4L5SA

P202 hin1 in complex with 12-mer dsdna
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
199
structure length
199
Chain Sequence
b'STPKKNISKGAVLHEKPMTVMVLTATEPFNYKEGKENMFHATVATESKYYRVKVFNMDLKEKFTENQFITISKYFNSSGILEINETATVSEAAPNQMFEVPKNIIRSAKETLKISKIKELDSGTLIYGVFAVEKKKVNDKSITFKIKDNEDNIKVVWDKEQHNINYEKGDKLQLFSFHLRKGNGKPILHSGNHSFIKGE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Interferon-activable protein 202
publication title Molecular Mechanism for p202-Mediated Specific Inhibition of AIM2 Inflammasome Activation.
pubmed doi rcsb
source organism Mus musculus
molecule tags Dna binding protein/dna
total genus 36
structure length 199
sequence length 199
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02760 HIN HIN-200/IF120x domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4l5sA02
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4l5sA01
3S2HH 3E0EA 4LFAQ 1KL9A 3L2PA 1XMQL 1YJWA 4LF5Q 4IFDG 3G4SA 2NZHA 4YCVA 1SFOH 1KXLA 3PCOB 1N34L 4GNXA 2OTJA 4DV4Q 1N36Q 2KBNA 2ZTEA 4YCUA 3J81i 3H15A 3S16H 1B70B 4K0KQ 2JJQA 3CPFA 1LUZA 4AQYQ 3TS2A 1X65A 3U58A 1R9TH 3GD7A 3CCUA 4YWLA 1YHQA 4DUYL 3KLWA 4DV1L 4GLVB 4NXNL 1EYGA 4LF4Q 1XNRL 4DR7Q 2K14A 1A62A 4JG2A 2WAQE 4B3TQ 1I5FA 3GTOH 1EIFA 4A3MG 3AYHB 4NPSA 4OO1G 4DR2Q 1VS0A 1HNZL 4JI0Q 3PO2G 3ULLA 3F2BA 1WYDA 4P74A 3DLLA 3D0FA 1VQOA 5GROA 5BR8Q 3OTOL 3KDFB 1S40A 1HZCA 1V1QA 2VL6A 1HR0L 1VQ6A 1UWVA 1Y1WG 2VQEQ 1UEBA 1VQGA 3GTQH 1I6HH 2UXDQ 3ULPA 1C0AA 2Q2IA 4QQBX 2RCNA 2F4VQ 3AQQA 1VQLA 3K80C 4DK3C 3CAMA 2KCMA 1VQDA 1PH7A 2Z6KA 2MO1A 2AWOA 3U50C 4JI2Q 2K5NA 4IPGA 3JAMc 4JV5Q 1YHBA 4DV6Q 2VZAA 1EIYB 4DV0L 1YITA 2N8NA 2JA9A 4EQ5A 4PMWA 2EQSA 1Q1EA 3A74A 3KYHC 4BBRH 4X65Q 1I3QH 4JOIC 4LF8Q 3RLFA 4P73A 1KAWA 2KENA 2WB1E 1QZGA 3KJOA 2R92G 4YHHL 4DR5L 1JJ2A 3J80i 4WJ4A 2YU9H 2PQAA 3H3VH 4GNXB 1MKHA 4X62L 3CCVA 4GOPA 1VQ9A 2I5HA 3CMEA 5GAHC 1X6OA 2ZJRA 1EQRA 1G51A 2K75A 1W2BA 1V43A 4LF6Q 1NJIC 3AFPA 4GNXC 4A3IG 3GTPH 3HOYG 4H02A 1HJPA 1VCIA 4LWCA 3U4ZA 4JI5Q 3I4NG 2WB1G 2UUAL 5C3EG 3K7AH 4DAYB 2E2IH 4JCVE 3G71A 5IWAL 4C3JH 5FLXc 4A93H 4JI4L 2D62A 2NZOA 2PI2A 4KHPL 4Y7NH 1S3OA 2ATWA 3J80c 2Q2HA 4R1JA 1VQIA 4A3MH 2ZJQA 3HOXH 4GKKQ 1HNXQ 4B3RQ 4LF7Q 3PIPA 4DR1L 1YJNA 1Q7YC 1PHJA 2K5VA 4JI3Q 2AMCB 2BH8A 4DUZQ 4LFCL 3RZOH 4XIGS 5IP9G 4JI8Q 2RF4A 1FJGQ 3S1NH 2FXQA 2YTXA 4NB3A 4L5QA 4UP8A 5IE8A 4LF9L 5EAYA 1KRSA 2I5LX 1J5EQ 4OWWB 3UDXA 2JA6H 1XPUA 5AJ3L 4ME3A 4UY8C 3RLNA 4A3LH 3H3VI 2Z6KC 3I7FA 2AHOB 2NVYH 3PV0A 1OXVA 4QL5A 3UDFA 5M3MG 3LGJA 1Q12A 1PH4A 3I2ZA 3J81j 2RHQB 2WP8J 4JI1L 1H95A 2BA0A 1YEZA 1PH6A 1PV4A 1PH1A 4BA2I 4DV5L 3S2DH 1CSPA 1BVSA 2ZTCA 5IT9c 4BY1G 2OCEA 2Y0SE 3KDFA 2R92H 1HNWL 2C35B 2JA7G 2N49A 1HZBA 4HIKA 1IBLQ 3GTGH 4DR6Q 2B63G 4GOPC 2H5XA 2CWAA 2XGTA 2F3IA 1K83H 2PI2E 3S24A 1CKMA 4A3JH 4TQUS 3GTLH 4GS3A 2I0QA 4LFAL 3RN2A 1E1OA 2D0PA 2Y0SG 4EX5A 4A3IH 2UUCQ 4LF5L 4JBWA 4A3FG 1U0LA 4R4TA 3PSIA 4DK6C 2DGYA 4DV4L 1N36L 2E2JH 4K0KL 5C3EH 1AH9A 5GAEC 2MFIA 4MTNA 1WI5A 4R4IA 4DV7Q 4AQYL 4A3EG 1XNQL 1QZHA 3NBHB 1XJVA 2MNAA 4JBMA 1AE3A 1Z9FA 2DUDA 1M90C 4POFA 1A63A 1E7ZA 5IYCG 1P8LA 4GKJQ 2ALYB 1MJCA 3HOVG 3CCMA 2LSSA 1K8AC 4DR2L 3BZKA 1FL0A 5DLQE 4DR3L 3UDGA 2HQLA 3CC2A 1YHAA 5LMUL 1EWIA 4J15A 4YY3Q 5ELNA 5BR8L 3I56A 3PO3H 1X3EA 4A3DG 1K0RA 4R4CA 3ULJA 5LMNQ 2VQEL 5IP7G 3G6EA 2AWNA 2K5HA 2HHHQ 1N32Q 3PUWA 2F4VL 1X56A 5GAGC 4JI7L 2UXBQ 2D0OA 5C0XI 1LYLA 2E5LQ 1J6QA 4X64Q 3JAMi 1YI2A 4A3KG 1PH9A 1PYSB 4JI2L 4A3GG 1VQHA 2JEAI 1QUQA 4HIOA 4DV6L 4HJ8A 3U4VA 5JEAJ 1Q86C 2VUMG 3STBD 1B7YB 2VQFQ 1XPRA 5JJKA 1TWGH 3I55A 3CXCA 4LFBL 1E22A 4LF8L 2JQOA 4B3SQ 4WJ3M 1X54A 2N3SA 4A3CG 4RMFA 1VQBA 2B63H 5GQOA 4DV3L 3CCJA 3PF5A 5J3BA 1VQ7A 3D31A 3I4MG 1EFWA 2K50A 3ICEA 3KF8B 3HFZB 4JYAL 4LF6L 1Q8KA 1PH8A 3EN2A 5LMNW 4QGUA 2E8GA 4JI6Q 3TRZA 4A3EH 4DV1Q 3RR5A 2MO0A 1VQFA 4A76A 3BU2A 3RN5A 1UE7A 5H1SE 1X9NA 1BBWA 2EXDA 4P72A 4IFDJ 4O0AA 4GKKL 3HOVH 5C0XG 1VQKA 2YTYA 5FLMG 3S17H 4B3RL 2R7ZG 3OTOQ 1HR0Q 4UP9A 4OWXB 4JI3L 4L5SA 3KOJA 4BBSG 5C44G 3HOUG 4DUZL 4L5TA 2VY3A 3TEHB 5IP7H 4HJAA 1QVGA 3AEVA 2NN6I 3T1HQ 1X55A 4MNOA 4OONA 1K73C 2JE6I 3H0GG 3MXNB 4GN4B 4GN5A 1X3GA 2K52A 3E9IA 1YJ9A 1J5EL 2BH2A 3S1MH 1QUQB 1GD7A 2JA5G 2CWPA 1Q46A 4IO9A 2OQ0A 4GLAC 3PO2H 4P75A 2WFWA 4A3KH 4IPDA 1VQNA 3JC66 2ID0A 4IPHA 3BZCA 1Y1VG 4BXXG 3CP0A 2KHJA 4LUZA 1LM0A 1EOVA 2ZJPA 4C3HH 1NTGA 3M4PA 3PUXA 1Y1WH 3CPWA 2VUMH 3CC7A 3GTKH 3VDYA 5ELOA 3CMAA 1I94Q 3GTJH 2IT1A 4P71A 1FVIA 1IBKQ 4UP7A 2MQHA 3CCQA 1AE2A 2IY5B 3BJUA 3F2CA 3I4MH 4C3IH 1NE3A 1IBLL 4X66L 1A0IA 2JA8G 2UXCQ 1N9WA 4PZ8A 5JJLA 1EQQA 3M3YH 1CSQA 2ASBA 3EIVA 1XTDA 1HR0W 3NEMA 1XMOQ 1OTCA 4DR4Q 4A75A 2PMZE 4OX9Q 3B6YA 1HH2P 1YZ6A 1KHIA 1SR3A 5M5YH 1A8VA 4L5RC 4NXML 2ES2A 4DV7L 2NN6G 3KJPA 2ZM6Q 4QY7A 4KHPQ 1Q82C 1SRUA 1HZAA 1OXTA 1IBMQ 1PVOA 2OTLA 3OW2A 1YVCA 4KHZA 1KRTA 1PA6A 4DR1Q 1NBWA 2V1CC 2K4KA 4GKJL 3HOYH 1NMFA 4LUOA 2GVBA 2N78A 1N8RC 1PH5A 4APVA 1G291 4DV2Q 1VQ4A 3I4NH 4BBSH 2HIXA 3K0XA 5C44H 2Q2TA 2Q2UA 2UUBQ 4B3MQ 1QVFA 2R7FA 1UE5A 3HOUH 3HOWG 4LF9Q 2EIFA 2VS1A 5HY6A 4KI0A 4IPCA 1X3FA 4ALPA 4LF4L 4DR7L 1JE5A 1N32L 4A4IA 3FKIG 1QVCA 4OXPA 4B3TL 3CCEA 2YV5A 2UU9Q 3W1GA 1K9MC 1YBYA 3PIOA 3ZJYC 1Y1VH 4JI1Q 2E5LL 4POGA 4BY7G 4X64L 4JI0L 4BXXH 1D8LA 1T9HA 3M9BA 4TVAB 5IP9H 4HJ9A 1VQCA 1S72A 1VQ8A 3W1BA 1WFQA 2VW9A 2GVAA 5HGQA 1K3RA 1TXYA 3GTMH 3T1YQ 2L15A 2UXDL 2BA1A 2OQKA 3NELA 2IHEA 1CKNB 5FJ8G 1HNWQ 3K81C 3A5UA 4PZ6A 1VQPA 4MZ9A 4LNQA 2GN5A 2JEBI 5M3MH 5IYBG 2JA8H 1I50H 3A0JA 1E3PA 2LXJA 4JV5L 1VQAA 3K8AA 4DPGA 1OXUA 1N33Q 1PYBA 4BY1H 4YCWA 4HJ7A 1L2FA 1C9OA 1RIPA 2R6GA 4LW1A 4X65L 1L0WA 3RLOA 1XNQQ 4JI6L 1Z47A 1O7IA 3AFQA 5C4XG 2JA7H 3L7ZC 3K7UC 3UDIA 2R7DA 2Z0SA 2CCZA 3CD6A 2XTIA 1KC8C 4A93G 1PFSA 4YWMA 2IX0A 1Q1BA 3HKZE 2YTVA 3RZDH 1XMQQ 3HOXG 3ERSX 4HJ5A 1JT8A 1N34Q 4FDBA 1FGUA 2LXKA 4DR3Q 1CUKA 3PGZA 4A3FH 1C7YA 1DGSA 1JMCA 3SGIA 5LMUQ 2NVXH 3HOWH 1WOCA 4JC0A 5C4JH 3J81c 1HZ9A 5IYDG 1Q81C 4JI5L 4DUYQ 2WAQG 4NXNQ 1XNRQ 3HKZG 2VNUD 1SLJA 4AIMA 3T1HL 3FKIH 2JA6G 3PF4A 4JI7Q 1D7QA 1BKBA 4A3LG 4JBJA 1L1OA 2B3GA 3Q8DA 5IYCH 1HNZQ 1OXSC 2JK8A 2RHSB 1HNXL 3CW2C 2E2HH 4BY7H 3UE1A 1IYJB 1JB7A 4LF7L 3M7NA 1SROA 1UE6A 1GVPA 1VQ5A 1K8GA 4A3DH 5IY0A 1SMXA 2NVTH 3CQZH 4JI8L 1Y14B 4A3BG 5JJIA 1TWHH 1FJGL 1E24A 4LFBQ 5FJ8H 4DAMA 1XPOA 4IOAA 1I94L 4LUVA 3MEFA 1GM5A 1NY4A 4PZ7A 5IYBH 4DV3Q 1IBKL 3TS0A 1WCMG 2QGQA 4IJHA 4A3GH 2CFMA 4DV0Q 2UXCL 3TQYA 2QA4A 4A3JG 4JYAQ 2CQOA 1U5KA 1XMOL 4DR4L 3F1ZA 1G6PA 3GDEA 2A1AA 4YWKA 2A19A 5GADC 3HKSA 1BBUA 4OX9L 4UPAA 2I5MX 3HOZG 5C4XH 4JBKA 1VQEA 4DKAC 4QJFA 3ER0A 4YHHQ 4DR5Q 2F52A 4A3CH 4X6AH 3CF5A 5M3FG 4X62Q 2ZM6L 4OWTB 3S1QH 2R93G 1IBML 1CKNA 4DR6L 3KF6A 4RG1A 3PUYA 1V9PA 4C2MH 3M4OH 1LTLA 3FHWA 1YIJA 2QEXA 1PH2A 2YYZA 2UUCL 3PUVA 5K36G 2UUAQ 4R4QA 5IYDH 4DV2L 2B29A 3GO5A 3CCLA 3CCSA 1E1TA 2UUBL 4B3ML 1L1OB 5IWAQ 3PO3G 4JI4Q 3F8TA 3I4OA 3STBC 2A8VA 3OYYA 3F2DA 3J7A5 4AH6A 3DM3A 1B8AA 4GLXA 1UE1A 1VQJA 1L1OC 2AKWB 5C0XJ 2PNHA 4PG3A 1SN8A 5E7NA 1TWAH 1P16A 2NVQH 4R4OA 4IFDI 2UU9L 5FLMH 1GKHA 2CKZB 3UE0A 1WJJA 2R7ZH 5M5XH 1MIUA 1RL2A 1KD1C 3KFUA 1EUJA 4LFCQ 3A5ZB 3CC4A 1NMGA 3J7ZC 3WWVA 1ASYA 1TWFH 3EBEA 4QIWE 4YY3L 5JEAG 2OWOA 4DNIA 4A3BH 3M4QA 3W5OA 3IRBA 1JJCB 2PQAB 3H0GH 3PUZA 5AJ3Q 5LMNL 3T1YL 3S14H 4GOPB 2HHHL 4GN3B 2IX1A 2KHIA 2JA5H 1MJEA 1W3SA 1PH3A 2HIVA 4AYBE 4OO1I 2UXBL 4IJLA 3E9HA 1WCMH 4X66Q 3L0OA 1GO3E 3FP9A 3CCRA 1M1KC 1TWCH 1JJGA 1IL2A 2IHFA 2KCTA 3TREA 4DV5Q 4IOCA 1KIXA 4KLKA 3M85A 4XTCS 3NENA 2HT1A 1CKOA 4HIDA 1N33L 4O2DA 3S15H 4NXMQ 4BBRG 4HIMA 2VQFL 1ASZA 3HOZH 4Y52H 4JOIA 4AYBG 3KF6B 5M5WH 4BA1I 3S1RH 1VQMA 1SE8A 1YNXA 5M3FH 3RNUA 1KQSA 4B3SL 2ZTDA 1IXRA 1IZ6A 2R93H 3G48A 1OXXK
chains in the Genus database with same CATH superfamily
2QDLA 3QOLA 3L2PA 4LF5Q 2EZVA 2NZHA 3K7AB 1CFMA 1N34L 2E2IB 4YCUA 4K0KQ 3H15A 4DAVA 2L4NA 1R9TH 3GD7A 3I91A 1YHQA 5EQ0A 4GLVB 2Q8RE 3PO2B 1K0SA 2GA4B 2PNRC 3QIAA 4NPSA 4QUFA 3PO2G 1VS0A 4C3HB 1GOZA 1Y1WB 3RZOB 3I8ZA 1AN8A 3MWYW 3S1NB 2MUYA 5GROA 3ONAB 2M9VA 4C3HG 1Y1WG 1EY9A 5JEAH 3TSSA 1GUWA 2Q2IA 3H94A 3KK7A 5J39A 4EQPA 2RCNA 2F0NA 3TZUA 4DK3C 2DN8A 3CAMA 4C1NI 1JCKB 3DHQA 1ESFA 2VB2X 3U50C 1IKLA 4DV6Q 5T1IA 2A6ED 4JK1C 2N8NA 4DN4M 4EQ5A 3A74A 3KYHC 1UUPA 3MFYA 2B2TA 3RLFA 2WB1E 2QDBA 4GNXB 3CCVA 4IFDH 2ZJRA 2WB1B 1EQRA 4PMBA 1NJIC 3AFPA 4GNXC 4XXEA 4H02A 1XYIA 1HJPA 4LWCA 2PZUA 1Q3LA 2WB1G 3EVQA 1TY2A 4DAYB 4KHPL 5ELDA 1S3OA 2NB0A 2Q2HA 3OIQA 4M8AA 2ZJQA 1GJXA 5I6YA 1HNXQ 1SE2A 3NBHA 4DR1L 1DYQA 1A2UA 3P7JA 3ND8A 2PQEA 2K6AA 4DUZQ 4LFCL 5IP9G 1STNA 2RF4A 2ICEC 2XVSA 4NB3A 3D6WA 4UP8A 2I5LX 1H9JA 5AJ3L 2Z6KC 2AHOB 2KEDA 1RF2D 4WRDA 1PH4A 1GHKA 3J81j 1H95A 2BA0A 3S9WA 3CKIB 1PV4A 3S2DH 1YNND 2ZTCA 4TKOB 2A6HC 4K6LA 1EU4A 3RZDB 5NUCA 2FINB 1FNWA 1HZBA 1IBLQ 4DR6Q 4GOPC 2HCCA 2XGTA 2F3IA 2Z6BA 1R4QB 4F8MA 1LTTD 5C4JB 2I0QA 3LNNA 2D0PA 5CV7A 3RN2A 3A56A 2A68C 2DGYA 1PFNA 1AH9A 1STHA 4UHVA 2EYJA 1WI5A 5CMDA 1XNQL 3W3AA 1AE3A 1CZWA 1Z9FA 3S17B 4ZQ3A 2AQ2B 1M90C 5FO7B 1E7ZA 4GKJQ 1RJTA 2LSSA 3P1HA 3O13A 4N8X1 1TWHB 2K5QA 4J15A 5BR8L 5LMUL 1XXGA 1X3EA 1K0RA 2O5JC 2VQEL 2K5HA 1LTGD 2J7ZA 1PYWD 4A3KB 3PUWA 3MEHA 5GAGC 2NWGA 2IPKD 1J6QA 4X64Q 3JAMi 1YI2A 4A3KG 1PYSB 4DGZA 3GTKB 3JAME 1VQHA 2EYLA 3NP8A 2CVRA 3VR4A 4XDXA 5JEAJ 1Q86C 5EPKA 1XPRA 1H9SA 3OPOA 3BYTB 3EFXD 4C3IB 3I55A 4LFBL 4Q5VA 4LF8L 1EY8A 2B63H 3CCJA 1BCPB 4C3IG 3D31A 1KABA 3D4WA 2BCOA 2K50A 3T51B 3KF8B 4JYAL 4LF6L 4MTKA 4LJZC 3EN2A 2PYKA 4QGUA 2F3VA 3RR5A 2NVQB 2MO0A 3MZ5A 4A76A 5FLXE 3BU2A 4RHRA 1BBWA 4IFDJ 3FMCA 3OMCA 1J8IA 3L9AX 4BBSB 5C44B 1VQKA 1TWFB 2F0MA 2F0LA 1D6EC 3MHBA 1ML0D 3A7AB 3NPPA 2J0TD 4UP9A 4JI3L 1WTWA 4V190 4BBSG 3N6RA 5C44G 4ZYSA 5IP7H 1TY0A 1QVGA 1X55A 4OONA 3MXNB 1EL0A 1Y1VB 1J5EL 1TWCB 1GD7A 5AFWA 4GLAC 2NUCA 4P75A 1VQNA 4IPHA 1Y1VG 1EOTA 3CP0A 3ERQA 1EOVA 4CHTB 2ZJPA 2B2UC 2KJXA 4NKLA 5ELOA 3A7LA 3CMAA 2XN9C 1IBKQ 3NWSA 2CW0D 2LFNA 3BJUA 1TT2A 3I4MH 2E76C 5C5LA 1A0IA 5L37A 2ENBA 5JJLA 1HHVA 1HR0W 1XTDA 3NEMA 3SHLA 4NMZA 1CI3M 3B6YA 1HH2P 1YZ6A 1SR3A 5M5YH 3GTOB 1IKMA 3J80L 3KJPA 1GXDC 2ZM6Q 4N9TA 1SRUA 1OXTA 2B39A 3BVGA 2EY5A 1I6VC 4DF7A 1PA6A 5C4HA 1ICWA 1TS5A 2V4DA 1B44D 3HOYH 4LUOA 1PH5A 1G291 2K05A 4DV2Q 1VQ4A 3I4NH 2Q2TA 3HOUH 1QVFA 2R7FA 3E6ZX 4IPCA 3X3NA 3NBIA 5C3WA 1SMYD 2EPBA 2EJMA 4NP5A 4XT3B 2E5LL 4POGA 2NVTB 1EY0A 2EJFC 3I73A 4HJ9A 4X3KA 1D2BA 2GVAA 3GTMH 2OQKA 2IHEA 5FJ8G 1PTOD 3A5UA 4A3GB 4RGTA 3K58A 4ZLTF 4ID6A 4MZ9A 5M3MH 2XNAC 4XYOA 1KDCA 5IGEA 2LXJA 5IGCA 1LT5D 4XT1B 4EQOA 3M4OH 1AZPA 4BY1H 4YCWA 4HJ7A 1RIPA 4LW1A 1JC7A 4X65L 5J22A 1O7IA 3AFQA 4RAUC 3L7ZC 3K7UC 2XTIA 1KC8C 1PFSA 4N9PA 3HG9A 4H0LC 4XYQA 1Q1BA 3HRZC 3ERSX 1JT8A 4DR3Q 1CUKA 3DM1A 4RGNA 4A3FH 1DGSA 4KMUC 3SGIA 1EEFD 3J81c 1TQOA 2WAQG 5EBCA 1XNRQ 3PF4A 3FKIH 4JI7Q 3CHBD 3HS0C 5IYCH 2KOLA 1OXSC 3NK9A 1HNZQ 2RHSB 2E2HH 3FDTA 4LF7L 2A74C 4QUCA 1JOQA 4U68A 3K5NA 2XWBB 4CKCA 4JI8L 1BCPF 1T5XD 5JJIA 2QEJC 3QB3A 4DAMA 1XPOA 3GTGB 3C46A 1I94L 1WTHA 3TMEA 3A8KE 3MEFA 1GM5A 1NY4A 2L9HA 1F77A 3MTSA 2QGQA 1RTOA 2D5DA 1F9QA 2Z9HA 2CFMA 3BG3A 3TQYA 3HOZB 1IL8A 4K5XA 1T5EA 2CQOA 3U9OA 1G6PA 4DR4L 3OW7A 5I2YA 3RUZA 1WTVA 3HOZG 5C4XH 1EZ8A 1YNJD 4DR5Q 1PTOB 1PXUA 1QCBD 3CF5A 4KKTA 5IODA 5FKAC 4OWTB 4X62Q 4RGOS 5ELEA 2F0EA 3NTKA 1IBML 3G6JB 2NTTA 1EYAA 4RG1A 2LS01 1V9PA 3S16B 4R8IA 3LX0A 1ICFB 4FXDA 3PO3B 4F87A 2RVLA 4HCEA 4CKEA 3FPUB 2X6GA 5C6AA 2DNEA 3GO5A 3TP8A 3SK8A 1L1OB 5IWAQ 3DWPA 3PO3G 3NWTA 1L1OC 2AKWB 1QWYA 1SN8A 4RHSA 3VYRA 2R7ZH 4KJNA 1I6HB 1BDOA 3A5ZB 3EBEA 2D2CC 2L0CA 3W5OA 2PQAB 3PUZA 3T1YL 3FRPB 2JA5H 3QWNA 2Q8TA 4OO1I 4GZYC 3E9HA 2RA4A 2H1EA 1Z6HA 1GO3E 4IOCA 1I3QB 4R8NA 5JPMC 3M85A 4HEDA 1WTQA 1N33L 3S15H 2K32A 1G91A 2YU9B 3KF6B 2OEOA 4BA1I 5E4WC 3KUPA 1IXRA 2R93H 3UI2A 1WD0A 3URYA 4LFAQ 5FO8B 3VYTA 4YCVA 1SFOH 4NW2A 5KIXA 5K36H 1N36Q 2ZTEA 4KK7A 3SR1A 1LUZA 1X65A 1PFMA 1PLFA 5E1FA 4A3MB 4F7XA 3KLWA 4DR7Q 4KD3A 2K14A 1A62A 1I5FA 1EIFA 5EGTA 4A3MG 2B8FA 3AYHB 4OO1G 4DR2Q 3DWAA 3F2BA 1WYDA 4P74A 5C4ZA 1ZYRD 3DLLA 1VQOA 1S40A 3OTOL 3U9SA 1HZCA 1V1QA 1HR0L 3GTJB 1KTKA 2UXDQ 1VQGA 2F0GA 3VR2A 4JVZA 4J8QA 2NVYB 3OMGA 5ISRA 2ZXOA 3AQQA 3I72A 2HDMA 2MO1A 1ET6A 4FVMA 5LL6S 3BVMA 4JI2Q 1DD2A 4JV5Q 1O78A 1YITA 5FK9C 4PMWA 2R92B 1Q1EA 5EKIA 2KENA 2R92G 5KYIA 3GTLB 2PQAA 5C3XA 4A3IB 3H3VH 2L1BA 3V96A 2IWHA 1JWSD 4IZ8A 3CMEA 1V43A 5C3EB 4A3IG 5KRUA 3U4ZA 4JI5Q 2UUAL 5C3EG 3K7AH 2E2IH 1DXMA 2ICIA 4JI4L 2D62A 2F1MA 1D1KA 2PI2A 3M7NA 2ATWA 4FF1A 1HA6A 3HOXH 1SNDA 1TU2B 2RQXA 4B3RQ 2ZXPA 2O5IC 3PIPA 1Q7YC 1SNPA 3MC0B 3VR5A 5EBDA 3RZOH 1SXTA 1Z7TA 1BUVT 1FJGQ 3S1NH 1UEAB 3C1EA 2IX3A 4DAPA 3NSWA 2JA6H 4OWWB 3UDXA 1I4QA 2F0FA 4A3LH 3H3VI 3I7FA 2RKSA 4QL5A 2B2VA 2A73B 3VR6A 4JI1L 1PH6A 2FFKB 1SAPA 4BA2I 4DV5L 1EQVA 2C5CA 2JA7B 4HSPA 1NAPA 2B2TC 4X3UA 1NCVA 2HQEA 3ND9A 1H9MA 3KLSX 2EYFA 2C35B 2HD3A 2N49A 2JA7G 2N55A 2F0WA 1JB3A 1S4ZA 4A3JH 3E0JA 4TQUS 1E1OA 4A3EB 4LF5L 1U0LA 3PSIA 2C9OA 3K6OA 4K0KL 4CJ2C 2MFIA 4MTNA 4DV7Q 4A3EG 3NBHB 1KLUD 3V2TA 2KUMA 3H3VC 4POFA 4CGYB 4LMQD 1P8LA 4OL7A 3ZYYX 1RD9D 3CCMA 1FL0A 5DLQE 3CQZB 3I3CA 2HQLA 4ULLA 1EWIA 4YY3Q 2EXZA 1BQQT 5ELNA 2F0KA 3SEBA 4TSSA 1B3QA 4LAAA 2WKCA 4R4CA 5EKKA 3S1MB 4QB4A 1A6XA 1N32Q 2X6LA 3NTHA 1Y69U 1QNKA 2UXBQ 1PRTB 1JE4A 2CH4W 1PH9A 1ENAA 3E3XA 4ILWA 1PRTC 1QUQA 4DV6L 4HJ8A 3U4VA 1KLGD 1B7YB 2RSNA 3MXGA 4XQNA 2QKIC 2F0QA 3H91A 4WJ3M 1X54A 4O1NA 3D4RA 3OSOA 3M3YB 4PV1C 3T4AC 1SYDA 2OT2A 1EY7A 1IW7D 1SE3A 5LMNW 2K33A 4JI6Q 3R2IA 1STGA 3EQLC 2K1BA 1TWAB 1VQFA 3SK5A 5H1SE 1X9NA 1GUTA 2YTYA 5FLMG 3S17H 4G7OC 1SE4A 4OWXB 4KY7A 4DUZL 3TEHB 2VY3A 3AEVA 2NN6I 3T1HQ 1WD1A 2EYHA 2JE6I 4GN5A 3SVMA 4G4KA 3JAML 4G7HC 2OQ0A 1JR0D 1ZEQX 4A3KH 3JC66 1EIGA 2ID0A 1C48A 1Y8NB 4KN7C 1H9SB 2L55A 1NTGA 3PUXA 3CPWA 5DM73 3CC7A 3GTKH 3VDYA 2PO4A 4HMJA 3DWQA 1RODA 1STYA 5ELCA 1I4PA 3NQTA 2IT1A 3GV3A 4YIJA 4UP7A 5DM63 1E2VA 4C3IH 1NE3A 1O7LA 3PIP3 1IBLL 1II3A 1EQQA 1LLRD 3R93A 1TIID 1R9TB 5FLXL 1BOSA 1CQFA 1KHIA 1A8VA 4NXML 1RDPD 4KY6A 1QOHA 5KNBA 2NN6G 4KHPQ 1Q82C 3OWEB 1FNUA 4DR1Q 3HOWB 1MHWC 5JOBA 4GKJL 3R3OA 1N8RC 2N78A 4LK1C 3OIPA 4BBSH 2HIXA 2UUBQ 5C44H 3HOWG 2DY7A 1TR5A 2EIFA 2A6EC 4TRDA 4KI0A 5FOBB 1X3FA 5J1ZA 4ALPA 1X3QA 4LF4L 3J7AV 1JE5A 2EDGA 4B3TL 1LV9A 2YV5A 1D1IA 3W1GA 1Y1VH 4X64L 5IT9L 4JI0L 3GP7A 1D8LA 3X3MA 3W1BA 1K3RA 1NSNS 1VQPA 3BYYB 2EOTA 5IYBG 4OGQC 1IHZA 5IGFA 1LT3D 5DEHA 3EROA 3K8AA 4DPGA 2EY1A 2EE1A 2PW7A 2X69A 1A15A 2F0SA 3M4YA 1XNQQ 1K28A 1GUOA 3S1QB 3CD6A 3UDIA 2CCZA 2FMMA 3SDZA 4C2MB 4ME5A 4O42A 1LTAD 1XTCD 1XMQQ 2CQAA 1JICA 1HUNA 4DNTB 1C7YA 2LXKA 3IL8A 1BCPC 3PGZA 3LWEA 5KNCA 5LMUQ 2NVXH 4CDEC 1HA5A 1PRTF 1HZ9A 5IYDG 1Q81C 4DUYQ 4NXNQ 1YNNC 3TZDA 1AW7A 1D7QA 3AU7A 1BKBA 3IAYA 2B3GA 4KTAA 3MXUA 3CW2C 3S2DB 2R61A 5I2XA 2BE5D 3BVZA 1UE6A 3S14B 1VQ5A 4A3DH 2NVTH 1Y14B 4EGVA 5BN3A 4LFBQ 1GUSA 5FJ8H 1WCMB 2VXWA 4LUVA 1IBKL 1CZGA 3V05A 4DK0A 1WCMG 5JJZA 4IJHA 4A3GH 1LTID 1D5XC 4DV0Q 1EIHA 4JYAQ 5ELFA 1C8CA 1U5KA 5M5WB 3F1ZA 3S1RB 5GADC 5M3FB 3MA2B 1BBUA 1LTSD 1O80A 4FF4A 4YHHQ 1KDBA 4K8IA 1ESRA 4A3CH 3S2HB 4DU9A 5M3FG 2WIIB 2ZM6L 3PMFA 3MAQA 5I6WA 2LMCB 5IGGA 3PUYA 1U4RA 2A5HA 4IUVA 1PMRA 1MSHA 1Y8OB 2QEXA 2UUCL 2YYZA 3PUVA 5G3LD 2F0HA 4R4QA 4DV2L 4K14A 2KECA 3OYYA 4AH6A 1F2LA 2PNHA 4R4OA 4B9XA 2CKZB 1WJJA 3KFUA 1MIUA 1RL2A 4FNFA 1KD1C 2K5WA 1EUJA 4MN3A 3CC4A 1SDFA 1ASYA 4IN3A 2KHSA 4DNIA 4B9WA 4DA2A 2KEEA 5LMNL 3H0GH 1EWHA 1NUCA 2HHHL 1MJEA 4RKBA 1DOLA 1RCVD 1W3SA 3NXWA 3OWFA 4ZUIA 3CCRA 1IL2A 4BBRB 1MI2A 1JWUD 3N52A 5JPNC 4RCOA 1LTBD 1W6JA 4BBRG 4HIMA 2VQFL 3HOZH 4WFN3 4JOIA 1S5DD 2BDNA 4B3SL 1YNXA 2Z8LA 4FF2A 3TP5A 1QG7A 1H9RA 1KL9A 1YJWA 3G4SA 1HRJA 3PCOB 4DV4Q 4C3JB 4OELB 3J81i 1VDZA 3S16H 1B70B 3CPFA 4AQYQ 3J81E 3TS2A 4IUQA 4YWLA 1U4PA 1HPCA 4DV1L 1MD2D 4C3JG 1EYGA 1XNRL 4JG2A 2WAQE 2MPMA 4G7ZC 2O4XA 3Q0AA 3HGBA 1HNZL 2CW0C 2WAQB 3D0FA 2VL6A 1SSOA 2F3WA 3F2UA 1K8MA 1JOOA 1UEBA 3GTQH 1I6HH 1QJOA 3ULPA 1A3TA 3WOEA 1IYUA 2L11A 2F4VQ 2RDFA 1VQDA 1PH7A 4PMCA 2PZWA 2K5NA 4S3SA 4L63B 1ENCA 2L5TA 5M5YB 2F0DA 3KLSA 2A69D 2JA9A 4WORA 3W2DA 3T16A 4X65Q 2EYPA 1I3QH 4H44C 1F2YA 4IUPA 1G2TA 5KEEA 4P73A 1KAWA 4KD4A 1K83B 3KJOA 4DR5L 4HTHA 3J80i 4WJ4A 1STAA 2YU9H 3HOYB 1MKHA 4X62L 2AUJD 1VQ9A 1B50A 2I5HA 2RCFA 1DJRD 1SMYC 3BDLA 5DNFA 5GAHC 1G51A 2K75A 1W2BA 2E2JB 1CA6A 3I70A 3HOYG 3GTPH 1JQYD 1VCIA 4Q0FA 3I4NG 2P5ZX 2JXMB 1EY6A 4JCVE 3G71A 3T13A 5IWAL 4A93H 2AQ1B 1AP0A 3NQIA 2NZOA 4Y7NH 3J80c 1VQIA 4A3MH 3A8IE 4GKKQ 2IL8A 4OO1H 1PTOC 4LF7Q 2FHTA 1PZJD 2K5VA 4UAIA 4HMIA 4JI8Q 1CT1D 4ZUJA 2FXQA 4LF9L 4X3SA 5EAYA 1KRSA 5M3MB 2NTSA 4EVOA 2NVYH 1OXVA 2XSCA 5M3MG 1Q12A 1CK1A 3QR8A 3I2ZA 4BY1B 2TSSA 2RHQB 3L3OC 2L12A 1I4GA 4IURA 1PH1A 1TWGB 4FXKC 1BVSA 4BY1G 2OCEA 2Y0SE 1CA5A 1DZ1A 1STEA 2R92H 4IUTA 2Q8IB 1HNWL 4PQXA 1HQMC 1E2ZA 2NZ1D 5CORA 4HIKA 2Y0SB 5A2QE 2H5XA 2CWAA 4A3FB 2PI2E 3GTLH 4I7ZC 4LFAL 1SBBB 4A3IH 2K5DA 2Y0SG 1IYVA 4A3FG 3CU7A 2B2YC 5JVH3 2B2WA 4DK6C 5ELBA 5I4DA 1N36L 3A55A 5C3EH 4OHJA 4R4IA 3NE5B 5E4XA 1QZHA 3HOVB 1XJVA 2MNAA 4JBMA 4KY5A 5LHY1 1DOKA 5IYCG 1A63A 2ALYB 1MJCA 3HOVG 4DR2L 3BZKA 3AB9A 2CH4A 1SNQA 3CC2A 1YHAA 1GUGA 1A2TA 3G6EA 2AWNA 4WJWA 4ZKCB 1KDAA 1S5FD 1X56A 2AQ3B 1HQRD 3DEOA 3D6CA 5C0XI 1LYLA 1YNJC 2B2VC 2VUMB 1VF5C 3AMUA 4JI2L 1SJHD 2JEAI 4HIOA 2VUMG 3STBD 5JJKA 1DONA 4IUUA 1SEBD 1WTXA 2N3SA 3WOFA 1VQBA 5GQOA 4DV3L 1VQ7A 5J3BA 1EFWA 4C56C 5EPLA 3I4LA 3HFZB 1Q8KA 2MP1A 1PH8A 3VR3A 1BO0A 2E8GA 3DUZA 4A3EH 1X3PA 1JWMD 4R9WA 1L0XB 1HXYD 2R7ZB 3HP3A 4DK1A 2E2DC 2EXDA 3H09A 4P72A 5G3LF 4KHVA 5C0XG 4I65A 4B3RL 2R7ZG 4Z9CB 3OTOQ 1HR0Q 3KOJA 3A54A 5D3IB 4E6IA 2RSOA 2JA5B 4MNOA 5IGBA 1X3GA 2K52A 3E9IA 1HFNA 3S1MH 1QUQB 2JA5G 2CWPA 4IO9A 4IALA 3PO2H 4IPDA 4RA8A 5KGUA 1M8AA 3BZCA 4BXXG 4FYDA 3ITPA 4LUZA 1FGBD 1LM0A 1LT6D 3S15B 3P20A 4C3HH 2EY2A 1Y1WH 4ABNA 3QO2A 4XQQA 1SNCA 1F9PA 2Z4IA 2JA8B 4P71A 1I50B 3CCQA 2IY5B 3F2CA 1SFOB 4X66L 2JA8G 2UXCQ 1N9WA 3M3YH 1CSQA 2EYOA 1PTOF 1XMOQ 1OTCA 4A75A 1H9KA 2KVMA 2PMZE 3TBIB 4OX9Q 3BDCA 1S5BD 1ZYRC 4L5RC 2EYMA 1HTPA 2ES2A 2WACA 4DV7L 1VMPA 2PMZB 4QY7A 3Q23A 2OTLA 1F9RA 1YVCA 4KHZA 3DEPA 2K4KA 1EZ6A 1DOMA 1NMFA 2GVBA 3TDQA 4APVA 3VA5A 1WTPA 2HUGA 3K0XA 4B3MQ 4FXGC 1UE5A 2MGSA 2R3ZA 2VS1A 5HY6A 2I07B 1ZKOA 4BY7B 1N32L 3QJYA 1B3AA 3CCEA 2UU9Q 1EU3A 1YBYA 3PIOA 3ZJYC 2K04A 4JI1Q 4BY7G 1T9HA 4TVAB 5IP9H 1VQCA 3D3RA 2VW9A 5HGQA 2BA1A 1I4RA 3NELA 3K81C 1PZID 1SYCA 2QCPX 4PZ6A 2M2LA 2JEBI 3DXJC 3G7LA 3A0JA 4K2KA 1E3PA 1B53A 3MXPA 1VQAA 3CRLC 1L0YB 1C9OA 1L2FA 1SYBA 1UNSA 2R6GA 3QOJA 4XQJA 1L0WA 2RDGA 2MHVA 4JI6L 1Z47A 2NN6H 3HOXB 2Z0SA 4J1MA 3HKZE 4KKSA 2YTVA 3RZDH 1G6ZA 3HOXG 5IIFA 3VA7A 1N34Q 1OO9B 1FGUA 4FDBA 2A6HD 4OEMB 2J4XA 1SNOA 1JMCA 3HKZB 2N88A 5DAUA 3HOWH 1B9NA 1EY4A 1WOCA 5C4JH 2JA6B 2SDFA 5KYLA 4K8JA 1W6KA 3HKZG 1NNXA 4F88A 1SLJA 3T1HL 2JA6G 5M5XB 3K5MA 4A3LG 1AEXA 1A3UA 2JK8A 1HNXL 1MGSA 1JB7A 2A68D 2F03A 1LTRD 4A3BB 1SMXA 4HR7B 4A3BG 1TWHH 3T53B 5C5MA 1CQVA 1FNVA 1SYGA 5D14A 4PZ7A 5IYBH 4A3JB 2KQ3A 3TS0A 1BBXC 4A3JG 1FR3A 4CJ1B 1SNMA 3TN2A 1EWCA 2F4IA 4UPAA 2I5MX 4JBKA 1VQEA 2F52A 1SYFA 4X6AH 4CJ0B 2LY7A 1UAPA 3S1QH 4DR6L 3MFGA 1GUNA 2DJGC 5CV9A 1G8ZD 2Z1CA 4C2MH 4DNRB 3NHHA 2G9DA 4KV6A 1TVXA 1PH2A 4IUNA 5IYDH 2B29A 3CCLA 3CCSA 1E1TA 2UUBL 4N8FA 2BOSA 3I4OA 4FP5D 3DM3A 1B8AA 1UE1A 3M7GA 1VQJA 3K5OA 2NVQH 2LKVA 5E7NA 1NR2A 1BCPD 4IFDI 3RMHA 2O2LD 1GKHA 3UE0A 1TKWB 3KLRA 5CR3A 2HDLA 5IGDA 4LFCQ 1NMGA 1ZXTA 3WWVA 1TWFH 1TS2A 1IW7C 5JEAG 2OWOA 1K8OA 3M4QA 3VYUA 3QG1A 1JJCB 3K5LA 5AJ3Q 3S14H 4GOPB 2HCIA 2IX1A 2G5DA 3HZXA 4PNYA 1PH3A 4AYBE 1WCMH 4V0BA 3L0OA 2K28A 3FP9A 1M1KC 1TWCH 3TREA 4KLKA 4AYBB 4XTCS 3SXHA 2KA7A 4HIDA 1STBA 4O2DA 4NXMQ 2D9UA 5FO9B 1JORA 4UDUC 1O7ZA 4U673 4AYBG 5M5WH 3S1RH 2BDOA 1KQSA 5M3FH 3RNUA 3OHXC 3OOCA 5T1GA 3PIO3 1GHJA 2E74C 3S2HH 1VMCA 3E0EA 1XMQL 4IFDG 3P75A 4HSVA 1KXLA 4GNXA 2OTJA 2KBNA 3Q22A 2JJQA 3U58A 5I9PA 2PPBC 3CCUA 4DUYL 4LF4Q 4NXNL 4B3TQ 3GTOH 1ONLA 2SNMA 4DAYA 4DXFA 4JI0Q 3TP7A 3ULLA 5COYA 5BR8Q 3KDFB 1VQ6A 1E0BA 1UWVA 1CHPD 2VQEQ 3C1FA 1C0AA 4QQBX 1U4LA 4HN7A 3K80C 1VQLA 2KCMA 2Z6KA 2AWOA 1F2MA 4IPGA 5JVG3 3JAMc 1YHBA 1TS4A 2VZAA 1EIYB 4DV0L 4B08A 2EQSA 4BBRH 1O7YA 4JOIC 3BS1A 4LF8Q 4RH6A 1QZGA 3SK4A 4YHHL 5F2DA 4IQZA 1JJ2A 4FO2A 4GOPA 1R4PB 3KBXA 1X6OA 3J81L 4LF6Q 4KN4C 4C3JH 5FLXc 1U9RA 3VYSA 3BDOA 1V1PB 2K7VA 4R1JA 3T56B 2PCFB 4MIUA 4EQNA 1YJNA 1PHJA 5LL6X 5CBEE 4JI3Q 2AMCB 3Q6SA 2BH8A 2XRSD 4XIGS 5IT9E 1SJED 2YTXA 4L5QA 5IE8A 1Q90A 1J5EQ 4RCNA 1XPUA 1I4XA 4ME3A 3H6MA 4UY8C 3RLNA 2CHBD 3PV0A 3UDFA 3LGJA 4FF3A 5EJWA 5D3DA 1BXTA 5EPJA 1A3VA 4MHEA 2WP8J 1YEZA 1EYCA 1KAAA 1CSPA 5IT9c 3FEWX 1QNUA 2B63B 1V8QA 2JSOA 3KDFA 3C3LA 2K01A 3BZDB 3GTGH 1D5MC 2MJ8A 2B63G 2XRQD 2F0VA 4DFAA 4HCSA 3K59A 2XIWA 2SOBA 1K83H 2NVXB 3S24A 1CKMA 1RKNA 1FD7D 2FMCA 2WV6D 4GS3A 2NYZD 2UUCQ 4EX5A 1ET9A 4JBWA 4R4TA 4DV4L 2E2JH 1B1ZA 2BE5C 5GAEC 5HGTA 4AQYL 1Q8IA 4ZAIA 3KF8A 1BR9A 2DUDA 1LO5D 5EKLA 1PTOH 4A3DB 1K8AC 4DR3L 3UDGA 2G9HD 5TSSA 3I56A 3PO3H 4A3DG 2DNCA 3ULJA 4ZKBB 5LMNQ 5IP7G 2OXPA 4OIKA 2HHHQ 2ZXRA 1KNEA 5E3FA 2XWJB 4ODGA 1PDQA 2F4VL 1KNAA 1HTLD 4JI7L 2TMPA 2D0OA 2NBFA 3IKJA 1EQTA 2PW5A 2E5LQ 3DMUA 3MXNA 4QMGA 4A3GG 1V1PA 2JP1A 3PQIA 2IW3A 4BS9A 2B2UA 3NTIA 1ILPA 5IOCA 4P2CB 2VQFQ 1EY5A 4KJOA 1TWGH 3CXCA 5A2QL 2B8GA 2FJ2A 2KCCA 3I4MB 1E22A 2JQOA 4B3SQ 2F0JA 1RTNA 4RMFA 4A3CG 3PF5A 3I4MG 3ICEA 1VF7A 2EJGC 1MBYA 5M9OA 2B2WC 3WDNA 5BN4A 2VB3X 4RGMA 3TRZA 1TS3A 4DV1Q 1EFID 4QF4A 3D8GA 3RN5A 1UE7A 4RFBA 3K57A 1ENFA 3J80E 4CDDC 4O0AA 4GKKL 3HOVH 3I4NB 3HOUB 3H0GB 4L5SA 3HOUG 2F0TA 4L5TA 1D5ZC 3GQBA 3KBGA 2QILA 4HJAA 1XX8A 1K73C 2EY6A 3H0GG 4GN4B 4CBVA 1YJ9A 2BH2A 1Q46A 2WFWA 1BF4A 5BN5A 1DM0B 2KHJA 3GTMB 1F2ZA 2VUMH 3M4PA 1M4VA 3LWUA 2F0IA 1I94Q 3Q24A 3GTJH 4JPBW 1FVIA 1S5CD 3E5SA 3SE0A 2MQHA 3EJIA 1AE2A 2F0UA 3M4OB 1XWEA 4PZ8A 2ASBA 3EIVA 2WKDA 4DR4Q 2F0OA 1WTOA 4H7BA 1AFPA 4CKBA 1WVLA 1CHQD 1CTMA 1E2WA 1HFGA 1HZAA 4M1UB 1RHPA 1IBMQ 1PVOA 5HURA 3OW2A 1KRTA 5C0XH 1NBWA 2V1CC 1K3BC 3GTQB 3IFDA 4H13C 2QW7A 5CV6A 2Q2UA 4QCLA 3FKIB 3RD4A 4LF9Q 4ZK9B 1LABA 2A69C 2M00A 3SK6A 2E2HB 4DR7L 4A4IA 3FKIG 3CRKC 1QVCA 4OXPA 1SYEA 4KKUA 1K9MC 4BXXH 2DJFC 2RDHA 4K6DA 3M9BA 1S72A 1VQ8A 1WFQA 2UXDL 1TXYA 3T1YQ 2L15A 1EEID 1CKNB 1HNWQ 1MSGA 4K2LA 4LNQA 2GN5A 4ZRZA 3R8BA 1X32A 2JA8H 1I50H 3GTPB 1B9MA 1S5ED 4JV5L 5C4XB 1OXUA 1N33Q 1PYBA 3C2PA 5D65A 4A93B 3RLOA 4Y7NB 5C4XG 2JA7H 2R7DA 4JW0A 4A93G 4OIJA 1QILA 4YWMA 2IX0A 3IFTA 2I46A 1U4MA 4HJ5A 4K5VA 2KCNA 5CV8A 2SNSA 3FPPA 5CYUA 4JC0A 1JOKA 3K0YA 3GV6A 4JI5L 4CDCC 1B2TA 2WINB 2OF1A 2VNUD 1F9SA 1CM9A 4AIMA 4HAEA 2RBMA 4J6HA 4CDFC 4JBJA 1L1OA 3Q8DA 2IJ0A 4BY7H 3UE1A 1IYJB 1SROA 4L6TB 5I9OA 2QF7A 1GVPA 1K8GA 2JYOA 5IY0A 2AUKA 3CQZH 1FJGL 3MVVA 1E24A 4G57A 3D4DA 4IOAA 1J9OA 5CGKA 4DV3Q 2EVBA 1HUMA 1LACA 2UXCL 2QA4A 3FVQA 1NR4A 5KNDA 1XMOL 3GDEA 2A1AA 2ZT9C 2A19A 2B2YA 4RWSC 4YWKA 3HKSA 4DXGA 4OX9L 2R93B 4DKAC 2PZTA 3ER0A 4QJFA 1ILQA 5CV4A 3J7AF 3HEJA 1B4OA 1HCZA 1PRTD 2JN4A 2R93G 1CKNA 3KF6A 1QB5D 1PZKD 5CBAE 2F0PA 1LTLA 3FHWA 1BNZA 1G2SA 1YIJA 5CV5A 1LT4D 5K36G 2UUAQ 3TP6A 4K5WA 4B3ML 5JAVA 4JI4Q 3F8TA 3STBC 2A8VA 1EYDA 1V1OA 3F2DA 3J7A5 4GLXA 4C1NK 5C0XJ 4PG3A 2SEBD 1TWAH 1P16A 3EA6A 5CC4A 2UU9L 2H4OA 5K5PA 5FLMH 4ZCKA 5M5XH 5A35A 1QE6A 1PFBA 3J7ZC 4QIWE 1AZQA 2K03A 4YY3L 3I90A 4A3BH 3IRBA 2E75C 4RKLA 4GN3B 1DCZA 2KHIA 4QIWB 2DY8A 2HIVA 1I4HA 2UXBL 4IJLA 4NDXA 1Y8PB 3A8JE 4BWGB 4X66Q 3J7YW 1FYCA 4X3TA 4L8JA 3R2TA 1JJGA 3NUCA 2IHFA 2KCTA 4DV5Q 1KIXA 2Z4HA 3NENA 2HT1A 1CKOA 1ASZA 4Y52H 1VQMA 1SE8A 4I7AA 2ZTDA 1IZ6A 3G48A 1WTRA 1OXXK 1C4QA
chains in the Genus database with same CATH topology
3S2HH 3E0EA 4LFAQ 1KL9A 3L2PA 1XMQL 1YJWA 4LF5Q 4IFDG 3G4SA 2NZHA 4YCVA 1SFOH 1KXLA 3PCOB 1N34L 4GNXA 2OTJA 4DV4Q 1N36Q 2KBNA 2ZTEA 4YCUA 3J81i 3H15A 3S16H 1B70B 4K0KQ 2JJQA 3CPFA 1LUZA 4AQYQ 3TS2A 1X65A 3U58A 1R9TH 3GD7A 3CCUA 4YWLA 1YHQA 4DUYL 3KLWA 4DV1L 4GLVB 4NXNL 1EYGA 4LF4Q 1XNRL 4DR7Q 2K14A 1A62A 4JG2A 2WAQE 4B3TQ 1I5FA 3GTOH 1EIFA 4A3MG 3AYHB 4NPSA 4OO1G 4DR2Q 1VS0A 1HNZL 4JI0Q 3PO2G 3ULLA 3F2BA 1WYDA 4P74A 3DLLA 3D0FA 1VQOA 5GROA 5BR8Q 3OTOL 3KDFB 1S40A 1HZCA 1V1QA 2VL6A 1HR0L 1VQ6A 1UWVA 1Y1WG 2VQEQ 1UEBA 1VQGA 3GTQH 1I6HH 2UXDQ 3ULPA 1C0AA 2Q2IA 4QQBX 2RCNA 2F4VQ 3AQQA 1VQLA 3K80C 4DK3C 3CAMA 2KCMA 1VQDA 1PH7A 2Z6KA 2MO1A 2AWOA 3U50C 4JI2Q 2K5NA 4IPGA 3JAMc 4JV5Q 1YHBA 4DV6Q 2VZAA 1EIYB 4DV0L 1YITA 2N8NA 2JA9A 4EQ5A 4PMWA 2EQSA 1Q1EA 3A74A 3KYHC 4BBRH 4X65Q 1I3QH 4JOIC 4LF8Q 3RLFA 4P73A 1KAWA 2KENA 2WB1E 1QZGA 3KJOA 2R92G 4YHHL 4DR5L 1JJ2A 3J80i 4WJ4A 2YU9H 2PQAA 3H3VH 4GNXB 1MKHA 4X62L 3CCVA 4GOPA 1VQ9A 2I5HA 3CMEA 5GAHC 1X6OA 2ZJRA 1EQRA 1G51A 2K75A 1W2BA 1V43A 4LF6Q 1NJIC 3AFPA 4GNXC 4A3IG 3GTPH 3HOYG 4H02A 1HJPA 1VCIA 4LWCA 3U4ZA 4JI5Q 3I4NG 2WB1G 2UUAL 5C3EG 3K7AH 4DAYB 2E2IH 4JCVE 3G71A 5IWAL 4C3JH 5FLXc 4A93H 4JI4L 2D62A 2NZOA 2PI2A 4KHPL 4Y7NH 1S3OA 2ATWA 3J80c 2Q2HA 4R1JA 1VQIA 4A3MH 2ZJQA 3HOXH 4GKKQ 1HNXQ 4B3RQ 4LF7Q 3PIPA 4DR1L 1YJNA 1Q7YC 1PHJA 2K5VA 4JI3Q 2AMCB 2BH8A 4DUZQ 4LFCL 3RZOH 4XIGS 5IP9G 4JI8Q 2RF4A 1FJGQ 3S1NH 2FXQA 2YTXA 4NB3A 4L5QA 4UP8A 5IE8A 4LF9L 5EAYA 1KRSA 2I5LX 1J5EQ 4OWWB 3UDXA 2JA6H 1XPUA 5AJ3L 4ME3A 4UY8C 3RLNA 4A3LH 3H3VI 2Z6KC 3I7FA 2AHOB 2NVYH 3PV0A 1OXVA 4QL5A 3UDFA 5M3MG 3LGJA 1Q12A 1PH4A 3I2ZA 3J81j 2RHQB 2WP8J 4JI1L 1H95A 2BA0A 1YEZA 1PH6A 1PV4A 1PH1A 4BA2I 4DV5L 3S2DH 1CSPA 1BVSA 2ZTCA 5IT9c 4BY1G 2OCEA 2Y0SE 3KDFA 2R92H 1HNWL 2C35B 2JA7G 2N49A 1HZBA 4HIKA 1IBLQ 3GTGH 4DR6Q 2B63G 4GOPC 2H5XA 2CWAA 2XGTA 2F3IA 1K83H 2PI2E 3S24A 1CKMA 4A3JH 4TQUS 3GTLH 4GS3A 2I0QA 4LFAL 3RN2A 1E1OA 2D0PA 2Y0SG 4EX5A 4A3IH 2UUCQ 4LF5L 4JBWA 4A3FG 1U0LA 4R4TA 3PSIA 4DK6C 2DGYA 4DV4L 1N36L 2E2JH 4K0KL 5C3EH 1AH9A 5GAEC 2MFIA 4MTNA 1WI5A 4R4IA 4DV7Q 4AQYL 4A3EG 1XNQL 1QZHA 3NBHB 1XJVA 2MNAA 4JBMA 1AE3A 1Z9FA 2DUDA 1M90C 4POFA 1A63A 1E7ZA 5IYCG 1P8LA 4GKJQ 2ALYB 1MJCA 3HOVG 3CCMA 2LSSA 1K8AC 4DR2L 3BZKA 1FL0A 5DLQE 4DR3L 3UDGA 2HQLA 3CC2A 1YHAA 5LMUL 1EWIA 4J15A 4YY3Q 5ELNA 5BR8L 3I56A 3PO3H 1X3EA 4A3DG 1K0RA 4R4CA 3ULJA 5LMNQ 2VQEL 5IP7G 3G6EA 2AWNA 2K5HA 2HHHQ 1N32Q 3PUWA 2F4VL 1X56A 5GAGC 4JI7L 2UXBQ 2D0OA 5C0XI 1LYLA 2E5LQ 1J6QA 4X64Q 3JAMi 1YI2A 4A3KG 1PH9A 1PYSB 4JI2L 4A3GG 1VQHA 2JEAI 1QUQA 4HIOA 4DV6L 4HJ8A 3U4VA 5JEAJ 1Q86C 2VUMG 3STBD 1B7YB 2VQFQ 1XPRA 5JJKA 1TWGH 3I55A 3CXCA 4LFBL 1E22A 4LF8L 2JQOA 4B3SQ 4WJ3M 1X54A 2N3SA 4A3CG 4RMFA 1VQBA 2B63H 5GQOA 4DV3L 3CCJA 3PF5A 5J3BA 1VQ7A 3D31A 3I4MG 1EFWA 2K50A 3ICEA 3KF8B 3HFZB 4JYAL 4LF6L 1Q8KA 1PH8A 3EN2A 5LMNW 4QGUA 2E8GA 4JI6Q 3TRZA 4A3EH 4DV1Q 3RR5A 2MO0A 1VQFA 4A76A 3BU2A 3RN5A 1UE7A 5H1SE 1X9NA 1BBWA 2EXDA 4P72A 4IFDJ 4O0AA 4GKKL 3HOVH 5C0XG 1VQKA 2YTYA 5FLMG 3S17H 4B3RL 2R7ZG 3OTOQ 1HR0Q 4UP9A 4OWXB 4JI3L 4L5SA 3KOJA 4BBSG 5C44G 3HOUG 4DUZL 4L5TA 2VY3A 3TEHB 5IP7H 4HJAA 1QVGA 3AEVA 2NN6I 3T1HQ 1X55A 4MNOA 4OONA 1K73C 2JE6I 3H0GG 3MXNB 4GN4B 4GN5A 1X3GA 2K52A 3E9IA 1YJ9A 1J5EL 2BH2A 3S1MH 1QUQB 1GD7A 2JA5G 2CWPA 1Q46A 4IO9A 2OQ0A 4GLAC 3PO2H 4P75A 2WFWA 4A3KH 4IPDA 1VQNA 3JC66 2ID0A 4IPHA 3BZCA 1Y1VG 4BXXG 3CP0A 2KHJA 4LUZA 1LM0A 1EOVA 2ZJPA 4C3HH 1NTGA 3M4PA 3PUXA 1Y1WH 3CPWA 2VUMH 3CC7A 3GTKH 3VDYA 5ELOA 3CMAA 1I94Q 3GTJH 2IT1A 4P71A 1FVIA 1IBKQ 4UP7A 2MQHA 3CCQA 1AE2A 2IY5B 3BJUA 3F2CA 3I4MH 4C3IH 1NE3A 1IBLL 4X66L 1A0IA 2JA8G 2UXCQ 1N9WA 4PZ8A 5JJLA 1EQQA 3M3YH 1CSQA 2ASBA 3EIVA 1XTDA 1HR0W 3NEMA 1XMOQ 1OTCA 4DR4Q 4A75A 2PMZE 4OX9Q 3B6YA 1HH2P 1YZ6A 1KHIA 1SR3A 5M5YH 1A8VA 4L5RC 4NXML 2ES2A 4DV7L 2NN6G 3KJPA 2ZM6Q 4QY7A 4KHPQ 1Q82C 1SRUA 1HZAA 1OXTA 1IBMQ 1PVOA 2OTLA 3OW2A 1YVCA 4KHZA 1KRTA 1PA6A 4DR1Q 1NBWA 2V1CC 2K4KA 4GKJL 3HOYH 1NMFA 4LUOA 2GVBA 2N78A 1N8RC 1PH5A 4APVA 1G291 4DV2Q 1VQ4A 3I4NH 4BBSH 2HIXA 3K0XA 5C44H 2Q2TA 2Q2UA 2UUBQ 4B3MQ 1QVFA 2R7FA 1UE5A 3HOUH 3HOWG 4LF9Q 2EIFA 2VS1A 5HY6A 4KI0A 4IPCA 1X3FA 4ALPA 4LF4L 4DR7L 1JE5A 1N32L 4A4IA 3FKIG 1QVCA 4OXPA 4B3TL 3CCEA 2YV5A 2UU9Q 3W1GA 1K9MC 1YBYA 3PIOA 3ZJYC 1Y1VH 4JI1Q 2E5LL 4POGA 4BY7G 4X64L 4JI0L 4BXXH 1D8LA 1T9HA 3M9BA 4TVAB 5IP9H 4HJ9A 1VQCA 1S72A 1VQ8A 3W1BA 1WFQA 2VW9A 2GVAA 5HGQA 1K3RA 1TXYA 3GTMH 3T1YQ 2L15A 2UXDL 2BA1A 2OQKA 3NELA 2IHEA 1CKNB 5FJ8G 1HNWQ 3K81C 3A5UA 4PZ6A 1VQPA 4MZ9A 4LNQA 2GN5A 2JEBI 5M3MH 5IYBG 2JA8H 1I50H 3A0JA 1E3PA 2LXJA 4JV5L 1VQAA 3K8AA 4DPGA 1OXUA 1N33Q 1PYBA 4BY1H 4YCWA 4HJ7A 1L2FA 1C9OA 1RIPA 2R6GA 4LW1A 4X65L 1L0WA 3RLOA 1XNQQ 4JI6L 1Z47A 1O7IA 3AFQA 5C4XG 2JA7H 3L7ZC 3K7UC 3UDIA 2R7DA 2Z0SA 2CCZA 3CD6A 2XTIA 1KC8C 4A93G 1PFSA 4YWMA 2IX0A 1Q1BA 3HKZE 2YTVA 3RZDH 1XMQQ 3HOXG 3ERSX 4HJ5A 1JT8A 1N34Q 4FDBA 1FGUA 2LXKA 4DR3Q 1CUKA 3PGZA 4A3FH 1C7YA 1DGSA 1JMCA 3SGIA 5LMUQ 2NVXH 3HOWH 1WOCA 4JC0A 5C4JH 3J81c 1HZ9A 5IYDG 1Q81C 4JI5L 4DUYQ 2WAQG 4NXNQ 1XNRQ 3HKZG 2VNUD 1SLJA 4AIMA 3T1HL 3FKIH 2JA6G 3PF4A 4JI7Q 1D7QA 1BKBA 4A3LG 4JBJA 1L1OA 2B3GA 3Q8DA 5IYCH 1HNZQ 1OXSC 2JK8A 2RHSB 1HNXL 3CW2C 2E2HH 4BY7H 3UE1A 1IYJB 1JB7A 4LF7L 3M7NA 1SROA 1UE6A 1GVPA 1VQ5A 1K8GA 4A3DH 5IY0A 1SMXA 2NVTH 3CQZH 4JI8L 1Y14B 4A3BG 5JJIA 1TWHH 1FJGL 1E24A 4LFBQ 5FJ8H 4DAMA 1XPOA 4IOAA 1I94L 4LUVA 3MEFA 1GM5A 1NY4A 4PZ7A 5IYBH 4DV3Q 1IBKL 3TS0A 1WCMG 2QGQA 4IJHA 4A3GH 2CFMA 4DV0Q 2UXCL 3TQYA 2QA4A 4A3JG 4JYAQ 2CQOA 1U5KA 1XMOL 4DR4L 3F1ZA 1G6PA 3GDEA 2A1AA 4YWKA 2A19A 5GADC 3HKSA 1BBUA 4OX9L 4UPAA 2I5MX 3HOZG 5C4XH 4JBKA 1VQEA 4DKAC 4QJFA 3ER0A 4YHHQ 4DR5Q 2F52A 4A3CH 4X6AH 3CF5A 5M3FG 4X62Q 2ZM6L 4OWTB 3S1QH 2R93G 1IBML 1CKNA 4DR6L 3KF6A 4RG1A 3PUYA 1V9PA 4C2MH 3M4OH 1LTLA 3FHWA 1YIJA 2QEXA 1PH2A 2YYZA 2UUCL 3PUVA 5K36G 2UUAQ 4R4QA 5IYDH 4DV2L 2B29A 3GO5A 3CCLA 3CCSA 1E1TA 2UUBL 4B3ML 1L1OB 5IWAQ 3PO3G 4JI4Q 3F8TA 3I4OA 3STBC 2A8VA 3OYYA 3F2DA 3J7A5 4AH6A 3DM3A 1B8AA 4GLXA 1UE1A 1VQJA 1L1OC 2AKWB 5C0XJ 2PNHA 4PG3A 1SN8A 5E7NA 1TWAH 1P16A 2NVQH 4R4OA 4IFDI 2UU9L 5FLMH 1GKHA 2CKZB 3UE0A 1WJJA 2R7ZH 5M5XH 1MIUA 1RL2A 1KD1C 3KFUA 1EUJA 4LFCQ 3A5ZB 3CC4A 1NMGA 3J7ZC 3WWVA 1ASYA 1TWFH 3EBEA 4QIWE 4YY3L 5JEAG 2OWOA 4DNIA 4A3BH 3M4QA 3W5OA 3IRBA 1JJCB 2PQAB 3H0GH 3PUZA 5AJ3Q 5LMNL 3T1YL 3S14H 4GOPB 2HHHL 4GN3B 2IX1A 2KHIA 2JA5H 1MJEA 1W3SA 1PH3A 2HIVA 4AYBE 4OO1I 2UXBL 4IJLA 3E9HA 1WCMH 4X66Q 3L0OA 1GO3E 3FP9A 3CCRA 1M1KC 1TWCH 1JJGA 1IL2A 2IHFA 2KCTA 3TREA 4DV5Q 4IOCA 1KIXA 4KLKA 3M85A 4XTCS 3NENA 2HT1A 1CKOA 4HIDA 1N33L 4O2DA 3S15H 4NXMQ 4BBRG 4HIMA 2VQFL 1ASZA 3HOZH 4Y52H 4JOIA 4AYBG 3KF6B 5M5WH 4BA1I 3S1RH 1VQMA 1SE8A 1YNXA 5M3FH 3RNUA 1KQSA 4B3SL 2ZTDA 1IXRA 1IZ6A 2R93H 3G48A 1OXXK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3S2H H;  3E0E A;  4LFA Q;  1KL9 A;  3L2P A;  1XMQ L;  1YJW A;  4LF5 Q;  4IFD G;  3G4S A;  2NZH A;  4YCV A;  1SFO H;  1KXL A;  3PCO B;  1N34 L;  4GNX A;  2OTJ A;  4DV4 Q;  1N36 Q;  2KBN A;  2ZTE A;  4YCU A;  3J81 i;  3H15 A;  3S16 H;  1B70 B;  4K0K Q;  2JJQ A;  3CPF A;  1LUZ A;  4AQY Q;  3TS2 A;  1X65 A;  3U58 A;  1R9T H;  3GD7 A;  3CCU A;  4YWL A;  1YHQ A;  4DUY L;  3KLW A;  4DV1 L;  4GLV B;  4NXN L;  1EYG A;  4LF4 Q;  1XNR L;  4DR7 Q;  2K14 A;  1A62 A;  4JG2 A;  2WAQ E;  4B3T Q;  1I5F A;  3GTO H;  1EIF A;  4A3M G;  3AYH B;  4NPS A;  4OO1 G;  4DR2 Q;  1VS0 A;  1HNZ L;  4JI0 Q;  3PO2 G;  3ULL A;  3F2B A;  1WYD A;  4P74 A;  3DLL A;  3D0F A;  1VQO A;  5GRO A;  5BR8 Q;  3OTO L;  3KDF B;  1S40 A;  1HZC A;  1V1Q A;  2VL6 A;  1HR0 L;  1VQ6 A;  1UWV A;  1Y1W G;  2VQE Q;  1UEB A;  1VQG A;  3GTQ H;  1I6H H;  2UXD Q;  3ULP A;  1C0A A;  2Q2I A;  4QQB X;  2RCN A;  2F4V Q;  3AQQ A;  1VQL A;  3K80 C;  4DK3 C;  3CAM A;  2KCM A;  1VQD A;  1PH7 A;  2Z6K A;  2MO1 A;  2AWO A;  3U50 C;  4JI2 Q;  2K5N A;  4IPG A;  3JAM c;  4JV5 Q;  1YHB A;  4DV6 Q;  2VZA A;  1EIY B;  4DV0 L;  1YIT A;  2N8N A;  2JA9 A;  4EQ5 A;  4PMW A;  2EQS A;  1Q1E A;  3A74 A;  3KYH C;  4BBR H;  4X65 Q;  1I3Q H;  4JOI C;  4LF8 Q;  3RLF A;  4P73 A;  1KAW A;  2KEN A;  2WB1 E;  1QZG A;  3KJO A;  2R92 G;  4YHH L;  4DR5 L;  1JJ2 A;  3J80 i;  4WJ4 A;  2YU9 H;  2PQA A;  3H3V H;  4GNX B;  1MKH A;  4X62 L;  3CCV A;  4GOP A;  1VQ9 A;  2I5H A;  3CME A;  5GAH C;  1X6O A;  2ZJR A;  1EQR A;  1G51 A;  2K75 A;  1W2B A;  1V43 A;  4LF6 Q;  1NJI C;  3AFP A;  4GNX C;  4A3I G;  3GTP H;  3HOY G;  4H02 A;  1HJP A;  1VCI A;  4LWC A;  3U4Z A;  4JI5 Q;  3I4N G;  2WB1 G;  2UUA L;  5C3E G;  3K7A H;  4DAY B;  2E2I H;  4JCV E;  3G71 A;  5IWA L;  4C3J H;  5FLX c;  4A93 H;  4JI4 L;  2D62 A;  2NZO A;  2PI2 A;  4KHP L;  4Y7N H;  1S3O A;  2ATW A;  3J80 c;  2Q2H A;  4R1J A;  1VQI A;  4A3M H;  2ZJQ A;  3HOX H;  4GKK Q;  1HNX Q;  4B3R Q;  4LF7 Q;  3PIP A;  4DR1 L;  1YJN A;  1Q7Y C;  1PHJ A;  2K5V A;  4JI3 Q;  2AMC B;  2BH8 A;  4DUZ Q;  4LFC L;  3RZO H;  4XIG S;  5IP9 G;  4JI8 Q;  2RF4 A;  1FJG Q;  3S1N H;  2FXQ A;  2YTX A;  4NB3 A;  4L5Q A;  4UP8 A;  5IE8 A;  4LF9 L;  5EAY A;  1KRS A;  2I5L X;  1J5E Q;  4OWW B;  3UDX A;  2JA6 H;  1XPU A;  5AJ3 L;  4ME3 A;  4UY8 C;  3RLN A;  4A3L H;  3H3V I;  2Z6K C;  3I7F A;  2AHO B;  2NVY H;  3PV0 A;  1OXV A;  4QL5 A;  3UDF A;  5M3M G;  3LGJ A;  1Q12 A;  1PH4 A;  3I2Z A;  3J81 j;  2RHQ B;  2WP8 J;  4JI1 L;  1H95 A;  2BA0 A;  1YEZ A;  1PH6 A;  1PV4 A;  1PH1 A;  4BA2 I;  4DV5 L;  3S2D H;  1CSP A;  1BVS A;  2ZTC A;  5IT9 c;  4BY1 G;  2OCE A;  2Y0S E;  3KDF A;  2R92 H;  1HNW L;  2C35 B;  2JA7 G;  2N49 A;  1HZB A;  4HIK A;  1IBL Q;  3GTG H;  4DR6 Q;  2B63 G;  4GOP C;  2H5X A;  2CWA A;  2XGT A;  2F3I A;  1K83 H;  2PI2 E;  3S24 A;  1CKM A;  4A3J H;  4TQU S;  3GTL H;  4GS3 A;  2I0Q A;  4LFA L;  3RN2 A;  1E1O A;  2D0P A;  2Y0S G;  4EX5 A;  4A3I H;  2UUC Q;  4LF5 L;  4JBW A;  4A3F G;  1U0L A;  4R4T A;  3PSI A;  4DK6 C;  2DGY A;  4DV4 L;  1N36 L;  2E2J H;  4K0K L;  5C3E H;  1AH9 A;  5GAE C;  2MFI A;  4MTN A;  1WI5 A;  4R4I A;  4DV7 Q;  4AQY L;  4A3E G;  1XNQ L;  1QZH A;  3NBH B;  1XJV A;  2MNA A;  4JBM A;  1AE3 A;  1Z9F A;  2DUD A;  1M90 C;  4POF A;  1A63 A;  1E7Z A;  5IYC G;  1P8L A;  4GKJ Q;  2ALY B;  1MJC A;  3HOV G;  3CCM A;  2LSS A;  1K8A C;  4DR2 L;  3BZK A;  1FL0 A;  5DLQ E;  4DR3 L;  3UDG A;  2HQL A;  3CC2 A;  1YHA A;  5LMU L;  1EWI A;  4J15 A;  4YY3 Q;  5ELN A;  5BR8 L;  3I56 A;  3PO3 H;  1X3E A;  4A3D G;  1K0R A;  4R4C A;  3ULJ A;  5LMN Q;  2VQE L;  5IP7 G;  3G6E A;  2AWN A;  2K5H A;  2HHH Q;  1N32 Q;  3PUW A;  2F4V L;  1X56 A;  5GAG C;  4JI7 L;  2UXB Q;  2D0O A;  5C0X I;  1LYL A;  2E5L Q;  1J6Q A;  4X64 Q;  3JAM i;  1YI2 A;  4A3K G;  1PH9 A;  1PYS B;  4JI2 L;  4A3G G;  1VQH A;  2JEA I;  1QUQ A;  4HIO A;  4DV6 L;  4HJ8 A;  3U4V A;  5JEA J;  1Q86 C;  2VUM G;  3STB D;  1B7Y B;  2VQF Q;  1XPR A;  5JJK A;  1TWG H;  3I55 A;  3CXC A;  4LFB L;  1E22 A;  4LF8 L;  2JQO A;  4B3S Q;  4WJ3 M;  1X54 A;  2N3S A;  4A3C G;  4RMF A;  1VQB A;  2B63 H;  5GQO A;  4DV3 L;  3CCJ A;  3PF5 A;  5J3B A;  1VQ7 A;  3D31 A;  3I4M G;  1EFW A;  2K50 A;  3ICE A;  3KF8 B;  3HFZ B;  4JYA L;  4LF6 L;  1Q8K A;  1PH8 A;  3EN2 A;  5LMN W;  4QGU A;  2E8G A;  4JI6 Q;  3TRZ A;  4A3E H;  4DV1 Q;  3RR5 A;  2MO0 A;  1VQF A;  4A76 A;  3BU2 A;  3RN5 A;  1UE7 A;  5H1S E;  1X9N A;  1BBW A;  2EXD A;  4P72 A;  4IFD J;  4O0A A;  4GKK L;  3HOV H;  5C0X G;  1VQK A;  2YTY A;  5FLM G;  3S17 H;  4B3R L;  2R7Z G;  3OTO Q;  1HR0 Q;  4UP9 A;  4OWX B;  4JI3 L;  4L5S A;  3KOJ A;  4BBS G;  5C44 G;  3HOU G;  4DUZ L;  4L5T A;  2VY3 A;  3TEH B;  5IP7 H;  4HJA A;  1QVG A;  3AEV A;  2NN6 I;  3T1H Q;  1X55 A;  4MNO A;  4OON A;  1K73 C;  2JE6 I;  3H0G G;  3MXN B;  4GN4 B;  4GN5 A;  1X3G A;  2K52 A;  3E9I A;  1YJ9 A;  1J5E L;  2BH2 A;  3S1M H;  1QUQ B;  1GD7 A;  2JA5 G;  2CWP A;  1Q46 A;  4IO9 A;  2OQ0 A;  4GLA C;  3PO2 H;  4P75 A;  2WFW A;  4A3K H;  4IPD A;  1VQN A;  3JC6 6;  2ID0 A;  4IPH A;  3BZC A;  1Y1V G;  4BXX G;  3CP0 A;  2KHJ A;  4LUZ A;  1LM0 A;  1EOV A;  2ZJP A;  4C3H H;  1NTG A;  3M4P A;  3PUX A;  1Y1W H;  3CPW A;  2VUM H;  3CC7 A;  3GTK H;  3VDY A;  5ELO A;  3CMA A;  1I94 Q;  3GTJ H;  2IT1 A;  4P71 A;  1FVI A;  1IBK Q;  4UP7 A;  2MQH A;  3CCQ A;  1AE2 A;  2IY5 B;  3BJU A;  3F2C A;  3I4M H;  4C3I H;  1NE3 A;  1IBL L;  4X66 L;  1A0I A;  2JA8 G;  2UXC Q;  1N9W A;  4PZ8 A;  5JJL A;  1EQQ A;  3M3Y H;  1CSQ A;  2ASB A;  3EIV A;  1XTD A;  1HR0 W;  3NEM A;  1XMO Q;  1OTC A;  4DR4 Q;  4A75 A;  2PMZ E;  4OX9 Q;  3B6Y A;  1HH2 P;  1YZ6 A;  1KHI A;  1SR3 A;  5M5Y H;  1A8V A;  4L5R C;  4NXM L;  2ES2 A;  4DV7 L;  2NN6 G;  3KJP A;  2ZM6 Q;  4QY7 A;  4KHP Q;  1Q82 C;  1SRU A;  1HZA A;  1OXT A;  1IBM Q;  1PVO A;  2OTL A;  3OW2 A;  1YVC A;  4KHZ A;  1KRT A;  1PA6 A;  4DR1 Q;  1NBW A;  2V1C C;  2K4K A;  4GKJ L;  3HOY H;  1NMF A;  4LUO A;  2GVB A;  2N78 A;  1N8R C;  1PH5 A;  4APV A;  1G29 1;  4DV2 Q;  1VQ4 A;  3I4N H;  4BBS H;  2HIX A;  3K0X A;  5C44 H;  2Q2T A;  2Q2U A;  2UUB Q;  4B3M Q;  1QVF A;  2R7F A;  1UE5 A;  3HOU H;  3HOW G;  4LF9 Q;  2EIF A;  2VS1 A;  5HY6 A;  4KI0 A;  4IPC A;  1X3F A;  4ALP A;  4LF4 L;  4DR7 L;  1JE5 A;  1N32 L;  4A4I A;  3FKI G;  1QVC A;  4OXP A;  4B3T L;  3CCE A;  2YV5 A;  2UU9 Q;  3W1G A;  1K9M C;  1YBY A;  3PIO A;  3ZJY C;  1Y1V H;  4JI1 Q;  2E5L L;  4POG A;  4BY7 G;  4X64 L;  4JI0 L;  4BXX H;  1D8L A;  1T9H A;  3M9B A;  4TVA B;  5IP9 H;  4HJ9 A;  1VQC A;  1S72 A;  1VQ8 A;  3W1B A;  1WFQ A;  2VW9 A;  2GVA A;  5HGQ A;  1K3R A;  1TXY A;  3GTM H;  3T1Y Q;  2L15 A;  2UXD L;  2BA1 A;  2OQK A;  3NEL A;  2IHE A;  1CKN B;  5FJ8 G;  1HNW Q;  3K81 C;  3A5U A;  4PZ6 A;  1VQP A;  4MZ9 A;  4LNQ A;  2GN5 A;  2JEB I;  5M3M H;  5IYB G;  2JA8 H;  1I50 H;  3A0J A;  1E3P A;  2LXJ A;  4JV5 L;  1VQA A;  3K8A A;  4DPG A;  1OXU A;  1N33 Q;  1PYB A;  4BY1 H;  4YCW A;  4HJ7 A;  1L2F A;  1C9O A;  1RIP A;  2R6G A;  4LW1 A;  4X65 L;  1L0W A;  3RLO A;  1XNQ Q;  4JI6 L;  1Z47 A;  1O7I A;  3AFQ A;  5C4X G;  2JA7 H;  3L7Z C;  3K7U C;  3UDI A;  2R7D A;  2Z0S A;  2CCZ A;  3CD6 A;  2XTI A;  1KC8 C;  4A93 G;  1PFS A;  4YWM A;  2IX0 A;  1Q1B A;  3HKZ E;  2YTV A;  3RZD H;  1XMQ Q;  3HOX G;  3ERS X;  4HJ5 A;  1JT8 A;  1N34 Q;  4FDB A;  1FGU A;  2LXK A;  4DR3 Q;  1CUK A;  3PGZ A;  4A3F H;  1C7Y A;  1DGS A;  1JMC A;  3SGI A;  5LMU Q;  2NVX H;  3HOW H;  1WOC A;  4JC0 A;  5C4J H;  3J81 c;  1HZ9 A;  5IYD G;  1Q81 C;  4JI5 L;  4DUY Q;  2WAQ G;  4NXN Q;  1XNR Q;  3HKZ G;  2VNU D;  1SLJ A;  4AIM A;  3T1H L;  3FKI H;  2JA6 G;  3PF4 A;  4JI7 Q;  1D7Q A;  1BKB A;  4A3L G;  4JBJ A;  1L1O A;  2B3G A;  3Q8D A;  5IYC H;  1HNZ Q;  1OXS C;  2JK8 A;  2RHS B;  1HNX L;  3CW2 C;  2E2H H;  4BY7 H;  3UE1 A;  1IYJ B;  1JB7 A;  4LF7 L;  3M7N A;  1SRO A;  1UE6 A;  1GVP A;  1VQ5 A;  1K8G A;  4A3D H;  5IY0 A;  1SMX A;  2NVT H;  3CQZ H;  4JI8 L;  1Y14 B;  4A3B G;  5JJI A;  1TWH H;  1FJG L;  1E24 A;  4LFB Q;  5FJ8 H;  4DAM A;  1XPO A;  4IOA A;  1I94 L;  4LUV A;  3MEF A;  1GM5 A;  1NY4 A;  4PZ7 A;  5IYB H;  4DV3 Q;  1IBK L;  3TS0 A;  1WCM G;  2QGQ A;  4IJH A;  4A3G H;  2CFM A;  4DV0 Q;  2UXC L;  3TQY A;  2QA4 A;  4A3J G;  4JYA Q;  2CQO A;  1U5K A;  1XMO L;  4DR4 L;  3F1Z A;  1G6P A;  3GDE A;  2A1A A;  4YWK A;  2A19 A;  5GAD C;  3HKS A;  1BBU A;  4OX9 L;  4UPA A;  2I5M X;  3HOZ G;  5C4X H;  4JBK A;  1VQE A;  4DKA C;  4QJF A;  3ER0 A;  4YHH Q;  4DR5 Q;  2F52 A;  4A3C H;  4X6A H;  3CF5 A;  5M3F G;  4X62 Q;  2ZM6 L;  4OWT B;  3S1Q H;  2R93 G;  1IBM L;  1CKN A;  4DR6 L;  3KF6 A;  4RG1 A;  3PUY A;  1V9P A;  4C2M H;  3M4O H;  1LTL A;  3FHW A;  1YIJ A;  2QEX A;  1PH2 A;  2YYZ A;  2UUC L;  3PUV A;  5K36 G;  2UUA Q;  4R4Q A;  5IYD H;  4DV2 L;  2B29 A;  3GO5 A;  3CCL A;  3CCS A;  1E1T A;  2UUB L;  4B3M L;  1L1O B;  5IWA Q;  3PO3 G;  4JI4 Q;  3F8T A;  3I4O A;  3STB C;  2A8V A;  3OYY A;  3F2D A;  3J7A 5;  4AH6 A;  3DM3 A;  1B8A A;  4GLX A;  1UE1 A;  1VQJ A;  1L1O C;  2AKW B;  5C0X J;  2PNH A;  4PG3 A;  1SN8 A;  5E7N A;  1TWA H;  1P16 A;  2NVQ H;  4R4O A;  4IFD I;  2UU9 L;  5FLM H;  1GKH A;  2CKZ B;  3UE0 A;  1WJJ A;  2R7Z H;  5M5X H;  1MIU A;  1RL2 A;  1KD1 C;  3KFU A;  1EUJ A;  4LFC Q;  3A5Z B;  3CC4 A;  1NMG A;  3J7Z C;  3WWV A;  1ASY A;  1TWF H;  3EBE A;  4QIW E;  4YY3 L;  5JEA G;  2OWO A;  4DNI A;  4A3B H;  3M4Q A;  3W5O A;  3IRB A;  1JJC B;  2PQA B;  3H0G H;  3PUZ A;  5AJ3 Q;  5LMN L;  3T1Y L;  3S14 H;  4GOP B;  2HHH L;  4GN3 B;  2IX1 A;  2KHI A;  2JA5 H;  1MJE A;  1W3S A;  1PH3 A;  2HIV A;  4AYB E;  4OO1 I;  2UXB L;  4IJL A;  3E9H A;  1WCM H;  4X66 Q;  3L0O A;  1GO3 E;  3FP9 A;  3CCR A;  1M1K C;  1TWC H;  1JJG A;  1IL2 A;  2IHF A;  2KCT A;  3TRE A;  4DV5 Q;  4IOC A;  1KIX A;  4KLK A;  3M85 A;  4XTC S;  3NEN A;  2HT1 A;  1CKO A;  4HID A;  1N33 L;  4O2D A;  3S15 H;  4NXM Q;  4BBR G;  4HIM A;  2VQF L;  1ASZ A;  3HOZ H;  4Y52 H;  4JOI A;  4AYB G;  3KF6 B;  5M5W H;  4BA1 I;  3S1R H;  1VQM A;  1SE8 A;  1YNX A;  5M3F H;  3RNU A;  1KQS A;  4B3S L;  2ZTD A;  1IXR A;  1IZ6 A;  2R93 H;  3G48 A;  1OXX K; 
#chains in the Genus database with same CATH topology
 2QDL A;  3QOL A;  3L2P A;  4LF5 Q;  2EZV A;  2NZH A;  3K7A B;  1CFM A;  1N34 L;  2E2I B;  4YCU A;  4K0K Q;  3H15 A;  4DAV A;  2L4N A;  1R9T H;  3GD7 A;  3I91 A;  1YHQ A;  5EQ0 A;  4GLV B;  2Q8R E;  3PO2 B;  1K0S A;  2GA4 B;  2PNR C;  3QIA A;  4NPS A;  4QUF A;  3PO2 G;  1VS0 A;  4C3H B;  1GOZ A;  1Y1W B;  3RZO B;  3I8Z A;  1AN8 A;  3MWY W;  3S1N B;  2MUY A;  5GRO A;  3ONA B;  2M9V A;  4C3H G;  1Y1W G;  1EY9 A;  5JEA H;  3TSS A;  1GUW A;  2Q2I A;  3H94 A;  3KK7 A;  5J39 A;  4EQP A;  2RCN A;  2F0N A;  3TZU A;  4DK3 C;  2DN8 A;  3CAM A;  4C1N I;  1JCK B;  3DHQ A;  1ESF A;  2VB2 X;  3U50 C;  1IKL A;  4DV6 Q;  5T1I A;  2A6E D;  4JK1 C;  2N8N A;  4DN4 M;  4EQ5 A;  3A74 A;  3KYH C;  1UUP A;  3MFY A;  2B2T A;  3RLF A;  2WB1 E;  2QDB A;  4GNX B;  3CCV A;  4IFD H;  2ZJR A;  2WB1 B;  1EQR A;  4PMB A;  1NJI C;  3AFP A;  4GNX C;  4XXE A;  4H02 A;  1XYI A;  1HJP A;  4LWC A;  2PZU A;  1Q3L A;  2WB1 G;  3EVQ A;  1TY2 A;  4DAY B;  4KHP L;  5ELD A;  1S3O A;  2NB0 A;  2Q2H A;  3OIQ A;  4M8A A;  2ZJQ A;  1GJX A;  5I6Y A;  1HNX Q;  1SE2 A;  3NBH A;  4DR1 L;  1DYQ A;  1A2U A;  3P7J A;  3ND8 A;  2PQE A;  2K6A A;  4DUZ Q;  4LFC L;  5IP9 G;  1STN A;  2RF4 A;  2ICE C;  2XVS A;  4NB3 A;  3D6W A;  4UP8 A;  2I5L X;  1H9J A;  5AJ3 L;  2Z6K C;  2AHO B;  2KED A;  1RF2 D;  4WRD A;  1PH4 A;  1GHK A;  3J81 j;  1H95 A;  2BA0 A;  3S9W A;  3CKI B;  1PV4 A;  3S2D H;  1YNN D;  2ZTC A;  4TKO B;  2A6H C;  4K6L A;  1EU4 A;  3RZD B;  5NUC A;  2FIN B;  1FNW A;  1HZB A;  1IBL Q;  4DR6 Q;  4GOP C;  2HCC A;  2XGT A;  2F3I A;  2Z6B A;  1R4Q B;  4F8M A;  1LTT D;  5C4J B;  2I0Q A;  3LNN A;  2D0P A;  5CV7 A;  3RN2 A;  3A56 A;  2A68 C;  2DGY A;  1PFN A;  1AH9 A;  1STH A;  4UHV A;  2EYJ A;  1WI5 A;  5CMD A;  1XNQ L;  3W3A A;  1AE3 A;  1CZW A;  1Z9F A;  3S17 B;  4ZQ3 A;  2AQ2 B;  1M90 C;  5FO7 B;  1E7Z A;  4GKJ Q;  1RJT A;  2LSS A;  3P1H A;  3O13 A;  4N8X 1;  1TWH B;  2K5Q A;  4J15 A;  5BR8 L;  5LMU L;  1XXG A;  1X3E A;  1K0R A;  2O5J C;  2VQE L;  2K5H A;  1LTG D;  2J7Z A;  1PYW D;  4A3K B;  3PUW A;  3MEH A;  5GAG C;  2NWG A;  2IPK D;  1J6Q A;  4X64 Q;  3JAM i;  1YI2 A;  4A3K G;  1PYS B;  4DGZ A;  3GTK B;  3JAM E;  1VQH A;  2EYL A;  3NP8 A;  2CVR A;  3VR4 A;  4XDX A;  5JEA J;  1Q86 C;  5EPK A;  1XPR A;  1H9S A;  3OPO A;  3BYT B;  3EFX D;  4C3I B;  3I55 A;  4LFB L;  4Q5V A;  4LF8 L;  1EY8 A;  2B63 H;  3CCJ A;  1BCP B;  4C3I G;  3D31 A;  1KAB A;  3D4W A;  2BCO A;  2K50 A;  3T51 B;  3KF8 B;  4JYA L;  4LF6 L;  4MTK A;  4LJZ C;  3EN2 A;  2PYK A;  4QGU A;  2F3V A;  3RR5 A;  2NVQ B;  2MO0 A;  3MZ5 A;  4A76 A;  5FLX E;  3BU2 A;  4RHR A;  1BBW A;  4IFD J;  3FMC A;  3OMC A;  1J8I A;  3L9A X;  4BBS B;  5C44 B;  1VQK A;  1TWF B;  2F0M A;  2F0L A;  1D6E C;  3MHB A;  1ML0 D;  3A7A B;  3NPP A;  2J0T D;  4UP9 A;  4JI3 L;  1WTW A;  4V19 0;  4BBS G;  3N6R A;  5C44 G;  4ZYS A;  5IP7 H;  1TY0 A;  1QVG A;  1X55 A;  4OON A;  3MXN B;  1EL0 A;  1Y1V B;  1J5E L;  1TWC B;  1GD7 A;  5AFW A;  4GLA C;  2NUC A;  4P75 A;  1VQN A;  4IPH A;  1Y1V G;  1EOT A;  3CP0 A;  3ERQ A;  1EOV A;  4CHT B;  2ZJP A;  2B2U C;  2KJX A;  4NKL A;  5ELO A;  3A7L A;  3CMA A;  2XN9 C;  1IBK Q;  3NWS A;  2CW0 D;  2LFN A;  3BJU A;  1TT2 A;  3I4M H;  2E76 C;  5C5L A;  1A0I A;  5L37 A;  2ENB A;  5JJL A;  1HHV A;  1HR0 W;  1XTD A;  3NEM A;  3SHL A;  4NMZ A;  1CI3 M;  3B6Y A;  1HH2 P;  1YZ6 A;  1SR3 A;  5M5Y H;  3GTO B;  1IKM A;  3J80 L;  3KJP A;  1GXD C;  2ZM6 Q;  4N9T A;  1SRU A;  1OXT A;  2B39 A;  3BVG A;  2EY5 A;  1I6V C;  4DF7 A;  1PA6 A;  5C4H A;  1ICW A;  1TS5 A;  2V4D A;  1B44 D;  3HOY H;  4LUO A;  1PH5 A;  1G29 1;  2K05 A;  4DV2 Q;  1VQ4 A;  3I4N H;  2Q2T A;  3HOU H;  1QVF A;  2R7F A;  3E6Z X;  4IPC A;  3X3N A;  3NBI A;  5C3W A;  1SMY D;  2EPB A;  2EJM A;  4NP5 A;  4XT3 B;  2E5L L;  4POG A;  2NVT B;  1EY0 A;  2EJF C;  3I73 A;  4HJ9 A;  4X3K A;  1D2B A;  2GVA A;  3GTM H;  2OQK A;  2IHE A;  5FJ8 G;  1PTO D;  3A5U A;  4A3G B;  4RGT A;  3K58 A;  4ZLT F;  4ID6 A;  4MZ9 A;  5M3M H;  2XNA C;  4XYO A;  1KDC A;  5IGE A;  2LXJ A;  5IGC A;  1LT5 D;  4XT1 B;  4EQO A;  3M4O H;  1AZP A;  4BY1 H;  4YCW A;  4HJ7 A;  1RIP A;  4LW1 A;  1JC7 A;  4X65 L;  5J22 A;  1O7I A;  3AFQ A;  4RAU C;  3L7Z C;  3K7U C;  2XTI A;  1KC8 C;  1PFS A;  4N9P A;  3HG9 A;  4H0L C;  4XYQ A;  1Q1B A;  3HRZ C;  3ERS X;  1JT8 A;  4DR3 Q;  1CUK A;  3DM1 A;  4RGN A;  4A3F H;  1DGS A;  4KMU C;  3SGI A;  1EEF D;  3J81 c;  1TQO A;  2WAQ G;  5EBC A;  1XNR Q;  3PF4 A;  3FKI H;  4JI7 Q;  3CHB D;  3HS0 C;  5IYC H;  2KOL A;  1OXS C;  3NK9 A;  1HNZ Q;  2RHS B;  2E2H H;  3FDT A;  4LF7 L;  2A74 C;  4QUC A;  1JOQ A;  4U68 A;  3K5N A;  2XWB B;  4CKC A;  4JI8 L;  1BCP F;  1T5X D;  5JJI A;  2QEJ C;  3QB3 A;  4DAM A;  1XPO A;  3GTG B;  3C46 A;  1I94 L;  1WTH A;  3TME A;  3A8K E;  3MEF A;  1GM5 A;  1NY4 A;  2L9H A;  1F77 A;  3MTS A;  2QGQ A;  1RTO A;  2D5D A;  1F9Q A;  2Z9H A;  2CFM A;  3BG3 A;  3TQY A;  3HOZ B;  1IL8 A;  4K5X A;  1T5E A;  2CQO A;  3U9O A;  1G6P A;  4DR4 L;  3OW7 A;  5I2Y A;  3RUZ A;  1WTV A;  3HOZ G;  5C4X H;  1EZ8 A;  1YNJ D;  4DR5 Q;  1PTO B;  1PXU A;  1QCB D;  3CF5 A;  4KKT A;  5IOD A;  5FKA C;  4OWT B;  4X62 Q;  4RGO S;  5ELE A;  2F0E A;  3NTK A;  1IBM L;  3G6J B;  2NTT A;  1EYA A;  4RG1 A;  2LS0 1;  1V9P A;  3S16 B;  4R8I A;  3LX0 A;  1ICF B;  4FXD A;  3PO3 B;  4F87 A;  2RVL A;  4HCE A;  4CKE A;  3FPU B;  2X6G A;  5C6A A;  2DNE A;  3GO5 A;  3TP8 A;  3SK8 A;  1L1O B;  5IWA Q;  3DWP A;  3PO3 G;  3NWT A;  1L1O C;  2AKW B;  1QWY A;  1SN8 A;  4RHS A;  3VYR A;  2R7Z H;  4KJN A;  1I6H B;  1BDO A;  3A5Z B;  3EBE A;  2D2C C;  2L0C A;  3W5O A;  2PQA B;  3PUZ A;  3T1Y L;  3FRP B;  2JA5 H;  3QWN A;  2Q8T A;  4OO1 I;  4GZY C;  3E9H A;  2RA4 A;  2H1E A;  1Z6H A;  1GO3 E;  4IOC A;  1I3Q B;  4R8N A;  5JPM C;  3M85 A;  4HED A;  1WTQ A;  1N33 L;  3S15 H;  2K32 A;  1G91 A;  2YU9 B;  3KF6 B;  2OEO A;  4BA1 I;  5E4W C;  3KUP A;  1IXR A;  2R93 H;  3UI2 A;  1WD0 A;  3URY A;  4LFA Q;  5FO8 B;  3VYT A;  4YCV A;  1SFO H;  4NW2 A;  5KIX A;  5K36 H;  1N36 Q;  2ZTE A;  4KK7 A;  3SR1 A;  1LUZ A;  1X65 A;  1PFM A;  1PLF A;  5E1F A;  4A3M B;  4F7X A;  3KLW A;  4DR7 Q;  4KD3 A;  2K14 A;  1A62 A;  1I5F A;  1EIF A;  5EGT A;  4A3M G;  2B8F A;  3AYH B;  4OO1 G;  4DR2 Q;  3DWA A;  3F2B A;  1WYD A;  4P74 A;  5C4Z A;  1ZYR D;  3DLL A;  1VQO A;  1S40 A;  3OTO L;  3U9S A;  1HZC A;  1V1Q A;  1HR0 L;  3GTJ B;  1KTK A;  2UXD Q;  1VQG A;  2F0G A;  3VR2 A;  4JVZ A;  4J8Q A;  2NVY B;  3OMG A;  5ISR A;  2ZXO A;  3AQQ A;  3I72 A;  2HDM A;  2MO1 A;  1ET6 A;  4FVM A;  5LL6 S;  3BVM A;  4JI2 Q;  1DD2 A;  4JV5 Q;  1O78 A;  1YIT A;  5FK9 C;  4PMW A;  2R92 B;  1Q1E A;  5EKI A;  2KEN A;  2R92 G;  5KYI A;  3GTL B;  2PQA A;  5C3X A;  4A3I B;  3H3V H;  2L1B A;  3V96 A;  2IWH A;  1JWS D;  4IZ8 A;  3CME A;  1V43 A;  5C3E B;  4A3I G;  5KRU A;  3U4Z A;  4JI5 Q;  2UUA L;  5C3E G;  3K7A H;  2E2I H;  1DXM A;  2ICI A;  4JI4 L;  2D62 A;  2F1M A;  1D1K A;  2PI2 A;  3M7N A;  2ATW A;  4FF1 A;  1HA6 A;  3HOX H;  1SND A;  1TU2 B;  2RQX A;  4B3R Q;  2ZXP A;  2O5I C;  3PIP A;  1Q7Y C;  1SNP A;  3MC0 B;  3VR5 A;  5EBD A;  3RZO H;  1SXT A;  1Z7T A;  1BUV T;  1FJG Q;  3S1N H;  1UEA B;  3C1E A;  2IX3 A;  4DAP A;  3NSW A;  2JA6 H;  4OWW B;  3UDX A;  1I4Q A;  2F0F A;  4A3L H;  3H3V I;  3I7F A;  2RKS A;  4QL5 A;  2B2V A;  2A73 B;  3VR6 A;  4JI1 L;  1PH6 A;  2FFK B;  1SAP A;  4BA2 I;  4DV5 L;  1EQV A;  2C5C A;  2JA7 B;  4HSP A;  1NAP A;  2B2T C;  4X3U A;  1NCV A;  2HQE A;  3ND9 A;  1H9M A;  3KLS X;  2EYF A;  2C35 B;  2HD3 A;  2N49 A;  2JA7 G;  2N55 A;  2F0W A;  1JB3 A;  1S4Z A;  4A3J H;  3E0J A;  4TQU S;  1E1O A;  4A3E B;  4LF5 L;  1U0L A;  3PSI A;  2C9O A;  3K6O A;  4K0K L;  4CJ2 C;  2MFI A;  4MTN A;  4DV7 Q;  4A3E G;  3NBH B;  1KLU D;  3V2T A;  2KUM A;  3H3V C;  4POF A;  4CGY B;  4LMQ D;  1P8L A;  4OL7 A;  3ZYY X;  1RD9 D;  3CCM A;  1FL0 A;  5DLQ E;  3CQZ B;  3I3C A;  2HQL A;  4ULL A;  1EWI A;  4YY3 Q;  2EXZ A;  1BQQ T;  5ELN A;  2F0K A;  3SEB A;  4TSS A;  1B3Q A;  4LAA A;  2WKC A;  4R4C A;  5EKK A;  3S1M B;  4QB4 A;  1A6X A;  1N32 Q;  2X6L A;  3NTH A;  1Y69 U;  1QNK A;  2UXB Q;  1PRT B;  1JE4 A;  2CH4 W;  1PH9 A;  1ENA A;  3E3X A;  4ILW A;  1PRT C;  1QUQ A;  4DV6 L;  4HJ8 A;  3U4V A;  1KLG D;  1B7Y B;  2RSN A;  3MXG A;  4XQN A;  2QKI C;  2F0Q A;  3H91 A;  4WJ3 M;  1X54 A;  4O1N A;  3D4R A;  3OSO A;  3M3Y B;  4PV1 C;  3T4A C;  1SYD A;  2OT2 A;  1EY7 A;  1IW7 D;  1SE3 A;  5LMN W;  2K33 A;  4JI6 Q;  3R2I A;  1STG A;  3EQL C;  2K1B A;  1TWA B;  1VQF A;  3SK5 A;  5H1S E;  1X9N A;  1GUT A;  2YTY A;  5FLM G;  3S17 H;  4G7O C;  1SE4 A;  4OWX B;  4KY7 A;  4DUZ L;  3TEH B;  2VY3 A;  3AEV A;  2NN6 I;  3T1H Q;  1WD1 A;  2EYH A;  2JE6 I;  4GN5 A;  3SVM A;  4G4K A;  3JAM L;  4G7H C;  2OQ0 A;  1JR0 D;  1ZEQ X;  4A3K H;  3JC6 6;  1EIG A;  2ID0 A;  1C48 A;  1Y8N B;  4KN7 C;  1H9S B;  2L55 A;  1NTG A;  3PUX A;  3CPW A;  5DM7 3;  3CC7 A;  3GTK H;  3VDY A;  2PO4 A;  4HMJ A;  3DWQ A;  1ROD A;  1STY A;  5ELC A;  1I4P A;  3NQT A;  2IT1 A;  3GV3 A;  4YIJ A;  4UP7 A;  5DM6 3;  1E2V A;  4C3I H;  1NE3 A;  1O7L A;  3PIP 3;  1IBL L;  1II3 A;  1EQQ A;  1LLR D;  3R93 A;  1TII D;  1R9T B;  5FLX L;  1BOS A;  1CQF A;  1KHI A;  1A8V A;  4NXM L;  1RDP D;  4KY6 A;  1QOH A;  5KNB A;  2NN6 G;  4KHP Q;  1Q82 C;  3OWE B;  1FNU A;  4DR1 Q;  3HOW B;  1MHW C;  5JOB A;  4GKJ L;  3R3O A;  1N8R C;  2N78 A;  4LK1 C;  3OIP A;  4BBS H;  2HIX A;  2UUB Q;  5C44 H;  3HOW G;  2DY7 A;  1TR5 A;  2EIF A;  2A6E C;  4TRD A;  4KI0 A;  5FOB B;  1X3F A;  5J1Z A;  4ALP A;  1X3Q A;  4LF4 L;  3J7A V;  1JE5 A;  2EDG A;  4B3T L;  1LV9 A;  2YV5 A;  1D1I A;  3W1G A;  1Y1V H;  4X64 L;  5IT9 L;  4JI0 L;  3GP7 A;  1D8L A;  3X3M A;  3W1B A;  1K3R A;  1NSN S;  1VQP A;  3BYY B;  2EOT A;  5IYB G;  4OGQ C;  1IHZ A;  5IGF A;  1LT3 D;  5DEH A;  3ERO A;  3K8A A;  4DPG A;  2EY1 A;  2EE1 A;  2PW7 A;  2X69 A;  1A15 A;  2F0S A;  3M4Y A;  1XNQ Q;  1K28 A;  1GUO A;  3S1Q B;  3CD6 A;  3UDI A;  2CCZ A;  2FMM A;  3SDZ A;  4C2M B;  4ME5 A;  4O42 A;  1LTA D;  1XTC D;  1XMQ Q;  2CQA A;  1JIC A;  1HUN A;  4DNT B;  1C7Y A;  2LXK A;  3IL8 A;  1BCP C;  3PGZ A;  3LWE A;  5KNC A;  5LMU Q;  2NVX H;  4CDE C;  1HA5 A;  1PRT F;  1HZ9 A;  5IYD G;  1Q81 C;  4DUY Q;  4NXN Q;  1YNN C;  3TZD A;  1AW7 A;  1D7Q A;  3AU7 A;  1BKB A;  3IAY A;  2B3G A;  4KTA A;  3MXU A;  3CW2 C;  3S2D B;  2R61 A;  5I2X A;  2BE5 D;  3BVZ A;  1UE6 A;  3S14 B;  1VQ5 A;  4A3D H;  2NVT H;  1Y14 B;  4EGV A;  5BN3 A;  4LFB Q;  1GUS A;  5FJ8 H;  1WCM B;  2VXW A;  4LUV A;  1IBK L;  1CZG A;  3V05 A;  4DK0 A;  1WCM G;  5JJZ A;  4IJH A;  4A3G H;  1LTI D;  1D5X C;  4DV0 Q;  1EIH A;  4JYA Q;  5ELF A;  1C8C A;  1U5K A;  5M5W B;  3F1Z A;  3S1R B;  5GAD C;  5M3F B;  3MA2 B;  1BBU A;  1LTS D;  1O80 A;  4FF4 A;  4YHH Q;  1KDB A;  4K8I A;  1ESR A;  4A3C H;  3S2H B;  4DU9 A;  5M3F G;  2WII B;  2ZM6 L;  3PMF A;  3MAQ A;  5I6W A;  2LMC B;  5IGG A;  3PUY A;  1U4R A;  2A5H A;  4IUV A;  1PMR A;  1MSH A;  1Y8O B;  2QEX A;  2UUC L;  2YYZ A;  3PUV A;  5G3L D;  2F0H A;  4R4Q A;  4DV2 L;  4K14 A;  2KEC A;  3OYY A;  4AH6 A;  1F2L A;  2PNH A;  4R4O A;  4B9X A;  2CKZ B;  1WJJ A;  3KFU A;  1MIU A;  1RL2 A;  4FNF A;  1KD1 C;  2K5W A;  1EUJ A;  4MN3 A;  3CC4 A;  1SDF A;  1ASY A;  4IN3 A;  2KHS A;  4DNI A;  4B9W A;  4DA2 A;  2KEE A;  5LMN L;  3H0G H;  1EWH A;  1NUC A;  2HHH L;  1MJE A;  4RKB A;  1DOL A;  1RCV D;  1W3S A;  3NXW A;  3OWF A;  4ZUI A;  3CCR A;  1IL2 A;  4BBR B;  1MI2 A;  1JWU D;  3N52 A;  5JPN C;  4RCO A;  1LTB D;  1W6J A;  4BBR G;  4HIM A;  2VQF L;  3HOZ H;  4WFN 3;  4JOI A;  1S5D D;  2BDN A;  4B3S L;  1YNX A;  2Z8L A;  4FF2 A;  3TP5 A;  1QG7 A;  1H9R A;  1KL9 A;  1YJW A;  3G4S A;  1HRJ A;  3PCO B;  4DV4 Q;  4C3J B;  4OEL B;  3J81 i;  1VDZ A;  3S16 H;  1B70 B;  3CPF A;  4AQY Q;  3J81 E;  3TS2 A;  4IUQ A;  4YWL A;  1U4P A;  1HPC A;  4DV1 L;  1MD2 D;  4C3J G;  1EYG A;  1XNR L;  4JG2 A;  2WAQ E;  2MPM A;  4G7Z C;  2O4X A;  3Q0A A;  3HGB A;  1HNZ L;  2CW0 C;  2WAQ B;  3D0F A;  2VL6 A;  1SSO A;  2F3W A;  3F2U A;  1K8M A;  1JOO A;  1UEB A;  3GTQ H;  1I6H H;  1QJO A;  3ULP A;  1A3T A;  3WOE A;  1IYU A;  2L11 A;  2F4V Q;  2RDF A;  1VQD A;  1PH7 A;  4PMC A;  2PZW A;  2K5N A;  4S3S A;  4L63 B;  1ENC A;  2L5T A;  5M5Y B;  2F0D A;  3KLS A;  2A69 D;  2JA9 A;  4WOR A;  3W2D A;  3T16 A;  4X65 Q;  2EYP A;  1I3Q H;  4H44 C;  1F2Y A;  4IUP A;  1G2T A;  5KEE A;  4P73 A;  1KAW A;  4KD4 A;  1K83 B;  3KJO A;  4DR5 L;  4HTH A;  3J80 i;  4WJ4 A;  1STA A;  2YU9 H;  3HOY B;  1MKH A;  4X62 L;  2AUJ D;  1VQ9 A;  1B50 A;  2I5H A;  2RCF A;  1DJR D;  1SMY C;  3BDL A;  5DNF A;  5GAH C;  1G51 A;  2K75 A;  1W2B A;  2E2J B;  1CA6 A;  3I70 A;  3HOY G;  3GTP H;  1JQY D;  1VCI A;  4Q0F A;  3I4N G;  2P5Z X;  2JXM B;  1EY6 A;  4JCV E;  3G71 A;  3T13 A;  5IWA L;  4A93 H;  2AQ1 B;  1AP0 A;  3NQI A;  2NZO A;  4Y7N H;  3J80 c;  1VQI A;  4A3M H;  3A8I E;  4GKK Q;  2IL8 A;  4OO1 H;  1PTO C;  4LF7 Q;  2FHT A;  1PZJ D;  2K5V A;  4UAI A;  4HMI A;  4JI8 Q;  1CT1 D;  4ZUJ A;  2FXQ A;  4LF9 L;  4X3S A;  5EAY A;  1KRS A;  5M3M B;  2NTS A;  4EVO A;  2NVY H;  1OXV A;  2XSC A;  5M3M G;  1Q12 A;  1CK1 A;  3QR8 A;  3I2Z A;  4BY1 B;  2TSS A;  2RHQ B;  3L3O C;  2L12 A;  1I4G A;  4IUR A;  1PH1 A;  1TWG B;  4FXK C;  1BVS A;  4BY1 G;  2OCE A;  2Y0S E;  1CA5 A;  1DZ1 A;  1STE A;  2R92 H;  4IUT A;  2Q8I B;  1HNW L;  4PQX A;  1HQM C;  1E2Z A;  2NZ1 D;  5COR A;  4HIK A;  2Y0S B;  5A2Q E;  2H5X A;  2CWA A;  4A3F B;  2PI2 E;  3GTL H;  4I7Z C;  4LFA L;  1SBB B;  4A3I H;  2K5D A;  2Y0S G;  1IYV A;  4A3F G;  3CU7 A;  2B2Y C;  5JVH 3;  2B2W A;  4DK6 C;  5ELB A;  5I4D A;  1N36 L;  3A55 A;  5C3E H;  4OHJ A;  4R4I A;  3NE5 B;  5E4X A;  1QZH A;  3HOV B;  1XJV A;  2MNA A;  4JBM A;  4KY5 A;  5LHY 1;  1DOK A;  5IYC G;  1A63 A;  2ALY B;  1MJC A;  3HOV G;  4DR2 L;  3BZK A;  3AB9 A;  2CH4 A;  1SNQ A;  3CC2 A;  1YHA A;  1GUG A;  1A2T A;  3G6E A;  2AWN A;  4WJW A;  4ZKC B;  1KDA A;  1S5F D;  1X56 A;  2AQ3 B;  1HQR D;  3DEO A;  3D6C A;  5C0X I;  1LYL A;  1YNJ C;  2B2V C;  2VUM B;  1VF5 C;  3AMU A;  4JI2 L;  1SJH D;  2JEA I;  4HIO A;  2VUM G;  3STB D;  5JJK A;  1DON A;  4IUU A;  1SEB D;  1WTX A;  2N3S A;  3WOF A;  1VQB A;  5GQO A;  4DV3 L;  1VQ7 A;  5J3B A;  1EFW A;  4C56 C;  5EPL A;  3I4L A;  3HFZ B;  1Q8K A;  2MP1 A;  1PH8 A;  3VR3 A;  1BO0 A;  2E8G A;  3DUZ A;  4A3E H;  1X3P A;  1JWM D;  4R9W A;  1L0X B;  1HXY D;  2R7Z B;  3HP3 A;  4DK1 A;  2E2D C;  2EXD A;  3H09 A;  4P72 A;  5G3L F;  4KHV A;  5C0X G;  4I65 A;  4B3R L;  2R7Z G;  4Z9C B;  3OTO Q;  1HR0 Q;  3KOJ A;  3A54 A;  5D3I B;  4E6I A;  2RSO A;  2JA5 B;  4MNO A;  5IGB A;  1X3G A;  2K52 A;  3E9I A;  1HFN A;  3S1M H;  1QUQ B;  2JA5 G;  2CWP A;  4IO9 A;  4IAL A;  3PO2 H;  4IPD A;  4RA8 A;  5KGU A;  1M8A A;  3BZC A;  4BXX G;  4FYD A;  3ITP A;  4LUZ A;  1FGB D;  1LM0 A;  1LT6 D;  3S15 B;  3P20 A;  4C3H H;  2EY2 A;  1Y1W H;  4ABN A;  3QO2 A;  4XQQ A;  1SNC A;  1F9P A;  2Z4I A;  2JA8 B;  4P71 A;  1I50 B;  3CCQ A;  2IY5 B;  3F2C A;  1SFO B;  4X66 L;  2JA8 G;  2UXC Q;  1N9W A;  3M3Y H;  1CSQ A;  2EYO A;  1PTO F;  1XMO Q;  1OTC A;  4A75 A;  1H9K A;  2KVM A;  2PMZ E;  3TBI B;  4OX9 Q;  3BDC A;  1S5B D;  1ZYR C;  4L5R C;  2EYM A;  1HTP A;  2ES2 A;  2WAC A;  4DV7 L;  1VMP A;  2PMZ B;  4QY7 A;  3Q23 A;  2OTL A;  1F9R A;  1YVC A;  4KHZ A;  3DEP A;  2K4K A;  1EZ6 A;  1DOM A;  1NMF A;  2GVB A;  3TDQ A;  4APV A;  3VA5 A;  1WTP A;  2HUG A;  3K0X A;  4B3M Q;  4FXG C;  1UE5 A;  2MGS A;  2R3Z A;  2VS1 A;  5HY6 A;  2I07 B;  1ZKO A;  4BY7 B;  1N32 L;  3QJY A;  1B3A A;  3CCE A;  2UU9 Q;  1EU3 A;  1YBY A;  3PIO A;  3ZJY C;  2K04 A;  4JI1 Q;  4BY7 G;  1T9H A;  4TVA B;  5IP9 H;  1VQC A;  3D3R A;  2VW9 A;  5HGQ A;  2BA1 A;  1I4R A;  3NEL A;  3K81 C;  1PZI D;  1SYC A;  2QCP X;  4PZ6 A;  2M2L A;  2JEB I;  3DXJ C;  3G7L A;  3A0J A;  4K2K A;  1E3P A;  1B53 A;  3MXP A;  1VQA A;  3CRL C;  1L0Y B;  1C9O A;  1L2F A;  1SYB A;  1UNS A;  2R6G A;  3QOJ A;  4XQJ A;  1L0W A;  2RDG A;  2MHV A;  4JI6 L;  1Z47 A;  2NN6 H;  3HOX B;  2Z0S A;  4J1M A;  3HKZ E;  4KKS A;  2YTV A;  3RZD H;  1G6Z A;  3HOX G;  5IIF A;  3VA7 A;  1N34 Q;  1OO9 B;  1FGU A;  4FDB A;  2A6H D;  4OEM B;  2J4X A;  1SNO A;  1JMC A;  3HKZ B;  2N88 A;  5DAU A;  3HOW H;  1B9N A;  1EY4 A;  1WOC A;  5C4J H;  2JA6 B;  2SDF A;  5KYL A;  4K8J A;  1W6K A;  3HKZ G;  1NNX A;  4F88 A;  1SLJ A;  3T1H L;  2JA6 G;  5M5X B;  3K5M A;  4A3L G;  1AEX A;  1A3U A;  2JK8 A;  1HNX L;  1MGS A;  1JB7 A;  2A68 D;  2F03 A;  1LTR D;  4A3B B;  1SMX A;  4HR7 B;  4A3B G;  1TWH H;  3T53 B;  5C5M A;  1CQV A;  1FNV A;  1SYG A;  5D14 A;  4PZ7 A;  5IYB H;  4A3J B;  2KQ3 A;  3TS0 A;  1BBX C;  4A3J G;  1FR3 A;  4CJ1 B;  1SNM A;  3TN2 A;  1EWC A;  2F4I A;  4UPA A;  2I5M X;  4JBK A;  1VQE A;  2F52 A;  1SYF A;  4X6A H;  4CJ0 B;  2LY7 A;  1UAP A;  3S1Q H;  4DR6 L;  3MFG A;  1GUN A;  2DJG C;  5CV9 A;  1G8Z D;  2Z1C A;  4C2M H;  4DNR B;  3NHH A;  2G9D A;  4KV6 A;  1TVX A;  1PH2 A;  4IUN A;  5IYD H;  2B29 A;  3CCL A;  3CCS A;  1E1T A;  2UUB L;  4N8F A;  2BOS A;  3I4O A;  4FP5 D;  3DM3 A;  1B8A A;  1UE1 A;  3M7G A;  1VQJ A;  3K5O A;  2NVQ H;  2LKV A;  5E7N A;  1NR2 A;  1BCP D;  4IFD I;  3RMH A;  2O2L D;  1GKH A;  3UE0 A;  1TKW B;  3KLR A;  5CR3 A;  2HDL A;  5IGD A;  4LFC Q;  1NMG A;  1ZXT A;  3WWV A;  1TWF H;  1TS2 A;  1IW7 C;  5JEA G;  2OWO A;  1K8O A;  3M4Q A;  3VYU A;  3QG1 A;  1JJC B;  3K5L A;  5AJ3 Q;  3S14 H;  4GOP B;  2HCI A;  2IX1 A;  2G5D A;  3HZX A;  4PNY A;  1PH3 A;  4AYB E;  1WCM H;  4V0B A;  3L0O A;  2K28 A;  3FP9 A;  1M1K C;  1TWC H;  3TRE A;  4KLK A;  4AYB B;  4XTC S;  3SXH A;  2KA7 A;  4HID A;  1STB A;  4O2D A;  4NXM Q;  2D9U A;  5FO9 B;  1JOR A;  4UDU C;  1O7Z A;  4U67 3;  4AYB G;  5M5W H;  3S1R H;  2BDO A;  1KQS A;  5M3F H;  3RNU A;  3OHX C;  3OOC A;  5T1G A;  3PIO 3;  1GHJ A;  2E74 C;  3S2H H;  1VMC A;  3E0E A;  1XMQ L;  4IFD G;  3P75 A;  4HSV A;  1KXL A;  4GNX A;  2OTJ A;  2KBN A;  3Q22 A;  2JJQ A;  3U58 A;  5I9P A;  2PPB C;  3CCU A;  4DUY L;  4LF4 Q;  4NXN L;  4B3T Q;  3GTO H;  1ONL A;  2SNM A;  4DAY A;  4DXF A;  4JI0 Q;  3TP7 A;  3ULL A;  5COY A;  5BR8 Q;  3KDF B;  1VQ6 A;  1E0B A;  1UWV A;  1CHP D;  2VQE Q;  3C1F A;  1C0A A;  4QQB X;  1U4L A;  4HN7 A;  3K80 C;  1VQL A;  2KCM A;  2Z6K A;  2AWO A;  1F2M A;  4IPG A;  5JVG 3;  3JAM c;  1YHB A;  1TS4 A;  2VZA A;  1EIY B;  4DV0 L;  4B08 A;  2EQS A;  4BBR H;  1O7Y A;  4JOI C;  3BS1 A;  4LF8 Q;  4RH6 A;  1QZG A;  3SK4 A;  4YHH L;  5F2D A;  4IQZ A;  1JJ2 A;  4FO2 A;  4GOP A;  1R4P B;  3KBX A;  1X6O A;  3J81 L;  4LF6 Q;  4KN4 C;  4C3J H;  5FLX c;  1U9R A;  3VYS A;  3BDO A;  1V1P B;  2K7V A;  4R1J A;  3T56 B;  2PCF B;  4MIU A;  4EQN A;  1YJN A;  1PHJ A;  5LL6 X;  5CBE E;  4JI3 Q;  2AMC B;  3Q6S A;  2BH8 A;  2XRS D;  4XIG S;  5IT9 E;  1SJE D;  2YTX A;  4L5Q A;  5IE8 A;  1Q90 A;  1J5E Q;  4RCN A;  1XPU A;  1I4X A;  4ME3 A;  3H6M A;  4UY8 C;  3RLN A;  2CHB D;  3PV0 A;  3UDF A;  3LGJ A;  4FF3 A;  5EJW A;  5D3D A;  1BXT A;  5EPJ A;  1A3V A;  4MHE A;  2WP8 J;  1YEZ A;  1EYC A;  1KAA A;  1CSP A;  5IT9 c;  3FEW X;  1QNU A;  2B63 B;  1V8Q A;  2JSO A;  3KDF A;  3C3L A;  2K01 A;  3BZD B;  3GTG H;  1D5M C;  2MJ8 A;  2B63 G;  2XRQ D;  2F0V A;  4DFA A;  4HCS A;  3K59 A;  2XIW A;  2SOB A;  1K83 H;  2NVX B;  3S24 A;  1CKM A;  1RKN A;  1FD7 D;  2FMC A;  2WV6 D;  4GS3 A;  2NYZ D;  2UUC Q;  4EX5 A;  1ET9 A;  4JBW A;  4R4T A;  4DV4 L;  2E2J H;  1B1Z A;  2BE5 C;  5GAE C;  5HGT A;  4AQY L;  1Q8I A;  4ZAI A;  3KF8 A;  1BR9 A;  2DUD A;  1LO5 D;  5EKL A;  1PTO H;  4A3D B;  1K8A C;  4DR3 L;  3UDG A;  2G9H D;  5TSS A;  3I56 A;  3PO3 H;  4A3D G;  2DNC A;  3ULJ A;  4ZKB B;  5LMN Q;  5IP7 G;  2OXP A;  4OIK A;  2HHH Q;  2ZXR A;  1KNE A;  5E3F A;  2XWJ B;  4ODG A;  1PDQ A;  2F4V L;  1KNA A;  1HTL D;  4JI7 L;  2TMP A;  2D0O A;  2NBF A;  3IKJ A;  1EQT A;  2PW5 A;  2E5L Q;  3DMU A;  3MXN A;  4QMG A;  4A3G G;  1V1P A;  2JP1 A;  3PQI A;  2IW3 A;  4BS9 A;  2B2U A;  3NTI A;  1ILP A;  5IOC A;  4P2C B;  2VQF Q;  1EY5 A;  4KJO A;  1TWG H;  3CXC A;  5A2Q L;  2B8G A;  2FJ2 A;  2KCC A;  3I4M B;  1E22 A;  2JQO A;  4B3S Q;  2F0J A;  1RTN A;  4RMF A;  4A3C G;  3PF5 A;  3I4M G;  3ICE A;  1VF7 A;  2EJG C;  1MBY A;  5M9O A;  2B2W C;  3WDN A;  5BN4 A;  2VB3 X;  4RGM A;  3TRZ A;  1TS3 A;  4DV1 Q;  1EFI D;  4QF4 A;  3D8G A;  3RN5 A;  1UE7 A;  4RFB A;  3K57 A;  1ENF A;  3J80 E;  4CDD C;  4O0A A;  4GKK L;  3HOV H;  3I4N B;  3HOU B;  3H0G B;  4L5S A;  3HOU G;  2F0T A;  4L5T A;  1D5Z C;  3GQB A;  3KBG A;  2QIL A;  4HJA A;  1XX8 A;  1K73 C;  2EY6 A;  3H0G G;  4GN4 B;  4CBV A;  1YJ9 A;  2BH2 A;  1Q46 A;  2WFW A;  1BF4 A;  5BN5 A;  1DM0 B;  2KHJ A;  3GTM B;  1F2Z A;  2VUM H;  3M4P A;  1M4V A;  3LWU A;  2F0I A;  1I94 Q;  3Q24 A;  3GTJ H;  4JPB W;  1FVI A;  1S5C D;  3E5S A;  3SE0 A;  2MQH A;  3EJI A;  1AE2 A;  2F0U A;  3M4O B;  1XWE A;  4PZ8 A;  2ASB A;  3EIV A;  2WKD A;  4DR4 Q;  2F0O A;  1WTO A;  4H7B A;  1AFP A;  4CKB A;  1WVL A;  1CHQ D;  1CTM A;  1E2W A;  1HFG A;  1HZA A;  4M1U B;  1RHP A;  1IBM Q;  1PVO A;  5HUR A;  3OW2 A;  1KRT A;  5C0X H;  1NBW A;  2V1C C;  1K3B C;  3GTQ B;  3IFD A;  4H13 C;  2QW7 A;  5CV6 A;  2Q2U A;  4QCL A;  3FKI B;  3RD4 A;  4LF9 Q;  4ZK9 B;  1LAB A;  2A69 C;  2M00 A;  3SK6 A;  2E2H B;  4DR7 L;  4A4I A;  3FKI G;  3CRK C;  1QVC A;  4OXP A;  1SYE A;  4KKU A;  1K9M C;  4BXX H;  2DJF C;  2RDH A;  4K6D A;  3M9B A;  1S72 A;  1VQ8 A;  1WFQ A;  2UXD L;  1TXY A;  3T1Y Q;  2L15 A;  1EEI D;  1CKN B;  1HNW Q;  1MSG A;  4K2L A;  4LNQ A;  2GN5 A;  4ZRZ A;  3R8B A;  1X32 A;  2JA8 H;  1I50 H;  3GTP B;  1B9M A;  1S5E D;  4JV5 L;  5C4X B;  1OXU A;  1N33 Q;  1PYB A;  3C2P A;  5D65 A;  4A93 B;  3RLO A;  4Y7N B;  5C4X G;  2JA7 H;  2R7D A;  4JW0 A;  4A93 G;  4OIJ A;  1QIL A;  4YWM A;  2IX0 A;  3IFT A;  2I46 A;  1U4M A;  4HJ5 A;  4K5V A;  2KCN A;  5CV8 A;  2SNS A;  3FPP A;  5CYU A;  4JC0 A;  1JOK A;  3K0Y A;  3GV6 A;  4JI5 L;  4CDC C;  1B2T A;  2WIN B;  2OF1 A;  2VNU D;  1F9S A;  1CM9 A;  4AIM A;  4HAE A;  2RBM A;  4J6H A;  4CDF C;  4JBJ A;  1L1O A;  3Q8D A;  2IJ0 A;  4BY7 H;  3UE1 A;  1IYJ B;  1SRO A;  4L6T B;  5I9O A;  2QF7 A;  1GVP A;  1K8G A;  2JYO A;  5IY0 A;  2AUK A;  3CQZ H;  1FJG L;  3MVV A;  1E24 A;  4G57 A;  3D4D A;  4IOA A;  1J9O A;  5CGK A;  4DV3 Q;  2EVB A;  1HUM A;  1LAC A;  2UXC L;  2QA4 A;  3FVQ A;  1NR4 A;  5KND A;  1XMO L;  3GDE A;  2A1A A;  2ZT9 C;  2A19 A;  2B2Y A;  4RWS C;  4YWK A;  3HKS A;  4DXG A;  4OX9 L;  2R93 B;  4DKA C;  2PZT A;  3ER0 A;  4QJF A;  1ILQ A;  5CV4 A;  3J7A F;  3HEJ A;  1B4O A;  1HCZ A;  1PRT D;  2JN4 A;  2R93 G;  1CKN A;  3KF6 A;  1QB5 D;  1PZK D;  5CBA E;  2F0P A;  1LTL A;  3FHW A;  1BNZ A;  1G2S A;  1YIJ A;  5CV5 A;  1LT4 D;  5K36 G;  2UUA Q;  3TP6 A;  4K5W A;  4B3M L;  5JAV A;  4JI4 Q;  3F8T A;  3STB C;  2A8V A;  1EYD A;  1V1O A;  3F2D A;  3J7A 5;  4GLX A;  4C1N K;  5C0X J;  4PG3 A;  2SEB D;  1TWA H;  1P16 A;  3EA6 A;  5CC4 A;  2UU9 L;  2H4O A;  5K5P A;  5FLM H;  4ZCK A;  5M5X H;  5A35 A;  1QE6 A;  1PFB A;  3J7Z C;  4QIW E;  1AZQ A;  2K03 A;  4YY3 L;  3I90 A;  4A3B H;  3IRB A;  2E75 C;  4RKL A;  4GN3 B;  1DCZ A;  2KHI A;  4QIW B;  2DY8 A;  2HIV A;  1I4H A;  2UXB L;  4IJL A;  4NDX A;  1Y8P B;  3A8J E;  4BWG B;  4X66 Q;  3J7Y W;  1FYC A;  4X3T A;  4L8J A;  3R2T A;  1JJG A;  3NUC A;  2IHF A;  2KCT A;  4DV5 Q;  1KIX A;  2Z4H A;  3NEN A;  2HT1 A;  1CKO A;  1ASZ A;  4Y52 H;  1VQM A;  1SE8 A;  4I7A A;  2ZTD A;  1IZ6 A;  3G48 A;  1WTR A;  1OXX K;  1C4Q A; 
#chains in the Genus database with same CATH homology
 3S2H H;  3E0E A;  4LFA Q;  1KL9 A;  3L2P A;  1XMQ L;  1YJW A;  4LF5 Q;  4IFD G;  3G4S A;  2NZH A;  4YCV A;  1SFO H;  1KXL A;  3PCO B;  1N34 L;  4GNX A;  2OTJ A;  4DV4 Q;  1N36 Q;  2KBN A;  2ZTE A;  4YCU A;  3J81 i;  3H15 A;  3S16 H;  1B70 B;  4K0K Q;  2JJQ A;  3CPF A;  1LUZ A;  4AQY Q;  3TS2 A;  1X65 A;  3U58 A;  1R9T H;  3GD7 A;  3CCU A;  4YWL A;  1YHQ A;  4DUY L;  3KLW A;  4DV1 L;  4GLV B;  4NXN L;  1EYG A;  4LF4 Q;  1XNR L;  4DR7 Q;  2K14 A;  1A62 A;  4JG2 A;  2WAQ E;  4B3T Q;  1I5F A;  3GTO H;  1EIF A;  4A3M G;  3AYH B;  4NPS A;  4OO1 G;  4DR2 Q;  1VS0 A;  1HNZ L;  4JI0 Q;  3PO2 G;  3ULL A;  3F2B A;  1WYD A;  4P74 A;  3DLL A;  3D0F A;  1VQO A;  5GRO A;  5BR8 Q;  3OTO L;  3KDF B;  1S40 A;  1HZC A;  1V1Q A;  2VL6 A;  1HR0 L;  1VQ6 A;  1UWV A;  1Y1W G;  2VQE Q;  1UEB A;  1VQG A;  3GTQ H;  1I6H H;  2UXD Q;  3ULP A;  1C0A A;  2Q2I A;  4QQB X;  2RCN A;  2F4V Q;  3AQQ A;  1VQL A;  3K80 C;  4DK3 C;  3CAM A;  2KCM A;  1VQD A;  1PH7 A;  2Z6K A;  2MO1 A;  2AWO A;  3U50 C;  4JI2 Q;  2K5N A;  4IPG A;  3JAM c;  4JV5 Q;  1YHB A;  4DV6 Q;  2VZA A;  1EIY B;  4DV0 L;  1YIT A;  2N8N A;  2JA9 A;  4EQ5 A;  4PMW A;  2EQS A;  1Q1E A;  3A74 A;  3KYH C;  4BBR H;  4X65 Q;  1I3Q H;  4JOI C;  4LF8 Q;  3RLF A;  4P73 A;  1KAW A;  2KEN A;  2WB1 E;  1QZG A;  3KJO A;  2R92 G;  4YHH L;  4DR5 L;  1JJ2 A;  3J80 i;  4WJ4 A;  2YU9 H;  2PQA A;  3H3V H;  4GNX B;  1MKH A;  4X62 L;  3CCV A;  4GOP A;  1VQ9 A;  2I5H A;  3CME A;  5GAH C;  1X6O A;  2ZJR A;  1EQR A;  1G51 A;  2K75 A;  1W2B A;  1V43 A;  4LF6 Q;  1NJI C;  3AFP A;  4GNX C;  4A3I G;  3GTP H;  3HOY G;  4H02 A;  1HJP A;  1VCI A;  4LWC A;  3U4Z A;  4JI5 Q;  3I4N G;  2WB1 G;  2UUA L;  5C3E G;  3K7A H;  4DAY B;  2E2I H;  4JCV E;  3G71 A;  5IWA L;  4C3J H;  5FLX c;  4A93 H;  4JI4 L;  2D62 A;  2NZO A;  2PI2 A;  4KHP L;  4Y7N H;  1S3O A;  2ATW A;  3J80 c;  2Q2H A;  4R1J A;  1VQI A;  4A3M H;  2ZJQ A;  3HOX H;  4GKK Q;  1HNX Q;  4B3R Q;  4LF7 Q;  3PIP A;  4DR1 L;  1YJN A;  1Q7Y C;  1PHJ A;  2K5V A;  4JI3 Q;  2AMC B;  2BH8 A;  4DUZ Q;  4LFC L;  3RZO H;  4XIG S;  5IP9 G;  4JI8 Q;  2RF4 A;  1FJG Q;  3S1N H;  2FXQ A;  2YTX A;  4NB3 A;  4L5Q A;  4UP8 A;  5IE8 A;  4LF9 L;  5EAY A;  1KRS A;  2I5L X;  1J5E Q;  4OWW B;  3UDX A;  2JA6 H;  1XPU A;  5AJ3 L;  4ME3 A;  4UY8 C;  3RLN A;  4A3L H;  3H3V I;  2Z6K C;  3I7F A;  2AHO B;  2NVY H;  3PV0 A;  1OXV A;  4QL5 A;  3UDF A;  5M3M G;  3LGJ A;  1Q12 A;  1PH4 A;  3I2Z A;  3J81 j;  2RHQ B;  2WP8 J;  4JI1 L;  1H95 A;  2BA0 A;  1YEZ A;  1PH6 A;  1PV4 A;  1PH1 A;  4BA2 I;  4DV5 L;  3S2D H;  1CSP A;  1BVS A;  2ZTC A;  5IT9 c;  4BY1 G;  2OCE A;  2Y0S E;  3KDF A;  2R92 H;  1HNW L;  2C35 B;  2JA7 G;  2N49 A;  1HZB A;  4HIK A;  1IBL Q;  3GTG H;  4DR6 Q;  2B63 G;  4GOP C;  2H5X A;  2CWA A;  2XGT A;  2F3I A;  1K83 H;  2PI2 E;  3S24 A;  1CKM A;  4A3J H;  4TQU S;  3GTL H;  4GS3 A;  2I0Q A;  4LFA L;  3RN2 A;  1E1O A;  2D0P A;  2Y0S G;  4EX5 A;  4A3I H;  2UUC Q;  4LF5 L;  4JBW A;  4A3F G;  1U0L A;  4R4T A;  3PSI A;  4DK6 C;  2DGY A;  4DV4 L;  1N36 L;  2E2J H;  4K0K L;  5C3E H;  1AH9 A;  5GAE C;  2MFI A;  4MTN A;  1WI5 A;  4R4I A;  4DV7 Q;  4AQY L;  4A3E G;  1XNQ L;  1QZH A;  3NBH B;  1XJV A;  2MNA A;  4JBM A;  1AE3 A;  1Z9F A;  2DUD A;  1M90 C;  4POF A;  1A63 A;  1E7Z A;  5IYC G;  1P8L A;  4GKJ Q;  2ALY B;  1MJC A;  3HOV G;  3CCM A;  2LSS A;  1K8A C;  4DR2 L;  3BZK A;  1FL0 A;  5DLQ E;  4DR3 L;  3UDG A;  2HQL A;  3CC2 A;  1YHA A;  5LMU L;  1EWI A;  4J15 A;  4YY3 Q;  5ELN A;  5BR8 L;  3I56 A;  3PO3 H;  1X3E A;  4A3D G;  1K0R A;  4R4C A;  3ULJ A;  5LMN Q;  2VQE L;  5IP7 G;  3G6E A;  2AWN A;  2K5H A;  2HHH Q;  1N32 Q;  3PUW A;  2F4V L;  1X56 A;  5GAG C;  4JI7 L;  2UXB Q;  2D0O A;  5C0X I;  1LYL A;  2E5L Q;  1J6Q A;  4X64 Q;  3JAM i;  1YI2 A;  4A3K G;  1PH9 A;  1PYS B;  4JI2 L;  4A3G G;  1VQH A;  2JEA I;  1QUQ A;  4HIO A;  4DV6 L;  4HJ8 A;  3U4V A;  5JEA J;  1Q86 C;  2VUM G;  3STB D;  1B7Y B;  2VQF Q;  1XPR A;  5JJK A;  1TWG H;  3I55 A;  3CXC A;  4LFB L;  1E22 A;  4LF8 L;  2JQO A;  4B3S Q;  4WJ3 M;  1X54 A;  2N3S A;  4A3C G;  4RMF A;  1VQB A;  2B63 H;  5GQO A;  4DV3 L;  3CCJ A;  3PF5 A;  5J3B A;  1VQ7 A;  3D31 A;  3I4M G;  1EFW A;  2K50 A;  3ICE A;  3KF8 B;  3HFZ B;  4JYA L;  4LF6 L;  1Q8K A;  1PH8 A;  3EN2 A;  5LMN W;  4QGU A;  2E8G A;  4JI6 Q;  3TRZ A;  4A3E H;  4DV1 Q;  3RR5 A;  2MO0 A;  1VQF A;  4A76 A;  3BU2 A;  3RN5 A;  1UE7 A;  5H1S E;  1X9N A;  1BBW A;  2EXD A;  4P72 A;  4IFD J;  4O0A A;  4GKK L;  3HOV H;  5C0X G;  1VQK A;  2YTY A;  5FLM G;  3S17 H;  4B3R L;  2R7Z G;  3OTO Q;  1HR0 Q;  4UP9 A;  4OWX B;  4JI3 L;  4L5S A;  3KOJ A;  4BBS G;  5C44 G;  3HOU G;  4DUZ L;  4L5T A;  2VY3 A;  3TEH B;  5IP7 H;  4HJA A;  1QVG A;  3AEV A;  2NN6 I;  3T1H Q;  1X55 A;  4MNO A;  4OON A;  1K73 C;  2JE6 I;  3H0G G;  3MXN B;  4GN4 B;  4GN5 A;  1X3G A;  2K52 A;  3E9I A;  1YJ9 A;  1J5E L;  2BH2 A;  3S1M H;  1QUQ B;  1GD7 A;  2JA5 G;  2CWP A;  1Q46 A;  4IO9 A;  2OQ0 A;  4GLA C;  3PO2 H;  4P75 A;  2WFW A;  4A3K H;  4IPD A;  1VQN A;  3JC6 6;  2ID0 A;  4IPH A;  3BZC A;  1Y1V G;  4BXX G;  3CP0 A;  2KHJ A;  4LUZ A;  1LM0 A;  1EOV A;  2ZJP A;  4C3H H;  1NTG A;  3M4P A;  3PUX A;  1Y1W H;  3CPW A;  2VUM H;  3CC7 A;  3GTK H;  3VDY A;  5ELO A;  3CMA A;  1I94 Q;  3GTJ H;  2IT1 A;  4P71 A;  1FVI A;  1IBK Q;  4UP7 A;  2MQH A;  3CCQ A;  1AE2 A;  2IY5 B;  3BJU A;  3F2C A;  3I4M H;  4C3I H;  1NE3 A;  1IBL L;  4X66 L;  1A0I A;  2JA8 G;  2UXC Q;  1N9W A;  4PZ8 A;  5JJL A;  1EQQ A;  3M3Y H;  1CSQ A;  2ASB A;  3EIV A;  1XTD A;  1HR0 W;  3NEM A;  1XMO Q;  1OTC A;  4DR4 Q;  4A75 A;  2PMZ E;  4OX9 Q;  3B6Y A;  1HH2 P;  1YZ6 A;  1KHI A;  1SR3 A;  5M5Y H;  1A8V A;  4L5R C;  4NXM L;  2ES2 A;  4DV7 L;  2NN6 G;  3KJP A;  2ZM6 Q;  4QY7 A;  4KHP Q;  1Q82 C;  1SRU A;  1HZA A;  1OXT A;  1IBM Q;  1PVO A;  2OTL A;  3OW2 A;  1YVC A;  4KHZ A;  1KRT A;  1PA6 A;  4DR1 Q;  1NBW A;  2V1C C;  2K4K A;  4GKJ L;  3HOY H;  1NMF A;  4LUO A;  2GVB A;  2N78 A;  1N8R C;  1PH5 A;  4APV A;  1G29 1;  4DV2 Q;  1VQ4 A;  3I4N H;  4BBS H;  2HIX A;  3K0X A;  5C44 H;  2Q2T A;  2Q2U A;  2UUB Q;  4B3M Q;  1QVF A;  2R7F A;  1UE5 A;  3HOU H;  3HOW G;  4LF9 Q;  2EIF A;  2VS1 A;  5HY6 A;  4KI0 A;  4IPC A;  1X3F A;  4ALP A;  4LF4 L;  4DR7 L;  1JE5 A;  1N32 L;  4A4I A;  3FKI G;  1QVC A;  4OXP A;  4B3T L;  3CCE A;  2YV5 A;  2UU9 Q;  3W1G A;  1K9M C;  1YBY A;  3PIO A;  3ZJY C;  1Y1V H;  4JI1 Q;  2E5L L;  4POG A;  4BY7 G;  4X64 L;  4JI0 L;  4BXX H;  1D8L A;  1T9H A;  3M9B A;  4TVA B;  5IP9 H;  4HJ9 A;  1VQC A;  1S72 A;  1VQ8 A;  3W1B A;  1WFQ A;  2VW9 A;  2GVA A;  5HGQ A;  1K3R A;  1TXY A;  3GTM H;  3T1Y Q;  2L15 A;  2UXD L;  2BA1 A;  2OQK A;  3NEL A;  2IHE A;  1CKN B;  5FJ8 G;  1HNW Q;  3K81 C;  3A5U A;  4PZ6 A;  1VQP A;  4MZ9 A;  4LNQ A;  2GN5 A;  2JEB I;  5M3M H;  5IYB G;  2JA8 H;  1I50 H;  3A0J A;  1E3P A;  2LXJ A;  4JV5 L;  1VQA A;  3K8A A;  4DPG A;  1OXU A;  1N33 Q;  1PYB A;  4BY1 H;  4YCW A;  4HJ7 A;  1L2F A;  1C9O A;  1RIP A;  2R6G A;  4LW1 A;  4X65 L;  1L0W A;  3RLO A;  1XNQ Q;  4JI6 L;  1Z47 A;  1O7I A;  3AFQ A;  5C4X G;  2JA7 H;  3L7Z C;  3K7U C;  3UDI A;  2R7D A;  2Z0S A;  2CCZ A;  3CD6 A;  2XTI A;  1KC8 C;  4A93 G;  1PFS A;  4YWM A;  2IX0 A;  1Q1B A;  3HKZ E;  2YTV A;  3RZD H;  1XMQ Q;  3HOX G;  3ERS X;  4HJ5 A;  1JT8 A;  1N34 Q;  4FDB A;  1FGU A;  2LXK A;  4DR3 Q;  1CUK A;  3PGZ A;  4A3F H;  1C7Y A;  1DGS A;  1JMC A;  3SGI A;  5LMU Q;  2NVX H;  3HOW H;  1WOC A;  4JC0 A;  5C4J H;  3J81 c;  1HZ9 A;  5IYD G;  1Q81 C;  4JI5 L;  4DUY Q;  2WAQ G;  4NXN Q;  1XNR Q;  3HKZ G;  2VNU D;  1SLJ A;  4AIM A;  3T1H L;  3FKI H;  2JA6 G;  3PF4 A;  4JI7 Q;  1D7Q A;  1BKB A;  4A3L G;  4JBJ A;  1L1O A;  2B3G A;  3Q8D A;  5IYC H;  1HNZ Q;  1OXS C;  2JK8 A;  2RHS B;  1HNX L;  3CW2 C;  2E2H H;  4BY7 H;  3UE1 A;  1IYJ B;  1JB7 A;  4LF7 L;  3M7N A;  1SRO A;  1UE6 A;  1GVP A;  1VQ5 A;  1K8G A;  4A3D H;  5IY0 A;  1SMX A;  2NVT H;  3CQZ H;  4JI8 L;  1Y14 B;  4A3B G;  5JJI A;  1TWH H;  1FJG L;  1E24 A;  4LFB Q;  5FJ8 H;  4DAM A;  1XPO A;  4IOA A;  1I94 L;  4LUV A;  3MEF A;  1GM5 A;  1NY4 A;  4PZ7 A;  5IYB H;  4DV3 Q;  1IBK L;  3TS0 A;  1WCM G;  2QGQ A;  4IJH A;  4A3G H;  2CFM A;  4DV0 Q;  2UXC L;  3TQY A;  2QA4 A;  4A3J G;  4JYA Q;  2CQO A;  1U5K A;  1XMO L;  4DR4 L;  3F1Z A;  1G6P A;  3GDE A;  2A1A A;  4YWK A;  2A19 A;  5GAD C;  3HKS A;  1BBU A;  4OX9 L;  4UPA A;  2I5M X;  3HOZ G;  5C4X H;  4JBK A;  1VQE A;  4DKA C;  4QJF A;  3ER0 A;  4YHH Q;  4DR5 Q;  2F52 A;  4A3C H;  4X6A H;  3CF5 A;  5M3F G;  4X62 Q;  2ZM6 L;  4OWT B;  3S1Q H;  2R93 G;  1IBM L;  1CKN A;  4DR6 L;  3KF6 A;  4RG1 A;  3PUY A;  1V9P A;  4C2M H;  3M4O H;  1LTL A;  3FHW A;  1YIJ A;  2QEX A;  1PH2 A;  2YYZ A;  2UUC L;  3PUV A;  5K36 G;  2UUA Q;  4R4Q A;  5IYD H;  4DV2 L;  2B29 A;  3GO5 A;  3CCL A;  3CCS A;  1E1T A;  2UUB L;  4B3M L;  1L1O B;  5IWA Q;  3PO3 G;  4JI4 Q;  3F8T A;  3I4O A;  3STB C;  2A8V A;  3OYY A;  3F2D A;  3J7A 5;  4AH6 A;  3DM3 A;  1B8A A;  4GLX A;  1UE1 A;  1VQJ A;  1L1O C;  2AKW B;  5C0X J;  2PNH A;  4PG3 A;  1SN8 A;  5E7N A;  1TWA H;  1P16 A;  2NVQ H;  4R4O A;  4IFD I;  2UU9 L;  5FLM H;  1GKH A;  2CKZ B;  3UE0 A;  1WJJ A;  2R7Z H;  5M5X H;  1MIU A;  1RL2 A;  1KD1 C;  3KFU A;  1EUJ A;  4LFC Q;  3A5Z B;  3CC4 A;  1NMG A;  3J7Z C;  3WWV A;  1ASY A;  1TWF H;  3EBE A;  4QIW E;  4YY3 L;  5JEA G;  2OWO A;  4DNI A;  4A3B H;  3M4Q A;  3W5O A;  3IRB A;  1JJC B;  2PQA B;  3H0G H;  3PUZ A;  5AJ3 Q;  5LMN L;  3T1Y L;  3S14 H;  4GOP B;  2HHH L;  4GN3 B;  2IX1 A;  2KHI A;  2JA5 H;  1MJE A;  1W3S A;  1PH3 A;  2HIV A;  4AYB E;  4OO1 I;  2UXB L;  4IJL A;  3E9H A;  1WCM H;  4X66 Q;  3L0O A;  1GO3 E;  3FP9 A;  3CCR A;  1M1K C;  1TWC H;  1JJG A;  1IL2 A;  2IHF A;  2KCT A;  3TRE A;  4DV5 Q;  4IOC A;  1KIX A;  4KLK A;  3M85 A;  4XTC S;  3NEN A;  2HT1 A;  1CKO A;  4HID A;  1N33 L;  4O2D A;  3S15 H;  4NXM Q;  4BBR G;  4HIM A;  2VQF L;  1ASZ A;  3HOZ H;  4Y52 H;  4JOI A;  4AYB G;  3KF6 B;  5M5W H;  4BA1 I;  3S1R H;  1VQM A;  1SE8 A;  1YNX A;  5M3F H;  3RNU A;  1KQS A;  4B3S L;  2ZTD A;  1IXR A;  1IZ6 A;  2R93 H;  3G48 A;  1OXX K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...