2B2TA

Tandem chromodomains of human chd1 complexed with histone h3 tail containing trimethyllysine 4 and phosphothreonine 3
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
176
structure length
176
Chain Sequence
EEFETIERFMDCRIGRKGATGATTTIYAVEADGDPNAGFEKNKEPGEIQYLIKWKGWSHIHNTWETEETLKQQNVRGMKKLDNYKKKDQETKRWLKNASPEDVEYYNCQQELTDDLHKQYQIVGRIIAHSNQKSAAGYPDYYCKWQGLPYSECSWEDGALISKKFQAMIDEYFSRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chromodomain-helicase-DNA-binding protein 1
publication title Double chromodomains cooperate to recognize the methylated histone H3 tail.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Peptide binding protein
total genus 49
structure length 176
sequence length 176
chains with identical sequence B
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2005-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2b2tA02
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2b2tA01
1G2SA 4MN3A 2NWGA 1U4PA 3R93A 1WTPA 4IURA 1QG7A 1IL8A 5CORA 1RJTA 1TVXA 5D14A 1QNKA 2B2WA 2CVRA 1X3PA 1HFNA 1ICWA 1X32A 5DNFA 3G7LA 2KEDA 2N88A 1AP0A 1ILQA 1KNAA 1MSGA 5COYA 1WTXA 1J8IA 2KVMA 3F2UA 3P7JA 1EOTA 4IUTA 4IUPA 1DOKA 3DM1A 2B2TA 4ZAIA 5T1IA 1F9SA 2L4NA 2HDMA 4IUUA 4MHEA 1CM9A 1F9RA 1HRJA 2MJ8A 1ZXTA 2KUMA 1NR4A 2EOTA 2R3ZA 1EIHA 2IL8A 1G6ZA 1HHVA 2B2YA 2KECA 1VMPA 1WVLA 1U4LA 1DZ1A 2N55A 3D6WA 4O42A 1SSOA 2NZ1D 2JYOA 1AZPA 4R9WA 1A15A 4X3KA 4ZK9B 1SDFA 4HEDA 3TN2A 1B2TA 2HDLA 2B2VC 1MSHA 2K1BA 4ZLTF 3LWEA 1RHPA 1ML0D 4X3TA 2K03A 1RODA 3I91A 5EKIA 5CMDA 2X69A 1O7YA 2FMMA 1JE4A 2M2LA 3N52A 2L9HA 1WTVA 1B50A 1WTOA 1BNZA 2MPMA 1MGSA 1HUMA 1HFGA 1WTQA 1M8AA 1BO0A 4OIKA 5CBEE 2FINB 4CJ1B 4OIJA 4X3UA 1EL0A 2L1BA 3HP3A 2K01A 1O80A 4IUQA 2B2UC 3I8ZA 1X3QA 2FJ2A 3KBXA 5E4XA 2H1EA 2MP1A 1XYIA 5EPKA 2B2WC 2K05A 5EPJA 1B4OA 1GUWA 3QO2A 4QUFA 2FFKB 1WTRA 2K04A 1DOLA 1F9QA 5EQ0A 4HSVA 3MTSA 4RWSC 1WTWA 1C8CA 2L11A 1G91A 2JP1A 3H91A 1BF4A 4RA8A 1CA6A 1EQTA 3UI2A 1NAPA 1XX8A 1HA6A 1EIGA 2EPBA 2B2TC 4RAUC 2MGSA 1LV9A 2B2VA 1HUNA 1NCVA 2KEEA 5D65A 1ESRA 1RTOA 2FHTA 3GV6A 4X3SA 2Q8RE 1ILPA 1PFBA 1PFMA 3ONAB 1IKMA 3MWYW 2EE1A 2RA4A 2KOLA 4XT3B 1G2TA 4NW2A 4IUVA 2J7ZA 2BDNA 1WD0A 1AZQA 1F2LA 4U68A 2HCCA 1PDQA 4CJ0B 1JICA 1PLFA 1DOMA 2X6LA 2B2UA 3I90A 1Q3LA 1S4ZA 4ZKCB 1PFNA 1VMCA 3I3CA 1DONA 3SVMA 3KUPA 4ZKBB 5T1GA 3DEOA 1B3AA 4QUCA 2RVLA 4XDXA 5JJZA 3FPUB 3GV3A 1NR2A 4UAIA 2K28A 2Q8TA 4CJ2C 2SDFA 4XT1B 2HCIA 2NYZD 1CA5A 1KNEA 3FDTA 1E0BA 2RSOA 2RSNA 3IL8A 3Q6SA 4HCSA 3IFDA 5EPLA 1QE6A 1WD1A 2VXWA 1BBXC 4LMQD 2HUGA 3TZDA 1SAPA 1MI2A 2X6GA 1IKLA 5CBAE 2D9UA 2B2YC 2DY7A 5AFWA 5E4WC 4DN4M 2DY8A 1O7ZA 1U4RA 4R8IA 1RTNA 4HAEA 2L12A 1J9OA 5EJWA 1U4MA 2XIWA 3DEPA 1F9PA 1B53A
chains in the Genus database with same CATH superfamily
1TY2A 3HOUG 2EXDA 1QG7A 3U50C 4PZ6A 1IYUA 4OWXB 1R9TB 2F0VA 1TVXA 5DEHA 1N8RC 1ICWA 2AWOA 1IBLL 1Q82C 2CFMA 2WB1B 5JPNC 2NBFA 3B6YA 1II3A 4A3MH 4ZAIA 4IFDG 3S1MB 4OGQC 4G7HC 5IYDH 2CKZB 5FLXL 4A3DH 2DGYA 2PW5A 4EQNA 1UE1A 1DZ1A 2N55A 1E2WA 1YBYA 4YHHL 2RKSA 3DWPA 1A6XA 3M85A 1S5DD 1HA5A 1B2TA 4LFCQ 3GTGH 3CQZH 1CZGA 4A3FB 4JBMA 2UXBQ 1ML0D 4MTKA 1RODA 5J39A 3H0GH 2Z4HA 3TQYA 1EWCA 4IN3A 2L9HA 5C4XH 1BNZA 3S1NH 1S5FD 4FP5D 4OEMB 1YHAA 2IX3A 4HCEA 3RZOH 1D2BA 1VQ6A 3HP3A 2ZJRA 4HJ7A 1BXTA 3R2IA 2FJ2A 3M3YH 5IWAQ 5EPJA 3ND9A 4A3IB 5LMNW 4DUZQ 4CKBA 2D5DA 2AMCB 1XPOA 1S72A 1SE2A 3FKIB 2BE5D 3MTSA 4ULLA 1C9OA 1SE3A 3MXGA 4QGUA 1XXGA 4FXDA 1FNUA 1LTAD 3EVQA 2B2VA 3TEHB 2PNRC 4A3DG 1AN8A 2DN8A 1L0XB 2RDGA 2VQFQ 1PFBA 3T16A 1G2TA 1AE3A 4C3JB 4IUVA 3DMUA 1AZQA 1OXUA 2HD3A 3CF5A 3KDFA 1O7LA 1DOMA 2UXDQ 3M4OH 2VL6A 3L9AX 5C4XG 1EYCA 1UWVA 4GNXC 2EJFC 1ENAA 2OTLA 3LX0A 3K6OA 1SYFA 5IGGA 5M5WH 1W2BA 4K0KQ 1B70B 2KCCA 1GUNA 5C3EB 2A5HA 2SNSA 1FYCA 5K36H 3HOVG 3J7A5 3KLWA 3NPPA 5C5LA 2B29A 3S16B 3PGZA 4DV3L 1LO5D 3V05A 3S1QB 2PZUA 5C3WA 4IO9A 4IURA 2K50A 2EZVA 2R92G 1SNDA 4UP8A 3GQBA 4IPDA 4DV1Q 4XIGS 1XPRA 4JI8L 3GP7A 5C0XI 4YCVA 1Y1VB 1PRTC 2EXZA 3DM1A 2P5ZX 2Z6KA 1UUPA 4P74A 1B3QA 3A5ZB 3MVVA 4HIOA 2WKCA 1K0RA 3A7AB 2UUBQ 4DV6L 4HJ9A 1NE3A 2WB1E 1ONLA 4JI5Q 2AUKA 2NZ1D 4ODGA 1VQJA 4M8AA 3VYSA 1W6JA 1HTLD 4HEDA 4C3IG 3OSOA 1LTSD 3STBC 4KKUA 1SLJA 1JORA 1NY4A 4Y52H 1WTOA 1HNZL 4L6TB 1M8AA 1IYJB 5GQOA 1EY6A 3MEFA 3RZDH 2XNAC 2B2UC 1CQFA 3PQIA 5CR3A 1S3OA 4QQBX 3WDNA 4LFAL 2D0PA 5LMUQ 1S5CD 2K5QA 1EQRA 2JJQA 3GDEA 3KF8A 1LM0A 5M5YB 1D7QA 4AQYL 1TS4A 3PO3B 1QZGA 5C4ZA 1JB7A 1YEZA 2FHTA 4UDUC 5ELDA 4ZRZA 1TWGB 3SXHA 2RDFA 1SMYC 4JI0Q 2BDNA 1F2LA 3L2PA 2X6LA 1TT2A 4OO1I 2UU9Q 3WOFA 2YU9B 4ZKBB 3FMCA 1WCMB 4BBSG 2PZWA 5C0XJ 4CDCC 5M3FB 2A6ED 2B8FA 3RLOA 4JOIC 4F87A 3D4RA 4DXFA 5HGQA 3FDTA 3IL8A 4C3JG 5KEEA 1I50B 3TS2A 1YVCA 4GKKL 2VQEL 2EY2A 5IP7H 2NVTB 4B08A 1JOQA 1ASYA 3OOCA 4APVA 1B8AA 1TR5A 2LKVA 4HAEA 4GOPA 2M9VA 2XIWA 5BR8L 3CCEA 2O5JC 3CRKC 2I0QA 3HOZH 5BN5A 3J7AF 2G9DA 1N33L 3J80E 1HNWQ 2CH4W 1ESFA 4RGMA 3X3NA 1PH2A 1GKHA 4P71A 3E5SA 1WTXA 2F0IA 3BDLA 4OELB 4HJAA 3F2UA 1DYQA 2RF4A 1Y1WB 1VS0A 2AHOB 2R93H 4K2KA 4DK3C 3PMFA 2HDMA 2ENBA 1QNUA 2HQLA 1GJXA 3I4NG 1X56A 3S2DH 1FGBD 1U4LA 3M4QA 1GUSA 1SNMA 1Y8NB 1AZPA 1OTCA 4JI2Q 1KL9A 3RLNA 4G4KA 3K5NA 1RHPA 2O4XA 3D4DA 2Z6BA 1VQOA 1JR0D 3N52A 3U4VA 3D31A 1PHJA 1GHKA 1VQEA 1I94Q 3TDQA 5FJ8H 4JI7Q 4OIJA 4G7ZC 5H1SE 1E22A 5ELEA 3ND8A 2LSSA 4DV5Q 3T1HQ 1B4OA 1YJWA 1QJOA 3HZXA 3QB3A 3ERQA 3HOYH 1HZAA 2JP1A 4BXXH 2NN6H 5KNDA 4RAUC 3CRLC 3DHQA 5IP9G 4NPSA 5F2DA 1IW7D 4EVOA 3GV6A 4A3EH 4JG2A 1QB5D 4OONA 1D8LA 5FK9C 3MWYW 4LFCL 3G48A 1PDQA 4GZYC 1JICA 3I7FA 3S15H 3S2HB 2UXBL 2Z1CA 1Q3LA 2ZXRA 5FLXE 2K33A 5JEAH 2Q8TA 2OTJA 2F0LA 1KNEA 2RSOA 1NSNS 3ULJA 4K2LA 5IWAL 1IBLQ 3R2TA 1EZ8A 4TRDA 5JPMC 4DUZL 1E1OA 1O7ZA 1JOOA 2PMZB 1U4RA 4BBRH 1YNJC 2K52A 3AYHB 5IGDA 5M3MB 3NK9A 2ICEC 2ZJQA 2E2HB 1QUQA 5CORA 2A6HC 4IJLA 5IGCA 3HGBA 1X3PA 2VQFL 5ELBA 1NBWA 4U673 3UDFA 3RUZA 2E2IH 3H09A 1PRTD 4QIWB 2UXDL 1I4HA 5LL6X 4A3KB 4RGOS 2XTIA 2NVQB 1ZXTA 1H9JA 5IGFA 4GN3B 1G6ZA 4DR2Q 1N36L 4K0KL 2HDLA 2QILA 4A3JG 1LTRD 1MJCA 3TP6A 1UE7A 1L0WA 1YIJA 2M2LA 4BBRG 5GAEC 5A35A 1PZID 1HR0L 4JOIA 3UDGA 3NBIA 4JW0A 3H94A 1B1ZA 4A93B 3Q8DA 4M1UB 2C5CA 4DAVA 2JA8H 2EY6A 4BY1G 3UE1A 4B3TL 4O2DA 1IL2A 4WFN3 2NVXB 4DV1L 2B2WC 1V8QA 2K05A 2D62A 3QO2A 4QUFA 2PYKA 1EY9A 4RWSC 3J80c 4BS9A 1XX8A 1QOHA 3K57A 2J4XA 4UP7A 1HZCA 4LF6Q 2UUBL 1PTOB 2F0DA 2E2JB 3ONAB 1YZ6A 1BKBA 1Q12A 1ENFA 1I6HB 2KOLA 1ET6A 1SYGA 4KKSA 3PCOB 5IE8A 4JC0A 3PO2G 3SVMA 1TS2A 5IIFA 3D8GA 1EZ6A 5JJZA 3GTQB 1AH9A 4HCSA 5EPLA 1EFWA 4RG1A 2QKIC 3KF6A 2EYFA 1I3QB 1EY0A 2RCFA 3CU7A 4C2MB 3WWVA 2F3WA 5LMUL 3S14B 1U4MA 2WACA 5K5PA 5IT9c 1S5ED 1VQMA 4YIJA 1LTGD 3QWNA 3BU2A 5KNBA 1MJEA 1TY0A 1AEXA 1RD9D 4RH6A 2R7ZB 1RKNA 3OYYA 4RMFA 1SRUA 2N3SA 2PMZE 1Q86C 4JI0L 1K3RA 1W3SA 4K5WA 3G4SA 2WAQG 1V1PB 1IBKL 4L8JA 5JOBA 2B63H 3K7AB 4JPBW 4Z9CB 2JA5G 2N49A 4FF4A 1PTOF 2IL8A 5TSSA 4CDFC 3S9WA 3CC7A 3D6WA 3EIVA 3IAYA 2ZJPA 5FLXc 3RMHA 1CSQA 4QIWE 2B2VC 2JA7G 2K1BA 1Y69U 3GTKH 3I91A 2X69A 1H9MA 4GKJQ 1PMRA 1QWYA 4A3BG 1B50A 5A2QL 1BO0A 4JI3Q 1TWCH 1OO9B 1FGUA 1AE2A 4FF1A 3FRPB 3TBIB 1CHQD 4A3GH 4OXPA 3ERSX 5C4JH 1HNWL 1A0IA 3P75A 1N32Q 2FFKB 1SBBB 1DOLA 4ABNA 3K7UC 2E2DC 4E6IA 4ILWA 1PYWD 4QB4A 2O2LD 2ZXPA 4XXEA 4H02A 5E1FA 3HOWB 5KYIA 4JI2L 4J8QA 3M9BA 3OWEB 5FLMH 2VQEQ 3T1YQ 1SMXA 4ZKCB 5LHY1 1L1OB 1D5XC 4IOCA 3ULPA 3CAMA 4XDXA 4KTAA 2LMCB 4UAIA 1I94L 1N34Q 4JI7L 4PMWA 4XT1B 4LF7L 4AIMA 4LUOA 1N9WA 4KJOA 1BBXC 4A3MB 4DR6L 3BS1A 3MXPA 3QJYA 4XQJA 3T1HL 2VUMG 2KBNA 4P72A 4L5QA 2QA4A 3GTJH 3TREA 1EY5A 1TWAB 1LTBD 3D3RA 3DEPA 4KD4A 4EX5A 2K5VA 2YYZA 3HOXG 4KD3A 3BZCA 4IFDH 3GTGB 2PI2E 2A6HD 3CQZB 2RBMA 3G6JB 4MZ9A 2B2WA 3H0GB 3A7LA 1PH9A 3GTLH 1NUCA 3MHBA 1AP0A 2TSSA 3S1NB 2EIFA 5JEAJ 1SROA 1ZYRD 5DLQE 3I4MB 3NQTA 2DJGC 1A62A 2M00A 5CYUA 1F9RA 1YNXA 3NELA 1GXDC 3M3YB 1PYBA 1HHVA 2JA6B 5ELOA 4HN7A 4RKBA 2A68D 1WVLA 4BY7G 1LT6D 3AB9A 4R9WA 1TQOA 1KDAA 4ZK9B 1STGA 3I4LA 4IPHA 4DR5Q 4DPGA 3RD4A 4RCNA 3NBHB 2A69C 3K80C 1HFGA 2RCNA 5C0XG 2KCTA 1E24A 4FDBA 2SNMA 4ME5A 3NP8A 1X55A 2NUCA 4YWLA 1STHA 2QF7A 1O80A 3TSSA 5I2YA 3CCJA 3BYTB 4N8X1 3M4OB 1X3QA 1OXSC 1K8GA 4R4OA 3OMCA 1D5ZC 4R4TA 1Q8IA 2DNCA 3PUYA 4FF2A 1EFID 1WYDA 5HGTA 3TP5A 2L11A 1WTWA 1C8CA 1A2TA 4NB3A 3H3VI 2IX1A 1HUNA 4B3RQ 4XTCS 1BVSA 5HY6A 3R3OA 1KHIA 4DR2L 2ZTCA 4GOPC 2JK8A 3S1RH 2A1AA 3KLSX 2WKDA 5EKLA 2DUDA 4P73A 5FKAC 2VS1A 4JK1C 3ITPA 5CV6A 1NTGA 3HOVH 3VA5A 3OW7A 2E5LQ 1K28A 4L5SA 2JEAI 3GV3A 2R61A 3A5UA 1SYEA 4DV0Q 5G3LF 1QE6A 2Y0SB 4B9WA 2AUJD 3TZDA 2HHHQ 5AJ3Q 5CBAE 2D9UA 2R92H 3S17H 2WFWA 1TU2B 2LXJA 2DY8A 1SYDA 1A3UA 3P20A 1TS3A 2PQAA 5IGBA 5C44G 1W6KA 3M4PA 1IKMA 4V190 1EEFD 4HSPA 4OO1G 4N9TA 3KJOA 4LF6L 2RDHA 1F2ZA 1X32A 3NTIA 4C3HG 1N36Q 1VQKA 3SHLA 4LJZC 3P7JA 1DOKA 2QEJC 4C3IH 5CV7A 4L5RC 1F9SA 1VQGA 5EAYA 3W5OA 3KJPA 4OWTB 4CKCA 4H0LC 1YJ9A 1HNXQ 4A76A 1VMPA 2F3IA 4KY6A 1HR0Q 3K5LA 3X3MA 4H7BA 2DJFC 4B3TQ 1C7YA 2ZXOA 3F2DA 2CW0D 4O0AA 1WJJA 4WJ3M 1GD7A 1MGSA 1DXMA 2BDOA 3CCSA 3H3VC 3E6ZX 5E7NA 3OIQA 3H6MA 2AQ1B 5M5XB 1A63A 3FVQA 4QY7A 2C35B 2JA9A 2WB1G 4HJ5A 1F9QA 4Y7NB 3H15A 4DR1L 4DK0A 1VQ7A 2LXKA 1DGSA 4GN4B 1TWHH 2PQAB 2EDGA 3PIOA 3BZDB 4BBSH 1LYLA 3DUZA 1BDOA 3PF4A 2Z0SA 2F0NA 2J7ZA 1LTLA 2AQ3B 4C3JH 4A3FG 1VQIA 3HOZB 4LF5Q 3I90A 1BBWA 4GKJL 3DEOA 2OCEA 2Z4IA 4IPGA 2GA4B 4ZQ3A 4LW1A 4JI3L 4DA2A 1RDPD 4CBVA 2XRQD 1KDBA 1PH6A 1CA5A 5I2XA 4H44C 5C6AA 2R93B 3HKZB 1KD1C 5ELNA 5JJLA 1G51A 4CDEC 4A3IG 5AFWA 1EU4A 1N32L 2F0PA 1H9KA 3PUVA 3TRZA 5A2QE 5I4DA 4EQ5A 3S2DB 5DM73 3FKIG 1HTPA 4AYBB 1UEAB 1XWEA 4POGA 1IBKQ 1A3VA 4MN3A 1PH3A 2BH8A 3GTPH 2Y0SE 1BCPD 1PYSB 3K81C 4RHSA 3I4NH 4HIMA 3JC66 4GS3A 3BYYB 4DK6C 1XJVA 1C4QA 3U58A 3GTOH 3PSIA 4KV6A 1WOCA 1Y1VH 3T1YL 1P8LA 5IY0A 3OPOA 3SK8A 1CKNA 3NE5B 4DV7L 3J81i 4ME3A 5JVG3 2RHQB 2E75C 1CZWA 4N9PA 2G9HD 1N34L 3HOYB 4X62Q 2B39A 4PQXA 3EROA 1Q81C 4ZLTF 5C3EG 4IQZA 5EKIA 3SK4A 4TSSA 1KDCA 2KCMA 4A3EB 1YNNC 1HUMA 3BDOA 1T9HA 5KYLA 5I9OA 3MAQA 3PF5A 1CI3M 4WJ4A 3I70A 5EGTA 3S15B 1R4QB 3KK7A 5IP9H 1JCKB 5E4XA 4RGNA 4DXGA 1WI5A 2QW7A 5EQ0A 1VCIA 1X3FA 2EYOA 2F0UA 4O1NA 5CV4A 1Y1VG 1CKOA 3I2ZA 4ZUIA 3UI2A 1MBYA 1TIID 2MGSA 5M5YH 4JI1Q 2IY5B 1RTOA 2I5MX 2D0OA 5C4HA 4RFBA 1LACA 1VQHA 1O7IA 3NWTA 1STEA 3EBEA 4ZYSA 1TWGH 5BN3A 4LF7Q 2F0FA 1YITA 4QMGA 4DR5L 4EQPA 3NTHA 2J0TD 1PH1A 1A8VA 4DR6Q 2KENA 3EN2A 2K75A 1YHBA 1WCMH 1L1OC 5IODA 1NR2A 1SR3A 2E2IB 3JAML 4KK7A 4RKLA 1CKNB 2SDFA 2HCIA 3NTKA 1VDZA 1ICFB 3LNNA 4LMQD 2JEBI 2F0WA 4K14A 1PH8A 1B9MA 3OTOQ 2EYJA 1EY4A 4OHJA 1LT5D 1STNA 3CCLA 3R93A 3PO3G 3HKZE 2IJ0A 4K5XA 4B3RL 4HIKA 1K83H 3JAMi 4KN4C 5D14A 1X3EA 4OX9Q 1H9SB 4PV1C 2B8GA 1EWHA 4AYBE 4IUTA 3CC4A 1Y1WH 3VR2A 2VB2X 1EEID 1VQLA 2JA8B 4A3JH 1KAWA 1XNQQ 1HRJA 1CUKA 2NVYB 2K7VA 1WCMG 1HQMC 2F52A 1UAPA 3CW2C 4AH6A 2E5LL 2B2YA 2KECA 4YWMA 4JYAQ 1EU3A 5ISRA 5M3FG 2AWNA 4DNIA 2F0TA 4DV0L 2K5WA 3LWUA 1IYVA 1SDFA 3RN5A 5I9PA 5D3DA 4WJWA 4BY1H 3SK6A 2HHHL 1RL2A 5AJ3L 2F1MA 5CMDA 3LGJA 5IYBH 3VA7A 1P16A 1TWFB 3K0XA 2ZTDA 2VB3X 4G7OC 4GLAC 2FINB 4G57A 1PA6A 2L15A 1KIXA 2PI2A 2MO1A 2VZAA 3BG3A 1OXVA 4L5TA 5EPKA 3QOLA 1JE5A 4GNXB 3PIPA 2ZM6Q 3E0JA 4POFA 1Y1WG 5GROA 2JN4A 1BF4A 4UY8C 4NP5A 3STBD 1EIGA 3PO2H 3EJIA 4HMJA 3A55A 4DR3Q 1Z9FA 3QR8A 1HNXL 1KLGD 2YTVA 3NUCA 4FXKC 4KMUC 3V96A 4HIDA 2BCOA 4X64L 2EJMA 4LF4Q 1IXRA 1V1PA 3Q22A 5IYBG 2Z9HA 4UHVA 2OQKA 3FPPA 4QUCA 3I56A 3E3XA 1PRTB 1E0BA 4LAAA 3MFGA 2B63B 3K58A 4KHVA 5LL6S 1SMYD 4QF4A 4IALA 3C1FA 2XSCA 4XT3B 1F9PA 2K32A 4R8NA 1EQQA 1EYDA 1D5MC 2YV5A 3OHXC 2JA5H 3GTKB 2NZOA 1SXTA 1T5EA 1VQCA 1TKWB 1NNXA 5DNFA 2CQAA 2YTYA 5GAGC 1TWCB 2K6AA 3A8KE 3TZUA 1DCZA 4LF5L 2JA7H 4A3GB 3BVZA 5LMNQ 5FOBB 5C4JB 1PH7A 1STBA 2AQ2B 2R3ZA 1LABA 4UPAA 4A3BH 1K73C 5BN4A 1LUZA 2MHVA 3NXWA 3UDIA 3GTMH 3VYTA 3NSWA 5CV8A 4MTNA 1YNND 1L1OA 3CHBD 4KY7A 1X65A 4DR1Q 4MNOA 5ELFA 3CCQA 1WTQA 1XMOL 5CBEE 2E74C 5M3MG 3KOJA 4CJ1B 2R7FA 1PRTF 4X3UA 1IHZA 1S5BD 2L1BA 5I6WA 2NN6I 3A8IE 4XQNA 1I4QA 2R6GA 2NVXH 3U4ZA 1PH5A 1XTDA 4J6HA 1EOVA 4DV4Q 5FO8B 2PNHA 3CD6A 1GUWA 1ZEQX 2AKWB 3J81E 2QDLA 5C5MA 4JI4L 4MIUA 3D0FA 1Y8OB 2A8VA 3FP9A 1MHWC 4RA8A 4IPCA 4KLKA 1CA6A 4LK1C 4LUVA 3HOUB 1H95A 4A3KG 2UUCQ 2PZTA 1Z47A 4R4CA 2KCNA 3ULLA 4X3SA 3HG9A 1PFSA 3K59A 1YJNA 4R4QA 4X62L 2EE1A 2G5DA 3F8TA 1WD0A 3W2DA 1GHJA 2SEBD 3ZYYX 1VQ8A 1SJHD 4PNYA 1RF2D 5CV9A 2VUMH 4CKEA 3GTLB 3VR4A 1KQSA 4CJ2C 2KHIA 4A93G 1D6EC 5IYCG 5JAVA 3HOXH 1EWIA 3NQIA 1XNRQ 2PO4A 1SAPA 1MI2A 1IKLA 4BA1I 3G6EA 4DN4M 1YHQA 1Q90A 3NBHA 4A3CG 2F4VL 2L12A 1J9OA 1UE6A 5CV5A 1DONA 2F0EA 3M4YA 4K6LA 4JI1L 1HH2P 4DV7Q 1WTPA 1Q8KA 1SYCA 4DR7Q 4X6AH 3PUZA 1SE4A 2R7ZH 2I5HA 1QNKA 2CVRA 1GVPA 1CHPD 1QILA 1HFNA 3UDXA 1HJPA 4HR7B 4BY7H 2EQSA 5COYA 2ATWA 1CTMA 5T1IA 2JXMB 2L4NA 1EIFA 2NTTA 4MHEA 4A3DB 4FYDA 4EQOA 2ASBA 1YNJD 4I7AA 4N8FA 1V1OA 3U9SA 4TVAB 5C0XH 3CMAA 1Q1EA 3URYA 2JSOA 3V2TA 4X3KA 1X6OA 3E9IA 5C3XA 1L2FA 1D1KA 1JJCB 3DWQA 4QL5A 4OWWB 1ASZA 2FMMA 5C4XB 1S40A 3OTOL 1CKMA 3TS0A 3JAME 2XRSD 3RZOB 4FXGC 2K01A 4JBKA 2R7ZG 2EY1A 1F77A 4L63B 3I55A 4YCWA 3CCVA 4OX9L 5EBCA 1HCZA 2QCPX 3HOVB 2GN5A 2UUAQ 3D4WA 3DWAA 1Q1BA 2UXCL 3MFYA 1LLRD 5IOCA 2A6EC 4A75A 4K8JA 2PW7A 4DGZA 1XNQL 3C2PA 2R92B 3BJUA 3S17B 3HS0C 4JYAL 1DJRD 1ILPA 3CCMA 3FHWA 2K5HA 4DFAA 4KN7C 4U68A 3C1EA 3HKSA 1FNVA 2OWOA 1PFNA 2V4DA 3I3CA 4NMZA 2H4OA 1CQVA 2K14A 1B3AA 3OMGA 2KHJA 1VQDA 5HURA 5M5WB 1SN8A 5C44H 2KHSA 2KJXA 3CCUA 1WFQA 3IFDA 4XYQA 4C3IB 1HZ9A 1LT3D 2VXWA 3J81j 3AMUA 3SR1A 4OO1H 2CCZA 1EUJA 2ZM6L 1JC7A 1VQBA 2E76C 4C3HH 4ZUJA 3K8AA 5EJWA 4DNTB 2F4IA 1TWAH 2PPBC 1U0LA 1JWSD 1VQ9A 1L0YB 1IL8A 4DR3L 2IX0A 2XN9C 3J81c 1B7YB 2QGQA 3VYRA 3IRBA 4LF4L 1ET9A 3HOWG 3KLRA 3KBGA 2EYPA 4B9XA 3BVGA 1O78A 1SFOH 3I4MH 2L0CA 3PIO3 2K5NA 4B3SQ 3W1GA 2MJ8A 1NR4A 2EOTA 3J7YW 3P1HA 3MXNA 2JA6H 2Q2HA 3OIPA 2WIIB 1K9MC 2MQHA 4A3MG 1G6PA 4DAYB 2KQ3A 1R9TH 3N6RA 2K03A 5IYDG 4C56C 1K8AC 1K3BC 5J22A 1JMCA 1TWHB 5JJKA 4IUNA 1HZBA 1IW7C 4BBSB 2OXPA 4OIKA 4A3LH 3TP7A 2LFNA 1WTHA 3L0OA 3RZDB 2ZTEA 3S1MH 2HT1A 4IUQA 2BOSA 1KRSA 1J6QA 4RHRA 3F2BA 3CC2A 3H0GG 3NENA 2H1EA 2MP1A 2TMPA 4C1NI 4X64Q 3I4MG 1G91A 4A3FH 3GD7A 5LMNL 3SGIA 5I6YA 1STAA 2HQEA 1X3GA 2JA6G 1F2YA 3FEWX 4DKAC 1E2VA 1PFMA 4NW2A 1Y14B 2N8NA 2VW9A 4P75A 3J7ZC 4HTHA 3GTPB 1CT1D 3U9OA 5CC4A 1S4ZA 1M4VA 5M9OA 1HXYD 1VQFA 3I4NB 4A3IH 4X66Q 1PXUA 5EKKA 4A3LG 5GAHC 3FKIH 2K28A 4DV2Q 3GTOB 1E1TA 1Q7YC 3KFUA 2K5DA 1PV4A 3NWSA 4IOAA 1JT8A 4IFDI 3MXNB 2IWHA 4TKOB 1BUVT 1UE5A 2ICIA 3JAMc 2HIXA 1SNQA 2BA1A 3HRZC 4DV4L 2B2YC 2F3VA 2A19A 1PTOC 1I5FA 3BVMA 1G8ZD 1RTNA 5GADC 3NHHA 3K0YA 2IPKD 2EYLA 1CSPA 2UUCL 2IT1A 4NXNL 3ZJYC 1XMQQ 5K36G 1FVIA 1SYBA 4JBWA 1EIYB 2YTXA 1JOKA 3W3AA 1KRTA 1GUOA 2N88A 1EQVA 1J8IA 3PUXA 3KDFB 4IUPA 3CCRA 3A8JE 1I4XA 1VF5C 5C3EH 4IUUA 1CM9A 1UEBA 5KIXA 2KUMA 4RCOA 1SEBD 2SOBA 3J81L 1XMOQ 3S16H 4LF9Q 4YY3L 3S1QH 1ZKOA 1A15A 2BA0A 1XNRL 3TN2A 2Y0SG 2CHBD 1BOSA 3LWEA 1JJGA 1O7YA 5CGKA 4X65L 4BWGB 3VR3A 2MPMA 2QDBA 4JI4Q 4LF8Q 4KY5A 4JVZA 2LS01 1NMFA 4GN5A 2V1CC 4DR7L 3I8ZA 4KHPQ 3NEMA 2F0JA 3L7ZC 3Q24A 5M5XH 1VQ4A 3SE0A 2GVAA 2OEOA 4JBJA 4HSVA 3J7AV 5KNCA 3MA2B 4Y7NH 1F2MA 3H91A 2CWPA 1QZHA 4IFDJ 1NAPA 1DM0B 1FD7D 2EPBA 2B2TC 3EA6A 2A69D 2MFIA 3AEVA 3SEBA 2NB0A 1IZ6A 3EQLC 1QVFA 2Q8RE 3UE0A 1H9SA 4PZ8A 1JWUD 1MD2D 1XTCD 1SNOA 4DAMA 4DUYQ 2D2CC 1MIUA 3ER0A 4NXMQ 4DF7A 4C1NK 1PLFA 2K4KA 4QCLA 1BCPB 4WRDA 1VMCA 3I4OA 5KRUA 1K83B 3KUPA 2RVLA 4NKLA 2F4VQ 1JJ2A 2FMCA 2ES2A 1A3TA 1J5EQ 3F1ZA 1K0SA 1AW7A 3PO3H 1FJGQ 4A3JB 1Q46A 2A74C 2X6GA 1EYGA 1KLUD 4BBRB 4B3MQ 1G291 2VY3A 2UUAL 2JQOA 2XWBB 4P2CB 3KF8B 4JV5Q 2F0KA 1G2SA 1EY7A 2F0OA 3PIP3 4OL7A 4HJ8A 2F0HA 4KJNA 4BY1B 2YU9H 1RJTA 5IP7G 2PQEA 1T5XD 1QCBD 4I65A 3T51B 1E2ZA 4DR4Q 4GNXA 5M3FH 4CGYB 1KNAA 1MSGA 4S3SA 3OW2A 1V1QA 3HOZG 1BBUA 1I50H 1UNSA 2CWAA 3ICEA 1STYA 3QOJA 1X9NA 2NVTH 2B3GA 5IT9E 2OF1A 1SNPA 4JI6Q 2EVBA 2Q8IB 5L37A 1SJED 3SDZA 3RLFA 2R93G 1PZKD 3HKZG 1GOZA 3PV0A 4ZCKA 3PO2B 1BCPF 4X3TA 2JE6I 4LUZA 2C9OA 1BR9A 3AFPA 1JE4A 1LTID 4DK1A 4GOPB 1WTVA 4V0BA 1C0AA 4AYBG 2UXCQ 4FF3A 2IHFA 1EL0A 3CPWA 3VR5A 4PMBA 3RN2A 2NZHA 3KBXA 3QG1A 3CKIB 4FO2A 3MEHA 1RIPA 4F7XA 1FL0A 1WTRA 5KGUA 1LTTD 3VYUA 1IBMQ 5FJ8G 2F03A 1HR0W 4LFBQ 1ENCA 4WORA 1EQTA 3T56B 5EBDA 4B3SL 1LV9A 3A56A 1H9RA 3K5MA 5ELCA 3T53B 1JQYD 1I4PA 2Q2IA 3IKJA 4K8IA 3HOYG 2RA4A 5NUCA 4GLVB 4BXXG 2NN6G 2LY7A 3OWFA 1C48A 1VQAA 2WAQB 2EYHA 2ZT9C 2RQXA 4PZ7A 1QVGA 1OXTA 2B2UA 2OQ0A 2A73B 2JA5B 5JVH3 1CK1A 1DD2A 5J1ZA 4A3EG 1E7ZA 3FPUB 4YHHQ 2NYZD 2Q2TA 1ZYRC 2JA7B 1GO3E 2CH4A 1SE8A 4DAPA 5E4WC 1PTOD 3RNUA 4A3BB 2XWJB 5JEAG 3E0EA 2A68C 2HUGA 3MXUA 3GTMB 2VNUD 2NWGA 1U4PA 3MZ5A 3S2HH 1K8MA 2WV6D 3IFTA 1X54A 2OT2A 4DNRB 3A54A 4TQUS 4XYOA 2KVMA 1EOTA 4UP9A 4JCVE 5DAUA 3RR5A 1GUTA 2B2TA 3CXCA 3CP0A 3WOEA 2R7DA 1HQRD 3DM3A 4IZ8A 3R8BA 2NVYH 2E8GA 4X66L 4I7ZC 1AFPA 3I72A 4DV2L 4O42A 1SSOA 1JWMD 5M3MH 4NDXA 1V43A 1GUGA 2E2HH 1I4GA 5D3IB 2I46A 3BZKA 1JB3A 3QIAA 3A74A 3GO5A 4ALPA 1TWFH 2L5TA 1OXXK 1VF7A 2Q2UA 4JI5L 1QUQB 2KA7A 4J15A 1MKHA 2DNEA 3AFQA 4A3KH 1B44D 2NVQH 1XMQL 1XYIA 2VUMB 1NJIC 1BQQT 2XVSA 2K04A 4F88A 2BE5C 1I4RA 4J1MA 4DV3Q 1Z6HA 2N78A 1M1KC 3HOXB 5JJIA 2JA8G 1KABA 3T4AC 3KYHC 4KI0A 1NCVA 2KEEA 2L55A 3AQQA 1KTKA 4K6DA 4ID6A 2GVBA 4KKTA 4EGVA 4LF9L 4JI8Q 3VDYA 2I07B 4LNQA 3H3VH 4A93H 4LWCA 5IYCH 1EYAA 2HCCA 3HFZB 1GM5A 1M90C 1VQPA 4H13C 2EYMA 5E3FA 5T1GA 2H5XA 3PUWA 2MNAA 1A2UA 4A3CH 5IGEA 4DV6Q 4BY7B 4LF8L 4PMCA 3Q6SA 2WAQE 2RSNA 4NXNQ 3K5OA 4PG3A 4KHPL 3C3LA 1HPCA 1Z7TA 2UU9L 1PTOH 2ALYB 3TP8A 3GTJB 4HMIA 2E2JH 3CMEA 1HNZQ 1I6HH 5FO9B 2ID0A 2IW3A 3Q0AA 3Q23A 1B53A 1FR3A 2EJGC 1VQ5A 3EFXD 4YWKA 3G7LA 3GTQH 2KEDA 1V9PA 4YY3Q 4LFAQ 3T13A 1ILQA 2CW0C 4RGTA 4DUYL 1Y8PB 3M7GA 4DU9A 4FNFA 4NXML 1D1IA 2F0QA 4KHZA 4AQYQ 3DLLA 1I3QH 3M7NA 4C2MH 1EIHA 2FXQA 3SK5A 4X65Q 2QEXA 3S14H 1TXYA 2JYOA 1J5EL 2CQOA 3D6CA 3KF6B 1I6VC 1MSHA 1FJGL 2B63G 3O13A 3VR6A 5FO7B 1R4PB 4B3ML 4K5VA 3A0JA 4JV5L 4Q0FA 2O5IC 4CDDC 4BA2I 5DM63 1YI2A 2WP8J 3J80L 3K7AH 3C46A 4GKKQ 1E3PA 3BDCA 3L3OC 3F2CA 1VQNA 1FNWA 4DR4L 1XPUA 1PZJD 1QVCA 3CPFA 5C44B 4R1JA 5BR8Q 1PH4A 4CHTB 2F0MA 5G3LD 2MO0A 1HA6A 1K8OA 2Z6KC 1U9RA 4YCUA 4A3GG 1N33Q 3HOUH 1RCVD 1SNCA 3I73A 5D65A 1ESRA 2WINB 1CFMA 3AU7A 4DV5L 4JI6L 4F8MA 2BH2A 4C3HB 3S1RB 4Q5VA 2HIVA 2MUYA 4QJFA 3J80i 3TMEA 1LT4D 1PVOA 3DXJC 3HEJA 2F0SA 1B9NA 4FVMA 2Z8LA 2F0GA 4CJ0B 4R4IA 4GLXA 3W1BA 1U5KA 1KAAA 1BCPC 1TS5A 2XGTA 3MC0B 1KC8C 2I5LX 1NMGA 2EY5A 3G71A 2RHSB 3S24A 4A4IA 2IHEA 4XQQA 1WD1A 1SFOB 4IJHA 5FLMG 2NTSA 3E9HA 4DAYA 5IT9L 1KXLA 2DY7A 5J3BA 1EY8A 3KLSA 4R8IA 1IBML 2PCFB 3HOWH 4LFBL
chains in the Genus database with same CATH topology
1TY2A 1QG7A 1IYUA 1R9TB 2F0VA 1TVXA 5DEHA 1ICWA 2AWOA 2WB1B 5JPNC 2NBFA 1II3A 4IFDG 4ZAIA 3S1MB 4OGQC 4G7HC 5FLXL 2PW5A 4EQNA 1DZ1A 2N55A 1E2WA 2RKSA 3DWPA 1A6XA 3M85A 1S5DD 1HA5A 1B2TA 1CZGA 4A3FB 1ML0D 1RODA 5J39A 2Z4HA 1EWCA 4IN3A 2L9HA 1BNZA 1S5FD 4FP5D 2IX3A 4HCEA 1D2BA 3HP3A 1BXTA 3R2IA 2FJ2A 5EPJA 3ND9A 4A3IB 4CKBA 2D5DA 1SE2A 3FKIB 2BE5D 3MTSA 4ULLA 1SE3A 3MXGA 1XXGA 4FXDA 1FNUA 1LTAD 3EVQA 2B2VA 2PNRC 1AN8A 2DN8A 1L0XB 2RDGA 1PFBA 3T16A 1G2TA 4C3JB 4IUVA 3DMUA 1AZQA 1OXUA 1O7LA 1DOMA 3L9AX 1EYCA 2EJFC 1ENAA 3LX0A 3K6OA 1SYFA 5IGGA 2KCCA 1GUNA 5C3EB 2A5HA 2SNSA 1FYCA 5K36H 3NPPA 5C5LA 3S16B 1LO5D 3V05A 3S1QB 2PZUA 5C3WA 4IURA 2EZVA 1SNDA 3GQBA 4XIGS 3GP7A 5C0XI 1Y1VB 1PRTC 2EXZA 3DM1A 1UUPA 3MVVA 2WKCA 3A7AB 1ONLA 2AUKA 2NZ1D 4ODGA 4M8AA 3VYSA 1W6JA 1HTLD 4HEDA 4C3IG 3OSOA 1LTSD 4KKUA 1JORA 1WTOA 4L6TB 1M8AA 1EY6A 2XNAC 2B2UC 1CQFA 5CR3A 3WDNA 1S5CD 2K5QA 3KF8A 5M5YB 1TS4A 3PO3B 5C4ZA 2FHTA 4UDUC 5ELDA 4ZRZA 1TWGB 3SXHA 2RDFA 1SMYC 2BDNA 1F2LA 2X6LA 1TT2A 4OO1I 3WOFA 2YU9B 4ZKBB 3FMCA 1WCMB 2PZWA 5C0XJ 5M3FB 2A6ED 2B8FA 4F87A 3D4RA 4DXFA 3FDTA 3IL8A 4C3JG 5KEEA 1I50B 2EY2A 2NVTB 4B08A 1JOQA 3OOCA 1TR5A 2LKVA 4HAEA 2M9VA 2XIWA 2O5JC 3CRKC 5BN5A 3J7AF 2G9DA 3J80E 1ESFA 4RGMA 3X3NA 3E5SA 1WTXA 2F0IA 3BDLA 3F2UA 1DYQA 1Y1WB 4K2KA 3PMFA 2HDMA 2ENBA 1QNUA 1GJXA 1FGBD 1U4LA 1GUSA 1SNMA 1Y8NB 1AZPA 4G4KA 3K5NA 1RHPA 2O4XA 3D4DA 1JR0D 3N52A 3D31A 1GHKA 3TDQA 4OIJA 4G7ZC 5ELEA 3ND8A 1B4OA 1QJOA 3HZXA 3QB3A 3ERQA 2JP1A 2NN6H 5KNDA 4RAUC 3CRLC 3DHQA 5F2DA 1IW7D 4EVOA 3GV6A 1QB5D 5FK9C 3MWYW 1PDQA 4GZYC 1JICA 3S2HB 2Z1CA 1Q3LA 2ZXRA 5FLXE 2K33A 5JEAH 2Q8TA 2F0LA 1KNEA 2RSOA 1NSNS 4K2LA 3R2TA 1EZ8A 4TRDA 5JPMC 1O7ZA 1JOOA 2PMZB 1U4RA 1YNJC 5IGDA 5M3MB 3NK9A 2ICEC 2E2HB 5CORA 2A6HC 5IGCA 3HGBA 1X3PA 5ELBA 4U673 3RUZA 3H09A 1PRTD 4QIWB 1I4HA 5LL6X 4A3KB 4RGOS 2NVQB 1ZXTA 1H9JA 5IGFA 1G6ZA 2HDLA 2QILA 1LTRD 3TP6A 2M2LA 5A35A 1PZID 3NBIA 3H94A 1B1ZA 4A93B 4M1UB 2C5CA 4DAVA 2EY6A 4WFN3 2NVXB 2B2WC 1V8QA 2K05A 2D62A 3QO2A 4QUFA 2PYKA 1EY9A 4RWSC 4BS9A 1XX8A 1QOHA 3K57A 2J4XA 1PTOB 2F0DA 2E2JB 3ONAB 1I6HB 1Q12A 1ENFA 2KOLA 1ET6A 1SYGA 4KKSA 3SVMA 1TS2A 5IIFA 3D8GA 1EZ6A 5JJZA 3GTQB 4HCSA 5EPLA 2QKIC 2EYFA 1I3QB 1EY0A 3CU7A 4C2MB 2F3WA 3S14B 1U4MA 2WACA 5K5PA 1S5ED 4YIJA 1LTGD 3QWNA 5KNBA 1TY0A 1AEXA 1RD9D 4RH6A 2R7ZB 1RKNA 4K5WA 1V1PB 4L8JA 5JOBA 3K7AB 4Z9CB 4FF4A 1PTOF 2IL8A 5TSSA 3S9WA 3D6WA 3IAYA 3RMHA 2B2VC 2K1BA 1Y69U 3I91A 2X69A 1H9MA 1PMRA 1QWYA 1B50A 5A2QL 1BO0A 1OO9B 4FF1A 3FRPB 3TBIB 1CHQD 3P75A 2FFKB 1SBBB 1DOLA 4ABNA 2E2DC 4E6IA 4ILWA 1PYWD 4QB4A 2O2LD 2ZXPA 4XXEA 5E1FA 3HOWB 5KYIA 4J8QA 3OWEB 4ZKCB 5LHY1 1D5XC 4XDXA 4KTAA 2LMCB 4UAIA 4PMWA 4XT1B 4KJOA 1BBXC 4A3MB 3BS1A 3MXPA 3QJYA 4XQJA 1EY5A 1TWAB 1LTBD 3D3RA 3DEPA 4KD4A 2YYZA 4KD3A 4IFDH 3GTGB 3CQZB 2A6HD 2RBMA 3G6JB 2B2WA 3H0GB 3A7LA 1NUCA 3MHBA 1AP0A 2TSSA 3S1NB 5JEAJ 1ZYRD 3I4MB 3NQTA 2M00A 5CYUA 1F9RA 1GXDC 3M3YB 1HHVA 2JA6B 4HN7A 4RKBA 2A68D 1WVLA 1LT6D 3AB9A 4R9WA 1TQOA 1KDAA 4ZK9B 1STGA 3I4LA 3RD4A 4RCNA 2A69C 1HFGA 5C0XG 2SNMA 4ME5A 3NP8A 2NUCA 1STHA 2QF7A 1O80A 3TSSA 5I2YA 3BYTB 3M4OB 1X3QA 1OXSC 3OMCA 1D5ZC 1Q8IA 2DNCA 3PUYA 4FF2A 1EFID 5HGTA 1WTWA 3TP5A 2L11A 1C8CA 1A2TA 2IX1A 1HUNA 4XTCS 3R3OA 3KLSX 2WKDA 5EKLA 5FKAC 4JK1C 3ITPA 5CV6A 3VA5A 3OW7A 2JEAI 3GV3A 2R61A 1SYEA 5G3LF 1QE6A 2Y0SB 4B9WA 2AUJD 3TZDA 5CBAE 2D9UA 1TU2B 2DY8A 1SYDA 1A3UA 3P20A 1TS3A 5IGBA 1W6KA 1IKMA 4V190 1EEFD 4HSPA 4OO1G 4N9TA 2RDHA 1F2ZA 1X32A 3NTIA 4C3HG 3SHLA 4LJZC 3P7JA 1DOKA 2QEJC 5CV7A 1F9SA 4CKCA 4H0LC 1VMPA 4KY6A 3K5LA 3X3MA 4H7BA 2ZXOA 2CW0D 1MGSA 1DXMA 2BDOA 3H3VC 3E6ZX 3OIQA 3H6MA 2AQ1B 5M5XB 3FVQA 1F9QA 4Y7NB 4DK0A 2EDGA 3BZDB 3DUZA 1BDOA 2F0NA 2J7ZA 2AQ3B 3HOZB 3I90A 3DEOA 2Z4IA 2GA4B 4ZQ3A 4DA2A 1RDPD 4CBVA 2XRQD 1KDBA 1CA5A 5I2XA 4H44C 5C6AA 2R93B 3HKZB 5AFWA 1EU4A 2F0PA 1H9KA 3PUVA 3S2DB 5A2QE 5I4DA 5DM73 1HTPA 4AYBB 1UEAB 1XWEA 1A3VA 4MN3A 1BCPD 4RHSA 3BYYB 1C4QA 4KV6A 3OPOA 3SK8A 3NE5B 5JVG3 2E75C 1CZWA 4N9PA 2G9HD 3HOYB 2B39A 4PQXA 3EROA 4ZLTF 4IQZA 5EKIA 3SK4A 4TSSA 1KDCA 4A3EB 1YNNC 1HUMA 3BDOA 5KYLA 5I9OA 3MAQA 1CI3M 3I70A 5EGTA 3S15B 1R4QB 3KK7A 1JCKB 5E4XA 4RGNA 4DXGA 5EQ0A 1VCIA 2EYOA 2F0UA 4O1NA 5CV4A 4ZUIA 3UI2A 1MBYA 1TIID 2MGSA 1RTOA 5C4HA 4RFBA 1LACA 3NWTA 1STEA 4ZYSA 5BN3A 2F0FA 4QMGA 4EQPA 3NTHA 2J0TD 5IODA 1NR2A 2E2IB 3JAML 4KK7A 4RKLA 2SDFA 2HCIA 3NTKA 1VDZA 3LNNA 4LMQD 2JEBI 2F0WA 4K14A 1B9MA 2EYJA 1EY4A 4OHJA 1LT5D 1STNA 3R93A 2IJ0A 4K5XA 4KN4C 5D14A 1H9SB 4PV1C 2B8GA 1EWHA 4IUTA 3VR2A 2VB2X 1EEID 2JA8B 1HRJA 2NVYB 2K7VA 1HQMC 1UAPA 2B2YA 2KECA 1EU3A 5ISRA 2AWNA 2F0TA 2K5WA 3LWUA 1IYVA 1SDFA 5I9PA 5D3DA 4WJWA 3SK6A 2F1MA 5CMDA 3VA7A 1TWFB 2VB3X 4G7OC 2FINB 4G57A 3BG3A 1OXVA 5EPKA 3QOLA 3E0JA 1BF4A 4NP5A 1EIGA 3EJIA 4HMJA 3A55A 1KLGD 3NUCA 4FXKC 4KMUC 3V96A 2BCOA 2EJMA 1V1PA 3Q22A 3FPPA 4QUCA 1PRTB 1E0BA 4LAAA 3MFGA 2B63B 3K58A 4KHVA 5LL6S 1SMYD 4QF4A 4IALA 3C1FA 2XSCA 4XT3B 1F9PA 2K32A 4R8NA 1EYDA 1D5MC 3OHXC 3GTKB 1SXTA 1T5EA 1TKWB 5DNFA 2CQAA 1TWCB 2K6AA 3A8KE 3TZUA 1DCZA 4A3GB 3BVZA 5FOBB 5C4JB 1STBA 2AQ2B 2R3ZA 1LABA 5BN4A 2MHVA 3NXWA 3VYTA 3NSWA 5CV8A 1YNND 3CHBD 4KY7A 1WTQA 5ELFA 5CBEE 2E74C 4CJ1B 1PRTF 4X3UA 1IHZA 1S5BD 2L1BA 5I6WA 2NN6I 3A8IE 4XQNA 1I4QA 2R6GA 4J6HA 1GUWA 5FO8B 1ZEQX 3J81E 5C5MA 4MIUA 1Y8OB 4RA8A 1CA6A 4LK1C 3HOUB 2PZTA 1Z47A 2KCNA 4X3SA 3HG9A 3K59A 2EE1A 1WD0A 3W2DA 1GHJA 2SEBD 3ZYYX 1SJHD 4PNYA 1RF2D 5CV9A 4CKEA 3GTLB 3VR4A 4CJ2C 1D6EC 5JAVA 3NQIA 2PO4A 1SAPA 1MI2A 1IKLA 4BA1I 4DN4M 1Q90A 3NBHA 2L12A 1J9OA 5CV5A 1DONA 2F0EA 3M4YA 4K6LA 1WTPA 1SYCA 3PUZA 1SE4A 1QNKA 2CVRA 1QILA 1CHPD 1HFNA 4HR7B 5COYA 1CTMA 5T1IA 2JXMB 2L4NA 2NTTA 4MHEA 4A3DB 4FYDA 4EQOA 1YNJD 1V1OA 3U9SA 5C0XH 1Q1EA 3URYA 2JSOA 3V2TA 4X3KA 5C3XA 1D1KA 3DWQA 2FMMA 5C4XB 3JAME 2XRSD 3RZOB 4FXGC 2K01A 2EY1A 1F77A 4L63B 5EBCA 1HCZA 2QCPX 3HOVB 3D4WA 3DWAA 1Q1BA 3MFYA 1LLRD 5IOCA 2A6EC 4K8JA 2PW7A 4DGZA 3C2PA 2R92B 3S17B 3HS0C 1DJRD 1ILPA 4DFAA 4KN7C 4U68A 3C1EA 1FNVA 1PFNA 2V4DA 3I3CA 4NMZA 2H4OA 1CQVA 1B3AA 3OMGA 5HURA 5M5WB 2KHSA 2KJXA 3IFDA 4XYQA 4C3IB 2VXWA 1LT3D 3AMUA 4OO1H 3SR1A 1JC7A 2E76C 4ZUJA 5EJWA 4DNTB 2F4IA 2PPBC 1JWSD 1L0YB 1IL8A 2IX0A 2XN9C 3VYRA 1ET9A 3KLRA 3KBGA 2EYPA 4B9XA 3BVGA 1O78A 2L0CA 3PIO3 2MJ8A 1NR4A 2EOTA 3J7YW 3P1HA 3MXNA 3OIPA 2WIIB 2KQ3A 3N6RA 2K03A 4C56C 5J22A 1TWHB 4IUNA 1IW7C 4BBSB 2OXPA 4OIKA 3TP7A 2LFNA 3RZDB 4IUQA 2BOSA 4RHRA 2H1EA 2MP1A 2TMPA 4C1NI 1G91A 3GD7A 5I6YA 1STAA 2HQEA 1F2YA 3FEWX 1E2VA 1PFMA 4NW2A 4HTHA 3GTPB 1CT1D 3U9OA 5CC4A 1S4ZA 1M4VA 5M9OA 1HXYD 3I4NB 1PXUA 5EKKA 2K28A 3GTOB 2K5DA 3NWSA 4IFDI 2IWHA 4TKOB 1BUVT 2ICIA 3HRZC 1SNQA 2BA1A 2B2YC 2F3VA 1PTOC 3BVMA 1G8ZD 1RTNA 3NHHA 3K0YA 2IPKD 2EYLA 2IT1A 5K36G 1SYBA 4JBWA 1JOKA 3W3AA 1GUOA 2N88A 1EQVA 1J8IA 3PUXA 4IUPA 3A8JE 1I4XA 1VF5C 4IUUA 1CM9A 5KIXA 2KUMA 4RCOA 1SEBD 2SOBA 3J81L 1ZKOA 1A15A 2BA0A 3TN2A 2CHBD 1BOSA 3LWEA 1O7YA 5CGKA 4BWGB 3VR3A 2MPMA 2QDBA 4KY5A 2LS01 3I8ZA 2F0JA 3L7ZC 3Q24A 3SE0A 2OEOA 4HSVA 3J7AV 5KNCA 3MA2B 1F2MA 3H91A 4IFDJ 1NAPA 1DM0B 1FD7D 2EPBA 2B2TC 3EA6A 2A69D 3SEBA 2NB0A 3EQLC 2Q8RE 1H9SA 1JWUD 1MD2D 1XTCD 1SNOA 2D2CC 4DF7A 4C1NK 1PLFA 4QCLA 1BCPB 4WRDA 1VMCA 5KRUA 1K83B 3KUPA 2RVLA 4NKLA 2FMCA 1A3TA 1AW7A 4A3JB 2A74C 2X6GA 1KLUD 4BBRB 1G291 2XWBB 4P2CB 2F0KA 1G2SA 1EY7A 2F0OA 3PIP3 4OL7A 2F0HA 4KJNA 4BY1B 1RJTA 2PQEA 1T5XD 1QCBD 4I65A 3T51B 1E2ZA 4CGYB 1KNAA 1MSGA 4S3SA 1UNSA 1STYA 3QOJA 5IT9E 2OF1A 1SNPA 2EVBA 2Q8IB 1SJED 3SDZA 3RLFA 1PZKD 1GOZA 3PV0A 3PO2B 1BCPF 4X3TA 2JE6I 2C9OA 1BR9A 1JE4A 1LTID 4DK1A 1WTVA 4V0BA 4FF3A 1EL0A 3VR5A 4PMBA 3KBXA 3QG1A 3CKIB 4FO2A 3MEHA 4F7XA 1WTRA 5KGUA 1LTTD 3VYUA 2F03A 1ENCA 4WORA 1EQTA 3T56B 5EBDA 1LV9A 3A56A 1H9RA 3K5MA 5ELCA 3T53B 1JQYD 1I4PA 3IKJA 4K8IA 2RA4A 5NUCA 2NN6G 2LY7A 3OWFA 1C48A 2WAQB 2ZT9C 2EYHA 2RQXA 1OXTA 2B2UA 2A73B 2JA5B 5JVH3 1CK1A 1DD2A 5J1ZA 3FPUB 2NYZD 1ZYRC 2JA7B 4DAPA 5E4WC 1PTOD 4A3BB 2XWJB 5JEAG 2A68C 2HUGA 3MXUA 3GTMB 2VNUD 2NWGA 1U4PA 3MZ5A 1K8MA 2WV6D 3IFTA 2OT2A 4DNRB 3A54A 4TQUS 4XYOA 2KVMA 1EOTA 5DAUA 1GUTA 2B2TA 3WOEA 1HQRD 4IZ8A 3R8BA 4I7ZC 1AFPA 3I72A 4O42A 1SSOA 1JWMD 4NDXA 1V43A 1GUGA 1I4GA 5D3IB 2I46A 1JB3A 3QIAA 3GO5A 2L5TA 1OXXK 1VF7A 2KA7A 2DNEA 1B44D 1XYIA 2VUMB 1BQQT 2XVSA 2K04A 4F88A 2BE5C 1I4RA 4J1MA 1Z6HA 3HOXB 1KABA 3T4AC 4KI0A 1NCVA 2KEEA 2L55A 1KTKA 4K6DA 4ID6A 4EGVA 4KKTA 2I07B 1EYAA 2HCCA 4H13C 2EYMA 5E3FA 5T1GA 3PUWA 1A2UA 5IGEA 4BY7B 4PMCA 3Q6SA 2RSNA 3K5OA 3C3LA 1HPCA 1Z7TA 1PTOH 3TP8A 3GTJB 4HMIA 5FO9B 2ID0A 2IW3A 3Q0AA 3Q23A 1B53A 1FR3A 2EJGC 3EFXD 3G7LA 2KEDA 3T13A 1ILQA 2CW0C 4RGTA 1Y8PB 3M7GA 4DU9A 4FNFA 1D1IA 2F0QA 4KHZA 3M7NA 1EIHA 3SK5A 2JYOA 3D6CA 1I6VC 1MSHA 3O13A 3VR6A 5FO7B 1R4PB 4K5VA 4Q0FA 2O5IC 4BA2I 5DM63 2WP8J 3J80L 3C46A 3BDCA 3L3OC 1FNWA 1PZJD 5C44B 4CHTB 2F0MA 5G3LD 1HA6A 1K8OA 1U9RA 1RCVD 1SNCA 3I73A 5D65A 1ESRA 2WINB 1CFMA 3AU7A 4F8MA 4C3HB 3S1RB 4Q5VA 2MUYA 3TMEA 1LT4D 3DXJC 3HEJA 2F0SA 1B9NA 4FVMA 2Z8LA 2F0GA 4CJ0B 1KAAA 1BCPC 1TS5A 3MC0B 2EY5A 4XQQA 1WD1A 1SFOB 2NTSA 4DAYA 5IT9L 2DY7A 1EY8A 3KLSA 4R8IA 2PCFB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G2S A;  4MN3 A;  2NWG A;  1U4P A;  3R93 A;  1WTP A;  4IUR A;  1QG7 A;  1IL8 A;  5COR A;  1RJT A;  1TVX A;  5D14 A;  1QNK A;  2B2W A;  2CVR A;  1X3P A;  1HFN A;  1ICW A;  1X32 A;  5DNF A;  3G7L A;  2KED A;  2N88 A;  1AP0 A;  1ILQ A;  1KNA A;  1MSG A;  5COY A;  1WTX A;  1J8I A;  2KVM A;  3F2U A;  3P7J A;  1EOT A;  4IUT A;  4IUP A;  1DOK A;  3DM1 A;  2B2T A;  4ZAI A;  5T1I A;  1F9S A;  2L4N A;  2HDM A;  4IUU A;  4MHE A;  1CM9 A;  1F9R A;  1HRJ A;  2MJ8 A;  1ZXT A;  2KUM A;  1NR4 A;  2EOT A;  2R3Z A;  1EIH A;  2IL8 A;  1G6Z A;  1HHV A;  2B2Y A;  2KEC A;  1VMP A;  1WVL A;  1U4L A;  1DZ1 A;  2N55 A;  3D6W A;  4O42 A;  1SSO A;  2NZ1 D;  2JYO A;  1AZP A;  4R9W A;  1A15 A;  4X3K A;  4ZK9 B;  1SDF A;  4HED A;  3TN2 A;  1B2T A;  2HDL A;  2B2V C;  1MSH A;  2K1B A;  4ZLT F;  3LWE A;  1RHP A;  1ML0 D;  4X3T A;  2K03 A;  1ROD A;  3I91 A;  5EKI A;  5CMD A;  2X69 A;  1O7Y A;  2FMM A;  1JE4 A;  2M2L A;  3N52 A;  2L9H A;  1WTV A;  1B50 A;  1WTO A;  1BNZ A;  2MPM A;  1MGS A;  1HUM A;  1HFG A;  1WTQ A;  1M8A A;  1BO0 A;  4OIK A;  5CBE E;  2FIN B;  4CJ1 B;  4OIJ A;  4X3U A;  1EL0 A;  2L1B A;  3HP3 A;  2K01 A;  1O80 A;  4IUQ A;  2B2U C;  3I8Z A;  1X3Q A;  2FJ2 A;  3KBX A;  5E4X A;  2H1E A;  2MP1 A;  1XYI A;  5EPK A;  2B2W C;  2K05 A;  5EPJ A;  1B4O A;  1GUW A;  3QO2 A;  4QUF A;  2FFK B;  1WTR A;  2K04 A;  1DOL A;  1F9Q A;  5EQ0 A;  4HSV A;  3MTS A;  4RWS C;  1WTW A;  1C8C A;  2L11 A;  1G91 A;  2JP1 A;  3H91 A;  1BF4 A;  4RA8 A;  1CA6 A;  1EQT A;  3UI2 A;  1NAP A;  1XX8 A;  1HA6 A;  1EIG A;  2EPB A;  2B2T C;  4RAU C;  2MGS A;  1LV9 A;  2B2V A;  1HUN A;  1NCV A;  2KEE A;  5D65 A;  1ESR A;  1RTO A;  2FHT A;  3GV6 A;  4X3S A;  2Q8R E;  1ILP A;  1PFB A;  1PFM A;  3ONA B;  1IKM A;  3MWY W;  2EE1 A;  2RA4 A;  2KOL A;  4XT3 B;  1G2T A;  4NW2 A;  4IUV A;  2J7Z A;  2BDN A;  1WD0 A;  1AZQ A;  1F2L A;  4U68 A;  2HCC A;  1PDQ A;  4CJ0 B;  1JIC A;  1PLF A;  1DOM A;  2X6L A;  2B2U A;  3I90 A;  1Q3L A;  1S4Z A;  4ZKC B;  1PFN A;  1VMC A;  3I3C A;  1DON A;  3SVM A;  3KUP A;  4ZKB B;  5T1G A;  3DEO A;  1B3A A;  4QUC A;  2RVL A;  4XDX A;  5JJZ A;  3FPU B;  3GV3 A;  1NR2 A;  4UAI A;  2K28 A;  2Q8T A;  4CJ2 C;  2SDF A;  4XT1 B;  2HCI A;  2NYZ D;  1CA5 A;  1KNE A;  3FDT A;  1E0B A;  2RSO A;  2RSN A;  3IL8 A;  3Q6S A;  4HCS A;  3IFD A;  5EPL A;  1QE6 A;  1WD1 A;  2VXW A;  1BBX C;  4LMQ D;  2HUG A;  3TZD A;  1SAP A;  1MI2 A;  2X6G A;  1IKL A;  5CBA E;  2D9U A;  2B2Y C;  2DY7 A;  5AFW A;  5E4W C;  4DN4 M;  2DY8 A;  1O7Z A;  1U4R A;  4R8I A;  1RTN A;  4HAE A;  2L12 A;  1J9O A;  5EJW A;  1U4M A;  2XIW A;  3DEP A;  1F9P A;  1B53 A; 
#chains in the Genus database with same CATH topology
 1TY2 A;  3HOU G;  2EXD A;  1QG7 A;  3U50 C;  4PZ6 A;  1IYU A;  4OWX B;  1R9T B;  2F0V A;  1TVX A;  5DEH A;  1N8R C;  1ICW A;  2AWO A;  1IBL L;  1Q82 C;  2CFM A;  2WB1 B;  5JPN C;  2NBF A;  3B6Y A;  1II3 A;  4A3M H;  4ZAI A;  4IFD G;  3S1M B;  4OGQ C;  4G7H C;  5IYD H;  2CKZ B;  5FLX L;  4A3D H;  2DGY A;  2PW5 A;  4EQN A;  1UE1 A;  1DZ1 A;  2N55 A;  1E2W A;  1YBY A;  4YHH L;  2RKS A;  3DWP A;  1A6X A;  3M85 A;  1S5D D;  1HA5 A;  1B2T A;  4LFC Q;  3GTG H;  3CQZ H;  1CZG A;  4A3F B;  4JBM A;  2UXB Q;  1ML0 D;  4MTK A;  1ROD A;  5J39 A;  3H0G H;  2Z4H A;  3TQY A;  1EWC A;  4IN3 A;  2L9H A;  5C4X H;  1BNZ A;  3S1N H;  1S5F D;  4FP5 D;  4OEM B;  1YHA A;  2IX3 A;  4HCE A;  3RZO H;  1D2B A;  1VQ6 A;  3HP3 A;  2ZJR A;  4HJ7 A;  1BXT A;  3R2I A;  2FJ2 A;  3M3Y H;  5IWA Q;  5EPJ A;  3ND9 A;  4A3I B;  5LMN W;  4DUZ Q;  4CKB A;  2D5D A;  2AMC B;  1XPO A;  1S72 A;  1SE2 A;  3FKI B;  2BE5 D;  3MTS A;  4ULL A;  1C9O A;  1SE3 A;  3MXG A;  4QGU A;  1XXG A;  4FXD A;  1FNU A;  1LTA D;  3EVQ A;  2B2V A;  3TEH B;  2PNR C;  4A3D G;  1AN8 A;  2DN8 A;  1L0X B;  2RDG A;  2VQF Q;  1PFB A;  3T16 A;  1G2T A;  1AE3 A;  4C3J B;  4IUV A;  3DMU A;  1AZQ A;  1OXU A;  2HD3 A;  3CF5 A;  3KDF A;  1O7L A;  1DOM A;  2UXD Q;  3M4O H;  2VL6 A;  3L9A X;  5C4X G;  1EYC A;  1UWV A;  4GNX C;  2EJF C;  1ENA A;  2OTL A;  3LX0 A;  3K6O A;  1SYF A;  5IGG A;  5M5W H;  1W2B A;  4K0K Q;  1B70 B;  2KCC A;  1GUN A;  5C3E B;  2A5H A;  2SNS A;  1FYC A;  5K36 H;  3HOV G;  3J7A 5;  3KLW A;  3NPP A;  5C5L A;  2B29 A;  3S16 B;  3PGZ A;  4DV3 L;  1LO5 D;  3V05 A;  3S1Q B;  2PZU A;  5C3W A;  4IO9 A;  4IUR A;  2K50 A;  2EZV A;  2R92 G;  1SND A;  4UP8 A;  3GQB A;  4IPD A;  4DV1 Q;  4XIG S;  1XPR A;  4JI8 L;  3GP7 A;  5C0X I;  4YCV A;  1Y1V B;  1PRT C;  2EXZ A;  3DM1 A;  2P5Z X;  2Z6K A;  1UUP A;  4P74 A;  1B3Q A;  3A5Z B;  3MVV A;  4HIO A;  2WKC A;  1K0R A;  3A7A B;  2UUB Q;  4DV6 L;  4HJ9 A;  1NE3 A;  2WB1 E;  1ONL A;  4JI5 Q;  2AUK A;  2NZ1 D;  4ODG A;  1VQJ A;  4M8A A;  3VYS A;  1W6J A;  1HTL D;  4HED A;  4C3I G;  3OSO A;  1LTS D;  3STB C;  4KKU A;  1SLJ A;  1JOR A;  1NY4 A;  4Y52 H;  1WTO A;  1HNZ L;  4L6T B;  1M8A A;  1IYJ B;  5GQO A;  1EY6 A;  3MEF A;  3RZD H;  2XNA C;  2B2U C;  1CQF A;  3PQI A;  5CR3 A;  1S3O A;  4QQB X;  3WDN A;  4LFA L;  2D0P A;  5LMU Q;  1S5C D;  2K5Q A;  1EQR A;  2JJQ A;  3GDE A;  3KF8 A;  1LM0 A;  5M5Y B;  1D7Q A;  4AQY L;  1TS4 A;  3PO3 B;  1QZG A;  5C4Z A;  1JB7 A;  1YEZ A;  2FHT A;  4UDU C;  5ELD A;  4ZRZ A;  1TWG B;  3SXH A;  2RDF A;  1SMY C;  4JI0 Q;  2BDN A;  1F2L A;  3L2P A;  2X6L A;  1TT2 A;  4OO1 I;  2UU9 Q;  3WOF A;  2YU9 B;  4ZKB B;  3FMC A;  1WCM B;  4BBS G;  2PZW A;  5C0X J;  4CDC C;  5M3F B;  2A6E D;  2B8F A;  3RLO A;  4JOI C;  4F87 A;  3D4R A;  4DXF A;  5HGQ A;  3FDT A;  3IL8 A;  4C3J G;  5KEE A;  1I50 B;  3TS2 A;  1YVC A;  4GKK L;  2VQE L;  2EY2 A;  5IP7 H;  2NVT B;  4B08 A;  1JOQ A;  1ASY A;  3OOC A;  4APV A;  1B8A A;  1TR5 A;  2LKV A;  4HAE A;  4GOP A;  2M9V A;  2XIW A;  5BR8 L;  3CCE A;  2O5J C;  3CRK C;  2I0Q A;  3HOZ H;  5BN5 A;  3J7A F;  2G9D A;  1N33 L;  3J80 E;  1HNW Q;  2CH4 W;  1ESF A;  4RGM A;  3X3N A;  1PH2 A;  1GKH A;  4P71 A;  3E5S A;  1WTX A;  2F0I A;  3BDL A;  4OEL B;  4HJA A;  3F2U A;  1DYQ A;  2RF4 A;  1Y1W B;  1VS0 A;  2AHO B;  2R93 H;  4K2K A;  4DK3 C;  3PMF A;  2HDM A;  2ENB A;  1QNU A;  2HQL A;  1GJX A;  3I4N G;  1X56 A;  3S2D H;  1FGB D;  1U4L A;  3M4Q A;  1GUS A;  1SNM A;  1Y8N B;  1AZP A;  1OTC A;  4JI2 Q;  1KL9 A;  3RLN A;  4G4K A;  3K5N A;  1RHP A;  2O4X A;  3D4D A;  2Z6B A;  1VQO A;  1JR0 D;  3N52 A;  3U4V A;  3D31 A;  1PHJ A;  1GHK A;  1VQE A;  1I94 Q;  3TDQ A;  5FJ8 H;  4JI7 Q;  4OIJ A;  4G7Z C;  5H1S E;  1E22 A;  5ELE A;  3ND8 A;  2LSS A;  4DV5 Q;  3T1H Q;  1B4O A;  1YJW A;  1QJO A;  3HZX A;  3QB3 A;  3ERQ A;  3HOY H;  1HZA A;  2JP1 A;  4BXX H;  2NN6 H;  5KND A;  4RAU C;  3CRL C;  3DHQ A;  5IP9 G;  4NPS A;  5F2D A;  1IW7 D;  4EVO A;  3GV6 A;  4A3E H;  4JG2 A;  1QB5 D;  4OON A;  1D8L A;  5FK9 C;  3MWY W;  4LFC L;  3G48 A;  1PDQ A;  4GZY C;  1JIC A;  3I7F A;  3S15 H;  3S2H B;  2UXB L;  2Z1C A;  1Q3L A;  2ZXR A;  5FLX E;  2K33 A;  5JEA H;  2Q8T A;  2OTJ A;  2F0L A;  1KNE A;  2RSO A;  1NSN S;  3ULJ A;  4K2L A;  5IWA L;  1IBL Q;  3R2T A;  1EZ8 A;  4TRD A;  5JPM C;  4DUZ L;  1E1O A;  1O7Z A;  1JOO A;  2PMZ B;  1U4R A;  4BBR H;  1YNJ C;  2K52 A;  3AYH B;  5IGD A;  5M3M B;  3NK9 A;  2ICE C;  2ZJQ A;  2E2H B;  1QUQ A;  5COR A;  2A6H C;  4IJL A;  5IGC A;  3HGB A;  1X3P A;  2VQF L;  5ELB A;  1NBW A;  4U67 3;  3UDF A;  3RUZ A;  2E2I H;  3H09 A;  1PRT D;  4QIW B;  2UXD L;  1I4H A;  5LL6 X;  4A3K B;  4RGO S;  2XTI A;  2NVQ B;  1ZXT A;  1H9J A;  5IGF A;  4GN3 B;  1G6Z A;  4DR2 Q;  1N36 L;  4K0K L;  2HDL A;  2QIL A;  4A3J G;  1LTR D;  1MJC A;  3TP6 A;  1UE7 A;  1L0W A;  1YIJ A;  2M2L A;  4BBR G;  5GAE C;  5A35 A;  1PZI D;  1HR0 L;  4JOI A;  3UDG A;  3NBI A;  4JW0 A;  3H94 A;  1B1Z A;  4A93 B;  3Q8D A;  4M1U B;  2C5C A;  4DAV A;  2JA8 H;  2EY6 A;  4BY1 G;  3UE1 A;  4B3T L;  4O2D A;  1IL2 A;  4WFN 3;  2NVX B;  4DV1 L;  2B2W C;  1V8Q A;  2K05 A;  2D62 A;  3QO2 A;  4QUF A;  2PYK A;  1EY9 A;  4RWS C;  3J80 c;  4BS9 A;  1XX8 A;  1QOH A;  3K57 A;  2J4X A;  4UP7 A;  1HZC A;  4LF6 Q;  2UUB L;  1PTO B;  2F0D A;  2E2J B;  3ONA B;  1YZ6 A;  1BKB A;  1Q12 A;  1ENF A;  1I6H B;  2KOL A;  1ET6 A;  1SYG A;  4KKS A;  3PCO B;  5IE8 A;  4JC0 A;  3PO2 G;  3SVM A;  1TS2 A;  5IIF A;  3D8G A;  1EZ6 A;  5JJZ A;  3GTQ B;  1AH9 A;  4HCS A;  5EPL A;  1EFW A;  4RG1 A;  2QKI C;  3KF6 A;  2EYF A;  1I3Q B;  1EY0 A;  2RCF A;  3CU7 A;  4C2M B;  3WWV A;  2F3W A;  5LMU L;  3S14 B;  1U4M A;  2WAC A;  5K5P A;  5IT9 c;  1S5E D;  1VQM A;  4YIJ A;  1LTG D;  3QWN A;  3BU2 A;  5KNB A;  1MJE A;  1TY0 A;  1AEX A;  1RD9 D;  4RH6 A;  2R7Z B;  1RKN A;  3OYY A;  4RMF A;  1SRU A;  2N3S A;  2PMZ E;  1Q86 C;  4JI0 L;  1K3R A;  1W3S A;  4K5W A;  3G4S A;  2WAQ G;  1V1P B;  1IBK L;  4L8J A;  5JOB A;  2B63 H;  3K7A B;  4JPB W;  4Z9C B;  2JA5 G;  2N49 A;  4FF4 A;  1PTO F;  2IL8 A;  5TSS A;  4CDF C;  3S9W A;  3CC7 A;  3D6W A;  3EIV A;  3IAY A;  2ZJP A;  5FLX c;  3RMH A;  1CSQ A;  4QIW E;  2B2V C;  2JA7 G;  2K1B A;  1Y69 U;  3GTK H;  3I91 A;  2X69 A;  1H9M A;  4GKJ Q;  1PMR A;  1QWY A;  4A3B G;  1B50 A;  5A2Q L;  1BO0 A;  4JI3 Q;  1TWC H;  1OO9 B;  1FGU A;  1AE2 A;  4FF1 A;  3FRP B;  3TBI B;  1CHQ D;  4A3G H;  4OXP A;  3ERS X;  5C4J H;  1HNW L;  1A0I A;  3P75 A;  1N32 Q;  2FFK B;  1SBB B;  1DOL A;  4ABN A;  3K7U C;  2E2D C;  4E6I A;  4ILW A;  1PYW D;  4QB4 A;  2O2L D;  2ZXP A;  4XXE A;  4H02 A;  5E1F A;  3HOW B;  5KYI A;  4JI2 L;  4J8Q A;  3M9B A;  3OWE B;  5FLM H;  2VQE Q;  3T1Y Q;  1SMX A;  4ZKC B;  5LHY 1;  1L1O B;  1D5X C;  4IOC A;  3ULP A;  3CAM A;  4XDX A;  4KTA A;  2LMC B;  4UAI A;  1I94 L;  1N34 Q;  4JI7 L;  4PMW A;  4XT1 B;  4LF7 L;  4AIM A;  4LUO A;  1N9W A;  4KJO A;  1BBX C;  4A3M B;  4DR6 L;  3BS1 A;  3MXP A;  3QJY A;  4XQJ A;  3T1H L;  2VUM G;  2KBN A;  4P72 A;  4L5Q A;  2QA4 A;  3GTJ H;  3TRE A;  1EY5 A;  1TWA B;  1LTB D;  3D3R A;  3DEP A;  4KD4 A;  4EX5 A;  2K5V A;  2YYZ A;  3HOX G;  4KD3 A;  3BZC A;  4IFD H;  3GTG B;  2PI2 E;  2A6H D;  3CQZ B;  2RBM A;  3G6J B;  4MZ9 A;  2B2W A;  3H0G B;  3A7L A;  1PH9 A;  3GTL H;  1NUC A;  3MHB A;  1AP0 A;  2TSS A;  3S1N B;  2EIF A;  5JEA J;  1SRO A;  1ZYR D;  5DLQ E;  3I4M B;  3NQT A;  2DJG C;  1A62 A;  2M00 A;  5CYU A;  1F9R A;  1YNX A;  3NEL A;  1GXD C;  3M3Y B;  1PYB A;  1HHV A;  2JA6 B;  5ELO A;  4HN7 A;  4RKB A;  2A68 D;  1WVL A;  4BY7 G;  1LT6 D;  3AB9 A;  4R9W A;  1TQO A;  1KDA A;  4ZK9 B;  1STG A;  3I4L A;  4IPH A;  4DR5 Q;  4DPG A;  3RD4 A;  4RCN A;  3NBH B;  2A69 C;  3K80 C;  1HFG A;  2RCN A;  5C0X G;  2KCT A;  1E24 A;  4FDB A;  2SNM A;  4ME5 A;  3NP8 A;  1X55 A;  2NUC A;  4YWL A;  1STH A;  2QF7 A;  1O80 A;  3TSS A;  5I2Y A;  3CCJ A;  3BYT B;  4N8X 1;  3M4O B;  1X3Q A;  1OXS C;  1K8G A;  4R4O A;  3OMC A;  1D5Z C;  4R4T A;  1Q8I A;  2DNC A;  3PUY A;  4FF2 A;  1EFI D;  1WYD A;  5HGT A;  3TP5 A;  2L11 A;  1WTW A;  1C8C A;  1A2T A;  4NB3 A;  3H3V I;  2IX1 A;  1HUN A;  4B3R Q;  4XTC S;  1BVS A;  5HY6 A;  3R3O A;  1KHI A;  4DR2 L;  2ZTC A;  4GOP C;  2JK8 A;  3S1R H;  2A1A A;  3KLS X;  2WKD A;  5EKL A;  2DUD A;  4P73 A;  5FKA C;  2VS1 A;  4JK1 C;  3ITP A;  5CV6 A;  1NTG A;  3HOV H;  3VA5 A;  3OW7 A;  2E5L Q;  1K28 A;  4L5S A;  2JEA I;  3GV3 A;  2R61 A;  3A5U A;  1SYE A;  4DV0 Q;  5G3L F;  1QE6 A;  2Y0S B;  4B9W A;  2AUJ D;  3TZD A;  2HHH Q;  5AJ3 Q;  5CBA E;  2D9U A;  2R92 H;  3S17 H;  2WFW A;  1TU2 B;  2LXJ A;  2DY8 A;  1SYD A;  1A3U A;  3P20 A;  1TS3 A;  2PQA A;  5IGB A;  5C44 G;  1W6K A;  3M4P A;  1IKM A;  4V19 0;  1EEF D;  4HSP A;  4OO1 G;  4N9T A;  3KJO A;  4LF6 L;  2RDH A;  1F2Z A;  1X32 A;  3NTI A;  4C3H G;  1N36 Q;  1VQK A;  3SHL A;  4LJZ C;  3P7J A;  1DOK A;  2QEJ C;  4C3I H;  5CV7 A;  4L5R C;  1F9S A;  1VQG A;  5EAY A;  3W5O A;  3KJP A;  4OWT B;  4CKC A;  4H0L C;  1YJ9 A;  1HNX Q;  4A76 A;  1VMP A;  2F3I A;  4KY6 A;  1HR0 Q;  3K5L A;  3X3M A;  4H7B A;  2DJF C;  4B3T Q;  1C7Y A;  2ZXO A;  3F2D A;  2CW0 D;  4O0A A;  1WJJ A;  4WJ3 M;  1GD7 A;  1MGS A;  1DXM A;  2BDO A;  3CCS A;  3H3V C;  3E6Z X;  5E7N A;  3OIQ A;  3H6M A;  2AQ1 B;  5M5X B;  1A63 A;  3FVQ A;  4QY7 A;  2C35 B;  2JA9 A;  2WB1 G;  4HJ5 A;  1F9Q A;  4Y7N B;  3H15 A;  4DR1 L;  4DK0 A;  1VQ7 A;  2LXK A;  1DGS A;  4GN4 B;  1TWH H;  2PQA B;  2EDG A;  3PIO A;  3BZD B;  4BBS H;  1LYL A;  3DUZ A;  1BDO A;  3PF4 A;  2Z0S A;  2F0N A;  2J7Z A;  1LTL A;  2AQ3 B;  4C3J H;  4A3F G;  1VQI A;  3HOZ B;  4LF5 Q;  3I90 A;  1BBW A;  4GKJ L;  3DEO A;  2OCE A;  2Z4I A;  4IPG A;  2GA4 B;  4ZQ3 A;  4LW1 A;  4JI3 L;  4DA2 A;  1RDP D;  4CBV A;  2XRQ D;  1KDB A;  1PH6 A;  1CA5 A;  5I2X A;  4H44 C;  5C6A A;  2R93 B;  3HKZ B;  1KD1 C;  5ELN A;  5JJL A;  1G51 A;  4CDE C;  4A3I G;  5AFW A;  1EU4 A;  1N32 L;  2F0P A;  1H9K A;  3PUV A;  3TRZ A;  5A2Q E;  5I4D A;  4EQ5 A;  3S2D B;  5DM7 3;  3FKI G;  1HTP A;  4AYB B;  1UEA B;  1XWE A;  4POG A;  1IBK Q;  1A3V A;  4MN3 A;  1PH3 A;  2BH8 A;  3GTP H;  2Y0S E;  1BCP D;  1PYS B;  3K81 C;  4RHS A;  3I4N H;  4HIM A;  3JC6 6;  4GS3 A;  3BYY B;  4DK6 C;  1XJV A;  1C4Q A;  3U58 A;  3GTO H;  3PSI A;  4KV6 A;  1WOC A;  1Y1V H;  3T1Y L;  1P8L A;  5IY0 A;  3OPO A;  3SK8 A;  1CKN A;  3NE5 B;  4DV7 L;  3J81 i;  4ME3 A;  5JVG 3;  2RHQ B;  2E75 C;  1CZW A;  4N9P A;  2G9H D;  1N34 L;  3HOY B;  4X62 Q;  2B39 A;  4PQX A;  3ERO A;  1Q81 C;  4ZLT F;  5C3E G;  4IQZ A;  5EKI A;  3SK4 A;  4TSS A;  1KDC A;  2KCM A;  4A3E B;  1YNN C;  1HUM A;  3BDO A;  1T9H A;  5KYL A;  5I9O A;  3MAQ A;  3PF5 A;  1CI3 M;  4WJ4 A;  3I70 A;  5EGT A;  3S15 B;  1R4Q B;  3KK7 A;  5IP9 H;  1JCK B;  5E4X A;  4RGN A;  4DXG A;  1WI5 A;  2QW7 A;  5EQ0 A;  1VCI A;  1X3F A;  2EYO A;  2F0U A;  4O1N A;  5CV4 A;  1Y1V G;  1CKO A;  3I2Z A;  4ZUI A;  3UI2 A;  1MBY A;  1TII D;  2MGS A;  5M5Y H;  4JI1 Q;  2IY5 B;  1RTO A;  2I5M X;  2D0O A;  5C4H A;  4RFB A;  1LAC A;  1VQH A;  1O7I A;  3NWT A;  1STE A;  3EBE A;  4ZYS A;  1TWG H;  5BN3 A;  4LF7 Q;  2F0F A;  1YIT A;  4QMG A;  4DR5 L;  4EQP A;  3NTH A;  2J0T D;  1PH1 A;  1A8V A;  4DR6 Q;  2KEN A;  3EN2 A;  2K75 A;  1YHB A;  1WCM H;  1L1O C;  5IOD A;  1NR2 A;  1SR3 A;  2E2I B;  3JAM L;  4KK7 A;  4RKL A;  1CKN B;  2SDF A;  2HCI A;  3NTK A;  1VDZ A;  1ICF B;  3LNN A;  4LMQ D;  2JEB I;  2F0W A;  4K14 A;  1PH8 A;  1B9M A;  3OTO Q;  2EYJ A;  1EY4 A;  4OHJ A;  1LT5 D;  1STN A;  3CCL A;  3R93 A;  3PO3 G;  3HKZ E;  2IJ0 A;  4K5X A;  4B3R L;  4HIK A;  1K83 H;  3JAM i;  4KN4 C;  5D14 A;  1X3E A;  4OX9 Q;  1H9S B;  4PV1 C;  2B8G A;  1EWH A;  4AYB E;  4IUT A;  3CC4 A;  1Y1W H;  3VR2 A;  2VB2 X;  1EEI D;  1VQL A;  2JA8 B;  4A3J H;  1KAW A;  1XNQ Q;  1HRJ A;  1CUK A;  2NVY B;  2K7V A;  1WCM G;  1HQM C;  2F52 A;  1UAP A;  3CW2 C;  4AH6 A;  2E5L L;  2B2Y A;  2KEC A;  4YWM A;  4JYA Q;  1EU3 A;  5ISR A;  5M3F G;  2AWN A;  4DNI A;  2F0T A;  4DV0 L;  2K5W A;  3LWU A;  1IYV A;  1SDF A;  3RN5 A;  5I9P A;  5D3D A;  4WJW A;  4BY1 H;  3SK6 A;  2HHH L;  1RL2 A;  5AJ3 L;  2F1M A;  5CMD A;  3LGJ A;  5IYB H;  3VA7 A;  1P16 A;  1TWF B;  3K0X A;  2ZTD A;  2VB3 X;  4G7O C;  4GLA C;  2FIN B;  4G57 A;  1PA6 A;  2L15 A;  1KIX A;  2PI2 A;  2MO1 A;  2VZA A;  3BG3 A;  1OXV A;  4L5T A;  5EPK A;  3QOL A;  1JE5 A;  4GNX B;  3PIP A;  2ZM6 Q;  3E0J A;  4POF A;  1Y1W G;  5GRO A;  2JN4 A;  1BF4 A;  4UY8 C;  4NP5 A;  3STB D;  1EIG A;  3PO2 H;  3EJI A;  4HMJ A;  3A55 A;  4DR3 Q;  1Z9F A;  3QR8 A;  1HNX L;  1KLG D;  2YTV A;  3NUC A;  4FXK C;  4KMU C;  3V96 A;  4HID A;  2BCO A;  4X64 L;  2EJM A;  4LF4 Q;  1IXR A;  1V1P A;  3Q22 A;  5IYB G;  2Z9H A;  4UHV A;  2OQK A;  3FPP A;  4QUC A;  3I56 A;  3E3X A;  1PRT B;  1E0B A;  4LAA A;  3MFG A;  2B63 B;  3K58 A;  4KHV A;  5LL6 S;  1SMY D;  4QF4 A;  4IAL A;  3C1F A;  2XSC A;  4XT3 B;  1F9P A;  2K32 A;  4R8N A;  1EQQ A;  1EYD A;  1D5M C;  2YV5 A;  3OHX C;  2JA5 H;  3GTK B;  2NZO A;  1SXT A;  1T5E A;  1VQC A;  1TKW B;  1NNX A;  5DNF A;  2CQA A;  2YTY A;  5GAG C;  1TWC B;  2K6A A;  3A8K E;  3TZU A;  1DCZ A;  4LF5 L;  2JA7 H;  4A3G B;  3BVZ A;  5LMN Q;  5FOB B;  5C4J B;  1PH7 A;  1STB A;  2AQ2 B;  2R3Z A;  1LAB A;  4UPA A;  4A3B H;  1K73 C;  5BN4 A;  1LUZ A;  2MHV A;  3NXW A;  3UDI A;  3GTM H;  3VYT A;  3NSW A;  5CV8 A;  4MTN A;  1YNN D;  1L1O A;  3CHB D;  4KY7 A;  1X65 A;  4DR1 Q;  4MNO A;  5ELF A;  3CCQ A;  1WTQ A;  1XMO L;  5CBE E;  2E74 C;  5M3M G;  3KOJ A;  4CJ1 B;  2R7F A;  1PRT F;  4X3U A;  1IHZ A;  1S5B D;  2L1B A;  5I6W A;  2NN6 I;  3A8I E;  4XQN A;  1I4Q A;  2R6G A;  2NVX H;  3U4Z A;  1PH5 A;  1XTD A;  4J6H A;  1EOV A;  4DV4 Q;  5FO8 B;  2PNH A;  3CD6 A;  1GUW A;  1ZEQ X;  2AKW B;  3J81 E;  2QDL A;  5C5M A;  4JI4 L;  4MIU A;  3D0F A;  1Y8O B;  2A8V A;  3FP9 A;  1MHW C;  4RA8 A;  4IPC A;  4KLK A;  1CA6 A;  4LK1 C;  4LUV A;  3HOU B;  1H95 A;  4A3K G;  2UUC Q;  2PZT A;  1Z47 A;  4R4C A;  2KCN A;  3ULL A;  4X3S A;  3HG9 A;  1PFS A;  3K59 A;  1YJN A;  4R4Q A;  4X62 L;  2EE1 A;  2G5D A;  3F8T A;  1WD0 A;  3W2D A;  1GHJ A;  2SEB D;  3ZYY X;  1VQ8 A;  1SJH D;  4PNY A;  1RF2 D;  5CV9 A;  2VUM H;  4CKE A;  3GTL B;  3VR4 A;  1KQS A;  4CJ2 C;  2KHI A;  4A93 G;  1D6E C;  5IYC G;  5JAV A;  3HOX H;  1EWI A;  3NQI A;  1XNR Q;  2PO4 A;  1SAP A;  1MI2 A;  1IKL A;  4BA1 I;  3G6E A;  4DN4 M;  1YHQ A;  1Q90 A;  3NBH A;  4A3C G;  2F4V L;  2L12 A;  1J9O A;  1UE6 A;  5CV5 A;  1DON A;  2F0E A;  3M4Y A;  4K6L A;  4JI1 L;  1HH2 P;  4DV7 Q;  1WTP A;  1Q8K A;  1SYC A;  4DR7 Q;  4X6A H;  3PUZ A;  1SE4 A;  2R7Z H;  2I5H A;  1QNK A;  2CVR A;  1GVP A;  1CHP D;  1QIL A;  1HFN A;  3UDX A;  1HJP A;  4HR7 B;  4BY7 H;  2EQS A;  5COY A;  2ATW A;  1CTM A;  5T1I A;  2JXM B;  2L4N A;  1EIF A;  2NTT A;  4MHE A;  4A3D B;  4FYD A;  4EQO A;  2ASB A;  1YNJ D;  4I7A A;  4N8F A;  1V1O A;  3U9S A;  4TVA B;  5C0X H;  3CMA A;  1Q1E A;  3URY A;  2JSO A;  3V2T A;  4X3K A;  1X6O A;  3E9I A;  5C3X A;  1L2F A;  1D1K A;  1JJC B;  3DWQ A;  4QL5 A;  4OWW B;  1ASZ A;  2FMM A;  5C4X B;  1S40 A;  3OTO L;  1CKM A;  3TS0 A;  3JAM E;  2XRS D;  3RZO B;  4FXG C;  2K01 A;  4JBK A;  2R7Z G;  2EY1 A;  1F77 A;  4L63 B;  3I55 A;  4YCW A;  3CCV A;  4OX9 L;  5EBC A;  1HCZ A;  2QCP X;  3HOV B;  2GN5 A;  2UUA Q;  3D4W A;  3DWA A;  1Q1B A;  2UXC L;  3MFY A;  1LLR D;  5IOC A;  2A6E C;  4A75 A;  4K8J A;  2PW7 A;  4DGZ A;  1XNQ L;  3C2P A;  2R92 B;  3BJU A;  3S17 B;  3HS0 C;  4JYA L;  1DJR D;  1ILP A;  3CCM A;  3FHW A;  2K5H A;  4DFA A;  4KN7 C;  4U68 A;  3C1E A;  3HKS A;  1FNV A;  2OWO A;  1PFN A;  2V4D A;  3I3C A;  4NMZ A;  2H4O A;  1CQV A;  2K14 A;  1B3A A;  3OMG A;  2KHJ A;  1VQD A;  5HUR A;  5M5W B;  1SN8 A;  5C44 H;  2KHS A;  2KJX A;  3CCU A;  1WFQ A;  3IFD A;  4XYQ A;  4C3I B;  1HZ9 A;  1LT3 D;  2VXW A;  3J81 j;  3AMU A;  3SR1 A;  4OO1 H;  2CCZ A;  1EUJ A;  2ZM6 L;  1JC7 A;  1VQB A;  2E76 C;  4C3H H;  4ZUJ A;  3K8A A;  5EJW A;  4DNT B;  2F4I A;  1TWA H;  2PPB C;  1U0L A;  1JWS D;  1VQ9 A;  1L0Y B;  1IL8 A;  4DR3 L;  2IX0 A;  2XN9 C;  3J81 c;  1B7Y B;  2QGQ A;  3VYR A;  3IRB A;  4LF4 L;  1ET9 A;  3HOW G;  3KLR A;  3KBG A;  2EYP A;  4B9X A;  3BVG A;  1O78 A;  1SFO H;  3I4M H;  2L0C A;  3PIO 3;  2K5N A;  4B3S Q;  3W1G A;  2MJ8 A;  1NR4 A;  2EOT A;  3J7Y W;  3P1H A;  3MXN A;  2JA6 H;  2Q2H A;  3OIP A;  2WII B;  1K9M C;  2MQH A;  4A3M G;  1G6P A;  4DAY B;  2KQ3 A;  1R9T H;  3N6R A;  2K03 A;  5IYD G;  4C56 C;  1K8A C;  1K3B C;  5J22 A;  1JMC A;  1TWH B;  5JJK A;  4IUN A;  1HZB A;  1IW7 C;  4BBS B;  2OXP A;  4OIK A;  4A3L H;  3TP7 A;  2LFN A;  1WTH A;  3L0O A;  3RZD B;  2ZTE A;  3S1M H;  2HT1 A;  4IUQ A;  2BOS A;  1KRS A;  1J6Q A;  4RHR A;  3F2B A;  3CC2 A;  3H0G G;  3NEN A;  2H1E A;  2MP1 A;  2TMP A;  4C1N I;  4X64 Q;  3I4M G;  1G91 A;  4A3F H;  3GD7 A;  5LMN L;  3SGI A;  5I6Y A;  1STA A;  2HQE A;  1X3G A;  2JA6 G;  1F2Y A;  3FEW X;  4DKA C;  1E2V A;  1PFM A;  4NW2 A;  1Y14 B;  2N8N A;  2VW9 A;  4P75 A;  3J7Z C;  4HTH A;  3GTP B;  1CT1 D;  3U9O A;  5CC4 A;  1S4Z A;  1M4V A;  5M9O A;  1HXY D;  1VQF A;  3I4N B;  4A3I H;  4X66 Q;  1PXU A;  5EKK A;  4A3L G;  5GAH C;  3FKI H;  2K28 A;  4DV2 Q;  3GTO B;  1E1T A;  1Q7Y C;  3KFU A;  2K5D A;  1PV4 A;  3NWS A;  4IOA A;  1JT8 A;  4IFD I;  3MXN B;  2IWH A;  4TKO B;  1BUV T;  1UE5 A;  2ICI A;  3JAM c;  2HIX A;  1SNQ A;  2BA1 A;  3HRZ C;  4DV4 L;  2B2Y C;  2F3V A;  2A19 A;  1PTO C;  1I5F A;  3BVM A;  1G8Z D;  1RTN A;  5GAD C;  3NHH A;  3K0Y A;  2IPK D;  2EYL A;  1CSP A;  2UUC L;  2IT1 A;  4NXN L;  3ZJY C;  1XMQ Q;  5K36 G;  1FVI A;  1SYB A;  4JBW A;  1EIY B;  2YTX A;  1JOK A;  3W3A A;  1KRT A;  1GUO A;  2N88 A;  1EQV A;  1J8I A;  3PUX A;  3KDF B;  4IUP A;  3CCR A;  3A8J E;  1I4X A;  1VF5 C;  5C3E H;  4IUU A;  1CM9 A;  1UEB A;  5KIX A;  2KUM A;  4RCO A;  1SEB D;  2SOB A;  3J81 L;  1XMO Q;  3S16 H;  4LF9 Q;  4YY3 L;  3S1Q H;  1ZKO A;  1A15 A;  2BA0 A;  1XNR L;  3TN2 A;  2Y0S G;  2CHB D;  1BOS A;  3LWE A;  1JJG A;  1O7Y A;  5CGK A;  4X65 L;  4BWG B;  3VR3 A;  2MPM A;  2QDB A;  4JI4 Q;  4LF8 Q;  4KY5 A;  4JVZ A;  2LS0 1;  1NMF A;  4GN5 A;  2V1C C;  4DR7 L;  3I8Z A;  4KHP Q;  3NEM A;  2F0J A;  3L7Z C;  3Q24 A;  5M5X H;  1VQ4 A;  3SE0 A;  2GVA A;  2OEO A;  4JBJ A;  4HSV A;  3J7A V;  5KNC A;  3MA2 B;  4Y7N H;  1F2M A;  3H91 A;  2CWP A;  1QZH A;  4IFD J;  1NAP A;  1DM0 B;  1FD7 D;  2EPB A;  2B2T C;  3EA6 A;  2A69 D;  2MFI A;  3AEV A;  3SEB A;  2NB0 A;  1IZ6 A;  3EQL C;  1QVF A;  2Q8R E;  3UE0 A;  1H9S A;  4PZ8 A;  1JWU D;  1MD2 D;  1XTC D;  1SNO A;  4DAM A;  4DUY Q;  2D2C C;  1MIU A;  3ER0 A;  4NXM Q;  4DF7 A;  4C1N K;  1PLF A;  2K4K A;  4QCL A;  1BCP B;  4WRD A;  1VMC A;  3I4O A;  5KRU A;  1K83 B;  3KUP A;  2RVL A;  4NKL A;  2F4V Q;  1JJ2 A;  2FMC A;  2ES2 A;  1A3T A;  1J5E Q;  3F1Z A;  1K0S A;  1AW7 A;  3PO3 H;  1FJG Q;  4A3J B;  1Q46 A;  2A74 C;  2X6G A;  1EYG A;  1KLU D;  4BBR B;  4B3M Q;  1G29 1;  2VY3 A;  2UUA L;  2JQO A;  2XWB B;  4P2C B;  3KF8 B;  4JV5 Q;  2F0K A;  1G2S A;  1EY7 A;  2F0O A;  3PIP 3;  4OL7 A;  4HJ8 A;  2F0H A;  4KJN A;  4BY1 B;  2YU9 H;  1RJT A;  5IP7 G;  2PQE A;  1T5X D;  1QCB D;  4I65 A;  3T51 B;  1E2Z A;  4DR4 Q;  4GNX A;  5M3F H;  4CGY B;  1KNA A;  1MSG A;  4S3S A;  3OW2 A;  1V1Q A;  3HOZ G;  1BBU A;  1I50 H;  1UNS A;  2CWA A;  3ICE A;  1STY A;  3QOJ A;  1X9N A;  2NVT H;  2B3G A;  5IT9 E;  2OF1 A;  1SNP A;  4JI6 Q;  2EVB A;  2Q8I B;  5L37 A;  1SJE D;  3SDZ A;  3RLF A;  2R93 G;  1PZK D;  3HKZ G;  1GOZ A;  3PV0 A;  4ZCK A;  3PO2 B;  1BCP F;  4X3T A;  2JE6 I;  4LUZ A;  2C9O A;  1BR9 A;  3AFP A;  1JE4 A;  1LTI D;  4DK1 A;  4GOP B;  1WTV A;  4V0B A;  1C0A A;  4AYB G;  2UXC Q;  4FF3 A;  2IHF A;  1EL0 A;  3CPW A;  3VR5 A;  4PMB A;  3RN2 A;  2NZH A;  3KBX A;  3QG1 A;  3CKI B;  4FO2 A;  3MEH A;  1RIP A;  4F7X A;  1FL0 A;  1WTR A;  5KGU A;  1LTT D;  3VYU A;  1IBM Q;  5FJ8 G;  2F03 A;  1HR0 W;  4LFB Q;  1ENC A;  4WOR A;  1EQT A;  3T56 B;  5EBD A;  4B3S L;  1LV9 A;  3A56 A;  1H9R A;  3K5M A;  5ELC A;  3T53 B;  1JQY D;  1I4P A;  2Q2I A;  3IKJ A;  4K8I A;  3HOY G;  2RA4 A;  5NUC A;  4GLV B;  4BXX G;  2NN6 G;  2LY7 A;  3OWF A;  1C48 A;  1VQA A;  2WAQ B;  2EYH A;  2ZT9 C;  2RQX A;  4PZ7 A;  1QVG A;  1OXT A;  2B2U A;  2OQ0 A;  2A73 B;  2JA5 B;  5JVH 3;  1CK1 A;  1DD2 A;  5J1Z A;  4A3E G;  1E7Z A;  3FPU B;  4YHH Q;  2NYZ D;  2Q2T A;  1ZYR C;  2JA7 B;  1GO3 E;  2CH4 A;  1SE8 A;  4DAP A;  5E4W C;  1PTO D;  3RNU A;  4A3B B;  2XWJ B;  5JEA G;  3E0E A;  2A68 C;  2HUG A;  3MXU A;  3GTM B;  2VNU D;  2NWG A;  1U4P A;  3MZ5 A;  3S2H H;  1K8M A;  2WV6 D;  3IFT A;  1X54 A;  2OT2 A;  4DNR B;  3A54 A;  4TQU S;  4XYO A;  2KVM A;  1EOT A;  4UP9 A;  4JCV E;  5DAU A;  3RR5 A;  1GUT A;  2B2T A;  3CXC A;  3CP0 A;  3WOE A;  2R7D A;  1HQR D;  3DM3 A;  4IZ8 A;  3R8B A;  2NVY H;  2E8G A;  4X66 L;  4I7Z C;  1AFP A;  3I72 A;  4DV2 L;  4O42 A;  1SSO A;  1JWM D;  5M3M H;  4NDX A;  1V43 A;  1GUG A;  2E2H H;  1I4G A;  5D3I B;  2I46 A;  3BZK A;  1JB3 A;  3QIA A;  3A74 A;  3GO5 A;  4ALP A;  1TWF H;  2L5T A;  1OXX K;  1VF7 A;  2Q2U A;  4JI5 L;  1QUQ B;  2KA7 A;  4J15 A;  1MKH A;  2DNE A;  3AFQ A;  4A3K H;  1B44 D;  2NVQ H;  1XMQ L;  1XYI A;  2VUM B;  1NJI C;  1BQQ T;  2XVS A;  2K04 A;  4F88 A;  2BE5 C;  1I4R A;  4J1M A;  4DV3 Q;  1Z6H A;  2N78 A;  1M1K C;  3HOX B;  5JJI A;  2JA8 G;  1KAB A;  3T4A C;  3KYH C;  4KI0 A;  1NCV A;  2KEE A;  2L55 A;  3AQQ A;  1KTK A;  4K6D A;  4ID6 A;  2GVB A;  4KKT A;  4EGV A;  4LF9 L;  4JI8 Q;  3VDY A;  2I07 B;  4LNQ A;  3H3V H;  4A93 H;  4LWC A;  5IYC H;  1EYA A;  2HCC A;  3HFZ B;  1GM5 A;  1M90 C;  1VQP A;  4H13 C;  2EYM A;  5E3F A;  5T1G A;  2H5X A;  3PUW A;  2MNA A;  1A2U A;  4A3C H;  5IGE A;  4DV6 Q;  4BY7 B;  4LF8 L;  4PMC A;  3Q6S A;  2WAQ E;  2RSN A;  4NXN Q;  3K5O A;  4PG3 A;  4KHP L;  3C3L A;  1HPC A;  1Z7T A;  2UU9 L;  1PTO H;  2ALY B;  3TP8 A;  3GTJ B;  4HMI A;  2E2J H;  3CME A;  1HNZ Q;  1I6H H;  5FO9 B;  2ID0 A;  2IW3 A;  3Q0A A;  3Q23 A;  1B53 A;  1FR3 A;  2EJG C;  1VQ5 A;  3EFX D;  4YWK A;  3G7L A;  3GTQ H;  2KED A;  1V9P A;  4YY3 Q;  4LFA Q;  3T13 A;  1ILQ A;  2CW0 C;  4RGT A;  4DUY L;  1Y8P B;  3M7G A;  4DU9 A;  4FNF A;  4NXM L;  1D1I A;  2F0Q A;  4KHZ A;  4AQY Q;  3DLL A;  1I3Q H;  3M7N A;  4C2M H;  1EIH A;  2FXQ A;  3SK5 A;  4X65 Q;  2QEX A;  3S14 H;  1TXY A;  2JYO A;  1J5E L;  2CQO A;  3D6C A;  3KF6 B;  1I6V C;  1MSH A;  1FJG L;  2B63 G;  3O13 A;  3VR6 A;  5FO7 B;  1R4P B;  4B3M L;  4K5V A;  3A0J A;  4JV5 L;  4Q0F A;  2O5I C;  4CDD C;  4BA2 I;  5DM6 3;  1YI2 A;  2WP8 J;  3J80 L;  3K7A H;  3C46 A;  4GKK Q;  1E3P A;  3BDC A;  3L3O C;  3F2C A;  1VQN A;  1FNW A;  4DR4 L;  1XPU A;  1PZJ D;  1QVC A;  3CPF A;  5C44 B;  4R1J A;  5BR8 Q;  1PH4 A;  4CHT B;  2F0M A;  5G3L D;  2MO0 A;  1HA6 A;  1K8O A;  2Z6K C;  1U9R A;  4YCU A;  4A3G G;  1N33 Q;  3HOU H;  1RCV D;  1SNC A;  3I73 A;  5D65 A;  1ESR A;  2WIN B;  1CFM A;  3AU7 A;  4DV5 L;  4JI6 L;  4F8M A;  2BH2 A;  4C3H B;  3S1R B;  4Q5V A;  2HIV A;  2MUY A;  4QJF A;  3J80 i;  3TME A;  1LT4 D;  1PVO A;  3DXJ C;  3HEJ A;  2F0S A;  1B9N A;  4FVM A;  2Z8L A;  2F0G A;  4CJ0 B;  4R4I A;  4GLX A;  3W1B A;  1U5K A;  1KAA A;  1BCP C;  1TS5 A;  2XGT A;  3MC0 B;  1KC8 C;  2I5L X;  1NMG A;  2EY5 A;  3G71 A;  2RHS B;  3S24 A;  4A4I A;  2IHE A;  4XQQ A;  1WD1 A;  1SFO B;  4IJH A;  5FLM G;  2NTS A;  3E9H A;  4DAY A;  5IT9 L;  1KXL A;  2DY7 A;  5J3B A;  1EY8 A;  3KLS A;  4R8I A;  1IBM L;  2PCF B;  3HOW H;  4LFB L; 
#chains in the Genus database with same CATH homology
 1TY2 A;  1QG7 A;  1IYU A;  1R9T B;  2F0V A;  1TVX A;  5DEH A;  1ICW A;  2AWO A;  2WB1 B;  5JPN C;  2NBF A;  1II3 A;  4IFD G;  4ZAI A;  3S1M B;  4OGQ C;  4G7H C;  5FLX L;  2PW5 A;  4EQN A;  1DZ1 A;  2N55 A;  1E2W A;  2RKS A;  3DWP A;  1A6X A;  3M85 A;  1S5D D;  1HA5 A;  1B2T A;  1CZG A;  4A3F B;  1ML0 D;  1ROD A;  5J39 A;  2Z4H A;  1EWC A;  4IN3 A;  2L9H A;  1BNZ A;  1S5F D;  4FP5 D;  2IX3 A;  4HCE A;  1D2B A;  3HP3 A;  1BXT A;  3R2I A;  2FJ2 A;  5EPJ A;  3ND9 A;  4A3I B;  4CKB A;  2D5D A;  1SE2 A;  3FKI B;  2BE5 D;  3MTS A;  4ULL A;  1SE3 A;  3MXG A;  1XXG A;  4FXD A;  1FNU A;  1LTA D;  3EVQ A;  2B2V A;  2PNR C;  1AN8 A;  2DN8 A;  1L0X B;  2RDG A;  1PFB A;  3T16 A;  1G2T A;  4C3J B;  4IUV A;  3DMU A;  1AZQ A;  1OXU A;  1O7L A;  1DOM A;  3L9A X;  1EYC A;  2EJF C;  1ENA A;  3LX0 A;  3K6O A;  1SYF A;  5IGG A;  2KCC A;  1GUN A;  5C3E B;  2A5H A;  2SNS A;  1FYC A;  5K36 H;  3NPP A;  5C5L A;  3S16 B;  1LO5 D;  3V05 A;  3S1Q B;  2PZU A;  5C3W A;  4IUR A;  2EZV A;  1SND A;  3GQB A;  4XIG S;  3GP7 A;  5C0X I;  1Y1V B;  1PRT C;  2EXZ A;  3DM1 A;  1UUP A;  3MVV A;  2WKC A;  3A7A B;  1ONL A;  2AUK A;  2NZ1 D;  4ODG A;  4M8A A;  3VYS A;  1W6J A;  1HTL D;  4HED A;  4C3I G;  3OSO A;  1LTS D;  4KKU A;  1JOR A;  1WTO A;  4L6T B;  1M8A A;  1EY6 A;  2XNA C;  2B2U C;  1CQF A;  5CR3 A;  3WDN A;  1S5C D;  2K5Q A;  3KF8 A;  5M5Y B;  1TS4 A;  3PO3 B;  5C4Z A;  2FHT A;  4UDU C;  5ELD A;  4ZRZ A;  1TWG B;  3SXH A;  2RDF A;  1SMY C;  2BDN A;  1F2L A;  2X6L A;  1TT2 A;  4OO1 I;  3WOF A;  2YU9 B;  4ZKB B;  3FMC A;  1WCM B;  2PZW A;  5C0X J;  5M3F B;  2A6E D;  2B8F A;  4F87 A;  3D4R A;  4DXF A;  3FDT A;  3IL8 A;  4C3J G;  5KEE A;  1I50 B;  2EY2 A;  2NVT B;  4B08 A;  1JOQ A;  3OOC A;  1TR5 A;  2LKV A;  4HAE A;  2M9V A;  2XIW A;  2O5J C;  3CRK C;  5BN5 A;  3J7A F;  2G9D A;  3J80 E;  1ESF A;  4RGM A;  3X3N A;  3E5S A;  1WTX A;  2F0I A;  3BDL A;  3F2U A;  1DYQ A;  1Y1W B;  4K2K A;  3PMF A;  2HDM A;  2ENB A;  1QNU A;  1GJX A;  1FGB D;  1U4L A;  1GUS A;  1SNM A;  1Y8N B;  1AZP A;  4G4K A;  3K5N A;  1RHP A;  2O4X A;  3D4D A;  1JR0 D;  3N52 A;  3D31 A;  1GHK A;  3TDQ A;  4OIJ A;  4G7Z C;  5ELE A;  3ND8 A;  1B4O A;  1QJO A;  3HZX A;  3QB3 A;  3ERQ A;  2JP1 A;  2NN6 H;  5KND A;  4RAU C;  3CRL C;  3DHQ A;  5F2D A;  1IW7 D;  4EVO A;  3GV6 A;  1QB5 D;  5FK9 C;  3MWY W;  1PDQ A;  4GZY C;  1JIC A;  3S2H B;  2Z1C A;  1Q3L A;  2ZXR A;  5FLX E;  2K33 A;  5JEA H;  2Q8T A;  2F0L A;  1KNE A;  2RSO A;  1NSN S;  4K2L A;  3R2T A;  1EZ8 A;  4TRD A;  5JPM C;  1O7Z A;  1JOO A;  2PMZ B;  1U4R A;  1YNJ C;  5IGD A;  5M3M B;  3NK9 A;  2ICE C;  2E2H B;  5COR A;  2A6H C;  5IGC A;  3HGB A;  1X3P A;  5ELB A;  4U67 3;  3RUZ A;  3H09 A;  1PRT D;  4QIW B;  1I4H A;  5LL6 X;  4A3K B;  4RGO S;  2NVQ B;  1ZXT A;  1H9J A;  5IGF A;  1G6Z A;  2HDL A;  2QIL A;  1LTR D;  3TP6 A;  2M2L A;  5A35 A;  1PZI D;  3NBI A;  3H94 A;  1B1Z A;  4A93 B;  4M1U B;  2C5C A;  4DAV A;  2EY6 A;  4WFN 3;  2NVX B;  2B2W C;  1V8Q A;  2K05 A;  2D62 A;  3QO2 A;  4QUF A;  2PYK A;  1EY9 A;  4RWS C;  4BS9 A;  1XX8 A;  1QOH A;  3K57 A;  2J4X A;  1PTO B;  2F0D A;  2E2J B;  3ONA B;  1I6H B;  1Q12 A;  1ENF A;  2KOL A;  1ET6 A;  1SYG A;  4KKS A;  3SVM A;  1TS2 A;  5IIF A;  3D8G A;  1EZ6 A;  5JJZ A;  3GTQ B;  4HCS A;  5EPL A;  2QKI C;  2EYF A;  1I3Q B;  1EY0 A;  3CU7 A;  4C2M B;  2F3W A;  3S14 B;  1U4M A;  2WAC A;  5K5P A;  1S5E D;  4YIJ A;  1LTG D;  3QWN A;  5KNB A;  1TY0 A;  1AEX A;  1RD9 D;  4RH6 A;  2R7Z B;  1RKN A;  4K5W A;  1V1P B;  4L8J A;  5JOB A;  3K7A B;  4Z9C B;  4FF4 A;  1PTO F;  2IL8 A;  5TSS A;  3S9W A;  3D6W A;  3IAY A;  3RMH A;  2B2V C;  2K1B A;  1Y69 U;  3I91 A;  2X69 A;  1H9M A;  1PMR A;  1QWY A;  1B50 A;  5A2Q L;  1BO0 A;  1OO9 B;  4FF1 A;  3FRP B;  3TBI B;  1CHQ D;  3P75 A;  2FFK B;  1SBB B;  1DOL A;  4ABN A;  2E2D C;  4E6I A;  4ILW A;  1PYW D;  4QB4 A;  2O2L D;  2ZXP A;  4XXE A;  5E1F A;  3HOW B;  5KYI A;  4J8Q A;  3OWE B;  4ZKC B;  5LHY 1;  1D5X C;  4XDX A;  4KTA A;  2LMC B;  4UAI A;  4PMW A;  4XT1 B;  4KJO A;  1BBX C;  4A3M B;  3BS1 A;  3MXP A;  3QJY A;  4XQJ A;  1EY5 A;  1TWA B;  1LTB D;  3D3R A;  3DEP A;  4KD4 A;  2YYZ A;  4KD3 A;  4IFD H;  3GTG B;  3CQZ B;  2A6H D;  2RBM A;  3G6J B;  2B2W A;  3H0G B;  3A7L A;  1NUC A;  3MHB A;  1AP0 A;  2TSS A;  3S1N B;  5JEA J;  1ZYR D;  3I4M B;  3NQT A;  2M00 A;  5CYU A;  1F9R A;  1GXD C;  3M3Y B;  1HHV A;  2JA6 B;  4HN7 A;  4RKB A;  2A68 D;  1WVL A;  1LT6 D;  3AB9 A;  4R9W A;  1TQO A;  1KDA A;  4ZK9 B;  1STG A;  3I4L A;  3RD4 A;  4RCN A;  2A69 C;  1HFG A;  5C0X G;  2SNM A;  4ME5 A;  3NP8 A;  2NUC A;  1STH A;  2QF7 A;  1O80 A;  3TSS A;  5I2Y A;  3BYT B;  3M4O B;  1X3Q A;  1OXS C;  3OMC A;  1D5Z C;  1Q8I A;  2DNC A;  3PUY A;  4FF2 A;  1EFI D;  5HGT A;  1WTW A;  3TP5 A;  2L11 A;  1C8C A;  1A2T A;  2IX1 A;  1HUN A;  4XTC S;  3R3O A;  3KLS X;  2WKD A;  5EKL A;  5FKA C;  4JK1 C;  3ITP A;  5CV6 A;  3VA5 A;  3OW7 A;  2JEA I;  3GV3 A;  2R61 A;  1SYE A;  5G3L F;  1QE6 A;  2Y0S B;  4B9W A;  2AUJ D;  3TZD A;  5CBA E;  2D9U A;  1TU2 B;  2DY8 A;  1SYD A;  1A3U A;  3P20 A;  1TS3 A;  5IGB A;  1W6K A;  1IKM A;  4V19 0;  1EEF D;  4HSP A;  4OO1 G;  4N9T A;  2RDH A;  1F2Z A;  1X32 A;  3NTI A;  4C3H G;  3SHL A;  4LJZ C;  3P7J A;  1DOK A;  2QEJ C;  5CV7 A;  1F9S A;  4CKC A;  4H0L C;  1VMP A;  4KY6 A;  3K5L A;  3X3M A;  4H7B A;  2ZXO A;  2CW0 D;  1MGS A;  1DXM A;  2BDO A;  3H3V C;  3E6Z X;  3OIQ A;  3H6M A;  2AQ1 B;  5M5X B;  3FVQ A;  1F9Q A;  4Y7N B;  4DK0 A;  2EDG A;  3BZD B;  3DUZ A;  1BDO A;  2F0N A;  2J7Z A;  2AQ3 B;  3HOZ B;  3I90 A;  3DEO A;  2Z4I A;  2GA4 B;  4ZQ3 A;  4DA2 A;  1RDP D;  4CBV A;  2XRQ D;  1KDB A;  1CA5 A;  5I2X A;  4H44 C;  5C6A A;  2R93 B;  3HKZ B;  5AFW A;  1EU4 A;  2F0P A;  1H9K A;  3PUV A;  3S2D B;  5A2Q E;  5I4D A;  5DM7 3;  1HTP A;  4AYB B;  1UEA B;  1XWE A;  1A3V A;  4MN3 A;  1BCP D;  4RHS A;  3BYY B;  1C4Q A;  4KV6 A;  3OPO A;  3SK8 A;  3NE5 B;  5JVG 3;  2E75 C;  1CZW A;  4N9P A;  2G9H D;  3HOY B;  2B39 A;  4PQX A;  3ERO A;  4ZLT F;  4IQZ A;  5EKI A;  3SK4 A;  4TSS A;  1KDC A;  4A3E B;  1YNN C;  1HUM A;  3BDO A;  5KYL A;  5I9O A;  3MAQ A;  1CI3 M;  3I70 A;  5EGT A;  3S15 B;  1R4Q B;  3KK7 A;  1JCK B;  5E4X A;  4RGN A;  4DXG A;  5EQ0 A;  1VCI A;  2EYO A;  2F0U A;  4O1N A;  5CV4 A;  4ZUI A;  3UI2 A;  1MBY A;  1TII D;  2MGS A;  1RTO A;  5C4H A;  4RFB A;  1LAC A;  3NWT A;  1STE A;  4ZYS A;  5BN3 A;  2F0F A;  4QMG A;  4EQP A;  3NTH A;  2J0T D;  5IOD A;  1NR2 A;  2E2I B;  3JAM L;  4KK7 A;  4RKL A;  2SDF A;  2HCI A;  3NTK A;  1VDZ A;  3LNN A;  4LMQ D;  2JEB I;  2F0W A;  4K14 A;  1B9M A;  2EYJ A;  1EY4 A;  4OHJ A;  1LT5 D;  1STN A;  3R93 A;  2IJ0 A;  4K5X A;  4KN4 C;  5D14 A;  1H9S B;  4PV1 C;  2B8G A;  1EWH A;  4IUT A;  3VR2 A;  2VB2 X;  1EEI D;  2JA8 B;  1HRJ A;  2NVY B;  2K7V A;  1HQM C;  1UAP A;  2B2Y A;  2KEC A;  1EU3 A;  5ISR A;  2AWN A;  2F0T A;  2K5W A;  3LWU A;  1IYV A;  1SDF A;  5I9P A;  5D3D A;  4WJW A;  3SK6 A;  2F1M A;  5CMD A;  3VA7 A;  1TWF B;  2VB3 X;  4G7O C;  2FIN B;  4G57 A;  3BG3 A;  1OXV A;  5EPK A;  3QOL A;  3E0J A;  1BF4 A;  4NP5 A;  1EIG A;  3EJI A;  4HMJ A;  3A55 A;  1KLG D;  3NUC A;  4FXK C;  4KMU C;  3V96 A;  2BCO A;  2EJM A;  1V1P A;  3Q22 A;  3FPP A;  4QUC A;  1PRT B;  1E0B A;  4LAA A;  3MFG A;  2B63 B;  3K58 A;  4KHV A;  5LL6 S;  1SMY D;  4QF4 A;  4IAL A;  3C1F A;  2XSC A;  4XT3 B;  1F9P A;  2K32 A;  4R8N A;  1EYD A;  1D5M C;  3OHX C;  3GTK B;  1SXT A;  1T5E A;  1TKW B;  5DNF A;  2CQA A;  1TWC B;  2K6A A;  3A8K E;  3TZU A;  1DCZ A;  4A3G B;  3BVZ A;  5FOB B;  5C4J B;  1STB A;  2AQ2 B;  2R3Z A;  1LAB A;  5BN4 A;  2MHV A;  3NXW A;  3VYT A;  3NSW A;  5CV8 A;  1YNN D;  3CHB D;  4KY7 A;  1WTQ A;  5ELF A;  5CBE E;  2E74 C;  4CJ1 B;  1PRT F;  4X3U A;  1IHZ A;  1S5B D;  2L1B A;  5I6W A;  2NN6 I;  3A8I E;  4XQN A;  1I4Q A;  2R6G A;  4J6H A;  1GUW A;  5FO8 B;  1ZEQ X;  3J81 E;  5C5M A;  4MIU A;  1Y8O B;  4RA8 A;  1CA6 A;  4LK1 C;  3HOU B;  2PZT A;  1Z47 A;  2KCN A;  4X3S A;  3HG9 A;  3K59 A;  2EE1 A;  1WD0 A;  3W2D A;  1GHJ A;  2SEB D;  3ZYY X;  1SJH D;  4PNY A;  1RF2 D;  5CV9 A;  4CKE A;  3GTL B;  3VR4 A;  4CJ2 C;  1D6E C;  5JAV A;  3NQI A;  2PO4 A;  1SAP A;  1MI2 A;  1IKL A;  4BA1 I;  4DN4 M;  1Q90 A;  3NBH A;  2L12 A;  1J9O A;  5CV5 A;  1DON A;  2F0E A;  3M4Y A;  4K6L A;  1WTP A;  1SYC A;  3PUZ A;  1SE4 A;  1QNK A;  2CVR A;  1QIL A;  1CHP D;  1HFN A;  4HR7 B;  5COY A;  1CTM A;  5T1I A;  2JXM B;  2L4N A;  2NTT A;  4MHE A;  4A3D B;  4FYD A;  4EQO A;  1YNJ D;  1V1O A;  3U9S A;  5C0X H;  1Q1E A;  3URY A;  2JSO A;  3V2T A;  4X3K A;  5C3X A;  1D1K A;  3DWQ A;  2FMM A;  5C4X B;  3JAM E;  2XRS D;  3RZO B;  4FXG C;  2K01 A;  2EY1 A;  1F77 A;  4L63 B;  5EBC A;  1HCZ A;  2QCP X;  3HOV B;  3D4W A;  3DWA A;  1Q1B A;  3MFY A;  1LLR D;  5IOC A;  2A6E C;  4K8J A;  2PW7 A;  4DGZ A;  3C2P A;  2R92 B;  3S17 B;  3HS0 C;  1DJR D;  1ILP A;  4DFA A;  4KN7 C;  4U68 A;  3C1E A;  1FNV A;  1PFN A;  2V4D A;  3I3C A;  4NMZ A;  2H4O A;  1CQV A;  1B3A A;  3OMG A;  5HUR A;  5M5W B;  2KHS A;  2KJX A;  3IFD A;  4XYQ A;  4C3I B;  2VXW A;  1LT3 D;  3AMU A;  4OO1 H;  3SR1 A;  1JC7 A;  2E76 C;  4ZUJ A;  5EJW A;  4DNT B;  2F4I A;  2PPB C;  1JWS D;  1L0Y B;  1IL8 A;  2IX0 A;  2XN9 C;  3VYR A;  1ET9 A;  3KLR A;  3KBG A;  2EYP A;  4B9X A;  3BVG A;  1O78 A;  2L0C A;  3PIO 3;  2MJ8 A;  1NR4 A;  2EOT A;  3J7Y W;  3P1H A;  3MXN A;  3OIP A;  2WII B;  2KQ3 A;  3N6R A;  2K03 A;  4C56 C;  5J22 A;  1TWH B;  4IUN A;  1IW7 C;  4BBS B;  2OXP A;  4OIK A;  3TP7 A;  2LFN A;  3RZD B;  4IUQ A;  2BOS A;  4RHR A;  2H1E A;  2MP1 A;  2TMP A;  4C1N I;  1G91 A;  3GD7 A;  5I6Y A;  1STA A;  2HQE A;  1F2Y A;  3FEW X;  1E2V A;  1PFM A;  4NW2 A;  4HTH A;  3GTP B;  1CT1 D;  3U9O A;  5CC4 A;  1S4Z A;  1M4V A;  5M9O A;  1HXY D;  3I4N B;  1PXU A;  5EKK A;  2K28 A;  3GTO B;  2K5D A;  3NWS A;  4IFD I;  2IWH A;  4TKO B;  1BUV T;  2ICI A;  3HRZ C;  1SNQ A;  2BA1 A;  2B2Y C;  2F3V A;  1PTO C;  3BVM A;  1G8Z D;  1RTN A;  3NHH A;  3K0Y A;  2IPK D;  2EYL A;  2IT1 A;  5K36 G;  1SYB A;  4JBW A;  1JOK A;  3W3A A;  1GUO A;  2N88 A;  1EQV A;  1J8I A;  3PUX A;  4IUP A;  3A8J E;  1I4X A;  1VF5 C;  4IUU A;  1CM9 A;  5KIX A;  2KUM A;  4RCO A;  1SEB D;  2SOB A;  3J81 L;  1ZKO A;  1A15 A;  2BA0 A;  3TN2 A;  2CHB D;  1BOS A;  3LWE A;  1O7Y A;  5CGK A;  4BWG B;  3VR3 A;  2MPM A;  2QDB A;  4KY5 A;  2LS0 1;  3I8Z A;  2F0J A;  3L7Z C;  3Q24 A;  3SE0 A;  2OEO A;  4HSV A;  3J7A V;  5KNC A;  3MA2 B;  1F2M A;  3H91 A;  4IFD J;  1NAP A;  1DM0 B;  1FD7 D;  2EPB A;  2B2T C;  3EA6 A;  2A69 D;  3SEB A;  2NB0 A;  3EQL C;  2Q8R E;  1H9S A;  1JWU D;  1MD2 D;  1XTC D;  1SNO A;  2D2C C;  4DF7 A;  4C1N K;  1PLF A;  4QCL A;  1BCP B;  4WRD A;  1VMC A;  5KRU A;  1K83 B;  3KUP A;  2RVL A;  4NKL A;  2FMC A;  1A3T A;  1AW7 A;  4A3J B;  2A74 C;  2X6G A;  1KLU D;  4BBR B;  1G29 1;  2XWB B;  4P2C B;  2F0K A;  1G2S A;  1EY7 A;  2F0O A;  3PIP 3;  4OL7 A;  2F0H A;  4KJN A;  4BY1 B;  1RJT A;  2PQE A;  1T5X D;  1QCB D;  4I65 A;  3T51 B;  1E2Z A;  4CGY B;  1KNA A;  1MSG A;  4S3S A;  1UNS A;  1STY A;  3QOJ A;  5IT9 E;  2OF1 A;  1SNP A;  2EVB A;  2Q8I B;  1SJE D;  3SDZ A;  3RLF A;  1PZK D;  1GOZ A;  3PV0 A;  3PO2 B;  1BCP F;  4X3T A;  2JE6 I;  2C9O A;  1BR9 A;  1JE4 A;  1LTI D;  4DK1 A;  1WTV A;  4V0B A;  4FF3 A;  1EL0 A;  3VR5 A;  4PMB A;  3KBX A;  3QG1 A;  3CKI B;  4FO2 A;  3MEH A;  4F7X A;  1WTR A;  5KGU A;  1LTT D;  3VYU A;  2F03 A;  1ENC A;  4WOR A;  1EQT A;  3T56 B;  5EBD A;  1LV9 A;  3A56 A;  1H9R A;  3K5M A;  5ELC A;  3T53 B;  1JQY D;  1I4P A;  3IKJ A;  4K8I A;  2RA4 A;  5NUC A;  2NN6 G;  2LY7 A;  3OWF A;  1C48 A;  2WAQ B;  2ZT9 C;  2EYH A;  2RQX A;  1OXT A;  2B2U A;  2A73 B;  2JA5 B;  5JVH 3;  1CK1 A;  1DD2 A;  5J1Z A;  3FPU B;  2NYZ D;  1ZYR C;  2JA7 B;  4DAP A;  5E4W C;  1PTO D;  4A3B B;  2XWJ B;  5JEA G;  2A68 C;  2HUG A;  3MXU A;  3GTM B;  2VNU D;  2NWG A;  1U4P A;  3MZ5 A;  1K8M A;  2WV6 D;  3IFT A;  2OT2 A;  4DNR B;  3A54 A;  4TQU S;  4XYO A;  2KVM A;  1EOT A;  5DAU A;  1GUT A;  2B2T A;  3WOE A;  1HQR D;  4IZ8 A;  3R8B A;  4I7Z C;  1AFP A;  3I72 A;  4O42 A;  1SSO A;  1JWM D;  4NDX A;  1V43 A;  1GUG A;  1I4G A;  5D3I B;  2I46 A;  1JB3 A;  3QIA A;  3GO5 A;  2L5T A;  1OXX K;  1VF7 A;  2KA7 A;  2DNE A;  1B44 D;  1XYI A;  2VUM B;  1BQQ T;  2XVS A;  2K04 A;  4F88 A;  2BE5 C;  1I4R A;  4J1M A;  1Z6H A;  3HOX B;  1KAB A;  3T4A C;  4KI0 A;  1NCV A;  2KEE A;  2L55 A;  1KTK A;  4K6D A;  4ID6 A;  4EGV A;  4KKT A;  2I07 B;  1EYA A;  2HCC A;  4H13 C;  2EYM A;  5E3F A;  5T1G A;  3PUW A;  1A2U A;  5IGE A;  4BY7 B;  4PMC A;  3Q6S A;  2RSN A;  3K5O A;  3C3L A;  1HPC A;  1Z7T A;  1PTO H;  3TP8 A;  3GTJ B;  4HMI A;  5FO9 B;  2ID0 A;  2IW3 A;  3Q0A A;  3Q23 A;  1B53 A;  1FR3 A;  2EJG C;  3EFX D;  3G7L A;  2KED A;  3T13 A;  1ILQ A;  2CW0 C;  4RGT A;  1Y8P B;  3M7G A;  4DU9 A;  4FNF A;  1D1I A;  2F0Q A;  4KHZ A;  3M7N A;  1EIH A;  3SK5 A;  2JYO A;  3D6C A;  1I6V C;  1MSH A;  3O13 A;  3VR6 A;  5FO7 B;  1R4P B;  4K5V A;  4Q0F A;  2O5I C;  4BA2 I;  5DM6 3;  2WP8 J;  3J80 L;  3C46 A;  3BDC A;  3L3O C;  1FNW A;  1PZJ D;  5C44 B;  4CHT B;  2F0M A;  5G3L D;  1HA6 A;  1K8O A;  1U9R A;  1RCV D;  1SNC A;  3I73 A;  5D65 A;  1ESR A;  2WIN B;  1CFM A;  3AU7 A;  4F8M A;  4C3H B;  3S1R B;  4Q5V A;  2MUY A;  3TME A;  1LT4 D;  3DXJ C;  3HEJ A;  2F0S A;  1B9N A;  4FVM A;  2Z8L A;  2F0G A;  4CJ0 B;  1KAA A;  1BCP C;  1TS5 A;  3MC0 B;  2EY5 A;  4XQQ A;  1WD1 A;  1SFO B;  2NTS A;  4DAY A;  5IT9 L;  2DY7 A;  1EY8 A;  3KLS A;  4R8I A;  2PCF B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...