4HJ5A

Crystal structure of schizosaccharomyces pombe pot1pc bound to ssdna (ggtttcggt)
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
138
structure length
138
Chain Sequence
SFSLLSQITPHQRCSFYAQVIKTWYSDKNFTLYVTDYTENELFFPMSPYTSSSRWRGPFGRFSIRCILWDEHDFYCRNYIKEGDYVVMKNVRTKIDHLGYLECILHGDSAKRYNMSIEKVDSEEPELNEIKSRKRLYV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protection of telomeres protein 1
publication title Nonspecific Recognition Is Achieved in Pot1pC through the Use of Multiple Binding Modes.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Dna binding protein
total genus 35
structure length 138
sequence length 138
ec nomenclature
pdb deposition date 2012-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16686 POT1PC ssDNA-binding domain of telomere protection protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4hj5A00
3HKZG 2JA5G 2KCTA 1K3RA 1VQ9A 1WYDA 5IYCG 4MNOA 4TQUS 4LF5L 4LF8L 4UP7A 3I4OA 3PCOB 1IYJB 3F1ZA 1V9PA 3I2ZA 2VQEL 2ES2A 1KRSA 2Q2TA 3J7ZC 1YNXA 5ELNA 4JI8Q 5C0XG 4A3DH 3CPFA 2YV5A 1OXUA 2AWNA 2N3SA 3Q8DA 4X62L 1KD1C 1HNZL 2JQOA 3UDXA 1Q81C 3FHWA 1X3FA 2AWOA 4WJ4A 2E2IH 3KF6B 1L0WA 4C3JH 1AE3A 3GTQH 3HOWH 2LSSA 1PH4A 2WAQE 1VQCA 4KLKA 1XPOA 1EUJA 4DK6C 2I5HA 3S17H 2CQOA 2VY3A 1JT8A 5GAGC 1OTCA 3UE1A 3I55A 1Q12A 1XNQQ 2E2HH 2N8NA 1WCMH 4X64L 2FXQA 5FLMG 1YVCA 4A3BG 4YCUA 4WJ3M 4IPGA 4PZ7A 1AE2A 3AYHB 1XNRQ 3KF6A 3HOXG 4JCVE 3M4OH 1N36L 1UEBA 1B7YB 3RLOA 2R93G 2VQFL 3HOVH 2WB1E 4LUVA 4L5TA 1JMCA 1V1QA 3S1RH 4XTCS 3JAMc 2JK8A 3BZKA 4K0KL 4AH6A 5M5XH 2JA9A 1YBYA 4DR4Q 1K8GA 3HOZG 4P74A 3KDFB 5C0XJ 1S72A 1VQLA 2B63G 5IY0A 2UU9L 2GVAA 4DV0Q 2NN6I 1X9NA 4A3LG 1E24A 1WI5A 3OYYA 4DUZL 4LF5Q 4JYAQ 2JA8G 2PQAA 2RCNA 1A62A 3RR5A 2YTYA 1SFOH 1JJCB 3ZJYC 4A3EH 4ALPA 2VZAA 4EQ5A 3HOUH 3J7A5 1EFWA 1CKOA 3M3YH 3M4PA 4KI0A 4JV5L 4DR6Q 4DV1L 3JC66 5BR8Q 3CCQA 2IX0A 1KHIA 3E9HA 4GNXC 1VQMA 5M3MH 2B29A 3EBEA 3EN2A 3I4NG 2WAQG 1B8AA 1X55A 2QEXA 2A1AA 4BBRH 4AYBE 4O0AA 3J80c 4IOCA 1C7YA 1E22A 3PGZA 2D62A 1VS0A 1PFSA 1X6OA 3GO5A 3K8AA 3NENA 4YHHQ 3H0GG 2MQHA 3I7FA 3W1BA 4B3MQ 2E5LL 4JBJA 1IZ6A 4RG1A 4A3KG 2F3IA 1KRTA 2UUCL 4A3GG 3TS2A 4HJ9A 3CCLA 4QQBX 3MEFA 1V43A 2MFIA 3S16H 2AMCB 4A93G 2KCMA 3U4VA 3UE0A 2UXDL 2YTXA 5HGQA 2OQKA 4JI5L 1LTLA 4LF7L 4DR1L 1PH3A 2WB1G 1TWAH 2PMZE 1N36Q 1K73C 3PIOA 2BA1A 5C4XH 3H15A 4GNXA 2VQFQ 4YWMA 1Y1WH 4BY1H 4A3DG 2UXBL 1IL2A 4Y52H 4K0KQ 1NE3A 1VQAA 4IPCA 3M85A 2UXCL 2PNHA 5J3BA 2CWPA 4JI1Q 4JI3Q 5M3FH 3CD6A 3A5ZB 2NN6G 2UU9Q 4OWXB 1N34L 3JAMi 4QGUA 3K0XA 4DV3Q 1NY4A 5JEAG 4IO9A 4A3JH 3L0OA 4OWTB 2JEAI 4AIMA 1M90C 1VQ8A 4DUZQ 4UP9A 1VQ7A 1E1TA 1YHBA 1VQHA 3VDYA 2VUMH 4HJ8A 5IE8A 1FJGL 1I6HH 5E7NA 4J15A 1CSPA 1WCMG 4OWWB 4GLXA 4AYBG 1VQBA 4JI7L 1EQQA 3PUWA 3RLNA 4B3SQ 2D0OA 2ZM6Q 4UP8A 4P73A 4DR3L 4BA1I 4JI0L 4PG3A 3KF8B 3OTOL 4DV4Q 4NXML 2ATWA 3HFZB 4BA2I 1SR3A 3HOVG 1SLJA 3PO2H 1PH7A 5DLQE 3PUVA 3T1HQ 5GAEC 4A3MH 3K7AH 4PZ6A 4YY3Q 3GD7A 4R4QA 3PSIA 2R7DA 1LUZA 2OTLA 3U58A 3DLLA 1E7ZA 4X66L 2MO1A 5IYBH 1KIXA 4DR7L 2V1CC 4JI5Q 3S1QH 3B6YA 4IPHA 3CCRA 1MKHA 3J81j 4GOPC 3W5OA 1D7QA 2NZOA 4OX9Q 1TXYA 1IBLL 1VQGA 3KFUA 5JEAJ 3HOUG 5C3EH 3OW2A 2UXCQ 3UDGA 3W1GA 5M3MG 1O7IA 4JI4Q 3UDFA 5IYDH 1VQEA 4BBRG 1H95A 4DUYL 2UUAQ 1Q1BA 1N34Q 1VQFA 4A3FH 4QY7A 4PZ8A 1IBKQ 2EQSA 3T1YL 1EIYB 2JJQA 4DR5Q 3HKSA 1S3OA 2D0PA 3E0EA 1MJEA 1JB7A 3NBHB 3FKIH 5IT9c 4JBKA 1ASYA 3HOYH 3CCEA 5FLXc 1TWCH 1PYSB 2R7ZH 1N8RC 1FJGQ 3GTMH 1IBMQ 2HT1A 3D31A 4NXNL 4IFDI 1RIPA 4LFAQ 1XMQL 3L2PA 2K52A 1HNXL 4GOPA 1EWIA 4BBSG 5C4XG 5C4JH 1N9WA 1WFQA 1HZAA 2I5MX 2MO0A 1XMOQ 1SMXA 1E1OA 1N32L 3K81C 3K80C 3UDIA 1NBWA 2PQAB 3AFQA 4DV5Q 1PA6A 4DR3Q 1HNWQ 1C9OA 1KAWA 1UWVA 1G51A 4AQYQ 4A3IH 2E2JH 4L5SA 4UY8C 4QJFA 2L15A 3SGIA 1Y1WG 2GVBA 4BY1G 3U50C 2GN5A 1X54A 1PYBA 2YU9H 1XPUA 1GM5A 1UE1A 1YJWA 4YCWA 2IHFA 2EIFA 1Q8KA 2HIVA 1FGUA 1CKMA 1X65A 2XGTA 3J81i 5M3FG 1VQ4A 1I94Q 3FP9A 4RMFA 3RLFA 1N33L 2NVQH 3CQZH 1Y1VH 2RHQB 4B3RL 2KHIA 4DV6L 4A3JG 1YHQA 4LF9L 3MXNB 3F2DA 4LF8Q 2VUMG 3S2HH 2VQEQ 1X56A 1CUKA 3STBD 3G6EA 4BXXH 3IRBA 4MTNA 1Q1EA 4HJ5A 4FDBA 4LW1A 2JE6I 4X62Q 1QZHA 1K8AC 2A19A 4R4TA 1HNZQ 4GKKL 4IOAA 1TWFH 4A75A 2JEBI 1QUQA 2OWOA 4LF4L 4DUYQ 4DR2L 4LUZA 2JA7H 3CCMA 1J5EL 3TS0A 2IY5B 2IT1A 4GNXB 1K9MC 3RN2A 2RF4A 1KL9A 1HJPA 3F8TA 4O2DA 3PO2G 4X65L 1MIUA 3EIVA 4P72A 2UUBL 2C35B 2F4VL 4JI2L 1PV4A 1TWHH 4IFDG 5C44H 4LFCL 4NXNQ 1B70B 4GN3B 4DNIA 1GD7A 4X64Q 4A76A 4NB3A 3S1NH 2E8GA 4KHPL 1NMGA 2K5NA 1N32Q 1L2FA 4X6AH 2KENA 3ULJA 3DM3A 3G4SA 3CC7A 4HIDA 4DAYB 4LUOA 1AH9A 4R4IA 3CCSA 4POGA 5EAYA 3TRZA 5C3EG 1QVCA 3CCUA 5LMUL 1UE5A 1VQPA 3CMEA 5IYDG 1SRUA 1VQIA 2QGQA 1DGSA 1QZGA 4B3RQ 1OXTA 2DUDA 4POFA 1GKHA 4HJAA 4A3FG 1CKNA 1HH2P 4DV7L 5LMNL 2Y0SE 4HIOA 4JG2A 3I56A 3FKIG 2JA6H 2R7ZG 2PI2E 3PO3H 4OONA 5M5WH 2ID0A 5GAHC 4LF6L 3ICEA 2XTIA 1KC8C 1VQJA 5IP7H 1PH1A 1OXXK 2I0QA 1G6PA 4JV5Q 4DV1Q 4JI8L 4A3CH 4IFDJ 1JJGA 2NVTH 4LF4Q 2Z6KC 3S1MH 4A3IG 3CW2C 4JOIC 1VQ6A 3H3VH 2E5LQ 3CF5A 3F2CA 2NVYH 3J80i 2EXDA 2UUCQ 1XTDA 1VQNA 1Z9FA 2JA8H 1Y14B 2N49A 2WP8J 4IJHA 1IXRA 1Y1VG 4GLAC 2UXDQ 4UPAA 1BBWA 1P16A 2VNUD 1XNQL 5IWAL 2Q2UA 3CP0A 1FVIA 1HZBA 1YITA 4Y7NH 1K0RA 4LF7Q 2WFWA 4DR1Q 4HIMA 5JJLA 4DAMA 3S14H 1L1OC 3S15H 4R1JA 4A3EG 2HIXA 2UXBQ 4GOPB 1XNRL 5LMUQ 3BZCA 1U0LA 5GQOA 2Z6KA 1CSQA 1GO3E 1PH8A 3K7UC 4QL5A 4DKAC 2HHHL 1MJCA 1LYLA 2ZJPA 1YI2A 2AHOB 2Y0SG 4A3KH 2JA7G 4DR4L 1R9TH 3I4MH 4A3GH 2I5LX 5AJ3L 2A8VA 1GVPA 5LMNQ 3RZDH 2LXKA 3GTJH 2K4KA 1WJJA 2DGYA 4DV0L 1I3QH 2KBNA 3H3VI 5C44G 4R4OA 4YCVA 4JYAL 4LF6Q 1HZ9A 2CFMA 1UE6A 2VW9A 1PH5A 2N78A 1Q86C 1L1OA 4MZ9A 4JI7Q 4OXPA 3KJOA 1XJVA 2K50A 1FL0A 2KHJA 2IHEA 5LMNW 1X3GA 4DR6L 1XPRA 4IJLA 5BR8L 3CC2A 1C0AA 4JI0Q 1VQDA 5JJIA 4LWCA 1W3SA 3OTOQ 4NXMQ 4OO1I 1YHAA 1YIJA 1EIFA 4NPSA 1X3EA 4DV2L 3S24A 2OTJA 4YHHL 1UE7A 4B3ML 1QUQB 1Z47A 3CAMA 3M9BA 4P75A 1HR0L 4B3TL 4JBWA 4BY7H 4JI6L 4X66Q 4DR7Q 4GKJQ 4YWLA 3ER0A 5IWAQ 2OCEA 3AQQA 3AEVA 3GTGH 1J6QA 3PIPA 1JJ2A 2JA6G 3PO3G 1IBLQ 1D8LA 3PV0A 1U5KA 2ZJRA 1M1KC 1Q82C 5IP7G 4KHZA 4GKJL 1YEZA 2ZTCA 1VQKA 2HHHQ 4A3CG 4GN5A 5FJ8H 2VS1A 4DPGA 2RHSB 1KQSA 2Q2IA 1BKBA 3STBC 5JJKA 1PH9A 3PUYA 1QVGA 4JI1L 4JI3L 4L5RC 1YJNA 1KXLA 1A63A 4C3IH 3TREA 4C2MH 4JC0A 5IP9H 5M5YH 5AJ3Q 3A0JA 3T1YQ 3HOWG 2CCZA 2K14A 2R92H 1P8LA 4GLVB 4DV3L 4LFBL 2JA5H 3KLWA 2BH2A 4A3MG 1BBUA 1SE8A 4GS3A 5IYCH 1Q7YC 1XMQQ 1HNXQ 1YJ9A 1CKNB 5IYBG 4A4IA 2H5XA 5GADC 3CXCA 3KOJA 1HZCA 1VCIA 1I5FA 4R4CA 5H1SE 4PMWA 3RNUA 4OO1G 1PH6A 4B3SL 3AFPA 1Q46A 2ZM6L 2K5HA 2YTVA 3KDFA 4H02A 1E3PA 3U4ZA 3CC4A 4DV2Q 1SROA 2OQ0A 4DV4L 1W2BA 4LNQA 2B3GA 4IPDA 2F52A 1N33Q 4L5QA 3GDEA 3GTKH 3PF4A 2ALYB 1HR0Q 4B3TQ 3T1HL 3E9IA 2IX1A 2Z0SA 4JI6Q 2BA0A 4YY3L 1YZ6A 3RN5A 3I4MG 1OXVA 4DV6Q 4LF9Q 3RZOH 5GROA 1JE5A 4GN4B 2Q2HA 4BBSH 3HOYG 5FLMH 1T9HA 2K75A 3CCJA 3NELA 1BVSA 4EX5A 3ULLA 3TQYA 4A3BH 3G48A 3M7NA 1S40A 3BU2A 1VQOA 4OX9L 2LXJA 1K83H 1OXSC 3HKZE 4APVA 4DK3C 2NZHA 2VL6A 3HOXH 2ZTEA 3CMAA 2R6GA 3PF5A 1HR0W 4GKKQ 3PUZA 2R93H 3GTLH 5ELOA 3KYHC 4P71A 4LFBQ 3ERSX 1NTGA 5C0XI 4DR2Q 2R7FA 3NEMA 1J5EQ 1EOVA 1ASZA 4JI4L 3GTOH 1PVOA 3HOZH 1G291 2B63H 2UUAL 4X65Q 2UUBQ 2CKZB 2CWAA 4C3HH 1IBKL 4ME3A 2F4VQ 3A74A 4JI2Q 4DR5L 1NJIC 4A3LH 2NVXH 4LFCQ 3GTPH 1RL2A 4HIKA 1LM0A 3CPWA 4XIGS 3TEHB 4BY7G 1IBML 1I50H 2YYZA 4KHPQ 2BH8A 1EYGA 2ZJQA 3CCVA 4LFAL 1SN8A 2AKWB 3LGJA 3WWVA 1WOCA 1XMOL 1QVFA 5K36G 2K5VA 3F2BA 4BXXG 4DV5L 3I4NH 1HNWL 2ZTDA 3KJPA 3J81c 2HQLA 4AQYL 1EQRA 2PI2A 3BJUA 1NMFA 3L7ZC 4QIWE 1L1OB 3ULPA 1A0IA 2ASBA 3H0GH 1A8VA 5FJ8G 2MNAA 1VQ5A 4JBMA 3S2DH 3M4QA 1PH2A 4JOIA 1I94L 4HJ7A 5IP9G 4DV7Q 2QA4A 4TVAB 5HY6A 4YWKA 1PHJA 3PUXA 3A5UA 4A93H 2R92G 3D0FA 1TWGH 3G71A
chains in the Genus database with same CATH superfamily
2JA5G 2IPKD 3T51B 2JA6B 3BDCA 1VQ9A 4M1UB 4MNOA 5IYCG 4O42A 1X32A 4X3TA 2VQEL 5JPMC 3Q23A 4UHVA 1YNXA 5DM73 2YV5A 2AWNA 1HNZL 2NZ1D 4WJ4A 2E2IH 3S1MB 3KF6B 3H6MA 1AE3A 1EEID 3OOCA 2LSSA 1PH4A 1XPOA 1EUJA 3MXPA 4DK1A 4V0BA 3NUCA 1IYVA 3VR4A 1WCMH 4OIKA 2EYMA 5CV4A 5ELBA 5IGFA 4YCUA 3A55A 4WJ3M 4IPGA 1XNRQ 3LWEA 1PRTC 3KF6A 3M4OH 2F0TA 2VQFL 4L5TA 1Y8NB 3J80L 1V1QA 2JK8A 4AH6A 5C3XA 2NB0A 3HOZG 1VQLA 4C1NK 4LAAA 3RUZA 1EYCA 3D4DA 3F2UA 4F8MA 4DV0Q 2E74C 1X9NA 1KABA 3D8GA 1WI5A 4KY7A 1I3QB 3OYYA 4DUZL 5D3IB 2R7ZB 2FHTA 2PQAA 1BR9A 2RCNA 3G7LA 3J7A5 5I9PA 5C4ZA 5ELDA 5C4JB 4JV5L 4DR6Q 2IX0A 1KHIA 3E9HA 4IUNA 1X55A 2QEXA 3SDZA 4AYBE 4O0AA 1C7YA 1E22A 2D62A 3RNUA 1PFSA 1XPRA 3I7FA 3W1BA 3T53B 1A2TA 2R61A 1IYUA 4JBJA 4MIUA 4A3KG 2PYKA 2NVQB 3MEFA 2IJ0A 2D2CC 2LFNA 5HGQA 4RWSC 1YNND 1LTLA 1NCVA 1XYIA 4LF7L 1PH3A 1PTOH 1TWAH 3PQIA 1TU2B 2AUKA 4N9TA 3TZUA 4QB4A 2PMZE 1WTHA 4PV1C 3C3LA 2BA1A 4A3DG 4GNXA 2VQFQ 2UXBL 4ZLTF 1LTID 2CWPA 5M3FH 3A5ZB 1HFNA 4C3JG 3NWSA 4AIMA 1M90C 1VQ8A 4DUZQ 1I6VC 1VQ7A 1EL0A 1TWHB 2WV6D 3VDYA 4LJZC 1B9MA 3P20A 1JORA 4OWWB 1TIID 1VQBA 4JI7L 2F0HA 3PUWA 1HQRD 5EJWA 4DR3L 4KJOA 4BA1I 4JI0L 4DU9A 1SR3A 3HOVG 1SLJA 3K5OA 5DLQE 2F0JA 1JWUD 3U58A 3DLLA 5IYBH 4DR7L 1E2ZA 3B6YA 3J81j 1UNSA 3IL8A 4GOPC 3A7AB 4G57A 4DFAA 5EBDA 3HOUG 4K8IA 3QWNA 3DWAA 3IAYA 1FNWA 1O7IA 1B2TA 1MD2D 5EQ0A 1B1ZA 2UUAQ 1Q1BA 4A3FH 1EIYB 2JJQA 1S3OA 1MJEA 3I91A 5IT9c 1A3TA 4ABNA 1PYSB 2R7ZH 2K6AA 4G4KA 2HT1A 4NXNL 1LTTD 2BCOA 4G7HC 1HNXL 1EWIA 5C4JH 1N9WA 4IURA 4J6HA 1D6EC 1HZAA 2B2YC 1KDCA 1SMXA 1E1OA 1N32L 3LWUA 3AFQA 4DV5Q 3HGBA 4DR3Q 1C9OA 1UWVA 3NXWA 2FMMA 3S15B 4UY8C 1Y1WG 2Q8RE 2GVBA 2GN5A 1QE6A 1XPUA 4YCWA 2B8FA 2XGTA 1CKMA 1N33L 2NVQH 2F0GA 4RMFA 1R9TB 4A3GB 4B3RL 5ELEA 2KHIA 4C3HG 4DV6L 4A3JG 4LF9L 1UEAB 4LF8Q 1X56A 2F0WA 3CU7A 1D5MC 3CRKC 2AQ3B 1K8MA 4B08A 4TSSA 4XXEA 2DY8A 2A5HA 4U673 2IY5B 3MHBA 2C35B 4DN4M 1TWHH 2IL8A 1PV4A 4LFCL 4NXNQ 4GN3B 2IW3A 2L11A 1GD7A 2IX3A 4NB3A 1AN8A 2B2VA 2E8GA 2K5NA 2MPMA 1N32Q 4U68A 3G4SA 3X3NA 5LL6X 1EY0A 3CCSA 1X3QA 3SHLA 4FO2A 5I9OA 3OWEB 5D65A 1QCBD 3D4WA 1UE5A 4X3SA 3S1RB 3CMEA 4OL7A 1WTXA 5FOBB 4B3RQ 1OXTA 2DUDA 4POFA 4HJAA 1CKNA 5I2YA 1EY5A 5LMNL 4HIOA 3I56A 3FKIG 2PI2E 2Z4HA 4WJWA 2ICEC 3I4LA 3ICEA 2D9UA 3MFYA 1OXXK 4DV1Q 1VDZA 1WD0A 1LT3D 1DONA 3VA7A 4J8QA 4JOIC 3P7JA 2E5LQ 4UDUC 2UUCQ 1XTDA 1U4PA 4CJ1B 2O5IC 1IXRA 1Y1VG 1PZJD 2UXDQ 1BBWA 2EJGC 4BBSB 1PTOC 4Q5VA 5JJLA 4XT3B 5FKAC 4DAMA 4A3BB 1L1OC 1JC7A 1EOTA 1B44D 3DXJC 3S15H 4A3EG 1JQYD 2VB2X 1BO0A 4BY1B 5GQOA 2R93B 1PH8A 4ILWA 2Y0SG 1U4LA 2JA7G 1R9TH 4A3GH 2I5LX 2J7ZA 5LMNQ 1YNJC 1NAPA 4KY6A 3H3VI 4R4OA 4KKUA 1GXDC 4YCVA 1EQVA 2EVBA 1HZ9A 4CKEA 1I6HB 1I50B 1QJOA 2DNEA 2G5DA 4OXPA 3X3MA 2IHEA 5LMNW 1BXTA 1VQDA 3BVZA 5IT9E 3OIQA 4OO1I 2RQXA 5KIXA 3A8JE 1EIFA 4FF4A 1X3EA 4DV2L 2OTJA 4G7ZC 4B3ML 4HSVA 1QUQB 1Z47A 4KD3A 4DNTB 1EQTA 4B3TL 4BY7H 4DK0A 4X66Q 3ER0A 1IKMA 3AEVA 4PQXA 4A93B 1Y8OB 1JJ2A 4KN4C 1HUNA 1H9RA 3PO3G 3MXGA 3PV0A 3CHBD 1C48A 2L1BA 4GKJL 1EWCA 2RVLA 4GN5A 1PZID 5FJ8H 1KQSA 1ESRA 3STBC 5JJKA 3PUYA 4JI3L 1YJNA 3GV6A 3NTIA 4XYOA 2X6LA 5M5YH 5IP9H 3T1YQ 2D5DA 3A0JA 3MXUA 2K14A 1G6ZA 2R92H 1CQVA 1K3BC 1TQOA 2KHSA 2BH2A 4LFBL 4PMCA 1ZEQX 1BBUA 4A3MG 2A69D 3S17B 3FRPB 1Q7YC 3GTMB 4FXDA 4H0LC 3I73A 1YJ9A 2DJFC 5GADC 3SXHA 1HTLD 5M9OA 2TMPA 1SMYD 2L12A 1I5FA 1Q46A 2ZM6L 3CC4A 3OIPA 2EY5A 1E3PA 1S5BD 3U4ZA 3MAQA 1D5ZC 4DV2Q 1W2BA 4LNQA 4NP5A 1GUTA 1KLGD 1I4PA 4B3TQ 3T1HL 2IX1A 3I4MG 4YY3L 2XVSA 3SK8A 1OXVA 1Q3LA 1B4OA 3RZOH 1JE5A 4MN3A 4BBSH 1T9HA 5A2QL 2PMZB 2NBFA 4A3BH 2RDFA 2K5DA 3SK4A 1S40A 3TP6A 4OX9L 1H9SB 2FINB 2LXJA 4GKJQ 3PF5A 2ZTEA 3M3YB 1T5XD 2R93H 1F2MA 3ERSX 1NTGA 4K5WA 2R7FA 3R93A 1J5EQ 2BE5D 2JP1A 4JI4L 4BBRB 2K33A 1IBKL 3N52A 1JOOA 4ME3A 2F4VQ 1V8QA 4JI2Q 4A3LH 4FF3A 3BYTB 4FVMA 1LM0A 5F2DA 1JWSD 4XIGS 1IBML 3S16B 1ZKOA 1I50H 5AFWA 3CCVA 4O1NA 1WOCA 1XMOL 1QVFA 4BXXG 1WTQA 2ZTDA 4FF2A 1WVLA 1JICA 3ULPA 2PO4A 3C1EA 1A8VA 1JOKA 4JBMA 1EFID 2DNCA 1M4VA 3KLRA 4HJ7A 2LMCB 3DHQA 3OSOA 3PUXA 1FNUA 3A5UA 4A93H 2NYZD 1K3RA 3Q24A 2OEOA 1BUVT 1S4ZA 1VMPA 2CW0C 3HRZC 1G2SA 4UP7A 3I4OA 1IYJB 3F1ZA 3I2ZA 2A68D 1KRSA 3EROA 2Q2TA 3J7ZC 4JI8Q 3ERQA 1RDPD 2F3VA 2C9OA 2JQOA 1EYAA 2AWOA 1HCZA 1L0WA 2NN6H 2WAQE 2WKDA 2RSNA 3S17H 2CQOA 3EA6A 3K7AB 1OTCA 4ZKBB 3V96A 1ZYRD 2F0EA 2CH4A 3R2IA 1VF5C 1YVCA 4Y7NB 5I2XA 2EYPA 1STEA 4E6IA 1TR5A 1UEBA 1B7YB 4LUVA 1JMCA 5C3EB 1I4QA 1Q90A 2EY2A 2BOSA 1F9PA 5LHY1 4P74A 3KDFB 2B63G 4K2LA 2KA7A 1TY2A 1FR3A 1H9KA 2K01A 4JYAQ 1TWCB 2JA8G 2K05A 4FXGC 2EYJA 1A62A 5ISRA 3RR5A 1SYGA 2YTYA 1JJCB 1NSNS 2EY1A 1CKOA 3M3YH 1EY7A 4KI0A 1RF2D 1R4PB 1MHWC 3MVVA 1VQMA 5M3MH 4BBRH 3NSWA 4IOCA 4A3IB 1EZ6A 1EU3A 5HGTA 1X6OA 3NENA 4YHHQ 3MXNA 3H0GG 2XNAC 5E1FA 1GOZA 4DGZA 1STNA 1TVXA 2A6ED 5JPNC 1V43A 2MFIA 1GHJA 3S16H 5CYUA 3UE0A 3U4VA 3GTGB 3BVGA 2OQKA 3GV3A 1E0BA 2WB1G 4BWGB 1K73C 3PIOA 1G2TA 3KLSX 1LTSD 2SDFA 1RTOA 2NTTA 1NE3A 3M85A 4IPCA 1SBBB 2UXCL 3EJIA 1DXMA 2PW5A 4Z9CB 3SE0A 3JAMi 1O78A 3K0XA 2R3ZA 2IWHA 5JEAG 4QGUA 4DV3Q 4CKCA 2JEAI 2I07B 5C44B 2B2UC 1E1TA 1S5DD 1ET6A 1WCMG 3T13A 1HFGA 5FO8B 4CJ2C 3D4RA 1BCPD 4PG3A 1TT2A 4DV4Q 4NXML 4NKLA 5CMDA 4DNRB 3PO2H 1VF7A 4OGQC 2RDHA 3PUVA 4IFDH 3K7AH 3PSIA 2OTLA 2DN8A 2V1CC 4IPHA 1E2VA 1HTPA 1MKHA 2E75C 3CCRA 5M5WB 4GZYC 1IBLL 5JEAJ 1K83B 5EBCA 3IFDA 5C3EH 2UXCQ 4Q0FA 2PW7A 3S9WA 1EZ8A 5IYDH 3MC0B 3UDFA 2RDGA 4ZUIA 1EY9A 1BCPF 3D6CA 1SJED 2D0PA 3E0EA 5FLXc 1TWCH 1AP0A 5KNBA 4KK7A 4JK1C 2HD3A 1S5CD 2WINB 3K80C 2PQAB 1HNWQ 1STHA 1DJRD 5FO7B 4A3IH 2E2JH 4L5SA 1PMRA 2L15A 2YU9H 1SNCA 3U50C 1PYBA 3VYSA 2B2WC 2IHFA 2HIVA 1A6XA 1AZQA 3J81i 5M3FG 2XRSD 4A3KB 2Z6BA 2EE1A 2ZT9C 1U4RA 1ONLA 2AQ2B 5T1IA 2KCCA 2ZXRA 2VXWA 5K36H 2VQEQ 3G6EA 3IKJA 3IRBA 5CV6A 4MTNA 3VR5A 2A19A 1HNZQ 1WTWA 3K58A 1TWFH 4A75A 2OWOA 4DR2L 3CCMA 3TS0A 1SAPA 4GNXB 2RF4A 4K5XA 1KL9A 4X65L 2UUBL 3EIVA 1I4RA 2SNMA 1CM9A 1QILA 3QJYA 3BDOA 4JW0A 5C44H 3VYUA 2RSOA 2JN4A 3TZDA 4A76A 1SYEA 3H94A 4KHPL 3K6OA 5JAVA 2KENA 1B53A 3CC7A 4HIDA 4KKSA 2C5CA 1G8ZD 3KBGA 3CCUA 4ZQ3A 5IGGA 3LNNA 1VQPA 5I6WA 5D3DA 1DGSA 1QZGA 5LL6S 4A3FG 1HH2P 4JG2A 2JA6H 5EKLA 2R7ZG 4OONA 1Y8PB 5M5WH 1KC8C 4EQPA 1VQJA 5IP7H 1PH1A 4JV5Q 4A3CH 2AUJD 1B50A 1J9OA 3MA2B 1JWMD 3S1MH 1W6JA 3K5MA 3Q0AA 2EPBA 2F0NA 3CF5A 2MJ8A 3J80i 2SEBD 1Z9FA 1V1OA 1BCPB 1FGBD 5ELFA 2RCFA 1P16A 1XNQL 2Q2UA 3CP0A 1HZBA 2WIIB 1K0RA 4LF7Q 5JOBA 2B8GA 2HIXA 3K59A 2UXBQ 2EDGA 2EOTA 3HOXB 1Y1WB 2Z6KA 1GO3E 1DYQA 3R2TA 4DKAC 4CJ0B 4MTKA 1YI2A 2AHOB 4FP5D 4ZK9B 4A3KH 4DR4L 3NP8A 1GUNA 5C5LA 1GVPA 4N8FA 2LXKA 4C3HB 2K4KA 1SJHD 2HDLA 1WJJA 2DGYA 4R8IA 4A3JB 1I3QH 2KBNA 4RCNA 2CFMA 3C46A 4IUQA 1UE6A 2BDOA 2O5JC 1HXYD 4JI7Q 5T1GA 1XJVA 1FL0A 2KHJA 1SYBA 5BR8L 5ELCA 4ODGA 1AZPA 4JI0Q 3I4NB 2WAQB 3J7AF 4LWCA 1W3SA 1WTPA 5FLXE 2F0DA 1F9QA 1YHAA 1D2BA 1UE7A 1BNZA 1II3A 3S2DB 3CAMA 3M9BA 4P75A 3FPPA 1HR0L 3K5LA 4TRDA 4DR7Q 4YWLA 1RTNA 1PRTD 2OCEA 3PIPA 2B2TA 1F2YA 1D8LA 3NQIA 1Q82C 4KHZA 4KV6A 1VQKA 5IODA 2F0IA 2Q2IA 1KXLA 4JI1L 4L5RC 3QG1A 5JVH3 3WDNA 4JC0A 3HOWB 1K8OA 1HNXQ 1CKNB 2H5XA 2E2HB 4RAUC 5C4HA 5C0XH 1WTRA 2PPBC 3FPUB 4XQNA 1EY4A 1HZCA 2LY7A 2A69C 5H1SE 2EJMA 1PRTF 2E76C 4B3SL 2YTVA 1SROA 3NHHA 4IPDA 1TS3A 1N33Q 5M5XB 2ALYB 1HR0Q 3K5NA 1GHKA 3E9IA 2BA0A 5CV7A 3CQZB 4IUTA 4M8AA 1Y1VB 4CGYB 4DV6Q 4LF9Q 1AFPA 4HAEA 4GN4B 3HOYG 2KCNA 5FLMH 1EEFD 3I72A 4EX5A 3FVQA 1TKWB 1B9NA 1HPCA 2ZJQA 2HCCA 1OXSC 1SFOB 4DK3C 4A3EB 5DNFA 3HOXH 1HR0W 1BQQT 1H9MA 4DXFA 3CMAA 4P71A 1PLFA 1L0YB 1EOVA 1E2WA 2Y0SB 2JA7B 1KAAA 2PZWA 4C3HH 1A3VA 3A74A 3M7GA 4N8X1 4DR5L 4LFCQ 2BE5C 1Q8IA 1D1IA 4BY7G 2YYZA 3OHXC 2BH8A 1EYGA 4LFAL 3MFGA 3M4YA 3LGJA 3WWVA 2PZUA 4P2CB 1F9RA 2K5VA 3F2BA 4K8JA 4KKTA 3I4NH 3VR2A 3J81c 4AQYL 5C4XB 1EQRA 1A0IA 4C1NI 3DEOA 5FJ8G 3S2DH 3M4QA 2FFKB 1I94L 3SK6A 1A2UA 2K1BA 5IP9G 5HY6A 1PHJA 5TSSA 1FYCA 2R92G 3G71A 3HKZG 4KMUC 3PO3B 1LTAD 2VUMB 3PCOB 4X3KA 1FNVA 3KF8A 3PIO3 2QF7A 3AU7A 1HHVA 2A74C 5BN4A 3CPFA 4X62L 1OXUA 1KD1C 2N3SA 1ENAA 3A56A 3MZ5A 4H44C 4H7BA 1Q81C 2CQAA 3FHWA 1X3FA 4L63B 3D6WA 1XX8A 3HOWH 1A15A 5E4XA 4JPBW 3QB3A 4KLKA 4DK6C 1HRJA 1SNDA 4A3MB 2VY3A 1JT8A 3PMFA 5GAGC 3UE1A 1Q12A 2E2HH 2N8NA 4X64L 2QCPX 3QIAA 4A3BG 4FYDA 1N36L 3RLOA 2R93G 3DEPA 4PNYA 3HZXA 3S1RH 1IW7D 4XTCS 1PRTB 3BZKA 4K0KL 5M5XH 1L0XB 1CFMA 2DJGC 1K8GA 1SE2A 2H4OA 1PYWD 2UU9L 2GVAA 3RZDB 1VMCA 2XIWA 4A3LG 1SXTA 4EQNA 1E24A 5JJZA 3V2TA 3VR3A 1BOSA 3JAME 1S5FD 1SFOH 3ZJYC 3ONAB 4ALPA 2VZAA 4EQ5A 4A3EH 2L9HA 1EFWA 3AB9A 4K14A 4R8NA 3JC66 4GNXC 4IQZA 1MSHA 3EBEA 2A1AA 3J80c 2A6HD 3PGZA 1VS0A 3K8AA 3SR1A 1SNMA 4RKBA 4B3MQ 2MQHA 1ENFA 4RG1A 3QO2A 1DM0B 4HJ9A 5EKIA 4QQBX 3NTHA 3AMUA 4A93G 2YTXA 4JI5L 2EYLA 2A6EC 4DR1L 3S2HB 2EZVA 1N36Q 3CRLC 5C4XH 3H15A 4BY1H 4YWMA 2G9HD 4ZKCB 4ULLA 1IL2A 2RBMA 4K0KQ 1TS4A 2PNHA 5J3BA 4JI3Q 3C2PA 3DWQA 3CD6A 2NN6G 3WOEA 2UU9Q 2EYHA 4RGTA 1N34L 1NY4A 4IO9A 2ICIA 3L0OA 4LFBQ 5IGDA 1ESFA 1U9RA 1EWHA 2VUMH 1VQHA 4HJ8A 1I6HH 1GUOA 1KTKA 4DAVA 3NPPA 4DXGA 3TP7A 1Y69U 4GLXA 4AYBG 5D14A 4ZYSA 3KBXA 2ZM6Q 4P73A 3BS1A 5CC4A 1LTRD 3OTOL 3N6RA 2ATWA 1I4HA 4BA2I 3Q22A 1F2LA 1PTOD 1PH7A 3T1HQ 4A3MH 4YY3Q 5IT9L 2R7DA 1KIXA 4JI5Q 4IN3A 4ME5A 4CHTB 3J81E 1LT6D 2NZOA 4OX9Q 1ICFB 1TXYA 2ZXOA 1VQGA 3OMGA 3KFUA 3FMCA 2F03A 3DWPA 3OW2A 1YNJD 3TP5A 3UDGA 3W1GA 5M3MG 4JI4Q 1TY0A 4BBRG 4DUYL 3GTOB 3EVQA 1N34Q 1VQFA 4CDCC 1IBKQ 2B63B 2EQSA 2M9VA 1CTMA 3HKSA 1B3AA 4JBKA 3HP3A 1DZ1A 3QOLA 3CCEA 1JB3A 3GTMH 2JA8B 2K32A 1IBMQ 2B2TC 5IGCA 1PTOF 1XMQL 4GOPA 1WFQA 5KEEA 3L3OC 1TS5A 2F0PA 2MO0A 1XMOQ 4YIJA 3K81C 1NBWA 1PA6A 2MGSA 2PQEA 1CI3M 1KAWA 1G51A 2KUMA 4QJFA 1X54A 4HSPA 4ZCKA 1O7YA 1UE1A 2I46A 1YJWA 1Q8KA 4F88A 1FGUA 1X65A 1KDAA 4XDXA 3FP9A 3RLFA 1QNUA 3O13A 3FDTA 1MGSA 2Z8LA 3GTJB 3MXNB 4EQOA 3ND8A 3F2DA 4RA8A 2B2VC 1SYFA 5IGEA 3S2HH 4BXXH 3STBD 1CUKA 1RODA 2WB1B 2B2YA 1Q1EA 2F0SA 4HJ5A 4LW1A 1K8AC 1CZGA 4GKKL 4C56C 2JEBI 3K57A 4LF4L 4DUYQ 4LUZA 5EKKA 2E2IB 1K9MC 2Z4IA 3F8TA 4OIJA 4QMGA 3PO2G 3KLSA 4IFDG 2ENBA 1STYA 4DNIA 4KY5A 3OPOA 1LT5D 1J8IA 3VYRA 1NMGA 3J80E 1PDQA 4X6AH 1L2FA 2XWJB 3I8ZA 1SDFA 3DM3A 3T4AC 3ULJA 4UAIA 3NWTA 1D5XC 5NUCA 4LUOA 4LMQD 3I3CA 1AH9A 5C5MA 4POGA 3E0JA 3A7LA 1YNNC 5C3EG 1NUCA 1QVCA 5LMUL 2JSOA 1ET9A 2EYOA 5IYDG 1S5ED 2QGQA 1KLUD 4RHRA 5HURA 1GKHA 4C3IB 4DV7L 2Y0SE 3PIP3 5IIFA 4OHJA 2JA5B 2JYOA 5J39A 1HUMA 2ID0A 1Z7TA 5GAHC 4KN7C 2I0QA 1G6PA 2XN9C 4IFDJ 1JJGA 4LF4Q 4CBVA 1NR4A 2CHBD 2TSSA 4LK1C 1SYCA 4A3IG 4K6DA 4OEMB 3H3VH 1LLRD 3C1FA 5IOCA 1K0SA 4V190 3F2CA 5J22A 1VQNA 2EXDA 1U4MA 3GTKB 4KTAA 2JA8H 1Y14B 2N49A 2WP8J 2QDBA 4UPAA 5IWAL 1YITA 4Y7NH 2K28A 2SNSA 2WFWA 2L4NA 4HIMA 4OO1H 1KNEA 2HDMA 1XNRL 5CGKA 5LMUQ 3BZCA 2RA4A 3GP7A 3GQBA 3GTLB 2HHHL 1EY6A 4QL5A 1MJCA 3BDLA 1BBXC 2Z9HA 3HOZB 5AJ3L 2A8VA 4QCLA 3ND9A 3GTJH 3K0YA 1JOQA 1SE4A 4KHVA 5DM63 4DV0L 2N88A 4TKOB 5C44G 4XQJA 3GTPB 2BDNA 2VW9A 1PH5A 2N78A 1Q86C 1L1OA 2K50A 3BVMA 4HN7A 1X3GA 4DR6L 4IJLA 1C0AA 5CORA 4NXMQ 5E3FA 1CZWA 3S24A 1RD9D 5JEAH 1CK1A 1PFBA 1B3QA 4RGOS 1SEBD 2KQ3A 2OXPA 3J7YW 5IWAQ 3GTGH 1J6QA 1TWGB 5EGTA 4ZAIA 2JA6G 1NR2A 1IBLQ 1U5KA 1DOMA 1OO9B 5KYLA 5IP7G 3IFTA 4A3DB 4A3CG 2HHHQ 2VS1A 4DPGA 1XTCD 2RHSB 2HUGA 4IUVA 1QVGA 4C3IH 5AJ3Q 4A3FB 4C3JB 4J1MA 1CQFA 2CCZA 3GTQB 1SE3A 1P8LA 4GLVB 2JA5H 3KLWA 1SE8A 2L5TA 4GS3A 5IYCH 3QOJA 4XQQA 3I90A 5IYBG 4CDEC 3CXCA 3KOJA 2B39A 1ILPA 1DOLA 4H02A 2B3GA 3G6JB 3HOVB 3PF4A 4L5QA 3GDEA 3GTKH 5L37A 2Z0SA 3RN5A 1YZ6A 5EPKA 2F0KA 3D3RA 1MSGA 5GROA 3V05A 2H1EA 3CCJA 3NTKA 1BDOA 3ULLA 2V4DA 3M7NA 1VQOA 1K83H 4HCEA 4APVA 2VL6A 3HOUB 4K2KA 3PUZA 3GTLH 5ELOA 3KYHC 1G91A 1O7ZA 2HQEA 4DR2Q 3NEMA 4KJNA 1EIHA 1QOHA 3HOZH 2N55A 4OELB 2UUAL 4X65Q 2UUBQ 2CKZB 4FNFA 4WFN3 3GTPH 1RL2A 4HIKA 2RKSA 3KUPA 4HR7B 3CPWA 4KHPQ 2MUYA 1RHPA 2AKWB 4DF7A 1CA6A 4DV5L 2DY7A 3P1HA 3KJPA 2KVMA 2HQLA 4QIWE 1NMFA 2MHVA 2ASBA 2NUCA 2MNAA 1VQ5A 5A35A 2QA4A 2JXMB 4YWKA 3L9AX 3D0FA 1TWGH 2KCTA 1WYDA 1LT4D 3EQLC 4TQUS 4LF5L 3RD4A 4LF8L 4EVOA 1V9PA 2ES2A 3ZYYX 3VA5A 4A3DH 5ELNA 5C0XG 3VYTA 3Q8DA 1AEXA 4KD4A 3UDXA 3H3VC 1WD1A 1V1PB 2EJFC 5KNCA 4RFBA 4IZ8A 1IL8A 1EIGA 4C3JH 3TN2A 3GTQH 2EYFA 1VQCA 2FMCA 1I4XA 1ML0D 1RJTA 2I5HA 5BN5A 2L55A 3I55A 1XNQQ 1LV9A 2F3WA 5FLMG 2FXQA 3S1QB 3TSSA 3HG9A 5J1ZA 4IUUA 3A8IE 1CA5A 1V1PA 4PZ7A 1AE2A 3AYHB 5G3LD 4HTHA 1GUWA 3HOXG 4JCVE 2CVRA 3EFXD 3HOVH 2WB1E 1C4QA 5CBAE 3JAMc 4S3SA 2JA9A 1YBYA 4DR4Q 2F0VA 5C0XJ 1S72A 5IY0A 2NN6I 5KNDA 1IW7C 3HOYB 3FKIB 2GA4B 4LF5Q 3I70A 5C6AA 2ZXPA 1W6KA 3HOUH 3DMUA 3A54A 5KGUA 5CBEE 5IGBA 3M4PA 2J0TD 4DV1L 1SNOA 5BR8Q 1STBA 3CCQA 1JE4A 2B29A 3EN2A 2F0QA 2WAQG 1B8AA 3I4NG 3TMEA 1F77A 1EY8A 5I6YA 3GO5A 1SMYC 2KJXA 1KNAA 2K5QA 2E5LL 5G3LF 4HCSA 1IZ6A 3MTSA 2F3IA 1KRTA 2UUCL 2A73B 4RGNA 1FD7D 3TS2A 2A6HC 3CCLA 4A3GG 4BY7B 2AMCB 3NQTA 3LX0A 3ITPA 3TDQA 3E5SA 2KCMA 2UXDL 4B9XA 2XWBB 2O2LD 3E3XA 1LTGD 1RCVD 1HA5A 1Y1WH 4Y52H 1VQAA 4JI1Q 3OMCA 1PXUA 2QEJC 4RGMA 1KDBA 1C8CA 5M5YB 4OWXB 1WTOA 3HOWG 1PZKD 4A3JH 4OWTB 2R92B 4UP9A 3HKZB 1YHBA 4HMJA 5IE8A 1FJGL 4H13C 5E7NA 4J15A 1DD2A 1CSPA 4X3UA 2XSCA 3S1NB 4CKBA 2KOLA 5K5PA 1NNXA 1EQQA 3RLNA 4B3SQ 2D0OA 1ILQA 4UP8A 2NTSA 2OT2A 2X6GA 3KF8B 3HFZB 1PFNA 5A2QE 2LS01 5CR3A 4MHEA 5GAEC 4PZ6A 3GD7A 4R4QA 1QNKA 1LUZA 5FLXL 1E7ZA 4X66L 2MO1A 3RZOB 2B2UA 3S1QH 1HQMC 2OF1A 3W5OA 4WRDA 1D7QA 1HA6A 4DAPA 2PCFB 4QUCA 2SOBA 4L6TB 2NVTB 2K7VA 1LTBD 1VQEA 1RKNA 1EU4A 2A68C 1H95A 2WACA 4EGVA 4NMZA 4QY7A 4PZ8A 3W2DA 3T1YL 3SEBA 4DR5Q 3MWYW 1JB7A 3HOYH 3QR8A 4XYQA 3NBHB 1UUPA 2NVYB 3FKIH 1ASYA 3HS0C 4BS9A 1N8RC 1FJGQ 1SSOA 4FF1A 3D31A 2MP1A 4IFDI 1RIPA 4LFAQ 3L2PA 2K52A 5BN3A 4BBSG 4NDXA 2I5MX 1I4GA 3UDIA 3S14B 2XRQD 4ID6A 4CDDC 4AQYQ 2CH4W 1ZYRC 4N9PA 3SGIA 5C4XG 4BY1G 5C3WA 3H91A 4PMBA 1GM5A 3T16A 3NBHA 2EIFA 1VQ4A 1I94Q 1EYDA 3CQZH 3I4MB 1Y1VH 2RHQB 2F1MA 1YHQA 4I65A 5DEHA 5FO9B 3SK5A 2VUMG 3OWFA 2G9DA 5JVG3 4L8JA 4FDBA 2JE6I 4X62Q 1QZHA 4IOAA 4R4TA 1DOKA 2X69A 4CDFC 1QUQA 1GJXA 2KEEA 1QG7A 2JA7H 1J5EL 2B2WA 2IT1A 2K5WA 3RN2A 1HJPA 1PFMA 4O2DA 5KRUA 1MIUA 4P72A 2F4VL 4JI2L 4IUPA 1H9JA 2K04A 1B70B 3TBIB 4X64Q 3S1NH 4I7AA 2NWGA 4RCOA 4AYBB 5CV5A 4ZUJA 4DAYB 1ENCA 4R4IA 4RHSA 5EAYA 3TRZA 5COYA 2QW7A 1SRUA 1VQIA 3BG3A 3RMHA 3SVMA 1Z6HA 4C2MB 2M2LA 5EPJA 4K6LA 4F7XA 3PO3H 4DAYA 3WOFA 4LF6L 2XTIA 2E2DC 5KYIA 4JI8L 3VR6A 2NVTH 5EPLA 1MI2A 2Z6KC 5M3MB 5FK9C 1D1KA 2F0LA 3CW2C 4JVZA 4G7OC 1VQ6A 5CV8A 1LACA 4ZRZA 1X3PA 1STAA 2NVYH 1BCPC 1MBYA 4IJHA 3FEWX 1H9SA 4GLAC 2VNUD 3W3AA 1FVIA 1LABA 4DR1Q 3S14H 2KEDA 4QIWB 3TP8A 4R1JA 3BZDB 3T56B 4GOPB 4RH6A 1GUSA 2VB3X 1U0LA 2EY6A 1CSQA 2QDLA 3K7UC 1LYLA 2ZJPA 1WTVA 3DM1A 2O4XA 3I4MH 1O7LA 3RZDH 1IHZA 1JR0D 2NVXB 4WORA 3P75A 4JYAL 1DCZA 4LF6Q 1QWYA 5DAUA 2P5ZX 2PZTA 3MEHA 4XT1B 1SNPA 4MZ9A 4IALA 3KJOA 3U9OA 2K03A 3R3OA 3CC2A 2PNRC 5JJIA 3OTOQ 3JAML 2WKCA 1YIJA 4NPSA 4YHHL 3H0GB 3UI2A 3URYA 3PO2B 3NE5B 3U9SA 1SYDA 4JBWA 4JI6L 1CT1D 3AQQA 1M8AA 2AQ1B 3OW7A 5I4DA 1A3UA 2ZJRA 1CHPD 1M1KC 1XXGA 1QB5D 2KECA 1YEZA 2ZTCA 4HMIA 3CKIB 1TS2A 1BKBA 1PH9A 1K28A 1A63A 3BYYB 3TREA 4C2MH 4QUFA 2F0MA 4DV3L 1SNQA 4F87A 1XMQQ 1UAPA 1BF4A 4A4IA 3E6ZX 1WCMB 4NW2A 4DA2A 1STGA 4I7ZC 1VCIA 4R4CA 4PMWA 4OO1G 3H09A 1PH6A 2F0FA 3AFPA 1R4QB 2K5HA 3KDFA 2E2JB 3M4OB 2YU9B 2OQ0A 4DV4L 3Q6SA 2F52A 2FJ2A 3NBIA 4JI6Q 1AW7A 2HCIA 2Q2HA 2K75A 2L0CA 3NELA 1BVSA 2F4IA 2M00A 3KK7A 3TQYA 3G48A 4B9WA 3DUZA 3BU2A 3HKZE 2NZHA 4GKKQ 2R6GA 2LKVA 2F0OA 3J81L 2QILA 5C0XI 1TWFB 1F9SA 3R8BA 1ICWA 1ASZA 1PVOA 3GTOH 3NK9A 1G291 2B63H 2EXZA 4FXKC 2CWAA 2Q8IB 1NJIC 1CHQD 4HEDA 2NVXH 3TEHB 1SN8A 5K36G 3HEJA 4QF4A 5CV9A 2Z1CA 1PTOB 1TWAB 1HNWL 3J7AV 1T5EA 1JCKB 1F2ZA 2J4XA 2QKIC 2PI2A 3BJUA 3L7ZC 1L1OB 1LO5D 1ZXTA 3H0GH 2F0UA 4RKLA 1O80A 2CW0D 4JOIA 5M3FB 1PH2A 3A8KE 4K5VA 4C3IG 1XWEA 4DV7Q 1GUGA 1IKLA 4R9WA 4TVAB 5E4WC 2Q8TA
chains in the Genus database with same CATH topology
3HKZG 2JA5G 2KCTA 1K3RA 1VQ9A 1WYDA 5IYCG 4MNOA 4TQUS 4LF5L 4LF8L 4UP7A 3I4OA 3PCOB 1IYJB 3F1ZA 1V9PA 3I2ZA 2VQEL 2ES2A 1KRSA 2Q2TA 3J7ZC 1YNXA 5ELNA 4JI8Q 5C0XG 4A3DH 3CPFA 2YV5A 1OXUA 2AWNA 2N3SA 3Q8DA 4X62L 1KD1C 1HNZL 2JQOA 3UDXA 1Q81C 3FHWA 1X3FA 2AWOA 4WJ4A 2E2IH 3KF6B 1L0WA 4C3JH 1AE3A 3GTQH 3HOWH 2LSSA 1PH4A 2WAQE 1VQCA 4KLKA 1XPOA 1EUJA 4DK6C 2I5HA 3S17H 2CQOA 2VY3A 1JT8A 5GAGC 1OTCA 3UE1A 3I55A 1Q12A 1XNQQ 2E2HH 2N8NA 1WCMH 4X64L 2FXQA 5FLMG 1YVCA 4A3BG 4YCUA 4WJ3M 4IPGA 4PZ7A 1AE2A 3AYHB 1XNRQ 3KF6A 3HOXG 4JCVE 3M4OH 1N36L 1UEBA 1B7YB 3RLOA 2R93G 2VQFL 3HOVH 2WB1E 4LUVA 4L5TA 1JMCA 1V1QA 3S1RH 4XTCS 3JAMc 2JK8A 3BZKA 4K0KL 4AH6A 5M5XH 2JA9A 1YBYA 4DR4Q 1K8GA 3HOZG 4P74A 3KDFB 5C0XJ 1S72A 1VQLA 2B63G 5IY0A 2UU9L 2GVAA 4DV0Q 2NN6I 1X9NA 4A3LG 1E24A 1WI5A 3OYYA 4DUZL 4LF5Q 4JYAQ 2JA8G 2PQAA 2RCNA 1A62A 3RR5A 2YTYA 1SFOH 1JJCB 3ZJYC 4A3EH 4ALPA 2VZAA 4EQ5A 3HOUH 3J7A5 1EFWA 1CKOA 3M3YH 3M4PA 4KI0A 4JV5L 4DR6Q 4DV1L 3JC66 5BR8Q 3CCQA 2IX0A 1KHIA 3E9HA 4GNXC 1VQMA 5M3MH 2B29A 3EBEA 3EN2A 3I4NG 2WAQG 1B8AA 1X55A 2QEXA 2A1AA 4BBRH 4AYBE 4O0AA 3J80c 4IOCA 1C7YA 1E22A 3PGZA 2D62A 1VS0A 1PFSA 1X6OA 3GO5A 3K8AA 3NENA 4YHHQ 3H0GG 2MQHA 3I7FA 3W1BA 4B3MQ 2E5LL 4JBJA 1IZ6A 4RG1A 4A3KG 2F3IA 1KRTA 2UUCL 4A3GG 3TS2A 4HJ9A 3CCLA 4QQBX 3MEFA 1V43A 2MFIA 3S16H 2AMCB 4A93G 2KCMA 3U4VA 3UE0A 2UXDL 2YTXA 5HGQA 2OQKA 4JI5L 1LTLA 4LF7L 4DR1L 1PH3A 2WB1G 1TWAH 2PMZE 1N36Q 1K73C 3PIOA 2BA1A 5C4XH 3H15A 4GNXA 2VQFQ 4YWMA 1Y1WH 4BY1H 4A3DG 2UXBL 1IL2A 4Y52H 4K0KQ 1NE3A 1VQAA 4IPCA 3M85A 2UXCL 2PNHA 5J3BA 2CWPA 4JI1Q 4JI3Q 5M3FH 3CD6A 3A5ZB 2NN6G 2UU9Q 4OWXB 1N34L 3JAMi 4QGUA 3K0XA 4DV3Q 1NY4A 5JEAG 4IO9A 4A3JH 3L0OA 4OWTB 2JEAI 4AIMA 1M90C 1VQ8A 4DUZQ 4UP9A 1VQ7A 1E1TA 1YHBA 1VQHA 3VDYA 2VUMH 4HJ8A 5IE8A 1FJGL 1I6HH 5E7NA 4J15A 1CSPA 1WCMG 4OWWB 4GLXA 4AYBG 1VQBA 4JI7L 1EQQA 3PUWA 3RLNA 4B3SQ 2D0OA 2ZM6Q 4UP8A 4P73A 4DR3L 4BA1I 4JI0L 4PG3A 3KF8B 3OTOL 4DV4Q 4NXML 2ATWA 3HFZB 4BA2I 1SR3A 3HOVG 1SLJA 3PO2H 1PH7A 5DLQE 3PUVA 3T1HQ 5GAEC 4A3MH 3K7AH 4PZ6A 4YY3Q 3GD7A 4R4QA 3PSIA 2R7DA 1LUZA 2OTLA 3U58A 3DLLA 1E7ZA 4X66L 2MO1A 5IYBH 1KIXA 4DR7L 2V1CC 4JI5Q 3S1QH 3B6YA 4IPHA 3CCRA 1MKHA 3J81j 4GOPC 3W5OA 1D7QA 2NZOA 4OX9Q 1TXYA 1IBLL 1VQGA 3KFUA 5JEAJ 3HOUG 5C3EH 3OW2A 2UXCQ 3UDGA 3W1GA 5M3MG 1O7IA 4JI4Q 3UDFA 5IYDH 1VQEA 4BBRG 1H95A 4DUYL 2UUAQ 1Q1BA 1N34Q 1VQFA 4A3FH 4QY7A 4PZ8A 1IBKQ 2EQSA 3T1YL 1EIYB 2JJQA 4DR5Q 3HKSA 1S3OA 2D0PA 3E0EA 1MJEA 1JB7A 3NBHB 3FKIH 5IT9c 4JBKA 1ASYA 3HOYH 3CCEA 5FLXc 1TWCH 1PYSB 2R7ZH 1N8RC 1FJGQ 3GTMH 1IBMQ 2HT1A 3D31A 4NXNL 4IFDI 1RIPA 4LFAQ 1XMQL 3L2PA 2K52A 1HNXL 4GOPA 1EWIA 4BBSG 5C4XG 5C4JH 1N9WA 1WFQA 1HZAA 2I5MX 2MO0A 1XMOQ 1SMXA 1E1OA 1N32L 3K81C 3K80C 3UDIA 1NBWA 2PQAB 3AFQA 4DV5Q 1PA6A 4DR3Q 1HNWQ 1C9OA 1KAWA 1UWVA 1G51A 4AQYQ 4A3IH 2E2JH 4L5SA 4UY8C 4QJFA 2L15A 3SGIA 1Y1WG 2GVBA 4BY1G 3U50C 2GN5A 1X54A 1PYBA 2YU9H 1XPUA 1GM5A 1UE1A 1YJWA 4YCWA 2IHFA 2EIFA 1Q8KA 2HIVA 1FGUA 1CKMA 1X65A 2XGTA 3J81i 5M3FG 1VQ4A 1I94Q 3FP9A 4RMFA 3RLFA 1N33L 2NVQH 3CQZH 1Y1VH 2RHQB 4B3RL 2KHIA 4DV6L 4A3JG 1YHQA 4LF9L 3MXNB 3F2DA 4LF8Q 2VUMG 3S2HH 2VQEQ 1X56A 1CUKA 3STBD 3G6EA 4BXXH 3IRBA 4MTNA 1Q1EA 4HJ5A 4FDBA 4LW1A 2JE6I 4X62Q 1QZHA 1K8AC 2A19A 4R4TA 1HNZQ 4GKKL 4IOAA 1TWFH 4A75A 2JEBI 1QUQA 2OWOA 4LF4L 4DUYQ 4DR2L 4LUZA 2JA7H 3CCMA 1J5EL 3TS0A 2IY5B 2IT1A 4GNXB 1K9MC 3RN2A 2RF4A 1KL9A 1HJPA 3F8TA 4O2DA 3PO2G 4X65L 1MIUA 3EIVA 4P72A 2UUBL 2C35B 2F4VL 4JI2L 1PV4A 1TWHH 4IFDG 5C44H 4LFCL 4NXNQ 1B70B 4GN3B 4DNIA 1GD7A 4X64Q 4A76A 4NB3A 3S1NH 2E8GA 4KHPL 1NMGA 2K5NA 1N32Q 1L2FA 4X6AH 2KENA 3ULJA 3DM3A 3G4SA 3CC7A 4HIDA 4DAYB 4LUOA 1AH9A 4R4IA 3CCSA 4POGA 5EAYA 3TRZA 5C3EG 1QVCA 3CCUA 5LMUL 1UE5A 1VQPA 3CMEA 5IYDG 1SRUA 1VQIA 2QGQA 1DGSA 1QZGA 4B3RQ 1OXTA 2DUDA 4POFA 1GKHA 4HJAA 4A3FG 1CKNA 1HH2P 4DV7L 5LMNL 2Y0SE 4HIOA 4JG2A 3I56A 3FKIG 2JA6H 2R7ZG 2PI2E 3PO3H 4OONA 5M5WH 2ID0A 5GAHC 4LF6L 3ICEA 2XTIA 1KC8C 1VQJA 5IP7H 1PH1A 1OXXK 2I0QA 1G6PA 4JV5Q 4DV1Q 4JI8L 4A3CH 4IFDJ 1JJGA 2NVTH 4LF4Q 2Z6KC 3S1MH 4A3IG 3CW2C 4JOIC 1VQ6A 3H3VH 2E5LQ 3CF5A 3F2CA 2NVYH 3J80i 2EXDA 2UUCQ 1XTDA 1VQNA 1Z9FA 2JA8H 1Y14B 2N49A 2WP8J 4IJHA 1IXRA 1Y1VG 4GLAC 2UXDQ 4UPAA 1BBWA 1P16A 2VNUD 1XNQL 5IWAL 2Q2UA 3CP0A 1FVIA 1HZBA 1YITA 4Y7NH 1K0RA 4LF7Q 2WFWA 4DR1Q 4HIMA 5JJLA 4DAMA 3S14H 1L1OC 3S15H 4R1JA 4A3EG 2HIXA 2UXBQ 4GOPB 1XNRL 5LMUQ 3BZCA 1U0LA 5GQOA 2Z6KA 1CSQA 1GO3E 1PH8A 3K7UC 4QL5A 4DKAC 2HHHL 1MJCA 1LYLA 2ZJPA 1YI2A 2AHOB 2Y0SG 4A3KH 2JA7G 4DR4L 1R9TH 3I4MH 4A3GH 2I5LX 5AJ3L 2A8VA 1GVPA 5LMNQ 3RZDH 2LXKA 3GTJH 2K4KA 1WJJA 2DGYA 4DV0L 1I3QH 2KBNA 3H3VI 5C44G 4R4OA 4YCVA 4JYAL 4LF6Q 1HZ9A 2CFMA 1UE6A 2VW9A 1PH5A 2N78A 1Q86C 1L1OA 4MZ9A 4JI7Q 4OXPA 3KJOA 1XJVA 2K50A 1FL0A 2KHJA 2IHEA 5LMNW 1X3GA 4DR6L 1XPRA 4IJLA 5BR8L 3CC2A 1C0AA 4JI0Q 1VQDA 5JJIA 4LWCA 1W3SA 3OTOQ 4NXMQ 4OO1I 1YHAA 1YIJA 1EIFA 4NPSA 1X3EA 4DV2L 3S24A 2OTJA 4YHHL 1UE7A 4B3ML 1QUQB 1Z47A 3CAMA 3M9BA 4P75A 1HR0L 4B3TL 4JBWA 4BY7H 4JI6L 4X66Q 4DR7Q 4GKJQ 4YWLA 3ER0A 5IWAQ 2OCEA 3AQQA 3AEVA 3GTGH 1J6QA 3PIPA 1JJ2A 2JA6G 3PO3G 1IBLQ 1D8LA 3PV0A 1U5KA 2ZJRA 1M1KC 1Q82C 5IP7G 4KHZA 4GKJL 1YEZA 2ZTCA 1VQKA 2HHHQ 4A3CG 4GN5A 5FJ8H 2VS1A 4DPGA 2RHSB 1KQSA 2Q2IA 1BKBA 3STBC 5JJKA 1PH9A 3PUYA 1QVGA 4JI1L 4JI3L 4L5RC 1YJNA 1KXLA 1A63A 4C3IH 3TREA 4C2MH 4JC0A 5IP9H 5M5YH 5AJ3Q 3A0JA 3T1YQ 3HOWG 2CCZA 2K14A 2R92H 1P8LA 4GLVB 4DV3L 4LFBL 2JA5H 3KLWA 2BH2A 4A3MG 1BBUA 1SE8A 4GS3A 5IYCH 1Q7YC 1XMQQ 1HNXQ 1YJ9A 1CKNB 5IYBG 4A4IA 2H5XA 5GADC 3CXCA 3KOJA 1HZCA 1VCIA 1I5FA 4R4CA 5H1SE 4PMWA 3RNUA 4OO1G 1PH6A 4B3SL 3AFPA 1Q46A 2ZM6L 2K5HA 2YTVA 3KDFA 4H02A 1E3PA 3U4ZA 3CC4A 4DV2Q 1SROA 2OQ0A 4DV4L 1W2BA 4LNQA 2B3GA 4IPDA 2F52A 1N33Q 4L5QA 3GDEA 3GTKH 3PF4A 2ALYB 1HR0Q 4B3TQ 3T1HL 3E9IA 2IX1A 2Z0SA 4JI6Q 2BA0A 4YY3L 1YZ6A 3RN5A 3I4MG 1OXVA 4DV6Q 4LF9Q 3RZOH 5GROA 1JE5A 4GN4B 2Q2HA 4BBSH 3HOYG 5FLMH 1T9HA 2K75A 3CCJA 3NELA 1BVSA 4EX5A 3ULLA 3TQYA 4A3BH 3G48A 3M7NA 1S40A 3BU2A 1VQOA 4OX9L 2LXJA 1K83H 1OXSC 3HKZE 4APVA 4DK3C 2NZHA 2VL6A 3HOXH 2ZTEA 3CMAA 2R6GA 3PF5A 1HR0W 4GKKQ 3PUZA 2R93H 3GTLH 5ELOA 3KYHC 4P71A 4LFBQ 3ERSX 1NTGA 5C0XI 4DR2Q 2R7FA 3NEMA 1J5EQ 1EOVA 1ASZA 4JI4L 3GTOH 1PVOA 3HOZH 1G291 2B63H 2UUAL 4X65Q 2UUBQ 2CKZB 2CWAA 4C3HH 1IBKL 4ME3A 2F4VQ 3A74A 4JI2Q 4DR5L 1NJIC 4A3LH 2NVXH 4LFCQ 3GTPH 1RL2A 4HIKA 1LM0A 3CPWA 4XIGS 3TEHB 4BY7G 1IBML 1I50H 2YYZA 4KHPQ 2BH8A 1EYGA 2ZJQA 3CCVA 4LFAL 1SN8A 2AKWB 3LGJA 3WWVA 1WOCA 1XMOL 1QVFA 5K36G 2K5VA 3F2BA 4BXXG 4DV5L 3I4NH 1HNWL 2ZTDA 3KJPA 3J81c 2HQLA 4AQYL 1EQRA 2PI2A 3BJUA 1NMFA 3L7ZC 4QIWE 1L1OB 3ULPA 1A0IA 2ASBA 3H0GH 1A8VA 5FJ8G 2MNAA 1VQ5A 4JBMA 3S2DH 3M4QA 1PH2A 4JOIA 1I94L 4HJ7A 5IP9G 4DV7Q 2QA4A 4TVAB 5HY6A 4YWKA 1PHJA 3PUXA 3A5UA 4A93H 2R92G 3D0FA 1TWGH 3G71A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HKZ G;  2JA5 G;  2KCT A;  1K3R A;  1VQ9 A;  1WYD A;  5IYC G;  4MNO A;  4TQU S;  4LF5 L;  4LF8 L;  4UP7 A;  3I4O A;  3PCO B;  1IYJ B;  3F1Z A;  1V9P A;  3I2Z A;  2VQE L;  2ES2 A;  1KRS A;  2Q2T A;  3J7Z C;  1YNX A;  5ELN A;  4JI8 Q;  5C0X G;  4A3D H;  3CPF A;  2YV5 A;  1OXU A;  2AWN A;  2N3S A;  3Q8D A;  4X62 L;  1KD1 C;  1HNZ L;  2JQO A;  3UDX A;  1Q81 C;  3FHW A;  1X3F A;  2AWO A;  4WJ4 A;  2E2I H;  3KF6 B;  1L0W A;  4C3J H;  1AE3 A;  3GTQ H;  3HOW H;  2LSS A;  1PH4 A;  2WAQ E;  1VQC A;  4KLK A;  1XPO A;  1EUJ A;  4DK6 C;  2I5H A;  3S17 H;  2CQO A;  2VY3 A;  1JT8 A;  5GAG C;  1OTC A;  3UE1 A;  3I55 A;  1Q12 A;  1XNQ Q;  2E2H H;  2N8N A;  1WCM H;  4X64 L;  2FXQ A;  5FLM G;  1YVC A;  4A3B G;  4YCU A;  4WJ3 M;  4IPG A;  4PZ7 A;  1AE2 A;  3AYH B;  1XNR Q;  3KF6 A;  3HOX G;  4JCV E;  3M4O H;  1N36 L;  1UEB A;  1B7Y B;  3RLO A;  2R93 G;  2VQF L;  3HOV H;  2WB1 E;  4LUV A;  4L5T A;  1JMC A;  1V1Q A;  3S1R H;  4XTC S;  3JAM c;  2JK8 A;  3BZK A;  4K0K L;  4AH6 A;  5M5X H;  2JA9 A;  1YBY A;  4DR4 Q;  1K8G A;  3HOZ G;  4P74 A;  3KDF B;  5C0X J;  1S72 A;  1VQL A;  2B63 G;  5IY0 A;  2UU9 L;  2GVA A;  4DV0 Q;  2NN6 I;  1X9N A;  4A3L G;  1E24 A;  1WI5 A;  3OYY A;  4DUZ L;  4LF5 Q;  4JYA Q;  2JA8 G;  2PQA A;  2RCN A;  1A62 A;  3RR5 A;  2YTY A;  1SFO H;  1JJC B;  3ZJY C;  4A3E H;  4ALP A;  2VZA A;  4EQ5 A;  3HOU H;  3J7A 5;  1EFW A;  1CKO A;  3M3Y H;  3M4P A;  4KI0 A;  4JV5 L;  4DR6 Q;  4DV1 L;  3JC6 6;  5BR8 Q;  3CCQ A;  2IX0 A;  1KHI A;  3E9H A;  4GNX C;  1VQM A;  5M3M H;  2B29 A;  3EBE A;  3EN2 A;  3I4N G;  2WAQ G;  1B8A A;  1X55 A;  2QEX A;  2A1A A;  4BBR H;  4AYB E;  4O0A A;  3J80 c;  4IOC A;  1C7Y A;  1E22 A;  3PGZ A;  2D62 A;  1VS0 A;  1PFS A;  1X6O A;  3GO5 A;  3K8A A;  3NEN A;  4YHH Q;  3H0G G;  2MQH A;  3I7F A;  3W1B A;  4B3M Q;  2E5L L;  4JBJ A;  1IZ6 A;  4RG1 A;  4A3K G;  2F3I A;  1KRT A;  2UUC L;  4A3G G;  3TS2 A;  4HJ9 A;  3CCL A;  4QQB X;  3MEF A;  1V43 A;  2MFI A;  3S16 H;  2AMC B;  4A93 G;  2KCM A;  3U4V A;  3UE0 A;  2UXD L;  2YTX A;  5HGQ A;  2OQK A;  4JI5 L;  1LTL A;  4LF7 L;  4DR1 L;  1PH3 A;  2WB1 G;  1TWA H;  2PMZ E;  1N36 Q;  1K73 C;  3PIO A;  2BA1 A;  5C4X H;  3H15 A;  4GNX A;  2VQF Q;  4YWM A;  1Y1W H;  4BY1 H;  4A3D G;  2UXB L;  1IL2 A;  4Y52 H;  4K0K Q;  1NE3 A;  1VQA A;  4IPC A;  3M85 A;  2UXC L;  2PNH A;  5J3B A;  2CWP A;  4JI1 Q;  4JI3 Q;  5M3F H;  3CD6 A;  3A5Z B;  2NN6 G;  2UU9 Q;  4OWX B;  1N34 L;  3JAM i;  4QGU A;  3K0X A;  4DV3 Q;  1NY4 A;  5JEA G;  4IO9 A;  4A3J H;  3L0O A;  4OWT B;  2JEA I;  4AIM A;  1M90 C;  1VQ8 A;  4DUZ Q;  4UP9 A;  1VQ7 A;  1E1T A;  1YHB A;  1VQH A;  3VDY A;  2VUM H;  4HJ8 A;  5IE8 A;  1FJG L;  1I6H H;  5E7N A;  4J15 A;  1CSP A;  1WCM G;  4OWW B;  4GLX A;  4AYB G;  1VQB A;  4JI7 L;  1EQQ A;  3PUW A;  3RLN A;  4B3S Q;  2D0O A;  2ZM6 Q;  4UP8 A;  4P73 A;  4DR3 L;  4BA1 I;  4JI0 L;  4PG3 A;  3KF8 B;  3OTO L;  4DV4 Q;  4NXM L;  2ATW A;  3HFZ B;  4BA2 I;  1SR3 A;  3HOV G;  1SLJ A;  3PO2 H;  1PH7 A;  5DLQ E;  3PUV A;  3T1H Q;  5GAE C;  4A3M H;  3K7A H;  4PZ6 A;  4YY3 Q;  3GD7 A;  4R4Q A;  3PSI A;  2R7D A;  1LUZ A;  2OTL A;  3U58 A;  3DLL A;  1E7Z A;  4X66 L;  2MO1 A;  5IYB H;  1KIX A;  4DR7 L;  2V1C C;  4JI5 Q;  3S1Q H;  3B6Y A;  4IPH A;  3CCR A;  1MKH A;  3J81 j;  4GOP C;  3W5O A;  1D7Q A;  2NZO A;  4OX9 Q;  1TXY A;  1IBL L;  1VQG A;  3KFU A;  5JEA J;  3HOU G;  5C3E H;  3OW2 A;  2UXC Q;  3UDG A;  3W1G A;  5M3M G;  1O7I A;  4JI4 Q;  3UDF A;  5IYD H;  1VQE A;  4BBR G;  1H95 A;  4DUY L;  2UUA Q;  1Q1B A;  1N34 Q;  1VQF A;  4A3F H;  4QY7 A;  4PZ8 A;  1IBK Q;  2EQS A;  3T1Y L;  1EIY B;  2JJQ A;  4DR5 Q;  3HKS A;  1S3O A;  2D0P A;  3E0E A;  1MJE A;  1JB7 A;  3NBH B;  3FKI H;  5IT9 c;  4JBK A;  1ASY A;  3HOY H;  3CCE A;  5FLX c;  1TWC H;  1PYS B;  2R7Z H;  1N8R C;  1FJG Q;  3GTM H;  1IBM Q;  2HT1 A;  3D31 A;  4NXN L;  4IFD I;  1RIP A;  4LFA Q;  1XMQ L;  3L2P A;  2K52 A;  1HNX L;  4GOP A;  1EWI A;  4BBS G;  5C4X G;  5C4J H;  1N9W A;  1WFQ A;  1HZA A;  2I5M X;  2MO0 A;  1XMO Q;  1SMX A;  1E1O A;  1N32 L;  3K81 C;  3K80 C;  3UDI A;  1NBW A;  2PQA B;  3AFQ A;  4DV5 Q;  1PA6 A;  4DR3 Q;  1HNW Q;  1C9O A;  1KAW A;  1UWV A;  1G51 A;  4AQY Q;  4A3I H;  2E2J H;  4L5S A;  4UY8 C;  4QJF A;  2L15 A;  3SGI A;  1Y1W G;  2GVB A;  4BY1 G;  3U50 C;  2GN5 A;  1X54 A;  1PYB A;  2YU9 H;  1XPU A;  1GM5 A;  1UE1 A;  1YJW A;  4YCW A;  2IHF A;  2EIF A;  1Q8K A;  2HIV A;  1FGU A;  1CKM A;  1X65 A;  2XGT A;  3J81 i;  5M3F G;  1VQ4 A;  1I94 Q;  3FP9 A;  4RMF A;  3RLF A;  1N33 L;  2NVQ H;  3CQZ H;  1Y1V H;  2RHQ B;  4B3R L;  2KHI A;  4DV6 L;  4A3J G;  1YHQ A;  4LF9 L;  3MXN B;  3F2D A;  4LF8 Q;  2VUM G;  3S2H H;  2VQE Q;  1X56 A;  1CUK A;  3STB D;  3G6E A;  4BXX H;  3IRB A;  4MTN A;  1Q1E A;  4HJ5 A;  4FDB A;  4LW1 A;  2JE6 I;  4X62 Q;  1QZH A;  1K8A C;  2A19 A;  4R4T A;  1HNZ Q;  4GKK L;  4IOA A;  1TWF H;  4A75 A;  2JEB I;  1QUQ A;  2OWO A;  4LF4 L;  4DUY Q;  4DR2 L;  4LUZ A;  2JA7 H;  3CCM A;  1J5E L;  3TS0 A;  2IY5 B;  2IT1 A;  4GNX B;  1K9M C;  3RN2 A;  2RF4 A;  1KL9 A;  1HJP A;  3F8T A;  4O2D A;  3PO2 G;  4X65 L;  1MIU A;  3EIV A;  4P72 A;  2UUB L;  2C35 B;  2F4V L;  4JI2 L;  1PV4 A;  1TWH H;  4IFD G;  5C44 H;  4LFC L;  4NXN Q;  1B70 B;  4GN3 B;  4DNI A;  1GD7 A;  4X64 Q;  4A76 A;  4NB3 A;  3S1N H;  2E8G A;  4KHP L;  1NMG A;  2K5N A;  1N32 Q;  1L2F A;  4X6A H;  2KEN A;  3ULJ A;  3DM3 A;  3G4S A;  3CC7 A;  4HID A;  4DAY B;  4LUO A;  1AH9 A;  4R4I A;  3CCS A;  4POG A;  5EAY A;  3TRZ A;  5C3E G;  1QVC A;  3CCU A;  5LMU L;  1UE5 A;  1VQP A;  3CME A;  5IYD G;  1SRU A;  1VQI A;  2QGQ A;  1DGS A;  1QZG A;  4B3R Q;  1OXT A;  2DUD A;  4POF A;  1GKH A;  4HJA A;  4A3F G;  1CKN A;  1HH2 P;  4DV7 L;  5LMN L;  2Y0S E;  4HIO A;  4JG2 A;  3I56 A;  3FKI G;  2JA6 H;  2R7Z G;  2PI2 E;  3PO3 H;  4OON A;  5M5W H;  2ID0 A;  5GAH C;  4LF6 L;  3ICE A;  2XTI A;  1KC8 C;  1VQJ A;  5IP7 H;  1PH1 A;  1OXX K;  2I0Q A;  1G6P A;  4JV5 Q;  4DV1 Q;  4JI8 L;  4A3C H;  4IFD J;  1JJG A;  2NVT H;  4LF4 Q;  2Z6K C;  3S1M H;  4A3I G;  3CW2 C;  4JOI C;  1VQ6 A;  3H3V H;  2E5L Q;  3CF5 A;  3F2C A;  2NVY H;  3J80 i;  2EXD A;  2UUC Q;  1XTD A;  1VQN A;  1Z9F A;  2JA8 H;  1Y14 B;  2N49 A;  2WP8 J;  4IJH A;  1IXR A;  1Y1V G;  4GLA C;  2UXD Q;  4UPA A;  1BBW A;  1P16 A;  2VNU D;  1XNQ L;  5IWA L;  2Q2U A;  3CP0 A;  1FVI A;  1HZB A;  1YIT A;  4Y7N H;  1K0R A;  4LF7 Q;  2WFW A;  4DR1 Q;  4HIM A;  5JJL A;  4DAM A;  3S14 H;  1L1O C;  3S15 H;  4R1J A;  4A3E G;  2HIX A;  2UXB Q;  4GOP B;  1XNR L;  5LMU Q;  3BZC A;  1U0L A;  5GQO A;  2Z6K A;  1CSQ A;  1GO3 E;  1PH8 A;  3K7U C;  4QL5 A;  4DKA C;  2HHH L;  1MJC A;  1LYL A;  2ZJP A;  1YI2 A;  2AHO B;  2Y0S G;  4A3K H;  2JA7 G;  4DR4 L;  1R9T H;  3I4M H;  4A3G H;  2I5L X;  5AJ3 L;  2A8V A;  1GVP A;  5LMN Q;  3RZD H;  2LXK A;  3GTJ H;  2K4K A;  1WJJ A;  2DGY A;  4DV0 L;  1I3Q H;  2KBN A;  3H3V I;  5C44 G;  4R4O A;  4YCV A;  4JYA L;  4LF6 Q;  1HZ9 A;  2CFM A;  1UE6 A;  2VW9 A;  1PH5 A;  2N78 A;  1Q86 C;  1L1O A;  4MZ9 A;  4JI7 Q;  4OXP A;  3KJO A;  1XJV A;  2K50 A;  1FL0 A;  2KHJ A;  2IHE A;  5LMN W;  1X3G A;  4DR6 L;  1XPR A;  4IJL A;  5BR8 L;  3CC2 A;  1C0A A;  4JI0 Q;  1VQD A;  5JJI A;  4LWC A;  1W3S A;  3OTO Q;  4NXM Q;  4OO1 I;  1YHA A;  1YIJ A;  1EIF A;  4NPS A;  1X3E A;  4DV2 L;  3S24 A;  2OTJ A;  4YHH L;  1UE7 A;  4B3M L;  1QUQ B;  1Z47 A;  3CAM A;  3M9B A;  4P75 A;  1HR0 L;  4B3T L;  4JBW A;  4BY7 H;  4JI6 L;  4X66 Q;  4DR7 Q;  4GKJ Q;  4YWL A;  3ER0 A;  5IWA Q;  2OCE A;  3AQQ A;  3AEV A;  3GTG H;  1J6Q A;  3PIP A;  1JJ2 A;  2JA6 G;  3PO3 G;  1IBL Q;  1D8L A;  3PV0 A;  1U5K A;  2ZJR A;  1M1K C;  1Q82 C;  5IP7 G;  4KHZ A;  4GKJ L;  1YEZ A;  2ZTC A;  1VQK A;  2HHH Q;  4A3C G;  4GN5 A;  5FJ8 H;  2VS1 A;  4DPG A;  2RHS B;  1KQS A;  2Q2I A;  1BKB A;  3STB C;  5JJK A;  1PH9 A;  3PUY A;  1QVG A;  4JI1 L;  4JI3 L;  4L5R C;  1YJN A;  1KXL A;  1A63 A;  4C3I H;  3TRE A;  4C2M H;  4JC0 A;  5IP9 H;  5M5Y H;  5AJ3 Q;  3A0J A;  3T1Y Q;  3HOW G;  2CCZ A;  2K14 A;  2R92 H;  1P8L A;  4GLV B;  4DV3 L;  4LFB L;  2JA5 H;  3KLW A;  2BH2 A;  4A3M G;  1BBU A;  1SE8 A;  4GS3 A;  5IYC H;  1Q7Y C;  1XMQ Q;  1HNX Q;  1YJ9 A;  1CKN B;  5IYB G;  4A4I A;  2H5X A;  5GAD C;  3CXC A;  3KOJ A;  1HZC A;  1VCI A;  1I5F A;  4R4C A;  5H1S E;  4PMW A;  3RNU A;  4OO1 G;  1PH6 A;  4B3S L;  3AFP A;  1Q46 A;  2ZM6 L;  2K5H A;  2YTV A;  3KDF A;  4H02 A;  1E3P A;  3U4Z A;  3CC4 A;  4DV2 Q;  1SRO A;  2OQ0 A;  4DV4 L;  1W2B A;  4LNQ A;  2B3G A;  4IPD A;  2F52 A;  1N33 Q;  4L5Q A;  3GDE A;  3GTK H;  3PF4 A;  2ALY B;  1HR0 Q;  4B3T Q;  3T1H L;  3E9I A;  2IX1 A;  2Z0S A;  4JI6 Q;  2BA0 A;  4YY3 L;  1YZ6 A;  3RN5 A;  3I4M G;  1OXV A;  4DV6 Q;  4LF9 Q;  3RZO H;  5GRO A;  1JE5 A;  4GN4 B;  2Q2H A;  4BBS H;  3HOY G;  5FLM H;  1T9H A;  2K75 A;  3CCJ A;  3NEL A;  1BVS A;  4EX5 A;  3ULL A;  3TQY A;  4A3B H;  3G48 A;  3M7N A;  1S40 A;  3BU2 A;  1VQO A;  4OX9 L;  2LXJ A;  1K83 H;  1OXS C;  3HKZ E;  4APV A;  4DK3 C;  2NZH A;  2VL6 A;  3HOX H;  2ZTE A;  3CMA A;  2R6G A;  3PF5 A;  1HR0 W;  4GKK Q;  3PUZ A;  2R93 H;  3GTL H;  5ELO A;  3KYH C;  4P71 A;  4LFB Q;  3ERS X;  1NTG A;  5C0X I;  4DR2 Q;  2R7F A;  3NEM A;  1J5E Q;  1EOV A;  1ASZ A;  4JI4 L;  3GTO H;  1PVO A;  3HOZ H;  1G29 1;  2B63 H;  2UUA L;  4X65 Q;  2UUB Q;  2CKZ B;  2CWA A;  4C3H H;  1IBK L;  4ME3 A;  2F4V Q;  3A74 A;  4JI2 Q;  4DR5 L;  1NJI C;  4A3L H;  2NVX H;  4LFC Q;  3GTP H;  1RL2 A;  4HIK A;  1LM0 A;  3CPW A;  4XIG S;  3TEH B;  4BY7 G;  1IBM L;  1I50 H;  2YYZ A;  4KHP Q;  2BH8 A;  1EYG A;  2ZJQ A;  3CCV A;  4LFA L;  1SN8 A;  2AKW B;  3LGJ A;  3WWV A;  1WOC A;  1XMO L;  1QVF A;  5K36 G;  2K5V A;  3F2B A;  4BXX G;  4DV5 L;  3I4N H;  1HNW L;  2ZTD A;  3KJP A;  3J81 c;  2HQL A;  4AQY L;  1EQR A;  2PI2 A;  3BJU A;  1NMF A;  3L7Z C;  4QIW E;  1L1O B;  3ULP A;  1A0I A;  2ASB A;  3H0G H;  1A8V A;  5FJ8 G;  2MNA A;  1VQ5 A;  4JBM A;  3S2D H;  3M4Q A;  1PH2 A;  4JOI A;  1I94 L;  4HJ7 A;  5IP9 G;  4DV7 Q;  2QA4 A;  4TVA B;  5HY6 A;  4YWK A;  1PHJ A;  3PUX A;  3A5U A;  4A93 H;  2R92 G;  3D0F A;  1TWG H;  3G71 A; 
#chains in the Genus database with same CATH topology
 2JA5 G;  2IPK D;  3T51 B;  2JA6 B;  3BDC A;  1VQ9 A;  4M1U B;  4MNO A;  5IYC G;  4O42 A;  1X32 A;  4X3T A;  2VQE L;  5JPM C;  3Q23 A;  4UHV A;  1YNX A;  5DM7 3;  2YV5 A;  2AWN A;  1HNZ L;  2NZ1 D;  4WJ4 A;  2E2I H;  3S1M B;  3KF6 B;  3H6M A;  1AE3 A;  1EEI D;  3OOC A;  2LSS A;  1PH4 A;  1XPO A;  1EUJ A;  3MXP A;  4DK1 A;  4V0B A;  3NUC A;  1IYV A;  3VR4 A;  1WCM H;  4OIK A;  2EYM A;  5CV4 A;  5ELB A;  5IGF A;  4YCU A;  3A55 A;  4WJ3 M;  4IPG A;  1XNR Q;  3LWE A;  1PRT C;  3KF6 A;  3M4O H;  2F0T A;  2VQF L;  4L5T A;  1Y8N B;  3J80 L;  1V1Q A;  2JK8 A;  4AH6 A;  5C3X A;  2NB0 A;  3HOZ G;  1VQL A;  4C1N K;  4LAA A;  3RUZ A;  1EYC A;  3D4D A;  3F2U A;  4F8M A;  4DV0 Q;  2E74 C;  1X9N A;  1KAB A;  3D8G A;  1WI5 A;  4KY7 A;  1I3Q B;  3OYY A;  4DUZ L;  5D3I B;  2R7Z B;  2FHT A;  2PQA A;  1BR9 A;  2RCN A;  3G7L A;  3J7A 5;  5I9P A;  5C4Z A;  5ELD A;  5C4J B;  4JV5 L;  4DR6 Q;  2IX0 A;  1KHI A;  3E9H A;  4IUN A;  1X55 A;  2QEX A;  3SDZ A;  4AYB E;  4O0A A;  1C7Y A;  1E22 A;  2D62 A;  3RNU A;  1PFS A;  1XPR A;  3I7F A;  3W1B A;  3T53 B;  1A2T A;  2R61 A;  1IYU A;  4JBJ A;  4MIU A;  4A3K G;  2PYK A;  2NVQ B;  3MEF A;  2IJ0 A;  2D2C C;  2LFN A;  5HGQ A;  4RWS C;  1YNN D;  1LTL A;  1NCV A;  1XYI A;  4LF7 L;  1PH3 A;  1PTO H;  1TWA H;  3PQI A;  1TU2 B;  2AUK A;  4N9T A;  3TZU A;  4QB4 A;  2PMZ E;  1WTH A;  4PV1 C;  3C3L A;  2BA1 A;  4A3D G;  4GNX A;  2VQF Q;  2UXB L;  4ZLT F;  1LTI D;  2CWP A;  5M3F H;  3A5Z B;  1HFN A;  4C3J G;  3NWS A;  4AIM A;  1M90 C;  1VQ8 A;  4DUZ Q;  1I6V C;  1VQ7 A;  1EL0 A;  1TWH B;  2WV6 D;  3VDY A;  4LJZ C;  1B9M A;  3P20 A;  1JOR A;  4OWW B;  1TII D;  1VQB A;  4JI7 L;  2F0H A;  3PUW A;  1HQR D;  5EJW A;  4DR3 L;  4KJO A;  4BA1 I;  4JI0 L;  4DU9 A;  1SR3 A;  3HOV G;  1SLJ A;  3K5O A;  5DLQ E;  2F0J A;  1JWU D;  3U58 A;  3DLL A;  5IYB H;  4DR7 L;  1E2Z A;  3B6Y A;  3J81 j;  1UNS A;  3IL8 A;  4GOP C;  3A7A B;  4G57 A;  4DFA A;  5EBD A;  3HOU G;  4K8I A;  3QWN A;  3DWA A;  3IAY A;  1FNW A;  1O7I A;  1B2T A;  1MD2 D;  5EQ0 A;  1B1Z A;  2UUA Q;  1Q1B A;  4A3F H;  1EIY B;  2JJQ A;  1S3O A;  1MJE A;  3I91 A;  5IT9 c;  1A3T A;  4ABN A;  1PYS B;  2R7Z H;  2K6A A;  4G4K A;  2HT1 A;  4NXN L;  1LTT D;  2BCO A;  4G7H C;  1HNX L;  1EWI A;  5C4J H;  1N9W A;  4IUR A;  4J6H A;  1D6E C;  1HZA A;  2B2Y C;  1KDC A;  1SMX A;  1E1O A;  1N32 L;  3LWU A;  3AFQ A;  4DV5 Q;  3HGB A;  4DR3 Q;  1C9O A;  1UWV A;  3NXW A;  2FMM A;  3S15 B;  4UY8 C;  1Y1W G;  2Q8R E;  2GVB A;  2GN5 A;  1QE6 A;  1XPU A;  4YCW A;  2B8F A;  2XGT A;  1CKM A;  1N33 L;  2NVQ H;  2F0G A;  4RMF A;  1R9T B;  4A3G B;  4B3R L;  5ELE A;  2KHI A;  4C3H G;  4DV6 L;  4A3J G;  4LF9 L;  1UEA B;  4LF8 Q;  1X56 A;  2F0W A;  3CU7 A;  1D5M C;  3CRK C;  2AQ3 B;  1K8M A;  4B08 A;  4TSS A;  4XXE A;  2DY8 A;  2A5H A;  4U67 3;  2IY5 B;  3MHB A;  2C35 B;  4DN4 M;  1TWH H;  2IL8 A;  1PV4 A;  4LFC L;  4NXN Q;  4GN3 B;  2IW3 A;  2L11 A;  1GD7 A;  2IX3 A;  4NB3 A;  1AN8 A;  2B2V A;  2E8G A;  2K5N A;  2MPM A;  1N32 Q;  4U68 A;  3G4S A;  3X3N A;  5LL6 X;  1EY0 A;  3CCS A;  1X3Q A;  3SHL A;  4FO2 A;  5I9O A;  3OWE B;  5D65 A;  1QCB D;  3D4W A;  1UE5 A;  4X3S A;  3S1R B;  3CME A;  4OL7 A;  1WTX A;  5FOB B;  4B3R Q;  1OXT A;  2DUD A;  4POF A;  4HJA A;  1CKN A;  5I2Y A;  1EY5 A;  5LMN L;  4HIO A;  3I56 A;  3FKI G;  2PI2 E;  2Z4H A;  4WJW A;  2ICE C;  3I4L A;  3ICE A;  2D9U A;  3MFY A;  1OXX K;  4DV1 Q;  1VDZ A;  1WD0 A;  1LT3 D;  1DON A;  3VA7 A;  4J8Q A;  4JOI C;  3P7J A;  2E5L Q;  4UDU C;  2UUC Q;  1XTD A;  1U4P A;  4CJ1 B;  2O5I C;  1IXR A;  1Y1V G;  1PZJ D;  2UXD Q;  1BBW A;  2EJG C;  4BBS B;  1PTO C;  4Q5V A;  5JJL A;  4XT3 B;  5FKA C;  4DAM A;  4A3B B;  1L1O C;  1JC7 A;  1EOT A;  1B44 D;  3DXJ C;  3S15 H;  4A3E G;  1JQY D;  2VB2 X;  1BO0 A;  4BY1 B;  5GQO A;  2R93 B;  1PH8 A;  4ILW A;  2Y0S G;  1U4L A;  2JA7 G;  1R9T H;  4A3G H;  2I5L X;  2J7Z A;  5LMN Q;  1YNJ C;  1NAP A;  4KY6 A;  3H3V I;  4R4O A;  4KKU A;  1GXD C;  4YCV A;  1EQV A;  2EVB A;  1HZ9 A;  4CKE A;  1I6H B;  1I50 B;  1QJO A;  2DNE A;  2G5D A;  4OXP A;  3X3M A;  2IHE A;  5LMN W;  1BXT A;  1VQD A;  3BVZ A;  5IT9 E;  3OIQ A;  4OO1 I;  2RQX A;  5KIX A;  3A8J E;  1EIF A;  4FF4 A;  1X3E A;  4DV2 L;  2OTJ A;  4G7Z C;  4B3M L;  4HSV A;  1QUQ B;  1Z47 A;  4KD3 A;  4DNT B;  1EQT A;  4B3T L;  4BY7 H;  4DK0 A;  4X66 Q;  3ER0 A;  1IKM A;  3AEV A;  4PQX A;  4A93 B;  1Y8O B;  1JJ2 A;  4KN4 C;  1HUN A;  1H9R A;  3PO3 G;  3MXG A;  3PV0 A;  3CHB D;  1C48 A;  2L1B A;  4GKJ L;  1EWC A;  2RVL A;  4GN5 A;  1PZI D;  5FJ8 H;  1KQS A;  1ESR A;  3STB C;  5JJK A;  3PUY A;  4JI3 L;  1YJN A;  3GV6 A;  3NTI A;  4XYO A;  2X6L A;  5M5Y H;  5IP9 H;  3T1Y Q;  2D5D A;  3A0J A;  3MXU A;  2K14 A;  1G6Z A;  2R92 H;  1CQV A;  1K3B C;  1TQO A;  2KHS A;  2BH2 A;  4LFB L;  4PMC A;  1ZEQ X;  1BBU A;  4A3M G;  2A69 D;  3S17 B;  3FRP B;  1Q7Y C;  3GTM B;  4FXD A;  4H0L C;  3I73 A;  1YJ9 A;  2DJF C;  5GAD C;  3SXH A;  1HTL D;  5M9O A;  2TMP A;  1SMY D;  2L12 A;  1I5F A;  1Q46 A;  2ZM6 L;  3CC4 A;  3OIP A;  2EY5 A;  1E3P A;  1S5B D;  3U4Z A;  3MAQ A;  1D5Z C;  4DV2 Q;  1W2B A;  4LNQ A;  4NP5 A;  1GUT A;  1KLG D;  1I4P A;  4B3T Q;  3T1H L;  2IX1 A;  3I4M G;  4YY3 L;  2XVS A;  3SK8 A;  1OXV A;  1Q3L A;  1B4O A;  3RZO H;  1JE5 A;  4MN3 A;  4BBS H;  1T9H A;  5A2Q L;  2PMZ B;  2NBF A;  4A3B H;  2RDF A;  2K5D A;  3SK4 A;  1S40 A;  3TP6 A;  4OX9 L;  1H9S B;  2FIN B;  2LXJ A;  4GKJ Q;  3PF5 A;  2ZTE A;  3M3Y B;  1T5X D;  2R93 H;  1F2M A;  3ERS X;  1NTG A;  4K5W A;  2R7F A;  3R93 A;  1J5E Q;  2BE5 D;  2JP1 A;  4JI4 L;  4BBR B;  2K33 A;  1IBK L;  3N52 A;  1JOO A;  4ME3 A;  2F4V Q;  1V8Q A;  4JI2 Q;  4A3L H;  4FF3 A;  3BYT B;  4FVM A;  1LM0 A;  5F2D A;  1JWS D;  4XIG S;  1IBM L;  3S16 B;  1ZKO A;  1I50 H;  5AFW A;  3CCV A;  4O1N A;  1WOC A;  1XMO L;  1QVF A;  4BXX G;  1WTQ A;  2ZTD A;  4FF2 A;  1WVL A;  1JIC A;  3ULP A;  2PO4 A;  3C1E A;  1A8V A;  1JOK A;  4JBM A;  1EFI D;  2DNC A;  1M4V A;  3KLR A;  4HJ7 A;  2LMC B;  3DHQ A;  3OSO A;  3PUX A;  1FNU A;  3A5U A;  4A93 H;  2NYZ D;  1K3R A;  3Q24 A;  2OEO A;  1BUV T;  1S4Z A;  1VMP A;  2CW0 C;  3HRZ C;  1G2S A;  4UP7 A;  3I4O A;  1IYJ B;  3F1Z A;  3I2Z A;  2A68 D;  1KRS A;  3ERO A;  2Q2T A;  3J7Z C;  4JI8 Q;  3ERQ A;  1RDP D;  2F3V A;  2C9O A;  2JQO A;  1EYA A;  2AWO A;  1HCZ A;  1L0W A;  2NN6 H;  2WAQ E;  2WKD A;  2RSN A;  3S17 H;  2CQO A;  3EA6 A;  3K7A B;  1OTC A;  4ZKB B;  3V96 A;  1ZYR D;  2F0E A;  2CH4 A;  3R2I A;  1VF5 C;  1YVC A;  4Y7N B;  5I2X A;  2EYP A;  1STE A;  4E6I A;  1TR5 A;  1UEB A;  1B7Y B;  4LUV A;  1JMC A;  5C3E B;  1I4Q A;  1Q90 A;  2EY2 A;  2BOS A;  1F9P A;  5LHY 1;  4P74 A;  3KDF B;  2B63 G;  4K2L A;  2KA7 A;  1TY2 A;  1FR3 A;  1H9K A;  2K01 A;  4JYA Q;  1TWC B;  2JA8 G;  2K05 A;  4FXG C;  2EYJ A;  1A62 A;  5ISR A;  3RR5 A;  1SYG A;  2YTY A;  1JJC B;  1NSN S;  2EY1 A;  1CKO A;  3M3Y H;  1EY7 A;  4KI0 A;  1RF2 D;  1R4P B;  1MHW C;  3MVV A;  1VQM A;  5M3M H;  4BBR H;  3NSW A;  4IOC A;  4A3I B;  1EZ6 A;  1EU3 A;  5HGT A;  1X6O A;  3NEN A;  4YHH Q;  3MXN A;  3H0G G;  2XNA C;  5E1F A;  1GOZ A;  4DGZ A;  1STN A;  1TVX A;  2A6E D;  5JPN C;  1V43 A;  2MFI A;  1GHJ A;  3S16 H;  5CYU A;  3UE0 A;  3U4V A;  3GTG B;  3BVG A;  2OQK A;  3GV3 A;  1E0B A;  2WB1 G;  4BWG B;  1K73 C;  3PIO A;  1G2T A;  3KLS X;  1LTS D;  2SDF A;  1RTO A;  2NTT A;  1NE3 A;  3M85 A;  4IPC A;  1SBB B;  2UXC L;  3EJI A;  1DXM A;  2PW5 A;  4Z9C B;  3SE0 A;  3JAM i;  1O78 A;  3K0X A;  2R3Z A;  2IWH A;  5JEA G;  4QGU A;  4DV3 Q;  4CKC A;  2JEA I;  2I07 B;  5C44 B;  2B2U C;  1E1T A;  1S5D D;  1ET6 A;  1WCM G;  3T13 A;  1HFG A;  5FO8 B;  4CJ2 C;  3D4R A;  1BCP D;  4PG3 A;  1TT2 A;  4DV4 Q;  4NXM L;  4NKL A;  5CMD A;  4DNR B;  3PO2 H;  1VF7 A;  4OGQ C;  2RDH A;  3PUV A;  4IFD H;  3K7A H;  3PSI A;  2OTL A;  2DN8 A;  2V1C C;  4IPH A;  1E2V A;  1HTP A;  1MKH A;  2E75 C;  3CCR A;  5M5W B;  4GZY C;  1IBL L;  5JEA J;  1K83 B;  5EBC A;  3IFD A;  5C3E H;  2UXC Q;  4Q0F A;  2PW7 A;  3S9W A;  1EZ8 A;  5IYD H;  3MC0 B;  3UDF A;  2RDG A;  4ZUI A;  1EY9 A;  1BCP F;  3D6C A;  1SJE D;  2D0P A;  3E0E A;  5FLX c;  1TWC H;  1AP0 A;  5KNB A;  4KK7 A;  4JK1 C;  2HD3 A;  1S5C D;  2WIN B;  3K80 C;  2PQA B;  1HNW Q;  1STH A;  1DJR D;  5FO7 B;  4A3I H;  2E2J H;  4L5S A;  1PMR A;  2L15 A;  2YU9 H;  1SNC A;  3U50 C;  1PYB A;  3VYS A;  2B2W C;  2IHF A;  2HIV A;  1A6X A;  1AZQ A;  3J81 i;  5M3F G;  2XRS D;  4A3K B;  2Z6B A;  2EE1 A;  2ZT9 C;  1U4R A;  1ONL A;  2AQ2 B;  5T1I A;  2KCC A;  2ZXR A;  2VXW A;  5K36 H;  2VQE Q;  3G6E A;  3IKJ A;  3IRB A;  5CV6 A;  4MTN A;  3VR5 A;  2A19 A;  1HNZ Q;  1WTW A;  3K58 A;  1TWF H;  4A75 A;  2OWO A;  4DR2 L;  3CCM A;  3TS0 A;  1SAP A;  4GNX B;  2RF4 A;  4K5X A;  1KL9 A;  4X65 L;  2UUB L;  3EIV A;  1I4R A;  2SNM A;  1CM9 A;  1QIL A;  3QJY A;  3BDO A;  4JW0 A;  5C44 H;  3VYU A;  2RSO A;  2JN4 A;  3TZD A;  4A76 A;  1SYE A;  3H94 A;  4KHP L;  3K6O A;  5JAV A;  2KEN A;  1B53 A;  3CC7 A;  4HID A;  4KKS A;  2C5C A;  1G8Z D;  3KBG A;  3CCU A;  4ZQ3 A;  5IGG A;  3LNN A;  1VQP A;  5I6W A;  5D3D A;  1DGS A;  1QZG A;  5LL6 S;  4A3F G;  1HH2 P;  4JG2 A;  2JA6 H;  5EKL A;  2R7Z G;  4OON A;  1Y8P B;  5M5W H;  1KC8 C;  4EQP A;  1VQJ A;  5IP7 H;  1PH1 A;  4JV5 Q;  4A3C H;  2AUJ D;  1B50 A;  1J9O A;  3MA2 B;  1JWM D;  3S1M H;  1W6J A;  3K5M A;  3Q0A A;  2EPB A;  2F0N A;  3CF5 A;  2MJ8 A;  3J80 i;  2SEB D;  1Z9F A;  1V1O A;  1BCP B;  1FGB D;  5ELF A;  2RCF A;  1P16 A;  1XNQ L;  2Q2U A;  3CP0 A;  1HZB A;  2WII B;  1K0R A;  4LF7 Q;  5JOB A;  2B8G A;  2HIX A;  3K59 A;  2UXB Q;  2EDG A;  2EOT A;  3HOX B;  1Y1W B;  2Z6K A;  1GO3 E;  1DYQ A;  3R2T A;  4DKA C;  4CJ0 B;  4MTK A;  1YI2 A;  2AHO B;  4FP5 D;  4ZK9 B;  4A3K H;  4DR4 L;  3NP8 A;  1GUN A;  5C5L A;  1GVP A;  4N8F A;  2LXK A;  4C3H B;  2K4K A;  1SJH D;  2HDL A;  1WJJ A;  2DGY A;  4R8I A;  4A3J B;  1I3Q H;  2KBN A;  4RCN A;  2CFM A;  3C46 A;  4IUQ A;  1UE6 A;  2BDO A;  2O5J C;  1HXY D;  4JI7 Q;  5T1G A;  1XJV A;  1FL0 A;  2KHJ A;  1SYB A;  5BR8 L;  5ELC A;  4ODG A;  1AZP A;  4JI0 Q;  3I4N B;  2WAQ B;  3J7A F;  4LWC A;  1W3S A;  1WTP A;  5FLX E;  2F0D A;  1F9Q A;  1YHA A;  1D2B A;  1UE7 A;  1BNZ A;  1II3 A;  3S2D B;  3CAM A;  3M9B A;  4P75 A;  3FPP A;  1HR0 L;  3K5L A;  4TRD A;  4DR7 Q;  4YWL A;  1RTN A;  1PRT D;  2OCE A;  3PIP A;  2B2T A;  1F2Y A;  1D8L A;  3NQI A;  1Q82 C;  4KHZ A;  4KV6 A;  1VQK A;  5IOD A;  2F0I A;  2Q2I A;  1KXL A;  4JI1 L;  4L5R C;  3QG1 A;  5JVH 3;  3WDN A;  4JC0 A;  3HOW B;  1K8O A;  1HNX Q;  1CKN B;  2H5X A;  2E2H B;  4RAU C;  5C4H A;  5C0X H;  1WTR A;  2PPB C;  3FPU B;  4XQN A;  1EY4 A;  1HZC A;  2LY7 A;  2A69 C;  5H1S E;  2EJM A;  1PRT F;  2E76 C;  4B3S L;  2YTV A;  1SRO A;  3NHH A;  4IPD A;  1TS3 A;  1N33 Q;  5M5X B;  2ALY B;  1HR0 Q;  3K5N A;  1GHK A;  3E9I A;  2BA0 A;  5CV7 A;  3CQZ B;  4IUT A;  4M8A A;  1Y1V B;  4CGY B;  4DV6 Q;  4LF9 Q;  1AFP A;  4HAE A;  4GN4 B;  3HOY G;  2KCN A;  5FLM H;  1EEF D;  3I72 A;  4EX5 A;  3FVQ A;  1TKW B;  1B9N A;  1HPC A;  2ZJQ A;  2HCC A;  1OXS C;  1SFO B;  4DK3 C;  4A3E B;  5DNF A;  3HOX H;  1HR0 W;  1BQQ T;  1H9M A;  4DXF A;  3CMA A;  4P71 A;  1PLF A;  1L0Y B;  1EOV A;  1E2W A;  2Y0S B;  2JA7 B;  1KAA A;  2PZW A;  4C3H H;  1A3V A;  3A74 A;  3M7G A;  4N8X 1;  4DR5 L;  4LFC Q;  2BE5 C;  1Q8I A;  1D1I A;  4BY7 G;  2YYZ A;  3OHX C;  2BH8 A;  1EYG A;  4LFA L;  3MFG A;  3M4Y A;  3LGJ A;  3WWV A;  2PZU A;  4P2C B;  1F9R A;  2K5V A;  3F2B A;  4K8J A;  4KKT A;  3I4N H;  3VR2 A;  3J81 c;  4AQY L;  5C4X B;  1EQR A;  1A0I A;  4C1N I;  3DEO A;  5FJ8 G;  3S2D H;  3M4Q A;  2FFK B;  1I94 L;  3SK6 A;  1A2U A;  2K1B A;  5IP9 G;  5HY6 A;  1PHJ A;  5TSS A;  1FYC A;  2R92 G;  3G71 A;  3HKZ G;  4KMU C;  3PO3 B;  1LTA D;  2VUM B;  3PCO B;  4X3K A;  1FNV A;  3KF8 A;  3PIO 3;  2QF7 A;  3AU7 A;  1HHV A;  2A74 C;  5BN4 A;  3CPF A;  4X62 L;  1OXU A;  1KD1 C;  2N3S A;  1ENA A;  3A56 A;  3MZ5 A;  4H44 C;  4H7B A;  1Q81 C;  2CQA A;  3FHW A;  1X3F A;  4L63 B;  3D6W A;  1XX8 A;  3HOW H;  1A15 A;  5E4X A;  4JPB W;  3QB3 A;  4KLK A;  4DK6 C;  1HRJ A;  1SND A;  4A3M B;  2VY3 A;  1JT8 A;  3PMF A;  5GAG C;  3UE1 A;  1Q12 A;  2E2H H;  2N8N A;  4X64 L;  2QCP X;  3QIA A;  4A3B G;  4FYD A;  1N36 L;  3RLO A;  2R93 G;  3DEP A;  4PNY A;  3HZX A;  3S1R H;  1IW7 D;  4XTC S;  1PRT B;  3BZK A;  4K0K L;  5M5X H;  1L0X B;  1CFM A;  2DJG C;  1K8G A;  1SE2 A;  2H4O A;  1PYW D;  2UU9 L;  2GVA A;  3RZD B;  1VMC A;  2XIW A;  4A3L G;  1SXT A;  4EQN A;  1E24 A;  5JJZ A;  3V2T A;  3VR3 A;  1BOS A;  3JAM E;  1S5F D;  1SFO H;  3ZJY C;  3ONA B;  4ALP A;  2VZA A;  4EQ5 A;  4A3E H;  2L9H A;  1EFW A;  3AB9 A;  4K14 A;  4R8N A;  3JC6 6;  4GNX C;  4IQZ A;  1MSH A;  3EBE A;  2A1A A;  3J80 c;  2A6H D;  3PGZ A;  1VS0 A;  3K8A A;  3SR1 A;  1SNM A;  4RKB A;  4B3M Q;  2MQH A;  1ENF A;  4RG1 A;  3QO2 A;  1DM0 B;  4HJ9 A;  5EKI A;  4QQB X;  3NTH A;  3AMU A;  4A93 G;  2YTX A;  4JI5 L;  2EYL A;  2A6E C;  4DR1 L;  3S2H B;  2EZV A;  1N36 Q;  3CRL C;  5C4X H;  3H15 A;  4BY1 H;  4YWM A;  2G9H D;  4ZKC B;  4ULL A;  1IL2 A;  2RBM A;  4K0K Q;  1TS4 A;  2PNH A;  5J3B A;  4JI3 Q;  3C2P A;  3DWQ A;  3CD6 A;  2NN6 G;  3WOE A;  2UU9 Q;  2EYH A;  4RGT A;  1N34 L;  1NY4 A;  4IO9 A;  2ICI A;  3L0O A;  4LFB Q;  5IGD A;  1ESF A;  1U9R A;  1EWH A;  2VUM H;  1VQH A;  4HJ8 A;  1I6H H;  1GUO A;  1KTK A;  4DAV A;  3NPP A;  4DXG A;  3TP7 A;  1Y69 U;  4GLX A;  4AYB G;  5D14 A;  4ZYS A;  3KBX A;  2ZM6 Q;  4P73 A;  3BS1 A;  5CC4 A;  1LTR D;  3OTO L;  3N6R A;  2ATW A;  1I4H A;  4BA2 I;  3Q22 A;  1F2L A;  1PTO D;  1PH7 A;  3T1H Q;  4A3M H;  4YY3 Q;  5IT9 L;  2R7D A;  1KIX A;  4JI5 Q;  4IN3 A;  4ME5 A;  4CHT B;  3J81 E;  1LT6 D;  2NZO A;  4OX9 Q;  1ICF B;  1TXY A;  2ZXO A;  1VQG A;  3OMG A;  3KFU A;  3FMC A;  2F03 A;  3DWP A;  3OW2 A;  1YNJ D;  3TP5 A;  3UDG A;  3W1G A;  5M3M G;  4JI4 Q;  1TY0 A;  4BBR G;  4DUY L;  3GTO B;  3EVQ A;  1N34 Q;  1VQF A;  4CDC C;  1IBK Q;  2B63 B;  2EQS A;  2M9V A;  1CTM A;  3HKS A;  1B3A A;  4JBK A;  3HP3 A;  1DZ1 A;  3QOL A;  3CCE A;  1JB3 A;  3GTM H;  2JA8 B;  2K32 A;  1IBM Q;  2B2T C;  5IGC A;  1PTO F;  1XMQ L;  4GOP A;  1WFQ A;  5KEE A;  3L3O C;  1TS5 A;  2F0P A;  2MO0 A;  1XMO Q;  4YIJ A;  3K81 C;  1NBW A;  1PA6 A;  2MGS A;  2PQE A;  1CI3 M;  1KAW A;  1G51 A;  2KUM A;  4QJF A;  1X54 A;  4HSP A;  4ZCK A;  1O7Y A;  1UE1 A;  2I46 A;  1YJW A;  1Q8K A;  4F88 A;  1FGU A;  1X65 A;  1KDA A;  4XDX A;  3FP9 A;  3RLF A;  1QNU A;  3O13 A;  3FDT A;  1MGS A;  2Z8L A;  3GTJ B;  3MXN B;  4EQO A;  3ND8 A;  3F2D A;  4RA8 A;  2B2V C;  1SYF A;  5IGE A;  3S2H H;  4BXX H;  3STB D;  1CUK A;  1ROD A;  2WB1 B;  2B2Y A;  1Q1E A;  2F0S A;  4HJ5 A;  4LW1 A;  1K8A C;  1CZG A;  4GKK L;  4C56 C;  2JEB I;  3K57 A;  4LF4 L;  4DUY Q;  4LUZ A;  5EKK A;  2E2I B;  1K9M C;  2Z4I A;  3F8T A;  4OIJ A;  4QMG A;  3PO2 G;  3KLS A;  4IFD G;  2ENB A;  1STY A;  4DNI A;  4KY5 A;  3OPO A;  1LT5 D;  1J8I A;  3VYR A;  1NMG A;  3J80 E;  1PDQ A;  4X6A H;  1L2F A;  2XWJ B;  3I8Z A;  1SDF A;  3DM3 A;  3T4A C;  3ULJ A;  4UAI A;  3NWT A;  1D5X C;  5NUC A;  4LUO A;  4LMQ D;  3I3C A;  1AH9 A;  5C5M A;  4POG A;  3E0J A;  3A7L A;  1YNN C;  5C3E G;  1NUC A;  1QVC A;  5LMU L;  2JSO A;  1ET9 A;  2EYO A;  5IYD G;  1S5E D;  2QGQ A;  1KLU D;  4RHR A;  5HUR A;  1GKH A;  4C3I B;  4DV7 L;  2Y0S E;  3PIP 3;  5IIF A;  4OHJ A;  2JA5 B;  2JYO A;  5J39 A;  1HUM A;  2ID0 A;  1Z7T A;  5GAH C;  4KN7 C;  2I0Q A;  1G6P A;  2XN9 C;  4IFD J;  1JJG A;  4LF4 Q;  4CBV A;  1NR4 A;  2CHB D;  2TSS A;  4LK1 C;  1SYC A;  4A3I G;  4K6D A;  4OEM B;  3H3V H;  1LLR D;  3C1F A;  5IOC A;  1K0S A;  4V19 0;  3F2C A;  5J22 A;  1VQN A;  2EXD A;  1U4M A;  3GTK B;  4KTA A;  2JA8 H;  1Y14 B;  2N49 A;  2WP8 J;  2QDB A;  4UPA A;  5IWA L;  1YIT A;  4Y7N H;  2K28 A;  2SNS A;  2WFW A;  2L4N A;  4HIM A;  4OO1 H;  1KNE A;  2HDM A;  1XNR L;  5CGK A;  5LMU Q;  3BZC A;  2RA4 A;  3GP7 A;  3GQB A;  3GTL B;  2HHH L;  1EY6 A;  4QL5 A;  1MJC A;  3BDL A;  1BBX C;  2Z9H A;  3HOZ B;  5AJ3 L;  2A8V A;  4QCL A;  3ND9 A;  3GTJ H;  3K0Y A;  1JOQ A;  1SE4 A;  4KHV A;  5DM6 3;  4DV0 L;  2N88 A;  4TKO B;  5C44 G;  4XQJ A;  3GTP B;  2BDN A;  2VW9 A;  1PH5 A;  2N78 A;  1Q86 C;  1L1O A;  2K50 A;  3BVM A;  4HN7 A;  1X3G A;  4DR6 L;  4IJL A;  1C0A A;  5COR A;  4NXM Q;  5E3F A;  1CZW A;  3S24 A;  1RD9 D;  5JEA H;  1CK1 A;  1PFB A;  1B3Q A;  4RGO S;  1SEB D;  2KQ3 A;  2OXP A;  3J7Y W;  5IWA Q;  3GTG H;  1J6Q A;  1TWG B;  5EGT A;  4ZAI A;  2JA6 G;  1NR2 A;  1IBL Q;  1U5K A;  1DOM A;  1OO9 B;  5KYL A;  5IP7 G;  3IFT A;  4A3D B;  4A3C G;  2HHH Q;  2VS1 A;  4DPG A;  1XTC D;  2RHS B;  2HUG A;  4IUV A;  1QVG A;  4C3I H;  5AJ3 Q;  4A3F B;  4C3J B;  4J1M A;  1CQF A;  2CCZ A;  3GTQ B;  1SE3 A;  1P8L A;  4GLV B;  2JA5 H;  3KLW A;  1SE8 A;  2L5T A;  4GS3 A;  5IYC H;  3QOJ A;  4XQQ A;  3I90 A;  5IYB G;  4CDE C;  3CXC A;  3KOJ A;  2B39 A;  1ILP A;  1DOL A;  4H02 A;  2B3G A;  3G6J B;  3HOV B;  3PF4 A;  4L5Q A;  3GDE A;  3GTK H;  5L37 A;  2Z0S A;  3RN5 A;  1YZ6 A;  5EPK A;  2F0K A;  3D3R A;  1MSG A;  5GRO A;  3V05 A;  2H1E A;  3CCJ A;  3NTK A;  1BDO A;  3ULL A;  2V4D A;  3M7N A;  1VQO A;  1K83 H;  4HCE A;  4APV A;  2VL6 A;  3HOU B;  4K2K A;  3PUZ A;  3GTL H;  5ELO A;  3KYH C;  1G91 A;  1O7Z A;  2HQE A;  4DR2 Q;  3NEM A;  4KJN A;  1EIH A;  1QOH A;  3HOZ H;  2N55 A;  4OEL B;  2UUA L;  4X65 Q;  2UUB Q;  2CKZ B;  4FNF A;  4WFN 3;  3GTP H;  1RL2 A;  4HIK A;  2RKS A;  3KUP A;  4HR7 B;  3CPW A;  4KHP Q;  2MUY A;  1RHP A;  2AKW B;  4DF7 A;  1CA6 A;  4DV5 L;  2DY7 A;  3P1H A;  3KJP A;  2KVM A;  2HQL A;  4QIW E;  1NMF A;  2MHV A;  2ASB A;  2NUC A;  2MNA A;  1VQ5 A;  5A35 A;  2QA4 A;  2JXM B;  4YWK A;  3L9A X;  3D0F A;  1TWG H;  2KCT A;  1WYD A;  1LT4 D;  3EQL C;  4TQU S;  4LF5 L;  3RD4 A;  4LF8 L;  4EVO A;  1V9P A;  2ES2 A;  3ZYY X;  3VA5 A;  4A3D H;  5ELN A;  5C0X G;  3VYT A;  3Q8D A;  1AEX A;  4KD4 A;  3UDX A;  3H3V C;  1WD1 A;  1V1P B;  2EJF C;  5KNC A;  4RFB A;  4IZ8 A;  1IL8 A;  1EIG A;  4C3J H;  3TN2 A;  3GTQ H;  2EYF A;  1VQC A;  2FMC A;  1I4X A;  1ML0 D;  1RJT A;  2I5H A;  5BN5 A;  2L55 A;  3I55 A;  1XNQ Q;  1LV9 A;  2F3W A;  5FLM G;  2FXQ A;  3S1Q B;  3TSS A;  3HG9 A;  5J1Z A;  4IUU A;  3A8I E;  1CA5 A;  1V1P A;  4PZ7 A;  1AE2 A;  3AYH B;  5G3L D;  4HTH A;  1GUW A;  3HOX G;  4JCV E;  2CVR A;  3EFX D;  3HOV H;  2WB1 E;  1C4Q A;  5CBA E;  3JAM c;  4S3S A;  2JA9 A;  1YBY A;  4DR4 Q;  2F0V A;  5C0X J;  1S72 A;  5IY0 A;  2NN6 I;  5KND A;  1IW7 C;  3HOY B;  3FKI B;  2GA4 B;  4LF5 Q;  3I70 A;  5C6A A;  2ZXP A;  1W6K A;  3HOU H;  3DMU A;  3A54 A;  5KGU A;  5CBE E;  5IGB A;  3M4P A;  2J0T D;  4DV1 L;  1SNO A;  5BR8 Q;  1STB A;  3CCQ A;  1JE4 A;  2B29 A;  3EN2 A;  2F0Q A;  2WAQ G;  1B8A A;  3I4N G;  3TME A;  1F77 A;  1EY8 A;  5I6Y A;  3GO5 A;  1SMY C;  2KJX A;  1KNA A;  2K5Q A;  2E5L L;  5G3L F;  4HCS A;  1IZ6 A;  3MTS A;  2F3I A;  1KRT A;  2UUC L;  2A73 B;  4RGN A;  1FD7 D;  3TS2 A;  2A6H C;  3CCL A;  4A3G G;  4BY7 B;  2AMC B;  3NQT A;  3LX0 A;  3ITP A;  3TDQ A;  3E5S A;  2KCM A;  2UXD L;  4B9X A;  2XWB B;  2O2L D;  3E3X A;  1LTG D;  1RCV D;  1HA5 A;  1Y1W H;  4Y52 H;  1VQA A;  4JI1 Q;  3OMC A;  1PXU A;  2QEJ C;  4RGM A;  1KDB A;  1C8C A;  5M5Y B;  4OWX B;  1WTO A;  3HOW G;  1PZK D;  4A3J H;  4OWT B;  2R92 B;  4UP9 A;  3HKZ B;  1YHB A;  4HMJ A;  5IE8 A;  1FJG L;  4H13 C;  5E7N A;  4J15 A;  1DD2 A;  1CSP A;  4X3U A;  2XSC A;  3S1N B;  4CKB A;  2KOL A;  5K5P A;  1NNX A;  1EQQ A;  3RLN A;  4B3S Q;  2D0O A;  1ILQ A;  4UP8 A;  2NTS A;  2OT2 A;  2X6G A;  3KF8 B;  3HFZ B;  1PFN A;  5A2Q E;  2LS0 1;  5CR3 A;  4MHE A;  5GAE C;  4PZ6 A;  3GD7 A;  4R4Q A;  1QNK A;  1LUZ A;  5FLX L;  1E7Z A;  4X66 L;  2MO1 A;  3RZO B;  2B2U A;  3S1Q H;  1HQM C;  2OF1 A;  3W5O A;  4WRD A;  1D7Q A;  1HA6 A;  4DAP A;  2PCF B;  4QUC A;  2SOB A;  4L6T B;  2NVT B;  2K7V A;  1LTB D;  1VQE A;  1RKN A;  1EU4 A;  2A68 C;  1H95 A;  2WAC A;  4EGV A;  4NMZ A;  4QY7 A;  4PZ8 A;  3W2D A;  3T1Y L;  3SEB A;  4DR5 Q;  3MWY W;  1JB7 A;  3HOY H;  3QR8 A;  4XYQ A;  3NBH B;  1UUP A;  2NVY B;  3FKI H;  1ASY A;  3HS0 C;  4BS9 A;  1N8R C;  1FJG Q;  1SSO A;  4FF1 A;  3D31 A;  2MP1 A;  4IFD I;  1RIP A;  4LFA Q;  3L2P A;  2K52 A;  5BN3 A;  4BBS G;  4NDX A;  2I5M X;  1I4G A;  3UDI A;  3S14 B;  2XRQ D;  4ID6 A;  4CDD C;  4AQY Q;  2CH4 W;  1ZYR C;  4N9P A;  3SGI A;  5C4X G;  4BY1 G;  5C3W A;  3H91 A;  4PMB A;  1GM5 A;  3T16 A;  3NBH A;  2EIF A;  1VQ4 A;  1I94 Q;  1EYD A;  3CQZ H;  3I4M B;  1Y1V H;  2RHQ B;  2F1M A;  1YHQ A;  4I65 A;  5DEH A;  5FO9 B;  3SK5 A;  2VUM G;  3OWF A;  2G9D A;  5JVG 3;  4L8J A;  4FDB A;  2JE6 I;  4X62 Q;  1QZH A;  4IOA A;  4R4T A;  1DOK A;  2X69 A;  4CDF C;  1QUQ A;  1GJX A;  2KEE A;  1QG7 A;  2JA7 H;  1J5E L;  2B2W A;  2IT1 A;  2K5W A;  3RN2 A;  1HJP A;  1PFM A;  4O2D A;  5KRU A;  1MIU A;  4P72 A;  2F4V L;  4JI2 L;  4IUP A;  1H9J A;  2K04 A;  1B70 B;  3TBI B;  4X64 Q;  3S1N H;  4I7A A;  2NWG A;  4RCO A;  4AYB B;  5CV5 A;  4ZUJ A;  4DAY B;  1ENC A;  4R4I A;  4RHS A;  5EAY A;  3TRZ A;  5COY A;  2QW7 A;  1SRU A;  1VQI A;  3BG3 A;  3RMH A;  3SVM A;  1Z6H A;  4C2M B;  2M2L A;  5EPJ A;  4K6L A;  4F7X A;  3PO3 H;  4DAY A;  3WOF A;  4LF6 L;  2XTI A;  2E2D C;  5KYI A;  4JI8 L;  3VR6 A;  2NVT H;  5EPL A;  1MI2 A;  2Z6K C;  5M3M B;  5FK9 C;  1D1K A;  2F0L A;  3CW2 C;  4JVZ A;  4G7O C;  1VQ6 A;  5CV8 A;  1LAC A;  4ZRZ A;  1X3P A;  1STA A;  2NVY H;  1BCP C;  1MBY A;  4IJH A;  3FEW X;  1H9S A;  4GLA C;  2VNU D;  3W3A A;  1FVI A;  1LAB A;  4DR1 Q;  3S14 H;  2KED A;  4QIW B;  3TP8 A;  4R1J A;  3BZD B;  3T56 B;  4GOP B;  4RH6 A;  1GUS A;  2VB3 X;  1U0L A;  2EY6 A;  1CSQ A;  2QDL A;  3K7U C;  1LYL A;  2ZJP A;  1WTV A;  3DM1 A;  2O4X A;  3I4M H;  1O7L A;  3RZD H;  1IHZ A;  1JR0 D;  2NVX B;  4WOR A;  3P75 A;  4JYA L;  1DCZ A;  4LF6 Q;  1QWY A;  5DAU A;  2P5Z X;  2PZT A;  3MEH A;  4XT1 B;  1SNP A;  4MZ9 A;  4IAL A;  3KJO A;  3U9O A;  2K03 A;  3R3O A;  3CC2 A;  2PNR C;  5JJI A;  3OTO Q;  3JAM L;  2WKC A;  1YIJ A;  4NPS A;  4YHH L;  3H0G B;  3UI2 A;  3URY A;  3PO2 B;  3NE5 B;  3U9S A;  1SYD A;  4JBW A;  4JI6 L;  1CT1 D;  3AQQ A;  1M8A A;  2AQ1 B;  3OW7 A;  5I4D A;  1A3U A;  2ZJR A;  1CHP D;  1M1K C;  1XXG A;  1QB5 D;  2KEC A;  1YEZ A;  2ZTC A;  4HMI A;  3CKI B;  1TS2 A;  1BKB A;  1PH9 A;  1K28 A;  1A63 A;  3BYY B;  3TRE A;  4C2M H;  4QUF A;  2F0M A;  4DV3 L;  1SNQ A;  4F87 A;  1XMQ Q;  1UAP A;  1BF4 A;  4A4I A;  3E6Z X;  1WCM B;  4NW2 A;  4DA2 A;  1STG A;  4I7Z C;  1VCI A;  4R4C A;  4PMW A;  4OO1 G;  3H09 A;  1PH6 A;  2F0F A;  3AFP A;  1R4Q B;  2K5H A;  3KDF A;  2E2J B;  3M4O B;  2YU9 B;  2OQ0 A;  4DV4 L;  3Q6S A;  2F52 A;  2FJ2 A;  3NBI A;  4JI6 Q;  1AW7 A;  2HCI A;  2Q2H A;  2K75 A;  2L0C A;  3NEL A;  1BVS A;  2F4I A;  2M00 A;  3KK7 A;  3TQY A;  3G48 A;  4B9W A;  3DUZ A;  3BU2 A;  3HKZ E;  2NZH A;  4GKK Q;  2R6G A;  2LKV A;  2F0O A;  3J81 L;  2QIL A;  5C0X I;  1TWF B;  1F9S A;  3R8B A;  1ICW A;  1ASZ A;  1PVO A;  3GTO H;  3NK9 A;  1G29 1;  2B63 H;  2EXZ A;  4FXK C;  2CWA A;  2Q8I B;  1NJI C;  1CHQ D;  4HED A;  2NVX H;  3TEH B;  1SN8 A;  5K36 G;  3HEJ A;  4QF4 A;  5CV9 A;  2Z1C A;  1PTO B;  1TWA B;  1HNW L;  3J7A V;  1T5E A;  1JCK B;  1F2Z A;  2J4X A;  2QKI C;  2PI2 A;  3BJU A;  3L7Z C;  1L1O B;  1LO5 D;  1ZXT A;  3H0G H;  2F0U A;  4RKL A;  1O80 A;  2CW0 D;  4JOI A;  5M3F B;  1PH2 A;  3A8K E;  4K5V A;  4C3I G;  1XWE A;  4DV7 Q;  1GUG A;  1IKL A;  4R9W A;  4TVA B;  5E4W C;  2Q8T A; 
#chains in the Genus database with same CATH homology
 3HKZ G;  2JA5 G;  2KCT A;  1K3R A;  1VQ9 A;  1WYD A;  5IYC G;  4MNO A;  4TQU S;  4LF5 L;  4LF8 L;  4UP7 A;  3I4O A;  3PCO B;  1IYJ B;  3F1Z A;  1V9P A;  3I2Z A;  2VQE L;  2ES2 A;  1KRS A;  2Q2T A;  3J7Z C;  1YNX A;  5ELN A;  4JI8 Q;  5C0X G;  4A3D H;  3CPF A;  2YV5 A;  1OXU A;  2AWN A;  2N3S A;  3Q8D A;  4X62 L;  1KD1 C;  1HNZ L;  2JQO A;  3UDX A;  1Q81 C;  3FHW A;  1X3F A;  2AWO A;  4WJ4 A;  2E2I H;  3KF6 B;  1L0W A;  4C3J H;  1AE3 A;  3GTQ H;  3HOW H;  2LSS A;  1PH4 A;  2WAQ E;  1VQC A;  4KLK A;  1XPO A;  1EUJ A;  4DK6 C;  2I5H A;  3S17 H;  2CQO A;  2VY3 A;  1JT8 A;  5GAG C;  1OTC A;  3UE1 A;  3I55 A;  1Q12 A;  1XNQ Q;  2E2H H;  2N8N A;  1WCM H;  4X64 L;  2FXQ A;  5FLM G;  1YVC A;  4A3B G;  4YCU A;  4WJ3 M;  4IPG A;  4PZ7 A;  1AE2 A;  3AYH B;  1XNR Q;  3KF6 A;  3HOX G;  4JCV E;  3M4O H;  1N36 L;  1UEB A;  1B7Y B;  3RLO A;  2R93 G;  2VQF L;  3HOV H;  2WB1 E;  4LUV A;  4L5T A;  1JMC A;  1V1Q A;  3S1R H;  4XTC S;  3JAM c;  2JK8 A;  3BZK A;  4K0K L;  4AH6 A;  5M5X H;  2JA9 A;  1YBY A;  4DR4 Q;  1K8G A;  3HOZ G;  4P74 A;  3KDF B;  5C0X J;  1S72 A;  1VQL A;  2B63 G;  5IY0 A;  2UU9 L;  2GVA A;  4DV0 Q;  2NN6 I;  1X9N A;  4A3L G;  1E24 A;  1WI5 A;  3OYY A;  4DUZ L;  4LF5 Q;  4JYA Q;  2JA8 G;  2PQA A;  2RCN A;  1A62 A;  3RR5 A;  2YTY A;  1SFO H;  1JJC B;  3ZJY C;  4A3E H;  4ALP A;  2VZA A;  4EQ5 A;  3HOU H;  3J7A 5;  1EFW A;  1CKO A;  3M3Y H;  3M4P A;  4KI0 A;  4JV5 L;  4DR6 Q;  4DV1 L;  3JC6 6;  5BR8 Q;  3CCQ A;  2IX0 A;  1KHI A;  3E9H A;  4GNX C;  1VQM A;  5M3M H;  2B29 A;  3EBE A;  3EN2 A;  3I4N G;  2WAQ G;  1B8A A;  1X55 A;  2QEX A;  2A1A A;  4BBR H;  4AYB E;  4O0A A;  3J80 c;  4IOC A;  1C7Y A;  1E22 A;  3PGZ A;  2D62 A;  1VS0 A;  1PFS A;  1X6O A;  3GO5 A;  3K8A A;  3NEN A;  4YHH Q;  3H0G G;  2MQH A;  3I7F A;  3W1B A;  4B3M Q;  2E5L L;  4JBJ A;  1IZ6 A;  4RG1 A;  4A3K G;  2F3I A;  1KRT A;  2UUC L;  4A3G G;  3TS2 A;  4HJ9 A;  3CCL A;  4QQB X;  3MEF A;  1V43 A;  2MFI A;  3S16 H;  2AMC B;  4A93 G;  2KCM A;  3U4V A;  3UE0 A;  2UXD L;  2YTX A;  5HGQ A;  2OQK A;  4JI5 L;  1LTL A;  4LF7 L;  4DR1 L;  1PH3 A;  2WB1 G;  1TWA H;  2PMZ E;  1N36 Q;  1K73 C;  3PIO A;  2BA1 A;  5C4X H;  3H15 A;  4GNX A;  2VQF Q;  4YWM A;  1Y1W H;  4BY1 H;  4A3D G;  2UXB L;  1IL2 A;  4Y52 H;  4K0K Q;  1NE3 A;  1VQA A;  4IPC A;  3M85 A;  2UXC L;  2PNH A;  5J3B A;  2CWP A;  4JI1 Q;  4JI3 Q;  5M3F H;  3CD6 A;  3A5Z B;  2NN6 G;  2UU9 Q;  4OWX B;  1N34 L;  3JAM i;  4QGU A;  3K0X A;  4DV3 Q;  1NY4 A;  5JEA G;  4IO9 A;  4A3J H;  3L0O A;  4OWT B;  2JEA I;  4AIM A;  1M90 C;  1VQ8 A;  4DUZ Q;  4UP9 A;  1VQ7 A;  1E1T A;  1YHB A;  1VQH A;  3VDY A;  2VUM H;  4HJ8 A;  5IE8 A;  1FJG L;  1I6H H;  5E7N A;  4J15 A;  1CSP A;  1WCM G;  4OWW B;  4GLX A;  4AYB G;  1VQB A;  4JI7 L;  1EQQ A;  3PUW A;  3RLN A;  4B3S Q;  2D0O A;  2ZM6 Q;  4UP8 A;  4P73 A;  4DR3 L;  4BA1 I;  4JI0 L;  4PG3 A;  3KF8 B;  3OTO L;  4DV4 Q;  4NXM L;  2ATW A;  3HFZ B;  4BA2 I;  1SR3 A;  3HOV G;  1SLJ A;  3PO2 H;  1PH7 A;  5DLQ E;  3PUV A;  3T1H Q;  5GAE C;  4A3M H;  3K7A H;  4PZ6 A;  4YY3 Q;  3GD7 A;  4R4Q A;  3PSI A;  2R7D A;  1LUZ A;  2OTL A;  3U58 A;  3DLL A;  1E7Z A;  4X66 L;  2MO1 A;  5IYB H;  1KIX A;  4DR7 L;  2V1C C;  4JI5 Q;  3S1Q H;  3B6Y A;  4IPH A;  3CCR A;  1MKH A;  3J81 j;  4GOP C;  3W5O A;  1D7Q A;  2NZO A;  4OX9 Q;  1TXY A;  1IBL L;  1VQG A;  3KFU A;  5JEA J;  3HOU G;  5C3E H;  3OW2 A;  2UXC Q;  3UDG A;  3W1G A;  5M3M G;  1O7I A;  4JI4 Q;  3UDF A;  5IYD H;  1VQE A;  4BBR G;  1H95 A;  4DUY L;  2UUA Q;  1Q1B A;  1N34 Q;  1VQF A;  4A3F H;  4QY7 A;  4PZ8 A;  1IBK Q;  2EQS A;  3T1Y L;  1EIY B;  2JJQ A;  4DR5 Q;  3HKS A;  1S3O A;  2D0P A;  3E0E A;  1MJE A;  1JB7 A;  3NBH B;  3FKI H;  5IT9 c;  4JBK A;  1ASY A;  3HOY H;  3CCE A;  5FLX c;  1TWC H;  1PYS B;  2R7Z H;  1N8R C;  1FJG Q;  3GTM H;  1IBM Q;  2HT1 A;  3D31 A;  4NXN L;  4IFD I;  1RIP A;  4LFA Q;  1XMQ L;  3L2P A;  2K52 A;  1HNX L;  4GOP A;  1EWI A;  4BBS G;  5C4X G;  5C4J H;  1N9W A;  1WFQ A;  1HZA A;  2I5M X;  2MO0 A;  1XMO Q;  1SMX A;  1E1O A;  1N32 L;  3K81 C;  3K80 C;  3UDI A;  1NBW A;  2PQA B;  3AFQ A;  4DV5 Q;  1PA6 A;  4DR3 Q;  1HNW Q;  1C9O A;  1KAW A;  1UWV A;  1G51 A;  4AQY Q;  4A3I H;  2E2J H;  4L5S A;  4UY8 C;  4QJF A;  2L15 A;  3SGI A;  1Y1W G;  2GVB A;  4BY1 G;  3U50 C;  2GN5 A;  1X54 A;  1PYB A;  2YU9 H;  1XPU A;  1GM5 A;  1UE1 A;  1YJW A;  4YCW A;  2IHF A;  2EIF A;  1Q8K A;  2HIV A;  1FGU A;  1CKM A;  1X65 A;  2XGT A;  3J81 i;  5M3F G;  1VQ4 A;  1I94 Q;  3FP9 A;  4RMF A;  3RLF A;  1N33 L;  2NVQ H;  3CQZ H;  1Y1V H;  2RHQ B;  4B3R L;  2KHI A;  4DV6 L;  4A3J G;  1YHQ A;  4LF9 L;  3MXN B;  3F2D A;  4LF8 Q;  2VUM G;  3S2H H;  2VQE Q;  1X56 A;  1CUK A;  3STB D;  3G6E A;  4BXX H;  3IRB A;  4MTN A;  1Q1E A;  4HJ5 A;  4FDB A;  4LW1 A;  2JE6 I;  4X62 Q;  1QZH A;  1K8A C;  2A19 A;  4R4T A;  1HNZ Q;  4GKK L;  4IOA A;  1TWF H;  4A75 A;  2JEB I;  1QUQ A;  2OWO A;  4LF4 L;  4DUY Q;  4DR2 L;  4LUZ A;  2JA7 H;  3CCM A;  1J5E L;  3TS0 A;  2IY5 B;  2IT1 A;  4GNX B;  1K9M C;  3RN2 A;  2RF4 A;  1KL9 A;  1HJP A;  3F8T A;  4O2D A;  3PO2 G;  4X65 L;  1MIU A;  3EIV A;  4P72 A;  2UUB L;  2C35 B;  2F4V L;  4JI2 L;  1PV4 A;  1TWH H;  4IFD G;  5C44 H;  4LFC L;  4NXN Q;  1B70 B;  4GN3 B;  4DNI A;  1GD7 A;  4X64 Q;  4A76 A;  4NB3 A;  3S1N H;  2E8G A;  4KHP L;  1NMG A;  2K5N A;  1N32 Q;  1L2F A;  4X6A H;  2KEN A;  3ULJ A;  3DM3 A;  3G4S A;  3CC7 A;  4HID A;  4DAY B;  4LUO A;  1AH9 A;  4R4I A;  3CCS A;  4POG A;  5EAY A;  3TRZ A;  5C3E G;  1QVC A;  3CCU A;  5LMU L;  1UE5 A;  1VQP A;  3CME A;  5IYD G;  1SRU A;  1VQI A;  2QGQ A;  1DGS A;  1QZG A;  4B3R Q;  1OXT A;  2DUD A;  4POF A;  1GKH A;  4HJA A;  4A3F G;  1CKN A;  1HH2 P;  4DV7 L;  5LMN L;  2Y0S E;  4HIO A;  4JG2 A;  3I56 A;  3FKI G;  2JA6 H;  2R7Z G;  2PI2 E;  3PO3 H;  4OON A;  5M5W H;  2ID0 A;  5GAH C;  4LF6 L;  3ICE A;  2XTI A;  1KC8 C;  1VQJ A;  5IP7 H;  1PH1 A;  1OXX K;  2I0Q A;  1G6P A;  4JV5 Q;  4DV1 Q;  4JI8 L;  4A3C H;  4IFD J;  1JJG A;  2NVT H;  4LF4 Q;  2Z6K C;  3S1M H;  4A3I G;  3CW2 C;  4JOI C;  1VQ6 A;  3H3V H;  2E5L Q;  3CF5 A;  3F2C A;  2NVY H;  3J80 i;  2EXD A;  2UUC Q;  1XTD A;  1VQN A;  1Z9F A;  2JA8 H;  1Y14 B;  2N49 A;  2WP8 J;  4IJH A;  1IXR A;  1Y1V G;  4GLA C;  2UXD Q;  4UPA A;  1BBW A;  1P16 A;  2VNU D;  1XNQ L;  5IWA L;  2Q2U A;  3CP0 A;  1FVI A;  1HZB A;  1YIT A;  4Y7N H;  1K0R A;  4LF7 Q;  2WFW A;  4DR1 Q;  4HIM A;  5JJL A;  4DAM A;  3S14 H;  1L1O C;  3S15 H;  4R1J A;  4A3E G;  2HIX A;  2UXB Q;  4GOP B;  1XNR L;  5LMU Q;  3BZC A;  1U0L A;  5GQO A;  2Z6K A;  1CSQ A;  1GO3 E;  1PH8 A;  3K7U C;  4QL5 A;  4DKA C;  2HHH L;  1MJC A;  1LYL A;  2ZJP A;  1YI2 A;  2AHO B;  2Y0S G;  4A3K H;  2JA7 G;  4DR4 L;  1R9T H;  3I4M H;  4A3G H;  2I5L X;  5AJ3 L;  2A8V A;  1GVP A;  5LMN Q;  3RZD H;  2LXK A;  3GTJ H;  2K4K A;  1WJJ A;  2DGY A;  4DV0 L;  1I3Q H;  2KBN A;  3H3V I;  5C44 G;  4R4O A;  4YCV A;  4JYA L;  4LF6 Q;  1HZ9 A;  2CFM A;  1UE6 A;  2VW9 A;  1PH5 A;  2N78 A;  1Q86 C;  1L1O A;  4MZ9 A;  4JI7 Q;  4OXP A;  3KJO A;  1XJV A;  2K50 A;  1FL0 A;  2KHJ A;  2IHE A;  5LMN W;  1X3G A;  4DR6 L;  1XPR A;  4IJL A;  5BR8 L;  3CC2 A;  1C0A A;  4JI0 Q;  1VQD A;  5JJI A;  4LWC A;  1W3S A;  3OTO Q;  4NXM Q;  4OO1 I;  1YHA A;  1YIJ A;  1EIF A;  4NPS A;  1X3E A;  4DV2 L;  3S24 A;  2OTJ A;  4YHH L;  1UE7 A;  4B3M L;  1QUQ B;  1Z47 A;  3CAM A;  3M9B A;  4P75 A;  1HR0 L;  4B3T L;  4JBW A;  4BY7 H;  4JI6 L;  4X66 Q;  4DR7 Q;  4GKJ Q;  4YWL A;  3ER0 A;  5IWA Q;  2OCE A;  3AQQ A;  3AEV A;  3GTG H;  1J6Q A;  3PIP A;  1JJ2 A;  2JA6 G;  3PO3 G;  1IBL Q;  1D8L A;  3PV0 A;  1U5K A;  2ZJR A;  1M1K C;  1Q82 C;  5IP7 G;  4KHZ A;  4GKJ L;  1YEZ A;  2ZTC A;  1VQK A;  2HHH Q;  4A3C G;  4GN5 A;  5FJ8 H;  2VS1 A;  4DPG A;  2RHS B;  1KQS A;  2Q2I A;  1BKB A;  3STB C;  5JJK A;  1PH9 A;  3PUY A;  1QVG A;  4JI1 L;  4JI3 L;  4L5R C;  1YJN A;  1KXL A;  1A63 A;  4C3I H;  3TRE A;  4C2M H;  4JC0 A;  5IP9 H;  5M5Y H;  5AJ3 Q;  3A0J A;  3T1Y Q;  3HOW G;  2CCZ A;  2K14 A;  2R92 H;  1P8L A;  4GLV B;  4DV3 L;  4LFB L;  2JA5 H;  3KLW A;  2BH2 A;  4A3M G;  1BBU A;  1SE8 A;  4GS3 A;  5IYC H;  1Q7Y C;  1XMQ Q;  1HNX Q;  1YJ9 A;  1CKN B;  5IYB G;  4A4I A;  2H5X A;  5GAD C;  3CXC A;  3KOJ A;  1HZC A;  1VCI A;  1I5F A;  4R4C A;  5H1S E;  4PMW A;  3RNU A;  4OO1 G;  1PH6 A;  4B3S L;  3AFP A;  1Q46 A;  2ZM6 L;  2K5H A;  2YTV A;  3KDF A;  4H02 A;  1E3P A;  3U4Z A;  3CC4 A;  4DV2 Q;  1SRO A;  2OQ0 A;  4DV4 L;  1W2B A;  4LNQ A;  2B3G A;  4IPD A;  2F52 A;  1N33 Q;  4L5Q A;  3GDE A;  3GTK H;  3PF4 A;  2ALY B;  1HR0 Q;  4B3T Q;  3T1H L;  3E9I A;  2IX1 A;  2Z0S A;  4JI6 Q;  2BA0 A;  4YY3 L;  1YZ6 A;  3RN5 A;  3I4M G;  1OXV A;  4DV6 Q;  4LF9 Q;  3RZO H;  5GRO A;  1JE5 A;  4GN4 B;  2Q2H A;  4BBS H;  3HOY G;  5FLM H;  1T9H A;  2K75 A;  3CCJ A;  3NEL A;  1BVS A;  4EX5 A;  3ULL A;  3TQY A;  4A3B H;  3G48 A;  3M7N A;  1S40 A;  3BU2 A;  1VQO A;  4OX9 L;  2LXJ A;  1K83 H;  1OXS C;  3HKZ E;  4APV A;  4DK3 C;  2NZH A;  2VL6 A;  3HOX H;  2ZTE A;  3CMA A;  2R6G A;  3PF5 A;  1HR0 W;  4GKK Q;  3PUZ A;  2R93 H;  3GTL H;  5ELO A;  3KYH C;  4P71 A;  4LFB Q;  3ERS X;  1NTG A;  5C0X I;  4DR2 Q;  2R7F A;  3NEM A;  1J5E Q;  1EOV A;  1ASZ A;  4JI4 L;  3GTO H;  1PVO A;  3HOZ H;  1G29 1;  2B63 H;  2UUA L;  4X65 Q;  2UUB Q;  2CKZ B;  2CWA A;  4C3H H;  1IBK L;  4ME3 A;  2F4V Q;  3A74 A;  4JI2 Q;  4DR5 L;  1NJI C;  4A3L H;  2NVX H;  4LFC Q;  3GTP H;  1RL2 A;  4HIK A;  1LM0 A;  3CPW A;  4XIG S;  3TEH B;  4BY7 G;  1IBM L;  1I50 H;  2YYZ A;  4KHP Q;  2BH8 A;  1EYG A;  2ZJQ A;  3CCV A;  4LFA L;  1SN8 A;  2AKW B;  3LGJ A;  3WWV A;  1WOC A;  1XMO L;  1QVF A;  5K36 G;  2K5V A;  3F2B A;  4BXX G;  4DV5 L;  3I4N H;  1HNW L;  2ZTD A;  3KJP A;  3J81 c;  2HQL A;  4AQY L;  1EQR A;  2PI2 A;  3BJU A;  1NMF A;  3L7Z C;  4QIW E;  1L1O B;  3ULP A;  1A0I A;  2ASB A;  3H0G H;  1A8V A;  5FJ8 G;  2MNA A;  1VQ5 A;  4JBM A;  3S2D H;  3M4Q A;  1PH2 A;  4JOI A;  1I94 L;  4HJ7 A;  5IP9 G;  4DV7 Q;  2QA4 A;  4TVA B;  5HY6 A;  4YWK A;  1PHJ A;  3PUX A;  3A5U A;  4A93 H;  2R92 G;  3D0F A;  1TWG H;  3G71 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...