1IBKQ

Structure of the thermus thermophilus 30s ribosomal subunit in complex with the antibiotic paromomycin
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
104
structure length
104
Chain Sequence
PKKVLTGVVVSDKMQKTVTVLVERQFPHPLYGKVIKRSKKYLAHDPEEKYKLGDVVEIIESRPISKRKRFRVLRLVESGRMDLVEKYLIRRQNYQSLSKRGGKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S RIBOSOMAL RNA
publication title Recognition of cognate transfer RNA by the 30S ribosomal subunit.
pubmed doi rcsb
total genus 17
structure length 104
sequence length 104
ec nomenclature
pdb deposition date 2001-03-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00366 Ribosomal_S17 Ribosomal protein S17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1ibkQ00
2UXCL 1X3GA 3KJPA 1CKMA 1X55A 1X9NA 3CCLA 3W1BA 1WI5A 2ZM6L 3AYHB 5M3FH 1WOCA 2R7DA 3PF4A 1X3FA 4X66L 1Q8KA 1CSPA 1WYDA 1JE5A 1UE1A 2CFMA 3ZJYC 4A3GH 2EIFA 1C0AA 4B3TQ 2YTXA 1VQ9A 2OTLA 4JYAQ 4C3HH 3T1HL 4DV0Q 1Q82C 1XPUA 1HZCA 3D0FA 1VCIA 4LF5L 2WAQG 4JI4L 1HZBA 3H15A 4GLXA 2F4VQ 4YCVA 4P72A 1RIPA 2AMCB 4HJAA 3J81j 1R9TH 3S1NH 2R92G 2WAQE 3U4ZA 4GLVB 1XPRA 2AWNA 4AH6A 3M7NA 1AH9A 4UP8A 4DK6C 1BBWA 1VQ6A 3RN2A 4RG1A 2IHEA 2KHJA 2ZTDA 4NXNL 2NVTH 3GTOH 1VQKA 2N8NA 4KLKA 2MFIA 1Q7YC 1NMGA 1T9HA 2LXKA 3FHWA 2GVBA 3OYYA 4QIWE 3ULJA 4DR7Q 3H0GH 4AQYL 3M4OH 4WJ4A 1V1QA 3M9BA 4LF6L 4DNIA 1VQLA 4MTNA 1H95A 5LMUQ 1J6QA 1QVCA 2JA8H 3GTJH 2Z0SA 2Z6KC 2I0QA 1TWFH 2UUAL 4YHHL 4R4QA 4B3SQ 4QL5A 1JMCA 3CC2A 4DR6Q 4QQBX 4PG3A 1PVOA 1L1OA 5ELNA 2E2IH 1DGSA 2K50A 3GTLH 3K0XA 1KQSA 2ZJPA 4BBSG 2JK8A 1Y1VH 1B70B 3GDEA 1XMOL 3S1QH 1V9PA 1YVCA 3STBC 4KHPQ 3OW2A 4TVAB 4K0KQ 3GD7A 4LFBL 1NBWA 2E2JH 4HIKA 2VUMH 2VZAA 3BJUA 3PUVA 4OX9L 4XTCS 4DR3Q 1KC8C 3S17H 5IY0A 1SFOH 2PQAA 1HJPA 4JV5Q 4C3IH 3CQZH 4L5QA 4A3IG 2K5HA 4IFDJ 4LF7L 3OTOQ 1O7IA 4GKJL 4JI7Q 4R4CA 1IYJB 3WWVA 3CCJA 2XGTA 3ER0A 5IT9c 2RCNA 5IP9H 1OTCA 4JBKA 2R92H 5M3FG 1N32Q 2JE6I 1X65A 4GS3A 4IPCA 5FJ8H 1J5EL 2H5XA 1FJGL 2BH2A 3ICEA 2F3IA 2CWAA 4IFDG 2UXDQ 1I94Q 2BA1A 4LFCL 4POFA 1VQ7A 4A3GG 3MXNB 5C4XH 1Q1BA 1Q86C 1IBLL 4LF9Q 2VY3A 3PV0A 1PH6A 2UU9Q 4B3MQ 2RHQB 5JJLA 2I5HA 1WCMH 1AE3A 5C0XI 2IY5B 2B29A 3NEMA 1K9MC 4AIMA 5J3BA 1G291 3EBEA 1HNXL 1QVFA 3GTMH 1JT8A 3G71A 3KFUA 4C3JH 1M90C 2VQFL 2E5LQ 2HIXA 3J7ZC 2EXDA 2RF4A 3PSIA 3BZCA 1EIYB 5HY6A 2CWPA 2KHIA 1VQAA 1P8LA 4DV6Q 3IRBA 2VW9A 2NN6I 4DV7L 3TS2A 1VQFA 1N34L 1HNZL 4BY1H 2Z6KA 1YJWA 2N78A 1KRTA 1VQNA 3JAMi 4DR5Q 1ASZA 4FDBA 3H0GG 5GAGC 2AKWB 1X6OA 3I7FA 4YY3Q 3EN2A 4POGA 2AWOA 1YNXA 4GN4B 4DUZL 2I5MX 2JA6H 4OWTB 1HR0Q 4YWLA 4NB3A 4JBWA 2VQEL 4LFAL 2JA8G 1D8LA 1SMXA 2WFWA 3CW2C 3I55A 4OO1G 2GVAA 2IHFA 1CKNB 2FXQA 2IX1A 2K4KA 2JEBI 3STBD 4NXML 1XMQQ 4JI3Q 1A0IA 4X66Q 2YV5A 3KF6B 5IYBH 2JA5H 5C44H 1N36L 2F52A 2UUBQ 1Y1VG 5M5WH 4A3KH 3CMAA 1IBML 4GN3B 4LUOA 3J81c 4JI6Q 3T1HQ 3PUYA 3KDFA 4X65Q 3F1ZA 2OTJA 2VUMG 1CKOA 5GQOA 2NVQH 3GTQH 1OXTA 4OXPA 5H1SE 4LUZA 1VQ8A 4LWCA 1E22A 1YJ9A 2CKZB 4DR4Q 2KBNA 3DLLA 5IYDH 3T1YL 2E2HH 1YEZA 1Z47A 4DK3C 4DV2L 4EX5A 3AEVA 2BA0A 2MNAA 1K8GA 4A3DH 5LMNW 1PHJA 1FVIA 3I2ZA 2QA4A 3UE1A 5BR8L 1YHAA 4JI5L 5IWAQ 3CCEA 2KCMA 3UE0A 5HGQA 3G6EA 1VQ4A 1YIJA 4X6AH 1LM0A 1K83H 2WP8J 5IP9G 1YZ6A 2XTIA 4HIMA 1PH9A 3HOZH 4LF6Q 4B3RL 2IT1A 3CPFA 2OQ0A 2PNHA 3PUXA 4JI2Q 4A4IA 1KD1C 1G51A 2RHSB 5FJ8G 4A3MH 4NXNQ 1M1KC 3E9IA 4O0AA 2JEAI 1NMFA 1C9OA 4RMFA 2HHHL 2UXBL 4DUYL 2K5VA 4HJ8A 1A8VA 5C4XG 3HOXH 2ID0A 4OWXB 2QGQA 1WCMG 5LMNL 1QUQA 2A1AA 3A5UA 4JI8L 2V1CC 4R4OA 5GAHC 3J80c 4YCWA 2IX0A 2A19A 3CCRA 3AQQA 1QVGA 1VS0A 1NE3A 3HOVH 4IPHA 1I50H 2K5NA 1NTGA 4L5SA 2NVXH 4A93H 2R6GA 4BA1I 4IOCA 4OX9Q 1X54A 4QGUA 4DAYB 2K52A 2DUDA 4BY1G 1KIXA 4JYAL 1MJCA 4IJLA 3L2PA 4X62L 4YWMA 2MQHA 4DV4Q 3KF8B 4DV0L 1YITA 3VDYA 4JG2A 3RLFA 1RL2A 1N33Q 4A3CH 2ALYB 2BH8A 2F4VL 2LXJA 5E7NA 3G48A 2NVYH 4P74A 3CPWA 1YHQA 2JA6G 2OCEA 2OQKA 3CXCA 1PH1A 1XJVA 1Z9FA 2C35B 2D0PA 1GVPA 2JQOA 4BXXH 3SGIA 4JC0A 2MO0A 3PO3H 3HOWH 4DV1L 4IFDI 3CCSA 1J5EQ 1GM5A 1KXLA 2HQLA 1K0RA 1FJGQ 3A74A 3HKZG 5IYBG 4DR2L 2JA5G 4PZ7A 5C44G 4A3KG 3L7ZC 3HKZE 4HIDA 3CC7A 1TWHH 1KRSA 4O2DA 3JC66 1UE6A 3Q8DA 4ME3A 4GNXA 2ZTEA 1G6PA 5LMUL 1IBKL 1MKHA 4EQ5A 1LUZA 1OXSC 3GO5A 2DGYA 2VNUD 1PFSA 4DKAC 4HJ5A 4B3SL 2YYZA 1Y1WH 4JI0Q 4DR6L 1V43A 5IYDG 4JI1Q 1X3EA 1VQIA 2NZHA 5JEAJ 1L1OB 1U5KA 2CQOA 4A3DG 1IXRA 4LW1A 4DV5Q 4DV3Q 2R93H 4DPGA 1XNRQ 2R7FA 4A3FH 4LF8Q 4IOAA 3A5ZB 5DLQE 2HT1A 4K0KL 3I4OA 4QJFA 1Q81C 1E24A 5M3MH 3PF5A 4LF4Q 3HOZG 2UXCQ 5GROA 1EIFA 4A3MG 2QEXA 4OO1I 4DR3L 3KJOA 4LFAQ 1EQRA 1OXVA 4H02A 3B6YA 1EWIA 4GKKQ 2D0OA 2PQAB 2Y0SG 4L5TA 2YTYA 1VQHA 4KHZA 3HOXG 3UDGA 5FLMH 1S40A 2Y0SE 5C3EH 1VQ5A 3OTOL 4JCVE 3ULPA 4PZ8A 1TWAH 4UP9A 1NY4A 2Q2IA 4QY7A 3CF5A 5IP7H 1YHBA 3TRZA 5K36G 5AJ3Q 4HJ7A 2ZTCA 5M5XH 4YWKA 4DR1L 3TQYA 1E1OA 1VQEA 2GN5A 3HOVG 1VQMA 1PH3A 1GO3E 1EQQA 3RNUA 3FP9A 3W1GA 2ZM6Q 1GD7A 4A93G 2UXDL 1I94L 3AFQA 2A8VA 1XNQL 4P71A 3M3YH 1W3SA 4B3ML 1Q46A 2ZJRA 1PYSB 1HNWL 1NJIC 1X56A 3K7AH 1C7YA 4A3CG 4HJ9A 1Y14B 1SR3A 4R4TA 3J81i 2Q2UA 3CCMA 1SN8A 3E9HA 2E5LL 3L0OA 1UWVA 3DM3A 4JI4Q 4LF5Q 4XIGS 1VQBA 2UUCL 4BXXG 4Y52H 1HH2P 3PO3G 3HOWG 2YU9H 4A3LH 4DV6L 3I4NH 4GNXC 4IJHA 3CMEA 3CD6A 1L0WA 3BU2A 4IO9A 1QZHA 3NBHB 5FLXc 2R7ZH 1N9WA 1UEBA 4A3EH 3ULLA 3GTKH 1L2FA 1I3QH 1Q1EA 1VQCA 4X64L 4LUVA 2ATWA 1SE8A 4YY3L 5LMNQ 3PO2H 2MO1A 2B63H 1KAWA 3PUWA 4OONA 4AQYQ 4PZ6A 3FKIH 4JI8Q 4A3JH 1A62A 1VQOA 2E8GA 5IYCH 1XPOA 2HIVA 3U4VA 1SROA 3J7A5 3HFZB 4APVA 4A3BH 1Y1WG 4JI3L 1XMQL 2PI2A 3S16H 2UUAQ 4YHHQ 1YBYA 4J15A 1JJ2A 3H3VH 2I5LX 3PIPA 1PYBA 1P16A 2R93G 2UUBL 3HOUH 1S72A 3NELA 4A3FG 2LSSA 4JI6L 4X62Q 4BY7H 3CAMA 3PCOB 3EIVA 1SRUA 3KDFB 3D31A 4X65L 4A75A 1XMOQ 2K75A 3J80i 5M3MG 1PH4A 1VQGA 1EOVA 1PV4A 3K81C 4LFBQ 4GOPC 5C4JH 1SLJA 3GTGH 5EAYA 4DR4L 4JBMA 4AYBG 3NENA 3U50C 4KI0A 1IL2A 4DV1Q 5FLMG 4AYBE 3K80C 5C3EG 4B3TL 3GTPH 1BKBA 4UPAA 2N49A 1E7ZA 4DR2Q 2L15A 5IWAL 3I4MH 4LF7Q 3RZDH 1VQPA 5IP7G 1ASYA 2JA7H 4KHPL 1WFQA 1PH2A 3K7UC 3M85A 4GKJQ 1BVSA 1UE5A 2KCTA 5IE8A 3A0JA 2NZOA 3UDFA 4JI2L 1IBKQ 3HOYH 3AFPA 3F2CA 3K8AA 1I5FA 4Y7NH 1PH8A 1FL0A 2D62A 5M5YH 4LFCQ 4JOIC 1IBLQ 4BBRH 1QUQB 4DR7L 4GLAC 3TEHB 3UDIA 3MEFA 1E1TA 1YI2A 3RR5A 1JJGA 3E0EA 3S14H 1B8AA 1MIUA 1HNXQ 1IZ6A 2VQFQ 1HZAA 1LTLA 2PMZE 3RN5A 3S2DH 2EQSA 3CC4A 3I4NG 4A3LG 1XTDA 1JB7A 1VQDA 2AHOB 2ZJQA 2YTVA 2CCZA 2PI2E 4L5RC 3W5OA 4DV7Q 3H3VI 3S1MH 1I6HH 3CCVA 2R7ZG 1TWGH 1A63A 3UDXA 4DV4L 4A3EG 1N34Q 1HNZQ 1N33L 3PIOA 3F2DA 1EUJA 3PO2G 1K3RA 1OXUA 1S3OA 5ELOA 4PMWA 4C2MH 4IPDA 1PH5A 2B63G 3RLNA 4NPSA 3I56A 3FKIG 3TS0A 4A3JG 4WJ3M 3U58A 5IYCG 4DUZQ 4R1JA 5JEAG 3G4SA 4DR1Q 1QZGA 2VQEQ 1W2BA 1N8RC 4A3BG 3S2HH 1E3PA 4ALPA 3CP0A 4GN5A 1KL9A 4UY8C 1CKNA 1PH7A 4JV5L 4NXMQ 4UP7A 1XNQQ 1OXXK 4A76A 4GOPA 3HOUG 1K73C 3KF6A 2JJQA 3ERSX 1N36Q 4TQUS 3M4QA 4JI7L 2ES2A 4BY7G 1BBUA 1HNWQ 4BA2I 4GNXB 4P73A 1KHIA 1IBMQ 1YJNA 2KENA 1VQJA 2VS1A 4JBJA 4OWWB 1D7QA 4YCUA 1N32L 1CSQA 3BZKA 4IPGA 3TREA 4LNQA 1B7YB 5C0XJ 2B3GA 2VL6A 3PUZA 3CCQA 1WJJA 2UUCQ 4JI0L 1TXYA 2WB1G 4JI1L 1K8AC 3CCUA 1GKHA 4LF9L 1CUKA 2WB1E 2UU9L 1TWCH 4DV5L 1UE7A 1JJCB 4DV3L 1FGUA 3T1YQ 1XNRL 3RZOH 4MNOA 4DV2Q 4LF8L 3JAMc 4BBSH 3I4MG 3S24A 5C0XG 4R4IA 3RLOA 2JA7G 5BR8Q 4X64Q 5GAEC 2Q2HA 3PGZA 1HR0W 4JI5Q 4LF4L 5JJIA 1Q12A 4JOIA 4HIOA 1L1OC 3S15H 2OWOA 2Q2TA 4B3RQ 3M4PA 2K14A 3S1RH 1PA6A 3HOYG 4GKKL 3F2BA 2ASBA 3F8TA 2JA9A 3KYHC 2HHHQ 4MZ9A 2UXBQ 2NN6G 4DUYQ 1AE2A 2N3SA 1HZ9A 4GOPB 5JJKA 4P75A 1MJEA 3HKSA 4DR5L 4BBRG 4DAMA 1LYLA 4A3IH 3KLWA 5GADC 1U0LA 5AJ3L 3KOJA 1EFWA 1HR0L 3LGJA 1EYGA
chains in the Genus database with same CATH superfamily
1X55A 2NTTA 2Z8LA 1EWCA 3GP7A 4X66L 1Q8KA 3ZJYC 2EIFA 1LTGD 1PZKD 1RCVD 2YTXA 1VQ9A 2OTLA 4JYAQ 4FYDA 5FO8B 3D0FA 1U4RA 1VCIA 2F4VQ 3H15A 2EDGA 1RIPA 2AMCB 1HA5A 3GV6A 5EKIA 2B2UA 3DUZA 3KBXA 1XPRA 4AH6A 3M7NA 3P7JA 1STEA 2RA4A 2RDFA 4RG1A 1SJHD 3QB3A 2KHJA 4CGYB 5C6AA 4NXNL 2K32A 4KN7C 4KLKA 4IURA 3FHWA 3A54A 4DR7Q 3M4OH 4UDUC 1V1QA 4LF6L 5I6YA 5LMUQ 3FPPA 2JA8H 2EJMA 4OO1H 1TT2A 2O5IC 4R4QA 3D4WA 1I4QA 4QQBX 4MN3A 1R4QB 1PVOA 1L1OA 1DGSA 1KQSA 2F0HA 2ZJPA 1I3QB 2JK8A 1Y1VH 1XMOL 1E0BA 2B63B 4Q5VA 2KOLA 1EY5A 1E2ZA 1X32A 3QIAA 4HIKA 1TR5A 4K2LA 3BJUA 4OX9L 1UAPA 5EQ0A 1WVLA 3S17H 5IY0A 2PQAA 5EPJA 3TP7A 1FNVA 5CYUA 1BXTA 5C4ZA 2QF7A 2SOBA 3CQZH 4L5QA 4A3IG 4LF7L 3OTOQ 2EJFC 3T51B 1G2TA 5C3XA 4PV1C 3CCJA 3NK9A 1LLRD 2RKSA 1CM9A 2R92H 3GQBA 1VDZA 3GTGB 1J5EL 2BH2A 3ICEA 2WB1B 2CWAA 1HFNA 5C4XH 1LO5D 3PV0A 3DXJC 3SEBA 4LF9Q 4MHEA 2I5HA 4KJNA 2EYOA 2CQAA 3C1FA 3BDOA 1G291 1HNXL 4ODGA 3G71A 4C3JH 2VQFL 5KYLA 2DNEA 1RDPD 1ET9A 2AQ3B 2CHBD 3DEOA 3HOYB 3K5MA 5D14A 2EJGC 5IGFA 2KHIA 2QEJC 1P8LA 1VQAA 1K0SA 2VW9A 2NN6I 5M5YB 4ID6A 1CQVA 3DWQA 3NBHA 5IGDA 5D65A 2N78A 4I65A 2DY7A 3QOJA 1WTPA 3EN2A 4PNYA 2AWOA 5DNFA 4POGA 2JA6H 1HQRD 1HR0Q 2PNRC 2NUCA 4JBWA 2JA8G 1SMXA 3KLRA 3R3OA 3CW2C 4OO1G 3VYSA 2GVAA 1CKNB 5D3DA 5FK9C 4J8QA 1QNUA 3STBD 4JI3Q 2FFKB 5DAUA 2YV5A 4H7BA 1ET6A 1EU3A 1Y1VG 4ZAIA 4GN3B 4YIJA 3T1HQ 1A2TA 4CDFC 1BO0A 5KIXA 3J7AV 1HQMC 5A2QE 3QOLA 2KBNA 5IYDH 2P5ZX 5FOBB 2IX3A 2Q8RE 4PMCA 4DV2L 3FPUB 3AEVA 2BA0A 4X3TA 2FJ2A 3MFGA 1JR0D 3NTIA 2J7ZA 4RKLA 3CCEA 5HGQA 3G6EA 2XRQD 3VYUA 5KYIA 1VQ4A 2WKCA 1LM0A 1K83H 2WACA 1AN8A 2PYKA 4FO2A 1GUWA 2IT1A 3OMGA 3PUXA 2PNHA 1NAPA 4JI2Q 4JW0A 1CK1A 1ZYRD 3E9IA 4O0AA 2JEAI 3ZYYX 4RMFA 4DUYL 2K5VA 5C4XG 5AFWA 3HOXH 2ID0A 4FXKC 3MAQA 3A5UA 2NTSA 1KNEA 5GAHC 2IX0A 4C3JG 2EYFA 5LL6X 3HOVH 1A2UA 1I50H 1GHKA 1B53A 2K5NA 1F2LA 3EQLC 2K01A 4QGUA 4FXGC 2DUDA 1STAA 4X62L 4YWMA 2C5CA 2MQHA 1UUPA 3KF8B 1N33Q 3LWUA 3VDYA 3RLFA 4A3CH 2BH8A 1YHQA 2JA6G 4OEMB 1PTOD 3BYTB 2OCEA 1XJVA 1Z9FA 5M9OA 4BXXH 2NVQB 3BDCA 1EY9A 5LHY1 3CCSA 1K0RA 5NUCA 4XT3B 4DR2L 1ILQA 2Z1CA 3CC7A 4DAPA 1KRSA 4K5WA 1UE6A 1G6PA 1RKNA 2QCPX 2G9DA 1R9TB 1MKHA 4EQ5A 4XQJA 2LY7A 2E76C 1PFSA 5CV4A 4DKAC 1Y1WH 4DR6L 1V43A 5IYDG 4JI1Q 1X3EA 3JAME 2NZHA 3NXWA 2R93H 1SYCA 1B50A 1EU4A 3KLSA 3MXUA 4KY5A 3I4OA 2F0GA 2UXCQ 4LF4Q 3VR4A 4OO1I 3KJOA 5ISRA 1LTAD 1LTSD 4I7AA 1HRJA 3HOXG 5FLMH 2E2IB 1F9PA 4JCVE 4PZ8A 1EZ8A 1NY4A 1GJXA 5IP7H 1ESFA 4HJ7A 3DEPA 3TQYA 2V4DA 1XXGA 3HOVG 3RNUA 1ONLA 4DAVA 4G7ZC 4V190 1KLGD 3MXPA 1SFOB 5BN4A 4B3ML 3R8BA 4KD4A 4KJOA 4A3CG 1EY6A 2B2TA 5BN5A 2Q2UA 2F03A 3K58A 3L0OA 1DM0B 1JC7A 2F1MA 2UUCL 4BXXG 1HH2P 2F0KA 2L4NA 1RJTA 1F2YA 2F4IA 4DV6L 5DM63 4IJHA 3UI2A 1Y69U 1QE6A 1GUGA 5COYA 3ULLA 1WCMB 1HHVA 1I3QH 1VQCA 3W3AA 4YY3L 2B63H 4CKCA 3PUWA 4R8IA 3U4VA 2F0QA 4APVA 1AFPA 2B2VC 2Q8TA 1Y1WG 1D2BA 1JJ2A 2R93G 4BY1B 2UUBL 3I72A 4JI6L 1JQYD 2HUGA 1QB5D 3CAMA 3PCOB 4DXFA 1DYQA 1XMOQ 4A75A 2K75A 1HFGA 1EOVA 5ELBA 1ENAA 3MC0B 1PV4A 1EQTA 4J6HA 5I9PA 3VYTA 5CC4A 3GTGH 4DR4L 3NENA 1IL2A 5FLMG 4CJ2C 2CH4W 2JA5B 5C44B 3PQIA 1LABA 5IT9E 5M5WB 5IWAL 4IUTA 4A3KB 4CKEA 3RZDH 4LF7Q 5IP7G 4KKUA 3K7UC 2ICIA 2NZOA 4RGOS 3GTQB 2EYPA 5CBEE 3HOYH 1SE4A 3AFPA 3BZDB 1PH8A 2E2HB 5M5YH 3MEHA 2JP1A 4JOIC 4DU9A 2FINB 2F3VA 4BWGB 1QUQB 3OHXC 4DR7L 1V1OA 1YI2A 1HNXQ 2PPBC 3HOZB 2VQFQ 1HZAA 2SNMA 1SE3A 3MWYW 1H9SB 3RMHA 3CC4A 3EFXD 2Y0SB 1VF5C 1Y8NB 3TP8A 2CCZA 2ZJQA 4L5RC 3W5OA 1QG7A 3CCVA 3UDXA 4U68A 2LFNA 1YNND 3PIOA 2F0FA 1K3RA 5ELOA 4PMWA 1PTOB 4EVOA 2B63G 1F9SA 4NPSA 4WJ3M 5C4HA 1Q90A 3U58A 4NKLA 1E3PA 4ALPA 2F0JA 1E2WA 1KL9A 1CKNA 3SDZA 4GOPA 1JORA 2B2UC 3M4QA 2ES2A 3VA7A 1S5FD 1NR4A 2NVYB 3H94A 4EGVA 3PUZA 5IODA 3CHBD 1TXYA 2WB1G 3VA5A 2D9UA 4LF9L 2WB1E 1JJCB 4DV3L 1XNRL 4DV2Q 3JAMc 1AW7A 4R4IA 4RKBA 4CHTB 3ND9A 1Y8OB 2AUKA 1L1OC 2EY5A 4DFAA 1LTTD 3HOYG 2WIIB 4G57A 4DUYQ 1AE2A 2N3SA 1HZ9A 3I90A 5JJKA 4P75A 1MJEA 5CV7A 5D3IB 3KLWA 1U0LA 1HR0L 4KHVA 5M3MB 3TSSA 3J80L 1X3GA 3KJPA 3CCLA 1I4PA 2SNSA 1WOCA 3FEWX 1LV9A 4B9WA 3OIPA 1T5EA 2O5JC 1JE5A 1UE1A 5KNCA 4K8IA 5CGKA 1IHZA 5A2QL 4TSSA 5KRUA 3KF8A 3T1HL 1XPUA 1HZCA 4LF5L 3IL8A 5M5XB 4GLXA 4KHPQ 4YCVA 3H09A 5EKLA 2JXMB 4HJAA 1R9TH 1LT5D 2KEDA 3NTHA 4DK6C 1PDQA 1BBWA 2SEBD 1RD9D 3RN2A 3O13A 3M3YB 2N88A 3Q6SA 3C1EA 1SAPA 3ERQA 2X6LA 2N8NA 1Q7YC 5KEEA 1VQKA 1NMGA 1T9HA 1JCKB 4AQYL 4FXDA 3M9BA 5KNBA 1J6QA 2Z0SA 2I0QA 1HCZA 2YU9B 5G3LF 3ONAB 1JMCA 3CC2A 4DR6Q 4P2CB 1B9MA 5ELNA 1JWSD 2E2IH 3GTLH 4A3EB 3V2TA 3GTKB 1B70B 4Z9CB 3OW2A 3AU7A 5CORA 3FKIB 3GD7A 1NBWA 4N8X1 1KC8C 1FNUA 1HTLD 4TRDA 1SFOH 3HOUB 4ABNA 2CW0C 3TZDA 4F87A 4RCOA 4GKJL 1MSGA 3P1HA 4R4CA 1IYJB 2XGTA 5IT9c 2A6EC 2O2LD 2PO4A 4RH6A 2PZTA 3SVMA 1OTCA 4JBKA 5C4JB 3S1NB 2A68D 1X65A 4IPCA 1HTPA 2H5XA 3A8KE 3H91A 2BA1A 4LFCL 4G7HC 2QKIC 4R9WA 3GTPB 1Q1BA 1IBLL 1I6VC 2VY3A 4B3MQ 1SYDA 2A73B 1WCMH 5J1ZA 3I4MB 2D2CC 1K9MC 4AIMA 5J3BA 3EBEA 1QVFA 4O1NA 2HIXA 3J7ZC 1PLFA 3PSIA 1FGBD 1CT1D 4DV6Q 3IRBA 1N34L 1HNZL 1WTWA 4KN4C 2Z6KA 5FLXL 4IUQA 4BY1H 1SMYD 3QWNA 3JAMi 4K2KA 1PRTF 2AKWB 2UXCL 3X3NA 4YY3Q 3S14B 4DUZL 3KK7A 1IYUA 4FP5D 4NB3A 2Z4HA 2IX1A 3S1MB 1I6HB 4CBVA 1A0IA 2MJ8A 2F0DA 5IYBH 2JA5H 4DK1A 5IGCA 5C44H 1N36L 2F52A 2UUBQ 5M5WH 4A3KH 3N6RA 1IBML 4JI6Q 3PUYA 4O42A 1S4ZA 1CKOA 5GQOA 1PRTC 4C1NI 1OXTA 3GTQH 4LUZA 4IN3A 4OELB 3Q24A 4DR4Q 2CKZB 3DLLA 1RODA 3K6OA 4X3UA 2E2HH 1Z47A 1B2TA 4DK3C 3BDLA 4EX5A 2PW5A 3IKJA 2MNAA 5LMNW 3J7AF 4M1UB 4V0BA 4JI5L 5IWAQ 5IOCA 1J8IA 1PH9A 4HIMA 3HOZH 2A69D 3CPFA 4A4IA 3I91A 1PXUA 1M1KC 1C9OA 2K6AA 2UXBL 1TWCB 4L8JA 1B3QA 4HCEA 3RZOB 1WCMG 3X3MA 1QUQA 1PTOH 2V1CC 5K36H 3DM1A 4YCWA 3S15B 2KHSA 1NE3A 4WRDA 2MPMA 5JOBA 1NTGA 1H9SA 5JAVA 1TS2A 1X54A 1F9QA 2K52A 4BY1G 4LAAA 1EL0A 2NVYH 3CPWA 4N9TA 3CXCA 1PH1A 1XTCD 5IT9L 2D0PA 2JQOA 1DOMA 4QMGA 3SGIA 2B2WA 1K3BC 3TBIB 1U4LA 3HOWH 1SNPA 1KXLA 2B2TC 1GM5A 5T1IA 1A6XA 3BVMA 2D5DA 3TP5A 3A74A 1MGSA 4A3GB 5IYBG 2JA5G 5C44G 1WTRA 4A3KG 4PMBA 1LT6D 2F0UA 2F3WA 4O2DA 5I9OA 1NNXA 1OXSC 2VNUD 1DZ1A 1C48A 2K5WA 2YYZA 3HS0C 4HCSA 5KGUA 5E4WC 1H9RA 1IXRA 4LW1A 4DV3Q 1XNRQ 4IOAA 3MHBA 1Q81C 5M3MH 2J4XA 3PF5A 3HOZG 5GROA 3GTJB 1SNQA 1EQRA 1TWFB 1EWIA 2D0OA 2Y0SG 1O7YA 2Y0SE 2F0EA 5CR3A 2M2LA 4QY7A 3CF5A 5K36G 1YHBA 5M5XH 1CZGA 2IJ0A 4RHSA 2EYJA 2VUMB 1EQQA 1AEXA 3K57A 3J7YW 2PZWA 2UXDL 3TMEA 3NWSA 1I94L 3AFQA 2A8VA 2RSNA 3TDQA 4IUVA 3M3YH 1W3SA 4CKBA 1Q46A 4C3IB 2ZT9C 1IKMA 2ZJRA 1PYSB 1ICFB 1X56A 3AMUA 1Y14B 1SR3A 4R4TA 4EQNA 2E5LL 1WTQA 1UWVA 3DM3A 4LF5Q 3BVZA 1LTBD 1VQBA 4ZK9B 1AZQA 4IZ8A 2B39A 1TS4A 3HOWG 2YU9H 4A3LH 4GNXC 1UEAB 1D5ZC 3K59A 1L0WA 3BU2A 4RFBA 4IO9A 1SNOA 1N9WA 1UEBA 4A3EH 4UHVA 3GTKH 3N52A 1L2FA 1I4HA 2ATWA 1SE8A 2LMCB 4OONA 4AQYQ 3FKIH 1XPOA 1VQOA 2E8GA 5IYCH 3J7A5 3HFZB 1XMQL 2PI2A 2MP1A 3TN2A 1YBYA 4XQQA 4ZRZA 4JVZA 3PIPA 1P16A 2QILA 2ZXRA 3HOUH 5K5PA 1A3UA 1TWAB 4BY7H 2MGSA 4X65L 3D31A 5M3MG 1VQGA 1STNA 4GOPC 4K6LA 1DOKA 1QCBD 5C4JH 4OHJA 1IW7C 1QNKA 3NSWA 4JBMA 4QUCA 4DV1Q 3KLSX 3HKZB 3GTPH 3G7LA 1BKBA 4UPAA 1OO9B 2L15A 1E2VA 3K7AB 3I4MH 3TP6A 5JJZA 4KHPL 1TIID 1ZXTA 4GKJQ 1BVSA 1UE5A 2KCTA 5IE8A 1KNAA 5EJWA 4FVMA 2L5TA 5EPLA 3T56B 3A8JE 2EVBA 1FL0A 2C9OA 2LKVA 4LFCQ 3KBGA 1O7LA 1IBLQ 4HAEA 5DEHA 3QJYA 2A6HC 5ELFA 1UNSA 1PFMA 3TEHB 1E1TA 3RR5A 3S14H 1SJED 4RAUC 1GUNA 3T4AC 1ESRA 2EQSA 2HDLA 1G2SA 4A3LG 1XTDA 2WKDA 3S1MH 1I6HH 2PI2E 2KEEA 3H3VI 1S5CD 3Q22A 4ULLA 2K5QA 4A3EG 4DV4L 1SEBD 1N34Q 1HNZQ 1NUCA 3I56A 3FKIG 5IYCG 4DUZQ 2G5DA 4DR1Q 1QZGA 1N8RC 2TMPA 3CP0A 4UY8C 2NVXB 1YNJC 2VXWA 3J81E 1OXXK 3HOUG 3HG9A 3D3RA 1N36Q 4BY7G 1KHIA 1IBMQ 2KENA 3BZKA 2B3GA 3FDTA 4ZYSA 3PO3B 1K8AC 4CJ1B 3D8GA 1CUKA 1TWCH 2H4OA 1UE7A 2FHTA 1FGUA 3BYYB 3RZOH 4LF8L 4L6TB 3I4MG 3S24A 1TWHB 1HA6A 4JI5Q 3PGZA 5JJIA 1JICA 2CH4A 3EA6A 2F0IA 3S15H 1MI2A 3OIQA 2K14A 1JWMD 1PA6A 4R8NA 3KYHC 2UXBQ 1D5XC 2R3ZA 1TWGB 1EIHA 4A3FB 2KUMA 5AJ3L 2QDLA 3KOJA 4C2MB 2ICEC 5C5MA 1ILPA 4PQXA 3W1BA 1WI5A 3AYHB 1BDOA 2RBMA 4H0LC 4AYBB 4IFDH 1A3VA 3MA2B 1CSPA 1QILA 2BE5D 2CFMA 5C3EB 4A3GH 5HURA 3ITPA 1Q82C 1SYBA 1HZBA 4P72A 1EQVA 2E74C 3U4ZA 4GLVB 1KLUD 1AH9A 5F2DA 3FRPB 4UP8A 1DJRD 1XWEA 2IHEA 2JSOA 2ZTDA 2O4XA 5C3WA 4OIJA 1ML0D 2F0NA 2JYOA 4WJ4A 4ZKCB 5FO7B 4DNIA 4MTNA 1H95A 2PMZB 1QVCA 4K6DA 4WJWA 5CMDA 1H9MA 3GTJH 2Z6KC 5J39A 1BCPD 1VMPA 2DJFC 2EYLA 1TWFH 3I4NB 2WINB 1SE2A 1K28A 4QL5A 4PG3A 2IWHA 2K50A 1M4VA 3K0XA 3PO2B 3STBC 1B4OA 1SXTA 2EYMA 3I73A 4A3JB 4J1MA 4RCNA 2VUMH 3BVGA 4A3BB 2IPKD 4XTCS 3S16B 1EY0A 4H13C 3SK4A 1S5BD 4C3IH 3IFDA 1W6JA 1STBA 4QUFA 1O7IA 2F0SA 3WWVA 3ER0A 3S9WA 2XIWA 1FYCA 4FNFA 1AZPA 1KABA 1N32Q 5KNDA 2NWGA 3D4DA 5FJ8H 3OMCA 2F3IA 4IFDG 2DNCA 1TS3A 2UXDQ 4CDDC 1I94Q 1Q8IA 4KV6A 4DK0A 4A3GG 1U4PA 2UU9Q 2RHQB 2B2YA 3CRKC 1ZYRC 2IY5B 3NEMA 2JA7B 2M9VA 2IW3A 1Q3LA 1M90C 2E5LQ 3L3OC 4HTHA 1PTOF 2EOTA 1LTRD 3BZCA 3R93A 2NBFA 4DV7L 1FR3A 4MTKA 3TS2A 4HEDA 4BBRB 1XYIA 1ASZA 5GAGC 1X6OA 3I7FA 4GN4B 1YNXA 2I5MX 1Y8PB 2E75C 4OWTB 1D8LA 2MHVA 2QW7A 2FXQA 5HGTA 4I7ZC 2K4KA 2JEBI 1XMQQ 1PTOC 4F8MA 4WFN3 4G4KA 3K5OA 3CMAA 3P20A 4LUOA 3J81c 1EY8A 5EPKA 3VYRA 1I4RA 2WAQB 4X65Q 4IUNA 2VUMG 2K03A 2NVQH 1BF4A 3I8ZA 4OXPA 3S2HB 2R92B 4LWCA 3SK5A 2F0MA 1JB3A 1SBBB 1GUTA 1RTOA 4C3IG 4QIWB 1K8GA 1LTID 3I70A 1PHJA 1FVIA 2I46A 2QA4A 3UE1A 5BR8L 1YHAA 3LNNA 3UE0A 2OF1A 3OWFA 4H44C 2RHSB 5FJ8G 1KD1C 2XVSA 5J22A 1A8VA 1NCVA 4BBSB 3OSOA 4R4OA 3FVQA 4UAIA 1BR9A 1B9NA 1QVGA 1VS0A 2OT2A 4IPHA 3S1RB 2BCOA 2HD3A 2HQEA 4L5SA 2NVXH 2R6GA 1KDCA 2PW7A 4WORA 4DAYB 1GUSA 1MJCA 4IJLA 4DV4Q 1YITA 4DV0L 2LXJA 1TS5A 3G48A 2L12A 2L0CA 1CHQD 3C3LA 2OQKA 3Q23A 3TZUA 2E2DC 5M3FB 4JC0A 3CU7A 3PO3H 4DV1L 4IFDI 1DCZA 2KA7A 1EY7A 1FJGQ 3HKZG 4PZ7A 3SXHA 1TU2B 3L7ZC 3HKZE 1HXYD 4HIDA 1SYEA 4C3HB 1TWHH 1MD2D 1A15A 2K33A 1BCPB 3OPOA 3GO5A 1KDAA 2M00A 4U673 4HJ5A 4B3SL 1VQIA 2F0TA 4NDXA 3GTOB 2NVTB 2GA4B 4DPGA 4A3FH 3H6MA 4LF8Q 3JAML 3A5ZB 3H0GB 2HT1A 4K0KL 1EIFA 4DXGA 2QEXA 4DR3L 4LFAQ 1EY4A 5L37A 4H02A 3DMUA 2X6GA 4L5TA 4KHZA 3UDGA 1S40A 2G9HD 1PRTB 5C3EH 1VQ5A 2JN4A 3S1QB 3TRZA 2Q2IA 2AQ2B 5AJ3Q 2ZTCA 4DR1L 2GN5A 2E2JB 1VQMA 1PH3A 2XN9C 1GD7A 4E6IA 4LMQD 4CDEC 4P71A 5I2XA 2Q8IB 4GZYC 2RCFA 1NJIC 5CV5A 1G6ZA 3EJIA 3J81i 2KVMA 1SN8A 4Y52H 3CRLC 3PO3G 2NZ1D 3I4NH 1U4MA 3WOEA 1J9OA 3A7AB 4C1NK 3PIO3 1CA6A 2R93B 3C46A 3Q0AA 3PO2H 5LMNQ 1GUOA 4NW2A 3GTMB 2MO1A 3DHQA 1EOTA 4PZ6A 4JI8Q 4A3JH 1KAAA 1HUMA 1YNNC 4XDXA 4A3BH 3S16H 4JK1C 3H3VH 5A35A 3NELA 1F77A 4A3FG 3E5SA 1B1ZA 1SRUA 3EIVA 3KDFB 1D5MC 4ZUIA 3MTSA 1YNJD 1WTXA 1EYCA 4NP5A 4ME5A 5EAYA 1II3A 1PYWD 5EKKA 4AYBG 2KCCA 1LT3D 1KTKA 4KI0A 5I2YA 4AYBE 5C3EG 1ZEQX 2TSSA 1E7ZA 1WTHA 5C0XH 1VQPA 1WD1A 2JA7H 2KCNA 1WFQA 2SDFA 1STGA 2PCFB 3BG3A 3K5LA 3A0JA 3UDFA 1BOSA 1S5ED 1IBKQ 4DA2A 1TKWB 1MBYA 1F2ZA 1JE4A 4L63B 3F2CA 1I5FA 5CV8A 1CTMA 1STYA 4A3DB 4DN4M 1CHPD 3F2UA 4BBRH 2RDGA 2X69A 1MHWC 3MEFA 5EBCA 2H1EA 1SSOA 1JJGA 1B8AA 1IZ6A 1AP0A 1LTLA 2PMZE 4A3MB 3RN5A 3I4NG 1JB7A 2AHOB 3NWTA 3A7LA 2NYZD 1W6KA 2YTVA 4DV7Q 1IKLA 4M8AA 2DY8A 1STHA 1FNWA 3PO2G 1PH5A 3TS0A 4A3JG 1CQFA 3I4LA 3SE0A 3G4SA 2EZVA 3S2HH 4A3BG 4A93B 3SK8A 1D6EC 1XNQQ 4A76A 1I4GA 2JJQA 4BS9A 3ERSX 1HPCA 4TQUS 1HNWQ 4QF4A 4BA2I 4GNXB 1DXMA 2OXPA 1A3TA 3RZDB 4OWWB 2VS1A 4IUUA 4KMUC 4YCUA 4RHRA 1N32L 1B7YB 4DNRB 1D1KA 3BS1A 4JI0L 5C5LA 2UU9L 4DV5L 1CI3M 4BBSH 4B9XA 5CV9A 3K5NA 1JOKA 4ZLTF 5C0XG 3RLOA 2JA7G 5BR8Q 4X64Q 2Q2HA 1HR0W 2Q2TA 3EROA 4IQZA 3M4PA 3S1RH 4GKKL 1ENCA 4LJZC 3F2BA 2Z9HA 2ASBA 3F8TA 2JA9A 3HGBA 4MZ9A 3OOCA 4GOPB 3VR6A 3HKSA 3J80E 4BBRG 3I3CA 1CA5A 5GADC 2BDOA 1EZ6A 1EFWA 3LGJA 1EYGA 3DWPA 4OIKA 1CKMA 1X9NA 2EE1A 2ZM6L 4B08A 3DWAA 5M3FH 2R7DA 3V05A 3PF4A 2PZUA 1X3FA 4XXEA 4ZQ3A 5ELEA 1WYDA 1PFNA 1GXDC 1C0AA 4K5VA 4DAYA 2A68C 4B3TQ 1SNDA 3C2PA 4X3KA 4C3HH 4DV0Q 5E3FA 2WAQG 4JI4L 2KECA 3QR8A 2EY6A 3J81j 3S1NH 2R92G 2WAQE 3A8IE 3QO2A 2B2YC 3M7GA 2AWNA 2KJXA 3D6CA 1VQ6A 1PFBA 2OEOA 1FD7D 1F9RA 4K14A 3R2TA 2NVTH 3GTOH 3D6WA 1SDFA 2MFIA 3HRZC 3OYYA 2LXKA 4QIWE 2GVBA 3SHLA 3ULJA 3PMFA 4DNTB 3H0GH 4RGMA 1VQLA 1EYAA 2EY1A 5IGBA 1SMYC 1O78A 3NPPA 1G8ZD 2UUAL 1JOOA 4YHHL 4B3SQ 2LS01 1GOZA 2R7ZB 3NTKA 4BBSG 3LWEA 2WV6D 3GDEA 1R4PB 3S1QH 1V9PA 1YVCA 5CBAE 4IALA 4TVAB 1BQQT 1WTOA 4K0KQ 4LFBL 2E2JH 4HR7B 2VZAA 1QJOA 3PUVA 4DR3Q 4K5XA 2RSOA 3NBIA 1V1PB 1HJPA 5ELDA 4JV5Q 1XX8A 3GV3A 2K5HA 4IFDJ 2DN8A 2B8GA 5CV6A 4JI7Q 5IGEA 4RA8A 2F0PA 2RCNA 5IP9H 5M3FG 2JE6I 4GS3A 1FJGL 2J0TD 2PQEA 3AB9A 4QB4A 4POFA 1VQ7A 3MXNB 3T13A 1Q86C 2A69C 2XSCA 1PH6A 3L9AX 5JJLA 1AE3A 4IUPA 4C3HG 2B29A 3MVVA 5C0XI 2R61A 3D4RA 2B8FA 3GTMH 4KY7A 5IIFA 1JT8A 3KFUA 3E0JA 3NHHA 2EXDA 2RF4A 1IYVA 1TQOA 5FLXE 1EIYB 5HY6A 2CWPA 2K1BA 4Y7NB 5EBDA 1VQFA 2XNAC 2L9HA 3GTLB 2HDMA 4TKOB 1KRTA 1YJWA 2BOSA 1VQNA 4DR5Q 3M4YA 3NP8A 4FDBA 3H0GG 2BDNA 4YWLA 2VQEL 4LFAL 1L0YB 2WFWA 3I55A 3S2DB 2IHFA 2FMCA 2ENBA 4NXML 1BNZA 2F0VA 4EQOA 4X66Q 3LX0A 3KF6B 4HSVA 1TVXA 3T16A 2L55A 3A55A 2EXZA 3MZ5A 3V96A 3KDFA 2CVRA 1RHPA 4OGQC 1C8CA 3WDNA 3F1ZA 2OTJA 2NB0A 5G3LD 1L0XB 5H1SE 2AUJD 2CW0D 1VQ8A 1E22A 1YJ9A 1GHJA 4HMIA 3T1YL 1YEZA 2A6ED 4A3DH 1VF7A 3VR3A 3I2ZA 4NXNQ 1YIJA 2KCMA 2L1BA 4X6AH 2L11A 1H9KA 2WP8J 3VR5A 5IP9G 1YZ6A 2XTIA 4XYQA 4B3RL 4LF6Q 2HCIA 2OQ0A 1G51A 4A3MH 1TY2A 1NMFA 2HHHL 2K05A 4HJ8A 4DF7A 4OWXB 2QGQA 5LMNL 2ZXOA 2A1AA 4EQPA 4JI8L 2Z6BA 3J80c 2A19A 3CCRA 1JOQA 3AQQA 2K5DA 4A93H 5JVG3 4OX9Q 3NUCA 4BA1I 4IOCA 3SK6A 1X3PA 1KIXA 4JYAL 3L2PA 1EEID 4A3IB 1LACA 4JG2A 1ICWA 1RL2A 2ALYB 1RTNA 2F4VL 2MUYA 5E7NA 4P74A 4CJ0B 1TY0A 2C35B 2EPBA 4FF3A 1B3AA 1GVPA 2MO0A 2RDHA 1DONA 1J5EQ 2HQLA 3KUPA 4C56C 1PRTD 3ND8A 3R2IA 3JC66 3Q8DA 4ME3A 4GNXA 2ZTEA 5LMUL 1IBKL 1CFMA 3IFTA 3OWEB 4HMJA 1LUZA 3A56A 2DGYA 4JI0Q 2IL8A 5JEAJ 1L1OB 3PIP3 1U5KA 1BBXC 2CQOA 4A3DG 4KKSA 4DV5Q 2I07B 3IAYA 2R7FA 1SYGA 5DLQE 4ZCKA 3M4OB 4X3SA 3HEJA 4QJFA 2F0OA 1E24A 3SR1A 1BUVT 1QWYA 2VB2X 2JA8B 1VMCA 4KY6A 4A3MG 1PZID 3NQIA 1OXVA 3B6YA 4GKKQ 2PQAB 4KTAA 4NMZA 2YTYA 1VQHA 1EEFD 2AQ1B 4S3SA 3OTOL 3ULPA 1Z6HA 3HZXA 4ZKBB 1TWAH 4UP9A 1Y1VB 5EGTA 3OW7A 4YWKA 1E1OA 1VQEA 1F2MA 3H3VC 1GO3E 1C4QA 3FP9A 3W1GA 2ZM6Q 4A93G 3HOWB 1O80A 3S17B 1XNQL 1ENFA 2XRSD 3CQZB 1HNWL 2B2WC 3K7AH 1C7YA 4HJ9A 5FKAC 1IL8A 3CCMA 2DJGC 3E9HA 2Z4IA 1DOLA 1EIGA 1ZKOA 1D1IA 4XIGS 4JI4Q 1PMRA 3VR2A 1SYFA 5JPMC 3CMEA 3CD6A 1QZHA 3QG1A 3U9SA 5C4XB 3NBHB 2K7VA 5FLXc 2R7ZH 5ELCA 3MFYA 1Q1EA 4X64L 2HCCA 4LUVA 1KAWA 4C3JB 1A62A 4FF1A 5JEAH 2HIVA 1SROA 4K8JA 1WD0A 2FMMA 4JI3L 4F88A 2UUAQ 1MSHA 4YHHQ 4J15A 5BN3A 3CKIB 2I5LX 1I4XA 1PYBA 1S72A 1M8AA 1G91A 2LSSA 2QDBA 4X62Q 4N9PA 1EFID 1PH4A 3G6JB 2JA6B 1NR2A 3J80i 3URYA 3K81C 4LFBQ 2EY2A 1SLJA 1EYDA 4F7XA 3MXGA 1PZJD 3U50C 3K80C 1V1PA 3T53B 4XQNA 4B3TL 2RQXA 2A5HA 2N49A 4DR2Q 4MIUA 1U9RA 1ASYA 1CZWA 3FMCA 1PH2A 4FF4A 3M85A 4ILWA 4QCLA 2F0WA 4RWSC 4JI2L 5TSSA 1DD2A 4DGZA 3K8AA 2N55A 5FO9B 5E1FA 4Y7NH 3HP3A 1RF2D 2D62A 3U9OA 1KDBA 2NN6H 3WOFA 3MXNA 2XWJB 1K8MA 4GLAC 3UDIA 4G7OC 1H9JA 3E0EA 5T1GA 4Q0FA 1K83B 1MIUA 5IGGA 3K0YA 3E3XA 1WTVA 1X3QA 3W2DA 5E4XA 1K8OA 3S2DH 2EYHA 5DM73 4XT1B 5I6WA 1VQDA 2ZXPA 3HOXB 2R7ZG 1TWGH 1SNMA 1V8QA 1A63A 1N33L 3EVQA 2B2VA 3F2DA 1EUJA 2K04A 1OXUA 1S3OA 4C2MH 4BY7B 4IPDA 5LL6S 3RUZA 3RLNA 1Z7TA 4N8FA 2A74C 2BE5C 4R1JA 5JEAG 1O7ZA 3HOVB 2VQEQ 1W2BA 1I50B 4GN5A 1PH7A 1BCPF 4JV5L 4NXMQ 3E6ZX 4UP7A 2RVLA 1K73C 3KF6A 1B44D 3RD4A 1IW7D 3NE5B 4KKTA 4JI7L 1BBUA 1NSNS 4P73A 4HSPA 1SNCA 3J81L 1YJNA 1VQJA 4JBJA 1QOHA 1D7QA 1CSQA 3TREA 4IPGA 1S5DD 2K28A 4KD3A 4LNQA 5JPNC 5C0XJ 2VL6A 3CCQA 1T5XD 1WJJA 2UUCQ 1HUNA 4JI1L 3CCUA 1GKHA 1LT4D 4RGTA 2F0LA 3T1YQ 5I4DA 4ZUJA 2VB3X 2KQ3A 4HN7A 4XYOA 1BCPC 4MNOA 4LK1C 3NQTA 5GAEC 1EWHA 4LF4L 1Q12A 4JOIA 4OL7A 4RGNA 2XWBB 4HIOA 2OWOA 4B3RQ 2A6HD 4CDCC 5JVH3 1Y1WB 4FF2A 4JPBW 2HHHQ 2NN6G 3P75A 1JWUD 4DR5L 4DAMA 1LYLA 4A3IH 4KK7A
chains in the Genus database with same CATH topology
2UXCL 1X3GA 3KJPA 1CKMA 1X55A 1X9NA 3CCLA 3W1BA 1WI5A 2ZM6L 3AYHB 5M3FH 1WOCA 2R7DA 3PF4A 1X3FA 4X66L 1Q8KA 1CSPA 1WYDA 1JE5A 1UE1A 2CFMA 3ZJYC 4A3GH 2EIFA 1C0AA 4B3TQ 2YTXA 1VQ9A 2OTLA 4JYAQ 4C3HH 3T1HL 4DV0Q 1Q82C 1XPUA 1HZCA 3D0FA 1VCIA 4LF5L 2WAQG 4JI4L 1HZBA 3H15A 4GLXA 2F4VQ 4YCVA 4P72A 1RIPA 2AMCB 4HJAA 3J81j 1R9TH 3S1NH 2R92G 2WAQE 3U4ZA 4GLVB 1XPRA 2AWNA 4AH6A 3M7NA 1AH9A 4UP8A 4DK6C 1BBWA 1VQ6A 3RN2A 4RG1A 2IHEA 2KHJA 2ZTDA 4NXNL 2NVTH 3GTOH 1VQKA 2N8NA 4KLKA 2MFIA 1Q7YC 1NMGA 1T9HA 2LXKA 3FHWA 2GVBA 3OYYA 4QIWE 3ULJA 4DR7Q 3H0GH 4AQYL 3M4OH 4WJ4A 1V1QA 3M9BA 4LF6L 4DNIA 1VQLA 4MTNA 1H95A 5LMUQ 1J6QA 1QVCA 2JA8H 3GTJH 2Z0SA 2Z6KC 2I0QA 1TWFH 2UUAL 4YHHL 4R4QA 4B3SQ 4QL5A 1JMCA 3CC2A 4DR6Q 4QQBX 4PG3A 1PVOA 1L1OA 5ELNA 2E2IH 1DGSA 2K50A 3GTLH 3K0XA 1KQSA 2ZJPA 4BBSG 2JK8A 1Y1VH 1B70B 3GDEA 1XMOL 3S1QH 1V9PA 1YVCA 3STBC 4KHPQ 3OW2A 4TVAB 4K0KQ 3GD7A 4LFBL 1NBWA 2E2JH 4HIKA 2VUMH 2VZAA 3BJUA 3PUVA 4OX9L 4XTCS 4DR3Q 1KC8C 3S17H 5IY0A 1SFOH 2PQAA 1HJPA 4JV5Q 4C3IH 3CQZH 4L5QA 4A3IG 2K5HA 4IFDJ 4LF7L 3OTOQ 1O7IA 4GKJL 4JI7Q 4R4CA 1IYJB 3WWVA 3CCJA 2XGTA 3ER0A 5IT9c 2RCNA 5IP9H 1OTCA 4JBKA 2R92H 5M3FG 1N32Q 2JE6I 1X65A 4GS3A 4IPCA 5FJ8H 1J5EL 2H5XA 1FJGL 2BH2A 3ICEA 2F3IA 2CWAA 4IFDG 2UXDQ 1I94Q 2BA1A 4LFCL 4POFA 1VQ7A 4A3GG 3MXNB 5C4XH 1Q1BA 1Q86C 1IBLL 4LF9Q 2VY3A 3PV0A 1PH6A 2UU9Q 4B3MQ 2RHQB 5JJLA 2I5HA 1WCMH 1AE3A 5C0XI 2IY5B 2B29A 3NEMA 1K9MC 4AIMA 5J3BA 1G291 3EBEA 1HNXL 1QVFA 3GTMH 1JT8A 3G71A 3KFUA 4C3JH 1M90C 2VQFL 2E5LQ 2HIXA 3J7ZC 2EXDA 2RF4A 3PSIA 3BZCA 1EIYB 5HY6A 2CWPA 2KHIA 1VQAA 1P8LA 4DV6Q 3IRBA 2VW9A 2NN6I 4DV7L 3TS2A 1VQFA 1N34L 1HNZL 4BY1H 2Z6KA 1YJWA 2N78A 1KRTA 1VQNA 3JAMi 4DR5Q 1ASZA 4FDBA 3H0GG 5GAGC 2AKWB 1X6OA 3I7FA 4YY3Q 3EN2A 4POGA 2AWOA 1YNXA 4GN4B 4DUZL 2I5MX 2JA6H 4OWTB 1HR0Q 4YWLA 4NB3A 4JBWA 2VQEL 4LFAL 2JA8G 1D8LA 1SMXA 2WFWA 3CW2C 3I55A 4OO1G 2GVAA 2IHFA 1CKNB 2FXQA 2IX1A 2K4KA 2JEBI 3STBD 4NXML 1XMQQ 4JI3Q 1A0IA 4X66Q 2YV5A 3KF6B 5IYBH 2JA5H 5C44H 1N36L 2F52A 2UUBQ 1Y1VG 5M5WH 4A3KH 3CMAA 1IBML 4GN3B 4LUOA 3J81c 4JI6Q 3T1HQ 3PUYA 3KDFA 4X65Q 3F1ZA 2OTJA 2VUMG 1CKOA 5GQOA 2NVQH 3GTQH 1OXTA 4OXPA 5H1SE 4LUZA 1VQ8A 4LWCA 1E22A 1YJ9A 2CKZB 4DR4Q 2KBNA 3DLLA 5IYDH 3T1YL 2E2HH 1YEZA 1Z47A 4DK3C 4DV2L 4EX5A 3AEVA 2BA0A 2MNAA 1K8GA 4A3DH 5LMNW 1PHJA 1FVIA 3I2ZA 2QA4A 3UE1A 5BR8L 1YHAA 4JI5L 5IWAQ 3CCEA 2KCMA 3UE0A 5HGQA 3G6EA 1VQ4A 1YIJA 4X6AH 1LM0A 1K83H 2WP8J 5IP9G 1YZ6A 2XTIA 4HIMA 1PH9A 3HOZH 4LF6Q 4B3RL 2IT1A 3CPFA 2OQ0A 2PNHA 3PUXA 4JI2Q 4A4IA 1KD1C 1G51A 2RHSB 5FJ8G 4A3MH 4NXNQ 1M1KC 3E9IA 4O0AA 2JEAI 1NMFA 1C9OA 4RMFA 2HHHL 2UXBL 4DUYL 2K5VA 4HJ8A 1A8VA 5C4XG 3HOXH 2ID0A 4OWXB 2QGQA 1WCMG 5LMNL 1QUQA 2A1AA 3A5UA 4JI8L 2V1CC 4R4OA 5GAHC 3J80c 4YCWA 2IX0A 2A19A 3CCRA 3AQQA 1QVGA 1VS0A 1NE3A 3HOVH 4IPHA 1I50H 2K5NA 1NTGA 4L5SA 2NVXH 4A93H 2R6GA 4BA1I 4IOCA 4OX9Q 1X54A 4QGUA 4DAYB 2K52A 2DUDA 4BY1G 1KIXA 4JYAL 1MJCA 4IJLA 3L2PA 4X62L 4YWMA 2MQHA 4DV4Q 3KF8B 4DV0L 1YITA 3VDYA 4JG2A 3RLFA 1RL2A 1N33Q 4A3CH 2ALYB 2BH8A 2F4VL 2LXJA 5E7NA 3G48A 2NVYH 4P74A 3CPWA 1YHQA 2JA6G 2OCEA 2OQKA 3CXCA 1PH1A 1XJVA 1Z9FA 2C35B 2D0PA 1GVPA 2JQOA 4BXXH 3SGIA 4JC0A 2MO0A 3PO3H 3HOWH 4DV1L 4IFDI 3CCSA 1J5EQ 1GM5A 1KXLA 2HQLA 1K0RA 1FJGQ 3A74A 3HKZG 5IYBG 4DR2L 2JA5G 4PZ7A 5C44G 4A3KG 3L7ZC 3HKZE 4HIDA 3CC7A 1TWHH 1KRSA 4O2DA 3JC66 1UE6A 3Q8DA 4ME3A 4GNXA 2ZTEA 1G6PA 5LMUL 1IBKL 1MKHA 4EQ5A 1LUZA 1OXSC 3GO5A 2DGYA 2VNUD 1PFSA 4DKAC 4HJ5A 4B3SL 2YYZA 1Y1WH 4JI0Q 4DR6L 1V43A 5IYDG 4JI1Q 1X3EA 1VQIA 2NZHA 5JEAJ 1L1OB 1U5KA 2CQOA 4A3DG 1IXRA 4LW1A 4DV5Q 4DV3Q 2R93H 4DPGA 1XNRQ 2R7FA 4A3FH 4LF8Q 4IOAA 3A5ZB 5DLQE 2HT1A 4K0KL 3I4OA 4QJFA 1Q81C 1E24A 5M3MH 3PF5A 4LF4Q 3HOZG 2UXCQ 5GROA 1EIFA 4A3MG 2QEXA 4OO1I 4DR3L 3KJOA 4LFAQ 1EQRA 1OXVA 4H02A 3B6YA 1EWIA 4GKKQ 2D0OA 2PQAB 2Y0SG 4L5TA 2YTYA 1VQHA 4KHZA 3HOXG 3UDGA 5FLMH 1S40A 2Y0SE 5C3EH 1VQ5A 3OTOL 4JCVE 3ULPA 4PZ8A 1TWAH 4UP9A 1NY4A 2Q2IA 4QY7A 3CF5A 5IP7H 1YHBA 3TRZA 5K36G 5AJ3Q 4HJ7A 2ZTCA 5M5XH 4YWKA 4DR1L 3TQYA 1E1OA 1VQEA 2GN5A 3HOVG 1VQMA 1PH3A 1GO3E 1EQQA 3RNUA 3FP9A 3W1GA 2ZM6Q 1GD7A 4A93G 2UXDL 1I94L 3AFQA 2A8VA 1XNQL 4P71A 3M3YH 1W3SA 4B3ML 1Q46A 2ZJRA 1PYSB 1HNWL 1NJIC 1X56A 3K7AH 1C7YA 4A3CG 4HJ9A 1Y14B 1SR3A 4R4TA 3J81i 2Q2UA 3CCMA 1SN8A 3E9HA 2E5LL 3L0OA 1UWVA 3DM3A 4JI4Q 4LF5Q 4XIGS 1VQBA 2UUCL 4BXXG 4Y52H 1HH2P 3PO3G 3HOWG 2YU9H 4A3LH 4DV6L 3I4NH 4GNXC 4IJHA 3CMEA 3CD6A 1L0WA 3BU2A 4IO9A 1QZHA 3NBHB 5FLXc 2R7ZH 1N9WA 1UEBA 4A3EH 3ULLA 3GTKH 1L2FA 1I3QH 1Q1EA 1VQCA 4X64L 4LUVA 2ATWA 1SE8A 4YY3L 5LMNQ 3PO2H 2MO1A 2B63H 1KAWA 3PUWA 4OONA 4AQYQ 4PZ6A 3FKIH 4JI8Q 4A3JH 1A62A 1VQOA 2E8GA 5IYCH 1XPOA 2HIVA 3U4VA 1SROA 3J7A5 3HFZB 4APVA 4A3BH 1Y1WG 4JI3L 1XMQL 2PI2A 3S16H 2UUAQ 4YHHQ 1YBYA 4J15A 1JJ2A 3H3VH 2I5LX 3PIPA 1PYBA 1P16A 2R93G 2UUBL 3HOUH 1S72A 3NELA 4A3FG 2LSSA 4JI6L 4X62Q 4BY7H 3CAMA 3PCOB 3EIVA 1SRUA 3KDFB 3D31A 4X65L 4A75A 1XMOQ 2K75A 3J80i 5M3MG 1PH4A 1VQGA 1EOVA 1PV4A 3K81C 4LFBQ 4GOPC 5C4JH 1SLJA 3GTGH 5EAYA 4DR4L 4JBMA 4AYBG 3NENA 3U50C 4KI0A 1IL2A 4DV1Q 5FLMG 4AYBE 3K80C 5C3EG 4B3TL 3GTPH 1BKBA 4UPAA 2N49A 1E7ZA 4DR2Q 2L15A 5IWAL 3I4MH 4LF7Q 3RZDH 1VQPA 5IP7G 1ASYA 2JA7H 4KHPL 1WFQA 1PH2A 3K7UC 3M85A 4GKJQ 1BVSA 1UE5A 2KCTA 5IE8A 3A0JA 2NZOA 3UDFA 4JI2L 1IBKQ 3HOYH 3AFPA 3F2CA 3K8AA 1I5FA 4Y7NH 1PH8A 1FL0A 2D62A 5M5YH 4LFCQ 4JOIC 1IBLQ 4BBRH 1QUQB 4DR7L 4GLAC 3TEHB 3UDIA 3MEFA 1E1TA 1YI2A 3RR5A 1JJGA 3E0EA 3S14H 1B8AA 1MIUA 1HNXQ 1IZ6A 2VQFQ 1HZAA 1LTLA 2PMZE 3RN5A 3S2DH 2EQSA 3CC4A 3I4NG 4A3LG 1XTDA 1JB7A 1VQDA 2AHOB 2ZJQA 2YTVA 2CCZA 2PI2E 4L5RC 3W5OA 4DV7Q 3H3VI 3S1MH 1I6HH 3CCVA 2R7ZG 1TWGH 1A63A 3UDXA 4DV4L 4A3EG 1N34Q 1HNZQ 1N33L 3PIOA 3F2DA 1EUJA 3PO2G 1K3RA 1OXUA 1S3OA 5ELOA 4PMWA 4C2MH 4IPDA 1PH5A 2B63G 3RLNA 4NPSA 3I56A 3FKIG 3TS0A 4A3JG 4WJ3M 3U58A 5IYCG 4DUZQ 4R1JA 5JEAG 3G4SA 4DR1Q 1QZGA 2VQEQ 1W2BA 1N8RC 4A3BG 3S2HH 1E3PA 4ALPA 3CP0A 4GN5A 1KL9A 4UY8C 1CKNA 1PH7A 4JV5L 4NXMQ 4UP7A 1XNQQ 1OXXK 4A76A 4GOPA 3HOUG 1K73C 3KF6A 2JJQA 3ERSX 1N36Q 4TQUS 3M4QA 4JI7L 2ES2A 4BY7G 1BBUA 1HNWQ 4BA2I 4GNXB 4P73A 1KHIA 1IBMQ 1YJNA 2KENA 1VQJA 2VS1A 4JBJA 4OWWB 1D7QA 4YCUA 1N32L 1CSQA 3BZKA 4IPGA 3TREA 4LNQA 1B7YB 5C0XJ 2B3GA 2VL6A 3PUZA 3CCQA 1WJJA 2UUCQ 4JI0L 1TXYA 2WB1G 4JI1L 1K8AC 3CCUA 1GKHA 4LF9L 1CUKA 2WB1E 2UU9L 1TWCH 4DV5L 1UE7A 1JJCB 4DV3L 1FGUA 3T1YQ 1XNRL 3RZOH 4MNOA 4DV2Q 4LF8L 3JAMc 4BBSH 3I4MG 3S24A 5C0XG 4R4IA 3RLOA 2JA7G 5BR8Q 4X64Q 5GAEC 2Q2HA 3PGZA 1HR0W 4JI5Q 4LF4L 5JJIA 1Q12A 4JOIA 4HIOA 1L1OC 3S15H 2OWOA 2Q2TA 4B3RQ 3M4PA 2K14A 3S1RH 1PA6A 3HOYG 4GKKL 3F2BA 2ASBA 3F8TA 2JA9A 3KYHC 2HHHQ 4MZ9A 2UXBQ 2NN6G 4DUYQ 1AE2A 2N3SA 1HZ9A 4GOPB 5JJKA 4P75A 1MJEA 3HKSA 4DR5L 4BBRG 4DAMA 1LYLA 4A3IH 3KLWA 5GADC 1U0LA 5AJ3L 3KOJA 1EFWA 1HR0L 3LGJA 1EYGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UXC L;  1X3G A;  3KJP A;  1CKM A;  1X55 A;  1X9N A;  3CCL A;  3W1B A;  1WI5 A;  2ZM6 L;  3AYH B;  5M3F H;  1WOC A;  2R7D A;  3PF4 A;  1X3F A;  4X66 L;  1Q8K A;  1CSP A;  1WYD A;  1JE5 A;  1UE1 A;  2CFM A;  3ZJY C;  4A3G H;  2EIF A;  1C0A A;  4B3T Q;  2YTX A;  1VQ9 A;  2OTL A;  4JYA Q;  4C3H H;  3T1H L;  4DV0 Q;  1Q82 C;  1XPU A;  1HZC A;  3D0F A;  1VCI A;  4LF5 L;  2WAQ G;  4JI4 L;  1HZB A;  3H15 A;  4GLX A;  2F4V Q;  4YCV A;  4P72 A;  1RIP A;  2AMC B;  4HJA A;  3J81 j;  1R9T H;  3S1N H;  2R92 G;  2WAQ E;  3U4Z A;  4GLV B;  1XPR A;  2AWN A;  4AH6 A;  3M7N A;  1AH9 A;  4UP8 A;  4DK6 C;  1BBW A;  1VQ6 A;  3RN2 A;  4RG1 A;  2IHE A;  2KHJ A;  2ZTD A;  4NXN L;  2NVT H;  3GTO H;  1VQK A;  2N8N A;  4KLK A;  2MFI A;  1Q7Y C;  1NMG A;  1T9H A;  2LXK A;  3FHW A;  2GVB A;  3OYY A;  4QIW E;  3ULJ A;  4DR7 Q;  3H0G H;  4AQY L;  3M4O H;  4WJ4 A;  1V1Q A;  3M9B A;  4LF6 L;  4DNI A;  1VQL A;  4MTN A;  1H95 A;  5LMU Q;  1J6Q A;  1QVC A;  2JA8 H;  3GTJ H;  2Z0S A;  2Z6K C;  2I0Q A;  1TWF H;  2UUA L;  4YHH L;  4R4Q A;  4B3S Q;  4QL5 A;  1JMC A;  3CC2 A;  4DR6 Q;  4QQB X;  4PG3 A;  1PVO A;  1L1O A;  5ELN A;  2E2I H;  1DGS A;  2K50 A;  3GTL H;  3K0X A;  1KQS A;  2ZJP A;  4BBS G;  2JK8 A;  1Y1V H;  1B70 B;  3GDE A;  1XMO L;  3S1Q H;  1V9P A;  1YVC A;  3STB C;  4KHP Q;  3OW2 A;  4TVA B;  4K0K Q;  3GD7 A;  4LFB L;  1NBW A;  2E2J H;  4HIK A;  2VUM H;  2VZA A;  3BJU A;  3PUV A;  4OX9 L;  4XTC S;  4DR3 Q;  1KC8 C;  3S17 H;  5IY0 A;  1SFO H;  2PQA A;  1HJP A;  4JV5 Q;  4C3I H;  3CQZ H;  4L5Q A;  4A3I G;  2K5H A;  4IFD J;  4LF7 L;  3OTO Q;  1O7I A;  4GKJ L;  4JI7 Q;  4R4C A;  1IYJ B;  3WWV A;  3CCJ A;  2XGT A;  3ER0 A;  5IT9 c;  2RCN A;  5IP9 H;  1OTC A;  4JBK A;  2R92 H;  5M3F G;  1N32 Q;  2JE6 I;  1X65 A;  4GS3 A;  4IPC A;  5FJ8 H;  1J5E L;  2H5X A;  1FJG L;  2BH2 A;  3ICE A;  2F3I A;  2CWA A;  4IFD G;  2UXD Q;  1I94 Q;  2BA1 A;  4LFC L;  4POF A;  1VQ7 A;  4A3G G;  3MXN B;  5C4X H;  1Q1B A;  1Q86 C;  1IBL L;  4LF9 Q;  2VY3 A;  3PV0 A;  1PH6 A;  2UU9 Q;  4B3M Q;  2RHQ B;  5JJL A;  2I5H A;  1WCM H;  1AE3 A;  5C0X I;  2IY5 B;  2B29 A;  3NEM A;  1K9M C;  4AIM A;  5J3B A;  1G29 1;  3EBE A;  1HNX L;  1QVF A;  3GTM H;  1JT8 A;  3G71 A;  3KFU A;  4C3J H;  1M90 C;  2VQF L;  2E5L Q;  2HIX A;  3J7Z C;  2EXD A;  2RF4 A;  3PSI A;  3BZC A;  1EIY B;  5HY6 A;  2CWP A;  2KHI A;  1VQA A;  1P8L A;  4DV6 Q;  3IRB A;  2VW9 A;  2NN6 I;  4DV7 L;  3TS2 A;  1VQF A;  1N34 L;  1HNZ L;  4BY1 H;  2Z6K A;  1YJW A;  2N78 A;  1KRT A;  1VQN A;  3JAM i;  4DR5 Q;  1ASZ A;  4FDB A;  3H0G G;  5GAG C;  2AKW B;  1X6O A;  3I7F A;  4YY3 Q;  3EN2 A;  4POG A;  2AWO A;  1YNX A;  4GN4 B;  4DUZ L;  2I5M X;  2JA6 H;  4OWT B;  1HR0 Q;  4YWL A;  4NB3 A;  4JBW A;  2VQE L;  4LFA L;  2JA8 G;  1D8L A;  1SMX A;  2WFW A;  3CW2 C;  3I55 A;  4OO1 G;  2GVA A;  2IHF A;  1CKN B;  2FXQ A;  2IX1 A;  2K4K A;  2JEB I;  3STB D;  4NXM L;  1XMQ Q;  4JI3 Q;  1A0I A;  4X66 Q;  2YV5 A;  3KF6 B;  5IYB H;  2JA5 H;  5C44 H;  1N36 L;  2F52 A;  2UUB Q;  1Y1V G;  5M5W H;  4A3K H;  3CMA A;  1IBM L;  4GN3 B;  4LUO A;  3J81 c;  4JI6 Q;  3T1H Q;  3PUY A;  3KDF A;  4X65 Q;  3F1Z A;  2OTJ A;  2VUM G;  1CKO A;  5GQO A;  2NVQ H;  3GTQ H;  1OXT A;  4OXP A;  5H1S E;  4LUZ A;  1VQ8 A;  4LWC A;  1E22 A;  1YJ9 A;  2CKZ B;  4DR4 Q;  2KBN A;  3DLL A;  5IYD H;  3T1Y L;  2E2H H;  1YEZ A;  1Z47 A;  4DK3 C;  4DV2 L;  4EX5 A;  3AEV A;  2BA0 A;  2MNA A;  1K8G A;  4A3D H;  5LMN W;  1PHJ A;  1FVI A;  3I2Z A;  2QA4 A;  3UE1 A;  5BR8 L;  1YHA A;  4JI5 L;  5IWA Q;  3CCE A;  2KCM A;  3UE0 A;  5HGQ A;  3G6E A;  1VQ4 A;  1YIJ A;  4X6A H;  1LM0 A;  1K83 H;  2WP8 J;  5IP9 G;  1YZ6 A;  2XTI A;  4HIM A;  1PH9 A;  3HOZ H;  4LF6 Q;  4B3R L;  2IT1 A;  3CPF A;  2OQ0 A;  2PNH A;  3PUX A;  4JI2 Q;  4A4I A;  1KD1 C;  1G51 A;  2RHS B;  5FJ8 G;  4A3M H;  4NXN Q;  1M1K C;  3E9I A;  4O0A A;  2JEA I;  1NMF A;  1C9O A;  4RMF A;  2HHH L;  2UXB L;  4DUY L;  2K5V A;  4HJ8 A;  1A8V A;  5C4X G;  3HOX H;  2ID0 A;  4OWX B;  2QGQ A;  1WCM G;  5LMN L;  1QUQ A;  2A1A A;  3A5U A;  4JI8 L;  2V1C C;  4R4O A;  5GAH C;  3J80 c;  4YCW A;  2IX0 A;  2A19 A;  3CCR A;  3AQQ A;  1QVG A;  1VS0 A;  1NE3 A;  3HOV H;  4IPH A;  1I50 H;  2K5N A;  1NTG A;  4L5S A;  2NVX H;  4A93 H;  2R6G A;  4BA1 I;  4IOC A;  4OX9 Q;  1X54 A;  4QGU A;  4DAY B;  2K52 A;  2DUD A;  4BY1 G;  1KIX A;  4JYA L;  1MJC A;  4IJL A;  3L2P A;  4X62 L;  4YWM A;  2MQH A;  4DV4 Q;  3KF8 B;  4DV0 L;  1YIT A;  3VDY A;  4JG2 A;  3RLF A;  1RL2 A;  1N33 Q;  4A3C H;  2ALY B;  2BH8 A;  2F4V L;  2LXJ A;  5E7N A;  3G48 A;  2NVY H;  4P74 A;  3CPW A;  1YHQ A;  2JA6 G;  2OCE A;  2OQK A;  3CXC A;  1PH1 A;  1XJV A;  1Z9F A;  2C35 B;  2D0P A;  1GVP A;  2JQO A;  4BXX H;  3SGI A;  4JC0 A;  2MO0 A;  3PO3 H;  3HOW H;  4DV1 L;  4IFD I;  3CCS A;  1J5E Q;  1GM5 A;  1KXL A;  2HQL A;  1K0R A;  1FJG Q;  3A74 A;  3HKZ G;  5IYB G;  4DR2 L;  2JA5 G;  4PZ7 A;  5C44 G;  4A3K G;  3L7Z C;  3HKZ E;  4HID A;  3CC7 A;  1TWH H;  1KRS A;  4O2D A;  3JC6 6;  1UE6 A;  3Q8D A;  4ME3 A;  4GNX A;  2ZTE A;  1G6P A;  5LMU L;  1IBK L;  1MKH A;  4EQ5 A;  1LUZ A;  1OXS C;  3GO5 A;  2DGY A;  2VNU D;  1PFS A;  4DKA C;  4HJ5 A;  4B3S L;  2YYZ A;  1Y1W H;  4JI0 Q;  4DR6 L;  1V43 A;  5IYD G;  4JI1 Q;  1X3E A;  1VQI A;  2NZH A;  5JEA J;  1L1O B;  1U5K A;  2CQO A;  4A3D G;  1IXR A;  4LW1 A;  4DV5 Q;  4DV3 Q;  2R93 H;  4DPG A;  1XNR Q;  2R7F A;  4A3F H;  4LF8 Q;  4IOA A;  3A5Z B;  5DLQ E;  2HT1 A;  4K0K L;  3I4O A;  4QJF A;  1Q81 C;  1E24 A;  5M3M H;  3PF5 A;  4LF4 Q;  3HOZ G;  2UXC Q;  5GRO A;  1EIF A;  4A3M G;  2QEX A;  4OO1 I;  4DR3 L;  3KJO A;  4LFA Q;  1EQR A;  1OXV A;  4H02 A;  3B6Y A;  1EWI A;  4GKK Q;  2D0O A;  2PQA B;  2Y0S G;  4L5T A;  2YTY A;  1VQH A;  4KHZ A;  3HOX G;  3UDG A;  5FLM H;  1S40 A;  2Y0S E;  5C3E H;  1VQ5 A;  3OTO L;  4JCV E;  3ULP A;  4PZ8 A;  1TWA H;  4UP9 A;  1NY4 A;  2Q2I A;  4QY7 A;  3CF5 A;  5IP7 H;  1YHB A;  3TRZ A;  5K36 G;  5AJ3 Q;  4HJ7 A;  2ZTC A;  5M5X H;  4YWK A;  4DR1 L;  3TQY A;  1E1O A;  1VQE A;  2GN5 A;  3HOV G;  1VQM A;  1PH3 A;  1GO3 E;  1EQQ A;  3RNU A;  3FP9 A;  3W1G A;  2ZM6 Q;  1GD7 A;  4A93 G;  2UXD L;  1I94 L;  3AFQ A;  2A8V A;  1XNQ L;  4P71 A;  3M3Y H;  1W3S A;  4B3M L;  1Q46 A;  2ZJR A;  1PYS B;  1HNW L;  1NJI C;  1X56 A;  3K7A H;  1C7Y A;  4A3C G;  4HJ9 A;  1Y14 B;  1SR3 A;  4R4T A;  3J81 i;  2Q2U A;  3CCM A;  1SN8 A;  3E9H A;  2E5L L;  3L0O A;  1UWV A;  3DM3 A;  4JI4 Q;  4LF5 Q;  4XIG S;  1VQB A;  2UUC L;  4BXX G;  4Y52 H;  1HH2 P;  3PO3 G;  3HOW G;  2YU9 H;  4A3L H;  4DV6 L;  3I4N H;  4GNX C;  4IJH A;  3CME A;  3CD6 A;  1L0W A;  3BU2 A;  4IO9 A;  1QZH A;  3NBH B;  5FLX c;  2R7Z H;  1N9W A;  1UEB A;  4A3E H;  3ULL A;  3GTK H;  1L2F A;  1I3Q H;  1Q1E A;  1VQC A;  4X64 L;  4LUV A;  2ATW A;  1SE8 A;  4YY3 L;  5LMN Q;  3PO2 H;  2MO1 A;  2B63 H;  1KAW A;  3PUW A;  4OON A;  4AQY Q;  4PZ6 A;  3FKI H;  4JI8 Q;  4A3J H;  1A62 A;  1VQO A;  2E8G A;  5IYC H;  1XPO A;  2HIV A;  3U4V A;  1SRO A;  3J7A 5;  3HFZ B;  4APV A;  4A3B H;  1Y1W G;  4JI3 L;  1XMQ L;  2PI2 A;  3S16 H;  2UUA Q;  4YHH Q;  1YBY A;  4J15 A;  1JJ2 A;  3H3V H;  2I5L X;  3PIP A;  1PYB A;  1P16 A;  2R93 G;  2UUB L;  3HOU H;  1S72 A;  3NEL A;  4A3F G;  2LSS A;  4JI6 L;  4X62 Q;  4BY7 H;  3CAM A;  3PCO B;  3EIV A;  1SRU A;  3KDF B;  3D31 A;  4X65 L;  4A75 A;  1XMO Q;  2K75 A;  3J80 i;  5M3M G;  1PH4 A;  1VQG A;  1EOV A;  1PV4 A;  3K81 C;  4LFB Q;  4GOP C;  5C4J H;  1SLJ A;  3GTG H;  5EAY A;  4DR4 L;  4JBM A;  4AYB G;  3NEN A;  3U50 C;  4KI0 A;  1IL2 A;  4DV1 Q;  5FLM G;  4AYB E;  3K80 C;  5C3E G;  4B3T L;  3GTP H;  1BKB A;  4UPA A;  2N49 A;  1E7Z A;  4DR2 Q;  2L15 A;  5IWA L;  3I4M H;  4LF7 Q;  3RZD H;  1VQP A;  5IP7 G;  1ASY A;  2JA7 H;  4KHP L;  1WFQ A;  1PH2 A;  3K7U C;  3M85 A;  4GKJ Q;  1BVS A;  1UE5 A;  2KCT A;  5IE8 A;  3A0J A;  2NZO A;  3UDF A;  4JI2 L;  1IBK Q;  3HOY H;  3AFP A;  3F2C A;  3K8A A;  1I5F A;  4Y7N H;  1PH8 A;  1FL0 A;  2D62 A;  5M5Y H;  4LFC Q;  4JOI C;  1IBL Q;  4BBR H;  1QUQ B;  4DR7 L;  4GLA C;  3TEH B;  3UDI A;  3MEF A;  1E1T A;  1YI2 A;  3RR5 A;  1JJG A;  3E0E A;  3S14 H;  1B8A A;  1MIU A;  1HNX Q;  1IZ6 A;  2VQF Q;  1HZA A;  1LTL A;  2PMZ E;  3RN5 A;  3S2D H;  2EQS A;  3CC4 A;  3I4N G;  4A3L G;  1XTD A;  1JB7 A;  1VQD A;  2AHO B;  2ZJQ A;  2YTV A;  2CCZ A;  2PI2 E;  4L5R C;  3W5O A;  4DV7 Q;  3H3V I;  3S1M H;  1I6H H;  3CCV A;  2R7Z G;  1TWG H;  1A63 A;  3UDX A;  4DV4 L;  4A3E G;  1N34 Q;  1HNZ Q;  1N33 L;  3PIO A;  3F2D A;  1EUJ A;  3PO2 G;  1K3R A;  1OXU A;  1S3O A;  5ELO A;  4PMW A;  4C2M H;  4IPD A;  1PH5 A;  2B63 G;  3RLN A;  4NPS A;  3I56 A;  3FKI G;  3TS0 A;  4A3J G;  4WJ3 M;  3U58 A;  5IYC G;  4DUZ Q;  4R1J A;  5JEA G;  3G4S A;  4DR1 Q;  1QZG A;  2VQE Q;  1W2B A;  1N8R C;  4A3B G;  3S2H H;  1E3P A;  4ALP A;  3CP0 A;  4GN5 A;  1KL9 A;  4UY8 C;  1CKN A;  1PH7 A;  4JV5 L;  4NXM Q;  4UP7 A;  1XNQ Q;  1OXX K;  4A76 A;  4GOP A;  3HOU G;  1K73 C;  3KF6 A;  2JJQ A;  3ERS X;  1N36 Q;  4TQU S;  3M4Q A;  4JI7 L;  2ES2 A;  4BY7 G;  1BBU A;  1HNW Q;  4BA2 I;  4GNX B;  4P73 A;  1KHI A;  1IBM Q;  1YJN A;  2KEN A;  1VQJ A;  2VS1 A;  4JBJ A;  4OWW B;  1D7Q A;  4YCU A;  1N32 L;  1CSQ A;  3BZK A;  4IPG A;  3TRE A;  4LNQ A;  1B7Y B;  5C0X J;  2B3G A;  2VL6 A;  3PUZ A;  3CCQ A;  1WJJ A;  2UUC Q;  4JI0 L;  1TXY A;  2WB1 G;  4JI1 L;  1K8A C;  3CCU A;  1GKH A;  4LF9 L;  1CUK A;  2WB1 E;  2UU9 L;  1TWC H;  4DV5 L;  1UE7 A;  1JJC B;  4DV3 L;  1FGU A;  3T1Y Q;  1XNR L;  3RZO H;  4MNO A;  4DV2 Q;  4LF8 L;  3JAM c;  4BBS H;  3I4M G;  3S24 A;  5C0X G;  4R4I A;  3RLO A;  2JA7 G;  5BR8 Q;  4X64 Q;  5GAE C;  2Q2H A;  3PGZ A;  1HR0 W;  4JI5 Q;  4LF4 L;  5JJI A;  1Q12 A;  4JOI A;  4HIO A;  1L1O C;  3S15 H;  2OWO A;  2Q2T A;  4B3R Q;  3M4P A;  2K14 A;  3S1R H;  1PA6 A;  3HOY G;  4GKK L;  3F2B A;  2ASB A;  3F8T A;  2JA9 A;  3KYH C;  2HHH Q;  4MZ9 A;  2UXB Q;  2NN6 G;  4DUY Q;  1AE2 A;  2N3S A;  1HZ9 A;  4GOP B;  5JJK A;  4P75 A;  1MJE A;  3HKS A;  4DR5 L;  4BBR G;  4DAM A;  1LYL A;  4A3I H;  3KLW A;  5GAD C;  1U0L A;  5AJ3 L;  3KOJ A;  1EFW A;  1HR0 L;  3LGJ A;  1EYG A; 
#chains in the Genus database with same CATH topology
 1X55 A;  2NTT A;  2Z8L A;  1EWC A;  3GP7 A;  4X66 L;  1Q8K A;  3ZJY C;  2EIF A;  1LTG D;  1PZK D;  1RCV D;  2YTX A;  1VQ9 A;  2OTL A;  4JYA Q;  4FYD A;  5FO8 B;  3D0F A;  1U4R A;  1VCI A;  2F4V Q;  3H15 A;  2EDG A;  1RIP A;  2AMC B;  1HA5 A;  3GV6 A;  5EKI A;  2B2U A;  3DUZ A;  3KBX A;  1XPR A;  4AH6 A;  3M7N A;  3P7J A;  1STE A;  2RA4 A;  2RDF A;  4RG1 A;  1SJH D;  3QB3 A;  2KHJ A;  4CGY B;  5C6A A;  4NXN L;  2K32 A;  4KN7 C;  4KLK A;  4IUR A;  3FHW A;  3A54 A;  4DR7 Q;  3M4O H;  4UDU C;  1V1Q A;  4LF6 L;  5I6Y A;  5LMU Q;  3FPP A;  2JA8 H;  2EJM A;  4OO1 H;  1TT2 A;  2O5I C;  4R4Q A;  3D4W A;  1I4Q A;  4QQB X;  4MN3 A;  1R4Q B;  1PVO A;  1L1O A;  1DGS A;  1KQS A;  2F0H A;  2ZJP A;  1I3Q B;  2JK8 A;  1Y1V H;  1XMO L;  1E0B A;  2B63 B;  4Q5V A;  2KOL A;  1EY5 A;  1E2Z A;  1X32 A;  3QIA A;  4HIK A;  1TR5 A;  4K2L A;  3BJU A;  4OX9 L;  1UAP A;  5EQ0 A;  1WVL A;  3S17 H;  5IY0 A;  2PQA A;  5EPJ A;  3TP7 A;  1FNV A;  5CYU A;  1BXT A;  5C4Z A;  2QF7 A;  2SOB A;  3CQZ H;  4L5Q A;  4A3I G;  4LF7 L;  3OTO Q;  2EJF C;  3T51 B;  1G2T A;  5C3X A;  4PV1 C;  3CCJ A;  3NK9 A;  1LLR D;  2RKS A;  1CM9 A;  2R92 H;  3GQB A;  1VDZ A;  3GTG B;  1J5E L;  2BH2 A;  3ICE A;  2WB1 B;  2CWA A;  1HFN A;  5C4X H;  1LO5 D;  3PV0 A;  3DXJ C;  3SEB A;  4LF9 Q;  4MHE A;  2I5H A;  4KJN A;  2EYO A;  2CQA A;  3C1F A;  3BDO A;  1G29 1;  1HNX L;  4ODG A;  3G71 A;  4C3J H;  2VQF L;  5KYL A;  2DNE A;  1RDP D;  1ET9 A;  2AQ3 B;  2CHB D;  3DEO A;  3HOY B;  3K5M A;  5D14 A;  2EJG C;  5IGF A;  2KHI A;  2QEJ C;  1P8L A;  1VQA A;  1K0S A;  2VW9 A;  2NN6 I;  5M5Y B;  4ID6 A;  1CQV A;  3DWQ A;  3NBH A;  5IGD A;  5D65 A;  2N78 A;  4I65 A;  2DY7 A;  3QOJ A;  1WTP A;  3EN2 A;  4PNY A;  2AWO A;  5DNF A;  4POG A;  2JA6 H;  1HQR D;  1HR0 Q;  2PNR C;  2NUC A;  4JBW A;  2JA8 G;  1SMX A;  3KLR A;  3R3O A;  3CW2 C;  4OO1 G;  3VYS A;  2GVA A;  1CKN B;  5D3D A;  5FK9 C;  4J8Q A;  1QNU A;  3STB D;  4JI3 Q;  2FFK B;  5DAU A;  2YV5 A;  4H7B A;  1ET6 A;  1EU3 A;  1Y1V G;  4ZAI A;  4GN3 B;  4YIJ A;  3T1H Q;  1A2T A;  4CDF C;  1BO0 A;  5KIX A;  3J7A V;  1HQM C;  5A2Q E;  3QOL A;  2KBN A;  5IYD H;  2P5Z X;  5FOB B;  2IX3 A;  2Q8R E;  4PMC A;  4DV2 L;  3FPU B;  3AEV A;  2BA0 A;  4X3T A;  2FJ2 A;  3MFG A;  1JR0 D;  3NTI A;  2J7Z A;  4RKL A;  3CCE A;  5HGQ A;  3G6E A;  2XRQ D;  3VYU A;  5KYI A;  1VQ4 A;  2WKC A;  1LM0 A;  1K83 H;  2WAC A;  1AN8 A;  2PYK A;  4FO2 A;  1GUW A;  2IT1 A;  3OMG A;  3PUX A;  2PNH A;  1NAP A;  4JI2 Q;  4JW0 A;  1CK1 A;  1ZYR D;  3E9I A;  4O0A A;  2JEA I;  3ZYY X;  4RMF A;  4DUY L;  2K5V A;  5C4X G;  5AFW A;  3HOX H;  2ID0 A;  4FXK C;  3MAQ A;  3A5U A;  2NTS A;  1KNE A;  5GAH C;  2IX0 A;  4C3J G;  2EYF A;  5LL6 X;  3HOV H;  1A2U A;  1I50 H;  1GHK A;  1B53 A;  2K5N A;  1F2L A;  3EQL C;  2K01 A;  4QGU A;  4FXG C;  2DUD A;  1STA A;  4X62 L;  4YWM A;  2C5C A;  2MQH A;  1UUP A;  3KF8 B;  1N33 Q;  3LWU A;  3VDY A;  3RLF A;  4A3C H;  2BH8 A;  1YHQ A;  2JA6 G;  4OEM B;  1PTO D;  3BYT B;  2OCE A;  1XJV A;  1Z9F A;  5M9O A;  4BXX H;  2NVQ B;  3BDC A;  1EY9 A;  5LHY 1;  3CCS A;  1K0R A;  5NUC A;  4XT3 B;  4DR2 L;  1ILQ A;  2Z1C A;  3CC7 A;  4DAP A;  1KRS A;  4K5W A;  1UE6 A;  1G6P A;  1RKN A;  2QCP X;  2G9D A;  1R9T B;  1MKH A;  4EQ5 A;  4XQJ A;  2LY7 A;  2E76 C;  1PFS A;  5CV4 A;  4DKA C;  1Y1W H;  4DR6 L;  1V43 A;  5IYD G;  4JI1 Q;  1X3E A;  3JAM E;  2NZH A;  3NXW A;  2R93 H;  1SYC A;  1B50 A;  1EU4 A;  3KLS A;  3MXU A;  4KY5 A;  3I4O A;  2F0G A;  2UXC Q;  4LF4 Q;  3VR4 A;  4OO1 I;  3KJO A;  5ISR A;  1LTA D;  1LTS D;  4I7A A;  1HRJ A;  3HOX G;  5FLM H;  2E2I B;  1F9P A;  4JCV E;  4PZ8 A;  1EZ8 A;  1NY4 A;  1GJX A;  5IP7 H;  1ESF A;  4HJ7 A;  3DEP A;  3TQY A;  2V4D A;  1XXG A;  3HOV G;  3RNU A;  1ONL A;  4DAV A;  4G7Z C;  4V19 0;  1KLG D;  3MXP A;  1SFO B;  5BN4 A;  4B3M L;  3R8B A;  4KD4 A;  4KJO A;  4A3C G;  1EY6 A;  2B2T A;  5BN5 A;  2Q2U A;  2F03 A;  3K58 A;  3L0O A;  1DM0 B;  1JC7 A;  2F1M A;  2UUC L;  4BXX G;  1HH2 P;  2F0K A;  2L4N A;  1RJT A;  1F2Y A;  2F4I A;  4DV6 L;  5DM6 3;  4IJH A;  3UI2 A;  1Y69 U;  1QE6 A;  1GUG A;  5COY A;  3ULL A;  1WCM B;  1HHV A;  1I3Q H;  1VQC A;  3W3A A;  4YY3 L;  2B63 H;  4CKC A;  3PUW A;  4R8I A;  3U4V A;  2F0Q A;  4APV A;  1AFP A;  2B2V C;  2Q8T A;  1Y1W G;  1D2B A;  1JJ2 A;  2R93 G;  4BY1 B;  2UUB L;  3I72 A;  4JI6 L;  1JQY D;  2HUG A;  1QB5 D;  3CAM A;  3PCO B;  4DXF A;  1DYQ A;  1XMO Q;  4A75 A;  2K75 A;  1HFG A;  1EOV A;  5ELB A;  1ENA A;  3MC0 B;  1PV4 A;  1EQT A;  4J6H A;  5I9P A;  3VYT A;  5CC4 A;  3GTG H;  4DR4 L;  3NEN A;  1IL2 A;  5FLM G;  4CJ2 C;  2CH4 W;  2JA5 B;  5C44 B;  3PQI A;  1LAB A;  5IT9 E;  5M5W B;  5IWA L;  4IUT A;  4A3K B;  4CKE A;  3RZD H;  4LF7 Q;  5IP7 G;  4KKU A;  3K7U C;  2ICI A;  2NZO A;  4RGO S;  3GTQ B;  2EYP A;  5CBE E;  3HOY H;  1SE4 A;  3AFP A;  3BZD B;  1PH8 A;  2E2H B;  5M5Y H;  3MEH A;  2JP1 A;  4JOI C;  4DU9 A;  2FIN B;  2F3V A;  4BWG B;  1QUQ B;  3OHX C;  4DR7 L;  1V1O A;  1YI2 A;  1HNX Q;  2PPB C;  3HOZ B;  2VQF Q;  1HZA A;  2SNM A;  1SE3 A;  3MWY W;  1H9S B;  3RMH A;  3CC4 A;  3EFX D;  2Y0S B;  1VF5 C;  1Y8N B;  3TP8 A;  2CCZ A;  2ZJQ A;  4L5R C;  3W5O A;  1QG7 A;  3CCV A;  3UDX A;  4U68 A;  2LFN A;  1YNN D;  3PIO A;  2F0F A;  1K3R A;  5ELO A;  4PMW A;  1PTO B;  4EVO A;  2B63 G;  1F9S A;  4NPS A;  4WJ3 M;  5C4H A;  1Q90 A;  3U58 A;  4NKL A;  1E3P A;  4ALP A;  2F0J A;  1E2W A;  1KL9 A;  1CKN A;  3SDZ A;  4GOP A;  1JOR A;  2B2U C;  3M4Q A;  2ES2 A;  3VA7 A;  1S5F D;  1NR4 A;  2NVY B;  3H94 A;  4EGV A;  3PUZ A;  5IOD A;  3CHB D;  1TXY A;  2WB1 G;  3VA5 A;  2D9U A;  4LF9 L;  2WB1 E;  1JJC B;  4DV3 L;  1XNR L;  4DV2 Q;  3JAM c;  1AW7 A;  4R4I A;  4RKB A;  4CHT B;  3ND9 A;  1Y8O B;  2AUK A;  1L1O C;  2EY5 A;  4DFA A;  1LTT D;  3HOY G;  2WII B;  4G57 A;  4DUY Q;  1AE2 A;  2N3S A;  1HZ9 A;  3I90 A;  5JJK A;  4P75 A;  1MJE A;  5CV7 A;  5D3I B;  3KLW A;  1U0L A;  1HR0 L;  4KHV A;  5M3M B;  3TSS A;  3J80 L;  1X3G A;  3KJP A;  3CCL A;  1I4P A;  2SNS A;  1WOC A;  3FEW X;  1LV9 A;  4B9W A;  3OIP A;  1T5E A;  2O5J C;  1JE5 A;  1UE1 A;  5KNC A;  4K8I A;  5CGK A;  1IHZ A;  5A2Q L;  4TSS A;  5KRU A;  3KF8 A;  3T1H L;  1XPU A;  1HZC A;  4LF5 L;  3IL8 A;  5M5X B;  4GLX A;  4KHP Q;  4YCV A;  3H09 A;  5EKL A;  2JXM B;  4HJA A;  1R9T H;  1LT5 D;  2KED A;  3NTH A;  4DK6 C;  1PDQ A;  1BBW A;  2SEB D;  1RD9 D;  3RN2 A;  3O13 A;  3M3Y B;  2N88 A;  3Q6S A;  3C1E A;  1SAP A;  3ERQ A;  2X6L A;  2N8N A;  1Q7Y C;  5KEE A;  1VQK A;  1NMG A;  1T9H A;  1JCK B;  4AQY L;  4FXD A;  3M9B A;  5KNB A;  1J6Q A;  2Z0S A;  2I0Q A;  1HCZ A;  2YU9 B;  5G3L F;  3ONA B;  1JMC A;  3CC2 A;  4DR6 Q;  4P2C B;  1B9M A;  5ELN A;  1JWS D;  2E2I H;  3GTL H;  4A3E B;  3V2T A;  3GTK B;  1B70 B;  4Z9C B;  3OW2 A;  3AU7 A;  5COR A;  3FKI B;  3GD7 A;  1NBW A;  4N8X 1;  1KC8 C;  1FNU A;  1HTL D;  4TRD A;  1SFO H;  3HOU B;  4ABN A;  2CW0 C;  3TZD A;  4F87 A;  4RCO A;  4GKJ L;  1MSG A;  3P1H A;  4R4C A;  1IYJ B;  2XGT A;  5IT9 c;  2A6E C;  2O2L D;  2PO4 A;  4RH6 A;  2PZT A;  3SVM A;  1OTC A;  4JBK A;  5C4J B;  3S1N B;  2A68 D;  1X65 A;  4IPC A;  1HTP A;  2H5X A;  3A8K E;  3H91 A;  2BA1 A;  4LFC L;  4G7H C;  2QKI C;  4R9W A;  3GTP B;  1Q1B A;  1IBL L;  1I6V C;  2VY3 A;  4B3M Q;  1SYD A;  2A73 B;  1WCM H;  5J1Z A;  3I4M B;  2D2C C;  1K9M C;  4AIM A;  5J3B A;  3EBE A;  1QVF A;  4O1N A;  2HIX A;  3J7Z C;  1PLF A;  3PSI A;  1FGB D;  1CT1 D;  4DV6 Q;  3IRB A;  1N34 L;  1HNZ L;  1WTW A;  4KN4 C;  2Z6K A;  5FLX L;  4IUQ A;  4BY1 H;  1SMY D;  3QWN A;  3JAM i;  4K2K A;  1PRT F;  2AKW B;  2UXC L;  3X3N A;  4YY3 Q;  3S14 B;  4DUZ L;  3KK7 A;  1IYU A;  4FP5 D;  4NB3 A;  2Z4H A;  2IX1 A;  3S1M B;  1I6H B;  4CBV A;  1A0I A;  2MJ8 A;  2F0D A;  5IYB H;  2JA5 H;  4DK1 A;  5IGC A;  5C44 H;  1N36 L;  2F52 A;  2UUB Q;  5M5W H;  4A3K H;  3N6R A;  1IBM L;  4JI6 Q;  3PUY A;  4O42 A;  1S4Z A;  1CKO A;  5GQO A;  1PRT C;  4C1N I;  1OXT A;  3GTQ H;  4LUZ A;  4IN3 A;  4OEL B;  3Q24 A;  4DR4 Q;  2CKZ B;  3DLL A;  1ROD A;  3K6O A;  4X3U A;  2E2H H;  1Z47 A;  1B2T A;  4DK3 C;  3BDL A;  4EX5 A;  2PW5 A;  3IKJ A;  2MNA A;  5LMN W;  3J7A F;  4M1U B;  4V0B A;  4JI5 L;  5IWA Q;  5IOC A;  1J8I A;  1PH9 A;  4HIM A;  3HOZ H;  2A69 D;  3CPF A;  4A4I A;  3I91 A;  1PXU A;  1M1K C;  1C9O A;  2K6A A;  2UXB L;  1TWC B;  4L8J A;  1B3Q A;  4HCE A;  3RZO B;  1WCM G;  3X3M A;  1QUQ A;  1PTO H;  2V1C C;  5K36 H;  3DM1 A;  4YCW A;  3S15 B;  2KHS A;  1NE3 A;  4WRD A;  2MPM A;  5JOB A;  1NTG A;  1H9S A;  5JAV A;  1TS2 A;  1X54 A;  1F9Q A;  2K52 A;  4BY1 G;  4LAA A;  1EL0 A;  2NVY H;  3CPW A;  4N9T A;  3CXC A;  1PH1 A;  1XTC D;  5IT9 L;  2D0P A;  2JQO A;  1DOM A;  4QMG A;  3SGI A;  2B2W A;  1K3B C;  3TBI B;  1U4L A;  3HOW H;  1SNP A;  1KXL A;  2B2T C;  1GM5 A;  5T1I A;  1A6X A;  3BVM A;  2D5D A;  3TP5 A;  3A74 A;  1MGS A;  4A3G B;  5IYB G;  2JA5 G;  5C44 G;  1WTR A;  4A3K G;  4PMB A;  1LT6 D;  2F0U A;  2F3W A;  4O2D A;  5I9O A;  1NNX A;  1OXS C;  2VNU D;  1DZ1 A;  1C48 A;  2K5W A;  2YYZ A;  3HS0 C;  4HCS A;  5KGU A;  5E4W C;  1H9R A;  1IXR A;  4LW1 A;  4DV3 Q;  1XNR Q;  4IOA A;  3MHB A;  1Q81 C;  5M3M H;  2J4X A;  3PF5 A;  3HOZ G;  5GRO A;  3GTJ B;  1SNQ A;  1EQR A;  1TWF B;  1EWI A;  2D0O A;  2Y0S G;  1O7Y A;  2Y0S E;  2F0E A;  5CR3 A;  2M2L A;  4QY7 A;  3CF5 A;  5K36 G;  1YHB A;  5M5X H;  1CZG A;  2IJ0 A;  4RHS A;  2EYJ A;  2VUM B;  1EQQ A;  1AEX A;  3K57 A;  3J7Y W;  2PZW A;  2UXD L;  3TME A;  3NWS A;  1I94 L;  3AFQ A;  2A8V A;  2RSN A;  3TDQ A;  4IUV A;  3M3Y H;  1W3S A;  4CKB A;  1Q46 A;  4C3I B;  2ZT9 C;  1IKM A;  2ZJR A;  1PYS B;  1ICF B;  1X56 A;  3AMU A;  1Y14 B;  1SR3 A;  4R4T A;  4EQN A;  2E5L L;  1WTQ A;  1UWV A;  3DM3 A;  4LF5 Q;  3BVZ A;  1LTB D;  1VQB A;  4ZK9 B;  1AZQ A;  4IZ8 A;  2B39 A;  1TS4 A;  3HOW G;  2YU9 H;  4A3L H;  4GNX C;  1UEA B;  1D5Z C;  3K59 A;  1L0W A;  3BU2 A;  4RFB A;  4IO9 A;  1SNO A;  1N9W A;  1UEB A;  4A3E H;  4UHV A;  3GTK H;  3N52 A;  1L2F A;  1I4H A;  2ATW A;  1SE8 A;  2LMC B;  4OON A;  4AQY Q;  3FKI H;  1XPO A;  1VQO A;  2E8G A;  5IYC H;  3J7A 5;  3HFZ B;  1XMQ L;  2PI2 A;  2MP1 A;  3TN2 A;  1YBY A;  4XQQ A;  4ZRZ A;  4JVZ A;  3PIP A;  1P16 A;  2QIL A;  2ZXR A;  3HOU H;  5K5P A;  1A3U A;  1TWA B;  4BY7 H;  2MGS A;  4X65 L;  3D31 A;  5M3M G;  1VQG A;  1STN A;  4GOP C;  4K6L A;  1DOK A;  1QCB D;  5C4J H;  4OHJ A;  1IW7 C;  1QNK A;  3NSW A;  4JBM A;  4QUC A;  4DV1 Q;  3KLS X;  3HKZ B;  3GTP H;  3G7L A;  1BKB A;  4UPA A;  1OO9 B;  2L15 A;  1E2V A;  3K7A B;  3I4M H;  3TP6 A;  5JJZ A;  4KHP L;  1TII D;  1ZXT A;  4GKJ Q;  1BVS A;  1UE5 A;  2KCT A;  5IE8 A;  1KNA A;  5EJW A;  4FVM A;  2L5T A;  5EPL A;  3T56 B;  3A8J E;  2EVB A;  1FL0 A;  2C9O A;  2LKV A;  4LFC Q;  3KBG A;  1O7L A;  1IBL Q;  4HAE A;  5DEH A;  3QJY A;  2A6H C;  5ELF A;  1UNS A;  1PFM A;  3TEH B;  1E1T A;  3RR5 A;  3S14 H;  1SJE D;  4RAU C;  1GUN A;  3T4A C;  1ESR A;  2EQS A;  2HDL A;  1G2S A;  4A3L G;  1XTD A;  2WKD A;  3S1M H;  1I6H H;  2PI2 E;  2KEE A;  3H3V I;  1S5C D;  3Q22 A;  4ULL A;  2K5Q A;  4A3E G;  4DV4 L;  1SEB D;  1N34 Q;  1HNZ Q;  1NUC A;  3I56 A;  3FKI G;  5IYC G;  4DUZ Q;  2G5D A;  4DR1 Q;  1QZG A;  1N8R C;  2TMP A;  3CP0 A;  4UY8 C;  2NVX B;  1YNJ C;  2VXW A;  3J81 E;  1OXX K;  3HOU G;  3HG9 A;  3D3R A;  1N36 Q;  4BY7 G;  1KHI A;  1IBM Q;  2KEN A;  3BZK A;  2B3G A;  3FDT A;  4ZYS A;  3PO3 B;  1K8A C;  4CJ1 B;  3D8G A;  1CUK A;  1TWC H;  2H4O A;  1UE7 A;  2FHT A;  1FGU A;  3BYY B;  3RZO H;  4LF8 L;  4L6T B;  3I4M G;  3S24 A;  1TWH B;  1HA6 A;  4JI5 Q;  3PGZ A;  5JJI A;  1JIC A;  2CH4 A;  3EA6 A;  2F0I A;  3S15 H;  1MI2 A;  3OIQ A;  2K14 A;  1JWM D;  1PA6 A;  4R8N A;  3KYH C;  2UXB Q;  1D5X C;  2R3Z A;  1TWG B;  1EIH A;  4A3F B;  2KUM A;  5AJ3 L;  2QDL A;  3KOJ A;  4C2M B;  2ICE C;  5C5M A;  1ILP A;  4PQX A;  3W1B A;  1WI5 A;  3AYH B;  1BDO A;  2RBM A;  4H0L C;  4AYB B;  4IFD H;  1A3V A;  3MA2 B;  1CSP A;  1QIL A;  2BE5 D;  2CFM A;  5C3E B;  4A3G H;  5HUR A;  3ITP A;  1Q82 C;  1SYB A;  1HZB A;  4P72 A;  1EQV A;  2E74 C;  3U4Z A;  4GLV B;  1KLU D;  1AH9 A;  5F2D A;  3FRP B;  4UP8 A;  1DJR D;  1XWE A;  2IHE A;  2JSO A;  2ZTD A;  2O4X A;  5C3W A;  4OIJ A;  1ML0 D;  2F0N A;  2JYO A;  4WJ4 A;  4ZKC B;  5FO7 B;  4DNI A;  4MTN A;  1H95 A;  2PMZ B;  1QVC A;  4K6D A;  4WJW A;  5CMD A;  1H9M A;  3GTJ H;  2Z6K C;  5J39 A;  1BCP D;  1VMP A;  2DJF C;  2EYL A;  1TWF H;  3I4N B;  2WIN B;  1SE2 A;  1K28 A;  4QL5 A;  4PG3 A;  2IWH A;  2K50 A;  1M4V A;  3K0X A;  3PO2 B;  3STB C;  1B4O A;  1SXT A;  2EYM A;  3I73 A;  4A3J B;  4J1M A;  4RCN A;  2VUM H;  3BVG A;  4A3B B;  2IPK D;  4XTC S;  3S16 B;  1EY0 A;  4H13 C;  3SK4 A;  1S5B D;  4C3I H;  3IFD A;  1W6J A;  1STB A;  4QUF A;  1O7I A;  2F0S A;  3WWV A;  3ER0 A;  3S9W A;  2XIW A;  1FYC A;  4FNF A;  1AZP A;  1KAB A;  1N32 Q;  5KND A;  2NWG A;  3D4D A;  5FJ8 H;  3OMC A;  2F3I A;  4IFD G;  2DNC A;  1TS3 A;  2UXD Q;  4CDD C;  1I94 Q;  1Q8I A;  4KV6 A;  4DK0 A;  4A3G G;  1U4P A;  2UU9 Q;  2RHQ B;  2B2Y A;  3CRK C;  1ZYR C;  2IY5 B;  3NEM A;  2JA7 B;  2M9V A;  2IW3 A;  1Q3L A;  1M90 C;  2E5L Q;  3L3O C;  4HTH A;  1PTO F;  2EOT A;  1LTR D;  3BZC A;  3R93 A;  2NBF A;  4DV7 L;  1FR3 A;  4MTK A;  3TS2 A;  4HED A;  4BBR B;  1XYI A;  1ASZ A;  5GAG C;  1X6O A;  3I7F A;  4GN4 B;  1YNX A;  2I5M X;  1Y8P B;  2E75 C;  4OWT B;  1D8L A;  2MHV A;  2QW7 A;  2FXQ A;  5HGT A;  4I7Z C;  2K4K A;  2JEB I;  1XMQ Q;  1PTO C;  4F8M A;  4WFN 3;  4G4K A;  3K5O A;  3CMA A;  3P20 A;  4LUO A;  3J81 c;  1EY8 A;  5EPK A;  3VYR A;  1I4R A;  2WAQ B;  4X65 Q;  4IUN A;  2VUM G;  2K03 A;  2NVQ H;  1BF4 A;  3I8Z A;  4OXP A;  3S2H B;  2R92 B;  4LWC A;  3SK5 A;  2F0M A;  1JB3 A;  1SBB B;  1GUT A;  1RTO A;  4C3I G;  4QIW B;  1K8G A;  1LTI D;  3I70 A;  1PHJ A;  1FVI A;  2I46 A;  2QA4 A;  3UE1 A;  5BR8 L;  1YHA A;  3LNN A;  3UE0 A;  2OF1 A;  3OWF A;  4H44 C;  2RHS B;  5FJ8 G;  1KD1 C;  2XVS A;  5J22 A;  1A8V A;  1NCV A;  4BBS B;  3OSO A;  4R4O A;  3FVQ A;  4UAI A;  1BR9 A;  1B9N A;  1QVG A;  1VS0 A;  2OT2 A;  4IPH A;  3S1R B;  2BCO A;  2HD3 A;  2HQE A;  4L5S A;  2NVX H;  2R6G A;  1KDC A;  2PW7 A;  4WOR A;  4DAY B;  1GUS A;  1MJC A;  4IJL A;  4DV4 Q;  1YIT A;  4DV0 L;  2LXJ A;  1TS5 A;  3G48 A;  2L12 A;  2L0C A;  1CHQ D;  3C3L A;  2OQK A;  3Q23 A;  3TZU A;  2E2D C;  5M3F B;  4JC0 A;  3CU7 A;  3PO3 H;  4DV1 L;  4IFD I;  1DCZ A;  2KA7 A;  1EY7 A;  1FJG Q;  3HKZ G;  4PZ7 A;  3SXH A;  1TU2 B;  3L7Z C;  3HKZ E;  1HXY D;  4HID A;  1SYE A;  4C3H B;  1TWH H;  1MD2 D;  1A15 A;  2K33 A;  1BCP B;  3OPO A;  3GO5 A;  1KDA A;  2M00 A;  4U67 3;  4HJ5 A;  4B3S L;  1VQI A;  2F0T A;  4NDX A;  3GTO B;  2NVT B;  2GA4 B;  4DPG A;  4A3F H;  3H6M A;  4LF8 Q;  3JAM L;  3A5Z B;  3H0G B;  2HT1 A;  4K0K L;  1EIF A;  4DXG A;  2QEX A;  4DR3 L;  4LFA Q;  1EY4 A;  5L37 A;  4H02 A;  3DMU A;  2X6G A;  4L5T A;  4KHZ A;  3UDG A;  1S40 A;  2G9H D;  1PRT B;  5C3E H;  1VQ5 A;  2JN4 A;  3S1Q B;  3TRZ A;  2Q2I A;  2AQ2 B;  5AJ3 Q;  2ZTC A;  4DR1 L;  2GN5 A;  2E2J B;  1VQM A;  1PH3 A;  2XN9 C;  1GD7 A;  4E6I A;  4LMQ D;  4CDE C;  4P71 A;  5I2X A;  2Q8I B;  4GZY C;  2RCF A;  1NJI C;  5CV5 A;  1G6Z A;  3EJI A;  3J81 i;  2KVM A;  1SN8 A;  4Y52 H;  3CRL C;  3PO3 G;  2NZ1 D;  3I4N H;  1U4M A;  3WOE A;  1J9O A;  3A7A B;  4C1N K;  3PIO 3;  1CA6 A;  2R93 B;  3C46 A;  3Q0A A;  3PO2 H;  5LMN Q;  1GUO A;  4NW2 A;  3GTM B;  2MO1 A;  3DHQ A;  1EOT A;  4PZ6 A;  4JI8 Q;  4A3J H;  1KAA A;  1HUM A;  1YNN C;  4XDX A;  4A3B H;  3S16 H;  4JK1 C;  3H3V H;  5A35 A;  3NEL A;  1F77 A;  4A3F G;  3E5S A;  1B1Z A;  1SRU A;  3EIV A;  3KDF B;  1D5M C;  4ZUI A;  3MTS A;  1YNJ D;  1WTX A;  1EYC A;  4NP5 A;  4ME5 A;  5EAY A;  1II3 A;  1PYW D;  5EKK A;  4AYB G;  2KCC A;  1LT3 D;  1KTK A;  4KI0 A;  5I2Y A;  4AYB E;  5C3E G;  1ZEQ X;  2TSS A;  1E7Z A;  1WTH A;  5C0X H;  1VQP A;  1WD1 A;  2JA7 H;  2KCN A;  1WFQ A;  2SDF A;  1STG A;  2PCF B;  3BG3 A;  3K5L A;  3A0J A;  3UDF A;  1BOS A;  1S5E D;  1IBK Q;  4DA2 A;  1TKW B;  1MBY A;  1F2Z A;  1JE4 A;  4L63 B;  3F2C A;  1I5F A;  5CV8 A;  1CTM A;  1STY A;  4A3D B;  4DN4 M;  1CHP D;  3F2U A;  4BBR H;  2RDG A;  2X69 A;  1MHW C;  3MEF A;  5EBC A;  2H1E A;  1SSO A;  1JJG A;  1B8A A;  1IZ6 A;  1AP0 A;  1LTL A;  2PMZ E;  4A3M B;  3RN5 A;  3I4N G;  1JB7 A;  2AHO B;  3NWT A;  3A7L A;  2NYZ D;  1W6K A;  2YTV A;  4DV7 Q;  1IKL A;  4M8A A;  2DY8 A;  1STH A;  1FNW A;  3PO2 G;  1PH5 A;  3TS0 A;  4A3J G;  1CQF A;  3I4L A;  3SE0 A;  3G4S A;  2EZV A;  3S2H H;  4A3B G;  4A93 B;  3SK8 A;  1D6E C;  1XNQ Q;  4A76 A;  1I4G A;  2JJQ A;  4BS9 A;  3ERS X;  1HPC A;  4TQU S;  1HNW Q;  4QF4 A;  4BA2 I;  4GNX B;  1DXM A;  2OXP A;  1A3T A;  3RZD B;  4OWW B;  2VS1 A;  4IUU A;  4KMU C;  4YCU A;  4RHR A;  1N32 L;  1B7Y B;  4DNR B;  1D1K A;  3BS1 A;  4JI0 L;  5C5L A;  2UU9 L;  4DV5 L;  1CI3 M;  4BBS H;  4B9X A;  5CV9 A;  3K5N A;  1JOK A;  4ZLT F;  5C0X G;  3RLO A;  2JA7 G;  5BR8 Q;  4X64 Q;  2Q2H A;  1HR0 W;  2Q2T A;  3ERO A;  4IQZ A;  3M4P A;  3S1R H;  4GKK L;  1ENC A;  4LJZ C;  3F2B A;  2Z9H A;  2ASB A;  3F8T A;  2JA9 A;  3HGB A;  4MZ9 A;  3OOC A;  4GOP B;  3VR6 A;  3HKS A;  3J80 E;  4BBR G;  3I3C A;  1CA5 A;  5GAD C;  2BDO A;  1EZ6 A;  1EFW A;  3LGJ A;  1EYG A;  3DWP A;  4OIK A;  1CKM A;  1X9N A;  2EE1 A;  2ZM6 L;  4B08 A;  3DWA A;  5M3F H;  2R7D A;  3V05 A;  3PF4 A;  2PZU A;  1X3F A;  4XXE A;  4ZQ3 A;  5ELE A;  1WYD A;  1PFN A;  1GXD C;  1C0A A;  4K5V A;  4DAY A;  2A68 C;  4B3T Q;  1SND A;  3C2P A;  4X3K A;  4C3H H;  4DV0 Q;  5E3F A;  2WAQ G;  4JI4 L;  2KEC A;  3QR8 A;  2EY6 A;  3J81 j;  3S1N H;  2R92 G;  2WAQ E;  3A8I E;  3QO2 A;  2B2Y C;  3M7G A;  2AWN A;  2KJX A;  3D6C A;  1VQ6 A;  1PFB A;  2OEO A;  1FD7 D;  1F9R A;  4K14 A;  3R2T A;  2NVT H;  3GTO H;  3D6W A;  1SDF A;  2MFI A;  3HRZ C;  3OYY A;  2LXK A;  4QIW E;  2GVB A;  3SHL A;  3ULJ A;  3PMF A;  4DNT B;  3H0G H;  4RGM A;  1VQL A;  1EYA A;  2EY1 A;  5IGB A;  1SMY C;  1O78 A;  3NPP A;  1G8Z D;  2UUA L;  1JOO A;  4YHH L;  4B3S Q;  2LS0 1;  1GOZ A;  2R7Z B;  3NTK A;  4BBS G;  3LWE A;  2WV6 D;  3GDE A;  1R4P B;  3S1Q H;  1V9P A;  1YVC A;  5CBA E;  4IAL A;  4TVA B;  1BQQ T;  1WTO A;  4K0K Q;  4LFB L;  2E2J H;  4HR7 B;  2VZA A;  1QJO A;  3PUV A;  4DR3 Q;  4K5X A;  2RSO A;  3NBI A;  1V1P B;  1HJP A;  5ELD A;  4JV5 Q;  1XX8 A;  3GV3 A;  2K5H A;  4IFD J;  2DN8 A;  2B8G A;  5CV6 A;  4JI7 Q;  5IGE A;  4RA8 A;  2F0P A;  2RCN A;  5IP9 H;  5M3F G;  2JE6 I;  4GS3 A;  1FJG L;  2J0T D;  2PQE A;  3AB9 A;  4QB4 A;  4POF A;  1VQ7 A;  3MXN B;  3T13 A;  1Q86 C;  2A69 C;  2XSC A;  1PH6 A;  3L9A X;  5JJL A;  1AE3 A;  4IUP A;  4C3H G;  2B29 A;  3MVV A;  5C0X I;  2R61 A;  3D4R A;  2B8F A;  3GTM H;  4KY7 A;  5IIF A;  1JT8 A;  3KFU A;  3E0J A;  3NHH A;  2EXD A;  2RF4 A;  1IYV A;  1TQO A;  5FLX E;  1EIY B;  5HY6 A;  2CWP A;  2K1B A;  4Y7N B;  5EBD A;  1VQF A;  2XNA C;  2L9H A;  3GTL B;  2HDM A;  4TKO B;  1KRT A;  1YJW A;  2BOS A;  1VQN A;  4DR5 Q;  3M4Y A;  3NP8 A;  4FDB A;  3H0G G;  2BDN A;  4YWL A;  2VQE L;  4LFA L;  1L0Y B;  2WFW A;  3I55 A;  3S2D B;  2IHF A;  2FMC A;  2ENB A;  4NXM L;  1BNZ A;  2F0V A;  4EQO A;  4X66 Q;  3LX0 A;  3KF6 B;  4HSV A;  1TVX A;  3T16 A;  2L55 A;  3A55 A;  2EXZ A;  3MZ5 A;  3V96 A;  3KDF A;  2CVR A;  1RHP A;  4OGQ C;  1C8C A;  3WDN A;  3F1Z A;  2OTJ A;  2NB0 A;  5G3L D;  1L0X B;  5H1S E;  2AUJ D;  2CW0 D;  1VQ8 A;  1E22 A;  1YJ9 A;  1GHJ A;  4HMI A;  3T1Y L;  1YEZ A;  2A6E D;  4A3D H;  1VF7 A;  3VR3 A;  3I2Z A;  4NXN Q;  1YIJ A;  2KCM A;  2L1B A;  4X6A H;  2L11 A;  1H9K A;  2WP8 J;  3VR5 A;  5IP9 G;  1YZ6 A;  2XTI A;  4XYQ A;  4B3R L;  4LF6 Q;  2HCI A;  2OQ0 A;  1G51 A;  4A3M H;  1TY2 A;  1NMF A;  2HHH L;  2K05 A;  4HJ8 A;  4DF7 A;  4OWX B;  2QGQ A;  5LMN L;  2ZXO A;  2A1A A;  4EQP A;  4JI8 L;  2Z6B A;  3J80 c;  2A19 A;  3CCR A;  1JOQ A;  3AQQ A;  2K5D A;  4A93 H;  5JVG 3;  4OX9 Q;  3NUC A;  4BA1 I;  4IOC A;  3SK6 A;  1X3P A;  1KIX A;  4JYA L;  3L2P A;  1EEI D;  4A3I B;  1LAC A;  4JG2 A;  1ICW A;  1RL2 A;  2ALY B;  1RTN A;  2F4V L;  2MUY A;  5E7N A;  4P74 A;  4CJ0 B;  1TY0 A;  2C35 B;  2EPB A;  4FF3 A;  1B3A A;  1GVP A;  2MO0 A;  2RDH A;  1DON A;  1J5E Q;  2HQL A;  3KUP A;  4C56 C;  1PRT D;  3ND8 A;  3R2I A;  3JC6 6;  3Q8D A;  4ME3 A;  4GNX A;  2ZTE A;  5LMU L;  1IBK L;  1CFM A;  3IFT A;  3OWE B;  4HMJ A;  1LUZ A;  3A56 A;  2DGY A;  4JI0 Q;  2IL8 A;  5JEA J;  1L1O B;  3PIP 3;  1U5K A;  1BBX C;  2CQO A;  4A3D G;  4KKS A;  4DV5 Q;  2I07 B;  3IAY A;  2R7F A;  1SYG A;  5DLQ E;  4ZCK A;  3M4O B;  4X3S A;  3HEJ A;  4QJF A;  2F0O A;  1E24 A;  3SR1 A;  1BUV T;  1QWY A;  2VB2 X;  2JA8 B;  1VMC A;  4KY6 A;  4A3M G;  1PZI D;  3NQI A;  1OXV A;  3B6Y A;  4GKK Q;  2PQA B;  4KTA A;  4NMZ A;  2YTY A;  1VQH A;  1EEF D;  2AQ1 B;  4S3S A;  3OTO L;  3ULP A;  1Z6H A;  3HZX A;  4ZKB B;  1TWA H;  4UP9 A;  1Y1V B;  5EGT A;  3OW7 A;  4YWK A;  1E1O A;  1VQE A;  1F2M A;  3H3V C;  1GO3 E;  1C4Q A;  3FP9 A;  3W1G A;  2ZM6 Q;  4A93 G;  3HOW B;  1O80 A;  3S17 B;  1XNQ L;  1ENF A;  2XRS D;  3CQZ B;  1HNW L;  2B2W C;  3K7A H;  1C7Y A;  4HJ9 A;  5FKA C;  1IL8 A;  3CCM A;  2DJG C;  3E9H A;  2Z4I A;  1DOL A;  1EIG A;  1ZKO A;  1D1I A;  4XIG S;  4JI4 Q;  1PMR A;  3VR2 A;  1SYF A;  5JPM C;  3CME A;  3CD6 A;  1QZH A;  3QG1 A;  3U9S A;  5C4X B;  3NBH B;  2K7V A;  5FLX c;  2R7Z H;  5ELC A;  3MFY A;  1Q1E A;  4X64 L;  2HCC A;  4LUV A;  1KAW A;  4C3J B;  1A62 A;  4FF1 A;  5JEA H;  2HIV A;  1SRO A;  4K8J A;  1WD0 A;  2FMM A;  4JI3 L;  4F88 A;  2UUA Q;  1MSH A;  4YHH Q;  4J15 A;  5BN3 A;  3CKI B;  2I5L X;  1I4X A;  1PYB A;  1S72 A;  1M8A A;  1G91 A;  2LSS A;  2QDB A;  4X62 Q;  4N9P A;  1EFI D;  1PH4 A;  3G6J B;  2JA6 B;  1NR2 A;  3J80 i;  3URY A;  3K81 C;  4LFB Q;  2EY2 A;  1SLJ A;  1EYD A;  4F7X A;  3MXG A;  1PZJ D;  3U50 C;  3K80 C;  1V1P A;  3T53 B;  4XQN A;  4B3T L;  2RQX A;  2A5H A;  2N49 A;  4DR2 Q;  4MIU A;  1U9R A;  1ASY A;  1CZW A;  3FMC A;  1PH2 A;  4FF4 A;  3M85 A;  4ILW A;  4QCL A;  2F0W A;  4RWS C;  4JI2 L;  5TSS A;  1DD2 A;  4DGZ A;  3K8A A;  2N55 A;  5FO9 B;  5E1F A;  4Y7N H;  3HP3 A;  1RF2 D;  2D62 A;  3U9O A;  1KDB A;  2NN6 H;  3WOF A;  3MXN A;  2XWJ B;  1K8M A;  4GLA C;  3UDI A;  4G7O C;  1H9J A;  3E0E A;  5T1G A;  4Q0F A;  1K83 B;  1MIU A;  5IGG A;  3K0Y A;  3E3X A;  1WTV A;  1X3Q A;  3W2D A;  5E4X A;  1K8O A;  3S2D H;  2EYH A;  5DM7 3;  4XT1 B;  5I6W A;  1VQD A;  2ZXP A;  3HOX B;  2R7Z G;  1TWG H;  1SNM A;  1V8Q A;  1A63 A;  1N33 L;  3EVQ A;  2B2V A;  3F2D A;  1EUJ A;  2K04 A;  1OXU A;  1S3O A;  4C2M H;  4BY7 B;  4IPD A;  5LL6 S;  3RUZ A;  3RLN A;  1Z7T A;  4N8F A;  2A74 C;  2BE5 C;  4R1J A;  5JEA G;  1O7Z A;  3HOV B;  2VQE Q;  1W2B A;  1I50 B;  4GN5 A;  1PH7 A;  1BCP F;  4JV5 L;  4NXM Q;  3E6Z X;  4UP7 A;  2RVL A;  1K73 C;  3KF6 A;  1B44 D;  3RD4 A;  1IW7 D;  3NE5 B;  4KKT A;  4JI7 L;  1BBU A;  1NSN S;  4P73 A;  4HSP A;  1SNC A;  3J81 L;  1YJN A;  1VQJ A;  4JBJ A;  1QOH A;  1D7Q A;  1CSQ A;  3TRE A;  4IPG A;  1S5D D;  2K28 A;  4KD3 A;  4LNQ A;  5JPN C;  5C0X J;  2VL6 A;  3CCQ A;  1T5X D;  1WJJ A;  2UUC Q;  1HUN A;  4JI1 L;  3CCU A;  1GKH A;  1LT4 D;  4RGT A;  2F0L A;  3T1Y Q;  5I4D A;  4ZUJ A;  2VB3 X;  2KQ3 A;  4HN7 A;  4XYO A;  1BCP C;  4MNO A;  4LK1 C;  3NQT A;  5GAE C;  1EWH A;  4LF4 L;  1Q12 A;  4JOI A;  4OL7 A;  4RGN A;  2XWB B;  4HIO A;  2OWO A;  4B3R Q;  2A6H D;  4CDC C;  5JVH 3;  1Y1W B;  4FF2 A;  4JPB W;  2HHH Q;  2NN6 G;  3P75 A;  1JWU D;  4DR5 L;  4DAM A;  1LYL A;  4A3I H;  4KK7 A; 
#chains in the Genus database with same CATH homology
 2UXC L;  1X3G A;  3KJP A;  1CKM A;  1X55 A;  1X9N A;  3CCL A;  3W1B A;  1WI5 A;  2ZM6 L;  3AYH B;  5M3F H;  1WOC A;  2R7D A;  3PF4 A;  1X3F A;  4X66 L;  1Q8K A;  1CSP A;  1WYD A;  1JE5 A;  1UE1 A;  2CFM A;  3ZJY C;  4A3G H;  2EIF A;  1C0A A;  4B3T Q;  2YTX A;  1VQ9 A;  2OTL A;  4JYA Q;  4C3H H;  3T1H L;  4DV0 Q;  1Q82 C;  1XPU A;  1HZC A;  3D0F A;  1VCI A;  4LF5 L;  2WAQ G;  4JI4 L;  1HZB A;  3H15 A;  4GLX A;  2F4V Q;  4YCV A;  4P72 A;  1RIP A;  2AMC B;  4HJA A;  3J81 j;  1R9T H;  3S1N H;  2R92 G;  2WAQ E;  3U4Z A;  4GLV B;  1XPR A;  2AWN A;  4AH6 A;  3M7N A;  1AH9 A;  4UP8 A;  4DK6 C;  1BBW A;  1VQ6 A;  3RN2 A;  4RG1 A;  2IHE A;  2KHJ A;  2ZTD A;  4NXN L;  2NVT H;  3GTO H;  1VQK A;  2N8N A;  4KLK A;  2MFI A;  1Q7Y C;  1NMG A;  1T9H A;  2LXK A;  3FHW A;  2GVB A;  3OYY A;  4QIW E;  3ULJ A;  4DR7 Q;  3H0G H;  4AQY L;  3M4O H;  4WJ4 A;  1V1Q A;  3M9B A;  4LF6 L;  4DNI A;  1VQL A;  4MTN A;  1H95 A;  5LMU Q;  1J6Q A;  1QVC A;  2JA8 H;  3GTJ H;  2Z0S A;  2Z6K C;  2I0Q A;  1TWF H;  2UUA L;  4YHH L;  4R4Q A;  4B3S Q;  4QL5 A;  1JMC A;  3CC2 A;  4DR6 Q;  4QQB X;  4PG3 A;  1PVO A;  1L1O A;  5ELN A;  2E2I H;  1DGS A;  2K50 A;  3GTL H;  3K0X A;  1KQS A;  2ZJP A;  4BBS G;  2JK8 A;  1Y1V H;  1B70 B;  3GDE A;  1XMO L;  3S1Q H;  1V9P A;  1YVC A;  3STB C;  4KHP Q;  3OW2 A;  4TVA B;  4K0K Q;  3GD7 A;  4LFB L;  1NBW A;  2E2J H;  4HIK A;  2VUM H;  2VZA A;  3BJU A;  3PUV A;  4OX9 L;  4XTC S;  4DR3 Q;  1KC8 C;  3S17 H;  5IY0 A;  1SFO H;  2PQA A;  1HJP A;  4JV5 Q;  4C3I H;  3CQZ H;  4L5Q A;  4A3I G;  2K5H A;  4IFD J;  4LF7 L;  3OTO Q;  1O7I A;  4GKJ L;  4JI7 Q;  4R4C A;  1IYJ B;  3WWV A;  3CCJ A;  2XGT A;  3ER0 A;  5IT9 c;  2RCN A;  5IP9 H;  1OTC A;  4JBK A;  2R92 H;  5M3F G;  1N32 Q;  2JE6 I;  1X65 A;  4GS3 A;  4IPC A;  5FJ8 H;  1J5E L;  2H5X A;  1FJG L;  2BH2 A;  3ICE A;  2F3I A;  2CWA A;  4IFD G;  2UXD Q;  1I94 Q;  2BA1 A;  4LFC L;  4POF A;  1VQ7 A;  4A3G G;  3MXN B;  5C4X H;  1Q1B A;  1Q86 C;  1IBL L;  4LF9 Q;  2VY3 A;  3PV0 A;  1PH6 A;  2UU9 Q;  4B3M Q;  2RHQ B;  5JJL A;  2I5H A;  1WCM H;  1AE3 A;  5C0X I;  2IY5 B;  2B29 A;  3NEM A;  1K9M C;  4AIM A;  5J3B A;  1G29 1;  3EBE A;  1HNX L;  1QVF A;  3GTM H;  1JT8 A;  3G71 A;  3KFU A;  4C3J H;  1M90 C;  2VQF L;  2E5L Q;  2HIX A;  3J7Z C;  2EXD A;  2RF4 A;  3PSI A;  3BZC A;  1EIY B;  5HY6 A;  2CWP A;  2KHI A;  1VQA A;  1P8L A;  4DV6 Q;  3IRB A;  2VW9 A;  2NN6 I;  4DV7 L;  3TS2 A;  1VQF A;  1N34 L;  1HNZ L;  4BY1 H;  2Z6K A;  1YJW A;  2N78 A;  1KRT A;  1VQN A;  3JAM i;  4DR5 Q;  1ASZ A;  4FDB A;  3H0G G;  5GAG C;  2AKW B;  1X6O A;  3I7F A;  4YY3 Q;  3EN2 A;  4POG A;  2AWO A;  1YNX A;  4GN4 B;  4DUZ L;  2I5M X;  2JA6 H;  4OWT B;  1HR0 Q;  4YWL A;  4NB3 A;  4JBW A;  2VQE L;  4LFA L;  2JA8 G;  1D8L A;  1SMX A;  2WFW A;  3CW2 C;  3I55 A;  4OO1 G;  2GVA A;  2IHF A;  1CKN B;  2FXQ A;  2IX1 A;  2K4K A;  2JEB I;  3STB D;  4NXM L;  1XMQ Q;  4JI3 Q;  1A0I A;  4X66 Q;  2YV5 A;  3KF6 B;  5IYB H;  2JA5 H;  5C44 H;  1N36 L;  2F52 A;  2UUB Q;  1Y1V G;  5M5W H;  4A3K H;  3CMA A;  1IBM L;  4GN3 B;  4LUO A;  3J81 c;  4JI6 Q;  3T1H Q;  3PUY A;  3KDF A;  4X65 Q;  3F1Z A;  2OTJ A;  2VUM G;  1CKO A;  5GQO A;  2NVQ H;  3GTQ H;  1OXT A;  4OXP A;  5H1S E;  4LUZ A;  1VQ8 A;  4LWC A;  1E22 A;  1YJ9 A;  2CKZ B;  4DR4 Q;  2KBN A;  3DLL A;  5IYD H;  3T1Y L;  2E2H H;  1YEZ A;  1Z47 A;  4DK3 C;  4DV2 L;  4EX5 A;  3AEV A;  2BA0 A;  2MNA A;  1K8G A;  4A3D H;  5LMN W;  1PHJ A;  1FVI A;  3I2Z A;  2QA4 A;  3UE1 A;  5BR8 L;  1YHA A;  4JI5 L;  5IWA Q;  3CCE A;  2KCM A;  3UE0 A;  5HGQ A;  3G6E A;  1VQ4 A;  1YIJ A;  4X6A H;  1LM0 A;  1K83 H;  2WP8 J;  5IP9 G;  1YZ6 A;  2XTI A;  4HIM A;  1PH9 A;  3HOZ H;  4LF6 Q;  4B3R L;  2IT1 A;  3CPF A;  2OQ0 A;  2PNH A;  3PUX A;  4JI2 Q;  4A4I A;  1KD1 C;  1G51 A;  2RHS B;  5FJ8 G;  4A3M H;  4NXN Q;  1M1K C;  3E9I A;  4O0A A;  2JEA I;  1NMF A;  1C9O A;  4RMF A;  2HHH L;  2UXB L;  4DUY L;  2K5V A;  4HJ8 A;  1A8V A;  5C4X G;  3HOX H;  2ID0 A;  4OWX B;  2QGQ A;  1WCM G;  5LMN L;  1QUQ A;  2A1A A;  3A5U A;  4JI8 L;  2V1C C;  4R4O A;  5GAH C;  3J80 c;  4YCW A;  2IX0 A;  2A19 A;  3CCR A;  3AQQ A;  1QVG A;  1VS0 A;  1NE3 A;  3HOV H;  4IPH A;  1I50 H;  2K5N A;  1NTG A;  4L5S A;  2NVX H;  4A93 H;  2R6G A;  4BA1 I;  4IOC A;  4OX9 Q;  1X54 A;  4QGU A;  4DAY B;  2K52 A;  2DUD A;  4BY1 G;  1KIX A;  4JYA L;  1MJC A;  4IJL A;  3L2P A;  4X62 L;  4YWM A;  2MQH A;  4DV4 Q;  3KF8 B;  4DV0 L;  1YIT A;  3VDY A;  4JG2 A;  3RLF A;  1RL2 A;  1N33 Q;  4A3C H;  2ALY B;  2BH8 A;  2F4V L;  2LXJ A;  5E7N A;  3G48 A;  2NVY H;  4P74 A;  3CPW A;  1YHQ A;  2JA6 G;  2OCE A;  2OQK A;  3CXC A;  1PH1 A;  1XJV A;  1Z9F A;  2C35 B;  2D0P A;  1GVP A;  2JQO A;  4BXX H;  3SGI A;  4JC0 A;  2MO0 A;  3PO3 H;  3HOW H;  4DV1 L;  4IFD I;  3CCS A;  1J5E Q;  1GM5 A;  1KXL A;  2HQL A;  1K0R A;  1FJG Q;  3A74 A;  3HKZ G;  5IYB G;  4DR2 L;  2JA5 G;  4PZ7 A;  5C44 G;  4A3K G;  3L7Z C;  3HKZ E;  4HID A;  3CC7 A;  1TWH H;  1KRS A;  4O2D A;  3JC6 6;  1UE6 A;  3Q8D A;  4ME3 A;  4GNX A;  2ZTE A;  1G6P A;  5LMU L;  1IBK L;  1MKH A;  4EQ5 A;  1LUZ A;  1OXS C;  3GO5 A;  2DGY A;  2VNU D;  1PFS A;  4DKA C;  4HJ5 A;  4B3S L;  2YYZ A;  1Y1W H;  4JI0 Q;  4DR6 L;  1V43 A;  5IYD G;  4JI1 Q;  1X3E A;  1VQI A;  2NZH A;  5JEA J;  1L1O B;  1U5K A;  2CQO A;  4A3D G;  1IXR A;  4LW1 A;  4DV5 Q;  4DV3 Q;  2R93 H;  4DPG A;  1XNR Q;  2R7F A;  4A3F H;  4LF8 Q;  4IOA A;  3A5Z B;  5DLQ E;  2HT1 A;  4K0K L;  3I4O A;  4QJF A;  1Q81 C;  1E24 A;  5M3M H;  3PF5 A;  4LF4 Q;  3HOZ G;  2UXC Q;  5GRO A;  1EIF A;  4A3M G;  2QEX A;  4OO1 I;  4DR3 L;  3KJO A;  4LFA Q;  1EQR A;  1OXV A;  4H02 A;  3B6Y A;  1EWI A;  4GKK Q;  2D0O A;  2PQA B;  2Y0S G;  4L5T A;  2YTY A;  1VQH A;  4KHZ A;  3HOX G;  3UDG A;  5FLM H;  1S40 A;  2Y0S E;  5C3E H;  1VQ5 A;  3OTO L;  4JCV E;  3ULP A;  4PZ8 A;  1TWA H;  4UP9 A;  1NY4 A;  2Q2I A;  4QY7 A;  3CF5 A;  5IP7 H;  1YHB A;  3TRZ A;  5K36 G;  5AJ3 Q;  4HJ7 A;  2ZTC A;  5M5X H;  4YWK A;  4DR1 L;  3TQY A;  1E1O A;  1VQE A;  2GN5 A;  3HOV G;  1VQM A;  1PH3 A;  1GO3 E;  1EQQ A;  3RNU A;  3FP9 A;  3W1G A;  2ZM6 Q;  1GD7 A;  4A93 G;  2UXD L;  1I94 L;  3AFQ A;  2A8V A;  1XNQ L;  4P71 A;  3M3Y H;  1W3S A;  4B3M L;  1Q46 A;  2ZJR A;  1PYS B;  1HNW L;  1NJI C;  1X56 A;  3K7A H;  1C7Y A;  4A3C G;  4HJ9 A;  1Y14 B;  1SR3 A;  4R4T A;  3J81 i;  2Q2U A;  3CCM A;  1SN8 A;  3E9H A;  2E5L L;  3L0O A;  1UWV A;  3DM3 A;  4JI4 Q;  4LF5 Q;  4XIG S;  1VQB A;  2UUC L;  4BXX G;  4Y52 H;  1HH2 P;  3PO3 G;  3HOW G;  2YU9 H;  4A3L H;  4DV6 L;  3I4N H;  4GNX C;  4IJH A;  3CME A;  3CD6 A;  1L0W A;  3BU2 A;  4IO9 A;  1QZH A;  3NBH B;  5FLX c;  2R7Z H;  1N9W A;  1UEB A;  4A3E H;  3ULL A;  3GTK H;  1L2F A;  1I3Q H;  1Q1E A;  1VQC A;  4X64 L;  4LUV A;  2ATW A;  1SE8 A;  4YY3 L;  5LMN Q;  3PO2 H;  2MO1 A;  2B63 H;  1KAW A;  3PUW A;  4OON A;  4AQY Q;  4PZ6 A;  3FKI H;  4JI8 Q;  4A3J H;  1A62 A;  1VQO A;  2E8G A;  5IYC H;  1XPO A;  2HIV A;  3U4V A;  1SRO A;  3J7A 5;  3HFZ B;  4APV A;  4A3B H;  1Y1W G;  4JI3 L;  1XMQ L;  2PI2 A;  3S16 H;  2UUA Q;  4YHH Q;  1YBY A;  4J15 A;  1JJ2 A;  3H3V H;  2I5L X;  3PIP A;  1PYB A;  1P16 A;  2R93 G;  2UUB L;  3HOU H;  1S72 A;  3NEL A;  4A3F G;  2LSS A;  4JI6 L;  4X62 Q;  4BY7 H;  3CAM A;  3PCO B;  3EIV A;  1SRU A;  3KDF B;  3D31 A;  4X65 L;  4A75 A;  1XMO Q;  2K75 A;  3J80 i;  5M3M G;  1PH4 A;  1VQG A;  1EOV A;  1PV4 A;  3K81 C;  4LFB Q;  4GOP C;  5C4J H;  1SLJ A;  3GTG H;  5EAY A;  4DR4 L;  4JBM A;  4AYB G;  3NEN A;  3U50 C;  4KI0 A;  1IL2 A;  4DV1 Q;  5FLM G;  4AYB E;  3K80 C;  5C3E G;  4B3T L;  3GTP H;  1BKB A;  4UPA A;  2N49 A;  1E7Z A;  4DR2 Q;  2L15 A;  5IWA L;  3I4M H;  4LF7 Q;  3RZD H;  1VQP A;  5IP7 G;  1ASY A;  2JA7 H;  4KHP L;  1WFQ A;  1PH2 A;  3K7U C;  3M85 A;  4GKJ Q;  1BVS A;  1UE5 A;  2KCT A;  5IE8 A;  3A0J A;  2NZO A;  3UDF A;  4JI2 L;  1IBK Q;  3HOY H;  3AFP A;  3F2C A;  3K8A A;  1I5F A;  4Y7N H;  1PH8 A;  1FL0 A;  2D62 A;  5M5Y H;  4LFC Q;  4JOI C;  1IBL Q;  4BBR H;  1QUQ B;  4DR7 L;  4GLA C;  3TEH B;  3UDI A;  3MEF A;  1E1T A;  1YI2 A;  3RR5 A;  1JJG A;  3E0E A;  3S14 H;  1B8A A;  1MIU A;  1HNX Q;  1IZ6 A;  2VQF Q;  1HZA A;  1LTL A;  2PMZ E;  3RN5 A;  3S2D H;  2EQS A;  3CC4 A;  3I4N G;  4A3L G;  1XTD A;  1JB7 A;  1VQD A;  2AHO B;  2ZJQ A;  2YTV A;  2CCZ A;  2PI2 E;  4L5R C;  3W5O A;  4DV7 Q;  3H3V I;  3S1M H;  1I6H H;  3CCV A;  2R7Z G;  1TWG H;  1A63 A;  3UDX A;  4DV4 L;  4A3E G;  1N34 Q;  1HNZ Q;  1N33 L;  3PIO A;  3F2D A;  1EUJ A;  3PO2 G;  1K3R A;  1OXU A;  1S3O A;  5ELO A;  4PMW A;  4C2M H;  4IPD A;  1PH5 A;  2B63 G;  3RLN A;  4NPS A;  3I56 A;  3FKI G;  3TS0 A;  4A3J G;  4WJ3 M;  3U58 A;  5IYC G;  4DUZ Q;  4R1J A;  5JEA G;  3G4S A;  4DR1 Q;  1QZG A;  2VQE Q;  1W2B A;  1N8R C;  4A3B G;  3S2H H;  1E3P A;  4ALP A;  3CP0 A;  4GN5 A;  1KL9 A;  4UY8 C;  1CKN A;  1PH7 A;  4JV5 L;  4NXM Q;  4UP7 A;  1XNQ Q;  1OXX K;  4A76 A;  4GOP A;  3HOU G;  1K73 C;  3KF6 A;  2JJQ A;  3ERS X;  1N36 Q;  4TQU S;  3M4Q A;  4JI7 L;  2ES2 A;  4BY7 G;  1BBU A;  1HNW Q;  4BA2 I;  4GNX B;  4P73 A;  1KHI A;  1IBM Q;  1YJN A;  2KEN A;  1VQJ A;  2VS1 A;  4JBJ A;  4OWW B;  1D7Q A;  4YCU A;  1N32 L;  1CSQ A;  3BZK A;  4IPG A;  3TRE A;  4LNQ A;  1B7Y B;  5C0X J;  2B3G A;  2VL6 A;  3PUZ A;  3CCQ A;  1WJJ A;  2UUC Q;  4JI0 L;  1TXY A;  2WB1 G;  4JI1 L;  1K8A C;  3CCU A;  1GKH A;  4LF9 L;  1CUK A;  2WB1 E;  2UU9 L;  1TWC H;  4DV5 L;  1UE7 A;  1JJC B;  4DV3 L;  1FGU A;  3T1Y Q;  1XNR L;  3RZO H;  4MNO A;  4DV2 Q;  4LF8 L;  3JAM c;  4BBS H;  3I4M G;  3S24 A;  5C0X G;  4R4I A;  3RLO A;  2JA7 G;  5BR8 Q;  4X64 Q;  5GAE C;  2Q2H A;  3PGZ A;  1HR0 W;  4JI5 Q;  4LF4 L;  5JJI A;  1Q12 A;  4JOI A;  4HIO A;  1L1O C;  3S15 H;  2OWO A;  2Q2T A;  4B3R Q;  3M4P A;  2K14 A;  3S1R H;  1PA6 A;  3HOY G;  4GKK L;  3F2B A;  2ASB A;  3F8T A;  2JA9 A;  3KYH C;  2HHH Q;  4MZ9 A;  2UXB Q;  2NN6 G;  4DUY Q;  1AE2 A;  2N3S A;  1HZ9 A;  4GOP B;  5JJK A;  4P75 A;  1MJE A;  3HKS A;  4DR5 L;  4BBR G;  4DAM A;  1LYL A;  4A3I H;  3KLW A;  5GAD C;  1U0L A;  5AJ3 L;  3KOJ A;  1EFW A;  1HR0 L;  3LGJ A;  1EYG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...