4IZ8A

Crystal structure of staphylococcal nuclease variant delta+phs h8e at cryogenic temperature
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
129
structure length
129
Chain Sequence
LEKEPATLIKAIDGDTVKLMYKGQPMTFRLLLVDTPEFNEKYGPEASAFTKKMVENAKKIEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKGNNTHEQLLRKAEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thermonuclease
publication title Crystal structure of Staphylococcal nuclease variant Delta+PHS H8E at cryogenic temperature
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
total genus 35
structure length 129
sequence length 129
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2013-01-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4iz8A00
2O4XA 5IGGA 1SYCA 4HTHA 5C5MA 2F0GA 1KAAA 1EYCA 2F0SA 2EY2A 4ODGA 5EKKA 1SNMA 3E5SA 4K5VA 2F3WA 5IGDA 1STNA 5IIFA 1JOQA 2PZWA 1NSNS 4LAAA 4WORA 4DU9A 4KTAA 4KD3A 4ZUJA 1JOOA 4YIJA 1U9RA 3TMEA 4NP5A 2EYOA 3BDLA 3SK5A 3MEHA 4EQNA 5NUCA 1ENCA 5E3FA 3SR1A 3TP7A 5KRUA 4PNYA 2PW7A 4KHVA 2NUCA 4DF7A 1EZ8A 2EYPA 2EXZA 2F0TA 3EJIA 1A3TA 2PZTA 4K2LA 4K8JA 4KY7A 4ID6A 5HURA 3S9WA 5KIXA 1STGA 1AEXA 2F3VA 4K8IA 2HQEA 4DFAA 4KV6A 4MIUA 1EY4A 5M9OA 4TRDA 4G57A 3SHLA 5DAUA 1ENAA 3SK6A 3OWFA 3TP6A 1EY8A 1KDCA 2RBMA 4WRDA 2F0HA 3BDCA 2LKVA 3NHHA 3MHBA 1JOKA 1SYBA 3ITPA 1F2ZA 1TQOA 3SK4A 5C6AA 5CC4A 2F0MA 5IGFA 4B9XA 1SNCA 1SYDA 2F0EA 5I9PA 2PYKA 2F0JA 1EYDA 1SNQA 1STHA 4EQPA 4HMJA 3P1HA 1EY5A 2PW5A 1EY9A 2RDFA 2F0UA 5C5LA 3DMUA 3PMFA 5CGKA 1A3UA 2ENBA 3EROA 5CR3A 2WACA 4I65A 2F0WA 1EQVA 4K6DA 2EY6A 3RUZA 4N9PA 1SNPA 3U9OA 5C4ZA 3OMGA 5IODA 5EGTA 4S3SA 2EYHA 2SOBA 2M00A 4KY5A 3NQTA 2RKSA 4EVOA 2F0OA 4IUNA 1II3A 4F8MA 1KDAA 2F0DA 3DHQA 3NUCA 3TP5A 1A2TA 2OXPA 3QOLA 2OEOA 1SNOA 2EY5A 2F0VA 1EY7A 2EYLA 5J1ZA 4EQOA 4HMIA 1TR5A 3OMCA 5IGBA 2F0IA 4NDXA 1EY0A 1KABA 3ERQA 3LX0A 1EY6A 1A3VA 3SXHA 1TT2A 4K14A 5J39A 3R3OA 4RKLA 4DGZA 5C4HA 5I6YA 3NXWA 2PZUA 5I6WA 3MXPA 5IOCA 4K5XA 3HZXA 1JORA 2QDBA 4PMBA 5JAVA 5JOBA 5KGUA 5IGCA 5J22A 2EYFA 2OF1A 3D8GA 4QB4A 5EKLA 5CV5A 2PQEA 3MZ5A 4B9WA 1F2MA 1STAA 5CV7A 5C3XA 3MVVA 3C1FA 3T13A 5K5PA 5ISRA 3QOJA 5CV6A 3D6CA 2SNMA 4H7BA 4F7XA 1KDBA 4QMGA 5KYIA 4NKLA 3VA5A 2EYMA 5HGTA 5F2DA 1STYA 1SNDA 1STBA 4IALA 3SK8A 1EZ6A 2EY1A 3HEJA 5CV9A 5C3WA 4K5WA 1RKNA 4J1MA 5DEHA 5KEEA 4J6HA 4QF4A 5CV8A 2EYJA 4ZQ3A 4KY6A 2F0PA 3EVQA 2SNSA 3D4DA 3H6MA 2F0FA 5CV4A 4ZUIA 1A2UA 1SYFA 3TP8A 3V2TA 4E6IA 3C1EA 1EYAA 2F0QA 3OSOA 1IHZA 2F0LA 3NK9A 1F2YA 3P75A 2KHSA 3NP8A 4KD4A 1SYEA 2F0NA 4R8NA 5IGEA 1NUCA 5E1FA 3T16A 2F0KA 4K2KA 3D4WA 3QB3A 4IZ8A 4OL7A 5KYLA 5I9OA 4KJNA 4N9TA 4KJOA 4RKBA 2KQ3A 4NMZA 4PMCA 1SYGA 4ME5A
chains in the Genus database with same CATH superfamily
1AP0A 4JI7Q 2F0GA 2FMMA 4A3KB 1TWAH 1I3QB 2F3WA 2MFIA 3L7ZC 1JQYD 2KVMA 1VQ8A 4DV5Q 1U9RA 1D5XC 1DOLA 4A3JH 5C44G 3AQQA 1UE7A 4PNYA 2HCCA 4K2LA 3FP9A 3NQIA 2VUMH 4NPSA 1AEXA 3GTPB 1QCBD 2L12A 3CCQA 3RZDH 2NBFA 1KHIA 1RJTA 1X3QA 2LXJA 4A3IG 2F0HA 2X6GA 2LKVA 5IGFA 1QWYA 1D5MC 2B63G 2R7ZG 1WTPA 1EOTA 3K0YA 3MA2B 5IYCG 2YYZA 2BOSA 1XYIA 3X3MA 1L0WA 2NN6H 3M7GA 4HEDA 3BS1A 2I5HA 1HNXQ 1X56A 1JR0D 3NQTA 2Z8LA 2B2YC 3NSWA 3GTLB 1LYLA 1C4QA 1HQMC 2F4VQ 3S1QB 1HZCA 4CJ1B 1SNOA 4BBSH 5JEAH 3K7AH 1I4HA 1IL2A 1HZAA 2JYOA 2F0IA 2ID0A 4A3EB 3ERQA 3EA6A 5IP9G 4DGZA 1JB3A 5JPNC 3C3LA 3ERSX 5LHY1 5M5YB 4K5XA 3SDZA 1B2TA 1E1TA 1ML0D 5A35A 3TS2A 3MZ5A 2L15A 5HY6A 4CHTB 2K5QA 5D3IB 3JAMc 3I2ZA 4IURA 1QNKA 2E2HB 1K8OA 1GOZA 3D6CA 1VQ6A 4DV1L 1V1QA 3KF8B 2NVXB 4A3MB 5A2QL 2B2TC 1G91A 5A2QE 2AHOB 3A0JA 4XT1B 2NN6I 2R7FA 3GTGH 4OO1G 3M3YB 2K5DA 4WJWA 3K5MA 1JE5A 4LF7L 3CHBD 2K14A 3K8AA 4B3TL 1GUGA 3KUPA 2H4OA 2PPBC 4TQUS 4C56C 2RA4A 2VY3A 1NMFA 3QB3A 4XQQA 1CA5A 4X3SA 1X3FA 5LMUL 2HIVA 1G2TA 1W2BA 2ICIA 1YNNC 3BJUA 3PUZA 3I4MH 1LACA 2A8VA 4A3EG 4DR5Q 4O42A 2DGYA 5C4JB 1JT8A 3TMEA 4X65L 4LWCA 4YIJA 1PH1A 1E2WA 5IYDH 4NXMQ 1TS2A 3AFPA 5NUCA 1EQRA 2NUCA 3BG3A 4POGA 1LTAD 1FR3A 3PSIA 4TRDA 1DZ1A 4BY7H 1G6ZA 1VF5C 4CKEA 2NVQB 3OWFA 2UUCL 1AH9A 1GO3E 1E7ZA 5BN4A 1Z7TA 3ITPA 5FJ8G 4HJAA 1PRTF 4RGTA 4DXGA 4B9XA 4A3MG 2E5LL 3S2HH 1N32L 5I9PA 5E4WC 2B2WC 2Q2UA 2PW5A 1SFOB 3M4PA 4DR6L 4MZ9A 3WOFA 4I65A 5JJKA 2BH8A 2F0WA 1AW7A 1WJJA 2K6AA 4XTCS 3GO5A 4N9PA 4IQZA 1VQCA 2N49A 4S3SA 3ND9A 3RLFA 1JICA 5C4XG 5M3MG 2F0OA 1XMQL 3S17B 1RL2A 2MNAA 1A2TA 4HN7A 3WDNA 2F0VA 1EY7A 1A62A 4Y7NB 1N8RC 2Z0SA 1I50H 1EY0A 3BDOA 2QKIC 4Z9CB 1FNWA 4HAEA 5TSSA 1OTCA 3UI2A 1S5CD 4IFDJ 1AE2A 3K59A 1CKNB 5EKIA 1L0YB 2HQLA 5CV7A 1B7YB 5K5PA 3CQZH 3HOVB 1J5EL 3H3VC 1YIJA 1S5DD 3SK8A 4OEMB 1B44D 4NXNQ 1MD2D 4K5WA 1RKNA 4DXFA 4MHEA 2JA6H 1J8IA 4B3RQ 1LTBD 2LY7A 2B2TA 4LFBL 2PMZE 2VL6A 1SYEA 4R8NA 1WCMH 3NELA 2I5LX 4IUQA 2IX1A 1D1KA 4IZ8A 4RHRA 3A55A 1F9QA 2B2UC 3AFQA 3KBXA 3TREA 1RTOA 5EBCA 3VYSA 1K8GA 1PFSA 2L4NA 2Z4IA 1PV4A 1LTRD 4A3FB 1XMOQ 3HS0C 4G7ZC 1GJXA 4OWXB 2JN4A 4EGVA 1VQ4A 3MC0B 3IRBA 2LXKA 1K9MC 4UAIA 4ID6A 1PYBA 1PRTD 1A63A 1P16A 3BVGA 4DFAA 4DV2Q 1JB7A 5M9OA 3BZDB 4DK1A 3HOVG 4UP9A 3OPOA 5C0XJ 1Q1EA 2C35B 1F2ZA 1DXMA 2BE5D 3LNNA 1HA5A 4RGOS 4ALPA 3E9HA 3DWAA 5ELOA 3LWUA 1CQVA 1GXDC 3GQBA 5D65A 4DN4M 5BN3A 1SN8A 2JA7H 3QWNA 4QCLA 1HFGA 2F0UA 3DMUA 1WYDA 2SDFA 1PH6A 5CR3A 1BR9A 2B2WA 1KLGD 3S1MB 1IXRA 1UAPA 3BZKA 3E0JA 4IUNA 2A69C 1KDAA 2B3GA 1LABA 3U4ZA 3GTKH 5ELNA 1X55A 3KBGA 3PQIA 2EDGA 4BA2I 4XYQA 4AQYQ 4OIKA 3R3OA 1PHJA 1PFMA 5E7NA 1FJGL 4DV7Q 1FGBD 4JBJA 2E8GA 1HUMA 5ELCA 2KCNA 4JI8Q 5ISRA 4BA1I 1B70B 2MO1A 2SNMA 5EQ0A 3I56A 4F7XA 1S40A 1STYA 2QW7A 1EZ6A 1TWFB 3KFUA 5CV9A 1I4RA 3FPUB 1FD7D 1I4PA 4J1MA 2RHQB 3J7AF 5GROA 1VDZA 3KF6A 4LW1A 2I0QA 4IFDG 3C1EA 1EYAA 2BDNA 2K03A 5EPKA 3T1HL 1G291 2AUKA 2F0NA 3H0GH 1PTOB 3T16A 4GOPB 3D4WA 5JJZA 4XXEA 1TWHB 4P71A 2OWOA 4C2MH 4TKOB 4HTHA 4AIMA 5M5WB 1PFBA 4DR2Q 3A54A 1LT4D 2B2UA 3S2DH 2R93H 1LV9A 2PZWA 4GLVB 1HNZL 4WORA 1QVGA 1NR4A 4F87A 2X6LA 1B53A 2EOTA 4BY1H 3HOYG 4OELB 1HTLD 2E76C 5CBEE 5IYBG 4FXGC 3PUVA 1L1OC 3S9WA 3E0EA 5HURA 4R4CA 1NTGA 1QJOA 3GTJB 4KV6A 2V4DA 2K28A 2XIWA 1UEBA 3S15H 1KRTA 4LUZA 1SNCA 2PYKA 2ZM6Q 1FNVA 4EX5A 4HJ9A 3PO2H 1PZKD 2UU9Q 4LF4L 1YITA 4X3TA 5IP7G 4LFCQ 3RNUA 5C0XG 4DR4Q 4JBWA 3BVZA 1S5ED 2JA5H 2XNAC 5K36H 3I70A 2Y0SB 4F88A 4A3DH 1GUOA 3RR5A 2UXDL 5BN5A 3I4NB 1NE3A 1K83B 2Q8RE 4NDXA 2YV5A 1TS4A 1IKMA 3W1BA 5COYA 3M4OB 4BBRG 3U50C 2UUAL 1XTCD 2Z1CA 1STAA 1CZWA 3UE1A 1TKWB 3C1FA 1PZID 5FLXL 3NE5B 4XQJA 3ER0A 4DAYA 2I46A 5FLXE 5LMNQ 3D6WA 3OIQA 4UPAA 4C3IH 2AQ2B 2PQAA 2J7ZA 5C3WA 2Q8IB 3NEMA 2PI2A 4JI2L 3E3XA 3H6MA 2F0FA 1NAPA 4JI6Q 5M3FG 2KHJA 2HDLA 2KHSA 2XWJB 2DY8A 1ZXTA 4NW2A 3Q23A 2NVTB 3T53B 4GS3A 3DEOA 2E2JH 4OX9L 3DM1A 2ZTDA 2CH4A 1T5EA 1BF4A 1SYGA 3IL8A 2ASBA 4X64Q 2PI2E 4MTNA 3J81j 1HNWQ 1V1PA 3TZUA 3F2CA 2JE6I 3TDQA 2PCFB 3CCEA 4JYAL 4KLKA 4ZUJA 3CAMA 1JOOA 3STBD 2LFNA 4LNQA 3BVMA 1Q8IA 2CW0C 5E3FA 4OIJA 4YY3Q 2MP1A 3EJIA 3KDFA 1XNRL 1X32A 2PZTA 4DV6L 4L8JA 4UY8C 4MNOA 1HH2P 1VQIA 3HOWH 2D62A 1ZYRC 2VQFQ 4P72A 4C3HB 1G2SA 1E2ZA 3DXJC 2NVYB 3IFTA 4ZKCB 3MHBA 2B8FA 1TQOA 3AU7A 1E2VA 2NZ1D 3G48A 2WKCA 1U0LA 1VS0A 4JOIC 1X3GA 4KHPL 2A6HD 3Q24A 2CQOA 1A3UA 2EQSA 2PO4A 4JI0L 1MHWC 2EY6A 2EJGC 3VR2A 1M8AA 3K5OA 5IODA 4ME3A 1S5FD 2A6EC 1SDFA 1RD9D 4H44C 4O0AA 3HOXB 4HCSA 4C1NI 2YTVA 1II3A 1NY4A 4LF9L 1Q12A 4L5QA 1BNZA 5LMNW 1NJIC 4K14A 1VQDA 2A73B 3GTQH 2PZUA 1K3BC 1TS3A 2IWHA 1OXVA 5JEAJ 2F4IA 2F4VL 3HRZC 1Y8OB 1CQFA 3F2BA 1IW7D 2B8GA 4RAUC 2WAQB 2VQEQ 1EIFA 3NTHA 1PYSB 5C3EG 4C3HG 1RCVD 1JWUD 3VA5A 2UXBL 1TS5A 4FXDA 3Q6SA 1SJED 3GV3A 1LT5D 2R7DA 2YU9B 1VQGA 1H9MA 2QGQA 2UUBL 2B29A 4KY6A 4ZUIA 3TP8A 3PF5A 1KTKA 4JI4L 4IN3A 1YBYA 2KOLA 4A3CG 1JJGA 4A93H 2EJFC 1VF7A 3K6OA 5FO8B 1BBWA 2G9DA 3HOZH 2GN5A 1SLJA 3MWYW 1LLRD 4RKBA 3RN5A 3RLOA 2FINB 5IY0A 1E24A 1U5KA 1KL9A 3KOJA 2R92H 3T56B 4QGUA 4YHHQ 1STNA 5IIFA 2B63B 3F2UA 1CUKA 2N8NA 4KTAA 1JCKB 1YEZA 3MEHA 2MHVA 3SR1A 1Y1VH 4PZ7A 1EZ8A 3A74A 2F0TA 2AWNA 3FKIG 1N33Q 1IL8A 1CFMA 3L0OA 1OXSC 4YCUA 3A5UA 2FHTA 4DR5L 1YNJC 2Z6KC 3NENA 4JK1C 1DCZA 3HOUG 4DUYL 3VDYA 1E1OA 4IPDA 1TY2A 2DNEA 4BBSB 4ZKBB 1EYDA 4HMJA 1HRJA 4FNFA 4GN4B 4ZK9B 5CGKA 4JOIA 3FRPB 2ZJRA 1MJEA 1CT1D 4A3JG 4C3JH 1PH7A 3D0FA 4R4QA 2RKSA 3J7ZC 1PRTB 2PMZB 2ZJPA 2VUMG 1D5ZC 4CDEC 1ESFA 2K4KA 4GNXB 1Q3LA 4IO9A 2IL8A 4JBKA 3KK7A 3PUYA 1IBKL 2RVLA 1XWEA 1ONLA 1X54A 1I5FA 1KABA 3SXHA 1N36Q 2OTLA 2UXCL 4ABNA 1NR2A 1L2FA 1WFQA 4OHJA 4DR3Q 1EOVA 5JOBA 2C9OA 3GTGB 5EKLA 3A8JE 5M5XH 4LJZC 2NN6G 2RDGA 1Y1WH 4IPCA 5FK9C 4H7BA 4DKAC 2R7ZH 1E0BA 3I4OA 4IALA 1GUSA 4BBSG 4DAMA 4J6HA 5JEAG 5FLMH 4G7OC 1R4PB 2IY5B 3EVQA 4L6TB 1WTWA 1TWCH 1BCPC 2QCPX 2F52A 1N34Q 4J15A 3QG1A 2SEBD 3NTIA 1NUCA 5E1FA 1EIHA 1ET9A 5AJ3L 1VQNA 4JI1Q 2KQ3A 4A3KH 2A6ED 4R4IA 2O4XA 1I3QH 1VQKA 3G6JB 2ALYB 3I3CA 2GA4B 4FYDA 1C7YA 1YZ6A 4X62Q 3NBHB 1KXLA 1XTDA 2BCOA 4CGYB 4EQNA 1QUQA 2ZXRA 1ENCA 1XNQL 1O7ZA 3GTPH 3L2PA 1YJWA 3CRKC 2MO0A 1B3QA 2J0TD 1VQLA 2F3VA 2JP1A 2HQEA 2KEDA 3S24A 5M3MB 5C4XB 3PIO3 4DAVA 4GKKQ 1SYBA 2Z6KA 1ENFA 1H9SA 1KLUD 2A19A 1IBLL 2KBNA 2F0JA 1GM5A 3I4MG 1X3EA 3ULJA 3G6EA 2H5XA 5J3BA 4OGQC 5FO9B 1IBMQ 5IYDG 3H15A 1CSPA 1AFPA 2E2IB 3J7AV 1X6OA 2EYHA 5IWAQ 1TIID 4KK7A 1T5XD 2WKDA 4F8MA 1UE5A 5GAHC 4BY7G 4JG2A 1Q1BA 3S14B 3J80E 3TZDA 4KN7C 1BOSA 5M5YH 4JI3Q 4OWTB 1I94Q 1HTPA 1HUNA 4HR7B 2JA6B 3HZXA 4JV5L 1UNSA 1JC7A 1DONA 4AH6A 1WTQA 1G8ZD 2JSOA 5I4DA 3OTOL 1F2MA 4HJ7A 3U9SA 2EZVA 3L3OC 1WCMB 4LF5L 2E2DC 2L55A 3TS0A 1LTSD 1YNJD 4RMFA 1LTID 4DV3L 2B2YA 3NWTA 3S16B 1OXTA 3R2IA 1K0SA 4GLXA 3M3YH 1EL0A 2F0PA 4DK0A 1ET6A 1E22A 1VCIA 2IJ0A 3P75A 1Y69U 3W1GA 3M85A 1XXGA 4LK1C 3ND8A 3CCSA 1CA6A 4RCNA 1WD1A 2EY2A 1CTMA 5C4JH 1XPUA 2EPBA 3H3VH 2R61A 1N9WA 3KLWA 4FXKC 4CJ2C 5JJLA 2JA6G 1CK1A 1SE3A 5LL6S 3PCOB 1E3PA 3D31A 1SBBB 1WCMG 1QVCA 2NTSA 3SK6A 5ELFA 4POFA 4CKBA 1KIXA 1OXUA 4DPGA 3SK4A 3GTMB 1SYDA 1SFOH 1PA6A 4EQPA 1ASZA 3PF4A 2RCFA 4K0KL 2K5NA 2WACA 1UE6A 1EU4A 4HCEA 3P7JA 2ZXOA 5IT9c 3J81L 5C4ZA 1MSGA 3J81E 4IPGA 2LS01 1O78A 3S17H 1FGUA 4JVZA 4DV0L 2WIIB 1XJVA 2N55A 3M7NA 4QJFA 4RGNA 4Y7NH 3H3VI 4IJHA 4B3TQ 2OEOA 3CCMA 4AYBE 3I8ZA 4HMIA 1Q46A 3H91A 2IT1A 3TEHB 4DNIA 5LMUQ 1HR0L 1CZGA 3MXPA 3S1RH 2JA7G 5JAVA 2I5MX 3W3AA 2OF1A 1XPOA 1BXTA 2D2CC 2M9VA 4X65Q 4RA8A 3T1YL 3R93A 1ZEQX 1JMCA 2VW9A 5HGTA 2VS1A 1GHJA 3KF8A 4GKJL 1K28A 2V1CC 3FHWA 1YNND 3EN2A 1HJPA 3D3RA 2UUCQ 1PH9A 4G4KA 4CBVA 2F0QA 2G5DA 3I4LA 1N32Q 3HOYB 3NK9A 1MSHA 4B3SL 3CW2C 3KDFB 1I4GA 4H13C 2L11A 1BKBA 4DR6Q 3VYUA 3DWQA 1AZPA 3KYHC 1C9OA 1IKLA 3CXCA 1C8CA 3WWVA 1EYCA 2F0SA 1CHQD 4A3FH 4FF4A 3MXNA 3DEPA 4CDCC 4B08A 4YWKA 1XMQQ 2ATWA 3S15B 1NSNS 4DUZL 1A6XA 1S3OA 3IAYA 2P5ZX 3BZCA 4KY7A 4IUPA 1S4ZA 3ICEA 3H0GG 4IOAA 4A3BH 1D6EC 1SSOA 1EY4A 1CSQA 4P2CB 3QR8A 1QZHA 3URYA 3NHHA 5KRUA 1TWGB 4A3DB 1YJNA 1Y8NB 3PIOA 4DV4L 5D3DA 2R93G 3J7A5 1J5EQ 5BR8L 2Z4HA 4HJ8A 3GDEA 2WFWA 4BY1G 1EEID 1S72A 4BBRB 3CRLC 5HGQA 5EGTA 1WOCA 1HA6A 2M00A 3OIPA 1SJHD 2CCZA 1EIYB 3NWSA 4LFBQ 4N8X1 2B2VC 2YTXA 1WTRA 3K5NA 3K58A 1B4OA 4C3IB 1O7YA 2IW3A 3PIP3 1Y8PB 1I6HB 1H9JA 4BXXH 4LF6L 3PO2G 4R9WA 2D9UA 4HJ5A 4PMBA 2D0PA 5M3FB 4ZLTF 2EYFA 1QB5D 3LWEA 2K5VA 1CKNA 2XTIA 1Q7YC 3PGZA 4B9WA 2DUDA 1CKOA 1OO9B 4A3LG 1QE6A 2JA8H 2RCNA 2Q2HA 1EU3A 1HPCA 2JA5G 5K36G 4A3DG 1JJCB 3DLLA 1WD0A 3HEJA 2FMCA 2X69A 1DGSA 4X66L 2ZTCA 2LMCB 3VA7A 4LFAL 5CV8A 5G3LF 3UDXA 2HT1A 1H9RA 1A2UA 1VQAA 1CKMA 1PTOC 3V2TA 1LT3D 5IP7H 4GOPC 2K75A 4O1NA 1PTOH 1JWMD 4KD4A 3WOEA 1X3PA 5ELBA 1TWHH 1HQRD 3CCRA 4MTKA 2HDMA 4OL7A 5M5WH 4NB3A 4NMZA 2EE1A 1WTXA 2CVRA 5ELEA 3CCVA 2F3IA 1KAAA 2VNUD 1MIUA 1EFID 4C3IG 1PYWD 2L0CA 1WTVA 4U68A 2HHHL 2KECA 1NMGA 3TN2A 5FOBB 4B3ML 4G7HC 1SRUA 2R6GA 3CC2A 2K01A 1B9MA 2XSCA 3O13A 3JAML 3CF5A 3TP7A 4U673 1VQJA 2PW7A 4KHVA 2EYPA 4QIWE 3JAME 3GTJH 4HIDA 2O5IC 1Z9FA 1R9TB 2K1BA 4ZAIA 1FJGQ 1LTGD 4JBMA 1EYGA 1RHPA 2AQ3B 4HIKA 2AQ1B 3RZOB 3A7AB 3CPWA 3HKZG 5CC4A 2A69D 3PO3H 1F9PA 2JEAI 3GTOB 1NCVA 1PH4A 1QG7A 2QDLA 4DR7L 2OQKA 1EUJA 3GTQB 3OOCA 1KAWA 1D1IA 3EQLC 4JI7L 3U9OA 1G51A 3G7LA 1TY0A 1M1KC 1YVCA 1K3RA 4ZRZA 2XGTA 3I91A 3HOWG 3T1HQ 1L1OA 1VMCA 2CHBD 5C3EB 2F0DA 3NUCA 2KEEA 2KUMA 4DV5L 3I4NH 2XWBB 2WV6D 1PVOA 4EQOA 3DM3A 2B2VA 3J81i 3M4OH 5EPLA 5C4HA 5I6YA 2EIFA 2MGSA 3CC4A 4JW0A 2JA9A 3AEVA 4KMUC 4A93B 1V9PA 1HNZQ 2DN8A 2WB1E 3M4YA 3W5OA 3I72A 3H94A 1VQ5A 3J81c 4XDXA 5G3LD 4DR3L 2MQHA 1KD1C 2EY1A 2BDOA 2R92B 4QF4A 2NWGA 4J8QA 4UHVA 3TRZA 5GAEC 1HNXL 5CV4A 1SYFA 2NVTH 3A56A 1BQQT 4RFBA 1P8LA 1U4LA 1F2YA 4JI5Q 2F0KA 3FKIB 4OONA 4ZYSA 5I9OA 4KJNA 4LF4Q 1DD2A 4G57A 1WVLA 3F8TA 1BVSA 1QNUA 2CQAA 5DM73 4A3GH 3HOUB 4RGMA 3EBEA 3E5SA 1Q86C 3V96A 1TWAB 4CDFC 2BA0A 2UXDQ 2K7VA 2KA7A 2JJQA 3BDLA 4JI1L 3SE0A 5GAGC 4WFN3 4A93G 2DJFC 2EXZA 1FL0A 3CP0A 3CKIB 4A3JB 4C3HH 2F1MA 5KIXA 4MIUA 3T4AC 3E6ZX 3HOZG 2NTTA 3SVMA 2VUMB 4OWWB 2UUAQ 4CJ0B 2ES2A 3RZDB 3BDCA 1JOKA 3ULPA 2F0MA 2R92G 1D7QA 2DJGC 1ASYA 1J6QA 1KRSA 1STHA 3FDTA 3P1HA 1D8LA 2IPKD 3EROA 1SE2A 3PUXA 1BUVT 4K6DA 5CYUA 1PTOD 1Y1VG 1FVIA 1SNPA 3RUZA 3HOXH 4JI2Q 4QY7A 3EIVA 5AFWA 3HGBA 2K04A 1IYUA 1W6JA 2O2LD 3NBIA 3HKZE 1Y1WB 1PH3A 1I4QA 2EY5A 1UE1A 4NXML 4OX9Q 3DWPA 1AN8A 4PV1C 5JPMC 1EY6A 1UWVA 3K7AB 3PIPA 3F2DA 1X9NA 5IOCA 2E74C 1KC8C 1JORA 3SGIA 4IUUA 3HFZB 1KNAA 4A76A 5IGCA 2XRSD 2Y0SE 4JYAQ 5I2XA 4C1NK 3R2TA 4QUFA 3BYYB 4GLAC 4QMGA 1XNRQ 2YU9H 2GVAA 4DV6Q 1AZQA 4FVMA 1F77A 1GUTA 4MN3A 1SE4A 3D4DA 1DOKA 5C44H 5JVH3 4H02A 4UP7A 1B3AA 5E4XA 2JK8A 3UE0A 4DR1Q 1O80A 4LUVA 4KHPQ 2CW0D 2CWAA 4K2KA 4DA2A 5L37A 1A8VA 1B8AA 4YWLA 1Y1WG 3MFGA 4A3IH 1K73C 4JI0Q 3S1NH 5IGGA 3ULLA 2B63H 3TQYA 1ZYRD 4ODGA 4K5VA 5IYCH 1VMPA 4LAAA 5FLMG 3I4MB 4AYBB 2JEBI 3A8KE 1ZKOA 3M9BA 4LF9Q 4WJ3M 2AWOA 4FO2A 4V0BA 2R3ZA 2YTYA 4K8JA 1A3TA 3CD6A 4K8IA 4NXNL 1SMXA 1G6PA 1RF2D 2JXMB 4P73A 3SHLA 2FXQA 4A3KG 2OCEA 4WRDA 4B3RL 3Q22A 1M90C 4BY7B 5FLXc 1FYCA 1PDQA 2ZTEA 4RHSA 3JAMi 3CU7A 5IP9H 1SNQA 3PUWA 3S2HB 4KHZA 3X3NA 2UXBQ 3T51B 1EY9A 3V05A 4LF8Q 2Q8TA 1PRTC 4BWGB 3IFDA 1PLFA 1PH8A 2UUBQ 4GNXC 1DJRD 1VQMA 2EJMA 4JI4Q 2RSOA 4ULLA 3HP3A 1PMRA 3MEFA 1FNUA 2BE5C 1XMOL 1SROA 4RCOA 5ELDA 4M8AA 3DHQA 2Z6BA 2VXWA 4Y52H 2LSSA 2CH4W 3CMEA 2L1BA 2EYLA 5J1ZA 1RTNA 1TR5A 4P74A 3OMCA 1TU2B 3N6RA 4AYBG 5IE8A 4RKLA 4OO1H 1I50B 5I6WA 3G71A 4A75A 4K6LA 4DV2L 2QDBA 1XPRA 1WI5A 5EPJA 1GD7A 4IOCA 1YHQA 2BA1A 4GZYC 5DM63 3GTLH 1VQEA 3KLSX 4P75A 5C3XA 3T13A 2NZOA 3CCUA 5GQOA 3S1QH 1H95A 5CV6A 1KQSA 1HZ9A 2A68C 1A15A 2IHEA 3J80L 3OHXC 1BCPF 1PZJD 1A0IA 1S5BD 3CQZB 3MXNB 5D14A 4A3EH 1CI3M 5DEHA 2KENA 2EVBA 4PQXA 5EJWA 2SNSA 4DUYQ 3KF6B 3FMCA 2WAQE 4E6IA 5CMDA 4DK6C 2F0LA 5CBAE 1LUZA 3VYTA 3ZYYX 2E2HH 3GV6A 4N9TA 2M2LA 4KJOA 4AQYL 5FJ8H 2Z9HA 3VR4A 2NVXH 4A3MH 4DV7L 3HG9A 5EKKA 1SNMA 1K8AC 2K5HA 5IGDA 4HIMA 4OO1I 1EEFD 2AKWB 3SK5A 4JI8L 5CORA 5KNBA 2B39A 4RWSC 1MI2A 4R1JA 1IBKQ 3VR3A 1YJ9A 3CCJA 4DNRB 3C2PA 2UXCQ 5C4XH 5M3MH 4KKSA 1ILPA 3PV0A 2KJXA 3RD4A 1BO0A 3QIAA 2FJ2A 5DAUA 3U58A 1M4VA 3K7UC 1YNXA 1KDCA 3A7LA 3SEBA 1ILQA 2BH2A 1O7IA 1EQQA 3JC66 1LM0A 2F03A 4CKCA 2E2IH 1JE4A 4QQBX 2OT2A 2JA7B 3S1RB 2DY7A 2RDHA 3GP7A 3HOUH 4DR2L 4PMWA 2QEJC 3UDGA 1HFNA 1BBXC 2NVQH 4EVOA 3MAQA 1EIGA 3S14H 4GNXA 4TVAB 1VQ7A 3QOLA 1GKHA 1WTHA 1GVPA 1YHAA 2NB0A 3F1ZA 1STEA 3NTKA 1Q8KA 5IGBA 5AJ3Q 3GTKB 1TXYA 5J39A 4DV1Q 4FF1A 2RQXA 3VR6A 5JVG3 2HD3A 2ZT9C 1BCPD 1IZ6A 2ICEC 4QIWB 2ZM6L 3R8BA 1XNQQ 4DAYB 3S16H 4LF7Q 4R4OA 1STBA 5T1IA 2UU9L 2PQAB 1Q81C 4N8FA 1U4RA 4LFCL 3QJYA 1VQPA 4DR4L 1YI2A 4KKTA 2OTJA 2EXDA 2N88A 1IBLQ 2J4XA 2IHFA 2JQOA 5IGEA 3EFXD 3BYTB 4QUCA 3HOVH 3KLRA 1QILA 3H0GB 4PMCA 5DLQE 3PMFA 4CDDC 3G4SA 4A3BB 1SYCA 5C5MA 1GUWA 5H1SE 2K52A 4C2MB 1V1PB 4IUTA 2K33A 4IPHA 1I6VC 3RN2A 4DU9A 1HCZA 3S2DB 2R93B 3NBHA 4EQ5A 3OW2A 2EYOA 3MXGA 1KNEA 2E5LQ 4BY1B 5LMNL 1X65A 1STGA 2G9HD 4JV5Q 1VQ9A 1L1OB 2WB1B 5I2YA 1EY8A 2RBMA 3OTOQ 4UP8A 3GTMH 4JI6L 1L0XB 4FF3A 3VR5A 5C6AA 3K57A 2A68D 3STBC 4A3FG 3B6YA 4LF5Q 1NNXA 4JPBW 3ONAB 1EY5A 3AB9A 2RDFA 4IUVA 4A4IA 4DV3Q 3PO2B 1EFWA 3NPPA 1I4XA 4UDUC 1B50A 4X64L 1HNWL 2SOBA 4KY5A 4ILWA 1MGSA 5FKAC 4KI0A 4A3BG 1Z6HA 3CCLA 2JA8B 2H1EA 1MJCA 1V43A 5FO7B 3TP5A 1C0AA 1B1ZA 2JA5B 2A6HC 2WINB 4YY3L 3W2DA 2VB3X 4M1UB 4IFDH 1TT2A 1SE8A 2MPMA 1F9SA 1LO5D 1Y14B 4YCVA 1WTOA 2VQFL 1EWHA 4L5SA 3I90A 3S1MH 1GUNA 2ZXPA 3D8GA 4QB4A 3N52A 1SAPA 3TSSA 2K5WA 3OWEB 1U4MA 2WB1G 4Q0FA 3AMUA 4PZ6A 1KDBA 1AE3A 4YWMA 4NKLA 2EYMA 4FDBA 3VYRA 1SNDA 1D2BA 3P20A 1SMYC 3MTSA 1IYVA 3QO2A 2K32A 2HIXA 3M4QA 4ZQ3A 3HOYH 1IW7C 4BXXG 1VQFA 5IYBH 2QA4A 1K8MA 1IHZA 1PXUA 3OSOA 1DOMA 3KJOA 3J80i 1NBWA 3RMHA 3D4RA 4K0KQ 2O5JC 2L5TA 4L5TA 2JA8G 3NP8A 2E2JB 4ME5A 3FEWX 3IKJA 3E9IA 1Z47A 1TWFH 5JJIA 4IFDI 3HKZB 4DV0Q 3L9AX 4JI5L 2A5HA 3J80c 3PO3B 2IX3A 1HHVA 1MKHA 2VQEL 4NP5A 2NYZD 5EBDA 1V8QA 2A1AA 4X3UA 4DF7A 4A3LH 1HR0Q 2N3SA 5C0XH 1DYQA 1VQBA 2MUYA 2GVBA 1TWGH 2L9HA 3DUZA 3TP6A 3HOWB 3FVQA 4RH6A 1PH5A 2QF7A 1VQOA 1ESRA 3T1YQ 4FF2A 4JCVE 4BBRH 1W6KA 5C5LA 1JWSD 1BDOA 4GKJQ 3Q0AA 1BBUA 1VQHA 1EQVA 1F2LA 4KN4C 2KCMA 5DNFA 2VB2X 1EWCA 4YHHL 2NZHA 2XVSA 2HUGA 4XYOA 1XX8A 3BU2A 4B3SQ 3HKSA 1I6HH 2K50A 3AYHB 4DK3C 1TVXA 1V1OA 3PO3G 2KHIA 3C46A 1N33L 1A3VA 3KJPA 2QILA 2DNCA 5M3FH 3NXWA 1C48A 5C0XI 3OYYA 5KGUA 1B9NA 5CV5A 5LL6X 2MJ8A 3MVVA 4DUZQ 3TBIB 1H9KA 2RHSB 2Y0SG 3QOJA 3K80C 4I7AA 2RF4A 2K05A 3H09A 1PTOF 4L5RC 5F2DA 2RSNA 3I4NG 1K83H 1T9HA 4A3GB 2CKZB 3A5ZB 4Q5VA 1R4QB 4R4TA 2PNHA 1LT6D 1F9RA 4DV4Q 3Q8DA 4I7ZC 4PZ8A 1PH2A 4LUOA 4QL5A 1OXXK 4APVA 5BR8Q 1HR0W 4GN3B 5KYLA 4O2DA 1EQTA 2HCIA 4JC0A 4V190 3I55A 1N36L 3HOZB 4X6AH 4TSSA 5KNDA 4ZCKA 4GN5A 4KKUA 4DR1L 1SR3A 3A8IE 3I7FA 1JOQA 4FP5D 4KD3A 2TSSA 1SEBD 1YHBA 2OQ0A 1MBYA 1RDPD 2FFKB 4HSPA 1QUQB 1R9TH 1LTTD 3CC7A 1RODA 2AUJD 1Y1VB 4GOPA 4LF6Q 3MFYA 4R8IA 1QZGA 2ZJQA 3K5LA 3RZOH 2E75C 1ENAA 4OXPA 1W3SA 2CWPA 2I07B 3GTOH 4A3GG 3U4VA 1N34L 2F0EA 1H9SB 3I73A 3KLSA 1CHPD 4XQNA 1SXTA 1SMYD 1CM9A 2D0OA 2ENBA 4XIGS 4LMQD 3UDFA 4WJ4A 4X66Q 1Q82C 4LFAQ 1ICWA 2PNRC 1UEAB 1U4PA 3OMGA 4DAPA 5KNCA 1UUPA 1Q90A 2CFMA 5C3EH 1GHKA 3GD7A 2Q2TA 4C3JB 5T1GA 2NVYH 1HZBA 5EAYA 1RIPA 4X62L 4HIOA 2OXPA 4LF8L 3K81C 3LGJA 1EWIA 3LX0A 2AMCB 4A3CH 4X3KA 2WP8J 2KCTA 2KCCA 5C44B 5J22A 2A74C 2Q2IA 2D5DA 3UDIA 2PQEA 3RLNA 3ZJYC 1K0RA 2HHHQ 4GKKL 1O7LA 4B3MQ 3HOXG 1QOHA 2QEXA 5M5XB 2N78A 2XRQD 4IJLA 3OW7A 4PG3A 5KYIA 3FPPA 4A3IB 1PFNA 4HSVA 3S1NB 4XT3B 3K0XA 2R7ZB 1IBML 2C5CA 5KEEA 4RG1A 3J7YW 4YCWA 2EYJA 5IT9L 3CPFA 1ICFB 5IWAL 5IT9E 2IX0A 1QVFA 5GADC 1JJ2A 2XN9C 4BS9A 3FKIH 1TWCB 1HXYD 2VZAA 2WAQG 1LTLA 4L63B 1BCPB 2TMPA 3MXUA 4C3JG 4DR7Q 3CMAA 4DNTB 1DM0B 1IYJB 1J9OA 4JI3L 4H0LC 1I94L
chains in the Genus database with same CATH topology
1AP0A 2F0GA 2FMMA 4A3KB 1I3QB 2F3WA 3L7ZC 1JQYD 2KVMA 1U9RA 1D5XC 1DOLA 4PNYA 2HCCA 4K2LA 3NQIA 1AEXA 3GTPB 1QCBD 2L12A 2NBFA 1RJTA 1X3QA 2F0HA 2X6GA 2LKVA 5IGFA 1QWYA 1D5MC 1WTPA 1EOTA 3K0YA 3MA2B 2YYZA 2BOSA 1XYIA 3X3MA 2NN6H 3M7GA 4HEDA 3BS1A 1JR0D 3NQTA 2Z8LA 2B2YC 3NSWA 3GTLB 1C4QA 1HQMC 3S1QB 4CJ1B 1SNOA 5JEAH 1I4HA 2JYOA 2F0IA 2ID0A 4A3EB 3ERQA 3EA6A 4DGZA 1JB3A 5JPNC 3C3LA 5LHY1 5M5YB 4K5XA 3SDZA 1B2TA 1ML0D 5A35A 3MZ5A 4CHTB 2K5QA 5D3IB 4IURA 1QNKA 2E2HB 1K8OA 1GOZA 3D6CA 2NVXB 4A3MB 5A2QL 2B2TC 1G91A 5A2QE 4XT1B 2NN6I 4OO1G 3M3YB 2K5DA 4WJWA 3K5MA 3CHBD 1GUGA 3KUPA 2H4OA 2PPBC 4TQUS 4C56C 2RA4A 3QB3A 4XQQA 1CA5A 4X3SA 1G2TA 2ICIA 1YNNC 3PUZA 1LACA 4O42A 5C4JB 3TMEA 4YIJA 1E2WA 1TS2A 5NUCA 2NUCA 3BG3A 1LTAD 1FR3A 4TRDA 1DZ1A 1G6ZA 1VF5C 4CKEA 2NVQB 3OWFA 5BN4A 1Z7TA 3ITPA 1PRTF 4RGTA 4DXGA 4B9XA 5I9PA 5E4WC 2B2WC 2PW5A 1SFOB 3WOFA 4I65A 2F0WA 1AW7A 2K6AA 4XTCS 3GO5A 4N9PA 4IQZA 4S3SA 3ND9A 3RLFA 1JICA 2F0OA 3S17B 1A2TA 4HN7A 3WDNA 2F0VA 1EY7A 4Y7NB 1EY0A 3BDOA 2QKIC 4Z9CB 1FNWA 4HAEA 5TSSA 3UI2A 1S5CD 4IFDJ 3K59A 5EKIA 1L0YB 5CV7A 5K5PA 3HOVB 3H3VC 1S5DD 3SK8A 1B44D 1MD2D 4K5WA 1RKNA 4DXFA 4MHEA 1J8IA 1LTBD 2LY7A 2B2TA 1SYEA 4R8NA 4IUQA 2IX1A 1D1KA 4IZ8A 4RHRA 3A55A 1F9QA 2B2UC 3KBXA 1RTOA 5EBCA 3VYSA 2L4NA 2Z4IA 1LTRD 4A3FB 3HS0C 4G7ZC 1GJXA 4EGVA 3MC0B 4UAIA 4ID6A 1PRTD 3BVGA 4DFAA 5M9OA 3BZDB 4DK1A 3OPOA 5C0XJ 1Q1EA 1F2ZA 1DXMA 2BE5D 3LNNA 1HA5A 4RGOS 3DWAA 3LWUA 1CQVA 1GXDC 3GQBA 5D65A 4DN4M 5BN3A 3QWNA 4QCLA 1HFGA 2F0UA 3DMUA 2SDFA 5CR3A 1BR9A 2B2WA 1KLGD 3S1MB 1UAPA 3E0JA 4IUNA 2A69C 1KDAA 1LABA 3KBGA 2EDGA 4BA2I 4XYQA 4OIKA 3R3OA 1PFMA 1FGBD 1HUMA 5ELCA 2KCNA 5ISRA 4BA1I 5EQ0A 2SNMA 4F7XA 1STYA 1EZ6A 1TWFB 5CV9A 1I4RA 3FPUB 1FD7D 1I4PA 4J1MA 3J7AF 1VDZA 4IFDG 3C1EA 1EYAA 2BDNA 2K03A 5EPKA 1G291 2AUKA 2F0NA 1PTOB 3T16A 3D4WA 5JJZA 4XXEA 1TWHB 4TKOB 4HTHA 5M5WB 1PFBA 3A54A 1LT4D 2B2UA 1LV9A 2PZWA 4WORA 1NR4A 4F87A 2X6LA 1B53A 2EOTA 1HTLD 2E76C 5CBEE 4FXGC 3PUVA 3S9WA 5HURA 1QJOA 3GTJB 4KV6A 2V4DA 2K28A 2XIWA 1SNCA 2PYKA 1FNVA 1PZKD 4X3TA 5C0XG 4JBWA 3BVZA 1S5ED 5K36H 2XNAC 3I70A 2Y0SB 4F88A 1GUOA 5BN5A 3I4NB 1K83B 2Q8RE 4NDXA 1TS4A 1IKMA 5COYA 3M4OB 1XTCD 2Z1CA 1STAA 1CZWA 1TKWB 3C1FA 1PZID 5FLXL 3NE5B 4XQJA 4DAYA 2I46A 5FLXE 3D6WA 3OIQA 2AQ2B 2J7ZA 5C3WA 2Q8IB 3H6MA 2F0FA 1NAPA 2HDLA 2KHSA 2XWJB 2DY8A 1ZXTA 4NW2A 3Q23A 2NVTB 3T53B 3DEOA 3DM1A 1T5EA 1BF4A 1SYGA 3IL8A 1V1PA 3TZUA 2JE6I 3TDQA 2PCFB 4ZUJA 1JOOA 2LFNA 3BVMA 1Q8IA 2CW0C 5E3FA 4OIJA 2MP1A 3EJIA 1X32A 2PZTA 4L8JA 2D62A 1ZYRC 4C3HB 1G2SA 1E2ZA 3DXJC 2NVYB 3IFTA 4ZKCB 3MHBA 2B8FA 1TQOA 3AU7A 1E2VA 2NZ1D 2WKCA 2A6HD 3Q24A 1A3UA 2PO4A 2EY6A 2EJGC 3VR2A 1M8AA 3K5OA 5IODA 1S5FD 2A6EC 1SDFA 1RD9D 4H44C 3HOXB 4HCSA 4C1NI 1II3A 1Q12A 1BNZA 4K14A 2A73B 2PZUA 1TS3A 2IWHA 1OXVA 5JEAJ 2F4IA 3HRZC 1Y8OB 1CQFA 1IW7D 2B8GA 4RAUC 2WAQB 3NTHA 4C3HG 1RCVD 1JWUD 3VA5A 1TS5A 4FXDA 3Q6SA 1SJED 3GV3A 1LT5D 2YU9B 1H9MA 4KY6A 4ZUIA 3TP8A 1KTKA 4IN3A 2KOLA 2EJFC 1VF7A 3K6OA 5FO8B 2G9DA 3MWYW 1LLRD 4RKBA 2FINB 3T56B 1STNA 5IIFA 2B63B 3F2UA 4KTAA 1JCKB 3MEHA 2MHVA 3SR1A 1EZ8A 2F0TA 2AWNA 1IL8A 1CFMA 1OXSC 2FHTA 1YNJC 4JK1C 1DCZA 1TY2A 2DNEA 4BBSB 4ZKBB 1EYDA 4HMJA 1HRJA 4FNFA 4ZK9B 5CGKA 3FRPB 1CT1D 2RKSA 1PRTB 2PMZB 1D5ZC 1ESFA 1Q3LA 2IL8A 3KK7A 3PUYA 2RVLA 1XWEA 1ONLA 1KABA 3SXHA 4ABNA 1NR2A 4OHJA 5JOBA 2C9OA 3GTGB 5EKLA 3A8JE 4LJZC 2NN6G 2RDGA 5FK9C 4H7BA 1E0BA 4IALA 1GUSA 4J6HA 5JEAG 4G7OC 1R4PB 3EVQA 4L6TB 1WTWA 1BCPC 2QCPX 3QG1A 2SEBD 3NTIA 1NUCA 5E1FA 1EIHA 1ET9A 2KQ3A 2A6ED 2O4XA 3G6JB 3I3CA 2GA4B 4FYDA 2BCOA 4CGYB 4EQNA 2ZXRA 1ENCA 1O7ZA 3CRKC 2J0TD 2F3VA 2JP1A 2HQEA 2KEDA 5M3MB 5C4XB 3PIO3 4DAVA 1SYBA 1ENFA 1H9SA 1KLUD 2F0JA 4OGQC 5FO9B 1AFPA 2E2IB 3J7AV 2EYHA 1TIID 4KK7A 1T5XD 2WKDA 4F8MA 1Q1BA 3S14B 3J80E 3TZDA 4KN7C 1BOSA 1HTPA 1HUNA 4HR7B 2JA6B 3HZXA 1UNSA 1JC7A 1DONA 1WTQA 1G8ZD 2JSOA 5I4DA 1F2MA 3U9SA 2EZVA 3L3OC 1WCMB 2E2DC 2L55A 1LTSD 1YNJD 1LTID 2B2YA 3NWTA 3S16B 1OXTA 3R2IA 1EL0A 2F0PA 4DK0A 1ET6A 1VCIA 2IJ0A 3P75A 1Y69U 3M85A 1XXGA 4LK1C 3ND8A 1CA6A 4RCNA 1WD1A 2EY2A 1CTMA 2EPBA 2R61A 4FXKC 4CJ2C 1CK1A 1SE3A 5LL6S 3D31A 1SBBB 2NTSA 3SK6A 5ELFA 4CKBA 1OXUA 3SK4A 3GTMB 1SYDA 4EQPA 2WACA 1EU4A 4HCEA 3P7JA 2ZXOA 3J81L 5C4ZA 1MSGA 3J81E 2LS01 1O78A 2WIIB 2N55A 3M7NA 4RGNA 2OEOA 3I8ZA 4HMIA 3H91A 2IT1A 1CZGA 3MXPA 5JAVA 3W3AA 2OF1A 1BXTA 2D2CC 2M9VA 4RA8A 3R93A 1ZEQX 5HGTA 1GHJA 3KF8A 1YNND 3D3RA 4G4KA 4CBVA 2F0QA 3I4LA 3HOYB 3NK9A 1MSHA 1I4GA 4H13C 2L11A 3VYUA 3DWQA 1AZPA 1IKLA 1C8CA 1EYCA 2F0SA 1CHQD 4FF4A 3MXNA 3DEPA 4B08A 3S15B 1NSNS 1A6XA 3IAYA 4KY7A 4IUPA 1S4ZA 1D6EC 1SSOA 1EY4A 4P2CB 3URYA 3NHHA 5KRUA 1TWGB 4A3DB 1Y8NB 5D3DA 2Z4HA 1EEID 4BBRB 3CRLC 5EGTA 1HA6A 2M00A 3OIPA 1SJHD 3NWSA 2B2VC 1WTRA 3K5NA 3K58A 1B4OA 4C3IB 1O7YA 2IW3A 3PIP3 1Y8PB 1I6HB 1H9JA 4R9WA 2D9UA 4PMBA 5M3FB 4ZLTF 2EYFA 1QB5D 3LWEA 4B9WA 1OO9B 1QE6A 1EU3A 1HPCA 5K36G 1WD0A 3HEJA 2FMCA 2X69A 2LMCB 3VA7A 5CV8A 5G3LF 1H9RA 1A2UA 3V2TA 1PTOC 1LT3D 4O1NA 1PTOH 1JWMD 4KD4A 3WOEA 1X3PA 5ELBA 1HQRD 2HDMA 4OL7A 4NMZA 2EE1A 1WTXA 2CVRA 5ELEA 1KAAA 2VNUD 1EFID 4C3IG 1PYWD 2L0CA 1WTVA 4U68A 2KECA 3TN2A 5FOBB 4G7HC 2R6GA 2K01A 1B9MA 2XSCA 3O13A 3JAML 3TP7A 4U673 2PW7A 4KHVA 2EYPA 3JAME 2O5IC 1R9TB 2K1BA 4ZAIA 1LTGD 1RHPA 2AQ3B 2AQ1B 3RZOB 3A7AB 5CC4A 2A69D 1F9PA 2JEAI 3GTOB 1NCVA 1QG7A 3GTQB 3OOCA 1D1IA 3EQLC 3U9OA 3G7LA 1TY0A 4ZRZA 3I91A 1VMCA 2CHBD 5C3EB 2F0DA 3NUCA 2KEEA 2KUMA 2XWBB 2WV6D 4EQOA 2B2VA 5EPLA 5C4HA 5I6YA 2MGSA 4KMUC 4A93B 2DN8A 3M4YA 3I72A 3H94A 4XDXA 5G3LD 2EY1A 2BDOA 2R92B 4QF4A 2NWGA 4J8QA 5CV4A 1SYFA 3A56A 1BQQT 4RFBA 1U4LA 1F2YA 2F0KA 3FKIB 4ZYSA 5I9OA 4KJNA 1DD2A 4G57A 1WVLA 1QNUA 2CQAA 5DM73 3HOUB 4RGMA 3E5SA 3V96A 1TWAB 2BA0A 2K7VA 2KA7A 3BDLA 3SE0A 4WFN3 2EXZA 4A3JB 3CKIB 2F1MA 5KIXA 4MIUA 3T4AC 3E6ZX 2NTTA 3SVMA 2VUMB 4CJ0B 3RZDB 3BDCA 1JOKA 2F0MA 1STHA 3FDTA 3P1HA 2IPKD 3EROA 1SE2A 3PUXA 1BUVT 4K6DA 5CYUA 1PTOD 3RUZA 1SNPA 5AFWA 3HGBA 2K04A 1IYUA 1W6JA 2O2LD 3NBIA 1Y1WB 1I4QA 2EY5A 3DWPA 1AN8A 4PV1C 5JPMC 1EY6A 3K7AB 5IOCA 2E74C 1JORA 4IUUA 1KNAA 5IGCA 2XRSD 5I2XA 4C1NK 3R2TA 4QUFA 3BYYB 4QMGA 1AZQA 4FVMA 1F77A 1GUTA 4MN3A 1SE4A 3D4DA 1DOKA 5JVH3 1B3AA 5E4XA 1O80A 2CW0D 4K2KA 4DA2A 3MFGA 5IGGA 1ZYRD 4ODGA 4K5VA 1VMPA 4LAAA 3I4MB 4AYBB 2JEBI 3A8KE 1ZKOA 2AWOA 4FO2A 4V0BA 2R3ZA 4K8JA 1A3TA 4K8IA 1RF2D 2JXMB 3SHLA 4WRDA 3Q22A 4BY7B 1FYCA 1PDQA 4RHSA 3CU7A 1SNQA 3PUWA 3S2HB 4KHZA 3X3NA 3T51B 1EY9A 3V05A 2Q8TA 1PRTC 4BWGB 3IFDA 1PLFA 1DJRD 2EJMA 2RSOA 4ULLA 3HP3A 1PMRA 1FNUA 2BE5C 5ELDA 4RCOA 4M8AA 3DHQA 2VXWA 2L1BA 2EYLA 5J1ZA 1RTNA 1TR5A 3OMCA 1TU2B 3N6RA 4RKLA 4OO1H 1I50B 5I6WA 4K6LA 2QDBA 5EPJA 2BA1A 4GZYC 5DM63 5C3XA 3KLSX 3T13A 5CV6A 2A68C 1A15A 3J80L 3OHXC 1BCPF 1PZJD 1S5BD 3CQZB 5D14A 1CI3M 5DEHA 2EVBA 4PQXA 5EJWA 2SNSA 3FMCA 5CMDA 4E6IA 2F0LA 5CBAE 3VYTA 3ZYYX 3GV6A 4N9TA 2M2LA 4KJOA 3VR4A 3HG9A 5EKKA 1SNMA 5IGDA 4OO1I 1EEFD 3SK5A 5CORA 5KNBA 2B39A 4RWSC 1MI2A 3VR3A 3C2PA 4DNRB 1ILPA 4KKSA 3PV0A 2KJXA 3RD4A 1BO0A 3QIAA 2FJ2A 5DAUA 1M4VA 1KDCA 3A7LA 3SEBA 1ILQA 2F03A 4CKCA 1JE4A 2OT2A 2JA7B 3S1RB 2DY7A 2RDHA 3GP7A 4PMWA 2QEJC 1HFNA 1BBXC 4EVOA 3MAQA 1EIGA 3QOLA 2NB0A 1STEA 3NTKA 5IGBA 3GTKB 5J39A 4FF1A 2RQXA 3VR6A 5JVG3 2ZT9C 1BCPD 2ICEC 4QIWB 3R8BA 1STBA 5T1IA 1U4RA 3QJYA 4KKTA 2N88A 2J4XA 5IGEA 3EFXD 3BYTB 4QUCA 3KLRA 1QILA 3H0GB 4PMCA 4A3BB 3PMFA 1SYCA 5C5MA 1GUWA 4C2MB 1V1PB 4IUTA 2K33A 1I6VC 4DU9A 1HCZA 3S2DB 2R93B 3NBHA 2EYOA 3MXGA 1KNEA 4BY1B 1STGA 2G9HD 2WB1B 5I2YA 1EY8A 2RBMA 1L0XB 4FF3A 3VR5A 5C6AA 3K57A 2A68D 3ONAB 1EY5A 3AB9A 2RDFA 4IUVA 3PO2B 3NPPA 1I4XA 4UDUC 1B50A 2SOBA 4KY5A 4ILWA 1MGSA 5FKAC 4KI0A 1Z6HA 2JA8B 2H1EA 1V43A 5FO7B 3TP5A 1B1ZA 2JA5B 2A6HC 2WINB 3W2DA 2VB3X 4M1UB 4IFDH 1TT2A 2MPMA 1F9SA 1LO5D 1WTOA 1EWHA 3I90A 1GUNA 2ZXPA 3D8GA 4QB4A 3N52A 1SAPA 3TSSA 2K5WA 3OWEB 1U4MA 4Q0FA 3AMUA 1KDBA 4NKLA 2EYMA 3VYRA 1SNDA 1D2BA 3P20A 1SMYC 3MTSA 1IYVA 3QO2A 2K32A 4ZQ3A 1IW7C 1K8MA 1IHZA 1PXUA 3OSOA 1DOMA 3RMHA 2O5JC 3D4RA 2L5TA 3NP8A 2E2JB 4ME5A 3FEWX 3IKJA 1Z47A 4IFDI 3HKZB 3L9AX 2A5HA 3PO3B 2IX3A 1HHVA 4NP5A 2NYZD 5EBDA 1V8QA 4X3UA 4DF7A 5C0XH 1DYQA 2MUYA 2L9HA 3DUZA 3TP6A 3HOWB 3FVQA 4RH6A 2QF7A 1ESRA 4FF2A 1W6KA 5C5LA 1JWSD 1BDOA 3Q0AA 1EQVA 1F2LA 4KN4C 5DNFA 2VB2X 1EWCA 2XVSA 2HUGA 4XYOA 1XX8A 1TVXA 1V1OA 3C46A 1A3VA 2QILA 2DNCA 3NXWA 1C48A 5C0XI 5KGUA 1B9NA 5CV5A 5LL6X 2MJ8A 3MVVA 3TBIB 1H9KA 3QOJA 2K05A 3H09A 1PTOF 5F2DA 2RSNA 4A3GB 4Q5VA 1R4QB 1LT6D 1F9RA 4I7ZC 1OXXK 5KYLA 1EQTA 2HCIA 4V190 3HOZB 4TSSA 5KNDA 4KKUA 3A8IE 1JOQA 4KD3A 4FP5D 2TSSA 1SEBD 1MBYA 1RDPD 2FFKB 4HSPA 1LTTD 1RODA 2AUJD 1Y1VB 3MFYA 4R8IA 3K5LA 2E75C 1ENAA 2I07B 2F0EA 1H9SB 3I73A 3KLSA 1CHPD 4XQNA 1SXTA 1SMYD 1CM9A 2ENBA 4XIGS 4LMQD 1ICWA 2PNRC 1UEAB 1U4PA 3OMGA 4DAPA 5KNCA 1UUPA 1Q90A 1GHKA 3GD7A 4C3JB 5T1GA 2OXPA 3LX0A 4X3KA 2WP8J 2KCCA 5C44B 5J22A 2A74C 2D5DA 2PQEA 1O7LA 1QOHA 5M5XB 2XRQD 3OW7A 5KYIA 3FPPA 4A3IB 1PFNA 4HSVA 3S1NB 4XT3B 2R7ZB 2C5CA 5KEEA 3J7YW 2EYJA 5IT9L 5IT9E 2IX0A 2XN9C 4BS9A 1TWCB 1HXYD 4L63B 1BCPB 2TMPA 3MXUA 4C3JG 4DNTB 1DM0B 1J9OA 4H0LC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O4X A;  5IGG A;  1SYC A;  4HTH A;  5C5M A;  2F0G A;  1KAA A;  1EYC A;  2F0S A;  2EY2 A;  4ODG A;  5EKK A;  1SNM A;  3E5S A;  4K5V A;  2F3W A;  5IGD A;  1STN A;  5IIF A;  1JOQ A;  2PZW A;  1NSN S;  4LAA A;  4WOR A;  4DU9 A;  4KTA A;  4KD3 A;  4ZUJ A;  1JOO A;  4YIJ A;  1U9R A;  3TME A;  4NP5 A;  2EYO A;  3BDL A;  3SK5 A;  3MEH A;  4EQN A;  5NUC A;  1ENC A;  5E3F A;  3SR1 A;  3TP7 A;  5KRU A;  4PNY A;  2PW7 A;  4KHV A;  2NUC A;  4DF7 A;  1EZ8 A;  2EYP A;  2EXZ A;  2F0T A;  3EJI A;  1A3T A;  2PZT A;  4K2L A;  4K8J A;  4KY7 A;  4ID6 A;  5HUR A;  3S9W A;  5KIX A;  1STG A;  1AEX A;  2F3V A;  4K8I A;  2HQE A;  4DFA A;  4KV6 A;  4MIU A;  1EY4 A;  5M9O A;  4TRD A;  4G57 A;  3SHL A;  5DAU A;  1ENA A;  3SK6 A;  3OWF A;  3TP6 A;  1EY8 A;  1KDC A;  2RBM A;  4WRD A;  2F0H A;  3BDC A;  2LKV A;  3NHH A;  3MHB A;  1JOK A;  1SYB A;  3ITP A;  1F2Z A;  1TQO A;  3SK4 A;  5C6A A;  5CC4 A;  2F0M A;  5IGF A;  4B9X A;  1SNC A;  1SYD A;  2F0E A;  5I9P A;  2PYK A;  2F0J A;  1EYD A;  1SNQ A;  1STH A;  4EQP A;  4HMJ A;  3P1H A;  1EY5 A;  2PW5 A;  1EY9 A;  2RDF A;  2F0U A;  5C5L A;  3DMU A;  3PMF A;  5CGK A;  1A3U A;  2ENB A;  3ERO A;  5CR3 A;  2WAC A;  4I65 A;  2F0W A;  1EQV A;  4K6D A;  2EY6 A;  3RUZ A;  4N9P A;  1SNP A;  3U9O A;  5C4Z A;  3OMG A;  5IOD A;  5EGT A;  4S3S A;  2EYH A;  2SOB A;  2M00 A;  4KY5 A;  3NQT A;  2RKS A;  4EVO A;  2F0O A;  4IUN A;  1II3 A;  4F8M A;  1KDA A;  2F0D A;  3DHQ A;  3NUC A;  3TP5 A;  1A2T A;  2OXP A;  3QOL A;  2OEO A;  1SNO A;  2EY5 A;  2F0V A;  1EY7 A;  2EYL A;  5J1Z A;  4EQO A;  4HMI A;  1TR5 A;  3OMC A;  5IGB A;  2F0I A;  4NDX A;  1EY0 A;  1KAB A;  3ERQ A;  3LX0 A;  1EY6 A;  1A3V A;  3SXH A;  1TT2 A;  4K14 A;  5J39 A;  3R3O A;  4RKL A;  4DGZ A;  5C4H A;  5I6Y A;  3NXW A;  2PZU A;  5I6W A;  3MXP A;  5IOC A;  4K5X A;  3HZX A;  1JOR A;  2QDB A;  4PMB A;  5JAV A;  5JOB A;  5KGU A;  5IGC A;  5J22 A;  2EYF A;  2OF1 A;  3D8G A;  4QB4 A;  5EKL A;  5CV5 A;  2PQE A;  3MZ5 A;  4B9W A;  1F2M A;  1STA A;  5CV7 A;  5C3X A;  3MVV A;  3C1F A;  3T13 A;  5K5P A;  5ISR A;  3QOJ A;  5CV6 A;  3D6C A;  2SNM A;  4H7B A;  4F7X A;  1KDB A;  4QMG A;  5KYI A;  4NKL A;  3VA5 A;  2EYM A;  5HGT A;  5F2D A;  1STY A;  1SND A;  1STB A;  4IAL A;  3SK8 A;  1EZ6 A;  2EY1 A;  3HEJ A;  5CV9 A;  5C3W A;  4K5W A;  1RKN A;  4J1M A;  5DEH A;  5KEE A;  4J6H A;  4QF4 A;  5CV8 A;  2EYJ A;  4ZQ3 A;  4KY6 A;  2F0P A;  3EVQ A;  2SNS A;  3D4D A;  3H6M A;  2F0F A;  5CV4 A;  4ZUI A;  1A2U A;  1SYF A;  3TP8 A;  3V2T A;  4E6I A;  3C1E A;  1EYA A;  2F0Q A;  3OSO A;  1IHZ A;  2F0L A;  3NK9 A;  1F2Y A;  3P75 A;  2KHS A;  3NP8 A;  4KD4 A;  1SYE A;  2F0N A;  4R8N A;  5IGE A;  1NUC A;  5E1F A;  3T16 A;  2F0K A;  4K2K A;  3D4W A;  3QB3 A;  4IZ8 A;  4OL7 A;  5KYL A;  5I9O A;  4KJN A;  4N9T A;  4KJO A;  4RKB A;  2KQ3 A;  4NMZ A;  4PMC A;  1SYG A;  4ME5 A; 
#chains in the Genus database with same CATH topology
 1AP0 A;  4JI7 Q;  2F0G A;  2FMM A;  4A3K B;  1TWA H;  1I3Q B;  2F3W A;  2MFI A;  3L7Z C;  1JQY D;  2KVM A;  1VQ8 A;  4DV5 Q;  1U9R A;  1D5X C;  1DOL A;  4A3J H;  5C44 G;  3AQQ A;  1UE7 A;  4PNY A;  2HCC A;  4K2L A;  3FP9 A;  3NQI A;  2VUM H;  4NPS A;  1AEX A;  3GTP B;  1QCB D;  2L12 A;  3CCQ A;  3RZD H;  2NBF A;  1KHI A;  1RJT A;  1X3Q A;  2LXJ A;  4A3I G;  2F0H A;  2X6G A;  2LKV A;  5IGF A;  1QWY A;  1D5M C;  2B63 G;  2R7Z G;  1WTP A;  1EOT A;  3K0Y A;  3MA2 B;  5IYC G;  2YYZ A;  2BOS A;  1XYI A;  3X3M A;  1L0W A;  2NN6 H;  3M7G A;  4HED A;  3BS1 A;  2I5H A;  1HNX Q;  1X56 A;  1JR0 D;  3NQT A;  2Z8L A;  2B2Y C;  3NSW A;  3GTL B;  1LYL A;  1C4Q A;  1HQM C;  2F4V Q;  3S1Q B;  1HZC A;  4CJ1 B;  1SNO A;  4BBS H;  5JEA H;  3K7A H;  1I4H A;  1IL2 A;  1HZA A;  2JYO A;  2F0I A;  2ID0 A;  4A3E B;  3ERQ A;  3EA6 A;  5IP9 G;  4DGZ A;  1JB3 A;  5JPN C;  3C3L A;  3ERS X;  5LHY 1;  5M5Y B;  4K5X A;  3SDZ A;  1B2T A;  1E1T A;  1ML0 D;  5A35 A;  3TS2 A;  3MZ5 A;  2L15 A;  5HY6 A;  4CHT B;  2K5Q A;  5D3I B;  3JAM c;  3I2Z A;  4IUR A;  1QNK A;  2E2H B;  1K8O A;  1GOZ A;  3D6C A;  1VQ6 A;  4DV1 L;  1V1Q A;  3KF8 B;  2NVX B;  4A3M B;  5A2Q L;  2B2T C;  1G91 A;  5A2Q E;  2AHO B;  3A0J A;  4XT1 B;  2NN6 I;  2R7F A;  3GTG H;  4OO1 G;  3M3Y B;  2K5D A;  4WJW A;  3K5M A;  1JE5 A;  4LF7 L;  3CHB D;  2K14 A;  3K8A A;  4B3T L;  1GUG A;  3KUP A;  2H4O A;  2PPB C;  4TQU S;  4C56 C;  2RA4 A;  2VY3 A;  1NMF A;  3QB3 A;  4XQQ A;  1CA5 A;  4X3S A;  1X3F A;  5LMU L;  2HIV A;  1G2T A;  1W2B A;  2ICI A;  1YNN C;  3BJU A;  3PUZ A;  3I4M H;  1LAC A;  2A8V A;  4A3E G;  4DR5 Q;  4O42 A;  2DGY A;  5C4J B;  1JT8 A;  3TME A;  4X65 L;  4LWC A;  4YIJ A;  1PH1 A;  1E2W A;  5IYD H;  4NXM Q;  1TS2 A;  3AFP A;  5NUC A;  1EQR A;  2NUC A;  3BG3 A;  4POG A;  1LTA D;  1FR3 A;  3PSI A;  4TRD A;  1DZ1 A;  4BY7 H;  1G6Z A;  1VF5 C;  4CKE A;  2NVQ B;  3OWF A;  2UUC L;  1AH9 A;  1GO3 E;  1E7Z A;  5BN4 A;  1Z7T A;  3ITP A;  5FJ8 G;  4HJA A;  1PRT F;  4RGT A;  4DXG A;  4B9X A;  4A3M G;  2E5L L;  3S2H H;  1N32 L;  5I9P A;  5E4W C;  2B2W C;  2Q2U A;  2PW5 A;  1SFO B;  3M4P A;  4DR6 L;  4MZ9 A;  3WOF A;  4I65 A;  5JJK A;  2BH8 A;  2F0W A;  1AW7 A;  1WJJ A;  2K6A A;  4XTC S;  3GO5 A;  4N9P A;  4IQZ A;  1VQC A;  2N49 A;  4S3S A;  3ND9 A;  3RLF A;  1JIC A;  5C4X G;  5M3M G;  2F0O A;  1XMQ L;  3S17 B;  1RL2 A;  2MNA A;  1A2T A;  4HN7 A;  3WDN A;  2F0V A;  1EY7 A;  1A62 A;  4Y7N B;  1N8R C;  2Z0S A;  1I50 H;  1EY0 A;  3BDO A;  2QKI C;  4Z9C B;  1FNW A;  4HAE A;  5TSS A;  1OTC A;  3UI2 A;  1S5C D;  4IFD J;  1AE2 A;  3K59 A;  1CKN B;  5EKI A;  1L0Y B;  2HQL A;  5CV7 A;  1B7Y B;  5K5P A;  3CQZ H;  3HOV B;  1J5E L;  3H3V C;  1YIJ A;  1S5D D;  3SK8 A;  4OEM B;  1B44 D;  4NXN Q;  1MD2 D;  4K5W A;  1RKN A;  4DXF A;  4MHE A;  2JA6 H;  1J8I A;  4B3R Q;  1LTB D;  2LY7 A;  2B2T A;  4LFB L;  2PMZ E;  2VL6 A;  1SYE A;  4R8N A;  1WCM H;  3NEL A;  2I5L X;  4IUQ A;  2IX1 A;  1D1K A;  4IZ8 A;  4RHR A;  3A55 A;  1F9Q A;  2B2U C;  3AFQ A;  3KBX A;  3TRE A;  1RTO A;  5EBC A;  3VYS A;  1K8G A;  1PFS A;  2L4N A;  2Z4I A;  1PV4 A;  1LTR D;  4A3F B;  1XMO Q;  3HS0 C;  4G7Z C;  1GJX A;  4OWX B;  2JN4 A;  4EGV A;  1VQ4 A;  3MC0 B;  3IRB A;  2LXK A;  1K9M C;  4UAI A;  4ID6 A;  1PYB A;  1PRT D;  1A63 A;  1P16 A;  3BVG A;  4DFA A;  4DV2 Q;  1JB7 A;  5M9O A;  3BZD B;  4DK1 A;  3HOV G;  4UP9 A;  3OPO A;  5C0X J;  1Q1E A;  2C35 B;  1F2Z A;  1DXM A;  2BE5 D;  3LNN A;  1HA5 A;  4RGO S;  4ALP A;  3E9H A;  3DWA A;  5ELO A;  3LWU A;  1CQV A;  1GXD C;  3GQB A;  5D65 A;  4DN4 M;  5BN3 A;  1SN8 A;  2JA7 H;  3QWN A;  4QCL A;  1HFG A;  2F0U A;  3DMU A;  1WYD A;  2SDF A;  1PH6 A;  5CR3 A;  1BR9 A;  2B2W A;  1KLG D;  3S1M B;  1IXR A;  1UAP A;  3BZK A;  3E0J A;  4IUN A;  2A69 C;  1KDA A;  2B3G A;  1LAB A;  3U4Z A;  3GTK H;  5ELN A;  1X55 A;  3KBG A;  3PQI A;  2EDG A;  4BA2 I;  4XYQ A;  4AQY Q;  4OIK A;  3R3O A;  1PHJ A;  1PFM A;  5E7N A;  1FJG L;  4DV7 Q;  1FGB D;  4JBJ A;  2E8G A;  1HUM A;  5ELC A;  2KCN A;  4JI8 Q;  5ISR A;  4BA1 I;  1B70 B;  2MO1 A;  2SNM A;  5EQ0 A;  3I56 A;  4F7X A;  1S40 A;  1STY A;  2QW7 A;  1EZ6 A;  1TWF B;  3KFU A;  5CV9 A;  1I4R A;  3FPU B;  1FD7 D;  1I4P A;  4J1M A;  2RHQ B;  3J7A F;  5GRO A;  1VDZ A;  3KF6 A;  4LW1 A;  2I0Q A;  4IFD G;  3C1E A;  1EYA A;  2BDN A;  2K03 A;  5EPK A;  3T1H L;  1G29 1;  2AUK A;  2F0N A;  3H0G H;  1PTO B;  3T16 A;  4GOP B;  3D4W A;  5JJZ A;  4XXE A;  1TWH B;  4P71 A;  2OWO A;  4C2M H;  4TKO B;  4HTH A;  4AIM A;  5M5W B;  1PFB A;  4DR2 Q;  3A54 A;  1LT4 D;  2B2U A;  3S2D H;  2R93 H;  1LV9 A;  2PZW A;  4GLV B;  1HNZ L;  4WOR A;  1QVG A;  1NR4 A;  4F87 A;  2X6L A;  1B53 A;  2EOT A;  4BY1 H;  3HOY G;  4OEL B;  1HTL D;  2E76 C;  5CBE E;  5IYB G;  4FXG C;  3PUV A;  1L1O C;  3S9W A;  3E0E A;  5HUR A;  4R4C A;  1NTG A;  1QJO A;  3GTJ B;  4KV6 A;  2V4D A;  2K28 A;  2XIW A;  1UEB A;  3S15 H;  1KRT A;  4LUZ A;  1SNC A;  2PYK A;  2ZM6 Q;  1FNV A;  4EX5 A;  4HJ9 A;  3PO2 H;  1PZK D;  2UU9 Q;  4LF4 L;  1YIT A;  4X3T A;  5IP7 G;  4LFC Q;  3RNU A;  5C0X G;  4DR4 Q;  4JBW A;  3BVZ A;  1S5E D;  2JA5 H;  2XNA C;  5K36 H;  3I70 A;  2Y0S B;  4F88 A;  4A3D H;  1GUO A;  3RR5 A;  2UXD L;  5BN5 A;  3I4N B;  1NE3 A;  1K83 B;  2Q8R E;  4NDX A;  2YV5 A;  1TS4 A;  1IKM A;  3W1B A;  5COY A;  3M4O B;  4BBR G;  3U50 C;  2UUA L;  1XTC D;  2Z1C A;  1STA A;  1CZW A;  3UE1 A;  1TKW B;  3C1F A;  1PZI D;  5FLX L;  3NE5 B;  4XQJ A;  3ER0 A;  4DAY A;  2I46 A;  5FLX E;  5LMN Q;  3D6W A;  3OIQ A;  4UPA A;  4C3I H;  2AQ2 B;  2PQA A;  2J7Z A;  5C3W A;  2Q8I B;  3NEM A;  2PI2 A;  4JI2 L;  3E3X A;  3H6M A;  2F0F A;  1NAP A;  4JI6 Q;  5M3F G;  2KHJ A;  2HDL A;  2KHS A;  2XWJ B;  2DY8 A;  1ZXT A;  4NW2 A;  3Q23 A;  2NVT B;  3T53 B;  4GS3 A;  3DEO A;  2E2J H;  4OX9 L;  3DM1 A;  2ZTD A;  2CH4 A;  1T5E A;  1BF4 A;  1SYG A;  3IL8 A;  2ASB A;  4X64 Q;  2PI2 E;  4MTN A;  3J81 j;  1HNW Q;  1V1P A;  3TZU A;  3F2C A;  2JE6 I;  3TDQ A;  2PCF B;  3CCE A;  4JYA L;  4KLK A;  4ZUJ A;  3CAM A;  1JOO A;  3STB D;  2LFN A;  4LNQ A;  3BVM A;  1Q8I A;  2CW0 C;  5E3F A;  4OIJ A;  4YY3 Q;  2MP1 A;  3EJI A;  3KDF A;  1XNR L;  1X32 A;  2PZT A;  4DV6 L;  4L8J A;  4UY8 C;  4MNO A;  1HH2 P;  1VQI A;  3HOW H;  2D62 A;  1ZYR C;  2VQF Q;  4P72 A;  4C3H B;  1G2S A;  1E2Z A;  3DXJ C;  2NVY B;  3IFT A;  4ZKC B;  3MHB A;  2B8F A;  1TQO A;  3AU7 A;  1E2V A;  2NZ1 D;  3G48 A;  2WKC A;  1U0L A;  1VS0 A;  4JOI C;  1X3G A;  4KHP L;  2A6H D;  3Q24 A;  2CQO A;  1A3U A;  2EQS A;  2PO4 A;  4JI0 L;  1MHW C;  2EY6 A;  2EJG C;  3VR2 A;  1M8A A;  3K5O A;  5IOD A;  4ME3 A;  1S5F D;  2A6E C;  1SDF A;  1RD9 D;  4H44 C;  4O0A A;  3HOX B;  4HCS A;  4C1N I;  2YTV A;  1II3 A;  1NY4 A;  4LF9 L;  1Q12 A;  4L5Q A;  1BNZ A;  5LMN W;  1NJI C;  4K14 A;  1VQD A;  2A73 B;  3GTQ H;  2PZU A;  1K3B C;  1TS3 A;  2IWH A;  1OXV A;  5JEA J;  2F4I A;  2F4V L;  3HRZ C;  1Y8O B;  1CQF A;  3F2B A;  1IW7 D;  2B8G A;  4RAU C;  2WAQ B;  2VQE Q;  1EIF A;  3NTH A;  1PYS B;  5C3E G;  4C3H G;  1RCV D;  1JWU D;  3VA5 A;  2UXB L;  1TS5 A;  4FXD A;  3Q6S A;  1SJE D;  3GV3 A;  1LT5 D;  2R7D A;  2YU9 B;  1VQG A;  1H9M A;  2QGQ A;  2UUB L;  2B29 A;  4KY6 A;  4ZUI A;  3TP8 A;  3PF5 A;  1KTK A;  4JI4 L;  4IN3 A;  1YBY A;  2KOL A;  4A3C G;  1JJG A;  4A93 H;  2EJF C;  1VF7 A;  3K6O A;  5FO8 B;  1BBW A;  2G9D A;  3HOZ H;  2GN5 A;  1SLJ A;  3MWY W;  1LLR D;  4RKB A;  3RN5 A;  3RLO A;  2FIN B;  5IY0 A;  1E24 A;  1U5K A;  1KL9 A;  3KOJ A;  2R92 H;  3T56 B;  4QGU A;  4YHH Q;  1STN A;  5IIF A;  2B63 B;  3F2U A;  1CUK A;  2N8N A;  4KTA A;  1JCK B;  1YEZ A;  3MEH A;  2MHV A;  3SR1 A;  1Y1V H;  4PZ7 A;  1EZ8 A;  3A74 A;  2F0T A;  2AWN A;  3FKI G;  1N33 Q;  1IL8 A;  1CFM A;  3L0O A;  1OXS C;  4YCU A;  3A5U A;  2FHT A;  4DR5 L;  1YNJ C;  2Z6K C;  3NEN A;  4JK1 C;  1DCZ A;  3HOU G;  4DUY L;  3VDY A;  1E1O A;  4IPD A;  1TY2 A;  2DNE A;  4BBS B;  4ZKB B;  1EYD A;  4HMJ A;  1HRJ A;  4FNF A;  4GN4 B;  4ZK9 B;  5CGK A;  4JOI A;  3FRP B;  2ZJR A;  1MJE A;  1CT1 D;  4A3J G;  4C3J H;  1PH7 A;  3D0F A;  4R4Q A;  2RKS A;  3J7Z C;  1PRT B;  2PMZ B;  2ZJP A;  2VUM G;  1D5Z C;  4CDE C;  1ESF A;  2K4K A;  4GNX B;  1Q3L A;  4IO9 A;  2IL8 A;  4JBK A;  3KK7 A;  3PUY A;  1IBK L;  2RVL A;  1XWE A;  1ONL A;  1X54 A;  1I5F A;  1KAB A;  3SXH A;  1N36 Q;  2OTL A;  2UXC L;  4ABN A;  1NR2 A;  1L2F A;  1WFQ A;  4OHJ A;  4DR3 Q;  1EOV A;  5JOB A;  2C9O A;  3GTG B;  5EKL A;  3A8J E;  5M5X H;  4LJZ C;  2NN6 G;  2RDG A;  1Y1W H;  4IPC A;  5FK9 C;  4H7B A;  4DKA C;  2R7Z H;  1E0B A;  3I4O A;  4IAL A;  1GUS A;  4BBS G;  4DAM A;  4J6H A;  5JEA G;  5FLM H;  4G7O C;  1R4P B;  2IY5 B;  3EVQ A;  4L6T B;  1WTW A;  1TWC H;  1BCP C;  2QCP X;  2F52 A;  1N34 Q;  4J15 A;  3QG1 A;  2SEB D;  3NTI A;  1NUC A;  5E1F A;  1EIH A;  1ET9 A;  5AJ3 L;  1VQN A;  4JI1 Q;  2KQ3 A;  4A3K H;  2A6E D;  4R4I A;  2O4X A;  1I3Q H;  1VQK A;  3G6J B;  2ALY B;  3I3C A;  2GA4 B;  4FYD A;  1C7Y A;  1YZ6 A;  4X62 Q;  3NBH B;  1KXL A;  1XTD A;  2BCO A;  4CGY B;  4EQN A;  1QUQ A;  2ZXR A;  1ENC A;  1XNQ L;  1O7Z A;  3GTP H;  3L2P A;  1YJW A;  3CRK C;  2MO0 A;  1B3Q A;  2J0T D;  1VQL A;  2F3V A;  2JP1 A;  2HQE A;  2KED A;  3S24 A;  5M3M B;  5C4X B;  3PIO 3;  4DAV A;  4GKK Q;  1SYB A;  2Z6K A;  1ENF A;  1H9S A;  1KLU D;  2A19 A;  1IBL L;  2KBN A;  2F0J A;  1GM5 A;  3I4M G;  1X3E A;  3ULJ A;  3G6E A;  2H5X A;  5J3B A;  4OGQ C;  5FO9 B;  1IBM Q;  5IYD G;  3H15 A;  1CSP A;  1AFP A;  2E2I B;  3J7A V;  1X6O A;  2EYH A;  5IWA Q;  1TII D;  4KK7 A;  1T5X D;  2WKD A;  4F8M A;  1UE5 A;  5GAH C;  4BY7 G;  4JG2 A;  1Q1B A;  3S14 B;  3J80 E;  3TZD A;  4KN7 C;  1BOS A;  5M5Y H;  4JI3 Q;  4OWT B;  1I94 Q;  1HTP A;  1HUN A;  4HR7 B;  2JA6 B;  3HZX A;  4JV5 L;  1UNS A;  1JC7 A;  1DON A;  4AH6 A;  1WTQ A;  1G8Z D;  2JSO A;  5I4D A;  3OTO L;  1F2M A;  4HJ7 A;  3U9S A;  2EZV A;  3L3O C;  1WCM B;  4LF5 L;  2E2D C;  2L55 A;  3TS0 A;  1LTS D;  1YNJ D;  4RMF A;  1LTI D;  4DV3 L;  2B2Y A;  3NWT A;  3S16 B;  1OXT A;  3R2I A;  1K0S A;  4GLX A;  3M3Y H;  1EL0 A;  2F0P A;  4DK0 A;  1ET6 A;  1E22 A;  1VCI A;  2IJ0 A;  3P75 A;  1Y69 U;  3W1G A;  3M85 A;  1XXG A;  4LK1 C;  3ND8 A;  3CCS A;  1CA6 A;  4RCN A;  1WD1 A;  2EY2 A;  1CTM A;  5C4J H;  1XPU A;  2EPB A;  3H3V H;  2R61 A;  1N9W A;  3KLW A;  4FXK C;  4CJ2 C;  5JJL A;  2JA6 G;  1CK1 A;  1SE3 A;  5LL6 S;  3PCO B;  1E3P A;  3D31 A;  1SBB B;  1WCM G;  1QVC A;  2NTS A;  3SK6 A;  5ELF A;  4POF A;  4CKB A;  1KIX A;  1OXU A;  4DPG A;  3SK4 A;  3GTM B;  1SYD A;  1SFO H;  1PA6 A;  4EQP A;  1ASZ A;  3PF4 A;  2RCF A;  4K0K L;  2K5N A;  2WAC A;  1UE6 A;  1EU4 A;  4HCE A;  3P7J A;  2ZXO A;  5IT9 c;  3J81 L;  5C4Z A;  1MSG A;  3J81 E;  4IPG A;  2LS0 1;  1O78 A;  3S17 H;  1FGU A;  4JVZ A;  4DV0 L;  2WII B;  1XJV A;  2N55 A;  3M7N A;  4QJF A;  4RGN A;  4Y7N H;  3H3V I;  4IJH A;  4B3T Q;  2OEO A;  3CCM A;  4AYB E;  3I8Z A;  4HMI A;  1Q46 A;  3H91 A;  2IT1 A;  3TEH B;  4DNI A;  5LMU Q;  1HR0 L;  1CZG A;  3MXP A;  3S1R H;  2JA7 G;  5JAV A;  2I5M X;  3W3A A;  2OF1 A;  1XPO A;  1BXT A;  2D2C C;  2M9V A;  4X65 Q;  4RA8 A;  3T1Y L;  3R93 A;  1ZEQ X;  1JMC A;  2VW9 A;  5HGT A;  2VS1 A;  1GHJ A;  3KF8 A;  4GKJ L;  1K28 A;  2V1C C;  3FHW A;  1YNN D;  3EN2 A;  1HJP A;  3D3R A;  2UUC Q;  1PH9 A;  4G4K A;  4CBV A;  2F0Q A;  2G5D A;  3I4L A;  1N32 Q;  3HOY B;  3NK9 A;  1MSH A;  4B3S L;  3CW2 C;  3KDF B;  1I4G A;  4H13 C;  2L11 A;  1BKB A;  4DR6 Q;  3VYU A;  3DWQ A;  1AZP A;  3KYH C;  1C9O A;  1IKL A;  3CXC A;  1C8C A;  3WWV A;  1EYC A;  2F0S A;  1CHQ D;  4A3F H;  4FF4 A;  3MXN A;  3DEP A;  4CDC C;  4B08 A;  4YWK A;  1XMQ Q;  2ATW A;  3S15 B;  1NSN S;  4DUZ L;  1A6X A;  1S3O A;  3IAY A;  2P5Z X;  3BZC A;  4KY7 A;  4IUP A;  1S4Z A;  3ICE A;  3H0G G;  4IOA A;  4A3B H;  1D6E C;  1SSO A;  1EY4 A;  1CSQ A;  4P2C B;  3QR8 A;  1QZH A;  3URY A;  3NHH A;  5KRU A;  1TWG B;  4A3D B;  1YJN A;  1Y8N B;  3PIO A;  4DV4 L;  5D3D A;  2R93 G;  3J7A 5;  1J5E Q;  5BR8 L;  2Z4H A;  4HJ8 A;  3GDE A;  2WFW A;  4BY1 G;  1EEI D;  1S72 A;  4BBR B;  3CRL C;  5HGQ A;  5EGT A;  1WOC A;  1HA6 A;  2M00 A;  3OIP A;  1SJH D;  2CCZ A;  1EIY B;  3NWS A;  4LFB Q;  4N8X 1;  2B2V C;  2YTX A;  1WTR A;  3K5N A;  3K58 A;  1B4O A;  4C3I B;  1O7Y A;  2IW3 A;  3PIP 3;  1Y8P B;  1I6H B;  1H9J A;  4BXX H;  4LF6 L;  3PO2 G;  4R9W A;  2D9U A;  4HJ5 A;  4PMB A;  2D0P A;  5M3F B;  4ZLT F;  2EYF A;  1QB5 D;  3LWE A;  2K5V A;  1CKN A;  2XTI A;  1Q7Y C;  3PGZ A;  4B9W A;  2DUD A;  1CKO A;  1OO9 B;  4A3L G;  1QE6 A;  2JA8 H;  2RCN A;  2Q2H A;  1EU3 A;  1HPC A;  2JA5 G;  5K36 G;  4A3D G;  1JJC B;  3DLL A;  1WD0 A;  3HEJ A;  2FMC A;  2X69 A;  1DGS A;  4X66 L;  2ZTC A;  2LMC B;  3VA7 A;  4LFA L;  5CV8 A;  5G3L F;  3UDX A;  2HT1 A;  1H9R A;  1A2U A;  1VQA A;  1CKM A;  1PTO C;  3V2T A;  1LT3 D;  5IP7 H;  4GOP C;  2K75 A;  4O1N A;  1PTO H;  1JWM D;  4KD4 A;  3WOE A;  1X3P A;  5ELB A;  1TWH H;  1HQR D;  3CCR A;  4MTK A;  2HDM A;  4OL7 A;  5M5W H;  4NB3 A;  4NMZ A;  2EE1 A;  1WTX A;  2CVR A;  5ELE A;  3CCV A;  2F3I A;  1KAA A;  2VNU D;  1MIU A;  1EFI D;  4C3I G;  1PYW D;  2L0C A;  1WTV A;  4U68 A;  2HHH L;  2KEC A;  1NMG A;  3TN2 A;  5FOB B;  4B3M L;  4G7H C;  1SRU A;  2R6G A;  3CC2 A;  2K01 A;  1B9M A;  2XSC A;  3O13 A;  3JAM L;  3CF5 A;  3TP7 A;  4U67 3;  1VQJ A;  2PW7 A;  4KHV A;  2EYP A;  4QIW E;  3JAM E;  3GTJ H;  4HID A;  2O5I C;  1Z9F A;  1R9T B;  2K1B A;  4ZAI A;  1FJG Q;  1LTG D;  4JBM A;  1EYG A;  1RHP A;  2AQ3 B;  4HIK A;  2AQ1 B;  3RZO B;  3A7A B;  3CPW A;  3HKZ G;  5CC4 A;  2A69 D;  3PO3 H;  1F9P A;  2JEA I;  3GTO B;  1NCV A;  1PH4 A;  1QG7 A;  2QDL A;  4DR7 L;  2OQK A;  1EUJ A;  3GTQ B;  3OOC A;  1KAW A;  1D1I A;  3EQL C;  4JI7 L;  3U9O A;  1G51 A;  3G7L A;  1TY0 A;  1M1K C;  1YVC A;  1K3R A;  4ZRZ A;  2XGT A;  3I91 A;  3HOW G;  3T1H Q;  1L1O A;  1VMC A;  2CHB D;  5C3E B;  2F0D A;  3NUC A;  2KEE A;  2KUM A;  4DV5 L;  3I4N H;  2XWB B;  2WV6 D;  1PVO A;  4EQO A;  3DM3 A;  2B2V A;  3J81 i;  3M4O H;  5EPL A;  5C4H A;  5I6Y A;  2EIF A;  2MGS A;  3CC4 A;  4JW0 A;  2JA9 A;  3AEV A;  4KMU C;  4A93 B;  1V9P A;  1HNZ Q;  2DN8 A;  2WB1 E;  3M4Y A;  3W5O A;  3I72 A;  3H94 A;  1VQ5 A;  3J81 c;  4XDX A;  5G3L D;  4DR3 L;  2MQH A;  1KD1 C;  2EY1 A;  2BDO A;  2R92 B;  4QF4 A;  2NWG A;  4J8Q A;  4UHV A;  3TRZ A;  5GAE C;  1HNX L;  5CV4 A;  1SYF A;  2NVT H;  3A56 A;  1BQQ T;  4RFB A;  1P8L A;  1U4L A;  1F2Y A;  4JI5 Q;  2F0K A;  3FKI B;  4OON A;  4ZYS A;  5I9O A;  4KJN A;  4LF4 Q;  1DD2 A;  4G57 A;  1WVL A;  3F8T A;  1BVS A;  1QNU A;  2CQA A;  5DM7 3;  4A3G H;  3HOU B;  4RGM A;  3EBE A;  3E5S A;  1Q86 C;  3V96 A;  1TWA B;  4CDF C;  2BA0 A;  2UXD Q;  2K7V A;  2KA7 A;  2JJQ A;  3BDL A;  4JI1 L;  3SE0 A;  5GAG C;  4WFN 3;  4A93 G;  2DJF C;  2EXZ A;  1FL0 A;  3CP0 A;  3CKI B;  4A3J B;  4C3H H;  2F1M A;  5KIX A;  4MIU A;  3T4A C;  3E6Z X;  3HOZ G;  2NTT A;  3SVM A;  2VUM B;  4OWW B;  2UUA Q;  4CJ0 B;  2ES2 A;  3RZD B;  3BDC A;  1JOK A;  3ULP A;  2F0M A;  2R92 G;  1D7Q A;  2DJG C;  1ASY A;  1J6Q A;  1KRS A;  1STH A;  3FDT A;  3P1H A;  1D8L A;  2IPK D;  3ERO A;  1SE2 A;  3PUX A;  1BUV T;  4K6D A;  5CYU A;  1PTO D;  1Y1V G;  1FVI A;  1SNP A;  3RUZ A;  3HOX H;  4JI2 Q;  4QY7 A;  3EIV A;  5AFW A;  3HGB A;  2K04 A;  1IYU A;  1W6J A;  2O2L D;  3NBI A;  3HKZ E;  1Y1W B;  1PH3 A;  1I4Q A;  2EY5 A;  1UE1 A;  4NXM L;  4OX9 Q;  3DWP A;  1AN8 A;  4PV1 C;  5JPM C;  1EY6 A;  1UWV A;  3K7A B;  3PIP A;  3F2D A;  1X9N A;  5IOC A;  2E74 C;  1KC8 C;  1JOR A;  3SGI A;  4IUU A;  3HFZ B;  1KNA A;  4A76 A;  5IGC A;  2XRS D;  2Y0S E;  4JYA Q;  5I2X A;  4C1N K;  3R2T A;  4QUF A;  3BYY B;  4GLA C;  4QMG A;  1XNR Q;  2YU9 H;  2GVA A;  4DV6 Q;  1AZQ A;  4FVM A;  1F77 A;  1GUT A;  4MN3 A;  1SE4 A;  3D4D A;  1DOK A;  5C44 H;  5JVH 3;  4H02 A;  4UP7 A;  1B3A A;  5E4X A;  2JK8 A;  3UE0 A;  4DR1 Q;  1O80 A;  4LUV A;  4KHP Q;  2CW0 D;  2CWA A;  4K2K A;  4DA2 A;  5L37 A;  1A8V A;  1B8A A;  4YWL A;  1Y1W G;  3MFG A;  4A3I H;  1K73 C;  4JI0 Q;  3S1N H;  5IGG A;  3ULL A;  2B63 H;  3TQY A;  1ZYR D;  4ODG A;  4K5V A;  5IYC H;  1VMP A;  4LAA A;  5FLM G;  3I4M B;  4AYB B;  2JEB I;  3A8K E;  1ZKO A;  3M9B A;  4LF9 Q;  4WJ3 M;  2AWO A;  4FO2 A;  4V0B A;  2R3Z A;  2YTY A;  4K8J A;  1A3T A;  3CD6 A;  4K8I A;  4NXN L;  1SMX A;  1G6P A;  1RF2 D;  2JXM B;  4P73 A;  3SHL A;  2FXQ A;  4A3K G;  2OCE A;  4WRD A;  4B3R L;  3Q22 A;  1M90 C;  4BY7 B;  5FLX c;  1FYC A;  1PDQ A;  2ZTE A;  4RHS A;  3JAM i;  3CU7 A;  5IP9 H;  1SNQ A;  3PUW A;  3S2H B;  4KHZ A;  3X3N A;  2UXB Q;  3T51 B;  1EY9 A;  3V05 A;  4LF8 Q;  2Q8T A;  1PRT C;  4BWG B;  3IFD A;  1PLF A;  1PH8 A;  2UUB Q;  4GNX C;  1DJR D;  1VQM A;  2EJM A;  4JI4 Q;  2RSO A;  4ULL A;  3HP3 A;  1PMR A;  3MEF A;  1FNU A;  2BE5 C;  1XMO L;  1SRO A;  4RCO A;  5ELD A;  4M8A A;  3DHQ A;  2Z6B A;  2VXW A;  4Y52 H;  2LSS A;  2CH4 W;  3CME A;  2L1B A;  2EYL A;  5J1Z A;  1RTN A;  1TR5 A;  4P74 A;  3OMC A;  1TU2 B;  3N6R A;  4AYB G;  5IE8 A;  4RKL A;  4OO1 H;  1I50 B;  5I6W A;  3G71 A;  4A75 A;  4K6L A;  4DV2 L;  2QDB A;  1XPR A;  1WI5 A;  5EPJ A;  1GD7 A;  4IOC A;  1YHQ A;  2BA1 A;  4GZY C;  5DM6 3;  3GTL H;  1VQE A;  3KLS X;  4P75 A;  5C3X A;  3T13 A;  2NZO A;  3CCU A;  5GQO A;  3S1Q H;  1H95 A;  5CV6 A;  1KQS A;  1HZ9 A;  2A68 C;  1A15 A;  2IHE A;  3J80 L;  3OHX C;  1BCP F;  1PZJ D;  1A0I A;  1S5B D;  3CQZ B;  3MXN B;  5D14 A;  4A3E H;  1CI3 M;  5DEH A;  2KEN A;  2EVB A;  4PQX A;  5EJW A;  2SNS A;  4DUY Q;  3KF6 B;  3FMC A;  2WAQ E;  4E6I A;  5CMD A;  4DK6 C;  2F0L A;  5CBA E;  1LUZ A;  3VYT A;  3ZYY X;  2E2H H;  3GV6 A;  4N9T A;  2M2L A;  4KJO A;  4AQY L;  5FJ8 H;  2Z9H A;  3VR4 A;  2NVX H;  4A3M H;  4DV7 L;  3HG9 A;  5EKK A;  1SNM A;  1K8A C;  2K5H A;  5IGD A;  4HIM A;  4OO1 I;  1EEF D;  2AKW B;  3SK5 A;  4JI8 L;  5COR A;  5KNB A;  2B39 A;  4RWS C;  1MI2 A;  4R1J A;  1IBK Q;  3VR3 A;  1YJ9 A;  3CCJ A;  4DNR B;  3C2P A;  2UXC Q;  5C4X H;  5M3M H;  4KKS A;  1ILP A;  3PV0 A;  2KJX A;  3RD4 A;  1BO0 A;  3QIA A;  2FJ2 A;  5DAU A;  3U58 A;  1M4V A;  3K7U C;  1YNX A;  1KDC A;  3A7L A;  3SEB A;  1ILQ A;  2BH2 A;  1O7I A;  1EQQ A;  3JC6 6;  1LM0 A;  2F03 A;  4CKC A;  2E2I H;  1JE4 A;  4QQB X;  2OT2 A;  2JA7 B;  3S1R B;  2DY7 A;  2RDH A;  3GP7 A;  3HOU H;  4DR2 L;  4PMW A;  2QEJ C;  3UDG A;  1HFN A;  1BBX C;  2NVQ H;  4EVO A;  3MAQ A;  1EIG A;  3S14 H;  4GNX A;  4TVA B;  1VQ7 A;  3QOL A;  1GKH A;  1WTH A;  1GVP A;  1YHA A;  2NB0 A;  3F1Z A;  1STE A;  3NTK A;  1Q8K A;  5IGB A;  5AJ3 Q;  3GTK B;  1TXY A;  5J39 A;  4DV1 Q;  4FF1 A;  2RQX A;  3VR6 A;  5JVG 3;  2HD3 A;  2ZT9 C;  1BCP D;  1IZ6 A;  2ICE C;  4QIW B;  2ZM6 L;  3R8B A;  1XNQ Q;  4DAY B;  3S16 H;  4LF7 Q;  4R4O A;  1STB A;  5T1I A;  2UU9 L;  2PQA B;  1Q81 C;  4N8F A;  1U4R A;  4LFC L;  3QJY A;  1VQP A;  4DR4 L;  1YI2 A;  4KKT A;  2OTJ A;  2EXD A;  2N88 A;  1IBL Q;  2J4X A;  2IHF A;  2JQO A;  5IGE A;  3EFX D;  3BYT B;  4QUC A;  3HOV H;  3KLR A;  1QIL A;  3H0G B;  4PMC A;  5DLQ E;  3PMF A;  4CDD C;  3G4S A;  4A3B B;  1SYC A;  5C5M A;  1GUW A;  5H1S E;  2K52 A;  4C2M B;  1V1P B;  4IUT A;  2K33 A;  4IPH A;  1I6V C;  3RN2 A;  4DU9 A;  1HCZ A;  3S2D B;  2R93 B;  3NBH A;  4EQ5 A;  3OW2 A;  2EYO A;  3MXG A;  1KNE A;  2E5L Q;  4BY1 B;  5LMN L;  1X65 A;  1STG A;  2G9H D;  4JV5 Q;  1VQ9 A;  1L1O B;  2WB1 B;  5I2Y A;  1EY8 A;  2RBM A;  3OTO Q;  4UP8 A;  3GTM H;  4JI6 L;  1L0X B;  4FF3 A;  3VR5 A;  5C6A A;  3K57 A;  2A68 D;  3STB C;  4A3F G;  3B6Y A;  4LF5 Q;  1NNX A;  4JPB W;  3ONA B;  1EY5 A;  3AB9 A;  2RDF A;  4IUV A;  4A4I A;  4DV3 Q;  3PO2 B;  1EFW A;  3NPP A;  1I4X A;  4UDU C;  1B50 A;  4X64 L;  1HNW L;  2SOB A;  4KY5 A;  4ILW A;  1MGS A;  5FKA C;  4KI0 A;  4A3B G;  1Z6H A;  3CCL A;  2JA8 B;  2H1E A;  1MJC A;  1V43 A;  5FO7 B;  3TP5 A;  1C0A A;  1B1Z A;  2JA5 B;  2A6H C;  2WIN B;  4YY3 L;  3W2D A;  2VB3 X;  4M1U B;  4IFD H;  1TT2 A;  1SE8 A;  2MPM A;  1F9S A;  1LO5 D;  1Y14 B;  4YCV A;  1WTO A;  2VQF L;  1EWH A;  4L5S A;  3I90 A;  3S1M H;  1GUN A;  2ZXP A;  3D8G A;  4QB4 A;  3N52 A;  1SAP A;  3TSS A;  2K5W A;  3OWE B;  1U4M A;  2WB1 G;  4Q0F A;  3AMU A;  4PZ6 A;  1KDB A;  1AE3 A;  4YWM A;  4NKL A;  2EYM A;  4FDB A;  3VYR A;  1SND A;  1D2B A;  3P20 A;  1SMY C;  3MTS A;  1IYV A;  3QO2 A;  2K32 A;  2HIX A;  3M4Q A;  4ZQ3 A;  3HOY H;  1IW7 C;  4BXX G;  1VQF A;  5IYB H;  2QA4 A;  1K8M A;  1IHZ A;  1PXU A;  3OSO A;  1DOM A;  3KJO A;  3J80 i;  1NBW A;  3RMH A;  3D4R A;  4K0K Q;  2O5J C;  2L5T A;  4L5T A;  2JA8 G;  3NP8 A;  2E2J B;  4ME5 A;  3FEW X;  3IKJ A;  3E9I A;  1Z47 A;  1TWF H;  5JJI A;  4IFD I;  3HKZ B;  4DV0 Q;  3L9A X;  4JI5 L;  2A5H A;  3J80 c;  3PO3 B;  2IX3 A;  1HHV A;  1MKH A;  2VQE L;  4NP5 A;  2NYZ D;  5EBD A;  1V8Q A;  2A1A A;  4X3U A;  4DF7 A;  4A3L H;  1HR0 Q;  2N3S A;  5C0X H;  1DYQ A;  1VQB A;  2MUY A;  2GVB A;  1TWG H;  2L9H A;  3DUZ A;  3TP6 A;  3HOW B;  3FVQ A;  4RH6 A;  1PH5 A;  2QF7 A;  1VQO A;  1ESR A;  3T1Y Q;  4FF2 A;  4JCV E;  4BBR H;  1W6K A;  5C5L A;  1JWS D;  1BDO A;  4GKJ Q;  3Q0A A;  1BBU A;  1VQH A;  1EQV A;  1F2L A;  4KN4 C;  2KCM A;  5DNF A;  2VB2 X;  1EWC A;  4YHH L;  2NZH A;  2XVS A;  2HUG A;  4XYO A;  1XX8 A;  3BU2 A;  4B3S Q;  3HKS A;  1I6H H;  2K50 A;  3AYH B;  4DK3 C;  1TVX A;  1V1O A;  3PO3 G;  2KHI A;  3C46 A;  1N33 L;  1A3V A;  3KJP A;  2QIL A;  2DNC A;  5M3F H;  3NXW A;  1C48 A;  5C0X I;  3OYY A;  5KGU A;  1B9N A;  5CV5 A;  5LL6 X;  2MJ8 A;  3MVV A;  4DUZ Q;  3TBI B;  1H9K A;  2RHS B;  2Y0S G;  3QOJ A;  3K80 C;  4I7A A;  2RF4 A;  2K05 A;  3H09 A;  1PTO F;  4L5R C;  5F2D A;  2RSN A;  3I4N G;  1K83 H;  1T9H A;  4A3G B;  2CKZ B;  3A5Z B;  4Q5V A;  1R4Q B;  4R4T A;  2PNH A;  1LT6 D;  1F9R A;  4DV4 Q;  3Q8D A;  4I7Z C;  4PZ8 A;  1PH2 A;  4LUO A;  4QL5 A;  1OXX K;  4APV A;  5BR8 Q;  1HR0 W;  4GN3 B;  5KYL A;  4O2D A;  1EQT A;  2HCI A;  4JC0 A;  4V19 0;  3I55 A;  1N36 L;  3HOZ B;  4X6A H;  4TSS A;  5KND A;  4ZCK A;  4GN5 A;  4KKU A;  4DR1 L;  1SR3 A;  3A8I E;  3I7F A;  1JOQ A;  4FP5 D;  4KD3 A;  2TSS A;  1SEB D;  1YHB A;  2OQ0 A;  1MBY A;  1RDP D;  2FFK B;  4HSP A;  1QUQ B;  1R9T H;  1LTT D;  3CC7 A;  1ROD A;  2AUJ D;  1Y1V B;  4GOP A;  4LF6 Q;  3MFY A;  4R8I A;  1QZG A;  2ZJQ A;  3K5L A;  3RZO H;  2E75 C;  1ENA A;  4OXP A;  1W3S A;  2CWP A;  2I07 B;  3GTO H;  4A3G G;  3U4V A;  1N34 L;  2F0E A;  1H9S B;  3I73 A;  3KLS A;  1CHP D;  4XQN A;  1SXT A;  1SMY D;  1CM9 A;  2D0O A;  2ENB A;  4XIG S;  4LMQ D;  3UDF A;  4WJ4 A;  4X66 Q;  1Q82 C;  4LFA Q;  1ICW A;  2PNR C;  1UEA B;  1U4P A;  3OMG A;  4DAP A;  5KNC A;  1UUP A;  1Q90 A;  2CFM A;  5C3E H;  1GHK A;  3GD7 A;  2Q2T A;  4C3J B;  5T1G A;  2NVY H;  1HZB A;  5EAY A;  1RIP A;  4X62 L;  4HIO A;  2OXP A;  4LF8 L;  3K81 C;  3LGJ A;  1EWI A;  3LX0 A;  2AMC B;  4A3C H;  4X3K A;  2WP8 J;  2KCT A;  2KCC A;  5C44 B;  5J22 A;  2A74 C;  2Q2I A;  2D5D A;  3UDI A;  2PQE A;  3RLN A;  3ZJY C;  1K0R A;  2HHH Q;  4GKK L;  1O7L A;  4B3M Q;  3HOX G;  1QOH A;  2QEX A;  5M5X B;  2N78 A;  2XRQ D;  4IJL A;  3OW7 A;  4PG3 A;  5KYI A;  3FPP A;  4A3I B;  1PFN A;  4HSV A;  3S1N B;  4XT3 B;  3K0X A;  2R7Z B;  1IBM L;  2C5C A;  5KEE A;  4RG1 A;  3J7Y W;  4YCW A;  2EYJ A;  5IT9 L;  3CPF A;  1ICF B;  5IWA L;  5IT9 E;  2IX0 A;  1QVF A;  5GAD C;  1JJ2 A;  2XN9 C;  4BS9 A;  3FKI H;  1TWC B;  1HXY D;  2VZA A;  2WAQ G;  1LTL A;  4L63 B;  1BCP B;  2TMP A;  3MXU A;  4C3J G;  4DR7 Q;  3CMA A;  4DNT B;  1DM0 B;  1IYJ B;  1J9O A;  4JI3 L;  4H0L C;  1I94 L; 
#chains in the Genus database with same CATH homology
 1AP0 A;  2F0G A;  2FMM A;  4A3K B;  1I3Q B;  2F3W A;  3L7Z C;  1JQY D;  2KVM A;  1U9R A;  1D5X C;  1DOL A;  4PNY A;  2HCC A;  4K2L A;  3NQI A;  1AEX A;  3GTP B;  1QCB D;  2L12 A;  2NBF A;  1RJT A;  1X3Q A;  2F0H A;  2X6G A;  2LKV A;  5IGF A;  1QWY A;  1D5M C;  1WTP A;  1EOT A;  3K0Y A;  3MA2 B;  2YYZ A;  2BOS A;  1XYI A;  3X3M A;  2NN6 H;  3M7G A;  4HED A;  3BS1 A;  1JR0 D;  3NQT A;  2Z8L A;  2B2Y C;  3NSW A;  3GTL B;  1C4Q A;  1HQM C;  3S1Q B;  4CJ1 B;  1SNO A;  5JEA H;  1I4H A;  2JYO A;  2F0I A;  2ID0 A;  4A3E B;  3ERQ A;  3EA6 A;  4DGZ A;  1JB3 A;  5JPN C;  3C3L A;  5LHY 1;  5M5Y B;  4K5X A;  3SDZ A;  1B2T A;  1ML0 D;  5A35 A;  3MZ5 A;  4CHT B;  2K5Q A;  5D3I B;  4IUR A;  1QNK A;  2E2H B;  1K8O A;  1GOZ A;  3D6C A;  2NVX B;  4A3M B;  5A2Q L;  2B2T C;  1G91 A;  5A2Q E;  4XT1 B;  2NN6 I;  4OO1 G;  3M3Y B;  2K5D A;  4WJW A;  3K5M A;  3CHB D;  1GUG A;  3KUP A;  2H4O A;  2PPB C;  4TQU S;  4C56 C;  2RA4 A;  3QB3 A;  4XQQ A;  1CA5 A;  4X3S A;  1G2T A;  2ICI A;  1YNN C;  3PUZ A;  1LAC A;  4O42 A;  5C4J B;  3TME A;  4YIJ A;  1E2W A;  1TS2 A;  5NUC A;  2NUC A;  3BG3 A;  1LTA D;  1FR3 A;  4TRD A;  1DZ1 A;  1G6Z A;  1VF5 C;  4CKE A;  2NVQ B;  3OWF A;  5BN4 A;  1Z7T A;  3ITP A;  1PRT F;  4RGT A;  4DXG A;  4B9X A;  5I9P A;  5E4W C;  2B2W C;  2PW5 A;  1SFO B;  3WOF A;  4I65 A;  2F0W A;  1AW7 A;  2K6A A;  4XTC S;  3GO5 A;  4N9P A;  4IQZ A;  4S3S A;  3ND9 A;  3RLF A;  1JIC A;  2F0O A;  3S17 B;  1A2T A;  4HN7 A;  3WDN A;  2F0V A;  1EY7 A;  4Y7N B;  1EY0 A;  3BDO A;  2QKI C;  4Z9C B;  1FNW A;  4HAE A;  5TSS A;  3UI2 A;  1S5C D;  4IFD J;  3K59 A;  5EKI A;  1L0Y B;  5CV7 A;  5K5P A;  3HOV B;  3H3V C;  1S5D D;  3SK8 A;  1B44 D;  1MD2 D;  4K5W A;  1RKN A;  4DXF A;  4MHE A;  1J8I A;  1LTB D;  2LY7 A;  2B2T A;  1SYE A;  4R8N A;  4IUQ A;  2IX1 A;  1D1K A;  4IZ8 A;  4RHR A;  3A55 A;  1F9Q A;  2B2U C;  3KBX A;  1RTO A;  5EBC A;  3VYS A;  2L4N A;  2Z4I A;  1LTR D;  4A3F B;  3HS0 C;  4G7Z C;  1GJX A;  4EGV A;  3MC0 B;  4UAI A;  4ID6 A;  1PRT D;  3BVG A;  4DFA A;  5M9O A;  3BZD B;  4DK1 A;  3OPO A;  5C0X J;  1Q1E A;  1F2Z A;  1DXM A;  2BE5 D;  3LNN A;  1HA5 A;  4RGO S;  3DWA A;  3LWU A;  1CQV A;  1GXD C;  3GQB A;  5D65 A;  4DN4 M;  5BN3 A;  3QWN A;  4QCL A;  1HFG A;  2F0U A;  3DMU A;  2SDF A;  5CR3 A;  1BR9 A;  2B2W A;  1KLG D;  3S1M B;  1UAP A;  3E0J A;  4IUN A;  2A69 C;  1KDA A;  1LAB A;  3KBG A;  2EDG A;  4BA2 I;  4XYQ A;  4OIK A;  3R3O A;  1PFM A;  1FGB D;  1HUM A;  5ELC A;  2KCN A;  5ISR A;  4BA1 I;  5EQ0 A;  2SNM A;  4F7X A;  1STY A;  1EZ6 A;  1TWF B;  5CV9 A;  1I4R A;  3FPU B;  1FD7 D;  1I4P A;  4J1M A;  3J7A F;  1VDZ A;  4IFD G;  3C1E A;  1EYA A;  2BDN A;  2K03 A;  5EPK A;  1G29 1;  2AUK A;  2F0N A;  1PTO B;  3T16 A;  3D4W A;  5JJZ A;  4XXE A;  1TWH B;  4TKO B;  4HTH A;  5M5W B;  1PFB A;  3A54 A;  1LT4 D;  2B2U A;  1LV9 A;  2PZW A;  4WOR A;  1NR4 A;  4F87 A;  2X6L A;  1B53 A;  2EOT A;  1HTL D;  2E76 C;  5CBE E;  4FXG C;  3PUV A;  3S9W A;  5HUR A;  1QJO A;  3GTJ B;  4KV6 A;  2V4D A;  2K28 A;  2XIW A;  1SNC A;  2PYK A;  1FNV A;  1PZK D;  4X3T A;  5C0X G;  4JBW A;  3BVZ A;  1S5E D;  5K36 H;  2XNA C;  3I70 A;  2Y0S B;  4F88 A;  1GUO A;  5BN5 A;  3I4N B;  1K83 B;  2Q8R E;  4NDX A;  1TS4 A;  1IKM A;  5COY A;  3M4O B;  1XTC D;  2Z1C A;  1STA A;  1CZW A;  1TKW B;  3C1F A;  1PZI D;  5FLX L;  3NE5 B;  4XQJ A;  4DAY A;  2I46 A;  5FLX E;  3D6W A;  3OIQ A;  2AQ2 B;  2J7Z A;  5C3W A;  2Q8I B;  3H6M A;  2F0F A;  1NAP A;  2HDL A;  2KHS A;  2XWJ B;  2DY8 A;  1ZXT A;  4NW2 A;  3Q23 A;  2NVT B;  3T53 B;  3DEO A;  3DM1 A;  1T5E A;  1BF4 A;  1SYG A;  3IL8 A;  1V1P A;  3TZU A;  2JE6 I;  3TDQ A;  2PCF B;  4ZUJ A;  1JOO A;  2LFN A;  3BVM A;  1Q8I A;  2CW0 C;  5E3F A;  4OIJ A;  2MP1 A;  3EJI A;  1X32 A;  2PZT A;  4L8J A;  2D62 A;  1ZYR C;  4C3H B;  1G2S A;  1E2Z A;  3DXJ C;  2NVY B;  3IFT A;  4ZKC B;  3MHB A;  2B8F A;  1TQO A;  3AU7 A;  1E2V A;  2NZ1 D;  2WKC A;  2A6H D;  3Q24 A;  1A3U A;  2PO4 A;  2EY6 A;  2EJG C;  3VR2 A;  1M8A A;  3K5O A;  5IOD A;  1S5F D;  2A6E C;  1SDF A;  1RD9 D;  4H44 C;  3HOX B;  4HCS A;  4C1N I;  1II3 A;  1Q12 A;  1BNZ A;  4K14 A;  2A73 B;  2PZU A;  1TS3 A;  2IWH A;  1OXV A;  5JEA J;  2F4I A;  3HRZ C;  1Y8O B;  1CQF A;  1IW7 D;  2B8G A;  4RAU C;  2WAQ B;  3NTH A;  4C3H G;  1RCV D;  1JWU D;  3VA5 A;  1TS5 A;  4FXD A;  3Q6S A;  1SJE D;  3GV3 A;  1LT5 D;  2YU9 B;  1H9M A;  4KY6 A;  4ZUI A;  3TP8 A;  1KTK A;  4IN3 A;  2KOL A;  2EJF C;  1VF7 A;  3K6O A;  5FO8 B;  2G9D A;  3MWY W;  1LLR D;  4RKB A;  2FIN B;  3T56 B;  1STN A;  5IIF A;  2B63 B;  3F2U A;  4KTA A;  1JCK B;  3MEH A;  2MHV A;  3SR1 A;  1EZ8 A;  2F0T A;  2AWN A;  1IL8 A;  1CFM A;  1OXS C;  2FHT A;  1YNJ C;  4JK1 C;  1DCZ A;  1TY2 A;  2DNE A;  4BBS B;  4ZKB B;  1EYD A;  4HMJ A;  1HRJ A;  4FNF A;  4ZK9 B;  5CGK A;  3FRP B;  1CT1 D;  2RKS A;  1PRT B;  2PMZ B;  1D5Z C;  1ESF A;  1Q3L A;  2IL8 A;  3KK7 A;  3PUY A;  2RVL A;  1XWE A;  1ONL A;  1KAB A;  3SXH A;  4ABN A;  1NR2 A;  4OHJ A;  5JOB A;  2C9O A;  3GTG B;  5EKL A;  3A8J E;  4LJZ C;  2NN6 G;  2RDG A;  5FK9 C;  4H7B A;  1E0B A;  4IAL A;  1GUS A;  4J6H A;  5JEA G;  4G7O C;  1R4P B;  3EVQ A;  4L6T B;  1WTW A;  1BCP C;  2QCP X;  3QG1 A;  2SEB D;  3NTI A;  1NUC A;  5E1F A;  1EIH A;  1ET9 A;  2KQ3 A;  2A6E D;  2O4X A;  3G6J B;  3I3C A;  2GA4 B;  4FYD A;  2BCO A;  4CGY B;  4EQN A;  2ZXR A;  1ENC A;  1O7Z A;  3CRK C;  2J0T D;  2F3V A;  2JP1 A;  2HQE A;  2KED A;  5M3M B;  5C4X B;  3PIO 3;  4DAV A;  1SYB A;  1ENF A;  1H9S A;  1KLU D;  2F0J A;  4OGQ C;  5FO9 B;  1AFP A;  2E2I B;  3J7A V;  2EYH A;  1TII D;  4KK7 A;  1T5X D;  2WKD A;  4F8M A;  1Q1B A;  3S14 B;  3J80 E;  3TZD A;  4KN7 C;  1BOS A;  1HTP A;  1HUN A;  4HR7 B;  2JA6 B;  3HZX A;  1UNS A;  1JC7 A;  1DON A;  1WTQ A;  1G8Z D;  2JSO A;  5I4D A;  1F2M A;  3U9S A;  2EZV A;  3L3O C;  1WCM B;  2E2D C;  2L55 A;  1LTS D;  1YNJ D;  1LTI D;  2B2Y A;  3NWT A;  3S16 B;  1OXT A;  3R2I A;  1EL0 A;  2F0P A;  4DK0 A;  1ET6 A;  1VCI A;  2IJ0 A;  3P75 A;  1Y69 U;  3M85 A;  1XXG A;  4LK1 C;  3ND8 A;  1CA6 A;  4RCN A;  1WD1 A;  2EY2 A;  1CTM A;  2EPB A;  2R61 A;  4FXK C;  4CJ2 C;  1CK1 A;  1SE3 A;  5LL6 S;  3D31 A;  1SBB B;  2NTS A;  3SK6 A;  5ELF A;  4CKB A;  1OXU A;  3SK4 A;  3GTM B;  1SYD A;  4EQP A;  2WAC A;  1EU4 A;  4HCE A;  3P7J A;  2ZXO A;  3J81 L;  5C4Z A;  1MSG A;  3J81 E;  2LS0 1;  1O78 A;  2WII B;  2N55 A;  3M7N A;  4RGN A;  2OEO A;  3I8Z A;  4HMI A;  3H91 A;  2IT1 A;  1CZG A;  3MXP A;  5JAV A;  3W3A A;  2OF1 A;  1BXT A;  2D2C C;  2M9V A;  4RA8 A;  3R93 A;  1ZEQ X;  5HGT A;  1GHJ A;  3KF8 A;  1YNN D;  3D3R A;  4G4K A;  4CBV A;  2F0Q A;  3I4L A;  3HOY B;  3NK9 A;  1MSH A;  1I4G A;  4H13 C;  2L11 A;  3VYU A;  3DWQ A;  1AZP A;  1IKL A;  1C8C A;  1EYC A;  2F0S A;  1CHQ D;  4FF4 A;  3MXN A;  3DEP A;  4B08 A;  3S15 B;  1NSN S;  1A6X A;  3IAY A;  4KY7 A;  4IUP A;  1S4Z A;  1D6E C;  1SSO A;  1EY4 A;  4P2C B;  3URY A;  3NHH A;  5KRU A;  1TWG B;  4A3D B;  1Y8N B;  5D3D A;  2Z4H A;  1EEI D;  4BBR B;  3CRL C;  5EGT A;  1HA6 A;  2M00 A;  3OIP A;  1SJH D;  3NWS A;  2B2V C;  1WTR A;  3K5N A;  3K58 A;  1B4O A;  4C3I B;  1O7Y A;  2IW3 A;  3PIP 3;  1Y8P B;  1I6H B;  1H9J A;  4R9W A;  2D9U A;  4PMB A;  5M3F B;  4ZLT F;  2EYF A;  1QB5 D;  3LWE A;  4B9W A;  1OO9 B;  1QE6 A;  1EU3 A;  1HPC A;  5K36 G;  1WD0 A;  3HEJ A;  2FMC A;  2X69 A;  2LMC B;  3VA7 A;  5CV8 A;  5G3L F;  1H9R A;  1A2U A;  3V2T A;  1PTO C;  1LT3 D;  4O1N A;  1PTO H;  1JWM D;  4KD4 A;  3WOE A;  1X3P A;  5ELB A;  1HQR D;  2HDM A;  4OL7 A;  4NMZ A;  2EE1 A;  1WTX A;  2CVR A;  5ELE A;  1KAA A;  2VNU D;  1EFI D;  4C3I G;  1PYW D;  2L0C A;  1WTV A;  4U68 A;  2KEC A;  3TN2 A;  5FOB B;  4G7H C;  2R6G A;  2K01 A;  1B9M A;  2XSC A;  3O13 A;  3JAM L;  3TP7 A;  4U67 3;  2PW7 A;  4KHV A;  2EYP A;  3JAM E;  2O5I C;  1R9T B;  2K1B A;  4ZAI A;  1LTG D;  1RHP A;  2AQ3 B;  2AQ1 B;  3RZO B;  3A7A B;  5CC4 A;  2A69 D;  1F9P A;  2JEA I;  3GTO B;  1NCV A;  1QG7 A;  3GTQ B;  3OOC A;  1D1I A;  3EQL C;  3U9O A;  3G7L A;  1TY0 A;  4ZRZ A;  3I91 A;  1VMC A;  2CHB D;  5C3E B;  2F0D A;  3NUC A;  2KEE A;  2KUM A;  2XWB B;  2WV6 D;  4EQO A;  2B2V A;  5EPL A;  5C4H A;  5I6Y A;  2MGS A;  4KMU C;  4A93 B;  2DN8 A;  3M4Y A;  3I72 A;  3H94 A;  4XDX A;  5G3L D;  2EY1 A;  2BDO A;  2R92 B;  4QF4 A;  2NWG A;  4J8Q A;  5CV4 A;  1SYF A;  3A56 A;  1BQQ T;  4RFB A;  1U4L A;  1F2Y A;  2F0K A;  3FKI B;  4ZYS A;  5I9O A;  4KJN A;  1DD2 A;  4G57 A;  1WVL A;  1QNU A;  2CQA A;  5DM7 3;  3HOU B;  4RGM A;  3E5S A;  3V96 A;  1TWA B;  2BA0 A;  2K7V A;  2KA7 A;  3BDL A;  3SE0 A;  4WFN 3;  2EXZ A;  4A3J B;  3CKI B;  2F1M A;  5KIX A;  4MIU A;  3T4A C;  3E6Z X;  2NTT A;  3SVM A;  2VUM B;  4CJ0 B;  3RZD B;  3BDC A;  1JOK A;  2F0M A;  1STH A;  3FDT A;  3P1H A;  2IPK D;  3ERO A;  1SE2 A;  3PUX A;  1BUV T;  4K6D A;  5CYU A;  1PTO D;  3RUZ A;  1SNP A;  5AFW A;  3HGB A;  2K04 A;  1IYU A;  1W6J A;  2O2L D;  3NBI A;  1Y1W B;  1I4Q A;  2EY5 A;  3DWP A;  1AN8 A;  4PV1 C;  5JPM C;  1EY6 A;  3K7A B;  5IOC A;  2E74 C;  1JOR A;  4IUU A;  1KNA A;  5IGC A;  2XRS D;  5I2X A;  4C1N K;  3R2T A;  4QUF A;  3BYY B;  4QMG A;  1AZQ A;  4FVM A;  1F77 A;  1GUT A;  4MN3 A;  1SE4 A;  3D4D A;  1DOK A;  5JVH 3;  1B3A A;  5E4X A;  1O80 A;  2CW0 D;  4K2K A;  4DA2 A;  3MFG A;  5IGG A;  1ZYR D;  4ODG A;  4K5V A;  1VMP A;  4LAA A;  3I4M B;  4AYB B;  2JEB I;  3A8K E;  1ZKO A;  2AWO A;  4FO2 A;  4V0B A;  2R3Z A;  4K8J A;  1A3T A;  4K8I A;  1RF2 D;  2JXM B;  3SHL A;  4WRD A;  3Q22 A;  4BY7 B;  1FYC A;  1PDQ A;  4RHS A;  3CU7 A;  1SNQ A;  3PUW A;  3S2H B;  4KHZ A;  3X3N A;  3T51 B;  1EY9 A;  3V05 A;  2Q8T A;  1PRT C;  4BWG B;  3IFD A;  1PLF A;  1DJR D;  2EJM A;  2RSO A;  4ULL A;  3HP3 A;  1PMR A;  1FNU A;  2BE5 C;  5ELD A;  4RCO A;  4M8A A;  3DHQ A;  2VXW A;  2L1B A;  2EYL A;  5J1Z A;  1RTN A;  1TR5 A;  3OMC A;  1TU2 B;  3N6R A;  4RKL A;  4OO1 H;  1I50 B;  5I6W A;  4K6L A;  2QDB A;  5EPJ A;  2BA1 A;  4GZY C;  5DM6 3;  5C3X A;  3KLS X;  3T13 A;  5CV6 A;  2A68 C;  1A15 A;  3J80 L;  3OHX C;  1BCP F;  1PZJ D;  1S5B D;  3CQZ B;  5D14 A;  1CI3 M;  5DEH A;  2EVB A;  4PQX A;  5EJW A;  2SNS A;  3FMC A;  5CMD A;  4E6I A;  2F0L A;  5CBA E;  3VYT A;  3ZYY X;  3GV6 A;  4N9T A;  2M2L A;  4KJO A;  3VR4 A;  3HG9 A;  5EKK A;  1SNM A;  5IGD A;  4OO1 I;  1EEF D;  3SK5 A;  5COR A;  5KNB A;  2B39 A;  4RWS C;  1MI2 A;  3VR3 A;  3C2P A;  4DNR B;  1ILP A;  4KKS A;  3PV0 A;  2KJX A;  3RD4 A;  1BO0 A;  3QIA A;  2FJ2 A;  5DAU A;  1M4V A;  1KDC A;  3A7L A;  3SEB A;  1ILQ A;  2F03 A;  4CKC A;  1JE4 A;  2OT2 A;  2JA7 B;  3S1R B;  2DY7 A;  2RDH A;  3GP7 A;  4PMW A;  2QEJ C;  1HFN A;  1BBX C;  4EVO A;  3MAQ A;  1EIG A;  3QOL A;  2NB0 A;  1STE A;  3NTK A;  5IGB A;  3GTK B;  5J39 A;  4FF1 A;  2RQX A;  3VR6 A;  5JVG 3;  2ZT9 C;  1BCP D;  2ICE C;  4QIW B;  3R8B A;  1STB A;  5T1I A;  1U4R A;  3QJY A;  4KKT A;  2N88 A;  2J4X A;  5IGE A;  3EFX D;  3BYT B;  4QUC A;  3KLR A;  1QIL A;  3H0G B;  4PMC A;  4A3B B;  3PMF A;  1SYC A;  5C5M A;  1GUW A;  4C2M B;  1V1P B;  4IUT A;  2K33 A;  1I6V C;  4DU9 A;  1HCZ A;  3S2D B;  2R93 B;  3NBH A;  2EYO A;  3MXG A;  1KNE A;  4BY1 B;  1STG A;  2G9H D;  2WB1 B;  5I2Y A;  1EY8 A;  2RBM A;  1L0X B;  4FF3 A;  3VR5 A;  5C6A A;  3K57 A;  2A68 D;  3ONA B;  1EY5 A;  3AB9 A;  2RDF A;  4IUV A;  3PO2 B;  3NPP A;  1I4X A;  4UDU C;  1B50 A;  2SOB A;  4KY5 A;  4ILW A;  1MGS A;  5FKA C;  4KI0 A;  1Z6H A;  2JA8 B;  2H1E A;  1V43 A;  5FO7 B;  3TP5 A;  1B1Z A;  2JA5 B;  2A6H C;  2WIN B;  3W2D A;  2VB3 X;  4M1U B;  4IFD H;  1TT2 A;  2MPM A;  1F9S A;  1LO5 D;  1WTO A;  1EWH A;  3I90 A;  1GUN A;  2ZXP A;  3D8G A;  4QB4 A;  3N52 A;  1SAP A;  3TSS A;  2K5W A;  3OWE B;  1U4M A;  4Q0F A;  3AMU A;  1KDB A;  4NKL A;  2EYM A;  3VYR A;  1SND A;  1D2B A;  3P20 A;  1SMY C;  3MTS A;  1IYV A;  3QO2 A;  2K32 A;  4ZQ3 A;  1IW7 C;  1K8M A;  1IHZ A;  1PXU A;  3OSO A;  1DOM A;  3RMH A;  2O5J C;  3D4R A;  2L5T A;  3NP8 A;  2E2J B;  4ME5 A;  3FEW X;  3IKJ A;  1Z47 A;  4IFD I;  3HKZ B;  3L9A X;  2A5H A;  3PO3 B;  2IX3 A;  1HHV A;  4NP5 A;  2NYZ D;  5EBD A;  1V8Q A;  4X3U A;  4DF7 A;  5C0X H;  1DYQ A;  2MUY A;  2L9H A;  3DUZ A;  3TP6 A;  3HOW B;  3FVQ A;  4RH6 A;  2QF7 A;  1ESR A;  4FF2 A;  1W6K A;  5C5L A;  1JWS D;  1BDO A;  3Q0A A;  1EQV A;  1F2L A;  4KN4 C;  5DNF A;  2VB2 X;  1EWC A;  2XVS A;  2HUG A;  4XYO A;  1XX8 A;  1TVX A;  1V1O A;  3C46 A;  1A3V A;  2QIL A;  2DNC A;  3NXW A;  1C48 A;  5C0X I;  5KGU A;  1B9N A;  5CV5 A;  5LL6 X;  2MJ8 A;  3MVV A;  3TBI B;  1H9K A;  3QOJ A;  2K05 A;  3H09 A;  1PTO F;  5F2D A;  2RSN A;  4A3G B;  4Q5V A;  1R4Q B;  1LT6 D;  1F9R A;  4I7Z C;  1OXX K;  5KYL A;  1EQT A;  2HCI A;  4V19 0;  3HOZ B;  4TSS A;  5KND A;  4KKU A;  3A8I E;  1JOQ A;  4KD3 A;  4FP5 D;  2TSS A;  1SEB D;  1MBY A;  1RDP D;  2FFK B;  4HSP A;  1LTT D;  1ROD A;  2AUJ D;  1Y1V B;  3MFY A;  4R8I A;  3K5L A;  2E75 C;  1ENA A;  2I07 B;  2F0E A;  1H9S B;  3I73 A;  3KLS A;  1CHP D;  4XQN A;  1SXT A;  1SMY D;  1CM9 A;  2ENB A;  4XIG S;  4LMQ D;  1ICW A;  2PNR C;  1UEA B;  1U4P A;  3OMG A;  4DAP A;  5KNC A;  1UUP A;  1Q90 A;  1GHK A;  3GD7 A;  4C3J B;  5T1G A;  2OXP A;  3LX0 A;  4X3K A;  2WP8 J;  2KCC A;  5C44 B;  5J22 A;  2A74 C;  2D5D A;  2PQE A;  1O7L A;  1QOH A;  5M5X B;  2XRQ D;  3OW7 A;  5KYI A;  3FPP A;  4A3I B;  1PFN A;  4HSV A;  3S1N B;  4XT3 B;  2R7Z B;  2C5C A;  5KEE A;  3J7Y W;  2EYJ A;  5IT9 L;  5IT9 E;  2IX0 A;  2XN9 C;  4BS9 A;  1TWC B;  1HXY D;  4L63 B;  1BCP B;  2TMP A;  3MXU A;  4C3J G;  4DNT B;  1DM0 B;  1J9O A;  4H0L C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...