1BF4A

Chromosomal dna-binding protein sso7d/d(gcgaacgc) complex
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
63
structure length
63
Chain Sequence
ATVKFKYKGEEKEVDISKIKKVWRVGKMISFTYDEGGGKTGRGAVSEKDAPKELLQMLEKQKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'-D(*GP*CP*GP*TP*5IUP*CP*GP*C)-3')
publication title The crystal structure of the hyperthermophile chromosomal protein Sso7d bound to DNA.
pubmed doi rcsb
source organism Sulfolobus acidocaldarius
molecule tags Dna-binding protein/dna
total genus 11
structure length 63
sequence length 63
ec nomenclature
pdb deposition date 1998-05-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1bf4A00
1KNAA 2X6GA 5EJWA 2DY7A 4DN4M 1HHVA 4IUTA 5D65A 5T1IA 4R8IA 1DOMA 2K04A 3GV3A 4IUUA 4MHEA 2L9HA 1RTNA 4O42A 2RSOA 3P7JA 2FINB 2Q8RE 1U4MA 2EOTA 1O7YA 5DNFA 3I3CA 2HCIA 1SSOA 3ONAB 5EPLA 1CA6A 1DONA 1U4LA 1HRJA 3TZDA 1B4OA 1MGSA 2L1BA 2EE1A 2X69A 1EQTA 1S4ZA 2B2WC 4XT1B 3D6WA 1VMCA 1JICA 3TN2A 2EPBA 2NYZD 1WTVA 1AZPA 1X32A 2XIWA 1J9OA 5D14A 3G7LA 1IL8A 1HFNA 1RTOA 2FJ2A 2KVMA 1G91A 4IUVA 1A15A 2B2TA 5AFWA 1DOLA 4OIKA 1BO0A 1WTOA 3DEPA 1NR4A 1NR2A 2HDLA 3DEOA 1XX8A 1WD1A 2B2TC 4ZAIA 2KEDA 1SDFA 2RSNA 5T1GA 3FDTA 2JYOA 3I91A 2NWGA 4OIJA 4XT3B 1AP0A 2B2YA 5CORA 1BBXC 3UI2A 1EIHA 1G2TA 1RHPA 2K05A 2R3ZA 4CJ2C 2K1BA 1F9PA 2B2WA 2MPMA 1MSHA 4QUFA 2B2YC 4ZKCB 1MI2A 3IL8A 3Q6SA 4UAIA 4X3TA 1HUNA 1WTWA 2K28A 1O7ZA 2MJ8A 1J8IA 3HP3A 3IFDA 1RJTA 2NZ1D 2RVLA 1X3PA 1F9QA 2L11A 1NAPA 4R9WA 1WTXA 3DM1A 2JP1A 1X3QA 3I8ZA 4HAEA 2J7ZA 1C8CA 3H91A 5JJZA 1GUWA 1DOKA 1PLFA 1B3AA 1ZXTA 2MP1A 2L4NA 2FMMA 1ILQA 2KUMA 1F9RA 2X6LA 2D9UA 5EKIA 4HCSA 1ICWA 2SDFA 1G2SA 2K01A 5EPJA 1IKLA 4CJ1B 3F2UA 1QE6A 3QO2A 1PFMA 2MGSA 1F2LA 1B2TA 1LV9A 1WTRA 4X3SA 2N55A 4HEDA 1WTPA 1M8AA 4U68A 3KBXA 4RWSC 1DZ1A 1BF4A 1ML0D 4IUPA 5EPKA 4CJ0B 4ZLTF 1BNZA 3FPUB 4ZK9B 2H1EA 2FHTA 3I90A 5CBEE 3SVMA 1WD0A 4ZKBB 1E0BA 1TVXA 2FFKB 2VXWA 4NW2A 4IUQA 5CBAE 2K03A 1VMPA 1O80A 1CM9A 4LMQD 4HSVA 3MWYW 1JE4A 3N52A 1PDQA 2HUGA 1CA5A 1SAPA 1EL0A 1G6ZA 1B50A 1XYIA 2DY8A 2L12A 5CMDA 1ILPA 2KEEA 3R93A 2BDNA 1EOTA 2HCCA 5EQ0A 1RODA 1QG7A 2B2UA 4QUCA 4RAUC 2KOLA 4X3KA 1AZQA 1PFNA 2B2VA 5E4XA 3LWEA 3MTSA 1IKMA 2RA4A 4X3UA 2N88A 2B2UC 1U4RA 1F9SA 4MN3A 3GV6A 2CVRA 1KNEA 2B2VC 4XDXA 1HUMA 2M2LA 1WTQA 3KUPA 5E4WC 1QNKA 1ESRA 4RA8A 1NCVA 1EIGA 1Q3LA 2KECA 1U4PA 5COYA 1WVLA 1MSGA 1B53A 1HFGA 4IURA 2IL8A 2Q8TA 1PFBA 1HA6A 2HDMA
chains in the Genus database with same CATH superfamily
4YY3L 2F3VA 5JEAG 1M1KC 5T1IA 1K8AC 1VQ8A 3BVGA 3RN2A 1OXSC 4OEMB 3HOWB 1Q1BA 1B4OA 1H9KA 3PCOB 1EQTA 4AH6A 3JC66 1Q12A 5M3MH 2MUYA 3ND8A 3A74A 5CGKA 1RCVD 3J80L 1YJNA 2PYKA 4YHHL 1TWFH 1D1IA 1DOLA 2MQHA 3ICEA 1WTOA 3U50C 1SE2A 2K14A 3M3YB 1PXUA 4JOIC 1ENFA 4A76A 1I3QH 1K83B 3K6OA 2LSSA 1XWEA 3U9OA 5J39A 3A8KE 1VQGA 4H7BA 3KDFA 1I50H 4DV7Q 1JJ2A 2PNHA 1WTWA 2K28A 1O7ZA 3PUWA 3IFDA 4C3HB 5K5PA 4QMGA 1ZKOA 3TP6A 4H13C 4CBVA 4IFDG 3HKSA 2M9VA 4PZ7A 4BXXG 3S2DB 3MFYA 5KYIA 1TS5A 2FMMA 4JI8L 2N8NA 1TY0A 3PO3B 4BY1G 1VS0A 4C2MH 4R4IA 4C3IG 3PUXA 1PFMA 4OO1H 2RCNA 2EZVA 4AYBB 3VR5A 2K5VA 1A2TA 3ERQA 2EIFA 2EXZA 3HOZG 4Y7NH 1KIXA 1TQOA 1EYAA 3W3AA 5IYCH 4DAMA 5CMDA 1TXYA 1B3QA 2BDNA 5JPNC 3LWEA 1UEBA 4KN4C 3I7FA 5CV5A 5C4XH 1EY7A 3A7AB 5C5MA 3HOVG 3BYTB 2JSOA 4DXFA 1S5FD 3ULLA 1TS3A 1VQ4A 1DGSA 1N9WA 3RLOA 4GN4B 4CDDC 5C44G 2K33A 3OSOA 1EY9A 2HDMA 4LUOA 3AMUA 3D31A 4R4CA 3GV3A 1GUOA 3GTKH 1UAPA 2FINB 1U4MA 3KJPA 2WB1E 2I5MX 3OTOL 1DONA 1M4VA 2MHVA 3KFUA 1BCPD 5M5YB 1R9TH 1D8LA 3FHWA 5M5WB 2B2WC 3ERSX 3H3VC 2RDGA 1SYGA 2J4XA 5AFWA 2NVYH 4PZ8A 2PW5A 3AB9A 1RL2A 3STBC 3A5UA 4DUZL 5L37A 3E9IA 1HJPA 1LTID 4U673 2PZTA 4X64L 1V1PB 2NWGA 5TSSA 4JPBW 4G7OC 1AP0A 2A6HC 4DR1Q 1N8RC 4BY7G 2VQEQ 3EBEA 1HZAA 5IT9c 5HY6A 2UUAL 2IJ0A 1LTSD 1RJTA 2D5DA 2XN9C 4KD3A 3TS0A 1TWGB 1SYBA 4JI3L 3H91A 3O13A 1STYA 4KK7A 1OTCA 1SYFA 3SDZA 2ID0A 3P75A 1HTPA 4V0BA 1TWHH 3BYYB 2EYMA 4NPSA 1SNDA 1UEAB 5EPJA 4B9WA 1L1OB 2EJMA 2G9HD 1STEA 5I9PA 2F0EA 1AW7A 2EYPA 3DWQA 4A3EH 4IUQA 4A3GB 2Z6KC 4DR6L 4LMQD 3H0GG 4ZUJA 3MC0B 1SMYD 1N36L 4JVZA 1V8QA 2KQ3A 4OWTB 1LUZA 2QCPX 4F8MA 2E74C 1HNXQ 1HR0W 2GN5A 1Q86C 3KOJA 4ILWA 1QZGA 4IQZA 5IWAL 2PI2A 4EQNA 2PCFB 4A3BH 2F0KA 1FGBD 4R4TA 2LKVA 1PFBA 4LF6Q 2PZWA 5LHY1 3CCRA 2CH4W 4DN4M 2UXDQ 4NXNL 3E5SA 2UU9L 4KY5A 4R8IA 3CCLA 1QJOA 2K6AA 5HURA 2EOTA 3OWFA 2N49A 5EPLA 4JI2Q 1CA6A 3GO5A 3CPWA 2VQFL 1MGSA 2MO1A 3PQIA 3UDFA 4IN3A 2EE1A 5M3FB 5M3MG 4H0LC 5JVG3 3NHHA 3BZCA 4JI4L 5IOCA 2D0PA 1V43A 1KRSA 1DJRD 1NE3A 1EY5A 1O7LA 1GUGA 2GVAA 3SGIA 5FLXL 1Q8IA 3PO2H 1NNXA 4KLKA 5KNCA 4DK0A 2A74C 1WD1A 2RCFA 4DV1Q 1SDFA 5EGTA 1UE6A 5I6YA 4MZ9A 2A8VA 3OIPA 2DJFC 4QJFA 2OF1A 2R3ZA 1EOVA 1YITA 4DNRB 3DWAA 3BS1A 1NUCA 1JE5A 4LF8Q 2K5DA 2DJGC 1X56A 2IW3A 1X6OA 2JA7B 4KV6A 4NP5A 3K57A 3M9BA 1SNPA 1L0XB 4POGA 1WI5A 3NBHA 3S14B 1CZGA 2EJGC 3A56A 5EKIA 1MJEA 5C0XI 1Q46A 3NBHB 3TEHB 1G51A 4KKTA 2JN4A 3G71A 4A3MB 1RIPA 2Z8LA 2D62A 1X54A 1S5BD 3T1YL 3K0XA 5FOBB 4OO1G 2UXCQ 5DLQE 2Y0SB 3WDNA 3SE0A 2Z4HA 3U9SA 4CJ0B 4NXML 1EY0A 1HPCA 4KHPL 1T5EA 3NELA 1KAAA 4GOPB 1XTCD 1JE4A 4UDUC 1SYDA 4UPAA 4KTAA 3CU7A 5IYCG 1E2VA 4IO9A 3G48A 3J80E 3CMAA 1PRTF 5IGGA 4JCVE 1B70B 2F0NA 4X3KA 2IY5B 1LT6D 4BBSH 3BDCA 4OONA 1K28A 1F9SA 4MN3A 1SMXA 2KCNA 1HUMA 1G6PA 2RDHA 2F0GA 1CQVA 3A8IE 3H94A 5CYUA 3QG1A 4DK3C 1G291 4YY3Q 3PUVA 3I4NB 2K32A 3VYUA 3S15B 1H9SA 1TR5A 2OQKA 1YJ9A 1ENAA 1H9SB 2F0SA 4AYBE 4A3CH 2KCTA 5DNFA 1O7YA 3A7LA 1U4LA 4A3JH 5BN3A 3G6JB 1LTGD 4QF4A 5NUCA 1K8MA 3OIQA 4XQJA 1HZBA 1J9OA 1XNRL 2JA6B 3K7AB 2KVMA 1K9MC 3CCSA 1X9NA 2F0QA 3HOUB 3E9HA 2F03A 3HKZB 1BO0A 2PMZE 4FP5D 3W1BA 1N34L 4IPGA 1X3FA 4GKKL 4RFBA 3RZOB 3W5OA 1V1OA 1EYGA 3AU7A 3EJIA 3MXNA 3VR3A 4DV3L 3GP7A 1LTLA 4ZKCB 3MXNB 3NSWA 2K75A 3BU2A 2UUBQ 5C4HA 2AWNA 1IW7D 2HQLA 5F2DA 1XJVA 5LMUL 3D4DA 2QEXA 1VQ9A 1FYCA 4S3SA 5CV6A 4N9TA 1WTXA 2HHHL 3I55A 1PH6A 1LACA 1DOKA 1Y69U 2BH8A 2F0WA 1PTOD 3S1MH 1K73C 3S1NB 3CD6A 2E8GA 1XMOL 2SDFA 3MHBA 5KYLA 4RKBA 5FLMH 1M8AA 2LXJA 4U68A 3F1ZA 3SK4A 1WCMG 1N33Q 4IUPA 2ICIA 4BS9A 4XYOA 3UE1A 2AQ1B 4DGZA 1WD0A 4A3EG 5LMNL 4TKOB 4E6IA 2C5CA 2ES2A 2WIIB 5EKKA 3VR6A 4OX9Q 1GJXA 2HUGA 1OO9B 4G4KA 1VQMA 4HIDA 2F0LA 1VCIA 4B3RL 3Q8DA 3R2IA 1XYIA 3AQQA 2L12A 4BY1B 4C3IB 4ID6A 1LTTD 2A68D 2WKDA 2KOLA 2QILA 2B2VA 4DR4Q 4OGQC 1KL9A 2BCOA 2F3IA 4BBRB 4UP7A 3Q0AA 2VUMH 4QIWB 2EVBA 2YU9H 2A6EC 2F0IA 1EIGA 2KECA 3I4OA 1U4PA 4B3TQ 1STAA 2XRSD 1GOZA 1HFGA 4GNXA 4L5TA 4P72A 4JI1Q 3HOZB 4EQPA 2DY7A 2R92H 4GNXB 5CV9A 2NZOA 3MA2B 4DR3Q 3PV0A 2RHSB 3GTOH 1LLRD 3EA6A 3I3CA 4CGYB 1CFMA 4P2CB 3F2DA 3RR5A 3EROA 1EY8A 2OQ0A 3R3OA 3S2HB 2K50A 5LL6S 2EPBA 2NYZD 1HNZQ 4JI5Q 5C0XJ 3MXPA 4K5VA 5IYDH 1KDAA 1G91A 4I65A 3PO2G 4KD4A 4ABNA 1HQMC 2F0FA 5BN4A 4DUYQ 1AN8A 5D3IB 3TDQA 4X64Q 4BWGB 4LF7Q 1STHA 2WAQE 2AKWB 1SNMA 2PI2E 3IKJA 4DAYB 1EIHA 4A3IB 5C4ZA 2PQAA 2CW0C 1C48A 5CR3A 1KC8C 1YHAA 3DHQA 3GTMB 4YCWA 4IFDJ 4OELB 2KJXA 4A3KH 2CW0D 4LF5L 3I4MG 1Q81C 4JC0A 2NZ1D 2RVLA 1SR3A 1EQVA 1F77A 3N6RA 1JT8A 4K2KA 2ZTDA 2NVTH 4RMFA 2ZJRA 4B3SQ 1FNWA 5C4JB 1A63A 1XTDA 1A8VA 1L2FA 1KAWA 5IYBG 1Y1WH 1EZ6A 2O5JC 2E75C 1IBML 5I9OA 4BY7B 1LV9A 2Z0SA 4DR7L 1A62A 1BF4A 5EPKA 1RD9D 1E1OA 4JI7Q 1LO5D 3RLFA 3J81c 4DU9A 1IBLQ 1IYJB 1EL0A 5I2XA 4ME5A 3HG9A 2KA7A 1JB3A 4KN7C 4QUCA 4BBSG 5G3LD 5FLXE 3MTSA 1IKMA 2B2UC 1C9OA 4TRDA 3GTPB 5IODA 4N8X1 4FO2A 5ELNA 2L15A 1QNKA 2NTSA 4CKBA 1NCVA 2RDFA 1SFOH 1VQPA 4L6TB 1B53A 1T5XD 2IL8A 4L63B 5K36H 2E2HH 4LF9L 1OXUA 4BA1I 1HH2P 5IP7G 4JBMA 1LT4D 4QCLA 2XVSA 3S1RH 4A3JG 1PYWD 4X65L 4AIMA 3TZDA 4RG1A 5EBDA 1IXRA 1WTVA 2JA8H 2VZAA 3HRZC 4FXKC 4A3DH 1RTOA 5ELEA 2Z1CA 4WORA 2ALYB 4JI0Q 2Z9HA 2B63H 3A5ZB 3RUZA 3DEPA 1NR2A 2A19A 1Z6HA 1SNCA 1QUQB 4R1JA 1W6KA 4WFN3 2RSNA 4DNIA 3R2TA 1WTHA 3UI2A 3CQZH 2O4XA 3CCVA 3L2PA 3IL8A 4UAIA 3D0FA 2UUCL 5IGBA 3OW7A 3MFGA 3S24A 5C6AA 2DUDA 4FVMA 1PRTB 1BBUA 1TWFB 1O78A 4APVA 3HZXA 2NN6I 3J81i 3NPPA 2K5QA 1GUSA 1SJHD 1S5ED 5EBCA 3T13A 1SEBD 4FDBA 2KUMA 3JAML 5C0XG 1JJCB 2F1MA 3A8JE 5FLMG 3HKZE 4HSPA 2K5HA 1C0AA 2E2JB 1SNQA 1GD7A 1PH2A 4YIJA 1ML0D 4NKLA 2B3GA 3HOYH 1EEFD 1TVXA 4R4OA 2I07B 5E7NA 2G5DA 1PDQA 1L0WA 5JJLA 4LF4L 2F0JA 3ZJYC 4IPCA 4H02A 4C2MB 1K83H 1UE1A 2KEEA 1QG7A 1LTAD 4GLVB 4MNOA 2LY7A 2EQSA 3TZUA 1LT5D 3IRBA 4LK1C 3K58A 1S40A 1WOCA 1HZCA 2JA5G 3GTLB 2CCZA 2F4IA 3J80c 3TMEA 4AQYQ 5COYA 2EY6A 1TWAH 2RQXA 4LUVA 4L5QA 4Y7NB 3U4VA 4XQNA 2R92G 3S2DH 1I5FA 4DV5L 3P20A 5GROA 5JOBA 1S5CD 4MHEA 4FF2A 3JAMc 4O42A 3OPOA 2PPBC 3PO3H 1J5EL 4IUNA 3WWVA 5KRUA 4OWWB 1QWYA 2YYZA 3CP0A 1VQKA 5LL6X 2XSCA 5IIFA 1SYEA 1XNRQ 4XT1B 4YWLA 4HJ8A 5A2QL 1CK1A 5IYDG 1PHJA 3QOLA 4LAAA 1CKOA 3PIP3 5M5XH 2L55A 5A35A 2B2TA 1PTOH 1KABA 3DEOA 1Y1VH 2HDLA 2AWOA 3X3NA 4IJLA 1LYLA 4O2DA 1BDOA 3MVVA 3D4WA 3KLSX 4QIWE 1XNQL 3K5OA 2VL6A 2CQOA 1I94Q 2Z6BA 1BCPC 2WFWA 3GTQB 1PH8A 3ER0A 1NJIC 1R9TB 4A3KG 2M00A 2HHHQ 2KENA 1YHQA 2F0TA 4K8IA 4Z9CB 5C5LA 4J6HA 1BCPF 2NN6H 1C8CA 2QDBA 2J7ZA 1GUWA 3RNUA 1NBWA 1XMOQ 3T1HL 1JJGA 1V1PA 1KTKA 4HIKA 1C4QA 1VQFA 4HR7B 1Y1WG 1T9HA 4K8JA 2IWHA 1U0LA 5GAGC 1L0YB 2OEOA 2KHJA 4X3SA 3U4ZA 5IP9H 1I6HB 5M5WH 5LMNQ 2HIXA 1VF7A 3QB3A 1B9NA 2KHIA 1PFSA 4LWCA 3J80i 1FD7D 1SN8A 1CUKA 3T51B 2MNAA 4B3RQ 2UXBL 3MAQA 2E2IH 2LMCB 1XMQQ 1G6ZA 1LT3D 4DR5L 3TP7A 4ZCKA 1L1OA 4CDEC 2CWPA 3ZYYX 2LXKA 3J81E 4LFAL 2AMCB 5BR8L 1JOOA 4L5SA 2RKSA 1WCMB 3B6YA 4A3EB 5JJKA 5CC4A 5IGEA 3QOJA 2I46A 1VQCA 3DUZA 4MTNA 3T16A 2R7ZH 1NTGA 5K36G 1SMYC 1I4GA 5EJWA 2NVXB 3S9WA 5D65A 3A55A 3CAMA 2IPKD 3ND9A 4K14A 1STGA 1RTNA 2L9HA 3PF5A 1IBKQ 4O1NA 1SSOA 1J6QA 2Z4IA 5GQOA 4DV4L 3GTJH 2A1AA 2JA8G 4DV0L 3D6WA 4LJZC 1HNWL 3W1GA 3CCJA 4YCVA 4A3DG 4JV5L 2B63G 4A4IA 1B1ZA 4OIKA 4A3GH 5AJ3L 1Y8NB 5GAHC 2JYOA 4GN3B 4B3ML 2Q2TA 4J8QA 4XT3B 3PIO3 2B2YA 1RF2D 4OHJA 1CT1D 5JVH3 2K4KA 5FO8B 4LF5Q 4X3TA 3CCQA 1IHZA 2R7DA 1J8IA 2BA0A 3J81j 4N9PA 4EGVA 3M7GA 4C56C 1E22A 1VQHA 1ILQA 4J1MA 2H4OA 4G7ZC 3DWPA 2D9UA 1PYSB 4P71A 4A3FH 2GVBA 1HXYD 1SRUA 4KMUC 1E3PA 1QE6A 2NVQB 1U5KA 4EQOA 2ZTCA 3I4MB 2YTXA 3HOYG 1JWMD 3I90A 5H1SE 4DR2L 2PW7A 3PF4A 4J15A 1HA5A 3M85A 1ZYRD 2TSSA 3K7UC 3P1HA 3NP8A 1YNNC 4K0KL 1D7QA 1YNND 4LFCL 3PUYA 1PH1A 4IZ8A 3QIAA 3QWNA 3F2CA 5FO7B 4LFBQ 4ZRZA 3NBIA 2IT1A 1I4HA 1H9MA 1D5MC 1E2ZA 2JA7H 1I4QA 4KKUA 4K5XA 4GOPA 2CHBD 4G57A 2ZJPA 4LF9Q 5FLXc 4FXGC 3D6CA 1BOSA 4JG2A 1HA6A 5C3EB 2ZTEA 1PV4A 3S14H 4X66Q 4DK6C 1AE2A 4HMJA 3L7ZC 2HCIA 4BBSB 4A3MH 1YZ6A 3HGBA 2X69A 3EIVA 2IHEA 1VMCA 4RCNA 4DNTB 5C4XG 4AYBG 3JAME 1IL8A 3KLRA 1HR0L 1UE5A 4JBWA 2E5LQ 1Y1VG 1ET6A 2A69D 1W2BA 3BJUA 3NE5B 4KI0A 2CQAA 3K80C 1K3BC 5T1GA 1I4RA 3K81C 1FVIA 1AFPA 5I6WA 2GA4B 1RHPA 2QF7A 5E1FA 3D4RA 2UUCQ 2WV6D 2K7VA 1MSHA 4UP8A 3K0YA 2Q2HA 3RD4A 4C3JB 2KCCA 3HP3A 4YHHQ 1BVSA 1Q90A 5GAEC 4PMWA 1X3PA 3MXUA 1CSPA 2NN6G 3AYHB 1GHJA 2BDOA 4HAEA 1S5DD 3HOXH 1EU4A 5JJZA 3S15H 1B3AA 2VS1A 3VA5A 4DXGA 3F2BA 2F0MA 1BUVT 3C46A 2JXMB 2R93H 2OCEA 2CH4A 1G2SA 1VQOA 4QL5A 3M4OH 3V05A 3H15A 1B2TA 3L9AX 4TQUS 1WTRA 5IP9G 1IW7C 1SJED 3KBXA 1CKNB 2HT1A 3FPUB 3I72A 2XGTA 3SVMA 2JA6H 3K7AH 3HOUH 2VXWA 1MJCA 1PTOC 4B9XA 2F0PA 4LF4Q 1U9RA 4JI8Q 5JEAH 4UY8C 3FEWX 2VY3A 1B7YB 4HTHA 4IPDA 4EQ5A 5A2QE 1ILPA 1GUTA 1QNUA 1CHQD 4X62L 1GVPA 1E24A 3CCUA 5I4DA 1PTOF 3I2ZA 3S17H 4KJNA 4X3UA 3AEVA 2EYFA 4JYAL 1A3VA 3CCEA 1D1KA 2R7ZG 1Q82C 1GHKA 3KLWA 5DAUA 2XNAC 1PZID 1PYBA 4I7AA 3S1NH 4IUTA 5FKAC 2A68C 4A93H 4FF1A 1A6XA 1R4PB 3FKIH 4ALPA 2QEJC 2H5XA 1EQQA 2Q2UA 3NUCA 1HZ9A 3PSIA 2ZXPA 4DR1L 2VQEL 4HJ7A 1AZPA 3PIOA 2JA5B 1HFNA 2VNUD 4A3BG 2KCMA 2FJ2A 1A15A 3J7A5 4A3GG 2B39A 4KY7A 4N8FA 1JC7A 1XX8A 4BXXH 4DA2A 3RLNA 1STBA 1Z7TA 3E6ZX 3OTOQ 4PZ6A 4C3IH 4HJ5A 4HCEA 1EU3A 3BZDB 3Q23A 2EDGA 1QVCA 5DM63 4MTKA 1TY2A 4XTCS 4BBRH 3KF6B 3AFQA 1VQ5A 1VQNA 2WAQG 2NTTA 3L3OC 2EY5A 3I73A 3RZDB 3HOVB 1TT2A 2V1CC 1TS4A 4F87A 4DUZQ 1D5XC 5C44B 3HOZH 2O5IC 1MIUA 2NBFA 1SBBB 3NEMA 3T53B 1YNJD 1MD2D 3KLSA 4NDXA 2L4NA 4WRDA 4DAYA 1VQJA 3GTGB 4A3FG 1VQ6A 3SXHA 3OHXC 1L1OC 2EYLA 3QO2A 2UUAQ 1W6JA 2MGSA 1F2LA 2AUJD 3S1QH 4DV6L 2F0HA 1CZWA 3S2HH 1JB7A 2Z6KA 2RBMA 2H1EA 2FHTA 4JI3Q 2UXBQ 4GLXA 4IJHA 4FXDA 3A54A 1SROA 4DR5Q 1S72A 1EYCA 4LF6L 5FK9C 3E3XA 1PVOA 2UXDL 1Y1WB 4FNFA 4WJ4A 2L0CA 1RODA 4RAUC 4A3IH 4XIGS 3F8TA 5ELCA 3CMEA 2SNSA 1A2UA 1BKBA 4XDXA 2M2LA 2Q8IB 2JA7G 1YNXA 3CCMA 4DR6Q 2Q2IA 1MSGA 1TWCB 4IALA 2Q8TA 3T56B 2NB0A 1N36Q 3EN2A 3K5MA 1NMFA 4DV1L 1HQRD 3G6EA 2N3SA 4LNQA 3P7JA 3CHBD 3AFPA 5J22A 4RGNA 3CC7A 2V4DA 5IWAQ 1HNWQ 3S16B 2L1BA 3W2DA 2A5HA 4LF8L 3NENA 2PZUA 3RMHA 1WYDA 3G7LA 1GKHA 4F7XA 5AJ3Q 5G3LF 1SFOB 1JCKB 4IUVA 4P74A 1Y14B 3LX0A 1NR4A 3UE0A 1QOHA 4NXNQ 1EWCA 2UU9Q 2ZXRA 3H0GB 4MIUA 4B3MQ 2E2HB 1VQIA 2Y0SE 4A3CG 2VQFQ 1P8LA 3U58A 4QY7A 4QUFA 2ICEC 1X55A 2JA8B 4JI4Q 3GTPH 2MJ8A 4QB4A 1B44D 2UXCL 3GDEA 4PMCA 4ME3A 5JAVA 2B63B 1DD2A 1F9QA 2F4VL 5FJ8H 1GO3E 3HOXG 4GKJL 3K59A 1Q8KA 1QUQA 3K8AA 1PLFA 1PH5A 2OTLA 1Z9FA 1X3EA 2R93G 5ELBA 2JQOA 2PO4A 4CDCC 4K2LA 1BBWA 4CJ1B 1IKLA 1JWUD 3F2UA 3L0OA 4A75A 1LABA 4ODGA 1HTLD 2DNEA 4DKAC 3BDOA 1ET9A 2PQEA 3OW2A 2SEBD 3MEFA 2KBNA 5M3MB 3NQTA 1XPOA 4K6DA 2JA6G 1YI2A 2FFKB 1JR0D 1ICFB 3C1EA 3KYHC 2AQ3B 4HSVA 5C3XA 2RHQB 4IPHA 4GOPC 4IOCA 1CTMA 1CA5A 1VQAA 3SHLA 4LFCQ 2IX0A 1TIID 1I3QB 4QGUA 3CXCA 4POFA 2SNMA 2R61A 2SOBA 3T1YQ 5EKLA 5GADC 2A73B 5E4XA 4L5RC 1I50B 4DV2L 3HOWH 4P73A 2CWAA 1PH7A 4NXMQ 3HOYB 4KHPQ 1NSNS 1ESRA 3KJOA 2AHOB 1YBYA 3KF8A 1Q3LA 2N78A 3OMGA 1YHBA 3KF8B 3M3YH 1HHVA 1AE3A 4A93G 4B08A 1F2YA 1DOMA 4IUUA 3FKIG 2DNCA 1CQFA 2Q8RE 2BOSA 1VF5C 3CW2C 1PZJD 3FPPA 1F2MA 5M9OA 4YWMA 1DYQA 2E2JH 2F0VA 3KDFB 1JICA 1HR0Q 1JORA 2VUMG 2IHFA 2XIWA 2UUBL 3K5NA 4C3HH 5I2YA 1A3TA 1RDPD 1TWAB 3VR2A 5KGUA 1EFWA 4HIMA 1XPRA 1QB5D 4OIJA 2OT2A 5CORA 3FP9A 5J3BA 4HIOA 4OXPA 4BBRG 1VQBA 2O2LD 5C4XB 5M5XB 1N33L 3GTLH 1YIJA 3OOCA 2WB1G 1PTOB 1V9PA 2WKCA 5KIXA 4R9WA 1Y1VB 3DM1A 1N34Q 1BQQT 4GKKQ 2FXQA 1C7YA 2D2CC 4KY6A 2OWOA 4A3LH 4YWKA 4OX9L 2JEBI 1F9RA 3GTKB 2D0OA 1P16A 5IY0A 1FNVA 4JI6L 4DV3Q 4FYDA 2PMZB 1B8AA 3FRPB 1EFID 5IT9L 2C9OA 4X6AH 1SLJA 4JK1C 3CRKC 2G9DA 1SE3A 1VQDA 4RHSA 4DR4L 5LMUQ 2QKIC 1VDZA 1X65A 3J7AV 3VYTA 1IYUA 2B8GA 3LNNA 2NVYB 3TP5A 4PQXA 2IX3A 4B3TL 3MWYW 3N52A 1XXGA 4ZYSA 3BDLA 4JI1L 4X62Q 4Y52H 2QW7A 3VYSA 1CHPD 2DY8A 2ZM6L 2QDLA 3R93A 4DR3L 3HFZB 4A3IG 5KEEA 4H44C 3GTQH 1I4PA 2B8FA 4JYAQ 1GUNA 4C1NI 1U4RA 5M5YH 1PMRA 2CVRA 2WACA 3GD7A 2B2VC 3DMUA 1D5ZC 1EIYB 1HNZL 1UNSA 1JOQA 2WP8J 3KK7A 4DAPA 4JI5L 2TMPA 2HQEA 2E2IB 4CHTB 5ISRA 2X6GA 3STBD 1GM5A 1TWHB 4DUYL 3HEJA 4GNXC 2K04A 1EEID 3JAMi 1PH3A 4LF7L 5J1ZA 1BXTA 1DXMA 3R8BA 1W3SA 2EYHA 2A6HD 4UHVA 3J7YW 1FGUA 1QCBD 4XYQA 1I6HH 3TN2A 3FMCA 2EJFC 3TQYA 3BZKA 5D14A 1N32L 2BE5C 1K8OA 1EQRA 1TWGH 2R7ZB 1Q7YC 2BE5D 4XXEA 3NWSA 4ZAIA 5KNDA 5KNBA 4B3SL 2CKZB 1NY4A 1SE4A 3UDXA 4C1NK 1B9MA 2K1BA 2MPMA 3PMFA 4KHVA 1X3GA 2WINB 4OL7A 3GTJB 1H9RA 1EZ8A 1ONLA 4R8NA 1ASYA 2ZXOA 1EWIA 1WCMH 3HS0C 3E0EA 4RHRA 4A3BB 5FJ8G 2L11A 3OMCA 1NAPA 3J7AF 3VA7A 2ATWA 4Q0FA 3I8ZA 4JI7L 2F0DA 1Y8PB 3KBGA 2LS01 4K5WA 2NVXH 5BN5A 1IBLL 2MP1A 1ICWA 3BG3A 4DV6Q 3C3LA 1WFQA 3H6MA 1F2ZA 3MZ5A 5IE8A 2WAQB 4RWSC 3Q24A 1K0SA 1BNZA 3PO2B 2K03A 1O80A 4DF7A 3PUZA 3RN5A 2CFMA 4LW1A 3CKIB 3NQIA 4A3FB 4PG3A 1V1QA 1IBMQ 2JE6I 2B2UA 1O7IA 3NTKA 4TSSA 1AZQA 1VQLA 4DR7Q 3HOWG 1IZ6A 1FR3A 5M3FH 3EFXD 1WTQA 1SNOA 5E4WC 1FNUA 1FJGL 1WVLA 1ZYRC 1CI3M 1NMGA 3URYA 4JI0L 1G8ZD 1G2TA 3ULPA 2BA1A 2EY2A 2I0QA 1H95A 1PA6A 1A0IA 1I6VC 1ENCA 1PH4A 1KQSA 3ONAB 1HRJA 2NVQH 4L8JA 4XQQA 3I4MH 2ZJQA 4C3HG 1UWVA 3EVQA 4UP9A 4OWXB 2DN8A 1AH9A 2F0OA 2AUKA 2KEDA 1KDBA 5IGFA 4KHZA 5JJIA 4PMBA 1E2WA 3FDTA 4X65Q 3PIPA 3PO3G 5IYBH 2K05A 1QVGA 3UDIA 1PZKD 5LMNW 3VR4A 1MI2A 5ELFA 3Q6SA 1HUNA 4K6LA 3D3RA 2FMCA 3V96A 2F4VQ 4GKJQ 4DV7L 1PRTC 4WJ3M 2JP1A 1PRTD 2A69C 4JOIA 4IFDI 4A3LG 1IL2A 4PV1C 5C3EH 4I7ZC 4RGMA 1ZXTA 4KJOA 3LWUA 2X6LA 2XRQD 3GQBA 1BR9A 2E2DC 3TP8A 1JOKA 4A3JB 4FF3A 5D3DA 1JQYD 2L5TA 2P5ZX 4F88A 1H9JA 1DZ1A 2C35B 1PH9A 3H3VI 4IOAA 4ZLTF 3NWTA 1Q1EA 4ZK9B 4QQBX 1DCZA 5CV8A 2XWJB 2EYOA 4GN5A 4NW2A 4M8AA 3Q22A 3SK6A 3HOXB 1K3RA 1AEXA 4AQYL 3I4NH 3UDGA 2KHSA 4RGOS 2R93B 3ULJA 1SAPA 1GXDC 5IP7H 4R4QA 1RKNA 1JMCA 4DV2Q 1TKWB 3M4OB 4ZQ3A 3VYRA 1OXXK 2RA4A 2NZHA 1UUPA 1CKNA 1KNEA 4C3JH 1UE7A 3T4AC 1CSQA 3OWEB 3TREA 2OTJA 3OYYA 4TVAB 1VQEA 4YCUA 1IYVA 4IURA 1OXVA 3S1MB 3MXGA 4ULLA 3RZOH 4BA2I 2J0TD 1EWHA 3NXWA 3H09A 3NTHA 2JK8A 2VB3X 3S17B 1I94L 1SXTA 3CF5A 5CV4A 2JEAI 1EUJA 1S4ZA 4PNYA 1X32A 4NMZA 2I5HA 3I70A 5DEHA 1M90C 3WOEA 5HGTA 3DM3A 1JWSD 4Q5VA 5IT9E 2F0UA 2VB2X 2YTYA 4DV5Q 2B2TC 1QZHA 1YEZA 4A93B 5C0XH 3FKIB 1SE8A 3I91A 1J5EQ 1MKHA 1BCPB 4DPGA 1VQ7A 4CJ2C 5EAYA 2BH2A 2B2WA 3I56A 1ESFA 1LTRD 1KDCA 1KRTA 1MHWC 4JBKA 3TS2A 1SYCA 2VUMB 1E1TA 3V2TA 3C1FA 2YU9B 2EXDA 1KXLA 2K52A 4IFDH 4GS3A 3SR1A 2R92B 3DXJC 1EY4A 4V190 4RGTA 4JI6Q 1XNQQ 1WJJA 4LUZA 5ELOA 3QR8A 4HCSA 3NTIA 1XMQL 3C2PA 1EYDA 1EIFA 3GTOB 2K01A 1ZEQX 4BY1H 1R4QB 4GZYC 3BVZA 2MO0A 3KF6A 1MBYA 4HEDA 2RF4A 2YTVA 1WTPA 3H3VH 5JEAJ 3TSSA 2F3WA 2JA5H 2WB1B 1E0BA 1E7ZA 1K0RA 2A6ED 3I4LA 1CM9A 4RH6A 1YNJC 3T1HQ 1II3A 2ZM6Q 2QGQA 4CDFC 3X3MA 1QVFA 3D8GA 3CPFA 3M4PA 1EOTA 5EQ0A 3S1QB 1IBKL 3K5LA 4HMIA 4RCOA 2JJQA 1ASZA 5M3FG 4A3KB 3BVMA 3GV6A 2QA4A 1HNXL 3PGZA 1KLGD 1DM0B 3M4YA 4GLAC 3KUPA 3RZDH 3A0JA 3HOVH 1K8GA 3M4QA 4RA8A 3J81L 3IFTA 2PNRC 5CV7A 1LM0A 4KKSA 3DLLA 3FVQA 5C44H 2NVTB 1KNAA 2IX1A 2HIVA 3WOFA 2RSOA 3GTGH 1HCZA 1D6EC 4LFAQ 4EX5A 2K5NA 3CRLC 5BR8Q 5HGQA 3IAYA 4JI2L 2PQAB 2B29A 3GTMH 1Y8OB 2VW9A 1Z47A 1N32Q 5ELDA 1XPUA 2I5LX 1S3OA 4G7HC 2ASBA 2R7FA 1KHIA 4O0AA 1A3UA 4WJWA 4HJAA 1CKMA 3J7ZC 4DK1A 4ZUIA 1KLUD 5IGCA 5C4JH 3M7NA 1BBXC 1TS2A 2YV5A 3SEBA 2MFIA 4A3MG 4DV4Q 1F9PA 1EY6A 4RKLA 4DV0Q 2B2YC 3LGJA 4BY7H 2ZT9C 2ENBA 2Y0SG 2DGYA 1LTBD 4JBJA 4HJ9A 4JV5Q 3G4SA 3VDYA 3SK5A 4K0KQ 3MEHA 3SK8A 1KD1C 1X3QA 1TWCH 1STNA 2E76C 5C3EG 2AQ2B 3EQLC 2LFNA 2JA9A 1YJWA 3QJYA 2NUCA 3S1RB 1QILA 2F52A 4P75A 1TU2B 3ITPA 4CKCA 3NK9A 3S16H 2EYJA 2N55A 4DAVA 1FL0A 3E0JA 3CC2A 4LFBL 4OO1I 4FF4A 5IGDA 4A3DB 2OXPA 5CBEE 4NB3A 4ZKBB 1D2BA 5CBAE 2EY1A 3TRZA 1VMPA 3I4NG 5C3WA 2XWBB 5E3FA 3H0GH 3CC4A 3TBIB 1B50A 1YVCA 4X66L 1OXTA 4CKEA 2HCCA 3CQZB 2HD3A 5DM73 2K5WA 4DFAA 4EVOA 1PFNA 2XTIA 5JPMC 5FO9B 2R6GA 2N88A 4C3JG 1FJGQ 4DR2Q 1I4XA 4M1UB 3HOUG 3HKZG 4JW0A 4HN7A 2E5LL
chains in the Genus database with same CATH topology
2F3VA 5JEAG 5T1IA 3BVGA 1OXSC 3HOWB 1Q1BA 1B4OA 1H9KA 1EQTA 1Q12A 2MUYA 3ND8A 5CGKA 1RCVD 3J80L 2PYKA 1D1IA 1DOLA 1WTOA 1SE2A 3M3YB 1PXUA 1ENFA 1K83B 3K6OA 1XWEA 3U9OA 5J39A 3A8KE 4H7BA 1WTWA 2K28A 1O7ZA 3PUWA 3IFDA 4C3HB 5K5PA 4QMGA 1ZKOA 3TP6A 4H13C 4CBVA 4IFDG 2M9VA 3S2DB 3MFYA 5KYIA 1TS5A 2FMMA 1TY0A 3PO3B 4C3IG 3PUXA 1PFMA 4OO1H 2EZVA 4AYBB 3VR5A 1A2TA 3ERQA 2EXZA 1TQOA 1EYAA 3W3AA 5CMDA 2BDNA 5JPNC 3LWEA 4KN4C 5CV5A 1EY7A 3A7AB 5C5MA 3BYTB 2JSOA 4DXFA 1S5FD 1TS3A 2K33A 3OSOA 1EY9A 2HDMA 3AMUA 3D31A 3GV3A 1GUOA 1UAPA 2FINB 1U4MA 1DONA 1M4VA 2MHVA 1BCPD 5M5YB 5M5WB 2B2WC 3H3VC 2RDGA 1SYGA 2J4XA 5AFWA 2PW5A 3AB9A 1LTID 4U673 2PZTA 1V1PB 2NWGA 5TSSA 4G7OC 1AP0A 2A6HC 2IJ0A 1LTSD 1RJTA 2D5DA 2XN9C 4KD3A 1TWGB 1SYBA 3H91A 3O13A 1STYA 4KK7A 1SYFA 3SDZA 2ID0A 3P75A 1HTPA 4V0BA 3BYYB 2EYMA 1SNDA 1UEAB 5EPJA 4B9WA 2EJMA 2G9HD 1STEA 5I9PA 2F0EA 1AW7A 2EYPA 3DWQA 4IUQA 4A3GB 4LMQD 4ZUJA 3MC0B 1SMYD 1V8QA 2KQ3A 2QCPX 4F8MA 2E74C 4ILWA 4IQZA 4EQNA 2PCFB 2F0KA 1FGBD 2LKVA 1PFBA 2PZWA 5LHY1 4DN4M 3E5SA 4KY5A 4R8IA 1QJOA 2K6AA 5HURA 2EOTA 3OWFA 5EPLA 1CA6A 3GO5A 1MGSA 4IN3A 2EE1A 5M3FB 5JVG3 4H0LC 3NHHA 5IOCA 1V43A 1DJRD 1EY5A 1O7LA 1GUGA 5FLXL 1Q8IA 5KNCA 4DK0A 2A74C 1WD1A 1SDFA 5EGTA 5I6YA 3OIPA 2OF1A 2R3ZA 4DNRB 3DWAA 3BS1A 1NUCA 2K5DA 2IW3A 2JA7B 4KV6A 4NP5A 3K57A 1SNPA 1L0XB 3NBHA 3S14B 1CZGA 2EJGC 3A56A 5EKIA 5C0XI 4KKTA 4A3MB 2Z8LA 2D62A 1S5BD 4OO1G 5FOBB 2Y0SB 3WDNA 3SE0A 2Z4HA 3U9SA 4CJ0B 1EY0A 1HPCA 1T5EA 1KAAA 1XTCD 1JE4A 4UDUC 1SYDA 4KTAA 3CU7A 1E2VA 3J80E 1PRTF 5IGGA 4X3KA 2F0NA 1LT6D 3BDCA 1F9SA 4MN3A 2KCNA 1HUMA 2RDHA 2F0GA 1CQVA 3A8IE 3H94A 5CYUA 3QG1A 1G291 3PUVA 3I4NB 2K32A 3VYUA 3S15B 1H9SA 1TR5A 1ENAA 1H9SB 2F0SA 5DNFA 1O7YA 3A7LA 1U4LA 5BN3A 3G6JB 1LTGD 4QF4A 5NUCA 1K8MA 3OIQA 4XQJA 1J9OA 2JA6B 3K7AB 2KVMA 3HOUB 2F0QA 2F03A 3HKZB 1BO0A 4FP5D 4RFBA 3RZOB 1V1OA 3AU7A 3EJIA 3MXNA 3VR3A 3GP7A 4ZKCB 3NSWA 5C4HA 2AWNA 1IW7D 5F2DA 3D4DA 1FYCA 4S3SA 5CV6A 4N9TA 1WTXA 1LACA 1DOKA 1Y69U 2F0WA 1PTOD 3S1NB 2SDFA 3MHBA 5KYLA 4RKBA 1M8AA 4U68A 3SK4A 4IUPA 2ICIA 4BS9A 4XYOA 2AQ1B 4DGZA 1WD0A 4TKOB 4E6IA 2C5CA 2WIIB 5EKKA 3VR6A 1GJXA 2HUGA 1OO9B 4G4KA 2F0LA 1VCIA 3R2IA 1XYIA 2L12A 4BY1B 4C3IB 4ID6A 1LTTD 2A68D 2WKDA 2KOLA 2QILA 2B2VA 4OGQC 2BCOA 4BBRB 3Q0AA 4QIWB 2EVBA 2A6EC 2F0IA 1EIGA 2KECA 1U4PA 1STAA 2XRSD 1GOZA 1HFGA 3HOZB 4EQPA 2DY7A 5CV9A 3MA2B 3PV0A 1LLRD 3EA6A 3I3CA 4CGYB 1CFMA 4P2CB 3EROA 1EY8A 3R3OA 3S2HB 5LL6S 2EPBA 2NYZD 5C0XJ 3MXPA 4K5VA 1KDAA 1G91A 4I65A 4KD4A 4ABNA 1HQMC 2F0FA 5BN4A 1AN8A 5D3IB 3TDQA 4BWGB 1STHA 1SNMA 3IKJA 1EIHA 4A3IB 5C4ZA 5CR3A 2CW0C 1C48A 3DHQA 3GTMB 4IFDJ 2KJXA 2CW0D 2NZ1D 2RVLA 1EQVA 1F77A 3N6RA 4K2KA 1FNWA 5C4JB 1EZ6A 2O5JC 2E75C 5I9OA 4BY7B 1LV9A 1BF4A 5EPKA 1RD9D 1LO5D 3RLFA 4DU9A 1EL0A 5I2XA 4ME5A 3HG9A 2KA7A 1JB3A 4KN7C 4QUCA 5G3LD 5FLXE 3MTSA 1IKMA 2B2UC 4TRDA 3GTPB 5IODA 4FO2A 1QNKA 2NTSA 4CKBA 1NCVA 2RDFA 4L6TB 1B53A 1T5XD 2IL8A 4L63B 5K36H 1OXUA 4BA1I 1LT4D 4QCLA 2XVSA 1PYWD 3TZDA 5EBDA 1WTVA 3HRZC 4FXKC 1RTOA 5ELEA 2Z1CA 4WORA 3RUZA 3DEPA 1NR2A 1Z6HA 1SNCA 1W6KA 4WFN3 2RSNA 3R2TA 3UI2A 2O4XA 3IL8A 4UAIA 5IGBA 3OW7A 3MFGA 5C6AA 4FVMA 1PRTB 1TWFB 1O78A 3HZXA 2NN6I 3NPPA 2K5QA 1GUSA 1SJHD 1S5ED 5EBCA 3T13A 1SEBD 2KUMA 3JAML 5C0XG 2F1MA 3A8JE 4HSPA 2E2JB 1SNQA 4YIJA 1ML0D 4NKLA 1EEFD 1TVXA 2I07B 1PDQA 2F0JA 4C2MB 2KEEA 1QG7A 1LTAD 2LY7A 3TZUA 1LT5D 4LK1C 3K58A 3GTLB 2F4IA 3TMEA 5COYA 2EY6A 2RQXA 4Y7NB 4XQNA 3P20A 5JOBA 1S5CD 4MHEA 4FF2A 4O42A 3OPOA 2PPBC 4IUNA 5KRUA 1QWYA 2YYZA 5LL6X 2XSCA 5IIFA 1SYEA 4XT1B 5A2QL 1CK1A 3QOLA 4LAAA 3PIP3 2L55A 5A35A 2B2TA 1PTOH 1KABA 3DEOA 2HDLA 2AWOA 3X3NA 1BDOA 3MVVA 3D4WA 3KLSX 3K5OA 1BCPC 3GTQB 1R9TB 2M00A 2F0TA 4K8IA 4Z9CB 5C5LA 4J6HA 1BCPF 2NN6H 1C8CA 2QDBA 2J7ZA 1GUWA 1V1PA 1KTKA 1C4QA 4HR7B 4K8JA 2IWHA 1L0YB 2OEOA 4X3SA 1I6HB 1VF7A 3QB3A 1B9NA 1FD7D 3T51B 3MAQA 2LMCB 1G6ZA 1LT3D 3TP7A 3ZYYX 3J81E 1JOOA 2RKSA 1WCMB 4A3EB 5CC4A 5IGEA 3QOJA 2I46A 3DUZA 3T16A 5K36G 1SMYC 1I4GA 5EJWA 2NVXB 3S9WA 5D65A 3A55A 2IPKD 3ND9A 4K14A 1STGA 1RTNA 2L9HA 4O1NA 1SSOA 2Z4IA 3D6WA 4LJZC 1B1ZA 4OIKA 1Y8NB 2JYOA 4J8QA 4XT3B 3PIO3 2B2YA 1RF2D 4OHJA 1CT1D 5JVH3 5FO8B 4X3TA 1IHZA 1J8IA 2BA0A 4N9PA 4EGVA 3M7GA 4C56C 1ILQA 4J1MA 2H4OA 4G7ZC 3DWPA 2D9UA 1HXYD 4KMUC 1QE6A 2NVQB 4EQOA 3I4MB 1JWMD 3I90A 2PW7A 1HA5A 3M85A 1ZYRD 2TSSA 3P1HA 3NP8A 1YNNC 1YNND 3PUYA 4IZ8A 3QIAA 3QWNA 5FO7B 4ZRZA 3NBIA 2IT1A 1I4HA 1H9MA 1D5MC 1E2ZA 1I4QA 4KKUA 4K5XA 2CHBD 4G57A 1HA6A 4FXGC 3D6CA 1BOSA 5C3EB 4HMJA 3L7ZC 2HCIA 4BBSB 3HGBA 2X69A 1VMCA 4RCNA 4DNTB 3JAME 1IL8A 3KLRA 4JBWA 1ET6A 2A69D 3NE5B 4KI0A 2CQAA 5T1GA 1I4RA 1AFPA 5I6WA 2GA4B 1RHPA 2QF7A 5E1FA 3D4RA 2WV6D 2K7VA 1MSHA 3K0YA 3RD4A 4C3JB 2KCCA 3HP3A 1Q90A 4PMWA 1X3PA 3MXUA 2NN6G 1GHJA 2BDOA 4HAEA 1S5DD 1EU4A 5JJZA 1B3AA 3VA5A 4DXGA 2F0MA 1BUVT 3C46A 2JXMB 1G2SA 3V05A 1B2TA 3L9AX 4TQUS 1WTRA 1IW7C 1SJED 3KBXA 3FPUB 3I72A 3SVMA 2VXWA 1PTOC 4B9XA 2F0PA 1U9RA 5JEAH 3FEWX 4HTHA 5A2QE 1ILPA 1GUTA 1QNUA 1CHQD 5I4DA 1PTOF 4KJNA 4X3UA 2EYFA 1A3VA 1D1KA 1GHKA 5DAUA 2XNAC 1PZID 4IUTA 5FKAC 2A68C 4FF1A 1A6XA 1R4PB 2QEJC 3NUCA 2ZXPA 1AZPA 2JA5B 1HFNA 2VNUD 2FJ2A 1A15A 2B39A 4KY7A 1JC7A 1XX8A 4DA2A 1STBA 1Z7TA 3E6ZX 4HCEA 1EU3A 3BZDB 3Q23A 2EDGA 5DM63 1TY2A 4XTCS 2NTTA 3L3OC 2EY5A 3I73A 3RZDB 3HOVB 1TT2A 1TS4A 4F87A 1D5XC 5C44B 2O5IC 2NBFA 1SBBB 3T53B 4NDXA 1YNJD 1MD2D 3KLSA 2L4NA 4WRDA 4DAYA 3GTGB 3SXHA 3OHXC 2EYLA 3QO2A 1W6JA 2MGSA 1F2LA 2AUJD 2F0HA 1CZWA 2RBMA 2H1EA 2FHTA 4FXDA 3A54A 1EYCA 5FK9C 1Y1WB 4FNFA 2L0CA 1RODA 4RAUC 4XIGS 5ELCA 2SNSA 1A2UA 4XDXA 2M2LA 2Q8IB 1MSGA 1TWCB 4IALA 2Q8TA 3T56B 2NB0A 3K5MA 1HQRD 3P7JA 3CHBD 5J22A 4RGNA 2V4DA 3S16B 2L1BA 3W2DA 2A5HA 2PZUA 3RMHA 3G7LA 4F7XA 1SFOB 5G3LF 1JCKB 4IUVA 3LX0A 1NR4A 1QOHA 1EWCA 2E2HB 2ZXRA 3H0GB 4MIUA 4QUFA 2ICEC 2JA8B 2MJ8A 4QB4A 1B44D 4PMCA 5JAVA 2B63B 1DD2A 1F9QA 3K59A 1PLFA 5ELBA 2PO4A 4K2LA 4CJ1B 1IKLA 1JWUD 3F2UA 1LABA 4ODGA 1HTLD 2DNEA 3BDOA 1ET9A 2PQEA 2SEBD 5M3MB 3NQTA 4K6DA 2FFKB 1JR0D 3C1EA 2AQ3B 4HSVA 5C3XA 1CTMA 1CA5A 3SHLA 2IX0A 1TIID 1I3QB 2SNMA 2R61A 2SOBA 5EKLA 2A73B 5E4XA 1I50B 3HOYB 1NSNS 1ESRA 3KF8A 1Q3LA 3OMGA 1HHVA 4B08A 1F2YA 1DOMA 4IUUA 2DNCA 1CQFA 2Q8RE 2BOSA 1VF5C 1PZJD 3FPPA 1F2MA 5M9OA 1DYQA 2F0VA 1JICA 1JORA 2XIWA 3K5NA 5I2YA 1A3TA 1RDPD 1TWAB 3VR2A 5KGUA 1QB5D 4OIJA 2OT2A 5CORA 2O2LD 5C4XB 5M5XB 3OOCA 2WKCA 1PTOB 5KIXA 4R9WA 1Y1VB 3DM1A 1BQQT 2D2CC 4KY6A 2JEBI 1F9RA 3GTKB 1FNVA 4FYDA 2PMZB 3FRPB 1EFID 5IT9L 2C9OA 4JK1C 4RHSA 3CRKC 2G9DA 1SE3A 2QKIC 1VDZA 3J7AV 3VYTA 1IYUA 2B8GA 3LNNA 2NVYB 3TP5A 4PQXA 2IX3A 3MWYW 3N52A 1XXGA 4ZYSA 3BDLA 3VYSA 1CHPD 2DY8A 3R93A 5KEEA 4H44C 1I4PA 2B8FA 1GUNA 4C1NI 1U4RA 1PMRA 2CVRA 2WACA 3GD7A 2B2VC 3DMUA 1D5ZC 1JOQA 1UNSA 2WP8J 3KK7A 4DAPA 2TMPA 2HQEA 2E2IB 4CHTB 5ISRA 2X6GA 1TWHB 3HEJA 2K04A 1EEID 5J1ZA 1BXTA 1DXMA 3R8BA 2EYHA 2A6HD 3J7YW 1QCBD 4XYQA 3TN2A 3FMCA 2EJFC 5D14A 2BE5C 1K8OA 2R7ZB 2BE5D 4XXEA 3NWSA 4ZAIA 5KNDA 5KNBA 1SE4A 4C1NK 1B9MA 2K1BA 2MPMA 3PMFA 4KHVA 2WINB 4OL7A 3GTJB 1H9RA 1EZ8A 1ONLA 4R8NA 2ZXOA 3HS0C 4RHRA 4A3BB 2L11A 3OMCA 1NAPA 3J7AF 3VA7A 4Q0FA 3I8ZA 2F0DA 1Y8PB 3KBGA 2LS01 4K5WA 5BN5A 2MP1A 1ICWA 3BG3A 3C3LA 3MZ5A 3H6MA 1F2ZA 2WAQB 4RWSC 3Q24A 1BNZA 3PO2B 2K03A 1O80A 4DF7A 3PUZA 3CKIB 3NQIA 4A3FB 2JE6I 2B2UA 3NTKA 4TSSA 1AZQA 1FR3A 3EFXD 1WTQA 1SNOA 5E4WC 1FNUA 1WVLA 1ZYRC 1CI3M 3URYA 1G2TA 1G8ZD 2BA1A 2EY2A 1I6VC 1ENCA 3ONAB 1HRJA 4L8JA 4XQQA 4C3HG 3EVQA 2DN8A 2F0OA 2AUKA 2KEDA 1KDBA 5IGFA 4KHZA 4PMBA 1E2WA 3FDTA 2K05A 1PZKD 3VR4A 1MI2A 5ELFA 3Q6SA 1HUNA 4K6LA 3D3RA 2FMCA 3V96A 1PRTC 2JP1A 1PRTD 2A69C 4IFDI 4PV1C 4I7ZC 4RGMA 1ZXTA 4KJOA 3LWUA 2X6LA 2XRQD 3GQBA 1BR9A 2E2DC 3TP8A 1JOKA 4A3JB 4FF3A 5D3DA 1JQYD 2L5TA 4F88A 1H9JA 1DZ1A 4ZLTF 3NWTA 1Q1EA 4ZK9B 1DCZA 5CV8A 2XWJB 2EYOA 4NW2A 3Q22A 4M8AA 3HOXB 3SK6A 1AEXA 2KHSA 4RGOS 2R93B 1SAPA 1GXDC 1RKNA 3M4OB 1TKWB 4ZQ3A 3VYRA 1OXXK 2RA4A 1UUPA 1KNEA 3T4AC 3OWEB 1IYVA 4IURA 1OXVA 3S1MB 3MXGA 4ULLA 4BA2I 2J0TD 1EWHA 3NXWA 3H09A 3NTHA 2VB3X 3S17B 1SXTA 5CV4A 2JEAI 1S4ZA 4PNYA 1X32A 4NMZA 3I70A 5DEHA 3WOEA 5HGTA 1JWSD 4Q5VA 5IT9E 2F0UA 2VB2X 2B2TC 4A93B 5C0XH 3FKIB 3I91A 1BCPB 4CJ2C 2B2WA 1ESFA 1LTRD 1KDCA 1SYCA 2VUMB 3V2TA 3C1FA 2YU9B 4IFDH 3SR1A 2R92B 3DXJC 1EY4A 4V190 4RGTA 4HCSA 3C2PA 3NTIA 3GTOB 4GZYC 1EYDA 2K01A 1ZEQX 1R4QB 3BVZA 1MBYA 4HEDA 1WTPA 5JEAJ 3TSSA 2F3WA 2WB1B 1E0BA 2A6ED 3I4LA 1CM9A 4RH6A 1YNJC 1II3A 3X3MA 3D8GA 1EOTA 5EQ0A 3S1QB 3K5LA 4HMIA 4RCOA 4A3KB 3BVMA 3GV6A 1KLGD 1DM0B 3M4YA 3KUPA 4RA8A 3J81L 3IFTA 2PNRC 5CV7A 4KKSA 3FVQA 2NVTB 1KNAA 2IX1A 3WOFA 2RSOA 1HCZA 1D6EC 3CRLC 3IAYA 1Y8OB 1Z47A 5ELDA 4G7HC 1A3UA 4WJWA 4DK1A 4ZUIA 1KLUD 5IGCA 3M7NA 1BBXC 1TS2A 3SEBA 1F9PA 1EY6A 4RKLA 2B2YC 2ZT9C 2ENBA 1LTBD 3SK5A 3MEHA 3SK8A 1X3QA 1STNA 2E76C 2AQ2B 3EQLC 2LFNA 3QJYA 2NUCA 3S1RB 1QILA 1TU2B 3ITPA 4CKCA 3NK9A 2EYJA 2N55A 4DAVA 3E0JA 4OO1I 4FF4A 5IGDA 4A3DB 2OXPA 5CBEE 4ZKBB 1D2BA 5CBAE 2EY1A 1VMPA 5C3WA 2XWBB 5E3FA 3TBIB 1B50A 1OXTA 4CKEA 2HCCA 4DFAA 5DM73 3CQZB 2K5WA 4EVOA 1PFNA 5JPMC 5FO9B 2R6GA 2N88A 4C3JG 1I4XA 4M1UB 4HN7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KNA A;  2X6G A;  5EJW A;  2DY7 A;  4DN4 M;  1HHV A;  4IUT A;  5D65 A;  5T1I A;  4R8I A;  1DOM A;  2K04 A;  3GV3 A;  4IUU A;  4MHE A;  2L9H A;  1RTN A;  4O42 A;  2RSO A;  3P7J A;  2FIN B;  2Q8R E;  1U4M A;  2EOT A;  1O7Y A;  5DNF A;  3I3C A;  2HCI A;  1SSO A;  3ONA B;  5EPL A;  1CA6 A;  1DON A;  1U4L A;  1HRJ A;  3TZD A;  1B4O A;  1MGS A;  2L1B A;  2EE1 A;  2X69 A;  1EQT A;  1S4Z A;  2B2W C;  4XT1 B;  3D6W A;  1VMC A;  1JIC A;  3TN2 A;  2EPB A;  2NYZ D;  1WTV A;  1AZP A;  1X32 A;  2XIW A;  1J9O A;  5D14 A;  3G7L A;  1IL8 A;  1HFN A;  1RTO A;  2FJ2 A;  2KVM A;  1G91 A;  4IUV A;  1A15 A;  2B2T A;  5AFW A;  1DOL A;  4OIK A;  1BO0 A;  1WTO A;  3DEP A;  1NR4 A;  1NR2 A;  2HDL A;  3DEO A;  1XX8 A;  1WD1 A;  2B2T C;  4ZAI A;  2KED A;  1SDF A;  2RSN A;  5T1G A;  3FDT A;  2JYO A;  3I91 A;  2NWG A;  4OIJ A;  4XT3 B;  1AP0 A;  2B2Y A;  5COR A;  1BBX C;  3UI2 A;  1EIH A;  1G2T A;  1RHP A;  2K05 A;  2R3Z A;  4CJ2 C;  2K1B A;  1F9P A;  2B2W A;  2MPM A;  1MSH A;  4QUF A;  2B2Y C;  4ZKC B;  1MI2 A;  3IL8 A;  3Q6S A;  4UAI A;  4X3T A;  1HUN A;  1WTW A;  2K28 A;  1O7Z A;  2MJ8 A;  1J8I A;  3HP3 A;  3IFD A;  1RJT A;  2NZ1 D;  2RVL A;  1X3P A;  1F9Q A;  2L11 A;  1NAP A;  4R9W A;  1WTX A;  3DM1 A;  2JP1 A;  1X3Q A;  3I8Z A;  4HAE A;  2J7Z A;  1C8C A;  3H91 A;  5JJZ A;  1GUW A;  1DOK A;  1PLF A;  1B3A A;  1ZXT A;  2MP1 A;  2L4N A;  2FMM A;  1ILQ A;  2KUM A;  1F9R A;  2X6L A;  2D9U A;  5EKI A;  4HCS A;  1ICW A;  2SDF A;  1G2S A;  2K01 A;  5EPJ A;  1IKL A;  4CJ1 B;  3F2U A;  1QE6 A;  3QO2 A;  1PFM A;  2MGS A;  1F2L A;  1B2T A;  1LV9 A;  1WTR A;  4X3S A;  2N55 A;  4HED A;  1WTP A;  1M8A A;  4U68 A;  3KBX A;  4RWS C;  1DZ1 A;  1BF4 A;  1ML0 D;  4IUP A;  5EPK A;  4CJ0 B;  4ZLT F;  1BNZ A;  3FPU B;  4ZK9 B;  2H1E A;  2FHT A;  3I90 A;  5CBE E;  3SVM A;  1WD0 A;  4ZKB B;  1E0B A;  1TVX A;  2FFK B;  2VXW A;  4NW2 A;  4IUQ A;  5CBA E;  2K03 A;  1VMP A;  1O80 A;  1CM9 A;  4LMQ D;  4HSV A;  3MWY W;  1JE4 A;  3N52 A;  1PDQ A;  2HUG A;  1CA5 A;  1SAP A;  1EL0 A;  1G6Z A;  1B50 A;  1XYI A;  2DY8 A;  2L12 A;  5CMD A;  1ILP A;  2KEE A;  3R93 A;  2BDN A;  1EOT A;  2HCC A;  5EQ0 A;  1ROD A;  1QG7 A;  2B2U A;  4QUC A;  4RAU C;  2KOL A;  4X3K A;  1AZQ A;  1PFN A;  2B2V A;  5E4X A;  3LWE A;  3MTS A;  1IKM A;  2RA4 A;  4X3U A;  2N88 A;  2B2U C;  1U4R A;  1F9S A;  4MN3 A;  3GV6 A;  2CVR A;  1KNE A;  2B2V C;  4XDX A;  1HUM A;  2M2L A;  1WTQ A;  3KUP A;  5E4W C;  1QNK A;  1ESR A;  4RA8 A;  1NCV A;  1EIG A;  1Q3L A;  2KEC A;  1U4P A;  5COY A;  1WVL A;  1MSG A;  1B53 A;  1HFG A;  4IUR A;  2IL8 A;  2Q8T A;  1PFB A;  1HA6 A;  2HDM A; 
#chains in the Genus database with same CATH topology
 4YY3 L;  2F3V A;  5JEA G;  1M1K C;  5T1I A;  1K8A C;  1VQ8 A;  3BVG A;  3RN2 A;  1OXS C;  4OEM B;  3HOW B;  1Q1B A;  1B4O A;  1H9K A;  3PCO B;  1EQT A;  4AH6 A;  3JC6 6;  1Q12 A;  5M3M H;  2MUY A;  3ND8 A;  3A74 A;  5CGK A;  1RCV D;  3J80 L;  1YJN A;  2PYK A;  4YHH L;  1TWF H;  1D1I A;  1DOL A;  2MQH A;  3ICE A;  1WTO A;  3U50 C;  1SE2 A;  2K14 A;  3M3Y B;  1PXU A;  4JOI C;  1ENF A;  4A76 A;  1I3Q H;  1K83 B;  3K6O A;  2LSS A;  1XWE A;  3U9O A;  5J39 A;  3A8K E;  1VQG A;  4H7B A;  3KDF A;  1I50 H;  4DV7 Q;  1JJ2 A;  2PNH A;  1WTW A;  2K28 A;  1O7Z A;  3PUW A;  3IFD A;  4C3H B;  5K5P A;  4QMG A;  1ZKO A;  3TP6 A;  4H13 C;  4CBV A;  4IFD G;  3HKS A;  2M9V A;  4PZ7 A;  4BXX G;  3S2D B;  3MFY A;  5KYI A;  1TS5 A;  2FMM A;  4JI8 L;  2N8N A;  1TY0 A;  3PO3 B;  4BY1 G;  1VS0 A;  4C2M H;  4R4I A;  4C3I G;  3PUX A;  1PFM A;  4OO1 H;  2RCN A;  2EZV A;  4AYB B;  3VR5 A;  2K5V A;  1A2T A;  3ERQ A;  2EIF A;  2EXZ A;  3HOZ G;  4Y7N H;  1KIX A;  1TQO A;  1EYA A;  3W3A A;  5IYC H;  4DAM A;  5CMD A;  1TXY A;  1B3Q A;  2BDN A;  5JPN C;  3LWE A;  1UEB A;  4KN4 C;  3I7F A;  5CV5 A;  5C4X H;  1EY7 A;  3A7A B;  5C5M A;  3HOV G;  3BYT B;  2JSO A;  4DXF A;  1S5F D;  3ULL A;  1TS3 A;  1VQ4 A;  1DGS A;  1N9W A;  3RLO A;  4GN4 B;  4CDD C;  5C44 G;  2K33 A;  3OSO A;  1EY9 A;  2HDM A;  4LUO A;  3AMU A;  3D31 A;  4R4C A;  3GV3 A;  1GUO A;  3GTK H;  1UAP A;  2FIN B;  1U4M A;  3KJP A;  2WB1 E;  2I5M X;  3OTO L;  1DON A;  1M4V A;  2MHV A;  3KFU A;  1BCP D;  5M5Y B;  1R9T H;  1D8L A;  3FHW A;  5M5W B;  2B2W C;  3ERS X;  3H3V C;  2RDG A;  1SYG A;  2J4X A;  5AFW A;  2NVY H;  4PZ8 A;  2PW5 A;  3AB9 A;  1RL2 A;  3STB C;  3A5U A;  4DUZ L;  5L37 A;  3E9I A;  1HJP A;  1LTI D;  4U67 3;  2PZT A;  4X64 L;  1V1P B;  2NWG A;  5TSS A;  4JPB W;  4G7O C;  1AP0 A;  2A6H C;  4DR1 Q;  1N8R C;  4BY7 G;  2VQE Q;  3EBE A;  1HZA A;  5IT9 c;  5HY6 A;  2UUA L;  2IJ0 A;  1LTS D;  1RJT A;  2D5D A;  2XN9 C;  4KD3 A;  3TS0 A;  1TWG B;  1SYB A;  4JI3 L;  3H91 A;  3O13 A;  1STY A;  4KK7 A;  1OTC A;  1SYF A;  3SDZ A;  2ID0 A;  3P75 A;  1HTP A;  4V0B A;  1TWH H;  3BYY B;  2EYM A;  4NPS A;  1SND A;  1UEA B;  5EPJ A;  4B9W A;  1L1O B;  2EJM A;  2G9H D;  1STE A;  5I9P A;  2F0E A;  1AW7 A;  2EYP A;  3DWQ A;  4A3E H;  4IUQ A;  4A3G B;  2Z6K C;  4DR6 L;  4LMQ D;  3H0G G;  4ZUJ A;  3MC0 B;  1SMY D;  1N36 L;  4JVZ A;  1V8Q A;  2KQ3 A;  4OWT B;  1LUZ A;  2QCP X;  4F8M A;  2E74 C;  1HNX Q;  1HR0 W;  2GN5 A;  1Q86 C;  3KOJ A;  4ILW A;  1QZG A;  4IQZ A;  5IWA L;  2PI2 A;  4EQN A;  2PCF B;  4A3B H;  2F0K A;  1FGB D;  4R4T A;  2LKV A;  1PFB A;  4LF6 Q;  2PZW A;  5LHY 1;  3CCR A;  2CH4 W;  4DN4 M;  2UXD Q;  4NXN L;  3E5S A;  2UU9 L;  4KY5 A;  4R8I A;  3CCL A;  1QJO A;  2K6A A;  5HUR A;  2EOT A;  3OWF A;  2N49 A;  5EPL A;  4JI2 Q;  1CA6 A;  3GO5 A;  3CPW A;  2VQF L;  1MGS A;  2MO1 A;  3PQI A;  3UDF A;  4IN3 A;  2EE1 A;  5M3F B;  5M3M G;  4H0L C;  5JVG 3;  3NHH A;  3BZC A;  4JI4 L;  5IOC A;  2D0P A;  1V43 A;  1KRS A;  1DJR D;  1NE3 A;  1EY5 A;  1O7L A;  1GUG A;  2GVA A;  3SGI A;  5FLX L;  1Q8I A;  3PO2 H;  1NNX A;  4KLK A;  5KNC A;  4DK0 A;  2A74 C;  1WD1 A;  2RCF A;  4DV1 Q;  1SDF A;  5EGT A;  1UE6 A;  5I6Y A;  4MZ9 A;  2A8V A;  3OIP A;  2DJF C;  4QJF A;  2OF1 A;  2R3Z A;  1EOV A;  1YIT A;  4DNR B;  3DWA A;  3BS1 A;  1NUC A;  1JE5 A;  4LF8 Q;  2K5D A;  2DJG C;  1X56 A;  2IW3 A;  1X6O A;  2JA7 B;  4KV6 A;  4NP5 A;  3K57 A;  3M9B A;  1SNP A;  1L0X B;  4POG A;  1WI5 A;  3NBH A;  3S14 B;  1CZG A;  2EJG C;  3A56 A;  5EKI A;  1MJE A;  5C0X I;  1Q46 A;  3NBH B;  3TEH B;  1G51 A;  4KKT A;  2JN4 A;  3G71 A;  4A3M B;  1RIP A;  2Z8L A;  2D62 A;  1X54 A;  1S5B D;  3T1Y L;  3K0X A;  5FOB B;  4OO1 G;  2UXC Q;  5DLQ E;  2Y0S B;  3WDN A;  3SE0 A;  2Z4H A;  3U9S A;  4CJ0 B;  4NXM L;  1EY0 A;  1HPC A;  4KHP L;  1T5E A;  3NEL A;  1KAA A;  4GOP B;  1XTC D;  1JE4 A;  4UDU C;  1SYD A;  4UPA A;  4KTA A;  3CU7 A;  5IYC G;  1E2V A;  4IO9 A;  3G48 A;  3J80 E;  3CMA A;  1PRT F;  5IGG A;  4JCV E;  1B70 B;  2F0N A;  4X3K A;  2IY5 B;  1LT6 D;  4BBS H;  3BDC A;  4OON A;  1K28 A;  1F9S A;  4MN3 A;  1SMX A;  2KCN A;  1HUM A;  1G6P A;  2RDH A;  2F0G A;  1CQV A;  3A8I E;  3H94 A;  5CYU A;  3QG1 A;  4DK3 C;  1G29 1;  4YY3 Q;  3PUV A;  3I4N B;  2K32 A;  3VYU A;  3S15 B;  1H9S A;  1TR5 A;  2OQK A;  1YJ9 A;  1ENA A;  1H9S B;  2F0S A;  4AYB E;  4A3C H;  2KCT A;  5DNF A;  1O7Y A;  3A7L A;  1U4L A;  4A3J H;  5BN3 A;  3G6J B;  1LTG D;  4QF4 A;  5NUC A;  1K8M A;  3OIQ A;  4XQJ A;  1HZB A;  1J9O A;  1XNR L;  2JA6 B;  3K7A B;  2KVM A;  1K9M C;  3CCS A;  1X9N A;  2F0Q A;  3HOU B;  3E9H A;  2F03 A;  3HKZ B;  1BO0 A;  2PMZ E;  4FP5 D;  3W1B A;  1N34 L;  4IPG A;  1X3F A;  4GKK L;  4RFB A;  3RZO B;  3W5O A;  1V1O A;  1EYG A;  3AU7 A;  3EJI A;  3MXN A;  3VR3 A;  4DV3 L;  3GP7 A;  1LTL A;  4ZKC B;  3MXN B;  3NSW A;  2K75 A;  3BU2 A;  2UUB Q;  5C4H A;  2AWN A;  1IW7 D;  2HQL A;  5F2D A;  1XJV A;  5LMU L;  3D4D A;  2QEX A;  1VQ9 A;  1FYC A;  4S3S A;  5CV6 A;  4N9T A;  1WTX A;  2HHH L;  3I55 A;  1PH6 A;  1LAC A;  1DOK A;  1Y69 U;  2BH8 A;  2F0W A;  1PTO D;  3S1M H;  1K73 C;  3S1N B;  3CD6 A;  2E8G A;  1XMO L;  2SDF A;  3MHB A;  5KYL A;  4RKB A;  5FLM H;  1M8A A;  2LXJ A;  4U68 A;  3F1Z A;  3SK4 A;  1WCM G;  1N33 Q;  4IUP A;  2ICI A;  4BS9 A;  4XYO A;  3UE1 A;  2AQ1 B;  4DGZ A;  1WD0 A;  4A3E G;  5LMN L;  4TKO B;  4E6I A;  2C5C A;  2ES2 A;  2WII B;  5EKK A;  3VR6 A;  4OX9 Q;  1GJX A;  2HUG A;  1OO9 B;  4G4K A;  1VQM A;  4HID A;  2F0L A;  1VCI A;  4B3R L;  3Q8D A;  3R2I A;  1XYI A;  3AQQ A;  2L12 A;  4BY1 B;  4C3I B;  4ID6 A;  1LTT D;  2A68 D;  2WKD A;  2KOL A;  2QIL A;  2B2V A;  4DR4 Q;  4OGQ C;  1KL9 A;  2BCO A;  2F3I A;  4BBR B;  4UP7 A;  3Q0A A;  2VUM H;  4QIW B;  2EVB A;  2YU9 H;  2A6E C;  2F0I A;  1EIG A;  2KEC A;  3I4O A;  1U4P A;  4B3T Q;  1STA A;  2XRS D;  1GOZ A;  1HFG A;  4GNX A;  4L5T A;  4P72 A;  4JI1 Q;  3HOZ B;  4EQP A;  2DY7 A;  2R92 H;  4GNX B;  5CV9 A;  2NZO A;  3MA2 B;  4DR3 Q;  3PV0 A;  2RHS B;  3GTO H;  1LLR D;  3EA6 A;  3I3C A;  4CGY B;  1CFM A;  4P2C B;  3F2D A;  3RR5 A;  3ERO A;  1EY8 A;  2OQ0 A;  3R3O A;  3S2H B;  2K50 A;  5LL6 S;  2EPB A;  2NYZ D;  1HNZ Q;  4JI5 Q;  5C0X J;  3MXP A;  4K5V A;  5IYD H;  1KDA A;  1G91 A;  4I65 A;  3PO2 G;  4KD4 A;  4ABN A;  1HQM C;  2F0F A;  5BN4 A;  4DUY Q;  1AN8 A;  5D3I B;  3TDQ A;  4X64 Q;  4BWG B;  4LF7 Q;  1STH A;  2WAQ E;  2AKW B;  1SNM A;  2PI2 E;  3IKJ A;  4DAY B;  1EIH A;  4A3I B;  5C4Z A;  2PQA A;  2CW0 C;  1C48 A;  5CR3 A;  1KC8 C;  1YHA A;  3DHQ A;  3GTM B;  4YCW A;  4IFD J;  4OEL B;  2KJX A;  4A3K H;  2CW0 D;  4LF5 L;  3I4M G;  1Q81 C;  4JC0 A;  2NZ1 D;  2RVL A;  1SR3 A;  1EQV A;  1F77 A;  3N6R A;  1JT8 A;  4K2K A;  2ZTD A;  2NVT H;  4RMF A;  2ZJR A;  4B3S Q;  1FNW A;  5C4J B;  1A63 A;  1XTD A;  1A8V A;  1L2F A;  1KAW A;  5IYB G;  1Y1W H;  1EZ6 A;  2O5J C;  2E75 C;  1IBM L;  5I9O A;  4BY7 B;  1LV9 A;  2Z0S A;  4DR7 L;  1A62 A;  1BF4 A;  5EPK A;  1RD9 D;  1E1O A;  4JI7 Q;  1LO5 D;  3RLF A;  3J81 c;  4DU9 A;  1IBL Q;  1IYJ B;  1EL0 A;  5I2X A;  4ME5 A;  3HG9 A;  2KA7 A;  1JB3 A;  4KN7 C;  4QUC A;  4BBS G;  5G3L D;  5FLX E;  3MTS A;  1IKM A;  2B2U C;  1C9O A;  4TRD A;  3GTP B;  5IOD A;  4N8X 1;  4FO2 A;  5ELN A;  2L15 A;  1QNK A;  2NTS A;  4CKB A;  1NCV A;  2RDF A;  1SFO H;  1VQP A;  4L6T B;  1B53 A;  1T5X D;  2IL8 A;  4L63 B;  5K36 H;  2E2H H;  4LF9 L;  1OXU A;  4BA1 I;  1HH2 P;  5IP7 G;  4JBM A;  1LT4 D;  4QCL A;  2XVS A;  3S1R H;  4A3J G;  1PYW D;  4X65 L;  4AIM A;  3TZD A;  4RG1 A;  5EBD A;  1IXR A;  1WTV A;  2JA8 H;  2VZA A;  3HRZ C;  4FXK C;  4A3D H;  1RTO A;  5ELE A;  2Z1C A;  4WOR A;  2ALY B;  4JI0 Q;  2Z9H A;  2B63 H;  3A5Z B;  3RUZ A;  3DEP A;  1NR2 A;  2A19 A;  1Z6H A;  1SNC A;  1QUQ B;  4R1J A;  1W6K A;  4WFN 3;  2RSN A;  4DNI A;  3R2T A;  1WTH A;  3UI2 A;  3CQZ H;  2O4X A;  3CCV A;  3L2P A;  3IL8 A;  4UAI A;  3D0F A;  2UUC L;  5IGB A;  3OW7 A;  3MFG A;  3S24 A;  5C6A A;  2DUD A;  4FVM A;  1PRT B;  1BBU A;  1TWF B;  1O78 A;  4APV A;  3HZX A;  2NN6 I;  3J81 i;  3NPP A;  2K5Q A;  1GUS A;  1SJH D;  1S5E D;  5EBC A;  3T13 A;  1SEB D;  4FDB A;  2KUM A;  3JAM L;  5C0X G;  1JJC B;  2F1M A;  3A8J E;  5FLM G;  3HKZ E;  4HSP A;  2K5H A;  1C0A A;  2E2J B;  1SNQ A;  1GD7 A;  1PH2 A;  4YIJ A;  1ML0 D;  4NKL A;  2B3G A;  3HOY H;  1EEF D;  1TVX A;  4R4O A;  2I07 B;  5E7N A;  2G5D A;  1PDQ A;  1L0W A;  5JJL A;  4LF4 L;  2F0J A;  3ZJY C;  4IPC A;  4H02 A;  4C2M B;  1K83 H;  1UE1 A;  2KEE A;  1QG7 A;  1LTA D;  4GLV B;  4MNO A;  2LY7 A;  2EQS A;  3TZU A;  1LT5 D;  3IRB A;  4LK1 C;  3K58 A;  1S40 A;  1WOC A;  1HZC A;  2JA5 G;  3GTL B;  2CCZ A;  2F4I A;  3J80 c;  3TME A;  4AQY Q;  5COY A;  2EY6 A;  1TWA H;  2RQX A;  4LUV A;  4L5Q A;  4Y7N B;  3U4V A;  4XQN A;  2R92 G;  3S2D H;  1I5F A;  4DV5 L;  3P20 A;  5GRO A;  5JOB A;  1S5C D;  4MHE A;  4FF2 A;  3JAM c;  4O42 A;  3OPO A;  2PPB C;  3PO3 H;  1J5E L;  4IUN A;  3WWV A;  5KRU A;  4OWW B;  1QWY A;  2YYZ A;  3CP0 A;  1VQK A;  5LL6 X;  2XSC A;  5IIF A;  1SYE A;  1XNR Q;  4XT1 B;  4YWL A;  4HJ8 A;  5A2Q L;  1CK1 A;  5IYD G;  1PHJ A;  3QOL A;  4LAA A;  1CKO A;  3PIP 3;  5M5X H;  2L55 A;  5A35 A;  2B2T A;  1PTO H;  1KAB A;  3DEO A;  1Y1V H;  2HDL A;  2AWO A;  3X3N A;  4IJL A;  1LYL A;  4O2D A;  1BDO A;  3MVV A;  3D4W A;  3KLS X;  4QIW E;  1XNQ L;  3K5O A;  2VL6 A;  2CQO A;  1I94 Q;  2Z6B A;  1BCP C;  2WFW A;  3GTQ B;  1PH8 A;  3ER0 A;  1NJI C;  1R9T B;  4A3K G;  2M00 A;  2HHH Q;  2KEN A;  1YHQ A;  2F0T A;  4K8I A;  4Z9C B;  5C5L A;  4J6H A;  1BCP F;  2NN6 H;  1C8C A;  2QDB A;  2J7Z A;  1GUW A;  3RNU A;  1NBW A;  1XMO Q;  3T1H L;  1JJG A;  1V1P A;  1KTK A;  4HIK A;  1C4Q A;  1VQF A;  4HR7 B;  1Y1W G;  1T9H A;  4K8J A;  2IWH A;  1U0L A;  5GAG C;  1L0Y B;  2OEO A;  2KHJ A;  4X3S A;  3U4Z A;  5IP9 H;  1I6H B;  5M5W H;  5LMN Q;  2HIX A;  1VF7 A;  3QB3 A;  1B9N A;  2KHI A;  1PFS A;  4LWC A;  3J80 i;  1FD7 D;  1SN8 A;  1CUK A;  3T51 B;  2MNA A;  4B3R Q;  2UXB L;  3MAQ A;  2E2I H;  2LMC B;  1XMQ Q;  1G6Z A;  1LT3 D;  4DR5 L;  3TP7 A;  4ZCK A;  1L1O A;  4CDE C;  2CWP A;  3ZYY X;  2LXK A;  3J81 E;  4LFA L;  2AMC B;  5BR8 L;  1JOO A;  4L5S A;  2RKS A;  1WCM B;  3B6Y A;  4A3E B;  5JJK A;  5CC4 A;  5IGE A;  3QOJ A;  2I46 A;  1VQC A;  3DUZ A;  4MTN A;  3T16 A;  2R7Z H;  1NTG A;  5K36 G;  1SMY C;  1I4G A;  5EJW A;  2NVX B;  3S9W A;  5D65 A;  3A55 A;  3CAM A;  2IPK D;  3ND9 A;  4K14 A;  1STG A;  1RTN A;  2L9H A;  3PF5 A;  1IBK Q;  4O1N A;  1SSO A;  1J6Q A;  2Z4I A;  5GQO A;  4DV4 L;  3GTJ H;  2A1A A;  2JA8 G;  4DV0 L;  3D6W A;  4LJZ C;  1HNW L;  3W1G A;  3CCJ A;  4YCV A;  4A3D G;  4JV5 L;  2B63 G;  4A4I A;  1B1Z A;  4OIK A;  4A3G H;  5AJ3 L;  1Y8N B;  5GAH C;  2JYO A;  4GN3 B;  4B3M L;  2Q2T A;  4J8Q A;  4XT3 B;  3PIO 3;  2B2Y A;  1RF2 D;  4OHJ A;  1CT1 D;  5JVH 3;  2K4K A;  5FO8 B;  4LF5 Q;  4X3T A;  3CCQ A;  1IHZ A;  2R7D A;  1J8I A;  2BA0 A;  3J81 j;  4N9P A;  4EGV A;  3M7G A;  4C56 C;  1E22 A;  1VQH A;  1ILQ A;  4J1M A;  2H4O A;  4G7Z C;  3DWP A;  2D9U A;  1PYS B;  4P71 A;  4A3F H;  2GVB A;  1HXY D;  1SRU A;  4KMU C;  1E3P A;  1QE6 A;  2NVQ B;  1U5K A;  4EQO A;  2ZTC A;  3I4M B;  2YTX A;  3HOY G;  1JWM D;  3I90 A;  5H1S E;  4DR2 L;  2PW7 A;  3PF4 A;  4J15 A;  1HA5 A;  3M85 A;  1ZYR D;  2TSS A;  3K7U C;  3P1H A;  3NP8 A;  1YNN C;  4K0K L;  1D7Q A;  1YNN D;  4LFC L;  3PUY A;  1PH1 A;  4IZ8 A;  3QIA A;  3QWN A;  3F2C A;  5FO7 B;  4LFB Q;  4ZRZ A;  3NBI A;  2IT1 A;  1I4H A;  1H9M A;  1D5M C;  1E2Z A;  2JA7 H;  1I4Q A;  4KKU A;  4K5X A;  4GOP A;  2CHB D;  4G57 A;  2ZJP A;  4LF9 Q;  5FLX c;  4FXG C;  3D6C A;  1BOS A;  4JG2 A;  1HA6 A;  5C3E B;  2ZTE A;  1PV4 A;  3S14 H;  4X66 Q;  4DK6 C;  1AE2 A;  4HMJ A;  3L7Z C;  2HCI A;  4BBS B;  4A3M H;  1YZ6 A;  3HGB A;  2X69 A;  3EIV A;  2IHE A;  1VMC A;  4RCN A;  4DNT B;  5C4X G;  4AYB G;  3JAM E;  1IL8 A;  3KLR A;  1HR0 L;  1UE5 A;  4JBW A;  2E5L Q;  1Y1V G;  1ET6 A;  2A69 D;  1W2B A;  3BJU A;  3NE5 B;  4KI0 A;  2CQA A;  3K80 C;  1K3B C;  5T1G A;  1I4R A;  3K81 C;  1FVI A;  1AFP A;  5I6W A;  2GA4 B;  1RHP A;  2QF7 A;  5E1F A;  3D4R A;  2UUC Q;  2WV6 D;  2K7V A;  1MSH A;  4UP8 A;  3K0Y A;  2Q2H A;  3RD4 A;  4C3J B;  2KCC A;  3HP3 A;  4YHH Q;  1BVS A;  1Q90 A;  5GAE C;  4PMW A;  1X3P A;  3MXU A;  1CSP A;  2NN6 G;  3AYH B;  1GHJ A;  2BDO A;  4HAE A;  1S5D D;  3HOX H;  1EU4 A;  5JJZ A;  3S15 H;  1B3A A;  2VS1 A;  3VA5 A;  4DXG A;  3F2B A;  2F0M A;  1BUV T;  3C46 A;  2JXM B;  2R93 H;  2OCE A;  2CH4 A;  1G2S A;  1VQO A;  4QL5 A;  3M4O H;  3V05 A;  3H15 A;  1B2T A;  3L9A X;  4TQU S;  1WTR A;  5IP9 G;  1IW7 C;  1SJE D;  3KBX A;  1CKN B;  2HT1 A;  3FPU B;  3I72 A;  2XGT A;  3SVM A;  2JA6 H;  3K7A H;  3HOU H;  2VXW A;  1MJC A;  1PTO C;  4B9X A;  2F0P A;  4LF4 Q;  1U9R A;  4JI8 Q;  5JEA H;  4UY8 C;  3FEW X;  2VY3 A;  1B7Y B;  4HTH A;  4IPD A;  4EQ5 A;  5A2Q E;  1ILP A;  1GUT A;  1QNU A;  1CHQ D;  4X62 L;  1GVP A;  1E24 A;  3CCU A;  5I4D A;  1PTO F;  3I2Z A;  3S17 H;  4KJN A;  4X3U A;  3AEV A;  2EYF A;  4JYA L;  1A3V A;  3CCE A;  1D1K A;  2R7Z G;  1Q82 C;  1GHK A;  3KLW A;  5DAU A;  2XNA C;  1PZI D;  1PYB A;  4I7A A;  3S1N H;  4IUT A;  5FKA C;  2A68 C;  4A93 H;  4FF1 A;  1A6X A;  1R4P B;  3FKI H;  4ALP A;  2QEJ C;  2H5X A;  1EQQ A;  2Q2U A;  3NUC A;  1HZ9 A;  3PSI A;  2ZXP A;  4DR1 L;  2VQE L;  4HJ7 A;  1AZP A;  3PIO A;  2JA5 B;  1HFN A;  2VNU D;  4A3B G;  2KCM A;  2FJ2 A;  1A15 A;  3J7A 5;  4A3G G;  2B39 A;  4KY7 A;  4N8F A;  1JC7 A;  1XX8 A;  4BXX H;  4DA2 A;  3RLN A;  1STB A;  1Z7T A;  3E6Z X;  3OTO Q;  4PZ6 A;  4C3I H;  4HJ5 A;  4HCE A;  1EU3 A;  3BZD B;  3Q23 A;  2EDG A;  1QVC A;  5DM6 3;  4MTK A;  1TY2 A;  4XTC S;  4BBR H;  3KF6 B;  3AFQ A;  1VQ5 A;  1VQN A;  2WAQ G;  2NTT A;  3L3O C;  2EY5 A;  3I73 A;  3RZD B;  3HOV B;  1TT2 A;  2V1C C;  1TS4 A;  4F87 A;  4DUZ Q;  1D5X C;  5C44 B;  3HOZ H;  2O5I C;  1MIU A;  2NBF A;  1SBB B;  3NEM A;  3T53 B;  1YNJ D;  1MD2 D;  3KLS A;  4NDX A;  2L4N A;  4WRD A;  4DAY A;  1VQJ A;  3GTG B;  4A3F G;  1VQ6 A;  3SXH A;  3OHX C;  1L1O C;  2EYL A;  3QO2 A;  2UUA Q;  1W6J A;  2MGS A;  1F2L A;  2AUJ D;  3S1Q H;  4DV6 L;  2F0H A;  1CZW A;  3S2H H;  1JB7 A;  2Z6K A;  2RBM A;  2H1E A;  2FHT A;  4JI3 Q;  2UXB Q;  4GLX A;  4IJH A;  4FXD A;  3A54 A;  1SRO A;  4DR5 Q;  1S72 A;  1EYC A;  4LF6 L;  5FK9 C;  3E3X A;  1PVO A;  2UXD L;  1Y1W B;  4FNF A;  4WJ4 A;  2L0C A;  1ROD A;  4RAU C;  4A3I H;  4XIG S;  3F8T A;  5ELC A;  3CME A;  2SNS A;  1A2U A;  1BKB A;  4XDX A;  2M2L A;  2Q8I B;  2JA7 G;  1YNX A;  3CCM A;  4DR6 Q;  2Q2I A;  1MSG A;  1TWC B;  4IAL A;  2Q8T A;  3T56 B;  2NB0 A;  1N36 Q;  3EN2 A;  3K5M A;  1NMF A;  4DV1 L;  1HQR D;  3G6E A;  2N3S A;  4LNQ A;  3P7J A;  3CHB D;  3AFP A;  5J22 A;  4RGN A;  3CC7 A;  2V4D A;  5IWA Q;  1HNW Q;  3S16 B;  2L1B A;  3W2D A;  2A5H A;  4LF8 L;  3NEN A;  2PZU A;  3RMH A;  1WYD A;  3G7L A;  1GKH A;  4F7X A;  5AJ3 Q;  5G3L F;  1SFO B;  1JCK B;  4IUV A;  4P74 A;  1Y14 B;  3LX0 A;  1NR4 A;  3UE0 A;  1QOH A;  4NXN Q;  1EWC A;  2UU9 Q;  2ZXR A;  3H0G B;  4MIU A;  4B3M Q;  2E2H B;  1VQI A;  2Y0S E;  4A3C G;  2VQF Q;  1P8L A;  3U58 A;  4QY7 A;  4QUF A;  2ICE C;  1X55 A;  2JA8 B;  4JI4 Q;  3GTP H;  2MJ8 A;  4QB4 A;  1B44 D;  2UXC L;  3GDE A;  4PMC A;  4ME3 A;  5JAV A;  2B63 B;  1DD2 A;  1F9Q A;  2F4V L;  5FJ8 H;  1GO3 E;  3HOX G;  4GKJ L;  3K59 A;  1Q8K A;  1QUQ A;  3K8A A;  1PLF A;  1PH5 A;  2OTL A;  1Z9F A;  1X3E A;  2R93 G;  5ELB A;  2JQO A;  2PO4 A;  4CDC C;  4K2L A;  1BBW A;  4CJ1 B;  1IKL A;  1JWU D;  3F2U A;  3L0O A;  4A75 A;  1LAB A;  4ODG A;  1HTL D;  2DNE A;  4DKA C;  3BDO A;  1ET9 A;  2PQE A;  3OW2 A;  2SEB D;  3MEF A;  2KBN A;  5M3M B;  3NQT A;  1XPO A;  4K6D A;  2JA6 G;  1YI2 A;  2FFK B;  1JR0 D;  1ICF B;  3C1E A;  3KYH C;  2AQ3 B;  4HSV A;  5C3X A;  2RHQ B;  4IPH A;  4GOP C;  4IOC A;  1CTM A;  1CA5 A;  1VQA A;  3SHL A;  4LFC Q;  2IX0 A;  1TII D;  1I3Q B;  4QGU A;  3CXC A;  4POF A;  2SNM A;  2R61 A;  2SOB A;  3T1Y Q;  5EKL A;  5GAD C;  2A73 B;  5E4X A;  4L5R C;  1I50 B;  4DV2 L;  3HOW H;  4P73 A;  2CWA A;  1PH7 A;  4NXM Q;  3HOY B;  4KHP Q;  1NSN S;  1ESR A;  3KJO A;  2AHO B;  1YBY A;  3KF8 A;  1Q3L A;  2N78 A;  3OMG A;  1YHB A;  3KF8 B;  3M3Y H;  1HHV A;  1AE3 A;  4A93 G;  4B08 A;  1F2Y A;  1DOM A;  4IUU A;  3FKI G;  2DNC A;  1CQF A;  2Q8R E;  2BOS A;  1VF5 C;  3CW2 C;  1PZJ D;  3FPP A;  1F2M A;  5M9O A;  4YWM A;  1DYQ A;  2E2J H;  2F0V A;  3KDF B;  1JIC A;  1HR0 Q;  1JOR A;  2VUM G;  2IHF A;  2XIW A;  2UUB L;  3K5N A;  4C3H H;  5I2Y A;  1A3T A;  1RDP D;  1TWA B;  3VR2 A;  5KGU A;  1EFW A;  4HIM A;  1XPR A;  1QB5 D;  4OIJ A;  2OT2 A;  5COR A;  3FP9 A;  5J3B A;  4HIO A;  4OXP A;  4BBR G;  1VQB A;  2O2L D;  5C4X B;  5M5X B;  1N33 L;  3GTL H;  1YIJ A;  3OOC A;  2WB1 G;  1PTO B;  1V9P A;  2WKC A;  5KIX A;  4R9W A;  1Y1V B;  3DM1 A;  1N34 Q;  1BQQ T;  4GKK Q;  2FXQ A;  1C7Y A;  2D2C C;  4KY6 A;  2OWO A;  4A3L H;  4YWK A;  4OX9 L;  2JEB I;  1F9R A;  3GTK B;  2D0O A;  1P16 A;  5IY0 A;  1FNV A;  4JI6 L;  4DV3 Q;  4FYD A;  2PMZ B;  1B8A A;  3FRP B;  1EFI D;  5IT9 L;  2C9O A;  4X6A H;  1SLJ A;  4JK1 C;  3CRK C;  2G9D A;  1SE3 A;  1VQD A;  4RHS A;  4DR4 L;  5LMU Q;  2QKI C;  1VDZ A;  1X65 A;  3J7A V;  3VYT A;  1IYU A;  2B8G A;  3LNN A;  2NVY B;  3TP5 A;  4PQX A;  2IX3 A;  4B3T L;  3MWY W;  3N52 A;  1XXG A;  4ZYS A;  3BDL A;  4JI1 L;  4X62 Q;  4Y52 H;  2QW7 A;  3VYS A;  1CHP D;  2DY8 A;  2ZM6 L;  2QDL A;  3R93 A;  4DR3 L;  3HFZ B;  4A3I G;  5KEE A;  4H44 C;  3GTQ H;  1I4P A;  2B8F A;  4JYA Q;  1GUN A;  4C1N I;  1U4R A;  5M5Y H;  1PMR A;  2CVR A;  2WAC A;  3GD7 A;  2B2V C;  3DMU A;  1D5Z C;  1EIY B;  1HNZ L;  1UNS A;  1JOQ A;  2WP8 J;  3KK7 A;  4DAP A;  4JI5 L;  2TMP A;  2HQE A;  2E2I B;  4CHT B;  5ISR A;  2X6G A;  3STB D;  1GM5 A;  1TWH B;  4DUY L;  3HEJ A;  4GNX C;  2K04 A;  1EEI D;  3JAM i;  1PH3 A;  4LF7 L;  5J1Z A;  1BXT A;  1DXM A;  3R8B A;  1W3S A;  2EYH A;  2A6H D;  4UHV A;  3J7Y W;  1FGU A;  1QCB D;  4XYQ A;  1I6H H;  3TN2 A;  3FMC A;  2EJF C;  3TQY A;  3BZK A;  5D14 A;  1N32 L;  2BE5 C;  1K8O A;  1EQR A;  1TWG H;  2R7Z B;  1Q7Y C;  2BE5 D;  4XXE A;  3NWS A;  4ZAI A;  5KND A;  5KNB A;  4B3S L;  2CKZ B;  1NY4 A;  1SE4 A;  3UDX A;  4C1N K;  1B9M A;  2K1B A;  2MPM A;  3PMF A;  4KHV A;  1X3G A;  2WIN B;  4OL7 A;  3GTJ B;  1H9R A;  1EZ8 A;  1ONL A;  4R8N A;  1ASY A;  2ZXO A;  1EWI A;  1WCM H;  3HS0 C;  3E0E A;  4RHR A;  4A3B B;  5FJ8 G;  2L11 A;  3OMC A;  1NAP A;  3J7A F;  3VA7 A;  2ATW A;  4Q0F A;  3I8Z A;  4JI7 L;  2F0D A;  1Y8P B;  3KBG A;  2LS0 1;  4K5W A;  2NVX H;  5BN5 A;  1IBL L;  2MP1 A;  1ICW A;  3BG3 A;  4DV6 Q;  3C3L A;  1WFQ A;  3H6M A;  1F2Z A;  3MZ5 A;  5IE8 A;  2WAQ B;  4RWS C;  3Q24 A;  1K0S A;  1BNZ A;  3PO2 B;  2K03 A;  1O80 A;  4DF7 A;  3PUZ A;  3RN5 A;  2CFM A;  4LW1 A;  3CKI B;  3NQI A;  4A3F B;  4PG3 A;  1V1Q A;  1IBM Q;  2JE6 I;  2B2U A;  1O7I A;  3NTK A;  4TSS A;  1AZQ A;  1VQL A;  4DR7 Q;  3HOW G;  1IZ6 A;  1FR3 A;  5M3F H;  3EFX D;  1WTQ A;  1SNO A;  5E4W C;  1FNU A;  1FJG L;  1WVL A;  1ZYR C;  1CI3 M;  1NMG A;  3URY A;  4JI0 L;  1G8Z D;  1G2T A;  3ULP A;  2BA1 A;  2EY2 A;  2I0Q A;  1H95 A;  1PA6 A;  1A0I A;  1I6V C;  1ENC A;  1PH4 A;  1KQS A;  3ONA B;  1HRJ A;  2NVQ H;  4L8J A;  4XQQ A;  3I4M H;  2ZJQ A;  4C3H G;  1UWV A;  3EVQ A;  4UP9 A;  4OWX B;  2DN8 A;  1AH9 A;  2F0O A;  2AUK A;  2KED A;  1KDB A;  5IGF A;  4KHZ A;  5JJI A;  4PMB A;  1E2W A;  3FDT A;  4X65 Q;  3PIP A;  3PO3 G;  5IYB H;  2K05 A;  1QVG A;  3UDI A;  1PZK D;  5LMN W;  3VR4 A;  1MI2 A;  5ELF A;  3Q6S A;  1HUN A;  4K6L A;  3D3R A;  2FMC A;  3V96 A;  2F4V Q;  4GKJ Q;  4DV7 L;  1PRT C;  4WJ3 M;  2JP1 A;  1PRT D;  2A69 C;  4JOI A;  4IFD I;  4A3L G;  1IL2 A;  4PV1 C;  5C3E H;  4I7Z C;  4RGM A;  1ZXT A;  4KJO A;  3LWU A;  2X6L A;  2XRQ D;  3GQB A;  1BR9 A;  2E2D C;  3TP8 A;  1JOK A;  4A3J B;  4FF3 A;  5D3D A;  1JQY D;  2L5T A;  2P5Z X;  4F88 A;  1H9J A;  1DZ1 A;  2C35 B;  1PH9 A;  3H3V I;  4IOA A;  4ZLT F;  3NWT A;  1Q1E A;  4ZK9 B;  4QQB X;  1DCZ A;  5CV8 A;  2XWJ B;  2EYO A;  4GN5 A;  4NW2 A;  4M8A A;  3Q22 A;  3SK6 A;  3HOX B;  1K3R A;  1AEX A;  4AQY L;  3I4N H;  3UDG A;  2KHS A;  4RGO S;  2R93 B;  3ULJ A;  1SAP A;  1GXD C;  5IP7 H;  4R4Q A;  1RKN A;  1JMC A;  4DV2 Q;  1TKW B;  3M4O B;  4ZQ3 A;  3VYR A;  1OXX K;  2RA4 A;  2NZH A;  1UUP A;  1CKN A;  1KNE A;  4C3J H;  1UE7 A;  3T4A C;  1CSQ A;  3OWE B;  3TRE A;  2OTJ A;  3OYY A;  4TVA B;  1VQE A;  4YCU A;  1IYV A;  4IUR A;  1OXV A;  3S1M B;  3MXG A;  4ULL A;  3RZO H;  4BA2 I;  2J0T D;  1EWH A;  3NXW A;  3H09 A;  3NTH A;  2JK8 A;  2VB3 X;  3S17 B;  1I94 L;  1SXT A;  3CF5 A;  5CV4 A;  2JEA I;  1EUJ A;  1S4Z A;  4PNY A;  1X32 A;  4NMZ A;  2I5H A;  3I70 A;  5DEH A;  1M90 C;  3WOE A;  5HGT A;  3DM3 A;  1JWS D;  4Q5V A;  5IT9 E;  2F0U A;  2VB2 X;  2YTY A;  4DV5 Q;  2B2T C;  1QZH A;  1YEZ A;  4A93 B;  5C0X H;  3FKI B;  1SE8 A;  3I91 A;  1J5E Q;  1MKH A;  1BCP B;  4DPG A;  1VQ7 A;  4CJ2 C;  5EAY A;  2BH2 A;  2B2W A;  3I56 A;  1ESF A;  1LTR D;  1KDC A;  1KRT A;  1MHW C;  4JBK A;  3TS2 A;  1SYC A;  2VUM B;  1E1T A;  3V2T A;  3C1F A;  2YU9 B;  2EXD A;  1KXL A;  2K52 A;  4IFD H;  4GS3 A;  3SR1 A;  2R92 B;  3DXJ C;  1EY4 A;  4V19 0;  4RGT A;  4JI6 Q;  1XNQ Q;  1WJJ A;  4LUZ A;  5ELO A;  3QR8 A;  4HCS A;  3NTI A;  1XMQ L;  3C2P A;  1EYD A;  1EIF A;  3GTO B;  2K01 A;  1ZEQ X;  4BY1 H;  1R4Q B;  4GZY C;  3BVZ A;  2MO0 A;  3KF6 A;  1MBY A;  4HED A;  2RF4 A;  2YTV A;  1WTP A;  3H3V H;  5JEA J;  3TSS A;  2F3W A;  2JA5 H;  2WB1 B;  1E0B A;  1E7Z A;  1K0R A;  2A6E D;  3I4L A;  1CM9 A;  4RH6 A;  1YNJ C;  3T1H Q;  1II3 A;  2ZM6 Q;  2QGQ A;  4CDF C;  3X3M A;  1QVF A;  3D8G A;  3CPF A;  3M4P A;  1EOT A;  5EQ0 A;  3S1Q B;  1IBK L;  3K5L A;  4HMI A;  4RCO A;  2JJQ A;  1ASZ A;  5M3F G;  4A3K B;  3BVM A;  3GV6 A;  2QA4 A;  1HNX L;  3PGZ A;  1KLG D;  1DM0 B;  3M4Y A;  4GLA C;  3KUP A;  3RZD H;  3A0J A;  3HOV H;  1K8G A;  3M4Q A;  4RA8 A;  3J81 L;  3IFT A;  2PNR C;  5CV7 A;  1LM0 A;  4KKS A;  3DLL A;  3FVQ A;  5C44 H;  2NVT B;  1KNA A;  2IX1 A;  2HIV A;  3WOF A;  2RSO A;  3GTG H;  1HCZ A;  1D6E C;  4LFA Q;  4EX5 A;  2K5N A;  3CRL C;  5BR8 Q;  5HGQ A;  3IAY A;  4JI2 L;  2PQA B;  2B29 A;  3GTM H;  1Y8O B;  2VW9 A;  1Z47 A;  1N32 Q;  5ELD A;  1XPU A;  2I5L X;  1S3O A;  4G7H C;  2ASB A;  2R7F A;  1KHI A;  4O0A A;  1A3U A;  4WJW A;  4HJA A;  1CKM A;  3J7Z C;  4DK1 A;  4ZUI A;  1KLU D;  5IGC A;  5C4J H;  3M7N A;  1BBX C;  1TS2 A;  2YV5 A;  3SEB A;  2MFI A;  4A3M G;  4DV4 Q;  1F9P A;  1EY6 A;  4RKL A;  4DV0 Q;  2B2Y C;  3LGJ A;  4BY7 H;  2ZT9 C;  2ENB A;  2Y0S G;  2DGY A;  1LTB D;  4JBJ A;  4HJ9 A;  4JV5 Q;  3G4S A;  3VDY A;  3SK5 A;  4K0K Q;  3MEH A;  3SK8 A;  1KD1 C;  1X3Q A;  1TWC H;  1STN A;  2E76 C;  5C3E G;  2AQ2 B;  3EQL C;  2LFN A;  2JA9 A;  1YJW A;  3QJY A;  2NUC A;  3S1R B;  1QIL A;  2F52 A;  4P75 A;  1TU2 B;  3ITP A;  4CKC A;  3NK9 A;  3S16 H;  2EYJ A;  2N55 A;  4DAV A;  1FL0 A;  3E0J A;  3CC2 A;  4LFB L;  4OO1 I;  4FF4 A;  5IGD A;  4A3D B;  2OXP A;  5CBE E;  4NB3 A;  4ZKB B;  1D2B A;  5CBA E;  2EY1 A;  3TRZ A;  1VMP A;  3I4N G;  5C3W A;  2XWB B;  5E3F A;  3H0G H;  3CC4 A;  3TBI B;  1B50 A;  1YVC A;  4X66 L;  1OXT A;  4CKE A;  2HCC A;  3CQZ B;  2HD3 A;  5DM7 3;  2K5W A;  4DFA A;  4EVO A;  1PFN A;  2XTI A;  5JPM C;  5FO9 B;  2R6G A;  2N88 A;  4C3J G;  1FJG Q;  4DR2 Q;  1I4X A;  4M1U B;  3HOU G;  3HKZ G;  4JW0 A;  4HN7 A;  2E5L L; 
#chains in the Genus database with same CATH homology
 2F3V A;  5JEA G;  5T1I A;  3BVG A;  1OXS C;  3HOW B;  1Q1B A;  1B4O A;  1H9K A;  1EQT A;  1Q12 A;  2MUY A;  3ND8 A;  5CGK A;  1RCV D;  3J80 L;  2PYK A;  1D1I A;  1DOL A;  1WTO A;  1SE2 A;  3M3Y B;  1PXU A;  1ENF A;  1K83 B;  3K6O A;  1XWE A;  3U9O A;  5J39 A;  3A8K E;  4H7B A;  1WTW A;  2K28 A;  1O7Z A;  3PUW A;  3IFD A;  4C3H B;  5K5P A;  4QMG A;  1ZKO A;  3TP6 A;  4H13 C;  4CBV A;  4IFD G;  2M9V A;  3S2D B;  3MFY A;  5KYI A;  1TS5 A;  2FMM A;  1TY0 A;  3PO3 B;  4C3I G;  3PUX A;  1PFM A;  4OO1 H;  2EZV A;  4AYB B;  3VR5 A;  1A2T A;  3ERQ A;  2EXZ A;  1TQO A;  1EYA A;  3W3A A;  5CMD A;  2BDN A;  5JPN C;  3LWE A;  4KN4 C;  5CV5 A;  1EY7 A;  3A7A B;  5C5M A;  3BYT B;  2JSO A;  4DXF A;  1S5F D;  1TS3 A;  2K33 A;  3OSO A;  1EY9 A;  2HDM A;  3AMU A;  3D31 A;  3GV3 A;  1GUO A;  1UAP A;  2FIN B;  1U4M A;  1DON A;  1M4V A;  2MHV A;  1BCP D;  5M5Y B;  5M5W B;  2B2W C;  3H3V C;  2RDG A;  1SYG A;  2J4X A;  5AFW A;  2PW5 A;  3AB9 A;  1LTI D;  4U67 3;  2PZT A;  1V1P B;  2NWG A;  5TSS A;  4G7O C;  1AP0 A;  2A6H C;  2IJ0 A;  1LTS D;  1RJT A;  2D5D A;  2XN9 C;  4KD3 A;  1TWG B;  1SYB A;  3H91 A;  3O13 A;  1STY A;  4KK7 A;  1SYF A;  3SDZ A;  2ID0 A;  3P75 A;  1HTP A;  4V0B A;  3BYY B;  2EYM A;  1SND A;  1UEA B;  5EPJ A;  4B9W A;  2EJM A;  2G9H D;  1STE A;  5I9P A;  2F0E A;  1AW7 A;  2EYP A;  3DWQ A;  4IUQ A;  4A3G B;  4LMQ D;  4ZUJ A;  3MC0 B;  1SMY D;  1V8Q A;  2KQ3 A;  2QCP X;  4F8M A;  2E74 C;  4ILW A;  4IQZ A;  4EQN A;  2PCF B;  2F0K A;  1FGB D;  2LKV A;  1PFB A;  2PZW A;  5LHY 1;  4DN4 M;  3E5S A;  4KY5 A;  4R8I A;  1QJO A;  2K6A A;  5HUR A;  2EOT A;  3OWF A;  5EPL A;  1CA6 A;  3GO5 A;  1MGS A;  4IN3 A;  2EE1 A;  5M3F B;  5JVG 3;  4H0L C;  3NHH A;  5IOC A;  1V43 A;  1DJR D;  1EY5 A;  1O7L A;  1GUG A;  5FLX L;  1Q8I A;  5KNC A;  4DK0 A;  2A74 C;  1WD1 A;  1SDF A;  5EGT A;  5I6Y A;  3OIP A;  2OF1 A;  2R3Z A;  4DNR B;  3DWA A;  3BS1 A;  1NUC A;  2K5D A;  2IW3 A;  2JA7 B;  4KV6 A;  4NP5 A;  3K57 A;  1SNP A;  1L0X B;  3NBH A;  3S14 B;  1CZG A;  2EJG C;  3A56 A;  5EKI A;  5C0X I;  4KKT A;  4A3M B;  2Z8L A;  2D62 A;  1S5B D;  4OO1 G;  5FOB B;  2Y0S B;  3WDN A;  3SE0 A;  2Z4H A;  3U9S A;  4CJ0 B;  1EY0 A;  1HPC A;  1T5E A;  1KAA A;  1XTC D;  1JE4 A;  4UDU C;  1SYD A;  4KTA A;  3CU7 A;  1E2V A;  3J80 E;  1PRT F;  5IGG A;  4X3K A;  2F0N A;  1LT6 D;  3BDC A;  1F9S A;  4MN3 A;  2KCN A;  1HUM A;  2RDH A;  2F0G A;  1CQV A;  3A8I E;  3H94 A;  5CYU A;  3QG1 A;  1G29 1;  3PUV A;  3I4N B;  2K32 A;  3VYU A;  3S15 B;  1H9S A;  1TR5 A;  1ENA A;  1H9S B;  2F0S A;  5DNF A;  1O7Y A;  3A7L A;  1U4L A;  5BN3 A;  3G6J B;  1LTG D;  4QF4 A;  5NUC A;  1K8M A;  3OIQ A;  4XQJ A;  1J9O A;  2JA6 B;  3K7A B;  2KVM A;  3HOU B;  2F0Q A;  2F03 A;  3HKZ B;  1BO0 A;  4FP5 D;  4RFB A;  3RZO B;  1V1O A;  3AU7 A;  3EJI A;  3MXN A;  3VR3 A;  3GP7 A;  4ZKC B;  3NSW A;  5C4H A;  2AWN A;  1IW7 D;  5F2D A;  3D4D A;  1FYC A;  4S3S A;  5CV6 A;  4N9T A;  1WTX A;  1LAC A;  1DOK A;  1Y69 U;  2F0W A;  1PTO D;  3S1N B;  2SDF A;  3MHB A;  5KYL A;  4RKB A;  1M8A A;  4U68 A;  3SK4 A;  4IUP A;  2ICI A;  4BS9 A;  4XYO A;  2AQ1 B;  4DGZ A;  1WD0 A;  4TKO B;  4E6I A;  2C5C A;  2WII B;  5EKK A;  3VR6 A;  1GJX A;  2HUG A;  1OO9 B;  4G4K A;  2F0L A;  1VCI A;  3R2I A;  1XYI A;  2L12 A;  4BY1 B;  4C3I B;  4ID6 A;  1LTT D;  2A68 D;  2WKD A;  2KOL A;  2QIL A;  2B2V A;  4OGQ C;  2BCO A;  4BBR B;  3Q0A A;  4QIW B;  2EVB A;  2A6E C;  2F0I A;  1EIG A;  2KEC A;  1U4P A;  1STA A;  2XRS D;  1GOZ A;  1HFG A;  3HOZ B;  4EQP A;  2DY7 A;  5CV9 A;  3MA2 B;  3PV0 A;  1LLR D;  3EA6 A;  3I3C A;  4CGY B;  1CFM A;  4P2C B;  3ERO A;  1EY8 A;  3R3O A;  3S2H B;  5LL6 S;  2EPB A;  2NYZ D;  5C0X J;  3MXP A;  4K5V A;  1KDA A;  1G91 A;  4I65 A;  4KD4 A;  4ABN A;  1HQM C;  2F0F A;  5BN4 A;  1AN8 A;  5D3I B;  3TDQ A;  4BWG B;  1STH A;  1SNM A;  3IKJ A;  1EIH A;  4A3I B;  5C4Z A;  5CR3 A;  2CW0 C;  1C48 A;  3DHQ A;  3GTM B;  4IFD J;  2KJX A;  2CW0 D;  2NZ1 D;  2RVL A;  1EQV A;  1F77 A;  3N6R A;  4K2K A;  1FNW A;  5C4J B;  1EZ6 A;  2O5J C;  2E75 C;  5I9O A;  4BY7 B;  1LV9 A;  1BF4 A;  5EPK A;  1RD9 D;  1LO5 D;  3RLF A;  4DU9 A;  1EL0 A;  5I2X A;  4ME5 A;  3HG9 A;  2KA7 A;  1JB3 A;  4KN7 C;  4QUC A;  5G3L D;  5FLX E;  3MTS A;  1IKM A;  2B2U C;  4TRD A;  3GTP B;  5IOD A;  4FO2 A;  1QNK A;  2NTS A;  4CKB A;  1NCV A;  2RDF A;  4L6T B;  1B53 A;  1T5X D;  2IL8 A;  4L63 B;  5K36 H;  1OXU A;  4BA1 I;  1LT4 D;  4QCL A;  2XVS A;  1PYW D;  3TZD A;  5EBD A;  1WTV A;  3HRZ C;  4FXK C;  1RTO A;  5ELE A;  2Z1C A;  4WOR A;  3RUZ A;  3DEP A;  1NR2 A;  1Z6H A;  1SNC A;  1W6K A;  4WFN 3;  2RSN A;  3R2T A;  3UI2 A;  2O4X A;  3IL8 A;  4UAI A;  5IGB A;  3OW7 A;  3MFG A;  5C6A A;  4FVM A;  1PRT B;  1TWF B;  1O78 A;  3HZX A;  2NN6 I;  3NPP A;  2K5Q A;  1GUS A;  1SJH D;  1S5E D;  5EBC A;  3T13 A;  1SEB D;  2KUM A;  3JAM L;  5C0X G;  2F1M A;  3A8J E;  4HSP A;  2E2J B;  1SNQ A;  4YIJ A;  1ML0 D;  4NKL A;  1EEF D;  1TVX A;  2I07 B;  1PDQ A;  2F0J A;  4C2M B;  2KEE A;  1QG7 A;  1LTA D;  2LY7 A;  3TZU A;  1LT5 D;  4LK1 C;  3K58 A;  3GTL B;  2F4I A;  3TME A;  5COY A;  2EY6 A;  2RQX A;  4Y7N B;  4XQN A;  3P20 A;  5JOB A;  1S5C D;  4MHE A;  4FF2 A;  4O42 A;  3OPO A;  2PPB C;  4IUN A;  5KRU A;  1QWY A;  2YYZ A;  5LL6 X;  2XSC A;  5IIF A;  1SYE A;  4XT1 B;  5A2Q L;  1CK1 A;  3QOL A;  4LAA A;  3PIP 3;  2L55 A;  5A35 A;  2B2T A;  1PTO H;  1KAB A;  3DEO A;  2HDL A;  2AWO A;  3X3N A;  1BDO A;  3MVV A;  3D4W A;  3KLS X;  3K5O A;  1BCP C;  3GTQ B;  1R9T B;  2M00 A;  2F0T A;  4K8I A;  4Z9C B;  5C5L A;  4J6H A;  1BCP F;  2NN6 H;  1C8C A;  2QDB A;  2J7Z A;  1GUW A;  1V1P A;  1KTK A;  1C4Q A;  4HR7 B;  4K8J A;  2IWH A;  1L0Y B;  2OEO A;  4X3S A;  1I6H B;  1VF7 A;  3QB3 A;  1B9N A;  1FD7 D;  3T51 B;  3MAQ A;  2LMC B;  1G6Z A;  1LT3 D;  3TP7 A;  3ZYY X;  3J81 E;  1JOO A;  2RKS A;  1WCM B;  4A3E B;  5CC4 A;  5IGE A;  3QOJ A;  2I46 A;  3DUZ A;  3T16 A;  5K36 G;  1SMY C;  1I4G A;  5EJW A;  2NVX B;  3S9W A;  5D65 A;  3A55 A;  2IPK D;  3ND9 A;  4K14 A;  1STG A;  1RTN A;  2L9H A;  4O1N A;  1SSO A;  2Z4I A;  3D6W A;  4LJZ C;  1B1Z A;  4OIK A;  1Y8N B;  2JYO A;  4J8Q A;  4XT3 B;  3PIO 3;  2B2Y A;  1RF2 D;  4OHJ A;  1CT1 D;  5JVH 3;  5FO8 B;  4X3T A;  1IHZ A;  1J8I A;  2BA0 A;  4N9P A;  4EGV A;  3M7G A;  4C56 C;  1ILQ A;  4J1M A;  2H4O A;  4G7Z C;  3DWP A;  2D9U A;  1HXY D;  4KMU C;  1QE6 A;  2NVQ B;  4EQO A;  3I4M B;  1JWM D;  3I90 A;  2PW7 A;  1HA5 A;  3M85 A;  1ZYR D;  2TSS A;  3P1H A;  3NP8 A;  1YNN C;  1YNN D;  3PUY A;  4IZ8 A;  3QIA A;  3QWN A;  5FO7 B;  4ZRZ A;  3NBI A;  2IT1 A;  1I4H A;  1H9M A;  1D5M C;  1E2Z A;  1I4Q A;  4KKU A;  4K5X A;  2CHB D;  4G57 A;  1HA6 A;  4FXG C;  3D6C A;  1BOS A;  5C3E B;  4HMJ A;  3L7Z C;  2HCI A;  4BBS B;  3HGB A;  2X69 A;  1VMC A;  4RCN A;  4DNT B;  3JAM E;  1IL8 A;  3KLR A;  4JBW A;  1ET6 A;  2A69 D;  3NE5 B;  4KI0 A;  2CQA A;  5T1G A;  1I4R A;  1AFP A;  5I6W A;  2GA4 B;  1RHP A;  2QF7 A;  5E1F A;  3D4R A;  2WV6 D;  2K7V A;  1MSH A;  3K0Y A;  3RD4 A;  4C3J B;  2KCC A;  3HP3 A;  1Q90 A;  4PMW A;  1X3P A;  3MXU A;  2NN6 G;  1GHJ A;  2BDO A;  4HAE A;  1S5D D;  1EU4 A;  5JJZ A;  1B3A A;  3VA5 A;  4DXG A;  2F0M A;  1BUV T;  3C46 A;  2JXM B;  1G2S A;  3V05 A;  1B2T A;  3L9A X;  4TQU S;  1WTR A;  1IW7 C;  1SJE D;  3KBX A;  3FPU B;  3I72 A;  3SVM A;  2VXW A;  1PTO C;  4B9X A;  2F0P A;  1U9R A;  5JEA H;  3FEW X;  4HTH A;  5A2Q E;  1ILP A;  1GUT A;  1QNU A;  1CHQ D;  5I4D A;  1PTO F;  4KJN A;  4X3U A;  2EYF A;  1A3V A;  1D1K A;  1GHK A;  5DAU A;  2XNA C;  1PZI D;  4IUT A;  5FKA C;  2A68 C;  4FF1 A;  1A6X A;  1R4P B;  2QEJ C;  3NUC A;  2ZXP A;  1AZP A;  2JA5 B;  1HFN A;  2VNU D;  2FJ2 A;  1A15 A;  2B39 A;  4KY7 A;  1JC7 A;  1XX8 A;  4DA2 A;  1STB A;  1Z7T A;  3E6Z X;  4HCE A;  1EU3 A;  3BZD B;  3Q23 A;  2EDG A;  5DM6 3;  1TY2 A;  4XTC S;  2NTT A;  3L3O C;  2EY5 A;  3I73 A;  3RZD B;  3HOV B;  1TT2 A;  1TS4 A;  4F87 A;  1D5X C;  5C44 B;  2O5I C;  2NBF A;  1SBB B;  3T53 B;  4NDX A;  1YNJ D;  1MD2 D;  3KLS A;  2L4N A;  4WRD A;  4DAY A;  3GTG B;  3SXH A;  3OHX C;  2EYL A;  3QO2 A;  1W6J A;  2MGS A;  1F2L A;  2AUJ D;  2F0H A;  1CZW A;  2RBM A;  2H1E A;  2FHT A;  4FXD A;  3A54 A;  1EYC A;  5FK9 C;  1Y1W B;  4FNF A;  2L0C A;  1ROD A;  4RAU C;  4XIG S;  5ELC A;  2SNS A;  1A2U A;  4XDX A;  2M2L A;  2Q8I B;  1MSG A;  1TWC B;  4IAL A;  2Q8T A;  3T56 B;  2NB0 A;  3K5M A;  1HQR D;  3P7J A;  3CHB D;  5J22 A;  4RGN A;  2V4D A;  3S16 B;  2L1B A;  3W2D A;  2A5H A;  2PZU A;  3RMH A;  3G7L A;  4F7X A;  1SFO B;  5G3L F;  1JCK B;  4IUV A;  3LX0 A;  1NR4 A;  1QOH A;  1EWC A;  2E2H B;  2ZXR A;  3H0G B;  4MIU A;  4QUF A;  2ICE C;  2JA8 B;  2MJ8 A;  4QB4 A;  1B44 D;  4PMC A;  5JAV A;  2B63 B;  1DD2 A;  1F9Q A;  3K59 A;  1PLF A;  5ELB A;  2PO4 A;  4K2L A;  4CJ1 B;  1IKL A;  1JWU D;  3F2U A;  1LAB A;  4ODG A;  1HTL D;  2DNE A;  3BDO A;  1ET9 A;  2PQE A;  2SEB D;  5M3M B;  3NQT A;  4K6D A;  2FFK B;  1JR0 D;  3C1E A;  2AQ3 B;  4HSV A;  5C3X A;  1CTM A;  1CA5 A;  3SHL A;  2IX0 A;  1TII D;  1I3Q B;  2SNM A;  2R61 A;  2SOB A;  5EKL A;  2A73 B;  5E4X A;  1I50 B;  3HOY B;  1NSN S;  1ESR A;  3KF8 A;  1Q3L A;  3OMG A;  1HHV A;  4B08 A;  1F2Y A;  1DOM A;  4IUU A;  2DNC A;  1CQF A;  2Q8R E;  2BOS A;  1VF5 C;  1PZJ D;  3FPP A;  1F2M A;  5M9O A;  1DYQ A;  2F0V A;  1JIC A;  1JOR A;  2XIW A;  3K5N A;  5I2Y A;  1A3T A;  1RDP D;  1TWA B;  3VR2 A;  5KGU A;  1QB5 D;  4OIJ A;  2OT2 A;  5COR A;  2O2L D;  5C4X B;  5M5X B;  3OOC A;  2WKC A;  1PTO B;  5KIX A;  4R9W A;  1Y1V B;  3DM1 A;  1BQQ T;  2D2C C;  4KY6 A;  2JEB I;  1F9R A;  3GTK B;  1FNV A;  4FYD A;  2PMZ B;  3FRP B;  1EFI D;  5IT9 L;  2C9O A;  4JK1 C;  4RHS A;  3CRK C;  2G9D A;  1SE3 A;  2QKI C;  1VDZ A;  3J7A V;  3VYT A;  1IYU A;  2B8G A;  3LNN A;  2NVY B;  3TP5 A;  4PQX A;  2IX3 A;  3MWY W;  3N52 A;  1XXG A;  4ZYS A;  3BDL A;  3VYS A;  1CHP D;  2DY8 A;  3R93 A;  5KEE A;  4H44 C;  1I4P A;  2B8F A;  1GUN A;  4C1N I;  1U4R A;  1PMR A;  2CVR A;  2WAC A;  3GD7 A;  2B2V C;  3DMU A;  1D5Z C;  1JOQ A;  1UNS A;  2WP8 J;  3KK7 A;  4DAP A;  2TMP A;  2HQE A;  2E2I B;  4CHT B;  5ISR A;  2X6G A;  1TWH B;  3HEJ A;  2K04 A;  1EEI D;  5J1Z A;  1BXT A;  1DXM A;  3R8B A;  2EYH A;  2A6H D;  3J7Y W;  1QCB D;  4XYQ A;  3TN2 A;  3FMC A;  2EJF C;  5D14 A;  2BE5 C;  1K8O A;  2R7Z B;  2BE5 D;  4XXE A;  3NWS A;  4ZAI A;  5KND A;  5KNB A;  1SE4 A;  4C1N K;  1B9M A;  2K1B A;  2MPM A;  3PMF A;  4KHV A;  2WIN B;  4OL7 A;  3GTJ B;  1H9R A;  1EZ8 A;  1ONL A;  4R8N A;  2ZXO A;  3HS0 C;  4RHR A;  4A3B B;  2L11 A;  3OMC A;  1NAP A;  3J7A F;  3VA7 A;  4Q0F A;  3I8Z A;  2F0D A;  1Y8P B;  3KBG A;  2LS0 1;  4K5W A;  5BN5 A;  2MP1 A;  1ICW A;  3BG3 A;  3C3L A;  3MZ5 A;  3H6M A;  1F2Z A;  2WAQ B;  4RWS C;  3Q24 A;  1BNZ A;  3PO2 B;  2K03 A;  1O80 A;  4DF7 A;  3PUZ A;  3CKI B;  3NQI A;  4A3F B;  2JE6 I;  2B2U A;  3NTK A;  4TSS A;  1AZQ A;  1FR3 A;  3EFX D;  1WTQ A;  1SNO A;  5E4W C;  1FNU A;  1WVL A;  1ZYR C;  1CI3 M;  3URY A;  1G2T A;  1G8Z D;  2BA1 A;  2EY2 A;  1I6V C;  1ENC A;  3ONA B;  1HRJ A;  4L8J A;  4XQQ A;  4C3H G;  3EVQ A;  2DN8 A;  2F0O A;  2AUK A;  2KED A;  1KDB A;  5IGF A;  4KHZ A;  4PMB A;  1E2W A;  3FDT A;  2K05 A;  1PZK D;  3VR4 A;  1MI2 A;  5ELF A;  3Q6S A;  1HUN A;  4K6L A;  3D3R A;  2FMC A;  3V96 A;  1PRT C;  2JP1 A;  1PRT D;  2A69 C;  4IFD I;  4PV1 C;  4I7Z C;  4RGM A;  1ZXT A;  4KJO A;  3LWU A;  2X6L A;  2XRQ D;  3GQB A;  1BR9 A;  2E2D C;  3TP8 A;  1JOK A;  4A3J B;  4FF3 A;  5D3D A;  1JQY D;  2L5T A;  4F88 A;  1H9J A;  1DZ1 A;  4ZLT F;  3NWT A;  1Q1E A;  4ZK9 B;  1DCZ A;  5CV8 A;  2XWJ B;  2EYO A;  4NW2 A;  3Q22 A;  4M8A A;  3HOX B;  3SK6 A;  1AEX A;  2KHS A;  4RGO S;  2R93 B;  1SAP A;  1GXD C;  1RKN A;  3M4O B;  1TKW B;  4ZQ3 A;  3VYR A;  1OXX K;  2RA4 A;  1UUP A;  1KNE A;  3T4A C;  3OWE B;  1IYV A;  4IUR A;  1OXV A;  3S1M B;  3MXG A;  4ULL A;  4BA2 I;  2J0T D;  1EWH A;  3NXW A;  3H09 A;  3NTH A;  2VB3 X;  3S17 B;  1SXT A;  5CV4 A;  2JEA I;  1S4Z A;  4PNY A;  1X32 A;  4NMZ A;  3I70 A;  5DEH A;  3WOE A;  5HGT A;  1JWS D;  4Q5V A;  5IT9 E;  2F0U A;  2VB2 X;  2B2T C;  4A93 B;  5C0X H;  3FKI B;  3I91 A;  1BCP B;  4CJ2 C;  2B2W A;  1ESF A;  1LTR D;  1KDC A;  1SYC A;  2VUM B;  3V2T A;  3C1F A;  2YU9 B;  4IFD H;  3SR1 A;  2R92 B;  3DXJ C;  1EY4 A;  4V19 0;  4RGT A;  4HCS A;  3C2P A;  3NTI A;  3GTO B;  4GZY C;  1EYD A;  2K01 A;  1ZEQ X;  1R4Q B;  3BVZ A;  1MBY A;  4HED A;  1WTP A;  5JEA J;  3TSS A;  2F3W A;  2WB1 B;  1E0B A;  2A6E D;  3I4L A;  1CM9 A;  4RH6 A;  1YNJ C;  1II3 A;  3X3M A;  3D8G A;  1EOT A;  5EQ0 A;  3S1Q B;  3K5L A;  4HMI A;  4RCO A;  4A3K B;  3BVM A;  3GV6 A;  1KLG D;  1DM0 B;  3M4Y A;  3KUP A;  4RA8 A;  3J81 L;  3IFT A;  2PNR C;  5CV7 A;  4KKS A;  3FVQ A;  2NVT B;  1KNA A;  2IX1 A;  3WOF A;  2RSO A;  1HCZ A;  1D6E C;  3CRL C;  3IAY A;  1Y8O B;  1Z47 A;  5ELD A;  4G7H C;  1A3U A;  4WJW A;  4DK1 A;  4ZUI A;  1KLU D;  5IGC A;  3M7N A;  1BBX C;  1TS2 A;  3SEB A;  1F9P A;  1EY6 A;  4RKL A;  2B2Y C;  2ZT9 C;  2ENB A;  1LTB D;  3SK5 A;  3MEH A;  3SK8 A;  1X3Q A;  1STN A;  2E76 C;  2AQ2 B;  3EQL C;  2LFN A;  3QJY A;  2NUC A;  3S1R B;  1QIL A;  1TU2 B;  3ITP A;  4CKC A;  3NK9 A;  2EYJ A;  2N55 A;  4DAV A;  3E0J A;  4OO1 I;  4FF4 A;  5IGD A;  4A3D B;  2OXP A;  5CBE E;  4ZKB B;  1D2B A;  5CBA E;  2EY1 A;  1VMP A;  5C3W A;  2XWB B;  5E3F A;  3TBI B;  1B50 A;  1OXT A;  4CKE A;  2HCC A;  4DFA A;  5DM7 3;  3CQZ B;  2K5W A;  4EVO A;  1PFN A;  5JPM C;  5FO9 B;  2R6G A;  2N88 A;  4C3J G;  1I4X A;  4M1U B;  4HN7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...