4HJ5A

Crystal structure of schizosaccharomyces pombe pot1pc bound to ssdna (ggtttcggt)
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
138
structure length
138
Chain Sequence
SFSLLSQITPHQRCSFYAQVIKTWYSDKNFTLYVTDYTENELFFPMSPYTSSSRWRGPFGRFSIRCILWDEHDFYCRNYIKEGDYVVMKNVRTKIDHLGYLECILHGDSAKRYNMSIEKVDSEEPELNEIKSRKRLYV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Protection of telomeres protein 1
publication title Nonspecific Recognition Is Achieved in Pot1pC through the Use of Multiple Binding Modes.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
total genus 35
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2012-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16686 POT1PC ssDNA-binding domain of telomere protection protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4hj5A00
3G48A 1A62A 3I7FA 1SMXA 5IYCG 2OWOA 2A1AA 1FGUA 1SRUA 1VQFA 4JI8Q 4X65Q 1Q12A 3CF5A 4L5QA 4X64Q 2VQEL 5HGQA 3HOZH 4A93G 4JBKA 1OXSC 1SLJA 5IY0A 1GM5A 4POGA 2UUBL 3J81j 2PMZE 2R93G 1PHJA 1EQRA 1X65A 4C3JH 1YI2A 1E7ZA 4IJHA 2K75A 3CCUA 1VQEA 3F2DA 2HIVA 4OX9Q 5LMUL 3PO2H 3TS0A 2I0QA 4BA1I 5IP7H 4DR1L 2OTLA 3AEVA 1N33Q 2BA0A 3TS2A 1VQ9A 1S72A 4DUZL 5BR8L 3JAMi 4GOPB 1YIJA 1FVIA 4IFDG 3DLLA 3S1RH 3U4ZA 2HHHQ 1VQMA 3K7UC 4DPGA 1KRSA 4TVAB 1EFWA 3M3YH 1I6HH 3H15A 4UP7A 3J80i 3KOJA 1H95A 1AE2A 1XPRA 2EXDA 4OWTB 2DGYA 4PG3A 4DR4Q 4LUOA 2Q2IA 4DR2L 1UE5A 3TREA 2UU9L 4B3RQ 3GD7A 1OXUA 3F1ZA 1NMFA 1IZ6A 1W3SA 3PF5A 3SGIA 1KL9A 3HKZG 4J15A 4IPCA 1EOVA 1U0LA 3L7ZC 4IFDI 4OXPA 1Z47A 2YTVA 2IT1A 2XGTA 1UE6A 4HIMA 4LF6Q 4LFBQ 3AFPA 1HNZL 1MIUA 3MXNB 4GNXC 1PA6A 1I94Q 2VNUD 3UDIA 4AH6A 4JI4L 1S40A 4IOCA 1C0AA 3CXCA 4OONA 3PIOA 1YHQA 4DV5Q 4LFCQ 1XNRQ 3GTLH 4OO1G 2V1CC 2MO1A 1XMQL 3M9BA 1XNQL 3H0GH 1KRTA 3AQQA 4BBRH 4EQ5A 1NY4A 2VUMH 5IT9c 2UXBL 2AHOB 2VQFL 3OTOQ 3T1YQ 4JOIC 4C2MH 1GD7A 3PUVA 5FLXc 1PH8A 2NVQH 1G6PA 1EQQA 1NBWA 2JJQA 2HQLA 1PH3A 4X66L 2A19A 4DV6L 1NE3A 4DV1Q 4DKAC 1KIXA 2RCNA 2K14A 3A5ZB 5IE8A 1HJPA 1EUJA 2UUBQ 3KF6B 3S1MH 3I2ZA 2B29A 1BBWA 1L0WA 3T1HL 4DR5L 4JCVE 1Y1WG 5J3BA 1PH4A 4LFAL 3B6YA 1BVSA 4DR6L 1BBUA 2AWNA 5IYCH 3STBC 4XIGS 1C7YA 1V1QA 4DV0L 5LMUQ 2E2HH 3HOVH 2E8GA 4A93H 4GLXA 3F8TA 4P74A 3RNUA 1I5FA 1K9MC 1Z9FA 4Y7NH 4DUZQ 3GTOH 3S17H 2R93H 1S3OA 2JK8A 3BU2A 4GN3B 4MNOA 4LF7L 1E1OA 2OCEA 4H02A 2MQHA 1E1TA 4JI7Q 4UPAA 3E9IA 4B3TQ 2WFWA 1M1KC 1IBKQ 2AKWB 3NBHB 2MFIA 5E7NA 4GKKL 2N49A 4YCUA 1PH6A 5M5WH 4DUYQ 3W1GA 2R92G 3JAMc 3A0JA 5IYBG 4YHHQ 5FLMG 1VQLA 3GTQH 2UXCL 1XJVA 2JA7G 3EBEA 2NN6I 4JV5L 1KAWA 3W1BA 1A63A 2K5HA 3CQZH 1YJWA 3CD6A 2JA8G 3I4MG 3FHWA 4QIWE 1Q82C 1YZ6A 2UXDQ 1G291 5AJ3L 3J80c 4B3MQ 1PH9A 4GNXB 2MNAA 4C3IH 3GTMH 4JYAQ 1GO3E 4DR7L 4K0KQ 4GLAC 4A3GG 1E22A 3F2BA 4HIKA 4P75A 3UDFA 1VQHA 1E24A 4JG2A 1CSPA 4L5TA 5IWAQ 4LF9L 1B8AA 4A3MG 4BBSG 3RLNA 1UE1A 3JC66 4X6AH 1AE3A 4LWCA 2C35B 1VQAA 2F3IA 3UE1A 3J7ZC 1XMQQ 2K4KA 3PUXA 5GAHC 4WJ4A 3PGZA 4JI0Q 1L2FA 2GVAA 2IY5B 3CAMA 1QUQA 1TXYA 1Y1VG 3S14H 4DV3L 1DGSA 4RMFA 1WYDA 4DV4L 5EAYA 1VQNA 5C4JH 1PH5A 1YJ9A 3HOVG 3VDYA 5JJIA 2E2JH 1XMOL 1K73C 4QGUA 5IYDG 1J5EQ 4DK6C 3CPWA 1TWCH 3TQYA 4DR5Q 1PH1A 1KC8C 2ALYB 3S15H 5C44G 1TWFH 1WCMG 1UE7A 3I55A 1IBML 1OTCA 2UUAL 3FKIG 4MTNA 4EX5A 2ASBA 3M85A 1HR0W 3CCRA 3BJUA 4DK3C 3J81i 3KLWA 4JI3Q 1KD1C 1V43A 4GN4B 1TWAH 4AIMA 2QEXA 4NXMQ 3CP0A 2YU9H 1N32Q 1Y1WH 1JE5A 3PUYA 2I5LX 3OYYA 1VQPA 1N36L 5M3MG 2UUCL 1L1OB 3HOUG 5IP9G 1EIYB 4PZ6A 2F4VL 4LF4Q 1XPUA 1B70B 1MJCA 4R4OA 3I56A 1FL0A 3HFZB 3TRZA 1X55A 1WI5A 1IYJB 3BZKA 1IXRA 1GKHA 4JBWA 1W2BA 1YJNA 1PV4A 2Q2UA 1K83H 2NVYH 2Y0SE 4OWWB 1YVCA 1Q46A 4DNIA 1LYLA 4DV7L 2NZOA 4YCVA 2EIFA 1Q81C 2PQAB 4O2DA 1HR0L 1D7QA 1P8LA 2PNHA 2XTIA 2I5MX 4GOPA 3I4NG 1LTLA 3UDGA 4A3EG 2E5LL 3ER0A 2R92H 5IYBH 5JJLA 1NMGA 5FLMH 4B3SL 1HNWL 4KHPQ 2JA7H 2VL6A 1XTDA 1K8GA 1FJGL 4JI6L 1TWGH 2NZHA 2KCTA 3RN5A 1J6QA 1VQGA 4R1JA 2Z6KC 2JA8H 1TWHH 2PI2E 4JI1Q 2JEAI 3I4MH 4A3JH 3S24A 3CC7A 1R9TH 2YTYA 4X62L 1QZHA 3PV0A 3CCMA 1YEZA 4LF8Q 2R6GA 4BXXG 4L5RC 1NJIC 4IJLA 4A3GH 3S16H 1IBLL 1EIFA 2L15A 5GADC 4PZ7A 4DV3Q 3CPFA 4DV2L 5FJ8G 4A3MH 1N34L 2VQEQ 1HNXL 4BBSH 4JI2L 2LSSA 4NB3A 4AQYL 1QVCA 1HZAA 4IPGA 3RN2A 2VUMG 3GTPH 4P73A 4DR3L 1X56A 1X3EA 4NXNL 3S1QH 4A3CG 1YNXA 3ICEA 1JB7A 1Y1VH 1IBMQ 2CQOA 2D0PA 4UP8A 1SN8A 2ZM6L 4HJAA 3DM3A 3HOXG 3E9HA 2GVBA 4A3KG 1Q86C 4LF5L 1P16A 5LMNW 1VCIA 3K0XA 4HJ9A 2NN6G 4DR1Q 1KXLA 4JI5L 3L0OA 1X6OA 2IHEA 4JI8L 5BR8Q 4A3LG 4Y52H 4X65L 5IYDH 1C9OA 3GO5A 1HH2P 4X64L 5C44H 3FP9A 2CCZA 1WCMH 1NTGA 5GROA 1XPOA 4L5SA 3RZOH 2VS1A 3FKIH 5H1SE 2Y0SG 2OTJA 1SR3A 3KF6A 1VQ5A 3GTGH 3J81c 2N78A 5GAGC 2OQ0A 1L1OC 4POFA 2GN5A 5JJKA 2JA6H 5GAEC 3CC4A 2ZJQA 3K80C 3NELA 4DR2Q 3KDFB 2UU9Q 2DUDA 3U50C 2D62A 3M7NA 4A3BG 4OX9L 2H5XA 5LMNL 3TEHB 1VQ7A 5M3MH 1HR0Q 1N33L 2KHJA 4JBJA 3HOUH 4A3JG 5IP9H 4A75A 3A74A 1O7IA 4R4CA 4YWLA 2JQOA 1V9PA 1Y14B 2HHHL 4HIDA 4MZ9A 1YBYA 4B3SQ 1HNZQ 2R7DA 1JT8A 3CCQA 3CC2A 4JI4Q 4BA2I 1VQBA 2FXQA 3CCEA 4GN5A 2WB1E 1PH2A 4A3FG 3PF4A 2RHQB 3ERSX 3PCOB 2IX1A 2YTXA 1CKNB 1PYSB 2K5NA 2ZTDA 4XTCS 1A0IA 4O0AA 1XNQQ 4B3RL 3I4NH 4A3EH 1QZGA 2UXBQ 1KHIA 1Q1BA 2VQFQ 4HJ7A 4A3DG 3H3VI 2K50A 2LXJA 1VQCA 4KI0A 1LM0A 4R4IA 4IOAA 3S2HH 4GNXA 4FDBA 3PUZA 3GDEA 3RLOA 3RR5A 4AYBE 4X66Q 4LF6L 3K81C 4DV6Q 2Z6KA 1I94L 5C3EG 4DR3Q 1E3PA 1Q8KA 1N8RC 4GS3A 5ELNA 5HY6A 3T1HQ 2WP8J 4LFAQ 3CMEA 1VQ8A 4LFCL 4BXXH 2CWPA 3CW2C 4DAMA 4DR6Q 3PO3G 2YYZA 4APVA 3MEFA 4JOIA 1HZ9A 4YWMA 5FJ8H 2MO0A 4LW1A 4DV0Q 1YITA 4LNQA 2WAQE 3PSIA 3M4PA 3A5UA 3OTOL 2VW9A 1G51A 3NENA 3T1YL 4JI5Q 2QA4A 5C4XG 2JA6G 1IL2A 2JA5G 4LF7Q 4A3CH 1X54A 2F52A 2N8NA 1YHAA 2KCMA 3E0EA 4DV1L 1BKBA 2CKZB 3HOXH 3CMAA 4A3KH 4UP9A 2ES2A 3HOWG 4GKKQ 4C3HH 1PH7A 3AFQA 3HOYG 2Z0SA 4TQUS 4YWKA 4BY7G 2ZTEA 3G71A 1X9NA 4QQBX 4A3LH 2UXCQ 1KQSA 1PFSA 2CWAA 3UDXA 4KHZA 4JV5Q 1WOCA 1X3GA 3M4OH 5LMNQ 1YHBA 2YV5A 4OWXB 4A4IA 4A3IG 4YY3L 2IX0A 1ASYA 5AJ3Q 2A8VA 1SE8A 1LUZA 3S2DH 3HKSA 3G4SA 2WB1G 2JE6I 2D0OA 4JI7L 4DR7Q 5JEAJ 3J7A5 4B3TL 1L1OA 4GKJL 4ME3A 1IBKL 4A3BH 4WJ3M 1JJ2A 1K0RA 1RIPA 2KENA 3PIPA 1QVGA 4LF9Q 4DUYL 5C0XJ 4BY1G 4YHHL 1UWVA 2R7ZG 3H3VH 1I50H 1RL2A 1JJGA 3ULJA 3NEMA 1OXTA 2AMCB 2EQSA 2PQAA 4AYBG 4R4TA 2UXDL 1CKMA 2RF4A 4PMWA 4B3ML 3CCVA 2B63G 4DV4Q 3D0FA 4A3FH 3GTKH 5M5YH 5M3FG 3BZCA 4HJ5A 1AH9A 1QVFA 3D31A 4YCWA 4JYAL 4HIOA 3K7AH 4K0KL 3KYHC 4IPHA 4QJFA 1K3RA 1EWIA 4P72A 3RLFA 3F2CA 2QGQA 1XMOQ 5IWAL 1VQJA 1HZBA 2WAQG 3CCSA 4A3DH 3HOZG 3ULLA 2IHFA 2BH8A 2JEBI 3KJPA 2UUAQ 5DLQE 4LUVA 4RG1A 4JI0L 3PUWA 2LXKA 5JEAG 1SFOH 3IRBA 5C3EH 1JJCB 1WJJA 1ASZA 5K36G 1UEBA 2ZJRA 1N36Q 3PO2G 3Q8DA 5C0XG 5IP7G 5ELOA 3KJOA 2UUCQ 3PO3H 3S1NH 2K52A 3RZDH 2PI2A 2F4VQ 4OO1I 4KLKA 1J5EL 1PYBA 2N3SA 2ZTCA 1CUKA 5C4XH 2B3GA 3EN2A 1VQDA 3ZJYC 2JA5H 1B7YB 1D8LA 2HT1A 2JA9A 2CFMA 4DV7Q 4IO9A 1VQ6A 5GQOA 4YY3Q 4ALPA 2KBNA 4JI3L 3CCJA 1GVPA 1X3FA 3KF8B 2VY3A 2NVXH 3U4VA 4NXML 1N32L 4GLVB 2ID0A 1MKHA 5C0XI 3HOWH 2E5LQ 3HOYH 4BY7H 1N9WA 3G6EA 2ZJPA 1I3QH 4GOPC 1HNWQ 1SROA 2AWOA 2K5VA 3ULPA 4GKJQ 1FJGQ 1VQKA 5M5XH 1EYGA 2E2IH 1MJEA 4JI6Q 4LF4L 3AYHB 1CKOA 4JC0A 2OQKA 4A3IH 3K8AA 1HZCA 1VQIA 2VZAA 4LUZA 1VQ4A 1Q7YC 4DR4L 1T9HA 1WFQA 3WWVA 4X62Q 4QL5A 1CSQA 3KDFA 4HJ8A 3LGJA 4UY8C 2BA1A 1QUQB 3KFUA 3OW2A 1IBLQ 3STBD 1OXXK 2Q2HA 4A76A 4DV2Q 3H0GG 3W5OA 1HNXQ 1A8VA 4BBRG 1N34Q 4DAYB 1M90C 4JI2Q 4P71A 1OXVA 4AQYQ 3U58A 3CCLA 3HKZE 1JMCA 4BY1H 2R7ZH 4LFBL 1PVOA 4JBMA 2I5HA 4IPDA 3I4OA 3GTJH 2NVTH 3M4QA 4KHPL 2ATWA 2RHSB 2R7FA 4R4QA 2KHIA 1VQOA 3L2PA 4NXNQ 2BH2A 2HIXA 4NPSA 4DV5L 4JI1L 1XNRL 2Q2TA 4IFDJ 3UE0A 1U5KA 2ZM6Q 1CKNA 2B63H 1VS0A 4QY7A 4LF5Q 1Q1EA 3EIVA 5M3FH 4LF8L 1K8AC 4PZ8A
chains in the Genus database with same CATH superfamily
2ENBA 1SMXA 4K6LA 5IYCG 3HKZB 1VQFA 1Q12A 1BUVT 4G57A 4C56C 4JBKA 1SLJA 5IY0A 1S5FD 1ZKOA 2PMZE 3J81j 1U4RA 4G7HC 1D5ZC 5I2YA 5G3LD 1V8QA 3MVVA 2Z9HA 3TS0A 5C0XH 1PFNA 4PMBA 5IGEA 1TWCB 2RDFA 1S72A 1VF5C 3T16A 5BR8L 3NXWA 3TZUA 3QO2A 3MC0B 2J0TD 1VQMA 1KRSA 1TVXA 1C4QA 4H13C 1I6HH 3KOJA 3LWEA 5FOBB 1AE2A 1TWAB 2QF7A 3LWUA 4RCOA 2YU9B 1XPRA 1H95A 2DGYA 4PG3A 1GUNA 2X6LA 2Z1CA 5IT9L 4K2KA 3TREA 4B3RQ 1OXUA 3Q6SA 1IZ6A 3NUCA 3K6OA 1PZJD 2YTVA 3IAYA 3Q22A 1SJHD 4LFBQ 4XT1B 3D4RA 3N52A 4JI4L 1DOKA 1EEFD 1BXTA 2EYMA 1MSHA 3NQIA 3NPPA 4BBRH 1NY4A 2VUMH 2AHOB 2EY5A 3OTOQ 3T1YQ 2LFNA 4JOIC 4C2MH 3PUVA 2GA4B 4KJNA 4EGVA 1PH8A 2RCFA 3VYTA 1LTSD 1STAA 2A19A 2VUMB 4DKAC 1XWEA 4BS9A 2B29A 5IT9E 4JCVE 3VR2A 2FJ2A 1BBUA 4BBSB 4XQJA 3STBC 3K5MA 4DV0L 2E2HH 2F0GA 4A93H 4GLXA 3F8TA 2ZXOA 1I5FA 3RNUA 1K9MC 3FRPB 1ENFA 4Y7NH 3GTOH 1S3OA 1DZ1A 4N8X1 1E1TA 4IUUA 5JPNC 3E9IA 2WFWA 2AKWB 3GTOB 2N49A 4YCUA 5M5WH 3W1GA 2R92G 2MPMA 3JAMc 4KD3A 5IYBG 3VYRA 2UXCL 1U4MA 3RMHA 3EBEA 1KAWA 1I4XA 1ENAA 3M4YA 4IFDH 2X6GA 2JA8G 3J80c 4B3MQ 3KF8A 4WFN3 5CV5A 4C3IH 2XVSA 4DR7L 4K0KQ 1KDBA 2RDHA 3QJYA 1F2LA 4P75A 3VYUA 1UE1A 2K6AA 4IUPA 2F3IA 2WIIB 4K8JA 3PUXA 3BVZA 5GAHC 4JI0Q 1QUQA 1Y1VG 1H9SB 4HEDA 2HDLA 1JOQA 4OIKA 4K5WA 1YJ9A 4I7AA 5E3FA 4J8QA 1CT1D 1XMOL 5IYDG 3CPWA 2J7ZA 2WV6D 3I55A 1IBML 1OTCA 4X3UA 1PZKD 2PZUA 4I65A 5CR3A 1SEBD 5CC4A 2KCNA 1V43A 1DM0B 3CP0A 3D6CA 3BG3A 3GV6A 1BOSA 2B2VA 2A6ED 2DY7A 5M3MG 2CW0D 1KTKA 4JVZA 4PZ6A 1EIHA 1I6VC 1B70B 1MJCA 4R4OA 1J8IA 3BZKA 1WI5A 1IYJB 4JBWA 1CA5A 3J7YW 1GOZA 4A3KB 1Q46A 2L11A 1LYLA 4DV7L 4RHSA 1JORA 4FNFA 1I4PA 2PNHA 2I5MX 3I4NG 5EGTA 1FYCA 2BE5C 3A8IE 1NMGA 2VL6A 5CV8A 3A7LA 1TWGH 1J6QA 1VQGA 2PI2E 4QUCA 3TSSA 3S24A 3CC7A 4FF3A 2YTYA 2LMCB 3BZDB 3GV3A 4B9XA 2QILA 4LF8Q 4BXXG 3ND9A 3VR4A 2L15A 3A8JE 3D4DA 4FXDA 5EPJA 1B1ZA 4A3MH 3D6WA 2F0WA 4AQYL 3V96A 3PMFA 4IPGA 5FK9C 3RN2A 3GTPH 1X56A 1X3EA 2AUKA 3S1QH 4A3FB 1NCVA 1FNWA 1QILA 2KECA 2ZM6L 1EYCA 1SN8A 1IBMQ 3E9HA 1Q86C 4C3HG 1PFMA 4EQNA 1NUCA 4X65L 3E0JA 1C9OA 3GO5A 2E76C 1NTGA 3SK6A 1ET9A 2IL8A 4TSSA 2VXWA 3KF6A 4RWSC 1VQ5A 1HCZA 4B9WA 5GAGC 1WTHA 2KCCA 4DU9A 5GAEC 4OL7A 4MTKA 4DR2Q 2D62A 2EE1A 3SK8A 3CRLC 3RZDB 3R2TA 1VQ7A 1AZQA 5E4XA 1AZPA 1Q8IA 2KHJA 3TZDA 3HOUH 5I2XA 1LTGD 4H0LC 3A56A 5CBAE 2JA5B 2CVRA 5COYA 1X3QA 4BA2I 3CCEA 1QCBD 1HTLD 1UNSA 5C3WA 1PH2A 2IX1A 2YTXA 1PYSB 2AQ1B 2DY8A 1A0IA 2OT2A 4A3EH 2UXBQ 2VQFQ 4HJ7A 3H3VI 3R3OA 3NWTA 4R4IA 1BCPF 4QF4A 1EEID 2ZXRA 3RR5A 4X66Q 3K81C 2Z6KA 1ESRA 2Q8IB 5CBEE 4RGTA 3T1HQ 1WVLA 2CWPA 4DR6Q 1KABA 1VF7A 4JOIA 2R7ZB 4YWMA 2MO0A 4LW1A 3WOEA 3A5UA 1D5XC 2HQEA 2A6HC 1LLRD 4AYBB 4CDDC 2F52A 3E0EA 4DV1L 1BKBA 1TR5A 1KAAA 3DUZA 2BOSA 4ZLTF 3HOWG 1CTMA 2RQXA 3AFQA 4BY7G 2WAQB 2ZTEA 1A3UA 1X9NA 1KQSA 3UDXA 2CWAA 4KHZA 1HTPA 3M4OH 1SNOA 1A2UA 3I90A 1ASYA 2DJGC 4U673 5JVG3 2D0OA 4CHTB 4JI7L 5CORA 4G4KA 5KYLA 1L1OA 4GKJL 4A3BH 1JJ2A 1K0RA 2KENA 4LF9Q 4DUYL 2M00A 1EY0A 4QB4A 3AB9A 2V4DA 5FO9B 1RL2A 3M3YB 4J6HA 1RCVD 3NEMA 1OXTA 2O2LD 3T4AC 1STBA 4PMWA 2RF4A 1O80A 1SYBA 2B63G 3I73A 3T53B 4DV4Q 5NUCA 3BZCA 1AH9A 1QVFA 4YCWA 4JYAL 1ILQA 5AFWA 1E2ZA 4IPHA 3F2CA 3K0YA 5IWAL 5F2DA 4A3DH 3HOZG 3ULLA 2IHFA 3TDQA 4L6TB 5LL6X 4FF2A 4IUTA 1TS3A 5IOCA 1LT3D 4RG1A 3PUWA 5C3EH 2B8GA 1WJJA 3MHBA 1MD2D 2ZJRA 3PO2G 3PO3H 5ELDA 4LAAA 4JPBW 2PI2A 2F4VQ 1J5EL 4RKLA 2NVQB 2ZTCA 4HAEA 2B3GA 2B2WA 3EN2A 1PLFA 3OOCA 1DYQA 3ZJYC 1D8LA 3EVQA 4IZ8A 4IO9A 3S1MB 5GQOA 1WTPA 2KBNA 3CCJA 4IQZA 3KF8B 2NVXH 5C0XI 2E5LQ 3DWAA 3KLSA 2ZJPA 1SROA 3IKJA 4GKJQ 5I6WA 2E2IH 4LF4L 2B2TC 4JC0A 4A3IH 4NKLA 3K8AA 4LUZA 1XTCD 4Z9CB 4X62Q 1F9PA 3KDFA 5TSSA 3X3MA 4HJ8A 1QUQB 3MZ5A 1EU3A 1IBLQ 5HGTA 5CMDA 3GTQB 1N34Q 3U58A 3CQZB 4JBMA 4IPDA 3I4OA 1T5EA 3GTJH 4DV5L 1XNRL 5T1IA 2Q2TA 1CKNA 4CKEA 1VS0A 2F0TA 2XNAC 3G48A 1KDCA 3QIAA 2KUMA 2A1AA 1FGUA 2VQEL 4X64Q 3VR3A 4HMJA 2R93G 3FVQA 3S14B 5BN5A 3FEWX 4IJHA 3CCUA 1H9KA 2HIVA 5K36H 4OX9Q 3ITPA 5LMUL 2E2JB 5IP7H 2OTLA 1VQ9A 4DUZL 1X32A 2PMZB 1L0XB 3DLLA 3S1RH 2HHHQ 1GUTA 1SMYC 4WORA 4TVAB 4ZK9B 4UP7A 1F9QA 3DWQA 4OWTB 3URYA 3S1RB 1D1KA 2UU9L 1FNUA 3GD7A 5FLXL 2KOLA 3PF5A 1SSOA 4KY6A 5IGFA 1QNUA 4J15A 4IPCA 1TT2A 4CKBA 3MFGA 4OHJA 4IFDI 4QMGA 2NVYB 2CH4W 3AFPA 1HNZL 1MIUA 4GNXC 1PA6A 1I94Q 2VNUD 2A6HD 3UDIA 1C8CA 4IOCA 4DNRB 2XWBB 4OO1G 4DV5Q 4LFCQ 1XNRQ 1HHVA 2R92B 2MO1A 4R9WA 2PCFB 1XNQL 3H0GH 2FINB 5IT9c 1K0SA 3QOJA 3MAQA 1GD7A 2JA8B 1NBWA 3H0GB 4X3SA 1KIXA 3A5ZB 2B2VC 1B3AA 3KF6B 4DK1A 2KJXA 1L0WA 1Y1WG 1PH4A 5CV7A 2B8FA 5FLXE 1DD2A 1C7YA 2EY6A 5LMUQ 2MJ8A 3SDZA 4DUZQ 3S17H 1Y1VB 3OWFA 1JOKA 2JK8A 3BU2A 1SYEA 2LS01 4LF7L 1E1OA 2EOTA 2A69D 1IKMA 1NR4A 4UPAA 1M1KC 1IBKQ 3KBGA 4GKKL 3S17B 1PH6A 2I46A 1PXUA 3A0JA 5C5MA 2JA7G 3I70A 2K5HA 1Y8PB 3WOFA 3I4MG 5KNCA 3AMUA 2DNCA 1PH9A 1I4HA 4DGZA 3GTMH 1EY8A 4A3GG 1E22A 5M3MB 1GJXA 4JG2A 1CSPA 5KEEA 3RLNA 4DAPA 3NP8A 3GTMB 1STEA 2F0NA 2K4KA 2PNRC 3AU7A 3CAMA 3CKIB 2F0DA 1DGSA 2F0KA 5EAYA 3I4NB 3H09A 3VDYA 2EDGA 4QGUA 1AW7A 4DK6C 1TWCH 1PH1A 1C48A 1KC8C 4C1NI 5C44G 3V2TA 1WCMG 4ILWA 1G2SA 1UE7A 3FKIG 3M85A 1FGBD 3CCRA 3J81i 2K04A 5CYUA 1KD1C 1O7YA 1D5MC 1TWAH 5J39A 2YU9H 1GUOA 5BN3A 1JCKB 1JE5A 1ZYRC 2I5LX 3OYYA 3PUYA 1K8OA 1L1OB 4LK1C 5IP9G 1EWHA 2K5QA 3I56A 4Q0FA 1X55A 1IXRA 1EQTA 1PTOB 1YJNA 2G9HD 4UAIA 5KGUA 4OWWB 1HQMC 2PYKA 3NBIA 4O2DA 4C3HB 1D7QA 1W6JA 3DMUA 1LTLA 3UDGA 3ER0A 3M7GA 2B2TA 5FLMH 1HNWL 1EFID 4JI6L 4KKTA 2NZHA 3RN5A 3S2DB 2Z6KC 2HDMA 4JI1Q 2SDFA 3CCMA 1O78A 1YEZA 2R6GA 3MEHA 1Y8OB 1JC7A 1EIFA 5GADC 1RJTA 4DV2L 5FJ8G 1HNXL 4BBSH 2P5ZX 1I50B 2LSSA 4LMQD 2K5WA 3J81L 1HZAA 4YIJA 4EQOA 3MXNA 4P73A 5J22A 3QB3A 4DR3L 1WTQA 2O5JC 1YNXA 3K57A 1HFNA 5M5YB 3T56B 5C4HA 1SMYD 4PMCA 4HJAA 3HOXG 5LMNW 1VCIA 3DEOA 3K0XA 2NN6G 4JI5L 2EZVA 3L0OA 5BR8Q 1UUPA 3EFXD 4JI8L 2HCCA 2CCZA 5GROA 4RGMA 1LT6D 5ELEA 1SR3A 3TMEA 2OQ0A 1L1OC 1A2TA 2ZJQA 3K80C 1B53A 3NELA 3KDFB 5I9PA 3U50C 3S1NB 4TKOB 3M7NA 1PTOC 5LMNL 2F0QA 2HD3A 1N33L 2LKVA 5K5PA 3NWSA 4K5VA 4FO2A 3J81E 2Q8TA 4RCNA 1CI3M 5CV6A 1AN8A 3CCQA 3CC2A 4JI4Q 1GUGA 1JT8A 1S5DD 2Q8RE 4DFAA 3HOWB 3ERSX 2F0SA 3PCOB 5G3LF 1CKNB 2K33A 2RDGA 3NTIA 4GZYC 1R4QB 4UHVA 5LHY1 1WD1A 2O5IC 3ZYYX 5D3IB 3ND8A 1QZGA 3O13A 1KHIA 5M5XB 2K50A 3IFDA 4N9PA 5C4ZA 4GNXA 2EYPA 3FPPA 4LF6L 4DR3Q 2IW3A 5HY6A 5ELNA 2I07B 2WP8J 1VQ8A 2XN9C 2RBMA 4EVOA 1QWYA 2K5DA 4DV0Q 2B2WC 1YITA 3PSIA 3M4PA 5CGKA 5C4XG 1PRTC 4JI5Q 2CH4A 1IL2A 3BS1A 3TP7A 4A3CH 1X54A 2KVMA 2B63B 3TN2A 3R8BA 3BYTB 4A3KH 3VR5A 4G7ZC 2FMMA 5KNDA 2ES2A 4ID6A 3HOYG 2IJ0A 4YWKA 2PO4A 2UXCQ 3HOZB 4A3LH 3K58A 1WOCA 1X3GA 2G5DA 5DNFA 4FF4A 5LMNQ 1IL8A 1YHBA 3OW7A 3P7JA 4A4IA 5IGCA 2IX0A 1ONLA 2K28A 1B44D 3R93A 5ELCA 1LUZA 2MUYA 4IURA 4DR7Q 3PO2B 5JEAJ 3J7A5 4B3TL 1RIPA 3PIPA 1VMPA 2RSOA 1QOHA 2EXZA 3CRKC 3P20A 4BY1G 4YHHL 1UWVA 3ULJA 5LL6S 2BDOA 2PQAA 4R4TA 2UXDL 2CHBD 2NBFA 4ZAIA 3D0FA 4A3FH 5M3FG 4HJ5A 3K7AH 3KYHC 4QJFA 3RLFA 1EWIA 1XMOQ 1CQVA 2L12A 2A73B 1WTXA 1OO9B 1V1PA 1D1IA 1PYWD 4FP5D 3E3XA 1K28A 3KJPA 1CK1A 3K7AB 3SVMA 4H7BA 4LUVA 1WTRA 1SAPA 2F0IA 2EYLA 3J7AF 4WJWA 2PW5A 5C0XG 1M8AA 3RZDH 1PYBA 2N3SA 1TS4A 2CQAA 5HURA 1VQDA 2JA5H 1B7YB 4HTHA 2HT1A 2CFMA 3R2IA 4DV7Q 1TIID 2Z8LA 1VQ6A 3QOLA 4ALPA 1ICWA 4KKUA 4JI3L 2NTTA 1N32L 4NXML 3F2UA 1N9WA 1XYIA 1I3QH 3DXJC 4GOPC 4ZUIA 2AWOA 1EYGA 1D6EC 3IL8A 2R93B 3AYHB 2OQKA 3C3LA 2VZAA 3EQLC 4IUQA 1VQ4A 1E2VA 1T9HA 2B39A 3KK7A 1I3QB 4QL5A 1WD0A 1SE4A 2BA1A 4N8FA 4ZKCB 3KFUA 3STBD 2FFKB 1OXXK 4HSVA 4A76A 1MGSA 5CV9A 4ODGA 4BBRG 2VUMG 1OXVA 4AQYQ 2WB1B 2R7ZH 4KHPL 2RHSB 5IODA 2R7FA 4R4QA 2KHIA 3L2PA 1AP0A 2N55A 3UE0A 2X69A 1U5KA 2ZM6Q 4QY7A 1EY4A 1K8AC 1B9MA 5FO8B 3Q23A 1STHA 3I7FA 1DOLA 4X65Q 3CF5A 4L5QA 1PTOD 4A93G 2EPBA 1X65A 4C3JH 5JEAH 5EQ0A 1K8MA 5C4JB 1VQEA 2F0OA 2SOBA 3F2DA 2D5DA 1I4GA 3PQIA 2I0QA 4BA1I 4DR1L 3AEVA 3TS2A 2L5TA 3S15B 4C3JB 3K5NA 1YIJA 4UDUC 4IFDG 3OMGA 3U4ZA 3S9WA 4CBVA 3K7UC 1STYA 4DPGA 1SE2A 3M3YH 5EBCA 3H15A 1QG7A 1SXTA 1Y1WB 1F2MA 4R8NA 4C3IG 1KLUD 1MHWC 4F8MA 3F1ZA 1NMFA 4K8IA 1MI2A 3SGIA 1EOVA 1K83B 1SDFA 1NAPA 1UE6A 4HMIA 4PV1C 4HIMA 4BWGB 3MXNB 4CGYB 4AH6A 3OMCA 3H91A 2Z4IA 3PIOA 1YHQA 1JE4A 3GTLH 4I7ZC 2V1CC 1YNNC 1YNJC 1F9RA 3SEBA 1Z7TA 3AQQA 5ISRA 4EQ5A 2JA7B 3LX0A 1KLGD 5JPMC 3GTLB 1TWHB 5FLXc 3I4MB 2NVQH 1R9TB 4KD4A 1EQQA 2JJQA 1M4VA 1MBYA 2HQLA 2M9VA 1H9RA 1NE3A 4DV1Q 4DV6L 2RCNA 2K14A 2TSSA 1EUJA 4A3GB 3S16B 3S1MH 3I3CA 4LFAL 3HZXA 4M1UB 3B6YA 1BVSA 2B2UC 2BE5D 5I4DA 1O7LA 2AWNA 5IYCH 1U9RA 4V0BA 1V1QA 4X3TA 1DJRD 1A15A 3OPOA 2IWHA 4H02A 2MQHA 4JI7Q 1PMRA 4XQNA 3A8KE 4KJOA 3MXUA 5E7NA 4XT3B 4DUYQ 1VQLA 3W3AA 3L3OC 5C44B 3GTQH 1WCMB 1XJVA 3QG1A 4JV5L 3RZOB 1A63A 3W1BA 2EY1A 3FKIB 3CQZH 1ZEQX 2KHSA 3Q24A 1YJWA 3CD6A 3FHWA 3MWYW 4QIWE 1Q82C 3GTGB 1G291 1LT4D 5AJ3L 1LTAD 4GNXB 2F0MA 1JOOA 2MNAA 1EU4A 4JYAQ 1GO3E 1W6KA 4GLAC 1XX8A 1BR9A 1G8ZD 5IWAQ 1VQHA 3LNNA 4L5TA 4A3MG 4KHVA 1VMCA 4X6AH 1LTRD 1AE3A 1CZGA 1EY6A 1VQAA 5C5LA 1HA6A 3K5OA 1ENCA 1TXYA 3S14H 4DV3L 2B2YA 4RMFA 1WYDA 2IX3A 1VQNA 1PH5A 4DAYA 3HOVG 3OIPA 3SK4A 2E2JH 1K73C 1BF4A 1J5EQ 2F0HA 4NMZA 5FO7B 1TWFH 3S2HB 2UUAL 4MTNA 2ASBA 4ZKBB 3KLWA 1ESFA 4HCSA 3DEPA 1E0BA 1TWFB 2ICEC 1JR0D 1VQPA 1N36L 2OF1A 2UUCL 3HOUG 2QDLA 1EIYB 2SNSA 2A5HA 4LF4Q 1F2ZA 1XPUA 3TRZA 2NN6H 1W2BA 3BDCA 1GKHA 1RTOA 1PV4A 2NVYH 2Y0SE 3HOXB 2LY7A 3SE0A 2PQAB 1RTNA 1P8LA 2XTIA 2N88A 1HRJA 4GOPA 1CA6A 2J4XA 4ZQ3A 5I9OA 3BYYB 4A3EG 2R92H 1EYDA 3WDNA 5IYBH 1K8GA 1FJGL 4MHEA 1BCPB 3MTSA 1FD7D 2JEAI 2IPKD 1V1PB 2JA8H 3PV0A 1SE3A 4FVMA 1EZ8A 4IJLA 1G91A 4DV3Q 4PZ7A 4PQXA 3NK9A 4RGOS 2VQEQ 4JI2L 3D4WA 2RSNA 3NTHA 1QNKA 3U9SA 4XXEA 3OHXC 1LTBD 4NXNL 2K32A 5ELBA 3ICEA 1JB7A 2L4NA 1Y1VH 2D0PA 4UP8A 1DCZA 2O4XA 4LF5L 1P16A 1V1OA 1KXLA 2F0VA 3G7LA 1X6OA 2IHEA 2OEOA 4XYQA 5IYDH 3HEJA 4L5SA 3C2PA 2VS1A 5H1SE 5A2QL 2K7VA 1SFOB 2Y0SG 2WACA 4M8AA 3J81c 2E75C 4HR7B 2GN5A 3CC4A 1GUWA 5JVH3 2R61A 2UU9Q 2F1MA 2DUDA 4FXGC 4A3BG 1Q3LA 2H5XA 1AEXA 3TEHB 1HUMA 5M3MH 3VYSA 4A3JG 1YNJD 4A75A 5C4XB 1X3PA 4R4CA 1HPCA 1AFPA 1TY2A 2JQOA 1Y14B 1PDQA 2L1BA 4HIDA 1YBYA 2PPBC 1HNZQ 2R7DA 2KEEA 1VQBA 4GN5A 3NBHA 3PF4A 2F0PA 3OSOA 3C46A 3U9OA 2K5NA 3HOYB 1H9MA 1BCPC 4O0AA 5J1ZA 1XNQQ 4B3RL 3I4NH 3T13A 1Z6HA 1JWSD 1Q1BA 1EQVA 1QE6A 4A3DG 1F77A 1L0YB 1VQCA 4KI0A 1LM0A 5D65A 4FDBA 1DXMA 1BBXC 5EKLA 4S3SA 3GDEA 3ONAB 1SNCA 5A2QE 2DN8A 3TP5A 2F3VA 5C3EG 3H3VC 4F88A 1Q8KA 1N8RC 4OIJA 4BXXH 3HGBA 5JOBA 4OELB 4DAMA 1JB3A 3PO3G 4WRDA 2YYZA 4APVA 4BY1B 1UEAB 3MEFA 5EBDA 3D8GA 2NVTB 3UI2A 4B08A 3OTOL 1G51A 3NENA 3T1YL 2QA4A 4PNYA 2JA6G 4XYOA 2AQ2B 3VR6A 3CU7A 1EY9A 1PTOH 4LF7Q 5M3FB 1SYFA 2CKZB 5M9OA 2B2UA 4DXGA 4GKKQ 4C3HH 1SNQA 1JWUD 4TQUS 1ML0D 1SNPA 3BVMA 4WJ4A 2XIWA 1RDPD 3TBIB 2YV5A 4A3IG 4YY3L 1RHPA 1TY0A 1SE8A 3S2DH 3HKSA 3G4SA 5BN4A 3I91A 2A68C 1VDZA 2PQEA 2D9UA 4RAUC 2BDNA 3TP8A 4WJ3M 1LO5D 5EKKA 3K59A 1I50H 1JJGA 1LT5D 3BVGA 2HCIA 1I6HB 2FHTA 2AMCB 1H9JA 1CKMA 1EIGA 4B3ML 3CCVA 3GTKH 5M5YH 1JICA 1LABA 4K0KL 1K3RA 4KN7C 2EYHA 3DHQA 5FKAC 3CCSA 3GTKB 3EJIA 2BH8A 1E2WA 5I6YA 1PRTB 2JEBI 4XQQA 5DLQE 4JI0L 2LXKA 1Q90A 3N6RA 2KQ3A 3IRBA 2F03A 1JJCB 4G7OC 1ASZA 4KMUC 5K36G 1UEBA 3Q8DA 5IP7G 5ELOA 3MXPA 4BBRB 2K1BA 3S1NH 1DONA 1LV9A 2K52A 4OO1I 5C3XA 4F7XA 4KLKA 4C2MB 1CUKA 3BDLA 1BQQT 3L9AX 2JA9A 1ET6A 1O7ZA 4YY3Q 5L37A 3C1EA 1B9NA 1GVPA 3G6JB 1B3QA 2ID0A 1S4ZA 4KKSA 1WTOA 3HOWH 4BY7H 1S5CD 2E2HB 1CQFA 1HNWQ 2K5VA 4CDFC 4A93B 3ULPA 3A7AB 5M5XH 4Y7NB 1MJEA 4JI6Q 1HXYD 1IYVA 4DR4L 1Q7YC 4BY7B 1CSQA 2ZT9C 2XRSD 3NE5B 1B50A 5M5WB 2Q2HA 1STGA 4DV2Q 3H0GG 3W5OA 1HNXQ 1JQYD 4DAYB 3KLRA 3CCLA 2XSCA 1PVOA 2NB0A 4Y52H 3HKZE 1JMCA 1IHZA 1T5XD 4HSPA 3GP7A 3QWNA 4X3KA 2QW7A 1PZID 4JW0A 4KN4C 3EROA 4ZYSA 4CJ1B 1VQOA 1G2TA 2BH2A 4ZRZA 1EYAA 1FNVA 4CJ2C 4C3IB 2B63H 3EIVA 1GHJA 2C5CA 1IW7C 4LF8L 1TKWB 1A62A 2NYZD 2K05A 2OWOA 4JI8Q 1SRUA 3VA7A 5E4WC 5HGQA 4RH6A 3HOZH 4DN4M 1OXSC 2FMCA 1GM5A 5IGGA 4POGA 2UUBL 1PHJA 1EQRA 1HQRD 1YI2A 1E7ZA 3I72A 2K75A 4K14A 5D14A 3FMCA 1A3TA 3PO2H 4K5XA 3W2DA 2PZWA 1N33Q 2BA0A 5A35A 1BCPD 3JAMi 4IUVA 3FDTA 4GOPB 1FVIA 1LACA 1D2BA 2ZXPA 1EFWA 3J80i 4FF1A 2EXDA 2EJFC 4DR4Q 1EZ6A 4KV6A 4LUOA 2Q2IA 5T1GA 2E2DC 4DR2L 1UE5A 4DNTB 1A3VA 3SXHA 1TS5A 2L55A 1W3SA 3C1FA 1KL9A 3HKZG 2R3ZA 1U0LA 3L7ZC 4OXPA 1Z47A 5JJZA 2NTSA 3E5SA 2IT1A 2XGTA 2B2YC 4LF6Q 4CDEC 1S40A 1C0AA 1ZYRD 3CXCA 4OONA 4Q5VA 5KNBA 1XMQL 3M9BA 1KRTA 1SBBB 2PW7A 2UXBL 2VQFL 1TWGB 1G6PA 4ULLA 2L0CA 5E1FA 2F0UA 1PH3A 4X66L 2UUBQ 3JAML 5IE8A 1HJPA 5C6AA 2NWGA 3I2ZA 1BBWA 3P75A 4DR5L 5JAVA 3T1HL 5J3BA 2A68D 2JSOA 3E6ZX 4A3MB 4DR6L 4DAVA 4XIGS 3J80L 4XDXA 1U4LA 3HRZC 2E8GA 3HOVH 3GTPB 4P74A 2XWJB 3SK5A 3S1QB 1Z9FA 2R93H 1J9OA 2M2LA 1Y69U 4V190 4GN3B 4MNOA 2OCEA 1HFGA 3HOVB 4B3TQ 2C9OA 3NBHB 2MFIA 2K03A 1BNZA 1GXDC 4YHHQ 4L8JA 5FLMG 1WTVA 2NN6I 3RD4A 1TS2A 1YZ6A 2UXDQ 1SNMA 2EVBA 3DWPA 3JAME 3F2BA 4HIKA 3UDFA 4F87A 3HOUB 1E24A 1EY5A 4LF9L 1B8AA 1MSGA 4BBSG 1GHKA 1A6XA 1ILPA 1FR3A 3JC66 1KNAA 4LWCA 3J80E 2C35B 1HA5A 3UE1A 3J7ZC 1XMQQ 4QIWB 3PGZA 1L2FA 2GVAA 2IY5B 1S5ED 3Q0AA 3NQTA 2RA4A 2F3WA 3DM1A 4DV4L 4OO1H 5C4JH 1XXGA 3H6MA 4A3EB 5DEHA 4DXFA 5JJIA 1CZWA 2JP1A 3TQYA 4DR5Q 3S15H 2ALYB 4NDXA 3SHLA 1CFMA 1B4OA 4U68A 4EX5A 5CV4A 1B2TA 1HR0W 3BJUA 4DK3C 4JI3Q 2Z4HA 4GN4B 2QEXA 4AIMA 2TMPA 4NXMQ 1N32Q 1NSNS 1Y1WH 2NZ1D 3HG9A 4CJ0B 1R4PB 2F4VL 3BDOA 2MGSA 4MN3A 1FL0A 3HFZB 1SYDA 3T51B 2Q2UA 2AQ3B 1UAPA 2WINB 1K83H 4K6DA 1YVCA 2JXMB 2F0JA 2F0FA 2RKSA 4DNIA 4DA2A 4ABNA 2NZOA 4YCVA 1BDOA 2EIFA 1Q81C 1HR0L 2EYFA 1GUSA 4RA8A 1IYUA 1KDAA 3PIP3 2E5LL 1IW7D 2BCOA 2E74C 3KBXA 3M4OB 2EYOA 5JJLA 2PZTA 1PRTD 4B3SL 4KHPQ 2JA7H 1XTDA 1STNA 1Y8NB 2MP1A 1KNEA 2Y0SB 2JYOA 2KCTA 4R1JA 5EPKA 5D3DA 4FYDA 1TWHH 5KRUA 3I4MH 2QKIC 3MXGA 4A3JH 1R9TH 4X62L 1QZHA 5IGBA 2G9DA 4O42A 2A69C 4A3BB 2ICIA 4L5RC 1NJIC 4A3GH 3S16H 1IBLL 3KLSX 3CPFA 3HP3A 1TU2B 4ZCKA 4A3JB 1N34L 1RODA 2K01A 3FPUB 4NB3A 4FXKC 1QVCA 1LTID 4ZUJA 1EL0A 4A3CG 3D3RA 2CQOA 4E6IA 4A3KG 3DM3A 2GVBA 2HUGA 4NW2A 4HJ9A 4DR1Q 1G6ZA 3OIQA 1JWMD 4LJZC 4DK0A 4A3DB 4A3LG 1HH2P 4X64L 4QCLA 5C44H 1EOTA 3FP9A 1WCMH 1XPOA 2KA7A 3RZOH 3H94A 4O1NA 3FKIH 2OTJA 3GTGH 5C3EB 1F2YA 2N78A 1NR2A 4POFA 5JJKA 1NNXA 3EA6A 2JA6H 5DM63 3PO3B 4OX9L 4K2LA 3NSWA 1HR0Q 1QB5D 3I4LA 4JBJA 1QJOA 2QCPX 5IP9H 3A74A 1O7IA 1F9SA 2JA6B 4HCEA 4YWLA 2QEJC 1V9PA 1PTOF 2HHHL 4MZ9A 4B3SQ 1K3BC 2F4IA 3NHHA 1RF2D 1ZXTA 2FXQA 2WB1E 4MIUA 2NVXB 4A3FG 2RHQB 2L9HA 2ZTDA 4XTCS 1II3A 3I8ZA 1TQOA 2OXPA 2E2IB 2EY2A 2SEBD 1SYCA 4A3IB 2LXJA 4IOAA 3S2HH 2DNEA 3A55A 3PUZA 3RLOA 4AYBE 4KTAA 1DOMA 4DV6Q 1IKLA 1I94L 4R8IA 1E3PA 4GS3A 4LFAQ 1SNDA 3CMEA 4LFCL 3CW2C 4QUFA 2AUJD 1HZ9A 5FJ8H 1WTWA 4LNQA 3GTJB 2WAQE 1CHQD 2VW9A 1CM9A 4HN7A 4P2CB 1H9SA 2JA5G 2VB2X 5KIXA 2NUCA 2N8NA 1YHAA 2KCMA 2D2CC 1PRTF 3HOXH 3CMAA 4KK7A 4UP9A 2JN4A 4H44C 4KY5A 2DJFC 1PH7A 5IGDA 2Z0SA 3G71A 4QQBX 3ERQA 1PFSA 4JV5Q 5DAUA 3OWEB 1ICFB 4OWXB 1S5BD 1I4RA 4L63B 2WKCA 5AJ3Q 2A8VA 2WB1G 2JE6I 1CHPD 2EYJA 5EJWA 4ME3A 1IBKL 2WKDA 1QVGA 3QR8A 3A54A 5C0XJ 2R7ZG 1RKNA 2SNMA 3H3VH 3CHBD 1EY7A 4NP5A 5ELFA 2MHVA 1SYGA 2EQSA 2F0LA 4KY7A 4AYBG 3J7AV 3PIO3 2VB3X 3D31A 4HIOA 5EKIA 4P72A 2QGQA 1VQJA 1HZBA 2WAQG 4IUNA 2UUAQ 3TP6A 1SJED 4C1NK 4C3JG 5JEAG 1SFOH 3HS0C 4IN3A 1N36Q 3KJOA 2UUCQ 1I4QA 2A74C 2H1EA 1PFBA 4TRDA 4CDCC 5IIFA 4RFBA 5C4XH 4J1MA 5DM73 2F0EA 2Z6BA 4OEMB 3SR1A 2EJGC 4IALA 1X3FA 1YNND 4DF7A 3IFTA 2VY3A 3U4VA 3NTKA 3MA2B 4GLVB 1MKHA 4CKCA 3P1HA 1RD9D 3GQBA 3HOYH 3G6EA 1FJGQ 1VQKA 2EJMA 1CKOA 2KEDA 3K5LA 1HZCA 1VQIA 2XRQD 4ME5A 4JK1C 1WFQA 3WWVA 2QDBA 4OGQC 1LTTD 1BO0A 3LGJA 4UY8C 2A6EC 4RKBA 1EWCA 2H4OA 2CW0C 3OW2A 1HUNA 3MFYA 1A8VA 4RHRA 1M90C 4JI2Q 4N9TA 4P71A 4BY1H 4LFBL 2RVLA 3RUZA 2I5HA 2NVTH 3M4QA 2ATWA 3V05A 4NXNQ 2HIXA 4NPSA 4JI1L 4IFDJ 5EPLA 4LF5Q 3KUPA 5KYIA 1Q1EA 3VA5A 4EQPA 5M3FH 1U4PA 4RGNA 3X3NA 4PZ8A
chains in the Genus database with same CATH topology
3G48A 1A62A 3I7FA 1SMXA 5IYCG 2OWOA 2A1AA 1FGUA 1SRUA 1VQFA 4JI8Q 4X65Q 1Q12A 3CF5A 4L5QA 4X64Q 2VQEL 5HGQA 3HOZH 4A93G 4JBKA 1OXSC 1SLJA 5IY0A 1GM5A 4POGA 2UUBL 3J81j 2PMZE 2R93G 1PHJA 1EQRA 1X65A 4C3JH 1YI2A 1E7ZA 4IJHA 2K75A 3CCUA 1VQEA 3F2DA 2HIVA 4OX9Q 5LMUL 3PO2H 3TS0A 2I0QA 4BA1I 5IP7H 4DR1L 2OTLA 3AEVA 1N33Q 2BA0A 3TS2A 1VQ9A 1S72A 4DUZL 5BR8L 3JAMi 4GOPB 1YIJA 1FVIA 4IFDG 3DLLA 3S1RH 3U4ZA 2HHHQ 1VQMA 3K7UC 4DPGA 1KRSA 4TVAB 1EFWA 3M3YH 1I6HH 3H15A 4UP7A 3J80i 3KOJA 1H95A 1AE2A 1XPRA 2EXDA 4OWTB 2DGYA 4PG3A 4DR4Q 4LUOA 2Q2IA 4DR2L 1UE5A 3TREA 2UU9L 4B3RQ 3GD7A 1OXUA 3F1ZA 1NMFA 1IZ6A 1W3SA 3PF5A 3SGIA 1KL9A 3HKZG 4J15A 4IPCA 1EOVA 1U0LA 3L7ZC 4IFDI 4OXPA 1Z47A 2YTVA 2IT1A 2XGTA 1UE6A 4HIMA 4LF6Q 4LFBQ 3AFPA 1HNZL 1MIUA 3MXNB 4GNXC 1PA6A 1I94Q 2VNUD 3UDIA 4AH6A 4JI4L 1S40A 4IOCA 1C0AA 3CXCA 4OONA 3PIOA 1YHQA 4DV5Q 4LFCQ 1XNRQ 3GTLH 4OO1G 2V1CC 2MO1A 1XMQL 3M9BA 1XNQL 3H0GH 1KRTA 3AQQA 4BBRH 4EQ5A 1NY4A 2VUMH 5IT9c 2UXBL 2AHOB 2VQFL 3OTOQ 3T1YQ 4JOIC 4C2MH 1GD7A 3PUVA 5FLXc 1PH8A 2NVQH 1G6PA 1EQQA 1NBWA 2JJQA 2HQLA 1PH3A 4X66L 2A19A 4DV6L 1NE3A 4DV1Q 4DKAC 1KIXA 2RCNA 2K14A 3A5ZB 5IE8A 1HJPA 1EUJA 2UUBQ 3KF6B 3S1MH 3I2ZA 2B29A 1BBWA 1L0WA 3T1HL 4DR5L 4JCVE 1Y1WG 5J3BA 1PH4A 4LFAL 3B6YA 1BVSA 4DR6L 1BBUA 2AWNA 5IYCH 3STBC 4XIGS 1C7YA 1V1QA 4DV0L 5LMUQ 2E2HH 3HOVH 2E8GA 4A93H 4GLXA 3F8TA 4P74A 3RNUA 1I5FA 1K9MC 1Z9FA 4Y7NH 4DUZQ 3GTOH 3S17H 2R93H 1S3OA 2JK8A 3BU2A 4GN3B 4MNOA 4LF7L 1E1OA 2OCEA 4H02A 2MQHA 1E1TA 4JI7Q 4UPAA 3E9IA 4B3TQ 2WFWA 1M1KC 1IBKQ 2AKWB 3NBHB 2MFIA 5E7NA 4GKKL 2N49A 4YCUA 1PH6A 5M5WH 4DUYQ 3W1GA 2R92G 3JAMc 3A0JA 5IYBG 4YHHQ 5FLMG 1VQLA 3GTQH 2UXCL 1XJVA 2JA7G 3EBEA 2NN6I 4JV5L 1KAWA 3W1BA 1A63A 2K5HA 3CQZH 1YJWA 3CD6A 2JA8G 3I4MG 3FHWA 4QIWE 1Q82C 1YZ6A 2UXDQ 1G291 5AJ3L 3J80c 4B3MQ 1PH9A 4GNXB 2MNAA 4C3IH 3GTMH 4JYAQ 1GO3E 4DR7L 4K0KQ 4GLAC 4A3GG 1E22A 3F2BA 4HIKA 4P75A 3UDFA 1VQHA 1E24A 4JG2A 1CSPA 4L5TA 5IWAQ 4LF9L 1B8AA 4A3MG 4BBSG 3RLNA 1UE1A 3JC66 4X6AH 1AE3A 4LWCA 2C35B 1VQAA 2F3IA 3UE1A 3J7ZC 1XMQQ 2K4KA 3PUXA 5GAHC 4WJ4A 3PGZA 4JI0Q 1L2FA 2GVAA 2IY5B 3CAMA 1QUQA 1TXYA 1Y1VG 3S14H 4DV3L 1DGSA 4RMFA 1WYDA 4DV4L 5EAYA 1VQNA 5C4JH 1PH5A 1YJ9A 3HOVG 3VDYA 5JJIA 2E2JH 1XMOL 1K73C 4QGUA 5IYDG 1J5EQ 4DK6C 3CPWA 1TWCH 3TQYA 4DR5Q 1PH1A 1KC8C 2ALYB 3S15H 5C44G 1TWFH 1WCMG 1UE7A 3I55A 1IBML 1OTCA 2UUAL 3FKIG 4MTNA 4EX5A 2ASBA 3M85A 1HR0W 3CCRA 3BJUA 4DK3C 3J81i 3KLWA 4JI3Q 1KD1C 1V43A 4GN4B 1TWAH 4AIMA 2QEXA 4NXMQ 3CP0A 2YU9H 1N32Q 1Y1WH 1JE5A 3PUYA 2I5LX 3OYYA 1VQPA 1N36L 5M3MG 2UUCL 1L1OB 3HOUG 5IP9G 1EIYB 4PZ6A 2F4VL 4LF4Q 1XPUA 1B70B 1MJCA 4R4OA 3I56A 1FL0A 3HFZB 3TRZA 1X55A 1WI5A 1IYJB 3BZKA 1IXRA 1GKHA 4JBWA 1W2BA 1YJNA 1PV4A 2Q2UA 1K83H 2NVYH 2Y0SE 4OWWB 1YVCA 1Q46A 4DNIA 1LYLA 4DV7L 2NZOA 4YCVA 2EIFA 1Q81C 2PQAB 4O2DA 1HR0L 1D7QA 1P8LA 2PNHA 2XTIA 2I5MX 4GOPA 3I4NG 1LTLA 3UDGA 4A3EG 2E5LL 3ER0A 2R92H 5IYBH 5JJLA 1NMGA 5FLMH 4B3SL 1HNWL 4KHPQ 2JA7H 2VL6A 1XTDA 1K8GA 1FJGL 4JI6L 1TWGH 2NZHA 2KCTA 3RN5A 1J6QA 1VQGA 4R1JA 2Z6KC 2JA8H 1TWHH 2PI2E 4JI1Q 2JEAI 3I4MH 4A3JH 3S24A 3CC7A 1R9TH 2YTYA 4X62L 1QZHA 3PV0A 3CCMA 1YEZA 4LF8Q 2R6GA 4BXXG 4L5RC 1NJIC 4IJLA 4A3GH 3S16H 1IBLL 1EIFA 2L15A 5GADC 4PZ7A 4DV3Q 3CPFA 4DV2L 5FJ8G 4A3MH 1N34L 2VQEQ 1HNXL 4BBSH 4JI2L 2LSSA 4NB3A 4AQYL 1QVCA 1HZAA 4IPGA 3RN2A 2VUMG 3GTPH 4P73A 4DR3L 1X56A 1X3EA 4NXNL 3S1QH 4A3CG 1YNXA 3ICEA 1JB7A 1Y1VH 1IBMQ 2CQOA 2D0PA 4UP8A 1SN8A 2ZM6L 4HJAA 3DM3A 3HOXG 3E9HA 2GVBA 4A3KG 1Q86C 4LF5L 1P16A 5LMNW 1VCIA 3K0XA 4HJ9A 2NN6G 4DR1Q 1KXLA 4JI5L 3L0OA 1X6OA 2IHEA 4JI8L 5BR8Q 4A3LG 4Y52H 4X65L 5IYDH 1C9OA 3GO5A 1HH2P 4X64L 5C44H 3FP9A 2CCZA 1WCMH 1NTGA 5GROA 1XPOA 4L5SA 3RZOH 2VS1A 3FKIH 5H1SE 2Y0SG 2OTJA 1SR3A 3KF6A 1VQ5A 3GTGH 3J81c 2N78A 5GAGC 2OQ0A 1L1OC 4POFA 2GN5A 5JJKA 2JA6H 5GAEC 3CC4A 2ZJQA 3K80C 3NELA 4DR2Q 3KDFB 2UU9Q 2DUDA 3U50C 2D62A 3M7NA 4A3BG 4OX9L 2H5XA 5LMNL 3TEHB 1VQ7A 5M3MH 1HR0Q 1N33L 2KHJA 4JBJA 3HOUH 4A3JG 5IP9H 4A75A 3A74A 1O7IA 4R4CA 4YWLA 2JQOA 1V9PA 1Y14B 2HHHL 4HIDA 4MZ9A 1YBYA 4B3SQ 1HNZQ 2R7DA 1JT8A 3CCQA 3CC2A 4JI4Q 4BA2I 1VQBA 2FXQA 3CCEA 4GN5A 2WB1E 1PH2A 4A3FG 3PF4A 2RHQB 3ERSX 3PCOB 2IX1A 2YTXA 1CKNB 1PYSB 2K5NA 2ZTDA 4XTCS 1A0IA 4O0AA 1XNQQ 4B3RL 3I4NH 4A3EH 1QZGA 2UXBQ 1KHIA 1Q1BA 2VQFQ 4HJ7A 4A3DG 3H3VI 2K50A 2LXJA 1VQCA 4KI0A 1LM0A 4R4IA 4IOAA 3S2HH 4GNXA 4FDBA 3PUZA 3GDEA 3RLOA 3RR5A 4AYBE 4X66Q 4LF6L 3K81C 4DV6Q 2Z6KA 1I94L 5C3EG 4DR3Q 1E3PA 1Q8KA 1N8RC 4GS3A 5ELNA 5HY6A 3T1HQ 2WP8J 4LFAQ 3CMEA 1VQ8A 4LFCL 4BXXH 2CWPA 3CW2C 4DAMA 4DR6Q 3PO3G 2YYZA 4APVA 3MEFA 4JOIA 1HZ9A 4YWMA 5FJ8H 2MO0A 4LW1A 4DV0Q 1YITA 4LNQA 2WAQE 3PSIA 3M4PA 3A5UA 3OTOL 2VW9A 1G51A 3NENA 3T1YL 4JI5Q 2QA4A 5C4XG 2JA6G 1IL2A 2JA5G 4LF7Q 4A3CH 1X54A 2F52A 2N8NA 1YHAA 2KCMA 3E0EA 4DV1L 1BKBA 2CKZB 3HOXH 3CMAA 4A3KH 4UP9A 2ES2A 3HOWG 4GKKQ 4C3HH 1PH7A 3AFQA 3HOYG 2Z0SA 4TQUS 4YWKA 4BY7G 2ZTEA 3G71A 1X9NA 4QQBX 4A3LH 2UXCQ 1KQSA 1PFSA 2CWAA 3UDXA 4KHZA 4JV5Q 1WOCA 1X3GA 3M4OH 5LMNQ 1YHBA 2YV5A 4OWXB 4A4IA 4A3IG 4YY3L 2IX0A 1ASYA 5AJ3Q 2A8VA 1SE8A 1LUZA 3S2DH 3HKSA 3G4SA 2WB1G 2JE6I 2D0OA 4JI7L 4DR7Q 5JEAJ 3J7A5 4B3TL 1L1OA 4GKJL 4ME3A 1IBKL 4A3BH 4WJ3M 1JJ2A 1K0RA 1RIPA 2KENA 3PIPA 1QVGA 4LF9Q 4DUYL 5C0XJ 4BY1G 4YHHL 1UWVA 2R7ZG 3H3VH 1I50H 1RL2A 1JJGA 3ULJA 3NEMA 1OXTA 2AMCB 2EQSA 2PQAA 4AYBG 4R4TA 2UXDL 1CKMA 2RF4A 4PMWA 4B3ML 3CCVA 2B63G 4DV4Q 3D0FA 4A3FH 3GTKH 5M5YH 5M3FG 3BZCA 4HJ5A 1AH9A 1QVFA 3D31A 4YCWA 4JYAL 4HIOA 3K7AH 4K0KL 3KYHC 4IPHA 4QJFA 1K3RA 1EWIA 4P72A 3RLFA 3F2CA 2QGQA 1XMOQ 5IWAL 1VQJA 1HZBA 2WAQG 3CCSA 4A3DH 3HOZG 3ULLA 2IHFA 2BH8A 2JEBI 3KJPA 2UUAQ 5DLQE 4LUVA 4RG1A 4JI0L 3PUWA 2LXKA 5JEAG 1SFOH 3IRBA 5C3EH 1JJCB 1WJJA 1ASZA 5K36G 1UEBA 2ZJRA 1N36Q 3PO2G 3Q8DA 5C0XG 5IP7G 5ELOA 3KJOA 2UUCQ 3PO3H 3S1NH 2K52A 3RZDH 2PI2A 2F4VQ 4OO1I 4KLKA 1J5EL 1PYBA 2N3SA 2ZTCA 1CUKA 5C4XH 2B3GA 3EN2A 1VQDA 3ZJYC 2JA5H 1B7YB 1D8LA 2HT1A 2JA9A 2CFMA 4DV7Q 4IO9A 1VQ6A 5GQOA 4YY3Q 4ALPA 2KBNA 4JI3L 3CCJA 1GVPA 1X3FA 3KF8B 2VY3A 2NVXH 3U4VA 4NXML 1N32L 4GLVB 2ID0A 1MKHA 5C0XI 3HOWH 2E5LQ 3HOYH 4BY7H 1N9WA 3G6EA 2ZJPA 1I3QH 4GOPC 1HNWQ 1SROA 2AWOA 2K5VA 3ULPA 4GKJQ 1FJGQ 1VQKA 5M5XH 1EYGA 2E2IH 1MJEA 4JI6Q 4LF4L 3AYHB 1CKOA 4JC0A 2OQKA 4A3IH 3K8AA 1HZCA 1VQIA 2VZAA 4LUZA 1VQ4A 1Q7YC 4DR4L 1T9HA 1WFQA 3WWVA 4X62Q 4QL5A 1CSQA 3KDFA 4HJ8A 3LGJA 4UY8C 2BA1A 1QUQB 3KFUA 3OW2A 1IBLQ 3STBD 1OXXK 2Q2HA 4A76A 4DV2Q 3H0GG 3W5OA 1HNXQ 1A8VA 4BBRG 1N34Q 4DAYB 1M90C 4JI2Q 4P71A 1OXVA 4AQYQ 3U58A 3CCLA 3HKZE 1JMCA 4BY1H 2R7ZH 4LFBL 1PVOA 4JBMA 2I5HA 4IPDA 3I4OA 3GTJH 2NVTH 3M4QA 4KHPL 2ATWA 2RHSB 2R7FA 4R4QA 2KHIA 1VQOA 3L2PA 4NXNQ 2BH2A 2HIXA 4NPSA 4DV5L 4JI1L 1XNRL 2Q2TA 4IFDJ 3UE0A 1U5KA 2ZM6Q 1CKNA 2B63H 1VS0A 4QY7A 4LF5Q 1Q1EA 3EIVA 5M3FH 4LF8L 1K8AC 4PZ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G48 A;  1A62 A;  3I7F A;  1SMX A;  5IYC G;  2OWO A;  2A1A A;  1FGU A;  1SRU A;  1VQF A;  4JI8 Q;  4X65 Q;  1Q12 A;  3CF5 A;  4L5Q A;  4X64 Q;  2VQE L;  5HGQ A;  3HOZ H;  4A93 G;  4JBK A;  1OXS C;  1SLJ A;  5IY0 A;  1GM5 A;  4POG A;  2UUB L;  3J81 j;  2PMZ E;  2R93 G;  1PHJ A;  1EQR A;  1X65 A;  4C3J H;  1YI2 A;  1E7Z A;  4IJH A;  2K75 A;  3CCU A;  1VQE A;  3F2D A;  2HIV A;  4OX9 Q;  5LMU L;  3PO2 H;  3TS0 A;  2I0Q A;  4BA1 I;  5IP7 H;  4DR1 L;  2OTL A;  3AEV A;  1N33 Q;  2BA0 A;  3TS2 A;  1VQ9 A;  1S72 A;  4DUZ L;  5BR8 L;  3JAM i;  4GOP B;  1YIJ A;  1FVI A;  4IFD G;  3DLL A;  3S1R H;  3U4Z A;  2HHH Q;  1VQM A;  3K7U C;  4DPG A;  1KRS A;  4TVA B;  1EFW A;  3M3Y H;  1I6H H;  3H15 A;  4UP7 A;  3J80 i;  3KOJ A;  1H95 A;  1AE2 A;  1XPR A;  2EXD A;  4OWT B;  2DGY A;  4PG3 A;  4DR4 Q;  4LUO A;  2Q2I A;  4DR2 L;  1UE5 A;  3TRE A;  2UU9 L;  4B3R Q;  3GD7 A;  1OXU A;  3F1Z A;  1NMF A;  1IZ6 A;  1W3S A;  3PF5 A;  3SGI A;  1KL9 A;  3HKZ G;  4J15 A;  4IPC A;  1EOV A;  1U0L A;  3L7Z C;  4IFD I;  4OXP A;  1Z47 A;  2YTV A;  2IT1 A;  2XGT A;  1UE6 A;  4HIM A;  4LF6 Q;  4LFB Q;  3AFP A;  1HNZ L;  1MIU A;  3MXN B;  4GNX C;  1PA6 A;  1I94 Q;  2VNU D;  3UDI A;  4AH6 A;  4JI4 L;  1S40 A;  4IOC A;  1C0A A;  3CXC A;  4OON A;  3PIO A;  1YHQ A;  4DV5 Q;  4LFC Q;  1XNR Q;  3GTL H;  4OO1 G;  2V1C C;  2MO1 A;  1XMQ L;  3M9B A;  1XNQ L;  3H0G H;  1KRT A;  3AQQ A;  4BBR H;  4EQ5 A;  1NY4 A;  2VUM H;  5IT9 c;  2UXB L;  2AHO B;  2VQF L;  3OTO Q;  3T1Y Q;  4JOI C;  4C2M H;  1GD7 A;  3PUV A;  5FLX c;  1PH8 A;  2NVQ H;  1G6P A;  1EQQ A;  1NBW A;  2JJQ A;  2HQL A;  1PH3 A;  4X66 L;  2A19 A;  4DV6 L;  1NE3 A;  4DV1 Q;  4DKA C;  1KIX A;  2RCN A;  2K14 A;  3A5Z B;  5IE8 A;  1HJP A;  1EUJ A;  2UUB Q;  3KF6 B;  3S1M H;  3I2Z A;  2B29 A;  1BBW A;  1L0W A;  3T1H L;  4DR5 L;  4JCV E;  1Y1W G;  5J3B A;  1PH4 A;  4LFA L;  3B6Y A;  1BVS A;  4DR6 L;  1BBU A;  2AWN A;  5IYC H;  3STB C;  4XIG S;  1C7Y A;  1V1Q A;  4DV0 L;  5LMU Q;  2E2H H;  3HOV H;  2E8G A;  4A93 H;  4GLX A;  3F8T A;  4P74 A;  3RNU A;  1I5F A;  1K9M C;  1Z9F A;  4Y7N H;  4DUZ Q;  3GTO H;  3S17 H;  2R93 H;  1S3O A;  2JK8 A;  3BU2 A;  4GN3 B;  4MNO A;  4LF7 L;  1E1O A;  2OCE A;  4H02 A;  2MQH A;  1E1T A;  4JI7 Q;  4UPA A;  3E9I A;  4B3T Q;  2WFW A;  1M1K C;  1IBK Q;  2AKW B;  3NBH B;  2MFI A;  5E7N A;  4GKK L;  2N49 A;  4YCU A;  1PH6 A;  5M5W H;  4DUY Q;  3W1G A;  2R92 G;  3JAM c;  3A0J A;  5IYB G;  4YHH Q;  5FLM G;  1VQL A;  3GTQ H;  2UXC L;  1XJV A;  2JA7 G;  3EBE A;  2NN6 I;  4JV5 L;  1KAW A;  3W1B A;  1A63 A;  2K5H A;  3CQZ H;  1YJW A;  3CD6 A;  2JA8 G;  3I4M G;  3FHW A;  4QIW E;  1Q82 C;  1YZ6 A;  2UXD Q;  1G29 1;  5AJ3 L;  3J80 c;  4B3M Q;  1PH9 A;  4GNX B;  2MNA A;  4C3I H;  3GTM H;  4JYA Q;  1GO3 E;  4DR7 L;  4K0K Q;  4GLA C;  4A3G G;  1E22 A;  3F2B A;  4HIK A;  4P75 A;  3UDF A;  1VQH A;  1E24 A;  4JG2 A;  1CSP A;  4L5T A;  5IWA Q;  4LF9 L;  1B8A A;  4A3M G;  4BBS G;  3RLN A;  1UE1 A;  3JC6 6;  4X6A H;  1AE3 A;  4LWC A;  2C35 B;  1VQA A;  2F3I A;  3UE1 A;  3J7Z C;  1XMQ Q;  2K4K A;  3PUX A;  5GAH C;  4WJ4 A;  3PGZ A;  4JI0 Q;  1L2F A;  2GVA A;  2IY5 B;  3CAM A;  1QUQ A;  1TXY A;  1Y1V G;  3S14 H;  4DV3 L;  1DGS A;  4RMF A;  1WYD A;  4DV4 L;  5EAY A;  1VQN A;  5C4J H;  1PH5 A;  1YJ9 A;  3HOV G;  3VDY A;  5JJI A;  2E2J H;  1XMO L;  1K73 C;  4QGU A;  5IYD G;  1J5E Q;  4DK6 C;  3CPW A;  1TWC H;  3TQY A;  4DR5 Q;  1PH1 A;  1KC8 C;  2ALY B;  3S15 H;  5C44 G;  1TWF H;  1WCM G;  1UE7 A;  3I55 A;  1IBM L;  1OTC A;  2UUA L;  3FKI G;  4MTN A;  4EX5 A;  2ASB A;  3M85 A;  1HR0 W;  3CCR A;  3BJU A;  4DK3 C;  3J81 i;  3KLW A;  4JI3 Q;  1KD1 C;  1V43 A;  4GN4 B;  1TWA H;  4AIM A;  2QEX A;  4NXM Q;  3CP0 A;  2YU9 H;  1N32 Q;  1Y1W H;  1JE5 A;  3PUY A;  2I5L X;  3OYY A;  1VQP A;  1N36 L;  5M3M G;  2UUC L;  1L1O B;  3HOU G;  5IP9 G;  1EIY B;  4PZ6 A;  2F4V L;  4LF4 Q;  1XPU A;  1B70 B;  1MJC A;  4R4O A;  3I56 A;  1FL0 A;  3HFZ B;  3TRZ A;  1X55 A;  1WI5 A;  1IYJ B;  3BZK A;  1IXR A;  1GKH A;  4JBW A;  1W2B A;  1YJN A;  1PV4 A;  2Q2U A;  1K83 H;  2NVY H;  2Y0S E;  4OWW B;  1YVC A;  1Q46 A;  4DNI A;  1LYL A;  4DV7 L;  2NZO A;  4YCV A;  2EIF A;  1Q81 C;  2PQA B;  4O2D A;  1HR0 L;  1D7Q A;  1P8L A;  2PNH A;  2XTI A;  2I5M X;  4GOP A;  3I4N G;  1LTL A;  3UDG A;  4A3E G;  2E5L L;  3ER0 A;  2R92 H;  5IYB H;  5JJL A;  1NMG A;  5FLM H;  4B3S L;  1HNW L;  4KHP Q;  2JA7 H;  2VL6 A;  1XTD A;  1K8G A;  1FJG L;  4JI6 L;  1TWG H;  2NZH A;  2KCT A;  3RN5 A;  1J6Q A;  1VQG A;  4R1J A;  2Z6K C;  2JA8 H;  1TWH H;  2PI2 E;  4JI1 Q;  2JEA I;  3I4M H;  4A3J H;  3S24 A;  3CC7 A;  1R9T H;  2YTY A;  4X62 L;  1QZH A;  3PV0 A;  3CCM A;  1YEZ A;  4LF8 Q;  2R6G A;  4BXX G;  4L5R C;  1NJI C;  4IJL A;  4A3G H;  3S16 H;  1IBL L;  1EIF A;  2L15 A;  5GAD C;  4PZ7 A;  4DV3 Q;  3CPF A;  4DV2 L;  5FJ8 G;  4A3M H;  1N34 L;  2VQE Q;  1HNX L;  4BBS H;  4JI2 L;  2LSS A;  4NB3 A;  4AQY L;  1QVC A;  1HZA A;  4IPG A;  3RN2 A;  2VUM G;  3GTP H;  4P73 A;  4DR3 L;  1X56 A;  1X3E A;  4NXN L;  3S1Q H;  4A3C G;  1YNX A;  3ICE A;  1JB7 A;  1Y1V H;  1IBM Q;  2CQO A;  2D0P A;  4UP8 A;  1SN8 A;  2ZM6 L;  4HJA A;  3DM3 A;  3HOX G;  3E9H A;  2GVB A;  4A3K G;  1Q86 C;  4LF5 L;  1P16 A;  5LMN W;  1VCI A;  3K0X A;  4HJ9 A;  2NN6 G;  4DR1 Q;  1KXL A;  4JI5 L;  3L0O A;  1X6O A;  2IHE A;  4JI8 L;  5BR8 Q;  4A3L G;  4Y52 H;  4X65 L;  5IYD H;  1C9O A;  3GO5 A;  1HH2 P;  4X64 L;  5C44 H;  3FP9 A;  2CCZ A;  1WCM H;  1NTG A;  5GRO A;  1XPO A;  4L5S A;  3RZO H;  2VS1 A;  3FKI H;  5H1S E;  2Y0S G;  2OTJ A;  1SR3 A;  3KF6 A;  1VQ5 A;  3GTG H;  3J81 c;  2N78 A;  5GAG C;  2OQ0 A;  1L1O C;  4POF A;  2GN5 A;  5JJK A;  2JA6 H;  5GAE C;  3CC4 A;  2ZJQ A;  3K80 C;  3NEL A;  4DR2 Q;  3KDF B;  2UU9 Q;  2DUD A;  3U50 C;  2D62 A;  3M7N A;  4A3B G;  4OX9 L;  2H5X A;  5LMN L;  3TEH B;  1VQ7 A;  5M3M H;  1HR0 Q;  1N33 L;  2KHJ A;  4JBJ A;  3HOU H;  4A3J G;  5IP9 H;  4A75 A;  3A74 A;  1O7I A;  4R4C A;  4YWL A;  2JQO A;  1V9P A;  1Y14 B;  2HHH L;  4HID A;  4MZ9 A;  1YBY A;  4B3S Q;  1HNZ Q;  2R7D A;  1JT8 A;  3CCQ A;  3CC2 A;  4JI4 Q;  4BA2 I;  1VQB A;  2FXQ A;  3CCE A;  4GN5 A;  2WB1 E;  1PH2 A;  4A3F G;  3PF4 A;  2RHQ B;  3ERS X;  3PCO B;  2IX1 A;  2YTX A;  1CKN B;  1PYS B;  2K5N A;  2ZTD A;  4XTC S;  1A0I A;  4O0A A;  1XNQ Q;  4B3R L;  3I4N H;  4A3E H;  1QZG A;  2UXB Q;  1KHI A;  1Q1B A;  2VQF Q;  4HJ7 A;  4A3D G;  3H3V I;  2K50 A;  2LXJ A;  1VQC A;  4KI0 A;  1LM0 A;  4R4I A;  4IOA A;  3S2H H;  4GNX A;  4FDB A;  3PUZ A;  3GDE A;  3RLO A;  3RR5 A;  4AYB E;  4X66 Q;  4LF6 L;  3K81 C;  4DV6 Q;  2Z6K A;  1I94 L;  5C3E G;  4DR3 Q;  1E3P A;  1Q8K A;  1N8R C;  4GS3 A;  5ELN A;  5HY6 A;  3T1H Q;  2WP8 J;  4LFA Q;  3CME A;  1VQ8 A;  4LFC L;  4BXX H;  2CWP A;  3CW2 C;  4DAM A;  4DR6 Q;  3PO3 G;  2YYZ A;  4APV A;  3MEF A;  4JOI A;  1HZ9 A;  4YWM A;  5FJ8 H;  2MO0 A;  4LW1 A;  4DV0 Q;  1YIT A;  4LNQ A;  2WAQ E;  3PSI A;  3M4P A;  3A5U A;  3OTO L;  2VW9 A;  1G51 A;  3NEN A;  3T1Y L;  4JI5 Q;  2QA4 A;  5C4X G;  2JA6 G;  1IL2 A;  2JA5 G;  4LF7 Q;  4A3C H;  1X54 A;  2F52 A;  2N8N A;  1YHA A;  2KCM A;  3E0E A;  4DV1 L;  1BKB A;  2CKZ B;  3HOX H;  3CMA A;  4A3K H;  4UP9 A;  2ES2 A;  3HOW G;  4GKK Q;  4C3H H;  1PH7 A;  3AFQ A;  3HOY G;  2Z0S A;  4TQU S;  4YWK A;  4BY7 G;  2ZTE A;  3G71 A;  1X9N A;  4QQB X;  4A3L H;  2UXC Q;  1KQS A;  1PFS A;  2CWA A;  3UDX A;  4KHZ A;  4JV5 Q;  1WOC A;  1X3G A;  3M4O H;  5LMN Q;  1YHB A;  2YV5 A;  4OWX B;  4A4I A;  4A3I G;  4YY3 L;  2IX0 A;  1ASY A;  5AJ3 Q;  2A8V A;  1SE8 A;  1LUZ A;  3S2D H;  3HKS A;  3G4S A;  2WB1 G;  2JE6 I;  2D0O A;  4JI7 L;  4DR7 Q;  5JEA J;  3J7A 5;  4B3T L;  1L1O A;  4GKJ L;  4ME3 A;  1IBK L;  4A3B H;  4WJ3 M;  1JJ2 A;  1K0R A;  1RIP A;  2KEN A;  3PIP A;  1QVG A;  4LF9 Q;  4DUY L;  5C0X J;  4BY1 G;  4YHH L;  1UWV A;  2R7Z G;  3H3V H;  1I50 H;  1RL2 A;  1JJG A;  3ULJ A;  3NEM A;  1OXT A;  2AMC B;  2EQS A;  2PQA A;  4AYB G;  4R4T A;  2UXD L;  1CKM A;  2RF4 A;  4PMW A;  4B3M L;  3CCV A;  2B63 G;  4DV4 Q;  3D0F A;  4A3F H;  3GTK H;  5M5Y H;  5M3F G;  3BZC A;  4HJ5 A;  1AH9 A;  1QVF A;  3D31 A;  4YCW A;  4JYA L;  4HIO A;  3K7A H;  4K0K L;  3KYH C;  4IPH A;  4QJF A;  1K3R A;  1EWI A;  4P72 A;  3RLF A;  3F2C A;  2QGQ A;  1XMO Q;  5IWA L;  1VQJ A;  1HZB A;  2WAQ G;  3CCS A;  4A3D H;  3HOZ G;  3ULL A;  2IHF A;  2BH8 A;  2JEB I;  3KJP A;  2UUA Q;  5DLQ E;  4LUV A;  4RG1 A;  4JI0 L;  3PUW A;  2LXK A;  5JEA G;  1SFO H;  3IRB A;  5C3E H;  1JJC B;  1WJJ A;  1ASZ A;  5K36 G;  1UEB A;  2ZJR A;  1N36 Q;  3PO2 G;  3Q8D A;  5C0X G;  5IP7 G;  5ELO A;  3KJO A;  2UUC Q;  3PO3 H;  3S1N H;  2K52 A;  3RZD H;  2PI2 A;  2F4V Q;  4OO1 I;  4KLK A;  1J5E L;  1PYB A;  2N3S A;  2ZTC A;  1CUK A;  5C4X H;  2B3G A;  3EN2 A;  1VQD A;  3ZJY C;  2JA5 H;  1B7Y B;  1D8L A;  2HT1 A;  2JA9 A;  2CFM A;  4DV7 Q;  4IO9 A;  1VQ6 A;  5GQO A;  4YY3 Q;  4ALP A;  2KBN A;  4JI3 L;  3CCJ A;  1GVP A;  1X3F A;  3KF8 B;  2VY3 A;  2NVX H;  3U4V A;  4NXM L;  1N32 L;  4GLV B;  2ID0 A;  1MKH A;  5C0X I;  3HOW H;  2E5L Q;  3HOY H;  4BY7 H;  1N9W A;  3G6E A;  2ZJP A;  1I3Q H;  4GOP C;  1HNW Q;  1SRO A;  2AWO A;  2K5V A;  3ULP A;  4GKJ Q;  1FJG Q;  1VQK A;  5M5X H;  1EYG A;  2E2I H;  1MJE A;  4JI6 Q;  4LF4 L;  3AYH B;  1CKO A;  4JC0 A;  2OQK A;  4A3I H;  3K8A A;  1HZC A;  1VQI A;  2VZA A;  4LUZ A;  1VQ4 A;  1Q7Y C;  4DR4 L;  1T9H A;  1WFQ A;  3WWV A;  4X62 Q;  4QL5 A;  1CSQ A;  3KDF A;  4HJ8 A;  3LGJ A;  4UY8 C;  2BA1 A;  1QUQ B;  3KFU A;  3OW2 A;  1IBL Q;  3STB D;  1OXX K;  2Q2H A;  4A76 A;  4DV2 Q;  3H0G G;  3W5O A;  1HNX Q;  1A8V A;  4BBR G;  1N34 Q;  4DAY B;  1M90 C;  4JI2 Q;  4P71 A;  1OXV A;  4AQY Q;  3U58 A;  3CCL A;  3HKZ E;  1JMC A;  4BY1 H;  2R7Z H;  4LFB L;  1PVO A;  4JBM A;  2I5H A;  4IPD A;  3I4O A;  3GTJ H;  2NVT H;  3M4Q A;  4KHP L;  2ATW A;  2RHS B;  2R7F A;  4R4Q A;  2KHI A;  1VQO A;  3L2P A;  4NXN Q;  2BH2 A;  2HIX A;  4NPS A;  4DV5 L;  4JI1 L;  1XNR L;  2Q2T A;  4IFD J;  3UE0 A;  1U5K A;  2ZM6 Q;  1CKN A;  2B63 H;  1VS0 A;  4QY7 A;  4LF5 Q;  1Q1E A;  3EIV A;  5M3F H;  4LF8 L;  1K8A C;  4PZ8 A; 
#chains in the Genus database with same CATH topology
 2ENB A;  1SMX A;  4K6L A;  5IYC G;  3HKZ B;  1VQF A;  1Q12 A;  1BUV T;  4G57 A;  4C56 C;  4JBK A;  1SLJ A;  5IY0 A;  1S5F D;  1ZKO A;  2PMZ E;  3J81 j;  1U4R A;  4G7H C;  1D5Z C;  5I2Y A;  5G3L D;  1V8Q A;  3MVV A;  2Z9H A;  3TS0 A;  5C0X H;  1PFN A;  4PMB A;  5IGE A;  1TWC B;  2RDF A;  1S72 A;  1VF5 C;  3T16 A;  5BR8 L;  3NXW A;  3TZU A;  3QO2 A;  3MC0 B;  2J0T D;  1VQM A;  1KRS A;  1TVX A;  1C4Q A;  4H13 C;  1I6H H;  3KOJ A;  3LWE A;  5FOB B;  1AE2 A;  1TWA B;  2QF7 A;  3LWU A;  4RCO A;  2YU9 B;  1XPR A;  1H95 A;  2DGY A;  4PG3 A;  1GUN A;  2X6L A;  2Z1C A;  5IT9 L;  4K2K A;  3TRE A;  4B3R Q;  1OXU A;  3Q6S A;  1IZ6 A;  3NUC A;  3K6O A;  1PZJ D;  2YTV A;  3IAY A;  3Q22 A;  1SJH D;  4LFB Q;  4XT1 B;  3D4R A;  3N52 A;  4JI4 L;  1DOK A;  1EEF D;  1BXT A;  2EYM A;  1MSH A;  3NQI A;  3NPP A;  4BBR H;  1NY4 A;  2VUM H;  2AHO B;  2EY5 A;  3OTO Q;  3T1Y Q;  2LFN A;  4JOI C;  4C2M H;  3PUV A;  2GA4 B;  4KJN A;  4EGV A;  1PH8 A;  2RCF A;  3VYT A;  1LTS D;  1STA A;  2A19 A;  2VUM B;  4DKA C;  1XWE A;  4BS9 A;  2B29 A;  5IT9 E;  4JCV E;  3VR2 A;  2FJ2 A;  1BBU A;  4BBS B;  4XQJ A;  3STB C;  3K5M A;  4DV0 L;  2E2H H;  2F0G A;  4A93 H;  4GLX A;  3F8T A;  2ZXO A;  1I5F A;  3RNU A;  1K9M C;  3FRP B;  1ENF A;  4Y7N H;  3GTO H;  1S3O A;  1DZ1 A;  4N8X 1;  1E1T A;  4IUU A;  5JPN C;  3E9I A;  2WFW A;  2AKW B;  3GTO B;  2N49 A;  4YCU A;  5M5W H;  3W1G A;  2R92 G;  2MPM A;  3JAM c;  4KD3 A;  5IYB G;  3VYR A;  2UXC L;  1U4M A;  3RMH A;  3EBE A;  1KAW A;  1I4X A;  1ENA A;  3M4Y A;  4IFD H;  2X6G A;  2JA8 G;  3J80 c;  4B3M Q;  3KF8 A;  4WFN 3;  5CV5 A;  4C3I H;  2XVS A;  4DR7 L;  4K0K Q;  1KDB A;  2RDH A;  3QJY A;  1F2L A;  4P75 A;  3VYU A;  1UE1 A;  2K6A A;  4IUP A;  2F3I A;  2WII B;  4K8J A;  3PUX A;  3BVZ A;  5GAH C;  4JI0 Q;  1QUQ A;  1Y1V G;  1H9S B;  4HED A;  2HDL A;  1JOQ A;  4OIK A;  4K5W A;  1YJ9 A;  4I7A A;  5E3F A;  4J8Q A;  1CT1 D;  1XMO L;  5IYD G;  3CPW A;  2J7Z A;  2WV6 D;  3I55 A;  1IBM L;  1OTC A;  4X3U A;  1PZK D;  2PZU A;  4I65 A;  5CR3 A;  1SEB D;  5CC4 A;  2KCN A;  1V43 A;  1DM0 B;  3CP0 A;  3D6C A;  3BG3 A;  3GV6 A;  1BOS A;  2B2V A;  2A6E D;  2DY7 A;  5M3M G;  2CW0 D;  1KTK A;  4JVZ A;  4PZ6 A;  1EIH A;  1I6V C;  1B70 B;  1MJC A;  4R4O A;  1J8I A;  3BZK A;  1WI5 A;  1IYJ B;  4JBW A;  1CA5 A;  3J7Y W;  1GOZ A;  4A3K B;  1Q46 A;  2L11 A;  1LYL A;  4DV7 L;  4RHS A;  1JOR A;  4FNF A;  1I4P A;  2PNH A;  2I5M X;  3I4N G;  5EGT A;  1FYC A;  2BE5 C;  3A8I E;  1NMG A;  2VL6 A;  5CV8 A;  3A7L A;  1TWG H;  1J6Q A;  1VQG A;  2PI2 E;  4QUC A;  3TSS A;  3S24 A;  3CC7 A;  4FF3 A;  2YTY A;  2LMC B;  3BZD B;  3GV3 A;  4B9X A;  2QIL A;  4LF8 Q;  4BXX G;  3ND9 A;  3VR4 A;  2L15 A;  3A8J E;  3D4D A;  4FXD A;  5EPJ A;  1B1Z A;  4A3M H;  3D6W A;  2F0W A;  4AQY L;  3V96 A;  3PMF A;  4IPG A;  5FK9 C;  3RN2 A;  3GTP H;  1X56 A;  1X3E A;  2AUK A;  3S1Q H;  4A3F B;  1NCV A;  1FNW A;  1QIL A;  2KEC A;  2ZM6 L;  1EYC A;  1SN8 A;  1IBM Q;  3E9H A;  1Q86 C;  4C3H G;  1PFM A;  4EQN A;  1NUC A;  4X65 L;  3E0J A;  1C9O A;  3GO5 A;  2E76 C;  1NTG A;  3SK6 A;  1ET9 A;  2IL8 A;  4TSS A;  2VXW A;  3KF6 A;  4RWS C;  1VQ5 A;  1HCZ A;  4B9W A;  5GAG C;  1WTH A;  2KCC A;  4DU9 A;  5GAE C;  4OL7 A;  4MTK A;  4DR2 Q;  2D62 A;  2EE1 A;  3SK8 A;  3CRL C;  3RZD B;  3R2T A;  1VQ7 A;  1AZQ A;  5E4X A;  1AZP A;  1Q8I A;  2KHJ A;  3TZD A;  3HOU H;  5I2X A;  1LTG D;  4H0L C;  3A56 A;  5CBA E;  2JA5 B;  2CVR A;  5COY A;  1X3Q A;  4BA2 I;  3CCE A;  1QCB D;  1HTL D;  1UNS A;  5C3W A;  1PH2 A;  2IX1 A;  2YTX A;  1PYS B;  2AQ1 B;  2DY8 A;  1A0I A;  2OT2 A;  4A3E H;  2UXB Q;  2VQF Q;  4HJ7 A;  3H3V I;  3R3O A;  3NWT A;  4R4I A;  1BCP F;  4QF4 A;  1EEI D;  2ZXR A;  3RR5 A;  4X66 Q;  3K81 C;  2Z6K A;  1ESR A;  2Q8I B;  5CBE E;  4RGT A;  3T1H Q;  1WVL A;  2CWP A;  4DR6 Q;  1KAB A;  1VF7 A;  4JOI A;  2R7Z B;  4YWM A;  2MO0 A;  4LW1 A;  3WOE A;  3A5U A;  1D5X C;  2HQE A;  2A6H C;  1LLR D;  4AYB B;  4CDD C;  2F52 A;  3E0E A;  4DV1 L;  1BKB A;  1TR5 A;  1KAA A;  3DUZ A;  2BOS A;  4ZLT F;  3HOW G;  1CTM A;  2RQX A;  3AFQ A;  4BY7 G;  2WAQ B;  2ZTE A;  1A3U A;  1X9N A;  1KQS A;  3UDX A;  2CWA A;  4KHZ A;  1HTP A;  3M4O H;  1SNO A;  1A2U A;  3I90 A;  1ASY A;  2DJG C;  4U67 3;  5JVG 3;  2D0O A;  4CHT B;  4JI7 L;  5COR A;  4G4K A;  5KYL A;  1L1O A;  4GKJ L;  4A3B H;  1JJ2 A;  1K0R A;  2KEN A;  4LF9 Q;  4DUY L;  2M00 A;  1EY0 A;  4QB4 A;  3AB9 A;  2V4D A;  5FO9 B;  1RL2 A;  3M3Y B;  4J6H A;  1RCV D;  3NEM A;  1OXT A;  2O2L D;  3T4A C;  1STB A;  4PMW A;  2RF4 A;  1O80 A;  1SYB A;  2B63 G;  3I73 A;  3T53 B;  4DV4 Q;  5NUC A;  3BZC A;  1AH9 A;  1QVF A;  4YCW A;  4JYA L;  1ILQ A;  5AFW A;  1E2Z A;  4IPH A;  3F2C A;  3K0Y A;  5IWA L;  5F2D A;  4A3D H;  3HOZ G;  3ULL A;  2IHF A;  3TDQ A;  4L6T B;  5LL6 X;  4FF2 A;  4IUT A;  1TS3 A;  5IOC A;  1LT3 D;  4RG1 A;  3PUW A;  5C3E H;  2B8G A;  1WJJ A;  3MHB A;  1MD2 D;  2ZJR A;  3PO2 G;  3PO3 H;  5ELD A;  4LAA A;  4JPB W;  2PI2 A;  2F4V Q;  1J5E L;  4RKL A;  2NVQ B;  2ZTC A;  4HAE A;  2B3G A;  2B2W A;  3EN2 A;  1PLF A;  3OOC A;  1DYQ A;  3ZJY C;  1D8L A;  3EVQ A;  4IZ8 A;  4IO9 A;  3S1M B;  5GQO A;  1WTP A;  2KBN A;  3CCJ A;  4IQZ A;  3KF8 B;  2NVX H;  5C0X I;  2E5L Q;  3DWA A;  3KLS A;  2ZJP A;  1SRO A;  3IKJ A;  4GKJ Q;  5I6W A;  2E2I H;  4LF4 L;  2B2T C;  4JC0 A;  4A3I H;  4NKL A;  3K8A A;  4LUZ A;  1XTC D;  4Z9C B;  4X62 Q;  1F9P A;  3KDF A;  5TSS A;  3X3M A;  4HJ8 A;  1QUQ B;  3MZ5 A;  1EU3 A;  1IBL Q;  5HGT A;  5CMD A;  3GTQ B;  1N34 Q;  3U58 A;  3CQZ B;  4JBM A;  4IPD A;  3I4O A;  1T5E A;  3GTJ H;  4DV5 L;  1XNR L;  5T1I A;  2Q2T A;  1CKN A;  4CKE A;  1VS0 A;  2F0T A;  2XNA C;  3G48 A;  1KDC A;  3QIA A;  2KUM A;  2A1A A;  1FGU A;  2VQE L;  4X64 Q;  3VR3 A;  4HMJ A;  2R93 G;  3FVQ A;  3S14 B;  5BN5 A;  3FEW X;  4IJH A;  3CCU A;  1H9K A;  2HIV A;  5K36 H;  4OX9 Q;  3ITP A;  5LMU L;  2E2J B;  5IP7 H;  2OTL A;  1VQ9 A;  4DUZ L;  1X32 A;  2PMZ B;  1L0X B;  3DLL A;  3S1R H;  2HHH Q;  1GUT A;  1SMY C;  4WOR A;  4TVA B;  4ZK9 B;  4UP7 A;  1F9Q A;  3DWQ A;  4OWT B;  3URY A;  3S1R B;  1D1K A;  2UU9 L;  1FNU A;  3GD7 A;  5FLX L;  2KOL A;  3PF5 A;  1SSO A;  4KY6 A;  5IGF A;  1QNU A;  4J15 A;  4IPC A;  1TT2 A;  4CKB A;  3MFG A;  4OHJ A;  4IFD I;  4QMG A;  2NVY B;  2CH4 W;  3AFP A;  1HNZ L;  1MIU A;  4GNX C;  1PA6 A;  1I94 Q;  2VNU D;  2A6H D;  3UDI A;  1C8C A;  4IOC A;  4DNR B;  2XWB B;  4OO1 G;  4DV5 Q;  4LFC Q;  1XNR Q;  1HHV A;  2R92 B;  2MO1 A;  4R9W A;  2PCF B;  1XNQ L;  3H0G H;  2FIN B;  5IT9 c;  1K0S A;  3QOJ A;  3MAQ A;  1GD7 A;  2JA8 B;  1NBW A;  3H0G B;  4X3S A;  1KIX A;  3A5Z B;  2B2V C;  1B3A A;  3KF6 B;  4DK1 A;  2KJX A;  1L0W A;  1Y1W G;  1PH4 A;  5CV7 A;  2B8F A;  5FLX E;  1DD2 A;  1C7Y A;  2EY6 A;  5LMU Q;  2MJ8 A;  3SDZ A;  4DUZ Q;  3S17 H;  1Y1V B;  3OWF A;  1JOK A;  2JK8 A;  3BU2 A;  1SYE A;  2LS0 1;  4LF7 L;  1E1O A;  2EOT A;  2A69 D;  1IKM A;  1NR4 A;  4UPA A;  1M1K C;  1IBK Q;  3KBG A;  4GKK L;  3S17 B;  1PH6 A;  2I46 A;  1PXU A;  3A0J A;  5C5M A;  2JA7 G;  3I70 A;  2K5H A;  1Y8P B;  3WOF A;  3I4M G;  5KNC A;  3AMU A;  2DNC A;  1PH9 A;  1I4H A;  4DGZ A;  3GTM H;  1EY8 A;  4A3G G;  1E22 A;  5M3M B;  1GJX A;  4JG2 A;  1CSP A;  5KEE A;  3RLN A;  4DAP A;  3NP8 A;  3GTM B;  1STE A;  2F0N A;  2K4K A;  2PNR C;  3AU7 A;  3CAM A;  3CKI B;  2F0D A;  1DGS A;  2F0K A;  5EAY A;  3I4N B;  3H09 A;  3VDY A;  2EDG A;  4QGU A;  1AW7 A;  4DK6 C;  1TWC H;  1PH1 A;  1C48 A;  1KC8 C;  4C1N I;  5C44 G;  3V2T A;  1WCM G;  4ILW A;  1G2S A;  1UE7 A;  3FKI G;  3M85 A;  1FGB D;  3CCR A;  3J81 i;  2K04 A;  5CYU A;  1KD1 C;  1O7Y A;  1D5M C;  1TWA H;  5J39 A;  2YU9 H;  1GUO A;  5BN3 A;  1JCK B;  1JE5 A;  1ZYR C;  2I5L X;  3OYY A;  3PUY A;  1K8O A;  1L1O B;  4LK1 C;  5IP9 G;  1EWH A;  2K5Q A;  3I56 A;  4Q0F A;  1X55 A;  1IXR A;  1EQT A;  1PTO B;  1YJN A;  2G9H D;  4UAI A;  5KGU A;  4OWW B;  1HQM C;  2PYK A;  3NBI A;  4O2D A;  4C3H B;  1D7Q A;  1W6J A;  3DMU A;  1LTL A;  3UDG A;  3ER0 A;  3M7G A;  2B2T A;  5FLM H;  1HNW L;  1EFI D;  4JI6 L;  4KKT A;  2NZH A;  3RN5 A;  3S2D B;  2Z6K C;  2HDM A;  4JI1 Q;  2SDF A;  3CCM A;  1O78 A;  1YEZ A;  2R6G A;  3MEH A;  1Y8O B;  1JC7 A;  1EIF A;  5GAD C;  1RJT A;  4DV2 L;  5FJ8 G;  1HNX L;  4BBS H;  2P5Z X;  1I50 B;  2LSS A;  4LMQ D;  2K5W A;  3J81 L;  1HZA A;  4YIJ A;  4EQO A;  3MXN A;  4P73 A;  5J22 A;  3QB3 A;  4DR3 L;  1WTQ A;  2O5J C;  1YNX A;  3K57 A;  1HFN A;  5M5Y B;  3T56 B;  5C4H A;  1SMY D;  4PMC A;  4HJA A;  3HOX G;  5LMN W;  1VCI A;  3DEO A;  3K0X A;  2NN6 G;  4JI5 L;  2EZV A;  3L0O A;  5BR8 Q;  1UUP A;  3EFX D;  4JI8 L;  2HCC A;  2CCZ A;  5GRO A;  4RGM A;  1LT6 D;  5ELE A;  1SR3 A;  3TME A;  2OQ0 A;  1L1O C;  1A2T A;  2ZJQ A;  3K80 C;  1B53 A;  3NEL A;  3KDF B;  5I9P A;  3U50 C;  3S1N B;  4TKO B;  3M7N A;  1PTO C;  5LMN L;  2F0Q A;  2HD3 A;  1N33 L;  2LKV A;  5K5P A;  3NWS A;  4K5V A;  4FO2 A;  3J81 E;  2Q8T A;  4RCN A;  1CI3 M;  5CV6 A;  1AN8 A;  3CCQ A;  3CC2 A;  4JI4 Q;  1GUG A;  1JT8 A;  1S5D D;  2Q8R E;  4DFA A;  3HOW B;  3ERS X;  2F0S A;  3PCO B;  5G3L F;  1CKN B;  2K33 A;  2RDG A;  3NTI A;  4GZY C;  1R4Q B;  4UHV A;  5LHY 1;  1WD1 A;  2O5I C;  3ZYY X;  5D3I B;  3ND8 A;  1QZG A;  3O13 A;  1KHI A;  5M5X B;  2K50 A;  3IFD A;  4N9P A;  5C4Z A;  4GNX A;  2EYP A;  3FPP A;  4LF6 L;  4DR3 Q;  2IW3 A;  5HY6 A;  5ELN A;  2I07 B;  2WP8 J;  1VQ8 A;  2XN9 C;  2RBM A;  4EVO A;  1QWY A;  2K5D A;  4DV0 Q;  2B2W C;  1YIT A;  3PSI A;  3M4P A;  5CGK A;  5C4X G;  1PRT C;  4JI5 Q;  2CH4 A;  1IL2 A;  3BS1 A;  3TP7 A;  4A3C H;  1X54 A;  2KVM A;  2B63 B;  3TN2 A;  3R8B A;  3BYT B;  4A3K H;  3VR5 A;  4G7Z C;  2FMM A;  5KND A;  2ES2 A;  4ID6 A;  3HOY G;  2IJ0 A;  4YWK A;  2PO4 A;  2UXC Q;  3HOZ B;  4A3L H;  3K58 A;  1WOC A;  1X3G A;  2G5D A;  5DNF A;  4FF4 A;  5LMN Q;  1IL8 A;  1YHB A;  3OW7 A;  3P7J A;  4A4I A;  5IGC A;  2IX0 A;  1ONL A;  2K28 A;  1B44 D;  3R93 A;  5ELC A;  1LUZ A;  2MUY A;  4IUR A;  4DR7 Q;  3PO2 B;  5JEA J;  3J7A 5;  4B3T L;  1RIP A;  3PIP A;  1VMP A;  2RSO A;  1QOH A;  2EXZ A;  3CRK C;  3P20 A;  4BY1 G;  4YHH L;  1UWV A;  3ULJ A;  5LL6 S;  2BDO A;  2PQA A;  4R4T A;  2UXD L;  2CHB D;  2NBF A;  4ZAI A;  3D0F A;  4A3F H;  5M3F G;  4HJ5 A;  3K7A H;  3KYH C;  4QJF A;  3RLF A;  1EWI A;  1XMO Q;  1CQV A;  2L12 A;  2A73 B;  1WTX A;  1OO9 B;  1V1P A;  1D1I A;  1PYW D;  4FP5 D;  3E3X A;  1K28 A;  3KJP A;  1CK1 A;  3K7A B;  3SVM A;  4H7B A;  4LUV A;  1WTR A;  1SAP A;  2F0I A;  2EYL A;  3J7A F;  4WJW A;  2PW5 A;  5C0X G;  1M8A A;  3RZD H;  1PYB A;  2N3S A;  1TS4 A;  2CQA A;  5HUR A;  1VQD A;  2JA5 H;  1B7Y B;  4HTH A;  2HT1 A;  2CFM A;  3R2I A;  4DV7 Q;  1TII D;  2Z8L A;  1VQ6 A;  3QOL A;  4ALP A;  1ICW A;  4KKU A;  4JI3 L;  2NTT A;  1N32 L;  4NXM L;  3F2U A;  1N9W A;  1XYI A;  1I3Q H;  3DXJ C;  4GOP C;  4ZUI A;  2AWO A;  1EYG A;  1D6E C;  3IL8 A;  2R93 B;  3AYH B;  2OQK A;  3C3L A;  2VZA A;  3EQL C;  4IUQ A;  1VQ4 A;  1E2V A;  1T9H A;  2B39 A;  3KK7 A;  1I3Q B;  4QL5 A;  1WD0 A;  1SE4 A;  2BA1 A;  4N8F A;  4ZKC B;  3KFU A;  3STB D;  2FFK B;  1OXX K;  4HSV A;  4A76 A;  1MGS A;  5CV9 A;  4ODG A;  4BBR G;  2VUM G;  1OXV A;  4AQY Q;  2WB1 B;  2R7Z H;  4KHP L;  2RHS B;  5IOD A;  2R7F A;  4R4Q A;  2KHI A;  3L2P A;  1AP0 A;  2N55 A;  3UE0 A;  2X69 A;  1U5K A;  2ZM6 Q;  4QY7 A;  1EY4 A;  1K8A C;  1B9M A;  5FO8 B;  3Q23 A;  1STH A;  3I7F A;  1DOL A;  4X65 Q;  3CF5 A;  4L5Q A;  1PTO D;  4A93 G;  2EPB A;  1X65 A;  4C3J H;  5JEA H;  5EQ0 A;  1K8M A;  5C4J B;  1VQE A;  2F0O A;  2SOB A;  3F2D A;  2D5D A;  1I4G A;  3PQI A;  2I0Q A;  4BA1 I;  4DR1 L;  3AEV A;  3TS2 A;  2L5T A;  3S15 B;  4C3J B;  3K5N A;  1YIJ A;  4UDU C;  4IFD G;  3OMG A;  3U4Z A;  3S9W A;  4CBV A;  3K7U C;  1STY A;  4DPG A;  1SE2 A;  3M3Y H;  5EBC A;  3H15 A;  1QG7 A;  1SXT A;  1Y1W B;  1F2M A;  4R8N A;  4C3I G;  1KLU D;  1MHW C;  4F8M A;  3F1Z A;  1NMF A;  4K8I A;  1MI2 A;  3SGI A;  1EOV A;  1K83 B;  1SDF A;  1NAP A;  1UE6 A;  4HMI A;  4PV1 C;  4HIM A;  4BWG B;  3MXN B;  4CGY B;  4AH6 A;  3OMC A;  3H91 A;  2Z4I A;  3PIO A;  1YHQ A;  1JE4 A;  3GTL H;  4I7Z C;  2V1C C;  1YNN C;  1YNJ C;  1F9R A;  3SEB A;  1Z7T A;  3AQQ A;  5ISR A;  4EQ5 A;  2JA7 B;  3LX0 A;  1KLG D;  5JPM C;  3GTL B;  1TWH B;  5FLX c;  3I4M B;  2NVQ H;  1R9T B;  4KD4 A;  1EQQ A;  2JJQ A;  1M4V A;  1MBY A;  2HQL A;  2M9V A;  1H9R A;  1NE3 A;  4DV1 Q;  4DV6 L;  2RCN A;  2K14 A;  2TSS A;  1EUJ A;  4A3G B;  3S16 B;  3S1M H;  3I3C A;  4LFA L;  3HZX A;  4M1U B;  3B6Y A;  1BVS A;  2B2U C;  2BE5 D;  5I4D A;  1O7L A;  2AWN A;  5IYC H;  1U9R A;  4V0B A;  1V1Q A;  4X3T A;  1DJR D;  1A15 A;  3OPO A;  2IWH A;  4H02 A;  2MQH A;  4JI7 Q;  1PMR A;  4XQN A;  3A8K E;  4KJO A;  3MXU A;  5E7N A;  4XT3 B;  4DUY Q;  1VQL A;  3W3A A;  3L3O C;  5C44 B;  3GTQ H;  1WCM B;  1XJV A;  3QG1 A;  4JV5 L;  3RZO B;  1A63 A;  3W1B A;  2EY1 A;  3FKI B;  3CQZ H;  1ZEQ X;  2KHS A;  3Q24 A;  1YJW A;  3CD6 A;  3FHW A;  3MWY W;  4QIW E;  1Q82 C;  3GTG B;  1G29 1;  1LT4 D;  5AJ3 L;  1LTA D;  4GNX B;  2F0M A;  1JOO A;  2MNA A;  1EU4 A;  4JYA Q;  1GO3 E;  1W6K A;  4GLA C;  1XX8 A;  1BR9 A;  1G8Z D;  5IWA Q;  1VQH A;  3LNN A;  4L5T A;  4A3M G;  4KHV A;  1VMC A;  4X6A H;  1LTR D;  1AE3 A;  1CZG A;  1EY6 A;  1VQA A;  5C5L A;  1HA6 A;  3K5O A;  1ENC A;  1TXY A;  3S14 H;  4DV3 L;  2B2Y A;  4RMF A;  1WYD A;  2IX3 A;  1VQN A;  1PH5 A;  4DAY A;  3HOV G;  3OIP A;  3SK4 A;  2E2J H;  1K73 C;  1BF4 A;  1J5E Q;  2F0H A;  4NMZ A;  5FO7 B;  1TWF H;  3S2H B;  2UUA L;  4MTN A;  2ASB A;  4ZKB B;  3KLW A;  1ESF A;  4HCS A;  3DEP A;  1E0B A;  1TWF B;  2ICE C;  1JR0 D;  1VQP A;  1N36 L;  2OF1 A;  2UUC L;  3HOU G;  2QDL A;  1EIY B;  2SNS A;  2A5H A;  4LF4 Q;  1F2Z A;  1XPU A;  3TRZ A;  2NN6 H;  1W2B A;  3BDC A;  1GKH A;  1RTO A;  1PV4 A;  2NVY H;  2Y0S E;  3HOX B;  2LY7 A;  3SE0 A;  2PQA B;  1RTN A;  1P8L A;  2XTI A;  2N88 A;  1HRJ A;  4GOP A;  1CA6 A;  2J4X A;  4ZQ3 A;  5I9O A;  3BYY B;  4A3E G;  2R92 H;  1EYD A;  3WDN A;  5IYB H;  1K8G A;  1FJG L;  4MHE A;  1BCP B;  3MTS A;  1FD7 D;  2JEA I;  2IPK D;  1V1P B;  2JA8 H;  3PV0 A;  1SE3 A;  4FVM A;  1EZ8 A;  4IJL A;  1G91 A;  4DV3 Q;  4PZ7 A;  4PQX A;  3NK9 A;  4RGO S;  2VQE Q;  4JI2 L;  3D4W A;  2RSN A;  3NTH A;  1QNK A;  3U9S A;  4XXE A;  3OHX C;  1LTB D;  4NXN L;  2K32 A;  5ELB A;  3ICE A;  1JB7 A;  2L4N A;  1Y1V H;  2D0P A;  4UP8 A;  1DCZ A;  2O4X A;  4LF5 L;  1P16 A;  1V1O A;  1KXL A;  2F0V A;  3G7L A;  1X6O A;  2IHE A;  2OEO A;  4XYQ A;  5IYD H;  3HEJ A;  4L5S A;  3C2P A;  2VS1 A;  5H1S E;  5A2Q L;  2K7V A;  1SFO B;  2Y0S G;  2WAC A;  4M8A A;  3J81 c;  2E75 C;  4HR7 B;  2GN5 A;  3CC4 A;  1GUW A;  5JVH 3;  2R61 A;  2UU9 Q;  2F1M A;  2DUD A;  4FXG C;  4A3B G;  1Q3L A;  2H5X A;  1AEX A;  3TEH B;  1HUM A;  5M3M H;  3VYS A;  4A3J G;  1YNJ D;  4A75 A;  5C4X B;  1X3P A;  4R4C A;  1HPC A;  1AFP A;  1TY2 A;  2JQO A;  1Y14 B;  1PDQ A;  2L1B A;  4HID A;  1YBY A;  2PPB C;  1HNZ Q;  2R7D A;  2KEE A;  1VQB A;  4GN5 A;  3NBH A;  3PF4 A;  2F0P A;  3OSO A;  3C46 A;  3U9O A;  2K5N A;  3HOY B;  1H9M A;  1BCP C;  4O0A A;  5J1Z A;  1XNQ Q;  4B3R L;  3I4N H;  3T13 A;  1Z6H A;  1JWS D;  1Q1B A;  1EQV A;  1QE6 A;  4A3D G;  1F77 A;  1L0Y B;  1VQC A;  4KI0 A;  1LM0 A;  5D65 A;  4FDB A;  1DXM A;  1BBX C;  5EKL A;  4S3S A;  3GDE A;  3ONA B;  1SNC A;  5A2Q E;  2DN8 A;  3TP5 A;  2F3V A;  5C3E G;  3H3V C;  4F88 A;  1Q8K A;  1N8R C;  4OIJ A;  4BXX H;  3HGB A;  5JOB A;  4OEL B;  4DAM A;  1JB3 A;  3PO3 G;  4WRD A;  2YYZ A;  4APV A;  4BY1 B;  1UEA B;  3MEF A;  5EBD A;  3D8G A;  2NVT B;  3UI2 A;  4B08 A;  3OTO L;  1G51 A;  3NEN A;  3T1Y L;  2QA4 A;  4PNY A;  2JA6 G;  4XYO A;  2AQ2 B;  3VR6 A;  3CU7 A;  1EY9 A;  1PTO H;  4LF7 Q;  5M3F B;  1SYF A;  2CKZ B;  5M9O A;  2B2U A;  4DXG A;  4GKK Q;  4C3H H;  1SNQ A;  1JWU D;  4TQU S;  1ML0 D;  1SNP A;  3BVM A;  4WJ4 A;  2XIW A;  1RDP D;  3TBI B;  2YV5 A;  4A3I G;  4YY3 L;  1RHP A;  1TY0 A;  1SE8 A;  3S2D H;  3HKS A;  3G4S A;  5BN4 A;  3I91 A;  2A68 C;  1VDZ A;  2PQE A;  2D9U A;  4RAU C;  2BDN A;  3TP8 A;  4WJ3 M;  1LO5 D;  5EKK A;  3K59 A;  1I50 H;  1JJG A;  1LT5 D;  3BVG A;  2HCI A;  1I6H B;  2FHT A;  2AMC B;  1H9J A;  1CKM A;  1EIG A;  4B3M L;  3CCV A;  3GTK H;  5M5Y H;  1JIC A;  1LAB A;  4K0K L;  1K3R A;  4KN7 C;  2EYH A;  3DHQ A;  5FKA C;  3CCS A;  3GTK B;  3EJI A;  2BH8 A;  1E2W A;  5I6Y A;  1PRT B;  2JEB I;  4XQQ A;  5DLQ E;  4JI0 L;  2LXK A;  1Q90 A;  3N6R A;  2KQ3 A;  3IRB A;  2F03 A;  1JJC B;  4G7O C;  1ASZ A;  4KMU C;  5K36 G;  1UEB A;  3Q8D A;  5IP7 G;  5ELO A;  3MXP A;  4BBR B;  2K1B A;  3S1N H;  1DON A;  1LV9 A;  2K52 A;  4OO1 I;  5C3X A;  4F7X A;  4KLK A;  4C2M B;  1CUK A;  3BDL A;  1BQQ T;  3L9A X;  2JA9 A;  1ET6 A;  1O7Z A;  4YY3 Q;  5L37 A;  3C1E A;  1B9N A;  1GVP A;  3G6J B;  1B3Q A;  2ID0 A;  1S4Z A;  4KKS A;  1WTO A;  3HOW H;  4BY7 H;  1S5C D;  2E2H B;  1CQF A;  1HNW Q;  2K5V A;  4CDF C;  4A93 B;  3ULP A;  3A7A B;  5M5X H;  4Y7N B;  1MJE A;  4JI6 Q;  1HXY D;  1IYV A;  4DR4 L;  1Q7Y C;  4BY7 B;  1CSQ A;  2ZT9 C;  2XRS D;  3NE5 B;  1B50 A;  5M5W B;  2Q2H A;  1STG A;  4DV2 Q;  3H0G G;  3W5O A;  1HNX Q;  1JQY D;  4DAY B;  3KLR A;  3CCL A;  2XSC A;  1PVO A;  2NB0 A;  4Y52 H;  3HKZ E;  1JMC A;  1IHZ A;  1T5X D;  4HSP A;  3GP7 A;  3QWN A;  4X3K A;  2QW7 A;  1PZI D;  4JW0 A;  4KN4 C;  3ERO A;  4ZYS A;  4CJ1 B;  1VQO A;  1G2T A;  2BH2 A;  4ZRZ A;  1EYA A;  1FNV A;  4CJ2 C;  4C3I B;  2B63 H;  3EIV A;  1GHJ A;  2C5C A;  1IW7 C;  4LF8 L;  1TKW B;  1A62 A;  2NYZ D;  2K05 A;  2OWO A;  4JI8 Q;  1SRU A;  3VA7 A;  5E4W C;  5HGQ A;  4RH6 A;  3HOZ H;  4DN4 M;  1OXS C;  2FMC A;  1GM5 A;  5IGG A;  4POG A;  2UUB L;  1PHJ A;  1EQR A;  1HQR D;  1YI2 A;  1E7Z A;  3I72 A;  2K75 A;  4K14 A;  5D14 A;  3FMC A;  1A3T A;  3PO2 H;  4K5X A;  3W2D A;  2PZW A;  1N33 Q;  2BA0 A;  5A35 A;  1BCP D;  3JAM i;  4IUV A;  3FDT A;  4GOP B;  1FVI A;  1LAC A;  1D2B A;  2ZXP A;  1EFW A;  3J80 i;  4FF1 A;  2EXD A;  2EJF C;  4DR4 Q;  1EZ6 A;  4KV6 A;  4LUO A;  2Q2I A;  5T1G A;  2E2D C;  4DR2 L;  1UE5 A;  4DNT B;  1A3V A;  3SXH A;  1TS5 A;  2L55 A;  1W3S A;  3C1F A;  1KL9 A;  3HKZ G;  2R3Z A;  1U0L A;  3L7Z C;  4OXP A;  1Z47 A;  5JJZ A;  2NTS A;  3E5S A;  2IT1 A;  2XGT A;  2B2Y C;  4LF6 Q;  4CDE C;  1S40 A;  1C0A A;  1ZYR D;  3CXC A;  4OON A;  4Q5V A;  5KNB A;  1XMQ L;  3M9B A;  1KRT A;  1SBB B;  2PW7 A;  2UXB L;  2VQF L;  1TWG B;  1G6P A;  4ULL A;  2L0C A;  5E1F A;  2F0U A;  1PH3 A;  4X66 L;  2UUB Q;  3JAM L;  5IE8 A;  1HJP A;  5C6A A;  2NWG A;  3I2Z A;  1BBW A;  3P75 A;  4DR5 L;  5JAV A;  3T1H L;  5J3B A;  2A68 D;  2JSO A;  3E6Z X;  4A3M B;  4DR6 L;  4DAV A;  4XIG S;  3J80 L;  4XDX A;  1U4L A;  3HRZ C;  2E8G A;  3HOV H;  3GTP B;  4P74 A;  2XWJ B;  3SK5 A;  3S1Q B;  1Z9F A;  2R93 H;  1J9O A;  2M2L A;  1Y69 U;  4V19 0;  4GN3 B;  4MNO A;  2OCE A;  1HFG A;  3HOV B;  4B3T Q;  2C9O A;  3NBH B;  2MFI A;  2K03 A;  1BNZ A;  1GXD C;  4YHH Q;  4L8J A;  5FLM G;  1WTV A;  2NN6 I;  3RD4 A;  1TS2 A;  1YZ6 A;  2UXD Q;  1SNM A;  2EVB A;  3DWP A;  3JAM E;  3F2B A;  4HIK A;  3UDF A;  4F87 A;  3HOU B;  1E24 A;  1EY5 A;  4LF9 L;  1B8A A;  1MSG A;  4BBS G;  1GHK A;  1A6X A;  1ILP A;  1FR3 A;  3JC6 6;  1KNA A;  4LWC A;  3J80 E;  2C35 B;  1HA5 A;  3UE1 A;  3J7Z C;  1XMQ Q;  4QIW B;  3PGZ A;  1L2F A;  2GVA A;  2IY5 B;  1S5E D;  3Q0A A;  3NQT A;  2RA4 A;  2F3W A;  3DM1 A;  4DV4 L;  4OO1 H;  5C4J H;  1XXG A;  3H6M A;  4A3E B;  5DEH A;  4DXF A;  5JJI A;  1CZW A;  2JP1 A;  3TQY A;  4DR5 Q;  3S15 H;  2ALY B;  4NDX A;  3SHL A;  1CFM A;  1B4O A;  4U68 A;  4EX5 A;  5CV4 A;  1B2T A;  1HR0 W;  3BJU A;  4DK3 C;  4JI3 Q;  2Z4H A;  4GN4 B;  2QEX A;  4AIM A;  2TMP A;  4NXM Q;  1N32 Q;  1NSN S;  1Y1W H;  2NZ1 D;  3HG9 A;  4CJ0 B;  1R4P B;  2F4V L;  3BDO A;  2MGS A;  4MN3 A;  1FL0 A;  3HFZ B;  1SYD A;  3T51 B;  2Q2U A;  2AQ3 B;  1UAP A;  2WIN B;  1K83 H;  4K6D A;  1YVC A;  2JXM B;  2F0J A;  2F0F A;  2RKS A;  4DNI A;  4DA2 A;  4ABN A;  2NZO A;  4YCV A;  1BDO A;  2EIF A;  1Q81 C;  1HR0 L;  2EYF A;  1GUS A;  4RA8 A;  1IYU A;  1KDA A;  3PIP 3;  2E5L L;  1IW7 D;  2BCO A;  2E74 C;  3KBX A;  3M4O B;  2EYO A;  5JJL A;  2PZT A;  1PRT D;  4B3S L;  4KHP Q;  2JA7 H;  1XTD A;  1STN A;  1Y8N B;  2MP1 A;  1KNE A;  2Y0S B;  2JYO A;  2KCT A;  4R1J A;  5EPK A;  5D3D A;  4FYD A;  1TWH H;  5KRU A;  3I4M H;  2QKI C;  3MXG A;  4A3J H;  1R9T H;  4X62 L;  1QZH A;  5IGB A;  2G9D A;  4O42 A;  2A69 C;  4A3B B;  2ICI A;  4L5R C;  1NJI C;  4A3G H;  3S16 H;  1IBL L;  3KLS X;  3CPF A;  3HP3 A;  1TU2 B;  4ZCK A;  4A3J B;  1N34 L;  1ROD A;  2K01 A;  3FPU B;  4NB3 A;  4FXK C;  1QVC A;  1LTI D;  4ZUJ A;  1EL0 A;  4A3C G;  3D3R A;  2CQO A;  4E6I A;  4A3K G;  3DM3 A;  2GVB A;  2HUG A;  4NW2 A;  4HJ9 A;  4DR1 Q;  1G6Z A;  3OIQ A;  1JWM D;  4LJZ C;  4DK0 A;  4A3D B;  4A3L G;  1HH2 P;  4X64 L;  4QCL A;  5C44 H;  1EOT A;  3FP9 A;  1WCM H;  1XPO A;  2KA7 A;  3RZO H;  3H94 A;  4O1N A;  3FKI H;  2OTJ A;  3GTG H;  5C3E B;  1F2Y A;  2N78 A;  1NR2 A;  4POF A;  5JJK A;  1NNX A;  3EA6 A;  2JA6 H;  5DM6 3;  3PO3 B;  4OX9 L;  4K2L A;  3NSW A;  1HR0 Q;  1QB5 D;  3I4L A;  4JBJ A;  1QJO A;  2QCP X;  5IP9 H;  3A74 A;  1O7I A;  1F9S A;  2JA6 B;  4HCE A;  4YWL A;  2QEJ C;  1V9P A;  1PTO F;  2HHH L;  4MZ9 A;  4B3S Q;  1K3B C;  2F4I A;  3NHH A;  1RF2 D;  1ZXT A;  2FXQ A;  2WB1 E;  4MIU A;  2NVX B;  4A3F G;  2RHQ B;  2L9H A;  2ZTD A;  4XTC S;  1II3 A;  3I8Z A;  1TQO A;  2OXP A;  2E2I B;  2EY2 A;  2SEB D;  1SYC A;  4A3I B;  2LXJ A;  4IOA A;  3S2H H;  2DNE A;  3A55 A;  3PUZ A;  3RLO A;  4AYB E;  4KTA A;  1DOM A;  4DV6 Q;  1IKL A;  1I94 L;  4R8I A;  1E3P A;  4GS3 A;  4LFA Q;  1SND A;  3CME A;  4LFC L;  3CW2 C;  4QUF A;  2AUJ D;  1HZ9 A;  5FJ8 H;  1WTW A;  4LNQ A;  3GTJ B;  2WAQ E;  1CHQ D;  2VW9 A;  1CM9 A;  4HN7 A;  4P2C B;  1H9S A;  2JA5 G;  2VB2 X;  5KIX A;  2NUC A;  2N8N A;  1YHA A;  2KCM A;  2D2C C;  1PRT F;  3HOX H;  3CMA A;  4KK7 A;  4UP9 A;  2JN4 A;  4H44 C;  4KY5 A;  2DJF C;  1PH7 A;  5IGD A;  2Z0S A;  3G71 A;  4QQB X;  3ERQ A;  1PFS A;  4JV5 Q;  5DAU A;  3OWE B;  1ICF B;  4OWX B;  1S5B D;  1I4R A;  4L63 B;  2WKC A;  5AJ3 Q;  2A8V A;  2WB1 G;  2JE6 I;  1CHP D;  2EYJ A;  5EJW A;  4ME3 A;  1IBK L;  2WKD A;  1QVG A;  3QR8 A;  3A54 A;  5C0X J;  2R7Z G;  1RKN A;  2SNM A;  3H3V H;  3CHB D;  1EY7 A;  4NP5 A;  5ELF A;  2MHV A;  1SYG A;  2EQS A;  2F0L A;  4KY7 A;  4AYB G;  3J7A V;  3PIO 3;  2VB3 X;  3D31 A;  4HIO A;  5EKI A;  4P72 A;  2QGQ A;  1VQJ A;  1HZB A;  2WAQ G;  4IUN A;  2UUA Q;  3TP6 A;  1SJE D;  4C1N K;  4C3J G;  5JEA G;  1SFO H;  3HS0 C;  4IN3 A;  1N36 Q;  3KJO A;  2UUC Q;  1I4Q A;  2A74 C;  2H1E A;  1PFB A;  4TRD A;  4CDC C;  5IIF A;  4RFB A;  5C4X H;  4J1M A;  5DM7 3;  2F0E A;  2Z6B A;  4OEM B;  3SR1 A;  2EJG C;  4IAL A;  1X3F A;  1YNN D;  4DF7 A;  3IFT A;  2VY3 A;  3U4V A;  3NTK A;  3MA2 B;  4GLV B;  1MKH A;  4CKC A;  3P1H A;  1RD9 D;  3GQB A;  3HOY H;  3G6E A;  1FJG Q;  1VQK A;  2EJM A;  1CKO A;  2KED A;  3K5L A;  1HZC A;  1VQI A;  2XRQ D;  4ME5 A;  4JK1 C;  1WFQ A;  3WWV A;  2QDB A;  4OGQ C;  1LTT D;  1BO0 A;  3LGJ A;  4UY8 C;  2A6E C;  4RKB A;  1EWC A;  2H4O A;  2CW0 C;  3OW2 A;  1HUN A;  3MFY A;  1A8V A;  4RHR A;  1M90 C;  4JI2 Q;  4N9T A;  4P71 A;  4BY1 H;  4LFB L;  2RVL A;  3RUZ A;  2I5H A;  2NVT H;  3M4Q A;  2ATW A;  3V05 A;  4NXN Q;  2HIX A;  4NPS A;  4JI1 L;  4IFD J;  5EPL A;  4LF5 Q;  3KUP A;  5KYI A;  1Q1E A;  3VA5 A;  4EQP A;  5M3F H;  1U4P A;  4RGN A;  3X3N A;  4PZ8 A; 
#chains in the Genus database with same CATH homology
 3G48 A;  1A62 A;  3I7F A;  1SMX A;  5IYC G;  2OWO A;  2A1A A;  1FGU A;  1SRU A;  1VQF A;  4JI8 Q;  4X65 Q;  1Q12 A;  3CF5 A;  4L5Q A;  4X64 Q;  2VQE L;  5HGQ A;  3HOZ H;  4A93 G;  4JBK A;  1OXS C;  1SLJ A;  5IY0 A;  1GM5 A;  4POG A;  2UUB L;  3J81 j;  2PMZ E;  2R93 G;  1PHJ A;  1EQR A;  1X65 A;  4C3J H;  1YI2 A;  1E7Z A;  4IJH A;  2K75 A;  3CCU A;  1VQE A;  3F2D A;  2HIV A;  4OX9 Q;  5LMU L;  3PO2 H;  3TS0 A;  2I0Q A;  4BA1 I;  5IP7 H;  4DR1 L;  2OTL A;  3AEV A;  1N33 Q;  2BA0 A;  3TS2 A;  1VQ9 A;  1S72 A;  4DUZ L;  5BR8 L;  3JAM i;  4GOP B;  1YIJ A;  1FVI A;  4IFD G;  3DLL A;  3S1R H;  3U4Z A;  2HHH Q;  1VQM A;  3K7U C;  4DPG A;  1KRS A;  4TVA B;  1EFW A;  3M3Y H;  1I6H H;  3H15 A;  4UP7 A;  3J80 i;  3KOJ A;  1H95 A;  1AE2 A;  1XPR A;  2EXD A;  4OWT B;  2DGY A;  4PG3 A;  4DR4 Q;  4LUO A;  2Q2I A;  4DR2 L;  1UE5 A;  3TRE A;  2UU9 L;  4B3R Q;  3GD7 A;  1OXU A;  3F1Z A;  1NMF A;  1IZ6 A;  1W3S A;  3PF5 A;  3SGI A;  1KL9 A;  3HKZ G;  4J15 A;  4IPC A;  1EOV A;  1U0L A;  3L7Z C;  4IFD I;  4OXP A;  1Z47 A;  2YTV A;  2IT1 A;  2XGT A;  1UE6 A;  4HIM A;  4LF6 Q;  4LFB Q;  3AFP A;  1HNZ L;  1MIU A;  3MXN B;  4GNX C;  1PA6 A;  1I94 Q;  2VNU D;  3UDI A;  4AH6 A;  4JI4 L;  1S40 A;  4IOC A;  1C0A A;  3CXC A;  4OON A;  3PIO A;  1YHQ A;  4DV5 Q;  4LFC Q;  1XNR Q;  3GTL H;  4OO1 G;  2V1C C;  2MO1 A;  1XMQ L;  3M9B A;  1XNQ L;  3H0G H;  1KRT A;  3AQQ A;  4BBR H;  4EQ5 A;  1NY4 A;  2VUM H;  5IT9 c;  2UXB L;  2AHO B;  2VQF L;  3OTO Q;  3T1Y Q;  4JOI C;  4C2M H;  1GD7 A;  3PUV A;  5FLX c;  1PH8 A;  2NVQ H;  1G6P A;  1EQQ A;  1NBW A;  2JJQ A;  2HQL A;  1PH3 A;  4X66 L;  2A19 A;  4DV6 L;  1NE3 A;  4DV1 Q;  4DKA C;  1KIX A;  2RCN A;  2K14 A;  3A5Z B;  5IE8 A;  1HJP A;  1EUJ A;  2UUB Q;  3KF6 B;  3S1M H;  3I2Z A;  2B29 A;  1BBW A;  1L0W A;  3T1H L;  4DR5 L;  4JCV E;  1Y1W G;  5J3B A;  1PH4 A;  4LFA L;  3B6Y A;  1BVS A;  4DR6 L;  1BBU A;  2AWN A;  5IYC H;  3STB C;  4XIG S;  1C7Y A;  1V1Q A;  4DV0 L;  5LMU Q;  2E2H H;  3HOV H;  2E8G A;  4A93 H;  4GLX A;  3F8T A;  4P74 A;  3RNU A;  1I5F A;  1K9M C;  1Z9F A;  4Y7N H;  4DUZ Q;  3GTO H;  3S17 H;  2R93 H;  1S3O A;  2JK8 A;  3BU2 A;  4GN3 B;  4MNO A;  4LF7 L;  1E1O A;  2OCE A;  4H02 A;  2MQH A;  1E1T A;  4JI7 Q;  4UPA A;  3E9I A;  4B3T Q;  2WFW A;  1M1K C;  1IBK Q;  2AKW B;  3NBH B;  2MFI A;  5E7N A;  4GKK L;  2N49 A;  4YCU A;  1PH6 A;  5M5W H;  4DUY Q;  3W1G A;  2R92 G;  3JAM c;  3A0J A;  5IYB G;  4YHH Q;  5FLM G;  1VQL A;  3GTQ H;  2UXC L;  1XJV A;  2JA7 G;  3EBE A;  2NN6 I;  4JV5 L;  1KAW A;  3W1B A;  1A63 A;  2K5H A;  3CQZ H;  1YJW A;  3CD6 A;  2JA8 G;  3I4M G;  3FHW A;  4QIW E;  1Q82 C;  1YZ6 A;  2UXD Q;  1G29 1;  5AJ3 L;  3J80 c;  4B3M Q;  1PH9 A;  4GNX B;  2MNA A;  4C3I H;  3GTM H;  4JYA Q;  1GO3 E;  4DR7 L;  4K0K Q;  4GLA C;  4A3G G;  1E22 A;  3F2B A;  4HIK A;  4P75 A;  3UDF A;  1VQH A;  1E24 A;  4JG2 A;  1CSP A;  4L5T A;  5IWA Q;  4LF9 L;  1B8A A;  4A3M G;  4BBS G;  3RLN A;  1UE1 A;  3JC6 6;  4X6A H;  1AE3 A;  4LWC A;  2C35 B;  1VQA A;  2F3I A;  3UE1 A;  3J7Z C;  1XMQ Q;  2K4K A;  3PUX A;  5GAH C;  4WJ4 A;  3PGZ A;  4JI0 Q;  1L2F A;  2GVA A;  2IY5 B;  3CAM A;  1QUQ A;  1TXY A;  1Y1V G;  3S14 H;  4DV3 L;  1DGS A;  4RMF A;  1WYD A;  4DV4 L;  5EAY A;  1VQN A;  5C4J H;  1PH5 A;  1YJ9 A;  3HOV G;  3VDY A;  5JJI A;  2E2J H;  1XMO L;  1K73 C;  4QGU A;  5IYD G;  1J5E Q;  4DK6 C;  3CPW A;  1TWC H;  3TQY A;  4DR5 Q;  1PH1 A;  1KC8 C;  2ALY B;  3S15 H;  5C44 G;  1TWF H;  1WCM G;  1UE7 A;  3I55 A;  1IBM L;  1OTC A;  2UUA L;  3FKI G;  4MTN A;  4EX5 A;  2ASB A;  3M85 A;  1HR0 W;  3CCR A;  3BJU A;  4DK3 C;  3J81 i;  3KLW A;  4JI3 Q;  1KD1 C;  1V43 A;  4GN4 B;  1TWA H;  4AIM A;  2QEX A;  4NXM Q;  3CP0 A;  2YU9 H;  1N32 Q;  1Y1W H;  1JE5 A;  3PUY A;  2I5L X;  3OYY A;  1VQP A;  1N36 L;  5M3M G;  2UUC L;  1L1O B;  3HOU G;  5IP9 G;  1EIY B;  4PZ6 A;  2F4V L;  4LF4 Q;  1XPU A;  1B70 B;  1MJC A;  4R4O A;  3I56 A;  1FL0 A;  3HFZ B;  3TRZ A;  1X55 A;  1WI5 A;  1IYJ B;  3BZK A;  1IXR A;  1GKH A;  4JBW A;  1W2B A;  1YJN A;  1PV4 A;  2Q2U A;  1K83 H;  2NVY H;  2Y0S E;  4OWW B;  1YVC A;  1Q46 A;  4DNI A;  1LYL A;  4DV7 L;  2NZO A;  4YCV A;  2EIF A;  1Q81 C;  2PQA B;  4O2D A;  1HR0 L;  1D7Q A;  1P8L A;  2PNH A;  2XTI A;  2I5M X;  4GOP A;  3I4N G;  1LTL A;  3UDG A;  4A3E G;  2E5L L;  3ER0 A;  2R92 H;  5IYB H;  5JJL A;  1NMG A;  5FLM H;  4B3S L;  1HNW L;  4KHP Q;  2JA7 H;  2VL6 A;  1XTD A;  1K8G A;  1FJG L;  4JI6 L;  1TWG H;  2NZH A;  2KCT A;  3RN5 A;  1J6Q A;  1VQG A;  4R1J A;  2Z6K C;  2JA8 H;  1TWH H;  2PI2 E;  4JI1 Q;  2JEA I;  3I4M H;  4A3J H;  3S24 A;  3CC7 A;  1R9T H;  2YTY A;  4X62 L;  1QZH A;  3PV0 A;  3CCM A;  1YEZ A;  4LF8 Q;  2R6G A;  4BXX G;  4L5R C;  1NJI C;  4IJL A;  4A3G H;  3S16 H;  1IBL L;  1EIF A;  2L15 A;  5GAD C;  4PZ7 A;  4DV3 Q;  3CPF A;  4DV2 L;  5FJ8 G;  4A3M H;  1N34 L;  2VQE Q;  1HNX L;  4BBS H;  4JI2 L;  2LSS A;  4NB3 A;  4AQY L;  1QVC A;  1HZA A;  4IPG A;  3RN2 A;  2VUM G;  3GTP H;  4P73 A;  4DR3 L;  1X56 A;  1X3E A;  4NXN L;  3S1Q H;  4A3C G;  1YNX A;  3ICE A;  1JB7 A;  1Y1V H;  1IBM Q;  2CQO A;  2D0P A;  4UP8 A;  1SN8 A;  2ZM6 L;  4HJA A;  3DM3 A;  3HOX G;  3E9H A;  2GVB A;  4A3K G;  1Q86 C;  4LF5 L;  1P16 A;  5LMN W;  1VCI A;  3K0X A;  4HJ9 A;  2NN6 G;  4DR1 Q;  1KXL A;  4JI5 L;  3L0O A;  1X6O A;  2IHE A;  4JI8 L;  5BR8 Q;  4A3L G;  4Y52 H;  4X65 L;  5IYD H;  1C9O A;  3GO5 A;  1HH2 P;  4X64 L;  5C44 H;  3FP9 A;  2CCZ A;  1WCM H;  1NTG A;  5GRO A;  1XPO A;  4L5S A;  3RZO H;  2VS1 A;  3FKI H;  5H1S E;  2Y0S G;  2OTJ A;  1SR3 A;  3KF6 A;  1VQ5 A;  3GTG H;  3J81 c;  2N78 A;  5GAG C;  2OQ0 A;  1L1O C;  4POF A;  2GN5 A;  5JJK A;  2JA6 H;  5GAE C;  3CC4 A;  2ZJQ A;  3K80 C;  3NEL A;  4DR2 Q;  3KDF B;  2UU9 Q;  2DUD A;  3U50 C;  2D62 A;  3M7N A;  4A3B G;  4OX9 L;  2H5X A;  5LMN L;  3TEH B;  1VQ7 A;  5M3M H;  1HR0 Q;  1N33 L;  2KHJ A;  4JBJ A;  3HOU H;  4A3J G;  5IP9 H;  4A75 A;  3A74 A;  1O7I A;  4R4C A;  4YWL A;  2JQO A;  1V9P A;  1Y14 B;  2HHH L;  4HID A;  4MZ9 A;  1YBY A;  4B3S Q;  1HNZ Q;  2R7D A;  1JT8 A;  3CCQ A;  3CC2 A;  4JI4 Q;  4BA2 I;  1VQB A;  2FXQ A;  3CCE A;  4GN5 A;  2WB1 E;  1PH2 A;  4A3F G;  3PF4 A;  2RHQ B;  3ERS X;  3PCO B;  2IX1 A;  2YTX A;  1CKN B;  1PYS B;  2K5N A;  2ZTD A;  4XTC S;  1A0I A;  4O0A A;  1XNQ Q;  4B3R L;  3I4N H;  4A3E H;  1QZG A;  2UXB Q;  1KHI A;  1Q1B A;  2VQF Q;  4HJ7 A;  4A3D G;  3H3V I;  2K50 A;  2LXJ A;  1VQC A;  4KI0 A;  1LM0 A;  4R4I A;  4IOA A;  3S2H H;  4GNX A;  4FDB A;  3PUZ A;  3GDE A;  3RLO A;  3RR5 A;  4AYB E;  4X66 Q;  4LF6 L;  3K81 C;  4DV6 Q;  2Z6K A;  1I94 L;  5C3E G;  4DR3 Q;  1E3P A;  1Q8K A;  1N8R C;  4GS3 A;  5ELN A;  5HY6 A;  3T1H Q;  2WP8 J;  4LFA Q;  3CME A;  1VQ8 A;  4LFC L;  4BXX H;  2CWP A;  3CW2 C;  4DAM A;  4DR6 Q;  3PO3 G;  2YYZ A;  4APV A;  3MEF A;  4JOI A;  1HZ9 A;  4YWM A;  5FJ8 H;  2MO0 A;  4LW1 A;  4DV0 Q;  1YIT A;  4LNQ A;  2WAQ E;  3PSI A;  3M4P A;  3A5U A;  3OTO L;  2VW9 A;  1G51 A;  3NEN A;  3T1Y L;  4JI5 Q;  2QA4 A;  5C4X G;  2JA6 G;  1IL2 A;  2JA5 G;  4LF7 Q;  4A3C H;  1X54 A;  2F52 A;  2N8N A;  1YHA A;  2KCM A;  3E0E A;  4DV1 L;  1BKB A;  2CKZ B;  3HOX H;  3CMA A;  4A3K H;  4UP9 A;  2ES2 A;  3HOW G;  4GKK Q;  4C3H H;  1PH7 A;  3AFQ A;  3HOY G;  2Z0S A;  4TQU S;  4YWK A;  4BY7 G;  2ZTE A;  3G71 A;  1X9N A;  4QQB X;  4A3L H;  2UXC Q;  1KQS A;  1PFS A;  2CWA A;  3UDX A;  4KHZ A;  4JV5 Q;  1WOC A;  1X3G A;  3M4O H;  5LMN Q;  1YHB A;  2YV5 A;  4OWX B;  4A4I A;  4A3I G;  4YY3 L;  2IX0 A;  1ASY A;  5AJ3 Q;  2A8V A;  1SE8 A;  1LUZ A;  3S2D H;  3HKS A;  3G4S A;  2WB1 G;  2JE6 I;  2D0O A;  4JI7 L;  4DR7 Q;  5JEA J;  3J7A 5;  4B3T L;  1L1O A;  4GKJ L;  4ME3 A;  1IBK L;  4A3B H;  4WJ3 M;  1JJ2 A;  1K0R A;  1RIP A;  2KEN A;  3PIP A;  1QVG A;  4LF9 Q;  4DUY L;  5C0X J;  4BY1 G;  4YHH L;  1UWV A;  2R7Z G;  3H3V H;  1I50 H;  1RL2 A;  1JJG A;  3ULJ A;  3NEM A;  1OXT A;  2AMC B;  2EQS A;  2PQA A;  4AYB G;  4R4T A;  2UXD L;  1CKM A;  2RF4 A;  4PMW A;  4B3M L;  3CCV A;  2B63 G;  4DV4 Q;  3D0F A;  4A3F H;  3GTK H;  5M5Y H;  5M3F G;  3BZC A;  4HJ5 A;  1AH9 A;  1QVF A;  3D31 A;  4YCW A;  4JYA L;  4HIO A;  3K7A H;  4K0K L;  3KYH C;  4IPH A;  4QJF A;  1K3R A;  1EWI A;  4P72 A;  3RLF A;  3F2C A;  2QGQ A;  1XMO Q;  5IWA L;  1VQJ A;  1HZB A;  2WAQ G;  3CCS A;  4A3D H;  3HOZ G;  3ULL A;  2IHF A;  2BH8 A;  2JEB I;  3KJP A;  2UUA Q;  5DLQ E;  4LUV A;  4RG1 A;  4JI0 L;  3PUW A;  2LXK A;  5JEA G;  1SFO H;  3IRB A;  5C3E H;  1JJC B;  1WJJ A;  1ASZ A;  5K36 G;  1UEB A;  2ZJR A;  1N36 Q;  3PO2 G;  3Q8D A;  5C0X G;  5IP7 G;  5ELO A;  3KJO A;  2UUC Q;  3PO3 H;  3S1N H;  2K52 A;  3RZD H;  2PI2 A;  2F4V Q;  4OO1 I;  4KLK A;  1J5E L;  1PYB A;  2N3S A;  2ZTC A;  1CUK A;  5C4X H;  2B3G A;  3EN2 A;  1VQD A;  3ZJY C;  2JA5 H;  1B7Y B;  1D8L A;  2HT1 A;  2JA9 A;  2CFM A;  4DV7 Q;  4IO9 A;  1VQ6 A;  5GQO A;  4YY3 Q;  4ALP A;  2KBN A;  4JI3 L;  3CCJ A;  1GVP A;  1X3F A;  3KF8 B;  2VY3 A;  2NVX H;  3U4V A;  4NXM L;  1N32 L;  4GLV B;  2ID0 A;  1MKH A;  5C0X I;  3HOW H;  2E5L Q;  3HOY H;  4BY7 H;  1N9W A;  3G6E A;  2ZJP A;  1I3Q H;  4GOP C;  1HNW Q;  1SRO A;  2AWO A;  2K5V A;  3ULP A;  4GKJ Q;  1FJG Q;  1VQK A;  5M5X H;  1EYG A;  2E2I H;  1MJE A;  4JI6 Q;  4LF4 L;  3AYH B;  1CKO A;  4JC0 A;  2OQK A;  4A3I H;  3K8A A;  1HZC A;  1VQI A;  2VZA A;  4LUZ A;  1VQ4 A;  1Q7Y C;  4DR4 L;  1T9H A;  1WFQ A;  3WWV A;  4X62 Q;  4QL5 A;  1CSQ A;  3KDF A;  4HJ8 A;  3LGJ A;  4UY8 C;  2BA1 A;  1QUQ B;  3KFU A;  3OW2 A;  1IBL Q;  3STB D;  1OXX K;  2Q2H A;  4A76 A;  4DV2 Q;  3H0G G;  3W5O A;  1HNX Q;  1A8V A;  4BBR G;  1N34 Q;  4DAY B;  1M90 C;  4JI2 Q;  4P71 A;  1OXV A;  4AQY Q;  3U58 A;  3CCL A;  3HKZ E;  1JMC A;  4BY1 H;  2R7Z H;  4LFB L;  1PVO A;  4JBM A;  2I5H A;  4IPD A;  3I4O A;  3GTJ H;  2NVT H;  3M4Q A;  4KHP L;  2ATW A;  2RHS B;  2R7F A;  4R4Q A;  2KHI A;  1VQO A;  3L2P A;  4NXN Q;  2BH2 A;  2HIX A;  4NPS A;  4DV5 L;  4JI1 L;  1XNR L;  2Q2T A;  4IFD J;  3UE0 A;  1U5K A;  2ZM6 Q;  1CKN A;  2B63 H;  1VS0 A;  4QY7 A;  4LF5 Q;  1Q1E A;  3EIV A;  5M3F H;  4LF8 L;  1K8A C;  4PZ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...