4JI2L

Crystal structure of 30s ribosomal subunit from thermus thermophilus
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
124
structure length
124
Chain Sequence
PTINQLVRKGREKVRKKSKVPALKGAPFRRGVCTVVRTVTPKKPNSALRKVAKVRLTSGYEVTAYIPGEGHNLQEHSVVLIRGGRVKDLWGVRYHIVRGVYDAAGVKDRKKSRSKYGTKKPKEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome
molecule keywords 16S rRNA
publication title The central role of protein S12 in organizing the structure of the decoding site of the ribosome.
pubmed doi rcsb
total genus 16
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2013-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF00164 Ribosom_S12_S23 Ribosomal protein S12/S23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4ji2L00
2QA4A 1ASZA 1UE1A 2UU9Q 2E2HH 4WJ3M 1FVIA 1TWHH 1WI5A 1PH2A 2YYZA 2Z0SA 4UPAA 1XMQL 5J3BA 4GLAC 4JI7L 2JA6H 2JA8H 4UP7A 4JI5Q 4AH6A 1W2BA 5IE8A 2VS1A 1EUJA 1KRSA 2RHQB 1VQCA 1VQHA 2PQAB 3S2HH 2A19A 1J5EQ 4KLKA 2GVBA 3KJPA 1TWFH 3CXCA 2Q2UA 4A3IH 1VQKA 2WAQG 3I4NG 1CUKA 3PUZA 4DV0L 4B3SQ 3GO5A 1U5KA 3G48A 4AYBE 1Q7YC 2JA7H 1KRTA 2AKWB 1X56A 3J80i 4Y7NH 1Q86C 2UUBQ 4A3LG 1TWAH 1CKMA 2Y0SG 5IYDH 4JC0A 5LMNW 2IX0A 4DAYB 2NVQH 4DR4Q 2NVTH 4PZ6A 4MZ9A 1K83H 4AQYL 2UUCL 1PH7A 4JOIA 4KHZA 2N8NA 1VQ5A 4LFBL 3GTKH 2UXDL 3CCRA 4JG2A 3EN2A 4YHHL 5FLMH 2ZTCA 4DUZL 2CFMA 1A63A 5JEAG 2UXBL 2B63G 5C4XG 2B3GA 4LFAQ 3TRZA 4FDBA 1VCIA 5K36G 1I3QH 5M5YH 1JJ2A 3PO3G 5GROA 1B7YB 4DAMA 1UE5A 1IBLQ 1TWCH 2IT1A 4DUYL 4X62Q 2PNHA 3S15H 3T1YQ 3M85A 2AWOA 3TS0A 3S1RH 1GVPA 1O7IA 1WJJA 1K3RA 3HOXG 3G6EA 4GNXC 3CP0A 2VQFQ 1KIXA 3S16H 1V1QA 3F1ZA 2MFIA 3HFZB 4DV5L 1YHQA 2Z6KC 3HKZG 1VQLA 1WCMG 1FJGQ 4KI0A 2CCZA 2PI2E 4A3LH 2F4VL 2XTIA 4B3RL 4UP9A 1P8LA 4DV7L 1PHJA 3CAMA 4OONA 4XTCS 1XPOA 2UU9L 4YWKA 5LMNQ 4YCWA 1X6OA 4IFDG 1K73C 1G6PA 2ZJQA 4A3CH 1J6QA 5M5XH 1VQ4A 4L5TA 4IO9A 4POGA 2HT1A 1VQEA 1WFQA 3K0XA 4YCVA 1E3PA 1E1OA 4JI5L 4K0KQ 3AEVA 4DV4L 3CW2C 2D0OA 5C4XH 2B63H 2I5MX 1NTGA 1X9NA 4HJ8A 1J5EL 3W5OA 2MNAA 3HOWG 1HNXQ 1H95A 2GN5A 3CCMA 3T1HQ 3RN5A 4KHPQ 1KHIA 1HZCA 4BY7H 2OTLA 1V43A 4B3SL 4BA2I 2R93H 1S72A 1PH5A 1L1OB 5LMUQ 3NELA 2VUMG 4HIKA 3J7A5 1SROA 1NY4A 3HOXH 2YTYA 3D31A 3CCQA 3GTJH 2UUBL 4OXPA 3J7ZC 1EYGA 1Y1VG 1HZ9A 2OQ0A 4DR7Q 5M3FH 4L5SA 4LF7Q 5BR8Q 1L0WA 4GN5A 3E9IA 4DR4L 1Y14B 1WCMH 1OTCA 4WJ4A 4QIWE 2A8VA 1PA6A 4QGUA 4NB3A 1PFSA 1HH2P 1I94Q 2WAQE 1G51A 1LM0A 4GLXA 2BH8A 1K8GA 2VNUD 1MIUA 2ES2A 4LFAL 3GDEA 4JI6Q 3MXNB 3GTPH 2HIXA 1IXRA 1A0IA 1YNXA 3BZKA 3G71A 1IBLL 3D0FA 2NN6G 4X62L 3GTMH 4P75A 1Q12A 2ALYB 3T1YL 4OWXB 3J81j 4A3JG 1L2FA 3I4NH 4GOPB 4R4OA 1HJPA 3PUYA 2OCEA 2Q2TA 4DK6C 2VQFL 3GTQH 2C35B 3CMAA 3GD7A 4J15A 3CCEA 4A3MH 1N9WA 2Q2HA 1N33Q 3VDYA 1FJGL 3AYHB 4DV2Q 4A93H 3EIVA 3TEHB 1SFOH 3A0JA 2BH2A 4RG1A 1BBWA 2I5HA 1Y1VH 2JA5G 4GKKQ 5JEAJ 3F2BA 2GVAA 2Q2IA 2ZM6L 1VQ9A 5LMNL 4MNOA 1E1TA 3KLWA 2PQAA 3U50C 3UDGA 2VZAA 4Y52H 1QVCA 2V1CC 4JOIC 1CSQA 1YVCA 3H15A 4K0KL 1A8VA 3PUXA 4JI3Q 1MJEA 4GN3B 3GTOH 3AQQA 3HKSA 1KD1C 1SN8A 3I2ZA 4IJHA 1KC8C 2ASBA 1LYLA 1HNXL 4AIMA 5GAGC 3RLFA 4A3EG 4A75A 3K8AA 3T1HL 1U0LA 1XNRQ 2QEXA 1AE2A 3K7AH 2VQEQ 4EQ5A 4KHPL 1N32Q 1PV4A 1PH3A 4QQBX 4A3JH 1VQGA 4DV3Q 5LMUL 2ZJPA 2WB1E 4PZ7A 3CCVA 3ULJA 2R6GA 4JBJA 4A3BH 2IX1A 3S1NH 3W1GA 1X3EA 3CCSA 5FLXc 4DR7L 4IFDJ 4LF7L 5BR8L 3TQYA 4PG3A 1Q1EA 2EIFA 3U4ZA 4YY3Q 1BBUA 3CF5A 1I94L 4LF4Q 1EQQA 2JA5H 3S1MH 1YBYA 4HJ7A 4A3KG 4BXXH 4GKJQ 1YEZA 2F52A 1XTDA 4A3DG 3JAMc 3STBC 4IPGA 4DR2Q 3K7UC 4A3CG 4DR1Q 1E7ZA 3UDIA 3I4MG 1YITA 4JI6L 1EIYB 3RN2A 3F8TA 2KENA 1YJNA 3HOUH 4PZ8A 4X66Q 1SE8A 3BZCA 3I56A 3RZDH 3A74A 4HIDA 3GTGH 2ZTEA 2UUAQ 3S1QH 2IHEA 3WWVA 1NMGA 4BY7G 3KJOA 5C3EG 1D7QA 4A76A 4A3EH 1EOVA 1UEBA 3BJUA 3U4VA 2R93G 1KQSA 1LUZA 1E22A 1VQDA 4DV1Q 1IBKQ 1N33L 1OXXK 5M3MG 4DV2L 3NEMA 1JJGA 5M3FG 1SRUA 3CPWA 2K50A 2QGQA 3KFUA 3CC4A 2R7DA 4NXNQ 3TS2A 4JI2Q 2RCNA 4GKKL 5C4JH 1R9TH 1T9HA 2KCMA 1QVGA 5AJ3Q 2FXQA 2LXKA 3PSIA 4JI1Q 1S40A 4LF6Q 1SR3A 2LXJA 5IP7G 1KAWA 4A3KH 3CC2A 3DLLA 1CKNB 4JI3L 3L0OA 3JAMi 4A3DH 4P71A 2IHFA 1C9OA 3I7FA 1L1OA 3I4MH 2K4KA 4JI8Q 5GAEC 4JCVE 3Q8DA 1I5FA 4IJLA 4QY7A 5IWAQ 3HOYH 3RZOH 1PYBA 1N8RC 3E0EA 4P72A 4BY1G 2RF4A 1GKHA 3UE0A 1YI2A 2VQEL 1OXTA 1WOCA 1YJ9A 4LFCQ 2D0PA 1UWVA 4EX5A 5C0XI 2OWOA 2H5XA 1VQNA 5IP9G 4LWCA 1IYJB 1Q81C 4DPGA 5C3EH 4A3MG 2JK8A 2AHOB 1EIFA 2K5NA 4A93G 2KBNA 4R1JA 5JJIA 1EFWA 3M4QA 5M3MH 3EBEA 2YTXA 2NZHA 4LUVA 4YY3L 4R4TA 3CCUA 3PIPA 4R4CA 2OQKA 5IYCH 2YU9H 4LF4L 4RMFA 2AMCB 2BA1A 4YWMA 3S24A 1VQPA 4UY8C 1Z47A 3H3VI 4GKJL 5E7NA 3KF6B 4DR2L 1N36Q 2E5LQ 4QJFA 4DR1L 3HOZG 2JE6I 2JEBI 4APVA 3FKIG 2VL6A 3NENA 4X64Q 3PIOA 4GOPA 4A3FG 1PH4A 5IP7H 1X54A 2R7FA 3I55A 4X66L 2Y0SE 4OO1I 3PUVA 2UUAL 3S2DH 1W3SA 3K80C 1NBWA 4GN4B 1M1KC 2CQOA 1VQJA 2E8GA 2JQOA 3OYYA 2CWPA 1Q46A 1QUQB 4A4IA 3PO2G 2UXCQ 1VS0A 4X65Q 4BY1H 4IOCA 3NBHB 1XNQQ 2ID0A 1I6HH 5HY6A 3A5ZB 3TREA 3CCJA 1IBKL 4DV1L 3J81i 3PF5A 4A3BG 5IP9H 5ELOA 1XMOQ 4MTNA 4GNXB 4JBMA 2N49A 5C44G 2MQHA 1GM5A 5GQOA 3H0GG 4NXNL 1N34Q 4JI2L 4P73A 1YIJA 1B8AA 3U58A 2HHHQ 4LW1A 5AJ3L 1XPRA 4LF6L 1X65A 4JI1L 4DR6Q 1A62A 4JBKA 4R4IA 4BBSH 3MEFA 2UXBQ 2WP8J 2DGYA 3ICEA 1D8LA 4ALPA 3HOZH 1JT8A 3B6YA 3HKZE 4A3FH 3FKIH 4JI8L 4GLVB 3HOUG 3PF4A 4ME3A 5IWAL 2NVXH 3F2CA 2VW9A 5ELNA 3KDFB 4BBRG 5JJLA 4JI4Q 4XIGS 4JV5Q 3M9BA 4LFCL 3S17H 1LTLA 3OW2A 4LF5Q 3KF8B 4OWTB 3PO2H 5JJKA 1HNZQ 3FP9A 1FL0A 1RL2A 1XNRL 1MKHA 1VQMA 3OTOQ 2ATWA 1BVSA 3UDXA 1GO3E 4POFA 5IYBH 1ASYA 2CWAA 2R92G 1VQ6A 2DUDA 3G4SA 4B3MQ 2B29A 2UXCL 1HZAA 3UDFA 5C44H 4DR5Q 4NPSA 3H0GH 3FHWA 3CMEA 1VQOA 3PGZA 5EAYA 1N36L 3BU2A 2E5LL 2JEAI 1VQIA 3CQZH 1JB7A 4X64L 4DV4Q 1DGSA 3UE1A 4TVAB 1Y1WH 1UE7A 2YV5A 4JI0Q 4O2DA 1VQFA 1NJIC 3HOYG 2I0QA 1YZ6A 1QZGA 3RNUA 4DV6Q 4IPDA 1L1OC 1P16A 3M7NA 1SMXA 5GADC 3PUWA 1VQ8A 1KL9A 2WFWA 4X65L 4BBRH 4L5RC 1XNQL 1VQAA 1OXSC 1WYDA 3ER0A 3ERSX 1HR0W 1X55A 1AE3A 4HJ9A 4IPHA 1CSPA 1XMOL 1IZ6A 1EQRA 3SGIA 4P74A 4B3TQ 1PYSB 2K5VA 4GS3A 1N34L 3I4OA 1CKNA 3RLNA 3ULPA 1VQ7A 2R92H 2HHHL 5IYCG 5IY0A 1FGUA 2OTJA 2I5LX 4A3GH 1PH6A 4HIOA 1Z9FA 2EXDA 4DR6L 1NE3A 4PMWA 1TWGH 1KXLA 2CKZB 2YTVA 1OXVA 3ULLA 4LF9Q 3ZJYC 4DNIA 5C0XG 2PI2A 2K5HA 2IY5B 2NZOA 4O0AA 4GOPC 3K81C 4BXXG 1Q82C 2VY3A 4LF8Q 1JE5A 2K14A 4OX9Q 2K75A 2KHJA 4JI4L 1JJCB 3L7ZC 4JV5L 2KCTA 1HNWQ 3A5UA 4LF5L 2MO1A 1JMCA 1VQBA 1HNZL 1B70B 4DK3C 1HZBA 4DV3L 3S14H 3J81c 3HOVG 1QZHA 2ZTDA 2ZJRA 4H02A 3OTOL 1IBMQ 1E24A 1RIPA 3KF6A 3GTLH 2KHIA 4QL5A 4DR3Q 3L2PA 1I50H 2JJQA 3LGJA 1HR0Q 4B3ML 4JYAQ 2ZM6Q 4DR5L 4NXMQ 5FJ8G 2E2JH 3STBD 1YHAA 4OO1G 1K0RA 3CD6A 4BBSG 2WB1G 2EQSA 1Q8KA 1SLJA 4IPCA 1XMQQ 1XPUA 1YJWA 4JI7Q 4AYBG 1QUQA 1TXYA 4YWLA 2N78A 4JI0L 4C2MH 3PO3H 1N32L 4HJ5A 3JC66 1CKOA 5M5WH 4X6AH 4DV6L 2HQLA 4C3JH 2E2IH 3CCLA 4GNXA 4IFDI 5DLQE 3AFQA 2Z6KA 3W1BA 4DV0Q 2BA0A 2HIVA 1NMFA 3RR5A 2R7ZG 1C7YA 3PV0A 3CC7A 5GAHC 1C0AA 1YHBA 4B3TL 2JA9A 5IYBG 3M3YH 1GD7A 3H3VH 3HOVH 2N3SA 3M4PA 2D62A 1OXUA 3M4OH 1Q1BA 4AQYQ 4DKAC 2UUCQ 1K9MC 1PVOA 4LFBQ 1M90C 2UXDQ 2LSSA 2JA8G 1BKBA 2JA6G 4YHHQ 4L5QA 5FJ8H 3KDFA 1UE6A 4HIMA 4DUZQ 4TQUS 4LF9L 1IL2A 2RHSB 3IRBA 4R4QA 1Y1WG 4LNQA 3CPFA 1AH9A 5HGQA 1S3OA 1PH9A 4BA1I 4C3HH 3F2DA 3RLOA 3AFPA 5IT9c 1MJCA 2AWNA 4LF8L 4OX9L 4DUYQ 2PMZE 2A1AA 4A3IG 3HOWH 4JBWA 1V9PA 4LUZA 4YCUA 1HNWL 3DM3A 2MO0A 2JA7G 4HJAA 1EWIA 4UP8A 5IYDG 1XJVA 4LUOA 2F3IA 3J80c 4DV5Q 1K8AC 2VUMH 2L15A 2NVYH 1G291 1X3FA 2NN6I 1IBML 4IOAA 2XGTA 2K52A 3E9HA 5H1SE 4DR3L 1QVFA 1X3GA 4C3IH 1HR0L 2R7ZH 3PCOB 1PH1A 1PH8A 4JYAL 2F4VQ 4B3RQ 3KYHC 3KOJA 4NXML 4DV7Q 5FLMG 5C0XJ 4A3GG 4OWWB
chains in the Genus database with same CATH superfamily
1Z7TA 1UE1A 4WJ3M 2XWBB 1BUVT 2Z0SA 1A6XA 3RMHA 2JA6H 4KK7A 1ENAA 3L3OC 2AQ2B 1GUTA 3BYTB 4KJNA 1J5EQ 3NWSA 1LABA 4KLKA 1FNWA 2L11A 1PTOH 4B3SQ 2B2WC 3G48A 4DK1A 2EY6A 3LNNA 2UUBQ 1AEXA 1EIHA 1TWAH 1HA5A 2NVQH 2NVTH 4MZ9A 5ELDA 5BN3A 1PH7A 4KHZA 4K5WA 2XRSD 1SFOB 1GOZA 1PFNA 2ZTCA 4DUZL 2UXBL 2B63G 4LFAQ 1VCIA 4Q5VA 5M5YH 1JJ2A 5GROA 1B7YB 2IT1A 4C3JG 3GTJB 2PNHA 2EXZA 3T1YQ 2AWOA 1K28A 3S1RH 2JA8B 1O7IA 3ND9A 2DNEA 5A35A 1BF4A 1LT5D 3I8ZA 2MFIA 3NHHA 3HKZG 5C4HA 1VQLA 4WJWA 1FJGQ 5I6YA 1CZGA 1TWFB 4CKBA 2FMMA 4UP9A 3T53B 4DV7L 2MJ8A 1X6OA 4A3CH 4CKCA 2HT1A 3TSSA 2EYHA 4IO9A 3CRLC 4YCVA 4HEDA 5LL6S 2F3VA 4J1MA 3AEVA 4DV4L 3ZYYX 1HUMA 1NTGA 2QDBA 3R2IA 2NWGA 3W5OA 2MNAA 3HOWG 1H95A 3CCMA 5BN5A 3RN5A 2OTLA 2J4XA 2R93H 1V8QA 1L1OB 1TS3A 5LMUQ 1S4ZA 3J7A5 1NR2A 1SROA 1RD9D 2YTYA 3GTJH 3FMCA 3MXGA 4ZLTF 1EZ6A 1EFID 1C48A 1K8MA 4L5SA 1GJXA 5CV8A 1OTCA 2A8VA 1ZKOA 4PMCA 1S5ED 1I94Q 1B3AA 3H94A 4GLXA 2L4NA 4RH6A 1I4PA 2F4IA 2ZXPA 2ES2A 3GDEA 1LTBD 3BS1A 3GTPH 2HIXA 1I4HA 2WINB 1A0IA 4L8JA 3G71A 1IBLL 4IALA 2DJGC 4DNRB 1Q12A 2ALYB 4CGYB 4DN4M 1ZYRD 3PUYA 1H9KA 3GTQH 3HP3A 3GD7A 2Q2HA 5E1FA 4CHTB 3Q6SA 1UEAB 3NXWA 1GUGA 3QB3A 3EIVA 1F2ZA 4EQPA 5KIXA 1SFOH 2K01A 1BBWA 2I5HA 2BH2A 3DM1A 4B08A 1QE6A 1T5EA 2X6GA 4RGOS 2RSOA 4O1NA 1TKWB 3FEWX 5M3MB 5HURA 1X32A 5M3FB 1YVCA 3I4LA 3HKZB 3H15A 1A2TA 5K5PA 1A8VA 4LK1C 1HHVA 1STBA 1HUNA 1PZJD 4Q0FA 1YNJC 1I4GA 4AIMA 4A3EG 2J7ZA 4A75A 4KHPL 4DAYA 1N32Q 1PH3A 4DV3Q 3S2DB 4PZ7A 1EY4A 3CCVA 2R6GA 4JBJA 4UAIA 3PIO3 4A3BH 5FKAC 1BBXC 5FLXc 3NPPA 3I4NB 3TQYA 2O2LD 4XDXA 2NBFA 3QJYA 4LF4Q 4HJ7A 4A3KG 4BXXH 4A93B 4WFN3 4A3DG 1F9PA 3STBC 4KN4C 3K7UC 2M2LA 1E7ZA 3UDIA 5EBDA 1YITA 2EY2A 4X66Q 1A3VA 3BZCA 3A74A 2LY7A 3R2TA 1EQTA 4RA8A 1NMGA 1D7QA 4A76A 1EOVA 1SNMA 5D65A 3D6WA 1LUZA 1IKMA 1VQDA 1IBKQ 4DGZA 1N33L 3NK9A 2F0KA 4DV2L 1JJGA 1PRTF 3K7AB 4NXNQ 1STAA 4GKKL 1JOQA 5CV7A 3OIQA 5IP7G 1EY7A 4S3SA 3CC2A 5A2QL 4FP5D 4ID6A 1C9OA 1EQVA 4U68A 2K4KA 3KUPA 5GAEC 1I5FA 2HUGA 3RZOH 1PYBA 1N8RC 3E0EA 5CV6A 1GKHA 1CI3M 2MHVA 3SK5A 1RHPA 5C0XI 4FXGC 5IP9G 3AMUA 4XT3B 3HOUB 3MTSA 2D2CC 4A3MG 2JK8A 3GTGB 1EIFA 2KA7A 5J22A 1CA6A 3S1QB 4R1JA 5M3MH 4YY3L 1U4LA 3CCUA 1E0BA 1STEA 4R4CA 1BCPF 2OQKA 3DWAA 2IX3A 2BA1A 3K58A 4DR1L 3K5NA 4FF4A 3W3AA 3FKIG 2VL6A 5EPLA 3WOFA 2EJGC 1NUCA 3PQIA 5EKLA 3H09A 2F03A 4OL7A 3S2DH 1W3SA 5I9PA 3PO2G 2L0CA 1C8CA 4XYQA 4A3DB 4X65Q 1XNQQ 2F0WA 2ID0A 1WTPA 3E5SA 1B53A 2VXWA 1SE3A 4EGVA 2B39A 3PF5A 1EU3A 5C44G 1QB5D 3J80E 1YIJA 3U58A 3F2UA 1XPRA 4DR6Q 1ZEQX 4QF4A 3GV6A 2SOBA 3GP7A 3P7JA 3EQLC 1HCZA 3B6YA 4XXEA 4M8AA 4A3FH 3DXJC 4GLVB 2VW9A 5ELNA 2A68D 2R61A 4JV5Q 1JICA 2EYJA 4TRDA 3KF8B 4X3UA 1RL2A 1U4PA 5CBEE 1VQMA 3T13A 3OTOQ 2ATWA 1IW7C 3UDXA 1GO3E 1TS2A 2B8FA 2UXCL 2K5DA 1H9SA 5EAYA 1MGSA 3BU2A 1N36L 4IUNA 3MFGA 1SNOA 2EE1A 3UE1A 4E6IA 1EIGA 4TVAB 3UI2A 3HOYG 1QZGA 4X3SA 2K5QA 5NUCA 2PPBC 3M7NA 1SMXA 3BDLA 1KL9A 3ONAB 1CZWA 2G9HD 1VQAA 1G6ZA 1JB3A 1X55A 1CSPA 1TQOA 1TS5A 3J7YW 4P74A 2BE5D 3S17B 5M9OA 3K5LA 3ULPA 2HHHL 1PH6A 4HIOA 2R7ZB 1KXLA 5ISRA 2YTVA 3TBIB 2H1EA 1TY0A 3T16A 5C44B 2E2HB 2PI2A 2IY5B 2NZOA 5C4ZA 4GOPC 1Q82C 2K14A 5COYA 2B2WA 4G7OC 1HNWQ 2EJFC 4LF5L 2IWHA 4DK3C 1W6JA 2WACA 4DV3L 1BNZA 3J81c 3HOVG 5EKIA 2ZJRA 4H02A 1HR0Q 2JJQA 3MVVA 3JAML 4KV6A 3NTHA 1JE4A 4BBSG 4FYDA 4CDCC 1I4RA 4AYBG 1QUQA 5IODA 1WTRA 2N78A 2TSSA 1SYBA 2A74C 3VR4A 1ML0D 3D3RA 2A68C 3EFXD 1JCKB 2BA0A 2HIVA 4I65A 1B50A 3PV0A 2PW7A 5GAHC 2CW0D 2RDHA 1YHBA 4OHJA 3S16B 2QCPX 1GD7A 3QIAA 1OXUA 5FO9B 1SE4A 2ENBA 2FFKB 3TP5A 1M90C 1BKBA 2JA6G 4DUZQ 3NBIA 4MTKA 3IRBA 1AH9A 4ZUJA 1R4QB 4C3HH 3F2DA 3RLOA 5IT9c 5M5XB 1MJCA 1KLUD 4ZCKA 3J81L 3DM3A 4I7ZC 2IW3A 1ICFB 4GZYC 1AFPA 1HFGA 5ELEA 5M5WB 1IBML 3IL8A 1QVFA 2R7ZH 3HOXB 4KKSA 4DV7Q 5FLXE 4A3GG 4OWWB 2QA4A 2E2HH 4ZUIA 1LTTD 1PH2A 2YYZA 1WCMB 4GLAC 4UP7A 4AH6A 3M4OB 5IE8A 2VS1A 4CKEA 1DM0B 1EUJA 2RHQB 1PRTC 2MP1A 1VF5C 3LWEA 2KOLA 3PUZA 5DM63 1S5FD 1BDOA 3I70A 1WTQA 1Q86C 2IL8A 1RCVD 1CKMA 3OHXC 2EOTA 3D8GA 5LMNW 2IX0A 4DAYB 5EPJA 5FO7B 4LFBL 2VUMB 2SNMA 3GTKH 3SK8A 1Y1VB 1A63A 2PQEA 1F2YA 5K36G 1A3UA 3PO3G 3IFTA 4DAMA 1Y8OB 3N6RA 1IBLQ 1TWCH 3LWUA 4J6HA 1RTNA 5T1GA 1BCPC 4GNXC 1KIXA 3S16H 3SDZA 3MWYW 4DAVA 5E3FA 4A3JB 2F1MA 4CBVA 3KBXA 5EBCA 4A3LH 2XTIA 4HCEA 1PTOB 1P8LA 1EYAA 4OONA 4XTCS 5C5MA 5EPKA 4EQNA 4IFDG 1TWAB 1K73C 1RKNA 1J6QA 5M5XH 1VQ4A 1VQEA 2PYKA 3KBGA 3MZ5A 3S1MB 2JA5B 2O5IC 2BCOA 5IGBA 2D0OA 4QUFA 4QB4A 2GN5A 4IUPA 5JVG3 4KHPQ 1CK1A 4BY7H 1PH5A 4HMIA 5CGKA 3VR2A 3HOXH 2E76C 2EYMA 2EY5A 4OEMB 1KNEA 2OQ0A 1L0WA 1Y14B 1WCMH 2F0HA 3M7GA 4QIWE 1PA6A 4QGUA 2WAQE 3TDQA 2BH8A 1O7LA 1JQYD 1JOKA 2EYFA 1R9TB 2A73B 4K14A 4R8NA 3BZKA 3GTMH 4P75A 2BDNA 3J81j 1L2FA 1HJPA 3I4MB 2OCEA 4KTAA 2Q2TA 4DK6C 1N33Q 4KKUA 4DV2Q 5IGDA 4DXGA 4ILWA 1Y1VH 4KHVA 4GKKQ 2R93B 1NSNS 5E4XA 3P75A 1JWSD 1E1TA 3U50C 2PQAA 2VZAA 3OWFA 2V1CC 5KEEA 4JOIC 4KN7C 5IOCA 2A69D 4K0KL 3PUXA 1G8ZD 4GN3B 1GHJA 3GTOH 3EROA 2F0GA 1KD1C 4IJHA 3JAME 4MHEA 5FOBB 1Y69U 3RLFA 3K8AA 3SXHA 1AE2A 4F7XA 4QQBX 4A3JH 1TR5A 1VQGA 3KLSA 3GTPB 2IPKD 3S1NH 4ME5A 1JORA 3CCSA 1LACA 4KJOA 4IFDJ 1A15A 3GTQB 4YY3Q 1MBYA 2J0TD 3T51B 3C3LA 3S1MH 2JA5H 1B9MA 1GUNA 1Q90A 2F52A 2XNAC 1XTDA 3DMUA 1D1IA 4NP5A 4DR1Q 4ZK9B 1GUSA 4NDXA 4JI6L 1H9SB 3RN2A 3F8TA 2KENA 2F0IA 4HIDA 2IHEA 3WWVA 1U9RA 2B2YC 1TY2A 3J80L 4HSPA 2NVXB 4KY6A 2L5TA 1E22A 5M3MG 5M3FG 5JAVA 2QGQA 4RWSC 1EY6A 3TS2A 2R7DA 3J81E 1SBBB 1R9TH 1T9HA 2RBMA 2KCMA 1ET6A 1XXGA 5TSSA 3IAYA 4A3BB 4G7HC 1SR3A 1Z6HA 3NTIA 1ENCA 4JI3L 3L0OA 4OELB 3JAMi 4IUVA 1Y8NB 3I7FA 3I4MH 3Q8DA 4IJLA 2FJ2A 2NYZD 2L12A 4QUCA 5CC4A 2ICIA 1XNRL 3I4NG 4ABNA 2VQEL 1WOCA 3I3CA 1YI2A 1YJ9A 2D0PA 4EX5A 2H5XA 4LWCA 1Q81C 2K32A 4RGTA 3GQBA 4A93G 2KBNA 5DNFA 4BBRB 5JJIA 1EFWA 1B2TA 4IUTA 3M4QA 4WORA 2UXCQ 1CA5A 4LUVA 3MXNA 3PIPA 3RD4A 5IYCH 4RMFA 1S5CD 1VQPA 3H3VI 1Z47A 4GKJL 5E7NA 4DR2L 4O42A 1N36Q 2F0FA 2JEBI 4GOPA 3PIOA 3NENA 4A3FG 1PH4A 1O78A 3FRPB 3I55A 1II3A 2Y0SE 3PUVA 2UUAL 4B9WA 1NBWA 4CDFC 5IT9E 1Q46A 1QUQB 2DY7A 2K28A 4A4IA 1VS0A 2B2UC 4BY1H 4IOCA 3NBHB 5HY6A 3A5ZB 4V0BA 4TKOB 1E2WA 3WDNA 4JK1C 3J81i 3RZOB 3I91A 4JBMA 2N49A 2MQHA 1TIID 3V2TA 5GQOA 3DWPA 1EYDA 4CJ1B 2HHHQ 1WTHA 4JI1L 1PFMA 1RJTA 4JBKA 4R4IA 3E0JA 3BYYB 2DGYA 5DAUA 3ICEA 1D8LA 5EGTA 4ALPA 2KJXA 4JI8L 3HOUG 4ME3A 5IWAL 2NVXH 3F2CA 4KMUC 5L37A 3NE5B 4XIGS 3I72A 1LTLA 4DA2A 4EVOA 4LF5Q 1HPCA 1GHKA 1O80A 3FP9A 3PMFA 1FL0A 4G57A 1ASYA 5IYBH 4K8JA 1NNXA 2ICEC 3UDFA 4NPSA 3CMEA 3M3YB 3I73A 1SJHD 1EOTA 1QJOA 5DEHA 4X64L 1Y1WH 4RKBA 2ZXRA 5I4DA 4O2DA 1DOKA 4CDEC 4CJ2C 2E74C 4DK0A 1P16A 2XSCA 3PUWA 4BBRH 4L5RC 2F0NA 4A3FB 2M9VA 3FDTA 1AE3A 2K1BA 4IPHA 1IZ6A 5AFWA 1ET9A 1PYSB 4GS3A 5JVH3 2HCIA 3I4OA 1CKNA 3EVQA 1N34L 2NVYB 4R8IA 2R92H 1ONLA 5CORA 1KABA 2EXDA 3OOCA 4C3IB 3J7AF 1F9RA 3QOLA 1K0SA 2CKZB 4KY7A 4DNIA 2K5HA 3M4YA 3HS0C 2VY3A 5CYUA 1JE5A 1TS4A 2MGSA 1JC7A 2KCTA 4N8X1 5KNDA 2MO1A 2EY1A 1ZYRC 3CHBD 5FLXL 4HAEA 2X69A 1QZHA 1IBMQ 3GTLH 2KHIA 3L2PA 4B3ML 3D4WA 2ZM6Q 2JA7B 2Z4HA 2O5JC 5C3XA 4K6LA 5BN4A 1KDBA 2G9DA 1Q8KA 1XPUA 4C3HG 4QCLA 1TXYA 3MXPA 1QWYA 2E2IH 4C3JH 3CCLA 4IFDI 4X6AH 4GNXA 5IIFA 3HZXA 2DN8A 1LLRD 3S15B 1BR9A 2R7ZG 3CC7A 1DXMA 1VDZA 2F0QA 4QIWB 3M3YH 1U4RA 1FGBD 1JWMD 2WAQB 2D62A 2QKIC 1Q1BA 4DF7A 1RF2D 2N88A 5T1IA 1K9MC 3E3XA 1HQRD 4LFBQ 2XWJB 4PQXA 4L5QA 5FJ8H 3KDFA 2KEDA 4HIMA 4OO1H 1PXUA 4LF9L 2F0DA 1I6VC 2A6ED 5HGQA 1S3OA 2RA4A 4BA1I 1S5DD 3AFPA 1IKLA 3DEOA 4LF8L 1EYCA 3A8JE 2PMZE 2LMCB 4ZAIA 3HOWH 1V9PA 4LUZA 1XWEA 3FVQA 4EQOA 1G91A 1LTID 5EJWA 5C4XB 1UAPA 4N8FA 1EWIA 1XJVA 1RTOA 1X3QA 1DONA 1K8AC 2L15A 2NVYH 1G291 1EWHA 1X3FA 2K52A 4HN7A 2EYLA 4IZ8A 4DR3L 1X3GA 3BZDB 4OIJA 4C3IH 3PCOB 1PH1A 1PH8A 4C56C 3VR6A 1IL8A 1V1PA 1ASZA 1FVIA 4BS9A 2X6LA 4UPAA 5J3BA 2C9OA 1W2BA 5KRUA 1KRSA 1LV9A 5D3IB 2PQAB 1VQHA 1FYCA 4PV1C 3S2HH 1G2TA 1DD2A 2A19A 1CHPD 3ND8A 2GVBA 5C3WA 1CUKA 4DV0L 1O7YA 2RQXA 4C3HB 4IUUA 1Q7YC 2JA7H 5KYLA 1KRTA 4A3LG 1X56A 3J80i 4Y7NH 5JPNC 2Y0SG 2GA4B 2NTTA 3NP8A 3BVGA 2UUCL 3MXUA 4JOIA 2PNRC 1VQ5A 2UXDL 5KYIA 3T56B 1O7ZA 4J8QA 4FDBA 4Z9CB 3VA5A 3R8BA 1UE5A 2MUYA 2L1BA 1SXTA 3O13A 4DUYL 3S15H 1EY0A 3M85A 3TS0A 2WKDA 1FNVA 2XRQD 1GVPA 1K3RA 1QCBD 3HOXG 1PTOD 4PNYA 1V1QA 3HFZB 2WIIB 3FPPA 1YHQA 1SSOA 2Z6KC 1FR3A 1WCMG 2PI2E 1U4MA 1KNAA 1H9MA 1PHJA 3CAMA 2EZVA 1XPOA 2UU9L 4YWKA 3SE0A 1G6PA 4L5TA 1WFQA 3K0XA 4JI5L 4K0KQ 3K5OA 3VR5A 2A6EC 1OO9B 5JEAH 2QILA 5C4XH 2I5MX 3GTKB 1X9NA 2B2YA 4HJ8A 2VB3X 4KD3A 2Z1CA 2AQ3B 3QOJA 1S72A 3K59A 2VUMG 4OGQC 1NY4A 2A5HA 1TWCB 2B8GA 3CCQA 3SVMA 1EYGA 1UUPA 1Y1VG 1HZ9A 2OXPA 4DR4L 3H3VC 4WJ4A 3FPUB 4NB3A 1PFSA 3AU7A 1G51A 2XN9C 4JVZA 3QG1A 1SMYD 4N9TA 2B2VC 2L55A 2VNUD 2Y0SB 3NSWA 4JI6Q 3MXNB 4K5VA 1YNXA 3D0FA 4X62L 1KDAA 4A3JG 2SNSA 4OWXB 4GOPB 5J1ZA 2VQFL 2KCCA 3CMAA 4A3MH 1E2ZA 2FMCA 3AYHB 4ZYSA 3D4DA 3TEHB 4BY7B 3A0JA 4RG1A 5C3EB 3OMGA 2JA5G 2BE5C 1CT1D 2GVAA 3BVZA 2ZM6L 1VQ9A 5LMNL 1LT3D 3KLWA 3TP8A 4Y52H 1QVCA 2EPBA 1CSQA 2YU9B 2NTSA 4JI3Q 1MJEA 1MD2D 3I2ZA 3R3OA 2ASBA 1LYLA 2B2UA 1HNXL 3T1HL 2NN6H 1F2LA 2Z9HA 3C1EA 2F3WA 3G7LA 2QEXA 2VQEQ 1XNRQ 1PV4A 1H9JA 2G5DA 4FNFA 3TN2A 3GTMB 1X3EA 4DR7L 1PFBA 5C5LA 5BR8L 5JPMC 4LF7L 4PG3A 2EIFA 3A7LA 3A54A 3CF5A 4LJZC 3TP7A 1YBYA 4V190 1GXDC 4GKJQ 4A3CG 2HD3A 4DR2Q 2D5DA 1LTGD 3I4MG 5IT9L 1EIYB 3D6CA 3A56A 2B2TC 5CR3A 1SE8A 4ULLA 2ZTEA 1WTWA 1VMPA 2UUAQ 3SK4A 3KJOA 4P2CB 1UEBA 2PO4A 3BJUA 3BVMA 3OWEB 3U4VA 3GTOB 2R93G 2LFNA 3J7AV 1L0YB 3NEMA 3OIPA 2K50A 3KFUA 2CW0C 1SYEA 3CC4A 4NW2A 2RCNA 1WD0A 5IGFA 5C4JH 1D5XC 1S40A 2FXQA 2LXKA 3PSIA 4JI1Q 3S1NB 2LXJA 3K6OA 2ZT9C 3H0GB 1CKNB 3DLLA 4P71A 2IHFA 3CU7A 4JI8Q 4C1NK 5IWAQ 3HOYH 1WTVA 3C1FA 4BY1G 1MSHA 2RF4A 5KGUA 2OWOA 1UWVA 1VQNA 1PRTB 5FO8B 1SNDA 1IYJB 1DOMA 4DPGA 1K3BC 5C3EH 1D5MC 5JJZA 2K5NA 4N9PA 1IHZA 3OPOA 4R4TA 2YU9H 2AMCB 4YWMA 1PLFA 5D14A 3S24A 1QILA 2P5ZX 3K5MA 1SNCA 2E2DC 1XYIA 2JE6I 1DZ1A 3TP6A 4X64Q 1TWGB 3K80C 3DEPA 3OMCA 4K5XA 2CQOA 5G3LF 2CWPA 1XTCD 1LTAD 3DHQA 4LAAA 1JOOA 2F0VA 4QMGA 3TREA 3CCJA 4HMJA 4DV1L 4A3BG 1BCPB 5ELOA 1R4PB 4MTNA 2AUKA 4GNXB 3EA6A 4KD4A 1GM5A 1HRJA 4DU9A 1N34Q 4JI2L 4P73A 3S14B 1B8AA 5AJ3L 4BXXG 4LF6L 4XYOA 2NZ1D 1A62A 4BBSH 3MEFA 2WV6D 3HOZH 2PMZB 2H4OA 3PF4A 2KUMA 1I4XA 1T5XD 2CH4W 3KDFB 4BBRG 5JJLA 3CKIB 4IURA 3M9BA 4LFCL 3OW2A 3IKJA 5LL6X 4OWTB 5JJKA 1QNKA 1A2UA 2JN4A 1MKHA 1QOHA 4K8IA 3WOEA 5ELFA 1BVSA 3NTKA 3U9OA 4POFA 2R92G 2CWAA 1VQ6A 2DUDA 4B3MQ 2B29A 2PCFB 4BY1B 3HG9A 3VYRA 1WVLA 3H0GH 3FHWA 1VQOA 3PGZA 3BDOA 2E5LL 2JEAI 1JB7A 1DOLA 1MSGA 1UE7A 2YV5A 1F9SA 1V1PB 2I0QA 1YZ6A 1EU4A 2WB1B 1L1OC 2F0SA 5ELCA 5GADC 1VQ8A 2K5WA 2WFWA 1HTPA 1EEID 3ER0A 3ERSX 1HR0W 3HEJA 1XMOL 4PMBA 1EQRA 1FD7D 2K5VA 2QF7A 1EY8A 3RLNA 1HA6A 1VQ7A 2WKCA 2I5LX 4A3GH 1Z9FA 2RDFA 1NE3A 1TWGH 1SYCA 2KHSA 3ULLA 4LF9Q 1YNJD 1TWHB 3X3NA 4HCSA 3K81C 1EL0A 1L0XB 4LF8Q 3NQTA 2K75A 3QR8A 4JI4L 1JJCB 1Q3LA 1Y1WB 1VQBA 1HNZL 1B70B 3QO2A 1CQVA 3S14H 3MEHA 3A7AB 4A3IB 2K05A 3KF6A 4FF1A 4QL5A 4DR3Q 4TSSA 1D2BA 4DR5L 5FJ8G 4L63B 2E2JH 3STBD 3Q0AA 1YHAA 2M00A 5F2DA 4OO1G 1K0RA 2EYPA 2JXMB 1K83B 1SLJA 4YIJA 4G7ZC 2FHTA 3CRKC 3Q24A 1CHQD 2R92B 5K36H 4JI0L 2A69C 3PO3H 1F77A 5C0XH 1BQQT 3JC66 1HFNA 4MIUA 4DV6L 4G4KA 1I3QB 4MN3A 5DLQE 1ICWA 3AFQA 2Z6KA 3W1BA 1DCZA 4DV0Q 3OSOA 2Q8IB 4HSVA 1NMFA 3RR5A 1ILPA 1C7YA 4C3IG 3BDCA 1B9NA 4B3TL 2F0EA 1E2VA 3ERQA 3K0YA 1PZID 3M4PA 2UUCQ 1B44D 2PZUA 4FXKC 1PVOA 3V96A 2UXDQ 5G3LD 4XQJA 3GTLB 4IFDH 3MC0B 2RHSB 4R4QA 3W2DA 5I2XA 1IYUA 2K6AA 4IQZA 4OX9L 4DUYQ 2A1AA 4JBWA 1TU2B 1IYVA 4YCUA 2JA7G 2B63B 4HJAA 4LUOA 4XQQA 4FO2A 1EEFD 1YNND 1PYWD 3Q22A 4C3JB 2E2IB 2RKSA 4JYAL 4WRDA 3KYHC 1MI2A 4DXFA 4NXML 2KVMA 2B2VA 4C1NI 2UU9Q 1STGA 1TWHH 1WI5A 1H9RA 1XMQL 3U9SA 3P1HA 4JI7L 2JA8H 4JI5Q 2PZWA 3PIP3 1VQCA 3KLSX 3EJIA 2CH4A 3KJPA 4RHSA 1TWFH 3CXCA 2Q2UA 4A3IH 1AZPA 2WAQG 1VQKA 3URYA 4CDDC 5KNCA 3GO5A 5CV9A 1U5KA 2F0OA 3A55A 4IN3A 4AYBE 1RODA 2I46A 3BG3A 1F9QA 1LO5D 2AKWB 5IYDH 1DYQA 2OT2A 3HOWB 4JC0A 1J9OA 4DR4Q 2OF1A 4PZ6A 1K83H 4AQYL 5CBAE 1STNA 2N8NA 2KECA 3CCRA 4JG2A 3EN2A 4YHHL 5FLMH 4ZKCB 1PMRA 1PTOF 2CFMA 1SDFA 5JEAG 5C4XG 2K7VA 2B3GA 1EWCA 3TRZA 1M4VA 1I3QH 3MHBA 3SK6A 4DAPA 1ENFA 4X62Q 3NWTA 2AQ1B 1WJJA 4M1UB 3G6EA 2SDFA 3CP0A 2VQFQ 3F1ZA 1AN8A 3MA2B 1IW7D 4DV5L 1TT2A 3S2HB 1ZXTA 4U673 4L6TB 4KI0A 2CCZA 2F4VL 1STHA 2HDMA 1QG7A 3NQIA 4B3RL 2A6HD 1KDCA 5EKKA 2JP1A 5IGCA 5LMNQ 4YCWA 2CHBD 2F0MA 3G6JB 4Y7NB 2K03A 2ZJQA 4POGA 2B2TA 3SR1A 4FXDA 1E3PA 1E1OA 4K2LA 3RUZA 3CW2C 3P20A 1VMCA 2B63H 2MPMA 1J5EL 1HNXQ 4IUQA 4FF3A 3T1HQ 1KHIA 1HZCA 2R3ZA 2ZXOA 1V43A 1SYDA 4B3SL 3RZDB 4BA2I 4RHRA 1GUWA 1B4OA 5JOBA 3NELA 4HIKA 3D31A 1YNNC 2F0TA 1TVXA 4OXPA 3X3MA 3J7ZC 2UUBL 4A3EB 1SYGA 4DR7Q 5M3FH 4LF7Q 5BR8Q 4GN5A 3E9IA 1AZQA 1HH2P 1UNSA 2OEOA 1CM9A 1LM0A 2CQAA 1K8GA 1MIUA 4LFAL 1LT6D 2K33A 3N52A 1IXRA 2VB2X 1B3QA 2NN6G 4A3KB 3KLRA 1SE2A 1VF7A 3T1YL 1CFMA 3I4NH 3KK7A 4R4OA 1G2SA 2C35B 1SNQA 2HDLA 4J15A 3CCEA 1N9WA 4JW0A 4K2KA 3VDYA 1FJGL 4A93H 2IJ0A 1LTSD 5JEAJ 3F2BA 2Q2IA 4MNOA 1ESFA 4K6DA 3UDGA 1XX8A 1KAAA 1GUOA 4UHVA 1D1KA 4NKLA 3AQQA 3HKSA 4HTHA 1EY5A 1SN8A 5CMDA 1KC8C 4BWGB 3MAQA 3C2PA 2EDGA 5I9OA 1RDPD 5GAGC 2F0PA 1U0LA 1FNUA 2KCNA 3K7AH 4R9WA 4EQ5A 1WTXA 1F2MA 2DY8A 5LMUL 2ZJPA 2WB1E 3ULJA 1SYFA 2IX1A 3W1GA 4RGNA 1I6HB 2K04A 1M8AA 1Q1EA 3U4ZA 5IGEA 2A6HC 1BBUA 1I94L 2SEBD 4A3MB 1EQQA 1YEZA 3JAMc 1I4QA 4IPGA 2E75C 1PDQA 1K8OA 4H0LC 1AP0A 1YJNA 3HOUH 4PZ8A 3RZDH 3I56A 3GTGH 2Z4IA 3S1QH 3I90A 4BY7G 3FKIB 5C3EG 4A3EH 2RSNA 3TZDA 1KQSA 4HR7B 3VA7A 1JR0D 4DV1Q 2C5CA 1OXXK 3GV3A 2QDLA 1SRUA 3CPWA 4F87A 2Q8TA 3PO2B 2HCCA 1Q8IA 4JI2Q 1LTRD 1QVGA 2FINB 5AJ3Q 1SJED 4LF6Q 2PW5A 3OW7A 2O4XA 1KAWA 4A3KH 5FK9C 3TMEA 5I6WA 4A3DH 1PRTD 1L1OA 3VYTA 2L9HA 4JCVE 4QY7A 1J8IA 3CQZB 4P72A 2EVBA 2RCFA 3UE0A 1OXTA 1N32L 4LFCQ 1NCVA 3SEBA 4ZRZA 3A8KE 2TMPA 2AHOB 3H91A 2EJMA 3EBEA 2YTXA 2NZHA 4RKLA 2BDOA 4NMZA 1SAPA 1KTKA 4LF4L 2JSOA 2Z8LA 2PZTA 4UY8C 3VYUA 1X3PA 3KF6B 2LS01 2E5LQ 4QJFA 3HOZG 3NBHA 4APVA 3DWQA 2Q8RE 4X3TA 5IP7H 5C4JB 1X54A 2R7FA 5IGGA 4X66L 1WD1A 1ILQA 5DM73 4OO1I 1BCPD 4GN4B 1M1KC 1VQJA 2E8GA 3OYYA 2JQOA 1NAPA 3ITPA 3DUZA 1SNPA 1I6HH 1IBKL 3HOYB 3T4AC 5IP9H 1XMOQ 3H0GG 2BOSA 4NXNL 2RDGA 2XVSA 4LW1A 2NUCA 1X65A 3LX0A 1I50B 3VR3A 3Q23A 2UXBQ 2WP8J 1EZ8A 4B9XA 1V1OA 2N55A 4RAUC 1JT8A 2XIWA 3HKZE 4JPBW 3FKIH 2CVRA 5D3DA 3NUCA 2D9UA 4JI4Q 5A2QE 4CJ0B 4C2MB 3S17H 1D6EC 5KNBA 4H44C 3PO2H 1HNZQ 1A3TA 1PTOC 5CV4A 1AW7A 1W6KA 2F0LA 1B1ZA 4I7AA 3VYSA 3G4SA 3SHLA 1HZAA 5C44H 4DR5Q 3HOVB 1BOSA 1VQIA 3CQZH 4DV4Q 1DGSA 3HGBA 3AB9A 4JI0Q 1VQFA 4ZKBB 1NJIC 2KEEA 1BXTA 3RNUA 4BBSB 4DV6Q 4IPDA 1ESRA 2F0UA 4AYBB 4X65L 1XNQL 3HOZB 1WYDA 1OXSC 4HJ9A 3TZUA 1JWUD 3SGIA 4B3TQ 2EYOA 4RCNA 5ELBA 5IYCG 5IY0A 1FGUA 2OTJA 3H6MA 4DR6L 4PMWA 2DJFC 4LMQD 4RGMA 5I2YA 1LT4D 4OIKA 1OXVA 1STYA 3ZJYC 5C0XG 1SMYC 1SEBD 2DNCA 2Z6BA 4O0AA 4DNTB 1BO0A 2JA6B 4OX9Q 3R93A 2KHJA 3L7ZC 4JV5L 1CTMA 1C4QA 3K57A 3A5UA 3HRZC 4UDUC 1MHWC 1JMCA 1HZBA 2KQ3A 2ZTDA 3OTOL 1E24A 1RIPA 3MFYA 1I50H 1HQMC 3LGJA 4RFBA 4JYAQ 3S9WA 4NXMQ 2I07B 3CD6A 2QW7A 2WB1G 4XT1B 2NVQB 2EQSA 4KKTA 2NVTB 1XMQQ 4IPCA 1YJWA 4JI7Q 4H7BA 3IFDA 4YWLA 4C2MH 4A3GB 4HJ5A 1EY9A 4XQNA 1CKOA 1KLGD 5M5WH 4H13C 2HQLA 1WTOA 2JYOA 1CQFA 1Y8PB 5M5YB 3QWNA 3V05A 1DJRD 5CV5A 2AUJD 4RCOA 3C46A 4X3KA 1NR4A 3S1RB 1C0AA 5C6AA 2JA9A 1HTLD 4FF2A 2HQEA 4DFAA 5IYBG 3H3VH 3HOVH 2N3SA 4ZQ3A 3A8IE 3M4OH 2QEJC 4AQYQ 4DKAC 5E4WC 2LSSA 2JA8G 5EQ0A 4YHHQ 5J39A 1UE6A 4TQUS 1IL2A 1Y1WG 4LNQA 3CPFA 2RVLA 3KF8A 1PH9A 2E2JB 4F88A 2NB0A 2AWNA 3L9AX 3D4RA 1D5ZC 4A3IG 2LKVA 4FVMA 1HNWL 2MO0A 2F0JA 4ODGA 4UP8A 1HXYD 5IYDG 2F3IA 3J80c 3PO3B 4DV5Q 2VUMH 4KY5A 2NN6I 3E6ZX 5LHY1 2XGTA 4F8MA 4IOAA 2V4DA 3E9HA 5H1SE 5HGTA 1HR0L 1S5BD 2F4VQ 4B3RQ 3KOJA 1QNUA 5FLMG 5C0XJ 1PZKD
chains in the Genus database with same CATH topology
2QA4A 1ASZA 1UE1A 2UU9Q 2E2HH 4WJ3M 1FVIA 1TWHH 1WI5A 1PH2A 2YYZA 2Z0SA 4UPAA 1XMQL 5J3BA 4GLAC 4JI7L 2JA6H 2JA8H 4UP7A 4JI5Q 4AH6A 1W2BA 5IE8A 2VS1A 1EUJA 1KRSA 2RHQB 1VQCA 1VQHA 2PQAB 3S2HH 2A19A 1J5EQ 4KLKA 2GVBA 3KJPA 1TWFH 3CXCA 2Q2UA 4A3IH 1VQKA 2WAQG 3I4NG 1CUKA 3PUZA 4DV0L 4B3SQ 3GO5A 1U5KA 3G48A 4AYBE 1Q7YC 2JA7H 1KRTA 2AKWB 1X56A 3J80i 4Y7NH 1Q86C 2UUBQ 4A3LG 1TWAH 1CKMA 2Y0SG 5IYDH 4JC0A 5LMNW 2IX0A 4DAYB 2NVQH 4DR4Q 2NVTH 4PZ6A 4MZ9A 1K83H 4AQYL 2UUCL 1PH7A 4JOIA 4KHZA 2N8NA 1VQ5A 4LFBL 3GTKH 2UXDL 3CCRA 4JG2A 3EN2A 4YHHL 5FLMH 2ZTCA 4DUZL 2CFMA 1A63A 5JEAG 2UXBL 2B63G 5C4XG 2B3GA 4LFAQ 3TRZA 4FDBA 1VCIA 5K36G 1I3QH 5M5YH 1JJ2A 3PO3G 5GROA 1B7YB 4DAMA 1UE5A 1IBLQ 1TWCH 2IT1A 4DUYL 4X62Q 2PNHA 3S15H 3T1YQ 3M85A 2AWOA 3TS0A 3S1RH 1GVPA 1O7IA 1WJJA 1K3RA 3HOXG 3G6EA 4GNXC 3CP0A 2VQFQ 1KIXA 3S16H 1V1QA 3F1ZA 2MFIA 3HFZB 4DV5L 1YHQA 2Z6KC 3HKZG 1VQLA 1WCMG 1FJGQ 4KI0A 2CCZA 2PI2E 4A3LH 2F4VL 2XTIA 4B3RL 4UP9A 1P8LA 4DV7L 1PHJA 3CAMA 4OONA 4XTCS 1XPOA 2UU9L 4YWKA 5LMNQ 4YCWA 1X6OA 4IFDG 1K73C 1G6PA 2ZJQA 4A3CH 1J6QA 5M5XH 1VQ4A 4L5TA 4IO9A 4POGA 2HT1A 1VQEA 1WFQA 3K0XA 4YCVA 1E3PA 1E1OA 4JI5L 4K0KQ 3AEVA 4DV4L 3CW2C 2D0OA 5C4XH 2B63H 2I5MX 1NTGA 1X9NA 4HJ8A 1J5EL 3W5OA 2MNAA 3HOWG 1HNXQ 1H95A 2GN5A 3CCMA 3T1HQ 3RN5A 4KHPQ 1KHIA 1HZCA 4BY7H 2OTLA 1V43A 4B3SL 4BA2I 2R93H 1S72A 1PH5A 1L1OB 5LMUQ 3NELA 2VUMG 4HIKA 3J7A5 1SROA 1NY4A 3HOXH 2YTYA 3D31A 3CCQA 3GTJH 2UUBL 4OXPA 3J7ZC 1EYGA 1Y1VG 1HZ9A 2OQ0A 4DR7Q 5M3FH 4L5SA 4LF7Q 5BR8Q 1L0WA 4GN5A 3E9IA 4DR4L 1Y14B 1WCMH 1OTCA 4WJ4A 4QIWE 2A8VA 1PA6A 4QGUA 4NB3A 1PFSA 1HH2P 1I94Q 2WAQE 1G51A 1LM0A 4GLXA 2BH8A 1K8GA 2VNUD 1MIUA 2ES2A 4LFAL 3GDEA 4JI6Q 3MXNB 3GTPH 2HIXA 1IXRA 1A0IA 1YNXA 3BZKA 3G71A 1IBLL 3D0FA 2NN6G 4X62L 3GTMH 4P75A 1Q12A 2ALYB 3T1YL 4OWXB 3J81j 4A3JG 1L2FA 3I4NH 4GOPB 4R4OA 1HJPA 3PUYA 2OCEA 2Q2TA 4DK6C 2VQFL 3GTQH 2C35B 3CMAA 3GD7A 4J15A 3CCEA 4A3MH 1N9WA 2Q2HA 1N33Q 3VDYA 1FJGL 3AYHB 4DV2Q 4A93H 3EIVA 3TEHB 1SFOH 3A0JA 2BH2A 4RG1A 1BBWA 2I5HA 1Y1VH 2JA5G 4GKKQ 5JEAJ 3F2BA 2GVAA 2Q2IA 2ZM6L 1VQ9A 5LMNL 4MNOA 1E1TA 3KLWA 2PQAA 3U50C 3UDGA 2VZAA 4Y52H 1QVCA 2V1CC 4JOIC 1CSQA 1YVCA 3H15A 4K0KL 1A8VA 3PUXA 4JI3Q 1MJEA 4GN3B 3GTOH 3AQQA 3HKSA 1KD1C 1SN8A 3I2ZA 4IJHA 1KC8C 2ASBA 1LYLA 1HNXL 4AIMA 5GAGC 3RLFA 4A3EG 4A75A 3K8AA 3T1HL 1U0LA 1XNRQ 2QEXA 1AE2A 3K7AH 2VQEQ 4EQ5A 4KHPL 1N32Q 1PV4A 1PH3A 4QQBX 4A3JH 1VQGA 4DV3Q 5LMUL 2ZJPA 2WB1E 4PZ7A 3CCVA 3ULJA 2R6GA 4JBJA 4A3BH 2IX1A 3S1NH 3W1GA 1X3EA 3CCSA 5FLXc 4DR7L 4IFDJ 4LF7L 5BR8L 3TQYA 4PG3A 1Q1EA 2EIFA 3U4ZA 4YY3Q 1BBUA 3CF5A 1I94L 4LF4Q 1EQQA 2JA5H 3S1MH 1YBYA 4HJ7A 4A3KG 4BXXH 4GKJQ 1YEZA 2F52A 1XTDA 4A3DG 3JAMc 3STBC 4IPGA 4DR2Q 3K7UC 4A3CG 4DR1Q 1E7ZA 3UDIA 3I4MG 1YITA 4JI6L 1EIYB 3RN2A 3F8TA 2KENA 1YJNA 3HOUH 4PZ8A 4X66Q 1SE8A 3BZCA 3I56A 3RZDH 3A74A 4HIDA 3GTGH 2ZTEA 2UUAQ 3S1QH 2IHEA 3WWVA 1NMGA 4BY7G 3KJOA 5C3EG 1D7QA 4A76A 4A3EH 1EOVA 1UEBA 3BJUA 3U4VA 2R93G 1KQSA 1LUZA 1E22A 1VQDA 4DV1Q 1IBKQ 1N33L 1OXXK 5M3MG 4DV2L 3NEMA 1JJGA 5M3FG 1SRUA 3CPWA 2K50A 2QGQA 3KFUA 3CC4A 2R7DA 4NXNQ 3TS2A 4JI2Q 2RCNA 4GKKL 5C4JH 1R9TH 1T9HA 2KCMA 1QVGA 5AJ3Q 2FXQA 2LXKA 3PSIA 4JI1Q 1S40A 4LF6Q 1SR3A 2LXJA 5IP7G 1KAWA 4A3KH 3CC2A 3DLLA 1CKNB 4JI3L 3L0OA 3JAMi 4A3DH 4P71A 2IHFA 1C9OA 3I7FA 1L1OA 3I4MH 2K4KA 4JI8Q 5GAEC 4JCVE 3Q8DA 1I5FA 4IJLA 4QY7A 5IWAQ 3HOYH 3RZOH 1PYBA 1N8RC 3E0EA 4P72A 4BY1G 2RF4A 1GKHA 3UE0A 1YI2A 2VQEL 1OXTA 1WOCA 1YJ9A 4LFCQ 2D0PA 1UWVA 4EX5A 5C0XI 2OWOA 2H5XA 1VQNA 5IP9G 4LWCA 1IYJB 1Q81C 4DPGA 5C3EH 4A3MG 2JK8A 2AHOB 1EIFA 2K5NA 4A93G 2KBNA 4R1JA 5JJIA 1EFWA 3M4QA 5M3MH 3EBEA 2YTXA 2NZHA 4LUVA 4YY3L 4R4TA 3CCUA 3PIPA 4R4CA 2OQKA 5IYCH 2YU9H 4LF4L 4RMFA 2AMCB 2BA1A 4YWMA 3S24A 1VQPA 4UY8C 1Z47A 3H3VI 4GKJL 5E7NA 3KF6B 4DR2L 1N36Q 2E5LQ 4QJFA 4DR1L 3HOZG 2JE6I 2JEBI 4APVA 3FKIG 2VL6A 3NENA 4X64Q 3PIOA 4GOPA 4A3FG 1PH4A 5IP7H 1X54A 2R7FA 3I55A 4X66L 2Y0SE 4OO1I 3PUVA 2UUAL 3S2DH 1W3SA 3K80C 1NBWA 4GN4B 1M1KC 2CQOA 1VQJA 2E8GA 2JQOA 3OYYA 2CWPA 1Q46A 1QUQB 4A4IA 3PO2G 2UXCQ 1VS0A 4X65Q 4BY1H 4IOCA 3NBHB 1XNQQ 2ID0A 1I6HH 5HY6A 3A5ZB 3TREA 3CCJA 1IBKL 4DV1L 3J81i 3PF5A 4A3BG 5IP9H 5ELOA 1XMOQ 4MTNA 4GNXB 4JBMA 2N49A 5C44G 2MQHA 1GM5A 5GQOA 3H0GG 4NXNL 1N34Q 4JI2L 4P73A 1YIJA 1B8AA 3U58A 2HHHQ 4LW1A 5AJ3L 1XPRA 4LF6L 1X65A 4JI1L 4DR6Q 1A62A 4JBKA 4R4IA 4BBSH 3MEFA 2UXBQ 2WP8J 2DGYA 3ICEA 1D8LA 4ALPA 3HOZH 1JT8A 3B6YA 3HKZE 4A3FH 3FKIH 4JI8L 4GLVB 3HOUG 3PF4A 4ME3A 5IWAL 2NVXH 3F2CA 2VW9A 5ELNA 3KDFB 4BBRG 5JJLA 4JI4Q 4XIGS 4JV5Q 3M9BA 4LFCL 3S17H 1LTLA 3OW2A 4LF5Q 3KF8B 4OWTB 3PO2H 5JJKA 1HNZQ 3FP9A 1FL0A 1RL2A 1XNRL 1MKHA 1VQMA 3OTOQ 2ATWA 1BVSA 3UDXA 1GO3E 4POFA 5IYBH 1ASYA 2CWAA 2R92G 1VQ6A 2DUDA 3G4SA 4B3MQ 2B29A 2UXCL 1HZAA 3UDFA 5C44H 4DR5Q 4NPSA 3H0GH 3FHWA 3CMEA 1VQOA 3PGZA 5EAYA 1N36L 3BU2A 2E5LL 2JEAI 1VQIA 3CQZH 1JB7A 4X64L 4DV4Q 1DGSA 3UE1A 4TVAB 1Y1WH 1UE7A 2YV5A 4JI0Q 4O2DA 1VQFA 1NJIC 3HOYG 2I0QA 1YZ6A 1QZGA 3RNUA 4DV6Q 4IPDA 1L1OC 1P16A 3M7NA 1SMXA 5GADC 3PUWA 1VQ8A 1KL9A 2WFWA 4X65L 4BBRH 4L5RC 1XNQL 1VQAA 1OXSC 1WYDA 3ER0A 3ERSX 1HR0W 1X55A 1AE3A 4HJ9A 4IPHA 1CSPA 1XMOL 1IZ6A 1EQRA 3SGIA 4P74A 4B3TQ 1PYSB 2K5VA 4GS3A 1N34L 3I4OA 1CKNA 3RLNA 3ULPA 1VQ7A 2R92H 2HHHL 5IYCG 5IY0A 1FGUA 2OTJA 2I5LX 4A3GH 1PH6A 4HIOA 1Z9FA 2EXDA 4DR6L 1NE3A 4PMWA 1TWGH 1KXLA 2CKZB 2YTVA 1OXVA 3ULLA 4LF9Q 3ZJYC 4DNIA 5C0XG 2PI2A 2K5HA 2IY5B 2NZOA 4O0AA 4GOPC 3K81C 4BXXG 1Q82C 2VY3A 4LF8Q 1JE5A 2K14A 4OX9Q 2K75A 2KHJA 4JI4L 1JJCB 3L7ZC 4JV5L 2KCTA 1HNWQ 3A5UA 4LF5L 2MO1A 1JMCA 1VQBA 1HNZL 1B70B 4DK3C 1HZBA 4DV3L 3S14H 3J81c 3HOVG 1QZHA 2ZTDA 2ZJRA 4H02A 3OTOL 1IBMQ 1E24A 1RIPA 3KF6A 3GTLH 2KHIA 4QL5A 4DR3Q 3L2PA 1I50H 2JJQA 3LGJA 1HR0Q 4B3ML 4JYAQ 2ZM6Q 4DR5L 4NXMQ 5FJ8G 2E2JH 3STBD 1YHAA 4OO1G 1K0RA 3CD6A 4BBSG 2WB1G 2EQSA 1Q8KA 1SLJA 4IPCA 1XMQQ 1XPUA 1YJWA 4JI7Q 4AYBG 1QUQA 1TXYA 4YWLA 2N78A 4JI0L 4C2MH 3PO3H 1N32L 4HJ5A 3JC66 1CKOA 5M5WH 4X6AH 4DV6L 2HQLA 4C3JH 2E2IH 3CCLA 4GNXA 4IFDI 5DLQE 3AFQA 2Z6KA 3W1BA 4DV0Q 2BA0A 2HIVA 1NMFA 3RR5A 2R7ZG 1C7YA 3PV0A 3CC7A 5GAHC 1C0AA 1YHBA 4B3TL 2JA9A 5IYBG 3M3YH 1GD7A 3H3VH 3HOVH 2N3SA 3M4PA 2D62A 1OXUA 3M4OH 1Q1BA 4AQYQ 4DKAC 2UUCQ 1K9MC 1PVOA 4LFBQ 1M90C 2UXDQ 2LSSA 2JA8G 1BKBA 2JA6G 4YHHQ 4L5QA 5FJ8H 3KDFA 1UE6A 4HIMA 4DUZQ 4TQUS 4LF9L 1IL2A 2RHSB 3IRBA 4R4QA 1Y1WG 4LNQA 3CPFA 1AH9A 5HGQA 1S3OA 1PH9A 4BA1I 4C3HH 3F2DA 3RLOA 3AFPA 5IT9c 1MJCA 2AWNA 4LF8L 4OX9L 4DUYQ 2PMZE 2A1AA 4A3IG 3HOWH 4JBWA 1V9PA 4LUZA 4YCUA 1HNWL 3DM3A 2MO0A 2JA7G 4HJAA 1EWIA 4UP8A 5IYDG 1XJVA 4LUOA 2F3IA 3J80c 4DV5Q 1K8AC 2VUMH 2L15A 2NVYH 1G291 1X3FA 2NN6I 1IBML 4IOAA 2XGTA 2K52A 3E9HA 5H1SE 4DR3L 1QVFA 1X3GA 4C3IH 1HR0L 2R7ZH 3PCOB 1PH1A 1PH8A 4JYAL 2F4VQ 4B3RQ 3KYHC 3KOJA 4NXML 4DV7Q 5FLMG 5C0XJ 4A3GG 4OWWB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QA4 A;  1ASZ A;  1UE1 A;  2UU9 Q;  2E2H H;  4WJ3 M;  1FVI A;  1TWH H;  1WI5 A;  1PH2 A;  2YYZ A;  2Z0S A;  4UPA A;  1XMQ L;  5J3B A;  4GLA C;  4JI7 L;  2JA6 H;  2JA8 H;  4UP7 A;  4JI5 Q;  4AH6 A;  1W2B A;  5IE8 A;  2VS1 A;  1EUJ A;  1KRS A;  2RHQ B;  1VQC A;  1VQH A;  2PQA B;  3S2H H;  2A19 A;  1J5E Q;  4KLK A;  2GVB A;  3KJP A;  1TWF H;  3CXC A;  2Q2U A;  4A3I H;  1VQK A;  2WAQ G;  3I4N G;  1CUK A;  3PUZ A;  4DV0 L;  4B3S Q;  3GO5 A;  1U5K A;  3G48 A;  4AYB E;  1Q7Y C;  2JA7 H;  1KRT A;  2AKW B;  1X56 A;  3J80 i;  4Y7N H;  1Q86 C;  2UUB Q;  4A3L G;  1TWA H;  1CKM A;  2Y0S G;  5IYD H;  4JC0 A;  5LMN W;  2IX0 A;  4DAY B;  2NVQ H;  4DR4 Q;  2NVT H;  4PZ6 A;  4MZ9 A;  1K83 H;  4AQY L;  2UUC L;  1PH7 A;  4JOI A;  4KHZ A;  2N8N A;  1VQ5 A;  4LFB L;  3GTK H;  2UXD L;  3CCR A;  4JG2 A;  3EN2 A;  4YHH L;  5FLM H;  2ZTC A;  4DUZ L;  2CFM A;  1A63 A;  5JEA G;  2UXB L;  2B63 G;  5C4X G;  2B3G A;  4LFA Q;  3TRZ A;  4FDB A;  1VCI A;  5K36 G;  1I3Q H;  5M5Y H;  1JJ2 A;  3PO3 G;  5GRO A;  1B7Y B;  4DAM A;  1UE5 A;  1IBL Q;  1TWC H;  2IT1 A;  4DUY L;  4X62 Q;  2PNH A;  3S15 H;  3T1Y Q;  3M85 A;  2AWO A;  3TS0 A;  3S1R H;  1GVP A;  1O7I A;  1WJJ A;  1K3R A;  3HOX G;  3G6E A;  4GNX C;  3CP0 A;  2VQF Q;  1KIX A;  3S16 H;  1V1Q A;  3F1Z A;  2MFI A;  3HFZ B;  4DV5 L;  1YHQ A;  2Z6K C;  3HKZ G;  1VQL A;  1WCM G;  1FJG Q;  4KI0 A;  2CCZ A;  2PI2 E;  4A3L H;  2F4V L;  2XTI A;  4B3R L;  4UP9 A;  1P8L A;  4DV7 L;  1PHJ A;  3CAM A;  4OON A;  4XTC S;  1XPO A;  2UU9 L;  4YWK A;  5LMN Q;  4YCW A;  1X6O A;  4IFD G;  1K73 C;  1G6P A;  2ZJQ A;  4A3C H;  1J6Q A;  5M5X H;  1VQ4 A;  4L5T A;  4IO9 A;  4POG A;  2HT1 A;  1VQE A;  1WFQ A;  3K0X A;  4YCV A;  1E3P A;  1E1O A;  4JI5 L;  4K0K Q;  3AEV A;  4DV4 L;  3CW2 C;  2D0O A;  5C4X H;  2B63 H;  2I5M X;  1NTG A;  1X9N A;  4HJ8 A;  1J5E L;  3W5O A;  2MNA A;  3HOW G;  1HNX Q;  1H95 A;  2GN5 A;  3CCM A;  3T1H Q;  3RN5 A;  4KHP Q;  1KHI A;  1HZC A;  4BY7 H;  2OTL A;  1V43 A;  4B3S L;  4BA2 I;  2R93 H;  1S72 A;  1PH5 A;  1L1O B;  5LMU Q;  3NEL A;  2VUM G;  4HIK A;  3J7A 5;  1SRO A;  1NY4 A;  3HOX H;  2YTY A;  3D31 A;  3CCQ A;  3GTJ H;  2UUB L;  4OXP A;  3J7Z C;  1EYG A;  1Y1V G;  1HZ9 A;  2OQ0 A;  4DR7 Q;  5M3F H;  4L5S A;  4LF7 Q;  5BR8 Q;  1L0W A;  4GN5 A;  3E9I A;  4DR4 L;  1Y14 B;  1WCM H;  1OTC A;  4WJ4 A;  4QIW E;  2A8V A;  1PA6 A;  4QGU A;  4NB3 A;  1PFS A;  1HH2 P;  1I94 Q;  2WAQ E;  1G51 A;  1LM0 A;  4GLX A;  2BH8 A;  1K8G A;  2VNU D;  1MIU A;  2ES2 A;  4LFA L;  3GDE A;  4JI6 Q;  3MXN B;  3GTP H;  2HIX A;  1IXR A;  1A0I A;  1YNX A;  3BZK A;  3G71 A;  1IBL L;  3D0F A;  2NN6 G;  4X62 L;  3GTM H;  4P75 A;  1Q12 A;  2ALY B;  3T1Y L;  4OWX B;  3J81 j;  4A3J G;  1L2F A;  3I4N H;  4GOP B;  4R4O A;  1HJP A;  3PUY A;  2OCE A;  2Q2T A;  4DK6 C;  2VQF L;  3GTQ H;  2C35 B;  3CMA A;  3GD7 A;  4J15 A;  3CCE A;  4A3M H;  1N9W A;  2Q2H A;  1N33 Q;  3VDY A;  1FJG L;  3AYH B;  4DV2 Q;  4A93 H;  3EIV A;  3TEH B;  1SFO H;  3A0J A;  2BH2 A;  4RG1 A;  1BBW A;  2I5H A;  1Y1V H;  2JA5 G;  4GKK Q;  5JEA J;  3F2B A;  2GVA A;  2Q2I A;  2ZM6 L;  1VQ9 A;  5LMN L;  4MNO A;  1E1T A;  3KLW A;  2PQA A;  3U50 C;  3UDG A;  2VZA A;  4Y52 H;  1QVC A;  2V1C C;  4JOI C;  1CSQ A;  1YVC A;  3H15 A;  4K0K L;  1A8V A;  3PUX A;  4JI3 Q;  1MJE A;  4GN3 B;  3GTO H;  3AQQ A;  3HKS A;  1KD1 C;  1SN8 A;  3I2Z A;  4IJH A;  1KC8 C;  2ASB A;  1LYL A;  1HNX L;  4AIM A;  5GAG C;  3RLF A;  4A3E G;  4A75 A;  3K8A A;  3T1H L;  1U0L A;  1XNR Q;  2QEX A;  1AE2 A;  3K7A H;  2VQE Q;  4EQ5 A;  4KHP L;  1N32 Q;  1PV4 A;  1PH3 A;  4QQB X;  4A3J H;  1VQG A;  4DV3 Q;  5LMU L;  2ZJP A;  2WB1 E;  4PZ7 A;  3CCV A;  3ULJ A;  2R6G A;  4JBJ A;  4A3B H;  2IX1 A;  3S1N H;  3W1G A;  1X3E A;  3CCS A;  5FLX c;  4DR7 L;  4IFD J;  4LF7 L;  5BR8 L;  3TQY A;  4PG3 A;  1Q1E A;  2EIF A;  3U4Z A;  4YY3 Q;  1BBU A;  3CF5 A;  1I94 L;  4LF4 Q;  1EQQ A;  2JA5 H;  3S1M H;  1YBY A;  4HJ7 A;  4A3K G;  4BXX H;  4GKJ Q;  1YEZ A;  2F52 A;  1XTD A;  4A3D G;  3JAM c;  3STB C;  4IPG A;  4DR2 Q;  3K7U C;  4A3C G;  4DR1 Q;  1E7Z A;  3UDI A;  3I4M G;  1YIT A;  4JI6 L;  1EIY B;  3RN2 A;  3F8T A;  2KEN A;  1YJN A;  3HOU H;  4PZ8 A;  4X66 Q;  1SE8 A;  3BZC A;  3I56 A;  3RZD H;  3A74 A;  4HID A;  3GTG H;  2ZTE A;  2UUA Q;  3S1Q H;  2IHE A;  3WWV A;  1NMG A;  4BY7 G;  3KJO A;  5C3E G;  1D7Q A;  4A76 A;  4A3E H;  1EOV A;  1UEB A;  3BJU A;  3U4V A;  2R93 G;  1KQS A;  1LUZ A;  1E22 A;  1VQD A;  4DV1 Q;  1IBK Q;  1N33 L;  1OXX K;  5M3M G;  4DV2 L;  3NEM A;  1JJG A;  5M3F G;  1SRU A;  3CPW A;  2K50 A;  2QGQ A;  3KFU A;  3CC4 A;  2R7D A;  4NXN Q;  3TS2 A;  4JI2 Q;  2RCN A;  4GKK L;  5C4J H;  1R9T H;  1T9H A;  2KCM A;  1QVG A;  5AJ3 Q;  2FXQ A;  2LXK A;  3PSI A;  4JI1 Q;  1S40 A;  4LF6 Q;  1SR3 A;  2LXJ A;  5IP7 G;  1KAW A;  4A3K H;  3CC2 A;  3DLL A;  1CKN B;  4JI3 L;  3L0O A;  3JAM i;  4A3D H;  4P71 A;  2IHF A;  1C9O A;  3I7F A;  1L1O A;  3I4M H;  2K4K A;  4JI8 Q;  5GAE C;  4JCV E;  3Q8D A;  1I5F A;  4IJL A;  4QY7 A;  5IWA Q;  3HOY H;  3RZO H;  1PYB A;  1N8R C;  3E0E A;  4P72 A;  4BY1 G;  2RF4 A;  1GKH A;  3UE0 A;  1YI2 A;  2VQE L;  1OXT A;  1WOC A;  1YJ9 A;  4LFC Q;  2D0P A;  1UWV A;  4EX5 A;  5C0X I;  2OWO A;  2H5X A;  1VQN A;  5IP9 G;  4LWC A;  1IYJ B;  1Q81 C;  4DPG A;  5C3E H;  4A3M G;  2JK8 A;  2AHO B;  1EIF A;  2K5N A;  4A93 G;  2KBN A;  4R1J A;  5JJI A;  1EFW A;  3M4Q A;  5M3M H;  3EBE A;  2YTX A;  2NZH A;  4LUV A;  4YY3 L;  4R4T A;  3CCU A;  3PIP A;  4R4C A;  2OQK A;  5IYC H;  2YU9 H;  4LF4 L;  4RMF A;  2AMC B;  2BA1 A;  4YWM A;  3S24 A;  1VQP A;  4UY8 C;  1Z47 A;  3H3V I;  4GKJ L;  5E7N A;  3KF6 B;  4DR2 L;  1N36 Q;  2E5L Q;  4QJF A;  4DR1 L;  3HOZ G;  2JE6 I;  2JEB I;  4APV A;  3FKI G;  2VL6 A;  3NEN A;  4X64 Q;  3PIO A;  4GOP A;  4A3F G;  1PH4 A;  5IP7 H;  1X54 A;  2R7F A;  3I55 A;  4X66 L;  2Y0S E;  4OO1 I;  3PUV A;  2UUA L;  3S2D H;  1W3S A;  3K80 C;  1NBW A;  4GN4 B;  1M1K C;  2CQO A;  1VQJ A;  2E8G A;  2JQO A;  3OYY A;  2CWP A;  1Q46 A;  1QUQ B;  4A4I A;  3PO2 G;  2UXC Q;  1VS0 A;  4X65 Q;  4BY1 H;  4IOC A;  3NBH B;  1XNQ Q;  2ID0 A;  1I6H H;  5HY6 A;  3A5Z B;  3TRE A;  3CCJ A;  1IBK L;  4DV1 L;  3J81 i;  3PF5 A;  4A3B G;  5IP9 H;  5ELO A;  1XMO Q;  4MTN A;  4GNX B;  4JBM A;  2N49 A;  5C44 G;  2MQH A;  1GM5 A;  5GQO A;  3H0G G;  4NXN L;  1N34 Q;  4JI2 L;  4P73 A;  1YIJ A;  1B8A A;  3U58 A;  2HHH Q;  4LW1 A;  5AJ3 L;  1XPR A;  4LF6 L;  1X65 A;  4JI1 L;  4DR6 Q;  1A62 A;  4JBK A;  4R4I A;  4BBS H;  3MEF A;  2UXB Q;  2WP8 J;  2DGY A;  3ICE A;  1D8L A;  4ALP A;  3HOZ H;  1JT8 A;  3B6Y A;  3HKZ E;  4A3F H;  3FKI H;  4JI8 L;  4GLV B;  3HOU G;  3PF4 A;  4ME3 A;  5IWA L;  2NVX H;  3F2C A;  2VW9 A;  5ELN A;  3KDF B;  4BBR G;  5JJL A;  4JI4 Q;  4XIG S;  4JV5 Q;  3M9B A;  4LFC L;  3S17 H;  1LTL A;  3OW2 A;  4LF5 Q;  3KF8 B;  4OWT B;  3PO2 H;  5JJK A;  1HNZ Q;  3FP9 A;  1FL0 A;  1RL2 A;  1XNR L;  1MKH A;  1VQM A;  3OTO Q;  2ATW A;  1BVS A;  3UDX A;  1GO3 E;  4POF A;  5IYB H;  1ASY A;  2CWA A;  2R92 G;  1VQ6 A;  2DUD A;  3G4S A;  4B3M Q;  2B29 A;  2UXC L;  1HZA A;  3UDF A;  5C44 H;  4DR5 Q;  4NPS A;  3H0G H;  3FHW A;  3CME A;  1VQO A;  3PGZ A;  5EAY A;  1N36 L;  3BU2 A;  2E5L L;  2JEA I;  1VQI A;  3CQZ H;  1JB7 A;  4X64 L;  4DV4 Q;  1DGS A;  3UE1 A;  4TVA B;  1Y1W H;  1UE7 A;  2YV5 A;  4JI0 Q;  4O2D A;  1VQF A;  1NJI C;  3HOY G;  2I0Q A;  1YZ6 A;  1QZG A;  3RNU A;  4DV6 Q;  4IPD A;  1L1O C;  1P16 A;  3M7N A;  1SMX A;  5GAD C;  3PUW A;  1VQ8 A;  1KL9 A;  2WFW A;  4X65 L;  4BBR H;  4L5R C;  1XNQ L;  1VQA A;  1OXS C;  1WYD A;  3ER0 A;  3ERS X;  1HR0 W;  1X55 A;  1AE3 A;  4HJ9 A;  4IPH A;  1CSP A;  1XMO L;  1IZ6 A;  1EQR A;  3SGI A;  4P74 A;  4B3T Q;  1PYS B;  2K5V A;  4GS3 A;  1N34 L;  3I4O A;  1CKN A;  3RLN A;  3ULP A;  1VQ7 A;  2R92 H;  2HHH L;  5IYC G;  5IY0 A;  1FGU A;  2OTJ A;  2I5L X;  4A3G H;  1PH6 A;  4HIO A;  1Z9F A;  2EXD A;  4DR6 L;  1NE3 A;  4PMW A;  1TWG H;  1KXL A;  2CKZ B;  2YTV A;  1OXV A;  3ULL A;  4LF9 Q;  3ZJY C;  4DNI A;  5C0X G;  2PI2 A;  2K5H A;  2IY5 B;  2NZO A;  4O0A A;  4GOP C;  3K81 C;  4BXX G;  1Q82 C;  2VY3 A;  4LF8 Q;  1JE5 A;  2K14 A;  4OX9 Q;  2K75 A;  2KHJ A;  4JI4 L;  1JJC B;  3L7Z C;  4JV5 L;  2KCT A;  1HNW Q;  3A5U A;  4LF5 L;  2MO1 A;  1JMC A;  1VQB A;  1HNZ L;  1B70 B;  4DK3 C;  1HZB A;  4DV3 L;  3S14 H;  3J81 c;  3HOV G;  1QZH A;  2ZTD A;  2ZJR A;  4H02 A;  3OTO L;  1IBM Q;  1E24 A;  1RIP A;  3KF6 A;  3GTL H;  2KHI A;  4QL5 A;  4DR3 Q;  3L2P A;  1I50 H;  2JJQ A;  3LGJ A;  1HR0 Q;  4B3M L;  4JYA Q;  2ZM6 Q;  4DR5 L;  4NXM Q;  5FJ8 G;  2E2J H;  3STB D;  1YHA A;  4OO1 G;  1K0R A;  3CD6 A;  4BBS G;  2WB1 G;  2EQS A;  1Q8K A;  1SLJ A;  4IPC A;  1XMQ Q;  1XPU A;  1YJW A;  4JI7 Q;  4AYB G;  1QUQ A;  1TXY A;  4YWL A;  2N78 A;  4JI0 L;  4C2M H;  3PO3 H;  1N32 L;  4HJ5 A;  3JC6 6;  1CKO A;  5M5W H;  4X6A H;  4DV6 L;  2HQL A;  4C3J H;  2E2I H;  3CCL A;  4GNX A;  4IFD I;  5DLQ E;  3AFQ A;  2Z6K A;  3W1B A;  4DV0 Q;  2BA0 A;  2HIV A;  1NMF A;  3RR5 A;  2R7Z G;  1C7Y A;  3PV0 A;  3CC7 A;  5GAH C;  1C0A A;  1YHB A;  4B3T L;  2JA9 A;  5IYB G;  3M3Y H;  1GD7 A;  3H3V H;  3HOV H;  2N3S A;  3M4P A;  2D62 A;  1OXU A;  3M4O H;  1Q1B A;  4AQY Q;  4DKA C;  2UUC Q;  1K9M C;  1PVO A;  4LFB Q;  1M90 C;  2UXD Q;  2LSS A;  2JA8 G;  1BKB A;  2JA6 G;  4YHH Q;  4L5Q A;  5FJ8 H;  3KDF A;  1UE6 A;  4HIM A;  4DUZ Q;  4TQU S;  4LF9 L;  1IL2 A;  2RHS B;  3IRB A;  4R4Q A;  1Y1W G;  4LNQ A;  3CPF A;  1AH9 A;  5HGQ A;  1S3O A;  1PH9 A;  4BA1 I;  4C3H H;  3F2D A;  3RLO A;  3AFP A;  5IT9 c;  1MJC A;  2AWN A;  4LF8 L;  4OX9 L;  4DUY Q;  2PMZ E;  2A1A A;  4A3I G;  3HOW H;  4JBW A;  1V9P A;  4LUZ A;  4YCU A;  1HNW L;  3DM3 A;  2MO0 A;  2JA7 G;  4HJA A;  1EWI A;  4UP8 A;  5IYD G;  1XJV A;  4LUO A;  2F3I A;  3J80 c;  4DV5 Q;  1K8A C;  2VUM H;  2L15 A;  2NVY H;  1G29 1;  1X3F A;  2NN6 I;  1IBM L;  4IOA A;  2XGT A;  2K52 A;  3E9H A;  5H1S E;  4DR3 L;  1QVF A;  1X3G A;  4C3I H;  1HR0 L;  2R7Z H;  3PCO B;  1PH1 A;  1PH8 A;  4JYA L;  2F4V Q;  4B3R Q;  3KYH C;  3KOJ A;  4NXM L;  4DV7 Q;  5FLM G;  5C0X J;  4A3G G;  4OWW B; 
#chains in the Genus database with same CATH topology
 1Z7T A;  1UE1 A;  4WJ3 M;  2XWB B;  1BUV T;  2Z0S A;  1A6X A;  3RMH A;  2JA6 H;  4KK7 A;  1ENA A;  3L3O C;  2AQ2 B;  1GUT A;  3BYT B;  4KJN A;  1J5E Q;  3NWS A;  1LAB A;  4KLK A;  1FNW A;  2L11 A;  1PTO H;  4B3S Q;  2B2W C;  3G48 A;  4DK1 A;  2EY6 A;  3LNN A;  2UUB Q;  1AEX A;  1EIH A;  1TWA H;  1HA5 A;  2NVQ H;  2NVT H;  4MZ9 A;  5ELD A;  5BN3 A;  1PH7 A;  4KHZ A;  4K5W A;  2XRS D;  1SFO B;  1GOZ A;  1PFN A;  2ZTC A;  4DUZ L;  2UXB L;  2B63 G;  4LFA Q;  1VCI A;  4Q5V A;  5M5Y H;  1JJ2 A;  5GRO A;  1B7Y B;  2IT1 A;  4C3J G;  3GTJ B;  2PNH A;  2EXZ A;  3T1Y Q;  2AWO A;  1K28 A;  3S1R H;  2JA8 B;  1O7I A;  3ND9 A;  2DNE A;  5A35 A;  1BF4 A;  1LT5 D;  3I8Z A;  2MFI A;  3NHH A;  3HKZ G;  5C4H A;  1VQL A;  4WJW A;  1FJG Q;  5I6Y A;  1CZG A;  1TWF B;  4CKB A;  2FMM A;  4UP9 A;  3T53 B;  4DV7 L;  2MJ8 A;  1X6O A;  4A3C H;  4CKC A;  2HT1 A;  3TSS A;  2EYH A;  4IO9 A;  3CRL C;  4YCV A;  4HED A;  5LL6 S;  2F3V A;  4J1M A;  3AEV A;  4DV4 L;  3ZYY X;  1HUM A;  1NTG A;  2QDB A;  3R2I A;  2NWG A;  3W5O A;  2MNA A;  3HOW G;  1H95 A;  3CCM A;  5BN5 A;  3RN5 A;  2OTL A;  2J4X A;  2R93 H;  1V8Q A;  1L1O B;  1TS3 A;  5LMU Q;  1S4Z A;  3J7A 5;  1NR2 A;  1SRO A;  1RD9 D;  2YTY A;  3GTJ H;  3FMC A;  3MXG A;  4ZLT F;  1EZ6 A;  1EFI D;  1C48 A;  1K8M A;  4L5S A;  1GJX A;  5CV8 A;  1OTC A;  2A8V A;  1ZKO A;  4PMC A;  1S5E D;  1I94 Q;  1B3A A;  3H94 A;  4GLX A;  2L4N A;  4RH6 A;  1I4P A;  2F4I A;  2ZXP A;  2ES2 A;  3GDE A;  1LTB D;  3BS1 A;  3GTP H;  2HIX A;  1I4H A;  2WIN B;  1A0I A;  4L8J A;  3G71 A;  1IBL L;  4IAL A;  2DJG C;  4DNR B;  1Q12 A;  2ALY B;  4CGY B;  4DN4 M;  1ZYR D;  3PUY A;  1H9K A;  3GTQ H;  3HP3 A;  3GD7 A;  2Q2H A;  5E1F A;  4CHT B;  3Q6S A;  1UEA B;  3NXW A;  1GUG A;  3QB3 A;  3EIV A;  1F2Z A;  4EQP A;  5KIX A;  1SFO H;  2K01 A;  1BBW A;  2I5H A;  2BH2 A;  3DM1 A;  4B08 A;  1QE6 A;  1T5E A;  2X6G A;  4RGO S;  2RSO A;  4O1N A;  1TKW B;  3FEW X;  5M3M B;  5HUR A;  1X32 A;  5M3F B;  1YVC A;  3I4L A;  3HKZ B;  3H15 A;  1A2T A;  5K5P A;  1A8V A;  4LK1 C;  1HHV A;  1STB A;  1HUN A;  1PZJ D;  4Q0F A;  1YNJ C;  1I4G A;  4AIM A;  4A3E G;  2J7Z A;  4A75 A;  4KHP L;  4DAY A;  1N32 Q;  1PH3 A;  4DV3 Q;  3S2D B;  4PZ7 A;  1EY4 A;  3CCV A;  2R6G A;  4JBJ A;  4UAI A;  3PIO 3;  4A3B H;  5FKA C;  1BBX C;  5FLX c;  3NPP A;  3I4N B;  3TQY A;  2O2L D;  4XDX A;  2NBF A;  3QJY A;  4LF4 Q;  4HJ7 A;  4A3K G;  4BXX H;  4A93 B;  4WFN 3;  4A3D G;  1F9P A;  3STB C;  4KN4 C;  3K7U C;  2M2L A;  1E7Z A;  3UDI A;  5EBD A;  1YIT A;  2EY2 A;  4X66 Q;  1A3V A;  3BZC A;  3A74 A;  2LY7 A;  3R2T A;  1EQT A;  4RA8 A;  1NMG A;  1D7Q A;  4A76 A;  1EOV A;  1SNM A;  5D65 A;  3D6W A;  1LUZ A;  1IKM A;  1VQD A;  1IBK Q;  4DGZ A;  1N33 L;  3NK9 A;  2F0K A;  4DV2 L;  1JJG A;  1PRT F;  3K7A B;  4NXN Q;  1STA A;  4GKK L;  1JOQ A;  5CV7 A;  3OIQ A;  5IP7 G;  1EY7 A;  4S3S A;  3CC2 A;  5A2Q L;  4FP5 D;  4ID6 A;  1C9O A;  1EQV A;  4U68 A;  2K4K A;  3KUP A;  5GAE C;  1I5F A;  2HUG A;  3RZO H;  1PYB A;  1N8R C;  3E0E A;  5CV6 A;  1GKH A;  1CI3 M;  2MHV A;  3SK5 A;  1RHP A;  5C0X I;  4FXG C;  5IP9 G;  3AMU A;  4XT3 B;  3HOU B;  3MTS A;  2D2C C;  4A3M G;  2JK8 A;  3GTG B;  1EIF A;  2KA7 A;  5J22 A;  1CA6 A;  3S1Q B;  4R1J A;  5M3M H;  4YY3 L;  1U4L A;  3CCU A;  1E0B A;  1STE A;  4R4C A;  1BCP F;  2OQK A;  3DWA A;  2IX3 A;  2BA1 A;  3K58 A;  4DR1 L;  3K5N A;  4FF4 A;  3W3A A;  3FKI G;  2VL6 A;  5EPL A;  3WOF A;  2EJG C;  1NUC A;  3PQI A;  5EKL A;  3H09 A;  2F03 A;  4OL7 A;  3S2D H;  1W3S A;  5I9P A;  3PO2 G;  2L0C A;  1C8C A;  4XYQ A;  4A3D B;  4X65 Q;  1XNQ Q;  2F0W A;  2ID0 A;  1WTP A;  3E5S A;  1B53 A;  2VXW A;  1SE3 A;  4EGV A;  2B39 A;  3PF5 A;  1EU3 A;  5C44 G;  1QB5 D;  3J80 E;  1YIJ A;  3U58 A;  3F2U A;  1XPR A;  4DR6 Q;  1ZEQ X;  4QF4 A;  3GV6 A;  2SOB A;  3GP7 A;  3P7J A;  3EQL C;  1HCZ A;  3B6Y A;  4XXE A;  4M8A A;  4A3F H;  3DXJ C;  4GLV B;  2VW9 A;  5ELN A;  2A68 D;  2R61 A;  4JV5 Q;  1JIC A;  2EYJ A;  4TRD A;  3KF8 B;  4X3U A;  1RL2 A;  1U4P A;  5CBE E;  1VQM A;  3T13 A;  3OTO Q;  2ATW A;  1IW7 C;  3UDX A;  1GO3 E;  1TS2 A;  2B8F A;  2UXC L;  2K5D A;  1H9S A;  5EAY A;  1MGS A;  3BU2 A;  1N36 L;  4IUN A;  3MFG A;  1SNO A;  2EE1 A;  3UE1 A;  4E6I A;  1EIG A;  4TVA B;  3UI2 A;  3HOY G;  1QZG A;  4X3S A;  2K5Q A;  5NUC A;  2PPB C;  3M7N A;  1SMX A;  3BDL A;  1KL9 A;  3ONA B;  1CZW A;  2G9H D;  1VQA A;  1G6Z A;  1JB3 A;  1X55 A;  1CSP A;  1TQO A;  1TS5 A;  3J7Y W;  4P74 A;  2BE5 D;  3S17 B;  5M9O A;  3K5L A;  3ULP A;  2HHH L;  1PH6 A;  4HIO A;  2R7Z B;  1KXL A;  5ISR A;  2YTV A;  3TBI B;  2H1E A;  1TY0 A;  3T16 A;  5C44 B;  2E2H B;  2PI2 A;  2IY5 B;  2NZO A;  5C4Z A;  4GOP C;  1Q82 C;  2K14 A;  5COY A;  2B2W A;  4G7O C;  1HNW Q;  2EJF C;  4LF5 L;  2IWH A;  4DK3 C;  1W6J A;  2WAC A;  4DV3 L;  1BNZ A;  3J81 c;  3HOV G;  5EKI A;  2ZJR A;  4H02 A;  1HR0 Q;  2JJQ A;  3MVV A;  3JAM L;  4KV6 A;  3NTH A;  1JE4 A;  4BBS G;  4FYD A;  4CDC C;  1I4R A;  4AYB G;  1QUQ A;  5IOD A;  1WTR A;  2N78 A;  2TSS A;  1SYB A;  2A74 C;  3VR4 A;  1ML0 D;  3D3R A;  2A68 C;  3EFX D;  1JCK B;  2BA0 A;  2HIV A;  4I65 A;  1B50 A;  3PV0 A;  2PW7 A;  5GAH C;  2CW0 D;  2RDH A;  1YHB A;  4OHJ A;  3S16 B;  2QCP X;  1GD7 A;  3QIA A;  1OXU A;  5FO9 B;  1SE4 A;  2ENB A;  2FFK B;  3TP5 A;  1M90 C;  1BKB A;  2JA6 G;  4DUZ Q;  3NBI A;  4MTK A;  3IRB A;  1AH9 A;  4ZUJ A;  1R4Q B;  4C3H H;  3F2D A;  3RLO A;  5IT9 c;  5M5X B;  1MJC A;  1KLU D;  4ZCK A;  3J81 L;  3DM3 A;  4I7Z C;  2IW3 A;  1ICF B;  4GZY C;  1AFP A;  1HFG A;  5ELE A;  5M5W B;  1IBM L;  3IL8 A;  1QVF A;  2R7Z H;  3HOX B;  4KKS A;  4DV7 Q;  5FLX E;  4A3G G;  4OWW B;  2QA4 A;  2E2H H;  4ZUI A;  1LTT D;  1PH2 A;  2YYZ A;  1WCM B;  4GLA C;  4UP7 A;  4AH6 A;  3M4O B;  5IE8 A;  2VS1 A;  4CKE A;  1DM0 B;  1EUJ A;  2RHQ B;  1PRT C;  2MP1 A;  1VF5 C;  3LWE A;  2KOL A;  3PUZ A;  5DM6 3;  1S5F D;  1BDO A;  3I70 A;  1WTQ A;  1Q86 C;  2IL8 A;  1RCV D;  1CKM A;  3OHX C;  2EOT A;  3D8G A;  5LMN W;  2IX0 A;  4DAY B;  5EPJ A;  5FO7 B;  4LFB L;  2VUM B;  2SNM A;  3GTK H;  3SK8 A;  1Y1V B;  1A63 A;  2PQE A;  1F2Y A;  5K36 G;  1A3U A;  3PO3 G;  3IFT A;  4DAM A;  1Y8O B;  3N6R A;  1IBL Q;  1TWC H;  3LWU A;  4J6H A;  1RTN A;  5T1G A;  1BCP C;  4GNX C;  1KIX A;  3S16 H;  3SDZ A;  3MWY W;  4DAV A;  5E3F A;  4A3J B;  2F1M A;  4CBV A;  3KBX A;  5EBC A;  4A3L H;  2XTI A;  4HCE A;  1PTO B;  1P8L A;  1EYA A;  4OON A;  4XTC S;  5C5M A;  5EPK A;  4EQN A;  4IFD G;  1TWA B;  1K73 C;  1RKN A;  1J6Q A;  5M5X H;  1VQ4 A;  1VQE A;  2PYK A;  3KBG A;  3MZ5 A;  3S1M B;  2JA5 B;  2O5I C;  2BCO A;  5IGB A;  2D0O A;  4QUF A;  4QB4 A;  2GN5 A;  4IUP A;  5JVG 3;  4KHP Q;  1CK1 A;  4BY7 H;  1PH5 A;  4HMI A;  5CGK A;  3VR2 A;  3HOX H;  2E76 C;  2EYM A;  2EY5 A;  4OEM B;  1KNE A;  2OQ0 A;  1L0W A;  1Y14 B;  1WCM H;  2F0H A;  3M7G A;  4QIW E;  1PA6 A;  4QGU A;  2WAQ E;  3TDQ A;  2BH8 A;  1O7L A;  1JQY D;  1JOK A;  2EYF A;  1R9T B;  2A73 B;  4K14 A;  4R8N A;  3BZK A;  3GTM H;  4P75 A;  2BDN A;  3J81 j;  1L2F A;  1HJP A;  3I4M B;  2OCE A;  4KTA A;  2Q2T A;  4DK6 C;  1N33 Q;  4KKU A;  4DV2 Q;  5IGD A;  4DXG A;  4ILW A;  1Y1V H;  4KHV A;  4GKK Q;  2R93 B;  1NSN S;  5E4X A;  3P75 A;  1JWS D;  1E1T A;  3U50 C;  2PQA A;  2VZA A;  3OWF A;  2V1C C;  5KEE A;  4JOI C;  4KN7 C;  5IOC A;  2A69 D;  4K0K L;  3PUX A;  1G8Z D;  4GN3 B;  1GHJ A;  3GTO H;  3ERO A;  2F0G A;  1KD1 C;  4IJH A;  3JAM E;  4MHE A;  5FOB B;  1Y69 U;  3RLF A;  3K8A A;  3SXH A;  1AE2 A;  4F7X A;  4QQB X;  4A3J H;  1TR5 A;  1VQG A;  3KLS A;  3GTP B;  2IPK D;  3S1N H;  4ME5 A;  1JOR A;  3CCS A;  1LAC A;  4KJO A;  4IFD J;  1A15 A;  3GTQ B;  4YY3 Q;  1MBY A;  2J0T D;  3T51 B;  3C3L A;  3S1M H;  2JA5 H;  1B9M A;  1GUN A;  1Q90 A;  2F52 A;  2XNA C;  1XTD A;  3DMU A;  1D1I A;  4NP5 A;  4DR1 Q;  4ZK9 B;  1GUS A;  4NDX A;  4JI6 L;  1H9S B;  3RN2 A;  3F8T A;  2KEN A;  2F0I A;  4HID A;  2IHE A;  3WWV A;  1U9R A;  2B2Y C;  1TY2 A;  3J80 L;  4HSP A;  2NVX B;  4KY6 A;  2L5T A;  1E22 A;  5M3M G;  5M3F G;  5JAV A;  2QGQ A;  4RWS C;  1EY6 A;  3TS2 A;  2R7D A;  3J81 E;  1SBB B;  1R9T H;  1T9H A;  2RBM A;  2KCM A;  1ET6 A;  1XXG A;  5TSS A;  3IAY A;  4A3B B;  4G7H C;  1SR3 A;  1Z6H A;  3NTI A;  1ENC A;  4JI3 L;  3L0O A;  4OEL B;  3JAM i;  4IUV A;  1Y8N B;  3I7F A;  3I4M H;  3Q8D A;  4IJL A;  2FJ2 A;  2NYZ D;  2L12 A;  4QUC A;  5CC4 A;  2ICI A;  1XNR L;  3I4N G;  4ABN A;  2VQE L;  1WOC A;  3I3C A;  1YI2 A;  1YJ9 A;  2D0P A;  4EX5 A;  2H5X A;  4LWC A;  1Q81 C;  2K32 A;  4RGT A;  3GQB A;  4A93 G;  2KBN A;  5DNF A;  4BBR B;  5JJI A;  1EFW A;  1B2T A;  4IUT A;  3M4Q A;  4WOR A;  2UXC Q;  1CA5 A;  4LUV A;  3MXN A;  3PIP A;  3RD4 A;  5IYC H;  4RMF A;  1S5C D;  1VQP A;  3H3V I;  1Z47 A;  4GKJ L;  5E7N A;  4DR2 L;  4O42 A;  1N36 Q;  2F0F A;  2JEB I;  4GOP A;  3PIO A;  3NEN A;  4A3F G;  1PH4 A;  1O78 A;  3FRP B;  3I55 A;  1II3 A;  2Y0S E;  3PUV A;  2UUA L;  4B9W A;  1NBW A;  4CDF C;  5IT9 E;  1Q46 A;  1QUQ B;  2DY7 A;  2K28 A;  4A4I A;  1VS0 A;  2B2U C;  4BY1 H;  4IOC A;  3NBH B;  5HY6 A;  3A5Z B;  4V0B A;  4TKO B;  1E2W A;  3WDN A;  4JK1 C;  3J81 i;  3RZO B;  3I91 A;  4JBM A;  2N49 A;  2MQH A;  1TII D;  3V2T A;  5GQO A;  3DWP A;  1EYD A;  4CJ1 B;  2HHH Q;  1WTH A;  4JI1 L;  1PFM A;  1RJT A;  4JBK A;  4R4I A;  3E0J A;  3BYY B;  2DGY A;  5DAU A;  3ICE A;  1D8L A;  5EGT A;  4ALP A;  2KJX A;  4JI8 L;  3HOU G;  4ME3 A;  5IWA L;  2NVX H;  3F2C A;  4KMU C;  5L37 A;  3NE5 B;  4XIG S;  3I72 A;  1LTL A;  4DA2 A;  4EVO A;  4LF5 Q;  1HPC A;  1GHK A;  1O80 A;  3FP9 A;  3PMF A;  1FL0 A;  4G57 A;  1ASY A;  5IYB H;  4K8J A;  1NNX A;  2ICE C;  3UDF A;  4NPS A;  3CME A;  3M3Y B;  3I73 A;  1SJH D;  1EOT A;  1QJO A;  5DEH A;  4X64 L;  1Y1W H;  4RKB A;  2ZXR A;  5I4D A;  4O2D A;  1DOK A;  4CDE C;  4CJ2 C;  2E74 C;  4DK0 A;  1P16 A;  2XSC A;  3PUW A;  4BBR H;  4L5R C;  2F0N A;  4A3F B;  2M9V A;  3FDT A;  1AE3 A;  2K1B A;  4IPH A;  1IZ6 A;  5AFW A;  1ET9 A;  1PYS B;  4GS3 A;  5JVH 3;  2HCI A;  3I4O A;  1CKN A;  3EVQ A;  1N34 L;  2NVY B;  4R8I A;  2R92 H;  1ONL A;  5COR A;  1KAB A;  2EXD A;  3OOC A;  4C3I B;  3J7A F;  1F9R A;  3QOL A;  1K0S A;  2CKZ B;  4KY7 A;  4DNI A;  2K5H A;  3M4Y A;  3HS0 C;  2VY3 A;  5CYU A;  1JE5 A;  1TS4 A;  2MGS A;  1JC7 A;  2KCT A;  4N8X 1;  5KND A;  2MO1 A;  2EY1 A;  1ZYR C;  3CHB D;  5FLX L;  4HAE A;  2X69 A;  1QZH A;  1IBM Q;  3GTL H;  2KHI A;  3L2P A;  4B3M L;  3D4W A;  2ZM6 Q;  2JA7 B;  2Z4H A;  2O5J C;  5C3X A;  4K6L A;  5BN4 A;  1KDB A;  2G9D A;  1Q8K A;  1XPU A;  4C3H G;  4QCL A;  1TXY A;  3MXP A;  1QWY A;  2E2I H;  4C3J H;  3CCL A;  4IFD I;  4X6A H;  4GNX A;  5IIF A;  3HZX A;  2DN8 A;  1LLR D;  3S15 B;  1BR9 A;  2R7Z G;  3CC7 A;  1DXM A;  1VDZ A;  2F0Q A;  4QIW B;  3M3Y H;  1U4R A;  1FGB D;  1JWM D;  2WAQ B;  2D62 A;  2QKI C;  1Q1B A;  4DF7 A;  1RF2 D;  2N88 A;  5T1I A;  1K9M C;  3E3X A;  1HQR D;  4LFB Q;  2XWJ B;  4PQX A;  4L5Q A;  5FJ8 H;  3KDF A;  2KED A;  4HIM A;  4OO1 H;  1PXU A;  4LF9 L;  2F0D A;  1I6V C;  2A6E D;  5HGQ A;  1S3O A;  2RA4 A;  4BA1 I;  1S5D D;  3AFP A;  1IKL A;  3DEO A;  4LF8 L;  1EYC A;  3A8J E;  2PMZ E;  2LMC B;  4ZAI A;  3HOW H;  1V9P A;  4LUZ A;  1XWE A;  3FVQ A;  4EQO A;  1G91 A;  1LTI D;  5EJW A;  5C4X B;  1UAP A;  4N8F A;  1EWI A;  1XJV A;  1RTO A;  1X3Q A;  1DON A;  1K8A C;  2L15 A;  2NVY H;  1G29 1;  1EWH A;  1X3F A;  2K52 A;  4HN7 A;  2EYL A;  4IZ8 A;  4DR3 L;  1X3G A;  3BZD B;  4OIJ A;  4C3I H;  3PCO B;  1PH1 A;  1PH8 A;  4C56 C;  3VR6 A;  1IL8 A;  1V1P A;  1ASZ A;  1FVI A;  4BS9 A;  2X6L A;  4UPA A;  5J3B A;  2C9O A;  1W2B A;  5KRU A;  1KRS A;  1LV9 A;  5D3I B;  2PQA B;  1VQH A;  1FYC A;  4PV1 C;  3S2H H;  1G2T A;  1DD2 A;  2A19 A;  1CHP D;  3ND8 A;  2GVB A;  5C3W A;  1CUK A;  4DV0 L;  1O7Y A;  2RQX A;  4C3H B;  4IUU A;  1Q7Y C;  2JA7 H;  5KYL A;  1KRT A;  4A3L G;  1X56 A;  3J80 i;  4Y7N H;  5JPN C;  2Y0S G;  2GA4 B;  2NTT A;  3NP8 A;  3BVG A;  2UUC L;  3MXU A;  4JOI A;  2PNR C;  1VQ5 A;  2UXD L;  5KYI A;  3T56 B;  1O7Z A;  4J8Q A;  4FDB A;  4Z9C B;  3VA5 A;  3R8B A;  1UE5 A;  2MUY A;  2L1B A;  1SXT A;  3O13 A;  4DUY L;  3S15 H;  1EY0 A;  3M85 A;  3TS0 A;  2WKD A;  1FNV A;  2XRQ D;  1GVP A;  1K3R A;  1QCB D;  3HOX G;  1PTO D;  4PNY A;  1V1Q A;  3HFZ B;  2WII B;  3FPP A;  1YHQ A;  1SSO A;  2Z6K C;  1FR3 A;  1WCM G;  2PI2 E;  1U4M A;  1KNA A;  1H9M A;  1PHJ A;  3CAM A;  2EZV A;  1XPO A;  2UU9 L;  4YWK A;  3SE0 A;  1G6P A;  4L5T A;  1WFQ A;  3K0X A;  4JI5 L;  4K0K Q;  3K5O A;  3VR5 A;  2A6E C;  1OO9 B;  5JEA H;  2QIL A;  5C4X H;  2I5M X;  3GTK B;  1X9N A;  2B2Y A;  4HJ8 A;  2VB3 X;  4KD3 A;  2Z1C A;  2AQ3 B;  3QOJ A;  1S72 A;  3K59 A;  2VUM G;  4OGQ C;  1NY4 A;  2A5H A;  1TWC B;  2B8G A;  3CCQ A;  3SVM A;  1EYG A;  1UUP A;  1Y1V G;  1HZ9 A;  2OXP A;  4DR4 L;  3H3V C;  4WJ4 A;  3FPU B;  4NB3 A;  1PFS A;  3AU7 A;  1G51 A;  2XN9 C;  4JVZ A;  3QG1 A;  1SMY D;  4N9T A;  2B2V C;  2L55 A;  2VNU D;  2Y0S B;  3NSW A;  4JI6 Q;  3MXN B;  4K5V A;  1YNX A;  3D0F A;  4X62 L;  1KDA A;  4A3J G;  2SNS A;  4OWX B;  4GOP B;  5J1Z A;  2VQF L;  2KCC A;  3CMA A;  4A3M H;  1E2Z A;  2FMC A;  3AYH B;  4ZYS A;  3D4D A;  3TEH B;  4BY7 B;  3A0J A;  4RG1 A;  5C3E B;  3OMG A;  2JA5 G;  2BE5 C;  1CT1 D;  2GVA A;  3BVZ A;  2ZM6 L;  1VQ9 A;  5LMN L;  1LT3 D;  3KLW A;  3TP8 A;  4Y52 H;  1QVC A;  2EPB A;  1CSQ A;  2YU9 B;  2NTS A;  4JI3 Q;  1MJE A;  1MD2 D;  3I2Z A;  3R3O A;  2ASB A;  1LYL A;  2B2U A;  1HNX L;  3T1H L;  2NN6 H;  1F2L A;  2Z9H A;  3C1E A;  2F3W A;  3G7L A;  2QEX A;  2VQE Q;  1XNR Q;  1PV4 A;  1H9J A;  2G5D A;  4FNF A;  3TN2 A;  3GTM B;  1X3E A;  4DR7 L;  1PFB A;  5C5L A;  5BR8 L;  5JPM C;  4LF7 L;  4PG3 A;  2EIF A;  3A7L A;  3A54 A;  3CF5 A;  4LJZ C;  3TP7 A;  1YBY A;  4V19 0;  1GXD C;  4GKJ Q;  4A3C G;  2HD3 A;  4DR2 Q;  2D5D A;  1LTG D;  3I4M G;  5IT9 L;  1EIY B;  3D6C A;  3A56 A;  2B2T C;  5CR3 A;  1SE8 A;  4ULL A;  2ZTE A;  1WTW A;  1VMP A;  2UUA Q;  3SK4 A;  3KJO A;  4P2C B;  1UEB A;  2PO4 A;  3BJU A;  3BVM A;  3OWE B;  3U4V A;  3GTO B;  2R93 G;  2LFN A;  3J7A V;  1L0Y B;  3NEM A;  3OIP A;  2K50 A;  3KFU A;  2CW0 C;  1SYE A;  3CC4 A;  4NW2 A;  2RCN A;  1WD0 A;  5IGF A;  5C4J H;  1D5X C;  1S40 A;  2FXQ A;  2LXK A;  3PSI A;  4JI1 Q;  3S1N B;  2LXJ A;  3K6O A;  2ZT9 C;  3H0G B;  1CKN B;  3DLL A;  4P71 A;  2IHF A;  3CU7 A;  4JI8 Q;  4C1N K;  5IWA Q;  3HOY H;  1WTV A;  3C1F A;  4BY1 G;  1MSH A;  2RF4 A;  5KGU A;  2OWO A;  1UWV A;  1VQN A;  1PRT B;  5FO8 B;  1SND A;  1IYJ B;  1DOM A;  4DPG A;  1K3B C;  5C3E H;  1D5M C;  5JJZ A;  2K5N A;  4N9P A;  1IHZ A;  3OPO A;  4R4T A;  2YU9 H;  2AMC B;  4YWM A;  1PLF A;  5D14 A;  3S24 A;  1QIL A;  2P5Z X;  3K5M A;  1SNC A;  2E2D C;  1XYI A;  2JE6 I;  1DZ1 A;  3TP6 A;  4X64 Q;  1TWG B;  3K80 C;  3DEP A;  3OMC A;  4K5X A;  2CQO A;  5G3L F;  2CWP A;  1XTC D;  1LTA D;  3DHQ A;  4LAA A;  1JOO A;  2F0V A;  4QMG A;  3TRE A;  3CCJ A;  4HMJ A;  4DV1 L;  4A3B G;  1BCP B;  5ELO A;  1R4P B;  4MTN A;  2AUK A;  4GNX B;  3EA6 A;  4KD4 A;  1GM5 A;  1HRJ A;  4DU9 A;  1N34 Q;  4JI2 L;  4P73 A;  3S14 B;  1B8A A;  5AJ3 L;  4BXX G;  4LF6 L;  4XYO A;  2NZ1 D;  1A62 A;  4BBS H;  3MEF A;  2WV6 D;  3HOZ H;  2PMZ B;  2H4O A;  3PF4 A;  2KUM A;  1I4X A;  1T5X D;  2CH4 W;  3KDF B;  4BBR G;  5JJL A;  3CKI B;  4IUR A;  3M9B A;  4LFC L;  3OW2 A;  3IKJ A;  5LL6 X;  4OWT B;  5JJK A;  1QNK A;  1A2U A;  2JN4 A;  1MKH A;  1QOH A;  4K8I A;  3WOE A;  5ELF A;  1BVS A;  3NTK A;  3U9O A;  4POF A;  2R92 G;  2CWA A;  1VQ6 A;  2DUD A;  4B3M Q;  2B29 A;  2PCF B;  4BY1 B;  3HG9 A;  3VYR A;  1WVL A;  3H0G H;  3FHW A;  1VQO A;  3PGZ A;  3BDO A;  2E5L L;  2JEA I;  1JB7 A;  1DOL A;  1MSG A;  1UE7 A;  2YV5 A;  1F9S A;  1V1P B;  2I0Q A;  1YZ6 A;  1EU4 A;  2WB1 B;  1L1O C;  2F0S A;  5ELC A;  5GAD C;  1VQ8 A;  2K5W A;  2WFW A;  1HTP A;  1EEI D;  3ER0 A;  3ERS X;  1HR0 W;  3HEJ A;  1XMO L;  4PMB A;  1EQR A;  1FD7 D;  2K5V A;  2QF7 A;  1EY8 A;  3RLN A;  1HA6 A;  1VQ7 A;  2WKC A;  2I5L X;  4A3G H;  1Z9F A;  2RDF A;  1NE3 A;  1TWG H;  1SYC A;  2KHS A;  3ULL A;  4LF9 Q;  1YNJ D;  1TWH B;  3X3N A;  4HCS A;  3K81 C;  1EL0 A;  1L0X B;  4LF8 Q;  3NQT A;  2K75 A;  3QR8 A;  4JI4 L;  1JJC B;  1Q3L A;  1Y1W B;  1VQB A;  1HNZ L;  1B70 B;  3QO2 A;  1CQV A;  3S14 H;  3MEH A;  3A7A B;  4A3I B;  2K05 A;  3KF6 A;  4FF1 A;  4QL5 A;  4DR3 Q;  4TSS A;  1D2B A;  4DR5 L;  5FJ8 G;  4L63 B;  2E2J H;  3STB D;  3Q0A A;  1YHA A;  2M00 A;  5F2D A;  4OO1 G;  1K0R A;  2EYP A;  2JXM B;  1K83 B;  1SLJ A;  4YIJ A;  4G7Z C;  2FHT A;  3CRK C;  3Q24 A;  1CHQ D;  2R92 B;  5K36 H;  4JI0 L;  2A69 C;  3PO3 H;  1F77 A;  5C0X H;  1BQQ T;  3JC6 6;  1HFN A;  4MIU A;  4DV6 L;  4G4K A;  1I3Q B;  4MN3 A;  5DLQ E;  1ICW A;  3AFQ A;  2Z6K A;  3W1B A;  1DCZ A;  4DV0 Q;  3OSO A;  2Q8I B;  4HSV A;  1NMF A;  3RR5 A;  1ILP A;  1C7Y A;  4C3I G;  3BDC A;  1B9N A;  4B3T L;  2F0E A;  1E2V A;  3ERQ A;  3K0Y A;  1PZI D;  3M4P A;  2UUC Q;  1B44 D;  2PZU A;  4FXK C;  1PVO A;  3V96 A;  2UXD Q;  5G3L D;  4XQJ A;  3GTL B;  4IFD H;  3MC0 B;  2RHS B;  4R4Q A;  3W2D A;  5I2X A;  1IYU A;  2K6A A;  4IQZ A;  4OX9 L;  4DUY Q;  2A1A A;  4JBW A;  1TU2 B;  1IYV A;  4YCU A;  2JA7 G;  2B63 B;  4HJA A;  4LUO A;  4XQQ A;  4FO2 A;  1EEF D;  1YNN D;  1PYW D;  3Q22 A;  4C3J B;  2E2I B;  2RKS A;  4JYA L;  4WRD A;  3KYH C;  1MI2 A;  4DXF A;  4NXM L;  2KVM A;  2B2V A;  4C1N I;  2UU9 Q;  1STG A;  1TWH H;  1WI5 A;  1H9R A;  1XMQ L;  3U9S A;  3P1H A;  4JI7 L;  2JA8 H;  4JI5 Q;  2PZW A;  3PIP 3;  1VQC A;  3KLS X;  3EJI A;  2CH4 A;  3KJP A;  4RHS A;  1TWF H;  3CXC A;  2Q2U A;  4A3I H;  1AZP A;  2WAQ G;  1VQK A;  3URY A;  4CDD C;  5KNC A;  3GO5 A;  5CV9 A;  1U5K A;  2F0O A;  3A55 A;  4IN3 A;  4AYB E;  1ROD A;  2I46 A;  3BG3 A;  1F9Q A;  1LO5 D;  2AKW B;  5IYD H;  1DYQ A;  2OT2 A;  3HOW B;  4JC0 A;  1J9O A;  4DR4 Q;  2OF1 A;  4PZ6 A;  1K83 H;  4AQY L;  5CBA E;  1STN A;  2N8N A;  2KEC A;  3CCR A;  4JG2 A;  3EN2 A;  4YHH L;  5FLM H;  4ZKC B;  1PMR A;  1PTO F;  2CFM A;  1SDF A;  5JEA G;  5C4X G;  2K7V A;  2B3G A;  1EWC A;  3TRZ A;  1M4V A;  1I3Q H;  3MHB A;  3SK6 A;  4DAP A;  1ENF A;  4X62 Q;  3NWT A;  2AQ1 B;  1WJJ A;  4M1U B;  3G6E A;  2SDF A;  3CP0 A;  2VQF Q;  3F1Z A;  1AN8 A;  3MA2 B;  1IW7 D;  4DV5 L;  1TT2 A;  3S2H B;  1ZXT A;  4U67 3;  4L6T B;  4KI0 A;  2CCZ A;  2F4V L;  1STH A;  2HDM A;  1QG7 A;  3NQI A;  4B3R L;  2A6H D;  1KDC A;  5EKK A;  2JP1 A;  5IGC A;  5LMN Q;  4YCW A;  2CHB D;  2F0M A;  3G6J B;  4Y7N B;  2K03 A;  2ZJQ A;  4POG A;  2B2T A;  3SR1 A;  4FXD A;  1E3P A;  1E1O A;  4K2L A;  3RUZ A;  3CW2 C;  3P20 A;  1VMC A;  2B63 H;  2MPM A;  1J5E L;  1HNX Q;  4IUQ A;  4FF3 A;  3T1H Q;  1KHI A;  1HZC A;  2R3Z A;  2ZXO A;  1V43 A;  1SYD A;  4B3S L;  3RZD B;  4BA2 I;  4RHR A;  1GUW A;  1B4O A;  5JOB A;  3NEL A;  4HIK A;  3D31 A;  1YNN C;  2F0T A;  1TVX A;  4OXP A;  3X3M A;  3J7Z C;  2UUB L;  4A3E B;  1SYG A;  4DR7 Q;  5M3F H;  4LF7 Q;  5BR8 Q;  4GN5 A;  3E9I A;  1AZQ A;  1HH2 P;  1UNS A;  2OEO A;  1CM9 A;  1LM0 A;  2CQA A;  1K8G A;  1MIU A;  4LFA L;  1LT6 D;  2K33 A;  3N52 A;  1IXR A;  2VB2 X;  1B3Q A;  2NN6 G;  4A3K B;  3KLR A;  1SE2 A;  1VF7 A;  3T1Y L;  1CFM A;  3I4N H;  3KK7 A;  4R4O A;  1G2S A;  2C35 B;  1SNQ A;  2HDL A;  4J15 A;  3CCE A;  1N9W A;  4JW0 A;  4K2K A;  3VDY A;  1FJG L;  4A93 H;  2IJ0 A;  1LTS D;  5JEA J;  3F2B A;  2Q2I A;  4MNO A;  1ESF A;  4K6D A;  3UDG A;  1XX8 A;  1KAA A;  1GUO A;  4UHV A;  1D1K A;  4NKL A;  3AQQ A;  3HKS A;  4HTH A;  1EY5 A;  1SN8 A;  5CMD A;  1KC8 C;  4BWG B;  3MAQ A;  3C2P A;  2EDG A;  5I9O A;  1RDP D;  5GAG C;  2F0P A;  1U0L A;  1FNU A;  2KCN A;  3K7A H;  4R9W A;  4EQ5 A;  1WTX A;  1F2M A;  2DY8 A;  5LMU L;  2ZJP A;  2WB1 E;  3ULJ A;  1SYF A;  2IX1 A;  3W1G A;  4RGN A;  1I6H B;  2K04 A;  1M8A A;  1Q1E A;  3U4Z A;  5IGE A;  2A6H C;  1BBU A;  1I94 L;  2SEB D;  4A3M B;  1EQQ A;  1YEZ A;  3JAM c;  1I4Q A;  4IPG A;  2E75 C;  1PDQ A;  1K8O A;  4H0L C;  1AP0 A;  1YJN A;  3HOU H;  4PZ8 A;  3RZD H;  3I56 A;  3GTG H;  2Z4I A;  3S1Q H;  3I90 A;  4BY7 G;  3FKI B;  5C3E G;  4A3E H;  2RSN A;  3TZD A;  1KQS A;  4HR7 B;  3VA7 A;  1JR0 D;  4DV1 Q;  2C5C A;  1OXX K;  3GV3 A;  2QDL A;  1SRU A;  3CPW A;  4F87 A;  2Q8T A;  3PO2 B;  2HCC A;  1Q8I A;  4JI2 Q;  1LTR D;  1QVG A;  2FIN B;  5AJ3 Q;  1SJE D;  4LF6 Q;  2PW5 A;  3OW7 A;  2O4X A;  1KAW A;  4A3K H;  5FK9 C;  3TME A;  5I6W A;  4A3D H;  1PRT D;  1L1O A;  3VYT A;  2L9H A;  4JCV E;  4QY7 A;  1J8I A;  3CQZ B;  4P72 A;  2EVB A;  2RCF A;  3UE0 A;  1OXT A;  1N32 L;  4LFC Q;  1NCV A;  3SEB A;  4ZRZ A;  3A8K E;  2TMP A;  2AHO B;  3H91 A;  2EJM A;  3EBE A;  2YTX A;  2NZH A;  4RKL A;  2BDO A;  4NMZ A;  1SAP A;  1KTK A;  4LF4 L;  2JSO A;  2Z8L A;  2PZT A;  4UY8 C;  3VYU A;  1X3P A;  3KF6 B;  2LS0 1;  2E5L Q;  4QJF A;  3HOZ G;  3NBH A;  4APV A;  3DWQ A;  2Q8R E;  4X3T A;  5IP7 H;  5C4J B;  1X54 A;  2R7F A;  5IGG A;  4X66 L;  1WD1 A;  1ILQ A;  5DM7 3;  4OO1 I;  1BCP D;  4GN4 B;  1M1K C;  1VQJ A;  2E8G A;  3OYY A;  2JQO A;  1NAP A;  3ITP A;  3DUZ A;  1SNP A;  1I6H H;  1IBK L;  3HOY B;  3T4A C;  5IP9 H;  1XMO Q;  3H0G G;  2BOS A;  4NXN L;  2RDG A;  2XVS A;  4LW1 A;  2NUC A;  1X65 A;  3LX0 A;  1I50 B;  3VR3 A;  3Q23 A;  2UXB Q;  2WP8 J;  1EZ8 A;  4B9X A;  1V1O A;  2N55 A;  4RAU C;  1JT8 A;  2XIW A;  3HKZ E;  4JPB W;  3FKI H;  2CVR A;  5D3D A;  3NUC A;  2D9U A;  4JI4 Q;  5A2Q E;  4CJ0 B;  4C2M B;  3S17 H;  1D6E C;  5KNB A;  4H44 C;  3PO2 H;  1HNZ Q;  1A3T A;  1PTO C;  5CV4 A;  1AW7 A;  1W6K A;  2F0L A;  1B1Z A;  4I7A A;  3VYS A;  3G4S A;  3SHL A;  1HZA A;  5C44 H;  4DR5 Q;  3HOV B;  1BOS A;  1VQI A;  3CQZ H;  4DV4 Q;  1DGS A;  3HGB A;  3AB9 A;  4JI0 Q;  1VQF A;  4ZKB B;  1NJI C;  2KEE A;  1BXT A;  3RNU A;  4BBS B;  4DV6 Q;  4IPD A;  1ESR A;  2F0U A;  4AYB B;  4X65 L;  1XNQ L;  3HOZ B;  1WYD A;  1OXS C;  4HJ9 A;  3TZU A;  1JWU D;  3SGI A;  4B3T Q;  2EYO A;  4RCN A;  5ELB A;  5IYC G;  5IY0 A;  1FGU A;  2OTJ A;  3H6M A;  4DR6 L;  4PMW A;  2DJF C;  4LMQ D;  4RGM A;  5I2Y A;  1LT4 D;  4OIK A;  1OXV A;  1STY A;  3ZJY C;  5C0X G;  1SMY C;  1SEB D;  2DNC A;  2Z6B A;  4O0A A;  4DNT B;  1BO0 A;  2JA6 B;  4OX9 Q;  3R93 A;  2KHJ A;  3L7Z C;  4JV5 L;  1CTM A;  1C4Q A;  3K57 A;  3A5U A;  3HRZ C;  4UDU C;  1MHW C;  1JMC A;  1HZB A;  2KQ3 A;  2ZTD A;  3OTO L;  1E24 A;  1RIP A;  3MFY A;  1I50 H;  1HQM C;  3LGJ A;  4RFB A;  4JYA Q;  3S9W A;  4NXM Q;  2I07 B;  3CD6 A;  2QW7 A;  2WB1 G;  4XT1 B;  2NVQ B;  2EQS A;  4KKT A;  2NVT B;  1XMQ Q;  4IPC A;  1YJW A;  4JI7 Q;  4H7B A;  3IFD A;  4YWL A;  4C2M H;  4A3G B;  4HJ5 A;  1EY9 A;  4XQN A;  1CKO A;  1KLG D;  5M5W H;  4H13 C;  2HQL A;  1WTO A;  2JYO A;  1CQF A;  1Y8P B;  5M5Y B;  3QWN A;  3V05 A;  1DJR D;  5CV5 A;  2AUJ D;  4RCO A;  3C46 A;  4X3K A;  1NR4 A;  3S1R B;  1C0A A;  5C6A A;  2JA9 A;  1HTL D;  4FF2 A;  2HQE A;  4DFA A;  5IYB G;  3H3V H;  3HOV H;  2N3S A;  4ZQ3 A;  3A8I E;  3M4O H;  2QEJ C;  4AQY Q;  4DKA C;  5E4W C;  2LSS A;  2JA8 G;  5EQ0 A;  4YHH Q;  5J39 A;  1UE6 A;  4TQU S;  1IL2 A;  1Y1W G;  4LNQ A;  3CPF A;  2RVL A;  3KF8 A;  1PH9 A;  2E2J B;  4F88 A;  2NB0 A;  2AWN A;  3L9A X;  3D4R A;  1D5Z C;  4A3I G;  2LKV A;  4FVM A;  1HNW L;  2MO0 A;  2F0J A;  4ODG A;  4UP8 A;  1HXY D;  5IYD G;  2F3I A;  3J80 c;  3PO3 B;  4DV5 Q;  2VUM H;  4KY5 A;  2NN6 I;  3E6Z X;  5LHY 1;  2XGT A;  4F8M A;  4IOA A;  2V4D A;  3E9H A;  5H1S E;  5HGT A;  1HR0 L;  1S5B D;  2F4V Q;  4B3R Q;  3KOJ A;  1QNU A;  5FLM G;  5C0X J;  1PZK D; 
#chains in the Genus database with same CATH homology
 2QA4 A;  1ASZ A;  1UE1 A;  2UU9 Q;  2E2H H;  4WJ3 M;  1FVI A;  1TWH H;  1WI5 A;  1PH2 A;  2YYZ A;  2Z0S A;  4UPA A;  1XMQ L;  5J3B A;  4GLA C;  4JI7 L;  2JA6 H;  2JA8 H;  4UP7 A;  4JI5 Q;  4AH6 A;  1W2B A;  5IE8 A;  2VS1 A;  1EUJ A;  1KRS A;  2RHQ B;  1VQC A;  1VQH A;  2PQA B;  3S2H H;  2A19 A;  1J5E Q;  4KLK A;  2GVB A;  3KJP A;  1TWF H;  3CXC A;  2Q2U A;  4A3I H;  1VQK A;  2WAQ G;  3I4N G;  1CUK A;  3PUZ A;  4DV0 L;  4B3S Q;  3GO5 A;  1U5K A;  3G48 A;  4AYB E;  1Q7Y C;  2JA7 H;  1KRT A;  2AKW B;  1X56 A;  3J80 i;  4Y7N H;  1Q86 C;  2UUB Q;  4A3L G;  1TWA H;  1CKM A;  2Y0S G;  5IYD H;  4JC0 A;  5LMN W;  2IX0 A;  4DAY B;  2NVQ H;  4DR4 Q;  2NVT H;  4PZ6 A;  4MZ9 A;  1K83 H;  4AQY L;  2UUC L;  1PH7 A;  4JOI A;  4KHZ A;  2N8N A;  1VQ5 A;  4LFB L;  3GTK H;  2UXD L;  3CCR A;  4JG2 A;  3EN2 A;  4YHH L;  5FLM H;  2ZTC A;  4DUZ L;  2CFM A;  1A63 A;  5JEA G;  2UXB L;  2B63 G;  5C4X G;  2B3G A;  4LFA Q;  3TRZ A;  4FDB A;  1VCI A;  5K36 G;  1I3Q H;  5M5Y H;  1JJ2 A;  3PO3 G;  5GRO A;  1B7Y B;  4DAM A;  1UE5 A;  1IBL Q;  1TWC H;  2IT1 A;  4DUY L;  4X62 Q;  2PNH A;  3S15 H;  3T1Y Q;  3M85 A;  2AWO A;  3TS0 A;  3S1R H;  1GVP A;  1O7I A;  1WJJ A;  1K3R A;  3HOX G;  3G6E A;  4GNX C;  3CP0 A;  2VQF Q;  1KIX A;  3S16 H;  1V1Q A;  3F1Z A;  2MFI A;  3HFZ B;  4DV5 L;  1YHQ A;  2Z6K C;  3HKZ G;  1VQL A;  1WCM G;  1FJG Q;  4KI0 A;  2CCZ A;  2PI2 E;  4A3L H;  2F4V L;  2XTI A;  4B3R L;  4UP9 A;  1P8L A;  4DV7 L;  1PHJ A;  3CAM A;  4OON A;  4XTC S;  1XPO A;  2UU9 L;  4YWK A;  5LMN Q;  4YCW A;  1X6O A;  4IFD G;  1K73 C;  1G6P A;  2ZJQ A;  4A3C H;  1J6Q A;  5M5X H;  1VQ4 A;  4L5T A;  4IO9 A;  4POG A;  2HT1 A;  1VQE A;  1WFQ A;  3K0X A;  4YCV A;  1E3P A;  1E1O A;  4JI5 L;  4K0K Q;  3AEV A;  4DV4 L;  3CW2 C;  2D0O A;  5C4X H;  2B63 H;  2I5M X;  1NTG A;  1X9N A;  4HJ8 A;  1J5E L;  3W5O A;  2MNA A;  3HOW G;  1HNX Q;  1H95 A;  2GN5 A;  3CCM A;  3T1H Q;  3RN5 A;  4KHP Q;  1KHI A;  1HZC A;  4BY7 H;  2OTL A;  1V43 A;  4B3S L;  4BA2 I;  2R93 H;  1S72 A;  1PH5 A;  1L1O B;  5LMU Q;  3NEL A;  2VUM G;  4HIK A;  3J7A 5;  1SRO A;  1NY4 A;  3HOX H;  2YTY A;  3D31 A;  3CCQ A;  3GTJ H;  2UUB L;  4OXP A;  3J7Z C;  1EYG A;  1Y1V G;  1HZ9 A;  2OQ0 A;  4DR7 Q;  5M3F H;  4L5S A;  4LF7 Q;  5BR8 Q;  1L0W A;  4GN5 A;  3E9I A;  4DR4 L;  1Y14 B;  1WCM H;  1OTC A;  4WJ4 A;  4QIW E;  2A8V A;  1PA6 A;  4QGU A;  4NB3 A;  1PFS A;  1HH2 P;  1I94 Q;  2WAQ E;  1G51 A;  1LM0 A;  4GLX A;  2BH8 A;  1K8G A;  2VNU D;  1MIU A;  2ES2 A;  4LFA L;  3GDE A;  4JI6 Q;  3MXN B;  3GTP H;  2HIX A;  1IXR A;  1A0I A;  1YNX A;  3BZK A;  3G71 A;  1IBL L;  3D0F A;  2NN6 G;  4X62 L;  3GTM H;  4P75 A;  1Q12 A;  2ALY B;  3T1Y L;  4OWX B;  3J81 j;  4A3J G;  1L2F A;  3I4N H;  4GOP B;  4R4O A;  1HJP A;  3PUY A;  2OCE A;  2Q2T A;  4DK6 C;  2VQF L;  3GTQ H;  2C35 B;  3CMA A;  3GD7 A;  4J15 A;  3CCE A;  4A3M H;  1N9W A;  2Q2H A;  1N33 Q;  3VDY A;  1FJG L;  3AYH B;  4DV2 Q;  4A93 H;  3EIV A;  3TEH B;  1SFO H;  3A0J A;  2BH2 A;  4RG1 A;  1BBW A;  2I5H A;  1Y1V H;  2JA5 G;  4GKK Q;  5JEA J;  3F2B A;  2GVA A;  2Q2I A;  2ZM6 L;  1VQ9 A;  5LMN L;  4MNO A;  1E1T A;  3KLW A;  2PQA A;  3U50 C;  3UDG A;  2VZA A;  4Y52 H;  1QVC A;  2V1C C;  4JOI C;  1CSQ A;  1YVC A;  3H15 A;  4K0K L;  1A8V A;  3PUX A;  4JI3 Q;  1MJE A;  4GN3 B;  3GTO H;  3AQQ A;  3HKS A;  1KD1 C;  1SN8 A;  3I2Z A;  4IJH A;  1KC8 C;  2ASB A;  1LYL A;  1HNX L;  4AIM A;  5GAG C;  3RLF A;  4A3E G;  4A75 A;  3K8A A;  3T1H L;  1U0L A;  1XNR Q;  2QEX A;  1AE2 A;  3K7A H;  2VQE Q;  4EQ5 A;  4KHP L;  1N32 Q;  1PV4 A;  1PH3 A;  4QQB X;  4A3J H;  1VQG A;  4DV3 Q;  5LMU L;  2ZJP A;  2WB1 E;  4PZ7 A;  3CCV A;  3ULJ A;  2R6G A;  4JBJ A;  4A3B H;  2IX1 A;  3S1N H;  3W1G A;  1X3E A;  3CCS A;  5FLX c;  4DR7 L;  4IFD J;  4LF7 L;  5BR8 L;  3TQY A;  4PG3 A;  1Q1E A;  2EIF A;  3U4Z A;  4YY3 Q;  1BBU A;  3CF5 A;  1I94 L;  4LF4 Q;  1EQQ A;  2JA5 H;  3S1M H;  1YBY A;  4HJ7 A;  4A3K G;  4BXX H;  4GKJ Q;  1YEZ A;  2F52 A;  1XTD A;  4A3D G;  3JAM c;  3STB C;  4IPG A;  4DR2 Q;  3K7U C;  4A3C G;  4DR1 Q;  1E7Z A;  3UDI A;  3I4M G;  1YIT A;  4JI6 L;  1EIY B;  3RN2 A;  3F8T A;  2KEN A;  1YJN A;  3HOU H;  4PZ8 A;  4X66 Q;  1SE8 A;  3BZC A;  3I56 A;  3RZD H;  3A74 A;  4HID A;  3GTG H;  2ZTE A;  2UUA Q;  3S1Q H;  2IHE A;  3WWV A;  1NMG A;  4BY7 G;  3KJO A;  5C3E G;  1D7Q A;  4A76 A;  4A3E H;  1EOV A;  1UEB A;  3BJU A;  3U4V A;  2R93 G;  1KQS A;  1LUZ A;  1E22 A;  1VQD A;  4DV1 Q;  1IBK Q;  1N33 L;  1OXX K;  5M3M G;  4DV2 L;  3NEM A;  1JJG A;  5M3F G;  1SRU A;  3CPW A;  2K50 A;  2QGQ A;  3KFU A;  3CC4 A;  2R7D A;  4NXN Q;  3TS2 A;  4JI2 Q;  2RCN A;  4GKK L;  5C4J H;  1R9T H;  1T9H A;  2KCM A;  1QVG A;  5AJ3 Q;  2FXQ A;  2LXK A;  3PSI A;  4JI1 Q;  1S40 A;  4LF6 Q;  1SR3 A;  2LXJ A;  5IP7 G;  1KAW A;  4A3K H;  3CC2 A;  3DLL A;  1CKN B;  4JI3 L;  3L0O A;  3JAM i;  4A3D H;  4P71 A;  2IHF A;  1C9O A;  3I7F A;  1L1O A;  3I4M H;  2K4K A;  4JI8 Q;  5GAE C;  4JCV E;  3Q8D A;  1I5F A;  4IJL A;  4QY7 A;  5IWA Q;  3HOY H;  3RZO H;  1PYB A;  1N8R C;  3E0E A;  4P72 A;  4BY1 G;  2RF4 A;  1GKH A;  3UE0 A;  1YI2 A;  2VQE L;  1OXT A;  1WOC A;  1YJ9 A;  4LFC Q;  2D0P A;  1UWV A;  4EX5 A;  5C0X I;  2OWO A;  2H5X A;  1VQN A;  5IP9 G;  4LWC A;  1IYJ B;  1Q81 C;  4DPG A;  5C3E H;  4A3M G;  2JK8 A;  2AHO B;  1EIF A;  2K5N A;  4A93 G;  2KBN A;  4R1J A;  5JJI A;  1EFW A;  3M4Q A;  5M3M H;  3EBE A;  2YTX A;  2NZH A;  4LUV A;  4YY3 L;  4R4T A;  3CCU A;  3PIP A;  4R4C A;  2OQK A;  5IYC H;  2YU9 H;  4LF4 L;  4RMF A;  2AMC B;  2BA1 A;  4YWM A;  3S24 A;  1VQP A;  4UY8 C;  1Z47 A;  3H3V I;  4GKJ L;  5E7N A;  3KF6 B;  4DR2 L;  1N36 Q;  2E5L Q;  4QJF A;  4DR1 L;  3HOZ G;  2JE6 I;  2JEB I;  4APV A;  3FKI G;  2VL6 A;  3NEN A;  4X64 Q;  3PIO A;  4GOP A;  4A3F G;  1PH4 A;  5IP7 H;  1X54 A;  2R7F A;  3I55 A;  4X66 L;  2Y0S E;  4OO1 I;  3PUV A;  2UUA L;  3S2D H;  1W3S A;  3K80 C;  1NBW A;  4GN4 B;  1M1K C;  2CQO A;  1VQJ A;  2E8G A;  2JQO A;  3OYY A;  2CWP A;  1Q46 A;  1QUQ B;  4A4I A;  3PO2 G;  2UXC Q;  1VS0 A;  4X65 Q;  4BY1 H;  4IOC A;  3NBH B;  1XNQ Q;  2ID0 A;  1I6H H;  5HY6 A;  3A5Z B;  3TRE A;  3CCJ A;  1IBK L;  4DV1 L;  3J81 i;  3PF5 A;  4A3B G;  5IP9 H;  5ELO A;  1XMO Q;  4MTN A;  4GNX B;  4JBM A;  2N49 A;  5C44 G;  2MQH A;  1GM5 A;  5GQO A;  3H0G G;  4NXN L;  1N34 Q;  4JI2 L;  4P73 A;  1YIJ A;  1B8A A;  3U58 A;  2HHH Q;  4LW1 A;  5AJ3 L;  1XPR A;  4LF6 L;  1X65 A;  4JI1 L;  4DR6 Q;  1A62 A;  4JBK A;  4R4I A;  4BBS H;  3MEF A;  2UXB Q;  2WP8 J;  2DGY A;  3ICE A;  1D8L A;  4ALP A;  3HOZ H;  1JT8 A;  3B6Y A;  3HKZ E;  4A3F H;  3FKI H;  4JI8 L;  4GLV B;  3HOU G;  3PF4 A;  4ME3 A;  5IWA L;  2NVX H;  3F2C A;  2VW9 A;  5ELN A;  3KDF B;  4BBR G;  5JJL A;  4JI4 Q;  4XIG S;  4JV5 Q;  3M9B A;  4LFC L;  3S17 H;  1LTL A;  3OW2 A;  4LF5 Q;  3KF8 B;  4OWT B;  3PO2 H;  5JJK A;  1HNZ Q;  3FP9 A;  1FL0 A;  1RL2 A;  1XNR L;  1MKH A;  1VQM A;  3OTO Q;  2ATW A;  1BVS A;  3UDX A;  1GO3 E;  4POF A;  5IYB H;  1ASY A;  2CWA A;  2R92 G;  1VQ6 A;  2DUD A;  3G4S A;  4B3M Q;  2B29 A;  2UXC L;  1HZA A;  3UDF A;  5C44 H;  4DR5 Q;  4NPS A;  3H0G H;  3FHW A;  3CME A;  1VQO A;  3PGZ A;  5EAY A;  1N36 L;  3BU2 A;  2E5L L;  2JEA I;  1VQI A;  3CQZ H;  1JB7 A;  4X64 L;  4DV4 Q;  1DGS A;  3UE1 A;  4TVA B;  1Y1W H;  1UE7 A;  2YV5 A;  4JI0 Q;  4O2D A;  1VQF A;  1NJI C;  3HOY G;  2I0Q A;  1YZ6 A;  1QZG A;  3RNU A;  4DV6 Q;  4IPD A;  1L1O C;  1P16 A;  3M7N A;  1SMX A;  5GAD C;  3PUW A;  1VQ8 A;  1KL9 A;  2WFW A;  4X65 L;  4BBR H;  4L5R C;  1XNQ L;  1VQA A;  1OXS C;  1WYD A;  3ER0 A;  3ERS X;  1HR0 W;  1X55 A;  1AE3 A;  4HJ9 A;  4IPH A;  1CSP A;  1XMO L;  1IZ6 A;  1EQR A;  3SGI A;  4P74 A;  4B3T Q;  1PYS B;  2K5V A;  4GS3 A;  1N34 L;  3I4O A;  1CKN A;  3RLN A;  3ULP A;  1VQ7 A;  2R92 H;  2HHH L;  5IYC G;  5IY0 A;  1FGU A;  2OTJ A;  2I5L X;  4A3G H;  1PH6 A;  4HIO A;  1Z9F A;  2EXD A;  4DR6 L;  1NE3 A;  4PMW A;  1TWG H;  1KXL A;  2CKZ B;  2YTV A;  1OXV A;  3ULL A;  4LF9 Q;  3ZJY C;  4DNI A;  5C0X G;  2PI2 A;  2K5H A;  2IY5 B;  2NZO A;  4O0A A;  4GOP C;  3K81 C;  4BXX G;  1Q82 C;  2VY3 A;  4LF8 Q;  1JE5 A;  2K14 A;  4OX9 Q;  2K75 A;  2KHJ A;  4JI4 L;  1JJC B;  3L7Z C;  4JV5 L;  2KCT A;  1HNW Q;  3A5U A;  4LF5 L;  2MO1 A;  1JMC A;  1VQB A;  1HNZ L;  1B70 B;  4DK3 C;  1HZB A;  4DV3 L;  3S14 H;  3J81 c;  3HOV G;  1QZH A;  2ZTD A;  2ZJR A;  4H02 A;  3OTO L;  1IBM Q;  1E24 A;  1RIP A;  3KF6 A;  3GTL H;  2KHI A;  4QL5 A;  4DR3 Q;  3L2P A;  1I50 H;  2JJQ A;  3LGJ A;  1HR0 Q;  4B3M L;  4JYA Q;  2ZM6 Q;  4DR5 L;  4NXM Q;  5FJ8 G;  2E2J H;  3STB D;  1YHA A;  4OO1 G;  1K0R A;  3CD6 A;  4BBS G;  2WB1 G;  2EQS A;  1Q8K A;  1SLJ A;  4IPC A;  1XMQ Q;  1XPU A;  1YJW A;  4JI7 Q;  4AYB G;  1QUQ A;  1TXY A;  4YWL A;  2N78 A;  4JI0 L;  4C2M H;  3PO3 H;  1N32 L;  4HJ5 A;  3JC6 6;  1CKO A;  5M5W H;  4X6A H;  4DV6 L;  2HQL A;  4C3J H;  2E2I H;  3CCL A;  4GNX A;  4IFD I;  5DLQ E;  3AFQ A;  2Z6K A;  3W1B A;  4DV0 Q;  2BA0 A;  2HIV A;  1NMF A;  3RR5 A;  2R7Z G;  1C7Y A;  3PV0 A;  3CC7 A;  5GAH C;  1C0A A;  1YHB A;  4B3T L;  2JA9 A;  5IYB G;  3M3Y H;  1GD7 A;  3H3V H;  3HOV H;  2N3S A;  3M4P A;  2D62 A;  1OXU A;  3M4O H;  1Q1B A;  4AQY Q;  4DKA C;  2UUC Q;  1K9M C;  1PVO A;  4LFB Q;  1M90 C;  2UXD Q;  2LSS A;  2JA8 G;  1BKB A;  2JA6 G;  4YHH Q;  4L5Q A;  5FJ8 H;  3KDF A;  1UE6 A;  4HIM A;  4DUZ Q;  4TQU S;  4LF9 L;  1IL2 A;  2RHS B;  3IRB A;  4R4Q A;  1Y1W G;  4LNQ A;  3CPF A;  1AH9 A;  5HGQ A;  1S3O A;  1PH9 A;  4BA1 I;  4C3H H;  3F2D A;  3RLO A;  3AFP A;  5IT9 c;  1MJC A;  2AWN A;  4LF8 L;  4OX9 L;  4DUY Q;  2PMZ E;  2A1A A;  4A3I G;  3HOW H;  4JBW A;  1V9P A;  4LUZ A;  4YCU A;  1HNW L;  3DM3 A;  2MO0 A;  2JA7 G;  4HJA A;  1EWI A;  4UP8 A;  5IYD G;  1XJV A;  4LUO A;  2F3I A;  3J80 c;  4DV5 Q;  1K8A C;  2VUM H;  2L15 A;  2NVY H;  1G29 1;  1X3F A;  2NN6 I;  1IBM L;  4IOA A;  2XGT A;  2K52 A;  3E9H A;  5H1S E;  4DR3 L;  1QVF A;  1X3G A;  4C3I H;  1HR0 L;  2R7Z H;  3PCO B;  1PH1 A;  1PH8 A;  4JYA L;  2F4V Q;  4B3R Q;  3KYH C;  3KOJ A;  4NXM L;  4DV7 Q;  5FLM G;  5C0X J;  4A3G G;  4OWW B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...