4L5SA

P202 hin1 in complex with 12-mer dsdna
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
199
structure length
199
Chain Sequence
STPKKNISKGAVLHEKPMTVMVLTATEPFNYKEGKENMFHATVATESKYYRVKVFNMDLKEKFTENQFITISKYFNSSGILEINETATVSEAAPNQMFEVPKNIIRSAKETLKISKIKELDSGTLIYGVFAVEKKKVNDKSITFKIKDNEDNIKVVWDKEQHNINYEKGDKLQLFSFHLRKGNGKPILHSGNHSFIKGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular Mechanism for p202-Mediated Specific Inhibition of AIM2 Inflammasome Activation.
pubmed doi rcsb
source organism Mus musculus
molecule tags Dna binding protein/dna
molecule keywords Interferon-activable protein 202
total genus 36
structure length 199
sequence length 199
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02760 HIN HIN-200/IF120x domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4l5sA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4l5sA01
1YEZA 1IBLQ 3J81j 4ME3A 5LMUQ 1I50H 2HQLA 2OWOA 3CCRA 1A63A 4DV0Q 5GAHC 4DV2Q 1QZHA 4LF6Q 2A8VA 1XNRQ 4B3RL 1EFWA 1EUJA 2IX1A 4A3IH 4A3KH 4BY1H 3KF6B 1JJGA 2K50A 1SRUA 2KBNA 4R4TA 4YY3L 4L5RC 4JBMA 3A5UA 4B3RQ 2CFMA 4KHPL 1N8RC 3G6EA 5FLXc 3A5ZB 1KC8C 3CCUA 5ELNA 1HNWL 4A3IG 3RLOA 4JI7Q 4HIOA 3JC66 2ES2A 1VQLA 4LUZA 4YWLA 3J80i 1YI2A 2NVXH 3UDFA 4B3TQ 2XGTA 4GN3B 1Q8KA 1JE5A 1FGUA 5EAYA 4HJ5A 1S72A 1IL2A 4JI7L 1Y1WG 1EIYB 2MO1A 3GTKH 2GVAA 4A3MG 4X65Q 1PFSA 4NB3A 5C3EH 3F2BA 4JG2A 2E2JH 3L7ZC 3M9BA 3HOVG 3F2DA 1VQKA 4YWKA 1N36L 2UU9Q 4MTNA 1WOCA 4EX5A 2N49A 1SR3A 4DV7L 4K0KL 4JBKA 3AQQA 4MZ9A 5IP7H 4DNIA 4A3GH 2JA6H 4DV7Q 1X3EA 4AYBG 5IT9c 2NZOA 4YCWA 3KYHC 2JK8A 1YJWA 1YHQA 3I4NG 4A3FG 5IP7G 5LMNQ 1E1OA 1U0LA 2DGYA 4RG1A 3L2PA 1WCMG 3CMEA 4LF7Q 4UY8C 4IO9A 4P75A 5IY0A 4R4OA 4DV4Q 4OWTB 4IPDA 5M5YH 1SFOH 1H95A 4JI2L 1L2FA 2Y0SG 2E2HH 3D31A 2KHJA 5GADC 2LXKA 2ZM6Q 1WCMH 4APVA 1E24A 4DR5L 3STBD 4NXML 2Q2IA 1VQ6A 2PI2E 1MJCA 2Q2HA 3ULLA 3PIPA 3OW2A 4GKKL 4GNXC 3RZDH 1B8AA 1WI5A 1CKNB 2JA7G 4WJ3M 2VS1A 5GROA 5IYBH 1YBYA 3K80C 4JI1L 1VQFA 2KENA 2JA8G 4DUYQ 5GAEC 1YZ6A 4DUZL 1VQMA 2UXBQ 4JI0Q 1OXXK 1TWAH 4DR2Q 2R92H 1OXUA 4OWXB 5C4XH 4DR4L 4BBSG 2PQAA 4LFAQ 1A62A 5IYCG 3HOZG 4JI6Q 3KDFB 4DR4Q 1SN8A 3A0JA 3RN2A 2YYZA 1MJEA 1I94Q 4BBSH 3FHWA 3ULPA 3HOVH 4OO1I 1DGSA 2YU9H 2VQEQ 5IYCH 3H3VH 4HJ9A 2D0OA 4UP9A 2JA5H 2B63G 1X55A 4GOPC 1EQQA 3PV0A 1E7ZA 3M4PA 1UE5A 1NY4A 1IYJB 4AQYL 4PZ7A 4A76A 2FXQA 4P72A 3ULJA 1HJPA 1KRTA 1LYLA 2EIFA 2ZTDA 3A74A 5HY6A 1XNQL 3PF4A 2NVTH 3W1GA 3KDFA 2PI2A 3CCVA 4DV1Q 2QEXA 5AJ3Q 1GVPA 4DR1Q 3AEVA 1YVCA 1NJIC 3GTMH 1EIFA 4JI2Q 3Q8DA 4GLVB 3D0FA 4X6AH 1VQAA 1Y1VG 2HT1A 3GTLH 4A93G 3ERSX 1HH2P 1AE2A 3ICEA 1LTLA 2DUDA 4XIGS 3TRZA 4DR7Q 2WB1E 3I4OA 3LGJA 1CKNA 1I6HH 3G4SA 1R9TH 1VQEA 1GKHA 3H0GH 4TVAB 4DV3Q 2ASBA 1HZAA 5J3BA 1N34Q 3AFQA 5IWAL 1EWIA 3K7UC 2UUBL 3E0EA 4LFCL 1VQJA 1VQCA 3B6YA 1UE7A 1L1OB 1E22A 3MXNB 3PUZA 3U58A 2HIXA 3NBHB 3E9HA 5FJ8G 2VQEL 3S1NH 1Z47A 1IBKL 3E9IA 1PH3A 4LF9Q 4BY7H 3S14H 3HKZE 5LMNW 3CCLA 4JI4L 1Q81C 1VQPA 3GTGH 1I5FA 4LWCA 1Q86C 3S1RH 2VUMH 3M7NA 3KJOA 3RZOH 1QZGA 1AH9A 1WYDA 3F2CA 1XNQQ 1GM5A 1Q46A 4JI4Q 1XPUA 5ELOA 5C44H 1UWVA 4IOCA 3K7AH 1X9NA 4DUZQ 4HIMA 2JA5G 4IPCA 2LSSA 3BZCA 1K8AC 2UUAQ 3NELA 4KHPQ 2UXCQ 5M5WH 3U4ZA 2OQKA 4GKKQ 5HGQA 1FJGL 3UE0A 4HJ7A 3T1YQ 4A3EG 5IYDG 4DV2L 1WJJA 1A0IA 2AWNA 3TEHB 2Q2TA 1IXRA 1Q12A 3RLFA 2JJQA 4IFDG 4B3SL 2NVQH 4UP8A 1UE6A 4LF8L 1EQRA 3G48A 5C4JH 4A3EH 4BBRG 1IBMQ 2WP8J 1HNWQ 2RCNA 1Y1VH 4LF4Q 4AIMA 3CQZH 3K8AA 2YTVA 4C2MH 2XTIA 1PH4A 3S2DH 4JI6L 4UPAA 2CKZB 4LF5L 1OTCA 1J5EQ 4P71A 1V9PA 5GAGC 1N34L 2UUBQ 2UXDL 1HZ9A 5H1SE 2WAQE 1VS0A 4L5SA 4O0AA 3CCMA 1OXVA 4OO1G 3GTJH 3K81C 1HR0Q 3JAMi 5M3FH 3PUYA 2UXDQ 4KI0A 2HHHQ 2K75A 3FKIH 4K0KQ 2IHEA 1NMGA 5FLMG 3VDYA 4DR6L 2F52A 4DV6L 3SGIA 4DV4L 2I0QA 2R7FA 4YHHL 4DV0L 4LF6L 5IYDH 3NEMA 1JJCB 3I2ZA 1XMOQ 5JJIA 1UEBA 1JB7A 3H15A 4BA2I 4JI8Q 3NENA 3S15H 1P16A 5C44G 3S17H 1KD1C 3PSIA 4JV5L 1XMQL 1KAWA 3UDXA 4QY7A 1VCIA 2UUCQ 4OWWB 2F4VL 1VQ5A 3CC7A 3BZKA 2YV5A 1CUKA 1X54A 1X3FA 4J15A 1K9MC 4HIDA 3PO3H 1NTGA 3IRBA 2H5XA 5IE8A 4X65L 2QA4A 1Q82C 1KIXA 3GTQH 3FP9A 3I7FA 4QL5A 3W5OA 2ZJQA 3OYYA 4GKJQ 2NVYH 3G71A 3CC4A 4EQ5A 2RF4A 4JYAQ 1QVCA 1CKMA 4DAMA 1NE3A 4P73A 4DR3L 2R93G 1L1OA 1E3PA 2N8NA 1M1KC 4WJ4A 1VQ4A 1CSQA 3DM3A 5C3EG 2R93H 1J6QA 4JOIC 3PO2G 1B7YB 4L5QA 1JJ2A 3H3VI 1CKOA 3U50C 1HR0L 2VZAA 5LMUL 1QVFA 1N32Q 3HKZG 5BR8Q 4JC0A 4JI8L 3FKIG 1L0WA 1YJ9A 5FLMH 2JA6G 1EOVA 4YY3Q 1YJNA 4DAYB 1EYGA 2BH8A 4IPHA 3CF5A 1RIPA 4R1JA 3CW2C 2E5LL 1HNZQ 5K36G 3I4MG 4X62L 3UDGA 3I56A 3HFZB 4X64L 4X66L 1WFQA 3KLWA 2KCTA 1PH2A 4JI5L 4HJ8A 2IHFA 1NMFA 4Y52H 2AKWB 3PF5A 4X64Q 3BJUA 3PGZA 5JJKA 2A19A 4P74A 1G6PA 1W3SA 3OTOQ 1HNXQ 2OTJA 1SROA 2ID0A 4PG3A 3CCQA 4FDBA 4MNOA 1KRSA 3PCOB 2JA7H 1G51A 1IZ6A 3CD6A 2IY5B 4LF4L 1I94L 2L15A 1V1QA 1VQHA 5IP9G 1VQ8A 1NBWA 2I5LX 2RHSB 3KF6A 4A3KG 1PVOA 2PNHA 1TXYA 2B3GA 4A3MH 1PH7A 3HOWG 5JJLA 4DR5Q 4LFAL 4GN4B 1Q1EA 4OX9Q 4IPGA 2MO0A 3STBC 3CP0A 3RN5A 2GN5A 4POFA 2VW9A 4R4QA 3CPFA 2LXJA 4JI1Q 3ER0A 2K14A 1E1TA 5IWAQ 2OTLA 5BR8L 1KXLA 2F4VQ 2E2IH 2EXDA 4IFDJ 2F3IA 4A3FH 4DV5L 4TQUS 4LUOA 1PH9A 1XTDA 2Z6KA 4KLKA 4QJFA 1W2BA 4R4IA 2BA1A 3U4VA 1YITA 1X56A 1VQ7A 1CSPA 1VQDA 2K5VA 1ASZA 3F8TA 2UUCL 4POGA 1QVGA 2IT1A 3PUXA 3HOXG 1TWHH 3JAMc 4DV6Q 4HIKA 3TS2A 2YTXA 1K3RA 2CWPA 4GNXB 3CXCA 1XMOL 5IYBG 3J7A5 3HOXH 4PZ8A 4LUVA 4HJAA 4LF9L 4DK6C 1TWGH 1K0RA 2V1CC 4BY1G 4YCUA 1YHBA 3CCSA 4AYBE 4A3JG 4B3MQ 3K0XA 3M3YH 5C4XG 4XTCS 2MQHA 2K52A 2Z0SA 5IP9H 2R6GA 1K83H 3CCJA 2WAQG 4AH6A 3HOWH 2MNAA 2D62A 1X65A 2JE6I 3TS0A 1FVIA 4BY7G 3J81i 2ZM6L 3T1HL 2AMCB 4JBJA 2N78A 2R7ZH 4JI0L 2JEBI 1LUZA 4DR2L 3EBEA 1Z9FA 3AYHB 1PYBA 3HOUG 3HOZH 2VNUD 2WB1G 2R7ZG 1PV4A 2NN6G 2GVBA 4C3IH 2E8GA 4QGUA 3GDEA 1GO3E 4PZ6A 2OQ0A 4JV5Q 3HOUH 2KCMA 3T1YL 4NXMQ 3KFUA 3L0OA 1N33Q 2KHIA 2ZTEA 4JOIA 4JI5Q 1VQBA 2CQOA 1J5EL 3RLNA 5GQOA 4A3BG 2OCEA 2ZTCA 1HZCA 4JBWA 4NXNL 3PO2H 2C35B 2BA0A 1KHIA 2PQAB 2K5HA 2ALYB 1SE8A 3M4QA 4DUYL 3H0GG 5AJ3L 1TWFH 4DR1L 1VQIA 1XJVA 4JYAL 1QUQA 3J7ZC 4LFBL 5M5XH 3J80c 1N32L 4AQYQ 2B29A 2K5NA 4A93H 3EIVA 1VQOA 5DLQE 3S24A 5FJ8H 3F1ZA 4A3JH 4QIWE 1C7YA 2WFWA 1VQ9A 4DR7L 3HOYH 2Q2UA 2N3SA 5E7NA 2JA8H 1YIJA 3PIOA 3CC2A 1A8VA 4BXXG 3HKSA 2CWAA 3AFPA 3RR5A 1QUQB 2R92G 3PUWA 5C0XG 5LMNL 3S1MH 1GD7A 4B3SQ 3WWVA 3S2HH 1AE3A 4A3LG 1S3OA 4GS3A 2YTYA 1Q1BA 4YWMA 4B3TL 2VY3A 4DV5Q 3M85A 1P8LA 4A4IA 4DPGA 1FJGQ 4A3DG 3GO5A 4A3LH 1VQGA 1C0AA 2A1AA 2VUMG 4DR6Q 1S40A 4C3JH 2B63H 1V43A 3CPWA 4LFCQ 4R4CA 4A3DH 2EQSA 4L5TA 2K4KA 3PO3G 1IBLL 1UE1A 4GOPA 1PH6A 1BBUA 1MKHA 4OX9L 1OXTA 2ATWA 4A75A 4OXPA 1KL9A 4OONA 5JEAG 1XPOA 1BKBA 4X66Q 4ALPA 3S1QH 2JA9A 4LF7L 3CMAA 4RMFA 2D0PA 1PH1A 2Z6KC 1XPRA 3EN2A 4O2DA 4BBRH 4DV1L 4LF8Q 5JEAJ 5M3MH 1B70B 2I5MX 3TREA 1PYSB 3OTOL 1HNXL 1D7QA 4DV3L 1Y14B 1SMXA 2UXBL 4C3HH 1D8LA 1Q7YC 1PA6A 1I3QH 3HOYG 5M3MG 4LW1A 1M90C 3MEFA 3DLLA 2UU9L 1JT8A 3ZJYC 1ASYA 1SLJA 1HR0W 4BXXH 2BH2A 4GOPB 1XNRL 4KHZA 3UDIA 5M3FG 1HNZL 4LNQA 1RL2A 3W1BA 4Y7NH 1K73C 1VQNA 4BA1I 1BVSA 2ZJRA 1U5KA 2HIVA 1IBKQ 1N33L 4PMWA 3I4MH 4JI3L 4B3ML 1O7IA 3CCEA 2Y0SE 2UUAL 1T9HA 3GTPH 1OXSC 2JEAI 3RNUA 4IFDI 4IJLA 4GLXA 2UXCL 4A3CG 1PH5A 2CCZA 1XMQQ 4JI3Q 3GD7A 5C0XI 1FL0A 3KOJA 1JMCA 1HZBA 3CAMA 4IJHA 4UP7A 3J81c 3T1HQ 5C0XJ 1YNXA 4A3CH 2QGQA 4LFBQ 3BU2A 2NZHA 1X3GA 2VQFL 3M4OH 3PUVA 4X62Q 4A3BH 4QQBX 4GNXA 4DK3C 1Y1WH 2E5LQ 1MIUA 4NXNQ 2PMZE 4NPSA 4DKAC 2VQFQ 1YHAA 4DR3Q 1KQSA 2AHOB 1PHJA 2JQOA 2MFIA 3I55A 4JCVE 3S16H 3UE1A 2I5HA 4YCVA 4A3GG 4GLAC 4GN5A 1X6OA 1C9OA 4LF5Q 1PH8A 2RHQB 4H02A 3KF8B 2VL6A 1N36Q 1K8GA 1BBWA 3I4NH 4YHHQ 4IOAA 3KJPA 1N9WA 3GTOH 1IBML 2IX0A 3TQYA 1G291 2NN6I 2AWOA 2HHHL 1L1OC 1LM0A 1TWCH 2ZJPA 4GKJL 2R7DA
chains in the Genus database with same CATH superfamily
2G5DA 4ME3A 1B9NA 1EUJA 3MVVA 4HMJA 4B9WA 3DM1A 2I07B 4YY3L 4JBMA 2CFMA 1IYUA 1N8RC 1KC8C 1C48A 3RLOA 4JI7Q 1GUTA 4NKLA 4YWLA 3J80i 3KBGA 2MHVA 4X3SA 2XGTA 2XNAC 2O5JC 5EAYA 3GV3A 3D4RA 3H6MA 1TKWB 3SXHA 3MXNA 5KYIA 5C3EH 4A3KB 3JAML 1RTOA 3IAYA 3DEPA 1LTAD 3E6ZX 3F2DA 5JVG3 4PV1C 5I9OA 4EX5A 2N49A 1SR3A 1MHWC 5C3EB 1CTMA 3ZYYX 4IURA 5IP7H 5KIXA 4DNIA 3HOXB 4S3SA 3KYHC 3HKZB 1YJWA 1EU3A 5IP7G 1O80A 2ENBA 4KJNA 3CMEA 1SFOH 5IY0A 4R4OA 4NW2A 2Y0SG 3LNNA 3U9OA 3D31A 5GADC 5M5XB 2L11A 3STBD 1PZID 4CDCC 2Q2IA 4KJOA 1VQ6A 1MJCA 2K32A 3ULLA 2H1EA 3S15B 1CFMA 3DMUA 2F0PA 4RWSC 1B8AA 4WJ3M 5EBCA 4JI1L 4DF7A 1I4XA 2NTSA 5J1ZA 1Y1VB 2KENA 5JVH3 2VB3X 2JA8G 5GAEC 2UXBQ 2RSNA 1OXXK 2R92H 5C4XH 3K5OA 1MGSA 1IHZA 1KABA 3EVQA 1I94Q 3FHWA 3ULPA 1GOZA 3HOVH 4OO1I 3BVMA 4QUFA 2VQEQ 5IYCH 2D0OA 4FNFA 5IGFA 2JA5H 2F4IA 4JPBW 1X55A 2B63G 3M4PA 1UE5A 1IYJB 1F9QA 4CJ1B 2FXQA 1LYLA 1ZXTA 2ZTDA 3FPUB 3PF4A 1M4VA 4A3GB 3AEVA 1KLGD 3IKJA 1PYWD 1RCVD 3GTMH 1EIHA 1WTOA 3Q8DA 3FDTA 3IL8A 5C4ZA 2N88A 4G7OC 2ZXRA 2AQ1B 1EWHA 4FYDA 3ICEA 2DUDA 4XIGS 5F2DA 2WB1E 3G6JB 1CKNA 1JWUD 3G4SA 1A3TA 1GKHA 4ZKCB 2ASBA 1YNND 3KBXA 3E0EA 3S1NB 3MXNB 3E9HA 5FJ8G 3S1NH 1S5BD 3E9IA 1QOHA 5LMNW 3CCLA 3NBIA 1Q81C 1VQPA 4IUUA 3GTGH 2VUMH 3VA5A 1STEA 2ICEC 3J81L 4IPCA 2NN6H 1AZPA 1FNWA 4OL7A 2UXCQ 5M5WH 4GKKQ 4BBSB 2JXMB 4A3EG 5IYDG 4DV2L 1WJJA 3WOFA 3KLRA 3AMUA 2V4DA 5JOBA 5CV6A 1UE6A 4LF8L 1IBMQ 1K28A 4BBRG 2WP8J 5KEEA 1UEAB 1XTCD 4WRDA 2EOTA 1W6KA 3S9WA 4P71A 1N34L 1VS0A 4OO1G 1OXVA 2J7ZA 3K81C 4EGVA 2X6LA 4ME5A 2UXDQ 3FKIH 4K0KQ 4ODGA 2F52A 4DV6L 5BN4A 4DV0L 1YNJC 3NEMA 1XMOQ 3DUZA 2X6GA 4JI8Q 2DY8A 2KCCA 1CI3M 3CRLC 1XMQL 2KQ3A 2RCFA 5I6YA 1CUKA 1X54A 1X3FA 1S5DD 1STAA 3PO3H 1NTGA 3GTQH 3TBIB 2ZJQA 2Q8IB 5COYA 3OYYA 4GKJQ 2NVYH 3G71A 1DYQA 2RF4A 2Z8LA 1CKMA 2XRQD 2PYKA 4DAMA 2R93G 1L1OA 1E3PA 1K3BC 1RD9D 5IGBA 4H13C 4NMZA 3M4YA 1S5ED 4KN7C 5C3EG 1J6QA 1JOQA 2L4NA 1JJ2A 4TKOB 4KKSA 2K03A 4JC0A 3NTKA 4RKBA 1YJ9A 1EYDA 1PMRA 3ONAB 2EJGC 2WIIB 4IPHA 1STYA 4R1JA 3K58A 3I4MG 3HFZB 4X64L 2KCTA 1PH2A 4JI5L 1NMFA 1SNOA 2AKWB 5LL6S 4Y52H 2DJGC 4HEDA 2B8GA 3PGZA 3BJUA 3L3OC 5CYUA 2A6HC 4P74A 1HNXQ 1TWCB 2K7VA 4FDBA 5CORA 1KRSA 3PCOB 2B39A 2JA7H 2AUJD 3FRPB 1EY7A 4LF4L 1G2TA 4A3EB 4A3KG 1PVOA 2B3GA 5FKAC 3HOWG 1B1ZA 4LFAL 2MO0A 4ULLA 1SMYD 3L9AX 1O7ZA 1WCMB 1GUOA 4RGTA 4R4QA 4A3BB 5CV9A 3RUZA 2LXJA 1EL0A 2F0QA 3R8BA 1EFID 3M4OB 2K28A 1E1TA 4RAUC 5BR8L 2F4VQ 5EKLA 4IFDJ 2AQ2B 4DN4M 4KLKA 4QJFA 3OMGA 5CBEE 1W2BA 3U4VA 1YITA 1VQ7A 1CSPA 4CKCA 1QCBD 2E2JB 4FF2A 2IT1A 2B2VA 3JAMc 4HIKA 2EE1A 2NVXB 4ZAIA 2PZWA 4GNXB 5FO7B 3SR1A 2JA6B 3J7A5 2B2UC 2PNRC 4DK6C 1TWGH 4BY1G 1YHBA 4A3JG 4HR7B 3GTKB 3HOZB 1M8AA 1PTOF 5IP9H 1NR4A 2R6GA 1K83H 1I4GA 2WAQG 2IJ0A 2NYZD 2F0EA 3T1HL 2IWHA 2K05A 3WOEA 3DWPA 3ND8A 3EBEA 1NR2A 4H44C 3EROA 2O5IC 2VNUD 2OF1A 3I72A 2NN6G 2E8GA 4PZ6A 5C6AA 3OSOA 1HUMA 4DFAA 3MFGA 2ZTEA 1EEFD 2CQOA 4JBWA 3PO2H 2QCPX 2ALYB 2QDBA 3M4QA 4DR1L 4JYAL 4X3KA 3J7ZC 3CRKC 1BDOA 2Y0SB 1N32L 2D2CC 3S24A 4RGNA 2Q2UA 3HOYH 3GV6A 4KTAA 3IFDA 4X3TA 3I8ZA 4BS9A 3NUCA 2L9HA 5C0XG 4K6LA 3H3VC 2F3VA 1FR3A 1BF4A 3S14B 1TR5A 1ENFA 1KAAA 1C8CA 1SYFA 2EJMA 2A1AA 4DR6Q 3CPWA 4C2MB 3D4DA 3VR6A 4FXDA 2BCOA 4WORA 3PO3G 3PO2B 1PH6A 2LY7A 2PZTA 2WKDA 4F87A 1RODA 2CQAA 4OXPA 1K83B 2JA9A 4K2KA 2B2TA 3CKIB 4ZRZA 2QW7A 4O2DA 4P2CB 4LF8Q 1Y8PB 1K8MA 1PYSB 2SEBD 3GP7A 1ENAA 1O7LA 4C3HH 1I3QH 2XIWA 3I4LA 4FXGC 1U4PA 3DLLA 5EKKA 1PZJD 4BXXH 1VMCA 1SLJA 1JT8A 2BH2A 1JOOA 2B63B 4Y7NH 2LKVA 1D1KA 3H0GB 1BCPD 1U5KA 4J6HA 1I6HB 1CA6A 1Y1WB 3RZOH 1O7IA 3GTPH 1T9HA 1UUPA 1OXSC 2KA7A 3RNUA 4IFDI 3SE0A 2UXCL 2SNSA 1H9SA 1PXUA 1FL0A 1HZBA 4A3CH 4LK1C 5C0XJ 1YNXA 1QNUA 1SEBD 2VQFL 2EY2A 4XQQA 1EEID 2A68D 2MUYA 1K8OA 4NPSA 1X3QA 2AHOB 1FYCA 4O1NA 2JQOA 1X3PA 2MFIA 4JCVE 2K5QA 5EPLA 2HCIA 5K36H 1ZYRC 1C9OA 1PH8A 3I90A 2RHQB 2VL6A 3KJPA 4G4KA 4N8FA 3GTOH 2AWOA 3K7AB 1MD2D 3RZDB 2ZJPA 4GKJL 3C1FA 3J81j 3KF8A 3KUPA 5GAHC 2A8VA 4B3RL 2WV6D 2IX1A 4BY1H 1AFPA 2K50A 1XXGA 4R4TA 4DAVA 4LJZC 4L5RC 3A5UA 4B3RQ 1R4QB 3G6EA 1RHPA 3A5ZB 1HNWL 1I3QB 4HIOA 4KY7A 1BQQT 4LAAA 3UDFA 1XWEA 4GN3B 1Q8KA 1FGUA 4HCSA 3NWSA 1S72A 4JI7L 2FHTA 2GVAA 4X65Q 3T13A 1QJOA 4JG2A 2E2JH 3L7ZC 2UU9Q 4F8MA 2RDGA 4QIWB 4DV7L 1EQVA 2C9OA 4MZ9A 5DAUA 2HDLA 2R92B 4A3GH 2JA6H 4AYBG 2NZOA 4YCWA 2IPKD 4A3FG 4LF7Q 3L2PA 2KEEA 4B08A 1NCVA 4K5XA 1Y8NB 2ZXPA 4P75A 4UY8C 1H95A 4OWTB 1L2FA 2E2HH 1BNZA 4A3JB 4KY5A 1E24A 3SK6A 4ZKBB 2Q2HA 3PIPA 1V1OA 3DWAA 4GKKL 3LWUA 4K5VA 3RZDH 3NTIA 1WI5A 2JA7B 4TSSA 5IYBH 3K80C 5DEHA 4DUYQ 1TWAH 4DR4L 1OXUA 2ICIA 4BBSG 1TU2B 4LFAQ 3E5SA 4WFN3 1PRTD 3HOZG 4DR4Q 5FK9C 1SN8A 1SE3A 3A0JA 4OIJA 3RN2A 5J39A 3QOLA 2K6AA 2PPBC 1FGBD 1HFGA 4AQYL 4A76A 2H4OA 3ULJA 1KRTA 2EIFA 1XNQL 5IYDH 2WKCA 3GTGB 2N55A 3W1GA 3KDFA 1F9SA 3EQLC 5AJ3Q 3HZXA 1YVCA 1X32A 1U4LA 1PRTB 4JI2Q 1VQAA 2K5DA 5C44B 4A93G 3D3RA 1LTLA 1O7YA 3LGJA 1I6HH 4I65A 3HS0C 3H0GH 4DV3Q 1TWHB 3GTQB 1B53A 1EWIA 4OO1H 4IUNA 5G3LF 1VQJA 1VQCA 1UE7A 4HN7A 1ESFA 1Z47A 1IBKL 4LF9Q 2B2YC 1TT2A 5IIFA 4BY7H 1I5FA 3S1RH 3KJOA 4K14A 1WYDA 4J8QA 1Q46A 1XPUA 5ELOA 5C44H 2QILA 1JWSD 2JA5G 3BZCA 1EWCA 2UUAQ 2F0SA 4KHPQ 5FOBB 5DM73 2O2LD 5A2QL 3T1YQ 3TEHB 2PW5A 1IXRA 1PFMA 1SDFA 5KYLA 3RLFA 2JJQA 3QWNA 5C4XB 4QMGA 2NVQH 3NPPA 2K33A 1LT5D 4LMQD 5JAVA 5C4JH 4CJ2C 3GTOB 1HNWQ 1NUCA 3D4WA 3TP8A 4UPAA 4QB4A 1RF2D 4EVOA 1J5EQ 5CGKA 1QILA 2UUBQ 3VR4A 5H1SE 1TWFB 3RMHA 1DM0B 5M3FH 2QDLA 1SE2A 3BZDB 2K75A 4B9XA 1L0YB 3VDYA 2F0HA 3SGIA 3CHBD 4DV4L 4PMCA 3W2DA 3D8GA 5JJIA 3X3MA 1JB7A 4BA2I 1P16A 2DJFC 1U9RA 5C3XA 2E2HB 3TP6A 2UUCQ 4HSVA 3OHXC 2DNCA 3MXUA 4RFBA 1G6ZA 5CV7A 3IRBA 2H5XA 2L12A 5EKIA 4OELB 1I6VC 5EBDA 1R9TB 1S5CD 1DJRD 4C1NK 3CC4A 1SNPA 1QVCA 2F0MA 4WJ4A 2R3ZA 1SJED 1A6XA 5I2XA 3VYUA 1ZEQX 2SDFA 3P1HA 2A74C 3H3VI 1DONA 4C3HB 3H91A 2NVYB 5BR8Q 5ELDA 3N52A 4YIJA 3FKIG 2JA6G 5FLMH 4YY3Q 1YJNA 4DAYB 1EYGA 2F0UA 1LTRD 2CH4A 3SDZA 4BY1B 2LS01 1LTBD 2F0VA 1I50B 4IALA 2YU9B 3KLWA 4HJ8A 1PLFA 1EOTA 2A68C 1G6PA 1AEXA 4XQNA 4CHTB 5AFWA 3NTHA 3CCQA 1ILQA 4R8NA 4MNOA 2IY5B 3H94A 3FKIB 3BS1A 1SYEA 1ENCA 1I94L 4RGMA 1VQ8A 3KF6A 1TXYA 5JJLA 5C3WA 4DR5Q 1JWMD 2KVMA 4IPGA 3STBC 3CP0A 3S1MB 1A3UA 3MXPA 4JI1Q 1JCKB 5IWAQ 1KXLA 1CQFA 3TDQA 1QE6A 4ABNA 4LUOA 2BA1A 1RDPD 1ASZA 3E3XA 3F8TA 2UUCL 2PO4A 3PUXA 4UAIA 1GUSA 3HRZC 2HQEA 4R9WA 3TZUA 4H7BA 2SOBA 2MGSA 3UI2A 1GHJA 3D6CA 4Y7NB 1SNMA 4PZ8A 4LUVA 4HJAA 2F03A 2HDMA 2F0JA 4AYBE 1C4QA 4V0BA 3M3YH 5C4XG 1ILPA 3VR5A 3A56A 3CCJA 5KNDA 4AH6A 3HOWH 2MNAA 4ID6A 3TS0A 1QNKA 2RDHA 3HEJA 3K6OA 3J81i 1E0BA 2AMCB 3TSSA 4M1UB 2R7ZH 4F7XA 4JI0L 2JA5B 1ET6A 1LUZA 3BDOA 1PZKD 3AYHB 1PYBA 3HOZH 5CV4A 2R7ZG 2EZVA 1D5XC 2EY1A 4JV5Q 2K01A 3HOUH 4DNTB 3T1YL 1LTID 1JICA 4KK7A 3LWEA 2KHIA 4ZUIA 2LFNA 1J5EL 3RLNA 2OCEA 3SK8A 4A3DB 2NBFA 1RTNA 1W6JA 5AJ3L 1SSOA 1R4PB 1SNDA 5TSSA 5IGDA 2B29A 1B4OA 1TY2A 2AQ3B 2K5NA 2MPMA 4AQYQ 1VQOA 4A93H 5DLQE 5FJ8H 1SFOB 4KY6A 1FNUA 2M9VA 2N3SA 1GXDC 5E7NA 1YIJA 1LT6D 4BXXG 4TRDA 2CWAA 1QUQB 4IUPA 5LMNL 3K5NA 3WWVA 3LX0A 4A3LG 1S3OA 2F3WA 4GS3A 3BG3A 5A35A 1Q1BA 1JR0D 2VY3A 4EQOA 3M85A 4DPGA 1FJGQ 3GO5A 4A3LH 1C0AA 2PQEA 4G7HC 3D6WA 4C3JH 1S40A 1ZYRD 4JVZA 4R4CA 4GZYC 4A3DH 3NBHA 3VR2A 4G57A 4DAPA 1MKHA 1EIGA 3PIP3 5JEAG 3HOUB 3NWTA 1XPOA 1BKBA 2F0LA 3QIAA 4RGOS 4XQJA 5I9PA 4LF7L 2B2WA 1KDCA 1SYDA 2D0PA 1PH1A 2F1MA 4RCOA 3EN2A 3FMCA 5T1GA 5JEAJ 1HNXL 1D7QA 1D6EC 1SMXA 1Q7YC 1PTOD 5JPMC 3MEFA 2UU9L 3ZJYC 2B2UA 4OEMB 1XNRL 2R61A 4KHZA 5M3FG 1JB3A 3W1BA 3OOCA 1K73C 3HGBA 1VQNA 2ZJRA 4UHVA 4HSPA 1WTQA 5HGTA 2C5CA 3DHQA 2F0GA 1WVLA 1XMQQ 4JI3Q 1MSHA 5ELEA 3GD7A 3R93A 5C0XI 4A3FB 2B2WC 1JMCA 2TSSA 3J81c 2BDOA 3SVMA 2QGQA 1S5FD 3V05A 1B3QA 4IUQA 3M4OH 4QQBX 3I73A 3PUVA 5KNBA 3BVZA 4X62Q 2E5LQ 3MHBA 2PMZE 2FFKB 3OW7A 2EVBA 1EZ8A 1VMPA 1PHJA 1NNXA 1J8IA 4YCVA 4GN5A 5FLXL 3QR8A 4H02A 3J7AV 1BBWA 3QO2A 1N9WA 1IBML 3TQYA 2NN6I 4DA2A 2R7DA 1YEZA 1IBLQ 2OWOA 5LMUQ 2A69C 4DV0Q 1EFWA 4BBRB 1EY6A 1CQVA 2RBMA 5T1IA 4A3KH 3KF6B 1JJGA 2BE5D 4Q0FA 4ZLTF 2NWGA 4KHPL 5FLXc 3CCUA 1O78A 2XVSA 1SXTA 5ELNA 1F2LA 1HQRD 1SE4A 3JC66 4LUZA 1HRJA 1YI2A 1E2WA 4B3TQ 2FMMA 4HJ5A 2HUGA 1Y1WG 1EIYB 2MO1A 3GTKH 4RCNA 3PIO3 1PFSA 3NXWA 1JQYD 1KDAA 1WOCA 3SHLA 4K0KL 3OIQA 1FD7D 3T16A 2IW3A 1SYBA 4JW0A 1BCPC 4JBKA 3AQQA 3VYSA 3M7GA 5IT9c 1SNCA 3ERQA 3I4NB 5LMNQ 1E1OA 4RG1A 4F88A 1CHPD 3I4MH 1WCMG 5IGCA 4IPDA 4JI2L 2EYLA 3KLSX 5IT9E 2KHJA 2XWJB 4E6IA 1WCMH 4APVA 2NVTB 4DR5L 1E2ZA 4NXML 5DNFA 1PRTF 2JA7G 5GROA 1OO9B 1VQFA 2Z4IA 3A8KE 3RD4A 5NUCA 4DR2Q 3OWEB 1KLUD 2PQAA 3BYTB 5IOCA 2FMCA 3FVQA 5IYCG 4CDFC 4JI6Q 1JOKA 3KDFB 5L37A 1PTOH 2JSOA 1DGSA 2Q8RE 1ICFB 4HJ9A 1A2UA 4C3JG 2EYOA 4MHEA 4GOPC 5D3IB 1Y69U 2K1BA 1NY4A 3MWYW 2L5TA 4P72A 1HJPA 3A74A 5JJZA 2NVTH 3H3VH 3C46A 4DR1Q 3M3YB 1EIFA 5JEAH 5BN3A 4X6AH 1Y1VG 2HT1A 4CDDC 2R7ZB 1CHQD 1DOMA 4OHJA 3U9SA 1R9TH 3R2TA 1VQEA 5M3MB 1NSNS 2UUBL 3AFQA 1H9KA 5CV8A 1IL8A 1L1OB 1E22A 4X3UA 3PUZA 1STGA 3U58A 2HIXA 1STBA 3NBHB 3DXJC 2VQEL 1II3A 2Z9HA 1PH3A 2B2VC 1EYAA 3BVGA 3S14H 4JI4L 3M7NA 1Q86C 5ELCA 1QZGA 3F2CA 4JI4Q 1YNNC 1UWVA 1TY0A 3K7AH 1HTPA 2A73B 4FF1A 5C5MA 3NELA 3U4ZA 3V2TA 2RDFA 3UE0A 2Q2TA 1HA5A 1A0IA 3X3NA 3S17B 1HUNA 1Q12A 4NDXA 4IFDG 1VF5C 4B3SL 3Q24A 3G48A 4A3EH 4IUVA 3NHHA 1HFNA 4QCLA 3A8JE 3NQTA 1VDZA 4DNRB 1IW7C 1TS4A 4AIMA 3CQZH 3K8AA 1PH4A 3S2DH 2CKZB 1PRTC 2F0KA 1OTCA 2E76C 1V9PA 5GAGC 2UXDL 1HZ9A 1EY4A 2WAQE 4L5SA 4O0AA 3CCMA 1HR0Q 2XWBB 4KI0A 2HHHQ 1KNAA 1NMGA 5FLMG 2R7FA 1Q90A 5I2YA 5DM63 1BCPB 3NENA 5C44G 1U4RA 2ZXOA 4A93B 1TS2A 3PSIA 1KAWA 2F4VL 1VQ5A 3CC7A 3BZKA 2YV5A 3S1QB 1K9MC 2F0DA 1TWGB 3MEHA 3OPOA 1Q82C 1KIXA 1S4ZA 3W5OA 4QL5A 2DY7A 1PTOC 3DWQA 3A7LA 4L6TB 4JK1C 2B8FA 1VQ4A 1XYIA 2G9DA 2A69D 5EGTA 4XYOA 4N8X1 1BBXC 4DK0A 2R93H 4L5QA 1BOSA 1F77A 1CKOA 2NTTA 3U50C 2VZAA 5LMUL 2KHSA 4RA8A 1EOVA 1STNA 2M2LA 3CF5A 3HOYB 3CW2C 2CVRA 4U68A 2F0WA 3UDGA 4NP5A 3I56A 3H09A 1WFQA 1U4MA 2Z6BA 1H9RA 3PF5A 4X64Q 5JJKA 1G8ZD 2A19A 1G2SA 1V1PA 4DAYA 1IW7D 1SROA 2ID0A 4PG3A 3P75A 4XYQA 1UAPA 3PQIA 3CD6A 1G51A 1F9PA 1LTSD 1SAPA 1VQHA 3KK7A 3TN2A 1GHKA 3GTJB 1NBWA 2I5LX 2RHSB 4OGQC 5E4XA 2PNHA 4A3MH 3MXGA 1PH7A 2Z4HA 1Q1EA 4GN4B 4OX9Q 3TP7A 2LMCB 3IFTA 4POFA 2VW9A 1JE4A 3NP8A 2VXWA 3ER0A 5D14A 5A2QE 4KKUA 4A3FH 5J22A 4TQUS 1F2ZA 4PMBA 4CGYB 1X56A 1RKNA 5KNCA 4EQNA 1D1IA 4DV6Q 1TWHH 2F0IA 3TS2A 1Z7TA 1PFBA 1KTKA 3BYYB 1K3RA 5ELBA 3CXCA 1XMOL 5IYBG 4WJWA 2AUKA 1D2BA 5IODA 2V1CC 3CCSA 4KD3A 1I4QA 2OXPA 4A3IB 4XTCS 2Z0SA 5ISRA 3K5MA 4ILWA 2D62A 1SYGA 1AP0A 2ZM6L 4ZUJA 4JBJA 3C2PA 2EYHA 5E1FA 3T51B 2WB1B 4I7ZC 2HCCA 4L63B 1BXTA 2O4XA 3HOVB 4C3IH 3K0YA 3T56B 2OQ0A 2PMZB 4NXMQ 3KFUA 1H9MA 2KUMA 1FNVA 1B44D 2K5WA 5GQOA 4A3BG 4NXNL 1HZCA 2C35B 5EPJA 2KJXA 2BA0A 1KHIA 2PQAB 3NSWA 2K5HA 1SE8A 4DUYL 3EFXD 3H0GG 3T53B 1TWFH 1VQIA 1XJVA 4EQPA 3MA2B 4N9PA 3MAQA 3EIVA 4G7ZC 4IN3A 2WINB 1Z6HA 4QIWE 1VQ9A 1EZ6A 1STHA 3PIOA 1ML0D 1I4RA 1I4PA 3HKSA 3RR5A 1GUWA 3S1MH 5IT9L 4B3SQ 2TMPA 1AE3A 3URYA 3FPPA 3CU7A 2YTYA 5EQ0A 3Q22A 4DV5Q 5KGUA 4FF3A 2VUMG 1DOLA 2A6EC 4LFCQ 2EQSA 1IBLL 1UE1A 4C56C 5C4JB 2J0TD 2PCFB 4DXGA 4GOPA 4L8JA 1G91A 1OXTA 2ATWA 1GJXA 4A75A 3S1QH 4C3IB 2D5DA 4RMFA 2R93B 1XPRA 4C3HG 2RSOA 4BBRH 4DV1L 3P7JA 1B70B 3OTOL 3NK9A 2UXBL 1PA6A 1F9RA 4LW1A 4R8IA 1TS3A 3JAME 2CHBD 3Q6SA 4CDEC 1ASYA 3VA7A 1LT4D 5E3FA 3UDIA 1HNZL 4C3JB 1CM9A 1CZWA 2E74C 1H9JA 4BA1I 1D5ZC 1BVSA 2FJ2A 3C1EA 1TIID 2HD3A 4MTKA 3CCEA 2UUAL 2JEAI 1QG7A 4A3CG 5EPKA 2B2YA 3KOJA 3S2HB 4IJHA 3T1HQ 4UDUC 1EY0A 5HURA 2NZHA 4GNXA 1Y1WH 1LO5D 1MIUA 3S2DB 2L55A 1D5MC 4DKAC 4DR3Q 3EJIA 3I55A 3S16H 2QF7A 1LV9A 1MSGA 1AW7A 4GLAC 5KRUA 5M5YB 4LF5Q 3KF8B 5E4WC 2GA4B 3QB3A 4QF4A 4YHHQ 4IOAA 2OEOA 2IX0A 1G291 1QWYA 1L1OC 1TWCH 1XX8A 4H0LC 1I50H 2HQLA 3CCRA 1A63A 4LF6Q 4DV2Q 1QZHA 1XNRQ 3HOWB 4A3IH 2F0FA 1SRUA 2KBNA 1HCZA 2BOSA 4PNYA 5IGGA 4A3IG 2ES2A 2Q8TA 1VQLA 2NVXH 1EY8A 1JE5A 1TQOA 1IL2A 5LL6X 4BY7B 3QG1A 4A3MG 3PO3B 4NB3A 1KNEA 3F2BA 1T5EA 1TVXA 3M9BA 3HOVG 1VQKA 4YWKA 1N36L 4MTNA 2BE5C 4K6DA 1WTXA 4DV7Q 3R2IA 1X3EA 4AYBB 5FLXE 1DOKA 2JK8A 4DU9A 1YHQA 3I4NG 4FXKC 1U0LA 2DGYA 4A3BH 1N33Q 3PO2G 4IO9A 4IQZA 4DV4Q 5M5YH 3I91A 5CMDA 2LXKA 2ZM6Q 1EQTA 2PI2E 2KECA 5ELFA 3OW2A 3G7LA 4GNXC 1CKNB 3C3LA 2CH4W 3A55A 2VS1A 1GUGA 1YBYA 4O42A 3VYTA 4DUZL 1YZ6A 1VQMA 1AZQA 4JI0Q 1ET9A 1CA5A 5BN5A 2DN8A 4K8JA 4OWXB 5C0XH 2A5HA 4CKBA 1A62A 4N9TA 3I3CA 3VR3A 2YYZA 1MJEA 4BBSH 1YNJD 2YU9H 3V96A 1SYCA 4UP9A 1PDQA 2F0OA 4FVMA 1UNSA 3PV0A 1EQQA 1DCZA 1E7ZA 4DK1A 4PZ7A 5HY6A 3CCVA 4DV1Q 1A3VA 2PI2A 2QEXA 3ITPA 1GVPA 4IFDH 1NJIC 1HTLD 5G3LD 4GLVB 3D0FA 3K57A 3GTLH 1HH2P 3ERSX 1AE2A 3TRZA 3RZOB 1EY9A 4DR7Q 1JC7A 3EA6A 3I4OA 3J7AF 4TVAB 1HZAA 5J3BA 1N34Q 5IWAL 3K7UC 2L1BA 4LFCL 3B6YA 4XXEA 1J9OA 2PW7A 1QB5D 4IZ8A 3HKZE 4LWCA 1AH9A 3W3AA 1E2VA 1HHVA 1XNQQ 2E75C 1GM5A 2D9UA 2E2DC 3GTLB 4IOCA 2X69A 1X9NA 4DUZQ 4HIMA 4Q5VA 3R3OA 2LSSA 1K8AC 2EPBA 3SK4A 2Z1CA 2OQKA 5HGQA 1FJGL 4HJ7A 1SJHD 2AWNA 5EJWA 4CBVA 4UP8A 1EQRA 2RCNA 1Y1VH 4LF4Q 2EY6A 2JN4A 4C2MH 2YTVA 4K8IA 2XTIA 4JI6L 4LF5L 4RKLA 2XRSD 3Q23A 1BO0A 4A3MB 1T5XD 3GTJH 3JAMi 1WTRA 3PUYA 5M5WB 3TP5A 2IHEA 4DR6L 2EDGA 3QJYA 2I0QA 4KD4A 2JYOA 4YHHL 4LF6L 4PQXA 1ZKOA 1JJCB 3A7AB 3I2ZA 5CC4A 2J4XA 1UEBA 3H15A 3S15H 3S17H 1KD1C 1LTTD 4JV5L 2B2TC 4ZCKA 3UDXA 4QY7A 1VCIA 4OWWB 1EU4A 2MP1A 1RJTA 4I7AA 4J15A 4HIDA 5IE8A 3OWFA 4X65L 2QA4A 3I4MB 1Q3LA 3FP9A 3I7FA 1ONLA 2CW0C 4EQ5A 1SNQA 3J80E 4JYAQ 1NE3A 4P73A 4DR3L 2N8NA 2PZUA 1M1KC 1CSQA 3DM3A 4KN4C 1WTVA 3GTMB 2MJ8A 2SNMA 1K0SA 2XN9C 4JOIC 2OT2A 1B7YB 2WACA 1HR0L 1QVFA 1N32Q 3HKZG 4V190 2F0TA 2K04A 4JI8L 1NAPA 1L0WA 2BDNA 2BH8A 1RIPA 1CT1D 3E0JA 3MFYA 2E5LL 1HNZQ 5K36G 4X62L 2KEDA 5M9OA 4X66L 3FEWX 3J7YW 2IHFA 3I70A 1SMYC 4KMUC 3T4AC 4CKEA 3A8IE 4K5WA 1BR9A 1W3SA 5I4DA 2ZT9C 3OTOQ 2OTJA 1I4HA 1IZ6A 3K59A 2L15A 1V1QA 5IP9G 1A15A 4OIKA 5C5LA 1F2MA 1TWAB 1V1PB 3RN5A 2GN5A 2A6HD 4ZK9B 4DXFA 3CPFA 1DZ1A 4KKTA 4CJ0B 2K14A 2OTLA 1HQMC 2NUCA 2E2IH 2EXDA 4C3IG 2F3IA 4DV5L 3BDLA 3S1RB 1PH9A 1XTDA 1V8QA 2XSCA 2Z6KA 4R4IA 4U673 4XT3B 1DXMA 2K5VA 1VQDA 3MC0B 4POGA 1QVGA 2P5ZX 3HOXG 1Q8IA 2YTXA 5C4HA 5I6WA 2CWPA 1LABA 2VUMB 3HOXH 4MIUA 4LF9L 3O13A 1K0RA 4YCUA 4B3MQ 3K0XA 1BUVT 1JORA 2MQHA 2K52A 3HP3A 1AN8A 1VF7A 3SEBA 2WAQB 3A54A 1X65A 2JE6I 3MTSA 1FVIA 2I46A 2IX3A 4XDXA 4BY7G 4HAEA 2N78A 5FO8B 1LLRD 1ICWA 1IKMA 2JEBI 5K5PA 4DR2L 1WTHA 4FP5D 4FO2A 1Z9FA 1BCPF 3HOUG 2WB1G 3J80L 1PV4A 3KLSA 5D3DA 2GVBA 4QGUA 3GDEA 1GO3E 2EYFA 2EXZA 2KCMA 1HA6A 3L0OA 4HCEA 4JOIA 4JI5Q 1VQBA 4J1MA 4RH6A 1Y8OB 2G9HD 2E2IB 2ZTCA 3AB9A 2EJFC 3OIPA 1B3AA 3K5LA 3VYRA 1A2TA 1MI2A 1PTOB 2EYPA 2FINB 1QUQA 4LFBL 4XT1B 5M5XH 1WD0A 3J80c 1WTWA 1ESRA 5JPNC 3ND9A 3F1ZA 4A3JH 1C7YA 2WFWA 4DR7L 2JA8H 3CC2A 1A8VA 3AFPA 2R92G 5CR3A 3GTPB 3PUWA 2JA8B 1EYCA 1GD7A 3S2HH 1F2YA 4YWMA 1B2TA 4B3TL 4ZQ3A 1P8LA 4A4IA 4A3DG 1VQGA 2EYMA 2JP1A 2B63H 1V43A 2EY5A 3NE5B 3CQZB 1LTGD 4DGZA 4L5TA 2K4KA 1BBUA 4M8AA 3NQIA 5FO9B 4OX9L 2KCNA 1KDBA 1SBBB 4RHSA 1KL9A 2L0CA 4OONA 4X66Q 4ALPA 1GUNA 4C1NI 1WD1A 1IKLA 4RHRA 3CMAA 1B9MA 4HTHA 2Z6KC 1L0XB 1PFNA 4K2LA 5M3MH 3TREA 2I5MX 4QUCA 2RVLA 3PMFA 4DV3L 1B50A 1Y14B 4ZYSA 1D8LA 3OMCA 1CZGA 4KV6A 3HOYG 1HXYD 5M3MG 1M90C 1HR0W 3F2UA 2VB2X 4GOPB 5M3FB 2RKSA 3AU7A 1WTPA 4LNQA 1RL2A 5D65A 4Z9CB 3TMEA 2RQXA 3S16B 3MZ5A 2HIVA 3DEOA 1IBKQ 1N33L 4PMWA 3SK5A 4JI3L 4B3ML 2Y0SE 5IGEA 4IJLA 4GLXA 3QOJA 3N6RA 4IUTA 2NVQB 2NB0A 1PH5A 2RA4A 5LHY1 3P20A 2CCZA 3TZDA 1HPCA 2NZ1D 1IYVA 3CAMA 4UP7A 5CV5A 4LFBQ 3BU2A 3GQBA 1X3GA 2QEJC 2KOLA 4DK3C 1EY5A 4NXNQ 2VQFQ 1YHAA 1DD2A 1CK1A 1KQSA 1H9SB 1TS5A 2IL8A 3BDCA 4KHVA 2M00A 3J81E 2QKIC 3UE1A 1MBYA 2I5HA 4FF4A 4A3GG 1X6OA 1LT3D 2DNEA 1LACA 3HG9A 4HMIA 3Q0AA 1N36Q 1K8GA 3I4NH 4BWGB 2EYJA 2A6ED 3WDNA 2CW0D 2F0NA 5CBAE 2HHHL 1LM0A 4MN3A
chains in the Genus database with same CATH topology
1YEZA 1IBLQ 3J81j 4ME3A 5LMUQ 1I50H 2HQLA 2OWOA 3CCRA 1A63A 4DV0Q 5GAHC 4DV2Q 1QZHA 4LF6Q 2A8VA 1XNRQ 4B3RL 1EFWA 1EUJA 2IX1A 4A3IH 4A3KH 4BY1H 3KF6B 1JJGA 2K50A 1SRUA 2KBNA 4R4TA 4YY3L 4L5RC 4JBMA 3A5UA 4B3RQ 2CFMA 4KHPL 1N8RC 3G6EA 5FLXc 3A5ZB 1KC8C 3CCUA 5ELNA 1HNWL 4A3IG 3RLOA 4JI7Q 4HIOA 3JC66 2ES2A 1VQLA 4LUZA 4YWLA 3J80i 1YI2A 2NVXH 3UDFA 4B3TQ 2XGTA 4GN3B 1Q8KA 1JE5A 1FGUA 5EAYA 4HJ5A 1S72A 1IL2A 4JI7L 1Y1WG 1EIYB 2MO1A 3GTKH 2GVAA 4A3MG 4X65Q 1PFSA 4NB3A 5C3EH 3F2BA 4JG2A 2E2JH 3L7ZC 3M9BA 3HOVG 3F2DA 1VQKA 4YWKA 1N36L 2UU9Q 4MTNA 1WOCA 4EX5A 2N49A 1SR3A 4DV7L 4K0KL 4JBKA 3AQQA 4MZ9A 5IP7H 4DNIA 4A3GH 2JA6H 4DV7Q 1X3EA 4AYBG 5IT9c 2NZOA 4YCWA 3KYHC 2JK8A 1YJWA 1YHQA 3I4NG 4A3FG 5IP7G 5LMNQ 1E1OA 1U0LA 2DGYA 4RG1A 3L2PA 1WCMG 3CMEA 4LF7Q 4UY8C 4IO9A 4P75A 5IY0A 4R4OA 4DV4Q 4OWTB 4IPDA 5M5YH 1SFOH 1H95A 4JI2L 1L2FA 2Y0SG 2E2HH 3D31A 2KHJA 5GADC 2LXKA 2ZM6Q 1WCMH 4APVA 1E24A 4DR5L 3STBD 4NXML 2Q2IA 1VQ6A 2PI2E 1MJCA 2Q2HA 3ULLA 3PIPA 3OW2A 4GKKL 4GNXC 3RZDH 1B8AA 1WI5A 1CKNB 2JA7G 4WJ3M 2VS1A 5GROA 5IYBH 1YBYA 3K80C 4JI1L 1VQFA 2KENA 2JA8G 4DUYQ 5GAEC 1YZ6A 4DUZL 1VQMA 2UXBQ 4JI0Q 1OXXK 1TWAH 4DR2Q 2R92H 1OXUA 4OWXB 5C4XH 4DR4L 4BBSG 2PQAA 4LFAQ 1A62A 5IYCG 3HOZG 4JI6Q 3KDFB 4DR4Q 1SN8A 3A0JA 3RN2A 2YYZA 1MJEA 1I94Q 4BBSH 3FHWA 3ULPA 3HOVH 4OO1I 1DGSA 2YU9H 2VQEQ 5IYCH 3H3VH 4HJ9A 2D0OA 4UP9A 2JA5H 2B63G 1X55A 4GOPC 1EQQA 3PV0A 1E7ZA 3M4PA 1UE5A 1NY4A 1IYJB 4AQYL 4PZ7A 4A76A 2FXQA 4P72A 3ULJA 1HJPA 1KRTA 1LYLA 2EIFA 2ZTDA 3A74A 5HY6A 1XNQL 3PF4A 2NVTH 3W1GA 3KDFA 2PI2A 3CCVA 4DV1Q 2QEXA 5AJ3Q 1GVPA 4DR1Q 3AEVA 1YVCA 1NJIC 3GTMH 1EIFA 4JI2Q 3Q8DA 4GLVB 3D0FA 4X6AH 1VQAA 1Y1VG 2HT1A 3GTLH 4A93G 3ERSX 1HH2P 1AE2A 3ICEA 1LTLA 2DUDA 4XIGS 3TRZA 4DR7Q 2WB1E 3I4OA 3LGJA 1CKNA 1I6HH 3G4SA 1R9TH 1VQEA 1GKHA 3H0GH 4TVAB 4DV3Q 2ASBA 1HZAA 5J3BA 1N34Q 3AFQA 5IWAL 1EWIA 3K7UC 2UUBL 3E0EA 4LFCL 1VQJA 1VQCA 3B6YA 1UE7A 1L1OB 1E22A 3MXNB 3PUZA 3U58A 2HIXA 3NBHB 3E9HA 5FJ8G 2VQEL 3S1NH 1Z47A 1IBKL 3E9IA 1PH3A 4LF9Q 4BY7H 3S14H 3HKZE 5LMNW 3CCLA 4JI4L 1Q81C 1VQPA 3GTGH 1I5FA 4LWCA 1Q86C 3S1RH 2VUMH 3M7NA 3KJOA 3RZOH 1QZGA 1AH9A 1WYDA 3F2CA 1XNQQ 1GM5A 1Q46A 4JI4Q 1XPUA 5ELOA 5C44H 1UWVA 4IOCA 3K7AH 1X9NA 4DUZQ 4HIMA 2JA5G 4IPCA 2LSSA 3BZCA 1K8AC 2UUAQ 3NELA 4KHPQ 2UXCQ 5M5WH 3U4ZA 2OQKA 4GKKQ 5HGQA 1FJGL 3UE0A 4HJ7A 3T1YQ 4A3EG 5IYDG 4DV2L 1WJJA 1A0IA 2AWNA 3TEHB 2Q2TA 1IXRA 1Q12A 3RLFA 2JJQA 4IFDG 4B3SL 2NVQH 4UP8A 1UE6A 4LF8L 1EQRA 3G48A 5C4JH 4A3EH 4BBRG 1IBMQ 2WP8J 1HNWQ 2RCNA 1Y1VH 4LF4Q 4AIMA 3CQZH 3K8AA 2YTVA 4C2MH 2XTIA 1PH4A 3S2DH 4JI6L 4UPAA 2CKZB 4LF5L 1OTCA 1J5EQ 4P71A 1V9PA 5GAGC 1N34L 2UUBQ 2UXDL 1HZ9A 5H1SE 2WAQE 1VS0A 4L5SA 4O0AA 3CCMA 1OXVA 4OO1G 3GTJH 3K81C 1HR0Q 3JAMi 5M3FH 3PUYA 2UXDQ 4KI0A 2HHHQ 2K75A 3FKIH 4K0KQ 2IHEA 1NMGA 5FLMG 3VDYA 4DR6L 2F52A 4DV6L 3SGIA 4DV4L 2I0QA 2R7FA 4YHHL 4DV0L 4LF6L 5IYDH 3NEMA 1JJCB 3I2ZA 1XMOQ 5JJIA 1UEBA 1JB7A 3H15A 4BA2I 4JI8Q 3NENA 3S15H 1P16A 5C44G 3S17H 1KD1C 3PSIA 4JV5L 1XMQL 1KAWA 3UDXA 4QY7A 1VCIA 2UUCQ 4OWWB 2F4VL 1VQ5A 3CC7A 3BZKA 2YV5A 1CUKA 1X54A 1X3FA 4J15A 1K9MC 4HIDA 3PO3H 1NTGA 3IRBA 2H5XA 5IE8A 4X65L 2QA4A 1Q82C 1KIXA 3GTQH 3FP9A 3I7FA 4QL5A 3W5OA 2ZJQA 3OYYA 4GKJQ 2NVYH 3G71A 3CC4A 4EQ5A 2RF4A 4JYAQ 1QVCA 1CKMA 4DAMA 1NE3A 4P73A 4DR3L 2R93G 1L1OA 1E3PA 2N8NA 1M1KC 4WJ4A 1VQ4A 1CSQA 3DM3A 5C3EG 2R93H 1J6QA 4JOIC 3PO2G 1B7YB 4L5QA 1JJ2A 3H3VI 1CKOA 3U50C 1HR0L 2VZAA 5LMUL 1QVFA 1N32Q 3HKZG 5BR8Q 4JC0A 4JI8L 3FKIG 1L0WA 1YJ9A 5FLMH 2JA6G 1EOVA 4YY3Q 1YJNA 4DAYB 1EYGA 2BH8A 4IPHA 3CF5A 1RIPA 4R1JA 3CW2C 2E5LL 1HNZQ 5K36G 3I4MG 4X62L 3UDGA 3I56A 3HFZB 4X64L 4X66L 1WFQA 3KLWA 2KCTA 1PH2A 4JI5L 4HJ8A 2IHFA 1NMFA 4Y52H 2AKWB 3PF5A 4X64Q 3BJUA 3PGZA 5JJKA 2A19A 4P74A 1G6PA 1W3SA 3OTOQ 1HNXQ 2OTJA 1SROA 2ID0A 4PG3A 3CCQA 4FDBA 4MNOA 1KRSA 3PCOB 2JA7H 1G51A 1IZ6A 3CD6A 2IY5B 4LF4L 1I94L 2L15A 1V1QA 1VQHA 5IP9G 1VQ8A 1NBWA 2I5LX 2RHSB 3KF6A 4A3KG 1PVOA 2PNHA 1TXYA 2B3GA 4A3MH 1PH7A 3HOWG 5JJLA 4DR5Q 4LFAL 4GN4B 1Q1EA 4OX9Q 4IPGA 2MO0A 3STBC 3CP0A 3RN5A 2GN5A 4POFA 2VW9A 4R4QA 3CPFA 2LXJA 4JI1Q 3ER0A 2K14A 1E1TA 5IWAQ 2OTLA 5BR8L 1KXLA 2F4VQ 2E2IH 2EXDA 4IFDJ 2F3IA 4A3FH 4DV5L 4TQUS 4LUOA 1PH9A 1XTDA 2Z6KA 4KLKA 4QJFA 1W2BA 4R4IA 2BA1A 3U4VA 1YITA 1X56A 1VQ7A 1CSPA 1VQDA 2K5VA 1ASZA 3F8TA 2UUCL 4POGA 1QVGA 2IT1A 3PUXA 3HOXG 1TWHH 3JAMc 4DV6Q 4HIKA 3TS2A 2YTXA 1K3RA 2CWPA 4GNXB 3CXCA 1XMOL 5IYBG 3J7A5 3HOXH 4PZ8A 4LUVA 4HJAA 4LF9L 4DK6C 1TWGH 1K0RA 2V1CC 4BY1G 4YCUA 1YHBA 3CCSA 4AYBE 4A3JG 4B3MQ 3K0XA 3M3YH 5C4XG 4XTCS 2MQHA 2K52A 2Z0SA 5IP9H 2R6GA 1K83H 3CCJA 2WAQG 4AH6A 3HOWH 2MNAA 2D62A 1X65A 2JE6I 3TS0A 1FVIA 4BY7G 3J81i 2ZM6L 3T1HL 2AMCB 4JBJA 2N78A 2R7ZH 4JI0L 2JEBI 1LUZA 4DR2L 3EBEA 1Z9FA 3AYHB 1PYBA 3HOUG 3HOZH 2VNUD 2WB1G 2R7ZG 1PV4A 2NN6G 2GVBA 4C3IH 2E8GA 4QGUA 3GDEA 1GO3E 4PZ6A 2OQ0A 4JV5Q 3HOUH 2KCMA 3T1YL 4NXMQ 3KFUA 3L0OA 1N33Q 2KHIA 2ZTEA 4JOIA 4JI5Q 1VQBA 2CQOA 1J5EL 3RLNA 5GQOA 4A3BG 2OCEA 2ZTCA 1HZCA 4JBWA 4NXNL 3PO2H 2C35B 2BA0A 1KHIA 2PQAB 2K5HA 2ALYB 1SE8A 3M4QA 4DUYL 3H0GG 5AJ3L 1TWFH 4DR1L 1VQIA 1XJVA 4JYAL 1QUQA 3J7ZC 4LFBL 5M5XH 3J80c 1N32L 4AQYQ 2B29A 2K5NA 4A93H 3EIVA 1VQOA 5DLQE 3S24A 5FJ8H 3F1ZA 4A3JH 4QIWE 1C7YA 2WFWA 1VQ9A 4DR7L 3HOYH 2Q2UA 2N3SA 5E7NA 2JA8H 1YIJA 3PIOA 3CC2A 1A8VA 4BXXG 3HKSA 2CWAA 3AFPA 3RR5A 1QUQB 2R92G 3PUWA 5C0XG 5LMNL 3S1MH 1GD7A 4B3SQ 3WWVA 3S2HH 1AE3A 4A3LG 1S3OA 4GS3A 2YTYA 1Q1BA 4YWMA 4B3TL 2VY3A 4DV5Q 3M85A 1P8LA 4A4IA 4DPGA 1FJGQ 4A3DG 3GO5A 4A3LH 1VQGA 1C0AA 2A1AA 2VUMG 4DR6Q 1S40A 4C3JH 2B63H 1V43A 3CPWA 4LFCQ 4R4CA 4A3DH 2EQSA 4L5TA 2K4KA 3PO3G 1IBLL 1UE1A 4GOPA 1PH6A 1BBUA 1MKHA 4OX9L 1OXTA 2ATWA 4A75A 4OXPA 1KL9A 4OONA 5JEAG 1XPOA 1BKBA 4X66Q 4ALPA 3S1QH 2JA9A 4LF7L 3CMAA 4RMFA 2D0PA 1PH1A 2Z6KC 1XPRA 3EN2A 4O2DA 4BBRH 4DV1L 4LF8Q 5JEAJ 5M3MH 1B70B 2I5MX 3TREA 1PYSB 3OTOL 1HNXL 1D7QA 4DV3L 1Y14B 1SMXA 2UXBL 4C3HH 1D8LA 1Q7YC 1PA6A 1I3QH 3HOYG 5M3MG 4LW1A 1M90C 3MEFA 3DLLA 2UU9L 1JT8A 3ZJYC 1ASYA 1SLJA 1HR0W 4BXXH 2BH2A 4GOPB 1XNRL 4KHZA 3UDIA 5M3FG 1HNZL 4LNQA 1RL2A 3W1BA 4Y7NH 1K73C 1VQNA 4BA1I 1BVSA 2ZJRA 1U5KA 2HIVA 1IBKQ 1N33L 4PMWA 3I4MH 4JI3L 4B3ML 1O7IA 3CCEA 2Y0SE 2UUAL 1T9HA 3GTPH 1OXSC 2JEAI 3RNUA 4IFDI 4IJLA 4GLXA 2UXCL 4A3CG 1PH5A 2CCZA 1XMQQ 4JI3Q 3GD7A 5C0XI 1FL0A 3KOJA 1JMCA 1HZBA 3CAMA 4IJHA 4UP7A 3J81c 3T1HQ 5C0XJ 1YNXA 4A3CH 2QGQA 4LFBQ 3BU2A 2NZHA 1X3GA 2VQFL 3M4OH 3PUVA 4X62Q 4A3BH 4QQBX 4GNXA 4DK3C 1Y1WH 2E5LQ 1MIUA 4NXNQ 2PMZE 4NPSA 4DKAC 2VQFQ 1YHAA 4DR3Q 1KQSA 2AHOB 1PHJA 2JQOA 2MFIA 3I55A 4JCVE 3S16H 3UE1A 2I5HA 4YCVA 4A3GG 4GLAC 4GN5A 1X6OA 1C9OA 4LF5Q 1PH8A 2RHQB 4H02A 3KF8B 2VL6A 1N36Q 1K8GA 1BBWA 3I4NH 4YHHQ 4IOAA 3KJPA 1N9WA 3GTOH 1IBML 2IX0A 3TQYA 1G291 2NN6I 2AWOA 2HHHL 1L1OC 1LM0A 1TWCH 2ZJPA 4GKJL 2R7DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YEZ A;  1IBL Q;  3J81 j;  4ME3 A;  5LMU Q;  1I50 H;  2HQL A;  2OWO A;  3CCR A;  1A63 A;  4DV0 Q;  5GAH C;  4DV2 Q;  1QZH A;  4LF6 Q;  2A8V A;  1XNR Q;  4B3R L;  1EFW A;  1EUJ A;  2IX1 A;  4A3I H;  4A3K H;  4BY1 H;  3KF6 B;  1JJG A;  2K50 A;  1SRU A;  2KBN A;  4R4T A;  4YY3 L;  4L5R C;  4JBM A;  3A5U A;  4B3R Q;  2CFM A;  4KHP L;  1N8R C;  3G6E A;  5FLX c;  3A5Z B;  1KC8 C;  3CCU A;  5ELN A;  1HNW L;  4A3I G;  3RLO A;  4JI7 Q;  4HIO A;  3JC6 6;  2ES2 A;  1VQL A;  4LUZ A;  4YWL A;  3J80 i;  1YI2 A;  2NVX H;  3UDF A;  4B3T Q;  2XGT A;  4GN3 B;  1Q8K A;  1JE5 A;  1FGU A;  5EAY A;  4HJ5 A;  1S72 A;  1IL2 A;  4JI7 L;  1Y1W G;  1EIY B;  2MO1 A;  3GTK H;  2GVA A;  4A3M G;  4X65 Q;  1PFS A;  4NB3 A;  5C3E H;  3F2B A;  4JG2 A;  2E2J H;  3L7Z C;  3M9B A;  3HOV G;  3F2D A;  1VQK A;  4YWK A;  1N36 L;  2UU9 Q;  4MTN A;  1WOC A;  4EX5 A;  2N49 A;  1SR3 A;  4DV7 L;  4K0K L;  4JBK A;  3AQQ A;  4MZ9 A;  5IP7 H;  4DNI A;  4A3G H;  2JA6 H;  4DV7 Q;  1X3E A;  4AYB G;  5IT9 c;  2NZO A;  4YCW A;  3KYH C;  2JK8 A;  1YJW A;  1YHQ A;  3I4N G;  4A3F G;  5IP7 G;  5LMN Q;  1E1O A;  1U0L A;  2DGY A;  4RG1 A;  3L2P A;  1WCM G;  3CME A;  4LF7 Q;  4UY8 C;  4IO9 A;  4P75 A;  5IY0 A;  4R4O A;  4DV4 Q;  4OWT B;  4IPD A;  5M5Y H;  1SFO H;  1H95 A;  4JI2 L;  1L2F A;  2Y0S G;  2E2H H;  3D31 A;  2KHJ A;  5GAD C;  2LXK A;  2ZM6 Q;  1WCM H;  4APV A;  1E24 A;  4DR5 L;  3STB D;  4NXM L;  2Q2I A;  1VQ6 A;  2PI2 E;  1MJC A;  2Q2H A;  3ULL A;  3PIP A;  3OW2 A;  4GKK L;  4GNX C;  3RZD H;  1B8A A;  1WI5 A;  1CKN B;  2JA7 G;  4WJ3 M;  2VS1 A;  5GRO A;  5IYB H;  1YBY A;  3K80 C;  4JI1 L;  1VQF A;  2KEN A;  2JA8 G;  4DUY Q;  5GAE C;  1YZ6 A;  4DUZ L;  1VQM A;  2UXB Q;  4JI0 Q;  1OXX K;  1TWA H;  4DR2 Q;  2R92 H;  1OXU A;  4OWX B;  5C4X H;  4DR4 L;  4BBS G;  2PQA A;  4LFA Q;  1A62 A;  5IYC G;  3HOZ G;  4JI6 Q;  3KDF B;  4DR4 Q;  1SN8 A;  3A0J A;  3RN2 A;  2YYZ A;  1MJE A;  1I94 Q;  4BBS H;  3FHW A;  3ULP A;  3HOV H;  4OO1 I;  1DGS A;  2YU9 H;  2VQE Q;  5IYC H;  3H3V H;  4HJ9 A;  2D0O A;  4UP9 A;  2JA5 H;  2B63 G;  1X55 A;  4GOP C;  1EQQ A;  3PV0 A;  1E7Z A;  3M4P A;  1UE5 A;  1NY4 A;  1IYJ B;  4AQY L;  4PZ7 A;  4A76 A;  2FXQ A;  4P72 A;  3ULJ A;  1HJP A;  1KRT A;  1LYL A;  2EIF A;  2ZTD A;  3A74 A;  5HY6 A;  1XNQ L;  3PF4 A;  2NVT H;  3W1G A;  3KDF A;  2PI2 A;  3CCV A;  4DV1 Q;  2QEX A;  5AJ3 Q;  1GVP A;  4DR1 Q;  3AEV A;  1YVC A;  1NJI C;  3GTM H;  1EIF A;  4JI2 Q;  3Q8D A;  4GLV B;  3D0F A;  4X6A H;  1VQA A;  1Y1V G;  2HT1 A;  3GTL H;  4A93 G;  3ERS X;  1HH2 P;  1AE2 A;  3ICE A;  1LTL A;  2DUD A;  4XIG S;  3TRZ A;  4DR7 Q;  2WB1 E;  3I4O A;  3LGJ A;  1CKN A;  1I6H H;  3G4S A;  1R9T H;  1VQE A;  1GKH A;  3H0G H;  4TVA B;  4DV3 Q;  2ASB A;  1HZA A;  5J3B A;  1N34 Q;  3AFQ A;  5IWA L;  1EWI A;  3K7U C;  2UUB L;  3E0E A;  4LFC L;  1VQJ A;  1VQC A;  3B6Y A;  1UE7 A;  1L1O B;  1E22 A;  3MXN B;  3PUZ A;  3U58 A;  2HIX A;  3NBH B;  3E9H A;  5FJ8 G;  2VQE L;  3S1N H;  1Z47 A;  1IBK L;  3E9I A;  1PH3 A;  4LF9 Q;  4BY7 H;  3S14 H;  3HKZ E;  5LMN W;  3CCL A;  4JI4 L;  1Q81 C;  1VQP A;  3GTG H;  1I5F A;  4LWC A;  1Q86 C;  3S1R H;  2VUM H;  3M7N A;  3KJO A;  3RZO H;  1QZG A;  1AH9 A;  1WYD A;  3F2C A;  1XNQ Q;  1GM5 A;  1Q46 A;  4JI4 Q;  1XPU A;  5ELO A;  5C44 H;  1UWV A;  4IOC A;  3K7A H;  1X9N A;  4DUZ Q;  4HIM A;  2JA5 G;  4IPC A;  2LSS A;  3BZC A;  1K8A C;  2UUA Q;  3NEL A;  4KHP Q;  2UXC Q;  5M5W H;  3U4Z A;  2OQK A;  4GKK Q;  5HGQ A;  1FJG L;  3UE0 A;  4HJ7 A;  3T1Y Q;  4A3E G;  5IYD G;  4DV2 L;  1WJJ A;  1A0I A;  2AWN A;  3TEH B;  2Q2T A;  1IXR A;  1Q12 A;  3RLF A;  2JJQ A;  4IFD G;  4B3S L;  2NVQ H;  4UP8 A;  1UE6 A;  4LF8 L;  1EQR A;  3G48 A;  5C4J H;  4A3E H;  4BBR G;  1IBM Q;  2WP8 J;  1HNW Q;  2RCN A;  1Y1V H;  4LF4 Q;  4AIM A;  3CQZ H;  3K8A A;  2YTV A;  4C2M H;  2XTI A;  1PH4 A;  3S2D H;  4JI6 L;  4UPA A;  2CKZ B;  4LF5 L;  1OTC A;  1J5E Q;  4P71 A;  1V9P A;  5GAG C;  1N34 L;  2UUB Q;  2UXD L;  1HZ9 A;  5H1S E;  2WAQ E;  1VS0 A;  4L5S A;  4O0A A;  3CCM A;  1OXV A;  4OO1 G;  3GTJ H;  3K81 C;  1HR0 Q;  3JAM i;  5M3F H;  3PUY A;  2UXD Q;  4KI0 A;  2HHH Q;  2K75 A;  3FKI H;  4K0K Q;  2IHE A;  1NMG A;  5FLM G;  3VDY A;  4DR6 L;  2F52 A;  4DV6 L;  3SGI A;  4DV4 L;  2I0Q A;  2R7F A;  4YHH L;  4DV0 L;  4LF6 L;  5IYD H;  3NEM A;  1JJC B;  3I2Z A;  1XMO Q;  5JJI A;  1UEB A;  1JB7 A;  3H15 A;  4BA2 I;  4JI8 Q;  3NEN A;  3S15 H;  1P16 A;  5C44 G;  3S17 H;  1KD1 C;  3PSI A;  4JV5 L;  1XMQ L;  1KAW A;  3UDX A;  4QY7 A;  1VCI A;  2UUC Q;  4OWW B;  2F4V L;  1VQ5 A;  3CC7 A;  3BZK A;  2YV5 A;  1CUK A;  1X54 A;  1X3F A;  4J15 A;  1K9M C;  4HID A;  3PO3 H;  1NTG A;  3IRB A;  2H5X A;  5IE8 A;  4X65 L;  2QA4 A;  1Q82 C;  1KIX A;  3GTQ H;  3FP9 A;  3I7F A;  4QL5 A;  3W5O A;  2ZJQ A;  3OYY A;  4GKJ Q;  2NVY H;  3G71 A;  3CC4 A;  4EQ5 A;  2RF4 A;  4JYA Q;  1QVC A;  1CKM A;  4DAM A;  1NE3 A;  4P73 A;  4DR3 L;  2R93 G;  1L1O A;  1E3P A;  2N8N A;  1M1K C;  4WJ4 A;  1VQ4 A;  1CSQ A;  3DM3 A;  5C3E G;  2R93 H;  1J6Q A;  4JOI C;  3PO2 G;  1B7Y B;  4L5Q A;  1JJ2 A;  3H3V I;  1CKO A;  3U50 C;  1HR0 L;  2VZA A;  5LMU L;  1QVF A;  1N32 Q;  3HKZ G;  5BR8 Q;  4JC0 A;  4JI8 L;  3FKI G;  1L0W A;  1YJ9 A;  5FLM H;  2JA6 G;  1EOV A;  4YY3 Q;  1YJN A;  4DAY B;  1EYG A;  2BH8 A;  4IPH A;  3CF5 A;  1RIP A;  4R1J A;  3CW2 C;  2E5L L;  1HNZ Q;  5K36 G;  3I4M G;  4X62 L;  3UDG A;  3I56 A;  3HFZ B;  4X64 L;  4X66 L;  1WFQ A;  3KLW A;  2KCT A;  1PH2 A;  4JI5 L;  4HJ8 A;  2IHF A;  1NMF A;  4Y52 H;  2AKW B;  3PF5 A;  4X64 Q;  3BJU A;  3PGZ A;  5JJK A;  2A19 A;  4P74 A;  1G6P A;  1W3S A;  3OTO Q;  1HNX Q;  2OTJ A;  1SRO A;  2ID0 A;  4PG3 A;  3CCQ A;  4FDB A;  4MNO A;  1KRS A;  3PCO B;  2JA7 H;  1G51 A;  1IZ6 A;  3CD6 A;  2IY5 B;  4LF4 L;  1I94 L;  2L15 A;  1V1Q A;  1VQH A;  5IP9 G;  1VQ8 A;  1NBW A;  2I5L X;  2RHS B;  3KF6 A;  4A3K G;  1PVO A;  2PNH A;  1TXY A;  2B3G A;  4A3M H;  1PH7 A;  3HOW G;  5JJL A;  4DR5 Q;  4LFA L;  4GN4 B;  1Q1E A;  4OX9 Q;  4IPG A;  2MO0 A;  3STB C;  3CP0 A;  3RN5 A;  2GN5 A;  4POF A;  2VW9 A;  4R4Q A;  3CPF A;  2LXJ A;  4JI1 Q;  3ER0 A;  2K14 A;  1E1T A;  5IWA Q;  2OTL A;  5BR8 L;  1KXL A;  2F4V Q;  2E2I H;  2EXD A;  4IFD J;  2F3I A;  4A3F H;  4DV5 L;  4TQU S;  4LUO A;  1PH9 A;  1XTD A;  2Z6K A;  4KLK A;  4QJF A;  1W2B A;  4R4I A;  2BA1 A;  3U4V A;  1YIT A;  1X56 A;  1VQ7 A;  1CSP A;  1VQD A;  2K5V A;  1ASZ A;  3F8T A;  2UUC L;  4POG A;  1QVG A;  2IT1 A;  3PUX A;  3HOX G;  1TWH H;  3JAM c;  4DV6 Q;  4HIK A;  3TS2 A;  2YTX A;  1K3R A;  2CWP A;  4GNX B;  3CXC A;  1XMO L;  5IYB G;  3J7A 5;  3HOX H;  4PZ8 A;  4LUV A;  4HJA A;  4LF9 L;  4DK6 C;  1TWG H;  1K0R A;  2V1C C;  4BY1 G;  4YCU A;  1YHB A;  3CCS A;  4AYB E;  4A3J G;  4B3M Q;  3K0X A;  3M3Y H;  5C4X G;  4XTC S;  2MQH A;  2K52 A;  2Z0S A;  5IP9 H;  2R6G A;  1K83 H;  3CCJ A;  2WAQ G;  4AH6 A;  3HOW H;  2MNA A;  2D62 A;  1X65 A;  2JE6 I;  3TS0 A;  1FVI A;  4BY7 G;  3J81 i;  2ZM6 L;  3T1H L;  2AMC B;  4JBJ A;  2N78 A;  2R7Z H;  4JI0 L;  2JEB I;  1LUZ A;  4DR2 L;  3EBE A;  1Z9F A;  3AYH B;  1PYB A;  3HOU G;  3HOZ H;  2VNU D;  2WB1 G;  2R7Z G;  1PV4 A;  2NN6 G;  2GVB A;  4C3I H;  2E8G A;  4QGU A;  3GDE A;  1GO3 E;  4PZ6 A;  2OQ0 A;  4JV5 Q;  3HOU H;  2KCM A;  3T1Y L;  4NXM Q;  3KFU A;  3L0O A;  1N33 Q;  2KHI A;  2ZTE A;  4JOI A;  4JI5 Q;  1VQB A;  2CQO A;  1J5E L;  3RLN A;  5GQO A;  4A3B G;  2OCE A;  2ZTC A;  1HZC A;  4JBW A;  4NXN L;  3PO2 H;  2C35 B;  2BA0 A;  1KHI A;  2PQA B;  2K5H A;  2ALY B;  1SE8 A;  3M4Q A;  4DUY L;  3H0G G;  5AJ3 L;  1TWF H;  4DR1 L;  1VQI A;  1XJV A;  4JYA L;  1QUQ A;  3J7Z C;  4LFB L;  5M5X H;  3J80 c;  1N32 L;  4AQY Q;  2B29 A;  2K5N A;  4A93 H;  3EIV A;  1VQO A;  5DLQ E;  3S24 A;  5FJ8 H;  3F1Z A;  4A3J H;  4QIW E;  1C7Y A;  2WFW A;  1VQ9 A;  4DR7 L;  3HOY H;  2Q2U A;  2N3S A;  5E7N A;  2JA8 H;  1YIJ A;  3PIO A;  3CC2 A;  1A8V A;  4BXX G;  3HKS A;  2CWA A;  3AFP A;  3RR5 A;  1QUQ B;  2R92 G;  3PUW A;  5C0X G;  5LMN L;  3S1M H;  1GD7 A;  4B3S Q;  3WWV A;  3S2H H;  1AE3 A;  4A3L G;  1S3O A;  4GS3 A;  2YTY A;  1Q1B A;  4YWM A;  4B3T L;  2VY3 A;  4DV5 Q;  3M85 A;  1P8L A;  4A4I A;  4DPG A;  1FJG Q;  4A3D G;  3GO5 A;  4A3L H;  1VQG A;  1C0A A;  2A1A A;  2VUM G;  4DR6 Q;  1S40 A;  4C3J H;  2B63 H;  1V43 A;  3CPW A;  4LFC Q;  4R4C A;  4A3D H;  2EQS A;  4L5T A;  2K4K A;  3PO3 G;  1IBL L;  1UE1 A;  4GOP A;  1PH6 A;  1BBU A;  1MKH A;  4OX9 L;  1OXT A;  2ATW A;  4A75 A;  4OXP A;  1KL9 A;  4OON A;  5JEA G;  1XPO A;  1BKB A;  4X66 Q;  4ALP A;  3S1Q H;  2JA9 A;  4LF7 L;  3CMA A;  4RMF A;  2D0P A;  1PH1 A;  2Z6K C;  1XPR A;  3EN2 A;  4O2D A;  4BBR H;  4DV1 L;  4LF8 Q;  5JEA J;  5M3M H;  1B70 B;  2I5M X;  3TRE A;  1PYS B;  3OTO L;  1HNX L;  1D7Q A;  4DV3 L;  1Y14 B;  1SMX A;  2UXB L;  4C3H H;  1D8L A;  1Q7Y C;  1PA6 A;  1I3Q H;  3HOY G;  5M3M G;  4LW1 A;  1M90 C;  3MEF A;  3DLL A;  2UU9 L;  1JT8 A;  3ZJY C;  1ASY A;  1SLJ A;  1HR0 W;  4BXX H;  2BH2 A;  4GOP B;  1XNR L;  4KHZ A;  3UDI A;  5M3F G;  1HNZ L;  4LNQ A;  1RL2 A;  3W1B A;  4Y7N H;  1K73 C;  1VQN A;  4BA1 I;  1BVS A;  2ZJR A;  1U5K A;  2HIV A;  1IBK Q;  1N33 L;  4PMW A;  3I4M H;  4JI3 L;  4B3M L;  1O7I A;  3CCE A;  2Y0S E;  2UUA L;  1T9H A;  3GTP H;  1OXS C;  2JEA I;  3RNU A;  4IFD I;  4IJL A;  4GLX A;  2UXC L;  4A3C G;  1PH5 A;  2CCZ A;  1XMQ Q;  4JI3 Q;  3GD7 A;  5C0X I;  1FL0 A;  3KOJ A;  1JMC A;  1HZB A;  3CAM A;  4IJH A;  4UP7 A;  3J81 c;  3T1H Q;  5C0X J;  1YNX A;  4A3C H;  2QGQ A;  4LFB Q;  3BU2 A;  2NZH A;  1X3G A;  2VQF L;  3M4O H;  3PUV A;  4X62 Q;  4A3B H;  4QQB X;  4GNX A;  4DK3 C;  1Y1W H;  2E5L Q;  1MIU A;  4NXN Q;  2PMZ E;  4NPS A;  4DKA C;  2VQF Q;  1YHA A;  4DR3 Q;  1KQS A;  2AHO B;  1PHJ A;  2JQO A;  2MFI A;  3I55 A;  4JCV E;  3S16 H;  3UE1 A;  2I5H A;  4YCV A;  4A3G G;  4GLA C;  4GN5 A;  1X6O A;  1C9O A;  4LF5 Q;  1PH8 A;  2RHQ B;  4H02 A;  3KF8 B;  2VL6 A;  1N36 Q;  1K8G A;  1BBW A;  3I4N H;  4YHH Q;  4IOA A;  3KJP A;  1N9W A;  3GTO H;  1IBM L;  2IX0 A;  3TQY A;  1G29 1;  2NN6 I;  2AWO A;  2HHH L;  1L1O C;  1LM0 A;  1TWC H;  2ZJP A;  4GKJ L;  2R7D A; 
#chains in the Genus database with same CATH topology
 2G5D A;  4ME3 A;  1B9N A;  1EUJ A;  3MVV A;  4HMJ A;  4B9W A;  3DM1 A;  2I07 B;  4YY3 L;  4JBM A;  2CFM A;  1IYU A;  1N8R C;  1KC8 C;  1C48 A;  3RLO A;  4JI7 Q;  1GUT A;  4NKL A;  4YWL A;  3J80 i;  3KBG A;  2MHV A;  4X3S A;  2XGT A;  2XNA C;  2O5J C;  5EAY A;  3GV3 A;  3D4R A;  3H6M A;  1TKW B;  3SXH A;  3MXN A;  5KYI A;  5C3E H;  4A3K B;  3JAM L;  1RTO A;  3IAY A;  3DEP A;  1LTA D;  3E6Z X;  3F2D A;  5JVG 3;  4PV1 C;  5I9O A;  4EX5 A;  2N49 A;  1SR3 A;  1MHW C;  5C3E B;  1CTM A;  3ZYY X;  4IUR A;  5IP7 H;  5KIX A;  4DNI A;  3HOX B;  4S3S A;  3KYH C;  3HKZ B;  1YJW A;  1EU3 A;  5IP7 G;  1O80 A;  2ENB A;  4KJN A;  3CME A;  1SFO H;  5IY0 A;  4R4O A;  4NW2 A;  2Y0S G;  3LNN A;  3U9O A;  3D31 A;  5GAD C;  5M5X B;  2L11 A;  3STB D;  1PZI D;  4CDC C;  2Q2I A;  4KJO A;  1VQ6 A;  1MJC A;  2K32 A;  3ULL A;  2H1E A;  3S15 B;  1CFM A;  3DMU A;  2F0P A;  4RWS C;  1B8A A;  4WJ3 M;  5EBC A;  4JI1 L;  4DF7 A;  1I4X A;  2NTS A;  5J1Z A;  1Y1V B;  2KEN A;  5JVH 3;  2VB3 X;  2JA8 G;  5GAE C;  2UXB Q;  2RSN A;  1OXX K;  2R92 H;  5C4X H;  3K5O A;  1MGS A;  1IHZ A;  1KAB A;  3EVQ A;  1I94 Q;  3FHW A;  3ULP A;  1GOZ A;  3HOV H;  4OO1 I;  3BVM A;  4QUF A;  2VQE Q;  5IYC H;  2D0O A;  4FNF A;  5IGF A;  2JA5 H;  2F4I A;  4JPB W;  1X55 A;  2B63 G;  3M4P A;  1UE5 A;  1IYJ B;  1F9Q A;  4CJ1 B;  2FXQ A;  1LYL A;  1ZXT A;  2ZTD A;  3FPU B;  3PF4 A;  1M4V A;  4A3G B;  3AEV A;  1KLG D;  3IKJ A;  1PYW D;  1RCV D;  3GTM H;  1EIH A;  1WTO A;  3Q8D A;  3FDT A;  3IL8 A;  5C4Z A;  2N88 A;  4G7O C;  2ZXR A;  2AQ1 B;  1EWH A;  4FYD A;  3ICE A;  2DUD A;  4XIG S;  5F2D A;  2WB1 E;  3G6J B;  1CKN A;  1JWU D;  3G4S A;  1A3T A;  1GKH A;  4ZKC B;  2ASB A;  1YNN D;  3KBX A;  3E0E A;  3S1N B;  3MXN B;  3E9H A;  5FJ8 G;  3S1N H;  1S5B D;  3E9I A;  1QOH A;  5LMN W;  3CCL A;  3NBI A;  1Q81 C;  1VQP A;  4IUU A;  3GTG H;  2VUM H;  3VA5 A;  1STE A;  2ICE C;  3J81 L;  4IPC A;  2NN6 H;  1AZP A;  1FNW A;  4OL7 A;  2UXC Q;  5M5W H;  4GKK Q;  4BBS B;  2JXM B;  4A3E G;  5IYD G;  4DV2 L;  1WJJ A;  3WOF A;  3KLR A;  3AMU A;  2V4D A;  5JOB A;  5CV6 A;  1UE6 A;  4LF8 L;  1IBM Q;  1K28 A;  4BBR G;  2WP8 J;  5KEE A;  1UEA B;  1XTC D;  4WRD A;  2EOT A;  1W6K A;  3S9W A;  4P71 A;  1N34 L;  1VS0 A;  4OO1 G;  1OXV A;  2J7Z A;  3K81 C;  4EGV A;  2X6L A;  4ME5 A;  2UXD Q;  3FKI H;  4K0K Q;  4ODG A;  2F52 A;  4DV6 L;  5BN4 A;  4DV0 L;  1YNJ C;  3NEM A;  1XMO Q;  3DUZ A;  2X6G A;  4JI8 Q;  2DY8 A;  2KCC A;  1CI3 M;  3CRL C;  1XMQ L;  2KQ3 A;  2RCF A;  5I6Y A;  1CUK A;  1X54 A;  1X3F A;  1S5D D;  1STA A;  3PO3 H;  1NTG A;  3GTQ H;  3TBI B;  2ZJQ A;  2Q8I B;  5COY A;  3OYY A;  4GKJ Q;  2NVY H;  3G71 A;  1DYQ A;  2RF4 A;  2Z8L A;  1CKM A;  2XRQ D;  2PYK A;  4DAM A;  2R93 G;  1L1O A;  1E3P A;  1K3B C;  1RD9 D;  5IGB A;  4H13 C;  4NMZ A;  3M4Y A;  1S5E D;  4KN7 C;  5C3E G;  1J6Q A;  1JOQ A;  2L4N A;  1JJ2 A;  4TKO B;  4KKS A;  2K03 A;  4JC0 A;  3NTK A;  4RKB A;  1YJ9 A;  1EYD A;  1PMR A;  3ONA B;  2EJG C;  2WII B;  4IPH A;  1STY A;  4R1J A;  3K58 A;  3I4M G;  3HFZ B;  4X64 L;  2KCT A;  1PH2 A;  4JI5 L;  1NMF A;  1SNO A;  2AKW B;  5LL6 S;  4Y52 H;  2DJG C;  4HED A;  2B8G A;  3PGZ A;  3BJU A;  3L3O C;  5CYU A;  2A6H C;  4P74 A;  1HNX Q;  1TWC B;  2K7V A;  4FDB A;  5COR A;  1KRS A;  3PCO B;  2B39 A;  2JA7 H;  2AUJ D;  3FRP B;  1EY7 A;  4LF4 L;  1G2T A;  4A3E B;  4A3K G;  1PVO A;  2B3G A;  5FKA C;  3HOW G;  1B1Z A;  4LFA L;  2MO0 A;  4ULL A;  1SMY D;  3L9A X;  1O7Z A;  1WCM B;  1GUO A;  4RGT A;  4R4Q A;  4A3B B;  5CV9 A;  3RUZ A;  2LXJ A;  1EL0 A;  2F0Q A;  3R8B A;  1EFI D;  3M4O B;  2K28 A;  1E1T A;  4RAU C;  5BR8 L;  2F4V Q;  5EKL A;  4IFD J;  2AQ2 B;  4DN4 M;  4KLK A;  4QJF A;  3OMG A;  5CBE E;  1W2B A;  3U4V A;  1YIT A;  1VQ7 A;  1CSP A;  4CKC A;  1QCB D;  2E2J B;  4FF2 A;  2IT1 A;  2B2V A;  3JAM c;  4HIK A;  2EE1 A;  2NVX B;  4ZAI A;  2PZW A;  4GNX B;  5FO7 B;  3SR1 A;  2JA6 B;  3J7A 5;  2B2U C;  2PNR C;  4DK6 C;  1TWG H;  4BY1 G;  1YHB A;  4A3J G;  4HR7 B;  3GTK B;  3HOZ B;  1M8A A;  1PTO F;  5IP9 H;  1NR4 A;  2R6G A;  1K83 H;  1I4G A;  2WAQ G;  2IJ0 A;  2NYZ D;  2F0E A;  3T1H L;  2IWH A;  2K05 A;  3WOE A;  3DWP A;  3ND8 A;  3EBE A;  1NR2 A;  4H44 C;  3ERO A;  2O5I C;  2VNU D;  2OF1 A;  3I72 A;  2NN6 G;  2E8G A;  4PZ6 A;  5C6A A;  3OSO A;  1HUM A;  4DFA A;  3MFG A;  2ZTE A;  1EEF D;  2CQO A;  4JBW A;  3PO2 H;  2QCP X;  2ALY B;  2QDB A;  3M4Q A;  4DR1 L;  4JYA L;  4X3K A;  3J7Z C;  3CRK C;  1BDO A;  2Y0S B;  1N32 L;  2D2C C;  3S24 A;  4RGN A;  2Q2U A;  3HOY H;  3GV6 A;  4KTA A;  3IFD A;  4X3T A;  3I8Z A;  4BS9 A;  3NUC A;  2L9H A;  5C0X G;  4K6L A;  3H3V C;  2F3V A;  1FR3 A;  1BF4 A;  3S14 B;  1TR5 A;  1ENF A;  1KAA A;  1C8C A;  1SYF A;  2EJM A;  2A1A A;  4DR6 Q;  3CPW A;  4C2M B;  3D4D A;  3VR6 A;  4FXD A;  2BCO A;  4WOR A;  3PO3 G;  3PO2 B;  1PH6 A;  2LY7 A;  2PZT A;  2WKD A;  4F87 A;  1ROD A;  2CQA A;  4OXP A;  1K83 B;  2JA9 A;  4K2K A;  2B2T A;  3CKI B;  4ZRZ A;  2QW7 A;  4O2D A;  4P2C B;  4LF8 Q;  1Y8P B;  1K8M A;  1PYS B;  2SEB D;  3GP7 A;  1ENA A;  1O7L A;  4C3H H;  1I3Q H;  2XIW A;  3I4L A;  4FXG C;  1U4P A;  3DLL A;  5EKK A;  1PZJ D;  4BXX H;  1VMC A;  1SLJ A;  1JT8 A;  2BH2 A;  1JOO A;  2B63 B;  4Y7N H;  2LKV A;  1D1K A;  3H0G B;  1BCP D;  1U5K A;  4J6H A;  1I6H B;  1CA6 A;  1Y1W B;  3RZO H;  1O7I A;  3GTP H;  1T9H A;  1UUP A;  1OXS C;  2KA7 A;  3RNU A;  4IFD I;  3SE0 A;  2UXC L;  2SNS A;  1H9S A;  1PXU A;  1FL0 A;  1HZB A;  4A3C H;  4LK1 C;  5C0X J;  1YNX A;  1QNU A;  1SEB D;  2VQF L;  2EY2 A;  4XQQ A;  1EEI D;  2A68 D;  2MUY A;  1K8O A;  4NPS A;  1X3Q A;  2AHO B;  1FYC A;  4O1N A;  2JQO A;  1X3P A;  2MFI A;  4JCV E;  2K5Q A;  5EPL A;  2HCI A;  5K36 H;  1ZYR C;  1C9O A;  1PH8 A;  3I90 A;  2RHQ B;  2VL6 A;  3KJP A;  4G4K A;  4N8F A;  3GTO H;  2AWO A;  3K7A B;  1MD2 D;  3RZD B;  2ZJP A;  4GKJ L;  3C1F A;  3J81 j;  3KF8 A;  3KUP A;  5GAH C;  2A8V A;  4B3R L;  2WV6 D;  2IX1 A;  4BY1 H;  1AFP A;  2K50 A;  1XXG A;  4R4T A;  4DAV A;  4LJZ C;  4L5R C;  3A5U A;  4B3R Q;  1R4Q B;  3G6E A;  1RHP A;  3A5Z B;  1HNW L;  1I3Q B;  4HIO A;  4KY7 A;  1BQQ T;  4LAA A;  3UDF A;  1XWE A;  4GN3 B;  1Q8K A;  1FGU A;  4HCS A;  3NWS A;  1S72 A;  4JI7 L;  2FHT A;  2GVA A;  4X65 Q;  3T13 A;  1QJO A;  4JG2 A;  2E2J H;  3L7Z C;  2UU9 Q;  4F8M A;  2RDG A;  4QIW B;  4DV7 L;  1EQV A;  2C9O A;  4MZ9 A;  5DAU A;  2HDL A;  2R92 B;  4A3G H;  2JA6 H;  4AYB G;  2NZO A;  4YCW A;  2IPK D;  4A3F G;  4LF7 Q;  3L2P A;  2KEE A;  4B08 A;  1NCV A;  4K5X A;  1Y8N B;  2ZXP A;  4P75 A;  4UY8 C;  1H95 A;  4OWT B;  1L2F A;  2E2H H;  1BNZ A;  4A3J B;  4KY5 A;  1E24 A;  3SK6 A;  4ZKB B;  2Q2H A;  3PIP A;  1V1O A;  3DWA A;  4GKK L;  3LWU A;  4K5V A;  3RZD H;  3NTI A;  1WI5 A;  2JA7 B;  4TSS A;  5IYB H;  3K80 C;  5DEH A;  4DUY Q;  1TWA H;  4DR4 L;  1OXU A;  2ICI A;  4BBS G;  1TU2 B;  4LFA Q;  3E5S A;  4WFN 3;  1PRT D;  3HOZ G;  4DR4 Q;  5FK9 C;  1SN8 A;  1SE3 A;  3A0J A;  4OIJ A;  3RN2 A;  5J39 A;  3QOL A;  2K6A A;  2PPB C;  1FGB D;  1HFG A;  4AQY L;  4A76 A;  2H4O A;  3ULJ A;  1KRT A;  2EIF A;  1XNQ L;  5IYD H;  2WKC A;  3GTG B;  2N55 A;  3W1G A;  3KDF A;  1F9S A;  3EQL C;  5AJ3 Q;  3HZX A;  1YVC A;  1X32 A;  1U4L A;  1PRT B;  4JI2 Q;  1VQA A;  2K5D A;  5C44 B;  4A93 G;  3D3R A;  1LTL A;  1O7Y A;  3LGJ A;  1I6H H;  4I65 A;  3HS0 C;  3H0G H;  4DV3 Q;  1TWH B;  3GTQ B;  1B53 A;  1EWI A;  4OO1 H;  4IUN A;  5G3L F;  1VQJ A;  1VQC A;  1UE7 A;  4HN7 A;  1ESF A;  1Z47 A;  1IBK L;  4LF9 Q;  2B2Y C;  1TT2 A;  5IIF A;  4BY7 H;  1I5F A;  3S1R H;  3KJO A;  4K14 A;  1WYD A;  4J8Q A;  1Q46 A;  1XPU A;  5ELO A;  5C44 H;  2QIL A;  1JWS D;  2JA5 G;  3BZC A;  1EWC A;  2UUA Q;  2F0S A;  4KHP Q;  5FOB B;  5DM7 3;  2O2L D;  5A2Q L;  3T1Y Q;  3TEH B;  2PW5 A;  1IXR A;  1PFM A;  1SDF A;  5KYL A;  3RLF A;  2JJQ A;  3QWN A;  5C4X B;  4QMG A;  2NVQ H;  3NPP A;  2K33 A;  1LT5 D;  4LMQ D;  5JAV A;  5C4J H;  4CJ2 C;  3GTO B;  1HNW Q;  1NUC A;  3D4W A;  3TP8 A;  4UPA A;  4QB4 A;  1RF2 D;  4EVO A;  1J5E Q;  5CGK A;  1QIL A;  2UUB Q;  3VR4 A;  5H1S E;  1TWF B;  3RMH A;  1DM0 B;  5M3F H;  2QDL A;  1SE2 A;  3BZD B;  2K75 A;  4B9X A;  1L0Y B;  3VDY A;  2F0H A;  3SGI A;  3CHB D;  4DV4 L;  4PMC A;  3W2D A;  3D8G A;  5JJI A;  3X3M A;  1JB7 A;  4BA2 I;  1P16 A;  2DJF C;  1U9R A;  5C3X A;  2E2H B;  3TP6 A;  2UUC Q;  4HSV A;  3OHX C;  2DNC A;  3MXU A;  4RFB A;  1G6Z A;  5CV7 A;  3IRB A;  2H5X A;  2L12 A;  5EKI A;  4OEL B;  1I6V C;  5EBD A;  1R9T B;  1S5C D;  1DJR D;  4C1N K;  3CC4 A;  1SNP A;  1QVC A;  2F0M A;  4WJ4 A;  2R3Z A;  1SJE D;  1A6X A;  5I2X A;  3VYU A;  1ZEQ X;  2SDF A;  3P1H A;  2A74 C;  3H3V I;  1DON A;  4C3H B;  3H91 A;  2NVY B;  5BR8 Q;  5ELD A;  3N52 A;  4YIJ A;  3FKI G;  2JA6 G;  5FLM H;  4YY3 Q;  1YJN A;  4DAY B;  1EYG A;  2F0U A;  1LTR D;  2CH4 A;  3SDZ A;  4BY1 B;  2LS0 1;  1LTB D;  2F0V A;  1I50 B;  4IAL A;  2YU9 B;  3KLW A;  4HJ8 A;  1PLF A;  1EOT A;  2A68 C;  1G6P A;  1AEX A;  4XQN A;  4CHT B;  5AFW A;  3NTH A;  3CCQ A;  1ILQ A;  4R8N A;  4MNO A;  2IY5 B;  3H94 A;  3FKI B;  3BS1 A;  1SYE A;  1ENC A;  1I94 L;  4RGM A;  1VQ8 A;  3KF6 A;  1TXY A;  5JJL A;  5C3W A;  4DR5 Q;  1JWM D;  2KVM A;  4IPG A;  3STB C;  3CP0 A;  3S1M B;  1A3U A;  3MXP A;  4JI1 Q;  1JCK B;  5IWA Q;  1KXL A;  1CQF A;  3TDQ A;  1QE6 A;  4ABN A;  4LUO A;  2BA1 A;  1RDP D;  1ASZ A;  3E3X A;  3F8T A;  2UUC L;  2PO4 A;  3PUX A;  4UAI A;  1GUS A;  3HRZ C;  2HQE A;  4R9W A;  3TZU A;  4H7B A;  2SOB A;  2MGS A;  3UI2 A;  1GHJ A;  3D6C A;  4Y7N B;  1SNM A;  4PZ8 A;  4LUV A;  4HJA A;  2F03 A;  2HDM A;  2F0J A;  4AYB E;  1C4Q A;  4V0B A;  3M3Y H;  5C4X G;  1ILP A;  3VR5 A;  3A56 A;  3CCJ A;  5KND A;  4AH6 A;  3HOW H;  2MNA A;  4ID6 A;  3TS0 A;  1QNK A;  2RDH A;  3HEJ A;  3K6O A;  3J81 i;  1E0B A;  2AMC B;  3TSS A;  4M1U B;  2R7Z H;  4F7X A;  4JI0 L;  2JA5 B;  1ET6 A;  1LUZ A;  3BDO A;  1PZK D;  3AYH B;  1PYB A;  3HOZ H;  5CV4 A;  2R7Z G;  2EZV A;  1D5X C;  2EY1 A;  4JV5 Q;  2K01 A;  3HOU H;  4DNT B;  3T1Y L;  1LTI D;  1JIC A;  4KK7 A;  3LWE A;  2KHI A;  4ZUI A;  2LFN A;  1J5E L;  3RLN A;  2OCE A;  3SK8 A;  4A3D B;  2NBF A;  1RTN A;  1W6J A;  5AJ3 L;  1SSO A;  1R4P B;  1SND A;  5TSS A;  5IGD A;  2B29 A;  1B4O A;  1TY2 A;  2AQ3 B;  2K5N A;  2MPM A;  4AQY Q;  1VQO A;  4A93 H;  5DLQ E;  5FJ8 H;  1SFO B;  4KY6 A;  1FNU A;  2M9V A;  2N3S A;  1GXD C;  5E7N A;  1YIJ A;  1LT6 D;  4BXX G;  4TRD A;  2CWA A;  1QUQ B;  4IUP A;  5LMN L;  3K5N A;  3WWV A;  3LX0 A;  4A3L G;  1S3O A;  2F3W A;  4GS3 A;  3BG3 A;  5A35 A;  1Q1B A;  1JR0 D;  2VY3 A;  4EQO A;  3M85 A;  4DPG A;  1FJG Q;  3GO5 A;  4A3L H;  1C0A A;  2PQE A;  4G7H C;  3D6W A;  4C3J H;  1S40 A;  1ZYR D;  4JVZ A;  4R4C A;  4GZY C;  4A3D H;  3NBH A;  3VR2 A;  4G57 A;  4DAP A;  1MKH A;  1EIG A;  3PIP 3;  5JEA G;  3HOU B;  3NWT A;  1XPO A;  1BKB A;  2F0L A;  3QIA A;  4RGO S;  4XQJ A;  5I9P A;  4LF7 L;  2B2W A;  1KDC A;  1SYD A;  2D0P A;  1PH1 A;  2F1M A;  4RCO A;  3EN2 A;  3FMC A;  5T1G A;  5JEA J;  1HNX L;  1D7Q A;  1D6E C;  1SMX A;  1Q7Y C;  1PTO D;  5JPM C;  3MEF A;  2UU9 L;  3ZJY C;  2B2U A;  4OEM B;  1XNR L;  2R61 A;  4KHZ A;  5M3F G;  1JB3 A;  3W1B A;  3OOC A;  1K73 C;  3HGB A;  1VQN A;  2ZJR A;  4UHV A;  4HSP A;  1WTQ A;  5HGT A;  2C5C A;  3DHQ A;  2F0G A;  1WVL A;  1XMQ Q;  4JI3 Q;  1MSH A;  5ELE A;  3GD7 A;  3R93 A;  5C0X I;  4A3F B;  2B2W C;  1JMC A;  2TSS A;  3J81 c;  2BDO A;  3SVM A;  2QGQ A;  1S5F D;  3V05 A;  1B3Q A;  4IUQ A;  3M4O H;  4QQB X;  3I73 A;  3PUV A;  5KNB A;  3BVZ A;  4X62 Q;  2E5L Q;  3MHB A;  2PMZ E;  2FFK B;  3OW7 A;  2EVB A;  1EZ8 A;  1VMP A;  1PHJ A;  1NNX A;  1J8I A;  4YCV A;  4GN5 A;  5FLX L;  3QR8 A;  4H02 A;  3J7A V;  1BBW A;  3QO2 A;  1N9W A;  1IBM L;  3TQY A;  2NN6 I;  4DA2 A;  2R7D A;  1YEZ A;  1IBL Q;  2OWO A;  5LMU Q;  2A69 C;  4DV0 Q;  1EFW A;  4BBR B;  1EY6 A;  1CQV A;  2RBM A;  5T1I A;  4A3K H;  3KF6 B;  1JJG A;  2BE5 D;  4Q0F A;  4ZLT F;  2NWG A;  4KHP L;  5FLX c;  3CCU A;  1O78 A;  2XVS A;  1SXT A;  5ELN A;  1F2L A;  1HQR D;  1SE4 A;  3JC6 6;  4LUZ A;  1HRJ A;  1YI2 A;  1E2W A;  4B3T Q;  2FMM A;  4HJ5 A;  2HUG A;  1Y1W G;  1EIY B;  2MO1 A;  3GTK H;  4RCN A;  3PIO 3;  1PFS A;  3NXW A;  1JQY D;  1KDA A;  1WOC A;  3SHL A;  4K0K L;  3OIQ A;  1FD7 D;  3T16 A;  2IW3 A;  1SYB A;  4JW0 A;  1BCP C;  4JBK A;  3AQQ A;  3VYS A;  3M7G A;  5IT9 c;  1SNC A;  3ERQ A;  3I4N B;  5LMN Q;  1E1O A;  4RG1 A;  4F88 A;  1CHP D;  3I4M H;  1WCM G;  5IGC A;  4IPD A;  4JI2 L;  2EYL A;  3KLS X;  5IT9 E;  2KHJ A;  2XWJ B;  4E6I A;  1WCM H;  4APV A;  2NVT B;  4DR5 L;  1E2Z A;  4NXM L;  5DNF A;  1PRT F;  2JA7 G;  5GRO A;  1OO9 B;  1VQF A;  2Z4I A;  3A8K E;  3RD4 A;  5NUC A;  4DR2 Q;  3OWE B;  1KLU D;  2PQA A;  3BYT B;  5IOC A;  2FMC A;  3FVQ A;  5IYC G;  4CDF C;  4JI6 Q;  1JOK A;  3KDF B;  5L37 A;  1PTO H;  2JSO A;  1DGS A;  2Q8R E;  1ICF B;  4HJ9 A;  1A2U A;  4C3J G;  2EYO A;  4MHE A;  4GOP C;  5D3I B;  1Y69 U;  2K1B A;  1NY4 A;  3MWY W;  2L5T A;  4P72 A;  1HJP A;  3A74 A;  5JJZ A;  2NVT H;  3H3V H;  3C46 A;  4DR1 Q;  3M3Y B;  1EIF A;  5JEA H;  5BN3 A;  4X6A H;  1Y1V G;  2HT1 A;  4CDD C;  2R7Z B;  1CHQ D;  1DOM A;  4OHJ A;  3U9S A;  1R9T H;  3R2T A;  1VQE A;  5M3M B;  1NSN S;  2UUB L;  3AFQ A;  1H9K A;  5CV8 A;  1IL8 A;  1L1O B;  1E22 A;  4X3U A;  3PUZ A;  1STG A;  3U58 A;  2HIX A;  1STB A;  3NBH B;  3DXJ C;  2VQE L;  1II3 A;  2Z9H A;  1PH3 A;  2B2V C;  1EYA A;  3BVG A;  3S14 H;  4JI4 L;  3M7N A;  1Q86 C;  5ELC A;  1QZG A;  3F2C A;  4JI4 Q;  1YNN C;  1UWV A;  1TY0 A;  3K7A H;  1HTP A;  2A73 B;  4FF1 A;  5C5M A;  3NEL A;  3U4Z A;  3V2T A;  2RDF A;  3UE0 A;  2Q2T A;  1HA5 A;  1A0I A;  3X3N A;  3S17 B;  1HUN A;  1Q12 A;  4NDX A;  4IFD G;  1VF5 C;  4B3S L;  3Q24 A;  3G48 A;  4A3E H;  4IUV A;  3NHH A;  1HFN A;  4QCL A;  3A8J E;  3NQT A;  1VDZ A;  4DNR B;  1IW7 C;  1TS4 A;  4AIM A;  3CQZ H;  3K8A A;  1PH4 A;  3S2D H;  2CKZ B;  1PRT C;  2F0K A;  1OTC A;  2E76 C;  1V9P A;  5GAG C;  2UXD L;  1HZ9 A;  1EY4 A;  2WAQ E;  4L5S A;  4O0A A;  3CCM A;  1HR0 Q;  2XWB B;  4KI0 A;  2HHH Q;  1KNA A;  1NMG A;  5FLM G;  2R7F A;  1Q90 A;  5I2Y A;  5DM6 3;  1BCP B;  3NEN A;  5C44 G;  1U4R A;  2ZXO A;  4A93 B;  1TS2 A;  3PSI A;  1KAW A;  2F4V L;  1VQ5 A;  3CC7 A;  3BZK A;  2YV5 A;  3S1Q B;  1K9M C;  2F0D A;  1TWG B;  3MEH A;  3OPO A;  1Q82 C;  1KIX A;  1S4Z A;  3W5O A;  4QL5 A;  2DY7 A;  1PTO C;  3DWQ A;  3A7L A;  4L6T B;  4JK1 C;  2B8F A;  1VQ4 A;  1XYI A;  2G9D A;  2A69 D;  5EGT A;  4XYO A;  4N8X 1;  1BBX C;  4DK0 A;  2R93 H;  4L5Q A;  1BOS A;  1F77 A;  1CKO A;  2NTT A;  3U50 C;  2VZA A;  5LMU L;  2KHS A;  4RA8 A;  1EOV A;  1STN A;  2M2L A;  3CF5 A;  3HOY B;  3CW2 C;  2CVR A;  4U68 A;  2F0W A;  3UDG A;  4NP5 A;  3I56 A;  3H09 A;  1WFQ A;  1U4M A;  2Z6B A;  1H9R A;  3PF5 A;  4X64 Q;  5JJK A;  1G8Z D;  2A19 A;  1G2S A;  1V1P A;  4DAY A;  1IW7 D;  1SRO A;  2ID0 A;  4PG3 A;  3P75 A;  4XYQ A;  1UAP A;  3PQI A;  3CD6 A;  1G51 A;  1F9P A;  1LTS D;  1SAP A;  1VQH A;  3KK7 A;  3TN2 A;  1GHK A;  3GTJ B;  1NBW A;  2I5L X;  2RHS B;  4OGQ C;  5E4X A;  2PNH A;  4A3M H;  3MXG A;  1PH7 A;  2Z4H A;  1Q1E A;  4GN4 B;  4OX9 Q;  3TP7 A;  2LMC B;  3IFT A;  4POF A;  2VW9 A;  1JE4 A;  3NP8 A;  2VXW A;  3ER0 A;  5D14 A;  5A2Q E;  4KKU A;  4A3F H;  5J22 A;  4TQU S;  1F2Z A;  4PMB A;  4CGY B;  1X56 A;  1RKN A;  5KNC A;  4EQN A;  1D1I A;  4DV6 Q;  1TWH H;  2F0I A;  3TS2 A;  1Z7T A;  1PFB A;  1KTK A;  3BYY B;  1K3R A;  5ELB A;  3CXC A;  1XMO L;  5IYB G;  4WJW A;  2AUK A;  1D2B A;  5IOD A;  2V1C C;  3CCS A;  4KD3 A;  1I4Q A;  2OXP A;  4A3I B;  4XTC S;  2Z0S A;  5ISR A;  3K5M A;  4ILW A;  2D62 A;  1SYG A;  1AP0 A;  2ZM6 L;  4ZUJ A;  4JBJ A;  3C2P A;  2EYH A;  5E1F A;  3T51 B;  2WB1 B;  4I7Z C;  2HCC A;  4L63 B;  1BXT A;  2O4X A;  3HOV B;  4C3I H;  3K0Y A;  3T56 B;  2OQ0 A;  2PMZ B;  4NXM Q;  3KFU A;  1H9M A;  2KUM A;  1FNV A;  1B44 D;  2K5W A;  5GQO A;  4A3B G;  4NXN L;  1HZC A;  2C35 B;  5EPJ A;  2KJX A;  2BA0 A;  1KHI A;  2PQA B;  3NSW A;  2K5H A;  1SE8 A;  4DUY L;  3EFX D;  3H0G G;  3T53 B;  1TWF H;  1VQI A;  1XJV A;  4EQP A;  3MA2 B;  4N9P A;  3MAQ A;  3EIV A;  4G7Z C;  4IN3 A;  2WIN B;  1Z6H A;  4QIW E;  1VQ9 A;  1EZ6 A;  1STH A;  3PIO A;  1ML0 D;  1I4R A;  1I4P A;  3HKS A;  3RR5 A;  1GUW A;  3S1M H;  5IT9 L;  4B3S Q;  2TMP A;  1AE3 A;  3URY A;  3FPP A;  3CU7 A;  2YTY A;  5EQ0 A;  3Q22 A;  4DV5 Q;  5KGU A;  4FF3 A;  2VUM G;  1DOL A;  2A6E C;  4LFC Q;  2EQS A;  1IBL L;  1UE1 A;  4C56 C;  5C4J B;  2J0T D;  2PCF B;  4DXG A;  4GOP A;  4L8J A;  1G91 A;  1OXT A;  2ATW A;  1GJX A;  4A75 A;  3S1Q H;  4C3I B;  2D5D A;  4RMF A;  2R93 B;  1XPR A;  4C3H G;  2RSO A;  4BBR H;  4DV1 L;  3P7J A;  1B70 B;  3OTO L;  3NK9 A;  2UXB L;  1PA6 A;  1F9R A;  4LW1 A;  4R8I A;  1TS3 A;  3JAM E;  2CHB D;  3Q6S A;  4CDE C;  1ASY A;  3VA7 A;  1LT4 D;  5E3F A;  3UDI A;  1HNZ L;  4C3J B;  1CM9 A;  1CZW A;  2E74 C;  1H9J A;  4BA1 I;  1D5Z C;  1BVS A;  2FJ2 A;  3C1E A;  1TII D;  2HD3 A;  4MTK A;  3CCE A;  2UUA L;  2JEA I;  1QG7 A;  4A3C G;  5EPK A;  2B2Y A;  3KOJ A;  3S2H B;  4IJH A;  3T1H Q;  4UDU C;  1EY0 A;  5HUR A;  2NZH A;  4GNX A;  1Y1W H;  1LO5 D;  1MIU A;  3S2D B;  2L55 A;  1D5M C;  4DKA C;  4DR3 Q;  3EJI A;  3I55 A;  3S16 H;  2QF7 A;  1LV9 A;  1MSG A;  1AW7 A;  4GLA C;  5KRU A;  5M5Y B;  4LF5 Q;  3KF8 B;  5E4W C;  2GA4 B;  3QB3 A;  4QF4 A;  4YHH Q;  4IOA A;  2OEO A;  2IX0 A;  1G29 1;  1QWY A;  1L1O C;  1TWC H;  1XX8 A;  4H0L C;  1I50 H;  2HQL A;  3CCR A;  1A63 A;  4LF6 Q;  4DV2 Q;  1QZH A;  1XNR Q;  3HOW B;  4A3I H;  2F0F A;  1SRU A;  2KBN A;  1HCZ A;  2BOS A;  4PNY A;  5IGG A;  4A3I G;  2ES2 A;  2Q8T A;  1VQL A;  2NVX H;  1EY8 A;  1JE5 A;  1TQO A;  1IL2 A;  5LL6 X;  4BY7 B;  3QG1 A;  4A3M G;  3PO3 B;  4NB3 A;  1KNE A;  3F2B A;  1T5E A;  1TVX A;  3M9B A;  3HOV G;  1VQK A;  4YWK A;  1N36 L;  4MTN A;  2BE5 C;  4K6D A;  1WTX A;  4DV7 Q;  3R2I A;  1X3E A;  4AYB B;  5FLX E;  1DOK A;  2JK8 A;  4DU9 A;  1YHQ A;  3I4N G;  4FXK C;  1U0L A;  2DGY A;  4A3B H;  1N33 Q;  3PO2 G;  4IO9 A;  4IQZ A;  4DV4 Q;  5M5Y H;  3I91 A;  5CMD A;  2LXK A;  2ZM6 Q;  1EQT A;  2PI2 E;  2KEC A;  5ELF A;  3OW2 A;  3G7L A;  4GNX C;  1CKN B;  3C3L A;  2CH4 W;  3A55 A;  2VS1 A;  1GUG A;  1YBY A;  4O42 A;  3VYT A;  4DUZ L;  1YZ6 A;  1VQM A;  1AZQ A;  4JI0 Q;  1ET9 A;  1CA5 A;  5BN5 A;  2DN8 A;  4K8J A;  4OWX B;  5C0X H;  2A5H A;  4CKB A;  1A62 A;  4N9T A;  3I3C A;  3VR3 A;  2YYZ A;  1MJE A;  4BBS H;  1YNJ D;  2YU9 H;  3V96 A;  1SYC A;  4UP9 A;  1PDQ A;  2F0O A;  4FVM A;  1UNS A;  3PV0 A;  1EQQ A;  1DCZ A;  1E7Z A;  4DK1 A;  4PZ7 A;  5HY6 A;  3CCV A;  4DV1 Q;  1A3V A;  2PI2 A;  2QEX A;  3ITP A;  1GVP A;  4IFD H;  1NJI C;  1HTL D;  5G3L D;  4GLV B;  3D0F A;  3K57 A;  3GTL H;  1HH2 P;  3ERS X;  1AE2 A;  3TRZ A;  3RZO B;  1EY9 A;  4DR7 Q;  1JC7 A;  3EA6 A;  3I4O A;  3J7A F;  4TVA B;  1HZA A;  5J3B A;  1N34 Q;  5IWA L;  3K7U C;  2L1B A;  4LFC L;  3B6Y A;  4XXE A;  1J9O A;  2PW7 A;  1QB5 D;  4IZ8 A;  3HKZ E;  4LWC A;  1AH9 A;  3W3A A;  1E2V A;  1HHV A;  1XNQ Q;  2E75 C;  1GM5 A;  2D9U A;  2E2D C;  3GTL B;  4IOC A;  2X69 A;  1X9N A;  4DUZ Q;  4HIM A;  4Q5V A;  3R3O A;  2LSS A;  1K8A C;  2EPB A;  3SK4 A;  2Z1C A;  2OQK A;  5HGQ A;  1FJG L;  4HJ7 A;  1SJH D;  2AWN A;  5EJW A;  4CBV A;  4UP8 A;  1EQR A;  2RCN A;  1Y1V H;  4LF4 Q;  2EY6 A;  2JN4 A;  4C2M H;  2YTV A;  4K8I A;  2XTI A;  4JI6 L;  4LF5 L;  4RKL A;  2XRS D;  3Q23 A;  1BO0 A;  4A3M B;  1T5X D;  3GTJ H;  3JAM i;  1WTR A;  3PUY A;  5M5W B;  3TP5 A;  2IHE A;  4DR6 L;  2EDG A;  3QJY A;  2I0Q A;  4KD4 A;  2JYO A;  4YHH L;  4LF6 L;  4PQX A;  1ZKO A;  1JJC B;  3A7A B;  3I2Z A;  5CC4 A;  2J4X A;  1UEB A;  3H15 A;  3S15 H;  3S17 H;  1KD1 C;  1LTT D;  4JV5 L;  2B2T C;  4ZCK A;  3UDX A;  4QY7 A;  1VCI A;  4OWW B;  1EU4 A;  2MP1 A;  1RJT A;  4I7A A;  4J15 A;  4HID A;  5IE8 A;  3OWF A;  4X65 L;  2QA4 A;  3I4M B;  1Q3L A;  3FP9 A;  3I7F A;  1ONL A;  2CW0 C;  4EQ5 A;  1SNQ A;  3J80 E;  4JYA Q;  1NE3 A;  4P73 A;  4DR3 L;  2N8N A;  2PZU A;  1M1K C;  1CSQ A;  3DM3 A;  4KN4 C;  1WTV A;  3GTM B;  2MJ8 A;  2SNM A;  1K0S A;  2XN9 C;  4JOI C;  2OT2 A;  1B7Y B;  2WAC A;  1HR0 L;  1QVF A;  1N32 Q;  3HKZ G;  4V19 0;  2F0T A;  2K04 A;  4JI8 L;  1NAP A;  1L0W A;  2BDN A;  2BH8 A;  1RIP A;  1CT1 D;  3E0J A;  3MFY A;  2E5L L;  1HNZ Q;  5K36 G;  4X62 L;  2KED A;  5M9O A;  4X66 L;  3FEW X;  3J7Y W;  2IHF A;  3I70 A;  1SMY C;  4KMU C;  3T4A C;  4CKE A;  3A8I E;  4K5W A;  1BR9 A;  1W3S A;  5I4D A;  2ZT9 C;  3OTO Q;  2OTJ A;  1I4H A;  1IZ6 A;  3K59 A;  2L15 A;  1V1Q A;  5IP9 G;  1A15 A;  4OIK A;  5C5L A;  1F2M A;  1TWA B;  1V1P B;  3RN5 A;  2GN5 A;  2A6H D;  4ZK9 B;  4DXF A;  3CPF A;  1DZ1 A;  4KKT A;  4CJ0 B;  2K14 A;  2OTL A;  1HQM C;  2NUC A;  2E2I H;  2EXD A;  4C3I G;  2F3I A;  4DV5 L;  3BDL A;  3S1R B;  1PH9 A;  1XTD A;  1V8Q A;  2XSC A;  2Z6K A;  4R4I A;  4U67 3;  4XT3 B;  1DXM A;  2K5V A;  1VQD A;  3MC0 B;  4POG A;  1QVG A;  2P5Z X;  3HOX G;  1Q8I A;  2YTX A;  5C4H A;  5I6W A;  2CWP A;  1LAB A;  2VUM B;  3HOX H;  4MIU A;  4LF9 L;  3O13 A;  1K0R A;  4YCU A;  4B3M Q;  3K0X A;  1BUV T;  1JOR A;  2MQH A;  2K52 A;  3HP3 A;  1AN8 A;  1VF7 A;  3SEB A;  2WAQ B;  3A54 A;  1X65 A;  2JE6 I;  3MTS A;  1FVI A;  2I46 A;  2IX3 A;  4XDX A;  4BY7 G;  4HAE A;  2N78 A;  5FO8 B;  1LLR D;  1ICW A;  1IKM A;  2JEB I;  5K5P A;  4DR2 L;  1WTH A;  4FP5 D;  4FO2 A;  1Z9F A;  1BCP F;  3HOU G;  2WB1 G;  3J80 L;  1PV4 A;  3KLS A;  5D3D A;  2GVB A;  4QGU A;  3GDE A;  1GO3 E;  2EYF A;  2EXZ A;  2KCM A;  1HA6 A;  3L0O A;  4HCE A;  4JOI A;  4JI5 Q;  1VQB A;  4J1M A;  4RH6 A;  1Y8O B;  2G9H D;  2E2I B;  2ZTC A;  3AB9 A;  2EJF C;  3OIP A;  1B3A A;  3K5L A;  3VYR A;  1A2T A;  1MI2 A;  1PTO B;  2EYP A;  2FIN B;  1QUQ A;  4LFB L;  4XT1 B;  5M5X H;  1WD0 A;  3J80 c;  1WTW A;  1ESR A;  5JPN C;  3ND9 A;  3F1Z A;  4A3J H;  1C7Y A;  2WFW A;  4DR7 L;  2JA8 H;  3CC2 A;  1A8V A;  3AFP A;  2R92 G;  5CR3 A;  3GTP B;  3PUW A;  2JA8 B;  1EYC A;  1GD7 A;  3S2H H;  1F2Y A;  4YWM A;  1B2T A;  4B3T L;  4ZQ3 A;  1P8L A;  4A4I A;  4A3D G;  1VQG A;  2EYM A;  2JP1 A;  2B63 H;  1V43 A;  2EY5 A;  3NE5 B;  3CQZ B;  1LTG D;  4DGZ A;  4L5T A;  2K4K A;  1BBU A;  4M8A A;  3NQI A;  5FO9 B;  4OX9 L;  2KCN A;  1KDB A;  1SBB B;  4RHS A;  1KL9 A;  2L0C A;  4OON A;  4X66 Q;  4ALP A;  1GUN A;  4C1N I;  1WD1 A;  1IKL A;  4RHR A;  3CMA A;  1B9M A;  4HTH A;  2Z6K C;  1L0X B;  1PFN A;  4K2L A;  5M3M H;  3TRE A;  2I5M X;  4QUC A;  2RVL A;  3PMF A;  4DV3 L;  1B50 A;  1Y14 B;  4ZYS A;  1D8L A;  3OMC A;  1CZG A;  4KV6 A;  3HOY G;  1HXY D;  5M3M G;  1M90 C;  1HR0 W;  3F2U A;  2VB2 X;  4GOP B;  5M3F B;  2RKS A;  3AU7 A;  1WTP A;  4LNQ A;  1RL2 A;  5D65 A;  4Z9C B;  3TME A;  2RQX A;  3S16 B;  3MZ5 A;  2HIV A;  3DEO A;  1IBK Q;  1N33 L;  4PMW A;  3SK5 A;  4JI3 L;  4B3M L;  2Y0S E;  5IGE A;  4IJL A;  4GLX A;  3QOJ A;  3N6R A;  4IUT A;  2NVQ B;  2NB0 A;  1PH5 A;  2RA4 A;  5LHY 1;  3P20 A;  2CCZ A;  3TZD A;  1HPC A;  2NZ1 D;  1IYV A;  3CAM A;  4UP7 A;  5CV5 A;  4LFB Q;  3BU2 A;  3GQB A;  1X3G A;  2QEJ C;  2KOL A;  4DK3 C;  1EY5 A;  4NXN Q;  2VQF Q;  1YHA A;  1DD2 A;  1CK1 A;  1KQS A;  1H9S B;  1TS5 A;  2IL8 A;  3BDC A;  4KHV A;  2M00 A;  3J81 E;  2QKI C;  3UE1 A;  1MBY A;  2I5H A;  4FF4 A;  4A3G G;  1X6O A;  1LT3 D;  2DNE A;  1LAC A;  3HG9 A;  4HMI A;  3Q0A A;  1N36 Q;  1K8G A;  3I4N H;  4BWG B;  2EYJ A;  2A6E D;  3WDN A;  2CW0 D;  2F0N A;  5CBA E;  2HHH L;  1LM0 A;  4MN3 A; 
#chains in the Genus database with same CATH homology
 1YEZ A;  1IBL Q;  3J81 j;  4ME3 A;  5LMU Q;  1I50 H;  2HQL A;  2OWO A;  3CCR A;  1A63 A;  4DV0 Q;  5GAH C;  4DV2 Q;  1QZH A;  4LF6 Q;  2A8V A;  1XNR Q;  4B3R L;  1EFW A;  1EUJ A;  2IX1 A;  4A3I H;  4A3K H;  4BY1 H;  3KF6 B;  1JJG A;  2K50 A;  1SRU A;  2KBN A;  4R4T A;  4YY3 L;  4L5R C;  4JBM A;  3A5U A;  4B3R Q;  2CFM A;  4KHP L;  1N8R C;  3G6E A;  5FLX c;  3A5Z B;  1KC8 C;  3CCU A;  5ELN A;  1HNW L;  4A3I G;  3RLO A;  4JI7 Q;  4HIO A;  3JC6 6;  2ES2 A;  1VQL A;  4LUZ A;  4YWL A;  3J80 i;  1YI2 A;  2NVX H;  3UDF A;  4B3T Q;  2XGT A;  4GN3 B;  1Q8K A;  1JE5 A;  1FGU A;  5EAY A;  4HJ5 A;  1S72 A;  1IL2 A;  4JI7 L;  1Y1W G;  1EIY B;  2MO1 A;  3GTK H;  2GVA A;  4A3M G;  4X65 Q;  1PFS A;  4NB3 A;  5C3E H;  3F2B A;  4JG2 A;  2E2J H;  3L7Z C;  3M9B A;  3HOV G;  3F2D A;  1VQK A;  4YWK A;  1N36 L;  2UU9 Q;  4MTN A;  1WOC A;  4EX5 A;  2N49 A;  1SR3 A;  4DV7 L;  4K0K L;  4JBK A;  3AQQ A;  4MZ9 A;  5IP7 H;  4DNI A;  4A3G H;  2JA6 H;  4DV7 Q;  1X3E A;  4AYB G;  5IT9 c;  2NZO A;  4YCW A;  3KYH C;  2JK8 A;  1YJW A;  1YHQ A;  3I4N G;  4A3F G;  5IP7 G;  5LMN Q;  1E1O A;  1U0L A;  2DGY A;  4RG1 A;  3L2P A;  1WCM G;  3CME A;  4LF7 Q;  4UY8 C;  4IO9 A;  4P75 A;  5IY0 A;  4R4O A;  4DV4 Q;  4OWT B;  4IPD A;  5M5Y H;  1SFO H;  1H95 A;  4JI2 L;  1L2F A;  2Y0S G;  2E2H H;  3D31 A;  2KHJ A;  5GAD C;  2LXK A;  2ZM6 Q;  1WCM H;  4APV A;  1E24 A;  4DR5 L;  3STB D;  4NXM L;  2Q2I A;  1VQ6 A;  2PI2 E;  1MJC A;  2Q2H A;  3ULL A;  3PIP A;  3OW2 A;  4GKK L;  4GNX C;  3RZD H;  1B8A A;  1WI5 A;  1CKN B;  2JA7 G;  4WJ3 M;  2VS1 A;  5GRO A;  5IYB H;  1YBY A;  3K80 C;  4JI1 L;  1VQF A;  2KEN A;  2JA8 G;  4DUY Q;  5GAE C;  1YZ6 A;  4DUZ L;  1VQM A;  2UXB Q;  4JI0 Q;  1OXX K;  1TWA H;  4DR2 Q;  2R92 H;  1OXU A;  4OWX B;  5C4X H;  4DR4 L;  4BBS G;  2PQA A;  4LFA Q;  1A62 A;  5IYC G;  3HOZ G;  4JI6 Q;  3KDF B;  4DR4 Q;  1SN8 A;  3A0J A;  3RN2 A;  2YYZ A;  1MJE A;  1I94 Q;  4BBS H;  3FHW A;  3ULP A;  3HOV H;  4OO1 I;  1DGS A;  2YU9 H;  2VQE Q;  5IYC H;  3H3V H;  4HJ9 A;  2D0O A;  4UP9 A;  2JA5 H;  2B63 G;  1X55 A;  4GOP C;  1EQQ A;  3PV0 A;  1E7Z A;  3M4P A;  1UE5 A;  1NY4 A;  1IYJ B;  4AQY L;  4PZ7 A;  4A76 A;  2FXQ A;  4P72 A;  3ULJ A;  1HJP A;  1KRT A;  1LYL A;  2EIF A;  2ZTD A;  3A74 A;  5HY6 A;  1XNQ L;  3PF4 A;  2NVT H;  3W1G A;  3KDF A;  2PI2 A;  3CCV A;  4DV1 Q;  2QEX A;  5AJ3 Q;  1GVP A;  4DR1 Q;  3AEV A;  1YVC A;  1NJI C;  3GTM H;  1EIF A;  4JI2 Q;  3Q8D A;  4GLV B;  3D0F A;  4X6A H;  1VQA A;  1Y1V G;  2HT1 A;  3GTL H;  4A93 G;  3ERS X;  1HH2 P;  1AE2 A;  3ICE A;  1LTL A;  2DUD A;  4XIG S;  3TRZ A;  4DR7 Q;  2WB1 E;  3I4O A;  3LGJ A;  1CKN A;  1I6H H;  3G4S A;  1R9T H;  1VQE A;  1GKH A;  3H0G H;  4TVA B;  4DV3 Q;  2ASB A;  1HZA A;  5J3B A;  1N34 Q;  3AFQ A;  5IWA L;  1EWI A;  3K7U C;  2UUB L;  3E0E A;  4LFC L;  1VQJ A;  1VQC A;  3B6Y A;  1UE7 A;  1L1O B;  1E22 A;  3MXN B;  3PUZ A;  3U58 A;  2HIX A;  3NBH B;  3E9H A;  5FJ8 G;  2VQE L;  3S1N H;  1Z47 A;  1IBK L;  3E9I A;  1PH3 A;  4LF9 Q;  4BY7 H;  3S14 H;  3HKZ E;  5LMN W;  3CCL A;  4JI4 L;  1Q81 C;  1VQP A;  3GTG H;  1I5F A;  4LWC A;  1Q86 C;  3S1R H;  2VUM H;  3M7N A;  3KJO A;  3RZO H;  1QZG A;  1AH9 A;  1WYD A;  3F2C A;  1XNQ Q;  1GM5 A;  1Q46 A;  4JI4 Q;  1XPU A;  5ELO A;  5C44 H;  1UWV A;  4IOC A;  3K7A H;  1X9N A;  4DUZ Q;  4HIM A;  2JA5 G;  4IPC A;  2LSS A;  3BZC A;  1K8A C;  2UUA Q;  3NEL A;  4KHP Q;  2UXC Q;  5M5W H;  3U4Z A;  2OQK A;  4GKK Q;  5HGQ A;  1FJG L;  3UE0 A;  4HJ7 A;  3T1Y Q;  4A3E G;  5IYD G;  4DV2 L;  1WJJ A;  1A0I A;  2AWN A;  3TEH B;  2Q2T A;  1IXR A;  1Q12 A;  3RLF A;  2JJQ A;  4IFD G;  4B3S L;  2NVQ H;  4UP8 A;  1UE6 A;  4LF8 L;  1EQR A;  3G48 A;  5C4J H;  4A3E H;  4BBR G;  1IBM Q;  2WP8 J;  1HNW Q;  2RCN A;  1Y1V H;  4LF4 Q;  4AIM A;  3CQZ H;  3K8A A;  2YTV A;  4C2M H;  2XTI A;  1PH4 A;  3S2D H;  4JI6 L;  4UPA A;  2CKZ B;  4LF5 L;  1OTC A;  1J5E Q;  4P71 A;  1V9P A;  5GAG C;  1N34 L;  2UUB Q;  2UXD L;  1HZ9 A;  5H1S E;  2WAQ E;  1VS0 A;  4L5S A;  4O0A A;  3CCM A;  1OXV A;  4OO1 G;  3GTJ H;  3K81 C;  1HR0 Q;  3JAM i;  5M3F H;  3PUY A;  2UXD Q;  4KI0 A;  2HHH Q;  2K75 A;  3FKI H;  4K0K Q;  2IHE A;  1NMG A;  5FLM G;  3VDY A;  4DR6 L;  2F52 A;  4DV6 L;  3SGI A;  4DV4 L;  2I0Q A;  2R7F A;  4YHH L;  4DV0 L;  4LF6 L;  5IYD H;  3NEM A;  1JJC B;  3I2Z A;  1XMO Q;  5JJI A;  1UEB A;  1JB7 A;  3H15 A;  4BA2 I;  4JI8 Q;  3NEN A;  3S15 H;  1P16 A;  5C44 G;  3S17 H;  1KD1 C;  3PSI A;  4JV5 L;  1XMQ L;  1KAW A;  3UDX A;  4QY7 A;  1VCI A;  2UUC Q;  4OWW B;  2F4V L;  1VQ5 A;  3CC7 A;  3BZK A;  2YV5 A;  1CUK A;  1X54 A;  1X3F A;  4J15 A;  1K9M C;  4HID A;  3PO3 H;  1NTG A;  3IRB A;  2H5X A;  5IE8 A;  4X65 L;  2QA4 A;  1Q82 C;  1KIX A;  3GTQ H;  3FP9 A;  3I7F A;  4QL5 A;  3W5O A;  2ZJQ A;  3OYY A;  4GKJ Q;  2NVY H;  3G71 A;  3CC4 A;  4EQ5 A;  2RF4 A;  4JYA Q;  1QVC A;  1CKM A;  4DAM A;  1NE3 A;  4P73 A;  4DR3 L;  2R93 G;  1L1O A;  1E3P A;  2N8N A;  1M1K C;  4WJ4 A;  1VQ4 A;  1CSQ A;  3DM3 A;  5C3E G;  2R93 H;  1J6Q A;  4JOI C;  3PO2 G;  1B7Y B;  4L5Q A;  1JJ2 A;  3H3V I;  1CKO A;  3U50 C;  1HR0 L;  2VZA A;  5LMU L;  1QVF A;  1N32 Q;  3HKZ G;  5BR8 Q;  4JC0 A;  4JI8 L;  3FKI G;  1L0W A;  1YJ9 A;  5FLM H;  2JA6 G;  1EOV A;  4YY3 Q;  1YJN A;  4DAY B;  1EYG A;  2BH8 A;  4IPH A;  3CF5 A;  1RIP A;  4R1J A;  3CW2 C;  2E5L L;  1HNZ Q;  5K36 G;  3I4M G;  4X62 L;  3UDG A;  3I56 A;  3HFZ B;  4X64 L;  4X66 L;  1WFQ A;  3KLW A;  2KCT A;  1PH2 A;  4JI5 L;  4HJ8 A;  2IHF A;  1NMF A;  4Y52 H;  2AKW B;  3PF5 A;  4X64 Q;  3BJU A;  3PGZ A;  5JJK A;  2A19 A;  4P74 A;  1G6P A;  1W3S A;  3OTO Q;  1HNX Q;  2OTJ A;  1SRO A;  2ID0 A;  4PG3 A;  3CCQ A;  4FDB A;  4MNO A;  1KRS A;  3PCO B;  2JA7 H;  1G51 A;  1IZ6 A;  3CD6 A;  2IY5 B;  4LF4 L;  1I94 L;  2L15 A;  1V1Q A;  1VQH A;  5IP9 G;  1VQ8 A;  1NBW A;  2I5L X;  2RHS B;  3KF6 A;  4A3K G;  1PVO A;  2PNH A;  1TXY A;  2B3G A;  4A3M H;  1PH7 A;  3HOW G;  5JJL A;  4DR5 Q;  4LFA L;  4GN4 B;  1Q1E A;  4OX9 Q;  4IPG A;  2MO0 A;  3STB C;  3CP0 A;  3RN5 A;  2GN5 A;  4POF A;  2VW9 A;  4R4Q A;  3CPF A;  2LXJ A;  4JI1 Q;  3ER0 A;  2K14 A;  1E1T A;  5IWA Q;  2OTL A;  5BR8 L;  1KXL A;  2F4V Q;  2E2I H;  2EXD A;  4IFD J;  2F3I A;  4A3F H;  4DV5 L;  4TQU S;  4LUO A;  1PH9 A;  1XTD A;  2Z6K A;  4KLK A;  4QJF A;  1W2B A;  4R4I A;  2BA1 A;  3U4V A;  1YIT A;  1X56 A;  1VQ7 A;  1CSP A;  1VQD A;  2K5V A;  1ASZ A;  3F8T A;  2UUC L;  4POG A;  1QVG A;  2IT1 A;  3PUX A;  3HOX G;  1TWH H;  3JAM c;  4DV6 Q;  4HIK A;  3TS2 A;  2YTX A;  1K3R A;  2CWP A;  4GNX B;  3CXC A;  1XMO L;  5IYB G;  3J7A 5;  3HOX H;  4PZ8 A;  4LUV A;  4HJA A;  4LF9 L;  4DK6 C;  1TWG H;  1K0R A;  2V1C C;  4BY1 G;  4YCU A;  1YHB A;  3CCS A;  4AYB E;  4A3J G;  4B3M Q;  3K0X A;  3M3Y H;  5C4X G;  4XTC S;  2MQH A;  2K52 A;  2Z0S A;  5IP9 H;  2R6G A;  1K83 H;  3CCJ A;  2WAQ G;  4AH6 A;  3HOW H;  2MNA A;  2D62 A;  1X65 A;  2JE6 I;  3TS0 A;  1FVI A;  4BY7 G;  3J81 i;  2ZM6 L;  3T1H L;  2AMC B;  4JBJ A;  2N78 A;  2R7Z H;  4JI0 L;  2JEB I;  1LUZ A;  4DR2 L;  3EBE A;  1Z9F A;  3AYH B;  1PYB A;  3HOU G;  3HOZ H;  2VNU D;  2WB1 G;  2R7Z G;  1PV4 A;  2NN6 G;  2GVB A;  4C3I H;  2E8G A;  4QGU A;  3GDE A;  1GO3 E;  4PZ6 A;  2OQ0 A;  4JV5 Q;  3HOU H;  2KCM A;  3T1Y L;  4NXM Q;  3KFU A;  3L0O A;  1N33 Q;  2KHI A;  2ZTE A;  4JOI A;  4JI5 Q;  1VQB A;  2CQO A;  1J5E L;  3RLN A;  5GQO A;  4A3B G;  2OCE A;  2ZTC A;  1HZC A;  4JBW A;  4NXN L;  3PO2 H;  2C35 B;  2BA0 A;  1KHI A;  2PQA B;  2K5H A;  2ALY B;  1SE8 A;  3M4Q A;  4DUY L;  3H0G G;  5AJ3 L;  1TWF H;  4DR1 L;  1VQI A;  1XJV A;  4JYA L;  1QUQ A;  3J7Z C;  4LFB L;  5M5X H;  3J80 c;  1N32 L;  4AQY Q;  2B29 A;  2K5N A;  4A93 H;  3EIV A;  1VQO A;  5DLQ E;  3S24 A;  5FJ8 H;  3F1Z A;  4A3J H;  4QIW E;  1C7Y A;  2WFW A;  1VQ9 A;  4DR7 L;  3HOY H;  2Q2U A;  2N3S A;  5E7N A;  2JA8 H;  1YIJ A;  3PIO A;  3CC2 A;  1A8V A;  4BXX G;  3HKS A;  2CWA A;  3AFP A;  3RR5 A;  1QUQ B;  2R92 G;  3PUW A;  5C0X G;  5LMN L;  3S1M H;  1GD7 A;  4B3S Q;  3WWV A;  3S2H H;  1AE3 A;  4A3L G;  1S3O A;  4GS3 A;  2YTY A;  1Q1B A;  4YWM A;  4B3T L;  2VY3 A;  4DV5 Q;  3M85 A;  1P8L A;  4A4I A;  4DPG A;  1FJG Q;  4A3D G;  3GO5 A;  4A3L H;  1VQG A;  1C0A A;  2A1A A;  2VUM G;  4DR6 Q;  1S40 A;  4C3J H;  2B63 H;  1V43 A;  3CPW A;  4LFC Q;  4R4C A;  4A3D H;  2EQS A;  4L5T A;  2K4K A;  3PO3 G;  1IBL L;  1UE1 A;  4GOP A;  1PH6 A;  1BBU A;  1MKH A;  4OX9 L;  1OXT A;  2ATW A;  4A75 A;  4OXP A;  1KL9 A;  4OON A;  5JEA G;  1XPO A;  1BKB A;  4X66 Q;  4ALP A;  3S1Q H;  2JA9 A;  4LF7 L;  3CMA A;  4RMF A;  2D0P A;  1PH1 A;  2Z6K C;  1XPR A;  3EN2 A;  4O2D A;  4BBR H;  4DV1 L;  4LF8 Q;  5JEA J;  5M3M H;  1B70 B;  2I5M X;  3TRE A;  1PYS B;  3OTO L;  1HNX L;  1D7Q A;  4DV3 L;  1Y14 B;  1SMX A;  2UXB L;  4C3H H;  1D8L A;  1Q7Y C;  1PA6 A;  1I3Q H;  3HOY G;  5M3M G;  4LW1 A;  1M90 C;  3MEF A;  3DLL A;  2UU9 L;  1JT8 A;  3ZJY C;  1ASY A;  1SLJ A;  1HR0 W;  4BXX H;  2BH2 A;  4GOP B;  1XNR L;  4KHZ A;  3UDI A;  5M3F G;  1HNZ L;  4LNQ A;  1RL2 A;  3W1B A;  4Y7N H;  1K73 C;  1VQN A;  4BA1 I;  1BVS A;  2ZJR A;  1U5K A;  2HIV A;  1IBK Q;  1N33 L;  4PMW A;  3I4M H;  4JI3 L;  4B3M L;  1O7I A;  3CCE A;  2Y0S E;  2UUA L;  1T9H A;  3GTP H;  1OXS C;  2JEA I;  3RNU A;  4IFD I;  4IJL A;  4GLX A;  2UXC L;  4A3C G;  1PH5 A;  2CCZ A;  1XMQ Q;  4JI3 Q;  3GD7 A;  5C0X I;  1FL0 A;  3KOJ A;  1JMC A;  1HZB A;  3CAM A;  4IJH A;  4UP7 A;  3J81 c;  3T1H Q;  5C0X J;  1YNX A;  4A3C H;  2QGQ A;  4LFB Q;  3BU2 A;  2NZH A;  1X3G A;  2VQF L;  3M4O H;  3PUV A;  4X62 Q;  4A3B H;  4QQB X;  4GNX A;  4DK3 C;  1Y1W H;  2E5L Q;  1MIU A;  4NXN Q;  2PMZ E;  4NPS A;  4DKA C;  2VQF Q;  1YHA A;  4DR3 Q;  1KQS A;  2AHO B;  1PHJ A;  2JQO A;  2MFI A;  3I55 A;  4JCV E;  3S16 H;  3UE1 A;  2I5H A;  4YCV A;  4A3G G;  4GLA C;  4GN5 A;  1X6O A;  1C9O A;  4LF5 Q;  1PH8 A;  2RHQ B;  4H02 A;  3KF8 B;  2VL6 A;  1N36 Q;  1K8G A;  1BBW A;  3I4N H;  4YHH Q;  4IOA A;  3KJP A;  1N9W A;  3GTO H;  1IBM L;  2IX0 A;  3TQY A;  1G29 1;  2NN6 I;  2AWO A;  2HHH L;  1L1O C;  1LM0 A;  1TWC H;  2ZJP A;  4GKJ L;  2R7D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...