2PQAB

Crystal structure of full-length human rpa 14/32 heterodimer
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
114
structure length
114
Chain Sequence
DMMDLPRSRINAGMLAQFIDKPVCFVGRLEKIHPTGKMFILSDGEGKNGTIELMEPLDEEISGIVEVVGRVTAKATILCTSYVQFKEDSHPFDLGLYNEAVKIIHDFPQFYPLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Replication
molecule keywords Replication protein A 32 kDa subunit
publication title Structure of the full-length human RPA14/32 complex gives insights into the mechanism of DNA binding and complex formation.
pubmed doi rcsb
source organism Homo sapiens
total genus 25
structure length 114
sequence length 114
chains with identical sequence D
ec nomenclature
pdb deposition date 2007-05-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF08661 Rep_fac-A_3 Replication factor A protein 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2pqaB00
4B3TQ 2AWNA 2K5VA 1YITA 3UDGA 1NE3A 3PF4A 1PH5A 3CCUA 1TWHH 1G51A 5IYCH 4GOPC 1RIPA 4LFAL 2HIVA 1K9MC 4A3GG 1JT8A 1X9NA 1HR0W 2CWAA 4GN4B 3U4VA 4A3MG 2R7ZH 3A0JA 3ER0A 4AYBG 4KLKA 2YU9H 3S14H 5M5XH 3LGJA 4UP7A 1TWFH 2Y0SG 3L7ZC 4A3KG 2MFIA 4B3SQ 5LMNQ 2WFWA 2VQEQ 1K8AC 2UUAL 1FVIA 3J80i 3T1YL 1BBWA 4BY1G 4GN3B 3CCJA 3PUYA 2PQAA 5HY6A 4JI3Q 2IHFA 3ULJA 2UUBL 2ALYB 4DR1Q 1VQDA 3GO5A 5ELNA 1QVFA 4A3DH 3CW2C 3MXNB 3I4MG 2A1AA 5IT9c 4BY7H 3I56A 4TQUS 4IOAA 1HZCA 4A75A 4JC0A 3G6EA 3S2DH 1TWCH 4MNOA 4LFAQ 3I7FA 3K7UC 2Z6KC 4TVAB 4JI8L 1I94Q 4A3EH 4BXXG 1M1KC 1GM5A 1WI5A 3I4OA 4C2MH 1K73C 4DK6C 4GKJL 4R4TA 5JEAJ 1WCMH 1X56A 4LF5L 4JBMA 1Q1BA 4X64L 3S15H 2UUAQ 4UP8A 5C3EG 3T1YQ 2CQOA 1B70B 3TEHB 2NN6G 4LW1A 1UE7A 1CUKA 4K0KL 2UUBQ 1S40A 4BBRH 5C0XI 1HH2P 3UDXA 4PMWA 1KRTA 1K83H 4OWXB 5IP7G 4DV7L 1Q46A 1W2BA 4YWLA 1B8AA 2R7DA 2VY3A 4JI8Q 2CKZB 1PA6A 3EIVA 2JA5G 3CPFA 1I3QH 3H0GG 4YWMA 4DR2L 3CC4A 3KFUA 3GTLH 2Z0SA 1AE2A 1XNRQ 2Y0SE 3PUWA 1CSQA 4JG2A 1J5EL 2R6GA 4JI1L 4LF5Q 3EBEA 4X64Q 2DGYA 1DGSA 3GTJH 1J6QA 1IXRA 4ME3A 1G6PA 3E0EA 2BH2A 4K0KQ 3HFZB 5M3FH 1PH6A 2IY5B 2C35B 4QL5A 4DV7Q 1XMQL 2K4KA 1HNZL 5IWAL 3DLLA 4RG1A 5IYBG 1KD1C 2XTIA 1V43A 1MKHA 1VQEA 3UE1A 1MJEA 4DV3L 1Q1EA 1R9TH 3UDFA 1IBKL 3W1BA 4A3JH 1KAWA 1Q8KA 4P74A 3BU2A 1K0RA 4DR2Q 3W5OA 3HOYH 1WOCA 1UWVA 4HJAA 4OO1I 1NBWA 2N78A 4AQYL 2K52A 1J5EQ 4B3SL 1GD7A 4HIMA 4JI1Q 4DAYB 4L5RC 3PF5A 3NENA 5AJ3L 3S1RH 2E5LQ 4JI6L 3GTMH 1OXXK 1A8VA 2BA0A 4PZ7A 2JA9A 3T1HL 1Q12A 1LYLA 1L0WA 1L1OB 3CMEA 2D0OA 1YJWA 4QIWE 3F2BA 2Q2UA 4IO9A 2HT1A 4YY3Q 1XMQQ 4JYAL 1O7IA 1BVSA 2VQFL 2NN6I 4IJHA 4DUYL 1JJGA 2ZTEA 3M7NA 3HOZH 2AMCB 4DV3Q 1EQRA 1VQ4A 1IBKQ 4BBSH 4DR7L 1VQAA 3PUVA 3RLFA 1VQ5A 3GTGH 3KYHC 1SRUA 4JBWA 4YCVA 5GQOA 2MNAA 1VQMA 4NXML 2VUMG 3M4OH 1XPUA 1KHIA 4B3TL 3FKIG 5FLMG 4AQYQ 1X55A 5M5YH 3CCQA 1SROA 4UP9A 3HOXG 5AJ3Q 1PHJA 1KL9A 4JI6Q 3K8AA 3CF5A 1YEZA 2RF4A 1FL0A 3OYYA 3GTPH 1H95A 3JAMc 5C44G 1Z9FA 3L2PA 2IT1A 3G4SA 1L1OC 4A3LG 1PH3A 1XPOA 1HNXL 5IYDG 3AEVA 1VQJA 2MO0A 3I2ZA 2LXJA 4LUOA 4AH6A 4LF6L 4JYAQ 2VQFQ 2QEXA 3H3VI 5C0XG 2K75A 4DUYQ 1TWGH 1GVPA 2VQEL 2ZJRA 5LMNL 3CC7A 3F8TA 4YWKA 1JB7A 1NMFA 1TWAH 2I5HA 4DR7Q 4DR5L 4A3GH 1N9WA 4PZ6A 2YYZA 3S2HH 2R7FA 1JJ2A 4A3MH 2PI2A 4OONA 4GNXA 1YJ9A 2B63G 3KLWA 1EYGA 3HKSA 2R92G 3CCMA 4A3KH 4OWWB 3UE0A 1U0LA 1I94L 3I4NG 4JBJA 2PQAB 1OXUA 4BY1H 3J80c 1Y14B 3M9BA 1YI2A 1VQHA 1Y1VG 1HNXQ 5JEAG 2OTJA 4LF6Q 1GO3E 2MO1A 1PV4A 3D0FA 3I4MH 1C0AA 5JJLA 4IFDJ 2B3GA 3STBC 5EAYA 1ASYA 2JA8G 2VW9A 4JV5L 4B3RL 4DR5Q 1N8RC 4BXXH 1VQOA 1FJGL 3HOWG 1XJVA 3MEFA 4WJ3M 2R93G 4Y52H 1WJJA 4L5TA 4DV0Q 3K0XA 3J7A5 2FXQA 3TRZA 4JOIA 4JCVE 1UE6A 4LUVA 1E3PA 2EXDA 4HJ5A 1IL2A 4OO1G 2UXCL 2L15A 5C3EH 2ZTDA 2CCZA 2NZHA 3KOJA 4YHHL 2ZM6Q 4L5QA 1KC8C 2ZJQA 4L5SA 1EUJA 3GTKH 1OXVA 2BA1A 2ASBA 3G48A 5IP7H 3J81c 3RNUA 4R1JA 1VQCA 4MZ9A 4YCUA 4DK3C 4J15A 4JV5Q 4B3RQ 5GROA 4KHZA 1QUQA 1FJGQ 4LWCA 4DR6L 2JA5H 3H0GH 4R4QA 1BKBA 4POFA 2K50A 5GAHC 2DUDA 4UPAA 5JJKA 3AFPA 3KF6A 4HJ9A 2JA6G 2UXCQ 4A3CG 2CWPA 2NZOA 4YHHQ 5GADC 4DV4L 2OQKA 1W3SA 4GLAC 1PYBA 1S72A 2UXBL 2HQLA 3HOVG 1VQBA 2E5LL 1P8LA 5IYBH 1E1OA 3BZKA 2IX1A 1Q7YC 3HOUG 4DR6Q 3E9HA 3Q8DA 1AE3A 2HHHQ 4JI4L 4JI7L 2KENA 3ICEA 3KDFA 3M85A 4YY3L 1S3OA 4DR4L 5LMNW 4DV5L 2WAQG 2IX0A 4A3FG 1EIYB 1VQKA 1LM0A 4BA2I 4XIGS 5K36G 2JA7G 2ZTCA 4HIKA 4EQ5A 3GD7A 5GAEC 5FJ8G 1HR0L 5J3BA 4JI2L 1VQ9A 4DV4Q 4OX9L 4GKKL 2CFMA 1AH9A 1X6OA 1K8GA 2UXBQ 3H15A 1IBLL 2LXKA 1P16A 2E2HH 3F2DA 3RZDH 1FGUA 2JE6I 4YCWA 3S1NH 3EN2A 4DV2Q 2NVYH 5HGQA 4DV1L 3U4ZA 4JI4Q 5H1SE 4JI7Q 4QGUA 2E8GA 2Q2TA 4EX5A 2VUMH 1A63A 3RLOA 4LF4L 4MTNA 3FKIH 5FLMH 3CP0A 5BR8L 3PIOA 1JJCB 4DV5Q 3CD6A 3S16H 4X62L 4A3IG 4DR4Q 1BBUA 3HOXH 4KHPL 4HJ7A 2UU9L 1PVOA 3A5UA 3SGIA 2N49A 1HR0Q 1E22A 1K3RA 1A0IA 1SMXA 4JI2Q 4JI5L 2QA4A 3PGZA 5C44H 2OWOA 4OX9Q 4GKKQ 4A3LH 1D8LA 1IBLQ 5IYDH 1XPRA 2LSSA 1MIUA 2OQ0A 2WP8J 3M4PA 4HIOA 2ZJPA 4A3BG 3GDEA 3FHWA 1PFSA 1CKOA 4DV1Q 1N33Q 5ELOA 5C4JH 3U50C 1N34Q 4DAMA 3TS0A 2K5NA 4GNXB 4LF8L 1QVCA 2KBNA 2E2IH 4LF4Q 2WAQE 4LNQA 3BJUA 2JQOA 5BR8Q 1Z47A 3CCSA 2WB1G 2B63H 4X62Q 4FDBA 4KHPQ 1OTCA 2UU9Q 3TQYA 1Q81C 2R92H 5IP9G 3F2CA 1HNWQ 3CCLA 1G291 5GAGC 4IPGA 4JI5Q 3I4NH 2AWOA 2YV5A 2VL6A 4A93G 4DV0L 1Y1VH 4Y7NH 2AHOB 5E7NA 2UUCL 5C4XG 2QGQA 1VCIA 2KHJA 3VDYA 3S1QH 1EQQA 3S24A 4GS3A 4LFCQ 2JA8H 1VQIA 1IBML 1OXSC 4LF9L 1CKNA 1T9HA 1Y1WG 3NBHB 5LMUL 3HOWH 2ZM6L 4NXNL 5M3MG 4JI0L 1IYJB 2EQSA 3S17H 4GOPA 1NJIC 4GNXC 4GLXA 3JAMi 2R93H 3ULPA 3CC2A 2NVTH 2VNUD 2GVAA 4DKAC 1PH7A 1B7YB 3CMAA 1XNQL 4JBKA 3ZJYC 5JJIA 4P72A 2YTXA 1SFOH 2AKWB 4C3JH 3GTQH 3PO2G 3W1GA 4X66L 3AFQA 4LF7Q 1YNXA 4H02A 4GN5A 1UE5A 1I5FA 4R4OA 3PO3G 2UUCQ 3G71A 4LUZA 3ERSX 1E24A 2RCNA 3CXCA 3JC66 1IBMQ 1QUQB 4DV6L 4LF9Q 3K7AH 1EFWA 4UY8C 2NVQH 3M3YH 5LMUQ 2I5LX 1NTGA 2F4VQ 4NXNQ 3TREA 2OCEA 4JI0Q 1VQ8A 1VQ6A 3NELA 2ATWA 2WB1E 5IYCG 3AQQA 1C7YA 4JOIC 1CSPA 1V9PA 4P73A 3KF6B 2Z6KA 5C0XJ 3PIPA 1XNQQ 2R7ZG 2JA6H 1QZGA 4LF8Q 4X6AH 4AIMA 4IFDI 4A3CH 3IRBA 3RN5A 1KXLA 2HHHL 4X66Q 1C9OA 1X54A 5M5WH 3RR5A 2Q2IA 2N8NA 2JEAI 3OW2A 2K14A 1HZBA 3HOVH 2F3IA 2N3SA 3S1MH 2UXDL 1NMGA 4ALPA 3PSIA 4DV6Q 3NEMA 4OXPA 1YZ6A 1PYSB 3H3VH 2JJQA 3HOUH 4A3DG 3KDFB 1SLJA 2OTLA 5IY0A 1I6HH 4BY7G 1LTLA 4O2DA 1X3EA 2NVXH 1X3FA 2KCMA 4QQBX 2VZAA 3PV0A 4PZ8A 2GVBA 4A3EG 1SR3A 4O0AA 3HKZE 4A3FH 3UDIA 5IE8A 3A74A 4GLVB 2JA7H 5FLXc 4DV2L 2H5XA 3J81i 2KCTA 1Q86C 5FJ8H 4DR3L 1YHBA 1VQ7A 1YHQA 3PUXA 1VQLA 1XNRL 4P75A 1EOVA 1WCMG 4BA1I 1I50H 3FP9A 1IZ6A 4POGA 3RN2A 3STBD 5DLQE 1TXYA 4R4CA 1N32L 2JK8A 2RHSB 2GN5A 3E9IA 1WFQA 1RL2A 1HZ9A 4C3HH 2UXDQ 4AYBE 1HZAA 2XGTA 4BBRG 3OTOL 1PH8A 4IPHA 4QY7A 3CQZH 2D0PA 3J81j 4GKJQ 2YTVA 3AYHB 4LFBL 2Q2HA 4P71A 2ID0A 4A3IH 1A62A 1V1QA 4A4IA 4R4IA 1KQSA 1SN8A 1X3GA 4DR3Q 1OXTA 1YBYA 3F1ZA 1N34L 1N33L 1GKHA 1EIFA 1KRSA 1X65A 3BZCA 4IJLA 4IPDA 3M4QA 4OWTB 3J7ZC 1UE1A 4IOCA 1E7ZA 1YIJA 1XMOL 2VS1A 1N32Q 1PH1A 4A3BH 1HNWL 1YVCA 5M3FG 1UEBA 3A5ZB 2D62A 3OTOQ 3L0OA 3PCOB 3KJOA 1VQPA 2RHQB 1CKMA 4HJ8A 4DUZL 1PH4A 4APVA 2KHIA 1VQGA 4LFBQ 4X65L 4WJ4A 4A3JG 3K80C 4DPGA 4LFCL 1VS0A 2JEBI 3CCVA 4IPCA 4A76A 1N36L 5IP9H 1ASZA 3HOYG 4NB3A 4QJFA 3CAMA 2ES2A 1Q82C 1YJNA 1HNZQ 5IWAQ 1XMOQ 1JE5A 4IFDG 4XTCS 4A93H 2E2JH 3CCRA 3RZOH 5C4XH 2EIFA 4NPSA 4B3ML 1CKNB 1U5KA 2I5MX 1L2FA 1L1OA 2MQHA 4PG3A 2PNHA 3I55A 1Y1WH 2B29A 3D31A 1NY4A 3K81C 4KI0A 3ULLA 3PUZA 1EWIA 5M3MH 4DUZQ 3CCEA 4GOPB 1LUZA 3HOZG 4LF7L 4BBSG 4X65Q 2A19A 3CPWA 1M90C 3U58A 2F52A 3T1HQ 1MJCA 1VQFA 3RLNA 1N36Q 2V1CC 2YTYA 3B6YA 4HIDA 3GTOH 2HIXA 1VQNA 2A8VA 3PO2H 4DNIA 2F4VL 1D7QA 1E1TA 1HJPA 1XTDA 2I0QA 2BH8A 4RMFA 3TS2A 4C3IH 1QVGA 3PO3H 1PH2A 3KJPA 3KF8B 3DM3A 2IHEA 4B3MQ 2PMZE 1JMCA 1WYDA 1PH9A 1YHAA 1KIXA 4NXMQ 1SE8A 3HKZG 3WWVA 2PI2E 2K5HA 4JI3L 1QZHA 4DR1L
chains in the Genus database with same CATH superfamily
3UDGA 1PH5A 3CCUA 2WV6D 1XX8A 1XYIA 1X9NA 1Q8IA 5C4JB 1W6KA 3U4VA 2R7ZH 2BCOA 1F2LA 1UNSA 3NWSA 4KLKA 5JAVA 3S14H 3I4LA 1UEAB 1ML0D 1LT3D 2Q8RE 2K03A 2UUAL 1G6ZA 1TWAB 3T1YL 3I4NB 5CV5A 2PQAA 3NBIA 4DR1Q 1Y8OB 2BE5D 5ELNA 4Y7NB 3MXNB 3I56A 1HZCA 3S2DH 4ZUIA 1TWCH 3I7FA 4BXXG 4EQNA 3Q6SA 1WI5A 2EY2A 1SNPA 2KOLA 2R93B 2F0QA 3CRKC 2CH4W 4JBMA 4X64L 4V0BA 4UP8A 1LTSD 5FO7B 5CV9A 3NXWA 1H9RA 1HH2P 1EWCA 1LO5D 1K83H 4OWXB 1ICWA 2R7DA 2VB3X 5BN3A 2CKZB 1EY8A 4K2KA 2F0PA 3H0GG 4ME5A 1NNXA 2K5QA 4YWMA 3KFUA 2Z0SA 1CQVA 1O80A 1S5BD 1A15A 4QIWB 1ESRA 4EVOA 1J6QA 2JA5B 3AU7A 4C56C 3HOVB 1NCVA 1KD1C 2XTIA 3S1MB 1VQEA 1R9TH 1Q1EA 3UDFA 4A3JH 3SXHA 2RSNA 4BWGB 1JB3A 1UWVA 3P7JA 1J5EQ 4HIMA 1U9RA 2A73B 4DAYB 4C3HG 2E5LQ 4A3FB 4IFDH 5EPJA 1OXXK 4CDDC 4F88A 1Q12A 3OOCA 4YY3Q 3PIP3 1WTQA 4XQJA 1SYCA 3HOZH 4DV3Q 3D6WA 5C3WA 1VQ5A 3KYHC 4JBWA 1VQMA 5GQOA 2MNAA 1BOSA 2VUMG 3NTKA 1K3BC 1KHIA 4B3TL 4MIUA 4A3IB 1KL9A 5DEHA 1YEZA 1B4OA 1E2WA 1SYEA 1A3VA 4J6HA 3FPUB 2BE5C 1HNXL 3AEVA 4LK1C 4AH6A 4JYAQ 2A68D 2VQFQ 2R61A 4FF4A 5C0XG 4A3BB 1GVPA 3F8TA 5FLXE 1TWAH 2IWHA 4A3GH 1U4MA 2LS01 3I73A 3A7LA 4OONA 3L9AX 1G8ZD 3CCMA 3I72A 3UE0A 3Q0AA 1EZ6A 1PZID 5G3LF 3J80c 1Y14B 3M9BA 5A2QE 1YI2A 1Y1VG 2Z8LA 3TBIB 4LF6Q 1GO3E 3C1EA 1U4LA 5C4XB 2ICIA 2R92B 3SK5A 2HD3A 1QG7A 1EZ8A 5CC4A 4DR5Q 1FJGL 2KA7A 2K32A 1XJVA 1Y1WB 3NBHA 1STYA 4L5TA 4Y52H 4DV0Q 3J7A5 3SVMA 4JOIA 4JCVE 1E3PA 2EXDA 4HJ5A 1IL2A 2L15A 1SNQA 3GTOB 5C3EH 1JR0D 4KY7A 3PO2B 3V2TA 2ZM6Q 3BG3A 1EUJA 2ASBA 5IP7H 4OELB 4R1JA 4YCUA 4DK3C 1BUVT 3H94A 2F0SA 5GROA 1QUQA 2JA5H 1TWHB 1DD2A 3OIPA 4IUQA 1DXMA 4CJ0B 4G7HC 3HZXA 2DUDA 4HJ9A 2EYPA 1W6JA 4ABNA 3K5LA 4YHHQ 4DV4L 2OQKA 1TWFB 4KV6A 4RGMA 1KTKA 1P8LA 5IYBH 5EBDA 2J7ZA 2SEBD 4FVMA 2JXMB 1SE4A 2F0MA 4JI4L 4JI7L 1A2UA 1SYBA 1TS2A 3M85A 3A54A 1YNND 2VB2X 5LMNW 4DV5L 1LM0A 4XIGS 4EQ5A 2N55A 1Y69U 5J3BA 1I6HB 2F0KA 3H15A 1IBLL 2A68C 3S15B 1FGUA 3ND9A 5I9PA 3S1NH 2F0LA 3Q23A 5HGQA 4QGUA 1L0YB 3T56B 1A63A 4ZAIA 3RLOA 4MTNA 3FKIH 3S16H 4X62L 1TKWB 1K28A 1YNJD 3CQZB 5C44H 5IT9E 2F0HA 5IYDH 2OQ0A 4HIOA 5AFWA 2ZJPA 2FINB 1J8IA 1SNCA 2EY6A 4DV1Q 2M2LA 2B2UA 3U50C 5C4HA 3VYTA 3TS0A 4LF8L 1GUNA 1ZYRD 2WAQE 3BJUA 2JQOA 3FVQA 4LNQA 3CCSA 2WB1G 1CM9A 1R4QB 2R92H 3TQYA 1HNWQ 3F2CA 3CCLA 3HOYB 2BDOA 1V8QA 2YV5A 2VL6A 3GTMB 2UUCL 3FRPB 4RGTA 3MVVA 1VMCA 3OW7A 3S24A 2JA8H 1VQIA 3DM1A 2AUKA 2SDFA 2CW0D 4WJWA 4NXNL 5M3MG 5IGGA 1IYJB 4GOPA 2QEJC 2PZTA 2NVTH 3LWUA 3CMAA 4X3SA 3GTQH 3J80L 1HUMA 4X66L 4XDXA 1YNXA 5EQ0A 4H02A 4C3IG 2F0OA 4J1MA 1HHVA 3GTPB 3JC66 1IBMQ 2F0IA 5DM73 4ZKCB 3M3YH 5LMUQ 2I5LX 2OCEA 1VQ8A 2NYZD 2ATWA 1YNNC 3AQQA 2KUMA 4ZKBB 1CSPA 3KF6B 2JYOA 1JOQA 2VXWA 2R7ZG 2TSSA 5EKLA 4A3MB 4LF8Q 4AIMA 4A3CH 1TU2B 3MFGA 1SBBB 3U9OA 1Q3LA 3GP7A 1EIGA 3OW2A 1HZBA 2B8GA 2F3IA 1NMGA 3PSIA 1GHKA 1WTVA 4DV6Q 3NEMA 4BY1B 1BO0A 1PYSB 2JJQA 2FFKB 1I6HH 4FNFA 3MXNA 1X3FA 2E75C 4QQBX 2A6HD 3E3XA 2F4IA 1JC7A 1YNJC 2H5XA 2K6AA 5FJ8H 1H9MA 3H91A 3A56A 1XNRL 4P75A 1EOVA 2L9HA 1IZ6A 3RN2A 1WTXA 3STBD 1TXYA 1N32L 2NTSA 3E9IA 4C3HH 4FO2A 1RL2A 2UXDQ 1RTOA 4AYBE 3A7AB 3CQZH 3GTKB 2D0PA 3E6ZX 2DNEA 4XT1B 1G2SA 1ZYRC 4OGQC 4LFBL 5CMDA 1PLFA 2ID0A 5L37A 4A4IA 1SN8A 3DUZA 4IUTA 4DR3Q 1EQTA 3F1ZA 5LL6S 4LMQD 3J7ZC 1UE1A 1LT6D 1A3UA 5D3IB 1ILQA 3F2UA 1YVCA 3GTLB 3OTOQ 2CW0C 1AZQA 3EQLC 3KJOA 2NBFA 4HJ8A 1PFBA 1EL0A 4U68A 5KGUA 2Z4HA 4A3JG 5JVH3 2HCIA 4LFCL 4R8IA 4IPCA 3VA7A 4A76A 5ELEA 4NB3A 3SHLA 1YJNA 1XMOQ 1ET6A 1NUCA 4IFDG 4DAYA 3CCRA 4NPSA 4PG3A 1PZKD 2F3VA 2B29A 3D31A 2ZXRA 3K81C 5I2XA 3D4WA 3PUZA 5TSSA 3HOZG 3CPWA 5LHY1 2F52A 3U58A 1MJCA 2NVYB 3S9WA 4S3SA 2YTYA 3J7AF 4N8X1 2A6ED 1S5DD 2D9UA 1ENFA 1EU3A 2PZUA 4QCLA 1LTID 4RMFA 1JWSD 3TS2A 4DNTB 3PO3H 3KJPA 4DU9A 2IHEA 2PMZE 4JVZA 5JPMC 1QZHA 3NHHA 2X6GA 2K5VA 4B3TQ 1WD0A 1NE3A 2A6HC 4FP5D 1RIPA 2DY8A 4LFAL 2HIVA 4A3GG 1CFMA 1JT8A 1HR0W 2A69C 4GN4B 3A0JA 1F2YA 3ER0A 4AYBG 2YU9H 3P75A 4KTAA 4UP7A 4NW2A 2B2WC 3SK4A 2R3ZA 1CA5A 3RMHA 1BBWA 5IGBA 4GN3B 1B53A 2G9HD 2IHFA 2UUBL 4A3DH 3GO5A 2F0DA 2Y0SB 1EY6A 3V05A 3QOJA 4MNOA 4JI8L 1GUGA 3HOWB 2IW3A 4DK6C 3S17B 4TSSA 1MD2D 1PZJD 4R4TA 1Y8NB 1WCMH 4K8JA 5C3EG 2JSOA 1UE7A 4K2LA 4K0KL 1D6EC 4KJNA 1S40A 4BBRH 2B2TA 3UDXA 4PMWA 5IP7G 3HS0C 1W2BA 1Q46A 1SAPA 5JPNC 3KLRA 4K5WA 2X6LA 1PA6A 4HMJA 4DXGA 4L6TB 2JA5G 3DEOA 4DR2L 3GTLH 2MHVA 5T1GA 1AE2A 3NUCA 2R6GA 4LF5Q 3EBEA 3RUZA 4RAUC 4EGVA 1DGSA 3E0EA 2BH2A 3DWQA 3HFZB 4DAPA 5M3FH 2IY5B 1PTOD 3LX0A 1WVLA 4DV7Q 1XMQL 1DCZA 1H9KA 3OWFA 4RG1A 5IYBG 1EEFD 1V43A 1MKHA 2QF7A 1F9QA 1MJEA 4R9WA 1JQYD 3T51B 3W1BA 1KAWA 3HOUB 5CV6A 3NPPA 3BU2A 1K0RA 2A6EC 4HJAA 5I6WA 1NBWA 4B3SL 1CHPD 1CK1A 3QG1A 4JI1Q 4DA2A 4L5RC 2WAQB 3NENA 5AJ3L 1A2TA 3S1RH 5IODA 4JI6L 4RCNA 2JA7B 2JA9A 1LYLA 3CMEA 1X3QA 1DM0B 2Q2UA 4IO9A 2HT1A 2E2DC 3PQIA 4IUNA 1B2TA 2K04A 1VQ4A 1HTPA 1IBKQ 4DR7L 1B44D 2QDBA 3GTGH 4YCVA 1SRUA 3H3VC 3SE0A 1JICA 3M4OH 1XPUA 3FKIG 2Z6BA 4AQYQ 3IFDA 1X55A 1BR9A 3CCQA 5EJWA 3K8AA 3MA2B 1FL0A 4MHEA 5C44G 5D14A 1Z9FA 3L2PA 1SYDA 1XPOA 5IYDG 2MO0A 2LXJA 5LL6X 2K75A 4DUYQ 2ZJRA 1QB5D 2DY7A 3KBGA 2VQEL 3OSOA 4YWKA 3JAML 1NMFA 3CC7A 2I5HA 4DAVA 2HQEA 1L0XB 1F2ZA 4I7AA 1JJ2A 2RDFA 2XSCA 5I2YA 1D1KA 1EYGA 2R92G 1AW7A 2SNMA 4A3KH 4OWWB 1ZKOA 1U0LA 5E3FA 2H1EA 2F0JA 1SDFA 2E2IB 4GZYC 2OTJA 3I4MH 1PFMA 2PYKA 2B3GA 2JA8G 2VW9A 4WRDA 3RD4A 2D2CC 2RSOA 1ILPA 3DMUA 1KABA 2CH4A 2NN6H 4RKBA 3P1HA 4L5SA 1PTOC 1XXGA 3G48A 4HCEA 2OF1A 4MZ9A 2HUGA 1IYUA 1ICFB 4K8IA 4ODGA 2B39A 4JV5Q 4B3RQ 2XRQD 4DR6L 4LWCA 4O42A 4F8MA 1HXYD 2O5JC 3D3RA 3J81L 1VF5C 2KJXA 5JJKA 3AFPA 3KF6A 2UXCQ 1ESFA 1IYVA 5J1ZA 4A3CG 2NZOA 5GADC 1W3SA 3R2TA 2EYFA 4RCOA 1CHQD 1TS4A 1VQBA 4TKOB 4RA8A 1GUOA 4ID6A 2JA6B 1E1OA 3FEWX 3CKIB 2FMMA 3CHBD 3VR4A 3Q8DA 3E5SA 5IGEA 2G9DA 4CKBA 3ICEA 1GXDC 1IW7D 1S3OA 4BA2I 5EGTA 4A3EB 2RBMA 1HR0L 5FJ8G 4JI2L 3DWAA 2KVMA 2K01A 3L3OC 3IKJA 3NQTA 1K8GA 1QNUA 2UXBQ 2PNRC 5EPKA 2LXKA 1P16A 4IN3A 3F2DA 2JE6I 2OEOA 4FYDA 3U4ZA 5H1SE 2E8GA 2Q8TA 4JK1C 1X32A 4LF4L 5FLMH 3BS1A 1MI2A 4DR4Q 1JJCB 3HOXH 1PVOA 1BCPD 4HJ7A 2UU9L 1I3QB 3SGIA 2N49A 1E22A 2F0EA 1UAPA 2OWOA 5CBAE 3PGZA 4OEMB 4OX9Q 4GKKQ 1JCKB 3M4PA 2WP8J 1FNUA 3GTJB 4H13C 1HUNA 3FHWA 1JOKA 2PMZB 5ELOA 5C4JH 1D5XC 5IOCA 2AUJD 2K5NA 2E2IH 2EJGC 3CRLC 5BR8Q 5FO8B 3Q24A 1OTCA 4KHPQ 2F0UA 5GAGC 4M8AA 4QF4A 4JI5Q 3I4NH 2EYHA 4DF7A 1CT1D 4Y7NH 4I65A 5EBCA 2QGQA 4B9WA 1EQQA 4LFCQ 1BQQT 5COYA 1DOLA 1TQOA 1JOOA 2ZT9C 3TP7A 4LF9L 4QUFA 3FPPA 3BDOA 4MN3A 2EQSA 2R93H 4GNXC 4GLXA 4CKCA 4BBSB 1JE4A 1TS5A 3C2PA 1B7YB 4RWSC 4JBKA 3ZJYC 3V96A 1CTMA 2AKWB 5I6YA 2PO4A 1K0SA 2AQ3B 5KIXA 3WOEA 4GN5A 1I5FA 4RHSA 3PO3G 3G71A 4LUZA 3ERSX 1E24A 3LNNA 2SNSA 1S4ZA 4HSVA 1Y8PB 1EFWA 4UY8C 3DWPA 3TMEA 3C3LA 1NTGA 4JI0Q 1VQ6A 3NELA 1IW7C 2WB1E 5C4ZA 1C7YA 4QUCA 1JWMD 1V9PA 3W2DA 1XNQQ 2SOBA 2Q8IB 2JA6H 3S2HB 2BOSA 3IRBA 3PIO3 1KXLA 2HHHL 1X54A 2FHTA 3RR5A 2Q2IA 4NMZA 2JEAI 1IKLA 4EQOA 2K14A 4K6LA 3HOVH 2PW5A 3S1MH 1EWHA 2PW7A 4A3DG 1PXUA 1FR3A 4CKEA 4DK1A 1XWEA 4XT3B 4O2DA 1DJRD 2VZAA 4KD3A 2GVBA 1BCPC 1SR3A 3HKZE 4O0AA 4A3FH 4Q5VA 2KECA 5K36H 4QMGA 4L63B 5FLXc 3G7LA 2G5DA 4DV2L 1YHBA 1QILA 4BA1I 1WCMG 3FP9A 4FF2A 4V190 5BN5A 2EYMA 2WACA 3NE5B 2JK8A 2RHSB 1WFQA 4ZYSA 4BBRG 1IHZA 4IPHA 5CV7A 4IZ8A 5CGKA 3J81j 1CQFA 1SXTA 4E6IA 1QCBD 4P71A 4A3IH 1KQSA 1N33L 2RQXA 1GKHA 3VR3A 1RODA 1HCZA 4IJLA 4OWTB 1YIJA 1E7ZA 1KNEA 1GUSA 4A3BH 3N52A 2MP1A 4KN4C 5M3FG 4P2CB 4DUZL 2L4NA 1PH4A 4APVA 2KHIA 3IFTA 1AZPA 1RTNA 4X65L 3K80C 4DPGA 2JEBI 1ASZA 5IP9H 2V4DA 2F0TA 3HGBA 5I9OA 3CAMA 1QOHA 2B2VC 1EY9A 3OPOA 2RKSA 2AQ2B 5C4XH 1LABA 4B3ML 1DYQA 1TR5A 1CKNB 4XYOA 3I55A 1Y1WH 4B3SQ 3ULPA 4KI0A 2E2HB 1LUZA 1BBXC 4JPBW 2A19A 1ZXTA 1M90C 1LV9A 1VQFA 1N36Q 3GTOH 2HIXA 3PO2H 2F4VL 1PDQA 3U9SA 1XTDA 1D7QA 2EVBA 5C5MA 1YHAA 3HKZG 2PI2E 4DR1L 2EY1A 3OWEB 4Z9CB 5M5YB 3PF4A 5EKKA 1TWHH 3A8IE 2NZ1D 5ELDA 5IYCH 2KCNA 1K9MC 2CWAA 3BYTB 1C8CA 1XTCD 3LGJA 1LTBD 1TWFH 1STHA 2Y0SG 1NAPA 1B9NA 4A3KG 2MFIA 2VQEQ 3O13A 1FVIA 4IUPA 4FXKC 4CJ2C 3CCJA 3PUYA 5HY6A 4JI3Q 3ULJA 4K5VA 2ALYB 3AB9A 3I4MG 5IT9c 4TVAB 3K7UC 2Z6KC 3TDQA 1GM5A 1K73C 2F0NA 5F2DA 1HQRD 1X56A 1Q1BA 3S15H 2ICEC 2UUAQ 5KNBA 3T1YQ 2OTLA 1B70B 2NN6G 4LW1A 1CUKA 1ENCA 3VR6A 3T13A 3SDZA 3MWYW 1DZ1A 3Q22A 1KRTA 4CDEC 1B8AA 3E0JA 4BS9A 2VY3A 5KYIA 3K7AB 1MSHA 5FLXL 1HFNA 1RCVD 3CC4A 2NVQB 1RHPA 3KK7A 3PUWA 4JG2A 3FDTA 1J5EL 4X64Q 3BVGA 1EY0A 1CZGA 2PZWA 1STEA 1PH6A 3NP8A 5A2QL 4QB4A 2K4KA 2RDHA 5IWAL 3DLLA 4FF1A 2MUYA 4DV3L 4JW0A 2O5IC 1Q8KA 4P74A 1HA5A 3HOYH 1WOCA 2NVXB 4OO1I 2N78A 1GD7A 3KLSX 1EYCA 3PF5A 3GTMH 5CBEE 1A8VA 2DJGC 4PZ7A 1L0WA 1YJWA 2D0OA 4RKLA 4QIWE 1I50B 2P5ZX 1B9MA 4JYAL 1GOZA 1O7IA 2VQFL 2NN6I 1KNAA 4IJHA 4RGNA 2ZTEA 3G6JB 1I4GA 3HEJA 1EQRA 1H9SB 1B3AA 1VQAA 5A35A 3ND8A 4NXML 2B2YC 4ULLA 1PTOF 2J0TD 5FLMG 4RHRA 1SEBD 5M5YH 1SROA 3HOXG 3CU7A 3CF5A 4MTKA 1V1PB 2RF4A 3OYYA 3GTPH 3JAMc 1L1OC 4LJZC 1PH3A 4LUOA 3I2ZA 4LF6L 2EXZA 5LMNL 4N9TA 4RGOS 4DR5L 1G2TA 4PZ6A 2YYZA 5CV4A 4A3MH 1TIID 3EVQA 1YJ9A 1HA6A 3TSSA 2QDLA 1WTHA 5CYUA 3HKSA 1O78A 2K05A 2MJ8A 1I94L 3I4NG 3BDLA 1PTOB 4JBJA 3T4AC 1K8OA 1OXUA 4BY1H 4CBVA 1FNVA 4HSPA 1VQHA 1HNXQ 1AN8A 2MO1A 1LTTD 3A55A 3D0FA 1PV4A 2B63B 3RZOB 2E2JB 5JJLA 3STBC 1JWUD 1ASYA 4XYQA 1VQOA 2DNCA 3BYYB 2IPKD 2R93G 1EFID 2FXQA 3TRZA 5ISRA 1UE6A 4LUVA 4HTHA 1I4RA 1LT5D 2CCZA 4WFN3 3KOJA 4YHHL 1Z6HA 1KC8C 5IT9L 3GTKH 4C3IB 3J81c 3RNUA 1ONLA 4J15A 1WTWA 4C3JB 3QWNA 1S5FD 4KHZA 1FJGQ 1I4QA 2BDNA 2A5HA 2K50A 5NUCA 5GAHC 2EYJA 4UPAA 3URYA 2JA6G 2FMCA 3IL8A 1S5ED 2CWPA 1G91A 4GLAC 1VF7A 2HQLA 2PCFB 4X3TA 3MAQA 1C48A 3HOVG 4KMUC 2EE1A 2Z9HA 3BZKA 2IX1A 1Q7YC 5C6AA 2ENBA 3E9HA 2HHHQ 5DAUA 2EY5A 5M5WB 1E2ZA 3S2DB 2IX0A 4A3FG 1EIYB 1VQKA 5K36G 2ZTCA 1MSGA 3GD7A 3M7GA 1VQ9A 4DV4Q 1BNZA 2RVLA 3MXGA 3X3MA 3VYSA 5KNDA 1EU4A 3EN2A 4DV2Q 2NVYH 4DV1L 4JI4Q 4JI7Q 1K83B 4EX5A 1EYAA 1D5MC 3PIOA 1A6XA 4DV5Q 4A3IG 4K6DA 3P20A 2HCCA 1UUPA 1E2VA 1K3RA 3I8ZA 2LKVA 5IIFA 4M1UB 4ZCKA 1PRTD 4A3LH 1D8LA 1IBLQ 2LSSA 4A3BG 3BZDB 3GDEA 1PFSA 1WTPA 1CKOA 1K8MA 1N33Q 2NTTA 5HURA 1PTOH 4U673 3I90A 4GNXB 1D2BA 1R9TB 2B63H 4X62Q 4FDBA 1KLUD 5IP9G 4ILWA 1G291 1F9RA 2AWOA 5JEAH 5JJZA 5C4XG 4IUVA 4HCSA 3VDYA 1BCPF 2XRSD 4GS3A 4OIKA 4KD4A 1IBML 1OXSC 4IURA 1CKNA 2RDGA 1T9HA 3K57A 1Y1WG 3M4YA 5LMUL 3HOWH 4A93B 1QNKA 3S17H 2WIIB 1NJIC 3HOZB 1QJOA 3CC2A 1MHWC 4LAAA 2GVAA 1PH7A 3DXJC 4OO1H 2YTXA 3A8KE 3PO2G 4C3JH 2MGSA 3W1GA 3IAYA 4RH6A 2F0VA 3AFQA 4HR7B 2EZVA 4R4OA 2UUCQ 3ERQA 2B2WA 2L0CA 2PQEA 1GUTA 4DV6L 3NSWA 4R8NA 2L5TA 1STBA 2F4VQ 4NXNQ 3TREA 3NTHA 5IYCG 4JOIC 1BCPB 5C0XJ 4A3GB 1RKNA 2XVSA 1QZGA 1LTGD 1NSNS 2XN9C 4X6AH 3QOLA 4AYBB 2IJ0A 4X66Q 1O7ZA 1C9OA 4KKSA 5M5WH 1TT2A 1DOMA 2N8NA 3TP6A 1OO9B 2N3SA 3T16A 2UXDL 4OXPA 3HOUH 2KEDA 3KDFB 5M5XB 1X3EA 3A8JE 4EQPA 3OHXC 4X3KA 5E4WC 1TVXA 1NR2A 3K5OA 3A74A 4GLVB 4C1NI 2JA7H 1Q86C 2KCTA 2EDGA 4DR3L 1E0BA 2LY7A 1LACA 1PRTC 3PUXA 1YHQA 4BY7B 1B1ZA 2CQAA 4POGA 3ZYYX 3NK9A 5DLQE 5C3EB 2K33A 3TP8A 4C2MB 3OTOL 1F77A 5IGDA 2K28A 3HG9A 3AYHB 2B8FA 1GHJA 4DGZA 3GQBA 3J80E 4YIJA 1EOTA 1X3GA 1OXTA 1N34L 2IL8A 1M8AA 3BZCA 4IPDA 1XNRQ 1XMOL 4NP5A 2GA4B 1N32Q 1PH1A 2O4XA 4XQQA 1UEBA 3A5ZB 2D62A 3L0OA 3PCOB 2RHQB 1CKMA 3R8BA 3MXUA 2O2LD 2I46A 4X3UA 1VQGA 4LFBQ 4WJ4A 3C46A 1ENAA 4CJ1B 1VS0A 3HOYG 3CCVA 4QJFA 3R3OA 3WDNA 3X3NA 2EOTA 3KLSA 2ES2A 2K5DA 5IWAQ 4G7OC 4HEDA 1SJHD 4XTCS 5KRUA 4A93H 2EIFA 1U5KA 2K1BA 1L2FA 2PNHA 2B2UC 3AMUA 1NY4A 4LF7L 3ULLA 1EWIA 4FF3A 1I4HA 3S1NB 3WOFA 3DHQA 1EY7A 1H9SA 2K5WA 2V1CC 1RJTA 1VQNA 2A8VA 3BDCA 3KBXA 4DNIA 3FKIB 1E1TA 4H44C 2I0QA 2BH8A 2CVRA 3S16B 1KLGD 1U4RA 5JVG3 3KF8B 1HFGA 1V1PA 1WYDA 1KIXA 5C44B 4NXMQ 1SE8A 4TRDA 2FJ2A 2XNAC 2AWNA 1YITA 1AEXA 1G51A 1MGSA 4GOPC 1LT4D 1B50A 4A3MG 2F03A 2F1MA 5M5XH 3K5NA 4G7ZC 1TWGB 2TMPA 3L7ZC 2NWGA 5DNFA 4DNRB 5LMNQ 2WFWA 1K8AC 4B08A 3J80i 1JORA 1S5CD 3D4RA 4BY1G 3ITPA 1I6VC 1MBYA 1QVFA 1STGA 1VQDA 4H0LC 1O7LA 3CW2C 2A1AA 4BY7H 4TQUS 4IOAA 4A75A 4JC0A 3G6EA 2JA8B 4LFAQ 4Q0FA 1I94Q 2N88A 1R4PB 3OMGA 4A3EH 1M1KC 4KKUA 2K7VA 3I4OA 4C2MH 4XQNA 1V1OA 1TY2A 1F9SA 2L11A 4GKJL 2NVTB 5JEAJ 4LF5L 2EPBA 2CHBD 2CQOA 3TEHB 3GTQB 5ELBA 5IGFA 2UUBQ 5C0XI 4DV7L 2EYLA 4YWLA 2DN8A 4JI8Q 3EJIA 3NQIA 3EIVA 3CPFA 1I3QH 3M3YB 3MEHA 5ELCA 2Y0SE 3R2IA 1CSQA 3DEPA 1SNMA 5FK9C 5M9OA 4JI1L 3MTSA 3HRZC 3TZUA 3VYRA 5FOBB 2DGYA 3QO2A 3GTJH 4B9XA 1IXRA 4ME3A 3H0GB 1G6PA 4K0KQ 2C35B 4QL5A 1HNZL 3K58A 3H09A 2XWJB 3UE1A 1T5EA 1IBKL 1WTRA 3C1FA 5BN4A 4DR2Q 4FXDA 3W5OA 2I07B 4IUUA 2ZXOA 3TP5A 3NWTA 3VR2A 4AQYL 2K52A 1H9JA 1KDAA 2BA0A 3T1HL 3QR8A 1L1OB 2F3WA 2HDLA 5C3XA 3F2BA 2QKIC 1XMQQ 1EY4A 1SMYD 1BVSA 1WD1A 1WTOA 4DUYL 1JJGA 4C3HB 1SE2A 3M7NA 2M00A 2AMCB 4BBSH 5I4DA 3PMFA 3J7AV 3MZ5A 3PUVA 3RLFA 4KK7A 5G3LD 2F0WA 1II3A 3MXPA 3RZDB 2Z4IA 3I70A 4UP9A 1PHJA 5AJ3Q 1LLRD 3GV3A 4JI6Q 2QCPX 4F87A 2NUCA 4FXGC 3SEBA 1H95A 3G4SA 2EYOA 2IT1A 2NB0A 3K0YA 4A3LG 4CHTB 1ZEQX 2ZXPA 2VUMB 3D4DA 1VQJA 4ZUJA 2QEXA 3H3VI 5K5PA 1TWGH 2L12A 1IL8A 1JB7A 4DR7Q 1N9WA 3S2HH 2R7FA 1BXTA 1QE6A 2PI2A 5HGTA 4GNXA 3K59A 2B63G 3KLWA 5KNCA 1SJED 1FGBD 3GV6A 1U4PA 4HN7A 2PQAB 3MFYA 5JEAG 1C0AA 4IFDJ 5EAYA 4JV5L 4B3RL 1N8RC 4BXXH 3HOWG 2QILA 3MEFA 5ELFA 3N6RA 4WJ3M 1WJJA 1Y1VB 3K0XA 4IQZA 3S1QB 2LMCB 1SE3A 4HAEA 4OO1G 1AP0A 2UXCL 5FO9B 4C3JG 2ZTDA 2NZHA 4N8FA 4L5QA 3W3AA 2ZJQA 1OXVA 2BA1A 5E1FA 1SYFA 3PO3B 1HQMC 5DM63 1VQCA 1SFOB 1SSOA 1STAA 3H0GH 4R4QA 1BKBA 1O7YA 4POFA 1SNDA 3SK6A 1F2MA 1TS3A 2YU9B 3I91A 1HRJA 1PYBA 2B2TC 1SMYC 1S72A 1EQVA 2UXBL 1T5XD 2C9OA 4WORA 4PMCA 5EPLA 2E5LL 2JP1A 2KHSA 3JAME 3VR5A 4I7ZC 2A69D 3HOUG 3EFXD 4DR6Q 4A3DB 1AE3A 2KENA 3KDFA 4YY3L 4DR4L 2WAQG 3VYUA 1J9OA 2JA7G 4DK0A 4HIKA 5GAEC 2E74C 5CORA 3R93A 4OX9L 4CDCC 2CFMA 4GKKL 1AH9A 1X6OA 1VDZA 1WCMB 5J39A 3QJYA 3QB3A 2E2HH 5FKAC 3RZDH 4H7BA 4YCWA 4BBRB 4OL7A 2Q2TA 2C5CA 2VUMH 5T1IA 3D6CA 3CP0A 3OIQA 5BR8L 3CD6A 2PPBC 4KY6A 1BBUA 4KHPL 3A5UA 1HR0Q 1F9PA 1A0IA 1SMXA 4JI2Q 4JI5L 2H4OA 2QA4A 2B2VA 2QW7A 2F0GA 4RFBA 1EYDA 1KAAA 2XIWA 1XPRA 1MIUA 1RF2D 4XXEA 5C0XH 5M3FB 2DJFC 3UI2A 1N34Q 4DAMA 2OXPA 3J81E 1QVCA 2KBNA 4LF4Q 3MC0B 1Z47A 4J8QA 1DONA 3OMCA 3EROA 2UU9Q 1Q81C 1NR4A 5J22A 4IPGA 2X69A 1ET9A 1QWYA 5CV8A 4A93G 4DV0L 1Y1VH 1EIHA 2AHOB 5E7NA 3S1RB 1VCIA 2WB1B 2KHJA 3S1QH 2JN4A 2WKCA 1A3TA 2L1BA 1AFPA 2E76C 3NBHB 2ZM6L 1PRTF 4JI0L 2F0FA 1Z7TA 3JAMi 2XWBB 2VNUD 1BDOA 4UAIA 4L8JA 4DKAC 1XNQL 5JJIA 3GTGB 4K14A 4P72A 2HDMA 3TN2A 1SFOH 1STNA 3M4OB 5M3MB 4LF7Q 1UE5A 3VA5A 1RD9D 2RCNA 5EKIA 3KF8A 3KUPA 4ZLTF 3CXCA 1QUQB 4LF9Q 3H6MA 3HKZB 3K7AH 1SNOA 2NVQH 2M9VA 4UDUC 1HPCA 4P73A 2WKDA 2Z6KA 4G4KA 3PIPA 4PNYA 3NTIA 1I4XA 3SK8A 4NKLA 4IFDI 5D65A 1PRTB 3RN5A 4O1NA 2EJMA 3BVZA 4A3KB 2D5DA 3FMCA 2KQ3A 2Z1CA 2R7ZB 4ALPA 1DOKA 3QIAA 4OIJA 1EY5A 1YZ6A 3H3VH 3S14B 1Q90A 1SLJA 1CZWA 2EJFC 2LFNA 4KY5A 1LTLA 4KN7C 5IY0A 1X3PA 1LTRD 4KKTA 2KCMA 2NVXH 3I4MB 1FYCA 3PV0A 4PZ8A 4K5XA 4A3EG 5D3DA 3UDIA 5IE8A 4G57A 1M4VA 3J81i 5JOBA 1VQ7A 1C4QA 1VQLA 1I50H 2RA4A 4ZQ3A 1TWCB 4R4CA 2GN5A 3K6OA 1HZ9A 1HZAA 4ZK9B 1PFNA 2XGTA 1PH8A 4QY7A 1PYWD 4GKJQ 4UHVA 3K5MA 2YTVA 4IALA 4F7XA 2Q2HA 1CA6A 1B3QA 1D5ZC 1A62A 4PQXA 1EEID 1V1QA 4R4IA 3SR1A 1YBYA 1GUWA 1EIFA 1KRSA 1X65A 4CDFC 4IOCA 3M4QA 4N9PA 4C1NK 5E4XA 1VMPA 2VS1A 1SYGA 1RDPD 1LTAD 3LWEA 2KEEA 2KCCA 1HNWL 2OT2A 1VQPA 1I4PA 2AQ1B 2J4XA 4DXFA 1PMRA 5IGCA 4HMIA 4DFAA 1KDBA 1IKMA 1N36L 5CR3A 4NDXA 2B2YA 2WINB 4KJOA 5KEEA 1Q82C 4KHVA 1HNZQ 1TY0A 1JE5A 2RCFA 2E2JH 5KYLA 3RZOH 4A3JB 2I5MX 2MQHA 1L1OA 2MPMA 2IX3A 1GJXA 4DN4M 4DUZQ 2L55A 1D1IA 5M3MH 4GOPB 3CCEA 3I3CA 4PMBA 1HTLD 4BBSG 4X65Q 1CI3M 3HP3A 3ONAB 3T1HQ 3D8GA 3RLNA 1FD7D 4CGYB 3BVMA 3B6YA 3EA6A 3J7YW 4HIDA 3TZDA 3MHBA 3T53B 1HJPA 1FNWA 1KDCA 3HOXB 4C3IH 1QVGA 1PH2A 1BF4A 2A74C 3DM3A 4OHJA 4B3MQ 1JMCA 4BY7G 1PH9A 4PV1C 4ZRZA 3WWVA 2K5HA 4JI3L 5C5LA
chains in the Genus database with same CATH topology
4B3TQ 2AWNA 2K5VA 1YITA 3UDGA 1NE3A 3PF4A 1PH5A 3CCUA 1TWHH 1G51A 5IYCH 4GOPC 1RIPA 4LFAL 2HIVA 1K9MC 4A3GG 1JT8A 1X9NA 1HR0W 2CWAA 4GN4B 3U4VA 4A3MG 2R7ZH 3A0JA 3ER0A 4AYBG 4KLKA 2YU9H 3S14H 5M5XH 3LGJA 4UP7A 1TWFH 2Y0SG 3L7ZC 4A3KG 2MFIA 4B3SQ 5LMNQ 2WFWA 2VQEQ 1K8AC 2UUAL 1FVIA 3J80i 3T1YL 1BBWA 4BY1G 4GN3B 3CCJA 3PUYA 2PQAA 5HY6A 4JI3Q 2IHFA 3ULJA 2UUBL 2ALYB 4DR1Q 1VQDA 3GO5A 5ELNA 1QVFA 4A3DH 3CW2C 3MXNB 3I4MG 2A1AA 5IT9c 4BY7H 3I56A 4TQUS 4IOAA 1HZCA 4A75A 4JC0A 3G6EA 3S2DH 1TWCH 4MNOA 4LFAQ 3I7FA 3K7UC 2Z6KC 4TVAB 4JI8L 1I94Q 4A3EH 4BXXG 1M1KC 1GM5A 1WI5A 3I4OA 4C2MH 1K73C 4DK6C 4GKJL 4R4TA 5JEAJ 1WCMH 1X56A 4LF5L 4JBMA 1Q1BA 4X64L 3S15H 2UUAQ 4UP8A 5C3EG 3T1YQ 2CQOA 1B70B 3TEHB 2NN6G 4LW1A 1UE7A 1CUKA 4K0KL 2UUBQ 1S40A 4BBRH 5C0XI 1HH2P 3UDXA 4PMWA 1KRTA 1K83H 4OWXB 5IP7G 4DV7L 1Q46A 1W2BA 4YWLA 1B8AA 2R7DA 2VY3A 4JI8Q 2CKZB 1PA6A 3EIVA 2JA5G 3CPFA 1I3QH 3H0GG 4YWMA 4DR2L 3CC4A 3KFUA 3GTLH 2Z0SA 1AE2A 1XNRQ 2Y0SE 3PUWA 1CSQA 4JG2A 1J5EL 2R6GA 4JI1L 4LF5Q 3EBEA 4X64Q 2DGYA 1DGSA 3GTJH 1J6QA 1IXRA 4ME3A 1G6PA 3E0EA 2BH2A 4K0KQ 3HFZB 5M3FH 1PH6A 2IY5B 2C35B 4QL5A 4DV7Q 1XMQL 2K4KA 1HNZL 5IWAL 3DLLA 4RG1A 5IYBG 1KD1C 2XTIA 1V43A 1MKHA 1VQEA 3UE1A 1MJEA 4DV3L 1Q1EA 1R9TH 3UDFA 1IBKL 3W1BA 4A3JH 1KAWA 1Q8KA 4P74A 3BU2A 1K0RA 4DR2Q 3W5OA 3HOYH 1WOCA 1UWVA 4HJAA 4OO1I 1NBWA 2N78A 4AQYL 2K52A 1J5EQ 4B3SL 1GD7A 4HIMA 4JI1Q 4DAYB 4L5RC 3PF5A 3NENA 5AJ3L 3S1RH 2E5LQ 4JI6L 3GTMH 1OXXK 1A8VA 2BA0A 4PZ7A 2JA9A 3T1HL 1Q12A 1LYLA 1L0WA 1L1OB 3CMEA 2D0OA 1YJWA 4QIWE 3F2BA 2Q2UA 4IO9A 2HT1A 4YY3Q 1XMQQ 4JYAL 1O7IA 1BVSA 2VQFL 2NN6I 4IJHA 4DUYL 1JJGA 2ZTEA 3M7NA 3HOZH 2AMCB 4DV3Q 1EQRA 1VQ4A 1IBKQ 4BBSH 4DR7L 1VQAA 3PUVA 3RLFA 1VQ5A 3GTGH 3KYHC 1SRUA 4JBWA 4YCVA 5GQOA 2MNAA 1VQMA 4NXML 2VUMG 3M4OH 1XPUA 1KHIA 4B3TL 3FKIG 5FLMG 4AQYQ 1X55A 5M5YH 3CCQA 1SROA 4UP9A 3HOXG 5AJ3Q 1PHJA 1KL9A 4JI6Q 3K8AA 3CF5A 1YEZA 2RF4A 1FL0A 3OYYA 3GTPH 1H95A 3JAMc 5C44G 1Z9FA 3L2PA 2IT1A 3G4SA 1L1OC 4A3LG 1PH3A 1XPOA 1HNXL 5IYDG 3AEVA 1VQJA 2MO0A 3I2ZA 2LXJA 4LUOA 4AH6A 4LF6L 4JYAQ 2VQFQ 2QEXA 3H3VI 5C0XG 2K75A 4DUYQ 1TWGH 1GVPA 2VQEL 2ZJRA 5LMNL 3CC7A 3F8TA 4YWKA 1JB7A 1NMFA 1TWAH 2I5HA 4DR7Q 4DR5L 4A3GH 1N9WA 4PZ6A 2YYZA 3S2HH 2R7FA 1JJ2A 4A3MH 2PI2A 4OONA 4GNXA 1YJ9A 2B63G 3KLWA 1EYGA 3HKSA 2R92G 3CCMA 4A3KH 4OWWB 3UE0A 1U0LA 1I94L 3I4NG 4JBJA 2PQAB 1OXUA 4BY1H 3J80c 1Y14B 3M9BA 1YI2A 1VQHA 1Y1VG 1HNXQ 5JEAG 2OTJA 4LF6Q 1GO3E 2MO1A 1PV4A 3D0FA 3I4MH 1C0AA 5JJLA 4IFDJ 2B3GA 3STBC 5EAYA 1ASYA 2JA8G 2VW9A 4JV5L 4B3RL 4DR5Q 1N8RC 4BXXH 1VQOA 1FJGL 3HOWG 1XJVA 3MEFA 4WJ3M 2R93G 4Y52H 1WJJA 4L5TA 4DV0Q 3K0XA 3J7A5 2FXQA 3TRZA 4JOIA 4JCVE 1UE6A 4LUVA 1E3PA 2EXDA 4HJ5A 1IL2A 4OO1G 2UXCL 2L15A 5C3EH 2ZTDA 2CCZA 2NZHA 3KOJA 4YHHL 2ZM6Q 4L5QA 1KC8C 2ZJQA 4L5SA 1EUJA 3GTKH 1OXVA 2BA1A 2ASBA 3G48A 5IP7H 3J81c 3RNUA 4R1JA 1VQCA 4MZ9A 4YCUA 4DK3C 4J15A 4JV5Q 4B3RQ 5GROA 4KHZA 1QUQA 1FJGQ 4LWCA 4DR6L 2JA5H 3H0GH 4R4QA 1BKBA 4POFA 2K50A 5GAHC 2DUDA 4UPAA 5JJKA 3AFPA 3KF6A 4HJ9A 2JA6G 2UXCQ 4A3CG 2CWPA 2NZOA 4YHHQ 5GADC 4DV4L 2OQKA 1W3SA 4GLAC 1PYBA 1S72A 2UXBL 2HQLA 3HOVG 1VQBA 2E5LL 1P8LA 5IYBH 1E1OA 3BZKA 2IX1A 1Q7YC 3HOUG 4DR6Q 3E9HA 3Q8DA 1AE3A 2HHHQ 4JI4L 4JI7L 2KENA 3ICEA 3KDFA 3M85A 4YY3L 1S3OA 4DR4L 5LMNW 4DV5L 2WAQG 2IX0A 4A3FG 1EIYB 1VQKA 1LM0A 4BA2I 4XIGS 5K36G 2JA7G 2ZTCA 4HIKA 4EQ5A 3GD7A 5GAEC 5FJ8G 1HR0L 5J3BA 4JI2L 1VQ9A 4DV4Q 4OX9L 4GKKL 2CFMA 1AH9A 1X6OA 1K8GA 2UXBQ 3H15A 1IBLL 2LXKA 1P16A 2E2HH 3F2DA 3RZDH 1FGUA 2JE6I 4YCWA 3S1NH 3EN2A 4DV2Q 2NVYH 5HGQA 4DV1L 3U4ZA 4JI4Q 5H1SE 4JI7Q 4QGUA 2E8GA 2Q2TA 4EX5A 2VUMH 1A63A 3RLOA 4LF4L 4MTNA 3FKIH 5FLMH 3CP0A 5BR8L 3PIOA 1JJCB 4DV5Q 3CD6A 3S16H 4X62L 4A3IG 4DR4Q 1BBUA 3HOXH 4KHPL 4HJ7A 2UU9L 1PVOA 3A5UA 3SGIA 2N49A 1HR0Q 1E22A 1K3RA 1A0IA 1SMXA 4JI2Q 4JI5L 2QA4A 3PGZA 5C44H 2OWOA 4OX9Q 4GKKQ 4A3LH 1D8LA 1IBLQ 5IYDH 1XPRA 2LSSA 1MIUA 2OQ0A 2WP8J 3M4PA 4HIOA 2ZJPA 4A3BG 3GDEA 3FHWA 1PFSA 1CKOA 4DV1Q 1N33Q 5ELOA 5C4JH 3U50C 1N34Q 4DAMA 3TS0A 2K5NA 4GNXB 4LF8L 1QVCA 2KBNA 2E2IH 4LF4Q 2WAQE 4LNQA 3BJUA 2JQOA 5BR8Q 1Z47A 3CCSA 2WB1G 2B63H 4X62Q 4FDBA 4KHPQ 1OTCA 2UU9Q 3TQYA 1Q81C 2R92H 5IP9G 3F2CA 1HNWQ 3CCLA 1G291 5GAGC 4IPGA 4JI5Q 3I4NH 2AWOA 2YV5A 2VL6A 4A93G 4DV0L 1Y1VH 4Y7NH 2AHOB 5E7NA 2UUCL 5C4XG 2QGQA 1VCIA 2KHJA 3VDYA 3S1QH 1EQQA 3S24A 4GS3A 4LFCQ 2JA8H 1VQIA 1IBML 1OXSC 4LF9L 1CKNA 1T9HA 1Y1WG 3NBHB 5LMUL 3HOWH 2ZM6L 4NXNL 5M3MG 4JI0L 1IYJB 2EQSA 3S17H 4GOPA 1NJIC 4GNXC 4GLXA 3JAMi 2R93H 3ULPA 3CC2A 2NVTH 2VNUD 2GVAA 4DKAC 1PH7A 1B7YB 3CMAA 1XNQL 4JBKA 3ZJYC 5JJIA 4P72A 2YTXA 1SFOH 2AKWB 4C3JH 3GTQH 3PO2G 3W1GA 4X66L 3AFQA 4LF7Q 1YNXA 4H02A 4GN5A 1UE5A 1I5FA 4R4OA 3PO3G 2UUCQ 3G71A 4LUZA 3ERSX 1E24A 2RCNA 3CXCA 3JC66 1IBMQ 1QUQB 4DV6L 4LF9Q 3K7AH 1EFWA 4UY8C 2NVQH 3M3YH 5LMUQ 2I5LX 1NTGA 2F4VQ 4NXNQ 3TREA 2OCEA 4JI0Q 1VQ8A 1VQ6A 3NELA 2ATWA 2WB1E 5IYCG 3AQQA 1C7YA 4JOIC 1CSPA 1V9PA 4P73A 3KF6B 2Z6KA 5C0XJ 3PIPA 1XNQQ 2R7ZG 2JA6H 1QZGA 4LF8Q 4X6AH 4AIMA 4IFDI 4A3CH 3IRBA 3RN5A 1KXLA 2HHHL 4X66Q 1C9OA 1X54A 5M5WH 3RR5A 2Q2IA 2N8NA 2JEAI 3OW2A 2K14A 1HZBA 3HOVH 2F3IA 2N3SA 3S1MH 2UXDL 1NMGA 4ALPA 3PSIA 4DV6Q 3NEMA 4OXPA 1YZ6A 1PYSB 3H3VH 2JJQA 3HOUH 4A3DG 3KDFB 1SLJA 2OTLA 5IY0A 1I6HH 4BY7G 1LTLA 4O2DA 1X3EA 2NVXH 1X3FA 2KCMA 4QQBX 2VZAA 3PV0A 4PZ8A 2GVBA 4A3EG 1SR3A 4O0AA 3HKZE 4A3FH 3UDIA 5IE8A 3A74A 4GLVB 2JA7H 5FLXc 4DV2L 2H5XA 3J81i 2KCTA 1Q86C 5FJ8H 4DR3L 1YHBA 1VQ7A 1YHQA 3PUXA 1VQLA 1XNRL 4P75A 1EOVA 1WCMG 4BA1I 1I50H 3FP9A 1IZ6A 4POGA 3RN2A 3STBD 5DLQE 1TXYA 4R4CA 1N32L 2JK8A 2RHSB 2GN5A 3E9IA 1WFQA 1RL2A 1HZ9A 4C3HH 2UXDQ 4AYBE 1HZAA 2XGTA 4BBRG 3OTOL 1PH8A 4IPHA 4QY7A 3CQZH 2D0PA 3J81j 4GKJQ 2YTVA 3AYHB 4LFBL 2Q2HA 4P71A 2ID0A 4A3IH 1A62A 1V1QA 4A4IA 4R4IA 1KQSA 1SN8A 1X3GA 4DR3Q 1OXTA 1YBYA 3F1ZA 1N34L 1N33L 1GKHA 1EIFA 1KRSA 1X65A 3BZCA 4IJLA 4IPDA 3M4QA 4OWTB 3J7ZC 1UE1A 4IOCA 1E7ZA 1YIJA 1XMOL 2VS1A 1N32Q 1PH1A 4A3BH 1HNWL 1YVCA 5M3FG 1UEBA 3A5ZB 2D62A 3OTOQ 3L0OA 3PCOB 3KJOA 1VQPA 2RHQB 1CKMA 4HJ8A 4DUZL 1PH4A 4APVA 2KHIA 1VQGA 4LFBQ 4X65L 4WJ4A 4A3JG 3K80C 4DPGA 4LFCL 1VS0A 2JEBI 3CCVA 4IPCA 4A76A 1N36L 5IP9H 1ASZA 3HOYG 4NB3A 4QJFA 3CAMA 2ES2A 1Q82C 1YJNA 1HNZQ 5IWAQ 1XMOQ 1JE5A 4IFDG 4XTCS 4A93H 2E2JH 3CCRA 3RZOH 5C4XH 2EIFA 4NPSA 4B3ML 1CKNB 1U5KA 2I5MX 1L2FA 1L1OA 2MQHA 4PG3A 2PNHA 3I55A 1Y1WH 2B29A 3D31A 1NY4A 3K81C 4KI0A 3ULLA 3PUZA 1EWIA 5M3MH 4DUZQ 3CCEA 4GOPB 1LUZA 3HOZG 4LF7L 4BBSG 4X65Q 2A19A 3CPWA 1M90C 3U58A 2F52A 3T1HQ 1MJCA 1VQFA 3RLNA 1N36Q 2V1CC 2YTYA 3B6YA 4HIDA 3GTOH 2HIXA 1VQNA 2A8VA 3PO2H 4DNIA 2F4VL 1D7QA 1E1TA 1HJPA 1XTDA 2I0QA 2BH8A 4RMFA 3TS2A 4C3IH 1QVGA 3PO3H 1PH2A 3KJPA 3KF8B 3DM3A 2IHEA 4B3MQ 2PMZE 1JMCA 1WYDA 1PH9A 1YHAA 1KIXA 4NXMQ 1SE8A 3HKZG 3WWVA 2PI2E 2K5HA 4JI3L 1QZHA 4DR1L
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B3T Q;  2AWN A;  2K5V A;  1YIT A;  3UDG A;  1NE3 A;  3PF4 A;  1PH5 A;  3CCU A;  1TWH H;  1G51 A;  5IYC H;  4GOP C;  1RIP A;  4LFA L;  2HIV A;  1K9M C;  4A3G G;  1JT8 A;  1X9N A;  1HR0 W;  2CWA A;  4GN4 B;  3U4V A;  4A3M G;  2R7Z H;  3A0J A;  3ER0 A;  4AYB G;  4KLK A;  2YU9 H;  3S14 H;  5M5X H;  3LGJ A;  4UP7 A;  1TWF H;  2Y0S G;  3L7Z C;  4A3K G;  2MFI A;  4B3S Q;  5LMN Q;  2WFW A;  2VQE Q;  1K8A C;  2UUA L;  1FVI A;  3J80 i;  3T1Y L;  1BBW A;  4BY1 G;  4GN3 B;  3CCJ A;  3PUY A;  2PQA A;  5HY6 A;  4JI3 Q;  2IHF A;  3ULJ A;  2UUB L;  2ALY B;  4DR1 Q;  1VQD A;  3GO5 A;  5ELN A;  1QVF A;  4A3D H;  3CW2 C;  3MXN B;  3I4M G;  2A1A A;  5IT9 c;  4BY7 H;  3I56 A;  4TQU S;  4IOA A;  1HZC A;  4A75 A;  4JC0 A;  3G6E A;  3S2D H;  1TWC H;  4MNO A;  4LFA Q;  3I7F A;  3K7U C;  2Z6K C;  4TVA B;  4JI8 L;  1I94 Q;  4A3E H;  4BXX G;  1M1K C;  1GM5 A;  1WI5 A;  3I4O A;  4C2M H;  1K73 C;  4DK6 C;  4GKJ L;  4R4T A;  5JEA J;  1WCM H;  1X56 A;  4LF5 L;  4JBM A;  1Q1B A;  4X64 L;  3S15 H;  2UUA Q;  4UP8 A;  5C3E G;  3T1Y Q;  2CQO A;  1B70 B;  3TEH B;  2NN6 G;  4LW1 A;  1UE7 A;  1CUK A;  4K0K L;  2UUB Q;  1S40 A;  4BBR H;  5C0X I;  1HH2 P;  3UDX A;  4PMW A;  1KRT A;  1K83 H;  4OWX B;  5IP7 G;  4DV7 L;  1Q46 A;  1W2B A;  4YWL A;  1B8A A;  2R7D A;  2VY3 A;  4JI8 Q;  2CKZ B;  1PA6 A;  3EIV A;  2JA5 G;  3CPF A;  1I3Q H;  3H0G G;  4YWM A;  4DR2 L;  3CC4 A;  3KFU A;  3GTL H;  2Z0S A;  1AE2 A;  1XNR Q;  2Y0S E;  3PUW A;  1CSQ A;  4JG2 A;  1J5E L;  2R6G A;  4JI1 L;  4LF5 Q;  3EBE A;  4X64 Q;  2DGY A;  1DGS A;  3GTJ H;  1J6Q A;  1IXR A;  4ME3 A;  1G6P A;  3E0E A;  2BH2 A;  4K0K Q;  3HFZ B;  5M3F H;  1PH6 A;  2IY5 B;  2C35 B;  4QL5 A;  4DV7 Q;  1XMQ L;  2K4K A;  1HNZ L;  5IWA L;  3DLL A;  4RG1 A;  5IYB G;  1KD1 C;  2XTI A;  1V43 A;  1MKH A;  1VQE A;  3UE1 A;  1MJE A;  4DV3 L;  1Q1E A;  1R9T H;  3UDF A;  1IBK L;  3W1B A;  4A3J H;  1KAW A;  1Q8K A;  4P74 A;  3BU2 A;  1K0R A;  4DR2 Q;  3W5O A;  3HOY H;  1WOC A;  1UWV A;  4HJA A;  4OO1 I;  1NBW A;  2N78 A;  4AQY L;  2K52 A;  1J5E Q;  4B3S L;  1GD7 A;  4HIM A;  4JI1 Q;  4DAY B;  4L5R C;  3PF5 A;  3NEN A;  5AJ3 L;  3S1R H;  2E5L Q;  4JI6 L;  3GTM H;  1OXX K;  1A8V A;  2BA0 A;  4PZ7 A;  2JA9 A;  3T1H L;  1Q12 A;  1LYL A;  1L0W A;  1L1O B;  3CME A;  2D0O A;  1YJW A;  4QIW E;  3F2B A;  2Q2U A;  4IO9 A;  2HT1 A;  4YY3 Q;  1XMQ Q;  4JYA L;  1O7I A;  1BVS A;  2VQF L;  2NN6 I;  4IJH A;  4DUY L;  1JJG A;  2ZTE A;  3M7N A;  3HOZ H;  2AMC B;  4DV3 Q;  1EQR A;  1VQ4 A;  1IBK Q;  4BBS H;  4DR7 L;  1VQA A;  3PUV A;  3RLF A;  1VQ5 A;  3GTG H;  3KYH C;  1SRU A;  4JBW A;  4YCV A;  5GQO A;  2MNA A;  1VQM A;  4NXM L;  2VUM G;  3M4O H;  1XPU A;  1KHI A;  4B3T L;  3FKI G;  5FLM G;  4AQY Q;  1X55 A;  5M5Y H;  3CCQ A;  1SRO A;  4UP9 A;  3HOX G;  5AJ3 Q;  1PHJ A;  1KL9 A;  4JI6 Q;  3K8A A;  3CF5 A;  1YEZ A;  2RF4 A;  1FL0 A;  3OYY A;  3GTP H;  1H95 A;  3JAM c;  5C44 G;  1Z9F A;  3L2P A;  2IT1 A;  3G4S A;  1L1O C;  4A3L G;  1PH3 A;  1XPO A;  1HNX L;  5IYD G;  3AEV A;  1VQJ A;  2MO0 A;  3I2Z A;  2LXJ A;  4LUO A;  4AH6 A;  4LF6 L;  4JYA Q;  2VQF Q;  2QEX A;  3H3V I;  5C0X G;  2K75 A;  4DUY Q;  1TWG H;  1GVP A;  2VQE L;  2ZJR A;  5LMN L;  3CC7 A;  3F8T A;  4YWK A;  1JB7 A;  1NMF A;  1TWA H;  2I5H A;  4DR7 Q;  4DR5 L;  4A3G H;  1N9W A;  4PZ6 A;  2YYZ A;  3S2H H;  2R7F A;  1JJ2 A;  4A3M H;  2PI2 A;  4OON A;  4GNX A;  1YJ9 A;  2B63 G;  3KLW A;  1EYG A;  3HKS A;  2R92 G;  3CCM A;  4A3K H;  4OWW B;  3UE0 A;  1U0L A;  1I94 L;  3I4N G;  4JBJ A;  2PQA B;  1OXU A;  4BY1 H;  3J80 c;  1Y14 B;  3M9B A;  1YI2 A;  1VQH A;  1Y1V G;  1HNX Q;  5JEA G;  2OTJ A;  4LF6 Q;  1GO3 E;  2MO1 A;  1PV4 A;  3D0F A;  3I4M H;  1C0A A;  5JJL A;  4IFD J;  2B3G A;  3STB C;  5EAY A;  1ASY A;  2JA8 G;  2VW9 A;  4JV5 L;  4B3R L;  4DR5 Q;  1N8R C;  4BXX H;  1VQO A;  1FJG L;  3HOW G;  1XJV A;  3MEF A;  4WJ3 M;  2R93 G;  4Y52 H;  1WJJ A;  4L5T A;  4DV0 Q;  3K0X A;  3J7A 5;  2FXQ A;  3TRZ A;  4JOI A;  4JCV E;  1UE6 A;  4LUV A;  1E3P A;  2EXD A;  4HJ5 A;  1IL2 A;  4OO1 G;  2UXC L;  2L15 A;  5C3E H;  2ZTD A;  2CCZ A;  2NZH A;  3KOJ A;  4YHH L;  2ZM6 Q;  4L5Q A;  1KC8 C;  2ZJQ A;  4L5S A;  1EUJ A;  3GTK H;  1OXV A;  2BA1 A;  2ASB A;  3G48 A;  5IP7 H;  3J81 c;  3RNU A;  4R1J A;  1VQC A;  4MZ9 A;  4YCU A;  4DK3 C;  4J15 A;  4JV5 Q;  4B3R Q;  5GRO A;  4KHZ A;  1QUQ A;  1FJG Q;  4LWC A;  4DR6 L;  2JA5 H;  3H0G H;  4R4Q A;  1BKB A;  4POF A;  2K50 A;  5GAH C;  2DUD A;  4UPA A;  5JJK A;  3AFP A;  3KF6 A;  4HJ9 A;  2JA6 G;  2UXC Q;  4A3C G;  2CWP A;  2NZO A;  4YHH Q;  5GAD C;  4DV4 L;  2OQK A;  1W3S A;  4GLA C;  1PYB A;  1S72 A;  2UXB L;  2HQL A;  3HOV G;  1VQB A;  2E5L L;  1P8L A;  5IYB H;  1E1O A;  3BZK A;  2IX1 A;  1Q7Y C;  3HOU G;  4DR6 Q;  3E9H A;  3Q8D A;  1AE3 A;  2HHH Q;  4JI4 L;  4JI7 L;  2KEN A;  3ICE A;  3KDF A;  3M85 A;  4YY3 L;  1S3O A;  4DR4 L;  5LMN W;  4DV5 L;  2WAQ G;  2IX0 A;  4A3F G;  1EIY B;  1VQK A;  1LM0 A;  4BA2 I;  4XIG S;  5K36 G;  2JA7 G;  2ZTC A;  4HIK A;  4EQ5 A;  3GD7 A;  5GAE C;  5FJ8 G;  1HR0 L;  5J3B A;  4JI2 L;  1VQ9 A;  4DV4 Q;  4OX9 L;  4GKK L;  2CFM A;  1AH9 A;  1X6O A;  1K8G A;  2UXB Q;  3H15 A;  1IBL L;  2LXK A;  1P16 A;  2E2H H;  3F2D A;  3RZD H;  1FGU A;  2JE6 I;  4YCW A;  3S1N H;  3EN2 A;  4DV2 Q;  2NVY H;  5HGQ A;  4DV1 L;  3U4Z A;  4JI4 Q;  5H1S E;  4JI7 Q;  4QGU A;  2E8G A;  2Q2T A;  4EX5 A;  2VUM H;  1A63 A;  3RLO A;  4LF4 L;  4MTN A;  3FKI H;  5FLM H;  3CP0 A;  5BR8 L;  3PIO A;  1JJC B;  4DV5 Q;  3CD6 A;  3S16 H;  4X62 L;  4A3I G;  4DR4 Q;  1BBU A;  3HOX H;  4KHP L;  4HJ7 A;  2UU9 L;  1PVO A;  3A5U A;  3SGI A;  2N49 A;  1HR0 Q;  1E22 A;  1K3R A;  1A0I A;  1SMX A;  4JI2 Q;  4JI5 L;  2QA4 A;  3PGZ A;  5C44 H;  2OWO A;  4OX9 Q;  4GKK Q;  4A3L H;  1D8L A;  1IBL Q;  5IYD H;  1XPR A;  2LSS A;  1MIU A;  2OQ0 A;  2WP8 J;  3M4P A;  4HIO A;  2ZJP A;  4A3B G;  3GDE A;  3FHW A;  1PFS A;  1CKO A;  4DV1 Q;  1N33 Q;  5ELO A;  5C4J H;  3U50 C;  1N34 Q;  4DAM A;  3TS0 A;  2K5N A;  4GNX B;  4LF8 L;  1QVC A;  2KBN A;  2E2I H;  4LF4 Q;  2WAQ E;  4LNQ A;  3BJU A;  2JQO A;  5BR8 Q;  1Z47 A;  3CCS A;  2WB1 G;  2B63 H;  4X62 Q;  4FDB A;  4KHP Q;  1OTC A;  2UU9 Q;  3TQY A;  1Q81 C;  2R92 H;  5IP9 G;  3F2C A;  1HNW Q;  3CCL A;  1G29 1;  5GAG C;  4IPG A;  4JI5 Q;  3I4N H;  2AWO A;  2YV5 A;  2VL6 A;  4A93 G;  4DV0 L;  1Y1V H;  4Y7N H;  2AHO B;  5E7N A;  2UUC L;  5C4X G;  2QGQ A;  1VCI A;  2KHJ A;  3VDY A;  3S1Q H;  1EQQ A;  3S24 A;  4GS3 A;  4LFC Q;  2JA8 H;  1VQI A;  1IBM L;  1OXS C;  4LF9 L;  1CKN A;  1T9H A;  1Y1W G;  3NBH B;  5LMU L;  3HOW H;  2ZM6 L;  4NXN L;  5M3M G;  4JI0 L;  1IYJ B;  2EQS A;  3S17 H;  4GOP A;  1NJI C;  4GNX C;  4GLX A;  3JAM i;  2R93 H;  3ULP A;  3CC2 A;  2NVT H;  2VNU D;  2GVA A;  4DKA C;  1PH7 A;  1B7Y B;  3CMA A;  1XNQ L;  4JBK A;  3ZJY C;  5JJI A;  4P72 A;  2YTX A;  1SFO H;  2AKW B;  4C3J H;  3GTQ H;  3PO2 G;  3W1G A;  4X66 L;  3AFQ A;  4LF7 Q;  1YNX A;  4H02 A;  4GN5 A;  1UE5 A;  1I5F A;  4R4O A;  3PO3 G;  2UUC Q;  3G71 A;  4LUZ A;  3ERS X;  1E24 A;  2RCN A;  3CXC A;  3JC6 6;  1IBM Q;  1QUQ B;  4DV6 L;  4LF9 Q;  3K7A H;  1EFW A;  4UY8 C;  2NVQ H;  3M3Y H;  5LMU Q;  2I5L X;  1NTG A;  2F4V Q;  4NXN Q;  3TRE A;  2OCE A;  4JI0 Q;  1VQ8 A;  1VQ6 A;  3NEL A;  2ATW A;  2WB1 E;  5IYC G;  3AQQ A;  1C7Y A;  4JOI C;  1CSP A;  1V9P A;  4P73 A;  3KF6 B;  2Z6K A;  5C0X J;  3PIP A;  1XNQ Q;  2R7Z G;  2JA6 H;  1QZG A;  4LF8 Q;  4X6A H;  4AIM A;  4IFD I;  4A3C H;  3IRB A;  3RN5 A;  1KXL A;  2HHH L;  4X66 Q;  1C9O A;  1X54 A;  5M5W H;  3RR5 A;  2Q2I A;  2N8N A;  2JEA I;  3OW2 A;  2K14 A;  1HZB A;  3HOV H;  2F3I A;  2N3S A;  3S1M H;  2UXD L;  1NMG A;  4ALP A;  3PSI A;  4DV6 Q;  3NEM A;  4OXP A;  1YZ6 A;  1PYS B;  3H3V H;  2JJQ A;  3HOU H;  4A3D G;  3KDF B;  1SLJ A;  2OTL A;  5IY0 A;  1I6H H;  4BY7 G;  1LTL A;  4O2D A;  1X3E A;  2NVX H;  1X3F A;  2KCM A;  4QQB X;  2VZA A;  3PV0 A;  4PZ8 A;  2GVB A;  4A3E G;  1SR3 A;  4O0A A;  3HKZ E;  4A3F H;  3UDI A;  5IE8 A;  3A74 A;  4GLV B;  2JA7 H;  5FLX c;  4DV2 L;  2H5X A;  3J81 i;  2KCT A;  1Q86 C;  5FJ8 H;  4DR3 L;  1YHB A;  1VQ7 A;  1YHQ A;  3PUX A;  1VQL A;  1XNR L;  4P75 A;  1EOV A;  1WCM G;  4BA1 I;  1I50 H;  3FP9 A;  1IZ6 A;  4POG A;  3RN2 A;  3STB D;  5DLQ E;  1TXY A;  4R4C A;  1N32 L;  2JK8 A;  2RHS B;  2GN5 A;  3E9I A;  1WFQ A;  1RL2 A;  1HZ9 A;  4C3H H;  2UXD Q;  4AYB E;  1HZA A;  2XGT A;  4BBR G;  3OTO L;  1PH8 A;  4IPH A;  4QY7 A;  3CQZ H;  2D0P A;  3J81 j;  4GKJ Q;  2YTV A;  3AYH B;  4LFB L;  2Q2H A;  4P71 A;  2ID0 A;  4A3I H;  1A62 A;  1V1Q A;  4A4I A;  4R4I A;  1KQS A;  1SN8 A;  1X3G A;  4DR3 Q;  1OXT A;  1YBY A;  3F1Z A;  1N34 L;  1N33 L;  1GKH A;  1EIF A;  1KRS A;  1X65 A;  3BZC A;  4IJL A;  4IPD A;  3M4Q A;  4OWT B;  3J7Z C;  1UE1 A;  4IOC A;  1E7Z A;  1YIJ A;  1XMO L;  2VS1 A;  1N32 Q;  1PH1 A;  4A3B H;  1HNW L;  1YVC A;  5M3F G;  1UEB A;  3A5Z B;  2D62 A;  3OTO Q;  3L0O A;  3PCO B;  3KJO A;  1VQP A;  2RHQ B;  1CKM A;  4HJ8 A;  4DUZ L;  1PH4 A;  4APV A;  2KHI A;  1VQG A;  4LFB Q;  4X65 L;  4WJ4 A;  4A3J G;  3K80 C;  4DPG A;  4LFC L;  1VS0 A;  2JEB I;  3CCV A;  4IPC A;  4A76 A;  1N36 L;  5IP9 H;  1ASZ A;  3HOY G;  4NB3 A;  4QJF A;  3CAM A;  2ES2 A;  1Q82 C;  1YJN A;  1HNZ Q;  5IWA Q;  1XMO Q;  1JE5 A;  4IFD G;  4XTC S;  4A93 H;  2E2J H;  3CCR A;  3RZO H;  5C4X H;  2EIF A;  4NPS A;  4B3M L;  1CKN B;  1U5K A;  2I5M X;  1L2F A;  1L1O A;  2MQH A;  4PG3 A;  2PNH A;  3I55 A;  1Y1W H;  2B29 A;  3D31 A;  1NY4 A;  3K81 C;  4KI0 A;  3ULL A;  3PUZ A;  1EWI A;  5M3M H;  4DUZ Q;  3CCE A;  4GOP B;  1LUZ A;  3HOZ G;  4LF7 L;  4BBS G;  4X65 Q;  2A19 A;  3CPW A;  1M90 C;  3U58 A;  2F52 A;  3T1H Q;  1MJC A;  1VQF A;  3RLN A;  1N36 Q;  2V1C C;  2YTY A;  3B6Y A;  4HID A;  3GTO H;  2HIX A;  1VQN A;  2A8V A;  3PO2 H;  4DNI A;  2F4V L;  1D7Q A;  1E1T A;  1HJP A;  1XTD A;  2I0Q A;  2BH8 A;  4RMF A;  3TS2 A;  4C3I H;  1QVG A;  3PO3 H;  1PH2 A;  3KJP A;  3KF8 B;  3DM3 A;  2IHE A;  4B3M Q;  2PMZ E;  1JMC A;  1WYD A;  1PH9 A;  1YHA A;  1KIX A;  4NXM Q;  1SE8 A;  3HKZ G;  3WWV A;  2PI2 E;  2K5H A;  4JI3 L;  1QZH A;  4DR1 L; 
#chains in the Genus database with same CATH topology
 3UDG A;  1PH5 A;  3CCU A;  2WV6 D;  1XX8 A;  1XYI A;  1X9N A;  1Q8I A;  5C4J B;  1W6K A;  3U4V A;  2R7Z H;  2BCO A;  1F2L A;  1UNS A;  3NWS A;  4KLK A;  5JAV A;  3S14 H;  3I4L A;  1UEA B;  1ML0 D;  1LT3 D;  2Q8R E;  2K03 A;  2UUA L;  1G6Z A;  1TWA B;  3T1Y L;  3I4N B;  5CV5 A;  2PQA A;  3NBI A;  4DR1 Q;  1Y8O B;  2BE5 D;  5ELN A;  4Y7N B;  3MXN B;  3I56 A;  1HZC A;  3S2D H;  4ZUI A;  1TWC H;  3I7F A;  4BXX G;  4EQN A;  3Q6S A;  1WI5 A;  2EY2 A;  1SNP A;  2KOL A;  2R93 B;  2F0Q A;  3CRK C;  2CH4 W;  4JBM A;  4X64 L;  4V0B A;  4UP8 A;  1LTS D;  5FO7 B;  5CV9 A;  3NXW A;  1H9R A;  1HH2 P;  1EWC A;  1LO5 D;  1K83 H;  4OWX B;  1ICW A;  2R7D A;  2VB3 X;  5BN3 A;  2CKZ B;  1EY8 A;  4K2K A;  2F0P A;  3H0G G;  4ME5 A;  1NNX A;  2K5Q A;  4YWM A;  3KFU A;  2Z0S A;  1CQV A;  1O80 A;  1S5B D;  1A15 A;  4QIW B;  1ESR A;  4EVO A;  1J6Q A;  2JA5 B;  3AU7 A;  4C56 C;  3HOV B;  1NCV A;  1KD1 C;  2XTI A;  3S1M B;  1VQE A;  1R9T H;  1Q1E A;  3UDF A;  4A3J H;  3SXH A;  2RSN A;  4BWG B;  1JB3 A;  1UWV A;  3P7J A;  1J5E Q;  4HIM A;  1U9R A;  2A73 B;  4DAY B;  4C3H G;  2E5L Q;  4A3F B;  4IFD H;  5EPJ A;  1OXX K;  4CDD C;  4F88 A;  1Q12 A;  3OOC A;  4YY3 Q;  3PIP 3;  1WTQ A;  4XQJ A;  1SYC A;  3HOZ H;  4DV3 Q;  3D6W A;  5C3W A;  1VQ5 A;  3KYH C;  4JBW A;  1VQM A;  5GQO A;  2MNA A;  1BOS A;  2VUM G;  3NTK A;  1K3B C;  1KHI A;  4B3T L;  4MIU A;  4A3I B;  1KL9 A;  5DEH A;  1YEZ A;  1B4O A;  1E2W A;  1SYE A;  1A3V A;  4J6H A;  3FPU B;  2BE5 C;  1HNX L;  3AEV A;  4LK1 C;  4AH6 A;  4JYA Q;  2A68 D;  2VQF Q;  2R61 A;  4FF4 A;  5C0X G;  4A3B B;  1GVP A;  3F8T A;  5FLX E;  1TWA H;  2IWH A;  4A3G H;  1U4M A;  2LS0 1;  3I73 A;  3A7L A;  4OON A;  3L9A X;  1G8Z D;  3CCM A;  3I72 A;  3UE0 A;  3Q0A A;  1EZ6 A;  1PZI D;  5G3L F;  3J80 c;  1Y14 B;  3M9B A;  5A2Q E;  1YI2 A;  1Y1V G;  2Z8L A;  3TBI B;  4LF6 Q;  1GO3 E;  3C1E A;  1U4L A;  5C4X B;  2ICI A;  2R92 B;  3SK5 A;  2HD3 A;  1QG7 A;  1EZ8 A;  5CC4 A;  4DR5 Q;  1FJG L;  2KA7 A;  2K32 A;  1XJV A;  1Y1W B;  3NBH A;  1STY A;  4L5T A;  4Y52 H;  4DV0 Q;  3J7A 5;  3SVM A;  4JOI A;  4JCV E;  1E3P A;  2EXD A;  4HJ5 A;  1IL2 A;  2L15 A;  1SNQ A;  3GTO B;  5C3E H;  1JR0 D;  4KY7 A;  3PO2 B;  3V2T A;  2ZM6 Q;  3BG3 A;  1EUJ A;  2ASB A;  5IP7 H;  4OEL B;  4R1J A;  4YCU A;  4DK3 C;  1BUV T;  3H94 A;  2F0S A;  5GRO A;  1QUQ A;  2JA5 H;  1TWH B;  1DD2 A;  3OIP A;  4IUQ A;  1DXM A;  4CJ0 B;  4G7H C;  3HZX A;  2DUD A;  4HJ9 A;  2EYP A;  1W6J A;  4ABN A;  3K5L A;  4YHH Q;  4DV4 L;  2OQK A;  1TWF B;  4KV6 A;  4RGM A;  1KTK A;  1P8L A;  5IYB H;  5EBD A;  2J7Z A;  2SEB D;  4FVM A;  2JXM B;  1SE4 A;  2F0M A;  4JI4 L;  4JI7 L;  1A2U A;  1SYB A;  1TS2 A;  3M85 A;  3A54 A;  1YNN D;  2VB2 X;  5LMN W;  4DV5 L;  1LM0 A;  4XIG S;  4EQ5 A;  2N55 A;  1Y69 U;  5J3B A;  1I6H B;  2F0K A;  3H15 A;  1IBL L;  2A68 C;  3S15 B;  1FGU A;  3ND9 A;  5I9P A;  3S1N H;  2F0L A;  3Q23 A;  5HGQ A;  4QGU A;  1L0Y B;  3T56 B;  1A63 A;  4ZAI A;  3RLO A;  4MTN A;  3FKI H;  3S16 H;  4X62 L;  1TKW B;  1K28 A;  1YNJ D;  3CQZ B;  5C44 H;  5IT9 E;  2F0H A;  5IYD H;  2OQ0 A;  4HIO A;  5AFW A;  2ZJP A;  2FIN B;  1J8I A;  1SNC A;  2EY6 A;  4DV1 Q;  2M2L A;  2B2U A;  3U50 C;  5C4H A;  3VYT A;  3TS0 A;  4LF8 L;  1GUN A;  1ZYR D;  2WAQ E;  3BJU A;  2JQO A;  3FVQ A;  4LNQ A;  3CCS A;  2WB1 G;  1CM9 A;  1R4Q B;  2R92 H;  3TQY A;  1HNW Q;  3F2C A;  3CCL A;  3HOY B;  2BDO A;  1V8Q A;  2YV5 A;  2VL6 A;  3GTM B;  2UUC L;  3FRP B;  4RGT A;  3MVV A;  1VMC A;  3OW7 A;  3S24 A;  2JA8 H;  1VQI A;  3DM1 A;  2AUK A;  2SDF A;  2CW0 D;  4WJW A;  4NXN L;  5M3M G;  5IGG A;  1IYJ B;  4GOP A;  2QEJ C;  2PZT A;  2NVT H;  3LWU A;  3CMA A;  4X3S A;  3GTQ H;  3J80 L;  1HUM A;  4X66 L;  4XDX A;  1YNX A;  5EQ0 A;  4H02 A;  4C3I G;  2F0O A;  4J1M A;  1HHV A;  3GTP B;  3JC6 6;  1IBM Q;  2F0I A;  5DM7 3;  4ZKC B;  3M3Y H;  5LMU Q;  2I5L X;  2OCE A;  1VQ8 A;  2NYZ D;  2ATW A;  1YNN C;  3AQQ A;  2KUM A;  4ZKB B;  1CSP A;  3KF6 B;  2JYO A;  1JOQ A;  2VXW A;  2R7Z G;  2TSS A;  5EKL A;  4A3M B;  4LF8 Q;  4AIM A;  4A3C H;  1TU2 B;  3MFG A;  1SBB B;  3U9O A;  1Q3L A;  3GP7 A;  1EIG A;  3OW2 A;  1HZB A;  2B8G A;  2F3I A;  1NMG A;  3PSI A;  1GHK A;  1WTV A;  4DV6 Q;  3NEM A;  4BY1 B;  1BO0 A;  1PYS B;  2JJQ A;  2FFK B;  1I6H H;  4FNF A;  3MXN A;  1X3F A;  2E75 C;  4QQB X;  2A6H D;  3E3X A;  2F4I A;  1JC7 A;  1YNJ C;  2H5X A;  2K6A A;  5FJ8 H;  1H9M A;  3H91 A;  3A56 A;  1XNR L;  4P75 A;  1EOV A;  2L9H A;  1IZ6 A;  3RN2 A;  1WTX A;  3STB D;  1TXY A;  1N32 L;  2NTS A;  3E9I A;  4C3H H;  4FO2 A;  1RL2 A;  2UXD Q;  1RTO A;  4AYB E;  3A7A B;  3CQZ H;  3GTK B;  2D0P A;  3E6Z X;  2DNE A;  4XT1 B;  1G2S A;  1ZYR C;  4OGQ C;  4LFB L;  5CMD A;  1PLF A;  2ID0 A;  5L37 A;  4A4I A;  1SN8 A;  3DUZ A;  4IUT A;  4DR3 Q;  1EQT A;  3F1Z A;  5LL6 S;  4LMQ D;  3J7Z C;  1UE1 A;  1LT6 D;  1A3U A;  5D3I B;  1ILQ A;  3F2U A;  1YVC A;  3GTL B;  3OTO Q;  2CW0 C;  1AZQ A;  3EQL C;  3KJO A;  2NBF A;  4HJ8 A;  1PFB A;  1EL0 A;  4U68 A;  5KGU A;  2Z4H A;  4A3J G;  5JVH 3;  2HCI A;  4LFC L;  4R8I A;  4IPC A;  3VA7 A;  4A76 A;  5ELE A;  4NB3 A;  3SHL A;  1YJN A;  1XMO Q;  1ET6 A;  1NUC A;  4IFD G;  4DAY A;  3CCR A;  4NPS A;  4PG3 A;  1PZK D;  2F3V A;  2B29 A;  3D31 A;  2ZXR A;  3K81 C;  5I2X A;  3D4W A;  3PUZ A;  5TSS A;  3HOZ G;  3CPW A;  5LHY 1;  2F52 A;  3U58 A;  1MJC A;  2NVY B;  3S9W A;  4S3S A;  2YTY A;  3J7A F;  4N8X 1;  2A6E D;  1S5D D;  2D9U A;  1ENF A;  1EU3 A;  2PZU A;  4QCL A;  1LTI D;  4RMF A;  1JWS D;  3TS2 A;  4DNT B;  3PO3 H;  3KJP A;  4DU9 A;  2IHE A;  2PMZ E;  4JVZ A;  5JPM C;  1QZH A;  3NHH A;  2X6G A;  2K5V A;  4B3T Q;  1WD0 A;  1NE3 A;  2A6H C;  4FP5 D;  1RIP A;  2DY8 A;  4LFA L;  2HIV A;  4A3G G;  1CFM A;  1JT8 A;  1HR0 W;  2A69 C;  4GN4 B;  3A0J A;  1F2Y A;  3ER0 A;  4AYB G;  2YU9 H;  3P75 A;  4KTA A;  4UP7 A;  4NW2 A;  2B2W C;  3SK4 A;  2R3Z A;  1CA5 A;  3RMH A;  1BBW A;  5IGB A;  4GN3 B;  1B53 A;  2G9H D;  2IHF A;  2UUB L;  4A3D H;  3GO5 A;  2F0D A;  2Y0S B;  1EY6 A;  3V05 A;  3QOJ A;  4MNO A;  4JI8 L;  1GUG A;  3HOW B;  2IW3 A;  4DK6 C;  3S17 B;  4TSS A;  1MD2 D;  1PZJ D;  4R4T A;  1Y8N B;  1WCM H;  4K8J A;  5C3E G;  2JSO A;  1UE7 A;  4K2L A;  4K0K L;  1D6E C;  4KJN A;  1S40 A;  4BBR H;  2B2T A;  3UDX A;  4PMW A;  5IP7 G;  3HS0 C;  1W2B A;  1Q46 A;  1SAP A;  5JPN C;  3KLR A;  4K5W A;  2X6L A;  1PA6 A;  4HMJ A;  4DXG A;  4L6T B;  2JA5 G;  3DEO A;  4DR2 L;  3GTL H;  2MHV A;  5T1G A;  1AE2 A;  3NUC A;  2R6G A;  4LF5 Q;  3EBE A;  3RUZ A;  4RAU C;  4EGV A;  1DGS A;  3E0E A;  2BH2 A;  3DWQ A;  3HFZ B;  4DAP A;  5M3F H;  2IY5 B;  1PTO D;  3LX0 A;  1WVL A;  4DV7 Q;  1XMQ L;  1DCZ A;  1H9K A;  3OWF A;  4RG1 A;  5IYB G;  1EEF D;  1V43 A;  1MKH A;  2QF7 A;  1F9Q A;  1MJE A;  4R9W A;  1JQY D;  3T51 B;  3W1B A;  1KAW A;  3HOU B;  5CV6 A;  3NPP A;  3BU2 A;  1K0R A;  2A6E C;  4HJA A;  5I6W A;  1NBW A;  4B3S L;  1CHP D;  1CK1 A;  3QG1 A;  4JI1 Q;  4DA2 A;  4L5R C;  2WAQ B;  3NEN A;  5AJ3 L;  1A2T A;  3S1R H;  5IOD A;  4JI6 L;  4RCN A;  2JA7 B;  2JA9 A;  1LYL A;  3CME A;  1X3Q A;  1DM0 B;  2Q2U A;  4IO9 A;  2HT1 A;  2E2D C;  3PQI A;  4IUN A;  1B2T A;  2K04 A;  1VQ4 A;  1HTP A;  1IBK Q;  4DR7 L;  1B44 D;  2QDB A;  3GTG H;  4YCV A;  1SRU A;  3H3V C;  3SE0 A;  1JIC A;  3M4O H;  1XPU A;  3FKI G;  2Z6B A;  4AQY Q;  3IFD A;  1X55 A;  1BR9 A;  3CCQ A;  5EJW A;  3K8A A;  3MA2 B;  1FL0 A;  4MHE A;  5C44 G;  5D14 A;  1Z9F A;  3L2P A;  1SYD A;  1XPO A;  5IYD G;  2MO0 A;  2LXJ A;  5LL6 X;  2K75 A;  4DUY Q;  2ZJR A;  1QB5 D;  2DY7 A;  3KBG A;  2VQE L;  3OSO A;  4YWK A;  3JAM L;  1NMF A;  3CC7 A;  2I5H A;  4DAV A;  2HQE A;  1L0X B;  1F2Z A;  4I7A A;  1JJ2 A;  2RDF A;  2XSC A;  5I2Y A;  1D1K A;  1EYG A;  2R92 G;  1AW7 A;  2SNM A;  4A3K H;  4OWW B;  1ZKO A;  1U0L A;  5E3F A;  2H1E A;  2F0J A;  1SDF A;  2E2I B;  4GZY C;  2OTJ A;  3I4M H;  1PFM A;  2PYK A;  2B3G A;  2JA8 G;  2VW9 A;  4WRD A;  3RD4 A;  2D2C C;  2RSO A;  1ILP A;  3DMU A;  1KAB A;  2CH4 A;  2NN6 H;  4RKB A;  3P1H A;  4L5S A;  1PTO C;  1XXG A;  3G48 A;  4HCE A;  2OF1 A;  4MZ9 A;  2HUG A;  1IYU A;  1ICF B;  4K8I A;  4ODG A;  2B39 A;  4JV5 Q;  4B3R Q;  2XRQ D;  4DR6 L;  4LWC A;  4O42 A;  4F8M A;  1HXY D;  2O5J C;  3D3R A;  3J81 L;  1VF5 C;  2KJX A;  5JJK A;  3AFP A;  3KF6 A;  2UXC Q;  1ESF A;  1IYV A;  5J1Z A;  4A3C G;  2NZO A;  5GAD C;  1W3S A;  3R2T A;  2EYF A;  4RCO A;  1CHQ D;  1TS4 A;  1VQB A;  4TKO B;  4RA8 A;  1GUO A;  4ID6 A;  2JA6 B;  1E1O A;  3FEW X;  3CKI B;  2FMM A;  3CHB D;  3VR4 A;  3Q8D A;  3E5S A;  5IGE A;  2G9D A;  4CKB A;  3ICE A;  1GXD C;  1IW7 D;  1S3O A;  4BA2 I;  5EGT A;  4A3E B;  2RBM A;  1HR0 L;  5FJ8 G;  4JI2 L;  3DWA A;  2KVM A;  2K01 A;  3L3O C;  3IKJ A;  3NQT A;  1K8G A;  1QNU A;  2UXB Q;  2PNR C;  5EPK A;  2LXK A;  1P16 A;  4IN3 A;  3F2D A;  2JE6 I;  2OEO A;  4FYD A;  3U4Z A;  5H1S E;  2E8G A;  2Q8T A;  4JK1 C;  1X32 A;  4LF4 L;  5FLM H;  3BS1 A;  1MI2 A;  4DR4 Q;  1JJC B;  3HOX H;  1PVO A;  1BCP D;  4HJ7 A;  2UU9 L;  1I3Q B;  3SGI A;  2N49 A;  1E22 A;  2F0E A;  1UAP A;  2OWO A;  5CBA E;  3PGZ A;  4OEM B;  4OX9 Q;  4GKK Q;  1JCK B;  3M4P A;  2WP8 J;  1FNU A;  3GTJ B;  4H13 C;  1HUN A;  3FHW A;  1JOK A;  2PMZ B;  5ELO A;  5C4J H;  1D5X C;  5IOC A;  2AUJ D;  2K5N A;  2E2I H;  2EJG C;  3CRL C;  5BR8 Q;  5FO8 B;  3Q24 A;  1OTC A;  4KHP Q;  2F0U A;  5GAG C;  4M8A A;  4QF4 A;  4JI5 Q;  3I4N H;  2EYH A;  4DF7 A;  1CT1 D;  4Y7N H;  4I65 A;  5EBC A;  2QGQ A;  4B9W A;  1EQQ A;  4LFC Q;  1BQQ T;  5COY A;  1DOL A;  1TQO A;  1JOO A;  2ZT9 C;  3TP7 A;  4LF9 L;  4QUF A;  3FPP A;  3BDO A;  4MN3 A;  2EQS A;  2R93 H;  4GNX C;  4GLX A;  4CKC A;  4BBS B;  1JE4 A;  1TS5 A;  3C2P A;  1B7Y B;  4RWS C;  4JBK A;  3ZJY C;  3V96 A;  1CTM A;  2AKW B;  5I6Y A;  2PO4 A;  1K0S A;  2AQ3 B;  5KIX A;  3WOE A;  4GN5 A;  1I5F A;  4RHS A;  3PO3 G;  3G71 A;  4LUZ A;  3ERS X;  1E24 A;  3LNN A;  2SNS A;  1S4Z A;  4HSV A;  1Y8P B;  1EFW A;  4UY8 C;  3DWP A;  3TME A;  3C3L A;  1NTG A;  4JI0 Q;  1VQ6 A;  3NEL A;  1IW7 C;  2WB1 E;  5C4Z A;  1C7Y A;  4QUC A;  1JWM D;  1V9P A;  3W2D A;  1XNQ Q;  2SOB A;  2Q8I B;  2JA6 H;  3S2H B;  2BOS A;  3IRB A;  3PIO 3;  1KXL A;  2HHH L;  1X54 A;  2FHT A;  3RR5 A;  2Q2I A;  4NMZ A;  2JEA I;  1IKL A;  4EQO A;  2K14 A;  4K6L A;  3HOV H;  2PW5 A;  3S1M H;  1EWH A;  2PW7 A;  4A3D G;  1PXU A;  1FR3 A;  4CKE A;  4DK1 A;  1XWE A;  4XT3 B;  4O2D A;  1DJR D;  2VZA A;  4KD3 A;  2GVB A;  1BCP C;  1SR3 A;  3HKZ E;  4O0A A;  4A3F H;  4Q5V A;  2KEC A;  5K36 H;  4QMG A;  4L63 B;  5FLX c;  3G7L A;  2G5D A;  4DV2 L;  1YHB A;  1QIL A;  4BA1 I;  1WCM G;  3FP9 A;  4FF2 A;  4V19 0;  5BN5 A;  2EYM A;  2WAC A;  3NE5 B;  2JK8 A;  2RHS B;  1WFQ A;  4ZYS A;  4BBR G;  1IHZ A;  4IPH A;  5CV7 A;  4IZ8 A;  5CGK A;  3J81 j;  1CQF A;  1SXT A;  4E6I A;  1QCB D;  4P71 A;  4A3I H;  1KQS A;  1N33 L;  2RQX A;  1GKH A;  3VR3 A;  1ROD A;  1HCZ A;  4IJL A;  4OWT B;  1YIJ A;  1E7Z A;  1KNE A;  1GUS A;  4A3B H;  3N52 A;  2MP1 A;  4KN4 C;  5M3F G;  4P2C B;  4DUZ L;  2L4N A;  1PH4 A;  4APV A;  2KHI A;  3IFT A;  1AZP A;  1RTN A;  4X65 L;  3K80 C;  4DPG A;  2JEB I;  1ASZ A;  5IP9 H;  2V4D A;  2F0T A;  3HGB A;  5I9O A;  3CAM A;  1QOH A;  2B2V C;  1EY9 A;  3OPO A;  2RKS A;  2AQ2 B;  5C4X H;  1LAB A;  4B3M L;  1DYQ A;  1TR5 A;  1CKN B;  4XYO A;  3I55 A;  1Y1W H;  4B3S Q;  3ULP A;  4KI0 A;  2E2H B;  1LUZ A;  1BBX C;  4JPB W;  2A19 A;  1ZXT A;  1M90 C;  1LV9 A;  1VQF A;  1N36 Q;  3GTO H;  2HIX A;  3PO2 H;  2F4V L;  1PDQ A;  3U9S A;  1XTD A;  1D7Q A;  2EVB A;  5C5M A;  1YHA A;  3HKZ G;  2PI2 E;  4DR1 L;  2EY1 A;  3OWE B;  4Z9C B;  5M5Y B;  3PF4 A;  5EKK A;  1TWH H;  3A8I E;  2NZ1 D;  5ELD A;  5IYC H;  2KCN A;  1K9M C;  2CWA A;  3BYT B;  1C8C A;  1XTC D;  3LGJ A;  1LTB D;  1TWF H;  1STH A;  2Y0S G;  1NAP A;  1B9N A;  4A3K G;  2MFI A;  2VQE Q;  3O13 A;  1FVI A;  4IUP A;  4FXK C;  4CJ2 C;  3CCJ A;  3PUY A;  5HY6 A;  4JI3 Q;  3ULJ A;  4K5V A;  2ALY B;  3AB9 A;  3I4M G;  5IT9 c;  4TVA B;  3K7U C;  2Z6K C;  3TDQ A;  1GM5 A;  1K73 C;  2F0N A;  5F2D A;  1HQR D;  1X56 A;  1Q1B A;  3S15 H;  2ICE C;  2UUA Q;  5KNB A;  3T1Y Q;  2OTL A;  1B70 B;  2NN6 G;  4LW1 A;  1CUK A;  1ENC A;  3VR6 A;  3T13 A;  3SDZ A;  3MWY W;  1DZ1 A;  3Q22 A;  1KRT A;  4CDE C;  1B8A A;  3E0J A;  4BS9 A;  2VY3 A;  5KYI A;  3K7A B;  1MSH A;  5FLX L;  1HFN A;  1RCV D;  3CC4 A;  2NVQ B;  1RHP A;  3KK7 A;  3PUW A;  4JG2 A;  3FDT A;  1J5E L;  4X64 Q;  3BVG A;  1EY0 A;  1CZG A;  2PZW A;  1STE A;  1PH6 A;  3NP8 A;  5A2Q L;  4QB4 A;  2K4K A;  2RDH A;  5IWA L;  3DLL A;  4FF1 A;  2MUY A;  4DV3 L;  4JW0 A;  2O5I C;  1Q8K A;  4P74 A;  1HA5 A;  3HOY H;  1WOC A;  2NVX B;  4OO1 I;  2N78 A;  1GD7 A;  3KLS X;  1EYC A;  3PF5 A;  3GTM H;  5CBE E;  1A8V A;  2DJG C;  4PZ7 A;  1L0W A;  1YJW A;  2D0O A;  4RKL A;  4QIW E;  1I50 B;  2P5Z X;  1B9M A;  4JYA L;  1GOZ A;  1O7I A;  2VQF L;  2NN6 I;  1KNA A;  4IJH A;  4RGN A;  2ZTE A;  3G6J B;  1I4G A;  3HEJ A;  1EQR A;  1H9S B;  1B3A A;  1VQA A;  5A35 A;  3ND8 A;  4NXM L;  2B2Y C;  4ULL A;  1PTO F;  2J0T D;  5FLM G;  4RHR A;  1SEB D;  5M5Y H;  1SRO A;  3HOX G;  3CU7 A;  3CF5 A;  4MTK A;  1V1P B;  2RF4 A;  3OYY A;  3GTP H;  3JAM c;  1L1O C;  4LJZ C;  1PH3 A;  4LUO A;  3I2Z A;  4LF6 L;  2EXZ A;  5LMN L;  4N9T A;  4RGO S;  4DR5 L;  1G2T A;  4PZ6 A;  2YYZ A;  5CV4 A;  4A3M H;  1TII D;  3EVQ A;  1YJ9 A;  1HA6 A;  3TSS A;  2QDL A;  1WTH A;  5CYU A;  3HKS A;  1O78 A;  2K05 A;  2MJ8 A;  1I94 L;  3I4N G;  3BDL A;  1PTO B;  4JBJ A;  3T4A C;  1K8O A;  1OXU A;  4BY1 H;  4CBV A;  1FNV A;  4HSP A;  1VQH A;  1HNX Q;  1AN8 A;  2MO1 A;  1LTT D;  3A55 A;  3D0F A;  1PV4 A;  2B63 B;  3RZO B;  2E2J B;  5JJL A;  3STB C;  1JWU D;  1ASY A;  4XYQ A;  1VQO A;  2DNC A;  3BYY B;  2IPK D;  2R93 G;  1EFI D;  2FXQ A;  3TRZ A;  5ISR A;  1UE6 A;  4LUV A;  4HTH A;  1I4R A;  1LT5 D;  2CCZ A;  4WFN 3;  3KOJ A;  4YHH L;  1Z6H A;  1KC8 C;  5IT9 L;  3GTK H;  4C3I B;  3J81 c;  3RNU A;  1ONL A;  4J15 A;  1WTW A;  4C3J B;  3QWN A;  1S5F D;  4KHZ A;  1FJG Q;  1I4Q A;  2BDN A;  2A5H A;  2K50 A;  5NUC A;  5GAH C;  2EYJ A;  4UPA A;  3URY A;  2JA6 G;  2FMC A;  3IL8 A;  1S5E D;  2CWP A;  1G91 A;  4GLA C;  1VF7 A;  2HQL A;  2PCF B;  4X3T A;  3MAQ A;  1C48 A;  3HOV G;  4KMU C;  2EE1 A;  2Z9H A;  3BZK A;  2IX1 A;  1Q7Y C;  5C6A A;  2ENB A;  3E9H A;  2HHH Q;  5DAU A;  2EY5 A;  5M5W B;  1E2Z A;  3S2D B;  2IX0 A;  4A3F G;  1EIY B;  1VQK A;  5K36 G;  2ZTC A;  1MSG A;  3GD7 A;  3M7G A;  1VQ9 A;  4DV4 Q;  1BNZ A;  2RVL A;  3MXG A;  3X3M A;  3VYS A;  5KND A;  1EU4 A;  3EN2 A;  4DV2 Q;  2NVY H;  4DV1 L;  4JI4 Q;  4JI7 Q;  1K83 B;  4EX5 A;  1EYA A;  1D5M C;  3PIO A;  1A6X A;  4DV5 Q;  4A3I G;  4K6D A;  3P20 A;  2HCC A;  1UUP A;  1E2V A;  1K3R A;  3I8Z A;  2LKV A;  5IIF A;  4M1U B;  4ZCK A;  1PRT D;  4A3L H;  1D8L A;  1IBL Q;  2LSS A;  4A3B G;  3BZD B;  3GDE A;  1PFS A;  1WTP A;  1CKO A;  1K8M A;  1N33 Q;  2NTT A;  5HUR A;  1PTO H;  4U67 3;  3I90 A;  4GNX B;  1D2B A;  1R9T B;  2B63 H;  4X62 Q;  4FDB A;  1KLU D;  5IP9 G;  4ILW A;  1G29 1;  1F9R A;  2AWO A;  5JEA H;  5JJZ A;  5C4X G;  4IUV A;  4HCS A;  3VDY A;  1BCP F;  2XRS D;  4GS3 A;  4OIK A;  4KD4 A;  1IBM L;  1OXS C;  4IUR A;  1CKN A;  2RDG A;  1T9H A;  3K57 A;  1Y1W G;  3M4Y A;  5LMU L;  3HOW H;  4A93 B;  1QNK A;  3S17 H;  2WII B;  1NJI C;  3HOZ B;  1QJO A;  3CC2 A;  1MHW C;  4LAA A;  2GVA A;  1PH7 A;  3DXJ C;  4OO1 H;  2YTX A;  3A8K E;  3PO2 G;  4C3J H;  2MGS A;  3W1G A;  3IAY A;  4RH6 A;  2F0V A;  3AFQ A;  4HR7 B;  2EZV A;  4R4O A;  2UUC Q;  3ERQ A;  2B2W A;  2L0C A;  2PQE A;  1GUT A;  4DV6 L;  3NSW A;  4R8N A;  2L5T A;  1STB A;  2F4V Q;  4NXN Q;  3TRE A;  3NTH A;  5IYC G;  4JOI C;  1BCP B;  5C0X J;  4A3G B;  1RKN A;  2XVS A;  1QZG A;  1LTG D;  1NSN S;  2XN9 C;  4X6A H;  3QOL A;  4AYB B;  2IJ0 A;  4X66 Q;  1O7Z A;  1C9O A;  4KKS A;  5M5W H;  1TT2 A;  1DOM A;  2N8N A;  3TP6 A;  1OO9 B;  2N3S A;  3T16 A;  2UXD L;  4OXP A;  3HOU H;  2KED A;  3KDF B;  5M5X B;  1X3E A;  3A8J E;  4EQP A;  3OHX C;  4X3K A;  5E4W C;  1TVX A;  1NR2 A;  3K5O A;  3A74 A;  4GLV B;  4C1N I;  2JA7 H;  1Q86 C;  2KCT A;  2EDG A;  4DR3 L;  1E0B A;  2LY7 A;  1LAC A;  1PRT C;  3PUX A;  1YHQ A;  4BY7 B;  1B1Z A;  2CQA A;  4POG A;  3ZYY X;  3NK9 A;  5DLQ E;  5C3E B;  2K33 A;  3TP8 A;  4C2M B;  3OTO L;  1F77 A;  5IGD A;  2K28 A;  3HG9 A;  3AYH B;  2B8F A;  1GHJ A;  4DGZ A;  3GQB A;  3J80 E;  4YIJ A;  1EOT A;  1X3G A;  1OXT A;  1N34 L;  2IL8 A;  1M8A A;  3BZC A;  4IPD A;  1XNR Q;  1XMO L;  4NP5 A;  2GA4 B;  1N32 Q;  1PH1 A;  2O4X A;  4XQQ A;  1UEB A;  3A5Z B;  2D62 A;  3L0O A;  3PCO B;  2RHQ B;  1CKM A;  3R8B A;  3MXU A;  2O2L D;  2I46 A;  4X3U A;  1VQG A;  4LFB Q;  4WJ4 A;  3C46 A;  1ENA A;  4CJ1 B;  1VS0 A;  3HOY G;  3CCV A;  4QJF A;  3R3O A;  3WDN A;  3X3N A;  2EOT A;  3KLS A;  2ES2 A;  2K5D A;  5IWA Q;  4G7O C;  4HED A;  1SJH D;  4XTC S;  5KRU A;  4A93 H;  2EIF A;  1U5K A;  2K1B A;  1L2F A;  2PNH A;  2B2U C;  3AMU A;  1NY4 A;  4LF7 L;  3ULL A;  1EWI A;  4FF3 A;  1I4H A;  3S1N B;  3WOF A;  3DHQ A;  1EY7 A;  1H9S A;  2K5W A;  2V1C C;  1RJT A;  1VQN A;  2A8V A;  3BDC A;  3KBX A;  4DNI A;  3FKI B;  1E1T A;  4H44 C;  2I0Q A;  2BH8 A;  2CVR A;  3S16 B;  1KLG D;  1U4R A;  5JVG 3;  3KF8 B;  1HFG A;  1V1P A;  1WYD A;  1KIX A;  5C44 B;  4NXM Q;  1SE8 A;  4TRD A;  2FJ2 A;  2XNA C;  2AWN A;  1YIT A;  1AEX A;  1G51 A;  1MGS A;  4GOP C;  1LT4 D;  1B50 A;  4A3M G;  2F03 A;  2F1M A;  5M5X H;  3K5N A;  4G7Z C;  1TWG B;  2TMP A;  3L7Z C;  2NWG A;  5DNF A;  4DNR B;  5LMN Q;  2WFW A;  1K8A C;  4B08 A;  3J80 i;  1JOR A;  1S5C D;  3D4R A;  4BY1 G;  3ITP A;  1I6V C;  1MBY A;  1QVF A;  1STG A;  1VQD A;  4H0L C;  1O7L A;  3CW2 C;  2A1A A;  4BY7 H;  4TQU S;  4IOA A;  4A75 A;  4JC0 A;  3G6E A;  2JA8 B;  4LFA Q;  4Q0F A;  1I94 Q;  2N88 A;  1R4P B;  3OMG A;  4A3E H;  1M1K C;  4KKU A;  2K7V A;  3I4O A;  4C2M H;  4XQN A;  1V1O A;  1TY2 A;  1F9S A;  2L11 A;  4GKJ L;  2NVT B;  5JEA J;  4LF5 L;  2EPB A;  2CHB D;  2CQO A;  3TEH B;  3GTQ B;  5ELB A;  5IGF A;  2UUB Q;  5C0X I;  4DV7 L;  2EYL A;  4YWL A;  2DN8 A;  4JI8 Q;  3EJI A;  3NQI A;  3EIV A;  3CPF A;  1I3Q H;  3M3Y B;  3MEH A;  5ELC A;  2Y0S E;  3R2I A;  1CSQ A;  3DEP A;  1SNM A;  5FK9 C;  5M9O A;  4JI1 L;  3MTS A;  3HRZ C;  3TZU A;  3VYR A;  5FOB B;  2DGY A;  3QO2 A;  3GTJ H;  4B9X A;  1IXR A;  4ME3 A;  3H0G B;  1G6P A;  4K0K Q;  2C35 B;  4QL5 A;  1HNZ L;  3K58 A;  3H09 A;  2XWJ B;  3UE1 A;  1T5E A;  1IBK L;  1WTR A;  3C1F A;  5BN4 A;  4DR2 Q;  4FXD A;  3W5O A;  2I07 B;  4IUU A;  2ZXO A;  3TP5 A;  3NWT A;  3VR2 A;  4AQY L;  2K52 A;  1H9J A;  1KDA A;  2BA0 A;  3T1H L;  3QR8 A;  1L1O B;  2F3W A;  2HDL A;  5C3X A;  3F2B A;  2QKI C;  1XMQ Q;  1EY4 A;  1SMY D;  1BVS A;  1WD1 A;  1WTO A;  4DUY L;  1JJG A;  4C3H B;  1SE2 A;  3M7N A;  2M00 A;  2AMC B;  4BBS H;  5I4D A;  3PMF A;  3J7A V;  3MZ5 A;  3PUV A;  3RLF A;  4KK7 A;  5G3L D;  2F0W A;  1II3 A;  3MXP A;  3RZD B;  2Z4I A;  3I70 A;  4UP9 A;  1PHJ A;  5AJ3 Q;  1LLR D;  3GV3 A;  4JI6 Q;  2QCP X;  4F87 A;  2NUC A;  4FXG C;  3SEB A;  1H95 A;  3G4S A;  2EYO A;  2IT1 A;  2NB0 A;  3K0Y A;  4A3L G;  4CHT B;  1ZEQ X;  2ZXP A;  2VUM B;  3D4D A;  1VQJ A;  4ZUJ A;  2QEX A;  3H3V I;  5K5P A;  1TWG H;  2L12 A;  1IL8 A;  1JB7 A;  4DR7 Q;  1N9W A;  3S2H H;  2R7F A;  1BXT A;  1QE6 A;  2PI2 A;  5HGT A;  4GNX A;  3K59 A;  2B63 G;  3KLW A;  5KNC A;  1SJE D;  1FGB D;  3GV6 A;  1U4P A;  4HN7 A;  2PQA B;  3MFY A;  5JEA G;  1C0A A;  4IFD J;  5EAY A;  4JV5 L;  4B3R L;  1N8R C;  4BXX H;  3HOW G;  2QIL A;  3MEF A;  5ELF A;  3N6R A;  4WJ3 M;  1WJJ A;  1Y1V B;  3K0X A;  4IQZ A;  3S1Q B;  2LMC B;  1SE3 A;  4HAE A;  4OO1 G;  1AP0 A;  2UXC L;  5FO9 B;  4C3J G;  2ZTD A;  2NZH A;  4N8F A;  4L5Q A;  3W3A A;  2ZJQ A;  1OXV A;  2BA1 A;  5E1F A;  1SYF A;  3PO3 B;  1HQM C;  5DM6 3;  1VQC A;  1SFO B;  1SSO A;  1STA A;  3H0G H;  4R4Q A;  1BKB A;  1O7Y A;  4POF A;  1SND A;  3SK6 A;  1F2M A;  1TS3 A;  2YU9 B;  3I91 A;  1HRJ A;  1PYB A;  2B2T C;  1SMY C;  1S72 A;  1EQV A;  2UXB L;  1T5X D;  2C9O A;  4WOR A;  4PMC A;  5EPL A;  2E5L L;  2JP1 A;  2KHS A;  3JAM E;  3VR5 A;  4I7Z C;  2A69 D;  3HOU G;  3EFX D;  4DR6 Q;  4A3D B;  1AE3 A;  2KEN A;  3KDF A;  4YY3 L;  4DR4 L;  2WAQ G;  3VYU A;  1J9O A;  2JA7 G;  4DK0 A;  4HIK A;  5GAE C;  2E74 C;  5COR A;  3R93 A;  4OX9 L;  4CDC C;  2CFM A;  4GKK L;  1AH9 A;  1X6O A;  1VDZ A;  1WCM B;  5J39 A;  3QJY A;  3QB3 A;  2E2H H;  5FKA C;  3RZD H;  4H7B A;  4YCW A;  4BBR B;  4OL7 A;  2Q2T A;  2C5C A;  2VUM H;  5T1I A;  3D6C A;  3CP0 A;  3OIQ A;  5BR8 L;  3CD6 A;  2PPB C;  4KY6 A;  1BBU A;  4KHP L;  3A5U A;  1HR0 Q;  1F9P A;  1A0I A;  1SMX A;  4JI2 Q;  4JI5 L;  2H4O A;  2QA4 A;  2B2V A;  2QW7 A;  2F0G A;  4RFB A;  1EYD A;  1KAA A;  2XIW A;  1XPR A;  1MIU A;  1RF2 D;  4XXE A;  5C0X H;  5M3F B;  2DJF C;  3UI2 A;  1N34 Q;  4DAM A;  2OXP A;  3J81 E;  1QVC A;  2KBN A;  4LF4 Q;  3MC0 B;  1Z47 A;  4J8Q A;  1DON A;  3OMC A;  3ERO A;  2UU9 Q;  1Q81 C;  1NR4 A;  5J22 A;  4IPG A;  2X69 A;  1ET9 A;  1QWY A;  5CV8 A;  4A93 G;  4DV0 L;  1Y1V H;  1EIH A;  2AHO B;  5E7N A;  3S1R B;  1VCI A;  2WB1 B;  2KHJ A;  3S1Q H;  2JN4 A;  2WKC A;  1A3T A;  2L1B A;  1AFP A;  2E76 C;  3NBH B;  2ZM6 L;  1PRT F;  4JI0 L;  2F0F A;  1Z7T A;  3JAM i;  2XWB B;  2VNU D;  1BDO A;  4UAI A;  4L8J A;  4DKA C;  1XNQ L;  5JJI A;  3GTG B;  4K14 A;  4P72 A;  2HDM A;  3TN2 A;  1SFO H;  1STN A;  3M4O B;  5M3M B;  4LF7 Q;  1UE5 A;  3VA5 A;  1RD9 D;  2RCN A;  5EKI A;  3KF8 A;  3KUP A;  4ZLT F;  3CXC A;  1QUQ B;  4LF9 Q;  3H6M A;  3HKZ B;  3K7A H;  1SNO A;  2NVQ H;  2M9V A;  4UDU C;  1HPC A;  4P73 A;  2WKD A;  2Z6K A;  4G4K A;  3PIP A;  4PNY A;  3NTI A;  1I4X A;  3SK8 A;  4NKL A;  4IFD I;  5D65 A;  1PRT B;  3RN5 A;  4O1N A;  2EJM A;  3BVZ A;  4A3K B;  2D5D A;  3FMC A;  2KQ3 A;  2Z1C A;  2R7Z B;  4ALP A;  1DOK A;  3QIA A;  4OIJ A;  1EY5 A;  1YZ6 A;  3H3V H;  3S14 B;  1Q90 A;  1SLJ A;  1CZW A;  2EJF C;  2LFN A;  4KY5 A;  1LTL A;  4KN7 C;  5IY0 A;  1X3P A;  1LTR D;  4KKT A;  2KCM A;  2NVX H;  3I4M B;  1FYC A;  3PV0 A;  4PZ8 A;  4K5X A;  4A3E G;  5D3D A;  3UDI A;  5IE8 A;  4G57 A;  1M4V A;  3J81 i;  5JOB A;  1VQ7 A;  1C4Q A;  1VQL A;  1I50 H;  2RA4 A;  4ZQ3 A;  1TWC B;  4R4C A;  2GN5 A;  3K6O A;  1HZ9 A;  1HZA A;  4ZK9 B;  1PFN A;  2XGT A;  1PH8 A;  4QY7 A;  1PYW D;  4GKJ Q;  4UHV A;  3K5M A;  2YTV A;  4IAL A;  4F7X A;  2Q2H A;  1CA6 A;  1B3Q A;  1D5Z C;  1A62 A;  4PQX A;  1EEI D;  1V1Q A;  4R4I A;  3SR1 A;  1YBY A;  1GUW A;  1EIF A;  1KRS A;  1X65 A;  4CDF C;  4IOC A;  3M4Q A;  4N9P A;  4C1N K;  5E4X A;  1VMP A;  2VS1 A;  1SYG A;  1RDP D;  1LTA D;  3LWE A;  2KEE A;  2KCC A;  1HNW L;  2OT2 A;  1VQP A;  1I4P A;  2AQ1 B;  2J4X A;  4DXF A;  1PMR A;  5IGC A;  4HMI A;  4DFA A;  1KDB A;  1IKM A;  1N36 L;  5CR3 A;  4NDX A;  2B2Y A;  2WIN B;  4KJO A;  5KEE A;  1Q82 C;  4KHV A;  1HNZ Q;  1TY0 A;  1JE5 A;  2RCF A;  2E2J H;  5KYL A;  3RZO H;  4A3J B;  2I5M X;  2MQH A;  1L1O A;  2MPM A;  2IX3 A;  1GJX A;  4DN4 M;  4DUZ Q;  2L55 A;  1D1I A;  5M3M H;  4GOP B;  3CCE A;  3I3C A;  4PMB A;  1HTL D;  4BBS G;  4X65 Q;  1CI3 M;  3HP3 A;  3ONA B;  3T1H Q;  3D8G A;  3RLN A;  1FD7 D;  4CGY B;  3BVM A;  3B6Y A;  3EA6 A;  3J7Y W;  4HID A;  3TZD A;  3MHB A;  3T53 B;  1HJP A;  1FNW A;  1KDC A;  3HOX B;  4C3I H;  1QVG A;  1PH2 A;  1BF4 A;  2A74 C;  3DM3 A;  4OHJ A;  4B3M Q;  1JMC A;  4BY7 G;  1PH9 A;  4PV1 C;  4ZRZ A;  3WWV A;  2K5H A;  4JI3 L;  5C5L A; 
#chains in the Genus database with same CATH homology
 4B3T Q;  2AWN A;  2K5V A;  1YIT A;  3UDG A;  1NE3 A;  3PF4 A;  1PH5 A;  3CCU A;  1TWH H;  1G51 A;  5IYC H;  4GOP C;  1RIP A;  4LFA L;  2HIV A;  1K9M C;  4A3G G;  1JT8 A;  1X9N A;  1HR0 W;  2CWA A;  4GN4 B;  3U4V A;  4A3M G;  2R7Z H;  3A0J A;  3ER0 A;  4AYB G;  4KLK A;  2YU9 H;  3S14 H;  5M5X H;  3LGJ A;  4UP7 A;  1TWF H;  2Y0S G;  3L7Z C;  4A3K G;  2MFI A;  4B3S Q;  5LMN Q;  2WFW A;  2VQE Q;  1K8A C;  2UUA L;  1FVI A;  3J80 i;  3T1Y L;  1BBW A;  4BY1 G;  4GN3 B;  3CCJ A;  3PUY A;  2PQA A;  5HY6 A;  4JI3 Q;  2IHF A;  3ULJ A;  2UUB L;  2ALY B;  4DR1 Q;  1VQD A;  3GO5 A;  5ELN A;  1QVF A;  4A3D H;  3CW2 C;  3MXN B;  3I4M G;  2A1A A;  5IT9 c;  4BY7 H;  3I56 A;  4TQU S;  4IOA A;  1HZC A;  4A75 A;  4JC0 A;  3G6E A;  3S2D H;  1TWC H;  4MNO A;  4LFA Q;  3I7F A;  3K7U C;  2Z6K C;  4TVA B;  4JI8 L;  1I94 Q;  4A3E H;  4BXX G;  1M1K C;  1GM5 A;  1WI5 A;  3I4O A;  4C2M H;  1K73 C;  4DK6 C;  4GKJ L;  4R4T A;  5JEA J;  1WCM H;  1X56 A;  4LF5 L;  4JBM A;  1Q1B A;  4X64 L;  3S15 H;  2UUA Q;  4UP8 A;  5C3E G;  3T1Y Q;  2CQO A;  1B70 B;  3TEH B;  2NN6 G;  4LW1 A;  1UE7 A;  1CUK A;  4K0K L;  2UUB Q;  1S40 A;  4BBR H;  5C0X I;  1HH2 P;  3UDX A;  4PMW A;  1KRT A;  1K83 H;  4OWX B;  5IP7 G;  4DV7 L;  1Q46 A;  1W2B A;  4YWL A;  1B8A A;  2R7D A;  2VY3 A;  4JI8 Q;  2CKZ B;  1PA6 A;  3EIV A;  2JA5 G;  3CPF A;  1I3Q H;  3H0G G;  4YWM A;  4DR2 L;  3CC4 A;  3KFU A;  3GTL H;  2Z0S A;  1AE2 A;  1XNR Q;  2Y0S E;  3PUW A;  1CSQ A;  4JG2 A;  1J5E L;  2R6G A;  4JI1 L;  4LF5 Q;  3EBE A;  4X64 Q;  2DGY A;  1DGS A;  3GTJ H;  1J6Q A;  1IXR A;  4ME3 A;  1G6P A;  3E0E A;  2BH2 A;  4K0K Q;  3HFZ B;  5M3F H;  1PH6 A;  2IY5 B;  2C35 B;  4QL5 A;  4DV7 Q;  1XMQ L;  2K4K A;  1HNZ L;  5IWA L;  3DLL A;  4RG1 A;  5IYB G;  1KD1 C;  2XTI A;  1V43 A;  1MKH A;  1VQE A;  3UE1 A;  1MJE A;  4DV3 L;  1Q1E A;  1R9T H;  3UDF A;  1IBK L;  3W1B A;  4A3J H;  1KAW A;  1Q8K A;  4P74 A;  3BU2 A;  1K0R A;  4DR2 Q;  3W5O A;  3HOY H;  1WOC A;  1UWV A;  4HJA A;  4OO1 I;  1NBW A;  2N78 A;  4AQY L;  2K52 A;  1J5E Q;  4B3S L;  1GD7 A;  4HIM A;  4JI1 Q;  4DAY B;  4L5R C;  3PF5 A;  3NEN A;  5AJ3 L;  3S1R H;  2E5L Q;  4JI6 L;  3GTM H;  1OXX K;  1A8V A;  2BA0 A;  4PZ7 A;  2JA9 A;  3T1H L;  1Q12 A;  1LYL A;  1L0W A;  1L1O B;  3CME A;  2D0O A;  1YJW A;  4QIW E;  3F2B A;  2Q2U A;  4IO9 A;  2HT1 A;  4YY3 Q;  1XMQ Q;  4JYA L;  1O7I A;  1BVS A;  2VQF L;  2NN6 I;  4IJH A;  4DUY L;  1JJG A;  2ZTE A;  3M7N A;  3HOZ H;  2AMC B;  4DV3 Q;  1EQR A;  1VQ4 A;  1IBK Q;  4BBS H;  4DR7 L;  1VQA A;  3PUV A;  3RLF A;  1VQ5 A;  3GTG H;  3KYH C;  1SRU A;  4JBW A;  4YCV A;  5GQO A;  2MNA A;  1VQM A;  4NXM L;  2VUM G;  3M4O H;  1XPU A;  1KHI A;  4B3T L;  3FKI G;  5FLM G;  4AQY Q;  1X55 A;  5M5Y H;  3CCQ A;  1SRO A;  4UP9 A;  3HOX G;  5AJ3 Q;  1PHJ A;  1KL9 A;  4JI6 Q;  3K8A A;  3CF5 A;  1YEZ A;  2RF4 A;  1FL0 A;  3OYY A;  3GTP H;  1H95 A;  3JAM c;  5C44 G;  1Z9F A;  3L2P A;  2IT1 A;  3G4S A;  1L1O C;  4A3L G;  1PH3 A;  1XPO A;  1HNX L;  5IYD G;  3AEV A;  1VQJ A;  2MO0 A;  3I2Z A;  2LXJ A;  4LUO A;  4AH6 A;  4LF6 L;  4JYA Q;  2VQF Q;  2QEX A;  3H3V I;  5C0X G;  2K75 A;  4DUY Q;  1TWG H;  1GVP A;  2VQE L;  2ZJR A;  5LMN L;  3CC7 A;  3F8T A;  4YWK A;  1JB7 A;  1NMF A;  1TWA H;  2I5H A;  4DR7 Q;  4DR5 L;  4A3G H;  1N9W A;  4PZ6 A;  2YYZ A;  3S2H H;  2R7F A;  1JJ2 A;  4A3M H;  2PI2 A;  4OON A;  4GNX A;  1YJ9 A;  2B63 G;  3KLW A;  1EYG A;  3HKS A;  2R92 G;  3CCM A;  4A3K H;  4OWW B;  3UE0 A;  1U0L A;  1I94 L;  3I4N G;  4JBJ A;  2PQA B;  1OXU A;  4BY1 H;  3J80 c;  1Y14 B;  3M9B A;  1YI2 A;  1VQH A;  1Y1V G;  1HNX Q;  5JEA G;  2OTJ A;  4LF6 Q;  1GO3 E;  2MO1 A;  1PV4 A;  3D0F A;  3I4M H;  1C0A A;  5JJL A;  4IFD J;  2B3G A;  3STB C;  5EAY A;  1ASY A;  2JA8 G;  2VW9 A;  4JV5 L;  4B3R L;  4DR5 Q;  1N8R C;  4BXX H;  1VQO A;  1FJG L;  3HOW G;  1XJV A;  3MEF A;  4WJ3 M;  2R93 G;  4Y52 H;  1WJJ A;  4L5T A;  4DV0 Q;  3K0X A;  3J7A 5;  2FXQ A;  3TRZ A;  4JOI A;  4JCV E;  1UE6 A;  4LUV A;  1E3P A;  2EXD A;  4HJ5 A;  1IL2 A;  4OO1 G;  2UXC L;  2L15 A;  5C3E H;  2ZTD A;  2CCZ A;  2NZH A;  3KOJ A;  4YHH L;  2ZM6 Q;  4L5Q A;  1KC8 C;  2ZJQ A;  4L5S A;  1EUJ A;  3GTK H;  1OXV A;  2BA1 A;  2ASB A;  3G48 A;  5IP7 H;  3J81 c;  3RNU A;  4R1J A;  1VQC A;  4MZ9 A;  4YCU A;  4DK3 C;  4J15 A;  4JV5 Q;  4B3R Q;  5GRO A;  4KHZ A;  1QUQ A;  1FJG Q;  4LWC A;  4DR6 L;  2JA5 H;  3H0G H;  4R4Q A;  1BKB A;  4POF A;  2K50 A;  5GAH C;  2DUD A;  4UPA A;  5JJK A;  3AFP A;  3KF6 A;  4HJ9 A;  2JA6 G;  2UXC Q;  4A3C G;  2CWP A;  2NZO A;  4YHH Q;  5GAD C;  4DV4 L;  2OQK A;  1W3S A;  4GLA C;  1PYB A;  1S72 A;  2UXB L;  2HQL A;  3HOV G;  1VQB A;  2E5L L;  1P8L A;  5IYB H;  1E1O A;  3BZK A;  2IX1 A;  1Q7Y C;  3HOU G;  4DR6 Q;  3E9H A;  3Q8D A;  1AE3 A;  2HHH Q;  4JI4 L;  4JI7 L;  2KEN A;  3ICE A;  3KDF A;  3M85 A;  4YY3 L;  1S3O A;  4DR4 L;  5LMN W;  4DV5 L;  2WAQ G;  2IX0 A;  4A3F G;  1EIY B;  1VQK A;  1LM0 A;  4BA2 I;  4XIG S;  5K36 G;  2JA7 G;  2ZTC A;  4HIK A;  4EQ5 A;  3GD7 A;  5GAE C;  5FJ8 G;  1HR0 L;  5J3B A;  4JI2 L;  1VQ9 A;  4DV4 Q;  4OX9 L;  4GKK L;  2CFM A;  1AH9 A;  1X6O A;  1K8G A;  2UXB Q;  3H15 A;  1IBL L;  2LXK A;  1P16 A;  2E2H H;  3F2D A;  3RZD H;  1FGU A;  2JE6 I;  4YCW A;  3S1N H;  3EN2 A;  4DV2 Q;  2NVY H;  5HGQ A;  4DV1 L;  3U4Z A;  4JI4 Q;  5H1S E;  4JI7 Q;  4QGU A;  2E8G A;  2Q2T A;  4EX5 A;  2VUM H;  1A63 A;  3RLO A;  4LF4 L;  4MTN A;  3FKI H;  5FLM H;  3CP0 A;  5BR8 L;  3PIO A;  1JJC B;  4DV5 Q;  3CD6 A;  3S16 H;  4X62 L;  4A3I G;  4DR4 Q;  1BBU A;  3HOX H;  4KHP L;  4HJ7 A;  2UU9 L;  1PVO A;  3A5U A;  3SGI A;  2N49 A;  1HR0 Q;  1E22 A;  1K3R A;  1A0I A;  1SMX A;  4JI2 Q;  4JI5 L;  2QA4 A;  3PGZ A;  5C44 H;  2OWO A;  4OX9 Q;  4GKK Q;  4A3L H;  1D8L A;  1IBL Q;  5IYD H;  1XPR A;  2LSS A;  1MIU A;  2OQ0 A;  2WP8 J;  3M4P A;  4HIO A;  2ZJP A;  4A3B G;  3GDE A;  3FHW A;  1PFS A;  1CKO A;  4DV1 Q;  1N33 Q;  5ELO A;  5C4J H;  3U50 C;  1N34 Q;  4DAM A;  3TS0 A;  2K5N A;  4GNX B;  4LF8 L;  1QVC A;  2KBN A;  2E2I H;  4LF4 Q;  2WAQ E;  4LNQ A;  3BJU A;  2JQO A;  5BR8 Q;  1Z47 A;  3CCS A;  2WB1 G;  2B63 H;  4X62 Q;  4FDB A;  4KHP Q;  1OTC A;  2UU9 Q;  3TQY A;  1Q81 C;  2R92 H;  5IP9 G;  3F2C A;  1HNW Q;  3CCL A;  1G29 1;  5GAG C;  4IPG A;  4JI5 Q;  3I4N H;  2AWO A;  2YV5 A;  2VL6 A;  4A93 G;  4DV0 L;  1Y1V H;  4Y7N H;  2AHO B;  5E7N A;  2UUC L;  5C4X G;  2QGQ A;  1VCI A;  2KHJ A;  3VDY A;  3S1Q H;  1EQQ A;  3S24 A;  4GS3 A;  4LFC Q;  2JA8 H;  1VQI A;  1IBM L;  1OXS C;  4LF9 L;  1CKN A;  1T9H A;  1Y1W G;  3NBH B;  5LMU L;  3HOW H;  2ZM6 L;  4NXN L;  5M3M G;  4JI0 L;  1IYJ B;  2EQS A;  3S17 H;  4GOP A;  1NJI C;  4GNX C;  4GLX A;  3JAM i;  2R93 H;  3ULP A;  3CC2 A;  2NVT H;  2VNU D;  2GVA A;  4DKA C;  1PH7 A;  1B7Y B;  3CMA A;  1XNQ L;  4JBK A;  3ZJY C;  5JJI A;  4P72 A;  2YTX A;  1SFO H;  2AKW B;  4C3J H;  3GTQ H;  3PO2 G;  3W1G A;  4X66 L;  3AFQ A;  4LF7 Q;  1YNX A;  4H02 A;  4GN5 A;  1UE5 A;  1I5F A;  4R4O A;  3PO3 G;  2UUC Q;  3G71 A;  4LUZ A;  3ERS X;  1E24 A;  2RCN A;  3CXC A;  3JC6 6;  1IBM Q;  1QUQ B;  4DV6 L;  4LF9 Q;  3K7A H;  1EFW A;  4UY8 C;  2NVQ H;  3M3Y H;  5LMU Q;  2I5L X;  1NTG A;  2F4V Q;  4NXN Q;  3TRE A;  2OCE A;  4JI0 Q;  1VQ8 A;  1VQ6 A;  3NEL A;  2ATW A;  2WB1 E;  5IYC G;  3AQQ A;  1C7Y A;  4JOI C;  1CSP A;  1V9P A;  4P73 A;  3KF6 B;  2Z6K A;  5C0X J;  3PIP A;  1XNQ Q;  2R7Z G;  2JA6 H;  1QZG A;  4LF8 Q;  4X6A H;  4AIM A;  4IFD I;  4A3C H;  3IRB A;  3RN5 A;  1KXL A;  2HHH L;  4X66 Q;  1C9O A;  1X54 A;  5M5W H;  3RR5 A;  2Q2I A;  2N8N A;  2JEA I;  3OW2 A;  2K14 A;  1HZB A;  3HOV H;  2F3I A;  2N3S A;  3S1M H;  2UXD L;  1NMG A;  4ALP A;  3PSI A;  4DV6 Q;  3NEM A;  4OXP A;  1YZ6 A;  1PYS B;  3H3V H;  2JJQ A;  3HOU H;  4A3D G;  3KDF B;  1SLJ A;  2OTL A;  5IY0 A;  1I6H H;  4BY7 G;  1LTL A;  4O2D A;  1X3E A;  2NVX H;  1X3F A;  2KCM A;  4QQB X;  2VZA A;  3PV0 A;  4PZ8 A;  2GVB A;  4A3E G;  1SR3 A;  4O0A A;  3HKZ E;  4A3F H;  3UDI A;  5IE8 A;  3A74 A;  4GLV B;  2JA7 H;  5FLX c;  4DV2 L;  2H5X A;  3J81 i;  2KCT A;  1Q86 C;  5FJ8 H;  4DR3 L;  1YHB A;  1VQ7 A;  1YHQ A;  3PUX A;  1VQL A;  1XNR L;  4P75 A;  1EOV A;  1WCM G;  4BA1 I;  1I50 H;  3FP9 A;  1IZ6 A;  4POG A;  3RN2 A;  3STB D;  5DLQ E;  1TXY A;  4R4C A;  1N32 L;  2JK8 A;  2RHS B;  2GN5 A;  3E9I A;  1WFQ A;  1RL2 A;  1HZ9 A;  4C3H H;  2UXD Q;  4AYB E;  1HZA A;  2XGT A;  4BBR G;  3OTO L;  1PH8 A;  4IPH A;  4QY7 A;  3CQZ H;  2D0P A;  3J81 j;  4GKJ Q;  2YTV A;  3AYH B;  4LFB L;  2Q2H A;  4P71 A;  2ID0 A;  4A3I H;  1A62 A;  1V1Q A;  4A4I A;  4R4I A;  1KQS A;  1SN8 A;  1X3G A;  4DR3 Q;  1OXT A;  1YBY A;  3F1Z A;  1N34 L;  1N33 L;  1GKH A;  1EIF A;  1KRS A;  1X65 A;  3BZC A;  4IJL A;  4IPD A;  3M4Q A;  4OWT B;  3J7Z C;  1UE1 A;  4IOC A;  1E7Z A;  1YIJ A;  1XMO L;  2VS1 A;  1N32 Q;  1PH1 A;  4A3B H;  1HNW L;  1YVC A;  5M3F G;  1UEB A;  3A5Z B;  2D62 A;  3OTO Q;  3L0O A;  3PCO B;  3KJO A;  1VQP A;  2RHQ B;  1CKM A;  4HJ8 A;  4DUZ L;  1PH4 A;  4APV A;  2KHI A;  1VQG A;  4LFB Q;  4X65 L;  4WJ4 A;  4A3J G;  3K80 C;  4DPG A;  4LFC L;  1VS0 A;  2JEB I;  3CCV A;  4IPC A;  4A76 A;  1N36 L;  5IP9 H;  1ASZ A;  3HOY G;  4NB3 A;  4QJF A;  3CAM A;  2ES2 A;  1Q82 C;  1YJN A;  1HNZ Q;  5IWA Q;  1XMO Q;  1JE5 A;  4IFD G;  4XTC S;  4A93 H;  2E2J H;  3CCR A;  3RZO H;  5C4X H;  2EIF A;  4NPS A;  4B3M L;  1CKN B;  1U5K A;  2I5M X;  1L2F A;  1L1O A;  2MQH A;  4PG3 A;  2PNH A;  3I55 A;  1Y1W H;  2B29 A;  3D31 A;  1NY4 A;  3K81 C;  4KI0 A;  3ULL A;  3PUZ A;  1EWI A;  5M3M H;  4DUZ Q;  3CCE A;  4GOP B;  1LUZ A;  3HOZ G;  4LF7 L;  4BBS G;  4X65 Q;  2A19 A;  3CPW A;  1M90 C;  3U58 A;  2F52 A;  3T1H Q;  1MJC A;  1VQF A;  3RLN A;  1N36 Q;  2V1C C;  2YTY A;  3B6Y A;  4HID A;  3GTO H;  2HIX A;  1VQN A;  2A8V A;  3PO2 H;  4DNI A;  2F4V L;  1D7Q A;  1E1T A;  1HJP A;  1XTD A;  2I0Q A;  2BH8 A;  4RMF A;  3TS2 A;  4C3I H;  1QVG A;  3PO3 H;  1PH2 A;  3KJP A;  3KF8 B;  3DM3 A;  2IHE A;  4B3M Q;  2PMZ E;  1JMC A;  1WYD A;  1PH9 A;  1YHA A;  1KIX A;  4NXM Q;  1SE8 A;  3HKZ G;  3WWV A;  2PI2 E;  2K5H A;  4JI3 L;  1QZH A;  4DR1 L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...