3K81C

Structure of the central interaction protein from the trypanosoma brucei editosome in complex with single domain antibodies
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
113
structure length
105
Chain Sequence
KSVNSVTLVGVVHDIQSGFVYEDAVTQFTLTTTSIVVVEKDHHTIRCFGELFSAEVKQKVKEGNVVCVNGRLRLSPQLEPSCNKHFYFPYIQVQPPHGQVAVIHG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system, rna binding protein
molecule keywords MP18 RNA editing complex protein
publication title Structures of a key interaction protein from the Trypanosoma brucei editosome in complex with single domain antibodies.
pubmed doi rcsb
source organism Trypanosoma brucei
total genus 17
structure length 105
sequence length 113
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00436 SSB Single-strand binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3k81C00
2WB1E 4IJHA 1XJVA 1A0IA 4IOCA 5IE8A 3AQQA 2ZJPA 3OTOQ 1K73C 3EN2A 2PQAA 1X55A 4A3CH 3L2PA 1N36L 1PFSA 3U4VA 1YITA 2WFWA 3PIPA 4LFBL 3PO3G 1HJPA 4GNXC 1C7YA 1EFWA 4ALPA 1EYGA 2VL6A 4QJFA 1LYLA 3D31A 1HR0Q 1TWGH 1Y1VG 4DV0L 2EQSA 4EQ5A 4QGUA 2JEAI 3NEMA 4LUZA 4OWTB 2C35B 2CKZB 1YNXA 1VQ6A 2UXCL 2ASBA 4R4QA 1YIJA 4JYAL 3PO3H 2IX1A 1JJGA 4A3KG 3CC7A 2R92G 4LW1A 2IHFA 4DV1Q 2B3GA 4MNOA 1WOCA 3L0OA 4A3BH 3KF8B 4DNIA 1C0AA 2CFMA 3UE0A 4B3SQ 2JA7G 3PIOA 1PYSB 1XNQQ 1SLJA 1X54A 3CCVA 3I4OA 3K81C 3CCMA 2R92H 2HQLA 5M5XH 3RN2A 5EAYA 4LFAQ 2WAQG 1XMQQ 1AH9A 3UDGA 2Z6KA 4L5TA 1Q86C 2JA7H 4X66L 5LMUL 4LFCL 1IBMQ 4JBMA 4DV4Q 3CCUA 2RF4A 1IBLQ 4B3TL 1FJGL 5M3MG 1VQ9A 1YJNA 4NPSA 4R4CA 1X3EA 4GN4B 5GQOA 2WAQE 3F8TA 1PYBA 1L0WA 4KHPL 4K0KL 3ERSX 5C0XG 2BH8A 2AWNA 1SN8A 5IP9G 5IP7G 3CCRA 5HGQA 5M3MH 2YTXA 2N3SA 3MEFA 5IYCG 4A3JG 4DUYL 3HOVG 4P74A 4R4OA 3H3VH 2AHOB 2ES2A 5LMNQ 3BZCA 3STBD 2K5NA 4TVAB 5IT9c 3CCJA 3HOZH 4LUVA 5IYDH 2NZOA 4J15A 4DUZL 5IP7H 4DV1L 1A63A 4A3IG 1YJWA 1Y14B 5IYCH 4A3JH 1PH3A 1K8AC 4B3SL 4GNXA 4GLAC 5J3BA 3S14H 2HHHQ 3HOUG 1SFOH 4DR4Q 4AQYQ 2OQKA 4FDBA 4B3RL 3A0JA 2EXDA 4POFA 4DR2L 1HNZL 4GOPC 1IZ6A 4A3FG 2E2HH 3S1MH 4QIWE 4DV2L 3HFZB 4A3IH 4LF8Q 4BBSH 4B3ML 3JAMc 3AEVA 5C44H 1LM0A 3J81i 4L5SA 2PI2A 2ATWA 3HOUH 4WJ4A 1N8RC 1IBLL 4OO1I 3J80c 1UE5A 5JEAG 4JBJA 3T1HL 4A3FH 4LF5L 3M7NA 1PH2A 4NB3A 3S2HH 4JI7Q 2UXDL 1V43A 2PMZE 4DR1L 2UUAQ 2KCMA 1IL2A 5DLQE 3CD6A 3I4MG 5H1SE 1YHBA 2AMCB 4JI1Q 1H95A 4HJ7A 1CKNA 1BBUA 2ZTDA 2VS1A 3CMEA 3H15A 1WFQA 1JMCA 3ULJA 4PZ8A 3CCQA 1KQSA 2JJQA 2XTIA 4C2MH 3K7AH 3I4MH 3A5ZB 3GTGH 1TWFH 4JBKA 3GTJH 1I50H 3I2ZA 1WYDA 2NZHA 2K75A 1TXYA 4A3DG 1N34L 1JJCB 1BKBA 3JC66 1YHQA 1AE3A 1CUKA 1HH2P 3I7FA 4LF9Q 1YHAA 4NXMQ 2OQ0A 1N33Q 1GVPA 5JJIA 3ZJYC 1QZHA 5BR8L 1X56A 4KI0A 3ULLA 1XPUA 2KENA 4BBRG 1NTGA 5C3EH 1VQPA 1KD1C 4OONA 4YWLA 5FJ8H 4Y7NH 1QUQA 4BBRH 1D8LA 1Z9FA 4YHHL 3KJOA 3GTLH 4O0AA 4YCVA 3CW2C 2VQEQ 5C4XG 2KHIA 4DK3C 3DLLA 1GM5A 2UUAL 4DR5Q 1RIPA 4DK6C 1MJEA 1RL2A 3BZKA 1XTDA 3JAMi 1U5KA 4DAYB 4LWCA 1XNRL 1VQ5A 3NELA 3TEHB 3VDYA 1VQMA 2UXBQ 4Y52H 1HZAA 2K5VA 4BA1I 3I55A 1IYJB 4BY1H 3KDFA 2D62A 1M1KC 4JV5Q 1UWVA 3S24A 1TWAH 5LMNW 4IJLA 3KLWA 3G6EA 2VUMG 1U0LA 4RG1A 4KLKA 1B70B 1KC8C 3CPWA 1X65A 2UU9L 1N32L 4BXXG 2GVAA 2I0QA 2CWAA 3G48A 1N33L 1KL9A 5IWAQ 4X64L 2VUMH 1B7YB 3DM3A 1OXXK 4XTCS 4DR3Q 4O2DA 4AIMA 1L2FA 2ALYB 1JJ2A 1VQLA 5HY6A 1SROA 4MZ9A 3KF6B 3M85A 1Q12A 2GVBA 1EUJA 4P73A 2QEXA 4QL5A 4UY8C 4JI4L 2WP8J 4AYBG 2F4VQ 4GKJL 1Y1VH 1KXLA 4AH6A 3L7ZC 4ME3A 3IRBA 4GLVB 4DV6Q 1I6HH 5GAEC 4BY7G 2OTJA 2VZAA 4X65Q 2AWOA 2VQFQ 3U50C 3CXCA 3CQZH 4A3KH 4PG3A 4JI5L 3SGIA 4DR7L 3CAMA 4AYBE 5M5WH 1VS0A 1YEZA 4BY7H 3CP0A 3PO2G 3GTPH 1WI5A 4YWMA 3OTOL 2YU9H 1Z47A 1YJ9A 3PV0A 3RLFA 1VQ7A 3FHWA 1PH8A 1PH4A 2ZJQA 1FL0A 2EIFA 2KHJA 5IY0A 5M3FG 1T9HA 2RCNA 3STBC 2ZM6Q 1W2BA 2UUBQ 3CC2A 2LXKA 3E9HA 4LNQA 3H0GG 1Y1WG 3PO2H 2BA1A 1EQRA 3RR5A 1HR0L 1P16A 2R7DA 3S1NH 4YCWA 2KCTA 1E7ZA 3PF4A 3NBHB 1B8AA 5M3FH 4A93G 3KYHC 1E1TA 1I3QH 4JI8Q 3H3VI 2I5LX 1LTLA 1Y1WH 1MIUA 3AFPA 1JE5A 1UEBA 3K80C 4C3JH 2CCZA 2F4VL 1OXVA 2Q2HA 4DV5Q 3PUVA 5C0XI 5IP9H 2ZTEA 3S16H 3HOVH 1VQOA 2R7FA 1XNQL 4JBWA 4A93H 5GAGC 1L1OB 3T1YQ 3AFQA 1NE3A 2UUCQ 2ID0A 4POGA 1DGSA 5AJ3Q 1XMQL 4LFAL 3GO5A 4JI3Q 4DAMA 2GN5A 1XMOQ 1IBML 4IPCA 4DV4L 2Y0SG 4HJ8A 4HIDA 1XPOA 1CSPA 3RZDH 2YYZA 2UUBL 3UDFA 2K52A 1PA6A 1K3RA 1EIFA 5GAHC 2ZM6L 1IBKQ 1AE2A 4DV7Q 2D0OA 4LF4Q 1IXRA 4HIMA 5GROA 2Y0SE 2JA8G 3HOYG 2A19A 5C0XJ 3PF5A 2YTYA 1FGUA 1Q7YC 2JA5G 5LMNL 1VQDA 4IPDA 1OXTA 4DV3Q 4OX9Q 1VQEA 4IO9A 3A74A 4YY3Q 4TQUS 4JI0Q 3LGJA 2JA8H 3EIVA 5E7NA 1BBWA 1VQNA 3HOYH 2JA5H 2HHHL 2BA0A 3G4SA 5GADC 4OWXB 2OCEA 4DR4L 4AQYL 4BBSG 1GKHA 1K8GA 2PQAB 3F1ZA 1X9NA 4PZ7A 1LUZA 1E3PA 1YZ6A 4A3DH 4JI3L 1VQ4A 2IHEA 4A4IA 4JI6Q 4LF8L 4OXPA 3J7ZC 2FXQA 4L5QA 4YWKA 3TRZA 1CKMA 1C9OA 1W3SA 1HNXQ 5JJLA 1A8VA 4QQBX 4GKKQ 2D0PA 1HZ9A 1SR3A 4JI7L 4GN3B 4R4TA 1K83H 4EX5A 4DV7L 5JEAJ 5M5YH 3TREA 3CF5A 5ELNA 1E24A 4JI1L 4DPGA 4HJAA 4IFDI 4APVA 2VNUD 5K36G 1N36Q 5C4XH 1VQAA 4NXNQ 1Q82C 3J80i 1G6PA 2E2JH 4LFBQ 3M4PA 1QVGA 3WWVA 1PH6A 1TWCH 1R9TH 3PCOB 1PV4A 2NN6G 3A5UA 2N78A 4DV0Q 4LF9L 3GTQH 4DR6Q 4NXML 2UXCQ 3HOXG 1O7IA 4A3EG 3CC4A 4LF6Q 3FP9A 1KHIA 4PZ6A 4A3GG 1P8LA 2MO0A 3RLNA 4R1JA 1PH1A 1NBWA 2JK8A 3J81j 3I56A 3FKIG 4A76A 2Z0SA 3HOXH 4DR7Q 3RNUA 2N49A 4A3GH 4H02A 4A3CG 2OWOA 1EOVA 2VQEL 3CCSA 4BXXH 2HIVA 3GDEA 1FVIA 4PMWA 4DR5L 3FKIH 4IFDJ 2IY5B 1Q1EA 1QVFA 3M4OH 4X66Q 3HKZG 5LMUQ 4HJ5A 4LFCQ 1J5EQ 4DKAC 2R7ZG 3M3YH 4WJ3M 2XGTA 1YI2A 3S2DH 2R6GA 1TWHH 1E22A 4B3TQ 2H5XA 3W1BA 4NXNL 4GNXB 5FLXc 4L5RC 1FJGQ 4XIGS 2UXBL 4GLXA 2QA4A 2JEBI 2YTVA 4R4IA 3PUXA 2JA9A 4JV5L 2MFIA 2R7ZH 3U58A 4KHPQ 2A1AA 1ASZA 3B6YA 3UDXA 2VW9A 4K0KQ 1D7QA 3HKZE 2CWPA 4A3BG 4HIKA 4A3MG 4DR6L 1V1QA 4LF6L 4DUYQ 4JC0A 3M4QA 4P72A 3PSIA 4JCVE 2MNAA 2E2IH 4LF7Q 2Q2TA 2Q2UA 3J81c 1EIYB 3KFUA 5IWAL 4DUZQ 4A3MH 1VQGA 4C3HH 4DR3L 3HOWG 1PHJA 2NVXH 1A62A 3OW2A 2E8GA 3CCLA 1XPRA 1E1OA 4RMFA 2CQOA 3RLOA 1CKNB 4B3RQ 2F3IA 1HNZQ 2K5HA 4DR2Q 1PVOA 1NMGA 3H0GH 3S17H 4DV2Q 2A8VA 1HNWQ 3S15H 2F52A 3HOWH 1NMFA 4B3MQ 1N9WA 1UE6A 4DV6L 1J5EL 3E0EA 4JOIA 2DUDA 1I94Q 4C3IH 3BU2A 1UE7A 4MTNA 1M90C 2I5HA 4X65L 3PGZA 2VQFL 2L15A 3T1HQ 4LF5Q 1L1OC 5JJKA 1VQHA 2UXDQ 3CMAA 1VQBA 1YVCA 4JI2Q 4DR1Q 1KRSA 3ULPA 2NVQH 1SMXA 1KAWA 3HOZG 2NVYH 5IYDG 1OXSC 3HKSA 4BA2I 1VQJA 1MKHA 2LXJA 3KF6A 3PUYA 2R93G 2IX0A 3AYHB 4HJ9A 4KHZA 1G291 1S3OA 1WCMG 2BH2A 4LF7L 4JYAQ 1QUQB 1PH5A 3D0FA 3TQYA 3M9BA 2I5MX 1N34Q 2ZTCA 2R93H 1HZCA 5C44G 3GTKH 2RHQB 4GOPB 4OO1G 1WCMH 4UPAA 1VQFA 2PNHA 4JI8L 5BR8Q 3NENA 1PH9A 1HNWL 3K0XA 4DV5L 4YCUA 3TS0A 3RN5A 5FLMG 3GTOH 1I94L 3KDFB 1X3GA 1NY4A 2B29A 3T1YL 3UDIA 3S1QH 2YV5A 3BJUA 1ASYA 2IT1A 3MXNB 4YHHQ 3GD7A 1KRTA 2UUCL 1JT8A 5AJ3L 2PI2E 4X62Q 4JI2L 3I4NG 3PUWA 5FLMH 2QGQA 1JB7A 1S40A 1CSQA 3GTMH 1Q46A 4P71A 3J7A5 1XMOL 2E5LQ 4P75A 1OXUA 1K9MC 2V1CC 4OWWB 1VCIA 1XNRQ 1Q8KA 2HIXA 1S72A 2JA6G 1HR0W 3EBEA 1BVSA 1SRUA 3K7UC 4LUOA 1YBYA 5ELOA 3I4NH 2MQHA 3UE1A 1IBKL 1PH7A 2DGYA 3W1GA 3S1RH 4X6AH 1GD7A 2AKWB 1WJJA 4IPGA 3F2BA 5C3EG 2OTLA 4LF4L 1VQKA 1VQCA 1I5FA 1L1OA 3KJPA 1KIXA 4IPHA 3OYYA 2N8NA 2JA6H 4GS3A 1MJCA 5IYBG 5FJ8G 2B63G 2JE6I 1OTCA 3TS2A 4DV3L 1VQ8A 4GN5A 4OX9L 1K0RA 1Q1BA 1N32Q 2UU9Q 2KBNA 1J6QA 1SE8A 1X6OA 2LSSA 4UP7A 2K14A 2MO1A 4HIOA 4YY3L 2ZJRA 4JI0L 1QVCA 4X64Q 1Q81C 3K8AA 2VY3A 1GO3E 3U4ZA 3ICEA 5IYBH 2B63H 3F2CA 3Q8DA 3E9IA 4IFDG 2Z6KC 1HZBA 1X3FA 4IOAA 4A75A 4UP8A 3CCEA 3ER0A 2NVTH 3PUZA 4X62L 3W5OA 3F2DA 3CPFA 4JOIC 4QY7A 4BY1G 4JI4Q 4A3LG 1QZGA 4JI6L 4GKJQ 2WB1G 2NN6I 1EWIA 2E5LL 4GOPA 1G51A 2JQOA 2RHSB 1NJIC 4A3EH 2K50A 1EQQA 3KOJA 1HNXL 5C4JH 1V9PA 4GKKL 2K4KA 4A3LH 3G71A 4JG2A 4UP9A 4JI5Q 1UE1A 2HT1A 3RZOH 1CKOA 2Q2IA 1VQIA
chains in the Genus database with same CATH superfamily
4IJHA 1A0IA 1WTOA 3KUPA 3AQQA 4A3JB 4NDXA 3S14B 1B1ZA 1W6KA 1PDQA 2PQAA 1X55A 1RTOA 4QIWB 1YITA 4KK7A 1Q90A 1LT6D 4BBSB 1CZGA 4CJ2C 4QJFA 1EU4A 3D31A 4CBVA 1Y1VG 1KDBA 2UXCL 4LUZA 2C35B 1YNXA 1HUMA 2ASBA 2WKDA 1BCPD 4FVMA 2PMZB 4PNYA 2HUGA 2K33A 5T1GA 2R92G 1SYCA 3I72A 1WOCA 3KF8B 2HCCA 1V8QA 1YNNC 1ILPA 2K5QA 1BNZA 3CCMA 2A74C 5IIFA 1XMQQ 3C3LA 5ELFA 3UDGA 4L5TA 5KRUA 2A73B 3D4RA 2J0TD 1SDFA 1FJGL 5M3MG 4NPSA 4QMGA 5GQOA 2EY6A 1EYDA 2C9OA 1TY0A 3ERSX 5C0XG 1H9JA 5IP7G 2O2LD 2A6HC 3NWSA 4Y7NB 3MEFA 4R4OA 2AHOB 2IL8A 3GTLB 1B2TA 4JPBW 3HOZH 3DHQA 4J15A 4A3IG 1K8AC 5I6WA 4GNXA 2HHHQ 1KTKA 2RDFA 3HOUG 2ZXOA 4J6HA 4AQYQ 4B3RL 1HNZL 1BF4A 1LT5D 1NCVA 1V1PB 3E6ZX 4QIWE 1E2WA 1SYBA 2F0DA 1K8MA 3TP5A 1LT3D 4B3ML 1ICWA 1STEA 4K2KA 2Q8RE 1LM0A 4WJ4A 4L5SA 3UI2A 3BS1A 4OO1I 5TSSA 3T1HL 4A3FH 3M7NA 3D6WA 1EY5A 4JI7Q 3EVQA 1V43A 2F0LA 1SMYD 2PMZE 3ITPA 4JK1C 4DR1L 1UUPA 1ESFA 2UUAQ 3CD6A 3E3XA 1H95A 5JEAH 3VYTA 1BBUA 1CTMA 3CMEA 3V96A 3ULJA 4PZ8A 1KQSA 2XTIA 3A5ZB 3GTJH 2NZHA 4G7OC 4K6DA 1T5XD 4CDFC 1YHQA 4RHRA 2JP1A 4I65A 4NXMQ 2B2UA 2JN4A 3ZJYC 3J81L 3ND9A 2D9UA 1CI3M 5BR8L 5FK9C 4AYBB 1BO0A 1IW7C 4BBRG 5C3EH 1VQPA 5J39A 1KD1C 4TSSA 4BY7B 3OPOA 2PYKA 4DFAA 4YWLA 4RAUC 2RBMA 1D8LA 4YHHL 3KJOA 4YCVA 1STHA 1SNPA 2PZTA 2UUAL 1K8OA 1X3QA 3VYSA 1MJEA 3P20A 4I7ZC 2CW0D 1PZKD 2Z8LA 1IKLA 3VDYA 1YNJD 4KKSA 2B2TA 2QILA 4BA1I 3I55A 1IYJB 1T5EA 4DNRB 1QILA 3MEHA 1KABA 1TWAH 5LMNW 3HOVB 4DAVA 2VUMG 5EJWA 3MXNA 5JVG3 4KLKA 2EYHA 1CFMA 1N32L 2GVAA 2CWAA 3ONAB 3SEBA 3DM3A 1FNVA 1L2FA 3FRPB 3KF6B 3WDNA 3NTKA 2GVBA 4P73A 5KNCA 1HPCA 2L1BA 1Y1VH 1KXLA 3L7ZC 3R8BA 4GLVB 3D4DA 1KNAA 2OTJA 4X65Q 2VQFQ 3U50C 4DXGA 3CXCA 1S5CD 4M1UB 4MHEA 3SGIA 5I6YA 4AYBE 1YEZA 3KLSA 5F2DA 4YWMA 2RQXA 3K5MA 1I4QA 1LTBD 1Z47A 5CBEE 1VQ7A 3FHWA 1PH8A 3CKIB 5IY0A 1SYEA 5G3LD 1O7LA 1W2BA 4DAYA 1EYCA 4C3JG 1EQRA 3NTHA 2Z4HA 3PMFA 2R7DA 1E7ZA 2NWGA 5M3FH 3AU7A 1I3QH 4JI8Q 4G7HC 3H3VI 1Y1WH 1MIUA 1JE5A 1XX8A 3WOEA 1TS4A 5M5YB 1OXVA 3A7AB 3S16H 2Z9HA 1Y69U 1ICFB 4A93H 4JBWA 1VDZA 5GAGC 3T1YQ 5NUCA 1CQVA 5IGGA 2E2JB 3PIP3 5AJ3Q 1KDCA 3GO5A 1SMYC 1R9TB 1XMOQ 4NW2A 4DV4L 2B2TC 3GTQB 2HCIA 3SK8A 1BOSA 1JWUD 3UDFA 1AEXA 4IUTA 2KECA 4DV7Q 3IKJA 4LF4Q 3K5LA 2LKVA 3HOXB 1GUNA 1II3A 1BCPF 1VQEA 3DEPA 2V4DA 2X69A 3M4OB 2JA8H 5E7NA 3HOYH 2JA5H 2BA0A 5HURA 1D1IA 1W6JA 1VMCA 1K8GA 4WFN3 3L9AX 3F1ZA 1WTWA 2B2YA 4PZ7A 3VR5A 1YZ6A 4A4IA 3HKZB 4OXPA 1EY6A 3J7ZC 2CW0C 3IL8A 5KGUA 4GKKQ 1YNJC 3KBGA 1I6VC 5E4WC 4GN3B 1JWSD 1K83H 2E2IB 4DV7L 3QOJA 3IFTA 3TREA 5ELEA 3A55A 3MFGA 1LV9A 5D3IB 1V1PA 5K36G 1M4VA 4NXNQ 1Q82C 3J80i 4LFBQ 3M4PA 4M8AA 3S15B 3BVGA 3QG1A 1TWCH 4B9XA 4O1NA 4C3IB 4DR6Q 4IUVA 1EIGA 4FF2A 3CC4A 4LF6Q 2QKIC 4A3GG 1P8LA 3RLNA 4R1JA 2F0FA 1E2ZA 4C1NI 2NVQB 1EY9A 3AB9A 1MSHA 3Q24A 3RNUA 1EY4A 4H02A 3MXUA 4ZRZA 1ONLA 1MD2D 2VQEL 3QWNA 3GDEA 4PQXA 4PMWA 4IFDJ 3TSSA 1QVFA 1B9NA 4KHVA 1K0SA 1B53A 2RDHA 2R93B 5LMUQ 4HJ5A 3OOCA 1G91A 1GHKA 2WIIB 4H44C 1YI2A 3I90A 2R6GA 2J7ZA 3W1BA 4B3TQ 4NXNL 5FLXc 4XIGS 4GLXA 1I4PA 4KKTA 3PUXA 2JA9A 4JV5L 5CV5A 1D7QA 2VW9A 3HKZE 2VB2X 4A3BG 4DR6L 1Y8NB 4XT1B 4LF6L 4JC0A 3M4QA 4OL7A 2K6AA 4NKLA 4CJ0B 2K03A 3HRZC 4ZCKA 4LF7Q 1IHZA 1S5FD 4DR3L 1A62A 1GUOA 3CCLA 1HHVA 1LLRD 2BCOA 4IUNA 3H94A 2NTTA 2F3IA 1QWYA 1PVOA 4DR2Q 2XWBB 2A8VA 1HNWQ 3HOWH 2G9HD 1Z6HA 1I94Q 3MWYW 4CDEC 1M90C 2JA6B 1HQRD 2UXDQ 1HA6A 3WOFA 1YVCA 2J4XA 1NUCA 3ULPA 2VB3X 3KF6A 2LXJA 1I4GA 1PRTD 2B63B 4LK1C 2KCCA 4KHZA 1G291 1R4QB 1S3OA 4JYAQ 4LF7L 2SOBA 3DWAA 2ZTCA 1L0YB 1GOZA 4BS9A 5L37A 3X3NA 2IWHA 1SE2A 2RHQB 4UPAA 2NTSA 2PNHA 3NENA 2PW5A 3RZOB 2WB1B 4E6IA 3E5SA 1HNWL 2KUMA 4DV5L 1PLFA 3RN5A 1I94L 3PQIA 4H7BA 4OO1H 3S1QH 3BJUA 2EDGA 2UUCL 1TKWB 3GD7A 4X62Q 3I4NG 3PUWA 5FLMH 2QGQA 1JR0D 4P71A 5FLXL 3J7A5 1TWGB 2EPBA 3NQIA 1K9MC 2ICEC 1VCIA 1XNRQ 5EBCA 1Q8KA 2FJ2A 2HIXA 1S72A 3PO3B 2K28A 5CR3A 1UEAB 1GUGA 5G3LF 2DGYA 3S1RH 1HRJA 4X6AH 1WJJA 4IPGA 4TRDA 2OTLA 1SSOA 1KIXA 4IPHA 2N8NA 5ELCA 4DV3L 4GN5A 1K0RA 3OWFA 1KAAA 4FO2A 1N33Q 2K14A 4YY3L 2JA7B 3MHBA 4N9TA 3S9WA 5IYBH 1HZBA 1X3FA 3TN2A 5EPKA 4X62L 4JI4Q 2EY5A 2NZ1D 1CA5A 1SNCA 3K5OA 1S4ZA 2K50A 4XQQA 4FF1A 1WVLA 1LTTD 4A3LH 1BXTA 1WTPA 3SVMA 4UP9A 4JI5Q 2DJGC 2WB1E 3QO2A 1U9RA 4FXGC 1K73C 1QCBD 3L2PA 1N36L 1PFSA 2E2HB 1D2BA 2D2CC 1HJPA 1C7YA 3V05A 4ALPA 1EYGA 2FHTA 5C44B 4N8X1 4QUFA 4QGUA 2JEAI 4OWTB 4J1MA 5CV8A 2F0MA 3S2HB 3BVZA 2B39A 4L8JA 1H9SB 4A3BH 1A3TA 4QF4A 2CFMA 1PYSB 1XTCD 3V2TA 1SLJA 3I4OA 3I4MB 1TWFB 5M5XH 1I50B 3RN2A 4LFAQ 2WAQG 2Z6KA 2XNAC 1M8AA 1IBMQ 4JBMA 3P75A 1CQFA 1PRTC 2RF4A 5IGEA 3MC0B 2PZWA 5C5LA 5KIXA 4R4CA 3LWUA 5LL6S 3F8TA 1HA5A 1L0WA 4KHPL 1KDAA 4FF4A 4ZAIA 1SN8A 4RGNA 3I91A 5FLXE 5HGQA 2YTXA 4RH6A 3HOVG 4ID6A 4P74A 3H3VH 2OF1A 1AZPA 2ES2A 3BZCA 5IOCA 1LTRD 3CCJA 2OEOA 2ZXPA 4V0BA 1I4RA 5IYCH 3S14H 4RGMA 4A3JH 3TP6A 1DOLA 3HEJA 4HR7B 4OIJA 4DR4Q 4FDBA 2F0JA 4POFA 4A3FG 3HFZB 4B9WA 5T1IA 4LF8Q 4BBSH 3MVVA 3J81i 3CU7A 2ATWA 1N8RC 1UE5A 5I9PA 4JBJA 5JEAG 1A6XA 3Q23A 3VR2A 4X3UA 3KK7A 4R8NA 1YHBA 3EA6A 4HJ7A 3QR8A 1WFQA 1JMCA 4HCEA 3CCQA 5LL6X 2JJQA 4JBKA 3I2ZA 1FYCA 2CQAA 1VF7A 4A3DG 2SNMA 1CHQD 1XXGA 2E2DC 1I6HB 3I7FA 1NAPA 4LF9Q 1TWHB 5JJIA 4CDCC 3CQZB 1X56A 4KI0A 2H4OA 1XPUA 1NTGA 5M5WB 1STNA 3GTPB 4OONA 2DNEA 3VA5A 4Y7NH 2HQEA 3GTLH 4O0AA 3JAME 4DAPA 2Z1CA 1B9MA 2KHIA 1DCZA 4DK3C 3DLLA 4CDDC 4DR5Q 3PO2B 4DK6C 1RL2A 3BZKA 3S1NB 1D1KA 4DAYB 4LWCA 2DY7A 2M9VA 5M9OA 2QW7A 3EFXD 1HZAA 3H0GB 3OIPA 2K04A 1M1KC 1UWVA 3S24A 2Q8TA 2KEEA 3SK6A 3NBIA 2XRQD 3NK9A 2QEJC 1EWCA 3K58A 1B70B 4P2CB 3CPWA 2UU9L 2WKCA 1KL9A 4MIUA 4O2DA 2C5CA 4AIMA 2ALYB 1VQLA 3RZDB 3K57A 1EUJA 5CBAE 4QL5A 2PQEA 5DAUA 2F4VQ 1K28A 2Y0SB 3T56B 4AH6A 1C4QA 4ME3A 2PNRC 5GAEC 3J7YW 1WTQA 2AWOA 1RODA 5DM63 3Q0AA 1SYDA 5I9OA 3VR4A 1B50A 4BY7H 2KEDA 3BVMA 3LNNA 3RLFA 1GUSA 1FNUA 5CMDA 2ZJQA 4G57A 5M3FG 2RCNA 2LXKA 3T51B 4LNQA 3FVQA 1Y1WG 1F77A 3TMEA 2PW7A 1AW7A 4KJNA 3MAQA 4A93G 3GV6A 1Q8IA 1OO9B 3K80C 4FP5D 2F4VL 1QJOA 4ODGA 1QG7A 2ZTEA 3HOVH 1QB5D 4ILWA 3NQTA 5C4XB 2ID0A 1XMQL 5JJZA 5AFWA 4JI3Q 1BUVT 1Z7TA 2K7VA 3LX0A 3URYA 1ENCA 2BDOA 1PA6A 1K3RA 1EIFA 1H9SA 1AE2A 1E2VA 1MBYA 1IXRA 2Y0SE 2JA8G 3HOYG 3H09A 5C0XJ 2YTYA 1Q7YC 2JA5G 1VQDA 3VA7A 3VR6A 3FKIB 4HSPA 4RHSA 1AP0A 3EIVA 4EGVA 1BBWA 3M3YB 3TZUA 2HHHL 3BDLA 1LACA 1LT4D 3C1FA 2OCEA 2XVSA 4WRDA 1MSGA 2IX3A 4AQYL 1X9NA 1E3PA 4A3DH 4JI3L 2R7ZB 5CV7A 2XWJB 1BBXC 4X3KA 1HNXQ 4QQBX 2D0PA 1EEID 4RWSC 4JI7L 4R4TA 4EX5A 2PO4A 3A54A 5M5YH 5CV4A 4A3MB 5ELNA 4C3HB 4LJZC 3D8GA 1FD7D 4HJAA 1SXTA 1QE6A 4IFDI 2VNUD 5I2XA 2E2JH 3S17B 3RMHA 1QVGA 5FKAC 2E74C 1R9TH 3PCOB 2DNCA 3TDQA 3A5UA 4DV0Q 3GTQH 4NXML 1PXUA 1O7IA 1EY0A 3FP9A 3NUCA 1NBWA 2JK8A 3J81j 4A76A 1TVXA 1A3VA 3HOXH 3RD4A 4ZKCB 1SBBB 1EFID 5CC4A 5EPLA 1EZ6A 2OWOA 3J7AV 4UDUC 4ULLA 5DM73 3HOZB 1FVIA 3K6OA 1HUNA 3M4OH 4X66Q 1PFNA 4KD4A 4LFCQ 4WJ3M 4DKAC 3GTKB 2O5JC 2F0WA 1SJED 1WCMB 5KNBA 2WINB 3DMUA 3C2PA 4CJ1B 2QA4A 2JEBI 3J7AF 2YTVA 4R4IA 1WTHA 1KNEA 2A1AA 4K0KQ 3B6YA 2EZVA 1JB3A 1LTGD 4F87A 4DUYQ 4P72A 5CGKA 3PSIA 4JCVE 4CGYB 2MNAA 2E2IH 4EQPA 2HDMA 2Q2UA 1EIYB 2N88A 4DUZQ 1B3QA 3HOWG 1PHJA 2FMCA 2CQOA 4ZKBB 1CKNB 2B2VA 3SDZA 5KNDA 4DV2Q 3EQLC 3S15H 2F52A 1PRTB 1N9WA 4JOIA 4C3IH 1UE7A 3O13A 4X65L 2VQFL 4LF5Q 4JW0A 1L1OC 5JJKA 1VQHA 5C3EB 5ELBA 1VQBA 3CMAA 1KRSA 2NVQH 1VMPA 1SMXA 1OXSC 3KLRA 2IX0A 1TS3A 3M7GA 1QUQB 1N34Q 2R93H 4N8FA 4A3EB 5C44G 3VR3A 5IODA 5C4JB 4OO1G 1VQFA 4C1NK 4JI8L 5E3FA 3OSOA 1CT1D 1PYWD 5K5PA 5FLMG 1X3GA 3T1YL 1QNKA 3UDIA 2RSNA 2IT1A 5AJ3L 2PI2E 4OIKA 5IGBA 2EYFA 1S40A 1CSQA 5J1ZA 1Q46A 1XMOL 1AFPA 1ZYRD 4KN4C 4IURA 1Y8PB 1JICA 3K7UC 5ELOA 2MQHA 3UE1A 3W1GA 2F0EA 2AKWB 1SE4A 3QJYA 4LF4L 1VQCA 1I5FA 4UAIA 3KJPA 4ZK9B 2JA6H 4GS3A 5JVH3 2F0KA 4HSVA 5IYBG 5FJ8G 1GJXA 2SEBD 1FR3A 1JWMD 4KY6A 3TS2A 2R92B 1J6QA 1X6OA 2F0UA 2CVRA 2MO1A 4HIOA 1QVCA 4X64Q 3K8AA 5CV6A 3U4ZA 3ICEA 2B2VC 2B63H 4K5XA 3Q8DA 4IFDG 4ZUIA 3MA2B 3PUZA 4WORA 4JOIC 4A3LG 4GKJQ 1SNDA 2NN6I 2F4IA 3HP3A 1LTAD 2JQOA 2RHSB 4N9PA 5M3MB 1JQYD 2JYOA 2K4KA 4GKKL 4JG2A 3RZOH 1ZXTA 4DR7Q 3W3AA 3A56A 2L12A 1VQIA 4IOCA 1G6ZA 5IE8A 2ZJPA 3OTOQ 1SFOB 3U4VA 3S1MB 4LFBL 4I7AA 4K5VA 1NR4A 4A3IB 1PFBA 1EFWA 1L0XB 1LYLA 5FO8B 2Z4IA 1HR0Q 1TWGH 3HOUB 2EQSA 2CKZB 3LWEA 2WACA 1C48A 1YIJA 3PO3H 3T16A 4K8IA 1S5ED 2XRSD 3H91A 4DV1Q 1C0AA 3L0OA 4DNIA 5JPMC 3UE0A 4B3SQ 1H9RA 3SK4A 3PIOA 1TU2B 1XNQQ 5HGTA 1X54A 4C2MB 1DOKA 3K81C 3K7AB 4HTHA 4IUQA 1ET6A 2HQLA 3ZYYX 3GTGB 5EAYA 2PZUA 1Q86C 2JA7H 5LMUL 3CCUA 1IBLQ 4B3TL 1C8CA 3A8KE 3NTIA 2AWNA 5IP9G 3KBXA 2SDFA 5IYCG 4A3JG 2EYLA 1SEBD 2JXMB 4BBRB 1MI2A 2EVBA 3FPUB 5LMNQ 3STBD 2ZXRA 3MXGA 2ZT9C 4QB4A 2K05A 2NZOA 4DV1L 2X6LA 4B3SL 1YJWA 4BBSG 1D5XC 4GLAC 5DNFA 1F2LA 3OW7A 3A0JA 2EXDA 3U9SA 4DR2L 2E2HH 4BY1B 1IZ6A 2QDLA 4QCLA 5EKKA 4UHVA 1CK1A 3JAMc 3AEVA 3ERQA 5C44H 2PI2A 5FO7B 1ZYRC 4HMIA 1IBLL 3J80c 1PH2A 4NB3A 5BN4A 2XN9C 4Q0FA 3S2HH 2UXDL 1ILQA 1EOTA 1IL2A 5DLQE 5H1SE 2VUMB 2AMCB 4JI1Q 2CHBD 1CKNA 2LY7A 2VS1A 3GV3A 4KN7C 3H15A 3PIO3 1STBA 4DF7A 3I4MH 4JYAL 1TWFH 1I50H 1TXYA 2K1BA 3JC66 1V1OA 4EQNA 1YHAA 4MN3A 1QZHA 4A3KB 4KV6A 2KENA 1JOQA 3KLSX 1SJHD 5BN5A 2YU9B 2I46A 3NE5B 1WTVA 2F0QA 5FJ8H 5KYLA 1QUQA 3AMUA 4Z9CB 3OWEB 3CW2C 1RDPD 3H6MA 5C4XG 2F1MA 2OXPA 1XTDA 1BDOA 4IFDH 1U5KA 2EYOA 1XNRL 2TMPA 3NELA 1VQMA 2UXBQ 4RA8A 2K5VA 1BQQT 4C3JB 1WTRA 4IUPA 4K2LA 2D62A 4CHTB 2EYMA 3DUZA 3OIQA 3KLWA 4IUUA 3G6EA 3W2DA 1DZ1A 3MXPA 1KC8C 4BXXG 2I0QA 2NYZD 3R93A 1N33L 5IWAQ 1KLGD 1EY7A 4XTCS 3L3OC 3M85A 3K5NA 3JAML 2QEXA 2JSOA 4UY8C 4JI4L 2WP8J 4AYBG 3J80L 2SNSA 3IRBA 4F8MA 4DV6Q 1I6HH 4BY7G 3CQZH 4JI5L 2Q8IB 3N52A 5M5WH 4L6TB 1SNQA 1VS0A 3GTPH 1WI5A 1JCKB 4C3HG 2DN8A 4K8JA 1YJ9A 4H0LC 5EQ0A 1PH4A 1FL0A 2UUBQ 1O7YA 3STBC 3E9HA 3PO2H 2X6GA 1IKMA 3RR5A 5D65A 1P16A 2B8GA 3S1NH 2KCTA 3A7LA 3KYHC 1E1TA 4Q5VA 4G7ZC 1LTLA 3AFPA 1UAPA 2CCZA 1G2TA 2Q2HA 3HG9A 5C0XI 5IP9H 5FOBB 4FF3A 2L55A 1VQOA 1L1OB 3AFQA 1PMRA 5I4DA 1D6EC 4LFAL 1DYQA 3FDTA 3K59A 1IBML 1SYFA 2LMCB 4HIDA 1DXMA 1JORA 5CORA 1CSPA 3RZDH 1B44D 2RCFA 2YYZA 2UUBL 1FGBD 2BOSA 5GAHC 1TY2A 2EYJA 1IBKQ 4FNFA 1HFNA 5EKLA 4A3GB 2A19A 2RA4A 3PF5A 2KJXA 1OXTA 1HXYD 4RGOS 4OX9Q 4IO9A 2R3ZA 2CH4A 3A74A 4JI0Q 4PV1C 1ENFA 5ISRA 3DEOA 5A35A 3S2DB 2L0CA 4OWXB 1PTOB 3Q6SA 4DR4L 1LUZA 4CKBA 2KHSA 1VQ4A 2IHEA 3G6JB 3GP7A 4JI6Q 4LF8L 2FXQA 4L5QA 4YWKA 1CKMA 1C9OA 1I4XA 1NSNS 4HCSA 4KMUC 5JEAJ 2RDGA 2A69C 4F7XA 3J80E 2RKSA 2NVXB 2IW3A 4K6LA 2F0HA 1PRTF 4KY7A 5C4XH 3R2TA 4BWGB 1PH6A 2N78A 3FPPA 4LF9L 4HEDA 2UXCQ 1JOKA 3HOXG 4A3EG 1SE3A 1G2SA 1KHIA 4OEMB 4PZ6A 2MO0A 4LAAA 1PH1A 2NN6H 2NVYB 2M2LA 3I56A 3IAYA 3QB3A 4DK0A 1MHWC 4A3CG 3CCSA 2EYPA 4BXXH 3ND8A 2HIVA 3M4YA 4DR5L 3FKIH 1Q1EA 1GUWA 1TS5A 3HKZG 3M3YH 1NNXA 3OHXC 4DXFA 2XGTA 1E22A 2H5XA 1FJGQ 3NSWA 5IGFA 1RF2D 5E4XA 4WJWA 3G7LA 2R7ZH 4RCNA 3U58A 3GTOB 4PMBA 3UDXA 3P7JA 2CWPA 4NP5A 3Q22A 1EEFD 2IJ0A 3DWPA 2A5HA 4CKEA 3BYTB 2Q2TA 3J81c 1AN8A 2F3VA 3GTMB 3KFUA 4GZYC 4A3MH 3I3CA 2EJGC 4C3HH 3N6RA 2E8GA 3CRKC 1XPRA 4C3IG 5JAVA 3D6CA 4C56C 3I4NB 2AQ3B 4B3RQ 1HNZQ 2K5HA 3F2UA 1NMGA 3S17H 4IN3A 4RKLA 1R4PB 1NMFA 1RD9D 2TSSA 3DWQA 4B3MQ 1UE6A 3E0EA 3I73A 2I5HA 3VYUA 3PGZA 5A2QE 4HAEA 3T1HQ 3SR1A 4JI2Q 4DR1Q 2CH4W 1D5MC 4ZUJA 3OMCA 5IYDG 3HKSA 1MKHA 5IGDA 2R93G 1LO5D 2KOLA 3AYHB 2G5DA 1TQOA 1O78A 2NVTB 2F0PA 4RFBA 1U4PA 2A68D 1A15A 2I07B 3M9BA 4DNTB 2B2WC 1K3BC 2K5DA 1F9RA 1HZCA 3GTKH 1F2MA 1WCMH 4U68A 1PH9A 5BR8Q 3NHHA 5IGCA 2ICIA 3KDFB 2EE1A 1SYGA 1NY4A 2Z6BA 2B29A 3T53B 2YV5A 1ASYA 4YHHQ 1ET9A 2XIWA 1JT8A 4JI2L 2O4XA 1JB7A 4DGZA 2E5LQ 4P75A 2D5DA 5C4ZA 2V1CC 2JA6G 1F9SA 1HR0W 3EBEA 1BVSA 4LUOA 1YBYA 1IL8A 1PTOD 5ELDA 1PH7A 4FXDA 1GD7A 3F2BA 1L1OA 1NR2A 3OYYA 2F0TA 1MJCA 1EZ8A 2B63G 2JE6I 1OTCA 1VQ8A 3BDOA 1N32Q 4RGTA 3NWTA 1SE8A 4ZQ3A 3MZ5A 1STAA 3HZXA 2VY3A 1GO3E 3F2CA 4A75A 2WAQB 3CCEA 1TIID 4DA2A 3W5OA 2NBFA 3CPFA 2KVMA 2RVLA 4BY1G 1QZGA 2WB1G 2E5LL 4GOPA 1O7ZA 1NJIC 4A3EH 2BE5D 2F0IA 1EQQA 1HNXL 3TZDA 2B8FA 5C4JH 1V9PA 2HT1A 3I4LA 1CKOA 2Q2IA 1XJVA 4IQZA 1EU3A 4KTAA 1Y8OB 3EN2A 4A3CH 1BCPC 2WFWA 4TKOB 3PIPA 3PO3G 4GNXC 2VL6A 4HN7A 1HCZA 4DV0L 4EQ5A 1VQ6A 1GHJA 2AQ2B 3NEMA 4A3FB 4R4QA 1JJGA 2N55A 2IX1A 4A3KG 3CC7A 1VF5C 3EJIA 4LW1A 2IHFA 1RJTA 4KY5A 2B3GA 4MNOA 2MUYA 1E0BA 2JA7G 3CCVA 2R92H 3GTJB 1AH9A 2PPBC 2P5ZX 4NMZA 4X66L 4LFCL 4DV4Q 5C3WA 1VQ9A 1YJNA 1XYIA 1X3EA 1S5BD 4GN4B 4A3DB 1RCVD 2WAQE 2A68C 4RKBA 1PYBA 2B2UC 4K0KL 2BH8A 5D3DA 4L63B 3CCRA 5M3MH 2N3SA 4DUYL 2PCFB 5C6AA 1CA6A 2K5NA 4IZ8A 4TVAB 5IT9c 5C0XH 1A2UA 4LUVA 5IYDH 1A63A 4DUZL 5IP7H 4V190 4J8QA 1Y14B 1PH3A 5J3BA 1DONA 1SFOH 3J81E 2OQKA 4QUCA 4GOPC 1PZJD 3S1MH 4DV2L 4A3IH 5D14A 3E0JA 1TWAB 4DK1A 2EJFC 3SE0A 3HOUH 4K5WA 1DOMA 1JE4A 3X3MA 4LF5L 1ENAA 2H1EA 3KF8A 1PTOC 3I4MG 2KCMA 3FEWX 4S3SA 2L5TA 1IYUA 4ZYSA 2ZTDA 4U673 1Q3LA 4C2MH 3K7AH 3GTGH 3C1EA 1QOHA 1WYDA 2K75A 2WV6D 1Y1VB 1JJCB 1BKBA 5BN3A 1CHPD 1N34L 1AE3A 3SHLA 1CUKA 1HH2P 5CV9A 4CKCA 2OQ0A 2NB0A 1GVPA 3NPPA 2F0NA 3ULLA 2RSOA 1WD0A 1EYAA 5C3XA 3TP8A 3TBIB 2R61A 4JVZA 1B3AA 2BE5C 1TS2A 2GA4B 4BBRH 1Z9FA 1RKNA 2VQEQ 1DM0B 1GM5A 1F9PA 1RIPA 1HQMC 3JAMi 1WD1A 5M3FB 1VQ5A 3TEHB 4Y52H 3TP7A 1I3QB 1Y1WB 4BY1H 3H3VC 3KDFA 4JV5Q 1TT2A 3S16B 3BYYB 2F0OA 4IJLA 1EIHA 4A93B 5IT9L 1U0LA 4RG1A 2E75C 1J8IA 1X65A 4DU9A 1LTID 3G48A 4KD3A 4X64L 2VUMH 1B7YB 1OXXK 3FMCA 4DR3Q 3HGBA 3IFDA 1JJ2A 2F0VA 5HY6A 1SROA 3QIAA 4MZ9A 1Q12A 3BDCA 2F3WA 4ZLTF 4GKJL 2L9HA 2VZAA 1ESRA 4A3KH 4PG3A 4DR7L 3CAMA 3I70A 1PTOF 2F0GA 2FMMA 2JA8B 3HOYB 3CP0A 3PO2G 2YU9H 3OTOL 2JA5B 2FFKB 3PV0A 2MP1A 1DD2A 1SNOA 2EIFA 2KHJA 1T9HA 3CC2A 2ZM6Q 1KLUD 3H0GG 2BA1A 1HR0L 2B2YC 2QF7A 2FINB 4YCWA 1HTLD 3PF4A 3NBHB 1B8AA 2LFNA 1TR5A 2I5LX 4XYQA 1K83B 1LABA 1UEBA 4C3JH 4DV5Q 3PUVA 3MFYA 2R7FA 1XNQL 1GUTA 2A6ED 2MHVA 1NE3A 1U4RA 2UUCQ 3SXHA 1MGSA 1DGSA 3P1HA 4POGA 4FYDA 4XT3B 1TWCB 2MJ8A 4DAMA 5DEHA 4X3TA 2GN5A 4IPCA 2Y0SG 4HJ8A 1XPOA 1QNUA 2IPKD 2K52A 3CHBD 2ZM6L 1WTXA 4MTKA 4KKUA 5EPJA 2D0OA 4HIMA 5GROA 1HFGA 1FGUA 3D4WA 5LMNL 4IPDA 4H13C 4DV3Q 4XQJA 4XDXA 2AUKA 5KYIA 4YY3Q 4TQUS 3LGJA 2L11A 1VQNA 3CRLC 4OELB 5LHY1 1JOOA 2EOTA 3G4SA 5IT9E 5GADC 1GKHA 1LTSD 4OGQC 2PQAB 5EKIA 2VXWA 2K32A 2KCNA 3OMGA 2HDLA 4KJOA 3TRZA 5C5MA 1W3SA 5JJLA 1A8VA 1HZ9A 1SR3A 2EY1A 4XXEA 5EBDA 3NP8A 3CF5A 1E24A 4X3SA 4JI1L 1FNWA 4DPGA 2F0SA 4APVA 1N36Q 1VQAA 1X32A 1EQTA 1RHPA 1G6PA 1J9OA 1EL0A 1H9KA 3U9OA 3WWVA 3HOWB 5E1FA 1STYA 2E76C 1PV4A 2A69D 2NN6G 2K01A 3D3RA 1U4MA 1DJRD 4IALA 5K36H 4PMCA 5COYA 1ML0D 4EVOA 1STGA 1G8ZD 3MTSA 3FKIG 2Z0SA 1HTPA 1XWEA 2N49A 4A3GH 1EOVA 1PZID 2L4NA 2QDBA 5EGTA 3SK5A 2IY5B 3DXJC 4XYOA 2R7ZG 1J5EQ 1BCPB 4B08A 1A3UA 1CZWA 3S2DH 1SAPA 1TWHH 4FXKC 3R3OA 3RUZA 2UXBL 1PTOH 3R2IA 4LMQD 3GQBA 4GNXB 4L5RC 4O42A 3VYRA 2HD3A 3T13A 1U4LA 1GXDC 2MFIA 4KHPQ 1EQVA 3K0YA 1ASZA 2DY8A 5JOBA 4HIKA 4A3MG 3S1QB 1V1QA 5JPNC 5IWAL 1VQGA 2NVXH 3OW2A 2LS01 2QCPX 2A6EC 1E1OA 2KQ3A 4K14A 4RMFA 3RLOA 2EXZA 1ZEQX 3H0GH 3S1RB 3HS0C 1B4OA 4DV6L 1J5EL 4YIJA 1YNND 2DUDA 4ABNA 3BU2A 4MTNA 1EY8A 2L15A 4HMJA 2NUCA 4DN4M 4R9WA 1D5ZC 1KAWA 3HOZG 2NVYH 1BR9A 3QOLA 3T4AC 1UNSA 1VQJA 3PUYA 4BA2I 1JC7A 2AUJD 2KA7A 4HJ9A 3DM1A 1WCMG 2BH2A 1PH5A 3D0FA 3TQYA 2I5MX 2DJFC 4R8IA 4ME5A 1AZQA 2AQ1B 2A6HD 1X3PA 1IYVA 4GOPB 5I2YA 1F2YA 2G9DA 2BDNA 2MPMA 3K0XA 3C46A 1F2ZA 4YCUA 3BG3A 3TS0A 2XSCA 3GTOH 4XQNA 5A2QL 1F9QA 2EJMA 4OHJA 1EWHA 4G4KA 3MXNB 1S5DD 2ENBA 1A2TA 3A8IE 1KRTA 5C4HA 3GTMH 3NBHA 5CYUA 1OXUA 4OWWB 4RCOA 1SRUA 3I4NH 1RTNA 2M00A 1IBKL 1I4HA 2MGSA 1SNMA 3I8ZA 2K5WA 5C3EG 4A3BB 1VQKA 3BZDB 5J22A 5M5XB 4OX9L 1O80A 1Q1BA 2UU9Q 2KBNA 1ZKOA 2LSSA 4UP7A 2ZJRA 4JI0L 1Q81C 4IOAA 3E9IA 2Z6KC 2B2WA 3EROA 4UP8A 3ER0A 2NVTH 1IW7D 3F2DA 2F03A 3NXWA 1CM9A 4QY7A 4JI6L 4EQOA 2EY2A 5KEEA 1EWIA 2OT2A 4F88A 1G51A 1PFMA 3KOJA 2O5IC 3G71A 5FO9B 1H9MA 1UE1A 3A8JE
chains in the Genus database with same CATH topology
2WB1E 4IJHA 1XJVA 1A0IA 4IOCA 5IE8A 3AQQA 2ZJPA 3OTOQ 1K73C 3EN2A 2PQAA 1X55A 4A3CH 3L2PA 1N36L 1PFSA 3U4VA 1YITA 2WFWA 3PIPA 4LFBL 3PO3G 1HJPA 4GNXC 1C7YA 1EFWA 4ALPA 1EYGA 2VL6A 4QJFA 1LYLA 3D31A 1HR0Q 1TWGH 1Y1VG 4DV0L 2EQSA 4EQ5A 4QGUA 2JEAI 3NEMA 4LUZA 4OWTB 2C35B 2CKZB 1YNXA 1VQ6A 2UXCL 2ASBA 4R4QA 1YIJA 4JYAL 3PO3H 2IX1A 1JJGA 4A3KG 3CC7A 2R92G 4LW1A 2IHFA 4DV1Q 2B3GA 4MNOA 1WOCA 3L0OA 4A3BH 3KF8B 4DNIA 1C0AA 2CFMA 3UE0A 4B3SQ 2JA7G 3PIOA 1PYSB 1XNQQ 1SLJA 1X54A 3CCVA 3I4OA 3K81C 3CCMA 2R92H 2HQLA 5M5XH 3RN2A 5EAYA 4LFAQ 2WAQG 1XMQQ 1AH9A 3UDGA 2Z6KA 4L5TA 1Q86C 2JA7H 4X66L 5LMUL 4LFCL 1IBMQ 4JBMA 4DV4Q 3CCUA 2RF4A 1IBLQ 4B3TL 1FJGL 5M3MG 1VQ9A 1YJNA 4NPSA 4R4CA 1X3EA 4GN4B 5GQOA 2WAQE 3F8TA 1PYBA 1L0WA 4KHPL 4K0KL 3ERSX 5C0XG 2BH8A 2AWNA 1SN8A 5IP9G 5IP7G 3CCRA 5HGQA 5M3MH 2YTXA 2N3SA 3MEFA 5IYCG 4A3JG 4DUYL 3HOVG 4P74A 4R4OA 3H3VH 2AHOB 2ES2A 5LMNQ 3BZCA 3STBD 2K5NA 4TVAB 5IT9c 3CCJA 3HOZH 4LUVA 5IYDH 2NZOA 4J15A 4DUZL 5IP7H 4DV1L 1A63A 4A3IG 1YJWA 1Y14B 5IYCH 4A3JH 1PH3A 1K8AC 4B3SL 4GNXA 4GLAC 5J3BA 3S14H 2HHHQ 3HOUG 1SFOH 4DR4Q 4AQYQ 2OQKA 4FDBA 4B3RL 3A0JA 2EXDA 4POFA 4DR2L 1HNZL 4GOPC 1IZ6A 4A3FG 2E2HH 3S1MH 4QIWE 4DV2L 3HFZB 4A3IH 4LF8Q 4BBSH 4B3ML 3JAMc 3AEVA 5C44H 1LM0A 3J81i 4L5SA 2PI2A 2ATWA 3HOUH 4WJ4A 1N8RC 1IBLL 4OO1I 3J80c 1UE5A 5JEAG 4JBJA 3T1HL 4A3FH 4LF5L 3M7NA 1PH2A 4NB3A 3S2HH 4JI7Q 2UXDL 1V43A 2PMZE 4DR1L 2UUAQ 2KCMA 1IL2A 5DLQE 3CD6A 3I4MG 5H1SE 1YHBA 2AMCB 4JI1Q 1H95A 4HJ7A 1CKNA 1BBUA 2ZTDA 2VS1A 3CMEA 3H15A 1WFQA 1JMCA 3ULJA 4PZ8A 3CCQA 1KQSA 2JJQA 2XTIA 4C2MH 3K7AH 3I4MH 3A5ZB 3GTGH 1TWFH 4JBKA 3GTJH 1I50H 3I2ZA 1WYDA 2NZHA 2K75A 1TXYA 4A3DG 1N34L 1JJCB 1BKBA 3JC66 1YHQA 1AE3A 1CUKA 1HH2P 3I7FA 4LF9Q 1YHAA 4NXMQ 2OQ0A 1N33Q 1GVPA 5JJIA 3ZJYC 1QZHA 5BR8L 1X56A 4KI0A 3ULLA 1XPUA 2KENA 4BBRG 1NTGA 5C3EH 1VQPA 1KD1C 4OONA 4YWLA 5FJ8H 4Y7NH 1QUQA 4BBRH 1D8LA 1Z9FA 4YHHL 3KJOA 3GTLH 4O0AA 4YCVA 3CW2C 2VQEQ 5C4XG 2KHIA 4DK3C 3DLLA 1GM5A 2UUAL 4DR5Q 1RIPA 4DK6C 1MJEA 1RL2A 3BZKA 1XTDA 3JAMi 1U5KA 4DAYB 4LWCA 1XNRL 1VQ5A 3NELA 3TEHB 3VDYA 1VQMA 2UXBQ 4Y52H 1HZAA 2K5VA 4BA1I 3I55A 1IYJB 4BY1H 3KDFA 2D62A 1M1KC 4JV5Q 1UWVA 3S24A 1TWAH 5LMNW 4IJLA 3KLWA 3G6EA 2VUMG 1U0LA 4RG1A 4KLKA 1B70B 1KC8C 3CPWA 1X65A 2UU9L 1N32L 4BXXG 2GVAA 2I0QA 2CWAA 3G48A 1N33L 1KL9A 5IWAQ 4X64L 2VUMH 1B7YB 3DM3A 1OXXK 4XTCS 4DR3Q 4O2DA 4AIMA 1L2FA 2ALYB 1JJ2A 1VQLA 5HY6A 1SROA 4MZ9A 3KF6B 3M85A 1Q12A 2GVBA 1EUJA 4P73A 2QEXA 4QL5A 4UY8C 4JI4L 2WP8J 4AYBG 2F4VQ 4GKJL 1Y1VH 1KXLA 4AH6A 3L7ZC 4ME3A 3IRBA 4GLVB 4DV6Q 1I6HH 5GAEC 4BY7G 2OTJA 2VZAA 4X65Q 2AWOA 2VQFQ 3U50C 3CXCA 3CQZH 4A3KH 4PG3A 4JI5L 3SGIA 4DR7L 3CAMA 4AYBE 5M5WH 1VS0A 1YEZA 4BY7H 3CP0A 3PO2G 3GTPH 1WI5A 4YWMA 3OTOL 2YU9H 1Z47A 1YJ9A 3PV0A 3RLFA 1VQ7A 3FHWA 1PH8A 1PH4A 2ZJQA 1FL0A 2EIFA 2KHJA 5IY0A 5M3FG 1T9HA 2RCNA 3STBC 2ZM6Q 1W2BA 2UUBQ 3CC2A 2LXKA 3E9HA 4LNQA 3H0GG 1Y1WG 3PO2H 2BA1A 1EQRA 3RR5A 1HR0L 1P16A 2R7DA 3S1NH 4YCWA 2KCTA 1E7ZA 3PF4A 3NBHB 1B8AA 5M3FH 4A93G 3KYHC 1E1TA 1I3QH 4JI8Q 3H3VI 2I5LX 1LTLA 1Y1WH 1MIUA 3AFPA 1JE5A 1UEBA 3K80C 4C3JH 2CCZA 2F4VL 1OXVA 2Q2HA 4DV5Q 3PUVA 5C0XI 5IP9H 2ZTEA 3S16H 3HOVH 1VQOA 2R7FA 1XNQL 4JBWA 4A93H 5GAGC 1L1OB 3T1YQ 3AFQA 1NE3A 2UUCQ 2ID0A 4POGA 1DGSA 5AJ3Q 1XMQL 4LFAL 3GO5A 4JI3Q 4DAMA 2GN5A 1XMOQ 1IBML 4IPCA 4DV4L 2Y0SG 4HJ8A 4HIDA 1XPOA 1CSPA 3RZDH 2YYZA 2UUBL 3UDFA 2K52A 1PA6A 1K3RA 1EIFA 5GAHC 2ZM6L 1IBKQ 1AE2A 4DV7Q 2D0OA 4LF4Q 1IXRA 4HIMA 5GROA 2Y0SE 2JA8G 3HOYG 2A19A 5C0XJ 3PF5A 2YTYA 1FGUA 1Q7YC 2JA5G 5LMNL 1VQDA 4IPDA 1OXTA 4DV3Q 4OX9Q 1VQEA 4IO9A 3A74A 4YY3Q 4TQUS 4JI0Q 3LGJA 2JA8H 3EIVA 5E7NA 1BBWA 1VQNA 3HOYH 2JA5H 2HHHL 2BA0A 3G4SA 5GADC 4OWXB 2OCEA 4DR4L 4AQYL 4BBSG 1GKHA 1K8GA 2PQAB 3F1ZA 1X9NA 4PZ7A 1LUZA 1E3PA 1YZ6A 4A3DH 4JI3L 1VQ4A 2IHEA 4A4IA 4JI6Q 4LF8L 4OXPA 3J7ZC 2FXQA 4L5QA 4YWKA 3TRZA 1CKMA 1C9OA 1W3SA 1HNXQ 5JJLA 1A8VA 4QQBX 4GKKQ 2D0PA 1HZ9A 1SR3A 4JI7L 4GN3B 4R4TA 1K83H 4EX5A 4DV7L 5JEAJ 5M5YH 3TREA 3CF5A 5ELNA 1E24A 4JI1L 4DPGA 4HJAA 4IFDI 4APVA 2VNUD 5K36G 1N36Q 5C4XH 1VQAA 4NXNQ 1Q82C 3J80i 1G6PA 2E2JH 4LFBQ 3M4PA 1QVGA 3WWVA 1PH6A 1TWCH 1R9TH 3PCOB 1PV4A 2NN6G 3A5UA 2N78A 4DV0Q 4LF9L 3GTQH 4DR6Q 4NXML 2UXCQ 3HOXG 1O7IA 4A3EG 3CC4A 4LF6Q 3FP9A 1KHIA 4PZ6A 4A3GG 1P8LA 2MO0A 3RLNA 4R1JA 1PH1A 1NBWA 2JK8A 3J81j 3I56A 3FKIG 4A76A 2Z0SA 3HOXH 4DR7Q 3RNUA 2N49A 4A3GH 4H02A 4A3CG 2OWOA 1EOVA 2VQEL 3CCSA 4BXXH 2HIVA 3GDEA 1FVIA 4PMWA 4DR5L 3FKIH 4IFDJ 2IY5B 1Q1EA 1QVFA 3M4OH 4X66Q 3HKZG 5LMUQ 4HJ5A 4LFCQ 1J5EQ 4DKAC 2R7ZG 3M3YH 4WJ3M 2XGTA 1YI2A 3S2DH 2R6GA 1TWHH 1E22A 4B3TQ 2H5XA 3W1BA 4NXNL 4GNXB 5FLXc 4L5RC 1FJGQ 4XIGS 2UXBL 4GLXA 2QA4A 2JEBI 2YTVA 4R4IA 3PUXA 2JA9A 4JV5L 2MFIA 2R7ZH 3U58A 4KHPQ 2A1AA 1ASZA 3B6YA 3UDXA 2VW9A 4K0KQ 1D7QA 3HKZE 2CWPA 4A3BG 4HIKA 4A3MG 4DR6L 1V1QA 4LF6L 4DUYQ 4JC0A 3M4QA 4P72A 3PSIA 4JCVE 2MNAA 2E2IH 4LF7Q 2Q2TA 2Q2UA 3J81c 1EIYB 3KFUA 5IWAL 4DUZQ 4A3MH 1VQGA 4C3HH 4DR3L 3HOWG 1PHJA 2NVXH 1A62A 3OW2A 2E8GA 3CCLA 1XPRA 1E1OA 4RMFA 2CQOA 3RLOA 1CKNB 4B3RQ 2F3IA 1HNZQ 2K5HA 4DR2Q 1PVOA 1NMGA 3H0GH 3S17H 4DV2Q 2A8VA 1HNWQ 3S15H 2F52A 3HOWH 1NMFA 4B3MQ 1N9WA 1UE6A 4DV6L 1J5EL 3E0EA 4JOIA 2DUDA 1I94Q 4C3IH 3BU2A 1UE7A 4MTNA 1M90C 2I5HA 4X65L 3PGZA 2VQFL 2L15A 3T1HQ 4LF5Q 1L1OC 5JJKA 1VQHA 2UXDQ 3CMAA 1VQBA 1YVCA 4JI2Q 4DR1Q 1KRSA 3ULPA 2NVQH 1SMXA 1KAWA 3HOZG 2NVYH 5IYDG 1OXSC 3HKSA 4BA2I 1VQJA 1MKHA 2LXJA 3KF6A 3PUYA 2R93G 2IX0A 3AYHB 4HJ9A 4KHZA 1G291 1S3OA 1WCMG 2BH2A 4LF7L 4JYAQ 1QUQB 1PH5A 3D0FA 3TQYA 3M9BA 2I5MX 1N34Q 2ZTCA 2R93H 1HZCA 5C44G 3GTKH 2RHQB 4GOPB 4OO1G 1WCMH 4UPAA 1VQFA 2PNHA 4JI8L 5BR8Q 3NENA 1PH9A 1HNWL 3K0XA 4DV5L 4YCUA 3TS0A 3RN5A 5FLMG 3GTOH 1I94L 3KDFB 1X3GA 1NY4A 2B29A 3T1YL 3UDIA 3S1QH 2YV5A 3BJUA 1ASYA 2IT1A 3MXNB 4YHHQ 3GD7A 1KRTA 2UUCL 1JT8A 5AJ3L 2PI2E 4X62Q 4JI2L 3I4NG 3PUWA 5FLMH 2QGQA 1JB7A 1S40A 1CSQA 3GTMH 1Q46A 4P71A 3J7A5 1XMOL 2E5LQ 4P75A 1OXUA 1K9MC 2V1CC 4OWWB 1VCIA 1XNRQ 1Q8KA 2HIXA 1S72A 2JA6G 1HR0W 3EBEA 1BVSA 1SRUA 3K7UC 4LUOA 1YBYA 5ELOA 3I4NH 2MQHA 3UE1A 1IBKL 1PH7A 2DGYA 3W1GA 3S1RH 4X6AH 1GD7A 2AKWB 1WJJA 4IPGA 3F2BA 5C3EG 2OTLA 4LF4L 1VQKA 1VQCA 1I5FA 1L1OA 3KJPA 1KIXA 4IPHA 3OYYA 2N8NA 2JA6H 4GS3A 1MJCA 5IYBG 5FJ8G 2B63G 2JE6I 1OTCA 3TS2A 4DV3L 1VQ8A 4GN5A 4OX9L 1K0RA 1Q1BA 1N32Q 2UU9Q 2KBNA 1J6QA 1SE8A 1X6OA 2LSSA 4UP7A 2K14A 2MO1A 4HIOA 4YY3L 2ZJRA 4JI0L 1QVCA 4X64Q 1Q81C 3K8AA 2VY3A 1GO3E 3U4ZA 3ICEA 5IYBH 2B63H 3F2CA 3Q8DA 3E9IA 4IFDG 2Z6KC 1HZBA 1X3FA 4IOAA 4A75A 4UP8A 3CCEA 3ER0A 2NVTH 3PUZA 4X62L 3W5OA 3F2DA 3CPFA 4JOIC 4QY7A 4BY1G 4JI4Q 4A3LG 1QZGA 4JI6L 4GKJQ 2WB1G 2NN6I 1EWIA 2E5LL 4GOPA 1G51A 2JQOA 2RHSB 1NJIC 4A3EH 2K50A 1EQQA 3KOJA 1HNXL 5C4JH 1V9PA 4GKKL 2K4KA 4A3LH 3G71A 4JG2A 4UP9A 4JI5Q 1UE1A 2HT1A 3RZOH 1CKOA 2Q2IA 1VQIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WB1 E;  4IJH A;  1XJV A;  1A0I A;  4IOC A;  5IE8 A;  3AQQ A;  2ZJP A;  3OTO Q;  1K73 C;  3EN2 A;  2PQA A;  1X55 A;  4A3C H;  3L2P A;  1N36 L;  1PFS A;  3U4V A;  1YIT A;  2WFW A;  3PIP A;  4LFB L;  3PO3 G;  1HJP A;  4GNX C;  1C7Y A;  1EFW A;  4ALP A;  1EYG A;  2VL6 A;  4QJF A;  1LYL A;  3D31 A;  1HR0 Q;  1TWG H;  1Y1V G;  4DV0 L;  2EQS A;  4EQ5 A;  4QGU A;  2JEA I;  3NEM A;  4LUZ A;  4OWT B;  2C35 B;  2CKZ B;  1YNX A;  1VQ6 A;  2UXC L;  2ASB A;  4R4Q A;  1YIJ A;  4JYA L;  3PO3 H;  2IX1 A;  1JJG A;  4A3K G;  3CC7 A;  2R92 G;  4LW1 A;  2IHF A;  4DV1 Q;  2B3G A;  4MNO A;  1WOC A;  3L0O A;  4A3B H;  3KF8 B;  4DNI A;  1C0A A;  2CFM A;  3UE0 A;  4B3S Q;  2JA7 G;  3PIO A;  1PYS B;  1XNQ Q;  1SLJ A;  1X54 A;  3CCV A;  3I4O A;  3K81 C;  3CCM A;  2R92 H;  2HQL A;  5M5X H;  3RN2 A;  5EAY A;  4LFA Q;  2WAQ G;  1XMQ Q;  1AH9 A;  3UDG A;  2Z6K A;  4L5T A;  1Q86 C;  2JA7 H;  4X66 L;  5LMU L;  4LFC L;  1IBM Q;  4JBM A;  4DV4 Q;  3CCU A;  2RF4 A;  1IBL Q;  4B3T L;  1FJG L;  5M3M G;  1VQ9 A;  1YJN A;  4NPS A;  4R4C A;  1X3E A;  4GN4 B;  5GQO A;  2WAQ E;  3F8T A;  1PYB A;  1L0W A;  4KHP L;  4K0K L;  3ERS X;  5C0X G;  2BH8 A;  2AWN A;  1SN8 A;  5IP9 G;  5IP7 G;  3CCR A;  5HGQ A;  5M3M H;  2YTX A;  2N3S A;  3MEF A;  5IYC G;  4A3J G;  4DUY L;  3HOV G;  4P74 A;  4R4O A;  3H3V H;  2AHO B;  2ES2 A;  5LMN Q;  3BZC A;  3STB D;  2K5N A;  4TVA B;  5IT9 c;  3CCJ A;  3HOZ H;  4LUV A;  5IYD H;  2NZO A;  4J15 A;  4DUZ L;  5IP7 H;  4DV1 L;  1A63 A;  4A3I G;  1YJW A;  1Y14 B;  5IYC H;  4A3J H;  1PH3 A;  1K8A C;  4B3S L;  4GNX A;  4GLA C;  5J3B A;  3S14 H;  2HHH Q;  3HOU G;  1SFO H;  4DR4 Q;  4AQY Q;  2OQK A;  4FDB A;  4B3R L;  3A0J A;  2EXD A;  4POF A;  4DR2 L;  1HNZ L;  4GOP C;  1IZ6 A;  4A3F G;  2E2H H;  3S1M H;  4QIW E;  4DV2 L;  3HFZ B;  4A3I H;  4LF8 Q;  4BBS H;  4B3M L;  3JAM c;  3AEV A;  5C44 H;  1LM0 A;  3J81 i;  4L5S A;  2PI2 A;  2ATW A;  3HOU H;  4WJ4 A;  1N8R C;  1IBL L;  4OO1 I;  3J80 c;  1UE5 A;  5JEA G;  4JBJ A;  3T1H L;  4A3F H;  4LF5 L;  3M7N A;  1PH2 A;  4NB3 A;  3S2H H;  4JI7 Q;  2UXD L;  1V43 A;  2PMZ E;  4DR1 L;  2UUA Q;  2KCM A;  1IL2 A;  5DLQ E;  3CD6 A;  3I4M G;  5H1S E;  1YHB A;  2AMC B;  4JI1 Q;  1H95 A;  4HJ7 A;  1CKN A;  1BBU A;  2ZTD A;  2VS1 A;  3CME A;  3H15 A;  1WFQ A;  1JMC A;  3ULJ A;  4PZ8 A;  3CCQ A;  1KQS A;  2JJQ A;  2XTI A;  4C2M H;  3K7A H;  3I4M H;  3A5Z B;  3GTG H;  1TWF H;  4JBK A;  3GTJ H;  1I50 H;  3I2Z A;  1WYD A;  2NZH A;  2K75 A;  1TXY A;  4A3D G;  1N34 L;  1JJC B;  1BKB A;  3JC6 6;  1YHQ A;  1AE3 A;  1CUK A;  1HH2 P;  3I7F A;  4LF9 Q;  1YHA A;  4NXM Q;  2OQ0 A;  1N33 Q;  1GVP A;  5JJI A;  3ZJY C;  1QZH A;  5BR8 L;  1X56 A;  4KI0 A;  3ULL A;  1XPU A;  2KEN A;  4BBR G;  1NTG A;  5C3E H;  1VQP A;  1KD1 C;  4OON A;  4YWL A;  5FJ8 H;  4Y7N H;  1QUQ A;  4BBR H;  1D8L A;  1Z9F A;  4YHH L;  3KJO A;  3GTL H;  4O0A A;  4YCV A;  3CW2 C;  2VQE Q;  5C4X G;  2KHI A;  4DK3 C;  3DLL A;  1GM5 A;  2UUA L;  4DR5 Q;  1RIP A;  4DK6 C;  1MJE A;  1RL2 A;  3BZK A;  1XTD A;  3JAM i;  1U5K A;  4DAY B;  4LWC A;  1XNR L;  1VQ5 A;  3NEL A;  3TEH B;  3VDY A;  1VQM A;  2UXB Q;  4Y52 H;  1HZA A;  2K5V A;  4BA1 I;  3I55 A;  1IYJ B;  4BY1 H;  3KDF A;  2D62 A;  1M1K C;  4JV5 Q;  1UWV A;  3S24 A;  1TWA H;  5LMN W;  4IJL A;  3KLW A;  3G6E A;  2VUM G;  1U0L A;  4RG1 A;  4KLK A;  1B70 B;  1KC8 C;  3CPW A;  1X65 A;  2UU9 L;  1N32 L;  4BXX G;  2GVA A;  2I0Q A;  2CWA A;  3G48 A;  1N33 L;  1KL9 A;  5IWA Q;  4X64 L;  2VUM H;  1B7Y B;  3DM3 A;  1OXX K;  4XTC S;  4DR3 Q;  4O2D A;  4AIM A;  1L2F A;  2ALY B;  1JJ2 A;  1VQL A;  5HY6 A;  1SRO A;  4MZ9 A;  3KF6 B;  3M85 A;  1Q12 A;  2GVB A;  1EUJ A;  4P73 A;  2QEX A;  4QL5 A;  4UY8 C;  4JI4 L;  2WP8 J;  4AYB G;  2F4V Q;  4GKJ L;  1Y1V H;  1KXL A;  4AH6 A;  3L7Z C;  4ME3 A;  3IRB A;  4GLV B;  4DV6 Q;  1I6H H;  5GAE C;  4BY7 G;  2OTJ A;  2VZA A;  4X65 Q;  2AWO A;  2VQF Q;  3U50 C;  3CXC A;  3CQZ H;  4A3K H;  4PG3 A;  4JI5 L;  3SGI A;  4DR7 L;  3CAM A;  4AYB E;  5M5W H;  1VS0 A;  1YEZ A;  4BY7 H;  3CP0 A;  3PO2 G;  3GTP H;  1WI5 A;  4YWM A;  3OTO L;  2YU9 H;  1Z47 A;  1YJ9 A;  3PV0 A;  3RLF A;  1VQ7 A;  3FHW A;  1PH8 A;  1PH4 A;  2ZJQ A;  1FL0 A;  2EIF A;  2KHJ A;  5IY0 A;  5M3F G;  1T9H A;  2RCN A;  3STB C;  2ZM6 Q;  1W2B A;  2UUB Q;  3CC2 A;  2LXK A;  3E9H A;  4LNQ A;  3H0G G;  1Y1W G;  3PO2 H;  2BA1 A;  1EQR A;  3RR5 A;  1HR0 L;  1P16 A;  2R7D A;  3S1N H;  4YCW A;  2KCT A;  1E7Z A;  3PF4 A;  3NBH B;  1B8A A;  5M3F H;  4A93 G;  3KYH C;  1E1T A;  1I3Q H;  4JI8 Q;  3H3V I;  2I5L X;  1LTL A;  1Y1W H;  1MIU A;  3AFP A;  1JE5 A;  1UEB A;  3K80 C;  4C3J H;  2CCZ A;  2F4V L;  1OXV A;  2Q2H A;  4DV5 Q;  3PUV A;  5C0X I;  5IP9 H;  2ZTE A;  3S16 H;  3HOV H;  1VQO A;  2R7F A;  1XNQ L;  4JBW A;  4A93 H;  5GAG C;  1L1O B;  3T1Y Q;  3AFQ A;  1NE3 A;  2UUC Q;  2ID0 A;  4POG A;  1DGS A;  5AJ3 Q;  1XMQ L;  4LFA L;  3GO5 A;  4JI3 Q;  4DAM A;  2GN5 A;  1XMO Q;  1IBM L;  4IPC A;  4DV4 L;  2Y0S G;  4HJ8 A;  4HID A;  1XPO A;  1CSP A;  3RZD H;  2YYZ A;  2UUB L;  3UDF A;  2K52 A;  1PA6 A;  1K3R A;  1EIF A;  5GAH C;  2ZM6 L;  1IBK Q;  1AE2 A;  4DV7 Q;  2D0O A;  4LF4 Q;  1IXR A;  4HIM A;  5GRO A;  2Y0S E;  2JA8 G;  3HOY G;  2A19 A;  5C0X J;  3PF5 A;  2YTY A;  1FGU A;  1Q7Y C;  2JA5 G;  5LMN L;  1VQD A;  4IPD A;  1OXT A;  4DV3 Q;  4OX9 Q;  1VQE A;  4IO9 A;  3A74 A;  4YY3 Q;  4TQU S;  4JI0 Q;  3LGJ A;  2JA8 H;  3EIV A;  5E7N A;  1BBW A;  1VQN A;  3HOY H;  2JA5 H;  2HHH L;  2BA0 A;  3G4S A;  5GAD C;  4OWX B;  2OCE A;  4DR4 L;  4AQY L;  4BBS G;  1GKH A;  1K8G A;  2PQA B;  3F1Z A;  1X9N A;  4PZ7 A;  1LUZ A;  1E3P A;  1YZ6 A;  4A3D H;  4JI3 L;  1VQ4 A;  2IHE A;  4A4I A;  4JI6 Q;  4LF8 L;  4OXP A;  3J7Z C;  2FXQ A;  4L5Q A;  4YWK A;  3TRZ A;  1CKM A;  1C9O A;  1W3S A;  1HNX Q;  5JJL A;  1A8V A;  4QQB X;  4GKK Q;  2D0P A;  1HZ9 A;  1SR3 A;  4JI7 L;  4GN3 B;  4R4T A;  1K83 H;  4EX5 A;  4DV7 L;  5JEA J;  5M5Y H;  3TRE A;  3CF5 A;  5ELN A;  1E24 A;  4JI1 L;  4DPG A;  4HJA A;  4IFD I;  4APV A;  2VNU D;  5K36 G;  1N36 Q;  5C4X H;  1VQA A;  4NXN Q;  1Q82 C;  3J80 i;  1G6P A;  2E2J H;  4LFB Q;  3M4P A;  1QVG A;  3WWV A;  1PH6 A;  1TWC H;  1R9T H;  3PCO B;  1PV4 A;  2NN6 G;  3A5U A;  2N78 A;  4DV0 Q;  4LF9 L;  3GTQ H;  4DR6 Q;  4NXM L;  2UXC Q;  3HOX G;  1O7I A;  4A3E G;  3CC4 A;  4LF6 Q;  3FP9 A;  1KHI A;  4PZ6 A;  4A3G G;  1P8L A;  2MO0 A;  3RLN A;  4R1J A;  1PH1 A;  1NBW A;  2JK8 A;  3J81 j;  3I56 A;  3FKI G;  4A76 A;  2Z0S A;  3HOX H;  4DR7 Q;  3RNU A;  2N49 A;  4A3G H;  4H02 A;  4A3C G;  2OWO A;  1EOV A;  2VQE L;  3CCS A;  4BXX H;  2HIV A;  3GDE A;  1FVI A;  4PMW A;  4DR5 L;  3FKI H;  4IFD J;  2IY5 B;  1Q1E A;  1QVF A;  3M4O H;  4X66 Q;  3HKZ G;  5LMU Q;  4HJ5 A;  4LFC Q;  1J5E Q;  4DKA C;  2R7Z G;  3M3Y H;  4WJ3 M;  2XGT A;  1YI2 A;  3S2D H;  2R6G A;  1TWH H;  1E22 A;  4B3T Q;  2H5X A;  3W1B A;  4NXN L;  4GNX B;  5FLX c;  4L5R C;  1FJG Q;  4XIG S;  2UXB L;  4GLX A;  2QA4 A;  2JEB I;  2YTV A;  4R4I A;  3PUX A;  2JA9 A;  4JV5 L;  2MFI A;  2R7Z H;  3U58 A;  4KHP Q;  2A1A A;  1ASZ A;  3B6Y A;  3UDX A;  2VW9 A;  4K0K Q;  1D7Q A;  3HKZ E;  2CWP A;  4A3B G;  4HIK A;  4A3M G;  4DR6 L;  1V1Q A;  4LF6 L;  4DUY Q;  4JC0 A;  3M4Q A;  4P72 A;  3PSI A;  4JCV E;  2MNA A;  2E2I H;  4LF7 Q;  2Q2T A;  2Q2U A;  3J81 c;  1EIY B;  3KFU A;  5IWA L;  4DUZ Q;  4A3M H;  1VQG A;  4C3H H;  4DR3 L;  3HOW G;  1PHJ A;  2NVX H;  1A62 A;  3OW2 A;  2E8G A;  3CCL A;  1XPR A;  1E1O A;  4RMF A;  2CQO A;  3RLO A;  1CKN B;  4B3R Q;  2F3I A;  1HNZ Q;  2K5H A;  4DR2 Q;  1PVO A;  1NMG A;  3H0G H;  3S17 H;  4DV2 Q;  2A8V A;  1HNW Q;  3S15 H;  2F52 A;  3HOW H;  1NMF A;  4B3M Q;  1N9W A;  1UE6 A;  4DV6 L;  1J5E L;  3E0E A;  4JOI A;  2DUD A;  1I94 Q;  4C3I H;  3BU2 A;  1UE7 A;  4MTN A;  1M90 C;  2I5H A;  4X65 L;  3PGZ A;  2VQF L;  2L15 A;  3T1H Q;  4LF5 Q;  1L1O C;  5JJK A;  1VQH A;  2UXD Q;  3CMA A;  1VQB A;  1YVC A;  4JI2 Q;  4DR1 Q;  1KRS A;  3ULP A;  2NVQ H;  1SMX A;  1KAW A;  3HOZ G;  2NVY H;  5IYD G;  1OXS C;  3HKS A;  4BA2 I;  1VQJ A;  1MKH A;  2LXJ A;  3KF6 A;  3PUY A;  2R93 G;  2IX0 A;  3AYH B;  4HJ9 A;  4KHZ A;  1G29 1;  1S3O A;  1WCM G;  2BH2 A;  4LF7 L;  4JYA Q;  1QUQ B;  1PH5 A;  3D0F A;  3TQY A;  3M9B A;  2I5M X;  1N34 Q;  2ZTC A;  2R93 H;  1HZC A;  5C44 G;  3GTK H;  2RHQ B;  4GOP B;  4OO1 G;  1WCM H;  4UPA A;  1VQF A;  2PNH A;  4JI8 L;  5BR8 Q;  3NEN A;  1PH9 A;  1HNW L;  3K0X A;  4DV5 L;  4YCU A;  3TS0 A;  3RN5 A;  5FLM G;  3GTO H;  1I94 L;  3KDF B;  1X3G A;  1NY4 A;  2B29 A;  3T1Y L;  3UDI A;  3S1Q H;  2YV5 A;  3BJU A;  1ASY A;  2IT1 A;  3MXN B;  4YHH Q;  3GD7 A;  1KRT A;  2UUC L;  1JT8 A;  5AJ3 L;  2PI2 E;  4X62 Q;  4JI2 L;  3I4N G;  3PUW A;  5FLM H;  2QGQ A;  1JB7 A;  1S40 A;  1CSQ A;  3GTM H;  1Q46 A;  4P71 A;  3J7A 5;  1XMO L;  2E5L Q;  4P75 A;  1OXU A;  1K9M C;  2V1C C;  4OWW B;  1VCI A;  1XNR Q;  1Q8K A;  2HIX A;  1S72 A;  2JA6 G;  1HR0 W;  3EBE A;  1BVS A;  1SRU A;  3K7U C;  4LUO A;  1YBY A;  5ELO A;  3I4N H;  2MQH A;  3UE1 A;  1IBK L;  1PH7 A;  2DGY A;  3W1G A;  3S1R H;  4X6A H;  1GD7 A;  2AKW B;  1WJJ A;  4IPG A;  3F2B A;  5C3E G;  2OTL A;  4LF4 L;  1VQK A;  1VQC A;  1I5F A;  1L1O A;  3KJP A;  1KIX A;  4IPH A;  3OYY A;  2N8N A;  2JA6 H;  4GS3 A;  1MJC A;  5IYB G;  5FJ8 G;  2B63 G;  2JE6 I;  1OTC A;  3TS2 A;  4DV3 L;  1VQ8 A;  4GN5 A;  4OX9 L;  1K0R A;  1Q1B A;  1N32 Q;  2UU9 Q;  2KBN A;  1J6Q A;  1SE8 A;  1X6O A;  2LSS A;  4UP7 A;  2K14 A;  2MO1 A;  4HIO A;  4YY3 L;  2ZJR A;  4JI0 L;  1QVC A;  4X64 Q;  1Q81 C;  3K8A A;  2VY3 A;  1GO3 E;  3U4Z A;  3ICE A;  5IYB H;  2B63 H;  3F2C A;  3Q8D A;  3E9I A;  4IFD G;  2Z6K C;  1HZB A;  1X3F A;  4IOA A;  4A75 A;  4UP8 A;  3CCE A;  3ER0 A;  2NVT H;  3PUZ A;  4X62 L;  3W5O A;  3F2D A;  3CPF A;  4JOI C;  4QY7 A;  4BY1 G;  4JI4 Q;  4A3L G;  1QZG A;  4JI6 L;  4GKJ Q;  2WB1 G;  2NN6 I;  1EWI A;  2E5L L;  4GOP A;  1G51 A;  2JQO A;  2RHS B;  1NJI C;  4A3E H;  2K50 A;  1EQQ A;  3KOJ A;  1HNX L;  5C4J H;  1V9P A;  4GKK L;  2K4K A;  4A3L H;  3G71 A;  4JG2 A;  4UP9 A;  4JI5 Q;  1UE1 A;  2HT1 A;  3RZO H;  1CKO A;  2Q2I A;  1VQI A; 
#chains in the Genus database with same CATH topology
 4IJH A;  1A0I A;  1WTO A;  3KUP A;  3AQQ A;  4A3J B;  4NDX A;  3S14 B;  1B1Z A;  1W6K A;  1PDQ A;  2PQA A;  1X55 A;  1RTO A;  4QIW B;  1YIT A;  4KK7 A;  1Q90 A;  1LT6 D;  4BBS B;  1CZG A;  4CJ2 C;  4QJF A;  1EU4 A;  3D31 A;  4CBV A;  1Y1V G;  1KDB A;  2UXC L;  4LUZ A;  2C35 B;  1YNX A;  1HUM A;  2ASB A;  2WKD A;  1BCP D;  4FVM A;  2PMZ B;  4PNY A;  2HUG A;  2K33 A;  5T1G A;  2R92 G;  1SYC A;  3I72 A;  1WOC A;  3KF8 B;  2HCC A;  1V8Q A;  1YNN C;  1ILP A;  2K5Q A;  1BNZ A;  3CCM A;  2A74 C;  5IIF A;  1XMQ Q;  3C3L A;  5ELF A;  3UDG A;  4L5T A;  5KRU A;  2A73 B;  3D4R A;  2J0T D;  1SDF A;  1FJG L;  5M3M G;  4NPS A;  4QMG A;  5GQO A;  2EY6 A;  1EYD A;  2C9O A;  1TY0 A;  3ERS X;  5C0X G;  1H9J A;  5IP7 G;  2O2L D;  2A6H C;  3NWS A;  4Y7N B;  3MEF A;  4R4O A;  2AHO B;  2IL8 A;  3GTL B;  1B2T A;  4JPB W;  3HOZ H;  3DHQ A;  4J15 A;  4A3I G;  1K8A C;  5I6W A;  4GNX A;  2HHH Q;  1KTK A;  2RDF A;  3HOU G;  2ZXO A;  4J6H A;  4AQY Q;  4B3R L;  1HNZ L;  1BF4 A;  1LT5 D;  1NCV A;  1V1P B;  3E6Z X;  4QIW E;  1E2W A;  1SYB A;  2F0D A;  1K8M A;  3TP5 A;  1LT3 D;  4B3M L;  1ICW A;  1STE A;  4K2K A;  2Q8R E;  1LM0 A;  4WJ4 A;  4L5S A;  3UI2 A;  3BS1 A;  4OO1 I;  5TSS A;  3T1H L;  4A3F H;  3M7N A;  3D6W A;  1EY5 A;  4JI7 Q;  3EVQ A;  1V43 A;  2F0L A;  1SMY D;  2PMZ E;  3ITP A;  4JK1 C;  4DR1 L;  1UUP A;  1ESF A;  2UUA Q;  3CD6 A;  3E3X A;  1H95 A;  5JEA H;  3VYT A;  1BBU A;  1CTM A;  3CME A;  3V96 A;  3ULJ A;  4PZ8 A;  1KQS A;  2XTI A;  3A5Z B;  3GTJ H;  2NZH A;  4G7O C;  4K6D A;  1T5X D;  4CDF C;  1YHQ A;  4RHR A;  2JP1 A;  4I65 A;  4NXM Q;  2B2U A;  2JN4 A;  3ZJY C;  3J81 L;  3ND9 A;  2D9U A;  1CI3 M;  5BR8 L;  5FK9 C;  4AYB B;  1BO0 A;  1IW7 C;  4BBR G;  5C3E H;  1VQP A;  5J39 A;  1KD1 C;  4TSS A;  4BY7 B;  3OPO A;  2PYK A;  4DFA A;  4YWL A;  4RAU C;  2RBM A;  1D8L A;  4YHH L;  3KJO A;  4YCV A;  1STH A;  1SNP A;  2PZT A;  2UUA L;  1K8O A;  1X3Q A;  3VYS A;  1MJE A;  3P20 A;  4I7Z C;  2CW0 D;  1PZK D;  2Z8L A;  1IKL A;  3VDY A;  1YNJ D;  4KKS A;  2B2T A;  2QIL A;  4BA1 I;  3I55 A;  1IYJ B;  1T5E A;  4DNR B;  1QIL A;  3MEH A;  1KAB A;  1TWA H;  5LMN W;  3HOV B;  4DAV A;  2VUM G;  5EJW A;  3MXN A;  5JVG 3;  4KLK A;  2EYH A;  1CFM A;  1N32 L;  2GVA A;  2CWA A;  3ONA B;  3SEB A;  3DM3 A;  1FNV A;  1L2F A;  3FRP B;  3KF6 B;  3WDN A;  3NTK A;  2GVB A;  4P73 A;  5KNC A;  1HPC A;  2L1B A;  1Y1V H;  1KXL A;  3L7Z C;  3R8B A;  4GLV B;  3D4D A;  1KNA A;  2OTJ A;  4X65 Q;  2VQF Q;  3U50 C;  4DXG A;  3CXC A;  1S5C D;  4M1U B;  4MHE A;  3SGI A;  5I6Y A;  4AYB E;  1YEZ A;  3KLS A;  5F2D A;  4YWM A;  2RQX A;  3K5M A;  1I4Q A;  1LTB D;  1Z47 A;  5CBE E;  1VQ7 A;  3FHW A;  1PH8 A;  3CKI B;  5IY0 A;  1SYE A;  5G3L D;  1O7L A;  1W2B A;  4DAY A;  1EYC A;  4C3J G;  1EQR A;  3NTH A;  2Z4H A;  3PMF A;  2R7D A;  1E7Z A;  2NWG A;  5M3F H;  3AU7 A;  1I3Q H;  4JI8 Q;  4G7H C;  3H3V I;  1Y1W H;  1MIU A;  1JE5 A;  1XX8 A;  3WOE A;  1TS4 A;  5M5Y B;  1OXV A;  3A7A B;  3S16 H;  2Z9H A;  1Y69 U;  1ICF B;  4A93 H;  4JBW A;  1VDZ A;  5GAG C;  3T1Y Q;  5NUC A;  1CQV A;  5IGG A;  2E2J B;  3PIP 3;  5AJ3 Q;  1KDC A;  3GO5 A;  1SMY C;  1R9T B;  1XMO Q;  4NW2 A;  4DV4 L;  2B2T C;  3GTQ B;  2HCI A;  3SK8 A;  1BOS A;  1JWU D;  3UDF A;  1AEX A;  4IUT A;  2KEC A;  4DV7 Q;  3IKJ A;  4LF4 Q;  3K5L A;  2LKV A;  3HOX B;  1GUN A;  1II3 A;  1BCP F;  1VQE A;  3DEP A;  2V4D A;  2X69 A;  3M4O B;  2JA8 H;  5E7N A;  3HOY H;  2JA5 H;  2BA0 A;  5HUR A;  1D1I A;  1W6J A;  1VMC A;  1K8G A;  4WFN 3;  3L9A X;  3F1Z A;  1WTW A;  2B2Y A;  4PZ7 A;  3VR5 A;  1YZ6 A;  4A4I A;  3HKZ B;  4OXP A;  1EY6 A;  3J7Z C;  2CW0 C;  3IL8 A;  5KGU A;  4GKK Q;  1YNJ C;  3KBG A;  1I6V C;  5E4W C;  4GN3 B;  1JWS D;  1K83 H;  2E2I B;  4DV7 L;  3QOJ A;  3IFT A;  3TRE A;  5ELE A;  3A55 A;  3MFG A;  1LV9 A;  5D3I B;  1V1P A;  5K36 G;  1M4V A;  4NXN Q;  1Q82 C;  3J80 i;  4LFB Q;  3M4P A;  4M8A A;  3S15 B;  3BVG A;  3QG1 A;  1TWC H;  4B9X A;  4O1N A;  4C3I B;  4DR6 Q;  4IUV A;  1EIG A;  4FF2 A;  3CC4 A;  4LF6 Q;  2QKI C;  4A3G G;  1P8L A;  3RLN A;  4R1J A;  2F0F A;  1E2Z A;  4C1N I;  2NVQ B;  1EY9 A;  3AB9 A;  1MSH A;  3Q24 A;  3RNU A;  1EY4 A;  4H02 A;  3MXU A;  4ZRZ A;  1ONL A;  1MD2 D;  2VQE L;  3QWN A;  3GDE A;  4PQX A;  4PMW A;  4IFD J;  3TSS A;  1QVF A;  1B9N A;  4KHV A;  1K0S A;  1B53 A;  2RDH A;  2R93 B;  5LMU Q;  4HJ5 A;  3OOC A;  1G91 A;  1GHK A;  2WII B;  4H44 C;  1YI2 A;  3I90 A;  2R6G A;  2J7Z A;  3W1B A;  4B3T Q;  4NXN L;  5FLX c;  4XIG S;  4GLX A;  1I4P A;  4KKT A;  3PUX A;  2JA9 A;  4JV5 L;  5CV5 A;  1D7Q A;  2VW9 A;  3HKZ E;  2VB2 X;  4A3B G;  4DR6 L;  1Y8N B;  4XT1 B;  4LF6 L;  4JC0 A;  3M4Q A;  4OL7 A;  2K6A A;  4NKL A;  4CJ0 B;  2K03 A;  3HRZ C;  4ZCK A;  4LF7 Q;  1IHZ A;  1S5F D;  4DR3 L;  1A62 A;  1GUO A;  3CCL A;  1HHV A;  1LLR D;  2BCO A;  4IUN A;  3H94 A;  2NTT A;  2F3I A;  1QWY A;  1PVO A;  4DR2 Q;  2XWB B;  2A8V A;  1HNW Q;  3HOW H;  2G9H D;  1Z6H A;  1I94 Q;  3MWY W;  4CDE C;  1M90 C;  2JA6 B;  1HQR D;  2UXD Q;  1HA6 A;  3WOF A;  1YVC A;  2J4X A;  1NUC A;  3ULP A;  2VB3 X;  3KF6 A;  2LXJ A;  1I4G A;  1PRT D;  2B63 B;  4LK1 C;  2KCC A;  4KHZ A;  1G29 1;  1R4Q B;  1S3O A;  4JYA Q;  4LF7 L;  2SOB A;  3DWA A;  2ZTC A;  1L0Y B;  1GOZ A;  4BS9 A;  5L37 A;  3X3N A;  2IWH A;  1SE2 A;  2RHQ B;  4UPA A;  2NTS A;  2PNH A;  3NEN A;  2PW5 A;  3RZO B;  2WB1 B;  4E6I A;  3E5S A;  1HNW L;  2KUM A;  4DV5 L;  1PLF A;  3RN5 A;  1I94 L;  3PQI A;  4H7B A;  4OO1 H;  3S1Q H;  3BJU A;  2EDG A;  2UUC L;  1TKW B;  3GD7 A;  4X62 Q;  3I4N G;  3PUW A;  5FLM H;  2QGQ A;  1JR0 D;  4P71 A;  5FLX L;  3J7A 5;  1TWG B;  2EPB A;  3NQI A;  1K9M C;  2ICE C;  1VCI A;  1XNR Q;  5EBC A;  1Q8K A;  2FJ2 A;  2HIX A;  1S72 A;  3PO3 B;  2K28 A;  5CR3 A;  1UEA B;  1GUG A;  5G3L F;  2DGY A;  3S1R H;  1HRJ A;  4X6A H;  1WJJ A;  4IPG A;  4TRD A;  2OTL A;  1SSO A;  1KIX A;  4IPH A;  2N8N A;  5ELC A;  4DV3 L;  4GN5 A;  1K0R A;  3OWF A;  1KAA A;  4FO2 A;  1N33 Q;  2K14 A;  4YY3 L;  2JA7 B;  3MHB A;  4N9T A;  3S9W A;  5IYB H;  1HZB A;  1X3F A;  3TN2 A;  5EPK A;  4X62 L;  4JI4 Q;  2EY5 A;  2NZ1 D;  1CA5 A;  1SNC A;  3K5O A;  1S4Z A;  2K50 A;  4XQQ A;  4FF1 A;  1WVL A;  1LTT D;  4A3L H;  1BXT A;  1WTP A;  3SVM A;  4UP9 A;  4JI5 Q;  2DJG C;  2WB1 E;  3QO2 A;  1U9R A;  4FXG C;  1K73 C;  1QCB D;  3L2P A;  1N36 L;  1PFS A;  2E2H B;  1D2B A;  2D2C C;  1HJP A;  1C7Y A;  3V05 A;  4ALP A;  1EYG A;  2FHT A;  5C44 B;  4N8X 1;  4QUF A;  4QGU A;  2JEA I;  4OWT B;  4J1M A;  5CV8 A;  2F0M A;  3S2H B;  3BVZ A;  2B39 A;  4L8J A;  1H9S B;  4A3B H;  1A3T A;  4QF4 A;  2CFM A;  1PYS B;  1XTC D;  3V2T A;  1SLJ A;  3I4O A;  3I4M B;  1TWF B;  5M5X H;  1I50 B;  3RN2 A;  4LFA Q;  2WAQ G;  2Z6K A;  2XNA C;  1M8A A;  1IBM Q;  4JBM A;  3P75 A;  1CQF A;  1PRT C;  2RF4 A;  5IGE A;  3MC0 B;  2PZW A;  5C5L A;  5KIX A;  4R4C A;  3LWU A;  5LL6 S;  3F8T A;  1HA5 A;  1L0W A;  4KHP L;  1KDA A;  4FF4 A;  4ZAI A;  1SN8 A;  4RGN A;  3I91 A;  5FLX E;  5HGQ A;  2YTX A;  4RH6 A;  3HOV G;  4ID6 A;  4P74 A;  3H3V H;  2OF1 A;  1AZP A;  2ES2 A;  3BZC A;  5IOC A;  1LTR D;  3CCJ A;  2OEO A;  2ZXP A;  4V0B A;  1I4R A;  5IYC H;  3S14 H;  4RGM A;  4A3J H;  3TP6 A;  1DOL A;  3HEJ A;  4HR7 B;  4OIJ A;  4DR4 Q;  4FDB A;  2F0J A;  4POF A;  4A3F G;  3HFZ B;  4B9W A;  5T1I A;  4LF8 Q;  4BBS H;  3MVV A;  3J81 i;  3CU7 A;  2ATW A;  1N8R C;  1UE5 A;  5I9P A;  4JBJ A;  5JEA G;  1A6X A;  3Q23 A;  3VR2 A;  4X3U A;  3KK7 A;  4R8N A;  1YHB A;  3EA6 A;  4HJ7 A;  3QR8 A;  1WFQ A;  1JMC A;  4HCE A;  3CCQ A;  5LL6 X;  2JJQ A;  4JBK A;  3I2Z A;  1FYC A;  2CQA A;  1VF7 A;  4A3D G;  2SNM A;  1CHQ D;  1XXG A;  2E2D C;  1I6H B;  3I7F A;  1NAP A;  4LF9 Q;  1TWH B;  5JJI A;  4CDC C;  3CQZ B;  1X56 A;  4KI0 A;  2H4O A;  1XPU A;  1NTG A;  5M5W B;  1STN A;  3GTP B;  4OON A;  2DNE A;  3VA5 A;  4Y7N H;  2HQE A;  3GTL H;  4O0A A;  3JAM E;  4DAP A;  2Z1C A;  1B9M A;  2KHI A;  1DCZ A;  4DK3 C;  3DLL A;  4CDD C;  4DR5 Q;  3PO2 B;  4DK6 C;  1RL2 A;  3BZK A;  3S1N B;  1D1K A;  4DAY B;  4LWC A;  2DY7 A;  2M9V A;  5M9O A;  2QW7 A;  3EFX D;  1HZA A;  3H0G B;  3OIP A;  2K04 A;  1M1K C;  1UWV A;  3S24 A;  2Q8T A;  2KEE A;  3SK6 A;  3NBI A;  2XRQ D;  3NK9 A;  2QEJ C;  1EWC A;  3K58 A;  1B70 B;  4P2C B;  3CPW A;  2UU9 L;  2WKC A;  1KL9 A;  4MIU A;  4O2D A;  2C5C A;  4AIM A;  2ALY B;  1VQL A;  3RZD B;  3K57 A;  1EUJ A;  5CBA E;  4QL5 A;  2PQE A;  5DAU A;  2F4V Q;  1K28 A;  2Y0S B;  3T56 B;  4AH6 A;  1C4Q A;  4ME3 A;  2PNR C;  5GAE C;  3J7Y W;  1WTQ A;  2AWO A;  1ROD A;  5DM6 3;  3Q0A A;  1SYD A;  5I9O A;  3VR4 A;  1B50 A;  4BY7 H;  2KED A;  3BVM A;  3LNN A;  3RLF A;  1GUS A;  1FNU A;  5CMD A;  2ZJQ A;  4G57 A;  5M3F G;  2RCN A;  2LXK A;  3T51 B;  4LNQ A;  3FVQ A;  1Y1W G;  1F77 A;  3TME A;  2PW7 A;  1AW7 A;  4KJN A;  3MAQ A;  4A93 G;  3GV6 A;  1Q8I A;  1OO9 B;  3K80 C;  4FP5 D;  2F4V L;  1QJO A;  4ODG A;  1QG7 A;  2ZTE A;  3HOV H;  1QB5 D;  4ILW A;  3NQT A;  5C4X B;  2ID0 A;  1XMQ L;  5JJZ A;  5AFW A;  4JI3 Q;  1BUV T;  1Z7T A;  2K7V A;  3LX0 A;  3URY A;  1ENC A;  2BDO A;  1PA6 A;  1K3R A;  1EIF A;  1H9S A;  1AE2 A;  1E2V A;  1MBY A;  1IXR A;  2Y0S E;  2JA8 G;  3HOY G;  3H09 A;  5C0X J;  2YTY A;  1Q7Y C;  2JA5 G;  1VQD A;  3VA7 A;  3VR6 A;  3FKI B;  4HSP A;  4RHS A;  1AP0 A;  3EIV A;  4EGV A;  1BBW A;  3M3Y B;  3TZU A;  2HHH L;  3BDL A;  1LAC A;  1LT4 D;  3C1F A;  2OCE A;  2XVS A;  4WRD A;  1MSG A;  2IX3 A;  4AQY L;  1X9N A;  1E3P A;  4A3D H;  4JI3 L;  2R7Z B;  5CV7 A;  2XWJ B;  1BBX C;  4X3K A;  1HNX Q;  4QQB X;  2D0P A;  1EEI D;  4RWS C;  4JI7 L;  4R4T A;  4EX5 A;  2PO4 A;  3A54 A;  5M5Y H;  5CV4 A;  4A3M B;  5ELN A;  4C3H B;  4LJZ C;  3D8G A;  1FD7 D;  4HJA A;  1SXT A;  1QE6 A;  4IFD I;  2VNU D;  5I2X A;  2E2J H;  3S17 B;  3RMH A;  1QVG A;  5FKA C;  2E74 C;  1R9T H;  3PCO B;  2DNC A;  3TDQ A;  3A5U A;  4DV0 Q;  3GTQ H;  4NXM L;  1PXU A;  1O7I A;  1EY0 A;  3FP9 A;  3NUC A;  1NBW A;  2JK8 A;  3J81 j;  4A76 A;  1TVX A;  1A3V A;  3HOX H;  3RD4 A;  4ZKC B;  1SBB B;  1EFI D;  5CC4 A;  5EPL A;  1EZ6 A;  2OWO A;  3J7A V;  4UDU C;  4ULL A;  5DM7 3;  3HOZ B;  1FVI A;  3K6O A;  1HUN A;  3M4O H;  4X66 Q;  1PFN A;  4KD4 A;  4LFC Q;  4WJ3 M;  4DKA C;  3GTK B;  2O5J C;  2F0W A;  1SJE D;  1WCM B;  5KNB A;  2WIN B;  3DMU A;  3C2P A;  4CJ1 B;  2QA4 A;  2JEB I;  3J7A F;  2YTV A;  4R4I A;  1WTH A;  1KNE A;  2A1A A;  4K0K Q;  3B6Y A;  2EZV A;  1JB3 A;  1LTG D;  4F87 A;  4DUY Q;  4P72 A;  5CGK A;  3PSI A;  4JCV E;  4CGY B;  2MNA A;  2E2I H;  4EQP A;  2HDM A;  2Q2U A;  1EIY B;  2N88 A;  4DUZ Q;  1B3Q A;  3HOW G;  1PHJ A;  2FMC A;  2CQO A;  4ZKB B;  1CKN B;  2B2V A;  3SDZ A;  5KND A;  4DV2 Q;  3EQL C;  3S15 H;  2F52 A;  1PRT B;  1N9W A;  4JOI A;  4C3I H;  1UE7 A;  3O13 A;  4X65 L;  2VQF L;  4LF5 Q;  4JW0 A;  1L1O C;  5JJK A;  1VQH A;  5C3E B;  5ELB A;  1VQB A;  3CMA A;  1KRS A;  2NVQ H;  1VMP A;  1SMX A;  1OXS C;  3KLR A;  2IX0 A;  1TS3 A;  3M7G A;  1QUQ B;  1N34 Q;  2R93 H;  4N8F A;  4A3E B;  5C44 G;  3VR3 A;  5IOD A;  5C4J B;  4OO1 G;  1VQF A;  4C1N K;  4JI8 L;  5E3F A;  3OSO A;  1CT1 D;  1PYW D;  5K5P A;  5FLM G;  1X3G A;  3T1Y L;  1QNK A;  3UDI A;  2RSN A;  2IT1 A;  5AJ3 L;  2PI2 E;  4OIK A;  5IGB A;  2EYF A;  1S40 A;  1CSQ A;  5J1Z A;  1Q46 A;  1XMO L;  1AFP A;  1ZYR D;  4KN4 C;  4IUR A;  1Y8P B;  1JIC A;  3K7U C;  5ELO A;  2MQH A;  3UE1 A;  3W1G A;  2F0E A;  2AKW B;  1SE4 A;  3QJY A;  4LF4 L;  1VQC A;  1I5F A;  4UAI A;  3KJP A;  4ZK9 B;  2JA6 H;  4GS3 A;  5JVH 3;  2F0K A;  4HSV A;  5IYB G;  5FJ8 G;  1GJX A;  2SEB D;  1FR3 A;  1JWM D;  4KY6 A;  3TS2 A;  2R92 B;  1J6Q A;  1X6O A;  2F0U A;  2CVR A;  2MO1 A;  4HIO A;  1QVC A;  4X64 Q;  3K8A A;  5CV6 A;  3U4Z A;  3ICE A;  2B2V C;  2B63 H;  4K5X A;  3Q8D A;  4IFD G;  4ZUI A;  3MA2 B;  3PUZ A;  4WOR A;  4JOI C;  4A3L G;  4GKJ Q;  1SND A;  2NN6 I;  2F4I A;  3HP3 A;  1LTA D;  2JQO A;  2RHS B;  4N9P A;  5M3M B;  1JQY D;  2JYO A;  2K4K A;  4GKK L;  4JG2 A;  3RZO H;  1ZXT A;  4DR7 Q;  3W3A A;  3A56 A;  2L12 A;  1VQI A;  4IOC A;  1G6Z A;  5IE8 A;  2ZJP A;  3OTO Q;  1SFO B;  3U4V A;  3S1M B;  4LFB L;  4I7A A;  4K5V A;  1NR4 A;  4A3I B;  1PFB A;  1EFW A;  1L0X B;  1LYL A;  5FO8 B;  2Z4I A;  1HR0 Q;  1TWG H;  3HOU B;  2EQS A;  2CKZ B;  3LWE A;  2WAC A;  1C48 A;  1YIJ A;  3PO3 H;  3T16 A;  4K8I A;  1S5E D;  2XRS D;  3H91 A;  4DV1 Q;  1C0A A;  3L0O A;  4DNI A;  5JPM C;  3UE0 A;  4B3S Q;  1H9R A;  3SK4 A;  3PIO A;  1TU2 B;  1XNQ Q;  5HGT A;  1X54 A;  4C2M B;  1DOK A;  3K81 C;  3K7A B;  4HTH A;  4IUQ A;  1ET6 A;  2HQL A;  3ZYY X;  3GTG B;  5EAY A;  2PZU A;  1Q86 C;  2JA7 H;  5LMU L;  3CCU A;  1IBL Q;  4B3T L;  1C8C A;  3A8K E;  3NTI A;  2AWN A;  5IP9 G;  3KBX A;  2SDF A;  5IYC G;  4A3J G;  2EYL A;  1SEB D;  2JXM B;  4BBR B;  1MI2 A;  2EVB A;  3FPU B;  5LMN Q;  3STB D;  2ZXR A;  3MXG A;  2ZT9 C;  4QB4 A;  2K05 A;  2NZO A;  4DV1 L;  2X6L A;  4B3S L;  1YJW A;  4BBS G;  1D5X C;  4GLA C;  5DNF A;  1F2L A;  3OW7 A;  3A0J A;  2EXD A;  3U9S A;  4DR2 L;  2E2H H;  4BY1 B;  1IZ6 A;  2QDL A;  4QCL A;  5EKK A;  4UHV A;  1CK1 A;  3JAM c;  3AEV A;  3ERQ A;  5C44 H;  2PI2 A;  5FO7 B;  1ZYR C;  4HMI A;  1IBL L;  3J80 c;  1PH2 A;  4NB3 A;  5BN4 A;  2XN9 C;  4Q0F A;  3S2H H;  2UXD L;  1ILQ A;  1EOT A;  1IL2 A;  5DLQ E;  5H1S E;  2VUM B;  2AMC B;  4JI1 Q;  2CHB D;  1CKN A;  2LY7 A;  2VS1 A;  3GV3 A;  4KN7 C;  3H15 A;  3PIO 3;  1STB A;  4DF7 A;  3I4M H;  4JYA L;  1TWF H;  1I50 H;  1TXY A;  2K1B A;  3JC6 6;  1V1O A;  4EQN A;  1YHA A;  4MN3 A;  1QZH A;  4A3K B;  4KV6 A;  2KEN A;  1JOQ A;  3KLS X;  1SJH D;  5BN5 A;  2YU9 B;  2I46 A;  3NE5 B;  1WTV A;  2F0Q A;  5FJ8 H;  5KYL A;  1QUQ A;  3AMU A;  4Z9C B;  3OWE B;  3CW2 C;  1RDP D;  3H6M A;  5C4X G;  2F1M A;  2OXP A;  1XTD A;  1BDO A;  4IFD H;  1U5K A;  2EYO A;  1XNR L;  2TMP A;  3NEL A;  1VQM A;  2UXB Q;  4RA8 A;  2K5V A;  1BQQ T;  4C3J B;  1WTR A;  4IUP A;  4K2L A;  2D62 A;  4CHT B;  2EYM A;  3DUZ A;  3OIQ A;  3KLW A;  4IUU A;  3G6E A;  3W2D A;  1DZ1 A;  3MXP A;  1KC8 C;  4BXX G;  2I0Q A;  2NYZ D;  3R93 A;  1N33 L;  5IWA Q;  1KLG D;  1EY7 A;  4XTC S;  3L3O C;  3M85 A;  3K5N A;  3JAM L;  2QEX A;  2JSO A;  4UY8 C;  4JI4 L;  2WP8 J;  4AYB G;  3J80 L;  2SNS A;  3IRB A;  4F8M A;  4DV6 Q;  1I6H H;  4BY7 G;  3CQZ H;  4JI5 L;  2Q8I B;  3N52 A;  5M5W H;  4L6T B;  1SNQ A;  1VS0 A;  3GTP H;  1WI5 A;  1JCK B;  4C3H G;  2DN8 A;  4K8J A;  1YJ9 A;  4H0L C;  5EQ0 A;  1PH4 A;  1FL0 A;  2UUB Q;  1O7Y A;  3STB C;  3E9H A;  3PO2 H;  2X6G A;  1IKM A;  3RR5 A;  5D65 A;  1P16 A;  2B8G A;  3S1N H;  2KCT A;  3A7L A;  3KYH C;  1E1T A;  4Q5V A;  4G7Z C;  1LTL A;  3AFP A;  1UAP A;  2CCZ A;  1G2T A;  2Q2H A;  3HG9 A;  5C0X I;  5IP9 H;  5FOB B;  4FF3 A;  2L55 A;  1VQO A;  1L1O B;  3AFQ A;  1PMR A;  5I4D A;  1D6E C;  4LFA L;  1DYQ A;  3FDT A;  3K59 A;  1IBM L;  1SYF A;  2LMC B;  4HID A;  1DXM A;  1JOR A;  5COR A;  1CSP A;  3RZD H;  1B44 D;  2RCF A;  2YYZ A;  2UUB L;  1FGB D;  2BOS A;  5GAH C;  1TY2 A;  2EYJ A;  1IBK Q;  4FNF A;  1HFN A;  5EKL A;  4A3G B;  2A19 A;  2RA4 A;  3PF5 A;  2KJX A;  1OXT A;  1HXY D;  4RGO S;  4OX9 Q;  4IO9 A;  2R3Z A;  2CH4 A;  3A74 A;  4JI0 Q;  4PV1 C;  1ENF A;  5ISR A;  3DEO A;  5A35 A;  3S2D B;  2L0C A;  4OWX B;  1PTO B;  3Q6S A;  4DR4 L;  1LUZ A;  4CKB A;  2KHS A;  1VQ4 A;  2IHE A;  3G6J B;  3GP7 A;  4JI6 Q;  4LF8 L;  2FXQ A;  4L5Q A;  4YWK A;  1CKM A;  1C9O A;  1I4X A;  1NSN S;  4HCS A;  4KMU C;  5JEA J;  2RDG A;  2A69 C;  4F7X A;  3J80 E;  2RKS A;  2NVX B;  2IW3 A;  4K6L A;  2F0H A;  1PRT F;  4KY7 A;  5C4X H;  3R2T A;  4BWG B;  1PH6 A;  2N78 A;  3FPP A;  4LF9 L;  4HED A;  2UXC Q;  1JOK A;  3HOX G;  4A3E G;  1SE3 A;  1G2S A;  1KHI A;  4OEM B;  4PZ6 A;  2MO0 A;  4LAA A;  1PH1 A;  2NN6 H;  2NVY B;  2M2L A;  3I56 A;  3IAY A;  3QB3 A;  4DK0 A;  1MHW C;  4A3C G;  3CCS A;  2EYP A;  4BXX H;  3ND8 A;  2HIV A;  3M4Y A;  4DR5 L;  3FKI H;  1Q1E A;  1GUW A;  1TS5 A;  3HKZ G;  3M3Y H;  1NNX A;  3OHX C;  4DXF A;  2XGT A;  1E22 A;  2H5X A;  1FJG Q;  3NSW A;  5IGF A;  1RF2 D;  5E4X A;  4WJW A;  3G7L A;  2R7Z H;  4RCN A;  3U58 A;  3GTO B;  4PMB A;  3UDX A;  3P7J A;  2CWP A;  4NP5 A;  3Q22 A;  1EEF D;  2IJ0 A;  3DWP A;  2A5H A;  4CKE A;  3BYT B;  2Q2T A;  3J81 c;  1AN8 A;  2F3V A;  3GTM B;  3KFU A;  4GZY C;  4A3M H;  3I3C A;  2EJG C;  4C3H H;  3N6R A;  2E8G A;  3CRK C;  1XPR A;  4C3I G;  5JAV A;  3D6C A;  4C56 C;  3I4N B;  2AQ3 B;  4B3R Q;  1HNZ Q;  2K5H A;  3F2U A;  1NMG A;  3S17 H;  4IN3 A;  4RKL A;  1R4P B;  1NMF A;  1RD9 D;  2TSS A;  3DWQ A;  4B3M Q;  1UE6 A;  3E0E A;  3I73 A;  2I5H A;  3VYU A;  3PGZ A;  5A2Q E;  4HAE A;  3T1H Q;  3SR1 A;  4JI2 Q;  4DR1 Q;  2CH4 W;  1D5M C;  4ZUJ A;  3OMC A;  5IYD G;  3HKS A;  1MKH A;  5IGD A;  2R93 G;  1LO5 D;  2KOL A;  3AYH B;  2G5D A;  1TQO A;  1O78 A;  2NVT B;  2F0P A;  4RFB A;  1U4P A;  2A68 D;  1A15 A;  2I07 B;  3M9B A;  4DNT B;  2B2W C;  1K3B C;  2K5D A;  1F9R A;  1HZC A;  3GTK H;  1F2M A;  1WCM H;  4U68 A;  1PH9 A;  5BR8 Q;  3NHH A;  5IGC A;  2ICI A;  3KDF B;  2EE1 A;  1SYG A;  1NY4 A;  2Z6B A;  2B29 A;  3T53 B;  2YV5 A;  1ASY A;  4YHH Q;  1ET9 A;  2XIW A;  1JT8 A;  4JI2 L;  2O4X A;  1JB7 A;  4DGZ A;  2E5L Q;  4P75 A;  2D5D A;  5C4Z A;  2V1C C;  2JA6 G;  1F9S A;  1HR0 W;  3EBE A;  1BVS A;  4LUO A;  1YBY A;  1IL8 A;  1PTO D;  5ELD A;  1PH7 A;  4FXD A;  1GD7 A;  3F2B A;  1L1O A;  1NR2 A;  3OYY A;  2F0T A;  1MJC A;  1EZ8 A;  2B63 G;  2JE6 I;  1OTC A;  1VQ8 A;  3BDO A;  1N32 Q;  4RGT A;  3NWT A;  1SE8 A;  4ZQ3 A;  3MZ5 A;  1STA A;  3HZX A;  2VY3 A;  1GO3 E;  3F2C A;  4A75 A;  2WAQ B;  3CCE A;  1TII D;  4DA2 A;  3W5O A;  2NBF A;  3CPF A;  2KVM A;  2RVL A;  4BY1 G;  1QZG A;  2WB1 G;  2E5L L;  4GOP A;  1O7Z A;  1NJI C;  4A3E H;  2BE5 D;  2F0I A;  1EQQ A;  1HNX L;  3TZD A;  2B8F A;  5C4J H;  1V9P A;  2HT1 A;  3I4L A;  1CKO A;  2Q2I A;  1XJV A;  4IQZ A;  1EU3 A;  4KTA A;  1Y8O B;  3EN2 A;  4A3C H;  1BCP C;  2WFW A;  4TKO B;  3PIP A;  3PO3 G;  4GNX C;  2VL6 A;  4HN7 A;  1HCZ A;  4DV0 L;  4EQ5 A;  1VQ6 A;  1GHJ A;  2AQ2 B;  3NEM A;  4A3F B;  4R4Q A;  1JJG A;  2N55 A;  2IX1 A;  4A3K G;  3CC7 A;  1VF5 C;  3EJI A;  4LW1 A;  2IHF A;  1RJT A;  4KY5 A;  2B3G A;  4MNO A;  2MUY A;  1E0B A;  2JA7 G;  3CCV A;  2R92 H;  3GTJ B;  1AH9 A;  2PPB C;  2P5Z X;  4NMZ A;  4X66 L;  4LFC L;  4DV4 Q;  5C3W A;  1VQ9 A;  1YJN A;  1XYI A;  1X3E A;  1S5B D;  4GN4 B;  4A3D B;  1RCV D;  2WAQ E;  2A68 C;  4RKB A;  1PYB A;  2B2U C;  4K0K L;  2BH8 A;  5D3D A;  4L63 B;  3CCR A;  5M3M H;  2N3S A;  4DUY L;  2PCF B;  5C6A A;  1CA6 A;  2K5N A;  4IZ8 A;  4TVA B;  5IT9 c;  5C0X H;  1A2U A;  4LUV A;  5IYD H;  1A63 A;  4DUZ L;  5IP7 H;  4V19 0;  4J8Q A;  1Y14 B;  1PH3 A;  5J3B A;  1DON A;  1SFO H;  3J81 E;  2OQK A;  4QUC A;  4GOP C;  1PZJ D;  3S1M H;  4DV2 L;  4A3I H;  5D14 A;  3E0J A;  1TWA B;  4DK1 A;  2EJF C;  3SE0 A;  3HOU H;  4K5W A;  1DOM A;  1JE4 A;  3X3M A;  4LF5 L;  1ENA A;  2H1E A;  3KF8 A;  1PTO C;  3I4M G;  2KCM A;  3FEW X;  4S3S A;  2L5T A;  1IYU A;  4ZYS A;  2ZTD A;  4U67 3;  1Q3L A;  4C2M H;  3K7A H;  3GTG H;  3C1E A;  1QOH A;  1WYD A;  2K75 A;  2WV6 D;  1Y1V B;  1JJC B;  1BKB A;  5BN3 A;  1CHP D;  1N34 L;  1AE3 A;  3SHL A;  1CUK A;  1HH2 P;  5CV9 A;  4CKC A;  2OQ0 A;  2NB0 A;  1GVP A;  3NPP A;  2F0N A;  3ULL A;  2RSO A;  1WD0 A;  1EYA A;  5C3X A;  3TP8 A;  3TBI B;  2R61 A;  4JVZ A;  1B3A A;  2BE5 C;  1TS2 A;  2GA4 B;  4BBR H;  1Z9F A;  1RKN A;  2VQE Q;  1DM0 B;  1GM5 A;  1F9P A;  1RIP A;  1HQM C;  3JAM i;  1WD1 A;  5M3F B;  1VQ5 A;  3TEH B;  4Y52 H;  3TP7 A;  1I3Q B;  1Y1W B;  4BY1 H;  3H3V C;  3KDF A;  4JV5 Q;  1TT2 A;  3S16 B;  3BYY B;  2F0O A;  4IJL A;  1EIH A;  4A93 B;  5IT9 L;  1U0L A;  4RG1 A;  2E75 C;  1J8I A;  1X65 A;  4DU9 A;  1LTI D;  3G48 A;  4KD3 A;  4X64 L;  2VUM H;  1B7Y B;  1OXX K;  3FMC A;  4DR3 Q;  3HGB A;  3IFD A;  1JJ2 A;  2F0V A;  5HY6 A;  1SRO A;  3QIA A;  4MZ9 A;  1Q12 A;  3BDC A;  2F3W A;  4ZLT F;  4GKJ L;  2L9H A;  2VZA A;  1ESR A;  4A3K H;  4PG3 A;  4DR7 L;  3CAM A;  3I70 A;  1PTO F;  2F0G A;  2FMM A;  2JA8 B;  3HOY B;  3CP0 A;  3PO2 G;  2YU9 H;  3OTO L;  2JA5 B;  2FFK B;  3PV0 A;  2MP1 A;  1DD2 A;  1SNO A;  2EIF A;  2KHJ A;  1T9H A;  3CC2 A;  2ZM6 Q;  1KLU D;  3H0G G;  2BA1 A;  1HR0 L;  2B2Y C;  2QF7 A;  2FIN B;  4YCW A;  1HTL D;  3PF4 A;  3NBH B;  1B8A A;  2LFN A;  1TR5 A;  2I5L X;  4XYQ A;  1K83 B;  1LAB A;  1UEB A;  4C3J H;  4DV5 Q;  3PUV A;  3MFY A;  2R7F A;  1XNQ L;  1GUT A;  2A6E D;  2MHV A;  1NE3 A;  1U4R A;  2UUC Q;  3SXH A;  1MGS A;  1DGS A;  3P1H A;  4POG A;  4FYD A;  4XT3 B;  1TWC B;  2MJ8 A;  4DAM A;  5DEH A;  4X3T A;  2GN5 A;  4IPC A;  2Y0S G;  4HJ8 A;  1XPO A;  1QNU A;  2IPK D;  2K52 A;  3CHB D;  2ZM6 L;  1WTX A;  4MTK A;  4KKU A;  5EPJ A;  2D0O A;  4HIM A;  5GRO A;  1HFG A;  1FGU A;  3D4W A;  5LMN L;  4IPD A;  4H13 C;  4DV3 Q;  4XQJ A;  4XDX A;  2AUK A;  5KYI A;  4YY3 Q;  4TQU S;  3LGJ A;  2L11 A;  1VQN A;  3CRL C;  4OEL B;  5LHY 1;  1JOO A;  2EOT A;  3G4S A;  5IT9 E;  5GAD C;  1GKH A;  1LTS D;  4OGQ C;  2PQA B;  5EKI A;  2VXW A;  2K32 A;  2KCN A;  3OMG A;  2HDL A;  4KJO A;  3TRZ A;  5C5M A;  1W3S A;  5JJL A;  1A8V A;  1HZ9 A;  1SR3 A;  2EY1 A;  4XXE A;  5EBD A;  3NP8 A;  3CF5 A;  1E24 A;  4X3S A;  4JI1 L;  1FNW A;  4DPG A;  2F0S A;  4APV A;  1N36 Q;  1VQA A;  1X32 A;  1EQT A;  1RHP A;  1G6P A;  1J9O A;  1EL0 A;  1H9K A;  3U9O A;  3WWV A;  3HOW B;  5E1F A;  1STY A;  2E76 C;  1PV4 A;  2A69 D;  2NN6 G;  2K01 A;  3D3R A;  1U4M A;  1DJR D;  4IAL A;  5K36 H;  4PMC A;  5COY A;  1ML0 D;  4EVO A;  1STG A;  1G8Z D;  3MTS A;  3FKI G;  2Z0S A;  1HTP A;  1XWE A;  2N49 A;  4A3G H;  1EOV A;  1PZI D;  2L4N A;  2QDB A;  5EGT A;  3SK5 A;  2IY5 B;  3DXJ C;  4XYO A;  2R7Z G;  1J5E Q;  1BCP B;  4B08 A;  1A3U A;  1CZW A;  3S2D H;  1SAP A;  1TWH H;  4FXK C;  3R3O A;  3RUZ A;  2UXB L;  1PTO H;  3R2I A;  4LMQ D;  3GQB A;  4GNX B;  4L5R C;  4O42 A;  3VYR A;  2HD3 A;  3T13 A;  1U4L A;  1GXD C;  2MFI A;  4KHP Q;  1EQV A;  3K0Y A;  1ASZ A;  2DY8 A;  5JOB A;  4HIK A;  4A3M G;  3S1Q B;  1V1Q A;  5JPN C;  5IWA L;  1VQG A;  2NVX H;  3OW2 A;  2LS0 1;  2QCP X;  2A6E C;  1E1O A;  2KQ3 A;  4K14 A;  4RMF A;  3RLO A;  2EXZ A;  1ZEQ X;  3H0G H;  3S1R B;  3HS0 C;  1B4O A;  4DV6 L;  1J5E L;  4YIJ A;  1YNN D;  2DUD A;  4ABN A;  3BU2 A;  4MTN A;  1EY8 A;  2L15 A;  4HMJ A;  2NUC A;  4DN4 M;  4R9W A;  1D5Z C;  1KAW A;  3HOZ G;  2NVY H;  1BR9 A;  3QOL A;  3T4A C;  1UNS A;  1VQJ A;  3PUY A;  4BA2 I;  1JC7 A;  2AUJ D;  2KA7 A;  4HJ9 A;  3DM1 A;  1WCM G;  2BH2 A;  1PH5 A;  3D0F A;  3TQY A;  2I5M X;  2DJF C;  4R8I A;  4ME5 A;  1AZQ A;  2AQ1 B;  2A6H D;  1X3P A;  1IYV A;  4GOP B;  5I2Y A;  1F2Y A;  2G9D A;  2BDN A;  2MPM A;  3K0X A;  3C46 A;  1F2Z A;  4YCU A;  3BG3 A;  3TS0 A;  2XSC A;  3GTO H;  4XQN A;  5A2Q L;  1F9Q A;  2EJM A;  4OHJ A;  1EWH A;  4G4K A;  3MXN B;  1S5D D;  2ENB A;  1A2T A;  3A8I E;  1KRT A;  5C4H A;  3GTM H;  3NBH A;  5CYU A;  1OXU A;  4OWW B;  4RCO A;  1SRU A;  3I4N H;  1RTN A;  2M00 A;  1IBK L;  1I4H A;  2MGS A;  1SNM A;  3I8Z A;  2K5W A;  5C3E G;  4A3B B;  1VQK A;  3BZD B;  5J22 A;  5M5X B;  4OX9 L;  1O80 A;  1Q1B A;  2UU9 Q;  2KBN A;  1ZKO A;  2LSS A;  4UP7 A;  2ZJR A;  4JI0 L;  1Q81 C;  4IOA A;  3E9I A;  2Z6K C;  2B2W A;  3ERO A;  4UP8 A;  3ER0 A;  2NVT H;  1IW7 D;  3F2D A;  2F03 A;  3NXW A;  1CM9 A;  4QY7 A;  4JI6 L;  4EQO A;  2EY2 A;  5KEE A;  1EWI A;  2OT2 A;  4F88 A;  1G51 A;  1PFM A;  3KOJ A;  2O5I C;  3G71 A;  5FO9 B;  1H9M A;  1UE1 A;  3A8J E; 
#chains in the Genus database with same CATH homology
 2WB1 E;  4IJH A;  1XJV A;  1A0I A;  4IOC A;  5IE8 A;  3AQQ A;  2ZJP A;  3OTO Q;  1K73 C;  3EN2 A;  2PQA A;  1X55 A;  4A3C H;  3L2P A;  1N36 L;  1PFS A;  3U4V A;  1YIT A;  2WFW A;  3PIP A;  4LFB L;  3PO3 G;  1HJP A;  4GNX C;  1C7Y A;  1EFW A;  4ALP A;  1EYG A;  2VL6 A;  4QJF A;  1LYL A;  3D31 A;  1HR0 Q;  1TWG H;  1Y1V G;  4DV0 L;  2EQS A;  4EQ5 A;  4QGU A;  2JEA I;  3NEM A;  4LUZ A;  4OWT B;  2C35 B;  2CKZ B;  1YNX A;  1VQ6 A;  2UXC L;  2ASB A;  4R4Q A;  1YIJ A;  4JYA L;  3PO3 H;  2IX1 A;  1JJG A;  4A3K G;  3CC7 A;  2R92 G;  4LW1 A;  2IHF A;  4DV1 Q;  2B3G A;  4MNO A;  1WOC A;  3L0O A;  4A3B H;  3KF8 B;  4DNI A;  1C0A A;  2CFM A;  3UE0 A;  4B3S Q;  2JA7 G;  3PIO A;  1PYS B;  1XNQ Q;  1SLJ A;  1X54 A;  3CCV A;  3I4O A;  3K81 C;  3CCM A;  2R92 H;  2HQL A;  5M5X H;  3RN2 A;  5EAY A;  4LFA Q;  2WAQ G;  1XMQ Q;  1AH9 A;  3UDG A;  2Z6K A;  4L5T A;  1Q86 C;  2JA7 H;  4X66 L;  5LMU L;  4LFC L;  1IBM Q;  4JBM A;  4DV4 Q;  3CCU A;  2RF4 A;  1IBL Q;  4B3T L;  1FJG L;  5M3M G;  1VQ9 A;  1YJN A;  4NPS A;  4R4C A;  1X3E A;  4GN4 B;  5GQO A;  2WAQ E;  3F8T A;  1PYB A;  1L0W A;  4KHP L;  4K0K L;  3ERS X;  5C0X G;  2BH8 A;  2AWN A;  1SN8 A;  5IP9 G;  5IP7 G;  3CCR A;  5HGQ A;  5M3M H;  2YTX A;  2N3S A;  3MEF A;  5IYC G;  4A3J G;  4DUY L;  3HOV G;  4P74 A;  4R4O A;  3H3V H;  2AHO B;  2ES2 A;  5LMN Q;  3BZC A;  3STB D;  2K5N A;  4TVA B;  5IT9 c;  3CCJ A;  3HOZ H;  4LUV A;  5IYD H;  2NZO A;  4J15 A;  4DUZ L;  5IP7 H;  4DV1 L;  1A63 A;  4A3I G;  1YJW A;  1Y14 B;  5IYC H;  4A3J H;  1PH3 A;  1K8A C;  4B3S L;  4GNX A;  4GLA C;  5J3B A;  3S14 H;  2HHH Q;  3HOU G;  1SFO H;  4DR4 Q;  4AQY Q;  2OQK A;  4FDB A;  4B3R L;  3A0J A;  2EXD A;  4POF A;  4DR2 L;  1HNZ L;  4GOP C;  1IZ6 A;  4A3F G;  2E2H H;  3S1M H;  4QIW E;  4DV2 L;  3HFZ B;  4A3I H;  4LF8 Q;  4BBS H;  4B3M L;  3JAM c;  3AEV A;  5C44 H;  1LM0 A;  3J81 i;  4L5S A;  2PI2 A;  2ATW A;  3HOU H;  4WJ4 A;  1N8R C;  1IBL L;  4OO1 I;  3J80 c;  1UE5 A;  5JEA G;  4JBJ A;  3T1H L;  4A3F H;  4LF5 L;  3M7N A;  1PH2 A;  4NB3 A;  3S2H H;  4JI7 Q;  2UXD L;  1V43 A;  2PMZ E;  4DR1 L;  2UUA Q;  2KCM A;  1IL2 A;  5DLQ E;  3CD6 A;  3I4M G;  5H1S E;  1YHB A;  2AMC B;  4JI1 Q;  1H95 A;  4HJ7 A;  1CKN A;  1BBU A;  2ZTD A;  2VS1 A;  3CME A;  3H15 A;  1WFQ A;  1JMC A;  3ULJ A;  4PZ8 A;  3CCQ A;  1KQS A;  2JJQ A;  2XTI A;  4C2M H;  3K7A H;  3I4M H;  3A5Z B;  3GTG H;  1TWF H;  4JBK A;  3GTJ H;  1I50 H;  3I2Z A;  1WYD A;  2NZH A;  2K75 A;  1TXY A;  4A3D G;  1N34 L;  1JJC B;  1BKB A;  3JC6 6;  1YHQ A;  1AE3 A;  1CUK A;  1HH2 P;  3I7F A;  4LF9 Q;  1YHA A;  4NXM Q;  2OQ0 A;  1N33 Q;  1GVP A;  5JJI A;  3ZJY C;  1QZH A;  5BR8 L;  1X56 A;  4KI0 A;  3ULL A;  1XPU A;  2KEN A;  4BBR G;  1NTG A;  5C3E H;  1VQP A;  1KD1 C;  4OON A;  4YWL A;  5FJ8 H;  4Y7N H;  1QUQ A;  4BBR H;  1D8L A;  1Z9F A;  4YHH L;  3KJO A;  3GTL H;  4O0A A;  4YCV A;  3CW2 C;  2VQE Q;  5C4X G;  2KHI A;  4DK3 C;  3DLL A;  1GM5 A;  2UUA L;  4DR5 Q;  1RIP A;  4DK6 C;  1MJE A;  1RL2 A;  3BZK A;  1XTD A;  3JAM i;  1U5K A;  4DAY B;  4LWC A;  1XNR L;  1VQ5 A;  3NEL A;  3TEH B;  3VDY A;  1VQM A;  2UXB Q;  4Y52 H;  1HZA A;  2K5V A;  4BA1 I;  3I55 A;  1IYJ B;  4BY1 H;  3KDF A;  2D62 A;  1M1K C;  4JV5 Q;  1UWV A;  3S24 A;  1TWA H;  5LMN W;  4IJL A;  3KLW A;  3G6E A;  2VUM G;  1U0L A;  4RG1 A;  4KLK A;  1B70 B;  1KC8 C;  3CPW A;  1X65 A;  2UU9 L;  1N32 L;  4BXX G;  2GVA A;  2I0Q A;  2CWA A;  3G48 A;  1N33 L;  1KL9 A;  5IWA Q;  4X64 L;  2VUM H;  1B7Y B;  3DM3 A;  1OXX K;  4XTC S;  4DR3 Q;  4O2D A;  4AIM A;  1L2F A;  2ALY B;  1JJ2 A;  1VQL A;  5HY6 A;  1SRO A;  4MZ9 A;  3KF6 B;  3M85 A;  1Q12 A;  2GVB A;  1EUJ A;  4P73 A;  2QEX A;  4QL5 A;  4UY8 C;  4JI4 L;  2WP8 J;  4AYB G;  2F4V Q;  4GKJ L;  1Y1V H;  1KXL A;  4AH6 A;  3L7Z C;  4ME3 A;  3IRB A;  4GLV B;  4DV6 Q;  1I6H H;  5GAE C;  4BY7 G;  2OTJ A;  2VZA A;  4X65 Q;  2AWO A;  2VQF Q;  3U50 C;  3CXC A;  3CQZ H;  4A3K H;  4PG3 A;  4JI5 L;  3SGI A;  4DR7 L;  3CAM A;  4AYB E;  5M5W H;  1VS0 A;  1YEZ A;  4BY7 H;  3CP0 A;  3PO2 G;  3GTP H;  1WI5 A;  4YWM A;  3OTO L;  2YU9 H;  1Z47 A;  1YJ9 A;  3PV0 A;  3RLF A;  1VQ7 A;  3FHW A;  1PH8 A;  1PH4 A;  2ZJQ A;  1FL0 A;  2EIF A;  2KHJ A;  5IY0 A;  5M3F G;  1T9H A;  2RCN A;  3STB C;  2ZM6 Q;  1W2B A;  2UUB Q;  3CC2 A;  2LXK A;  3E9H A;  4LNQ A;  3H0G G;  1Y1W G;  3PO2 H;  2BA1 A;  1EQR A;  3RR5 A;  1HR0 L;  1P16 A;  2R7D A;  3S1N H;  4YCW A;  2KCT A;  1E7Z A;  3PF4 A;  3NBH B;  1B8A A;  5M3F H;  4A93 G;  3KYH C;  1E1T A;  1I3Q H;  4JI8 Q;  3H3V I;  2I5L X;  1LTL A;  1Y1W H;  1MIU A;  3AFP A;  1JE5 A;  1UEB A;  3K80 C;  4C3J H;  2CCZ A;  2F4V L;  1OXV A;  2Q2H A;  4DV5 Q;  3PUV A;  5C0X I;  5IP9 H;  2ZTE A;  3S16 H;  3HOV H;  1VQO A;  2R7F A;  1XNQ L;  4JBW A;  4A93 H;  5GAG C;  1L1O B;  3T1Y Q;  3AFQ A;  1NE3 A;  2UUC Q;  2ID0 A;  4POG A;  1DGS A;  5AJ3 Q;  1XMQ L;  4LFA L;  3GO5 A;  4JI3 Q;  4DAM A;  2GN5 A;  1XMO Q;  1IBM L;  4IPC A;  4DV4 L;  2Y0S G;  4HJ8 A;  4HID A;  1XPO A;  1CSP A;  3RZD H;  2YYZ A;  2UUB L;  3UDF A;  2K52 A;  1PA6 A;  1K3R A;  1EIF A;  5GAH C;  2ZM6 L;  1IBK Q;  1AE2 A;  4DV7 Q;  2D0O A;  4LF4 Q;  1IXR A;  4HIM A;  5GRO A;  2Y0S E;  2JA8 G;  3HOY G;  2A19 A;  5C0X J;  3PF5 A;  2YTY A;  1FGU A;  1Q7Y C;  2JA5 G;  5LMN L;  1VQD A;  4IPD A;  1OXT A;  4DV3 Q;  4OX9 Q;  1VQE A;  4IO9 A;  3A74 A;  4YY3 Q;  4TQU S;  4JI0 Q;  3LGJ A;  2JA8 H;  3EIV A;  5E7N A;  1BBW A;  1VQN A;  3HOY H;  2JA5 H;  2HHH L;  2BA0 A;  3G4S A;  5GAD C;  4OWX B;  2OCE A;  4DR4 L;  4AQY L;  4BBS G;  1GKH A;  1K8G A;  2PQA B;  3F1Z A;  1X9N A;  4PZ7 A;  1LUZ A;  1E3P A;  1YZ6 A;  4A3D H;  4JI3 L;  1VQ4 A;  2IHE A;  4A4I A;  4JI6 Q;  4LF8 L;  4OXP A;  3J7Z C;  2FXQ A;  4L5Q A;  4YWK A;  3TRZ A;  1CKM A;  1C9O A;  1W3S A;  1HNX Q;  5JJL A;  1A8V A;  4QQB X;  4GKK Q;  2D0P A;  1HZ9 A;  1SR3 A;  4JI7 L;  4GN3 B;  4R4T A;  1K83 H;  4EX5 A;  4DV7 L;  5JEA J;  5M5Y H;  3TRE A;  3CF5 A;  5ELN A;  1E24 A;  4JI1 L;  4DPG A;  4HJA A;  4IFD I;  4APV A;  2VNU D;  5K36 G;  1N36 Q;  5C4X H;  1VQA A;  4NXN Q;  1Q82 C;  3J80 i;  1G6P A;  2E2J H;  4LFB Q;  3M4P A;  1QVG A;  3WWV A;  1PH6 A;  1TWC H;  1R9T H;  3PCO B;  1PV4 A;  2NN6 G;  3A5U A;  2N78 A;  4DV0 Q;  4LF9 L;  3GTQ H;  4DR6 Q;  4NXM L;  2UXC Q;  3HOX G;  1O7I A;  4A3E G;  3CC4 A;  4LF6 Q;  3FP9 A;  1KHI A;  4PZ6 A;  4A3G G;  1P8L A;  2MO0 A;  3RLN A;  4R1J A;  1PH1 A;  1NBW A;  2JK8 A;  3J81 j;  3I56 A;  3FKI G;  4A76 A;  2Z0S A;  3HOX H;  4DR7 Q;  3RNU A;  2N49 A;  4A3G H;  4H02 A;  4A3C G;  2OWO A;  1EOV A;  2VQE L;  3CCS A;  4BXX H;  2HIV A;  3GDE A;  1FVI A;  4PMW A;  4DR5 L;  3FKI H;  4IFD J;  2IY5 B;  1Q1E A;  1QVF A;  3M4O H;  4X66 Q;  3HKZ G;  5LMU Q;  4HJ5 A;  4LFC Q;  1J5E Q;  4DKA C;  2R7Z G;  3M3Y H;  4WJ3 M;  2XGT A;  1YI2 A;  3S2D H;  2R6G A;  1TWH H;  1E22 A;  4B3T Q;  2H5X A;  3W1B A;  4NXN L;  4GNX B;  5FLX c;  4L5R C;  1FJG Q;  4XIG S;  2UXB L;  4GLX A;  2QA4 A;  2JEB I;  2YTV A;  4R4I A;  3PUX A;  2JA9 A;  4JV5 L;  2MFI A;  2R7Z H;  3U58 A;  4KHP Q;  2A1A A;  1ASZ A;  3B6Y A;  3UDX A;  2VW9 A;  4K0K Q;  1D7Q A;  3HKZ E;  2CWP A;  4A3B G;  4HIK A;  4A3M G;  4DR6 L;  1V1Q A;  4LF6 L;  4DUY Q;  4JC0 A;  3M4Q A;  4P72 A;  3PSI A;  4JCV E;  2MNA A;  2E2I H;  4LF7 Q;  2Q2T A;  2Q2U A;  3J81 c;  1EIY B;  3KFU A;  5IWA L;  4DUZ Q;  4A3M H;  1VQG A;  4C3H H;  4DR3 L;  3HOW G;  1PHJ A;  2NVX H;  1A62 A;  3OW2 A;  2E8G A;  3CCL A;  1XPR A;  1E1O A;  4RMF A;  2CQO A;  3RLO A;  1CKN B;  4B3R Q;  2F3I A;  1HNZ Q;  2K5H A;  4DR2 Q;  1PVO A;  1NMG A;  3H0G H;  3S17 H;  4DV2 Q;  2A8V A;  1HNW Q;  3S15 H;  2F52 A;  3HOW H;  1NMF A;  4B3M Q;  1N9W A;  1UE6 A;  4DV6 L;  1J5E L;  3E0E A;  4JOI A;  2DUD A;  1I94 Q;  4C3I H;  3BU2 A;  1UE7 A;  4MTN A;  1M90 C;  2I5H A;  4X65 L;  3PGZ A;  2VQF L;  2L15 A;  3T1H Q;  4LF5 Q;  1L1O C;  5JJK A;  1VQH A;  2UXD Q;  3CMA A;  1VQB A;  1YVC A;  4JI2 Q;  4DR1 Q;  1KRS A;  3ULP A;  2NVQ H;  1SMX A;  1KAW A;  3HOZ G;  2NVY H;  5IYD G;  1OXS C;  3HKS A;  4BA2 I;  1VQJ A;  1MKH A;  2LXJ A;  3KF6 A;  3PUY A;  2R93 G;  2IX0 A;  3AYH B;  4HJ9 A;  4KHZ A;  1G29 1;  1S3O A;  1WCM G;  2BH2 A;  4LF7 L;  4JYA Q;  1QUQ B;  1PH5 A;  3D0F A;  3TQY A;  3M9B A;  2I5M X;  1N34 Q;  2ZTC A;  2R93 H;  1HZC A;  5C44 G;  3GTK H;  2RHQ B;  4GOP B;  4OO1 G;  1WCM H;  4UPA A;  1VQF A;  2PNH A;  4JI8 L;  5BR8 Q;  3NEN A;  1PH9 A;  1HNW L;  3K0X A;  4DV5 L;  4YCU A;  3TS0 A;  3RN5 A;  5FLM G;  3GTO H;  1I94 L;  3KDF B;  1X3G A;  1NY4 A;  2B29 A;  3T1Y L;  3UDI A;  3S1Q H;  2YV5 A;  3BJU A;  1ASY A;  2IT1 A;  3MXN B;  4YHH Q;  3GD7 A;  1KRT A;  2UUC L;  1JT8 A;  5AJ3 L;  2PI2 E;  4X62 Q;  4JI2 L;  3I4N G;  3PUW A;  5FLM H;  2QGQ A;  1JB7 A;  1S40 A;  1CSQ A;  3GTM H;  1Q46 A;  4P71 A;  3J7A 5;  1XMO L;  2E5L Q;  4P75 A;  1OXU A;  1K9M C;  2V1C C;  4OWW B;  1VCI A;  1XNR Q;  1Q8K A;  2HIX A;  1S72 A;  2JA6 G;  1HR0 W;  3EBE A;  1BVS A;  1SRU A;  3K7U C;  4LUO A;  1YBY A;  5ELO A;  3I4N H;  2MQH A;  3UE1 A;  1IBK L;  1PH7 A;  2DGY A;  3W1G A;  3S1R H;  4X6A H;  1GD7 A;  2AKW B;  1WJJ A;  4IPG A;  3F2B A;  5C3E G;  2OTL A;  4LF4 L;  1VQK A;  1VQC A;  1I5F A;  1L1O A;  3KJP A;  1KIX A;  4IPH A;  3OYY A;  2N8N A;  2JA6 H;  4GS3 A;  1MJC A;  5IYB G;  5FJ8 G;  2B63 G;  2JE6 I;  1OTC A;  3TS2 A;  4DV3 L;  1VQ8 A;  4GN5 A;  4OX9 L;  1K0R A;  1Q1B A;  1N32 Q;  2UU9 Q;  2KBN A;  1J6Q A;  1SE8 A;  1X6O A;  2LSS A;  4UP7 A;  2K14 A;  2MO1 A;  4HIO A;  4YY3 L;  2ZJR A;  4JI0 L;  1QVC A;  4X64 Q;  1Q81 C;  3K8A A;  2VY3 A;  1GO3 E;  3U4Z A;  3ICE A;  5IYB H;  2B63 H;  3F2C A;  3Q8D A;  3E9I A;  4IFD G;  2Z6K C;  1HZB A;  1X3F A;  4IOA A;  4A75 A;  4UP8 A;  3CCE A;  3ER0 A;  2NVT H;  3PUZ A;  4X62 L;  3W5O A;  3F2D A;  3CPF A;  4JOI C;  4QY7 A;  4BY1 G;  4JI4 Q;  4A3L G;  1QZG A;  4JI6 L;  4GKJ Q;  2WB1 G;  2NN6 I;  1EWI A;  2E5L L;  4GOP A;  1G51 A;  2JQO A;  2RHS B;  1NJI C;  4A3E H;  2K50 A;  1EQQ A;  3KOJ A;  1HNX L;  5C4J H;  1V9P A;  4GKK L;  2K4K A;  4A3L H;  3G71 A;  4JG2 A;  4UP9 A;  4JI5 Q;  1UE1 A;  2HT1 A;  3RZO H;  1CKO A;  2Q2I A;  1VQI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...