2B2TA

Tandem chromodomains of human chd1 complexed with histone h3 tail containing trimethyllysine 4 and phosphothreonine 3
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
176
structure length
176
Chain Sequence
EEFETIERFMDCRIGRKGATGATTTIYAVEADGDPNAGFEKNKEPGEIQYLIKWKGWSHIHNTWETEETLKQQNVRGMKKLDNYKKKDQETKRWLKNASPEDVEYYNCQQELTDDLHKQYQIVGRIIAHSNQKSAAGYPDYYCKWQGLPYSECSWEDGALISKKFQAMIDEYFSRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Peptide binding protein
molecule keywords Chromodomain-helicase-DNA-binding protein 1
publication title Double chromodomains cooperate to recognize the methylated histone H3 tail.
pubmed doi rcsb
source organism Homo sapiens
total genus 49
structure length 176
sequence length 176
chains with identical sequence B
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2005-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2b2tA02
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2b2tA01
2J7ZA 1WTQA 2B2UC 2H1EA 3GV6A 1RTOA 1HFGA 1J9OA 1M8AA 2B2WA 2B2VA 4ZAIA 5T1GA 1CA5A 1X3PA 5D65A 1ICWA 1WD0A 4XT1B 1ILQA 1BO0A 2M2LA 3I3CA 2RSNA 3MTSA 4O42A 4ZKCB 1WD1A 1MGSA 5DNFA 4ZKBB 2L11A 4LMQD 1NCVA 3IL8A 2B2TA 3I90A 2X6GA 4IURA 1MI2A 1HA6A 2HCCA 1G2TA 1DOLA 1DOKA 2JYOA 5T1IA 2MPMA 2VXWA 1NR2A 4X3UA 1IKLA 2NZ1D 3G7LA 1WTRA 1EL0A 2B2YC 4U68A 1KNEA 1MSGA 2X69A 4HSVA 2MJ8A 5CBEE 3IFDA 1WVLA 2L9HA 1WTXA 3DM1A 4RAUC 2MGSA 4QUFA 1G91A 4IUTA 2HDLA 3FPUB 4CJ0B 3N52A 3DEPA 2B2WC 3ONAB 2B2VC 2XIWA 1HUNA 1S4ZA 5CMDA 2X6LA 1DOMA 4MHEA 1RODA 2L1BA 5E4WC 2EOTA 4X3KA 1JE4A 2Q8RE 3QO2A 3F2UA 4MN3A 4IUPA 4XDXA 1IL8A 3MWYW 3UI2A 3I8ZA 4CJ1B 3FDTA 2B2TC 1PDQA 4X3SA 1B3AA 2FINB 2K01A 5EPJA 4QUCA 2Q8TA 1WTVA 1MSHA 2RVLA 4XT3B 2FFKB 2DY8A 2KVMA 2KEEA 4ZLTF 1BBXC 5EPLA 4R8IA 2K05A 4NW2A 1B4OA 2N88A 1AP0A 1O7YA 3I91A 1VMPA 4HCSA 1AZPA 2SDFA 5EQ0A 2IL8A 1QG7A 2K28A 3Q6SA 1X32A 1CA6A 3SVMA 1HRJA 1VMCA 1U4PA 2BDNA 2HUGA 1B2TA 1J8IA 1B50A 1E0BA 5CBAE 2FMMA 1WTPA 1HFNA 1DONA 2KUMA 4UAIA 1G6ZA 5CORA 2L4NA 1EIGA 4IUVA 5COYA 5JJZA 5D14A 1KNAA 4X3TA 1QE6A 1DZ1A 2RSOA 2K04A 2NWGA 2FJ2A 2NYZD 1GUWA 3P7JA 1RTNA 2FHTA 3H91A 1U4LA 1ML0D 1NR4A 1ILPA 2DY7A 1F9RA 2HCIA 1HHVA 1HUMA 5EKIA 2R3ZA 1LV9A 1IKMA 3TZDA 2CVRA 5EPKA 4DN4M 2L12A 1F2LA 3KUPA 1XX8A 4IUUA 1A15A 2B2UA 3D6WA 1EQTA 2HDMA 3KBXA 1NAPA 4R9WA 5AFWA 4ZK9B 2D9UA 1WTWA 4RWSC 1XYIA 2K1BA 1AZQA 3DEOA 3LWEA 1G2SA 2EE1A 1F9PA 5EJWA 1O7ZA 1B53A 1ZXTA 4CJ2C 3HP3A 1SSOA 1BNZA 5E4XA 2EPBA 3GV3A 4HAEA 1CM9A 1Q3LA 2KOLA 2N55A 1SAPA 1WTOA 1RHPA 2RA4A 3TN2A 1QNKA 1JICA 1X3QA 2JP1A 2KEDA 1PFMA 1U4RA 2B2YA 4HEDA 1SDFA 1TVXA 1C8CA 1EIHA 1F9SA 1F9QA 1PFBA 1ESRA 4OIKA 4RA8A 3R93A 1BF4A 2K03A 1O80A 1PFNA 2MP1A 2KECA 1PLFA 1U4MA 4OIJA 1RJTA 1EOTA 4IUQA
chains in the Genus database with same CATH superfamily
2JK8A 4GKKL 1R4QB 1H9SA 1JOQA 1EY6A 3I3CA 2DJFC 2F0IA 1CSPA 2F0EA 4KHPL 4KD4A 3VA5A 2NZHA 4NKLA 4JI5L 2MPMA 1WTRA 5FLMG 2B29A 4X64Q 4U68A 2NTTA 1LABA 1CT1D 2A19A 3EIVA 5ELOA 3KDFB 1YITA 2ATWA 4DR7L 2ZM6Q 5A2QE 1DOMA 1YEZA 1UE7A 1ET6A 4LF4L 4GKJQ 3OW7A 4XDXA 1DGSA 3HKZE 4FXKC 1TQOA 1GKHA 3HOXH 4GKKQ 1BXTA 1FGUA 4YWKA 1Q82C 1B4OA 2JA7H 2NVQB 1O7YA 1KHIA 2NUCA 5IGDA 1ASYA 1IZ6A 4WFN3 1WCMH 1GD7A 4JBKA 1K28A 4KHPQ 4JOIA 3M4OB 3S1NH 4FDBA 5ELCA 3F2BA 2BE5D 2JEBI 4IPDA 2KQ3A 1V1OA 3W2DA 1PRTF 4KTAA 1LUZA 5JAVA 4IJHA 1EU4A 1FGBD 4DR7Q 3K58A 4FXDA 2EYPA 3TRZA 1CHQD 2PO4A 3RZDB 1SMXA 4LF4Q 4XTCS 3PIP3 4RKBA 3H0GB 5IYBG 1EQTA 3DMUA 2KBNA 5C3WA 4QIWE 1YHQA 3D4RA 4A3CG 2F0UA 1FNVA 1B53A 4M8AA 5M5YB 3W1GA 1FJGQ 1BKBA 4JW0A 3M3YH 1NSNS 3BDLA 3J81E 1JICA 2K7VA 1SNOA 1LTBD 4F7XA 1K9MC 2E2IB 4HEDA 4LF9L 5I2XA 3RLNA 2QDBA 2J7ZA 3OMGA 4OEMB 2ICEC 1RTOA 1KRSA 5T1GA 3GTOH 3NQIA 3BYTB 5IP9G 2F4VL 1I5FA 4DK0A 3MEFA 4ZKCB 4QQBX 1NCVA 3I7FA 3MHBA 2B2TA 4IURA 3GTQB 1H9RA 1EIYB 1HA6A 1HZAA 3G7LA 3S1QB 4LW1A 4BBRH 2BA0A 2C35B 5JVG3 4N9TA 3PO2G 2L9HA 1WTXA 3RLOA 3G71A 4BBSH 1PRTD 4QY7A 4DUZQ 4PZ8A 1SLJA 1L0XB 2PZUA 4LF9Q 2PW7A 3P75A 4A3JH 1HJPA 4MN3A 4CDEC 3I8ZA 1TWFB 3MXGA 3T4AC 2EYMA 2K5DA 1MKHA 5EKKA 5FLXc 4R8NA 2F4VQ 3STBD 3H6MA 2AUKA 3ERQA 1LT6D 3SGIA 3T13A 4L63B 3G6JB 2F0GA 1BOSA 1PTOB 1U4PA 4KKTA 4O1NA 5HY6A 4K8JA 1B2TA 4POFA 2XRSD 3K0YA 4K0KQ 3HOZH 1I4GA 5K36H 1JC7A 3UDGA 1TWHH 2IX1A 3HOXG 2JA5G 3BJUA 2RSOA 1NNXA 2EZVA 2FJ2A 2IHFA 3K8AA 1JORA 1I50H 1A3UA 1U4LA 1V1PB 4A3FH 3J7AV 1EYAA 1TWCH 2GVAA 2A6HD 3W1BA 2B2UA 3D6WA 2B63G 5J22A 2ZTCA 3VR2A 3VR4A 4YHHQ 1EZ8A 3E6ZX 1XYIA 1VQ9A 4FF1A 2EDGA 2ALYB 3I4NH 5EJWA 1BDOA 5E4XA 3D4WA 1TY0A 1LYLA 4HJAA 3EA6A 2ZJRA 1IBKL 4C56C 4DR3L 4IPHA 2RQXA 1SDFA 1VQDA 1F9SA 4RA8A 2E8GA 1GUSA 4M1UB 2BH2A 1LTLA 4KY6A 4ULLA 3RZOB 4CKCA 3AB9A 3BS1A 2O2LD 4J1MA 4ZAIA 4RFBA 1RF2D 3OTOL 1G8ZD 3PO3G 3RN5A 1XNQQ 2CFMA 4OXPA 1LTGD 1Q1EA 4ZKBB 1YVCA 5KEEA 4KY7A 5C3EH 3V05A 4UP7A 4CHTB 3KLWA 3OMCA 4A3LH 2Z6KA 3GO5A 3TQYA 2F0DA 1MSGA 2YTXA 3VA7A 1W6KA 1ZYRD 3NWTA 1WVLA 1RL2A 2NVXB 3GTPH 4RAUC 1B70B 4DR3Q 4G7HC 4BY7B 4G57A 3WOEA 2B2VC 5I2YA 1I6HB 1S4ZA 1R9TH 2J0TD 5JEAH 4DV5Q 3TP8A 4DV2L 3EQLC 3GTGB 3F2UA 2F0MA 3A8KE 5C4XH 1MHWC 2JA8G 4BBRG 4K8IA 1MSHA 1ZKOA 2EYJA 3OTOQ 2R92H 3PF4A 1FVIA 4YCVA 3J81i 4DUYL 3HOVH 4JI2Q 1LTTD 4BS9A 5TSSA 1D5ZC 1TU2B 4JI0L 3MXNB 5CV4A 3PUVA 5M3FG 1G6ZA 1S5BD 4FYDA 1VQJA 2QW7A 3VR6A 4E6IA 1H95A 4A3DG 2K04A 1UE1A 1LM0A 3CRLC 3Q24A 3H91A 2EJMA 5IYDG 2MHVA 1PMRA 1F9RA 1YJ9A 1EQRA 3TZDA 2WP8J 4P71A 5KNBA 5I4DA 2CW0D 2AWNA 2DUDA 4BWGB 3A0JA 2PNRC 2QF7A 2F0LA 1HA5A 3GDEA 5C44G 3FKIH 5IGGA 3K5LA 2N49A 3OIQA 1BNZA 4DUYQ 1PRTB 4I7ZC 5LMUL 1EYCA 1SE3A 2K14A 4H13C 1ENFA 1QVCA 4LFCL 3NHHA 5IT9c 4JI0Q 5L37A 1I94L 2EQSA 1SE2A 4XYQA 2K4KA 3FHWA 3ITPA 1XJVA 1Y69U 4IOAA 4TKOB 4UPAA 4A3MB 4GNXA 4JG2A 1AE2A 1HH2P 1Y1VB 5ISRA 4KK7A 1ICWA 3NSWA 3MXUA 1WD1A 1K73C 1MGSA 2IHEA 2X6GA 3NBIA 5IGBA 2PPBC 4B08A 3S16H 2UXBL 1IKLA 1WYDA 4HSVA 1VQMA 5BR8L 4QJFA 5LMUQ 2K52A 4LFCQ 3CCVA 1B8AA 4RCOA 3N52A 3TS0A 5DEHA 5C3EG 1EYDA 4A76A 3A55A 2AQ3B 2EY5A 2MO1A 5M5WH 2R7ZH 5DLQE 1NMFA 4IUPA 2A74C 4JI8Q 4LAAA 4A93G 4K5XA 1EQQA 2HIVA 1SFOB 1CKOA 3SE0A 2ID0A 1QOHA 4KJNA 4R4OA 4DR4Q 2ZXRA 1SXTA 1EYGA 3S15B 4OGQC 1QG7A 1GUOA 1VQEA 1GHJA 5EBDA 3I56A 2IY5B 1A8VA 5HURA 3DLLA 5C4XG 3OWFA 4BY1B 1PXUA 4V190 5BR8Q 2HQLA 2Z4HA 1IBMQ 4PMBA 1OTCA 1QWYA 5IODA 2AQ1B 3OW2A 1D8LA 1ML0D 3I4LA 2E2HH 1YNJC 4MTKA 3AEVA 3WOFA 1J6QA 1VQ7A 3H3VI 1OXVA 4CJ1B 2HDMA 1E1OA 4ZK9B 5M3MB 3SEBA 5ELDA 5CR3A 3K5NA 4N8FA 1O7ZA 2AHOB 2VS1A 3OPOA 4JI6L 2A69C 2Z4IA 3RD4A 3OIPA 3X3MA 4YIJA 2SNMA 4DV0L 3SK5A 1C0AA 3RUZA 2VUMB 4QMGA 2B2YA 3CCEA 4RMFA 1TT2A 4IQZA 1NBWA 5IIFA 4EQPA 3Q22A 4ALPA 1EOTA 1SEBD 2H1EA 1QZGA 4DNIA 2EYFA 2B2WA 3J7A5 5C0XJ 1HCZA 5EBCA 3C2PA 1XNRL 2A73B 1VQKA 1KAWA 2ZTEA 5DNFA 1JOOA 3IL8A 4YCUA 1WJJA 4NB3A 4A3KB 5IE8A 1G2TA 5T1IA 3SHLA 3S9WA 1I4QA 1QUQB 4ZRZA 3I4MB 3S1MH 2F0WA 3HOYG 2PI2E 3G48A 3U9OA 3DWQA 4XXEA 5IGFA 1XMOQ 2F1MA 2F0SA 3M4PA 1VQIA 5JOBA 2PW5A 3H09A 3LX0A 2QGQA 5ELBA 5CV8A 3M4YA 5FLMH 3UDFA 2WB1E 4CJ0B 3H94A 5IOCA 3DEPA 1U9RA 2XIWA 3PUXA 1VQ5A 4QF4A 4A3BG 2PI2A 4LF6Q 1XTDA 1X3FA 4DV4L 1B3AA 4C3HB 1OXXK 5IGEA 2DY8A 2SOBA 1Y8PB 1STGA 4APVA 4JVZA 2OWOA 1A2UA 2K50A 2VQFL 4A3EG 4LFAL 4KKUA 3TSSA 1HFNA 1L0YB 2FMMA 3NELA 4XQJA 2KCTA 2KCNA 3V96A 1SJHD 2BA1A 2PQAB 3I70A 2I5MX 5D14A 2Q8IB 1KNAA 2FXQA 5I6YA 1CI3M 2R93G 2HIXA 1SYFA 2NVTH 5C4HA 4B3ML 2HCIA 4K5VA 4RH6A 2XTIA 3IFTA 3NENA 1H9SB 3QOJA 3TDQA 4LK1C 1X56A 2ZJPA 1WFQA 3M9BA 2VQEQ 3J80L 4R9WA 4DV4Q 4ABNA 1NAPA 4HN7A 3V2TA 1L1OA 4ZUJA 4DV1L 2K1BA 5M9OA 2M00A 3FPPA 5IYBH 1BBWA 1LTAD 3HOUG 1TS2A 1VCIA 4K5WA 1JJGA 2VQFQ 2RDFA 1CFMA 3S1RB 4A3CH 2H5XA 2IWHA 3ULPA 4DR1L 1S40A 4BA1I 4L5SA 4I65A 4YWLA 3U4ZA 4OIKA 1C8CA 1I4PA 1NTGA 2K03A 3CCQA 3A7LA 5A35A 1G291 4OIJA 4X6AH 3NTKA 5I9OA 3HFZB 1Y1WG 3EVQA 4A4IA 1EWHA 1HPCA 4B3MQ 3VDYA 4NPSA 1HTPA 2VNUD 3P1HA 3CPWA 3Q0AA 4XT1B 3T1HL 3IAYA 4JC0A 1CKNB 5CGKA 3CQZB 3MC0B 5J39A 1PH7A 1N32L 1ENCA 2WKDA 3ND8A 1X54A 3NTHA 4DV1Q 5IP9H 2HCCA 3J80E 5ELNA 4A3GG 1V1QA 5FO7B 1Z47A 4OHJA 4KHVA 4L6TB 4OX9Q 4TSSA 2B39A 1DXMA 2HD3A 1Q8IA 4HIDA 4LFBQ 3E0EA 3PO2H 1SJED 2QEJC 3PCOB 5CMDA 3RNUA 1RODA 1LLRD 1N33L 3M4QA 3CRKC 2D5DA 2ZJQA 3R8BA 1CTMA 1STAA 1UEAB 2CHBD 2EXZA 2FMCA 5IGCA 3T1HQ 3J81c 4IZ8A 2Z8LA 4JI4Q 3HOWB 3TP5A 1AP0A 1ET9A 2PNHA 3I91A 4YY3L 4FF4A 2MO0A 2K5NA 2JA6G 2JN4A 4DV7L 4OO1G 3QR8A 1GOZA 3SR1A 1WTHA 4OL7A 4OONA 4PZ6A 1VF5C 3BZKA 3HKZG 2L4NA 1E2ZA 2RF4A 1K8OA 4QIWB 1EY7A 4OO1I 1J5EL 3UDIA 3S2DB 2NWGA 2K6AA 1RCVD 1Q90A 2OT2A 3AFPA 3TP6A 3IRBA 4OELB 2JA5H 1YZ6A 1A2TA 1TR5A 4B9WA 3GTLB 1PA6A 1CKNA 1N33Q 4GLXA 2WFWA 2UXDL 5I9PA 2DGYA 3AQQA 4JI5Q 4LF8L 4O0AA 1G2SA 1K83B 4JYAL 4CKBA 1PYSB 1PZID 2OXPA 4YY3Q 1TWFH 2B63H 4JK1C 3L0OA 4GLVB 2RBMA 1P8LA 4DV7Q 3NK9A 3BVZA 1PZJD 3GTKH 2K32A 4R4TA 2I5LX 2N78A 1F9QA 2ICIA 1ESRA 2JJQA 4O2DA 1DD2A 1J5EQ 2MP1A 3JAMi 2XWJB 4C2MB 1DOLA 5C5LA 4IUQA 1KIXA 3GV6A 3AYHB 1XXGA 1J9OA 1CA5A 3U4VA 1X3PA 3GTJB 1X55A 1RD9D 2F0NA 1SRUA 3KOJA 3S17B 3CC4A 3I73A 1E2VA 4ZCKA 5DM63 2UXDQ 2KHIA 3KFUA 3K57A 3PO3H 1Q12A 4Z9CB 4LF8Q 4JI3L 4CDDC 2N3SA 4X3UA 4C3IB 5H1SE 1CKMA 2N8NA 3FEWX 4IO9A 1F2ZA 2LXKA 4KMUC 2LKVA 5IP7G 5C4JB 1ASZA 2V1CC 3E0JA 1DYQA 2UUCL 1G91A 2RCNA 3D0FA 2L1BA 2XNAC 3CXCA 1B44D 3UI2A 4NXML 3H0GG 4FVMA 2EY2A 2OF1A 4P73A 1X6OA 3Q8DA 4NW2A 1QVFA 4X62L 3RMHA 4DK1A 2JA8H 2LY7A 4PG3A 5C6AA 5BN3A 3SK6A 4EVOA 4CKEA 2EJGC 3MZ5A 4DAMA 4JI3Q 4JI7L 4RG1A 1DONA 1DJRD 4AYBB 2QKIC 1Z9FA 3S14H 2SNSA 2F03A 5M3FH 3K80C 5NUCA 1SMYC 1YNNC 1WOCA 1PH5A 4A3DH 1MD2D 2R3ZA 4FXGC 2L12A 2JA7B 3J80i 4IFDJ 5IYDH 2IX0A 5KNCA 2RHSB 2CQOA 5LL6S 3KBXA 4K2KA 3CAMA 1KRTA 1WCMB 1A3TA 4HTHA 3VYUA 1JJ2A 3S1NB 4X62Q 4I7AA 3HP3A 1PH2A 3GV3A 4BXXG 4HMJA 1QZHA 5C44H 4JI7Q 5FJ8G 4CDFC 4IALA 1HQMC 4Q5VA 3GTMH 1UE5A 2CH4A 1YI2A 1JB7A 2F0QA 1RKNA 2KECA 1U4MA 5KRUA 1QILA 2BDOA 1LT5D 2F52A 2XVSA 4GOPC 4AYBE 1A0IA 3ERSX 5D3DA 3AFQA 1VQ4A 1OXUA 4DV6L 4C1NK 1CUKA 3J7YW 1K0SA 4GN4B 4K14A 4P2CB 2AKWB 1HTLD 2M9VA 1PTOC 1JCKB 3L3OC 3M3YB 1HNXL 2JYOA 3I55A 1Q81C 1L2FA 5FLXL 1YNJD 1LO5D 1XMQL 4FF3A 3IFDA 1VQAA 2HHHL 3CCMA 2D2CC 2E2JH 2NTSA 2EJFC 2O5IC 2F0VA 3GTOB 2DJGC 3K6OA 3Q23A 4H02A 4X3KA 3QO2A 2OTLA 1VQHA 1BQQT 3DUZA 1PDQA 2CQAA 3KF8B 3MEHA 2Q2HA 4DV6Q 1GO3E 2D0PA 3S2HH 3KJOA 1QCBD 3RN2A 1RIPA 2Z6BA 3SK4A 1U5KA 4A93H 1S5DD 1FNWA 2DNCA 1IBKQ 4BBSB 1B50A 2O4XA 4UAIA 1KLUD 1FYCA 1XMQQ 2HHHQ 2YTYA 2XN9C 5KNDA 2VL6A 3HGBA 1TS5A 1V8QA 4A3JB 1H9KA 1RTNA 3EJIA 4GNXB 1S3OA 3E5SA 3NXWA 3TP7A 3KF6B 1XX8A 3C46A 3H3VH 4JPBW 2JSOA 1IYJB 2BE5C 2UU9L 1VQ6A 2WV6D 2WAQB 1PH8A 4JV5L 5IWAL 1BVSA 4HR7B 2F0HA 3HOZB 1BCPC 1KDCA 3E9IA 1VQOA 1TWHB 2N55A 1N8RC 1PYBA 1SNCA 3C1EA 1O78A 4L5TA 1D6EC 4BY7G 1I50B 3K0XA 3PIOA 4A3FB 2A1AA 4NDXA 1TWCB 1FNUA 1SYCA 2PQEA 5E1FA 4DV2Q 2TMPA 4PNYA 4ZYSA 2IPKD 3MFYA 2K75A 3KF8A 1GM5A 4BY1H 1E2WA 2B2VA 1LT4D 2EIFA 3EN2A 4P72A 2XWBB 2LS01 3AU7A 3MTSA 3I4NB 3DWAA 4X65L 5FOBB 4HIOA 3T53B 2L5TA 2VXWA 1NR2A 3W5OA 1EL0A 1EY8A 3PF5A 4JBWA 2K5HA 2KHJA 2WAQE 3A7AB 4TVAB 3HOYH 1UWVA 1SBBB 1PH4A 3FPUB 4UHVA 1C7YA 1DM0B 4L5RC 3KF6A 4C3JB 2L0CA 5M5XH 1SE4A 2KCMA 3URYA 5GAGC 3J7AF 4L8JA 2AMCB 2LSSA 1A62A 3D3RA 2OTJA 1CQFA 1EUJA 4QUCA 5EAYA 5HGQA 4DR5L 2FFKB 2KVMA 4BA2I 4A3BH 1R4PB 4R8IA 5JPMC 3MVVA 2A8VA 2N88A 2ZXOA 1UUPA 1PRTC 3IKJA 3B6YA 1VMPA 3TZUA 3BZCA 1K3BC 2IL8A 1SN8A 1CA6A 3SVMA 3KLSA 3GTPB 4QGUA 5CYUA 5IYCH 4WJ4A 1A3VA 1I94Q 3CHBD 3D31A 5GQOA 5JJZA 5K5PA 1R9TB 2P5ZX 4B3SL 4A3EH 3D4DA 1JB3A 5JPNC 4UP8A 4A3MG 1Y1VG 2DY7A 4HMIA 1V43A 4ILWA 1MIUA 2WIIB 5IT9L 4IJLA 4DK3C 5KIXA 1B7YB 2CVRA 1W6JA 4WRDA 5BN5A 3H15A 2R92B 2R93H 1E1TA 4KLKA 3HOVB 3VYTA 4IFDG 2R6GA 1K0RA 3A5UA 4DR5Q 3DEOA 4CDCC 4F8MA 3LWEA 2UXBQ 3A56A 1Y14B 4CBVA 2KOLA 4IFDI 1LACA 1TS4A 2YYZA 1GHKA 1AE3A 3H3VC 3RLFA 1JE5A 3A8JE 4RKLA 1IBLL 2F3VA 3HOUH 4DNRB 2UXCL 4XYOA 4B3SQ 3JAMc 3OOCA 1RJTA 2MQHA 1WTQA 2IT1A 4A3IB 4OWWB 5CV7A 3QG1A 1N9WA 2Z1CA 1Z6HA 1IHZA 5DM73 5C5MA 2WB1B 3PMFA 3FKIB 1Y1WH 2L11A 2HT1A 1U0LA 1NUCA 2D62A 4B9XA 1I3QH 4HCEA 4RCNA 3CC2A 1G51A 3K7AH 1BR9A 2MFIA 4BY1G 2YU9B 1LTSD 3GQBA 1P16A 1JWUD 3NE5B 4A3GH 3BVMA 1CHPD 4GN3B 4RHRA 3VR5A 1IBLQ 3KLRA 3PUZA 2UXCQ 1ZEQX 3M7NA 4MHEA 4A75A 4ODGA 3U58A 3O13A 3CCJA 2EYLA 2RDHA 3TREA 4DKAC 5M3MG 4FO2A 1L1OB 3MXPA 3S16B 1M4VA 1ZYRC 2K05A 4C1NI 4IN3A 4JI6Q 5J3BA 1B9MA 2Q2TA 4JBMA 2OCEA 3HS0C 1X32A 4DV0Q 3SDZA 4F88A 1XWEA 4DAPA 1J8IA 3CKIB 2GVBA 5CBAE 4KN7C 1BUVT 2VUMG 3OHXC 4DPGA 2JA6H 1AFPA 2VZAA 4OO1H 1NJIC 1DZ1A 5M5WB 2R7ZB 4LJZC 4Y7NH 1JWSD 4K6DA 3R3OA 4DR6L 1PH1A 1XNRQ 1HUMA 3QOLA 4YWMA 1LV9A 3J80c 2ZT9C 4DN4M 5IYCG 3PUWA 4AQYL 3NP8A 2RKSA 2IW3A 4A3KG 2TSSA 5JJIA 4PMCA 1KDBA 2OQKA 4RGTA 4Q0FA 5ELEA 3K5MA 4AIMA 3I4MG 2EPBA 5EKLA 4UY8C 5JJKA 1PFSA 1SAPA 2CCZA 2RA4A 1EY0A 2BOSA 3NQTA 3BDOA 1X3QA 5FO8B 2VB2X 1X9NA 1UE6A 2LMCB 1QNUA 2E2HB 3CP0A 2CW0C 3QWNA 4UP9A 2E76C 1KXLA 3BDCA 4R1JA 4DR6Q 4DV3L 4C3HG 1E7ZA 1D1KA 1T5EA 2NVYB 1PV4A 2Q2IA 1AW7A 2M2LA 4RHSA 1BBUA 3I90A 1PH3A 1MI2A 2O5JC 3PSIA 1YHAA 4QB4A 4LFAQ 3GTLH 2Y0SB 5GROA 2NVQH 1SMYD 3KJPA 4HSPA 2XSCA 5CBEE 1NMGA 3K5OA 1II3A 3M4OH 1HXYD 3EBEA 4IUTA 5I6WA 5IP7H 4DR2L 2JXMB 3J81j 4EGVA 2SEBD 2F0JA 1PYWD 1STHA 4J6HA 3MWYW 1EY9A 2V4DA 3OSOA 1KL9A 4FP5D 1A6XA 2L55A 4EQ5A 4ZLTF 3U50C 1KDAA 4QL5A 3RZDH 2B3GA 3H0GH 3S1MB 1AZPA 4R4CA 3CMAA 2F0OA 1AEXA 1V9PA 4EQOA 4IUNA 3GTJH 4DR1Q 3ICEA 1HZ9A 5M5YH 3T56B 2MNAA 5LHY1 4NP5A 4RGNA 2UUBL 1NE3A 2G5DA 2Y0SE 1H9JA 2I0QA 4LF5L 1EFWA 2FHTA 1GUWA 3QB3A 1F2MA 2E2IH 5LL6X 1TY2A 4DR2Q 2NN6G 4DA2A 5HGTA 1A63A 2ZM6L 1PH6A 2KENA 3MAQA 1BCPF 1F2LA 3PIPA 2BH8A 1N32Q 2NN6I 2CH4W 3ULLA 2EYHA 3C3LA 4JOIC 4YCWA 4DU9A 1ESFA 2EY1A 2A6EC 4G7ZC 2K5WA 1ZXTA 1IL2A 2OQ0A 4P74A 3OYYA 2JQOA 2F0KA 2Z0SA 1D2BA 3U9SA 3GTQH 5E3FA 1XPOA 1MJEA 3TEHB 3S1QH 4EQNA 4G4KA 4BXXH 1U4RA 2NVTB 2R7DA 2G9HD 2GN5A 3K7UC 3R93A 2UUBQ 1TIID 4UDUC 3UDXA 5FJ8H 4LF5Q 1HFGA 1TWAB 2QILA 2QDLA 1IW7C 1Q86C 4R4QA 3HOWG 1EFID 4LMQD 1VQCA 3BYYB 3PV0A 3K59A 3LNNA 2VW9A 4KY5A 5JVH3 2CKZB 3JC66 4J15A 1TWGB 1FD7D 2EXDA 5CV5A 3J81L 1FJGL 1EOVA 1F2YA 1PTOH 3DM1A 3SXHA 3CPFA 1HR0W 3L2PA 1Q7YC 1SNPA 4H0LC 4ME3A 1T9HA 3ONAB 4LUZA 3PUYA 4DAYA 3BVGA 5C0XG 1B3QA 2QEXA 4KN4C 1JE4A 1BCPD 3FDTA 4QCLA 2B2TC 2Q8TA 2RVLA 4JI1L 5C0XI 4HIMA 5CV6A 1VQFA 1BBXC 5J1ZA 5EPLA 4JYAQ 4GZYC 3ULJA 4V0BA 2A5HA 2K28A 4HIKA 2LFNA 1Y8NB 1SNQA 1WTPA 5E7NA 1B9NA 1SYBA 4LF7L 3KDFA 3PO2B 3D6CA 1SYDA 3A8IE 1EY4A 1JR0D 3UE1A 2F3WA 2ASBA 1Q1BA 1XPRA 4DUZL 1K3RA 2RCFA 5C3XA 2IX3A 5EPKA 1YJWA 3RZOH 3KUPA 4HJ5A 3NPPA 3TMEA 2I5HA 2EYOA 3K81C 1IYUA 3F1ZA 2A68C 4LUOA 4JI1Q 1AZQA 4PMWA 1VQ8A 3ND9A 3BU2A 3I72A 1Y8OB 2PMZB 2WINB 5LMNW 4C3IG 3CF5A 3L9AX 2BCOA 1E3PA 4IOCA 1QNKA 2JP1A 2UUCQ 2I46A 3KYHC 4K0KL 4LF7Q 3FVQA 3HOXB 2JA5B 1O80A 1PFNA 2NVXH 3LGJA 2AQ2B 4BY7H 2KJXA 4NXMQ 2B2UC 1M8AA 1I6HH 4X66L 1I4RA 4CGYB 3A54A 1W3SA 1L0WA 4WJ3M 3GTGH 1SROA 1X3GA 2C5CA 2PYKA 2XGTA 1I4HA 2B63B 1GUTA 4FF2A 3CU7A 1KD1C 4TRDA 4OWTB 4GOPB 4YHHL 1M90C 3S24A 3NUCA 1DOKA 1HR0L 3GTKB 1S5CD 3R2TA 2NZ1D 1D1IA 2IJ0A 4AYBG 2ZXPA 1K8MA 5JEAJ 2PZTA 3G4SA 4NMZA 4ZQ3A 2PMZE 3BG3A 4XQQA 4OWXB 4HJ9A 1JT8A 3HEJA 4GN5A 2JA9A 1SR3A 2KCCA 3M7GA 2JA7G 2QCPX 1X3EA 3ZYYX 4NXNL 4HJ7A 2K01A 1WTVA 4XT3B 4X66Q 1WCMG 3PO3B 2Z6KC 1PVOA 1XNQL 3HRZC 4S3SA 1LT3D 2K5VA 4HCSA 5EQ0A 1FR3A 3HG9A 1HRJA 1E22A 1VMCA 2HUGA 4HJ8A 1XPUA 4Y52H 1HR0Q 1E0BA 4B3TL 2KUMA 3FP9A 1NY4A 3QJYA 1HNWL 3KLSX 4XIGS 2A69D 2NYZD 1D5XC 3UE0A 1JMCA 5EKIA 4JBJA 1OXSC 2PCFB 2OEOA 4DV5L 3T16A 2KA7A 4A3MH 1M1KC 2JA8B 3KK7A 1Y1VH 4BBRB 1A15A 5LMNL 4NXNQ 2CWAA 4GOPA 2R61A 4C3JH 1HNXQ 4KHZA 1HZCA 1YJNA 5KYIA 1VQNA 1SSOA 4PQXA 2H4OA 4HAEA 4IPGA 1Q3LA 4IFDH 3F2CA 3DHQA 3TS2A 2YV5A 3DM3A 5FLXE 3WWVA 4JI2L 3S14B 3D8GA 1RDPD 2KEDA 2K5QA 4F87A 5M3FB 1VF7A 4B3TQ 3VR3A 1GXDC 1BCPB 4P75A 1HNWQ 3MFGA 4A3DB 2AWOA 3CW2C 1EEFD 1V1PA 3NWSA 4FNFA 2Z9HA 3W3AA 1Q46A 1ILQA 2ES2A 1SYEA 1STBA 3EFXD 1GVPA 5LMNQ 2D0OA 1B1ZA 2XRQD 1SFOH 1CQVA 1QB5D 5GAHC 2G9DA 1VDZA 1XTCD 4GLAC 2DN8A 5C44B 4BBSG 3A5ZB 5D3IB 3S15H 1YNXA 2RDGA 2MJ8A 3GTMB 1VQBA 3GD7A 1JQYD 1KLGD 4GS3A 1N36L 4KV6A 1EWIA 1GUGA 4A3JG 1C4QA 4QUFA 4ID6A 2B8FA 4GNXC 2HDLA 3ER0A 4DGZA 1G6PA 1ICFB 3A74A 1E24A 2GA4B 1O7LA 2EOTA 5BN4A 5FK9C 4X3SA 2FINB 1Q8KA 2UU9Q 1STYA 2WAQG 4DK6C 5GADC 3P20A 4JV5Q 5IWAQ 2B8GA 3HOZG 5K36G 3MA2B 4A3IH 5M3MH 4LWCA 5ELFA 3DXJC 2BDNA 3T1YL 3J7ZC 2E2JB 3HZXA 2AUJD 2PZWA 3FRPB 5CORA 1CZGA 1W2BA 4A3FG 5COYA 5CC4A 5EGTA 1N36Q 3HKSA 2VUMH 3P7JA 3EROA 4WORA 1UEBA 5C3EB 3I2ZA 1FL0A 3QIAA 2YU9H 4G7OC 3R2IA 4N8X1 1YBYA 5AJ3L 5F2DA 3C1FA 5FO9B 3I4NG 3S2HB 1S72A 4IUUA 4KI0A 1I6VC 5AFWA 2I07B 4JI8L 4X65Q 4H7BA 1WTWA 3AMUA 4A93B 1I4XA 2D9UA 2K33A 3N6RA 4RWSC 4ZUIA 5G3LF 2EE1A 4DR4L 1F9PA 1CM9A 1WTOA 2EVBA 1WI5A 4H44C 4A3KH 3ZJYC 3WDNA 3T1YQ 2E74C 4MZ9A 3MXNA 4R4IA 5C4XB 3I4MH 3STBC 3CC7A 1KQSA 3GP7A 1ENAA 3PIO3 1TVXA 1PFBA 4C3JG 1IBML 3CCLA 3VYSA 3NEMA 1LTRD 1N34L 4B3RL 4DF7A 2L15A 4K2LA 1UNSA 2J4XA 2E2DC 5D65A 5AJ3Q 1BO0A 4LNQA 4O42A 2RSNA 3LWUA 1IXRA 4A3LG 1SNDA 4C3HH 3X3NA 4MIUA 2A6HC 5CV9A 3CD6A 2B2YC 2X69A 1ONLA 4JCVE 1O7IA 3VYRA 1HZBA 1CK1A 5JEAG 4AH6A 1HQRD 2F0PA 2B2WC 3NBHB 2A6ED 3TBIB 1HUNA 1KTKA 2Q8RE 5IT9E 1D7QA 2R92G 1IL8A 1VS0A 4N9PA 2NB0A 1N34Q 3I4OA 3PGZA 3M85A 4B3RQ 3HOVG 4RGMA 1QVGA 1LTID 1GUNA 1GJXA 1TS3A 1UAPA 5G3LD 2F3IA 2WACA 2QA4A 2R7FA 1K8GA 1K8AC 4DFAA 1OO9B 2SDFA 2MUYA 2NVYH 3Q6SA 2F0TA 3L7ZC 4DNTB 3HOYB 1SE8A 1YIJA 1EIFA 1EIGA 4IUVA 4MNOA 1IW7D 1KC8C 1XMOL 4X3TA 4U673 1JJCB 5GAEC 3S1RH 5M5XB 1EWCA 4POGA 3KBGA 2C9OA 1NR4A 2NZOA 4A3IG 1ILPA 1X65A 2F4IA 2NBFA 2UUAL 1IKMA 3CCRA 4PV1C 2E5LL 4A3BB 1Z7TA 2WB1G 4LF6L 3FKIG 3JAML 2NN6H 2EY6A 4DXFA 1TXYA 2DNEA 3CMEA 4DAVA 3CQZH 4CJ2C 3RR5A 3TN2A 4A3EB 3E9HA 1MJCA 2ENBA 2RHQB 3BZDB 1PFMA 4PZ7A 3NBHA 1AN8A 4MTNA 2JE6I 4RGOS 1EIHA 1HNZL 1S5FD 4J8QA 2R93B 5IY0A 1VQLA 3T51B 1L1OC 1EU3A 5KGUA 1WD0A 2UUAQ 1TKWB 2E5LQ 2ZTDA 1KABA 3F2DA 2VQEL 3JAME 3HOWH 3E3XA 1CSQA 1KNEA 4IPCA 3CCSA 1T5XD 3HOUB 1C9OA 1H9MA 2R7ZG 2MGSA 1IYVA 3F8TA 1PTOF 2A68D 1HNZQ 4KKSA 2X6LA 1SNMA 3S2DH 5E4WC 4EX5A 1Y1WB 4AQYQ 1VQGA 1EZ6A 1C48A 5EPJA 1PHJA 1EEID 5C0XH 2KEEA 4K6LA 1JWMD 5FKAC 1I3QB 1EY5A 2YTVA 1YNND 1DCZA 1F77A 5C4ZA 3K7AB 4L5QA 2VY3A 1CZWA 3SK8A 2Q2UA 1TWAH 1KAAA 1AH9A 1K83H 3CCUA 4A3GB 1QUQA 1STEA 5JJLA 1D5MC 2E75C 1QJOA 1OXTA 2WKCA 3OWEB 1QE6A 2JEAI 1MBYA 4OX9L 1TWGH 4WJWA 1YHBA 4DV3Q 1EQVA 4LFBL 1JOKA 1HHVA 4C2MH 2LXJA 1STNA 4ME5A 5KYLA 3PQIA 2F0FA 4XQNA 2Y0SG 4JI4L 3S17H 4KJOA 1S5ED 4X64L 4TQUS 2VB3X 4DXGA 3DWPA 2JA6B 1RHPA 2HQEA 1VQPA 4KD3A 1SYGA 4LUVA 4Y7NB 3FMCA 3NTIA 5A2QL 3HKZB 1PH9A 4C3IH 2KHSA 2PQAA 1PTOD 5C4JH 1BF4A 2CWPA 4DAYB 3G6EA 1PLFA 5DAUA 4GKJL 1PZKD
chains in the Genus database with same CATH topology
1R4QB 1H9SA 1JOQA 1EY6A 3I3CA 2F0IA 2F0EA 4KD4A 3VA5A 4NKLA 2MPMA 1WTRA 4U68A 2NTTA 1LABA 1CT1D 5A2QE 1DOMA 1ET6A 3OW7A 4XDXA 4FXKC 1TQOA 1BXTA 1B4OA 2NVQB 1O7YA 2NUCA 5IGDA 4WFN3 3M4OB 5ELCA 2BE5D 2JEBI 2KQ3A 1V1OA 3W2DA 1PRTF 4KTAA 5JAVA 1EU4A 1FGBD 3K58A 4FXDA 2EYPA 1CHQD 2PO4A 3RZDB 4XTCS 3PIP3 4RKBA 3H0GB 1EQTA 3DMUA 5C3WA 3D4RA 2F0UA 1FNVA 1B53A 4M8AA 5M5YB 1NSNS 3BDLA 3J81E 1JICA 2K7VA 1SNOA 1LTBD 4F7XA 2E2IB 4HEDA 5I2XA 2QDBA 2J7ZA 3OMGA 2ICEC 1RTOA 5T1GA 3NQIA 3BYTB 4DK0A 4ZKCB 1NCVA 3MHBA 2B2TA 4IURA 3GTQB 1H9RA 1HA6A 3G7LA 3S1QB 2BA0A 5JVG3 4N9TA 2L9HA 1WTXA 1PRTD 1L0XB 2PZUA 2PW7A 3P75A 4MN3A 3I8ZA 1TWFB 3MXGA 3T4AC 2EYMA 2K5DA 5EKKA 4R8NA 3H6MA 2AUKA 3ERQA 1LT6D 3T13A 4L63B 3G6JB 2F0GA 1BOSA 1PTOB 1U4PA 4KKTA 4O1NA 1B2TA 4K8JA 2XRSD 3K0YA 1I4GA 5K36H 1JC7A 2IX1A 2RSOA 2EZVA 2FJ2A 1JORA 1A3UA 1U4LA 1V1PB 3J7AV 1EYAA 2A6HD 2B2UA 3D6WA 5J22A 3VR2A 3VR4A 4FF1A 1EZ8A 3E6ZX 1XYIA 2EDGA 5EJWA 1BDOA 5E4XA 3D4WA 1TY0A 3EA6A 4C56C 2RQXA 1SDFA 1F9SA 4RA8A 1GUSA 4M1UB 4KY6A 4ULLA 3RZOB 4CKCA 3AB9A 3BS1A 2O2LD 4J1MA 4ZAIA 4RFBA 1RF2D 1G8ZD 1LTGD 1Q1EA 4ZKBB 5KEEA 4KY7A 3V05A 4CHTB 3OMCA 3GO5A 2F0DA 1MSGA 3VA7A 1W6KA 1ZYRD 3NWTA 1WVLA 2NVXB 4RAUC 4G7HC 4BY7B 4G57A 3WOEA 2B2VC 5I2YA 1I6HB 1S4ZA 2J0TD 5JEAH 3TP8A 3GTGB 3EQLC 3F2UA 2F0MA 3A8KE 4K8IA 1MSHA 1ZKOA 2EYJA 1LTTD 4BS9A 5TSSA 1D5ZC 1TU2B 5CV4A 3PUVA 1G6ZA 1S5BD 4FYDA 3VR6A 4E6IA 2K04A 3CRLC 3Q24A 3H91A 2EJMA 2MHVA 1PMRA 1F9RA 3TZDA 2WP8J 5KNBA 5I4DA 2CW0D 2AWNA 4BWGB 2PNRC 2QF7A 2F0LA 1HA5A 5IGGA 3K5LA 3OIQA 1BNZA 1PRTB 4I7ZC 1EYCA 1SE3A 4H13C 1ENFA 3NHHA 1SE2A 4XYQA 3ITPA 1Y69U 4TKOB 4A3MB 1Y1VB 5ISRA 4KK7A 1ICWA 3NSWA 3MXUA 1WD1A 1MGSA 2X6GA 3NBIA 5IGBA 2PPBC 4B08A 1IKLA 4HSVA 4RCOA 3N52A 5DEHA 1EYDA 3A55A 2AQ3B 2EY5A 4IUPA 2A74C 4LAAA 4K5XA 1SFOB 3SE0A 2ID0A 1QOHA 4KJNA 2ZXRA 1SXTA 3S15B 4OGQC 1QG7A 1GUOA 1GHJA 5EBDA 5HURA 3OWFA 4BY1B 1PXUA 4V190 2Z4HA 4PMBA 1QWYA 5IODA 2AQ1B 1ML0D 3I4LA 1YNJC 3WOFA 1OXVA 4CJ1B 2HDMA 4ZK9B 5M3MB 3SEBA 5ELDA 5CR3A 3K5NA 1O7ZA 3OPOA 2A69C 2Z4IA 3RD4A 3OIPA 3X3MA 4YIJA 2SNMA 3SK5A 3RUZA 2VUMB 4QMGA 2B2YA 1TT2A 4IQZA 5IIFA 4EQPA 3Q22A 1EOTA 1SEBD 2H1EA 2EYFA 2B2WA 5C0XJ 1HCZA 5EBCA 3C2PA 2A73B 5DNFA 1JOOA 3IL8A 4A3KB 1G2TA 5T1IA 3SHLA 3S9WA 1I4QA 4ZRZA 3I4MB 2F0WA 3U9OA 3DWQA 4XXEA 5IGFA 2F1MA 2F0SA 5JOBA 2PW5A 3H09A 3LX0A 5ELBA 5CV8A 3M4YA 4CJ0B 3H94A 5IOCA 3DEPA 1U9RA 2XIWA 3PUXA 4QF4A 1B3AA 4C3HB 1OXXK 5IGEA 2DY8A 2SOBA 1Y8PB 1STGA 1A2UA 4KKUA 3TSSA 1HFNA 1L0YB 2FMMA 4XQJA 2KCNA 3V96A 1SJHD 2BA1A 3I70A 5D14A 2Q8IB 1KNAA 5I6YA 1CI3M 1SYFA 5C4HA 2HCIA 4K5VA 4RH6A 3IFTA 1H9SB 3QOJA 3TDQA 4LK1C 3J80L 4R9WA 4ABNA 1NAPA 4HN7A 3V2TA 4ZUJA 2K1BA 5M9OA 2M00A 3FPPA 1LTAD 1TS2A 1VCIA 4K5WA 2RDFA 1CFMA 3S1RB 2IWHA 4BA1I 4I65A 1C8CA 4OIKA 1I4PA 2K03A 3A7LA 5A35A 1G291 4OIJA 3NTKA 5I9OA 3EVQA 1EWHA 1HPCA 1HTPA 2VNUD 3P1HA 3Q0AA 4XT1B 3IAYA 5CGKA 3CQZB 3MC0B 5J39A 1ENCA 2WKDA 3ND8A 3NTHA 2HCCA 3J80E 5FO7B 1Z47A 4OHJA 4KHVA 4L6TB 4TSSA 2B39A 1DXMA 1Q8IA 1SJED 2QEJC 5CMDA 1RODA 1LLRD 3CRKC 2D5DA 3R8BA 1CTMA 1STAA 1UEAB 2CHBD 2EXZA 2FMCA 5IGCA 4IZ8A 2Z8LA 3HOWB 3TP5A 1AP0A 1ET9A 3I91A 4FF4A 4OO1G 1GOZA 3SR1A 4OL7A 1VF5C 2L4NA 1E2ZA 1K8OA 4QIWB 1EY7A 4OO1I 3S2DB 2NWGA 2K6AA 1RCVD 1Q90A 2OT2A 3TP6A 1A2TA 1TR5A 4B9WA 3GTLB 5I9PA 1G2SA 1K83B 4CKBA 1PZID 2OXPA 4JK1C 2RBMA 3NK9A 3BVZA 1PZJD 2K32A 1F9QA 2ICIA 1ESRA 1DD2A 2MP1A 2XWJB 4C2MB 1DOLA 5C5LA 4IUQA 3GV6A 1XXGA 1J9OA 1CA5A 1X3PA 3GTJB 2F0NA 1RD9D 3S17B 3I73A 1E2VA 5DM63 3K57A 1Q12A 4Z9CB 4X3UA 4C3IB 3FEWX 1F2ZA 4KMUC 5C4JB 2LKVA 3E0JA 1DYQA 1G91A 2L1BA 2XNAC 1B44D 3UI2A 4FVMA 2EY2A 2OF1A 4NW2A 3RMHA 4DK1A 2LY7A 5C6AA 5BN3A 3SK6A 4EVOA 4CKEA 2EJGC 3MZ5A 1DONA 1DJRD 4AYBB 2QKIC 2SNSA 2F03A 5NUCA 1SMYC 1YNNC 1MD2D 2R3ZA 4FXGC 2L12A 2JA7B 4IFDJ 5KNCA 2IX0A 5LL6S 3KBXA 4K2KA 1WCMB 1A3TA 4HTHA 3VYUA 3S1NB 3HP3A 3GV3A 4HMJA 4IALA 1HQMC 4Q5VA 2F0QA 1RKNA 2KECA 1U4MA 5KRUA 1QILA 2BDOA 1LT5D 2XVSA 5D3DA 1OXUA 4C1NK 3J7YW 4K14A 4P2CB 1HTLD 2M9VA 1PTOC 1JCKB 3L3OC 3M3YB 2JYOA 5FLXL 1YNJD 1LO5D 4FF3A 3IFDA 2D2CC 2NTSA 2EJFC 2O5IC 2F0VA 3GTOB 3K6OA 3Q23A 4X3KA 3QO2A 1BQQT 3DUZA 1PDQA 2CQAA 3MEHA 1QCBD 3SK4A 1S5DD 1FNWA 2DNCA 4BBSB 1B50A 2O4XA 4UAIA 1KLUD 1FYCA 2XN9C 5KNDA 3HGBA 1TS5A 1V8QA 4A3JB 1H9KA 1RTNA 3EJIA 3E5SA 3NXWA 3TP7A 1XX8A 3C46A 2JSOA 2BE5C 2WV6D 2WAQB 4HR7B 2F0HA 3HOZB 1BCPC 1KDCA 1TWHB 2N55A 1SNCA 3C1EA 1O78A 1D6EC 1I50B 4A3FB 4NDXA 1TWCB 1FNUA 1SYCA 2PQEA 5E1FA 2TMPA 4PNYA 4ZYSA 2IPKD 3MFYA 3KF8A 1E2WA 2B2VA 1LT4D 2XWBB 2LS01 3AU7A 3MTSA 3I4NB 3DWAA 5FOBB 3T53B 2L5TA 2VXWA 1NR2A 1EL0A 1EY8A 4JBWA 3A7AB 1SBBB 3FPUB 1DM0B 4C3JB 2L0CA 1SE4A 3URYA 3J7AF 4L8JA 3D3RA 1CQFA 4QUCA 2FFKB 2KVMA 4BA2I 1R4PB 4R8IA 5JPMC 3MVVA 2N88A 2ZXOA 1UUPA 1PRTC 3IKJA 1VMPA 3TZUA 2IL8A 1CA6A 3SVMA 3KLSA 3GTPB 5CYUA 1A3VA 3CHBD 3D31A 5JJZA 5K5PA 1R9TB 3D4DA 1JB3A 5JPNC 2DY7A 4HMIA 1V43A 4ILWA 2WIIB 5IT9L 5KIXA 2CVRA 1W6JA 4WRDA 5BN5A 2R92B 3HOVB 3VYTA 4IFDG 2R6GA 3DEOA 4F8MA 3LWEA 3A56A 4CBVA 2KOLA 4IFDI 1LACA 1TS4A 2YYZA 1GHKA 3H3VC 3RLFA 4RKLA 3A8JE 2F3VA 4DNRB 4XYOA 3OOCA 1RJTA 1WTQA 2IT1A 4A3IB 5CV7A 3QG1A 2Z1CA 1Z6HA 1IHZA 5DM73 5C5MA 2WB1B 3PMFA 3FKIB 2L11A 1NUCA 2D62A 4B9XA 4HCEA 4RCNA 1BR9A 2YU9B 1LTSD 3GQBA 1JWUD 3NE5B 3BVMA 1CHPD 4RHRA 3VR5A 3KLRA 3PUZA 1ZEQX 3M7NA 4MHEA 4ODGA 3O13A 2EYLA 2RDHA 4FO2A 3MXPA 3S16B 1M4VA 1ZYRC 2K05A 4C1NI 4IN3A 1B9MA 3HS0C 1X32A 3SDZA 4F88A 1XWEA 4DAPA 1J8IA 3CKIB 5CBAE 4KN7C 1BUVT 3OHXC 1AFPA 4OO1H 1DZ1A 5M5WB 2R7ZB 4LJZC 1JWSD 4K6DA 3R3OA 1HUMA 3QOLA 1LV9A 2ZT9C 4DN4M 3PUWA 3NP8A 2RKSA 2IW3A 2TSSA 4PMCA 1KDBA 4RGTA 4Q0FA 5ELEA 3K5MA 2EPBA 5EKLA 1SAPA 2RA4A 1EY0A 2BOSA 3NQTA 3BDOA 1X3QA 5FO8B 2VB2X 2LMCB 1QNUA 2E2HB 2CW0C 3QWNA 2E76C 3BDCA 4C3HG 1D1KA 1T5EA 2NVYB 1AW7A 2M2LA 4RHSA 3I90A 1MI2A 2O5JC 4QB4A 2Y0SB 1SMYD 4HSPA 2XSCA 5CBEE 3K5OA 1II3A 1HXYD 4IUTA 5I6WA 2JXMB 4EGVA 2SEBD 2F0JA 1PYWD 4J6HA 1STHA 3MWYW 1EY9A 2V4DA 3OSOA 4FP5D 1A6XA 2L55A 4ZLTF 1KDAA 3S1MB 1AZPA 2F0OA 1AEXA 4EQOA 4IUNA 3T56B 5LHY1 4NP5A 4RGNA 1GUWA 1H9JA 2FHTA 3QB3A 1F2MA 5LL6X 1TY2A 2NN6G 4DA2A 5HGTA 3MAQA 1BCPF 1F2LA 2NN6I 2EYHA 3C3LA 4DU9A 1ESFA 2EY1A 2A6EC 4G7ZC 2K5WA 1ZXTA 2F0KA 1D2BA 3U9SA 5E3FA 4EQNA 4G4KA 2NVTB 1U4RA 2G9HD 3R93A 1TIID 4UDUC 1HFGA 1TWAB 2QILA 1IW7C 1EFID 4LMQD 3BYYB 3PV0A 3K59A 3LNNA 4KY5A 5JVH3 1TWGB 1FD7D 5CV5A 3J81L 1F2YA 1PTOH 3DM1A 3SXHA 1SNPA 4H0LC 3ONAB 3PUYA 4DAYA 3BVGA 5C0XG 4KN4C 1JE4A 1BCPD 3FDTA 4QCLA 2B2TC 2Q8TA 2RVLA 5C0XI 1BBXC 5CV6A 5J1ZA 5EPLA 4GZYC 4V0BA 2A5HA 2K28A 2LFNA 1Y8NB 1SNQA 1WTPA 1B9NA 1SYBA 3PO2B 3D6CA 1SYDA 3A8IE 1EY4A 1JR0D 2F3WA 1Q1BA 5C3XA 2IX3A 5EPKA 3KUPA 3NPPA 3TMEA 2EYOA 1IYUA 2A68C 1AZQA 4PMWA 3ND9A 3I72A 1Y8OB 2PMZB 2WINB 4C3IG 3L9AX 2BCOA 1QNKA 2JP1A 2I46A 3FVQA 3HOXB 2JA5B 1O80A 1PFNA 2AQ2B 2KJXA 2B2UC 1M8AA 1I4RA 4CGYB 3A54A 2C5CA 2PYKA 1I4HA 2B63B 1GUTA 4FF2A 3CU7A 4TRDA 3NUCA 1DOKA 3GTKB 1S5CD 3R2TA 2NZ1D 1D1IA 2IJ0A 2ZXPA 1K8MA 5JEAJ 2PZTA 4NMZA 4ZQ3A 3BG3A 4XQQA 3HEJA 2KCCA 3M7GA 2QCPX 3ZYYX 2K01A 1WTVA 4XT3B 3PO3B 3HRZC 4S3SA 1LT3D 4HCSA 5EQ0A 1FR3A 3HG9A 1HRJA 1VMCA 2HUGA 1E0BA 2KUMA 3QJYA 3KLSX 4XIGS 2A69D 2NYZD 1D5XC 5EKIA 1OXSC 2PCFB 2OEOA 3T16A 2KA7A 2JA8B 3KK7A 4BBRB 1A15A 2R61A 4KHZA 5KYIA 1SSOA 4PQXA 2H4OA 4HAEA 1Q3LA 4IFDH 3DHQA 5FLXE 3S14B 3D8GA 1RDPD 2KEDA 2K5QA 4F87A 5M3FB 1VF7A 3VR3A 1GXDC 1BCPB 3MFGA 4A3DB 2AWOA 1EEFD 1V1PA 3NWSA 4FNFA 3W3AA 1ILQA 1SYEA 1STBA 3EFXD 1B1ZA 2XRQD 1CQVA 1QB5D 2G9DA 1VDZA 1XTCD 2DN8A 5C44B 5D3IB 2RDGA 2MJ8A 3GTMB 3GD7A 1JQYD 1KLGD 4KV6A 1GUGA 1C4QA 4QUFA 4ID6A 2B8FA 2HDLA 4DGZA 2GA4B 1O7LA 2EOTA 5BN4A 5FK9C 4X3SA 2FINB 1STYA 3P20A 2B8GA 5K36G 3MA2B 5ELFA 3DXJC 2BDNA 2E2JB 3HZXA 2AUJD 2PZWA 3FRPB 5CORA 1CZGA 5COYA 5CC4A 5EGTA 3P7JA 3EROA 4WORA 5C3EB 3QIAA 4G7OC 3R2IA 5F2DA 3C1FA 5FO9B 3S2HB 4IUUA 4KI0A 1I6VC 5AFWA 2I07B 4H7BA 1WTWA 3AMUA 4A93B 1I4XA 2D9UA 2K33A 3N6RA 4RWSC 4ZUIA 5G3LF 2EE1A 1F9PA 1CM9A 1WTOA 2EVBA 4H44C 3WDNA 2E74C 3MXNA 5C4XB 3GP7A 1ENAA 3PIO3 1TVXA 1PFBA 4C3JG 3VYSA 1LTRD 4DF7A 4K2LA 1UNSA 2J4XA 2E2DC 5D65A 1BO0A 4O42A 2RSNA 3LWUA 1SNDA 3X3NA 4MIUA 2A6HC 5CV9A 2B2YC 2X69A 1ONLA 3VYRA 1CK1A 5JEAG 1HQRD 2F0PA 2B2WC 2A6ED 3TBIB 1HUNA 1KTKA 2Q8RE 5IT9E 1IL8A 4N9PA 2NB0A 3M85A 4RGMA 1LTID 1GUNA 1GJXA 1TS3A 1UAPA 5G3LD 2WACA 4DFAA 1OO9B 2SDFA 2MUYA 3Q6SA 2F0TA 3L7ZC 4DNTB 3HOYB 1EIGA 4IUVA 1IW7D 4X3TA 4U673 5M5XB 1EWCA 3KBGA 2C9OA 1NR4A 1ILPA 2F4IA 2NBFA 1IKMA 4A3BB 4PV1C 1Z7TA 3JAML 2NN6H 2EY6A 4DXFA 2DNEA 4DAVA 4CJ2C 3TN2A 4A3EB 2ENBA 3BZDB 1PFMA 3NBHA 1AN8A 2JE6I 4RGOS 1EIHA 1S5FD 4J8QA 2R93B 3T51B 1EU3A 5KGUA 1WD0A 1TKWB 1KABA 3JAME 1KNEA 1T5XD 3HOUB 1H9MA 2MGSA 1IYVA 1PTOF 2A68D 4KKSA 2X6LA 1SNMA 5E4WC 1Y1WB 1EZ6A 1C48A 5EPJA 1EEID 5C0XH 2KEEA 4K6LA 1JWMD 5FKAC 1I3QB 1EY5A 1YNND 1DCZA 1F77A 5C4ZA 3K7AB 1CZWA 3SK8A 1KAAA 4A3GB 1STEA 1D5MC 2E75C 1QJOA 1OXTA 2WKCA 3OWEB 1QE6A 2JEAI 1MBYA 4WJWA 1EQVA 1JOKA 1HHVA 1STNA 4ME5A 5KYLA 2F0FA 4XQNA 4KJOA 1S5ED 4DXGA 2VB3X 4TQUS 3DWPA 2JA6B 1RHPA 2HQEA 4KD3A 1SYGA 4Y7NB 3FMCA 3NTIA 5A2QL 3HKZB 2KHSA 1PTOD 1BF4A 1PLFA 5DAUA 1PZKD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J7Z A;  1WTQ A;  2B2U C;  2H1E A;  3GV6 A;  1RTO A;  1HFG A;  1J9O A;  1M8A A;  2B2W A;  2B2V A;  4ZAI A;  5T1G A;  1CA5 A;  1X3P A;  5D65 A;  1ICW A;  1WD0 A;  4XT1 B;  1ILQ A;  1BO0 A;  2M2L A;  3I3C A;  2RSN A;  3MTS A;  4O42 A;  4ZKC B;  1WD1 A;  1MGS A;  5DNF A;  4ZKB B;  2L11 A;  4LMQ D;  1NCV A;  3IL8 A;  2B2T A;  3I90 A;  2X6G A;  4IUR A;  1MI2 A;  1HA6 A;  2HCC A;  1G2T A;  1DOL A;  1DOK A;  2JYO A;  5T1I A;  2MPM A;  2VXW A;  1NR2 A;  4X3U A;  1IKL A;  2NZ1 D;  3G7L A;  1WTR A;  1EL0 A;  2B2Y C;  4U68 A;  1KNE A;  1MSG A;  2X69 A;  4HSV A;  2MJ8 A;  5CBE E;  3IFD A;  1WVL A;  2L9H A;  1WTX A;  3DM1 A;  4RAU C;  2MGS A;  4QUF A;  1G91 A;  4IUT A;  2HDL A;  3FPU B;  4CJ0 B;  3N52 A;  3DEP A;  2B2W C;  3ONA B;  2B2V C;  2XIW A;  1HUN A;  1S4Z A;  5CMD A;  2X6L A;  1DOM A;  4MHE A;  1ROD A;  2L1B A;  5E4W C;  2EOT A;  4X3K A;  1JE4 A;  2Q8R E;  3QO2 A;  3F2U A;  4MN3 A;  4IUP A;  4XDX A;  1IL8 A;  3MWY W;  3UI2 A;  3I8Z A;  4CJ1 B;  3FDT A;  2B2T C;  1PDQ A;  4X3S A;  1B3A A;  2FIN B;  2K01 A;  5EPJ A;  4QUC A;  2Q8T A;  1WTV A;  1MSH A;  2RVL A;  4XT3 B;  2FFK B;  2DY8 A;  2KVM A;  2KEE A;  4ZLT F;  1BBX C;  5EPL A;  4R8I A;  2K05 A;  4NW2 A;  1B4O A;  2N88 A;  1AP0 A;  1O7Y A;  3I91 A;  1VMP A;  4HCS A;  1AZP A;  2SDF A;  5EQ0 A;  2IL8 A;  1QG7 A;  2K28 A;  3Q6S A;  1X32 A;  1CA6 A;  3SVM A;  1HRJ A;  1VMC A;  1U4P A;  2BDN A;  2HUG A;  1B2T A;  1J8I A;  1B50 A;  1E0B A;  5CBA E;  2FMM A;  1WTP A;  1HFN A;  1DON A;  2KUM A;  4UAI A;  1G6Z A;  5COR A;  2L4N A;  1EIG A;  4IUV A;  5COY A;  5JJZ A;  5D14 A;  1KNA A;  4X3T A;  1QE6 A;  1DZ1 A;  2RSO A;  2K04 A;  2NWG A;  2FJ2 A;  2NYZ D;  1GUW A;  3P7J A;  1RTN A;  2FHT A;  3H91 A;  1U4L A;  1ML0 D;  1NR4 A;  1ILP A;  2DY7 A;  1F9R A;  2HCI A;  1HHV A;  1HUM A;  5EKI A;  2R3Z A;  1LV9 A;  1IKM A;  3TZD A;  2CVR A;  5EPK A;  4DN4 M;  2L12 A;  1F2L A;  3KUP A;  1XX8 A;  4IUU A;  1A15 A;  2B2U A;  3D6W A;  1EQT A;  2HDM A;  3KBX A;  1NAP A;  4R9W A;  5AFW A;  4ZK9 B;  2D9U A;  1WTW A;  4RWS C;  1XYI A;  2K1B A;  1AZQ A;  3DEO A;  3LWE A;  1G2S A;  2EE1 A;  1F9P A;  5EJW A;  1O7Z A;  1B53 A;  1ZXT A;  4CJ2 C;  3HP3 A;  1SSO A;  1BNZ A;  5E4X A;  2EPB A;  3GV3 A;  4HAE A;  1CM9 A;  1Q3L A;  2KOL A;  2N55 A;  1SAP A;  1WTO A;  1RHP A;  2RA4 A;  3TN2 A;  1QNK A;  1JIC A;  1X3Q A;  2JP1 A;  2KED A;  1PFM A;  1U4R A;  2B2Y A;  4HED A;  1SDF A;  1TVX A;  1C8C A;  1EIH A;  1F9S A;  1F9Q A;  1PFB A;  1ESR A;  4OIK A;  4RA8 A;  3R93 A;  1BF4 A;  2K03 A;  1O80 A;  1PFN A;  2MP1 A;  2KEC A;  1PLF A;  1U4M A;  4OIJ A;  1RJT A;  1EOT A;  4IUQ A; 
#chains in the Genus database with same CATH topology
 2JK8 A;  4GKK L;  1R4Q B;  1H9S A;  1JOQ A;  1EY6 A;  3I3C A;  2DJF C;  2F0I A;  1CSP A;  2F0E A;  4KHP L;  4KD4 A;  3VA5 A;  2NZH A;  4NKL A;  4JI5 L;  2MPM A;  1WTR A;  5FLM G;  2B29 A;  4X64 Q;  4U68 A;  2NTT A;  1LAB A;  1CT1 D;  2A19 A;  3EIV A;  5ELO A;  3KDF B;  1YIT A;  2ATW A;  4DR7 L;  2ZM6 Q;  5A2Q E;  1DOM A;  1YEZ A;  1UE7 A;  1ET6 A;  4LF4 L;  4GKJ Q;  3OW7 A;  4XDX A;  1DGS A;  3HKZ E;  4FXK C;  1TQO A;  1GKH A;  3HOX H;  4GKK Q;  1BXT A;  1FGU A;  4YWK A;  1Q82 C;  1B4O A;  2JA7 H;  2NVQ B;  1O7Y A;  1KHI A;  2NUC A;  5IGD A;  1ASY A;  1IZ6 A;  4WFN 3;  1WCM H;  1GD7 A;  4JBK A;  1K28 A;  4KHP Q;  4JOI A;  3M4O B;  3S1N H;  4FDB A;  5ELC A;  3F2B A;  2BE5 D;  2JEB I;  4IPD A;  2KQ3 A;  1V1O A;  3W2D A;  1PRT F;  4KTA A;  1LUZ A;  5JAV A;  4IJH A;  1EU4 A;  1FGB D;  4DR7 Q;  3K58 A;  4FXD A;  2EYP A;  3TRZ A;  1CHQ D;  2PO4 A;  3RZD B;  1SMX A;  4LF4 Q;  4XTC S;  3PIP 3;  4RKB A;  3H0G B;  5IYB G;  1EQT A;  3DMU A;  2KBN A;  5C3W A;  4QIW E;  1YHQ A;  3D4R A;  4A3C G;  2F0U A;  1FNV A;  1B53 A;  4M8A A;  5M5Y B;  3W1G A;  1FJG Q;  1BKB A;  4JW0 A;  3M3Y H;  1NSN S;  3BDL A;  3J81 E;  1JIC A;  2K7V A;  1SNO A;  1LTB D;  4F7X A;  1K9M C;  2E2I B;  4HED A;  4LF9 L;  5I2X A;  3RLN A;  2QDB A;  2J7Z A;  3OMG A;  4OEM B;  2ICE C;  1RTO A;  1KRS A;  5T1G A;  3GTO H;  3NQI A;  3BYT B;  5IP9 G;  2F4V L;  1I5F A;  4DK0 A;  3MEF A;  4ZKC B;  4QQB X;  1NCV A;  3I7F A;  3MHB A;  2B2T A;  4IUR A;  3GTQ B;  1H9R A;  1EIY B;  1HA6 A;  1HZA A;  3G7L A;  3S1Q B;  4LW1 A;  4BBR H;  2BA0 A;  2C35 B;  5JVG 3;  4N9T A;  3PO2 G;  2L9H A;  1WTX A;  3RLO A;  3G71 A;  4BBS H;  1PRT D;  4QY7 A;  4DUZ Q;  4PZ8 A;  1SLJ A;  1L0X B;  2PZU A;  4LF9 Q;  2PW7 A;  3P75 A;  4A3J H;  1HJP A;  4MN3 A;  4CDE C;  3I8Z A;  1TWF B;  3MXG A;  3T4A C;  2EYM A;  2K5D A;  1MKH A;  5EKK A;  5FLX c;  4R8N A;  2F4V Q;  3STB D;  3H6M A;  2AUK A;  3ERQ A;  1LT6 D;  3SGI A;  3T13 A;  4L63 B;  3G6J B;  2F0G A;  1BOS A;  1PTO B;  1U4P A;  4KKT A;  4O1N A;  5HY6 A;  4K8J A;  1B2T A;  4POF A;  2XRS D;  3K0Y A;  4K0K Q;  3HOZ H;  1I4G A;  5K36 H;  1JC7 A;  3UDG A;  1TWH H;  2IX1 A;  3HOX G;  2JA5 G;  3BJU A;  2RSO A;  1NNX A;  2EZV A;  2FJ2 A;  2IHF A;  3K8A A;  1JOR A;  1I50 H;  1A3U A;  1U4L A;  1V1P B;  4A3F H;  3J7A V;  1EYA A;  1TWC H;  2GVA A;  2A6H D;  3W1B A;  2B2U A;  3D6W A;  2B63 G;  5J22 A;  2ZTC A;  3VR2 A;  3VR4 A;  4YHH Q;  1EZ8 A;  3E6Z X;  1XYI A;  1VQ9 A;  4FF1 A;  2EDG A;  2ALY B;  3I4N H;  5EJW A;  1BDO A;  5E4X A;  3D4W A;  1TY0 A;  1LYL A;  4HJA A;  3EA6 A;  2ZJR A;  1IBK L;  4C56 C;  4DR3 L;  4IPH A;  2RQX A;  1SDF A;  1VQD A;  1F9S A;  4RA8 A;  2E8G A;  1GUS A;  4M1U B;  2BH2 A;  1LTL A;  4KY6 A;  4ULL A;  3RZO B;  4CKC A;  3AB9 A;  3BS1 A;  2O2L D;  4J1M A;  4ZAI A;  4RFB A;  1RF2 D;  3OTO L;  1G8Z D;  3PO3 G;  3RN5 A;  1XNQ Q;  2CFM A;  4OXP A;  1LTG D;  1Q1E A;  4ZKB B;  1YVC A;  5KEE A;  4KY7 A;  5C3E H;  3V05 A;  4UP7 A;  4CHT B;  3KLW A;  3OMC A;  4A3L H;  2Z6K A;  3GO5 A;  3TQY A;  2F0D A;  1MSG A;  2YTX A;  3VA7 A;  1W6K A;  1ZYR D;  3NWT A;  1WVL A;  1RL2 A;  2NVX B;  3GTP H;  4RAU C;  1B70 B;  4DR3 Q;  4G7H C;  4BY7 B;  4G57 A;  3WOE A;  2B2V C;  5I2Y A;  1I6H B;  1S4Z A;  1R9T H;  2J0T D;  5JEA H;  4DV5 Q;  3TP8 A;  4DV2 L;  3EQL C;  3GTG B;  3F2U A;  2F0M A;  3A8K E;  5C4X H;  1MHW C;  2JA8 G;  4BBR G;  4K8I A;  1MSH A;  1ZKO A;  2EYJ A;  3OTO Q;  2R92 H;  3PF4 A;  1FVI A;  4YCV A;  3J81 i;  4DUY L;  3HOV H;  4JI2 Q;  1LTT D;  4BS9 A;  5TSS A;  1D5Z C;  1TU2 B;  4JI0 L;  3MXN B;  5CV4 A;  3PUV A;  5M3F G;  1G6Z A;  1S5B D;  4FYD A;  1VQJ A;  2QW7 A;  3VR6 A;  4E6I A;  1H95 A;  4A3D G;  2K04 A;  1UE1 A;  1LM0 A;  3CRL C;  3Q24 A;  3H91 A;  2EJM A;  5IYD G;  2MHV A;  1PMR A;  1F9R A;  1YJ9 A;  1EQR A;  3TZD A;  2WP8 J;  4P71 A;  5KNB A;  5I4D A;  2CW0 D;  2AWN A;  2DUD A;  4BWG B;  3A0J A;  2PNR C;  2QF7 A;  2F0L A;  1HA5 A;  3GDE A;  5C44 G;  3FKI H;  5IGG A;  3K5L A;  2N49 A;  3OIQ A;  1BNZ A;  4DUY Q;  1PRT B;  4I7Z C;  5LMU L;  1EYC A;  1SE3 A;  2K14 A;  4H13 C;  1ENF A;  1QVC A;  4LFC L;  3NHH A;  5IT9 c;  4JI0 Q;  5L37 A;  1I94 L;  2EQS A;  1SE2 A;  4XYQ A;  2K4K A;  3FHW A;  3ITP A;  1XJV A;  1Y69 U;  4IOA A;  4TKO B;  4UPA A;  4A3M B;  4GNX A;  4JG2 A;  1AE2 A;  1HH2 P;  1Y1V B;  5ISR A;  4KK7 A;  1ICW A;  3NSW A;  3MXU A;  1WD1 A;  1K73 C;  1MGS A;  2IHE A;  2X6G A;  3NBI A;  5IGB A;  2PPB C;  4B08 A;  3S16 H;  2UXB L;  1IKL A;  1WYD A;  4HSV A;  1VQM A;  5BR8 L;  4QJF A;  5LMU Q;  2K52 A;  4LFC Q;  3CCV A;  1B8A A;  4RCO A;  3N52 A;  3TS0 A;  5DEH A;  5C3E G;  1EYD A;  4A76 A;  3A55 A;  2AQ3 B;  2EY5 A;  2MO1 A;  5M5W H;  2R7Z H;  5DLQ E;  1NMF A;  4IUP A;  2A74 C;  4JI8 Q;  4LAA A;  4A93 G;  4K5X A;  1EQQ A;  2HIV A;  1SFO B;  1CKO A;  3SE0 A;  2ID0 A;  1QOH A;  4KJN A;  4R4O A;  4DR4 Q;  2ZXR A;  1SXT A;  1EYG A;  3S15 B;  4OGQ C;  1QG7 A;  1GUO A;  1VQE A;  1GHJ A;  5EBD A;  3I56 A;  2IY5 B;  1A8V A;  5HUR A;  3DLL A;  5C4X G;  3OWF A;  4BY1 B;  1PXU A;  4V19 0;  5BR8 Q;  2HQL A;  2Z4H A;  1IBM Q;  4PMB A;  1OTC A;  1QWY A;  5IOD A;  2AQ1 B;  3OW2 A;  1D8L A;  1ML0 D;  3I4L A;  2E2H H;  1YNJ C;  4MTK A;  3AEV A;  3WOF A;  1J6Q A;  1VQ7 A;  3H3V I;  1OXV A;  4CJ1 B;  2HDM A;  1E1O A;  4ZK9 B;  5M3M B;  3SEB A;  5ELD A;  5CR3 A;  3K5N A;  4N8F A;  1O7Z A;  2AHO B;  2VS1 A;  3OPO A;  4JI6 L;  2A69 C;  2Z4I A;  3RD4 A;  3OIP A;  3X3M A;  4YIJ A;  2SNM A;  4DV0 L;  3SK5 A;  1C0A A;  3RUZ A;  2VUM B;  4QMG A;  2B2Y A;  3CCE A;  4RMF A;  1TT2 A;  4IQZ A;  1NBW A;  5IIF A;  4EQP A;  3Q22 A;  4ALP A;  1EOT A;  1SEB D;  2H1E A;  1QZG A;  4DNI A;  2EYF A;  2B2W A;  3J7A 5;  5C0X J;  1HCZ A;  5EBC A;  3C2P A;  1XNR L;  2A73 B;  1VQK A;  1KAW A;  2ZTE A;  5DNF A;  1JOO A;  3IL8 A;  4YCU A;  1WJJ A;  4NB3 A;  4A3K B;  5IE8 A;  1G2T A;  5T1I A;  3SHL A;  3S9W A;  1I4Q A;  1QUQ B;  4ZRZ A;  3I4M B;  3S1M H;  2F0W A;  3HOY G;  2PI2 E;  3G48 A;  3U9O A;  3DWQ A;  4XXE A;  5IGF A;  1XMO Q;  2F1M A;  2F0S A;  3M4P A;  1VQI A;  5JOB A;  2PW5 A;  3H09 A;  3LX0 A;  2QGQ A;  5ELB A;  5CV8 A;  3M4Y A;  5FLM H;  3UDF A;  2WB1 E;  4CJ0 B;  3H94 A;  5IOC A;  3DEP A;  1U9R A;  2XIW A;  3PUX A;  1VQ5 A;  4QF4 A;  4A3B G;  2PI2 A;  4LF6 Q;  1XTD A;  1X3F A;  4DV4 L;  1B3A A;  4C3H B;  1OXX K;  5IGE A;  2DY8 A;  2SOB A;  1Y8P B;  1STG A;  4APV A;  4JVZ A;  2OWO A;  1A2U A;  2K50 A;  2VQF L;  4A3E G;  4LFA L;  4KKU A;  3TSS A;  1HFN A;  1L0Y B;  2FMM A;  3NEL A;  4XQJ A;  2KCT A;  2KCN A;  3V96 A;  1SJH D;  2BA1 A;  2PQA B;  3I70 A;  2I5M X;  5D14 A;  2Q8I B;  1KNA A;  2FXQ A;  5I6Y A;  1CI3 M;  2R93 G;  2HIX A;  1SYF A;  2NVT H;  5C4H A;  4B3M L;  2HCI A;  4K5V A;  4RH6 A;  2XTI A;  3IFT A;  3NEN A;  1H9S B;  3QOJ A;  3TDQ A;  4LK1 C;  1X56 A;  2ZJP A;  1WFQ A;  3M9B A;  2VQE Q;  3J80 L;  4R9W A;  4DV4 Q;  4ABN A;  1NAP A;  4HN7 A;  3V2T A;  1L1O A;  4ZUJ A;  4DV1 L;  2K1B A;  5M9O A;  2M00 A;  3FPP A;  5IYB H;  1BBW A;  1LTA D;  3HOU G;  1TS2 A;  1VCI A;  4K5W A;  1JJG A;  2VQF Q;  2RDF A;  1CFM A;  3S1R B;  4A3C H;  2H5X A;  2IWH A;  3ULP A;  4DR1 L;  1S40 A;  4BA1 I;  4L5S A;  4I65 A;  4YWL A;  3U4Z A;  4OIK A;  1C8C A;  1I4P A;  1NTG A;  2K03 A;  3CCQ A;  3A7L A;  5A35 A;  1G29 1;  4OIJ A;  4X6A H;  3NTK A;  5I9O A;  3HFZ B;  1Y1W G;  3EVQ A;  4A4I A;  1EWH A;  1HPC A;  4B3M Q;  3VDY A;  4NPS A;  1HTP A;  2VNU D;  3P1H A;  3CPW A;  3Q0A A;  4XT1 B;  3T1H L;  3IAY A;  4JC0 A;  1CKN B;  5CGK A;  3CQZ B;  3MC0 B;  5J39 A;  1PH7 A;  1N32 L;  1ENC A;  2WKD A;  3ND8 A;  1X54 A;  3NTH A;  4DV1 Q;  5IP9 H;  2HCC A;  3J80 E;  5ELN A;  4A3G G;  1V1Q A;  5FO7 B;  1Z47 A;  4OHJ A;  4KHV A;  4L6T B;  4OX9 Q;  4TSS A;  2B39 A;  1DXM A;  2HD3 A;  1Q8I A;  4HID A;  4LFB Q;  3E0E A;  3PO2 H;  1SJE D;  2QEJ C;  3PCO B;  5CMD A;  3RNU A;  1ROD A;  1LLR D;  1N33 L;  3M4Q A;  3CRK C;  2D5D A;  2ZJQ A;  3R8B A;  1CTM A;  1STA A;  1UEA B;  2CHB D;  2EXZ A;  2FMC A;  5IGC A;  3T1H Q;  3J81 c;  4IZ8 A;  2Z8L A;  4JI4 Q;  3HOW B;  3TP5 A;  1AP0 A;  1ET9 A;  2PNH A;  3I91 A;  4YY3 L;  4FF4 A;  2MO0 A;  2K5N A;  2JA6 G;  2JN4 A;  4DV7 L;  4OO1 G;  3QR8 A;  1GOZ A;  3SR1 A;  1WTH A;  4OL7 A;  4OON A;  4PZ6 A;  1VF5 C;  3BZK A;  3HKZ G;  2L4N A;  1E2Z A;  2RF4 A;  1K8O A;  4QIW B;  1EY7 A;  4OO1 I;  1J5E L;  3UDI A;  3S2D B;  2NWG A;  2K6A A;  1RCV D;  1Q90 A;  2OT2 A;  3AFP A;  3TP6 A;  3IRB A;  4OEL B;  2JA5 H;  1YZ6 A;  1A2T A;  1TR5 A;  4B9W A;  3GTL B;  1PA6 A;  1CKN A;  1N33 Q;  4GLX A;  2WFW A;  2UXD L;  5I9P A;  2DGY A;  3AQQ A;  4JI5 Q;  4LF8 L;  4O0A A;  1G2S A;  1K83 B;  4JYA L;  4CKB A;  1PYS B;  1PZI D;  2OXP A;  4YY3 Q;  1TWF H;  2B63 H;  4JK1 C;  3L0O A;  4GLV B;  2RBM A;  1P8L A;  4DV7 Q;  3NK9 A;  3BVZ A;  1PZJ D;  3GTK H;  2K32 A;  4R4T A;  2I5L X;  2N78 A;  1F9Q A;  2ICI A;  1ESR A;  2JJQ A;  4O2D A;  1DD2 A;  1J5E Q;  2MP1 A;  3JAM i;  2XWJ B;  4C2M B;  1DOL A;  5C5L A;  4IUQ A;  1KIX A;  3GV6 A;  3AYH B;  1XXG A;  1J9O A;  1CA5 A;  3U4V A;  1X3P A;  3GTJ B;  1X55 A;  1RD9 D;  2F0N A;  1SRU A;  3KOJ A;  3S17 B;  3CC4 A;  3I73 A;  1E2V A;  4ZCK A;  5DM6 3;  2UXD Q;  2KHI A;  3KFU A;  3K57 A;  3PO3 H;  1Q12 A;  4Z9C B;  4LF8 Q;  4JI3 L;  4CDD C;  2N3S A;  4X3U A;  4C3I B;  5H1S E;  1CKM A;  2N8N A;  3FEW X;  4IO9 A;  1F2Z A;  2LXK A;  4KMU C;  2LKV A;  5IP7 G;  5C4J B;  1ASZ A;  2V1C C;  3E0J A;  1DYQ A;  2UUC L;  1G91 A;  2RCN A;  3D0F A;  2L1B A;  2XNA C;  3CXC A;  1B44 D;  3UI2 A;  4NXM L;  3H0G G;  4FVM A;  2EY2 A;  2OF1 A;  4P73 A;  1X6O A;  3Q8D A;  4NW2 A;  1QVF A;  4X62 L;  3RMH A;  4DK1 A;  2JA8 H;  2LY7 A;  4PG3 A;  5C6A A;  5BN3 A;  3SK6 A;  4EVO A;  4CKE A;  2EJG C;  3MZ5 A;  4DAM A;  4JI3 Q;  4JI7 L;  4RG1 A;  1DON A;  1DJR D;  4AYB B;  2QKI C;  1Z9F A;  3S14 H;  2SNS A;  2F03 A;  5M3F H;  3K80 C;  5NUC A;  1SMY C;  1YNN C;  1WOC A;  1PH5 A;  4A3D H;  1MD2 D;  2R3Z A;  4FXG C;  2L12 A;  2JA7 B;  3J80 i;  4IFD J;  5IYD H;  2IX0 A;  5KNC A;  2RHS B;  2CQO A;  5LL6 S;  3KBX A;  4K2K A;  3CAM A;  1KRT A;  1WCM B;  1A3T A;  4HTH A;  3VYU A;  1JJ2 A;  3S1N B;  4X62 Q;  4I7A A;  3HP3 A;  1PH2 A;  3GV3 A;  4BXX G;  4HMJ A;  1QZH A;  5C44 H;  4JI7 Q;  5FJ8 G;  4CDF C;  4IAL A;  1HQM C;  4Q5V A;  3GTM H;  1UE5 A;  2CH4 A;  1YI2 A;  1JB7 A;  2F0Q A;  1RKN A;  2KEC A;  1U4M A;  5KRU A;  1QIL A;  2BDO A;  1LT5 D;  2F52 A;  2XVS A;  4GOP C;  4AYB E;  1A0I A;  3ERS X;  5D3D A;  3AFQ A;  1VQ4 A;  1OXU A;  4DV6 L;  4C1N K;  1CUK A;  3J7Y W;  1K0S A;  4GN4 B;  4K14 A;  4P2C B;  2AKW B;  1HTL D;  2M9V A;  1PTO C;  1JCK B;  3L3O C;  3M3Y B;  1HNX L;  2JYO A;  3I55 A;  1Q81 C;  1L2F A;  5FLX L;  1YNJ D;  1LO5 D;  1XMQ L;  4FF3 A;  3IFD A;  1VQA A;  2HHH L;  3CCM A;  2D2C C;  2E2J H;  2NTS A;  2EJF C;  2O5I C;  2F0V A;  3GTO B;  2DJG C;  3K6O A;  3Q23 A;  4H02 A;  4X3K A;  3QO2 A;  2OTL A;  1VQH A;  1BQQ T;  3DUZ A;  1PDQ A;  2CQA A;  3KF8 B;  3MEH A;  2Q2H A;  4DV6 Q;  1GO3 E;  2D0P A;  3S2H H;  3KJO A;  1QCB D;  3RN2 A;  1RIP A;  2Z6B A;  3SK4 A;  1U5K A;  4A93 H;  1S5D D;  1FNW A;  2DNC A;  1IBK Q;  4BBS B;  1B50 A;  2O4X A;  4UAI A;  1KLU D;  1FYC A;  1XMQ Q;  2HHH Q;  2YTY A;  2XN9 C;  5KND A;  2VL6 A;  3HGB A;  1TS5 A;  1V8Q A;  4A3J B;  1H9K A;  1RTN A;  3EJI A;  4GNX B;  1S3O A;  3E5S A;  3NXW A;  3TP7 A;  3KF6 B;  1XX8 A;  3C46 A;  3H3V H;  4JPB W;  2JSO A;  1IYJ B;  2BE5 C;  2UU9 L;  1VQ6 A;  2WV6 D;  2WAQ B;  1PH8 A;  4JV5 L;  5IWA L;  1BVS A;  4HR7 B;  2F0H A;  3HOZ B;  1BCP C;  1KDC A;  3E9I A;  1VQO A;  1TWH B;  2N55 A;  1N8R C;  1PYB A;  1SNC A;  3C1E A;  1O78 A;  4L5T A;  1D6E C;  4BY7 G;  1I50 B;  3K0X A;  3PIO A;  4A3F B;  2A1A A;  4NDX A;  1TWC B;  1FNU A;  1SYC A;  2PQE A;  5E1F A;  4DV2 Q;  2TMP A;  4PNY A;  4ZYS A;  2IPK D;  3MFY A;  2K75 A;  3KF8 A;  1GM5 A;  4BY1 H;  1E2W A;  2B2V A;  1LT4 D;  2EIF A;  3EN2 A;  4P72 A;  2XWB B;  2LS0 1;  3AU7 A;  3MTS A;  3I4N B;  3DWA A;  4X65 L;  5FOB B;  4HIO A;  3T53 B;  2L5T A;  2VXW A;  1NR2 A;  3W5O A;  1EL0 A;  1EY8 A;  3PF5 A;  4JBW A;  2K5H A;  2KHJ A;  2WAQ E;  3A7A B;  4TVA B;  3HOY H;  1UWV A;  1SBB B;  1PH4 A;  3FPU B;  4UHV A;  1C7Y A;  1DM0 B;  4L5R C;  3KF6 A;  4C3J B;  2L0C A;  5M5X H;  1SE4 A;  2KCM A;  3URY A;  5GAG C;  3J7A F;  4L8J A;  2AMC B;  2LSS A;  1A62 A;  3D3R A;  2OTJ A;  1CQF A;  1EUJ A;  4QUC A;  5EAY A;  5HGQ A;  4DR5 L;  2FFK B;  2KVM A;  4BA2 I;  4A3B H;  1R4P B;  4R8I A;  5JPM C;  3MVV A;  2A8V A;  2N88 A;  2ZXO A;  1UUP A;  1PRT C;  3IKJ A;  3B6Y A;  1VMP A;  3TZU A;  3BZC A;  1K3B C;  2IL8 A;  1SN8 A;  1CA6 A;  3SVM A;  3KLS A;  3GTP B;  4QGU A;  5CYU A;  5IYC H;  4WJ4 A;  1A3V A;  1I94 Q;  3CHB D;  3D31 A;  5GQO A;  5JJZ A;  5K5P A;  1R9T B;  2P5Z X;  4B3S L;  4A3E H;  3D4D A;  1JB3 A;  5JPN C;  4UP8 A;  4A3M G;  1Y1V G;  2DY7 A;  4HMI A;  1V43 A;  4ILW A;  1MIU A;  2WII B;  5IT9 L;  4IJL A;  4DK3 C;  5KIX A;  1B7Y B;  2CVR A;  1W6J A;  4WRD A;  5BN5 A;  3H15 A;  2R92 B;  2R93 H;  1E1T A;  4KLK A;  3HOV B;  3VYT A;  4IFD G;  2R6G A;  1K0R A;  3A5U A;  4DR5 Q;  3DEO A;  4CDC C;  4F8M A;  3LWE A;  2UXB Q;  3A56 A;  1Y14 B;  4CBV A;  2KOL A;  4IFD I;  1LAC A;  1TS4 A;  2YYZ A;  1GHK A;  1AE3 A;  3H3V C;  3RLF A;  1JE5 A;  3A8J E;  4RKL A;  1IBL L;  2F3V A;  3HOU H;  4DNR B;  2UXC L;  4XYO A;  4B3S Q;  3JAM c;  3OOC A;  1RJT A;  2MQH A;  1WTQ A;  2IT1 A;  4A3I B;  4OWW B;  5CV7 A;  3QG1 A;  1N9W A;  2Z1C A;  1Z6H A;  1IHZ A;  5DM7 3;  5C5M A;  2WB1 B;  3PMF A;  3FKI B;  1Y1W H;  2L11 A;  2HT1 A;  1U0L A;  1NUC A;  2D62 A;  4B9X A;  1I3Q H;  4HCE A;  4RCN A;  3CC2 A;  1G51 A;  3K7A H;  1BR9 A;  2MFI A;  4BY1 G;  2YU9 B;  1LTS D;  3GQB A;  1P16 A;  1JWU D;  3NE5 B;  4A3G H;  3BVM A;  1CHP D;  4GN3 B;  4RHR A;  3VR5 A;  1IBL Q;  3KLR A;  3PUZ A;  2UXC Q;  1ZEQ X;  3M7N A;  4MHE A;  4A75 A;  4ODG A;  3U58 A;  3O13 A;  3CCJ A;  2EYL A;  2RDH A;  3TRE A;  4DKA C;  5M3M G;  4FO2 A;  1L1O B;  3MXP A;  3S16 B;  1M4V A;  1ZYR C;  2K05 A;  4C1N I;  4IN3 A;  4JI6 Q;  5J3B A;  1B9M A;  2Q2T A;  4JBM A;  2OCE A;  3HS0 C;  1X32 A;  4DV0 Q;  3SDZ A;  4F88 A;  1XWE A;  4DAP A;  1J8I A;  3CKI B;  2GVB A;  5CBA E;  4KN7 C;  1BUV T;  2VUM G;  3OHX C;  4DPG A;  2JA6 H;  1AFP A;  2VZA A;  4OO1 H;  1NJI C;  1DZ1 A;  5M5W B;  2R7Z B;  4LJZ C;  4Y7N H;  1JWS D;  4K6D A;  3R3O A;  4DR6 L;  1PH1 A;  1XNR Q;  1HUM A;  3QOL A;  4YWM A;  1LV9 A;  3J80 c;  2ZT9 C;  4DN4 M;  5IYC G;  3PUW A;  4AQY L;  3NP8 A;  2RKS A;  2IW3 A;  4A3K G;  2TSS A;  5JJI A;  4PMC A;  1KDB A;  2OQK A;  4RGT A;  4Q0F A;  5ELE A;  3K5M A;  4AIM A;  3I4M G;  2EPB A;  5EKL A;  4UY8 C;  5JJK A;  1PFS A;  1SAP A;  2CCZ A;  2RA4 A;  1EY0 A;  2BOS A;  3NQT A;  3BDO A;  1X3Q A;  5FO8 B;  2VB2 X;  1X9N A;  1UE6 A;  2LMC B;  1QNU A;  2E2H B;  3CP0 A;  2CW0 C;  3QWN A;  4UP9 A;  2E76 C;  1KXL A;  3BDC A;  4R1J A;  4DR6 Q;  4DV3 L;  4C3H G;  1E7Z A;  1D1K A;  1T5E A;  2NVY B;  1PV4 A;  2Q2I A;  1AW7 A;  2M2L A;  4RHS A;  1BBU A;  3I90 A;  1PH3 A;  1MI2 A;  2O5J C;  3PSI A;  1YHA A;  4QB4 A;  4LFA Q;  3GTL H;  2Y0S B;  5GRO A;  2NVQ H;  1SMY D;  3KJP A;  4HSP A;  2XSC A;  5CBE E;  1NMG A;  3K5O A;  1II3 A;  3M4O H;  1HXY D;  3EBE A;  4IUT A;  5I6W A;  5IP7 H;  4DR2 L;  2JXM B;  3J81 j;  4EGV A;  2SEB D;  2F0J A;  1PYW D;  1STH A;  4J6H A;  3MWY W;  1EY9 A;  2V4D A;  3OSO A;  1KL9 A;  4FP5 D;  1A6X A;  2L55 A;  4EQ5 A;  4ZLT F;  3U50 C;  1KDA A;  4QL5 A;  3RZD H;  2B3G A;  3H0G H;  3S1M B;  1AZP A;  4R4C A;  3CMA A;  2F0O A;  1AEX A;  1V9P A;  4EQO A;  4IUN A;  3GTJ H;  4DR1 Q;  3ICE A;  1HZ9 A;  5M5Y H;  3T56 B;  2MNA A;  5LHY 1;  4NP5 A;  4RGN A;  2UUB L;  1NE3 A;  2G5D A;  2Y0S E;  1H9J A;  2I0Q A;  4LF5 L;  1EFW A;  2FHT A;  1GUW A;  3QB3 A;  1F2M A;  2E2I H;  5LL6 X;  1TY2 A;  4DR2 Q;  2NN6 G;  4DA2 A;  5HGT A;  1A63 A;  2ZM6 L;  1PH6 A;  2KEN A;  3MAQ A;  1BCP F;  1F2L A;  3PIP A;  2BH8 A;  1N32 Q;  2NN6 I;  2CH4 W;  3ULL A;  2EYH A;  3C3L A;  4JOI C;  4YCW A;  4DU9 A;  1ESF A;  2EY1 A;  2A6E C;  4G7Z C;  2K5W A;  1ZXT A;  1IL2 A;  2OQ0 A;  4P74 A;  3OYY A;  2JQO A;  2F0K A;  2Z0S A;  1D2B A;  3U9S A;  3GTQ H;  5E3F A;  1XPO A;  1MJE A;  3TEH B;  3S1Q H;  4EQN A;  4G4K A;  4BXX H;  1U4R A;  2NVT B;  2R7D A;  2G9H D;  2GN5 A;  3K7U C;  3R93 A;  2UUB Q;  1TII D;  4UDU C;  3UDX A;  5FJ8 H;  4LF5 Q;  1HFG A;  1TWA B;  2QIL A;  2QDL A;  1IW7 C;  1Q86 C;  4R4Q A;  3HOW G;  1EFI D;  4LMQ D;  1VQC A;  3BYY B;  3PV0 A;  3K59 A;  3LNN A;  2VW9 A;  4KY5 A;  5JVH 3;  2CKZ B;  3JC6 6;  4J15 A;  1TWG B;  1FD7 D;  2EXD A;  5CV5 A;  3J81 L;  1FJG L;  1EOV A;  1F2Y A;  1PTO H;  3DM1 A;  3SXH A;  3CPF A;  1HR0 W;  3L2P A;  1Q7Y C;  1SNP A;  4H0L C;  4ME3 A;  1T9H A;  3ONA B;  4LUZ A;  3PUY A;  4DAY A;  3BVG A;  5C0X G;  1B3Q A;  2QEX A;  4KN4 C;  1JE4 A;  1BCP D;  3FDT A;  4QCL A;  2B2T C;  2Q8T A;  2RVL A;  4JI1 L;  5C0X I;  4HIM A;  5CV6 A;  1VQF A;  1BBX C;  5J1Z A;  5EPL A;  4JYA Q;  4GZY C;  3ULJ A;  4V0B A;  2A5H A;  2K28 A;  4HIK A;  2LFN A;  1Y8N B;  1SNQ A;  1WTP A;  5E7N A;  1B9N A;  1SYB A;  4LF7 L;  3KDF A;  3PO2 B;  3D6C A;  1SYD A;  3A8I E;  1EY4 A;  1JR0 D;  3UE1 A;  2F3W A;  2ASB A;  1Q1B A;  1XPR A;  4DUZ L;  1K3R A;  2RCF A;  5C3X A;  2IX3 A;  5EPK A;  1YJW A;  3RZO H;  3KUP A;  4HJ5 A;  3NPP A;  3TME A;  2I5H A;  2EYO A;  3K81 C;  1IYU A;  3F1Z A;  2A68 C;  4LUO A;  4JI1 Q;  1AZQ A;  4PMW A;  1VQ8 A;  3ND9 A;  3BU2 A;  3I72 A;  1Y8O B;  2PMZ B;  2WIN B;  5LMN W;  4C3I G;  3CF5 A;  3L9A X;  2BCO A;  1E3P A;  4IOC A;  1QNK A;  2JP1 A;  2UUC Q;  2I46 A;  3KYH C;  4K0K L;  4LF7 Q;  3FVQ A;  3HOX B;  2JA5 B;  1O80 A;  1PFN A;  2NVX H;  3LGJ A;  2AQ2 B;  4BY7 H;  2KJX A;  4NXM Q;  2B2U C;  1M8A A;  1I6H H;  4X66 L;  1I4R A;  4CGY B;  3A54 A;  1W3S A;  1L0W A;  4WJ3 M;  3GTG H;  1SRO A;  1X3G A;  2C5C A;  2PYK A;  2XGT A;  1I4H A;  2B63 B;  1GUT A;  4FF2 A;  3CU7 A;  1KD1 C;  4TRD A;  4OWT B;  4GOP B;  4YHH L;  1M90 C;  3S24 A;  3NUC A;  1DOK A;  1HR0 L;  3GTK B;  1S5C D;  3R2T A;  2NZ1 D;  1D1I A;  2IJ0 A;  4AYB G;  2ZXP A;  1K8M A;  5JEA J;  2PZT A;  3G4S A;  4NMZ A;  4ZQ3 A;  2PMZ E;  3BG3 A;  4XQQ A;  4OWX B;  4HJ9 A;  1JT8 A;  3HEJ A;  4GN5 A;  2JA9 A;  1SR3 A;  2KCC A;  3M7G A;  2JA7 G;  2QCP X;  1X3E A;  3ZYY X;  4NXN L;  4HJ7 A;  2K01 A;  1WTV A;  4XT3 B;  4X66 Q;  1WCM G;  3PO3 B;  2Z6K C;  1PVO A;  1XNQ L;  3HRZ C;  4S3S A;  1LT3 D;  2K5V A;  4HCS A;  5EQ0 A;  1FR3 A;  3HG9 A;  1HRJ A;  1E22 A;  1VMC A;  2HUG A;  4HJ8 A;  1XPU A;  4Y52 H;  1HR0 Q;  1E0B A;  4B3T L;  2KUM A;  3FP9 A;  1NY4 A;  3QJY A;  1HNW L;  3KLS X;  4XIG S;  2A69 D;  2NYZ D;  1D5X C;  3UE0 A;  1JMC A;  5EKI A;  4JBJ A;  1OXS C;  2PCF B;  2OEO A;  4DV5 L;  3T16 A;  2KA7 A;  4A3M H;  1M1K C;  2JA8 B;  3KK7 A;  1Y1V H;  4BBR B;  1A15 A;  5LMN L;  4NXN Q;  2CWA A;  4GOP A;  2R61 A;  4C3J H;  1HNX Q;  4KHZ A;  1HZC A;  1YJN A;  5KYI A;  1VQN A;  1SSO A;  4PQX A;  2H4O A;  4HAE A;  4IPG A;  1Q3L A;  4IFD H;  3F2C A;  3DHQ A;  3TS2 A;  2YV5 A;  3DM3 A;  5FLX E;  3WWV A;  4JI2 L;  3S14 B;  3D8G A;  1RDP D;  2KED A;  2K5Q A;  4F87 A;  5M3F B;  1VF7 A;  4B3T Q;  3VR3 A;  1GXD C;  1BCP B;  4P75 A;  1HNW Q;  3MFG A;  4A3D B;  2AWO A;  3CW2 C;  1EEF D;  1V1P A;  3NWS A;  4FNF A;  2Z9H A;  3W3A A;  1Q46 A;  1ILQ A;  2ES2 A;  1SYE A;  1STB A;  3EFX D;  1GVP A;  5LMN Q;  2D0O A;  1B1Z A;  2XRQ D;  1SFO H;  1CQV A;  1QB5 D;  5GAH C;  2G9D A;  1VDZ A;  1XTC D;  4GLA C;  2DN8 A;  5C44 B;  4BBS G;  3A5Z B;  5D3I B;  3S15 H;  1YNX A;  2RDG A;  2MJ8 A;  3GTM B;  1VQB A;  3GD7 A;  1JQY D;  1KLG D;  4GS3 A;  1N36 L;  4KV6 A;  1EWI A;  1GUG A;  4A3J G;  1C4Q A;  4QUF A;  4ID6 A;  2B8F A;  4GNX C;  2HDL A;  3ER0 A;  4DGZ A;  1G6P A;  1ICF B;  3A74 A;  1E24 A;  2GA4 B;  1O7L A;  2EOT A;  5BN4 A;  5FK9 C;  4X3S A;  2FIN B;  1Q8K A;  2UU9 Q;  1STY A;  2WAQ G;  4DK6 C;  5GAD C;  3P20 A;  4JV5 Q;  5IWA Q;  2B8G A;  3HOZ G;  5K36 G;  3MA2 B;  4A3I H;  5M3M H;  4LWC A;  5ELF A;  3DXJ C;  2BDN A;  3T1Y L;  3J7Z C;  2E2J B;  3HZX A;  2AUJ D;  2PZW A;  3FRP B;  5COR A;  1CZG A;  1W2B A;  4A3F G;  5COY A;  5CC4 A;  5EGT A;  1N36 Q;  3HKS A;  2VUM H;  3P7J A;  3ERO A;  4WOR A;  1UEB A;  5C3E B;  3I2Z A;  1FL0 A;  3QIA A;  2YU9 H;  4G7O C;  3R2I A;  4N8X 1;  1YBY A;  5AJ3 L;  5F2D A;  3C1F A;  5FO9 B;  3I4N G;  3S2H B;  1S72 A;  4IUU A;  4KI0 A;  1I6V C;  5AFW A;  2I07 B;  4JI8 L;  4X65 Q;  4H7B A;  1WTW A;  3AMU A;  4A93 B;  1I4X A;  2D9U A;  2K33 A;  3N6R A;  4RWS C;  4ZUI A;  5G3L F;  2EE1 A;  4DR4 L;  1F9P A;  1CM9 A;  1WTO A;  2EVB A;  1WI5 A;  4H44 C;  4A3K H;  3ZJY C;  3WDN A;  3T1Y Q;  2E74 C;  4MZ9 A;  3MXN A;  4R4I A;  5C4X B;  3I4M H;  3STB C;  3CC7 A;  1KQS A;  3GP7 A;  1ENA A;  3PIO 3;  1TVX A;  1PFB A;  4C3J G;  1IBM L;  3CCL A;  3VYS A;  3NEM A;  1LTR D;  1N34 L;  4B3R L;  4DF7 A;  2L15 A;  4K2L A;  1UNS A;  2J4X A;  2E2D C;  5D65 A;  5AJ3 Q;  1BO0 A;  4LNQ A;  4O42 A;  2RSN A;  3LWU A;  1IXR A;  4A3L G;  1SND A;  4C3H H;  3X3N A;  4MIU A;  2A6H C;  5CV9 A;  3CD6 A;  2B2Y C;  2X69 A;  1ONL A;  4JCV E;  1O7I A;  3VYR A;  1HZB A;  1CK1 A;  5JEA G;  4AH6 A;  1HQR D;  2F0P A;  2B2W C;  3NBH B;  2A6E D;  3TBI B;  1HUN A;  1KTK A;  2Q8R E;  5IT9 E;  1D7Q A;  2R92 G;  1IL8 A;  1VS0 A;  4N9P A;  2NB0 A;  1N34 Q;  3I4O A;  3PGZ A;  3M85 A;  4B3R Q;  3HOV G;  4RGM A;  1QVG A;  1LTI D;  1GUN A;  1GJX A;  1TS3 A;  1UAP A;  5G3L D;  2F3I A;  2WAC A;  2QA4 A;  2R7F A;  1K8G A;  1K8A C;  4DFA A;  1OO9 B;  2SDF A;  2MUY A;  2NVY H;  3Q6S A;  2F0T A;  3L7Z C;  4DNT B;  3HOY B;  1SE8 A;  1YIJ A;  1EIF A;  1EIG A;  4IUV A;  4MNO A;  1IW7 D;  1KC8 C;  1XMO L;  4X3T A;  4U67 3;  1JJC B;  5GAE C;  3S1R H;  5M5X B;  1EWC A;  4POG A;  3KBG A;  2C9O A;  1NR4 A;  2NZO A;  4A3I G;  1ILP A;  1X65 A;  2F4I A;  2NBF A;  2UUA L;  1IKM A;  3CCR A;  4PV1 C;  2E5L L;  4A3B B;  1Z7T A;  2WB1 G;  4LF6 L;  3FKI G;  3JAM L;  2NN6 H;  2EY6 A;  4DXF A;  1TXY A;  2DNE A;  3CME A;  4DAV A;  3CQZ H;  4CJ2 C;  3RR5 A;  3TN2 A;  4A3E B;  3E9H A;  1MJC A;  2ENB A;  2RHQ B;  3BZD B;  1PFM A;  4PZ7 A;  3NBH A;  1AN8 A;  4MTN A;  2JE6 I;  4RGO S;  1EIH A;  1HNZ L;  1S5F D;  4J8Q A;  2R93 B;  5IY0 A;  1VQL A;  3T51 B;  1L1O C;  1EU3 A;  5KGU A;  1WD0 A;  2UUA Q;  1TKW B;  2E5L Q;  2ZTD A;  1KAB A;  3F2D A;  2VQE L;  3JAM E;  3HOW H;  3E3X A;  1CSQ A;  1KNE A;  4IPC A;  3CCS A;  1T5X D;  3HOU B;  1C9O A;  1H9M A;  2R7Z G;  2MGS A;  1IYV A;  3F8T A;  1PTO F;  2A68 D;  1HNZ Q;  4KKS A;  2X6L A;  1SNM A;  3S2D H;  5E4W C;  4EX5 A;  1Y1W B;  4AQY Q;  1VQG A;  1EZ6 A;  1C48 A;  5EPJ A;  1PHJ A;  1EEI D;  5C0X H;  2KEE A;  4K6L A;  1JWM D;  5FKA C;  1I3Q B;  1EY5 A;  2YTV A;  1YNN D;  1DCZ A;  1F77 A;  5C4Z A;  3K7A B;  4L5Q A;  2VY3 A;  1CZW A;  3SK8 A;  2Q2U A;  1TWA H;  1KAA A;  1AH9 A;  1K83 H;  3CCU A;  4A3G B;  1QUQ A;  1STE A;  5JJL A;  1D5M C;  2E75 C;  1QJO A;  1OXT A;  2WKC A;  3OWE B;  1QE6 A;  2JEA I;  1MBY A;  4OX9 L;  1TWG H;  4WJW A;  1YHB A;  4DV3 Q;  1EQV A;  4LFB L;  1JOK A;  1HHV A;  4C2M H;  2LXJ A;  1STN A;  4ME5 A;  5KYL A;  3PQI A;  2F0F A;  4XQN A;  2Y0S G;  4JI4 L;  3S17 H;  4KJO A;  1S5E D;  4X64 L;  4TQU S;  2VB3 X;  4DXG A;  3DWP A;  2JA6 B;  1RHP A;  2HQE A;  1VQP A;  4KD3 A;  1SYG A;  4LUV A;  4Y7N B;  3FMC A;  3NTI A;  5A2Q L;  3HKZ B;  1PH9 A;  4C3I H;  2KHS A;  2PQA A;  1PTO D;  5C4J H;  1BF4 A;  2CWP A;  4DAY B;  3G6E A;  1PLF A;  5DAU A;  4GKJ L;  1PZK D; 
#chains in the Genus database with same CATH homology
 1R4Q B;  1H9S A;  1JOQ A;  1EY6 A;  3I3C A;  2F0I A;  2F0E A;  4KD4 A;  3VA5 A;  4NKL A;  2MPM A;  1WTR A;  4U68 A;  2NTT A;  1LAB A;  1CT1 D;  5A2Q E;  1DOM A;  1ET6 A;  3OW7 A;  4XDX A;  4FXK C;  1TQO A;  1BXT A;  1B4O A;  2NVQ B;  1O7Y A;  2NUC A;  5IGD A;  4WFN 3;  3M4O B;  5ELC A;  2BE5 D;  2JEB I;  2KQ3 A;  1V1O A;  3W2D A;  1PRT F;  4KTA A;  5JAV A;  1EU4 A;  1FGB D;  3K58 A;  4FXD A;  2EYP A;  1CHQ D;  2PO4 A;  3RZD B;  4XTC S;  3PIP 3;  4RKB A;  3H0G B;  1EQT A;  3DMU A;  5C3W A;  3D4R A;  2F0U A;  1FNV A;  1B53 A;  4M8A A;  5M5Y B;  1NSN S;  3BDL A;  3J81 E;  1JIC A;  2K7V A;  1SNO A;  1LTB D;  4F7X A;  2E2I B;  4HED A;  5I2X A;  2QDB A;  2J7Z A;  3OMG A;  2ICE C;  1RTO A;  5T1G A;  3NQI A;  3BYT B;  4DK0 A;  4ZKC B;  1NCV A;  3MHB A;  2B2T A;  4IUR A;  3GTQ B;  1H9R A;  1HA6 A;  3G7L A;  3S1Q B;  2BA0 A;  5JVG 3;  4N9T A;  2L9H A;  1WTX A;  1PRT D;  1L0X B;  2PZU A;  2PW7 A;  3P75 A;  4MN3 A;  3I8Z A;  1TWF B;  3MXG A;  3T4A C;  2EYM A;  2K5D A;  5EKK A;  4R8N A;  3H6M A;  2AUK A;  3ERQ A;  1LT6 D;  3T13 A;  4L63 B;  3G6J B;  2F0G A;  1BOS A;  1PTO B;  1U4P A;  4KKT A;  4O1N A;  1B2T A;  4K8J A;  2XRS D;  3K0Y A;  1I4G A;  5K36 H;  1JC7 A;  2IX1 A;  2RSO A;  2EZV A;  2FJ2 A;  1JOR A;  1A3U A;  1U4L A;  1V1P B;  3J7A V;  1EYA A;  2A6H D;  2B2U A;  3D6W A;  5J22 A;  3VR2 A;  3VR4 A;  4FF1 A;  1EZ8 A;  3E6Z X;  1XYI A;  2EDG A;  5EJW A;  1BDO A;  5E4X A;  3D4W A;  1TY0 A;  3EA6 A;  4C56 C;  2RQX A;  1SDF A;  1F9S A;  4RA8 A;  1GUS A;  4M1U B;  4KY6 A;  4ULL A;  3RZO B;  4CKC A;  3AB9 A;  3BS1 A;  2O2L D;  4J1M A;  4ZAI A;  4RFB A;  1RF2 D;  1G8Z D;  1LTG D;  1Q1E A;  4ZKB B;  5KEE A;  4KY7 A;  3V05 A;  4CHT B;  3OMC A;  3GO5 A;  2F0D A;  1MSG A;  3VA7 A;  1W6K A;  1ZYR D;  3NWT A;  1WVL A;  2NVX B;  4RAU C;  4G7H C;  4BY7 B;  4G57 A;  3WOE A;  2B2V C;  5I2Y A;  1I6H B;  1S4Z A;  2J0T D;  5JEA H;  3TP8 A;  3GTG B;  3EQL C;  3F2U A;  2F0M A;  3A8K E;  4K8I A;  1MSH A;  1ZKO A;  2EYJ A;  1LTT D;  4BS9 A;  5TSS A;  1D5Z C;  1TU2 B;  5CV4 A;  3PUV A;  1G6Z A;  1S5B D;  4FYD A;  3VR6 A;  4E6I A;  2K04 A;  3CRL C;  3Q24 A;  3H91 A;  2EJM A;  2MHV A;  1PMR A;  1F9R A;  3TZD A;  2WP8 J;  5KNB A;  5I4D A;  2CW0 D;  2AWN A;  4BWG B;  2PNR C;  2QF7 A;  2F0L A;  1HA5 A;  5IGG A;  3K5L A;  3OIQ A;  1BNZ A;  1PRT B;  4I7Z C;  1EYC A;  1SE3 A;  4H13 C;  1ENF A;  3NHH A;  1SE2 A;  4XYQ A;  3ITP A;  1Y69 U;  4TKO B;  4A3M B;  1Y1V B;  5ISR A;  4KK7 A;  1ICW A;  3NSW A;  3MXU A;  1WD1 A;  1MGS A;  2X6G A;  3NBI A;  5IGB A;  2PPB C;  4B08 A;  1IKL A;  4HSV A;  4RCO A;  3N52 A;  5DEH A;  1EYD A;  3A55 A;  2AQ3 B;  2EY5 A;  4IUP A;  2A74 C;  4LAA A;  4K5X A;  1SFO B;  3SE0 A;  2ID0 A;  1QOH A;  4KJN A;  2ZXR A;  1SXT A;  3S15 B;  4OGQ C;  1QG7 A;  1GUO A;  1GHJ A;  5EBD A;  5HUR A;  3OWF A;  4BY1 B;  1PXU A;  4V19 0;  2Z4H A;  4PMB A;  1QWY A;  5IOD A;  2AQ1 B;  1ML0 D;  3I4L A;  1YNJ C;  3WOF A;  1OXV A;  4CJ1 B;  2HDM A;  4ZK9 B;  5M3M B;  3SEB A;  5ELD A;  5CR3 A;  3K5N A;  1O7Z A;  3OPO A;  2A69 C;  2Z4I A;  3RD4 A;  3OIP A;  3X3M A;  4YIJ A;  2SNM A;  3SK5 A;  3RUZ A;  2VUM B;  4QMG A;  2B2Y A;  1TT2 A;  4IQZ A;  5IIF A;  4EQP A;  3Q22 A;  1EOT A;  1SEB D;  2H1E A;  2EYF A;  2B2W A;  5C0X J;  1HCZ A;  5EBC A;  3C2P A;  2A73 B;  5DNF A;  1JOO A;  3IL8 A;  4A3K B;  1G2T A;  5T1I A;  3SHL A;  3S9W A;  1I4Q A;  4ZRZ A;  3I4M B;  2F0W A;  3U9O A;  3DWQ A;  4XXE A;  5IGF A;  2F1M A;  2F0S A;  5JOB A;  2PW5 A;  3H09 A;  3LX0 A;  5ELB A;  5CV8 A;  3M4Y A;  4CJ0 B;  3H94 A;  5IOC A;  3DEP A;  1U9R A;  2XIW A;  3PUX A;  4QF4 A;  1B3A A;  4C3H B;  1OXX K;  5IGE A;  2DY8 A;  2SOB A;  1Y8P B;  1STG A;  1A2U A;  4KKU A;  3TSS A;  1HFN A;  1L0Y B;  2FMM A;  4XQJ A;  2KCN A;  3V96 A;  1SJH D;  2BA1 A;  3I70 A;  5D14 A;  2Q8I B;  1KNA A;  5I6Y A;  1CI3 M;  1SYF A;  5C4H A;  2HCI A;  4K5V A;  4RH6 A;  3IFT A;  1H9S B;  3QOJ A;  3TDQ A;  4LK1 C;  3J80 L;  4R9W A;  4ABN A;  1NAP A;  4HN7 A;  3V2T A;  4ZUJ A;  2K1B A;  5M9O A;  2M00 A;  3FPP A;  1LTA D;  1TS2 A;  1VCI A;  4K5W A;  2RDF A;  1CFM A;  3S1R B;  2IWH A;  4BA1 I;  4I65 A;  1C8C A;  4OIK A;  1I4P A;  2K03 A;  3A7L A;  5A35 A;  1G29 1;  4OIJ A;  3NTK A;  5I9O A;  3EVQ A;  1EWH A;  1HPC A;  1HTP A;  2VNU D;  3P1H A;  3Q0A A;  4XT1 B;  3IAY A;  5CGK A;  3CQZ B;  3MC0 B;  5J39 A;  1ENC A;  2WKD A;  3ND8 A;  3NTH A;  2HCC A;  3J80 E;  5FO7 B;  1Z47 A;  4OHJ A;  4KHV A;  4L6T B;  4TSS A;  2B39 A;  1DXM A;  1Q8I A;  1SJE D;  2QEJ C;  5CMD A;  1ROD A;  1LLR D;  3CRK C;  2D5D A;  3R8B A;  1CTM A;  1STA A;  1UEA B;  2CHB D;  2EXZ A;  2FMC A;  5IGC A;  4IZ8 A;  2Z8L A;  3HOW B;  3TP5 A;  1AP0 A;  1ET9 A;  3I91 A;  4FF4 A;  4OO1 G;  1GOZ A;  3SR1 A;  4OL7 A;  1VF5 C;  2L4N A;  1E2Z A;  1K8O A;  4QIW B;  1EY7 A;  4OO1 I;  3S2D B;  2NWG A;  2K6A A;  1RCV D;  1Q90 A;  2OT2 A;  3TP6 A;  1A2T A;  1TR5 A;  4B9W A;  3GTL B;  5I9P A;  1G2S A;  1K83 B;  4CKB A;  1PZI D;  2OXP A;  4JK1 C;  2RBM A;  3NK9 A;  3BVZ A;  1PZJ D;  2K32 A;  1F9Q A;  2ICI A;  1ESR A;  1DD2 A;  2MP1 A;  2XWJ B;  4C2M B;  1DOL A;  5C5L A;  4IUQ A;  3GV6 A;  1XXG A;  1J9O A;  1CA5 A;  1X3P A;  3GTJ B;  2F0N A;  1RD9 D;  3S17 B;  3I73 A;  1E2V A;  5DM6 3;  3K57 A;  1Q12 A;  4Z9C B;  4X3U A;  4C3I B;  3FEW X;  1F2Z A;  4KMU C;  5C4J B;  2LKV A;  3E0J A;  1DYQ A;  1G91 A;  2L1B A;  2XNA C;  1B44 D;  3UI2 A;  4FVM A;  2EY2 A;  2OF1 A;  4NW2 A;  3RMH A;  4DK1 A;  2LY7 A;  5C6A A;  5BN3 A;  3SK6 A;  4EVO A;  4CKE A;  2EJG C;  3MZ5 A;  1DON A;  1DJR D;  4AYB B;  2QKI C;  2SNS A;  2F03 A;  5NUC A;  1SMY C;  1YNN C;  1MD2 D;  2R3Z A;  4FXG C;  2L12 A;  2JA7 B;  4IFD J;  5KNC A;  2IX0 A;  5LL6 S;  3KBX A;  4K2K A;  1WCM B;  1A3T A;  4HTH A;  3VYU A;  3S1N B;  3HP3 A;  3GV3 A;  4HMJ A;  4IAL A;  1HQM C;  4Q5V A;  2F0Q A;  1RKN A;  2KEC A;  1U4M A;  5KRU A;  1QIL A;  2BDO A;  1LT5 D;  2XVS A;  5D3D A;  1OXU A;  4C1N K;  3J7Y W;  4K14 A;  4P2C B;  1HTL D;  2M9V A;  1PTO C;  1JCK B;  3L3O C;  3M3Y B;  2JYO A;  5FLX L;  1YNJ D;  1LO5 D;  4FF3 A;  3IFD A;  2D2C C;  2NTS A;  2EJF C;  2O5I C;  2F0V A;  3GTO B;  3K6O A;  3Q23 A;  4X3K A;  3QO2 A;  1BQQ T;  3DUZ A;  1PDQ A;  2CQA A;  3MEH A;  1QCB D;  3SK4 A;  1S5D D;  1FNW A;  2DNC A;  4BBS B;  1B50 A;  2O4X A;  4UAI A;  1KLU D;  1FYC A;  2XN9 C;  5KND A;  3HGB A;  1TS5 A;  1V8Q A;  4A3J B;  1H9K A;  1RTN A;  3EJI A;  3E5S A;  3NXW A;  3TP7 A;  1XX8 A;  3C46 A;  2JSO A;  2BE5 C;  2WV6 D;  2WAQ B;  4HR7 B;  2F0H A;  3HOZ B;  1BCP C;  1KDC A;  1TWH B;  2N55 A;  1SNC A;  3C1E A;  1O78 A;  1D6E C;  1I50 B;  4A3F B;  4NDX A;  1TWC B;  1FNU A;  1SYC A;  2PQE A;  5E1F A;  2TMP A;  4PNY A;  4ZYS A;  2IPK D;  3MFY A;  3KF8 A;  1E2W A;  2B2V A;  1LT4 D;  2XWB B;  2LS0 1;  3AU7 A;  3MTS A;  3I4N B;  3DWA A;  5FOB B;  3T53 B;  2L5T A;  2VXW A;  1NR2 A;  1EL0 A;  1EY8 A;  4JBW A;  3A7A B;  1SBB B;  3FPU B;  1DM0 B;  4C3J B;  2L0C A;  1SE4 A;  3URY A;  3J7A F;  4L8J A;  3D3R A;  1CQF A;  4QUC A;  2FFK B;  2KVM A;  4BA2 I;  1R4P B;  4R8I A;  5JPM C;  3MVV A;  2N88 A;  2ZXO A;  1UUP A;  1PRT C;  3IKJ A;  1VMP A;  3TZU A;  2IL8 A;  1CA6 A;  3SVM A;  3KLS A;  3GTP B;  5CYU A;  1A3V A;  3CHB D;  3D31 A;  5JJZ A;  5K5P A;  1R9T B;  3D4D A;  1JB3 A;  5JPN C;  2DY7 A;  4HMI A;  1V43 A;  4ILW A;  2WII B;  5IT9 L;  5KIX A;  2CVR A;  1W6J A;  4WRD A;  5BN5 A;  2R92 B;  3HOV B;  3VYT A;  4IFD G;  2R6G A;  3DEO A;  4F8M A;  3LWE A;  3A56 A;  4CBV A;  2KOL A;  4IFD I;  1LAC A;  1TS4 A;  2YYZ A;  1GHK A;  3H3V C;  3RLF A;  4RKL A;  3A8J E;  2F3V A;  4DNR B;  4XYO A;  3OOC A;  1RJT A;  1WTQ A;  2IT1 A;  4A3I B;  5CV7 A;  3QG1 A;  2Z1C A;  1Z6H A;  1IHZ A;  5DM7 3;  5C5M A;  2WB1 B;  3PMF A;  3FKI B;  2L11 A;  1NUC A;  2D62 A;  4B9X A;  4HCE A;  4RCN A;  1BR9 A;  2YU9 B;  1LTS D;  3GQB A;  1JWU D;  3NE5 B;  3BVM A;  1CHP D;  4RHR A;  3VR5 A;  3KLR A;  3PUZ A;  1ZEQ X;  3M7N A;  4MHE A;  4ODG A;  3O13 A;  2EYL A;  2RDH A;  4FO2 A;  3MXP A;  3S16 B;  1M4V A;  1ZYR C;  2K05 A;  4C1N I;  4IN3 A;  1B9M A;  3HS0 C;  1X32 A;  3SDZ A;  4F88 A;  1XWE A;  4DAP A;  1J8I A;  3CKI B;  5CBA E;  4KN7 C;  1BUV T;  3OHX C;  1AFP A;  4OO1 H;  1DZ1 A;  5M5W B;  2R7Z B;  4LJZ C;  1JWS D;  4K6D A;  3R3O A;  1HUM A;  3QOL A;  1LV9 A;  2ZT9 C;  4DN4 M;  3PUW A;  3NP8 A;  2RKS A;  2IW3 A;  2TSS A;  4PMC A;  1KDB A;  4RGT A;  4Q0F A;  5ELE A;  3K5M A;  2EPB A;  5EKL A;  1SAP A;  2RA4 A;  1EY0 A;  2BOS A;  3NQT A;  3BDO A;  1X3Q A;  5FO8 B;  2VB2 X;  2LMC B;  1QNU A;  2E2H B;  2CW0 C;  3QWN A;  2E76 C;  3BDC A;  4C3H G;  1D1K A;  1T5E A;  2NVY B;  1AW7 A;  2M2L A;  4RHS A;  3I90 A;  1MI2 A;  2O5J C;  4QB4 A;  2Y0S B;  1SMY D;  4HSP A;  2XSC A;  5CBE E;  3K5O A;  1II3 A;  1HXY D;  4IUT A;  5I6W A;  2JXM B;  4EGV A;  2SEB D;  2F0J A;  1PYW D;  4J6H A;  1STH A;  3MWY W;  1EY9 A;  2V4D A;  3OSO A;  4FP5 D;  1A6X A;  2L55 A;  4ZLT F;  1KDA A;  3S1M B;  1AZP A;  2F0O A;  1AEX A;  4EQO A;  4IUN A;  3T56 B;  5LHY 1;  4NP5 A;  4RGN A;  1GUW A;  1H9J A;  2FHT A;  3QB3 A;  1F2M A;  5LL6 X;  1TY2 A;  2NN6 G;  4DA2 A;  5HGT A;  3MAQ A;  1BCP F;  1F2L A;  2NN6 I;  2EYH A;  3C3L A;  4DU9 A;  1ESF A;  2EY1 A;  2A6E C;  4G7Z C;  2K5W A;  1ZXT A;  2F0K A;  1D2B A;  3U9S A;  5E3F A;  4EQN A;  4G4K A;  2NVT B;  1U4R A;  2G9H D;  3R93 A;  1TII D;  4UDU C;  1HFG A;  1TWA B;  2QIL A;  1IW7 C;  1EFI D;  4LMQ D;  3BYY B;  3PV0 A;  3K59 A;  3LNN A;  4KY5 A;  5JVH 3;  1TWG B;  1FD7 D;  5CV5 A;  3J81 L;  1F2Y A;  1PTO H;  3DM1 A;  3SXH A;  1SNP A;  4H0L C;  3ONA B;  3PUY A;  4DAY A;  3BVG A;  5C0X G;  4KN4 C;  1JE4 A;  1BCP D;  3FDT A;  4QCL A;  2B2T C;  2Q8T A;  2RVL A;  5C0X I;  1BBX C;  5CV6 A;  5J1Z A;  5EPL A;  4GZY C;  4V0B A;  2A5H A;  2K28 A;  2LFN A;  1Y8N B;  1SNQ A;  1WTP A;  1B9N A;  1SYB A;  3PO2 B;  3D6C A;  1SYD A;  3A8I E;  1EY4 A;  1JR0 D;  2F3W A;  1Q1B A;  5C3X A;  2IX3 A;  5EPK A;  3KUP A;  3NPP A;  3TME A;  2EYO A;  1IYU A;  2A68 C;  1AZQ A;  4PMW A;  3ND9 A;  3I72 A;  1Y8O B;  2PMZ B;  2WIN B;  4C3I G;  3L9A X;  2BCO A;  1QNK A;  2JP1 A;  2I46 A;  3FVQ A;  3HOX B;  2JA5 B;  1O80 A;  1PFN A;  2AQ2 B;  2KJX A;  2B2U C;  1M8A A;  1I4R A;  4CGY B;  3A54 A;  2C5C A;  2PYK A;  1I4H A;  2B63 B;  1GUT A;  4FF2 A;  3CU7 A;  4TRD A;  3NUC A;  1DOK A;  3GTK B;  1S5C D;  3R2T A;  2NZ1 D;  1D1I A;  2IJ0 A;  2ZXP A;  1K8M A;  5JEA J;  2PZT A;  4NMZ A;  4ZQ3 A;  3BG3 A;  4XQQ A;  3HEJ A;  2KCC A;  3M7G A;  2QCP X;  3ZYY X;  2K01 A;  1WTV A;  4XT3 B;  3PO3 B;  3HRZ C;  4S3S A;  1LT3 D;  4HCS A;  5EQ0 A;  1FR3 A;  3HG9 A;  1HRJ A;  1VMC A;  2HUG A;  1E0B A;  2KUM A;  3QJY A;  3KLS X;  4XIG S;  2A69 D;  2NYZ D;  1D5X C;  5EKI A;  1OXS C;  2PCF B;  2OEO A;  3T16 A;  2KA7 A;  2JA8 B;  3KK7 A;  4BBR B;  1A15 A;  2R61 A;  4KHZ A;  5KYI A;  1SSO A;  4PQX A;  2H4O A;  4HAE A;  1Q3L A;  4IFD H;  3DHQ A;  5FLX E;  3S14 B;  3D8G A;  1RDP D;  2KED A;  2K5Q A;  4F87 A;  5M3F B;  1VF7 A;  3VR3 A;  1GXD C;  1BCP B;  3MFG A;  4A3D B;  2AWO A;  1EEF D;  1V1P A;  3NWS A;  4FNF A;  3W3A A;  1ILQ A;  1SYE A;  1STB A;  3EFX D;  1B1Z A;  2XRQ D;  1CQV A;  1QB5 D;  2G9D A;  1VDZ A;  1XTC D;  2DN8 A;  5C44 B;  5D3I B;  2RDG A;  2MJ8 A;  3GTM B;  3GD7 A;  1JQY D;  1KLG D;  4KV6 A;  1GUG A;  1C4Q A;  4QUF A;  4ID6 A;  2B8F A;  2HDL A;  4DGZ A;  2GA4 B;  1O7L A;  2EOT A;  5BN4 A;  5FK9 C;  4X3S A;  2FIN B;  1STY A;  3P20 A;  2B8G A;  5K36 G;  3MA2 B;  5ELF A;  3DXJ C;  2BDN A;  2E2J B;  3HZX A;  2AUJ D;  2PZW A;  3FRP B;  5COR A;  1CZG A;  5COY A;  5CC4 A;  5EGT A;  3P7J A;  3ERO A;  4WOR A;  5C3E B;  3QIA A;  4G7O C;  3R2I A;  5F2D A;  3C1F A;  5FO9 B;  3S2H B;  4IUU A;  4KI0 A;  1I6V C;  5AFW A;  2I07 B;  4H7B A;  1WTW A;  3AMU A;  4A93 B;  1I4X A;  2D9U A;  2K33 A;  3N6R A;  4RWS C;  4ZUI A;  5G3L F;  2EE1 A;  1F9P A;  1CM9 A;  1WTO A;  2EVB A;  4H44 C;  3WDN A;  2E74 C;  3MXN A;  5C4X B;  3GP7 A;  1ENA A;  3PIO 3;  1TVX A;  1PFB A;  4C3J G;  3VYS A;  1LTR D;  4DF7 A;  4K2L A;  1UNS A;  2J4X A;  2E2D C;  5D65 A;  1BO0 A;  4O42 A;  2RSN A;  3LWU A;  1SND A;  3X3N A;  4MIU A;  2A6H C;  5CV9 A;  2B2Y C;  2X69 A;  1ONL A;  3VYR A;  1CK1 A;  5JEA G;  1HQR D;  2F0P A;  2B2W C;  2A6E D;  3TBI B;  1HUN A;  1KTK A;  2Q8R E;  5IT9 E;  1IL8 A;  4N9P A;  2NB0 A;  3M85 A;  4RGM A;  1LTI D;  1GUN A;  1GJX A;  1TS3 A;  1UAP A;  5G3L D;  2WAC A;  4DFA A;  1OO9 B;  2SDF A;  2MUY A;  3Q6S A;  2F0T A;  3L7Z C;  4DNT B;  3HOY B;  1EIG A;  4IUV A;  1IW7 D;  4X3T A;  4U67 3;  5M5X B;  1EWC A;  3KBG A;  2C9O A;  1NR4 A;  1ILP A;  2F4I A;  2NBF A;  1IKM A;  4A3B B;  4PV1 C;  1Z7T A;  3JAM L;  2NN6 H;  2EY6 A;  4DXF A;  2DNE A;  4DAV A;  4CJ2 C;  3TN2 A;  4A3E B;  2ENB A;  3BZD B;  1PFM A;  3NBH A;  1AN8 A;  2JE6 I;  4RGO S;  1EIH A;  1S5F D;  4J8Q A;  2R93 B;  3T51 B;  1EU3 A;  5KGU A;  1WD0 A;  1TKW B;  1KAB A;  3JAM E;  1KNE A;  1T5X D;  3HOU B;  1H9M A;  2MGS A;  1IYV A;  1PTO F;  2A68 D;  4KKS A;  2X6L A;  1SNM A;  5E4W C;  1Y1W B;  1EZ6 A;  1C48 A;  5EPJ A;  1EEI D;  5C0X H;  2KEE A;  4K6L A;  1JWM D;  5FKA C;  1I3Q B;  1EY5 A;  1YNN D;  1DCZ A;  1F77 A;  5C4Z A;  3K7A B;  1CZW A;  3SK8 A;  1KAA A;  4A3G B;  1STE A;  1D5M C;  2E75 C;  1QJO A;  1OXT A;  2WKC A;  3OWE B;  1QE6 A;  2JEA I;  1MBY A;  4WJW A;  1EQV A;  1JOK A;  1HHV A;  1STN A;  4ME5 A;  5KYL A;  2F0F A;  4XQN A;  4KJO A;  1S5E D;  4DXG A;  2VB3 X;  4TQU S;  3DWP A;  2JA6 B;  1RHP A;  2HQE A;  4KD3 A;  1SYG A;  4Y7N B;  3FMC A;  3NTI A;  5A2Q L;  3HKZ B;  2KHS A;  1PTO D;  1BF4 A;  1PLF A;  5DAU A;  1PZK D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...