4HJ5A

Crystal structure of schizosaccharomyces pombe pot1pc bound to ssdna (ggtttcggt)
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
138
structure length
138
Chain Sequence
b'SFSLLSQITPHQRCSFYAQVIKTWYSDKNFTLYVTDYTENELFFPMSPYTSSSRWRGPFGRFSIRCILWDEHDFYCRNYIKEGDYVVMKNVRTKIDHLGYLECILHGDSAKRYNMSIEKVDSEEPELNEIKSRKRLYV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protection of telomeres protein 1
publication title Nonspecific Recognition Is Achieved in Pot1pC through the Use of Multiple Binding Modes.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Dna binding protein
total genus 35
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2012-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16686 POT1PC ssDNA-binding domain of telomere protection protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4hj5A00
1MIUA 2JEAI 3AQQA 2OTLA 2HIVA 1X65A 4A3JG 1E22A 4IFDG 1VQKA 2F4VQ 1BBUA 1B70B 1JB7A 1CSPA 2KCMA 3I4OA 4C3IH 1IYJB 2Q2HA 1HZBA 4JBKA 3NBHB 4HIKA 2K5HA 4GN3B 4EQ5A 3CCVA 1NJIC 4JI3Q 2JJQA 3G4SA 5IYBH 3S1NH 2Q2IA 5FJ8H 5LMNW 5LMNQ 1XMOQ 3I4NH 4NXNQ 2I5LX 4LNQA 4DV6Q 5AJ3L 2WB1G 4OONA 4LF9L 5GAHC 1NBWA 2RCNA 4DR6L 1X9NA 5GROA 3LGJA 3CMEA 1GM5A 2E5LQ 2K4KA 1UE1A 4JI2Q 2ZM6Q 3KJPA 4A3IG 1QVFA 5DLQE 2R7DA 3KLWA 4IJLA 4DV2Q 1LYLA 2BA1A 2K5VA 4YWLA 2HT1A 3GTLH 1L2FA 3EBEA 4GLXA 3J7A5 2YTYA 4DUZL 2NVTH 4X6AH 1IBKL 1I3QH 3HOUG 2D62A 5JJLA 3FKIG 2I5MX 3OW2A 1PH3A 2K50A 4HJ7A 3L0OA 3E0EA 1E24A 4A3FG 5FLXc 3CXCA 2NZOA 1K8AC 5C4XG 5IYCG 3ULJA 2LXKA 4LUZA 4XIGS 2K14A 3UDIA 1EQQA 1P8LA 1DGSA 3AFQA 2B29A 1CKMA 1YHQA 3K7UC 4JV5L 5AJ3Q 4LF9Q 1WCMG 1N36L 4DR6Q 3KFUA 4YY3Q 3TS0A 1A8VA 1PH2A 3FHWA 1L0WA 1D7QA 1PA6A 1YVCA 4C3HH 3GTOH 3RN5A 1QVGA 2AMCB 1EOVA 4JOIA 3RLNA 2NVXH 3HOUH 2WFWA 3FKIH 2JA8G 1SROA 4JBMA 1NMGA 4A3DG 3K7AH 4GOPB 2JA5G 4OX9L 2A1AA 1Q86C 2UXBL 2CKZB 4A3FH 1QUQA 3ULPA 1CKNA 1VQIA 2YYZA 5C4XH 5M3FH 5IYCH 4DUZQ 3U58A 4AYBE 2K5NA 3M4QA 1IBKQ 3CC2A 3TRZA 2DGYA 3K80C 5HGQA 1I94L 4YWMA 3PGZA 1WCMH 3CPFA 3OYYA 2IHEA 4NPSA 3UE1A 2UUCL 1VQLA 3HFZB 1VQAA 2IY5B 1VQ4A 4YCUA 1Y14B 3W1GA 3EN2A 3J7ZC 1WYDA 1PH5A 1G291 3A5UA 1YHAA 2A19A 4JV5Q 2JA8H 4DV4L 3S1MH 3HOYG 1D8LA 1N36Q 2JA5H 3CP0A 4ALPA 3T1HL 1WOCA 1N9WA 1Y1WH 2R92G 4AH6A 2WAQE 3SGIA 4LF7Q 3HKZE 1ASYA 2Z6KA 3CC7A 1TWGH 4A75A 3HOXG 4DR4L 4DPGA 2YTVA 4PMWA 4OX9Q 2UXBQ 3JAMc 2B3GA 3J81c 4KLKA 2OWOA 2GVAA 1VQ9A 1SN8A 2XGTA 3GTJH 1L1OA 3BU2A 3WWVA 1YEZA 3KOJA 1I94Q 4L5RC 2NZHA 1YJNA 2VUMG 3HOYH 4BXXG 2UUCQ 4JOIC 1EWIA 1SE8A 1JJCB 3EIVA 1KD1C 2R92H 1PYSB 3H15A 4X62L 3W1BA 3PIOA 3NEMA 2B63G 4UP8A 2NVQH 1P16A 1X6OA 3U4VA 3PUZA 4DV4Q 1GD7A 1W2BA 4PG3A 3T1HQ 1SMXA 1IL2A 1GO3E 3ULLA 2HQLA 4GLAC 4GS3A 5JEAG 2K75A 1GVPA 1CSQA 2R7ZG 1SLJA 3GTPH 2PQAA 4JI8L 2D0PA 2YV5A 4JI2L 3A5ZB 1N32L 4LF5L 4FDBA 4RG1A 4OO1G 2VUMH 2UXCL 4BXXH 4APVA 1V43A 2IT1A 4GLVB 4DV2L 4DR2L 4BBSG 1VQOA 1Q82C 2D0OA 3ERSX 5M5XH 3PV0A 1VQ5A 4MZ9A 1T9HA 3KYHC 2B63H 3RZOH 4A3KG 2VQFL 3IRBA 2Z6KC 4HJ5A 4UP9A 3H3VI 1PVOA 1QZHA 1Q1EA 5M3MG 2XTIA 3MXNB 4OWWB 4DAMA 4BY7G 3T1YL 4OXPA 5JEAJ 5IY0A 4X62Q 1N33L 4P73A 1O7IA 2UUBQ 3CCRA 2R7ZH 3S24A 1KAWA 3B6YA 4GN5A 3J80i 2JA6G 4LFBL 1WFQA 1NMFA 3TS2A 2E2HH 2ZTDA 2JK8A 3KF8B 1L1OC 4NB3A 4OWTB 4BBSH 2CQOA 1OTCA 4YY3L 2N3SA 1X3EA 2MNAA 1PH8A 2EXDA 3NELA 4DV0Q 1TWHH 3TREA 4JI8Q 4A3KH 1YJ9A 4KHPQ 1X3FA 2HHHL 2H5XA 2MO0A 4LF5Q 1N32Q 3CCQA 2UXCQ 5M3MH 3UDXA 4DR2Q 2C35B 4BY7H 3PIPA 3PO3G 4A3BG 3KF6B 4DV3L 2UU9Q 2VQFQ 2JA6H 2NN6I 4DNIA 5IT9c 4LF6L 2LXJA 4A76A 1VQJA 3T1YQ 1K8GA 1QZGA 1EYGA 1N33Q 2UXDQ 2NVYH 5M3FG 5HY6A 1BBWA 4LFBQ 3U4ZA 5C44G 4C3JH 1VS0A 2MQHA 3VDYA 1EFWA 1Q12A 4DR3Q 4LUVA 1VQCA 2KBNA 3CW2C 3PO3H 4P72A 4R4IA 4A3BH 2AKWB 2BH8A 1A63A 5IP9G 1UEBA 2WP8J 3HKZG 3TQYA 4X66L 4DKAC 4IOCA 4LF7L 4X64L 2HHHQ 2MO1A 4JI4Q 1PH4A 4GNXB 3M3YH 1YI2A 1YITA 2E2JH 1B7YB 4GN4B 4GKKL 4TVAB 2KHJA 3K0XA 1C0AA 4A3MG 2OQKA 4L5QA 4DV3Q 1Y1WG 1U5KA 2ZJPA 1K0RA 2V1CC 1TWAH 1XPUA 1C7YA 5C44H 2QEXA 3CCJA 4B3TL 1VQNA 3BZKA 1MJEA 3RR5A 4LF6Q 1PFSA 1OXXK 4MNOA 5LMUL 4HJ8A 2WB1E 3D0FA 1WJJA 3KDFB 4YWKA 5C3EG 1JJ2A 4WJ4A 1Q8KA 2JA7G 2F3IA 3F1ZA 5IP9H 4LW1A 5H1SE 4POGA 2I5HA 1KQSA 1LUZA 1ASZA 4JI6Q 1VQPA 4LUOA 2VW9A 2N8NA 3BJUA 3RN2A 4QJFA 3PUWA 2E8GA 5BR8Q 3F2CA 1S40A 4A3MH 1X55A 2IX1A 3STBD 4X66Q 1S3OA 1LTLA 4X64Q 3UDGA 2ATWA 1GKHA 3M4PA 3OTOL 1A0IA 4X65L 1NY4A 2OCEA 1IBLQ 1V9PA 4GKKQ 3BZCA 2QA4A 4HIOA 5IE8A 5C3EH 4OWXB 1EIYB 4Y52H 4L5TA 2JA7H 1HZ9A 2CWPA 4B3TQ 1IZ6A 1IBMQ 1H95A 1VQMA 4LF4L 4IOAA 4R4QA 2KHIA 1KRSA 3GO5A 5LMUQ 4AQYL 1E1TA 1HNZQ 1Q1BA 4IFDI 1NE3A 2Z0SA 4GNXA 3K8AA 2UUBL 1PH1A 4GOPA 4DR5L 4JG2A 2ZTEA 4RMFA 2VZAA 3S16H 4A3LG 1Z47A 2HIXA 3S17H 4DAYB 5GAEC 2OQ0A 1N34L 1Q46A 5ELOA 2RHQB 2VQEL 1A62A 3CQZH 2PI2E 1KL9A 2N49A 3PUVA 1TXYA 1XJVA 3OTOQ 3KDFA 4IPHA 4X65Q 1LM0A 1QVCA 4R4TA 4DV0L 1KC8C 3NENA 1HR0L 4DV7L 4KI0A 4DK6C 1JMCA 2ES2A 4KHPL 2BA0A 1G51A 3G71A 4B3MQ 4JI1L 3GTQH 4IO9A 2OTJA 4TQUS 3I55A 4HJAA 4BA2I 2UU9L 4LF4Q 4DK3C 3CAMA 4R4OA 4QQBX 4JBJA 4H02A 5M5YH 4A3LH 1R9TH 4BA1I 4AQYQ 3CD6A 1K83H 4IPGA 5C0XI 3PCOB 3DM3A 2UXDL 2Y0SE 4JI7L 4LF8Q 1HNWL 4DR5Q 4WJ3M 2ID0A 3PUYA 2JEBI 3S14H 3PO2G 1U0LA 2VNUD 3GTMH 4DV1L 3F2DA 3W5OA 3F2BA 1TWCH 1N34Q 3RNUA 1SFOH 4DR3L 4A4IA 5IP7G 1IXRA 4L5SA 4A3CG 2VQEQ 3GD7A 1UE6A 4QGUA 4NXML 3J80c 2YTXA 1K3RA 1CUKA 1AE3A 3ICEA 4GNXC 2PI2A 1VQ6A 2K52A 1HR0W 1HR0Q 4DV7Q 2UUAL 2R6GA 1J6QA 1YHBA 3M85A 4GOPC 4JI4L 3A0JA 4LFAQ 4UY8C 4QIWE 3CC4A 3PF5A 4JI1Q 3M7NA 3I4MG 1NTGA 4B3SL 3S2DH 5K36G 1AH9A 2EIFA 1Y1VG 1K9MC 1X56A 2JE6I 3PSIA 3AYHB 4DUYL 3DLLA 2CWAA 4QL5A 5GAGC 1PH6A 4B3RL 4AYBG 4DV5L 1JJGA 2IX0A 1XPRA 1J5EQ 3PO2H 1YNXA 1QUQB 1CKNB 3RLOA 2QGQA 1OXVA 2PMZE 3I2ZA 4P74A 1FL0A 5IYDG 1HH2P 3MEFA 2AWOA 3RLFA 5IP7H 3M4OH 4A3CH 4K0KL 3E9HA 1HNXQ 4JI7Q 1HJPA 4A3JH 1HNWQ 1X54A 2KENA 4IFDJ 1K73C 4LFCL 4EX5A 3ER0A 1B8AA 2RF4A 4DV1Q 2IHFA 4JI6L 1FJGL 1JE5A 2BH2A 4J15A 1AE2A 4UPAA 1VQEA 3K81C 4IPCA 3I4MH 5FLMG 1V1QA 1Y1VH 3STBC 2GVBA 3L7ZC 4AIMA 5BR8L 4GKJL 1M90C 2WAQG 4NXMQ 3F8TA 1MKHA 4P71A 5C0XG 1I5FA 1PH7A 1M1KC 2UUAQ 1KXLA 2JA9A 1XNRL 1G6PA 5ELNA 4JCVE 1FGUA 1IBLL 5IYDH 4B3SQ 4HJ9A 4JI5L 4B3RQ 4DUYQ 1EIFA 4A3EG 4DR1L 1C9OA 1BKBA 4DV5Q 3CCEA 1KIXA 3H0GG 2ASBA 2CFMA 3PUXA 1XMQL 2YU9H 1IBML 5JJKA 4A3IH 2R7FA 1UWVA 2GN5A 1PHJA 4A3GG 3CCMA 1YIJA 2N78A 2I0QA 1XPOA 1S72A 4K0KQ 1YBYA 1L1OB 3A74A 5EAYA 5FLMH 1UE5A 1WI5A 4O2DA 2CCZA 3H3VH 1Z9FA 1HNZL 2EQSA 4KHZA 1YZ6A 1VQHA 3HKSA 4YHHL 4R1JA 5C0XJ 4LFCQ 3ZJYC 1Q81C 4BBRG 1VQBA 1SR3A 3JC66 1N8RC 1FJGQ 4QY7A 1KRTA 3KF6A 3CCSA 4MTNA 4HIMA 2ZTCA 3S2HH 1VQDA 4ME3A 2LSSA 2NN6G 1VQFA 4GKJQ 2KCTA 3U50C 3S1RH 4A3EH 2VS1A 3H0GH 5GADC 2PNHA 1XNRQ 4R4CA 4YCWA 4JBWA 4LWCA 4A3GH 3HOVG 1HZAA 2AWNA 1W3SA 3S15H 4JYAL 4JI5Q 3Q8DA 2ALYB 5IWAL 1I50H 2PQAB 4B3ML 4DR1Q 1YJWA 2E2IH 4XTCS 1HZCA 4A93G 1XMQQ 2VL6A 1PH9A 3D31A 1BVSA 1OXUA 5C4JH 4BBRH 3L2PA 4OO1I 3HOWG 3UDFA 4DR7L 3UE0A 4POFA 2ZJRA 4A3DH 4JI0L 2Q2UA 2AHOB 3CMAA 3G48A 3JAMi 3J81j 3GTGH 4PZ7A 4YHHQ 3J81i 3RZDH 1XNQL 4IJHA 2Y0SG 1VQ8A 3CF5A 4LF8L 3HOZG 5JJIA 2VY3A 2L15A 2JQOA 1OXSC 4PZ6A 3HOVH 2R93G 5GQOA 1I6HH 4P75A 4YCVA 4Y7NH 2RHSB 1VQGA 3GDEA 4PZ8A 3TEHB 4A93H 3CCUA 1X3GA 4BY1G 2A8VA 5M5WH 1OXTA 3I56A 2Q2TA 1EQRA 3HOWH 1VQ7A 1RIPA 2F4VL 1RL2A 3PF4A 3E9IA 3I7FA 4JYAQ 5IWAQ 2F52A 4UP7A 4LFAL 3AEVA 1MJCA 1JT8A 3AFPA 5E7NA 5J3BA 2ZJQA 3GTKH 1TWFH 2DUDA 4C2MH 3HOZH 3FP9A 4JI3L 1CKOA 3HOXH 1J5EL 4DR7Q 3CCLA 1XMOL 5LMNL 3S1QH 4JI0Q 2R93H 1FVIA 4NXNL 2MFIA 4DV6L 1VCIA 1Q7YC 3M9BA 1XNQQ 1PV4A 1XTDA 1PYBA 1SRUA 3KJOA 4JC0A 1HNXL 3CPWA 4BY1H 4IPDA 1KHIA 1E7ZA 4O0AA 5IYBG 1UE7A 3G6EA 5FJ8G 1E1OA 2E5LL 3I4NG 2ZM6L 4DR4Q 4HIDA 2FXQA 1EUJA 1E3PA
chains in the Genus database with same CATH superfamily
4F7XA 1MIUA 2JEAI 3AQQA 5KGUA 3GQBA 4RAUC 4U673 1VQKA 2F4VQ 4C1NK 1PTOC 4N9TA 1K83B 3BVZA 4G7HC 1JB7A 2J7ZA 2KCMA 1EQVA 3KUPA 3WDNA 4JBKA 4HIKA 1C8CA 1NJIC 3CCVA 2JJQA 4KY6A 4K6DA 1BDOA 4DGZA 4CJ1B 3I4NH 5I9PA 4RHRA 3K5MA 5AJ3L 3I91A 3HS0C 2EYFA 2WB1G 4LF9L 1YNJC 3V2TA 5GAHC 4DR6L 2SOBA 1DM0B 2F0FA 2Q8RE 1QVFA 2ZM6Q 1WTRA 1B9NA 2R7DA 4ZRZA 2K5VA 2AUJD 3ITPA 4ZAIA 1IBKL 1I3QH 3M4OB 2D62A 1G2SA 2K50A 1CQVA 2MPMA 1EY5A 2KECA 3CXCA 2NZOA 5C4XG 2Z4IA 2F0QA 1TS5A 2M00A 3TP6A 3BG3A 3AFQA 1YHQA 1CKMA 4KN7C 3K7UC 5AJ3Q 1FYCA 4LF9Q 4DR6Q 3KFUA 3Q22A 3FHWA 1Y8OB 1BCPB 1JICA 1D7QA 1TT2A 4C3HH 3RN5A 1JR0D 1EOVA 4JOIA 3HOUH 1NMGA 4A3DG 3K7AH 2JA5G 2UXBL 2A1AA 2YU9B 3ULPA 4XT1B 5IYCH 3TRZA 1IBKQ 5BN3A 1GUSA 2EYMA 1LTGD 4X3SA 1WTPA 2Z9HA 3UE1A 2UUCL 3HFZB 1VQAA 1SMYC 4O42A 4C3HB 1VQ4A 2BCOA 3QWNA 1PZJD 3W2DA 1YHAA 2DY7A 3P75A 1S4ZA 3SE0A 5BN5A 3HOYG 1D8LA 4A3EB 3T1HL 2B2WA 1Y1WH 2R92G 3SGIA 4A3GB 3HKZE 2HDLA 1F2ZA 2Z1CA 1VF7A 5I2YA 2UXBQ 3J81c 1UUPA 4BBRB 1SN8A 4ZLTF 5EKIA 3FDTA 2UUCQ 3RZDB 1SE8A 1HHVA 3QOLA 1KD1C 1A15A 1PYSB 2B63G 2NVQH 1D1IA 4ZCKA 1M8AA 1ZXTA 4Y7NB 3S9WA 3T1HQ 3G6JB 1IL2A 2F0HA 2HQLA 4DXGA 1SLJA 2PQAA 4JI2L 3A5ZB 1EEID 1SSOA 2CVRA 4Z9CB 4LF5L 2UXCL 2V4DA 4BXXH 1DCZA 1V43A 1TWFB 4APVA 4C2MB 4HSVA 1Q82C 1EWCA 3ERSX 1O7ZA 2AQ1B 1T9HA 1QNKA 1QZHA 3MXNB 3TDQA 4BY7G 2KA7A 5IY0A 4ZK9B 1O7IA 1KLGD 3CCRA 2F0LA 2R7ZH 2X69A 1KAWA 4HSPA 4LFBL 3J80E 4KKTA 5ELFA 2WKCA 2EYHA 1OTCA 1CZWA 1X3EA 2D5DA 1EU4A 2EXDA 4DV0Q 3DHQA 5JVG3 4LF5Q 4C3IB 2UXCQ 2L55A 3UDXA 5M3MH 5I9OA 1EL0A 3KF6B 5EKKA 4LAAA 2EY6A 2NN6I 1SYEA 1VQJA 1K8GA 1EYGA 5M3FG 1SYGA 4LFBQ 4L63B 5JPNC 5C44G 4C3JH 2MQHA 3VDYA 1EFWA 1Q12A 4KJOA 2LY7A 3CW2C 4CGYB 4R4IA 4HCEA 1SNOA 2AKWB 2BH8A 4UAIA 1BCPD 1A63A 1HA6A 4LF7L 3HKZG 4X66L 1JB3A 4X64L 2WB1B 1YITA 2X6LA 4GN4B 5ELCA 1O80A 1SYCA 1C0AA 1ZEQX 3MXGA 1PZKD 5A35A 1VQNA 3E0JA 2K5QA 1PFSA 4HJ8A 4S3SA 3KDFB 1JJ2A 4WJ4A 4FF2A 2JA7G 1W6KA 2F3IA 3F1ZA 3NK9A 5CV9A 3A7AB 4X3KA 1KQSA 1M4VA 2DN8A 4BWGB 2N55A 4IUTA 2VW9A 4R8NA 5BR8Q 1X55A 2MHVA 4X66Q 3CKIB 4LK1C 4X64Q 3UDGA 3BDLA 1HA5A 1RCVD 3MVVA 3OTOL 1A0IA 2RA4A 2KQ3A 2OCEA 1CHPD 1EY8A 2F0GA 2QA4A 5C4ZA 4V190 4L5TA 1TS4A 2CWPA 1K0SA 4LF4L 1HNZQ 1V1PA 3A56A 3GP7A 3K8AA 2UUBL 1X3QA 4IZ8A 3S16H 4A3LG 2E74C 4ZYSA 2HIXA 3S17H 1D5XC 2OQ0A 4J1MA 1H9MA 3GTJB 1I4HA 5EBCA 2R3ZA 2B2YA 5CC4A 1I4RA 3OTOQ 1KC8C 1JOOA 3P1HA 5L37A 3HOYB 3NENA 2L0CA 4KI0A 4PMCA 1JMCA 4IUNA 1G51A 4B3MQ 3GTQH 1EWHA 2UU9L 4LF4Q 4QQBX 1X32A 1R9TH 1EFID 3CD6A 4IPGA 4QCLA 2UXDL 3Q6SA 3GTPB 4JI7L 4LF8Q 2JEBI 1U0LA 2VNUD 4DV1L 3W5OA 3F2BA 1LV9A 4A4IA 5IP7G 1EU3A 3H09A 1BCPC 5E4WC 1Y69U 2B63B 3GD7A 4NXML 1K3RA 1CUKA 1AE3A 2NZ1D 3ICEA 4GNXC 1VQ6A 4EQNA 1HR0W 2EE1A 2R6GA 4LFAQ 4QIWE 3I4MG 2EIFA 3Q0AA 1UNSA 2RDGA 5ELEA 4AYBG 2N88A 2E2HB 3PO2H 4R8IA 4KD3A 4ME5A 5TSSA 1GXDC 4P74A 3NWTA 2AWOA 1I6VC 2OT2A 1HJPA 4JI7Q 1ML0D 2BE5D 2Z8LA 3ER0A 1B8AA 4DV1Q 2F0WA 4DK1A 4JI6L 2BH2A 3K81C 5K36H 4H0LC 4CHTB 2ICEC 4B9WA 1M90C 4NXMQ 1MKHA 5FLXE 5C0XG 4FVMA 2JA9A 1G6PA 4DAPA 5ELNA 1SJHD 1FGUA 4JCVE 1A3TA 5COYA 2JYOA 2NVYB 4HJ9A 5CYUA 1SNDA 1C9OA 3KF8A 1XMQL 2DY8A 4A3IH 3E6ZX 4M8AA 1B3AA 3NQTA 1RKNA 1S72A 5EAYA 5FLMH 3H3VH 4O2DA 1TS2A 3FVQA 1YZ6A 4YHHL 3MXUA 2B8GA 4R1JA 1CFMA 1Q81C 3M3YB 1SR3A 2E2JB 1PZID 4HIMA 2ZTCA 2QW7A 4CBVA 2NN6G 3BVGA 1ICWA 5KNBA 1TWAB 2FHTA 5C44B 1G91A 3EVQA 3H0GH 1LT6D 2PNHA 4YCWA 4R9WA 3K0YA 1HZAA 3EJIA 4KY7A 2EYOA 1I50H 3HKZB 2E2IH 1HZCA 5LHY1 4A93G 2PCFB 1XMQQ 1OXUA 3VR3A 4DR7L 4POFA 3G7LA 3T56B 1BXTA 3TZUA 3CMAA 3H0GB 4YHHQ 4IJHA 2BDOA 1EOTA 1VQ8A 3HOZG 2VY3A 2JQOA 3EQLC 3MEHA 1I6HH 1GUNA 1KDCA 1SXTA 4OIJA 2L9HA 2AQ3B 4BY1G 3FMCA 2Q2TA 2A8VA 4F88A 3HOWH 2F0DA 2D9UA 3VR4A 4EQPA 3PF4A 3KLRA 3AEVA 3GTKH 5C3WA 1JE4A 2K28A 1F2LA 1L0YB 1E2ZA 3OWFA 4QB4A 1CKOA 4NMZA 4DR7Q 3CCLA 3S1QH 4NXNL 3VYSA 2MFIA 3X3NA 2F0SA 3CQZB 4DFAA 2BE5C 1HNXL 4JC0A 3CPWA 1SDFA 1E7ZA 1HTLD 4DR4Q 3I4NG 2E5LL 2FXQA 3E3XA 4RGTA 3SXHA 2OTLA 1X65A 5E4XA 1B3QA 4PV1C 5M5YB 1TU2B 2IX3A 5HGTA 3VYUA 5EBDA 3TBIB 1IYJB 2IPKD 3NBHB 3R2TA 3J7YW 5M9OA 4DAYA 1TWCB 1EY6A 4RCOA 4NXNQ 5IGBA 1NBWA 2RCNA 1LTID 4ID6A 3CMEA 2E5LQ 2RBMA 3I4LA 1FNUA 4IJLA 2QKIC 1LYLA 3MFYA 4YWLA 2HT1A 2PW7A 1L2FA 5IT9E 3EBEA 4KMUC 2YTYA 2A73B 2NVTH 4C3HG 5D3DA 3HOUG 4CKEA 5JJLA 2I5MX 3T53B 3OW2A 4HJ7A 4A3JB 3E0EA 1E24A 4PQXA 5IYCG 3ULJA 3RMHA 2E76C 2KCCA 1BBXC 1DGSA 2FFKB 4O1NA 4FF4A 3I4MB 3K58A 1A8VA 1J9OA 4H13C 1L0WA 3EA6A 1YVCA 3GTOH 4FXKC 2AMCB 2WFWA 2K5DA 1SROA 4ZKCB 4GOPB 4OX9L 1IKLA 1IHZA 5FK9C 1GUGA 1A3VA 2A74C 1VQIA 1VMCA 2K5NA 2RCFA 4XYQA 2DJFC 2DGYA 2O5IC 3K80C 1F2YA 4FP5D 1I94L 4YWMA 3PGZA 1WCMH 3CPFA 4X3UA 3OYYA 2IHEA 5DEHA 3W1GA 3EN2A 1PH5A 3S2HB 1DD2A 1G291 1ENCA 2NUCA 3S1RB 4ALPA 3BYTB 3DWAA 2J0TD 2JN4A 3C1EA 1V1OA 2WKDA 3CC7A 3K5OA 4L6TB 3SHLA 3CHBD 4OX9Q 1RF2D 3KBXA 3SK6A 1SNMA 2VB2X 1L1OA 3WWVA 1KABA 1YEZA 4FXGC 1J8IA 1I94Q 3LWUA 1YJNA 4FXDA 3GTGB 4BXXG 1EWIA 2QDBA 2XNAC 3H15A 4X62L 4UP8A 3U4VA 3IAYA 1GD7A 4PG3A 3Q23A 1EZ8A 2OF1A 1SMXA 1ZKOA 3IFTA 5E3FA 2R7ZG 1LTRD 2B2VA 4JI8L 2D0PA 1N32L 4FDBA 1DZ1A 2VUMH 1QE6A 3D4WA 4OL7A 3OW7A 2D0OA 2PYKA 5M5XH 3HOZB 3PV0A 1WTXA 1HUNA 3HOXB 1SBBB 4MZ9A 3RZOH 4CDCC 4DN4M 2VQFL 2Z6KC 3H3VI 1PVOA 1IYVA 1Q1EA 5M3MG 1ET6A 4OWWB 4L8JA 4BY1B 3T1YL 4OXPA 5JEAJ 4X62Q 2KVMA 2J4XA 1H9RA 3J80i 4GN5A 1WFQA 4QIWB 4RGNA 5C5LA 2MNAA 1PH8A 5AFWA 4RH6A 4JI8Q 4DF7A 4A3KH 3OOCA 2DNCA 4C3JG 2MO0A 1N32Q 3CCQA 2SNMA 3SDZA 1EY9A 4IUVA 3I4NB 2VQFQ 2JA6H 1JCKB 3H3VC 3T1YQ 5HY6A 2ICIA 1SJED 1VS0A 4LUVA 5C4HA 1DJRD 3PO3H 4P72A 4XYOA 5KEEA 4A3BH 2JA6B 3NBIA 1I3QB 1CQFA 3NWSA 1UEBA 2XIWA 1U4RA 4JI4Q 4GNXB 4GKKL 4M1UB 1B44D 2KHJA 5KNCA 4HR7B 1K0RA 1SEBD 1GJXA 1C7YA 2QEXA 4B3TL 1MJEA 2A5HA 1LLRD 3OHXC 4FO2A 2LS01 3RR5A 5A2QL 1QJOA 2QILA 1NCVA 5CMDA 1Q8KA 5IP9H 5H1SE 3HOUB 2I5HA 4ODGA 2F1MA 3K7AB 3AU7A 1PLFA 2N8NA 3BJUA 2CH4W 2E8GA 4HEDA 1S40A 4DU9A 1O7LA 5DM73 5C5MA 2VXWA 2EY5A 1EIGA 1SNCA 4K14A 5CR3A 1IKMA 3DWPA 1PMRA 4GKKQ 3BZCA 3K6OA 4OWXB 3D6CA 4Y52H 1TY2A 2A6HD 3GV3A 4B3TQ 1W6JA 1VQMA 4DA2A 4R4QA 5JPMC 1U4PA 3GO5A 1Y1WB 2KHSA 4AQYL 1E1TA 1NE3A 1S5BD 1EEFD 3J81E 4I7AA 1L0XB 2VZAA 1Z47A 1TQOA 1Q46A 2VQEL 2F0EA 3KDFA 4IPHA 4DV0L 4R4TA 1HR0L 4DV7L 2ES2A 1MSGA 2K04A 2BDNA 2G5DA 5FOBB 4IO9A 2OTJA 1BUVT 2ZXRA 2NVQB 4TQUS 3FPUB 1EY7A 2OXPA 5EPJA 2EVBA 1D1KA 4AQYQ 1K3BC 5C0XI 3PCOB 3DM3A 4TSSA 5CV4A 3CU7A 5KIXA 2ID0A 3S14H 3PO2G 1KLUD 3GTMH 1SFOH 2EOTA 2VQEQ 1V8QA 2PO4A 4QGUA 1FD7D 4F8MA 3C2PA 2JP1A 3J80c 4WRDA 2B2UA 2K52A 5T1GA 1HR0Q 4DV7Q 1J6QA 1YHBA 4GOPC 3QG1A 3CC4A 1NAPA 3A7LA 3S2DH 1NTGA 2R7ZB 1XTCD 5K36G 1X56A 2JE6I 3PSIA 1PH6A 4B3RL 3DLLA 2CWAA 1NNXA 4DV5L 5FKAC 2IX0A 1XPRA 1Y8NB 3ERQA 1SFOB 1F9PA 1OXVA 2PMZE 1D6EC 3NSWA 2K7VA 1GUTA 3KK7A 1ICFB 1X54A 2OEOA 1D2BA 3DEPA 4LFCL 4EX5A 2RF4A 5M3MB 3MZ5A 1S5DD 2G9HD 4J15A 3P20A 4IPCA 5FLMG 1Y1VH 5BR8L 4AIMA 1RTNA 2JSOA 4GKJL 5K5PA 3F8TA 2RVLA 4ZUJA 1STYA 5IYDH 5DAUA 4B3RQ 1E2VA 1EIFA 2A6HC 3I3CA 4C3JB 5D3IB 2M2LA 3H0GG 4H7BA 2CFMA 3L9AX 4K6LA 4DV5Q 1KIXA 2ASBA 1YIJA 1AFPA 2I0QA 1XPOA 1YBYA 3A74A 2CCZA 2RSNA 1Z9FA 1HNZL 2EQSA 1VQHA 4LFCQ 4DXFA 2CHBD 3ZJYC 4FF1A 1KRTA 4HAEA 4MTNA 1VQDA 2LSSA 4GKJQ 3U50C 5C6AA 1HFNA 3VR5A 4IUPA 1QG7A 4CJ0B 3S15H 4JYAL 3Q8DA 1G8ZD 2PQAB 2O4XA 3NTHA 5IWAL 3HP3A 4B3ML 2EDGA 4DNTB 1WD1A 2K03A 2VL6A 3D31A 1FNVA 4N8FA 5CV8A 5C4JH 3L2PA 3HOWG 3UDFA 2MUYA 4NW2A 3UE0A 1HXYD 2WACA 4A3DH 1EYDA 2AHOB 4K5XA 3G48A 1WVLA 3J81j 4PZ7A 3CRLC 3TP5A 3JAME 1CT1D 4LF8L 5JJIA 2L15A 1PRTD 2X6GA 3HOVH 4RKLA 2WV6D 3GV6A 5GQOA 1NUCA 4YCVA 2RHSB 4PZ8A 4HTHA 1JWUD 3MXPA 5M5WH 1OXTA 1A2TA 5D14A 4V0BA 5DM63 3E9IA 3RUZA 4UHVA 4JYAQ 3QO2A 5IWAQ 4LFAL 2DUDA 3S16B 1NSNS 3FP9A 3UI2A 4JI3L 3S17B 1F9RA 2R93H 5EPKA 2Z6BA 5KYIA 4DV6L 1Q7YC 3AB9A 1PV4A 3H91A 1SRUA 4EQOA 4N9PA 1I4QA 1KHIA 1AW7A 4Q0FA 5JOBA 3I73A 1S5FD 3GTQB 1H9SA 3C1FA 4OIKA 1STGA 2A68D 4DK0A 4A3JG 1WTHA 2K1BA 3J80L 4CKBA 1R9TB 1BBUA 1B70B 4QUFA 4QMGA 1H9JA 3I4OA 1AZPA 3A8IE 2K5HA 3LX0A 1I4XA 4JI3Q 1EY0A 1GUWA 1HRJA 3G4SA 5LMNW 5FJ8H 4RCNA 2I5LX 4EGVA 2I46A 4DV6Q 1JWSD 4OONA 1ENAA 1EY4A 1UEAB 1AZQA 2EYLA 2AQ2B 4IFDH 2PZWA 1IW7D 1GM5A 3OIQA 2K4KA 2XRQD 2PPBC 5DLQE 2IJ0A 3KLWA 4DV2Q 1IYUA 2RDFA 4QUCA 1TVXA 3GTLH 4N8X1 3PO2B 1TIID 5EKLA 4GLXA 4DUZL 4X6AH 1I4PA 3EROA 2L1BA 1KAAA 4OELB 3MAQA 1VMPA 5FO9B 1PH3A 3L0OA 3BZDB 1PTOH 3DEOA 1WTWA 1BR9A 5FLXc 1K8AC 1RD9D 2LXKA 4LUZA 3BDCA 4XIGS 2K14A 4WJWA 2HDMA 3UDIA 1LTAD 1P8LA 1SE2A 4NDXA 2B29A 2EY2A 1WCMG 2F0MA 4YIJA 4YY3Q 3TS0A 4HMIA 5J39A 1PH2A 3VR2A 1JC7A 4RGOS 2I07B 3I72A 2H1EA 1QVGA 1ESRA 2NVXH 4PNYA 3FKIH 2HD3A 4U68A 1Q86C 3QIAA 2CKZB 4A3FH 1QUQA 1CKNA 2YYZA 5M3FH 4DUZQ 2K05A 3U58A 4A3IB 3OMCA 3M4QA 1SE4A 1Q8IA 5HGQA 2F0TA 2C5CA 4NPSA 4IALA 1Y14B 3D4RA 1AP0A 5NUCA 5G3LF 2JA8H 4DV4L 2QEJC 3S1MH 1EZ6A 3K5NA 1FNWA 4B08A 1WOCA 2CW0D 1N9WA 1PFNA 4AH6A 2WAQE 4GZYC 1Z7TA 1ASYA 1JORA 1TWGH 3VR6A 3HOXG 4DR4L 1R4PB 4DPGA 3OWEB 1I50B 3KLSA 2E2IB 4OEMB 2B2TC 2B3GA 2A68C 3MFGA 4KLKA 2GVAA 1VQ9A 1E0BA 2XGTA 5ELBA 3KOJA 4CDEC 2NZHA 5IIFA 2VUMG 3URYA 4JOIC 4DNRB 3R93A 2EY1A 3MHBA 3W1BA 1KDBA 3PIOA 3NEMA 1XXGA 3QR8A 1I6HB 3D6WA 4DV4Q 5ISRA 1W2BA 1G2TA 1GO3E 4GLAC 2K75A 1GVPA 1CSQA 3A54A 3HOWB 1IW7C 1ILPA 1X3PA 3T51B 1S5ED 1NR4A 2F0OA 2ZXOA 4RG1A 3SVMA 3GTKB 4GLVB 3NPPA 1VQOA 1VQ5A 1G6ZA 2K01A 3S1QB 2B2WC 1B4OA 3SK5A 4A3KG 2RKSA 3IRBA 2PZUA 3PQIA 4UP9A 3LWEA 2XTIA 1ENFA 5JEAH 2Q8TA 4P73A 4TRDA 3S24A 1AN8A 3B6YA 2FJ2A 2JA6G 2F0VA 1A6XA 1CZGA 2ZTDA 4OO1H 3KF8B 4MIUA 4OWTB 4BBSH 2CQOA 3NELA 1TWHH 3TREA 2PMZB 1KNAA 1VDZA 3TMEA 5CBEE 3PO3G 4A3BG 1FR3A 1B2TA 4DV3L 1QILA 2SDFA 4DNIA 5IT9c 2F4IA 1VF5C 3NXWA 4A76A 4FNFA 1QZGA 5FLXL 1TWHB 1LO5D 1TS3A 3U4ZA 4RHSA 4WORA 4B9XA 4DR3Q 1XYIA 1JOKA 2CW0C 2KBNA 4KD4A 4CDDC 4J6HA 2NVTB 5JJZA 5IP9G 3CRKC 3TQYA 4IOCA 2KOLA 4ABNA 1O7YA 3ND9A 4G7OC 1YI2A 1B7YB 4UDUC 2Z4HA 4TVAB 3K0XA 1F77A 2OQKA 2L12A 4DV3Q 1U5KA 1Y1WG 2ZJPA 2V1CC 1XPUA 3CCJA 3BZKA 5IGEA 4MNOA 2WB1E 1WJJA 1STEA 3GTOB 1DYQA 4LW1A 1LACA 1ASZA 5LL6S 4C1NI 3RN2A 3FEWX 3PUWA 4I65A 3EFXD 3F2CA 2EJGC 4A3MH 4KK7A 3STBD 1S3OA 3MA2B 1GKHA 3M4PA 3J7AV 1WCMB 1NY4A 1IBLQ 3J7AF 1V9PA 1CHQD 5IE8A 5C3EH 1EIYB 3QJYA 1F2MA 1IZ6A 1IBMQ 4P2CB 2IWHA 2PZTA 3I70A 1MGSA 4A3MB 5T1IA 1Q1BA 4IFDI 2Z0SA 1DOMA 4GNXA 3DMUA 2C9OA 1PH1A 2ZTEA 1DONA 2QF7A 4RMFA 3BS1A 1B1ZA 4DAYB 5GAEC 1N34L 5ELOA 1KNEA 2RHQB 1A62A 4F87A 1KL9A 1CTMA 2F0UA 2NWGA 1LM0A 3D8GA 4DK6C 4K2LA 2BA0A 1MD2D 3G71A 4JI1L 2XWBB 2F3WA 3I55A 4HJAA 4BA2I 4DK3C 3CAMA 4R4OA 2EYPA 4H02A 3TP7A 4BA1I 1K83H 1RTOA 1HFGA 4IQZA 1RJTA 2Y0SE 1HNWL 3VYTA 3TN2A 3PMFA 2KJXA 2VUMB 2KUMA 3F2DA 1JQYD 4KV6A 3OSOA 1N34Q 3RNUA 1CA6A 5M5XB 1IXRA 2H4OA 3RZOB 3RD4A 5G3LD 1UE6A 1TKWB 2YTXA 2PI2A 1H9KA 2UUAL 4JI4L 3M85A 4UY8C 3PF5A 4JI1Q 2EPBA 3QOJA 4B3SL 1Y1VG 1RDPD 1K9MC 4DUYL 3AYHB 1K8MA 4QL5A 5GAGC 3W3AA 1J5EQ 1YNXA 2B2YC 3RLOA 5IT9L 4ZUIA 1FL0A 2G9DA 5FO7B 3DUZA 5IYDG 1PRTF 1D5MC 3M4OH 4A3CH 3E9HA 3FPPA 1HNWQ 4A3KB 2KENA 1EQTA 2B8FA 1HQRD 2IHFA 1I4GA 1FJGL 2XWJB 2FMMA 5IODA 1V1QA 3STBC 2GVBA 4P71A 2EJMA 3MXNA 1HCZA 2UUAQ 1XNRL 1ILQA 1II3A 4B3SQ 4JI5L 3PIO3 4DUYQ 1NR2A 1FGBD 2RDHA 1BKBA 3CCEA 3PUXA 2YU9H 2R7FA 1UWVA 2GN5A 1PHJA 2B2TA 3PO3B 1DXMA 4A3BB 2N78A 4X3TA 1L1OB 5FO8B 1UE5A 4BS9A 2HUGA 3HKSA 5C0XJ 5E1FA 1FJGQ 4QY7A 3KF6A 4ME3A 4TKOB 4ZKBB 5KYLA 2KCTA 2P5ZX 5BN4A 4A3EH 1IL8A 2VS1A 4CDFC 4G57A 3AMUA 1XNRQ 4A3GH 1KDAA 4JBWA 4LWCA 3HOVG 2AWNA 1QWYA 1W3SA 4JI5Q 2WAQB 4G4KA 2ALYB 4NP5A 1YJWA 4XTCS 4K5VA 2BOSA 3T4AC 5DNFA 2IL8A 4OO1I 4BBRH 1Q90A 3R2IA 2ZJRA 1KTKA 2K33A 4JI0L 3U9SA 5CGKA 3JAMi 3RZDH 2TSSA 2A69D 1A2UA 2Y0SG 3CF5A 2QDLA 1STAA 5IGCA 3A8JE 1PRTB 5HURA 4K8IA 2PQEA 4K5WA 4QF4A 2R93G 4P75A 4Y7NH 4MN3A 5JAVA 1VQGA 3MWYW 1LT4D 1EQRA 4HCSA 1VQ7A 3I90A 1XX8A 3BVMA 3I7FA 4UP7A 1MJCA 4XQNA 5E7NA 2ZJQA 5IGFA 1TWFH 4C2MH 1STBA 2EJFC 3A55A 3BYYB 3HGBA 1XMOL 1LTTD 2K6AA 5LMNL 4IN3A 3IFDA 4KHVA 4MTKA 1BF4A 4JI0Q 1JOQA 3DXJC 4H44C 1U9RA 2GA4B 2NYZD 1EYAA 1PYBA 2K32A 4O0AA 4KJNA 3G6EA 5FJ8G 1E1OA 2MGSA 4HIDA 5CORA 1E3PA 1Y8PB 2HIVA 2F3VA 3M7GA 1E22A 4JPBW 1PFMA 4IFDG 1PFBA 5J1ZA 5KRUA 2NBFA 3NTKA 2LKVA 1C4QA 3K5LA 1SNPA 1CSPA 1EYCA 4C3IH 1BOSA 1HZBA 2Q2HA 3S14B 4GN3B 4EQ5A 3GTMB 4CKCA 3S1NH 5IYBH 2Q2IA 1XMOQ 5LMNQ 4XQJA 4LNQA 5ELDA 1UAPA 4PMBA 1HQMC 1X9NA 1ET9A 5GROA 4KKSA 1GUOA 3LGJA 5EGTA 1T5EA 4JI2Q 1UE1A 3P7JA 3KJPA 4A3IG 3S2DB 3TSSA 1HPCA 3MTSA 1GHKA 2BA1A 2HCIA 3S1NB 3J7A5 1QB5D 1ONLA 3FKIG 3ZYYX 4A3FG 3TP8A 3SR1A 4ZQ3A 3V05A 1EQQA 3NHHA 4LMQD 2ZT9C 1RHPA 4IURA 4JV5L 1Y1VB 5IOCA 3KBGA 5D65A 1N36L 2CQAA 2A69C 2R61A 3KLSX 1PA6A 3NUCA 2WIIB 3DWQA 3RLNA 2JA8G 4JBMA 1LTSD 4IUQA 5C4XH 4AYBE 3CC2A 3TZDA 2O5JC 4CJ2C 5IGGA 2XVSA 1VQLA 1A3UA 2IY5B 4YCUA 1DOKA 3J7ZC 1WYDA 4LJZC 3A5UA 2A19A 4JV5Q 1N36Q 2XSCA 1SNQA 3CP0A 2JA5H 5C4XB 3IKJA 1B50A 1BO0A 2L11A 4LF7Q 1SE3A 2Z6KA 3S15B 1QNUA 3U9OA 4A75A 2YTVA 4JK1C 1RODA 4PMWA 1E2WA 1LTBD 3JAMc 3J81L 5C4JB 1WTOA 2OWOA 3GTJH 4K2KA 3BU2A 4XXEA 4XT3B 4A3DB 4L5RC 1T5XD 2JA5B 3HOYH 3BDOA 3T16A 1JJCB 1XWEA 3EIVA 2R92H 2QCPX 3FRPB 3HOVB 1P16A 1X6OA 3PUZA 3HG9A 3N6RA 2D2CC 1PTOF 2ENBA 3ULLA 4Q5VA 5M5WB 4GS3A 5JEAG 2NTTA 3E5SA 3GTPH 2YV5A 5KNDA 2L5TA 1Z6HA 4OO1G 4DV2L 2R92B 2IT1A 4DR2L 4BBSG 2Y0SB 3K59A 2RSOA 2B63H 3KYHC 2R93B 3VA7A 1WTQA 4HJ5A 4DAMA 3IL8A 3X3MA 1N33L 3L3OC 2UUBQ 1NMFA 3TS2A 2E2HH 2JK8A 1L1OC 4NB3A 2LMCB 5CBAE 1ZYRD 4YY3L 5C3XA 2N3SA 2F0JA 1YJ9A 2EXZA 1X3FA 2HHHL 2H5XA 3T13A 4DR2Q 2C35B 3D4DA 4BY7H 4WFN3 3PIPA 4K8JA 2O2LD 2DNEA 3V96A 2UU9Q 2B2VC 4LF6L 1AEXA 2LXJA 2WINB 1N33Q 1B53A 2IW3A 2UXDQ 2NVYH 1BBWA 3D3RA 1HUMA 4E6IA 3GTLB 4JW0A 4BY7B 2L4NA 1VQCA 5J22A 4OHJA 2WP8J 4DKAC 2HHHQ 2MO1A 1PRTC 1PH4A 1ESFA 1V1PB 2EYJA 1PTOB 1BQQT 3NBHA 3M3YH 2E2JH 4HN7A 1SYBA 3C3LA 4A3MG 4L5QA 3VA5A 2K5WA 1TWAH 5C44H 3HEJA 5EJWA 4LF6Q 2NB0A 1OXXK 5LMUL 3D0FA 4YWKA 5C3EG 1PYWD 2FINB 4POGA 2NVXB 3FKIB 1LUZA 4JI6Q 1VQPA 1WTVA 4LUOA 2PW5A 4A3FB 4QJFA 1F9QA 5M3FB 2IX1A 3OPOA 1LTLA 2ATWA 4X65L 3HZXA 1STNA 4KY5A 4HIOA 3JAML 3HRZC 5CV7A 1CM9A 2JA7H 1H9SB 1HZ9A 2EZVA 1H95A 2JA8B 3S1MB 4IOAA 1CK1A 3SK4A 2VB3X 3F2UA 5JVH3 2KHIA 1KRSA 5LMUQ 3O13A 1D5ZC 3R8BA 1TWGB 1U4MA 1DOLA 4FYDA 4GOPA 1YNND 2NTSA 4DR5L 4JG2A 2A6ED 3Q24A 1TY0A 3MC0B 1R4QB 2JA7B 1ZYRC 1SAPA 5I6YA 3C46A 3CQZH 2PI2E 4KN4C 2N49A 3PUVA 1TXYA 1XJVA 4X65Q 1QVCA 3M4YA 2XN9C 4KHPL 2PNRC 4KTAA 1S5CD 4OGQC 5F2DA 4JBJA 2SEBD 4KKUA 4EVOA 4IUUA 5M5YH 4A3LH 1JWMD 2SNSA 1MI2A 2Q8IB 4WJ3M 4DR5Q 3PUYA 5EQ0A 3A8KE 2FMCA 1TWCH 4MHEA 4DR3L 4L5SA 4XDXA 4A3CG 1K8OA 1F9SA 5I6WA 2B39A 4DAVA 4ILWA 4HMJA 4KHPQ 2JXMB 3A0JA 5LL6X 3M7NA 4ULLA 1AH9A 3OMGA 2HCCA 1JJGA 1PXUA 2F0NA 3VYRA 4NKLA 1QUQB 1CKNB 2HQEA 2QGQA 4BBSB 3I2ZA 5CV5A 1HH2P 3MEFA 3RLFA 5IP7H 4K0KL 1HNXQ 4G7ZC 4A3JH 4FF3A 3SK8A 1K73C 4IFDJ 4I7ZC 3R3OA 2KEEA 4RWSC 2F03A 1JE5A 1LABA 1AE2A 4UPAA 1VQEA 3I4MH 1LT5D 2DJGC 3L7ZC 2WAQG 3ND8A 1WD0A 1I5FA 1PH7A 1M1KC 1KXLA 1PTOD 1K28A 1U4LA 4RGMA 1GOZA 1IBLL 1MBYA 1QOHA 4RKBA 4A3EG 4DR1L 5IGDA 3DM1A 5CV6A 1IBML 5JJKA 4A3GG 3CCMA 5I4DA 1SYFA 2B2UC 3H94A 4K0KQ 1PDQA 1STHA 1WI5A 4AYBB 4J8QA 1YNJD 1C48A 4XQQA 4KHZA 3OIPA 1YNNC 5C0XH 2E2DC 2A6EC 4BBRG 1VQBA 2M9VA 2XRSD 3JC66 1N8RC 3S2HH 3CCSA 1MHWC 3NE5B 1VQFA 5A2QE 3S1RH 2KCNA 5GADC 4R4CA 1HTPA 2E75C 2MP1A 1CA5A 4JVZA 3N52A 4DR1Q 1PH9A 3K57A 1BVSA 2CH4A 5I2XA 1TR5A 2NN6H 3H6MA 2Q2UA 2F0IA 3WOEA 3GTGH 3J81i 1XNQL 1OO9B 3WOFA 1OXSC 4PZ6A 3PIP3 5C3EB 3NTIA 1O78A 3GDEA 3I8ZA 2MJ8A 1LT3D 2AUKA 3TEHB 1CI3M 3CCUA 1X3GA 2LFNA 4A93H 2KEDA 3I56A 1MSHA 1Q3LA 1QCBD 1RIPA 3LNNA 1RL2A 4RFBA 3SEBA 2F4VL 4C56C 2F52A 1EIHA 1JT8A 3AFPA 5J3BA 2F0PA 3NP8A 1SYDA 1SMYD 3QB3A 3HOZH 1BCPF 3HOXH 1J5EL 1GHJA 5EPLA 1FVIA 1B9MA 3NQIA 4A93B 1VCIA 4C3IG 3M9BA 3ONAB 1XNQQ 2RQXA 1XTDA 3KJOA 4BY1H 4IPDA 4RA8A 5IYBG 1UE7A 2ZM6L 1EUJA 2TMPA 2F0KA 1BNZA 2ZXPA
chains in the Genus database with same CATH topology
1MIUA 2JEAI 3AQQA 2OTLA 2HIVA 1X65A 4A3JG 1E22A 4IFDG 1VQKA 2F4VQ 1BBUA 1B70B 1JB7A 1CSPA 2KCMA 3I4OA 4C3IH 1IYJB 2Q2HA 1HZBA 4JBKA 3NBHB 4HIKA 2K5HA 4GN3B 4EQ5A 3CCVA 1NJIC 4JI3Q 2JJQA 3G4SA 5IYBH 3S1NH 2Q2IA 5FJ8H 5LMNW 5LMNQ 1XMOQ 3I4NH 4NXNQ 2I5LX 4LNQA 4DV6Q 5AJ3L 2WB1G 4OONA 4LF9L 5GAHC 1NBWA 2RCNA 4DR6L 1X9NA 5GROA 3LGJA 3CMEA 1GM5A 2E5LQ 2K4KA 1UE1A 4JI2Q 2ZM6Q 3KJPA 4A3IG 1QVFA 5DLQE 2R7DA 3KLWA 4IJLA 4DV2Q 1LYLA 2BA1A 2K5VA 4YWLA 2HT1A 3GTLH 1L2FA 3EBEA 4GLXA 3J7A5 2YTYA 4DUZL 2NVTH 4X6AH 1IBKL 1I3QH 3HOUG 2D62A 5JJLA 3FKIG 2I5MX 3OW2A 1PH3A 2K50A 4HJ7A 3L0OA 3E0EA 1E24A 4A3FG 5FLXc 3CXCA 2NZOA 1K8AC 5C4XG 5IYCG 3ULJA 2LXKA 4LUZA 4XIGS 2K14A 3UDIA 1EQQA 1P8LA 1DGSA 3AFQA 2B29A 1CKMA 1YHQA 3K7UC 4JV5L 5AJ3Q 4LF9Q 1WCMG 1N36L 4DR6Q 3KFUA 4YY3Q 3TS0A 1A8VA 1PH2A 3FHWA 1L0WA 1D7QA 1PA6A 1YVCA 4C3HH 3GTOH 3RN5A 1QVGA 2AMCB 1EOVA 4JOIA 3RLNA 2NVXH 3HOUH 2WFWA 3FKIH 2JA8G 1SROA 4JBMA 1NMGA 4A3DG 3K7AH 4GOPB 2JA5G 4OX9L 2A1AA 1Q86C 2UXBL 2CKZB 4A3FH 1QUQA 3ULPA 1CKNA 1VQIA 2YYZA 5C4XH 5M3FH 5IYCH 4DUZQ 3U58A 4AYBE 2K5NA 3M4QA 1IBKQ 3CC2A 3TRZA 2DGYA 3K80C 5HGQA 1I94L 4YWMA 3PGZA 1WCMH 3CPFA 3OYYA 2IHEA 4NPSA 3UE1A 2UUCL 1VQLA 3HFZB 1VQAA 2IY5B 1VQ4A 4YCUA 1Y14B 3W1GA 3EN2A 3J7ZC 1WYDA 1PH5A 1G291 3A5UA 1YHAA 2A19A 4JV5Q 2JA8H 4DV4L 3S1MH 3HOYG 1D8LA 1N36Q 2JA5H 3CP0A 4ALPA 3T1HL 1WOCA 1N9WA 1Y1WH 2R92G 4AH6A 2WAQE 3SGIA 4LF7Q 3HKZE 1ASYA 2Z6KA 3CC7A 1TWGH 4A75A 3HOXG 4DR4L 4DPGA 2YTVA 4PMWA 4OX9Q 2UXBQ 3JAMc 2B3GA 3J81c 4KLKA 2OWOA 2GVAA 1VQ9A 1SN8A 2XGTA 3GTJH 1L1OA 3BU2A 3WWVA 1YEZA 3KOJA 1I94Q 4L5RC 2NZHA 1YJNA 2VUMG 3HOYH 4BXXG 2UUCQ 4JOIC 1EWIA 1SE8A 1JJCB 3EIVA 1KD1C 2R92H 1PYSB 3H15A 4X62L 3W1BA 3PIOA 3NEMA 2B63G 4UP8A 2NVQH 1P16A 1X6OA 3U4VA 3PUZA 4DV4Q 1GD7A 1W2BA 4PG3A 3T1HQ 1SMXA 1IL2A 1GO3E 3ULLA 2HQLA 4GLAC 4GS3A 5JEAG 2K75A 1GVPA 1CSQA 2R7ZG 1SLJA 3GTPH 2PQAA 4JI8L 2D0PA 2YV5A 4JI2L 3A5ZB 1N32L 4LF5L 4FDBA 4RG1A 4OO1G 2VUMH 2UXCL 4BXXH 4APVA 1V43A 2IT1A 4GLVB 4DV2L 4DR2L 4BBSG 1VQOA 1Q82C 2D0OA 3ERSX 5M5XH 3PV0A 1VQ5A 4MZ9A 1T9HA 3KYHC 2B63H 3RZOH 4A3KG 2VQFL 3IRBA 2Z6KC 4HJ5A 4UP9A 3H3VI 1PVOA 1QZHA 1Q1EA 5M3MG 2XTIA 3MXNB 4OWWB 4DAMA 4BY7G 3T1YL 4OXPA 5JEAJ 5IY0A 4X62Q 1N33L 4P73A 1O7IA 2UUBQ 3CCRA 2R7ZH 3S24A 1KAWA 3B6YA 4GN5A 3J80i 2JA6G 4LFBL 1WFQA 1NMFA 3TS2A 2E2HH 2ZTDA 2JK8A 3KF8B 1L1OC 4NB3A 4OWTB 4BBSH 2CQOA 1OTCA 4YY3L 2N3SA 1X3EA 2MNAA 1PH8A 2EXDA 3NELA 4DV0Q 1TWHH 3TREA 4JI8Q 4A3KH 1YJ9A 4KHPQ 1X3FA 2HHHL 2H5XA 2MO0A 4LF5Q 1N32Q 3CCQA 2UXCQ 5M3MH 3UDXA 4DR2Q 2C35B 4BY7H 3PIPA 3PO3G 4A3BG 3KF6B 4DV3L 2UU9Q 2VQFQ 2JA6H 2NN6I 4DNIA 5IT9c 4LF6L 2LXJA 4A76A 1VQJA 3T1YQ 1K8GA 1QZGA 1EYGA 1N33Q 2UXDQ 2NVYH 5M3FG 5HY6A 1BBWA 4LFBQ 3U4ZA 5C44G 4C3JH 1VS0A 2MQHA 3VDYA 1EFWA 1Q12A 4DR3Q 4LUVA 1VQCA 2KBNA 3CW2C 3PO3H 4P72A 4R4IA 4A3BH 2AKWB 2BH8A 1A63A 5IP9G 1UEBA 2WP8J 3HKZG 3TQYA 4X66L 4DKAC 4IOCA 4LF7L 4X64L 2HHHQ 2MO1A 4JI4Q 1PH4A 4GNXB 3M3YH 1YI2A 1YITA 2E2JH 1B7YB 4GN4B 4GKKL 4TVAB 2KHJA 3K0XA 1C0AA 4A3MG 2OQKA 4L5QA 4DV3Q 1Y1WG 1U5KA 2ZJPA 1K0RA 2V1CC 1TWAH 1XPUA 1C7YA 5C44H 2QEXA 3CCJA 4B3TL 1VQNA 3BZKA 1MJEA 3RR5A 4LF6Q 1PFSA 1OXXK 4MNOA 5LMUL 4HJ8A 2WB1E 3D0FA 1WJJA 3KDFB 4YWKA 5C3EG 1JJ2A 4WJ4A 1Q8KA 2JA7G 2F3IA 3F1ZA 5IP9H 4LW1A 5H1SE 4POGA 2I5HA 1KQSA 1LUZA 1ASZA 4JI6Q 1VQPA 4LUOA 2VW9A 2N8NA 3BJUA 3RN2A 4QJFA 3PUWA 2E8GA 5BR8Q 3F2CA 1S40A 4A3MH 1X55A 2IX1A 3STBD 4X66Q 1S3OA 1LTLA 4X64Q 3UDGA 2ATWA 1GKHA 3M4PA 3OTOL 1A0IA 4X65L 1NY4A 2OCEA 1IBLQ 1V9PA 4GKKQ 3BZCA 2QA4A 4HIOA 5IE8A 5C3EH 4OWXB 1EIYB 4Y52H 4L5TA 2JA7H 1HZ9A 2CWPA 4B3TQ 1IZ6A 1IBMQ 1H95A 1VQMA 4LF4L 4IOAA 4R4QA 2KHIA 1KRSA 3GO5A 5LMUQ 4AQYL 1E1TA 1HNZQ 1Q1BA 4IFDI 1NE3A 2Z0SA 4GNXA 3K8AA 2UUBL 1PH1A 4GOPA 4DR5L 4JG2A 2ZTEA 4RMFA 2VZAA 3S16H 4A3LG 1Z47A 2HIXA 3S17H 4DAYB 5GAEC 2OQ0A 1N34L 1Q46A 5ELOA 2RHQB 2VQEL 1A62A 3CQZH 2PI2E 1KL9A 2N49A 3PUVA 1TXYA 1XJVA 3OTOQ 3KDFA 4IPHA 4X65Q 1LM0A 1QVCA 4R4TA 4DV0L 1KC8C 3NENA 1HR0L 4DV7L 4KI0A 4DK6C 1JMCA 2ES2A 4KHPL 2BA0A 1G51A 3G71A 4B3MQ 4JI1L 3GTQH 4IO9A 2OTJA 4TQUS 3I55A 4HJAA 4BA2I 2UU9L 4LF4Q 4DK3C 3CAMA 4R4OA 4QQBX 4JBJA 4H02A 5M5YH 4A3LH 1R9TH 4BA1I 4AQYQ 3CD6A 1K83H 4IPGA 5C0XI 3PCOB 3DM3A 2UXDL 2Y0SE 4JI7L 4LF8Q 1HNWL 4DR5Q 4WJ3M 2ID0A 3PUYA 2JEBI 3S14H 3PO2G 1U0LA 2VNUD 3GTMH 4DV1L 3F2DA 3W5OA 3F2BA 1TWCH 1N34Q 3RNUA 1SFOH 4DR3L 4A4IA 5IP7G 1IXRA 4L5SA 4A3CG 2VQEQ 3GD7A 1UE6A 4QGUA 4NXML 3J80c 2YTXA 1K3RA 1CUKA 1AE3A 3ICEA 4GNXC 2PI2A 1VQ6A 2K52A 1HR0W 1HR0Q 4DV7Q 2UUAL 2R6GA 1J6QA 1YHBA 3M85A 4GOPC 4JI4L 3A0JA 4LFAQ 4UY8C 4QIWE 3CC4A 3PF5A 4JI1Q 3M7NA 3I4MG 1NTGA 4B3SL 3S2DH 5K36G 1AH9A 2EIFA 1Y1VG 1K9MC 1X56A 2JE6I 3PSIA 3AYHB 4DUYL 3DLLA 2CWAA 4QL5A 5GAGC 1PH6A 4B3RL 4AYBG 4DV5L 1JJGA 2IX0A 1XPRA 1J5EQ 3PO2H 1YNXA 1QUQB 1CKNB 3RLOA 2QGQA 1OXVA 2PMZE 3I2ZA 4P74A 1FL0A 5IYDG 1HH2P 3MEFA 2AWOA 3RLFA 5IP7H 3M4OH 4A3CH 4K0KL 3E9HA 1HNXQ 4JI7Q 1HJPA 4A3JH 1HNWQ 1X54A 2KENA 4IFDJ 1K73C 4LFCL 4EX5A 3ER0A 1B8AA 2RF4A 4DV1Q 2IHFA 4JI6L 1FJGL 1JE5A 2BH2A 4J15A 1AE2A 4UPAA 1VQEA 3K81C 4IPCA 3I4MH 5FLMG 1V1QA 1Y1VH 3STBC 2GVBA 3L7ZC 4AIMA 5BR8L 4GKJL 1M90C 2WAQG 4NXMQ 3F8TA 1MKHA 4P71A 5C0XG 1I5FA 1PH7A 1M1KC 2UUAQ 1KXLA 2JA9A 1XNRL 1G6PA 5ELNA 4JCVE 1FGUA 1IBLL 5IYDH 4B3SQ 4HJ9A 4JI5L 4B3RQ 4DUYQ 1EIFA 4A3EG 4DR1L 1C9OA 1BKBA 4DV5Q 3CCEA 1KIXA 3H0GG 2ASBA 2CFMA 3PUXA 1XMQL 2YU9H 1IBML 5JJKA 4A3IH 2R7FA 1UWVA 2GN5A 1PHJA 4A3GG 3CCMA 1YIJA 2N78A 2I0QA 1XPOA 1S72A 4K0KQ 1YBYA 1L1OB 3A74A 5EAYA 5FLMH 1UE5A 1WI5A 4O2DA 2CCZA 3H3VH 1Z9FA 1HNZL 2EQSA 4KHZA 1YZ6A 1VQHA 3HKSA 4YHHL 4R1JA 5C0XJ 4LFCQ 3ZJYC 1Q81C 4BBRG 1VQBA 1SR3A 3JC66 1N8RC 1FJGQ 4QY7A 1KRTA 3KF6A 3CCSA 4MTNA 4HIMA 2ZTCA 3S2HH 1VQDA 4ME3A 2LSSA 2NN6G 1VQFA 4GKJQ 2KCTA 3U50C 3S1RH 4A3EH 2VS1A 3H0GH 5GADC 2PNHA 1XNRQ 4R4CA 4YCWA 4JBWA 4LWCA 4A3GH 3HOVG 1HZAA 2AWNA 1W3SA 3S15H 4JYAL 4JI5Q 3Q8DA 2ALYB 5IWAL 1I50H 2PQAB 4B3ML 4DR1Q 1YJWA 2E2IH 4XTCS 1HZCA 4A93G 1XMQQ 2VL6A 1PH9A 3D31A 1BVSA 1OXUA 5C4JH 4BBRH 3L2PA 4OO1I 3HOWG 3UDFA 4DR7L 3UE0A 4POFA 2ZJRA 4A3DH 4JI0L 2Q2UA 2AHOB 3CMAA 3G48A 3JAMi 3J81j 3GTGH 4PZ7A 4YHHQ 3J81i 3RZDH 1XNQL 4IJHA 2Y0SG 1VQ8A 3CF5A 4LF8L 3HOZG 5JJIA 2VY3A 2L15A 2JQOA 1OXSC 4PZ6A 3HOVH 2R93G 5GQOA 1I6HH 4P75A 4YCVA 4Y7NH 2RHSB 1VQGA 3GDEA 4PZ8A 3TEHB 4A93H 3CCUA 1X3GA 4BY1G 2A8VA 5M5WH 1OXTA 3I56A 2Q2TA 1EQRA 3HOWH 1VQ7A 1RIPA 2F4VL 1RL2A 3PF4A 3E9IA 3I7FA 4JYAQ 5IWAQ 2F52A 4UP7A 4LFAL 3AEVA 1MJCA 1JT8A 3AFPA 5E7NA 5J3BA 2ZJQA 3GTKH 1TWFH 2DUDA 4C2MH 3HOZH 3FP9A 4JI3L 1CKOA 3HOXH 1J5EL 4DR7Q 3CCLA 1XMOL 5LMNL 3S1QH 4JI0Q 2R93H 1FVIA 4NXNL 2MFIA 4DV6L 1VCIA 1Q7YC 3M9BA 1XNQQ 1PV4A 1XTDA 1PYBA 1SRUA 3KJOA 4JC0A 1HNXL 3CPWA 4BY1H 4IPDA 1KHIA 1E7ZA 4O0AA 5IYBG 1UE7A 3G6EA 5FJ8G 1E1OA 2E5LL 3I4NG 2ZM6L 4DR4Q 4HIDA 2FXQA 1EUJA 1E3PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MIU A;  2JEA I;  3AQQ A;  2OTL A;  2HIV A;  1X65 A;  4A3J G;  1E22 A;  4IFD G;  1VQK A;  2F4V Q;  1BBU A;  1B70 B;  1JB7 A;  1CSP A;  2KCM A;  3I4O A;  4C3I H;  1IYJ B;  2Q2H A;  1HZB A;  4JBK A;  3NBH B;  4HIK A;  2K5H A;  4GN3 B;  4EQ5 A;  3CCV A;  1NJI C;  4JI3 Q;  2JJQ A;  3G4S A;  5IYB H;  3S1N H;  2Q2I A;  5FJ8 H;  5LMN W;  5LMN Q;  1XMO Q;  3I4N H;  4NXN Q;  2I5L X;  4LNQ A;  4DV6 Q;  5AJ3 L;  2WB1 G;  4OON A;  4LF9 L;  5GAH C;  1NBW A;  2RCN A;  4DR6 L;  1X9N A;  5GRO A;  3LGJ A;  3CME A;  1GM5 A;  2E5L Q;  2K4K A;  1UE1 A;  4JI2 Q;  2ZM6 Q;  3KJP A;  4A3I G;  1QVF A;  5DLQ E;  2R7D A;  3KLW A;  4IJL A;  4DV2 Q;  1LYL A;  2BA1 A;  2K5V A;  4YWL A;  2HT1 A;  3GTL H;  1L2F A;  3EBE A;  4GLX A;  3J7A 5;  2YTY A;  4DUZ L;  2NVT H;  4X6A H;  1IBK L;  1I3Q H;  3HOU G;  2D62 A;  5JJL A;  3FKI G;  2I5M X;  3OW2 A;  1PH3 A;  2K50 A;  4HJ7 A;  3L0O A;  3E0E A;  1E24 A;  4A3F G;  5FLX c;  3CXC A;  2NZO A;  1K8A C;  5C4X G;  5IYC G;  3ULJ A;  2LXK A;  4LUZ A;  4XIG S;  2K14 A;  3UDI A;  1EQQ A;  1P8L A;  1DGS A;  3AFQ A;  2B29 A;  1CKM A;  1YHQ A;  3K7U C;  4JV5 L;  5AJ3 Q;  4LF9 Q;  1WCM G;  1N36 L;  4DR6 Q;  3KFU A;  4YY3 Q;  3TS0 A;  1A8V A;  1PH2 A;  3FHW A;  1L0W A;  1D7Q A;  1PA6 A;  1YVC A;  4C3H H;  3GTO H;  3RN5 A;  1QVG A;  2AMC B;  1EOV A;  4JOI A;  3RLN A;  2NVX H;  3HOU H;  2WFW A;  3FKI H;  2JA8 G;  1SRO A;  4JBM A;  1NMG A;  4A3D G;  3K7A H;  4GOP B;  2JA5 G;  4OX9 L;  2A1A A;  1Q86 C;  2UXB L;  2CKZ B;  4A3F H;  1QUQ A;  3ULP A;  1CKN A;  1VQI A;  2YYZ A;  5C4X H;  5M3F H;  5IYC H;  4DUZ Q;  3U58 A;  4AYB E;  2K5N A;  3M4Q A;  1IBK Q;  3CC2 A;  3TRZ A;  2DGY A;  3K80 C;  5HGQ A;  1I94 L;  4YWM A;  3PGZ A;  1WCM H;  3CPF A;  3OYY A;  2IHE A;  4NPS A;  3UE1 A;  2UUC L;  1VQL A;  3HFZ B;  1VQA A;  2IY5 B;  1VQ4 A;  4YCU A;  1Y14 B;  3W1G A;  3EN2 A;  3J7Z C;  1WYD A;  1PH5 A;  1G29 1;  3A5U A;  1YHA A;  2A19 A;  4JV5 Q;  2JA8 H;  4DV4 L;  3S1M H;  3HOY G;  1D8L A;  1N36 Q;  2JA5 H;  3CP0 A;  4ALP A;  3T1H L;  1WOC A;  1N9W A;  1Y1W H;  2R92 G;  4AH6 A;  2WAQ E;  3SGI A;  4LF7 Q;  3HKZ E;  1ASY A;  2Z6K A;  3CC7 A;  1TWG H;  4A75 A;  3HOX G;  4DR4 L;  4DPG A;  2YTV A;  4PMW A;  4OX9 Q;  2UXB Q;  3JAM c;  2B3G A;  3J81 c;  4KLK A;  2OWO A;  2GVA A;  1VQ9 A;  1SN8 A;  2XGT A;  3GTJ H;  1L1O A;  3BU2 A;  3WWV A;  1YEZ A;  3KOJ A;  1I94 Q;  4L5R C;  2NZH A;  1YJN A;  2VUM G;  3HOY H;  4BXX G;  2UUC Q;  4JOI C;  1EWI A;  1SE8 A;  1JJC B;  3EIV A;  1KD1 C;  2R92 H;  1PYS B;  3H15 A;  4X62 L;  3W1B A;  3PIO A;  3NEM A;  2B63 G;  4UP8 A;  2NVQ H;  1P16 A;  1X6O A;  3U4V A;  3PUZ A;  4DV4 Q;  1GD7 A;  1W2B A;  4PG3 A;  3T1H Q;  1SMX A;  1IL2 A;  1GO3 E;  3ULL A;  2HQL A;  4GLA C;  4GS3 A;  5JEA G;  2K75 A;  1GVP A;  1CSQ A;  2R7Z G;  1SLJ A;  3GTP H;  2PQA A;  4JI8 L;  2D0P A;  2YV5 A;  4JI2 L;  3A5Z B;  1N32 L;  4LF5 L;  4FDB A;  4RG1 A;  4OO1 G;  2VUM H;  2UXC L;  4BXX H;  4APV A;  1V43 A;  2IT1 A;  4GLV B;  4DV2 L;  4DR2 L;  4BBS G;  1VQO A;  1Q82 C;  2D0O A;  3ERS X;  5M5X H;  3PV0 A;  1VQ5 A;  4MZ9 A;  1T9H A;  3KYH C;  2B63 H;  3RZO H;  4A3K G;  2VQF L;  3IRB A;  2Z6K C;  4HJ5 A;  4UP9 A;  3H3V I;  1PVO A;  1QZH A;  1Q1E A;  5M3M G;  2XTI A;  3MXN B;  4OWW B;  4DAM A;  4BY7 G;  3T1Y L;  4OXP A;  5JEA J;  5IY0 A;  4X62 Q;  1N33 L;  4P73 A;  1O7I A;  2UUB Q;  3CCR A;  2R7Z H;  3S24 A;  1KAW A;  3B6Y A;  4GN5 A;  3J80 i;  2JA6 G;  4LFB L;  1WFQ A;  1NMF A;  3TS2 A;  2E2H H;  2ZTD A;  2JK8 A;  3KF8 B;  1L1O C;  4NB3 A;  4OWT B;  4BBS H;  2CQO A;  1OTC A;  4YY3 L;  2N3S A;  1X3E A;  2MNA A;  1PH8 A;  2EXD A;  3NEL A;  4DV0 Q;  1TWH H;  3TRE A;  4JI8 Q;  4A3K H;  1YJ9 A;  4KHP Q;  1X3F A;  2HHH L;  2H5X A;  2MO0 A;  4LF5 Q;  1N32 Q;  3CCQ A;  2UXC Q;  5M3M H;  3UDX A;  4DR2 Q;  2C35 B;  4BY7 H;  3PIP A;  3PO3 G;  4A3B G;  3KF6 B;  4DV3 L;  2UU9 Q;  2VQF Q;  2JA6 H;  2NN6 I;  4DNI A;  5IT9 c;  4LF6 L;  2LXJ A;  4A76 A;  1VQJ A;  3T1Y Q;  1K8G A;  1QZG A;  1EYG A;  1N33 Q;  2UXD Q;  2NVY H;  5M3F G;  5HY6 A;  1BBW A;  4LFB Q;  3U4Z A;  5C44 G;  4C3J H;  1VS0 A;  2MQH A;  3VDY A;  1EFW A;  1Q12 A;  4DR3 Q;  4LUV A;  1VQC A;  2KBN A;  3CW2 C;  3PO3 H;  4P72 A;  4R4I A;  4A3B H;  2AKW B;  2BH8 A;  1A63 A;  5IP9 G;  1UEB A;  2WP8 J;  3HKZ G;  3TQY A;  4X66 L;  4DKA C;  4IOC A;  4LF7 L;  4X64 L;  2HHH Q;  2MO1 A;  4JI4 Q;  1PH4 A;  4GNX B;  3M3Y H;  1YI2 A;  1YIT A;  2E2J H;  1B7Y B;  4GN4 B;  4GKK L;  4TVA B;  2KHJ A;  3K0X A;  1C0A A;  4A3M G;  2OQK A;  4L5Q A;  4DV3 Q;  1Y1W G;  1U5K A;  2ZJP A;  1K0R A;  2V1C C;  1TWA H;  1XPU A;  1C7Y A;  5C44 H;  2QEX A;  3CCJ A;  4B3T L;  1VQN A;  3BZK A;  1MJE A;  3RR5 A;  4LF6 Q;  1PFS A;  1OXX K;  4MNO A;  5LMU L;  4HJ8 A;  2WB1 E;  3D0F A;  1WJJ A;  3KDF B;  4YWK A;  5C3E G;  1JJ2 A;  4WJ4 A;  1Q8K A;  2JA7 G;  2F3I A;  3F1Z A;  5IP9 H;  4LW1 A;  5H1S E;  4POG A;  2I5H A;  1KQS A;  1LUZ A;  1ASZ A;  4JI6 Q;  1VQP A;  4LUO A;  2VW9 A;  2N8N A;  3BJU A;  3RN2 A;  4QJF A;  3PUW A;  2E8G A;  5BR8 Q;  3F2C A;  1S40 A;  4A3M H;  1X55 A;  2IX1 A;  3STB D;  4X66 Q;  1S3O A;  1LTL A;  4X64 Q;  3UDG A;  2ATW A;  1GKH A;  3M4P A;  3OTO L;  1A0I A;  4X65 L;  1NY4 A;  2OCE A;  1IBL Q;  1V9P A;  4GKK Q;  3BZC A;  2QA4 A;  4HIO A;  5IE8 A;  5C3E H;  4OWX B;  1EIY B;  4Y52 H;  4L5T A;  2JA7 H;  1HZ9 A;  2CWP A;  4B3T Q;  1IZ6 A;  1IBM Q;  1H95 A;  1VQM A;  4LF4 L;  4IOA A;  4R4Q A;  2KHI A;  1KRS A;  3GO5 A;  5LMU Q;  4AQY L;  1E1T A;  1HNZ Q;  1Q1B A;  4IFD I;  1NE3 A;  2Z0S A;  4GNX A;  3K8A A;  2UUB L;  1PH1 A;  4GOP A;  4DR5 L;  4JG2 A;  2ZTE A;  4RMF A;  2VZA A;  3S16 H;  4A3L G;  1Z47 A;  2HIX A;  3S17 H;  4DAY B;  5GAE C;  2OQ0 A;  1N34 L;  1Q46 A;  5ELO A;  2RHQ B;  2VQE L;  1A62 A;  3CQZ H;  2PI2 E;  1KL9 A;  2N49 A;  3PUV A;  1TXY A;  1XJV A;  3OTO Q;  3KDF A;  4IPH A;  4X65 Q;  1LM0 A;  1QVC A;  4R4T A;  4DV0 L;  1KC8 C;  3NEN A;  1HR0 L;  4DV7 L;  4KI0 A;  4DK6 C;  1JMC A;  2ES2 A;  4KHP L;  2BA0 A;  1G51 A;  3G71 A;  4B3M Q;  4JI1 L;  3GTQ H;  4IO9 A;  2OTJ A;  4TQU S;  3I55 A;  4HJA A;  4BA2 I;  2UU9 L;  4LF4 Q;  4DK3 C;  3CAM A;  4R4O A;  4QQB X;  4JBJ A;  4H02 A;  5M5Y H;  4A3L H;  1R9T H;  4BA1 I;  4AQY Q;  3CD6 A;  1K83 H;  4IPG A;  5C0X I;  3PCO B;  3DM3 A;  2UXD L;  2Y0S E;  4JI7 L;  4LF8 Q;  1HNW L;  4DR5 Q;  4WJ3 M;  2ID0 A;  3PUY A;  2JEB I;  3S14 H;  3PO2 G;  1U0L A;  2VNU D;  3GTM H;  4DV1 L;  3F2D A;  3W5O A;  3F2B A;  1TWC H;  1N34 Q;  3RNU A;  1SFO H;  4DR3 L;  4A4I A;  5IP7 G;  1IXR A;  4L5S A;  4A3C G;  2VQE Q;  3GD7 A;  1UE6 A;  4QGU A;  4NXM L;  3J80 c;  2YTX A;  1K3R A;  1CUK A;  1AE3 A;  3ICE A;  4GNX C;  2PI2 A;  1VQ6 A;  2K52 A;  1HR0 W;  1HR0 Q;  4DV7 Q;  2UUA L;  2R6G A;  1J6Q A;  1YHB A;  3M85 A;  4GOP C;  4JI4 L;  3A0J A;  4LFA Q;  4UY8 C;  4QIW E;  3CC4 A;  3PF5 A;  4JI1 Q;  3M7N A;  3I4M G;  1NTG A;  4B3S L;  3S2D H;  5K36 G;  1AH9 A;  2EIF A;  1Y1V G;  1K9M C;  1X56 A;  2JE6 I;  3PSI A;  3AYH B;  4DUY L;  3DLL A;  2CWA A;  4QL5 A;  5GAG C;  1PH6 A;  4B3R L;  4AYB G;  4DV5 L;  1JJG A;  2IX0 A;  1XPR A;  1J5E Q;  3PO2 H;  1YNX A;  1QUQ B;  1CKN B;  3RLO A;  2QGQ A;  1OXV A;  2PMZ E;  3I2Z A;  4P74 A;  1FL0 A;  5IYD G;  1HH2 P;  3MEF A;  2AWO A;  3RLF A;  5IP7 H;  3M4O H;  4A3C H;  4K0K L;  3E9H A;  1HNX Q;  4JI7 Q;  1HJP A;  4A3J H;  1HNW Q;  1X54 A;  2KEN A;  4IFD J;  1K73 C;  4LFC L;  4EX5 A;  3ER0 A;  1B8A A;  2RF4 A;  4DV1 Q;  2IHF A;  4JI6 L;  1FJG L;  1JE5 A;  2BH2 A;  4J15 A;  1AE2 A;  4UPA A;  1VQE A;  3K81 C;  4IPC A;  3I4M H;  5FLM G;  1V1Q A;  1Y1V H;  3STB C;  2GVB A;  3L7Z C;  4AIM A;  5BR8 L;  4GKJ L;  1M90 C;  2WAQ G;  4NXM Q;  3F8T A;  1MKH A;  4P71 A;  5C0X G;  1I5F A;  1PH7 A;  1M1K C;  2UUA Q;  1KXL A;  2JA9 A;  1XNR L;  1G6P A;  5ELN A;  4JCV E;  1FGU A;  1IBL L;  5IYD H;  4B3S Q;  4HJ9 A;  4JI5 L;  4B3R Q;  4DUY Q;  1EIF A;  4A3E G;  4DR1 L;  1C9O A;  1BKB A;  4DV5 Q;  3CCE A;  1KIX A;  3H0G G;  2ASB A;  2CFM A;  3PUX A;  1XMQ L;  2YU9 H;  1IBM L;  5JJK A;  4A3I H;  2R7F A;  1UWV A;  2GN5 A;  1PHJ A;  4A3G G;  3CCM A;  1YIJ A;  2N78 A;  2I0Q A;  1XPO A;  1S72 A;  4K0K Q;  1YBY A;  1L1O B;  3A74 A;  5EAY A;  5FLM H;  1UE5 A;  1WI5 A;  4O2D A;  2CCZ A;  3H3V H;  1Z9F A;  1HNZ L;  2EQS A;  4KHZ A;  1YZ6 A;  1VQH A;  3HKS A;  4YHH L;  4R1J A;  5C0X J;  4LFC Q;  3ZJY C;  1Q81 C;  4BBR G;  1VQB A;  1SR3 A;  3JC6 6;  1N8R C;  1FJG Q;  4QY7 A;  1KRT A;  3KF6 A;  3CCS A;  4MTN A;  4HIM A;  2ZTC A;  3S2H H;  1VQD A;  4ME3 A;  2LSS A;  2NN6 G;  1VQF A;  4GKJ Q;  2KCT A;  3U50 C;  3S1R H;  4A3E H;  2VS1 A;  3H0G H;  5GAD C;  2PNH A;  1XNR Q;  4R4C A;  4YCW A;  4JBW A;  4LWC A;  4A3G H;  3HOV G;  1HZA A;  2AWN A;  1W3S A;  3S15 H;  4JYA L;  4JI5 Q;  3Q8D A;  2ALY B;  5IWA L;  1I50 H;  2PQA B;  4B3M L;  4DR1 Q;  1YJW A;  2E2I H;  4XTC S;  1HZC A;  4A93 G;  1XMQ Q;  2VL6 A;  1PH9 A;  3D31 A;  1BVS A;  1OXU A;  5C4J H;  4BBR H;  3L2P A;  4OO1 I;  3HOW G;  3UDF A;  4DR7 L;  3UE0 A;  4POF A;  2ZJR A;  4A3D H;  4JI0 L;  2Q2U A;  2AHO B;  3CMA A;  3G48 A;  3JAM i;  3J81 j;  3GTG H;  4PZ7 A;  4YHH Q;  3J81 i;  3RZD H;  1XNQ L;  4IJH A;  2Y0S G;  1VQ8 A;  3CF5 A;  4LF8 L;  3HOZ G;  5JJI A;  2VY3 A;  2L15 A;  2JQO A;  1OXS C;  4PZ6 A;  3HOV H;  2R93 G;  5GQO A;  1I6H H;  4P75 A;  4YCV A;  4Y7N H;  2RHS B;  1VQG A;  3GDE A;  4PZ8 A;  3TEH B;  4A93 H;  3CCU A;  1X3G A;  4BY1 G;  2A8V A;  5M5W H;  1OXT A;  3I56 A;  2Q2T A;  1EQR A;  3HOW H;  1VQ7 A;  1RIP A;  2F4V L;  1RL2 A;  3PF4 A;  3E9I A;  3I7F A;  4JYA Q;  5IWA Q;  2F52 A;  4UP7 A;  4LFA L;  3AEV A;  1MJC A;  1JT8 A;  3AFP A;  5E7N A;  5J3B A;  2ZJQ A;  3GTK H;  1TWF H;  2DUD A;  4C2M H;  3HOZ H;  3FP9 A;  4JI3 L;  1CKO A;  3HOX H;  1J5E L;  4DR7 Q;  3CCL A;  1XMO L;  5LMN L;  3S1Q H;  4JI0 Q;  2R93 H;  1FVI A;  4NXN L;  2MFI A;  4DV6 L;  1VCI A;  1Q7Y C;  3M9B A;  1XNQ Q;  1PV4 A;  1XTD A;  1PYB A;  1SRU A;  3KJO A;  4JC0 A;  1HNX L;  3CPW A;  4BY1 H;  4IPD A;  1KHI A;  1E7Z A;  4O0A A;  5IYB G;  1UE7 A;  3G6E A;  5FJ8 G;  1E1O A;  2E5L L;  3I4N G;  2ZM6 L;  4DR4 Q;  4HID A;  2FXQ A;  1EUJ A;  1E3P A; 
#chains in the Genus database with same CATH topology
 4F7X A;  1MIU A;  2JEA I;  3AQQ A;  5KGU A;  3GQB A;  4RAU C;  4U67 3;  1VQK A;  2F4V Q;  4C1N K;  1PTO C;  4N9T A;  1K83 B;  3BVZ A;  4G7H C;  1JB7 A;  2J7Z A;  2KCM A;  1EQV A;  3KUP A;  3WDN A;  4JBK A;  4HIK A;  1C8C A;  1NJI C;  3CCV A;  2JJQ A;  4KY6 A;  4K6D A;  1BDO A;  4DGZ A;  4CJ1 B;  3I4N H;  5I9P A;  4RHR A;  3K5M A;  5AJ3 L;  3I91 A;  3HS0 C;  2EYF A;  2WB1 G;  4LF9 L;  1YNJ C;  3V2T A;  5GAH C;  4DR6 L;  2SOB A;  1DM0 B;  2F0F A;  2Q8R E;  1QVF A;  2ZM6 Q;  1WTR A;  1B9N A;  2R7D A;  4ZRZ A;  2K5V A;  2AUJ D;  3ITP A;  4ZAI A;  1IBK L;  1I3Q H;  3M4O B;  2D62 A;  1G2S A;  2K50 A;  1CQV A;  2MPM A;  1EY5 A;  2KEC A;  3CXC A;  2NZO A;  5C4X G;  2Z4I A;  2F0Q A;  1TS5 A;  2M00 A;  3TP6 A;  3BG3 A;  3AFQ A;  1YHQ A;  1CKM A;  4KN7 C;  3K7U C;  5AJ3 Q;  1FYC A;  4LF9 Q;  4DR6 Q;  3KFU A;  3Q22 A;  3FHW A;  1Y8O B;  1BCP B;  1JIC A;  1D7Q A;  1TT2 A;  4C3H H;  3RN5 A;  1JR0 D;  1EOV A;  4JOI A;  3HOU H;  1NMG A;  4A3D G;  3K7A H;  2JA5 G;  2UXB L;  2A1A A;  2YU9 B;  3ULP A;  4XT1 B;  5IYC H;  3TRZ A;  1IBK Q;  5BN3 A;  1GUS A;  2EYM A;  1LTG D;  4X3S A;  1WTP A;  2Z9H A;  3UE1 A;  2UUC L;  3HFZ B;  1VQA A;  1SMY C;  4O42 A;  4C3H B;  1VQ4 A;  2BCO A;  3QWN A;  1PZJ D;  3W2D A;  1YHA A;  2DY7 A;  3P75 A;  1S4Z A;  3SE0 A;  5BN5 A;  3HOY G;  1D8L A;  4A3E B;  3T1H L;  2B2W A;  1Y1W H;  2R92 G;  3SGI A;  4A3G B;  3HKZ E;  2HDL A;  1F2Z A;  2Z1C A;  1VF7 A;  5I2Y A;  2UXB Q;  3J81 c;  1UUP A;  4BBR B;  1SN8 A;  4ZLT F;  5EKI A;  3FDT A;  2UUC Q;  3RZD B;  1SE8 A;  1HHV A;  3QOL A;  1KD1 C;  1A15 A;  1PYS B;  2B63 G;  2NVQ H;  1D1I A;  4ZCK A;  1M8A A;  1ZXT A;  4Y7N B;  3S9W A;  3T1H Q;  3G6J B;  1IL2 A;  2F0H A;  2HQL A;  4DXG A;  1SLJ A;  2PQA A;  4JI2 L;  3A5Z B;  1EEI D;  1SSO A;  2CVR A;  4Z9C B;  4LF5 L;  2UXC L;  2V4D A;  4BXX H;  1DCZ A;  1V43 A;  1TWF B;  4APV A;  4C2M B;  4HSV A;  1Q82 C;  1EWC A;  3ERS X;  1O7Z A;  2AQ1 B;  1T9H A;  1QNK A;  1QZH A;  3MXN B;  3TDQ A;  4BY7 G;  2KA7 A;  5IY0 A;  4ZK9 B;  1O7I A;  1KLG D;  3CCR A;  2F0L A;  2R7Z H;  2X69 A;  1KAW A;  4HSP A;  4LFB L;  3J80 E;  4KKT A;  5ELF A;  2WKC A;  2EYH A;  1OTC A;  1CZW A;  1X3E A;  2D5D A;  1EU4 A;  2EXD A;  4DV0 Q;  3DHQ A;  5JVG 3;  4LF5 Q;  4C3I B;  2UXC Q;  2L55 A;  3UDX A;  5M3M H;  5I9O A;  1EL0 A;  3KF6 B;  5EKK A;  4LAA A;  2EY6 A;  2NN6 I;  1SYE A;  1VQJ A;  1K8G A;  1EYG A;  5M3F G;  1SYG A;  4LFB Q;  4L63 B;  5JPN C;  5C44 G;  4C3J H;  2MQH A;  3VDY A;  1EFW A;  1Q12 A;  4KJO A;  2LY7 A;  3CW2 C;  4CGY B;  4R4I A;  4HCE A;  1SNO A;  2AKW B;  2BH8 A;  4UAI A;  1BCP D;  1A63 A;  1HA6 A;  4LF7 L;  3HKZ G;  4X66 L;  1JB3 A;  4X64 L;  2WB1 B;  1YIT A;  2X6L A;  4GN4 B;  5ELC A;  1O80 A;  1SYC A;  1C0A A;  1ZEQ X;  3MXG A;  1PZK D;  5A35 A;  1VQN A;  3E0J A;  2K5Q A;  1PFS A;  4HJ8 A;  4S3S A;  3KDF B;  1JJ2 A;  4WJ4 A;  4FF2 A;  2JA7 G;  1W6K A;  2F3I A;  3F1Z A;  3NK9 A;  5CV9 A;  3A7A B;  4X3K A;  1KQS A;  1M4V A;  2DN8 A;  4BWG B;  2N55 A;  4IUT A;  2VW9 A;  4R8N A;  5BR8 Q;  1X55 A;  2MHV A;  4X66 Q;  3CKI B;  4LK1 C;  4X64 Q;  3UDG A;  3BDL A;  1HA5 A;  1RCV D;  3MVV A;  3OTO L;  1A0I A;  2RA4 A;  2KQ3 A;  2OCE A;  1CHP D;  1EY8 A;  2F0G A;  2QA4 A;  5C4Z A;  4V19 0;  4L5T A;  1TS4 A;  2CWP A;  1K0S A;  4LF4 L;  1HNZ Q;  1V1P A;  3A56 A;  3GP7 A;  3K8A A;  2UUB L;  1X3Q A;  4IZ8 A;  3S16 H;  4A3L G;  2E74 C;  4ZYS A;  2HIX A;  3S17 H;  1D5X C;  2OQ0 A;  4J1M A;  1H9M A;  3GTJ B;  1I4H A;  5EBC A;  2R3Z A;  2B2Y A;  5CC4 A;  1I4R A;  3OTO Q;  1KC8 C;  1JOO A;  3P1H A;  5L37 A;  3HOY B;  3NEN A;  2L0C A;  4KI0 A;  4PMC A;  1JMC A;  4IUN A;  1G51 A;  4B3M Q;  3GTQ H;  1EWH A;  2UU9 L;  4LF4 Q;  4QQB X;  1X32 A;  1R9T H;  1EFI D;  3CD6 A;  4IPG A;  4QCL A;  2UXD L;  3Q6S A;  3GTP B;  4JI7 L;  4LF8 Q;  2JEB I;  1U0L A;  2VNU D;  4DV1 L;  3W5O A;  3F2B A;  1LV9 A;  4A4I A;  5IP7 G;  1EU3 A;  3H09 A;  1BCP C;  5E4W C;  1Y69 U;  2B63 B;  3GD7 A;  4NXM L;  1K3R A;  1CUK A;  1AE3 A;  2NZ1 D;  3ICE A;  4GNX C;  1VQ6 A;  4EQN A;  1HR0 W;  2EE1 A;  2R6G A;  4LFA Q;  4QIW E;  3I4M G;  2EIF A;  3Q0A A;  1UNS A;  2RDG A;  5ELE A;  4AYB G;  2N88 A;  2E2H B;  3PO2 H;  4R8I A;  4KD3 A;  4ME5 A;  5TSS A;  1GXD C;  4P74 A;  3NWT A;  2AWO A;  1I6V C;  2OT2 A;  1HJP A;  4JI7 Q;  1ML0 D;  2BE5 D;  2Z8L A;  3ER0 A;  1B8A A;  4DV1 Q;  2F0W A;  4DK1 A;  4JI6 L;  2BH2 A;  3K81 C;  5K36 H;  4H0L C;  4CHT B;  2ICE C;  4B9W A;  1M90 C;  4NXM Q;  1MKH A;  5FLX E;  5C0X G;  4FVM A;  2JA9 A;  1G6P A;  4DAP A;  5ELN A;  1SJH D;  1FGU A;  4JCV E;  1A3T A;  5COY A;  2JYO A;  2NVY B;  4HJ9 A;  5CYU A;  1SND A;  1C9O A;  3KF8 A;  1XMQ L;  2DY8 A;  4A3I H;  3E6Z X;  4M8A A;  1B3A A;  3NQT A;  1RKN A;  1S72 A;  5EAY A;  5FLM H;  3H3V H;  4O2D A;  1TS2 A;  3FVQ A;  1YZ6 A;  4YHH L;  3MXU A;  2B8G A;  4R1J A;  1CFM A;  1Q81 C;  3M3Y B;  1SR3 A;  2E2J B;  1PZI D;  4HIM A;  2ZTC A;  2QW7 A;  4CBV A;  2NN6 G;  3BVG A;  1ICW A;  5KNB A;  1TWA B;  2FHT A;  5C44 B;  1G91 A;  3EVQ A;  3H0G H;  1LT6 D;  2PNH A;  4YCW A;  4R9W A;  3K0Y A;  1HZA A;  3EJI A;  4KY7 A;  2EYO A;  1I50 H;  3HKZ B;  2E2I H;  1HZC A;  5LHY 1;  4A93 G;  2PCF B;  1XMQ Q;  1OXU A;  3VR3 A;  4DR7 L;  4POF A;  3G7L A;  3T56 B;  1BXT A;  3TZU A;  3CMA A;  3H0G B;  4YHH Q;  4IJH A;  2BDO A;  1EOT A;  1VQ8 A;  3HOZ G;  2VY3 A;  2JQO A;  3EQL C;  3MEH A;  1I6H H;  1GUN A;  1KDC A;  1SXT A;  4OIJ A;  2L9H A;  2AQ3 B;  4BY1 G;  3FMC A;  2Q2T A;  2A8V A;  4F88 A;  3HOW H;  2F0D A;  2D9U A;  3VR4 A;  4EQP A;  3PF4 A;  3KLR A;  3AEV A;  3GTK H;  5C3W A;  1JE4 A;  2K28 A;  1F2L A;  1L0Y B;  1E2Z A;  3OWF A;  4QB4 A;  1CKO A;  4NMZ A;  4DR7 Q;  3CCL A;  3S1Q H;  4NXN L;  3VYS A;  2MFI A;  3X3N A;  2F0S A;  3CQZ B;  4DFA A;  2BE5 C;  1HNX L;  4JC0 A;  3CPW A;  1SDF A;  1E7Z A;  1HTL D;  4DR4 Q;  3I4N G;  2E5L L;  2FXQ A;  3E3X A;  4RGT A;  3SXH A;  2OTL A;  1X65 A;  5E4X A;  1B3Q A;  4PV1 C;  5M5Y B;  1TU2 B;  2IX3 A;  5HGT A;  3VYU A;  5EBD A;  3TBI B;  1IYJ B;  2IPK D;  3NBH B;  3R2T A;  3J7Y W;  5M9O A;  4DAY A;  1TWC B;  1EY6 A;  4RCO A;  4NXN Q;  5IGB A;  1NBW A;  2RCN A;  1LTI D;  4ID6 A;  3CME A;  2E5L Q;  2RBM A;  3I4L A;  1FNU A;  4IJL A;  2QKI C;  1LYL A;  3MFY A;  4YWL A;  2HT1 A;  2PW7 A;  1L2F A;  5IT9 E;  3EBE A;  4KMU C;  2YTY A;  2A73 B;  2NVT H;  4C3H G;  5D3D A;  3HOU G;  4CKE A;  5JJL A;  2I5M X;  3T53 B;  3OW2 A;  4HJ7 A;  4A3J B;  3E0E A;  1E24 A;  4PQX A;  5IYC G;  3ULJ A;  3RMH A;  2E76 C;  2KCC A;  1BBX C;  1DGS A;  2FFK B;  4O1N A;  4FF4 A;  3I4M B;  3K58 A;  1A8V A;  1J9O A;  4H13 C;  1L0W A;  3EA6 A;  1YVC A;  3GTO H;  4FXK C;  2AMC B;  2WFW A;  2K5D A;  1SRO A;  4ZKC B;  4GOP B;  4OX9 L;  1IKL A;  1IHZ A;  5FK9 C;  1GUG A;  1A3V A;  2A74 C;  1VQI A;  1VMC A;  2K5N A;  2RCF A;  4XYQ A;  2DJF C;  2DGY A;  2O5I C;  3K80 C;  1F2Y A;  4FP5 D;  1I94 L;  4YWM A;  3PGZ A;  1WCM H;  3CPF A;  4X3U A;  3OYY A;  2IHE A;  5DEH A;  3W1G A;  3EN2 A;  1PH5 A;  3S2H B;  1DD2 A;  1G29 1;  1ENC A;  2NUC A;  3S1R B;  4ALP A;  3BYT B;  3DWA A;  2J0T D;  2JN4 A;  3C1E A;  1V1O A;  2WKD A;  3CC7 A;  3K5O A;  4L6T B;  3SHL A;  3CHB D;  4OX9 Q;  1RF2 D;  3KBX A;  3SK6 A;  1SNM A;  2VB2 X;  1L1O A;  3WWV A;  1KAB A;  1YEZ A;  4FXG C;  1J8I A;  1I94 Q;  3LWU A;  1YJN A;  4FXD A;  3GTG B;  4BXX G;  1EWI A;  2QDB A;  2XNA C;  3H15 A;  4X62 L;  4UP8 A;  3U4V A;  3IAY A;  1GD7 A;  4PG3 A;  3Q23 A;  1EZ8 A;  2OF1 A;  1SMX A;  1ZKO A;  3IFT A;  5E3F A;  2R7Z G;  1LTR D;  2B2V A;  4JI8 L;  2D0P A;  1N32 L;  4FDB A;  1DZ1 A;  2VUM H;  1QE6 A;  3D4W A;  4OL7 A;  3OW7 A;  2D0O A;  2PYK A;  5M5X H;  3HOZ B;  3PV0 A;  1WTX A;  1HUN A;  3HOX B;  1SBB B;  4MZ9 A;  3RZO H;  4CDC C;  4DN4 M;  2VQF L;  2Z6K C;  3H3V I;  1PVO A;  1IYV A;  1Q1E A;  5M3M G;  1ET6 A;  4OWW B;  4L8J A;  4BY1 B;  3T1Y L;  4OXP A;  5JEA J;  4X62 Q;  2KVM A;  2J4X A;  1H9R A;  3J80 i;  4GN5 A;  1WFQ A;  4QIW B;  4RGN A;  5C5L A;  2MNA A;  1PH8 A;  5AFW A;  4RH6 A;  4JI8 Q;  4DF7 A;  4A3K H;  3OOC A;  2DNC A;  4C3J G;  2MO0 A;  1N32 Q;  3CCQ A;  2SNM A;  3SDZ A;  1EY9 A;  4IUV A;  3I4N B;  2VQF Q;  2JA6 H;  1JCK B;  3H3V C;  3T1Y Q;  5HY6 A;  2ICI A;  1SJE D;  1VS0 A;  4LUV A;  5C4H A;  1DJR D;  3PO3 H;  4P72 A;  4XYO A;  5KEE A;  4A3B H;  2JA6 B;  3NBI A;  1I3Q B;  1CQF A;  3NWS A;  1UEB A;  2XIW A;  1U4R A;  4JI4 Q;  4GNX B;  4GKK L;  4M1U B;  1B44 D;  2KHJ A;  5KNC A;  4HR7 B;  1K0R A;  1SEB D;  1GJX A;  1C7Y A;  2QEX A;  4B3T L;  1MJE A;  2A5H A;  1LLR D;  3OHX C;  4FO2 A;  2LS0 1;  3RR5 A;  5A2Q L;  1QJO A;  2QIL A;  1NCV A;  5CMD A;  1Q8K A;  5IP9 H;  5H1S E;  3HOU B;  2I5H A;  4ODG A;  2F1M A;  3K7A B;  3AU7 A;  1PLF A;  2N8N A;  3BJU A;  2CH4 W;  2E8G A;  4HED A;  1S40 A;  4DU9 A;  1O7L A;  5DM7 3;  5C5M A;  2VXW A;  2EY5 A;  1EIG A;  1SNC A;  4K14 A;  5CR3 A;  1IKM A;  3DWP A;  1PMR A;  4GKK Q;  3BZC A;  3K6O A;  4OWX B;  3D6C A;  4Y52 H;  1TY2 A;  2A6H D;  3GV3 A;  4B3T Q;  1W6J A;  1VQM A;  4DA2 A;  4R4Q A;  5JPM C;  1U4P A;  3GO5 A;  1Y1W B;  2KHS A;  4AQY L;  1E1T A;  1NE3 A;  1S5B D;  1EEF D;  3J81 E;  4I7A A;  1L0X B;  2VZA A;  1Z47 A;  1TQO A;  1Q46 A;  2VQE L;  2F0E A;  3KDF A;  4IPH A;  4DV0 L;  4R4T A;  1HR0 L;  4DV7 L;  2ES2 A;  1MSG A;  2K04 A;  2BDN A;  2G5D A;  5FOB B;  4IO9 A;  2OTJ A;  1BUV T;  2ZXR A;  2NVQ B;  4TQU S;  3FPU B;  1EY7 A;  2OXP A;  5EPJ A;  2EVB A;  1D1K A;  4AQY Q;  1K3B C;  5C0X I;  3PCO B;  3DM3 A;  4TSS A;  5CV4 A;  3CU7 A;  5KIX A;  2ID0 A;  3S14 H;  3PO2 G;  1KLU D;  3GTM H;  1SFO H;  2EOT A;  2VQE Q;  1V8Q A;  2PO4 A;  4QGU A;  1FD7 D;  4F8M A;  3C2P A;  2JP1 A;  3J80 c;  4WRD A;  2B2U A;  2K52 A;  5T1G A;  1HR0 Q;  4DV7 Q;  1J6Q A;  1YHB A;  4GOP C;  3QG1 A;  3CC4 A;  1NAP A;  3A7L A;  3S2D H;  1NTG A;  2R7Z B;  1XTC D;  5K36 G;  1X56 A;  2JE6 I;  3PSI A;  1PH6 A;  4B3R L;  3DLL A;  2CWA A;  1NNX A;  4DV5 L;  5FKA C;  2IX0 A;  1XPR A;  1Y8N B;  3ERQ A;  1SFO B;  1F9P A;  1OXV A;  2PMZ E;  1D6E C;  3NSW A;  2K7V A;  1GUT A;  3KK7 A;  1ICF B;  1X54 A;  2OEO A;  1D2B A;  3DEP A;  4LFC L;  4EX5 A;  2RF4 A;  5M3M B;  3MZ5 A;  1S5D D;  2G9H D;  4J15 A;  3P20 A;  4IPC A;  5FLM G;  1Y1V H;  5BR8 L;  4AIM A;  1RTN A;  2JSO A;  4GKJ L;  5K5P A;  3F8T A;  2RVL A;  4ZUJ A;  1STY A;  5IYD H;  5DAU A;  4B3R Q;  1E2V A;  1EIF A;  2A6H C;  3I3C A;  4C3J B;  5D3I B;  2M2L A;  3H0G G;  4H7B A;  2CFM A;  3L9A X;  4K6L A;  4DV5 Q;  1KIX A;  2ASB A;  1YIJ A;  1AFP A;  2I0Q A;  1XPO A;  1YBY A;  3A74 A;  2CCZ A;  2RSN A;  1Z9F A;  1HNZ L;  2EQS A;  1VQH A;  4LFC Q;  4DXF A;  2CHB D;  3ZJY C;  4FF1 A;  1KRT A;  4HAE A;  4MTN A;  1VQD A;  2LSS A;  4GKJ Q;  3U50 C;  5C6A A;  1HFN A;  3VR5 A;  4IUP A;  1QG7 A;  4CJ0 B;  3S15 H;  4JYA L;  3Q8D A;  1G8Z D;  2PQA B;  2O4X A;  3NTH A;  5IWA L;  3HP3 A;  4B3M L;  2EDG A;  4DNT B;  1WD1 A;  2K03 A;  2VL6 A;  3D31 A;  1FNV A;  4N8F A;  5CV8 A;  5C4J H;  3L2P A;  3HOW G;  3UDF A;  2MUY A;  4NW2 A;  3UE0 A;  1HXY D;  2WAC A;  4A3D H;  1EYD A;  2AHO B;  4K5X A;  3G48 A;  1WVL A;  3J81 j;  4PZ7 A;  3CRL C;  3TP5 A;  3JAM E;  1CT1 D;  4LF8 L;  5JJI A;  2L15 A;  1PRT D;  2X6G A;  3HOV H;  4RKL A;  2WV6 D;  3GV6 A;  5GQO A;  1NUC A;  4YCV A;  2RHS B;  4PZ8 A;  4HTH A;  1JWU D;  3MXP A;  5M5W H;  1OXT A;  1A2T A;  5D14 A;  4V0B A;  5DM6 3;  3E9I A;  3RUZ A;  4UHV A;  4JYA Q;  3QO2 A;  5IWA Q;  4LFA L;  2DUD A;  3S16 B;  1NSN S;  3FP9 A;  3UI2 A;  4JI3 L;  3S17 B;  1F9R A;  2R93 H;  5EPK A;  2Z6B A;  5KYI A;  4DV6 L;  1Q7Y C;  3AB9 A;  1PV4 A;  3H91 A;  1SRU A;  4EQO A;  4N9P A;  1I4Q A;  1KHI A;  1AW7 A;  4Q0F A;  5JOB A;  3I73 A;  1S5F D;  3GTQ B;  1H9S A;  3C1F A;  4OIK A;  1STG A;  2A68 D;  4DK0 A;  4A3J G;  1WTH A;  2K1B A;  3J80 L;  4CKB A;  1R9T B;  1BBU A;  1B70 B;  4QUF A;  4QMG A;  1H9J A;  3I4O A;  1AZP A;  3A8I E;  2K5H A;  3LX0 A;  1I4X A;  4JI3 Q;  1EY0 A;  1GUW A;  1HRJ A;  3G4S A;  5LMN W;  5FJ8 H;  4RCN A;  2I5L X;  4EGV A;  2I46 A;  4DV6 Q;  1JWS D;  4OON A;  1ENA A;  1EY4 A;  1UEA B;  1AZQ A;  2EYL A;  2AQ2 B;  4IFD H;  2PZW A;  1IW7 D;  1GM5 A;  3OIQ A;  2K4K A;  2XRQ D;  2PPB C;  5DLQ E;  2IJ0 A;  3KLW A;  4DV2 Q;  1IYU A;  2RDF A;  4QUC A;  1TVX A;  3GTL H;  4N8X 1;  3PO2 B;  1TII D;  5EKL A;  4GLX A;  4DUZ L;  4X6A H;  1I4P A;  3ERO A;  2L1B A;  1KAA A;  4OEL B;  3MAQ A;  1VMP A;  5FO9 B;  1PH3 A;  3L0O A;  3BZD B;  1PTO H;  3DEO A;  1WTW A;  1BR9 A;  5FLX c;  1K8A C;  1RD9 D;  2LXK A;  4LUZ A;  3BDC A;  4XIG S;  2K14 A;  4WJW A;  2HDM A;  3UDI A;  1LTA D;  1P8L A;  1SE2 A;  4NDX A;  2B29 A;  2EY2 A;  1WCM G;  2F0M A;  4YIJ A;  4YY3 Q;  3TS0 A;  4HMI A;  5J39 A;  1PH2 A;  3VR2 A;  1JC7 A;  4RGO S;  2I07 B;  3I72 A;  2H1E A;  1QVG A;  1ESR A;  2NVX H;  4PNY A;  3FKI H;  2HD3 A;  4U68 A;  1Q86 C;  3QIA A;  2CKZ B;  4A3F H;  1QUQ A;  1CKN A;  2YYZ A;  5M3F H;  4DUZ Q;  2K05 A;  3U58 A;  4A3I B;  3OMC A;  3M4Q A;  1SE4 A;  1Q8I A;  5HGQ A;  2F0T A;  2C5C A;  4NPS A;  4IAL A;  1Y14 B;  3D4R A;  1AP0 A;  5NUC A;  5G3L F;  2JA8 H;  4DV4 L;  2QEJ C;  3S1M H;  1EZ6 A;  3K5N A;  1FNW A;  4B08 A;  1WOC A;  2CW0 D;  1N9W A;  1PFN A;  4AH6 A;  2WAQ E;  4GZY C;  1Z7T A;  1ASY A;  1JOR A;  1TWG H;  3VR6 A;  3HOX G;  4DR4 L;  1R4P B;  4DPG A;  3OWE B;  1I50 B;  3KLS A;  2E2I B;  4OEM B;  2B2T C;  2B3G A;  2A68 C;  3MFG A;  4KLK A;  2GVA A;  1VQ9 A;  1E0B A;  2XGT A;  5ELB A;  3KOJ A;  4CDE C;  2NZH A;  5IIF A;  2VUM G;  3URY A;  4JOI C;  4DNR B;  3R93 A;  2EY1 A;  3MHB A;  3W1B A;  1KDB A;  3PIO A;  3NEM A;  1XXG A;  3QR8 A;  1I6H B;  3D6W A;  4DV4 Q;  5ISR A;  1W2B A;  1G2T A;  1GO3 E;  4GLA C;  2K75 A;  1GVP A;  1CSQ A;  3A54 A;  3HOW B;  1IW7 C;  1ILP A;  1X3P A;  3T51 B;  1S5E D;  1NR4 A;  2F0O A;  2ZXO A;  4RG1 A;  3SVM A;  3GTK B;  4GLV B;  3NPP A;  1VQO A;  1VQ5 A;  1G6Z A;  2K01 A;  3S1Q B;  2B2W C;  1B4O A;  3SK5 A;  4A3K G;  2RKS A;  3IRB A;  2PZU A;  3PQI A;  4UP9 A;  3LWE A;  2XTI A;  1ENF A;  5JEA H;  2Q8T A;  4P73 A;  4TRD A;  3S24 A;  1AN8 A;  3B6Y A;  2FJ2 A;  2JA6 G;  2F0V A;  1A6X A;  1CZG A;  2ZTD A;  4OO1 H;  3KF8 B;  4MIU A;  4OWT B;  4BBS H;  2CQO A;  3NEL A;  1TWH H;  3TRE A;  2PMZ B;  1KNA A;  1VDZ A;  3TME A;  5CBE E;  3PO3 G;  4A3B G;  1FR3 A;  1B2T A;  4DV3 L;  1QIL A;  2SDF A;  4DNI A;  5IT9 c;  2F4I A;  1VF5 C;  3NXW A;  4A76 A;  4FNF A;  1QZG A;  5FLX L;  1TWH B;  1LO5 D;  1TS3 A;  3U4Z A;  4RHS A;  4WOR A;  4B9X A;  4DR3 Q;  1XYI A;  1JOK A;  2CW0 C;  2KBN A;  4KD4 A;  4CDD C;  4J6H A;  2NVT B;  5JJZ A;  5IP9 G;  3CRK C;  3TQY A;  4IOC A;  2KOL A;  4ABN A;  1O7Y A;  3ND9 A;  4G7O C;  1YI2 A;  1B7Y B;  4UDU C;  2Z4H A;  4TVA B;  3K0X A;  1F77 A;  2OQK A;  2L12 A;  4DV3 Q;  1U5K A;  1Y1W G;  2ZJP A;  2V1C C;  1XPU A;  3CCJ A;  3BZK A;  5IGE A;  4MNO A;  2WB1 E;  1WJJ A;  1STE A;  3GTO B;  1DYQ A;  4LW1 A;  1LAC A;  1ASZ A;  5LL6 S;  4C1N I;  3RN2 A;  3FEW X;  3PUW A;  4I65 A;  3EFX D;  3F2C A;  2EJG C;  4A3M H;  4KK7 A;  3STB D;  1S3O A;  3MA2 B;  1GKH A;  3M4P A;  3J7A V;  1WCM B;  1NY4 A;  1IBL Q;  3J7A F;  1V9P A;  1CHQ D;  5IE8 A;  5C3E H;  1EIY B;  3QJY A;  1F2M A;  1IZ6 A;  1IBM Q;  4P2C B;  2IWH A;  2PZT A;  3I70 A;  1MGS A;  4A3M B;  5T1I A;  1Q1B A;  4IFD I;  2Z0S A;  1DOM A;  4GNX A;  3DMU A;  2C9O A;  1PH1 A;  2ZTE A;  1DON A;  2QF7 A;  4RMF A;  3BS1 A;  1B1Z A;  4DAY B;  5GAE C;  1N34 L;  5ELO A;  1KNE A;  2RHQ B;  1A62 A;  4F87 A;  1KL9 A;  1CTM A;  2F0U A;  2NWG A;  1LM0 A;  3D8G A;  4DK6 C;  4K2L A;  2BA0 A;  1MD2 D;  3G71 A;  4JI1 L;  2XWB B;  2F3W A;  3I55 A;  4HJA A;  4BA2 I;  4DK3 C;  3CAM A;  4R4O A;  2EYP A;  4H02 A;  3TP7 A;  4BA1 I;  1K83 H;  1RTO A;  1HFG A;  4IQZ A;  1RJT A;  2Y0S E;  1HNW L;  3VYT A;  3TN2 A;  3PMF A;  2KJX A;  2VUM B;  2KUM A;  3F2D A;  1JQY D;  4KV6 A;  3OSO A;  1N34 Q;  3RNU A;  1CA6 A;  5M5X B;  1IXR A;  2H4O A;  3RZO B;  3RD4 A;  5G3L D;  1UE6 A;  1TKW B;  2YTX A;  2PI2 A;  1H9K A;  2UUA L;  4JI4 L;  3M85 A;  4UY8 C;  3PF5 A;  4JI1 Q;  2EPB A;  3QOJ A;  4B3S L;  1Y1V G;  1RDP D;  1K9M C;  4DUY L;  3AYH B;  1K8M A;  4QL5 A;  5GAG C;  3W3A A;  1J5E Q;  1YNX A;  2B2Y C;  3RLO A;  5IT9 L;  4ZUI A;  1FL0 A;  2G9D A;  5FO7 B;  3DUZ A;  5IYD G;  1PRT F;  1D5M C;  3M4O H;  4A3C H;  3E9H A;  3FPP A;  1HNW Q;  4A3K B;  2KEN A;  1EQT A;  2B8F A;  1HQR D;  2IHF A;  1I4G A;  1FJG L;  2XWJ B;  2FMM A;  5IOD A;  1V1Q A;  3STB C;  2GVB A;  4P71 A;  2EJM A;  3MXN A;  1HCZ A;  2UUA Q;  1XNR L;  1ILQ A;  1II3 A;  4B3S Q;  4JI5 L;  3PIO 3;  4DUY Q;  1NR2 A;  1FGB D;  2RDH A;  1BKB A;  3CCE A;  3PUX A;  2YU9 H;  2R7F A;  1UWV A;  2GN5 A;  1PHJ A;  2B2T A;  3PO3 B;  1DXM A;  4A3B B;  2N78 A;  4X3T A;  1L1O B;  5FO8 B;  1UE5 A;  4BS9 A;  2HUG A;  3HKS A;  5C0X J;  5E1F A;  1FJG Q;  4QY7 A;  3KF6 A;  4ME3 A;  4TKO B;  4ZKB B;  5KYL A;  2KCT A;  2P5Z X;  5BN4 A;  4A3E H;  1IL8 A;  2VS1 A;  4CDF C;  4G57 A;  3AMU A;  1XNR Q;  4A3G H;  1KDA A;  4JBW A;  4LWC A;  3HOV G;  2AWN A;  1QWY A;  1W3S A;  4JI5 Q;  2WAQ B;  4G4K A;  2ALY B;  4NP5 A;  1YJW A;  4XTC S;  4K5V A;  2BOS A;  3T4A C;  5DNF A;  2IL8 A;  4OO1 I;  4BBR H;  1Q90 A;  3R2I A;  2ZJR A;  1KTK A;  2K33 A;  4JI0 L;  3U9S A;  5CGK A;  3JAM i;  3RZD H;  2TSS A;  2A69 D;  1A2U A;  2Y0S G;  3CF5 A;  2QDL A;  1STA A;  5IGC A;  3A8J E;  1PRT B;  5HUR A;  4K8I A;  2PQE A;  4K5W A;  4QF4 A;  2R93 G;  4P75 A;  4Y7N H;  4MN3 A;  5JAV A;  1VQG A;  3MWY W;  1LT4 D;  1EQR A;  4HCS A;  1VQ7 A;  3I90 A;  1XX8 A;  3BVM A;  3I7F A;  4UP7 A;  1MJC A;  4XQN A;  5E7N A;  2ZJQ A;  5IGF A;  1TWF H;  4C2M H;  1STB A;  2EJF C;  3A55 A;  3BYY B;  3HGB A;  1XMO L;  1LTT D;  2K6A A;  5LMN L;  4IN3 A;  3IFD A;  4KHV A;  4MTK A;  1BF4 A;  4JI0 Q;  1JOQ A;  3DXJ C;  4H44 C;  1U9R A;  2GA4 B;  2NYZ D;  1EYA A;  1PYB A;  2K32 A;  4O0A A;  4KJN A;  3G6E A;  5FJ8 G;  1E1O A;  2MGS A;  4HID A;  5COR A;  1E3P A;  1Y8P B;  2HIV A;  2F3V A;  3M7G A;  1E22 A;  4JPB W;  1PFM A;  4IFD G;  1PFB A;  5J1Z A;  5KRU A;  2NBF A;  3NTK A;  2LKV A;  1C4Q A;  3K5L A;  1SNP A;  1CSP A;  1EYC A;  4C3I H;  1BOS A;  1HZB A;  2Q2H A;  3S14 B;  4GN3 B;  4EQ5 A;  3GTM B;  4CKC A;  3S1N H;  5IYB H;  2Q2I A;  1XMO Q;  5LMN Q;  4XQJ A;  4LNQ A;  5ELD A;  1UAP A;  4PMB A;  1HQM C;  1X9N A;  1ET9 A;  5GRO A;  4KKS A;  1GUO A;  3LGJ A;  5EGT A;  1T5E A;  4JI2 Q;  1UE1 A;  3P7J A;  3KJP A;  4A3I G;  3S2D B;  3TSS A;  1HPC A;  3MTS A;  1GHK A;  2BA1 A;  2HCI A;  3S1N B;  3J7A 5;  1QB5 D;  1ONL A;  3FKI G;  3ZYY X;  4A3F G;  3TP8 A;  3SR1 A;  4ZQ3 A;  3V05 A;  1EQQ A;  3NHH A;  4LMQ D;  2ZT9 C;  1RHP A;  4IUR A;  4JV5 L;  1Y1V B;  5IOC A;  3KBG A;  5D65 A;  1N36 L;  2CQA A;  2A69 C;  2R61 A;  3KLS X;  1PA6 A;  3NUC A;  2WII B;  3DWQ A;  3RLN A;  2JA8 G;  4JBM A;  1LTS D;  4IUQ A;  5C4X H;  4AYB E;  3CC2 A;  3TZD A;  2O5J C;  4CJ2 C;  5IGG A;  2XVS A;  1VQL A;  1A3U A;  2IY5 B;  4YCU A;  1DOK A;  3J7Z C;  1WYD A;  4LJZ C;  3A5U A;  2A19 A;  4JV5 Q;  1N36 Q;  2XSC A;  1SNQ A;  3CP0 A;  2JA5 H;  5C4X B;  3IKJ A;  1B50 A;  1BO0 A;  2L11 A;  4LF7 Q;  1SE3 A;  2Z6K A;  3S15 B;  1QNU A;  3U9O A;  4A75 A;  2YTV A;  4JK1 C;  1ROD A;  4PMW A;  1E2W A;  1LTB D;  3JAM c;  3J81 L;  5C4J B;  1WTO A;  2OWO A;  3GTJ H;  4K2K A;  3BU2 A;  4XXE A;  4XT3 B;  4A3D B;  4L5R C;  1T5X D;  2JA5 B;  3HOY H;  3BDO A;  3T16 A;  1JJC B;  1XWE A;  3EIV A;  2R92 H;  2QCP X;  3FRP B;  3HOV B;  1P16 A;  1X6O A;  3PUZ A;  3HG9 A;  3N6R A;  2D2C C;  1PTO F;  2ENB A;  3ULL A;  4Q5V A;  5M5W B;  4GS3 A;  5JEA G;  2NTT A;  3E5S A;  3GTP H;  2YV5 A;  5KND A;  2L5T A;  1Z6H A;  4OO1 G;  4DV2 L;  2R92 B;  2IT1 A;  4DR2 L;  4BBS G;  2Y0S B;  3K59 A;  2RSO A;  2B63 H;  3KYH C;  2R93 B;  3VA7 A;  1WTQ A;  4HJ5 A;  4DAM A;  3IL8 A;  3X3M A;  1N33 L;  3L3O C;  2UUB Q;  1NMF A;  3TS2 A;  2E2H H;  2JK8 A;  1L1O C;  4NB3 A;  2LMC B;  5CBA E;  1ZYR D;  4YY3 L;  5C3X A;  2N3S A;  2F0J A;  1YJ9 A;  2EXZ A;  1X3F A;  2HHH L;  2H5X A;  3T13 A;  4DR2 Q;  2C35 B;  3D4D A;  4BY7 H;  4WFN 3;  3PIP A;  4K8J A;  2O2L D;  2DNE A;  3V96 A;  2UU9 Q;  2B2V C;  4LF6 L;  1AEX A;  2LXJ A;  2WIN B;  1N33 Q;  1B53 A;  2IW3 A;  2UXD Q;  2NVY H;  1BBW A;  3D3R A;  1HUM A;  4E6I A;  3GTL B;  4JW0 A;  4BY7 B;  2L4N A;  1VQC A;  5J22 A;  4OHJ A;  2WP8 J;  4DKA C;  2HHH Q;  2MO1 A;  1PRT C;  1PH4 A;  1ESF A;  1V1P B;  2EYJ A;  1PTO B;  1BQQ T;  3NBH A;  3M3Y H;  2E2J H;  4HN7 A;  1SYB A;  3C3L A;  4A3M G;  4L5Q A;  3VA5 A;  2K5W A;  1TWA H;  5C44 H;  3HEJ A;  5EJW A;  4LF6 Q;  2NB0 A;  1OXX K;  5LMU L;  3D0F A;  4YWK A;  5C3E G;  1PYW D;  2FIN B;  4POG A;  2NVX B;  3FKI B;  1LUZ A;  4JI6 Q;  1VQP A;  1WTV A;  4LUO A;  2PW5 A;  4A3F B;  4QJF A;  1F9Q A;  5M3F B;  2IX1 A;  3OPO A;  1LTL A;  2ATW A;  4X65 L;  3HZX A;  1STN A;  4KY5 A;  4HIO A;  3JAM L;  3HRZ C;  5CV7 A;  1CM9 A;  2JA7 H;  1H9S B;  1HZ9 A;  2EZV A;  1H95 A;  2JA8 B;  3S1M B;  4IOA A;  1CK1 A;  3SK4 A;  2VB3 X;  3F2U A;  5JVH 3;  2KHI A;  1KRS A;  5LMU Q;  3O13 A;  1D5Z C;  3R8B A;  1TWG B;  1U4M A;  1DOL A;  4FYD A;  4GOP A;  1YNN D;  2NTS A;  4DR5 L;  4JG2 A;  2A6E D;  3Q24 A;  1TY0 A;  3MC0 B;  1R4Q B;  2JA7 B;  1ZYR C;  1SAP A;  5I6Y A;  3C46 A;  3CQZ H;  2PI2 E;  4KN4 C;  2N49 A;  3PUV A;  1TXY A;  1XJV A;  4X65 Q;  1QVC A;  3M4Y A;  2XN9 C;  4KHP L;  2PNR C;  4KTA A;  1S5C D;  4OGQ C;  5F2D A;  4JBJ A;  2SEB D;  4KKU A;  4EVO A;  4IUU A;  5M5Y H;  4A3L H;  1JWM D;  2SNS A;  1MI2 A;  2Q8I B;  4WJ3 M;  4DR5 Q;  3PUY A;  5EQ0 A;  3A8K E;  2FMC A;  1TWC H;  4MHE A;  4DR3 L;  4L5S A;  4XDX A;  4A3C G;  1K8O A;  1F9S A;  5I6W A;  2B39 A;  4DAV A;  4ILW A;  4HMJ A;  4KHP Q;  2JXM B;  3A0J A;  5LL6 X;  3M7N A;  4ULL A;  1AH9 A;  3OMG A;  2HCC A;  1JJG A;  1PXU A;  2F0N A;  3VYR A;  4NKL A;  1QUQ B;  1CKN B;  2HQE A;  2QGQ A;  4BBS B;  3I2Z A;  5CV5 A;  1HH2 P;  3MEF A;  3RLF A;  5IP7 H;  4K0K L;  1HNX Q;  4G7Z C;  4A3J H;  4FF3 A;  3SK8 A;  1K73 C;  4IFD J;  4I7Z C;  3R3O A;  2KEE A;  4RWS C;  2F03 A;  1JE5 A;  1LAB A;  1AE2 A;  4UPA A;  1VQE A;  3I4M H;  1LT5 D;  2DJG C;  3L7Z C;  2WAQ G;  3ND8 A;  1WD0 A;  1I5F A;  1PH7 A;  1M1K C;  1KXL A;  1PTO D;  1K28 A;  1U4L A;  4RGM A;  1GOZ A;  1IBL L;  1MBY A;  1QOH A;  4RKB A;  4A3E G;  4DR1 L;  5IGD A;  3DM1 A;  5CV6 A;  1IBM L;  5JJK A;  4A3G G;  3CCM A;  5I4D A;  1SYF A;  2B2U C;  3H94 A;  4K0K Q;  1PDQ A;  1STH A;  1WI5 A;  4AYB B;  4J8Q A;  1YNJ D;  1C48 A;  4XQQ A;  4KHZ A;  3OIP A;  1YNN C;  5C0X H;  2E2D C;  2A6E C;  4BBR G;  1VQB A;  2M9V A;  2XRS D;  3JC6 6;  1N8R C;  3S2H H;  3CCS A;  1MHW C;  3NE5 B;  1VQF A;  5A2Q E;  3S1R H;  2KCN A;  5GAD C;  4R4C A;  1HTP A;  2E75 C;  2MP1 A;  1CA5 A;  4JVZ A;  3N52 A;  4DR1 Q;  1PH9 A;  3K57 A;  1BVS A;  2CH4 A;  5I2X A;  1TR5 A;  2NN6 H;  3H6M A;  2Q2U A;  2F0I A;  3WOE A;  3GTG H;  3J81 i;  1XNQ L;  1OO9 B;  3WOF A;  1OXS C;  4PZ6 A;  3PIP 3;  5C3E B;  3NTI A;  1O78 A;  3GDE A;  3I8Z A;  2MJ8 A;  1LT3 D;  2AUK A;  3TEH B;  1CI3 M;  3CCU A;  1X3G A;  2LFN A;  4A93 H;  2KED A;  3I56 A;  1MSH A;  1Q3L A;  1QCB D;  1RIP A;  3LNN A;  1RL2 A;  4RFB A;  3SEB A;  2F4V L;  4C56 C;  2F52 A;  1EIH A;  1JT8 A;  3AFP A;  5J3B A;  2F0P A;  3NP8 A;  1SYD A;  1SMY D;  3QB3 A;  3HOZ H;  1BCP F;  3HOX H;  1J5E L;  1GHJ A;  5EPL A;  1FVI A;  1B9M A;  3NQI A;  4A93 B;  1VCI A;  4C3I G;  3M9B A;  3ONA B;  1XNQ Q;  2RQX A;  1XTD A;  3KJO A;  4BY1 H;  4IPD A;  4RA8 A;  5IYB G;  1UE7 A;  2ZM6 L;  1EUJ A;  2TMP A;  2F0K A;  1BNZ A;  2ZXP A; 
#chains in the Genus database with same CATH homology
 1MIU A;  2JEA I;  3AQQ A;  2OTL A;  2HIV A;  1X65 A;  4A3J G;  1E22 A;  4IFD G;  1VQK A;  2F4V Q;  1BBU A;  1B70 B;  1JB7 A;  1CSP A;  2KCM A;  3I4O A;  4C3I H;  1IYJ B;  2Q2H A;  1HZB A;  4JBK A;  3NBH B;  4HIK A;  2K5H A;  4GN3 B;  4EQ5 A;  3CCV A;  1NJI C;  4JI3 Q;  2JJQ A;  3G4S A;  5IYB H;  3S1N H;  2Q2I A;  5FJ8 H;  5LMN W;  5LMN Q;  1XMO Q;  3I4N H;  4NXN Q;  2I5L X;  4LNQ A;  4DV6 Q;  5AJ3 L;  2WB1 G;  4OON A;  4LF9 L;  5GAH C;  1NBW A;  2RCN A;  4DR6 L;  1X9N A;  5GRO A;  3LGJ A;  3CME A;  1GM5 A;  2E5L Q;  2K4K A;  1UE1 A;  4JI2 Q;  2ZM6 Q;  3KJP A;  4A3I G;  1QVF A;  5DLQ E;  2R7D A;  3KLW A;  4IJL A;  4DV2 Q;  1LYL A;  2BA1 A;  2K5V A;  4YWL A;  2HT1 A;  3GTL H;  1L2F A;  3EBE A;  4GLX A;  3J7A 5;  2YTY A;  4DUZ L;  2NVT H;  4X6A H;  1IBK L;  1I3Q H;  3HOU G;  2D62 A;  5JJL A;  3FKI G;  2I5M X;  3OW2 A;  1PH3 A;  2K50 A;  4HJ7 A;  3L0O A;  3E0E A;  1E24 A;  4A3F G;  5FLX c;  3CXC A;  2NZO A;  1K8A C;  5C4X G;  5IYC G;  3ULJ A;  2LXK A;  4LUZ A;  4XIG S;  2K14 A;  3UDI A;  1EQQ A;  1P8L A;  1DGS A;  3AFQ A;  2B29 A;  1CKM A;  1YHQ A;  3K7U C;  4JV5 L;  5AJ3 Q;  4LF9 Q;  1WCM G;  1N36 L;  4DR6 Q;  3KFU A;  4YY3 Q;  3TS0 A;  1A8V A;  1PH2 A;  3FHW A;  1L0W A;  1D7Q A;  1PA6 A;  1YVC A;  4C3H H;  3GTO H;  3RN5 A;  1QVG A;  2AMC B;  1EOV A;  4JOI A;  3RLN A;  2NVX H;  3HOU H;  2WFW A;  3FKI H;  2JA8 G;  1SRO A;  4JBM A;  1NMG A;  4A3D G;  3K7A H;  4GOP B;  2JA5 G;  4OX9 L;  2A1A A;  1Q86 C;  2UXB L;  2CKZ B;  4A3F H;  1QUQ A;  3ULP A;  1CKN A;  1VQI A;  2YYZ A;  5C4X H;  5M3F H;  5IYC H;  4DUZ Q;  3U58 A;  4AYB E;  2K5N A;  3M4Q A;  1IBK Q;  3CC2 A;  3TRZ A;  2DGY A;  3K80 C;  5HGQ A;  1I94 L;  4YWM A;  3PGZ A;  1WCM H;  3CPF A;  3OYY A;  2IHE A;  4NPS A;  3UE1 A;  2UUC L;  1VQL A;  3HFZ B;  1VQA A;  2IY5 B;  1VQ4 A;  4YCU A;  1Y14 B;  3W1G A;  3EN2 A;  3J7Z C;  1WYD A;  1PH5 A;  1G29 1;  3A5U A;  1YHA A;  2A19 A;  4JV5 Q;  2JA8 H;  4DV4 L;  3S1M H;  3HOY G;  1D8L A;  1N36 Q;  2JA5 H;  3CP0 A;  4ALP A;  3T1H L;  1WOC A;  1N9W A;  1Y1W H;  2R92 G;  4AH6 A;  2WAQ E;  3SGI A;  4LF7 Q;  3HKZ E;  1ASY A;  2Z6K A;  3CC7 A;  1TWG H;  4A75 A;  3HOX G;  4DR4 L;  4DPG A;  2YTV A;  4PMW A;  4OX9 Q;  2UXB Q;  3JAM c;  2B3G A;  3J81 c;  4KLK A;  2OWO A;  2GVA A;  1VQ9 A;  1SN8 A;  2XGT A;  3GTJ H;  1L1O A;  3BU2 A;  3WWV A;  1YEZ A;  3KOJ A;  1I94 Q;  4L5R C;  2NZH A;  1YJN A;  2VUM G;  3HOY H;  4BXX G;  2UUC Q;  4JOI C;  1EWI A;  1SE8 A;  1JJC B;  3EIV A;  1KD1 C;  2R92 H;  1PYS B;  3H15 A;  4X62 L;  3W1B A;  3PIO A;  3NEM A;  2B63 G;  4UP8 A;  2NVQ H;  1P16 A;  1X6O A;  3U4V A;  3PUZ A;  4DV4 Q;  1GD7 A;  1W2B A;  4PG3 A;  3T1H Q;  1SMX A;  1IL2 A;  1GO3 E;  3ULL A;  2HQL A;  4GLA C;  4GS3 A;  5JEA G;  2K75 A;  1GVP A;  1CSQ A;  2R7Z G;  1SLJ A;  3GTP H;  2PQA A;  4JI8 L;  2D0P A;  2YV5 A;  4JI2 L;  3A5Z B;  1N32 L;  4LF5 L;  4FDB A;  4RG1 A;  4OO1 G;  2VUM H;  2UXC L;  4BXX H;  4APV A;  1V43 A;  2IT1 A;  4GLV B;  4DV2 L;  4DR2 L;  4BBS G;  1VQO A;  1Q82 C;  2D0O A;  3ERS X;  5M5X H;  3PV0 A;  1VQ5 A;  4MZ9 A;  1T9H A;  3KYH C;  2B63 H;  3RZO H;  4A3K G;  2VQF L;  3IRB A;  2Z6K C;  4HJ5 A;  4UP9 A;  3H3V I;  1PVO A;  1QZH A;  1Q1E A;  5M3M G;  2XTI A;  3MXN B;  4OWW B;  4DAM A;  4BY7 G;  3T1Y L;  4OXP A;  5JEA J;  5IY0 A;  4X62 Q;  1N33 L;  4P73 A;  1O7I A;  2UUB Q;  3CCR A;  2R7Z H;  3S24 A;  1KAW A;  3B6Y A;  4GN5 A;  3J80 i;  2JA6 G;  4LFB L;  1WFQ A;  1NMF A;  3TS2 A;  2E2H H;  2ZTD A;  2JK8 A;  3KF8 B;  1L1O C;  4NB3 A;  4OWT B;  4BBS H;  2CQO A;  1OTC A;  4YY3 L;  2N3S A;  1X3E A;  2MNA A;  1PH8 A;  2EXD A;  3NEL A;  4DV0 Q;  1TWH H;  3TRE A;  4JI8 Q;  4A3K H;  1YJ9 A;  4KHP Q;  1X3F A;  2HHH L;  2H5X A;  2MO0 A;  4LF5 Q;  1N32 Q;  3CCQ A;  2UXC Q;  5M3M H;  3UDX A;  4DR2 Q;  2C35 B;  4BY7 H;  3PIP A;  3PO3 G;  4A3B G;  3KF6 B;  4DV3 L;  2UU9 Q;  2VQF Q;  2JA6 H;  2NN6 I;  4DNI A;  5IT9 c;  4LF6 L;  2LXJ A;  4A76 A;  1VQJ A;  3T1Y Q;  1K8G A;  1QZG A;  1EYG A;  1N33 Q;  2UXD Q;  2NVY H;  5M3F G;  5HY6 A;  1BBW A;  4LFB Q;  3U4Z A;  5C44 G;  4C3J H;  1VS0 A;  2MQH A;  3VDY A;  1EFW A;  1Q12 A;  4DR3 Q;  4LUV A;  1VQC A;  2KBN A;  3CW2 C;  3PO3 H;  4P72 A;  4R4I A;  4A3B H;  2AKW B;  2BH8 A;  1A63 A;  5IP9 G;  1UEB A;  2WP8 J;  3HKZ G;  3TQY A;  4X66 L;  4DKA C;  4IOC A;  4LF7 L;  4X64 L;  2HHH Q;  2MO1 A;  4JI4 Q;  1PH4 A;  4GNX B;  3M3Y H;  1YI2 A;  1YIT A;  2E2J H;  1B7Y B;  4GN4 B;  4GKK L;  4TVA B;  2KHJ A;  3K0X A;  1C0A A;  4A3M G;  2OQK A;  4L5Q A;  4DV3 Q;  1Y1W G;  1U5K A;  2ZJP A;  1K0R A;  2V1C C;  1TWA H;  1XPU A;  1C7Y A;  5C44 H;  2QEX A;  3CCJ A;  4B3T L;  1VQN A;  3BZK A;  1MJE A;  3RR5 A;  4LF6 Q;  1PFS A;  1OXX K;  4MNO A;  5LMU L;  4HJ8 A;  2WB1 E;  3D0F A;  1WJJ A;  3KDF B;  4YWK A;  5C3E G;  1JJ2 A;  4WJ4 A;  1Q8K A;  2JA7 G;  2F3I A;  3F1Z A;  5IP9 H;  4LW1 A;  5H1S E;  4POG A;  2I5H A;  1KQS A;  1LUZ A;  1ASZ A;  4JI6 Q;  1VQP A;  4LUO A;  2VW9 A;  2N8N A;  3BJU A;  3RN2 A;  4QJF A;  3PUW A;  2E8G A;  5BR8 Q;  3F2C A;  1S40 A;  4A3M H;  1X55 A;  2IX1 A;  3STB D;  4X66 Q;  1S3O A;  1LTL A;  4X64 Q;  3UDG A;  2ATW A;  1GKH A;  3M4P A;  3OTO L;  1A0I A;  4X65 L;  1NY4 A;  2OCE A;  1IBL Q;  1V9P A;  4GKK Q;  3BZC A;  2QA4 A;  4HIO A;  5IE8 A;  5C3E H;  4OWX B;  1EIY B;  4Y52 H;  4L5T A;  2JA7 H;  1HZ9 A;  2CWP A;  4B3T Q;  1IZ6 A;  1IBM Q;  1H95 A;  1VQM A;  4LF4 L;  4IOA A;  4R4Q A;  2KHI A;  1KRS A;  3GO5 A;  5LMU Q;  4AQY L;  1E1T A;  1HNZ Q;  1Q1B A;  4IFD I;  1NE3 A;  2Z0S A;  4GNX A;  3K8A A;  2UUB L;  1PH1 A;  4GOP A;  4DR5 L;  4JG2 A;  2ZTE A;  4RMF A;  2VZA A;  3S16 H;  4A3L G;  1Z47 A;  2HIX A;  3S17 H;  4DAY B;  5GAE C;  2OQ0 A;  1N34 L;  1Q46 A;  5ELO A;  2RHQ B;  2VQE L;  1A62 A;  3CQZ H;  2PI2 E;  1KL9 A;  2N49 A;  3PUV A;  1TXY A;  1XJV A;  3OTO Q;  3KDF A;  4IPH A;  4X65 Q;  1LM0 A;  1QVC A;  4R4T A;  4DV0 L;  1KC8 C;  3NEN A;  1HR0 L;  4DV7 L;  4KI0 A;  4DK6 C;  1JMC A;  2ES2 A;  4KHP L;  2BA0 A;  1G51 A;  3G71 A;  4B3M Q;  4JI1 L;  3GTQ H;  4IO9 A;  2OTJ A;  4TQU S;  3I55 A;  4HJA A;  4BA2 I;  2UU9 L;  4LF4 Q;  4DK3 C;  3CAM A;  4R4O A;  4QQB X;  4JBJ A;  4H02 A;  5M5Y H;  4A3L H;  1R9T H;  4BA1 I;  4AQY Q;  3CD6 A;  1K83 H;  4IPG A;  5C0X I;  3PCO B;  3DM3 A;  2UXD L;  2Y0S E;  4JI7 L;  4LF8 Q;  1HNW L;  4DR5 Q;  4WJ3 M;  2ID0 A;  3PUY A;  2JEB I;  3S14 H;  3PO2 G;  1U0L A;  2VNU D;  3GTM H;  4DV1 L;  3F2D A;  3W5O A;  3F2B A;  1TWC H;  1N34 Q;  3RNU A;  1SFO H;  4DR3 L;  4A4I A;  5IP7 G;  1IXR A;  4L5S A;  4A3C G;  2VQE Q;  3GD7 A;  1UE6 A;  4QGU A;  4NXM L;  3J80 c;  2YTX A;  1K3R A;  1CUK A;  1AE3 A;  3ICE A;  4GNX C;  2PI2 A;  1VQ6 A;  2K52 A;  1HR0 W;  1HR0 Q;  4DV7 Q;  2UUA L;  2R6G A;  1J6Q A;  1YHB A;  3M85 A;  4GOP C;  4JI4 L;  3A0J A;  4LFA Q;  4UY8 C;  4QIW E;  3CC4 A;  3PF5 A;  4JI1 Q;  3M7N A;  3I4M G;  1NTG A;  4B3S L;  3S2D H;  5K36 G;  1AH9 A;  2EIF A;  1Y1V G;  1K9M C;  1X56 A;  2JE6 I;  3PSI A;  3AYH B;  4DUY L;  3DLL A;  2CWA A;  4QL5 A;  5GAG C;  1PH6 A;  4B3R L;  4AYB G;  4DV5 L;  1JJG A;  2IX0 A;  1XPR A;  1J5E Q;  3PO2 H;  1YNX A;  1QUQ B;  1CKN B;  3RLO A;  2QGQ A;  1OXV A;  2PMZ E;  3I2Z A;  4P74 A;  1FL0 A;  5IYD G;  1HH2 P;  3MEF A;  2AWO A;  3RLF A;  5IP7 H;  3M4O H;  4A3C H;  4K0K L;  3E9H A;  1HNX Q;  4JI7 Q;  1HJP A;  4A3J H;  1HNW Q;  1X54 A;  2KEN A;  4IFD J;  1K73 C;  4LFC L;  4EX5 A;  3ER0 A;  1B8A A;  2RF4 A;  4DV1 Q;  2IHF A;  4JI6 L;  1FJG L;  1JE5 A;  2BH2 A;  4J15 A;  1AE2 A;  4UPA A;  1VQE A;  3K81 C;  4IPC A;  3I4M H;  5FLM G;  1V1Q A;  1Y1V H;  3STB C;  2GVB A;  3L7Z C;  4AIM A;  5BR8 L;  4GKJ L;  1M90 C;  2WAQ G;  4NXM Q;  3F8T A;  1MKH A;  4P71 A;  5C0X G;  1I5F A;  1PH7 A;  1M1K C;  2UUA Q;  1KXL A;  2JA9 A;  1XNR L;  1G6P A;  5ELN A;  4JCV E;  1FGU A;  1IBL L;  5IYD H;  4B3S Q;  4HJ9 A;  4JI5 L;  4B3R Q;  4DUY Q;  1EIF A;  4A3E G;  4DR1 L;  1C9O A;  1BKB A;  4DV5 Q;  3CCE A;  1KIX A;  3H0G G;  2ASB A;  2CFM A;  3PUX A;  1XMQ L;  2YU9 H;  1IBM L;  5JJK A;  4A3I H;  2R7F A;  1UWV A;  2GN5 A;  1PHJ A;  4A3G G;  3CCM A;  1YIJ A;  2N78 A;  2I0Q A;  1XPO A;  1S72 A;  4K0K Q;  1YBY A;  1L1O B;  3A74 A;  5EAY A;  5FLM H;  1UE5 A;  1WI5 A;  4O2D A;  2CCZ A;  3H3V H;  1Z9F A;  1HNZ L;  2EQS A;  4KHZ A;  1YZ6 A;  1VQH A;  3HKS A;  4YHH L;  4R1J A;  5C0X J;  4LFC Q;  3ZJY C;  1Q81 C;  4BBR G;  1VQB A;  1SR3 A;  3JC6 6;  1N8R C;  1FJG Q;  4QY7 A;  1KRT A;  3KF6 A;  3CCS A;  4MTN A;  4HIM A;  2ZTC A;  3S2H H;  1VQD A;  4ME3 A;  2LSS A;  2NN6 G;  1VQF A;  4GKJ Q;  2KCT A;  3U50 C;  3S1R H;  4A3E H;  2VS1 A;  3H0G H;  5GAD C;  2PNH A;  1XNR Q;  4R4C A;  4YCW A;  4JBW A;  4LWC A;  4A3G H;  3HOV G;  1HZA A;  2AWN A;  1W3S A;  3S15 H;  4JYA L;  4JI5 Q;  3Q8D A;  2ALY B;  5IWA L;  1I50 H;  2PQA B;  4B3M L;  4DR1 Q;  1YJW A;  2E2I H;  4XTC S;  1HZC A;  4A93 G;  1XMQ Q;  2VL6 A;  1PH9 A;  3D31 A;  1BVS A;  1OXU A;  5C4J H;  4BBR H;  3L2P A;  4OO1 I;  3HOW G;  3UDF A;  4DR7 L;  3UE0 A;  4POF A;  2ZJR A;  4A3D H;  4JI0 L;  2Q2U A;  2AHO B;  3CMA A;  3G48 A;  3JAM i;  3J81 j;  3GTG H;  4PZ7 A;  4YHH Q;  3J81 i;  3RZD H;  1XNQ L;  4IJH A;  2Y0S G;  1VQ8 A;  3CF5 A;  4LF8 L;  3HOZ G;  5JJI A;  2VY3 A;  2L15 A;  2JQO A;  1OXS C;  4PZ6 A;  3HOV H;  2R93 G;  5GQO A;  1I6H H;  4P75 A;  4YCV A;  4Y7N H;  2RHS B;  1VQG A;  3GDE A;  4PZ8 A;  3TEH B;  4A93 H;  3CCU A;  1X3G A;  4BY1 G;  2A8V A;  5M5W H;  1OXT A;  3I56 A;  2Q2T A;  1EQR A;  3HOW H;  1VQ7 A;  1RIP A;  2F4V L;  1RL2 A;  3PF4 A;  3E9I A;  3I7F A;  4JYA Q;  5IWA Q;  2F52 A;  4UP7 A;  4LFA L;  3AEV A;  1MJC A;  1JT8 A;  3AFP A;  5E7N A;  5J3B A;  2ZJQ A;  3GTK H;  1TWF H;  2DUD A;  4C2M H;  3HOZ H;  3FP9 A;  4JI3 L;  1CKO A;  3HOX H;  1J5E L;  4DR7 Q;  3CCL A;  1XMO L;  5LMN L;  3S1Q H;  4JI0 Q;  2R93 H;  1FVI A;  4NXN L;  2MFI A;  4DV6 L;  1VCI A;  1Q7Y C;  3M9B A;  1XNQ Q;  1PV4 A;  1XTD A;  1PYB A;  1SRU A;  3KJO A;  4JC0 A;  1HNX L;  3CPW A;  4BY1 H;  4IPD A;  1KHI A;  1E7Z A;  4O0A A;  5IYB G;  1UE7 A;  3G6E A;  5FJ8 G;  1E1O A;  2E5L L;  3I4N G;  2ZM6 L;  4DR4 Q;  4HID A;  2FXQ A;  1EUJ A;  1E3P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...