4L5SA

P202 hin1 in complex with 12-mer dsdna
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
199
structure length
199
Chain Sequence
STPKKNISKGAVLHEKPMTVMVLTATEPFNYKEGKENMFHATVATESKYYRVKVFNMDLKEKFTENQFITISKYFNSSGILEINETATVSEAAPNQMFEVPKNIIRSAKETLKISKIKELDSGTLIYGVFAVEKKKVNDKSITFKIKDNEDNIKVVWDKEQHNINYEKGDKLQLFSFHLRKGNGKPILHSGNHSFIKGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Interferon-activable protein 202
publication title Molecular Mechanism for p202-Mediated Specific Inhibition of AIM2 Inflammasome Activation.
pubmed doi rcsb
source organism Mus musculus
molecule tags Dna binding protein/dna
total genus 36
structure length 199
sequence length 199
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02760 HIN HIN-200/IF120x domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4l5sA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4l5sA01
4JI6L 3AFQA 1OXVA 2Q2UA 1XMOL 4A3LH 4JI1L 3RNUA 2V1CC 3GTKH 2WAQE 4AIMA 4A3GH 4QQBX 2VQFL 4DAYB 3FP9A 3RR5A 1IBML 2VQEQ 1L1OA 3RLOA 1VQ5A 3CMAA 1K8GA 2ZM6L 2PQAA 4DR3L 4LF9L 2B63G 3F2CA 5IYCH 1XNQL 3H0GG 3TS2A 5C4XH 1SE8A 1X65A 1YHAA 1YIJA 2UUAL 1B8AA 3F8TA 3UDIA 3M7NA 1C9OA 3I2ZA 2AWNA 4DR1Q 2JQOA 2YTXA 4A3JG 3VDYA 1PVOA 1PA6A 3CP0A 1NJIC 1YEZA 1QVGA 5IP9H 3ERSX 4A3DH 4IOCA 3HFZB 5IY0A 2A1AA 2UU9L 2GVBA 1NTGA 2KCTA 2N8NA 1A63A 4LFAL 4PMWA 5C44H 5M5WH 5FLXc 3L7ZC 4IO9A 1E7ZA 4GN5A 1KD1C 5LMNW 5M3MH 2E2HH 3K0XA 3J80c 3U4VA 3W5OA 1PH6A 3CPWA 3NELA 3UDXA 4A3IG 2JA6G 1PH9A 1M1KC 2R92G 3H3VI 1Q1BA 2GVAA 2ZTEA 3S15H 2I0QA 4LUVA 3G6EA 3PF5A 2QGQA 2YYZA 1PYBA 4AH6A 2DUDA 5H1SE 1O7IA 2A8VA 1PH4A 5LMUQ 5JJIA 4DK3C 4A4IA 3G71A 3K7UC 1W3SA 4GKKQ 1PH1A 4JBKA 4HIMA 2XGTA 1IZ6A 5IYDG 5C3EH 4P73A 1X3FA 2PI2E 4L5TA 3OW2A 3I4NG 3J7A5 2OQ0A 3E9IA 1N34Q 3KLWA 3M3YH 5DLQE 4JBWA 3J81c 2JK8A 4HJ9A 3OTOQ 4OX9L 2R93H 1S3OA 1HNWL 1VQ6A 4YCUA 1V1QA 4UP9A 1JB7A 2IT1A 2Y0SG 1T9HA 4AYBG 5LMNQ 2JA9A 4OWWB 4XIGS 1R9TH 4LWCA 5C0XG 3HOXH 3TQYA 3AYHB 5IT9c 3RLNA 5LMUL 2LXKA 3FKIH 1YJNA 3PUWA 1EQRA 3W1BA 2XTIA 1SR3A 4BBRG 1AE3A 2MFIA 1S72A 4JYAQ 1MIUA 1WCMH 1FVIA 4GNXB 3CCSA 4BA1I 3UE1A 1LUZA 4DV3L 2JA5G 3HOVH 4A3KG 4A93G 5IWAL 2KBNA 4DR2L 1Q86C 1PH3A 1SRUA 1K9MC 2K50A 2Q2HA 4DK6C 4A3LG 4YY3Q 4LF5L 2CFMA 4A3GG 4IPGA 3OTOL 4GOPB 2E5LL 4JI3Q 4DUYL 4LF8L 2JA8H 1CSPA 4X64L 3GTGH 3GTMH 1X9NA 4JV5Q 1IBLQ 4J15A 1I5FA 5M3FH 1B70B 5LMNL 1UWVA 4UP7A 4DV1L 4DR5Q 2HHHQ 4A3FH 4LF4Q 1XTDA 5IYCG 3RLFA 5HGQA 1N32L 1EFWA 1EYGA 2EXDA 1ASZA 2Q2TA 3I4MH 1VQNA 4GKJQ 4XTCS 1J6QA 1TWGH 5FJ8H 4X65Q 3PIOA 1L2FA 2MO0A 1HR0L 5ELOA 4JI8L 3I4OA 1KQSA 2LSSA 3K81C 3SGIA 4JYAL 1KXLA 4C2MH 5IP9G 1K3RA 1C7YA 1ASYA 4IPCA 4IFDJ 2OTJA 4PZ6A 2CWAA 1J5EL 1YITA 3J81j 3T1HQ 2KHIA 1I3QH 2ID0A 5JJKA 1S40A 3F2BA 1EQQA 1OXTA 5IP7H 3KF8B 1X3EA 1JE5A 1X54A 3PF4A 1PHJA 3CQZH 4JOIA 1MKHA 1TXYA 1CUKA 3CC7A 4LF6L 3CCQA 1E1TA 2VS1A 1OXUA 3E0EA 4R1JA 3KOJA 3PUXA 1IBLL 2VUMG 5GROA 1Z47A 5FLMG 4DR5L 1CSQA 1AE2A 2K14A 2R7FA 3UE0A 5AJ3Q 2NZOA 1CKNA 2OQKA 1WI5A 4B3ML 1L1OC 2IHFA 3PO2G 3CCMA 3RZDH 4DUZQ 4DV0L 2YTVA 3TREA 1IYJB 1LTLA 2R7ZG 3HOUH 3EN2A 4K0KQ 1KC8C 3HKZE 3CD6A 3S14H 4BBSH 1Q82C 1XPUA 1VQMA 1N36Q 2JA7H 2K5VA 2ES2A 1HZ9A 4DPGA 2E2JH 3CCVA 1BKBA 1G6PA 4BXXG 1WFQA 3BZKA 5C0XI 1OTCA 4JI4Q 3M85A 4LFBQ 3S17H 4B3SL 3BZCA 4JI5L 4DAMA 1K8AC 2H5XA 1FGUA 4GLVB 2D0PA 3CC2A 4BY1G 4FDBA 5M5XH 1PH8A 2A19A 3HOWG 1Q46A 4DV7Q 3CCUA 4H02A 1CKMA 3PUZA 1SFOH 1HNXQ 1VQLA 2HQLA 2I5HA 3FHWA 1WJJA 5BR8Q 3I56A 2VL6A 3M4QA 3KDFA 4LFCL 3CMEA 2I5MX 4GLAC 3KJPA 4DUZL 4HJ5A 4JI0L 1OXXK 2NVXH 4R4IA 3Q8DA 1G291 2PQAB 3ER0A 4JI7Q 3K8AA 2UUCL 4ALPA 2HT1A 2AKWB 4DNIA 1N36L 2WAQG 2NN6I 2JJQA 1YNXA 1VS0A 3JAMc 1YHQA 3PO3H 2IHEA 4QY7A 1YJ9A 3CCEA 4P75A 4JI4L 1VQDA 4BY7G 1SN8A 3G4SA 4B3TQ 2JEBI 4LFBL 4AQYQ 4DV5Q 1WOCA 2D62A 4GN4B 4YCVA 3H3VH 1GD7A 2K5NA 2IX0A 4TQUS 4UPAA 2R7DA 2WB1E 5HY6A 2VQEL 1PH5A 1I6HH 1JJCB 4OONA 5C4JH 4PZ8A 4APVA 2CQOA 4DV7L 4A3FG 1QVFA 2BA1A 5IYBH 1HNXL 1UE5A 4DR1L 3PCOB 2UUBQ 1VQFA 5BR8L 2B3GA 1XJVA 4POFA 3K7AH 3T1YQ 1VQ9A 2AHOB 4DV6Q 4X62Q 3AQQA 2HIXA 1Y14B 2JE6I 1A0IA 4QIWE 2LXJA 1VQKA 1YVCA 2F3IA 2ALYB 3HOZG 4A3MG 4L5SA 3IRBA 2MQHA 2UXBQ 4JC0A 4JI2Q 3KJOA 5IP7G 2ATWA 2B29A 3CAMA 4AQYL 3D31A 1L0WA 1MJCA 1V9PA 4A3CG 3GTOH 3NBHB 1HZCA 3PUVA 3CCLA 1VQBA 4EQ5A 4X66Q 4Y7NH 3BJUA 1W2BA 4KHPQ 3ULLA 4DR7Q 1I94Q 2UXCQ 1Y1WG 4GKKL 2UUBL 4LW1A 3W1GA 3T1YL 3S1RH 4A3EG 4NXNQ 3HOUG 4WJ3M 1UE7A 3MEFA 1IL2A 2CCZA 1E3PA 1NBWA 1N34L 3PSIA 2C35B 1UE6A 3GTJH 3U58A 3GTPH 1FJGQ 2CKZB 2K4KA 5GQOA 4IJHA 4DV4Q 1OXSC 2B63H 3CPFA 1EIYB 3S2DH 4HJ8A 3H0GH 2UXBL 1C0AA 4R4QA 1JMCA 5M5YH 3BU2A 1Q81C 1VQAA 4RMFA 1VQPA 2NN6G 1NMFA 2GN5A 4QGUA 2HIVA 4OXPA 1E22A 4DR4Q 5C4XG 2Q2IA 5ELNA 2R6GA 4BA2I 4IFDG 3KF6A 4C3IH 4JOIC 4JCVE 4DR7L 3G48A 1XPOA 1EOVA 1EUJA 1GO3E 1QUQA 1FL0A 4A3IH 2JA6H 4C3HH 1KRSA 2EIFA 5C44G 1TWHH 1TWCH 2VW9A 4IJLA 5M3MG 3TRZA 3RZOH 4GLXA 2N3SA 1PYSB 3JC66 2UXDQ 2N49A 4YY3L 1NY4A 4LF7Q 5GADC 4JI3L 3UDGA 3EBEA 2WP8J 4L5QA 4MTNA 3ULPA 1XNRQ 4JV5L 2ASBA 2VY3A 1P8LA 3J7ZC 1H95A 3AFPA 4LF4L 2HHHL 5IYDH 1EIFA 3A0JA 4ME3A 3CCRA 1D7QA 5IE8A 1VCIA 1IXRA 4YWLA 4DR4L 4OO1G 2RHSB 4POGA 4JI6Q 1P16A 4GKJL 1AH9A 1X55A 4NXMQ 4X65L 1XMOQ 2CWPA 4JI1Q 5C3EG 1NMGA 4YWMA 3PV0A 2RF4A 2OTLA 2VQFQ 1X3GA 1Z9FA 2YV5A 1E1OA 1IBMQ 4RG1A 2F4VQ 3T1HL 4NB3A 2ZM6Q 1PH7A 1VQ8A 1JJ2A 4LF9Q 1U5KA 4QL5A 2R93G 3HKSA 2UXDL 5JEAJ 1QVCA 1YZ6A 4C3JH 1GM5A 3S1QH 1QZHA 3PUYA 1K0RA 3TS0A 2KCMA 4IPHA 2BH2A 4LNQA 1KAWA 3HOXG 1HH2P 5J3BA 4UY8C 1HZBA 3PGZA 2MNAA 2JA5H 4A93H 3FKIG 3E9HA 5AJ3L 3ULJA 4A76A 4A3KH 4LFAQ 3EIVA 3STBC 3HKZG 2ZJRA 1K73C 4K0KL 1WCMG 1VQEA 1L1OB 3DM3A 5EAYA 3STBD 3UDFA 4NXML 4EX5A 4PG3A 3HOVG 4MZ9A 1BBUA 4R4CA 3OYYA 3KFUA 3HOYH 1Y1VH 2F4VL 2JEAI 1E24A 3F2DA 1TWAH 4OWTB 4P74A 3J81i 4JBMA 3KDFB 2JA8G 4IFDI 1JT8A 2I5LX 2Z6KA 1PFSA 4IPDA 2QA4A 1HNZQ 1VQGA 5M3FG 4DR6Q 4Y52H 1JJGA 4IOAA 3M4PA 3S16H 3PIPA 2NZHA 4R4TA 3CCJA 1VQOA 3I4MG 1UEBA 1VQHA 3K80C 4X6AH 4UP8A 5FJ8G 1IBKQ 3MXNB 5GAGC 2PMZE 2K75A 2BH8A 1GVPA 2RCNA 4OX9Q 1U0LA 2FXQA 4JI7L 1HNWQ 4O2DA 1KIXA 2NVQH 1YI2A 4HIKA 4TVAB 3S2HH 1HR0W 2VUMH 2Y0SE 3U50C 5FLMH 4B3TL 4AYBE 2WB1G 4OO1I 1VQIA 4DV5L 2N78A 4L5RC 2OCEA 3S24A 3PO2H 3F1ZA 4GNXC 3KYHC 1HNZL 4A3BH 5E7NA 2R7ZH 1I50H 1TWFH 1X56A 3A74A 3A5UA 4DV3Q 4A75A 1YJWA 2IX1A 4DR6L 4NPSA 2VNUD 1CKOA 1Q8KA 3L0OA 5IWAQ 4DR2Q 3GD7A 2QEXA 1A62A 1HJPA 3DLLA 3WWVA 2ZTDA 4A3DG 4GOPC 4BXXH 5JJLA 1IBKL 4DV6L 2E8GA 3GO5A 3I7FA 4X62L 1XPRA 4LF5Q 2EQSA 3AEVA 2E5LQ 4LF8Q 4BBSG 4DUYQ 2BA0A 2JA7G 4KHZA 4X64Q 3CC4A 5GAHC 4GNXA 4BY1H 1VQJA 4DV1Q 1VQCA 2DGYA 3HOWH 2L15A 4JI2L 2YTYA 1Q12A 4HJAA 4HIOA 1SMXA 2WFWA 1RIPA 4LUOA 3M4OH 1A8VA 1N32Q 1K83H 4PZ7A 4KLKA 3I55A 4A3JH 4GOPA 1WYDA 4B3RQ 1KL9A 5C0XJ 1HR0Q 4JI8Q 1PV4A 2MO1A 1G51A 4DV2Q 2AWOA 4X66L 2YU9H 4KHPL 4YCWA 1X6OA 1PH2A 1J5EQ 1I94L 4WJ4A 1NE3A 2VZAA 2UXCL 1EWIA 4JBJA 3L2PA 3CXCA 1N33Q 2E2IH 1KHIA 3GTQH 2NVTH 4NXNL 2R92H 4BY7H 4DKAC 4JG2A 4GS3A 4O0AA 2PI2A 4LF6Q 2AMCB 3HOYG 3GTLH 1Y1VG 5GAEC 2OWOA 1FJGL 3PO3G 3KF6B 3A5ZB 4DV4L 1SLJA 3B6YA 1B7YB 2K5HA 2K52A 4B3MQ 2IY5B 1DGSA 2F52A 3NEMA 1QUQB 3D0FA 4DV0Q 1M90C 4B3RL 1XMQQ 4LUZA 4YHHQ 2RHQB 3CF5A 4QJFA 1MJEA 5IYBG 4DV2L 3I4NH 3U4ZA 3RN5A 4R4OA 1LYLA 3S1NH 3CW2C 2KENA 2ZTCA 4MNOA 2ZJPA 3RN2A 3HOZH 4A3MH 3ZJYC 3GDEA 3H15A 1LM0A 3NENA 4GN3B 1N33L 4B3SQ 1QZGA 5K36G 5JEAG 4JI5Q 3M9BA 2NVYH 1N9WA 4DR3Q 1KRTA 4YWKA 2ZJQA 1CKNB 1XNQQ 4A3CH 1VQ7A 3LGJA 3J80i 2UUAQ 4P71A 3JAMi 4LF7L 1VQ4A 1N8RC 1GKHA 1Q1EA 1UE1A 1YBYA 2KHJA 4KI0A 1XNRL 3TEHB 4BBRH 1YHBA 1HZAA 1V43A 1BBWA 1Y1WH 1D8LA 4LFCQ 4P72A 1BVSA 4A3BG 4JI0Q 2PNHA 2UU9Q 4HJ7A 4A3EH 1XMQL 1Q7YC 4YHHL 2D0OA 3S1MH 4HIDA 1RL2A 2UUCQ 4OWXB 2Z6KC 1SROA 2Z0SA 3ICEA
chains in the Genus database with same CATH superfamily
1OXVA 1TVXA 5M5WB 3RNUA 4CHTB 2A69C 2VQFL 2PZWA 4DAYB 3EJIA 2NVQB 2K33A 2PQAA 2ZM6L 4L6TB 5IYCH 1XNQL 3S2HB 3H0GG 3AU7A 1YHAA 3OIQA 5CORA 3F8TA 3GQBA 1Y8PB 1YIJA 2CH4W 3I2ZA 4RCOA 5G3LD 3KBXA 4RFBA 1PA6A 1RTOA 5I9OA 3CP0A 1NJIC 1YEZA 5IP9H 4QF4A 1A63A 1ET9A 3H6MA 5C44H 5M3MH 2E2HH 2D9UA 3W5OA 4A3IG 3R8BA 3H3VI 1FGBD 2GVAA 2A6HD 2FHTA 4ME5A 1PYBA 2E74C 4BY1B 2A8VA 1Y69U 5LL6S 1Y8OB 5LMUQ 3DEOA 4IQZA 1E0BA 3SK8A 3G71A 4KY7A 2VXWA 1PLFA 4DNRB 2N55A 4L5TA 3OW2A 4XYQA 3J7A5 5CGKA 3NWSA 5FOBB 5LL6X 3HGBA 3IAYA 2ZXPA 4JBWA 4NW2A 3J81c 1TKWB 3W2DA 4OX9L 2R93H 4E6IA 1EWCA 5T1IA 5IGGA 4ZQ3A 4UP9A 5ELEA 4AYBG 5LMNQ 4LWCA 2B39A 1ILPA 1SYDA 3D6WA 1ZXTA 1SR3A 5IGEA 4BBRG 2MFIA 4NMZA 4BA1I 3UI2A 3HOVH 4NP5A 2NUCA 5IWAL 4K2LA 1BQQT 3A56A 1SRUA 1K9MC 1DYQA 2A68D 4DFAA 3BG3A 2CFMA 1DJRD 4GOPB 2E5LL 4DUYL 2B2VA 5M3FH 1UWVA 5IYCG 3AMUA 2EXDA 3R3OA 4F8MA 4G57A 2HDMA 3PIOA 1ILQA 5ELOA 5IP9G 4IFDJ 4A3EB 1J5EL 2TMPA 2WKCA 3J81j 1BCPF 4LJZC 5IP7H 1X3EA 5KYLA 1X54A 2M00A 3E3XA 3PF4A 1PHJA 4ZCKA 4LF6L 2VS1A 1H9SB 4QUCA 3KOJA 3T16A 5GROA 1Z47A 5FLMG 2MUYA 2R7FA 1TY2A 1CKNA 2RSNA 3PO2G 3RZDH 2QEJC 2Q8TA 4Z9CB 3EN2A 2RA4A 4KJNA 4BBSH 5D3IB 1Q82C 1XPUA 2K5VA 3R2TA 1GUTA 4JI4Q 4B3SL 3BZCA 4RCNA 4DAMA 3CC2A 2Q8RE 1STBA 4XT1B 1KLUD 5IT9E 1I6VC 2I5HA 1WJJA 3I56A 3MC0B 4G4KA 3KJPA 4DUZL 1HFNA 4R4IA 4ALPA 1SMYD 1PTOC 2JJQA 5KIXA 2SNSA 3VYRA 4B3TQ 2JEBI 4AQYQ 1WOCA 4GN4B 4YCVA 5CYUA 4TQUS 2R7DA 1I6HH 5C4JH 2NB0A 1RKNA 4APVA 1A15A 3CRLC 1UE5A 5JJZA 1XJVA 4DV6Q 1JC7A 1E2ZA 4X62Q 4H0LC 2IW3A 1Y14B 3HOZG 2VB3X 4A3MG 2MQHA 1DM0B 1HRJA 4JI2Q 5IP7G 2RDHA 1SJHD 4CDDC 5M5YB 3GTMB 4A3CG 4KHPQ 1IL8A 1LT5D 4X3UA 4DR7Q 1BCPD 2F1MA 3I3CA 3SE0A 5A35A 3T1YL 3KLRA 4NDXA 3W1GA 1W6JA 1N34L 5HURA 1UE6A 1EYCA 1D1KA 3GTJH 3GTPH 4R8IA 4XXEA 2K4KA 3J81L 5GQOA 4ILWA 2B63H 1OXSC 4ZK9B 1I3QB 2UXBL 3J7YW 2IL8A 1Q81C 1KAAA 2WB1B 1VQPA 1SE4A 3DWQA 1ZKOA 2NN6G 1EY7A 1NMFA 4QGUA 1E22A 1TU2B 2Q2IA 3N6RA 1WTVA 4BA2I 3KF6A 4OGQC 4C3IH 3IFDA 2F03A 1EEFD 2MHVA 4IUPA 1CTMA 4YIJA 1EOVA 2B2YA 3NTKA 3PIP3 1EUJA 4DU9A 4RGMA 1YNJD 2VW9A 4DN4M 1D5ZC 3J80E 1PYSB 4YY3L 1HCZA 2NWGA 4MTNA 3KF8A 1P8LA 2L12A 4LF4L 1EQVA 1HXYD 2HHHL 4FVMA 3J7AV 1VCIA 4F88A 4OO1G 1JOQA 2EVBA 1D1IA 5EBDA 1BF4A 2CWPA 5C3EG 2V4DA 3SDZA 3SK5A 2VQFQ 1X3GA 2YV5A 2EJFC 2F4VQ 1HPCA 3T1HL 4NB3A 2ZM6Q 4JPBW 1QVCA 1YZ6A 1GM5A 3S1QH 1MBYA 3NUCA 1QZHA 3TN2A 3PUYA 4FF3A 1CQFA 1STNA 3SHLA 3RMHA 2BH2A 1K8OA 2F0VA 3BDOA 4FF4A 4UAIA 3TDQA 3M4YA 3FKIG 4A76A 5AJ3L 4A3KH 3EIVA 3HKZG 1F2MA 2J4XA 1K73C 4PG3A 1IYUA 4N9TA 2A73B 2OXPA 4QMGA 2NBFA 2A69D 3OYYA 1R4PB 4EVOA 2JEAI 1DOMA 4OWTB 4JBMA 2JA8G 2HUGA 1B3AA 1HA5A 2PYKA 3NTIA 4Y52H 2IWHA 3M4PA 1HA6A 2NZHA 4HCSA 4KV6A 3K0YA 3I4MG 4C3IG 2O5JC 1CK1A 4OX9Q 4DNTB 3S1RB 1FD7D 4O2DA 2NVQH 2K7VA 2M9VA 4TVAB 3S2HH 3A7LA 3WOEA 4H44C 4RGOS 4AYBE 3S2DB 5JVH3 4TRDA 4OO1I 3CRKC 3MXUA 4L5RC 5DM73 3QOLA 1SNOA 3F1ZA 2KVMA 4GNXC 1QE6A 1JWMD 3Q22A 2LFNA 5E7NA 1X56A 3A5UA 1ENFA 1CKOA 3P7JA 5IWAQ 3NBHA 1A62A 1U4RA 1PRTF 4K8IA 1EZ6A 2ZTDA 4S3SA 3DLLA 4BXXH 5JJLA 1IBKL 4HEDA 3SEBA 1QWYA 3AEVA 2E5LQ 4HR7B 4DUYQ 2JA7G 3GTQB 4PMBA 3BVMA 4C3HB 3CC4A 2R92B 4BY1H 1Z6HA 2PO4A 2CHBD 2L15A 3AB9A 1GUGA 1EY0A 2EZVA 2B2WA 4A3JH 4GOPA 4B3RQ 1KL9A 1H9RA 1PV4A 4OIKA 1J5EQ 1FNUA 1QB5D 1ESFA 2UXCL 1BCPB 2PMZB 3L2PA 2B2TC 4NXNL 3HOZB 4DKAC 4O0AA 2WV6D 2PI2A 4LF6Q 5I6WA 2OWOA 2Y0SB 1FYCA 3A5ZB 2M2LA 1X3QA 1K3BC 2DJFC 1GUWA 1WD0A 2K52A 3KUPA 1D5XC 5LHY1 2IY5B 1HTPA 1M90C 3FPPA 2L1BA 4YHHQ 3CF5A 2CW0C 1H9SA 5IYBG 3I4NH 1A3VA 1EOTA 2JA5B 4A93B 2X69A 5IOCA 5EPJA 4B3SQ 1QZGA 1LTID 1K0SA 4A3GB 3E6ZX 5DNFA 1KRTA 1CKNB 1ET6A 5C0XH 3QR8A 1VQ7A 3J80i 3JAMi 2EOTA 1GKHA 1Q1EA 1YBYA 4OEMB 5D14A 2K6AA 2F0HA 4EQPA 1U4MA 4P72A 2NTTA 2UU9Q 4A3EH 1Q7YC 4MN3A 3AFQA 2BDOA 1WTWA 2V1CC 3T56B 4AIMA 2ENBA 4MHEA 1HHVA 3RR5A 1L1OA 2FINB 2L9HA 1H9MA 3RLOA 1VQ5A 1KDBA 2F0SA 3F2CA 3TBIB 2UUAL 1X65A 3ERQA 2QKIC 4KN7C 3T53B 3UDIA 1PRTD 2K05A 2JQOA 2YTXA 2A5HA 4A3JG 2EYFA 1PVOA 2EE1A 2K32A 1QVGA 2K01A 1NTGA 4PMWA 4IO9A 1E7ZA 1KD1C 3M7GA 2RVLA 5LMNW 2KCNA 3J80c 3UDXA 1PTOD 2JA6G 1Q1BA 1K28A 2I0QA 2YYZA 5H1SE 1O7IA 4ULLA 3HOWB 5EKKA 2I07B 3A8IE 1B4OA 1W3SA 1PH1A 1IZ6A 3I4NG 3KK7A 1N34Q 3E9IA 5KNCA 5C6AA 1S4ZA 2JK8A 4ZAIA 3OTOQ 4IUVA 3DXJC 4YCUA 1V1QA 4V0BA 5IIFA 2RBMA 2JA9A 5C0XG 3GTLB 3TQYA 1O78A 4C3JG 2JXMB 1KNEA 1F2YA 2LXKA 5I2XA 3PUWA 3W1BA 4IUUA 1DOKA 1HQMC 4JYAQ 4DV3L 1LUZA 2C5CA 4BS9A 1PH3A 1STHA 5CV7A 1JOKA 4Q0FA 3S1NB 2L0CA 1SDFA 4IN3A 4YY3Q 4LF5L 4IPGA 3CHBD 1HUNA 3GTMH 1X9NA 1IBLQ 2ICIA 2NVYB 4J15A 4DV1L 1B70B 3I91A 3W3AA 4LF4Q 2HHHQ 4A3FH 1AZPA 1STGA 4FF2A 4G7HC 1N32L 3ND9A 1VQNA 1V1OA 5ELDA 2XSCA 4RWSC 1L2FA 2MO0A 4C1NI 1XXGA 2OTJA 1K3RA 1C7YA 1QNUA 1YITA 3C3LA 3S1MB 4QB4A 1D2BA 3T1HQ 1A2UA 1I3QH 1PZID 2ID0A 2KHIA 3L3OC 2E2JB 3KF8B 2HD3A 1JE5A 5I9PA 3CQZH 4JOIA 1MKHA 3CC7A 1CUKA 4R1JA 3PUXA 4IUTA 4DR5L 3UE0A 5AJ3Q 2Z8LA 2NZOA 2OQKA 5C4XB 3ITPA 2IHFA 1GHJA 1I4GA 4A3DH 2F0TA 1IYJB 1LTLA 3T13A 3HOUH 2R7ZG 2C9OA 3HKZE 1C4QA 4K5XA 1HZ9A 4DPGA 2ES2A 5KNDA 3CCVA 1BKBA 1GXDC 1WFQA 1OTCA 5C0XI 1RDPD 1MI2A 2F0WA 5DM63 1O7YA 1K8AC 4FXDA 2H5XA 2D0PA 5J22A 3S15B 5D65A 4FDBA 4QCLA 1PH8A 1Q46A 4H02A 1CKMA 3PUZA 5CBAE 1SYGA 1AZQA 3K5MA 5BR8Q 1EIHA 2F4IA 1EEID 3Q8DA 3K7AB 3ER0A 3NQTA 2UUCL 1N36L 2L5TA 2WAQG 1G2SA 3M3YB 1PFBA 2EJMA 3A54A 2D2CC 4UDUC 4Q5VA 4ZYSA 1VQDA 4BY7G 3G4SA 4LFBL 1LO5D 1JORA 2K5NA 2IX0A 2VQEL 1JJCB 1SYCA 4OONA 4U68A 2CQOA 4DV7L 4A3FG 1QVFA 1PZJD 2BA1A 3HOXB 1QNKA 1HNXL 2EDGA 1HQRD 1PRTB 1STYA 2KEEA 2UUBQ 4JW0A 3H09A 1VQFA 2Z6BA 1PFMA 3AQQA 4CJ0B 1WCMB 1R4QB 1K8MA 2EXZA 1EY8A 2JE6I 1A0IA 1VQKA 1YVCA 2F3IA 1V8QA 4ZKCB 3J80L 3U9SA 2ATWA 2X6GA 4DA2A 5EPLA 1V9PA 3NBHB 1HZCA 5E4WC 1L0XB 4JVZA 2UXCQ 1Y1WG 4GKKL 4LW1A 3S1RH 3HOUG 4NXNQ 1UE7A 1IL2A 1E3PA 1XWEA 4C2MB 1BDOA 3PSIA 1M8AA 2C35B 3U58A 3FVQA 3VYTA 2CKZB 3S2DH 3VR5A 4DGZA 3CPFA 1EIYB 4HJ8A 2TSSA 4R4QA 4CJ1B 4IURA 3BU2A 2FMCA 1G8ZD 1VQAA 1CQVA 2LY7A 2QCPX 4DR4Q 3EFXD 3DWPA 1XPOA 1GO3E 4C3HH 5C44G 1TWCH 1VMPA 4WFN3 5M3MG 3TRZA 3MVVA 3RZOH 3P1HA 5CR3A 3JC66 4P2CB 4XQNA 4JI3L 3S17B 2WP8J 2IPKD 3ULPA 4JV5L 4XT3B 1LLRD 1DOLA 5IYDH 4ME3A 3CCRA 5IE8A 1IXRA 2RDFA 1CZGA 4POGA 2CW0D 3T51B 1P16A 4LAAA 1X55A 4X65L 3DEPA 1CZWA 3DHQA 3MZ5A 1NMGA 4YWMA 1NR2A 2B2UA 2NVXB 3EVQA 4RG1A 2F0LA 1SNPA 3T4AC 4EGVA 3HOYB 3PO3B 2R93G 3H91A 2UXDL 1VDZA 3URYA 5CV6A 2KCMA 5CV5A 1MSGA 1EQTA 1HZBA 3FDTA 1S5ED 3PGZA 2JA5H 4A93H 3ULJA 1KLGD 2XWBB 2CQAA 1TQOA 4K0KL 3UDFA 1VQEA 1L1OB 3STBD 4NXML 4EX5A 1LTSD 2F0EA 3HOVG 2JSOA 1SSOA 1Y1VH 4I7AA 3P75A 1NSNS 3KDFB 2KQ3A 5C3XA 2RSOA 2Z6KA 1LV9A 2R3ZA 5BN4A 2QA4A 4K5VA 1VQGA 5M3FG 3V05A 2XIWA 5E1FA 3S16H 5CV4A 2K5DA 3HS0C 4BWGB 1ENAA 1UEBA 2X6LA 2EJGC 1RD9D 3MXNB 5GAGC 1WTOA 2RCNA 1DD2A 5JEAH 4IZ8A 3TZDA 1U0LA 1KABA 2FXQA 4JI7L 1KIXA 1YI2A 4HIKA 2MPMA 2H4OA 3Q23A 2VUMH 3OSOA 4X3TA 3U50C 4KKUA 1SNDA 3H0GB 2MJ8A 1QG7A 3TP8A 3BDCA 1HNZL 4A3BH 3A74A 3EQLC 4DR6L 4DV3Q 2VNUD 3L0OA 3GD7A 2EYJA 2F3VA 4GOPC 4CDFC 2D5DA 4DXGA 5KGUA 2ZT9C 2E8GA 4LF5Q 1XPRA 3VR3A 4BBSG 2J7ZA 4A3IB 4KHZA 2NTSA 2XVSA 1TWHB 2Z4IA 4DV1Q 1VQCA 3HOWH 4HIOA 1N32Q 1A8VA 1B9MA 2G9DA 4L8JA 4HTHA 1WYDA 5KRUA 1IW7C 4DV2Q 4YCWA 1TIID 1X6OA 1MHWC 5JAVA 4V190 2F0KA 2OF1A 3CXCA 2E2IH 3BVGA 5I2YA 3NP8A 2NVTH 4XQJA 2FMMA 3GTLH 1Y1VG 2PPBC 3JAME 1FJGL 4AYBB 1L0YB 3C1FA 1QUQB 1DXMA 1XMQQ 4LUZA 4BBRB 1Y1WB 1MJEA 3RN5A 3VR2A 3S1NH 4DF7A 2ZJPA 2ZTCA 5JOBA 5FO8B 1STEA 4KY6A 4NKLA 3NENA 1N33L 1RF2D 5JEAG 5EBCA 3M9BA 4KD3A 1MD2D 2NVYH 1XNQQ 4KKTA 4P71A 2DNEA 4KI0A 2E76C 2WACA 4K6LA 3OWFA 1XNRL 4FP5D 1V43A 1BVSA 4A3BG 4MTKA 4HJ7A 1SYEA 5JPNC 3S1MH 4HIDA 1RL2A 2UUCQ 3ICEA 3OHXC 1VF5C 2Q2UA 4A3LH 1T5EA 4QQBX 2WAQE 2E2DC 4M1UB 4FXGC 4WJWA 3FP9A 2VQEQ 3CMAA 1K8GA 4LF9L 3I70A 4DR3L 3QJYA 4F7XA 2B63G 5C4XH 3M7NA 3DM1A 3LX0A 1B8AA 1SEBD 5C3WA 1JCKB 3X3NA 2LMCB 3PO2B 2K04A 1LTAD 2LKVA 3ERSX 3D4WA 3SK6A 4IOCA 3HFZB 1I50B 2A1AA 2F0FA 2F0PA 5IY0A 4LFAL 5M5WH 4GN5A 4K8JA 3K0XA 4KMUC 3HG9A 1ONLA 4FYDA 1J8IA 2EYMA 2FFKB 1M1KC 2A6HC 2ZTEA 3S15H 1RTNA 3G6EA 3PF5A 2Z1CA 1SJED 2QGQA 2K28A 5CV9A 1WD1A 1DCZA 2DUDA 2CH4A 3NQIA 5KNBA 4B08A 1PH4A 3N52A 1G2TA 5L37A 1K83B 4JBKA 4GKKQ 3BDLA 5CV8A 4HIMA 1B1ZA 3MA2B 2XGTA 3FPUB 4P73A 1X3FA 2SDFA 3MAQA 3KLWA 3M3YH 4LK1C 2P5ZX 3K5NA 3I8ZA 1BOSA 4GZYC 1KNAA 2F0QA 5TSSA 1ML0D 1S3OA 4OHJA 1VQ6A 3MFYA 2HDLA 1T9HA 5A2QE 4OWWB 5ELBA 3QG1A 3HOXH 1BO0A 1PTOF 5IT9c 5M3FB 2F3WA 3RLNA 5LMUL 1EQRA 2XTIA 1CM9A 1AE3A 1F77A 2ZXOA 1S72A 1MIUA 1WCMH 1FVIA 3CCSA 3UE1A 3VYUA 4A3KG 4DR2L 2Q2HA 2FJ2A 1V1PA 4A3LG 5KYIA 4A3MB 4JI3Q 3I4LA 4X64L 4JV5Q 1B3QA 2DY8A 1I5FA 2MGSA 4WORA 5LMNL 4UP7A 1X32A 3RLFA 3TP5A 4HCEA 4KJOA 1RCVD 2EY6A 1EYGA 2JN4A 1F9RA 2IX3A 5FJ8H 4X65Q 2RDGA 1LTRD 1HR0L 1EFID 4JI8L 2O4XA 1KQSA 3K81C 3SGIA 3P20A 4C2MH 1ASYA 4IPCA 4PZ6A 2CWAA 1SE2A 3Q0AA 4OL7A 1S40A 1I4RA 3F2BA 1X3PA 3GTKB 1AW7A 1A3TA 1TXYA 2MP1A 5I6YA 1OXUA 3E0EA 1NR4A 1CSQA 1AE2A 1Z7TA 5EPKA 3CU7A 4ID6A 4DUZQ 4DV0L 4K0KQ 3TREA 5DEHA 2K5WA 3CD6A 1RODA 1Q3LA 5FKAC 2HQEA 4BXXG 1D6EC 1WVLA 2B8GA 3S17H 4L63B 1F2ZA 4JI5L 3CKIB 4GLVB 1B44D 1H9KA 2NZ1D 4BY1G 4U673 2A19A 3CCUA 1VQLA 5C4JB 4IFDH 4H7BA 3C46A 3FHWA 1T5XD 2ICEC 3KDFA 4LFCL 3CMEA 4GLAC 4HJ5A 4JI0L 2PZTA 1CFMA 2NVXH 1TT2A 1G291 5C3EB 2EYPA 4JI7Q 3K8AA 2WIIB 5J39A 4IUQA 2HT1A 1CI3M 2EPBA 1YNXA 1B9NA 4XQQA 3JAMc 1YHQA 2IHEA 1SBBB 5CC4A 3PO3H 4JI4L 3MXNA 5ISRA 4OIJA 2D62A 5IGFA 3H3VH 1GD7A 1YNNC 5HY6A 1AP0A 2G9HD 4PZ8A 1R9TB 3LNNA 4DR1L 3FKIB 2B3GA 3T1YQ 1RHPA 2AHOB 4HSPA 3HKZB 1C8CA 1PFNA 1ESRA 2DY7A 4QIWE 2RKSA 2LXJA 2F0IA 2ALYB 1SNCA 4L5SA 3IRBA 1EU3A 2UXBQ 4JC0A 3KJOA 2EY5A 4AQYL 3D31A 4KHVA 2JA8B 3MWYW 3TMEA 3GTGB 3PUVA 2QW7A 1VQBA 4EQ5A 3BJUA 2HCIA 3ULLA 2B2VC 4ZRZA 3I4MB 4C3IB 1TWGB 4A3EG 3MEFA 5C5LA 1NBWA 1EY4A 3I90A 1FJGQ 4IJHA 3H0GH 5IODA 1JMCA 5M5YH 1B50A 1EL0A 4OXPA 1IYVA 1BR9A 2OT2A 4G7OC 5IT9L 4IFDG 3A55A 1NNXA 4DR7L 2EYLA 3K6OA 2BCOA 1DZ1A 1QUQA 1FL0A 1YNJC 1I4PA 4A3IH 2EIFA 4HN7A 1TWHH 3S14B 5FLXE 2JA7B 3D4RA 1LTTD 2XRQD 4CDEC 5GADC 2B2UC 4ODGA 1SYFA 3EBEA 1XNRQ 1ICFB 3S1QB 2ASBA 2QILA 2B2TA 5M5XB 3D3RA 3TSSA 1SFOB 2RHSB 5EGTA 1JOOA 1E2VA 4CKEA 4GKJL 1AH9A 1CA5A 3KLSA 2RF4A 2OTLA 4ZUIA 1Z9FA 1E1OA 2SEBD 2EYHA 2AQ2B 5C4HA 1ICWA 1ZYRC 4LF9Q 4CGYB 1JJ2A 1U5KA 1EU4A 1SYBA 3OOCA 5DAUA 1VF7A 2KCCA 5HGTA 4C56C 1K0RA 3TS0A 4IPHA 1EIGA 2F0DA 2Z4HA 1HH2P 5J3BA 4UY8C 3MEHA 2PW5A 4LFAQ 3IL8A 4J8QA 4IUNA 2ZJRA 3DWAA 3DM3A 3BS1A 3MXPA 4HMJA 1XX8A 1UNSA 4K14A 1IKMA 2I46A 4R4CA 5C5MA 4DAPA 1EYDA 2F4VL 4K6DA 4PV1C 3F2DA 4UHVA 4P74A 3J81i 2F0MA 4IFDI 1KTKA 2BE5C 3V2TA 4HSVA 4IOAA 2RQXA 3GTOB 3PIPA 3LWUA 4Y7NB 1VQHA 3K80C 3WOFA 4X6AH 1IBKQ 3X3MA 1GVPA 3D4DA 4X3SA 5EQ0A 4RHRA 3O13A 1GJXA 1FNWA 4KTAA 1U4PA 3JAML 5FLMH 1PTOB 2WB1G 1SXTA 4CJ2C 4X3KA 4O42A 4DV5L 2OCEA 3PO2H 4RGNA 3KYHC 4A3JB 1I50H 1YJWA 4A75A 2IX1A 2GA4B 4NPSA 3FEWX 5K36H 4DR2Q 2QEXA 1HJPA 4K5WA 3WWVA 4A3DG 1GUOA 2R61A 3VYSA 3I7FA 2EQSA 3GP7A 2BA0A 4J6HA 1BBXC 4X64Q 2JA6B 2PQEA 5GAHC 4H13C 3OWEB 2B2YC 2KOLA 1Q12A 4HJAA 2WFWA 1RIPA 1K83H 1CHQD 4PZ7A 4KLKA 3I55A 2WKDA 3NPPA 5C0XJ 1HFGA 1HR0Q 4JI8Q 2KA7A 1G51A 2MO1A 2O2LD 4X66L 1V1PB 1NUCA 2Q8IB 1I94L 3R2IA 1NE3A 3I4NB 3L9AX 5F2DA 4JBJA 1KHIA 1LACA 3GTQH 2R92H 1DONA 4JG2A 4GS3A 2AMCB 4DK1A 5GAEC 4PMCA 2L4NA 1UAPA 5D3DA 4DV4L 1SLJA 1B7YB 4C3JB 1LTGD 1DGSA 1EY9A 4DV0Q 4B3RL 2RHQB 3U4ZA 4R4OA 3CW2C 2KENA 4MNOA 1AEXA 1S5FD 3RN2A 3HOZH 4A3MH 2XN9C 3GDEA 3PQIA 3ZJYC 4GN3B 3H15A 5I4DA 2F0OA 4JI5Q 3I72A 3V96A 3FRPB 1PXUA 1EWHA 3LWEA 2F0UA 2ZJQA 4A3CH 5EKLA 3TP6A 3SK4A 1SE3A 2UUAQ 4LF7L 1TWAB 1PZKD 2BOSA 3TEHB 3NXWA 1HZAA 1BBWA 4LFCQ 3K59A 1GHKA 3SVMA 2JP1A 4JI0Q 4DK0A 2PNHA 3BZDB 1J9OA 4YHHL 1A3UA 4XYOA 3HEJA 2EY2A 5K36G 1VQJA 3R93A 2KECA 4JI6L 3ONAB 1XMOL 4JI1L 3GTKH 4A3GH 5ELFA 1IBML 2NN6H 3IFTA 5BN3A 5A2QL 3TS2A 1PRTC 3DMUA 1SE8A 1C9OA 4DR1Q 2AWNA 3E5SA 3VDYA 3NHHA 4I7ZC 5AFWA 1F9SA 2R7ZB 1TWFB 2UU9L 2GVBA 2KCTA 2N8NA 4JK1C 3U9OA 2O5IC 5FLXc 3L7ZC 4LNQA 1TS3A 3U4VA 2KHSA 3QB3A 1PH6A 3CPWA 3NELA 1PH9A 4C3HG 2R92G 4M8AA 4LUVA 4N9PA 3RUZA 4AH6A 3G7LA 1W6KA 4RHSA 3IKJA 5EJWA 1UEAB 1YNND 5JJIA 1AFPA 2DNCA 4DK3C 4LMQD 4A4IA 3M4OB 4OO1H 3K7UC 3VA5A 5FO7B 5IYDG 5C3EH 2F0NA 2PI2E 1ZEQX 1OO9B 2YU9B 2A6EC 2B2WC 2OQ0A 3I73A 5E3FA 2HCCA 1PYWD 5DLQE 2WAQB 4HJ9A 1JWSD 3NSWA 3GV6A 1HNWL 4BY7B 1JB7A 2IT1A 2Y0SG 4EQOA 1BNZA 3K5LA 4XIGS 1R9TH 3AYHB 1YJNA 3FKIH 4TSSA 4A3FB 2AQ3B 3KBGA 1F9PA 4EQNA 4GNXB 2JA5G 4A93G 1TR5A 2EY1A 2KBNA 1Q86C 3OIPA 2H1EA 1A2TA 3HRZC 2K50A 5EKIA 4DK6C 4A3GG 3K58A 3S9WA 4RH6A 3OTOL 4LF8L 2JA8H 1B2TA 1CSPA 3GTGH 2PW7A 2QDLA 4HMIA 1QCBD 2KJXA 5M9OA 2JYOA 3CQZB 4DR5Q 1XTDA 5FO9B 5HGQA 4RAUC 3BYYB 1EFWA 1ASZA 2Q2TA 3I4MH 4R9WA 4GKJQ 3HP3A 4XTCS 1J6QA 2OEOA 1TWGH 5T1GA 3I4OA 4N8X1 4JYAL 2LSSA 1KXLA 4A3DB 1CHPD 3HOUB 4XDXA 3GV3A 4FNFA 4TKOB 5JJKA 4KN4C 1EQQA 1OXTA 3H3VC 1C48A 2K1BA 4CBVA 1IHZA 4RKLA 5C4ZA 3CCQA 1E1TA 3QIAA 2XNAC 4I65A 1IBLL 1TS5A 2VUMG 2L55A 2K14A 4B3ML 1WI5A 4B9XA 1L1OC 3C1EA 3CCMA 2YTVA 1JQYD 3D8GA 1KC8C 3SR1A 1M4VA 3S14H 2JA7H 1VQMA 1N36Q 1EYAA 2K5QA 2E2JH 3E0JA 1NCVA 1G6PA 5C44B 3BZKA 3ND8A 5M3MB 2KUMA 3M85A 2E2HB 4LFBQ 1ZYRD 4C1NK 1TS4A 1FGUA 5IGBA 1FNVA 3VR6A 3OMGA 5M5XH 3HOWG 4DV7Q 4DAYA 1F9QA 1Q8IA 3K5OA 1SFOH 1HNXQ 2HQLA 1WTPA 3OW7A 4OELB 2KEDA 2VL6A 3M4QA 2I5MX 2RCFA 1OXXK 1B53A 2PQAB 5BN5A 2AKWB 2A74C 5NUCA 4DNIA 3PIO3 2NN6I 1U9RA 1VS0A 1YJ9A 4QY7A 3CCEA 4P75A 1IKLA 1SN8A 1S5CD 4DV5Q 3BVZA 2R93B 1A6XA 4UPAA 2WB1E 1PH5A 1TS2A 1G6ZA 2BE5D 4PNYA 5IYBH 3PCOB 4HAEA 1GUNA 5BR8L 1O80A 2BDNA 3K7AH 3NBIA 4POFA 1VQ9A 5KEEA 2QF7A 4F87A 3OPOA 2HIXA 3HOVB 1Q90A 3NWTA 5FLXL 1STAA 1WTQA 2B29A 3CAMA 1JR0D 1L0WA 1MJCA 5E4XA 3FMCA 3GTOH 3CCLA 4X66Q 4Y7NH 1W2BA 3NK9A 1KDCA 3WDNA 4DAVA 1I94Q 1KDAA 2UUBL 3BYTB 1G91A 4WJ3M 1EZ8A 1F2LA 1I4XA 2A68C 2CCZA 2CVRA 1TWCB 1PTOH 4IALA 4DV4Q 1C0AA 1XTCD 2XRSD 5K5PA 3TZUA 3RZOB 3C2PA 4K2KA 4R8NA 4B9WA 2QDBA 1ENCA 2VB2X 4RMFA 4FF1A 2GN5A 2HIVA 1XYIA 2PZUA 3QO2A 5C4XG 1GOZA 2R6GA 4RGTA 1RJTA 5ELNA 4JOIC 4JCVE 3G48A 1LABA 1CT1D 3RZDB 1QILA 5COYA 2JA6H 3G6JB 1LT4D 1KRSA 4QIWB 3A8KE 4BBSB 4IJLA 4O1NA 3TP7A 2N88A 4GLXA 1JE4A 4FO2A 2N3SA 2F0GA 3KLSX 4KKSA 2N49A 2UXDQ 1QOHA 1NY4A 3VR4A 3UDGA 4LF7Q 4WRDA 4L5QA 3Q6SA 1SNQA 4G7ZC 2VY3A 3J7ZC 1H95A 1MGSA 3AFPA 2F0JA 1EIFA 3A0JA 1D7QA 4YWLA 4DR4L 1AN8A 5CMDA 3HZXA 1MSHA 4JI6Q 4FXKC 4NXMQ 3QOJA 2PNRC 1XMOQ 2DN8A 4JI1Q 1HUMA 3PV0A 4ABNA 3QWNA 3EA6A 1IBMQ 1PH7A 3J81E 1VQ8A 3MTSA 2NYZD 1Y1VB 4QL5A 3HKSA 5JVG3 5JEAJ 4C3JH 1SNMA 1VMCA 1KAWA 3HOXG 1I6HB 1LT6D 2DJGC 2MNAA 2AUJD 3E9HA 3DUZA 3S16B 1EY5A 3PMFA 2WINB 2Z9HA 3VA7A 3A8JE 3STBC 2PCFB 1WCMG 5EAYA 4CKCA 3F2UA 4MZ9A 1SMYC 2SOBA 1BBUA 3KFUA 3HOYH 5CBEE 3MHBA 1E24A 1TWAH 3EROA 3J7AF 1JT8A 2VUMB 4KD4A 2I5LX 4CDCC 1PFSA 4IPDA 1HNZQ 1UUPA 4DR6Q 1JJGA 1H9JA 1CA6A 4A3BB 4R4TA 3CCJA 1VQOA 2L11A 1NAPA 1HTLD 4UP8A 5FJ8G 2K75A 2PMZE 2BH8A 2IJ0A 2SNMA 1HNWQ 3D6CA 3NE5B 1EY6A 3SXHA 4DXFA 3GTJB 1SAPA 3GTPB 1HR0W 2Y0SE 3Q24A 2B8FA 2J0TD 4B3TL 2B63B 1QJOA 1E2WA 1U4LA 1I4QA 1JB3A 1VQIA 2N78A 3S24A 3ZYYX 2EYOA 1TWFH 2R7ZH 1O7LA 1BCPC 1TY0A 1Q8KA 2A6ED 5G3LF 4KK7A 4DV6L 3GO5A 1JICA 1PDQA 5FK9C 4X62L 1WTHA 4LF8Q 2E2IB 2NVTB 3H94A 4MIUA 4GNXA 2DGYA 4CKBA 1FR3A 5IGCA 4JI2L 1WTXA 2YTYA 3MFGA 3M4OH 1SMXA 4LUOA 1JWUD 1BUVT 3NTHA 1GUSA 1II3A 2AQ1B 2AWOA 2YU9H 4KHPL 4ZLTF 4J1MA 1IW7D 2E75C 1PH2A 4WJ4A 1BXTA 1PMRA 1EWIA 2VZAA 1D5MC 1N33Q 1LT3D 5ELCA 4BY7H 3OMCA 4ZUJA 4N8FA 5J1ZA 3HOYG 3RD4A 2K03A 3PO3G 3KF6B 5JPMC 3B6YA 4PQXA 2K5HA 1LTBD 1WTRA 4B3MQ 3A7AB 3NEMA 2F52A 3D0FA 2LS01 4QJFA 1I4HA 4DV2L 1LYLA 4KY5A 4A3KB 4RKBA 3MXGA 1LM0A 2ZXRA 2XWJB 5IGDA 1O7ZA 2AUKA 1N9WA 4DR3Q 1Y8NB 4YWKA 3LGJA 4ZKBB 2G5DA 1VQ4A 1N8RC 2KHJA 1UE1A 4BBRH 1YHBA 1S5BD 1Y1WH 3K57A 1D8LA 4QUFA 1S5DD 4RA8A 1XMQL 2D0OA 4OWXB 2Z6KC 1SROA 2Z0SA
chains in the Genus database with same CATH topology
4JI6L 3AFQA 1OXVA 2Q2UA 1XMOL 4A3LH 4JI1L 3RNUA 2V1CC 3GTKH 2WAQE 4AIMA 4A3GH 4QQBX 2VQFL 4DAYB 3FP9A 3RR5A 1IBML 2VQEQ 1L1OA 3RLOA 1VQ5A 3CMAA 1K8GA 2ZM6L 2PQAA 4DR3L 4LF9L 2B63G 3F2CA 5IYCH 1XNQL 3H0GG 3TS2A 5C4XH 1SE8A 1X65A 1YHAA 1YIJA 2UUAL 1B8AA 3F8TA 3UDIA 3M7NA 1C9OA 3I2ZA 2AWNA 4DR1Q 2JQOA 2YTXA 4A3JG 3VDYA 1PVOA 1PA6A 3CP0A 1NJIC 1YEZA 1QVGA 5IP9H 3ERSX 4A3DH 4IOCA 3HFZB 5IY0A 2A1AA 2UU9L 2GVBA 1NTGA 2KCTA 2N8NA 1A63A 4LFAL 4PMWA 5C44H 5M5WH 5FLXc 3L7ZC 4IO9A 1E7ZA 4GN5A 1KD1C 5LMNW 5M3MH 2E2HH 3K0XA 3J80c 3U4VA 3W5OA 1PH6A 3CPWA 3NELA 3UDXA 4A3IG 2JA6G 1PH9A 1M1KC 2R92G 3H3VI 1Q1BA 2GVAA 2ZTEA 3S15H 2I0QA 4LUVA 3G6EA 3PF5A 2QGQA 2YYZA 1PYBA 4AH6A 2DUDA 5H1SE 1O7IA 2A8VA 1PH4A 5LMUQ 5JJIA 4DK3C 4A4IA 3G71A 3K7UC 1W3SA 4GKKQ 1PH1A 4JBKA 4HIMA 2XGTA 1IZ6A 5IYDG 5C3EH 4P73A 1X3FA 2PI2E 4L5TA 3OW2A 3I4NG 3J7A5 2OQ0A 3E9IA 1N34Q 3KLWA 3M3YH 5DLQE 4JBWA 3J81c 2JK8A 4HJ9A 3OTOQ 4OX9L 2R93H 1S3OA 1HNWL 1VQ6A 4YCUA 1V1QA 4UP9A 1JB7A 2IT1A 2Y0SG 1T9HA 4AYBG 5LMNQ 2JA9A 4OWWB 4XIGS 1R9TH 4LWCA 5C0XG 3HOXH 3TQYA 3AYHB 5IT9c 3RLNA 5LMUL 2LXKA 3FKIH 1YJNA 3PUWA 1EQRA 3W1BA 2XTIA 1SR3A 4BBRG 1AE3A 2MFIA 1S72A 4JYAQ 1MIUA 1WCMH 1FVIA 4GNXB 3CCSA 4BA1I 3UE1A 1LUZA 4DV3L 2JA5G 3HOVH 4A3KG 4A93G 5IWAL 2KBNA 4DR2L 1Q86C 1PH3A 1SRUA 1K9MC 2K50A 2Q2HA 4DK6C 4A3LG 4YY3Q 4LF5L 2CFMA 4A3GG 4IPGA 3OTOL 4GOPB 2E5LL 4JI3Q 4DUYL 4LF8L 2JA8H 1CSPA 4X64L 3GTGH 3GTMH 1X9NA 4JV5Q 1IBLQ 4J15A 1I5FA 5M3FH 1B70B 5LMNL 1UWVA 4UP7A 4DV1L 4DR5Q 2HHHQ 4A3FH 4LF4Q 1XTDA 5IYCG 3RLFA 5HGQA 1N32L 1EFWA 1EYGA 2EXDA 1ASZA 2Q2TA 3I4MH 1VQNA 4GKJQ 4XTCS 1J6QA 1TWGH 5FJ8H 4X65Q 3PIOA 1L2FA 2MO0A 1HR0L 5ELOA 4JI8L 3I4OA 1KQSA 2LSSA 3K81C 3SGIA 4JYAL 1KXLA 4C2MH 5IP9G 1K3RA 1C7YA 1ASYA 4IPCA 4IFDJ 2OTJA 4PZ6A 2CWAA 1J5EL 1YITA 3J81j 3T1HQ 2KHIA 1I3QH 2ID0A 5JJKA 1S40A 3F2BA 1EQQA 1OXTA 5IP7H 3KF8B 1X3EA 1JE5A 1X54A 3PF4A 1PHJA 3CQZH 4JOIA 1MKHA 1TXYA 1CUKA 3CC7A 4LF6L 3CCQA 1E1TA 2VS1A 1OXUA 3E0EA 4R1JA 3KOJA 3PUXA 1IBLL 2VUMG 5GROA 1Z47A 5FLMG 4DR5L 1CSQA 1AE2A 2K14A 2R7FA 3UE0A 5AJ3Q 2NZOA 1CKNA 2OQKA 1WI5A 4B3ML 1L1OC 2IHFA 3PO2G 3CCMA 3RZDH 4DUZQ 4DV0L 2YTVA 3TREA 1IYJB 1LTLA 2R7ZG 3HOUH 3EN2A 4K0KQ 1KC8C 3HKZE 3CD6A 3S14H 4BBSH 1Q82C 1XPUA 1VQMA 1N36Q 2JA7H 2K5VA 2ES2A 1HZ9A 4DPGA 2E2JH 3CCVA 1BKBA 1G6PA 4BXXG 1WFQA 3BZKA 5C0XI 1OTCA 4JI4Q 3M85A 4LFBQ 3S17H 4B3SL 3BZCA 4JI5L 4DAMA 1K8AC 2H5XA 1FGUA 4GLVB 2D0PA 3CC2A 4BY1G 4FDBA 5M5XH 1PH8A 2A19A 3HOWG 1Q46A 4DV7Q 3CCUA 4H02A 1CKMA 3PUZA 1SFOH 1HNXQ 1VQLA 2HQLA 2I5HA 3FHWA 1WJJA 5BR8Q 3I56A 2VL6A 3M4QA 3KDFA 4LFCL 3CMEA 2I5MX 4GLAC 3KJPA 4DUZL 4HJ5A 4JI0L 1OXXK 2NVXH 4R4IA 3Q8DA 1G291 2PQAB 3ER0A 4JI7Q 3K8AA 2UUCL 4ALPA 2HT1A 2AKWB 4DNIA 1N36L 2WAQG 2NN6I 2JJQA 1YNXA 1VS0A 3JAMc 1YHQA 3PO3H 2IHEA 4QY7A 1YJ9A 3CCEA 4P75A 4JI4L 1VQDA 4BY7G 1SN8A 3G4SA 4B3TQ 2JEBI 4LFBL 4AQYQ 4DV5Q 1WOCA 2D62A 4GN4B 4YCVA 3H3VH 1GD7A 2K5NA 2IX0A 4TQUS 4UPAA 2R7DA 2WB1E 5HY6A 2VQEL 1PH5A 1I6HH 1JJCB 4OONA 5C4JH 4PZ8A 4APVA 2CQOA 4DV7L 4A3FG 1QVFA 2BA1A 5IYBH 1HNXL 1UE5A 4DR1L 3PCOB 2UUBQ 1VQFA 5BR8L 2B3GA 1XJVA 4POFA 3K7AH 3T1YQ 1VQ9A 2AHOB 4DV6Q 4X62Q 3AQQA 2HIXA 1Y14B 2JE6I 1A0IA 4QIWE 2LXJA 1VQKA 1YVCA 2F3IA 2ALYB 3HOZG 4A3MG 4L5SA 3IRBA 2MQHA 2UXBQ 4JC0A 4JI2Q 3KJOA 5IP7G 2ATWA 2B29A 3CAMA 4AQYL 3D31A 1L0WA 1MJCA 1V9PA 4A3CG 3GTOH 3NBHB 1HZCA 3PUVA 3CCLA 1VQBA 4EQ5A 4X66Q 4Y7NH 3BJUA 1W2BA 4KHPQ 3ULLA 4DR7Q 1I94Q 2UXCQ 1Y1WG 4GKKL 2UUBL 4LW1A 3W1GA 3T1YL 3S1RH 4A3EG 4NXNQ 3HOUG 4WJ3M 1UE7A 3MEFA 1IL2A 2CCZA 1E3PA 1NBWA 1N34L 3PSIA 2C35B 1UE6A 3GTJH 3U58A 3GTPH 1FJGQ 2CKZB 2K4KA 5GQOA 4IJHA 4DV4Q 1OXSC 2B63H 3CPFA 1EIYB 3S2DH 4HJ8A 3H0GH 2UXBL 1C0AA 4R4QA 1JMCA 5M5YH 3BU2A 1Q81C 1VQAA 4RMFA 1VQPA 2NN6G 1NMFA 2GN5A 4QGUA 2HIVA 4OXPA 1E22A 4DR4Q 5C4XG 2Q2IA 5ELNA 2R6GA 4BA2I 4IFDG 3KF6A 4C3IH 4JOIC 4JCVE 4DR7L 3G48A 1XPOA 1EOVA 1EUJA 1GO3E 1QUQA 1FL0A 4A3IH 2JA6H 4C3HH 1KRSA 2EIFA 5C44G 1TWHH 1TWCH 2VW9A 4IJLA 5M3MG 3TRZA 3RZOH 4GLXA 2N3SA 1PYSB 3JC66 2UXDQ 2N49A 4YY3L 1NY4A 4LF7Q 5GADC 4JI3L 3UDGA 3EBEA 2WP8J 4L5QA 4MTNA 3ULPA 1XNRQ 4JV5L 2ASBA 2VY3A 1P8LA 3J7ZC 1H95A 3AFPA 4LF4L 2HHHL 5IYDH 1EIFA 3A0JA 4ME3A 3CCRA 1D7QA 5IE8A 1VCIA 1IXRA 4YWLA 4DR4L 4OO1G 2RHSB 4POGA 4JI6Q 1P16A 4GKJL 1AH9A 1X55A 4NXMQ 4X65L 1XMOQ 2CWPA 4JI1Q 5C3EG 1NMGA 4YWMA 3PV0A 2RF4A 2OTLA 2VQFQ 1X3GA 1Z9FA 2YV5A 1E1OA 1IBMQ 4RG1A 2F4VQ 3T1HL 4NB3A 2ZM6Q 1PH7A 1VQ8A 1JJ2A 4LF9Q 1U5KA 4QL5A 2R93G 3HKSA 2UXDL 5JEAJ 1QVCA 1YZ6A 4C3JH 1GM5A 3S1QH 1QZHA 3PUYA 1K0RA 3TS0A 2KCMA 4IPHA 2BH2A 4LNQA 1KAWA 3HOXG 1HH2P 5J3BA 4UY8C 1HZBA 3PGZA 2MNAA 2JA5H 4A93H 3FKIG 3E9HA 5AJ3L 3ULJA 4A76A 4A3KH 4LFAQ 3EIVA 3STBC 3HKZG 2ZJRA 1K73C 4K0KL 1WCMG 1VQEA 1L1OB 3DM3A 5EAYA 3STBD 3UDFA 4NXML 4EX5A 4PG3A 3HOVG 4MZ9A 1BBUA 4R4CA 3OYYA 3KFUA 3HOYH 1Y1VH 2F4VL 2JEAI 1E24A 3F2DA 1TWAH 4OWTB 4P74A 3J81i 4JBMA 3KDFB 2JA8G 4IFDI 1JT8A 2I5LX 2Z6KA 1PFSA 4IPDA 2QA4A 1HNZQ 1VQGA 5M3FG 4DR6Q 4Y52H 1JJGA 4IOAA 3M4PA 3S16H 3PIPA 2NZHA 4R4TA 3CCJA 1VQOA 3I4MG 1UEBA 1VQHA 3K80C 4X6AH 4UP8A 5FJ8G 1IBKQ 3MXNB 5GAGC 2PMZE 2K75A 2BH8A 1GVPA 2RCNA 4OX9Q 1U0LA 2FXQA 4JI7L 1HNWQ 4O2DA 1KIXA 2NVQH 1YI2A 4HIKA 4TVAB 3S2HH 1HR0W 2VUMH 2Y0SE 3U50C 5FLMH 4B3TL 4AYBE 2WB1G 4OO1I 1VQIA 4DV5L 2N78A 4L5RC 2OCEA 3S24A 3PO2H 3F1ZA 4GNXC 3KYHC 1HNZL 4A3BH 5E7NA 2R7ZH 1I50H 1TWFH 1X56A 3A74A 3A5UA 4DV3Q 4A75A 1YJWA 2IX1A 4DR6L 4NPSA 2VNUD 1CKOA 1Q8KA 3L0OA 5IWAQ 4DR2Q 3GD7A 2QEXA 1A62A 1HJPA 3DLLA 3WWVA 2ZTDA 4A3DG 4GOPC 4BXXH 5JJLA 1IBKL 4DV6L 2E8GA 3GO5A 3I7FA 4X62L 1XPRA 4LF5Q 2EQSA 3AEVA 2E5LQ 4LF8Q 4BBSG 4DUYQ 2BA0A 2JA7G 4KHZA 4X64Q 3CC4A 5GAHC 4GNXA 4BY1H 1VQJA 4DV1Q 1VQCA 2DGYA 3HOWH 2L15A 4JI2L 2YTYA 1Q12A 4HJAA 4HIOA 1SMXA 2WFWA 1RIPA 4LUOA 3M4OH 1A8VA 1N32Q 1K83H 4PZ7A 4KLKA 3I55A 4A3JH 4GOPA 1WYDA 4B3RQ 1KL9A 5C0XJ 1HR0Q 4JI8Q 1PV4A 2MO1A 1G51A 4DV2Q 2AWOA 4X66L 2YU9H 4KHPL 4YCWA 1X6OA 1PH2A 1J5EQ 1I94L 4WJ4A 1NE3A 2VZAA 2UXCL 1EWIA 4JBJA 3L2PA 3CXCA 1N33Q 2E2IH 1KHIA 3GTQH 2NVTH 4NXNL 2R92H 4BY7H 4DKAC 4JG2A 4GS3A 4O0AA 2PI2A 4LF6Q 2AMCB 3HOYG 3GTLH 1Y1VG 5GAEC 2OWOA 1FJGL 3PO3G 3KF6B 3A5ZB 4DV4L 1SLJA 3B6YA 1B7YB 2K5HA 2K52A 4B3MQ 2IY5B 1DGSA 2F52A 3NEMA 1QUQB 3D0FA 4DV0Q 1M90C 4B3RL 1XMQQ 4LUZA 4YHHQ 2RHQB 3CF5A 4QJFA 1MJEA 5IYBG 4DV2L 3I4NH 3U4ZA 3RN5A 4R4OA 1LYLA 3S1NH 3CW2C 2KENA 2ZTCA 4MNOA 2ZJPA 3RN2A 3HOZH 4A3MH 3ZJYC 3GDEA 3H15A 1LM0A 3NENA 4GN3B 1N33L 4B3SQ 1QZGA 5K36G 5JEAG 4JI5Q 3M9BA 2NVYH 1N9WA 4DR3Q 1KRTA 4YWKA 2ZJQA 1CKNB 1XNQQ 4A3CH 1VQ7A 3LGJA 3J80i 2UUAQ 4P71A 3JAMi 4LF7L 1VQ4A 1N8RC 1GKHA 1Q1EA 1UE1A 1YBYA 2KHJA 4KI0A 1XNRL 3TEHB 4BBRH 1YHBA 1HZAA 1V43A 1BBWA 1Y1WH 1D8LA 4LFCQ 4P72A 1BVSA 4A3BG 4JI0Q 2PNHA 2UU9Q 4HJ7A 4A3EH 1XMQL 1Q7YC 4YHHL 2D0OA 3S1MH 4HIDA 1RL2A 2UUCQ 4OWXB 2Z6KC 1SROA 2Z0SA 3ICEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI6 L;  3AFQ A;  1OXV A;  2Q2U A;  1XMO L;  4A3L H;  4JI1 L;  3RNU A;  2V1C C;  3GTK H;  2WAQ E;  4AIM A;  4A3G H;  4QQB X;  2VQF L;  4DAY B;  3FP9 A;  3RR5 A;  1IBM L;  2VQE Q;  1L1O A;  3RLO A;  1VQ5 A;  3CMA A;  1K8G A;  2ZM6 L;  2PQA A;  4DR3 L;  4LF9 L;  2B63 G;  3F2C A;  5IYC H;  1XNQ L;  3H0G G;  3TS2 A;  5C4X H;  1SE8 A;  1X65 A;  1YHA A;  1YIJ A;  2UUA L;  1B8A A;  3F8T A;  3UDI A;  3M7N A;  1C9O A;  3I2Z A;  2AWN A;  4DR1 Q;  2JQO A;  2YTX A;  4A3J G;  3VDY A;  1PVO A;  1PA6 A;  3CP0 A;  1NJI C;  1YEZ A;  1QVG A;  5IP9 H;  3ERS X;  4A3D H;  4IOC A;  3HFZ B;  5IY0 A;  2A1A A;  2UU9 L;  2GVB A;  1NTG A;  2KCT A;  2N8N A;  1A63 A;  4LFA L;  4PMW A;  5C44 H;  5M5W H;  5FLX c;  3L7Z C;  4IO9 A;  1E7Z A;  4GN5 A;  1KD1 C;  5LMN W;  5M3M H;  2E2H H;  3K0X A;  3J80 c;  3U4V A;  3W5O A;  1PH6 A;  3CPW A;  3NEL A;  3UDX A;  4A3I G;  2JA6 G;  1PH9 A;  1M1K C;  2R92 G;  3H3V I;  1Q1B A;  2GVA A;  2ZTE A;  3S15 H;  2I0Q A;  4LUV A;  3G6E A;  3PF5 A;  2QGQ A;  2YYZ A;  1PYB A;  4AH6 A;  2DUD A;  5H1S E;  1O7I A;  2A8V A;  1PH4 A;  5LMU Q;  5JJI A;  4DK3 C;  4A4I A;  3G71 A;  3K7U C;  1W3S A;  4GKK Q;  1PH1 A;  4JBK A;  4HIM A;  2XGT A;  1IZ6 A;  5IYD G;  5C3E H;  4P73 A;  1X3F A;  2PI2 E;  4L5T A;  3OW2 A;  3I4N G;  3J7A 5;  2OQ0 A;  3E9I A;  1N34 Q;  3KLW A;  3M3Y H;  5DLQ E;  4JBW A;  3J81 c;  2JK8 A;  4HJ9 A;  3OTO Q;  4OX9 L;  2R93 H;  1S3O A;  1HNW L;  1VQ6 A;  4YCU A;  1V1Q A;  4UP9 A;  1JB7 A;  2IT1 A;  2Y0S G;  1T9H A;  4AYB G;  5LMN Q;  2JA9 A;  4OWW B;  4XIG S;  1R9T H;  4LWC A;  5C0X G;  3HOX H;  3TQY A;  3AYH B;  5IT9 c;  3RLN A;  5LMU L;  2LXK A;  3FKI H;  1YJN A;  3PUW A;  1EQR A;  3W1B A;  2XTI A;  1SR3 A;  4BBR G;  1AE3 A;  2MFI A;  1S72 A;  4JYA Q;  1MIU A;  1WCM H;  1FVI A;  4GNX B;  3CCS A;  4BA1 I;  3UE1 A;  1LUZ A;  4DV3 L;  2JA5 G;  3HOV H;  4A3K G;  4A93 G;  5IWA L;  2KBN A;  4DR2 L;  1Q86 C;  1PH3 A;  1SRU A;  1K9M C;  2K50 A;  2Q2H A;  4DK6 C;  4A3L G;  4YY3 Q;  4LF5 L;  2CFM A;  4A3G G;  4IPG A;  3OTO L;  4GOP B;  2E5L L;  4JI3 Q;  4DUY L;  4LF8 L;  2JA8 H;  1CSP A;  4X64 L;  3GTG H;  3GTM H;  1X9N A;  4JV5 Q;  1IBL Q;  4J15 A;  1I5F A;  5M3F H;  1B70 B;  5LMN L;  1UWV A;  4UP7 A;  4DV1 L;  4DR5 Q;  2HHH Q;  4A3F H;  4LF4 Q;  1XTD A;  5IYC G;  3RLF A;  5HGQ A;  1N32 L;  1EFW A;  1EYG A;  2EXD A;  1ASZ A;  2Q2T A;  3I4M H;  1VQN A;  4GKJ Q;  4XTC S;  1J6Q A;  1TWG H;  5FJ8 H;  4X65 Q;  3PIO A;  1L2F A;  2MO0 A;  1HR0 L;  5ELO A;  4JI8 L;  3I4O A;  1KQS A;  2LSS A;  3K81 C;  3SGI A;  4JYA L;  1KXL A;  4C2M H;  5IP9 G;  1K3R A;  1C7Y A;  1ASY A;  4IPC A;  4IFD J;  2OTJ A;  4PZ6 A;  2CWA A;  1J5E L;  1YIT A;  3J81 j;  3T1H Q;  2KHI A;  1I3Q H;  2ID0 A;  5JJK A;  1S40 A;  3F2B A;  1EQQ A;  1OXT A;  5IP7 H;  3KF8 B;  1X3E A;  1JE5 A;  1X54 A;  3PF4 A;  1PHJ A;  3CQZ H;  4JOI A;  1MKH A;  1TXY A;  1CUK A;  3CC7 A;  4LF6 L;  3CCQ A;  1E1T A;  2VS1 A;  1OXU A;  3E0E A;  4R1J A;  3KOJ A;  3PUX A;  1IBL L;  2VUM G;  5GRO A;  1Z47 A;  5FLM G;  4DR5 L;  1CSQ A;  1AE2 A;  2K14 A;  2R7F A;  3UE0 A;  5AJ3 Q;  2NZO A;  1CKN A;  2OQK A;  1WI5 A;  4B3M L;  1L1O C;  2IHF A;  3PO2 G;  3CCM A;  3RZD H;  4DUZ Q;  4DV0 L;  2YTV A;  3TRE A;  1IYJ B;  1LTL A;  2R7Z G;  3HOU H;  3EN2 A;  4K0K Q;  1KC8 C;  3HKZ E;  3CD6 A;  3S14 H;  4BBS H;  1Q82 C;  1XPU A;  1VQM A;  1N36 Q;  2JA7 H;  2K5V A;  2ES2 A;  1HZ9 A;  4DPG A;  2E2J H;  3CCV A;  1BKB A;  1G6P A;  4BXX G;  1WFQ A;  3BZK A;  5C0X I;  1OTC A;  4JI4 Q;  3M85 A;  4LFB Q;  3S17 H;  4B3S L;  3BZC A;  4JI5 L;  4DAM A;  1K8A C;  2H5X A;  1FGU A;  4GLV B;  2D0P A;  3CC2 A;  4BY1 G;  4FDB A;  5M5X H;  1PH8 A;  2A19 A;  3HOW G;  1Q46 A;  4DV7 Q;  3CCU A;  4H02 A;  1CKM A;  3PUZ A;  1SFO H;  1HNX Q;  1VQL A;  2HQL A;  2I5H A;  3FHW A;  1WJJ A;  5BR8 Q;  3I56 A;  2VL6 A;  3M4Q A;  3KDF A;  4LFC L;  3CME A;  2I5M X;  4GLA C;  3KJP A;  4DUZ L;  4HJ5 A;  4JI0 L;  1OXX K;  2NVX H;  4R4I A;  3Q8D A;  1G29 1;  2PQA B;  3ER0 A;  4JI7 Q;  3K8A A;  2UUC L;  4ALP A;  2HT1 A;  2AKW B;  4DNI A;  1N36 L;  2WAQ G;  2NN6 I;  2JJQ A;  1YNX A;  1VS0 A;  3JAM c;  1YHQ A;  3PO3 H;  2IHE A;  4QY7 A;  1YJ9 A;  3CCE A;  4P75 A;  4JI4 L;  1VQD A;  4BY7 G;  1SN8 A;  3G4S A;  4B3T Q;  2JEB I;  4LFB L;  4AQY Q;  4DV5 Q;  1WOC A;  2D62 A;  4GN4 B;  4YCV A;  3H3V H;  1GD7 A;  2K5N A;  2IX0 A;  4TQU S;  4UPA A;  2R7D A;  2WB1 E;  5HY6 A;  2VQE L;  1PH5 A;  1I6H H;  1JJC B;  4OON A;  5C4J H;  4PZ8 A;  4APV A;  2CQO A;  4DV7 L;  4A3F G;  1QVF A;  2BA1 A;  5IYB H;  1HNX L;  1UE5 A;  4DR1 L;  3PCO B;  2UUB Q;  1VQF A;  5BR8 L;  2B3G A;  1XJV A;  4POF A;  3K7A H;  3T1Y Q;  1VQ9 A;  2AHO B;  4DV6 Q;  4X62 Q;  3AQQ A;  2HIX A;  1Y14 B;  2JE6 I;  1A0I A;  4QIW E;  2LXJ A;  1VQK A;  1YVC A;  2F3I A;  2ALY B;  3HOZ G;  4A3M G;  4L5S A;  3IRB A;  2MQH A;  2UXB Q;  4JC0 A;  4JI2 Q;  3KJO A;  5IP7 G;  2ATW A;  2B29 A;  3CAM A;  4AQY L;  3D31 A;  1L0W A;  1MJC A;  1V9P A;  4A3C G;  3GTO H;  3NBH B;  1HZC A;  3PUV A;  3CCL A;  1VQB A;  4EQ5 A;  4X66 Q;  4Y7N H;  3BJU A;  1W2B A;  4KHP Q;  3ULL A;  4DR7 Q;  1I94 Q;  2UXC Q;  1Y1W G;  4GKK L;  2UUB L;  4LW1 A;  3W1G A;  3T1Y L;  3S1R H;  4A3E G;  4NXN Q;  3HOU G;  4WJ3 M;  1UE7 A;  3MEF A;  1IL2 A;  2CCZ A;  1E3P A;  1NBW A;  1N34 L;  3PSI A;  2C35 B;  1UE6 A;  3GTJ H;  3U58 A;  3GTP H;  1FJG Q;  2CKZ B;  2K4K A;  5GQO A;  4IJH A;  4DV4 Q;  1OXS C;  2B63 H;  3CPF A;  1EIY B;  3S2D H;  4HJ8 A;  3H0G H;  2UXB L;  1C0A A;  4R4Q A;  1JMC A;  5M5Y H;  3BU2 A;  1Q81 C;  1VQA A;  4RMF A;  1VQP A;  2NN6 G;  1NMF A;  2GN5 A;  4QGU A;  2HIV A;  4OXP A;  1E22 A;  4DR4 Q;  5C4X G;  2Q2I A;  5ELN A;  2R6G A;  4BA2 I;  4IFD G;  3KF6 A;  4C3I H;  4JOI C;  4JCV E;  4DR7 L;  3G48 A;  1XPO A;  1EOV A;  1EUJ A;  1GO3 E;  1QUQ A;  1FL0 A;  4A3I H;  2JA6 H;  4C3H H;  1KRS A;  2EIF A;  5C44 G;  1TWH H;  1TWC H;  2VW9 A;  4IJL A;  5M3M G;  3TRZ A;  3RZO H;  4GLX A;  2N3S A;  1PYS B;  3JC6 6;  2UXD Q;  2N49 A;  4YY3 L;  1NY4 A;  4LF7 Q;  5GAD C;  4JI3 L;  3UDG A;  3EBE A;  2WP8 J;  4L5Q A;  4MTN A;  3ULP A;  1XNR Q;  4JV5 L;  2ASB A;  2VY3 A;  1P8L A;  3J7Z C;  1H95 A;  3AFP A;  4LF4 L;  2HHH L;  5IYD H;  1EIF A;  3A0J A;  4ME3 A;  3CCR A;  1D7Q A;  5IE8 A;  1VCI A;  1IXR A;  4YWL A;  4DR4 L;  4OO1 G;  2RHS B;  4POG A;  4JI6 Q;  1P16 A;  4GKJ L;  1AH9 A;  1X55 A;  4NXM Q;  4X65 L;  1XMO Q;  2CWP A;  4JI1 Q;  5C3E G;  1NMG A;  4YWM A;  3PV0 A;  2RF4 A;  2OTL A;  2VQF Q;  1X3G A;  1Z9F A;  2YV5 A;  1E1O A;  1IBM Q;  4RG1 A;  2F4V Q;  3T1H L;  4NB3 A;  2ZM6 Q;  1PH7 A;  1VQ8 A;  1JJ2 A;  4LF9 Q;  1U5K A;  4QL5 A;  2R93 G;  3HKS A;  2UXD L;  5JEA J;  1QVC A;  1YZ6 A;  4C3J H;  1GM5 A;  3S1Q H;  1QZH A;  3PUY A;  1K0R A;  3TS0 A;  2KCM A;  4IPH A;  2BH2 A;  4LNQ A;  1KAW A;  3HOX G;  1HH2 P;  5J3B A;  4UY8 C;  1HZB A;  3PGZ A;  2MNA A;  2JA5 H;  4A93 H;  3FKI G;  3E9H A;  5AJ3 L;  3ULJ A;  4A76 A;  4A3K H;  4LFA Q;  3EIV A;  3STB C;  3HKZ G;  2ZJR A;  1K73 C;  4K0K L;  1WCM G;  1VQE A;  1L1O B;  3DM3 A;  5EAY A;  3STB D;  3UDF A;  4NXM L;  4EX5 A;  4PG3 A;  3HOV G;  4MZ9 A;  1BBU A;  4R4C A;  3OYY A;  3KFU A;  3HOY H;  1Y1V H;  2F4V L;  2JEA I;  1E24 A;  3F2D A;  1TWA H;  4OWT B;  4P74 A;  3J81 i;  4JBM A;  3KDF B;  2JA8 G;  4IFD I;  1JT8 A;  2I5L X;  2Z6K A;  1PFS A;  4IPD A;  2QA4 A;  1HNZ Q;  1VQG A;  5M3F G;  4DR6 Q;  4Y52 H;  1JJG A;  4IOA A;  3M4P A;  3S16 H;  3PIP A;  2NZH A;  4R4T A;  3CCJ A;  1VQO A;  3I4M G;  1UEB A;  1VQH A;  3K80 C;  4X6A H;  4UP8 A;  5FJ8 G;  1IBK Q;  3MXN B;  5GAG C;  2PMZ E;  2K75 A;  2BH8 A;  1GVP A;  2RCN A;  4OX9 Q;  1U0L A;  2FXQ A;  4JI7 L;  1HNW Q;  4O2D A;  1KIX A;  2NVQ H;  1YI2 A;  4HIK A;  4TVA B;  3S2H H;  1HR0 W;  2VUM H;  2Y0S E;  3U50 C;  5FLM H;  4B3T L;  4AYB E;  2WB1 G;  4OO1 I;  1VQI A;  4DV5 L;  2N78 A;  4L5R C;  2OCE A;  3S24 A;  3PO2 H;  3F1Z A;  4GNX C;  3KYH C;  1HNZ L;  4A3B H;  5E7N A;  2R7Z H;  1I50 H;  1TWF H;  1X56 A;  3A74 A;  3A5U A;  4DV3 Q;  4A75 A;  1YJW A;  2IX1 A;  4DR6 L;  4NPS A;  2VNU D;  1CKO A;  1Q8K A;  3L0O A;  5IWA Q;  4DR2 Q;  3GD7 A;  2QEX A;  1A62 A;  1HJP A;  3DLL A;  3WWV A;  2ZTD A;  4A3D G;  4GOP C;  4BXX H;  5JJL A;  1IBK L;  4DV6 L;  2E8G A;  3GO5 A;  3I7F A;  4X62 L;  1XPR A;  4LF5 Q;  2EQS A;  3AEV A;  2E5L Q;  4LF8 Q;  4BBS G;  4DUY Q;  2BA0 A;  2JA7 G;  4KHZ A;  4X64 Q;  3CC4 A;  5GAH C;  4GNX A;  4BY1 H;  1VQJ A;  4DV1 Q;  1VQC A;  2DGY A;  3HOW H;  2L15 A;  4JI2 L;  2YTY A;  1Q12 A;  4HJA A;  4HIO A;  1SMX A;  2WFW A;  1RIP A;  4LUO A;  3M4O H;  1A8V A;  1N32 Q;  1K83 H;  4PZ7 A;  4KLK A;  3I55 A;  4A3J H;  4GOP A;  1WYD A;  4B3R Q;  1KL9 A;  5C0X J;  1HR0 Q;  4JI8 Q;  1PV4 A;  2MO1 A;  1G51 A;  4DV2 Q;  2AWO A;  4X66 L;  2YU9 H;  4KHP L;  4YCW A;  1X6O A;  1PH2 A;  1J5E Q;  1I94 L;  4WJ4 A;  1NE3 A;  2VZA A;  2UXC L;  1EWI A;  4JBJ A;  3L2P A;  3CXC A;  1N33 Q;  2E2I H;  1KHI A;  3GTQ H;  2NVT H;  4NXN L;  2R92 H;  4BY7 H;  4DKA C;  4JG2 A;  4GS3 A;  4O0A A;  2PI2 A;  4LF6 Q;  2AMC B;  3HOY G;  3GTL H;  1Y1V G;  5GAE C;  2OWO A;  1FJG L;  3PO3 G;  3KF6 B;  3A5Z B;  4DV4 L;  1SLJ A;  3B6Y A;  1B7Y B;  2K5H A;  2K52 A;  4B3M Q;  2IY5 B;  1DGS A;  2F52 A;  3NEM A;  1QUQ B;  3D0F A;  4DV0 Q;  1M90 C;  4B3R L;  1XMQ Q;  4LUZ A;  4YHH Q;  2RHQ B;  3CF5 A;  4QJF A;  1MJE A;  5IYB G;  4DV2 L;  3I4N H;  3U4Z A;  3RN5 A;  4R4O A;  1LYL A;  3S1N H;  3CW2 C;  2KEN A;  2ZTC A;  4MNO A;  2ZJP A;  3RN2 A;  3HOZ H;  4A3M H;  3ZJY C;  3GDE A;  3H15 A;  1LM0 A;  3NEN A;  4GN3 B;  1N33 L;  4B3S Q;  1QZG A;  5K36 G;  5JEA G;  4JI5 Q;  3M9B A;  2NVY H;  1N9W A;  4DR3 Q;  1KRT A;  4YWK A;  2ZJQ A;  1CKN B;  1XNQ Q;  4A3C H;  1VQ7 A;  3LGJ A;  3J80 i;  2UUA Q;  4P71 A;  3JAM i;  4LF7 L;  1VQ4 A;  1N8R C;  1GKH A;  1Q1E A;  1UE1 A;  1YBY A;  2KHJ A;  4KI0 A;  1XNR L;  3TEH B;  4BBR H;  1YHB A;  1HZA A;  1V43 A;  1BBW A;  1Y1W H;  1D8L A;  4LFC Q;  4P72 A;  1BVS A;  4A3B G;  4JI0 Q;  2PNH A;  2UU9 Q;  4HJ7 A;  4A3E H;  1XMQ L;  1Q7Y C;  4YHH L;  2D0O A;  3S1M H;  4HID A;  1RL2 A;  2UUC Q;  4OWX B;  2Z6K C;  1SRO A;  2Z0S A;  3ICE A; 
#chains in the Genus database with same CATH topology
 1OXV A;  1TVX A;  5M5W B;  3RNU A;  4CHT B;  2A69 C;  2VQF L;  2PZW A;  4DAY B;  3EJI A;  2NVQ B;  2K33 A;  2PQA A;  2ZM6 L;  4L6T B;  5IYC H;  1XNQ L;  3S2H B;  3H0G G;  3AU7 A;  1YHA A;  3OIQ A;  5COR A;  3F8T A;  3GQB A;  1Y8P B;  1YIJ A;  2CH4 W;  3I2Z A;  4RCO A;  5G3L D;  3KBX A;  4RFB A;  1PA6 A;  1RTO A;  5I9O A;  3CP0 A;  1NJI C;  1YEZ A;  5IP9 H;  4QF4 A;  1A63 A;  1ET9 A;  3H6M A;  5C44 H;  5M3M H;  2E2H H;  2D9U A;  3W5O A;  4A3I G;  3R8B A;  3H3V I;  1FGB D;  2GVA A;  2A6H D;  2FHT A;  4ME5 A;  1PYB A;  2E74 C;  4BY1 B;  2A8V A;  1Y69 U;  5LL6 S;  1Y8O B;  5LMU Q;  3DEO A;  4IQZ A;  1E0B A;  3SK8 A;  3G71 A;  4KY7 A;  2VXW A;  1PLF A;  4DNR B;  2N55 A;  4L5T A;  3OW2 A;  4XYQ A;  3J7A 5;  5CGK A;  3NWS A;  5FOB B;  5LL6 X;  3HGB A;  3IAY A;  2ZXP A;  4JBW A;  4NW2 A;  3J81 c;  1TKW B;  3W2D A;  4OX9 L;  2R93 H;  4E6I A;  1EWC A;  5T1I A;  5IGG A;  4ZQ3 A;  4UP9 A;  5ELE A;  4AYB G;  5LMN Q;  4LWC A;  2B39 A;  1ILP A;  1SYD A;  3D6W A;  1ZXT A;  1SR3 A;  5IGE A;  4BBR G;  2MFI A;  4NMZ A;  4BA1 I;  3UI2 A;  3HOV H;  4NP5 A;  2NUC A;  5IWA L;  4K2L A;  1BQQ T;  3A56 A;  1SRU A;  1K9M C;  1DYQ A;  2A68 D;  4DFA A;  3BG3 A;  2CFM A;  1DJR D;  4GOP B;  2E5L L;  4DUY L;  2B2V A;  5M3F H;  1UWV A;  5IYC G;  3AMU A;  2EXD A;  3R3O A;  4F8M A;  4G57 A;  2HDM A;  3PIO A;  1ILQ A;  5ELO A;  5IP9 G;  4IFD J;  4A3E B;  1J5E L;  2TMP A;  2WKC A;  3J81 j;  1BCP F;  4LJZ C;  5IP7 H;  1X3E A;  5KYL A;  1X54 A;  2M00 A;  3E3X A;  3PF4 A;  1PHJ A;  4ZCK A;  4LF6 L;  2VS1 A;  1H9S B;  4QUC A;  3KOJ A;  3T16 A;  5GRO A;  1Z47 A;  5FLM G;  2MUY A;  2R7F A;  1TY2 A;  1CKN A;  2RSN A;  3PO2 G;  3RZD H;  2QEJ C;  2Q8T A;  4Z9C B;  3EN2 A;  2RA4 A;  4KJN A;  4BBS H;  5D3I B;  1Q82 C;  1XPU A;  2K5V A;  3R2T A;  1GUT A;  4JI4 Q;  4B3S L;  3BZC A;  4RCN A;  4DAM A;  3CC2 A;  2Q8R E;  1STB A;  4XT1 B;  1KLU D;  5IT9 E;  1I6V C;  2I5H A;  1WJJ A;  3I56 A;  3MC0 B;  4G4K A;  3KJP A;  4DUZ L;  1HFN A;  4R4I A;  4ALP A;  1SMY D;  1PTO C;  2JJQ A;  5KIX A;  2SNS A;  3VYR A;  4B3T Q;  2JEB I;  4AQY Q;  1WOC A;  4GN4 B;  4YCV A;  5CYU A;  4TQU S;  2R7D A;  1I6H H;  5C4J H;  2NB0 A;  1RKN A;  4APV A;  1A15 A;  3CRL C;  1UE5 A;  5JJZ A;  1XJV A;  4DV6 Q;  1JC7 A;  1E2Z A;  4X62 Q;  4H0L C;  2IW3 A;  1Y14 B;  3HOZ G;  2VB3 X;  4A3M G;  2MQH A;  1DM0 B;  1HRJ A;  4JI2 Q;  5IP7 G;  2RDH A;  1SJH D;  4CDD C;  5M5Y B;  3GTM B;  4A3C G;  4KHP Q;  1IL8 A;  1LT5 D;  4X3U A;  4DR7 Q;  1BCP D;  2F1M A;  3I3C A;  3SE0 A;  5A35 A;  3T1Y L;  3KLR A;  4NDX A;  3W1G A;  1W6J A;  1N34 L;  5HUR A;  1UE6 A;  1EYC A;  1D1K A;  3GTJ H;  3GTP H;  4R8I A;  4XXE A;  2K4K A;  3J81 L;  5GQO A;  4ILW A;  2B63 H;  1OXS C;  4ZK9 B;  1I3Q B;  2UXB L;  3J7Y W;  2IL8 A;  1Q81 C;  1KAA A;  2WB1 B;  1VQP A;  1SE4 A;  3DWQ A;  1ZKO A;  2NN6 G;  1EY7 A;  1NMF A;  4QGU A;  1E22 A;  1TU2 B;  2Q2I A;  3N6R A;  1WTV A;  4BA2 I;  3KF6 A;  4OGQ C;  4C3I H;  3IFD A;  2F03 A;  1EEF D;  2MHV A;  4IUP A;  1CTM A;  4YIJ A;  1EOV A;  2B2Y A;  3NTK A;  3PIP 3;  1EUJ A;  4DU9 A;  4RGM A;  1YNJ D;  2VW9 A;  4DN4 M;  1D5Z C;  3J80 E;  1PYS B;  4YY3 L;  1HCZ A;  2NWG A;  4MTN A;  3KF8 A;  1P8L A;  2L12 A;  4LF4 L;  1EQV A;  1HXY D;  2HHH L;  4FVM A;  3J7A V;  1VCI A;  4F88 A;  4OO1 G;  1JOQ A;  2EVB A;  1D1I A;  5EBD A;  1BF4 A;  2CWP A;  5C3E G;  2V4D A;  3SDZ A;  3SK5 A;  2VQF Q;  1X3G A;  2YV5 A;  2EJF C;  2F4V Q;  1HPC A;  3T1H L;  4NB3 A;  2ZM6 Q;  4JPB W;  1QVC A;  1YZ6 A;  1GM5 A;  3S1Q H;  1MBY A;  3NUC A;  1QZH A;  3TN2 A;  3PUY A;  4FF3 A;  1CQF A;  1STN A;  3SHL A;  3RMH A;  2BH2 A;  1K8O A;  2F0V A;  3BDO A;  4FF4 A;  4UAI A;  3TDQ A;  3M4Y A;  3FKI G;  4A76 A;  5AJ3 L;  4A3K H;  3EIV A;  3HKZ G;  1F2M A;  2J4X A;  1K73 C;  4PG3 A;  1IYU A;  4N9T A;  2A73 B;  2OXP A;  4QMG A;  2NBF A;  2A69 D;  3OYY A;  1R4P B;  4EVO A;  2JEA I;  1DOM A;  4OWT B;  4JBM A;  2JA8 G;  2HUG A;  1B3A A;  1HA5 A;  2PYK A;  3NTI A;  4Y52 H;  2IWH A;  3M4P A;  1HA6 A;  2NZH A;  4HCS A;  4KV6 A;  3K0Y A;  3I4M G;  4C3I G;  2O5J C;  1CK1 A;  4OX9 Q;  4DNT B;  3S1R B;  1FD7 D;  4O2D A;  2NVQ H;  2K7V A;  2M9V A;  4TVA B;  3S2H H;  3A7L A;  3WOE A;  4H44 C;  4RGO S;  4AYB E;  3S2D B;  5JVH 3;  4TRD A;  4OO1 I;  3CRK C;  3MXU A;  4L5R C;  5DM7 3;  3QOL A;  1SNO A;  3F1Z A;  2KVM A;  4GNX C;  1QE6 A;  1JWM D;  3Q22 A;  2LFN A;  5E7N A;  1X56 A;  3A5U A;  1ENF A;  1CKO A;  3P7J A;  5IWA Q;  3NBH A;  1A62 A;  1U4R A;  1PRT F;  4K8I A;  1EZ6 A;  2ZTD A;  4S3S A;  3DLL A;  4BXX H;  5JJL A;  1IBK L;  4HED A;  3SEB A;  1QWY A;  3AEV A;  2E5L Q;  4HR7 B;  4DUY Q;  2JA7 G;  3GTQ B;  4PMB A;  3BVM A;  4C3H B;  3CC4 A;  2R92 B;  4BY1 H;  1Z6H A;  2PO4 A;  2CHB D;  2L15 A;  3AB9 A;  1GUG A;  1EY0 A;  2EZV A;  2B2W A;  4A3J H;  4GOP A;  4B3R Q;  1KL9 A;  1H9R A;  1PV4 A;  4OIK A;  1J5E Q;  1FNU A;  1QB5 D;  1ESF A;  2UXC L;  1BCP B;  2PMZ B;  3L2P A;  2B2T C;  4NXN L;  3HOZ B;  4DKA C;  4O0A A;  2WV6 D;  2PI2 A;  4LF6 Q;  5I6W A;  2OWO A;  2Y0S B;  1FYC A;  3A5Z B;  2M2L A;  1X3Q A;  1K3B C;  2DJF C;  1GUW A;  1WD0 A;  2K52 A;  3KUP A;  1D5X C;  5LHY 1;  2IY5 B;  1HTP A;  1M90 C;  3FPP A;  2L1B A;  4YHH Q;  3CF5 A;  2CW0 C;  1H9S A;  5IYB G;  3I4N H;  1A3V A;  1EOT A;  2JA5 B;  4A93 B;  2X69 A;  5IOC A;  5EPJ A;  4B3S Q;  1QZG A;  1LTI D;  1K0S A;  4A3G B;  3E6Z X;  5DNF A;  1KRT A;  1CKN B;  1ET6 A;  5C0X H;  3QR8 A;  1VQ7 A;  3J80 i;  3JAM i;  2EOT A;  1GKH A;  1Q1E A;  1YBY A;  4OEM B;  5D14 A;  2K6A A;  2F0H A;  4EQP A;  1U4M A;  4P72 A;  2NTT A;  2UU9 Q;  4A3E H;  1Q7Y C;  4MN3 A;  3AFQ A;  2BDO A;  1WTW A;  2V1C C;  3T56 B;  4AIM A;  2ENB A;  4MHE A;  1HHV A;  3RR5 A;  1L1O A;  2FIN B;  2L9H A;  1H9M A;  3RLO A;  1VQ5 A;  1KDB A;  2F0S A;  3F2C A;  3TBI B;  2UUA L;  1X65 A;  3ERQ A;  2QKI C;  4KN7 C;  3T53 B;  3UDI A;  1PRT D;  2K05 A;  2JQO A;  2YTX A;  2A5H A;  4A3J G;  2EYF A;  1PVO A;  2EE1 A;  2K32 A;  1QVG A;  2K01 A;  1NTG A;  4PMW A;  4IO9 A;  1E7Z A;  1KD1 C;  3M7G A;  2RVL A;  5LMN W;  2KCN A;  3J80 c;  3UDX A;  1PTO D;  2JA6 G;  1Q1B A;  1K28 A;  2I0Q A;  2YYZ A;  5H1S E;  1O7I A;  4ULL A;  3HOW B;  5EKK A;  2I07 B;  3A8I E;  1B4O A;  1W3S A;  1PH1 A;  1IZ6 A;  3I4N G;  3KK7 A;  1N34 Q;  3E9I A;  5KNC A;  5C6A A;  1S4Z A;  2JK8 A;  4ZAI A;  3OTO Q;  4IUV A;  3DXJ C;  4YCU A;  1V1Q A;  4V0B A;  5IIF A;  2RBM A;  2JA9 A;  5C0X G;  3GTL B;  3TQY A;  1O78 A;  4C3J G;  2JXM B;  1KNE A;  1F2Y A;  2LXK A;  5I2X A;  3PUW A;  3W1B A;  4IUU A;  1DOK A;  1HQM C;  4JYA Q;  4DV3 L;  1LUZ A;  2C5C A;  4BS9 A;  1PH3 A;  1STH A;  5CV7 A;  1JOK A;  4Q0F A;  3S1N B;  2L0C A;  1SDF A;  4IN3 A;  4YY3 Q;  4LF5 L;  4IPG A;  3CHB D;  1HUN A;  3GTM H;  1X9N A;  1IBL Q;  2ICI A;  2NVY B;  4J15 A;  4DV1 L;  1B70 B;  3I91 A;  3W3A A;  4LF4 Q;  2HHH Q;  4A3F H;  1AZP A;  1STG A;  4FF2 A;  4G7H C;  1N32 L;  3ND9 A;  1VQN A;  1V1O A;  5ELD A;  2XSC A;  4RWS C;  1L2F A;  2MO0 A;  4C1N I;  1XXG A;  2OTJ A;  1K3R A;  1C7Y A;  1QNU A;  1YIT A;  3C3L A;  3S1M B;  4QB4 A;  1D2B A;  3T1H Q;  1A2U A;  1I3Q H;  1PZI D;  2ID0 A;  2KHI A;  3L3O C;  2E2J B;  3KF8 B;  2HD3 A;  1JE5 A;  5I9P A;  3CQZ H;  4JOI A;  1MKH A;  3CC7 A;  1CUK A;  4R1J A;  3PUX A;  4IUT A;  4DR5 L;  3UE0 A;  5AJ3 Q;  2Z8L A;  2NZO A;  2OQK A;  5C4X B;  3ITP A;  2IHF A;  1GHJ A;  1I4G A;  4A3D H;  2F0T A;  1IYJ B;  1LTL A;  3T13 A;  3HOU H;  2R7Z G;  2C9O A;  3HKZ E;  1C4Q A;  4K5X A;  1HZ9 A;  4DPG A;  2ES2 A;  5KND A;  3CCV A;  1BKB A;  1GXD C;  1WFQ A;  1OTC A;  5C0X I;  1RDP D;  1MI2 A;  2F0W A;  5DM6 3;  1O7Y A;  1K8A C;  4FXD A;  2H5X A;  2D0P A;  5J22 A;  3S15 B;  5D65 A;  4FDB A;  4QCL A;  1PH8 A;  1Q46 A;  4H02 A;  1CKM A;  3PUZ A;  5CBA E;  1SYG A;  1AZQ A;  3K5M A;  5BR8 Q;  1EIH A;  2F4I A;  1EEI D;  3Q8D A;  3K7A B;  3ER0 A;  3NQT A;  2UUC L;  1N36 L;  2L5T A;  2WAQ G;  1G2S A;  3M3Y B;  1PFB A;  2EJM A;  3A54 A;  2D2C C;  4UDU C;  4Q5V A;  4ZYS A;  1VQD A;  4BY7 G;  3G4S A;  4LFB L;  1LO5 D;  1JOR A;  2K5N A;  2IX0 A;  2VQE L;  1JJC B;  1SYC A;  4OON A;  4U68 A;  2CQO A;  4DV7 L;  4A3F G;  1QVF A;  1PZJ D;  2BA1 A;  3HOX B;  1QNK A;  1HNX L;  2EDG A;  1HQR D;  1PRT B;  1STY A;  2KEE A;  2UUB Q;  4JW0 A;  3H09 A;  1VQF A;  2Z6B A;  1PFM A;  3AQQ A;  4CJ0 B;  1WCM B;  1R4Q B;  1K8M A;  2EXZ A;  1EY8 A;  2JE6 I;  1A0I A;  1VQK A;  1YVC A;  2F3I A;  1V8Q A;  4ZKC B;  3J80 L;  3U9S A;  2ATW A;  2X6G A;  4DA2 A;  5EPL A;  1V9P A;  3NBH B;  1HZC A;  5E4W C;  1L0X B;  4JVZ A;  2UXC Q;  1Y1W G;  4GKK L;  4LW1 A;  3S1R H;  3HOU G;  4NXN Q;  1UE7 A;  1IL2 A;  1E3P A;  1XWE A;  4C2M B;  1BDO A;  3PSI A;  1M8A A;  2C35 B;  3U58 A;  3FVQ A;  3VYT A;  2CKZ B;  3S2D H;  3VR5 A;  4DGZ A;  3CPF A;  1EIY B;  4HJ8 A;  2TSS A;  4R4Q A;  4CJ1 B;  4IUR A;  3BU2 A;  2FMC A;  1G8Z D;  1VQA A;  1CQV A;  2LY7 A;  2QCP X;  4DR4 Q;  3EFX D;  3DWP A;  1XPO A;  1GO3 E;  4C3H H;  5C44 G;  1TWC H;  1VMP A;  4WFN 3;  5M3M G;  3TRZ A;  3MVV A;  3RZO H;  3P1H A;  5CR3 A;  3JC6 6;  4P2C B;  4XQN A;  4JI3 L;  3S17 B;  2WP8 J;  2IPK D;  3ULP A;  4JV5 L;  4XT3 B;  1LLR D;  1DOL A;  5IYD H;  4ME3 A;  3CCR A;  5IE8 A;  1IXR A;  2RDF A;  1CZG A;  4POG A;  2CW0 D;  3T51 B;  1P16 A;  4LAA A;  1X55 A;  4X65 L;  3DEP A;  1CZW A;  3DHQ A;  3MZ5 A;  1NMG A;  4YWM A;  1NR2 A;  2B2U A;  2NVX B;  3EVQ A;  4RG1 A;  2F0L A;  1SNP A;  3T4A C;  4EGV A;  3HOY B;  3PO3 B;  2R93 G;  3H91 A;  2UXD L;  1VDZ A;  3URY A;  5CV6 A;  2KCM A;  5CV5 A;  1MSG A;  1EQT A;  1HZB A;  3FDT A;  1S5E D;  3PGZ A;  2JA5 H;  4A93 H;  3ULJ A;  1KLG D;  2XWB B;  2CQA A;  1TQO A;  4K0K L;  3UDF A;  1VQE A;  1L1O B;  3STB D;  4NXM L;  4EX5 A;  1LTS D;  2F0E A;  3HOV G;  2JSO A;  1SSO A;  1Y1V H;  4I7A A;  3P75 A;  1NSN S;  3KDF B;  2KQ3 A;  5C3X A;  2RSO A;  2Z6K A;  1LV9 A;  2R3Z A;  5BN4 A;  2QA4 A;  4K5V A;  1VQG A;  5M3F G;  3V05 A;  2XIW A;  5E1F A;  3S16 H;  5CV4 A;  2K5D A;  3HS0 C;  4BWG B;  1ENA A;  1UEB A;  2X6L A;  2EJG C;  1RD9 D;  3MXN B;  5GAG C;  1WTO A;  2RCN A;  1DD2 A;  5JEA H;  4IZ8 A;  3TZD A;  1U0L A;  1KAB A;  2FXQ A;  4JI7 L;  1KIX A;  1YI2 A;  4HIK A;  2MPM A;  2H4O A;  3Q23 A;  2VUM H;  3OSO A;  4X3T A;  3U50 C;  4KKU A;  1SND A;  3H0G B;  2MJ8 A;  1QG7 A;  3TP8 A;  3BDC A;  1HNZ L;  4A3B H;  3A74 A;  3EQL C;  4DR6 L;  4DV3 Q;  2VNU D;  3L0O A;  3GD7 A;  2EYJ A;  2F3V A;  4GOP C;  4CDF C;  2D5D A;  4DXG A;  5KGU A;  2ZT9 C;  2E8G A;  4LF5 Q;  1XPR A;  3VR3 A;  4BBS G;  2J7Z A;  4A3I B;  4KHZ A;  2NTS A;  2XVS A;  1TWH B;  2Z4I A;  4DV1 Q;  1VQC A;  3HOW H;  4HIO A;  1N32 Q;  1A8V A;  1B9M A;  2G9D A;  4L8J A;  4HTH A;  1WYD A;  5KRU A;  1IW7 C;  4DV2 Q;  4YCW A;  1TII D;  1X6O A;  1MHW C;  5JAV A;  4V19 0;  2F0K A;  2OF1 A;  3CXC A;  2E2I H;  3BVG A;  5I2Y A;  3NP8 A;  2NVT H;  4XQJ A;  2FMM A;  3GTL H;  1Y1V G;  2PPB C;  3JAM E;  1FJG L;  4AYB B;  1L0Y B;  3C1F A;  1QUQ B;  1DXM A;  1XMQ Q;  4LUZ A;  4BBR B;  1Y1W B;  1MJE A;  3RN5 A;  3VR2 A;  3S1N H;  4DF7 A;  2ZJP A;  2ZTC A;  5JOB A;  5FO8 B;  1STE A;  4KY6 A;  4NKL A;  3NEN A;  1N33 L;  1RF2 D;  5JEA G;  5EBC A;  3M9B A;  4KD3 A;  1MD2 D;  2NVY H;  1XNQ Q;  4KKT A;  4P71 A;  2DNE A;  4KI0 A;  2E76 C;  2WAC A;  4K6L A;  3OWF A;  1XNR L;  4FP5 D;  1V43 A;  1BVS A;  4A3B G;  4MTK A;  4HJ7 A;  1SYE A;  5JPN C;  3S1M H;  4HID A;  1RL2 A;  2UUC Q;  3ICE A;  3OHX C;  1VF5 C;  2Q2U A;  4A3L H;  1T5E A;  4QQB X;  2WAQ E;  2E2D C;  4M1U B;  4FXG C;  4WJW A;  3FP9 A;  2VQE Q;  3CMA A;  1K8G A;  4LF9 L;  3I70 A;  4DR3 L;  3QJY A;  4F7X A;  2B63 G;  5C4X H;  3M7N A;  3DM1 A;  3LX0 A;  1B8A A;  1SEB D;  5C3W A;  1JCK B;  3X3N A;  2LMC B;  3PO2 B;  2K04 A;  1LTA D;  2LKV A;  3ERS X;  3D4W A;  3SK6 A;  4IOC A;  3HFZ B;  1I50 B;  2A1A A;  2F0F A;  2F0P A;  5IY0 A;  4LFA L;  5M5W H;  4GN5 A;  4K8J A;  3K0X A;  4KMU C;  3HG9 A;  1ONL A;  4FYD A;  1J8I A;  2EYM A;  2FFK B;  1M1K C;  2A6H C;  2ZTE A;  3S15 H;  1RTN A;  3G6E A;  3PF5 A;  2Z1C A;  1SJE D;  2QGQ A;  2K28 A;  5CV9 A;  1WD1 A;  1DCZ A;  2DUD A;  2CH4 A;  3NQI A;  5KNB A;  4B08 A;  1PH4 A;  3N52 A;  1G2T A;  5L37 A;  1K83 B;  4JBK A;  4GKK Q;  3BDL A;  5CV8 A;  4HIM A;  1B1Z A;  3MA2 B;  2XGT A;  3FPU B;  4P73 A;  1X3F A;  2SDF A;  3MAQ A;  3KLW A;  3M3Y H;  4LK1 C;  2P5Z X;  3K5N A;  3I8Z A;  1BOS A;  4GZY C;  1KNA A;  2F0Q A;  5TSS A;  1ML0 D;  1S3O A;  4OHJ A;  1VQ6 A;  3MFY A;  2HDL A;  1T9H A;  5A2Q E;  4OWW B;  5ELB A;  3QG1 A;  3HOX H;  1BO0 A;  1PTO F;  5IT9 c;  5M3F B;  2F3W A;  3RLN A;  5LMU L;  1EQR A;  2XTI A;  1CM9 A;  1AE3 A;  1F77 A;  2ZXO A;  1S72 A;  1MIU A;  1WCM H;  1FVI A;  3CCS A;  3UE1 A;  3VYU A;  4A3K G;  4DR2 L;  2Q2H A;  2FJ2 A;  1V1P A;  4A3L G;  5KYI A;  4A3M B;  4JI3 Q;  3I4L A;  4X64 L;  4JV5 Q;  1B3Q A;  2DY8 A;  1I5F A;  2MGS A;  4WOR A;  5LMN L;  4UP7 A;  1X32 A;  3RLF A;  3TP5 A;  4HCE A;  4KJO A;  1RCV D;  2EY6 A;  1EYG A;  2JN4 A;  1F9R A;  2IX3 A;  5FJ8 H;  4X65 Q;  2RDG A;  1LTR D;  1HR0 L;  1EFI D;  4JI8 L;  2O4X A;  1KQS A;  3K81 C;  3SGI A;  3P20 A;  4C2M H;  1ASY A;  4IPC A;  4PZ6 A;  2CWA A;  1SE2 A;  3Q0A A;  4OL7 A;  1S40 A;  1I4R A;  3F2B A;  1X3P A;  3GTK B;  1AW7 A;  1A3T A;  1TXY A;  2MP1 A;  5I6Y A;  1OXU A;  3E0E A;  1NR4 A;  1CSQ A;  1AE2 A;  1Z7T A;  5EPK A;  3CU7 A;  4ID6 A;  4DUZ Q;  4DV0 L;  4K0K Q;  3TRE A;  5DEH A;  2K5W A;  3CD6 A;  1ROD A;  1Q3L A;  5FKA C;  2HQE A;  4BXX G;  1D6E C;  1WVL A;  2B8G A;  3S17 H;  4L63 B;  1F2Z A;  4JI5 L;  3CKI B;  4GLV B;  1B44 D;  1H9K A;  2NZ1 D;  4BY1 G;  4U67 3;  2A19 A;  3CCU A;  1VQL A;  5C4J B;  4IFD H;  4H7B A;  3C46 A;  3FHW A;  1T5X D;  2ICE C;  3KDF A;  4LFC L;  3CME A;  4GLA C;  4HJ5 A;  4JI0 L;  2PZT A;  1CFM A;  2NVX H;  1TT2 A;  1G29 1;  5C3E B;  2EYP A;  4JI7 Q;  3K8A A;  2WII B;  5J39 A;  4IUQ A;  2HT1 A;  1CI3 M;  2EPB A;  1YNX A;  1B9N A;  4XQQ A;  3JAM c;  1YHQ A;  2IHE A;  1SBB B;  5CC4 A;  3PO3 H;  4JI4 L;  3MXN A;  5ISR A;  4OIJ A;  2D62 A;  5IGF A;  3H3V H;  1GD7 A;  1YNN C;  5HY6 A;  1AP0 A;  2G9H D;  4PZ8 A;  1R9T B;  3LNN A;  4DR1 L;  3FKI B;  2B3G A;  3T1Y Q;  1RHP A;  2AHO B;  4HSP A;  3HKZ B;  1C8C A;  1PFN A;  1ESR A;  2DY7 A;  4QIW E;  2RKS A;  2LXJ A;  2F0I A;  2ALY B;  1SNC A;  4L5S A;  3IRB A;  1EU3 A;  2UXB Q;  4JC0 A;  3KJO A;  2EY5 A;  4AQY L;  3D31 A;  4KHV A;  2JA8 B;  3MWY W;  3TME A;  3GTG B;  3PUV A;  2QW7 A;  1VQB A;  4EQ5 A;  3BJU A;  2HCI A;  3ULL A;  2B2V C;  4ZRZ A;  3I4M B;  4C3I B;  1TWG B;  4A3E G;  3MEF A;  5C5L A;  1NBW A;  1EY4 A;  3I90 A;  1FJG Q;  4IJH A;  3H0G H;  5IOD A;  1JMC A;  5M5Y H;  1B50 A;  1EL0 A;  4OXP A;  1IYV A;  1BR9 A;  2OT2 A;  4G7O C;  5IT9 L;  4IFD G;  3A55 A;  1NNX A;  4DR7 L;  2EYL A;  3K6O A;  2BCO A;  1DZ1 A;  1QUQ A;  1FL0 A;  1YNJ C;  1I4P A;  4A3I H;  2EIF A;  4HN7 A;  1TWH H;  3S14 B;  5FLX E;  2JA7 B;  3D4R A;  1LTT D;  2XRQ D;  4CDE C;  5GAD C;  2B2U C;  4ODG A;  1SYF A;  3EBE A;  1XNR Q;  1ICF B;  3S1Q B;  2ASB A;  2QIL A;  2B2T A;  5M5X B;  3D3R A;  3TSS A;  1SFO B;  2RHS B;  5EGT A;  1JOO A;  1E2V A;  4CKE A;  4GKJ L;  1AH9 A;  1CA5 A;  3KLS A;  2RF4 A;  2OTL A;  4ZUI A;  1Z9F A;  1E1O A;  2SEB D;  2EYH A;  2AQ2 B;  5C4H A;  1ICW A;  1ZYR C;  4LF9 Q;  4CGY B;  1JJ2 A;  1U5K A;  1EU4 A;  1SYB A;  3OOC A;  5DAU A;  1VF7 A;  2KCC A;  5HGT A;  4C56 C;  1K0R A;  3TS0 A;  4IPH A;  1EIG A;  2F0D A;  2Z4H A;  1HH2 P;  5J3B A;  4UY8 C;  3MEH A;  2PW5 A;  4LFA Q;  3IL8 A;  4J8Q A;  4IUN A;  2ZJR A;  3DWA A;  3DM3 A;  3BS1 A;  3MXP A;  4HMJ A;  1XX8 A;  1UNS A;  4K14 A;  1IKM A;  2I46 A;  4R4C A;  5C5M A;  4DAP A;  1EYD A;  2F4V L;  4K6D A;  4PV1 C;  3F2D A;  4UHV A;  4P74 A;  3J81 i;  2F0M A;  4IFD I;  1KTK A;  2BE5 C;  3V2T A;  4HSV A;  4IOA A;  2RQX A;  3GTO B;  3PIP A;  3LWU A;  4Y7N B;  1VQH A;  3K80 C;  3WOF A;  4X6A H;  1IBK Q;  3X3M A;  1GVP A;  3D4D A;  4X3S A;  5EQ0 A;  4RHR A;  3O13 A;  1GJX A;  1FNW A;  4KTA A;  1U4P A;  3JAM L;  5FLM H;  1PTO B;  2WB1 G;  1SXT A;  4CJ2 C;  4X3K A;  4O42 A;  4DV5 L;  2OCE A;  3PO2 H;  4RGN A;  3KYH C;  4A3J B;  1I50 H;  1YJW A;  4A75 A;  2IX1 A;  2GA4 B;  4NPS A;  3FEW X;  5K36 H;  4DR2 Q;  2QEX A;  1HJP A;  4K5W A;  3WWV A;  4A3D G;  1GUO A;  2R61 A;  3VYS A;  3I7F A;  2EQS A;  3GP7 A;  2BA0 A;  4J6H A;  1BBX C;  4X64 Q;  2JA6 B;  2PQE A;  5GAH C;  4H13 C;  3OWE B;  2B2Y C;  2KOL A;  1Q12 A;  4HJA A;  2WFW A;  1RIP A;  1K83 H;  1CHQ D;  4PZ7 A;  4KLK A;  3I55 A;  2WKD A;  3NPP A;  5C0X J;  1HFG A;  1HR0 Q;  4JI8 Q;  2KA7 A;  1G51 A;  2MO1 A;  2O2L D;  4X66 L;  1V1P B;  1NUC A;  2Q8I B;  1I94 L;  3R2I A;  1NE3 A;  3I4N B;  3L9A X;  5F2D A;  4JBJ A;  1KHI A;  1LAC A;  3GTQ H;  2R92 H;  1DON A;  4JG2 A;  4GS3 A;  2AMC B;  4DK1 A;  5GAE C;  4PMC A;  2L4N A;  1UAP A;  5D3D A;  4DV4 L;  1SLJ A;  1B7Y B;  4C3J B;  1LTG D;  1DGS A;  1EY9 A;  4DV0 Q;  4B3R L;  2RHQ B;  3U4Z A;  4R4O A;  3CW2 C;  2KEN A;  4MNO A;  1AEX A;  1S5F D;  3RN2 A;  3HOZ H;  4A3M H;  2XN9 C;  3GDE A;  3PQI A;  3ZJY C;  4GN3 B;  3H15 A;  5I4D A;  2F0O A;  4JI5 Q;  3I72 A;  3V96 A;  3FRP B;  1PXU A;  1EWH A;  3LWE A;  2F0U A;  2ZJQ A;  4A3C H;  5EKL A;  3TP6 A;  3SK4 A;  1SE3 A;  2UUA Q;  4LF7 L;  1TWA B;  1PZK D;  2BOS A;  3TEH B;  3NXW A;  1HZA A;  1BBW A;  4LFC Q;  3K59 A;  1GHK A;  3SVM A;  2JP1 A;  4JI0 Q;  4DK0 A;  2PNH A;  3BZD B;  1J9O A;  4YHH L;  1A3U A;  4XYO A;  3HEJ A;  2EY2 A;  5K36 G;  1VQJ A;  3R93 A;  2KEC A;  4JI6 L;  3ONA B;  1XMO L;  4JI1 L;  3GTK H;  4A3G H;  5ELF A;  1IBM L;  2NN6 H;  3IFT A;  5BN3 A;  5A2Q L;  3TS2 A;  1PRT C;  3DMU A;  1SE8 A;  1C9O A;  4DR1 Q;  2AWN A;  3E5S A;  3VDY A;  3NHH A;  4I7Z C;  5AFW A;  1F9S A;  2R7Z B;  1TWF B;  2UU9 L;  2GVB A;  2KCT A;  2N8N A;  4JK1 C;  3U9O A;  2O5I C;  5FLX c;  3L7Z C;  4LNQ A;  1TS3 A;  3U4V A;  2KHS A;  3QB3 A;  1PH6 A;  3CPW A;  3NEL A;  1PH9 A;  4C3H G;  2R92 G;  4M8A A;  4LUV A;  4N9P A;  3RUZ A;  4AH6 A;  3G7L A;  1W6K A;  4RHS A;  3IKJ A;  5EJW A;  1UEA B;  1YNN D;  5JJI A;  1AFP A;  2DNC A;  4DK3 C;  4LMQ D;  4A4I A;  3M4O B;  4OO1 H;  3K7U C;  3VA5 A;  5FO7 B;  5IYD G;  5C3E H;  2F0N A;  2PI2 E;  1ZEQ X;  1OO9 B;  2YU9 B;  2A6E C;  2B2W C;  2OQ0 A;  3I73 A;  5E3F A;  2HCC A;  1PYW D;  5DLQ E;  2WAQ B;  4HJ9 A;  1JWS D;  3NSW A;  3GV6 A;  1HNW L;  4BY7 B;  1JB7 A;  2IT1 A;  2Y0S G;  4EQO A;  1BNZ A;  3K5L A;  4XIG S;  1R9T H;  3AYH B;  1YJN A;  3FKI H;  4TSS A;  4A3F B;  2AQ3 B;  3KBG A;  1F9P A;  4EQN A;  4GNX B;  2JA5 G;  4A93 G;  1TR5 A;  2EY1 A;  2KBN A;  1Q86 C;  3OIP A;  2H1E A;  1A2T A;  3HRZ C;  2K50 A;  5EKI A;  4DK6 C;  4A3G G;  3K58 A;  3S9W A;  4RH6 A;  3OTO L;  4LF8 L;  2JA8 H;  1B2T A;  1CSP A;  3GTG H;  2PW7 A;  2QDL A;  4HMI A;  1QCB D;  2KJX A;  5M9O A;  2JYO A;  3CQZ B;  4DR5 Q;  1XTD A;  5FO9 B;  5HGQ A;  4RAU C;  3BYY B;  1EFW A;  1ASZ A;  2Q2T A;  3I4M H;  4R9W A;  4GKJ Q;  3HP3 A;  4XTC S;  1J6Q A;  2OEO A;  1TWG H;  5T1G A;  3I4O A;  4N8X 1;  4JYA L;  2LSS A;  1KXL A;  4A3D B;  1CHP D;  3HOU B;  4XDX A;  3GV3 A;  4FNF A;  4TKO B;  5JJK A;  4KN4 C;  1EQQ A;  1OXT A;  3H3V C;  1C48 A;  2K1B A;  4CBV A;  1IHZ A;  4RKL A;  5C4Z A;  3CCQ A;  1E1T A;  3QIA A;  2XNA C;  4I65 A;  1IBL L;  1TS5 A;  2VUM G;  2L55 A;  2K14 A;  4B3M L;  1WI5 A;  4B9X A;  1L1O C;  3C1E A;  3CCM A;  2YTV A;  1JQY D;  3D8G A;  1KC8 C;  3SR1 A;  1M4V A;  3S14 H;  2JA7 H;  1VQM A;  1N36 Q;  1EYA A;  2K5Q A;  2E2J H;  3E0J A;  1NCV A;  1G6P A;  5C44 B;  3BZK A;  3ND8 A;  5M3M B;  2KUM A;  3M85 A;  2E2H B;  4LFB Q;  1ZYR D;  4C1N K;  1TS4 A;  1FGU A;  5IGB A;  1FNV A;  3VR6 A;  3OMG A;  5M5X H;  3HOW G;  4DV7 Q;  4DAY A;  1F9Q A;  1Q8I A;  3K5O A;  1SFO H;  1HNX Q;  2HQL A;  1WTP A;  3OW7 A;  4OEL B;  2KED A;  2VL6 A;  3M4Q A;  2I5M X;  2RCF A;  1OXX K;  1B53 A;  2PQA B;  5BN5 A;  2AKW B;  2A74 C;  5NUC A;  4DNI A;  3PIO 3;  2NN6 I;  1U9R A;  1VS0 A;  1YJ9 A;  4QY7 A;  3CCE A;  4P75 A;  1IKL A;  1SN8 A;  1S5C D;  4DV5 Q;  3BVZ A;  2R93 B;  1A6X A;  4UPA A;  2WB1 E;  1PH5 A;  1TS2 A;  1G6Z A;  2BE5 D;  4PNY A;  5IYB H;  3PCO B;  4HAE A;  1GUN A;  5BR8 L;  1O80 A;  2BDN A;  3K7A H;  3NBI A;  4POF A;  1VQ9 A;  5KEE A;  2QF7 A;  4F87 A;  3OPO A;  2HIX A;  3HOV B;  1Q90 A;  3NWT A;  5FLX L;  1STA A;  1WTQ A;  2B29 A;  3CAM A;  1JR0 D;  1L0W A;  1MJC A;  5E4X A;  3FMC A;  3GTO H;  3CCL A;  4X66 Q;  4Y7N H;  1W2B A;  3NK9 A;  1KDC A;  3WDN A;  4DAV A;  1I94 Q;  1KDA A;  2UUB L;  3BYT B;  1G91 A;  4WJ3 M;  1EZ8 A;  1F2L A;  1I4X A;  2A68 C;  2CCZ A;  2CVR A;  1TWC B;  1PTO H;  4IAL A;  4DV4 Q;  1C0A A;  1XTC D;  2XRS D;  5K5P A;  3TZU A;  3RZO B;  3C2P A;  4K2K A;  4R8N A;  4B9W A;  2QDB A;  1ENC A;  2VB2 X;  4RMF A;  4FF1 A;  2GN5 A;  2HIV A;  1XYI A;  2PZU A;  3QO2 A;  5C4X G;  1GOZ A;  2R6G A;  4RGT A;  1RJT A;  5ELN A;  4JOI C;  4JCV E;  3G48 A;  1LAB A;  1CT1 D;  3RZD B;  1QIL A;  5COY A;  2JA6 H;  3G6J B;  1LT4 D;  1KRS A;  4QIW B;  3A8K E;  4BBS B;  4IJL A;  4O1N A;  3TP7 A;  2N88 A;  4GLX A;  1JE4 A;  4FO2 A;  2N3S A;  2F0G A;  3KLS X;  4KKS A;  2N49 A;  2UXD Q;  1QOH A;  1NY4 A;  3VR4 A;  3UDG A;  4LF7 Q;  4WRD A;  4L5Q A;  3Q6S A;  1SNQ A;  4G7Z C;  2VY3 A;  3J7Z C;  1H95 A;  1MGS A;  3AFP A;  2F0J A;  1EIF A;  3A0J A;  1D7Q A;  4YWL A;  4DR4 L;  1AN8 A;  5CMD A;  3HZX A;  1MSH A;  4JI6 Q;  4FXK C;  4NXM Q;  3QOJ A;  2PNR C;  1XMO Q;  2DN8 A;  4JI1 Q;  1HUM A;  3PV0 A;  4ABN A;  3QWN A;  3EA6 A;  1IBM Q;  1PH7 A;  3J81 E;  1VQ8 A;  3MTS A;  2NYZ D;  1Y1V B;  4QL5 A;  3HKS A;  5JVG 3;  5JEA J;  4C3J H;  1SNM A;  1VMC A;  1KAW A;  3HOX G;  1I6H B;  1LT6 D;  2DJG C;  2MNA A;  2AUJ D;  3E9H A;  3DUZ A;  3S16 B;  1EY5 A;  3PMF A;  2WIN B;  2Z9H A;  3VA7 A;  3A8J E;  3STB C;  2PCF B;  1WCM G;  5EAY A;  4CKC A;  3F2U A;  4MZ9 A;  1SMY C;  2SOB A;  1BBU A;  3KFU A;  3HOY H;  5CBE E;  3MHB A;  1E24 A;  1TWA H;  3ERO A;  3J7A F;  1JT8 A;  2VUM B;  4KD4 A;  2I5L X;  4CDC C;  1PFS A;  4IPD A;  1HNZ Q;  1UUP A;  4DR6 Q;  1JJG A;  1H9J A;  1CA6 A;  4A3B B;  4R4T A;  3CCJ A;  1VQO A;  2L11 A;  1NAP A;  1HTL D;  4UP8 A;  5FJ8 G;  2K75 A;  2PMZ E;  2BH8 A;  2IJ0 A;  2SNM A;  1HNW Q;  3D6C A;  3NE5 B;  1EY6 A;  3SXH A;  4DXF A;  3GTJ B;  1SAP A;  3GTP B;  1HR0 W;  2Y0S E;  3Q24 A;  2B8F A;  2J0T D;  4B3T L;  2B63 B;  1QJO A;  1E2W A;  1U4L A;  1I4Q A;  1JB3 A;  1VQI A;  2N78 A;  3S24 A;  3ZYY X;  2EYO A;  1TWF H;  2R7Z H;  1O7L A;  1BCP C;  1TY0 A;  1Q8K A;  2A6E D;  5G3L F;  4KK7 A;  4DV6 L;  3GO5 A;  1JIC A;  1PDQ A;  5FK9 C;  4X62 L;  1WTH A;  4LF8 Q;  2E2I B;  2NVT B;  3H94 A;  4MIU A;  4GNX A;  2DGY A;  4CKB A;  1FR3 A;  5IGC A;  4JI2 L;  1WTX A;  2YTY A;  3MFG A;  3M4O H;  1SMX A;  4LUO A;  1JWU D;  1BUV T;  3NTH A;  1GUS A;  1II3 A;  2AQ1 B;  2AWO A;  2YU9 H;  4KHP L;  4ZLT F;  4J1M A;  1IW7 D;  2E75 C;  1PH2 A;  4WJ4 A;  1BXT A;  1PMR A;  1EWI A;  2VZA A;  1D5M C;  1N33 Q;  1LT3 D;  5ELC A;  4BY7 H;  3OMC A;  4ZUJ A;  4N8F A;  5J1Z A;  3HOY G;  3RD4 A;  2K03 A;  3PO3 G;  3KF6 B;  5JPM C;  3B6Y A;  4PQX A;  2K5H A;  1LTB D;  1WTR A;  4B3M Q;  3A7A B;  3NEM A;  2F52 A;  3D0F A;  2LS0 1;  4QJF A;  1I4H A;  4DV2 L;  1LYL A;  4KY5 A;  4A3K B;  4RKB A;  3MXG A;  1LM0 A;  2ZXR A;  2XWJ B;  5IGD A;  1O7Z A;  2AUK A;  1N9W A;  4DR3 Q;  1Y8N B;  4YWK A;  3LGJ A;  4ZKB B;  2G5D A;  1VQ4 A;  1N8R C;  2KHJ A;  1UE1 A;  4BBR H;  1YHB A;  1S5B D;  1Y1W H;  3K57 A;  1D8L A;  4QUF A;  1S5D D;  4RA8 A;  1XMQ L;  2D0O A;  4OWX B;  2Z6K C;  1SRO A;  2Z0S A; 
#chains in the Genus database with same CATH homology
 4JI6 L;  3AFQ A;  1OXV A;  2Q2U A;  1XMO L;  4A3L H;  4JI1 L;  3RNU A;  2V1C C;  3GTK H;  2WAQ E;  4AIM A;  4A3G H;  4QQB X;  2VQF L;  4DAY B;  3FP9 A;  3RR5 A;  1IBM L;  2VQE Q;  1L1O A;  3RLO A;  1VQ5 A;  3CMA A;  1K8G A;  2ZM6 L;  2PQA A;  4DR3 L;  4LF9 L;  2B63 G;  3F2C A;  5IYC H;  1XNQ L;  3H0G G;  3TS2 A;  5C4X H;  1SE8 A;  1X65 A;  1YHA A;  1YIJ A;  2UUA L;  1B8A A;  3F8T A;  3UDI A;  3M7N A;  1C9O A;  3I2Z A;  2AWN A;  4DR1 Q;  2JQO A;  2YTX A;  4A3J G;  3VDY A;  1PVO A;  1PA6 A;  3CP0 A;  1NJI C;  1YEZ A;  1QVG A;  5IP9 H;  3ERS X;  4A3D H;  4IOC A;  3HFZ B;  5IY0 A;  2A1A A;  2UU9 L;  2GVB A;  1NTG A;  2KCT A;  2N8N A;  1A63 A;  4LFA L;  4PMW A;  5C44 H;  5M5W H;  5FLX c;  3L7Z C;  4IO9 A;  1E7Z A;  4GN5 A;  1KD1 C;  5LMN W;  5M3M H;  2E2H H;  3K0X A;  3J80 c;  3U4V A;  3W5O A;  1PH6 A;  3CPW A;  3NEL A;  3UDX A;  4A3I G;  2JA6 G;  1PH9 A;  1M1K C;  2R92 G;  3H3V I;  1Q1B A;  2GVA A;  2ZTE A;  3S15 H;  2I0Q A;  4LUV A;  3G6E A;  3PF5 A;  2QGQ A;  2YYZ A;  1PYB A;  4AH6 A;  2DUD A;  5H1S E;  1O7I A;  2A8V A;  1PH4 A;  5LMU Q;  5JJI A;  4DK3 C;  4A4I A;  3G71 A;  3K7U C;  1W3S A;  4GKK Q;  1PH1 A;  4JBK A;  4HIM A;  2XGT A;  1IZ6 A;  5IYD G;  5C3E H;  4P73 A;  1X3F A;  2PI2 E;  4L5T A;  3OW2 A;  3I4N G;  3J7A 5;  2OQ0 A;  3E9I A;  1N34 Q;  3KLW A;  3M3Y H;  5DLQ E;  4JBW A;  3J81 c;  2JK8 A;  4HJ9 A;  3OTO Q;  4OX9 L;  2R93 H;  1S3O A;  1HNW L;  1VQ6 A;  4YCU A;  1V1Q A;  4UP9 A;  1JB7 A;  2IT1 A;  2Y0S G;  1T9H A;  4AYB G;  5LMN Q;  2JA9 A;  4OWW B;  4XIG S;  1R9T H;  4LWC A;  5C0X G;  3HOX H;  3TQY A;  3AYH B;  5IT9 c;  3RLN A;  5LMU L;  2LXK A;  3FKI H;  1YJN A;  3PUW A;  1EQR A;  3W1B A;  2XTI A;  1SR3 A;  4BBR G;  1AE3 A;  2MFI A;  1S72 A;  4JYA Q;  1MIU A;  1WCM H;  1FVI A;  4GNX B;  3CCS A;  4BA1 I;  3UE1 A;  1LUZ A;  4DV3 L;  2JA5 G;  3HOV H;  4A3K G;  4A93 G;  5IWA L;  2KBN A;  4DR2 L;  1Q86 C;  1PH3 A;  1SRU A;  1K9M C;  2K50 A;  2Q2H A;  4DK6 C;  4A3L G;  4YY3 Q;  4LF5 L;  2CFM A;  4A3G G;  4IPG A;  3OTO L;  4GOP B;  2E5L L;  4JI3 Q;  4DUY L;  4LF8 L;  2JA8 H;  1CSP A;  4X64 L;  3GTG H;  3GTM H;  1X9N A;  4JV5 Q;  1IBL Q;  4J15 A;  1I5F A;  5M3F H;  1B70 B;  5LMN L;  1UWV A;  4UP7 A;  4DV1 L;  4DR5 Q;  2HHH Q;  4A3F H;  4LF4 Q;  1XTD A;  5IYC G;  3RLF A;  5HGQ A;  1N32 L;  1EFW A;  1EYG A;  2EXD A;  1ASZ A;  2Q2T A;  3I4M H;  1VQN A;  4GKJ Q;  4XTC S;  1J6Q A;  1TWG H;  5FJ8 H;  4X65 Q;  3PIO A;  1L2F A;  2MO0 A;  1HR0 L;  5ELO A;  4JI8 L;  3I4O A;  1KQS A;  2LSS A;  3K81 C;  3SGI A;  4JYA L;  1KXL A;  4C2M H;  5IP9 G;  1K3R A;  1C7Y A;  1ASY A;  4IPC A;  4IFD J;  2OTJ A;  4PZ6 A;  2CWA A;  1J5E L;  1YIT A;  3J81 j;  3T1H Q;  2KHI A;  1I3Q H;  2ID0 A;  5JJK A;  1S40 A;  3F2B A;  1EQQ A;  1OXT A;  5IP7 H;  3KF8 B;  1X3E A;  1JE5 A;  1X54 A;  3PF4 A;  1PHJ A;  3CQZ H;  4JOI A;  1MKH A;  1TXY A;  1CUK A;  3CC7 A;  4LF6 L;  3CCQ A;  1E1T A;  2VS1 A;  1OXU A;  3E0E A;  4R1J A;  3KOJ A;  3PUX A;  1IBL L;  2VUM G;  5GRO A;  1Z47 A;  5FLM G;  4DR5 L;  1CSQ A;  1AE2 A;  2K14 A;  2R7F A;  3UE0 A;  5AJ3 Q;  2NZO A;  1CKN A;  2OQK A;  1WI5 A;  4B3M L;  1L1O C;  2IHF A;  3PO2 G;  3CCM A;  3RZD H;  4DUZ Q;  4DV0 L;  2YTV A;  3TRE A;  1IYJ B;  1LTL A;  2R7Z G;  3HOU H;  3EN2 A;  4K0K Q;  1KC8 C;  3HKZ E;  3CD6 A;  3S14 H;  4BBS H;  1Q82 C;  1XPU A;  1VQM A;  1N36 Q;  2JA7 H;  2K5V A;  2ES2 A;  1HZ9 A;  4DPG A;  2E2J H;  3CCV A;  1BKB A;  1G6P A;  4BXX G;  1WFQ A;  3BZK A;  5C0X I;  1OTC A;  4JI4 Q;  3M85 A;  4LFB Q;  3S17 H;  4B3S L;  3BZC A;  4JI5 L;  4DAM A;  1K8A C;  2H5X A;  1FGU A;  4GLV B;  2D0P A;  3CC2 A;  4BY1 G;  4FDB A;  5M5X H;  1PH8 A;  2A19 A;  3HOW G;  1Q46 A;  4DV7 Q;  3CCU A;  4H02 A;  1CKM A;  3PUZ A;  1SFO H;  1HNX Q;  1VQL A;  2HQL A;  2I5H A;  3FHW A;  1WJJ A;  5BR8 Q;  3I56 A;  2VL6 A;  3M4Q A;  3KDF A;  4LFC L;  3CME A;  2I5M X;  4GLA C;  3KJP A;  4DUZ L;  4HJ5 A;  4JI0 L;  1OXX K;  2NVX H;  4R4I A;  3Q8D A;  1G29 1;  2PQA B;  3ER0 A;  4JI7 Q;  3K8A A;  2UUC L;  4ALP A;  2HT1 A;  2AKW B;  4DNI A;  1N36 L;  2WAQ G;  2NN6 I;  2JJQ A;  1YNX A;  1VS0 A;  3JAM c;  1YHQ A;  3PO3 H;  2IHE A;  4QY7 A;  1YJ9 A;  3CCE A;  4P75 A;  4JI4 L;  1VQD A;  4BY7 G;  1SN8 A;  3G4S A;  4B3T Q;  2JEB I;  4LFB L;  4AQY Q;  4DV5 Q;  1WOC A;  2D62 A;  4GN4 B;  4YCV A;  3H3V H;  1GD7 A;  2K5N A;  2IX0 A;  4TQU S;  4UPA A;  2R7D A;  2WB1 E;  5HY6 A;  2VQE L;  1PH5 A;  1I6H H;  1JJC B;  4OON A;  5C4J H;  4PZ8 A;  4APV A;  2CQO A;  4DV7 L;  4A3F G;  1QVF A;  2BA1 A;  5IYB H;  1HNX L;  1UE5 A;  4DR1 L;  3PCO B;  2UUB Q;  1VQF A;  5BR8 L;  2B3G A;  1XJV A;  4POF A;  3K7A H;  3T1Y Q;  1VQ9 A;  2AHO B;  4DV6 Q;  4X62 Q;  3AQQ A;  2HIX A;  1Y14 B;  2JE6 I;  1A0I A;  4QIW E;  2LXJ A;  1VQK A;  1YVC A;  2F3I A;  2ALY B;  3HOZ G;  4A3M G;  4L5S A;  3IRB A;  2MQH A;  2UXB Q;  4JC0 A;  4JI2 Q;  3KJO A;  5IP7 G;  2ATW A;  2B29 A;  3CAM A;  4AQY L;  3D31 A;  1L0W A;  1MJC A;  1V9P A;  4A3C G;  3GTO H;  3NBH B;  1HZC A;  3PUV A;  3CCL A;  1VQB A;  4EQ5 A;  4X66 Q;  4Y7N H;  3BJU A;  1W2B A;  4KHP Q;  3ULL A;  4DR7 Q;  1I94 Q;  2UXC Q;  1Y1W G;  4GKK L;  2UUB L;  4LW1 A;  3W1G A;  3T1Y L;  3S1R H;  4A3E G;  4NXN Q;  3HOU G;  4WJ3 M;  1UE7 A;  3MEF A;  1IL2 A;  2CCZ A;  1E3P A;  1NBW A;  1N34 L;  3PSI A;  2C35 B;  1UE6 A;  3GTJ H;  3U58 A;  3GTP H;  1FJG Q;  2CKZ B;  2K4K A;  5GQO A;  4IJH A;  4DV4 Q;  1OXS C;  2B63 H;  3CPF A;  1EIY B;  3S2D H;  4HJ8 A;  3H0G H;  2UXB L;  1C0A A;  4R4Q A;  1JMC A;  5M5Y H;  3BU2 A;  1Q81 C;  1VQA A;  4RMF A;  1VQP A;  2NN6 G;  1NMF A;  2GN5 A;  4QGU A;  2HIV A;  4OXP A;  1E22 A;  4DR4 Q;  5C4X G;  2Q2I A;  5ELN A;  2R6G A;  4BA2 I;  4IFD G;  3KF6 A;  4C3I H;  4JOI C;  4JCV E;  4DR7 L;  3G48 A;  1XPO A;  1EOV A;  1EUJ A;  1GO3 E;  1QUQ A;  1FL0 A;  4A3I H;  2JA6 H;  4C3H H;  1KRS A;  2EIF A;  5C44 G;  1TWH H;  1TWC H;  2VW9 A;  4IJL A;  5M3M G;  3TRZ A;  3RZO H;  4GLX A;  2N3S A;  1PYS B;  3JC6 6;  2UXD Q;  2N49 A;  4YY3 L;  1NY4 A;  4LF7 Q;  5GAD C;  4JI3 L;  3UDG A;  3EBE A;  2WP8 J;  4L5Q A;  4MTN A;  3ULP A;  1XNR Q;  4JV5 L;  2ASB A;  2VY3 A;  1P8L A;  3J7Z C;  1H95 A;  3AFP A;  4LF4 L;  2HHH L;  5IYD H;  1EIF A;  3A0J A;  4ME3 A;  3CCR A;  1D7Q A;  5IE8 A;  1VCI A;  1IXR A;  4YWL A;  4DR4 L;  4OO1 G;  2RHS B;  4POG A;  4JI6 Q;  1P16 A;  4GKJ L;  1AH9 A;  1X55 A;  4NXM Q;  4X65 L;  1XMO Q;  2CWP A;  4JI1 Q;  5C3E G;  1NMG A;  4YWM A;  3PV0 A;  2RF4 A;  2OTL A;  2VQF Q;  1X3G A;  1Z9F A;  2YV5 A;  1E1O A;  1IBM Q;  4RG1 A;  2F4V Q;  3T1H L;  4NB3 A;  2ZM6 Q;  1PH7 A;  1VQ8 A;  1JJ2 A;  4LF9 Q;  1U5K A;  4QL5 A;  2R93 G;  3HKS A;  2UXD L;  5JEA J;  1QVC A;  1YZ6 A;  4C3J H;  1GM5 A;  3S1Q H;  1QZH A;  3PUY A;  1K0R A;  3TS0 A;  2KCM A;  4IPH A;  2BH2 A;  4LNQ A;  1KAW A;  3HOX G;  1HH2 P;  5J3B A;  4UY8 C;  1HZB A;  3PGZ A;  2MNA A;  2JA5 H;  4A93 H;  3FKI G;  3E9H A;  5AJ3 L;  3ULJ A;  4A76 A;  4A3K H;  4LFA Q;  3EIV A;  3STB C;  3HKZ G;  2ZJR A;  1K73 C;  4K0K L;  1WCM G;  1VQE A;  1L1O B;  3DM3 A;  5EAY A;  3STB D;  3UDF A;  4NXM L;  4EX5 A;  4PG3 A;  3HOV G;  4MZ9 A;  1BBU A;  4R4C A;  3OYY A;  3KFU A;  3HOY H;  1Y1V H;  2F4V L;  2JEA I;  1E24 A;  3F2D A;  1TWA H;  4OWT B;  4P74 A;  3J81 i;  4JBM A;  3KDF B;  2JA8 G;  4IFD I;  1JT8 A;  2I5L X;  2Z6K A;  1PFS A;  4IPD A;  2QA4 A;  1HNZ Q;  1VQG A;  5M3F G;  4DR6 Q;  4Y52 H;  1JJG A;  4IOA A;  3M4P A;  3S16 H;  3PIP A;  2NZH A;  4R4T A;  3CCJ A;  1VQO A;  3I4M G;  1UEB A;  1VQH A;  3K80 C;  4X6A H;  4UP8 A;  5FJ8 G;  1IBK Q;  3MXN B;  5GAG C;  2PMZ E;  2K75 A;  2BH8 A;  1GVP A;  2RCN A;  4OX9 Q;  1U0L A;  2FXQ A;  4JI7 L;  1HNW Q;  4O2D A;  1KIX A;  2NVQ H;  1YI2 A;  4HIK A;  4TVA B;  3S2H H;  1HR0 W;  2VUM H;  2Y0S E;  3U50 C;  5FLM H;  4B3T L;  4AYB E;  2WB1 G;  4OO1 I;  1VQI A;  4DV5 L;  2N78 A;  4L5R C;  2OCE A;  3S24 A;  3PO2 H;  3F1Z A;  4GNX C;  3KYH C;  1HNZ L;  4A3B H;  5E7N A;  2R7Z H;  1I50 H;  1TWF H;  1X56 A;  3A74 A;  3A5U A;  4DV3 Q;  4A75 A;  1YJW A;  2IX1 A;  4DR6 L;  4NPS A;  2VNU D;  1CKO A;  1Q8K A;  3L0O A;  5IWA Q;  4DR2 Q;  3GD7 A;  2QEX A;  1A62 A;  1HJP A;  3DLL A;  3WWV A;  2ZTD A;  4A3D G;  4GOP C;  4BXX H;  5JJL A;  1IBK L;  4DV6 L;  2E8G A;  3GO5 A;  3I7F A;  4X62 L;  1XPR A;  4LF5 Q;  2EQS A;  3AEV A;  2E5L Q;  4LF8 Q;  4BBS G;  4DUY Q;  2BA0 A;  2JA7 G;  4KHZ A;  4X64 Q;  3CC4 A;  5GAH C;  4GNX A;  4BY1 H;  1VQJ A;  4DV1 Q;  1VQC A;  2DGY A;  3HOW H;  2L15 A;  4JI2 L;  2YTY A;  1Q12 A;  4HJA A;  4HIO A;  1SMX A;  2WFW A;  1RIP A;  4LUO A;  3M4O H;  1A8V A;  1N32 Q;  1K83 H;  4PZ7 A;  4KLK A;  3I55 A;  4A3J H;  4GOP A;  1WYD A;  4B3R Q;  1KL9 A;  5C0X J;  1HR0 Q;  4JI8 Q;  1PV4 A;  2MO1 A;  1G51 A;  4DV2 Q;  2AWO A;  4X66 L;  2YU9 H;  4KHP L;  4YCW A;  1X6O A;  1PH2 A;  1J5E Q;  1I94 L;  4WJ4 A;  1NE3 A;  2VZA A;  2UXC L;  1EWI A;  4JBJ A;  3L2P A;  3CXC A;  1N33 Q;  2E2I H;  1KHI A;  3GTQ H;  2NVT H;  4NXN L;  2R92 H;  4BY7 H;  4DKA C;  4JG2 A;  4GS3 A;  4O0A A;  2PI2 A;  4LF6 Q;  2AMC B;  3HOY G;  3GTL H;  1Y1V G;  5GAE C;  2OWO A;  1FJG L;  3PO3 G;  3KF6 B;  3A5Z B;  4DV4 L;  1SLJ A;  3B6Y A;  1B7Y B;  2K5H A;  2K52 A;  4B3M Q;  2IY5 B;  1DGS A;  2F52 A;  3NEM A;  1QUQ B;  3D0F A;  4DV0 Q;  1M90 C;  4B3R L;  1XMQ Q;  4LUZ A;  4YHH Q;  2RHQ B;  3CF5 A;  4QJF A;  1MJE A;  5IYB G;  4DV2 L;  3I4N H;  3U4Z A;  3RN5 A;  4R4O A;  1LYL A;  3S1N H;  3CW2 C;  2KEN A;  2ZTC A;  4MNO A;  2ZJP A;  3RN2 A;  3HOZ H;  4A3M H;  3ZJY C;  3GDE A;  3H15 A;  1LM0 A;  3NEN A;  4GN3 B;  1N33 L;  4B3S Q;  1QZG A;  5K36 G;  5JEA G;  4JI5 Q;  3M9B A;  2NVY H;  1N9W A;  4DR3 Q;  1KRT A;  4YWK A;  2ZJQ A;  1CKN B;  1XNQ Q;  4A3C H;  1VQ7 A;  3LGJ A;  3J80 i;  2UUA Q;  4P71 A;  3JAM i;  4LF7 L;  1VQ4 A;  1N8R C;  1GKH A;  1Q1E A;  1UE1 A;  1YBY A;  2KHJ A;  4KI0 A;  1XNR L;  3TEH B;  4BBR H;  1YHB A;  1HZA A;  1V43 A;  1BBW A;  1Y1W H;  1D8L A;  4LFC Q;  4P72 A;  1BVS A;  4A3B G;  4JI0 Q;  2PNH A;  2UU9 Q;  4HJ7 A;  4A3E H;  1XMQ L;  1Q7Y C;  4YHH L;  2D0O A;  3S1M H;  4HID A;  1RL2 A;  2UUC Q;  4OWX B;  2Z6K C;  1SRO A;  2Z0S A;  3ICE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...