1BF4A

Chromosomal dna-binding protein sso7d/d(gcgaacgc) complex
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
63
structure length
63
Chain Sequence
ATVKFKYKGEEKEVDISKIKKVWRVGKMISFTYDEGGGKTGRGAVSEKDAPKELLQMLEKQKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of the hyperthermophile chromosomal protein Sso7d bound to DNA.
pubmed doi rcsb
source organism Sulfolobus acidocaldarius
molecule tags Dna-binding protein/dna
molecule keywords DNA (5'-D(*GP*CP*GP*TP*5IUP*CP*GP*C)-3')
total genus 11
structure length 63
sequence length 63
ec nomenclature
pdb deposition date 1998-05-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1bf4A00
1F9QA 1ILPA 1ILQA 1C8CA 1G91A 1MSGA 2NYZD 4XDXA 1PFBA 1JICA 1WD0A 1LV9A 1DOMA 1DONA 1M8AA 1O80A 1F9RA 2X69A 2XIWA 5E4WC 4ZKCB 3IL8A 2EOTA 2JP1A 1RTOA 4MHEA 1DOLA 1MGSA 2L12A 4ZK9B 1WVLA 1B3AA 2K04A 4R9WA 1EL0A 1J8IA 2B2UA 2B2VA 1IKMA 1NCVA 2KOLA 3MTSA 4OIKA 1X32A 1O7YA 2B2YC 2HCCA 2K01A 5EPJA 1E0BA 4CJ0B 4R8IA 3FDTA 2EPBA 2L1BA 1ZXTA 4HEDA 4CJ1B 1F9PA 1U4PA 2L4NA 5DNFA 1HRJA 1BBXC 1CA5A 1AP0A 1QG7A 3D6WA 2M2LA 1HUMA 1SDFA 2KUMA 1GUWA 5EPKA 1IL8A 1RTNA 1B4OA 1U4MA 1NAPA 1RJTA 4ZAIA 2B2WA 5EPLA 5CBAE 1NR4A 1PFMA 1JE4A 1DOKA 2BDNA 2KEEA 1PDQA 3GV6A 4X3UA 3N52A 1VMPA 2B2TC 2X6GA 3FPUB 4ZLTF 1WTXA 2K05A 2MPMA 1G6ZA 2L9HA 1TVXA 4CJ2C 1HFGA 5EJWA 5EQ0A 2KECA 1WTQA 2B2YA 5AFWA 2MP1A 4IUVA 4RA8A 5D14A 3QO2A 1ML0D 1PFNA 2DY7A 4MN3A 4NW2A 1HUNA 1CA6A 4XT3B 3LWEA 4QUFA 1AZQA 2Q8RE 1QE6A 2X6LA 3Q6SA 4HSVA 1HA6A 2B2UC 4HAEA 1SSOA 2RSNA 2CVRA 2IL8A 2D9UA 1EIGA 1CM9A 1MSHA 2FINB 1G2TA 4IUPA 1HFNA 5CORA 4IUQA 1DZ1A 2JYOA 1AZPA 1BNZA 1WTPA 1B50A 2B2WC 1EQTA 1PLFA 2N88A 1KNEA 5T1GA 1WTOA 3P7JA 1IKLA 4IUUA 1XX8A 3I3CA 2R3ZA 2HDMA 3DM1A 1B53A 1QNKA 1Q3LA 2KEDA 1G2SA 3MWYW 5JJZA 3GV3A 4U68A 1NR2A 1WTRA 5T1IA 2SDFA 1J9OA 2HUGA 4QUCA 2RSOA 2EE1A 4X3SA 3KUPA 2DY8A 1O7ZA 1RHPA 5EKIA 2NWGA 4UAIA 4DN4M 1X3PA 3H91A 1XYIA 1X3QA 2B2VC 1WTVA 3I90A 2J7ZA 3ONAB 1EIHA 2MGSA 2RVLA 2L11A 2FMMA 1ESRA 3KBXA 4ZKBB 4X3TA 1F2LA 1U4RA 3DEPA 3HP3A 4X3KA 5COYA 2K1BA 2MJ8A 3I8ZA 1WD1A 3UI2A 1ICWA 5CBEE 4IURA 1KNAA 3I91A 3TZDA 4RWSC 2H1EA 3F2UA 4RAUC 2FJ2A 2K03A 4IUTA 4XT1B 5E4XA 5CMDA 1SAPA 1A15A 2FHTA 4LMQD 4OIJA 2Q8TA 2B2TA 4O42A 1BF4A 1BO0A 3TN2A 3DEOA 2KVMA 1U4LA 2FFKB 2VXWA 1VMCA 2HDLA 5D65A 1B2TA 1EOTA 2K28A 4HCSA 1F9SA 2N55A 1WTWA 3G7LA 2HCIA 3SVMA 2RA4A 1HHVA 3R93A 2NZ1D 1S4ZA 1RODA 1MI2A 3IFDA
chains in the Genus database with same CATH superfamily
4PNYA 1V1PB 2QCPX 3HOUG 3KLSA 3J80E 1YNXA 2XWBB 4DU9A 1O80A 2RF4A 4RGTA 4JI8Q 4LF5Q 1VQPA 2NTTA 1IYUA 4B3SQ 4L5TA 4E6IA 4EQNA 1UE7A 3UE1A 1QZHA 1A3UA 1ZXTA 2F0UA 2ZJPA 3HEJA 4A3LG 2KJXA 1IBMQ 2PO4A 1K8MA 2AHOB 1JOKA 5FLXL 2PW5A 4B08A 3K81C 4K2KA 2PZWA 4CJ2C 1QILA 1Q8KA 3T56B 3GTOH 2B2YA 1SRUA 4ZRZA 5A2QL 3MXPA 1XNQL 5M3FH 4NW2A 3S1RH 4U673 4Q5VA 1SEBD 2X6LA 5FKAC 2F0EA 2Z6KC 3BG3A 4JBJA 1WCMB 3MXNA 4IUQA 2JYOA 1NTGA 1I50H 4WORA 2PMZE 1IHZA 1GHJA 5C3EG 1KD1C 5DM63 1VQEA 1IKLA 2K5WA 1CQFA 2KEDA 1I6VC 1LTGD 2IPKD 4A93H 1G51A 4DR1L 3U50C 1VQ9A 4UHVA 2RSOA 3I4NH 4OO1H 1NY4A 4QF4A 5JEAJ 4K6LA 1ZKOA 4K0KL 4RCOA 2NWGA 1TY2A 2IX3A 3KBXA 4H0LC 4XQQA 3HP3A 1UE6A 2K1BA 4DUZQ 1VCIA 5FLXc 1I4HA 1Y8NB 2FJ2A 4RH6A 4K5WA 1RF2D 3I4NB 5BN3A 3M4OB 1LACA 1X3FA 2CFMA 2B2TA 4OO1I 2CW0D 1STEA 1D2BA 1ASYA 2EYMA 5GAGC 5C0XG 2R92B 1PYBA 2HHHQ 5M5YH 2F0VA 1VQLA 4WJ4A 5C4XG 2A5HA 1PV4A 1OXSC 3EFXD 1FNVA 2F0JA 2KCCA 4C56C 4IQZA 1TWGH 4A3KG 4A3EG 1H95A 1IBML 1ET6A 4I7AA 5M5YB 1EZ8A 4A3FG 4DR7Q 1O7YA 1A2TA 4G7HC 3S14H 2EQSA 3I70A 1PRTC 2K5NA 4JYAQ 1ASZA 3HZXA 4LWCA 3W3AA 3RD4A 4DV1L 4BS9A 2G5DA 1XMOQ 3CCUA 1WFQA 1AH9A 3TSSA 1PH7A 2TMPA 1EWCA 1EYGA 2PI2E 1HA5A 3J81L 1RCVD 1LTID 3A7LA 1XNRQ 4LF6L 1TU2B 1ML0D 1HUNA 1EY6A 4WRDA 3L0OA 1JE5A 2BE5D 1YITA 1H9RA 4JI4L 1CKOA 3S15B 2RSNA 2IL8A 4DK6C 5GAHC 1EFWA 2LSSA 5FO8B 3TQYA 2XRSD 2NUCA 1XMQL 4IFDH 1IW7D 1L1OA 3MHBA 4MZ9A 3S1RB 1XX8A 3NENA 2D62A 1B53A 2EYLA 5KRUA 4IJHA 3VA7A 1S5DD 5EGTA 4CKCA 3S24A 5M3FB 2OWOA 1XXGA 4GKJL 1KXLA 2JK8A 1O7LA 1BKBA 2J7ZA 3STBC 1OO9B 1N34Q 1ESRA 1T5XD 4YCUA 1D1KA 3M3YB 2NBFA 5COYA 2NVTH 3QOLA 3UI2A 3PUZA 3HOZH 3KLRA 2AQ2B 2F0NA 4IUTA 2F0GA 4DV1Q 1XMOL 1RDPD 4OIJA 2EYFA 1V1OA 1EQVA 2QGQA 3TN2A 2UU9L 3HOWG 5D65A 5I4DA 4HCSA 2K28A 3MA2B 4OX9L 3DHQA 1GKHA 3NTKA 3OWFA 2ZJRA 5AJ3L 1XWEA 2YU9H 2PCFB 5IE8A 1TXYA 2LKVA 2LXJA 1SJED 4JI3Q 1M8AA 5J1ZA 2F3WA 1IYJB 1LTRD 1DM0B 1JCKB 2JEBI 3CQZB 1E7ZA 3MTSA 3CCLA 4HIKA 4AYBG 4BA1I 3T16A 2F52A 2WAQG 5LMNW 4A3LH 1JWMD 3EVQA 3KOJA 4DR6L 2NVQH 4F8MA 5FJ8H 1CK1A 1WCMH 5ISRA 2AQ3B 3BVGA 3CCJA 4KKUA 1JE4A 3PO3G 2ZTEA 5C3WA 3H0GB 3W2DA 2GVAA 1CTMA 2B2TC 2JA8G 3QR8A 1Y1WG 2KECA 1C9OA 2F0IA 5D14A 3QG1A 4L5RC 3KF8A 4DKAC 3VR6A 1FJGL 2EJFC 3NXWA 4B3ML 2CQAA 4R8NA 2EDGA 4ILWA 3ULPA 2EYOA 3FVQA 3PUYA 4KKTA 4GLXA 5KGUA 2ZT9C 1MBYA 3CAMA 2NTSA 2K33A 1PRTF 5IGBA 1EWIA 2L15A 5T1GA 4IUUA 4RHSA 3V2TA 4L8JA 2G9DA 2HDMA 5IWAL 3FPPA 3KDFB 4QY7A 1D5ZC 1JWSD 2BA0A 3A8JE 5ELBA 2R7ZB 1EU3A 1EIFA 3NWTA 1Q82C 3CP0A 4R4CA 3IRBA 2F4VQ 5M3FG 2E2JB 1QNUA 1PH4A 1EIHA 3E9HA 5JAVA 1S5ED 4DV6L 4ZKBB 2UXCL 3GTPB 2D5DA 4LUZA 2NN6I 1WYDA 2BCOA 1PTOF 2OCEA 5BN4A 3S1QH 5IYDG 2ZM6Q 3GTJH 1BF4A 1PMRA 3S14B 2N55A 1WTWA 1VF5C 1IZ6A 3J81E 3H15A 1C4QA 4APVA 1Q1BA 1TWFB 3FRPB 4M8AA 4TQUS 4A3DG 2ZXOA 1ILPA 4JI1Q 4LFBL 4IOAA 2F4IA 4XDXA 1SMYD 2PNRC 4UPAA 5HGTA 2EYPA 4DR6Q 4BY7G 2IHEA 1BCPB 3Q22A 2NVXB 4Q0FA 3TREA 1IBKL 2A6HC 2F0TA 3K8AA 1TWFH 1UWVA 1L1OB 3DWPA 4R8IA 2EPBA 1F77A 3OIQA 1LUZA 2ZTDA 4CJ1B 1PH1A 5DNFA 3GTOB 1CT1D 4H13C 4GZYC 2CWPA 1NNXA 3EIVA 4PMWA 1IL8A 5FLMH 4A75A 2IX0A 1K0RA 2H4OA 5M3MG 1D8LA 2L9HA 4CDDC 3IKJA 4JI2Q 4AH6A 2PQEA 3PUWA 2EJGC 3QO2A 1PFNA 3KFUA 1FR3A 3SXHA 1E2ZA 2VQFL 4A93B 3BYTB 5KIXA 2A19A 4DR5Q 1PZKD 4C3JB 1MIUA 4QL5A 1EQTA 4LFAQ 1IW7C 3SK8A 3GO5A 4A3JG 4GOPC 3KF6A 5CYUA 4JK1C 3V05A 2K14A 5C4HA 3KUPA 1TWAB 2KHSA 2VQFQ 3BZKA 2XVSA 5C6AA 1YZ6A 4YWKA 1KAWA 4CDEC 2A8VA 1MJCA 1FJGQ 3T1HQ 2RDHA 3SK4A 2XGTA 1STGA 1K73C 3I91A 4FYDA 1TY0A 2E2DC 2JA6G 2FHTA 5CV9A 3GTQB 1U4LA 4HIDA 3E0JA 3RZOH 1ZYRD 3GQBA 2MFIA 1HHVA 1SN8A 2NZ1D 4LUVA 4Y7NH 1QB5D 1Y1WH 4EVOA 1B7YB 3PUXA 3VYRA 5IOCA 5LMNQ 4DV7L 1GUTA 1LT4D 2Z8LA 1C8CA 1VDZA 3IAYA 2Q2UA 3T51B 4DV7Q 1SFOH 2RCFA 5D3DA 3C46A 4HCEA 4PV1C 3GTQH 4A3CH 4JYAL 1VQGA 3P1HA 1VQ5A 1RTOA 3U4VA 2R92H 3R8BA 3K6OA 2YYZA 4DR7L 3KLSX 1Y69U 2K5QA 4KHPQ 1F9PA 1H9JA 1HNZQ 2Z6KA 2UXDL 1SNQA 2WB1E 5EKKA 4WJ3M 2BOSA 4F88A 2WFWA 2QDBA 3GV6A 1PDQA 3WOFA 1PA6A 4KI0A 5GAEC 4RKBA 2K05A 4Z9CB 2GA4B 2I5HA 3HOVG 3S16B 5EJWA 1B9MA 1EQQA 3JAMc 2DY7A 2K7VA 1KLGD 1CZGA 1QOHA 2JQOA 1SXTA 4MN3A 4YCWA 3T4AC 2A68D 4UP9A 4K8JA 4BBSH 1T5EA 1SSOA 4RFBA 4R4TA 2RKSA 4JI5L 5IP9H 4HMJA 1BUVT 2D9UA 1S5BD 3R2TA 1MSHA 3DWAA 5CV5A 4IUPA 1R9TB 1SNOA 1VQJA 4DR5L 5CV8A 1SMXA 4LK1C 1KIXA 1N9WA 3P7JA 5IY0A 2UXBQ 3KF8B 2C9OA 1XPUA 2E2IB 3S17H 4B3TL 3AYHB 1SE3A 2OTJA 1SNDA 1YNND 3Q0AA 5C0XJ 1SLJA 5I2YA 1WTHA 3E0EA 2UXBL 2BE5C 4C2MH 1XYIA 3ONAB 3HOYB 2RVLA 2E5LL 1Q46A 4X3TA 4KMUC 2VB3X 1LTBD 3DEPA 4AQYL 1TWGB 3I8ZA 1WD1A 4LF6Q 2IHFA 4DR4L 5E4XA 4IFDG 1HTLD 2K5HA 3T53B 3BZCA 2Q2TA 2KVMA 3I73A 3OWEB 3ER0A 3FHWA 5C5LA 3DMUA 3IFTA 2YTYA 1PTOC 3CC7A 4H44C 4A3DH 5CGKA 5M9OA 1NJIC 2M00A 1DCZA 1LTLA 2OF1A 3A8IE 1MSGA 3VDYA 3GTKH 4GOPA 5KNBA 3CRKC 3NEMA 3K57A 1XTCD 1KRSA 4X64L 2BA1A 4DNRB 3KJOA 3NTIA 5E7NA 3S1MH 4CKEA 4NXMQ 4HJ8A 1Q8IA 4ZK9B 2JN4A 2KHIA 4R9WA 2K75A 2KOLA 3T1YL 3D31A 1YHQA 3V96A 1W2BA 2IY5B 4FF2A 2WV6D 3HOYG 4DV0L 3OMCA 4H7BA 1SE4A 5C3EB 1AN8A 5EPKA 3F2BA 3RNUA 4KY6A 4JI7Q 1B4OA 5JJLA 1SR3A 1PYWD 1ESFA 2DJGC 2EJMA 2R6GA 3J80i 1CZWA 4UDUC 1G6ZA 1N34L 3OHXC 4DV3L 3I72A 4GLVB 2MO1A 3D6CA 4DV4Q 4KHZA 2G9HD 3MC0B 2UUBQ 5FK9C 1NBWA 5E3FA 4RHRA 1HR0Q 2CVRA 5ELCA 3U4ZA 1T9HA 1EEFD 3HFZB 2FINB 5M5WH 1PTOH 4JC0A 1E24A 2N78A 3J81c 2KBNA 1BDOA 4BBRG 1VQ4A 1WJJA 1KNEA 1IBLL 1YJNA 1STNA 4UAIA 2R7ZG 2WKCA 3KJPA 3GV3A 5IYCG 1EYCA 3A7AB 3CU7A 3S16H 5M3MH 4X3SA 3RZDH 4LAAA 4C3HG 2XN9C 4XQJA 1QWYA 2R93G 3OSOA 4A3BH 1VQNA 4ABNA 1WTVA 4DV4L 4NKLA 4IO9A 5IYCH 4DV3Q 2L11A 4A93G 2F0KA 2R93B 4X3KA 3G71A 5CBEE 3L3OC 1KNAA 4YHHQ 1I94Q 4RWSC 2ES2A 5JVG3 2DGYA 2WINB 3VYTA 2O5IC 4DV2Q 1SAPA 4GNXB 4LMQD 4FNFA 1BBUA 1HNWQ 1VQDA 2A73B 2HDLA 2LXKA 5K5PA 3AMUA 2F0FA 3AU7A 3A74A 2KHJA 1PRTD 1BOSA 4WFN3 2SOBA 1PH3A 3G6JB 1ET9A 1SYDA 3B6YA 4L5QA 1I4PA 1D7QA 1VS0A 2ZTCA 1WD0A 4LF8Q 2CQOA 3D3RA 1L0XB 2O4XA 1Z9FA 4ZKCB 1PVOA 1J5EQ 1UE5A 1PH9A 5IP9G 3I4MB 2K04A 2B2UA 1GVPA 2UU9Q 1NCVA 4EQPA 2PNHA 3J7AF 5M5XB 1Y1VH 2JA7B 5LMNL 2F03A 1FYCA 3CD6A 1GUWA 1X65A 2E74C 3A54A 3WDNA 4BY1B 1RJTA 5I9PA 3GTKB 1DOKA 2A6EC 4LFCL 4ZLTF 1TQOA 2WP8J 1TVXA 1B44D 1FGBD 2ENBA 2PZTA 5IYBH 1EY5A 1UE1A 3RZDB 2MO0A 3C2PA 1B3QA 1V1QA 3HKSA 2UUCL 1HH2P 4FF3A 3FKIH 2Z6BA 1ONLA 4HAEA 1J6QA 4IFDI 2EIFA 4R4IA 4JW0A 4C3HH 4AYBE 4DV6Q 4R4QA 1BNZA 3L2PA 3H94A 1WTPA 1JC7A 1TR5A 1KDBA 2WAQE 2WB1B 2K4KA 2VUMH 5JJZA 1IYVA 1O78A 4V190 1I6HB 2HUGA 4LF7Q 2ID0A 3S2DH 3M4OH 2DY8A 5EKIA 5KNDA 1WCMG 1VQ6A 4RGOS 4JBKA 3LX0A 1I4RA 4LJZC 1I4QA 4DAYB 3J7YW 3S15H 4K8IA 2F0DA 2CH4W 1N33L 1D6EC 4G57A 2GVBA 1SYEA 3RN2A 3MZ5A 4F7XA 3OPOA 3F2UA 4JI0L 2K03A 1E22A 1KLUD 1QCBD 4O2DA 3OW2A 1DXMA 4MTKA 3K5NA 2CHBD 4IPCA 5M5XH 2MHVA 3I4MG 3OYYA 1PH6A 4ZCKA 1V43A 2K5VA 4S3SA 3GTPH 2K5DA 4BA2I 1YNJC 5C4JH 1I3QB 1S4ZA 4XIGS 1RODA 4ID6A 5ELFA 2LY7A 1FL0A 1GUSA 4JI8L 4LF5L 3HOWH 1JJ2A 4KJOA 1IXRA 1DONA 2BH8A 4B9WA 2JEAI 3BJUA 2Q2IA 1VQCA 3U9OA 3IL8A 3NWSA 1JJGA 1HNXL 1DGSA 5GQOA 5J39A 1J8IA 4ULLA 2Z1CA 4QCLA 2EYJA 3MAQA 2A69D 4P2CB 1RD9D 4EX5A 2Q2HA 3QIAA 1P8LA 3K7UC 4DAPA 4JI3L 4C3JH 1XTDA 3UDXA 3N6RA 1D1IA 4EQ5A 5NUCA 2WKDA 1S5FD 4OO1G 3X3NA 5CR3A 2VUMB 1Q12A 1K28A 3G6EA 4OX9Q 1II3A 3SEBA 3CQZH 5M3MB 2RBMA 3NK9A 2AWNA 3M7NA 1ZYRC 3PGZA 1CA6A 4XT3B 1HNWL 3LWEA 4GNXC 4L5SA 1GXDC 2JSOA 1TS3A 4FXDA 1BR9A 1I4GA 1F2YA 5CV4A 1YI2A 2EZVA 3J80L 2L5TA 2JA7H 2N8NA 2NVQB 1GJXA 4K6DA 4PZ6A 3S1NB 1G2TA 1LT3D 3ITPA 2MNAA 1LT5D 4LFAL 4KKSA 1PLFA 1FD7D 1AE2A 1FGUA 1OXTA 1STAA 2N88A 4GKKQ 1WTOA 5CC4A 4N8X1 5I6YA 1Q3LA 3EA6A 3MWYW 4BWGB 2NVTB 5A35A 1EFID 2KENA 2QW7A 3RLFA 1UAPA 1OTCA 2A68C 4LUOA 1EY9A 4NXNL 3FEWX 4ZYSA 4BBSG 2HIVA 2IWHA 3L7ZC 1SNCA 4HN7A 3PIO3 4A3FH 2MJ8A 4O0AA 3TZUA 4DUYQ 2UXDQ 3A56A 1I6HH 1Q81C 2B63G 1TS4A 2C35B 4DK1A 1I5FA 3CPWA 2BH2A 3G7LA 1N36L 1YNNC 4OONA 3R93A 4OELB 4KK7A 1EZ6A 3J7ZC 3W1GA 3IFDA 5E1FA 3GP7A 3HOXB 2MUYA 4A3IG 2R93H 4GNXA 3HOVB 3J81j 2NVYB 4JV5L 2XRQD 1BCPF 1G6PA 4C3IB 1DYQA 1O7IA 2VW9A 2E8GA 4K2LA 2JP1A 1PRTB 2L12A 1KRTA 2VQEL 3CF5A 1EL0A 5DAUA 4HJ9A 3T1YQ 2B2YC 5C4ZA 4HMIA 2EY5A 1U4PA 5IP7H 1TWHB 1BBXC 4DXGA 5JPNC 2NVYH 1PTOD 3VR3A 2F0LA 4UP7A 1NAPA 3ULLA 4K5XA 3F1ZA 1K9MC 3VYUA 5J22A 4EGVA 2NN6H 1PTOB 4JCVE 1Y8OB 4V0BA 5EQ0A 2OTLA 3UE0A 2JA5H 5AFWA 1OXXK 2N49A 3TBIB 4BY7B 5JEAG 1JR0D 4GKKL 3J80c 3HRZC 2HQEA 3KDFA 3W1BA 3D0FA 3TEHB 3TRZA 4ME5A 1KDCA 1STYA 3E5SA 5H1SE 4ME3A 1EOVA 2DUDA 1CKNB 1YVCA 3EQLC 1Z6HA 2CWAA 4KY5A 4QMGA 3RLOA 3HG9A 4K0KQ 3MEHA 1G291 1WTRA 1AE3A 2SDFA 1NE3A 1XMQQ 4DR1Q 2AWOA 4B3MQ 2CKZB 4DNIA 1LO5D 1JQYD 1B9NA 1TKWB 3FKIB 1X3PA 2K6AA 4LF9Q 2EY2A 4A3EB 2JXMB 1R4PB 3BS1A 2E2IH 1STHA 1ICWA 1VQHA 4DGZA 4DK0A 4JI5Q 4BBRH 2RHSB 1AW7A 1SBBB 2Q8IB 1LABA 1A8VA 2AMCB 2Q8TA 1YHBA 3MEFA 4O42A 1IBKQ 2HIXA 1EWHA 2RCNA 4FVMA 5JOBA 1A6XA 5CV6A 3DXJC 4YY3Q 1BCPC 3HS0C 3S2DB 2SEBD 3M3YH 4A3GG 4JBWA 3SK6A 4DV0Q 3CCVA 1LTTD 2LS01 4MNOA 1DOMA 1EY0A 3CKIB 1F9RA 5LMUQ 2NZHA 1HNZL 3CPFA 5LMUL 5F2DA 3CC2A 2CCZA 4GN3B 4A3DB 2D0PA 4OIKA 4A3JB 1EYAA 2QDLA 5EPJA 4X62Q 4BBSB 1A3VA 1GUOA 2B29A 2L1BA 4HEDA 4HTHA 4N9PA 3ULJA 3J81i 2JA6B 3HOUB 4AYBB 4BXXG 2O5JC 4A3BG 2RQXA 1NMFA 4JOIA 2KUMA 1VQFA 1GOZA 1U4MA 2I5LX 5EPLA 1ENCA 3SE0A 3HKZE 4A3JH 3S17B 1W3SA 2JJQA 4HR7B 4POGA 3HOUH 3PO2H 1TWCB 2MP1A 2RHQB 3RN5A 1DD2A 4C1NK 4XTCS 4IPGA 3I56A 4QUFA 2ALYB 1Q7YC 5DEHA 4X6AH 3R2IA 4LF9L 4G7OC 1E2VA 4G4KA 4A3EH 2FMCA 3QOJA 1RIPA 1SYBA 2M9VA 3SK5A 1K8AC 4QB4A 1DZ1A 2PW7A 1B70B 3VR5A 1QUQB 1B8AA 3CMEA 4B3TQ 3GTMB 2DJFC 3E6ZX 3I7FA 2PQAA 4L63B 4FO2A 2Z4IA 4IALA 3O13A 1NSNS 3HGBA 1HZCA 3EN2A 2XNAC 4KY7A 1Q90A 2R7FA 1HPCA 4A3MH 3RZOB 4YWMA 1X3QA 3DM3A 3I90A 3HOXH 2A74C 5C4JB 2JA8B 1VQMA 3KF6B 4X66L 1SE8A 1C48A 2Z9HA 2QEJC 1HR0W 3OOCA 4P71A 3CCMA 5D3IB 2E2HB 3P75A 1H9SA 1R4QB 1PH8A 1YJ9A 4X62L 4FF4A 1S5CD 1SMYC 1M4VA 2NB0A 2OEOA 1PZID 1V8QA 2JA5G 2LFNA 1G91A 5HY6A 4JVZA 3D8GA 4KD4A 1NMGA 4YCVA 4DV5L 1F2MA 3KK7A 4HJ7A 1NUCA 3H6MA 2XIWA 1G8ZD 1PH2A 3PF4A 4DAMA 1WVLA 1Z47A 4CDFC 3PO3B 1K8OA 5J3BA 1L1OC 4J15A 4JV5Q 2C5CA 1E0BA 4CJ0B 5KNCA 3FDTA 5IP7G 1X6OA 2N3SA 3FP9A 1S72A 4RGMA 3HOWB 1QG7A 4KTAA 3BU2A 4OWTB 5EBCA 1SDFA 4P73A 5HGQA 4KD3A 5KYIA 3F8TA 5CBAE 1K3BC 3QB3A 2X6GA 4GLAC 1WTXA 1Y14B 3H3VC 2CH4A 4A3IH 2YTVA 4DNTB 2PPBC 5C0XI 1WTQA 3AQQA 2R7ZH 1QUQA 1KL9A 5ELEA 2RDFA 3LGJA 3T1HL 3VR2A 1YIJA 2RDGA 1PZJD 3OTOQ 1OXVA 3NP8A 3ND8A 4XYQA 4NXNQ 1P16A 3A5ZB 2Z0SA 1HFNA 4R1JA 3JAML 4UP8A 4CDCC 1AZPA 3OW7A 2B2WC 3PIOA 1KAAA 2R7DA 3HOXG 5LL6X 3H0GH 3T13A 3HOZG 2F4VL 3I3CA 2R3ZA 3DM1A 2F0HA 4NDXA 1CKMA 5BN5A 3CXCA 2EE1A 4IOCA 2EVBA 4BY7H 1RHPA 5DM73 1UEBA 2ZJQA 1GM5A 1AFPA 1YBYA 2K52A 4CKBA 2D0OA 4QGUA 1S3OA 2H1EA 2DNEA 4TVAB 1MJEA 3DLLA 3OTOL 3NBIA 1CHPD 2QEXA 2H5XA 4C2MB 4B3RQ 3CCEA 4C1NI 4WJWA 3HOYH 3SVMA 4NXML 5IT9E 1U9RA 1X56A 4K5VA 1KDAA 5C44B 4A3GH 4A3FB 4DR2L 1KC8C 1VQ8A 1L0WA 2QKIC 3H3VI 3PO2G 1VQOA 2ZXPA 4TSSA 1SE2A 1KTKA 1PFBA 2QA4A 4J1MA 2VB2X 3PUVA 2HHHL 1CHQD 2UUAQ 2EOTA 1KQSA 1B3AA 3Q23A 4DR3L 5JJIA 1MD2D 1E2WA 3K7AH 2B2VA 1HCZA 1IKMA 4A3GB 4HIMA 1S40A 3A8KE 1Z7TA 3CRLC 4GN4B 4YWLA 3EJIA 1HRJA 4BXXH 5C0XH 3MXUA 1X3GA 3PF5A 3D6WA 4C3HB 1EEID 4DR2Q 2XSCA 3HKZG 2I07B 1HTPA 3BDOA 2OT2A 4ZAIA 2D2CC 1NR4A 1PFMA 1VQIA 1LTAD 1FVIA 2F0OA 4A3CG 4X3UA 5ELOA 5AJ3Q 3FPUB 4XYOA 2MPMA 1H9SB 1GUGA 2VZAA 3CCQA 1Y1VG 2F0WA 3D4WA 3I4MH 2VUMG 3OIPA 1CSPA 2DN8A 2JA9A 3C1EA 5C3EH 1EQRA 5ELNA 2DNCA 2B2UC 1W6KA 2JA6H 2F3VA 3I4LA 2ZXRA 4A3BB 2Y0SG 4RG1A 4LF7L 4DAYA 2HT1A 3Q24A 1X54A 1A62A 2PI2A 2HD3A 1SNPA 1QNKA 3TP7A 5C3XA 1XNQQ 3UDIA 3R3OA 4RCNA 1CI3M 5JPMC 4QUCA 1TWCH 5FO9B 1TIID 4PMCA 3DWQA 2E75C 4C3JG 3C1FA 4O1NA 2B8FA 3H91A 1HQMC 3MFGA 1CUKA 4OEMB 1EYDA 4JPBW 3SDZA 4IPHA 2WIIB 1QVFA 5C44G 5C4XB 4I7ZC 3STBD 2B3GA 1MHWC 2L0CA 1FNUA 3J7AV 4ZQ3A 4HJ5A 1FNWA 3ZJYC 1JMCA 1BO0A 3DEOA 3I55A 1W6JA 3K0XA 3TP6A 3K5OA 3LWUA 1QVGA 2HCIA 1TWHH 3PSIA 1SJHD 3WWVA 4ODGA 2A69C 3NQTA 2KA7A 1MI2A 1QJOA 1Q1EA 4A3MB 3FMCA 4KHVA 1KHIA 2TSSA 5FLXE 2F3IA 1Y1VB 1PXUA 5FLMG 2AUKA 1CFMA 2X69A 1U5KA 1ENFA 5E4WC 3U9SA 4MHEA 2SNSA 3GTGB 2A1AA 1HXYD 5BR8Q 4NP5A 2VY3A 1K3RA 1M1KC 2L4NA 3AFPA 4P75A 1JWUD 1R9TH 3S1MB 2IX1A 3TP8A 4JI0Q 4A3KH 1SYCA 1I4XA 3K7AB 3N52A 4FXGC 3SHLA 2QF7A 1HZ9A 4RA8A 1PFSA 2EYHA 1N8RC 5LL6S 4A4IA 4R4OA 1AEXA 1QVCA 2Q8RE 1QE6A 5I2XA 5KEEA 3AB9A 4JG2A 4RGNA 3PQIA 3NQIA 2XWJB 5FJ8G 4ZUIA 3UDGA 1TT2A 4ALPA 3RUZA 1GHKA 1A3TA 2AUJD 5IT9L 4KV6A 5DLQE 2Y0SB 3M7GA 3S9WA 2JA8H 2ASBA 1JOOA 1A0IA 1GUNA 2EY1A 1IBLQ 3S2HH 4DPGA 1NR2A 1E1TA 1XPRA 2FXQA 3S1QB 4KN4C 3URYA 1YHAA 1Y8PB 4RMFA 3NPPA 5G3LF 2E2HH 4OHJA 2F0QA 2K50A 5JJKA 1HZBA 3DUZA 3HOVH 4Y52H 2IT1A 4CHTB 4Y7NB 1U4RA 4DK3C 3S1NH 4HJAA 3W5OA 3S2HB 2PQAB 4C3IH 5IGGA 1I50B 3D4RA 3MFYA 3Q8DA 5CV7A 2E76C 2R92G 5IIFA 2VXWA 4FF1A 4DR3Q 1N32L 4ZUJA 2UUAL 5JVH3 4X65L 3F2DA 3SGIA 4OWXB 3H09A 2KQ3A 3QWNA 5FOBB 2OQKA 2OXPA 4CGYB 4LFBQ 4GS3A 5EBDA 4A3KB 2K32A 3BZDB 3M4PA 1VQ7A 3EROA 4IPDA 4LF8L 4DV5Q 5LHY1 3RLNA 1VQKA 2XTIA 4BY1G 1JOQA 4KJNA 1DOLA 1MGSA 1X9NA 3M4YA 2YV5A 4X64Q 2ZM6L 2K01A 1V9PA 5BR8L 3A55A 5EAYA 1K83H 4TKOB 1STBA 1M90C 4PG3A 2LMCB 3E3XA 1PHJA 4OWWB 5M5WB 2UXCQ 1N33Q 3G48A 1RTNA 4X65Q 4HSPA 4YY3L 3AEVA 1N32Q 2BDNA 4X66Q 3PCOB 5IGCA 3A0JA 1EUJA 5G3LD 1HZAA 1HQRD 1CKNA 4PQXA 1N36Q 4IUVA 3VA5A 2V1CC 1JORA 2WB1G 4GKJQ 4RKLA 2E2JH 4FDBA 4I65A 4P74A 1RL2A 2KCTA 3NBHA 1EIGA 2WACA 1CM9A 5CORA 2EXZA 5IT9c 2EY6A 1B50A 3PO2B 3E9IA 1EY7A 4G7ZC 1K8GA 1YNJD 1GO3E 5IYBG 1G2SA 2O2LD 3QJYA 4PMBA 3CW2C 3TS0A 3H3VH 5L37A 4LFCQ 1H9MA 1PH5A 4DN4M 5KYLA 3K5LA 4IZ8A 1L0YB 3L9AX 2MGSA 2P5ZX 3GTMH 1F2LA 2F0MA 5C44H 4JOIC 1Y1WB 3CCSA 2VNUD 1PYSB 2I46A 4IURA 4YIJA 2AKWB 4RAUC 4L6TB 4XT1B 3G4SA 1BVSA 3PO3H 1UUPA 3NE5B 3VR4A 4KLKA 1LLRD 4K14A 4AIMA 1GD7A 1K83B 1VMCA 2YTXA 4M1UB 1C7YA 4UY8C 4QQBX 4OXPA 4POFA 4JI6Q 5K36G 2F0SA 1YEZA 1F9QA 2A6HD 1EIYB 4HIOA 2QILA 3F2CA 1JICA 1MKHA 1LV9A 4LW1A 1BCPD 3D4DA 5IYDH 5FO7B 4A3IB 4IN3A 2VQEQ 4IUNA 5IGDA 4BBRB 1DJRD 4J6HA 5IODA 1LTSD 4DFAA 1I3QH 5JEAH 5HURA 5IGEA 2HCCA 4PZ7A 4QJFA 3NHHA 3X3MA 5A2QE 3U58A 1V1PA 3M9BA 1BBWA 1CA5A 1AP0A 2Y0SE 3AFQA 3NTHA 1HUMA 2PZUA 1LYLA 4NB3A 2YU9B 2B2WA 4JI1L 4B9XA 2KEEA 4DR4Q 2AQ1B 4DUZL 5GROA 1EU4A 1VMPA 4AQYQ 3NELA 4DF7A 4F87A 2E5LQ 1A2UA 1HFGA 2IJ0A 1BQQT 1BXTA 2VL6A 3OMGA 1WOCA 3ND9A 1TWAH 3WOEA 1KABA 4N8FA 3HKZB 1AZQA 1HA6A 3Q6SA 2OQ0A 3KBGA 3K0YA 4XXEA 3EBEA 1JB3A 2B63H 3SR1A 3CC4A 2F0PA 4J8QA 4GN5A 3ERSX 1HR0L 2JA5B 1RKNA 1X55A 3RMHA 4JI4Q 4LF4Q 4GOPB 1TS5A 2GN5A 1F2ZA 3VYSA 5IGFA 1HJPA 1XNRL 2EXDA 3HOZB 3KLWA 3TDQA 3I4NG 4KN7C 1ICFB 3K59A 1O7ZA 1QZGA 2J4XA 5C5MA 3I4OA 3NUCA 3ZYYX 2F1MA 3PIP3 4FP5D 4LF4L 4JBMA 1CSQA 3KYHC 5GADC 2R61A 4JI7L 3BDLA 3C3LA 3GDEA 1U0LA 2I5MX 4A76A 2B8GA 1EY8A 4MIUA 3TZDA 4TRDA 3ICEA 4PZ8A 4LNQA 5CMDA 2KCMA 3P20A 4JI2L 1A15A 3JAMi 2UUCQ 3MXGA 2J0TD 1UEAB 1B2TA 1F9SA 2PYKA 1X3EA 3TP5A 2RA4A 4KHPL 3GTGH 3MXNB 4MTNA 4DA2A 5C4XH 2JE6I 1OXUA 2NN6G 4CBVA 4FXKC 1ILQA 1ZEQX 2B39A 4B3SL 2WAQB 2NYZD 3GD7A 3PIPA 2NZOA 2I0QA 2ATWA 4DAVA 1E1OA 2A6ED 3ERQA 4BY1H 1HNXQ 1VF7A 1A63A 1IL2A 4C3IG 1VQAA 3GTJB 3BYYB 3A5UA 1X32A 3TS2A 3K5MA 2PMZB 3RR5A 4H02A 1J5EL 2M2LA 1B1ZA 2CW0C 1WI5A 3BVZA 3MVVA 2IW3A 4B3RL 4DUYL 3NBHB 5I6WA 4JI6L 1YJWA 4IJLA 3H0GG 1SYFA 3GTLH 2NVXH 5TSSA 1UNSA 3BVMA 1L2FA 1XPOA 4EQOA 1LM0A 4DV2L 1TS2A 4HSVA 4OGQC 1H9KA 2SNMA 3UDFA 1XJVA 3LNNA 3PMFA 4YHHL 1D5MC 4N9TA 1I94L 2KCNA 3FKIG 3GTLB 3I2ZA 2L55A 4IFDJ 3K80C 1JB7A 4P72A 1ENAA 1SYGA 3TMEA 4OL7A 5IWAQ 1E3PA 4U68A 1Q86C 5T1IA 1J9OA 2B63B 4A3MG 3CHBD 2V4DA 2BDOA 3K58A 4NPSA 3PV0A 3JAME 1K0SA 1EY4A 2B2VC 1D5XC 2Z4HA 2FMMA 3JC66 1JT8A 2VS1A 3BDCA 4XQNA 4QIWE 5EKLA 3CCRA 1SNMA 3J7A5 1JJCB 1SFOB 2HQLA 4NMZA 3M85A 2FFKB 2ICEC 3CMAA 1SROA 2JA7G 2UUBL 1EOTA 5ELDA 2ICIA 4DXFA 4QIWB 1C0AA 1VQBA 3NSWA 1CQVA 5K36H 1LT6D 2MQHA 3M4QA 5I9OA
chains in the Genus database with same CATH topology
4PNYA 1V1PB 2QCPX 3KLSA 3J80E 2XWBB 4DU9A 1O80A 4RGTA 2NTTA 1IYUA 4E6IA 4EQNA 1A3UA 1ZXTA 2F0UA 3HEJA 2KJXA 2PO4A 1K8MA 1JOKA 5FLXL 2PW5A 4B08A 4K2KA 2PZWA 4CJ2C 1QILA 3T56B 2B2YA 4ZRZA 5A2QL 3MXPA 4NW2A 4U673 4Q5VA 1SEBD 2X6LA 5FKAC 2F0EA 3BG3A 1WCMB 3MXNA 4IUQA 2JYOA 4WORA 1IHZA 1GHJA 5DM63 1IKLA 2K5WA 1CQFA 2KEDA 1I6VC 1LTGD 2IPKD 2RSOA 4OO1H 4QF4A 5JEAJ 4K6LA 1ZKOA 4RCOA 2NWGA 1TY2A 2IX3A 3KBXA 4H0LC 4XQQA 3HP3A 2K1BA 1VCIA 1I4HA 1Y8NB 2FJ2A 4RH6A 4K5WA 1RF2D 3I4NB 5BN3A 3M4OB 1LACA 2B2TA 4OO1I 2CW0D 1STEA 1D2BA 2EYMA 5C0XG 2R92B 2F0VA 2A5HA 1OXSC 3EFXD 1FNVA 2F0JA 2KCCA 4C56C 4IQZA 1ET6A 5M5YB 1EZ8A 1O7YA 1A2TA 4G7HC 3I70A 1PRTC 3HZXA 3W3AA 3RD4A 4BS9A 3TSSA 2TMPA 1EWCA 1HA5A 3J81L 1RCVD 1LTID 3A7LA 1TU2B 1ML0D 1HUNA 1EY6A 4WRDA 2BE5D 1H9RA 3S15B 2RSNA 2IL8A 5FO8B 2XRSD 2NUCA 4IFDH 1IW7D 3MHBA 3S1RB 1XX8A 2D62A 1B53A 2EYLA 5KRUA 3VA7A 1S5DD 5EGTA 4CKCA 5M3FB 1XXGA 1O7LA 2J7ZA 1OO9B 1ESRA 1T5XD 1D1KA 3M3YB 2NBFA 5COYA 3QOLA 3UI2A 3PUZA 3KLRA 2AQ2B 2F0NA 4IUTA 2F0GA 1RDPD 4OIJA 2EYFA 1V1OA 1EQVA 3TN2A 5D65A 5I4DA 4HCSA 2K28A 3MA2B 3DHQA 3NTKA 3OWFA 1XWEA 2PCFB 2LKVA 1SJED 1M8AA 5J1ZA 2F3WA 1LTRD 1DM0B 1JCKB 2JEBI 3CQZB 3MTSA 4BA1I 3T16A 1JWMD 3EVQA 4F8MA 1CK1A 5ISRA 2AQ3B 3BVGA 4KKUA 1JE4A 5C3WA 3H0GB 3W2DA 1CTMA 2B2TC 2KECA 2F0IA 5D14A 3QG1A 3KF8A 3VR6A 2EJFC 3NXWA 2CQAA 4R8NA 2EDGA 4ILWA 2EYOA 3FVQA 3PUYA 4KKTA 5KGUA 2ZT9C 1MBYA 2NTSA 2K33A 1PRTF 5IGBA 5T1GA 4IUUA 4RHSA 3V2TA 4L8JA 2G9DA 2HDMA 3FPPA 1D5ZC 1JWSD 2BA0A 3A8JE 5ELBA 2R7ZB 1EU3A 3NWTA 2E2JB 1QNUA 1EIHA 5JAVA 1S5ED 4ZKBB 3GTPB 2D5DA 2NN6I 2BCOA 1PTOF 5BN4A 1BF4A 1PMRA 3S14B 2N55A 1WTWA 1VF5C 3J81E 1C4QA 1Q1BA 1TWFB 3FRPB 4M8AA 4TQUS 2ZXOA 1ILPA 2F4IA 4XDXA 1SMYD 2PNRC 5HGTA 2EYPA 1BCPB 3Q22A 2NVXB 4Q0FA 2A6HC 2F0TA 3DWPA 4R8IA 2EPBA 1F77A 3OIQA 4CJ1B 5DNFA 3GTOB 1CT1D 4H13C 4GZYC 4PMWA 1IL8A 2IX0A 2H4OA 2L9HA 3IKJA 2PQEA 3PUWA 2EJGC 3QO2A 1PFNA 1FR3A 3SXHA 1E2ZA 4A93B 3BYTB 5KIXA 1PZKD 4C3JB 1EQTA 1IW7C 3SK8A 3GO5A 5CYUA 4JK1C 3V05A 5C4HA 3KUPA 1TWAB 2KHSA 2XVSA 5C6AA 2RDHA 3SK4A 1STGA 3I91A 4FYDA 1TY0A 2E2DC 2FHTA 5CV9A 3GTQB 1U4LA 3E0JA 1ZYRD 3GQBA 1HHVA 2NZ1D 1QB5D 4EVOA 5IOCA 3PUXA 3VYRA 1GUTA 1LT4D 2Z8LA 1C8CA 1VDZA 3IAYA 3T51B 5D3DA 3C46A 4HCEA 4PV1C 3P1HA 1RTOA 3R8BA 3K6OA 2YYZA 3KLSX 1Y69U 2K5QA 1F9PA 1H9JA 1SNQA 5EKKA 2BOSA 4F88A 2QDBA 3GV6A 1PDQA 3WOFA 4KI0A 4RKBA 2K05A 4Z9CB 2GA4B 3S16B 5EJWA 1B9MA 2DY7A 2K7VA 1KLGD 1CZGA 1QOHA 4MN3A 1SXTA 3T4AC 2A68D 4K8JA 1T5EA 1SSOA 4RFBA 2RKSA 4HMJA 1BUVT 2D9UA 1S5BD 3R2TA 1MSHA 3DWAA 5CV5A 4IUPA 1R9TB 1SNOA 5CV8A 4LK1C 3P7JA 2C9OA 2E2IB 1SE3A 1SNDA 1YNND 3Q0AA 5C0XJ 5I2YA 2BE5C 1XYIA 3ONAB 3HOYB 2RVLA 4X3TA 4KMUC 2VB3X 1LTBD 3DEPA 1TWGB 3I8ZA 1WD1A 5E4XA 4IFDG 1HTLD 3T53B 2KVMA 3I73A 3OWEB 5C5LA 3DMUA 3IFTA 1PTOC 4H44C 5CGKA 5M9OA 2M00A 1DCZA 2OF1A 3A8IE 1MSGA 5KNBA 3CRKC 3K57A 1XTCD 2BA1A 4DNRB 3NTIA 4CKEA 1Q8IA 4ZK9B 4R9WA 2KOLA 3D31A 3V96A 4FF2A 2WV6D 3OMCA 4H7BA 1SE4A 5C3EB 1AN8A 5EPKA 4KY6A 1B4OA 1PYWD 1ESFA 2R6GA 2EJMA 1CZWA 4UDUC 1G6ZA 3OHXC 3I72A 3D6CA 4KHZA 2G9HD 3MC0B 5FK9C 5E3FA 4RHRA 2CVRA 5ELCA 1EEFD 2FINB 1PTOH 1BDOA 1KNEA 1STNA 4UAIA 2WKCA 3GV3A 1EYCA 3A7AB 3CU7A 4X3SA 4LAAA 4C3HG 2XN9C 4XQJA 1QWYA 3OSOA 4ABNA 1WTVA 4NKLA 2L11A 2R93B 2F0KA 4X3KA 5CBEE 3L3OC 1KNAA 4RWSC 5JVG3 2WINB 3VYTA 2O5IC 1SAPA 4LMQD 4FNFA 2A73B 2HDLA 5K5PA 3AMUA 2F0FA 3AU7A 1PRTD 1BOSA 4WFN3 2SOBA 3G6JB 1ET9A 1SYDA 1I4PA 1WD0A 3D3RA 1L0XB 2O4XA 4ZKCB 3I4MB 2K04A 2B2UA 1NCVA 4EQPA 3J7AF 5M5XB 2JA7B 2F03A 1FYCA 1GUWA 2E74C 3A54A 3WDNA 4BY1B 1RJTA 5I9PA 3GTKB 1DOKA 2A6EC 4ZLTF 1TQOA 2WP8J 1TVXA 1B44D 1FGBD 2ENBA 2PZTA 1EY5A 3RZDB 3C2PA 4FF3A 1ONLA 4HAEA 4IFDI 1BNZA 1WTPA 3H94A 1TR5A 1JC7A 1KDBA 2WB1B 5JJZA 1IYVA 1O78A 4V190 1I6HB 2HUGA 2ID0A 2DY8A 5EKIA 5KNDA 4RGOS 3LX0A 1I4RA 4LJZC 1I4QA 3J7YW 4K8IA 2F0DA 1D6EC 4G57A 1SYEA 3MZ5A 4F7XA 3OPOA 3F2UA 2K03A 1KLUD 1QCBD 1DXMA 3K5NA 2CHBD 2MHVA 1V43A 4S3SA 2K5DA 4BA2I 1YNJC 1I3QB 1S4ZA 4XIGS 1RODA 4ID6A 5ELFA 2LY7A 1GUSA 4KJOA 1DONA 4B9WA 2JEAI 3U9OA 3IL8A 3NWSA 1J8IA 5J39A 4ULLA 2Z1CA 4QCLA 2EYJA 3MAQA 2A69D 4P2CB 1RD9D 3QIAA 4DAPA 3N6RA 1D1IA 5NUCA 2WKDA 1S5FD 4OO1G 3X3NA 5CR3A 2VUMB 1Q12A 1II3A 3SEBA 5M3MB 2RBMA 3NK9A 2AWNA 3M7NA 1ZYRC 1CA6A 4XT3B 3LWEA 1GXDC 2JSOA 1TS3A 4FXDA 1BR9A 1I4GA 1F2YA 5CV4A 2EZVA 3J80L 2L5TA 2NVQB 1GJXA 4K6DA 3S1NB 1G2TA 1LT3D 3ITPA 1LT5D 4KKSA 1PLFA 1FD7D 1STAA 1OXTA 2N88A 1WTOA 5CC4A 5I6YA 1Q3LA 3EA6A 3MWYW 4BWGB 2NVTB 5A35A 1EFID 3RLFA 1UAPA 2A68C 1EY9A 3FEWX 4ZYSA 2IWHA 3L7ZC 1SNCA 4HN7A 3PIO3 2MJ8A 3TZUA 3A56A 1TS4A 4DK1A 3G7LA 1YNNC 3R93A 4KK7A 1EZ6A 3IFDA 5E1FA 3GP7A 3HOXB 2MUYA 3HOVB 2NVYB 2XRQD 1BCPF 4C3IB 1DYQA 4K2LA 2JP1A 1PRTB 2L12A 1EL0A 5DAUA 2B2YC 5C4ZA 4HMIA 2EY5A 1U4PA 1TWHB 1BBXC 4DXGA 5JPNC 1PTOD 3VR3A 2F0LA 1NAPA 4K5XA 3VYUA 5J22A 4EGVA 2NN6H 1PTOB 1Y8OB 4V0BA 5EQ0A 5AFWA 1OXXK 3TBIB 4BY7B 5JEAG 1JR0D 3HRZC 2HQEA 4ME5A 1KDCA 1STYA 3E5SA 3EQLC 1Z6HA 4KY5A 4QMGA 3HG9A 3MEHA 1G291 1WTRA 2SDFA 2AWOA 1LO5D 1JQYD 1B9NA 1TKWB 3FKIB 1X3PA 2K6AA 2EY2A 4A3EB 2JXMB 3BS1A 1R4PB 1STHA 1ICWA 4DGZA 4DK0A 1AW7A 1SBBB 2Q8IB 1LABA 2Q8TA 4O42A 1EWHA 4FVMA 5JOBA 1A6XA 5CV6A 3DXJC 1BCPC 3HS0C 3S2DB 2SEBD 4JBWA 3SK6A 1LTTD 2LS01 1DOMA 1EY0A 3CKIB 1F9RA 5F2DA 4A3DB 4OIKA 4A3JB 1EYAA 5EPJA 4BBSB 1A3VA 1GUOA 2L1BA 4HEDA 4N9PA 4HTHA 3HOUB 2JA6B 2O5JC 4AYBB 2RQXA 2KUMA 1GOZA 1U4MA 5EPLA 1ENCA 3SE0A 3S17B 4HR7B 1TWCB 2MP1A 1DD2A 4C1NK 4XTCS 4QUFA 5DEHA 3R2IA 4G7OC 1E2VA 4G4KA 2FMCA 3QOJA 1SYBA 2M9VA 1DZ1A 3SK5A 4QB4A 2PW7A 3VR5A 3GTMB 3E6ZX 4L63B 4FO2A 2Z4IA 4IALA 3O13A 1NSNS 3HGBA 4KY7A 2XNAC 1Q90A 1HPCA 3RZOB 1X3QA 3I90A 2A74C 5C4JB 2JA8B 1C48A 2QEJC 3OOCA 5D3IB 2E2HB 3P75A 1H9SA 1R4QB 4FF4A 1S5CD 1SMYC 1M4VA 2NB0A 2OEOA 1PZID 1V8QA 2LFNA 1G91A 3D8GA 4KD4A 1F2MA 3KK7A 1NUCA 3H6MA 2XIWA 1G8ZD 1WVLA 1Z47A 3PO3B 1K8OA 2C5CA 1E0BA 4CJ0B 5KNCA 3FDTA 4RGMA 3HOWB 1QG7A 4KTAA 5EBCA 1SDFA 4KD3A 5KYIA 5CBAE 3QB3A 2X6GA 1WTXA 3H3VC 4DNTB 2PPBC 5C0XI 1WTQA 5ELEA 2RDFA 3VR2A 2RDGA 1PZJD 1OXVA 3NP8A 3ND8A 4XYQA 1HFNA 3JAML 1AZPA 3OW7A 2B2WC 1KAAA 5LL6X 3T13A 3I3CA 2R3ZA 3DM1A 2F0HA 4NDXA 5BN5A 2EE1A 2EVBA 1RHPA 5DM73 1AFPA 4CKBA 2H1EA 2DNEA 3NBIA 1CHPD 4C2MB 4C1NI 4WJWA 3SVMA 5IT9E 1U9RA 4K5VA 1KDAA 5C44B 4A3FB 2QKIC 2ZXPA 4TSSA 1SE2A 1KTKA 1PFBA 4J1MA 2VB2X 3PUVA 1CHQD 2EOTA 1B3AA 3Q23A 1MD2D 1E2WA 2B2VA 1HCZA 1IKMA 4A3GB 3A8KE 1Z7TA 3CRLC 3EJIA 1HRJA 5C0XH 3MXUA 3D6WA 4C3HB 1EEID 2XSCA 2I07B 1HTPA 3BDOA 2OT2A 4ZAIA 2D2CC 1NR4A 1PFMA 1LTAD 2F0OA 4X3UA 3FPUB 4XYOA 2MPMA 1H9SB 1GUGA 2F0WA 3D4WA 3OIPA 2DN8A 3C1EA 2DNCA 2B2UC 1W6KA 2F3VA 3I4LA 2ZXRA 4A3BB 4DAYA 3Q24A 1SNPA 1QNKA 3TP7A 5C3XA 3R3OA 4RCNA 1CI3M 5JPMC 4QUCA 5FO9B 1TIID 4PMCA 3DWQA 2E75C 4C3JG 3C1FA 4O1NA 2B8FA 3H91A 1HQMC 3MFGA 1EYDA 3SDZA 2WIIB 5C4XB 4I7ZC 2L0CA 1FNUA 3J7AV 4ZQ3A 1FNWA 1BO0A 3DEOA 1W6JA 3TP6A 3K5OA 3LWUA 2HCIA 1SJHD 4ODGA 3NQTA 2A69C 2KA7A 1MI2A 4A3MB 1Q1EA 1QJOA 3FMCA 4KHVA 2TSSA 5FLXE 1Y1VB 1PXUA 2AUKA 1CFMA 2X69A 1ENFA 5E4WC 3U9SA 4MHEA 2SNSA 3GTGB 1HXYD 4NP5A 2L4NA 1JWUD 3S1MB 2IX1A 3TP8A 1SYCA 1I4XA 3K7AB 3N52A 4FXGC 3SHLA 2QF7A 4RA8A 2EYHA 5LL6S 1AEXA 2Q8RE 1QE6A 5I2XA 5KEEA 3AB9A 4RGNA 3NQIA 2XWJB 4ZUIA 1TT2A 3RUZA 1GHKA 1A3TA 2AUJD 5IT9L 4KV6A 2Y0SB 3M7GA 3S9WA 1JOOA 1GUNA 2EY1A 1NR2A 3S1QB 4KN4C 3URYA 1Y8PB 3NPPA 5G3LF 4OHJA 2F0QA 3DUZA 2IT1A 4CHTB 4Y7NB 1U4RA 3S2HB 5IGGA 1I50B 3D4RA 3MFYA 5CV7A 2E76C 5IIFA 2VXWA 4FF1A 4ZUJA 5JVH3 3H09A 2KQ3A 3QWNA 5FOBB 2OXPA 4CGYB 5EBDA 4A3KB 2K32A 3BZDB 3EROA 5LHY1 1JOQA 4KJNA 1DOLA 1MGSA 3M4YA 2K01A 3A55A 4TKOB 1STBA 2LMCB 5M5WB 1RTNA 4HSPA 2BDNA 5IGCA 5G3LD 1HQRD 4PQXA 4IUVA 3VA5A 1JORA 4RKLA 4I65A 3NBHA 1EIGA 2WACA 1CM9A 5CORA 2EXZA 2EY6A 1B50A 3PO2B 1EY7A 4G7ZC 1YNJD 1G2SA 2O2LD 3QJYA 4PMBA 1H9MA 4DN4M 5KYLA 3K5LA 4IZ8A 1L0YB 3L9AX 2MGSA 1F2LA 2F0MA 1Y1WB 2VNUD 2I46A 4IURA 4YIJA 4RAUC 4L6TB 4XT1B 1UUPA 3NE5B 3VR4A 1LLRD 4K14A 1K83B 1VMCA 4M1UB 5K36G 2F0SA 1F9QA 2A6HD 2QILA 1JICA 1LV9A 1BCPD 3D4DA 5FO7B 4A3IB 4IN3A 4IUNA 5IGDA 4BBRB 1DJRD 4J6HA 5IODA 1LTSD 4DFAA 5JEAH 5HURA 5IGEA 2HCCA 3X3MA 3NHHA 5A2QE 1V1PA 1CA5A 1AP0A 3NTHA 1HUMA 2PZUA 2YU9B 2B2WA 4B9XA 2KEEA 2AQ1B 1EU4A 1VMPA 4DF7A 4F87A 1A2UA 1HFGA 2IJ0A 1BQQT 1BXTA 3OMGA 3ND9A 3WOEA 1KABA 3HKZB 1AZQA 1HA6A 3Q6SA 3KBGA 3K0YA 4XXEA 1JB3A 3SR1A 2F0PA 4J8QA 2JA5B 1RKNA 3RMHA 1TS5A 1F2ZA 3VYSA 5IGFA 3HOZB 3TDQA 4KN7C 3K59A 1O7ZA 2J4XA 5C5MA 3NUCA 3ZYYX 2F1MA 3PIP3 4FP5D 2R61A 3BDLA 3C3LA 2B8GA 1EY8A 4MIUA 3TZDA 4TRDA 5CMDA 3P20A 1A15A 3MXGA 2J0TD 1UEAB 1B2TA 1F9SA 2PYKA 3TP5A 2RA4A 4DA2A 2JE6I 1OXUA 2NN6G 4CBVA 4FXKC 1ILQA 1ZEQX 2B39A 2WAQB 2NYZD 3GD7A 4DAVA 2A6ED 3ERQA 1VF7A 4C3IG 3GTJB 3BYYB 1X32A 3K5MA 2PMZB 2M2LA 1B1ZA 2CW0C 3BVZA 3MVVA 2IW3A 5I6WA 1SYFA 5TSSA 1UNSA 3BVMA 4EQOA 1TS2A 4HSVA 4OGQC 1H9KA 2SNMA 3LNNA 3PMFA 1D5MC 4N9TA 2KCNA 3GTLB 4IFDJ 2L55A 1ENAA 1SYGA 3TMEA 4OL7A 4U68A 5T1IA 1J9OA 2B63B 3CHBD 2V4DA 2BDOA 3K58A 3PV0A 3JAME 1EY4A 2B2VC 1D5XC 2Z4HA 2FMMA 3BDCA 4XQNA 5EKLA 1SNMA 1SFOB 4NMZA 3M85A 2FFKB 2ICEC 1EOTA 5ELDA 2ICIA 4DXFA 4QIWB 3NSWA 1CQVA 5K36H 1LT6D 5I9OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F9Q A;  1ILP A;  1ILQ A;  1C8C A;  1G91 A;  1MSG A;  2NYZ D;  4XDX A;  1PFB A;  1JIC A;  1WD0 A;  1LV9 A;  1DOM A;  1DON A;  1M8A A;  1O80 A;  1F9R A;  2X69 A;  2XIW A;  5E4W C;  4ZKC B;  3IL8 A;  2EOT A;  2JP1 A;  1RTO A;  4MHE A;  1DOL A;  1MGS A;  2L12 A;  4ZK9 B;  1WVL A;  1B3A A;  2K04 A;  4R9W A;  1EL0 A;  1J8I A;  2B2U A;  2B2V A;  1IKM A;  1NCV A;  2KOL A;  3MTS A;  4OIK A;  1X32 A;  1O7Y A;  2B2Y C;  2HCC A;  2K01 A;  5EPJ A;  1E0B A;  4CJ0 B;  4R8I A;  3FDT A;  2EPB A;  2L1B A;  1ZXT A;  4HED A;  4CJ1 B;  1F9P A;  1U4P A;  2L4N A;  5DNF A;  1HRJ A;  1BBX C;  1CA5 A;  1AP0 A;  1QG7 A;  3D6W A;  2M2L A;  1HUM A;  1SDF A;  2KUM A;  1GUW A;  5EPK A;  1IL8 A;  1RTN A;  1B4O A;  1U4M A;  1NAP A;  1RJT A;  4ZAI A;  2B2W A;  5EPL A;  5CBA E;  1NR4 A;  1PFM A;  1JE4 A;  1DOK A;  2BDN A;  2KEE A;  1PDQ A;  3GV6 A;  4X3U A;  3N52 A;  1VMP A;  2B2T C;  2X6G A;  3FPU B;  4ZLT F;  1WTX A;  2K05 A;  2MPM A;  1G6Z A;  2L9H A;  1TVX A;  4CJ2 C;  1HFG A;  5EJW A;  5EQ0 A;  2KEC A;  1WTQ A;  2B2Y A;  5AFW A;  2MP1 A;  4IUV A;  4RA8 A;  5D14 A;  3QO2 A;  1ML0 D;  1PFN A;  2DY7 A;  4MN3 A;  4NW2 A;  1HUN A;  1CA6 A;  4XT3 B;  3LWE A;  4QUF A;  1AZQ A;  2Q8R E;  1QE6 A;  2X6L A;  3Q6S A;  4HSV A;  1HA6 A;  2B2U C;  4HAE A;  1SSO A;  2RSN A;  2CVR A;  2IL8 A;  2D9U A;  1EIG A;  1CM9 A;  1MSH A;  2FIN B;  1G2T A;  4IUP A;  1HFN A;  5COR A;  4IUQ A;  1DZ1 A;  2JYO A;  1AZP A;  1BNZ A;  1WTP A;  1B50 A;  2B2W C;  1EQT A;  1PLF A;  2N88 A;  1KNE A;  5T1G A;  1WTO A;  3P7J A;  1IKL A;  4IUU A;  1XX8 A;  3I3C A;  2R3Z A;  2HDM A;  3DM1 A;  1B53 A;  1QNK A;  1Q3L A;  2KED A;  1G2S A;  3MWY W;  5JJZ A;  3GV3 A;  4U68 A;  1NR2 A;  1WTR A;  5T1I A;  2SDF A;  1J9O A;  2HUG A;  4QUC A;  2RSO A;  2EE1 A;  4X3S A;  3KUP A;  2DY8 A;  1O7Z A;  1RHP A;  5EKI A;  2NWG A;  4UAI A;  4DN4 M;  1X3P A;  3H91 A;  1XYI A;  1X3Q A;  2B2V C;  1WTV A;  3I90 A;  2J7Z A;  3ONA B;  1EIH A;  2MGS A;  2RVL A;  2L11 A;  2FMM A;  1ESR A;  3KBX A;  4ZKB B;  4X3T A;  1F2L A;  1U4R A;  3DEP A;  3HP3 A;  4X3K A;  5COY A;  2K1B A;  2MJ8 A;  3I8Z A;  1WD1 A;  3UI2 A;  1ICW A;  5CBE E;  4IUR A;  1KNA A;  3I91 A;  3TZD A;  4RWS C;  2H1E A;  3F2U A;  4RAU C;  2FJ2 A;  2K03 A;  4IUT A;  4XT1 B;  5E4X A;  5CMD A;  1SAP A;  1A15 A;  2FHT A;  4LMQ D;  4OIJ A;  2Q8T A;  2B2T A;  4O42 A;  1BF4 A;  1BO0 A;  3TN2 A;  3DEO A;  2KVM A;  1U4L A;  2FFK B;  2VXW A;  1VMC A;  2HDL A;  5D65 A;  1B2T A;  1EOT A;  2K28 A;  4HCS A;  1F9S A;  2N55 A;  1WTW A;  3G7L A;  2HCI A;  3SVM A;  2RA4 A;  1HHV A;  3R93 A;  2NZ1 D;  1S4Z A;  1ROD A;  1MI2 A;  3IFD A; 
#chains in the Genus database with same CATH topology
 4PNY A;  1V1P B;  2QCP X;  3HOU G;  3KLS A;  3J80 E;  1YNX A;  2XWB B;  4DU9 A;  1O80 A;  2RF4 A;  4RGT A;  4JI8 Q;  4LF5 Q;  1VQP A;  2NTT A;  1IYU A;  4B3S Q;  4L5T A;  4E6I A;  4EQN A;  1UE7 A;  3UE1 A;  1QZH A;  1A3U A;  1ZXT A;  2F0U A;  2ZJP A;  3HEJ A;  4A3L G;  2KJX A;  1IBM Q;  2PO4 A;  1K8M A;  2AHO B;  1JOK A;  5FLX L;  2PW5 A;  4B08 A;  3K81 C;  4K2K A;  2PZW A;  4CJ2 C;  1QIL A;  1Q8K A;  3T56 B;  3GTO H;  2B2Y A;  1SRU A;  4ZRZ A;  5A2Q L;  3MXP A;  1XNQ L;  5M3F H;  4NW2 A;  3S1R H;  4U67 3;  4Q5V A;  1SEB D;  2X6L A;  5FKA C;  2F0E A;  2Z6K C;  3BG3 A;  4JBJ A;  1WCM B;  3MXN A;  4IUQ A;  2JYO A;  1NTG A;  1I50 H;  4WOR A;  2PMZ E;  1IHZ A;  1GHJ A;  5C3E G;  1KD1 C;  5DM6 3;  1VQE A;  1IKL A;  2K5W A;  1CQF A;  2KED A;  1I6V C;  1LTG D;  2IPK D;  4A93 H;  1G51 A;  4DR1 L;  3U50 C;  1VQ9 A;  4UHV A;  2RSO A;  3I4N H;  4OO1 H;  1NY4 A;  4QF4 A;  5JEA J;  4K6L A;  1ZKO A;  4K0K L;  4RCO A;  2NWG A;  1TY2 A;  2IX3 A;  3KBX A;  4H0L C;  4XQQ A;  3HP3 A;  1UE6 A;  2K1B A;  4DUZ Q;  1VCI A;  5FLX c;  1I4H A;  1Y8N B;  2FJ2 A;  4RH6 A;  4K5W A;  1RF2 D;  3I4N B;  5BN3 A;  3M4O B;  1LAC A;  1X3F A;  2CFM A;  2B2T A;  4OO1 I;  2CW0 D;  1STE A;  1D2B A;  1ASY A;  2EYM A;  5GAG C;  5C0X G;  2R92 B;  1PYB A;  2HHH Q;  5M5Y H;  2F0V A;  1VQL A;  4WJ4 A;  5C4X G;  2A5H A;  1PV4 A;  1OXS C;  3EFX D;  1FNV A;  2F0J A;  2KCC A;  4C56 C;  4IQZ A;  1TWG H;  4A3K G;  4A3E G;  1H95 A;  1IBM L;  1ET6 A;  4I7A A;  5M5Y B;  1EZ8 A;  4A3F G;  4DR7 Q;  1O7Y A;  1A2T A;  4G7H C;  3S14 H;  2EQS A;  3I70 A;  1PRT C;  2K5N A;  4JYA Q;  1ASZ A;  3HZX A;  4LWC A;  3W3A A;  3RD4 A;  4DV1 L;  4BS9 A;  2G5D A;  1XMO Q;  3CCU A;  1WFQ A;  1AH9 A;  3TSS A;  1PH7 A;  2TMP A;  1EWC A;  1EYG A;  2PI2 E;  1HA5 A;  3J81 L;  1RCV D;  1LTI D;  3A7L A;  1XNR Q;  4LF6 L;  1TU2 B;  1ML0 D;  1HUN A;  1EY6 A;  4WRD A;  3L0O A;  1JE5 A;  2BE5 D;  1YIT A;  1H9R A;  4JI4 L;  1CKO A;  3S15 B;  2RSN A;  2IL8 A;  4DK6 C;  5GAH C;  1EFW A;  2LSS A;  5FO8 B;  3TQY A;  2XRS D;  2NUC A;  1XMQ L;  4IFD H;  1IW7 D;  1L1O A;  3MHB A;  4MZ9 A;  3S1R B;  1XX8 A;  3NEN A;  2D62 A;  1B53 A;  2EYL A;  5KRU A;  4IJH A;  3VA7 A;  1S5D D;  5EGT A;  4CKC A;  3S24 A;  5M3F B;  2OWO A;  1XXG A;  4GKJ L;  1KXL A;  2JK8 A;  1O7L A;  1BKB A;  2J7Z A;  3STB C;  1OO9 B;  1N34 Q;  1ESR A;  1T5X D;  4YCU A;  1D1K A;  3M3Y B;  2NBF A;  5COY A;  2NVT H;  3QOL A;  3UI2 A;  3PUZ A;  3HOZ H;  3KLR A;  2AQ2 B;  2F0N A;  4IUT A;  2F0G A;  4DV1 Q;  1XMO L;  1RDP D;  4OIJ A;  2EYF A;  1V1O A;  1EQV A;  2QGQ A;  3TN2 A;  2UU9 L;  3HOW G;  5D65 A;  5I4D A;  4HCS A;  2K28 A;  3MA2 B;  4OX9 L;  3DHQ A;  1GKH A;  3NTK A;  3OWF A;  2ZJR A;  5AJ3 L;  1XWE A;  2YU9 H;  2PCF B;  5IE8 A;  1TXY A;  2LKV A;  2LXJ A;  1SJE D;  4JI3 Q;  1M8A A;  5J1Z A;  2F3W A;  1IYJ B;  1LTR D;  1DM0 B;  1JCK B;  2JEB I;  3CQZ B;  1E7Z A;  3MTS A;  3CCL A;  4HIK A;  4AYB G;  4BA1 I;  3T16 A;  2F52 A;  2WAQ G;  5LMN W;  4A3L H;  1JWM D;  3EVQ A;  3KOJ A;  4DR6 L;  2NVQ H;  4F8M A;  5FJ8 H;  1CK1 A;  1WCM H;  5ISR A;  2AQ3 B;  3BVG A;  3CCJ A;  4KKU A;  1JE4 A;  3PO3 G;  2ZTE A;  5C3W A;  3H0G B;  3W2D A;  2GVA A;  1CTM A;  2B2T C;  2JA8 G;  3QR8 A;  1Y1W G;  2KEC A;  1C9O A;  2F0I A;  5D14 A;  3QG1 A;  4L5R C;  3KF8 A;  4DKA C;  3VR6 A;  1FJG L;  2EJF C;  3NXW A;  4B3M L;  2CQA A;  4R8N A;  2EDG A;  4ILW A;  3ULP A;  2EYO A;  3FVQ A;  3PUY A;  4KKT A;  4GLX A;  5KGU A;  2ZT9 C;  1MBY A;  3CAM A;  2NTS A;  2K33 A;  1PRT F;  5IGB A;  1EWI A;  2L15 A;  5T1G A;  4IUU A;  4RHS A;  3V2T A;  4L8J A;  2G9D A;  2HDM A;  5IWA L;  3FPP A;  3KDF B;  4QY7 A;  1D5Z C;  1JWS D;  2BA0 A;  3A8J E;  5ELB A;  2R7Z B;  1EU3 A;  1EIF A;  3NWT A;  1Q82 C;  3CP0 A;  4R4C A;  3IRB A;  2F4V Q;  5M3F G;  2E2J B;  1QNU A;  1PH4 A;  1EIH A;  3E9H A;  5JAV A;  1S5E D;  4DV6 L;  4ZKB B;  2UXC L;  3GTP B;  2D5D A;  4LUZ A;  2NN6 I;  1WYD A;  2BCO A;  1PTO F;  2OCE A;  5BN4 A;  3S1Q H;  5IYD G;  2ZM6 Q;  3GTJ H;  1BF4 A;  1PMR A;  3S14 B;  2N55 A;  1WTW A;  1VF5 C;  1IZ6 A;  3J81 E;  3H15 A;  1C4Q A;  4APV A;  1Q1B A;  1TWF B;  3FRP B;  4M8A A;  4TQU S;  4A3D G;  2ZXO A;  1ILP A;  4JI1 Q;  4LFB L;  4IOA A;  2F4I A;  4XDX A;  1SMY D;  2PNR C;  4UPA A;  5HGT A;  2EYP A;  4DR6 Q;  4BY7 G;  2IHE A;  1BCP B;  3Q22 A;  2NVX B;  4Q0F A;  3TRE A;  1IBK L;  2A6H C;  2F0T A;  3K8A A;  1TWF H;  1UWV A;  1L1O B;  3DWP A;  4R8I A;  2EPB A;  1F77 A;  3OIQ A;  1LUZ A;  2ZTD A;  4CJ1 B;  1PH1 A;  5DNF A;  3GTO B;  1CT1 D;  4H13 C;  4GZY C;  2CWP A;  1NNX A;  3EIV A;  4PMW A;  1IL8 A;  5FLM H;  4A75 A;  2IX0 A;  1K0R A;  2H4O A;  5M3M G;  1D8L A;  2L9H A;  4CDD C;  3IKJ A;  4JI2 Q;  4AH6 A;  2PQE A;  3PUW A;  2EJG C;  3QO2 A;  1PFN A;  3KFU A;  1FR3 A;  3SXH A;  1E2Z A;  2VQF L;  4A93 B;  3BYT B;  5KIX A;  2A19 A;  4DR5 Q;  1PZK D;  4C3J B;  1MIU A;  4QL5 A;  1EQT A;  4LFA Q;  1IW7 C;  3SK8 A;  3GO5 A;  4A3J G;  4GOP C;  3KF6 A;  5CYU A;  4JK1 C;  3V05 A;  2K14 A;  5C4H A;  3KUP A;  1TWA B;  2KHS A;  2VQF Q;  3BZK A;  2XVS A;  5C6A A;  1YZ6 A;  4YWK A;  1KAW A;  4CDE C;  2A8V A;  1MJC A;  1FJG Q;  3T1H Q;  2RDH A;  3SK4 A;  2XGT A;  1STG A;  1K73 C;  3I91 A;  4FYD A;  1TY0 A;  2E2D C;  2JA6 G;  2FHT A;  5CV9 A;  3GTQ B;  1U4L A;  4HID A;  3E0J A;  3RZO H;  1ZYR D;  3GQB A;  2MFI A;  1HHV A;  1SN8 A;  2NZ1 D;  4LUV A;  4Y7N H;  1QB5 D;  1Y1W H;  4EVO A;  1B7Y B;  3PUX A;  3VYR A;  5IOC A;  5LMN Q;  4DV7 L;  1GUT A;  1LT4 D;  2Z8L A;  1C8C A;  1VDZ A;  3IAY A;  2Q2U A;  3T51 B;  4DV7 Q;  1SFO H;  2RCF A;  5D3D A;  3C46 A;  4HCE A;  4PV1 C;  3GTQ H;  4A3C H;  4JYA L;  1VQG A;  3P1H A;  1VQ5 A;  1RTO A;  3U4V A;  2R92 H;  3R8B A;  3K6O A;  2YYZ A;  4DR7 L;  3KLS X;  1Y69 U;  2K5Q A;  4KHP Q;  1F9P A;  1H9J A;  1HNZ Q;  2Z6K A;  2UXD L;  1SNQ A;  2WB1 E;  5EKK A;  4WJ3 M;  2BOS A;  4F88 A;  2WFW A;  2QDB A;  3GV6 A;  1PDQ A;  3WOF A;  1PA6 A;  4KI0 A;  5GAE C;  4RKB A;  2K05 A;  4Z9C B;  2GA4 B;  2I5H A;  3HOV G;  3S16 B;  5EJW A;  1B9M A;  1EQQ A;  3JAM c;  2DY7 A;  2K7V A;  1KLG D;  1CZG A;  1QOH A;  2JQO A;  1SXT A;  4MN3 A;  4YCW A;  3T4A C;  2A68 D;  4UP9 A;  4K8J A;  4BBS H;  1T5E A;  1SSO A;  4RFB A;  4R4T A;  2RKS A;  4JI5 L;  5IP9 H;  4HMJ A;  1BUV T;  2D9U A;  1S5B D;  3R2T A;  1MSH A;  3DWA A;  5CV5 A;  4IUP A;  1R9T B;  1SNO A;  1VQJ A;  4DR5 L;  5CV8 A;  1SMX A;  4LK1 C;  1KIX A;  1N9W A;  3P7J A;  5IY0 A;  2UXB Q;  3KF8 B;  2C9O A;  1XPU A;  2E2I B;  3S17 H;  4B3T L;  3AYH B;  1SE3 A;  2OTJ A;  1SND A;  1YNN D;  3Q0A A;  5C0X J;  1SLJ A;  5I2Y A;  1WTH A;  3E0E A;  2UXB L;  2BE5 C;  4C2M H;  1XYI A;  3ONA B;  3HOY B;  2RVL A;  2E5L L;  1Q46 A;  4X3T A;  4KMU C;  2VB3 X;  1LTB D;  3DEP A;  4AQY L;  1TWG B;  3I8Z A;  1WD1 A;  4LF6 Q;  2IHF A;  4DR4 L;  5E4X A;  4IFD G;  1HTL D;  2K5H A;  3T53 B;  3BZC A;  2Q2T A;  2KVM A;  3I73 A;  3OWE B;  3ER0 A;  3FHW A;  5C5L A;  3DMU A;  3IFT A;  2YTY A;  1PTO C;  3CC7 A;  4H44 C;  4A3D H;  5CGK A;  5M9O A;  1NJI C;  2M00 A;  1DCZ A;  1LTL A;  2OF1 A;  3A8I E;  1MSG A;  3VDY A;  3GTK H;  4GOP A;  5KNB A;  3CRK C;  3NEM A;  3K57 A;  1XTC D;  1KRS A;  4X64 L;  2BA1 A;  4DNR B;  3KJO A;  3NTI A;  5E7N A;  3S1M H;  4CKE A;  4NXM Q;  4HJ8 A;  1Q8I A;  4ZK9 B;  2JN4 A;  2KHI A;  4R9W A;  2K75 A;  2KOL A;  3T1Y L;  3D31 A;  1YHQ A;  3V96 A;  1W2B A;  2IY5 B;  4FF2 A;  2WV6 D;  3HOY G;  4DV0 L;  3OMC A;  4H7B A;  1SE4 A;  5C3E B;  1AN8 A;  5EPK A;  3F2B A;  3RNU A;  4KY6 A;  4JI7 Q;  1B4O A;  5JJL A;  1SR3 A;  1PYW D;  1ESF A;  2DJG C;  2EJM A;  2R6G A;  3J80 i;  1CZW A;  4UDU C;  1G6Z A;  1N34 L;  3OHX C;  4DV3 L;  3I72 A;  4GLV B;  2MO1 A;  3D6C A;  4DV4 Q;  4KHZ A;  2G9H D;  3MC0 B;  2UUB Q;  5FK9 C;  1NBW A;  5E3F A;  4RHR A;  1HR0 Q;  2CVR A;  5ELC A;  3U4Z A;  1T9H A;  1EEF D;  3HFZ B;  2FIN B;  5M5W H;  1PTO H;  4JC0 A;  1E24 A;  2N78 A;  3J81 c;  2KBN A;  1BDO A;  4BBR G;  1VQ4 A;  1WJJ A;  1KNE A;  1IBL L;  1YJN A;  1STN A;  4UAI A;  2R7Z G;  2WKC A;  3KJP A;  3GV3 A;  5IYC G;  1EYC A;  3A7A B;  3CU7 A;  3S16 H;  5M3M H;  4X3S A;  3RZD H;  4LAA A;  4C3H G;  2XN9 C;  4XQJ A;  1QWY A;  2R93 G;  3OSO A;  4A3B H;  1VQN A;  4ABN A;  1WTV A;  4DV4 L;  4NKL A;  4IO9 A;  5IYC H;  4DV3 Q;  2L11 A;  4A93 G;  2F0K A;  2R93 B;  4X3K A;  3G71 A;  5CBE E;  3L3O C;  1KNA A;  4YHH Q;  1I94 Q;  4RWS C;  2ES2 A;  5JVG 3;  2DGY A;  2WIN B;  3VYT A;  2O5I C;  4DV2 Q;  1SAP A;  4GNX B;  4LMQ D;  4FNF A;  1BBU A;  1HNW Q;  1VQD A;  2A73 B;  2HDL A;  2LXK A;  5K5P A;  3AMU A;  2F0F A;  3AU7 A;  3A74 A;  2KHJ A;  1PRT D;  1BOS A;  4WFN 3;  2SOB A;  1PH3 A;  3G6J B;  1ET9 A;  1SYD A;  3B6Y A;  4L5Q A;  1I4P A;  1D7Q A;  1VS0 A;  2ZTC A;  1WD0 A;  4LF8 Q;  2CQO A;  3D3R A;  1L0X B;  2O4X A;  1Z9F A;  4ZKC B;  1PVO A;  1J5E Q;  1UE5 A;  1PH9 A;  5IP9 G;  3I4M B;  2K04 A;  2B2U A;  1GVP A;  2UU9 Q;  1NCV A;  4EQP A;  2PNH A;  3J7A F;  5M5X B;  1Y1V H;  2JA7 B;  5LMN L;  2F03 A;  1FYC A;  3CD6 A;  1GUW A;  1X65 A;  2E74 C;  3A54 A;  3WDN A;  4BY1 B;  1RJT A;  5I9P A;  3GTK B;  1DOK A;  2A6E C;  4LFC L;  4ZLT F;  1TQO A;  2WP8 J;  1TVX A;  1B44 D;  1FGB D;  2ENB A;  2PZT A;  5IYB H;  1EY5 A;  1UE1 A;  3RZD B;  2MO0 A;  3C2P A;  1B3Q A;  1V1Q A;  3HKS A;  2UUC L;  1HH2 P;  4FF3 A;  3FKI H;  2Z6B A;  1ONL A;  4HAE A;  1J6Q A;  4IFD I;  2EIF A;  4R4I A;  4JW0 A;  4C3H H;  4AYB E;  4DV6 Q;  4R4Q A;  1BNZ A;  3L2P A;  3H94 A;  1WTP A;  1JC7 A;  1TR5 A;  1KDB A;  2WAQ E;  2WB1 B;  2K4K A;  2VUM H;  5JJZ A;  1IYV A;  1O78 A;  4V19 0;  1I6H B;  2HUG A;  4LF7 Q;  2ID0 A;  3S2D H;  3M4O H;  2DY8 A;  5EKI A;  5KND A;  1WCM G;  1VQ6 A;  4RGO S;  4JBK A;  3LX0 A;  1I4R A;  4LJZ C;  1I4Q A;  4DAY B;  3J7Y W;  3S15 H;  4K8I A;  2F0D A;  2CH4 W;  1N33 L;  1D6E C;  4G57 A;  2GVB A;  1SYE A;  3RN2 A;  3MZ5 A;  4F7X A;  3OPO A;  3F2U A;  4JI0 L;  2K03 A;  1E22 A;  1KLU D;  1QCB D;  4O2D A;  3OW2 A;  1DXM A;  4MTK A;  3K5N A;  2CHB D;  4IPC A;  5M5X H;  2MHV A;  3I4M G;  3OYY A;  1PH6 A;  4ZCK A;  1V43 A;  2K5V A;  4S3S A;  3GTP H;  2K5D A;  4BA2 I;  1YNJ C;  5C4J H;  1I3Q B;  1S4Z A;  4XIG S;  1ROD A;  4ID6 A;  5ELF A;  2LY7 A;  1FL0 A;  1GUS A;  4JI8 L;  4LF5 L;  3HOW H;  1JJ2 A;  4KJO A;  1IXR A;  1DON A;  2BH8 A;  4B9W A;  2JEA I;  3BJU A;  2Q2I A;  1VQC A;  3U9O A;  3IL8 A;  3NWS A;  1JJG A;  1HNX L;  1DGS A;  5GQO A;  5J39 A;  1J8I A;  4ULL A;  2Z1C A;  4QCL A;  2EYJ A;  3MAQ A;  2A69 D;  4P2C B;  1RD9 D;  4EX5 A;  2Q2H A;  3QIA A;  1P8L A;  3K7U C;  4DAP A;  4JI3 L;  4C3J H;  1XTD A;  3UDX A;  3N6R A;  1D1I A;  4EQ5 A;  5NUC A;  2WKD A;  1S5F D;  4OO1 G;  3X3N A;  5CR3 A;  2VUM B;  1Q12 A;  1K28 A;  3G6E A;  4OX9 Q;  1II3 A;  3SEB A;  3CQZ H;  5M3M B;  2RBM A;  3NK9 A;  2AWN A;  3M7N A;  1ZYR C;  3PGZ A;  1CA6 A;  4XT3 B;  1HNW L;  3LWE A;  4GNX C;  4L5S A;  1GXD C;  2JSO A;  1TS3 A;  4FXD A;  1BR9 A;  1I4G A;  1F2Y A;  5CV4 A;  1YI2 A;  2EZV A;  3J80 L;  2L5T A;  2JA7 H;  2N8N A;  2NVQ B;  1GJX A;  4K6D A;  4PZ6 A;  3S1N B;  1G2T A;  1LT3 D;  3ITP A;  2MNA A;  1LT5 D;  4LFA L;  4KKS A;  1PLF A;  1FD7 D;  1AE2 A;  1FGU A;  1OXT A;  1STA A;  2N88 A;  4GKK Q;  1WTO A;  5CC4 A;  4N8X 1;  5I6Y A;  1Q3L A;  3EA6 A;  3MWY W;  4BWG B;  2NVT B;  5A35 A;  1EFI D;  2KEN A;  2QW7 A;  3RLF A;  1UAP A;  1OTC A;  2A68 C;  4LUO A;  1EY9 A;  4NXN L;  3FEW X;  4ZYS A;  4BBS G;  2HIV A;  2IWH A;  3L7Z C;  1SNC A;  4HN7 A;  3PIO 3;  4A3F H;  2MJ8 A;  4O0A A;  3TZU A;  4DUY Q;  2UXD Q;  3A56 A;  1I6H H;  1Q81 C;  2B63 G;  1TS4 A;  2C35 B;  4DK1 A;  1I5F A;  3CPW A;  2BH2 A;  3G7L A;  1N36 L;  1YNN C;  4OON A;  3R93 A;  4OEL B;  4KK7 A;  1EZ6 A;  3J7Z C;  3W1G A;  3IFD A;  5E1F A;  3GP7 A;  3HOX B;  2MUY A;  4A3I G;  2R93 H;  4GNX A;  3HOV B;  3J81 j;  2NVY B;  4JV5 L;  2XRQ D;  1BCP F;  1G6P A;  4C3I B;  1DYQ A;  1O7I A;  2VW9 A;  2E8G A;  4K2L A;  2JP1 A;  1PRT B;  2L12 A;  1KRT A;  2VQE L;  3CF5 A;  1EL0 A;  5DAU A;  4HJ9 A;  3T1Y Q;  2B2Y C;  5C4Z A;  4HMI A;  2EY5 A;  1U4P A;  5IP7 H;  1TWH B;  1BBX C;  4DXG A;  5JPN C;  2NVY H;  1PTO D;  3VR3 A;  2F0L A;  4UP7 A;  1NAP A;  3ULL A;  4K5X A;  3F1Z A;  1K9M C;  3VYU A;  5J22 A;  4EGV A;  2NN6 H;  1PTO B;  4JCV E;  1Y8O B;  4V0B A;  5EQ0 A;  2OTL A;  3UE0 A;  2JA5 H;  5AFW A;  1OXX K;  2N49 A;  3TBI B;  4BY7 B;  5JEA G;  1JR0 D;  4GKK L;  3J80 c;  3HRZ C;  2HQE A;  3KDF A;  3W1B A;  3D0F A;  3TEH B;  3TRZ A;  4ME5 A;  1KDC A;  1STY A;  3E5S A;  5H1S E;  4ME3 A;  1EOV A;  2DUD A;  1CKN B;  1YVC A;  3EQL C;  1Z6H A;  2CWA A;  4KY5 A;  4QMG A;  3RLO A;  3HG9 A;  4K0K Q;  3MEH A;  1G29 1;  1WTR A;  1AE3 A;  2SDF A;  1NE3 A;  1XMQ Q;  4DR1 Q;  2AWO A;  4B3M Q;  2CKZ B;  4DNI A;  1LO5 D;  1JQY D;  1B9N A;  1TKW B;  3FKI B;  1X3P A;  2K6A A;  4LF9 Q;  2EY2 A;  4A3E B;  2JXM B;  1R4P B;  3BS1 A;  2E2I H;  1STH A;  1ICW A;  1VQH A;  4DGZ A;  4DK0 A;  4JI5 Q;  4BBR H;  2RHS B;  1AW7 A;  1SBB B;  2Q8I B;  1LAB A;  1A8V A;  2AMC B;  2Q8T A;  1YHB A;  3MEF A;  4O42 A;  1IBK Q;  2HIX A;  1EWH A;  2RCN A;  4FVM A;  5JOB A;  1A6X A;  5CV6 A;  3DXJ C;  4YY3 Q;  1BCP C;  3HS0 C;  3S2D B;  2SEB D;  3M3Y H;  4A3G G;  4JBW A;  3SK6 A;  4DV0 Q;  3CCV A;  1LTT D;  2LS0 1;  4MNO A;  1DOM A;  1EY0 A;  3CKI B;  1F9R A;  5LMU Q;  2NZH A;  1HNZ L;  3CPF A;  5LMU L;  5F2D A;  3CC2 A;  2CCZ A;  4GN3 B;  4A3D B;  2D0P A;  4OIK A;  4A3J B;  1EYA A;  2QDL A;  5EPJ A;  4X62 Q;  4BBS B;  1A3V A;  1GUO A;  2B29 A;  2L1B A;  4HED A;  4HTH A;  4N9P A;  3ULJ A;  3J81 i;  2JA6 B;  3HOU B;  4AYB B;  4BXX G;  2O5J C;  4A3B G;  2RQX A;  1NMF A;  4JOI A;  2KUM A;  1VQF A;  1GOZ A;  1U4M A;  2I5L X;  5EPL A;  1ENC A;  3SE0 A;  3HKZ E;  4A3J H;  3S17 B;  1W3S A;  2JJQ A;  4HR7 B;  4POG A;  3HOU H;  3PO2 H;  1TWC B;  2MP1 A;  2RHQ B;  3RN5 A;  1DD2 A;  4C1N K;  4XTC S;  4IPG A;  3I56 A;  4QUF A;  2ALY B;  1Q7Y C;  5DEH A;  4X6A H;  3R2I A;  4LF9 L;  4G7O C;  1E2V A;  4G4K A;  4A3E H;  2FMC A;  3QOJ A;  1RIP A;  1SYB A;  2M9V A;  3SK5 A;  1K8A C;  4QB4 A;  1DZ1 A;  2PW7 A;  1B70 B;  3VR5 A;  1QUQ B;  1B8A A;  3CME A;  4B3T Q;  3GTM B;  2DJF C;  3E6Z X;  3I7F A;  2PQA A;  4L63 B;  4FO2 A;  2Z4I A;  4IAL A;  3O13 A;  1NSN S;  3HGB A;  1HZC A;  3EN2 A;  2XNA C;  4KY7 A;  1Q90 A;  2R7F A;  1HPC A;  4A3M H;  3RZO B;  4YWM A;  1X3Q A;  3DM3 A;  3I90 A;  3HOX H;  2A74 C;  5C4J B;  2JA8 B;  1VQM A;  3KF6 B;  4X66 L;  1SE8 A;  1C48 A;  2Z9H A;  2QEJ C;  1HR0 W;  3OOC A;  4P71 A;  3CCM A;  5D3I B;  2E2H B;  3P75 A;  1H9S A;  1R4Q B;  1PH8 A;  1YJ9 A;  4X62 L;  4FF4 A;  1S5C D;  1SMY C;  1M4V A;  2NB0 A;  2OEO A;  1PZI D;  1V8Q A;  2JA5 G;  2LFN A;  1G91 A;  5HY6 A;  4JVZ A;  3D8G A;  4KD4 A;  1NMG A;  4YCV A;  4DV5 L;  1F2M A;  3KK7 A;  4HJ7 A;  1NUC A;  3H6M A;  2XIW A;  1G8Z D;  1PH2 A;  3PF4 A;  4DAM A;  1WVL A;  1Z47 A;  4CDF C;  3PO3 B;  1K8O A;  5J3B A;  1L1O C;  4J15 A;  4JV5 Q;  2C5C A;  1E0B A;  4CJ0 B;  5KNC A;  3FDT A;  5IP7 G;  1X6O A;  2N3S A;  3FP9 A;  1S72 A;  4RGM A;  3HOW B;  1QG7 A;  4KTA A;  3BU2 A;  4OWT B;  5EBC A;  1SDF A;  4P73 A;  5HGQ A;  4KD3 A;  5KYI A;  3F8T A;  5CBA E;  1K3B C;  3QB3 A;  2X6G A;  4GLA C;  1WTX A;  1Y14 B;  3H3V C;  2CH4 A;  4A3I H;  2YTV A;  4DNT B;  2PPB C;  5C0X I;  1WTQ A;  3AQQ A;  2R7Z H;  1QUQ A;  1KL9 A;  5ELE A;  2RDF A;  3LGJ A;  3T1H L;  3VR2 A;  1YIJ A;  2RDG A;  1PZJ D;  3OTO Q;  1OXV A;  3NP8 A;  3ND8 A;  4XYQ A;  4NXN Q;  1P16 A;  3A5Z B;  2Z0S A;  1HFN A;  4R1J A;  3JAM L;  4UP8 A;  4CDC C;  1AZP A;  3OW7 A;  2B2W C;  3PIO A;  1KAA A;  2R7D A;  3HOX G;  5LL6 X;  3H0G H;  3T13 A;  3HOZ G;  2F4V L;  3I3C A;  2R3Z A;  3DM1 A;  2F0H A;  4NDX A;  1CKM A;  5BN5 A;  3CXC A;  2EE1 A;  4IOC A;  2EVB A;  4BY7 H;  1RHP A;  5DM7 3;  1UEB A;  2ZJQ A;  1GM5 A;  1AFP A;  1YBY A;  2K52 A;  4CKB A;  2D0O A;  4QGU A;  1S3O A;  2H1E A;  2DNE A;  4TVA B;  1MJE A;  3DLL A;  3OTO L;  3NBI A;  1CHP D;  2QEX A;  2H5X A;  4C2M B;  4B3R Q;  3CCE A;  4C1N I;  4WJW A;  3HOY H;  3SVM A;  4NXM L;  5IT9 E;  1U9R A;  1X56 A;  4K5V A;  1KDA A;  5C44 B;  4A3G H;  4A3F B;  4DR2 L;  1KC8 C;  1VQ8 A;  1L0W A;  2QKI C;  3H3V I;  3PO2 G;  1VQO A;  2ZXP A;  4TSS A;  1SE2 A;  1KTK A;  1PFB A;  2QA4 A;  4J1M A;  2VB2 X;  3PUV A;  2HHH L;  1CHQ D;  2UUA Q;  2EOT A;  1KQS A;  1B3A A;  3Q23 A;  4DR3 L;  5JJI A;  1MD2 D;  1E2W A;  3K7A H;  2B2V A;  1HCZ A;  1IKM A;  4A3G B;  4HIM A;  1S40 A;  3A8K E;  1Z7T A;  3CRL C;  4GN4 B;  4YWL A;  3EJI A;  1HRJ A;  4BXX H;  5C0X H;  3MXU A;  1X3G A;  3PF5 A;  3D6W A;  4C3H B;  1EEI D;  4DR2 Q;  2XSC A;  3HKZ G;  2I07 B;  1HTP A;  3BDO A;  2OT2 A;  4ZAI A;  2D2C C;  1NR4 A;  1PFM A;  1VQI A;  1LTA D;  1FVI A;  2F0O A;  4A3C G;  4X3U A;  5ELO A;  5AJ3 Q;  3FPU B;  4XYO A;  2MPM A;  1H9S B;  1GUG A;  2VZA A;  3CCQ A;  1Y1V G;  2F0W A;  3D4W A;  3I4M H;  2VUM G;  3OIP A;  1CSP A;  2DN8 A;  2JA9 A;  3C1E A;  5C3E H;  1EQR A;  5ELN A;  2DNC A;  2B2U C;  1W6K A;  2JA6 H;  2F3V A;  3I4L A;  2ZXR A;  4A3B B;  2Y0S G;  4RG1 A;  4LF7 L;  4DAY A;  2HT1 A;  3Q24 A;  1X54 A;  1A62 A;  2PI2 A;  2HD3 A;  1SNP A;  1QNK A;  3TP7 A;  5C3X A;  1XNQ Q;  3UDI A;  3R3O A;  4RCN A;  1CI3 M;  5JPM C;  4QUC A;  1TWC H;  5FO9 B;  1TII D;  4PMC A;  3DWQ A;  2E75 C;  4C3J G;  3C1F A;  4O1N A;  2B8F A;  3H91 A;  1HQM C;  3MFG A;  1CUK A;  4OEM B;  1EYD A;  4JPB W;  3SDZ A;  4IPH A;  2WII B;  1QVF A;  5C44 G;  5C4X B;  4I7Z C;  3STB D;  2B3G A;  1MHW C;  2L0C A;  1FNU A;  3J7A V;  4ZQ3 A;  4HJ5 A;  1FNW A;  3ZJY C;  1JMC A;  1BO0 A;  3DEO A;  3I55 A;  1W6J A;  3K0X A;  3TP6 A;  3K5O A;  3LWU A;  1QVG A;  2HCI A;  1TWH H;  3PSI A;  1SJH D;  3WWV A;  4ODG A;  2A69 C;  3NQT A;  2KA7 A;  1MI2 A;  1QJO A;  1Q1E A;  4A3M B;  3FMC A;  4KHV A;  1KHI A;  2TSS A;  5FLX E;  2F3I A;  1Y1V B;  1PXU A;  5FLM G;  2AUK A;  1CFM A;  2X69 A;  1U5K A;  1ENF A;  5E4W C;  3U9S A;  4MHE A;  2SNS A;  3GTG B;  2A1A A;  1HXY D;  5BR8 Q;  4NP5 A;  2VY3 A;  1K3R A;  1M1K C;  2L4N A;  3AFP A;  4P75 A;  1JWU D;  1R9T H;  3S1M B;  2IX1 A;  3TP8 A;  4JI0 Q;  4A3K H;  1SYC A;  1I4X A;  3K7A B;  3N52 A;  4FXG C;  3SHL A;  2QF7 A;  1HZ9 A;  4RA8 A;  1PFS A;  2EYH A;  1N8R C;  5LL6 S;  4A4I A;  4R4O A;  1AEX A;  1QVC A;  2Q8R E;  1QE6 A;  5I2X A;  5KEE A;  3AB9 A;  4JG2 A;  4RGN A;  3PQI A;  3NQI A;  2XWJ B;  5FJ8 G;  4ZUI A;  3UDG A;  1TT2 A;  4ALP A;  3RUZ A;  1GHK A;  1A3T A;  2AUJ D;  5IT9 L;  4KV6 A;  5DLQ E;  2Y0S B;  3M7G A;  3S9W A;  2JA8 H;  2ASB A;  1JOO A;  1A0I A;  1GUN A;  2EY1 A;  1IBL Q;  3S2H H;  4DPG A;  1NR2 A;  1E1T A;  1XPR A;  2FXQ A;  3S1Q B;  4KN4 C;  3URY A;  1YHA A;  1Y8P B;  4RMF A;  3NPP A;  5G3L F;  2E2H H;  4OHJ A;  2F0Q A;  2K50 A;  5JJK A;  1HZB A;  3DUZ A;  3HOV H;  4Y52 H;  2IT1 A;  4CHT B;  4Y7N B;  1U4R A;  4DK3 C;  3S1N H;  4HJA A;  3W5O A;  3S2H B;  2PQA B;  4C3I H;  5IGG A;  1I50 B;  3D4R A;  3MFY A;  3Q8D A;  5CV7 A;  2E76 C;  2R92 G;  5IIF A;  2VXW A;  4FF1 A;  4DR3 Q;  1N32 L;  4ZUJ A;  2UUA L;  5JVH 3;  4X65 L;  3F2D A;  3SGI A;  4OWX B;  3H09 A;  2KQ3 A;  3QWN A;  5FOB B;  2OQK A;  2OXP A;  4CGY B;  4LFB Q;  4GS3 A;  5EBD A;  4A3K B;  2K32 A;  3BZD B;  3M4P A;  1VQ7 A;  3ERO A;  4IPD A;  4LF8 L;  4DV5 Q;  5LHY 1;  3RLN A;  1VQK A;  2XTI A;  4BY1 G;  1JOQ A;  4KJN A;  1DOL A;  1MGS A;  1X9N A;  3M4Y A;  2YV5 A;  4X64 Q;  2ZM6 L;  2K01 A;  1V9P A;  5BR8 L;  3A55 A;  5EAY A;  1K83 H;  4TKO B;  1STB A;  1M90 C;  4PG3 A;  2LMC B;  3E3X A;  1PHJ A;  4OWW B;  5M5W B;  2UXC Q;  1N33 Q;  3G48 A;  1RTN A;  4X65 Q;  4HSP A;  4YY3 L;  3AEV A;  1N32 Q;  2BDN A;  4X66 Q;  3PCO B;  5IGC A;  3A0J A;  1EUJ A;  5G3L D;  1HZA A;  1HQR D;  1CKN A;  4PQX A;  1N36 Q;  4IUV A;  3VA5 A;  2V1C C;  1JOR A;  2WB1 G;  4GKJ Q;  4RKL A;  2E2J H;  4FDB A;  4I65 A;  4P74 A;  1RL2 A;  2KCT A;  3NBH A;  1EIG A;  2WAC A;  1CM9 A;  5COR A;  2EXZ A;  5IT9 c;  2EY6 A;  1B50 A;  3PO2 B;  3E9I A;  1EY7 A;  4G7Z C;  1K8G A;  1YNJ D;  1GO3 E;  5IYB G;  1G2S A;  2O2L D;  3QJY A;  4PMB A;  3CW2 C;  3TS0 A;  3H3V H;  5L37 A;  4LFC Q;  1H9M A;  1PH5 A;  4DN4 M;  5KYL A;  3K5L A;  4IZ8 A;  1L0Y B;  3L9A X;  2MGS A;  2P5Z X;  3GTM H;  1F2L A;  2F0M A;  5C44 H;  4JOI C;  1Y1W B;  3CCS A;  2VNU D;  1PYS B;  2I46 A;  4IUR A;  4YIJ A;  2AKW B;  4RAU C;  4L6T B;  4XT1 B;  3G4S A;  1BVS A;  3PO3 H;  1UUP A;  3NE5 B;  3VR4 A;  4KLK A;  1LLR D;  4K14 A;  4AIM A;  1GD7 A;  1K83 B;  1VMC A;  2YTX A;  4M1U B;  1C7Y A;  4UY8 C;  4QQB X;  4OXP A;  4POF A;  4JI6 Q;  5K36 G;  2F0S A;  1YEZ A;  1F9Q A;  2A6H D;  1EIY B;  4HIO A;  2QIL A;  3F2C A;  1JIC A;  1MKH A;  1LV9 A;  4LW1 A;  1BCP D;  3D4D A;  5IYD H;  5FO7 B;  4A3I B;  4IN3 A;  2VQE Q;  4IUN A;  5IGD A;  4BBR B;  1DJR D;  4J6H A;  5IOD A;  1LTS D;  4DFA A;  1I3Q H;  5JEA H;  5HUR A;  5IGE A;  2HCC A;  4PZ7 A;  4QJF A;  3NHH A;  3X3M A;  5A2Q E;  3U58 A;  1V1P A;  3M9B A;  1BBW A;  1CA5 A;  1AP0 A;  2Y0S E;  3AFQ A;  3NTH A;  1HUM A;  2PZU A;  1LYL A;  4NB3 A;  2YU9 B;  2B2W A;  4JI1 L;  4B9X A;  2KEE A;  4DR4 Q;  2AQ1 B;  4DUZ L;  5GRO A;  1EU4 A;  1VMP A;  4AQY Q;  3NEL A;  4DF7 A;  4F87 A;  2E5L Q;  1A2U A;  1HFG A;  2IJ0 A;  1BQQ T;  1BXT A;  2VL6 A;  3OMG A;  1WOC A;  3ND9 A;  1TWA H;  3WOE A;  1KAB A;  4N8F A;  3HKZ B;  1AZQ A;  1HA6 A;  3Q6S A;  2OQ0 A;  3KBG A;  3K0Y A;  4XXE A;  3EBE A;  1JB3 A;  2B63 H;  3SR1 A;  3CC4 A;  2F0P A;  4J8Q A;  4GN5 A;  3ERS X;  1HR0 L;  2JA5 B;  1RKN A;  1X55 A;  3RMH A;  4JI4 Q;  4LF4 Q;  4GOP B;  1TS5 A;  2GN5 A;  1F2Z A;  3VYS A;  5IGF A;  1HJP A;  1XNR L;  2EXD A;  3HOZ B;  3KLW A;  3TDQ A;  3I4N G;  4KN7 C;  1ICF B;  3K59 A;  1O7Z A;  1QZG A;  2J4X A;  5C5M A;  3I4O A;  3NUC A;  3ZYY X;  2F1M A;  3PIP 3;  4FP5 D;  4LF4 L;  4JBM A;  1CSQ A;  3KYH C;  5GAD C;  2R61 A;  4JI7 L;  3BDL A;  3C3L A;  3GDE A;  1U0L A;  2I5M X;  4A76 A;  2B8G A;  1EY8 A;  4MIU A;  3TZD A;  4TRD A;  3ICE A;  4PZ8 A;  4LNQ A;  5CMD A;  2KCM A;  3P20 A;  4JI2 L;  1A15 A;  3JAM i;  2UUC Q;  3MXG A;  2J0T D;  1UEA B;  1B2T A;  1F9S A;  2PYK A;  1X3E A;  3TP5 A;  2RA4 A;  4KHP L;  3GTG H;  3MXN B;  4MTN A;  4DA2 A;  5C4X H;  2JE6 I;  1OXU A;  2NN6 G;  4CBV A;  4FXK C;  1ILQ A;  1ZEQ X;  2B39 A;  4B3S L;  2WAQ B;  2NYZ D;  3GD7 A;  3PIP A;  2NZO A;  2I0Q A;  2ATW A;  4DAV A;  1E1O A;  2A6E D;  3ERQ A;  4BY1 H;  1HNX Q;  1VF7 A;  1A63 A;  1IL2 A;  4C3I G;  1VQA A;  3GTJ B;  3BYY B;  3A5U A;  1X32 A;  3TS2 A;  3K5M A;  2PMZ B;  3RR5 A;  4H02 A;  1J5E L;  2M2L A;  1B1Z A;  2CW0 C;  1WI5 A;  3BVZ A;  3MVV A;  2IW3 A;  4B3R L;  4DUY L;  3NBH B;  5I6W A;  4JI6 L;  1YJW A;  4IJL A;  3H0G G;  1SYF A;  3GTL H;  2NVX H;  5TSS A;  1UNS A;  3BVM A;  1L2F A;  1XPO A;  4EQO A;  1LM0 A;  4DV2 L;  1TS2 A;  4HSV A;  4OGQ C;  1H9K A;  2SNM A;  3UDF A;  1XJV A;  3LNN A;  3PMF A;  4YHH L;  1D5M C;  4N9T A;  1I94 L;  2KCN A;  3FKI G;  3GTL B;  3I2Z A;  2L55 A;  4IFD J;  3K80 C;  1JB7 A;  4P72 A;  1ENA A;  1SYG A;  3TME A;  4OL7 A;  5IWA Q;  1E3P A;  4U68 A;  1Q86 C;  5T1I A;  1J9O A;  2B63 B;  4A3M G;  3CHB D;  2V4D A;  2BDO A;  3K58 A;  4NPS A;  3PV0 A;  3JAM E;  1K0S A;  1EY4 A;  2B2V C;  1D5X C;  2Z4H A;  2FMM A;  3JC6 6;  1JT8 A;  2VS1 A;  3BDC A;  4XQN A;  4QIW E;  5EKL A;  3CCR A;  1SNM A;  3J7A 5;  1JJC B;  1SFO B;  2HQL A;  4NMZ A;  3M85 A;  2FFK B;  2ICE C;  3CMA A;  1SRO A;  2JA7 G;  2UUB L;  1EOT A;  5ELD A;  2ICI A;  4DXF A;  4QIW B;  1C0A A;  1VQB A;  3NSW A;  1CQV A;  5K36 H;  1LT6 D;  2MQH A;  3M4Q A;  5I9O A; 
#chains in the Genus database with same CATH homology
 4PNY A;  1V1P B;  2QCP X;  3KLS A;  3J80 E;  2XWB B;  4DU9 A;  1O80 A;  4RGT A;  2NTT A;  1IYU A;  4E6I A;  4EQN A;  1A3U A;  1ZXT A;  2F0U A;  3HEJ A;  2KJX A;  2PO4 A;  1K8M A;  1JOK A;  5FLX L;  2PW5 A;  4B08 A;  4K2K A;  2PZW A;  4CJ2 C;  1QIL A;  3T56 B;  2B2Y A;  4ZRZ A;  5A2Q L;  3MXP A;  4NW2 A;  4U67 3;  4Q5V A;  1SEB D;  2X6L A;  5FKA C;  2F0E A;  3BG3 A;  1WCM B;  3MXN A;  4IUQ A;  2JYO A;  4WOR A;  1IHZ A;  1GHJ A;  5DM6 3;  1IKL A;  2K5W A;  1CQF A;  2KED A;  1I6V C;  1LTG D;  2IPK D;  2RSO A;  4OO1 H;  4QF4 A;  5JEA J;  4K6L A;  1ZKO A;  4RCO A;  2NWG A;  1TY2 A;  2IX3 A;  3KBX A;  4H0L C;  4XQQ A;  3HP3 A;  2K1B A;  1VCI A;  1I4H A;  1Y8N B;  2FJ2 A;  4RH6 A;  4K5W A;  1RF2 D;  3I4N B;  5BN3 A;  3M4O B;  1LAC A;  2B2T A;  4OO1 I;  2CW0 D;  1STE A;  1D2B A;  2EYM A;  5C0X G;  2R92 B;  2F0V A;  2A5H A;  1OXS C;  3EFX D;  1FNV A;  2F0J A;  2KCC A;  4C56 C;  4IQZ A;  1ET6 A;  5M5Y B;  1EZ8 A;  1O7Y A;  1A2T A;  4G7H C;  3I70 A;  1PRT C;  3HZX A;  3W3A A;  3RD4 A;  4BS9 A;  3TSS A;  2TMP A;  1EWC A;  1HA5 A;  3J81 L;  1RCV D;  1LTI D;  3A7L A;  1TU2 B;  1ML0 D;  1HUN A;  1EY6 A;  4WRD A;  2BE5 D;  1H9R A;  3S15 B;  2RSN A;  2IL8 A;  5FO8 B;  2XRS D;  2NUC A;  4IFD H;  1IW7 D;  3MHB A;  3S1R B;  1XX8 A;  2D62 A;  1B53 A;  2EYL A;  5KRU A;  3VA7 A;  1S5D D;  5EGT A;  4CKC A;  5M3F B;  1XXG A;  1O7L A;  2J7Z A;  1OO9 B;  1ESR A;  1T5X D;  1D1K A;  3M3Y B;  2NBF A;  5COY A;  3QOL A;  3UI2 A;  3PUZ A;  3KLR A;  2AQ2 B;  2F0N A;  4IUT A;  2F0G A;  1RDP D;  4OIJ A;  2EYF A;  1V1O A;  1EQV A;  3TN2 A;  5D65 A;  5I4D A;  4HCS A;  2K28 A;  3MA2 B;  3DHQ A;  3NTK A;  3OWF A;  1XWE A;  2PCF B;  2LKV A;  1SJE D;  1M8A A;  5J1Z A;  2F3W A;  1LTR D;  1DM0 B;  1JCK B;  2JEB I;  3CQZ B;  3MTS A;  4BA1 I;  3T16 A;  1JWM D;  3EVQ A;  4F8M A;  1CK1 A;  5ISR A;  2AQ3 B;  3BVG A;  4KKU A;  1JE4 A;  5C3W A;  3H0G B;  3W2D A;  1CTM A;  2B2T C;  2KEC A;  2F0I A;  5D14 A;  3QG1 A;  3KF8 A;  3VR6 A;  2EJF C;  3NXW A;  2CQA A;  4R8N A;  2EDG A;  4ILW A;  2EYO A;  3FVQ A;  3PUY A;  4KKT A;  5KGU A;  2ZT9 C;  1MBY A;  2NTS A;  2K33 A;  1PRT F;  5IGB A;  5T1G A;  4IUU A;  4RHS A;  3V2T A;  4L8J A;  2G9D A;  2HDM A;  3FPP A;  1D5Z C;  1JWS D;  2BA0 A;  3A8J E;  5ELB A;  2R7Z B;  1EU3 A;  3NWT A;  2E2J B;  1QNU A;  1EIH A;  5JAV A;  1S5E D;  4ZKB B;  3GTP B;  2D5D A;  2NN6 I;  2BCO A;  1PTO F;  5BN4 A;  1BF4 A;  1PMR A;  3S14 B;  2N55 A;  1WTW A;  1VF5 C;  3J81 E;  1C4Q A;  1Q1B A;  1TWF B;  3FRP B;  4M8A A;  4TQU S;  2ZXO A;  1ILP A;  2F4I A;  4XDX A;  1SMY D;  2PNR C;  5HGT A;  2EYP A;  1BCP B;  3Q22 A;  2NVX B;  4Q0F A;  2A6H C;  2F0T A;  3DWP A;  4R8I A;  2EPB A;  1F77 A;  3OIQ A;  4CJ1 B;  5DNF A;  3GTO B;  1CT1 D;  4H13 C;  4GZY C;  4PMW A;  1IL8 A;  2IX0 A;  2H4O A;  2L9H A;  3IKJ A;  2PQE A;  3PUW A;  2EJG C;  3QO2 A;  1PFN A;  1FR3 A;  3SXH A;  1E2Z A;  4A93 B;  3BYT B;  5KIX A;  1PZK D;  4C3J B;  1EQT A;  1IW7 C;  3SK8 A;  3GO5 A;  5CYU A;  4JK1 C;  3V05 A;  5C4H A;  3KUP A;  1TWA B;  2KHS A;  2XVS A;  5C6A A;  2RDH A;  3SK4 A;  1STG A;  3I91 A;  4FYD A;  1TY0 A;  2E2D C;  2FHT A;  5CV9 A;  3GTQ B;  1U4L A;  3E0J A;  1ZYR D;  3GQB A;  1HHV A;  2NZ1 D;  1QB5 D;  4EVO A;  5IOC A;  3PUX A;  3VYR A;  1GUT A;  1LT4 D;  2Z8L A;  1C8C A;  1VDZ A;  3IAY A;  3T51 B;  5D3D A;  3C46 A;  4HCE A;  4PV1 C;  3P1H A;  1RTO A;  3R8B A;  3K6O A;  2YYZ A;  3KLS X;  1Y69 U;  2K5Q A;  1F9P A;  1H9J A;  1SNQ A;  5EKK A;  2BOS A;  4F88 A;  2QDB A;  3GV6 A;  1PDQ A;  3WOF A;  4KI0 A;  4RKB A;  2K05 A;  4Z9C B;  2GA4 B;  3S16 B;  5EJW A;  1B9M A;  2DY7 A;  2K7V A;  1KLG D;  1CZG A;  1QOH A;  4MN3 A;  1SXT A;  3T4A C;  2A68 D;  4K8J A;  1T5E A;  1SSO A;  4RFB A;  2RKS A;  4HMJ A;  1BUV T;  2D9U A;  1S5B D;  3R2T A;  1MSH A;  3DWA A;  5CV5 A;  4IUP A;  1R9T B;  1SNO A;  5CV8 A;  4LK1 C;  3P7J A;  2C9O A;  2E2I B;  1SE3 A;  1SND A;  1YNN D;  3Q0A A;  5C0X J;  5I2Y A;  2BE5 C;  1XYI A;  3ONA B;  3HOY B;  2RVL A;  4X3T A;  4KMU C;  2VB3 X;  1LTB D;  3DEP A;  1TWG B;  3I8Z A;  1WD1 A;  5E4X A;  4IFD G;  1HTL D;  3T53 B;  2KVM A;  3I73 A;  3OWE B;  5C5L A;  3DMU A;  3IFT A;  1PTO C;  4H44 C;  5CGK A;  5M9O A;  2M00 A;  1DCZ A;  2OF1 A;  3A8I E;  1MSG A;  5KNB A;  3CRK C;  3K57 A;  1XTC D;  2BA1 A;  4DNR B;  3NTI A;  4CKE A;  1Q8I A;  4ZK9 B;  4R9W A;  2KOL A;  3D31 A;  3V96 A;  4FF2 A;  2WV6 D;  3OMC A;  4H7B A;  1SE4 A;  5C3E B;  1AN8 A;  5EPK A;  4KY6 A;  1B4O A;  1PYW D;  1ESF A;  2R6G A;  2EJM A;  1CZW A;  4UDU C;  1G6Z A;  3OHX C;  3I72 A;  3D6C A;  4KHZ A;  2G9H D;  3MC0 B;  5FK9 C;  5E3F A;  4RHR A;  2CVR A;  5ELC A;  1EEF D;  2FIN B;  1PTO H;  1BDO A;  1KNE A;  1STN A;  4UAI A;  2WKC A;  3GV3 A;  1EYC A;  3A7A B;  3CU7 A;  4X3S A;  4LAA A;  4C3H G;  2XN9 C;  4XQJ A;  1QWY A;  3OSO A;  4ABN A;  1WTV A;  4NKL A;  2L11 A;  2R93 B;  2F0K A;  4X3K A;  5CBE E;  3L3O C;  1KNA A;  4RWS C;  5JVG 3;  2WIN B;  3VYT A;  2O5I C;  1SAP A;  4LMQ D;  4FNF A;  2A73 B;  2HDL A;  5K5P A;  3AMU A;  2F0F A;  3AU7 A;  1PRT D;  1BOS A;  4WFN 3;  2SOB A;  3G6J B;  1ET9 A;  1SYD A;  1I4P A;  1WD0 A;  3D3R A;  1L0X B;  2O4X A;  4ZKC B;  3I4M B;  2K04 A;  2B2U A;  1NCV A;  4EQP A;  3J7A F;  5M5X B;  2JA7 B;  2F03 A;  1FYC A;  1GUW A;  2E74 C;  3A54 A;  3WDN A;  4BY1 B;  1RJT A;  5I9P A;  3GTK B;  1DOK A;  2A6E C;  4ZLT F;  1TQO A;  2WP8 J;  1TVX A;  1B44 D;  1FGB D;  2ENB A;  2PZT A;  1EY5 A;  3RZD B;  3C2P A;  4FF3 A;  1ONL A;  4HAE A;  4IFD I;  1BNZ A;  1WTP A;  3H94 A;  1TR5 A;  1JC7 A;  1KDB A;  2WB1 B;  5JJZ A;  1IYV A;  1O78 A;  4V19 0;  1I6H B;  2HUG A;  2ID0 A;  2DY8 A;  5EKI A;  5KND A;  4RGO S;  3LX0 A;  1I4R A;  4LJZ C;  1I4Q A;  3J7Y W;  4K8I A;  2F0D A;  1D6E C;  4G57 A;  1SYE A;  3MZ5 A;  4F7X A;  3OPO A;  3F2U A;  2K03 A;  1KLU D;  1QCB D;  1DXM A;  3K5N A;  2CHB D;  2MHV A;  1V43 A;  4S3S A;  2K5D A;  4BA2 I;  1YNJ C;  1I3Q B;  1S4Z A;  4XIG S;  1ROD A;  4ID6 A;  5ELF A;  2LY7 A;  1GUS A;  4KJO A;  1DON A;  4B9W A;  2JEA I;  3U9O A;  3IL8 A;  3NWS A;  1J8I A;  5J39 A;  4ULL A;  2Z1C A;  4QCL A;  2EYJ A;  3MAQ A;  2A69 D;  4P2C B;  1RD9 D;  3QIA A;  4DAP A;  3N6R A;  1D1I A;  5NUC A;  2WKD A;  1S5F D;  4OO1 G;  3X3N A;  5CR3 A;  2VUM B;  1Q12 A;  1II3 A;  3SEB A;  5M3M B;  2RBM A;  3NK9 A;  2AWN A;  3M7N A;  1ZYR C;  1CA6 A;  4XT3 B;  3LWE A;  1GXD C;  2JSO A;  1TS3 A;  4FXD A;  1BR9 A;  1I4G A;  1F2Y A;  5CV4 A;  2EZV A;  3J80 L;  2L5T A;  2NVQ B;  1GJX A;  4K6D A;  3S1N B;  1G2T A;  1LT3 D;  3ITP A;  1LT5 D;  4KKS A;  1PLF A;  1FD7 D;  1STA A;  1OXT A;  2N88 A;  1WTO A;  5CC4 A;  5I6Y A;  1Q3L A;  3EA6 A;  3MWY W;  4BWG B;  2NVT B;  5A35 A;  1EFI D;  3RLF A;  1UAP A;  2A68 C;  1EY9 A;  3FEW X;  4ZYS A;  2IWH A;  3L7Z C;  1SNC A;  4HN7 A;  3PIO 3;  2MJ8 A;  3TZU A;  3A56 A;  1TS4 A;  4DK1 A;  3G7L A;  1YNN C;  3R93 A;  4KK7 A;  1EZ6 A;  3IFD A;  5E1F A;  3GP7 A;  3HOX B;  2MUY A;  3HOV B;  2NVY B;  2XRQ D;  1BCP F;  4C3I B;  1DYQ A;  4K2L A;  2JP1 A;  1PRT B;  2L12 A;  1EL0 A;  5DAU A;  2B2Y C;  5C4Z A;  4HMI A;  2EY5 A;  1U4P A;  1TWH B;  1BBX C;  4DXG A;  5JPN C;  1PTO D;  3VR3 A;  2F0L A;  1NAP A;  4K5X A;  3VYU A;  5J22 A;  4EGV A;  2NN6 H;  1PTO B;  1Y8O B;  4V0B A;  5EQ0 A;  5AFW A;  1OXX K;  3TBI B;  4BY7 B;  5JEA G;  1JR0 D;  3HRZ C;  2HQE A;  4ME5 A;  1KDC A;  1STY A;  3E5S A;  3EQL C;  1Z6H A;  4KY5 A;  4QMG A;  3HG9 A;  3MEH A;  1G29 1;  1WTR A;  2SDF A;  2AWO A;  1LO5 D;  1JQY D;  1B9N A;  1TKW B;  3FKI B;  1X3P A;  2K6A A;  2EY2 A;  4A3E B;  2JXM B;  3BS1 A;  1R4P B;  1STH A;  1ICW A;  4DGZ A;  4DK0 A;  1AW7 A;  1SBB B;  2Q8I B;  1LAB A;  2Q8T A;  4O42 A;  1EWH A;  4FVM A;  5JOB A;  1A6X A;  5CV6 A;  3DXJ C;  1BCP C;  3HS0 C;  3S2D B;  2SEB D;  4JBW A;  3SK6 A;  1LTT D;  2LS0 1;  1DOM A;  1EY0 A;  3CKI B;  1F9R A;  5F2D A;  4A3D B;  4OIK A;  4A3J B;  1EYA A;  5EPJ A;  4BBS B;  1A3V A;  1GUO A;  2L1B A;  4HED A;  4N9P A;  4HTH A;  3HOU B;  2JA6 B;  2O5J C;  4AYB B;  2RQX A;  2KUM A;  1GOZ A;  1U4M A;  5EPL A;  1ENC A;  3SE0 A;  3S17 B;  4HR7 B;  1TWC B;  2MP1 A;  1DD2 A;  4C1N K;  4XTC S;  4QUF A;  5DEH A;  3R2I A;  4G7O C;  1E2V A;  4G4K A;  2FMC A;  3QOJ A;  1SYB A;  2M9V A;  1DZ1 A;  3SK5 A;  4QB4 A;  2PW7 A;  3VR5 A;  3GTM B;  3E6Z X;  4L63 B;  4FO2 A;  2Z4I A;  4IAL A;  3O13 A;  1NSN S;  3HGB A;  4KY7 A;  2XNA C;  1Q90 A;  1HPC A;  3RZO B;  1X3Q A;  3I90 A;  2A74 C;  5C4J B;  2JA8 B;  1C48 A;  2QEJ C;  3OOC A;  5D3I B;  2E2H B;  3P75 A;  1H9S A;  1R4Q B;  4FF4 A;  1S5C D;  1SMY C;  1M4V A;  2NB0 A;  2OEO A;  1PZI D;  1V8Q A;  2LFN A;  1G91 A;  3D8G A;  4KD4 A;  1F2M A;  3KK7 A;  1NUC A;  3H6M A;  2XIW A;  1G8Z D;  1WVL A;  1Z47 A;  3PO3 B;  1K8O A;  2C5C A;  1E0B A;  4CJ0 B;  5KNC A;  3FDT A;  4RGM A;  3HOW B;  1QG7 A;  4KTA A;  5EBC A;  1SDF A;  4KD3 A;  5KYI A;  5CBA E;  3QB3 A;  2X6G A;  1WTX A;  3H3V C;  4DNT B;  2PPB C;  5C0X I;  1WTQ A;  5ELE A;  2RDF A;  3VR2 A;  2RDG A;  1PZJ D;  1OXV A;  3NP8 A;  3ND8 A;  4XYQ A;  1HFN A;  3JAM L;  1AZP A;  3OW7 A;  2B2W C;  1KAA A;  5LL6 X;  3T13 A;  3I3C A;  2R3Z A;  3DM1 A;  2F0H A;  4NDX A;  5BN5 A;  2EE1 A;  2EVB A;  1RHP A;  5DM7 3;  1AFP A;  4CKB A;  2H1E A;  2DNE A;  3NBI A;  1CHP D;  4C2M B;  4C1N I;  4WJW A;  3SVM A;  5IT9 E;  1U9R A;  4K5V A;  1KDA A;  5C44 B;  4A3F B;  2QKI C;  2ZXP A;  4TSS A;  1SE2 A;  1KTK A;  1PFB A;  4J1M A;  2VB2 X;  3PUV A;  1CHQ D;  2EOT A;  1B3A A;  3Q23 A;  1MD2 D;  1E2W A;  2B2V A;  1HCZ A;  1IKM A;  4A3G B;  3A8K E;  1Z7T A;  3CRL C;  3EJI A;  1HRJ A;  5C0X H;  3MXU A;  3D6W A;  4C3H B;  1EEI D;  2XSC A;  2I07 B;  1HTP A;  3BDO A;  2OT2 A;  4ZAI A;  2D2C C;  1NR4 A;  1PFM A;  1LTA D;  2F0O A;  4X3U A;  3FPU B;  4XYO A;  2MPM A;  1H9S B;  1GUG A;  2F0W A;  3D4W A;  3OIP A;  2DN8 A;  3C1E A;  2DNC A;  2B2U C;  1W6K A;  2F3V A;  3I4L A;  2ZXR A;  4A3B B;  4DAY A;  3Q24 A;  1SNP A;  1QNK A;  3TP7 A;  5C3X A;  3R3O A;  4RCN A;  1CI3 M;  5JPM C;  4QUC A;  5FO9 B;  1TII D;  4PMC A;  3DWQ A;  2E75 C;  4C3J G;  3C1F A;  4O1N A;  2B8F A;  3H91 A;  1HQM C;  3MFG A;  1EYD A;  3SDZ A;  2WII B;  5C4X B;  4I7Z C;  2L0C A;  1FNU A;  3J7A V;  4ZQ3 A;  1FNW A;  1BO0 A;  3DEO A;  1W6J A;  3TP6 A;  3K5O A;  3LWU A;  2HCI A;  1SJH D;  4ODG A;  3NQT A;  2A69 C;  2KA7 A;  1MI2 A;  4A3M B;  1Q1E A;  1QJO A;  3FMC A;  4KHV A;  2TSS A;  5FLX E;  1Y1V B;  1PXU A;  2AUK A;  1CFM A;  2X69 A;  1ENF A;  5E4W C;  3U9S A;  4MHE A;  2SNS A;  3GTG B;  1HXY D;  4NP5 A;  2L4N A;  1JWU D;  3S1M B;  2IX1 A;  3TP8 A;  1SYC A;  1I4X A;  3K7A B;  3N52 A;  4FXG C;  3SHL A;  2QF7 A;  4RA8 A;  2EYH A;  5LL6 S;  1AEX A;  2Q8R E;  1QE6 A;  5I2X A;  5KEE A;  3AB9 A;  4RGN A;  3NQI A;  2XWJ B;  4ZUI A;  1TT2 A;  3RUZ A;  1GHK A;  1A3T A;  2AUJ D;  5IT9 L;  4KV6 A;  2Y0S B;  3M7G A;  3S9W A;  1JOO A;  1GUN A;  2EY1 A;  1NR2 A;  3S1Q B;  4KN4 C;  3URY A;  1Y8P B;  3NPP A;  5G3L F;  4OHJ A;  2F0Q A;  3DUZ A;  2IT1 A;  4CHT B;  4Y7N B;  1U4R A;  3S2H B;  5IGG A;  1I50 B;  3D4R A;  3MFY A;  5CV7 A;  2E76 C;  5IIF A;  2VXW A;  4FF1 A;  4ZUJ A;  5JVH 3;  3H09 A;  2KQ3 A;  3QWN A;  5FOB B;  2OXP A;  4CGY B;  5EBD A;  4A3K B;  2K32 A;  3BZD B;  3ERO A;  5LHY 1;  1JOQ A;  4KJN A;  1DOL A;  1MGS A;  3M4Y A;  2K01 A;  3A55 A;  4TKO B;  1STB A;  2LMC B;  5M5W B;  1RTN A;  4HSP A;  2BDN A;  5IGC A;  5G3L D;  1HQR D;  4PQX A;  4IUV A;  3VA5 A;  1JOR A;  4RKL A;  4I65 A;  3NBH A;  1EIG A;  2WAC A;  1CM9 A;  5COR A;  2EXZ A;  2EY6 A;  1B50 A;  3PO2 B;  1EY7 A;  4G7Z C;  1YNJ D;  1G2S A;  2O2L D;  3QJY A;  4PMB A;  1H9M A;  4DN4 M;  5KYL A;  3K5L A;  4IZ8 A;  1L0Y B;  3L9A X;  2MGS A;  1F2L A;  2F0M A;  1Y1W B;  2VNU D;  2I46 A;  4IUR A;  4YIJ A;  4RAU C;  4L6T B;  4XT1 B;  1UUP A;  3NE5 B;  3VR4 A;  1LLR D;  4K14 A;  1K83 B;  1VMC A;  4M1U B;  5K36 G;  2F0S A;  1F9Q A;  2A6H D;  2QIL A;  1JIC A;  1LV9 A;  1BCP D;  3D4D A;  5FO7 B;  4A3I B;  4IN3 A;  4IUN A;  5IGD A;  4BBR B;  1DJR D;  4J6H A;  5IOD A;  1LTS D;  4DFA A;  5JEA H;  5HUR A;  5IGE A;  2HCC A;  3X3M A;  3NHH A;  5A2Q E;  1V1P A;  1CA5 A;  1AP0 A;  3NTH A;  1HUM A;  2PZU A;  2YU9 B;  2B2W A;  4B9X A;  2KEE A;  2AQ1 B;  1EU4 A;  1VMP A;  4DF7 A;  4F87 A;  1A2U A;  1HFG A;  2IJ0 A;  1BQQ T;  1BXT A;  3OMG A;  3ND9 A;  3WOE A;  1KAB A;  3HKZ B;  1AZQ A;  1HA6 A;  3Q6S A;  3KBG A;  3K0Y A;  4XXE A;  1JB3 A;  3SR1 A;  2F0P A;  4J8Q A;  2JA5 B;  1RKN A;  3RMH A;  1TS5 A;  1F2Z A;  3VYS A;  5IGF A;  3HOZ B;  3TDQ A;  4KN7 C;  3K59 A;  1O7Z A;  2J4X A;  5C5M A;  3NUC A;  3ZYY X;  2F1M A;  3PIP 3;  4FP5 D;  2R61 A;  3BDL A;  3C3L A;  2B8G A;  1EY8 A;  4MIU A;  3TZD A;  4TRD A;  5CMD A;  3P20 A;  1A15 A;  3MXG A;  2J0T D;  1UEA B;  1B2T A;  1F9S A;  2PYK A;  3TP5 A;  2RA4 A;  4DA2 A;  2JE6 I;  1OXU A;  2NN6 G;  4CBV A;  4FXK C;  1ILQ A;  1ZEQ X;  2B39 A;  2WAQ B;  2NYZ D;  3GD7 A;  4DAV A;  2A6E D;  3ERQ A;  1VF7 A;  4C3I G;  3GTJ B;  3BYY B;  1X32 A;  3K5M A;  2PMZ B;  2M2L A;  1B1Z A;  2CW0 C;  3BVZ A;  3MVV A;  2IW3 A;  5I6W A;  1SYF A;  5TSS A;  1UNS A;  3BVM A;  4EQO A;  1TS2 A;  4HSV A;  4OGQ C;  1H9K A;  2SNM A;  3LNN A;  3PMF A;  1D5M C;  4N9T A;  2KCN A;  3GTL B;  4IFD J;  2L55 A;  1ENA A;  1SYG A;  3TME A;  4OL7 A;  4U68 A;  5T1I A;  1J9O A;  2B63 B;  3CHB D;  2V4D A;  2BDO A;  3K58 A;  3PV0 A;  3JAM E;  1EY4 A;  2B2V C;  1D5X C;  2Z4H A;  2FMM A;  3BDC A;  4XQN A;  5EKL A;  1SNM A;  1SFO B;  4NMZ A;  3M85 A;  2FFK B;  2ICE C;  1EOT A;  5ELD A;  2ICI A;  4DXF A;  4QIW B;  3NSW A;  1CQV A;  5K36 H;  1LT6 D;  5I9O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...