1BF4A

Chromosomal dna-binding protein sso7d/d(gcgaacgc) complex
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
63
structure length
63
Chain Sequence
ATVKFKYKGEEKEVDISKIKKVWRVGKMISFTYDEGGGKTGRGAVSEKDAPKELLQMLEKQKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of the hyperthermophile chromosomal protein Sso7d bound to DNA.
pubmed doi rcsb
source organism Sulfolobus acidocaldarius
molecule tags Dna-binding protein/dna
molecule keywords DNA (5'-D(*GP*CP*GP*TP*5IUP*CP*GP*C)-3')
total genus 11
structure length 63
sequence length 63
ec nomenclature
pdb deposition date 1998-05-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1bf4A00
3Q6SA 2KUMA 1HUMA 1AZPA 4IUUA 4IUTA 4HSVA 2KECA 1ILPA 2Q8RE 5CMDA 1HA6A 2B2WC 2JYOA 2RVLA 2DY7A 1LV9A 1O7ZA 3KUPA 1DZ1A 1PFNA 4X3KA 5COYA 2K03A 3LWEA 1PFBA 1PLFA 4X3SA 2HCIA 3N52A 2D9UA 4QUFA 1PFMA 2X6GA 3ONAB 2RSNA 4CJ2C 1B50A 4X3UA 1BNZA 2K28A 2KEDA 1WVLA 2L1BA 3SVMA 3I3CA 4X3TA 1IKMA 3FPUB 1VMPA 5T1GA 2KVMA 1HHVA 1B2TA 4LMQD 1EQTA 1SDFA 1DOLA 1U4LA 2L11A 2H1EA 3GV6A 4XT3B 2MJ8A 5E4WC 2RSOA 4IURA 3H91A 2K01A 4NW2A 3IL8A 2KEEA 2K05A 4RAUC 1CA5A 2HDMA 1J9OA 1O80A 2N88A 1HFGA 4R8IA 2HUGA 1SAPA 4RA8A 4RWSC 1U4MA 2DY8A 1F9QA 3D6WA 1C8CA 2B2WA 1KNEA 1QE6A 2X6LA 1QNKA 1DOKA 1S4ZA 2SDFA 1F2LA 1WTOA 2M2LA 3KBXA 5JJZA 4HCSA 1DOMA 3DM1A 1BBXC 4IUQA 5EJWA 3I91A 2K1BA 1GUWA 2X69A 5CBEE 4CJ0B 1EL0A 1WTVA 1JE4A 1ML0D 2FMMA 3DEPA 4MN3A 1B3AA 2IL8A 5CORA 1IKLA 4CJ1B 4ZLTF 2B2VA 2HDLA 3I90A 1E0BA 1WTXA 2L4NA 1AP0A 2B2UC 5D14A 1G2TA 4DN4M 2MP1A 1ESRA 1U4PA 3TZDA 1VMCA 1SSOA 4UAIA 1ICWA 1X32A 2B2UA 1NR2A 2FFKB 1XYIA 2KOLA 1G2SA 1MGSA 2VXWA 3P7JA 4ZAIA 5T1IA 3F2UA 4IUPA 1NAPA 3HP3A 2Q8TA 1A15A 4ZKCB 1J8IA 4R9WA 5DNFA 1WD1A 1WTWA 2MGSA 1BO0A 1RTOA 2NZ1D 2R3ZA 3I8ZA 4HEDA 4QUCA 2FJ2A 1G91A 1TVXA 5EKIA 2FHTA 4IUVA 1EIGA 1ZXTA 1WTQA 1QG7A 1AZQA 4OIKA 1F9PA 2JP1A 3IFDA 2XIWA 3GV3A 1NCVA 5EPJA 3UI2A 1HRJA 4OIJA 4XT1B 1U4RA 1O7YA 4O42A 4U68A 1WTPA 1X3PA 2EOTA 2J7ZA 1BF4A 1WD0A 1M8AA 2B2YC 2MPMA 5EPLA 5EQ0A 1HFNA 1B53A 1RTNA 2L12A 1WTRA 1ILQA 1CM9A 2B2YA 1MSGA 5CBAE 4ZKBB 2L9HA 1HUNA 5AFWA 3MTSA 2B2TC 3TN2A 3FDTA 2RA4A 1DONA 2FINB 1G6ZA 1F9RA 1PDQA 1KNAA 3R93A 2N55A 2EE1A 1RJTA 1F9SA 2HCCA 2NWGA 2NYZD 1CA6A 3MWYW 4ZK9B 5E4XA 4MHEA 3DEOA 5D65A 1RODA 1RHPA 1EIHA 1B4OA 1XX8A 2K04A 1Q3LA 5EPKA 2EPBA 2CVRA 3G7LA 1NR4A 1IL8A 1X3QA 1MI2A 1MSHA 1JICA 2B2TA 2B2VC 3QO2A 4HAEA 4XDXA 2BDNA 1EOTA
chains in the Genus database with same CATH superfamily
3TSSA 1SYFA 4IUUA 2Q8RE 4E6IA 3F2CA 2QILA 3C46A 2TMPA 5IYDG 1WCMH 3WWVA 1WCMG 4KHPQ 1BCPB 1PA6A 1EY9A 5DAUA 3I4MH 1Y1VH 3HS0C 2PQAB 3UE0A 3OHXC 4YHHL 1NMGA 3LWEA 2G9DA 4QUFA 3EN2A 1STYA 2VQEL 5G3LF 4A3JH 4TRDA 1LT3D 1HXYD 5FLMG 3FMCA 5ELEA 4YWLA 4A3FB 1KHIA 1VQ5A 1XXGA 1QZHA 2XN9C 1KAAA 3GV6A 2MJ8A 1WFQA 2UUCQ 5GROA 3KBGA 3QOJA 1V8QA 4ME5A 3M3YB 2MUYA 3J80L 1XNQQ 2LMCB 2BCOA 1LYLA 1VQCA 1LT4D 5IT9c 4P72A 2N3SA 1A62A 4C2MB 4IUQA 5EJWA 4BBRH 2AWOA 2Z6KA 3F8TA 3S2HB 3D6CA 4C3JH 2HHHL 4JI7Q 2HD3A 3NEMA 4DN4M 3HRZC 1VMCA 4GLAC 1X32A 4QIWB 1I6HB 2A69C 5I6WA 1VQJA 4A3GH 1A0IA 2LS01 3OPOA 2K50A 2JN4A 4JI8L 2YV5A 3CAMA 2F0PA 1SNQA 3NPPA 3I72A 1AW7A 1C9OA 3J81c 1STEA 2DN8A 5FO8B 2K7VA 4L5SA 2JEBI 2JK8A 2R92B 1ET6A 1SE8A 2F0MA 1Y14B 3PUXA 4FF3A 5E1FA 4EQNA 1HZAA 1HNWL 3V2TA 4KI0A 4DV5L 3MTSA 2UUBL 2YTYA 2IX1A 3WOEA 4IN3A 3S15B 1RCVD 5ELDA 3CC4A 4G7HC 2E8GA 1PDQA 1K8OA 2I5LX 4MTNA 4R4OA 3Q0AA 1BCPF 3K5OA 2ID0A 4F88A 3PO3H 2FMCA 1B8AA 1ESFA 4B9XA 1VQIA 1IZ6A 2YU9B 3A7AB 3MFYA 5CMDA 1CT1D 4AH6A 3PO2B 5J22A 3LNNA 3K0XA 3T53B 5KYIA 2JA8H 4BS9A 3OW7A 3D8GA 3HOYB 2JA6G 3KUPA 1IW7C 3FKIH 5FLXc 5JJIA 1AFPA 1TKWB 1CKMA 2K03A 4JVZA 2CQAA 2FXQA 2HCIA 4MNOA 3VYTA 5A35A 2RSNA 4CJ2C 1HTLD 1Q1EA 2DJGC 1T9HA 4KY6A 2IWHA 3G4SA 1YI2A 2JA7G 3SVMA 4HIMA 1TT2A 1IBKL 2KVMA 3L3OC 4LUVA 5C3EH 5IGGA 2F0VA 1PYWD 1EEFD 4ZYSA 2XWJB 4A3BH 4AIMA 4DV1L 5IP9H 2K01A 2TSSA 5IP9G 2EJGC 4DNRB 1UE7A 1QUQB 1RL2A 4A3CH 5M3MG 3A54A 3A8IE 3URYA 2QEJC 1QE6A 2M2LA 1I4HA 1Q1BA 2WINB 3DM1A 5M5XH 4CKEA 5I2YA 2R6GA 3GTMH 1YNND 5G3LD 4JOIA 4HCEA 1JE4A 1LABA 2JSOA 3H6MA 4LF4Q 4F7XA 2IL8A 1G2TA 4O1NA 4DR6L 4A3BB 1GUTA 2MFIA 4Y52H 3CP0A 5M5WB 2K33A 3S9WA 4K8IA 5I9OA 3TS0A 1HA5A 1SE4A 1HQMC 5C44G 1QVGA 3Q22A 3K7UC 2F0KA 4HEDA 3GTQH 2IX3A 2ICEC 3M7NA 5IYBG 2CCZA 4M8AA 1YJ9A 4DAYB 5ISRA 1IW7D 1F9PA 4NXNQ 1SE3A 2D62A 3OTOQ 2I5HA 2KJXA 3HKZE 1DYQA 1EIYB 3CW2C 5CV6A 3NQIA 2F4VL 1SRUA 1YJNA 2F0NA 4WRDA 5C4JH 2KENA 3C2PA 2FINB 2RDFA 2BE5C 4A3KH 3HZXA 1KQSA 3WDNA 2NYZD 5EBDA 1B1ZA 2R7FA 3J7ZC 5CGKA 1KD1C 1YNXA 1EIHA 2B8FA 3GO5A 4DK0A 4R4CA 4C56C 4NXMQ 2K5WA 4IUTA 1VS0A 3FPPA 3W1GA 1J5EL 3S1QB 5C4XG 1X65A 4XXEA 4BBRB 3RN5A 1BCPD 1YHQA 5LMNL 1KAWA 1FGBD 1KXLA 3H0GH 1TWFH 2WAQG 3HKSA 3NHHA 4RMFA 2E2IH 1VQ4A 3KOJA 3SE0A 3PO3G 1BNZA 4H0LC 4LFCQ 3HOUH 2ZJRA 3TP8A 3DHQA 1HPCA 4A3GB 1FJGL 4JI4L 3BYTB 1STBA 1TQOA 1GHKA 5C5LA 2VS1A 3R2TA 4JI6L 1Q86C 3K5LA 2Z1CA 4RAUC 2F3VA 2Z8LA 1F9QA 4A3EH 1E7ZA 1KRSA 2OCEA 4L5RC 1S4ZA 4LUZA 3BU2A 1FNWA 1PH8A 1PZJD 2PZUA 4H02A 3GTPH 3MVVA 3VDYA 1SMXA 3U9SA 3EQLC 4OX9Q 4IO9A 2E2DC 3S1NB 2L5TA 4IPHA 2NVXB 1V1OA 4DV0L 1G6PA 4DV3Q 1L0XB 4QF4A 4K2KA 3OMGA 4WORA 4YCWA 5FLXE 2R3ZA 3HOXG 1PRTD 3D4DA 2IJ0A 1QG7A 2MNAA 1LTAD 4V0BA 4BBSB 3I56A 3S16H 1X3PA 1VF5C 2L55A 3NTIA 1EWIA 3JAMi 2JA5H 3H0GB 3NTKA 1VQBA 4P2CB 4NMZA 5J39A 1PZKD 1Y1WB 4UP9A 3PO3B 1G6ZA 4I7AA 5IP7H 4ODGA 1RODA 2ASBA 4DAMA 2EY2A 3PUVA 3G7LA 4DV6Q 3QO2A 1MI2A 2ALYB 4HSVA 1YITA 1K8MA 1JJGA 3NBHB 5M5XB 1HUMA 4DU9A 3R3OA 1LTTD 1OXXK 2GN5A 1D6EC 1JJCB 2EVBA 3D31A 3KLWA 4A3KB 4J15A 1JR0D 1IBLQ 2A19A 4DV3L 2JA5G 4A93G 3A0JA 2UXCQ 4X66L 1P16A 2XSCA 4U673 2ICIA 4AQYL 1TU2B 4B3TL 2YTXA 3JC66 1YJWA 5JOBA 3U4VA 5IYBH 1CKOA 2OQKA 1QB5D 1LO5D 1JJ2A 1I94L 1SDFA 1SYCA 4A3DG 4DV7L 3DWPA 2LSSA 4RKBA 1X56A 1VQPA 1EWCA 2RSOA 4CKBA 3CMAA 1EY8A 4KKTA 4DV2L 3PGZA 3QR8A 1JE5A 4R8IA 3CMEA 1R4PB 1SAPA 3HOXB 3R8BA 2WB1G 4KMUC 4B08A 1KIXA 3VR2A 2B3GA 1WTOA 4XIGS 2EYOA 5IWAQ 4DR5L 1EYDA 3ND8A 1BBXC 2OWOA 1DOMA 5IYDH 4R4TA 4QY7A 5I6YA 3ICEA 1QVCA 3M3YH 1KTKA 2NB0A 1AP0A 1UWVA 1CQFA 2OXPA 5EGTA 4UAIA 3ULJA 4ZAIA 4H13C 3F2UA 3CCJA 1FGUA 1TWGB 4A3JB 5IY0A 4OO1I 1AEXA 2EIFA 1S5FD 2FHTA 1WTQA 4L6TB 3AU7A 3GP7A 3T13A 5LMUL 4PV1C 3UDXA 4KTAA 4EQPA 2PW5A 4DR1Q 5EQ0A 2YTVA 1G51A 3CC7A 1PYBA 3BYYB 1ILQA 1BXTA 4ZKBB 3GTLB 3CPFA 3BZKA 4UY8C 1SE2A 2JJQA 4BBRG 4N9PA 3H3VI 3DM3A 4M1UB 4R4QA 4DR7L 2Q2IA 3FVQA 5IYCG 2YU9H 4C3HB 4CDCC 3RR5A 4L5QA 4ZK9B 5D65A 5EAYA 2F0JA 4TKOB 3CD6A 4JBWA 3LWUA 2BDNA 4OONA 3BVZA 3GTPB 1DGSA 4FXDA 1U5KA 1X54A 1XPUA 3H94A 4GNXA 2UUCL 3V05A 3KF8B 3K59A 3IRBA 4BXXH 1DXMA 2MO1A 4DUYL 5COYA 1F2MA 3RLOA 3HOYG 4RFBA 1A6XA 3I73A 4KLKA 5BN5A 4ME3A 2D9UA 2A5HA 3SGIA 2VZAA 3HFZB 3KJOA 2R92H 4KD3A 3CRKC 4HMIA 2L1BA 4BY1G 3G71A 1C48A 4A3IG 2A74C 3EA6A 5JEAH 2Z6BA 4IOCA 3GTGH 2PYKA 3ITPA 4ZRZA 1TS2A 2N8NA 1EEID 4Q5VA 3BJUA 2JA7B 2VQFL 1HR0W 3I4MB 2Q2HA 3E9IA 2D2CC 1SNCA 2B2WA 3E5SA 5IP7G 1K83H 1JB7A 4DGZA 3M9BA 4BWGB 1WJJA 2AQ1B 1WTVA 3PIO3 2Z9HA 2IX0A 5C0XH 4GKJQ 1ML0D 4MN3A 4R1JA 4BY1H 3G6JB 2PZTA 4BY7H 4CJ1B 1IKLA 4ZLTF 1J5EQ 3OYYA 1XPRA 2A68C 1KLUD 3NSWA 1SSOA 1NJIC 1XYIA 1G2SA 2E75C 3D4RA 2Q8TA 3D0FA 1N33L 1OXUA 1AH9A 2XNAC 4QUCA 3KF6B 4XTCS 1BUVT 1L2FA 2F3IA 3M7GA 5M3MH 3D3RA 5J1ZA 2AMCB 3I2ZA 4CHTB 3TREA 3TMEA 2PCFB 4L5TA 5M5YH 5C0XG 3JAML 1VQAA 4IALA 1HFNA 4YCVA 2K6AA 2D0OA 3S1RH 4QCLA 4BA1I 3DXJC 1RKNA 4YY3Q 3CHBD 1PV4A 4RGOS 3J81j 4A3MG 4K5VA 3KLSA 4YWMA 1B9NA 3HOVG 1GUGA 1XX8A 4LF9L 4OX9L 2B2TA 2A6HC 3Q6SA 4Q0FA 1PH9A 2KHJA 1HNXL 3BVMA 5HURA 1HQRD 2G5DA 3K81C 3X3MA 3QJYA 3TRZA 3BG3A 3HOZG 5CV5A 4UHVA 1VQEA 5KYLA 2F0EA 1PFMA 2ZTEA 3ONAB 2ZXPA 4A3DH 2VB3X 4KY5A 4LFAL 5C4XB 4OWWB 4X62Q 2CQOA 3BVGA 3FEWX 3RZOB 1XMQQ 4B3RL 4NXML 4HR7B 2LKVA 2VUMG 4DV4L 2QDLA 1PFSA 4DR6Q 1TXYA 2HQEA 3GTOB 4DAPA 3J80i 3T16A 1W3SA 1OXTA 2HUGA 3TQYA 4X65L 2X6LA 2SNSA 1K83B 1KDAA 1T5XD 1HZBA 3I91A 3PIOA 4CJ0B 3KF6A 1STHA 4OWTB 5IT9L 3OTOL 4FF2A 2OT2A 1NBWA 3NP8A 5C4ZA 2HDLA 1K8GA 4JBJA 1NUCA 2VNUD 1D8LA 1Q90A 1NR2A 3A74A 4DUZQ 3CRLC 5T1IA 3E3XA 4BXXG 5LMNQ 4AQYQ 2B29A 4WJWA 2M00A 4NKLA 2EYJA 5EBCA 5FO9B 3H3VC 3BDLA 4HJ5A 4K8JA 4LFAQ 1CTMA 1UE1A 2JP1A 4PG3A 2XWBB 3GV3A 3IFDA 1B44D 1Y8NB 1HRJA 5J3BA 5LMNW 1MBYA 1TR5A 3QOLA 1CZWA 2SNMA 1I5FA 2UXDL 4DV7Q 4EVOA 1N8RC 2F0OA 1BR9A 3AMUA 4XQQA 2B2TC 2VB2X 2YYZA 3FDTA 1Q82C 1F9RA 1YVCA 5BR8L 4P74A 1CA6A 1F9SA 2NWGA 2WKCA 5CV9A 4LFCL 4CDEC 2ATWA 2KCNA 3VR5A 5DEHA 4GOPB 5JJLA 4BY1B 1E1TA 4GLXA 1D1KA 1KC8C 4HAEA 2B2VC 1HJPA 2NVXH 4FF4A 1DJRD 4LF7L 1YHAA 1HA6A 1L0YB 5A2QE 3HOWH 3HOXH 2ZXRA 2A1AA 2JA7H 2HT1A 2R93G 3IKJA 4A93B 1PLFA 3S14B 3SDZA 3PUYA 4JI5L 1GUSA 1X9NA 1D2BA 2A69D 3D4WA 5LMUQ 4KK7A 2A73B 3I3CA 2K52A 3PCOB 4PNYA 2AQ3B 1M90C 1EQVA 4GN5A 2UXDQ 2R61A 4IURA 4JI1L 4FF1A 1N36Q 3MXPA 2UUBQ 2LY7A 2PW7A 4NPSA 2F0SA 4I7ZC 1CUKA 3HOWG 2UUAQ 3HKZB 3KFUA 2L15A 2KQ3A 4JV5L 3CCQA 2R7ZB 4BY7B 3ULLA 1B9MA 3A7LA 3T1YL 4HMJA 5FOBB 4CGYB 2F3WA 2X69A 4EGVA 2B8GA 3UDIA 1N32Q 3I4OA 3K8AA 1TWAH 2M9VA 4V190 1CI3M 1PTOH 2NVQB 1SXTA 1LTSD 1IBLL 4DR2Q 2JA6B 1Y1VG 2IHEA 4JI3Q 1WD1A 1FL0A 1QWYA 1S72A 3OIPA 3DWAA 4A3JG 3S17B 1I4RA 3PV0A 1BBWA 3GTKB 4IFDJ 2Y0SB 4S3SA 2CWPA 4KHZA 1U4RA 3I55A 5I4DA 1Y8PB 3KDFB 1OXVA 2KCCA 1Z6HA 4C3IG 4A76A 2PZWA 3FHWA 5M3MB 4PMWA 4DV2Q 3OWFA 3FP9A 1FNVA 1B7YB 2UUAL 2K14A 3R93A 2N55A 2NVQH 4JV5Q 3MA2B 3UDGA 3S2DH 4DNTB 5HGQA 3KDFA 2A6ED 2NVYB 4IPCA 5IYCH 5E7NA 4RCOA 1NE3A 3H0GG 1A3TA 1AZPA 1E2VA 2KECA 5IE8A 3GTJH 4C3HG 4L63B 1R9TH 4LF6L 4GNXC 1O7ZA 1EY0A 1DZ1A 3CQZH 2I46A 2UU9Q 4X3UA 3P75A 2DNEA 4FXGC 2KHIA 1V1PA 3U4ZA 3FKIG 3FPUB 5FJ8G 1U4LA 4JYAL 1K73C 1IYUA 3ND9A 2JXMB 2XVSA 3AFQA 5IT9E 4ZUJA 1EY5A 2NZHA 5EKKA 3OSOA 5ELCA 1H9RA 4DUYQ 5C3XA 4G7OC 4JI8Q 4KN7C 1E2WA 1K3BC 2KA7A 1QOHA 2GVBA 1F2LA 4FNFA 3Q8DA 2LXKA 2HIXA 3L0OA 3PIP3 5C6AA 4DK3C 2NN6I 3M4YA 4LF5Q 1IBKQ 3KJPA 1E22A 3CCSA 2DNCA 4KN4C 4QB4A 1B3AA 5CORA 4FXKC 4C3IB 5D3DA 3GTOH 2EXDA 3TDQA 5FLXL 1EOVA 3KF8A 1IYVA 3GQBA 1B3QA 1ZYRC 4POFA 5C4JB 1EY7A 3PUZA 4DK1A 2NTSA 5IOCA 2RDGA 1RTOA 3A8KE 4HSPA 3SR1A 1TY0A 2UU9L 2NUCA 4IUVA 1EIGA 3S15H 1O7IA 2NN6G 5GAGC 1NNXA 1H95A 4K2LA 4RH6A 1G8ZD 2MPMA 5EPLA 2CW0D 1TY2A 1WTRA 1GM5A 4GOPA 4JBKA 1ENAA 2KBNA 4Y7NH 4N9TA 1WI5A 4DXGA 2Q2UA 3NE5B 5KEEA 4MZ9A 3M4OH 1RF2D 2P5ZX 3S1MB 1PTOD 4RCNA 1A63A 3AQQA 2NN6H 3HOVB 5CV4A 5M3FH 1UNSA 1TS4A 4JK1C 4A3MH 1P8LA 1K3RA 1V1PB 1I4GA 1ASZA 1GOZA 1TWAB 5IGEA 2J4XA 4DUZL 2DY7A 5M5YB 1UEBA 1C4QA 4YY3L 1I3QH 5C44H 3L7ZC 5JAVA 1VQLA 1SNMA 1SEBD 2ZTCA 3T1HL 1B50A 1D7QA 3PQIA 2KEDA 1A2TA 2E2JH 1WVLA 4BBSG 5JEAJ 1K9MC 3AB9A 1B2TA 3S17H 3NBHA 4YWKA 3W1BA 4JC0A 1E1OA 2AUKA 2PNHA 2VUMB 4A3FH 4JOIC 2WP8J 4C3IH 3A5UA 5ELFA 1CHPD 1EIFA 2EYFA 4Z9CB 3SK8A 4RA8A 3O13A 2Z0SA 1C8CA 1KNEA 5KNDA 1QNKA 1SYGA 1U9RA 2SDFA 3NXWA 3KBXA 3STBC 4TQUS 1CZGA 4X62L 2Y0SG 3QG1A 2FMMA 2I5MX 3P1HA 4HJ9A 2KCTA 4DFAA 5FLMH 1K28A 2B63G 4JI6Q 3CCLA 2VW9A 3MEHA 1SNDA 3M4OB 3SK5A 2N49A 2Z4HA 1CHQD 1MHWC 4JI2Q 1EYAA 4JI5Q 1VQ7A 4J6HA 1TS5A 1XMOL 1I50H 2A8VA 4KV6A 1TVXA 4DR4L 3CCRA 1PH4A 1JWSD 1AZQA 3SXHA 3KLRA 4ZCKA 4AYBG 1NCVA 2PMZB 2K5NA 2Z4IA 1XTCD 3CQZB 1SYDA 1YNJC 3J81L 3HOYH 3QB3A 4KD4A 3LGJA 3E0JA 4A3DB 1M8AA 1B53A 1QUQA 2QW7A 4C3JG 1SR3A 1N36L 1PHJA 3MFGA 3TBIB 3R2IA 2JQOA 2PI2A 1EU3A 3K80C 3H15A 3L9AX 4UP7A 5IWAL 2NBFA 3OMCA 3I4NG 5H1SE 2QA4A 1RHPA 4ILWA 1GJXA 1GHJA 1B4OA 3F2BA 1XMQL 3J7AV 4LFBQ 1E3PA 3BZCA 4R9WA 4X3SA 1KDBA 4JBMA 1M4VA 3I4LA 1PTOB 1ILPA 3TP6A 1RIPA 2K5VA 1EYGA 1N34L 1PH5A 1YNJD 4JI3L 5CC4A 1PFBA 3RD4A 3N52A 4PMCA 3K7AB 5TSSA 2EY5A 4HTHA 4R4IA 2WFWA 1KL9A 2ES2A 4ID6A 3I4NH 5DM63 2F0WA 4K0KQ 3GTQB 1I6HH 1BVSA 1UE5A 2N78A 2L11A 2QEXA 2H1EA 2I0QA 2EJFC 1Q12A 4DV0Q 3CCEA 4NW2A 4RGMA 3HOZB 1EQQA 2XTIA 3CPWA 4DR7Q 1UEAB 3FRPB 4B3MQ 4KJNA 4JI0Q 1Z9FA 3STBD 4A4IA 4DK6C 2Z6KC 4G4KA 2VQEQ 2K1BA 2VL6A 3NQTA 1EL0A 2BOSA 2ZJQA 4LF8Q 2R93H 4MIUA 4N8FA 5K5PA 4EX5A 2MP1A 1ESRA 1D5XC 1H9KA 2CH4W 4JG2A 1ENCA 2FFKB 1S5ED 1STNA 1Z47A 3HEJA 3W3AA 1KABA 1NAPA 3VA5A 2A6HD 4HJ8A 3I4NB 1KRTA 1SNOA 1VQNA 2BE5D 3A55A 5JVH3 1OXSC 2SEBD 3I8ZA 2OTJA 3P20A 3EROA 4NDXA 1H9MA 3UI2A 2IW3A 3JAMc 4GNXB 2IT1A 1VQGA 1Y1VB 2HQLA 1O7YA 1S5CD 3KYHC 4IQZA 2J7ZA 3J81i 4UDUC 3K5NA 2E76C 1SFOH 4JI7L 3Q23A 3SK4A 2F52A 3J80c 2B2YA 3AEVA 4A3IB 1BOSA 3V96A 4ULLA 3TN2A 3L2PA 1A2UA 1DONA 2K75A 1O7LA 1KNAA 2C5CA 2KCMA 4CDDC 2XRSD 3RLNA 2HCCA 3NUCA 1V9PA 1JMCA 2K5DA 4MHEA 1JWUD 3T1YQ 2E2HB 2ZTDA 3KK7A 3I4MG 2EPBA 2CVRA 2JA9A 1NR4A 1X3QA 1GUNA 3CCUA 1I94Q 1HR0L 3S2DB 3S24A 1EOTA 1ASYA 2PQAA 4QQBX 3MC0B 4RG1A 1I6VC 1JC7A 4JPBW 1FVIA 3DLLA 5IGDA 5LL6X 4DPGA 1D5ZC 1EU4A 1HNZQ 5E3FA 2EZVA 2DGYA 1EY4A 3OW2A 4DR5Q 3M85A 1I4PA 4GKKL 1NTGA 3CU7A 4IFDG 2WKDA 4YIJA 4PMBA 3T4AC 5BN4A 2EY1A 3C3LA 5ELOA 2F0GA 5ELBA 1X6OA 3J7YW 2R93B 1BKBA 3CC2A 1TWHB 2K05A 1CA5A 1J9OA 3VR3A 1O80A 1IHZA 1PVOA 2DY8A 2O5JC 2B63H 2WB1E 4A3EB 1ENFA 3VYRA 3CXCA 5I2XA 3VYUA 4CBVA 3I90A 4DNIA 4A3MB 5D14A 4HIOA 1IBMQ 4A3CG 2B2UA 1AE2A 4TVAB 3HKZG 1TWHH 3P7JA 1E24A 1V1QA 2PO4A 1HCZA 3NWTA 5DLQE 3VA7A 1EZ8A 3EFXD 1TWCH 4BY7G 5FJ8H 1A3VA 3E6ZX 1C0AA 5D3IB 4QGUA 1YBYA 1L1OA 5C3WA 1HH2P 1F2ZA 2C9OA 1BCPC 1DCZA 3M4QA 4LF5L 1JT8A 4U68A 3PMFA 2MO0A 3TP5A 4F8MA 2EOTA 1WTPA 3UE1A 3VR4A 4A93H 1MSGA 1Y1WG 3K57A 1VQFA 1YNNC 4I65A 4GOPC 1PH6A 1JWMD 3TZUA 1UAPA 1VF7A 1SMYD 5KNBA 1S5DD 4HIKA 2I07B 1SN8A 3MWYW 2K5QA 4ZQ3A 2JA6H 3NELA 4IPDA 4LAAA 4PZ7A 1C7YA 3MXNB 2B2WC 1IBML 1LV9A 3MXNA 2LXJA 4FDBA 1EYCA 1YHBA 2JA5B 3QWNA 4NB3A 4RGNA 2KHSA 5JVG3 1XNRQ 1I50B 4OEMB 4DR4Q 3W2DA 2NTTA 5JPNC 2F0UA 1T5EA 4LUOA 1IKMA 2JE6I 3T51B 4WJ4A 5T1GA 1I4XA 2ENBA 2BDOA 1DOLA 1TS3A 4IJHA 3GTGB 1X3GA 3K7AH 1QZGA 2PQEA 4KKUA 5E4WC 1HNWQ 2BA1A 3MHBA 4RHRA 3H09A 2L0CA 1BDOA 1G291 1D5MC 1CKNA 1JCKB 2HDMA 1HZ9A 1BQQT 3ZYYX 4J1MA 2CWAA 2PNRC 3E9HA 2K32A 4HCSA 2WB1B 3I70A 1CSQA 1WYDA 3S2HH 4LNQA 2GVAA 1L1OB 1X55A 2RHSB 4QMGA 2F4IA 5ELNA 4B9WA 3DEPA 3M4PA 4C2MH 4C1NK 4B3RQ 3MZ5A 1ICFB 2B2VA 2F0FA 4KHVA 1WTXA 2L4NA 3PF4A 4POGA 2QCPX 1YEZA 4ALPA 1IYJB 1N34Q 1PTOC 1JOOA 1H9SB 2A6EC 1GO3E 2F0QA 3HP3A 4LWCA 4JW0A 5DNFA 1BO0A 4C3HH 3DMUA 2B39A 3BDCA 2IHFA 2WV6D 3A8JE 1E2ZA 1RDPD 2F0LA 4LF9Q 5I9PA 1M1KC 3K5MA 4P73A 1BF4A 2AWNA 2E2IB 2L12A 1PXUA 4OHJA 1CM9A 1LTID 2K4KA 3J81E 1N9WA 3WOFA 5CBAE 2PPBC 1PZID 1V43A 2NVYH 3HOWB 2RA4A 1WCMB 2F0TA 2O4XA 3MEFA 4L8JA 4IOAA 5GADC 5GAHC 4B3ML 3S1MH 4A3LH 4ZUIA 3T1HQ 1K8AC 3DEOA 2ZXOA 5LHY1 3OOCA 4QIWE 1FNUA 3OIQA 1FJGQ 3NENA 4DV4Q 2KUMA 2R7ZG 1JQYD 4DAYA 4XYQA 1SJHD 3NK9A 4DR3Q 4IFDH 4GN4B 2UXBL 3CF5A 4JI2L 4DKAC 4RGTA 3CCVA 2X6GA 4O0AA 2E5LL 1AN8A 4O2DA 3T56B 3I7FA 2K28A 1TWCB 2RCFA 4NXNL 5JEAG 4LMQD 1LLRD 4LF7Q 1ET9A 2AKWB 2H4OA 2WIIB 1RD9D 1VQ9A 3GD7A 1EWHA 3IL8A 2F0IA 3RZOH 3C1FA 2Q2TA 2RQXA 2UXCL 1CFMA 4IUNA 2C35B 2CW0C 2WACA 1XMOQ 1L0WA 1DOKA 1XJVA 4LJZC 1FD7D 4OO1H 5JJZA 1X3EA 1SNPA 4HJAA 1CSPA 3J7AF 3RN2A 3TP7A 2MQHA 2R7DA 4G57A 4C1NI 2EXZA 1U4PA 1NY4A 4EQOA 5IGBA 1A15A 3H3VH 5BN3A 3MAQA 2EJMA 3MXGA 1XNQL 2V1CC 5C3EG 4GLVB 3CKIB 4KKSA 1PYSB 2FJ2A 2CKZB 4X64L 1Y1WH 1CQVA 5GAEC 1PRTB 3SHLA 1N32L 4OIJA 4XT1B 4O42A 1MD2D 1QJOA 2JEAI 2B2YC 4NP5A 4H7BA 1Q46A 4IZ8A 3FKIB 4DR2L 4N8X1 1XPOA 1OTCA 1YIJA 1EFID 2HIVA 3VR6A 1A8VA 4B3TQ 2CH4A 5M3FG 3S1QH 1SYEA 1VCIA 2WAQE 1JORA 4P75A 3W5OA 1IL2A 3HOVH 5C5MA 1S40A 3N6RA 2K04A 5F2DA 2Q8IB 1SYBA 3IAYA 1VQ6A 2HHHQ 3U58A 4LF8L 2QF7A 1H9JA 3K0YA 2RCNA 2RVLA 3C1EA 1Z7TA 2G9HD 3GTMB 1LTBD 2ZM6Q 5FO7B 4BBSH 3EIVA 3HOZH 3GTKH 1XWEA 2BH8A 3HG9A 2AQ2B 1Y8OB 1XTDA 1LM0A 1BBUA 4X64Q 1TWGH 3DUZA 3EVQA 1ZYRD 3NTHA 4A3FG 1VQOA 3AFPA 1VMPA 4CKCA 4DF7A 3BS1A 2VUMH 2IPKD 2EYPA 4B3SL 1GVPA 1LTRD 1VDZA 4FYDA 2A68D 3H91A 3K6OA 4DV5Q 3S14H 4FP5D 4LF6Q 1SJED 4OELB 2PMZE 2IY5B 5CYUA 4LW1A 1S3OA 4DA2A 4RWSC 5AJ3L 1U4MA 4A3LG 4FVMA 1K0SA 1B70B 4DAVA 1I3QB 5C44B 1F77A 1Q81C 1GUWA 5K36H 2BA0A 3BZDB 4RHSA 3RZDH 1LACA 4A3EG 4K6LA 4TSSA 1HR0Q 4DR1L 5C4HA 2OEOA 2B2UC 1Q8KA 2D5DA 3HOUG 2CHBD 5FK9C 4H44C 1AE3A 1MGSA 2VXWA 4KHPL 4IFDI 2EY6A 2OTLA 3J7A5 1NMFA 4X66Q 4HIDA 1HNZL 2NZ1D 1S5BD 1PH7A 1G91A 1HZCA 2RF4A 4A75A 1STGA 2R92G 3RMHA 2QKIC 5EPJA 4Y7NB 5CV8A 4PQXA 3RNUA 3GTLH 1YZ6A 4HJ7A 4UPAA 1QCBD 1RTNA 1VQHA 2SOBA 1HUNA 5AFWA 5JJKA 1PRTF 5IGFA 1PH2A 3PIPA 2ZJPA 5GQOA 2K5HA 5IODA 3PO2G 2WAQB 1I4QA 4K6DA 1QNUA 4GKKQ 1QILA 4GZYC 1LUZA 1EUJA 1Q3LA 5EPKA 1KDCA 1MSHA 1JICA 4WJ3M 1J6QA 1WTHA 4JYAQ 3JAME 5A2QL 2RKSA 2JYOA 1EFWA 2O5IC 3TS2A 2NVTH 1PRTC 4WFN3 1UE6A 2H5XA 4A3IH 3RLFA 2MHVA 1PFNA 1MKHA 1MIUA 2B63B 1SFOB 4PZ8A 1D1IA 1PTOF 3MXUA 4AYBB 4LF4L 4LK1C 4G7ZC 2BH2A 1K0RA 1KLGD 3HOUB 1VQDA 1Q7YC 2F4VQ 2XGTA 1NSNS 2J0TD 5KRUA 3S1NH 3OWEB 1TWFB 2KEEA 2N88A 4F87A 5KGUA 4OL7A 2D0PA 3D6WA 1FR3A 5NUCA 3PUWA 4C3JB 2EYHA 4YCUA 1CKNB 1XNRL 2V4DA 1ZEQX 3HGBA 1SBBB 1GXDC 2JA8B 2RBMA 5KIXA 1VQMA 1SROA 1H9SA 4PZ6A 1EY6A 3TZDA 1ICWA 3GDEA 4IUPA 4ZKCB 4KY7A 3BDOA 2E2HH 1VQ8A 2E2JB 2MGSA 3S1RB 1II3A 2O2LD 5C4XH 5KNCA 3DWQA 3LX0A 1QVFA 5HY6A 1GKHA 4IJLA 5IGCA 1WOCA 2NZOA 2OF1A 4OIKA 3NWSA 1JB3A 3ERQA 3EBEA 2PI2E 2NVTB 4J8QA 1R4QB 3NBIA 4APVA 4OGQC 1HNXQ 3GTJB 2F0DA 4UP8A 3S16B 4DXFA 1DM0B 4DV1Q 2L9HA 4AYBE 1Y69U 3PF5A 2EQSA 2RDHA 2VY3A 2VQFQ 1GUOA 5M5WH 1STAA 2EDGA 2EE1A 5IIFA 4QL5A 3TEHB 3G6EA 4BA2I 1LTLA 1ZKOA 1EQRA 3F2DA 4K5XA 1JOKA 3PSIA 5K36G 4KJOA 1IL8A 4GN3B 5C0XI 4JI4Q 4GKJL 3ZJYC 4XDXA 1LT6D 4XQNA 1UUPA 2QGQA 1W2BA 1MJCA 2EYLA 3KLSX 3Q24A 4A3GG 1U0LA 2Y0SE 5DM73 3J80E 4X3KA 1OO9B 5JPMC 1JOQA 3ER0A 3IFTA 1L1OC 1N33Q 5FKAC 3SK6A 1Q8IA 1MJEA 5BR8Q 2DJFC 1A3UA 2OQ0A 2JA8G 3A56A 2DUDA 4EQ5A 4X3TA 3ERSX 2EYMA 4DV6L 1TIID 1HHVA 2RHQB 1EQTA 2GA4B 1SLJA 4ABNA 1PH3A 4XT3B 4K14A 4R8NA 2F0HA 4MTKA 3A5ZB 3AYHB 5EKLA 2CFMA 3UDFA 4DR3L 3U50C 4OXPA 1HFGA 4K5WA 1DD2A 2AHOB 4P71A 3PO2H 2R7ZH 1X3FA 1HTPA 4HN7A 1IXRA 5CBEE 5HGTA 1ONLA 1SMYC 2QDBA 3F1ZA 4K0KL 1E0BA 1PMRA 4OO1G 5CV7A 2AUJD 4XQJA 4JI1Q 2KOLA 3U9OA 4GS3A 3K58A 4FO2A 2ZM6L 1PH1A 4YHHQ 1J8IA 2UXBQ 1WTWA 3ULPA 1VQKA 4JI0L 2LFNA 4RKLA 5CR3A 5EKIA 5C3EB 5L37A 3B6YA 1ZXTA 4OWXB 5C0XJ 4CDFC 1FYCA 1LT5D 4LFBL 5LL6S 1LTGD 1O78A 2F1MA 2XIWA 4X6AH 2E74C 2XRQD 3G48A 1W6JA 4B3SQ 1R9TB 1WD0A 1CK1A 3VYSA 4A3BG 5M9OA 3EJIA 3CCMA 3RUZA 3X3NA 4XYOA 3QIAA 5AJ3Q 4X65Q 2E5LQ 1RJTA 1W6KA 4QJFA 2ZT9C 1EZ6A 5M3FB 3SEBA 1F2YA 2F03A 1GD7A 4JCVE 3RZDB 4IPGA 5E4XA 3E0EA 4A3KG
chains in the Genus database with same CATH topology
3TSSA 1SYFA 4IUUA 2Q8RE 4E6IA 2QILA 3C46A 2TMPA 1BCPB 1EY9A 5DAUA 3HS0C 3OHXC 3LWEA 2G9DA 4QUFA 1STYA 5G3LF 4TRDA 1LT3D 1HXYD 3FMCA 5ELEA 4A3FB 1XXGA 2XN9C 1KAAA 3GV6A 2MJ8A 3KBGA 3QOJA 1V8QA 4ME5A 3M3YB 2MUYA 3J80L 2LMCB 2BCOA 1LT4D 4C2MB 4IUQA 5EJWA 2AWOA 3S2HB 3D6CA 4DN4M 3HRZC 1VMCA 1X32A 4QIWB 1I6HB 2A69C 5I6WA 2LS01 3OPOA 2F0PA 1SNQA 3NPPA 3I72A 1AW7A 1STEA 2DN8A 5FO8B 2K7VA 2JEBI 2R92B 1ET6A 2F0MA 3PUXA 4FF3A 5E1FA 4EQNA 3V2TA 4KI0A 3MTSA 2IX1A 3WOEA 4IN3A 3S15B 1RCVD 5ELDA 4G7HC 1PDQA 1K8OA 3Q0AA 1BCPF 3K5OA 2ID0A 4F88A 2FMCA 1ESFA 4B9XA 2YU9B 3A7AB 3MFYA 5CMDA 1CT1D 3PO2B 5J22A 3LNNA 3T53B 5KYIA 4BS9A 3OW7A 3D8GA 3HOYB 3KUPA 1IW7C 1AFPA 1TKWB 2K03A 2CQAA 2HCIA 3VYTA 5A35A 2RSNA 4CJ2C 1HTLD 1Q1EA 4KY6A 2IWHA 3SVMA 1TT2A 2KVMA 3L3OC 5IGGA 2F0VA 1PYWD 1EEFD 4ZYSA 2XWJB 2K01A 2TSSA 2EJGC 4DNRB 3A54A 3A8IE 3URYA 2QEJC 1QE6A 2M2LA 1I4HA 1Q1BA 2WINB 3DM1A 4CKEA 5I2YA 2R6GA 1YNND 5G3LD 4HCEA 1JE4A 1LABA 2JSOA 3H6MA 4F7XA 2IL8A 1G2TA 4O1NA 4A3BB 1GUTA 5M5WB 2K33A 3S9WA 4K8IA 5I9OA 1HA5A 1SE4A 1HQMC 3Q22A 2F0KA 4HEDA 2IX3A 2ICEC 3M7NA 4M8AA 5ISRA 1IW7D 1F9PA 1SE3A 2D62A 2KJXA 1DYQA 5CV6A 3NQIA 2F0NA 4WRDA 3C2PA 2FINB 2RDFA 2BE5C 3HZXA 3WDNA 2NYZD 5EBDA 1B1ZA 5CGKA 1EIHA 2B8FA 3GO5A 4DK0A 4C56C 2K5WA 4IUTA 3FPPA 3S1QB 4XXEA 4BBRB 1BCPD 1FGBD 3NHHA 3SE0A 1BNZA 4H0LC 3TP8A 3DHQA 1HPCA 4A3GB 3BYTB 1STBA 1TQOA 1GHKA 5C5LA 3R2TA 3K5LA 2Z1CA 4RAUC 2F3VA 2Z8LA 1F9QA 1S4ZA 1FNWA 1PZJD 2PZUA 3MVVA 3U9SA 3EQLC 2E2DC 3S1NB 2L5TA 2NVXB 1V1OA 1L0XB 4QF4A 4K2KA 3OMGA 4WORA 5FLXE 2R3ZA 1PRTD 3D4DA 2IJ0A 1QG7A 1LTAD 4V0BA 4BBSB 1X3PA 1VF5C 2L55A 3NTIA 3H0GB 3NTKA 4P2CB 4NMZA 5J39A 1PZKD 1Y1WB 3PO3B 1G6ZA 4ODGA 1RODA 2EY2A 3PUVA 3G7LA 3QO2A 1MI2A 4HSVA 1K8MA 5M5XB 1HUMA 4DU9A 3R3OA 1LTTD 1OXXK 3D31A 1D6EC 2EVBA 4A3KB 1JR0D 2XSCA 4U673 2ICIA 1TU2B 5JOBA 1QB5D 1LO5D 1SDFA 1SYCA 3DWPA 4RKBA 1EWCA 2RSOA 4CKBA 1EY8A 4KKTA 4R8IA 1R4PB 1SAPA 3HOXB 3R8BA 4KMUC 4B08A 3VR2A 1WTOA 4XIGS 2EYOA 1EYDA 3ND8A 1BBXC 1DOMA 5I6YA 1KTKA 2NB0A 1AP0A 1CQFA 2OXPA 5EGTA 4UAIA 4ZAIA 4H13C 3F2UA 1TWGB 4A3JB 4OO1I 1AEXA 1S5FD 2FHTA 1WTQA 4L6TB 3T13A 3AU7A 3GP7A 4PV1C 4KTAA 4EQPA 2PW5A 5EQ0A 3BYYB 1ILQA 1BXTA 4ZKBB 3GTLB 1SE2A 4N9PA 4M1UB 3FVQA 4C3HB 4ZK9B 5D65A 2F0JA 4TKOB 4JBWA 3LWUA 2BDNA 3BVZA 3GTPB 4FXDA 3H94A 3V05A 3K59A 1DXMA 5COYA 1F2MA 4RFBA 1A6XA 3I73A 5BN5A 2D9UA 2A5HA 4KD3A 3CRKC 4HMIA 2L1BA 1C48A 2A74C 3EA6A 5JEAH 2PYKA 3ITPA 4ZRZA 1TS2A 1EEID 4Q5VA 2JA7B 3I4MB 2D2CC 1SNCA 2B2WA 3E5SA 4DGZA 4BWGB 2AQ1B 1WTVA 3PIO3 2IX0A 5C0XH 1ML0D 4MN3A 3G6JB 2PZTA 4CJ1B 1IKLA 4ZLTF 2A68C 1KLUD 3NSWA 1SSOA 1XYIA 1G2SA 2E75C 3D4RA 2Q8TA 1OXUA 2XNAC 4QUCA 4XTCS 1BUVT 3M7GA 3D3RA 5J1ZA 4CHTB 3TMEA 2PCFB 5C0XG 3JAML 4IALA 1HFNA 2K6AA 4QCLA 4BA1I 3DXJC 1RKNA 3CHBD 4RGOS 4K5VA 3KLSA 1B9NA 1GUGA 1XX8A 2B2TA 2A6HC 3Q6SA 4Q0FA 3BVMA 5HURA 1HQRD 3X3MA 3QJYA 3BG3A 5CV5A 5KYLA 2F0EA 1PFMA 3ONAB 2ZXPA 2VB3X 4KY5A 5C4XB 3BVGA 3FEWX 3RZOB 4HR7B 2LKVA 2HQEA 3GTOB 4DAPA 3T16A 1OXTA 2HUGA 2X6LA 2SNSA 1K83B 1KDAA 1T5XD 3I91A 4CJ0B 1STHA 5IT9L 4FF2A 2OT2A 3NP8A 5C4ZA 2HDLA 1NUCA 2VNUD 1Q90A 1NR2A 3CRLC 5T1IA 4WJWA 2M00A 4NKLA 2EYJA 5EBCA 5FO9B 3H3VC 3BDLA 4K8JA 1CTMA 2JP1A 2XWBB 3GV3A 3IFDA 1B44D 1Y8NB 1HRJA 1MBYA 1TR5A 3QOLA 1CZWA 2SNMA 4EVOA 2F0OA 1BR9A 3AMUA 4XQQA 2B2TC 2VB2X 2YYZA 3FDTA 1F9RA 1CA6A 1F9SA 2NWGA 2WKCA 5CV9A 2KCNA 3VR5A 5DEHA 4BY1B 1D1KA 4HAEA 2B2VC 4FF4A 1DJRD 1HA6A 1L0YB 5A2QE 2ZXRA 3IKJA 4A93B 1PLFA 3S14B 3SDZA 3PUYA 1GUSA 1D2BA 2A69D 3D4WA 4KK7A 2A73B 3I3CA 4PNYA 2AQ3B 1EQVA 2R61A 4IURA 4FF1A 3MXPA 2LY7A 2PW7A 2F0SA 4I7ZC 3HKZB 2KQ3A 2R7ZB 4BY7B 1B9MA 3A7LA 4HMJA 5FOBB 4CGYB 2F3WA 2X69A 4EGVA 2B8GA 2M9VA 4V190 1CI3M 1PTOH 2NVQB 1SXTA 1LTSD 2JA6B 1WD1A 1QWYA 3OIPA 3DWAA 3S17B 1I4RA 3PV0A 4IFDJ 3GTKB 2Y0SB 4S3SA 4KHZA 1U4RA 5I4DA 1Y8PB 1OXVA 2KCCA 1Z6HA 4C3IG 2PZWA 5M3MB 4PMWA 3OWFA 1FNVA 3R93A 2N55A 3MA2B 4DNTB 2A6ED 2NVYB 4RCOA 1AZPA 1A3TA 1E2VA 2KECA 4C3HG 4L63B 1O7ZA 1EY0A 1DZ1A 2I46A 4X3UA 3P75A 2DNEA 4FXGC 1V1PA 3FPUB 1U4LA 1IYUA 3ND9A 2JXMB 2XVSA 5IT9E 4ZUJA 1EY5A 5EKKA 3OSOA 5ELCA 1H9RA 5C3XA 4G7OC 4KN7C 1E2WA 2KA7A 1QOHA 1F2LA 4FNFA 3PIP3 5C6AA 2NN6I 3M4YA 2DNCA 4KN4C 4QB4A 1B3AA 5CORA 4FXKC 4C3IB 5D3DA 3TDQA 5FLXL 3KF8A 1IYVA 3GQBA 1ZYRC 5C4JB 1EY7A 3PUZA 4DK1A 2NTSA 5IOCA 2RDGA 1RTOA 3A8KE 4HSPA 3SR1A 1TY0A 2NUCA 4IUVA 1EIGA 2NN6G 4K2LA 4RH6A 1G8ZD 2MPMA 5EPLA 2CW0D 1TY2A 1WTRA 1ENAA 4N9TA 4DXGA 3NE5B 5KEEA 1RF2D 3S1MB 1PTOD 4RCNA 2NN6H 3HOVB 5CV4A 1UNSA 1TS4A 4JK1C 1V1PB 1I4GA 1GOZA 1TWAB 5IGEA 2J4XA 2DY7A 5M5YB 1C4QA 3L7ZC 5JAVA 1SNMA 1SEBD 1B50A 2KEDA 1A2TA 1WVLA 5JEAJ 3AB9A 1B2TA 3NBHA 2AUKA 2VUMB 2WP8J 5ELFA 1CHPD 2EYFA 4Z9CB 3SK8A 4RA8A 3O13A 1C8CA 1KNEA 5KNDA 1QNKA 1SYGA 1U9RA 2SDFA 3NXWA 3KBXA 4TQUS 1CZGA 3QG1A 2FMMA 3P1HA 4DFAA 3MEHA 1SNDA 3M4OB 3SK5A 2Z4HA 1CHQD 1EYAA 4J6HA 1TS5A 4KV6A 1TVXA 1JWSD 1AZQA 3SXHA 3KLRA 1NCVA 2PMZB 2Z4IA 1XTCD 3CQZB 1SYDA 1YNJC 3J81L 3QB3A 4KD4A 3E0JA 4A3DB 1M8AA 1B53A 4C3JG 3MFGA 3TBIB 3R2IA 1EU3A 3L9AX 2NBFA 3OMCA 1RHPA 4ILWA 1GJXA 1GHJA 1B4OA 3J7AV 4R9WA 4X3SA 1KDBA 1M4VA 3I4LA 1PTOB 1ILPA 3TP6A 1YNJD 5CC4A 1PFBA 3RD4A 3N52A 4PMCA 3K7AB 5TSSA 2EY5A 4HTHA 4ID6A 5DM63 2F0WA 3GTQB 2L11A 2H1EA 2EJFC 1Q12A 4NW2A 4RGMA 3HOZB 1UEAB 3FRPB 4KJNA 4G4KA 2K1BA 3NQTA 1EL0A 2BOSA 4MIUA 5K5PA 2MP1A 1ESRA 1D5XC 1H9KA 1ENCA 2FFKB 1S5ED 1STNA 1Z47A 3HEJA 3W3AA 1KABA 1NAPA 3VA5A 2A6HD 3I4NB 1SNOA 2BE5D 3A55A 5JVH3 1OXSC 2SEBD 3I8ZA 3P20A 3EROA 4NDXA 1H9MA 3UI2A 2IW3A 2IT1A 1Y1VB 1O7YA 1S5CD 4IQZA 2J7ZA 4UDUC 3K5NA 2E76C 3Q23A 3SK4A 2B2YA 4A3IB 1BOSA 3V96A 4ULLA 3TN2A 1A2UA 1DONA 1O7LA 1KNAA 2C5CA 2XRSD 2HCCA 3NUCA 2K5DA 4MHEA 1JWUD 2E2HB 3KK7A 2EPBA 2CVRA 1NR4A 1X3QA 1GUNA 3S2DB 1EOTA 3MC0B 1I6VC 1JC7A 5IGDA 5LL6X 1D5ZC 1EU4A 5E3FA 2EZVA 1EY4A 3M85A 1I4PA 3CU7A 4IFDG 2WKDA 4YIJA 4PMBA 3T4AC 5BN4A 2EY1A 3C3LA 2F0GA 5ELBA 3J7YW 2R93B 1TWHB 2K05A 1CA5A 1J9OA 3VR3A 1O80A 1IHZA 2DY8A 2O5JC 4A3EB 1ENFA 3VYRA 5I2XA 3VYUA 4CBVA 3I90A 4A3MB 5D14A 2B2UA 3P7JA 2PO4A 1HCZA 3NWTA 3VA7A 1EZ8A 3EFXD 1A3VA 3E6ZX 5D3IB 5C3WA 1F2ZA 2C9OA 1BCPC 1DCZA 4U68A 3PMFA 3TP5A 4F8MA 2EOTA 1WTPA 3VR4A 1MSGA 3K57A 1YNNC 4I65A 1JWMD 3TZUA 1UAPA 1VF7A 1SMYD 5KNBA 1S5DD 2I07B 3MWYW 2K5QA 4ZQ3A 4LAAA 2B2WC 1LV9A 3MXNA 1EYCA 2JA5B 3QWNA 4RGNA 2KHSA 5JVG3 1I50B 3W2DA 2NTTA 5JPNC 2F0UA 1T5EA 1IKMA 2JE6I 3T51B 5T1GA 1I4XA 2ENBA 2BDOA 1DOLA 1TS3A 3GTGB 5E4WC 2PQEA 4KKUA 2BA1A 3MHBA 4RHRA 3H09A 2L0CA 1BDOA 1G291 1D5MC 1JCKB 2HDMA 1BQQT 3ZYYX 4J1MA 2PNRC 2K32A 4HCSA 2WB1B 3I70A 4QMGA 2F4IA 4B9WA 3DEPA 4C1NK 3MZ5A 2B2VA 2F0FA 1WTXA 4KHVA 2L4NA 2QCPX 1PTOC 1JOOA 1H9SB 2A6EC 2F0QA 3HP3A 5DNFA 1BO0A 3DMUA 2B39A 3BDCA 2WV6D 3A8JE 1E2ZA 1RDPD 2F0LA 5I9PA 3K5MA 1BF4A 2AWNA 2E2IB 2L12A 1PXUA 4OHJA 1CM9A 1LTID 3J81E 3WOFA 5CBAE 2PPBC 1PZID 1V43A 3HOWB 2RA4A 1WCMB 2F0TA 2O4XA 4L8JA 4ZUIA 3DEOA 2ZXOA 5LHY1 3OOCA 1FNUA 3OIQA 2KUMA 1JQYD 4DAYA 4XYQA 1SJHD 3NK9A 4IFDH 4RGTA 2X6GA 1AN8A 3T56B 2K28A 1TWCB 5JEAG 4LMQD 1LLRD 1ET9A 2H4OA 2WIIB 1RD9D 3GD7A 1EWHA 3IL8A 2F0IA 3C1FA 2RQXA 1CFMA 4IUNA 2CW0C 2WACA 1DOKA 4LJZC 1FD7D 4OO1H 5JJZA 1SNPA 3J7AF 3TP7A 4G57A 4C1NI 2EXZA 1U4PA 4EQOA 5IGBA 1A15A 5BN3A 3MAQA 2EJMA 3MXGA 3CKIB 4KKSA 2FJ2A 1CQVA 1PRTB 3SHLA 4OIJA 4XT1B 4O42A 1MD2D 1QJOA 2JEAI 2B2YC 4NP5A 4H7BA 4IZ8A 3FKIB 1EFID 3VR6A 1SYEA 1VCIA 1JORA 5C5MA 3N6RA 2K04A 5F2DA 2Q8IB 1SYBA 3IAYA 2QF7A 1H9JA 3K0YA 2RVLA 3C1EA 1Z7TA 2G9HD 3GTMB 1LTBD 5FO7B 1XWEA 3HG9A 2AQ2B 1Y8OB 3DUZA 3EVQA 1ZYRD 3NTHA 1VMPA 4CKCA 4DF7A 3BS1A 2IPKD 2EYPA 1LTRD 1VDZA 4FYDA 2A68D 3H91A 3K6OA 4FP5D 1SJED 5CYUA 4DA2A 4RWSC 1U4MA 4FVMA 4DAVA 1I3QB 5C44B 1F77A 1GUWA 5K36H 2BA0A 3BZDB 4RHSA 1LACA 4K6LA 4TSSA 5C4HA 2OEOA 2B2UC 2D5DA 2CHBD 5FK9C 4H44C 1MGSA 2VXWA 4IFDI 2EY6A 2NZ1D 1S5BD 1G91A 1STGA 3RMHA 2QKIC 5EPJA 4Y7NB 5CV8A 4PQXA 1QCBD 1RTNA 2SOBA 1HUNA 5AFWA 1PRTF 5IGFA 5IODA 2WAQB 1I4QA 4K6DA 1QNUA 1QILA 4GZYC 1Q3LA 5EPKA 1KDCA 1MSHA 1JICA 3JAME 5A2QL 2RKSA 2JYOA 2O5IC 1PRTC 4WFN3 3RLFA 2MHVA 1PFNA 2B63B 1SFOB 1D1IA 1PTOF 3MXUA 4AYBB 4LK1C 4G7ZC 1KLGD 3HOUB 1NSNS 2J0TD 5KRUA 3OWEB 1TWFB 2KEEA 2N88A 4F87A 5KGUA 4OL7A 3D6WA 1FR3A 5NUCA 3PUWA 4C3JB 2EYHA 2V4DA 1ZEQX 3HGBA 1SBBB 1GXDC 2JA8B 2RBMA 5KIXA 1H9SA 1EY6A 3TZDA 1ICWA 4IUPA 4ZKCB 4KY7A 3BDOA 2E2JB 2MGSA 3S1RB 1II3A 2O2LD 5KNCA 3DWQA 3LX0A 5IGCA 2OF1A 4OIKA 3NWSA 1JB3A 3ERQA 2NVTB 4J8QA 1R4QB 3NBIA 4OGQC 3GTJB 2F0DA 3S16B 4DXFA 1DM0B 2L9HA 1Y69U 2RDHA 1GUOA 1STAA 2EDGA 2EE1A 5IIFA 4BA2I 1ZKOA 4K5XA 1JOKA 5K36G 1IL8A 4KJOA 5C0XI 4XDXA 1LT6D 4XQNA 1UUPA 2EYLA 3KLSX 3Q24A 5DM73 3J80E 4X3KA 1OO9B 5JPMC 1JOQA 3IFTA 5FKAC 3SK6A 1Q8IA 1A3UA 3A56A 4X3TA 1HHVA 2EYMA 1TIID 1EQTA 2GA4B 4ABNA 4XT3B 4K14A 4R8NA 2F0HA 5EKLA 1HFGA 4K5WA 1DD2A 1HTPA 4HN7A 5CBEE 5HGTA 1ONLA 1SMYC 2QDBA 1E0BA 1PMRA 4OO1G 5CV7A 2AUJD 4XQJA 2KOLA 3U9OA 3K58A 4FO2A 1J8IA 1WTWA 2LFNA 4RKLA 5CR3A 5EKIA 5C3EB 1ZXTA 5C0XJ 1FYCA 1LT5D 5LL6S 1LTGD 1O78A 2F1MA 2XIWA 2E74C 2XRQD 1W6JA 1R9TB 1WD0A 1CK1A 3VYSA 5M9OA 3EJIA 3RUZA 3X3NA 4XYOA 3QIAA 1RJTA 1W6KA 2ZT9C 1EZ6A 5M3FB 3SEBA 1F2YA 2F03A 3RZDB 5E4XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q6S A;  2KUM A;  1HUM A;  1AZP A;  4IUU A;  4IUT A;  4HSV A;  2KEC A;  1ILP A;  2Q8R E;  5CMD A;  1HA6 A;  2B2W C;  2JYO A;  2RVL A;  2DY7 A;  1LV9 A;  1O7Z A;  3KUP A;  1DZ1 A;  1PFN A;  4X3K A;  5COY A;  2K03 A;  3LWE A;  1PFB A;  1PLF A;  4X3S A;  2HCI A;  3N52 A;  2D9U A;  4QUF A;  1PFM A;  2X6G A;  3ONA B;  2RSN A;  4CJ2 C;  1B50 A;  4X3U A;  1BNZ A;  2K28 A;  2KED A;  1WVL A;  2L1B A;  3SVM A;  3I3C A;  4X3T A;  1IKM A;  3FPU B;  1VMP A;  5T1G A;  2KVM A;  1HHV A;  1B2T A;  4LMQ D;  1EQT A;  1SDF A;  1DOL A;  1U4L A;  2L11 A;  2H1E A;  3GV6 A;  4XT3 B;  2MJ8 A;  5E4W C;  2RSO A;  4IUR A;  3H91 A;  2K01 A;  4NW2 A;  3IL8 A;  2KEE A;  2K05 A;  4RAU C;  1CA5 A;  2HDM A;  1J9O A;  1O80 A;  2N88 A;  1HFG A;  4R8I A;  2HUG A;  1SAP A;  4RA8 A;  4RWS C;  1U4M A;  2DY8 A;  1F9Q A;  3D6W A;  1C8C A;  2B2W A;  1KNE A;  1QE6 A;  2X6L A;  1QNK A;  1DOK A;  1S4Z A;  2SDF A;  1F2L A;  1WTO A;  2M2L A;  3KBX A;  5JJZ A;  4HCS A;  1DOM A;  3DM1 A;  1BBX C;  4IUQ A;  5EJW A;  3I91 A;  2K1B A;  1GUW A;  2X69 A;  5CBE E;  4CJ0 B;  1EL0 A;  1WTV A;  1JE4 A;  1ML0 D;  2FMM A;  3DEP A;  4MN3 A;  1B3A A;  2IL8 A;  5COR A;  1IKL A;  4CJ1 B;  4ZLT F;  2B2V A;  2HDL A;  3I90 A;  1E0B A;  1WTX A;  2L4N A;  1AP0 A;  2B2U C;  5D14 A;  1G2T A;  4DN4 M;  2MP1 A;  1ESR A;  1U4P A;  3TZD A;  1VMC A;  1SSO A;  4UAI A;  1ICW A;  1X32 A;  2B2U A;  1NR2 A;  2FFK B;  1XYI A;  2KOL A;  1G2S A;  1MGS A;  2VXW A;  3P7J A;  4ZAI A;  5T1I A;  3F2U A;  4IUP A;  1NAP A;  3HP3 A;  2Q8T A;  1A15 A;  4ZKC B;  1J8I A;  4R9W A;  5DNF A;  1WD1 A;  1WTW A;  2MGS A;  1BO0 A;  1RTO A;  2NZ1 D;  2R3Z A;  3I8Z A;  4HED A;  4QUC A;  2FJ2 A;  1G91 A;  1TVX A;  5EKI A;  2FHT A;  4IUV A;  1EIG A;  1ZXT A;  1WTQ A;  1QG7 A;  1AZQ A;  4OIK A;  1F9P A;  2JP1 A;  3IFD A;  2XIW A;  3GV3 A;  1NCV A;  5EPJ A;  3UI2 A;  1HRJ A;  4OIJ A;  4XT1 B;  1U4R A;  1O7Y A;  4O42 A;  4U68 A;  1WTP A;  1X3P A;  2EOT A;  2J7Z A;  1BF4 A;  1WD0 A;  1M8A A;  2B2Y C;  2MPM A;  5EPL A;  5EQ0 A;  1HFN A;  1B53 A;  1RTN A;  2L12 A;  1WTR A;  1ILQ A;  1CM9 A;  2B2Y A;  1MSG A;  5CBA E;  4ZKB B;  2L9H A;  1HUN A;  5AFW A;  3MTS A;  2B2T C;  3TN2 A;  3FDT A;  2RA4 A;  1DON A;  2FIN B;  1G6Z A;  1F9R A;  1PDQ A;  1KNA A;  3R93 A;  2N55 A;  2EE1 A;  1RJT A;  1F9S A;  2HCC A;  2NWG A;  2NYZ D;  1CA6 A;  3MWY W;  4ZK9 B;  5E4X A;  4MHE A;  3DEO A;  5D65 A;  1ROD A;  1RHP A;  1EIH A;  1B4O A;  1XX8 A;  2K04 A;  1Q3L A;  5EPK A;  2EPB A;  2CVR A;  3G7L A;  1NR4 A;  1IL8 A;  1X3Q A;  1MI2 A;  1MSH A;  1JIC A;  2B2T A;  2B2V C;  3QO2 A;  4HAE A;  4XDX A;  2BDN A;  1EOT A; 
#chains in the Genus database with same CATH topology
 3TSS A;  1SYF A;  4IUU A;  2Q8R E;  4E6I A;  3F2C A;  2QIL A;  3C46 A;  2TMP A;  5IYD G;  1WCM H;  3WWV A;  1WCM G;  4KHP Q;  1BCP B;  1PA6 A;  1EY9 A;  5DAU A;  3I4M H;  1Y1V H;  3HS0 C;  2PQA B;  3UE0 A;  3OHX C;  4YHH L;  1NMG A;  3LWE A;  2G9D A;  4QUF A;  3EN2 A;  1STY A;  2VQE L;  5G3L F;  4A3J H;  4TRD A;  1LT3 D;  1HXY D;  5FLM G;  3FMC A;  5ELE A;  4YWL A;  4A3F B;  1KHI A;  1VQ5 A;  1XXG A;  1QZH A;  2XN9 C;  1KAA A;  3GV6 A;  2MJ8 A;  1WFQ A;  2UUC Q;  5GRO A;  3KBG A;  3QOJ A;  1V8Q A;  4ME5 A;  3M3Y B;  2MUY A;  3J80 L;  1XNQ Q;  2LMC B;  2BCO A;  1LYL A;  1VQC A;  1LT4 D;  5IT9 c;  4P72 A;  2N3S A;  1A62 A;  4C2M B;  4IUQ A;  5EJW A;  4BBR H;  2AWO A;  2Z6K A;  3F8T A;  3S2H B;  3D6C A;  4C3J H;  2HHH L;  4JI7 Q;  2HD3 A;  3NEM A;  4DN4 M;  3HRZ C;  1VMC A;  4GLA C;  1X32 A;  4QIW B;  1I6H B;  2A69 C;  5I6W A;  1VQJ A;  4A3G H;  1A0I A;  2LS0 1;  3OPO A;  2K50 A;  2JN4 A;  4JI8 L;  2YV5 A;  3CAM A;  2F0P A;  1SNQ A;  3NPP A;  3I72 A;  1AW7 A;  1C9O A;  3J81 c;  1STE A;  2DN8 A;  5FO8 B;  2K7V A;  4L5S A;  2JEB I;  2JK8 A;  2R92 B;  1ET6 A;  1SE8 A;  2F0M A;  1Y14 B;  3PUX A;  4FF3 A;  5E1F A;  4EQN A;  1HZA A;  1HNW L;  3V2T A;  4KI0 A;  4DV5 L;  3MTS A;  2UUB L;  2YTY A;  2IX1 A;  3WOE A;  4IN3 A;  3S15 B;  1RCV D;  5ELD A;  3CC4 A;  4G7H C;  2E8G A;  1PDQ A;  1K8O A;  2I5L X;  4MTN A;  4R4O A;  3Q0A A;  1BCP F;  3K5O A;  2ID0 A;  4F88 A;  3PO3 H;  2FMC A;  1B8A A;  1ESF A;  4B9X A;  1VQI A;  1IZ6 A;  2YU9 B;  3A7A B;  3MFY A;  5CMD A;  1CT1 D;  4AH6 A;  3PO2 B;  5J22 A;  3LNN A;  3K0X A;  3T53 B;  5KYI A;  2JA8 H;  4BS9 A;  3OW7 A;  3D8G A;  3HOY B;  2JA6 G;  3KUP A;  1IW7 C;  3FKI H;  5FLX c;  5JJI A;  1AFP A;  1TKW B;  1CKM A;  2K03 A;  4JVZ A;  2CQA A;  2FXQ A;  2HCI A;  4MNO A;  3VYT A;  5A35 A;  2RSN A;  4CJ2 C;  1HTL D;  1Q1E A;  2DJG C;  1T9H A;  4KY6 A;  2IWH A;  3G4S A;  1YI2 A;  2JA7 G;  3SVM A;  4HIM A;  1TT2 A;  1IBK L;  2KVM A;  3L3O C;  4LUV A;  5C3E H;  5IGG A;  2F0V A;  1PYW D;  1EEF D;  4ZYS A;  2XWJ B;  4A3B H;  4AIM A;  4DV1 L;  5IP9 H;  2K01 A;  2TSS A;  5IP9 G;  2EJG C;  4DNR B;  1UE7 A;  1QUQ B;  1RL2 A;  4A3C H;  5M3M G;  3A54 A;  3A8I E;  3URY A;  2QEJ C;  1QE6 A;  2M2L A;  1I4H A;  1Q1B A;  2WIN B;  3DM1 A;  5M5X H;  4CKE A;  5I2Y A;  2R6G A;  3GTM H;  1YNN D;  5G3L D;  4JOI A;  4HCE A;  1JE4 A;  1LAB A;  2JSO A;  3H6M A;  4LF4 Q;  4F7X A;  2IL8 A;  1G2T A;  4O1N A;  4DR6 L;  4A3B B;  1GUT A;  2MFI A;  4Y52 H;  3CP0 A;  5M5W B;  2K33 A;  3S9W A;  4K8I A;  5I9O A;  3TS0 A;  1HA5 A;  1SE4 A;  1HQM C;  5C44 G;  1QVG A;  3Q22 A;  3K7U C;  2F0K A;  4HED A;  3GTQ H;  2IX3 A;  2ICE C;  3M7N A;  5IYB G;  2CCZ A;  4M8A A;  1YJ9 A;  4DAY B;  5ISR A;  1IW7 D;  1F9P A;  4NXN Q;  1SE3 A;  2D62 A;  3OTO Q;  2I5H A;  2KJX A;  3HKZ E;  1DYQ A;  1EIY B;  3CW2 C;  5CV6 A;  3NQI A;  2F4V L;  1SRU A;  1YJN A;  2F0N A;  4WRD A;  5C4J H;  2KEN A;  3C2P A;  2FIN B;  2RDF A;  2BE5 C;  4A3K H;  3HZX A;  1KQS A;  3WDN A;  2NYZ D;  5EBD A;  1B1Z A;  2R7F A;  3J7Z C;  5CGK A;  1KD1 C;  1YNX A;  1EIH A;  2B8F A;  3GO5 A;  4DK0 A;  4R4C A;  4C56 C;  4NXM Q;  2K5W A;  4IUT A;  1VS0 A;  3FPP A;  3W1G A;  1J5E L;  3S1Q B;  5C4X G;  1X65 A;  4XXE A;  4BBR B;  3RN5 A;  1BCP D;  1YHQ A;  5LMN L;  1KAW A;  1FGB D;  1KXL A;  3H0G H;  1TWF H;  2WAQ G;  3HKS A;  3NHH A;  4RMF A;  2E2I H;  1VQ4 A;  3KOJ A;  3SE0 A;  3PO3 G;  1BNZ A;  4H0L C;  4LFC Q;  3HOU H;  2ZJR A;  3TP8 A;  3DHQ A;  1HPC A;  4A3G B;  1FJG L;  4JI4 L;  3BYT B;  1STB A;  1TQO A;  1GHK A;  5C5L A;  2VS1 A;  3R2T A;  4JI6 L;  1Q86 C;  3K5L A;  2Z1C A;  4RAU C;  2F3V A;  2Z8L A;  1F9Q A;  4A3E H;  1E7Z A;  1KRS A;  2OCE A;  4L5R C;  1S4Z A;  4LUZ A;  3BU2 A;  1FNW A;  1PH8 A;  1PZJ D;  2PZU A;  4H02 A;  3GTP H;  3MVV A;  3VDY A;  1SMX A;  3U9S A;  3EQL C;  4OX9 Q;  4IO9 A;  2E2D C;  3S1N B;  2L5T A;  4IPH A;  2NVX B;  1V1O A;  4DV0 L;  1G6P A;  4DV3 Q;  1L0X B;  4QF4 A;  4K2K A;  3OMG A;  4WOR A;  4YCW A;  5FLX E;  2R3Z A;  3HOX G;  1PRT D;  3D4D A;  2IJ0 A;  1QG7 A;  2MNA A;  1LTA D;  4V0B A;  4BBS B;  3I56 A;  3S16 H;  1X3P A;  1VF5 C;  2L55 A;  3NTI A;  1EWI A;  3JAM i;  2JA5 H;  3H0G B;  3NTK A;  1VQB A;  4P2C B;  4NMZ A;  5J39 A;  1PZK D;  1Y1W B;  4UP9 A;  3PO3 B;  1G6Z A;  4I7A A;  5IP7 H;  4ODG A;  1ROD A;  2ASB A;  4DAM A;  2EY2 A;  3PUV A;  3G7L A;  4DV6 Q;  3QO2 A;  1MI2 A;  2ALY B;  4HSV A;  1YIT A;  1K8M A;  1JJG A;  3NBH B;  5M5X B;  1HUM A;  4DU9 A;  3R3O A;  1LTT D;  1OXX K;  2GN5 A;  1D6E C;  1JJC B;  2EVB A;  3D31 A;  3KLW A;  4A3K B;  4J15 A;  1JR0 D;  1IBL Q;  2A19 A;  4DV3 L;  2JA5 G;  4A93 G;  3A0J A;  2UXC Q;  4X66 L;  1P16 A;  2XSC A;  4U67 3;  2ICI A;  4AQY L;  1TU2 B;  4B3T L;  2YTX A;  3JC6 6;  1YJW A;  5JOB A;  3U4V A;  5IYB H;  1CKO A;  2OQK A;  1QB5 D;  1LO5 D;  1JJ2 A;  1I94 L;  1SDF A;  1SYC A;  4A3D G;  4DV7 L;  3DWP A;  2LSS A;  4RKB A;  1X56 A;  1VQP A;  1EWC A;  2RSO A;  4CKB A;  3CMA A;  1EY8 A;  4KKT A;  4DV2 L;  3PGZ A;  3QR8 A;  1JE5 A;  4R8I A;  3CME A;  1R4P B;  1SAP A;  3HOX B;  3R8B A;  2WB1 G;  4KMU C;  4B08 A;  1KIX A;  3VR2 A;  2B3G A;  1WTO A;  4XIG S;  2EYO A;  5IWA Q;  4DR5 L;  1EYD A;  3ND8 A;  1BBX C;  2OWO A;  1DOM A;  5IYD H;  4R4T A;  4QY7 A;  5I6Y A;  3ICE A;  1QVC A;  3M3Y H;  1KTK A;  2NB0 A;  1AP0 A;  1UWV A;  1CQF A;  2OXP A;  5EGT A;  4UAI A;  3ULJ A;  4ZAI A;  4H13 C;  3F2U A;  3CCJ A;  1FGU A;  1TWG B;  4A3J B;  5IY0 A;  4OO1 I;  1AEX A;  2EIF A;  1S5F D;  2FHT A;  1WTQ A;  4L6T B;  3AU7 A;  3GP7 A;  3T13 A;  5LMU L;  4PV1 C;  3UDX A;  4KTA A;  4EQP A;  2PW5 A;  4DR1 Q;  5EQ0 A;  2YTV A;  1G51 A;  3CC7 A;  1PYB A;  3BYY B;  1ILQ A;  1BXT A;  4ZKB B;  3GTL B;  3CPF A;  3BZK A;  4UY8 C;  1SE2 A;  2JJQ A;  4BBR G;  4N9P A;  3H3V I;  3DM3 A;  4M1U B;  4R4Q A;  4DR7 L;  2Q2I A;  3FVQ A;  5IYC G;  2YU9 H;  4C3H B;  4CDC C;  3RR5 A;  4L5Q A;  4ZK9 B;  5D65 A;  5EAY A;  2F0J A;  4TKO B;  3CD6 A;  4JBW A;  3LWU A;  2BDN A;  4OON A;  3BVZ A;  3GTP B;  1DGS A;  4FXD A;  1U5K A;  1X54 A;  1XPU A;  3H94 A;  4GNX A;  2UUC L;  3V05 A;  3KF8 B;  3K59 A;  3IRB A;  4BXX H;  1DXM A;  2MO1 A;  4DUY L;  5COY A;  1F2M A;  3RLO A;  3HOY G;  4RFB A;  1A6X A;  3I73 A;  4KLK A;  5BN5 A;  4ME3 A;  2D9U A;  2A5H A;  3SGI A;  2VZA A;  3HFZ B;  3KJO A;  2R92 H;  4KD3 A;  3CRK C;  4HMI A;  2L1B A;  4BY1 G;  3G71 A;  1C48 A;  4A3I G;  2A74 C;  3EA6 A;  5JEA H;  2Z6B A;  4IOC A;  3GTG H;  2PYK A;  3ITP A;  4ZRZ A;  1TS2 A;  2N8N A;  1EEI D;  4Q5V A;  3BJU A;  2JA7 B;  2VQF L;  1HR0 W;  3I4M B;  2Q2H A;  3E9I A;  2D2C C;  1SNC A;  2B2W A;  3E5S A;  5IP7 G;  1K83 H;  1JB7 A;  4DGZ A;  3M9B A;  4BWG B;  1WJJ A;  2AQ1 B;  1WTV A;  3PIO 3;  2Z9H A;  2IX0 A;  5C0X H;  4GKJ Q;  1ML0 D;  4MN3 A;  4R1J A;  4BY1 H;  3G6J B;  2PZT A;  4BY7 H;  4CJ1 B;  1IKL A;  4ZLT F;  1J5E Q;  3OYY A;  1XPR A;  2A68 C;  1KLU D;  3NSW A;  1SSO A;  1NJI C;  1XYI A;  1G2S A;  2E75 C;  3D4R A;  2Q8T A;  3D0F A;  1N33 L;  1OXU A;  1AH9 A;  2XNA C;  4QUC A;  3KF6 B;  4XTC S;  1BUV T;  1L2F A;  2F3I A;  3M7G A;  5M3M H;  3D3R A;  5J1Z A;  2AMC B;  3I2Z A;  4CHT B;  3TRE A;  3TME A;  2PCF B;  4L5T A;  5M5Y H;  5C0X G;  3JAM L;  1VQA A;  4IAL A;  1HFN A;  4YCV A;  2K6A A;  2D0O A;  3S1R H;  4QCL A;  4BA1 I;  3DXJ C;  1RKN A;  4YY3 Q;  3CHB D;  1PV4 A;  4RGO S;  3J81 j;  4A3M G;  4K5V A;  3KLS A;  4YWM A;  1B9N A;  3HOV G;  1GUG A;  1XX8 A;  4LF9 L;  4OX9 L;  2B2T A;  2A6H C;  3Q6S A;  4Q0F A;  1PH9 A;  2KHJ A;  1HNX L;  3BVM A;  5HUR A;  1HQR D;  2G5D A;  3K81 C;  3X3M A;  3QJY A;  3TRZ A;  3BG3 A;  3HOZ G;  5CV5 A;  4UHV A;  1VQE A;  5KYL A;  2F0E A;  1PFM A;  2ZTE A;  3ONA B;  2ZXP A;  4A3D H;  2VB3 X;  4KY5 A;  4LFA L;  5C4X B;  4OWW B;  4X62 Q;  2CQO A;  3BVG A;  3FEW X;  3RZO B;  1XMQ Q;  4B3R L;  4NXM L;  4HR7 B;  2LKV A;  2VUM G;  4DV4 L;  2QDL A;  1PFS A;  4DR6 Q;  1TXY A;  2HQE A;  3GTO B;  4DAP A;  3J80 i;  3T16 A;  1W3S A;  1OXT A;  2HUG A;  3TQY A;  4X65 L;  2X6L A;  2SNS A;  1K83 B;  1KDA A;  1T5X D;  1HZB A;  3I91 A;  3PIO A;  4CJ0 B;  3KF6 A;  1STH A;  4OWT B;  5IT9 L;  3OTO L;  4FF2 A;  2OT2 A;  1NBW A;  3NP8 A;  5C4Z A;  2HDL A;  1K8G A;  4JBJ A;  1NUC A;  2VNU D;  1D8L A;  1Q90 A;  1NR2 A;  3A74 A;  4DUZ Q;  3CRL C;  5T1I A;  3E3X A;  4BXX G;  5LMN Q;  4AQY Q;  2B29 A;  4WJW A;  2M00 A;  4NKL A;  2EYJ A;  5EBC A;  5FO9 B;  3H3V C;  3BDL A;  4HJ5 A;  4K8J A;  4LFA Q;  1CTM A;  1UE1 A;  2JP1 A;  4PG3 A;  2XWB B;  3GV3 A;  3IFD A;  1B44 D;  1Y8N B;  1HRJ A;  5J3B A;  5LMN W;  1MBY A;  1TR5 A;  3QOL A;  1CZW A;  2SNM A;  1I5F A;  2UXD L;  4DV7 Q;  4EVO A;  1N8R C;  2F0O A;  1BR9 A;  3AMU A;  4XQQ A;  2B2T C;  2VB2 X;  2YYZ A;  3FDT A;  1Q82 C;  1F9R A;  1YVC A;  5BR8 L;  4P74 A;  1CA6 A;  1F9S A;  2NWG A;  2WKC A;  5CV9 A;  4LFC L;  4CDE C;  2ATW A;  2KCN A;  3VR5 A;  5DEH A;  4GOP B;  5JJL A;  4BY1 B;  1E1T A;  4GLX A;  1D1K A;  1KC8 C;  4HAE A;  2B2V C;  1HJP A;  2NVX H;  4FF4 A;  1DJR D;  4LF7 L;  1YHA A;  1HA6 A;  1L0Y B;  5A2Q E;  3HOW H;  3HOX H;  2ZXR A;  2A1A A;  2JA7 H;  2HT1 A;  2R93 G;  3IKJ A;  4A93 B;  1PLF A;  3S14 B;  3SDZ A;  3PUY A;  4JI5 L;  1GUS A;  1X9N A;  1D2B A;  2A69 D;  3D4W A;  5LMU Q;  4KK7 A;  2A73 B;  3I3C A;  2K52 A;  3PCO B;  4PNY A;  2AQ3 B;  1M90 C;  1EQV A;  4GN5 A;  2UXD Q;  2R61 A;  4IUR A;  4JI1 L;  4FF1 A;  1N36 Q;  3MXP A;  2UUB Q;  2LY7 A;  2PW7 A;  4NPS A;  2F0S A;  4I7Z C;  1CUK A;  3HOW G;  2UUA Q;  3HKZ B;  3KFU A;  2L15 A;  2KQ3 A;  4JV5 L;  3CCQ A;  2R7Z B;  4BY7 B;  3ULL A;  1B9M A;  3A7L A;  3T1Y L;  4HMJ A;  5FOB B;  4CGY B;  2F3W A;  2X69 A;  4EGV A;  2B8G A;  3UDI A;  1N32 Q;  3I4O A;  3K8A A;  1TWA H;  2M9V A;  4V19 0;  1CI3 M;  1PTO H;  2NVQ B;  1SXT A;  1LTS D;  1IBL L;  4DR2 Q;  2JA6 B;  1Y1V G;  2IHE A;  4JI3 Q;  1WD1 A;  1FL0 A;  1QWY A;  1S72 A;  3OIP A;  3DWA A;  4A3J G;  3S17 B;  1I4R A;  3PV0 A;  1BBW A;  3GTK B;  4IFD J;  2Y0S B;  4S3S A;  2CWP A;  4KHZ A;  1U4R A;  3I55 A;  5I4D A;  1Y8P B;  3KDF B;  1OXV A;  2KCC A;  1Z6H A;  4C3I G;  4A76 A;  2PZW A;  3FHW A;  5M3M B;  4PMW A;  4DV2 Q;  3OWF A;  3FP9 A;  1FNV A;  1B7Y B;  2UUA L;  2K14 A;  3R93 A;  2N55 A;  2NVQ H;  4JV5 Q;  3MA2 B;  3UDG A;  3S2D H;  4DNT B;  5HGQ A;  3KDF A;  2A6E D;  2NVY B;  4IPC A;  5IYC H;  5E7N A;  4RCO A;  1NE3 A;  3H0G G;  1A3T A;  1AZP A;  1E2V A;  2KEC A;  5IE8 A;  3GTJ H;  4C3H G;  4L63 B;  1R9T H;  4LF6 L;  4GNX C;  1O7Z A;  1EY0 A;  1DZ1 A;  3CQZ H;  2I46 A;  2UU9 Q;  4X3U A;  3P75 A;  2DNE A;  4FXG C;  2KHI A;  1V1P A;  3U4Z A;  3FKI G;  3FPU B;  5FJ8 G;  1U4L A;  4JYA L;  1K73 C;  1IYU A;  3ND9 A;  2JXM B;  2XVS A;  3AFQ A;  5IT9 E;  4ZUJ A;  1EY5 A;  2NZH A;  5EKK A;  3OSO A;  5ELC A;  1H9R A;  4DUY Q;  5C3X A;  4G7O C;  4JI8 Q;  4KN7 C;  1E2W A;  1K3B C;  2KA7 A;  1QOH A;  2GVB A;  1F2L A;  4FNF A;  3Q8D A;  2LXK A;  2HIX A;  3L0O A;  3PIP 3;  5C6A A;  4DK3 C;  2NN6 I;  3M4Y A;  4LF5 Q;  1IBK Q;  3KJP A;  1E22 A;  3CCS A;  2DNC A;  4KN4 C;  4QB4 A;  1B3A A;  5COR A;  4FXK C;  4C3I B;  5D3D A;  3GTO H;  2EXD A;  3TDQ A;  5FLX L;  1EOV A;  3KF8 A;  1IYV A;  3GQB A;  1B3Q A;  1ZYR C;  4POF A;  5C4J B;  1EY7 A;  3PUZ A;  4DK1 A;  2NTS A;  5IOC A;  2RDG A;  1RTO A;  3A8K E;  4HSP A;  3SR1 A;  1TY0 A;  2UU9 L;  2NUC A;  4IUV A;  1EIG A;  3S15 H;  1O7I A;  2NN6 G;  5GAG C;  1NNX A;  1H95 A;  4K2L A;  4RH6 A;  1G8Z D;  2MPM A;  5EPL A;  2CW0 D;  1TY2 A;  1WTR A;  1GM5 A;  4GOP A;  4JBK A;  1ENA A;  2KBN A;  4Y7N H;  4N9T A;  1WI5 A;  4DXG A;  2Q2U A;  3NE5 B;  5KEE A;  4MZ9 A;  3M4O H;  1RF2 D;  2P5Z X;  3S1M B;  1PTO D;  4RCN A;  1A63 A;  3AQQ A;  2NN6 H;  3HOV B;  5CV4 A;  5M3F H;  1UNS A;  1TS4 A;  4JK1 C;  4A3M H;  1P8L A;  1K3R A;  1V1P B;  1I4G A;  1ASZ A;  1GOZ A;  1TWA B;  5IGE A;  2J4X A;  4DUZ L;  2DY7 A;  5M5Y B;  1UEB A;  1C4Q A;  4YY3 L;  1I3Q H;  5C44 H;  3L7Z C;  5JAV A;  1VQL A;  1SNM A;  1SEB D;  2ZTC A;  3T1H L;  1B50 A;  1D7Q A;  3PQI A;  2KED A;  1A2T A;  2E2J H;  1WVL A;  4BBS G;  5JEA J;  1K9M C;  3AB9 A;  1B2T A;  3S17 H;  3NBH A;  4YWK A;  3W1B A;  4JC0 A;  1E1O A;  2AUK A;  2PNH A;  2VUM B;  4A3F H;  4JOI C;  2WP8 J;  4C3I H;  3A5U A;  5ELF A;  1CHP D;  1EIF A;  2EYF A;  4Z9C B;  3SK8 A;  4RA8 A;  3O13 A;  2Z0S A;  1C8C A;  1KNE A;  5KND A;  1QNK A;  1SYG A;  1U9R A;  2SDF A;  3NXW A;  3KBX A;  3STB C;  4TQU S;  1CZG A;  4X62 L;  2Y0S G;  3QG1 A;  2FMM A;  2I5M X;  3P1H A;  4HJ9 A;  2KCT A;  4DFA A;  5FLM H;  1K28 A;  2B63 G;  4JI6 Q;  3CCL A;  2VW9 A;  3MEH A;  1SND A;  3M4O B;  3SK5 A;  2N49 A;  2Z4H A;  1CHQ D;  1MHW C;  4JI2 Q;  1EYA A;  4JI5 Q;  1VQ7 A;  4J6H A;  1TS5 A;  1XMO L;  1I50 H;  2A8V A;  4KV6 A;  1TVX A;  4DR4 L;  3CCR A;  1PH4 A;  1JWS D;  1AZQ A;  3SXH A;  3KLR A;  4ZCK A;  4AYB G;  1NCV A;  2PMZ B;  2K5N A;  2Z4I A;  1XTC D;  3CQZ B;  1SYD A;  1YNJ C;  3J81 L;  3HOY H;  3QB3 A;  4KD4 A;  3LGJ A;  3E0J A;  4A3D B;  1M8A A;  1B53 A;  1QUQ A;  2QW7 A;  4C3J G;  1SR3 A;  1N36 L;  1PHJ A;  3MFG A;  3TBI B;  3R2I A;  2JQO A;  2PI2 A;  1EU3 A;  3K80 C;  3H15 A;  3L9A X;  4UP7 A;  5IWA L;  2NBF A;  3OMC A;  3I4N G;  5H1S E;  2QA4 A;  1RHP A;  4ILW A;  1GJX A;  1GHJ A;  1B4O A;  3F2B A;  1XMQ L;  3J7A V;  4LFB Q;  1E3P A;  3BZC A;  4R9W A;  4X3S A;  1KDB A;  4JBM A;  1M4V A;  3I4L A;  1PTO B;  1ILP A;  3TP6 A;  1RIP A;  2K5V A;  1EYG A;  1N34 L;  1PH5 A;  1YNJ D;  4JI3 L;  5CC4 A;  1PFB A;  3RD4 A;  3N52 A;  4PMC A;  3K7A B;  5TSS A;  2EY5 A;  4HTH A;  4R4I A;  2WFW A;  1KL9 A;  2ES2 A;  4ID6 A;  3I4N H;  5DM6 3;  2F0W A;  4K0K Q;  3GTQ B;  1I6H H;  1BVS A;  1UE5 A;  2N78 A;  2L11 A;  2QEX A;  2H1E A;  2I0Q A;  2EJF C;  1Q12 A;  4DV0 Q;  3CCE A;  4NW2 A;  4RGM A;  3HOZ B;  1EQQ A;  2XTI A;  3CPW A;  4DR7 Q;  1UEA B;  3FRP B;  4B3M Q;  4KJN A;  4JI0 Q;  1Z9F A;  3STB D;  4A4I A;  4DK6 C;  2Z6K C;  4G4K A;  2VQE Q;  2K1B A;  2VL6 A;  3NQT A;  1EL0 A;  2BOS A;  2ZJQ A;  4LF8 Q;  2R93 H;  4MIU A;  4N8F A;  5K5P A;  4EX5 A;  2MP1 A;  1ESR A;  1D5X C;  1H9K A;  2CH4 W;  4JG2 A;  1ENC A;  2FFK B;  1S5E D;  1STN A;  1Z47 A;  3HEJ A;  3W3A A;  1KAB A;  1NAP A;  3VA5 A;  2A6H D;  4HJ8 A;  3I4N B;  1KRT A;  1SNO A;  1VQN A;  2BE5 D;  3A55 A;  5JVH 3;  1OXS C;  2SEB D;  3I8Z A;  2OTJ A;  3P20 A;  3ERO A;  4NDX A;  1H9M A;  3UI2 A;  2IW3 A;  3JAM c;  4GNX B;  2IT1 A;  1VQG A;  1Y1V B;  2HQL A;  1O7Y A;  1S5C D;  3KYH C;  4IQZ A;  2J7Z A;  3J81 i;  4UDU C;  3K5N A;  2E76 C;  1SFO H;  4JI7 L;  3Q23 A;  3SK4 A;  2F52 A;  3J80 c;  2B2Y A;  3AEV A;  4A3I B;  1BOS A;  3V96 A;  4ULL A;  3TN2 A;  3L2P A;  1A2U A;  1DON A;  2K75 A;  1O7L A;  1KNA A;  2C5C A;  2KCM A;  4CDD C;  2XRS D;  3RLN A;  2HCC A;  3NUC A;  1V9P A;  1JMC A;  2K5D A;  4MHE A;  1JWU D;  3T1Y Q;  2E2H B;  2ZTD A;  3KK7 A;  3I4M G;  2EPB A;  2CVR A;  2JA9 A;  1NR4 A;  1X3Q A;  1GUN A;  3CCU A;  1I94 Q;  1HR0 L;  3S2D B;  3S24 A;  1EOT A;  1ASY A;  2PQA A;  4QQB X;  3MC0 B;  4RG1 A;  1I6V C;  1JC7 A;  4JPB W;  1FVI A;  3DLL A;  5IGD A;  5LL6 X;  4DPG A;  1D5Z C;  1EU4 A;  1HNZ Q;  5E3F A;  2EZV A;  2DGY A;  1EY4 A;  3OW2 A;  4DR5 Q;  3M85 A;  1I4P A;  4GKK L;  1NTG A;  3CU7 A;  4IFD G;  2WKD A;  4YIJ A;  4PMB A;  3T4A C;  5BN4 A;  2EY1 A;  3C3L A;  5ELO A;  2F0G A;  5ELB A;  1X6O A;  3J7Y W;  2R93 B;  1BKB A;  3CC2 A;  1TWH B;  2K05 A;  1CA5 A;  1J9O A;  3VR3 A;  1O80 A;  1IHZ A;  1PVO A;  2DY8 A;  2O5J C;  2B63 H;  2WB1 E;  4A3E B;  1ENF A;  3VYR A;  3CXC A;  5I2X A;  3VYU A;  4CBV A;  3I90 A;  4DNI A;  4A3M B;  5D14 A;  4HIO A;  1IBM Q;  4A3C G;  2B2U A;  1AE2 A;  4TVA B;  3HKZ G;  1TWH H;  3P7J A;  1E24 A;  1V1Q A;  2PO4 A;  1HCZ A;  3NWT A;  5DLQ E;  3VA7 A;  1EZ8 A;  3EFX D;  1TWC H;  4BY7 G;  5FJ8 H;  1A3V A;  3E6Z X;  1C0A A;  5D3I B;  4QGU A;  1YBY A;  1L1O A;  5C3W A;  1HH2 P;  1F2Z A;  2C9O A;  1BCP C;  1DCZ A;  3M4Q A;  4LF5 L;  1JT8 A;  4U68 A;  3PMF A;  2MO0 A;  3TP5 A;  4F8M A;  2EOT A;  1WTP A;  3UE1 A;  3VR4 A;  4A93 H;  1MSG A;  1Y1W G;  3K57 A;  1VQF A;  1YNN C;  4I65 A;  4GOP C;  1PH6 A;  1JWM D;  3TZU A;  1UAP A;  1VF7 A;  1SMY D;  5KNB A;  1S5D D;  4HIK A;  2I07 B;  1SN8 A;  3MWY W;  2K5Q A;  4ZQ3 A;  2JA6 H;  3NEL A;  4IPD A;  4LAA A;  4PZ7 A;  1C7Y A;  3MXN B;  2B2W C;  1IBM L;  1LV9 A;  3MXN A;  2LXJ A;  4FDB A;  1EYC A;  1YHB A;  2JA5 B;  3QWN A;  4NB3 A;  4RGN A;  2KHS A;  5JVG 3;  1XNR Q;  1I50 B;  4OEM B;  4DR4 Q;  3W2D A;  2NTT A;  5JPN C;  2F0U A;  1T5E A;  4LUO A;  1IKM A;  2JE6 I;  3T51 B;  4WJ4 A;  5T1G A;  1I4X A;  2ENB A;  2BDO A;  1DOL A;  1TS3 A;  4IJH A;  3GTG B;  1X3G A;  3K7A H;  1QZG A;  2PQE A;  4KKU A;  5E4W C;  1HNW Q;  2BA1 A;  3MHB A;  4RHR A;  3H09 A;  2L0C A;  1BDO A;  1G29 1;  1D5M C;  1CKN A;  1JCK B;  2HDM A;  1HZ9 A;  1BQQ T;  3ZYY X;  4J1M A;  2CWA A;  2PNR C;  3E9H A;  2K32 A;  4HCS A;  2WB1 B;  3I70 A;  1CSQ A;  1WYD A;  3S2H H;  4LNQ A;  2GVA A;  1L1O B;  1X55 A;  2RHS B;  4QMG A;  2F4I A;  5ELN A;  4B9W A;  3DEP A;  3M4P A;  4C2M H;  4C1N K;  4B3R Q;  3MZ5 A;  1ICF B;  2B2V A;  2F0F A;  4KHV A;  1WTX A;  2L4N A;  3PF4 A;  4POG A;  2QCP X;  1YEZ A;  4ALP A;  1IYJ B;  1N34 Q;  1PTO C;  1JOO A;  1H9S B;  2A6E C;  1GO3 E;  2F0Q A;  3HP3 A;  4LWC A;  4JW0 A;  5DNF A;  1BO0 A;  4C3H H;  3DMU A;  2B39 A;  3BDC A;  2IHF A;  2WV6 D;  3A8J E;  1E2Z A;  1RDP D;  2F0L A;  4LF9 Q;  5I9P A;  1M1K C;  3K5M A;  4P73 A;  1BF4 A;  2AWN A;  2E2I B;  2L12 A;  1PXU A;  4OHJ A;  1CM9 A;  1LTI D;  2K4K A;  3J81 E;  1N9W A;  3WOF A;  5CBA E;  2PPB C;  1PZI D;  1V43 A;  2NVY H;  3HOW B;  2RA4 A;  1WCM B;  2F0T A;  2O4X A;  3MEF A;  4L8J A;  4IOA A;  5GAD C;  5GAH C;  4B3M L;  3S1M H;  4A3L H;  4ZUI A;  3T1H Q;  1K8A C;  3DEO A;  2ZXO A;  5LHY 1;  3OOC A;  4QIW E;  1FNU A;  3OIQ A;  1FJG Q;  3NEN A;  4DV4 Q;  2KUM A;  2R7Z G;  1JQY D;  4DAY A;  4XYQ A;  1SJH D;  3NK9 A;  4DR3 Q;  4IFD H;  4GN4 B;  2UXB L;  3CF5 A;  4JI2 L;  4DKA C;  4RGT A;  3CCV A;  2X6G A;  4O0A A;  2E5L L;  1AN8 A;  4O2D A;  3T56 B;  3I7F A;  2K28 A;  1TWC B;  2RCF A;  4NXN L;  5JEA G;  4LMQ D;  1LLR D;  4LF7 Q;  1ET9 A;  2AKW B;  2H4O A;  2WII B;  1RD9 D;  1VQ9 A;  3GD7 A;  1EWH A;  3IL8 A;  2F0I A;  3RZO H;  3C1F A;  2Q2T A;  2RQX A;  2UXC L;  1CFM A;  4IUN A;  2C35 B;  2CW0 C;  2WAC A;  1XMO Q;  1L0W A;  1DOK A;  1XJV A;  4LJZ C;  1FD7 D;  4OO1 H;  5JJZ A;  1X3E A;  1SNP A;  4HJA A;  1CSP A;  3J7A F;  3RN2 A;  3TP7 A;  2MQH A;  2R7D A;  4G57 A;  4C1N I;  2EXZ A;  1U4P A;  1NY4 A;  4EQO A;  5IGB A;  1A15 A;  3H3V H;  5BN3 A;  3MAQ A;  2EJM A;  3MXG A;  1XNQ L;  2V1C C;  5C3E G;  4GLV B;  3CKI B;  4KKS A;  1PYS B;  2FJ2 A;  2CKZ B;  4X64 L;  1Y1W H;  1CQV A;  5GAE C;  1PRT B;  3SHL A;  1N32 L;  4OIJ A;  4XT1 B;  4O42 A;  1MD2 D;  1QJO A;  2JEA I;  2B2Y C;  4NP5 A;  4H7B A;  1Q46 A;  4IZ8 A;  3FKI B;  4DR2 L;  4N8X 1;  1XPO A;  1OTC A;  1YIJ A;  1EFI D;  2HIV A;  3VR6 A;  1A8V A;  4B3T Q;  2CH4 A;  5M3F G;  3S1Q H;  1SYE A;  1VCI A;  2WAQ E;  1JOR A;  4P75 A;  3W5O A;  1IL2 A;  3HOV H;  5C5M A;  1S40 A;  3N6R A;  2K04 A;  5F2D A;  2Q8I B;  1SYB A;  3IAY A;  1VQ6 A;  2HHH Q;  3U58 A;  4LF8 L;  2QF7 A;  1H9J A;  3K0Y A;  2RCN A;  2RVL A;  3C1E A;  1Z7T A;  2G9H D;  3GTM B;  1LTB D;  2ZM6 Q;  5FO7 B;  4BBS H;  3EIV A;  3HOZ H;  3GTK H;  1XWE A;  2BH8 A;  3HG9 A;  2AQ2 B;  1Y8O B;  1XTD A;  1LM0 A;  1BBU A;  4X64 Q;  1TWG H;  3DUZ A;  3EVQ A;  1ZYR D;  3NTH A;  4A3F G;  1VQO A;  3AFP A;  1VMP A;  4CKC A;  4DF7 A;  3BS1 A;  2VUM H;  2IPK D;  2EYP A;  4B3S L;  1GVP A;  1LTR D;  1VDZ A;  4FYD A;  2A68 D;  3H91 A;  3K6O A;  4DV5 Q;  3S14 H;  4FP5 D;  4LF6 Q;  1SJE D;  4OEL B;  2PMZ E;  2IY5 B;  5CYU A;  4LW1 A;  1S3O A;  4DA2 A;  4RWS C;  5AJ3 L;  1U4M A;  4A3L G;  4FVM A;  1K0S A;  1B70 B;  4DAV A;  1I3Q B;  5C44 B;  1F77 A;  1Q81 C;  1GUW A;  5K36 H;  2BA0 A;  3BZD B;  4RHS A;  3RZD H;  1LAC A;  4A3E G;  4K6L A;  4TSS A;  1HR0 Q;  4DR1 L;  5C4H A;  2OEO A;  2B2U C;  1Q8K A;  2D5D A;  3HOU G;  2CHB D;  5FK9 C;  4H44 C;  1AE3 A;  1MGS A;  2VXW A;  4KHP L;  4IFD I;  2EY6 A;  2OTL A;  3J7A 5;  1NMF A;  4X66 Q;  4HID A;  1HNZ L;  2NZ1 D;  1S5B D;  1PH7 A;  1G91 A;  1HZC A;  2RF4 A;  4A75 A;  1STG A;  2R92 G;  3RMH A;  2QKI C;  5EPJ A;  4Y7N B;  5CV8 A;  4PQX A;  3RNU A;  3GTL H;  1YZ6 A;  4HJ7 A;  4UPA A;  1QCB D;  1RTN A;  1VQH A;  2SOB A;  1HUN A;  5AFW A;  5JJK A;  1PRT F;  5IGF A;  1PH2 A;  3PIP A;  2ZJP A;  5GQO A;  2K5H A;  5IOD A;  3PO2 G;  2WAQ B;  1I4Q A;  4K6D A;  1QNU A;  4GKK Q;  1QIL A;  4GZY C;  1LUZ A;  1EUJ A;  1Q3L A;  5EPK A;  1KDC A;  1MSH A;  1JIC A;  4WJ3 M;  1J6Q A;  1WTH A;  4JYA Q;  3JAM E;  5A2Q L;  2RKS A;  2JYO A;  1EFW A;  2O5I C;  3TS2 A;  2NVT H;  1PRT C;  4WFN 3;  1UE6 A;  2H5X A;  4A3I H;  3RLF A;  2MHV A;  1PFN A;  1MKH A;  1MIU A;  2B63 B;  1SFO B;  4PZ8 A;  1D1I A;  1PTO F;  3MXU A;  4AYB B;  4LF4 L;  4LK1 C;  4G7Z C;  2BH2 A;  1K0R A;  1KLG D;  3HOU B;  1VQD A;  1Q7Y C;  2F4V Q;  2XGT A;  1NSN S;  2J0T D;  5KRU A;  3S1N H;  3OWE B;  1TWF B;  2KEE A;  2N88 A;  4F87 A;  5KGU A;  4OL7 A;  2D0P A;  3D6W A;  1FR3 A;  5NUC A;  3PUW A;  4C3J B;  2EYH A;  4YCU A;  1CKN B;  1XNR L;  2V4D A;  1ZEQ X;  3HGB A;  1SBB B;  1GXD C;  2JA8 B;  2RBM A;  5KIX A;  1VQM A;  1SRO A;  1H9S A;  4PZ6 A;  1EY6 A;  3TZD A;  1ICW A;  3GDE A;  4IUP A;  4ZKC B;  4KY7 A;  3BDO A;  2E2H H;  1VQ8 A;  2E2J B;  2MGS A;  3S1R B;  1II3 A;  2O2L D;  5C4X H;  5KNC A;  3DWQ A;  3LX0 A;  1QVF A;  5HY6 A;  1GKH A;  4IJL A;  5IGC A;  1WOC A;  2NZO A;  2OF1 A;  4OIK A;  3NWS A;  1JB3 A;  3ERQ A;  3EBE A;  2PI2 E;  2NVT B;  4J8Q A;  1R4Q B;  3NBI A;  4APV A;  4OGQ C;  1HNX Q;  3GTJ B;  2F0D A;  4UP8 A;  3S16 B;  4DXF A;  1DM0 B;  4DV1 Q;  2L9H A;  4AYB E;  1Y69 U;  3PF5 A;  2EQS A;  2RDH A;  2VY3 A;  2VQF Q;  1GUO A;  5M5W H;  1STA A;  2EDG A;  2EE1 A;  5IIF A;  4QL5 A;  3TEH B;  3G6E A;  4BA2 I;  1LTL A;  1ZKO A;  1EQR A;  3F2D A;  4K5X A;  1JOK A;  3PSI A;  5K36 G;  4KJO A;  1IL8 A;  4GN3 B;  5C0X I;  4JI4 Q;  4GKJ L;  3ZJY C;  4XDX A;  1LT6 D;  4XQN A;  1UUP A;  2QGQ A;  1W2B A;  1MJC A;  2EYL A;  3KLS X;  3Q24 A;  4A3G G;  1U0L A;  2Y0S E;  5DM7 3;  3J80 E;  4X3K A;  1OO9 B;  5JPM C;  1JOQ A;  3ER0 A;  3IFT A;  1L1O C;  1N33 Q;  5FKA C;  3SK6 A;  1Q8I A;  1MJE A;  5BR8 Q;  2DJF C;  1A3U A;  2OQ0 A;  2JA8 G;  3A56 A;  2DUD A;  4EQ5 A;  4X3T A;  3ERS X;  2EYM A;  4DV6 L;  1TII D;  1HHV A;  2RHQ B;  1EQT A;  2GA4 B;  1SLJ A;  4ABN A;  1PH3 A;  4XT3 B;  4K14 A;  4R8N A;  2F0H A;  4MTK A;  3A5Z B;  3AYH B;  5EKL A;  2CFM A;  3UDF A;  4DR3 L;  3U50 C;  4OXP A;  1HFG A;  4K5W A;  1DD2 A;  2AHO B;  4P71 A;  3PO2 H;  2R7Z H;  1X3F A;  1HTP A;  4HN7 A;  1IXR A;  5CBE E;  5HGT A;  1ONL A;  1SMY C;  2QDB A;  3F1Z A;  4K0K L;  1E0B A;  1PMR A;  4OO1 G;  5CV7 A;  2AUJ D;  4XQJ A;  4JI1 Q;  2KOL A;  3U9O A;  4GS3 A;  3K58 A;  4FO2 A;  2ZM6 L;  1PH1 A;  4YHH Q;  1J8I A;  2UXB Q;  1WTW A;  3ULP A;  1VQK A;  4JI0 L;  2LFN A;  4RKL A;  5CR3 A;  5EKI A;  5C3E B;  5L37 A;  3B6Y A;  1ZXT A;  4OWX B;  5C0X J;  4CDF C;  1FYC A;  1LT5 D;  4LFB L;  5LL6 S;  1LTG D;  1O78 A;  2F1M A;  2XIW A;  4X6A H;  2E74 C;  2XRQ D;  3G48 A;  1W6J A;  4B3S Q;  1R9T B;  1WD0 A;  1CK1 A;  3VYS A;  4A3B G;  5M9O A;  3EJI A;  3CCM A;  3RUZ A;  3X3N A;  4XYO A;  3QIA A;  5AJ3 Q;  4X65 Q;  2E5L Q;  1RJT A;  1W6K A;  4QJF A;  2ZT9 C;  1EZ6 A;  5M3F B;  3SEB A;  1F2Y A;  2F03 A;  1GD7 A;  4JCV E;  3RZD B;  4IPG A;  5E4X A;  3E0E A;  4A3K G; 
#chains in the Genus database with same CATH homology
 3TSS A;  1SYF A;  4IUU A;  2Q8R E;  4E6I A;  2QIL A;  3C46 A;  2TMP A;  1BCP B;  1EY9 A;  5DAU A;  3HS0 C;  3OHX C;  3LWE A;  2G9D A;  4QUF A;  1STY A;  5G3L F;  4TRD A;  1LT3 D;  1HXY D;  3FMC A;  5ELE A;  4A3F B;  1XXG A;  2XN9 C;  1KAA A;  3GV6 A;  2MJ8 A;  3KBG A;  3QOJ A;  1V8Q A;  4ME5 A;  3M3Y B;  2MUY A;  3J80 L;  2LMC B;  2BCO A;  1LT4 D;  4C2M B;  4IUQ A;  5EJW A;  2AWO A;  3S2H B;  3D6C A;  4DN4 M;  3HRZ C;  1VMC A;  1X32 A;  4QIW B;  1I6H B;  2A69 C;  5I6W A;  2LS0 1;  3OPO A;  2F0P A;  1SNQ A;  3NPP A;  3I72 A;  1AW7 A;  1STE A;  2DN8 A;  5FO8 B;  2K7V A;  2JEB I;  2R92 B;  1ET6 A;  2F0M A;  3PUX A;  4FF3 A;  5E1F A;  4EQN A;  3V2T A;  4KI0 A;  3MTS A;  2IX1 A;  3WOE A;  4IN3 A;  3S15 B;  1RCV D;  5ELD A;  4G7H C;  1PDQ A;  1K8O A;  3Q0A A;  1BCP F;  3K5O A;  2ID0 A;  4F88 A;  2FMC A;  1ESF A;  4B9X A;  2YU9 B;  3A7A B;  3MFY A;  5CMD A;  1CT1 D;  3PO2 B;  5J22 A;  3LNN A;  3T53 B;  5KYI A;  4BS9 A;  3OW7 A;  3D8G A;  3HOY B;  3KUP A;  1IW7 C;  1AFP A;  1TKW B;  2K03 A;  2CQA A;  2HCI A;  3VYT A;  5A35 A;  2RSN A;  4CJ2 C;  1HTL D;  1Q1E A;  4KY6 A;  2IWH A;  3SVM A;  1TT2 A;  2KVM A;  3L3O C;  5IGG A;  2F0V A;  1PYW D;  1EEF D;  4ZYS A;  2XWJ B;  2K01 A;  2TSS A;  2EJG C;  4DNR B;  3A54 A;  3A8I E;  3URY A;  2QEJ C;  1QE6 A;  2M2L A;  1I4H A;  1Q1B A;  2WIN B;  3DM1 A;  4CKE A;  5I2Y A;  2R6G A;  1YNN D;  5G3L D;  4HCE A;  1JE4 A;  1LAB A;  2JSO A;  3H6M A;  4F7X A;  2IL8 A;  1G2T A;  4O1N A;  4A3B B;  1GUT A;  5M5W B;  2K33 A;  3S9W A;  4K8I A;  5I9O A;  1HA5 A;  1SE4 A;  1HQM C;  3Q22 A;  2F0K A;  4HED A;  2IX3 A;  2ICE C;  3M7N A;  4M8A A;  5ISR A;  1IW7 D;  1F9P A;  1SE3 A;  2D62 A;  2KJX A;  1DYQ A;  5CV6 A;  3NQI A;  2F0N A;  4WRD A;  3C2P A;  2FIN B;  2RDF A;  2BE5 C;  3HZX A;  3WDN A;  2NYZ D;  5EBD A;  1B1Z A;  5CGK A;  1EIH A;  2B8F A;  3GO5 A;  4DK0 A;  4C56 C;  2K5W A;  4IUT A;  3FPP A;  3S1Q B;  4XXE A;  4BBR B;  1BCP D;  1FGB D;  3NHH A;  3SE0 A;  1BNZ A;  4H0L C;  3TP8 A;  3DHQ A;  1HPC A;  4A3G B;  3BYT B;  1STB A;  1TQO A;  1GHK A;  5C5L A;  3R2T A;  3K5L A;  2Z1C A;  4RAU C;  2F3V A;  2Z8L A;  1F9Q A;  1S4Z A;  1FNW A;  1PZJ D;  2PZU A;  3MVV A;  3U9S A;  3EQL C;  2E2D C;  3S1N B;  2L5T A;  2NVX B;  1V1O A;  1L0X B;  4QF4 A;  4K2K A;  3OMG A;  4WOR A;  5FLX E;  2R3Z A;  1PRT D;  3D4D A;  2IJ0 A;  1QG7 A;  1LTA D;  4V0B A;  4BBS B;  1X3P A;  1VF5 C;  2L55 A;  3NTI A;  3H0G B;  3NTK A;  4P2C B;  4NMZ A;  5J39 A;  1PZK D;  1Y1W B;  3PO3 B;  1G6Z A;  4ODG A;  1ROD A;  2EY2 A;  3PUV A;  3G7L A;  3QO2 A;  1MI2 A;  4HSV A;  1K8M A;  5M5X B;  1HUM A;  4DU9 A;  3R3O A;  1LTT D;  1OXX K;  3D31 A;  1D6E C;  2EVB A;  4A3K B;  1JR0 D;  2XSC A;  4U67 3;  2ICI A;  1TU2 B;  5JOB A;  1QB5 D;  1LO5 D;  1SDF A;  1SYC A;  3DWP A;  4RKB A;  1EWC A;  2RSO A;  4CKB A;  1EY8 A;  4KKT A;  4R8I A;  1R4P B;  1SAP A;  3HOX B;  3R8B A;  4KMU C;  4B08 A;  3VR2 A;  1WTO A;  4XIG S;  2EYO A;  1EYD A;  3ND8 A;  1BBX C;  1DOM A;  5I6Y A;  1KTK A;  2NB0 A;  1AP0 A;  1CQF A;  2OXP A;  5EGT A;  4UAI A;  4ZAI A;  4H13 C;  3F2U A;  1TWG B;  4A3J B;  4OO1 I;  1AEX A;  1S5F D;  2FHT A;  1WTQ A;  4L6T B;  3T13 A;  3AU7 A;  3GP7 A;  4PV1 C;  4KTA A;  4EQP A;  2PW5 A;  5EQ0 A;  3BYY B;  1ILQ A;  1BXT A;  4ZKB B;  3GTL B;  1SE2 A;  4N9P A;  4M1U B;  3FVQ A;  4C3H B;  4ZK9 B;  5D65 A;  2F0J A;  4TKO B;  4JBW A;  3LWU A;  2BDN A;  3BVZ A;  3GTP B;  4FXD A;  3H94 A;  3V05 A;  3K59 A;  1DXM A;  5COY A;  1F2M A;  4RFB A;  1A6X A;  3I73 A;  5BN5 A;  2D9U A;  2A5H A;  4KD3 A;  3CRK C;  4HMI A;  2L1B A;  1C48 A;  2A74 C;  3EA6 A;  5JEA H;  2PYK A;  3ITP A;  4ZRZ A;  1TS2 A;  1EEI D;  4Q5V A;  2JA7 B;  3I4M B;  2D2C C;  1SNC A;  2B2W A;  3E5S A;  4DGZ A;  4BWG B;  2AQ1 B;  1WTV A;  3PIO 3;  2IX0 A;  5C0X H;  1ML0 D;  4MN3 A;  3G6J B;  2PZT A;  4CJ1 B;  1IKL A;  4ZLT F;  2A68 C;  1KLU D;  3NSW A;  1SSO A;  1XYI A;  1G2S A;  2E75 C;  3D4R A;  2Q8T A;  1OXU A;  2XNA C;  4QUC A;  4XTC S;  1BUV T;  3M7G A;  3D3R A;  5J1Z A;  4CHT B;  3TME A;  2PCF B;  5C0X G;  3JAM L;  4IAL A;  1HFN A;  2K6A A;  4QCL A;  4BA1 I;  3DXJ C;  1RKN A;  3CHB D;  4RGO S;  4K5V A;  3KLS A;  1B9N A;  1GUG A;  1XX8 A;  2B2T A;  2A6H C;  3Q6S A;  4Q0F A;  3BVM A;  5HUR A;  1HQR D;  3X3M A;  3QJY A;  3BG3 A;  5CV5 A;  5KYL A;  2F0E A;  1PFM A;  3ONA B;  2ZXP A;  2VB3 X;  4KY5 A;  5C4X B;  3BVG A;  3FEW X;  3RZO B;  4HR7 B;  2LKV A;  2HQE A;  3GTO B;  4DAP A;  3T16 A;  1OXT A;  2HUG A;  2X6L A;  2SNS A;  1K83 B;  1KDA A;  1T5X D;  3I91 A;  4CJ0 B;  1STH A;  5IT9 L;  4FF2 A;  2OT2 A;  3NP8 A;  5C4Z A;  2HDL A;  1NUC A;  2VNU D;  1Q90 A;  1NR2 A;  3CRL C;  5T1I A;  4WJW A;  2M00 A;  4NKL A;  2EYJ A;  5EBC A;  5FO9 B;  3H3V C;  3BDL A;  4K8J A;  1CTM A;  2JP1 A;  2XWB B;  3GV3 A;  3IFD A;  1B44 D;  1Y8N B;  1HRJ A;  1MBY A;  1TR5 A;  3QOL A;  1CZW A;  2SNM A;  4EVO A;  2F0O A;  1BR9 A;  3AMU A;  4XQQ A;  2B2T C;  2VB2 X;  2YYZ A;  3FDT A;  1F9R A;  1CA6 A;  1F9S A;  2NWG A;  2WKC A;  5CV9 A;  2KCN A;  3VR5 A;  5DEH A;  4BY1 B;  1D1K A;  4HAE A;  2B2V C;  4FF4 A;  1DJR D;  1HA6 A;  1L0Y B;  5A2Q E;  2ZXR A;  3IKJ A;  4A93 B;  1PLF A;  3S14 B;  3SDZ A;  3PUY A;  1GUS A;  1D2B A;  2A69 D;  3D4W A;  4KK7 A;  2A73 B;  3I3C A;  4PNY A;  2AQ3 B;  1EQV A;  2R61 A;  4IUR A;  4FF1 A;  3MXP A;  2LY7 A;  2PW7 A;  2F0S A;  4I7Z C;  3HKZ B;  2KQ3 A;  2R7Z B;  4BY7 B;  1B9M A;  3A7L A;  4HMJ A;  5FOB B;  4CGY B;  2F3W A;  2X69 A;  4EGV A;  2B8G A;  2M9V A;  4V19 0;  1CI3 M;  1PTO H;  2NVQ B;  1SXT A;  1LTS D;  2JA6 B;  1WD1 A;  1QWY A;  3OIP A;  3DWA A;  3S17 B;  1I4R A;  3PV0 A;  4IFD J;  3GTK B;  2Y0S B;  4S3S A;  4KHZ A;  1U4R A;  5I4D A;  1Y8P B;  1OXV A;  2KCC A;  1Z6H A;  4C3I G;  2PZW A;  5M3M B;  4PMW A;  3OWF A;  1FNV A;  3R93 A;  2N55 A;  3MA2 B;  4DNT B;  2A6E D;  2NVY B;  4RCO A;  1AZP A;  1A3T A;  1E2V A;  2KEC A;  4C3H G;  4L63 B;  1O7Z A;  1EY0 A;  1DZ1 A;  2I46 A;  4X3U A;  3P75 A;  2DNE A;  4FXG C;  1V1P A;  3FPU B;  1U4L A;  1IYU A;  3ND9 A;  2JXM B;  2XVS A;  5IT9 E;  4ZUJ A;  1EY5 A;  5EKK A;  3OSO A;  5ELC A;  1H9R A;  5C3X A;  4G7O C;  4KN7 C;  1E2W A;  2KA7 A;  1QOH A;  1F2L A;  4FNF A;  3PIP 3;  5C6A A;  2NN6 I;  3M4Y A;  2DNC A;  4KN4 C;  4QB4 A;  1B3A A;  5COR A;  4FXK C;  4C3I B;  5D3D A;  3TDQ A;  5FLX L;  3KF8 A;  1IYV A;  3GQB A;  1ZYR C;  5C4J B;  1EY7 A;  3PUZ A;  4DK1 A;  2NTS A;  5IOC A;  2RDG A;  1RTO A;  3A8K E;  4HSP A;  3SR1 A;  1TY0 A;  2NUC A;  4IUV A;  1EIG A;  2NN6 G;  4K2L A;  4RH6 A;  1G8Z D;  2MPM A;  5EPL A;  2CW0 D;  1TY2 A;  1WTR A;  1ENA A;  4N9T A;  4DXG A;  3NE5 B;  5KEE A;  1RF2 D;  3S1M B;  1PTO D;  4RCN A;  2NN6 H;  3HOV B;  5CV4 A;  1UNS A;  1TS4 A;  4JK1 C;  1V1P B;  1I4G A;  1GOZ A;  1TWA B;  5IGE A;  2J4X A;  2DY7 A;  5M5Y B;  1C4Q A;  3L7Z C;  5JAV A;  1SNM A;  1SEB D;  1B50 A;  2KED A;  1A2T A;  1WVL A;  5JEA J;  3AB9 A;  1B2T A;  3NBH A;  2AUK A;  2VUM B;  2WP8 J;  5ELF A;  1CHP D;  2EYF A;  4Z9C B;  3SK8 A;  4RA8 A;  3O13 A;  1C8C A;  1KNE A;  5KND A;  1QNK A;  1SYG A;  1U9R A;  2SDF A;  3NXW A;  3KBX A;  4TQU S;  1CZG A;  3QG1 A;  2FMM A;  3P1H A;  4DFA A;  3MEH A;  1SND A;  3M4O B;  3SK5 A;  2Z4H A;  1CHQ D;  1EYA A;  4J6H A;  1TS5 A;  4KV6 A;  1TVX A;  1JWS D;  1AZQ A;  3SXH A;  3KLR A;  1NCV A;  2PMZ B;  2Z4I A;  1XTC D;  3CQZ B;  1SYD A;  1YNJ C;  3J81 L;  3QB3 A;  4KD4 A;  3E0J A;  4A3D B;  1M8A A;  1B53 A;  4C3J G;  3MFG A;  3TBI B;  3R2I A;  1EU3 A;  3L9A X;  2NBF A;  3OMC A;  1RHP A;  4ILW A;  1GJX A;  1GHJ A;  1B4O A;  3J7A V;  4R9W A;  4X3S A;  1KDB A;  1M4V A;  3I4L A;  1PTO B;  1ILP A;  3TP6 A;  1YNJ D;  5CC4 A;  1PFB A;  3RD4 A;  3N52 A;  4PMC A;  3K7A B;  5TSS A;  2EY5 A;  4HTH A;  4ID6 A;  5DM6 3;  2F0W A;  3GTQ B;  2L11 A;  2H1E A;  2EJF C;  1Q12 A;  4NW2 A;  4RGM A;  3HOZ B;  1UEA B;  3FRP B;  4KJN A;  4G4K A;  2K1B A;  3NQT A;  1EL0 A;  2BOS A;  4MIU A;  5K5P A;  2MP1 A;  1ESR A;  1D5X C;  1H9K A;  1ENC A;  2FFK B;  1S5E D;  1STN A;  1Z47 A;  3HEJ A;  3W3A A;  1KAB A;  1NAP A;  3VA5 A;  2A6H D;  3I4N B;  1SNO A;  2BE5 D;  3A55 A;  5JVH 3;  1OXS C;  2SEB D;  3I8Z A;  3P20 A;  3ERO A;  4NDX A;  1H9M A;  3UI2 A;  2IW3 A;  2IT1 A;  1Y1V B;  1O7Y A;  1S5C D;  4IQZ A;  2J7Z A;  4UDU C;  3K5N A;  2E76 C;  3Q23 A;  3SK4 A;  2B2Y A;  4A3I B;  1BOS A;  3V96 A;  4ULL A;  3TN2 A;  1A2U A;  1DON A;  1O7L A;  1KNA A;  2C5C A;  2XRS D;  2HCC A;  3NUC A;  2K5D A;  4MHE A;  1JWU D;  2E2H B;  3KK7 A;  2EPB A;  2CVR A;  1NR4 A;  1X3Q A;  1GUN A;  3S2D B;  1EOT A;  3MC0 B;  1I6V C;  1JC7 A;  5IGD A;  5LL6 X;  1D5Z C;  1EU4 A;  5E3F A;  2EZV A;  1EY4 A;  3M85 A;  1I4P A;  3CU7 A;  4IFD G;  2WKD A;  4YIJ A;  4PMB A;  3T4A C;  5BN4 A;  2EY1 A;  3C3L A;  2F0G A;  5ELB A;  3J7Y W;  2R93 B;  1TWH B;  2K05 A;  1CA5 A;  1J9O A;  3VR3 A;  1O80 A;  1IHZ A;  2DY8 A;  2O5J C;  4A3E B;  1ENF A;  3VYR A;  5I2X A;  3VYU A;  4CBV A;  3I90 A;  4A3M B;  5D14 A;  2B2U A;  3P7J A;  2PO4 A;  1HCZ A;  3NWT A;  3VA7 A;  1EZ8 A;  3EFX D;  1A3V A;  3E6Z X;  5D3I B;  5C3W A;  1F2Z A;  2C9O A;  1BCP C;  1DCZ A;  4U68 A;  3PMF A;  3TP5 A;  4F8M A;  2EOT A;  1WTP A;  3VR4 A;  1MSG A;  3K57 A;  1YNN C;  4I65 A;  1JWM D;  3TZU A;  1UAP A;  1VF7 A;  1SMY D;  5KNB A;  1S5D D;  2I07 B;  3MWY W;  2K5Q A;  4ZQ3 A;  4LAA A;  2B2W C;  1LV9 A;  3MXN A;  1EYC A;  2JA5 B;  3QWN A;  4RGN A;  2KHS A;  5JVG 3;  1I50 B;  3W2D A;  2NTT A;  5JPN C;  2F0U A;  1T5E A;  1IKM A;  2JE6 I;  3T51 B;  5T1G A;  1I4X A;  2ENB A;  2BDO A;  1DOL A;  1TS3 A;  3GTG B;  5E4W C;  2PQE A;  4KKU A;  2BA1 A;  3MHB A;  4RHR A;  3H09 A;  2L0C A;  1BDO A;  1G29 1;  1D5M C;  1JCK B;  2HDM A;  1BQQ T;  3ZYY X;  4J1M A;  2PNR C;  2K32 A;  4HCS A;  2WB1 B;  3I70 A;  4QMG A;  2F4I A;  4B9W A;  3DEP A;  4C1N K;  3MZ5 A;  2B2V A;  2F0F A;  1WTX A;  4KHV A;  2L4N A;  2QCP X;  1PTO C;  1JOO A;  1H9S B;  2A6E C;  2F0Q A;  3HP3 A;  5DNF A;  1BO0 A;  3DMU A;  2B39 A;  3BDC A;  2WV6 D;  3A8J E;  1E2Z A;  1RDP D;  2F0L A;  5I9P A;  3K5M A;  1BF4 A;  2AWN A;  2E2I B;  2L12 A;  1PXU A;  4OHJ A;  1CM9 A;  1LTI D;  3J81 E;  3WOF A;  5CBA E;  2PPB C;  1PZI D;  1V43 A;  3HOW B;  2RA4 A;  1WCM B;  2F0T A;  2O4X A;  4L8J A;  4ZUI A;  3DEO A;  2ZXO A;  5LHY 1;  3OOC A;  1FNU A;  3OIQ A;  2KUM A;  1JQY D;  4DAY A;  4XYQ A;  1SJH D;  3NK9 A;  4IFD H;  4RGT A;  2X6G A;  1AN8 A;  3T56 B;  2K28 A;  1TWC B;  5JEA G;  4LMQ D;  1LLR D;  1ET9 A;  2H4O A;  2WII B;  1RD9 D;  3GD7 A;  1EWH A;  3IL8 A;  2F0I A;  3C1F A;  2RQX A;  1CFM A;  4IUN A;  2CW0 C;  2WAC A;  1DOK A;  4LJZ C;  1FD7 D;  4OO1 H;  5JJZ A;  1SNP A;  3J7A F;  3TP7 A;  4G57 A;  4C1N I;  2EXZ A;  1U4P A;  4EQO A;  5IGB A;  1A15 A;  5BN3 A;  3MAQ A;  2EJM A;  3MXG A;  3CKI B;  4KKS A;  2FJ2 A;  1CQV A;  1PRT B;  3SHL A;  4OIJ A;  4XT1 B;  4O42 A;  1MD2 D;  1QJO A;  2JEA I;  2B2Y C;  4NP5 A;  4H7B A;  4IZ8 A;  3FKI B;  1EFI D;  3VR6 A;  1SYE A;  1VCI A;  1JOR A;  5C5M A;  3N6R A;  2K04 A;  5F2D A;  2Q8I B;  1SYB A;  3IAY A;  2QF7 A;  1H9J A;  3K0Y A;  2RVL A;  3C1E A;  1Z7T A;  2G9H D;  3GTM B;  1LTB D;  5FO7 B;  1XWE A;  3HG9 A;  2AQ2 B;  1Y8O B;  3DUZ A;  3EVQ A;  1ZYR D;  3NTH A;  1VMP A;  4CKC A;  4DF7 A;  3BS1 A;  2IPK D;  2EYP A;  1LTR D;  1VDZ A;  4FYD A;  2A68 D;  3H91 A;  3K6O A;  4FP5 D;  1SJE D;  5CYU A;  4DA2 A;  4RWS C;  1U4M A;  4FVM A;  4DAV A;  1I3Q B;  5C44 B;  1F77 A;  1GUW A;  5K36 H;  2BA0 A;  3BZD B;  4RHS A;  1LAC A;  4K6L A;  4TSS A;  5C4H A;  2OEO A;  2B2U C;  2D5D A;  2CHB D;  5FK9 C;  4H44 C;  1MGS A;  2VXW A;  4IFD I;  2EY6 A;  2NZ1 D;  1S5B D;  1G91 A;  1STG A;  3RMH A;  2QKI C;  5EPJ A;  4Y7N B;  5CV8 A;  4PQX A;  1QCB D;  1RTN A;  2SOB A;  1HUN A;  5AFW A;  1PRT F;  5IGF A;  5IOD A;  2WAQ B;  1I4Q A;  4K6D A;  1QNU A;  1QIL A;  4GZY C;  1Q3L A;  5EPK A;  1KDC A;  1MSH A;  1JIC A;  3JAM E;  5A2Q L;  2RKS A;  2JYO A;  2O5I C;  1PRT C;  4WFN 3;  3RLF A;  2MHV A;  1PFN A;  2B63 B;  1SFO B;  1D1I A;  1PTO F;  3MXU A;  4AYB B;  4LK1 C;  4G7Z C;  1KLG D;  3HOU B;  1NSN S;  2J0T D;  5KRU A;  3OWE B;  1TWF B;  2KEE A;  2N88 A;  4F87 A;  5KGU A;  4OL7 A;  3D6W A;  1FR3 A;  5NUC A;  3PUW A;  4C3J B;  2EYH A;  2V4D A;  1ZEQ X;  3HGB A;  1SBB B;  1GXD C;  2JA8 B;  2RBM A;  5KIX A;  1H9S A;  1EY6 A;  3TZD A;  1ICW A;  4IUP A;  4ZKC B;  4KY7 A;  3BDO A;  2E2J B;  2MGS A;  3S1R B;  1II3 A;  2O2L D;  5KNC A;  3DWQ A;  3LX0 A;  5IGC A;  2OF1 A;  4OIK A;  3NWS A;  1JB3 A;  3ERQ A;  2NVT B;  4J8Q A;  1R4Q B;  3NBI A;  4OGQ C;  3GTJ B;  2F0D A;  3S16 B;  4DXF A;  1DM0 B;  2L9H A;  1Y69 U;  2RDH A;  1GUO A;  1STA A;  2EDG A;  2EE1 A;  5IIF A;  4BA2 I;  1ZKO A;  4K5X A;  1JOK A;  5K36 G;  1IL8 A;  4KJO A;  5C0X I;  4XDX A;  1LT6 D;  4XQN A;  1UUP A;  2EYL A;  3KLS X;  3Q24 A;  5DM7 3;  3J80 E;  4X3K A;  1OO9 B;  5JPM C;  1JOQ A;  3IFT A;  5FKA C;  3SK6 A;  1Q8I A;  1A3U A;  3A56 A;  4X3T A;  1HHV A;  2EYM A;  1TII D;  1EQT A;  2GA4 B;  4ABN A;  4XT3 B;  4K14 A;  4R8N A;  2F0H A;  5EKL A;  1HFG A;  4K5W A;  1DD2 A;  1HTP A;  4HN7 A;  5CBE E;  5HGT A;  1ONL A;  1SMY C;  2QDB A;  1E0B A;  1PMR A;  4OO1 G;  5CV7 A;  2AUJ D;  4XQJ A;  2KOL A;  3U9O A;  3K58 A;  4FO2 A;  1J8I A;  1WTW A;  2LFN A;  4RKL A;  5CR3 A;  5EKI A;  5C3E B;  1ZXT A;  5C0X J;  1FYC A;  1LT5 D;  5LL6 S;  1LTG D;  1O78 A;  2F1M A;  2XIW A;  2E74 C;  2XRQ D;  1W6J A;  1R9T B;  1WD0 A;  1CK1 A;  3VYS A;  5M9O A;  3EJI A;  3RUZ A;  3X3N A;  4XYO A;  3QIA A;  1RJT A;  1W6K A;  2ZT9 C;  1EZ6 A;  5M3F B;  3SEB A;  1F2Y A;  2F03 A;  3RZD B;  5E4X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...