1IYVA

Lipoyl domain of pyruvate dehydrogenase complex, nmr, 29 structures
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
79
structure length
79
Chain Sequence
SEIIRVPDIGGDGEVIELLVKTGDLIEVEQGLVVLESAKASMEVPSPKAGVVKSVSVKLGDKLKEGDAIIELEPAAGAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Acyltransferase
molecule keywords DIHYDROLIPOAMIDE ACETYLTRANSFERASE COMPONENT OF PYRUVATE DEH
publication title Three-dimensional structure in solution of the N-terminal lipoyl domain of the pyruvate dehydrogenase complex from Azotobacter vinelandii.
pubmed doi rcsb
total genus 6
structure length 79
sequence length 79
ec nomenclature ec 2.3.1.12: Dihydrolipoyllysine-residue acetyltransferase.
pdb deposition date 1996-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00364 Biotin_lipoyl Biotin-requiring enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1iyvA00
5K36G 3SE0A 1O78A 1PMRA 3CRLC 2K33A 1HCZA 3D4RA 3FPPA 2DN8A 5A35A 1Y8OB 1O7LA 3QG1A 3LNNA 5K36H 2E74C 1DD2A 2A6HD 4H44C 2F1MA 1VCIA 2A6EC 2EJFC 2A6ED 3I73A 1Q90A 1GJXA 3W3AA 3A7LA 1V43A 3L7ZC 2EDGA 1H9KA 5KNCA 2EVBA 4LK1C 3NE5B 2A68C 4KN4C 2A68D 5JEAG 5KNBA 4H0LC 4G7ZC 1VF5C 1TKWB 2E75C 2KCCA 4KI0A 1B9NA 2D2CC 1GUOA 4DNRB 1LACA 1H9JA 1OXXK 2O5JC 3M4YA 1HTPA 1BDOA 4LJZC 3P20A 2L5TA 1IYVA 3VA7A 1VF7A 2R6GA 2O5IC 1DCZA 3OOCA 1T5EA 1Y8PB 5C0XH 3PUVA 3QIAA 1H9RA 5BN3A 2NN6H 4DK1A 4TQUS 4JBWA 3OW7A 2BDOA 4KMUC 2JE6I 3BDOA 1GUNA 2D62A 1VDZA 1DXMA 2B8FA 1H9SB 2NN6I 2JEAI 1Z6HA 1GUSA 3M7NA 3VR6A 1OXTA 1OXUA 2A6HC 1I6VC 4JK1C 1YNNC 4KKSA 2K32A 2D5DA 3VR3A 1Q12A 4GZYC 1G291 3A8IE 2PNRC 4RCNA 3DXJC 2BE5C 1V8QA 1ZKOA 2BE5D 3GD7A 3FMCA 5BN4A 2LMCB 1K8OA 1Z7TA 3RLFA 1H9SA 3BG3A 1B9MA 2A69C 3LWUA 2A69D 3N6RA 4I7ZC 3M85A 4PV1C 4BA1I 4IFDG 1E2ZA 1ZYRC 1GHJA 4XIGS 2AUJD 3PUYA 1Q1BA 5JEAH 1IW7C 3PUZA 4DK0A 1IW7D 2DNCA 2JEBI 3HGBA 4IQZA 1CTMA 5KNDA 4BA2I 2EJGC 3IKJA 2EJMA 3AB9A 3D31A 1GUTA 3GQBA 3I72A 2E76C 1E2VA 1TU2B 3H94A 3CRKC 1E2WA 1CFMA 1FYCA 3U9SA 2B8GA 4G7OC 2QF7A 1Q1EA 2PCFB 3A7AB 4KN7C 2AWOA 3VR2A 1LABA 1ONLA 5BN5A 3PUXA 3ND8A 2Q8IB 3VR4A 1FR3A 2BA0A 1Y8NB 1Y69U 3IFTA 1EWHA 4H13C 2YYZA 3A8JE 4KKTA 1HPCA 3EQLC 4L8JA 3T51B 3VR5A 2V4DA 2IT1A 2JXMB 4OO1H 3I4LA 3A8KE 3MXUA 1SMYC 4TKOB 4OO1G 1OXSC 3T53B 4DNTB 3PV0A 4XTCS 3ND9A 1QJOA 2AUKA 3OPOA 3T56B 3MFYA 4IFDH 3TZUA 3SDZA 1K8MA 1OXVA 2DNEA 2BA1A 2CW0C 1HQMC 1GUGA 1IYUA 2PPBC 1YNJC 3PUWA 4OGQC 1GHKA 3QJYA 5C0XG 2KA7A 1CI3M 4KHZA 2ZT9C 2NN6G 4KKUA 4G7HC 3KLRA 2K7VA 1A6XA 4HR7B 1H9MA 3WDNA
chains in the Genus database with same CATH superfamily
2CQAA 1X55A 1YNXA 1HUNA 4OL7A 3NP8A 3I4NH 2QEJC 3FPPA 1AP0A 2ZM6L 4LFCQ 3QG1A 4F7XA 4ZLTF 4ID6A 1TR5A 3GTOH 2AHOB 1X65A 1RIPA 4C56C 3RLOA 1SROA 3DEPA 1PFBA 4ZYSA 2UXCL 3CF5A 3KK7A 2E75C 4KI0A 3AFQA 2JA6G 4A3MG 4QIWE 3I70A 3QB3A 1B2TA 3HKZG 3RD4A 1DCZA 4K14A 4TVAB 1IBML 1LUZA 4V0BA 1H9RA 2QW7A 5G3LF 4AYBE 1CKMA 2VQEL 2ATWA 4RMFA 5CBAE 2ZTCA 2DJGC 1GUNA 4RHRA 1QVCA 2R61A 1B44D 1XTDA 2MHVA 4QGUA 4BY7H 1SYBA 4N9PA 3UE0A 4IJHA 5GAEC 1OXTA 5J3BA 1SNCA 4EVOA 1HR0L 4ALPA 2KOLA 1I5FA 4C3JH 3PO3G 3R3OA 1XNRL 3FVQA 1BF4A 3D4DA 1HJPA 5C4XG 2F0VA 4C3IG 3LWUA 4N8FA 4KY7A 1SFOB 4FF4A 2X6LA 1SDFA 1Y1WB 3A0JA 4FP5D 4AQYL 2AQ3B 1HH2P 3LX0A 5EPJA 3PF4A 4V190 1I6HB 2DNCA 2N78A 3O13A 4RAUC 4UPAA 1Q81C 2WB1B 4B08A 3M3YH 3DM1A 2ZJPA 4P75A 1IBKL 4JYAL 2Z8LA 5CV5A 5C44H 3BDCA 4HIDA 1X3GA 4DV0Q 2KENA 2UXDQ 2CCZA 1EZ8A 3T1YL 1KLGD 1KDBA 4XT1B 1HZAA 1KHIA 3I56A 3ZYYX 4A93G 3VYRA 1OTCA 2ZM6Q 1FNUA 4R4OA 4MTNA 3S15B 4DV4L 1FL0A 4LUZA 1E3PA 2UXCQ 2R93B 2C35B 4OGQC 4ZK9B 2NN6G 1EY5A 1ESFA 3VDYA 4BBRH 2GN5A 4HEDA 1IBMQ 4TRDA 4WJWA 4LF5Q 2VQEQ 1IYJB 1PMRA 3I2ZA 4IUNA 4XXEA 1WYDA 1EIYB 1HR0Q 1SEBD 4L5TA 2RDGA 1DD2A 1A15A 3JAMc 1EZ6A 1KTKA 2PNHA 4HJAA 4YWKA 1WCMH 2M00A 1SYEA 5ISRA 3F2UA 1VQEA 3GTMH 2G5DA 5KNBA 4J15A 3PCOB 1TKWB 2KHJA 1QNKA 4AQYQ 2WFWA 2WIIB 1XMOL 1D1IA 4YCWA 1ET9A 1STAA 3OTOL 4DV3L 3CMEA 1BCPC 1BCPD 4JBWA 3SGIA 3TN2A 1S5CD 3T16A 1IBKQ 4JYAQ 4C2MH 3HKSA 5DM63 4JV5L 4DNIA 1BCPB 1BBXC 2PZWA 3T1YQ 5JVH3 3DXJC 3T13A 4DR2L 2XRSD 4KD4A 1H9SA 3BG3A 5C3EB 4U68A 1MD2D 1BKBA 1PRTF 1TVXA 2PW7A 1CQFA 4HTHA 3MAQA 2E2HH 3PUYA 1SYCA 2JA6H 4A3MH 4NXNL 4DV4Q 3IKJA 3E0EA 4KJNA 1WJJA 3ICEA 5KYIA 2F0GA 2Z6BA 3HOXB 4A3FB 1CSQA 4X3UA 4R8NA 1JQYD 1CK1A 4DUYL 3JAMi 3VR2A 3GTJH 1SE2A 2R92B 1ILQA 4EQNA 1Q82C 2IHFA 3CCSA 4FXDA 2XWBB 4JI0L 3PO3H 1SE8A 3J7YW 1CT1D 4CJ0B 1UEAB 3MEHA 4DNTB 3RLNA 4C3IH 5C4XH 4OX9L 5EBCA 1FNWA 3KLSA 1V1QA 3Q22A 2BA1A 3CU7A 1IBLL 1HNWL 2KCMA 3GTQB 2ZT9C 4G7HC 4IPHA 2B2UC 5IE8A 4O42A 3V05A 5M5YB 1HFNA 3NWSA 5C0XJ 1PTOC 2ES2A 1PTOD 2L4NA 1S3OA 2LXJA 3A5UA 5IP7G 4B3ML 2Y0SB 4JV5Q 2QKIC 3AQQA 1QB5D 3BJUA 1VCIA 1YHAA 1PTOB 4DR2Q 3K5NA 2ALYB 2EDGA 2EVBA 1B1ZA 2A68C 1O7YA 2A68D 4WFN3 1WVLA 2HDMA 3I91A 1NR4A 2R3ZA 2AWNA 3KF6A 1VQ6A 1JICA 1HTPA 2EXDA 3FKIG 1N33L 3U4ZA 1LYLA 2ICEC 1KNAA 2NN6H 4DAMA 4NXNQ 4IALA 1VDZA 5LMNW 1TS4A 4DV2L 4BS9A 1YNNC 2KVMA 3A5ZB 1YNND 4X66L 4XQNA 3SXHA 1VQ7A 4DUYQ 3H09A 1Q7YC 1Y1VB 1SR3A 2HCIA 1W2BA 1V1PB 3NBHA 2B29A 1DOLA 3I90A 2QGQA 3GTKH 4QIWB 4JI0Q 4GNXC 4JI4Q 3RMHA 4CBVA 2BH2A 2WACA 1GHJA 4XIGS 4CKEA 2ID0A 3EJIA 1MSGA 4A3EB 4A3JG 1FJGL 2JK8A 1EY9A 1D5ZC 4GNXB 4OX9Q 4IQZA 1CTMA 3MXGA 5LHY1 3S16B 1NTGA 5EQ0A 1S40A 2EOTA 5ELCA 5GAHC 3RNUA 4DV1L 1CQVA 2RDFA 3S2HB 1GVPA 1IBLQ 1TWGB 2BCOA 1EEID 3OWEB 2QF7A 3PIOA 3UDXA 5IGDA 3HOYG 2K5DA 2WAQG 3HOZB 2IY5B 1ENCA 1LM0A 4R4QA 1PVOA 5I4DA 1SMYC 2I5LX 4B3MQ 3KDFA 4QL5A 2EPBA 4C3HG 4ZQ3A 1C4QA 3UE1A 3MXNB 2AUKA 1VQ5A 2B3GA 4JVZA 5IYDG 1YHQA 2CW0C 1QZGA 5DNFA 2CW0D 2CWPA 4A3IG 1K83H 2K4KA 1SNQA 5M3MB 2OXPA 2F0UA 3MVVA 5ELBA 4ZCKA 2F0PA 2N49A 4B3RL 1TWFH 1SRUA 1VQGA 2K33A 4DV2Q 1KRSA 5M5WH 2NVXB 4M8AA 3CCEA 2Z4IA 2JJQA 4F8MA 2EYLA 4X66Q 4JOIA 5IWAL 3J80L 3W3AA 1V43A 2KJXA 3K0YA 1YJWA 3K80C 4TSSA 4KN4C 2H5XA 3CQZH 1U4LA 1D5MC 2WKDA 2SDFA 4DNRB 1EYCA 5AFWA 4Q5VA 1WTQA 2O5JC 2NWGA 5EBDA 2QEXA 4L6TB 2OQKA 4OELB 5E3FA 5IGBA 1FJGQ 1Y8PB 4JW0A 1TS3A 3V96A 4DK1A 5C0XI 5HURA 1D7QA 3K0XA 4ME5A 4DV1Q 2VQFL 4ZKCB 3HZXA 1EEFD 3PO2H 4KHVA 1UUPA 2NVQB 3R8BA 4DXFA 1K8OA 2LMCB 3D8GA 3M4PA 5IP7H 1J6QA 1EY0A 1EQQA 1FD7D 4ODGA 3UDFA 4YY3L 2ZJRA 2YU9H 4K2KA 4GLXA 5FO9B 5C3XA 4DK0A 2VXWA 2JP1A 3DWPA 1EYAA 1C9OA 1BBUA 3OSOA 4S3SA 1QCBD 5TSSA 1QWYA 4KTAA 4FVMA 3FKIH 1YI2A 3H94A 3TP7A 1EQTA 3B6YA 2F0FA 3S14B 1RJTA 2L11A 2JYOA 4CKCA 4B3RQ 3J7AV 3PGZA 1EIGA 2V4DA 3NPPA 1N34L 4A3GB 1YEZA 1G6ZA 4NMZA 1U4RA 2NZ1D 2F0IA 5ELDA 5IWAQ 4LUOA 1C7YA 3J7AF 2YV5A 4KV6A 3UDGA 2DNEA 4A3JH 1TWHH 1I50B 4KKUA 1JOOA 4KK7A 5IGGA 1EU4A 3EBEA 5CC4A 1YJ9A 1PH5A 1MKHA 2BH8A 4KLKA 3F8TA 1QVFA 4L63B 5BR8L 2EYHA 1VQCA 4LF4Q 3X3NA 1BQQT 3D4RA 2VQFQ 2IPKD 3RR5A 1LTRD 4JBKA 3VA5A 1U5KA 1SN8A 4OHJA 2KBNA 2F1MA 3CPFA 4JG2A 2K04A 4K8JA 4G7ZC 4C3HH 3HOUG 2Q8RE 1UNSA 1JCKB 1X32A 2E5LL 1E24A 1GUOA 1YHBA 4CJ1B 2I5HA 1EYGA 4YY3Q 2ZTEA 2DJFC 3STBC 2UUCQ 4OWTB 3STBD 2FJ2A 1IYVA 4DGZA 1TS2A 4A3IH 4DR1Q 2ICIA 4GLVB 1VQNA 4TQUS 2OEOA 5COYA 5CV7A 4A3KG 1D2BA 4NPSA 3S1MB 1DXMA 2ASBA 3KJPA 3I4MB 3OW2A 2JA8G 3GDEA 4OEMB 1KRTA 2IW3A 4RCNA 4OO1G 2RHQB 3GD7A 3M4OB 2M2LA 5BN4A 3LGJA 4RHSA 1B9MA 1VQJA 3K5MA 4ULLA 2QCPX 4I7ZC 2PI2A 5IIFA 1N34Q 1VMPA 2NZHA 3G7LA 1DGSA 1Q1BA 5FJ8G 1MJCA 2SNMA 1EWIA 3PUZA 5ELEA 4A3BG 4Y7NB 3S1RH 1L0WA 1FGUA 4X65L 4UP7A 1WTOA 3QR8A 4JI7L 2F52A 3OHXC 3J81E 2MO0A 2JA7B 4HSVA 2VUMG 3NTHA 5GAGC 1F9SA 1RODA 2KUMA 3K7AH 5BR8Q 3BDLA 1I3QB 1PZJD 2Z6KC 3EQLC 3J80c 5CR3A 1ASYA 2IT1A 2G9HD 4U673 3DMUA 1ILPA 2E2JH 4ZUJA 4N8X1 3SK4A 4IUPA 3MFYA 3CC7A 4DV7L 3EVQA 1LT3D 1RTOA 2AKWB 3G48A 1SE3A 5C0XG 4MNOA 2B39A 5JPMC 2E5LQ 1EU3A 1A2UA 2IHEA 1UE7A 3WDNA 3ULPA 4FF1A 1DONA 1SE4A 1XWEA 1Q3LA 2XRQD 2BOSA 2KCTA 2IX0A 1EFID 3BS1A 3G4SA 2YTVA 1JORA 5JJZA 5KIXA 1TWCB 3I55A 1PYWD 2VY3A 3SVMA 3PIPA 4RFBA 1A8VA 4GS3A 3CXCA 2PMZE 1B9NA 3AEVA 5FLMG 1LACA 4DXGA 4DV0L 1S4ZA 3M4YA 1PH3A 1M1KC 4LJZC 4GN3B 3CCQA 4LF7L 2RBMA 1EWCA 3EIVA 4X65Q 1Y1WG 2Q8TA 4JI7Q 5EAYA 3GO5A 1Z6HA 1OXUA 3TSSA 1Q12A 2MPMA 2B63B 5FKAC 2WB1G 1V8QA 2OCEA 1V9PA 3FMCA 2WKCA 4I65A 1LLRD 3D3RA 1PA6A 1F9QA 1I94L 2OT2A 4DR3L 2LS01 2L1BA 1F2YA 2XNAC 3U58A 3TP5A 4LF5L 1JJCB 3HOUH 3MZ5A 2F0QA 1A3UA 2JEBI 2RA4A 3PSIA 4O2DA 2Q2IA 4RG1A 4DV7Q 3AB9A 2BDNA 3MEFA 2CKZB 1WTVA 2I5MX 1B3QA 1I4GA 3U9SA 5FLXE 1E1TA 1Q1EA 4LF9L 1X3PA 4A3KH 1X54A 2AWOA 4AH6A 2AQ2B 4XYQA 4DKAC 3F2CA 3S17B 2C5CA 2R93G 3GTLB 2OTJA 4LUVA 3KBGA 2FXQA 2JA8H 1PH8A 4WORA 3TREA 4PMWA 4OO1H 2B2VC 2PYKA 4R4TA 2Q2TA 1GD7A 3ND9A 4DN4M 3OPOA 3T56B 3RZDB 1F9PA 3RZOB 2V1CC 1VQ8A 1GUGA 1VQKA 5FJ8H 3KYHC 4A3BH 1D8LA 2KA7A 5FO7B 2K7VA 2UXBL 1WTPA 5JJLA 4EQPA 2K50A 4IUQA 4LF7Q 5A2QE 1BCPF 2A5HA 4JI5L 2VUMH 2DN8A 1HNZL 2HIXA 2A6HD 3S1NH 3P7JA 5H1SE 1PYBA 1I4HA 3S2DH 2FINB 1JJGA 4POFA 1H9KA 3G6JB 5CV8A 2B2YC 1I94Q 4A3DB 3CP0A 4XQJA 4DR3Q 2KCCA 2HD3A 4K8IA 2PQEA 1VQMA 1MGSA 1RD9D 3BZKA 1JR0D 1SYFA 4OIJA 1O80A 3VA7A 2B2TA 1T5EA 4DAYB 5C3EG 5C0XH 1C48A 3VYUA 1KQSA 3HRZC 5G3LD 5IT9E 1WD0A 1K0SA 4FNFA 5EGTA 1GUSA 4HMIA 1L1OC 4EX5A 4KJOA 2KHSA 4LF9Q 1ZKOA 4RGOS 3R2IA 3HOXG 4A3FG 1L1OB 5IGFA 3N6RA 2LKVA 1K8AC 1VS0A 4X3SA 2R92G 4DV6L 3HEJA 5HGTA 1TWAB 3H3VI 1IW7C 1SMXA 1UE1A 1IW7D 2Z0SA 3IRBA 5CV9A 1AZQA 2F4VQ 3MFGA 2NVTB 5FLMH 2GA4B 3J7ZC 1JWSD 1KDAA 4X62L 1E2VA 5C6AA 1EUJA 1CFMA 1TS5A 1SFOH 1KD1C 1NUCA 5EKIA 1Y1WH 4YWLA 5NUCA 4GNXA 2UXBQ 4A93B 1UE5A 1PZID 3R2TA 4LFBL 2EYPA 5CMDA 3DM3A 5EPKA 1I6HH 3J81c 2B2WC 3TS0A 1HPCA 4JI5Q 1HRJA 1PTOF 1UAPA 1HNZQ 1JT8A 5C4ZA 3MA2B 4GLAC 1MBYA 5J1ZA 1TT2A 1QVGA 4KY6A 3P75A 3HOWB 1HZ9A 3H6MA 4JI8Q 4X3KA 5DLQE 1F2LA 2Y0SG 5KRUA 1QNUA 1FNVA 1B3AA 3CAMA 2UU9L 1WI5A 3MXNA 2QDLA 2HT1A 2KEEA 1CUKA 2RCFA 4YHHL 4JI4L 4DUZL 3Q8DA 3S15H 2HHHL 4DR6L 1HZBA 1NMFA 5A35A 4O0AA 3H91A 2R93H 2LY7A 5K36H 1STYA 2EJFC 3DLLA 1LTLA 1G91A 2K5QA 1SYDA 1SNPA 2Z4HA 1O7ZA 2ZTDA 1VF5C 1R4QB 2PZUA 1NJIC 4DV6Q 1OXXK 1Y1VG 1ZXTA 4YIJA 1Z9FA 2L5TA 1E7ZA 3U9OA 1YZ6A 3ULLA 3PO2G 1CZWA 5M3FB 2EZVA 1PFNA 3LWEA 3SK8A 4X62Q 4AYBG 2K05A 3M7NA 1X56A 4A3EG 1W3SA 4LFAL 1PLFA 4DPGA 4EGVA 2K52A 4C1NI 5IOCA 4LFBQ 4K5XA 2PMZB 2XSCA 3DWQA 1EOVA 4CDCC 2PO4A 4Z9CB 3M85A 1N8RC 2XVSA 2R7DA 1XPOA 3CC4A 2A19A 3KUPA 3TRZA 3HOZG 3CHBD 4BY1B 1VQPA 1SYGA 2MUYA 3A56A 4LMQD 4DA2A 1E2WA 3RUZA 1FYCA 5C3EH 1HA6A 1ICWA 2KEDA 2UU9Q 3H0GB 3BU2A 5LMNL 4HCSA 2L0CA 3VR4A 1X3EA 1PZKD 2H1EA 4GN4B 4YHHQ 1JOKA 1STGA 2XTIA 1UEBA 4DUZQ 2HHHQ 4DR6Q 2P5ZX 3GV6A 5M3MG 2FHTA 1G51A 5CYUA 3HOXH 4A3FH 2WP8J 1DJRD 1NBWA 1F2ZA 3M4QA 3W2DA 5EJWA 2R92H 3GTGB 2RSNA 1CA6A 1ICFB 5CORA 5HY6A 3PUWA 1VQAA 4R9WA 1CI3M 3SK5A 2RCNA 3VYTA 2MO1A 2IL8A 4DR7L 4HJ9A 1A6XA 2VS1A 1I4PA 2J7ZA 2KCNA 4IUVA 3QWNA 1SJHD 2EXZA 2ZXOA 2KHIA 3TZDA 1TIID 1SNMA 3D6WA 4LFAQ 3GTPB 1D6EC 1ET6A 4OO1I 2E2IB 4QB4A 3GTQH 1VQDA 1C8CA 4NKLA 1GJXA 3P1HA 3L3OC 2KQ3A 1K8GA 3NE5B 3PIO3 2K5NA 2NB0A 2XIWA 1AEXA 5I2YA 3UDIA 4E6IA 5C5LA 4WRDA 4P74A 1EY4A 2E2DC 2K5VA 1C0AA 1GXDC 3BDOA 4N9TA 4HIMA 1VQLA 1KDCA 2IJ0A 5ELFA 3L2PA 4KKSA 1JJ2A 5LMNQ 1GKHA 3K58A 4WJ4A 1JMCA 1NNXA 2C9OA 2SOBA 2NVYB 2HDLA 3E9IA 1LTID 3HG9A 1Z7TA 4J6HA 4QF4A 4K2LA 4K5VA 1AE3A 1WTXA 4BA1I 2A73B 1EQRA 4RGNA 2IWHA 1IL2A 3FRPB 3BVGA 3CW2C 1DOMA 4PZ7A 3W1GA 4JBMA 2R7ZB 4A3GG 4LF4L 1Y1VH 2PQAA 2NBFA 3HOYB 2F3IA 4L5RC 2RF4A 1IXRA 2B8GA 1U4PA 4DR7Q 1VQ4A 4G7OC 1DOKA 3A7AB 3T4AC 5M5XB 1QUQB 2EY1A 2MGSA 3T1HQ 4A3EH 4DR4L 5I6YA 3IFTA 4LAAA 4KKTA 3S16H 3A8KE 4TKOB 4DAVA 2UUCL 2K01A 3S2HH 1TWGH 3PV0A 4DV5L 4DR1L 4NXML 1QZHA 3KJOA 1W6KA 3KF6B 2EY6A 1TY0A 3NXWA 1MJEA 1IKMA 1GHKA 3ERQA 1F2MA 3HOZH 1NY4A 2VZAA 4IPCA 4B9WA 3BYYB 3MHBA 3Q24A 1TQOA 2RHSB 2Z6KA 1AZPA 1H9MA 4ZAIA 2ZXPA 4MTKA 5E7NA 4ABNA 4LF6L 1EIHA 4OXPA 4LNQA 3F2BA 3S1RB 3TMEA 3S1QH 2NTTA 5M3MH 1PH6A 5KYLA 2UUAL 1CZGA 1AH9A 2CWAA 4RH6A 5IYBG 2CH4A 3K7UC 3ERSX 3KOJA 3I4MG 3HKZE 1E22A 2DY7A 4QUFA 4R1JA 1L0XB 5D3DA 2LXKA 2NVXH 1XMQQ 4IUUA 1S72A 1B50A 1RL2A 1CKNB 1XPRA 2PW5A 4Q0FA 2BDOA 2I0QA 2R7FA 1WOCA 1AW7A 2F3VA 1H95A 2HCCA 1U4MA 2D5DA 4IURA 3U4VA 3VR3A 2JA5B 2PNRC 4X6AH 4ZRZA 1R9TH 3KDFB 1Y14B 4DR4Q 3HOVB 3PF5A 4IUTA 3BYTB 1STEA 2D0OA 3C46A 2JA7G 4IFDG 5CV4A 3H3VH 3NQTA 2F0WA 5GROA 4DV5Q 1PFMA 4NXMQ 1HUMA 2NVQH 1O7IA 2K5HA 5C4JB 3G71A 3RN2A 2EJMA 5FK9C 1Q8KA 4CDDC 4JOIC 4P72A 4PQXA 2L12A 1PH2A 1X6OA 3D0FA 4UP9A 1YVCA 1GOZA 2F0KA 1LABA 2J4XA 1DYQA 4YWMA 2Q8IB 1PYSB 4BBSB 3NBIA 4NW2A 1EWHA 4CJ2C 4DR5Q 1A3VA 3JAME 4LF6Q 5D14A 3T53B 1YIJA 1KIXA 4QY7A 3S9WA 5JVG3 4PZ6A 1RHPA 2UUAQ 3I4NB 3S14H 1K73C 2CHBD 1I4QA 1M8AA 3GTOB 1TY2A 2EYMA 4A3GH 1T5XD 2OTLA 1N32Q 2B2VA 4DU9A 1CKOA 5E1FA 1O78A 3F2DA 1AE2A 3K5OA 3URYA 1HCZA 2F03A 1KAWA 4B9XA 4H44C 3C1FA 4RA8A 4DFAA 1Q90A 3NQIA 1K28A 2HQLA 4BY7B 1JB3A 3E9HA 3L7ZC 3MXPA 1PHJA 4UDUC 4HJ5A 3M9BA 2LSSA 4H0LC 3CC2A 4C3JB 1BVSA 1R4PB 4IPDA 3AU7A 1BDOA 3P20A 2L55A 2XWJB 1RKNA 2R6GA 2O5IC 2X6GA 3CD6A 4DK6C 2D62A 2B8FA 1LO5D 1U9RA 2WV6D 4EQOA 1A0IA 4JK1C 4EQ5A 2B2YA 3IFDA 3J81L 4DAYA 1P8LA 4R4CA 3A8IE 5IYCH 3M3YB 2MFIA 3NK9A 1LTGD 3NUCA 2N3SA 5C44B 3Q0AA 1PH7A 1XXGA 4IN3A 2N88A 3IAYA 3S1MH 1K0RA 5IYBH 2JA9A 1L1OA 4RKLA 3I4MH 1LTBD 2RDHA 3OYYA 3J80i 3M4OH 3D31A 2E76C 2E8GA 4K0KQ 1SAPA 4UAIA 4GKKL 4A3CG 3KF8B 2O2LD 4HSPA 4KN7C 3PIP3 1A2TA 2EQSA 2RVLA 1GM5A 3VYSA 1Q8IA 2K14A 2YYZA 4Y7NH 3A8JE 4RCOA 4R4IA 1SBBB 4BBRB 3PQIA 3I4LA 2EIFA 5JOBA 4A75A 1UWVA 3NTKA 5DAUA 1S5FD 3K8AA 1QJOA 3A54A 1WD1A 2JA7H 4IFDH 2HIVA 1HQMC 4FO2A 1WTRA 1S5DD 3NENA 1I3QH 1NAPA 2B2WA 5DEHA 4CGYB 3WWVA 1NR2A 1WCMB 2VB2X 4UY8C 1VQ9A 3AYHB 1SSOA 4HN7A 5K36G 3ONAB 5IODA 4A3DG 3GTMB 4A4IA 2OWOA 1HR0W 2TMPA 3DUZA 1G8ZD 3PMFA 2RQXA 5EKKA 2CQOA 4CHTB 1ZEQX 2F4VL 2DGYA 3MTSA 1SNDA 4LK1C 2IX3A 1LTAD 5JEAG 4C2MB 3EROA 1G2TA 3SEBA 3QOJA 2F0HA 1JOQA 2MQHA 5I9PA 1VF7A 3IL8A 3OOCA 1HNXL 1TWCH 4MZ9A 3GP7A 3AFPA 2I46A 1RF2D 4NB3A 1PXUA 4QQBX 4POGA 2F0NA 2Z9HA 2E2HB 4GKKQ 2A6HC 1BOSA 1I6VC 3KBXA 3X3MA 3K59A 1STHA 5FLXL 3FDTA 2JA6B 2D0PA 1XPUA 1G291 4A3MB 3ITPA 2B2UA 2G9DA 4JI8L 5CBEE 3HKZB 4OWWB 4JI2L 1BO0A 3K6OA 3E6ZX 5C5MA 5JJKA 2EYJA 1E2ZA 1ZYRC 3GTJB 1ZYRD 1TXYA 2IX1A 1HHVA 1S5ED 5T1IA 2F4IA 2K03A 1XYIA 3KFUA 4KHPL 3M7GA 3PO3B 2B63H 3E0JA 5JJIA 3V2TA 4F88A 3I72A 4MN3A 5D3IB 5JAVA 2A8VA 3CRKC 4GOPC 4C3IB 5C4XB 2F3WA 3BZCA 2PCFB 4JPBW 2WAQE 3HOWG 5BN5A 3CCRA 3ND8A 4JI1L 4CDFC 5EKLA 4G57A 5C4HA 4GOPB 1Q46A 5A2QL 1Y69U 3A55A 2VB3X 5I2XA 1LTTD 3TQYA 3DHQA 5LL6X 4PZ8A 2MP1A 1DZ1A 1V1PA 1BBWA 5IY0A 1SXTA 4HIKA 1KC8C 3A74A 3ZJYC 4YCVA 5IGEA 1XNRQ 2WINB 3I3CA 4IFDJ 3S17H 1J9OA 5HGQA 3NTIA 5EPLA 1YNJC 3GTLH 1YNJD 1KLUD 1ENAA 1VQIA 4XQQA 1II3A 3BZDB 4FXKC 5LL6S 4DAPA 2Q2UA 4NDXA 5M9OA 1HNXQ 2F0SA 4A3CH 4O1NA 3RZDH 1K3RA 1YJNA 3RZOH 5IT9L 4NP5A 1O7LA 3LNNA 1MSHA 4HMJA 5M3FG 2A74C 3I73A 4L5SA 3W5OA 3J7A5 4YCUA 4IJLA 3Q6SA 2GVAA 1AFPA 2F0MA 1QG7A 4JI2Q 4C1NK 1PV4A 3E5SA 3OIQA 4IPGA 2F0LA 4QCLA 3GTKB 4KHPQ 5BN3A 1M4VA 5IP9G 1I4RA 5K5PA 2JE6I 4CKBA 3EA6A 4HJ7A 4A3DH 4BY1G 3OMCA 3NHHA 4JI1Q 2BE5C 2BE5D 4RGTA 3J81j 4X3TA 2OF1A 3H0GG 4BXXG 2Q2HA 4J8QA 3BVMA 4QJFA 1GO3E 1HFGA 2J0TD 2D9UA 1N36L 4FYDA 1STBA 5JEAH 1WFQA 1AN8A 2DY8A 3BVZA 3J81i 2EJGC 3FP9A 3TEHB 1GUTA 4J1MA 1TU2B 2YTYA 2L15A 3K81C 4GN5A 3SR1A 5I6WA 4HIOA 1XX8A 3I7FA 4MIUA 4A3LG 1FVIA 1XMOQ 5T1GA 1TWAH 1BNZA 2ZJQA 2BA0A 1Y8NB 1JE4A 3OTOQ 1K83B 4DV3Q 3VR5A 2NVTH 1PRTC 1XTCD 1PRTD 1OXSC 1QUQA 2B2TC 2RSOA 4H7BA 1TWFB 4A93H 1PRTB 3KLSX 5M5WB 4R8IA 2VL6A 4P2CB 4XYOA 4KHZA 1M90C 3TP6A 4IOCA 5FLXc 1BR9A 3CQZB 1VQFA 2JSOA 1A63A 2FFKB 1SNOA 4KY5A 1B4OA 3HOWH 4ZUIA 2N55A 3ER0A 4PNYA 4P71A 1PH4A 1W6JA 2A6EC 2A6ED 4IO9A 1IHZA 1PH1A 1HA5A 4IFDI 2HUGA 1NE3A 3NELA 1JWMD 4PMBA 3PO2B 3CMAA 3L0OA 1H9JA 1N36Q 4B3SL 3T1HL 1NSNS 4RGMA 4AYBB 1KAAA 3PUVA 3QIAA 4LF8L 4KMUC 4K6DA 1H9SB 1VQHA 2YU9B 3VR6A 5E4WC 4ME3A 2GVBA 1OO9B 1HNWQ 3D6CA 4JI3L 1CKNA 1F77A 2FMCA 2R7ZG 4M1UB 3J80E 5L37A 1VQOA 1UE6A 1KXLA 5M5YH 3FKIB 5I9OA 3HP3A 2A69C 3U50C 3WOEA 2A69D 3ULJA 5M3FH 1HQRD 2QDBA 5GQOA 1B70B 1I4XA 1SMYD 1NCVA 2Z1CA 4L5QA 5JEAJ 1Z47A 2XGTA 2CFMA 2K6AA 5C3WA 3CCUA 3K57A 1PTOH 4LW1A 4BA2I 3QOLA 4APVA 1JC7A 2N8NA 3OIPA 5JPNC 4A76A 3CCJA 1X9NA 5IP9H 5IT9c 1PH9A 4DF7A 3NWTA 3S1QB 1VMCA 1S5BD 1G6PA 1N33Q 2AQ1B 4BY1H 1STNA 1TWHB 4A3JB 5ELOA 2OQ0A 4L8JA 1EL0A 1ML0D 1ESRA 1QOHA 4UP8A 1J5EL 1XMQL 2AMCB 3FHWA 1E1OA 1A3TA 2F0TA 2MJ8A 4XTCS 3H0GH 4BXXH 2F0DA 3RN5A 1T9HA 4IOAA 3SK6A 2WAQB 4K6LA 2XN9C 3F1ZA 1CM9A 3KLRA 2EY2A 4OIKA 4B3SQ 1G2SA 4XT3B 3H3VC 2CH4W 1R9TB 1L0YB 3SE0A 1J8IA 5E4XA 4K5WA 1MHWC 4C3HB 4LF8Q 3CRLC 4A3LH 4P73A 1PFSA 3GTGH 2M9VA 1Y8OB 1GUWA 2A1AA 2E74C 4A3IB 4PMCA 1IL8A 4JI3Q 2PI2E 3A7LA 4ZKBB 2QA4A 2TSSA 4FDBA 5J22A 3OWFA 2JA5G 3CKIB 2PZTA 1IZ6A 2YTXA 3TDQA 1CSPA 4H02A 4GKJL 3GTPH 2E2IH 3HOVG 1KABA 2L9HA 4AIMA 3S24A 1P16A 4DR5L 4WJ3M 5IYCG 3I8ZA 3OW7A 3TP8A 2F0EA 4HJ8A 3NBHB 2H4OA 5CGKA 1B7YB 2WB1E 2K32A 4OONA 1F9RA 4F87A 4GZYC 5LMUL 2K28A 2UUBL 3E3XA 1LT6D 3KLWA 3RLFA 4PG3A 3DWAA 1ENFA 2I07B 2EE1A 2EYFA 1SJED 1J5EQ 3R93A 1MIUA 4PV1C 4B3TL 1N32L 1ASZA 5CV6A 4MHEA 1L2FA 3NEMA 4BBSG 4QMGA 3K7AB 1D1KA 5F2DA 4HCEA 3JC66 2NVYH 3CCMA 1FGBD 3GQBA 1E0BA 5ELNA 2E2JB 1EY6A 3C1EA 4DK3C 2VW9A 3I4NG 1ONLA 1RDPD 3PUXA 3TS2A 1K9MC 4JI6L 3EFXD 4H13C 2K1BA 3WOFA 1VQBA 3KF8A 2R7ZH 1RCVD 2QILA 2JXMB 1YBYA 3K5LA 3H15A 3HOYH 3MXUA 3MC0B 1IKLA 3L9AX 3GV3A 1U0LA 4JBJA 1JE5A 1B8AA 5J39A 3MWYW 2CVRA 3SDZA 3TZUA 5KGUA 2EY5A 2ZXRA 1K8MA 5M5XH 4X64L 3C2PA 1CHPD 2KECA 2PPBC 2NTSA 3QJYA 1EY8A 1PDQA 5AJ3L 4BY7G 4GKJQ 1D5XC 1NMGA 1LT5D 3NSWA 5IYDH 3CPWA 2JN4A 3I4OA 4C3JG 3C3LA 1EOTA 2F0JA 3DEOA 3N52A 1LTSD 5D65A 4KD3A 3CCLA 2SNSA 1YITA 1HXYD 1EIFA 5LMUQ 2UUBQ 2SEBD 2NYZD 1QE6A 5KNCA 4FF2A 4K0KL 1EFWA 1XNQL 1DM0B 3OMGA 2D2CC 3UI2A 4B3TQ 2PQAB 1SLJA 1JWUD 2LFNA 4RWSC 1B53A 5C44G 4QUCA 4G4KA 1MI2A 1XJVA 1WTWA 3HFZB 4LWCA 2JEAI 4CDEC 2NN6I 4I7AA 2DUDA 1RTNA 1WTHA 4LFCL 1I50H 1A62A 1N9WA 4FF3A 3HOUB 1V1OA 3FEWX 4RKBA 5IGCA 4JI6Q 4XDXA 3HS0C 1EYDA 1LV9A 4FXGC 1CHQD 2NUCA 3Q23A 3JAML 2B63G 4A3KB 1LT4D 2AUJD 1X3QA 3AMUA 1QILA 2RKSA 3HGBA 2JA5H 2JA8B 5FOBB 5KNDA 1BUVT 2ENBA 4BBRG 4X64Q 3W1BA 4ILWA 4OWXB 1KL9A 3HOVH 3FPUB 1BXTA 1HZCA 1K3BC 5GADC 2EYOA 3QO2A 5AJ3Q 1CA5A 3D4WA 1JB7A 1HTLD 3SHLA 5KEEA 2VNUD 1FR3A 2K75A 4A3BB 3TBIB 3T51B 4IZ8A 3G6EA 4HAEA 5DM73 5C4JH 1WCMG 2MNAA 5FO8B 2F0OA 4GOPA 1EQVA 1KNEA 2O4XA 2Y0SE 1EY7A 2VUMB 4UHVA 2NZOA 1OXVA 3CCVA 4JCVE 1IYUA 2FMMA 4BBSH 2HQEA 2K5WA 1Q86C 4JC0A 1XNQQ 4Y52H 2X69A 3S1NB 3EN2A 1X3FA 2JQOA 3S2DB 4HR7B 2UXDL 4BWGB
chains in the Genus database with same CATH topology
2CQAA 1HUNA 4OL7A 3NP8A 2QEJC 3FPPA 1AP0A 3QG1A 4F7XA 4ZLTF 4ID6A 1TR5A 4C56C 3DEPA 1PFBA 4ZYSA 3KK7A 2E75C 4KI0A 3I70A 3QB3A 1B2TA 3RD4A 1DCZA 4K14A 4V0BA 1H9RA 5G3LF 5CBAE 1GUNA 4RHRA 2R61A 1B44D 2MHVA 1SYBA 4N9PA 1OXTA 4EVOA 1SNCA 2KOLA 3R3OA 3FVQA 1BF4A 3D4DA 2F0VA 4C3IG 3LWUA 4KY7A 1SFOB 4FF4A 2X6LA 1SDFA 1Y1WB 4FP5D 2AQ3B 3LX0A 5EPJA 4V190 1I6HB 2DNCA 3O13A 4RAUC 2WB1B 4B08A 3DM1A 2Z8LA 5CV5A 3BDCA 1EZ8A 1KLGD 1KDBA 4XT1B 3ZYYX 3VYRA 1FNUA 3S15B 2R93B 4OGQC 4ZK9B 2NN6G 1EY5A 1ESFA 4HEDA 4TRDA 4WJWA 1PMRA 4IUNA 4XXEA 1SEBD 2RDGA 1DD2A 1A15A 1EZ6A 1KTKA 2M00A 1SYEA 5ISRA 3F2UA 5KNBA 1TKWB 1QNKA 2WIIB 1D1IA 1ET9A 1STAA 1BCPC 1BCPD 4JBWA 3TN2A 1S5CD 3T16A 5DM63 1BCPB 1BBXC 2PZWA 5JVH3 3DXJC 3T13A 2XRSD 4KD4A 1H9SA 3BG3A 5C3EB 4U68A 1MD2D 1PRTF 1TVXA 2PW7A 1CQFA 4HTHA 3MAQA 3PUYA 1SYCA 3IKJA 4KJNA 5KYIA 2F0GA 3HOXB 4A3FB 4X3UA 4R8NA 1JQYD 1CK1A 3VR2A 2R92B 1SE2A 1ILQA 4EQNA 4FXDA 2XWBB 3J7YW 1CT1D 4CJ0B 1UEAB 3MEHA 4DNTB 5EBCA 1FNWA 3KLSA 3Q22A 2BA1A 3CU7A 3GTQB 2ZT9C 4G7HC 2B2UC 4O42A 3V05A 5M5YB 1HFNA 3NWSA 5C0XJ 1PTOC 1PTOD 2L4NA 2Y0SB 2QKIC 1QB5D 1VCIA 1PTOB 3K5NA 2EDGA 2EVBA 1B1ZA 2A68C 1O7YA 2A68D 4WFN3 1WVLA 2HDMA 3I91A 1NR4A 2R3ZA 2AWNA 1JICA 1HTPA 2ICEC 1KNAA 2NN6H 4IALA 1VDZA 1TS4A 4BS9A 1YNNC 2KVMA 1YNND 4XQNA 3SXHA 3H09A 1Y1VB 2HCIA 1V1PB 3NBHA 1DOLA 3I90A 4QIWB 3RMHA 4CBVA 2WACA 1GHJA 4XIGS 4CKEA 2ID0A 3EJIA 1MSGA 4A3EB 1EY9A 1D5ZC 4IQZA 1CTMA 3MXGA 5LHY1 3S16B 5EQ0A 2EOTA 5ELCA 1CQVA 2RDFA 3S2HB 1TWGB 2BCOA 1EEID 3OWEB 2QF7A 5IGDA 2K5DA 3HOZB 1ENCA 5I4DA 1SMYC 2EPBA 4C3HG 4ZQ3A 1C4QA 2AUKA 2CW0C 5DNFA 2CW0D 1SNQA 5M3MB 2OXPA 2F0UA 3MVVA 5ELBA 2F0PA 2K33A 2NVXB 4M8AA 2Z4IA 4F8MA 2EYLA 3J80L 3W3AA 1V43A 2KJXA 3K0YA 4TSSA 4KN4C 1U4LA 1D5MC 2WKDA 2SDFA 4DNRB 1EYCA 5AFWA 4Q5VA 1WTQA 2O5JC 2NWGA 5EBDA 4L6TB 5E3FA 5IGBA 1Y8PB 1TS3A 3V96A 4DK1A 5C0XI 5HURA 4ME5A 4ZKCB 3HZXA 1EEFD 4KHVA 1UUPA 2NVQB 3R8BA 4DXFA 1K8OA 2LMCB 3D8GA 1EY0A 1FD7D 4ODGA 4K2KA 5FO9B 5C3XA 4DK0A 2VXWA 2JP1A 3DWPA 1EYAA 3OSOA 4S3SA 1QCBD 5TSSA 1QWYA 4KTAA 4FVMA 3H94A 3TP7A 1EQTA 2F0FA 3S14B 1RJTA 2L11A 2JYOA 4CKCA 3J7AV 1EIGA 2V4DA 3NPPA 4A3GB 1G6ZA 4NMZA 1U4RA 2NZ1D 2F0IA 5ELDA 3J7AF 4KV6A 2DNEA 1I50B 4KKUA 1JOOA 4KK7A 5IGGA 1EU4A 5CC4A 4L63B 2EYHA 3X3NA 1BQQT 3D4RA 2IPKD 1LTRD 3VA5A 4OHJA 2F1MA 2K04A 4K8JA 4G7ZC 2Q8RE 1UNSA 1JCKB 1X32A 1GUOA 4CJ1B 1IYVA 2FJ2A 4DGZA 1TS2A 2ICIA 4TQUS 2OEOA 5COYA 5CV7A 1D2BA 3S1MB 1DXMA 3I4MB 2IW3A 4RCNA 4OO1G 3GD7A 3M4OB 2M2LA 5BN4A 4RHSA 1B9MA 3K5MA 4ULLA 2QCPX 4I7ZC 5IIFA 1VMPA 3G7LA 1Q1BA 2SNMA 3PUZA 5ELEA 4Y7NB 1WTOA 3OHXC 3J81E 2JA7B 4HSVA 3NTHA 1F9SA 1RODA 2KUMA 3BDLA 1I3QB 1PZJD 3EQLC 5CR3A 2IT1A 2G9HD 4U673 3DMUA 1ILPA 4ZUJA 3SK4A 4IUPA 3MFYA 3EVQA 1LT3D 1RTOA 1SE3A 5C0XG 2B39A 5JPMC 1EU3A 1A2UA 3WDNA 4FF1A 1DONA 1SE4A 1XWEA 1Q3LA 2XRQD 2BOSA 2IX0A 1EFID 3BS1A 1JORA 5JJZA 5KIXA 1TWCB 1PYWD 3SVMA 4RFBA 1B9NA 1LACA 4DXGA 1S4ZA 3M4YA 4LJZC 2RBMA 1EWCA 2Q8TA 3GO5A 1Z6HA 1OXUA 3TSSA 1Q12A 2MPMA 2B63B 5FKAC 1V8QA 3FMCA 2WKCA 4I65A 1LLRD 3D3RA 1F9QA 2OT2A 2LS01 2L1BA 1F2YA 2XNAC 3TP5A 3MZ5A 2F0QA 1A3UA 2JEBI 2RA4A 3AB9A 2BDNA 1WTVA 1I4GA 3U9SA 5FLXE 1Q1EA 1X3PA 2AWOA 2AQ2B 4XYQA 3S17B 2C5CA 3GTLB 3KBGA 4WORA 4PMWA 4OO1H 2B2VC 2PYKA 3ND9A 4DN4M 3OPOA 3T56B 3RZDB 1F9PA 3RZOB 1GUGA 2KA7A 5FO7B 2K7VA 1WTPA 4EQPA 4IUQA 5A2QE 1BCPF 2A5HA 2DN8A 2A6HD 3P7JA 1I4HA 2FINB 1H9KA 3G6JB 5CV8A 2B2YC 4A3DB 4XQJA 2KCCA 4K8IA 2PQEA 1MGSA 1RD9D 1JR0D 4OIJA 1SYFA 1O80A 3VA7A 2B2TA 1T5EA 5C0XH 1C48A 3VYUA 3HRZC 5G3LD 5IT9E 1WD0A 4FNFA 5EGTA 1GUSA 4HMIA 4KJOA 2KHSA 1ZKOA 4RGOS 3R2IA 5IGFA 3N6RA 2LKVA 4X3SA 3HEJA 5HGTA 1TWAB 1IW7C 1IW7D 5CV9A 1AZQA 3MFGA 2NVTB 2GA4B 1JWSD 1KDAA 1E2VA 5C6AA 1CFMA 1TS5A 1NUCA 5EKIA 5NUCA 4A93B 1PZID 3R2TA 2EYPA 5CMDA 5EPKA 2B2WC 1HPCA 1HRJA 1PTOF 1UAPA 5C4ZA 3MA2B 1MBYA 5J1ZA 1TT2A 4KY6A 3P75A 3HOWB 3H6MA 4X3KA 1F2LA 5KRUA 1QNUA 1FNVA 1B3AA 3MXNA 2KEEA 5A35A 3H91A 2LY7A 5K36H 1STYA 2EJFC 1G91A 2K5QA 1SYDA 1SNPA 2Z4HA 1O7ZA 1VF5C 1R4QB 2PZUA 1OXXK 1ZXTA 4YIJA 2L5TA 3U9OA 1CZWA 5M3FB 2EZVA 1PFNA 3LWEA 3SK8A 2K05A 3M7NA 1PLFA 4EGVA 4C1NI 5IOCA 4K5XA 2PMZB 2XSCA 3DWQA 2PO4A 4Z9CB 3M85A 2XVSA 3KUPA 3CHBD 4BY1B 1SYGA 2MUYA 3A56A 4LMQD 4DA2A 1E2WA 3RUZA 1FYCA 1HA6A 1ICWA 2KEDA 3H0GB 4HCSA 2L0CA 3VR4A 1PZKD 2H1EA 1JOKA 1STGA 3GV6A 2FHTA 5CYUA 2WP8J 1DJRD 1F2ZA 3W2DA 5EJWA 3GTGB 2RSNA 1CA6A 5CORA 3PUWA 4R9WA 1CI3M 3SK5A 3VYTA 2IL8A 1A6XA 1I4PA 2J7ZA 2KCNA 4IUVA 3QWNA 1SJHD 2EXZA 2ZXOA 3TZDA 1TIID 1SNMA 3D6WA 3GTPB 4OO1I 1D6EC 1ET6A 2E2IB 4QB4A 1C8CA 4NKLA 1GJXA 3P1HA 3L3OC 2KQ3A 3NE5B 3PIO3 2NB0A 2XIWA 1AEXA 5I2YA 4E6IA 5C5LA 4WRDA 1EY4A 2E2DC 1GXDC 3BDOA 4N9TA 1KDCA 2IJ0A 5ELFA 4KKSA 3K58A 2C9OA 2SOBA 2NVYB 2HDLA 1LTID 3HG9A 1Z7TA 4J6HA 4QF4A 4K2LA 4K5VA 1WTXA 4BA1I 2A73B 4RGNA 2IWHA 3FRPB 3BVGA 1DOMA 2R7ZB 2NBFA 3HOYB 2B8GA 1U4PA 4G7OC 1DOKA 3A7AB 3T4AC 5M5XB 2EY1A 2MGSA 5I6YA 3IFTA 4LAAA 4KKTA 3A8KE 4TKOB 4DAVA 2K01A 3PV0A 1W6KA 2EY6A 1TY0A 3NXWA 1IKMA 1GHKA 3ERQA 1F2MA 4B9WA 3BYYB 3MHBA 3Q24A 1TQOA 1AZPA 1H9MA 4ZAIA 2ZXPA 4ABNA 1EIHA 3S1RB 3TMEA 2NTTA 5KYLA 1CZGA 4RH6A 2DY7A 4QUFA 1L0XB 5D3DA 4IUUA 1B50A 2PW5A 4Q0FA 2BDOA 1AW7A 2F3VA 2HCCA 1U4MA 2D5DA 4IURA 3VR3A 2JA5B 2PNRC 4ZRZA 3HOVB 4IUTA 3BYTB 1STEA 3C46A 4IFDG 5CV4A 3NQTA 2F0WA 1PFMA 1HUMA 5C4JB 2EJMA 5FK9C 4PQXA 2L12A 1GOZA 2F0KA 1LABA 2J4XA 1DYQA 2Q8IB 4BBSB 3NBIA 4NW2A 1EWHA 4CJ2C 1A3VA 3JAME 5D14A 3T53B 3S9WA 5JVG3 1RHPA 3I4NB 2CHBD 1I4QA 1M8AA 3GTOB 1TY2A 2EYMA 1T5XD 2B2VA 4DU9A 5E1FA 1O78A 3K5OA 3URYA 1HCZA 2F03A 4B9XA 4H44C 3C1FA 4RA8A 4DFAA 1Q90A 3NQIA 4BY7B 1JB3A 3L7ZC 3MXPA 4UDUC 4H0LC 4C3JB 1R4PB 3AU7A 1BDOA 3P20A 2L55A 2XWJB 1RKNA 2R6GA 2O5IC 2X6GA 2D62A 2B8FA 1LO5D 1U9RA 2WV6D 4EQOA 4JK1C 2B2YA 3IFDA 3J81L 4DAYA 3A8IE 3M3YB 3NK9A 1LTGD 3NUCA 5C44B 3Q0AA 1XXGA 4IN3A 2N88A 3IAYA 4RKLA 1LTBD 2RDHA 3D31A 2E76C 1SAPA 4UAIA 2O2LD 4HSPA 4KN7C 3PIP3 1A2TA 2RVLA 3VYSA 1Q8IA 2YYZA 3A8JE 4RCOA 1SBBB 4BBRB 3I4LA 5JOBA 3NTKA 5DAUA 1S5FD 1QJOA 3A54A 1WD1A 4IFDH 1HQMC 4FO2A 1WTRA 1S5DD 1NAPA 2B2WA 5DEHA 4CGYB 1NR2A 1WCMB 2VB2X 1SSOA 4HN7A 5K36G 3ONAB 5IODA 3GTMB 2TMPA 3DUZA 1G8ZD 3PMFA 2RQXA 5EKKA 4CHTB 1ZEQX 3MTSA 1SNDA 4LK1C 2IX3A 1LTAD 5JEAG 4C2MB 3EROA 1G2TA 3SEBA 3QOJA 2F0HA 1JOQA 5I9PA 1VF7A 3IL8A 3OOCA 3GP7A 2I46A 1RF2D 1PXUA 2F0NA 2E2HB 2A6HC 1BOSA 1I6VC 3KBXA 3X3MA 3K59A 1STHA 5FLXL 3FDTA 2JA6B 1G291 4A3MB 3ITPA 2B2UA 2G9DA 5CBEE 3HKZB 1BO0A 3K6OA 3E6ZX 5C5MA 2EYJA 1E2ZA 1ZYRC 3GTJB 1ZYRD 2IX1A 1HHVA 1S5ED 5T1IA 2F4IA 2K03A 1XYIA 3M7GA 3PO3B 3E0JA 3V2TA 4F88A 3I72A 4MN3A 5D3IB 5JAVA 3CRKC 5C4XB 4C3IB 2F3WA 2PCFB 5BN5A 3ND8A 5EKLA 4G57A 5C4HA 5A2QL 1Y69U 3A55A 5I2XA 2VB3X 1LTTD 3DHQA 5LL6X 2MP1A 1DZ1A 1V1PA 1SXTA 5IGEA 2WINB 3I3CA 4IFDJ 1J9OA 5EPLA 3NTIA 1YNJC 1YNJD 1KLUD 1ENAA 4XQQA 1II3A 3BZDB 4DAPA 5LL6S 4FXKC 4NDXA 5M9OA 2F0SA 4O1NA 5IT9L 4NP5A 1O7LA 3LNNA 1MSHA 4HMJA 2A74C 3I73A 3Q6SA 1AFPA 2F0MA 1QG7A 4C1NK 3E5SA 3OIQA 2F0LA 4QCLA 3GTKB 5BN3A 1M4VA 1I4RA 5K5PA 2JE6I 4CKBA 3EA6A 3OMCA 3NHHA 2BE5C 2BE5D 4RGTA 4X3TA 2OF1A 4J8QA 3BVMA 1HFGA 2J0TD 2D9UA 4FYDA 1STBA 5JEAH 1AN8A 2DY8A 3BVZA 2EJGC 1GUTA 4J1MA 1TU2B 3SR1A 5I6WA 1XX8A 4MIUA 5T1GA 1BNZA 2BA0A 1Y8NB 1JE4A 1K83B 3VR5A 1PRTC 1XTCD 1PRTD 1OXSC 2B2TC 2RSOA 4H7BA 1TWFB 1PRTB 3KLSX 5M5WB 4R8IA 4P2CB 4XYOA 4KHZA 3TP6A 1BR9A 3CQZB 2JSOA 2FFKB 1SNOA 4KY5A 1B4OA 4ZUIA 2N55A 4PNYA 1W6JA 2A6EC 2A6ED 1IHZA 1HA5A 4IFDI 2HUGA 1JWMD 4PMBA 3PO2B 1H9JA 1NSNS 4RGMA 4AYBB 1KAAA 3PUVA 3QIAA 4KMUC 4K6DA 1H9SB 2YU9B 3VR6A 5E4WC 1OO9B 3D6CA 1F77A 2FMCA 4M1UB 3J80E 3FKIB 5I9OA 3HP3A 2A69C 3WOEA 2A69D 1HQRD 2QDBA 1I4XA 1SMYD 1NCVA 2Z1CA 5JEAJ 1Z47A 5C3WA 2K6AA 3K57A 1PTOH 4BA2I 3QOLA 1JC7A 3OIPA 5JPNC 4DF7A 3NWTA 3S1QB 1VMCA 1S5BD 2AQ1B 1STNA 1TWHB 4A3JB 4L8JA 1EL0A 1ML0D 1ESRA 1QOHA 1A3TA 2F0TA 2MJ8A 4XTCS 2F0DA 3SK6A 2WAQB 4K6LA 2XN9C 1CM9A 3KLRA 2EY2A 4OIKA 1G2SA 4XT3B 3H3VC 1R9TB 1L0YB 3SE0A 1J8IA 5E4XA 4K5WA 4C3HB 3CRLC 2M9VA 1Y8OB 1GUWA 2E74C 4A3IB 4PMCA 1IL8A 3A7LA 4ZKBB 2TSSA 5J22A 3OWFA 3CKIB 2PZTA 3TDQA 1KABA 2L9HA 3I8ZA 3OW7A 3TP8A 2F0EA 2H4OA 5CGKA 2K32A 1F9RA 4F87A 4GZYC 2K28A 1LT6D 3RLFA 3DWAA 1ENFA 2I07B 2EE1A 2EYFA 1SJED 3R93A 4PV1C 5CV6A 4MHEA 4QMGA 3K7AB 1D1KA 5F2DA 4HCEA 1FGBD 3GQBA 1E0BA 2E2JB 1EY6A 3C1EA 1ONLA 1RDPD 3PUXA 3EFXD 4H13C 2K1BA 3WOFA 3KF8A 1RCVD 2QILA 2JXMB 3K5LA 3MXUA 3MC0B 1IKLA 3L9AX 3GV3A 5J39A 3TZUA 3MWYW 2CVRA 3SDZA 5KGUA 2EY5A 2ZXRA 1K8MA 3C2PA 1CHPD 2KECA 2PPBC 2NTSA 3QJYA 1EY8A 1PDQA 1D5XC 1LT5D 3NSWA 4C3JG 3C3LA 1EOTA 2F0JA 3DEOA 3N52A 1LTSD 5D65A 4KD3A 2SNSA 1HXYD 2SEBD 2NYZD 1QE6A 5KNCA 4FF2A 1DM0B 3OMGA 2D2CC 3UI2A 1JWUD 2LFNA 4RWSC 1B53A 4QUCA 4G4KA 1MI2A 1WTWA 2JEAI 2NN6I 1RTNA 4FF3A 3HOUB 1V1OA 3FEWX 4RKBA 5IGCA 4XDXA 3HS0C 1EYDA 1LV9A 4FXGC 1CHQD 2NUCA 3Q23A 3JAML 4A3KB 1LT4D 2AUJD 1X3QA 3AMUA 1QILA 2RKSA 3HGBA 2JA8B 5FOBB 5KNDA 1BUVT 2ENBA 4ILWA 3FPUB 1BXTA 2EYOA 3QO2A 1CA5A 3D4WA 1HTLD 3SHLA 5KEEA 2VNUD 1FR3A 4A3BB 3TBIB 3T51B 4IZ8A 4HAEA 5DM73 5FO8B 2F0OA 1EQVA 1KNEA 2O4XA 1EY7A 2VUMB 1OXVA 1IYUA 2FMMA 2HQEA 2K5WA 2X69A 3S1NB 3S2DB 4HR7B 4BWGB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5K36 G;  3SE0 A;  1O78 A;  1PMR A;  3CRL C;  2K33 A;  1HCZ A;  3D4R A;  3FPP A;  2DN8 A;  5A35 A;  1Y8O B;  1O7L A;  3QG1 A;  3LNN A;  5K36 H;  2E74 C;  1DD2 A;  2A6H D;  4H44 C;  2F1M A;  1VCI A;  2A6E C;  2EJF C;  2A6E D;  3I73 A;  1Q90 A;  1GJX A;  3W3A A;  3A7L A;  1V43 A;  3L7Z C;  2EDG A;  1H9K A;  5KNC A;  2EVB A;  4LK1 C;  3NE5 B;  2A68 C;  4KN4 C;  2A68 D;  5JEA G;  5KNB A;  4H0L C;  4G7Z C;  1VF5 C;  1TKW B;  2E75 C;  2KCC A;  4KI0 A;  1B9N A;  2D2C C;  1GUO A;  4DNR B;  1LAC A;  1H9J A;  1OXX K;  2O5J C;  3M4Y A;  1HTP A;  1BDO A;  4LJZ C;  3P20 A;  2L5T A;  1IYV A;  3VA7 A;  1VF7 A;  2R6G A;  2O5I C;  1DCZ A;  3OOC A;  1T5E A;  1Y8P B;  5C0X H;  3PUV A;  3QIA A;  1H9R A;  5BN3 A;  2NN6 H;  4DK1 A;  4TQU S;  4JBW A;  3OW7 A;  2BDO A;  4KMU C;  2JE6 I;  3BDO A;  1GUN A;  2D62 A;  1VDZ A;  1DXM A;  2B8F A;  1H9S B;  2NN6 I;  2JEA I;  1Z6H A;  1GUS A;  3M7N A;  3VR6 A;  1OXT A;  1OXU A;  2A6H C;  1I6V C;  4JK1 C;  1YNN C;  4KKS A;  2K32 A;  2D5D A;  3VR3 A;  1Q12 A;  4GZY C;  1G29 1;  3A8I E;  2PNR C;  4RCN A;  3DXJ C;  2BE5 C;  1V8Q A;  1ZKO A;  2BE5 D;  3GD7 A;  3FMC A;  5BN4 A;  2LMC B;  1K8O A;  1Z7T A;  3RLF A;  1H9S A;  3BG3 A;  1B9M A;  2A69 C;  3LWU A;  2A69 D;  3N6R A;  4I7Z C;  3M85 A;  4PV1 C;  4BA1 I;  4IFD G;  1E2Z A;  1ZYR C;  1GHJ A;  4XIG S;  2AUJ D;  3PUY A;  1Q1B A;  5JEA H;  1IW7 C;  3PUZ A;  4DK0 A;  1IW7 D;  2DNC A;  2JEB I;  3HGB A;  4IQZ A;  1CTM A;  5KND A;  4BA2 I;  2EJG C;  3IKJ A;  2EJM A;  3AB9 A;  3D31 A;  1GUT A;  3GQB A;  3I72 A;  2E76 C;  1E2V A;  1TU2 B;  3H94 A;  3CRK C;  1E2W A;  1CFM A;  1FYC A;  3U9S A;  2B8G A;  4G7O C;  2QF7 A;  1Q1E A;  2PCF B;  3A7A B;  4KN7 C;  2AWO A;  3VR2 A;  1LAB A;  1ONL A;  5BN5 A;  3PUX A;  3ND8 A;  2Q8I B;  3VR4 A;  1FR3 A;  2BA0 A;  1Y8N B;  1Y69 U;  3IFT A;  1EWH A;  4H13 C;  2YYZ A;  3A8J E;  4KKT A;  1HPC A;  3EQL C;  4L8J A;  3T51 B;  3VR5 A;  2V4D A;  2IT1 A;  2JXM B;  4OO1 H;  3I4L A;  3A8K E;  3MXU A;  1SMY C;  4TKO B;  4OO1 G;  1OXS C;  3T53 B;  4DNT B;  3PV0 A;  4XTC S;  3ND9 A;  1QJO A;  2AUK A;  3OPO A;  3T56 B;  3MFY A;  4IFD H;  3TZU A;  3SDZ A;  1K8M A;  1OXV A;  2DNE A;  2BA1 A;  2CW0 C;  1HQM C;  1GUG A;  1IYU A;  2PPB C;  1YNJ C;  3PUW A;  4OGQ C;  1GHK A;  3QJY A;  5C0X G;  2KA7 A;  1CI3 M;  4KHZ A;  2ZT9 C;  2NN6 G;  4KKU A;  4G7H C;  3KLR A;  2K7V A;  1A6X A;  4HR7 B;  1H9M A;  3WDN A; 
#chains in the Genus database with same CATH topology
 2CQA A;  1X55 A;  1YNX A;  1HUN A;  4OL7 A;  3NP8 A;  3I4N H;  2QEJ C;  3FPP A;  1AP0 A;  2ZM6 L;  4LFC Q;  3QG1 A;  4F7X A;  4ZLT F;  4ID6 A;  1TR5 A;  3GTO H;  2AHO B;  1X65 A;  1RIP A;  4C56 C;  3RLO A;  1SRO A;  3DEP A;  1PFB A;  4ZYS A;  2UXC L;  3CF5 A;  3KK7 A;  2E75 C;  4KI0 A;  3AFQ A;  2JA6 G;  4A3M G;  4QIW E;  3I70 A;  3QB3 A;  1B2T A;  3HKZ G;  3RD4 A;  1DCZ A;  4K14 A;  4TVA B;  1IBM L;  1LUZ A;  4V0B A;  1H9R A;  2QW7 A;  5G3L F;  4AYB E;  1CKM A;  2VQE L;  2ATW A;  4RMF A;  5CBA E;  2ZTC A;  2DJG C;  1GUN A;  4RHR A;  1QVC A;  2R61 A;  1B44 D;  1XTD A;  2MHV A;  4QGU A;  4BY7 H;  1SYB A;  4N9P A;  3UE0 A;  4IJH A;  5GAE C;  1OXT A;  5J3B A;  1SNC A;  4EVO A;  1HR0 L;  4ALP A;  2KOL A;  1I5F A;  4C3J H;  3PO3 G;  3R3O A;  1XNR L;  3FVQ A;  1BF4 A;  3D4D A;  1HJP A;  5C4X G;  2F0V A;  4C3I G;  3LWU A;  4N8F A;  4KY7 A;  1SFO B;  4FF4 A;  2X6L A;  1SDF A;  1Y1W B;  3A0J A;  4FP5 D;  4AQY L;  2AQ3 B;  1HH2 P;  3LX0 A;  5EPJ A;  3PF4 A;  4V19 0;  1I6H B;  2DNC A;  2N78 A;  3O13 A;  4RAU C;  4UPA A;  1Q81 C;  2WB1 B;  4B08 A;  3M3Y H;  3DM1 A;  2ZJP A;  4P75 A;  1IBK L;  4JYA L;  2Z8L A;  5CV5 A;  5C44 H;  3BDC A;  4HID A;  1X3G A;  4DV0 Q;  2KEN A;  2UXD Q;  2CCZ A;  1EZ8 A;  3T1Y L;  1KLG D;  1KDB A;  4XT1 B;  1HZA A;  1KHI A;  3I56 A;  3ZYY X;  4A93 G;  3VYR A;  1OTC A;  2ZM6 Q;  1FNU A;  4R4O A;  4MTN A;  3S15 B;  4DV4 L;  1FL0 A;  4LUZ A;  1E3P A;  2UXC Q;  2R93 B;  2C35 B;  4OGQ C;  4ZK9 B;  2NN6 G;  1EY5 A;  1ESF A;  3VDY A;  4BBR H;  2GN5 A;  4HED A;  1IBM Q;  4TRD A;  4WJW A;  4LF5 Q;  2VQE Q;  1IYJ B;  1PMR A;  3I2Z A;  4IUN A;  4XXE A;  1WYD A;  1EIY B;  1HR0 Q;  1SEB D;  4L5T A;  2RDG A;  1DD2 A;  1A15 A;  3JAM c;  1EZ6 A;  1KTK A;  2PNH A;  4HJA A;  4YWK A;  1WCM H;  2M00 A;  1SYE A;  5ISR A;  3F2U A;  1VQE A;  3GTM H;  2G5D A;  5KNB A;  4J15 A;  3PCO B;  1TKW B;  2KHJ A;  1QNK A;  4AQY Q;  2WFW A;  2WII B;  1XMO L;  1D1I A;  4YCW A;  1ET9 A;  1STA A;  3OTO L;  4DV3 L;  3CME A;  1BCP C;  1BCP D;  4JBW A;  3SGI A;  3TN2 A;  1S5C D;  3T16 A;  1IBK Q;  4JYA Q;  4C2M H;  3HKS A;  5DM6 3;  4JV5 L;  4DNI A;  1BCP B;  1BBX C;  2PZW A;  3T1Y Q;  5JVH 3;  3DXJ C;  3T13 A;  4DR2 L;  2XRS D;  4KD4 A;  1H9S A;  3BG3 A;  5C3E B;  4U68 A;  1MD2 D;  1BKB A;  1PRT F;  1TVX A;  2PW7 A;  1CQF A;  4HTH A;  3MAQ A;  2E2H H;  3PUY A;  1SYC A;  2JA6 H;  4A3M H;  4NXN L;  4DV4 Q;  3IKJ A;  3E0E A;  4KJN A;  1WJJ A;  3ICE A;  5KYI A;  2F0G A;  2Z6B A;  3HOX B;  4A3F B;  1CSQ A;  4X3U A;  4R8N A;  1JQY D;  1CK1 A;  4DUY L;  3JAM i;  3VR2 A;  3GTJ H;  1SE2 A;  2R92 B;  1ILQ A;  4EQN A;  1Q82 C;  2IHF A;  3CCS A;  4FXD A;  2XWB B;  4JI0 L;  3PO3 H;  1SE8 A;  3J7Y W;  1CT1 D;  4CJ0 B;  1UEA B;  3MEH A;  4DNT B;  3RLN A;  4C3I H;  5C4X H;  4OX9 L;  5EBC A;  1FNW A;  3KLS A;  1V1Q A;  3Q22 A;  2BA1 A;  3CU7 A;  1IBL L;  1HNW L;  2KCM A;  3GTQ B;  2ZT9 C;  4G7H C;  4IPH A;  2B2U C;  5IE8 A;  4O42 A;  3V05 A;  5M5Y B;  1HFN A;  3NWS A;  5C0X J;  1PTO C;  2ES2 A;  1PTO D;  2L4N A;  1S3O A;  2LXJ A;  3A5U A;  5IP7 G;  4B3M L;  2Y0S B;  4JV5 Q;  2QKI C;  3AQQ A;  1QB5 D;  3BJU A;  1VCI A;  1YHA A;  1PTO B;  4DR2 Q;  3K5N A;  2ALY B;  2EDG A;  2EVB A;  1B1Z A;  2A68 C;  1O7Y A;  2A68 D;  4WFN 3;  1WVL A;  2HDM A;  3I91 A;  1NR4 A;  2R3Z A;  2AWN A;  3KF6 A;  1VQ6 A;  1JIC A;  1HTP A;  2EXD A;  3FKI G;  1N33 L;  3U4Z A;  1LYL A;  2ICE C;  1KNA A;  2NN6 H;  4DAM A;  4NXN Q;  4IAL A;  1VDZ A;  5LMN W;  1TS4 A;  4DV2 L;  4BS9 A;  1YNN C;  2KVM A;  3A5Z B;  1YNN D;  4X66 L;  4XQN A;  3SXH A;  1VQ7 A;  4DUY Q;  3H09 A;  1Q7Y C;  1Y1V B;  1SR3 A;  2HCI A;  1W2B A;  1V1P B;  3NBH A;  2B29 A;  1DOL A;  3I90 A;  2QGQ A;  3GTK H;  4QIW B;  4JI0 Q;  4GNX C;  4JI4 Q;  3RMH A;  4CBV A;  2BH2 A;  2WAC A;  1GHJ A;  4XIG S;  4CKE A;  2ID0 A;  3EJI A;  1MSG A;  4A3E B;  4A3J G;  1FJG L;  2JK8 A;  1EY9 A;  1D5Z C;  4GNX B;  4OX9 Q;  4IQZ A;  1CTM A;  3MXG A;  5LHY 1;  3S16 B;  1NTG A;  5EQ0 A;  1S40 A;  2EOT A;  5ELC A;  5GAH C;  3RNU A;  4DV1 L;  1CQV A;  2RDF A;  3S2H B;  1GVP A;  1IBL Q;  1TWG B;  2BCO A;  1EEI D;  3OWE B;  2QF7 A;  3PIO A;  3UDX A;  5IGD A;  3HOY G;  2K5D A;  2WAQ G;  3HOZ B;  2IY5 B;  1ENC A;  1LM0 A;  4R4Q A;  1PVO A;  5I4D A;  1SMY C;  2I5L X;  4B3M Q;  3KDF A;  4QL5 A;  2EPB A;  4C3H G;  4ZQ3 A;  1C4Q A;  3UE1 A;  3MXN B;  2AUK A;  1VQ5 A;  2B3G A;  4JVZ A;  5IYD G;  1YHQ A;  2CW0 C;  1QZG A;  5DNF A;  2CW0 D;  2CWP A;  4A3I G;  1K83 H;  2K4K A;  1SNQ A;  5M3M B;  2OXP A;  2F0U A;  3MVV A;  5ELB A;  4ZCK A;  2F0P A;  2N49 A;  4B3R L;  1TWF H;  1SRU A;  1VQG A;  2K33 A;  4DV2 Q;  1KRS A;  5M5W H;  2NVX B;  4M8A A;  3CCE A;  2Z4I A;  2JJQ A;  4F8M A;  2EYL A;  4X66 Q;  4JOI A;  5IWA L;  3J80 L;  3W3A A;  1V43 A;  2KJX A;  3K0Y A;  1YJW A;  3K80 C;  4TSS A;  4KN4 C;  2H5X A;  3CQZ H;  1U4L A;  1D5M C;  2WKD A;  2SDF A;  4DNR B;  1EYC A;  5AFW A;  4Q5V A;  1WTQ A;  2O5J C;  2NWG A;  5EBD A;  2QEX A;  4L6T B;  2OQK A;  4OEL B;  5E3F A;  5IGB A;  1FJG Q;  1Y8P B;  4JW0 A;  1TS3 A;  3V96 A;  4DK1 A;  5C0X I;  5HUR A;  1D7Q A;  3K0X A;  4ME5 A;  4DV1 Q;  2VQF L;  4ZKC B;  3HZX A;  1EEF D;  3PO2 H;  4KHV A;  1UUP A;  2NVQ B;  3R8B A;  4DXF A;  1K8O A;  2LMC B;  3D8G A;  3M4P A;  5IP7 H;  1J6Q A;  1EY0 A;  1EQQ A;  1FD7 D;  4ODG A;  3UDF A;  4YY3 L;  2ZJR A;  2YU9 H;  4K2K A;  4GLX A;  5FO9 B;  5C3X A;  4DK0 A;  2VXW A;  2JP1 A;  3DWP A;  1EYA A;  1C9O A;  1BBU A;  3OSO A;  4S3S A;  1QCB D;  5TSS A;  1QWY A;  4KTA A;  4FVM A;  3FKI H;  1YI2 A;  3H94 A;  3TP7 A;  1EQT A;  3B6Y A;  2F0F A;  3S14 B;  1RJT A;  2L11 A;  2JYO A;  4CKC A;  4B3R Q;  3J7A V;  3PGZ A;  1EIG A;  2V4D A;  3NPP A;  1N34 L;  4A3G B;  1YEZ A;  1G6Z A;  4NMZ A;  1U4R A;  2NZ1 D;  2F0I A;  5ELD A;  5IWA Q;  4LUO A;  1C7Y A;  3J7A F;  2YV5 A;  4KV6 A;  3UDG A;  2DNE A;  4A3J H;  1TWH H;  1I50 B;  4KKU A;  1JOO A;  4KK7 A;  5IGG A;  1EU4 A;  3EBE A;  5CC4 A;  1YJ9 A;  1PH5 A;  1MKH A;  2BH8 A;  4KLK A;  3F8T A;  1QVF A;  4L63 B;  5BR8 L;  2EYH A;  1VQC A;  4LF4 Q;  3X3N A;  1BQQ T;  3D4R A;  2VQF Q;  2IPK D;  3RR5 A;  1LTR D;  4JBK A;  3VA5 A;  1U5K A;  1SN8 A;  4OHJ A;  2KBN A;  2F1M A;  3CPF A;  4JG2 A;  2K04 A;  4K8J A;  4G7Z C;  4C3H H;  3HOU G;  2Q8R E;  1UNS A;  1JCK B;  1X32 A;  2E5L L;  1E24 A;  1GUO A;  1YHB A;  4CJ1 B;  2I5H A;  1EYG A;  4YY3 Q;  2ZTE A;  2DJF C;  3STB C;  2UUC Q;  4OWT B;  3STB D;  2FJ2 A;  1IYV A;  4DGZ A;  1TS2 A;  4A3I H;  4DR1 Q;  2ICI A;  4GLV B;  1VQN A;  4TQU S;  2OEO A;  5COY A;  5CV7 A;  4A3K G;  1D2B A;  4NPS A;  3S1M B;  1DXM A;  2ASB A;  3KJP A;  3I4M B;  3OW2 A;  2JA8 G;  3GDE A;  4OEM B;  1KRT A;  2IW3 A;  4RCN A;  4OO1 G;  2RHQ B;  3GD7 A;  3M4O B;  2M2L A;  5BN4 A;  3LGJ A;  4RHS A;  1B9M A;  1VQJ A;  3K5M A;  4ULL A;  2QCP X;  4I7Z C;  2PI2 A;  5IIF A;  1N34 Q;  1VMP A;  2NZH A;  3G7L A;  1DGS A;  1Q1B A;  5FJ8 G;  1MJC A;  2SNM A;  1EWI A;  3PUZ A;  5ELE A;  4A3B G;  4Y7N B;  3S1R H;  1L0W A;  1FGU A;  4X65 L;  4UP7 A;  1WTO A;  3QR8 A;  4JI7 L;  2F52 A;  3OHX C;  3J81 E;  2MO0 A;  2JA7 B;  4HSV A;  2VUM G;  3NTH A;  5GAG C;  1F9S A;  1ROD A;  2KUM A;  3K7A H;  5BR8 Q;  3BDL A;  1I3Q B;  1PZJ D;  2Z6K C;  3EQL C;  3J80 c;  5CR3 A;  1ASY A;  2IT1 A;  2G9H D;  4U67 3;  3DMU A;  1ILP A;  2E2J H;  4ZUJ A;  4N8X 1;  3SK4 A;  4IUP A;  3MFY A;  3CC7 A;  4DV7 L;  3EVQ A;  1LT3 D;  1RTO A;  2AKW B;  3G48 A;  1SE3 A;  5C0X G;  4MNO A;  2B39 A;  5JPM C;  2E5L Q;  1EU3 A;  1A2U A;  2IHE A;  1UE7 A;  3WDN A;  3ULP A;  4FF1 A;  1DON A;  1SE4 A;  1XWE A;  1Q3L A;  2XRQ D;  2BOS A;  2KCT A;  2IX0 A;  1EFI D;  3BS1 A;  3G4S A;  2YTV A;  1JOR A;  5JJZ A;  5KIX A;  1TWC B;  3I55 A;  1PYW D;  2VY3 A;  3SVM A;  3PIP A;  4RFB A;  1A8V A;  4GS3 A;  3CXC A;  2PMZ E;  1B9N A;  3AEV A;  5FLM G;  1LAC A;  4DXG A;  4DV0 L;  1S4Z A;  3M4Y A;  1PH3 A;  1M1K C;  4LJZ C;  4GN3 B;  3CCQ A;  4LF7 L;  2RBM A;  1EWC A;  3EIV A;  4X65 Q;  1Y1W G;  2Q8T A;  4JI7 Q;  5EAY A;  3GO5 A;  1Z6H A;  1OXU A;  3TSS A;  1Q12 A;  2MPM A;  2B63 B;  5FKA C;  2WB1 G;  1V8Q A;  2OCE A;  1V9P A;  3FMC A;  2WKC A;  4I65 A;  1LLR D;  3D3R A;  1PA6 A;  1F9Q A;  1I94 L;  2OT2 A;  4DR3 L;  2LS0 1;  2L1B A;  1F2Y A;  2XNA C;  3U58 A;  3TP5 A;  4LF5 L;  1JJC B;  3HOU H;  3MZ5 A;  2F0Q A;  1A3U A;  2JEB I;  2RA4 A;  3PSI A;  4O2D A;  2Q2I A;  4RG1 A;  4DV7 Q;  3AB9 A;  2BDN A;  3MEF A;  2CKZ B;  1WTV A;  2I5M X;  1B3Q A;  1I4G A;  3U9S A;  5FLX E;  1E1T A;  1Q1E A;  4LF9 L;  1X3P A;  4A3K H;  1X54 A;  2AWO A;  4AH6 A;  2AQ2 B;  4XYQ A;  4DKA C;  3F2C A;  3S17 B;  2C5C A;  2R93 G;  3GTL B;  2OTJ A;  4LUV A;  3KBG A;  2FXQ A;  2JA8 H;  1PH8 A;  4WOR A;  3TRE A;  4PMW A;  4OO1 H;  2B2V C;  2PYK A;  4R4T A;  2Q2T A;  1GD7 A;  3ND9 A;  4DN4 M;  3OPO A;  3T56 B;  3RZD B;  1F9P A;  3RZO B;  2V1C C;  1VQ8 A;  1GUG A;  1VQK A;  5FJ8 H;  3KYH C;  4A3B H;  1D8L A;  2KA7 A;  5FO7 B;  2K7V A;  2UXB L;  1WTP A;  5JJL A;  4EQP A;  2K50 A;  4IUQ A;  4LF7 Q;  5A2Q E;  1BCP F;  2A5H A;  4JI5 L;  2VUM H;  2DN8 A;  1HNZ L;  2HIX A;  2A6H D;  3S1N H;  3P7J A;  5H1S E;  1PYB A;  1I4H A;  3S2D H;  2FIN B;  1JJG A;  4POF A;  1H9K A;  3G6J B;  5CV8 A;  2B2Y C;  1I94 Q;  4A3D B;  3CP0 A;  4XQJ A;  4DR3 Q;  2KCC A;  2HD3 A;  4K8I A;  2PQE A;  1VQM A;  1MGS A;  1RD9 D;  3BZK A;  1JR0 D;  1SYF A;  4OIJ A;  1O80 A;  3VA7 A;  2B2T A;  1T5E A;  4DAY B;  5C3E G;  5C0X H;  1C48 A;  3VYU A;  1KQS A;  3HRZ C;  5G3L D;  5IT9 E;  1WD0 A;  1K0S A;  4FNF A;  5EGT A;  1GUS A;  4HMI A;  1L1O C;  4EX5 A;  4KJO A;  2KHS A;  4LF9 Q;  1ZKO A;  4RGO S;  3R2I A;  3HOX G;  4A3F G;  1L1O B;  5IGF A;  3N6R A;  2LKV A;  1K8A C;  1VS0 A;  4X3S A;  2R92 G;  4DV6 L;  3HEJ A;  5HGT A;  1TWA B;  3H3V I;  1IW7 C;  1SMX A;  1UE1 A;  1IW7 D;  2Z0S A;  3IRB A;  5CV9 A;  1AZQ A;  2F4V Q;  3MFG A;  2NVT B;  5FLM H;  2GA4 B;  3J7Z C;  1JWS D;  1KDA A;  4X62 L;  1E2V A;  5C6A A;  1EUJ A;  1CFM A;  1TS5 A;  1SFO H;  1KD1 C;  1NUC A;  5EKI A;  1Y1W H;  4YWL A;  5NUC A;  4GNX A;  2UXB Q;  4A93 B;  1UE5 A;  1PZI D;  3R2T A;  4LFB L;  2EYP A;  5CMD A;  3DM3 A;  5EPK A;  1I6H H;  3J81 c;  2B2W C;  3TS0 A;  1HPC A;  4JI5 Q;  1HRJ A;  1PTO F;  1UAP A;  1HNZ Q;  1JT8 A;  5C4Z A;  3MA2 B;  4GLA C;  1MBY A;  5J1Z A;  1TT2 A;  1QVG A;  4KY6 A;  3P75 A;  3HOW B;  1HZ9 A;  3H6M A;  4JI8 Q;  4X3K A;  5DLQ E;  1F2L A;  2Y0S G;  5KRU A;  1QNU A;  1FNV A;  1B3A A;  3CAM A;  2UU9 L;  1WI5 A;  3MXN A;  2QDL A;  2HT1 A;  2KEE A;  1CUK A;  2RCF A;  4YHH L;  4JI4 L;  4DUZ L;  3Q8D A;  3S15 H;  2HHH L;  4DR6 L;  1HZB A;  1NMF A;  5A35 A;  4O0A A;  3H91 A;  2R93 H;  2LY7 A;  5K36 H;  1STY A;  2EJF C;  3DLL A;  1LTL A;  1G91 A;  2K5Q A;  1SYD A;  1SNP A;  2Z4H A;  1O7Z A;  2ZTD A;  1VF5 C;  1R4Q B;  2PZU A;  1NJI C;  4DV6 Q;  1OXX K;  1Y1V G;  1ZXT A;  4YIJ A;  1Z9F A;  2L5T A;  1E7Z A;  3U9O A;  1YZ6 A;  3ULL A;  3PO2 G;  1CZW A;  5M3F B;  2EZV A;  1PFN A;  3LWE A;  3SK8 A;  4X62 Q;  4AYB G;  2K05 A;  3M7N A;  1X56 A;  4A3E G;  1W3S A;  4LFA L;  1PLF A;  4DPG A;  4EGV A;  2K52 A;  4C1N I;  5IOC A;  4LFB Q;  4K5X A;  2PMZ B;  2XSC A;  3DWQ A;  1EOV A;  4CDC C;  2PO4 A;  4Z9C B;  3M85 A;  1N8R C;  2XVS A;  2R7D A;  1XPO A;  3CC4 A;  2A19 A;  3KUP A;  3TRZ A;  3HOZ G;  3CHB D;  4BY1 B;  1VQP A;  1SYG A;  2MUY A;  3A56 A;  4LMQ D;  4DA2 A;  1E2W A;  3RUZ A;  1FYC A;  5C3E H;  1HA6 A;  1ICW A;  2KED A;  2UU9 Q;  3H0G B;  3BU2 A;  5LMN L;  4HCS A;  2L0C A;  3VR4 A;  1X3E A;  1PZK D;  2H1E A;  4GN4 B;  4YHH Q;  1JOK A;  1STG A;  2XTI A;  1UEB A;  4DUZ Q;  2HHH Q;  4DR6 Q;  2P5Z X;  3GV6 A;  5M3M G;  2FHT A;  1G51 A;  5CYU A;  3HOX H;  4A3F H;  2WP8 J;  1DJR D;  1NBW A;  1F2Z A;  3M4Q A;  3W2D A;  5EJW A;  2R92 H;  3GTG B;  2RSN A;  1CA6 A;  1ICF B;  5COR A;  5HY6 A;  3PUW A;  1VQA A;  4R9W A;  1CI3 M;  3SK5 A;  2RCN A;  3VYT A;  2MO1 A;  2IL8 A;  4DR7 L;  4HJ9 A;  1A6X A;  2VS1 A;  1I4P A;  2J7Z A;  2KCN A;  4IUV A;  3QWN A;  1SJH D;  2EXZ A;  2ZXO A;  2KHI A;  3TZD A;  1TII D;  1SNM A;  3D6W A;  4LFA Q;  3GTP B;  1D6E C;  1ET6 A;  4OO1 I;  2E2I B;  4QB4 A;  3GTQ H;  1VQD A;  1C8C A;  4NKL A;  1GJX A;  3P1H A;  3L3O C;  2KQ3 A;  1K8G A;  3NE5 B;  3PIO 3;  2K5N A;  2NB0 A;  2XIW A;  1AEX A;  5I2Y A;  3UDI A;  4E6I A;  5C5L A;  4WRD A;  4P74 A;  1EY4 A;  2E2D C;  2K5V A;  1C0A A;  1GXD C;  3BDO A;  4N9T A;  4HIM A;  1VQL A;  1KDC A;  2IJ0 A;  5ELF A;  3L2P A;  4KKS A;  1JJ2 A;  5LMN Q;  1GKH A;  3K58 A;  4WJ4 A;  1JMC A;  1NNX A;  2C9O A;  2SOB A;  2NVY B;  2HDL A;  3E9I A;  1LTI D;  3HG9 A;  1Z7T A;  4J6H A;  4QF4 A;  4K2L A;  4K5V A;  1AE3 A;  1WTX A;  4BA1 I;  2A73 B;  1EQR A;  4RGN A;  2IWH A;  1IL2 A;  3FRP B;  3BVG A;  3CW2 C;  1DOM A;  4PZ7 A;  3W1G A;  4JBM A;  2R7Z B;  4A3G G;  4LF4 L;  1Y1V H;  2PQA A;  2NBF A;  3HOY B;  2F3I A;  4L5R C;  2RF4 A;  1IXR A;  2B8G A;  1U4P A;  4DR7 Q;  1VQ4 A;  4G7O C;  1DOK A;  3A7A B;  3T4A C;  5M5X B;  1QUQ B;  2EY1 A;  2MGS A;  3T1H Q;  4A3E H;  4DR4 L;  5I6Y A;  3IFT A;  4LAA A;  4KKT A;  3S16 H;  3A8K E;  4TKO B;  4DAV A;  2UUC L;  2K01 A;  3S2H H;  1TWG H;  3PV0 A;  4DV5 L;  4DR1 L;  4NXM L;  1QZH A;  3KJO A;  1W6K A;  3KF6 B;  2EY6 A;  1TY0 A;  3NXW A;  1MJE A;  1IKM A;  1GHK A;  3ERQ A;  1F2M A;  3HOZ H;  1NY4 A;  2VZA A;  4IPC A;  4B9W A;  3BYY B;  3MHB A;  3Q24 A;  1TQO A;  2RHS B;  2Z6K A;  1AZP A;  1H9M A;  4ZAI A;  2ZXP A;  4MTK A;  5E7N A;  4ABN A;  4LF6 L;  1EIH A;  4OXP A;  4LNQ A;  3F2B A;  3S1R B;  3TME A;  3S1Q H;  2NTT A;  5M3M H;  1PH6 A;  5KYL A;  2UUA L;  1CZG A;  1AH9 A;  2CWA A;  4RH6 A;  5IYB G;  2CH4 A;  3K7U C;  3ERS X;  3KOJ A;  3I4M G;  3HKZ E;  1E22 A;  2DY7 A;  4QUF A;  4R1J A;  1L0X B;  5D3D A;  2LXK A;  2NVX H;  1XMQ Q;  4IUU A;  1S72 A;  1B50 A;  1RL2 A;  1CKN B;  1XPR A;  2PW5 A;  4Q0F A;  2BDO A;  2I0Q A;  2R7F A;  1WOC A;  1AW7 A;  2F3V A;  1H95 A;  2HCC A;  1U4M A;  2D5D A;  4IUR A;  3U4V A;  3VR3 A;  2JA5 B;  2PNR C;  4X6A H;  4ZRZ A;  1R9T H;  3KDF B;  1Y14 B;  4DR4 Q;  3HOV B;  3PF5 A;  4IUT A;  3BYT B;  1STE A;  2D0O A;  3C46 A;  2JA7 G;  4IFD G;  5CV4 A;  3H3V H;  3NQT A;  2F0W A;  5GRO A;  4DV5 Q;  1PFM A;  4NXM Q;  1HUM A;  2NVQ H;  1O7I A;  2K5H A;  5C4J B;  3G71 A;  3RN2 A;  2EJM A;  5FK9 C;  1Q8K A;  4CDD C;  4JOI C;  4P72 A;  4PQX A;  2L12 A;  1PH2 A;  1X6O A;  3D0F A;  4UP9 A;  1YVC A;  1GOZ A;  2F0K A;  1LAB A;  2J4X A;  1DYQ A;  4YWM A;  2Q8I B;  1PYS B;  4BBS B;  3NBI A;  4NW2 A;  1EWH A;  4CJ2 C;  4DR5 Q;  1A3V A;  3JAM E;  4LF6 Q;  5D14 A;  3T53 B;  1YIJ A;  1KIX A;  4QY7 A;  3S9W A;  5JVG 3;  4PZ6 A;  1RHP A;  2UUA Q;  3I4N B;  3S14 H;  1K73 C;  2CHB D;  1I4Q A;  1M8A A;  3GTO B;  1TY2 A;  2EYM A;  4A3G H;  1T5X D;  2OTL A;  1N32 Q;  2B2V A;  4DU9 A;  1CKO A;  5E1F A;  1O78 A;  3F2D A;  1AE2 A;  3K5O A;  3URY A;  1HCZ A;  2F03 A;  1KAW A;  4B9X A;  4H44 C;  3C1F A;  4RA8 A;  4DFA A;  1Q90 A;  3NQI A;  1K28 A;  2HQL A;  4BY7 B;  1JB3 A;  3E9H A;  3L7Z C;  3MXP A;  1PHJ A;  4UDU C;  4HJ5 A;  3M9B A;  2LSS A;  4H0L C;  3CC2 A;  4C3J B;  1BVS A;  1R4P B;  4IPD A;  3AU7 A;  1BDO A;  3P20 A;  2L55 A;  2XWJ B;  1RKN A;  2R6G A;  2O5I C;  2X6G A;  3CD6 A;  4DK6 C;  2D62 A;  2B8F A;  1LO5 D;  1U9R A;  2WV6 D;  4EQO A;  1A0I A;  4JK1 C;  4EQ5 A;  2B2Y A;  3IFD A;  3J81 L;  4DAY A;  1P8L A;  4R4C A;  3A8I E;  5IYC H;  3M3Y B;  2MFI A;  3NK9 A;  1LTG D;  3NUC A;  2N3S A;  5C44 B;  3Q0A A;  1PH7 A;  1XXG A;  4IN3 A;  2N88 A;  3IAY A;  3S1M H;  1K0R A;  5IYB H;  2JA9 A;  1L1O A;  4RKL A;  3I4M H;  1LTB D;  2RDH A;  3OYY A;  3J80 i;  3M4O H;  3D31 A;  2E76 C;  2E8G A;  4K0K Q;  1SAP A;  4UAI A;  4GKK L;  4A3C G;  3KF8 B;  2O2L D;  4HSP A;  4KN7 C;  3PIP 3;  1A2T A;  2EQS A;  2RVL A;  1GM5 A;  3VYS A;  1Q8I A;  2K14 A;  2YYZ A;  4Y7N H;  3A8J E;  4RCO A;  4R4I A;  1SBB B;  4BBR B;  3PQI A;  3I4L A;  2EIF A;  5JOB A;  4A75 A;  1UWV A;  3NTK A;  5DAU A;  1S5F D;  3K8A A;  1QJO A;  3A54 A;  1WD1 A;  2JA7 H;  4IFD H;  2HIV A;  1HQM C;  4FO2 A;  1WTR A;  1S5D D;  3NEN A;  1I3Q H;  1NAP A;  2B2W A;  5DEH A;  4CGY B;  3WWV A;  1NR2 A;  1WCM B;  2VB2 X;  4UY8 C;  1VQ9 A;  3AYH B;  1SSO A;  4HN7 A;  5K36 G;  3ONA B;  5IOD A;  4A3D G;  3GTM B;  4A4I A;  2OWO A;  1HR0 W;  2TMP A;  3DUZ A;  1G8Z D;  3PMF A;  2RQX A;  5EKK A;  2CQO A;  4CHT B;  1ZEQ X;  2F4V L;  2DGY A;  3MTS A;  1SND A;  4LK1 C;  2IX3 A;  1LTA D;  5JEA G;  4C2M B;  3ERO A;  1G2T A;  3SEB A;  3QOJ A;  2F0H A;  1JOQ A;  2MQH A;  5I9P A;  1VF7 A;  3IL8 A;  3OOC A;  1HNX L;  1TWC H;  4MZ9 A;  3GP7 A;  3AFP A;  2I46 A;  1RF2 D;  4NB3 A;  1PXU A;  4QQB X;  4POG A;  2F0N A;  2Z9H A;  2E2H B;  4GKK Q;  2A6H C;  1BOS A;  1I6V C;  3KBX A;  3X3M A;  3K59 A;  1STH A;  5FLX L;  3FDT A;  2JA6 B;  2D0P A;  1XPU A;  1G29 1;  4A3M B;  3ITP A;  2B2U A;  2G9D A;  4JI8 L;  5CBE E;  3HKZ B;  4OWW B;  4JI2 L;  1BO0 A;  3K6O A;  3E6Z X;  5C5M A;  5JJK A;  2EYJ A;  1E2Z A;  1ZYR C;  3GTJ B;  1ZYR D;  1TXY A;  2IX1 A;  1HHV A;  1S5E D;  5T1I A;  2F4I A;  2K03 A;  1XYI A;  3KFU A;  4KHP L;  3M7G A;  3PO3 B;  2B63 H;  3E0J A;  5JJI A;  3V2T A;  4F88 A;  3I72 A;  4MN3 A;  5D3I B;  5JAV A;  2A8V A;  3CRK C;  4GOP C;  4C3I B;  5C4X B;  2F3W A;  3BZC A;  2PCF B;  4JPB W;  2WAQ E;  3HOW G;  5BN5 A;  3CCR A;  3ND8 A;  4JI1 L;  4CDF C;  5EKL A;  4G57 A;  5C4H A;  4GOP B;  1Q46 A;  5A2Q L;  1Y69 U;  3A55 A;  2VB3 X;  5I2X A;  1LTT D;  3TQY A;  3DHQ A;  5LL6 X;  4PZ8 A;  2MP1 A;  1DZ1 A;  1V1P A;  1BBW A;  5IY0 A;  1SXT A;  4HIK A;  1KC8 C;  3A74 A;  3ZJY C;  4YCV A;  5IGE A;  1XNR Q;  2WIN B;  3I3C A;  4IFD J;  3S17 H;  1J9O A;  5HGQ A;  3NTI A;  5EPL A;  1YNJ C;  3GTL H;  1YNJ D;  1KLU D;  1ENA A;  1VQI A;  4XQQ A;  1II3 A;  3BZD B;  4FXK C;  5LL6 S;  4DAP A;  2Q2U A;  4NDX A;  5M9O A;  1HNX Q;  2F0S A;  4A3C H;  4O1N A;  3RZD H;  1K3R A;  1YJN A;  3RZO H;  5IT9 L;  4NP5 A;  1O7L A;  3LNN A;  1MSH A;  4HMJ A;  5M3F G;  2A74 C;  3I73 A;  4L5S A;  3W5O A;  3J7A 5;  4YCU A;  4IJL A;  3Q6S A;  2GVA A;  1AFP A;  2F0M A;  1QG7 A;  4JI2 Q;  4C1N K;  1PV4 A;  3E5S A;  3OIQ A;  4IPG A;  2F0L A;  4QCL A;  3GTK B;  4KHP Q;  5BN3 A;  1M4V A;  5IP9 G;  1I4R A;  5K5P A;  2JE6 I;  4CKB A;  3EA6 A;  4HJ7 A;  4A3D H;  4BY1 G;  3OMC A;  3NHH A;  4JI1 Q;  2BE5 C;  2BE5 D;  4RGT A;  3J81 j;  4X3T A;  2OF1 A;  3H0G G;  4BXX G;  2Q2H A;  4J8Q A;  3BVM A;  4QJF A;  1GO3 E;  1HFG A;  2J0T D;  2D9U A;  1N36 L;  4FYD A;  1STB A;  5JEA H;  1WFQ A;  1AN8 A;  2DY8 A;  3BVZ A;  3J81 i;  2EJG C;  3FP9 A;  3TEH B;  1GUT A;  4J1M A;  1TU2 B;  2YTY A;  2L15 A;  3K81 C;  4GN5 A;  3SR1 A;  5I6W A;  4HIO A;  1XX8 A;  3I7F A;  4MIU A;  4A3L G;  1FVI A;  1XMO Q;  5T1G A;  1TWA H;  1BNZ A;  2ZJQ A;  2BA0 A;  1Y8N B;  1JE4 A;  3OTO Q;  1K83 B;  4DV3 Q;  3VR5 A;  2NVT H;  1PRT C;  1XTC D;  1PRT D;  1OXS C;  1QUQ A;  2B2T C;  2RSO A;  4H7B A;  1TWF B;  4A93 H;  1PRT B;  3KLS X;  5M5W B;  4R8I A;  2VL6 A;  4P2C B;  4XYO A;  4KHZ A;  1M90 C;  3TP6 A;  4IOC A;  5FLX c;  1BR9 A;  3CQZ B;  1VQF A;  2JSO A;  1A63 A;  2FFK B;  1SNO A;  4KY5 A;  1B4O A;  3HOW H;  4ZUI A;  2N55 A;  3ER0 A;  4PNY A;  4P71 A;  1PH4 A;  1W6J A;  2A6E C;  2A6E D;  4IO9 A;  1IHZ A;  1PH1 A;  1HA5 A;  4IFD I;  2HUG A;  1NE3 A;  3NEL A;  1JWM D;  4PMB A;  3PO2 B;  3CMA A;  3L0O A;  1H9J A;  1N36 Q;  4B3S L;  3T1H L;  1NSN S;  4RGM A;  4AYB B;  1KAA A;  3PUV A;  3QIA A;  4LF8 L;  4KMU C;  4K6D A;  1H9S B;  1VQH A;  2YU9 B;  3VR6 A;  5E4W C;  4ME3 A;  2GVB A;  1OO9 B;  1HNW Q;  3D6C A;  4JI3 L;  1CKN A;  1F77 A;  2FMC A;  2R7Z G;  4M1U B;  3J80 E;  5L37 A;  1VQO A;  1UE6 A;  1KXL A;  5M5Y H;  3FKI B;  5I9O A;  3HP3 A;  2A69 C;  3U50 C;  3WOE A;  2A69 D;  3ULJ A;  5M3F H;  1HQR D;  2QDB A;  5GQO A;  1B70 B;  1I4X A;  1SMY D;  1NCV A;  2Z1C A;  4L5Q A;  5JEA J;  1Z47 A;  2XGT A;  2CFM A;  2K6A A;  5C3W A;  3CCU A;  3K57 A;  1PTO H;  4LW1 A;  4BA2 I;  3QOL A;  4APV A;  1JC7 A;  2N8N A;  3OIP A;  5JPN C;  4A76 A;  3CCJ A;  1X9N A;  5IP9 H;  5IT9 c;  1PH9 A;  4DF7 A;  3NWT A;  3S1Q B;  1VMC A;  1S5B D;  1G6P A;  1N33 Q;  2AQ1 B;  4BY1 H;  1STN A;  1TWH B;  4A3J B;  5ELO A;  2OQ0 A;  4L8J A;  1EL0 A;  1ML0 D;  1ESR A;  1QOH A;  4UP8 A;  1J5E L;  1XMQ L;  2AMC B;  3FHW A;  1E1O A;  1A3T A;  2F0T A;  2MJ8 A;  4XTC S;  3H0G H;  4BXX H;  2F0D A;  3RN5 A;  1T9H A;  4IOA A;  3SK6 A;  2WAQ B;  4K6L A;  2XN9 C;  3F1Z A;  1CM9 A;  3KLR A;  2EY2 A;  4OIK A;  4B3S Q;  1G2S A;  4XT3 B;  3H3V C;  2CH4 W;  1R9T B;  1L0Y B;  3SE0 A;  1J8I A;  5E4X A;  4K5W A;  1MHW C;  4C3H B;  4LF8 Q;  3CRL C;  4A3L H;  4P73 A;  1PFS A;  3GTG H;  2M9V A;  1Y8O B;  1GUW A;  2A1A A;  2E74 C;  4A3I B;  4PMC A;  1IL8 A;  4JI3 Q;  2PI2 E;  3A7L A;  4ZKB B;  2QA4 A;  2TSS A;  4FDB A;  5J22 A;  3OWF A;  2JA5 G;  3CKI B;  2PZT A;  1IZ6 A;  2YTX A;  3TDQ A;  1CSP A;  4H02 A;  4GKJ L;  3GTP H;  2E2I H;  3HOV G;  1KAB A;  2L9H A;  4AIM A;  3S24 A;  1P16 A;  4DR5 L;  4WJ3 M;  5IYC G;  3I8Z A;  3OW7 A;  3TP8 A;  2F0E A;  4HJ8 A;  3NBH B;  2H4O A;  5CGK A;  1B7Y B;  2WB1 E;  2K32 A;  4OON A;  1F9R A;  4F87 A;  4GZY C;  5LMU L;  2K28 A;  2UUB L;  3E3X A;  1LT6 D;  3KLW A;  3RLF A;  4PG3 A;  3DWA A;  1ENF A;  2I07 B;  2EE1 A;  2EYF A;  1SJE D;  1J5E Q;  3R93 A;  1MIU A;  4PV1 C;  4B3T L;  1N32 L;  1ASZ A;  5CV6 A;  4MHE A;  1L2F A;  3NEM A;  4BBS G;  4QMG A;  3K7A B;  1D1K A;  5F2D A;  4HCE A;  3JC6 6;  2NVY H;  3CCM A;  1FGB D;  3GQB A;  1E0B A;  5ELN A;  2E2J B;  1EY6 A;  3C1E A;  4DK3 C;  2VW9 A;  3I4N G;  1ONL A;  1RDP D;  3PUX A;  3TS2 A;  1K9M C;  4JI6 L;  3EFX D;  4H13 C;  2K1B A;  3WOF A;  1VQB A;  3KF8 A;  2R7Z H;  1RCV D;  2QIL A;  2JXM B;  1YBY A;  3K5L A;  3H15 A;  3HOY H;  3MXU A;  3MC0 B;  1IKL A;  3L9A X;  3GV3 A;  1U0L A;  4JBJ A;  1JE5 A;  1B8A A;  5J39 A;  3MWY W;  2CVR A;  3SDZ A;  3TZU A;  5KGU A;  2EY5 A;  2ZXR A;  1K8M A;  5M5X H;  4X64 L;  3C2P A;  1CHP D;  2KEC A;  2PPB C;  2NTS A;  3QJY A;  1EY8 A;  1PDQ A;  5AJ3 L;  4BY7 G;  4GKJ Q;  1D5X C;  1NMG A;  1LT5 D;  3NSW A;  5IYD H;  3CPW A;  2JN4 A;  3I4O A;  4C3J G;  3C3L A;  1EOT A;  2F0J A;  3DEO A;  3N52 A;  1LTS D;  5D65 A;  4KD3 A;  3CCL A;  2SNS A;  1YIT A;  1HXY D;  1EIF A;  5LMU Q;  2UUB Q;  2SEB D;  2NYZ D;  1QE6 A;  5KNC A;  4FF2 A;  4K0K L;  1EFW A;  1XNQ L;  1DM0 B;  3OMG A;  2D2C C;  3UI2 A;  4B3T Q;  2PQA B;  1SLJ A;  1JWU D;  2LFN A;  4RWS C;  1B53 A;  5C44 G;  4QUC A;  4G4K A;  1MI2 A;  1XJV A;  1WTW A;  3HFZ B;  4LWC A;  2JEA I;  4CDE C;  2NN6 I;  4I7A A;  2DUD A;  1RTN A;  1WTH A;  4LFC L;  1I50 H;  1A62 A;  1N9W A;  4FF3 A;  3HOU B;  1V1O A;  3FEW X;  4RKB A;  5IGC A;  4JI6 Q;  4XDX A;  3HS0 C;  1EYD A;  1LV9 A;  4FXG C;  1CHQ D;  2NUC A;  3Q23 A;  3JAM L;  2B63 G;  4A3K B;  1LT4 D;  2AUJ D;  1X3Q A;  3AMU A;  1QIL A;  2RKS A;  3HGB A;  2JA5 H;  2JA8 B;  5FOB B;  5KND A;  1BUV T;  2ENB A;  4BBR G;  4X64 Q;  3W1B A;  4ILW A;  4OWX B;  1KL9 A;  3HOV H;  3FPU B;  1BXT A;  1HZC A;  1K3B C;  5GAD C;  2EYO A;  3QO2 A;  5AJ3 Q;  1CA5 A;  3D4W A;  1JB7 A;  1HTL D;  3SHL A;  5KEE A;  2VNU D;  1FR3 A;  2K75 A;  4A3B B;  3TBI B;  3T51 B;  4IZ8 A;  3G6E A;  4HAE A;  5DM7 3;  5C4J H;  1WCM G;  2MNA A;  5FO8 B;  2F0O A;  4GOP A;  1EQV A;  1KNE A;  2O4X A;  2Y0S E;  1EY7 A;  2VUM B;  4UHV A;  2NZO A;  1OXV A;  3CCV A;  4JCV E;  1IYU A;  2FMM A;  4BBS H;  2HQE A;  2K5W A;  1Q86 C;  4JC0 A;  1XNQ Q;  4Y52 H;  2X69 A;  3S1N B;  3EN2 A;  1X3F A;  2JQO A;  3S2D B;  4HR7 B;  2UXD L;  4BWG B; 
#chains in the Genus database with same CATH homology
 2CQA A;  1HUN A;  4OL7 A;  3NP8 A;  2QEJ C;  3FPP A;  1AP0 A;  3QG1 A;  4F7X A;  4ZLT F;  4ID6 A;  1TR5 A;  4C56 C;  3DEP A;  1PFB A;  4ZYS A;  3KK7 A;  2E75 C;  4KI0 A;  3I70 A;  3QB3 A;  1B2T A;  3RD4 A;  1DCZ A;  4K14 A;  4V0B A;  1H9R A;  5G3L F;  5CBA E;  1GUN A;  4RHR A;  2R61 A;  1B44 D;  2MHV A;  1SYB A;  4N9P A;  1OXT A;  4EVO A;  1SNC A;  2KOL A;  3R3O A;  3FVQ A;  1BF4 A;  3D4D A;  2F0V A;  4C3I G;  3LWU A;  4KY7 A;  1SFO B;  4FF4 A;  2X6L A;  1SDF A;  1Y1W B;  4FP5 D;  2AQ3 B;  3LX0 A;  5EPJ A;  4V19 0;  1I6H B;  2DNC A;  3O13 A;  4RAU C;  2WB1 B;  4B08 A;  3DM1 A;  2Z8L A;  5CV5 A;  3BDC A;  1EZ8 A;  1KLG D;  1KDB A;  4XT1 B;  3ZYY X;  3VYR A;  1FNU A;  3S15 B;  2R93 B;  4OGQ C;  4ZK9 B;  2NN6 G;  1EY5 A;  1ESF A;  4HED A;  4TRD A;  4WJW A;  1PMR A;  4IUN A;  4XXE A;  1SEB D;  2RDG A;  1DD2 A;  1A15 A;  1EZ6 A;  1KTK A;  2M00 A;  1SYE A;  5ISR A;  3F2U A;  5KNB A;  1TKW B;  1QNK A;  2WII B;  1D1I A;  1ET9 A;  1STA A;  1BCP C;  1BCP D;  4JBW A;  3TN2 A;  1S5C D;  3T16 A;  5DM6 3;  1BCP B;  1BBX C;  2PZW A;  5JVH 3;  3DXJ C;  3T13 A;  2XRS D;  4KD4 A;  1H9S A;  3BG3 A;  5C3E B;  4U68 A;  1MD2 D;  1PRT F;  1TVX A;  2PW7 A;  1CQF A;  4HTH A;  3MAQ A;  3PUY A;  1SYC A;  3IKJ A;  4KJN A;  5KYI A;  2F0G A;  3HOX B;  4A3F B;  4X3U A;  4R8N A;  1JQY D;  1CK1 A;  3VR2 A;  2R92 B;  1SE2 A;  1ILQ A;  4EQN A;  4FXD A;  2XWB B;  3J7Y W;  1CT1 D;  4CJ0 B;  1UEA B;  3MEH A;  4DNT B;  5EBC A;  1FNW A;  3KLS A;  3Q22 A;  2BA1 A;  3CU7 A;  3GTQ B;  2ZT9 C;  4G7H C;  2B2U C;  4O42 A;  3V05 A;  5M5Y B;  1HFN A;  3NWS A;  5C0X J;  1PTO C;  1PTO D;  2L4N A;  2Y0S B;  2QKI C;  1QB5 D;  1VCI A;  1PTO B;  3K5N A;  2EDG A;  2EVB A;  1B1Z A;  2A68 C;  1O7Y A;  2A68 D;  4WFN 3;  1WVL A;  2HDM A;  3I91 A;  1NR4 A;  2R3Z A;  2AWN A;  1JIC A;  1HTP A;  2ICE C;  1KNA A;  2NN6 H;  4IAL A;  1VDZ A;  1TS4 A;  4BS9 A;  1YNN C;  2KVM A;  1YNN D;  4XQN A;  3SXH A;  3H09 A;  1Y1V B;  2HCI A;  1V1P B;  3NBH A;  1DOL A;  3I90 A;  4QIW B;  3RMH A;  4CBV A;  2WAC A;  1GHJ A;  4XIG S;  4CKE A;  2ID0 A;  3EJI A;  1MSG A;  4A3E B;  1EY9 A;  1D5Z C;  4IQZ A;  1CTM A;  3MXG A;  5LHY 1;  3S16 B;  5EQ0 A;  2EOT A;  5ELC A;  1CQV A;  2RDF A;  3S2H B;  1TWG B;  2BCO A;  1EEI D;  3OWE B;  2QF7 A;  5IGD A;  2K5D A;  3HOZ B;  1ENC A;  5I4D A;  1SMY C;  2EPB A;  4C3H G;  4ZQ3 A;  1C4Q A;  2AUK A;  2CW0 C;  5DNF A;  2CW0 D;  1SNQ A;  5M3M B;  2OXP A;  2F0U A;  3MVV A;  5ELB A;  2F0P A;  2K33 A;  2NVX B;  4M8A A;  2Z4I A;  4F8M A;  2EYL A;  3J80 L;  3W3A A;  1V43 A;  2KJX A;  3K0Y A;  4TSS A;  4KN4 C;  1U4L A;  1D5M C;  2WKD A;  2SDF A;  4DNR B;  1EYC A;  5AFW A;  4Q5V A;  1WTQ A;  2O5J C;  2NWG A;  5EBD A;  4L6T B;  5E3F A;  5IGB A;  1Y8P B;  1TS3 A;  3V96 A;  4DK1 A;  5C0X I;  5HUR A;  4ME5 A;  4ZKC B;  3HZX A;  1EEF D;  4KHV A;  1UUP A;  2NVQ B;  3R8B A;  4DXF A;  1K8O A;  2LMC B;  3D8G A;  1EY0 A;  1FD7 D;  4ODG A;  4K2K A;  5FO9 B;  5C3X A;  4DK0 A;  2VXW A;  2JP1 A;  3DWP A;  1EYA A;  3OSO A;  4S3S A;  1QCB D;  5TSS A;  1QWY A;  4KTA A;  4FVM A;  3H94 A;  3TP7 A;  1EQT A;  2F0F A;  3S14 B;  1RJT A;  2L11 A;  2JYO A;  4CKC A;  3J7A V;  1EIG A;  2V4D A;  3NPP A;  4A3G B;  1G6Z A;  4NMZ A;  1U4R A;  2NZ1 D;  2F0I A;  5ELD A;  3J7A F;  4KV6 A;  2DNE A;  1I50 B;  4KKU A;  1JOO A;  4KK7 A;  5IGG A;  1EU4 A;  5CC4 A;  4L63 B;  2EYH A;  3X3N A;  1BQQ T;  3D4R A;  2IPK D;  1LTR D;  3VA5 A;  4OHJ A;  2F1M A;  2K04 A;  4K8J A;  4G7Z C;  2Q8R E;  1UNS A;  1JCK B;  1X32 A;  1GUO A;  4CJ1 B;  1IYV A;  2FJ2 A;  4DGZ A;  1TS2 A;  2ICI A;  4TQU S;  2OEO A;  5COY A;  5CV7 A;  1D2B A;  3S1M B;  1DXM A;  3I4M B;  2IW3 A;  4RCN A;  4OO1 G;  3GD7 A;  3M4O B;  2M2L A;  5BN4 A;  4RHS A;  1B9M A;  3K5M A;  4ULL A;  2QCP X;  4I7Z C;  5IIF A;  1VMP A;  3G7L A;  1Q1B A;  2SNM A;  3PUZ A;  5ELE A;  4Y7N B;  1WTO A;  3OHX C;  3J81 E;  2JA7 B;  4HSV A;  3NTH A;  1F9S A;  1ROD A;  2KUM A;  3BDL A;  1I3Q B;  1PZJ D;  3EQL C;  5CR3 A;  2IT1 A;  2G9H D;  4U67 3;  3DMU A;  1ILP A;  4ZUJ A;  3SK4 A;  4IUP A;  3MFY A;  3EVQ A;  1LT3 D;  1RTO A;  1SE3 A;  5C0X G;  2B39 A;  5JPM C;  1EU3 A;  1A2U A;  3WDN A;  4FF1 A;  1DON A;  1SE4 A;  1XWE A;  1Q3L A;  2XRQ D;  2BOS A;  2IX0 A;  1EFI D;  3BS1 A;  1JOR A;  5JJZ A;  5KIX A;  1TWC B;  1PYW D;  3SVM A;  4RFB A;  1B9N A;  1LAC A;  4DXG A;  1S4Z A;  3M4Y A;  4LJZ C;  2RBM A;  1EWC A;  2Q8T A;  3GO5 A;  1Z6H A;  1OXU A;  3TSS A;  1Q12 A;  2MPM A;  2B63 B;  5FKA C;  1V8Q A;  3FMC A;  2WKC A;  4I65 A;  1LLR D;  3D3R A;  1F9Q A;  2OT2 A;  2LS0 1;  2L1B A;  1F2Y A;  2XNA C;  3TP5 A;  3MZ5 A;  2F0Q A;  1A3U A;  2JEB I;  2RA4 A;  3AB9 A;  2BDN A;  1WTV A;  1I4G A;  3U9S A;  5FLX E;  1Q1E A;  1X3P A;  2AWO A;  2AQ2 B;  4XYQ A;  3S17 B;  2C5C A;  3GTL B;  3KBG A;  4WOR A;  4PMW A;  4OO1 H;  2B2V C;  2PYK A;  3ND9 A;  4DN4 M;  3OPO A;  3T56 B;  3RZD B;  1F9P A;  3RZO B;  1GUG A;  2KA7 A;  5FO7 B;  2K7V A;  1WTP A;  4EQP A;  4IUQ A;  5A2Q E;  1BCP F;  2A5H A;  2DN8 A;  2A6H D;  3P7J A;  1I4H A;  2FIN B;  1H9K A;  3G6J B;  5CV8 A;  2B2Y C;  4A3D B;  4XQJ A;  2KCC A;  4K8I A;  2PQE A;  1MGS A;  1RD9 D;  1JR0 D;  4OIJ A;  1SYF A;  1O80 A;  3VA7 A;  2B2T A;  1T5E A;  5C0X H;  1C48 A;  3VYU A;  3HRZ C;  5G3L D;  5IT9 E;  1WD0 A;  4FNF A;  5EGT A;  1GUS A;  4HMI A;  4KJO A;  2KHS A;  1ZKO A;  4RGO S;  3R2I A;  5IGF A;  3N6R A;  2LKV A;  4X3S A;  3HEJ A;  5HGT A;  1TWA B;  1IW7 C;  1IW7 D;  5CV9 A;  1AZQ A;  3MFG A;  2NVT B;  2GA4 B;  1JWS D;  1KDA A;  1E2V A;  5C6A A;  1CFM A;  1TS5 A;  1NUC A;  5EKI A;  5NUC A;  4A93 B;  1PZI D;  3R2T A;  2EYP A;  5CMD A;  5EPK A;  2B2W C;  1HPC A;  1HRJ A;  1PTO F;  1UAP A;  5C4Z A;  3MA2 B;  1MBY A;  5J1Z A;  1TT2 A;  4KY6 A;  3P75 A;  3HOW B;  3H6M A;  4X3K A;  1F2L A;  5KRU A;  1QNU A;  1FNV A;  1B3A A;  3MXN A;  2KEE A;  5A35 A;  3H91 A;  2LY7 A;  5K36 H;  1STY A;  2EJF C;  1G91 A;  2K5Q A;  1SYD A;  1SNP A;  2Z4H A;  1O7Z A;  1VF5 C;  1R4Q B;  2PZU A;  1OXX K;  1ZXT A;  4YIJ A;  2L5T A;  3U9O A;  1CZW A;  5M3F B;  2EZV A;  1PFN A;  3LWE A;  3SK8 A;  2K05 A;  3M7N A;  1PLF A;  4EGV A;  4C1N I;  5IOC A;  4K5X A;  2PMZ B;  2XSC A;  3DWQ A;  2PO4 A;  4Z9C B;  3M85 A;  2XVS A;  3KUP A;  3CHB D;  4BY1 B;  1SYG A;  2MUY A;  3A56 A;  4LMQ D;  4DA2 A;  1E2W A;  3RUZ A;  1FYC A;  1HA6 A;  1ICW A;  2KED A;  3H0G B;  4HCS A;  2L0C A;  3VR4 A;  1PZK D;  2H1E A;  1JOK A;  1STG A;  3GV6 A;  2FHT A;  5CYU A;  2WP8 J;  1DJR D;  1F2Z A;  3W2D A;  5EJW A;  3GTG B;  2RSN A;  1CA6 A;  5COR A;  3PUW A;  4R9W A;  1CI3 M;  3SK5 A;  3VYT A;  2IL8 A;  1A6X A;  1I4P A;  2J7Z A;  2KCN A;  4IUV A;  3QWN A;  1SJH D;  2EXZ A;  2ZXO A;  3TZD A;  1TII D;  1SNM A;  3D6W A;  3GTP B;  4OO1 I;  1D6E C;  1ET6 A;  2E2I B;  4QB4 A;  1C8C A;  4NKL A;  1GJX A;  3P1H A;  3L3O C;  2KQ3 A;  3NE5 B;  3PIO 3;  2NB0 A;  2XIW A;  1AEX A;  5I2Y A;  4E6I A;  5C5L A;  4WRD A;  1EY4 A;  2E2D C;  1GXD C;  3BDO A;  4N9T A;  1KDC A;  2IJ0 A;  5ELF A;  4KKS A;  3K58 A;  2C9O A;  2SOB A;  2NVY B;  2HDL A;  1LTI D;  3HG9 A;  1Z7T A;  4J6H A;  4QF4 A;  4K2L A;  4K5V A;  1WTX A;  4BA1 I;  2A73 B;  4RGN A;  2IWH A;  3FRP B;  3BVG A;  1DOM A;  2R7Z B;  2NBF A;  3HOY B;  2B8G A;  1U4P A;  4G7O C;  1DOK A;  3A7A B;  3T4A C;  5M5X B;  2EY1 A;  2MGS A;  5I6Y A;  3IFT A;  4LAA A;  4KKT A;  3A8K E;  4TKO B;  4DAV A;  2K01 A;  3PV0 A;  1W6K A;  2EY6 A;  1TY0 A;  3NXW A;  1IKM A;  1GHK A;  3ERQ A;  1F2M A;  4B9W A;  3BYY B;  3MHB A;  3Q24 A;  1TQO A;  1AZP A;  1H9M A;  4ZAI A;  2ZXP A;  4ABN A;  1EIH A;  3S1R B;  3TME A;  2NTT A;  5KYL A;  1CZG A;  4RH6 A;  2DY7 A;  4QUF A;  1L0X B;  5D3D A;  4IUU A;  1B50 A;  2PW5 A;  4Q0F A;  2BDO A;  1AW7 A;  2F3V A;  2HCC A;  1U4M A;  2D5D A;  4IUR A;  3VR3 A;  2JA5 B;  2PNR C;  4ZRZ A;  3HOV B;  4IUT A;  3BYT B;  1STE A;  3C46 A;  4IFD G;  5CV4 A;  3NQT A;  2F0W A;  1PFM A;  1HUM A;  5C4J B;  2EJM A;  5FK9 C;  4PQX A;  2L12 A;  1GOZ A;  2F0K A;  1LAB A;  2J4X A;  1DYQ A;  2Q8I B;  4BBS B;  3NBI A;  4NW2 A;  1EWH A;  4CJ2 C;  1A3V A;  3JAM E;  5D14 A;  3T53 B;  3S9W A;  5JVG 3;  1RHP A;  3I4N B;  2CHB D;  1I4Q A;  1M8A A;  3GTO B;  1TY2 A;  2EYM A;  1T5X D;  2B2V A;  4DU9 A;  5E1F A;  1O78 A;  3K5O A;  3URY A;  1HCZ A;  2F03 A;  4B9X A;  4H44 C;  3C1F A;  4RA8 A;  4DFA A;  1Q90 A;  3NQI A;  4BY7 B;  1JB3 A;  3L7Z C;  3MXP A;  4UDU C;  4H0L C;  4C3J B;  1R4P B;  3AU7 A;  1BDO A;  3P20 A;  2L55 A;  2XWJ B;  1RKN A;  2R6G A;  2O5I C;  2X6G A;  2D62 A;  2B8F A;  1LO5 D;  1U9R A;  2WV6 D;  4EQO A;  4JK1 C;  2B2Y A;  3IFD A;  3J81 L;  4DAY A;  3A8I E;  3M3Y B;  3NK9 A;  1LTG D;  3NUC A;  5C44 B;  3Q0A A;  1XXG A;  4IN3 A;  2N88 A;  3IAY A;  4RKL A;  1LTB D;  2RDH A;  3D31 A;  2E76 C;  1SAP A;  4UAI A;  2O2L D;  4HSP A;  4KN7 C;  3PIP 3;  1A2T A;  2RVL A;  3VYS A;  1Q8I A;  2YYZ A;  3A8J E;  4RCO A;  1SBB B;  4BBR B;  3I4L A;  5JOB A;  3NTK A;  5DAU A;  1S5F D;  1QJO A;  3A54 A;  1WD1 A;  4IFD H;  1HQM C;  4FO2 A;  1WTR A;  1S5D D;  1NAP A;  2B2W A;  5DEH A;  4CGY B;  1NR2 A;  1WCM B;  2VB2 X;  1SSO A;  4HN7 A;  5K36 G;  3ONA B;  5IOD A;  3GTM B;  2TMP A;  3DUZ A;  1G8Z D;  3PMF A;  2RQX A;  5EKK A;  4CHT B;  1ZEQ X;  3MTS A;  1SND A;  4LK1 C;  2IX3 A;  1LTA D;  5JEA G;  4C2M B;  3ERO A;  1G2T A;  3SEB A;  3QOJ A;  2F0H A;  1JOQ A;  5I9P A;  1VF7 A;  3IL8 A;  3OOC A;  3GP7 A;  2I46 A;  1RF2 D;  1PXU A;  2F0N A;  2E2H B;  2A6H C;  1BOS A;  1I6V C;  3KBX A;  3X3M A;  3K59 A;  1STH A;  5FLX L;  3FDT A;  2JA6 B;  1G29 1;  4A3M B;  3ITP A;  2B2U A;  2G9D A;  5CBE E;  3HKZ B;  1BO0 A;  3K6O A;  3E6Z X;  5C5M A;  2EYJ A;  1E2Z A;  1ZYR C;  3GTJ B;  1ZYR D;  2IX1 A;  1HHV A;  1S5E D;  5T1I A;  2F4I A;  2K03 A;  1XYI A;  3M7G A;  3PO3 B;  3E0J A;  3V2T A;  4F88 A;  3I72 A;  4MN3 A;  5D3I B;  5JAV A;  3CRK C;  5C4X B;  4C3I B;  2F3W A;  2PCF B;  5BN5 A;  3ND8 A;  5EKL A;  4G57 A;  5C4H A;  5A2Q L;  1Y69 U;  3A55 A;  5I2X A;  2VB3 X;  1LTT D;  3DHQ A;  5LL6 X;  2MP1 A;  1DZ1 A;  1V1P A;  1SXT A;  5IGE A;  2WIN B;  3I3C A;  4IFD J;  1J9O A;  5EPL A;  3NTI A;  1YNJ C;  1YNJ D;  1KLU D;  1ENA A;  4XQQ A;  1II3 A;  3BZD B;  4DAP A;  5LL6 S;  4FXK C;  4NDX A;  5M9O A;  2F0S A;  4O1N A;  5IT9 L;  4NP5 A;  1O7L A;  3LNN A;  1MSH A;  4HMJ A;  2A74 C;  3I73 A;  3Q6S A;  1AFP A;  2F0M A;  1QG7 A;  4C1N K;  3E5S A;  3OIQ A;  2F0L A;  4QCL A;  3GTK B;  5BN3 A;  1M4V A;  1I4R A;  5K5P A;  2JE6 I;  4CKB A;  3EA6 A;  3OMC A;  3NHH A;  2BE5 C;  2BE5 D;  4RGT A;  4X3T A;  2OF1 A;  4J8Q A;  3BVM A;  1HFG A;  2J0T D;  2D9U A;  4FYD A;  1STB A;  5JEA H;  1AN8 A;  2DY8 A;  3BVZ A;  2EJG C;  1GUT A;  4J1M A;  1TU2 B;  3SR1 A;  5I6W A;  1XX8 A;  4MIU A;  5T1G A;  1BNZ A;  2BA0 A;  1Y8N B;  1JE4 A;  1K83 B;  3VR5 A;  1PRT C;  1XTC D;  1PRT D;  1OXS C;  2B2T C;  2RSO A;  4H7B A;  1TWF B;  1PRT B;  3KLS X;  5M5W B;  4R8I A;  4P2C B;  4XYO A;  4KHZ A;  3TP6 A;  1BR9 A;  3CQZ B;  2JSO A;  2FFK B;  1SNO A;  4KY5 A;  1B4O A;  4ZUI A;  2N55 A;  4PNY A;  1W6J A;  2A6E C;  2A6E D;  1IHZ A;  1HA5 A;  4IFD I;  2HUG A;  1JWM D;  4PMB A;  3PO2 B;  1H9J A;  1NSN S;  4RGM A;  4AYB B;  1KAA A;  3PUV A;  3QIA A;  4KMU C;  4K6D A;  1H9S B;  2YU9 B;  3VR6 A;  5E4W C;  1OO9 B;  3D6C A;  1F77 A;  2FMC A;  4M1U B;  3J80 E;  3FKI B;  5I9O A;  3HP3 A;  2A69 C;  3WOE A;  2A69 D;  1HQR D;  2QDB A;  1I4X A;  1SMY D;  1NCV A;  2Z1C A;  5JEA J;  1Z47 A;  5C3W A;  2K6A A;  3K57 A;  1PTO H;  4BA2 I;  3QOL A;  1JC7 A;  3OIP A;  5JPN C;  4DF7 A;  3NWT A;  3S1Q B;  1VMC A;  1S5B D;  2AQ1 B;  1STN A;  1TWH B;  4A3J B;  4L8J A;  1EL0 A;  1ML0 D;  1ESR A;  1QOH A;  1A3T A;  2F0T A;  2MJ8 A;  4XTC S;  2F0D A;  3SK6 A;  2WAQ B;  4K6L A;  2XN9 C;  1CM9 A;  3KLR A;  2EY2 A;  4OIK A;  1G2S A;  4XT3 B;  3H3V C;  1R9T B;  1L0Y B;  3SE0 A;  1J8I A;  5E4X A;  4K5W A;  4C3H B;  3CRL C;  2M9V A;  1Y8O B;  1GUW A;  2E74 C;  4A3I B;  4PMC A;  1IL8 A;  3A7L A;  4ZKB B;  2TSS A;  5J22 A;  3OWF A;  3CKI B;  2PZT A;  3TDQ A;  1KAB A;  2L9H A;  3I8Z A;  3OW7 A;  3TP8 A;  2F0E A;  2H4O A;  5CGK A;  2K32 A;  1F9R A;  4F87 A;  4GZY C;  2K28 A;  1LT6 D;  3RLF A;  3DWA A;  1ENF A;  2I07 B;  2EE1 A;  2EYF A;  1SJE D;  3R93 A;  4PV1 C;  5CV6 A;  4MHE A;  4QMG A;  3K7A B;  1D1K A;  5F2D A;  4HCE A;  1FGB D;  3GQB A;  1E0B A;  2E2J B;  1EY6 A;  3C1E A;  1ONL A;  1RDP D;  3PUX A;  3EFX D;  4H13 C;  2K1B A;  3WOF A;  3KF8 A;  1RCV D;  2QIL A;  2JXM B;  3K5L A;  3MXU A;  3MC0 B;  1IKL A;  3L9A X;  3GV3 A;  5J39 A;  3TZU A;  3MWY W;  2CVR A;  3SDZ A;  5KGU A;  2EY5 A;  2ZXR A;  1K8M A;  3C2P A;  1CHP D;  2KEC A;  2PPB C;  2NTS A;  3QJY A;  1EY8 A;  1PDQ A;  1D5X C;  1LT5 D;  3NSW A;  4C3J G;  3C3L A;  1EOT A;  2F0J A;  3DEO A;  3N52 A;  1LTS D;  5D65 A;  4KD3 A;  2SNS A;  1HXY D;  2SEB D;  2NYZ D;  1QE6 A;  5KNC A;  4FF2 A;  1DM0 B;  3OMG A;  2D2C C;  3UI2 A;  1JWU D;  2LFN A;  4RWS C;  1B53 A;  4QUC A;  4G4K A;  1MI2 A;  1WTW A;  2JEA I;  2NN6 I;  1RTN A;  4FF3 A;  3HOU B;  1V1O A;  3FEW X;  4RKB A;  5IGC A;  4XDX A;  3HS0 C;  1EYD A;  1LV9 A;  4FXG C;  1CHQ D;  2NUC A;  3Q23 A;  3JAM L;  4A3K B;  1LT4 D;  2AUJ D;  1X3Q A;  3AMU A;  1QIL A;  2RKS A;  3HGB A;  2JA8 B;  5FOB B;  5KND A;  1BUV T;  2ENB A;  4ILW A;  3FPU B;  1BXT A;  2EYO A;  3QO2 A;  1CA5 A;  3D4W A;  1HTL D;  3SHL A;  5KEE A;  2VNU D;  1FR3 A;  4A3B B;  3TBI B;  3T51 B;  4IZ8 A;  4HAE A;  5DM7 3;  5FO8 B;  2F0O A;  1EQV A;  1KNE A;  2O4X A;  1EY7 A;  2VUM B;  1OXV A;  1IYU A;  2FMM A;  2HQE A;  2K5W A;  2X69 A;  3S1N B;  3S2D B;  4HR7 B;  4BWG B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...