1BF4A

Chromosomal dna-binding protein sso7d/d(gcgaacgc) complex
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
63
structure length
63
Chain Sequence
ATVKFKYKGEEKEVDISKIKKVWRVGKMISFTYDEGGGKTGRGAVSEKDAPKELLQMLEKQKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna-binding protein/dna
molecule keywords DNA (5'-D(*GP*CP*GP*TP*5IUP*CP*GP*C)-3')
publication title The crystal structure of the hyperthermophile chromosomal protein Sso7d bound to DNA.
pubmed doi rcsb
source organism Sulfolobus acidocaldarius
total genus 11
structure length 63
sequence length 63
ec nomenclature
pdb deposition date 1998-05-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1bf4A00
4LMQD 3MWYW 5T1GA 2B2UA 1B3AA 3GV6A 3SVMA 1WTQA 2L11A 2KEDA 2Q8TA 4HSVA 1HHVA 1RTNA 5T1IA 2K04A 1U4MA 4CJ1B 3GV3A 4IUVA 2N55A 1C8CA 4MHEA 2K01A 3G7LA 3I3CA 4X3TA 2KUMA 5E4XA 1BO0A 4IUTA 2HUGA 2EE1A 1JICA 4DN4M 1HA6A 1PLFA 4ZAIA 1VMCA 2B2YA 1AZPA 1HRJA 2NWGA 1XYIA 2EPBA 5COYA 2KEEA 1HFNA 4IUUA 1F9RA 2EOTA 2L9HA 2MJ8A 4RA8A 1SDFA 1RTOA 4RAUC 3D6WA 1IKMA 1X32A 1EIHA 1NAPA 1KNAA 1DOLA 5D65A 4ZKBB 2B2WA 5EJWA 4ZK9B 1J8IA 2SDFA 5EKIA 4O42A 5D14A 3ONAB 2HDLA 1WVLA 2N88A 1BNZA 5EPKA 1G2SA 1O7YA 2DY7A 1WTVA 1SSOA 1SAPA 5CORA 1DZ1A 4XDXA 5EPLA 2HCIA 2NZ1D 2JYOA 1U4RA 3H91A 5E4WC 1WTWA 2BDNA 2CVRA 2XIWA 3LWEA 5EQ0A 2HDMA 1BBXC 1ILPA 1ILQA 1NR4A 1ML0D 1EL0A 1PFBA 2X69A 4MN3A 2RSNA 2MGSA 2MP1A 1RHPA 4CJ0B 1PFMA 4QUFA 1PDQA 3IL8A 1AP0A 1QG7A 4NW2A 3IFDA 3DEOA 2B2VC 1WTOA 5AFWA 1G2TA 4XT1B 1J9OA 1XX8A 1KNEA 3I91A 3MTSA 2K05A 2HCCA 1VMPA 3HP3A 1WD0A 1WD1A 1CA5A 3UI2A 1B4OA 1A15A 1E0BA 4R8IA 2B2TC 3I90A 1CM9A 2VXWA 4IURA 2RA4A 3QO2A 4R9WA 1HUNA 1F2LA 2X6LA 1EIGA 5CBAE 3FDTA 1DONA 3Q6SA 1IL8A 3F2UA 1O80A 4HCSA 3DEPA 2M2LA 4X3UA 1WTRA 1JE4A 1F9SA 1RODA 2FMMA 3KBXA 1F9PA 1BF4A 2K03A 1X3QA 1MGSA 1MI2A 1M8AA 4OIJA 1B50A 1EQTA 2D9UA 2K28A 2FHTA 4U68A 1B2TA 1TVXA 2Q8RE 2L1BA 1G6ZA 1RJTA 1WTXA 5EPJA 4IUQA 2NYZD 5DNFA 2B2UC 2L12A 3TZDA 4OIKA 1AZQA 4ZLTF 2FJ2A 1ZXTA 1NCVA 2JP1A 3FPUB 2B2VA 2IL8A 2KOLA 1S4ZA 5JJZA 1O7ZA 1DOMA 2KVMA 4HAEA 4QUCA 1WTPA 4X3KA 4RWSC 2J7ZA 1LV9A 2DY8A 2L4NA 1DOKA 1HUMA 1PFNA 1QE6A 1EOTA 1CA6A 2R3ZA 1GUWA 1U4PA 3N52A 1HFGA 1QNKA 1Q3LA 2B2TA 3DM1A 4HEDA 1F9QA 2MPMA 3P7JA 2B2YC 1X3PA 4IUPA 4ZKCB 3KUPA 3I8ZA 1MSHA 4UAIA 2FFKB 4X3SA 1ICWA 5CMDA 1G91A 1ESRA 2H1EA 2RVLA 2X6GA 4XT3B 4CJ2C 1B53A 2B2WC 3R93A 2KECA 1U4LA 2RSOA 3TN2A 1NR2A 2FINB 1IKLA 2K1BA 1MSGA 5CBEE
chains in the Genus database with same CATH superfamily
4LK1C 4X64Q 2I5LX 2KEDA 1EIYB 4LF4Q 4KHVA 4DV1Q 2F03A 4X62Q 1QILA 1SNCA 5CV4A 3RLFA 1X6OA 2YYZA 4DF7A 1QCBD 2UXDL 5HURA 1I6HB 3RLOA 1MKHA 3L2PA 1SNOA 2PMZB 1UAPA 3M7GA 1KL9A 1Y8NB 3X3MA 1EWHA 1SR3A 2M00A 3SE0A 4B3TL 3HOUH 4Y7NH 4DV7Q 5CV9A 3S14B 1EYAA 3VYSA 3TP8A 3R2TA 3HOVB 4DR6L 3CCVA 4OL7A 5CV7A 4XXEA 4RHSA 2IX3A 1ILPA 5KGUA 3SGIA 1JOQA 2AWNA 4F8MA 5KYLA 1TS5A 4XQQA 1S5FD 4QUFA 5ELOA 2KCTA 2JXMB 2KHIA 3HP3A 2OTLA 4GNXB 2H4OA 2E5LL 4E6IA 1MJEA 2F0OA 1CKNB 4EQOA 3K57A 2QA4A 5ISRA 3GTQB 1JE4A 1QNUA 3QB3A 1NMGA 3TZUA 2F0DA 5A2QE 1YEZA 3A5UA 3J7A5 1PRTB 4GN5A 1EQTA 5ELBA 3Q22A 1PH3A 1YI2A 4I65A 4CDEC 2R7FA 1WCMB 2L12A 1UUPA 4B3SQ 1XNRQ 4MIUA 1PH7A 1UE7A 2FJ2A 1NCVA 2JP1A 4RGMA 2KVMA 1FVIA 1IBLQ 3L0OA 4LF7Q 1X54A 1VF7A 5JJLA 4A3GG 2KENA 2ZT9C 5FLXc 4C3HH 3A8KE 4XQJA 2NZOA 3MA2B 1FGBD 2G5DA 1XPUA 2HQEA 1SFOH 4R1JA 3A0JA 4X65Q 4K5WA 1QOHA 3LNNA 3I8ZA 1ICWA 4N9PA 3S24A 1DM0B 2H1EA 3I4MH 1AH9A 1B53A 5KYIA 1CHPD 5I9PA 4P2CB 3AFQA 4DV3Q 1QVCA 3QIAA 5FO9B 3KLSX 4C56C 3E3XA 5CBEE 3VR4A 3GV6A 4PZ7A 4A3IG 2JA7B 1QWYA 3TEHB 4A3FH 2VQFQ 4DR3Q 1DYQA 5JEAJ 2EE1A 2PI2E 1K83B 1R4PB 3TP6A 4JG2A 1KDAA 2XNAC 1CQVA 5COYA 5CV6A 2CHBD 1L2FA 3F2BA 1BQQT 4DGZA 1CZWA 5KRUA 2R7ZH 3HOYG 4LJZC 2A6HD 1LYLA 4O42A 5KNCA 1PH1A 1UE6A 1CZGA 2QDLA 2N88A 2RF4A 1GO3E 4FF4A 1HA5A 3EROA 4GNXA 4JYAQ 4GS3A 4DAMA 1XMQQ 2I46A 1SE3A 1BKBA 1U4RA 3EA6A 1D2BA 3GTOB 2RHSB 3BYYB 3KLRA 4DAPA 1P16A 1KLUD 1EY6A 1PFBA 4MN3A 4RCOA 4KV6A 3GTGB 2AQ1B 1A3UA 1J5EL 1MD2D 1U9RA 2B2VC 4FF2A 3CMEA 1ESFA 1N8RC 4XT1B 3BDLA 1D1KA 1LUZA 4KKUA 1L1OA 4F7XA 3T1YQ 2RDFA 3HOWG 1FJGL 1TWAB 1PYBA 3LGJA 1TR5A 2IJ0A 1F2LA 4IJHA 1EIGA 2SOBA 1SNQA 4A3LH 3T13A 3OSOA 1IHZA 2SNSA 1EU3A 5IGEA 3S9WA 4FF3A 3CCSA 2NUCA 1DGSA 2K32A 3DM3A 5CC4A 1TQOA 4U68A 3I7FA 1EFWA 2E8GA 5EPJA 5M9OA 4A3DG 1SE2A 4MTKA 4IFDJ 2E2DC 4OX9Q 1HCZA 3D31A 1VQLA 4NXNQ 1N33Q 1K0RA 1DOKA 4JI1Q 1Y1VB 1HFGA 2RKSA 3DM1A 2MPMA 5C4JH 3M3YH 4DV6L 2B2WC 2A8VA 1CSPA 5EAYA 3K7AB 2AQ3B 1GOZA 4JI8L 4ABNA 1VQFA 2YTYA 3FKIH 3UDXA 3CCLA 1LT5D 2Q8TA 1E1OA 3E9IA 3I72A 1W6KA 2K01A 1VQ6A 1Y69U 3NENA 1JJ2A 2NB0A 4P73A 1JICA 1LTGD 4DN4M 4QB4A 1EYCA 3NTIA 1BCPC 4DFAA 3S16H 4A3KG 4IUUA 5LHY1 4RA8A 4BA1I 4YCWA 3PQIA 2KCMA 2OCEA 1E2WA 4L6TB 4RH6A 3OIQA 2EYPA 1WVLA 4NXMQ 1PYSB 1PTOH 1FGUA 3MVVA 5IYDH 5BR8Q 3JAMi 1STBA 5C5LA 4DK1A 4HIDA 1HNXQ 2E75C 1GUNA 2BCOA 5IGDA 3KYHC 3I4LA 2MGSA 1V1OA 2CCZA 5FJ8H 1AP0A 1SMYC 3IFDA 1UWVA 2VQEL 4PZ8A 5IP7G 3I73A 3HOUB 4Y7NB 4FXGC 4DAVA 5K36H 2JK8A 4DR5Q 4J6HA 2JA8H 1PZID 3KBGA 3TS2A 2JA6G 4LFAL 2B29A 1DONA 3DEPA 4CHTB 4R4QA 3ZYYX 1SE4A 2JJQA 2FMMA 4JBMA 3GTPH 3PO3H 1RD9D 1X3QA 1OXXK 1PYWD 4TRDA 4DR1L 1EYGA 1HNWL 5JEAG 2MQHA 3KJPA 3BVZA 2FHTA 4UHVA 3GP7A 4A93G 1RJTA 2QEJC 1N34L 4GKJQ 2VB3X 1YNNC 1A2TA 1TS2A 3UDGA 3GQBA 4HMJA 2A6EC 4J15A 1J6QA 2K75A 5JJZA 1VQAA 2A68C 4DAYA 2LFNA 2IWHA 2F0JA 2CW0C 4JBJA 3PO2B 1Q3LA 4V0BA 4C3JG 1F9QA 5JOBA 1R9TB 2N49A 3NWSA 2FFKB 1SJHD 4IOCA 4GOPA 4DUZQ 2YV5A 2KHSA 4A76A 3G71A 1NR2A 4DR2L 5ELCA 1B9NA 3T1HQ 3C3LA 4BY1G 2K1BA 1MSGA 2WIIB 4AH6A 4A3BH 3MWYW 2OF1A 3R8BA 1PH5A 2F4IA 3J7AV 4HCEA 4GZYC 5C3EB 4C3HB 1JWUD 3KJOA 4JV5L 1GXDC 1SFOB 3GTMH 1XWEA 2ZXRA 4X66Q 2E2HH 1I6HH 1LT4D 5A35A 5HGQA 1TWHH 1HFNA 3PIP3 1V8QA 4DR4L 3HOXG 4B3RQ 2UXBQ 4B9WA 4OWTB 3KLWA 1K8MA 3VR6A 2ZTEA 1B8AA 4ZUIA 3ULJA 2AWOA 4IQZA 1VQJA 4LF5Q 5EQ0A 4A3EG 1OTCA 1Q8IA 2OXPA 3HKZB 4F87A 3I4MG 4JBKA 3RZOB 1Z7TA 3NTKA 4DNRB 3K5LA 1JOKA 3M4QA 4A75A 1MBYA 3QG1A 1G6PA 1X56A 3BDCA 4AYBB 1A2UA 1XNQL 2F0KA 1D5XC 3PUWA 4A3FG 4KHPL 1V9PA 4JCVE 4JI3Q 1QJOA 2R6GA 1A15A 3F2DA 1O7IA 1EY5A 5M3FG 4IALA 1CI3M 2IPKD 3CC4A 3BVGA 1HJPA 2C35B 2DN8A 1F9PA 4HJ8A 1CUKA 4KY6A 2LSSA 3RN5A 5KEEA 4BBSH 4A3MB 2R7ZG 4WJWA 5F2DA 2FXQA 2JEAI 1ENAA 4MZ9A 1L0XB 2B2UC 1AZQA 1WCMH 1NSNS 1VQGA 4UDUC 4BXXH 3H94A 5C4XB 1EQQA 1N32L 2WB1B 3BU2A 2JSOA 4BBRG 1K8OA 1Z6HA 1QE6A 1EOTA 3X3NA 2HQLA 4EQ5A 4KLKA 3CXCA 1YJ9A 1E3PA 2DGYA 4GN3B 2MUYA 2A6HC 4A4IA 3NE5B 3DWPA 4JI4Q 3T51B 4K6DA 4AQYQ 4YCUA 3QOJA 4CJ2C 2X6GA 1KRSA 2UXCQ 4WJ4A 3OHXC 4AIMA 1C8CA 4JOIC 2HHHL 4JBWA 4HSVA 4QL5A 4A3LG 2F0LA 5E7NA 1LTID 3MXPA 3FP9A 3BYTB 1TY2A 3G7LA 3H0GH 3QR8A 1BOSA 4PMCA 1AEXA 1FNWA 2K5QA 3M3YB 2OQ0A 3BDOA 1HA6A 1D6EC 1PLFA 4OEMB 2B2YA 4K0KQ 3PUZA 1VQ8A 3U50C 1IBML 4IO9A 1LT6D 3G6EA 2B63B 1LTTD 2PQAB 2AHOB 3AB9A 2ZM6Q 4LF8Q 4DR7Q 1E2VA 2IY5B 5LMUQ 3BZDB 2B8GA 4DV0Q 4RGOS 3OWFA 2EYOA 2MO1A 3FKIB 4ZRZA 3OW2A 1C0AA 2JN4A 4DV4L 1XPOA 4Q5VA 5ELEA 5ELNA 3CAMA 1JE5A 3AQQA 2NZ1D 1TIID 4RMFA 2EJFC 3NWTA 1ILQA 5D3DA 3S16B 5CYUA 2FMCA 1D8LA 4X64L 4HJ7A 3E6ZX 4LF4L 4CBVA 4DV1L 1PXUA 4X62L 3CKIB 2MO0A 4H0LC 3U9SA 1W6JA 1PTOB 4K14A 1WOCA 4JI0L 4XYQA 5C5MA 3E0EA 4BY7H 3ULLA 5C3XA 1IYVA 1OXUA 4O1NA 2I0QA 5IP9H 1MI2A 3PUYA 3VYUA 4DV7L 4LFBQ 5LL6S 2L1BA 2VW9A 1XMOQ 1KRTA 2ZJPA 2JE6I 5I2YA 1VQPA 2EYLA 2RCFA 3I56A 4N8X1 4QMGA 1EQRA 5I9OA 1BCPD 1A3VA 3FHWA 3NP8A 4DXFA 3S1RH 5JJKA 2KQ3A 4JC0A 4L8JA 2NVTH 2K50A 2WAQG 2JA8B 4GKKQ 2F3WA 3U58A 1I3QB 3KLSA 3GTPB 1Z9FA 2EDGA 4QIWB 3PO3B 3KUPA 2XVSA 4J8QA 3I2ZA 2RVLA 4QY7A 1TWCH 2YTXA 3TN2A 2PNHA 5K36G 1QZGA 3RZDH 1IZ6A 3TQYA 1K9MC 3MXGA 1B3QA 1YIJA 2HIXA 4DU9A 5M5WB 1LO5D 1SMYD 5EBDA 5E1FA 1V1PB 4EVOA 3T16A 2F52A 4KD4A 3TSSA 1WFQA 4DK6C 4B3SL 1XNRL 2NWGA 2QDBA 2EPBA 1MIUA 4J1MA 2F4VL 3CC7A 1Q12A 1Q86C 1IBLL 4LF7L 2MFIA 2N8NA 3C2PA 4IZ8A 1BBUA 4G7HC 3SK5A 5LMNW 1SYDA 3I55A 3RD4A 4PG3A 4UP8A 4X65L 1Y1WH 1GD7A 3FEWX 2VUMG 5GAEC 3CRKC 3D4WA 1D5ZC 1W3SA 4KJNA 2UU9Q 1YNND 3WOEA 5IY0A 5AJ3Q 3GTMB 2JEBI 2A6ED 2E2HB 4DV3L 4JI7Q 4ID6A 2A68D 1RHPA 1TWHB 2XN9C 2CW0D 1ICFB 3HKSA 4A3BG 3CRLC 3DEOA 1FNVA 1RL2A 3EQLC 2F0SA 5NUCA 2VQFL 1UEBA 1XX8A 4DR3L 3H3VC 2F0IA 4POGA 1W2BA 3O13A 1CM9A 2QW7A 3J81i 1HZBA 3W5OA 1LT3D 4EQNA 1QUQB 1I4RA 2PZWA 5I6YA 4XQNA 1KC8C 4QQBX 2EY1A 3SEBA 2QGQA 5JPNC 4IFDI 4YCVA 2J0TD 2JQOA 1B2TA 4IOAA 2WINB 1SNPA 2P5ZX 4DK0A 4JYAL 1XMQL 2B2VA 2N78A 3DXJC 1SYBA 3TMEA 4R8NA 5JVG3 1KD1C 1TS4A 3AMUA 3HOVG 3MZ5A 5E3FA 3GTJH 1I4GA 2WKCA 4OO1G 2Z4HA 3GTLH 1HXYD 4YY3Q 3SK6A 1QNKA 2PZUA 2Q2HA 4HEDA 5C0XI 3PO2H 1AFPA 1C7YA 5BN3A 1V1PA 1R9TH 1Q7YC 2GA4B 1I4QA 3PF4A 1VQHA 1X3FA 4R4IA 4GLAC 3BG3A 4BBSB 2KECA 3CQZH 4HR7B 1CQFA 4UP9A 1VQ4A 1HZAA 5LMNQ 1Q46A 1L1OB 3S17H 2OT2A 1HTLD 1H95A 1EOVA 3HRZC 3A54A 4QJFA 3I3CA 3TBIB 5E4XA 3SK4A 5C6AA 5C3EH 2WAQE 1CSQA 4JPBW 2A73B 4JI5Q 3TREA 1H9MA 1XYIA 1RDPD 2F0VA 3EVQA 1JOOA 1YHBA 2NN6I 1WCMG 5DEHA 5C3WA 1DOLA 1STNA 5CR3A 2B2WA 4NXNL 1NTGA 3SK8A 5H1SE 1N33L 2O4XA 5D14A 4JI1L 5GAHC 1GJXA 1SE8A 1HZCA 1FNUA 3J7AF 1BNZA 2DY7A 5KNBA 4LF9Q 1ZYRC 5EPLA 1WYDA 4IFDH 3VA5A 3H0GB 3NK9A 1ZKOA 2KBNA 4OWWB 2EXZA 2NVXH 1QUQA 2EY2A 3RZOH 1XXGA 2B3GA 4FXKC 3OOCA 3D0FA 5EKKA 3CPFA 3S15B 5AFWA 2JA7G 5C0XH 1J9OA 4PZ6A 1VMPA 3SHLA 2UUAQ 4L5QA 3UI2A 5FLMG 1B4OA 2UUCQ 3MEHA 3PMFA 2B2TC 3QO2A 4PV1C 3OTOQ 3PIPA 3Q6SA 1Y14B 2M2LA 3F1ZA 2I5HA 3KBXA 1AW7A 4P75A 3HEJA 1DJRD 1F2YA 1M8AA 5ELDA 2NZHA 1YHQA 1EU4A 3K80C 4NB3A 2PW5A 2D0OA 4A3MH 4NXML 4LNQA 5DNFA 2C5CA 4R4OA 1WJJA 5BR8L 5C4XH 1SNMA 4CDDC 1N36Q 3K8AA 2BH8A 1HNXL 1K3BC 4IUNA 4K2KA 1CA6A 4BY7B 2NN6H 3DLLA 2K5DA 4YWKA 3DUZA 3W2DA 4ALPA 3N6RA 3P1HA 1OO9B 3K7UC 2PMZE 5CMDA 2F0NA 1QB5D 3SDZA 4DR5L 2GVAA 1B7YB 4WJ3M 1LTSD 3F2CA 1RTNA 1EEFD 3S1RB 3VDYA 4KKSA 5FKAC 1M90C 5IWAQ 2NVTB 4GN4B 3CCMA 1BO0A 5IP9G 2EQSA 3CF5A 3ULPA 1U0LA 1B1ZA 2H5XA 2I5MX 3MEFA 4C3IB 4NMZA 4GKJL 4LF6Q 1NMFA 2B63H 3S1NH 3UE1A 1F9RA 2L9HA 1TWCB 3K5OA 4OHJA 1KNAA 4RCNA 4ZKBB 4ZK9B 5JPMC 3NSWA 2EIFA 3RZDB 4DAYB 2CWPA 1SXTA 4H13C 1Y1VG 1JJGA 4O2DA 5KNDA 4UP7A 3K5NA 4DUZL 1I50H 2CFMA 5HY6A 2OWOA 4A3JH 3T1HL 4GOPB 1JR0D 1RF2D 5J1ZA 2G9DA 2L5TA 1LABA 4C1NK 4HIMA 3NQIA 1XTCD 2IHEA 2C9OA 1K0SA 1JQYD 3M4PA 2K05A 2RBMA 4C2MH 1EYDA 4X66L 1Y1WB 1L0YB 2L15A 1XJVA 4K8IA 2DNCA 3CD6A 2UXBL 3I4NH 4PQXA 3J80L 2JA5H 5IYBG 1NBWA 5IYCG 2R92H 4P71A 4ME3A 4GNXC 4KJOA 2F0UA 1DOMA 4LF5L 2E2IB 3Q0AA 4RWSC 1LV9A 4K5XA 3TRZA 5CGKA 4ZYSA 2KA7A 1U4PA 2EZVA 4G7ZC 3HOZB 1I3QH 3P7JA 3CCEA 3A74A 5TSSA 2E2JH 3OMCA 1PRTC 1MSHA 1STGA 3G6JB 3KF6B 4U673 1S40A 4XT3B 4RKBA 1S5ED 4H44C 3R93A 3RMHA 1JJCB 4JI3L 1T5EA 3AYHB 3HOUG 5HGTA 5JVH3 1S5CD 1BCPF 2B2UA 3D4RA 1WTQA 2Z9HA 1HHVA 1GUTA 2XRSD 3BZKA 3GTJB 3U9OA 3A7LA 3GTLB 2RDGA 2KUMA 5M5WH 3J80E 3U4VA 2Y0SB 1CKOA 3ICEA 4JI6Q 2MNAA 3WWVA 2XTIA 3C1FA 2YTVA 1WTHA 2AUJD 4RAUC 3BZCA 3NPPA 1EIHA 3CQZB 3UE0A 5EKLA 1X3GA 3E5SA 3VYRA 4XIGS 3S17B 2VS1A 1H9SB 1STHA 1YNJC 1C48A 3CCUA 4ODGA 3PO2G 2JA9A 3RR5A 4JI4L 2ICIA 3L9AX 3A56A 4AQYL 5EGTA 4IJLA 1I6VC 1PH9A 3OPOA 1X3EA 4LWCA 3URYA 2UXCL 2Z6KC 1TT2A 1NR4A 1EL0A 3BVMA 5FK9C 2LKVA 1UE5A 2Z6BA 1QG7A 5M3MB 2QILA 4DUYQ 4CDCC 1KNEA 3VR3A 4JK1C 5C3EG 1TS3A 4C3HG 4BWGB 4IURA 2RA4A 1I94Q 4DNTB 1IBKQ 4K0KL 2WFWA 1IL8A 3W1GA 1TKWB 2ZM6L 4LF8L 2RDHA 1VQCA 4DR7L 4HN7A 2EYHA 3IFTA 1PVOA 5LMUL 2NVXB 4XTCS 4DV0L 2K28A 3KF6A 1SYGA 4IPGA 4DKAC 4IUQA 2ZTCA 1TWGH 4BA2I 3PUXA 4QF4A 1CFMA 1GUWA 1GM5A 3HKZG 1V43A 4GLXA 1YITA 3L3OC 1HTPA 4YHHQ 4TVAB 3DHQA 1GUSA 1KAAA 1SN8A 2EVBA 4AYBG 2ALYB 4L5RC 2EJGC 1ZYRD 3VR2A 3M7NA 2D2CC 1SJED 1PH2A 3J80c 5LL6X 3H15A 2Q8IB 1FR3A 2NVQH 2K04A 1H9SA 4ZQ3A 3C46A 4LUOA 3A8IE 4A3GH 4LFBL 1A3TA 2XWBB 1XMOL 4H7BA 1KDBA 3OWEB 4A3MG 1HRJA 2XWJB 3S1MB 3I4OA 3OIPA 1LTBD 4DV2Q 1IKMA 1RTOA 5C4XG 2VZAA 3AU7A 3JC66 2Q2TA 4GKKL 2WB1G 5EKIA 2GVBA 4FDBA 2PNRC 2HDLA 1D7QA 4FXDA 2KCCA 5EPKA 4ZCKA 1R4QB 3EFXD 4OGQC 1SEBD 1HPCA 3K6OA 3W1BA 3D4DA 3H91A 4GLVB 3H09A 3LWEA 2CVRA 2XIWA 1IL2A 1SYFA 3A8JE 2PQEA 4JVZA 2Q2UA 1SRUA 3HGBA 3S1NB 3NUCA 4UPAA 2L55A 2O2LD 3S15H 1G2TA 1JWMD 2A1AA 3CPWA 3HOYH 2D62A 2M9VA 1E24A 1ENCA 4PMBA 1TU2B 1O80A 5G3LD 1I50B 3R3OA 5CV8A 2B63G 3MC0B 1EZ6A 4A3JB 4FNFA 2WV6D 1I5FA 4N9TA 3E0JA 3ND9A 2F0WA 1VQMA 3A55A 2EYMA 3K58A 3TZDA 4I7ZC 3FKIG 3FRPB 1ZXTA 2A69C 3FPUB 4FVMA 4CKEA 2R93B 4C2MB 3MAQA 2UU9L 5AJ3L 1M4VA 2DY8A 3HOWH 4JI7L 1VQDA 2WP8J 1EY8A 1G51A 3M4YA 2XSCA 2XRQD 2PPBC 2SEBD 1AE2A 1EY4A 1A8VA 1JC7A 3I4NB 2PZTA 2SNMA 2LS01 3A5ZB 2JA5B 3ERSX 2K33A 4PNYA 2FINB 3NTHA 3GO5A 1F77A 2R92B 1KDCA 1JB3A 3C1EA 4MNOA 4A3DH 4LW1A 5IYDG 1G8ZD 5K5PA 2K5WA 3K59A 4IUVA 1OXSC 1N32Q 1HZ9A 3M4OB 4ULLA 1S5BD 2G9HD 2LXKA 4WRDA 3HKZE 3NELA 4OONA 2E2JB 4EQPA 3S2DH 4ZAIA 4C3IH 1AZPA 3B6YA 4RG1A 5FJ8G 5GROA 3DMUA 1EUJA 1IXRA 1JT8A 1NAPA 4AYBE 2SDFA 3QOLA 2JA8G 1VQOA 2K5HA 4M1UB 4L5TA 3UDIA 4B08A 2AKWB 2HHHQ 2F0MA 4HTHA 3PO3G 4L63B 1RIPA 4MTNA 5C44B 3Q23A 2F0HA 1IW7D 3NQTA 1HR0W 4G57A 3NBHB 3E9HA 1IYUA 4H02A 4A3KH 1CK1A 3GD7A 5C4HA 2IX0A 2V1CC 5BN4A 1PRTD 1ENFA 1EWIA 2WB1E 4JI5L 1E0BA 1VQIA 1SROA 4KHZA 4JI2Q 1O78A 1WI5A 4KMUC 4X3UA 4HSPA 1Q90A 1RODA 4Z9CB 3JAML 1BF4A 3HG9A 1OXVA 2K5VA 4XYOA 3CMAA 1Q1BA 3NEMA 1Q81C 1KHIA 4OIKA 4DV5Q 4LF9L 1HQRD 2IL8A 3TP5A 1O7ZA 5IP7H 3PGZA 4B3MQ 1E1TA 2E2IH 2ES2A 4FYDA 4CGYB 3TP7A 4APVA 1DD2A 2NTSA 2QEXA 2B2TA 4K5VA 3HOZH 2LMCB 4RFBA 2JA6H 1VQKA 4JI0Q 1K28A 4I7AA 2F0QA 1YNJD 4LFCQ 3NXWA 5D3IB 1RCVD 1BCPB 2CH4A 4PMWA 2NTTA 5JEAH 2UUAL 2RSOA 3CW2C 2PW7A 2CKZB 5A2QL 2UUCL 4A93H 1KIXA 3OTOL 3D8GA 3MFGA 1TWGB 3SVMA 5L37A 1IYJB 3KDFB 2RHQB 3JAME 2N55A 5FO7B 4CKCA 4TQUS 1EQVA 2HUGA 2ZJQA 2ASBA 4C3JH 3KK7A 2PI2A 1HR0Q 5EBCA 2RQXA 2KCNA 1GUGA 1SBBB 1TWFH 2EOTA 5JAVA 3T1YL 4Y52H 1SDFA 1VS0A 2K4KA 1N36L 1X32A 4IPHA 3NBHA 3GDEA 2VB2X 2TMPA 3K0XA 3ONAB 4BY1H 1RKNA 1Z47A 3VR5A 2UUBQ 1BXTA 2NVQB 1O7YA 1ZEQX 5IODA 3U4ZA 1KABA 3P20A 1PH4A 1AN8A 2CH4W 3LX0A 5JJIA 3STBD 4A3GB 3G48A 1YZ6A 1T9HA 3P75A 2KJXA 3OW7A 3H3VI 4BBSG 1VDZA 3MXUA 4CJ0B 1PDQA 2ENBA 3D3RA 1EFID 3LWUA 3IL8A 4NW2A 2HT1A 4BXXG 2F3VA 4OX9L 1ET6A 5M3MH 5IWAL 3D6CA 2F4VQ 2RCNA 4KY7A 1PH8A 2MHVA 3FVQA 3HOXH 4V190 2HCCA 3PIO3 1VQ5A 1CA5A 2Z0SA 1HNZQ 1A0IA 3M85A 3I90A 4A3IB 2VL6A 5KIXA 4LF6L 4K6LA 3BS1A 2EJMA 1O7LA 4QIWE 2E76C 2VNUD 2PYKA 1II3A 1BDOA 1STYA 2I07B 4A3EH 2D9UA 4C1NI 1YJNA 1K8GA 1N9WA 1TVXA 1KTKA 2UXDQ 4X6AH 4R4TA 2OEOA 2IT1A 4FP5D 1PTOC 1X9NA 1FYCA 2F0PA 3HOYB 1KXLA 1EY0A 4X3KA 2J7ZA 1OXTA 3H0GG 4A3CH 3CHBD 3KDFA 4B3TQ 3OMGA 2R3ZA 3QWNA 3N52A 1CTMA 4KK7A 4FF1A 5DM63 1VQBA 5M3FH 2EYJA 3GTKH 3MXNB 4UAIA 3AFPA 1G91A 2IHFA 4DR6Q 1PMRA 3JAMc 4A3BB 5IGCA 5GQOA 1VQ9A 1ET9A 3KFUA 2K14A 2NBFA 1B3AA 1SLJA 1QVGA 2L11A 1LTRD 3H3VH 3V96A 1FL0A 4CJ1B 4ILWA 3CCRA 3HOWB 3J7ZC 4BBRH 3CCQA 4IUTA 1C9OA 1PA6A 1CKNA 2E5LQ 1H9RA 4S3SA 5J39A 4IPDA 3A7AB 1KQSA 3S1MH 1ASYA 3R2IA 4LUVA 1YVCA 5EJWA 1EY7A 3UDFA 3S2HH 2HD3A 2YU9H 1KAWA 4A3DB 1D1IA 2CWAA 5ELFA 2BE5C 1SYEA 4BY7G 1NY4A 1NNXA 1SSOA 1SAPA 3BJUA 1I4HA 1EWCA 3IRBA 4HIKA 4KY5A 4POFA 1JORA 1PTOF 4R4CA 5C4ZA 2BDNA 3EN2A 2A69D 1MHWC 1BBXC 3FMCA 4DNIA 3S2DB 1ML0D 2RSNA 1GKHA 4B9XA 3S1QH 1JB7A 2ZXPA 4YWLA 5IGFA 4RHRA 3MTSA 1SYCA 3SXHA 2D0PA 2F0FA 3T56B 4JI6L 4CKBA 2QF7A 1AE3A 5J3BA 3PV0A 4C3IG 4NPSA 1PH6A 4L5SA 5C0XJ 2Z6KA 3WOFA 3MXNA 4RGNA 4P74A 2F0GA 5BN5A 4A3KB 2NYZD 1BR9A 1F2ZA 1XTDA 2R93H 1S4ZA 3HS0C 2R7DA 5DM73 4QUCA 1B70B 2L4NA 4QGUA 1X55A 3TDQA 2CQOA 3DWAA 5G3LF 1F2MA 1Q8KA 1PFSA 1K3RA 1C4QA 3W3AA 2KHJA 3AEVA 4DUYL 4X3SA 5M5XH 4B3RL 2EXDA 3V2TA 5GAGC 4O0AA 3J81j 1SMXA 1I94L 2F3IA 3RNUA 1IBKL 1U5KA 4LMQD 4M8AA 2AUKA 4EX5A 1Y1WG 2D5DA 1J5EQ 3PUVA 3RLNA 3GV3A 1IW7C 2K52A 5GADC 4MHEA 1YHAA 4X3TA 1A62A 3ERQA 2O5IC 3M4OH 1FJGQ 2DJGC 2JA6B 1GHKA 5M5YH 2OQKA 4DK3C 2DNEA 4KI0A 4K2LA 2VY3A 2LY7A 5D65A 1L1OC 4TKOB 4A93B 1J8IA 1E2ZA 1NJIC 4JW0A 2F0TA 2TSSA 3VA7A 4YHHL 3HOZG 2BH2A 3Q8DA 4DXGA 2HCIA 3ITPA 4RKLA 1LLRD 2JYOA 4K8JA 4ZUJA 1K8AC 4F88A 1UNSA 3PF5A 4C3JB 5C44H 3PSIA 4NKLA 1EEID 4OO1I 1TWFB 4DV6Q 4G4KA 2NVYH 4WFN3 4WORA 1B44D 4BY1B 3K81C 4R8IA 4JOIA 1BBWA 2K5NA 4NP5A 2Y0SG 4YWMA 4JI8Q 1STAA 3FDTA 5CBAE 2VUMH 3F2UA 5DAUA 4DV2L 3Q24A 1P8LA 2EY5A 4KD3A 3EJIA 2Z4IA 1S5DD 5IT9L 1H9KA 1FD7D 1NE3A 1WTXA 1KLGD 1M1KC 5I2XA 3V05A 1PRTF 3HOXB 1DCZA 1JWSD 2N3SA 2ID0A 1ASZA 2CQAA 1T5XD 3ZJYC 1PFNA 1CT1D 1EZ8A 2QCPX 3CU7A 4UY8C 3J7YW 1E7ZA 2BOSA 2XGTA 2K6AA 4DA2A 4BS9A 3J81L 4IUPA 4A3EB 5I4DA 3I4MB 4YIJA 2R61A 2BA1A 5M3MG 4EGVA 2O5JC 1BVSA 4KKTA 3STBC 4HJ9A 1PZKD 5I6WA 1PHJA 3CP0A 5T1GA 4CDFC 3S14H 1U4MA 3NHHA 3RN2A 4IFDG 2VQEQ 4A3FB 1VQ7A 3HOVH 5IT9E 4HJAA 4OO1H 4Q0FA 5M3FB 2HIVA 1PZJD 3GTKB 4LFAQ 1YBYA 3T53B 2KEEA 2MJ8A 1STEA 5C0XG 4TSSA 2DUDA 3HFZB 4DR1Q 1Y8OB 1HNWQ 1JCKB 2R7ZB 3VYTA 5IGGA 1PV4A 2AQ2B 1NUCA 4KN4C 4A3CG 5DLQE 4G7OC 1G291 1G2SA 3J81E 1N34Q 1WTVA 1UEAB 1DZ1A 5CORA 3ND8A 3KOJA 3PCOB 1VQNA 4OWXB 4QCLA 4BBRB 3GTQH 1L0WA 2BA0A 3IKJA 3K0YA 2HDMA 1PTOD 1Y8PB 2Z1CA 4IPCA 1Q82C 1A6XA 3SR1A 1PFMA 1DXMA 2ATWA 3MFYA 1H9JA 1LTAD 1UE1A 3S2HB 1S72A 2YU9B 1WD1A 3KF8B 4DR2Q 2NN6G 2VXWA 3I70A 4A3IH 4R9WA 3K5MA 1GUOA 4ME5A 1E22A 4HCSA 1VQEA 1F9SA 4GOPC 3RUZA 1MGSA 2Q2IA 4OIJA 1B50A 1MJCA 1YNXA 4JV5Q 3S1QB 1GVPA 5CV5A 4ZLTF 2JA7H 1HH2P 2DJFC 4DR4Q 3IAYA 1X65A 1HUMA 4OELB 2ICEC 5FLMH 2WKDA 1EY9A 2QKIC 2A5HA 5C4JB 2Y0SE 5J22A 1K83H 3NBIA 4ZKCB 1XPRA 5IE8A 1YJWA 2BE5D 5IGBA 3PIOA 1QVFA 1EIFA 2ZJRA 2GN5A 4HMIA 1VCIA 5IT9c 4DPGA 4JI2L 5FO8B 1I4PA 3HZXA 1B9MA 1LACA 1TY0A 1K73C 5T1IA 2EY6A 2ZXOA 1XNQQ 2V4DA 2Z8LA 4KHPQ 2L0CA 3GTOH 4A3JG 1D5MC 5IOCA 1VMCA 2PCFB 4DV5L 5M5XB 3GTGH 3J81c 3FPPA 2WACA 2BDOA 3D6WA 4B3ML 2R93G 2ZTDA 1JMCA 2OTJA 1TWAH 3MHBA 3ER0A 3F8TA 3CC2A 1VF5C 4NDXA 3H6MA 3KF8A 4XDXA 4LFCL 1LM0A 1A63A 1GHJA 2WAQB 5E4WC 1WTWA 3EIVA 3J80i 3I4NG 3WDNA 1I4XA 5M5YB 2X69A 3T4AC 2JA5G 2MP1A 4FO2A 1SNDA 1LTLA 4LUZA 4LAAA 2R92G 4RGTA 1BUVT 1WTOA 4IN3A 3QJYA 3M9BA 3I91A 5FLXL 3L7ZC 4YY3L 1WD0A 2E74C 2EYFA 2PO4A 1Q1EA 3EBEA 2B8FA 3G4SA 2F0EA 2X6LA 1HR0L 1HUNA 1Y1VH 3CCJA 2LXJA 2K7VA 1CKMA 1WTRA 1V1QA 4HIOA 1QZHA 1TXYA 2K03A 2A19A 5LMNL 2J4XA 4OXPA 2PQAA 2Q8RE 1G6ZA 2UUBL 2IX1A 3K7AH 1IBMQ 2NVYB 3TS0A 2IW3A 2KOLA 1S3OA 2AMCB 4HAEA 4N8FA 1WTPA 1ONLA 3DWQA 4P72A 2VUMB 5FOBB 5C44G 4HJ5A 2B2YC 5IIFA 1X3PA 4DV4Q 1HQMC 2B39A 1CHQD 3OYYA 1ESRA 5FLXE 2A74C 1U4LA 1HNZL 4KN7C 2F1MA 5IYBH 4KTAA 1IKLA 5IYCH
chains in the Genus database with same CATH topology
4LK1C 2KEDA 4KHVA 2F03A 1QILA 1SNCA 5CV4A 3RLFA 2YYZA 4DF7A 1QCBD 5HURA 1I6HB 1SNOA 2PMZB 1UAPA 3M7GA 1Y8NB 3X3MA 1EWHA 2M00A 3SE0A 5CV9A 3S14B 1EYAA 3VYSA 3TP8A 3R2TA 3HOVB 4OL7A 5CV7A 4XXEA 4RHSA 2IX3A 1ILPA 5KGUA 1JOQA 2AWNA 4F8MA 5KYLA 1TS5A 4XQQA 1S5FD 4QUFA 2JXMB 3HP3A 2H4OA 4E6IA 2F0OA 4EQOA 3K57A 5ISRA 3GTQB 1JE4A 1QNUA 3QB3A 3TZUA 2F0DA 5A2QE 1PRTB 5ELBA 1EQTA 3Q22A 4I65A 1WCMB 2L12A 1UUPA 4MIUA 2FJ2A 1NCVA 2JP1A 4RGMA 2KVMA 1VF7A 2ZT9C 4XQJA 3A8KE 3MA2B 1FGBD 2HQEA 4K5WA 1QOHA 3LNNA 3I8ZA 1ICWA 4N9PA 1DM0B 2H1EA 1B53A 5KYIA 1CHPD 5I9PA 4P2CB 3QIAA 5FO9B 3KLSX 4C56C 5CBEE 3VR4A 3GV6A 2JA7B 1QWYA 1DYQA 5JEAJ 2EE1A 1K83B 1R4PB 3TP6A 1KDAA 2XNAC 1CQVA 5COYA 5CV6A 2CHBD 1BQQT 4DGZA 1CZWA 5KRUA 4LJZC 2A6HD 4O42A 5KNCA 1CZGA 2N88A 4FF4A 1HA5A 3EROA 2I46A 1SE3A 1U4RA 3EA6A 1D2BA 3GTOB 3BYYB 3KLRA 4DAPA 4RCOA 1KLUD 1EY6A 1PFBA 4MN3A 4KV6A 3GTGB 2AQ1B 1A3UA 1MD2D 1U9RA 2B2VC 4FF2A 1ESFA 4XT1B 3BDLA 1D1KA 4KKUA 4F7XA 2RDFA 1TWAB 1TR5A 2IJ0A 1F2LA 1EIGA 2SOBA 1SNQA 3T13A 3OSOA 1IHZA 2SNSA 1EU3A 5IGEA 3S9WA 4FF3A 2NUCA 2K32A 5CC4A 1TQOA 4U68A 5EPJA 5M9OA 1SE2A 4IFDJ 2E2DC 1HCZA 3D31A 1DOKA 1Y1VB 1HFGA 2RKSA 3DM1A 2MPMA 2B2WC 3K7AB 2AQ3B 1GOZA 4ABNA 1LT5D 2Q8TA 3I72A 1W6KA 2K01A 1Y69U 2NB0A 1JICA 1LTGD 4DN4M 4QB4A 1EYCA 3NTIA 1BCPC 4DFAA 4IUUA 5LHY1 4RA8A 4BA1I 1E2WA 4L6TB 4RH6A 3OIQA 2EYPA 1WVLA 1PTOH 3MVVA 1STBA 5C5LA 4DK1A 2E75C 1GUNA 2BCOA 5IGDA 3I4LA 2MGSA 1V1OA 1AP0A 1SMYC 3IFDA 3I73A 3HOUB 4Y7NB 4FXGC 4DAVA 5K36H 4J6HA 1PZID 3KBGA 1DONA 3DEPA 4CHTB 3ZYYX 1SE4A 2FMMA 1RD9D 1X3QA 1OXXK 1PYWD 4TRDA 5JEAG 3BVZA 2FHTA 3GP7A 1RJTA 2QEJC 2VB3X 1YNNC 1A2TA 1TS2A 3GQBA 4HMJA 2A6EC 5JJZA 2A68C 4DAYA 2LFNA 2IWHA 2F0JA 2CW0C 3PO2B 1Q3LA 4V0BA 4C3JG 1F9QA 5JOBA 1R9TB 3NWSA 2FFKB 1SJHD 2KHSA 1NR2A 5ELCA 1B9NA 3C3LA 2K1BA 1MSGA 2WIIB 3MWYW 2OF1A 3R8BA 2F4IA 3J7AV 4HCEA 4GZYC 5C3EB 4C3HB 1JWUD 1GXDC 1SFOB 1XWEA 2ZXRA 1LT4D 5A35A 1HFNA 3PIP3 1V8QA 4B9WA 1K8MA 3VR6A 4ZUIA 2AWOA 4IQZA 5EQ0A 1Q8IA 2OXPA 3HKZB 4F87A 3RZOB 1Z7TA 3NTKA 4DNRB 3K5LA 1JOKA 1MBYA 3QG1A 3BDCA 4AYBB 1A2UA 2F0KA 1D5XC 3PUWA 1QJOA 2R6GA 1A15A 1EY5A 4IALA 1CI3M 2IPKD 3BVGA 2DN8A 1F9PA 4KY6A 5KEEA 4A3MB 4WJWA 5F2DA 2JEAI 1ENAA 1L0XB 2B2UC 1AZQA 1NSNS 4UDUC 5C4XB 3H94A 2WB1B 2JSOA 1K8OA 1Z6HA 1QE6A 1EOTA 3X3NA 2MUYA 2A6HC 3NE5B 3DWPA 3T51B 4K6DA 3QOJA 4CJ2C 2X6GA 3OHXC 1C8CA 4JBWA 4HSVA 2F0LA 1LTID 3MXPA 3BYTB 1TY2A 3G7LA 1BOSA 4PMCA 1AEXA 1FNWA 2K5QA 3M3YB 3BDOA 1HA6A 1D6EC 1PLFA 2B2YA 3PUZA 1LT6D 2B63B 1LTTD 3AB9A 1E2VA 3BZDB 2B8GA 4RGOS 3OWFA 2EYOA 4ZRZA 3FKIB 4Q5VA 5ELEA 2NZ1D 1TIID 2EJFC 3NWTA 1ILQA 5D3DA 3S16B 5CYUA 2FMCA 3E6ZX 4CBVA 1PXUA 3CKIB 4H0LC 3U9SA 1W6JA 1PTOB 4K14A 4XYQA 5C5MA 5C3XA 1IYVA 1OXUA 4O1NA 1MI2A 3PUYA 3VYUA 5LL6S 2L1BA 2JE6I 5I2YA 2EYLA 4QMGA 5I9OA 1BCPD 1A3VA 3NP8A 4DXFA 2KQ3A 2JA8B 4L8JA 2F3WA 1I3QB 3KLSA 3GTPB 2EDGA 4QIWB 3PO3B 3KUPA 2XVSA 4J8QA 2RVLA 3TN2A 5K36G 3MXGA 4DU9A 5M5WB 1LO5D 1SMYD 5EBDA 5E1FA 1V1PB 4EVOA 3T16A 3TSSA 4KD4A 2NWGA 2QDBA 2EPBA 4J1MA 1Q12A 3C2PA 4IZ8A 4G7HC 3SK5A 1SYDA 3RD4A 3FEWX 3CRKC 3D4WA 1D5ZC 4KJNA 1YNND 3WOEA 3GTMB 2JEBI 2A6ED 2E2HB 4ID6A 2A68D 1RHPA 1TWHB 2XN9C 2CW0D 3CRLC 3DEOA 1FNVA 3EQLC 2F0SA 5NUCA 1XX8A 3H3VC 2F0IA 3O13A 1CM9A 1LT3D 4EQNA 1I4RA 2PZWA 5I6YA 4XQNA 2EY1A 3SEBA 5JPNC 4IFDI 1B2TA 2J0TD 2WINB 1SNPA 4DK0A 2B2VA 3DXJC 1SYBA 3TMEA 4R8NA 5JVG3 1TS4A 3AMUA 3MZ5A 5E3FA 1I4GA 2WKCA 4OO1G 2Z4HA 1HXYD 3SK6A 1QNKA 2PZUA 4HEDA 5C0XI 1AFPA 5BN3A 1V1PA 2GA4B 1I4QA 3BG3A 4BBSB 2KECA 4HR7B 1CQFA 2OT2A 1HTLD 3HRZC 3A54A 3I3CA 3TBIB 5E4XA 3SK4A 5C6AA 2A73B 1H9MA 1XYIA 1RDPD 2F0VA 3EVQA 1JOOA 2NN6I 5DEHA 5C3WA 1DOLA 1STNA 5CR3A 2B2WA 3SK8A 2O4XA 5D14A 1GJXA 1FNUA 3J7AF 1BNZA 2DY7A 5KNBA 1ZYRC 5EPLA 4IFDH 3VA5A 3H0GB 3NK9A 1ZKOA 2EXZA 2EY2A 1XXGA 4FXKC 3OOCA 5EKKA 3S15B 5AFWA 5C0XH 1J9OA 1VMPA 3SHLA 3UI2A 1B4OA 3MEHA 3PMFA 2B2TC 3QO2A 4PV1C 3Q6SA 2M2LA 3KBXA 1AW7A 3HEJA 1DJRD 1F2YA 1M8AA 5ELDA 1EU4A 2PW5A 5DNFA 2C5CA 1SNMA 4IUNA 4K2KA 1CA6A 4BY7B 2NN6H 2K5DA 3DUZA 3W2DA 3N6RA 3P1HA 1OO9B 5CMDA 2F0NA 1QB5D 3SDZA 1LTSD 1RTNA 1EEFD 3S1RB 4KKSA 5FKAC 2NVTB 1BO0A 1B1ZA 4C3IB 4NMZA 1F9RA 2L9HA 1TWCB 3K5OA 4OHJA 1KNAA 4RCNA 4ZKBB 4ZK9B 5JPMC 3NSWA 3RZDB 1SXTA 4H13C 5KNDA 3K5NA 1JR0D 1RF2D 5J1ZA 2G9DA 2L5TA 4C1NK 1LABA 3NQIA 1XTCD 2C9OA 1JQYD 2K05A 2RBMA 1EYDA 1Y1WB 1L0YB 4K8IA 2DNCA 4PQXA 3J80L 4KJOA 2F0UA 1DOMA 2E2IB 3Q0AA 4RWSC 1LV9A 4K5XA 5CGKA 4ZYSA 2KA7A 1U4PA 2EZVA 4G7ZC 3HOZB 3P7JA 5TSSA 3OMCA 1PRTC 1MSHA 1STGA 3G6JB 4U673 4XT3B 4RKBA 1S5ED 4H44C 3R93A 3RMHA 1T5EA 5HGTA 5JVH3 1S5CD 1BCPF 2B2UA 3D4RA 1WTQA 1HHVA 1GUTA 2XRSD 3GTJB 3U9OA 3A7LA 3GTLB 2RDGA 2KUMA 3J80E 2Y0SB 3C1FA 2AUJD 4RAUC 3NPPA 1EIHA 3CQZB 5EKLA 3E5SA 3VYRA 4XIGS 3S17B 1H9SB 1STHA 1YNJC 1C48A 4ODGA 2ICIA 3L9AX 3A56A 5EGTA 1I6VC 3OPOA 3URYA 1TT2A 1NR4A 1EL0A 3BVMA 5FK9C 2LKVA 1QG7A 5M3MB 2QILA 1KNEA 3VR3A 4JK1C 1TS3A 4C3HG 4BWGB 4IURA 2RA4A 4DNTB 1IL8A 1TKWB 2RDHA 2NVXB 4HN7A 2EYHA 3IFTA 4XTCS 2K28A 1SYGA 4IUQA 4BA2I 3PUXA 4QF4A 1CFMA 1GUWA 1V43A 3L3OC 1HTPA 3DHQA 1GUSA 1KAAA 2EVBA 2EJGC 1ZYRD 3VR2A 3M7NA 2D2CC 1SJED 5LL6X 2Q8IB 1FR3A 2K04A 1H9SA 4ZQ3A 3C46A 3A8IE 1A3TA 2XWBB 4H7BA 1KDBA 3OWEB 1HRJA 2XWJB 3S1MB 3OIPA 1LTBD 1IKMA 1RTOA 3AU7A 5EKIA 2PNRC 2HDLA 4FXDA 2KCCA 5EPKA 1R4QB 3EFXD 4OGQC 1SEBD 1HPCA 3K6OA 3D4DA 3H91A 3H09A 3LWEA 2CVRA 2XIWA 1SYFA 3A8JE 2PQEA 3HGBA 3S1NB 3NUCA 2L55A 2O2LD 1G2TA 1JWMD 2D62A 2M9VA 1ENCA 4PMBA 1TU2B 1O80A 5G3LD 1I50B 3R3OA 5CV8A 3MC0B 1EZ6A 4A3JB 4FNFA 2WV6D 4N9TA 3E0JA 3ND9A 2F0WA 3A55A 2EYMA 3K58A 3TZDA 4I7ZC 3FRPB 4CKEA 1ZXTA 2A69C 3FPUB 4FVMA 2R93B 4C2MB 3MAQA 1M4VA 2DY8A 2WP8J 1EY8A 3M4YA 2XSCA 2XRQD 2PPBC 2SEBD 1EY4A 1JC7A 3I4NB 2PZTA 2SNMA 2LS01 2JA5B 2K33A 4PNYA 2FINB 3NTHA 3GO5A 1F77A 2R92B 1KDCA 1JB3A 3C1EA 1G8ZD 5K5PA 2K5WA 3K59A 4IUVA 1OXSC 3M4OB 4ULLA 1S5BD 2G9HD 4WRDA 2E2JB 4EQPA 4ZAIA 1AZPA 3DMUA 1NAPA 2SDFA 3QOLA 4M1UB 4B08A 2F0MA 4HTHA 4L63B 5C44B 3Q23A 2F0HA 1IW7D 3NQTA 4G57A 1IYUA 1CK1A 3GD7A 5C4HA 2IX0A 5BN4A 1PRTD 1ENFA 1E0BA 4KHZA 1O78A 4KMUC 4X3UA 4HSPA 1Q90A 1RODA 4Z9CB 3JAML 1BF4A 3HG9A 1OXVA 4XYOA 1Q1BA 4OIKA 1HQRD 2IL8A 3TP5A 1O7ZA 4FYDA 4CGYB 3TP7A 1DD2A 2NTSA 2B2TA 4K5VA 2LMCB 4RFBA 2F0QA 1YNJD 3NXWA 5D3IB 1RCVD 1BCPB 4PMWA 2NTTA 5JEAH 2RSOA 2PW7A 5A2QL 3D8GA 3MFGA 1TWGB 3SVMA 3JAME 2N55A 5FO7B 4CKCA 4TQUS 1EQVA 2HUGA 3KK7A 5EBCA 2RQXA 2KCNA 1GUGA 1SBBB 2EOTA 5JAVA 1SDFA 1X32A 3NBHA 2VB2X 2TMPA 3ONAB 1RKNA 1Z47A 3VR5A 1BXTA 2NVQB 1O7YA 1ZEQX 5IODA 1KABA 3P20A 1AN8A 3LX0A 4A3GB 3P75A 2KJXA 3OW7A 1VDZA 4CJ0B 3MXUA 1PDQA 2ENBA 3D3RA 1EFID 3LWUA 3IL8A 4NW2A 2F3VA 1ET6A 3D6CA 4KY7A 2MHVA 3FVQA 4V190 2HCCA 3PIO3 1CA5A 3M85A 3I90A 4A3IB 5KIXA 4K6LA 3BS1A 2EJMA 1O7LA 2E76C 2VNUD 2PYKA 1II3A 1BDOA 1STYA 2I07B 2D9UA 4C1NI 1TVXA 1KTKA 2OEOA 2IT1A 4FP5D 1PTOC 1FYCA 2F0PA 3HOYB 1EY0A 4X3KA 2J7ZA 1OXTA 3CHBD 3OMGA 2R3ZA 3QWNA 3N52A 1CTMA 4KK7A 4FF1A 5DM63 2EYJA 4UAIA 1G91A 1PMRA 5IGCA 1ET9A 2NBFA 1B3AA 2L11A 1LTRD 3V96A 4CJ1B 4ILWA 3HOWB 4IUTA 1H9RA 4S3SA 5J39A 3A7AB 3R2IA 5EJWA 1EY7A 4A3DB 1D1IA 5ELFA 2BE5C 1SYEA 1SSOA 1SAPA 1I4HA 1EWCA 4KY5A 1JORA 1PTOF 5C4ZA 2BDNA 2A69D 1BBXC 3FMCA 3S2DB 1ML0D 2RSNA 4B9XA 2ZXPA 5IGFA 4RHRA 3MTSA 1SYCA 3SXHA 2F0FA 3T56B 4CKBA 2QF7A 3PV0A 4C3IG 5C0XJ 3WOFA 3MXNA 4RGNA 2F0GA 5BN5A 4A3KB 2NYZD 1BR9A 1F2ZA 1S4ZA 3HS0C 5DM73 4QUCA 2L4NA 3TDQA 3DWAA 5G3LF 1F2MA 1C4QA 3W3AA 4X3SA 3V2TA 4LMQD 4M8AA 2AUKA 2D5DA 3PUVA 3GV3A 1IW7C 4MHEA 4X3TA 3ERQA 2O5IC 2JA6B 1GHKA 2DNEA 4KI0A 4K2LA 2LY7A 5D65A 4TKOB 4A93B 1J8IA 1E2ZA 2F0TA 2TSSA 3VA7A 4DXGA 2HCIA 4RKLA 3ITPA 1LLRD 2JYOA 4K8JA 4ZUJA 4F88A 1UNSA 4C3JB 4NKLA 1EEID 4OO1I 1TWFB 4G4KA 4WFN3 4WORA 1B44D 4BY1B 4R8IA 4NP5A 5CBAE 1STAA 3FDTA 3F2UA 5DAUA 3Q24A 2EY5A 4KD3A 3EJIA 2Z4IA 1S5DD 5IT9L 1H9KA 1FD7D 1WTXA 1KLGD 5I2XA 3V05A 1PRTF 3HOXB 1DCZA 1JWSD 2ID0A 2CQAA 1T5XD 1PFNA 1CT1D 1EZ8A 2QCPX 3CU7A 3J7YW 2BOSA 2K6AA 4DA2A 4BS9A 3J81L 4IUPA 4A3EB 5I4DA 3I4MB 4YIJA 2R61A 2BA1A 2O5JC 4EGVA 4KKTA 1PZKD 5I6WA 5T1GA 1U4MA 3NHHA 4IFDG 4A3FB 5IT9E 4OO1H 4Q0FA 5M3FB 1PZJD 3GTKB 3T53B 2KEEA 2MJ8A 1STEA 5C0XG 4TSSA 2R7ZB 1Y8OB 1JCKB 3VYTA 5IGGA 2AQ2B 1NUCA 4KN4C 4G7OC 1G291 1G2SA 3J81E 1WTVA 1UEAB 1DZ1A 5CORA 3ND8A 4QCLA 4BBRB 2BA0A 3IKJA 3K0YA 2HDMA 1PTOD 1Y8PB 2Z1CA 1A6XA 3SR1A 1PFMA 1DXMA 3MFYA 1H9JA 1LTAD 3S2HB 2YU9B 1WD1A 2NN6G 2VXWA 3I70A 4R9WA 3K5MA 1GUOA 4ME5A 4HCSA 1F9SA 3RUZA 1MGSA 4OIJA 1B50A 3S1QB 5CV5A 4ZLTF 3IAYA 1HUMA 2ICEC 2WKDA 1EY9A 2QKIC 2A5HA 5C4JB 5J22A 3NBIA 4ZKCB 2BE5D 5IGBA 4HMIA 1VCIA 5FO8B 1I4PA 3HZXA 1B9MA 1LACA 1TY0A 5T1IA 2EY6A 2ZXOA 2V4DA 2Z8LA 2L0CA 1D5MC 5IOCA 1VMCA 2PCFB 5M5XB 2WACA 3FPPA 2BDOA 3D6WA 3MHBA 1VF5C 4NDXA 3H6MA 3KF8A 4XDXA 1GHJA 2WAQB 5E4WC 1WTWA 3WDNA 1I4XA 5M5YB 2X69A 3T4AC 2MP1A 4FO2A 1SNDA 4LAAA 4RGTA 1BUVT 1WTOA 4IN3A 3QJYA 3I91A 5FLXL 3L7ZC 1WD0A 2E74C 2EYFA 2PO4A 1Q1EA 2B8FA 2F0EA 2X6LA 1HUNA 2K7VA 1WTRA 2K03A 2J4XA 2Q8RE 1G6ZA 2IX1A 2NVYB 2IW3A 2KOLA 4HAEA 1WTPA 1ONLA 3DWQA 2VUMB 5FOBB 2B2YC 5IIFA 1X3PA 1HQMC 2B39A 1CHQD 1ESRA 5FLXE 2A74C 1U4LA 4KN7C 2F1MA 4KTAA 1IKLA 4A3BB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LMQ D;  3MWY W;  5T1G A;  2B2U A;  1B3A A;  3GV6 A;  3SVM A;  1WTQ A;  2L11 A;  2KED A;  2Q8T A;  4HSV A;  1HHV A;  1RTN A;  5T1I A;  2K04 A;  1U4M A;  4CJ1 B;  3GV3 A;  4IUV A;  2N55 A;  1C8C A;  4MHE A;  2K01 A;  3G7L A;  3I3C A;  4X3T A;  2KUM A;  5E4X A;  1BO0 A;  4IUT A;  2HUG A;  2EE1 A;  1JIC A;  4DN4 M;  1HA6 A;  1PLF A;  4ZAI A;  1VMC A;  2B2Y A;  1AZP A;  1HRJ A;  2NWG A;  1XYI A;  2EPB A;  5COY A;  2KEE A;  1HFN A;  4IUU A;  1F9R A;  2EOT A;  2L9H A;  2MJ8 A;  4RA8 A;  1SDF A;  1RTO A;  4RAU C;  3D6W A;  1IKM A;  1X32 A;  1EIH A;  1NAP A;  1KNA A;  1DOL A;  5D65 A;  4ZKB B;  2B2W A;  5EJW A;  4ZK9 B;  1J8I A;  2SDF A;  5EKI A;  4O42 A;  5D14 A;  3ONA B;  2HDL A;  1WVL A;  2N88 A;  1BNZ A;  5EPK A;  1G2S A;  1O7Y A;  2DY7 A;  1WTV A;  1SSO A;  1SAP A;  5COR A;  1DZ1 A;  4XDX A;  5EPL A;  2HCI A;  2NZ1 D;  2JYO A;  1U4R A;  3H91 A;  5E4W C;  1WTW A;  2BDN A;  2CVR A;  2XIW A;  3LWE A;  5EQ0 A;  2HDM A;  1BBX C;  1ILP A;  1ILQ A;  1NR4 A;  1ML0 D;  1EL0 A;  1PFB A;  2X69 A;  4MN3 A;  2RSN A;  2MGS A;  2MP1 A;  1RHP A;  4CJ0 B;  1PFM A;  4QUF A;  1PDQ A;  3IL8 A;  1AP0 A;  1QG7 A;  4NW2 A;  3IFD A;  3DEO A;  2B2V C;  1WTO A;  5AFW A;  1G2T A;  4XT1 B;  1J9O A;  1XX8 A;  1KNE A;  3I91 A;  3MTS A;  2K05 A;  2HCC A;  1VMP A;  3HP3 A;  1WD0 A;  1WD1 A;  1CA5 A;  3UI2 A;  1B4O A;  1A15 A;  1E0B A;  4R8I A;  2B2T C;  3I90 A;  1CM9 A;  2VXW A;  4IUR A;  2RA4 A;  3QO2 A;  4R9W A;  1HUN A;  1F2L A;  2X6L A;  1EIG A;  5CBA E;  3FDT A;  1DON A;  3Q6S A;  1IL8 A;  3F2U A;  1O80 A;  4HCS A;  3DEP A;  2M2L A;  4X3U A;  1WTR A;  1JE4 A;  1F9S A;  1ROD A;  2FMM A;  3KBX A;  1F9P A;  1BF4 A;  2K03 A;  1X3Q A;  1MGS A;  1MI2 A;  1M8A A;  4OIJ A;  1B50 A;  1EQT A;  2D9U A;  2K28 A;  2FHT A;  4U68 A;  1B2T A;  1TVX A;  2Q8R E;  2L1B A;  1G6Z A;  1RJT A;  1WTX A;  5EPJ A;  4IUQ A;  2NYZ D;  5DNF A;  2B2U C;  2L12 A;  3TZD A;  4OIK A;  1AZQ A;  4ZLT F;  2FJ2 A;  1ZXT A;  1NCV A;  2JP1 A;  3FPU B;  2B2V A;  2IL8 A;  2KOL A;  1S4Z A;  5JJZ A;  1O7Z A;  1DOM A;  2KVM A;  4HAE A;  4QUC A;  1WTP A;  4X3K A;  4RWS C;  2J7Z A;  1LV9 A;  2DY8 A;  2L4N A;  1DOK A;  1HUM A;  1PFN A;  1QE6 A;  1EOT A;  1CA6 A;  2R3Z A;  1GUW A;  1U4P A;  3N52 A;  1HFG A;  1QNK A;  1Q3L A;  2B2T A;  3DM1 A;  4HED A;  1F9Q A;  2MPM A;  3P7J A;  2B2Y C;  1X3P A;  4IUP A;  4ZKC B;  3KUP A;  3I8Z A;  1MSH A;  4UAI A;  2FFK B;  4X3S A;  1ICW A;  5CMD A;  1G91 A;  1ESR A;  2H1E A;  2RVL A;  2X6G A;  4XT3 B;  4CJ2 C;  1B53 A;  2B2W C;  3R93 A;  2KEC A;  1U4L A;  2RSO A;  3TN2 A;  1NR2 A;  2FIN B;  1IKL A;  2K1B A;  1MSG A;  5CBE E; 
#chains in the Genus database with same CATH topology
 4LK1 C;  4X64 Q;  2I5L X;  2KED A;  1EIY B;  4LF4 Q;  4KHV A;  4DV1 Q;  2F03 A;  4X62 Q;  1QIL A;  1SNC A;  5CV4 A;  3RLF A;  1X6O A;  2YYZ A;  4DF7 A;  1QCB D;  2UXD L;  5HUR A;  1I6H B;  3RLO A;  1MKH A;  3L2P A;  1SNO A;  2PMZ B;  1UAP A;  3M7G A;  1KL9 A;  1Y8N B;  3X3M A;  1EWH A;  1SR3 A;  2M00 A;  3SE0 A;  4B3T L;  3HOU H;  4Y7N H;  4DV7 Q;  5CV9 A;  3S14 B;  1EYA A;  3VYS A;  3TP8 A;  3R2T A;  3HOV B;  4DR6 L;  3CCV A;  4OL7 A;  5CV7 A;  4XXE A;  4RHS A;  2IX3 A;  1ILP A;  5KGU A;  3SGI A;  1JOQ A;  2AWN A;  4F8M A;  5KYL A;  1TS5 A;  4XQQ A;  1S5F D;  4QUF A;  5ELO A;  2KCT A;  2JXM B;  2KHI A;  3HP3 A;  2OTL A;  4GNX B;  2H4O A;  2E5L L;  4E6I A;  1MJE A;  2F0O A;  1CKN B;  4EQO A;  3K57 A;  2QA4 A;  5ISR A;  3GTQ B;  1JE4 A;  1QNU A;  3QB3 A;  1NMG A;  3TZU A;  2F0D A;  5A2Q E;  1YEZ A;  3A5U A;  3J7A 5;  1PRT B;  4GN5 A;  1EQT A;  5ELB A;  3Q22 A;  1PH3 A;  1YI2 A;  4I65 A;  4CDE C;  2R7F A;  1WCM B;  2L12 A;  1UUP A;  4B3S Q;  1XNR Q;  4MIU A;  1PH7 A;  1UE7 A;  2FJ2 A;  1NCV A;  2JP1 A;  4RGM A;  2KVM A;  1FVI A;  1IBL Q;  3L0O A;  4LF7 Q;  1X54 A;  1VF7 A;  5JJL A;  4A3G G;  2KEN A;  2ZT9 C;  5FLX c;  4C3H H;  3A8K E;  4XQJ A;  2NZO A;  3MA2 B;  1FGB D;  2G5D A;  1XPU A;  2HQE A;  1SFO H;  4R1J A;  3A0J A;  4X65 Q;  4K5W A;  1QOH A;  3LNN A;  3I8Z A;  1ICW A;  4N9P A;  3S24 A;  1DM0 B;  2H1E A;  3I4M H;  1AH9 A;  1B53 A;  5KYI A;  1CHP D;  5I9P A;  4P2C B;  3AFQ A;  4DV3 Q;  1QVC A;  3QIA A;  5FO9 B;  3KLS X;  4C56 C;  3E3X A;  5CBE E;  3VR4 A;  3GV6 A;  4PZ7 A;  4A3I G;  2JA7 B;  1QWY A;  3TEH B;  4A3F H;  2VQF Q;  4DR3 Q;  1DYQ A;  5JEA J;  2EE1 A;  2PI2 E;  1K83 B;  1R4P B;  3TP6 A;  4JG2 A;  1KDA A;  2XNA C;  1CQV A;  5COY A;  5CV6 A;  2CHB D;  1L2F A;  3F2B A;  1BQQ T;  4DGZ A;  1CZW A;  5KRU A;  2R7Z H;  3HOY G;  4LJZ C;  2A6H D;  1LYL A;  4O42 A;  5KNC A;  1PH1 A;  1UE6 A;  1CZG A;  2QDL A;  2N88 A;  2RF4 A;  1GO3 E;  4FF4 A;  1HA5 A;  3ERO A;  4GNX A;  4JYA Q;  4GS3 A;  4DAM A;  1XMQ Q;  2I46 A;  1SE3 A;  1BKB A;  1U4R A;  3EA6 A;  1D2B A;  3GTO B;  2RHS B;  3BYY B;  3KLR A;  4DAP A;  1P16 A;  1KLU D;  1EY6 A;  1PFB A;  4MN3 A;  4RCO A;  4KV6 A;  3GTG B;  2AQ1 B;  1A3U A;  1J5E L;  1MD2 D;  1U9R A;  2B2V C;  4FF2 A;  3CME A;  1ESF A;  1N8R C;  4XT1 B;  3BDL A;  1D1K A;  1LUZ A;  4KKU A;  1L1O A;  4F7X A;  3T1Y Q;  2RDF A;  3HOW G;  1FJG L;  1TWA B;  1PYB A;  3LGJ A;  1TR5 A;  2IJ0 A;  1F2L A;  4IJH A;  1EIG A;  2SOB A;  1SNQ A;  4A3L H;  3T13 A;  3OSO A;  1IHZ A;  2SNS A;  1EU3 A;  5IGE A;  3S9W A;  4FF3 A;  3CCS A;  2NUC A;  1DGS A;  2K32 A;  3DM3 A;  5CC4 A;  1TQO A;  4U68 A;  3I7F A;  1EFW A;  2E8G A;  5EPJ A;  5M9O A;  4A3D G;  1SE2 A;  4MTK A;  4IFD J;  2E2D C;  4OX9 Q;  1HCZ A;  3D31 A;  1VQL A;  4NXN Q;  1N33 Q;  1K0R A;  1DOK A;  4JI1 Q;  1Y1V B;  1HFG A;  2RKS A;  3DM1 A;  2MPM A;  5C4J H;  3M3Y H;  4DV6 L;  2B2W C;  2A8V A;  1CSP A;  5EAY A;  3K7A B;  2AQ3 B;  1GOZ A;  4JI8 L;  4ABN A;  1VQF A;  2YTY A;  3FKI H;  3UDX A;  3CCL A;  1LT5 D;  2Q8T A;  1E1O A;  3E9I A;  3I72 A;  1W6K A;  2K01 A;  1VQ6 A;  1Y69 U;  3NEN A;  1JJ2 A;  2NB0 A;  4P73 A;  1JIC A;  1LTG D;  4DN4 M;  4QB4 A;  1EYC A;  3NTI A;  1BCP C;  4DFA A;  3S16 H;  4A3K G;  4IUU A;  5LHY 1;  4RA8 A;  4BA1 I;  4YCW A;  3PQI A;  2KCM A;  2OCE A;  1E2W A;  4L6T B;  4RH6 A;  3OIQ A;  2EYP A;  1WVL A;  4NXM Q;  1PYS B;  1PTO H;  1FGU A;  3MVV A;  5IYD H;  5BR8 Q;  3JAM i;  1STB A;  5C5L A;  4DK1 A;  4HID A;  1HNX Q;  2E75 C;  1GUN A;  2BCO A;  5IGD A;  3KYH C;  3I4L A;  2MGS A;  1V1O A;  2CCZ A;  5FJ8 H;  1AP0 A;  1SMY C;  3IFD A;  1UWV A;  2VQE L;  4PZ8 A;  5IP7 G;  3I73 A;  3HOU B;  4Y7N B;  4FXG C;  4DAV A;  5K36 H;  2JK8 A;  4DR5 Q;  4J6H A;  2JA8 H;  1PZI D;  3KBG A;  3TS2 A;  2JA6 G;  4LFA L;  2B29 A;  1DON A;  3DEP A;  4CHT B;  4R4Q A;  3ZYY X;  1SE4 A;  2JJQ A;  2FMM A;  4JBM A;  3GTP H;  3PO3 H;  1RD9 D;  1X3Q A;  1OXX K;  1PYW D;  4TRD A;  4DR1 L;  1EYG A;  1HNW L;  5JEA G;  2MQH A;  3KJP A;  3BVZ A;  2FHT A;  4UHV A;  3GP7 A;  4A93 G;  1RJT A;  2QEJ C;  1N34 L;  4GKJ Q;  2VB3 X;  1YNN C;  1A2T A;  1TS2 A;  3UDG A;  3GQB A;  4HMJ A;  2A6E C;  4J15 A;  1J6Q A;  2K75 A;  5JJZ A;  1VQA A;  2A68 C;  4DAY A;  2LFN A;  2IWH A;  2F0J A;  2CW0 C;  4JBJ A;  3PO2 B;  1Q3L A;  4V0B A;  4C3J G;  1F9Q A;  5JOB A;  1R9T B;  2N49 A;  3NWS A;  2FFK B;  1SJH D;  4IOC A;  4GOP A;  4DUZ Q;  2YV5 A;  2KHS A;  4A76 A;  3G71 A;  1NR2 A;  4DR2 L;  5ELC A;  1B9N A;  3T1H Q;  3C3L A;  4BY1 G;  2K1B A;  1MSG A;  2WII B;  4AH6 A;  4A3B H;  3MWY W;  2OF1 A;  3R8B A;  1PH5 A;  2F4I A;  3J7A V;  4HCE A;  4GZY C;  5C3E B;  4C3H B;  1JWU D;  3KJO A;  4JV5 L;  1GXD C;  1SFO B;  3GTM H;  1XWE A;  2ZXR A;  4X66 Q;  2E2H H;  1I6H H;  1LT4 D;  5A35 A;  5HGQ A;  1TWH H;  1HFN A;  3PIP 3;  1V8Q A;  4DR4 L;  3HOX G;  4B3R Q;  2UXB Q;  4B9W A;  4OWT B;  3KLW A;  1K8M A;  3VR6 A;  2ZTE A;  1B8A A;  4ZUI A;  3ULJ A;  2AWO A;  4IQZ A;  1VQJ A;  4LF5 Q;  5EQ0 A;  4A3E G;  1OTC A;  1Q8I A;  2OXP A;  3HKZ B;  4F87 A;  3I4M G;  4JBK A;  3RZO B;  1Z7T A;  3NTK A;  4DNR B;  3K5L A;  1JOK A;  3M4Q A;  4A75 A;  1MBY A;  3QG1 A;  1G6P A;  1X56 A;  3BDC A;  4AYB B;  1A2U A;  1XNQ L;  2F0K A;  1D5X C;  3PUW A;  4A3F G;  4KHP L;  1V9P A;  4JCV E;  4JI3 Q;  1QJO A;  2R6G A;  1A15 A;  3F2D A;  1O7I A;  1EY5 A;  5M3F G;  4IAL A;  1CI3 M;  2IPK D;  3CC4 A;  3BVG A;  1HJP A;  2C35 B;  2DN8 A;  1F9P A;  4HJ8 A;  1CUK A;  4KY6 A;  2LSS A;  3RN5 A;  5KEE A;  4BBS H;  4A3M B;  2R7Z G;  4WJW A;  5F2D A;  2FXQ A;  2JEA I;  1ENA A;  4MZ9 A;  1L0X B;  2B2U C;  1AZQ A;  1WCM H;  1NSN S;  1VQG A;  4UDU C;  4BXX H;  3H94 A;  5C4X B;  1EQQ A;  1N32 L;  2WB1 B;  3BU2 A;  2JSO A;  4BBR G;  1K8O A;  1Z6H A;  1QE6 A;  1EOT A;  3X3N A;  2HQL A;  4EQ5 A;  4KLK A;  3CXC A;  1YJ9 A;  1E3P A;  2DGY A;  4GN3 B;  2MUY A;  2A6H C;  4A4I A;  3NE5 B;  3DWP A;  4JI4 Q;  3T51 B;  4K6D A;  4AQY Q;  4YCU A;  3QOJ A;  4CJ2 C;  2X6G A;  1KRS A;  2UXC Q;  4WJ4 A;  3OHX C;  4AIM A;  1C8C A;  4JOI C;  2HHH L;  4JBW A;  4HSV A;  4QL5 A;  4A3L G;  2F0L A;  5E7N A;  1LTI D;  3MXP A;  3FP9 A;  3BYT B;  1TY2 A;  3G7L A;  3H0G H;  3QR8 A;  1BOS A;  4PMC A;  1AEX A;  1FNW A;  2K5Q A;  3M3Y B;  2OQ0 A;  3BDO A;  1HA6 A;  1D6E C;  1PLF A;  4OEM B;  2B2Y A;  4K0K Q;  3PUZ A;  1VQ8 A;  3U50 C;  1IBM L;  4IO9 A;  1LT6 D;  3G6E A;  2B63 B;  1LTT D;  2PQA B;  2AHO B;  3AB9 A;  2ZM6 Q;  4LF8 Q;  4DR7 Q;  1E2V A;  2IY5 B;  5LMU Q;  3BZD B;  2B8G A;  4DV0 Q;  4RGO S;  3OWF A;  2EYO A;  2MO1 A;  3FKI B;  4ZRZ A;  3OW2 A;  1C0A A;  2JN4 A;  4DV4 L;  1XPO A;  4Q5V A;  5ELE A;  5ELN A;  3CAM A;  1JE5 A;  3AQQ A;  2NZ1 D;  1TII D;  4RMF A;  2EJF C;  3NWT A;  1ILQ A;  5D3D A;  3S16 B;  5CYU A;  2FMC A;  1D8L A;  4X64 L;  4HJ7 A;  3E6Z X;  4LF4 L;  4CBV A;  4DV1 L;  1PXU A;  4X62 L;  3CKI B;  2MO0 A;  4H0L C;  3U9S A;  1W6J A;  1PTO B;  4K14 A;  1WOC A;  4JI0 L;  4XYQ A;  5C5M A;  3E0E A;  4BY7 H;  3ULL A;  5C3X A;  1IYV A;  1OXU A;  4O1N A;  2I0Q A;  5IP9 H;  1MI2 A;  3PUY A;  3VYU A;  4DV7 L;  4LFB Q;  5LL6 S;  2L1B A;  2VW9 A;  1XMO Q;  1KRT A;  2ZJP A;  2JE6 I;  5I2Y A;  1VQP A;  2EYL A;  2RCF A;  3I56 A;  4N8X 1;  4QMG A;  1EQR A;  5I9O A;  1BCP D;  1A3V A;  3FHW A;  3NP8 A;  4DXF A;  3S1R H;  5JJK A;  2KQ3 A;  4JC0 A;  4L8J A;  2NVT H;  2K50 A;  2WAQ G;  2JA8 B;  4GKK Q;  2F3W A;  3U58 A;  1I3Q B;  3KLS A;  3GTP B;  1Z9F A;  2EDG A;  4QIW B;  3PO3 B;  3KUP A;  2XVS A;  4J8Q A;  3I2Z A;  2RVL A;  4QY7 A;  1TWC H;  2YTX A;  3TN2 A;  2PNH A;  5K36 G;  1QZG A;  3RZD H;  1IZ6 A;  3TQY A;  1K9M C;  3MXG A;  1B3Q A;  1YIJ A;  2HIX A;  4DU9 A;  5M5W B;  1LO5 D;  1SMY D;  5EBD A;  5E1F A;  1V1P B;  4EVO A;  3T16 A;  2F52 A;  4KD4 A;  3TSS A;  1WFQ A;  4DK6 C;  4B3S L;  1XNR L;  2NWG A;  2QDB A;  2EPB A;  1MIU A;  4J1M A;  2F4V L;  3CC7 A;  1Q12 A;  1Q86 C;  1IBL L;  4LF7 L;  2MFI A;  2N8N A;  3C2P A;  4IZ8 A;  1BBU A;  4G7H C;  3SK5 A;  5LMN W;  1SYD A;  3I55 A;  3RD4 A;  4PG3 A;  4UP8 A;  4X65 L;  1Y1W H;  1GD7 A;  3FEW X;  2VUM G;  5GAE C;  3CRK C;  3D4W A;  1D5Z C;  1W3S A;  4KJN A;  2UU9 Q;  1YNN D;  3WOE A;  5IY0 A;  5AJ3 Q;  3GTM B;  2JEB I;  2A6E D;  2E2H B;  4DV3 L;  4JI7 Q;  4ID6 A;  2A68 D;  1RHP A;  1TWH B;  2XN9 C;  2CW0 D;  1ICF B;  3HKS A;  4A3B G;  3CRL C;  3DEO A;  1FNV A;  1RL2 A;  3EQL C;  2F0S A;  5NUC A;  2VQF L;  1UEB A;  1XX8 A;  4DR3 L;  3H3V C;  2F0I A;  4POG A;  1W2B A;  3O13 A;  1CM9 A;  2QW7 A;  3J81 i;  1HZB A;  3W5O A;  1LT3 D;  4EQN A;  1QUQ B;  1I4R A;  2PZW A;  5I6Y A;  4XQN A;  1KC8 C;  4QQB X;  2EY1 A;  3SEB A;  2QGQ A;  5JPN C;  4IFD I;  4YCV A;  2J0T D;  2JQO A;  1B2T A;  4IOA A;  2WIN B;  1SNP A;  2P5Z X;  4DK0 A;  4JYA L;  1XMQ L;  2B2V A;  2N78 A;  3DXJ C;  1SYB A;  3TME A;  4R8N A;  5JVG 3;  1KD1 C;  1TS4 A;  3AMU A;  3HOV G;  3MZ5 A;  5E3F A;  3GTJ H;  1I4G A;  2WKC A;  4OO1 G;  2Z4H A;  3GTL H;  1HXY D;  4YY3 Q;  3SK6 A;  1QNK A;  2PZU A;  2Q2H A;  4HED A;  5C0X I;  3PO2 H;  1AFP A;  1C7Y A;  5BN3 A;  1V1P A;  1R9T H;  1Q7Y C;  2GA4 B;  1I4Q A;  3PF4 A;  1VQH A;  1X3F A;  4R4I A;  4GLA C;  3BG3 A;  4BBS B;  2KEC A;  3CQZ H;  4HR7 B;  1CQF A;  4UP9 A;  1VQ4 A;  1HZA A;  5LMN Q;  1Q46 A;  1L1O B;  3S17 H;  2OT2 A;  1HTL D;  1H95 A;  1EOV A;  3HRZ C;  3A54 A;  4QJF A;  3I3C A;  3TBI B;  5E4X A;  3SK4 A;  5C6A A;  5C3E H;  2WAQ E;  1CSQ A;  4JPB W;  2A73 B;  4JI5 Q;  3TRE A;  1H9M A;  1XYI A;  1RDP D;  2F0V A;  3EVQ A;  1JOO A;  1YHB A;  2NN6 I;  1WCM G;  5DEH A;  5C3W A;  1DOL A;  1STN A;  5CR3 A;  2B2W A;  4NXN L;  1NTG A;  3SK8 A;  5H1S E;  1N33 L;  2O4X A;  5D14 A;  4JI1 L;  5GAH C;  1GJX A;  1SE8 A;  1HZC A;  1FNU A;  3J7A F;  1BNZ A;  2DY7 A;  5KNB A;  4LF9 Q;  1ZYR C;  5EPL A;  1WYD A;  4IFD H;  3VA5 A;  3H0G B;  3NK9 A;  1ZKO A;  2KBN A;  4OWW B;  2EXZ A;  2NVX H;  1QUQ A;  2EY2 A;  3RZO H;  1XXG A;  2B3G A;  4FXK C;  3OOC A;  3D0F A;  5EKK A;  3CPF A;  3S15 B;  5AFW A;  2JA7 G;  5C0X H;  1J9O A;  4PZ6 A;  1VMP A;  3SHL A;  2UUA Q;  4L5Q A;  3UI2 A;  5FLM G;  1B4O A;  2UUC Q;  3MEH A;  3PMF A;  2B2T C;  3QO2 A;  4PV1 C;  3OTO Q;  3PIP A;  3Q6S A;  1Y14 B;  2M2L A;  3F1Z A;  2I5H A;  3KBX A;  1AW7 A;  4P75 A;  3HEJ A;  1DJR D;  1F2Y A;  1M8A A;  5ELD A;  2NZH A;  1YHQ A;  1EU4 A;  3K80 C;  4NB3 A;  2PW5 A;  2D0O A;  4A3M H;  4NXM L;  4LNQ A;  5DNF A;  2C5C A;  4R4O A;  1WJJ A;  5BR8 L;  5C4X H;  1SNM A;  4CDD C;  1N36 Q;  3K8A A;  2BH8 A;  1HNX L;  1K3B C;  4IUN A;  4K2K A;  1CA6 A;  4BY7 B;  2NN6 H;  3DLL A;  2K5D A;  4YWK A;  3DUZ A;  3W2D A;  4ALP A;  3N6R A;  3P1H A;  1OO9 B;  3K7U C;  2PMZ E;  5CMD A;  2F0N A;  1QB5 D;  3SDZ A;  4DR5 L;  2GVA A;  1B7Y B;  4WJ3 M;  1LTS D;  3F2C A;  1RTN A;  1EEF D;  3S1R B;  3VDY A;  4KKS A;  5FKA C;  1M90 C;  5IWA Q;  2NVT B;  4GN4 B;  3CCM A;  1BO0 A;  5IP9 G;  2EQS A;  3CF5 A;  3ULP A;  1U0L A;  1B1Z A;  2H5X A;  2I5M X;  3MEF A;  4C3I B;  4NMZ A;  4GKJ L;  4LF6 Q;  1NMF A;  2B63 H;  3S1N H;  3UE1 A;  1F9R A;  2L9H A;  1TWC B;  3K5O A;  4OHJ A;  1KNA A;  4RCN A;  4ZKB B;  4ZK9 B;  5JPM C;  3NSW A;  2EIF A;  3RZD B;  4DAY B;  2CWP A;  1SXT A;  4H13 C;  1Y1V G;  1JJG A;  4O2D A;  5KND A;  4UP7 A;  3K5N A;  4DUZ L;  1I50 H;  2CFM A;  5HY6 A;  2OWO A;  4A3J H;  3T1H L;  4GOP B;  1JR0 D;  1RF2 D;  5J1Z A;  2G9D A;  2L5T A;  1LAB A;  4C1N K;  4HIM A;  3NQI A;  1XTC D;  2IHE A;  2C9O A;  1K0S A;  1JQY D;  3M4P A;  2K05 A;  2RBM A;  4C2M H;  1EYD A;  4X66 L;  1Y1W B;  1L0Y B;  2L15 A;  1XJV A;  4K8I A;  2DNC A;  3CD6 A;  2UXB L;  3I4N H;  4PQX A;  3J80 L;  2JA5 H;  5IYB G;  1NBW A;  5IYC G;  2R92 H;  4P71 A;  4ME3 A;  4GNX C;  4KJO A;  2F0U A;  1DOM A;  4LF5 L;  2E2I B;  3Q0A A;  4RWS C;  1LV9 A;  4K5X A;  3TRZ A;  5CGK A;  4ZYS A;  2KA7 A;  1U4P A;  2EZV A;  4G7Z C;  3HOZ B;  1I3Q H;  3P7J A;  3CCE A;  3A74 A;  5TSS A;  2E2J H;  3OMC A;  1PRT C;  1MSH A;  1STG A;  3G6J B;  3KF6 B;  4U67 3;  1S40 A;  4XT3 B;  4RKB A;  1S5E D;  4H44 C;  3R93 A;  3RMH A;  1JJC B;  4JI3 L;  1T5E A;  3AYH B;  3HOU G;  5HGT A;  5JVH 3;  1S5C D;  1BCP F;  2B2U A;  3D4R A;  1WTQ A;  2Z9H A;  1HHV A;  1GUT A;  2XRS D;  3BZK A;  3GTJ B;  3U9O A;  3A7L A;  3GTL B;  2RDG A;  2KUM A;  5M5W H;  3J80 E;  3U4V A;  2Y0S B;  1CKO A;  3ICE A;  4JI6 Q;  2MNA A;  3WWV A;  2XTI A;  3C1F A;  2YTV A;  1WTH A;  2AUJ D;  4RAU C;  3BZC A;  3NPP A;  1EIH A;  3CQZ B;  3UE0 A;  5EKL A;  1X3G A;  3E5S A;  3VYR A;  4XIG S;  3S17 B;  2VS1 A;  1H9S B;  1STH A;  1YNJ C;  1C48 A;  3CCU A;  4ODG A;  3PO2 G;  2JA9 A;  3RR5 A;  4JI4 L;  2ICI A;  3L9A X;  3A56 A;  4AQY L;  5EGT A;  4IJL A;  1I6V C;  1PH9 A;  3OPO A;  1X3E A;  4LWC A;  3URY A;  2UXC L;  2Z6K C;  1TT2 A;  1NR4 A;  1EL0 A;  3BVM A;  5FK9 C;  2LKV A;  1UE5 A;  2Z6B A;  1QG7 A;  5M3M B;  2QIL A;  4DUY Q;  4CDC C;  1KNE A;  3VR3 A;  4JK1 C;  5C3E G;  1TS3 A;  4C3H G;  4BWG B;  4IUR A;  2RA4 A;  1I94 Q;  4DNT B;  1IBK Q;  4K0K L;  2WFW A;  1IL8 A;  3W1G A;  1TKW B;  2ZM6 L;  4LF8 L;  2RDH A;  1VQC A;  4DR7 L;  4HN7 A;  2EYH A;  3IFT A;  1PVO A;  5LMU L;  2NVX B;  4XTC S;  4DV0 L;  2K28 A;  3KF6 A;  1SYG A;  4IPG A;  4DKA C;  4IUQ A;  2ZTC A;  1TWG H;  4BA2 I;  3PUX A;  4QF4 A;  1CFM A;  1GUW A;  1GM5 A;  3HKZ G;  1V43 A;  4GLX A;  1YIT A;  3L3O C;  1HTP A;  4YHH Q;  4TVA B;  3DHQ A;  1GUS A;  1KAA A;  1SN8 A;  2EVB A;  4AYB G;  2ALY B;  4L5R C;  2EJG C;  1ZYR D;  3VR2 A;  3M7N A;  2D2C C;  1SJE D;  1PH2 A;  3J80 c;  5LL6 X;  3H15 A;  2Q8I B;  1FR3 A;  2NVQ H;  2K04 A;  1H9S A;  4ZQ3 A;  3C46 A;  4LUO A;  3A8I E;  4A3G H;  4LFB L;  1A3T A;  2XWB B;  1XMO L;  4H7B A;  1KDB A;  3OWE B;  4A3M G;  1HRJ A;  2XWJ B;  3S1M B;  3I4O A;  3OIP A;  1LTB D;  4DV2 Q;  1IKM A;  1RTO A;  5C4X G;  2VZA A;  3AU7 A;  3JC6 6;  2Q2T A;  4GKK L;  2WB1 G;  5EKI A;  2GVB A;  4FDB A;  2PNR C;  2HDL A;  1D7Q A;  4FXD A;  2KCC A;  5EPK A;  4ZCK A;  1R4Q B;  3EFX D;  4OGQ C;  1SEB D;  1HPC A;  3K6O A;  3W1B A;  3D4D A;  3H91 A;  4GLV B;  3H09 A;  3LWE A;  2CVR A;  2XIW A;  1IL2 A;  1SYF A;  3A8J E;  2PQE A;  4JVZ A;  2Q2U A;  1SRU A;  3HGB A;  3S1N B;  3NUC A;  4UPA A;  2L55 A;  2O2L D;  3S15 H;  1G2T A;  1JWM D;  2A1A A;  3CPW A;  3HOY H;  2D62 A;  2M9V A;  1E24 A;  1ENC A;  4PMB A;  1TU2 B;  1O80 A;  5G3L D;  1I50 B;  3R3O A;  5CV8 A;  2B63 G;  3MC0 B;  1EZ6 A;  4A3J B;  4FNF A;  2WV6 D;  1I5F A;  4N9T A;  3E0J A;  3ND9 A;  2F0W A;  1VQM A;  3A55 A;  2EYM A;  3K58 A;  3TZD A;  4I7Z C;  3FKI G;  3FRP B;  1ZXT A;  2A69 C;  3FPU B;  4FVM A;  4CKE A;  2R93 B;  4C2M B;  3MAQ A;  2UU9 L;  5AJ3 L;  1M4V A;  2DY8 A;  3HOW H;  4JI7 L;  1VQD A;  2WP8 J;  1EY8 A;  1G51 A;  3M4Y A;  2XSC A;  2XRQ D;  2PPB C;  2SEB D;  1AE2 A;  1EY4 A;  1A8V A;  1JC7 A;  3I4N B;  2PZT A;  2SNM A;  2LS0 1;  3A5Z B;  2JA5 B;  3ERS X;  2K33 A;  4PNY A;  2FIN B;  3NTH A;  3GO5 A;  1F77 A;  2R92 B;  1KDC A;  1JB3 A;  3C1E A;  4MNO A;  4A3D H;  4LW1 A;  5IYD G;  1G8Z D;  5K5P A;  2K5W A;  3K59 A;  4IUV A;  1OXS C;  1N32 Q;  1HZ9 A;  3M4O B;  4ULL A;  1S5B D;  2G9H D;  2LXK A;  4WRD A;  3HKZ E;  3NEL A;  4OON A;  2E2J B;  4EQP A;  3S2D H;  4ZAI A;  4C3I H;  1AZP A;  3B6Y A;  4RG1 A;  5FJ8 G;  5GRO A;  3DMU A;  1EUJ A;  1IXR A;  1JT8 A;  1NAP A;  4AYB E;  2SDF A;  3QOL A;  2JA8 G;  1VQO A;  2K5H A;  4M1U B;  4L5T A;  3UDI A;  4B08 A;  2AKW B;  2HHH Q;  2F0M A;  4HTH A;  3PO3 G;  4L63 B;  1RIP A;  4MTN A;  5C44 B;  3Q23 A;  2F0H A;  1IW7 D;  3NQT A;  1HR0 W;  4G57 A;  3NBH B;  3E9H A;  1IYU A;  4H02 A;  4A3K H;  1CK1 A;  3GD7 A;  5C4H A;  2IX0 A;  2V1C C;  5BN4 A;  1PRT D;  1ENF A;  1EWI A;  2WB1 E;  4JI5 L;  1E0B A;  1VQI A;  1SRO A;  4KHZ A;  4JI2 Q;  1O78 A;  1WI5 A;  4KMU C;  4X3U A;  4HSP A;  1Q90 A;  1ROD A;  4Z9C B;  3JAM L;  1BF4 A;  3HG9 A;  1OXV A;  2K5V A;  4XYO A;  3CMA A;  1Q1B A;  3NEM A;  1Q81 C;  1KHI A;  4OIK A;  4DV5 Q;  4LF9 L;  1HQR D;  2IL8 A;  3TP5 A;  1O7Z A;  5IP7 H;  3PGZ A;  4B3M Q;  1E1T A;  2E2I H;  2ES2 A;  4FYD A;  4CGY B;  3TP7 A;  4APV A;  1DD2 A;  2NTS A;  2QEX A;  2B2T A;  4K5V A;  3HOZ H;  2LMC B;  4RFB A;  2JA6 H;  1VQK A;  4JI0 Q;  1K28 A;  4I7A A;  2F0Q A;  1YNJ D;  4LFC Q;  3NXW A;  5D3I B;  1RCV D;  1BCP B;  2CH4 A;  4PMW A;  2NTT A;  5JEA H;  2UUA L;  2RSO A;  3CW2 C;  2PW7 A;  2CKZ B;  5A2Q L;  2UUC L;  4A93 H;  1KIX A;  3OTO L;  3D8G A;  3MFG A;  1TWG B;  3SVM A;  5L37 A;  1IYJ B;  3KDF B;  2RHQ B;  3JAM E;  2N55 A;  5FO7 B;  4CKC A;  4TQU S;  1EQV A;  2HUG A;  2ZJQ A;  2ASB A;  4C3J H;  3KK7 A;  2PI2 A;  1HR0 Q;  5EBC A;  2RQX A;  2KCN A;  1GUG A;  1SBB B;  1TWF H;  2EOT A;  5JAV A;  3T1Y L;  4Y52 H;  1SDF A;  1VS0 A;  2K4K A;  1N36 L;  1X32 A;  4IPH A;  3NBH A;  3GDE A;  2VB2 X;  2TMP A;  3K0X A;  3ONA B;  4BY1 H;  1RKN A;  1Z47 A;  3VR5 A;  2UUB Q;  1BXT A;  2NVQ B;  1O7Y A;  1ZEQ X;  5IOD A;  3U4Z A;  1KAB A;  3P20 A;  1PH4 A;  1AN8 A;  2CH4 W;  3LX0 A;  5JJI A;  3STB D;  4A3G B;  3G48 A;  1YZ6 A;  1T9H A;  3P75 A;  2KJX A;  3OW7 A;  3H3V I;  4BBS G;  1VDZ A;  3MXU A;  4CJ0 B;  1PDQ A;  2ENB A;  3D3R A;  1EFI D;  3LWU A;  3IL8 A;  4NW2 A;  2HT1 A;  4BXX G;  2F3V A;  4OX9 L;  1ET6 A;  5M3M H;  5IWA L;  3D6C A;  2F4V Q;  2RCN A;  4KY7 A;  1PH8 A;  2MHV A;  3FVQ A;  3HOX H;  4V19 0;  2HCC A;  3PIO 3;  1VQ5 A;  1CA5 A;  2Z0S A;  1HNZ Q;  1A0I A;  3M85 A;  3I90 A;  4A3I B;  2VL6 A;  5KIX A;  4LF6 L;  4K6L A;  3BS1 A;  2EJM A;  1O7L A;  4QIW E;  2E76 C;  2VNU D;  2PYK A;  1II3 A;  1BDO A;  1STY A;  2I07 B;  4A3E H;  2D9U A;  4C1N I;  1YJN A;  1K8G A;  1N9W A;  1TVX A;  1KTK A;  2UXD Q;  4X6A H;  4R4T A;  2OEO A;  2IT1 A;  4FP5 D;  1PTO C;  1X9N A;  1FYC A;  2F0P A;  3HOY B;  1KXL A;  1EY0 A;  4X3K A;  2J7Z A;  1OXT A;  3H0G G;  4A3C H;  3CHB D;  3KDF A;  4B3T Q;  3OMG A;  2R3Z A;  3QWN A;  3N52 A;  1CTM A;  4KK7 A;  4FF1 A;  5DM6 3;  1VQB A;  5M3F H;  2EYJ A;  3GTK H;  3MXN B;  4UAI A;  3AFP A;  1G91 A;  2IHF A;  4DR6 Q;  1PMR A;  3JAM c;  4A3B B;  5IGC A;  5GQO A;  1VQ9 A;  1ET9 A;  3KFU A;  2K14 A;  2NBF A;  1B3A A;  1SLJ A;  1QVG A;  2L11 A;  1LTR D;  3H3V H;  3V96 A;  1FL0 A;  4CJ1 B;  4ILW A;  3CCR A;  3HOW B;  3J7Z C;  4BBR H;  3CCQ A;  4IUT A;  1C9O A;  1PA6 A;  1CKN A;  2E5L Q;  1H9R A;  4S3S A;  5J39 A;  4IPD A;  3A7A B;  1KQS A;  3S1M H;  1ASY A;  3R2I A;  4LUV A;  1YVC A;  5EJW A;  1EY7 A;  3UDF A;  3S2H H;  2HD3 A;  2YU9 H;  1KAW A;  4A3D B;  1D1I A;  2CWA A;  5ELF A;  2BE5 C;  1SYE A;  4BY7 G;  1NY4 A;  1NNX A;  1SSO A;  1SAP A;  3BJU A;  1I4H A;  1EWC A;  3IRB A;  4HIK A;  4KY5 A;  4POF A;  1JOR A;  1PTO F;  4R4C A;  5C4Z A;  2BDN A;  3EN2 A;  2A69 D;  1MHW C;  1BBX C;  3FMC A;  4DNI A;  3S2D B;  1ML0 D;  2RSN A;  1GKH A;  4B9X A;  3S1Q H;  1JB7 A;  2ZXP A;  4YWL A;  5IGF A;  4RHR A;  3MTS A;  1SYC A;  3SXH A;  2D0P A;  2F0F A;  3T56 B;  4JI6 L;  4CKB A;  2QF7 A;  1AE3 A;  5J3B A;  3PV0 A;  4C3I G;  4NPS A;  1PH6 A;  4L5S A;  5C0X J;  2Z6K A;  3WOF A;  3MXN A;  4RGN A;  4P74 A;  2F0G A;  5BN5 A;  4A3K B;  2NYZ D;  1BR9 A;  1F2Z A;  1XTD A;  2R93 H;  1S4Z A;  3HS0 C;  2R7D A;  5DM7 3;  4QUC A;  1B70 B;  2L4N A;  4QGU A;  1X55 A;  3TDQ A;  2CQO A;  3DWA A;  5G3L F;  1F2M A;  1Q8K A;  1PFS A;  1K3R A;  1C4Q A;  3W3A A;  2KHJ A;  3AEV A;  4DUY L;  4X3S A;  5M5X H;  4B3R L;  2EXD A;  3V2T A;  5GAG C;  4O0A A;  3J81 j;  1SMX A;  1I94 L;  2F3I A;  3RNU A;  1IBK L;  1U5K A;  4LMQ D;  4M8A A;  2AUK A;  4EX5 A;  1Y1W G;  2D5D A;  1J5E Q;  3PUV A;  3RLN A;  3GV3 A;  1IW7 C;  2K52 A;  5GAD C;  4MHE A;  1YHA A;  4X3T A;  1A62 A;  3ERQ A;  2O5I C;  3M4O H;  1FJG Q;  2DJG C;  2JA6 B;  1GHK A;  5M5Y H;  2OQK A;  4DK3 C;  2DNE A;  4KI0 A;  4K2L A;  2VY3 A;  2LY7 A;  5D65 A;  1L1O C;  4TKO B;  4A93 B;  1J8I A;  1E2Z A;  1NJI C;  4JW0 A;  2F0T A;  2TSS A;  3VA7 A;  4YHH L;  3HOZ G;  2BH2 A;  3Q8D A;  4DXG A;  2HCI A;  3ITP A;  4RKL A;  1LLR D;  2JYO A;  4K8J A;  4ZUJ A;  1K8A C;  4F88 A;  1UNS A;  3PF5 A;  4C3J B;  5C44 H;  3PSI A;  4NKL A;  1EEI D;  4OO1 I;  1TWF B;  4DV6 Q;  4G4K A;  2NVY H;  4WFN 3;  4WOR A;  1B44 D;  4BY1 B;  3K81 C;  4R8I A;  4JOI A;  1BBW A;  2K5N A;  4NP5 A;  2Y0S G;  4YWM A;  4JI8 Q;  1STA A;  3FDT A;  5CBA E;  2VUM H;  3F2U A;  5DAU A;  4DV2 L;  3Q24 A;  1P8L A;  2EY5 A;  4KD3 A;  3EJI A;  2Z4I A;  1S5D D;  5IT9 L;  1H9K A;  1FD7 D;  1NE3 A;  1WTX A;  1KLG D;  1M1K C;  5I2X A;  3V05 A;  1PRT F;  3HOX B;  1DCZ A;  1JWS D;  2N3S A;  2ID0 A;  1ASZ A;  2CQA A;  1T5X D;  3ZJY C;  1PFN A;  1CT1 D;  1EZ8 A;  2QCP X;  3CU7 A;  4UY8 C;  3J7Y W;  1E7Z A;  2BOS A;  2XGT A;  2K6A A;  4DA2 A;  4BS9 A;  3J81 L;  4IUP A;  4A3E B;  5I4D A;  3I4M B;  4YIJ A;  2R61 A;  2BA1 A;  5M3M G;  4EGV A;  2O5J C;  1BVS A;  4KKT A;  3STB C;  4HJ9 A;  1PZK D;  5I6W A;  1PHJ A;  3CP0 A;  5T1G A;  4CDF C;  3S14 H;  1U4M A;  3NHH A;  3RN2 A;  4IFD G;  2VQE Q;  4A3F B;  1VQ7 A;  3HOV H;  5IT9 E;  4HJA A;  4OO1 H;  4Q0F A;  5M3F B;  2HIV A;  1PZJ D;  3GTK B;  4LFA Q;  1YBY A;  3T53 B;  2KEE A;  2MJ8 A;  1STE A;  5C0X G;  4TSS A;  2DUD A;  3HFZ B;  4DR1 Q;  1Y8O B;  1HNW Q;  1JCK B;  2R7Z B;  3VYT A;  5IGG A;  1PV4 A;  2AQ2 B;  1NUC A;  4KN4 C;  4A3C G;  5DLQ E;  4G7O C;  1G29 1;  1G2S A;  3J81 E;  1N34 Q;  1WTV A;  1UEA B;  1DZ1 A;  5COR A;  3ND8 A;  3KOJ A;  3PCO B;  1VQN A;  4OWX B;  4QCL A;  4BBR B;  3GTQ H;  1L0W A;  2BA0 A;  3IKJ A;  3K0Y A;  2HDM A;  1PTO D;  1Y8P B;  2Z1C A;  4IPC A;  1Q82 C;  1A6X A;  3SR1 A;  1PFM A;  1DXM A;  2ATW A;  3MFY A;  1H9J A;  1LTA D;  1UE1 A;  3S2H B;  1S72 A;  2YU9 B;  1WD1 A;  3KF8 B;  4DR2 Q;  2NN6 G;  2VXW A;  3I70 A;  4A3I H;  4R9W A;  3K5M A;  1GUO A;  4ME5 A;  1E22 A;  4HCS A;  1VQE A;  1F9S A;  4GOP C;  3RUZ A;  1MGS A;  2Q2I A;  4OIJ A;  1B50 A;  1MJC A;  1YNX A;  4JV5 Q;  3S1Q B;  1GVP A;  5CV5 A;  4ZLT F;  2JA7 H;  1HH2 P;  2DJF C;  4DR4 Q;  3IAY A;  1X65 A;  1HUM A;  4OEL B;  2ICE C;  5FLM H;  2WKD A;  1EY9 A;  2QKI C;  2A5H A;  5C4J B;  2Y0S E;  5J22 A;  1K83 H;  3NBI A;  4ZKC B;  1XPR A;  5IE8 A;  1YJW A;  2BE5 D;  5IGB A;  3PIO A;  1QVF A;  1EIF A;  2ZJR A;  2GN5 A;  4HMI A;  1VCI A;  5IT9 c;  4DPG A;  4JI2 L;  5FO8 B;  1I4P A;  3HZX A;  1B9M A;  1LAC A;  1TY0 A;  1K73 C;  5T1I A;  2EY6 A;  2ZXO A;  1XNQ Q;  2V4D A;  2Z8L A;  4KHP Q;  2L0C A;  3GTO H;  4A3J G;  1D5M C;  5IOC A;  1VMC A;  2PCF B;  4DV5 L;  5M5X B;  3GTG H;  3J81 c;  3FPP A;  2WAC A;  2BDO A;  3D6W A;  4B3M L;  2R93 G;  2ZTD A;  1JMC A;  2OTJ A;  1TWA H;  3MHB A;  3ER0 A;  3F8T A;  3CC2 A;  1VF5 C;  4NDX A;  3H6M A;  3KF8 A;  4XDX A;  4LFC L;  1LM0 A;  1A63 A;  1GHJ A;  2WAQ B;  5E4W C;  1WTW A;  3EIV A;  3J80 i;  3I4N G;  3WDN A;  1I4X A;  5M5Y B;  2X69 A;  3T4A C;  2JA5 G;  2MP1 A;  4FO2 A;  1SND A;  1LTL A;  4LUZ A;  4LAA A;  2R92 G;  4RGT A;  1BUV T;  1WTO A;  4IN3 A;  3QJY A;  3M9B A;  3I91 A;  5FLX L;  3L7Z C;  4YY3 L;  1WD0 A;  2E74 C;  2EYF A;  2PO4 A;  1Q1E A;  3EBE A;  2B8F A;  3G4S A;  2F0E A;  2X6L A;  1HR0 L;  1HUN A;  1Y1V H;  3CCJ A;  2LXJ A;  2K7V A;  1CKM A;  1WTR A;  1V1Q A;  4HIO A;  1QZH A;  1TXY A;  2K03 A;  2A19 A;  5LMN L;  2J4X A;  4OXP A;  2PQA A;  2Q8R E;  1G6Z A;  2UUB L;  2IX1 A;  3K7A H;  1IBM Q;  2NVY B;  3TS0 A;  2IW3 A;  2KOL A;  1S3O A;  2AMC B;  4HAE A;  4N8F A;  1WTP A;  1ONL A;  3DWQ A;  4P72 A;  2VUM B;  5FOB B;  5C44 G;  4HJ5 A;  2B2Y C;  5IIF A;  1X3P A;  4DV4 Q;  1HQM C;  2B39 A;  1CHQ D;  3OYY A;  1ESR A;  5FLX E;  2A74 C;  1U4L A;  1HNZ L;  4KN7 C;  2F1M A;  5IYB H;  4KTA A;  1IKL A;  5IYC H; 
#chains in the Genus database with same CATH homology
 4LK1 C;  2KED A;  4KHV A;  2F03 A;  1QIL A;  1SNC A;  5CV4 A;  3RLF A;  2YYZ A;  4DF7 A;  1QCB D;  5HUR A;  1I6H B;  1SNO A;  2PMZ B;  1UAP A;  3M7G A;  1Y8N B;  3X3M A;  1EWH A;  2M00 A;  3SE0 A;  5CV9 A;  3S14 B;  1EYA A;  3VYS A;  3TP8 A;  3R2T A;  3HOV B;  4OL7 A;  5CV7 A;  4XXE A;  4RHS A;  2IX3 A;  1ILP A;  5KGU A;  1JOQ A;  2AWN A;  4F8M A;  5KYL A;  1TS5 A;  4XQQ A;  1S5F D;  4QUF A;  2JXM B;  3HP3 A;  2H4O A;  4E6I A;  2F0O A;  4EQO A;  3K57 A;  5ISR A;  3GTQ B;  1JE4 A;  1QNU A;  3QB3 A;  3TZU A;  2F0D A;  5A2Q E;  1PRT B;  5ELB A;  1EQT A;  3Q22 A;  4I65 A;  1WCM B;  2L12 A;  1UUP A;  4MIU A;  2FJ2 A;  1NCV A;  2JP1 A;  4RGM A;  2KVM A;  1VF7 A;  2ZT9 C;  4XQJ A;  3A8K E;  3MA2 B;  1FGB D;  2HQE A;  4K5W A;  1QOH A;  3LNN A;  3I8Z A;  1ICW A;  4N9P A;  1DM0 B;  2H1E A;  1B53 A;  5KYI A;  1CHP D;  5I9P A;  4P2C B;  3QIA A;  5FO9 B;  3KLS X;  4C56 C;  5CBE E;  3VR4 A;  3GV6 A;  2JA7 B;  1QWY A;  1DYQ A;  5JEA J;  2EE1 A;  1K83 B;  1R4P B;  3TP6 A;  1KDA A;  2XNA C;  1CQV A;  5COY A;  5CV6 A;  2CHB D;  1BQQ T;  4DGZ A;  1CZW A;  5KRU A;  4LJZ C;  2A6H D;  4O42 A;  5KNC A;  1CZG A;  2N88 A;  4FF4 A;  1HA5 A;  3ERO A;  2I46 A;  1SE3 A;  1U4R A;  3EA6 A;  1D2B A;  3GTO B;  3BYY B;  3KLR A;  4DAP A;  4RCO A;  1KLU D;  1EY6 A;  1PFB A;  4MN3 A;  4KV6 A;  3GTG B;  2AQ1 B;  1A3U A;  1MD2 D;  1U9R A;  2B2V C;  4FF2 A;  1ESF A;  4XT1 B;  3BDL A;  1D1K A;  4KKU A;  4F7X A;  2RDF A;  1TWA B;  1TR5 A;  2IJ0 A;  1F2L A;  1EIG A;  2SOB A;  1SNQ A;  3T13 A;  3OSO A;  1IHZ A;  2SNS A;  1EU3 A;  5IGE A;  3S9W A;  4FF3 A;  2NUC A;  2K32 A;  5CC4 A;  1TQO A;  4U68 A;  5EPJ A;  5M9O A;  1SE2 A;  4IFD J;  2E2D C;  1HCZ A;  3D31 A;  1DOK A;  1Y1V B;  1HFG A;  2RKS A;  3DM1 A;  2MPM A;  2B2W C;  3K7A B;  2AQ3 B;  1GOZ A;  4ABN A;  1LT5 D;  2Q8T A;  3I72 A;  1W6K A;  2K01 A;  1Y69 U;  2NB0 A;  1JIC A;  1LTG D;  4DN4 M;  4QB4 A;  1EYC A;  3NTI A;  1BCP C;  4DFA A;  4IUU A;  5LHY 1;  4RA8 A;  4BA1 I;  1E2W A;  4L6T B;  4RH6 A;  3OIQ A;  2EYP A;  1WVL A;  1PTO H;  3MVV A;  1STB A;  5C5L A;  4DK1 A;  2E75 C;  1GUN A;  2BCO A;  5IGD A;  3I4L A;  2MGS A;  1V1O A;  1AP0 A;  1SMY C;  3IFD A;  3I73 A;  3HOU B;  4Y7N B;  4FXG C;  4DAV A;  5K36 H;  4J6H A;  1PZI D;  3KBG A;  1DON A;  3DEP A;  4CHT B;  3ZYY X;  1SE4 A;  2FMM A;  1RD9 D;  1X3Q A;  1OXX K;  1PYW D;  4TRD A;  5JEA G;  3BVZ A;  2FHT A;  3GP7 A;  1RJT A;  2QEJ C;  2VB3 X;  1YNN C;  1A2T A;  1TS2 A;  3GQB A;  4HMJ A;  2A6E C;  5JJZ A;  2A68 C;  4DAY A;  2LFN A;  2IWH A;  2F0J A;  2CW0 C;  3PO2 B;  1Q3L A;  4V0B A;  4C3J G;  1F9Q A;  5JOB A;  1R9T B;  3NWS A;  2FFK B;  1SJH D;  2KHS A;  1NR2 A;  5ELC A;  1B9N A;  3C3L A;  2K1B A;  1MSG A;  2WII B;  3MWY W;  2OF1 A;  3R8B A;  2F4I A;  3J7A V;  4HCE A;  4GZY C;  5C3E B;  4C3H B;  1JWU D;  1GXD C;  1SFO B;  1XWE A;  2ZXR A;  1LT4 D;  5A35 A;  1HFN A;  3PIP 3;  1V8Q A;  4B9W A;  1K8M A;  3VR6 A;  4ZUI A;  2AWO A;  4IQZ A;  5EQ0 A;  1Q8I A;  2OXP A;  3HKZ B;  4F87 A;  3RZO B;  1Z7T A;  3NTK A;  4DNR B;  3K5L A;  1JOK A;  1MBY A;  3QG1 A;  3BDC A;  4AYB B;  1A2U A;  2F0K A;  1D5X C;  3PUW A;  1QJO A;  2R6G A;  1A15 A;  1EY5 A;  4IAL A;  1CI3 M;  2IPK D;  3BVG A;  2DN8 A;  1F9P A;  4KY6 A;  5KEE A;  4A3M B;  4WJW A;  5F2D A;  2JEA I;  1ENA A;  1L0X B;  2B2U C;  1AZQ A;  1NSN S;  4UDU C;  5C4X B;  3H94 A;  2WB1 B;  2JSO A;  1K8O A;  1Z6H A;  1QE6 A;  1EOT A;  3X3N A;  2MUY A;  2A6H C;  3NE5 B;  3DWP A;  3T51 B;  4K6D A;  3QOJ A;  4CJ2 C;  2X6G A;  3OHX C;  1C8C A;  4JBW A;  4HSV A;  2F0L A;  1LTI D;  3MXP A;  3BYT B;  1TY2 A;  3G7L A;  1BOS A;  4PMC A;  1AEX A;  1FNW A;  2K5Q A;  3M3Y B;  3BDO A;  1HA6 A;  1D6E C;  1PLF A;  2B2Y A;  3PUZ A;  1LT6 D;  2B63 B;  1LTT D;  3AB9 A;  1E2V A;  3BZD B;  2B8G A;  4RGO S;  3OWF A;  2EYO A;  4ZRZ A;  3FKI B;  4Q5V A;  5ELE A;  2NZ1 D;  1TII D;  2EJF C;  3NWT A;  1ILQ A;  5D3D A;  3S16 B;  5CYU A;  2FMC A;  3E6Z X;  4CBV A;  1PXU A;  3CKI B;  4H0L C;  3U9S A;  1W6J A;  1PTO B;  4K14 A;  4XYQ A;  5C5M A;  5C3X A;  1IYV A;  1OXU A;  4O1N A;  1MI2 A;  3PUY A;  3VYU A;  5LL6 S;  2L1B A;  2JE6 I;  5I2Y A;  2EYL A;  4QMG A;  5I9O A;  1BCP D;  1A3V A;  3NP8 A;  4DXF A;  2KQ3 A;  2JA8 B;  4L8J A;  2F3W A;  1I3Q B;  3KLS A;  3GTP B;  2EDG A;  4QIW B;  3PO3 B;  3KUP A;  2XVS A;  4J8Q A;  2RVL A;  3TN2 A;  5K36 G;  3MXG A;  4DU9 A;  5M5W B;  1LO5 D;  1SMY D;  5EBD A;  5E1F A;  1V1P B;  4EVO A;  3T16 A;  3TSS A;  4KD4 A;  2NWG A;  2QDB A;  2EPB A;  4J1M A;  1Q12 A;  3C2P A;  4IZ8 A;  4G7H C;  3SK5 A;  1SYD A;  3RD4 A;  3FEW X;  3CRK C;  3D4W A;  1D5Z C;  4KJN A;  1YNN D;  3WOE A;  3GTM B;  2JEB I;  2A6E D;  2E2H B;  4ID6 A;  2A68 D;  1RHP A;  1TWH B;  2XN9 C;  2CW0 D;  3CRL C;  3DEO A;  1FNV A;  3EQL C;  2F0S A;  5NUC A;  1XX8 A;  3H3V C;  2F0I A;  3O13 A;  1CM9 A;  1LT3 D;  4EQN A;  1I4R A;  2PZW A;  5I6Y A;  4XQN A;  2EY1 A;  3SEB A;  5JPN C;  4IFD I;  1B2T A;  2J0T D;  2WIN B;  1SNP A;  4DK0 A;  2B2V A;  3DXJ C;  1SYB A;  3TME A;  4R8N A;  5JVG 3;  1TS4 A;  3AMU A;  3MZ5 A;  5E3F A;  1I4G A;  2WKC A;  4OO1 G;  2Z4H A;  1HXY D;  3SK6 A;  1QNK A;  2PZU A;  4HED A;  5C0X I;  1AFP A;  5BN3 A;  1V1P A;  2GA4 B;  1I4Q A;  3BG3 A;  4BBS B;  2KEC A;  4HR7 B;  1CQF A;  2OT2 A;  1HTL D;  3HRZ C;  3A54 A;  3I3C A;  3TBI B;  5E4X A;  3SK4 A;  5C6A A;  2A73 B;  1H9M A;  1XYI A;  1RDP D;  2F0V A;  3EVQ A;  1JOO A;  2NN6 I;  5DEH A;  5C3W A;  1DOL A;  1STN A;  5CR3 A;  2B2W A;  3SK8 A;  2O4X A;  5D14 A;  1GJX A;  1FNU A;  3J7A F;  1BNZ A;  2DY7 A;  5KNB A;  1ZYR C;  5EPL A;  4IFD H;  3VA5 A;  3H0G B;  3NK9 A;  1ZKO A;  2EXZ A;  2EY2 A;  1XXG A;  4FXK C;  3OOC A;  5EKK A;  3S15 B;  5AFW A;  5C0X H;  1J9O A;  1VMP A;  3SHL A;  3UI2 A;  1B4O A;  3MEH A;  3PMF A;  2B2T C;  3QO2 A;  4PV1 C;  3Q6S A;  2M2L A;  3KBX A;  1AW7 A;  3HEJ A;  1DJR D;  1F2Y A;  1M8A A;  5ELD A;  1EU4 A;  2PW5 A;  5DNF A;  2C5C A;  1SNM A;  4IUN A;  4K2K A;  1CA6 A;  4BY7 B;  2NN6 H;  2K5D A;  3DUZ A;  3W2D A;  3N6R A;  3P1H A;  1OO9 B;  5CMD A;  2F0N A;  1QB5 D;  3SDZ A;  1LTS D;  1RTN A;  1EEF D;  3S1R B;  4KKS A;  5FKA C;  2NVT B;  1BO0 A;  1B1Z A;  4C3I B;  4NMZ A;  1F9R A;  2L9H A;  1TWC B;  3K5O A;  4OHJ A;  1KNA A;  4RCN A;  4ZKB B;  4ZK9 B;  5JPM C;  3NSW A;  3RZD B;  1SXT A;  4H13 C;  5KND A;  3K5N A;  1JR0 D;  1RF2 D;  5J1Z A;  2G9D A;  2L5T A;  4C1N K;  1LAB A;  3NQI A;  1XTC D;  2C9O A;  1JQY D;  2K05 A;  2RBM A;  1EYD A;  1Y1W B;  1L0Y B;  4K8I A;  2DNC A;  4PQX A;  3J80 L;  4KJO A;  2F0U A;  1DOM A;  2E2I B;  3Q0A A;  4RWS C;  1LV9 A;  4K5X A;  5CGK A;  4ZYS A;  2KA7 A;  1U4P A;  2EZV A;  4G7Z C;  3HOZ B;  3P7J A;  5TSS A;  3OMC A;  1PRT C;  1MSH A;  1STG A;  3G6J B;  4U67 3;  4XT3 B;  4RKB A;  1S5E D;  4H44 C;  3R93 A;  3RMH A;  1T5E A;  5HGT A;  5JVH 3;  1S5C D;  1BCP F;  2B2U A;  3D4R A;  1WTQ A;  1HHV A;  1GUT A;  2XRS D;  3GTJ B;  3U9O A;  3A7L A;  3GTL B;  2RDG A;  2KUM A;  3J80 E;  2Y0S B;  3C1F A;  2AUJ D;  4RAU C;  3NPP A;  1EIH A;  3CQZ B;  5EKL A;  3E5S A;  3VYR A;  4XIG S;  3S17 B;  1H9S B;  1STH A;  1YNJ C;  1C48 A;  4ODG A;  2ICI A;  3L9A X;  3A56 A;  5EGT A;  1I6V C;  3OPO A;  3URY A;  1TT2 A;  1NR4 A;  1EL0 A;  3BVM A;  5FK9 C;  2LKV A;  1QG7 A;  5M3M B;  2QIL A;  1KNE A;  3VR3 A;  4JK1 C;  1TS3 A;  4C3H G;  4BWG B;  4IUR A;  2RA4 A;  4DNT B;  1IL8 A;  1TKW B;  2RDH A;  2NVX B;  4HN7 A;  2EYH A;  3IFT A;  4XTC S;  2K28 A;  1SYG A;  4IUQ A;  4BA2 I;  3PUX A;  4QF4 A;  1CFM A;  1GUW A;  1V43 A;  3L3O C;  1HTP A;  3DHQ A;  1GUS A;  1KAA A;  2EVB A;  2EJG C;  1ZYR D;  3VR2 A;  3M7N A;  2D2C C;  1SJE D;  5LL6 X;  2Q8I B;  1FR3 A;  2K04 A;  1H9S A;  4ZQ3 A;  3C46 A;  3A8I E;  1A3T A;  2XWB B;  4H7B A;  1KDB A;  3OWE B;  1HRJ A;  2XWJ B;  3S1M B;  3OIP A;  1LTB D;  1IKM A;  1RTO A;  3AU7 A;  5EKI A;  2PNR C;  2HDL A;  4FXD A;  2KCC A;  5EPK A;  1R4Q B;  3EFX D;  4OGQ C;  1SEB D;  1HPC A;  3K6O A;  3D4D A;  3H91 A;  3H09 A;  3LWE A;  2CVR A;  2XIW A;  1SYF A;  3A8J E;  2PQE A;  3HGB A;  3S1N B;  3NUC A;  2L55 A;  2O2L D;  1G2T A;  1JWM D;  2D62 A;  2M9V A;  1ENC A;  4PMB A;  1TU2 B;  1O80 A;  5G3L D;  1I50 B;  3R3O A;  5CV8 A;  3MC0 B;  1EZ6 A;  4A3J B;  4FNF A;  2WV6 D;  4N9T A;  3E0J A;  3ND9 A;  2F0W A;  3A55 A;  2EYM A;  3K58 A;  3TZD A;  4I7Z C;  3FRP B;  4CKE A;  1ZXT A;  2A69 C;  3FPU B;  4FVM A;  2R93 B;  4C2M B;  3MAQ A;  1M4V A;  2DY8 A;  2WP8 J;  1EY8 A;  3M4Y A;  2XSC A;  2XRQ D;  2PPB C;  2SEB D;  1EY4 A;  1JC7 A;  3I4N B;  2PZT A;  2SNM A;  2LS0 1;  2JA5 B;  2K33 A;  4PNY A;  2FIN B;  3NTH A;  3GO5 A;  1F77 A;  2R92 B;  1KDC A;  1JB3 A;  3C1E A;  1G8Z D;  5K5P A;  2K5W A;  3K59 A;  4IUV A;  1OXS C;  3M4O B;  4ULL A;  1S5B D;  2G9H D;  4WRD A;  2E2J B;  4EQP A;  4ZAI A;  1AZP A;  3DMU A;  1NAP A;  2SDF A;  3QOL A;  4M1U B;  4B08 A;  2F0M A;  4HTH A;  4L63 B;  5C44 B;  3Q23 A;  2F0H A;  1IW7 D;  3NQT A;  4G57 A;  1IYU A;  1CK1 A;  3GD7 A;  5C4H A;  2IX0 A;  5BN4 A;  1PRT D;  1ENF A;  1E0B A;  4KHZ A;  1O78 A;  4KMU C;  4X3U A;  4HSP A;  1Q90 A;  1ROD A;  4Z9C B;  3JAM L;  1BF4 A;  3HG9 A;  1OXV A;  4XYO A;  1Q1B A;  4OIK A;  1HQR D;  2IL8 A;  3TP5 A;  1O7Z A;  4FYD A;  4CGY B;  3TP7 A;  1DD2 A;  2NTS A;  2B2T A;  4K5V A;  2LMC B;  4RFB A;  2F0Q A;  1YNJ D;  3NXW A;  5D3I B;  1RCV D;  1BCP B;  4PMW A;  2NTT A;  5JEA H;  2RSO A;  2PW7 A;  5A2Q L;  3D8G A;  3MFG A;  1TWG B;  3SVM A;  3JAM E;  2N55 A;  5FO7 B;  4CKC A;  4TQU S;  1EQV A;  2HUG A;  3KK7 A;  5EBC A;  2RQX A;  2KCN A;  1GUG A;  1SBB B;  2EOT A;  5JAV A;  1SDF A;  1X32 A;  3NBH A;  2VB2 X;  2TMP A;  3ONA B;  1RKN A;  1Z47 A;  3VR5 A;  1BXT A;  2NVQ B;  1O7Y A;  1ZEQ X;  5IOD A;  1KAB A;  3P20 A;  1AN8 A;  3LX0 A;  4A3G B;  3P75 A;  2KJX A;  3OW7 A;  1VDZ A;  4CJ0 B;  3MXU A;  1PDQ A;  2ENB A;  3D3R A;  1EFI D;  3LWU A;  3IL8 A;  4NW2 A;  2F3V A;  1ET6 A;  3D6C A;  4KY7 A;  2MHV A;  3FVQ A;  4V19 0;  2HCC A;  3PIO 3;  1CA5 A;  3M85 A;  3I90 A;  4A3I B;  5KIX A;  4K6L A;  3BS1 A;  2EJM A;  1O7L A;  2E76 C;  2VNU D;  2PYK A;  1II3 A;  1BDO A;  1STY A;  2I07 B;  2D9U A;  4C1N I;  1TVX A;  1KTK A;  2OEO A;  2IT1 A;  4FP5 D;  1PTO C;  1FYC A;  2F0P A;  3HOY B;  1EY0 A;  4X3K A;  2J7Z A;  1OXT A;  3CHB D;  3OMG A;  2R3Z A;  3QWN A;  3N52 A;  1CTM A;  4KK7 A;  4FF1 A;  5DM6 3;  2EYJ A;  4UAI A;  1G91 A;  1PMR A;  5IGC A;  1ET9 A;  2NBF A;  1B3A A;  2L11 A;  1LTR D;  3V96 A;  4CJ1 B;  4ILW A;  3HOW B;  4IUT A;  1H9R A;  4S3S A;  5J39 A;  3A7A B;  3R2I A;  5EJW A;  1EY7 A;  4A3D B;  1D1I A;  5ELF A;  2BE5 C;  1SYE A;  1SSO A;  1SAP A;  1I4H A;  1EWC A;  4KY5 A;  1JOR A;  1PTO F;  5C4Z A;  2BDN A;  2A69 D;  1BBX C;  3FMC A;  3S2D B;  1ML0 D;  2RSN A;  4B9X A;  2ZXP A;  5IGF A;  4RHR A;  3MTS A;  1SYC A;  3SXH A;  2F0F A;  3T56 B;  4CKB A;  2QF7 A;  3PV0 A;  4C3I G;  5C0X J;  3WOF A;  3MXN A;  4RGN A;  2F0G A;  5BN5 A;  4A3K B;  2NYZ D;  1BR9 A;  1F2Z A;  1S4Z A;  3HS0 C;  5DM7 3;  4QUC A;  2L4N A;  3TDQ A;  3DWA A;  5G3L F;  1F2M A;  1C4Q A;  3W3A A;  4X3S A;  3V2T A;  4LMQ D;  4M8A A;  2AUK A;  2D5D A;  3PUV A;  3GV3 A;  1IW7 C;  4MHE A;  4X3T A;  3ERQ A;  2O5I C;  2JA6 B;  1GHK A;  2DNE A;  4KI0 A;  4K2L A;  2LY7 A;  5D65 A;  4TKO B;  4A93 B;  1J8I A;  1E2Z A;  2F0T A;  2TSS A;  3VA7 A;  4DXG A;  2HCI A;  4RKL A;  3ITP A;  1LLR D;  2JYO A;  4K8J A;  4ZUJ A;  4F88 A;  1UNS A;  4C3J B;  4NKL A;  1EEI D;  4OO1 I;  1TWF B;  4G4K A;  4WFN 3;  4WOR A;  1B44 D;  4BY1 B;  4R8I A;  4NP5 A;  5CBA E;  1STA A;  3FDT A;  3F2U A;  5DAU A;  3Q24 A;  2EY5 A;  4KD3 A;  3EJI A;  2Z4I A;  1S5D D;  5IT9 L;  1H9K A;  1FD7 D;  1WTX A;  1KLG D;  5I2X A;  3V05 A;  1PRT F;  3HOX B;  1DCZ A;  1JWS D;  2ID0 A;  2CQA A;  1T5X D;  1PFN A;  1CT1 D;  1EZ8 A;  2QCP X;  3CU7 A;  3J7Y W;  2BOS A;  2K6A A;  4DA2 A;  4BS9 A;  3J81 L;  4IUP A;  4A3E B;  5I4D A;  3I4M B;  4YIJ A;  2R61 A;  2BA1 A;  2O5J C;  4EGV A;  4KKT A;  1PZK D;  5I6W A;  5T1G A;  1U4M A;  3NHH A;  4IFD G;  4A3F B;  5IT9 E;  4OO1 H;  4Q0F A;  5M3F B;  1PZJ D;  3GTK B;  3T53 B;  2KEE A;  2MJ8 A;  1STE A;  5C0X G;  4TSS A;  2R7Z B;  1Y8O B;  1JCK B;  3VYT A;  5IGG A;  2AQ2 B;  1NUC A;  4KN4 C;  4G7O C;  1G29 1;  1G2S A;  3J81 E;  1WTV A;  1UEA B;  1DZ1 A;  5COR A;  3ND8 A;  4QCL A;  4BBR B;  2BA0 A;  3IKJ A;  3K0Y A;  2HDM A;  1PTO D;  1Y8P B;  2Z1C A;  1A6X A;  3SR1 A;  1PFM A;  1DXM A;  3MFY A;  1H9J A;  1LTA D;  3S2H B;  2YU9 B;  1WD1 A;  2NN6 G;  2VXW A;  3I70 A;  4R9W A;  3K5M A;  1GUO A;  4ME5 A;  4HCS A;  1F9S A;  3RUZ A;  1MGS A;  4OIJ A;  1B50 A;  3S1Q B;  5CV5 A;  4ZLT F;  3IAY A;  1HUM A;  2ICE C;  2WKD A;  1EY9 A;  2QKI C;  2A5H A;  5C4J B;  5J22 A;  3NBI A;  4ZKC B;  2BE5 D;  5IGB A;  4HMI A;  1VCI A;  5FO8 B;  1I4P A;  3HZX A;  1B9M A;  1LAC A;  1TY0 A;  5T1I A;  2EY6 A;  2ZXO A;  2V4D A;  2Z8L A;  2L0C A;  1D5M C;  5IOC A;  1VMC A;  2PCF B;  5M5X B;  2WAC A;  3FPP A;  2BDO A;  3D6W A;  3MHB A;  1VF5 C;  4NDX A;  3H6M A;  3KF8 A;  4XDX A;  1GHJ A;  2WAQ B;  5E4W C;  1WTW A;  3WDN A;  1I4X A;  5M5Y B;  2X69 A;  3T4A C;  2MP1 A;  4FO2 A;  1SND A;  4LAA A;  4RGT A;  1BUV T;  1WTO A;  4IN3 A;  3QJY A;  3I91 A;  5FLX L;  3L7Z C;  1WD0 A;  2E74 C;  2EYF A;  2PO4 A;  1Q1E A;  2B8F A;  2F0E A;  2X6L A;  1HUN A;  2K7V A;  1WTR A;  2K03 A;  2J4X A;  2Q8R E;  1G6Z A;  2IX1 A;  2NVY B;  2IW3 A;  2KOL A;  4HAE A;  1WTP A;  1ONL A;  3DWQ A;  2VUM B;  5FOB B;  2B2Y C;  5IIF A;  1X3P A;  1HQM C;  2B39 A;  1CHQ D;  1ESR A;  5FLX E;  2A74 C;  1U4L A;  4KN7 C;  2F1M A;  4KTA A;  1IKL A;  4A3B B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...