A 2YTYA 3CCVA 4IO9A 1PTOH 3TDQA 4HCEA 4CKCA 1IXRA 1E2WA 1QILA 1GD7A 2OWOA 4IOCA 4QQBX 1STAA 1WFQA 4DR2Q 1R4PB 2PZTA 2HQLA 4V190 1HA6A 2XGTA 2NVXH 4JVZA 2B2WC 3W2DA 4DR6L 3DEPA 4J15A 3PF4A 1L1OB 4CDDC 1XNRL 1PH9A 2QDBA 1WTHA 4PMCA 2F0TA 1IBMQ 1EU3A 3F2DA 1ET9A 4X3KA 1E7ZA 2AWNA 5C44H 3A5UA 3AEVA 3BDOA 2CW0C 4CDFC 3CD6A 2BCOA 1F9PA 1GKHA 1O78A 2NUCA 1OTCA 3RD4A 3CXCA 1HR0Q 4A3BG 1C0AA 4UDUC 3BYTB 4DR1L 2P5ZX 3QG1A 3BVMA 5C3WA 3GTGH 3OMCA 4KY6A 2A69C 3R3OA 1X56A 4GLAC 5C3EG 4TVAB 1RKNA 2UXBQ 4PMBA 4A3FB 3K59A 2NN6H 1GUTA 3EFXD 3W1BA 1QCBD 1P8LA 3S1MH 1IL2A 1GUOA 1LT6D 4RGNA 4TRDA 2LMCB 1SYCA 3C46A 3TSSA 2RHSB 3BDCA 1I4HA 3KF6B 4IJHA 2I07B 1VQBA 2RVLA 4OX9L 3AU7A 1YHAA 5FO7B 5DNFA 1YHQA 1G291 3KLSX 4BS9A 1XNQQ 1FL0A 3SK4A 2AQ3B 3BU2A 5I4DA 5T1IA 4UP9A 1HFGA 4XQQA 3H0GG 4PMWA 4L5SA 3I3CA 5FLMG 2VW9A 4P71A 2CKZB 1F2MA 3CW2C 1SNPA 4DV0Q 2R3ZA 1I6HB 2KVMA 1N34Q 4K0KQ 2CHBD 5E4WC 1VQ8A 3GTKB 1HRJA 3GTLH 2E2HB 2B2VA 3I90A 4LMQD 4DK0A 3S16H 3T16A 3M4PA 2ID0A 2UUBL 1Y1VG 2CWPA 4LAAA 3CF5A 1EQQA 3L3OC 4C3IG 1PDQA 5EPKA 3U4ZA 3PUVA 2M2LA 1ENCA 3SEBA 3CC7A 2E5LQ 3S1NH 5FLXE 5EQ0A 3VR2A 3I7FA 2QKIC 2PQEA 3E9HA 2RDHA 1SYGA 3KDFB 3SVMA 2PO4A 4CDCC 4J1MA 4DR4Q 2MGSA 2AWOA 2QEXA 3JAMc 1N8RC 2JA7G 1CZWA 3I70A 2F0UA 3SE0A 1EZ6A 3GTOH 1K0SA 1OXXK 3HOUH 3QJYA 1EY6A 3KOJA 3GDEA 1TWFB 3I4LA 3M9BA 1EOVA 1TU2B 1F9QA 1PH7A 1PH5A 3D4DA 1ASZA 1AN8A 2IW3A 5KNBA 2VQEQ 2F0NA 1D1KA 3HG9A 2PQAB 1VQLA 2D62A 4NKLA 2R7ZH 2XNAC 5CV4A 1RJTA 4YHHQ 2PI2E 1Q1EA 2F4VL 1E2VA 3X3NA 3PO3G 2VS1A 3C2PA 1EY0A 5EJWA 3U4VA 4AYBG 1U5KA 4LF5Q 1JJCB 1G6PA 4IFDI 2LKVA 1RCVD 1BCPD 3S17B 1BF4A 2Y0SG 1HNZL 4IFDG 3W5OA 2DNCA 2F03A 1SFOB 4DR5L 4A3EG 2F0WA 1SYFA 1D2BA 3RMHA 1CA6A 3GD7A 2A1AA 1K8MA 1MJCA 1PTOD 4IN3A 3CC2A 4BBRG 3VYSA 5JPMC 3H09A 3OIQA 3BZKA 4X3TA 3FKIG 3H91A 4NP5A 1HR0W 4AYBE 3HOWB 1KQSA 2HCCA 2XTIA 1B8AA 3F8TA 4EQ5A 1MJEA 2PI2A 4GN5A 2K33A 2MQHA 3A5ZB 5IGCA 2Y0SE 3TEHB 2PCFB 4UP8A 1QOHA 2K5QA 4IUNA 3URYA 2XWJB 1TT2A 2BDOA 2I5MX 3DM1A 1I4RA 5COYA 2VQFL 4GN3B 4XQJA 4KLKA 2RA4A 4HAEA 1D1IA 3KF8A 1XPUA 4A3CG 4WJWA 3ONAB 5KNDA 4KHPL 4A93B 4QUFA 3RZOH 3K5LA 2PNRC 4B3MQ 4ID6A 4KMUC 1X3GA 1VQ9A 1OXSC 1AZPA 2ZM6Q 1E3PA 2NVYH 4HIKA 1S3OA 1CUKA 2B39A 4KI0A 4A3JB 4DUYL 4WORA 1N32L 3MZ5A 2JXMB 4JV5Q 1ENFA 2F0VA 3NE5B 4I7AA 3KJOA 1SSOA 2E76C 4LNQA 1BCPC 1SEBD 5IYBH 2Z6BA 1II3A 4DV5L 2OQKA 1Y1WB 1JMCA 4LFAQ 2L4NA 1BUVT 1CK1A 2YV5A 3KUPA 1I4GA 3NTHA 3NXWA 4YY3L 2AKWB 4QUCA 4GNXB 4C3HB 1TS2A 3PO2H 1QJOA 1TS4A 1SE8A 3B6YA 2LFNA 2WB1B 3H3VH 3H0GH 1PTOC 4B3RQ 5FLMH 2JA5G 4L5RC 3OSOA 4KKTA 4X66Q 1QWYA 3GV6A 4F8MA 3VYRA 5IT9c 4AIMA 4RG1A 2UUCL 4HEDA 1JE5A 4OWXB 1YBYA 2CQOA 3FHWA 5JAVA 1SYBA 1KNEA 1PRTB 3HOXG 4MIUA 2JA6G 4XXEA 2RCNA 4JI6L 5M5WB 1Y1VH 4JBMA 2KHJA 2IX1A 3EN2A 2R92G 2N3SA 4ZQ3A 4K8IA 4C3IH 3I55A 2F1MA 1RD9D 1HUMA 1R9TB 2E2IB 2QGQA 4N8FA 1G51A 1X3EA 5LMUL 4JK1C 1LYLA 3OWFA 1JC7A 4V0BA 4K2LA 2RCFA 1LTTD 4BBSB 2EYJA 4JI1Q 1ONLA 4IUQA 2JA7H 3U9OA 1JB7A 3R8BA 4DUZQ 1TWHB 2UXDL 3PQIA 1EY7A 1HA5A 5I6WA 2E2JH 1U4LA 1B70B 2GVAA 3E6ZX 4NXNQ 1Q86C 3JAME 1HXYD 5GQOA 1PH8A 4QIWB 3P20A 5IGDA 2M00A 2CWAA 1VQ7A 4XQNA 5TSSA 4R4TA 1IKMA 3F2UA 5AFWA 3M4OB 2H4OA 2Q8RE 5KNCA 2KCNA 3M7GA 3M4QA 3CHBD 3PO3H 4DR3L 1WTXA 1I4PA 1ML0D 1EEFD 3KBGA 1ZYRD 3L9AX 2B2YC 4JI4L 1IBLQ 3A7LA 3ITPA 1X55A 3HOYH 4AQYL 4JI5Q 1I4XA 4DXFA 1B53A 3TMEA 1ESRA 5IIFA 3N6RA 3GTMH 1HFNA 5KGUA 2BE5D 1YJ9A 2FHTA 4JI7L 1K83H 4BA2I 2KCCA 4C2MH 4G7OC 4C1NI 5GAEC 4UHVA 4ZUIA 3SK6A 4DAYB 2CCZA 3E0EA 1VQMA 5IP9G 2NZHA 4NMZA 1TS5A 4MHEA 1YI2A 4A3GB 3S15H 4BBRH 1UE5A 2MJ8A 5HY6A 5CV9A 5IODA 1H9RA 1MHWC 3H94A 1K28A 2V4DA 1UEAB 3NBHB 4DV2Q 1EWIA 2B2UA 4IPCA 1CQVA 5E4XA 3DUZA 1F9SA 5FO8B 5JVG3 1V9PA 1ESFA 1Q46A 2A68D 3V05A 4JBKA 1UUPA 1JJ2A 2L9HA 3J7AF 1NJIC 2EYMA 2L5TA 3UE0A 1J6QA 3JAMi 1ILPA 4X64L 4A3CH 1H9SA 2ALYB 3EA6A 1F2LA 4X65Q 1TWAB 1SLJA 1JWSD 3A54A 5IWAL 2N8NA 1CZGA 1BBUA 2WAQB 2I0QA 4X62Q 1BO0A 3NUCA 1ZYRC 2K1BA 4G7HC 2RKSA 3TP7A 1DGSA 1SYDA 2F0FA 1X65A 4A3DH 4CJ1B 4DV7L 3FMCA 3MC0B 4JI2Q 1KNAA 4DNIA 1OO9B 2V1CC 4UY8C 2NB0A 3HS0C 3GTPB 2BE5C 4HIMA 1BXTA 2NN6G 4AH6A 1K9MC 4JBJA 4DV6Q 3I4NB 2A6HD 2IX3A 3I2ZA 3Q24A 4L5QA 1VMPA 5CORA 4IPHA 2O5JC 2I5HA 4DV3L 1CKNB 3A7AB 2AQ1B 5H1SE 4HR7B 1Z9FA 3U58A 4WRDA 3NTIA 1WCMB 4DR6Q 4H13C 3K5MA 4XIGS 1TR5A 3CPWA 2WP8J 3ULJA 2CFMA 1RL2A 4IUVA 2SNMA 2A68C 2QDLA 3AYHB 3DWAA 2HHHQ 3AB9A 1E1OA 2B2VC 4DKAC 3DLLA 3KDFA 4FNFA 3T1HL 2LXKA 3VYUA 1AEXA 3I4MB 1MGSA 1BOSA 2X6LA 5FK9C 4KTAA 4POGA 5DM73 2PZUA 2EY1A 3R2TA 4HJ9A 4OO1G 1AE3A 4ODGA 1N9WA 4MNOA 5IE8A 1RTNA 1KDAA 1EIGA 3MFYA 4A93G 3WOFA 1S40A 1WD0A 4NB3A 1S72A 4QJFA 3SK5A 4XT1B 3Q23A 4X3SA 1CSQA 1VQGA 2PNHA 4OGQC 3T13A 1FNWA 4FXDA 4P74A 2A19A 4L6TB 1HUNA 4K6DA 3BG3A 4A3FH 5IGEA 2AHOB 4A3JG 1DOKA 3M85A 3NP8A 1EQTA 2A6HC 1ZEQX 4O1NA 4DV4Q 5LL6X 2CVRA 1A8VA 2IHEA 3HRZC 3TREA 3QOLA 3VR6A 1SMYD 4A4IA 1Y1WG 4OX9Q 4R9WA 2F0SA 4XYQA 3CCEA 1L0YB 3FPPA 1DM0B 1NUCA 4C1NK 3CCRA 3H3VC 4GKKL 4HIDA 2EVBA 2F3IA 1EWCA 1F2ZA 3AFQA 5ELFA 2Z6KA 4DU9A 4JOIA 2FINB 5I9OA 1RODA 2KCMA 3NTKA 3N52A 4HCSA 4ZUJA 1I6HH 3STBD 5G3LD 5IP9H 1DZ1A 4Y7NB 4FF3A 3GTKH 4OIJA 4DK3C 2E2HH 2L1BA 1Y8OB 3KBXA 3J81j 3QWNA 1ICFB 3I8ZA 1KL9A 3A74A 3A8JE 2PZWA 2RF4A 2WB1E 3SR1A 5LMNQ 2N49A 2JP1A 1YNJD 2ZTEA 4CDEC 3DM3A 2B29A 5FKAC 1JB3A 4FO2A 2K5WA 2MUYA 4H7BA 1GHJA 1VQOA 4HSPA 2JE6I 2QEJC 1HZBA 5C6AA 4BBSG 2R6GA 3CAMA 5T1GA 3CCUA 1XPOA 1J5EL 4DR7L 3Q22A 1BKBA 1BQQT 2LS01 4ZYSA 2I46A 1C8CA 2K01A 1CFMA 2R93B 3K8AA 5EBDA 1SNCA 4KHVA 1TWFH 1KIXA 3F1ZA 1VDZA 3NPPA 5I6YA 1YNND 3CPFA 1DCZA 1LTRD 4GKJL 4RGMA 4I7ZC 1XJVA 5JJLA 2ZTDA 1TXYA 1L2FA 2SNSA 2G9DA 2F3VA 3ND8A 1WI5A 1XMQL 3HKZB 2N88A 5D14A 3GTJH 4P75A 2ES2A 1GM5A 1JR0D 1X6OA 2LXJA 1N36L 1VQ6A 1I4QA 1KDCA 3BYYB 1EYCA 1WTRA 2HIXA 2JJQA 4YWLA 3STBC 3MA2B 1D5MC 5AJ3L 4A3KG 2F0LA 4N8X1 2EPBA 4DNRB 1HNZQ 1HCZA 1B50A 1PZJD 5IYBG 3S17H 4DR5Q 3HOZB 4NXML 3H3VI 1SFOH 5C5MA 3PO2G 2RQXA 5BN4A 1NMFA 2Q2HA 4LF7L 5HGQA 1HNXL 1YVCA 1YNJC 4A3GG 1B9MA 5J1ZA 1VF7A 1I50B 4CJ0B 1U0LA 3KFUA 1K3BC 5M5YB 1EY8A 1TY0A 1CTMA 3HOWH 3ERQA 2RSNA 3FP9A 1F2YA 2N55A 1HQMC 1IKLA 5A35A 1Z6HA 4JG2A 5C4XB 3BS1A 2F0MA 4ZRZA 5K36G 1LT3D 1PH1A 1JICA 1YNNC 2I5LX 2HCIA 4OO1H 1E0BA 4WJ3M 3S2DB 1IW7D 5IT9L 1SE4A 1GUNA 1YJNA 4A93H 2ZJRA 2NVQB 5EGTA 2JA8B 4LF4L 3HZXA 4DV1L 4O0AA 4WFN3 2KA7A 5CV7A 2A8VA 5EPLA 2F0PA 1D5XC 1TKWB 4A3JH 3PUXA 3C1EA 4OELB 3CCQA 5E3FA 2Q2TA 4DV5Q 4CKBA 4WJ4A 5D3IB 3R2IA 3D4RA 4YY3Q 1PYWD 1VMCA 1C9OA 3VR5A 5BR8Q 3K6OA 1Y1WH 3CC4A 3CCLA 1UNSA 1YIJA 2F0OA 5NUCA 1LT4D 3KLSA 3BDLA 1LO5D 3AFPA 3M3YB 3MXNA 2SEBD 4EX5A 1KDBA 2DJFC 3ER0A 4K8JA 4RCNA 4RWSC 2X69A 4LF9L 4BXXG 2F0IA 3L0OA 5C44B 2J7ZA 1YITA 3A0JA 3TN2A 3NQIA 3TZUA 2UUCQ 3IFTA 2B3GA 5GADC 3BVGA 3OYYA 5KRUA 1SE3A 2IPKD 3HOYG 5LMNW 3NELA 2OT2A 2OTJA 2E75C 4PZ6A 5CMDA 2QCPX 2K04A 1WD1A 3CQZB 2DY7A 3NBHA 4OIKA 4RAUC 1GO3E 4EGVA 1X3QA 4JI3Q 1FJGL 3AQQA 5M5WH 4BY7B 4DFAA 1TS3A 1EYGA 4RCOA 3T4AC 1VQJA 1O7YA 2LSSA 1S4ZA 4JI8Q 5A2QL 4R8NA 1IW7C 5CV8A 5M3FG 3ICEA 1NTGA 5LMUQ 1QVGA 3GQBA 3I4MG 2UXBL 1R9TH 1LUZA 1PA6A 2E2IH 5GAGC 1SXTA 2FMMA 1H95A 1SAPA 5HURA 1HHVA 4RGOS 5ELNA 3VR4A 2AQ2B 2B2UC 4R4IA 2XN9C 4BBSH 2YYZA 3J7YW 2UXDQ 1C48A 3NEMA 3DWQA 1CHPD 2QILA 5ELEA 3MWYW 4YWMA 1AP0A 1TWHH 4O2DA 1EYAA 3CCMA 5M3MB 1SRUA 2HT1A 3E9IA 3K7AB 2BOSA 3UDIA 4KN4C 1XNQL 4JI0L 2Q8TA 1XYIA 1Q90A 2QF7A 1VQHA 1HNWL 3S1QB 2VB2X 3O13A 3RLNA 2KEDA 1KXLA 1C4QA 4R4QA 3CMEA 3M4OH 4OWWB 1CHQD 1OXVA 2H5XA 2M9VA 1N34L 4FP5D 4DR3Q 5EPJA 1KRTA 1GUSA 4K0KL 2NYZD 5JPNC 4IZ8A 3WDNA 3BZDB 4JI4Q 2XIWA 1WJJA 5C0XJ 3L2PA 3SHLA 4AQYQ 2MO1A 2HDLA 1EFWA 4LFBQ 2PW7A 1EZ8A 1Y14B 4A3KH 3QOJA 4A3DG 2BH8A 3I91A 1YZ6A 2FMCA 3GTQB 2EYFA 1SYEA 1NBWA 2EDGA 3U9SA 2EXZA 1LTID 3OOCA 3OTOL 1PFMA 1Y8NB 2MFIA 4HIOA 3J80L 1PH4A 4DR4L 1QB5D 5F2DA 1E2ZA 1E24A 1EFID 3J81c 2Z4HA 4A3IB 4A3GH 4IQZA 4RHSA 3K0XA 1YJWA 1STHA 1NMGA 4KKUA 2L11A 3KLRA 1VS0A 4ILWA 2OCEA 2JSOA 2RSOA 3DWPA 5D65A 3EVQA 4N9PA 1MIUA 1KD1C 2L12A 3K5OA 2WKCA 2X6GA 4ULLA 1L0XB 1D8LA 3IFDA 3VA7A 3NQTA 5ELBA 5K36H 2N78A 3HFZB 3NWTA 3SK8A 3T56B 3T1YQ 4ZLTF 4B3TL 3D6WA 2MHVA 1GHKA 4RKLA 2F0JA 2VQEL 1K3RA 2GN5A 4X64Q 1RHPA 4M8AA 4CBVA 1E22A 1A6XA 4YHHL 1ZXTA 2F0DA 1JCKB 5IWAQ 2FJ2A 4KY7A 4FF4A 1TWAH 1WOCA 3ZJYC 2EYHA 3GO5A 3S2HB 4LF5L 2UXCL 4MZ9A 4DA2A 4HJ5A 4DAPA 4LUZA 4NPSA 2H1EA 2IL8A 5CR3A 3MFGA 1G2SA 3SDZA 2BDNA 4JW0A 3S24A 4PNYA 4GOPA 2JA9A 3HKZG 4FDBA 1KTKA 5C4HA 4QGUA 2RBMA 1BCPF 3MEFA 4S3SA 3GTPH 1PHJA 2WV6D 4A3FG 1LM0A 1PMRA 4DV3Q 3I4NH 1KRSA 2IHFA 2MP1A 5KYLA 5IYCH 1V43A 1I3QB 3A56A 4B9WA 2AUKA 2PMZB 1QZGA 4P72A 4B3SQ 1CSPA 2G5DA 4BXXH 3PGZA 4R8IA 2TMPA 3HOZG 5ELDA 1PTOF 1AH9A 3PIPA 4KV6A 1TIID 4LFCL 1SDFA 4BY1B 1DOLA 2EY2A 5FLXL 2O4XA 3EIVA 2RDGA 1YHBA 3QIAA 4A3BB 4K5XA 2Z6KC 4TSSA 1SNDA 1PZID 1WCMH 4JOIC 5C0XH 4ZKCB 1B3AA 1HZAA 3HKZE 1DOMA 4FXKC 4UPAA 1X9NA 1QNUA 4KY5A 3T1HQ 4IOAA 5GROA 5C3EB 4LUVA 1IBKL 2F0QA 5IP7G 4OEMB 3JC66 5M3FH 2CH4A 4ZKBB 1L1OA 4B08A 4IUUA 4GLXA 2B8FA 1PRTD 3I4MH 1PYSB 2ZM6L 2UU9Q 3OHXC 1D5ZC 3OPOA 5C4ZA 5EKIA 3HGBA 4JV5L 3CKIB 2G9HD 3LWUA 2WFWA 4LFAL 1LT5D 4HN7A 1HJPA 1WYDA 2F3WA 2NTTA 2VUMB 2EY5A 1PH3A 2KJXA 1PXUA 3BZCA 3F2CA 1QVCA 1XX8A 4KD3A 3D6CA 4FVMA 4X66L 1AZQA 3RN2A 1SNOA 4IURA 3K5NA 1A0IA 4EQOA 2ZTCA 1H9JA 2F0HA 4LWCA 4OXPA 3TP5A 5IYDG 2UUAL 1TWGB 4GKKQ 1CKMA 4ALPA 2D0PA 1U4PA 5JEAJ 3KF6A 2XSCA 4C3IB 2XWBB 3RNUA 5K5PA 3J80c 4KN7C 1VQKA 3A8IE 1SE2A 4PQXA 1NR4A 2NN6I 2WIIB 2WKDA 1K0RA 4RKBA 2YTVA 1NAPA 4BA1I 3HOVB 4DF7A 4C3JB 1VQIA 4JPBW 2EOTA 3CP0A 1LTBD 1FGUA 1QZHA 1PRTC 2KENA 2Q2UA 3RLFA 1XMOL 1VQFA 1KABA 1PFSA 5J3BA 1IZ6A 4BY7G 1UAPA 2FXQA 4LF8L 1N33L 4FYDA 4LW1A 3K80C 1FR3A 2FFKB 3KF8B 3TS2A 1LLRD 4NXNL 1VQPA 5FOBB 4JC0A 2NZOA 2AMCB 3EJIA 4JYAL 4QL5A 1H9MA 4C56C 2EJGC 1BBXC 4JCVE 5IT9E 1XNRQ 3I56A 4YCVA 3QR8A 4GLVB 3DEOA 1AE2A 2MNAA 3HOWG 4M1UB 3PUYA 5IOCA 1GVPA 1O7IA 1A15A 4QB4A 1M8AA 4X3UA 3NHHA 2DNEA 4AYBB 4OO1I 1M4VA 4P2CB 5M3MG 1PVOA 3G48A 3LX0A 2R93H 2D5DA 2EXDA 2NTSA 3G6JB 4DR1Q 2KHIA 3D0FA 3PIOA 2L0CA 3NENA 4L5TA 3TS0A 4G7ZC 3V2TA 3GP7A 3HKSA 1DYQA 1HH2P 2Z8LA 1WTPA 3M7NA 1EL0A 1H9KA 4A3EB 1JOOA 2E8GA 3DMUA 1J8IA 1LTSD 4CGYB 1UE7A 4R4CA 5M9OA 2J0TD 2PQAA 2ASBA 3W1GA 2EY6A 2JQOA 4XTCS 5FLXc 1VCIA 3SXHA 4K6LA 3FKIB 1NR2A 1STNA 3I73A 3T51B 5I2XA 4NXMQ 2KHSA 3MEHA 1STBA 4RGTA 1PRTF 4GS3A 4U68A 5M5XB 3HOZH 2E74C 5JOBA 4F7XA 3TP8A 4C3HG 4LF7Q 4K5WA 1HNXQ 2VL6A 1X3PA 2EE1A 1LACA 4HSVA 2EYLA 2WB1G 4A3IG 4ZCKA 3J81i 1EQRA 1I50H 5A2QE 1BDOA 2K14A 1ET6A 1B44D 4DN4M 2WACA 5IP7H 2F52A 1C7YA 3G71A 4QCLA 1PZKD 3K58A 5C4XH 4X62L 2UUBQ 1XPRA 2KEEA 2D0OA 3DHQA 4IJLA 3E5SA 1V1PB 2VZAA 2ZXOA 3S2DH 3CCSA 1IYJB 2B2TA 2K5VA 2C9OA 4ME3A 1UE1A 3ZYYX 1XXGA 1MBYA 2K32A 4GN4B 2KCTA 2NVQH 4DV6L 5FJ8G 1AW7A 2MO0A 5IGFA 1HQRD 2A74C 2HUGA 2JA5B 3BJUA 1L0WA 1E1TA 3PSIA 1K73C 4CHTB 1DD2A 1SMXA 2ZJPA 1BR9A 2K5HA 2TSSA 1SMYC 3RZDB 2XVSA 4OL7A 3TZDA 1WTVA 3KJPA 1EIFA 2Z4IA 5IGBA 5C4JB 3HOXB 3S1RB 5CGKA 2JA6B 5IYDH 3MVVA 2EYPA 1ENAA 3M3YH 3H6MA 5DEHA 4LF9Q 2R92B 1KHIA 3FRPB 1DXMA 2HHHL 4GNXA 1A2UA 4P73A 3S14B 2F4VQ 4JBWA 2D2CC 1FGBD 5I9PA 1I94L 3H15A 4A3MB 2ATWA 2K03A 2QA4A 4BY1G 2K5DA 3J80E 3VA5A 3FVQA 4F87A 2YU9B 5LHY1 2J4XA 1JWMD 1FJGQ 4XT3B 3RN5A 2HIVA 1T9HA 1KLUD 2A5HA 1JQYD 3CQZH 1EU4A 1B4OA 4MTNA 4QMGA 4QIWE 2BH2A 4BY7H 2KOLA 1SJED 4FF1A 4PV1C 2PYKA 1AFPA 4PZ7A 1H9SB 2OEOA 2PMZE 4FXGC 1EIYB 3IRBA 1DJRD 5CC4A 5I2YA 1GUGA 2B63B 1TWCB 4EQPA 1EOTA 4DV4L 1GXDC 3D4WA 1Q12A 3L7ZC 1EYDA 1HZ9A 3R93A 1OXUA 3ULLA 1SROA 3GV3A 3K81C 2NVTB 5CBAE 3K0YA 4UAIA 4LF6L 2Q8IB 3J81L 3J7AV 4JI0Q 5M3MH 2BA1A 2VQFQ 1NE3A 3Q6SA 3K7AH 4F88A 4OWTB 4NDXA 2VUMG 1HNWQ 4K2KA 3C3LA 3HEJA 5DLQE 1BCPB 4APVA 4KHPQ 4BWGB 1SR3A 2VXWA 5CV5A 1B9NA 3S1QH 3IL8A 3G4SA 1R4QB 4DNTB 1G8ZD 4Q5VA 4CJ2C 2ENBA 4U673 1QUQB 3OWEB 2WAQG 4DUYQ 5BN3A 1N32Q 2L55A 1PTOB 4DK6C 1ILQA 5J22A 2R7DA 2OF1A 1IYVA 4GOPC 3P1HA 4A3LG 1CI3M 1TVXA 3J80i 3NBIA 5C5LA 3ULPA 5G3LF 4DR2L 1Q81C 2NVXB 2NWGA 5LMNL 3GTQH 1VQ5A 1BVSA 3OTOQ 3HOVG 2NBFA 4C3JG 5EKKA 3C1FA 4C3HH 3I4NG 5IYCG 1S5DD 4DK1A 4ME5A 4ZK9B 2GA4B 3K7UC 4DAYA 4A3IH 2WAQE 1IBML 3NK9A 3D8GA 5C0XI 2K4KA 4IALA 2JYOA 2ZXPA 1NNXA 4ZAIA 1Z7TA 1QNKA 1WCMG 5C0XG 3GTGB 2IX0A 4JI6Q 1HR0L 4B3TQ 2KECA 1G2TA 4QY7A 1L1OC 1G91A 3GTJB 4KD4A 1YNXA 4KJNA 1STYA 3FPUB 4PZ8A 3S1MB 2UXCQ 3RR5A 4LK1C 5FJ8H 3S2HH 4DGZA 2KBNA 1EY9A 2D9UA 1A2TA 2EJMA 3CRLC 5CV6A 3K57A 4Y52H 3EBEA 4MTKA 1FVIA 1Q1BA 2OTLA 1IHZA 3U50C 2R7FA 1UEBA 2K75A 1GUWA 1GJXA 3UDFA 4RH6A 2KUMA 4DAMA 3KYHC 1PFNA 1ASYA 2B2WA 1I3QH 3OW2A 1NSNS 4LFCQ 4CKEA 4DV0L 3GTLB 1W3SA 3UDGA 4DAVA 1CKNA 5JJKA 3S16B 4HJAA 4BY1H 1A3TA 1JORA 3PCOB 4A3BH 5JJZA 3UDXA 3TBIB 3MAQA 3S1NB 4JI7Q 2HDMA 1IBKQ 4KK7A 5KIXA 1PV4A 1JJGA 1ZKOA 2E5LL 3I72A 2ZT9C 5C3EH 3G6EA 1KC8C 1HTPA 2VNUD 1Y8PB 3GTOB 2LY7A 2O5IC 3HOUB 1A3UA 4IFDJ 1Q8IA 4G57A 1LABA 1MD2D 1XWEA 4QF4A 3TRZA 1T5EA 2F4IA 1F77A 1WTWA 2PW5A 5BR8L 5EKLA 3QO2A 2L15A 1CM9A 1QVFA 1JOQA 1STGA 2EYOA 1LTLA 1VQAA 2K7VA 2CQAA 1Q82C 2R7ZB 2O2LD 2VUMH 4TQUS 4RMFA 1UWVA 2PPBC 1SN8A 1EQVA 1VQNA 1J9OA 5GAHC 3CU7A 2VY3A 3PF5A 2ICEC 5C3XA 2VB3X 2R93G 2UUAQ 1Y69U 3MXPA 3ERSX 1LV9A 4R1JA 1EUJA 3M4YA 5ELOA 1TWGH 1UE6A 4HMIA 4JI3L 1XTCD 4A3LH 4POFA 1A63A 4O42A 4DV7Q 2ZJQA 3PMFA 3J7A5 1YEZA 1S5ED 4EQNA 1M1KC 4JI8L 1RIPA 4A3MG 3OMGA 1IYUA 2Z9HA 2BA0A 1V8QA 1X32A 4KJOA 3HOVH 1ICWA 5CBEE 1VQDA 4C3JH 4FF2A 1GOZA 3OW7A 2OQ0A 5J39A 1XMOQ 1Q3LA 2EQSA 4ABNA 1N33Q 4I65A 4LF8Q 3PUWA 1U9RA 4HTHA 1JE4A 1K8GA 3HP3A 1JWUD 3QB3A 3I4OA 2JEAI 1RF2D 1LTGD 3TQYA 5D3DA 4MN3A 3EQLC 2E2DC 4RA8A 2SDFA 1V1PA 1WVLA 4JYAQ 3FEWX 2ZXRA 2WINB 3D31A 2F0KA 5JEAG 1KAAA 4K5VA 3RZOB 4LUOA 2GVBA 2B63G 2RDFA 3MXUA 3J7ZC 1O80A 5HGTA 1W2BA 4L63B 4IPDA 4A75A 4B3ML 1RDPD 3IAYA 1NCVA 2NVYB 3MTSA 1B3QA 3FDTA 3RUZA 5C4XG 4EVOA 4L8JA 5LL6S 1U4RA 3WOEA 4B9XA 1X3FA 3MXGA 2IY5B 4A3KB 4N9TA 2DJGC 2B2TC 4OHJA 3PV0A 1EY5A 5FO9B 4LFBL 1EIHA 1NY4A 4PG3A 1WTOA 3A55A 3MXNB 4IFDH 1O7ZA 4TKOB 1B2TA 1FYCA 4A3EH 3PO2B 2K28A 1MKHA 4YCUA 1T5XD 2SOBA 3EROA 3P7JA 1MSGA 1MSHA 2JN4A 2JA8G 3ND9A 3H0GB 1P16A 2F0EA 1CQFA 4HMJA 1FNUA 5ISRA 1JT8A 3Q0AA 1EY4A 4UP7A 3FKIH 1K8AC 4B3RL 5DAUA 3AMUA 2KQ3A 4YCWA 1STEA 3LWEA 4X6AH 2AUJD 2OXPA 4J6HA 1D7QA 4H0LC 1PFBA 5EAYA 5M5XH 4GNXC 2A73B 1Y1VB 1A3VA 3P75A 3KLWA 3IKJA 3T1YL 3CCJA 2JK8A 2YTXA 3PIP3 4YIJA 4YWKA 5C44G 1FD7D 2A6ED 4J8QA 2K52A 4K14A 1W6KA 2EIFA 1V1QA 1QG7A 2B8GA 5IY0A 2JA7B 4Y7NH 3T53B 3V96A 1SNQA 4JI1L 2K5NA 3W3AA 2E2JB 1TQOA 4DUZL 1PLFA 1Q8KA 4R4OA 4IUPA 2DUDA 2K50A 1K8OA 2EJFC 1SNMA 3J81E 3BVZA 4KHZA 2XRSD 4H02A 2IJ0A 2EZVA 4H44C 1W6JA 1OXTA 2NZ1D 2F0GA 4IUTA 4NW2A 3E3XA 1J5EQ 2C35B 5EBCA 4DR7Q 4LJZC 3OIPA 2JA5H 3LNNA 4B3SL 1EWHA 1QUQA 2ICIA 2DGYA 3PO3B 1S5BD 3LGJA 3A8KE 5IGGA 2JEBI 2K6AA 3HOYB 2Z1CA 1XTDA 1V1OA 1O7LA 4E6IA 1VQEA 3CRKC 1HZCA 2DY8A 3RZDH 1IBLL 4GKJQ 1A62A 4JI5L 3HOXH 2Y0SB 3GTMB 5C4JH 2JA6H 1S5FD 3S1RH 1WTQA 1K83B 5CYUA 4C2MB 1B1ZA 1VF5C 2C5CA 5JVH3 1SBBB 3E0JA 1RTOA 3SGIA 1XMQQ 2R92H 1BNZA 1QE6A 1X54A 1I94Q 5M3FB
chains in the Genus database with same CATH topology
3S14H 4YWMA 3M4QA 1TWHH 4O2DA 1N36Q 3RLOA 3CCMA 3PO3H 4IPGA 4PZ7A 4DR3L 1SRUA 2HT1A 3E9IA 2PMZE 4A3MH 3UDIA 1EIYB 4JI4L 3IRBA 1IBLQ 1XNQL 1X55A 4JI0L 3HOYH 4AQYL 5AJ3Q 4JI5Q 2UU9L 1VQHA 1PH2A 2YU9H 1HNWL 4DV4L 3RLNA 1KXLA 1Q7YC 3GTMH 1Q12A 3L7ZC 4R4QA 5E7NA 1HZ9A 4DPGA 1K83H 3CMEA 1YJ9A 4C2MH 4JI7L 1BBWA 1OXUA 3ULLA 3Q8DA 3M4OH 4BA2I 1SROA 1OXVA 2H5XA 4OWWB 5GAEC 3K81C 1N34L 1PYBA 4DR3Q 4DAYB 4DV2L 1KRTA 2CCZA 3E0EA 1VQMA 4K0KL 5IP9G 4LF6L 3F2BA 2NZHA 4JI4Q 1YI2A 4OONA 1WJJA 5M3MH 2BA1A 5C0XJ 3L2PA 1NE3A 2VQFQ 4AQYQ 4JI0Q 3S15H 3K7AH 1B7YB 2MO1A 4BBRH 1UE5A 4OWTB 2VUMG 1EFWA 1HNWQ 1I5FA 5HY6A 4LFBQ 1CKOA 1Y14B 5DLQE 4A3KH 4APVA 4KHPQ 2IT1A 1SR3A 3HOUG 2BH8A 4A3DG 1YZ6A 1TWCH 2B63H 3S1QH 1VQCA 1M90C 3CMAA 4A76A 3NBHB 4X65L 5M5YH 2Q2IA 4DV2Q 1EWIA 3G4SA 1VQ4A 1NBWA 4IPCA 4LF6Q 1PH6A 1QUQB 1V9PA 3VDYA 2NVTH 1KAWA 1Q46A 4HJ8A 2WAQG 3OTOL 4DUYQ 2MFIA 3WWVA 4JBKA 4HIOA 4DK6C 4GOPB 1PH4A 1JJ2A 4DR4L 1N32Q 2R7DA 1E24A 3J81c 4GOPC 1NJIC 4A3GH 3UE0A 4A3LG 3K0XA 2R7ZG 1YJWA 1J6QA 3UE1A 3JAMi 1NMGA 4X64L 2RHQB 3J80i 1VS0A 4A3CH 3ULPA 2OCEA 2ALYB 4X65Q 4DR2L 1Z47A 1SLJA 4JI2L 1Q81C 5LMNL 5IWAL 1MIUA 1KD1C 4LF4Q 4DV1Q 2N8NA 3GTQH 3PUZA 1BBUA 2Z0SA 1BVSA 3OTOQ 4X62Q 1VQ5A 2I0QA 3HOVG 1D8LA 3I4NG 4C3HH 2JA8H 5IYCG 5JJIA 4HJ7A 2N78A 3HFZB 2YTYA 3CCVA 3T1YQ 4B3TL 4IO9A 4BY7G 2VQEL 1IXRA 1K3RA 2GN5A 3K7UC 1DGSA 1GD7A 4X64Q 4A3IH 2OWOA 2WAQE 4IOCA 1X65A 1E22A 1IBML 4QQBX 1WFQA 4A3DH 4DR2Q 4DV7L 5C0XI 2K4KA 4YHHL 4JI2Q 4DNIA 2V1CC 4UY8C 5IWAQ 4HIMA 2HQLA 1TWAH 2NN6G 2XGTA 4AH6A 4JBJA 4DV6Q 1K9MC 2NVXH 1WOCA 3I2ZA 1WCMG 3ZJYC 3GO5A 5C0XG 4L5QA 4LF5L 4DR6L 4MZ9A 4IPHA 2UXCL 2I5HA 2IX0A 4DV3L 1CKNB 4HJ5A 1HR0L 4B3TQ 4JI6Q 4J15A 4LUZA 4NPSA 3PF4A 1L1OB 1XNRL 1PH9A 4QY7A 1IBMQ 1L1OC 5H1SE 3F2DA 1Z9FA 1E7ZA 1YNXA 3S24A 2AWNA 5C44H 3A5UA 3U58A 4GOPA 3AEVA 2JA9A 3CD6A 3HKZG 4FDBA 4QGUA 1GKHA 3MEFA 1OTCA 3GTPH 4PZ8A 1PHJA 4DR6Q 2UXCQ 4A3FG 3RR5A 1LM0A 3CXCA 4DV3Q 1HR0Q 4A3BG 4XIGS 1C0AA 3CPWA 2WP8J 5FJ8H 1KRSA 3I4NH 2IHFA 3ULJA 2CFMA 5IYCH 4DR1L 3S2HH 1RL2A 1V43A 3GTGH 3AYHB 2KBNA 2HHHQ 1X56A 1QZGA 4P72A 4B3SQ 1CSPA 1E1OA 4BXXH 4DKAC 3PGZA 3DLLA 4GLAC 4Y52H 3KDFA 3T1HL 3EBEA 3HOZG 1FVIA 5C3EG 1AH9A 1Q1BA 2LXKA 4TVAB 4LFCL 3PIPA 3U50C 2OTLA 2R7FA 2UXBQ 4POGA 1UEBA 3EIVA 2K75A 1YHBA 2Z6KC 3UDFA 4HJ9A 3W1BA 1WCMH 4JOIC 1P8LA 3S1MH 1IL2A 1HZAA 4DAMA 3HKZE 4OO1G 4UPAA 1AE3A 1X9NA 3KYHC 1ASYA 1N9WA 4MNOA 5IE8A 1I3QH 3OW2A 3T1HQ 4IOAA 5GROA 4LUVA 1IBKL 4A93G 2RHSB 1S40A 4NB3A 1S72A 4QJFA 4LFCQ 4DV0L 3KF6B 1W3SA 4IJHA 3UDGA 5IP7G 1VQBA 1CKNA 1CSQA 3JC66 4OX9L 5JJKA 1VQGA 2PNHA 5M3FH 1YHAA 1L1OA 1G291 1YHQA 4HJAA 4P74A 2A19A 4GLXA 1XNQQ 1FL0A 4BY1H 3I4MH 1PYSB 3BU2A 2ZM6L 4UP9A 4A3FH 2UU9Q 3PCOB 2AHOB 3H0GG 4PMWA 4A3JG 3M85A 4L5SA 4A3BH 3UDXA 5FLMG 4DV4Q 2VW9A 4P71A 2CKZB 1A8VA 2IHEA 4JV5L 3TREA 4JI7Q 3CW2C 1IBKQ 1PV4A 4DV0Q 1JJGA 1N34Q 4A4IA 2E5LL 1Y1WG 2WFWA 4LFAL 4OX9Q 5C3EH 4K0KQ 3CCEA 1VQ8A 1HJPA 3GTLH 1WYDA 3G6EA 1KC8C 3CCRA 3S16H 3M4PA 4GKKL 4HIDA 2ID0A 1PH3A 2UUBL 1Y1VG 2VNUD 2CWPA 3CF5A 3BZCA 2F3IA 1EQQA 3F2CA 3AFQA 1QVCA 4IFDJ 3U4ZA 2Z6KA 3PUVA 3CC7A 2E5LQ 4JOIA 3S1NH 4X66L 3TRZA 3RN2A 2KCMA 1A0IA 3I7FA 1I6HH 3STBD 5BR8L 2ZTCA 3E9HA 4LWCA 4OXPA 5IYDG 5IP9H 3KDFB 2L15A 2UUAL 3GTKH 1QVFA 4DR4Q 4GKKQ 4DK3C 2AWOA 2E2HH 1CKMA 4ALPA 1LTLA 2QEXA 1VQAA 1Q82C 3JAMc 1N8RC 2D0PA 5JEAJ 3J81j 3KF6A 2JA7G 2VUMH 3RNUA 3J80c 4TQUS 1VQKA 1KL9A 3A74A 3GTOH 1OXXK 4RMFA 1UWVA 2NN6I 1SN8A 3HOUH 3KOJA 3GDEA 1VQNA 2RF4A 5GAHC 2WB1E 5LMNQ 1K0RA 2VY3A 3PF5A 2YTVA 2N49A 4BA1I 3M9BA 1EOVA 2ZTEA 3DM3A 2R93G 2B29A 2UUAQ 1VQIA 3ERSX 1PH7A 1PH5A 3CP0A 1FGUA 4R1JA 1QZHA 1ASZA 1EUJA 5ELOA 1VQOA 1TWGH 2JE6I 1HZBA 2VQEQ 4BBSG 2KENA 1UE6A 2R6GA 3CAMA 2Q2UA 2PQAB 3CCUA 1XPOA 2D62A 4JI3L 3RLFA 1J5EL 4POFA 1XMOL 1VQFA 1VQLA 2R7ZH 4DR7L 4A3LH 1PFSA 5J3BA 1A63A 1IZ6A 4DV7Q 2FXQA 1BKBA 2PI2E 4YHHQ 4LF8L 2ZJQA 1Q1EA 1N33L 3J7A5 1YEZA 2F4VL 4LW1A 3K80C 2VS1A 4JI8L 1M1KC 3PO3G 3KF8B 3TS2A 1RIPA 3K8AA 4NXNL 4A3MG 3U4VA 1TWFH 4AYBG 1U5KA 2BA0A 3F1ZA 1VQPA 1KIXA 4LF5Q 4JC0A 1JJCB 3CPFA 1G6PA 2NZOA 3HOVH 2AMCB 4IFDI 4JYAL 1VQDA 4C3JH 4QL5A 4GKJL 2OQ0A 4JCVE 1XNRQ 1XJVA 3I56A 4YCVA 2Y0SG 4GLVB 1XMOQ 2EQSA 5JJLA 2ZTDA 1TXYA 1L2FA 1HNZL 1AE2A 2MNAA 1N33Q 3HOWG 3W5OA 4LF8Q 4IFDG 3PUWA 1XMQL 1WI5A 3PUYA 4DR5L 1K8GA 1GVPA 4A3EG 1O7IA 3I4OA 2JEAI 3GTJH 4P75A 2ES2A 1GM5A 4OO1I 3GD7A 2A1AA 1X6OA 2LXJA 3TQYA 1N36L 1VQ6A 5M3MG 1MJCA 1PVOA 3G48A 3CC2A 2R93H 4BBRG 4JYAQ 2HIXA 2EXDA 2JJQA 4YWLA 3STBC 4DR1Q 2KHIA 3D0FA 3PIOA 4L5TA 3NENA 5AJ3L 3TS0A 3D31A 4A3KG 3BZKA 5JEAG 3FKIG 1HR0W 4LUOA 2GVBA 3HKSA 4AYBE 1KQSA 1HNZQ 1HH2P 5IYBG 2XTIA 2B63G 3J7ZC 3M7NA 3S17H 4DR5Q 1B8AA 4NXML 1W2BA 3F8TA 4EQ5A 2E8GA 4IPDA 1MJEA 2PI2A 4GN5A 4A75A 4B3ML 3H3VI 2MQHA 3A5ZB 2Y0SE 1SFOH 3TEHB 1UE7A 3PO2G 4R4CA 4UP8A 5C4XG 2PQAA 1NMFA 2Q2HA 2ASBA 3W1GA 2JQOA 2I5MX 4XTCS 4LF7L 5HGQA 1X3FA 5FLXc 2VQFL 4GN3B 1VCIA 1YVCA 1HNXL 4A3GG 2IY5B 3PV0A 4KLKA 4LFBL 1NY4A 1XPUA 1U0LA 3KFUA 4A3CG 4PG3A 4KHPL 3MXNB 4NXMQ 3RZOH 3HOWH 4B3MQ 3FP9A 1VQ9A 1X3GA 1OXSC 4GS3A 4A3EH 3HOZH 1MKHA 4YCUA 4JG2A 2ZM6Q 4LF7Q 1E3PA 2NVYH 2JA8G 4HIKA 1S3OA 1CUKA 1PH1A 4KI0A 1P16A 1HNXQ 5K36G 2VL6A 4DUYL 1N32L 2WB1G 1JT8A 2I5LX 4A3IG 4JV5Q 3J81i 1EQRA 3FKIH 4UP7A 3KJOA 1K8AC 4B3RL 4WJ3M 1I50H 4LNQA 5IYBH 4YCWA 4DV5L 2OQKA 1YJNA 1JMCA 2K14A 4LFAQ 4X6AH 2YV5A 4A93H 4YY3L 2AKWB 2ZJRA 1D7QA 5IP7H 4GNXB 2F52A 1C7YA 3G71A 4LF4L 4DV1L 5EAYA 5M5XH 4GNXC 3PO2H 1SE8A 4O0AA 5C4XH 4X62L 2A8VA 3B6YA 2UUBQ 1XPRA 3H3VH 2D0OA 3KLWA 3H0GH 4A3JH 3PUXA 3T1YL 3CCJA 4B3RQ 2JK8A 2YTXA 4IJLA 3CCQA 5FLMH 2Q2TA 2JA5G 4L5RC 2VZAA 4DV5Q 4WJ4A 4X66Q 4YWKA 5C44G 3S2DH 4YY3Q 3CCSA 1C9OA 5IT9c 1IYJB 2K52A 4AIMA 2K5VA 4RG1A 4ME3A 5BR8Q 1Y1WH 2UUCL 1UE1A 3CC4A 1JE5A 4OWXB 1YBYA 2CQOA 3CCLA 3FHWA 4GN4B 1YIJA 2EIFA 1V1QA 2KCTA 2NVQH 4DV6L 3AFPA 5FJ8G 5IY0A 3HOXG 2MO0A 4EX5A 2JA6G 2RCNA 3ER0A 4Y7NH 4JI6L 1Y1VH 4JBMA 4JI1L 2KHJA 2IX1A 4LF9L 2K5NA 3EN2A 2R92G 3BJUA 4BXXG 2N3SA 3L0OA 1L0WA 1E1TA 3PSIA 4C3IH 3I55A 1YITA 1K73C 4DUZL 1Q8KA 3A0JA 4R4OA 1SMXA 2UUCQ 2ZJPA 2DUDA 2B3GA 2K50A 2K5HA 1G51A 2QGQA 3OYYA 5GADC 1X3EA 5LMUL 1LYLA 4KHZA 4H02A 3HOYG 5LMNW 3NELA 2OTJA 3KJPA 1EIFA 4PZ6A 5IYDH 1OXTA 3M3YH 4JI1Q 4LF9Q 1GO3E 2C35B 1KHIA 1J5EQ 4JI3Q 1FJGL 4DR7Q 2JA7H 3AQQA 5M5WH 2HHHL 4GNXA 2JA5H 1JB7A 4P73A 4DUZQ 1EYGA 4B3SL 2UXDL 1QUQA 1VQJA 2F4VQ 2DGYA 2LSSA 4JBWA 4JI8Q 1I94L 2E2JH 1B70B 2GVAA 3LGJA 5M3FG 3H15A 2ATWA 1NTGA 2JEBI 5LMUQ 1Q86C 1QVGA 4NXNQ 3ICEA 1XTDA 3I4MG 2QA4A 5GQOA 2UXBL 4BY1G 1PH8A 1R9TH 1LUZA 1PA6A 1VQEA 2E2IH 1HZCA 5GAGC 2CWAA 1VQ7A 1H95A 3RZDH 1IBLL 4GKJQ 4R4TA 5ELNA 1A62A 4JI5L 3HOXH 1FJGQ 5C4JH 2JA6H 3S1RH 3RN5A 2HIVA 1T9HA 4R4IA 4BBSH 3CQZH 2YYZA 4MTNA 2UXDQ 3SGIA 4QIWE 1XMQQ 2R92H 3NEMA 1X54A 1I94Q 2BH2A 4BY7H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S14 H;  4YWM A;  3M4Q A;  1TWH H;  4O2D A;  1N36 Q;  3RLO A;  3CCM A;  3PO3 H;  4IPG A;  4PZ7 A;  4DR3 L;  1SRU A;  2HT1 A;  3E9I A;  2PMZ E;  4A3M H;  3UDI A;  1EIY B;  4JI4 L;  3IRB A;  1IBL Q;  1XNQ L;  1X55 A;  4JI0 L;  3HOY H;  4AQY L;  5AJ3 Q;  4JI5 Q;  2UU9 L;  1VQH A;  1PH2 A;  2YU9 H;  1HNW L;  4DV4 L;  3RLN A;  1KXL A;  1Q7Y C;  3GTM H;  1Q12 A;  3L7Z C;  4R4Q A;  5E7N A;  1HZ9 A;  4DPG A;  1K83 H;  3CME A;  1YJ9 A;  4C2M H;  4JI7 L;  1BBW A;  1OXU A;  3ULL A;  3Q8D A;  3M4O H;  4BA2 I;  1SRO A;  1OXV A;  2H5X A;  4OWW B;  5GAE C;  3K81 C;  1N34 L;  1PYB A;  4DR3 Q;  4DAY B;  4DV2 L;  1KRT A;  2CCZ A;  3E0E A;  1VQM A;  4K0K L;  5IP9 G;  4LF6 L;  3F2B A;  2NZH A;  4JI4 Q;  1YI2 A;  4OON A;  1WJJ A;  5M3M H;  2BA1 A;  5C0X J;  3L2P A;  1NE3 A;  2VQF Q;  4AQY Q;  4JI0 Q;  3S15 H;  3K7A H;  1B7Y B;  2MO1 A;  4BBR H;  1UE5 A;  4OWT B;  2VUM G;  1EFW A;  1HNW Q;  1I5F A;  5HY6 A;  4LFB Q;  1CKO A;  1Y14 B;  5DLQ E;  4A3K H;  4APV A;  4KHP Q;  2IT1 A;  1SR3 A;  3HOU G;  2BH8 A;  4A3D G;  1YZ6 A;  1TWC H;  2B63 H;  3S1Q H;  1VQC A;  1M90 C;  3CMA A;  4A76 A;  3NBH B;  4X65 L;  5M5Y H;  2Q2I A;  4DV2 Q;  1EWI A;  3G4S A;  1VQ4 A;  1NBW A;  4IPC A;  4LF6 Q;  1PH6 A;  1QUQ B;  1V9P A;  3VDY A;  2NVT H;  1KAW A;  1Q46 A;  4HJ8 A;  2WAQ G;  3OTO L;  4DUY Q;  2MFI A;  3WWV A;  4JBK A;  4HIO A;  4DK6 C;  4GOP B;  1PH4 A;  1JJ2 A;  4DR4 L;  1N32 Q;  2R7D A;  1E24 A;  3J81 c;  4GOP C;  1NJI C;  4A3G H;  3UE0 A;  4A3L G;  3K0X A;  2R7Z G;  1YJW A;  1J6Q A;  3UE1 A;  3JAM i;  1NMG A;  4X64 L;  2RHQ B;  3J80 i;  1VS0 A;  4A3C H;  3ULP A;  2OCE A;  2ALY B;  4X65 Q;  4DR2 L;  1Z47 A;  1SLJ A;  4JI2 L;  1Q81 C;  5LMN L;  5IWA L;  1MIU A;  1KD1 C;  4LF4 Q;  4DV1 Q;  2N8N A;  3GTQ H;  3PUZ A;  1BBU A;  2Z0S A;  1BVS A;  3OTO Q;  4X62 Q;  1VQ5 A;  2I0Q A;  3HOV G;  1D8L A;  3I4N G;  4C3H H;  2JA8 H;  5IYC G;  5JJI A;  4HJ7 A;  2N78 A;  3HFZ B;  2YTY A;  3CCV A;  3T1Y Q;  4B3T L;  4IO9 A;  4BY7 G;  2VQE L;  1IXR A;  1K3R A;  2GN5 A;  3K7U C;  1DGS A;  1GD7 A;  4X64 Q;  4A3I H;  2OWO A;  2WAQ E;  4IOC A;  1X65 A;  1E22 A;  1IBM L;  4QQB X;  1WFQ A;  4A3D H;  4DR2 Q;  4DV7 L;  5C0X I;  2K4K A;  4YHH L;  4JI2 Q;  4DNI A;  2V1C C;  4UY8 C;  5IWA Q;  4HIM A;  2HQL A;  1TWA H;  2NN6 G;  2XGT A;  4AH6 A;  4JBJ A;  4DV6 Q;  1K9M C;  2NVX H;  1WOC A;  3I2Z A;  1WCM G;  3ZJY C;  3GO5 A;  5C0X G;  4L5Q A;  4LF5 L;  4DR6 L;  4MZ9 A;  4IPH A;  2UXC L;  2I5H A;  2IX0 A;  4DV3 L;  1CKN B;  4HJ5 A;  1HR0 L;  4B3T Q;  4JI6 Q;  4J15 A;  4LUZ A;  4NPS A;  3PF4 A;  1L1O B;  1XNR L;  1PH9 A;  4QY7 A;  1IBM Q;  1L1O C;  5H1S E;  3F2D A;  1Z9F A;  1E7Z A;  1YNX A;  3S24 A;  2AWN A;  5C44 H;  3A5U A;  3U58 A;  4GOP A;  3AEV A;  2JA9 A;  3CD6 A;  3HKZ G;  4FDB A;  4QGU A;  1GKH A;  3MEF A;  1OTC A;  3GTP H;  4PZ8 A;  1PHJ A;  4DR6 Q;  2UXC Q;  4A3F G;  3RR5 A;  1LM0 A;  3CXC A;  4DV3 Q;  1HR0 Q;  4A3B G;  4XIG S;  1C0A A;  3CPW A;  2WP8 J;  5FJ8 H;  1KRS A;  3I4N H;  2IHF A;  3ULJ A;  2CFM A;  5IYC H;  4DR1 L;  3S2H H;  1RL2 A;  1V43 A;  3GTG H;  3AYH B;  2KBN A;  2HHH Q;  1X56 A;  1QZG A;  4P72 A;  4B3S Q;  1CSP A;  1E1O A;  4BXX H;  4DKA C;  3PGZ A;  3DLL A;  4GLA C;  4Y52 H;  3KDF A;  3T1H L;  3EBE A;  3HOZ G;  1FVI A;  5C3E G;  1AH9 A;  1Q1B A;  2LXK A;  4TVA B;  4LFC L;  3PIP A;  3U50 C;  2OTL A;  2R7F A;  2UXB Q;  4POG A;  1UEB A;  3EIV A;  2K75 A;  1YHB A;  2Z6K C;  3UDF A;  4HJ9 A;  3W1B A;  1WCM H;  4JOI C;  1P8L A;  3S1M H;  1IL2 A;  1HZA A;  4DAM A;  3HKZ E;  4OO1 G;  4UPA A;  1AE3 A;  1X9N A;  3KYH C;  1ASY A;  1N9W A;  4MNO A;  5IE8 A;  1I3Q H;  3OW2 A;  3T1H Q;  4IOA A;  5GRO A;  4LUV A;  1IBK L;  4A93 G;  2RHS B;  1S40 A;  4NB3 A;  1S72 A;  4QJF A;  4LFC Q;  4DV0 L;  3KF6 B;  1W3S A;  4IJH A;  3UDG A;  5IP7 G;  1VQB A;  1CKN A;  1CSQ A;  3JC6 6;  4OX9 L;  5JJK A;  1VQG A;  2PNH A;  5M3F H;  1YHA A;  1L1O A;  1G29 1;  1YHQ A;  4HJA A;  4P74 A;  2A19 A;  4GLX A;  1XNQ Q;  1FL0 A;  4BY1 H;  3I4M H;  1PYS B;  3BU2 A;  2ZM6 L;  4UP9 A;  4A3F H;  2UU9 Q;  3PCO B;  2AHO B;  3H0G G;  4PMW A;  4A3J G;  3M85 A;  4L5S A;  4A3B H;  3UDX A;  5FLM G;  4DV4 Q;  2VW9 A;  4P71 A;  2CKZ B;  1A8V A;  2IHE A;  4JV5 L;  3TRE A;  4JI7 Q;  3CW2 C;  1IBK Q;  1PV4 A;  4DV0 Q;  1JJG A;  1N34 Q;  4A4I A;  2E5L L;  1Y1W G;  2WFW A;  4LFA L;  4OX9 Q;  5C3E H;  4K0K Q;  3CCE A;  1VQ8 A;  1HJP A;  3GTL H;  1WYD A;  3G6E A;  1KC8 C;  3CCR A;  3S16 H;  3M4P A;  4GKK L;  4HID A;  2ID0 A;  1PH3 A;  2UUB L;  1Y1V G;  2VNU D;  2CWP A;  3CF5 A;  3BZC A;  2F3I A;  1EQQ A;  3F2C A;  3AFQ A;  1QVC A;  4IFD J;  3U4Z A;  2Z6K A;  3PUV A;  3CC7 A;  2E5L Q;  4JOI A;  3S1N H;  4X66 L;  3TRZ A;  3RN2 A;  2KCM A;  1A0I A;  3I7F A;  1I6H H;  3STB D;  5BR8 L;  2ZTC A;  3E9H A;  4LWC A;  4OXP A;  5IYD G;  5IP9 H;  3KDF B;  2L15 A;  2UUA L;  3GTK H;  1QVF A;  4DR4 Q;  4GKK Q;  4DK3 C;  2AWO A;  2E2H H;  1CKM A;  4ALP A;  1LTL A;  2QEX A;  1VQA A;  1Q82 C;  3JAM c;  1N8R C;  2D0P A;  5JEA J;  3J81 j;  3KF6 A;  2JA7 G;  2VUM H;  3RNU A;  3J80 c;  4TQU S;  1VQK A;  1KL9 A;  3A74 A;  3GTO H;  1OXX K;  4RMF A;  1UWV A;  2NN6 I;  1SN8 A;  3HOU H;  3KOJ A;  3GDE A;  1VQN A;  2RF4 A;  5GAH C;  2WB1 E;  5LMN Q;  1K0R A;  2VY3 A;  3PF5 A;  2YTV A;  2N49 A;  4BA1 I;  3M9B A;  1EOV A;  2ZTE A;  3DM3 A;  2R93 G;  2B29 A;  2UUA Q;  1VQI A;  3ERS X;  1PH7 A;  1PH5 A;  3CP0 A;  1FGU A;  4R1J A;  1QZH A;  1ASZ A;  1EUJ A;  5ELO A;  1VQO A;  1TWG H;  2JE6 I;  1HZB A;  2VQE Q;  4BBS G;  2KEN A;  1UE6 A;  2R6G A;  3CAM A;  2Q2U A;  2PQA B;  3CCU A;  1XPO A;  2D62 A;  4JI3 L;  3RLF A;  1J5E L;  4POF A;  1XMO L;  1VQF A;  1VQL A;  2R7Z H;  4DR7 L;  4A3L H;  1PFS A;  5J3B A;  1A63 A;  1IZ6 A;  4DV7 Q;  2FXQ A;  1BKB A;  2PI2 E;  4YHH Q;  4LF8 L;  2ZJQ A;  1Q1E A;  1N33 L;  3J7A 5;  1YEZ A;  2F4V L;  4LW1 A;  3K80 C;  2VS1 A;  4JI8 L;  1M1K C;  3PO3 G;  3KF8 B;  3TS2 A;  1RIP A;  3K8A A;  4NXN L;  4A3M G;  3U4V A;  1TWF H;  4AYB G;  1U5K A;  2BA0 A;  3F1Z A;  1VQP A;  1KIX A;  4LF5 Q;  4JC0 A;  1JJC B;  3CPF A;  1G6P A;  2NZO A;  3HOV H;  2AMC B;  4IFD I;  4JYA L;  1VQD A;  4C3J H;  4QL5 A;  4GKJ L;  2OQ0 A;  4JCV E;  1XNR Q;  1XJV A;  3I56 A;  4YCV A;  2Y0S G;  4GLV B;  1XMO Q;  2EQS A;  5JJL A;  2ZTD A;  1TXY A;  1L2F A;  1HNZ L;  1AE2 A;  2MNA A;  1N33 Q;  3HOW G;  3W5O A;  4LF8 Q;  4IFD G;  3PUW A;  1XMQ L;  1WI5 A;  3PUY A;  4DR5 L;  1K8G A;  1GVP A;  4A3E G;  1O7I A;  3I4O A;  2JEA I;  3GTJ H;  4P75 A;  2ES2 A;  1GM5 A;  4OO1 I;  3GD7 A;  2A1A A;  1X6O A;  2LXJ A;  3TQY A;  1N36 L;  1VQ6 A;  5M3M G;  1MJC A;  1PVO A;  3G48 A;  3CC2 A;  2R93 H;  4BBR G;  4JYA Q;  2HIX A;  2EXD A;  2JJQ A;  4YWL A;  3STB C;  4DR1 Q;  2KHI A;  3D0F A;  3PIO A;  4L5T A;  3NEN A;  5AJ3 L;  3TS0 A;  3D31 A;  4A3K G;  3BZK A;  5JEA G;  3FKI G;  1HR0 W;  4LUO A;  2GVB A;  3HKS A;  4AYB E;  1KQS A;  1HNZ Q;  1HH2 P;  5IYB G;  2XTI A;  2B63 G;  3J7Z C;  3M7N A;  3S17 H;  4DR5 Q;  1B8A A;  4NXM L;  1W2B A;  3F8T A;  4EQ5 A;  2E8G A;  4IPD A;  1MJE A;  2PI2 A;  4GN5 A;  4A75 A;  4B3M L;  3H3V I;  2MQH A;  3A5Z B;  2Y0S E;  1SFO H;  3TEH B;  1UE7 A;  3PO2 G;  4R4C A;  4UP8 A;  5C4X G;  2PQA A;  1NMF A;  2Q2H A;  2ASB A;  3W1G A;  2JQO A;  2I5M X;  4XTC S;  4LF7 L;  5HGQ A;  1X3F A;  5FLX c;  2VQF L;  4GN3 B;  1VCI A;  1YVC A;  1HNX L;  4A3G G;  2IY5 B;  3PV0 A;  4KLK A;  4LFB L;  1NY4 A;  1XPU A;  1U0L A;  3KFU A;  4A3C G;  4PG3 A;  4KHP L;  3MXN B;  4NXM Q;  3RZO H;  3HOW H;  4B3M Q;  3FP9 A;  1VQ9 A;  1X3G A;  1OXS C;  4GS3 A;  4A3E H;  3HOZ H;  1MKH A;  4YCU A;  4JG2 A;  2ZM6 Q;  4LF7 Q;  1E3P A;  2NVY H;  2JA8 G;  4HIK A;  1S3O A;  1CUK A;  1PH1 A;  4KI0 A;  1P16 A;  1HNX Q;  5K36 G;  2VL6 A;  4DUY L;  1N32 L;  2WB1 G;  1JT8 A;  2I5L X;  4A3I G;  4JV5 Q;  3J81 i;  1EQR A;  3FKI H;  4UP7 A;  3KJO A;  1K8A C;  4B3R L;  4WJ3 M;  1I50 H;  4LNQ A;  5IYB H;  4YCW A;  4DV5 L;  2OQK A;  1YJN A;  1JMC A;  2K14 A;  4LFA Q;  4X6A H;  2YV5 A;  4A93 H;  4YY3 L;  2AKW B;  2ZJR A;  1D7Q A;  5IP7 H;  4GNX B;  2F52 A;  1C7Y A;  3G71 A;  4LF4 L;  4DV1 L;  5EAY A;  5M5X H;  4GNX C;  3PO2 H;  1SE8 A;  4O0A A;  5C4X H;  4X62 L;  2A8V A;  3B6Y A;  2UUB Q;  1XPR A;  3H3V H;  2D0O A;  3KLW A;  3H0G H;  4A3J H;  3PUX A;  3T1Y L;  3CCJ A;  4B3R Q;  2JK8 A;  2YTX A;  4IJL A;  3CCQ A;  5FLM H;  2Q2T A;  2JA5 G;  4L5R C;  2VZA A;  4DV5 Q;  4WJ4 A;  4X66 Q;  4YWK A;  5C44 G;  3S2D H;  4YY3 Q;  3CCS A;  1C9O A;  5IT9 c;  1IYJ B;  2K52 A;  4AIM A;  2K5V A;  4RG1 A;  4ME3 A;  5BR8 Q;  1Y1W H;  2UUC L;  1UE1 A;  3CC4 A;  1JE5 A;  4OWX B;  1YBY A;  2CQO A;  3CCL A;  3FHW A;  4GN4 B;  1YIJ A;  2EIF A;  1V1Q A;  2KCT A;  2NVQ H;  4DV6 L;  3AFP A;  5FJ8 G;  5IY0 A;  3HOX G;  2MO0 A;  4EX5 A;  2JA6 G;  2RCN A;  3ER0 A;  4Y7N H;  4JI6 L;  1Y1V H;  4JBM A;  4JI1 L;  2KHJ A;  2IX1 A;  4LF9 L;  2K5N A;  3EN2 A;  2R92 G;  3BJU A;  4BXX G;  2N3S A;  3L0O A;  1L0W A;  1E1T A;  3PSI A;  4C3I H;  3I55 A;  1YIT A;  1K73 C;  4DUZ L;  1Q8K A;  3A0J A;  4R4O A;  1SMX A;  2UUC Q;  2ZJP A;  2DUD A;  2B3G A;  2K50 A;  2K5H A;  1G51 A;  2QGQ A;  3OYY A;  5GAD C;  1X3E A;  5LMU L;  1LYL A;  4KHZ A;  4H02 A;  3HOY G;  5LMN W;  3NEL A;  2OTJ A;  3KJP A;  1EIF A;  4PZ6 A;  5IYD H;  1OXT A;  3M3Y H;  4JI1 Q;  4LF9 Q;  1GO3 E;  2C35 B;  1KHI A;  1J5E Q;  4JI3 Q;  1FJG L;  4DR7 Q;  2JA7 H;  3AQQ A;  5M5W H;  2HHH L;  4GNX A;  2JA5 H;  1JB7 A;  4P73 A;  4DUZ Q;  1EYG A;  4B3S L;  2UXD L;  1QUQ A;  1VQJ A;  2F4V Q;  2DGY A;  2LSS A;  4JBW A;  4JI8 Q;  1I94 L;  2E2J H;  1B70 B;  2GVA A;  3LGJ A;  5M3F G;  3H15 A;  2ATW A;  1NTG A;  2JEB I;  5LMU Q;  1Q86 C;  1QVG A;  4NXN Q;  3ICE A;  1XTD A;  3I4M G;  2QA4 A;  5GQO A;  2UXB L;  4BY1 G;  1PH8 A;  1R9T H;  1LUZ A;  1PA6 A;  1VQE A;  2E2I H;  1HZC A;  5GAG C;  2CWA A;  1VQ7 A;  1H95 A;  3RZD H;  1IBL L;  4GKJ Q;  4R4T A;  5ELN A;  1A62 A;  4JI5 L;  3HOX H;  1FJG Q;  5C4J H;  2JA6 H;  3S1R H;  3RN5 A;  2HIV A;  1T9H A;  4R4I A;  4BBS H;  3CQZ H;  2YYZ A;  4MTN A;  2UXD Q;  3SGI A;  4QIW E;  1XMQ Q;  2R92 H;  3NEM A;  1X54 A;  1I94 Q;  2BH2 A;  4BY7 H; 
#chains in the Genus database with same CATH topology
 4G4K A;  3S14 H;  1MI2 A;  3D3R A;  2MPM A;  1N36 Q;  1JOK A;  3RLO A;  4IPG A;  1I6V C;  1EEI D;  3S15 B;  2A6E C;  2K05 A;  4BBR B;  5BN5 A;  1IL8 A;  4A3M H;  4RFB A;  4Z9C B;  5AJ3 Q;  1G6Z A;  2UU9 L;  3NSW A;  3X3M A;  1PH2 A;  2YU9 H;  2XRQ D;  1LTA D;  1Q7Y C;  5E7N A;  3MHB A;  4DPG A;  1BBW A;  3Q8D A;  4Q0F A;  5ELC A;  2R61 A;  1HTL D;  4XYO A;  5E1F A;  3VYT A;  1PYB A;  3DXJ C;  4DV2 L;  1SJH D;  3VR3 A;  3KK7 A;  1CA5 A;  3F2B A;  5KYI A;  4OON A;  5L37 A;  1B7Y B;  1I5F A;  4XDX A;  1CKO A;  5JEA H;  2IT1 A;  3HOU G;  2CW0 D;  2B63 H;  1TWC H;  1VQC A;  1F9R A;  1M90 C;  3CMA A;  4A76 A;  1DON A;  4X65 L;  5M5Y H;  2Q2I A;  1VQ4 A;  2HQE A;  1U4M A;  4LF6 Q;  1HPC A;  1PH6 A;  2NVT H;  3VDY A;  3JAM L;  1KAW A;  4HJ8 A;  3UI2 A;  2IWH A;  3WWV A;  2A69 D;  4GOP B;  3G7L A;  4RHR A;  1S5C D;  1D6E C;  2R7Z G;  4A3D B;  3UE1 A;  2DN8 A;  2QW7 A;  2B2Y A;  4KKS A;  2RHQ B;  1TY2 A;  1KLG D;  3NWS A;  1FNV A;  1CT1 D;  1Z47 A;  4GZY C;  5KEE A;  4JI2 L;  4LF4 Q;  4DV1 Q;  3S9W A;  3PIO 3;  3PUZ A;  5DM6 3;  2Z0S A;  3TP6 A;  4DXG A;  2HD3 A;  2JA8 H;  2CH4 W;  5JJI A;  4HJ7 A;  2YTY A;  3CCV A;  4IO9 A;  1PTO H;  3TDQ A;  4HCE A;  4CKC A;  1IXR A;  1E2W A;  1QIL A;  1GD7 A;  2OWO A;  4IOC A;  4QQB X;  1STA A;  1WFQ A;  4DR2 Q;  1R4P B;  2PZT A;  2HQL A;  4V19 0;  1HA6 A;  2XGT A;  2NVX H;  4JVZ A;  2B2W C;  3W2D A;  4DR6 L;  3DEP A;  4J15 A;  3PF4 A;  1L1O B;  4CDD C;  1XNR L;  1PH9 A;  2QDB A;  1WTH A;  4PMC A;  2F0T A;  1IBM Q;  1EU3 A;  3F2D A;  1ET9 A;  4X3K A;  1E7Z A;  2AWN A;  5C44 H;  3A5U A;  3AEV A;  3BDO A;  2CW0 C;  4CDF C;  3CD6 A;  2BCO A;  1F9P A;  1GKH A;  1O78 A;  2NUC A;  1OTC A;  3RD4 A;  3CXC A;  1HR0 Q;  4A3B G;  1C0A A;  4UDU C;  3BYT B;  4DR1 L;  2P5Z X;  3QG1 A;  3BVM A;  5C3W A;  3GTG H;  3OMC A;  4KY6 A;  2A69 C;  3R3O A;  1X56 A;  4GLA C;  5C3E G;  4TVA B;  1RKN A;  2UXB Q;  4PMB A;  4A3F B;  3K59 A;  2NN6 H;  1GUT A;  3EFX D;  3W1B A;  1QCB D;  1P8L A;  3S1M H;  1IL2 A;  1GUO A;  1LT6 D;  4RGN A;  4TRD A;  2LMC B;  1SYC A;  3C46 A;  3TSS A;  2RHS B;  3BDC A;  1I4H A;  3KF6 B;  4IJH A;  2I07 B;  1VQB A;  2RVL A;  4OX9 L;  3AU7 A;  1YHA A;  5FO7 B;  5DNF A;  1YHQ A;  1G29 1;  3KLS X;  4BS9 A;  1XNQ Q;  1FL0 A;  3SK4 A;  2AQ3 B;  3BU2 A;  5I4D A;  5T1I A;  4UP9 A;  1HFG A;  4XQQ A;  3H0G G;  4PMW A;  4L5S A;  3I3C A;  5FLM G;  2VW9 A;  4P71 A;  2CKZ B;  1F2M A;  3CW2 C;  1SNP A;  4DV0 Q;  2R3Z A;  1I6H B;  2KVM A;  1N34 Q;  4K0K Q;  2CHB D;  5E4W C;  1VQ8 A;  3GTK B;  1HRJ A;  3GTL H;  2E2H B;  2B2V A;  3I90 A;  4LMQ D;  4DK0 A;  3S16 H;  3T16 A;  3M4P A;  2ID0 A;  2UUB L;  1Y1V G;  2CWP A;  4LAA A;  3CF5 A;  1EQQ A;  3L3O C;  4C3I G;  1PDQ A;  5EPK A;  3U4Z A;  3PUV A;  2M2L A;  1ENC A;  3SEB A;  3CC7 A;  2E5L Q;  3S1N H;  5FLX E;  5EQ0 A;  3VR2 A;  3I7F A;  2QKI C;  2PQE A;  3E9H A;  2RDH A;  1SYG A;  3KDF B;  3SVM A;  2PO4 A;  4CDC C;  4J1M A;  4DR4 Q;  2MGS A;  2AWO A;  2QEX A;  3JAM c;  1N8R C;  2JA7 G;  1CZW A;  3I70 A;  2F0U A;  3SE0 A;  1EZ6 A;  3GTO H;  1K0S A;  1OXX K;  3HOU H;  3QJY A;  1EY6 A;  3KOJ A;  3GDE A;  1TWF B;  3I4L A;  3M9B A;  1EOV A;  1TU2 B;  1F9Q A;  1PH7 A;  1PH5 A;  3D4D A;  1ASZ A;  1AN8 A;  2IW3 A;  5KNB A;  2VQE Q;  2F0N A;  1D1K A;  3HG9 A;  2PQA B;  1VQL A;  2D62 A;  4NKL A;  2R7Z H;  2XNA C;  5CV4 A;  1RJT A;  4YHH Q;  2PI2 E;  1Q1E A;  2F4V L;  1E2V A;  3X3N A;  3PO3 G;  2VS1 A;  3C2P A;  1EY0 A;  5EJW A;  3U4V A;  4AYB G;  1U5K A;  4LF5 Q;  1JJC B;  1G6P A;  4IFD I;  2LKV A;  1RCV D;  1BCP D;  3S17 B;  1BF4 A;  2Y0S G;  1HNZ L;  4IFD G;  3W5O A;  2DNC A;  2F03 A;  1SFO B;  4DR5 L;  4A3E G;  2F0W A;  1SYF A;  1D2B A;  3RMH A;  1CA6 A;  3GD7 A;  2A1A A;  1K8M A;  1MJC A;  1PTO D;  4IN3 A;  3CC2 A;  4BBR G;  3VYS A;  5JPM C;  3H09 A;  3OIQ A;  3BZK A;  4X3T A;  3FKI G;  3H91 A;  4NP5 A;  1HR0 W;  4AYB E;  3HOW B;  1KQS A;  2HCC A;  2XTI A;  1B8A A;  3F8T A;  4EQ5 A;  1MJE A;  2PI2 A;  4GN5 A;  2K33 A;  2MQH A;  3A5Z B;  5IGC A;  2Y0S E;  3TEH B;  2PCF B;  4UP8 A;  1QOH A;  2K5Q A;  4IUN A;  3URY A;  2XWJ B;  1TT2 A;  2BDO A;  2I5M X;  3DM1 A;  1I4R A;  5COY A;  2VQF L;  4GN3 B;  4XQJ A;  4KLK A;  2RA4 A;  4HAE A;  1D1I A;  3KF8 A;  1XPU A;  4A3C G;  4WJW A;  3ONA B;  5KND A;  4KHP L;  4A93 B;  4QUF A;  3RZO H;  3K5L A;  2PNR C;  4B3M Q;  4ID6 A;  4KMU C;  1X3G A;  1VQ9 A;  1OXS C;  1AZP A;  2ZM6 Q;  1E3P A;  2NVY H;  4HIK A;  1S3O A;  1CUK A;  2B39 A;  4KI0 A;  4A3J B;  4DUY L;  4WOR A;  1N32 L;  3MZ5 A;  2JXM B;  4JV5 Q;  1ENF A;  2F0V A;  3NE5 B;  4I7A A;  3KJO A;  1SSO A;  2E76 C;  4LNQ A;  1BCP C;  1SEB D;  5IYB H;  2Z6B A;  1II3 A;  4DV5 L;  2OQK A;  1Y1W B;  1JMC A;  4LFA Q;  2L4N A;  1BUV T;  1CK1 A;  2YV5 A;  3KUP A;  1I4G A;  3NTH A;  3NXW A;  4YY3 L;  2AKW B;  4QUC A;  4GNX B;  4C3H B;  1TS2 A;  3PO2 H;  1QJO A;  1TS4 A;  1SE8 A;  3B6Y A;  2LFN A;  2WB1 B;  3H3V H;  3H0G H;  1PTO C;  4B3R Q;  5FLM H;  2JA5 G;  4L5R C;  3OSO A;  4KKT A;  4X66 Q;  1QWY A;  3GV6 A;  4F8M A;  3VYR A;  5IT9 c;  4AIM A;  4RG1 A;  2UUC L;  4HED A;  1JE5 A;  4OWX B;  1YBY A;  2CQO A;  3FHW A;  5JAV A;  1SYB A;  1KNE A;  1PRT B;  3HOX G;  4MIU A;  2JA6 G;  4XXE A;  2RCN A;  4JI6 L;  5M5W B;  1Y1V H;  4JBM A;  2KHJ A;  2IX1 A;  3EN2 A;  2R92 G;  2N3S A;  4ZQ3 A;  4K8I A;  4C3I H;  3I55 A;  2F1M A;  1RD9 D;  1HUM A;  1R9T B;  2E2I B;  2QGQ A;  4N8F A;  1G51 A;  1X3E A;  5LMU L;  4JK1 C;  1LYL A;  3OWF A;  1JC7 A;  4V0B A;  4K2L A;  2RCF A;  1LTT D;  4BBS B;  2EYJ A;  4JI1 Q;  1ONL A;  4IUQ A;  2JA7 H;  3U9O A;  1JB7 A;  3R8B A;  4DUZ Q;  1TWH B;  2UXD L;  3PQI A;  1EY7 A;  1HA5 A;  5I6W A;  2E2J H;  1U4L A;  1B70 B;  2GVA A;  3E6Z X;  4NXN Q;  1Q86 C;  3JAM E;  1HXY D;  5GQO A;  1PH8 A;  4QIW B;  3P20 A;  5IGD A;  2M00 A;  2CWA A;  1VQ7 A;  4XQN A;  5TSS A;  4R4T A;  1IKM A;  3F2U A;  5AFW A;  3M4O B;  2H4O A;  2Q8R E;  5KNC A;  2KCN A;  3M7G A;  3M4Q A;  3CHB D;  3PO3 H;  4DR3 L;  1WTX A;  1I4P A;  1ML0 D;  1EEF D;  3KBG A;  1ZYR D;  3L9A X;  2B2Y C;  4JI4 L;  1IBL Q;  3A7L A;  3ITP A;  1X55 A;  3HOY H;  4AQY L;  4JI5 Q;  1I4X A;  4DXF A;  1B53 A;  3TME A;  1ESR A;  5IIF A;  3N6R A;  3GTM H;  1HFN A;  5KGU A;  2BE5 D;  1YJ9 A;  2FHT A;  4JI7 L;  1K83 H;  4BA2 I;  2KCC A;  4C2M H;  4G7O C;  4C1N I;  5GAE C;  4UHV A;  4ZUI A;  3SK6 A;  4DAY B;  2CCZ A;  3E0E A;  1VQM A;  5IP9 G;  2NZH A;  4NMZ A;  1TS5 A;  4MHE A;  1YI2 A;  4A3G B;  3S15 H;  4BBR H;  1UE5 A;  2MJ8 A;  5HY6 A;  5CV9 A;  5IOD A;  1H9R A;  1MHW C;  3H94 A;  1K28 A;  2V4D A;  1UEA B;  3NBH B;  4DV2 Q;  1EWI A;  2B2U A;  4IPC A;  1CQV A;  5E4X A;  3DUZ A;  1F9S A;  5FO8 B;  5JVG 3;  1V9P A;  1ESF A;  1Q46 A;  2A68 D;  3V05 A;  4JBK A;  1UUP A;  1JJ2 A;  2L9H A;  3J7A F;  1NJI C;  2EYM A;  2L5T A;  3UE0 A;  1J6Q A;  3JAM i;  1ILP A;  4X64 L;  4A3C H;  1H9S A;  2ALY B;  3EA6 A;  1F2L A;  4X65 Q;  1TWA B;  1SLJ A;  1JWS D;  3A54 A;  5IWA L;  2N8N A;  1CZG A;  1BBU A;  2WAQ B;  2I0Q A;  4X62 Q;  1BO0 A;  3NUC A;  1ZYR C;  2K1B A;  4G7H C;  2RKS A;  3TP7 A;  1DGS A;  1SYD A;  2F0F A;  1X65 A;  4A3D H;  4CJ1 B;  4DV7 L;  3FMC A;  3MC0 B;  4JI2 Q;  1KNA A;  4DNI A;  1OO9 B;  2V1C C;  4UY8 C;  2NB0 A;  3HS0 C;  3GTP B;  2BE5 C;  4HIM A;  1BXT A;  2NN6 G;  4AH6 A;  1K9M C;  4JBJ A;  4DV6 Q;  3I4N B;  2A6H D;  2IX3 A;  3I2Z A;  3Q24 A;  4L5Q A;  1VMP A;  5COR A;  4IPH A;  2O5J C;  2I5H A;  4DV3 L;  1CKN B;  3A7A B;  2AQ1 B;  5H1S E;  4HR7 B;  1Z9F A;  3U58 A;  4WRD A;  3NTI A;  1WCM B;  4DR6 Q;  4H13 C;  3K5M A;  4XIG S;  1TR5 A;  3CPW A;  2WP8 J;  3ULJ A;  2CFM A;  1RL2 A;  4IUV A;  2SNM A;  2A68 C;  2QDL A;  3AYH B;  3DWA A;  2HHH Q;  3AB9 A;  1E1O A;  2B2V C;  4DKA C;  3DLL A;  3KDF A;  4FNF A;  3T1H L;  2LXK A;  3VYU A;  1AEX A;  3I4M B;  1MGS A;  1BOS A;  2X6L A;  5FK9 C;  4KTA A;  4POG A;  5DM7 3;  2PZU A;  2EY1 A;  3R2T A;  4HJ9 A;  4OO1 G;  1AE3 A;  4ODG A;  1N9W A;  4MNO A;  5IE8 A;  1RTN A;  1KDA A;  1EIG A;  3MFY A;  4A93 G;  3WOF A;  1S40 A;  1WD0 A;  4NB3 A;  1S72 A;  4QJF A;  3SK5 A;  4XT1 B;  3Q23 A;  4X3S A;  1CSQ A;  1VQG A;  2PNH A;  4OGQ C;  3T13 A;  1FNW A;  4FXD A;  4P74 A;  2A19 A;  4L6T B;  1HUN A;  4K6D A;  3BG3 A;  4A3F H;  5IGE A;  2AHO B;  4A3J G;  1DOK A;  3M85 A;  3NP8 A;  1EQT A;  2A6H C;  1ZEQ X;  4O1N A;  4DV4 Q;  5LL6 X;  2CVR A;  1A8V A;  2IHE A;  3HRZ C;  3TRE A;  3QOL A;  3VR6 A;  1SMY D;  4A4I A;  1Y1W G;  4OX9 Q;  4R9W A;  2F0S A;  4XYQ A;  3CCE A;  1L0Y B;  3FPP A;  1DM0 B;  1NUC A;  4C1N K;  3CCR A;  3H3V C;  4GKK L;  4HID A;  2EVB A;  2F3I A;  1EWC A;  1F2Z A;  3AFQ A;  5ELF A;  2Z6K A;  4DU9 A;  4JOI A;  2FIN B;  5I9O A;  1ROD A;  2KCM A;  3NTK A;  3N52 A;  4HCS A;  4ZUJ A;  1I6H H;  3STB D;  5G3L D;  5IP9 H;  1DZ1 A;  4Y7N B;  4FF3 A;  3GTK H;  4OIJ A;  4DK3 C;  2E2H H;  2L1B A;  1Y8O B;  3KBX A;  3J81 j;  3QWN A;  1ICF B;  3I8Z A;  1KL9 A;  3A74 A;  3A8J E;  2PZW A;  2RF4 A;  2WB1 E;  3SR1 A;  5LMN Q;  2N49 A;  2JP1 A;  1YNJ D;  2ZTE A;  4CDE C;  3DM3 A;  2B29 A;  5FKA C;  1JB3 A;  4FO2 A;  2K5W A;  2MUY A;  4H7B A;  1GHJ A;  1VQO A;  4HSP A;  2JE6 I;  2QEJ C;  1HZB A;  5C6A A;  4BBS G;  2R6G A;  3CAM A;  5T1G A;  3CCU A;  1XPO A;  1J5E L;  4DR7 L;  3Q22 A;  1BKB A;  1BQQ T;  2LS0 1;  4ZYS A;  2I46 A;  1C8C A;  2K01 A;  1CFM A;  2R93 B;  3K8A A;  5EBD A;  1SNC A;  4KHV A;  1TWF H;  1KIX A;  3F1Z A;  1VDZ A;  3NPP A;  5I6Y A;  1YNN D;  3CPF A;  1DCZ A;  1LTR D;  4GKJ L;  4RGM A;  4I7Z C;  1XJV A;  5JJL A;  2ZTD A;  1TXY A;  1L2F A;  2SNS A;  2G9D A;  2F3V A;  3ND8 A;  1WI5 A;  1XMQ L;  3HKZ B;  2N88 A;  5D14 A;  3GTJ H;  4P75 A;  2ES2 A;  1GM5 A;  1JR0 D;  1X6O A;  2LXJ A;  1N36 L;  1VQ6 A;  1I4Q A;  1KDC A;  3BYY B;  1EYC A;  1WTR A;  2HIX A;  2JJQ A;  4YWL A;  3STB C;  3MA2 B;  1D5M C;  5AJ3 L;  4A3K G;  2F0L A;  4N8X 1;  2EPB A;  4DNR B;  1HNZ Q;  1HCZ A;  1B50 A;  1PZJ D;  5IYB G;  3S17 H;  4DR5 Q;  3HOZ B;  4NXM L;  3H3V I;  1SFO H;  5C5M A;  3PO2 G;  2RQX A;  5BN4 A;  1NMF A;  2Q2H A;  4LF7 L;  5HGQ A;  1HNX L;  1YVC A;  1YNJ C;  4A3G G;  1B9M A;  5J1Z A;  1VF7 A;  1I50 B;  4CJ0 B;  1U0L A;  3KFU A;  1K3B C;  5M5Y B;  1EY8 A;  1TY0 A;  1CTM A;  3HOW H;  3ERQ A;  2RSN A;  3FP9 A;  1F2Y A;  2N55 A;  1HQM C;  1IKL A;  5A35 A;  1Z6H A;  4JG2 A;  5C4X B;  3BS1 A;  2F0M A;  4ZRZ A;  5K36 G;  1LT3 D;  1PH1 A;  1JIC A;  1YNN C;  2I5L X;  2HCI A;  4OO1 H;  1E0B A;  4WJ3 M;  3S2D B;  1IW7 D;  5IT9 L;  1SE4 A;  1GUN A;  1YJN A;  4A93 H;  2ZJR A;  2NVQ B;  5EGT A;  2JA8 B;  4LF4 L;  3HZX A;  4DV1 L;  4O0A A;  4WFN 3;  2KA7 A;  5CV7 A;  2A8V A;  5EPL A;  2F0P A;  1D5X C;  1TKW B;  4A3J H;  3PUX A;  3C1E A;  4OEL B;  3CCQ A;  5E3F A;  2Q2T A;  4DV5 Q;  4CKB A;  4WJ4 A;  5D3I B;  3R2I A;  3D4R A;  4YY3 Q;  1PYW D;  1VMC A;  1C9O A;  3VR5 A;  5BR8 Q;  3K6O A;  1Y1W H;  3CC4 A;  3CCL A;  1UNS A;  1YIJ A;  2F0O A;  5NUC A;  1LT4 D;  3KLS A;  3BDL A;  1LO5 D;  3AFP A;  3M3Y B;  3MXN A;  2SEB D;  4EX5 A;  1KDB A;  2DJF C;  3ER0 A;  4K8J A;  4RCN A;  4RWS C;  2X69 A;  4LF9 L;  4BXX G;  2F0I A;  3L0O A;  5C44 B;  2J7Z A;  1YIT A;  3A0J A;  3TN2 A;  3NQI A;  3TZU A;  2UUC Q;  3IFT A;  2B3G A;  5GAD C;  3BVG A;  3OYY A;  5KRU A;  1SE3 A;  2IPK D;  3HOY G;  5LMN W;  3NEL A;  2OT2 A;  2OTJ A;  2E75 C;  4PZ6 A;  5CMD A;  2QCP X;  2K04 A;  1WD1 A;  3CQZ B;  2DY7 A;  3NBH A;  4OIK A;  4RAU C;  1GO3 E;  4EGV A;  1X3Q A;  4JI3 Q;  1FJG L;  3AQQ A;  5M5W H;  4BY7 B;  4DFA A;  1TS3 A;  1EYG A;  4RCO A;  3T4A C;  1VQJ A;  1O7Y A;  2LSS A;  1S4Z A;  4JI8 Q;  5A2Q L;  4R8N A;  1IW7 C;  5CV8 A;  5M3F G;  3ICE A;  1NTG A;  5LMU Q;  1QVG A;  3GQB A;  3I4M G;  2UXB L;  1R9T H;  1LUZ A;  1PA6 A;  2E2I H;  5GAG C;  1SXT A;  2FMM A;  1H95 A;  1SAP A;  5HUR A;  1HHV A;  4RGO S;  5ELN A;  3VR4 A;  2AQ2 B;  2B2U C;  4R4I A;  2XN9 C;  4BBS H;  2YYZ A;  3J7Y W;  2UXD Q;  1C48 A;  3NEM A;  3DWQ A;  1CHP D;  2QIL A;  5ELE A;  3MWY W;  4YWM A;  1AP0 A;  1TWH H;  4O2D A;  1EYA A;  3CCM A;  5M3M B;  1SRU A;  2HT1 A;  3E9I A;  3K7A B;  2BOS A;  3UDI A;  4KN4 C;  1XNQ L;  4JI0 L;  2Q8T A;  1XYI A;  1Q90 A;  2QF7 A;  1VQH A;  1HNW L;  3S1Q B;  2VB2 X;  3O13 A;  3RLN A;  2KED A;  1KXL A;  1C4Q A;  4R4Q A;  3CME A;  3M4O H;  4OWW B;  1CHQ D;  1OXV A;  2H5X A;  2M9V A;  1N34 L;  4FP5 D;  4DR3 Q;  5EPJ A;  1KRT A;  1GUS A;  4K0K L;  2NYZ D;  5JPN C;  4IZ8 A;  3WDN A;  3BZD B;  4JI4 Q;  2XIW A;  1WJJ A;  5C0X J;  3L2P A;  3SHL A;  4AQY Q;  2MO1 A;  2HDL A;  1EFW A;  4LFB Q;  2PW7 A;  1EZ8 A;  1Y14 B;  4A3K H;  3QOJ A;  4A3D G;  2BH8 A;  3I91 A;  1YZ6 A;  2FMC A;  3GTQ B;  2EYF A;  1SYE A;  1NBW A;  2EDG A;  3U9S A;  2EXZ A;  1LTI D;  3OOC A;  3OTO L;  1PFM A;  1Y8N B;  2MFI A;  4HIO A;  3J80 L;  1PH4 A;  4DR4 L;  1QB5 D;  5F2D A;  1E2Z A;  1E24 A;  1EFI D;  3J81 c;  2Z4H A;  4A3I B;  4A3G H;  4IQZ A;  4RHS A;  3K0X A;  1YJW A;  1STH A;  1NMG A;  4KKU A;  2L11 A;  3KLR A;  1VS0 A;  4ILW A;  2OCE A;  2JSO A;  2RSO A;  3DWP A;  5D65 A;  3EVQ A;  4N9P A;  1MIU A;  1KD1 C;  2L12 A;  3K5O A;  2WKC A;  2X6G A;  4ULL A;  1L0X B;  1D8L A;  3IFD A;  3VA7 A;  3NQT A;  5ELB A;  5K36 H;  2N78 A;  3HFZ B;  3NWT A;  3SK8 A;  3T56 B;  3T1Y Q;  4ZLT F;  4B3T L;  3D6W A;  2MHV A;  1GHK A;  4RKL A;  2F0J A;  2VQE L;  1K3R A;  2GN5 A;  4X64 Q;  1RHP A;  4M8A A;  4CBV A;  1E22 A;  1A6X A;  4YHH L;  1ZXT A;  2F0D A;  1JCK B;  5IWA Q;  2FJ2 A;  4KY7 A;  4FF4 A;  1TWA H;  1WOC A;  3ZJY C;  2EYH A;  3GO5 A;  3S2H B;  4LF5 L;  2UXC L;  4MZ9 A;  4DA2 A;  4HJ5 A;  4DAP A;  4LUZ A;  4NPS A;  2H1E A;  2IL8 A;  5CR3 A;  3MFG A;  1G2S A;  3SDZ A;  2BDN A;  4JW0 A;  3S24 A;  4PNY A;  4GOP A;  2JA9 A;  3HKZ G;  4FDB A;  1KTK A;  5C4H A;  4QGU A;  2RBM A;  1BCP F;  3MEF A;  4S3S A;  3GTP H;  1PHJ A;  2WV6 D;  4A3F G;  1LM0 A;  1PMR A;  4DV3 Q;  3I4N H;  1KRS A;  2IHF A;  2MP1 A;  5KYL A;  5IYC H;  1V43 A;  1I3Q B;  3A56 A;  4B9W A;  2AUK A;  2PMZ B;  1QZG A;  4P72 A;  4B3S Q;  1CSP A;  2G5D A;  4BXX H;  3PGZ A;  4R8I A;  2TMP A;  3HOZ G;  5ELD A;  1PTO F;  1AH9 A;  3PIP A;  4KV6 A;  1TII D;  4LFC L;  1SDF A;  4BY1 B;  1DOL A;  2EY2 A;  5FLX L;  2O4X A;  3EIV A;  2RDG A;  1YHB A;  3QIA A;  4A3B B;  4K5X A;  2Z6K C;  4TSS A;  1SND A;  1PZI D;  1WCM H;  4JOI C;  5C0X H;  4ZKC B;  1B3A A;  1HZA A;  3HKZ E;  1DOM A;  4FXK C;  4UPA A;  1X9N A;  1QNU A;  4KY5 A;  3T1H Q;  4IOA A;  5GRO A;  5C3E B;  4LUV A;  1IBK L;  2F0Q A;  5IP7 G;  4OEM B;  3JC6 6;  5M3F H;  2CH4 A;  4ZKB B;  1L1O A;  4B08 A;  4IUU A;  4GLX A;  2B8F A;  1PRT D;  3I4M H;  1PYS B;  2ZM6 L;  2UU9 Q;  3OHX C;  1D5Z C;  3OPO A;  5C4Z A;  5EKI A;  3HGB A;  4JV5 L;  3CKI B;  2G9H D;  3LWU A;  2WFW A;  4LFA L;  1LT5 D;  4HN7 A;  1HJP A;  1WYD A;  2F3W A;  2NTT A;  2VUM B;  2EY5 A;  1PH3 A;  2KJX A;  1PXU A;  3BZC A;  3F2C A;  1QVC A;  1XX8 A;  4KD3 A;  3D6C A;  4FVM A;  4X66 L;  1AZQ A;  3RN2 A;  1SNO A;  4IUR A;  3K5N A;  1A0I A;  4EQO A;  2ZTC A;  1H9J A;  2F0H A;  4LWC A;  4OXP A;  3TP5 A;  5IYD G;  2UUA L;  1TWG B;  4GKK Q;  1CKM A;  4ALP A;  2D0P A;  1U4P A;  5JEA J;  3KF6 A;  2XSC A;  4C3I B;  2XWB B;  3RNU A;  5K5P A;  3J80 c;  4KN7 C;  1VQK A;  3A8I E;  1SE2 A;  4PQX A;  1NR4 A;  2NN6 I;  2WII B;  2WKD A;  1K0R A;  4RKB A;  2YTV A;  1NAP A;  4BA1 I;  3HOV B;  4DF7 A;  4C3J B;  1VQI A;  4JPB W;  2EOT A;  3CP0 A;  1LTB D;  1FGU A;  1QZH A;  1PRT C;  2KEN A;  2Q2U A;  3RLF A;  1XMO L;  1VQF A;  1KAB A;  1PFS A;  5J3B A;  1IZ6 A;  4BY7 G;  1UAP A;  2FXQ A;  4LF8 L;  1N33 L;  4FYD A;  4LW1 A;  3K80 C;  1FR3 A;  2FFK B;  3KF8 B;  3TS2 A;  1LLR D;  4NXN L;  1VQP A;  5FOB B;  4JC0 A;  2NZO A;  2AMC B;  3EJI A;  4JYA L;  4QL5 A;  1H9M A;  4C56 C;  2EJG C;  1BBX C;  4JCV E;  5IT9 E;  1XNR Q;  3I56 A;  4YCV A;  3QR8 A;  4GLV B;  3DEO A;  1AE2 A;  2MNA A;  3HOW G;  4M1U B;  3PUY A;  5IOC A;  1GVP A;  1O7I A;  1A15 A;  4QB4 A;  1M8A A;  4X3U A;  3NHH A;  2DNE A;  4AYB B;  4OO1 I;  1M4V A;  4P2C B;  5M3M G;  1PVO A;  3G48 A;  3LX0 A;  2R93 H;  2D5D A;  2EXD A;  2NTS A;  3G6J B;  4DR1 Q;  2KHI A;  3D0F A;  3PIO A;  2L0C A;  3NEN A;  4L5T A;  3TS0 A;  4G7Z C;  3V2T A;  3GP7 A;  3HKS A;  1DYQ A;  1HH2 P;  2Z8L A;  1WTP A;  3M7N A;  1EL0 A;  1H9K A;  4A3E B;  1JOO A;  2E8G A;  3DMU A;  1J8I A;  1LTS D;  4CGY B;  1UE7 A;  4R4C A;  5M9O A;  2J0T D;  2PQA A;  2ASB A;  3W1G A;  2EY6 A;  2JQO A;  4XTC S;  5FLX c;  1VCI A;  3SXH A;  4K6L A;  3FKI B;  1NR2 A;  1STN A;  3I73 A;  3T51 B;  5I2X A;  4NXM Q;  2KHS A;  3MEH A;  1STB A;  4RGT A;  1PRT F;  4GS3 A;  4U68 A;  5M5X B;  3HOZ H;  2E74 C;  5JOB A;  4F7X A;  3TP8 A;  4C3H G;  4LF7 Q;  4K5W A;  1HNX Q;  2VL6 A;  1X3P A;  2EE1 A;  1LAC A;  4HSV A;  2EYL A;  2WB1 G;  4A3I G;  4ZCK A;  3J81 i;  1EQR A;  1I50 H;  5A2Q E;  1BDO A;  2K14 A;  1ET6 A;  1B44 D;  4DN4 M;  2WAC A;  5IP7 H;  2F52 A;  1C7Y A;  3G71 A;  4QCL A;  1PZK D;  3K58 A;  5C4X H;  4X62 L;  2UUB Q;  1XPR A;  2KEE A;  2D0O A;  3DHQ A;  4IJL A;  3E5S A;  1V1P B;  2VZA A;  2ZXO A;  3S2D H;  3CCS A;  1IYJ B;  2B2T A;  2K5V A;  2C9O A;  4ME3 A;  1UE1 A;  3ZYY X;  1XXG A;  1MBY A;  2K32 A;  4GN4 B;  2KCT A;  2NVQ H;  4DV6 L;  5FJ8 G;  1AW7 A;  2MO0 A;  5IGF A;  1HQR D;  2A74 C;  2HUG A;  2JA5 B;  3BJU A;  1L0W A;  1E1T A;  3PSI A;  1K73 C;  4CHT B;  1DD2 A;  1SMX A;  2ZJP A;  1BR9 A;  2K5H A;  2TSS A;  1SMY C;  3RZD B;  2XVS A;  4OL7 A;  3TZD A;  1WTV A;  3KJP A;  1EIF A;  2Z4I A;  5IGB A;  5C4J B;  3HOX B;  3S1R B;  5CGK A;  2JA6 B;  5IYD H;  3MVV A;  2EYP A;  1ENA A;  3M3Y H;  3H6M A;  5DEH A;  4LF9 Q;  2R92 B;  1KHI A;  3FRP B;  1DXM A;  2HHH L;  4GNX A;  1A2U A;  4P73 A;  3S14 B;  2F4V Q;  4JBW A;  2D2C C;  1FGB D;  5I9P A;  1I94 L;  3H15 A;  4A3M B;  2ATW A;  2K03 A;  2QA4 A;  4BY1 G;  2K5D A;  3J80 E;  3VA5 A;  3FVQ A;  4F87 A;  2YU9 B;  5LHY 1;  2J4X A;  1JWM D;  1FJG Q;  4XT3 B;  3RN5 A;  2HIV A;  1T9H A;  1KLU D;  2A5H A;  1JQY D;  3CQZ H;  1EU4 A;  1B4O A;  4MTN A;  4QMG A;  4QIW E;  2BH2 A;  4BY7 H;  2KOL A;  1SJE D;  4FF1 A;  4PV1 C;  2PYK A;  1AFP A;  4PZ7 A;  1H9S B;  2OEO A;  2PMZ E;  4FXG C;  1EIY B;  3IRB A;  1DJR D;  5CC4 A;  5I2Y A;  1GUG A;  2B63 B;  1TWC B;  4EQP A;  1EOT A;  4DV4 L;  1GXD C;  3D4W A;  1Q12 A;  3L7Z C;  1EYD A;  1HZ9 A;  3R93 A;  1OXU A;  3ULL A;  1SRO A;  3GV3 A;  3K81 C;  2NVT B;  5CBA E;  3K0Y A;  4UAI A;  4LF6 L;  2Q8I B;  3J81 L;  3J7A V;  4JI0 Q;  5M3M H;  2BA1 A;  2VQF Q;  1NE3 A;  3Q6S A;  3K7A H;  4F88 A;  4OWT B;  4NDX A;  2VUM G;  1HNW Q;  4K2K A;  3C3L A;  3HEJ A;  5DLQ E;  1BCP B;  4APV A;  4KHP Q;  4BWG B;  1SR3 A;  2VXW A;  5CV5 A;  1B9N A;  3S1Q H;  3IL8 A;  3G4S A;  1R4Q B;  4DNT B;  1G8Z D;  4Q5V A;  4CJ2 C;  2ENB A;  4U67 3;  1QUQ B;  3OWE B;  2WAQ G;  4DUY Q;  5BN3 A;  1N32 Q;  2L55 A;  1PTO B;  4DK6 C;  1ILQ A;  5J22 A;  2R7D A;  2OF1 A;  1IYV A;  4GOP C;  3P1H A;  4A3L G;  1CI3 M;  1TVX A;  3J80 i;  3NBI A;  5C5L A;  3ULP A;  5G3L F;  4DR2 L;  1Q81 C;  2NVX B;  2NWG A;  5LMN L;  3GTQ H;  1VQ5 A;  1BVS A;  3OTO Q;  3HOV G;  2NBF A;  4C3J G;  5EKK A;  3C1F A;  4C3H H;  3I4N G;  5IYC G;  1S5D D;  4DK1 A;  4ME5 A;  4ZK9 B;  2GA4 B;  3K7U C;  4DAY A;  4A3I H;  2WAQ E;  1IBM L;  3NK9 A;  3D8G A;  5C0X I;  2K4K A;  4IAL A;  2JYO A;  2ZXP A;  1NNX A;  4ZAI A;  1Z7T A;  1QNK A;  1WCM G;  5C0X G;  3GTG B;  2IX0 A;  4JI6 Q;  1HR0 L;  4B3T Q;  2KEC A;  1G2T A;  4QY7 A;  1L1O C;  1G91 A;  3GTJ B;  4KD4 A;  1YNX A;  4KJN A;  1STY A;  3FPU B;  4PZ8 A;  3S1M B;  2UXC Q;  3RR5 A;  4LK1 C;  5FJ8 H;  3S2H H;  4DGZ A;  2KBN A;  1EY9 A;  2D9U A;  1A2T A;  2EJM A;  3CRL C;  5CV6 A;  3K57 A;  4Y52 H;  3EBE A;  4MTK A;  1FVI A;  1Q1B A;  2OTL A;  1IHZ A;  3U50 C;  2R7F A;  1UEB A;  2K75 A;  1GUW A;  1GJX A;  3UDF A;  4RH6 A;  2KUM A;  4DAM A;  3KYH C;  1PFN A;  1ASY A;  2B2W A;  1I3Q H;  3OW2 A;  1NSN S;  4LFC Q;  4CKE A;  4DV0 L;  3GTL B;  1W3S A;  3UDG A;  4DAV A;  1CKN A;  5JJK A;  3S16 B;  4HJA A;  4BY1 H;  1A3T A;  1JOR A;  3PCO B;  4A3B H;  5JJZ A;  3UDX A;  3TBI B;  3MAQ A;  3S1N B;  4JI7 Q;  2HDM A;  1IBK Q;  4KK7 A;  5KIX A;  1PV4 A;  1JJG A;  1ZKO A;  2E5L L;  3I72 A;  2ZT9 C;  5C3E H;  3G6E A;  1KC8 C;  1HTP A;  2VNU D;  1Y8P B;  3GTO B;  2LY7 A;  2O5I C;  3HOU B;  1A3U A;  4IFD J;  1Q8I A;  4G57 A;  1LAB A;  1MD2 D;  1XWE A;  4QF4 A;  3TRZ A;  1T5E A;  2F4I A;  1F77 A;  1WTW A;  2PW5 A;  5BR8 L;  5EKL A;  3QO2 A;  2L15 A;  1CM9 A;  1QVF A;  1JOQ A;  1STG A;  2EYO A;  1LTL A;  1VQA A;  2K7V A;  2CQA A;  1Q82 C;  2R7Z B;  2O2L D;  2VUM H;  4TQU S;  4RMF A;  1UWV A;  2PPB C;  1SN8 A;  1EQV A;  1VQN A;  1J9O A;  5GAH C;  3CU7 A;  2VY3 A;  3PF5 A;  2ICE C;  5C3X A;  2VB3 X;  2R93 G;  2UUA Q;  1Y69 U;  3MXP A;  3ERS X;  1LV9 A;  4R1J A;  1EUJ A;  3M4Y A;  5ELO A;  1TWG H;  1UE6 A;  4HMI A;  4JI3 L;  1XTC D;  4A3L H;  4POF A;  1A63 A;  4O42 A;  4DV7 Q;  2ZJQ A;  3PMF A;  3J7A 5;  1YEZ A;  1S5E D;  4EQN A;  1M1K C;  4JI8 L;  1RIP A;  4A3M G;  3OMG A;  1IYU A;  2Z9H A;  2BA0 A;  1V8Q A;  1X32 A;  4KJO A;  3HOV H;  1ICW A;  5CBE E;  1VQD A;  4C3J H;  4FF2 A;  1GOZ A;  3OW7 A;  2OQ0 A;  5J39 A;  1XMO Q;  1Q3L A;  2EQS A;  4ABN A;  1N33 Q;  4I65 A;  4LF8 Q;  3PUW A;  1U9R A;  4HTH A;  1JE4 A;  1K8G A;  3HP3 A;  1JWU D;  3QB3 A;  3I4O A;  2JEA I;  1RF2 D;  1LTG D;  3TQY A;  5D3D A;  4MN3 A;  3EQL C;  2E2D C;  4RA8 A;  2SDF A;  1V1P A;  1WVL A;  4JYA Q;  3FEW X;  2ZXR A;  2WIN B;  3D31 A;  2F0K A;  5JEA G;  1KAA A;  4K5V A;  3RZO B;  4LUO A;  2GVB A;  2B63 G;  2RDF A;  3MXU A;  3J7Z C;  1O80 A;  5HGT A;  1W2B A;  4L63 B;  4IPD A;  4A75 A;  4B3M L;  1RDP D;  3IAY A;  1NCV A;  2NVY B;  3MTS A;  1B3Q A;  3FDT A;  3RUZ A;  5C4X G;  4EVO A;  4L8J A;  5LL6 S;  1U4R A;  3WOE A;  4B9X A;  1X3F A;  3MXG A;  2IY5 B;  4A3K B;  4N9T A;  2DJG C;  2B2T C;  4OHJ A;  3PV0 A;  1EY5 A;  5FO9 B;  4LFB L;  1EIH A;  1NY4 A;  4PG3 A;  1WTO A;  3A55 A;  3MXN B;  4IFD H;  1O7Z A;  4TKO B;  1B2T A;  1FYC A;  4A3E H;  3PO2 B;  2K28 A;  1MKH A;  4YCU A;  1T5X D;  2SOB A;  3ERO A;  3P7J A;  1MSG A;  1MSH A;  2JN4 A;  2JA8 G;  3ND9 A;  3H0G B;  1P16 A;  2F0E A;  1CQF A;  4HMJ A;  1FNU A;  5ISR A;  1JT8 A;  3Q0A A;  1EY4 A;  4UP7 A;  3FKI H;  1K8A C;  4B3R L;  5DAU A;  3AMU A;  2KQ3 A;  4YCW A;  1STE A;  3LWE A;  4X6A H;  2AUJ D;  2OXP A;  4J6H A;  1D7Q A;  4H0L C;  1PFB A;  5EAY A;  5M5X H;  4GNX C;  2A73 B;  1Y1V B;  1A3V A;  3P75 A;  3KLW A;  3IKJ A;  3T1Y L;  3CCJ A;  2JK8 A;  2YTX A;  3PIP 3;  4YIJ A;  4YWK A;  5C44 G;  1FD7 D;  2A6E D;  4J8Q A;  2K52 A;  4K14 A;  1W6K A;  2EIF A;  1V1Q A;  1QG7 A;  2B8G A;  5IY0 A;  2JA7 B;  4Y7N H;  3T53 B;  3V96 A;  1SNQ A;  4JI1 L;  2K5N A;  3W3A A;  2E2J B;  1TQO A;  4DUZ L;  1PLF A;  1Q8K A;  4R4O A;  4IUP A;  2DUD A;  2K50 A;  1K8O A;  2EJF C;  1SNM A;  3J81 E;  3BVZ A;  4KHZ A;  2XRS D;  4H02 A;  2IJ0 A;  2EZV A;  4H44 C;  1W6J A;  1OXT A;  2NZ1 D;  2F0G A;  4IUT A;  4NW2 A;  3E3X A;  1J5E Q;  2C35 B;  5EBC A;  4DR7 Q;  4LJZ C;  3OIP A;  2JA5 H;  3LNN A;  4B3S L;  1EWH A;  1QUQ A;  2ICI A;  2DGY A;  3PO3 B;  1S5B D;  3LGJ A;  3A8K E;  5IGG A;  2JEB I;  2K6A A;  3HOY B;  2Z1C A;  1XTD A;  1V1O A;  1O7L A;  4E6I A;  1VQE A;  3CRK C;  1HZC A;  2DY8 A;  3RZD H;  1IBL L;  4GKJ Q;  1A62 A;  4JI5 L;  3HOX H;  2Y0S B;  3GTM B;  5C4J H;  2JA6 H;  1S5F D;  3S1R H;  1WTQ A;  1K83 B;  5CYU A;  4C2M B;  1B1Z A;  1VF5 C;  2C5C A;  5JVH 3;  1SBB B;  3E0J A;  1RTO A;  3SGI A;  1XMQ Q;  2R92 H;  1BNZ A;  1QE6 A;  1X54 A;  1I94 Q;  5M3F B; 
#chains in the Genus database with same CATH homology
 3S14 H;  4YWM A;  3M4Q A;  1TWH H;  4O2D A;  1N36 Q;  3RLO A;  3CCM A;  3PO3 H;  4IPG A;  4PZ7 A;  4DR3 L;  1SRU A;  2HT1 A;  3E9I A;  2PMZ E;  4A3M H;  3UDI A;  1EIY B;  4JI4 L;  3IRB A;  1IBL Q;  1XNQ L;  1X55 A;  4JI0 L;  3HOY H;  4AQY L;  5AJ3 Q;  4JI5 Q;  2UU9 L;  1VQH A;  1PH2 A;  2YU9 H;  1HNW L;  4DV4 L;  3RLN A;  1KXL A;  1Q7Y C;  3GTM H;  1Q12 A;  3L7Z C;  4R4Q A;  5E7N A;  1HZ9 A;  4DPG A;  1K83 H;  3CME A;  1YJ9 A;  4C2M H;  4JI7 L;  1BBW A;  1OXU A;  3ULL A;  3Q8D A;  3M4O H;  4BA2 I;  1SRO A;  1OXV A;  2H5X A;  4OWW B;  5GAE C;  3K81 C;  1N34 L;  1PYB A;  4DR3 Q;  4DAY B;  4DV2 L;  1KRT A;  2CCZ A;  3E0E A;  1VQM A;  4K0K L;  5IP9 G;  4LF6 L;  3F2B A;  2NZH A;  4JI4 Q;  1YI2 A;  4OON A;  1WJJ A;  5M3M H;  2BA1 A;  5C0X J;  3L2P A;  1NE3 A;  2VQF Q;  4AQY Q;  4JI0 Q;  3S15 H;  3K7A H;  1B7Y B;  2MO1 A;  4BBR H;  1UE5 A;  4OWT B;  2VUM G;  1EFW A;  1HNW Q;  1I5F A;  5HY6 A;  4LFB Q;  1CKO A;  1Y14 B;  5DLQ E;  4A3K H;  4APV A;  4KHP Q;  2IT1 A;  1SR3 A;  3HOU G;  2BH8 A;  4A3D G;  1YZ6 A;  1TWC H;  2B63 H;  3S1Q H;  1VQC A;  1M90 C;  3CMA A;  4A76 A;  3NBH B;  4X65 L;  5M5Y H;  2Q2I A;  4DV2 Q;  1EWI A;  3G4S A;  1VQ4 A;  1NBW A;  4IPC A;  4LF6 Q;  1PH6 A;  1QUQ B;  1V9P A;  3VDY A;  2NVT H;  1KAW A;  1Q46 A;  4HJ8 A;  2WAQ G;  3OTO L;  4DUY Q;  2MFI A;  3WWV A;  4JBK A;  4HIO A;  4DK6 C;  4GOP B;  1PH4 A;  1JJ2 A;  4DR4 L;  1N32 Q;  2R7D A;  1E24 A;  3J81 c;  4GOP C;  1NJI C;  4A3G H;  3UE0 A;  4A3L G;  3K0X A;  2R7Z G;  1YJW A;  1J6Q A;  3UE1 A;  3JAM i;  1NMG A;  4X64 L;  2RHQ B;  3J80 i;  1VS0 A;  4A3C H;  3ULP A;  2OCE A;  2ALY B;  4X65 Q;  4DR2 L;  1Z47 A;  1SLJ A;  4JI2 L;  1Q81 C;  5LMN L;  5IWA L;  1MIU A;  1KD1 C;  4LF4 Q;  4DV1 Q;  2N8N A;  3GTQ H;  3PUZ A;  1BBU A;  2Z0S A;  1BVS A;  3OTO Q;  4X62 Q;  1VQ5 A;  2I0Q A;  3HOV G;  1D8L A;  3I4N G;  4C3H H;  2JA8 H;  5IYC G;  5JJI A;  4HJ7 A;  2N78 A;  3HFZ B;  2YTY A;  3CCV A;  3T1Y Q;  4B3T L;  4IO9 A;  4BY7 G;  2VQE L;  1IXR A;  1K3R A;  2GN5 A;  3K7U C;  1DGS A;  1GD7 A;  4X64 Q;  4A3I H;  2OWO A;  2WAQ E;  4IOC A;  1X65 A;  1E22 A;  1IBM L;  4QQB X;  1WFQ A;  4A3D H;  4DR2 Q;  4DV7 L;  5C0X I;  2K4K A;  4YHH L;  4JI2 Q;  4DNI A;  2V1C C;  4UY8 C;  5IWA Q;  4HIM A;  2HQL A;  1TWA H;  2NN6 G;  2XGT A;  4AH6 A;  4JBJ A;  4DV6 Q;  1K9M C;  2NVX H;  1WOC A;  3I2Z A;  1WCM G;  3ZJY C;  3GO5 A;  5C0X G;  4L5Q A;  4LF5 L;  4DR6 L;  4MZ9 A;  4IPH A;  2UXC L;  2I5H A;  2IX0 A;  4DV3 L;  1CKN B;  4HJ5 A;  1HR0 L;  4B3T Q;  4JI6 Q;  4J15 A;  4LUZ A;  4NPS A;  3PF4 A;  1L1O B;  1XNR L;  1PH9 A;  4QY7 A;  1IBM Q;  1L1O C;  5H1S E;  3F2D A;  1Z9F A;  1E7Z A;  1YNX A;  3S24 A;  2AWN A;  5C44 H;  3A5U A;  3U58 A;  4GOP A;  3AEV A;  2JA9 A;  3CD6 A;  3HKZ G;  4FDB A;  4QGU A;  1GKH A;  3MEF A;  1OTC A;  3GTP H;  4PZ8 A;  1PHJ A;  4DR6 Q;  2UXC Q;  4A3F G;  3RR5 A;  1LM0 A;  3CXC A;  4DV3 Q;  1HR0 Q;  4A3B G;  4XIG S;  1C0A A;  3CPW A;  2WP8 J;  5FJ8 H;  1KRS A;  3I4N H;  2IHF A;  3ULJ A;  2CFM A;  5IYC H;  4DR1 L;  3S2H H;  1RL2 A;  1V43 A;  3GTG H;  3AYH B;  2KBN A;  2HHH Q;  1X56 A;  1QZG A;  4P72 A;  4B3S Q;  1CSP A;  1E1O A;  4BXX H;  4DKA C;  3PGZ A;  3DLL A;  4GLA C;  4Y52 H;  3KDF A;  3T1H L;  3EBE A;  3HOZ G;  1FVI A;  5C3E G;  1AH9 A;  1Q1B A;  2LXK A;  4TVA B;  4LFC L;  3PIP A;  3U50 C;  2OTL A;  2R7F A;  2UXB Q;  4POG A;  1UEB A;  3EIV A;  2K75 A;  1YHB A;  2Z6K C;  3UDF A;  4HJ9 A;  3W1B A;  1WCM H;  4JOI C;  1P8L A;  3S1M H;  1IL2 A;  1HZA A;  4DAM A;  3HKZ E;  4OO1 G;  4UPA A;  1AE3 A;  1X9N A;  3KYH C;  1ASY A;  1N9W A;  4MNO A;  5IE8 A;  1I3Q H;  3OW2 A;  3T1H Q;  4IOA A;  5GRO A;  4LUV A;  1IBK L;  4A93 G;  2RHS B;  1S40 A;  4NB3 A;  1S72 A;  4QJF A;  4LFC Q;  4DV0 L;  3KF6 B;  1W3S A;  4IJH A;  3UDG A;  5IP7 G;  1VQB A;  1CKN A;  1CSQ A;  3JC6 6;  4OX9 L;  5JJK A;  1VQG A;  2PNH A;  5M3F H;  1YHA A;  1L1O A;  1G29 1;  1YHQ A;  4HJA A;  4P74 A;  2A19 A;  4GLX A;  1XNQ Q;  1FL0 A;  4BY1 H;  3I4M H;  1PYS B;  3BU2 A;  2ZM6 L;  4UP9 A;  4A3F H;  2UU9 Q;  3PCO B;  2AHO B;  3H0G G;  4PMW A;  4A3J G;  3M85 A;  4L5S A;  4A3B H;  3UDX A;  5FLM G;  4DV4 Q;  2VW9 A;  4P71 A;  2CKZ B;  1A8V A;  2IHE A;  4JV5 L;  3TRE A;  4JI7 Q;  3CW2 C;  1IBK Q;  1PV4 A;  4DV0 Q;  1JJG A;  1N34 Q;  4A4I A;  2E5L L;  1Y1W G;  2WFW A;  4LFA L;  4OX9 Q;  5C3E H;  4K0K Q;  3CCE A;  1VQ8 A;  1HJP A;  3GTL H;  1WYD A;  3G6E A;  1KC8 C;  3CCR A;  3S16 H;  3M4P A;  4GKK L;  4HID A;  2ID0 A;  1PH3 A;  2UUB L;  1Y1V G;  2VNU D;  2CWP A;  3CF5 A;  3BZC A;  2F3I A;  1EQQ A;  3F2C A;  3AFQ A;  1QVC A;  4IFD J;  3U4Z A;  2Z6K A;  3PUV A;  3CC7 A;  2E5L Q;  4JOI A;  3S1N H;  4X66 L;  3TRZ A;  3RN2 A;  2KCM A;  1A0I A;  3I7F A;  1I6H H;  3STB D;  5BR8 L;  2ZTC A;  3E9H A;  4LWC A;  4OXP A;  5IYD G;  5IP9 H;  3KDF B;  2L15 A;  2UUA L;  3GTK H;  1QVF A;  4DR4 Q;  4GKK Q;  4DK3 C;  2AWO A;  2E2H H;  1CKM A;  4ALP A;  1LTL A;  2QEX A;  1VQA A;  1Q82 C;  3JAM c;  1N8R C;  2D0P A;  5JEA J;  3J81 j;  3KF6 A;  2JA7 G;  2VUM H;  3RNU A;  3J80 c;  4TQU S;  1VQK A;  1KL9 A;  3A74 A;  3GTO H;  1OXX K;  4RMF A;  1UWV A;  2NN6 I;  1SN8 A;  3HOU H;  3KOJ A;  3GDE A;  1VQN A;  2RF4 A;  5GAH C;  2WB1 E;  5LMN Q;  1K0R A;  2VY3 A;  3PF5 A;  2YTV A;  2N49 A;  4BA1 I;  3M9B A;  1EOV A;  2ZTE A;  3DM3 A;  2R93 G;  2B29 A;  2UUA Q;  1VQI A;  3ERS X;  1PH7 A;  1PH5 A;  3CP0 A;  1FGU A;  4R1J A;  1QZH A;  1ASZ A;  1EUJ A;  5ELO A;  1VQO A;  1TWG H;  2JE6 I;  1HZB A;  2VQE Q;  4BBS G;  2KEN A;  1UE6 A;  2R6G A;  3CAM A;  2Q2U A;  2PQA B;  3CCU A;  1XPO A;  2D62 A;  4JI3 L;  3RLF A;  1J5E L;  4POF A;  1XMO L;  1VQF A;  1VQL A;  2R7Z H;  4DR7 L;  4A3L H;  1PFS A;  5J3B A;  1A63 A;  1IZ6 A;  4DV7 Q;  2FXQ A;  1BKB A;  2PI2 E;  4YHH Q;  4LF8 L;  2ZJQ A;  1Q1E A;  1N33 L;  3J7A 5;  1YEZ A;  2F4V L;  4LW1 A;  3K80 C;  2VS1 A;  4JI8 L;  1M1K C;  3PO3 G;  3KF8 B;  3TS2 A;  1RIP A;  3K8A A;  4NXN L;  4A3M G;  3U4V A;  1TWF H;  4AYB G;  1U5K A;  2BA0 A;  3F1Z A;  1VQP A;  1KIX A;  4LF5 Q;  4JC0 A;  1JJC B;  3CPF A;  1G6P A;  2NZO A;  3HOV H;  2AMC B;  4IFD I;  4JYA L;  1VQD A;  4C3J H;  4QL5 A;  4GKJ L;  2OQ0 A;  4JCV E;  1XNR Q;  1XJV A;  3I56 A;  4YCV A;  2Y0S G;  4GLV B;  1XMO Q;  2EQS A;  5JJL A;  2ZTD A;  1TXY A;  1L2F A;  1HNZ L;  1AE2 A;  2MNA A;  1N33 Q;  3HOW G;  3W5O A;  4LF8 Q;  4IFD G;  3PUW A;  1XMQ L;  1WI5 A;  3PUY A;  4DR5 L;  1K8G A;  1GVP A;  4A3E G;  1O7I A;  3I4O A;  2JEA I;  3GTJ H;  4P75 A;  2ES2 A;  1GM5 A;  4OO1 I;  3GD7 A;  2A1A A;  1X6O A;  2LXJ A;  3TQY A;  1N36 L;  1VQ6 A;  5M3M G;  1MJC A;  1PVO A;  3G48 A;  3CC2 A;  2R93 H;  4BBR G;  4JYA Q;  2HIX A;  2EXD A;  2JJQ A;  4YWL A;  3STB C;  4DR1 Q;  2KHI A;  3D0F A;  3PIO A;  4L5T A;  3NEN A;  5AJ3 L;  3TS0 A;  3D31 A;  4A3K G;  3BZK A;  5JEA G;  3FKI G;  1HR0 W;  4LUO A;  2GVB A;  3HKS A;  4AYB E;  1KQS A;  1HNZ Q;  1HH2 P;  5IYB G;  2XTI A;  2B63 G;  3J7Z C;  3M7N A;  3S17 H;  4DR5 Q;  1B8A A;  4NXM L;  1W2B A;  3F8T A;  4EQ5 A;  2E8G A;  4IPD A;  1MJE A;  2PI2 A;  4GN5 A;  4A75 A;  4B3M L;  3H3V I;  2MQH A;  3A5Z B;  2Y0S E;  1SFO H;  3TEH B;  1UE7 A;  3PO2 G;  4R4C A;  4UP8 A;  5C4X G;  2PQA A;  1NMF A;  2Q2H A;  2ASB A;  3W1G A;  2JQO A;  2I5M X;  4XTC S;  4LF7 L;  5HGQ A;  1X3F A;  5FLX c;  2VQF L;  4GN3 B;  1VCI A;  1YVC A;  1HNX L;  4A3G G;  2IY5 B;  3PV0 A;  4KLK A;  4LFB L;  1NY4 A;  1XPU A;  1U0L A;  3KFU A;  4A3C G;  4PG3 A;  4KHP L;  3MXN B;  4NXM Q;  3RZO H;  3HOW H;  4B3M Q;  3FP9 A;  1VQ9 A;  1X3G A;  1OXS C;  4GS3 A;  4A3E H;  3HOZ H;  1MKH A;  4YCU A;  4JG2 A;  2ZM6 Q;  4LF7 Q;  1E3P A;  2NVY H;  2JA8 G;  4HIK A;  1S3O A;  1CUK A;  1PH1 A;  4KI0 A;  1P16 A;  1HNX Q;  5K36 G;  2VL6 A;  4DUY L;  1N32 L;  2WB1 G;  1JT8 A;  2I5L X;  4A3I G;  4JV5 Q;  3J81 i;  1EQR A;  3FKI H;  4UP7 A;  3KJO A;  1K8A C;  4B3R L;  4WJ3 M;  1I50 H;  4LNQ A;  5IYB H;  4YCW A;  4DV5 L;  2OQK A;  1YJN A;  1JMC A;  2K14 A;  4LFA Q;  4X6A H;  2YV5 A;  4A93 H;  4YY3 L;  2AKW B;  2ZJR A;  1D7Q A;  5IP7 H;  4GNX B;  2F52 A;  1C7Y A;  3G71 A;  4LF4 L;  4DV1 L;  5EAY A;  5M5X H;  4GNX C;  3PO2 H;  1SE8 A;  4O0A A;  5C4X H;  4X62 L;  2A8V A;  3B6Y A;  2UUB Q;  1XPR A;  3H3V H;  2D0O A;  3KLW A;  3H0G H;  4A3J H;  3PUX A;  3T1Y L;  3CCJ A;  4B3R Q;  2JK8 A;  2YTX A;  4IJL A;  3CCQ A;  5FLM H;  2Q2T A;  2JA5 G;  4L5R C;  2VZA A;  4DV5 Q;  4WJ4 A;  4X66 Q;  4YWK A;  5C44 G;  3S2D H;  4YY3 Q;  3CCS A;  1C9O A;  5IT9 c;  1IYJ B;  2K52 A;  4AIM A;  2K5V A;  4RG1 A;  4ME3 A;  5BR8 Q;  1Y1W H;  2UUC L;  1UE1 A;  3CC4 A;  1JE5 A;  4OWX B;  1YBY A;  2CQO A;  3CCL A;  3FHW A;  4GN4 B;  1YIJ A;  2EIF A;  1V1Q A;  2KCT A;  2NVQ H;  4DV6 L;  3AFP A;  5FJ8 G;  5IY0 A;  3HOX G;  2MO0 A;  4EX5 A;  2JA6 G;  2RCN A;  3ER0 A;  4Y7N H;  4JI6 L;  1Y1V H;  4JBM A;  4JI1 L;  2KHJ A;  2IX1 A;  4LF9 L;  2K5N A;  3EN2 A;  2R92 G;  3BJU A;  4BXX G;  2N3S A;  3L0O A;  1L0W A;  1E1T A;  3PSI A;  4C3I H;  3I55 A;  1YIT A;  1K73 C;  4DUZ L;  1Q8K A;  3A0J A;  4R4O A;  1SMX A;  2UUC Q;  2ZJP A;  2DUD A;  2B3G A;  2K50 A;  2K5H A;  1G51 A;  2QGQ A;  3OYY A;  5GAD C;  1X3E A;  5LMU L;  1LYL A;  4KHZ A;  4H02 A;  3HOY G;  5LMN W;  3NEL A;  2OTJ A;  3KJP A;  1EIF A;  4PZ6 A;  5IYD H;  1OXT A;  3M3Y H;  4JI1 Q;  4LF9 Q;  1GO3 E;  2C35 B;  1KHI A;  1J5E Q;  4JI3 Q;  1FJG L;  4DR7 Q;  2JA7 H;  3AQQ A;  5M5W H;  2HHH L;  4GNX A;  2JA5 H;  1JB7 A;  4P73 A;  4DUZ Q;  1EYG A;  4B3S L;  2UXD L;  1QUQ A;  1VQJ A;  2F4V Q;  2DGY A;  2LSS A;  4JBW A;  4JI8 Q;  1I94 L;  2E2J H;  1B70 B;  2GVA A;  3LGJ A;  5M3F G;  3H15 A;  2ATW A;  1NTG A;  2JEB I;  5LMU Q;  1Q86 C;  1QVG A;  4NXN Q;  3ICE A;  1XTD A;  3I4M G;  2QA4 A;  5GQO A;  2UXB L;  4BY1 G;  1PH8 A;  1R9T H;  1LUZ A;  1PA6 A;  1VQE A;  2E2I H;  1HZC A;  5GAG C;  2CWA A;  1VQ7 A;  1H95 A;  3RZD H;  1IBL L;  4GKJ Q;  4R4T A;  5ELN A;  1A62 A;  4JI5 L;  3HOX H;  1FJG Q;  5C4J H;  2JA6 H;  3S1R H;  3RN5 A;  2HIV A;  1T9H A;  4R4I A;  4BBS H;  3CQZ H;  2YYZ A;  4MTN A;  2UXD Q;  3SGI A;  4QIW E;  1XMQ Q;  2R92 H;  3NEM A;  1X54 A;  1I94 Q;  2BH2 A;  4BY7 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...