1IYVA

Lipoyl domain of pyruvate dehydrogenase complex, nmr, 29 structures
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
79
structure length
79
Chain Sequence
SEIIRVPDIGGDGEVIELLVKTGDLIEVEQGLVVLESAKASMEVPSPKAGVVKSVSVKLGDKLKEGDAIIELEPAAGAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DIHYDROLIPOAMIDE ACETYLTRANSFERASE COMPONENT OF PYRUVATE DEH
publication title Three-dimensional structure in solution of the N-terminal lipoyl domain of the pyruvate dehydrogenase complex from Azotobacter vinelandii.
pubmed doi rcsb
molecule tags Acyltransferase
total genus 6
structure length 79
sequence length 79
ec nomenclature ec 2.3.1.12: Dihydrolipoyllysine-residue acetyltransferase.
pdb deposition date 1996-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00364 Biotin_lipoyl Biotin-requiring enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1iyvA00
3RLFA 3WDNA 4KKUA 1HCZA 1Y8OB 4XTCS 4DNRB 1Q12A 3T53B 2A68D 2A69C 3BG3A 1O78A 4LK1C 3PUVA 3KLRA 2CW0C 2A6EC 4RCNA 3PV0A 2B8GA 4G7HC 1VCIA 3I4LA 4KMUC 3VA7A 2AUJD 2EJGC 3PUXA 1HTPA 1CTMA 3W3AA 5KNCA 5BN3A 2L5TA 3ND9A 1Z6HA 1O7LA 1V43A 1GUTA 2E74C 4H0LC 4XIGS 3VR5A 1ZYRC 3A8IE 3ND8A 2D5DA 1GHKA 2PCFB 1VF7A 3I72A 3IKJA 1HPCA 4TKOB 1H9RA 1TKWB 1H9MA 3H94A 2A68C 3QIAA 4OO1H 4IQZA 1B9NA 1FYCA 2R6GA 2JEBI 3TZUA 1TU2B 1OXXK 2EJFC 4LJZC 3VR2A 4GZYC 2BE5C 2F1MA 1OXVA 3OW7A 2K32A 2KCCA 2ZT9C 2AWOA 2O5IC 2BA1A 4IFDG 3OPOA 1OXSC 1DXMA 3M7NA 2A6HC 3MXUA 1GUNA 4OGQC 2YYZA 3EQLC 3SE0A 3SDZA 3PUZA 2KA7A 2BE5D 1CI3M 1ONLA 2JE6I 3CRKC 1Q90A 1YNNC 1H9KA 4DNTB 2PPBC 3NE5B 5JEAH 2JEAI 2A6HD 1T5EA 3VR4A 1IYUA 1LACA 1A6XA 1VF5C 2JXMB 1GUGA 1HQMC 2DN8A 4L8JA 1GUSA 5BN5A 4BA1I 3PUYA 2PNRC 3VR6A 5A35A 1Y8NB 2K7VA 3IFTA 4JK1C 1DCZA 2NN6H 1GJXA 1LABA 4KN7C 3N6RA 1EWHA 4KN4C 3M85A 1QJOA 4JBWA 4KI0A 2DNCA 4KHZA 4HR7B 3M4YA 5K36H 4OO1G 1VDZA 2EDGA 2B8FA 2E75C 3A7AB 2K33A 2NN6G 5C0XH 1OXTA 2D62A 3A8JE 1ZKOA 3FMCA 1IW7D 3OOCA 1Q1EA 4PV1C 3BDOA 1SMYC 3LWUA 3U9SA 1E2VA 2EJMA 2V4DA 5KNDA 1E2ZA 1B9MA 4H13C 3AB9A 5BN4A 1E2WA 4DK1A 1YNJC 3GQBA 4BA2I 2BDOA 1Z7TA 1H9SB 3VR3A 2BA0A 2EVBA 3MFYA 1Y69U 1V8QA 2NN6I 1OXUA 5KNBA 3HGBA 3GD7A 1PMRA 4KKTA 5JEAG 1K8MA 2DNEA 1DD2A 1GHJA 3QG1A 2D2CC 3QJYA 1CFMA 4TQUS 4G7OC 2QF7A 3A7LA 1IW7C 3DXJC 4DK0A 4I7ZC 1G291 2Q8IB 3P20A 3A8KE 3T51B 3D4RA 2A69D 2E76C 3CRLC 4KKSA 3T56B 4G7ZC 1Y8PB 3PUWA 1BDOA 3I73A 1IYVA 2LMCB 3L7ZC 1Q1BA 2A6ED 1H9JA 4H44C 2O5JC 1FR3A 1K8OA 5K36G 1I6VC 4IFDH 3LNNA 3D31A 2IT1A 1H9SA 5C0XG 3FPPA 1GUOA 2AUKA
chains in the Genus database with same CATH superfamily
4KKUA 1KIXA 5T1IA 4DKAC 1W6KA 4A3CG 4A3FG 3RR5A 5ISRA 2X6LA 5JJIA 3NPPA 3W3AA 5T1GA 4IOAA 1AZQA 2JA6H 4X65Q 1HPCA 1H9RA 2L15A 5IT9L 3CW2C 3ERQA 3NQIA 1XNQL 1VQOA 4DXGA 2F03A 4CKCA 4ALPA 3RUZA 1Q81C 2X69A 2WV6D 2B63H 1KDCA 5GQOA 2XRQD 1SFOH 2K5WA 1V1PB 1CHPD 2JA7H 1EYAA 2QKIC 4NXMQ 2B2TC 1N8RC 5DM73 5COYA 2EIFA 4A3IB 4PQXA 3H3VC 4XQQA 5IP9G 4DR4Q 4RH6A 3IFTA 2IHFA 4K5XA 5IE8A 1EY0A 3D3RA 2OTJA 4KHZA 4DF7A 3DMUA 1DOLA 5IODA 2JYOA 3S17B 2I46A 2K6AA 3H6MA 4K8IA 4YY3Q 4TRDA 1SE8A 3I8ZA 3BVMA 5KNBA 5KNDA 3KOJA 1SMYC 5FK9C 1WTOA 1PVOA 5FLMG 1EQVA 4C3IG 1STBA 2KHSA 3HOZB 4BA2I 4IPHA 4R4IA 1H9SB 1I94L 2E2DC 5J39A 1HA5A 3HFZB 3R8BA 3CMEA 4DR7Q 3OMCA 4DR1Q 2KHIA 4K5WA 4G7OC 4DV4Q 1CFMA 3GTPH 4R1JA 5M5YB 4A3JB 4C2MB 2XRSD 3L7ZC 2ZTEA 3MFGA 2XNAC 3J80E 2LKVA 4AYBE 2F0KA 5IGDA 1QB5D 3EVQA 4YWLA 3STBD 2NBFA 1WTQA 1PTOF 3RLFA 4LF4L 1Y8OB 4TVAB 1E0BA 5M5XB 3BG3A 1D1KA 1WOCA 3TS0A 2OWOA 1XNQQ 3PUVA 2OQ0A 5C4XH 4JYAL 5NUCA 3AQQA 3NTKA 1C9OA 1UE7A 4X3UA 4CKBA 5CBAE 4DXFA 4CGYB 3JAMc 2E74C 2XWJB 3STBC 1SYBA 4OELB 3BYYB 4DR3L 4TKOB 3A56A 1EY4A 3H09A 3AEVA 2CHBD 4Q0FA 2E2HH 1ZYRD 2F1MA 2BCOA 4DPGA 2RSNA 2KCCA 1F2YA 3EJIA 4IUUA 1GXDC 3P7JA 4DR6L 3S1QH 1PDQA 3HKZG 1M1KC 1BCPB 2F0TA 2L0CA 1LV9A 5C6AA 5L37A 3PSIA 1IHZA 3S1NB 4DV3L 1XWEA 3DWPA 1SNCA 1DGSA 4BY7H 1F9RA 1CKNA 2PNRC 2NVTB 1X9NA 3NTHA 3TZDA 2HHHL 2UUAL 3KJOA 1EWHA 2R93B 1Y1WB 2IHEA 1TIID 1DONA 1SE4A 1JMCA 1RIPA 1I94Q 1D5MC 2UUBL 3HOUG 2Z4IA 3KF8A 4JC0A 1VDZA 2ZJQA 3A7AB 3HOXG 1ZKOA 5JPMC 4JI3L 2A5HA 3S2DH 4DUZL 1A15A 2F0GA 2HCCA 1IYJB 2Q2TA 1XNRL 2I0QA 4Y7NH 1K9MC 4JVZA 4A3KH 1I4PA 1B2TA 3M3YH 1YITA 5IGGA 3EBEA 2NVYB 1PMRA 3U50C 4DAVA 1Y1VG 1K73C 1SYFA 1MSHA 2KOLA 2P5ZX 1GVPA 1K83B 1CZWA 1STEA 3DXJC 4FNFA 4LF4Q 1EEID 1V9PA 4B9WA 1RF2D 4JYAQ 3ERSX 3BDLA 1YBYA 4UAIA 1IKLA 2JSOA 3D31A 2RQXA 1SDFA 2MNAA 4OEMB 4DR3Q 1Q12A 1A0IA 3OMGA 3K7UC 5I9OA 2TSSA 1KABA 3MZ5A 2EYJA 4G7HC 2Z8LA 2K5VA 5M5WH 3W2DA 1N32L 4DR6Q 2PMZE 2OEOA 2EXDA 2VZAA 4POFA 1QVFA 1CKOA 3J80L 1VQKA 1XMOL 3OWFA 4KLKA 3QIAA 1HRJA 1BVSA 2ZXPA 4GLVB 1RL2A 4DV3Q 5C3EG 4FP5D 5M3MB 4NDXA 1TWCH 2WAQB 4ZYSA 2BA1A 2IX3A 1WTHA 1K3BC 3VYRA 2MPMA 1EIFA 4OGQC 1KRTA 2HHHQ 1SROA 2XTIA 2UUAQ 3AU7A 1U4MA 2B63G 1EY5A 1F9QA 3V2TA 2UUBQ 3J81c 1FNWA 1E22A 5I2YA 4K5VA 1R4QB 3A5ZB 2JA7G 2WFWA 1EFWA 4JI3Q 1FGUA 4K2LA 2R7ZH 4DUZQ 1NBWA 3AFPA 5GROA 4CDDC 2NZ1D 1XNRQ 4KN7C 3M85A 1NJIC 4JBWA 2F0MA 4XYQA 2ASBA 3GO5A 1V1PA 4OO1G 1FVIA 1HNWL 1K8GA 1XXGA 4QJFA 2PI2A 1B4OA 1SLJA 5DLQE 1P8LA 1PFSA 5GADC 3K58A 5EPKA 5LMUL 3I4NH 4H13C 1HFGA 5J1ZA 4IUNA 4DV7L 3LGJA 5ELOA 3H15A 1WCMH 4A3DG 4WJ3M 3GD7A 1NSNS 2NWGA 1GHJA 4FXDA 4XXEA 3RZOB 1E1TA 4RGMA 1PH5A 2NTTA 4PZ8A 3U4ZA 4F8MA 4P72A 1Y8PB 3I3CA 5DAUA 1JWSD 1O7YA 3EFXD 4C3HB 5C4JB 4FF1A 4A75A 3VYSA 5LMNW 4IFDH 1N32Q 3NP8A 4RKLA 2E2JH 2QEXA 2JA8H 1H9SA 3DUZA 3I55A 3CC4A 3L9AX 1K0SA 4HCEA 1XMOQ 1SSOA 4C3IB 4I65A 2IY5B 1CA6A 4YWMA 1YHAA 4XQJA 2KEDA 3GTKH 1EYDA 5FJ8H 3S16B 5FOBB 5C4XG 2F0OA 2JN4A 1EOVA 3H94A 2B2WC 5ELNA 3TQYA 4GZYC 2X6GA 1O80A 2A73B 2ZM6L 1VQ6A 3MHBA 3OPOA 3FEWX 2L1BA 3F8TA 3K7AB 3MXUA 4QMGA 3GTGB 4N9TA 1CI3M 3MTSA 5KIXA 4A93G 5I2XA 1D2BA 5IY0A 1JB3A 4J15A 1HNWQ 5ELCA 1VF5C 2G9HD 2BH2A 4X66L 2ALYB 3KFUA 1QILA 1J6QA 3WWVA 1PZJD 4KJNA 5LMUQ 4G4KA 1GJXA 5A2QL 4ILWA 1E1OA 4KI0A 4DV7Q 1N33L 1C0AA 4BY7G 3NEMA 1TWGB 1NMFA 3BJUA 3FRPB 2YTVA 2K5NA 3BZDB 3JAML 3BDOA 2KEEA 1XTCD 1B9MA 4N8FA 3HKZB 2DY7A 2NZOA 5HY6A 3K59A 3K5LA 1U5KA 2Z9HA 4DGZA 3T4AC 4AIMA 1S5CD 3CHBD 1R9TH 2F4VL 3ZYYX 3J80i 2VB3X 3T56B 3PIPA 4GOPC 1VQGA 2N55A 4LMQD 4P2CB 4AYBG 2RSOA 4LFBL 1ENCA 2VUMG 2PW5A 2A6ED 3M9BA 1AW7A 3CXCA 1K8OA 2C35B 3MEHA 3E9IA 3HOUB 3WOEA 4ZKCB 3HOXB 2Y0SE 4DV0L 2RDFA 4KD4A 3CQZH 1AZPA 2RKSA 4HIMA 1HZBA 1O78A 4LK1C 4A3EB 3HOYG 1MD2D 2OF1A 2A6EC 3NUCA 5IYDG 2PNHA 1LTAD 3C3LA 4Y52H 1N34L 2L4NA 2ZM6Q 4Z9CB 4B9XA 3PO3H 3CMAA 1VQPA 1Y1VB 3DWQA 4IPCA 1RTNA 2CFMA 2PCFB 4JBJA 4MTKA 3D0FA 3TRZA 5IT9E 1HJPA 3MA2B 1B9NA 1SR3A 1VQDA 2HIVA 2K32A 5CMDA 2F3VA 4X66Q 3FP9A 1A62A 2A6HC 1TWFB 3J7A5 1PTOD 1AE3A 2KA7A 2BE5D 4HJ7A 2R7FA 2F0WA 4QGUA 1N33Q 1BXTA 3OTOL 2VXWA 3FDTA 1D5ZC 2FINB 3I4OA 1HQMC 2IPKD 4FVMA 3TSSA 1YJWA 4L8JA 1PXUA 2E5LL 3CCEA 1B3AA 1TWAH 1YEZA 4S3SA 4DK3C 1DZ1A 1B8AA 1YNJD 1SNDA 1PH7A 3M4YA 5CYUA 5H1SE 2L12A 1CQFA 1PRTF 1SNQA 3S15B 1OXTA 4GN3B 5C3EB 2UXDL 1CZGA 4HMIA 2F0HA 3OOCA 4DNTB 2F4VQ 4ZK9B 1E2ZA 4OL7A 1HNZL 3GTLH 3NBHB 2GN5A 5BN4A 1Z9FA 2HUGA 1YNJC 4LFBQ 2A1AA 1SE2A 2B63B 3I4MG 2MGSA 3TN2A 2XVSA 1PH4A 2A8VA 2EYFA 1BO0A 4YCWA 5JEAG 3I4NG 3TP5A 5J22A 4KJOA 1J9OA 4DV0Q 1GM5A 1QNUA 3GTOB 4RMFA 5C3WA 1WCMG 3HOVG 3KJPA 3FKIH 2EOTA 3CRLC 3IFDA 3PIO3 4X3TA 5IGEA 1IYVA 2AKWB 3NTIA 2LMCB 4CBVA 3V05A 1N34Q 4ZAIA 2ZJRA 1E24A 5DEHA 3FPPA 2JA5G 3A0JA 3KBXA 2F0SA 2K75A 3UDIA 4K6LA 3NELA 3K57A 2ZTCA 4R9WA 5IWAL 1UWVA 4CJ2C 4R8NA 3VA7A 3S1MB 3PUXA 1SNMA 1HTPA 4C1NK 4A3DB 5CV6A 5BN3A 2ATWA 1Z6HA 2B2YA 1A8VA 2JQOA 1I4HA 2WKCA 1GUWA 3URYA 3OTOQ 1AFPA 2SEBD 4DV5L 4QIWB 3H0GB 1PH8A 1T5XD 2H1EA 4F88A 1J5EL 1U9RA 1S40A 2ZT9C 2O5IC 4NW2A 3L3OC 2E5LQ 4HAEA 2UXBL 1XTDA 3EQLC 3M4OH 1S5FD 2JE6I 5G3LF 1X3EA 2WKDA 1Q90A 2FMMA 5D65A 1G51A 2Z6KA 1A3UA 4JV5L 1GUSA 1VQ4A 2UXDQ 1CK1A 2H5XA 3VR6A 5IGFA 1WI5A 1HFNA 3E5SA 4J1MA 1HNZQ 2KECA 1JQYD 3GTQH 1VQEA 1ILQA 5AFWA 4DV6L 4N8X1 2F0LA 5EBCA 4IJHA 3R2IA 4UP7A 2B2VC 1K28A 3J7ZC 3CPWA 1KQSA 4A3BH 1HH2P 1TWHH 2HIXA 1TT2A 4ME3A 5LL6X 4BY1H 1ICFB 2E2IB 1IBKL 4L63B 2XWBB 1D5XC 1VQMA 5IP7H 1PH1A 5M3FH 4LF8L 1LO5D 4GN4B 5EKLA 2LSSA 3O13A 4A93B 1SMYD 5EQ0A 5IYCG 1I4QA 2D2CC 1ET9A 4KD3A 3ULLA 1PYBA 4KV6A 4A3LG 5HGTA 3P20A 1UE6A 3GTJB 4HSVA 1YNXA 4KKSA 2PW7A 1DM0B 1CSQA 5IWAQ 2EYHA 1H9JA 3M4QA 3SR1A 2Z6BA 3KLSX 1AEXA 4DUYL 1WTXA 4YCVA 3X3NA 1BR9A 1JICA 3IRBA 2D0OA 4OWWB 4JBMA 3GTMH 4ZUJA 3PO2H 4DV5Q 4CKEA 1I50H 1FGBD 1J5EQ 1L1OB 5C44H 1I6HH 1I3QB 1LT6D 4DFAA 5KNCA 3QOJA 1L0WA 4RWSC 1HZCA 3K80C 1JCKB 1VMCA 2NVXB 2UXBQ 4EQNA 3LWEA 1I4XA 2K01A 2D5DA 1MKHA 4IFDI 4JOIC 1TKWB 2R92B 2PQAB 4K2KA 5IIFA 5KYIA 4QUFA 1FYCA 3PO3G 1UEAB 1C4QA 3L2PA 2K4KA 2RHQB 4AYBB 3HOWH 4BBSH 2VUMB 4JV5Q 2OCEA 5CV8A 4ZRZA 1GUNA 5C0XJ 4JI2L 4BBRB 3NHHA 1F77A 2V1CC 1TR5A 3OSOA 4C3JB 4B3MQ 1Q46A 4DV6Q 3RLNA 1C7YA 5EGTA 3HOYB 1J8IA 2D0PA 3CCVA 2PZWA 1F9PA 3D6CA 1I5FA 1IBKQ 3PUYA 4P74A 3TP7A 4PMBA 4LFCL 3VYTA 3NWTA 2NN6H 2B2TA 1KDAA 1PFBA 1STYA 1EZ8A 1JB7A 4A3MG 1PZKD 2NTSA 4LF8Q 1IKMA 4OHJA 4RKBA 5FLXc 1STHA 2M9VA 1STAA 4JI4L 3L0OA 2FJ2A 1PH3A 4WRDA 4YHHL 1EYGA 1E2WA 1GD7A 1ESRA 5BR8L 4A3GG 3ITPA 4O42A 3VDYA 1Z7TA 4A3IH 5EAYA 2DUDA 4ZKBB 2I5MX 4IOCA 3GV3A 4KKTA 1K8MA 3BZCA 1DD2A 3V96A 1JORA 4DUYQ 3SEBA 4UP8A 4X6AH 3S17H 4EGVA 4IUPA 1EU4A 1EWIA 3NSWA 4IPDA 1BF4A 4ABNA 2Y0SG 3NBHA 4KY7A 1CM9A 3S2HB 2VQFQ 4FF2A 3HOZH 1G6PA 2EY5A 4DNRB 1A2UA 1HCZA 4XYOA 2R3ZA 5ELBA 2WB1E 2DY8A 5C5LA 3S14B 1P16A 4KY5A 3RZDB 2HDMA 5K5PA 3CCJA 2N49A 2F0QA 5FKAC 3OIPA 4OWXB 3I4MB 5M5YH 3BS1A 4A3JH 4H0LC 4XIGS 1X56A 4C2MH 3RNUA 4JI2Q 5JVG3 1MSGA 3HOVB 1EIYB 1JC7A 1IBML 3HP3A 4EQ5A 5M5XH 1G91A 3DM1A 2I5LX 1DYQA 2YYZA 4LFCQ 3SDZA 2JA5B 4LF9L 4MIUA 1VQ5A 2NVQB 3CRKC 1H9KA 2Q2HA 4JI5L 4QF4A 3I2ZA 3W1GA 2NYZD 2KQ3A 4B3RL 2JXMB 1HQRD 4H7BA 4JI4Q 4MTNA 3TP8A 1X3GA 2OT2A 1S72A 4HJ9A 4P73A 3Q8DA 4YHHQ 3S1RB 1BQQT 4FYDA 1D6EC 5BR8Q 1NR2A 5A2QE 2JA6G 3ULPA 4UDUC 3E0EA 5GAEC 4GS3A 2F52A 1KC8C 3T16A 4JW0A 1JWUD 2EDGA 4JCVE 4HJ8A 2K33A 5C0XH 4RGNA 4HIKA 1LUZA 1YZ6A 1IBLL 1AP0A 3D4DA 2F0VA 5E3FA 3JAME 3PCOB 2Q8TA 4PMWA 4A3FB 3S1NH 2PZTA 2K5DA 2RDHA 4A3BG 1WJJA 3R93A 3RN2A 5CV5A 4DAPA 4BY1G 4KTAA 2BA0A 4LF7L 2F0UA 1YHQA 3UI2A 2NVTH 1VQBA 3EA6A 1AE2A 1IL8A 1CA5A 4QB4A 2DNEA 1B53A 1PFMA 1Y1WH 2R93H 2QEJC 1LTRD 3E6ZX 4AH6A 1RCVD 1SXTA 1YJNA 4P75A 3I70A 4G7ZC 3KBGA 4NKLA 3OWEB 3P75A 3G7LA 1SRUA 2J7ZA 4OXPA 2O5JC 4GNXC 4RG1A 3KUPA 1PRTD 5C4ZA 1TS2A 4BXXH 3DWAA 2ZXRA 4XTCS 5IYBH 2EQSA 3AFQA 3E0JA 2NVYH 2IX1A 1A63A 1B1ZA 1IBMQ 2ID0A 4RCNA 1K83H 1PRTC 5I4DA 4HEDA 2RBMA 1K8AC 2L5TA 3W5OA 2I5HA 4J8QA 3K8AA 2EY2A 1EY7A 1NTGA 1TS5A 2SOBA 3PO2G 3ND8A 2F0JA 4HMJA 2XGTA 4LF9Q 1EOTA 4L5RC 4JI5Q 4B3RQ 4LW1A 4LF5L 1HTLD 1MJEA 4CDEC 4OONA 1C8CA 1L1OA 1SE3A 1TS4A 2UU9L 1QZHA 1PTOB 2J0TD 2Z0SA 3TBIB 3SHLA 2F3WA 2JEAI 2LY7A 2PQAA 4RCOA 3OHXC 4C56C 3MXGA 1BUVT 1IBLQ 4UY8C 2KENA 2M00A 1PH6A 5JAVA 1Y8NB 2K7VA 2ZTDA 4JI6Q 1HZ9A 1LTBD 5J3BA 4IZ8A 1WVLA 1FNUA 5M3MH 4WORA 1EZ6A 1VS0A 3OIQA 1L2FA 5K36H 4LF7Q 3RN5A 1LTTD 1SJHD 3PF5A 2NN6G 2MQHA 1W3SA 2EJMA 4A3CH 5C4HA 2PQEA 4DK1A 1LT4D 5EPJA 2HCIA 5G3LD 4HCSA 1EIGA 5KGUA 3NBIA 2L11A 3I90A 4K6DA 1NR4A 3Q22A 3CCQA 4TQUS 4JBKA 1QUQB 1SJED 4DK0A 1SAPA 3UE0A 2A69D 3CCLA 2ICIA 3PUWA 4RAUC 1MHWC 4A3MB 3J81E 3SK5A 4IQZA 4X3SA 2AHOB 2ZXOA 1DOKA 3T53B 3A55A 2A69C 2WP8J 3E3XA 4DU9A 3T1YL 4B3TL 2XIWA 1YJ9A 4A3GB 3ULJA 1JOQA 1GHKA 3RZOH 1VCIA 1TY0A 2QGQA 4GLXA 3E9HA 3KYHC 4IN3A 4LF5Q 2NB0A 4A3KG 3D4WA 1KLUD 3IL8A 4L5QA 1O7LA 1V43A 4EX5A 3F2CA 3ER0A 1DOMA 2UU9Q 3K0XA 2DJGC 2IX0A 4C3HH 5C4JH 3CKIB 4C1NI 3MVVA 1PLFA 2EJFC 4RA8A 3VR2A 1SNPA 3BDCA 3GP7A 3CC2A 1R4PB 1PYWD 1G6ZA 2Y0SB 3M7NA 2K5QA 4C3IH 1UUPA 2A74C 4K0KL 2B2WA 4QL5A 2B39A 1E7ZA 4A4IA 1D1IA 5TSSA 5CV4A 3X3MA 3GDEA 1LM0A 3S16H 2A6HD 5CR3A 3VR4A 1X32A 2K5HA 1EFID 2KVMA 3TP6A 1D8LA 2B2UC 1SNOA 1EWCA 2DN8A 4HJAA 2IW3A 3KK7A 4R4TA 1CHQD 1ASZA 1V1QA 3T1HL 4M8AA 3MEFA 1YVCA 3NENA 1NAPA 2YU9B 1LTID 5CC4A 3K7AH 3J81j 5IOCA 4RGOS 3DHQA 3GTGH 1ZEQX 1EY8A 4PV1C 2EYPA 3HG9A 1U4LA 3UE1A 4YIJA 4LWCA 4PZ7A 2K14A 5JJLA 2B2YC 2NN6I 2IL8A 5CV7A 1X3FA 1WTRA 2R7ZG 3A8KE 5ELDA 1TWGH 3SVMA 3QOLA 3I73A 3T1YQ 4B3TQ 1Y1WG 3QB3A 2JA6B 1RJTA 1F2MA 2N78A 4LNQA 4ZUIA 1FD7D 1BCPF 2JK8A 2WB1G 4YWKA 5EJWA 1DJRD 1Q8IA 4NB3A 4IO9A 1SFOB 3PMFA 2AQ2B 5JJKA 4BXXG 2Z6KC 3KDFB 2XSCA 1CKMA 2CW0C 2EPBA 2JA7B 3PV0A 1JR0D 2VY3A 5E4WC 2IWHA 2L55A 2PO4A 3CP0A 4R8IA 4DN4M 3T13A 4IPGA 1LYLA 3CCRA 4K0KQ 2OQKA 1VF7A 3I72A 3J81L 1SYGA 4DNIA 3QWNA 4KHPL 3HOUH 1PH2A 2R6GA 1PH9A 1UEBA 1Z47A 3KF6B 4LJZC 3HOXH 1PYSB 1RHPA 1OXVA 2CQOA 5DNFA 1VQ9A 4IFDG 4A3EH 1ASYA 1L0XB 3BU2A 2JA8G 1BKBA 4APVA 5I6WA 3T1HQ 1OTCA 3A5UA 1EQRA 2HQEA 1WD0A 3U9OA 3R3OA 3J80c 1LT3D 1Y1VH 1S3OA 1T9HA 4GKJL 1GUGA 1EQQA 1B70B 1N9WA 1KAAA 1UAPA 4JG2A 5FJ8G 1KNEA 3PIP3 1ESFA 2FHTA 3PQIA 2F0EA 2IJ0A 3GTPB 4FO2A 2LXJA 1KTKA 2OXPA 3JAMi 4DV1L 1TWFH 1EY6A 4EVOA 2A19A 2SNMA 3FMCA 3H3VH 4DR2L 1VQAA 5M3MG 1VQCA 4OIJA 1GO3E 3HRZC 1O7ZA 3NK9A 3AB9A 1EQTA 2KCTA 3GQBA 1RKNA 1SYCA 2EVBA 1Y69U 1V8QA 2GVAA 4FF3A 4WJ4A 5M9OA 5C4XB 3QG1A 2NUCA 3PGZA 2WACA 4B3ML 5E7NA 2B29A 3DEOA 2EYLA 2RF4A 3T51B 5C0XI 4QUCA 2E8GA 1S5DD 1XJVA 3S15H 1BDOA 5C3EH 3Q23A 4LUOA 4H44C 4BWGB 4M1UB 3S24A 1X3QA 4HTHA 5CGKA 3U58A 3Q6SA 4UP9A 2Q2UA 5F2DA 2E2HB 1WYDA 1M8AA 1L0YB 2LFNA 5FO7B 4KHPQ 4ZLTF 3U4VA 1B44D 1UNSA 3S1QB 3HZXA 3KLRA 1ICWA 3B6YA 2PI2E 1QUQA 4LUZA 3CF5A 3A54A 3GTOH 2QDLA 5LMNL 4EQOA 1LTLA 4ODGA 1VQHA 1SN8A 2J4XA 4LAAA 4OIKA 2VW9A 2YV5A 3F2BA 2ZJPA 1H9MA 4DV2L 3H91A 4BY7B 3NWSA 4OO1H 3JC66 2JEBI 1F2ZA 3FVQA 1CQVA 4UHVA 4GKJQ 3OW7A 4C3HG 1W6JA 3SK6A 1FL0A 4KK7A 1Q82C 4EQPA 3EROA 1RDPD 2Q8RE 3S1MH 4MHEA 3TDQA 4IUQA 3S2DB 2AMCB 4A3DH 4DR5L 4DV1Q 1MI2A 4O2DA 1T5EA 2VQFL 1LACA 3C46A 2OTLA 1A6XA 4Y7NB 2F0FA 3P1HA 1EU3A 2LXKA 3K0YA 5BN5A 4BA1I 4DR2Q 1TXYA 4A3KB 1IL2A 3M3YB 3M4PA 3H0GH 2SNSA 3N6RA 4KN4C 4DAYB 2Z1CA 4JPBW 4QCLA 1JT8A 2CH4A 1RD9D 4JI8L 3VA5A 1PA6A 2B8FA 4QY7A 4JI1L 1HR0W 1X65A 4FXKC 4POGA 2VL6A 3R2TA 1Q1EA 1NMGA 4KY6A 4MNOA 2K52A 3PF4A 2B2VA 3RLOA 5EPLA 1B7YB 1EIHA 2L9HA 5DM63 1NNXA 3MFYA 3C2PA 2MFIA 1GKHA 4LFAL 3K6OA 4GNXB 3TREA 1KLGD 5M5WB 4B08A 4OX9L 3J81i 3CCMA 4B3SL 2E76C 1EY9A 2E2IH 2HDLA 1A3VA 2RA4A 2EY1A 2LS01 5LMNQ 4ZCKA 1WTWA 2TMPA 2K50A 2UUCL 3QR8A 1PRTB 3FPUB 2K04A 2GA4B 2N88A 1V1OA 4DV2Q 1TWCB 1PHJA 4A93H 4AQYL 4RFBA 4NMZA 2HT1A 1U4PA 5D3DA 2QW7A 2K28A 2N8NA 1CTMA 3GTJH 5JEAJ 3ND9A 1G8ZD 5EKIA 1JJ2A 2K1BA 1GUTA 1KD1C 3VR5A 1VQ7A 1ZYRC 2R7DA 3IKJA 2R7ZB 2CWAA 4U673 4IUTA 1SYDA 3FKIG 1XMQL 4DR5Q 2RHSB 1TU2B 2CVRA 1Q86C 3N52A 1GOZA 5KEEA 4ME5A 1SBBB 3KLWA 1EUJA 2KUMA 5CORA 3KDFA 4JOIA 1QNKA 3CAMA 2RCNA 2WB1B 1ML0D 4RHRA 1HZAA 2AQ1B 1QCBD 2ICEC 1I3QH 1EEFD 3EN2A 4IFDJ 4JI8Q 3I4NB 4A3EG 2NVXH 4TSSA 4WJWA 4JI1Q 1VMPA 2R92H 3TMEA 1WCMB 3KF6A 1FNVA 1RTOA 2JJQA 5HGQA 1SEBD 3ONAB 1B50A 5CV9A 1TQOA 1UE5A 2VUMH 3ZJYC 4UPAA 5GAGC 2EE1A 4GKKL 1TVXA 2AQ3B 5KRUA 4LFAQ 4BBRH 1X6OA 4Q5VA 1LT5D 2EYMA 4C3JH 3AMUA 1XPRA 2MP1A 1E2VA 1ET6A 4OX9Q 2E2JB 4CDCC 4B3SQ 1ENFA 3HOYH 3F2DA 1CUKA 2F0DA 1KAWA 1XX8A 2JA8B 1BBUA 2F0IA 1QOHA 5IYDH 4JI7L 4R4CA 2PMZB 4L5TA 1CSPA 2VB2X 3QJYA 2JP1A 2UUCQ 1SYEA 3A7LA 1Q7YC 2F0PA 4IUVA 3GTKB 4HSPA 4AQYQ 3D4RA 2ES2A 1G2TA 1RODA 5IGBA 1K3RA 1BNZA 2CWPA 4JI6L 1L1OC 5LHY1 1JE5A 2QCPX 2WAQE 1E3PA 4GOPB 2A68D 1XMQQ 3NQTA 2KCNA 5IP7G 2B3GA 3I4LA 2I07B 3C1EA 5M3FG 2CH4W 3DM3A 1S4ZA 3K5OA 3NXWA 3M7GA 4X62L 5AJ3L 5FLXE 3CCUA 1HUNA 2DGYA 3MC0B 3A74A 3A8IE 1PV4A 2QDBA 2A68C 4FXGC 1WTPA 5D3IB 3UDFA 1HXYD 1Q8KA 1QZGA 1YNND 4P71A 1U0LA 5GAHC 1HA6A 3S2HH 1BBWA 4O1NA 2XN9C 2PYKA 2AWOA 1BCPD 2SDFA 3S14H 4PMCA 3RZDH 1FJGL 1ENAA 5JJZA 1KHIA 2UXCL 3CPFA 3I4MH 3Q0AA 1YNNC 3CCSA 4GKKQ 1VQJA 1LLRD 5JEAH 3K5MA 1IYUA 1N36L 4BBSB 1JOKA 4IURA 3SXHA 4IJLA 5C44G 1QE6A 1BCPC 5FO8B 3HOVH 3OW2A 1X54A 4IALA 5I6YA 1JOOA 2DJFC 4HN7A 1NCVA 1F2LA 2O2LD 2DNCA 4JI7Q 4CJ1B 1R9TB 3MXNB 3AYHB 4PZ6A 2BOSA 4YCUA 3H0GG 3A8JE 2D62A 3HOWG 2JA5H 4BBSG 3CD6A 4K14A 4LUVA 2NVQH 3GV6A 3LWUA 1XYIA 2V4DA 3OYYA 5IT9c 2HQLA 2KCMA 3G6EA 4K8JA 1I4GA 2F3IA 2BDOA 5E4XA 4CJ0B 2PZUA 3CQZB 3MAQA 2KHJA 1IXRA 2M2LA 1QVGA 3S1RH 4DAYA 1TS3A 3BZKA 3BVZA 2RCFA 5EKKA 2QF7A 5C5MA 2Q2IA 1G291 2R61A 4X64L 2H4OA 3PO3B 3H3VI 1UE1A 1EYCA 1K0RA 1KNAA 3VYUA 1Q1BA 2FXQA 4A3FH 3G6JB 1NE3A 2D9UA 4X62Q 5AJ3Q 2IT1A 2YTYA 1Q3LA 2VS1A 1GUOA 2PPBC 3WDNA 1KDBA 5CBEE 5KYLA 4A76A 4CHTB 3G48A 3SGIA 4HIOA 4GNXA 3LX0A 2KBNA 1QWYA 2WINB 2K03A 2B8GA 2MO1A 2AUJD 2MHVA 4R4OA 4A3IG 2ENBA 4WFN3 2RDGA 3CU7A 3I91A 3DLLA 1TY2A 1FJGQ 1VQIA 2VQEL 1BBXC 2UXCQ 4X3KA 2MUYA 1WD1A 4G57A 4HIDA 3PIOA 2YTXA 1H95A 1QVCA 4RHSA 3HEJA 4L5SA 3MWYW 1TWAB 1VQFA 1N36Q 4PNYA 1M4VA 1HNXL 2VNUD 3K81C 4GN5A 4JI0L 1VQLA 3MXPA 5I9PA 3HOZG 1JJGA 3UDXA 2CKZB 5JOBA 3HKZE 5FLXL 5IP9H 3W1BA 4DA2A 2EXZA 5IYCH 3NE5B 1LTSD 3GTLB 4OO1I 4CDFC 1KXLA 4A3LH 4A3JG 3BVGA 2BDNA 5EBDA 4XQNA 4JK1C 4LF6L 1DCZA 3TEHB 1LABA 4F7XA 1HR0L 4U68A 2BH8A 1QJOA 1M90C 3IAYA 2R92G 4HR7B 4ZQ3A 1O7IA 3ICEA 5FLMH 3FKIB 1AN8A 4DK6C 1C48A 1PFNA 3I56A 5E1FA 4FF4A 3U9SA 1PTOH 3F2UA 4KHVA 1F9SA 4MZ9A 4O0AA 2QILA 4NPSA 5IGCA 1OO9B 2N3SA 4X64Q 3UDGA 1YIJA 1KL9A 2K05A 3Q24A 4BBRG 5HURA 1XPUA 4RGTA 3VR3A 1A2TA 4R4QA 4XT1B 4C3JG 3QO2A 2AWNA 3D6WA 1OXUA 1WTVA 1STNA 1U4RA 5ELFA 2CQAA 2NZHA 2Q8IB 1HUMA 5D14A 3J7AF 2EYOA 1QG7A 2G9DA 1I6VC 1X3PA 3LNNA 4PG3A 1MJCA 3J7AV 3K5NA 2RVLA 5C0XG 4OWTB 3C1FA 4L6TB 2VQEQ 2EZVA 1MBYA 3M4OB 2KJXA 4KMUC 4XT3B 2EJGC 3HS0C 4NXNL 1HNXQ 2HD3A 4F87A 1JE4A 4JI0Q 3SK4A 3WOFA 1Y14B 4QQBX 2CW0D 2FMCA 2R93G 3D8GA 1ILPA 4A3MH 3DEPA 2JA9A 1EL0A 1YI2A 3FHWA 2G5DA 1ZXTA 1CKNB 1OXXK 3TZUA 4FDBA 1PTOC 3GTQB 4GOPA 2MO0A 2BE5C 2EY6A 1X55A 2F0NA 3RD4A 3TS2A 1JJCB 1II3A 1OXSC 1JWMD 1DXMA 4A3BB 4BS9A 3SE0A 1MIUA 1I4RA 3KF8B 1TWHB 3PUZA 5ELEA 1MGSA 3BYTB 1HR0Q 4LF6Q 4X65L 4BY1B 4A3GH 1ONLA 4DAMA 1S5BD 5IYBG 2C9OA 3HKSA 1LTGD 1PZID 5FO9B 3J7YW 1VQNA 3G4SA 1NY4A 1HHVA 1STGA 4HJ5A 1XPOA 2C5CA 5M3FB 1WFQA 1YHBA 5JVH3 3SK8A 5A35A 3KLSA 2GVBA 4I7AA 3G71A 1B3QA 2FFKB 4NXML 1NUCA 2B2UA 1CT1D 2F4IA 3RMHA 1W2BA 2E75C 3F1ZA 1IW7D 1A3TA 4DR4L 5JPNC 1SMXA 4E6IA 1G2SA 4H02A 4N9PA 2O4XA 1BOSA 4MN3A 4GLAC 2QA4A 1IZ6A 4J6HA 4V190 3HGBA 4YY3L 3GTMB 3PO2B 4V0BA 2Z4HA 5LL6S 2MJ8A 3MXNA 1IW7C 1I50B 1VQ8A 5C44B 1I6HB 1KRSA 2YU9H 4I7ZC 5C3XA 3EIVA 1AH9A 4XDXA 4NP5A 2CCZA 2WAQG 1FR3A 4QIWE 5K36G 4NXNQ 3S9WA 1D7QA 1S5ED 4DR7L 4DR1L 2WIIB 3CC7A 4ULLA 4ID6A 4DV4L 3I7FA 3HOWB 2AUKA
chains in the Genus database with same CATH topology
4KKUA 5T1IA 1W6KA 5ISRA 2X6LA 3NPPA 3W3AA 5T1GA 1AZQA 1HPCA 1H9RA 5IT9L 3ERQA 3NQIA 4DXGA 2F03A 4CKCA 3RUZA 2X69A 2WV6D 1KDCA 2XRQD 2K5WA 1V1PB 1CHPD 1EYAA 2QKIC 2B2TC 5DM73 5COYA 4A3IB 4PQXA 3H3VC 4XQQA 4RH6A 3IFTA 4K5XA 1EY0A 3D3RA 4KHZA 4DF7A 3DMUA 1DOLA 5IODA 2JYOA 3S17B 2I46A 2K6AA 3H6MA 4K8IA 4TRDA 3I8ZA 3BVMA 5KNBA 5KNDA 1WTOA 1SMYC 5FK9C 1EQVA 4C3IG 1STBA 2KHSA 3HOZB 4BA2I 1H9SB 2E2DC 5J39A 1HA5A 3R8BA 3OMCA 4K5WA 4G7OC 1CFMA 5M5YB 4A3JB 4C2MB 2XRSD 3L7ZC 3MFGA 2XNAC 3J80E 2LKVA 2F0KA 5IGDA 1QB5D 3EVQA 2NBFA 1WTQA 1PTOF 3RLFA 1Y8OB 1E0BA 5M5XB 3BG3A 1D1KA 3PUVA 5NUCA 3NTKA 4X3UA 4CKBA 5CBAE 4DXFA 4CGYB 2E74C 2XWJB 1SYBA 3BYYB 4TKOB 3A56A 1EY4A 3H09A 2CHBD 4Q0FA 1ZYRD 2F1MA 2BCOA 2RSNA 2KCCA 1F2YA 3EJIA 4IUUA 1GXDC 3P7JA 1PDQA 1BCPB 2F0TA 2L0CA 1LV9A 5C6AA 1IHZA 3S1NB 1XWEA 3DWPA 1SNCA 1F9RA 2PNRC 2NVTB 3NTHA 3TZDA 1EWHA 2R93B 1Y1WB 1TIID 1DONA 1SE4A 1D5MC 2Z4IA 3KF8A 1VDZA 3A7AB 1ZKOA 5JPMC 2A5HA 1A15A 2F0GA 2HCCA 1B2TA 1I4PA 5IGGA 2NVYB 1PMRA 4DAVA 1SYFA 1MSHA 2KOLA 1K83B 1CZWA 1STEA 3DXJC 4FNFA 1EEID 4B9WA 1RF2D 3BDLA 4UAIA 1IKLA 2JSOA 3D31A 2RQXA 1SDFA 1Q12A 3OMGA 5I9OA 2TSSA 1KABA 3MZ5A 2EYJA 4G7HC 2Z8LA 3W2DA 2OEOA 3J80L 3OWFA 3QIAA 1HRJA 2ZXPA 4FP5D 5M3MB 4NDXA 2WAQB 4ZYSA 2BA1A 2IX3A 3VYRA 2MPMA 4OGQC 3AU7A 1U4MA 1EY5A 1F9QA 3V2TA 1FNWA 5I2YA 4K5VA 1R4QB 4K2LA 2NZ1D 4KN7C 3M85A 4JBWA 2F0MA 4XYQA 3GO5A 1V1PA 4OO1G 1XXGA 1B4OA 3K58A 5EPKA 4H13C 1HFGA 5J1ZA 4IUNA 3GD7A 1NSNS 2NWGA 1GHJA 4FXDA 4XXEA 3RZOB 4RGMA 2NTTA 4F8MA 1Y8PB 3I3CA 5DAUA 1JWSD 1O7YA 3EFXD 4C3HB 5C4JB 4FF1A 3VYSA 4IFDH 3NP8A 4RKLA 1H9SA 3DUZA 3L9AX 4HCEA 1SSOA 4C3IB 4I65A 1CA6A 4XQJA 2KEDA 1EYDA 3S16B 5FOBB 2F0OA 3H94A 2B2WC 4GZYC 2X6GA 1O80A 2A73B 3MHBA 3OPOA 3FEWX 2L1BA 3K7AB 3MXUA 4QMGA 3GTGB 4N9TA 1CI3M 3MTSA 5KIXA 5I2XA 1D2BA 1JB3A 5ELCA 1VF5C 2G9HD 1QILA 1PZJD 4KJNA 4G4KA 1GJXA 5A2QL 4ILWA 4KI0A 1TWGB 3FRPB 3BZDB 3JAML 3BDOA 2KEEA 1XTCD 1B9MA 3HKZB 2DY7A 3K59A 3K5LA 4DGZA 3T4AC 1S5CD 3CHBD 3ZYYX 2VB3X 3T56B 2N55A 4LMQD 4P2CB 2RSOA 1ENCA 2PW5A 2A6ED 1AW7A 1K8OA 3MEHA 3HOUB 3WOEA 4ZKCB 3HOXB 2RDFA 4KD4A 1AZPA 2RKSA 1O78A 4LK1C 4A3EB 1MD2D 2OF1A 2A6EC 3NUCA 1LTAD 3C3LA 2L4NA 4Z9CB 4B9XA 1Y1VB 3DWQA 1RTNA 2PCFB 5IT9E 3MA2B 1B9NA 2K32A 5CMDA 2F3VA 2A6HC 1TWFB 1PTOD 2KA7A 2BE5D 2F0WA 1BXTA 2VXWA 3FDTA 1D5ZC 2FINB 1HQMC 2IPKD 4FVMA 3TSSA 4L8JA 1PXUA 1B3AA 1DZ1A 4S3SA 1YNJD 1SNDA 3M4YA 5CYUA 2L12A 1CQFA 1PRTF 1SNQA 3S15B 1OXTA 5C3EB 1CZGA 4HMIA 2F0HA 3OOCA 4DNTB 4ZK9B 1E2ZA 4OL7A 5BN4A 2HUGA 1YNJC 1SE2A 2B63B 2MGSA 3TN2A 2XVSA 2EYFA 1BO0A 5JEAG 3TP5A 5J22A 4KJOA 1J9OA 1QNUA 3GTOB 5C3WA 3IFDA 2EOTA 3CRLC 3PIO3 4X3TA 5IGEA 1IYVA 3NTIA 2LMCB 4CBVA 3V05A 4ZAIA 5DEHA 3FPPA 3KBXA 2F0SA 4K6LA 3K57A 4R9WA 4CJ2C 3VA7A 4R8NA 3S1MB 3PUXA 1SNMA 1HTPA 4C1NK 4A3DB 5CV6A 5BN3A 1Z6HA 2B2YA 1I4HA 2WKCA 1GUWA 3URYA 1AFPA 2SEBD 4QIWB 3H0GB 1T5XD 2H1EA 4F88A 1U9RA 2ZT9C 2O5IC 4NW2A 3L3OC 4HAEA 3EQLC 1S5FD 2JE6I 5G3LF 2WKDA 1Q90A 2FMMA 5D65A 1A3UA 1GUSA 1CK1A 3VR6A 5IGFA 1HFNA 3E5SA 4J1MA 2KECA 1JQYD 1ILQA 5AFWA 2F0LA 5EBCA 3R2IA 2B2VC 1TT2A 5LL6X 2E2IB 4L63B 2XWBB 1D5XC 1LO5D 5EKLA 3O13A 4A93B 1SMYD 5EQ0A 1I4QA 2D2CC 1ET9A 4KD3A 4KV6A 5HGTA 3P20A 3GTJB 4HSVA 4KKSA 2PW7A 1DM0B 2EYHA 1H9JA 3SR1A 3KLSX 1AEXA 1WTXA 3X3NA 1BR9A 1JICA 4ZUJA 4CKEA 1FGBD 1I3QB 1LT6D 4DFAA 5KNCA 3QOJA 4RWSC 1JCKB 1VMCA 2NVXB 4EQNA 3LWEA 1I4XA 2K01A 2D5DA 4IFDI 2R92B 1TKWB 4K2KA 5IIFA 5KYIA 4QUFA 1FYCA 1UEAB 1C4QA 4AYBB 2VUMB 5CV8A 4ZRZA 1GUNA 5C0XJ 4BBRB 3NHHA 1F77A 1TR5A 3OSOA 4C3JB 5EGTA 3HOYB 1J8IA 2PZWA 1F9PA 3D6CA 3PUYA 3TP7A 4PMBA 3VYTA 3NWTA 2NN6H 2B2TA 1KDAA 1PFBA 1STYA 1EZ8A 1PZKD 2NTSA 1IKMA 4OHJA 4RKBA 1STHA 2M9VA 1STAA 2FJ2A 4WRDA 1E2WA 1ESRA 3ITPA 4O42A 1Z7TA 4ZKBB 3GV3A 4KKTA 1K8MA 1DD2A 3V96A 1JORA 3SEBA 4EGVA 4IUPA 1EU4A 3NSWA 1BF4A 4ABNA 3NBHA 4KY7A 1CM9A 3S2HB 4FF2A 2EY5A 4DNRB 1A2UA 1HCZA 4XYOA 2R3ZA 5ELBA 2DY8A 5C5LA 3S14B 4KY5A 3RZDB 2HDMA 5K5PA 2F0QA 5FKAC 3OIPA 3I4MB 3BS1A 4H0LC 4XIGS 5JVG3 1MSGA 3HOVB 1JC7A 3HP3A 1G91A 3DM1A 1DYQA 2YYZA 3SDZA 2JA5B 4MIUA 2NVQB 3CRKC 1H9KA 2NYZD 2KQ3A 2JXMB 1HQRD 4H7BA 3TP8A 2OT2A 3S1RB 1BQQT 4FYDA 1D6EC 1NR2A 5A2QE 4UDUC 3T16A 1JWUD 2EDGA 2K33A 5C0XH 4RGNA 1AP0A 3D4DA 2F0VA 5E3FA 3JAME 2Q8TA 4PMWA 4A3FB 2PZTA 2K5DA 2RDHA 3R93A 5CV5A 4DAPA 4KTAA 2BA0A 2F0UA 3UI2A 3EA6A 1CA5A 1IL8A 4QB4A 2DNEA 1B53A 1PFMA 2QEJC 1LTRD 3E6ZX 1RCVD 1SXTA 3I70A 4G7ZC 3KBGA 4NKLA 3OWEB 3P75A 3G7LA 2J7ZA 2O5JC 3KUPA 1PRTD 5C4ZA 1TS2A 3DWAA 2ZXRA 4XTCS 3E0JA 2IX1A 1B1ZA 2ID0A 4RCNA 1PRTC 5I4DA 4HEDA 2RBMA 2L5TA 4J8QA 2EY2A 1EY7A 1TS5A 2SOBA 3ND8A 2F0JA 4HMJA 1EOTA 1HTLD 1C8CA 1SE3A 1TS4A 1PTOB 2J0TD 3TBIB 3SHLA 2F3WA 2JEAI 2LY7A 4RCOA 3OHXC 4C56C 3MXGA 1BUVT 2M00A 5JAVA 1Y8NB 2K7VA 1LTBD 4IZ8A 1WVLA 1FNUA 4WORA 1EZ6A 3OIQA 5K36H 1LTTD 1SJHD 2NN6G 2EJMA 5C4HA 2PQEA 4DK1A 1LT4D 5EPJA 2HCIA 5G3LD 4HCSA 1EIGA 5KGUA 3NBIA 2L11A 3I90A 4K6DA 1NR4A 3Q22A 4TQUS 1SJED 4DK0A 1SAPA 2A69D 2ICIA 3PUWA 4RAUC 4A3MB 3J81E 3SK5A 4IQZA 4X3SA 2ZXOA 1DOKA 3T53B 3A55A 2A69C 2WP8J 4DU9A 1JOQA 2XIWA 4A3GB 1GHKA 1VCIA 1TY0A 4IN3A 2NB0A 3D4WA 1KLUD 3IL8A 1O7LA 1V43A 1DOMA 2IX0A 3CKIB 4C1NI 3MVVA 1PLFA 2EJFC 4RA8A 3VR2A 1SNPA 3BDCA 3GP7A 1R4PB 1PYWD 1G6ZA 2Y0SB 3M7NA 2K5QA 1UUPA 2A74C 2B2WA 2B39A 1D1IA 5TSSA 5CV4A 3X3MA 2A6HD 5CR3A 3VR4A 1X32A 1EFID 2KVMA 3TP6A 2B2UC 1SNOA 1EWCA 2DN8A 2IW3A 3KK7A 1CHQD 4M8AA 1NAPA 2YU9B 1LTID 5CC4A 5IOCA 4RGOS 3DHQA 1ZEQX 1EY8A 4PV1C 2EYPA 3HG9A 1U4LA 4YIJA 2B2YC 2NN6I 2IL8A 5CV7A 1WTRA 3A8KE 5ELDA 3SVMA 3QOLA 3I73A 3QB3A 2JA6B 1RJTA 1F2MA 4ZUIA 1FD7D 1BCPF 5EJWA 1DJRD 1Q8IA 1SFOB 3PMFA 2AQ2B 2XSCA 2CW0C 2EPBA 2JA7B 3PV0A 1JR0D 5E4WC 2IWHA 2L55A 2PO4A 4R8IA 4DN4M 3T13A 1VF7A 3I72A 3J81L 1SYGA 3QWNA 2R6GA 1Z47A 4LJZC 1RHPA 1OXVA 5DNFA 4IFDG 1L0XB 5I6WA 2HQEA 1WD0A 3U9OA 3R3OA 1LT3D 1GUGA 1KAAA 1UAPA 1KNEA 3PIP3 1ESFA 2FHTA 2F0EA 2IJ0A 3GTPB 4FO2A 1KTKA 2OXPA 1EY6A 4EVOA 3FMCA 2SNMA 4OIJA 3HRZC 1O7ZA 3NK9A 3AB9A 1EQTA 3GQBA 1RKNA 1SYCA 2EVBA 1Y69U 1V8QA 4FF3A 5M9OA 5C4XB 3QG1A 2NUCA 2WACA 3DEOA 2EYLA 3T51B 5C0XI 4QUCA 1S5DD 1BDOA 3Q23A 4H44C 4BWGB 4M1UB 1X3QA 4HTHA 5CGKA 3Q6SA 5F2DA 2E2HB 1M8AA 1L0YB 2LFNA 5FO7B 4ZLTF 1B44D 1UNSA 3S1QB 3HZXA 3KLRA 1ICWA 3A54A 4EQOA 4ODGA 2J4XA 4LAAA 4OIKA 4BY7B 1H9MA 3H91A 3NWSA 4OO1H 2JEBI 1F2ZA 3FVQA 1CQVA 3OW7A 4C3HG 1W6JA 3SK6A 4KK7A 4EQPA 3EROA 1RDPD 2Q8RE 4MHEA 3TDQA 4IUQA 3S2DB 1MI2A 1T5EA 1LACA 3C46A 1A6XA 4Y7NB 2F0FA 3P1HA 1EU3A 3K0YA 5BN5A 4BA1I 4A3KB 3M3YB 2SNSA 3N6RA 4KN4C 2Z1CA 4QCLA 1RD9D 3VA5A 2B8FA 4FXKC 3R2TA 1Q1EA 4KY6A 2B2VA 5EPLA 1EIHA 2L9HA 5DM63 3MFYA 3C2PA 3K6OA 1KLGD 5M5WB 4B08A 2E76C 1EY9A 2HDLA 1A3VA 2RA4A 2EY1A 2LS01 1WTWA 2TMPA 1PRTB 3FPUB 2K04A 2GA4B 2N88A 1V1OA 1TWCB 4RFBA 4NMZA 1U4PA 5D3DA 2K28A 1CTMA 5JEAJ 3ND9A 1G8ZD 5EKIA 2K1BA 1GUTA 3VR5A 1ZYRC 3IKJA 2R7ZB 4U673 4IUTA 1SYDA 1TU2B 2CVRA 3N52A 1GOZA 5KEEA 4ME5A 1SBBB 2KUMA 5CORA 1QNKA 2WB1B 1ML0D 4RHRA 2AQ1B 1QCBD 2ICEC 1EEFD 4IFDJ 3I4NB 4TSSA 4WJWA 1VMPA 3TMEA 1WCMB 1FNVA 1RTOA 1B50A 1SEBD 3ONAB 5CV9A 1TQOA 2EE1A 1TVXA 2AQ3B 5KRUA 4Q5VA 1LT5D 2EYMA 3AMUA 2MP1A 1E2VA 1ET6A 2E2JB 1ENFA 2F0DA 1XX8A 2JA8B 2F0IA 1QOHA 2PMZB 2VB2X 3QJYA 2JP1A 1SYEA 3A7LA 2F0PA 4IUVA 3GTKB 4HSPA 3D4RA 1G2TA 1RODA 5IGBA 1BNZA 5LHY1 2QCPX 2A68D 3NQTA 2KCNA 3I4LA 2I07B 3C1EA 1S4ZA 3K5OA 3NXWA 3M7GA 5FLXE 1HUNA 3MC0B 3A8IE 2QDBA 2A68C 4FXGC 1WTPA 5D3IB 1HXYD 1YNND 1HA6A 4O1NA 2XN9C 2PYKA 2AWOA 1BCPD 2SDFA 4PMCA 1ENAA 5JJZA 3Q0AA 1YNNC 1LLRD 5JEAH 3K5MA 1IYUA 4BBSB 1JOKA 4IURA 3SXHA 1QE6A 1BCPC 5FO8B 4IALA 5I6YA 1JOOA 4HN7A 1NCVA 1F2LA 2O2LD 2DNCA 4CJ1B 1R9TB 2BOSA 3A8JE 2D62A 4K14A 3GV6A 3LWUA 1XYIA 2V4DA 4K8JA 1I4GA 2BDOA 5E4XA 4CJ0B 2PZUA 3CQZB 3MAQA 2M2LA 4DAYA 1TS3A 3BVZA 5EKKA 2QF7A 5C5MA 1G291 2R61A 2H4OA 3PO3B 1EYCA 1KNAA 3VYUA 1Q1BA 3G6JB 2D9UA 2IT1A 1Q3LA 1GUOA 2PPBC 3WDNA 1KDBA 5CBEE 5KYLA 4CHTB 3LX0A 1QWYA 2WINB 2K03A 2B8GA 2AUJD 2MHVA 2ENBA 4WFN3 2RDGA 3CU7A 3I91A 1TY2A 1BBXC 4X3KA 2MUYA 1WD1A 4G57A 4RHSA 3HEJA 3MWYW 1TWAB 4PNYA 1M4VA 2VNUD 3MXPA 5I9PA 5JOBA 5FLXL 4DA2A 2EXZA 3NE5B 1LTSD 3GTLB 4OO1I 3BVGA 2BDNA 5EBDA 4XQNA 4JK1C 1DCZA 1LABA 4F7XA 4U68A 1QJOA 3IAYA 4HR7B 4ZQ3A 3FKIB 1AN8A 1C48A 1PFNA 5E1FA 4FF4A 3U9SA 1PTOH 3F2UA 4KHVA 1F9SA 2QILA 5IGCA 1OO9B 2K05A 3Q24A 5HURA 4RGTA 3VR3A 1A2TA 4XT1B 4C3JG 3QO2A 2AWNA 3D6WA 1OXUA 1WTVA 1STNA 1U4RA 5ELFA 2CQAA 2Q8IB 1HUMA 5D14A 3J7AF 2EYOA 1QG7A 2G9DA 1I6VC 1X3PA 3LNNA 3J7AV 3K5NA 2RVLA 5C0XG 3C1FA 4L6TB 2EZVA 1MBYA 3M4OB 2KJXA 4KMUC 4XT3B 2EJGC 3HS0C 4F87A 1JE4A 3SK4A 3WOFA 2CW0D 2FMCA 3D8GA 1ILPA 3DEPA 1EL0A 1ZXTA 3TZUA 1OXXK 1PTOC 3GTQB 2BE5C 2EY6A 2F0NA 3RD4A 1II3A 1JWMD 1DXMA 1OXSC 4A3BB 4BS9A 3SE0A 1I4RA 5ELEA 1TWHB 3PUZA 1MGSA 3BYTB 4BY1B 1ONLA 1S5BD 2C9OA 1LTGD 1PZID 5FO9B 3J7YW 1HHVA 1STGA 2C5CA 5M3FB 5JVH3 3SK8A 5A35A 3KLSA 2FFKB 1NUCA 2B2UA 1CT1D 2F4IA 3RMHA 2E75C 1IW7D 1A3TA 5JPNC 4E6IA 1G2SA 4N9PA 2O4XA 1BOSA 4MN3A 4J6HA 4V190 3HGBA 3GTMB 3PO2B 4V0BA 2Z4HA 5LL6S 2MJ8A 3MXNA 1IW7C 1I50B 5C44B 1I6HB 4I7ZC 5C3XA 4XDXA 4NP5A 1FR3A 5K36G 3S9WA 1S5ED 2WIIB 4ULLA 4ID6A 4QF4A 3HOWB 2AUKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RLF A;  3WDN A;  4KKU A;  1HCZ A;  1Y8O B;  4XTC S;  4DNR B;  1Q12 A;  3T53 B;  2A68 D;  2A69 C;  3BG3 A;  1O78 A;  4LK1 C;  3PUV A;  3KLR A;  2CW0 C;  2A6E C;  4RCN A;  3PV0 A;  2B8G A;  4G7H C;  1VCI A;  3I4L A;  4KMU C;  3VA7 A;  2AUJ D;  2EJG C;  3PUX A;  1HTP A;  1CTM A;  3W3A A;  5KNC A;  5BN3 A;  2L5T A;  3ND9 A;  1Z6H A;  1O7L A;  1V43 A;  1GUT A;  2E74 C;  4H0L C;  4XIG S;  3VR5 A;  1ZYR C;  3A8I E;  3ND8 A;  2D5D A;  1GHK A;  2PCF B;  1VF7 A;  3I72 A;  3IKJ A;  1HPC A;  4TKO B;  1H9R A;  1TKW B;  1H9M A;  3H94 A;  2A68 C;  3QIA A;  4OO1 H;  4IQZ A;  1B9N A;  1FYC A;  2R6G A;  2JEB I;  3TZU A;  1TU2 B;  1OXX K;  2EJF C;  4LJZ C;  3VR2 A;  4GZY C;  2BE5 C;  2F1M A;  1OXV A;  3OW7 A;  2K32 A;  2KCC A;  2ZT9 C;  2AWO A;  2O5I C;  2BA1 A;  4IFD G;  3OPO A;  1OXS C;  1DXM A;  3M7N A;  2A6H C;  3MXU A;  1GUN A;  4OGQ C;  2YYZ A;  3EQL C;  3SE0 A;  3SDZ A;  3PUZ A;  2KA7 A;  2BE5 D;  1CI3 M;  1ONL A;  2JE6 I;  3CRK C;  1Q90 A;  1YNN C;  1H9K A;  4DNT B;  2PPB C;  3NE5 B;  5JEA H;  2JEA I;  2A6H D;  1T5E A;  3VR4 A;  1IYU A;  1LAC A;  1A6X A;  1VF5 C;  2JXM B;  1GUG A;  1HQM C;  2DN8 A;  4L8J A;  1GUS A;  5BN5 A;  4BA1 I;  3PUY A;  2PNR C;  3VR6 A;  5A35 A;  1Y8N B;  2K7V A;  3IFT A;  4JK1 C;  1DCZ A;  2NN6 H;  1GJX A;  1LAB A;  4KN7 C;  3N6R A;  1EWH A;  4KN4 C;  3M85 A;  1QJO A;  4JBW A;  4KI0 A;  2DNC A;  4KHZ A;  4HR7 B;  3M4Y A;  5K36 H;  4OO1 G;  1VDZ A;  2EDG A;  2B8F A;  2E75 C;  3A7A B;  2K33 A;  2NN6 G;  5C0X H;  1OXT A;  2D62 A;  3A8J E;  1ZKO A;  3FMC A;  1IW7 D;  3OOC A;  1Q1E A;  4PV1 C;  3BDO A;  1SMY C;  3LWU A;  3U9S A;  1E2V A;  2EJM A;  2V4D A;  5KND A;  1E2Z A;  1B9M A;  4H13 C;  3AB9 A;  5BN4 A;  1E2W A;  4DK1 A;  1YNJ C;  3GQB A;  4BA2 I;  2BDO A;  1Z7T A;  1H9S B;  3VR3 A;  2BA0 A;  2EVB A;  3MFY A;  1Y69 U;  1V8Q A;  2NN6 I;  1OXU A;  5KNB A;  3HGB A;  3GD7 A;  1PMR A;  4KKT A;  5JEA G;  1K8M A;  2DNE A;  1DD2 A;  1GHJ A;  3QG1 A;  2D2C C;  3QJY A;  1CFM A;  4TQU S;  4G7O C;  2QF7 A;  3A7L A;  1IW7 C;  3DXJ C;  4DK0 A;  4I7Z C;  1G29 1;  2Q8I B;  3P20 A;  3A8K E;  3T51 B;  3D4R A;  2A69 D;  2E76 C;  3CRL C;  4KKS A;  3T56 B;  4G7Z C;  1Y8P B;  3PUW A;  1BDO A;  3I73 A;  1IYV A;  2LMC B;  3L7Z C;  1Q1B A;  2A6E D;  1H9J A;  4H44 C;  2O5J C;  1FR3 A;  1K8O A;  5K36 G;  1I6V C;  4IFD H;  3LNN A;  3D31 A;  2IT1 A;  1H9S A;  5C0X G;  3FPP A;  1GUO A;  2AUK A; 
#chains in the Genus database with same CATH topology
 4KKU A;  1KIX A;  5T1I A;  4DKA C;  1W6K A;  4A3C G;  4A3F G;  3RR5 A;  5ISR A;  2X6L A;  5JJI A;  3NPP A;  3W3A A;  5T1G A;  4IOA A;  1AZQ A;  2JA6 H;  4X65 Q;  1HPC A;  1H9R A;  2L15 A;  5IT9 L;  3CW2 C;  3ERQ A;  3NQI A;  1XNQ L;  1VQO A;  4DXG A;  2F03 A;  4CKC A;  4ALP A;  3RUZ A;  1Q81 C;  2X69 A;  2WV6 D;  2B63 H;  1KDC A;  5GQO A;  2XRQ D;  1SFO H;  2K5W A;  1V1P B;  1CHP D;  2JA7 H;  1EYA A;  2QKI C;  4NXM Q;  2B2T C;  1N8R C;  5DM7 3;  5COY A;  2EIF A;  4A3I B;  4PQX A;  3H3V C;  4XQQ A;  5IP9 G;  4DR4 Q;  4RH6 A;  3IFT A;  2IHF A;  4K5X A;  5IE8 A;  1EY0 A;  3D3R A;  2OTJ A;  4KHZ A;  4DF7 A;  3DMU A;  1DOL A;  5IOD A;  2JYO A;  3S17 B;  2I46 A;  2K6A A;  3H6M A;  4K8I A;  4YY3 Q;  4TRD A;  1SE8 A;  3I8Z A;  3BVM A;  5KNB A;  5KND A;  3KOJ A;  1SMY C;  5FK9 C;  1WTO A;  1PVO A;  5FLM G;  1EQV A;  4C3I G;  1STB A;  2KHS A;  3HOZ B;  4BA2 I;  4IPH A;  4R4I A;  1H9S B;  1I94 L;  2E2D C;  5J39 A;  1HA5 A;  3HFZ B;  3R8B A;  3CME A;  4DR7 Q;  3OMC A;  4DR1 Q;  2KHI A;  4K5W A;  4G7O C;  4DV4 Q;  1CFM A;  3GTP H;  4R1J A;  5M5Y B;  4A3J B;  4C2M B;  2XRS D;  3L7Z C;  2ZTE A;  3MFG A;  2XNA C;  3J80 E;  2LKV A;  4AYB E;  2F0K A;  5IGD A;  1QB5 D;  3EVQ A;  4YWL A;  3STB D;  2NBF A;  1WTQ A;  1PTO F;  3RLF A;  4LF4 L;  1Y8O B;  4TVA B;  1E0B A;  5M5X B;  3BG3 A;  1D1K A;  1WOC A;  3TS0 A;  2OWO A;  1XNQ Q;  3PUV A;  2OQ0 A;  5C4X H;  4JYA L;  5NUC A;  3AQQ A;  3NTK A;  1C9O A;  1UE7 A;  4X3U A;  4CKB A;  5CBA E;  4DXF A;  4CGY B;  3JAM c;  2E74 C;  2XWJ B;  3STB C;  1SYB A;  4OEL B;  3BYY B;  4DR3 L;  4TKO B;  3A56 A;  1EY4 A;  3H09 A;  3AEV A;  2CHB D;  4Q0F A;  2E2H H;  1ZYR D;  2F1M A;  2BCO A;  4DPG A;  2RSN A;  2KCC A;  1F2Y A;  3EJI A;  4IUU A;  1GXD C;  3P7J A;  4DR6 L;  3S1Q H;  1PDQ A;  3HKZ G;  1M1K C;  1BCP B;  2F0T A;  2L0C A;  1LV9 A;  5C6A A;  5L37 A;  3PSI A;  1IHZ A;  3S1N B;  4DV3 L;  1XWE A;  3DWP A;  1SNC A;  1DGS A;  4BY7 H;  1F9R A;  1CKN A;  2PNR C;  2NVT B;  1X9N A;  3NTH A;  3TZD A;  2HHH L;  2UUA L;  3KJO A;  1EWH A;  2R93 B;  1Y1W B;  2IHE A;  1TII D;  1DON A;  1SE4 A;  1JMC A;  1RIP A;  1I94 Q;  1D5M C;  2UUB L;  3HOU G;  2Z4I A;  3KF8 A;  4JC0 A;  1VDZ A;  2ZJQ A;  3A7A B;  3HOX G;  1ZKO A;  5JPM C;  4JI3 L;  2A5H A;  3S2D H;  4DUZ L;  1A15 A;  2F0G A;  2HCC A;  1IYJ B;  2Q2T A;  1XNR L;  2I0Q A;  4Y7N H;  1K9M C;  4JVZ A;  4A3K H;  1I4P A;  1B2T A;  3M3Y H;  1YIT A;  5IGG A;  3EBE A;  2NVY B;  1PMR A;  3U50 C;  4DAV A;  1Y1V G;  1K73 C;  1SYF A;  1MSH A;  2KOL A;  2P5Z X;  1GVP A;  1K83 B;  1CZW A;  1STE A;  3DXJ C;  4FNF A;  4LF4 Q;  1EEI D;  1V9P A;  4B9W A;  1RF2 D;  4JYA Q;  3ERS X;  3BDL A;  1YBY A;  4UAI A;  1IKL A;  2JSO A;  3D31 A;  2RQX A;  1SDF A;  2MNA A;  4OEM B;  4DR3 Q;  1Q12 A;  1A0I A;  3OMG A;  3K7U C;  5I9O A;  2TSS A;  1KAB A;  3MZ5 A;  2EYJ A;  4G7H C;  2Z8L A;  2K5V A;  5M5W H;  3W2D A;  1N32 L;  4DR6 Q;  2PMZ E;  2OEO A;  2EXD A;  2VZA A;  4POF A;  1QVF A;  1CKO A;  3J80 L;  1VQK A;  1XMO L;  3OWF A;  4KLK A;  3QIA A;  1HRJ A;  1BVS A;  2ZXP A;  4GLV B;  1RL2 A;  4DV3 Q;  5C3E G;  4FP5 D;  5M3M B;  4NDX A;  1TWC H;  2WAQ B;  4ZYS A;  2BA1 A;  2IX3 A;  1WTH A;  1K3B C;  3VYR A;  2MPM A;  1EIF A;  4OGQ C;  1KRT A;  2HHH Q;  1SRO A;  2XTI A;  2UUA Q;  3AU7 A;  1U4M A;  2B63 G;  1EY5 A;  1F9Q A;  3V2T A;  2UUB Q;  3J81 c;  1FNW A;  1E22 A;  5I2Y A;  4K5V A;  1R4Q B;  3A5Z B;  2JA7 G;  2WFW A;  1EFW A;  4JI3 Q;  1FGU A;  4K2L A;  2R7Z H;  4DUZ Q;  1NBW A;  3AFP A;  5GRO A;  4CDD C;  2NZ1 D;  1XNR Q;  4KN7 C;  3M85 A;  1NJI C;  4JBW A;  2F0M A;  4XYQ A;  2ASB A;  3GO5 A;  1V1P A;  4OO1 G;  1FVI A;  1HNW L;  1K8G A;  1XXG A;  4QJF A;  2PI2 A;  1B4O A;  1SLJ A;  5DLQ E;  1P8L A;  1PFS A;  5GAD C;  3K58 A;  5EPK A;  5LMU L;  3I4N H;  4H13 C;  1HFG A;  5J1Z A;  4IUN A;  4DV7 L;  3LGJ A;  5ELO A;  3H15 A;  1WCM H;  4A3D G;  4WJ3 M;  3GD7 A;  1NSN S;  2NWG A;  1GHJ A;  4FXD A;  4XXE A;  3RZO B;  1E1T A;  4RGM A;  1PH5 A;  2NTT A;  4PZ8 A;  3U4Z A;  4F8M A;  4P72 A;  1Y8P B;  3I3C A;  5DAU A;  1JWS D;  1O7Y A;  3EFX D;  4C3H B;  5C4J B;  4FF1 A;  4A75 A;  3VYS A;  5LMN W;  4IFD H;  1N32 Q;  3NP8 A;  4RKL A;  2E2J H;  2QEX A;  2JA8 H;  1H9S A;  3DUZ A;  3I55 A;  3CC4 A;  3L9A X;  1K0S A;  4HCE A;  1XMO Q;  1SSO A;  4C3I B;  4I65 A;  2IY5 B;  1CA6 A;  4YWM A;  1YHA A;  4XQJ A;  2KED A;  3GTK H;  1EYD A;  5FJ8 H;  3S16 B;  5FOB B;  5C4X G;  2F0O A;  2JN4 A;  1EOV A;  3H94 A;  2B2W C;  5ELN A;  3TQY A;  4GZY C;  2X6G A;  1O80 A;  2A73 B;  2ZM6 L;  1VQ6 A;  3MHB A;  3OPO A;  3FEW X;  2L1B A;  3F8T A;  3K7A B;  3MXU A;  4QMG A;  3GTG B;  4N9T A;  1CI3 M;  3MTS A;  5KIX A;  4A93 G;  5I2X A;  1D2B A;  5IY0 A;  1JB3 A;  4J15 A;  1HNW Q;  5ELC A;  1VF5 C;  2G9H D;  2BH2 A;  4X66 L;  2ALY B;  3KFU A;  1QIL A;  1J6Q A;  3WWV A;  1PZJ D;  4KJN A;  5LMU Q;  4G4K A;  1GJX A;  5A2Q L;  4ILW A;  1E1O A;  4KI0 A;  4DV7 Q;  1N33 L;  1C0A A;  4BY7 G;  3NEM A;  1TWG B;  1NMF A;  3BJU A;  3FRP B;  2YTV A;  2K5N A;  3BZD B;  3JAM L;  3BDO A;  2KEE A;  1XTC D;  1B9M A;  4N8F A;  3HKZ B;  2DY7 A;  2NZO A;  5HY6 A;  3K59 A;  3K5L A;  1U5K A;  2Z9H A;  4DGZ A;  3T4A C;  4AIM A;  1S5C D;  3CHB D;  1R9T H;  2F4V L;  3ZYY X;  3J80 i;  2VB3 X;  3T56 B;  3PIP A;  4GOP C;  1VQG A;  2N55 A;  4LMQ D;  4P2C B;  4AYB G;  2RSO A;  4LFB L;  1ENC A;  2VUM G;  2PW5 A;  2A6E D;  3M9B A;  1AW7 A;  3CXC A;  1K8O A;  2C35 B;  3MEH A;  3E9I A;  3HOU B;  3WOE A;  4ZKC B;  3HOX B;  2Y0S E;  4DV0 L;  2RDF A;  4KD4 A;  3CQZ H;  1AZP A;  2RKS A;  4HIM A;  1HZB A;  1O78 A;  4LK1 C;  4A3E B;  3HOY G;  1MD2 D;  2OF1 A;  2A6E C;  3NUC A;  5IYD G;  2PNH A;  1LTA D;  3C3L A;  4Y52 H;  1N34 L;  2L4N A;  2ZM6 Q;  4Z9C B;  4B9X A;  3PO3 H;  3CMA A;  1VQP A;  1Y1V B;  3DWQ A;  4IPC A;  1RTN A;  2CFM A;  2PCF B;  4JBJ A;  4MTK A;  3D0F A;  3TRZ A;  5IT9 E;  1HJP A;  3MA2 B;  1B9N A;  1SR3 A;  1VQD A;  2HIV A;  2K32 A;  5CMD A;  2F3V A;  4X66 Q;  3FP9 A;  1A62 A;  2A6H C;  1TWF B;  3J7A 5;  1PTO D;  1AE3 A;  2KA7 A;  2BE5 D;  4HJ7 A;  2R7F A;  2F0W A;  4QGU A;  1N33 Q;  1BXT A;  3OTO L;  2VXW A;  3FDT A;  1D5Z C;  2FIN B;  3I4O A;  1HQM C;  2IPK D;  4FVM A;  3TSS A;  1YJW A;  4L8J A;  1PXU A;  2E5L L;  3CCE A;  1B3A A;  1TWA H;  1YEZ A;  4S3S A;  4DK3 C;  1DZ1 A;  1B8A A;  1YNJ D;  1SND A;  1PH7 A;  3M4Y A;  5CYU A;  5H1S E;  2L12 A;  1CQF A;  1PRT F;  1SNQ A;  3S15 B;  1OXT A;  4GN3 B;  5C3E B;  2UXD L;  1CZG A;  4HMI A;  2F0H A;  3OOC A;  4DNT B;  2F4V Q;  4ZK9 B;  1E2Z A;  4OL7 A;  1HNZ L;  3GTL H;  3NBH B;  2GN5 A;  5BN4 A;  1Z9F A;  2HUG A;  1YNJ C;  4LFB Q;  2A1A A;  1SE2 A;  2B63 B;  3I4M G;  2MGS A;  3TN2 A;  2XVS A;  1PH4 A;  2A8V A;  2EYF A;  1BO0 A;  4YCW A;  5JEA G;  3I4N G;  3TP5 A;  5J22 A;  4KJO A;  1J9O A;  4DV0 Q;  1GM5 A;  1QNU A;  3GTO B;  4RMF A;  5C3W A;  1WCM G;  3HOV G;  3KJP A;  3FKI H;  2EOT A;  3CRL C;  3IFD A;  3PIO 3;  4X3T A;  5IGE A;  1IYV A;  2AKW B;  3NTI A;  2LMC B;  4CBV A;  3V05 A;  1N34 Q;  4ZAI A;  2ZJR A;  1E24 A;  5DEH A;  3FPP A;  2JA5 G;  3A0J A;  3KBX A;  2F0S A;  2K75 A;  3UDI A;  4K6L A;  3NEL A;  3K57 A;  2ZTC A;  4R9W A;  5IWA L;  1UWV A;  4CJ2 C;  4R8N A;  3VA7 A;  3S1M B;  3PUX A;  1SNM A;  1HTP A;  4C1N K;  4A3D B;  5CV6 A;  5BN3 A;  2ATW A;  1Z6H A;  2B2Y A;  1A8V A;  2JQO A;  1I4H A;  2WKC A;  1GUW A;  3URY A;  3OTO Q;  1AFP A;  2SEB D;  4DV5 L;  4QIW B;  3H0G B;  1PH8 A;  1T5X D;  2H1E A;  4F88 A;  1J5E L;  1U9R A;  1S40 A;  2ZT9 C;  2O5I C;  4NW2 A;  3L3O C;  2E5L Q;  4HAE A;  2UXB L;  1XTD A;  3EQL C;  3M4O H;  1S5F D;  2JE6 I;  5G3L F;  1X3E A;  2WKD A;  1Q90 A;  2FMM A;  5D65 A;  1G51 A;  2Z6K A;  1A3U A;  4JV5 L;  1GUS A;  1VQ4 A;  2UXD Q;  1CK1 A;  2H5X A;  3VR6 A;  5IGF A;  1WI5 A;  1HFN A;  3E5S A;  4J1M A;  1HNZ Q;  2KEC A;  1JQY D;  3GTQ H;  1VQE A;  1ILQ A;  5AFW A;  4DV6 L;  4N8X 1;  2F0L A;  5EBC A;  4IJH A;  3R2I A;  4UP7 A;  2B2V C;  1K28 A;  3J7Z C;  3CPW A;  1KQS A;  4A3B H;  1HH2 P;  1TWH H;  2HIX A;  1TT2 A;  4ME3 A;  5LL6 X;  4BY1 H;  1ICF B;  2E2I B;  1IBK L;  4L63 B;  2XWB B;  1D5X C;  1VQM A;  5IP7 H;  1PH1 A;  5M3F H;  4LF8 L;  1LO5 D;  4GN4 B;  5EKL A;  2LSS A;  3O13 A;  4A93 B;  1SMY D;  5EQ0 A;  5IYC G;  1I4Q A;  2D2C C;  1ET9 A;  4KD3 A;  3ULL A;  1PYB A;  4KV6 A;  4A3L G;  5HGT A;  3P20 A;  1UE6 A;  3GTJ B;  4HSV A;  1YNX A;  4KKS A;  2PW7 A;  1DM0 B;  1CSQ A;  5IWA Q;  2EYH A;  1H9J A;  3M4Q A;  3SR1 A;  2Z6B A;  3KLS X;  1AEX A;  4DUY L;  1WTX A;  4YCV A;  3X3N A;  1BR9 A;  1JIC A;  3IRB A;  2D0O A;  4OWW B;  4JBM A;  3GTM H;  4ZUJ A;  3PO2 H;  4DV5 Q;  4CKE A;  1I50 H;  1FGB D;  1J5E Q;  1L1O B;  5C44 H;  1I6H H;  1I3Q B;  1LT6 D;  4DFA A;  5KNC A;  3QOJ A;  1L0W A;  4RWS C;  1HZC A;  3K80 C;  1JCK B;  1VMC A;  2NVX B;  2UXB Q;  4EQN A;  3LWE A;  1I4X A;  2K01 A;  2D5D A;  1MKH A;  4IFD I;  4JOI C;  1TKW B;  2R92 B;  2PQA B;  4K2K A;  5IIF A;  5KYI A;  4QUF A;  1FYC A;  3PO3 G;  1UEA B;  1C4Q A;  3L2P A;  2K4K A;  2RHQ B;  4AYB B;  3HOW H;  4BBS H;  2VUM B;  4JV5 Q;  2OCE A;  5CV8 A;  4ZRZ A;  1GUN A;  5C0X J;  4JI2 L;  4BBR B;  3NHH A;  1F77 A;  2V1C C;  1TR5 A;  3OSO A;  4C3J B;  4B3M Q;  1Q46 A;  4DV6 Q;  3RLN A;  1C7Y A;  5EGT A;  3HOY B;  1J8I A;  2D0P A;  3CCV A;  2PZW A;  1F9P A;  3D6C A;  1I5F A;  1IBK Q;  3PUY A;  4P74 A;  3TP7 A;  4PMB A;  4LFC L;  3VYT A;  3NWT A;  2NN6 H;  2B2T A;  1KDA A;  1PFB A;  1STY A;  1EZ8 A;  1JB7 A;  4A3M G;  1PZK D;  2NTS A;  4LF8 Q;  1IKM A;  4OHJ A;  4RKB A;  5FLX c;  1STH A;  2M9V A;  1STA A;  4JI4 L;  3L0O A;  2FJ2 A;  1PH3 A;  4WRD A;  4YHH L;  1EYG A;  1E2W A;  1GD7 A;  1ESR A;  5BR8 L;  4A3G G;  3ITP A;  4O42 A;  3VDY A;  1Z7T A;  4A3I H;  5EAY A;  2DUD A;  4ZKB B;  2I5M X;  4IOC A;  3GV3 A;  4KKT A;  1K8M A;  3BZC A;  1DD2 A;  3V96 A;  1JOR A;  4DUY Q;  3SEB A;  4UP8 A;  4X6A H;  3S17 H;  4EGV A;  4IUP A;  1EU4 A;  1EWI A;  3NSW A;  4IPD A;  1BF4 A;  4ABN A;  2Y0S G;  3NBH A;  4KY7 A;  1CM9 A;  3S2H B;  2VQF Q;  4FF2 A;  3HOZ H;  1G6P A;  2EY5 A;  4DNR B;  1A2U A;  1HCZ A;  4XYO A;  2R3Z A;  5ELB A;  2WB1 E;  2DY8 A;  5C5L A;  3S14 B;  1P16 A;  4KY5 A;  3RZD B;  2HDM A;  5K5P A;  3CCJ A;  2N49 A;  2F0Q A;  5FKA C;  3OIP A;  4OWX B;  3I4M B;  5M5Y H;  3BS1 A;  4A3J H;  4H0L C;  4XIG S;  1X56 A;  4C2M H;  3RNU A;  4JI2 Q;  5JVG 3;  1MSG A;  3HOV B;  1EIY B;  1JC7 A;  1IBM L;  3HP3 A;  4EQ5 A;  5M5X H;  1G91 A;  3DM1 A;  2I5L X;  1DYQ A;  2YYZ A;  4LFC Q;  3SDZ A;  2JA5 B;  4LF9 L;  4MIU A;  1VQ5 A;  2NVQ B;  3CRK C;  1H9K A;  2Q2H A;  4JI5 L;  4QF4 A;  3I2Z A;  3W1G A;  2NYZ D;  2KQ3 A;  4B3R L;  2JXM B;  1HQR D;  4H7B A;  4JI4 Q;  4MTN A;  3TP8 A;  1X3G A;  2OT2 A;  1S72 A;  4HJ9 A;  4P73 A;  3Q8D A;  4YHH Q;  3S1R B;  1BQQ T;  4FYD A;  1D6E C;  5BR8 Q;  1NR2 A;  5A2Q E;  2JA6 G;  3ULP A;  4UDU C;  3E0E A;  5GAE C;  4GS3 A;  2F52 A;  1KC8 C;  3T16 A;  4JW0 A;  1JWU D;  2EDG A;  4JCV E;  4HJ8 A;  2K33 A;  5C0X H;  4RGN A;  4HIK A;  1LUZ A;  1YZ6 A;  1IBL L;  1AP0 A;  3D4D A;  2F0V A;  5E3F A;  3JAM E;  3PCO B;  2Q8T A;  4PMW A;  4A3F B;  3S1N H;  2PZT A;  2K5D A;  2RDH A;  4A3B G;  1WJJ A;  3R93 A;  3RN2 A;  5CV5 A;  4DAP A;  4BY1 G;  4KTA A;  2BA0 A;  4LF7 L;  2F0U A;  1YHQ A;  3UI2 A;  2NVT H;  1VQB A;  3EA6 A;  1AE2 A;  1IL8 A;  1CA5 A;  4QB4 A;  2DNE A;  1B53 A;  1PFM A;  1Y1W H;  2R93 H;  2QEJ C;  1LTR D;  3E6Z X;  4AH6 A;  1RCV D;  1SXT A;  1YJN A;  4P75 A;  3I70 A;  4G7Z C;  3KBG A;  4NKL A;  3OWE B;  3P75 A;  3G7L A;  1SRU A;  2J7Z A;  4OXP A;  2O5J C;  4GNX C;  4RG1 A;  3KUP A;  1PRT D;  5C4Z A;  1TS2 A;  4BXX H;  3DWA A;  2ZXR A;  4XTC S;  5IYB H;  2EQS A;  3AFQ A;  3E0J A;  2NVY H;  2IX1 A;  1A63 A;  1B1Z A;  1IBM Q;  2ID0 A;  4RCN A;  1K83 H;  1PRT C;  5I4D A;  4HED A;  2RBM A;  1K8A C;  2L5T A;  3W5O A;  2I5H A;  4J8Q A;  3K8A A;  2EY2 A;  1EY7 A;  1NTG A;  1TS5 A;  2SOB A;  3PO2 G;  3ND8 A;  2F0J A;  4HMJ A;  2XGT A;  4LF9 Q;  1EOT A;  4L5R C;  4JI5 Q;  4B3R Q;  4LW1 A;  4LF5 L;  1HTL D;  1MJE A;  4CDE C;  4OON A;  1C8C A;  1L1O A;  1SE3 A;  1TS4 A;  2UU9 L;  1QZH A;  1PTO B;  2J0T D;  2Z0S A;  3TBI B;  3SHL A;  2F3W A;  2JEA I;  2LY7 A;  2PQA A;  4RCO A;  3OHX C;  4C56 C;  3MXG A;  1BUV T;  1IBL Q;  4UY8 C;  2KEN A;  2M00 A;  1PH6 A;  5JAV A;  1Y8N B;  2K7V A;  2ZTD A;  4JI6 Q;  1HZ9 A;  1LTB D;  5J3B A;  4IZ8 A;  1WVL A;  1FNU A;  5M3M H;  4WOR A;  1EZ6 A;  1VS0 A;  3OIQ A;  1L2F A;  5K36 H;  4LF7 Q;  3RN5 A;  1LTT D;  1SJH D;  3PF5 A;  2NN6 G;  2MQH A;  1W3S A;  2EJM A;  4A3C H;  5C4H A;  2PQE A;  4DK1 A;  1LT4 D;  5EPJ A;  2HCI A;  5G3L D;  4HCS A;  1EIG A;  5KGU A;  3NBI A;  2L11 A;  3I90 A;  4K6D A;  1NR4 A;  3Q22 A;  3CCQ A;  4TQU S;  4JBK A;  1QUQ B;  1SJE D;  4DK0 A;  1SAP A;  3UE0 A;  2A69 D;  3CCL A;  2ICI A;  3PUW A;  4RAU C;  1MHW C;  4A3M B;  3J81 E;  3SK5 A;  4IQZ A;  4X3S A;  2AHO B;  2ZXO A;  1DOK A;  3T53 B;  3A55 A;  2A69 C;  2WP8 J;  3E3X A;  4DU9 A;  3T1Y L;  4B3T L;  2XIW A;  1YJ9 A;  4A3G B;  3ULJ A;  1JOQ A;  1GHK A;  3RZO H;  1VCI A;  1TY0 A;  2QGQ A;  4GLX A;  3E9H A;  3KYH C;  4IN3 A;  4LF5 Q;  2NB0 A;  4A3K G;  3D4W A;  1KLU D;  3IL8 A;  4L5Q A;  1O7L A;  1V43 A;  4EX5 A;  3F2C A;  3ER0 A;  1DOM A;  2UU9 Q;  3K0X A;  2DJG C;  2IX0 A;  4C3H H;  5C4J H;  3CKI B;  4C1N I;  3MVV A;  1PLF A;  2EJF C;  4RA8 A;  3VR2 A;  1SNP A;  3BDC A;  3GP7 A;  3CC2 A;  1R4P B;  1PYW D;  1G6Z A;  2Y0S B;  3M7N A;  2K5Q A;  4C3I H;  1UUP A;  2A74 C;  4K0K L;  2B2W A;  4QL5 A;  2B39 A;  1E7Z A;  4A4I A;  1D1I A;  5TSS A;  5CV4 A;  3X3M A;  3GDE A;  1LM0 A;  3S16 H;  2A6H D;  5CR3 A;  3VR4 A;  1X32 A;  2K5H A;  1EFI D;  2KVM A;  3TP6 A;  1D8L A;  2B2U C;  1SNO A;  1EWC A;  2DN8 A;  4HJA A;  2IW3 A;  3KK7 A;  4R4T A;  1CHQ D;  1ASZ A;  1V1Q A;  3T1H L;  4M8A A;  3MEF A;  1YVC A;  3NEN A;  1NAP A;  2YU9 B;  1LTI D;  5CC4 A;  3K7A H;  3J81 j;  5IOC A;  4RGO S;  3DHQ A;  3GTG H;  1ZEQ X;  1EY8 A;  4PV1 C;  2EYP A;  3HG9 A;  1U4L A;  3UE1 A;  4YIJ A;  4LWC A;  4PZ7 A;  2K14 A;  5JJL A;  2B2Y C;  2NN6 I;  2IL8 A;  5CV7 A;  1X3F A;  1WTR A;  2R7Z G;  3A8K E;  5ELD A;  1TWG H;  3SVM A;  3QOL A;  3I73 A;  3T1Y Q;  4B3T Q;  1Y1W G;  3QB3 A;  2JA6 B;  1RJT A;  1F2M A;  2N78 A;  4LNQ A;  4ZUI A;  1FD7 D;  1BCP F;  2JK8 A;  2WB1 G;  4YWK A;  5EJW A;  1DJR D;  1Q8I A;  4NB3 A;  4IO9 A;  1SFO B;  3PMF A;  2AQ2 B;  5JJK A;  4BXX G;  2Z6K C;  3KDF B;  2XSC A;  1CKM A;  2CW0 C;  2EPB A;  2JA7 B;  3PV0 A;  1JR0 D;  2VY3 A;  5E4W C;  2IWH A;  2L55 A;  2PO4 A;  3CP0 A;  4R8I A;  4DN4 M;  3T13 A;  4IPG A;  1LYL A;  3CCR A;  4K0K Q;  2OQK A;  1VF7 A;  3I72 A;  3J81 L;  1SYG A;  4DNI A;  3QWN A;  4KHP L;  3HOU H;  1PH2 A;  2R6G A;  1PH9 A;  1UEB A;  1Z47 A;  3KF6 B;  4LJZ C;  3HOX H;  1PYS B;  1RHP A;  1OXV A;  2CQO A;  5DNF A;  1VQ9 A;  4IFD G;  4A3E H;  1ASY A;  1L0X B;  3BU2 A;  2JA8 G;  1BKB A;  4APV A;  5I6W A;  3T1H Q;  1OTC A;  3A5U A;  1EQR A;  2HQE A;  1WD0 A;  3U9O A;  3R3O A;  3J80 c;  1LT3 D;  1Y1V H;  1S3O A;  1T9H A;  4GKJ L;  1GUG A;  1EQQ A;  1B70 B;  1N9W A;  1KAA A;  1UAP A;  4JG2 A;  5FJ8 G;  1KNE A;  3PIP 3;  1ESF A;  2FHT A;  3PQI A;  2F0E A;  2IJ0 A;  3GTP B;  4FO2 A;  2LXJ A;  1KTK A;  2OXP A;  3JAM i;  4DV1 L;  1TWF H;  1EY6 A;  4EVO A;  2A19 A;  2SNM A;  3FMC A;  3H3V H;  4DR2 L;  1VQA A;  5M3M G;  1VQC A;  4OIJ A;  1GO3 E;  3HRZ C;  1O7Z A;  3NK9 A;  3AB9 A;  1EQT A;  2KCT A;  3GQB A;  1RKN A;  1SYC A;  2EVB A;  1Y69 U;  1V8Q A;  2GVA A;  4FF3 A;  4WJ4 A;  5M9O A;  5C4X B;  3QG1 A;  2NUC A;  3PGZ A;  2WAC A;  4B3M L;  5E7N A;  2B29 A;  3DEO A;  2EYL A;  2RF4 A;  3T51 B;  5C0X I;  4QUC A;  2E8G A;  1S5D D;  1XJV A;  3S15 H;  1BDO A;  5C3E H;  3Q23 A;  4LUO A;  4H44 C;  4BWG B;  4M1U B;  3S24 A;  1X3Q A;  4HTH A;  5CGK A;  3U58 A;  3Q6S A;  4UP9 A;  2Q2U A;  5F2D A;  2E2H B;  1WYD A;  1M8A A;  1L0Y B;  2LFN A;  5FO7 B;  4KHP Q;  4ZLT F;  3U4V A;  1B44 D;  1UNS A;  3S1Q B;  3HZX A;  3KLR A;  1ICW A;  3B6Y A;  2PI2 E;  1QUQ A;  4LUZ A;  3CF5 A;  3A54 A;  3GTO H;  2QDL A;  5LMN L;  4EQO A;  1LTL A;  4ODG A;  1VQH A;  1SN8 A;  2J4X A;  4LAA A;  4OIK A;  2VW9 A;  2YV5 A;  3F2B A;  2ZJP A;  1H9M A;  4DV2 L;  3H91 A;  4BY7 B;  3NWS A;  4OO1 H;  3JC6 6;  2JEB I;  1F2Z A;  3FVQ A;  1CQV A;  4UHV A;  4GKJ Q;  3OW7 A;  4C3H G;  1W6J A;  3SK6 A;  1FL0 A;  4KK7 A;  1Q82 C;  4EQP A;  3ERO A;  1RDP D;  2Q8R E;  3S1M H;  4MHE A;  3TDQ A;  4IUQ A;  3S2D B;  2AMC B;  4A3D H;  4DR5 L;  4DV1 Q;  1MI2 A;  4O2D A;  1T5E A;  2VQF L;  1LAC A;  3C46 A;  2OTL A;  1A6X A;  4Y7N B;  2F0F A;  3P1H A;  1EU3 A;  2LXK A;  3K0Y A;  5BN5 A;  4BA1 I;  4DR2 Q;  1TXY A;  4A3K B;  1IL2 A;  3M3Y B;  3M4P A;  3H0G H;  2SNS A;  3N6R A;  4KN4 C;  4DAY B;  2Z1C A;  4JPB W;  4QCL A;  1JT8 A;  2CH4 A;  1RD9 D;  4JI8 L;  3VA5 A;  1PA6 A;  2B8F A;  4QY7 A;  4JI1 L;  1HR0 W;  1X65 A;  4FXK C;  4POG A;  2VL6 A;  3R2T A;  1Q1E A;  1NMG A;  4KY6 A;  4MNO A;  2K52 A;  3PF4 A;  2B2V A;  3RLO A;  5EPL A;  1B7Y B;  1EIH A;  2L9H A;  5DM6 3;  1NNX A;  3MFY A;  3C2P A;  2MFI A;  1GKH A;  4LFA L;  3K6O A;  4GNX B;  3TRE A;  1KLG D;  5M5W B;  4B08 A;  4OX9 L;  3J81 i;  3CCM A;  4B3S L;  2E76 C;  1EY9 A;  2E2I H;  2HDL A;  1A3V A;  2RA4 A;  2EY1 A;  2LS0 1;  5LMN Q;  4ZCK A;  1WTW A;  2TMP A;  2K50 A;  2UUC L;  3QR8 A;  1PRT B;  3FPU B;  2K04 A;  2GA4 B;  2N88 A;  1V1O A;  4DV2 Q;  1TWC B;  1PHJ A;  4A93 H;  4AQY L;  4RFB A;  4NMZ A;  2HT1 A;  1U4P A;  5D3D A;  2QW7 A;  2K28 A;  2N8N A;  1CTM A;  3GTJ H;  5JEA J;  3ND9 A;  1G8Z D;  5EKI A;  1JJ2 A;  2K1B A;  1GUT A;  1KD1 C;  3VR5 A;  1VQ7 A;  1ZYR C;  2R7D A;  3IKJ A;  2R7Z B;  2CWA A;  4U67 3;  4IUT A;  1SYD A;  3FKI G;  1XMQ L;  4DR5 Q;  2RHS B;  1TU2 B;  2CVR A;  1Q86 C;  3N52 A;  1GOZ A;  5KEE A;  4ME5 A;  1SBB B;  3KLW A;  1EUJ A;  2KUM A;  5COR A;  3KDF A;  4JOI A;  1QNK A;  3CAM A;  2RCN A;  2WB1 B;  1ML0 D;  4RHR A;  1HZA A;  2AQ1 B;  1QCB D;  2ICE C;  1I3Q H;  1EEF D;  3EN2 A;  4IFD J;  4JI8 Q;  3I4N B;  4A3E G;  2NVX H;  4TSS A;  4WJW A;  4JI1 Q;  1VMP A;  2R92 H;  3TME A;  1WCM B;  3KF6 A;  1FNV A;  1RTO A;  2JJQ A;  5HGQ A;  1SEB D;  3ONA B;  1B50 A;  5CV9 A;  1TQO A;  1UE5 A;  2VUM H;  3ZJY C;  4UPA A;  5GAG C;  2EE1 A;  4GKK L;  1TVX A;  2AQ3 B;  5KRU A;  4LFA Q;  4BBR H;  1X6O A;  4Q5V A;  1LT5 D;  2EYM A;  4C3J H;  3AMU A;  1XPR A;  2MP1 A;  1E2V A;  1ET6 A;  4OX9 Q;  2E2J B;  4CDC C;  4B3S Q;  1ENF A;  3HOY H;  3F2D A;  1CUK A;  2F0D A;  1KAW A;  1XX8 A;  2JA8 B;  1BBU A;  2F0I A;  1QOH A;  5IYD H;  4JI7 L;  4R4C A;  2PMZ B;  4L5T A;  1CSP A;  2VB2 X;  3QJY A;  2JP1 A;  2UUC Q;  1SYE A;  3A7L A;  1Q7Y C;  2F0P A;  4IUV A;  3GTK B;  4HSP A;  4AQY Q;  3D4R A;  2ES2 A;  1G2T A;  1ROD A;  5IGB A;  1K3R A;  1BNZ A;  2CWP A;  4JI6 L;  1L1O C;  5LHY 1;  1JE5 A;  2QCP X;  2WAQ E;  1E3P A;  4GOP B;  2A68 D;  1XMQ Q;  3NQT A;  2KCN A;  5IP7 G;  2B3G A;  3I4L A;  2I07 B;  3C1E A;  5M3F G;  2CH4 W;  3DM3 A;  1S4Z A;  3K5O A;  3NXW A;  3M7G A;  4X62 L;  5AJ3 L;  5FLX E;  3CCU A;  1HUN A;  2DGY A;  3MC0 B;  3A74 A;  3A8I E;  1PV4 A;  2QDB A;  2A68 C;  4FXG C;  1WTP A;  5D3I B;  3UDF A;  1HXY D;  1Q8K A;  1QZG A;  1YNN D;  4P71 A;  1U0L A;  5GAH C;  1HA6 A;  3S2H H;  1BBW A;  4O1N A;  2XN9 C;  2PYK A;  2AWO A;  1BCP D;  2SDF A;  3S14 H;  4PMC A;  3RZD H;  1FJG L;  1ENA A;  5JJZ A;  1KHI A;  2UXC L;  3CPF A;  3I4M H;  3Q0A A;  1YNN C;  3CCS A;  4GKK Q;  1VQJ A;  1LLR D;  5JEA H;  3K5M A;  1IYU A;  1N36 L;  4BBS B;  1JOK A;  4IUR A;  3SXH A;  4IJL A;  5C44 G;  1QE6 A;  1BCP C;  5FO8 B;  3HOV H;  3OW2 A;  1X54 A;  4IAL A;  5I6Y A;  1JOO A;  2DJF C;  4HN7 A;  1NCV A;  1F2L A;  2O2L D;  2DNC A;  4JI7 Q;  4CJ1 B;  1R9T B;  3MXN B;  3AYH B;  4PZ6 A;  2BOS A;  4YCU A;  3H0G G;  3A8J E;  2D62 A;  3HOW G;  2JA5 H;  4BBS G;  3CD6 A;  4K14 A;  4LUV A;  2NVQ H;  3GV6 A;  3LWU A;  1XYI A;  2V4D A;  3OYY A;  5IT9 c;  2HQL A;  2KCM A;  3G6E A;  4K8J A;  1I4G A;  2F3I A;  2BDO A;  5E4X A;  4CJ0 B;  2PZU A;  3CQZ B;  3MAQ A;  2KHJ A;  1IXR A;  2M2L A;  1QVG A;  3S1R H;  4DAY A;  1TS3 A;  3BZK A;  3BVZ A;  2RCF A;  5EKK A;  2QF7 A;  5C5M A;  2Q2I A;  1G29 1;  2R61 A;  4X64 L;  2H4O A;  3PO3 B;  3H3V I;  1UE1 A;  1EYC A;  1K0R A;  1KNA A;  3VYU A;  1Q1B A;  2FXQ A;  4A3F H;  3G6J B;  1NE3 A;  2D9U A;  4X62 Q;  5AJ3 Q;  2IT1 A;  2YTY A;  1Q3L A;  2VS1 A;  1GUO A;  2PPB C;  3WDN A;  1KDB A;  5CBE E;  5KYL A;  4A76 A;  4CHT B;  3G48 A;  3SGI A;  4HIO A;  4GNX A;  3LX0 A;  2KBN A;  1QWY A;  2WIN B;  2K03 A;  2B8G A;  2MO1 A;  2AUJ D;  2MHV A;  4R4O A;  4A3I G;  2ENB A;  4WFN 3;  2RDG A;  3CU7 A;  3I91 A;  3DLL A;  1TY2 A;  1FJG Q;  1VQI A;  2VQE L;  1BBX C;  2UXC Q;  4X3K A;  2MUY A;  1WD1 A;  4G57 A;  4HID A;  3PIO A;  2YTX A;  1H95 A;  1QVC A;  4RHS A;  3HEJ A;  4L5S A;  3MWY W;  1TWA B;  1VQF A;  1N36 Q;  4PNY A;  1M4V A;  1HNX L;  2VNU D;  3K81 C;  4GN5 A;  4JI0 L;  1VQL A;  3MXP A;  5I9P A;  3HOZ G;  1JJG A;  3UDX A;  2CKZ B;  5JOB A;  3HKZ E;  5FLX L;  5IP9 H;  3W1B A;  4DA2 A;  2EXZ A;  5IYC H;  3NE5 B;  1LTS D;  3GTL B;  4OO1 I;  4CDF C;  1KXL A;  4A3L H;  4A3J G;  3BVG A;  2BDN A;  5EBD A;  4XQN A;  4JK1 C;  4LF6 L;  1DCZ A;  3TEH B;  1LAB A;  4F7X A;  1HR0 L;  4U68 A;  2BH8 A;  1QJO A;  1M90 C;  3IAY A;  2R92 G;  4HR7 B;  4ZQ3 A;  1O7I A;  3ICE A;  5FLM H;  3FKI B;  1AN8 A;  4DK6 C;  1C48 A;  1PFN A;  3I56 A;  5E1F A;  4FF4 A;  3U9S A;  1PTO H;  3F2U A;  4KHV A;  1F9S A;  4MZ9 A;  4O0A A;  2QIL A;  4NPS A;  5IGC A;  1OO9 B;  2N3S A;  4X64 Q;  3UDG A;  1YIJ A;  1KL9 A;  2K05 A;  3Q24 A;  4BBR G;  5HUR A;  1XPU A;  4RGT A;  3VR3 A;  1A2T A;  4R4Q A;  4XT1 B;  4C3J G;  3QO2 A;  2AWN A;  3D6W A;  1OXU A;  1WTV A;  1STN A;  1U4R A;  5ELF A;  2CQA A;  2NZH A;  2Q8I B;  1HUM A;  5D14 A;  3J7A F;  2EYO A;  1QG7 A;  2G9D A;  1I6V C;  1X3P A;  3LNN A;  4PG3 A;  1MJC A;  3J7A V;  3K5N A;  2RVL A;  5C0X G;  4OWT B;  3C1F A;  4L6T B;  2VQE Q;  2EZV A;  1MBY A;  3M4O B;  2KJX A;  4KMU C;  4XT3 B;  2EJG C;  3HS0 C;  4NXN L;  1HNX Q;  2HD3 A;  4F87 A;  1JE4 A;  4JI0 Q;  3SK4 A;  3WOF A;  1Y14 B;  4QQB X;  2CW0 D;  2FMC A;  2R93 G;  3D8G A;  1ILP A;  4A3M H;  3DEP A;  2JA9 A;  1EL0 A;  1YI2 A;  3FHW A;  2G5D A;  1ZXT A;  1CKN B;  1OXX K;  3TZU A;  4FDB A;  1PTO C;  3GTQ B;  4GOP A;  2MO0 A;  2BE5 C;  2EY6 A;  1X55 A;  2F0N A;  3RD4 A;  3TS2 A;  1JJC B;  1II3 A;  1OXS C;  1JWM D;  1DXM A;  4A3B B;  4BS9 A;  3SE0 A;  1MIU A;  1I4R A;  3KF8 B;  1TWH B;  3PUZ A;  5ELE A;  1MGS A;  3BYT B;  1HR0 Q;  4LF6 Q;  4X65 L;  4BY1 B;  4A3G H;  1ONL A;  4DAM A;  1S5B D;  5IYB G;  2C9O A;  3HKS A;  1LTG D;  1PZI D;  5FO9 B;  3J7Y W;  1VQN A;  3G4S A;  1NY4 A;  1HHV A;  1STG A;  4HJ5 A;  1XPO A;  2C5C A;  5M3F B;  1WFQ A;  1YHB A;  5JVH 3;  3SK8 A;  5A35 A;  3KLS A;  2GVB A;  4I7A A;  3G71 A;  1B3Q A;  2FFK B;  4NXM L;  1NUC A;  2B2U A;  1CT1 D;  2F4I A;  3RMH A;  1W2B A;  2E75 C;  3F1Z A;  1IW7 D;  1A3T A;  4DR4 L;  5JPN C;  1SMX A;  4E6I A;  1G2S A;  4H02 A;  4N9P A;  2O4X A;  1BOS A;  4MN3 A;  4GLA C;  2QA4 A;  1IZ6 A;  4J6H A;  4V19 0;  3HGB A;  4YY3 L;  3GTM B;  3PO2 B;  4V0B A;  2Z4H A;  5LL6 S;  2MJ8 A;  3MXN A;  1IW7 C;  1I50 B;  1VQ8 A;  5C44 B;  1I6H B;  1KRS A;  2YU9 H;  4I7Z C;  5C3X A;  3EIV A;  1AH9 A;  4XDX A;  4NP5 A;  2CCZ A;  2WAQ G;  1FR3 A;  4QIW E;  5K36 G;  4NXN Q;  3S9W A;  1D7Q A;  1S5E D;  4DR7 L;  4DR1 L;  2WII B;  3CC7 A;  4ULL A;  4ID6 A;  4DV4 L;  3I7F A;  3HOW B;  2AUK A; 
#chains in the Genus database with same CATH homology
 4KKU A;  5T1I A;  1W6K A;  5ISR A;  2X6L A;  3NPP A;  3W3A A;  5T1G A;  1AZQ A;  1HPC A;  1H9R A;  5IT9 L;  3ERQ A;  3NQI A;  4DXG A;  2F03 A;  4CKC A;  3RUZ A;  2X69 A;  2WV6 D;  1KDC A;  2XRQ D;  2K5W A;  1V1P B;  1CHP D;  1EYA A;  2QKI C;  2B2T C;  5DM7 3;  5COY A;  4A3I B;  4PQX A;  3H3V C;  4XQQ A;  4RH6 A;  3IFT A;  4K5X A;  1EY0 A;  3D3R A;  4KHZ A;  4DF7 A;  3DMU A;  1DOL A;  5IOD A;  2JYO A;  3S17 B;  2I46 A;  2K6A A;  3H6M A;  4K8I A;  4TRD A;  3I8Z A;  3BVM A;  5KNB A;  5KND A;  1WTO A;  1SMY C;  5FK9 C;  1EQV A;  4C3I G;  1STB A;  2KHS A;  3HOZ B;  4BA2 I;  1H9S B;  2E2D C;  5J39 A;  1HA5 A;  3R8B A;  3OMC A;  4K5W A;  4G7O C;  1CFM A;  5M5Y B;  4A3J B;  4C2M B;  2XRS D;  3L7Z C;  3MFG A;  2XNA C;  3J80 E;  2LKV A;  2F0K A;  5IGD A;  1QB5 D;  3EVQ A;  2NBF A;  1WTQ A;  1PTO F;  3RLF A;  1Y8O B;  1E0B A;  5M5X B;  3BG3 A;  1D1K A;  3PUV A;  5NUC A;  3NTK A;  4X3U A;  4CKB A;  5CBA E;  4DXF A;  4CGY B;  2E74 C;  2XWJ B;  1SYB A;  3BYY B;  4TKO B;  3A56 A;  1EY4 A;  3H09 A;  2CHB D;  4Q0F A;  1ZYR D;  2F1M A;  2BCO A;  2RSN A;  2KCC A;  1F2Y A;  3EJI A;  4IUU A;  1GXD C;  3P7J A;  1PDQ A;  1BCP B;  2F0T A;  2L0C A;  1LV9 A;  5C6A A;  1IHZ A;  3S1N B;  1XWE A;  3DWP A;  1SNC A;  1F9R A;  2PNR C;  2NVT B;  3NTH A;  3TZD A;  1EWH A;  2R93 B;  1Y1W B;  1TII D;  1DON A;  1SE4 A;  1D5M C;  2Z4I A;  3KF8 A;  1VDZ A;  3A7A B;  1ZKO A;  5JPM C;  2A5H A;  1A15 A;  2F0G A;  2HCC A;  1B2T A;  1I4P A;  5IGG A;  2NVY B;  1PMR A;  4DAV A;  1SYF A;  1MSH A;  2KOL A;  1K83 B;  1CZW A;  1STE A;  3DXJ C;  4FNF A;  1EEI D;  4B9W A;  1RF2 D;  3BDL A;  4UAI A;  1IKL A;  2JSO A;  3D31 A;  2RQX A;  1SDF A;  1Q12 A;  3OMG A;  5I9O A;  2TSS A;  1KAB A;  3MZ5 A;  2EYJ A;  4G7H C;  2Z8L A;  3W2D A;  2OEO A;  3J80 L;  3OWF A;  3QIA A;  1HRJ A;  2ZXP A;  4FP5 D;  5M3M B;  4NDX A;  2WAQ B;  4ZYS A;  2BA1 A;  2IX3 A;  3VYR A;  2MPM A;  4OGQ C;  3AU7 A;  1U4M A;  1EY5 A;  1F9Q A;  3V2T A;  1FNW A;  5I2Y A;  4K5V A;  1R4Q B;  4K2L A;  2NZ1 D;  4KN7 C;  3M85 A;  4JBW A;  2F0M A;  4XYQ A;  3GO5 A;  1V1P A;  4OO1 G;  1XXG A;  1B4O A;  3K58 A;  5EPK A;  4H13 C;  1HFG A;  5J1Z A;  4IUN A;  3GD7 A;  1NSN S;  2NWG A;  1GHJ A;  4FXD A;  4XXE A;  3RZO B;  4RGM A;  2NTT A;  4F8M A;  1Y8P B;  3I3C A;  5DAU A;  1JWS D;  1O7Y A;  3EFX D;  4C3H B;  5C4J B;  4FF1 A;  3VYS A;  4IFD H;  3NP8 A;  4RKL A;  1H9S A;  3DUZ A;  3L9A X;  4HCE A;  1SSO A;  4C3I B;  4I65 A;  1CA6 A;  4XQJ A;  2KED A;  1EYD A;  3S16 B;  5FOB B;  2F0O A;  3H94 A;  2B2W C;  4GZY C;  2X6G A;  1O80 A;  2A73 B;  3MHB A;  3OPO A;  3FEW X;  2L1B A;  3K7A B;  3MXU A;  4QMG A;  3GTG B;  4N9T A;  1CI3 M;  3MTS A;  5KIX A;  5I2X A;  1D2B A;  1JB3 A;  5ELC A;  1VF5 C;  2G9H D;  1QIL A;  1PZJ D;  4KJN A;  4G4K A;  1GJX A;  5A2Q L;  4ILW A;  4KI0 A;  1TWG B;  3FRP B;  3BZD B;  3JAM L;  3BDO A;  2KEE A;  1XTC D;  1B9M A;  3HKZ B;  2DY7 A;  3K59 A;  3K5L A;  4DGZ A;  3T4A C;  1S5C D;  3CHB D;  3ZYY X;  2VB3 X;  3T56 B;  2N55 A;  4LMQ D;  4P2C B;  2RSO A;  1ENC A;  2PW5 A;  2A6E D;  1AW7 A;  1K8O A;  3MEH A;  3HOU B;  3WOE A;  4ZKC B;  3HOX B;  2RDF A;  4KD4 A;  1AZP A;  2RKS A;  1O78 A;  4LK1 C;  4A3E B;  1MD2 D;  2OF1 A;  2A6E C;  3NUC A;  1LTA D;  3C3L A;  2L4N A;  4Z9C B;  4B9X A;  1Y1V B;  3DWQ A;  1RTN A;  2PCF B;  5IT9 E;  3MA2 B;  1B9N A;  2K32 A;  5CMD A;  2F3V A;  2A6H C;  1TWF B;  1PTO D;  2KA7 A;  2BE5 D;  2F0W A;  1BXT A;  2VXW A;  3FDT A;  1D5Z C;  2FIN B;  1HQM C;  2IPK D;  4FVM A;  3TSS A;  4L8J A;  1PXU A;  1B3A A;  1DZ1 A;  4S3S A;  1YNJ D;  1SND A;  3M4Y A;  5CYU A;  2L12 A;  1CQF A;  1PRT F;  1SNQ A;  3S15 B;  1OXT A;  5C3E B;  1CZG A;  4HMI A;  2F0H A;  3OOC A;  4DNT B;  4ZK9 B;  1E2Z A;  4OL7 A;  5BN4 A;  2HUG A;  1YNJ C;  1SE2 A;  2B63 B;  2MGS A;  3TN2 A;  2XVS A;  2EYF A;  1BO0 A;  5JEA G;  3TP5 A;  5J22 A;  4KJO A;  1J9O A;  1QNU A;  3GTO B;  5C3W A;  3IFD A;  2EOT A;  3CRL C;  3PIO 3;  4X3T A;  5IGE A;  1IYV A;  3NTI A;  2LMC B;  4CBV A;  3V05 A;  4ZAI A;  5DEH A;  3FPP A;  3KBX A;  2F0S A;  4K6L A;  3K57 A;  4R9W A;  4CJ2 C;  3VA7 A;  4R8N A;  3S1M B;  3PUX A;  1SNM A;  1HTP A;  4C1N K;  4A3D B;  5CV6 A;  5BN3 A;  1Z6H A;  2B2Y A;  1I4H A;  2WKC A;  1GUW A;  3URY A;  1AFP A;  2SEB D;  4QIW B;  3H0G B;  1T5X D;  2H1E A;  4F88 A;  1U9R A;  2ZT9 C;  2O5I C;  4NW2 A;  3L3O C;  4HAE A;  3EQL C;  1S5F D;  2JE6 I;  5G3L F;  2WKD A;  1Q90 A;  2FMM A;  5D65 A;  1A3U A;  1GUS A;  1CK1 A;  3VR6 A;  5IGF A;  1HFN A;  3E5S A;  4J1M A;  2KEC A;  1JQY D;  1ILQ A;  5AFW A;  2F0L A;  5EBC A;  3R2I A;  2B2V C;  1TT2 A;  5LL6 X;  2E2I B;  4L63 B;  2XWB B;  1D5X C;  1LO5 D;  5EKL A;  3O13 A;  4A93 B;  1SMY D;  5EQ0 A;  1I4Q A;  2D2C C;  1ET9 A;  4KD3 A;  4KV6 A;  5HGT A;  3P20 A;  3GTJ B;  4HSV A;  4KKS A;  2PW7 A;  1DM0 B;  2EYH A;  1H9J A;  3SR1 A;  3KLS X;  1AEX A;  1WTX A;  3X3N A;  1BR9 A;  1JIC A;  4ZUJ A;  4CKE A;  1FGB D;  1I3Q B;  1LT6 D;  4DFA A;  5KNC A;  3QOJ A;  4RWS C;  1JCK B;  1VMC A;  2NVX B;  4EQN A;  3LWE A;  1I4X A;  2K01 A;  2D5D A;  4IFD I;  2R92 B;  1TKW B;  4K2K A;  5IIF A;  5KYI A;  4QUF A;  1FYC A;  1UEA B;  1C4Q A;  4AYB B;  2VUM B;  5CV8 A;  4ZRZ A;  1GUN A;  5C0X J;  4BBR B;  3NHH A;  1F77 A;  1TR5 A;  3OSO A;  4C3J B;  5EGT A;  3HOY B;  1J8I A;  2PZW A;  1F9P A;  3D6C A;  3PUY A;  3TP7 A;  4PMB A;  3VYT A;  3NWT A;  2NN6 H;  2B2T A;  1KDA A;  1PFB A;  1STY A;  1EZ8 A;  1PZK D;  2NTS A;  1IKM A;  4OHJ A;  4RKB A;  1STH A;  2M9V A;  1STA A;  2FJ2 A;  4WRD A;  1E2W A;  1ESR A;  3ITP A;  4O42 A;  1Z7T A;  4ZKB B;  3GV3 A;  4KKT A;  1K8M A;  1DD2 A;  3V96 A;  1JOR A;  3SEB A;  4EGV A;  4IUP A;  1EU4 A;  3NSW A;  1BF4 A;  4ABN A;  3NBH A;  4KY7 A;  1CM9 A;  3S2H B;  4FF2 A;  2EY5 A;  4DNR B;  1A2U A;  1HCZ A;  4XYO A;  2R3Z A;  5ELB A;  2DY8 A;  5C5L A;  3S14 B;  4KY5 A;  3RZD B;  2HDM A;  5K5P A;  2F0Q A;  5FKA C;  3OIP A;  3I4M B;  3BS1 A;  4H0L C;  4XIG S;  5JVG 3;  1MSG A;  3HOV B;  1JC7 A;  3HP3 A;  1G91 A;  3DM1 A;  1DYQ A;  2YYZ A;  3SDZ A;  2JA5 B;  4MIU A;  2NVQ B;  3CRK C;  1H9K A;  2NYZ D;  2KQ3 A;  2JXM B;  1HQR D;  4H7B A;  3TP8 A;  2OT2 A;  3S1R B;  1BQQ T;  4FYD A;  1D6E C;  1NR2 A;  5A2Q E;  4UDU C;  3T16 A;  1JWU D;  2EDG A;  2K33 A;  5C0X H;  4RGN A;  1AP0 A;  3D4D A;  2F0V A;  5E3F A;  3JAM E;  2Q8T A;  4PMW A;  4A3F B;  2PZT A;  2K5D A;  2RDH A;  3R93 A;  5CV5 A;  4DAP A;  4KTA A;  2BA0 A;  2F0U A;  3UI2 A;  3EA6 A;  1CA5 A;  1IL8 A;  4QB4 A;  2DNE A;  1B53 A;  1PFM A;  2QEJ C;  1LTR D;  3E6Z X;  1RCV D;  1SXT A;  3I70 A;  4G7Z C;  3KBG A;  4NKL A;  3OWE B;  3P75 A;  3G7L A;  2J7Z A;  2O5J C;  3KUP A;  1PRT D;  5C4Z A;  1TS2 A;  3DWA A;  2ZXR A;  4XTC S;  3E0J A;  2IX1 A;  1B1Z A;  2ID0 A;  4RCN A;  1PRT C;  5I4D A;  4HED A;  2RBM A;  2L5T A;  4J8Q A;  2EY2 A;  1EY7 A;  1TS5 A;  2SOB A;  3ND8 A;  2F0J A;  4HMJ A;  1EOT A;  1HTL D;  1C8C A;  1SE3 A;  1TS4 A;  1PTO B;  2J0T D;  3TBI B;  3SHL A;  2F3W A;  2JEA I;  2LY7 A;  4RCO A;  3OHX C;  4C56 C;  3MXG A;  1BUV T;  2M00 A;  5JAV A;  1Y8N B;  2K7V A;  1LTB D;  4IZ8 A;  1WVL A;  1FNU A;  4WOR A;  1EZ6 A;  3OIQ A;  5K36 H;  1LTT D;  1SJH D;  2NN6 G;  2EJM A;  5C4H A;  2PQE A;  4DK1 A;  1LT4 D;  5EPJ A;  2HCI A;  5G3L D;  4HCS A;  1EIG A;  5KGU A;  3NBI A;  2L11 A;  3I90 A;  4K6D A;  1NR4 A;  3Q22 A;  4TQU S;  1SJE D;  4DK0 A;  1SAP A;  2A69 D;  2ICI A;  3PUW A;  4RAU C;  4A3M B;  3J81 E;  3SK5 A;  4IQZ A;  4X3S A;  2ZXO A;  1DOK A;  3T53 B;  3A55 A;  2A69 C;  2WP8 J;  4DU9 A;  1JOQ A;  2XIW A;  4A3G B;  1GHK A;  1VCI A;  1TY0 A;  4IN3 A;  2NB0 A;  3D4W A;  1KLU D;  3IL8 A;  1O7L A;  1V43 A;  1DOM A;  2IX0 A;  3CKI B;  4C1N I;  3MVV A;  1PLF A;  2EJF C;  4RA8 A;  3VR2 A;  1SNP A;  3BDC A;  3GP7 A;  1R4P B;  1PYW D;  1G6Z A;  2Y0S B;  3M7N A;  2K5Q A;  1UUP A;  2A74 C;  2B2W A;  2B39 A;  1D1I A;  5TSS A;  5CV4 A;  3X3M A;  2A6H D;  5CR3 A;  3VR4 A;  1X32 A;  1EFI D;  2KVM A;  3TP6 A;  2B2U C;  1SNO A;  1EWC A;  2DN8 A;  2IW3 A;  3KK7 A;  1CHQ D;  4M8A A;  1NAP A;  2YU9 B;  1LTI D;  5CC4 A;  5IOC A;  4RGO S;  3DHQ A;  1ZEQ X;  1EY8 A;  4PV1 C;  2EYP A;  3HG9 A;  1U4L A;  4YIJ A;  2B2Y C;  2NN6 I;  2IL8 A;  5CV7 A;  1WTR A;  3A8K E;  5ELD A;  3SVM A;  3QOL A;  3I73 A;  3QB3 A;  2JA6 B;  1RJT A;  1F2M A;  4ZUI A;  1FD7 D;  1BCP F;  5EJW A;  1DJR D;  1Q8I A;  1SFO B;  3PMF A;  2AQ2 B;  2XSC A;  2CW0 C;  2EPB A;  2JA7 B;  3PV0 A;  1JR0 D;  5E4W C;  2IWH A;  2L55 A;  2PO4 A;  4R8I A;  4DN4 M;  3T13 A;  1VF7 A;  3I72 A;  3J81 L;  1SYG A;  3QWN A;  2R6G A;  1Z47 A;  4LJZ C;  1RHP A;  1OXV A;  5DNF A;  4IFD G;  1L0X B;  5I6W A;  2HQE A;  1WD0 A;  3U9O A;  3R3O A;  1LT3 D;  1GUG A;  1KAA A;  1UAP A;  1KNE A;  3PIP 3;  1ESF A;  2FHT A;  2F0E A;  2IJ0 A;  3GTP B;  4FO2 A;  1KTK A;  2OXP A;  1EY6 A;  4EVO A;  3FMC A;  2SNM A;  4OIJ A;  3HRZ C;  1O7Z A;  3NK9 A;  3AB9 A;  1EQT A;  3GQB A;  1RKN A;  1SYC A;  2EVB A;  1Y69 U;  1V8Q A;  4FF3 A;  5M9O A;  5C4X B;  3QG1 A;  2NUC A;  2WAC A;  3DEO A;  2EYL A;  3T51 B;  5C0X I;  4QUC A;  1S5D D;  1BDO A;  3Q23 A;  4H44 C;  4BWG B;  4M1U B;  1X3Q A;  4HTH A;  5CGK A;  3Q6S A;  5F2D A;  2E2H B;  1M8A A;  1L0Y B;  2LFN A;  5FO7 B;  4ZLT F;  1B44 D;  1UNS A;  3S1Q B;  3HZX A;  3KLR A;  1ICW A;  3A54 A;  4EQO A;  4ODG A;  2J4X A;  4LAA A;  4OIK A;  4BY7 B;  1H9M A;  3H91 A;  3NWS A;  4OO1 H;  2JEB I;  1F2Z A;  3FVQ A;  1CQV A;  3OW7 A;  4C3H G;  1W6J A;  3SK6 A;  4KK7 A;  4EQP A;  3ERO A;  1RDP D;  2Q8R E;  4MHE A;  3TDQ A;  4IUQ A;  3S2D B;  1MI2 A;  1T5E A;  1LAC A;  3C46 A;  1A6X A;  4Y7N B;  2F0F A;  3P1H A;  1EU3 A;  3K0Y A;  5BN5 A;  4BA1 I;  4A3K B;  3M3Y B;  2SNS A;  3N6R A;  4KN4 C;  2Z1C A;  4QCL A;  1RD9 D;  3VA5 A;  2B8F A;  4FXK C;  3R2T A;  1Q1E A;  4KY6 A;  2B2V A;  5EPL A;  1EIH A;  2L9H A;  5DM6 3;  3MFY A;  3C2P A;  3K6O A;  1KLG D;  5M5W B;  4B08 A;  2E76 C;  1EY9 A;  2HDL A;  1A3V A;  2RA4 A;  2EY1 A;  2LS0 1;  1WTW A;  2TMP A;  1PRT B;  3FPU B;  2K04 A;  2GA4 B;  2N88 A;  1V1O A;  1TWC B;  4RFB A;  4NMZ A;  1U4P A;  5D3D A;  2K28 A;  1CTM A;  5JEA J;  3ND9 A;  1G8Z D;  5EKI A;  2K1B A;  1GUT A;  3VR5 A;  1ZYR C;  3IKJ A;  2R7Z B;  4U67 3;  4IUT A;  1SYD A;  1TU2 B;  2CVR A;  3N52 A;  1GOZ A;  5KEE A;  4ME5 A;  1SBB B;  2KUM A;  5COR A;  1QNK A;  2WB1 B;  1ML0 D;  4RHR A;  2AQ1 B;  1QCB D;  2ICE C;  1EEF D;  4IFD J;  3I4N B;  4TSS A;  4WJW A;  1VMP A;  3TME A;  1WCM B;  1FNV A;  1RTO A;  1B50 A;  1SEB D;  3ONA B;  5CV9 A;  1TQO A;  2EE1 A;  1TVX A;  2AQ3 B;  5KRU A;  4Q5V A;  1LT5 D;  2EYM A;  3AMU A;  2MP1 A;  1E2V A;  1ET6 A;  2E2J B;  1ENF A;  2F0D A;  1XX8 A;  2JA8 B;  2F0I A;  1QOH A;  2PMZ B;  2VB2 X;  3QJY A;  2JP1 A;  1SYE A;  3A7L A;  2F0P A;  4IUV A;  3GTK B;  4HSP A;  3D4R A;  1G2T A;  1ROD A;  5IGB A;  1BNZ A;  5LHY 1;  2QCP X;  2A68 D;  3NQT A;  2KCN A;  3I4L A;  2I07 B;  3C1E A;  1S4Z A;  3K5O A;  3NXW A;  3M7G A;  5FLX E;  1HUN A;  3MC0 B;  3A8I E;  2QDB A;  2A68 C;  4FXG C;  1WTP A;  5D3I B;  1HXY D;  1YNN D;  1HA6 A;  4O1N A;  2XN9 C;  2PYK A;  2AWO A;  1BCP D;  2SDF A;  4PMC A;  1ENA A;  5JJZ A;  3Q0A A;  1YNN C;  1LLR D;  5JEA H;  3K5M A;  1IYU A;  4BBS B;  1JOK A;  4IUR A;  3SXH A;  1QE6 A;  1BCP C;  5FO8 B;  4IAL A;  5I6Y A;  1JOO A;  4HN7 A;  1NCV A;  1F2L A;  2O2L D;  2DNC A;  4CJ1 B;  1R9T B;  2BOS A;  3A8J E;  2D62 A;  4K14 A;  3GV6 A;  3LWU A;  1XYI A;  2V4D A;  4K8J A;  1I4G A;  2BDO A;  5E4X A;  4CJ0 B;  2PZU A;  3CQZ B;  3MAQ A;  2M2L A;  4DAY A;  1TS3 A;  3BVZ A;  5EKK A;  2QF7 A;  5C5M A;  1G29 1;  2R61 A;  2H4O A;  3PO3 B;  1EYC A;  1KNA A;  3VYU A;  1Q1B A;  3G6J B;  2D9U A;  2IT1 A;  1Q3L A;  1GUO A;  2PPB C;  3WDN A;  1KDB A;  5CBE E;  5KYL A;  4CHT B;  3LX0 A;  1QWY A;  2WIN B;  2K03 A;  2B8G A;  2AUJ D;  2MHV A;  2ENB A;  4WFN 3;  2RDG A;  3CU7 A;  3I91 A;  1TY2 A;  1BBX C;  4X3K A;  2MUY A;  1WD1 A;  4G57 A;  4RHS A;  3HEJ A;  3MWY W;  1TWA B;  4PNY A;  1M4V A;  2VNU D;  3MXP A;  5I9P A;  5JOB A;  5FLX L;  4DA2 A;  2EXZ A;  3NE5 B;  1LTS D;  3GTL B;  4OO1 I;  3BVG A;  2BDN A;  5EBD A;  4XQN A;  4JK1 C;  1DCZ A;  1LAB A;  4F7X A;  4U68 A;  1QJO A;  3IAY A;  4HR7 B;  4ZQ3 A;  3FKI B;  1AN8 A;  1C48 A;  1PFN A;  5E1F A;  4FF4 A;  3U9S A;  1PTO H;  3F2U A;  4KHV A;  1F9S A;  2QIL A;  5IGC A;  1OO9 B;  2K05 A;  3Q24 A;  5HUR A;  4RGT A;  3VR3 A;  1A2T A;  4XT1 B;  4C3J G;  3QO2 A;  2AWN A;  3D6W A;  1OXU A;  1WTV A;  1STN A;  1U4R A;  5ELF A;  2CQA A;  2Q8I B;  1HUM A;  5D14 A;  3J7A F;  2EYO A;  1QG7 A;  2G9D A;  1I6V C;  1X3P A;  3LNN A;  3J7A V;  3K5N A;  2RVL A;  5C0X G;  3C1F A;  4L6T B;  2EZV A;  1MBY A;  3M4O B;  2KJX A;  4KMU C;  4XT3 B;  2EJG C;  3HS0 C;  4F87 A;  1JE4 A;  3SK4 A;  3WOF A;  2CW0 D;  2FMC A;  3D8G A;  1ILP A;  3DEP A;  1EL0 A;  1ZXT A;  3TZU A;  1OXX K;  1PTO C;  3GTQ B;  2BE5 C;  2EY6 A;  2F0N A;  3RD4 A;  1II3 A;  1JWM D;  1DXM A;  1OXS C;  4A3B B;  4BS9 A;  3SE0 A;  1I4R A;  5ELE A;  1TWH B;  3PUZ A;  1MGS A;  3BYT B;  4BY1 B;  1ONL A;  1S5B D;  2C9O A;  1LTG D;  1PZI D;  5FO9 B;  3J7Y W;  1HHV A;  1STG A;  2C5C A;  5M3F B;  5JVH 3;  3SK8 A;  5A35 A;  3KLS A;  2FFK B;  1NUC A;  2B2U A;  1CT1 D;  2F4I A;  3RMH A;  2E75 C;  1IW7 D;  1A3T A;  5JPN C;  4E6I A;  1G2S A;  4N9P A;  2O4X A;  1BOS A;  4MN3 A;  4J6H A;  4V19 0;  3HGB A;  3GTM B;  3PO2 B;  4V0B A;  2Z4H A;  5LL6 S;  2MJ8 A;  3MXN A;  1IW7 C;  1I50 B;  5C44 B;  1I6H B;  4I7Z C;  5C3X A;  4XDX A;  4NP5 A;  1FR3 A;  5K36 G;  3S9W A;  1S5E D;  2WII B;  4ULL A;  4ID6 A;  4QF4 A;  3HOW B;  2AUK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...