1IYVA

Lipoyl domain of pyruvate dehydrogenase complex, nmr, 29 structures
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
79
structure length
79
Chain Sequence
SEIIRVPDIGGDGEVIELLVKTGDLIEVEQGLVVLESAKASMEVPSPKAGVVKSVSVKLGDKLKEGDAIIELEPAAGAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DIHYDROLIPOAMIDE ACETYLTRANSFERASE COMPONENT OF PYRUVATE DEH
publication title Three-dimensional structure in solution of the N-terminal lipoyl domain of the pyruvate dehydrogenase complex from Azotobacter vinelandii.
pubmed doi rcsb
molecule tags Acyltransferase
total genus 6
structure length 79
sequence length 79
ec nomenclature ec 2.3.1.12: Dihydrolipoyllysine-residue acetyltransferase.
pdb deposition date 1996-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00364 Biotin_lipoyl Biotin-requiring enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1iyvA00
1O78A 1H9RA 2A6ED 2K7VA 5C0XG 3IFTA 4KKUA 4TQUS 3WDNA 3BG3A 3NE5B 3OW7A 5BN3A 1GUGA 5KNCA 1BDOA 2ZT9C 3MXUA 4RCNA 3PV0A 3PUZA 5BN5A 3ND9A 3CRLC 3HGBA 3VR3A 1Y8NB 2D5DA 2PNRC 2B8FA 1OXTA 3H94A 2NN6I 3T56B 3BDOA 1SMYC 3P20A 2BE5C 3OPOA 2PPBC 1Z7TA 2BA1A 2JEBI 3VA7A 1H9SA 4JK1C 3QJYA 5K36G 1Y8OB 1B9MA 1IYUA 3SDZA 2BE5D 2B8GA 4KKSA 4DNRB 4XTCS 1OXVA 4H44C 3KLRA 1CTMA 5KNBA 1FR3A 3T51B 3D4RA 2CW0C 1LABA 1HQMC 2D62A 2A69C 2AWOA 1TKWB 2A68C 4OGQC 4LJZC 3AB9A 1A6XA 3FPPA 1Q12A 1ZYRC 1HTPA 2LMCB 3PUXA 4XIGS 1OXXK 4OO1G 4BA1I 3M7NA 1T5EA 2YYZA 2EJMA 2A69D 3W3AA 2A68D 4H0LC 2NN6H 1Y8PB 3PUYA 2L5TA 3U9SA 4KN7C 1GUOA 1GHJA 2KCCA 3I73A 3L7ZC 4IFDG 4G7HC 4DK0A 1V8QA 1I6VC 1Q90A 3QIAA 2K33A 2O5JC 3MFYA 2BDOA 1H9MA 4KKTA 3FMCA 3N6RA 1K8MA 1HPCA 3PUVA 1Q1EA 1YNNC 2D2CC 4H13C 1DD2A 4G7OC 5JEAH 5K36H 2KA7A 4G7ZC 1CFMA 1ONLA 1YNJC 4KMUC 3ND8A 1Y69U 2K32A 4BA2I 1LACA 1VF7A 2EDGA 3A8JE 1Q1BA 4KN4C 1GUTA 5BN4A 5C0XH 4IQZA 3TZUA 1GHKA 1H9SB 2JE6I 2E75C 3VR2A 2O5IC 1GUNA 3IKJA 1K8OA 4I7ZC 1H9KA 2QF7A 4HR7B 3GD7A 4KHZA 2DN8A 1G291 4OO1H 2JXMB 2AUJD 3PUWA 2A6HC 2DNEA 3T53B 1H9JA 3A8KE 3A8IE 2PCFB 1ZKOA 1IW7D 2V4DA 4GZYC 1VCIA 3DXJC 1PMRA 2BA0A 1QJOA 2DNCA 3M85A 4IFDH 2E74C 4KI0A 2A6HD 1FYCA 2IT1A 1DXMA 1E2WA 3D31A 3I72A 2Q8IB 1TU2B 1B9NA 2NN6G 1VF5C 1GUSA 3LNNA 1OXUA 4DK1A 2EJGC 1V43A 1VDZA 2F1MA 3CRKC 1E2ZA 3VR5A 1Z6HA 3A7AB 3EQLC 4PV1C 3QG1A 3VR6A 1O7LA 1GJXA 1IW7C 2E76C 2EVBA 3OOCA 2R6GA 4L8JA 3SE0A 2JEAI 2A6EC 1OXSC 5KNDA 3VR4A 3M4YA 4TKOB 5JEAG 4JBWA 1HCZA 2EJFC 3I4LA 3LWUA 5A35A 4LK1C 2AUKA 3A7LA 3GQBA 3RLFA 1DCZA 4DNTB 1E2VA 1CI3M 1EWHA 1IYVA
chains in the Genus database with same CATH superfamily
2WV6D 1BBWA 3RLNA 2IY5B 3KJOA 4GLVB 4AQYQ 2RDHA 2H5XA 1S72A 2Z6BA 5BN3A 2EY5A 4R4IA 2JA6H 1HZBA 1CZWA 3KBXA 1EY4A 4LFBQ 2PYKA 3D4WA 1WJJA 1WYDA 1IHZA 3R93A 1PTOC 1JR0D 1HNWL 2WINB 3KLWA 1VMCA 1JWMD 4IUPA 2K03A 3TREA 2X6LA 4LUZA 2ATWA 2A1AA 1SFOH 4A3IB 1IBKQ 2F0JA 4LNQA 1E24A 3SDZA 1ZXTA 2ID0A 2EXDA 2EQSA 4XTCS 2F0WA 3A0JA 3GO5A 2K04A 1DOLA 2K5QA 2L0CA 3X3MA 1LM0A 3HOZH 4BBRH 4A3BB 1TKWB 2IJ0A 2TSSA 4JI6Q 1F9RA 2RBMA 4LF5L 5M3FG 3ICEA 1EY5A 2MPMA 4DA2A 1XX8A 4JI2Q 3S1RH 1AZPA 2ENBA 4GS3A 2K5WA 2PW5A 5JVH3 4DV2L 4DAYA 4JBJA 4G7HC 4IUTA 2K33A 3TS0A 3CQZB 1LTLA 1SAPA 4BBSH 3PUVA 1I3QB 1CK1A 2KA7A 1MKHA 1SR3A 1CFMA 4FNFA 4KMUC 4NXML 4ZUIA 3DM3A 1HR0W 3S17H 5IWAQ 4IPCA 4LF7Q 1KD1C 3OMCA 4UAIA 3GD7A 2D0OA 4IFDJ 3JAML 1QZHA 3NTHA 3CHBD 3MZ5A 1UNSA 5CV8A 1D5XC 3TDQA 1HZAA 1OO9B 3K5LA 3S1QB 5M5XB 1PH7A 4QGUA 1STNA 5C4JH 2F1MA 1VDZA 2NVXB 2L15A 4N8X1 1M4VA 2QDBA 1FL0A 1D7QA 5ELDA 1YNXA 3FP9A 2ICIA 3UDIA 1F2YA 1V1PA 1J5EL 2B2TA 2EJFC 2EY2A 5D3DA 2UUCQ 4JW0A 1I5FA 2VQEQ 4RGMA 4DPGA 1S40A 3L3OC 3MAQA 3OW7A 4OIKA 2NYZD 3BZCA 3PV0A 1IL8A 3ERSX 5M5WH 2NN6I 3ONAB 3HS0C 1EOVA 1Q8IA 4BY1H 5IP9G 4KV6A 4DR2Q 2QA4A 2RHSB 2PQEA 1EY7A 1S5DD 1B9MA 2K01A 1C9OA 5C44B 4RHSA 2Z1CA 3HEJA 3TP7A 2RDFA 1A63A 1JC7A 2WKDA 2B2TC 1XNQL 3J7ZC 4B3MQ 1Q12A 3S1NB 1IBMQ 1ICFB 2AQ3B 3M7NA 2O4XA 4GN3B 3SEBA 1D1IA 2A5HA 2A69D 1I4QA 1BBUA 4P71A 2L9HA 2DJFC 2QEXA 3HOVB 1GHJA 2CQAA 4JYAL 4DK0A 1VQFA 2H4OA 3MFYA 5A2QE 1IZ6A 2CFMA 4H13C 1CZGA 3S2DB 5BR8Q 3KDFB 2E2JB 3Q0AA 3CP0A 2NVTB 4A3EG 2QILA 1KRSA 2UXBQ 2JA5G 2NVYH 2JE6I 1BNZA 3HFZB 3OTOQ 1LT3D 4IO9A 2DN8A 2Z8LA 1NBWA 1E1TA 3ZYYX 3PO3G 1AZQA 3A8KE 1P8LA 2VB2X 3PIP3 3CC4A 1A3UA 2DGYA 2I5LX 4XYOA 3U4ZA 1K8GA 4JOIA 3ULLA 4A3MG 1S3OA 4LF4Q 2IPKD 5IYDH 2B2VA 1SYCA 2K14A 4ZKCB 2N3SA 3PIPA 2IT1A 2KENA 1TWHH 4RWSC 1IL2A 1XTCD 1L1OB 2OWOA 1C0AA 3DEOA 3RZDB 1HQRD 1KDBA 5EKKA 1V9PA 3PF5A 2R6GA 1SYBA 4TKOB 4TRDA 5M3FH 1WTHA 3S24A 4JV5Q 2JA7H 1Q86C 4CHTB 5GAEC 1RF2D 1R4QB 1EYAA 1ASZA 1SE3A 1PZKD 3V05A 4CBVA 2B63H 1B2TA 1BDOA 4YWMA 3K57A 5C4XG 5I6YA 1O7ZA 3A5ZB 1LTSD 1BXTA 2CW0D 4G57A 1HR0Q 4AYBB 4CJ0B 4MN3A 2B2VC 5CV7A 5C4HA 1EY8A 1D2BA 4DR3Q 3H0GB 3K5MA 5EGTA 2JA9A 2MNAA 2BE5D 2F0QA 1UEAB 5IT9E 2KHJA 1TT2A 2KQ3A 3LX0A 3T51B 1GUWA 3MFGA 1UWVA 2DUDA 4H02A 3PUXA 4FF3A 3S14H 4JI3L 5E1FA 1EZ6A 4DUYQ 2J4XA 2YU9H 1N9WA 2A68D 3FVQA 1DOKA 4FP5D 3RUZA 3PO2G 1E22A 2ZXOA 4OELB 1E7ZA 1I6VC 4RKBA 5EKIA 3S1MB 2O5JC 4V0BA 5EPLA 3ULPA 4DAMA 2Q2HA 4AH6A 2VQFQ 4A3FB 3CCQA 4DR7L 1ILQA 3M4OB 4X3UA 4ME5A 2AWNA 4LW1A 1PHJA 4J1MA 1EWIA 2E75C 3NTIA 4JBMA 1NE3A 1K3RA 1GXDC 4XDXA 3T1HQ 1HNZQ 4GKJL 4OO1H 4IJLA 1S4ZA 1VQHA 2V1CC 1G2SA 4K0KQ 3PUWA 2A6HC 2K75A 3E0JA 1NMFA 5C5LA 1XMOL 3K81C 2TMPA 1G6ZA 2R92G 2N8NA 3IAYA 4OWXB 4FO2A 3HG9A 3C1EA 2B3GA 3NWTA 2ZJQA 1O7YA 3LNNA 3MXGA 1I50B 3SK4A 4OWWB 1LTTD 4LF9L 2EPBA 4EQOA 3EQLC 5IGEA 3CC7A 4A3JG 2AMCB 3VR6A 1JMCA 4FF4A 4HCSA 2RKSA 3NENA 2JA8B 1HCZA 1SFOB 5EPKA 2F3WA 2F0OA 1L0YB 1HJPA 4LAAA 2FINB 4A3KG 1FGUA 2PZWA 1KC8C 4J6HA 3U50C 1SNCA 4FXKC 4K8JA 5C0XI 4Y7NH 5BN5A 4LWCA 2KBNA 3EA6A 2K5NA 4QUFA 1WFQA 4NDXA 2VW9A 5J3BA 2XRQD 3H94A 4HJ5A 3BDOA 1JB3A 2F4IA 1IKMA 2DJGC 4A3EH 3VA7A 2VUMG 2RSOA 3I4NB 2JA5H 2JSOA 5EBCA 1J9OA 3QJYA 4A3GG 1VQIA 4BBSB 3SK8A 4H44C 3EFXD 1WCMG 3PO3H 1YEZA 3D4RA 2CW0C 1EU3A 3D8GA 1SYDA 2Q2IA 1W2BA 2K5VA 3K5NA 4HIOA 1JE4A 2ZXPA 2IX1A 2A19A 4A3MH 2R7DA 4BA1I 4JCVE 2XRSD 4DR6L 4DN4M 4XT1B 3W3AA 4NPSA 3OWEB 3J80L 1VQ9A 1VQPA 2L5TA 1ZYRD 4IN3A 1W6JA 3F2UA 4WRDA 5AJ3Q 4A3DG 4BY7B 2VZAA 3FHWA 5H1SE 2EYOA 1QILA 3TZDA 4GNXB 1DD2A 1EYGA 4GKKQ 5K5PA 2I0QA 1FGBD 2CQOA 4Y52H 1CQVA 3TP6A 1KXLA 3K6OA 5BN4A 1ASYA 1PFMA 2RF4A 4YIJA 2BH8A 2O5IC 3GP7A 3T1YQ 4I7ZC 4C3IB 3WWVA 3LGJA 3BVMA 4ZRZA 1TWGH 2AUJD 2JQOA 4IOCA 2NTSA 1HZ9A 1IW7D 2JA6G 4EQPA 2EE1A 3E0EA 2QW7A 4X64Q 3HRZC 4HEDA 4OL7A 3HOUG 3MXNB 1WTXA 1HH2P 4OX9L 5IGCA 4ODGA 1PYWD 4NP5A 5FO9B 2E5LQ 1EIGA 2I5HA 1GJXA 4BY1B 1F9SA 4ILWA 4ALPA 4IUVA 1AN8A 4H7BA 4DGZA 3HOZG 1JQYD 4B3SL 1U9RA 2NZHA 4GN5A 5JPMC 1YITA 4FXGC 4DV0L 3PO2H 3VA5A 3IRBA 1EQTA 5M3MG 1KABA 4CJ1B 1TWCB 3DUZA 1PXUA 4Q0FA 1ET6A 3KDFA 2F3IA 5E4XA 4QIWE 1W6KA 3A56A 1IKLA 1E3PA 1BCPB 1YBYA 1L0WA 1PTOD 2CCZA 2Q2UA 2PI2E 2CVRA 1G8ZD 1Q8KA 4L5TA 2WB1B 3KLSX 4X3SA 1D8LA 5I9PA 4TVAB 3PMFA 4LF8Q 2R92H 2LMCB 1ZEQX 4PNYA 4OEMB 1SSOA 1L1OA 1PH5A 2RCNA 3CCMA 1Y8PB 1HUNA 1YVCA 2KECA 1AE2A 1PRTB 3EIVA 2NZOA 2MO1A 4LFAQ 4X3KA 1JE5A 1EZ8A 1RKNA 1VQDA 4DUZQ 4IFDI 4O42A 5LMNL 1NNXA 1ML0D 4UDUC 4R8NA 1G91A 3TBIB 4WFN3 4WJ4A 1PVOA 4A3KH 1R9TH 1GHKA 3NWSA 1H9SB 3RZOH 2CH4A 2R93H 3M4PA 2NVQB 1WD1A 1EIHA 2K4KA 2QF7A 1G2TA 2RQXA 4JI4Q 5IYCG 3A74A 4IURA 2L4NA 5M3FB 3GTQH 2PCFB 4DXGA 2QCPX 2BA0A 4K6LA 3HOYH 4DFAA 1Z9FA 4K6DA 4DV7Q 4FF2A 4JI8Q 2K6AA 1S5FD 4JI5Q 4PZ8A 4YY3L 1VQLA 2R7ZG 3I72A 1HUMA 2NN6G 5LHY1 3K5OA 3OSOA 1N36Q 3A7AB 3TEHB 4POGA 1EWCA 1K28A 3CAMA 1HNXL 1IW7C 2E76C 1Y1WH 3H3VI 2A6EC 5IT9c 3GTJH 1SDFA 2GA4B 3RLFA 3OMGA 2QGQA 5KGUA 1O78A 3GTOB 3S16H 1TS5A 2ASBA 4DR5L 2EY6A 2ZT9C 4A3DH 1C48A 5IODA 3GTKB 1E0BA 4JI1L 3OWFA 3S14B 3J81i 4C1NK 1PTOH 1YJ9A 3CKIB 3H3VC 1IBLQ 2KOLA 1XMQL 1AFPA 1VQKA 2F4VQ 4IALA 2M2LA 1SYFA 2CWPA 4P74A 1SEBD 1UUPA 3E6ZX 3DHQA 2Q8TA 1GM5A 2B8GA 3GDEA 3H6MA 5ELNA 1X3EA 2EYHA 1LTGD 2D62A 2AWOA 1WTPA 3L0OA 3B6YA 4RH6A 3J7YW 2F0KA 5IOCA 1FJGL 4ZAIA 4DF7A 3HOUH 2DY7A 1PH6A 4IOAA 3J81j 5LL6S 4DKAC 5JEAJ 3TP8A 2HIXA 3I73A 4RKLA 5D14A 5IYDG 4M1UB 5LMUQ 1HHVA 1K8AC 3AU7A 2PZTA 1HPCA 3MXPA 2JP1A 4R4OA 1LT5D 3VYRA 2IW3A 4POFA 2K05A 1CKMA 1WI5A 1BO0A 3EROA 1RD9D 2E2HB 2EDGA 2AKWB 2F0UA 4BWGB 2GVAA 1VMPA 4JI7Q 1R4PB 4LFBL 4CDEC 4PMBA 4B3RQ 2KCTA 4QIWB 2JA7G 5M3MH 2BDNA 2HD3A 3CC2A 5FO7B 1KHIA 3TRZA 5E3FA 2F0VA 5CBAE 3RNUA 2AQ1B 3E5SA 2B63G 5CBEE 4NKLA 4HTHA 4JVZA 4U68A 2XTIA 4LF6L 3I8ZA 4DV6Q 3K8AA 3L9AX 2LY7A 1RTNA 3D31A 4KY5A 4Y7NB 1V43A 4MTNA 4JI6L 1UE5A 2EY1A 1UE7A 2B39A 3NTKA 4NMZA 4MNOA 4QUCA 5GROA 4C3HB 3A5UA 2B2YA 1Q46A 3M4YA 1T5XD 2WKCA 4X62Q 4A3EB 1XNRQ 2XSCA 2JA5B 3PCOB 5NUCA 1IYVA 1BOSA 1CI3M 1BQQT 3M4QA 3CCSA 5JJIA 3UI2A 3WDNA 5FKAC 1ICWA 4YWLA 2QDLA 3PO3B 3EBEA 1X32A 4DR4L 3HKSA 4XXEA 4R4TA 2A74C 1GO3E 2ZTDA 1QNUA 1KNAA 3OW2A 1NJIC 1YZ6A 4LMQD 5IWAL 5EQ0A 1YHAA 3P20A 4LF7L 1CKNB 4L5QA 2JEBI 3CCEA 3OIQA 2XNAC 5GAHC 2GN5A 3TS2A 2Y0SG 1I6HH 1Y1VG 2NB0A 1SYGA 5IYCH 2B2YC 1K83H 3GTPH 1WTRA 3AB9A 2L1BA 1OXXK 4OO1G 3MXNA 2R7ZH 2UXCL 1SNOA 1XJVA 4H0LC 1K0RA 2NN6H 4EVOA 5C4XB 1DONA 3TSSA 4DNIA 4R4QA 4DV4Q 3ITPA 1B3QA 1TWGB 2UUAL 1SYEA 4IPDA 2F0FA 1M8AA 2E2DC 1JOOA 5LL6X 3BS1A 4G7OC 2VQEL 3IFDA 2X6GA 4G7ZC 3PSIA 2LXKA 1STYA 3FKIB 1TWFH 3MVVA 3TZUA 1K73C 4HAEA 3JC66 2D9UA 1SNDA 2OQ0A 2R3ZA 2I07B 1LO5D 5C3EB 4UP8A 4CKEA 4QMGA 2LFNA 5T1IA 3BZDB 4N9TA 4IZ8A 3UE0A 3PO2B 3KBGA 2A6HD 5M5YB 2A73B 1DXMA 1KL9A 1YHQA 3P1HA 3P75A 3G48A 4DK1A 3CRKC 2Z4IA 2EZVA 1IBML 4DR1L 2C9OA 2NWGA 4U673 3SE0A 1SE8A 1JICA 2CHBD 1N34Q 5JJLA 3CCJA 3D3RA 1TWAH 5HY6A 2JK8A 3UE1A 1CA5A 3HP3A 4X66L 3GTMH 1Q7YC 1N8RC 5JAVA 2UU9Q 5JPNC 4L6TB 1GUGA 1XPUA 4RHRA 4CKCA 1ET9A 5HGTA 2F0HA 4ME3A 3RLOA 5BR8L 2R92B 1BCPC 1OXTA 1XYIA 3Q8DA 4QQBX 2UXBL 2F0PA 1YIJA 4P75A 2UXDL 3K7AH 2KVMA 1HRJA 3M9BA 2PPBC 1H9SA 3OTOL 2YTYA 1XWEA 4PG3A 3D6CA 3BYYB 1PFSA 4KHPL 4A3JB 1QVGA 4A93B 2FFKB 1DGSA 1EY6A 5FOBB 1FR3A 4X65L 4Z9CB 5JVG3 1HQMC 5GADC 3SHLA 4APVA 1YNND 3EN2A 5IP7G 1LTID 1CHPD 2ICEC 1BR9A 1EIFA 1PRTC 1KDAA 2YYZA 5GQOA 1S5ED 3P7JA 4JOIC 5T1GA 1HFNA 2E2IH 3E9HA 1BVSA 2PZUA 4DV5L 3KYHC 1N33Q 1B44D 1DJRD 4JV5L 1SRUA 1Q1EA 1MJEA 4XQNA 4ZCKA 2VUMB 1ONLA 3BYTB 3J81E 4GLXA 3J7AV 2K32A 4QF4A 3H15A 4A3GB 4GN4B 1Q1BA 4DV3Q 4C56C 3GTLH 1CM9A 4P73A 3VR2A 5CORA 1WCMB 3GV6A 4B3TQ 3C2PA 1CHQD 1MBYA 3Q6SA 5IE8A 1HR0L 4KHZA 1G291 4UPAA 3W5OA 1N32Q 1A3TA 4KY6A 2DNEA 3S15H 1I4PA 1ZKOA 4C2MH 4DR3L 1QUQB 2IL8A 2UUBQ 5EPJA 4DAVA 3S2HH 2N88A 1FYCA 1E2WA 3U9OA 3HOVG 1Y1VH 1IXRA 2ZM6Q 5I2YA 1JOQA 4HJ8A 3J80E 2E8GA 1STBA 3U4VA 4FDBA 1A8VA 2I46A 3V2TA 3CPWA 3JAMi 5JOBA 1QWYA 2VQFL 3BZKA 1X54A 3HOXG 2JA6B 1U4MA 1V1QA 2EXZA 1Q82C 1PTOF 1JB7A 1X55A 1Z47A 1SMYC 3CXCA 4YWKA 2B29A 3OPOA 1WD0A 4A3IH 1RCVD 1Z7TA 2EYJA 4N8FA 2XIWA 3T1HL 2OF1A 3C46A 2MQHA 2HHHQ 2Z4HA 4K0KL 1QCBD 3BDCA 2ZTCA 5J1ZA 1OXVA 3KLRA 2R93G 2SNSA 3HOZB 4O1NA 1KAAA 4BBRB 3CMAA 2WAQG 2R61A 1NY4A 1RDPD 2F0TA 4R1JA 2IHEA 3I90A 3I55A 3SK6A 1VQ5A 1AEXA 1S5BD 5JJZA 2EIFA 3N52A 1NAPA 1SROA 3HOYG 3W2DA 3S1RB 4DU9A 1C4QA 3F1ZA 3QIAA 1YJWA 2KUMA 3WOEA 1I3QH 5IT9L 4KKTA 2FXQA 3N6RA 3Q23A 1PH1A 2F52A 1YNNC 2D2CC 4UY8C 4CDCC 4J8QA 4AYBG 5C3WA 1B4OA 3FEWX 1STGA 4DR6Q 1MD2D 2KCMA 1Y1WG 2Z9HA 1VQ4A 1A2TA 5G3LD 4QL5A 1WTQA 3S17B 4HSVA 2WFWA 5EJWA 3CPFA 3PF4A 4A3LH 3M3YH 1UAPA 1G51A 5E7NA 4GOPB 4MIUA 3S1QH 1CKNA 1F2MA 1HA6A 4KTAA 3F2CA 1PFNA 1QJOA 2DNCA 3SGIA 4JBKA 5ELBA 3G7LA 1X9NA 5F2DA 2K28A 1GUSA 2EYMA 4NXNL 3C1FA 3BDLA 3KK7A 1VS0A 5C4JB 1STAA 3URYA 1WTOA 4KD3A 4A3FG 1NCVA 5IP7H 5KNDA 4A76A 3I4LA 1DCZA 2K52A 1JWUD 3T4AC 2PNHA 4C3JG 2A6ED 3R2TA 1A0IA 2LKVA 4GKKL 4ZK9B 4NB3A 3PUZA 2Z0SA 1K83B 1F9PA 3CRLC 2Y0SE 1SNMA 1JOKA 3T56B 5M5WB 1KQSA 4XYQA 4CGYB 2OTLA 3A55A 3T1YL 2BA1A 1M1KC 3BVGA 3DEPA 1HA5A 5COYA 5C3XA 3WOFA 2ALYB 2MHVA 1WVLA 5IYBG 1CSQA 2PMZE 4KKSA 2Z6KA 4IJHA 1PFBA 4R4CA 3MC0B 4X64L 1EEID 2RHQB 2VS1A 4RMFA 3KFUA 2JA8G 3NK9A 1QG7A 4JC0A 3X3NA 4A3CG 5J39A 1YNJD 4KY7A 4CDFC 3HOVH 2E5LL 2LSSA 2WIIB 3OYYA 1GUOA 1KAWA 1U4PA 3R2IA 5DM73 1SLJA 1EFWA 4DV1Q 3RN2A 3DMUA 1K8MA 1I4GA 5C6AA 3S2DH 5K36H 1FVIA 3MEHA 2E2JH 2N78A 5ELOA 4HMJA 1PLFA 1LACA 3I4NG 3RR5A 4LFCQ 1BKBA 1GVPA 3T13A 2Z6KC 1HXYD 1NR4A 4IPHA 1LT6D 4XT3B 3D6WA 2NVYB 3HOXH 4HR7B 5FLXE 5ELFA 4XQJA 4B9WA 5LMNQ 3A8IE 3UDXA 3C3LA 4PQXA 3Q24A 4EX5A 3MA2B 4OXPA 3H09A 4IFDH 1D1KA 3I3CA 1DOMA 5CV9A 2FHTA 1VF5C 4QJFA 1X6OA 1TWHB 5FLMH 1EEFD 2N49A 2ZXRA 4BY7G 5CV4A 5KYLA 3VYUA 1O7LA 1STHA 1PZJD 4I65A 2JEAI 3K7AB 5DEHA 1I94L 2YTXA 4YHHL 1NR2A 3LWUA 5A35A 3GQBA 4F7XA 1S5CD 4EGVA 2JA7B 3RN5A 2RA4A 4DUZL 1TY2A 1FNVA 3K80C 1L1OC 5DM63 3BG3A 3NE5B 4C3IG 3CMEA 3PIO3 3I7FA 4K2LA 2AQ2B 3V96A 2B63B 4B9XA 2D0PA 3O13A 3NBHB 3GTGH 1HNXQ 2K5HA 3NEMA 5D65A 4QCLA 4JI0L 3NHHA 1YI2A 1JJGA 3H0GH 4KK7A 3J81c 3H3VH 1Y8OB 1IYUA 3I4MG 4QY7A 3Q22A 1RIPA 2CWAA 1O7IA 3TP5A 4L63B 1K3BC 4HIKA 1JJ2A 4LJZC 4JI8L 1C8CA 4JI5L 2KCNA 2EYLA 1D5MC 2P5ZX 5FO8B 1PH4A 2X69A 4IPGA 1MI2A 3T16A 1N36L 2HDLA 1GKHA 3HOWG 3S1MH 2YU9B 1WOCA 4B08A 3L7ZC 3JAME 4EQ5A 3K59A 1Q90A 1XPRA 2QEJC 4K5XA 4OWTB 4A3FH 1TY0A 3S15B 4K5WA 3M4OH 1YNJC 1VQOA 1YJNA 4R8IA 5J22A 2VNUD 4BA2I 2FMCA 1HNWQ 4C3JH 2M9VA 1I4XA 2L12A 1FNUA 2WB1G 3M7GA 5KYIA 3G6JB 1UEBA 1PH8A 4G4KA 3UDFA 3DLLA 4A75A 1ILPA 2JXMB 1IBLL 3SR1A 2F4VL 4FYDA 2PMZB 2BH2A 3M85A 3J80i 4EQNA 2BOSA 3CCVA 4M8AA 3KF6B 4AQYL 1QVFA 1I50H 1TU2B 4LF5Q 5IYBH 5M9OA 2LS01 3W1BA 3DWQA 1Z6HA 1PV4A 4DV2Q 2JA8H 4KLKA 2RDGA 5KRUA 4A3CH 2ZTEA 5FJ8H 4LF6Q 1Q81C 1E2VA 1IBKL 3TQYA 2C5CA 5LMUL 4KD4A 4E6IA 3A54A 1G6PA 1AW7A 1NTGA 4NXMQ 3NSWA 1EYDA 3K7UC 3VR3A 2D5DA 4DXFA 1F9QA 4FF1A 3BU2A 4HN7A 4JI7L 1SJED 2SDFA 3I4NH 4B3RL 1XXGA 1ESFA 1X3GA 1U4LA 3SVMA 1BCPD 1RL2A 1Y14B 4JI2L 4UP9A 2WAQE 5IGFA 3RD4A 4GOPA 2G9DA 5KNBA 1RJTA 4DR4Q 3CW2C 4DV6L 4X6AH 1EQVA 1LABA 3KOJA 3L2PA 5EKLA 4GNXA 3FPPA 1CSPA 1HTPA 2MP1A 1EUJA 2K5DA 4AYBE 4A3MB 2HUGA 4WJWA 2OTJA 3R3OA 5DAUA 1J5EQ 3BVZA 3PUYA 3CCLA 2A8VA 3G6EA 4BY7H 4RGOS 3M3YB 1PRTD 1XNRL 4X62L 3FMCA 1B8AA 1MJCA 5HURA 3ND8A 1SE2A 2F0GA 3HKZG 2UXCQ 1GUTA 2MFIA 4IQZA 3VYTA 4P72A 4C3IH 4HJ9A 2R7FA 4OONA 4GOPC 5FK9C 5IGDA 1XPOA 3EVQA 1B3AA 2UUAQ 2XGTA 2Q2TA 3E9IA 4GNXC 1KLUD 1EYCA 3STBC 1VQMA 4GZYC 1VCIA 1W3SA 3I70A 1X56A 4RGTA 4O2DA 2UUCL 1I4HA 1XNQQ 4WJ3M 1QOHA 1GOZA 4ABNA 2KHSA 5KEEA 3I4MH 4S3SA 2NZ1D 4A3IG 2EJGC 1KIXA 2ZJPA 5DNFA 5ISRA 4JYAQ 2NBFA 1CQFA 5ELEA 2PQAB 4A3BG 4DR2L 2AUKA 3A7LA 4DV4L 4JPBW 1SNPA 4PMCA 1KTKA 3HOWH 1PDQA 5C0XG 1NMGA 3IFTA 4TQUS 2HCIA 4YCVA 2MGSA 5KNCA 1K0SA 3GV3A 5CMDA 4RCNA 1ENAA 1TS2A 1TWCH 3ND9A 1BBXC 1X3QA 3K0XA 3QB3A 2M00A 3TN2A 1QVCA 4DR1Q 4IUNA 1NUCA 4K8IA 5D3IB 4B3ML 2VL6A 1TS4A 3QR8A 4IUUA 4JK1C 4DK3C 4HMIA 1T9HA 4OIJA 4X66Q 3AMUA 1H95A 2J0TD 3NXWA 2F0MA 1SBBB 1SMYD 1TIID 1VQGA 1MGSA 4KJNA 3PQIA 3I4OA 3I91A 2XWBB 4DK6C 4C3HG 4FVMA 3NQTA 1A6XA 3F2DA 2FJ2A 3VDYA 5FLXc 4A3LG 2CKZB 2UXDQ 4XIGS 1STEA 3ER0A 2HQLA 5GAGC 4LUOA 3MTSA 3HOXB 2L11A 4DAPA 4KHPQ 1HTLD 1N34L 4KHVA 2F3VA 1XTDA 1QB5D 1LTRD 2BDOA 4X65Q 1SXTA 3AFPA 5G3LF 1A62A 3K0YA 2UU9L 1J8IA 4GLAC 4LF4L 4KN4C 3I56A 3A8JE 2NVQH 1F2LA 4X3TA 3KUPA 4A3KB 1EQQA 2JJQA 1R9TB 1GUNA 2JYOA 1K8OA 1H9KA 3RZOB 2R93B 3FRPB 3NBHA 2GVBA 5EAYA 4DV5Q 2IX3A 2I5MX 1BUVT 2WAQB 3MHBA 2BCOA 4ZLTF 1LV9A 1EY0A 3GTQB 1EIYB 1M90C 1HFGA 3HOYB 2OQKA 4KI0A 1VQ8A 2JN4A 2Q8IB 4ZQ3A 3TMEA 4RA8A 4JI3Q 1TQOA 1EOTA 2NUCA 2XVSA 1TVXA 4RCOA 4UHVA 3ZJYC 1VQ7A 3GTGB 2F0SA 5C44G 2F0IA 1CA6A 4L8JA 1X3FA 5L37A 5JEAG 1PA6A 1VQCA 1Y1WB 2NTTA 3G71A 3FKIG 3GTJB 1L0XB 4DNTB 3GTOH 5A2QL 1BF4A 3IL8A 2K50A 1N33L 4J15A 3NUCA 2H1EA 4DR7Q 4MHEA 3NP8A 4HCEA 2OCEA 3F8TA 1NSNS 1EQRA 3GTKH 3S16B 3MXUA 5C3EG 2WP8J 4A3DB 1KLGD 1PH2A 2HQEA 4DV3L 3JAMc 1B53A 3KF8B 4ID6A 4GKJQ 2EYFA 4B3TL 3SXHA 1EL0A 1LLRD 1CT1D 1PTOB 4DUYL 1XMOQ 3J7AF 1PZID 5K36G 1N32L 5TSSA 4ZYSA 1SJHD 4DNRB 2PW7A 1VQNA 1SMXA 4Q5VA 2UUBL 3NPPA 2A69C 3LWEA 4OGQC 1SE4A 1UE6A 1EY9A 1PYSB 2F0EA 3QOLA 4LF9Q 3ULJA 4C3JB 4AIMA 2B2WA 3KF6A 2ZM6L 1T5EA 1X3PA 3MEFA 5CGKA 3U58A 4OO1I 3HOUB 3U9SA 1KNEA 1TS3A 4F87A 5LMNW 1HNZL 4IFDG 4K5VA 5IP9H 1QE6A 2WB1E 4F88A 5CV6A 1D6EC 5FLMG 4YCUA 2PI2A 4CJ2C 4A3BH 2E2HH 1Y69U 4BS9A 1A15A 1TXYA 1VF7A 3D4DA 2FMMA 3S9WA 5C0XH 1RHPA 2YV5A 4V190 1O80A 2DY8A 2WACA 5CYUA 4A93G 5KIXA 3G4SA 1HZCA 5M3MB 2KJXA 1VQEA 1KRTA 2HDMA 1ENCA 3CQZH 4PZ7A 2L55A 1YHBA 5CR3A 5ELCA 2B2WC 2HHHL 1QNKA 2AHOB 4PMWA 3DWAA 2EYPA 2N55A 3J81L 3UDGA 3EJIA 1LTBD 2ZJRA 1Q3LA 1FNWA 2F0NA 2E74C 1RODA 1JCKB 1JJCB 1FD7D 2B2UA 1DYQA 2RVLA 3D0FA 3H0GG 2VXWA 4DAYB 4C3HH 4K2KA 4ZUJA 4PV1C 3QG1A 4PZ6A 1A3VA 2EVBA 3QWNA 3W1GA 2XWJB 4ZKBB 1OXSC 3VR4A 3QOJA 5IIFA 1K9MC 2EJMA 1AH9A 3ERQA 5M5XH 1H9RA 1PH9A 4KKUA 2C35B 1VQJA 4NXNQ 1LTAD 3NELA 1B70B 4RG1A 3HGBA 1VQAA 2NVXH 1Y8NB 4HJAA 2PNRC 1CUKA 2B8FA 5IGGA 4MZ9A 2BE5C 2HIVA 3PGZA 4A4IA 4NW2A 4HSPA 2B2UC 2MO0A 4L5SA 1QZGA 3AEVA 2MJ8A 4BXXG 1JORA 1JWSD 1ESRA 5AJ3L 2RSNA 1I6HB 3VYSA 1CTMA 4OX9Q 1F77A 3OHXC 2A68C 3KLSA 4RGNA 4JG2A 3GTPB 5DLQE 1U0LA 5C4XH 1V1PB 1WTWA 2KHIA 4P2CB 2EOTA 2R7ZB 4KN7C 4B3SQ 2KCCA 1KDCA 3HKZE 4WORA 1MIUA 1V8QA 5C44H 1F2ZA 3RMHA 4DV0Q 4F8MA 1TR5A 1C7YA 2PQAA 5JEAH 3FKIH 3S1NH 1AP0A 3I4MB 4XQQA 1U5KA 1IYJB 1TWFB 5FJ8G 5C3EH 2RCFA 1B7YB 4BBRG 1EFID 2OT2A 2V4DA 3DXJC 3R8BA 3AYHB 4RAUC 1PMRA 1GD7A 3HOWB 5M5YH 1OTCA 1A2UA 4CKBA 2NVTH 1B9NA 1OXUA 5EBDA 1E2ZA 3VR5A 1VQ6A 1PH3A 5C5MA 3AFQA 1E1OA 4BBSG 3H91A 5AFWA 2O2LD 2PO4A 2G9HD 4JBWA 4LK1C 5C4ZA 2HT1A 2ES2A 3BJUA 2YTVA 1TWAB 3I2ZA 3K58A 1II3A 5HGQA 4DV1L 1U4RA 2K7VA 1UE1A 2J7ZA 1B1ZA 3DWPA 3GTMB 4HIMA 3HZXA 5E4WC 3MWYW 1P16A 1DM0B 3CD6A 4ULLA 3RZDH 1LYLA 1EU4A 4C1NI 2VY3A 4LF8L 1BCPF 2IX0A 4LFCL 1I94Q 4YHHQ 4CDDC 4KJOA 1SN8A 2Q8RE 4A3JH 1X65A 4A93H 4UP7A 5I6WA 5C0XJ 2XN9C 4LFAL 1SNQA 2SNMA 4YY3Q 4R9WA 2SEBD 3FPUB 4MTKA 4IUQA 5CC4A 4I7AA 2KEEA 1LUZA 4TSSA 2G5DA 1ZYRC 1MSGA 4JI0Q 1PRTF 3PIOA 3CCUA 2MUYA 3F2BA 2IWHA 1B50A 5I2XA 3SK5A 2LXJA 4HIDA 2E2IB 3DM1A 2K1BA 5I4DA 1H9MA 1L2FA 4JI4L 4QB4A 2IHFA 2VUMH 4DR5Q 2F03A 1D5ZC 1PYBA 1RTOA 4OHJA 5CV5A 1MHWC 4A3GH 4FXDA 3J7A5 4BY1G 4JI1Q 2SOBA 4DV7L 1QUQA 1WCMH 3AQQA 4K14A 4RFBA 3NQIA 3FDTA 3QO2A 3GTLB 3IKJA 1I4RA 1XMQQ 2OXPA 4HJ7A 1J6QA 1MSHA 3KF8A 4O0AA 2F0DA 3T53B 1H9JA 3CU7A 3KJPA 2CH4W 1JT8A 2KEDA 1VQBA 3OIPA 4C2MB 2F0LA 5IY0A 2QKIC 5IGBA 4L5RC 3STBD 1CKOA 1FJGQ 1LT4D 2HCCA 4BXXH 3NBIA 3S2HB 1AE3A 2Y0SB 3E3XA 3J80c 2VB3X 1Y1VB 5JJKA 1ENFA 4YCWA 1DZ1A 5I9OA 1WTVA 5FLXL 3CCRA 3CF5A 3HKZB 4N9PA 2OEOA 3OOCA 4LUVA 1EWHA 1V1OA
chains in the Genus database with same CATH topology
2WV6D 2RDHA 5BN3A 2EY5A 1CZWA 3KBXA 1EY4A 2PYKA 3D4WA 1IHZA 3R93A 1PTOC 1JR0D 2WINB 1VMCA 1JWMD 4IUPA 2K03A 2X6LA 4A3IB 2F0JA 3SDZA 1ZXTA 2ID0A 4XTCS 2F0WA 3GO5A 2K04A 1DOLA 2K5QA 2L0CA 3X3MA 4A3BB 1TKWB 2IJ0A 2TSSA 1F9RA 2RBMA 1EY5A 2MPMA 4DA2A 1XX8A 1AZPA 2ENBA 2K5WA 2PW5A 5JVH3 4DAYA 4G7HC 4IUTA 2K33A 3CQZB 1SAPA 3PUVA 1I3QB 1CK1A 2KA7A 4FNFA 1CFMA 4KMUC 4ZUIA 3OMCA 4UAIA 3GD7A 4IFDJ 3JAML 3NTHA 3CHBD 3MZ5A 1UNSA 5CV8A 1D5XC 3TDQA 1OO9B 3K5LA 3S1QB 5M5XB 1STNA 2F1MA 1VDZA 2NVXB 1M4VA 2QDBA 5ELDA 2ICIA 1F2YA 1V1PA 2B2TA 2EJFC 2EY2A 5D3DA 4RGMA 3L3OC 3MAQA 3OW7A 4OIKA 2NYZD 3PV0A 1IL8A 2NN6I 3ONAB 3HS0C 1Q8IA 4KV6A 2PQEA 1EY7A 1S5DD 1B9MA 2K01A 5C44B 4RHSA 2Z1CA 3HEJA 3TP7A 2RDFA 1JC7A 2WKDA 2B2TC 1Q12A 3S1NB 2AQ3B 3M7NA 2O4XA 3SEBA 1D1IA 2A5HA 2A69D 1I4QA 2L9HA 3HOVB 1GHJA 2CQAA 4DK0A 2H4OA 3MFYA 5A2QE 4H13C 1CZGA 3S2DB 2E2JB 3Q0AA 2NVTB 2QILA 2JE6I 1BNZA 1LT3D 2DN8A 2Z8LA 3ZYYX 1AZQA 3A8KE 2VB2X 3PIP3 1A3UA 4XYOA 2IPKD 2B2VA 1SYCA 4ZKCB 2IT1A 4RWSC 1XTCD 3DEOA 3RZDB 1HQRD 1KDBA 5EKKA 2R6GA 1SYBA 4TKOB 4TRDA 4CHTB 1RF2D 1R4QB 1EYAA 1SE3A 1PZKD 3V05A 4CBVA 1B2TA 1BDOA 3K57A 5I6YA 1O7ZA 1LTSD 1BXTA 2CW0D 4G57A 4AYBB 4CJ0B 4MN3A 2B2VC 5CV7A 5C4HA 1EY8A 1D2BA 3H0GB 3K5MA 5EGTA 2BE5D 2F0QA 1UEAB 5IT9E 1TT2A 2KQ3A 3LX0A 3T51B 1GUWA 3MFGA 3PUXA 4FF3A 5E1FA 1EZ6A 2J4XA 2A68D 3FVQA 1DOKA 4FP5D 3RUZA 2ZXOA 3S1MB 5EKIA 1I6VC 4RKBA 2O5JC 4V0BA 5EPLA 4A3FB 1ILQA 3M4OB 4X3UA 4ME5A 2AWNA 4J1MA 2E75C 3NTIA 1GXDC 4XDXA 4OO1H 1S4ZA 1G2SA 3PUWA 2A6HC 3E0JA 5C5LA 2TMPA 1G6ZA 3IAYA 4FO2A 3HG9A 3C1EA 3NWTA 1O7YA 3LNNA 3MXGA 1I50B 3SK4A 1LTTD 2EPBA 4EQOA 3EQLC 5IGEA 4FF4A 3VR6A 4HCSA 2RKSA 2JA8B 1HCZA 1SFOB 5EPKA 2F3WA 2F0OA 1L0YB 4LAAA 2FINB 2PZWA 4J6HA 1SNCA 4FXKC 4K8JA 5C0XI 5BN5A 3EA6A 4QUFA 4NDXA 2XRQD 3H94A 3BDOA 1JB3A 2F4IA 1IKMA 3VA7A 2RSOA 3I4NB 2JSOA 5EBCA 1J9OA 3QJYA 4BBSB 3SK8A 4H44C 3EFXD 3D4RA 2CW0C 1EU3A 3D8GA 1SYDA 3K5NA 1JE4A 2ZXPA 2IX1A 4BA1I 2XRSD 4DN4M 4XT1B 3W3AA 3OWEB 3J80L 2L5TA 1ZYRD 4IN3A 1W6JA 3F2UA 4WRDA 4BY7B 2EYOA 1QILA 3TZDA 1DD2A 5K5PA 1FGBD 1CQVA 3TP6A 3K6OA 5BN4A 1PFMA 4YIJA 2O5IC 3GP7A 4I7ZC 4C3IB 3BVMA 4ZRZA 2AUJD 2NTSA 1IW7D 4EQPA 2EE1A 3HRZC 4HEDA 4OL7A 1WTXA 5IGCA 4ODGA 1PYWD 4NP5A 5FO9B 1EIGA 1GJXA 4BY1B 1F9SA 4ILWA 4IUVA 1AN8A 4H7BA 4DGZA 1JQYD 1U9RA 5JPMC 4FXGC 3VA5A 1EQTA 1KABA 4CJ1B 1TWCB 3DUZA 1PXUA 4Q0FA 1ET6A 5E4XA 1W6KA 3A56A 1IKLA 1BCPB 1PTOD 2CVRA 1G8ZD 2WB1B 3KLSX 4X3SA 5I9PA 3PMFA 2LMCB 1ZEQX 4PNYA 1SSOA 1Y8PB 1HUNA 2KECA 1PRTB 4X3KA 1EZ8A 1RKNA 4IFDI 4O42A 1ML0D 4UDUC 4R8NA 1G91A 3TBIB 4WFN3 1GHKA 3NWSA 1H9SB 2NVQB 1WD1A 1EIHA 2QF7A 1G2TA 2RQXA 4IURA 2L4NA 5M3FB 2PCFB 4DXGA 2QCPX 2BA0A 4K6LA 4DFAA 4K6DA 4FF2A 2K6AA 1S5FD 3I72A 1HUMA 2NN6G 5LHY1 3K5OA 3OSOA 3A7AB 1EWCA 1IW7C 2E76C 2A6EC 1SDFA 2GA4B 3RLFA 3OMGA 5KGUA 1O78A 3GTOB 1TS5A 2EY6A 2ZT9C 1C48A 5IODA 3GTKB 1E0BA 3OWFA 3S14B 4C1NK 1PTOH 3CKIB 3H3VC 2KOLA 1AFPA 4IALA 2M2LA 1SYFA 1SEBD 1UUPA 3E6ZX 3DHQA 2Q8TA 2B8GA 3H6MA 2EYHA 1LTGD 2D62A 2AWOA 1WTPA 4RH6A 3J7YW 2F0KA 5IOCA 4ZAIA 4DF7A 2DY7A 5LL6S 5JEAJ 3TP8A 3I73A 4RKLA 5D14A 1HHVA 4M1UB 3AU7A 2PZTA 1HPCA 3MXPA 2JP1A 1LT5D 3VYRA 2IW3A 2K05A 1BO0A 3EROA 1RD9D 2E2HB 2EDGA 2F0UA 4BWGB 1VMPA 1R4PB 4PMBA 4QIWB 2BDNA 5FO7B 5E3FA 2F0VA 5CBAE 2AQ1B 3E5SA 5CBEE 4NKLA 4HTHA 4U68A 3I8ZA 3L9AX 2LY7A 1RTNA 3D31A 4KY5A 4Y7NB 1V43A 2EY1A 2B39A 3NTKA 4NMZA 4QUCA 4C3HB 2B2YA 3M4YA 1T5XD 2WKCA 4A3EB 2XSCA 2JA5B 5NUCA 1IYVA 1BOSA 1CI3M 1BQQT 3UI2A 3WDNA 5FKAC 1ICWA 3PO3B 1X32A 4XXEA 2A74C 1QNUA 1KNAA 4LMQD 5EQ0A 3P20A 2JEBI 3OIQA 2XNAC 2NB0A 1SYGA 2B2YC 1WTRA 3AB9A 2L1BA 1OXXK 4OO1G 3MXNA 1SNOA 4H0LC 2NN6H 4EVOA 5C4XB 1DONA 3TSSA 3ITPA 1TWGB 1SYEA 2F0FA 1M8AA 2E2DC 1JOOA 5LL6X 3BS1A 4G7OC 3IFDA 2X6GA 4G7ZC 1STYA 3FKIB 3MVVA 3TZUA 4HAEA 2D9UA 1SNDA 2R3ZA 2I07B 1LO5D 5C3EB 4CKEA 4QMGA 2LFNA 5T1IA 3BZDB 4N9TA 4IZ8A 3PO2B 3KBGA 2A6HD 5M5YB 2A73B 1DXMA 3P1HA 3P75A 4DK1A 3CRKC 2Z4IA 2EZVA 2C9OA 2NWGA 4U673 3SE0A 1JICA 2CHBD 3D3RA 1CA5A 3HP3A 5JAVA 5JPNC 4L6TB 1GUGA 4RHRA 4CKCA 1ET9A 5HGTA 2F0HA 2R92B 1BCPC 1OXTA 1XYIA 2F0PA 2KVMA 1HRJA 2PPBC 1H9SA 1XWEA 3D6CA 3BYYB 4A3JB 4A93B 2FFKB 1EY6A 5FOBB 1FR3A 4Z9CB 5JVG3 1HQMC 3SHLA 1YNND 1LTID 1CHPD 2ICEC 1BR9A 1PRTC 1KDAA 2YYZA 1S5ED 3P7JA 5T1GA 1HFNA 2PZUA 1B44D 1DJRD 1Q1EA 4XQNA 2VUMB 1ONLA 3BYTB 3J81E 3J7AV 2K32A 4QF4A 4A3GB 1Q1BA 4C56C 1CM9A 3VR2A 5CORA 1WCMB 3GV6A 3C2PA 1CHQD 1MBYA 3Q6SA 4KHZA 1G291 1A3TA 4KY6A 2DNEA 1I4PA 1ZKOA 2IL8A 5EPJA 4DAVA 2N88A 1FYCA 1E2WA 3U9OA 5I2YA 1JOQA 3J80E 1STBA 2I46A 3V2TA 5JOBA 1QWYA 2JA6B 1U4MA 2EXZA 1PTOF 1Z47A 1SMYC 3OPOA 1WD0A 1RCVD 1Z7TA 2EYJA 2XIWA 2OF1A 3C46A 2Z4HA 1QCBD 3BDCA 5J1ZA 1OXVA 3KLRA 2SNSA 3HOZB 4O1NA 1KAAA 4BBRB 2R61A 1RDPD 2F0TA 3I90A 3SK6A 1AEXA 1S5BD 5JJZA 3N52A 1NAPA 3W2DA 3S1RB 4DU9A 1C4QA 3QIAA 2KUMA 3WOEA 5IT9L 4KKTA 3N6RA 3Q23A 1YNNC 2D2CC 4J8QA 5C3WA 1B4OA 3FEWX 1STGA 1MD2D 1A2TA 5G3LD 1WTQA 3S17B 4HSVA 5EJWA 1UAPA 4MIUA 1F2MA 1HA6A 4KTAA 1PFNA 1QJOA 2DNCA 5ELBA 3G7LA 5F2DA 2K28A 1GUSA 2EYMA 3C1FA 3BDLA 3KK7A 5C4JB 1STAA 3URYA 1WTOA 4KD3A 1NCVA 5KNDA 3I4LA 1DCZA 1JWUD 3T4AC 4C3JG 2A6ED 3R2TA 2LKVA 4ZK9B 3PUZA 1K83B 1F9PA 3CRLC 1SNMA 1JOKA 3T56B 5M5WB 4XYQA 4CGYB 3A55A 2BA1A 3BVGA 3DEPA 1HA5A 5COYA 5C3XA 3WOFA 1WVLA 2MHVA 4KKSA 1PFBA 3MC0B 1EEID 3NK9A 1QG7A 3X3NA 5J39A 1YNJD 4KY7A 2WIIB 1GUOA 1U4PA 3R2IA 5DM73 3DMUA 1K8MA 1I4GA 5C6AA 5K36H 3MEHA 4HMJA 1PLFA 1LACA 3T13A 1HXYD 1NR4A 1LT6D 4XT3B 3D6WA 2NVYB 4HR7B 5FLXE 5ELFA 4XQJA 4B9WA 3A8IE 3C3LA 4PQXA 3Q24A 3MA2B 3H09A 4IFDH 1D1KA 3I3CA 1DOMA 5CV9A 2FHTA 1VF5C 1TWHB 1EEFD 2ZXRA 5CV4A 5KYLA 3VYUA 1O7LA 1STHA 1PZJD 4I65A 2JEAI 3K7AB 5DEHA 1NR2A 3LWUA 5A35A 3GQBA 4F7XA 1S5CD 4EGVA 2JA7B 2RA4A 1TY2A 1FNVA 5DM63 3BG3A 3NE5B 4C3IG 3PIO3 4K2LA 2AQ2B 3V96A 2B63B 4B9XA 3O13A 5D65A 4QCLA 3NHHA 4KK7A 1Y8OB 1IYUA 3Q22A 3TP5A 4L63B 4LJZC 1C8CA 2KCNA 2EYLA 1D5MC 5FO8B 2X69A 1MI2A 3T16A 2HDLA 2YU9B 4B08A 3L7ZC 3JAME 3K59A 1Q90A 2QEJC 4K5XA 3S15B 1TY0A 4K5WA 1YNJC 4R8IA 5J22A 2VNUD 4BA2I 2FMCA 2M9VA 1I4XA 2L12A 1FNUA 3M7GA 5KYIA 3G6JB 4G4KA 1ILPA 2JXMB 3SR1A 4FYDA 2PMZB 3M85A 4EQNA 2BOSA 4M8AA 1TU2B 5M9OA 2LS01 3DWQA 1Z6HA 2RDGA 5KRUA 1E2VA 2C5CA 4KD4A 4E6IA 3A54A 1AW7A 3NSWA 1EYDA 3VR3A 2D5DA 4DXFA 1F9QA 4FF1A 4HN7A 1SJED 2SDFA 1XXGA 1ESFA 1U4LA 3SVMA 1BCPD 5IGFA 3RD4A 2G9DA 5KNBA 1RJTA 1EQVA 1LABA 5EKLA 3FPPA 1HTPA 2MP1A 2K5DA 4A3MB 2HUGA 4WJWA 3R3OA 5DAUA 3BVZA 3PUYA 3M3YB 4RGOS 1PRTD 3FMCA 5HURA 3ND8A 1SE2A 2F0GA 1GUTA 4IQZA 3VYTA 5FK9C 5IGDA 3EVQA 1B3AA 1KLUD 1EYCA 4GZYC 1VCIA 3I70A 4RGTA 1I4HA 1QOHA 1GOZA 4ABNA 2KHSA 5KEEA 4S3SA 2NZ1D 2EJGC 5DNFA 5ISRA 2NBFA 1CQFA 5ELEA 2AUKA 3A7LA 1SNPA 4PMCA 1KTKA 1PDQA 5C0XG 3IFTA 4TQUS 2HCIA 2MGSA 5KNCA 3GV3A 5CMDA 4RCNA 1ENAA 1TS2A 3ND9A 1BBXC 1X3QA 3QB3A 2M00A 3TN2A 4IUNA 1NUCA 4K8IA 5D3IB 1TS4A 4IUUA 4JK1C 4HMIA 4OIJA 3AMUA 2J0TD 3NXWA 2F0MA 1SBBB 1SMYD 1TIID 1MGSA 4KJNA 3I91A 2XWBB 4C3HG 4FVMA 3NQTA 1A6XA 2FJ2A 4XIGS 1STEA 3MTSA 3HOXB 2L11A 4DAPA 1HTLD 4KHVA 2F3VA 1QB5D 1LTRD 2BDOA 1SXTA 5G3LF 3K0YA 1J8IA 4KN4C 3A8JE 1F2LA 4X3TA 3KUPA 4A3KB 1R9TB 1GUNA 2JYOA 1K8OA 1H9KA 3RZOB 2R93B 3FRPB 3NBHA 2IX3A 1BUVT 2WAQB 3MHBA 2BCOA 4ZLTF 1LV9A 1EY0A 3GTQB 1HFGA 3HOYB 4KI0A 2Q8IB 4ZQ3A 3TMEA 4RA8A 1TQOA 1EOTA 2NUCA 2XVSA 1TVXA 4RCOA 3GTGB 2F0SA 2F0IA 1CA6A 4L8JA 5JEAG 1Y1WB 2NTTA 3GTJB 1L0XB 4DNTB 5A2QL 1BF4A 3IL8A 3NUCA 2H1EA 4MHEA 3NP8A 4HCEA 3S16B 1NSNS 3MXUA 2WP8J 4A3DB 1KLGD 2HQEA 1B53A 4ID6A 2EYFA 3SXHA 1EL0A 1LLRD 1CT1D 1PTOB 3J7AF 1PZID 5K36G 5TSSA 4ZYSA 1SJHD 4DNRB 2PW7A 4Q5VA 3NPPA 2A69C 3LWEA 4OGQC 1SE4A 1EY9A 2F0EA 3QOLA 4C3JB 2B2WA 1T5EA 1X3PA 5CGKA 4OO1I 3HOUB 3U9SA 1KNEA 1TS3A 4F87A 4IFDG 4K5VA 1QE6A 4F88A 5CV6A 1D6EC 4CJ2C 1Y69U 4BS9A 1A15A 1VF7A 3D4DA 2FMMA 3S9WA 5C0XH 1RHPA 4V190 1O80A 2DY8A 2WACA 5CYUA 5KIXA 5M3MB 2KJXA 2HDMA 1ENCA 2L55A 5CR3A 5ELCA 2B2WC 1QNKA 4PMWA 3DWAA 2EYPA 2N55A 3J81L 3EJIA 1LTBD 1Q3LA 1FNWA 2F0NA 2E74C 1RODA 1JCKB 1FD7D 2B2UA 1DYQA 2RVLA 2VXWA 4K2KA 4ZUJA 4PV1C 3QG1A 1A3VA 2EVBA 3QWNA 2XWJB 4ZKBB 1OXSC 3VR4A 3QOJA 5IIFA 2EJMA 3ERQA 1H9RA 4KKUA 1LTAD 3HGBA 1Y8NB 2PNRC 2B8FA 5IGGA 2BE5C 4NW2A 4HSPA 2B2UC 2MJ8A 1JORA 1JWSD 1ESRA 2RSNA 1I6HB 3VYSA 1CTMA 1F77A 3OHXC 2A68C 3KLSA 4RGNA 3GTPB 1V1PB 1WTWA 4P2CB 2EOTA 2R7ZB 4KN7C 2KCCA 1KDCA 4WORA 1V8QA 1F2ZA 3RMHA 4F8MA 1TR5A 5JEAH 1AP0A 3I4MB 4XQQA 1TWFB 1EFID 2OT2A 2V4DA 3DXJC 3R8BA 4RAUC 1PMRA 3HOWB 1A2UA 4CKBA 1B9NA 1OXUA 5EBDA 1E2ZA 3VR5A 5C5MA 3H91A 5AFWA 2O2LD 2PO4A 2G9HD 4JBWA 4LK1C 5C4ZA 1TWAB 3K58A 1II3A 1U4RA 2K7VA 2J7ZA 1B1ZA 3DWPA 3GTMB 3HZXA 5E4WC 3MWYW 1DM0B 4ULLA 1EU4A 4C1NI 1BCPF 2IX0A 4KJOA 2Q8RE 5I6WA 5C0XJ 2XN9C 1SNQA 2SNMA 4R9WA 2SEBD 3FPUB 4IUQA 5CC4A 2KEEA 4TSSA 1ZYRC 1MSGA 1PRTF 2MUYA 2IWHA 1B50A 5I2XA 3SK5A 2E2IB 3DM1A 2K1BA 5I4DA 1H9MA 4QB4A 2F03A 1D5ZC 1RTOA 4OHJA 5CV5A 4FXDA 2SOBA 4K14A 4RFBA 3NQIA 3FDTA 3QO2A 3GTLB 3IKJA 1I4RA 2OXPA 1MSHA 3KF8A 2F0DA 3T53B 1H9JA 3CU7A 2KEDA 3OIPA 4C2MB 2F0LA 2QKIC 5IGBA 1LT4D 2HCCA 3S2HB 3NBIA 2Y0SB 2VB3X 1Y1VB 1ENFA 1DZ1A 5I9OA 1WTVA 5FLXL 3HKZB 4N9PA 2OEOA 3OOCA 1EWHA 1V1OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O78 A;  1H9R A;  2A6E D;  2K7V A;  5C0X G;  3IFT A;  4KKU A;  4TQU S;  3WDN A;  3BG3 A;  3NE5 B;  3OW7 A;  5BN3 A;  1GUG A;  5KNC A;  1BDO A;  2ZT9 C;  3MXU A;  4RCN A;  3PV0 A;  3PUZ A;  5BN5 A;  3ND9 A;  3CRL C;  3HGB A;  3VR3 A;  1Y8N B;  2D5D A;  2PNR C;  2B8F A;  1OXT A;  3H94 A;  2NN6 I;  3T56 B;  3BDO A;  1SMY C;  3P20 A;  2BE5 C;  3OPO A;  2PPB C;  1Z7T A;  2BA1 A;  2JEB I;  3VA7 A;  1H9S A;  4JK1 C;  3QJY A;  5K36 G;  1Y8O B;  1B9M A;  1IYU A;  3SDZ A;  2BE5 D;  2B8G A;  4KKS A;  4DNR B;  4XTC S;  1OXV A;  4H44 C;  3KLR A;  1CTM A;  5KNB A;  1FR3 A;  3T51 B;  3D4R A;  2CW0 C;  1LAB A;  1HQM C;  2D62 A;  2A69 C;  2AWO A;  1TKW B;  2A68 C;  4OGQ C;  4LJZ C;  3AB9 A;  1A6X A;  3FPP A;  1Q12 A;  1ZYR C;  1HTP A;  2LMC B;  3PUX A;  4XIG S;  1OXX K;  4OO1 G;  4BA1 I;  3M7N A;  1T5E A;  2YYZ A;  2EJM A;  2A69 D;  3W3A A;  2A68 D;  4H0L C;  2NN6 H;  1Y8P B;  3PUY A;  2L5T A;  3U9S A;  4KN7 C;  1GUO A;  1GHJ A;  2KCC A;  3I73 A;  3L7Z C;  4IFD G;  4G7H C;  4DK0 A;  1V8Q A;  1I6V C;  1Q90 A;  3QIA A;  2K33 A;  2O5J C;  3MFY A;  2BDO A;  1H9M A;  4KKT A;  3FMC A;  3N6R A;  1K8M A;  1HPC A;  3PUV A;  1Q1E A;  1YNN C;  2D2C C;  4H13 C;  1DD2 A;  4G7O C;  5JEA H;  5K36 H;  2KA7 A;  4G7Z C;  1CFM A;  1ONL A;  1YNJ C;  4KMU C;  3ND8 A;  1Y69 U;  2K32 A;  4BA2 I;  1LAC A;  1VF7 A;  2EDG A;  3A8J E;  1Q1B A;  4KN4 C;  1GUT A;  5BN4 A;  5C0X H;  4IQZ A;  3TZU A;  1GHK A;  1H9S B;  2JE6 I;  2E75 C;  3VR2 A;  2O5I C;  1GUN A;  3IKJ A;  1K8O A;  4I7Z C;  1H9K A;  2QF7 A;  4HR7 B;  3GD7 A;  4KHZ A;  2DN8 A;  1G29 1;  4OO1 H;  2JXM B;  2AUJ D;  3PUW A;  2A6H C;  2DNE A;  3T53 B;  1H9J A;  3A8K E;  3A8I E;  2PCF B;  1ZKO A;  1IW7 D;  2V4D A;  4GZY C;  1VCI A;  3DXJ C;  1PMR A;  2BA0 A;  1QJO A;  2DNC A;  3M85 A;  4IFD H;  2E74 C;  4KI0 A;  2A6H D;  1FYC A;  2IT1 A;  1DXM A;  1E2W A;  3D31 A;  3I72 A;  2Q8I B;  1TU2 B;  1B9N A;  2NN6 G;  1VF5 C;  1GUS A;  3LNN A;  1OXU A;  4DK1 A;  2EJG C;  1V43 A;  1VDZ A;  2F1M A;  3CRK C;  1E2Z A;  3VR5 A;  1Z6H A;  3A7A B;  3EQL C;  4PV1 C;  3QG1 A;  3VR6 A;  1O7L A;  1GJX A;  1IW7 C;  2E76 C;  2EVB A;  3OOC A;  2R6G A;  4L8J A;  3SE0 A;  2JEA I;  2A6E C;  1OXS C;  5KND A;  3VR4 A;  3M4Y A;  4TKO B;  5JEA G;  4JBW A;  1HCZ A;  2EJF C;  3I4L A;  3LWU A;  5A35 A;  4LK1 C;  2AUK A;  3A7L A;  3GQB A;  3RLF A;  1DCZ A;  4DNT B;  1E2V A;  1CI3 M;  1EWH A;  1IYV A; 
#chains in the Genus database with same CATH topology
 2WV6 D;  1BBW A;  3RLN A;  2IY5 B;  3KJO A;  4GLV B;  4AQY Q;  2RDH A;  2H5X A;  1S72 A;  2Z6B A;  5BN3 A;  2EY5 A;  4R4I A;  2JA6 H;  1HZB A;  1CZW A;  3KBX A;  1EY4 A;  4LFB Q;  2PYK A;  3D4W A;  1WJJ A;  1WYD A;  1IHZ A;  3R93 A;  1PTO C;  1JR0 D;  1HNW L;  2WIN B;  3KLW A;  1VMC A;  1JWM D;  4IUP A;  2K03 A;  3TRE A;  2X6L A;  4LUZ A;  2ATW A;  2A1A A;  1SFO H;  4A3I B;  1IBK Q;  2F0J A;  4LNQ A;  1E24 A;  3SDZ A;  1ZXT A;  2ID0 A;  2EXD A;  2EQS A;  4XTC S;  2F0W A;  3A0J A;  3GO5 A;  2K04 A;  1DOL A;  2K5Q A;  2L0C A;  3X3M A;  1LM0 A;  3HOZ H;  4BBR H;  4A3B B;  1TKW B;  2IJ0 A;  2TSS A;  4JI6 Q;  1F9R A;  2RBM A;  4LF5 L;  5M3F G;  3ICE A;  1EY5 A;  2MPM A;  4DA2 A;  1XX8 A;  4JI2 Q;  3S1R H;  1AZP A;  2ENB A;  4GS3 A;  2K5W A;  2PW5 A;  5JVH 3;  4DV2 L;  4DAY A;  4JBJ A;  4G7H C;  4IUT A;  2K33 A;  3TS0 A;  3CQZ B;  1LTL A;  1SAP A;  4BBS H;  3PUV A;  1I3Q B;  1CK1 A;  2KA7 A;  1MKH A;  1SR3 A;  1CFM A;  4FNF A;  4KMU C;  4NXM L;  4ZUI A;  3DM3 A;  1HR0 W;  3S17 H;  5IWA Q;  4IPC A;  4LF7 Q;  1KD1 C;  3OMC A;  4UAI A;  3GD7 A;  2D0O A;  4IFD J;  3JAM L;  1QZH A;  3NTH A;  3CHB D;  3MZ5 A;  1UNS A;  5CV8 A;  1D5X C;  3TDQ A;  1HZA A;  1OO9 B;  3K5L A;  3S1Q B;  5M5X B;  1PH7 A;  4QGU A;  1STN A;  5C4J H;  2F1M A;  1VDZ A;  2NVX B;  2L15 A;  4N8X 1;  1M4V A;  2QDB A;  1FL0 A;  1D7Q A;  5ELD A;  1YNX A;  3FP9 A;  2ICI A;  3UDI A;  1F2Y A;  1V1P A;  1J5E L;  2B2T A;  2EJF C;  2EY2 A;  5D3D A;  2UUC Q;  4JW0 A;  1I5F A;  2VQE Q;  4RGM A;  4DPG A;  1S40 A;  3L3O C;  3MAQ A;  3OW7 A;  4OIK A;  2NYZ D;  3BZC A;  3PV0 A;  1IL8 A;  3ERS X;  5M5W H;  2NN6 I;  3ONA B;  3HS0 C;  1EOV A;  1Q8I A;  4BY1 H;  5IP9 G;  4KV6 A;  4DR2 Q;  2QA4 A;  2RHS B;  2PQE A;  1EY7 A;  1S5D D;  1B9M A;  2K01 A;  1C9O A;  5C44 B;  4RHS A;  2Z1C A;  3HEJ A;  3TP7 A;  2RDF A;  1A63 A;  1JC7 A;  2WKD A;  2B2T C;  1XNQ L;  3J7Z C;  4B3M Q;  1Q12 A;  3S1N B;  1IBM Q;  1ICF B;  2AQ3 B;  3M7N A;  2O4X A;  4GN3 B;  3SEB A;  1D1I A;  2A5H A;  2A69 D;  1I4Q A;  1BBU A;  4P71 A;  2L9H A;  2DJF C;  2QEX A;  3HOV B;  1GHJ A;  2CQA A;  4JYA L;  4DK0 A;  1VQF A;  2H4O A;  3MFY A;  5A2Q E;  1IZ6 A;  2CFM A;  4H13 C;  1CZG A;  3S2D B;  5BR8 Q;  3KDF B;  2E2J B;  3Q0A A;  3CP0 A;  2NVT B;  4A3E G;  2QIL A;  1KRS A;  2UXB Q;  2JA5 G;  2NVY H;  2JE6 I;  1BNZ A;  3HFZ B;  3OTO Q;  1LT3 D;  4IO9 A;  2DN8 A;  2Z8L A;  1NBW A;  1E1T A;  3ZYY X;  3PO3 G;  1AZQ A;  3A8K E;  1P8L A;  2VB2 X;  3PIP 3;  3CC4 A;  1A3U A;  2DGY A;  2I5L X;  4XYO A;  3U4Z A;  1K8G A;  4JOI A;  3ULL A;  4A3M G;  1S3O A;  4LF4 Q;  2IPK D;  5IYD H;  2B2V A;  1SYC A;  2K14 A;  4ZKC B;  2N3S A;  3PIP A;  2IT1 A;  2KEN A;  1TWH H;  4RWS C;  1IL2 A;  1XTC D;  1L1O B;  2OWO A;  1C0A A;  3DEO A;  3RZD B;  1HQR D;  1KDB A;  5EKK A;  1V9P A;  3PF5 A;  2R6G A;  1SYB A;  4TKO B;  4TRD A;  5M3F H;  1WTH A;  3S24 A;  4JV5 Q;  2JA7 H;  1Q86 C;  4CHT B;  5GAE C;  1RF2 D;  1R4Q B;  1EYA A;  1ASZ A;  1SE3 A;  1PZK D;  3V05 A;  4CBV A;  2B63 H;  1B2T A;  1BDO A;  4YWM A;  3K57 A;  5C4X G;  5I6Y A;  1O7Z A;  3A5Z B;  1LTS D;  1BXT A;  2CW0 D;  4G57 A;  1HR0 Q;  4AYB B;  4CJ0 B;  4MN3 A;  2B2V C;  5CV7 A;  5C4H A;  1EY8 A;  1D2B A;  4DR3 Q;  3H0G B;  3K5M A;  5EGT A;  2JA9 A;  2MNA A;  2BE5 D;  2F0Q A;  1UEA B;  5IT9 E;  2KHJ A;  1TT2 A;  2KQ3 A;  3LX0 A;  3T51 B;  1GUW A;  3MFG A;  1UWV A;  2DUD A;  4H02 A;  3PUX A;  4FF3 A;  3S14 H;  4JI3 L;  5E1F A;  1EZ6 A;  4DUY Q;  2J4X A;  2YU9 H;  1N9W A;  2A68 D;  3FVQ A;  1DOK A;  4FP5 D;  3RUZ A;  3PO2 G;  1E22 A;  2ZXO A;  4OEL B;  1E7Z A;  1I6V C;  4RKB A;  5EKI A;  3S1M B;  2O5J C;  4V0B A;  5EPL A;  3ULP A;  4DAM A;  2Q2H A;  4AH6 A;  2VQF Q;  4A3F B;  3CCQ A;  4DR7 L;  1ILQ A;  3M4O B;  4X3U A;  4ME5 A;  2AWN A;  4LW1 A;  1PHJ A;  4J1M A;  1EWI A;  2E75 C;  3NTI A;  4JBM A;  1NE3 A;  1K3R A;  1GXD C;  4XDX A;  3T1H Q;  1HNZ Q;  4GKJ L;  4OO1 H;  4IJL A;  1S4Z A;  1VQH A;  2V1C C;  1G2S A;  4K0K Q;  3PUW A;  2A6H C;  2K75 A;  3E0J A;  1NMF A;  5C5L A;  1XMO L;  3K81 C;  2TMP A;  1G6Z A;  2R92 G;  2N8N A;  3IAY A;  4OWX B;  4FO2 A;  3HG9 A;  3C1E A;  2B3G A;  3NWT A;  2ZJQ A;  1O7Y A;  3LNN A;  3MXG A;  1I50 B;  3SK4 A;  4OWW B;  1LTT D;  4LF9 L;  2EPB A;  4EQO A;  3EQL C;  5IGE A;  3CC7 A;  4A3J G;  2AMC B;  3VR6 A;  1JMC A;  4FF4 A;  4HCS A;  2RKS A;  3NEN A;  2JA8 B;  1HCZ A;  1SFO B;  5EPK A;  2F3W A;  2F0O A;  1L0Y B;  1HJP A;  4LAA A;  2FIN B;  4A3K G;  1FGU A;  2PZW A;  1KC8 C;  4J6H A;  3U50 C;  1SNC A;  4FXK C;  4K8J A;  5C0X I;  4Y7N H;  5BN5 A;  4LWC A;  2KBN A;  3EA6 A;  2K5N A;  4QUF A;  1WFQ A;  4NDX A;  2VW9 A;  5J3B A;  2XRQ D;  3H94 A;  4HJ5 A;  3BDO A;  1JB3 A;  2F4I A;  1IKM A;  2DJG C;  4A3E H;  3VA7 A;  2VUM G;  2RSO A;  3I4N B;  2JA5 H;  2JSO A;  5EBC A;  1J9O A;  3QJY A;  4A3G G;  1VQI A;  4BBS B;  3SK8 A;  4H44 C;  3EFX D;  1WCM G;  3PO3 H;  1YEZ A;  3D4R A;  2CW0 C;  1EU3 A;  3D8G A;  1SYD A;  2Q2I A;  1W2B A;  2K5V A;  3K5N A;  4HIO A;  1JE4 A;  2ZXP A;  2IX1 A;  2A19 A;  4A3M H;  2R7D A;  4BA1 I;  4JCV E;  2XRS D;  4DR6 L;  4DN4 M;  4XT1 B;  3W3A A;  4NPS A;  3OWE B;  3J80 L;  1VQ9 A;  1VQP A;  2L5T A;  1ZYR D;  4IN3 A;  1W6J A;  3F2U A;  4WRD A;  5AJ3 Q;  4A3D G;  4BY7 B;  2VZA A;  3FHW A;  5H1S E;  2EYO A;  1QIL A;  3TZD A;  4GNX B;  1DD2 A;  1EYG A;  4GKK Q;  5K5P A;  2I0Q A;  1FGB D;  2CQO A;  4Y52 H;  1CQV A;  3TP6 A;  1KXL A;  3K6O A;  5BN4 A;  1ASY A;  1PFM A;  2RF4 A;  4YIJ A;  2BH8 A;  2O5I C;  3GP7 A;  3T1Y Q;  4I7Z C;  4C3I B;  3WWV A;  3LGJ A;  3BVM A;  4ZRZ A;  1TWG H;  2AUJ D;  2JQO A;  4IOC A;  2NTS A;  1HZ9 A;  1IW7 D;  2JA6 G;  4EQP A;  2EE1 A;  3E0E A;  2QW7 A;  4X64 Q;  3HRZ C;  4HED A;  4OL7 A;  3HOU G;  3MXN B;  1WTX A;  1HH2 P;  4OX9 L;  5IGC A;  4ODG A;  1PYW D;  4NP5 A;  5FO9 B;  2E5L Q;  1EIG A;  2I5H A;  1GJX A;  4BY1 B;  1F9S A;  4ILW A;  4ALP A;  4IUV A;  1AN8 A;  4H7B A;  4DGZ A;  3HOZ G;  1JQY D;  4B3S L;  1U9R A;  2NZH A;  4GN5 A;  5JPM C;  1YIT A;  4FXG C;  4DV0 L;  3PO2 H;  3VA5 A;  3IRB A;  1EQT A;  5M3M G;  1KAB A;  4CJ1 B;  1TWC B;  3DUZ A;  1PXU A;  4Q0F A;  1ET6 A;  3KDF A;  2F3I A;  5E4X A;  4QIW E;  1W6K A;  3A56 A;  1IKL A;  1E3P A;  1BCP B;  1YBY A;  1L0W A;  1PTO D;  2CCZ A;  2Q2U A;  2PI2 E;  2CVR A;  1G8Z D;  1Q8K A;  4L5T A;  2WB1 B;  3KLS X;  4X3S A;  1D8L A;  5I9P A;  4TVA B;  3PMF A;  4LF8 Q;  2R92 H;  2LMC B;  1ZEQ X;  4PNY A;  4OEM B;  1SSO A;  1L1O A;  1PH5 A;  2RCN A;  3CCM A;  1Y8P B;  1HUN A;  1YVC A;  2KEC A;  1AE2 A;  1PRT B;  3EIV A;  2NZO A;  2MO1 A;  4LFA Q;  4X3K A;  1JE5 A;  1EZ8 A;  1RKN A;  1VQD A;  4DUZ Q;  4IFD I;  4O42 A;  5LMN L;  1NNX A;  1ML0 D;  4UDU C;  4R8N A;  1G91 A;  3TBI B;  4WFN 3;  4WJ4 A;  1PVO A;  4A3K H;  1R9T H;  1GHK A;  3NWS A;  1H9S B;  3RZO H;  2CH4 A;  2R93 H;  3M4P A;  2NVQ B;  1WD1 A;  1EIH A;  2K4K A;  2QF7 A;  1G2T A;  2RQX A;  4JI4 Q;  5IYC G;  3A74 A;  4IUR A;  2L4N A;  5M3F B;  3GTQ H;  2PCF B;  4DXG A;  2QCP X;  2BA0 A;  4K6L A;  3HOY H;  4DFA A;  1Z9F A;  4K6D A;  4DV7 Q;  4FF2 A;  4JI8 Q;  2K6A A;  1S5F D;  4JI5 Q;  4PZ8 A;  4YY3 L;  1VQL A;  2R7Z G;  3I72 A;  1HUM A;  2NN6 G;  5LHY 1;  3K5O A;  3OSO A;  1N36 Q;  3A7A B;  3TEH B;  4POG A;  1EWC A;  1K28 A;  3CAM A;  1HNX L;  1IW7 C;  2E76 C;  1Y1W H;  3H3V I;  2A6E C;  5IT9 c;  3GTJ H;  1SDF A;  2GA4 B;  3RLF A;  3OMG A;  2QGQ A;  5KGU A;  1O78 A;  3GTO B;  3S16 H;  1TS5 A;  2ASB A;  4DR5 L;  2EY6 A;  2ZT9 C;  4A3D H;  1C48 A;  5IOD A;  3GTK B;  1E0B A;  4JI1 L;  3OWF A;  3S14 B;  3J81 i;  4C1N K;  1PTO H;  1YJ9 A;  3CKI B;  3H3V C;  1IBL Q;  2KOL A;  1XMQ L;  1AFP A;  1VQK A;  2F4V Q;  4IAL A;  2M2L A;  1SYF A;  2CWP A;  4P74 A;  1SEB D;  1UUP A;  3E6Z X;  3DHQ A;  2Q8T A;  1GM5 A;  2B8G A;  3GDE A;  3H6M A;  5ELN A;  1X3E A;  2EYH A;  1LTG D;  2D62 A;  2AWO A;  1WTP A;  3L0O A;  3B6Y A;  4RH6 A;  3J7Y W;  2F0K A;  5IOC A;  1FJG L;  4ZAI A;  4DF7 A;  3HOU H;  2DY7 A;  1PH6 A;  4IOA A;  3J81 j;  5LL6 S;  4DKA C;  5JEA J;  3TP8 A;  2HIX A;  3I73 A;  4RKL A;  5D14 A;  5IYD G;  4M1U B;  5LMU Q;  1HHV A;  1K8A C;  3AU7 A;  2PZT A;  1HPC A;  3MXP A;  2JP1 A;  4R4O A;  1LT5 D;  3VYR A;  2IW3 A;  4POF A;  2K05 A;  1CKM A;  1WI5 A;  1BO0 A;  3ERO A;  1RD9 D;  2E2H B;  2EDG A;  2AKW B;  2F0U A;  4BWG B;  2GVA A;  1VMP A;  4JI7 Q;  1R4P B;  4LFB L;  4CDE C;  4PMB A;  4B3R Q;  2KCT A;  4QIW B;  2JA7 G;  5M3M H;  2BDN A;  2HD3 A;  3CC2 A;  5FO7 B;  1KHI A;  3TRZ A;  5E3F A;  2F0V A;  5CBA E;  3RNU A;  2AQ1 B;  3E5S A;  2B63 G;  5CBE E;  4NKL A;  4HTH A;  4JVZ A;  4U68 A;  2XTI A;  4LF6 L;  3I8Z A;  4DV6 Q;  3K8A A;  3L9A X;  2LY7 A;  1RTN A;  3D31 A;  4KY5 A;  4Y7N B;  1V43 A;  4MTN A;  4JI6 L;  1UE5 A;  2EY1 A;  1UE7 A;  2B39 A;  3NTK A;  4NMZ A;  4MNO A;  4QUC A;  5GRO A;  4C3H B;  3A5U A;  2B2Y A;  1Q46 A;  3M4Y A;  1T5X D;  2WKC A;  4X62 Q;  4A3E B;  1XNR Q;  2XSC A;  2JA5 B;  3PCO B;  5NUC A;  1IYV A;  1BOS A;  1CI3 M;  1BQQ T;  3M4Q A;  3CCS A;  5JJI A;  3UI2 A;  3WDN A;  5FKA C;  1ICW A;  4YWL A;  2QDL A;  3PO3 B;  3EBE A;  1X32 A;  4DR4 L;  3HKS A;  4XXE A;  4R4T A;  2A74 C;  1GO3 E;  2ZTD A;  1QNU A;  1KNA A;  3OW2 A;  1NJI C;  1YZ6 A;  4LMQ D;  5IWA L;  5EQ0 A;  1YHA A;  3P20 A;  4LF7 L;  1CKN B;  4L5Q A;  2JEB I;  3CCE A;  3OIQ A;  2XNA C;  5GAH C;  2GN5 A;  3TS2 A;  2Y0S G;  1I6H H;  1Y1V G;  2NB0 A;  1SYG A;  5IYC H;  2B2Y C;  1K83 H;  3GTP H;  1WTR A;  3AB9 A;  2L1B A;  1OXX K;  4OO1 G;  3MXN A;  2R7Z H;  2UXC L;  1SNO A;  1XJV A;  4H0L C;  1K0R A;  2NN6 H;  4EVO A;  5C4X B;  1DON A;  3TSS A;  4DNI A;  4R4Q A;  4DV4 Q;  3ITP A;  1B3Q A;  1TWG B;  2UUA L;  1SYE A;  4IPD A;  2F0F A;  1M8A A;  2E2D C;  1JOO A;  5LL6 X;  3BS1 A;  4G7O C;  2VQE L;  3IFD A;  2X6G A;  4G7Z C;  3PSI A;  2LXK A;  1STY A;  3FKI B;  1TWF H;  3MVV A;  3TZU A;  1K73 C;  4HAE A;  3JC6 6;  2D9U A;  1SND A;  2OQ0 A;  2R3Z A;  2I07 B;  1LO5 D;  5C3E B;  4UP8 A;  4CKE A;  4QMG A;  2LFN A;  5T1I A;  3BZD B;  4N9T A;  4IZ8 A;  3UE0 A;  3PO2 B;  3KBG A;  2A6H D;  5M5Y B;  2A73 B;  1DXM A;  1KL9 A;  1YHQ A;  3P1H A;  3P75 A;  3G48 A;  4DK1 A;  3CRK C;  2Z4I A;  2EZV A;  1IBM L;  4DR1 L;  2C9O A;  2NWG A;  4U67 3;  3SE0 A;  1SE8 A;  1JIC A;  2CHB D;  1N34 Q;  5JJL A;  3CCJ A;  3D3R A;  1TWA H;  5HY6 A;  2JK8 A;  3UE1 A;  1CA5 A;  3HP3 A;  4X66 L;  3GTM H;  1Q7Y C;  1N8R C;  5JAV A;  2UU9 Q;  5JPN C;  4L6T B;  1GUG A;  1XPU A;  4RHR A;  4CKC A;  1ET9 A;  5HGT A;  2F0H A;  4ME3 A;  3RLO A;  5BR8 L;  2R92 B;  1BCP C;  1OXT A;  1XYI A;  3Q8D A;  4QQB X;  2UXB L;  2F0P A;  1YIJ A;  4P75 A;  2UXD L;  3K7A H;  2KVM A;  1HRJ A;  3M9B A;  2PPB C;  1H9S A;  3OTO L;  2YTY A;  1XWE A;  4PG3 A;  3D6C A;  3BYY B;  1PFS A;  4KHP L;  4A3J B;  1QVG A;  4A93 B;  2FFK B;  1DGS A;  1EY6 A;  5FOB B;  1FR3 A;  4X65 L;  4Z9C B;  5JVG 3;  1HQM C;  5GAD C;  3SHL A;  4APV A;  1YNN D;  3EN2 A;  5IP7 G;  1LTI D;  1CHP D;  2ICE C;  1BR9 A;  1EIF A;  1PRT C;  1KDA A;  2YYZ A;  5GQO A;  1S5E D;  3P7J A;  4JOI C;  5T1G A;  1HFN A;  2E2I H;  3E9H A;  1BVS A;  2PZU A;  4DV5 L;  3KYH C;  1N33 Q;  1B44 D;  1DJR D;  4JV5 L;  1SRU A;  1Q1E A;  1MJE A;  4XQN A;  4ZCK A;  2VUM B;  1ONL A;  3BYT B;  3J81 E;  4GLX A;  3J7A V;  2K32 A;  4QF4 A;  3H15 A;  4A3G B;  4GN4 B;  1Q1B A;  4DV3 Q;  4C56 C;  3GTL H;  1CM9 A;  4P73 A;  3VR2 A;  5COR A;  1WCM B;  3GV6 A;  4B3T Q;  3C2P A;  1CHQ D;  1MBY A;  3Q6S A;  5IE8 A;  1HR0 L;  4KHZ A;  1G29 1;  4UPA A;  3W5O A;  1N32 Q;  1A3T A;  4KY6 A;  2DNE A;  3S15 H;  1I4P A;  1ZKO A;  4C2M H;  4DR3 L;  1QUQ B;  2IL8 A;  2UUB Q;  5EPJ A;  4DAV A;  3S2H H;  2N88 A;  1FYC A;  1E2W A;  3U9O A;  3HOV G;  1Y1V H;  1IXR A;  2ZM6 Q;  5I2Y A;  1JOQ A;  4HJ8 A;  3J80 E;  2E8G A;  1STB A;  3U4V A;  4FDB A;  1A8V A;  2I46 A;  3V2T A;  3CPW A;  3JAM i;  5JOB A;  1QWY A;  2VQF L;  3BZK A;  1X54 A;  3HOX G;  2JA6 B;  1U4M A;  1V1Q A;  2EXZ A;  1Q82 C;  1PTO F;  1JB7 A;  1X55 A;  1Z47 A;  1SMY C;  3CXC A;  4YWK A;  2B29 A;  3OPO A;  1WD0 A;  4A3I H;  1RCV D;  1Z7T A;  2EYJ A;  4N8F A;  2XIW A;  3T1H L;  2OF1 A;  3C46 A;  2MQH A;  2HHH Q;  2Z4H A;  4K0K L;  1QCB D;  3BDC A;  2ZTC A;  5J1Z A;  1OXV A;  3KLR A;  2R93 G;  2SNS A;  3HOZ B;  4O1N A;  1KAA A;  4BBR B;  3CMA A;  2WAQ G;  2R61 A;  1NY4 A;  1RDP D;  2F0T A;  4R1J A;  2IHE A;  3I90 A;  3I55 A;  3SK6 A;  1VQ5 A;  1AEX A;  1S5B D;  5JJZ A;  2EIF A;  3N52 A;  1NAP A;  1SRO A;  3HOY G;  3W2D A;  3S1R B;  4DU9 A;  1C4Q A;  3F1Z A;  3QIA A;  1YJW A;  2KUM A;  3WOE A;  1I3Q H;  5IT9 L;  4KKT A;  2FXQ A;  3N6R A;  3Q23 A;  1PH1 A;  2F52 A;  1YNN C;  2D2C C;  4UY8 C;  4CDC C;  4J8Q A;  4AYB G;  5C3W A;  1B4O A;  3FEW X;  1STG A;  4DR6 Q;  1MD2 D;  2KCM A;  1Y1W G;  2Z9H A;  1VQ4 A;  1A2T A;  5G3L D;  4QL5 A;  1WTQ A;  3S17 B;  4HSV A;  2WFW A;  5EJW A;  3CPF A;  3PF4 A;  4A3L H;  3M3Y H;  1UAP A;  1G51 A;  5E7N A;  4GOP B;  4MIU A;  3S1Q H;  1CKN A;  1F2M A;  1HA6 A;  4KTA A;  3F2C A;  1PFN A;  1QJO A;  2DNC A;  3SGI A;  4JBK A;  5ELB A;  3G7L A;  1X9N A;  5F2D A;  2K28 A;  1GUS A;  2EYM A;  4NXN L;  3C1F A;  3BDL A;  3KK7 A;  1VS0 A;  5C4J B;  1STA A;  3URY A;  1WTO A;  4KD3 A;  4A3F G;  1NCV A;  5IP7 H;  5KND A;  4A76 A;  3I4L A;  1DCZ A;  2K52 A;  1JWU D;  3T4A C;  2PNH A;  4C3J G;  2A6E D;  3R2T A;  1A0I A;  2LKV A;  4GKK L;  4ZK9 B;  4NB3 A;  3PUZ A;  2Z0S A;  1K83 B;  1F9P A;  3CRL C;  2Y0S E;  1SNM A;  1JOK A;  3T56 B;  5M5W B;  1KQS A;  4XYQ A;  4CGY B;  2OTL A;  3A55 A;  3T1Y L;  2BA1 A;  1M1K C;  3BVG A;  3DEP A;  1HA5 A;  5COY A;  5C3X A;  3WOF A;  2ALY B;  2MHV A;  1WVL A;  5IYB G;  1CSQ A;  2PMZ E;  4KKS A;  2Z6K A;  4IJH A;  1PFB A;  4R4C A;  3MC0 B;  4X64 L;  1EEI D;  2RHQ B;  2VS1 A;  4RMF A;  3KFU A;  2JA8 G;  3NK9 A;  1QG7 A;  4JC0 A;  3X3N A;  4A3C G;  5J39 A;  1YNJ D;  4KY7 A;  4CDF C;  3HOV H;  2E5L L;  2LSS A;  2WII B;  3OYY A;  1GUO A;  1KAW A;  1U4P A;  3R2I A;  5DM7 3;  1SLJ A;  1EFW A;  4DV1 Q;  3RN2 A;  3DMU A;  1K8M A;  1I4G A;  5C6A A;  3S2D H;  5K36 H;  1FVI A;  3MEH A;  2E2J H;  2N78 A;  5ELO A;  4HMJ A;  1PLF A;  1LAC A;  3I4N G;  3RR5 A;  4LFC Q;  1BKB A;  1GVP A;  3T13 A;  2Z6K C;  1HXY D;  1NR4 A;  4IPH A;  1LT6 D;  4XT3 B;  3D6W A;  2NVY B;  3HOX H;  4HR7 B;  5FLX E;  5ELF A;  4XQJ A;  4B9W A;  5LMN Q;  3A8I E;  3UDX A;  3C3L A;  4PQX A;  3Q24 A;  4EX5 A;  3MA2 B;  4OXP A;  3H09 A;  4IFD H;  1D1K A;  3I3C A;  1DOM A;  5CV9 A;  2FHT A;  1VF5 C;  4QJF A;  1X6O A;  1TWH B;  5FLM H;  1EEF D;  2N49 A;  2ZXR A;  4BY7 G;  5CV4 A;  5KYL A;  3VYU A;  1O7L A;  1STH A;  1PZJ D;  4I65 A;  2JEA I;  3K7A B;  5DEH A;  1I94 L;  2YTX A;  4YHH L;  1NR2 A;  3LWU A;  5A35 A;  3GQB A;  4F7X A;  1S5C D;  4EGV A;  2JA7 B;  3RN5 A;  2RA4 A;  4DUZ L;  1TY2 A;  1FNV A;  3K80 C;  1L1O C;  5DM6 3;  3BG3 A;  3NE5 B;  4C3I G;  3CME A;  3PIO 3;  3I7F A;  4K2L A;  2AQ2 B;  3V96 A;  2B63 B;  4B9X A;  2D0P A;  3O13 A;  3NBH B;  3GTG H;  1HNX Q;  2K5H A;  3NEM A;  5D65 A;  4QCL A;  4JI0 L;  3NHH A;  1YI2 A;  1JJG A;  3H0G H;  4KK7 A;  3J81 c;  3H3V H;  1Y8O B;  1IYU A;  3I4M G;  4QY7 A;  3Q22 A;  1RIP A;  2CWA A;  1O7I A;  3TP5 A;  4L63 B;  1K3B C;  4HIK A;  1JJ2 A;  4LJZ C;  4JI8 L;  1C8C A;  4JI5 L;  2KCN A;  2EYL A;  1D5M C;  2P5Z X;  5FO8 B;  1PH4 A;  2X69 A;  4IPG A;  1MI2 A;  3T16 A;  1N36 L;  2HDL A;  1GKH A;  3HOW G;  3S1M H;  2YU9 B;  1WOC A;  4B08 A;  3L7Z C;  3JAM E;  4EQ5 A;  3K59 A;  1Q90 A;  1XPR A;  2QEJ C;  4K5X A;  4OWT B;  4A3F H;  1TY0 A;  3S15 B;  4K5W A;  3M4O H;  1YNJ C;  1VQO A;  1YJN A;  4R8I A;  5J22 A;  2VNU D;  4BA2 I;  2FMC A;  1HNW Q;  4C3J H;  2M9V A;  1I4X A;  2L12 A;  1FNU A;  2WB1 G;  3M7G A;  5KYI A;  3G6J B;  1UEB A;  1PH8 A;  4G4K A;  3UDF A;  3DLL A;  4A75 A;  1ILP A;  2JXM B;  1IBL L;  3SR1 A;  2F4V L;  4FYD A;  2PMZ B;  2BH2 A;  3M85 A;  3J80 i;  4EQN A;  2BOS A;  3CCV A;  4M8A A;  3KF6 B;  4AQY L;  1QVF A;  1I50 H;  1TU2 B;  4LF5 Q;  5IYB H;  5M9O A;  2LS0 1;  3W1B A;  3DWQ A;  1Z6H A;  1PV4 A;  4DV2 Q;  2JA8 H;  4KLK A;  2RDG A;  5KRU A;  4A3C H;  2ZTE A;  5FJ8 H;  4LF6 Q;  1Q81 C;  1E2V A;  1IBK L;  3TQY A;  2C5C A;  5LMU L;  4KD4 A;  4E6I A;  3A54 A;  1G6P A;  1AW7 A;  1NTG A;  4NXM Q;  3NSW A;  1EYD A;  3K7U C;  3VR3 A;  2D5D A;  4DXF A;  1F9Q A;  4FF1 A;  3BU2 A;  4HN7 A;  4JI7 L;  1SJE D;  2SDF A;  3I4N H;  4B3R L;  1XXG A;  1ESF A;  1X3G A;  1U4L A;  3SVM A;  1BCP D;  1RL2 A;  1Y14 B;  4JI2 L;  4UP9 A;  2WAQ E;  5IGF A;  3RD4 A;  4GOP A;  2G9D A;  5KNB A;  1RJT A;  4DR4 Q;  3CW2 C;  4DV6 L;  4X6A H;  1EQV A;  1LAB A;  3KOJ A;  3L2P A;  5EKL A;  4GNX A;  3FPP A;  1CSP A;  1HTP A;  2MP1 A;  1EUJ A;  2K5D A;  4AYB E;  4A3M B;  2HUG A;  4WJW A;  2OTJ A;  3R3O A;  5DAU A;  1J5E Q;  3BVZ A;  3PUY A;  3CCL A;  2A8V A;  3G6E A;  4BY7 H;  4RGO S;  3M3Y B;  1PRT D;  1XNR L;  4X62 L;  3FMC A;  1B8A A;  1MJC A;  5HUR A;  3ND8 A;  1SE2 A;  2F0G A;  3HKZ G;  2UXC Q;  1GUT A;  2MFI A;  4IQZ A;  3VYT A;  4P72 A;  4C3I H;  4HJ9 A;  2R7F A;  4OON A;  4GOP C;  5FK9 C;  5IGD A;  1XPO A;  3EVQ A;  1B3A A;  2UUA Q;  2XGT A;  2Q2T A;  3E9I A;  4GNX C;  1KLU D;  1EYC A;  3STB C;  1VQM A;  4GZY C;  1VCI A;  1W3S A;  3I70 A;  1X56 A;  4RGT A;  4O2D A;  2UUC L;  1I4H A;  1XNQ Q;  4WJ3 M;  1QOH A;  1GOZ A;  4ABN A;  2KHS A;  5KEE A;  3I4M H;  4S3S A;  2NZ1 D;  4A3I G;  2EJG C;  1KIX A;  2ZJP A;  5DNF A;  5ISR A;  4JYA Q;  2NBF A;  1CQF A;  5ELE A;  2PQA B;  4A3B G;  4DR2 L;  2AUK A;  3A7L A;  4DV4 L;  4JPB W;  1SNP A;  4PMC A;  1KTK A;  3HOW H;  1PDQ A;  5C0X G;  1NMG A;  3IFT A;  4TQU S;  2HCI A;  4YCV A;  2MGS A;  5KNC A;  1K0S A;  3GV3 A;  5CMD A;  4RCN A;  1ENA A;  1TS2 A;  1TWC H;  3ND9 A;  1BBX C;  1X3Q A;  3K0X A;  3QB3 A;  2M00 A;  3TN2 A;  1QVC A;  4DR1 Q;  4IUN A;  1NUC A;  4K8I A;  5D3I B;  4B3M L;  2VL6 A;  1TS4 A;  3QR8 A;  4IUU A;  4JK1 C;  4DK3 C;  4HMI A;  1T9H A;  4OIJ A;  4X66 Q;  3AMU A;  1H95 A;  2J0T D;  3NXW A;  2F0M A;  1SBB B;  1SMY D;  1TII D;  1VQG A;  1MGS A;  4KJN A;  3PQI A;  3I4O A;  3I91 A;  2XWB B;  4DK6 C;  4C3H G;  4FVM A;  3NQT A;  1A6X A;  3F2D A;  2FJ2 A;  3VDY A;  5FLX c;  4A3L G;  2CKZ B;  2UXD Q;  4XIG S;  1STE A;  3ER0 A;  2HQL A;  5GAG C;  4LUO A;  3MTS A;  3HOX B;  2L11 A;  4DAP A;  4KHP Q;  1HTL D;  1N34 L;  4KHV A;  2F3V A;  1XTD A;  1QB5 D;  1LTR D;  2BDO A;  4X65 Q;  1SXT A;  3AFP A;  5G3L F;  1A62 A;  3K0Y A;  2UU9 L;  1J8I A;  4GLA C;  4LF4 L;  4KN4 C;  3I56 A;  3A8J E;  2NVQ H;  1F2L A;  4X3T A;  3KUP A;  4A3K B;  1EQQ A;  2JJQ A;  1R9T B;  1GUN A;  2JYO A;  1K8O A;  1H9K A;  3RZO B;  2R93 B;  3FRP B;  3NBH A;  2GVB A;  5EAY A;  4DV5 Q;  2IX3 A;  2I5M X;  1BUV T;  2WAQ B;  3MHB A;  2BCO A;  4ZLT F;  1LV9 A;  1EY0 A;  3GTQ B;  1EIY B;  1M90 C;  1HFG A;  3HOY B;  2OQK A;  4KI0 A;  1VQ8 A;  2JN4 A;  2Q8I B;  4ZQ3 A;  3TME A;  4RA8 A;  4JI3 Q;  1TQO A;  1EOT A;  2NUC A;  2XVS A;  1TVX A;  4RCO A;  4UHV A;  3ZJY C;  1VQ7 A;  3GTG B;  2F0S A;  5C44 G;  2F0I A;  1CA6 A;  4L8J A;  1X3F A;  5L37 A;  5JEA G;  1PA6 A;  1VQC A;  1Y1W B;  2NTT A;  3G71 A;  3FKI G;  3GTJ B;  1L0X B;  4DNT B;  3GTO H;  5A2Q L;  1BF4 A;  3IL8 A;  2K50 A;  1N33 L;  4J15 A;  3NUC A;  2H1E A;  4DR7 Q;  4MHE A;  3NP8 A;  4HCE A;  2OCE A;  3F8T A;  1NSN S;  1EQR A;  3GTK H;  3S16 B;  3MXU A;  5C3E G;  2WP8 J;  4A3D B;  1KLG D;  1PH2 A;  2HQE A;  4DV3 L;  3JAM c;  1B53 A;  3KF8 B;  4ID6 A;  4GKJ Q;  2EYF A;  4B3T L;  3SXH A;  1EL0 A;  1LLR D;  1CT1 D;  1PTO B;  4DUY L;  1XMO Q;  3J7A F;  1PZI D;  5K36 G;  1N32 L;  5TSS A;  4ZYS A;  1SJH D;  4DNR B;  2PW7 A;  1VQN A;  1SMX A;  4Q5V A;  2UUB L;  3NPP A;  2A69 C;  3LWE A;  4OGQ C;  1SE4 A;  1UE6 A;  1EY9 A;  1PYS B;  2F0E A;  3QOL A;  4LF9 Q;  3ULJ A;  4C3J B;  4AIM A;  2B2W A;  3KF6 A;  2ZM6 L;  1T5E A;  1X3P A;  3MEF A;  5CGK A;  3U58 A;  4OO1 I;  3HOU B;  3U9S A;  1KNE A;  1TS3 A;  4F87 A;  5LMN W;  1HNZ L;  4IFD G;  4K5V A;  5IP9 H;  1QE6 A;  2WB1 E;  4F88 A;  5CV6 A;  1D6E C;  5FLM G;  4YCU A;  2PI2 A;  4CJ2 C;  4A3B H;  2E2H H;  1Y69 U;  4BS9 A;  1A15 A;  1TXY A;  1VF7 A;  3D4D A;  2FMM A;  3S9W A;  5C0X H;  1RHP A;  2YV5 A;  4V19 0;  1O80 A;  2DY8 A;  2WAC A;  5CYU A;  4A93 G;  5KIX A;  3G4S A;  1HZC A;  5M3M B;  2KJX A;  1VQE A;  1KRT A;  2HDM A;  1ENC A;  3CQZ H;  4PZ7 A;  2L55 A;  1YHB A;  5CR3 A;  5ELC A;  2B2W C;  2HHH L;  1QNK A;  2AHO B;  4PMW A;  3DWA A;  2EYP A;  2N55 A;  3J81 L;  3UDG A;  3EJI A;  1LTB D;  2ZJR A;  1Q3L A;  1FNW A;  2F0N A;  2E74 C;  1ROD A;  1JCK B;  1JJC B;  1FD7 D;  2B2U A;  1DYQ A;  2RVL A;  3D0F A;  3H0G G;  2VXW A;  4DAY B;  4C3H H;  4K2K A;  4ZUJ A;  4PV1 C;  3QG1 A;  4PZ6 A;  1A3V A;  2EVB A;  3QWN A;  3W1G A;  2XWJ B;  4ZKB B;  1OXS C;  3VR4 A;  3QOJ A;  5IIF A;  1K9M C;  2EJM A;  1AH9 A;  3ERQ A;  5M5X H;  1H9R A;  1PH9 A;  4KKU A;  2C35 B;  1VQJ A;  4NXN Q;  1LTA D;  3NEL A;  1B70 B;  4RG1 A;  3HGB A;  1VQA A;  2NVX H;  1Y8N B;  4HJA A;  2PNR C;  1CUK A;  2B8F A;  5IGG A;  4MZ9 A;  2BE5 C;  2HIV A;  3PGZ A;  4A4I A;  4NW2 A;  4HSP A;  2B2U C;  2MO0 A;  4L5S A;  1QZG A;  3AEV A;  2MJ8 A;  4BXX G;  1JOR A;  1JWS D;  1ESR A;  5AJ3 L;  2RSN A;  1I6H B;  3VYS A;  1CTM A;  4OX9 Q;  1F77 A;  3OHX C;  2A68 C;  3KLS A;  4RGN A;  4JG2 A;  3GTP B;  5DLQ E;  1U0L A;  5C4X H;  1V1P B;  1WTW A;  2KHI A;  4P2C B;  2EOT A;  2R7Z B;  4KN7 C;  4B3S Q;  2KCC A;  1KDC A;  3HKZ E;  4WOR A;  1MIU A;  1V8Q A;  5C44 H;  1F2Z A;  3RMH A;  4DV0 Q;  4F8M A;  1TR5 A;  1C7Y A;  2PQA A;  5JEA H;  3FKI H;  3S1N H;  1AP0 A;  3I4M B;  4XQQ A;  1U5K A;  1IYJ B;  1TWF B;  5FJ8 G;  5C3E H;  2RCF A;  1B7Y B;  4BBR G;  1EFI D;  2OT2 A;  2V4D A;  3DXJ C;  3R8B A;  3AYH B;  4RAU C;  1PMR A;  1GD7 A;  3HOW B;  5M5Y H;  1OTC A;  1A2U A;  4CKB A;  2NVT H;  1B9N A;  1OXU A;  5EBD A;  1E2Z A;  3VR5 A;  1VQ6 A;  1PH3 A;  5C5M A;  3AFQ A;  1E1O A;  4BBS G;  3H91 A;  5AFW A;  2O2L D;  2PO4 A;  2G9H D;  4JBW A;  4LK1 C;  5C4Z A;  2HT1 A;  2ES2 A;  3BJU A;  2YTV A;  1TWA B;  3I2Z A;  3K58 A;  1II3 A;  5HGQ A;  4DV1 L;  1U4R A;  2K7V A;  1UE1 A;  2J7Z A;  1B1Z A;  3DWP A;  3GTM B;  4HIM A;  3HZX A;  5E4W C;  3MWY W;  1P16 A;  1DM0 B;  3CD6 A;  4ULL A;  3RZD H;  1LYL A;  1EU4 A;  4C1N I;  2VY3 A;  4LF8 L;  1BCP F;  2IX0 A;  4LFC L;  1I94 Q;  4YHH Q;  4CDD C;  4KJO A;  1SN8 A;  2Q8R E;  4A3J H;  1X65 A;  4A93 H;  4UP7 A;  5I6W A;  5C0X J;  2XN9 C;  4LFA L;  1SNQ A;  2SNM A;  4YY3 Q;  4R9W A;  2SEB D;  3FPU B;  4MTK A;  4IUQ A;  5CC4 A;  4I7A A;  2KEE A;  1LUZ A;  4TSS A;  2G5D A;  1ZYR C;  1MSG A;  4JI0 Q;  1PRT F;  3PIO A;  3CCU A;  2MUY A;  3F2B A;  2IWH A;  1B50 A;  5I2X A;  3SK5 A;  2LXJ A;  4HID A;  2E2I B;  3DM1 A;  2K1B A;  5I4D A;  1H9M A;  1L2F A;  4JI4 L;  4QB4 A;  2IHF A;  2VUM H;  4DR5 Q;  2F03 A;  1D5Z C;  1PYB A;  1RTO A;  4OHJ A;  5CV5 A;  1MHW C;  4A3G H;  4FXD A;  3J7A 5;  4BY1 G;  4JI1 Q;  2SOB A;  4DV7 L;  1QUQ A;  1WCM H;  3AQQ A;  4K14 A;  4RFB A;  3NQI A;  3FDT A;  3QO2 A;  3GTL B;  3IKJ A;  1I4R A;  1XMQ Q;  2OXP A;  4HJ7 A;  1J6Q A;  1MSH A;  3KF8 A;  4O0A A;  2F0D A;  3T53 B;  1H9J A;  3CU7 A;  3KJP A;  2CH4 W;  1JT8 A;  2KED A;  1VQB A;  3OIP A;  4C2M B;  2F0L A;  5IY0 A;  2QKI C;  5IGB A;  4L5R C;  3STB D;  1CKO A;  1FJG Q;  1LT4 D;  2HCC A;  4BXX H;  3NBI A;  3S2H B;  1AE3 A;  2Y0S B;  3E3X A;  3J80 c;  2VB3 X;  1Y1V B;  5JJK A;  1ENF A;  4YCW A;  1DZ1 A;  5I9O A;  1WTV A;  5FLX L;  3CCR A;  3CF5 A;  3HKZ B;  4N9P A;  2OEO A;  3OOC A;  4LUV A;  1EWH A;  1V1O A; 
#chains in the Genus database with same CATH homology
 2WV6 D;  2RDH A;  5BN3 A;  2EY5 A;  1CZW A;  3KBX A;  1EY4 A;  2PYK A;  3D4W A;  1IHZ A;  3R93 A;  1PTO C;  1JR0 D;  2WIN B;  1VMC A;  1JWM D;  4IUP A;  2K03 A;  2X6L A;  4A3I B;  2F0J A;  3SDZ A;  1ZXT A;  2ID0 A;  4XTC S;  2F0W A;  3GO5 A;  2K04 A;  1DOL A;  2K5Q A;  2L0C A;  3X3M A;  4A3B B;  1TKW B;  2IJ0 A;  2TSS A;  1F9R A;  2RBM A;  1EY5 A;  2MPM A;  4DA2 A;  1XX8 A;  1AZP A;  2ENB A;  2K5W A;  2PW5 A;  5JVH 3;  4DAY A;  4G7H C;  4IUT A;  2K33 A;  3CQZ B;  1SAP A;  3PUV A;  1I3Q B;  1CK1 A;  2KA7 A;  4FNF A;  1CFM A;  4KMU C;  4ZUI A;  3OMC A;  4UAI A;  3GD7 A;  4IFD J;  3JAM L;  3NTH A;  3CHB D;  3MZ5 A;  1UNS A;  5CV8 A;  1D5X C;  3TDQ A;  1OO9 B;  3K5L A;  3S1Q B;  5M5X B;  1STN A;  2F1M A;  1VDZ A;  2NVX B;  1M4V A;  2QDB A;  5ELD A;  2ICI A;  1F2Y A;  1V1P A;  2B2T A;  2EJF C;  2EY2 A;  5D3D A;  4RGM A;  3L3O C;  3MAQ A;  3OW7 A;  4OIK A;  2NYZ D;  3PV0 A;  1IL8 A;  2NN6 I;  3ONA B;  3HS0 C;  1Q8I A;  4KV6 A;  2PQE A;  1EY7 A;  1S5D D;  1B9M A;  2K01 A;  5C44 B;  4RHS A;  2Z1C A;  3HEJ A;  3TP7 A;  2RDF A;  1JC7 A;  2WKD A;  2B2T C;  1Q12 A;  3S1N B;  2AQ3 B;  3M7N A;  2O4X A;  3SEB A;  1D1I A;  2A5H A;  2A69 D;  1I4Q A;  2L9H A;  3HOV B;  1GHJ A;  2CQA A;  4DK0 A;  2H4O A;  3MFY A;  5A2Q E;  4H13 C;  1CZG A;  3S2D B;  2E2J B;  3Q0A A;  2NVT B;  2QIL A;  2JE6 I;  1BNZ A;  1LT3 D;  2DN8 A;  2Z8L A;  3ZYY X;  1AZQ A;  3A8K E;  2VB2 X;  3PIP 3;  1A3U A;  4XYO A;  2IPK D;  2B2V A;  1SYC A;  4ZKC B;  2IT1 A;  4RWS C;  1XTC D;  3DEO A;  3RZD B;  1HQR D;  1KDB A;  5EKK A;  2R6G A;  1SYB A;  4TKO B;  4TRD A;  4CHT B;  1RF2 D;  1R4Q B;  1EYA A;  1SE3 A;  1PZK D;  3V05 A;  4CBV A;  1B2T A;  1BDO A;  3K57 A;  5I6Y A;  1O7Z A;  1LTS D;  1BXT A;  2CW0 D;  4G57 A;  4AYB B;  4CJ0 B;  4MN3 A;  2B2V C;  5CV7 A;  5C4H A;  1EY8 A;  1D2B A;  3H0G B;  3K5M A;  5EGT A;  2BE5 D;  2F0Q A;  1UEA B;  5IT9 E;  1TT2 A;  2KQ3 A;  3LX0 A;  3T51 B;  1GUW A;  3MFG A;  3PUX A;  4FF3 A;  5E1F A;  1EZ6 A;  2J4X A;  2A68 D;  3FVQ A;  1DOK A;  4FP5 D;  3RUZ A;  2ZXO A;  3S1M B;  5EKI A;  1I6V C;  4RKB A;  2O5J C;  4V0B A;  5EPL A;  4A3F B;  1ILQ A;  3M4O B;  4X3U A;  4ME5 A;  2AWN A;  4J1M A;  2E75 C;  3NTI A;  1GXD C;  4XDX A;  4OO1 H;  1S4Z A;  1G2S A;  3PUW A;  2A6H C;  3E0J A;  5C5L A;  2TMP A;  1G6Z A;  3IAY A;  4FO2 A;  3HG9 A;  3C1E A;  3NWT A;  1O7Y A;  3LNN A;  3MXG A;  1I50 B;  3SK4 A;  1LTT D;  2EPB A;  4EQO A;  3EQL C;  5IGE A;  4FF4 A;  3VR6 A;  4HCS A;  2RKS A;  2JA8 B;  1HCZ A;  1SFO B;  5EPK A;  2F3W A;  2F0O A;  1L0Y B;  4LAA A;  2FIN B;  2PZW A;  4J6H A;  1SNC A;  4FXK C;  4K8J A;  5C0X I;  5BN5 A;  3EA6 A;  4QUF A;  4NDX A;  2XRQ D;  3H94 A;  3BDO A;  1JB3 A;  2F4I A;  1IKM A;  3VA7 A;  2RSO A;  3I4N B;  2JSO A;  5EBC A;  1J9O A;  3QJY A;  4BBS B;  3SK8 A;  4H44 C;  3EFX D;  3D4R A;  2CW0 C;  1EU3 A;  3D8G A;  1SYD A;  3K5N A;  1JE4 A;  2ZXP A;  2IX1 A;  4BA1 I;  2XRS D;  4DN4 M;  4XT1 B;  3W3A A;  3OWE B;  3J80 L;  2L5T A;  1ZYR D;  4IN3 A;  1W6J A;  3F2U A;  4WRD A;  4BY7 B;  2EYO A;  1QIL A;  3TZD A;  1DD2 A;  5K5P A;  1FGB D;  1CQV A;  3TP6 A;  3K6O A;  5BN4 A;  1PFM A;  4YIJ A;  2O5I C;  3GP7 A;  4I7Z C;  4C3I B;  3BVM A;  4ZRZ A;  2AUJ D;  2NTS A;  1IW7 D;  4EQP A;  2EE1 A;  3HRZ C;  4HED A;  4OL7 A;  1WTX A;  5IGC A;  4ODG A;  1PYW D;  4NP5 A;  5FO9 B;  1EIG A;  1GJX A;  4BY1 B;  1F9S A;  4ILW A;  4IUV A;  1AN8 A;  4H7B A;  4DGZ A;  1JQY D;  1U9R A;  5JPM C;  4FXG C;  3VA5 A;  1EQT A;  1KAB A;  4CJ1 B;  1TWC B;  3DUZ A;  1PXU A;  4Q0F A;  1ET6 A;  5E4X A;  1W6K A;  3A56 A;  1IKL A;  1BCP B;  1PTO D;  2CVR A;  1G8Z D;  2WB1 B;  3KLS X;  4X3S A;  5I9P A;  3PMF A;  2LMC B;  1ZEQ X;  4PNY A;  1SSO A;  1Y8P B;  1HUN A;  2KEC A;  1PRT B;  4X3K A;  1EZ8 A;  1RKN A;  4IFD I;  4O42 A;  1ML0 D;  4UDU C;  4R8N A;  1G91 A;  3TBI B;  4WFN 3;  1GHK A;  3NWS A;  1H9S B;  2NVQ B;  1WD1 A;  1EIH A;  2QF7 A;  1G2T A;  2RQX A;  4IUR A;  2L4N A;  5M3F B;  2PCF B;  4DXG A;  2QCP X;  2BA0 A;  4K6L A;  4DFA A;  4K6D A;  4FF2 A;  2K6A A;  1S5F D;  3I72 A;  1HUM A;  2NN6 G;  5LHY 1;  3K5O A;  3OSO A;  3A7A B;  1EWC A;  1IW7 C;  2E76 C;  2A6E C;  1SDF A;  2GA4 B;  3RLF A;  3OMG A;  5KGU A;  1O78 A;  3GTO B;  1TS5 A;  2EY6 A;  2ZT9 C;  1C48 A;  5IOD A;  3GTK B;  1E0B A;  3OWF A;  3S14 B;  4C1N K;  1PTO H;  3CKI B;  3H3V C;  2KOL A;  1AFP A;  4IAL A;  2M2L A;  1SYF A;  1SEB D;  1UUP A;  3E6Z X;  3DHQ A;  2Q8T A;  2B8G A;  3H6M A;  2EYH A;  1LTG D;  2D62 A;  2AWO A;  1WTP A;  4RH6 A;  3J7Y W;  2F0K A;  5IOC A;  4ZAI A;  4DF7 A;  2DY7 A;  5LL6 S;  5JEA J;  3TP8 A;  3I73 A;  4RKL A;  5D14 A;  1HHV A;  4M1U B;  3AU7 A;  2PZT A;  1HPC A;  3MXP A;  2JP1 A;  1LT5 D;  3VYR A;  2IW3 A;  2K05 A;  1BO0 A;  3ERO A;  1RD9 D;  2E2H B;  2EDG A;  2F0U A;  4BWG B;  1VMP A;  1R4P B;  4PMB A;  4QIW B;  2BDN A;  5FO7 B;  5E3F A;  2F0V A;  5CBA E;  2AQ1 B;  3E5S A;  5CBE E;  4NKL A;  4HTH A;  4U68 A;  3I8Z A;  3L9A X;  2LY7 A;  1RTN A;  3D31 A;  4KY5 A;  4Y7N B;  1V43 A;  2EY1 A;  2B39 A;  3NTK A;  4NMZ A;  4QUC A;  4C3H B;  2B2Y A;  3M4Y A;  1T5X D;  2WKC A;  4A3E B;  2XSC A;  2JA5 B;  5NUC A;  1IYV A;  1BOS A;  1CI3 M;  1BQQ T;  3UI2 A;  3WDN A;  5FKA C;  1ICW A;  3PO3 B;  1X32 A;  4XXE A;  2A74 C;  1QNU A;  1KNA A;  4LMQ D;  5EQ0 A;  3P20 A;  2JEB I;  3OIQ A;  2XNA C;  2NB0 A;  1SYG A;  2B2Y C;  1WTR A;  3AB9 A;  2L1B A;  1OXX K;  4OO1 G;  3MXN A;  1SNO A;  4H0L C;  2NN6 H;  4EVO A;  5C4X B;  1DON A;  3TSS A;  3ITP A;  1TWG B;  1SYE A;  2F0F A;  1M8A A;  2E2D C;  1JOO A;  5LL6 X;  3BS1 A;  4G7O C;  3IFD A;  2X6G A;  4G7Z C;  1STY A;  3FKI B;  3MVV A;  3TZU A;  4HAE A;  2D9U A;  1SND A;  2R3Z A;  2I07 B;  1LO5 D;  5C3E B;  4CKE A;  4QMG A;  2LFN A;  5T1I A;  3BZD B;  4N9T A;  4IZ8 A;  3PO2 B;  3KBG A;  2A6H D;  5M5Y B;  2A73 B;  1DXM A;  3P1H A;  3P75 A;  4DK1 A;  3CRK C;  2Z4I A;  2EZV A;  2C9O A;  2NWG A;  4U67 3;  3SE0 A;  1JIC A;  2CHB D;  3D3R A;  1CA5 A;  3HP3 A;  5JAV A;  5JPN C;  4L6T B;  1GUG A;  4RHR A;  4CKC A;  1ET9 A;  5HGT A;  2F0H A;  2R92 B;  1BCP C;  1OXT A;  1XYI A;  2F0P A;  2KVM A;  1HRJ A;  2PPB C;  1H9S A;  1XWE A;  3D6C A;  3BYY B;  4A3J B;  4A93 B;  2FFK B;  1EY6 A;  5FOB B;  1FR3 A;  4Z9C B;  5JVG 3;  1HQM C;  3SHL A;  1YNN D;  1LTI D;  1CHP D;  2ICE C;  1BR9 A;  1PRT C;  1KDA A;  2YYZ A;  1S5E D;  3P7J A;  5T1G A;  1HFN A;  2PZU A;  1B44 D;  1DJR D;  1Q1E A;  4XQN A;  2VUM B;  1ONL A;  3BYT B;  3J81 E;  3J7A V;  2K32 A;  4QF4 A;  4A3G B;  1Q1B A;  4C56 C;  1CM9 A;  3VR2 A;  5COR A;  1WCM B;  3GV6 A;  3C2P A;  1CHQ D;  1MBY A;  3Q6S A;  4KHZ A;  1G29 1;  1A3T A;  4KY6 A;  2DNE A;  1I4P A;  1ZKO A;  2IL8 A;  5EPJ A;  4DAV A;  2N88 A;  1FYC A;  1E2W A;  3U9O A;  5I2Y A;  1JOQ A;  3J80 E;  1STB A;  2I46 A;  3V2T A;  5JOB A;  1QWY A;  2JA6 B;  1U4M A;  2EXZ A;  1PTO F;  1Z47 A;  1SMY C;  3OPO A;  1WD0 A;  1RCV D;  1Z7T A;  2EYJ A;  2XIW A;  2OF1 A;  3C46 A;  2Z4H A;  1QCB D;  3BDC A;  5J1Z A;  1OXV A;  3KLR A;  2SNS A;  3HOZ B;  4O1N A;  1KAA A;  4BBR B;  2R61 A;  1RDP D;  2F0T A;  3I90 A;  3SK6 A;  1AEX A;  1S5B D;  5JJZ A;  3N52 A;  1NAP A;  3W2D A;  3S1R B;  4DU9 A;  1C4Q A;  3QIA A;  2KUM A;  3WOE A;  5IT9 L;  4KKT A;  3N6R A;  3Q23 A;  1YNN C;  2D2C C;  4J8Q A;  5C3W A;  1B4O A;  3FEW X;  1STG A;  1MD2 D;  1A2T A;  5G3L D;  1WTQ A;  3S17 B;  4HSV A;  5EJW A;  1UAP A;  4MIU A;  1F2M A;  1HA6 A;  4KTA A;  1PFN A;  1QJO A;  2DNC A;  5ELB A;  3G7L A;  5F2D A;  2K28 A;  1GUS A;  2EYM A;  3C1F A;  3BDL A;  3KK7 A;  5C4J B;  1STA A;  3URY A;  1WTO A;  4KD3 A;  1NCV A;  5KND A;  3I4L A;  1DCZ A;  1JWU D;  3T4A C;  4C3J G;  2A6E D;  3R2T A;  2LKV A;  4ZK9 B;  3PUZ A;  1K83 B;  1F9P A;  3CRL C;  1SNM A;  1JOK A;  3T56 B;  5M5W B;  4XYQ A;  4CGY B;  3A55 A;  2BA1 A;  3BVG A;  3DEP A;  1HA5 A;  5COY A;  5C3X A;  3WOF A;  1WVL A;  2MHV A;  4KKS A;  1PFB A;  3MC0 B;  1EEI D;  3NK9 A;  1QG7 A;  3X3N A;  5J39 A;  1YNJ D;  4KY7 A;  2WII B;  1GUO A;  1U4P A;  3R2I A;  5DM7 3;  3DMU A;  1K8M A;  1I4G A;  5C6A A;  5K36 H;  3MEH A;  4HMJ A;  1PLF A;  1LAC A;  3T13 A;  1HXY D;  1NR4 A;  1LT6 D;  4XT3 B;  3D6W A;  2NVY B;  4HR7 B;  5FLX E;  5ELF A;  4XQJ A;  4B9W A;  3A8I E;  3C3L A;  4PQX A;  3Q24 A;  3MA2 B;  3H09 A;  4IFD H;  1D1K A;  3I3C A;  1DOM A;  5CV9 A;  2FHT A;  1VF5 C;  1TWH B;  1EEF D;  2ZXR A;  5CV4 A;  5KYL A;  3VYU A;  1O7L A;  1STH A;  1PZJ D;  4I65 A;  2JEA I;  3K7A B;  5DEH A;  1NR2 A;  3LWU A;  5A35 A;  3GQB A;  4F7X A;  1S5C D;  4EGV A;  2JA7 B;  2RA4 A;  1TY2 A;  1FNV A;  5DM6 3;  3BG3 A;  3NE5 B;  4C3I G;  3PIO 3;  4K2L A;  2AQ2 B;  3V96 A;  2B63 B;  4B9X A;  3O13 A;  5D65 A;  4QCL A;  3NHH A;  4KK7 A;  1Y8O B;  1IYU A;  3Q22 A;  3TP5 A;  4L63 B;  4LJZ C;  1C8C A;  2KCN A;  2EYL A;  1D5M C;  5FO8 B;  2X69 A;  1MI2 A;  3T16 A;  2HDL A;  2YU9 B;  4B08 A;  3L7Z C;  3JAM E;  3K59 A;  1Q90 A;  2QEJ C;  4K5X A;  3S15 B;  1TY0 A;  4K5W A;  1YNJ C;  4R8I A;  5J22 A;  2VNU D;  4BA2 I;  2FMC A;  2M9V A;  1I4X A;  2L12 A;  1FNU A;  3M7G A;  5KYI A;  3G6J B;  4G4K A;  1ILP A;  2JXM B;  3SR1 A;  4FYD A;  2PMZ B;  3M85 A;  4EQN A;  2BOS A;  4M8A A;  1TU2 B;  5M9O A;  2LS0 1;  3DWQ A;  1Z6H A;  2RDG A;  5KRU A;  1E2V A;  2C5C A;  4KD4 A;  4E6I A;  3A54 A;  1AW7 A;  3NSW A;  1EYD A;  3VR3 A;  2D5D A;  4DXF A;  1F9Q A;  4FF1 A;  4HN7 A;  1SJE D;  2SDF A;  1XXG A;  1ESF A;  1U4L A;  3SVM A;  1BCP D;  5IGF A;  3RD4 A;  2G9D A;  5KNB A;  1RJT A;  1EQV A;  1LAB A;  5EKL A;  3FPP A;  1HTP A;  2MP1 A;  2K5D A;  4A3M B;  2HUG A;  4WJW A;  3R3O A;  5DAU A;  3BVZ A;  3PUY A;  3M3Y B;  4RGO S;  1PRT D;  3FMC A;  5HUR A;  3ND8 A;  1SE2 A;  2F0G A;  1GUT A;  4IQZ A;  3VYT A;  5FK9 C;  5IGD A;  3EVQ A;  1B3A A;  1KLU D;  1EYC A;  4GZY C;  1VCI A;  3I70 A;  4RGT A;  1I4H A;  1QOH A;  1GOZ A;  4ABN A;  2KHS A;  5KEE A;  4S3S A;  2NZ1 D;  2EJG C;  5DNF A;  5ISR A;  2NBF A;  1CQF A;  5ELE A;  2AUK A;  3A7L A;  1SNP A;  4PMC A;  1KTK A;  1PDQ A;  5C0X G;  3IFT A;  4TQU S;  2HCI A;  2MGS A;  5KNC A;  3GV3 A;  5CMD A;  4RCN A;  1ENA A;  1TS2 A;  3ND9 A;  1BBX C;  1X3Q A;  3QB3 A;  2M00 A;  3TN2 A;  4IUN A;  1NUC A;  4K8I A;  5D3I B;  1TS4 A;  4IUU A;  4JK1 C;  4HMI A;  4OIJ A;  3AMU A;  2J0T D;  3NXW A;  2F0M A;  1SBB B;  1SMY D;  1TII D;  1MGS A;  4KJN A;  3I91 A;  2XWB B;  4C3H G;  4FVM A;  3NQT A;  1A6X A;  2FJ2 A;  4XIG S;  1STE A;  3MTS A;  3HOX B;  2L11 A;  4DAP A;  1HTL D;  4KHV A;  2F3V A;  1QB5 D;  1LTR D;  2BDO A;  1SXT A;  5G3L F;  3K0Y A;  1J8I A;  4KN4 C;  3A8J E;  1F2L A;  4X3T A;  3KUP A;  4A3K B;  1R9T B;  1GUN A;  2JYO A;  1K8O A;  1H9K A;  3RZO B;  2R93 B;  3FRP B;  3NBH A;  2IX3 A;  1BUV T;  2WAQ B;  3MHB A;  2BCO A;  4ZLT F;  1LV9 A;  1EY0 A;  3GTQ B;  1HFG A;  3HOY B;  4KI0 A;  2Q8I B;  4ZQ3 A;  3TME A;  4RA8 A;  1TQO A;  1EOT A;  2NUC A;  2XVS A;  1TVX A;  4RCO A;  3GTG B;  2F0S A;  2F0I A;  1CA6 A;  4L8J A;  5JEA G;  1Y1W B;  2NTT A;  3GTJ B;  1L0X B;  4DNT B;  5A2Q L;  1BF4 A;  3IL8 A;  3NUC A;  2H1E A;  4MHE A;  3NP8 A;  4HCE A;  3S16 B;  1NSN S;  3MXU A;  2WP8 J;  4A3D B;  1KLG D;  2HQE A;  1B53 A;  4ID6 A;  2EYF A;  3SXH A;  1EL0 A;  1LLR D;  1CT1 D;  1PTO B;  3J7A F;  1PZI D;  5K36 G;  5TSS A;  4ZYS A;  1SJH D;  4DNR B;  2PW7 A;  4Q5V A;  3NPP A;  2A69 C;  3LWE A;  4OGQ C;  1SE4 A;  1EY9 A;  2F0E A;  3QOL A;  4C3J B;  2B2W A;  1T5E A;  1X3P A;  5CGK A;  4OO1 I;  3HOU B;  3U9S A;  1KNE A;  1TS3 A;  4F87 A;  4IFD G;  4K5V A;  1QE6 A;  4F88 A;  5CV6 A;  1D6E C;  4CJ2 C;  1Y69 U;  4BS9 A;  1A15 A;  1VF7 A;  3D4D A;  2FMM A;  3S9W A;  5C0X H;  1RHP A;  4V19 0;  1O80 A;  2DY8 A;  2WAC A;  5CYU A;  5KIX A;  5M3M B;  2KJX A;  2HDM A;  1ENC A;  2L55 A;  5CR3 A;  5ELC A;  2B2W C;  1QNK A;  4PMW A;  3DWA A;  2EYP A;  2N55 A;  3J81 L;  3EJI A;  1LTB D;  1Q3L A;  1FNW A;  2F0N A;  2E74 C;  1ROD A;  1JCK B;  1FD7 D;  2B2U A;  1DYQ A;  2RVL A;  2VXW A;  4K2K A;  4ZUJ A;  4PV1 C;  3QG1 A;  1A3V A;  2EVB A;  3QWN A;  2XWJ B;  4ZKB B;  1OXS C;  3VR4 A;  3QOJ A;  5IIF A;  2EJM A;  3ERQ A;  1H9R A;  4KKU A;  1LTA D;  3HGB A;  1Y8N B;  2PNR C;  2B8F A;  5IGG A;  2BE5 C;  4NW2 A;  4HSP A;  2B2U C;  2MJ8 A;  1JOR A;  1JWS D;  1ESR A;  2RSN A;  1I6H B;  3VYS A;  1CTM A;  1F77 A;  3OHX C;  2A68 C;  3KLS A;  4RGN A;  3GTP B;  1V1P B;  1WTW A;  4P2C B;  2EOT A;  2R7Z B;  4KN7 C;  2KCC A;  1KDC A;  4WOR A;  1V8Q A;  1F2Z A;  3RMH A;  4F8M A;  1TR5 A;  5JEA H;  1AP0 A;  3I4M B;  4XQQ A;  1TWF B;  1EFI D;  2OT2 A;  2V4D A;  3DXJ C;  3R8B A;  4RAU C;  1PMR A;  3HOW B;  1A2U A;  4CKB A;  1B9N A;  1OXU A;  5EBD A;  1E2Z A;  3VR5 A;  5C5M A;  3H91 A;  5AFW A;  2O2L D;  2PO4 A;  2G9H D;  4JBW A;  4LK1 C;  5C4Z A;  1TWA B;  3K58 A;  1II3 A;  1U4R A;  2K7V A;  2J7Z A;  1B1Z A;  3DWP A;  3GTM B;  3HZX A;  5E4W C;  3MWY W;  1DM0 B;  4ULL A;  1EU4 A;  4C1N I;  1BCP F;  2IX0 A;  4KJO A;  2Q8R E;  5I6W A;  5C0X J;  2XN9 C;  1SNQ A;  2SNM A;  4R9W A;  2SEB D;  3FPU B;  4IUQ A;  5CC4 A;  2KEE A;  4TSS A;  1ZYR C;  1MSG A;  1PRT F;  2MUY A;  2IWH A;  1B50 A;  5I2X A;  3SK5 A;  2E2I B;  3DM1 A;  2K1B A;  5I4D A;  1H9M A;  4QB4 A;  2F03 A;  1D5Z C;  1RTO A;  4OHJ A;  5CV5 A;  4FXD A;  2SOB A;  4K14 A;  4RFB A;  3NQI A;  3FDT A;  3QO2 A;  3GTL B;  3IKJ A;  1I4R A;  2OXP A;  1MSH A;  3KF8 A;  2F0D A;  3T53 B;  1H9J A;  3CU7 A;  2KED A;  3OIP A;  4C2M B;  2F0L A;  2QKI C;  5IGB A;  1LT4 D;  2HCC A;  3S2H B;  3NBI A;  2Y0S B;  2VB3 X;  1Y1V B;  1ENF A;  1DZ1 A;  5I9O A;  1WTV A;  5FLX L;  3HKZ B;  4N9P A;  2OEO A;  3OOC A;  1EWH A;  1V1O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...