4IZ8A

Crystal structure of staphylococcal nuclease variant delta+phs h8e at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LEKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS H8E at cryogenic temperature
rcsb
source organism Staphylococcus aureus
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2013-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4iz8A00
4ME5A 2NUCA 3OWFA 3PMFA 5C5LA 3S9WA 3D8GA 4ZUJA 5IGDA 3T13A 5IODA 2QDBA 3QB3A 1STAA 5JOBA 5C4ZA 3OMCA 4EVOA 1EY9A 1EZ6A 3ERQA 2EYMA 2PQEA 5CV4A 1SYGA 2F0LA 2F0NA 2SNSA 4F8MA 2EYLA 1KDCA 3D4WA 1SYDA 2EYPA 4WRDA 3NQTA 4QB4A 4DFAA 3TP6A 5EKKA 4HMIA 5C3XA 5K5PA 2RKSA 2F0VA 4KJNA 1RKNA 2F0KA 4G57A 4KD3A 2F0OA 2F3WA 4KV6A 4OL7A 4I65A 3NXWA 1A2UA 3SK6A 5CV8A 1EY0A 2EY6A 3BDCA 5C6AA 5CV6A 5E1FA 3LX0A 2EY2A 1SYCA 3RUZA 1JOKA 3MZ5A 3R3OA 2OF1A 2EXZA 5I6WA 1U9RA 1EYDA 1SYBA 3MVVA 1TR5A 2F0GA 4NP5A 4QMGA 4DU9A 4K2KA 5I9OA 4K14A 2EY1A 3MEHA 4N9TA 5F2DA 4PNYA 5I6YA 2EYOA 5J1ZA 1SNOA 3U9OA 4E6IA 3SK4A 3ITPA 2EYJA 2PYKA 3QOLA 5KEEA 4HTHA 1EY4A 4K5VA 2F0DA 1F2ZA 5IGEA 3EVQA 4KTAA 1STGA 2F0SA 3V2TA 2OEOA 4R8NA 5NUCA 3DHQA 1EY5A 4ZQ3A 1A2TA 1EY7A 1F2YA 4K5XA 3P1HA 2F3VA 1EYCA 2OXPA 4HMJA 4ID6A 2F0QA 3SK5A 4B9WA 3TP7A 1JOQA 4PMCA 2WACA 1EY6A 3TP8A 3HEJA 4NKLA 3C1EA 4PMBA 5CC4A 4IALA 1SNCA 4KD4A 1EZ8A 2EYHA 5DEHA 2PW5A 2F0WA 4J1MA 3E5SA 2F0MA 2PZWA 4K2LA 4RKLA 4KHVA 4NDXA 4WORA 3EJIA 1STNA 5C5MA 3OMGA 2PZUA 2RBMA 3SXHA 2KQ3A 3VA5A 2PZTA 5KIXA 3QOJA 4IUNA 1SNPA 2EYFA 3NUCA 1A3TA 5IGBA 1SNMA 1SYEA 4TRDA 4RKBA 2F0PA 3TP5A 1F2MA 1NUCA 2EY5A 2F0UA 4K5WA 1KAAA 4DGZA 5J22A 3MXPA 5KGUA 5I9PA 1JOOA 5IGCA 1SNQA 3D4DA 1JORA 1A3VA 3D6CA 1KABA 5M9OA 4K8JA 2M00A 3DMUA 4EQNA 2ENBA 2F0HA 4N9PA 3T16A 3HZXA 4KY5A 5IOCA 3MHBA 4F7XA 1SYFA 4K6DA 1STBA 4DF7A 5KRUA 1TQOA 5ISRA 1ENAA 3NHHA 4J6HA 1STYA 3BDLA 3H6MA 3EROA 5E3FA 1TT2A 3P75A 1EYAA 2F0EA 5CV7A 5EGTA 4S3SA 4H7BA 5CV5A 4LAAA 4NMZA 1II3A 5KYIA 2F0TA 2F0IA 5CGKA 4YIJA 1EY8A 1SNDA 2O4XA 2PW7A 5HURA 2SNMA 5IGFA 5CV9A 1EQVA 5IIFA 1IHZA 1KDBA 2SOBA 1KDAA 4ODGA 2RDFA 5IGGA 5CR3A 5KYLA 5JAVA 4K8IA 1A3UA 1AEXA 3NK9A 3SR1A 2LKVA 3SHLA 4QF4A 5DAUA 3NP8A 4KY7A 2F0JA 4ZUIA 4B9XA 1STHA 5C3WA 5EKLA 3TMEA 3SK8A 4IZ8A 5J39A 4MIUA 2KHSA 2F0FA 5C4HA 2HQEA 3OSOA 4KJOA 1ENCA 3C1FA 1NSNS 4KY6A 4EQOA 4EQPA 5HGTA
chains in the Genus database with same CATH superfamily
3P20A 2KUMA 3RR5A 2IX3A 4X66Q 3D8GA 2BH2A 1PMRA 4C3HB 1VQPA 4G7OC 4ILWA 2EYMA 1BBUA 2VB2X 1VQNA 1YHAA 1E2VA 1GVPA 4DAPA 2JQOA 4YCVA 1SEBD 3SEBA 5IE8A 1WTHA 4RFBA 4IFDG 1U4PA 1E24A 2QF7A 5CV6A 1PRTD 1YZ6A 4ZYSA 1Q1EA 4DR6Q 2E5LQ 4QGUA 4N8FA 4N9TA 5F2DA 1AP0A 1JWUD 4DNRB 1NJIC 1VQ6A 3CCJA 4X6AH 4EGVA 2ZT9C 3QOLA 4HR7B 2A6HD 2I5LX 4K0KQ 1MD2D 4HIOA 4IUTA 3S1QH 2MQHA 2K04A 4OXPA 3DEOA 1TKWB 1A2TA 5T1GA 4DV2L 2DNEA 2UU9Q 5M5YB 2A5HA 4FF4A 3TP7A 3L3OC 2QDLA 4GLVB 3G71A 2Z4HA 5ELFA 4R4OA 2PW5A 1IYVA 4B9WA 4X3KA 4DV0L 4O1NA 1MIUA 3AB9A 3OMGA 4DV6L 2VUMH 1DONA 3ULLA 3KYHC 4OELB 1QZHA 2KHIA 5DLQE 4UP8A 5IYBG 3FPPA 2TSSA 4OONA 1PH6A 5LL6X 4K8JA 4DR2L 3H0GH 3HOXB 1FGUA 2JA5G 2L4NA 1Y1VB 3STBD 2QILA 4I7AA 1NTGA 3F2CA 4ZK9B 3QJYA 1QG7A 5LMNL 2BOSA 5D65A 3K5MA 3KLSX 1EY8A 5JJZA 1Z6HA 4NW2A 1PTOB 1BVSA 2L11A 4ODGA 2RDFA 2K28A 3F2BA 3PIPA 3G7LA 1UE1A 2KCMA 3NPPA 4DV0Q 1L0YB 3VYSA 5EKLA 3TMEA 1IBLQ 3HOVH 2JYOA 5A2QL 2HQEA 3OSOA 1ENCA 3KOJA 5EPJA 3HGBA 3NQIA 4H13C 2HT1A 2IWHA 2EOTA 1GM5A 3U4VA 2JA6B 1UE7A 3K5NA 4R4CA 4DR2Q 3FKIG 1XPOA 4HSVA 2HD3A 2ZTCA 3CW2C 3TP6A 3RMHA 1MJEA 5FO8B 2RDGA 1CSQA 4AIMA 4B3RL 3O13A 2A68C 4P73A 4WJWA 1IZ6A 1HNXL 5FO9B 1JOKA 3NTHA 3J80E 3R3OA 2OF1A 2EXZA 2R7ZG 4DK0A 1IW7C 1K8OA 5I6YA 4JI5Q 1UE5A 1ZYRD 2NN6G 5ELOA 1TWGH 4CJ2C 3KF8B 4K5VA 3JAMi 1NCVA 2Z6BA 2B63H 5C4JH 5NUCA 1IBKQ 1SFOB 2B2TC 3PIO3 2A8VA 1F2YA 3GTKB 3S2DH 1EYCA 1BR9A 4FNFA 4DV3Q 2C5CA 1BCPF 2JN4A 2LY7A 3TP8A 1RDPD 4KD4A 3TZDA 1XX8A 3CXCA 2IHEA 5I2XA 4LF8L 3ONAB 3QOJA 4A3EH 1VF7A 2HHHL 4C2MB 4A3KG 4A3GH 1KHIA 1NAPA 3M3YH 1F2MA 1JE4A 1HNXQ 2HCIA 1GUTA 1XPRA 1LTSD 1OO9B 4EQNA 3VR3A 3Q24A 2UXCQ 1GUOA 4DK6C 3J81j 2E2IH 3J81L 2R92B 1SXTA 1TT2A 3P75A 3CCRA 4DUZL 1PH1A 2QCPX 2JA8H 3E9IA 1UNSA 1T5EA 1E0BA 3H3VH 1SN8A 2JA5B 1QE6A 3SR1A 4QF4A 2PO4A 5CYUA 4LF8Q 3DLLA 4OGQC 4DAYB 1G2SA 1SLJA 4IUVA 3QG1A 3PUXA 4KKTA 1D2BA 1NSNS 1S5ED 3A7AB 4YY3L 2BH8A 2R7FA 3MA2B 3K0YA 5EKIA 1C0AA 5JEAH 3TBIB 2F0NA 4HJAA 3GTQH 1IYUA 1WTPA 2EYPA 3MFGA 1K73C 5LMUL 4H44C 2F0VA 4KJNA 3CCQA 4DR1L 1O7IA 5AFWA 1SE4A 2JJQA 4DUZQ 5M3FH 3KDFA 3OWEB 3H3VI 4FO2A 4LWCA 1PFBA 2NVXB 2AWNA 2CH4A 1BOSA 2IJ0A 3J7ZC 4MHEA 1TWHH 4DV7L 2EZVA 1PRTB 1RF2D 4QIWB 3EVQA 1L2FA 1STGA 3I70A 1XNRL 1BO0A 1EY7A 2K5QA 3MXNB 3SDZA 1RHPA 2CW0C 3A5ZB 1D5ZC 1EEID 4IALA 1NMGA 1N36L 5DEHA 5T1IA 1U5KA 4K2LA 1B4OA 3K5OA 3S9WA 1R4PB 5M3FB 3ERSX 3SXHA 1TY2A 1D5MC 3H15A 3HOYB 4CDEC 4JBKA 3F8TA 1RL2A 1V43A 3ZYYX 4LUVA 1EWCA 2IX1A 5LMUQ 3S2HH 1NE3A 5C3EB 1AZQA 1HFNA 4JK1C 2E8GA 3TP5A 2R3ZA 2VNUD 4PQXA 4IFDJ 1PYBA 2F4VL 1JOOA 1YJWA 4LFCL 4Z9CB 2NZ1D 4LJZC 1XNQL 1KABA 2SDFA 1CQVA 3HG9A 2JK8A 1JJGA 1ET6A 4LNQA 4N9PA 1I6HB 2KCNA 2HIVA 2O2LD 4DR3L 3HFZB 1ENAA 3NHHA 2J4XA 5E3FA 1OXTA 2F0EA 1XNRQ 2K5NA 1I50H 5CV5A 2R93G 1I94Q 4MNOA 3NTKA 1PH9A 4JI2L 2KA7A 5IIFA 1Q90A 3ND8A 2WP8J 1GUSA 4K8IA 1AEXA 1HZCA 4IPCA 4B9XA 1STHA 5CBEE 1TXYA 4X62L 1M1KC 4GLXA 1TS2A 4CKBA 5IP7H 4CHTB 3TRZA 4UHVA 3GTLH 1OXVA 3OWFA 3VR6A 5HGQA 4DR5L 1KLGD 1TWAB 3S17H 3OMCA 3CD6A 3I8ZA 4NB3A 1SYDA 2MFIA 3U4ZA 2N88A 1LTLA 4A3JH 1MSHA 1SMXA 2HUGA 4QUFA 4OL7A 5ELNA 3KJOA 3LWUA 3UI2A 4DV4L 3BDCA 4A4IA 1QB5D 1SYCA 4A3DH 1QJOA 1P8LA 1ILPA 4JI2Q 5GAGC 3S14H 5C44G 1FNVA 2PI2E 1A0IA 1EY4A 4DNIA 1WCMH 2D0PA 2K1BA 1M4VA 4OX9Q 2F0SA 2VL6A 4C3IG 1MGSA 5L37A 2OXPA 2E2HH 1B53A 3PO3B 1R9TH 1YNJC 1BF4A 3I3CA 1VQEA 4PMBA 4YCUA 4A3JB 4LF5L 3RLNA 1HR0W 1I4QA 1WOCA 2A68D 4KHZA 2PZUA 2RSOA 4B3SL 2PZTA 3KUPA 3V96A 2EYFA 3K7AH 4XIGS 3NUCA 3I72A 3RLFA 1LLRD 4IOAA 5IP9G 1IW7D 4PMWA 2JA7H 2MO1A 2F0PA 2F0UA 4DV4Q 1MHWC 5GAEC 1Z47A 5M9OA 2WB1G 4KKUA 3FEWX 4APVA 3MXUA 4KN7C 3AQQA 1QWYA 5M3MH 3Q22A 4K6DA 2YU9H 1X3GA 5ISRA 3PIOA 5AJ3L 1TWFH 3S1MH 2PMZB 1N34Q 1II3A 4C3JH 4OWWB 1L1OC 4BBSG 3HOWB 5HURA 3BZKA 2SNMA 3S1RH 1K83H 1SSOA 4U673 5IWAQ 4JW0A 1A3UA 3PUVA 4JI8Q 2LKVA 3NP8A 2C9OA 3H09A 1VF5C 2B2WA 1JQYD 2X69A 4ZAIA 4IZ8A 2G9HD 2F0FA 4X3UA 4A3MG 5C4HA 2K33A 3WOFA 3BVZA 1J5EL 2O5IC 3A8JE 1BCPC 4BY7H 4R4TA 1YBYA 3A8IE 1KL9A 1ET9A 2PQEA 1CFMA 2FINB 4DFAA 1TIID 4AYBG 1O80A 1ZKOA 2FXQA 3PO2B 1FVIA 4DPGA 1I3QB 5CV8A 1UEAB 3R8BA 4BY1G 1AE3A 2EJMA 2GVBA 5D3IB 1PZID 2ZM6L 1CKNA 2F0GA 1X65A 2EY1A 3E0EA 1K8MA 2LS01 1VQGA 4BBRH 1J8IA 2ASBA 4DUYL 3A54A 3ICEA 1CZGA 3NBIA 4LUZA 3OOCA 4GKKQ 5EAYA 2O5JC 3I73A 3PCOB 1JWMD 2A1AA 4K5XA 1S5CD 1VQCA 1J5EQ 1HTLD 2MPMA 3TDQA 3EIVA 3GV6A 1A15A 1HZAA 4J1MA 1VQ9A 2PZWA 2EQSA 5C0XH 3GTPH 2RBMA 4C3IB 4L5RC 4IUNA 1S4ZA 1RD9D 3T1HL 1JR0D 3LWEA 4A75A 4RGOS 3FVQA 1CT1D 4LF4Q 3S16H 3S15B 4B3TL 4X65L 1EWIA 3D6CA 3RZOH 2PPBC 3HOUB 2BDNA 1IKMA 4FF3A 1V1QA 5KRUA 4NXMQ 1TQOA 3PV0A 2CW0D 4DUYQ 4LW1A 4GNXC 2BA1A 1U4MA 2AQ1B 5M5XB 3GTMB 2NVYB 2OTLA 4U68A 2N78A 3NELA 3JAML 1UUPA 2QEJC 5C0XI 1HA6A 2A69C 4QL5A 3J81c 2I0QA 1HJPA 3KJPA 2KHSA 4BBSB 3T1HQ 3A0JA 3MTSA 4C3HH 2N3SA 1QUQA 4EQOA 5HGTA 4L63B 5C5LA 3LNNA 4ZUJA 2B3GA 2GVAA 1OXUA 2L0CA 3QB3A 1KRSA 1SE3A 1S5DD 3KBXA 5FLMH 4B3ML 4CDFC 4P71A 4R8IA 3RZDB 4IOCA 2F0KA 4ZRZA 2KCCA 3CPFA 4CJ1B 5IYCH 3SK6A 4C1NI 1EY0A 2XGTA 3LX0A 4ABNA 2G9DA 1QZGA 3PUWA 4A3IB 3MVVA 1A6XA 1N32L 3AU7A 4HEDA 2UUBL 3NBHB 3RN5A 2Y0SB 1KLUD 1M8AA 3ITPA 3GQBA 1XPUA 5KEEA 4B08A 3H0GG 1O7LA 2K03A 5M5YH 2E2JB 1FYCA 4H0LC 3RLOA 4JBMA 3K80C 1B1ZA 1XMQL 2WACA 1XJVA 2K52A 1GKHA 2XSCA 1XMOQ 2B2WC 1AFPA 1EZ8A 1D5XC 2CCZA 5H1SE 4A3BB 1P16A 2K50A 2P5ZX 4NDXA 3HS0C 4UAIA 4JBJA 4B3MQ 3AMUA 1EFID 2OTJA 2EJGC 3AEVA 1NNXA 1PH7A 1SNMA 1STEA 2IW3A 3G4SA 2UUCL 3HOVG 3UDGA 2IPKD 1XXGA 1NUCA 4F87A 1TWCB 3A56A 3EBEA 1BBXC 1JB7A 3CAMA 2NZHA 5C4XG 1SAPA 3HOXH 1FNUA 3DEPA 1KNAA 4A93B 1Y1VH 2UUBQ 3RNUA 2KHJA 4RGMA 1F77A 4KMUC 1CKMA 1STBA 1YNJD 4JV5L 4J6HA 2XTIA 4M8AA 5EQ0A 3I4NG 4QJFA 1I6VC 1PTOH 1B7YB 4NPSA 1DJRD 2PW7A 4R4IA 1EU3A 2QKIC 1W6KA 1VQ4A 4GS3A 1KDAA 3GTJH 1PYWD 1T5XD 4JI3L 2ZJRA 2AUKA 3PUYA 2VXWA 1BUVT 1LUZA 5D14A 1B9NA 2R6GA 3T51B 1W6JA 1WD1A 2B63G 2K05A 2OT2A 2JA6H 2J0TD 3BU2A 4A3LH 1OXXK 1STAA 5HY6A 1JJCB 4EVOA 4DV2Q 1EY9A 1ICFB 2SNSA 3H94A 2UUAL 4XQNA 3GO5A 4JV5Q 1E2WA 2V1CC 4MTKA 4A3EG 4DV6Q 3GTJB 4OO1H 4A3GG 5C6AA 4JG2A 2F52A 2Z6KA 3N6RA 4FF1A 3BJUA 1JCKB 3OIPA 4FXKC 4IQZA 1WYDA 4RMFA 2Q8IB 2VY3A 4PNYA 1VQAA 4IFDH 4TVAB 2I07B 2PYKA 1WTXA 2EDGA 1BCPD 3CCSA 4JI3Q 1SFOH 3GTKH 2MO0A 3C3LA 3OW7A 2NVTB 3M9BA 1RCVD 2WAQG 4RG1A 1VQHA 3M7NA 3HOZB 1PYSB 2XWJB 4O42A 3KK7A 2JA8G 1DGSA 5LMNQ 1I4RA 1Q8KA 4RKLA 1FR3A 1V9PA 4C2MH 1UWVA 4IO9A 2BE5C 2N8NA 3N52A 1B44D 1E1TA 4OO1I 2L9HA 3B6YA 4K5WA 5LMNW 5FLXL 5JVH3 4XXEA 2ZXOA 3HKZG 1YJ9A 3BDOA 4N8X1 1K0SA 4TSSA 4UPAA 4IFDI 4LK1C 2DGYA 4HIKA 2F0HA 2R92H 5FKAC 3UDIA 4KY5A 5JEAG 1ENFA 1SYFA 3D0FA 3HKSA 4R9WA 4DR4L 1RODA 1JICA 3JC66 3OPOA 4NMZA 2AQ2B 2F0TA 3EN2A 3HRZC 1JE5A 3VR2A 4YIJA 2JA5H 1LT5D 1KDBA 4B3RQ 2YV5A 1U4RA 1EUJA 3J80i 1F9PA 3X3MA 3M4PA 3R2TA 1PH4A 2D9UA 1HH2P 4ULLA 2FHTA 3H91A 4MIUA 4WJ3M 1B3AA 4PZ7A 1YNXA 4JI1L 3CPWA 2GN5A 4JCVE 1D1IA 3PMFA 3UDFA 2KCTA 3NE5B 4YHHL 2ALYB 2JEAI 3I4MG 2L12A 3RD4A 5EKKA 5E7NA 2Q8TA 4DXFA 2Q2HA 1CZWA 2ID0A 2A69D 1K28A 3W1BA 2NVXH 3BYYB 1D8LA 4IPHA 1F9QA 2VZAA 4JC0A 5K36H 3F2DA 4DR7L 2HHHQ 1Y69U 5JJKA 1PFSA 3OW2A 1SYBA 1PH2A 4HIMA 4GN4B 1EQRA 1HZBA 2I5HA 2A6ED 4JI7L 4CKCA 2Q2UA 2WKCA 1F2ZA 1GD7A 3U50C 1Q86C 3A74A 3DM1A 1A8VA 1G51A 2F0QA 4XQQA 3MWYW 3WDNA 3HEJA 4NKLA 5DNFA 2XVSA 1KQSA 4K6LA 3HOYH 3S1NB 5C5MA 3LGJA 5C3EH 5FOBB 4POGA 3FKIB 2XRQD 3M4OB 1IL2A 1L1OA 3KFUA 2WAQB 1DM0B 1GOZA 3EQLC 2G5DA 4LFBL 1BNZA 4OEMB 4TRDA 1DCZA 2JXMB 2I46A 4XYQA 2FJ2A 3RN2A 5IP7G 1GHKA 4QQBX 1RJTA 1ESRA 3CF5A 1PV4A 4DR7Q 5EBCA 5GAHC 1I6HH 2R7ZB 1UE6A 2WIIB 1WFQA 4KK7A 3CMAA 4YY3Q 3T16A 5IOCA 4KHPL 4JI7Q 2Z6KC 3MC0B 1WJJA 5BR8L 4X3TA 1WTOA 2DJGC 1YIJA 4S3SA 2K4KA 3HKZB 2K75A 5FK9C 1Z7TA 5A2QE 2VQFL 1WVLA 2X6LA 4BXXH 3W5OA 1EEFD 2PMZE 2OQKA 4DR1Q 1ZXTA 4A3DG 1PHJA 1SBBB 3UDXA 1HNZL 1AE2A 3OYYA 3SHLA 3EFXD 2E2DC 2RHSB 1X56A 2AWOA 5M5WH 1YHBA 4KI0A 2IL8A 4DV7Q 1GO3E 3JAMc 4LFBQ 1FJGL 3VYTA 4A3KB 2B2YA 1TWAH 1DYQA 4ZKBB 1EFWA 3SGIA 2Q8RE 2NBFA 4BS9A 4HIDA 3CU7A 1V1PB 2Q2IA 4CDCC 1SYGA 2ZXPA 3E3XA 1U0LA 1IL8A 4DNTB 3KDFB 4KHPQ 1N36Q 2JEBI 5K5PA 1BKBA 2F0OA 3T4AC 4GLAC 3GP7A 1HHVA 1I4HA 1KD1C 1J6QA 3PSIA 2JA7G 2EVBA 2VQFQ 1VQOA 3S24A 5I6WA 5M5WB 1EYDA 4EQ5A 1WTQA 4NP5A 2UXBL 4LMQD 5GROA 1I4XA 5BN3A 3M85A 2PQAA 2CFMA 3HP3A 4M1UB 5BN4A 1C4QA 2EXDA 3KF6B 2F4VQ 4A3CH 4LFCQ 2X6GA 1XNQQ 2N55A 1PXUA 1YITA 5M3MG 4P75A 3DHQA 4G4KA 3PO3H 1AZPA 3IKJA 3Q0AA 2EJFC 1BCPB 3F2UA 4DR3Q 1G6PA 4C3JG 4L5SA 1HNWL 1TVXA 3M4YA 4LF9L 1A62A 2F0MA 4GNXA 1RIPA 1H95A 2CWAA 3H3VC 4O2DA 2KQ3A 3A7LA 5KIXA 3PQIA 4LF6L 5IYDH 4X64L 1VQ8A 4MN3A 5IT9L 3C2PA 3K81C 3J81E 2H5XA 2MGSA 1QVCA 2EIFA 4X62Q 3CHBD 1IKLA 3D4DA 2KOLA 4BY7G 1A3VA 1LTBD 1WD0A 4BA1I 3GDEA 3A5UA 3ULPA 1XWEA 2BA0A 3CC7A 3HZXA 3L2PA 4DR5Q 1Y8OB 4L6TB 2B2UA 3H6MA 1WTVA 3HOWH 2KVMA 3VDYA 1E1OA 5CGKA 4GN5A 1H9JA 3J7AV 2I5MX 2BE5D 1HNWQ 1QVFA 3BS1A 4A3FG 1N33L 1F9SA 1C48A 4GOPA 4BBRG 3C46A 4H02A 1X6OA 2YTVA 4BA2I 3C1FA 1MJCA 2NUCA 1AW7A 3DM3A 5JJLA 4CDDC 1EOTA 4Q5VA 4FDBA 2QDBA 4IUPA 5CV4A 3PO2H 1H9RA 4F8MA 3L9AX 3NQTA 1I3QH 5C0XG 5C3XA 4HMIA 5JEAJ 2Q2TA 4LF5Q 2AMCB 3DXJC 4KV6A 4V190 4L5TA 4B3SQ 3FHWA 1Y1WG 4L5QA 2R93B 5EBDA 1EYGA 2FMMA 4PG3A 1TR5A 1PDQA 3NENA 3QR8A 4DAVA 2B8GA 4PZ6A 4G7HC 3MEHA 1NMFA 5G3LF 3V05A 1VQ7A 1JORA 1JWSD 1D1KA 1YNNC 2Z8LA 1IBML 2MHVA 1HXYD 5COYA 2RDHA 2PI2A 4RAUC 4CJ0B 2Y0SE 2A73B 3Q6SA 3TREA 4FF2A 1GUWA 2DY7A 3CQZB 1LO5D 3U9SA 5AJ3Q 5CC4A 1LTRD 4C3IH 2EYHA 2KEDA 4FYDA 4AH6A 1G291 2B2YC 1X32A 3VYRA 4DK3C 4QCLA 1F9RA 1SYEA 1M90C 4RKBA 3S15H 5FJ8H 1KAAA 4C3HG 4TKOB 1JC7A 1VQBA 3HOUH 2K14A 3L7ZC 2VW9A 2H4OA 5IP9H 1NBWA 5FLMG 4P74A 5C44B 3MXGA 4F7XA 4DA2A 2RVLA 2YTXA 5M5XH 1IBMQ 4JYAL 5FLXc 4HCEA 1K8AC 3GTMH 2NVYH 1DZ1A 2HQLA 1H9KA 5DM63 4J8QA 4NXNL 2F0IA 3G6JB 5ELDA 5IYCG 1AH9A 2NTSA 1LT3D 4Y7NB 1SNDA 2NYZD 3QIAA 4XYOA 5IGFA 4JBWA 2D62A 1HCZA 1PTOF 3AFQA 1UEBA 4R4QA 3OTOL 4X3SA 1B2TA 1CQFA 1PZKD 4BBSH 4JI4L 3DWAA 2RSNA 2ZM6Q 2ES2A 2BDOA 3K6OA 5J39A 3PF5A 4JOIA 1LT4D 1SRUA 1WI5A 4JPBW 4DN4M 1LT6D 1W2BA 1VQLA 1EWHA 2K32A 2QGQA 3ULJA 5C4ZA 3RZDH 1YVCA 2IHFA 2WB1B 3W2DA 5ELEA 2A74C 1K3RA 1LTTD 4JYAQ 4A3IH 1QCBD 3NXWA 1XYIA 4NXNQ 3D4RA 2UXDL 2NVQB 1Q7YC 2EY2A 2TMPA 1PLFA 3MFYA 2EPBA 2RCFA 1HPCA 1B8AA 1HUNA 2B2UC 1LM0A 4K14A 2F03A 3HOXG 5J1ZA 3KLRA 4JI6L 5ELCA 4JI0L 4B3TQ 2E2JH 4X65Q 4HJ7A 1VQIA 3PF4A 1KAWA 5E4XA 4A3MB 2Z9HA 3J80L 3PGZA 2VUMG 3NWSA 4A3BH 4XQJA 3ND9A 4GOPC 3GTOB 1S3OA 4DF7A 2XIWA 5I9OA 3OHXC 1H9SB 1SNPA 4AYBB 2QEXA 4G7ZC 1EIFA 1TS3A 4DR6L 3W1GA 3Q8DA 1VQMA 2ICIA 1TWCH 5J3BA 2ZTDA 1EL0A 1ONLA 2L15A 4A93H 2UXDQ 3MXPA 4BY1B 1SDFA 1G91A 3CCUA 1XTCD 5IGCA 3FDTA 4K0KL 4FXGC 4A3LG 4LFAL 2M9VA 1VMCA 2NB0A 2ENBA 1GUGA 2XWBB 4JI0Q 2UU9L 2ICEC 1GUNA 2R7DA 2HCCA 3L0OA 1O78A 1VDZA 2KJXA 4LAAA 3GTGH 1CA5A 3E9HA 2PNRC 3I7FA 2E74C 2XRSD 1C7YA 4OO1G 2O4XA 1NY4A 1X54A 1S72A 3URYA 2IX0A 2SOBA 3VYUA 1KIXA 1LTAD 3FRPB 4FP5D 3IL8A 1QUQB 3K57A 4C56C 1C9OA 1N32Q 3D6WA 1FGBD 1WTWA 5KNBA 4HJ9A 4EQPA 3FMCA 3K8AA 2LFNA 4I7ZC 4LUOA 3CCLA 4LFAQ 4C1NK 5EPKA 2ZTEA 1XMQQ 1KDCA 3GTGB 1I4GA 2JP1A 5EJWA 3I56A 1NR2A 1RKNA 4KLKA 3DWQA 2F3WA 1K9MC 1GXDC 4YWLA 3AFPA 4OWTB 2CH4W 5JPMC 1U9RA 2UUCQ 4QMGA 1IBLL 3KLSA 4XT3B 1K8GA 1SE8A 1VQJA 1PRTF 2WKDA 2NVTH 2R92G 1C8CA 3V2TA 2OEOA 1SMYC 3HOZH 1LACA 1EY5A 4UP7A 2ZJPA 3BZCA 4J15A 3KF8A 3MEFA 2ZJQA 3S1QB 1B3QA 1FD7D 4ME3A 1Q8IA 1CSPA 1SNCA 4FXDA 1CHQD 1MBYA 4JOIC 3SK4A 3EJIA 1STNA 1VQFA 3ZJYC 4XDXA 4ALPA 4HAEA 1EIGA 4PZ8A 1CUKA 5GADC 3K59A 1A3TA 5C0XJ 2VUMB 4OWXB 3TSSA 1LABA 2WAQE 1BQQT 4JI5L 3G48A 1YNND 5J22A 2F3IA 1DD2A 5KGUA 4QIWE 1IXRA 3TN2A 1EU4A 3CC2A 4ZKCB 3JAME 2M00A 3DMUA 1IBKL 4HSPA 3J7AF 5IT9c 4FVMA 1YHQA 4DV3L 3W3AA 4OIJA 5JOBA 2CKZB 3EROA 3H0GB 5C4XH 5CV7A 3CMEA 4H7BA 2UUAQ 1YI2A 1S40A 1JB3A 3VR5A 1X3FA 2RQXA 1S5FD 2D0OA 3HKZE 1KXLA 2B8FA 5K36G 1HZ9A 2V4DA 2K01A 5DAUA 4CGYB 3I4NH 4YWKA 1EIYB 1OXSC 5IYBH 2L5TA 4RWSC 1QILA 3HOVB 1KRTA 4MZ9A 4DAYA 1HRJA 2UXCL 2K7VA 2E75C 3BYTB 5E4WC 5C4XB 1EZ6A 1QNUA 3ERQA 5M3FG 1KC8C 4DXGA 3HOYG 3E6ZX 3IAYA 1VMPA 5C3EG 2VB3X 1K0RA 2AHOB 3CCVA 1Q46A 2OCEA 4IN3A 2Z1CA 1PH3A 4I65A 1MKHA 2MNAA 2XN9C 3I4NB 5IY0A 1KNEA 3AYHB 3D31A 2D2CC 1LTGD 4WJ4A 4WFN3 1BBWA 3K0XA 3CKIB 2K5VA 2CHBD 4HTHA 1Y14B 1TWGB 3IFTA 2IT1A 1PFMA 1EQQA 2F3VA 2B63B 5C4JB 1HUMA 1JOQA 3P7JA 5LL6S 1N8RC 3S1NH 1EY6A 5CMDA 1Q81C 4DR4Q 3S2DB 4GZYC 4BXXG 1NR4A 1PTOC 3FKIH 3MXNA 4DAMA 1DXMA 4DV5L 3M4OH 2VS1A 4PV1C 5IGEA 2RF4A 2HDMA 2PCFB 5A35A 1VS0A 5IGBA 4P72A 1VQ5A 1Y8PB 1ZEQX 3KBGA 1Z9FA 3GV3A 4CKEA 3I91A 4A3EB 2F1MA 3BG3A 3CRKC 5I2YA 2R7ZH 4A3GB 3M3YB 4OHJA 4JI1Q 1W3SA 3I4OA 1ASYA 2NN6H 3VR4A 1YJNA 2J7ZA 1X3PA 1CTMA 4YHHQ 1CI3M 5EGTA 4RHSA 3T53B 3NTIA 5I4DA 2E2IB 1EQVA 2K5WA 2JA8B 4MTNA 1HQRD 1VCIA 1V1PA 3NK9A 4DV5Q 1HFGA 2L55A 4HN7A 3UE0A 3TS0A 3FPUB 4A3KH 4A3CG 2IY5B 1JJ2A 4AQYL 1PFNA 3X3NA 4KY6A 3PO3G 4A3JG 5JJIA 1RTOA 1YEZA 4GN3B 2NN6I 1JMCA 2DUDA 1GJXA 2EYLA 3E0JA 4QB4A 3KF6A 1I94L 1TY0A 3CC4A 5EPLA 5BN5A 1ICWA 3GTQB 2FFKB 4G57A 4KD3A 1TS5A 5IYDG 4Y52H 1A63A 3I4MH 2BCOA 4RHRA 3BVGA 1QOHA 1WCMG 4DU9A 2E76C 2EYOA 1LTID 3IRBA 4POFA 1TWHB 1SE2A 2R61A 4RCOA 4Q0FA 1SROA 2JSOA 1ASZA 2B29A 1PVOA 3HOWG 4AQYQ 1PH5A 2N49A 3P1HA 4ID6A 1E22A 1N9WA 5BR8Q 4RGTA 1SJED 4KKSA 5FLXE 5JVG3 4JVZA 1S5BD 3I90A 1L1OB 2RHQB 1PH8A 1PZJD 1Q3LA 1B9MA 1RTNA 3VA5A 3I4MB 1I5FA 3J80c 1MSGA 2RCNA 3ER0A 1HNZQ 1CM9A 1DOMA 1BXTA 3S2HB 1V1OA 3PUZA 4IJHA 5I9PA 4A76A 1X55A 3K7UC 4IJLA 2B2VA 2ATWA 1FJGQ 1HR0L 2MJ8A 1SJHD 1SMYD 4OX9L 3CP0A 1B50A 1I4PA 3PO2G 2HDLA 1CK1A 3CCEA 1AN8A 1STYA 3KLWA 4UDUC 2GA4B 1DOKA 3D3RA 5KYIA 4QUCA 2AKWB 3DWPA 4CBVA 1I50B 1L0XB 2K5DA 3M4QA 5CR3A 5JAVA 2KBNA 3R2IA 2K5HA 4XT1B 4ZCKA 1PRTC 3A8KE 3K5LA 2MP1A 1R4QB 4HJ5A 2UXBQ 3UE1A 1E2ZA 3SK8A 3U58A 3EA6A 2WFWA 3TEHB 4IUQA 4ME5A 5TSSA 2OWOA 2KECA 2L1BA 2A6HC 1J9OA 2WINB 3NWTA 3GTLB 5IODA 2AUJD 3A55A 2DNCA 1HR0Q 1N34L 1X3QA 3D4WA 1BDOA 4XTCS 3S17B 2VQEL 2F4IA 4LF9Q 3NSWA 2WB1E 1GHJA 2R93H 5G3LD 1MI2A 1A2UA 3I4LA 5IWAL 1H9MA 2AQ3B 2PQAB 4JI8L 4LF6Q 5FJ8G 1VQDA 4X64Q 4RCNA 3J81i 4A3DB 4RGNA 3HOUG 4E6IA 1SNOA 2LSSA 1CA6A 2EYJA 2QW7A 3S14B 2NWGA 3CQZH 4R8NA 2EE1A 1OTCA 1X3EA 3BZDB 4ZQ3A 1WCMB 2FMCA 4HMJA 1D7QA 1X9NA 1B70B 3M7GA 4PMCA 4GNXB 3STBC 4HCSA 3C1EA 4V0BA 5ELBA 2E2HB 1R9TB 3E5SA 4KHVA 3TZUA 1IYJB 1Q1BA 2JE6I 3PIP3 2VQEQ 1VQKA 1CKOA 4DV1L 3F1ZA 1KTKA 1N33Q 1UAPA 3DUZA 3K7AB 2JA9A 4AYBE 2EY5A 1LYLA 2JA7B 1SNQA 4LF7L 4GKJL 2LXKA 3BVMA 5C44H 2QA4A 4GKKL 1EOVA 1QNKA 3TQYA 4ZLTF 1G8ZD 1Q12A 2HIXA 2DJFC 4IURA 1PTOD 1EIHA 2H1EA 5M3MB 1E7ZA 4Y7NH 3QWNA 3FP9A 2YU9B 2C35B 4IPGA 3I55A 4A3IG 1TWFB 2CQOA 3NEMA 4YCWA 3S1MB 4KN4C 2NTTA 4EX5A 4C3JB 2A19A 1T9HA 4GOPB 1IHZA 2Y0SG 1QVGA 5KYLA 3S1RB 1FNWA 1K83B 5JPNC 2OQ0A 1PA6A 3TS2A 2D5DA 4KY7A 4ZUIA 5C3WA 1ESFA 3K58A 2CVRA 4LF4L 3G6EA 4A3FH 4YWMA 4DV1Q 4R1JA 1ZYRC 5IGDA 2YYZA 3T13A 4NXML 3J7YW 4A3BG 4LF7Q 4BY7B 3MAQA 4GKJQ 3SE0A 4P2CB 3WOEA 2F0LA 2XNAC 1Q82C 3CCMA 4WRDA 2KEEA 4RH6A 2RKSA 1G2TA 2B39A 2NVQH 1ML0D 1HA5A 2B2VC 2Z4IA 2EY6A 5E1FA 2RA4A 3RUZA 2CWPA 3MZ5A 2LXJA 1EQTA 4BWGB 2Z0SA 4A93G 4OIKA 1E3PA 4K2KA 1L0WA 1F2LA 4A3FB 3U9OA 2SEBD 1Y1WH 3J7A5 2MUYA 5KNCA 1H9SA 1TU2B 4A3MH 2F0DA 4KTAA 1ILQA 4BBRB 3NBHA 4DK1A 4RA8A 3CRLC 2LMCB 2NZOA 5IT9E 4IUUA 3OIQA 3GTOH 3T1YL 2DY8A 1CKNB 4QY7A 1XTDA 4O0AA 2F0WA 4WORA 1K3BC 3SK5A 1O7ZA 1SR3A 3QO2A 5D3DA 1JT8A 3GTPB 3OTOQ 1CHPD 4UP9A 1Y1VG 2ZXRA 4BY1H 4JI4Q 4X66L 4DGZA 2M2LA 4F88A 1DOLA 1Y1WB 5FO7B 2YTYA 1HTPA 1Y8NB 2KENA 4IPDA 5GQOA 1HQMC 3S16B 2WV6D 1TS4A 3R93A 2DN8A 4UY8C 3RZOB 3MHBA 3GD7A 1U4LA 3WWVA 2A6EC 1LV9A 3BDLA 2PNHA 1EYAA 1V8QA 4DKAC 3VA7A 1XMOL 5CBAE 1FL0A 5KNDA 3IFDA 3I2ZA 5LHY1 5DM73 2E5LL 4TQUS 4L8JA 5CV9A 3T1YQ 1O7YA 1G6ZA 1D6EC 2B2TA 5IGGA 1WTRA 2JA6G 3T56B 2F0JA 2K6AA 4HJ8A 3Q23A 3SVMA 2CQAA 4JI6Q 4KJOA 3HOZG 5CORA
chains in the Genus database with same CATH topology
3P20A 2KUMA 2IX3A 3D8GA 1PMRA 4C3HB 4G7OC 4ILWA 2EYMA 2VB2X 1E2VA 4DAPA 1SEBD 3SEBA 4RFBA 4IFDG 1U4PA 2QF7A 5CV6A 1PRTD 4ZYSA 1Q1EA 4N9TA 5F2DA 1AP0A 1JWUD 4DNRB 4EGVA 2ZT9C 3QOLA 4HR7B 2A6HD 1MD2D 4IUTA 2K04A 3DEOA 1TKWB 1A2TA 5T1GA 2DNEA 5M5YB 2A5HA 4FF4A 3TP7A 3L3OC 2Z4HA 5ELFA 2PW5A 1IYVA 4B9WA 4X3KA 4O1NA 3AB9A 3OMGA 1DONA 3FPPA 2TSSA 5LL6X 4K8JA 3HOXB 2L4NA 1Y1VB 2QILA 4ZK9B 3QJYA 1QG7A 2BOSA 5D65A 3K5MA 3KLSX 1EY8A 5JJZA 1Z6HA 4NW2A 1PTOB 2L11A 4ODGA 2RDFA 2K28A 3G7LA 3NPPA 1L0YB 3VYSA 5EKLA 3TMEA 2JYOA 5A2QL 2HQEA 3OSOA 1ENCA 5EPJA 3HGBA 3NQIA 4H13C 2IWHA 2EOTA 2JA6B 3K5NA 4HSVA 3TP6A 3RMHA 5FO8B 2RDGA 3O13A 2A68C 4WJWA 5FO9B 1JOKA 3NTHA 3J80E 3R3OA 2OF1A 2EXZA 4DK0A 1IW7C 1K8OA 5I6YA 1ZYRD 2NN6G 4CJ2C 4K5VA 1NCVA 5NUCA 1SFOB 2B2TC 3PIO3 3GTKB 1F2YA 1EYCA 1BR9A 4FNFA 2C5CA 1BCPF 2LY7A 3TP8A 1RDPD 4KD4A 3TZDA 1XX8A 5I2XA 3ONAB 3QOJA 1VF7A 4C2MB 1NAPA 1F2MA 1JE4A 2HCIA 1GUTA 1LTSD 1OO9B 4EQNA 3VR3A 3Q24A 1GUOA 2R92B 3J81L 1SXTA 1TT2A 3P75A 2QCPX 1UNSA 1T5EA 1E0BA 2JA5B 1QE6A 3SR1A 4QF4A 5CYUA 2PO4A 4OGQC 1G2SA 4IUVA 3QG1A 3PUXA 4KKTA 1D2BA 1NSNS 1S5ED 3A7AB 3MA2B 3K0YA 5EKIA 5JEAH 3TBIB 2F0NA 1IYUA 1WTPA 2EYPA 3MFGA 4H44C 2F0VA 4KJNA 5AFWA 1SE4A 3OWEB 4FO2A 1PFBA 2NVXB 2AWNA 1BOSA 2IJ0A 4MHEA 2EZVA 1PRTB 1RF2D 4QIWB 3EVQA 3I70A 1STGA 1BO0A 1EY7A 2K5QA 3SDZA 1RHPA 2CW0C 1D5ZC 1EEID 4IALA 5DEHA 5T1IA 4K2LA 1B4OA 3K5OA 3S9WA 1R4PB 5M3FB 3SXHA 1TY2A 1D5MC 3HOYB 1V43A 3ZYYX 1EWCA 2IX1A 5C3EB 1AZQA 1HFNA 4JK1C 3TP5A 2R3ZA 2VNUD 4PQXA 4IFDJ 1JOOA 4Z9CB 2NZ1D 4LJZC 1KABA 2SDFA 1CQVA 3HG9A 1ET6A 4N9PA 1I6HB 2KCNA 2O2LD 1ENAA 3NHHA 2J4XA 5E3FA 1OXTA 2F0EA 5CV5A 3NTKA 2KA7A 5IIFA 1Q90A 3ND8A 2WP8J 1GUSA 4K8IA 1AEXA 4B9XA 5CBEE 1STHA 1TS2A 4CKBA 4CHTB 1OXVA 3OWFA 3VR6A 1KLGD 1TWAB 3OMCA 3I8ZA 1SYDA 2N88A 1MSHA 2HUGA 4QUFA 4OL7A 3LWUA 3UI2A 3BDCA 1QB5D 1SYCA 1QJOA 1ILPA 1FNVA 1EY4A 2K1BA 1M4VA 2F0SA 4C3IG 1MGSA 2OXPA 1B53A 3PO3B 1YNJC 1BF4A 3I3CA 4PMBA 4A3JB 1I4QA 2A68D 4KHZA 2PZUA 2RSOA 2PZTA 3KUPA 3V96A 2EYFA 4XIGS 3NUCA 3I72A 3RLFA 1LLRD 1IW7D 4PMWA 2F0PA 2F0UA 1Z47A 5M9OA 4KKUA 3FEWX 3MXUA 4KN7C 1QWYA 3Q22A 4K6DA 5ISRA 2PMZB 1II3A 3HOWB 5HURA 2SNMA 1SSOA 4U673 1A3UA 3PUVA 2LKVA 3NP8A 2C9OA 3H09A 1VF5C 2B2WA 1JQYD 2X69A 4ZAIA 4IZ8A 2G9HD 2F0FA 4X3UA 5C4HA 2K33A 3WOFA 3BVZA 2O5IC 3A8JE 1BCPC 3A8IE 1ET9A 2PQEA 1CFMA 2FINB 4DFAA 1TIID 1O80A 1ZKOA 3PO2B 1I3QB 5CV8A 1UEAB 3R8BA 2EJMA 5D3IB 1PZID 2F0GA 2EY1A 1K8MA 2LS01 1J8IA 3A54A 1CZGA 3NBIA 3OOCA 2O5JC 3I73A 1JWMD 4K5XA 1S5CD 1HTLD 2MPMA 3TDQA 3GV6A 1A15A 4J1MA 2PZWA 5C0XH 2RBMA 4C3IB 4IUNA 1S4ZA 1RD9D 1JR0D 3LWEA 4RGOS 3FVQA 1CT1D 3S15B 3D6CA 2PPBC 3HOUB 2BDNA 1IKMA 4FF3A 5KRUA 1TQOA 3PV0A 2CW0D 2BA1A 1U4MA 2AQ1B 5M5XB 3GTMB 2NVYB 4U68A 3JAML 1UUPA 2QEJC 5C0XI 1HA6A 2A69C 2KHSA 4BBSB 3MTSA 4EQOA 5HGTA 4L63B 5C5LA 3LNNA 4ZUJA 1OXUA 2L0CA 3QB3A 1SE3A 1S5DD 3KBXA 3RZDB 4R8IA 2F0KA 4ZRZA 2KCCA 4CJ1B 3SK6A 4C1NI 1EY0A 3LX0A 4ABNA 2G9DA 3PUWA 4A3IB 3MVVA 1A6XA 3AU7A 4HEDA 2Y0SB 1KLUD 1M8AA 3ITPA 3GQBA 5KEEA 4B08A 1O7LA 2K03A 2E2JB 1FYCA 4H0LC 1B1ZA 2WACA 2XSCA 1AFPA 2B2WC 1EZ8A 1D5XC 4A3BB 4UAIA 4NDXA 3HS0C 3AMUA 1EFID 2EJGC 1SNMA 1STEA 2IW3A 2IPKD 1XXGA 1NUCA 4F87A 1TWCB 3A56A 1BBXC 1SAPA 1FNUA 3DEPA 1KNAA 4A93B 4RGMA 1F77A 4KMUC 1STBA 1YNJD 4J6HA 4M8AA 5EQ0A 1I6VC 1PTOH 1DJRD 2PW7A 1EU3A 2QKIC 1W6KA 1KDAA 1T5XD 1PYWD 2AUKA 3PUYA 2VXWA 1BUVT 5D14A 1B9NA 2R6GA 3T51B 1W6JA 1WD1A 2K05A 2OT2A 2J0TD 1OXXK 1STAA 4EVOA 1EY9A 3H94A 2SNSA 4XQNA 3GO5A 1E2WA 3GTJB 4OO1H 5C6AA 3N6RA 4FF1A 1JCKB 3OIPA 4FXKC 4IQZA 2Q8IB 4PNYA 4IFDH 1WTXA 2I07B 2PYKA 2EDGA 1BCPD 3C3LA 3OW7A 2NVTB 1RCVD 3M7NA 3HOZB 2XWJB 4O42A 3KK7A 1I4RA 4RKLA 1FR3A 2BE5C 3N52A 1B44D 4OO1I 2L9HA 4K5WA 5FLXL 5JVH3 4XXEA 2ZXOA 3BDOA 4TSSA 4IFDI 4LK1C 2F0HA 5FKAC 5JEAG 4KY5A 1ENFA 1SYFA 4R9WA 1RODA 1JICA 4NMZA 3OPOA 2AQ2B 2F0TA 3HRZC 3VR2A 4YIJA 1LT5D 1KDBA 1U4RA 1F9PA 3X3MA 3R2TA 2D9UA 4ULLA 2FHTA 3H91A 4MIUA 1B3AA 1D1IA 3PMFA 3NE5B 2JEAI 2L12A 3RD4A 5EKKA 2Q8TA 4DXFA 1CZWA 2ID0A 2A69D 3BYYB 1F9QA 5K36H 1Y69U 1SYBA 2A6ED 4CKCA 2WKCA 1F2ZA 3DM1A 2F0QA 4XQQA 3MWYW 3WDNA 3HEJA 4NKLA 5DNFA 2XVSA 4K6LA 3S1NB 5C5MA 5FOBB 3FKIB 2XRQD 3M4OB 2WAQB 1DM0B 1GOZA 3EQLC 1BNZA 4TRDA 1DCZA 2JXMB 2I46A 4XYQA 2FJ2A 1GHKA 1RJTA 1ESRA 5EBCA 2R7ZB 2WIIB 4KK7A 3T16A 5IOCA 3MC0B 4X3TA 1WTOA 4S3SA 3HKZB 5FK9C 1Z7TA 5A2QE 1WVLA 2X6LA 1EEFD 1ZXTA 1SBBB 3SHLA 3EFXD 2E2DC 2AWOA 4KI0A 2IL8A 3VYTA 4A3KB 2B2YA 1DYQA 4ZKBB 2Q8RE 2NBFA 4BS9A 3CU7A 1V1PB 1SYGA 2ZXPA 1IL8A 4DNTB 2JEBI 5K5PA 3T4AC 2F0OA 3GP7A 1HHVA 1I4HA 2EVBA 5I6WA 5M5WB 1EYDA 1WTQA 4NP5A 4LMQD 1I4XA 5BN3A 3M85A 4M1UB 5BN4A 3HP3A 1C4QA 2X6GA 2N55A 1PXUA 3DHQA 4G4KA 1AZPA 3IKJA 3Q0AA 2EJFC 1BCPB 3F2UA 4C3JG 1TVXA 3M4YA 2F0MA 3H3VC 2KQ3A 3A7LA 5KIXA 4MN3A 5IT9L 3C2PA 3J81E 2MGSA 3CHBD 1IKLA 3D4DA 2KOLA 1A3VA 1LTBD 1WD0A 4BA1I 1XWEA 2BA0A 3HZXA 1Y8OB 4L6TB 2B2UA 3H6MA 1WTVA 2KVMA 5CGKA 1H9JA 3J7AV 2BE5D 3BS1A 1F9SA 1C48A 3C46A 4BA2I 3C1FA 2NUCA 1AW7A 4Q5VA 1EOTA 2QDBA 4IUPA 5CV4A 1H9RA 4F8MA 3L9AX 3NQTA 5C0XG 5C3XA 4HMIA 5JEAJ 3DXJC 4KV6A 4V190 2R93B 5EBDA 2FMMA 1TR5A 1PDQA 4DAVA 2B8GA 4G7HC 3MEHA 3V05A 5G3LF 1JORA 1JWSD 1D1KA 1YNNC 2Z8LA 2MHVA 1HXYD 5COYA 2RDHA 4CJ0B 4RAUC 3Q6SA 2A73B 4FF2A 1GUWA 2DY7A 3CQZB 1LO5D 3U9SA 5CC4A 1LTRD 2EYHA 2KEDA 4FYDA 1G291 2B2YC 1X32A 3VYRA 4QCLA 1F9RA 1SYEA 4RKBA 1KAAA 4C3HG 4TKOB 1JC7A 3L7ZC 2H4OA 5C44B 3MXGA 4F7XA 4DA2A 2RVLA 1DZ1A 4HCEA 1H9KA 5DM63 4J8QA 2F0IA 3G6JB 5ELDA 2NTSA 1LT3D 4Y7NB 1SNDA 2NYZD 3QIAA 4XYOA 5IGFA 4JBWA 2D62A 1HCZA 1PTOF 1B2TA 4X3SA 1CQFA 1PZKD 3DWAA 2RSNA 2BDOA 3K6OA 5J39A 1LT4D 4DN4M 1LT6D 1EWHA 2K32A 5C4ZA 2WB1B 3W2DA 5ELEA 2A74C 1LTTD 1QCBD 3NXWA 1XYIA 3D4RA 2NVQB 2EY2A 2TMPA 1PLFA 3MFYA 2EPBA 1HPCA 1HUNA 2B2UC 4K14A 2F03A 5J1ZA 3KLRA 5ELCA 5E4XA 4A3MB 3J80L 3NWSA 4XQJA 3ND9A 3GTOB 4DF7A 2XIWA 5I9OA 3OHXC 1H9SB 1SNPA 4AYBB 4G7ZC 1TS3A 2ICIA 1EL0A 1ONLA 3MXPA 4BY1B 1SDFA 1G91A 1XTCD 5IGCA 3FDTA 4FXGC 2M9VA 1VMCA 2NB0A 2ENBA 1GUGA 2XWBB 2ICEC 1GUNA 2HCCA 1O78A 1VDZA 2KJXA 4LAAA 1CA5A 2PNRC 2E74C 2XRSD 4OO1G 2O4XA 3URYA 2IX0A 2SOBA 3VYUA 1LTAD 3FRPB 4FP5D 3IL8A 3K57A 4C56C 3D6WA 1FGBD 1WTWA 5KNBA 4EQPA 3FMCA 2LFNA 4I7ZC 4C1NK 5EPKA 1KDCA 3GTGB 1I4GA 2JP1A 5EJWA 1NR2A 1RKNA 3DWQA 2F3WA 1GXDC 5JPMC 1U9RA 4QMGA 3KLSA 4XT3B 1PRTF 2WKDA 1C8CA 3V2TA 2OEOA 1SMYC 1LACA 1EY5A 3KF8A 3S1QB 1FD7D 1Q8IA 1SNCA 4FXDA 1CHQD 1MBYA 3SK4A 3EJIA 1STNA 4XDXA 4HAEA 1EIGA 3K59A 1A3TA 5C0XJ 2VUMB 3TSSA 1LABA 1BQQT 5J22A 1DD2A 1YNND 5KGUA 3TN2A 1EU4A 4ZKCB 3JAME 2M00A 3DMUA 4HSPA 3J7AF 4FVMA 3W3AA 4OIJA 5JOBA 3H0GB 3EROA 5CV7A 4H7BA 1JB3A 3VR5A 2RQXA 1S5FD 2B8FA 5K36G 2V4DA 2K01A 5DAUA 4CGYB 1OXSC 2L5TA 4RWSC 1QILA 3HOVB 4DAYA 1HRJA 2K7VA 2E75C 3BYTB 5E4WC 5C4XB 1EZ6A 1QNUA 3ERQA 4DXGA 3E6ZX 3IAYA 1VMPA 2VB3X 4IN3A 2Z1CA 4I65A 3I4NB 2XN9C 1KNEA 3D31A 2D2CC 1LTGD 4WFN3 3CKIB 2CHBD 4HTHA 1TWGB 3IFTA 2IT1A 1PFMA 2F3VA 2B63B 5C4JB 1HUMA 1JOQA 3P7JA 5LL6S 1EY6A 5CMDA 4GZYC 3S2DB 1NR4A 1PTOC 3MXNA 1DXMA 4PV1C 5IGEA 2HDMA 2PCFB 5A35A 5IGBA 1Y8PB 1ZEQX 3KBGA 3GV3A 4CKEA 3I91A 4A3EB 2F1MA 3BG3A 3CRKC 5I2YA 4A3GB 3M3YB 4OHJA 2NN6H 3VR4A 2J7ZA 1X3PA 1CTMA 1CI3M 5EGTA 4RHSA 3T53B 3NTIA 5I4DA 2E2IB 1EQVA 2K5WA 2JA8B 1HQRD 1VCIA 1V1PA 3NK9A 1HFGA 2L55A 4HN7A 3FPUB 1PFNA 3X3NA 4KY6A 1RTOA 2NN6I 1GJXA 2EYLA 3E0JA 4QB4A 1TY0A 5EPLA 5BN5A 1ICWA 3GTQB 2FFKB 4G57A 4KD3A 1TS5A 2BCOA 4RHRA 3BVGA 1QOHA 4DU9A 2E76C 2EYOA 1LTID 1TWHB 1SE2A 2R61A 4RCOA 4Q0FA 2JSOA 3P1HA 4ID6A 4RGTA 1SJED 4KKSA 5FLXE 5JVG3 1S5BD 3I90A 1PZJD 1Q3LA 1B9MA 1RTNA 3VA5A 3I4MB 1MSGA 1CM9A 1DOMA 1BXTA 3S2HB 1V1OA 3PUZA 5I9PA 2B2VA 2MJ8A 1SJHD 1SMYD 1B50A 1I4PA 2HDLA 1CK1A 1AN8A 1STYA 4UDUC 2GA4B 1DOKA 3D3RA 5KYIA 4QUCA 4CBVA 3DWPA 1I50B 1L0XB 2K5DA 5CR3A 5JAVA 3R2IA 4XT1B 1PRTC 3A8KE 3K5LA 2MP1A 1R4QB 1E2ZA 3SK8A 3EA6A 4IUQA 4ME5A 5TSSA 2KECA 2L1BA 2A6HC 1J9OA 2WINB 3NWTA 3GTLB 5IODA 2AUJD 3A55A 2DNCA 1X3QA 3D4WA 1BDOA 4XTCS 3S17B 2F4IA 3NSWA 1GHJA 5G3LD 1MI2A 1A2UA 3I4LA 1H9MA 2AQ3B 4RCNA 4A3DB 4RGNA 4E6IA 1SNOA 1CA6A 2EYJA 3S14B 2NWGA 4R8NA 2EE1A 3BZDB 4ZQ3A 1WCMB 2FMCA 4HMJA 3M7GA 4PMCA 4HCSA 3C1EA 4V0BA 5ELBA 2E2HB 1R9TB 3E5SA 4KHVA 3TZUA 2JE6I 1Q1BA 3PIP3 1KTKA 1UAPA 3DUZA 3K7AB 2EY5A 2JA7B 1SNQA 3BVMA 1QNKA 4ZLTF 1G8ZD 1Q12A 4IURA 1PTOD 1EIHA 2H1EA 5M3MB 3QWNA 2YU9B 1TWFB 3S1MB 4KN4C 2NTTA 4C3JB 1IHZA 5KYLA 3S1RB 1FNWA 1K83B 5JPNC 2D5DA 4KY7A 4ZUIA 5C3WA 1ESFA 3K58A 2CVRA 1ZYRC 5IGDA 2YYZA 3T13A 3J7YW 4BY7B 3MAQA 3SE0A 4P2CB 3WOEA 2F0LA 2XNAC 4WRDA 2KEEA 4RH6A 2RKSA 1G2TA 2B39A 1ML0D 1HA5A 2B2VC 2Z4IA 2EY6A 5E1FA 2RA4A 3RUZA 3MZ5A 1EQTA 4BWGB 4OIKA 4K2KA 1F2LA 4A3FB 3U9OA 2SEBD 2MUYA 5KNCA 1H9SA 1TU2B 2F0DA 4KTAA 1ILQA 4BBRB 3NBHA 4DK1A 4RA8A 3CRLC 2LMCB 5IT9E 4IUUA 3OIQA 2DY8A 2F0WA 4WORA 3SK5A 1O7ZA 3QO2A 5D3DA 3GTPB 1CHPD 2ZXRA 4DGZA 2M2LA 4F88A 1DOLA 1Y1WB 5FO7B 1HTPA 1Y8NB 1HQMC 3S16B 2WV6D 1TS4A 3R93A 2DN8A 3RZOB 3MHBA 3GD7A 1U4LA 2A6EC 1LV9A 3BDLA 1EYAA 1V8QA 3VA7A 5CBAE 5KNDA 3IFDA 5LHY1 5DM73 4TQUS 4L8JA 5CV9A 1O7YA 1G6ZA 1D6EC 2B2TA 5IGGA 1WTRA 3T56B 2F0JA 2K6AA 3Q23A 3SVMA 2CQAA 4KJOA 5CORA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ME5 A;  2NUC A;  3OWF A;  3PMF A;  5C5L A;  3S9W A;  3D8G A;  4ZUJ A;  5IGD A;  3T13 A;  5IOD A;  2QDB A;  3QB3 A;  1STA A;  5JOB A;  5C4Z A;  3OMC A;  4EVO A;  1EY9 A;  1EZ6 A;  3ERQ A;  2EYM A;  2PQE A;  5CV4 A;  1SYG A;  2F0L A;  2F0N A;  2SNS A;  4F8M A;  2EYL A;  1KDC A;  3D4W A;  1SYD A;  2EYP A;  4WRD A;  3NQT A;  4QB4 A;  4DFA A;  3TP6 A;  5EKK A;  4HMI A;  5C3X A;  5K5P A;  2RKS A;  2F0V A;  4KJN A;  1RKN A;  2F0K A;  4G57 A;  4KD3 A;  2F0O A;  2F3W A;  4KV6 A;  4OL7 A;  4I65 A;  3NXW A;  1A2U A;  3SK6 A;  5CV8 A;  1EY0 A;  2EY6 A;  3BDC A;  5C6A A;  5CV6 A;  5E1F A;  3LX0 A;  2EY2 A;  1SYC A;  3RUZ A;  1JOK A;  3MZ5 A;  3R3O A;  2OF1 A;  2EXZ A;  5I6W A;  1U9R A;  1EYD A;  1SYB A;  3MVV A;  1TR5 A;  2F0G A;  4NP5 A;  4QMG A;  4DU9 A;  4K2K A;  5I9O A;  4K14 A;  2EY1 A;  3MEH A;  4N9T A;  5F2D A;  4PNY A;  5I6Y A;  2EYO A;  5J1Z A;  1SNO A;  3U9O A;  4E6I A;  3SK4 A;  3ITP A;  2EYJ A;  2PYK A;  3QOL A;  5KEE A;  4HTH A;  1EY4 A;  4K5V A;  2F0D A;  1F2Z A;  5IGE A;  3EVQ A;  4KTA A;  1STG A;  2F0S A;  3V2T A;  2OEO A;  4R8N A;  5NUC A;  3DHQ A;  1EY5 A;  4ZQ3 A;  1A2T A;  1EY7 A;  1F2Y A;  4K5X A;  3P1H A;  2F3V A;  1EYC A;  2OXP A;  4HMJ A;  4ID6 A;  2F0Q A;  3SK5 A;  4B9W A;  3TP7 A;  1JOQ A;  4PMC A;  2WAC A;  1EY6 A;  3TP8 A;  3HEJ A;  4NKL A;  3C1E A;  4PMB A;  5CC4 A;  4IAL A;  1SNC A;  4KD4 A;  1EZ8 A;  2EYH A;  5DEH A;  2PW5 A;  2F0W A;  4J1M A;  3E5S A;  2F0M A;  2PZW A;  4K2L A;  4RKL A;  4KHV A;  4NDX A;  4WOR A;  3EJI A;  1STN A;  5C5M A;  3OMG A;  2PZU A;  2RBM A;  3SXH A;  2KQ3 A;  3VA5 A;  2PZT A;  5KIX A;  3QOJ A;  4IUN A;  1SNP A;  2EYF A;  3NUC A;  1A3T A;  5IGB A;  1SNM A;  1SYE A;  4TRD A;  4RKB A;  2F0P A;  3TP5 A;  1F2M A;  1NUC A;  2EY5 A;  2F0U A;  4K5W A;  1KAA A;  4DGZ A;  5J22 A;  3MXP A;  5KGU A;  5I9P A;  1JOO A;  5IGC A;  1SNQ A;  3D4D A;  1JOR A;  1A3V A;  3D6C A;  1KAB A;  5M9O A;  4K8J A;  2M00 A;  3DMU A;  4EQN A;  2ENB A;  2F0H A;  4N9P A;  3T16 A;  3HZX A;  4KY5 A;  5IOC A;  3MHB A;  4F7X A;  1SYF A;  4K6D A;  1STB A;  4DF7 A;  5KRU A;  1TQO A;  5ISR A;  1ENA A;  3NHH A;  4J6H A;  1STY A;  3BDL A;  3H6M A;  3ERO A;  5E3F A;  1TT2 A;  3P75 A;  1EYA A;  2F0E A;  5CV7 A;  5EGT A;  4S3S A;  4H7B A;  5CV5 A;  4LAA A;  4NMZ A;  1II3 A;  5KYI A;  2F0T A;  2F0I A;  5CGK A;  4YIJ A;  1EY8 A;  1SND A;  2O4X A;  2PW7 A;  5HUR A;  2SNM A;  5IGF A;  5CV9 A;  1EQV A;  5IIF A;  1IHZ A;  1KDB A;  2SOB A;  1KDA A;  4ODG A;  2RDF A;  5IGG A;  5CR3 A;  5KYL A;  5JAV A;  4K8I A;  1A3U A;  1AEX A;  3NK9 A;  3SR1 A;  2LKV A;  3SHL A;  4QF4 A;  5DAU A;  3NP8 A;  4KY7 A;  2F0J A;  4ZUI A;  4B9X A;  1STH A;  5C3W A;  5EKL A;  3TME A;  3SK8 A;  4IZ8 A;  5J39 A;  4MIU A;  2KHS A;  2F0F A;  5C4H A;  2HQE A;  3OSO A;  4KJO A;  1ENC A;  3C1F A;  1NSN S;  4KY6 A;  4EQO A;  4EQP A;  5HGT A; 
#chains in the Genus database with same CATH topology
 3P20 A;  2KUM A;  3RR5 A;  2IX3 A;  4X66 Q;  3D8G A;  2BH2 A;  1PMR A;  4C3H B;  1VQP A;  4G7O C;  4ILW A;  2EYM A;  1BBU A;  2VB2 X;  1VQN A;  1YHA A;  1E2V A;  1GVP A;  4DAP A;  2JQO A;  4YCV A;  1SEB D;  3SEB A;  5IE8 A;  1WTH A;  4RFB A;  4IFD G;  1U4P A;  1E24 A;  2QF7 A;  5CV6 A;  1PRT D;  1YZ6 A;  4ZYS A;  1Q1E A;  4DR6 Q;  2E5L Q;  4QGU A;  4N8F A;  4N9T A;  5F2D A;  1AP0 A;  1JWU D;  4DNR B;  1NJI C;  1VQ6 A;  3CCJ A;  4X6A H;  4EGV A;  2ZT9 C;  3QOL A;  4HR7 B;  2A6H D;  2I5L X;  4K0K Q;  1MD2 D;  4HIO A;  4IUT A;  3S1Q H;  2MQH A;  2K04 A;  4OXP A;  3DEO A;  1TKW B;  1A2T A;  5T1G A;  4DV2 L;  2DNE A;  2UU9 Q;  5M5Y B;  2A5H A;  4FF4 A;  3TP7 A;  3L3O C;  2QDL A;  4GLV B;  3G71 A;  2Z4H A;  5ELF A;  4R4O A;  2PW5 A;  1IYV A;  4B9W A;  4X3K A;  4DV0 L;  4O1N A;  1MIU A;  3AB9 A;  3OMG A;  4DV6 L;  2VUM H;  1DON A;  3ULL A;  3KYH C;  4OEL B;  1QZH A;  2KHI A;  5DLQ E;  4UP8 A;  5IYB G;  3FPP A;  2TSS A;  4OON A;  1PH6 A;  5LL6 X;  4K8J A;  4DR2 L;  3H0G H;  3HOX B;  1FGU A;  2JA5 G;  2L4N A;  1Y1V B;  3STB D;  2QIL A;  4I7A A;  1NTG A;  3F2C A;  4ZK9 B;  3QJY A;  1QG7 A;  5LMN L;  2BOS A;  5D65 A;  3K5M A;  3KLS X;  1EY8 A;  5JJZ A;  1Z6H A;  4NW2 A;  1PTO B;  1BVS A;  2L11 A;  4ODG A;  2RDF A;  2K28 A;  3F2B A;  3PIP A;  3G7L A;  1UE1 A;  2KCM A;  3NPP A;  4DV0 Q;  1L0Y B;  3VYS A;  5EKL A;  3TME A;  1IBL Q;  3HOV H;  2JYO A;  5A2Q L;  2HQE A;  3OSO A;  1ENC A;  3KOJ A;  5EPJ A;  3HGB A;  3NQI A;  4H13 C;  2HT1 A;  2IWH A;  2EOT A;  1GM5 A;  3U4V A;  2JA6 B;  1UE7 A;  3K5N A;  4R4C A;  4DR2 Q;  3FKI G;  1XPO A;  4HSV A;  2HD3 A;  2ZTC A;  3CW2 C;  3TP6 A;  3RMH A;  1MJE A;  5FO8 B;  2RDG A;  1CSQ A;  4AIM A;  4B3R L;  3O13 A;  2A68 C;  4P73 A;  4WJW A;  1IZ6 A;  1HNX L;  5FO9 B;  1JOK A;  3NTH A;  3J80 E;  3R3O A;  2OF1 A;  2EXZ A;  2R7Z G;  4DK0 A;  1IW7 C;  1K8O A;  5I6Y A;  4JI5 Q;  1UE5 A;  1ZYR D;  2NN6 G;  5ELO A;  1TWG H;  4CJ2 C;  3KF8 B;  4K5V A;  3JAM i;  1NCV A;  2Z6B A;  2B63 H;  5C4J H;  5NUC A;  1IBK Q;  1SFO B;  2B2T C;  3PIO 3;  2A8V A;  1F2Y A;  3GTK B;  3S2D H;  1EYC A;  1BR9 A;  4FNF A;  4DV3 Q;  2C5C A;  1BCP F;  2JN4 A;  2LY7 A;  3TP8 A;  1RDP D;  4KD4 A;  3TZD A;  1XX8 A;  3CXC A;  2IHE A;  5I2X A;  4LF8 L;  3ONA B;  3QOJ A;  4A3E H;  1VF7 A;  2HHH L;  4C2M B;  4A3K G;  4A3G H;  1KHI A;  1NAP A;  3M3Y H;  1F2M A;  1JE4 A;  1HNX Q;  2HCI A;  1GUT A;  1XPR A;  1LTS D;  1OO9 B;  4EQN A;  3VR3 A;  3Q24 A;  2UXC Q;  1GUO A;  4DK6 C;  3J81 j;  2E2I H;  3J81 L;  2R92 B;  1SXT A;  1TT2 A;  3P75 A;  3CCR A;  4DUZ L;  1PH1 A;  2QCP X;  2JA8 H;  3E9I A;  1UNS A;  1T5E A;  1E0B A;  3H3V H;  1SN8 A;  2JA5 B;  1QE6 A;  3SR1 A;  4QF4 A;  2PO4 A;  5CYU A;  4LF8 Q;  3DLL A;  4OGQ C;  4DAY B;  1G2S A;  1SLJ A;  4IUV A;  3QG1 A;  3PUX A;  4KKT A;  1D2B A;  1NSN S;  1S5E D;  3A7A B;  4YY3 L;  2BH8 A;  2R7F A;  3MA2 B;  3K0Y A;  5EKI A;  1C0A A;  5JEA H;  3TBI B;  2F0N A;  4HJA A;  3GTQ H;  1IYU A;  1WTP A;  2EYP A;  3MFG A;  1K73 C;  5LMU L;  4H44 C;  2F0V A;  4KJN A;  3CCQ A;  4DR1 L;  1O7I A;  5AFW A;  1SE4 A;  2JJQ A;  4DUZ Q;  5M3F H;  3KDF A;  3OWE B;  3H3V I;  4FO2 A;  4LWC A;  1PFB A;  2NVX B;  2AWN A;  2CH4 A;  1BOS A;  2IJ0 A;  3J7Z C;  4MHE A;  1TWH H;  4DV7 L;  2EZV A;  1PRT B;  1RF2 D;  4QIW B;  3EVQ A;  1L2F A;  1STG A;  3I70 A;  1XNR L;  1BO0 A;  1EY7 A;  2K5Q A;  3MXN B;  3SDZ A;  1RHP A;  2CW0 C;  3A5Z B;  1D5Z C;  1EEI D;  4IAL A;  1NMG A;  1N36 L;  5DEH A;  5T1I A;  1U5K A;  4K2L A;  1B4O A;  3K5O A;  3S9W A;  1R4P B;  5M3F B;  3ERS X;  3SXH A;  1TY2 A;  1D5M C;  3H15 A;  3HOY B;  4CDE C;  4JBK A;  3F8T A;  1RL2 A;  1V43 A;  3ZYY X;  4LUV A;  1EWC A;  2IX1 A;  5LMU Q;  3S2H H;  1NE3 A;  5C3E B;  1AZQ A;  1HFN A;  4JK1 C;  2E8G A;  3TP5 A;  2R3Z A;  2VNU D;  4PQX A;  4IFD J;  1PYB A;  2F4V L;  1JOO A;  1YJW A;  4LFC L;  4Z9C B;  2NZ1 D;  4LJZ C;  1XNQ L;  1KAB A;  2SDF A;  1CQV A;  3HG9 A;  2JK8 A;  1JJG A;  1ET6 A;  4LNQ A;  4N9P A;  1I6H B;  2KCN A;  2HIV A;  2O2L D;  4DR3 L;  3HFZ B;  1ENA A;  3NHH A;  2J4X A;  5E3F A;  1OXT A;  2F0E A;  1XNR Q;  2K5N A;  1I50 H;  5CV5 A;  2R93 G;  1I94 Q;  4MNO A;  3NTK A;  1PH9 A;  4JI2 L;  2KA7 A;  5IIF A;  1Q90 A;  3ND8 A;  2WP8 J;  1GUS A;  4K8I A;  1AEX A;  1HZC A;  4IPC A;  4B9X A;  1STH A;  5CBE E;  1TXY A;  4X62 L;  1M1K C;  4GLX A;  1TS2 A;  4CKB A;  5IP7 H;  4CHT B;  3TRZ A;  4UHV A;  3GTL H;  1OXV A;  3OWF A;  3VR6 A;  5HGQ A;  4DR5 L;  1KLG D;  1TWA B;  3S17 H;  3OMC A;  3CD6 A;  3I8Z A;  4NB3 A;  1SYD A;  2MFI A;  3U4Z A;  2N88 A;  1LTL A;  4A3J H;  1MSH A;  1SMX A;  2HUG A;  4QUF A;  4OL7 A;  5ELN A;  3KJO A;  3LWU A;  3UI2 A;  4DV4 L;  3BDC A;  4A4I A;  1QB5 D;  1SYC A;  4A3D H;  1QJO A;  1P8L A;  1ILP A;  4JI2 Q;  5GAG C;  3S14 H;  5C44 G;  1FNV A;  2PI2 E;  1A0I A;  1EY4 A;  4DNI A;  1WCM H;  2D0P A;  2K1B A;  1M4V A;  4OX9 Q;  2F0S A;  2VL6 A;  4C3I G;  1MGS A;  5L37 A;  2OXP A;  2E2H H;  1B53 A;  3PO3 B;  1R9T H;  1YNJ C;  1BF4 A;  3I3C A;  1VQE A;  4PMB A;  4YCU A;  4A3J B;  4LF5 L;  3RLN A;  1HR0 W;  1I4Q A;  1WOC A;  2A68 D;  4KHZ A;  2PZU A;  2RSO A;  4B3S L;  2PZT A;  3KUP A;  3V96 A;  2EYF A;  3K7A H;  4XIG S;  3NUC A;  3I72 A;  3RLF A;  1LLR D;  4IOA A;  5IP9 G;  1IW7 D;  4PMW A;  2JA7 H;  2MO1 A;  2F0P A;  2F0U A;  4DV4 Q;  1MHW C;  5GAE C;  1Z47 A;  5M9O A;  2WB1 G;  4KKU A;  3FEW X;  4APV A;  3MXU A;  4KN7 C;  3AQQ A;  1QWY A;  5M3M H;  3Q22 A;  4K6D A;  2YU9 H;  1X3G A;  5ISR A;  3PIO A;  5AJ3 L;  1TWF H;  3S1M H;  2PMZ B;  1N34 Q;  1II3 A;  4C3J H;  4OWW B;  1L1O C;  4BBS G;  3HOW B;  5HUR A;  3BZK A;  2SNM A;  3S1R H;  1K83 H;  1SSO A;  4U67 3;  5IWA Q;  4JW0 A;  1A3U A;  3PUV A;  4JI8 Q;  2LKV A;  3NP8 A;  2C9O A;  3H09 A;  1VF5 C;  2B2W A;  1JQY D;  2X69 A;  4ZAI A;  4IZ8 A;  2G9H D;  2F0F A;  4X3U A;  4A3M G;  5C4H A;  2K33 A;  3WOF A;  3BVZ A;  1J5E L;  2O5I C;  3A8J E;  1BCP C;  4BY7 H;  4R4T A;  1YBY A;  3A8I E;  1KL9 A;  1ET9 A;  2PQE A;  1CFM A;  2FIN B;  4DFA A;  1TII D;  4AYB G;  1O80 A;  1ZKO A;  2FXQ A;  3PO2 B;  1FVI A;  4DPG A;  1I3Q B;  5CV8 A;  1UEA B;  3R8B A;  4BY1 G;  1AE3 A;  2EJM A;  2GVB A;  5D3I B;  1PZI D;  2ZM6 L;  1CKN A;  2F0G A;  1X65 A;  2EY1 A;  3E0E A;  1K8M A;  2LS0 1;  1VQG A;  4BBR H;  1J8I A;  2ASB A;  4DUY L;  3A54 A;  3ICE A;  1CZG A;  3NBI A;  4LUZ A;  3OOC A;  4GKK Q;  5EAY A;  2O5J C;  3I73 A;  3PCO B;  1JWM D;  2A1A A;  4K5X A;  1S5C D;  1VQC A;  1J5E Q;  1HTL D;  2MPM A;  3TDQ A;  3EIV A;  3GV6 A;  1A15 A;  1HZA A;  4J1M A;  1VQ9 A;  2PZW A;  2EQS A;  5C0X H;  3GTP H;  2RBM A;  4C3I B;  4L5R C;  4IUN A;  1S4Z A;  1RD9 D;  3T1H L;  1JR0 D;  3LWE A;  4A75 A;  4RGO S;  3FVQ A;  1CT1 D;  4LF4 Q;  3S16 H;  3S15 B;  4B3T L;  4X65 L;  1EWI A;  3D6C A;  3RZO H;  2PPB C;  3HOU B;  2BDN A;  1IKM A;  4FF3 A;  1V1Q A;  5KRU A;  4NXM Q;  1TQO A;  3PV0 A;  2CW0 D;  4DUY Q;  4LW1 A;  4GNX C;  2BA1 A;  1U4M A;  2AQ1 B;  5M5X B;  3GTM B;  2NVY B;  2OTL A;  4U68 A;  2N78 A;  3NEL A;  3JAM L;  1UUP A;  2QEJ C;  5C0X I;  1HA6 A;  2A69 C;  4QL5 A;  3J81 c;  2I0Q A;  1HJP A;  3KJP A;  2KHS A;  4BBS B;  3T1H Q;  3A0J A;  3MTS A;  4C3H H;  2N3S A;  1QUQ A;  4EQO A;  5HGT A;  4L63 B;  5C5L A;  3LNN A;  4ZUJ A;  2B3G A;  2GVA A;  1OXU A;  2L0C A;  3QB3 A;  1KRS A;  1SE3 A;  1S5D D;  3KBX A;  5FLM H;  4B3M L;  4CDF C;  4P71 A;  4R8I A;  3RZD B;  4IOC A;  2F0K A;  4ZRZ A;  2KCC A;  3CPF A;  4CJ1 B;  5IYC H;  3SK6 A;  4C1N I;  1EY0 A;  2XGT A;  3LX0 A;  4ABN A;  2G9D A;  1QZG A;  3PUW A;  4A3I B;  3MVV A;  1A6X A;  1N32 L;  3AU7 A;  4HED A;  2UUB L;  3NBH B;  3RN5 A;  2Y0S B;  1KLU D;  1M8A A;  3ITP A;  3GQB A;  1XPU A;  5KEE A;  4B08 A;  3H0G G;  1O7L A;  2K03 A;  5M5Y H;  2E2J B;  1FYC A;  4H0L C;  3RLO A;  4JBM A;  3K80 C;  1B1Z A;  1XMQ L;  2WAC A;  1XJV A;  2K52 A;  1GKH A;  2XSC A;  1XMO Q;  2B2W C;  1AFP A;  1EZ8 A;  1D5X C;  2CCZ A;  5H1S E;  4A3B B;  1P16 A;  2K50 A;  2P5Z X;  4NDX A;  3HS0 C;  4UAI A;  4JBJ A;  4B3M Q;  3AMU A;  1EFI D;  2OTJ A;  2EJG C;  3AEV A;  1NNX A;  1PH7 A;  1SNM A;  1STE A;  2IW3 A;  3G4S A;  2UUC L;  3HOV G;  3UDG A;  2IPK D;  1XXG A;  1NUC A;  4F87 A;  1TWC B;  3A56 A;  3EBE A;  1BBX C;  1JB7 A;  3CAM A;  2NZH A;  5C4X G;  1SAP A;  3HOX H;  1FNU A;  3DEP A;  1KNA A;  4A93 B;  1Y1V H;  2UUB Q;  3RNU A;  2KHJ A;  4RGM A;  1F77 A;  4KMU C;  1CKM A;  1STB A;  1YNJ D;  4JV5 L;  4J6H A;  2XTI A;  4M8A A;  5EQ0 A;  3I4N G;  4QJF A;  1I6V C;  1PTO H;  1B7Y B;  4NPS A;  1DJR D;  2PW7 A;  4R4I A;  1EU3 A;  2QKI C;  1W6K A;  1VQ4 A;  4GS3 A;  1KDA A;  3GTJ H;  1PYW D;  1T5X D;  4JI3 L;  2ZJR A;  2AUK A;  3PUY A;  2VXW A;  1BUV T;  1LUZ A;  5D14 A;  1B9N A;  2R6G A;  3T51 B;  1W6J A;  1WD1 A;  2B63 G;  2K05 A;  2OT2 A;  2JA6 H;  2J0T D;  3BU2 A;  4A3L H;  1OXX K;  1STA A;  5HY6 A;  1JJC B;  4EVO A;  4DV2 Q;  1EY9 A;  1ICF B;  2SNS A;  3H94 A;  2UUA L;  4XQN A;  3GO5 A;  4JV5 Q;  1E2W A;  2V1C C;  4MTK A;  4A3E G;  4DV6 Q;  3GTJ B;  4OO1 H;  4A3G G;  5C6A A;  4JG2 A;  2F52 A;  2Z6K A;  3N6R A;  4FF1 A;  3BJU A;  1JCK B;  3OIP A;  4FXK C;  4IQZ A;  1WYD A;  4RMF A;  2Q8I B;  2VY3 A;  4PNY A;  1VQA A;  4IFD H;  4TVA B;  2I07 B;  2PYK A;  1WTX A;  2EDG A;  1BCP D;  3CCS A;  4JI3 Q;  1SFO H;  3GTK H;  2MO0 A;  3C3L A;  3OW7 A;  2NVT B;  3M9B A;  1RCV D;  2WAQ G;  4RG1 A;  1VQH A;  3M7N A;  3HOZ B;  1PYS B;  2XWJ B;  4O42 A;  3KK7 A;  2JA8 G;  1DGS A;  5LMN Q;  1I4R A;  1Q8K A;  4RKL A;  1FR3 A;  1V9P A;  4C2M H;  1UWV A;  4IO9 A;  2BE5 C;  2N8N A;  3N52 A;  1B44 D;  1E1T A;  4OO1 I;  2L9H A;  3B6Y A;  4K5W A;  5LMN W;  5FLX L;  5JVH 3;  4XXE A;  2ZXO A;  3HKZ G;  1YJ9 A;  3BDO A;  4N8X 1;  1K0S A;  4TSS A;  4UPA A;  4IFD I;  4LK1 C;  2DGY A;  4HIK A;  2F0H A;  2R92 H;  5FKA C;  3UDI A;  4KY5 A;  5JEA G;  1ENF A;  1SYF A;  3D0F A;  3HKS A;  4R9W A;  4DR4 L;  1ROD A;  1JIC A;  3JC6 6;  3OPO A;  4NMZ A;  2AQ2 B;  2F0T A;  3EN2 A;  3HRZ C;  1JE5 A;  3VR2 A;  4YIJ A;  2JA5 H;  1LT5 D;  1KDB A;  4B3R Q;  2YV5 A;  1U4R A;  1EUJ A;  3J80 i;  1F9P A;  3X3M A;  3M4P A;  3R2T A;  1PH4 A;  2D9U A;  1HH2 P;  4ULL A;  2FHT A;  3H91 A;  4MIU A;  4WJ3 M;  1B3A A;  4PZ7 A;  1YNX A;  4JI1 L;  3CPW A;  2GN5 A;  4JCV E;  1D1I A;  3PMF A;  3UDF A;  2KCT A;  3NE5 B;  4YHH L;  2ALY B;  2JEA I;  3I4M G;  2L12 A;  3RD4 A;  5EKK A;  5E7N A;  2Q8T A;  4DXF A;  2Q2H A;  1CZW A;  2ID0 A;  2A69 D;  1K28 A;  3W1B A;  2NVX H;  3BYY B;  1D8L A;  4IPH A;  1F9Q A;  2VZA A;  4JC0 A;  5K36 H;  3F2D A;  4DR7 L;  2HHH Q;  1Y69 U;  5JJK A;  1PFS A;  3OW2 A;  1SYB A;  1PH2 A;  4HIM A;  4GN4 B;  1EQR A;  1HZB A;  2I5H A;  2A6E D;  4JI7 L;  4CKC A;  2Q2U A;  2WKC A;  1F2Z A;  1GD7 A;  3U50 C;  1Q86 C;  3A74 A;  3DM1 A;  1A8V A;  1G51 A;  2F0Q A;  4XQQ A;  3MWY W;  3WDN A;  3HEJ A;  4NKL A;  5DNF A;  2XVS A;  1KQS A;  4K6L A;  3HOY H;  3S1N B;  5C5M A;  3LGJ A;  5C3E H;  5FOB B;  4POG A;  3FKI B;  2XRQ D;  3M4O B;  1IL2 A;  1L1O A;  3KFU A;  2WAQ B;  1DM0 B;  1GOZ A;  3EQL C;  2G5D A;  4LFB L;  1BNZ A;  4OEM B;  4TRD A;  1DCZ A;  2JXM B;  2I46 A;  4XYQ A;  2FJ2 A;  3RN2 A;  5IP7 G;  1GHK A;  4QQB X;  1RJT A;  1ESR A;  3CF5 A;  1PV4 A;  4DR7 Q;  5EBC A;  5GAH C;  1I6H H;  2R7Z B;  1UE6 A;  2WII B;  1WFQ A;  4KK7 A;  3CMA A;  4YY3 Q;  3T16 A;  5IOC A;  4KHP L;  4JI7 Q;  2Z6K C;  3MC0 B;  1WJJ A;  5BR8 L;  4X3T A;  1WTO A;  2DJG C;  1YIJ A;  4S3S A;  2K4K A;  3HKZ B;  2K75 A;  5FK9 C;  1Z7T A;  5A2Q E;  2VQF L;  1WVL A;  2X6L A;  4BXX H;  3W5O A;  1EEF D;  2PMZ E;  2OQK A;  4DR1 Q;  1ZXT A;  4A3D G;  1PHJ A;  1SBB B;  3UDX A;  1HNZ L;  1AE2 A;  3OYY A;  3SHL A;  3EFX D;  2E2D C;  2RHS B;  1X56 A;  2AWO A;  5M5W H;  1YHB A;  4KI0 A;  2IL8 A;  4DV7 Q;  1GO3 E;  3JAM c;  4LFB Q;  1FJG L;  3VYT A;  4A3K B;  2B2Y A;  1TWA H;  1DYQ A;  4ZKB B;  1EFW A;  3SGI A;  2Q8R E;  2NBF A;  4BS9 A;  4HID A;  3CU7 A;  1V1P B;  2Q2I A;  4CDC C;  1SYG A;  2ZXP A;  3E3X A;  1U0L A;  1IL8 A;  4DNT B;  3KDF B;  4KHP Q;  1N36 Q;  2JEB I;  5K5P A;  1BKB A;  2F0O A;  3T4A C;  4GLA C;  3GP7 A;  1HHV A;  1I4H A;  1KD1 C;  1J6Q A;  3PSI A;  2JA7 G;  2EVB A;  2VQF Q;  1VQO A;  3S24 A;  5I6W A;  5M5W B;  1EYD A;  4EQ5 A;  1WTQ A;  4NP5 A;  2UXB L;  4LMQ D;  5GRO A;  1I4X A;  5BN3 A;  3M85 A;  2PQA A;  2CFM A;  3HP3 A;  4M1U B;  5BN4 A;  1C4Q A;  2EXD A;  3KF6 B;  2F4V Q;  4A3C H;  4LFC Q;  2X6G A;  1XNQ Q;  2N55 A;  1PXU A;  1YIT A;  5M3M G;  4P75 A;  3DHQ A;  4G4K A;  3PO3 H;  1AZP A;  3IKJ A;  3Q0A A;  2EJF C;  1BCP B;  3F2U A;  4DR3 Q;  1G6P A;  4C3J G;  4L5S A;  1HNW L;  1TVX A;  3M4Y A;  4LF9 L;  1A62 A;  2F0M A;  4GNX A;  1RIP A;  1H95 A;  2CWA A;  3H3V C;  4O2D A;  2KQ3 A;  3A7L A;  5KIX A;  3PQI A;  4LF6 L;  5IYD H;  4X64 L;  1VQ8 A;  4MN3 A;  5IT9 L;  3C2P A;  3K81 C;  3J81 E;  2H5X A;  2MGS A;  1QVC A;  2EIF A;  4X62 Q;  3CHB D;  1IKL A;  3D4D A;  2KOL A;  4BY7 G;  1A3V A;  1LTB D;  1WD0 A;  4BA1 I;  3GDE A;  3A5U A;  3ULP A;  1XWE A;  2BA0 A;  3CC7 A;  3HZX A;  3L2P A;  4DR5 Q;  1Y8O B;  4L6T B;  2B2U A;  3H6M A;  1WTV A;  3HOW H;  2KVM A;  3VDY A;  1E1O A;  5CGK A;  4GN5 A;  1H9J A;  3J7A V;  2I5M X;  2BE5 D;  1HNW Q;  1QVF A;  3BS1 A;  4A3F G;  1N33 L;  1F9S A;  1C48 A;  4GOP A;  4BBR G;  3C46 A;  4H02 A;  1X6O A;  2YTV A;  4BA2 I;  3C1F A;  1MJC A;  2NUC A;  1AW7 A;  3DM3 A;  5JJL A;  4CDD C;  1EOT A;  4Q5V A;  4FDB A;  2QDB A;  4IUP A;  5CV4 A;  3PO2 H;  1H9R A;  4F8M A;  3L9A X;  3NQT A;  1I3Q H;  5C0X G;  5C3X A;  4HMI A;  5JEA J;  2Q2T A;  4LF5 Q;  2AMC B;  3DXJ C;  4KV6 A;  4V19 0;  4L5T A;  4B3S Q;  3FHW A;  1Y1W G;  4L5Q A;  2R93 B;  5EBD A;  1EYG A;  2FMM A;  4PG3 A;  1TR5 A;  1PDQ A;  3NEN A;  3QR8 A;  4DAV A;  2B8G A;  4PZ6 A;  4G7H C;  3MEH A;  1NMF A;  5G3L F;  3V05 A;  1VQ7 A;  1JOR A;  1JWS D;  1D1K A;  1YNN C;  2Z8L A;  1IBM L;  2MHV A;  1HXY D;  5COY A;  2RDH A;  2PI2 A;  4RAU C;  4CJ0 B;  2Y0S E;  2A73 B;  3Q6S A;  3TRE A;  4FF2 A;  1GUW A;  2DY7 A;  3CQZ B;  1LO5 D;  3U9S A;  5AJ3 Q;  5CC4 A;  1LTR D;  4C3I H;  2EYH A;  2KED A;  4FYD A;  4AH6 A;  1G29 1;  2B2Y C;  1X32 A;  3VYR A;  4DK3 C;  4QCL A;  1F9R A;  1SYE A;  1M90 C;  4RKB A;  3S15 H;  5FJ8 H;  1KAA A;  4C3H G;  4TKO B;  1JC7 A;  1VQB A;  3HOU H;  2K14 A;  3L7Z C;  2VW9 A;  2H4O A;  5IP9 H;  1NBW A;  5FLM G;  4P74 A;  5C44 B;  3MXG A;  4F7X A;  4DA2 A;  2RVL A;  2YTX A;  5M5X H;  1IBM Q;  4JYA L;  5FLX c;  4HCE A;  1K8A C;  3GTM H;  2NVY H;  1DZ1 A;  2HQL A;  1H9K A;  5DM6 3;  4J8Q A;  4NXN L;  2F0I A;  3G6J B;  5ELD A;  5IYC G;  1AH9 A;  2NTS A;  1LT3 D;  4Y7N B;  1SND A;  2NYZ D;  3QIA A;  4XYO A;  5IGF A;  4JBW A;  2D62 A;  1HCZ A;  1PTO F;  3AFQ A;  1UEB A;  4R4Q A;  3OTO L;  4X3S A;  1B2T A;  1CQF A;  1PZK D;  4BBS H;  4JI4 L;  3DWA A;  2RSN A;  2ZM6 Q;  2ES2 A;  2BDO A;  3K6O A;  5J39 A;  3PF5 A;  4JOI A;  1LT4 D;  1SRU A;  1WI5 A;  4JPB W;  4DN4 M;  1LT6 D;  1W2B A;  1VQL A;  1EWH A;  2K32 A;  2QGQ A;  3ULJ A;  5C4Z A;  3RZD H;  1YVC A;  2IHF A;  2WB1 B;  3W2D A;  5ELE A;  2A74 C;  1K3R A;  1LTT D;  4JYA Q;  4A3I H;  1QCB D;  3NXW A;  1XYI A;  4NXN Q;  3D4R A;  2UXD L;  2NVQ B;  1Q7Y C;  2EY2 A;  2TMP A;  1PLF A;  3MFY A;  2EPB A;  2RCF A;  1HPC A;  1B8A A;  1HUN A;  2B2U C;  1LM0 A;  4K14 A;  2F03 A;  3HOX G;  5J1Z A;  3KLR A;  4JI6 L;  5ELC A;  4JI0 L;  4B3T Q;  2E2J H;  4X65 Q;  4HJ7 A;  1VQI A;  3PF4 A;  1KAW A;  5E4X A;  4A3M B;  2Z9H A;  3J80 L;  3PGZ A;  2VUM G;  3NWS A;  4A3B H;  4XQJ A;  3ND9 A;  4GOP C;  3GTO B;  1S3O A;  4DF7 A;  2XIW A;  5I9O A;  3OHX C;  1H9S B;  1SNP A;  4AYB B;  2QEX A;  4G7Z C;  1EIF A;  1TS3 A;  4DR6 L;  3W1G A;  3Q8D A;  1VQM A;  2ICI A;  1TWC H;  5J3B A;  2ZTD A;  1EL0 A;  1ONL A;  2L15 A;  4A93 H;  2UXD Q;  3MXP A;  4BY1 B;  1SDF A;  1G91 A;  3CCU A;  1XTC D;  5IGC A;  3FDT A;  4K0K L;  4FXG C;  4A3L G;  4LFA L;  2M9V A;  1VMC A;  2NB0 A;  2ENB A;  1GUG A;  2XWB B;  4JI0 Q;  2UU9 L;  2ICE C;  1GUN A;  2R7D A;  2HCC A;  3L0O A;  1O78 A;  1VDZ A;  2KJX A;  4LAA A;  3GTG H;  1CA5 A;  3E9H A;  2PNR C;  3I7F A;  2E74 C;  2XRS D;  1C7Y A;  4OO1 G;  2O4X A;  1NY4 A;  1X54 A;  1S72 A;  3URY A;  2IX0 A;  2SOB A;  3VYU A;  1KIX A;  1LTA D;  3FRP B;  4FP5 D;  3IL8 A;  1QUQ B;  3K57 A;  4C56 C;  1C9O A;  1N32 Q;  3D6W A;  1FGB D;  1WTW A;  5KNB A;  4HJ9 A;  4EQP A;  3FMC A;  3K8A A;  2LFN A;  4I7Z C;  4LUO A;  3CCL A;  4LFA Q;  4C1N K;  5EPK A;  2ZTE A;  1XMQ Q;  1KDC A;  3GTG B;  1I4G A;  2JP1 A;  5EJW A;  3I56 A;  1NR2 A;  1RKN A;  4KLK A;  3DWQ A;  2F3W A;  1K9M C;  1GXD C;  4YWL A;  3AFP A;  4OWT B;  2CH4 W;  5JPM C;  1U9R A;  2UUC Q;  4QMG A;  1IBL L;  3KLS A;  4XT3 B;  1K8G A;  1SE8 A;  1VQJ A;  1PRT F;  2WKD A;  2NVT H;  2R92 G;  1C8C A;  3V2T A;  2OEO A;  1SMY C;  3HOZ H;  1LAC A;  1EY5 A;  4UP7 A;  2ZJP A;  3BZC A;  4J15 A;  3KF8 A;  3MEF A;  2ZJQ A;  3S1Q B;  1B3Q A;  1FD7 D;  4ME3 A;  1Q8I A;  1CSP A;  1SNC A;  4FXD A;  1CHQ D;  1MBY A;  4JOI C;  3SK4 A;  3EJI A;  1STN A;  1VQF A;  3ZJY C;  4XDX A;  4ALP A;  4HAE A;  1EIG A;  4PZ8 A;  1CUK A;  5GAD C;  3K59 A;  1A3T A;  5C0X J;  2VUM B;  4OWX B;  3TSS A;  1LAB A;  2WAQ E;  1BQQ T;  4JI5 L;  3G48 A;  1YNN D;  5J22 A;  2F3I A;  1DD2 A;  5KGU A;  4QIW E;  1IXR A;  3TN2 A;  1EU4 A;  3CC2 A;  4ZKC B;  3JAM E;  2M00 A;  3DMU A;  1IBK L;  4HSP A;  3J7A F;  5IT9 c;  4FVM A;  1YHQ A;  4DV3 L;  3W3A A;  4OIJ A;  5JOB A;  2CKZ B;  3ERO A;  3H0G B;  5C4X H;  5CV7 A;  3CME A;  4H7B A;  2UUA Q;  1YI2 A;  1S40 A;  1JB3 A;  3VR5 A;  1X3F A;  2RQX A;  1S5F D;  2D0O A;  3HKZ E;  1KXL A;  2B8F A;  5K36 G;  1HZ9 A;  2V4D A;  2K01 A;  5DAU A;  4CGY B;  3I4N H;  4YWK A;  1EIY B;  1OXS C;  5IYB H;  2L5T A;  4RWS C;  1QIL A;  3HOV B;  1KRT A;  4MZ9 A;  4DAY A;  1HRJ A;  2UXC L;  2K7V A;  2E75 C;  3BYT B;  5E4W C;  5C4X B;  1EZ6 A;  1QNU A;  3ERQ A;  5M3F G;  1KC8 C;  4DXG A;  3HOY G;  3E6Z X;  3IAY A;  1VMP A;  5C3E G;  2VB3 X;  1K0R A;  2AHO B;  3CCV A;  1Q46 A;  2OCE A;  4IN3 A;  2Z1C A;  1PH3 A;  4I65 A;  1MKH A;  2MNA A;  2XN9 C;  3I4N B;  5IY0 A;  1KNE A;  3AYH B;  3D31 A;  2D2C C;  1LTG D;  4WJ4 A;  4WFN 3;  1BBW A;  3K0X A;  3CKI B;  2K5V A;  2CHB D;  4HTH A;  1Y14 B;  1TWG B;  3IFT A;  2IT1 A;  1PFM A;  1EQQ A;  2F3V A;  2B63 B;  5C4J B;  1HUM A;  1JOQ A;  3P7J A;  5LL6 S;  1N8R C;  3S1N H;  1EY6 A;  5CMD A;  1Q81 C;  4DR4 Q;  3S2D B;  4GZY C;  4BXX G;  1NR4 A;  1PTO C;  3FKI H;  3MXN A;  4DAM A;  1DXM A;  4DV5 L;  3M4O H;  2VS1 A;  4PV1 C;  5IGE A;  2RF4 A;  2HDM A;  2PCF B;  5A35 A;  1VS0 A;  5IGB A;  4P72 A;  1VQ5 A;  1Y8P B;  1ZEQ X;  3KBG A;  1Z9F A;  3GV3 A;  4CKE A;  3I91 A;  4A3E B;  2F1M A;  3BG3 A;  3CRK C;  5I2Y A;  2R7Z H;  4A3G B;  3M3Y B;  4OHJ A;  4JI1 Q;  1W3S A;  3I4O A;  1ASY A;  2NN6 H;  3VR4 A;  1YJN A;  2J7Z A;  1X3P A;  1CTM A;  4YHH Q;  1CI3 M;  5EGT A;  4RHS A;  3T53 B;  3NTI A;  5I4D A;  2E2I B;  1EQV A;  2K5W A;  2JA8 B;  4MTN A;  1HQR D;  1VCI A;  1V1P A;  3NK9 A;  4DV5 Q;  1HFG A;  2L55 A;  4HN7 A;  3UE0 A;  3TS0 A;  3FPU B;  4A3K H;  4A3C G;  2IY5 B;  1JJ2 A;  4AQY L;  1PFN A;  3X3N A;  4KY6 A;  3PO3 G;  4A3J G;  5JJI A;  1RTO A;  1YEZ A;  4GN3 B;  2NN6 I;  1JMC A;  2DUD A;  1GJX A;  2EYL A;  3E0J A;  4QB4 A;  3KF6 A;  1I94 L;  1TY0 A;  3CC4 A;  5EPL A;  5BN5 A;  1ICW A;  3GTQ B;  2FFK B;  4G57 A;  4KD3 A;  1TS5 A;  5IYD G;  4Y52 H;  1A63 A;  3I4M H;  2BCO A;  4RHR A;  3BVG A;  1QOH A;  1WCM G;  4DU9 A;  2E76 C;  2EYO A;  1LTI D;  3IRB A;  4POF A;  1TWH B;  1SE2 A;  2R61 A;  4RCO A;  4Q0F A;  1SRO A;  2JSO A;  1ASZ A;  2B29 A;  1PVO A;  3HOW G;  4AQY Q;  1PH5 A;  2N49 A;  3P1H A;  4ID6 A;  1E22 A;  1N9W A;  5BR8 Q;  4RGT A;  1SJE D;  4KKS A;  5FLX E;  5JVG 3;  4JVZ A;  1S5B D;  3I90 A;  1L1O B;  2RHQ B;  1PH8 A;  1PZJ D;  1Q3L A;  1B9M A;  1RTN A;  3VA5 A;  3I4M B;  1I5F A;  3J80 c;  1MSG A;  2RCN A;  3ER0 A;  1HNZ Q;  1CM9 A;  1DOM A;  1BXT A;  3S2H B;  1V1O A;  3PUZ A;  4IJH A;  5I9P A;  4A76 A;  1X55 A;  3K7U C;  4IJL A;  2B2V A;  2ATW A;  1FJG Q;  1HR0 L;  2MJ8 A;  1SJH D;  1SMY D;  4OX9 L;  3CP0 A;  1B50 A;  1I4P A;  3PO2 G;  2HDL A;  1CK1 A;  3CCE A;  1AN8 A;  1STY A;  3KLW A;  4UDU C;  2GA4 B;  1DOK A;  3D3R A;  5KYI A;  4QUC A;  2AKW B;  3DWP A;  4CBV A;  1I50 B;  1L0X B;  2K5D A;  3M4Q A;  5CR3 A;  5JAV A;  2KBN A;  3R2I A;  2K5H A;  4XT1 B;  4ZCK A;  1PRT C;  3A8K E;  3K5L A;  2MP1 A;  1R4Q B;  4HJ5 A;  2UXB Q;  3UE1 A;  1E2Z A;  3SK8 A;  3U58 A;  3EA6 A;  2WFW A;  3TEH B;  4IUQ A;  4ME5 A;  5TSS A;  2OWO A;  2KEC A;  2L1B A;  2A6H C;  1J9O A;  2WIN B;  3NWT A;  3GTL B;  5IOD A;  2AUJ D;  3A55 A;  2DNC A;  1HR0 Q;  1N34 L;  1X3Q A;  3D4W A;  1BDO A;  4XTC S;  3S17 B;  2VQE L;  2F4I A;  4LF9 Q;  3NSW A;  2WB1 E;  1GHJ A;  2R93 H;  5G3L D;  1MI2 A;  1A2U A;  3I4L A;  5IWA L;  1H9M A;  2AQ3 B;  2PQA B;  4JI8 L;  4LF6 Q;  5FJ8 G;  1VQD A;  4X64 Q;  4RCN A;  3J81 i;  4A3D B;  4RGN A;  3HOU G;  4E6I A;  1SNO A;  2LSS A;  1CA6 A;  2EYJ A;  2QW7 A;  3S14 B;  2NWG A;  3CQZ H;  4R8N A;  2EE1 A;  1OTC A;  1X3E A;  3BZD B;  4ZQ3 A;  1WCM B;  2FMC A;  4HMJ A;  1D7Q A;  1X9N A;  1B70 B;  3M7G A;  4PMC A;  4GNX B;  3STB C;  4HCS A;  3C1E A;  4V0B A;  5ELB A;  2E2H B;  1R9T B;  3E5S A;  4KHV A;  3TZU A;  1IYJ B;  1Q1B A;  2JE6 I;  3PIP 3;  2VQE Q;  1VQK A;  1CKO A;  4DV1 L;  3F1Z A;  1KTK A;  1N33 Q;  1UAP A;  3DUZ A;  3K7A B;  2JA9 A;  4AYB E;  2EY5 A;  1LYL A;  2JA7 B;  1SNQ A;  4LF7 L;  4GKJ L;  2LXK A;  3BVM A;  5C44 H;  2QA4 A;  4GKK L;  1EOV A;  1QNK A;  3TQY A;  4ZLT F;  1G8Z D;  1Q12 A;  2HIX A;  2DJF C;  4IUR A;  1PTO D;  1EIH A;  2H1E A;  5M3M B;  1E7Z A;  4Y7N H;  3QWN A;  3FP9 A;  2YU9 B;  2C35 B;  4IPG A;  3I55 A;  4A3I G;  1TWF B;  2CQO A;  3NEM A;  4YCW A;  3S1M B;  4KN4 C;  2NTT A;  4EX5 A;  4C3J B;  2A19 A;  1T9H A;  4GOP B;  1IHZ A;  2Y0S G;  1QVG A;  5KYL A;  3S1R B;  1FNW A;  1K83 B;  5JPN C;  2OQ0 A;  1PA6 A;  3TS2 A;  2D5D A;  4KY7 A;  4ZUI A;  5C3W A;  1ESF A;  3K58 A;  2CVR A;  4LF4 L;  3G6E A;  4A3F H;  4YWM A;  4DV1 Q;  4R1J A;  1ZYR C;  5IGD A;  2YYZ A;  3T13 A;  4NXM L;  3J7Y W;  4A3B G;  4LF7 Q;  4BY7 B;  3MAQ A;  4GKJ Q;  3SE0 A;  4P2C B;  3WOE A;  2F0L A;  2XNA C;  1Q82 C;  3CCM A;  4WRD A;  2KEE A;  4RH6 A;  2RKS A;  1G2T A;  2B39 A;  2NVQ H;  1ML0 D;  1HA5 A;  2B2V C;  2Z4I A;  2EY6 A;  5E1F A;  2RA4 A;  3RUZ A;  2CWP A;  3MZ5 A;  2LXJ A;  1EQT A;  4BWG B;  2Z0S A;  4A93 G;  4OIK A;  1E3P A;  4K2K A;  1L0W A;  1F2L A;  4A3F B;  3U9O A;  2SEB D;  1Y1W H;  3J7A 5;  2MUY A;  5KNC A;  1H9S A;  1TU2 B;  4A3M H;  2F0D A;  4KTA A;  1ILQ A;  4BBR B;  3NBH A;  4DK1 A;  4RA8 A;  3CRL C;  2LMC B;  2NZO A;  5IT9 E;  4IUU A;  3OIQ A;  3GTO H;  3T1Y L;  2DY8 A;  1CKN B;  4QY7 A;  1XTD A;  4O0A A;  2F0W A;  4WOR A;  1K3B C;  3SK5 A;  1O7Z A;  1SR3 A;  3QO2 A;  5D3D A;  1JT8 A;  3GTP B;  3OTO Q;  1CHP D;  4UP9 A;  1Y1V G;  2ZXR A;  4BY1 H;  4JI4 Q;  4X66 L;  4DGZ A;  2M2L A;  4F88 A;  1DOL A;  1Y1W B;  5FO7 B;  2YTY A;  1HTP A;  1Y8N B;  2KEN A;  4IPD A;  5GQO A;  1HQM C;  3S16 B;  2WV6 D;  1TS4 A;  3R93 A;  2DN8 A;  4UY8 C;  3RZO B;  3MHB A;  3GD7 A;  1U4L A;  3WWV A;  2A6E C;  1LV9 A;  3BDL A;  2PNH A;  1EYA A;  1V8Q A;  4DKA C;  3VA7 A;  1XMO L;  5CBA E;  1FL0 A;  5KND A;  3IFD A;  3I2Z A;  5LHY 1;  5DM7 3;  2E5L L;  4TQU S;  4L8J A;  5CV9 A;  3T1Y Q;  1O7Y A;  1G6Z A;  1D6E C;  2B2T A;  5IGG A;  1WTR A;  2JA6 G;  3T56 B;  2F0J A;  2K6A A;  4HJ8 A;  3Q23 A;  3SVM A;  2CQA A;  4JI6 Q;  4KJO A;  3HOZ G;  5COR A; 
#chains in the Genus database with same CATH homology
 3P20 A;  2KUM A;  2IX3 A;  3D8G A;  1PMR A;  4C3H B;  4G7O C;  4ILW A;  2EYM A;  2VB2 X;  1E2V A;  4DAP A;  1SEB D;  3SEB A;  4RFB A;  4IFD G;  1U4P A;  2QF7 A;  5CV6 A;  1PRT D;  4ZYS A;  1Q1E A;  4N9T A;  5F2D A;  1AP0 A;  1JWU D;  4DNR B;  4EGV A;  2ZT9 C;  3QOL A;  4HR7 B;  2A6H D;  1MD2 D;  4IUT A;  2K04 A;  3DEO A;  1TKW B;  1A2T A;  5T1G A;  2DNE A;  5M5Y B;  2A5H A;  4FF4 A;  3TP7 A;  3L3O C;  2Z4H A;  5ELF A;  2PW5 A;  1IYV A;  4B9W A;  4X3K A;  4O1N A;  3AB9 A;  3OMG A;  1DON A;  3FPP A;  2TSS A;  5LL6 X;  4K8J A;  3HOX B;  2L4N A;  1Y1V B;  2QIL A;  4ZK9 B;  3QJY A;  1QG7 A;  2BOS A;  5D65 A;  3K5M A;  3KLS X;  1EY8 A;  5JJZ A;  1Z6H A;  4NW2 A;  1PTO B;  2L11 A;  4ODG A;  2RDF A;  2K28 A;  3G7L A;  3NPP A;  1L0Y B;  3VYS A;  5EKL A;  3TME A;  2JYO A;  5A2Q L;  2HQE A;  3OSO A;  1ENC A;  5EPJ A;  3HGB A;  3NQI A;  4H13 C;  2IWH A;  2EOT A;  2JA6 B;  3K5N A;  4HSV A;  3TP6 A;  3RMH A;  5FO8 B;  2RDG A;  3O13 A;  2A68 C;  4WJW A;  5FO9 B;  1JOK A;  3NTH A;  3J80 E;  3R3O A;  2OF1 A;  2EXZ A;  4DK0 A;  1IW7 C;  1K8O A;  5I6Y A;  1ZYR D;  2NN6 G;  4CJ2 C;  4K5V A;  1NCV A;  5NUC A;  1SFO B;  2B2T C;  3PIO 3;  3GTK B;  1F2Y A;  1EYC A;  1BR9 A;  4FNF A;  2C5C A;  1BCP F;  2LY7 A;  3TP8 A;  1RDP D;  4KD4 A;  3TZD A;  1XX8 A;  5I2X A;  3ONA B;  3QOJ A;  1VF7 A;  4C2M B;  1NAP A;  1F2M A;  1JE4 A;  2HCI A;  1GUT A;  1LTS D;  1OO9 B;  4EQN A;  3VR3 A;  3Q24 A;  1GUO A;  2R92 B;  3J81 L;  1SXT A;  1TT2 A;  3P75 A;  2QCP X;  1UNS A;  1T5E A;  1E0B A;  2JA5 B;  1QE6 A;  3SR1 A;  4QF4 A;  5CYU A;  2PO4 A;  4OGQ C;  1G2S A;  4IUV A;  3QG1 A;  3PUX A;  4KKT A;  1D2B A;  1NSN S;  1S5E D;  3A7A B;  3MA2 B;  3K0Y A;  5EKI A;  5JEA H;  3TBI B;  2F0N A;  1IYU A;  1WTP A;  2EYP A;  3MFG A;  4H44 C;  2F0V A;  4KJN A;  5AFW A;  1SE4 A;  3OWE B;  4FO2 A;  1PFB A;  2NVX B;  2AWN A;  1BOS A;  2IJ0 A;  4MHE A;  2EZV A;  1PRT B;  1RF2 D;  4QIW B;  3EVQ A;  3I70 A;  1STG A;  1BO0 A;  1EY7 A;  2K5Q A;  3SDZ A;  1RHP A;  2CW0 C;  1D5Z C;  1EEI D;  4IAL A;  5DEH A;  5T1I A;  4K2L A;  1B4O A;  3K5O A;  3S9W A;  1R4P B;  5M3F B;  3SXH A;  1TY2 A;  1D5M C;  3HOY B;  1V43 A;  3ZYY X;  1EWC A;  2IX1 A;  5C3E B;  1AZQ A;  1HFN A;  4JK1 C;  3TP5 A;  2R3Z A;  2VNU D;  4PQX A;  4IFD J;  1JOO A;  4Z9C B;  2NZ1 D;  4LJZ C;  1KAB A;  2SDF A;  1CQV A;  3HG9 A;  1ET6 A;  4N9P A;  1I6H B;  2KCN A;  2O2L D;  1ENA A;  3NHH A;  2J4X A;  5E3F A;  1OXT A;  2F0E A;  5CV5 A;  3NTK A;  2KA7 A;  5IIF A;  1Q90 A;  3ND8 A;  2WP8 J;  1GUS A;  4K8I A;  1AEX A;  4B9X A;  5CBE E;  1STH A;  1TS2 A;  4CKB A;  4CHT B;  1OXV A;  3OWF A;  3VR6 A;  1KLG D;  1TWA B;  3OMC A;  3I8Z A;  1SYD A;  2N88 A;  1MSH A;  2HUG A;  4QUF A;  4OL7 A;  3LWU A;  3UI2 A;  3BDC A;  1QB5 D;  1SYC A;  1QJO A;  1ILP A;  1FNV A;  1EY4 A;  2K1B A;  1M4V A;  2F0S A;  4C3I G;  1MGS A;  2OXP A;  1B53 A;  3PO3 B;  1YNJ C;  1BF4 A;  3I3C A;  4PMB A;  4A3J B;  1I4Q A;  2A68 D;  4KHZ A;  2PZU A;  2RSO A;  2PZT A;  3KUP A;  3V96 A;  2EYF A;  4XIG S;  3NUC A;  3I72 A;  3RLF A;  1LLR D;  1IW7 D;  4PMW A;  2F0P A;  2F0U A;  1Z47 A;  5M9O A;  4KKU A;  3FEW X;  3MXU A;  4KN7 C;  1QWY A;  3Q22 A;  4K6D A;  5ISR A;  2PMZ B;  1II3 A;  3HOW B;  5HUR A;  2SNM A;  1SSO A;  4U67 3;  1A3U A;  3PUV A;  2LKV A;  3NP8 A;  2C9O A;  3H09 A;  1VF5 C;  2B2W A;  1JQY D;  2X69 A;  4ZAI A;  4IZ8 A;  2G9H D;  2F0F A;  4X3U A;  5C4H A;  2K33 A;  3WOF A;  3BVZ A;  2O5I C;  3A8J E;  1BCP C;  3A8I E;  1ET9 A;  2PQE A;  1CFM A;  2FIN B;  4DFA A;  1TII D;  1O80 A;  1ZKO A;  3PO2 B;  1I3Q B;  5CV8 A;  1UEA B;  3R8B A;  2EJM A;  5D3I B;  1PZI D;  2F0G A;  2EY1 A;  1K8M A;  2LS0 1;  1J8I A;  3A54 A;  1CZG A;  3NBI A;  3OOC A;  2O5J C;  3I73 A;  1JWM D;  4K5X A;  1S5C D;  1HTL D;  2MPM A;  3TDQ A;  3GV6 A;  1A15 A;  4J1M A;  2PZW A;  5C0X H;  2RBM A;  4C3I B;  4IUN A;  1S4Z A;  1RD9 D;  1JR0 D;  3LWE A;  4RGO S;  3FVQ A;  1CT1 D;  3S15 B;  3D6C A;  2PPB C;  3HOU B;  2BDN A;  1IKM A;  4FF3 A;  5KRU A;  1TQO A;  3PV0 A;  2CW0 D;  2BA1 A;  1U4M A;  2AQ1 B;  5M5X B;  3GTM B;  2NVY B;  4U68 A;  3JAM L;  1UUP A;  2QEJ C;  5C0X I;  1HA6 A;  2A69 C;  2KHS A;  4BBS B;  3MTS A;  4EQO A;  5HGT A;  4L63 B;  5C5L A;  3LNN A;  4ZUJ A;  1OXU A;  2L0C A;  3QB3 A;  1SE3 A;  1S5D D;  3KBX A;  3RZD B;  4R8I A;  2F0K A;  4ZRZ A;  2KCC A;  4CJ1 B;  3SK6 A;  4C1N I;  1EY0 A;  3LX0 A;  4ABN A;  2G9D A;  3PUW A;  4A3I B;  3MVV A;  1A6X A;  3AU7 A;  4HED A;  2Y0S B;  1KLU D;  1M8A A;  3ITP A;  3GQB A;  5KEE A;  4B08 A;  1O7L A;  2K03 A;  2E2J B;  1FYC A;  4H0L C;  1B1Z A;  2WAC A;  2XSC A;  1AFP A;  2B2W C;  1EZ8 A;  1D5X C;  4A3B B;  4UAI A;  4NDX A;  3HS0 C;  3AMU A;  1EFI D;  2EJG C;  1SNM A;  1STE A;  2IW3 A;  2IPK D;  1XXG A;  1NUC A;  4F87 A;  1TWC B;  3A56 A;  1BBX C;  1SAP A;  1FNU A;  3DEP A;  1KNA A;  4A93 B;  4RGM A;  1F77 A;  4KMU C;  1STB A;  1YNJ D;  4J6H A;  4M8A A;  5EQ0 A;  1I6V C;  1PTO H;  1DJR D;  2PW7 A;  1EU3 A;  2QKI C;  1W6K A;  1KDA A;  1T5X D;  1PYW D;  2AUK A;  3PUY A;  2VXW A;  1BUV T;  5D14 A;  1B9N A;  2R6G A;  3T51 B;  1W6J A;  1WD1 A;  2K05 A;  2OT2 A;  2J0T D;  1OXX K;  1STA A;  4EVO A;  1EY9 A;  3H94 A;  2SNS A;  4XQN A;  3GO5 A;  1E2W A;  3GTJ B;  4OO1 H;  5C6A A;  3N6R A;  4FF1 A;  1JCK B;  3OIP A;  4FXK C;  4IQZ A;  2Q8I B;  4PNY A;  4IFD H;  1WTX A;  2I07 B;  2PYK A;  2EDG A;  1BCP D;  3C3L A;  3OW7 A;  2NVT B;  1RCV D;  3M7N A;  3HOZ B;  2XWJ B;  4O42 A;  3KK7 A;  1I4R A;  4RKL A;  1FR3 A;  2BE5 C;  3N52 A;  1B44 D;  4OO1 I;  2L9H A;  4K5W A;  5FLX L;  5JVH 3;  4XXE A;  2ZXO A;  3BDO A;  4TSS A;  4IFD I;  4LK1 C;  2F0H A;  5FKA C;  5JEA G;  4KY5 A;  1ENF A;  1SYF A;  4R9W A;  1ROD A;  1JIC A;  4NMZ A;  3OPO A;  2AQ2 B;  2F0T A;  3HRZ C;  3VR2 A;  4YIJ A;  1LT5 D;  1KDB A;  1U4R A;  1F9P A;  3X3M A;  3R2T A;  2D9U A;  4ULL A;  2FHT A;  3H91 A;  4MIU A;  1B3A A;  1D1I A;  3PMF A;  3NE5 B;  2JEA I;  2L12 A;  3RD4 A;  5EKK A;  2Q8T A;  4DXF A;  1CZW A;  2ID0 A;  2A69 D;  3BYY B;  1F9Q A;  5K36 H;  1Y69 U;  1SYB A;  2A6E D;  4CKC A;  2WKC A;  1F2Z A;  3DM1 A;  2F0Q A;  4XQQ A;  3MWY W;  3WDN A;  3HEJ A;  4NKL A;  5DNF A;  2XVS A;  4K6L A;  3S1N B;  5C5M A;  5FOB B;  3FKI B;  2XRQ D;  3M4O B;  2WAQ B;  1DM0 B;  1GOZ A;  3EQL C;  1BNZ A;  4TRD A;  1DCZ A;  2JXM B;  2I46 A;  4XYQ A;  2FJ2 A;  1GHK A;  1RJT A;  1ESR A;  5EBC A;  2R7Z B;  2WII B;  4KK7 A;  3T16 A;  5IOC A;  3MC0 B;  4X3T A;  1WTO A;  4S3S A;  3HKZ B;  5FK9 C;  1Z7T A;  5A2Q E;  1WVL A;  2X6L A;  1EEF D;  1ZXT A;  1SBB B;  3SHL A;  3EFX D;  2E2D C;  2AWO A;  4KI0 A;  2IL8 A;  3VYT A;  4A3K B;  2B2Y A;  1DYQ A;  4ZKB B;  2Q8R E;  2NBF A;  4BS9 A;  3CU7 A;  1V1P B;  1SYG A;  2ZXP A;  1IL8 A;  4DNT B;  2JEB I;  5K5P A;  3T4A C;  2F0O A;  3GP7 A;  1HHV A;  1I4H A;  2EVB A;  5I6W A;  5M5W B;  1EYD A;  1WTQ A;  4NP5 A;  4LMQ D;  1I4X A;  5BN3 A;  3M85 A;  4M1U B;  5BN4 A;  3HP3 A;  1C4Q A;  2X6G A;  2N55 A;  1PXU A;  3DHQ A;  4G4K A;  1AZP A;  3IKJ A;  3Q0A A;  2EJF C;  1BCP B;  3F2U A;  4C3J G;  1TVX A;  3M4Y A;  2F0M A;  3H3V C;  2KQ3 A;  3A7L A;  5KIX A;  4MN3 A;  5IT9 L;  3C2P A;  3J81 E;  2MGS A;  3CHB D;  1IKL A;  3D4D A;  2KOL A;  1A3V A;  1LTB D;  1WD0 A;  4BA1 I;  1XWE A;  2BA0 A;  3HZX A;  1Y8O B;  4L6T B;  2B2U A;  3H6M A;  1WTV A;  2KVM A;  5CGK A;  1H9J A;  3J7A V;  2BE5 D;  3BS1 A;  1F9S A;  1C48 A;  3C46 A;  4BA2 I;  3C1F A;  2NUC A;  1AW7 A;  4Q5V A;  1EOT A;  2QDB A;  4IUP A;  5CV4 A;  1H9R A;  4F8M A;  3L9A X;  3NQT A;  5C0X G;  5C3X A;  4HMI A;  5JEA J;  3DXJ C;  4KV6 A;  4V19 0;  2R93 B;  5EBD A;  2FMM A;  1TR5 A;  1PDQ A;  4DAV A;  2B8G A;  4G7H C;  3MEH A;  3V05 A;  5G3L F;  1JOR A;  1JWS D;  1D1K A;  1YNN C;  2Z8L A;  2MHV A;  1HXY D;  5COY A;  2RDH A;  4CJ0 B;  4RAU C;  3Q6S A;  2A73 B;  4FF2 A;  1GUW A;  2DY7 A;  3CQZ B;  1LO5 D;  3U9S A;  5CC4 A;  1LTR D;  2EYH A;  2KED A;  4FYD A;  1G29 1;  2B2Y C;  1X32 A;  3VYR A;  4QCL A;  1F9R A;  1SYE A;  4RKB A;  1KAA A;  4C3H G;  4TKO B;  1JC7 A;  3L7Z C;  2H4O A;  5C44 B;  3MXG A;  4F7X A;  4DA2 A;  2RVL A;  1DZ1 A;  4HCE A;  1H9K A;  5DM6 3;  4J8Q A;  2F0I A;  3G6J B;  5ELD A;  2NTS A;  1LT3 D;  4Y7N B;  1SND A;  2NYZ D;  3QIA A;  4XYO A;  5IGF A;  4JBW A;  2D62 A;  1HCZ A;  1PTO F;  1B2T A;  4X3S A;  1CQF A;  1PZK D;  3DWA A;  2RSN A;  2BDO A;  3K6O A;  5J39 A;  1LT4 D;  4DN4 M;  1LT6 D;  1EWH A;  2K32 A;  5C4Z A;  2WB1 B;  3W2D A;  5ELE A;  2A74 C;  1LTT D;  1QCB D;  3NXW A;  1XYI A;  3D4R A;  2NVQ B;  2EY2 A;  2TMP A;  1PLF A;  3MFY A;  2EPB A;  1HPC A;  1HUN A;  2B2U C;  4K14 A;  2F03 A;  5J1Z A;  3KLR A;  5ELC A;  5E4X A;  4A3M B;  3J80 L;  3NWS A;  4XQJ A;  3ND9 A;  3GTO B;  4DF7 A;  2XIW A;  5I9O A;  3OHX C;  1H9S B;  1SNP A;  4AYB B;  4G7Z C;  1TS3 A;  2ICI A;  1EL0 A;  1ONL A;  3MXP A;  4BY1 B;  1SDF A;  1G91 A;  1XTC D;  5IGC A;  3FDT A;  4FXG C;  2M9V A;  1VMC A;  2NB0 A;  2ENB A;  1GUG A;  2XWB B;  2ICE C;  1GUN A;  2HCC A;  1O78 A;  1VDZ A;  2KJX A;  4LAA A;  1CA5 A;  2PNR C;  2E74 C;  2XRS D;  4OO1 G;  2O4X A;  3URY A;  2IX0 A;  2SOB A;  3VYU A;  1LTA D;  3FRP B;  4FP5 D;  3IL8 A;  3K57 A;  4C56 C;  3D6W A;  1FGB D;  1WTW A;  5KNB A;  4EQP A;  3FMC A;  2LFN A;  4I7Z C;  4C1N K;  5EPK A;  1KDC A;  3GTG B;  1I4G A;  2JP1 A;  5EJW A;  1NR2 A;  1RKN A;  3DWQ A;  2F3W A;  1GXD C;  5JPM C;  1U9R A;  4QMG A;  3KLS A;  4XT3 B;  1PRT F;  2WKD A;  1C8C A;  3V2T A;  2OEO A;  1SMY C;  1LAC A;  1EY5 A;  3KF8 A;  3S1Q B;  1FD7 D;  1Q8I A;  1SNC A;  4FXD A;  1CHQ D;  1MBY A;  3SK4 A;  3EJI A;  1STN A;  4XDX A;  4HAE A;  1EIG A;  3K59 A;  1A3T A;  5C0X J;  2VUM B;  3TSS A;  1LAB A;  1BQQ T;  5J22 A;  1DD2 A;  1YNN D;  5KGU A;  3TN2 A;  1EU4 A;  4ZKC B;  3JAM E;  2M00 A;  3DMU A;  4HSP A;  3J7A F;  4FVM A;  3W3A A;  4OIJ A;  5JOB A;  3H0G B;  3ERO A;  5CV7 A;  4H7B A;  1JB3 A;  3VR5 A;  2RQX A;  1S5F D;  2B8F A;  5K36 G;  2V4D A;  2K01 A;  5DAU A;  4CGY B;  1OXS C;  2L5T A;  4RWS C;  1QIL A;  3HOV B;  4DAY A;  1HRJ A;  2K7V A;  2E75 C;  3BYT B;  5E4W C;  5C4X B;  1EZ6 A;  1QNU A;  3ERQ A;  4DXG A;  3E6Z X;  3IAY A;  1VMP A;  2VB3 X;  4IN3 A;  2Z1C A;  4I65 A;  3I4N B;  2XN9 C;  1KNE A;  3D31 A;  2D2C C;  1LTG D;  4WFN 3;  3CKI B;  2CHB D;  4HTH A;  1TWG B;  3IFT A;  2IT1 A;  1PFM A;  2F3V A;  2B63 B;  5C4J B;  1HUM A;  1JOQ A;  3P7J A;  5LL6 S;  1EY6 A;  5CMD A;  4GZY C;  3S2D B;  1NR4 A;  1PTO C;  3MXN A;  1DXM A;  4PV1 C;  5IGE A;  2HDM A;  2PCF B;  5A35 A;  5IGB A;  1Y8P B;  1ZEQ X;  3KBG A;  3GV3 A;  4CKE A;  3I91 A;  4A3E B;  2F1M A;  3BG3 A;  3CRK C;  5I2Y A;  4A3G B;  3M3Y B;  4OHJ A;  2NN6 H;  3VR4 A;  2J7Z A;  1X3P A;  1CTM A;  1CI3 M;  5EGT A;  4RHS A;  3T53 B;  3NTI A;  5I4D A;  2E2I B;  1EQV A;  2K5W A;  2JA8 B;  1HQR D;  1VCI A;  1V1P A;  3NK9 A;  1HFG A;  2L55 A;  4HN7 A;  3FPU B;  1PFN A;  3X3N A;  4KY6 A;  1RTO A;  2NN6 I;  1GJX A;  2EYL A;  3E0J A;  4QB4 A;  1TY0 A;  5EPL A;  5BN5 A;  1ICW A;  3GTQ B;  2FFK B;  4G57 A;  4KD3 A;  1TS5 A;  2BCO A;  4RHR A;  3BVG A;  1QOH A;  4DU9 A;  2E76 C;  2EYO A;  1LTI D;  1TWH B;  1SE2 A;  2R61 A;  4RCO A;  4Q0F A;  2JSO A;  3P1H A;  4ID6 A;  4RGT A;  1SJE D;  4KKS A;  5FLX E;  5JVG 3;  1S5B D;  3I90 A;  1PZJ D;  1Q3L A;  1B9M A;  1RTN A;  3VA5 A;  3I4M B;  1MSG A;  1CM9 A;  1DOM A;  1BXT A;  3S2H B;  1V1O A;  3PUZ A;  5I9P A;  2B2V A;  2MJ8 A;  1SJH D;  1SMY D;  1B50 A;  1I4P A;  2HDL A;  1CK1 A;  1AN8 A;  1STY A;  4UDU C;  2GA4 B;  1DOK A;  3D3R A;  5KYI A;  4QUC A;  4CBV A;  3DWP A;  1I50 B;  1L0X B;  2K5D A;  5CR3 A;  5JAV A;  3R2I A;  4XT1 B;  1PRT C;  3A8K E;  3K5L A;  2MP1 A;  1R4Q B;  1E2Z A;  3SK8 A;  3EA6 A;  4IUQ A;  4ME5 A;  5TSS A;  2KEC A;  2L1B A;  2A6H C;  1J9O A;  2WIN B;  3NWT A;  3GTL B;  5IOD A;  2AUJ D;  3A55 A;  2DNC A;  1X3Q A;  3D4W A;  1BDO A;  4XTC S;  3S17 B;  2F4I A;  3NSW A;  1GHJ A;  5G3L D;  1MI2 A;  1A2U A;  3I4L A;  1H9M A;  2AQ3 B;  4RCN A;  4A3D B;  4RGN A;  4E6I A;  1SNO A;  1CA6 A;  2EYJ A;  3S14 B;  2NWG A;  4R8N A;  2EE1 A;  3BZD B;  4ZQ3 A;  1WCM B;  2FMC A;  4HMJ A;  3M7G A;  4PMC A;  4HCS A;  3C1E A;  4V0B A;  5ELB A;  2E2H B;  1R9T B;  3E5S A;  4KHV A;  3TZU A;  2JE6 I;  1Q1B A;  3PIP 3;  1KTK A;  1UAP A;  3DUZ A;  3K7A B;  2EY5 A;  2JA7 B;  1SNQ A;  3BVM A;  1QNK A;  4ZLT F;  1G8Z D;  1Q12 A;  4IUR A;  1PTO D;  1EIH A;  2H1E A;  5M3M B;  3QWN A;  2YU9 B;  1TWF B;  3S1M B;  4KN4 C;  2NTT A;  4C3J B;  1IHZ A;  5KYL A;  3S1R B;  1FNW A;  1K83 B;  5JPN C;  2D5D A;  4KY7 A;  4ZUI A;  5C3W A;  1ESF A;  3K58 A;  2CVR A;  1ZYR C;  5IGD A;  2YYZ A;  3T13 A;  3J7Y W;  4BY7 B;  3MAQ A;  3SE0 A;  4P2C B;  3WOE A;  2F0L A;  2XNA C;  4WRD A;  2KEE A;  4RH6 A;  2RKS A;  1G2T A;  2B39 A;  1ML0 D;  1HA5 A;  2B2V C;  2Z4I A;  2EY6 A;  5E1F A;  2RA4 A;  3RUZ A;  3MZ5 A;  1EQT A;  4BWG B;  4OIK A;  4K2K A;  1F2L A;  4A3F B;  3U9O A;  2SEB D;  2MUY A;  5KNC A;  1H9S A;  1TU2 B;  2F0D A;  4KTA A;  1ILQ A;  4BBR B;  3NBH A;  4DK1 A;  4RA8 A;  3CRL C;  2LMC B;  5IT9 E;  4IUU A;  3OIQ A;  2DY8 A;  2F0W A;  4WOR A;  3SK5 A;  1O7Z A;  3QO2 A;  5D3D A;  3GTP B;  1CHP D;  2ZXR A;  4DGZ A;  2M2L A;  4F88 A;  1DOL A;  1Y1W B;  5FO7 B;  1HTP A;  1Y8N B;  1HQM C;  3S16 B;  2WV6 D;  1TS4 A;  3R93 A;  2DN8 A;  3RZO B;  3MHB A;  3GD7 A;  1U4L A;  2A6E C;  1LV9 A;  3BDL A;  1EYA A;  1V8Q A;  3VA7 A;  5CBA E;  5KND A;  3IFD A;  5LHY 1;  5DM7 3;  4TQU S;  4L8J A;  5CV9 A;  1O7Y A;  1G6Z A;  1D6E C;  2B2T A;  5IGG A;  1WTR A;  3T56 B;  2F0J A;  2K6A A;  3Q23 A;  3SVM A;  2CQA A;  4KJO A;  5COR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...