4L5SA

P202 hin1 in complex with 12-mer dsdna
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
199
structure length
199
Chain Sequence
STPKKNISKGAVLHEKPMTVMVLTATEPFNYKEGKENMFHATVATESKYYRVKVFNMDLKEKFTENQFITISKYFNSSGILEINETATVSEAAPNQMFEVPKNIIRSAKETLKISKIKELDSGTLIYGVFAVEKKKVNDKSITFKIKDNEDNIKVVWDKEQHNINYEKGDKLQLFSFHLRKGNGKPILHSGNHSFIKGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein/dna
molecule keywords Interferon-activable protein 202
publication title Molecular Mechanism for p202-Mediated Specific Inhibition of AIM2 Inflammasome Activation.
pubmed doi rcsb
source organism Mus musculus
total genus 36
structure length 199
sequence length 199
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02760 HIN HIN-200/IF120x domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4l5sA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4l5sA01
3PO3G 4LF9L 2OWOA 1PHJA 4JI6L 4DV0L 5FLMG 2ZTCA 4C3HH 1P8LA 4GOPC 4IPCA 1CSQA 2K5HA 1Y14B 1R9TH 1E22A 2OQKA 2HT1A 5IWAL 1VQPA 2WAQG 3RR5A 4OO1G 4BBRH 1ASZA 4JI7L 4ALPA 1IBMQ 4LFCQ 3OYYA 2AHOB 3UDIA 5C0XJ 1K9MC 2K52A 1C7YA 2K5VA 3I4NG 4A3LH 2OCEA 2K14A 2V1CC 1KL9A 1K3RA 4YWKA 4PZ7A 5C0XG 1KAWA 1HR0W 5BR8L 2CWPA 5JJKA 3TS0A 1Y1VG 3TREA 2NZOA 2JA6G 4GNXB 5EAYA 2A1AA 2KHJA 1L1OC 1Q82C 2R93G 3PO2G 4A3IH 2Y0SG 3D31A 2YTVA 4PMWA 1HR0Q 2B29A 4C2MH 4H02A 3CCUA 2UXDL 3AEVA 4YY3L 2EXDA 4KHPL 2IHFA 5JJIA 1E3PA 2VL6A 3G4SA 4KI0A 4X62Q 1A62A 4NXNQ 1XNRL 4LF5Q 1MJCA 3CCRA 1MKHA 2Z6KA 3L7ZC 2RCNA 4MNOA 2BA1A 3U58A 2RHQB 3A5UA 2N49A 1VS0A 3HKZG 3EBEA 4O0AA 4JI3L 2UXBQ 2JA8G 3S16H 3TEHB 4DV5L 1PH5A 4LFBL 2R7DA 2JA7G 3J81j 5FLXc 1W2BA 2WB1E 1YZ6A 5ELOA 1YHAA 3F2CA 1MIUA 4OONA 3PGZA 4DV2L 4A3MG 2D0PA 1X55A 4QY7A 4IPHA 4OWWB 3RN5A 4DK6C 4Y7NH 3STBC 4A4IA 3BU2A 5AJ3L 2NVXH 1L0WA 3GTMH 3PO3H 4GLAC 4GOPB 5FLMH 3ER0A 4DR4L 1JB7A 1VQLA 1M1KC 1PH7A 4POGA 2ES2A 4P74A 2AWNA 4DAMA 4HJ9A 3T1HQ 1VQ5A 3I4MG 2ZJQA 1VQHA 4DV4Q 1HNXQ 1TWFH 2MO0A 3RLFA 2K75A 3H3VI 1YEZA 3T1YQ 5GAEC 1KXLA 3M85A 1U5KA 3I4NH 3CF5A 4AQYL 2UXCL 1N9WA 4IOCA 4B3SQ 4UY8C 4APVA 4IFDJ 3RZDH 4DR6L 1I3QH 1N33L 4A3FG 2QEXA 1Y1VH 4R1JA 4JI4Q 2GN5A 3K0XA 4X65L 2JA6H 4IFDG 3KYHC 1EUJA 1L1OB 2R93H 1WJJA 3PF4A 3I2ZA 1TWHH 2DUDA 3PO2H 2PI2E 4HJ5A 3K7UC 1XNQL 2Q2UA 3ULLA 3A0JA 4LFAQ 2VQEL 2VZAA 1N34L 4GS3A 2I5MX 3PCOB 3CAMA 5HGQA 2KCTA 4DR2L 1I6HH 3UDGA 2HHHL 3UE0A 4Y52H 2JA8H 2OTLA 1OXVA 5IYDG 1Y1WG 4QIWE 2KCMA 3HOYG 2UUBQ 1VQJA 4X66L 2QGQA 4DK3C 1B7YB 5GAHC 2JA7H 2Q2HA 2WFWA 5LMNL 1NMGA 1UE6A 1KHIA 1BBUA 1SLJA 2CKZB 2ID0A 5JEAJ 4DV1L 4A76A 1S40A 2R92G 5JEAG 3JAMc 4DUYL 4GNXC 4P73A 4FDBA 1N8RC 4YWMA 4JBMA 4JV5L 4DR7Q 1VCIA 1QUQA 4DV3Q 2E2JH 5IY0A 2UU9L 3ICEA 1N36L 4DNIA 1GM5A 2A8VA 1UE5A 1HZ9A 4HJ8A 1Z47A 4A3JG 1XMQQ 2RHSB 4B3TL 4A3DG 1D7QA 1PH3A 3W1GA 3I4MH 2NVYH 3ULJA 2IT1A 1W3SA 1VQEA 3RNUA 2R7ZG 5GROA 4OX9Q 1CKNB 3KF6A 4DR5L 3AQQA 4YHHL 1PH8A 1NTGA 5LMUQ 1VQ8A 3SGIA 1MJEA 1IBKL 2E2HH 4A3FH 1WOCA 1VQDA 1L2FA 1YNXA 1NE3A 5IE8A 2BH2A 1KRSA 1GKHA 2JK8A 1HJPA 2A19A 1S3OA 4GKKQ 1G291 4KHPQ 3J7ZC 4JI1L 1E7ZA 3UDFA 2FXQA 1XJVA 3H3VH 4B3ML 5GAGC 2D0OA 1IBML 2I5HA 4A75A 4K0KQ 2JJQA 1C0AA 2MNAA 2N8NA 5C3EG 2ZM6Q 3OTOL 1QVGA 3PV0A 1JT8A 1VQFA 4AYBE 3K8AA 1K73C 1J5EQ 1Y1WH 1IBLL 5IYDH 3HOYH 4DV6Q 3U50C 4AH6A 3IRBA 1TWCH 4L5QA 2XGTA 4YCUA 4X62L 4NXNL 1Q86C 2R92H 1YHQA 4LF5L 4PZ6A 2VQFQ 4JI5Q 2NN6I 1A63A 1NBWA 3J81c 2JE6I 4YCVA 1XMOQ 1FGUA 3BZKA 3M3YH 3H0GG 2UXBL 4JI0L 4NXMQ 3PSIA 4UP7A 3HOVG 4A3DH 2PNHA 4A3JH 4A3EG 2IX0A 4JI8Q 1B70B 1E24A 4GN3B 4MZ9A 1QZGA 4JI6Q 4A93G 2R7ZH 1Q12A 1Z9FA 2MO1A 1X9NA 1UEBA 1BKBA 3RZOH 2JEBI 1EQQA 3CMAA 4L5TA 2NN6G 3PUXA 3L2PA 3G71A 2PI2A 4A3KG 4KHZA 5C4XG 3CPWA 2IX1A 4JI7Q 3J80c 1CKOA 1DGSA 1VQCA 3JC66 3NEMA 4LNQA 1N32Q 4IO9A 2E2IH 1V43A 1C9OA 3RLOA 4EQ5A 4PG3A 3FP9A 4A3BG 4DUZL 2D62A 5BR8Q 1IZ6A 5E7NA 4IPGA 3CW2C 1KQSA 4JCVE 1O7IA 1EIFA 4KLKA 1FJGQ 1VQMA 1YVCA 2Q2IA 3T1YL 2NVTH 4JG2A 1Q1BA 2UXDQ 4LF4L 1V9PA 4YY3Q 4JC0A 5GADC 1I94Q 2ASBA 4BBSG 5C3EH 2KENA 4A3GG 1JJ2A 1XNRQ 1JMCA 5M5YH 1Q1EA 1Q46A 3KDFB 1HNZL 4GKJL 3L0OA 5C4JH 2N78A 4GLXA 4LUOA 3GTPH 1OXSC 4DR1Q 1BVSA 3VDYA 2H5XA 4LW1A 5IYBG 4A3CG 1AE3A 2EQSA 5IP9G 1PVOA 1K8GA 3J80i 4HIDA 1IXRA 3EN2A 2E5LL 1YITA 1E1TA 1AH9A 2VY3A 3H0GH 2VW9A 4DV2Q 3HOVH 3S17H 3EIVA 3W1BA 3F8TA 4OWXB 3PIOA 3E9IA 3RLNA 4A3EH 4DPGA 5AJ3Q 4BA1I 4R4TA 4LUVA 4GOPA 4A93H 1ASYA 3GTKH 4DR4Q 1IYJB 1VQAA 2QA4A 1OXUA 2UUCL 2CWAA 3CC2A 2F4VL 1YHBA 3PUYA 4A3KH 5C4XH 2ZTDA 4EX5A 1QUQB 4BY1G 3S2HH 4GKKL 1B8AA 2LXKA 4DR3L 1OTCA 4LF7L 2MFIA 4JI2L 3KJOA 1XMQL 1IL2A 4AQYQ 1VQ7A 4A3MH 1TWAH 3PIPA 2WAQE 4A3BH 2N3SA 3DM3A 2Z6KC 1N33Q 3B6YA 3CCQA 2DGYA 4X65Q 2OQ0A 2WP8J 2WB1G 2LSSA 3CD6A 1X65A 3F2DA 5LMUL 4BBSH 1SE8A 1RIPA 4QQBX 4DV7L 1SN8A 4B3RL 4A3GH 1I50H 4JOIA 5IYCG 1VQNA 2C35B 1TWGH 2HQLA 2JQOA 2VQEQ 2VNUD 2Y0SE 4DR2Q 3W5OA 5J3BA 3RN2A 1X3EA 1PH6A 1HZBA 1K8AC 2HHHQ 1KC8C 3I7FA 3PF5A 4RG1A 4BXXG 3ULPA 5LMNW 2L15A 1XTDA 4GN5A 2B63G 2ZJPA 5IYBH 4A3CH 5IP9H 4MTNA 3KJPA 3U4ZA 1SFOH 3FKIG 3CP0A 4J15A 5LMNQ 1QZHA 2RF4A 1Q7YC 3HOWG 1EQRA 3HKZE 4UP8A 4DV1Q 3OW2A 1G51A 4JYAQ 3JAMi 4UP9A 4R4OA 2PQAA 4DUYQ 2K5NA 3K7AH 4HIKA 1E1OA 3ERSX 1PYSB 3H15A 2EIFA 5DLQE 3GDEA 4LFCL 4JV5Q 5M5WH 4LF8Q 4AIMA 3I55A 2UUAQ 4L5SA 4JBKA 1HNWQ 4WJ3M 2OTJA 1SRUA 3CXCA 1A0IA 1NJIC 4P75A 3TQYA 2VQFL 1YIJA 3PUWA 3HOZG 5JJLA 1YJNA 3F1ZA 5FJ8G 1JJGA 2AMCB 4OO1I 3GTJH 3G6EA 1VQOA 1CKNA 1HR0L 4BY1H 4YHHQ 4NXML 4LUZA 2NZHA 1VQBA 1LM0A 4LF6Q 4PZ8A 3CCLA 4JI8L 5C0XI 3CCMA 3KLWA 2IHEA 4O2DA 1VQGA 4OXPA 1IBKQ 4L5RC 3J7A5 4WJ4A 3TS2A 4POFA 1VQ9A 4X64Q 3A5ZB 5K36G 1X56A 2R7FA 1GVPA 2CFMA 1AE2A 1YBYA 4JI1Q 4LF9Q 1J6QA 3GTOH 5IYCH 2HIVA 4DV0Q 4B3MQ 1VQ6A 1N32L 5C44G 4R4IA 4QJFA 4BXXH 5IWAQ 1HZCA 3OTOQ 2YU9H 5M3FG 3CC4A 1RL2A 3CMEA 3S24A 3GD7A 3HOXG 1IBLQ 2LXJA 2B63H 4YCWA 3NELA 1FJGL 3TRZA 1D8LA 3CQZH 3GTQH 1OXTA 3FKIH 3HOWH 3T1HL 1I94L 2XTIA 4NPSA 4ME3A 3ZJYC 4DV4L 1X6OA 3MEFA 4JOIC 4IJHA 3STBD 1M90C 1HNXL 4GNXA 5M3MG 1JE5A 4BY7G 2I5LX 1EFWA 2B3GA 4IJLA 3J81i 3K80C 5IP7G 5M5XH 1QVCA 1FL0A 1K0RA 4R4CA 4UPAA 4DR1L 4B3SL 1OXXK 1YJWA 4JI0Q 2ATWA 1KD1C 1PH9A 3E0EA 1H95A 4DKAC 4JI4L 2KBNA 1WI5A 4DAYB 1Q8KA 1PYBA 3BJUA 3HOZH 5FJ8H 3F2BA 1PH2A 2BA0A 4RMFA 1VQKA 4JI3Q 2YYZA 4X6AH 2ZTEA 4IPDA 1HZAA 4HIMA 1WCMG 4OWTB 4DV5Q 4HIOA 5ELNA 3HOUG 4AYBG 4LFAL 4LFBQ 1UE7A 4IFDI 1EIYB 1TXYA 3S1NH 2ALYB 4GLVB 1LYLA 3M9BA 3S1RH 2ZJRA 2IY5B 4DUZQ 3GO5A 1PH1A 1JJCB 3MXNB 1LUZA 1NY4A 1V1QA 2YTYA 2UUBL 5IT9c 1Q81C 1X3GA 2VUMG 1X3FA 2MQHA 5C44H 2K50A 4XIGS 1EWIA 2JEAI 3CC7A 1PA6A 1KIXA 4LF4Q 1XPUA 1GD7A 2AKWB 2JA5G 3NBHB 1A8VA 2Z0SA 4NB3A 1WFQA 1HNZQ 3KDFA 4P72A 1T9HA 3PUZA 3WWVA 2BH8A 2GVBA 5M3FH 4DV3L 4DR7L 3HOXH 4GKJQ 3S1QH 3E9HA 2KHIA 1SROA 5H1SE 2UXCQ 1S72A 4DR6Q 4TVAB 3D0FA 2GVAA 3M4PA 3M4OH 2K4KA 3G48A 3KF6B 2F3IA 3AFQA 5M3MH 4OX9L 4BY7H 1L1OA 1UWVA 1K83H 1X54A 3FHWA 5IP7H 2YTXA 2E5LQ 3AFPA 1U0LA 2YV5A 1XNQQ 4HJ7A 2CCZA 3HKSA 1YJ9A 4BA2I 3A74A 4BBRG 4QL5A 2JA9A 5HY6A 2Q2TA 2HIXA 4YWLA 3KF8B 3KFUA 1WYDA 1N34Q 4HJAA 3CCVA 4A3LG 3K81C 3AYHB 3DLLA 3PUVA 4C3JH 3UDXA 1EYGA 3S14H 3S2DH 3CPFA 4TQUS 1CUKA 4JYAL 4JBWA 2UUCQ 3Q8DA 2PQAB 1WCMH 1FVIA 1I5FA 1VQIA 2F4VQ 3HOUH 1PFSA 4QGUA 1PV4A 2AWOA 1G6PA 4A3IG 1VQ4A 1CSPA 2R6GA 1BBWA 4C3IH 4X66Q 1XPRA 4LF8L 2NVQH 3GTGH 3GTLH 4K0KL 4DR3Q 4LF7Q 4LWCA 1GO3E 2ZM6L 1HH2P 1NMFA 4JI2Q 2UUAL 1HNWL 3KOJA 4P71A 1KRTA 3M7NA 3HFZB 5GQOA 1J5EL 1QVFA 1P16A 3I4OA 1UE1A 4DV6L 4R4QA 1SR3A 1XPOA 2UU9Q 2VUMH 1N36Q 4GN4B 4XTCS 3S15H 2CQOA 3UE1A 4B3TQ 4LF6L 3BZCA 3CCJA 3U4VA 1YI2A 4JI5L 4DV7Q 2JA5H 2E8GA 2VS1A 3LGJA 3NENA 1PH4A 2I0QA 4B3RQ 4IOAA 1SMXA 3CCEA 1XMOL 1CKMA 4DR5Q 4X64L 3S1MH 3M4QA 3CCSA 1LTLA 2PMZE 4JBJA 2F52A 3I56A 1EOVA
chains in the Genus database with same CATH superfamily
3PO3G 4LF9L 1PHJA 4DV0L 2EY6A 4ZYSA 4IPCA 1PRTF 3L3OC 3EA6A 1CM9A 1JC7A 2QW7A 3AMUA 1F2MA 4OIKA 2WAQG 3RR5A 1F2ZA 4OO1G 1SE2A 1ASZA 1EWCA 2RA4A 4ABNA 3OYYA 2X69A 4A3LH 3HOZB 4YWKA 1LTGD 3MWYW 4PZ7A 1KAWA 2CWPA 2JA6G 4NDXA 5T1GA 2F0JA 2BCOA 5EKKA 2Y0SG 1D5MC 1HCZA 3CCUA 3PO3B 2NVXB 4YY3L 4EGVA 3G4SA 4X62Q 1XNRL 4CDDC 1CZGA 1IHZA 2A69D 1MKHA 3L7ZC 3S1RB 2RCNA 4ZK9B 1CZWA 4KTAA 4JI3L 3EBEA 3RMHA 2JA8G 1I4PA 4KKSA 5C44B 2FJ2A 1U4RA 2JP1A 3J81j 5FLXc 1DOKA 1W2BA 1YZ6A 4FNFA 1STEA 1YHAA 3PGZA 2D0PA 4QY7A 4XDXA 1FD7D 2IL8A 3PO3H 2NVXH 4DR4L 1JB7A 4DF7A 3QIAA 3I4MG 1IYVA 2ZJQA 1HNXQ 3IKJA 4OO1H 2MO0A 2EE1A 2PW7A 3J81L 5EPKA 1YEZA 2F0IA 5JVG3 3T1YQ 3M85A 3IFTA 3ND9A 4AQYL 4UY8C 1N33L 1GUWA 2QEXA 4IFDG 2GN5A 3K0XA 4X65L 2JA6H 1HHVA 1L1OB 3KBGA 5C4HA 1WJJA 3VYSA 5JJZA 1Z7TA 3I91A 2ICIA 2MPMA 4LFAQ 2VZAA 1S5FD 4PMBA 2VQEL 4GS3A 3A7LA 2I5MX 5HGQA 3P75A 2HHHL 3L9AX 3G7LA 2JA8H 1O78A 1PRTC 1FYCA 5IYDG 2XWBB 1Y1WG 4X66L 5CBEE 5JEAJ 1B44D 1S40A 2ID0A 3MFYA 5BN3A 3D4RA 4J1MA 4XQQA 3FVQA 1A2TA 4P73A 1PZID 4B08A 4GZYC 2EJGC 4C56C 4JBMA 1GHKA 1H9MA 1K8MA 4PMCA 4DNIA 5J1ZA 2A8VA 2Z8LA 1D7QA 4A3DG 1PH3A 3NE5B 3I4MH 3ULJA 3WOEA 3AQQA 1VQ8A 3CRKC 3T53B 3SGIA 2VB2X 4IFDH 2BOSA 3KF8A 1W6JA 2JXMB 2BH2A 1GKHA 2JK8A 2WIIB 1GUSA 2QILA 3J7ZC 4FF1A 5AFWA 4B9XA 2FXQA 1XJVA 1EL0A 5GAGC 4A3DB 2F4IA 4K0KQ 1SNQA 2BE5D 3U9SA 4QUCA 2EYMA 2QF7A 5C3EG 3OTOL 2ZM6Q 1CA5A 3MHBA 2KEEA 3NTKA 4AYBE 1K73C 3S16B 5IYDH 1Y1WH 4DV6Q 1IW7D 4AH6A 3HZXA 3MXUA 4UAIA 1R4QB 4XQJA 4WORA 4X62L 1Q86C 4PZ6A 4G7HC 5LL6S 4B9WA 1S5CD 3J81c 5IGDA 1MGSA 3GTMB 4JI0L 4NXMQ 4G7ZC 2B8FA 4A3DH 1BCPF 4JI8Q 4MZ9A 3NPPA 1Q12A 1Z9FA 5C3EB 2MO1A 1DM0B 1SYDA 3CMAA 3PUXA 3G71A 3CPWA 2IX1A 1CKOA 4LNQA 1SXTA 3GV3A 4L6TB 2R93B 3KUPA 4DUZL 1VDZA 2E2DC 1KQSA 4TSSA 5E4WC 5C3XA 3DXJC 4DU9A 1FJGQ 3T1YL 2A6ED 3Q24A 5COYA 2UXDQ 3KLSX 4LF4L 4BBSG 4JC0A 2ASBA 5C3EH 4A3GG 2B2VA 1Q46A 1HNZL 3IFDA 5TSSA 2RBMA 1JCKB 1LABA 1ENFA 3C46A 1HUMA 1K8GA 4A3MB 4HN7A 5I6WA 3EN2A 2E5LL 1YITA 1E1TA 5I4DA 4I65A 2VY3A 3FRPB 2E2JB 2I07B 3W1BA 2F0QA 1NUCA 3E9IA 3RLNA 5AJ3Q 4BBSB 4LUVA 1ASYA 1WD1A 1OXUA 3MAQA 1EY9A 1JE4A 4XQNA 2LS01 3DM1A 3J7AV 1YHBA 1STGA 5HGTA 1QUQB 4BY1G 1KNAA 3NXWA 1B8AA 2LXKA 2AQ1B 5CV6A 4LF7L 3KJOA 1X3QA 4A3MH 5LL6X 4IUVA 2N3SA 3B6YA 4BWGB 1BNZA 4FO2A 2WP8J 1LTID 2KOLA 3CD6A 4CBVA 5G3LF 1PDQA 4KHVA 4QQBX 4BBSH 1SE8A 1SN8A 4I7AA 4A3GH 4K5XA 4JOIA 1TT2A 1VQNA 4KN4C 2JQOA 4R8NA 3W5OA 2EPBA 1HZBA 3I7FA 4FYDA 1AW7A 4XYQA 3CRLC 4MTNA 1Y8NB 2KQ3A 5KEEA 1QZHA 1EQRA 4UP8A 3JAMi 1F9RA 1PZJD 1E2VA 1E1OA 3ERSX 3PIO3 3C3LA 5DLQE 3GDEA 4PQXA 3RUZA 1B3AA 1LTSD 3LX0A 1S5ED 1SRUA 2KCNA 2E75C 1JJGA 1JOQA 4BY1H 2YU9B 2F0TA 2Z6BA 4NXML 2E2IB 1VQBA 4PZ8A 4KJNA 3PIP3 4JI8L 3GTQB 3MA2B 5EPJA 1NR2A 2B2YA 1STHA 2ICEC 4WJ4A 1VQ9A 1NAPA 2B39A 5CV5A 2R7FA 2H1EA 1D5ZC 1Q90A 1GVPA 3NQTA 4JPBW 2NVTB 3TP6A 1JOOA 2BDNA 3NWTA 4JI1Q 1J6QA 1F9SA 4CDEC 1JR0D 2TSSA 2HIVA 2N88A 4C1NI 4E6IA 4QJFA 2KA7A 5IWAQ 1F9QA 1HZCA 2YU9H 3CMEA 1FJGL 3TRZA 3GTQH 2XTIA 3S1NB 2K5WA 1X6OA 1SYCA 1IYUA 3HOVB 4BY7G 4ZUIA 1EFWA 4A3EB 1G8ZD 2F0SA 1QVCA 1FL0A 4OIJA 4KKTA 4B3SL 1OXXK 1VF5C 1GJXA 4FXDA 3E0EA 4JI4L 4CHTB 3BJUA 1B50A 4H7BA 2KCCA 3I72A 3P7JA 4HIMA 4OWTB 4DV5Q 4HIOA 5ELNA 3HOUG 4AYBG 1UE7A 4C3IG 5I2YA 1SE3A 1EIYB 3S1NH 5IGBA 4GLVB 1LYLA 1STNA 1K83B 1PH1A 3NBIA 1LTAD 1JICA 2PMZB 4DAPA 3ZYYX 4WFN3 2B2UA 1I50B 1UAPA 2K50A 4XIGS 1EWIA 1PA6A 2AKWB 2NN6H 2JA5G 3PQIA 3S2DB 1WFQA 4DR7L 3WWVA 2GVBA 1MSGA 4MHEA 4DV3L 2FMCA 3HOUB 1SROA 1GUGA 1SFOB 1E2WA 4DR6Q 3G48A 3SXHA 1SAPA 4BY7H 1EY5A 1K83H 3FHWA 2YTXA 4JVZA 3AFPA 4ULLA 4HJ7A 1TS3A 1VF7A 5M5WB 2CCZA 1YJ9A 4BA2I 5HY6A 3I3CA 1N34Q 1I4QA 3CCVA 4KY5A 4F8MA 1TU2B 3PUVA 3S2DH 3CPFA 4TQUS 3SDZA 3GTJB 5FO8B 4JBWA 1BO0A 2UUCQ 1C48A 1VQIA 2LY7A 2F4VQ 3HOUH 4QGUA 2AWOA 1L0XB 4C3IH 4DR3Q 4JI2Q 1NMFA 3KOJA 1KRTA 5GQOA 1QVFA 4KMUC 2F0HA 1XPOA 1SNMA 3GTOB 3SK5A 3LWEA 2ZXPA 4JI5L 2JA5H 3NP8A 4IOAA 5C5LA 5C5MA 1Y8PB 3M4QA 4F7XA 3TDQA 4F87A 2B2WC 3CCSA 5IOCA 3QO2A 1EY8A 2D5DA 1K8OA 1FR3A 1NNXA 4O1NA 3P20A 1Y14B 2K28A 5IWAL 2D9UA 4NKLA 4JI7L 4EQOA 3OW7A 2QCPX 2K5QA 1BQQT 4LFCQ 5KIXA 1K9MC 2K52A 2V1CC 2K14A 5C0XG 1HR0W 5BR8L 3DHQA 1Y1VG 2NZOA 3S9WA 4GNXB 1L1OC 3PO2G 2YTVA 5CC4A 1KAAA 2B29A 2A68C 2K7VA 4H02A 3HS0C 4C2MH 3AEVA 4KI0A 3CCRA 1CHPD 2Z6KA 5EPLA 3U58A 4ZAIA 2F03A 2UXBQ 4DV5L 3EFXD 1EZ6A 2A5HA 3RZDB 1SYFA 5ELOA 3BG3A 4WRDA 3HOXB 4ZUJA 4IPHA 4DK6C 4Y7NH 3LWUA 3STBC 5CYUA 5CR3A 4GOPB 1O7ZA 2FHTA 4N9PA 4RCNA 4POGA 4P74A 2AWNA 4DAMA 4HJ9A 1V1PB 1VQHA 1ZYRD 3MXGA 4DV4Q 3H3VI 2CW0D 4NW2A 1ICFB 1SEBD 5GAEC 3CF5A 2QEJC 1N9WA 4IFDJ 5C0XH 3RZDH 4DR6L 1QG7A 2B2YC 4A3FG 1Y1VH 4R1JA 2RDGA 1ILQA 1YNNC 2F0EA 1ICWA 3PO2H 2PI2E 3ERQA 4H44C 2F0KA 1STBA 1XXGA 2PZWA 3GTLB 4K8JA 1N34L 3PCOB 2NVYB 3CAMA 1QWYA 4DR2L 1I6HH 4KK7A 3UDGA 1MBYA 3S15B 4QIWE 5L37A 2UUBQ 4WJWA 2QGQA 5GAHC 5A2QL 5LMNL 1NMGA 1KHIA 1BBUA 2CKZB 3URYA 1ET6A 4DUYL 3UI2A 1DONA 3KLSA 1J9OA 4JV5L 1VCIA 4KD3A 1I6VC 2CH4A 1Z47A 1XMQQ 3Q6SA 2N55A 3W1GA 2NVYH 2IT1A 2IX3A 1VQEA 3FPPA 3EROA 1CKNB 4K5VA 1EQVA 4IURA 2IW3A 5LMUQ 1MJEA 1IBKL 4A3FH 1WOCA 3I8ZA 1D1KA 3Q0AA 5IE8A 2DY8A 1KRSA 1HJPA 4GKKQ 2GA4B 1E0BA 1XX8A 1E7ZA 4OHJA 2TMPA 3H3VH 4RAUC 2D0OA 2B2UC 2I5HA 4A75A 4PNYA 1C0AA 2K04A 4CDFC 3TBIB 1QVGA 2L12A 1VQFA 1MSHA 1LTTD 1I4HA 1DOLA 2PZTA 2FMMA 4RH6A 2ZT9C 5BN4A 3E0JA 4N8X1 1EY0A 4YCUA 4HSVA 4ZQ3A 1TIID 1NBWA 2M9VA 3BZKA 3M3YH 2UXBL 2QKIC 3BYYB 1E24A 4HAEA 4K5WA 4JI6Q 3I73A 2WAQB 3QWNA 2CH4W 5M5YB 1BKBA 5KNBA 3RZOH 4K6DA 1ENAA 4L5TA 2PNRC 2K33A 1D2BA 1DGSA 1U4PA 5C4ZA 4IO9A 3BVGA 2JA6B 1CFMA 4OELB 2C5CA 2K5DA 2Y0SB 5E7NA 4IPGA 3D4DA 3S17B 1CI3M 1EIFA 1AP0A 2SNMA 1CTMA 1Q1BA 2L5TA 4IUNA 2KENA 2PCFB 4G4KA 4ZKCB 5M5YH 1Q1EA 1F77A 5C4JH 4GKJL 2JA8B 2N78A 3T51B 3EQLC 2L4NA 5EBCA 3DWQA 3GTPH 1OXSC 1B9MA 1D6EC 4KY7A 4M1UB 1Y8OB 2H5XA 1LT6D 4DNRB 1SYEA 4IUTA 1IXRA 2SNSA 1AH9A 4DV2Q 3S17H 1UUPA 3PIOA 1F2YA 4BA1I 3I4MB 4GOPA 1KDAA 3QG1A 4CJ0B 3CC2A 1ZXTA 1OO9B 3MVVA 1GUNA 3K58A 1V1PA 1DYQA 4EX5A 2DN8A 2MFIA 2V4DA 4RHRA 3R2IA 1XMQL 3PIPA 2Z6KC 3DEOA 1CHQD 3E3XA 3VR4A 5FK9C 2LSSA 3K7AB 5FLXE 1H9JA 1PTOH 5LMUL 4DV7L 1Y69U 2J0TD 4B3RL 1SE4A 2C35B 1EY6A 4GKKL 3CKIB 1X3EA 2FINB 1Y1WB 1K8AC 1KC8C 4RG1A 1WTQA 3ULPA 4GN5A 2B63G 5IT9L 3ITPA 3KJPA 4LJZC 3CP0A 4ZLTF 1HTPA 2RF4A 3HKZE 4DV1Q 1G51A 3C1EA 4UP9A 1ET9A 2K5NA 3K7AH 5E3FA 3W3AA 2EIFA 2ZXOA 4AIMA 1IKLA 4DN4M 3K59A 4JBKA 4WJ3M 3EVQA 4QUFA 5CV7A 4P75A 1YIJA 1YJNA 1CKNA 3MC0B 4YHHQ 4UDUC 4X3TA 2B63B 1SBBB 2RCFA 4LUZA 4H13C 3CCLA 2XSCA 3CCMA 2IHEA 1TS4A 4HTHA 3DUZA 4ID6A 2R3ZA 4K6LA 1GHJA 4X64Q 2D2CC 3A5ZB 3E6ZX 1X56A 1SMYC 3U9OA 5FOBB 2EYLA 1AE2A 2Q8IB 2JYOA 5KGUA 3E5SA 1PZKD 1VQ6A 4B3MQ 1B1ZA 1PYWD 3A7AB 3HP3A 2EDGA 4JK1C 5ELDA 3VR3A 4RGOS 2B63H 1RL2A 1F9PA 1IBLQ 3NELA 3P1HA 3CQZH 1EQTA 4NPSA 1EY4A 1HNXL 2O2LD 3MEFA 4QF4A 5M3MG 1JE5A 5DAUA 5IP7G 3A8JE 3NWSA 5KRUA 1Q8KA 2PQEA 4TKOB 3SHLA 4C3JG 3F2BA 4RMFA 1ESFA 1MI2A 5EBDA 3KLRA 2EY1A 1WCMG 1EEFD 3S1QB 2RSOA 1EU3A 4LFAL 4LFBQ 2JN4A 5E1FA 3NUCA 3M4OB 2RDHA 1LO5D 3M9BA 2PYKA 5M3MB 2B2WA 1J8IA 3GO5A 4XT1B 3MXNB 2YTYA 1NY4A 1V1QA 5IT9c 1A15A 2K6AA 1Q81C 3X3MA 2VUMG 4A3GB 3J81E 1D5XC 5LHY1 2JEAI 1WTPA 1KIXA 1PRTD 4C3JB 3BVMA 3NBHB 4L63B 4NB3A 5CV8A 3BDCA 4P72A 3IAYA 2BH8A 3KK7A 1M4VA 5I2XA 3S1QH 5H1SE 4FP5D 2NVQB 2CVRA 4TVAB 4DK1A 2GVAA 3M4PA 1TVXA 4C3HG 3M4OH 3KF6B 1NSNS 1TS2A 2F3IA 2IPKD 3AFQA 1L1OA 5M3MH 2WKDA 4YIJA 5IP7H 1C8CA 3HKSA 3A74A 4BBRG 2Q2TA 2HIXA 1FGBD 3DLLA 3S14H 4C3JH 3UDXA 1EYGA 1QCBD 5C3WA 2AQ2B 1BDOA 4BY1B 1MHWC 2PQAB 1WCMH 1I5FA 3QOJA 2Q8RE 4A3IG 4K0KL 4IZ8A 3GTGH 2NVQH 2O5JC 1EU4A 2F0GA 1GOZA 2ZM6L 1HH2P 3ONAB 4MIUA 4C3HB 2L0CA 1X32A 4P71A 5E4XA 2IJ0A 3I4OA 4DV6L 2RVLA 2VUMH 1LACA 4BBRB 2WKCA 4XTCS 4MTKA 3LNNA 4R8IA 4B3TQ 1C4QA 3BZCA 4ZKBB 1CQVA 4IUPA 5BN5A 3CCEA 5IGFA 4X64L 4A3IB 1K3RA 4JBJA 2F52A 3I56A 1EOVA 3WDNA 4RGNA 2MUYA 4GOPC 1PFBA 2ZTCA 4C3HH 5FLMG 2ZXRA 1BOSA 1R9TH 5KNCA 2OQKA 1VQPA 3ND8A 3JAML 3FEWX 1PRTB 4BBRH 3TP7A 4ALPA 2M00A 1IBMQ 5C0XJ 3I4NG 2DNEA 2OCEA 1KL9A 2DJGC 2E76C 3TREA 2EOTA 1S5DD 2NBFA 2A1AA 2KHJA 3A8IE 2EJFC 4A3IH 4PMWA 1HR0Q 3BDLA 4LAAA 2UXDL 2EXDA 2IHFA 3HEJA 1E3PA 2VL6A 4NXNQ 2F0OA 4CGYB 4KD4A 4MNOA 2BA1A 1JB3A 2KJXA 3QR8A 1HA5A 1A2UA 3A5UA 3HKZG 4RWSC 1CT1D 3M7GA 2FFKB 1PH5A 4LFBL 2JA7G 4HSPA 1I3QB 2WB1E 3FMCA 1H9KA 1DJRD 4OONA 4XYOA 1X55A 1L0YB 1QJOA 3BU2A 4A4IA 5AJ3L 1A3TA 5FLMH 1UNSA 4U673 5FO9B 4O42A 4BY7B 3T1HQ 1VQ5A 2NUCA 1O7LA 2PZUA 5EQ0A 3IL8A 1TS5A 4K14A 3V05A 3I4NH 1U5KA 4ZRZA 2EY2A 4APVA 3TN2A 1I3QH 4V0BA 2AQ3B 2B2TA 3KYHC 1EUJA 3H6MA 3PF4A 3Q22A 4AYBB 3O13A 4C3IB 1BR9A 1O80A 3ULLA 1U4LA 3A0JA 5EGTA 5KYIA 3J80L 3J7YW 2KCTA 1QNUA 2Z4HA 3BDOA 3UE0A 2VB3X 1E2ZA 2OTLA 1QNKA 3MXNA 3HOYG 1A3UA 1VQJA 2JA7H 4DK3C 1BCPD 1B7YB 2JA5B 1LT3D 2Q2HA 4RKLA 2E2HB 1UE6A 1SLJA 3JAMc 1JWUD 2RQXA 3NBHA 4FDBA 5CV4A 4YWMA 1QUQA 3N52A 5IY0A 3ICEA 1GM5A 1UE5A 1HZ9A 3OHXC 3SE0A 4B3TL 1PFMA 1JQYD 1YNJD 3DEPA 3RNUA 2R7ZG 4OX9Q 3KF6A 4DA2A 1RJTA 2HCCA 1PH8A 1NTGA 2F3WA 3A56A 2B8GA 1O7YA 1TWCB 2E2HH 2IWHA 3AB9A 3VR6A 1TY2A 1L2FA 3QJYA 4KHPQ 1LTBD 1G291 2HCIA 4I7ZC 3SK4A 2CQAA 4C2MB 1ZEQX 4ME5A 4JI1L 1WTWA 3UDFA 2EXZA 4HR7B 4FVMA 1IBML 2NWGA 1JWSD 3OSOA 2R7ZB 2QDBA 3QB3A 2KEDA 1I4RA 1J5EQ 3HOYH 1TWCH 2DJFC 4L5QA 2XGTA 4NXNL 3BS1A 1YHQA 5IIFA 2VQFQ 1BXTA 4DGZA 1A63A 2JE6I 2EYOA 2J4XA 1XMOQ 4Y7NB 3WOFA 1FGUA 2HQEA 3H0GG 4DFAA 5DEHA 3H09A 2AUJD 1D1IA 1PLFA 1B70B 3TZUA 4GN3B 3G6JB 4A93G 2R7ZH 3MXPA 1WTOA 1X9NA 1HA6A 1BCPB 2C9OA 3K5LA 1EQQA 3L2PA 4A3KG 5C4XG 4KHZA 3J80c 1VQCA 3JC66 4NMZA 1N32Q 1KABA 1Y1VB 2L9HA 4J6HA 4EQ5A 4PG3A 3FP9A 3PO2B 2XIWA 3NTIA 5FKAC 2O4XA 1IZ6A 2PPBC 4ILWA 2A69C 3BYTB 4JCVE 1VQMA 1YVCA 2Q2IA 1ILPA 4JG2A 4N9TA 1V9PA 4YY3Q 1I94Q 1I6HB 4DNTB 1JJ2A 1EWHA 3C2PA 1XNRQ 3KDFB 1U9RA 3NSWA 3L0OA 1HQMC 4A3KB 4DR1Q 1KLGD 2MP1A 2HD3A 3T4AC 3VDYA 1K28A 1AE3A 2EQSA 5IP9G 4HIDA 1RTOA 2H4OA 3H0GH 4LK1C 5NUCA 1EYAA 1XTCD 3EIVA 5IGGA 5M9OA 4OWXB 4RGTA 5CBAE 4R4TA 4A93H 2NYZD 4DR4Q 1VQAA 1QE6A 2QA4A 2UUCL 2CWAA 3BZDB 2F4VL 1RODA 4A3KH 5C4XH 1SDFA 2ZTDA 3S2HH 4DR3L 4A3FB 4JI2L 4AQYQ 2NZ1D 1TWAH 1TY0A 1N33Q 4CDCC 1LLRD 4X65Q 2OQ0A 4FF4A 2WB1G 1F2LA 5FLXL 3R93A 1RIPA 5ELBA 5IYCG 4IQZA 2X6GA 2VQEQ 1AEXA 5D3IB 4CKBA 5J3BA 3RN2A 1PH6A 3NK9A 4OGQC 2HHHQ 4BXXG 3GV6A 5LMNW 1XTDA 3OWEB 5IP9H 1A6XA 3A54A 1HQRD 4J15A 3HOWG 4CJ2C 4JW0A 4EQPA 1Q7YC 1DXMA 4G7OC 3OW2A 4KV6A 1GUOA 4R4OA 3V96A 3M3YB 1H9RA 3H15A 4K2LA 3X3NA 4LFCL 4LF8Q 4N8FA 3I55A 1EYCA 4L5SA 2OTJA 3N6RA 3CXCA 3RZOB 2B2TC 2VQFL 1PTOD 3PUWA 3HOZG 3F1ZA 3TZDA 5FJ8G 4OO1I 1VQOA 1G6ZA 2XVSA 3D4WA 1KTKA 1FNWA 4IUQA 3HOWB 4KJOA 4OXPA 3J7A5 3VYTA 1K3BC 2A68D 4IUUA 1EYDA 1WD0A 2BE5C 2CFMA 5M5XB 1YBYA 2EVBA 5IYCH 1N32L 2KVMA 3C1FA 2EYFA 1IW7C 5C44G 4NP5A 5C4JB 4R4IA 1A3VA 2HDMA 4BXXH 3OTOQ 4IALA 3GTPB 3NHHA 4ZCKA 1KDBA 3CC4A 3S24A 2LXJA 4YCWA 1D8LA 1IKMA 4L8JA 3HOWH 1I94L 5CMDA 3ZJYC 4DV4L 1M90C 3STBD 4IJHA 4M8AA 4GNXA 2K01A 3J81i 2Q8TA 3K80C 5M5XH 4R4CA 4UPAA 4DR1L 1YJWA 4JI0Q 1KD1C 1PH9A 3T16A 2KBNA 4DAYB 3HOZH 5FJ8H 1PH2A 2BA0A 4U68A 2MHVA 5ELFA 4IPDA 1HZAA 2KUMA 3CHBD 1W6KA 1YNND 4IFDI 2EJMA 3SEBA 2ALYB 3F2UA 2A6EC 3A55A 1WVLA 3S1RH 2ZJRA 2IY5B 5JPMC 3GP7A 4DUZQ 1JJCB 1LUZA 5JAVA 2UUBL 1PTOB 4CKCA 1AZPA 1S5BD 2EYPA 2G9HD 1V8QA 1T5XD 2MQHA 5C44H 3CC7A 4LF4Q 3DWPA 3M4YA 2G9DA 1XPUA 2Z0SA 2F0LA 1HNZQ 3KDFA 3PUZA 3MTSA 5EKIA 1JOKA 2KHSA 3E9HA 3NQIA 4G57A 3I4LA 3MFGA 2UXCQ 1ENCA 1Q8IA 3D0FA 2P5ZX 4HMIA 1X54A 3R2TA 2E5LQ 1M8AA 1I4GA 2ENBA 2YV5A 1XNQQ 3A8KE 1V1OA 3I70A 2LKVA 2NTSA 4HJAA 3K81C 3AYHB 5A2QE 1TKWB 3TMEA 2Z1CA 3Q8DA 3S1MB 1B3QA 5J22A 1H9SB 5JOBA 4FF3A 2A6HD 4R9WA 1G6PA 1CSPA 1XPRA 1BBWA 4LF8L 4LF7Q 4LWCA 1X3PA 2XN9C 1XYIA 1R4PB 4HCEA 1DZ1A 3M7NA 3HFZB 1P16A 2F0FA 1UE1A 2UU9Q 1RF2D 1N36Q 4GN4B 1SJHD 2EYJA 3UE1A 3CCJA 2K1BA 1RD9D 4UHVA 1B2TA 5J39A 2X6LA 4DR5Q 3S1MH 3CU7A 1LTLA 2PMZE 5I9OA 4F88A 3CQZB 2OWOA 4JI6L 1P8LA 1CSQA 2K5HA 3DWAA 3R8BA 2E74C 1E22A 2HT1A 1FNUA 1TR5A 5CV9A 1DCZA 2F0VA 4KN7C 2AHOB 3UDIA 1C7YA 2K5VA 5DM63 5T1IA 2K03A 5JJKA 3TS0A 4DXFA 3K5MA 5EAYA 3SK8A 1Q82C 2R93G 1KNEA 3R3OA 2DY7A 3D31A 5DNFA 1B53A 1AZQA 4QIWB 4Q5VA 4H0LC 5JJIA 2LMCB 1A62A 1SJED 4LF5Q 1MJCA 1SNPA 1VMPA 1XWEA 2RHQB 1TWFB 1JORA 2N49A 1VS0A 4O0AA 4FXKC 3S16H 3TEHB 1EIHA 3VYUA 3D3RA 2R7DA 5JPNC 4CKEA 4V190 3F2CA 1MIUA 4DV2L 4A3MG 3OOCA 2L55A 1TWHB 4X3SA 4OWWB 3RN5A 3GTMH 1L0WA 4GLAC 5D14A 5KNDA 3ER0A 4IN3A 1VQLA 1M1KC 1PH7A 1CK1A 2BDOA 3GQBA 1TWFH 3RLFA 2K75A 2R61A 3OIPA 1KXLA 2UXCL 1EEID 4IOCA 4B3SQ 3S14B 3OWFA 4JI4Q 4DAYA 5I6YA 1WCMB 1B9NA 4P2CB 2R93H 3I2ZA 1TWHH 2DUDA 4HJ5A 1QILA 1K0SA 3K7UC 1XNQL 4BS9A 3GTGB 2Q2UA 4K2KA 2AUKA 1RTNA 1CQFA 2VUMB 4Y52H 1PXUA 1OXVA 2L1BA 1G2TA 2K32A 2KCMA 3K5OA 2WFWA 3VYRA 3T13A 2ES2A 4DV1L 4A76A 1KLUD 2R92G 5JEAG 5IODA 2XWJB 4GNXC 4DXGA 5JVH3 1N8RC 4DR7Q 3V2TA 1EY7A 4DV3Q 2E2JH 2UU9L 1N36L 4QMGA 4HJ8A 4A3JG 2RHSB 2NTTA 2DNCA 1R9TB 1LT5D 1W3SA 5GROA 1WTHA 4OEMB 4DR5L 3BVZA 4HMJA 4YHHL 3K5NA 1BCPC 4KY6A 5ISRA 2RSNA 1VQDA 2R92B 4TRDA 1YNXA 1I4XA 1NE3A 5IT9E 2A19A 1QOHA 1S3OA 1YNJC 1H9SA 4RGMA 4B3ML 4A3JB 3W2DA 2JJQA 1SMYD 2MNAA 2F0PA 5K5PA 2N8NA 2M2LA 3PV0A 1JT8A 2A73B 3K8AA 1PMRA 3VA7A 1IBLL 5KYLA 3PMFA 3NTHA 3U50C 3TP5A 3IRBA 1WTVA 1STAA 2R92H 5JEAH 4LF5L 5HURA 4JI5Q 2NN6I 3OMGA 4YCVA 1II3A 1RHPA 1HTLD 2OXPA 3HOVG 3PSIA 4UP7A 2PNHA 4A3JH 3VA5A 4A3EG 2IX0A 1GXDC 3D6WA 1QZGA 4ODGA 3J7AF 1GUTA 1UEBA 2JEBI 2NN6G 4J8QA 3I4NB 2PI2A 4JI7Q 3NEMA 3EJIA 2E2IH 1V43A 1C9OA 3RLOA 1RKNA 1HFGA 4A3BG 2D62A 4RHSA 5BR8Q 1BBXC 2JSOA 3CW2C 1O7IA 4KLKA 2NVTH 3H3VC 2OT2A 1STYA 3H91A 2WV6D 5GADC 1G91A 3GTKB 5EJWA 4QCLA 1JMCA 2OEOA 3HKZB 1Z6HA 2HDLA 1QB5D 2SOBA 4GLXA 4LUOA 1HUNA 2JA7B 1BVSA 4HCSA 1FNVA 1UEAB 4LW1A 5IYBG 4A3CG 1PVOA 3J80i 4A3BB 2MJ8A 1PTOF 1PFNA 2VW9A 2F0NA 2QDLA 3HOVH 3DMUA 3TSSA 3F8TA 4A3EH 1ZYRC 5D65A 4DPGA 2NB0A 3I90A 1NR4A 2CW0C 3GTKH 2Z4IA 1IYJB 5EKLA 1TWGB 2PO4A 2SDFA 3PUYA 5C6AA 1JWMD 1RDPD 1OTCA 1EZ8A 3K6OA 3OPOA 1SNCA 1IL2A 3AU7A 1VQ7A 3OIQA 2WAQE 4A3BH 3DM3A 2RDFA 5ELEA 3CCQA 1IL8A 2DGYA 3OMCA 1AFPA 2VXWA 1LT4D 1X65A 3F2DA 5IGEA 2K05A 4LMQD 1WTRA 5CGKA 1I50H 1TWGH 2HQLA 2VNUD 2Y0SE 4DR2Q 3HOYB 3PF5A 2L15A 4XT3B 3TP8A 4X3UA 2ZJPA 3VR5A 5IYBH 4A3CH 1SNOA 2F0UA 2XNAC 3U4ZA 1SFOH 3FKIG 1U4MA 2XRQD 5LMNQ 4JYAQ 4EQNA 4DUYQ 2PQAA 2B2VC 4HIKA 1PYSB 1EFID 2F0MA 4RKBA 2F0DA 4JV5Q 2OF1A 5M5WH 1LTRD 2UUAQ 1HNWQ 4DAVA 1A0IA 1NJIC 3TQYA 5JJLA 5F2DA 3SK6A 2AMCB 3GTJH 1EIGA 1S4ZA 3G6EA 1HR0L 5D3DA 1WTXA 2NZHA 1LM0A 3VR2A 4LF6Q 5C0XI 3KLWA 3FKIB 4RFBA 4O2DA 1VQGA 1DD2A 1IBKQ 4L5RC 2PW5A 3TS2A 4POFA 2EYHA 5K36G 2EY5A 5CORA 1HRJA 4Z9CB 2O5IC 3Q23A 1G2SA 2F0WA 3JAME 4LF9Q 3GTOH 1PTOC 4X3KA 4DV0Q 4RA8A 5G3LD 5M3FG 4EVOA 3GD7A 3HOXG 1DOMA 1OXTA 3FKIH 3T1HL 4ME3A 4JOIC 3H0GB 2I5LX 2B3GA 4IJLA 4KKUA 3FDTA 1K0RA 5FO7B 4A93B 2ATWA 3KBXA 1ZKOA 1H95A 4DKAC 1WI5A 1PYBA 2KECA 5ELCA 1VQKA 5C4XB 1KDCA 4JI3Q 2YYZA 3S2HB 5M3FB 2ZTEA 4X6AH 4HEDA 1ONLA 4DK0A 3FPUB 3T56B 1TWAB 2WACA 3SVMA 1TXYA 2I46A 3MEHA 2MGSA 1VMCA 5K36H 1EOTA 3K57A 4XXEA 1HPCA 1LV9A 1BUVT 2L11A 1NCVA 4PV1C 1AN8A 1X3GA 3MZ5A 1B4OA 1X3FA 4FF2A 2HUGA 1GD7A 1A8VA 4OL7A 4FXGC 1T9HA 5M3FH 4GKJQ 2XRSD 2RKSA 3HOXH 1SYGA 1CA6A 2KHIA 1SNDA 1S72A 1RCVD 5DM73 4QB4A 2K4KA 1TQOA 4OX9L 2A74C 1UWVA 2Z9HA 3J80E 1U0LA 3D8GA 1BF4A 4CJ1B 3K0YA 4QL5A 2SEBD 3SR1A 2JA9A 3D6CA 3KF8B 4YWLA 4RCOA 5A35A 1WYDA 4K8IA 3KFUA 4A3LG 4KHPL 1HFNA 1CUKA 4JYAL 3H94A 3HG9A 1FVIA 2LFNA 1PFSA 1PV4A 1SSOA 2CHBD 2G5DA 1VQ4A 2R6GA 4X66Q 5I9PA 3GTLH 1SYBA 2EZVA 2UUAL 1GO3E 1HXYD 1HNWL 2WB1B 4C1NK 1J5EL 2J7ZA 2WINB 4R4QA 1SR3A 1MD2D 3S15H 2CQOA 1ESRA 3HRZC 2F1MA 4LF6L 3U4VA 3RD4A 2F3VA 1YI2A 3QOLA 4DV7Q 1Q3LA 1T5EA 2E8GA 3LGJA 3NENA 1PH4A 2A6HC 5IGCA 2I0QA 1SMXA 4B3RQ 1XMOL 4MN3A 1CKMA 1ML0D 4S3SA 3HGBA 2VS1A 4Q0FA
chains in the Genus database with same CATH topology
3PO3G 4LF9L 2OWOA 1PHJA 4JI6L 4DV0L 5FLMG 2ZTCA 4C3HH 1P8LA 4GOPC 4IPCA 1CSQA 2K5HA 1Y14B 1R9TH 1E22A 2OQKA 2HT1A 5IWAL 1VQPA 2WAQG 3RR5A 4OO1G 4BBRH 1ASZA 4JI7L 4ALPA 1IBMQ 4LFCQ 3OYYA 2AHOB 3UDIA 5C0XJ 1K9MC 2K52A 1C7YA 2K5VA 3I4NG 4A3LH 2OCEA 2K14A 2V1CC 1KL9A 1K3RA 4YWKA 4PZ7A 5C0XG 1KAWA 1HR0W 5BR8L 2CWPA 5JJKA 3TS0A 1Y1VG 3TREA 2NZOA 2JA6G 4GNXB 5EAYA 2A1AA 2KHJA 1L1OC 1Q82C 2R93G 3PO2G 4A3IH 2Y0SG 3D31A 2YTVA 4PMWA 1HR0Q 2B29A 4C2MH 4H02A 3CCUA 2UXDL 3AEVA 4YY3L 2EXDA 4KHPL 2IHFA 5JJIA 1E3PA 2VL6A 3G4SA 4KI0A 4X62Q 1A62A 4NXNQ 1XNRL 4LF5Q 1MJCA 3CCRA 1MKHA 2Z6KA 3L7ZC 2RCNA 4MNOA 2BA1A 3U58A 2RHQB 3A5UA 2N49A 1VS0A 3HKZG 3EBEA 4O0AA 4JI3L 2UXBQ 2JA8G 3S16H 3TEHB 4DV5L 1PH5A 4LFBL 2R7DA 2JA7G 3J81j 5FLXc 1W2BA 2WB1E 1YZ6A 5ELOA 1YHAA 3F2CA 1MIUA 4OONA 3PGZA 4DV2L 4A3MG 2D0PA 1X55A 4QY7A 4IPHA 4OWWB 3RN5A 4DK6C 4Y7NH 3STBC 4A4IA 3BU2A 5AJ3L 2NVXH 1L0WA 3GTMH 3PO3H 4GLAC 4GOPB 5FLMH 3ER0A 4DR4L 1JB7A 1VQLA 1M1KC 1PH7A 4POGA 2ES2A 4P74A 2AWNA 4DAMA 4HJ9A 3T1HQ 1VQ5A 3I4MG 2ZJQA 1VQHA 4DV4Q 1HNXQ 1TWFH 2MO0A 3RLFA 2K75A 3H3VI 1YEZA 3T1YQ 5GAEC 1KXLA 3M85A 1U5KA 3I4NH 3CF5A 4AQYL 2UXCL 1N9WA 4IOCA 4B3SQ 4UY8C 4APVA 4IFDJ 3RZDH 4DR6L 1I3QH 1N33L 4A3FG 2QEXA 1Y1VH 4R1JA 4JI4Q 2GN5A 3K0XA 4X65L 2JA6H 4IFDG 3KYHC 1EUJA 1L1OB 2R93H 1WJJA 3PF4A 3I2ZA 1TWHH 2DUDA 3PO2H 2PI2E 4HJ5A 3K7UC 1XNQL 2Q2UA 3ULLA 3A0JA 4LFAQ 2VQEL 2VZAA 1N34L 4GS3A 2I5MX 3PCOB 3CAMA 5HGQA 2KCTA 4DR2L 1I6HH 3UDGA 2HHHL 3UE0A 4Y52H 2JA8H 2OTLA 1OXVA 5IYDG 1Y1WG 4QIWE 2KCMA 3HOYG 2UUBQ 1VQJA 4X66L 2QGQA 4DK3C 1B7YB 5GAHC 2JA7H 2Q2HA 2WFWA 5LMNL 1NMGA 1UE6A 1KHIA 1BBUA 1SLJA 2CKZB 2ID0A 5JEAJ 4DV1L 4A76A 1S40A 2R92G 5JEAG 3JAMc 4DUYL 4GNXC 4P73A 4FDBA 1N8RC 4YWMA 4JBMA 4JV5L 4DR7Q 1VCIA 1QUQA 4DV3Q 2E2JH 5IY0A 2UU9L 3ICEA 1N36L 4DNIA 1GM5A 2A8VA 1UE5A 1HZ9A 4HJ8A 1Z47A 4A3JG 1XMQQ 2RHSB 4B3TL 4A3DG 1D7QA 1PH3A 3W1GA 3I4MH 2NVYH 3ULJA 2IT1A 1W3SA 1VQEA 3RNUA 2R7ZG 5GROA 4OX9Q 1CKNB 3KF6A 4DR5L 3AQQA 4YHHL 1PH8A 1NTGA 5LMUQ 1VQ8A 3SGIA 1MJEA 1IBKL 2E2HH 4A3FH 1WOCA 1VQDA 1L2FA 1YNXA 1NE3A 5IE8A 2BH2A 1KRSA 1GKHA 2JK8A 1HJPA 2A19A 1S3OA 4GKKQ 1G291 4KHPQ 3J7ZC 4JI1L 1E7ZA 3UDFA 2FXQA 1XJVA 3H3VH 4B3ML 5GAGC 2D0OA 1IBML 2I5HA 4A75A 4K0KQ 2JJQA 1C0AA 2MNAA 2N8NA 5C3EG 2ZM6Q 3OTOL 1QVGA 3PV0A 1JT8A 1VQFA 4AYBE 3K8AA 1K73C 1J5EQ 1Y1WH 1IBLL 5IYDH 3HOYH 4DV6Q 3U50C 4AH6A 3IRBA 1TWCH 4L5QA 2XGTA 4YCUA 4X62L 4NXNL 1Q86C 2R92H 1YHQA 4LF5L 4PZ6A 2VQFQ 4JI5Q 2NN6I 1A63A 1NBWA 3J81c 2JE6I 4YCVA 1XMOQ 1FGUA 3BZKA 3M3YH 3H0GG 2UXBL 4JI0L 4NXMQ 3PSIA 4UP7A 3HOVG 4A3DH 2PNHA 4A3JH 4A3EG 2IX0A 4JI8Q 1B70B 1E24A 4GN3B 4MZ9A 1QZGA 4JI6Q 4A93G 2R7ZH 1Q12A 1Z9FA 2MO1A 1X9NA 1UEBA 1BKBA 3RZOH 2JEBI 1EQQA 3CMAA 4L5TA 2NN6G 3PUXA 3L2PA 3G71A 2PI2A 4A3KG 4KHZA 5C4XG 3CPWA 2IX1A 4JI7Q 3J80c 1CKOA 1DGSA 1VQCA 3JC66 3NEMA 4LNQA 1N32Q 4IO9A 2E2IH 1V43A 1C9OA 3RLOA 4EQ5A 4PG3A 3FP9A 4A3BG 4DUZL 2D62A 5BR8Q 1IZ6A 5E7NA 4IPGA 3CW2C 1KQSA 4JCVE 1O7IA 1EIFA 4KLKA 1FJGQ 1VQMA 1YVCA 2Q2IA 3T1YL 2NVTH 4JG2A 1Q1BA 2UXDQ 4LF4L 1V9PA 4YY3Q 4JC0A 5GADC 1I94Q 2ASBA 4BBSG 5C3EH 2KENA 4A3GG 1JJ2A 1XNRQ 1JMCA 5M5YH 1Q1EA 1Q46A 3KDFB 1HNZL 4GKJL 3L0OA 5C4JH 2N78A 4GLXA 4LUOA 3GTPH 1OXSC 4DR1Q 1BVSA 3VDYA 2H5XA 4LW1A 5IYBG 4A3CG 1AE3A 2EQSA 5IP9G 1PVOA 1K8GA 3J80i 4HIDA 1IXRA 3EN2A 2E5LL 1YITA 1E1TA 1AH9A 2VY3A 3H0GH 2VW9A 4DV2Q 3HOVH 3S17H 3EIVA 3W1BA 3F8TA 4OWXB 3PIOA 3E9IA 3RLNA 4A3EH 4DPGA 5AJ3Q 4BA1I 4R4TA 4LUVA 4GOPA 4A93H 1ASYA 3GTKH 4DR4Q 1IYJB 1VQAA 2QA4A 1OXUA 2UUCL 2CWAA 3CC2A 2F4VL 1YHBA 3PUYA 4A3KH 5C4XH 2ZTDA 4EX5A 1QUQB 4BY1G 3S2HH 4GKKL 1B8AA 2LXKA 4DR3L 1OTCA 4LF7L 2MFIA 4JI2L 3KJOA 1XMQL 1IL2A 4AQYQ 1VQ7A 4A3MH 1TWAH 3PIPA 2WAQE 4A3BH 2N3SA 3DM3A 2Z6KC 1N33Q 3B6YA 3CCQA 2DGYA 4X65Q 2OQ0A 2WP8J 2WB1G 2LSSA 3CD6A 1X65A 3F2DA 5LMUL 4BBSH 1SE8A 1RIPA 4QQBX 4DV7L 1SN8A 4B3RL 4A3GH 1I50H 4JOIA 5IYCG 1VQNA 2C35B 1TWGH 2HQLA 2JQOA 2VQEQ 2VNUD 2Y0SE 4DR2Q 3W5OA 5J3BA 3RN2A 1X3EA 1PH6A 1HZBA 1K8AC 2HHHQ 1KC8C 3I7FA 3PF5A 4RG1A 4BXXG 3ULPA 5LMNW 2L15A 1XTDA 4GN5A 2B63G 2ZJPA 5IYBH 4A3CH 5IP9H 4MTNA 3KJPA 3U4ZA 1SFOH 3FKIG 3CP0A 4J15A 5LMNQ 1QZHA 2RF4A 1Q7YC 3HOWG 1EQRA 3HKZE 4UP8A 4DV1Q 3OW2A 1G51A 4JYAQ 3JAMi 4UP9A 4R4OA 2PQAA 4DUYQ 2K5NA 3K7AH 4HIKA 1E1OA 3ERSX 1PYSB 3H15A 2EIFA 5DLQE 3GDEA 4LFCL 4JV5Q 5M5WH 4LF8Q 4AIMA 3I55A 2UUAQ 4L5SA 4JBKA 1HNWQ 4WJ3M 2OTJA 1SRUA 3CXCA 1A0IA 1NJIC 4P75A 3TQYA 2VQFL 1YIJA 3PUWA 3HOZG 5JJLA 1YJNA 3F1ZA 5FJ8G 1JJGA 2AMCB 4OO1I 3GTJH 3G6EA 1VQOA 1CKNA 1HR0L 4BY1H 4YHHQ 4NXML 4LUZA 2NZHA 1VQBA 1LM0A 4LF6Q 4PZ8A 3CCLA 4JI8L 5C0XI 3CCMA 3KLWA 2IHEA 4O2DA 1VQGA 4OXPA 1IBKQ 4L5RC 3J7A5 4WJ4A 3TS2A 4POFA 1VQ9A 4X64Q 3A5ZB 5K36G 1X56A 2R7FA 1GVPA 2CFMA 1AE2A 1YBYA 4JI1Q 4LF9Q 1J6QA 3GTOH 5IYCH 2HIVA 4DV0Q 4B3MQ 1VQ6A 1N32L 5C44G 4R4IA 4QJFA 4BXXH 5IWAQ 1HZCA 3OTOQ 2YU9H 5M3FG 3CC4A 1RL2A 3CMEA 3S24A 3GD7A 3HOXG 1IBLQ 2LXJA 2B63H 4YCWA 3NELA 1FJGL 3TRZA 1D8LA 3CQZH 3GTQH 1OXTA 3FKIH 3HOWH 3T1HL 1I94L 2XTIA 4NPSA 4ME3A 3ZJYC 4DV4L 1X6OA 3MEFA 4JOIC 4IJHA 3STBD 1M90C 1HNXL 4GNXA 5M3MG 1JE5A 4BY7G 2I5LX 1EFWA 2B3GA 4IJLA 3J81i 3K80C 5IP7G 5M5XH 1QVCA 1FL0A 1K0RA 4R4CA 4UPAA 4DR1L 4B3SL 1OXXK 1YJWA 4JI0Q 2ATWA 1KD1C 1PH9A 3E0EA 1H95A 4DKAC 4JI4L 2KBNA 1WI5A 4DAYB 1Q8KA 1PYBA 3BJUA 3HOZH 5FJ8H 3F2BA 1PH2A 2BA0A 4RMFA 1VQKA 4JI3Q 2YYZA 4X6AH 2ZTEA 4IPDA 1HZAA 4HIMA 1WCMG 4OWTB 4DV5Q 4HIOA 5ELNA 3HOUG 4AYBG 4LFAL 4LFBQ 1UE7A 4IFDI 1EIYB 1TXYA 3S1NH 2ALYB 4GLVB 1LYLA 3M9BA 3S1RH 2ZJRA 2IY5B 4DUZQ 3GO5A 1PH1A 1JJCB 3MXNB 1LUZA 1NY4A 1V1QA 2YTYA 2UUBL 5IT9c 1Q81C 1X3GA 2VUMG 1X3FA 2MQHA 5C44H 2K50A 4XIGS 1EWIA 2JEAI 3CC7A 1PA6A 1KIXA 4LF4Q 1XPUA 1GD7A 2AKWB 2JA5G 3NBHB 1A8VA 2Z0SA 4NB3A 1WFQA 1HNZQ 3KDFA 4P72A 1T9HA 3PUZA 3WWVA 2BH8A 2GVBA 5M3FH 4DV3L 4DR7L 3HOXH 4GKJQ 3S1QH 3E9HA 2KHIA 1SROA 5H1SE 2UXCQ 1S72A 4DR6Q 4TVAB 3D0FA 2GVAA 3M4PA 3M4OH 2K4KA 3G48A 3KF6B 2F3IA 3AFQA 5M3MH 4OX9L 4BY7H 1L1OA 1UWVA 1K83H 1X54A 3FHWA 5IP7H 2YTXA 2E5LQ 3AFPA 1U0LA 2YV5A 1XNQQ 4HJ7A 2CCZA 3HKSA 1YJ9A 4BA2I 3A74A 4BBRG 4QL5A 2JA9A 5HY6A 2Q2TA 2HIXA 4YWLA 3KF8B 3KFUA 1WYDA 1N34Q 4HJAA 3CCVA 4A3LG 3K81C 3AYHB 3DLLA 3PUVA 4C3JH 3UDXA 1EYGA 3S14H 3S2DH 3CPFA 4TQUS 1CUKA 4JYAL 4JBWA 2UUCQ 3Q8DA 2PQAB 1WCMH 1FVIA 1I5FA 1VQIA 2F4VQ 3HOUH 1PFSA 4QGUA 1PV4A 2AWOA 1G6PA 4A3IG 1VQ4A 1CSPA 2R6GA 1BBWA 4C3IH 4X66Q 1XPRA 4LF8L 2NVQH 3GTGH 3GTLH 4K0KL 4DR3Q 4LF7Q 4LWCA 1GO3E 2ZM6L 1HH2P 1NMFA 4JI2Q 2UUAL 1HNWL 3KOJA 4P71A 1KRTA 3M7NA 3HFZB 5GQOA 1J5EL 1QVFA 1P16A 3I4OA 1UE1A 4DV6L 4R4QA 1SR3A 1XPOA 2UU9Q 2VUMH 1N36Q 4GN4B 4XTCS 3S15H 2CQOA 3UE1A 4B3TQ 4LF6L 3BZCA 3CCJA 3U4VA 1YI2A 4JI5L 4DV7Q 2JA5H 2E8GA 2VS1A 3LGJA 3NENA 1PH4A 2I0QA 4B3RQ 4IOAA 1SMXA 3CCEA 1XMOL 1CKMA 4DR5Q 4X64L 3S1MH 3M4QA 3CCSA 1LTLA 2PMZE 4JBJA 2F52A 3I56A 1EOVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PO3 G;  4LF9 L;  2OWO A;  1PHJ A;  4JI6 L;  4DV0 L;  5FLM G;  2ZTC A;  4C3H H;  1P8L A;  4GOP C;  4IPC A;  1CSQ A;  2K5H A;  1Y14 B;  1R9T H;  1E22 A;  2OQK A;  2HT1 A;  5IWA L;  1VQP A;  2WAQ G;  3RR5 A;  4OO1 G;  4BBR H;  1ASZ A;  4JI7 L;  4ALP A;  1IBM Q;  4LFC Q;  3OYY A;  2AHO B;  3UDI A;  5C0X J;  1K9M C;  2K52 A;  1C7Y A;  2K5V A;  3I4N G;  4A3L H;  2OCE A;  2K14 A;  2V1C C;  1KL9 A;  1K3R A;  4YWK A;  4PZ7 A;  5C0X G;  1KAW A;  1HR0 W;  5BR8 L;  2CWP A;  5JJK A;  3TS0 A;  1Y1V G;  3TRE A;  2NZO A;  2JA6 G;  4GNX B;  5EAY A;  2A1A A;  2KHJ A;  1L1O C;  1Q82 C;  2R93 G;  3PO2 G;  4A3I H;  2Y0S G;  3D31 A;  2YTV A;  4PMW A;  1HR0 Q;  2B29 A;  4C2M H;  4H02 A;  3CCU A;  2UXD L;  3AEV A;  4YY3 L;  2EXD A;  4KHP L;  2IHF A;  5JJI A;  1E3P A;  2VL6 A;  3G4S A;  4KI0 A;  4X62 Q;  1A62 A;  4NXN Q;  1XNR L;  4LF5 Q;  1MJC A;  3CCR A;  1MKH A;  2Z6K A;  3L7Z C;  2RCN A;  4MNO A;  2BA1 A;  3U58 A;  2RHQ B;  3A5U A;  2N49 A;  1VS0 A;  3HKZ G;  3EBE A;  4O0A A;  4JI3 L;  2UXB Q;  2JA8 G;  3S16 H;  3TEH B;  4DV5 L;  1PH5 A;  4LFB L;  2R7D A;  2JA7 G;  3J81 j;  5FLX c;  1W2B A;  2WB1 E;  1YZ6 A;  5ELO A;  1YHA A;  3F2C A;  1MIU A;  4OON A;  3PGZ A;  4DV2 L;  4A3M G;  2D0P A;  1X55 A;  4QY7 A;  4IPH A;  4OWW B;  3RN5 A;  4DK6 C;  4Y7N H;  3STB C;  4A4I A;  3BU2 A;  5AJ3 L;  2NVX H;  1L0W A;  3GTM H;  3PO3 H;  4GLA C;  4GOP B;  5FLM H;  3ER0 A;  4DR4 L;  1JB7 A;  1VQL A;  1M1K C;  1PH7 A;  4POG A;  2ES2 A;  4P74 A;  2AWN A;  4DAM A;  4HJ9 A;  3T1H Q;  1VQ5 A;  3I4M G;  2ZJQ A;  1VQH A;  4DV4 Q;  1HNX Q;  1TWF H;  2MO0 A;  3RLF A;  2K75 A;  3H3V I;  1YEZ A;  3T1Y Q;  5GAE C;  1KXL A;  3M85 A;  1U5K A;  3I4N H;  3CF5 A;  4AQY L;  2UXC L;  1N9W A;  4IOC A;  4B3S Q;  4UY8 C;  4APV A;  4IFD J;  3RZD H;  4DR6 L;  1I3Q H;  1N33 L;  4A3F G;  2QEX A;  1Y1V H;  4R1J A;  4JI4 Q;  2GN5 A;  3K0X A;  4X65 L;  2JA6 H;  4IFD G;  3KYH C;  1EUJ A;  1L1O B;  2R93 H;  1WJJ A;  3PF4 A;  3I2Z A;  1TWH H;  2DUD A;  3PO2 H;  2PI2 E;  4HJ5 A;  3K7U C;  1XNQ L;  2Q2U A;  3ULL A;  3A0J A;  4LFA Q;  2VQE L;  2VZA A;  1N34 L;  4GS3 A;  2I5M X;  3PCO B;  3CAM A;  5HGQ A;  2KCT A;  4DR2 L;  1I6H H;  3UDG A;  2HHH L;  3UE0 A;  4Y52 H;  2JA8 H;  2OTL A;  1OXV A;  5IYD G;  1Y1W G;  4QIW E;  2KCM A;  3HOY G;  2UUB Q;  1VQJ A;  4X66 L;  2QGQ A;  4DK3 C;  1B7Y B;  5GAH C;  2JA7 H;  2Q2H A;  2WFW A;  5LMN L;  1NMG A;  1UE6 A;  1KHI A;  1BBU A;  1SLJ A;  2CKZ B;  2ID0 A;  5JEA J;  4DV1 L;  4A76 A;  1S40 A;  2R92 G;  5JEA G;  3JAM c;  4DUY L;  4GNX C;  4P73 A;  4FDB A;  1N8R C;  4YWM A;  4JBM A;  4JV5 L;  4DR7 Q;  1VCI A;  1QUQ A;  4DV3 Q;  2E2J H;  5IY0 A;  2UU9 L;  3ICE A;  1N36 L;  4DNI A;  1GM5 A;  2A8V A;  1UE5 A;  1HZ9 A;  4HJ8 A;  1Z47 A;  4A3J G;  1XMQ Q;  2RHS B;  4B3T L;  4A3D G;  1D7Q A;  1PH3 A;  3W1G A;  3I4M H;  2NVY H;  3ULJ A;  2IT1 A;  1W3S A;  1VQE A;  3RNU A;  2R7Z G;  5GRO A;  4OX9 Q;  1CKN B;  3KF6 A;  4DR5 L;  3AQQ A;  4YHH L;  1PH8 A;  1NTG A;  5LMU Q;  1VQ8 A;  3SGI A;  1MJE A;  1IBK L;  2E2H H;  4A3F H;  1WOC A;  1VQD A;  1L2F A;  1YNX A;  1NE3 A;  5IE8 A;  2BH2 A;  1KRS A;  1GKH A;  2JK8 A;  1HJP A;  2A19 A;  1S3O A;  4GKK Q;  1G29 1;  4KHP Q;  3J7Z C;  4JI1 L;  1E7Z A;  3UDF A;  2FXQ A;  1XJV A;  3H3V H;  4B3M L;  5GAG C;  2D0O A;  1IBM L;  2I5H A;  4A75 A;  4K0K Q;  2JJQ A;  1C0A A;  2MNA A;  2N8N A;  5C3E G;  2ZM6 Q;  3OTO L;  1QVG A;  3PV0 A;  1JT8 A;  1VQF A;  4AYB E;  3K8A A;  1K73 C;  1J5E Q;  1Y1W H;  1IBL L;  5IYD H;  3HOY H;  4DV6 Q;  3U50 C;  4AH6 A;  3IRB A;  1TWC H;  4L5Q A;  2XGT A;  4YCU A;  4X62 L;  4NXN L;  1Q86 C;  2R92 H;  1YHQ A;  4LF5 L;  4PZ6 A;  2VQF Q;  4JI5 Q;  2NN6 I;  1A63 A;  1NBW A;  3J81 c;  2JE6 I;  4YCV A;  1XMO Q;  1FGU A;  3BZK A;  3M3Y H;  3H0G G;  2UXB L;  4JI0 L;  4NXM Q;  3PSI A;  4UP7 A;  3HOV G;  4A3D H;  2PNH A;  4A3J H;  4A3E G;  2IX0 A;  4JI8 Q;  1B70 B;  1E24 A;  4GN3 B;  4MZ9 A;  1QZG A;  4JI6 Q;  4A93 G;  2R7Z H;  1Q12 A;  1Z9F A;  2MO1 A;  1X9N A;  1UEB A;  1BKB A;  3RZO H;  2JEB I;  1EQQ A;  3CMA A;  4L5T A;  2NN6 G;  3PUX A;  3L2P A;  3G71 A;  2PI2 A;  4A3K G;  4KHZ A;  5C4X G;  3CPW A;  2IX1 A;  4JI7 Q;  3J80 c;  1CKO A;  1DGS A;  1VQC A;  3JC6 6;  3NEM A;  4LNQ A;  1N32 Q;  4IO9 A;  2E2I H;  1V43 A;  1C9O A;  3RLO A;  4EQ5 A;  4PG3 A;  3FP9 A;  4A3B G;  4DUZ L;  2D62 A;  5BR8 Q;  1IZ6 A;  5E7N A;  4IPG A;  3CW2 C;  1KQS A;  4JCV E;  1O7I A;  1EIF A;  4KLK A;  1FJG Q;  1VQM A;  1YVC A;  2Q2I A;  3T1Y L;  2NVT H;  4JG2 A;  1Q1B A;  2UXD Q;  4LF4 L;  1V9P A;  4YY3 Q;  4JC0 A;  5GAD C;  1I94 Q;  2ASB A;  4BBS G;  5C3E H;  2KEN A;  4A3G G;  1JJ2 A;  1XNR Q;  1JMC A;  5M5Y H;  1Q1E A;  1Q46 A;  3KDF B;  1HNZ L;  4GKJ L;  3L0O A;  5C4J H;  2N78 A;  4GLX A;  4LUO A;  3GTP H;  1OXS C;  4DR1 Q;  1BVS A;  3VDY A;  2H5X A;  4LW1 A;  5IYB G;  4A3C G;  1AE3 A;  2EQS A;  5IP9 G;  1PVO A;  1K8G A;  3J80 i;  4HID A;  1IXR A;  3EN2 A;  2E5L L;  1YIT A;  1E1T A;  1AH9 A;  2VY3 A;  3H0G H;  2VW9 A;  4DV2 Q;  3HOV H;  3S17 H;  3EIV A;  3W1B A;  3F8T A;  4OWX B;  3PIO A;  3E9I A;  3RLN A;  4A3E H;  4DPG A;  5AJ3 Q;  4BA1 I;  4R4T A;  4LUV A;  4GOP A;  4A93 H;  1ASY A;  3GTK H;  4DR4 Q;  1IYJ B;  1VQA A;  2QA4 A;  1OXU A;  2UUC L;  2CWA A;  3CC2 A;  2F4V L;  1YHB A;  3PUY A;  4A3K H;  5C4X H;  2ZTD A;  4EX5 A;  1QUQ B;  4BY1 G;  3S2H H;  4GKK L;  1B8A A;  2LXK A;  4DR3 L;  1OTC A;  4LF7 L;  2MFI A;  4JI2 L;  3KJO A;  1XMQ L;  1IL2 A;  4AQY Q;  1VQ7 A;  4A3M H;  1TWA H;  3PIP A;  2WAQ E;  4A3B H;  2N3S A;  3DM3 A;  2Z6K C;  1N33 Q;  3B6Y A;  3CCQ A;  2DGY A;  4X65 Q;  2OQ0 A;  2WP8 J;  2WB1 G;  2LSS A;  3CD6 A;  1X65 A;  3F2D A;  5LMU L;  4BBS H;  1SE8 A;  1RIP A;  4QQB X;  4DV7 L;  1SN8 A;  4B3R L;  4A3G H;  1I50 H;  4JOI A;  5IYC G;  1VQN A;  2C35 B;  1TWG H;  2HQL A;  2JQO A;  2VQE Q;  2VNU D;  2Y0S E;  4DR2 Q;  3W5O A;  5J3B A;  3RN2 A;  1X3E A;  1PH6 A;  1HZB A;  1K8A C;  2HHH Q;  1KC8 C;  3I7F A;  3PF5 A;  4RG1 A;  4BXX G;  3ULP A;  5LMN W;  2L15 A;  1XTD A;  4GN5 A;  2B63 G;  2ZJP A;  5IYB H;  4A3C H;  5IP9 H;  4MTN A;  3KJP A;  3U4Z A;  1SFO H;  3FKI G;  3CP0 A;  4J15 A;  5LMN Q;  1QZH A;  2RF4 A;  1Q7Y C;  3HOW G;  1EQR A;  3HKZ E;  4UP8 A;  4DV1 Q;  3OW2 A;  1G51 A;  4JYA Q;  3JAM i;  4UP9 A;  4R4O A;  2PQA A;  4DUY Q;  2K5N A;  3K7A H;  4HIK A;  1E1O A;  3ERS X;  1PYS B;  3H15 A;  2EIF A;  5DLQ E;  3GDE A;  4LFC L;  4JV5 Q;  5M5W H;  4LF8 Q;  4AIM A;  3I55 A;  2UUA Q;  4L5S A;  4JBK A;  1HNW Q;  4WJ3 M;  2OTJ A;  1SRU A;  3CXC A;  1A0I A;  1NJI C;  4P75 A;  3TQY A;  2VQF L;  1YIJ A;  3PUW A;  3HOZ G;  5JJL A;  1YJN A;  3F1Z A;  5FJ8 G;  1JJG A;  2AMC B;  4OO1 I;  3GTJ H;  3G6E A;  1VQO A;  1CKN A;  1HR0 L;  4BY1 H;  4YHH Q;  4NXM L;  4LUZ A;  2NZH A;  1VQB A;  1LM0 A;  4LF6 Q;  4PZ8 A;  3CCL A;  4JI8 L;  5C0X I;  3CCM A;  3KLW A;  2IHE A;  4O2D A;  1VQG A;  4OXP A;  1IBK Q;  4L5R C;  3J7A 5;  4WJ4 A;  3TS2 A;  4POF A;  1VQ9 A;  4X64 Q;  3A5Z B;  5K36 G;  1X56 A;  2R7F A;  1GVP A;  2CFM A;  1AE2 A;  1YBY A;  4JI1 Q;  4LF9 Q;  1J6Q A;  3GTO H;  5IYC H;  2HIV A;  4DV0 Q;  4B3M Q;  1VQ6 A;  1N32 L;  5C44 G;  4R4I A;  4QJF A;  4BXX H;  5IWA Q;  1HZC A;  3OTO Q;  2YU9 H;  5M3F G;  3CC4 A;  1RL2 A;  3CME A;  3S24 A;  3GD7 A;  3HOX G;  1IBL Q;  2LXJ A;  2B63 H;  4YCW A;  3NEL A;  1FJG L;  3TRZ A;  1D8L A;  3CQZ H;  3GTQ H;  1OXT A;  3FKI H;  3HOW H;  3T1H L;  1I94 L;  2XTI A;  4NPS A;  4ME3 A;  3ZJY C;  4DV4 L;  1X6O A;  3MEF A;  4JOI C;  4IJH A;  3STB D;  1M90 C;  1HNX L;  4GNX A;  5M3M G;  1JE5 A;  4BY7 G;  2I5L X;  1EFW A;  2B3G A;  4IJL A;  3J81 i;  3K80 C;  5IP7 G;  5M5X H;  1QVC A;  1FL0 A;  1K0R A;  4R4C A;  4UPA A;  4DR1 L;  4B3S L;  1OXX K;  1YJW A;  4JI0 Q;  2ATW A;  1KD1 C;  1PH9 A;  3E0E A;  1H95 A;  4DKA C;  4JI4 L;  2KBN A;  1WI5 A;  4DAY B;  1Q8K A;  1PYB A;  3BJU A;  3HOZ H;  5FJ8 H;  3F2B A;  1PH2 A;  2BA0 A;  4RMF A;  1VQK A;  4JI3 Q;  2YYZ A;  4X6A H;  2ZTE A;  4IPD A;  1HZA A;  4HIM A;  1WCM G;  4OWT B;  4DV5 Q;  4HIO A;  5ELN A;  3HOU G;  4AYB G;  4LFA L;  4LFB Q;  1UE7 A;  4IFD I;  1EIY B;  1TXY A;  3S1N H;  2ALY B;  4GLV B;  1LYL A;  3M9B A;  3S1R H;  2ZJR A;  2IY5 B;  4DUZ Q;  3GO5 A;  1PH1 A;  1JJC B;  3MXN B;  1LUZ A;  1NY4 A;  1V1Q A;  2YTY A;  2UUB L;  5IT9 c;  1Q81 C;  1X3G A;  2VUM G;  1X3F A;  2MQH A;  5C44 H;  2K50 A;  4XIG S;  1EWI A;  2JEA I;  3CC7 A;  1PA6 A;  1KIX A;  4LF4 Q;  1XPU A;  1GD7 A;  2AKW B;  2JA5 G;  3NBH B;  1A8V A;  2Z0S A;  4NB3 A;  1WFQ A;  1HNZ Q;  3KDF A;  4P72 A;  1T9H A;  3PUZ A;  3WWV A;  2BH8 A;  2GVB A;  5M3F H;  4DV3 L;  4DR7 L;  3HOX H;  4GKJ Q;  3S1Q H;  3E9H A;  2KHI A;  1SRO A;  5H1S E;  2UXC Q;  1S72 A;  4DR6 Q;  4TVA B;  3D0F A;  2GVA A;  3M4P A;  3M4O H;  2K4K A;  3G48 A;  3KF6 B;  2F3I A;  3AFQ A;  5M3M H;  4OX9 L;  4BY7 H;  1L1O A;  1UWV A;  1K83 H;  1X54 A;  3FHW A;  5IP7 H;  2YTX A;  2E5L Q;  3AFP A;  1U0L A;  2YV5 A;  1XNQ Q;  4HJ7 A;  2CCZ A;  3HKS A;  1YJ9 A;  4BA2 I;  3A74 A;  4BBR G;  4QL5 A;  2JA9 A;  5HY6 A;  2Q2T A;  2HIX A;  4YWL A;  3KF8 B;  3KFU A;  1WYD A;  1N34 Q;  4HJA A;  3CCV A;  4A3L G;  3K81 C;  3AYH B;  3DLL A;  3PUV A;  4C3J H;  3UDX A;  1EYG A;  3S14 H;  3S2D H;  3CPF A;  4TQU S;  1CUK A;  4JYA L;  4JBW A;  2UUC Q;  3Q8D A;  2PQA B;  1WCM H;  1FVI A;  1I5F A;  1VQI A;  2F4V Q;  3HOU H;  1PFS A;  4QGU A;  1PV4 A;  2AWO A;  1G6P A;  4A3I G;  1VQ4 A;  1CSP A;  2R6G A;  1BBW A;  4C3I H;  4X66 Q;  1XPR A;  4LF8 L;  2NVQ H;  3GTG H;  3GTL H;  4K0K L;  4DR3 Q;  4LF7 Q;  4LWC A;  1GO3 E;  2ZM6 L;  1HH2 P;  1NMF A;  4JI2 Q;  2UUA L;  1HNW L;  3KOJ A;  4P71 A;  1KRT A;  3M7N A;  3HFZ B;  5GQO A;  1J5E L;  1QVF A;  1P16 A;  3I4O A;  1UE1 A;  4DV6 L;  4R4Q A;  1SR3 A;  1XPO A;  2UU9 Q;  2VUM H;  1N36 Q;  4GN4 B;  4XTC S;  3S15 H;  2CQO A;  3UE1 A;  4B3T Q;  4LF6 L;  3BZC A;  3CCJ A;  3U4V A;  1YI2 A;  4JI5 L;  4DV7 Q;  2JA5 H;  2E8G A;  2VS1 A;  3LGJ A;  3NEN A;  1PH4 A;  2I0Q A;  4B3R Q;  4IOA A;  1SMX A;  3CCE A;  1XMO L;  1CKM A;  4DR5 Q;  4X64 L;  3S1M H;  3M4Q A;  3CCS A;  1LTL A;  2PMZ E;  4JBJ A;  2F52 A;  3I56 A;  1EOV A; 
#chains in the Genus database with same CATH topology
 3PO3 G;  4LF9 L;  1PHJ A;  4DV0 L;  2EY6 A;  4ZYS A;  4IPC A;  1PRT F;  3L3O C;  3EA6 A;  1CM9 A;  1JC7 A;  2QW7 A;  3AMU A;  1F2M A;  4OIK A;  2WAQ G;  3RR5 A;  1F2Z A;  4OO1 G;  1SE2 A;  1ASZ A;  1EWC A;  2RA4 A;  4ABN A;  3OYY A;  2X69 A;  4A3L H;  3HOZ B;  4YWK A;  1LTG D;  3MWY W;  4PZ7 A;  1KAW A;  2CWP A;  2JA6 G;  4NDX A;  5T1G A;  2F0J A;  2BCO A;  5EKK A;  2Y0S G;  1D5M C;  1HCZ A;  3CCU A;  3PO3 B;  2NVX B;  4YY3 L;  4EGV A;  3G4S A;  4X62 Q;  1XNR L;  4CDD C;  1CZG A;  1IHZ A;  2A69 D;  1MKH A;  3L7Z C;  3S1R B;  2RCN A;  4ZK9 B;  1CZW A;  4KTA A;  4JI3 L;  3EBE A;  3RMH A;  2JA8 G;  1I4P A;  4KKS A;  5C44 B;  2FJ2 A;  1U4R A;  2JP1 A;  3J81 j;  5FLX c;  1DOK A;  1W2B A;  1YZ6 A;  4FNF A;  1STE A;  1YHA A;  3PGZ A;  2D0P A;  4QY7 A;  4XDX A;  1FD7 D;  2IL8 A;  3PO3 H;  2NVX H;  4DR4 L;  1JB7 A;  4DF7 A;  3QIA A;  3I4M G;  1IYV A;  2ZJQ A;  1HNX Q;  3IKJ A;  4OO1 H;  2MO0 A;  2EE1 A;  2PW7 A;  3J81 L;  5EPK A;  1YEZ A;  2F0I A;  5JVG 3;  3T1Y Q;  3M85 A;  3IFT A;  3ND9 A;  4AQY L;  4UY8 C;  1N33 L;  1GUW A;  2QEX A;  4IFD G;  2GN5 A;  3K0X A;  4X65 L;  2JA6 H;  1HHV A;  1L1O B;  3KBG A;  5C4H A;  1WJJ A;  3VYS A;  5JJZ A;  1Z7T A;  3I91 A;  2ICI A;  2MPM A;  4LFA Q;  2VZA A;  1S5F D;  4PMB A;  2VQE L;  4GS3 A;  3A7L A;  2I5M X;  5HGQ A;  3P75 A;  2HHH L;  3L9A X;  3G7L A;  2JA8 H;  1O78 A;  1PRT C;  1FYC A;  5IYD G;  2XWB B;  1Y1W G;  4X66 L;  5CBE E;  5JEA J;  1B44 D;  1S40 A;  2ID0 A;  3MFY A;  5BN3 A;  3D4R A;  4J1M A;  4XQQ A;  3FVQ A;  1A2T A;  4P73 A;  1PZI D;  4B08 A;  4GZY C;  2EJG C;  4C56 C;  4JBM A;  1GHK A;  1H9M A;  1K8M A;  4PMC A;  4DNI A;  5J1Z A;  2A8V A;  2Z8L A;  1D7Q A;  4A3D G;  1PH3 A;  3NE5 B;  3I4M H;  3ULJ A;  3WOE A;  3AQQ A;  1VQ8 A;  3CRK C;  3T53 B;  3SGI A;  2VB2 X;  4IFD H;  2BOS A;  3KF8 A;  1W6J A;  2JXM B;  2BH2 A;  1GKH A;  2JK8 A;  2WII B;  1GUS A;  2QIL A;  3J7Z C;  4FF1 A;  5AFW A;  4B9X A;  2FXQ A;  1XJV A;  1EL0 A;  5GAG C;  4A3D B;  2F4I A;  4K0K Q;  1SNQ A;  2BE5 D;  3U9S A;  4QUC A;  2EYM A;  2QF7 A;  5C3E G;  3OTO L;  2ZM6 Q;  1CA5 A;  3MHB A;  2KEE A;  3NTK A;  4AYB E;  1K73 C;  3S16 B;  5IYD H;  1Y1W H;  4DV6 Q;  1IW7 D;  4AH6 A;  3HZX A;  3MXU A;  4UAI A;  1R4Q B;  4XQJ A;  4WOR A;  4X62 L;  1Q86 C;  4PZ6 A;  4G7H C;  5LL6 S;  4B9W A;  1S5C D;  3J81 c;  5IGD A;  1MGS A;  3GTM B;  4JI0 L;  4NXM Q;  4G7Z C;  2B8F A;  4A3D H;  1BCP F;  4JI8 Q;  4MZ9 A;  3NPP A;  1Q12 A;  1Z9F A;  5C3E B;  2MO1 A;  1DM0 B;  1SYD A;  3CMA A;  3PUX A;  3G71 A;  3CPW A;  2IX1 A;  1CKO A;  4LNQ A;  1SXT A;  3GV3 A;  4L6T B;  2R93 B;  3KUP A;  4DUZ L;  1VDZ A;  2E2D C;  1KQS A;  4TSS A;  5E4W C;  5C3X A;  3DXJ C;  4DU9 A;  1FJG Q;  3T1Y L;  2A6E D;  3Q24 A;  5COY A;  2UXD Q;  3KLS X;  4LF4 L;  4BBS G;  4JC0 A;  2ASB A;  5C3E H;  4A3G G;  2B2V A;  1Q46 A;  1HNZ L;  3IFD A;  5TSS A;  2RBM A;  1JCK B;  1LAB A;  1ENF A;  3C46 A;  1HUM A;  1K8G A;  4A3M B;  4HN7 A;  5I6W A;  3EN2 A;  2E5L L;  1YIT A;  1E1T A;  5I4D A;  4I65 A;  2VY3 A;  3FRP B;  2E2J B;  2I07 B;  3W1B A;  2F0Q A;  1NUC A;  3E9I A;  3RLN A;  5AJ3 Q;  4BBS B;  4LUV A;  1ASY A;  1WD1 A;  1OXU A;  3MAQ A;  1EY9 A;  1JE4 A;  4XQN A;  2LS0 1;  3DM1 A;  3J7A V;  1YHB A;  1STG A;  5HGT A;  1QUQ B;  4BY1 G;  1KNA A;  3NXW A;  1B8A A;  2LXK A;  2AQ1 B;  5CV6 A;  4LF7 L;  3KJO A;  1X3Q A;  4A3M H;  5LL6 X;  4IUV A;  2N3S A;  3B6Y A;  4BWG B;  1BNZ A;  4FO2 A;  2WP8 J;  1LTI D;  2KOL A;  3CD6 A;  4CBV A;  5G3L F;  1PDQ A;  4KHV A;  4QQB X;  4BBS H;  1SE8 A;  1SN8 A;  4I7A A;  4A3G H;  4K5X A;  4JOI A;  1TT2 A;  1VQN A;  4KN4 C;  2JQO A;  4R8N A;  3W5O A;  2EPB A;  1HZB A;  3I7F A;  4FYD A;  1AW7 A;  4XYQ A;  3CRL C;  4MTN A;  1Y8N B;  2KQ3 A;  5KEE A;  1QZH A;  1EQR A;  4UP8 A;  3JAM i;  1F9R A;  1PZJ D;  1E2V A;  1E1O A;  3ERS X;  3PIO 3;  3C3L A;  5DLQ E;  3GDE A;  4PQX A;  3RUZ A;  1B3A A;  1LTS D;  3LX0 A;  1S5E D;  1SRU A;  2KCN A;  2E75 C;  1JJG A;  1JOQ A;  4BY1 H;  2YU9 B;  2F0T A;  2Z6B A;  4NXM L;  2E2I B;  1VQB A;  4PZ8 A;  4KJN A;  3PIP 3;  4JI8 L;  3GTQ B;  3MA2 B;  5EPJ A;  1NR2 A;  2B2Y A;  1STH A;  2ICE C;  4WJ4 A;  1VQ9 A;  1NAP A;  2B39 A;  5CV5 A;  2R7F A;  2H1E A;  1D5Z C;  1Q90 A;  1GVP A;  3NQT A;  4JPB W;  2NVT B;  3TP6 A;  1JOO A;  2BDN A;  3NWT A;  4JI1 Q;  1J6Q A;  1F9S A;  4CDE C;  1JR0 D;  2TSS A;  2HIV A;  2N88 A;  4C1N I;  4E6I A;  4QJF A;  2KA7 A;  5IWA Q;  1F9Q A;  1HZC A;  2YU9 H;  3CME A;  1FJG L;  3TRZ A;  3GTQ H;  2XTI A;  3S1N B;  2K5W A;  1X6O A;  1SYC A;  1IYU A;  3HOV B;  4BY7 G;  4ZUI A;  1EFW A;  4A3E B;  1G8Z D;  2F0S A;  1QVC A;  1FL0 A;  4OIJ A;  4KKT A;  4B3S L;  1OXX K;  1VF5 C;  1GJX A;  4FXD A;  3E0E A;  4JI4 L;  4CHT B;  3BJU A;  1B50 A;  4H7B A;  2KCC A;  3I72 A;  3P7J A;  4HIM A;  4OWT B;  4DV5 Q;  4HIO A;  5ELN A;  3HOU G;  4AYB G;  1UE7 A;  4C3I G;  5I2Y A;  1SE3 A;  1EIY B;  3S1N H;  5IGB A;  4GLV B;  1LYL A;  1STN A;  1K83 B;  1PH1 A;  3NBI A;  1LTA D;  1JIC A;  2PMZ B;  4DAP A;  3ZYY X;  4WFN 3;  2B2U A;  1I50 B;  1UAP A;  2K50 A;  4XIG S;  1EWI A;  1PA6 A;  2AKW B;  2NN6 H;  2JA5 G;  3PQI A;  3S2D B;  1WFQ A;  4DR7 L;  3WWV A;  2GVB A;  1MSG A;  4MHE A;  4DV3 L;  2FMC A;  3HOU B;  1SRO A;  1GUG A;  1SFO B;  1E2W A;  4DR6 Q;  3G48 A;  3SXH A;  1SAP A;  4BY7 H;  1EY5 A;  1K83 H;  3FHW A;  2YTX A;  4JVZ A;  3AFP A;  4ULL A;  4HJ7 A;  1TS3 A;  1VF7 A;  5M5W B;  2CCZ A;  1YJ9 A;  4BA2 I;  5HY6 A;  3I3C A;  1N34 Q;  1I4Q A;  3CCV A;  4KY5 A;  4F8M A;  1TU2 B;  3PUV A;  3S2D H;  3CPF A;  4TQU S;  3SDZ A;  3GTJ B;  5FO8 B;  4JBW A;  1BO0 A;  2UUC Q;  1C48 A;  1VQI A;  2LY7 A;  2F4V Q;  3HOU H;  4QGU A;  2AWO A;  1L0X B;  4C3I H;  4DR3 Q;  4JI2 Q;  1NMF A;  3KOJ A;  1KRT A;  5GQO A;  1QVF A;  4KMU C;  2F0H A;  1XPO A;  1SNM A;  3GTO B;  3SK5 A;  3LWE A;  2ZXP A;  4JI5 L;  2JA5 H;  3NP8 A;  4IOA A;  5C5L A;  5C5M A;  1Y8P B;  3M4Q A;  4F7X A;  3TDQ A;  4F87 A;  2B2W C;  3CCS A;  5IOC A;  3QO2 A;  1EY8 A;  2D5D A;  1K8O A;  1FR3 A;  1NNX A;  4O1N A;  3P20 A;  1Y14 B;  2K28 A;  5IWA L;  2D9U A;  4NKL A;  4JI7 L;  4EQO A;  3OW7 A;  2QCP X;  2K5Q A;  1BQQ T;  4LFC Q;  5KIX A;  1K9M C;  2K52 A;  2V1C C;  2K14 A;  5C0X G;  1HR0 W;  5BR8 L;  3DHQ A;  1Y1V G;  2NZO A;  3S9W A;  4GNX B;  1L1O C;  3PO2 G;  2YTV A;  5CC4 A;  1KAA A;  2B29 A;  2A68 C;  2K7V A;  4H02 A;  3HS0 C;  4C2M H;  3AEV A;  4KI0 A;  3CCR A;  1CHP D;  2Z6K A;  5EPL A;  3U58 A;  4ZAI A;  2F03 A;  2UXB Q;  4DV5 L;  3EFX D;  1EZ6 A;  2A5H A;  3RZD B;  1SYF A;  5ELO A;  3BG3 A;  4WRD A;  3HOX B;  4ZUJ A;  4IPH A;  4DK6 C;  4Y7N H;  3LWU A;  3STB C;  5CYU A;  5CR3 A;  4GOP B;  1O7Z A;  2FHT A;  4N9P A;  4RCN A;  4POG A;  4P74 A;  2AWN A;  4DAM A;  4HJ9 A;  1V1P B;  1VQH A;  1ZYR D;  3MXG A;  4DV4 Q;  3H3V I;  2CW0 D;  4NW2 A;  1ICF B;  1SEB D;  5GAE C;  3CF5 A;  2QEJ C;  1N9W A;  4IFD J;  5C0X H;  3RZD H;  4DR6 L;  1QG7 A;  2B2Y C;  4A3F G;  1Y1V H;  4R1J A;  2RDG A;  1ILQ A;  1YNN C;  2F0E A;  1ICW A;  3PO2 H;  2PI2 E;  3ERQ A;  4H44 C;  2F0K A;  1STB A;  1XXG A;  2PZW A;  3GTL B;  4K8J A;  1N34 L;  3PCO B;  2NVY B;  3CAM A;  1QWY A;  4DR2 L;  1I6H H;  4KK7 A;  3UDG A;  1MBY A;  3S15 B;  4QIW E;  5L37 A;  2UUB Q;  4WJW A;  2QGQ A;  5GAH C;  5A2Q L;  5LMN L;  1NMG A;  1KHI A;  1BBU A;  2CKZ B;  3URY A;  1ET6 A;  4DUY L;  3UI2 A;  1DON A;  3KLS A;  1J9O A;  4JV5 L;  1VCI A;  4KD3 A;  1I6V C;  2CH4 A;  1Z47 A;  1XMQ Q;  3Q6S A;  2N55 A;  3W1G A;  2NVY H;  2IT1 A;  2IX3 A;  1VQE A;  3FPP A;  3ERO A;  1CKN B;  4K5V A;  1EQV A;  4IUR A;  2IW3 A;  5LMU Q;  1MJE A;  1IBK L;  4A3F H;  1WOC A;  3I8Z A;  1D1K A;  3Q0A A;  5IE8 A;  2DY8 A;  1KRS A;  1HJP A;  4GKK Q;  2GA4 B;  1E0B A;  1XX8 A;  1E7Z A;  4OHJ A;  2TMP A;  3H3V H;  4RAU C;  2D0O A;  2B2U C;  2I5H A;  4A75 A;  4PNY A;  1C0A A;  2K04 A;  4CDF C;  3TBI B;  1QVG A;  2L12 A;  1VQF A;  1MSH A;  1LTT D;  1I4H A;  1DOL A;  2PZT A;  2FMM A;  4RH6 A;  2ZT9 C;  5BN4 A;  3E0J A;  4N8X 1;  1EY0 A;  4YCU A;  4HSV A;  4ZQ3 A;  1TII D;  1NBW A;  2M9V A;  3BZK A;  3M3Y H;  2UXB L;  2QKI C;  3BYY B;  1E24 A;  4HAE A;  4K5W A;  4JI6 Q;  3I73 A;  2WAQ B;  3QWN A;  2CH4 W;  5M5Y B;  1BKB A;  5KNB A;  3RZO H;  4K6D A;  1ENA A;  4L5T A;  2PNR C;  2K33 A;  1D2B A;  1DGS A;  1U4P A;  5C4Z A;  4IO9 A;  3BVG A;  2JA6 B;  1CFM A;  4OEL B;  2C5C A;  2K5D A;  2Y0S B;  5E7N A;  4IPG A;  3D4D A;  3S17 B;  1CI3 M;  1EIF A;  1AP0 A;  2SNM A;  1CTM A;  1Q1B A;  2L5T A;  4IUN A;  2KEN A;  2PCF B;  4G4K A;  4ZKC B;  5M5Y H;  1Q1E A;  1F77 A;  5C4J H;  4GKJ L;  2JA8 B;  2N78 A;  3T51 B;  3EQL C;  2L4N A;  5EBC A;  3DWQ A;  3GTP H;  1OXS C;  1B9M A;  1D6E C;  4KY7 A;  4M1U B;  1Y8O B;  2H5X A;  1LT6 D;  4DNR B;  1SYE A;  4IUT A;  1IXR A;  2SNS A;  1AH9 A;  4DV2 Q;  3S17 H;  1UUP A;  3PIO A;  1F2Y A;  4BA1 I;  3I4M B;  4GOP A;  1KDA A;  3QG1 A;  4CJ0 B;  3CC2 A;  1ZXT A;  1OO9 B;  3MVV A;  1GUN A;  3K58 A;  1V1P A;  1DYQ A;  4EX5 A;  2DN8 A;  2MFI A;  2V4D A;  4RHR A;  3R2I A;  1XMQ L;  3PIP A;  2Z6K C;  3DEO A;  1CHQ D;  3E3X A;  3VR4 A;  5FK9 C;  2LSS A;  3K7A B;  5FLX E;  1H9J A;  1PTO H;  5LMU L;  4DV7 L;  1Y69 U;  2J0T D;  4B3R L;  1SE4 A;  2C35 B;  1EY6 A;  4GKK L;  3CKI B;  1X3E A;  2FIN B;  1Y1W B;  1K8A C;  1KC8 C;  4RG1 A;  1WTQ A;  3ULP A;  4GN5 A;  2B63 G;  5IT9 L;  3ITP A;  3KJP A;  4LJZ C;  3CP0 A;  4ZLT F;  1HTP A;  2RF4 A;  3HKZ E;  4DV1 Q;  1G51 A;  3C1E A;  4UP9 A;  1ET9 A;  2K5N A;  3K7A H;  5E3F A;  3W3A A;  2EIF A;  2ZXO A;  4AIM A;  1IKL A;  4DN4 M;  3K59 A;  4JBK A;  4WJ3 M;  3EVQ A;  4QUF A;  5CV7 A;  4P75 A;  1YIJ A;  1YJN A;  1CKN A;  3MC0 B;  4YHH Q;  4UDU C;  4X3T A;  2B63 B;  1SBB B;  2RCF A;  4LUZ A;  4H13 C;  3CCL A;  2XSC A;  3CCM A;  2IHE A;  1TS4 A;  4HTH A;  3DUZ A;  4ID6 A;  2R3Z A;  4K6L A;  1GHJ A;  4X64 Q;  2D2C C;  3A5Z B;  3E6Z X;  1X56 A;  1SMY C;  3U9O A;  5FOB B;  2EYL A;  1AE2 A;  2Q8I B;  2JYO A;  5KGU A;  3E5S A;  1PZK D;  1VQ6 A;  4B3M Q;  1B1Z A;  1PYW D;  3A7A B;  3HP3 A;  2EDG A;  4JK1 C;  5ELD A;  3VR3 A;  4RGO S;  2B63 H;  1RL2 A;  1F9P A;  1IBL Q;  3NEL A;  3P1H A;  3CQZ H;  1EQT A;  4NPS A;  1EY4 A;  1HNX L;  2O2L D;  3MEF A;  4QF4 A;  5M3M G;  1JE5 A;  5DAU A;  5IP7 G;  3A8J E;  3NWS A;  5KRU A;  1Q8K A;  2PQE A;  4TKO B;  3SHL A;  4C3J G;  3F2B A;  4RMF A;  1ESF A;  1MI2 A;  5EBD A;  3KLR A;  2EY1 A;  1WCM G;  1EEF D;  3S1Q B;  2RSO A;  1EU3 A;  4LFA L;  4LFB Q;  2JN4 A;  5E1F A;  3NUC A;  3M4O B;  2RDH A;  1LO5 D;  3M9B A;  2PYK A;  5M3M B;  2B2W A;  1J8I A;  3GO5 A;  4XT1 B;  3MXN B;  2YTY A;  1NY4 A;  1V1Q A;  5IT9 c;  1A15 A;  2K6A A;  1Q81 C;  3X3M A;  2VUM G;  4A3G B;  3J81 E;  1D5X C;  5LHY 1;  2JEA I;  1WTP A;  1KIX A;  1PRT D;  4C3J B;  3BVM A;  3NBH B;  4L63 B;  4NB3 A;  5CV8 A;  3BDC A;  4P72 A;  3IAY A;  2BH8 A;  3KK7 A;  1M4V A;  5I2X A;  3S1Q H;  5H1S E;  4FP5 D;  2NVQ B;  2CVR A;  4TVA B;  4DK1 A;  2GVA A;  3M4P A;  1TVX A;  4C3H G;  3M4O H;  3KF6 B;  1NSN S;  1TS2 A;  2F3I A;  2IPK D;  3AFQ A;  1L1O A;  5M3M H;  2WKD A;  4YIJ A;  5IP7 H;  1C8C A;  3HKS A;  3A74 A;  4BBR G;  2Q2T A;  2HIX A;  1FGB D;  3DLL A;  3S14 H;  4C3J H;  3UDX A;  1EYG A;  1QCB D;  5C3W A;  2AQ2 B;  1BDO A;  4BY1 B;  1MHW C;  2PQA B;  1WCM H;  1I5F A;  3QOJ A;  2Q8R E;  4A3I G;  4K0K L;  4IZ8 A;  3GTG H;  2NVQ H;  2O5J C;  1EU4 A;  2F0G A;  1GOZ A;  2ZM6 L;  1HH2 P;  3ONA B;  4MIU A;  4C3H B;  2L0C A;  1X32 A;  4P71 A;  5E4X A;  2IJ0 A;  3I4O A;  4DV6 L;  2RVL A;  2VUM H;  1LAC A;  4BBR B;  2WKC A;  4XTC S;  4MTK A;  3LNN A;  4R8I A;  4B3T Q;  1C4Q A;  3BZC A;  4ZKB B;  1CQV A;  4IUP A;  5BN5 A;  3CCE A;  5IGF A;  4X64 L;  4A3I B;  1K3R A;  4JBJ A;  2F52 A;  3I56 A;  1EOV A;  3WDN A;  4RGN A;  2MUY A;  4GOP C;  1PFB A;  2ZTC A;  4C3H H;  5FLM G;  2ZXR A;  1BOS A;  1R9T H;  5KNC A;  2OQK A;  1VQP A;  3ND8 A;  3JAM L;  3FEW X;  1PRT B;  4BBR H;  3TP7 A;  4ALP A;  2M00 A;  1IBM Q;  5C0X J;  3I4N G;  2DNE A;  2OCE A;  1KL9 A;  2DJG C;  2E76 C;  3TRE A;  2EOT A;  1S5D D;  2NBF A;  2A1A A;  2KHJ A;  3A8I E;  2EJF C;  4A3I H;  4PMW A;  1HR0 Q;  3BDL A;  4LAA A;  2UXD L;  2EXD A;  2IHF A;  3HEJ A;  1E3P A;  2VL6 A;  4NXN Q;  2F0O A;  4CGY B;  4KD4 A;  4MNO A;  2BA1 A;  1JB3 A;  2KJX A;  3QR8 A;  1HA5 A;  1A2U A;  3A5U A;  3HKZ G;  4RWS C;  1CT1 D;  3M7G A;  2FFK B;  1PH5 A;  4LFB L;  2JA7 G;  4HSP A;  1I3Q B;  2WB1 E;  3FMC A;  1H9K A;  1DJR D;  4OON A;  4XYO A;  1X55 A;  1L0Y B;  1QJO A;  3BU2 A;  4A4I A;  5AJ3 L;  1A3T A;  5FLM H;  1UNS A;  4U67 3;  5FO9 B;  4O42 A;  4BY7 B;  3T1H Q;  1VQ5 A;  2NUC A;  1O7L A;  2PZU A;  5EQ0 A;  3IL8 A;  1TS5 A;  4K14 A;  3V05 A;  3I4N H;  1U5K A;  4ZRZ A;  2EY2 A;  4APV A;  3TN2 A;  1I3Q H;  4V0B A;  2AQ3 B;  2B2T A;  3KYH C;  1EUJ A;  3H6M A;  3PF4 A;  3Q22 A;  4AYB B;  3O13 A;  4C3I B;  1BR9 A;  1O80 A;  3ULL A;  1U4L A;  3A0J A;  5EGT A;  5KYI A;  3J80 L;  3J7Y W;  2KCT A;  1QNU A;  2Z4H A;  3BDO A;  3UE0 A;  2VB3 X;  1E2Z A;  2OTL A;  1QNK A;  3MXN A;  3HOY G;  1A3U A;  1VQJ A;  2JA7 H;  4DK3 C;  1BCP D;  1B7Y B;  2JA5 B;  1LT3 D;  2Q2H A;  4RKL A;  2E2H B;  1UE6 A;  1SLJ A;  3JAM c;  1JWU D;  2RQX A;  3NBH A;  4FDB A;  5CV4 A;  4YWM A;  1QUQ A;  3N52 A;  5IY0 A;  3ICE A;  1GM5 A;  1UE5 A;  1HZ9 A;  3OHX C;  3SE0 A;  4B3T L;  1PFM A;  1JQY D;  1YNJ D;  3DEP A;  3RNU A;  2R7Z G;  4OX9 Q;  3KF6 A;  4DA2 A;  1RJT A;  2HCC A;  1PH8 A;  1NTG A;  2F3W A;  3A56 A;  2B8G A;  1O7Y A;  1TWC B;  2E2H H;  2IWH A;  3AB9 A;  3VR6 A;  1TY2 A;  1L2F A;  3QJY A;  4KHP Q;  1LTB D;  1G29 1;  2HCI A;  4I7Z C;  3SK4 A;  2CQA A;  4C2M B;  1ZEQ X;  4ME5 A;  4JI1 L;  1WTW A;  3UDF A;  2EXZ A;  4HR7 B;  4FVM A;  1IBM L;  2NWG A;  1JWS D;  3OSO A;  2R7Z B;  2QDB A;  3QB3 A;  2KED A;  1I4R A;  1J5E Q;  3HOY H;  1TWC H;  2DJF C;  4L5Q A;  2XGT A;  4NXN L;  3BS1 A;  1YHQ A;  5IIF A;  2VQF Q;  1BXT A;  4DGZ A;  1A63 A;  2JE6 I;  2EYO A;  2J4X A;  1XMO Q;  4Y7N B;  3WOF A;  1FGU A;  2HQE A;  3H0G G;  4DFA A;  5DEH A;  3H09 A;  2AUJ D;  1D1I A;  1PLF A;  1B70 B;  3TZU A;  4GN3 B;  3G6J B;  4A93 G;  2R7Z H;  3MXP A;  1WTO A;  1X9N A;  1HA6 A;  1BCP B;  2C9O A;  3K5L A;  1EQQ A;  3L2P A;  4A3K G;  5C4X G;  4KHZ A;  3J80 c;  1VQC A;  3JC6 6;  4NMZ A;  1N32 Q;  1KAB A;  1Y1V B;  2L9H A;  4J6H A;  4EQ5 A;  4PG3 A;  3FP9 A;  3PO2 B;  2XIW A;  3NTI A;  5FKA C;  2O4X A;  1IZ6 A;  2PPB C;  4ILW A;  2A69 C;  3BYT B;  4JCV E;  1VQM A;  1YVC A;  2Q2I A;  1ILP A;  4JG2 A;  4N9T A;  1V9P A;  4YY3 Q;  1I94 Q;  1I6H B;  4DNT B;  1JJ2 A;  1EWH A;  3C2P A;  1XNR Q;  3KDF B;  1U9R A;  3NSW A;  3L0O A;  1HQM C;  4A3K B;  4DR1 Q;  1KLG D;  2MP1 A;  2HD3 A;  3T4A C;  3VDY A;  1K28 A;  1AE3 A;  2EQS A;  5IP9 G;  4HID A;  1RTO A;  2H4O A;  3H0G H;  4LK1 C;  5NUC A;  1EYA A;  1XTC D;  3EIV A;  5IGG A;  5M9O A;  4OWX B;  4RGT A;  5CBA E;  4R4T A;  4A93 H;  2NYZ D;  4DR4 Q;  1VQA A;  1QE6 A;  2QA4 A;  2UUC L;  2CWA A;  3BZD B;  2F4V L;  1ROD A;  4A3K H;  5C4X H;  1SDF A;  2ZTD A;  3S2H H;  4DR3 L;  4A3F B;  4JI2 L;  4AQY Q;  2NZ1 D;  1TWA H;  1TY0 A;  1N33 Q;  4CDC C;  1LLR D;  4X65 Q;  2OQ0 A;  4FF4 A;  2WB1 G;  1F2L A;  5FLX L;  3R93 A;  1RIP A;  5ELB A;  5IYC G;  4IQZ A;  2X6G A;  2VQE Q;  1AEX A;  5D3I B;  4CKB A;  5J3B A;  3RN2 A;  1PH6 A;  3NK9 A;  4OGQ C;  2HHH Q;  4BXX G;  3GV6 A;  5LMN W;  1XTD A;  3OWE B;  5IP9 H;  1A6X A;  3A54 A;  1HQR D;  4J15 A;  3HOW G;  4CJ2 C;  4JW0 A;  4EQP A;  1Q7Y C;  1DXM A;  4G7O C;  3OW2 A;  4KV6 A;  1GUO A;  4R4O A;  3V96 A;  3M3Y B;  1H9R A;  3H15 A;  4K2L A;  3X3N A;  4LFC L;  4LF8 Q;  4N8F A;  3I55 A;  1EYC A;  4L5S A;  2OTJ A;  3N6R A;  3CXC A;  3RZO B;  2B2T C;  2VQF L;  1PTO D;  3PUW A;  3HOZ G;  3F1Z A;  3TZD A;  5FJ8 G;  4OO1 I;  1VQO A;  1G6Z A;  2XVS A;  3D4W A;  1KTK A;  1FNW A;  4IUQ A;  3HOW B;  4KJO A;  4OXP A;  3J7A 5;  3VYT A;  1K3B C;  2A68 D;  4IUU A;  1EYD A;  1WD0 A;  2BE5 C;  2CFM A;  5M5X B;  1YBY A;  2EVB A;  5IYC H;  1N32 L;  2KVM A;  3C1F A;  2EYF A;  1IW7 C;  5C44 G;  4NP5 A;  5C4J B;  4R4I A;  1A3V A;  2HDM A;  4BXX H;  3OTO Q;  4IAL A;  3GTP B;  3NHH A;  4ZCK A;  1KDB A;  3CC4 A;  3S24 A;  2LXJ A;  4YCW A;  1D8L A;  1IKM A;  4L8J A;  3HOW H;  1I94 L;  5CMD A;  3ZJY C;  4DV4 L;  1M90 C;  3STB D;  4IJH A;  4M8A A;  4GNX A;  2K01 A;  3J81 i;  2Q8T A;  3K80 C;  5M5X H;  4R4C A;  4UPA A;  4DR1 L;  1YJW A;  4JI0 Q;  1KD1 C;  1PH9 A;  3T16 A;  2KBN A;  4DAY B;  3HOZ H;  5FJ8 H;  1PH2 A;  2BA0 A;  4U68 A;  2MHV A;  5ELF A;  4IPD A;  1HZA A;  2KUM A;  3CHB D;  1W6K A;  1YNN D;  4IFD I;  2EJM A;  3SEB A;  2ALY B;  3F2U A;  2A6E C;  3A55 A;  1WVL A;  3S1R H;  2ZJR A;  2IY5 B;  5JPM C;  3GP7 A;  4DUZ Q;  1JJC B;  1LUZ A;  5JAV A;  2UUB L;  1PTO B;  4CKC A;  1AZP A;  1S5B D;  2EYP A;  2G9H D;  1V8Q A;  1T5X D;  2MQH A;  5C44 H;  3CC7 A;  4LF4 Q;  3DWP A;  3M4Y A;  2G9D A;  1XPU A;  2Z0S A;  2F0L A;  1HNZ Q;  3KDF A;  3PUZ A;  3MTS A;  5EKI A;  1JOK A;  2KHS A;  3E9H A;  3NQI A;  4G57 A;  3I4L A;  3MFG A;  2UXC Q;  1ENC A;  1Q8I A;  3D0F A;  2P5Z X;  4HMI A;  1X54 A;  3R2T A;  2E5L Q;  1M8A A;  1I4G A;  2ENB A;  2YV5 A;  1XNQ Q;  3A8K E;  1V1O A;  3I70 A;  2LKV A;  2NTS A;  4HJA A;  3K81 C;  3AYH B;  5A2Q E;  1TKW B;  3TME A;  2Z1C A;  3Q8D A;  3S1M B;  1B3Q A;  5J22 A;  1H9S B;  5JOB A;  4FF3 A;  2A6H D;  4R9W A;  1G6P A;  1CSP A;  1XPR A;  1BBW A;  4LF8 L;  4LF7 Q;  4LWC A;  1X3P A;  2XN9 C;  1XYI A;  1R4P B;  4HCE A;  1DZ1 A;  3M7N A;  3HFZ B;  1P16 A;  2F0F A;  1UE1 A;  2UU9 Q;  1RF2 D;  1N36 Q;  4GN4 B;  1SJH D;  2EYJ A;  3UE1 A;  3CCJ A;  2K1B A;  1RD9 D;  4UHV A;  1B2T A;  5J39 A;  2X6L A;  4DR5 Q;  3S1M H;  3CU7 A;  1LTL A;  2PMZ E;  5I9O A;  4F88 A;  3CQZ B;  2OWO A;  4JI6 L;  1P8L A;  1CSQ A;  2K5H A;  3DWA A;  3R8B A;  2E74 C;  1E22 A;  2HT1 A;  1FNU A;  1TR5 A;  5CV9 A;  1DCZ A;  2F0V A;  4KN7 C;  2AHO B;  3UDI A;  1C7Y A;  2K5V A;  5DM6 3;  5T1I A;  2K03 A;  5JJK A;  3TS0 A;  4DXF A;  3K5M A;  5EAY A;  3SK8 A;  1Q82 C;  2R93 G;  1KNE A;  3R3O A;  2DY7 A;  3D31 A;  5DNF A;  1B53 A;  1AZQ A;  4QIW B;  4Q5V A;  4H0L C;  5JJI A;  2LMC B;  1A62 A;  1SJE D;  4LF5 Q;  1MJC A;  1SNP A;  1VMP A;  1XWE A;  2RHQ B;  1TWF B;  1JOR A;  2N49 A;  1VS0 A;  4O0A A;  4FXK C;  3S16 H;  3TEH B;  1EIH A;  3VYU A;  3D3R A;  2R7D A;  5JPN C;  4CKE A;  4V19 0;  3F2C A;  1MIU A;  4DV2 L;  4A3M G;  3OOC A;  2L55 A;  1TWH B;  4X3S A;  4OWW B;  3RN5 A;  3GTM H;  1L0W A;  4GLA C;  5D14 A;  5KND A;  3ER0 A;  4IN3 A;  1VQL A;  1M1K C;  1PH7 A;  1CK1 A;  2BDO A;  3GQB A;  1TWF H;  3RLF A;  2K75 A;  2R61 A;  3OIP A;  1KXL A;  2UXC L;  1EEI D;  4IOC A;  4B3S Q;  3S14 B;  3OWF A;  4JI4 Q;  4DAY A;  5I6Y A;  1WCM B;  1B9N A;  4P2C B;  2R93 H;  3I2Z A;  1TWH H;  2DUD A;  4HJ5 A;  1QIL A;  1K0S A;  3K7U C;  1XNQ L;  4BS9 A;  3GTG B;  2Q2U A;  4K2K A;  2AUK A;  1RTN A;  1CQF A;  2VUM B;  4Y52 H;  1PXU A;  1OXV A;  2L1B A;  1G2T A;  2K32 A;  2KCM A;  3K5O A;  2WFW A;  3VYR A;  3T13 A;  2ES2 A;  4DV1 L;  4A76 A;  1KLU D;  2R92 G;  5JEA G;  5IOD A;  2XWJ B;  4GNX C;  4DXG A;  5JVH 3;  1N8R C;  4DR7 Q;  3V2T A;  1EY7 A;  4DV3 Q;  2E2J H;  2UU9 L;  1N36 L;  4QMG A;  4HJ8 A;  4A3J G;  2RHS B;  2NTT A;  2DNC A;  1R9T B;  1LT5 D;  1W3S A;  5GRO A;  1WTH A;  4OEM B;  4DR5 L;  3BVZ A;  4HMJ A;  4YHH L;  3K5N A;  1BCP C;  4KY6 A;  5ISR A;  2RSN A;  1VQD A;  2R92 B;  4TRD A;  1YNX A;  1I4X A;  1NE3 A;  5IT9 E;  2A19 A;  1QOH A;  1S3O A;  1YNJ C;  1H9S A;  4RGM A;  4B3M L;  4A3J B;  3W2D A;  2JJQ A;  1SMY D;  2MNA A;  2F0P A;  5K5P A;  2N8N A;  2M2L A;  3PV0 A;  1JT8 A;  2A73 B;  3K8A A;  1PMR A;  3VA7 A;  1IBL L;  5KYL A;  3PMF A;  3NTH A;  3U50 C;  3TP5 A;  3IRB A;  1WTV A;  1STA A;  2R92 H;  5JEA H;  4LF5 L;  5HUR A;  4JI5 Q;  2NN6 I;  3OMG A;  4YCV A;  1II3 A;  1RHP A;  1HTL D;  2OXP A;  3HOV G;  3PSI A;  4UP7 A;  2PNH A;  4A3J H;  3VA5 A;  4A3E G;  2IX0 A;  1GXD C;  3D6W A;  1QZG A;  4ODG A;  3J7A F;  1GUT A;  1UEB A;  2JEB I;  2NN6 G;  4J8Q A;  3I4N B;  2PI2 A;  4JI7 Q;  3NEM A;  3EJI A;  2E2I H;  1V43 A;  1C9O A;  3RLO A;  1RKN A;  1HFG A;  4A3B G;  2D62 A;  4RHS A;  5BR8 Q;  1BBX C;  2JSO A;  3CW2 C;  1O7I A;  4KLK A;  2NVT H;  3H3V C;  2OT2 A;  1STY A;  3H91 A;  2WV6 D;  5GAD C;  1G91 A;  3GTK B;  5EJW A;  4QCL A;  1JMC A;  2OEO A;  3HKZ B;  1Z6H A;  2HDL A;  1QB5 D;  2SOB A;  4GLX A;  4LUO A;  1HUN A;  2JA7 B;  1BVS A;  4HCS A;  1FNV A;  1UEA B;  4LW1 A;  5IYB G;  4A3C G;  1PVO A;  3J80 i;  4A3B B;  2MJ8 A;  1PTO F;  1PFN A;  2VW9 A;  2F0N A;  2QDL A;  3HOV H;  3DMU A;  3TSS A;  3F8T A;  4A3E H;  1ZYR C;  5D65 A;  4DPG A;  2NB0 A;  3I90 A;  1NR4 A;  2CW0 C;  3GTK H;  2Z4I A;  1IYJ B;  5EKL A;  1TWG B;  2PO4 A;  2SDF A;  3PUY A;  5C6A A;  1JWM D;  1RDP D;  1OTC A;  1EZ8 A;  3K6O A;  3OPO A;  1SNC A;  1IL2 A;  3AU7 A;  1VQ7 A;  3OIQ A;  2WAQ E;  4A3B H;  3DM3 A;  2RDF A;  5ELE A;  3CCQ A;  1IL8 A;  2DGY A;  3OMC A;  1AFP A;  2VXW A;  1LT4 D;  1X65 A;  3F2D A;  5IGE A;  2K05 A;  4LMQ D;  1WTR A;  5CGK A;  1I50 H;  1TWG H;  2HQL A;  2VNU D;  2Y0S E;  4DR2 Q;  3HOY B;  3PF5 A;  2L15 A;  4XT3 B;  3TP8 A;  4X3U A;  2ZJP A;  3VR5 A;  5IYB H;  4A3C H;  1SNO A;  2F0U A;  2XNA C;  3U4Z A;  1SFO H;  3FKI G;  1U4M A;  2XRQ D;  5LMN Q;  4JYA Q;  4EQN A;  4DUY Q;  2PQA A;  2B2V C;  4HIK A;  1PYS B;  1EFI D;  2F0M A;  4RKB A;  2F0D A;  4JV5 Q;  2OF1 A;  5M5W H;  1LTR D;  2UUA Q;  1HNW Q;  4DAV A;  1A0I A;  1NJI C;  3TQY A;  5JJL A;  5F2D A;  3SK6 A;  2AMC B;  3GTJ H;  1EIG A;  1S4Z A;  3G6E A;  1HR0 L;  5D3D A;  1WTX A;  2NZH A;  1LM0 A;  3VR2 A;  4LF6 Q;  5C0X I;  3KLW A;  3FKI B;  4RFB A;  4O2D A;  1VQG A;  1DD2 A;  1IBK Q;  4L5R C;  2PW5 A;  3TS2 A;  4POF A;  2EYH A;  5K36 G;  2EY5 A;  5COR A;  1HRJ A;  4Z9C B;  2O5I C;  3Q23 A;  1G2S A;  2F0W A;  3JAM E;  4LF9 Q;  3GTO H;  1PTO C;  4X3K A;  4DV0 Q;  4RA8 A;  5G3L D;  5M3F G;  4EVO A;  3GD7 A;  3HOX G;  1DOM A;  1OXT A;  3FKI H;  3T1H L;  4ME3 A;  4JOI C;  3H0G B;  2I5L X;  2B3G A;  4IJL A;  4KKU A;  3FDT A;  1K0R A;  5FO7 B;  4A93 B;  2ATW A;  3KBX A;  1ZKO A;  1H95 A;  4DKA C;  1WI5 A;  1PYB A;  2KEC A;  5ELC A;  1VQK A;  5C4X B;  1KDC A;  4JI3 Q;  2YYZ A;  3S2H B;  5M3F B;  2ZTE A;  4X6A H;  4HED A;  1ONL A;  4DK0 A;  3FPU B;  3T56 B;  1TWA B;  2WAC A;  3SVM A;  1TXY A;  2I46 A;  3MEH A;  2MGS A;  1VMC A;  5K36 H;  1EOT A;  3K57 A;  4XXE A;  1HPC A;  1LV9 A;  1BUV T;  2L11 A;  1NCV A;  4PV1 C;  1AN8 A;  1X3G A;  3MZ5 A;  1B4O A;  1X3F A;  4FF2 A;  2HUG A;  1GD7 A;  1A8V A;  4OL7 A;  4FXG C;  1T9H A;  5M3F H;  4GKJ Q;  2XRS D;  2RKS A;  3HOX H;  1SYG A;  1CA6 A;  2KHI A;  1SND A;  1S72 A;  1RCV D;  5DM7 3;  4QB4 A;  2K4K A;  1TQO A;  4OX9 L;  2A74 C;  1UWV A;  2Z9H A;  3J80 E;  1U0L A;  3D8G A;  1BF4 A;  4CJ1 B;  3K0Y A;  4QL5 A;  2SEB D;  3SR1 A;  2JA9 A;  3D6C A;  3KF8 B;  4YWL A;  4RCO A;  5A35 A;  1WYD A;  4K8I A;  3KFU A;  4A3L G;  4KHP L;  1HFN A;  1CUK A;  4JYA L;  3H94 A;  3HG9 A;  1FVI A;  2LFN A;  1PFS A;  1PV4 A;  1SSO A;  2CHB D;  2G5D A;  1VQ4 A;  2R6G A;  4X66 Q;  5I9P A;  3GTL H;  1SYB A;  2EZV A;  2UUA L;  1GO3 E;  1HXY D;  1HNW L;  2WB1 B;  4C1N K;  1J5E L;  2J7Z A;  2WIN B;  4R4Q A;  1SR3 A;  1MD2 D;  3S15 H;  2CQO A;  1ESR A;  3HRZ C;  2F1M A;  4LF6 L;  3U4V A;  3RD4 A;  2F3V A;  1YI2 A;  3QOL A;  4DV7 Q;  1Q3L A;  1T5E A;  2E8G A;  3LGJ A;  3NEN A;  1PH4 A;  2A6H C;  5IGC A;  2I0Q A;  1SMX A;  4B3R Q;  1XMO L;  4MN3 A;  1CKM A;  1ML0 D;  4S3S A;  3HGB A;  2VS1 A;  4Q0F A; 
#chains in the Genus database with same CATH homology
 3PO3 G;  4LF9 L;  2OWO A;  1PHJ A;  4JI6 L;  4DV0 L;  5FLM G;  2ZTC A;  4C3H H;  1P8L A;  4GOP C;  4IPC A;  1CSQ A;  2K5H A;  1Y14 B;  1R9T H;  1E22 A;  2OQK A;  2HT1 A;  5IWA L;  1VQP A;  2WAQ G;  3RR5 A;  4OO1 G;  4BBR H;  1ASZ A;  4JI7 L;  4ALP A;  1IBM Q;  4LFC Q;  3OYY A;  2AHO B;  3UDI A;  5C0X J;  1K9M C;  2K52 A;  1C7Y A;  2K5V A;  3I4N G;  4A3L H;  2OCE A;  2K14 A;  2V1C C;  1KL9 A;  1K3R A;  4YWK A;  4PZ7 A;  5C0X G;  1KAW A;  1HR0 W;  5BR8 L;  2CWP A;  5JJK A;  3TS0 A;  1Y1V G;  3TRE A;  2NZO A;  2JA6 G;  4GNX B;  5EAY A;  2A1A A;  2KHJ A;  1L1O C;  1Q82 C;  2R93 G;  3PO2 G;  4A3I H;  2Y0S G;  3D31 A;  2YTV A;  4PMW A;  1HR0 Q;  2B29 A;  4C2M H;  4H02 A;  3CCU A;  2UXD L;  3AEV A;  4YY3 L;  2EXD A;  4KHP L;  2IHF A;  5JJI A;  1E3P A;  2VL6 A;  3G4S A;  4KI0 A;  4X62 Q;  1A62 A;  4NXN Q;  1XNR L;  4LF5 Q;  1MJC A;  3CCR A;  1MKH A;  2Z6K A;  3L7Z C;  2RCN A;  4MNO A;  2BA1 A;  3U58 A;  2RHQ B;  3A5U A;  2N49 A;  1VS0 A;  3HKZ G;  3EBE A;  4O0A A;  4JI3 L;  2UXB Q;  2JA8 G;  3S16 H;  3TEH B;  4DV5 L;  1PH5 A;  4LFB L;  2R7D A;  2JA7 G;  3J81 j;  5FLX c;  1W2B A;  2WB1 E;  1YZ6 A;  5ELO A;  1YHA A;  3F2C A;  1MIU A;  4OON A;  3PGZ A;  4DV2 L;  4A3M G;  2D0P A;  1X55 A;  4QY7 A;  4IPH A;  4OWW B;  3RN5 A;  4DK6 C;  4Y7N H;  3STB C;  4A4I A;  3BU2 A;  5AJ3 L;  2NVX H;  1L0W A;  3GTM H;  3PO3 H;  4GLA C;  4GOP B;  5FLM H;  3ER0 A;  4DR4 L;  1JB7 A;  1VQL A;  1M1K C;  1PH7 A;  4POG A;  2ES2 A;  4P74 A;  2AWN A;  4DAM A;  4HJ9 A;  3T1H Q;  1VQ5 A;  3I4M G;  2ZJQ A;  1VQH A;  4DV4 Q;  1HNX Q;  1TWF H;  2MO0 A;  3RLF A;  2K75 A;  3H3V I;  1YEZ A;  3T1Y Q;  5GAE C;  1KXL A;  3M85 A;  1U5K A;  3I4N H;  3CF5 A;  4AQY L;  2UXC L;  1N9W A;  4IOC A;  4B3S Q;  4UY8 C;  4APV A;  4IFD J;  3RZD H;  4DR6 L;  1I3Q H;  1N33 L;  4A3F G;  2QEX A;  1Y1V H;  4R1J A;  4JI4 Q;  2GN5 A;  3K0X A;  4X65 L;  2JA6 H;  4IFD G;  3KYH C;  1EUJ A;  1L1O B;  2R93 H;  1WJJ A;  3PF4 A;  3I2Z A;  1TWH H;  2DUD A;  3PO2 H;  2PI2 E;  4HJ5 A;  3K7U C;  1XNQ L;  2Q2U A;  3ULL A;  3A0J A;  4LFA Q;  2VQE L;  2VZA A;  1N34 L;  4GS3 A;  2I5M X;  3PCO B;  3CAM A;  5HGQ A;  2KCT A;  4DR2 L;  1I6H H;  3UDG A;  2HHH L;  3UE0 A;  4Y52 H;  2JA8 H;  2OTL A;  1OXV A;  5IYD G;  1Y1W G;  4QIW E;  2KCM A;  3HOY G;  2UUB Q;  1VQJ A;  4X66 L;  2QGQ A;  4DK3 C;  1B7Y B;  5GAH C;  2JA7 H;  2Q2H A;  2WFW A;  5LMN L;  1NMG A;  1UE6 A;  1KHI A;  1BBU A;  1SLJ A;  2CKZ B;  2ID0 A;  5JEA J;  4DV1 L;  4A76 A;  1S40 A;  2R92 G;  5JEA G;  3JAM c;  4DUY L;  4GNX C;  4P73 A;  4FDB A;  1N8R C;  4YWM A;  4JBM A;  4JV5 L;  4DR7 Q;  1VCI A;  1QUQ A;  4DV3 Q;  2E2J H;  5IY0 A;  2UU9 L;  3ICE A;  1N36 L;  4DNI A;  1GM5 A;  2A8V A;  1UE5 A;  1HZ9 A;  4HJ8 A;  1Z47 A;  4A3J G;  1XMQ Q;  2RHS B;  4B3T L;  4A3D G;  1D7Q A;  1PH3 A;  3W1G A;  3I4M H;  2NVY H;  3ULJ A;  2IT1 A;  1W3S A;  1VQE A;  3RNU A;  2R7Z G;  5GRO A;  4OX9 Q;  1CKN B;  3KF6 A;  4DR5 L;  3AQQ A;  4YHH L;  1PH8 A;  1NTG A;  5LMU Q;  1VQ8 A;  3SGI A;  1MJE A;  1IBK L;  2E2H H;  4A3F H;  1WOC A;  1VQD A;  1L2F A;  1YNX A;  1NE3 A;  5IE8 A;  2BH2 A;  1KRS A;  1GKH A;  2JK8 A;  1HJP A;  2A19 A;  1S3O A;  4GKK Q;  1G29 1;  4KHP Q;  3J7Z C;  4JI1 L;  1E7Z A;  3UDF A;  2FXQ A;  1XJV A;  3H3V H;  4B3M L;  5GAG C;  2D0O A;  1IBM L;  2I5H A;  4A75 A;  4K0K Q;  2JJQ A;  1C0A A;  2MNA A;  2N8N A;  5C3E G;  2ZM6 Q;  3OTO L;  1QVG A;  3PV0 A;  1JT8 A;  1VQF A;  4AYB E;  3K8A A;  1K73 C;  1J5E Q;  1Y1W H;  1IBL L;  5IYD H;  3HOY H;  4DV6 Q;  3U50 C;  4AH6 A;  3IRB A;  1TWC H;  4L5Q A;  2XGT A;  4YCU A;  4X62 L;  4NXN L;  1Q86 C;  2R92 H;  1YHQ A;  4LF5 L;  4PZ6 A;  2VQF Q;  4JI5 Q;  2NN6 I;  1A63 A;  1NBW A;  3J81 c;  2JE6 I;  4YCV A;  1XMO Q;  1FGU A;  3BZK A;  3M3Y H;  3H0G G;  2UXB L;  4JI0 L;  4NXM Q;  3PSI A;  4UP7 A;  3HOV G;  4A3D H;  2PNH A;  4A3J H;  4A3E G;  2IX0 A;  4JI8 Q;  1B70 B;  1E24 A;  4GN3 B;  4MZ9 A;  1QZG A;  4JI6 Q;  4A93 G;  2R7Z H;  1Q12 A;  1Z9F A;  2MO1 A;  1X9N A;  1UEB A;  1BKB A;  3RZO H;  2JEB I;  1EQQ A;  3CMA A;  4L5T A;  2NN6 G;  3PUX A;  3L2P A;  3G71 A;  2PI2 A;  4A3K G;  4KHZ A;  5C4X G;  3CPW A;  2IX1 A;  4JI7 Q;  3J80 c;  1CKO A;  1DGS A;  1VQC A;  3JC6 6;  3NEM A;  4LNQ A;  1N32 Q;  4IO9 A;  2E2I H;  1V43 A;  1C9O A;  3RLO A;  4EQ5 A;  4PG3 A;  3FP9 A;  4A3B G;  4DUZ L;  2D62 A;  5BR8 Q;  1IZ6 A;  5E7N A;  4IPG A;  3CW2 C;  1KQS A;  4JCV E;  1O7I A;  1EIF A;  4KLK A;  1FJG Q;  1VQM A;  1YVC A;  2Q2I A;  3T1Y L;  2NVT H;  4JG2 A;  1Q1B A;  2UXD Q;  4LF4 L;  1V9P A;  4YY3 Q;  4JC0 A;  5GAD C;  1I94 Q;  2ASB A;  4BBS G;  5C3E H;  2KEN A;  4A3G G;  1JJ2 A;  1XNR Q;  1JMC A;  5M5Y H;  1Q1E A;  1Q46 A;  3KDF B;  1HNZ L;  4GKJ L;  3L0O A;  5C4J H;  2N78 A;  4GLX A;  4LUO A;  3GTP H;  1OXS C;  4DR1 Q;  1BVS A;  3VDY A;  2H5X A;  4LW1 A;  5IYB G;  4A3C G;  1AE3 A;  2EQS A;  5IP9 G;  1PVO A;  1K8G A;  3J80 i;  4HID A;  1IXR A;  3EN2 A;  2E5L L;  1YIT A;  1E1T A;  1AH9 A;  2VY3 A;  3H0G H;  2VW9 A;  4DV2 Q;  3HOV H;  3S17 H;  3EIV A;  3W1B A;  3F8T A;  4OWX B;  3PIO A;  3E9I A;  3RLN A;  4A3E H;  4DPG A;  5AJ3 Q;  4BA1 I;  4R4T A;  4LUV A;  4GOP A;  4A93 H;  1ASY A;  3GTK H;  4DR4 Q;  1IYJ B;  1VQA A;  2QA4 A;  1OXU A;  2UUC L;  2CWA A;  3CC2 A;  2F4V L;  1YHB A;  3PUY A;  4A3K H;  5C4X H;  2ZTD A;  4EX5 A;  1QUQ B;  4BY1 G;  3S2H H;  4GKK L;  1B8A A;  2LXK A;  4DR3 L;  1OTC A;  4LF7 L;  2MFI A;  4JI2 L;  3KJO A;  1XMQ L;  1IL2 A;  4AQY Q;  1VQ7 A;  4A3M H;  1TWA H;  3PIP A;  2WAQ E;  4A3B H;  2N3S A;  3DM3 A;  2Z6K C;  1N33 Q;  3B6Y A;  3CCQ A;  2DGY A;  4X65 Q;  2OQ0 A;  2WP8 J;  2WB1 G;  2LSS A;  3CD6 A;  1X65 A;  3F2D A;  5LMU L;  4BBS H;  1SE8 A;  1RIP A;  4QQB X;  4DV7 L;  1SN8 A;  4B3R L;  4A3G H;  1I50 H;  4JOI A;  5IYC G;  1VQN A;  2C35 B;  1TWG H;  2HQL A;  2JQO A;  2VQE Q;  2VNU D;  2Y0S E;  4DR2 Q;  3W5O A;  5J3B A;  3RN2 A;  1X3E A;  1PH6 A;  1HZB A;  1K8A C;  2HHH Q;  1KC8 C;  3I7F A;  3PF5 A;  4RG1 A;  4BXX G;  3ULP A;  5LMN W;  2L15 A;  1XTD A;  4GN5 A;  2B63 G;  2ZJP A;  5IYB H;  4A3C H;  5IP9 H;  4MTN A;  3KJP A;  3U4Z A;  1SFO H;  3FKI G;  3CP0 A;  4J15 A;  5LMN Q;  1QZH A;  2RF4 A;  1Q7Y C;  3HOW G;  1EQR A;  3HKZ E;  4UP8 A;  4DV1 Q;  3OW2 A;  1G51 A;  4JYA Q;  3JAM i;  4UP9 A;  4R4O A;  2PQA A;  4DUY Q;  2K5N A;  3K7A H;  4HIK A;  1E1O A;  3ERS X;  1PYS B;  3H15 A;  2EIF A;  5DLQ E;  3GDE A;  4LFC L;  4JV5 Q;  5M5W H;  4LF8 Q;  4AIM A;  3I55 A;  2UUA Q;  4L5S A;  4JBK A;  1HNW Q;  4WJ3 M;  2OTJ A;  1SRU A;  3CXC A;  1A0I A;  1NJI C;  4P75 A;  3TQY A;  2VQF L;  1YIJ A;  3PUW A;  3HOZ G;  5JJL A;  1YJN A;  3F1Z A;  5FJ8 G;  1JJG A;  2AMC B;  4OO1 I;  3GTJ H;  3G6E A;  1VQO A;  1CKN A;  1HR0 L;  4BY1 H;  4YHH Q;  4NXM L;  4LUZ A;  2NZH A;  1VQB A;  1LM0 A;  4LF6 Q;  4PZ8 A;  3CCL A;  4JI8 L;  5C0X I;  3CCM A;  3KLW A;  2IHE A;  4O2D A;  1VQG A;  4OXP A;  1IBK Q;  4L5R C;  3J7A 5;  4WJ4 A;  3TS2 A;  4POF A;  1VQ9 A;  4X64 Q;  3A5Z B;  5K36 G;  1X56 A;  2R7F A;  1GVP A;  2CFM A;  1AE2 A;  1YBY A;  4JI1 Q;  4LF9 Q;  1J6Q A;  3GTO H;  5IYC H;  2HIV A;  4DV0 Q;  4B3M Q;  1VQ6 A;  1N32 L;  5C44 G;  4R4I A;  4QJF A;  4BXX H;  5IWA Q;  1HZC A;  3OTO Q;  2YU9 H;  5M3F G;  3CC4 A;  1RL2 A;  3CME A;  3S24 A;  3GD7 A;  3HOX G;  1IBL Q;  2LXJ A;  2B63 H;  4YCW A;  3NEL A;  1FJG L;  3TRZ A;  1D8L A;  3CQZ H;  3GTQ H;  1OXT A;  3FKI H;  3HOW H;  3T1H L;  1I94 L;  2XTI A;  4NPS A;  4ME3 A;  3ZJY C;  4DV4 L;  1X6O A;  3MEF A;  4JOI C;  4IJH A;  3STB D;  1M90 C;  1HNX L;  4GNX A;  5M3M G;  1JE5 A;  4BY7 G;  2I5L X;  1EFW A;  2B3G A;  4IJL A;  3J81 i;  3K80 C;  5IP7 G;  5M5X H;  1QVC A;  1FL0 A;  1K0R A;  4R4C A;  4UPA A;  4DR1 L;  4B3S L;  1OXX K;  1YJW A;  4JI0 Q;  2ATW A;  1KD1 C;  1PH9 A;  3E0E A;  1H95 A;  4DKA C;  4JI4 L;  2KBN A;  1WI5 A;  4DAY B;  1Q8K A;  1PYB A;  3BJU A;  3HOZ H;  5FJ8 H;  3F2B A;  1PH2 A;  2BA0 A;  4RMF A;  1VQK A;  4JI3 Q;  2YYZ A;  4X6A H;  2ZTE A;  4IPD A;  1HZA A;  4HIM A;  1WCM G;  4OWT B;  4DV5 Q;  4HIO A;  5ELN A;  3HOU G;  4AYB G;  4LFA L;  4LFB Q;  1UE7 A;  4IFD I;  1EIY B;  1TXY A;  3S1N H;  2ALY B;  4GLV B;  1LYL A;  3M9B A;  3S1R H;  2ZJR A;  2IY5 B;  4DUZ Q;  3GO5 A;  1PH1 A;  1JJC B;  3MXN B;  1LUZ A;  1NY4 A;  1V1Q A;  2YTY A;  2UUB L;  5IT9 c;  1Q81 C;  1X3G A;  2VUM G;  1X3F A;  2MQH A;  5C44 H;  2K50 A;  4XIG S;  1EWI A;  2JEA I;  3CC7 A;  1PA6 A;  1KIX A;  4LF4 Q;  1XPU A;  1GD7 A;  2AKW B;  2JA5 G;  3NBH B;  1A8V A;  2Z0S A;  4NB3 A;  1WFQ A;  1HNZ Q;  3KDF A;  4P72 A;  1T9H A;  3PUZ A;  3WWV A;  2BH8 A;  2GVB A;  5M3F H;  4DV3 L;  4DR7 L;  3HOX H;  4GKJ Q;  3S1Q H;  3E9H A;  2KHI A;  1SRO A;  5H1S E;  2UXC Q;  1S72 A;  4DR6 Q;  4TVA B;  3D0F A;  2GVA A;  3M4P A;  3M4O H;  2K4K A;  3G48 A;  3KF6 B;  2F3I A;  3AFQ A;  5M3M H;  4OX9 L;  4BY7 H;  1L1O A;  1UWV A;  1K83 H;  1X54 A;  3FHW A;  5IP7 H;  2YTX A;  2E5L Q;  3AFP A;  1U0L A;  2YV5 A;  1XNQ Q;  4HJ7 A;  2CCZ A;  3HKS A;  1YJ9 A;  4BA2 I;  3A74 A;  4BBR G;  4QL5 A;  2JA9 A;  5HY6 A;  2Q2T A;  2HIX A;  4YWL A;  3KF8 B;  3KFU A;  1WYD A;  1N34 Q;  4HJA A;  3CCV A;  4A3L G;  3K81 C;  3AYH B;  3DLL A;  3PUV A;  4C3J H;  3UDX A;  1EYG A;  3S14 H;  3S2D H;  3CPF A;  4TQU S;  1CUK A;  4JYA L;  4JBW A;  2UUC Q;  3Q8D A;  2PQA B;  1WCM H;  1FVI A;  1I5F A;  1VQI A;  2F4V Q;  3HOU H;  1PFS A;  4QGU A;  1PV4 A;  2AWO A;  1G6P A;  4A3I G;  1VQ4 A;  1CSP A;  2R6G A;  1BBW A;  4C3I H;  4X66 Q;  1XPR A;  4LF8 L;  2NVQ H;  3GTG H;  3GTL H;  4K0K L;  4DR3 Q;  4LF7 Q;  4LWC A;  1GO3 E;  2ZM6 L;  1HH2 P;  1NMF A;  4JI2 Q;  2UUA L;  1HNW L;  3KOJ A;  4P71 A;  1KRT A;  3M7N A;  3HFZ B;  5GQO A;  1J5E L;  1QVF A;  1P16 A;  3I4O A;  1UE1 A;  4DV6 L;  4R4Q A;  1SR3 A;  1XPO A;  2UU9 Q;  2VUM H;  1N36 Q;  4GN4 B;  4XTC S;  3S15 H;  2CQO A;  3UE1 A;  4B3T Q;  4LF6 L;  3BZC A;  3CCJ A;  3U4V A;  1YI2 A;  4JI5 L;  4DV7 Q;  2JA5 H;  2E8G A;  2VS1 A;  3LGJ A;  3NEN A;  1PH4 A;  2I0Q A;  4B3R Q;  4IOA A;  1SMX A;  3CCE A;  1XMO L;  1CKM A;  4DR5 Q;  4X64 L;  3S1M H;  3M4Q A;  3CCS A;  1LTL A;  2PMZ E;  4JBJ A;  2F52 A;  3I56 A;  1EOV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...