1RJTA

Nmr structure of cxc chemokine cxcl11/itac
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
73
structure length
73
Chain Sequence
FPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSNNCDKIEVIITLKENKGQRCLNPKSKQARLIIKKVERKNF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cytokine
molecule keywords Small inducible cytokine B11
publication title NMR structure of CXCR3 binding chemokine CXCL11 (ITAC).
pubmed doi rcsb
total genus 7
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2003-11-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1rjtA00
2KEEA 4ZKBB 4HSVA 1A15A 1KNEA 2DY7A 5E4XA 1DOKA 4ZLTF 3F2UA 1EQTA 5EPKA 2R3ZA 2Q8RE 1HHVA 1BF4A 1VMCA 3N52A 5COYA 2H1EA 3DEOA 5D65A 1ILPA 1QNKA 1MSGA 2K1BA 1HUNA 2MPMA 2EPBA 2DY8A 4R8IA 1WTVA 3I91A 2CVRA 5E4WC 4CJ0B 1CA5A 1X3QA 1WTXA 1F9SA 3G7LA 2FHTA 2RVLA 2B2UC 1NR2A 2B2WA 4CJ2C 1ICWA 1XX8A 3GV3A 1IL8A 1ESRA 2L12A 2X69A 4DN4M 5CBAE 2J7ZA 4ZAIA 4XDXA 2HDLA 3TN2A 1BO0A 4IUVA 1NCVA 2L4NA 5DNFA 1JE4A 1BBXC 3FPUB 1IKLA 1F9QA 4RWSC 1BNZA 1WTWA 2B2YC 3I3CA 5EKIA 1LV9A 3P7JA 1B4OA 3I8ZA 2MP1A 3R93A 4CJ1B 5JJZA 3SVMA 2RA4A 4XT1B 1WTQA 1HFNA 1NAPA 1RJTA 1U4MA 2X6LA 1PFBA 1DZ1A 4OIKA 2L11A 1CM9A 1G91A 2SDFA 4RAUC 2JYOA 1RHPA 2KECA 4HCSA 1G6ZA 1O80A 4XT3B 4O42A 4R9WA 2B2VC 2KEDA 1TVXA 1GUWA 1RTOA 2K05A 1S4ZA 1VMPA 1DOMA 1J9OA 2NYZD 4X3TA 5CMDA 2RSNA 2K28A 1U4LA 1PLFA 2EOTA 2FFKB 5EPJA 2D9UA 2FINB 1G2SA 2M2LA 1WD0A 1B50A 1Q3LA 4IUPA 2HDMA 4ZK9B 3LWEA 1WTOA 1O7ZA 1HFGA 3MWYW 4IUQA 1WD1A 2NZ1D 1DONA 1E0BA 2HCCA 4RA8A 4UAIA 3I90A 2BDNA 5T1IA 1B53A 2B2UA 2B2TA 2RSOA 5CORA 1QG7A 4ZKCB 1J8IA 2N55A 1HUMA 1M8AA 2B2WC 3MTSA 2Q8TA 1HA6A 1SDFA 5EJWA 3FDTA 1F9RA 1B3AA 5EPLA 1EL0A 1EIGA 1AZPA 2B2YA 2L9HA 3DEPA 1MGSA 2HCIA 2MJ8A 4NW2A 1MSHA 2JP1A 2NWGA 3UI2A 1PFMA 5D14A 4HAEA 1O7YA 3GV6A 3D6WA 1WTPA 2MGSA 2HUGA 3HP3A 3KUPA 1JICA 1U4PA 2K03A 5CBEE 1B2TA 1PFNA 3QO2A 2B2VA 1U4RA 1SAPA 1EIHA 1ILQA 2EE1A 2KOLA 2VXWA 1AP0A 3H91A 1KNAA 3KBXA 2N88A 2KUMA 4MN3A 2FMMA 4IURA 4X3KA 1NR4A 1DOLA 1IKMA 4QUCA 4HEDA 4LMQD 2X6GA 1X3PA 4IUUA 1QE6A 1CA6A 1WVLA 1WTRA 1C8CA 5EQ0A 1AZQA 2K04A 1G2TA 1RTNA 5AFWA 2K01A 4QUFA 2L1BA 3DM1A 1SSOA 2XIWA 3IFDA 4U68A 2KVMA 2FJ2A 4IUTA 2B2TC 3IL8A 1RODA 3Q6SA 4OIJA 4X3SA 1F9PA 1ML0D 1PDQA 1XYIA 2IL8A 1EOTA 3TZDA 1F2LA 1ZXTA 1MI2A 3ONAB 4X3UA 1HRJA 4MHEA 5T1GA 1X32A
chains in the Genus database with same CATH superfamily
1W6JA 1V1QA 2DY7A 3MEFA 3VR5A 1I94Q 1HZCA 1CHPD 1B1ZA 1FVIA 4UDUC 1GVPA 3BZCA 3AFQA 1MSGA 3TSSA 2YV5A 5D3IB 1PA6A 3BYYB 1I50H 2CVRA 5FO8B 1S40A 4K14A 2KHSA 2H4OA 1WOCA 3QG1A 1EEFD 3DWPA 3HOUB 1VQNA 4H44C 1ESRA 4MNOA 3MXGA 3HOZG 3CRKC 5K36G 1L0YB 4FF3A 1WYDA 4I65A 4DV6L 4KI0A 4A4IA 3Q0AA 2UXBQ 4KY7A 4R1JA 1DZ1A 2RKSA 3HKZG 3D3RA 1Q86C 4C3HB 1RDPD 4HMJA 1XWEA 1D5ZC 4DV0L 5C44H 1IBKQ 2D0PA 4RHRA 2F0OA 2ZJQA 3K80C 1C0AA 4X3TA 4OL7A 4BBRB 4JI5Q 1PZKD 4TKOB 4ZK9B 3CC2A 4LFBL 4IOCA 3PV0A 3OIQA 3IAYA 3NQIA 4LW1A 4DUZL 5DLQE 2IX1A 3RR5A 3MTSA 5JVH3 3KJOA 3K58A 3KBGA 5I4DA 1XXGA 1VDZA 2F0LA 3D8GA 2EYHA 3DEPA 1CZGA 2Z4IA 4B3SQ 3NBHA 3HOVG 2E2HB 3J7YW 4OGQC 2K03A 3U9OA 2RDHA 2VL6A 3SR1A 2ZXRA 3ZYYX 1LTLA 1GUGA 4DR5Q 4C3IH 2BA0A 3KBXA 4IURA 2F0HA 4UP8A 4QGUA 1I5FA 1FYCA 1WVLA 3L3OC 1CSQA 5AFWA 4O2DA 5GROA 4A3BG 5DAUA 2XIWA 1KC8C 1DM0B 4OIJA 5CR3A 4DUYL 3BU2A 2K6AA 2IWHA 2VNUD 5CYUA 1KRSA 3QR8A 1CKMA 1NMGA 2UUCL 1I4HA 1EQVA 1EY5A 3A55A 4YCUA 3GTKB 5IYCG 4A3FB 3VR3A 2EYPA 5ELEA 1VMCA 1HXYD 1E2VA 4HJAA 1RKNA 1J5EL 4JI0L 4IFDI 1QOHA 4HCEA 4IPGA 4POFA 4FDBA 4CDCC 4PQXA 1SNDA 1JORA 3NSWA 1IYUA 4DN4M 5C3EH 1BOSA 1H9RA 2NVQH 1BO0A 1F77A 1HQRD 3NTKA 1SNPA 1E2WA 1LTGD 1W6KA 1XJVA 1KD1C 2K33A 1OXXK 3E9IA 4B3ML 2E2IB 5BN3A 1NAPA 4JW0A 2PW5A 3I4LA 3DWQA 4OIKA 1A63A 3FHWA 3K7AH 3H0GB 3EVQA 4YHHL 4A3MH 1G6ZA 4O42A 4DK3C 3WDNA 4HSPA 4X62L 5M5WH 4WFN3 4KY5A 1VMPA 1U0LA 5DM73 1LTAD 2KHJA 1GO3E 1JR0D 4R4QA 5I6YA 4DXFA 1N32L 3J80L 4OHJA 2F0DA 3I90A 2BDNA 3PMFA 4JI1Q 2B2TA 5I2YA 4GNXA 1A0IA 1XMQL 3M4OH 3E9HA 5EPLA 1QVGA 4EX5A 3OPOA 3EA6A 5I9OA 1I3QH 2CCZA 5ELCA 1SEBD 3BJUA 1Z9FA 1JICA 1WTHA 1PFNA 3CQZB 1LYLA 4MTNA 4A93H 4J8QA 1PYWD 3VR6A 5KRUA 1OXSC 2PQAA 1JOQA 2JQOA 5A2QE 1EY9A 3RLNA 2GVBA 1DOLA 3D6CA 3GTPH 2I07B 3R8BA 1EZ8A 2K5DA 2Z9HA 4R4OA 5C5LA 3SGIA 1SSOA 4ODGA 2R93G 5IOCA 1M90C 2IL8A 4MZ9A 2WINB 5IP7H 1PTOH 1E3PA 4LJZC 1D8LA 5E1FA 3KDFA 4K0KQ 5M3FB 2ZJRA 3F2UA 4JBWA 2B63B 3NBHB 4EQNA 3FP9A 1YHAA 1XTDA 1PYBA 3A8IE 1CKNA 3CU7A 1O7IA 2ALYB 2K1BA 3A7AB 3F2BA 4KHPL 2I0QA 3GDEA 2JA5H 2VUMB 2RHSB 1F9SA 1TY2A 4TQUS 4DR3Q 2EYLA 4HIKA 3JAMi 4A3GH 1K3RA 3S1NH 4LUZA 2KCCA 1Y1VG 2MNAA 1BBXC 2E8GA 3TS0A 4ID6A 1LV9A 1RJTA 1SE3A 4JI2Q 4CKEA 4P73A 3OTOQ 2CW0D 3S9WA 2SNSA 1II3A 2PO4A 1K8MA 1SRUA 2WAQE 4CDDC 2F0QA 3LGJA 1K0SA 2D5DA 4JBJA 3HOUH 3K0YA 4OX9L 3K5MA 3M4PA 2WB1G 3BDOA 5T1IA 1JOKA 4G4KA 4B3TL 5KEEA 4YWLA 4DFAA 4DK0A 2B2WC 3I73A 5IT9L 5EBDA 4LF8Q 4AYBG 4L8JA 4X66Q 1OTCA 2A5HA 2DUDA 3PO3G 4HTHA 4C3HH 2IY5B 1R4PB 4JG2A 2A6HD 4YIJA 3KF8A 4UY8C 4ZYSA 1WTPA 5C4XG 2H5XA 1EYCA 3H15A 1WCMB 3TRZA 1U4RA 4BBRH 1K8OA 2KOLA 4H0LC 1HPCA 1G291 2VZAA 2CWAA 1A62A 1ONLA 3I2ZA 1HR0Q 5K5PA 3V05A 2KUMA 2F52A 3KF6A 4ILWA 1QE6A 3WWVA 1DXMA 4HIDA 2L1BA 3ICEA 2VB3X 3OWEB 5M9OA 5I2XA 1GHKA 4NXNL 4YY3L 1YNNC 4EQPA 1VQ6A 1YJWA 1N34Q 2E2HH 1HRJA 3CCSA 2WV6D 3E0EA 3MVVA 5T1GA 2N3SA 3OHXC 3NTHA 3IRBA 1Z7TA 1DOKA 1PH2A 4BXXG 4IZ8A 3GTMH 5IWAQ 1JT8A 4EGVA 1VQDA 4RKLA 3F2CA 1H95A 1I50B 3NBIA 4DR1L 3DM3A 4U673 4R8NA 1UUPA 3L7ZC 3PIPA 5CV5A 2E74C 3I4MG 2R7ZB 4CKCA 2UUAQ 2F0SA 1IL8A 1Y1WG 2L0CA 4Y52H 4OWWB 1GUNA 2HDLA 4JYAQ 4BWGB 4IO9A 3C46A 4R4IA 1BNZA 2HHHQ 3HKZE 5L37A 1SN8A 3CCEA 1STEA 3Q8DA 5KYIA 4DV3Q 3GTKH 5CV8A 3PIO3 1RHPA 2CWPA 1ESFA 4GS3A 3KDFB 3MEHA 4K2LA 1MJCA 3T51B 3HKZB 1DD2A 2CQOA 5CGKA 4BBSG 2ASBA 1D7QA 1IBLQ 1MKHA 2K5QA 2D9UA 2PMZE 1X3FA 5GAGC 1ET9A 5C0XJ 4FP5D 4G7ZC 1PH9A 3C1EA 1HR0W 1I6HH 2JEAI 2Q8TA 2PCFB 2PMZB 2KBNA 4DR6L 4KTAA 1RCVD 2PZUA 2E2IH 1B3QA 2JK8A 4XQNA 1MGSA 3H0GH 1GM5A 3UI2A 1L2FA 3ULLA 3T1YQ 3L9AX 1XTCD 1EYDA 2LSSA 4RCOA 2HIXA 1STYA 4J6HA 4OO1H 4DV1L 4FF4A 4JK1C 3DWAA 3W1GA 3T4AC 1WI5A 4NDXA 4GKKQ 1YITA 4RKBA 1S3OA 1MD2D 1PHJA 3QB3A 3TZUA 4ME5A 2KVMA 3RZOH 1VQBA 4ZQ3A 1LABA 3EJIA 5H1SE 1JB7A 2EYMA 2NZOA 4RCNA 2ZXPA 3U4ZA 2JA8H 4FO2A 3S16H 3MXPA 2Z1CA 3TREA 3CW2C 1TKWB 1ILPA 4QMGA 4HR7B 2NB0A 1CZWA 2F4IA 3Q24A 2E5LL 1F2MA 2PQEA 3HOYB 1D1IA 5C6AA 5C3EB 1D2BA 1PTOC 1LO5D 4HJ5A 2L12A 2NVQB 2FMCA 2X69A 1I6VC 2PNHA 1QB5D 3HOWB 3TN2A 3NE5B 3J7AV 4PMWA 2LMCB 4RWSC 1WTWA 4CJ1B 5M3FH 4GN4B 2EXZA 1TS4A 5AJ3Q 3K7AB 1CTMA 4JI4L 2IHFA 5M5WB 4EQ5A 2UU9L 2VQEQ 1TVXA 3T16A 5IGCA 4IALA 1J9OA 2OEOA 4AQYL 2VUMH 5JJKA 1U9RA 4IFDH 1SNOA 4KJOA 3PO2G 1KLUD 3KYHC 4NXMQ 1EQQA 1SMYD 1TWHB 4DV2Q 1LT4D 3A8JE 3BDLA 3NELA 3D4DA 3HGBA 4J1MA 2QDLA 2NBFA 4PG3A 1XPUA 1X54A 2HUGA 2HIVA 3J81i 5CBEE 3R2TA 3UDGA 2JA7B 3CC4A 2QF7A 2EXDA 1CHQD 1HQMC 4FXKC 1XNRL 3GTPB 4L5RC 3KOJA 3T53B 2EY1A 3NPPA 2ENBA 4PNYA 5E3FA 4I7ZC 3OWFA 4WJ4A 2KHIA 4A3EB 3U9SA 2EDGA 4R4CA 4CBVA 1ASYA 1NE3A 4UPAA 4QCLA 3JAMc 4U68A 1SJED 4DAYA 4NP5A 2Y0SG 1VQOA 3CD6A 2F03A 1PTOB 1L0XB 1A3TA 3TZDA 1YNJD 3BVMA 2F0FA 1YNXA 2VQFL 1PH7A 4XXEA 4UP7A 1FGUA 2QA4A 1A15A 1KNEA 3D31A 1UAPA 4P72A 5CV6A 1G6PA 1KTKA 3TP6A 1GXDC 5JEAG 1I94L 3HOXG 3I4OA 2A19A 5GADC 4A3LG 1EU3A 1WTVA 1GD7A 2RVLA 4BA2I 4K8IA 3MZ5A 1SR3A 5IT9E 3FKIG 3AU7A 3S1NB 1AE2A 3KLSA 1PH8A 1QUQB 4ZAIA 4ZUIA 2ZTCA 1FD7D 5JAVA 2LXJA 1HJPA 3NP8A 1Q12A 3SDZA 2JA6G 4LF6Q 3I3CA 3DLLA 4RGMA 4BY1B 1AN8A 3I4NG 1A8VA 2YU9B 3HEJA 3EBEA 1CSPA 4NPSA 4KKTA 1K3BC 1PVOA 1EOVA 1OO9B 3ULJA 3GTGB 2O5JC 2WB1E 1MHWC 4DU9A 1HNWL 2R7ZH 4JI5L 1C7YA 1A6XA 2UXDL 5FLXL 4PZ6A 2NN6H 4AYBE 3JAML 5FJ8G 1IL2A 5E7NA 3EROA 3HOZH 2QEXA 3FDTA 1PH6A 3VDYA 3E0JA 1N33Q 1V9PA 2L9HA 3AFPA 4GLVB 3UE0A 4KV6A 1UE1A 2F0EA 4A3KG 2MGSA 3ER0A 4B9WA 1HNXQ 4B3SL 4OO1I 4ABNA 2WIIB 2Z6BA 3HG9A 4M1UB 1LTTD 5C44G 4LAAA 1AE3A 4DR5L 1BCPB 1NJIC 1PTOF 4HEDA 2X6GA 2F0IA 1V1PB 1BCPD 5EQ0A 2Z6KC 3C3LA 5HGTA 3NEMA 3WOFA 4BY7B 4IUTA 3IL8A 5IP9H 1AW7A 2HQLA 5EKKA 1JCKB 1ZXTA 1MI2A 3K5OA 1PMRA 4A3DB 1L1OA 1X32A 2IJ0A 3SE0A 3GQBA 4C3JB 3GTMB 5EPKA 3O13A 3VYTA 2Q8RE 1HHVA 1KL9A 3S1QH 4LFCQ 2G9HD 4DV0Q 4HJ8A 2ZM6L 2IW3A 5ELOA 1O7LA 1F2ZA 5M3MG 1QILA 5EKLA 1V43A 2CHBD 3FVQA 4L5TA 4DA2A 4C3IG 2N78A 3CCQA 4FF2A 1KABA 5ELNA 5CBAE 4A3CH 2J7ZA 1OXTA 1BKBA 1P8LA 5CC4A 3R3OA 3R93A 4DAYB 4DR7Q 4K5WA 1L0WA 3RMHA 2X6LA 3SK8A 4JVZA 4GLXA 1YHQA 1JC7A 4GZYC 4JBKA 4R9WA 5IYCH 4S3SA 2IPKD 4LFAQ 2K28A 2FFKB 5C3XA 1PRTD 3CCRA 3HOYH 4KJNA 1Q3LA 3NUCA 4MTKA 4HJ7A 4RGNA 1HFGA 1EWIA 4IUQA 1WD1A 2R92B 1I6HB 3HOWH 2K5VA 5C4ZA 4JI1L 2BCOA 1HA6A 1AH9A 2QW7A 1LACA 4O1NA 5IGFA 2D62A 2AHOB 3EFXD 1B3AA 4A3IB 3SXHA 5IYDG 4DUYQ 1L1OC 1IYVA 4ULLA 1XPOA 1B44D 2EJMA 4RFBA 4G7HC 3IFTA 1ENCA 4WRDA 2BA1A 1T9HA 3OMCA 2YTVA 2JJQA 3CP0A 1SYDA 2MO1A 4P75A 4A3MG 1VQ5A 1V8QA 4QF4A 3K59A 1ENFA 1TWHH 1J5EQ 1S72A 1SNMA 1N8RC 3H3VH 3CCLA 2C9OA 1X3PA 2A69D 1SJHD 2QKIC 2CW0C 1Q82C 1C8CA 1FJGQ 1ICFB 2K01A 4XQJA 3M3YH 3RZOB 2I5MX 4LF9Q 5C0XG 1Q90A 1UWVA 3G6EA 3Q6SA 1RODA 5CV4A 5JEAJ 1HZBA 4G57A 1G8ZD 3OW7A 5LMNL 3JC66 2D0OA 5C4HA 2A74C 2JA8B 4HSVA 4B3MQ 1K8GA 2JA7H 3S16B 4IUNA 4F87A 4K0KL 3N52A 2K32A 2H1EA 2JEBI 4DV4Q 4M8AA 3BS1A 3M7GA 3D4RA 4JV5Q 4A3EH 2XVSA 1JQYD 4CJ0B 4A93G 3K81C 2A6HC 2MO0A 4IPHA 2KENA 1K0RA 2B2WA 1VCIA 1N32Q 3HFZB 4L6TB 5J22A 1VQEA 3ZJYC 4LF5L 1RIPA 3M7NA 2R93H 4XIGS 1N9WA 3CMAA 4C1NI 3PIP3 3K5NA 3G48A 1SE2A 2EYJA 1H9SB 2KECA 4JI2L 3AEVA 4RH6A 3QIAA 5IP7G 1L1OB 4XYOA 5GAEC 3GTLB 1STAA 3J81c 1RTOA 1NNXA 1S5CD 1RL2A 1KDAA 4K8JA 1DOMA 1PXUA 3UDFA 2YTXA 3OOCA 4N9PA 1U4LA 2NN6I 4I7AA 1WD0A 1IZ6A 5EPJA 1G2SA 5JPNC 1B50A 1LTID 3ERSX 4IUPA 4LF7Q 4NB3A 1TR5A 2E76C 2CFMA 4OXPA 1Q8IA 3NWTA 3A5UA 1UE6A 4X65L 4A3JG 1PH4A 4BY1H 1SLJA 1F9RA 4A3GG 4LF8L 2YU9H 2NVTB 4X66L 1S5DD 4NMZA 3T1HQ 4KLKA 2G5DA 2ZJPA 1VQFA 1B2TA 1IXRA 3GTGH 2B2VA 1VS0A 2C5CA 1AP0A 4KKUA 3D0FA 2WAQB 2K5WA 1BVSA 2L15A 2G9DA 4LWCA 2OQKA 1BXTA 1RTNA 1HCZA 1STNA 3HOUG 1B9MA 1F9PA 1PDQA 2L5TA 4RMFA 4DR4Q 2I5HA 5J1ZA 3PO3H 3W3AA 1N34L 1VF5C 1BDOA 4GN5A 4K5VA 3STBD 3M4QA 5E4XA 5EAYA 3TS2A 5C4XH 1Y8OB 2P5ZX 4TSSA 4C3HG 1TS3A 1VF7A 2PW7A 2B39A 2VY3A 1A3VA 1B7YB 5D65A 2EY2A 5IWAL 1R9TB 2MPMA 5FLXE 4FF1A 5E4WC 3A8KE 4X64Q 3G7LA 4YWKA 3GV3A 4BY7H 1VQMA 5IYBG 5HGQA 5DNFA 2MUYA 4CDEC 4JYAL 4A3DH 1Y8NB 1WTQA 4XTCS 1A2TA 1G51A 2JA6B 4C3JH 1U4MA 3LNNA 2KCMA 1G91A 4BXXH 4DV3L 1YEZA 2V1CC 1TU2B 2K5HA 5IGDA 2B2VC 3BVZA 3G4SA 1E1TA 3S2DB 2B8FA 2PNRC 4YCWA 2EOTA 2FXQA 3A54A 5BR8Q 4LF4Q 4UP9A 1CKOA 2MFIA 2B2UA 3HOZB 3IKJA 4RHSA 1Y1WH 1C4QA 2F1MA 3VYRA 1LTSD 1HUMA 1KAWA 1SDFA 5J39A 4NXNQ 4ALPA 5D3DA 3T13A 3J7AF 1EZ6A 2R7DA 4YY3Q 3QOJA 4HN7A 3A74A 5J3BA 1MSHA 1VQPA 3CRLC 3MXUA 2LY7A 1BQQT 3HP3A 1ENAA 3P1HA 4JOIA 4A3KB 4A3FG 1ILQA 1GOZA 2EE1A 2VXWA 4N9TA 4DK6C 3H3VI 4DV7Q 2R92H 3CCMA 1S5BD 2EYFA 2AQ1B 4X3KA 4DR1Q 4TRDA 5FK9C 1GHJA 1GUOA 1W2BA 2BH2A 1E22A 5FLMH 4A3IH 1MIUA 2ZT9C 3J80i 2DJFC 1H9MA 3CPFA 1S5FD 1VQJA 2ZTEA 3EN2A 2K75A 2F3IA 3HOVB 5M5XB 1TWAB 5IY0A 4B3RQ 4JI8Q 1SMYC 3F8TA 2QCPX 4FYDA 3H0GG 3S1QB 2JN4A 2F0WA 3H3VC 1CQVA 1NTGA 1PH3A 3AB9A 1QUQA 1QVCA 1Q8KA 4HMIA 2M00A 4DXGA 1D1KA 2B2UC 5ELDA 3MA2B 4A3BB 1ZKOA 2AQ3B 1QWYA 1SNQA 3KLSX 1IBMQ 4LNQA 2Q8IB 3SK4A 5FOBB 4F7XA 2UUBQ 3FPUB 1IKLA 5JJIA 1CUKA 5LMUL 4A75A 3P7JA 4ME3A 4K6LA 3VR4A 1PV4A 1CM9A 4JPBW 2KQ3A 3CHBD 1O80A 1ZEQX 4JOIC 3J80E 2K05A 3G6JB 1I4PA 5IGGA 1YNJC 1NBWA 2FINB 3DMUA 5GQOA 4N8X1 3S24A 1XNQL 1YHBA 2NZ1D 2HCCA 1D5XC 2ATWA 3RNUA 4NXML 1K73C 1TWFB 1QG7A 3A56A 2N55A 5GAHC 4PZ8A 4DV2L 2R7FA 3HKSA 3G71A 1VQIA 1PYSB 3TBIB 3E6ZX 5JOBA 3TP8A 3J7ZC 1X65A 2XWBB 1IYJB 2BE5D 3V96A 3PUZA 3QWNA 3GTLH 1O7YA 1NMFA 5M3FG 4FXGC 3PF4A 1EY8A 4JCVE 5IGBA 2F0PA 1V1PA 2UXCQ 3QO2A 1N36L 2B63G 4WORA 2QGQA 2Z4HA 3S15B 3GO5A 3CCVA 4B08A 2N88A 1IKMA 3W1BA 4RG1A 4N8FA 4C1NK 4FVMA 2VUMG 1FL0A 4IFDG 3M3YB 2E5LQ 1RF2D 1HNZQ 4IJHA 1S5ED 1ZYRD 1BBUA 1GUTA 3IFDA 3BDCA 2NVTH 1A2UA 3BZDB 2AQ2B 1VQHA 4KMUC 1TQOA 4MHEA 4ZKBB 4DF7A 2A6ED 3ULPA 4G7OC 3CKIB 3ND8A 1VQ4A 3WOEA 3GTOB 1BF4A 3HZXA 1K8AC 1Z6HA 3CC7A 4GKJL 4QY7A 2UU9Q 1VQAA 3OIPA 3OYYA 3CCUA 3TDQA 4AQYQ 3TQYA 1Q1EA 1JB3A 2A73B 3PUWA 5KYLA 2R93B 1E1OA 2EYOA 3UDXA 2WKDA 4DAVA 4JI3L 3I56A 4DAPA 2SEBD 1XMOL 2EY5A 3KLRA 1TWGH 3PUYA 1NCVA 4O0AA 5NUCA 3E3XA 1UE7A 4DR2Q 4Y7NH 4C2MH 2RDGA 5LHY1 3LWUA 4LF6L 5DEHA 3NHHA 4KY6A 4QIWE 1BCPC 1PH1A 2D2CC 1X55A 2QEJC 1HA5A 5FO9B 2EIFA 1R9TH 5JEAH 1Q46A 4IJLA 3HOXH 1S4ZA 1X9NA 1WCMG 2O5IC 1KQSA 5BN5A 4A3LH 4UHVA 2SOBA 4QIWB 1STHA 2BDOA 3MFGA 1JJGA 3C2PA 1TS2A 2Z6KA 4OEMB 1WTOA 4JI7Q 3MHBA 1XNRQ 1TY0A 5M5YH 3S14B 3A7LA 4DV5Q 1EIFA 3FKIH 3TP5A 1UEBA 2CQAA 1J8IA 2Q2IA 1VQ8A 1Y1VB 1EIYB 2M9VA 4HJ9A 4JI6Q 2CH4W 1SE8A 3MXNA 5EJWA 2KCTA 4LUVA 2JA6H 2UXBL 4A3JB 4FXDA 4E6IA 3AMUA 3OSOA 3PUVA 2JP1A 2VQFQ 1IBKL 3S2DH 2HD3A 3FEWX 3KUPA 1EWCA 1PFSA 4PZ7A 1HNXL 3S1MB 2CH4A 4TVAB 3TMEA 1B8AA 1OXUA 2EJFC 2RF4A 5K36H 1SYCA 2WB1B 1T5EA 5CV9A 5FJ8H 2NUCA 2R7ZG 2A8VA 1GJXA 2F4VQ 3P20A 4YWMA 4AYBB 2OT2A 1XYIA 1C9OA 1X56A 2FJ2A 2XRSD 2NN6G 3RUZA 3PO3B 1EOTA 3K0XA 4IPDA 5I9PA 3CPWA 1PRTC 3BYTB 1JWUD 5C4XB 2C35B 4GLAC 4A3KH 1FNWA 1YJ9A 3K7UC 4KHVA 4C56C 2YTYA 3DEOA 4LFCL 1HUNA 4R4TA 5EGTA 3URYA 1HNWQ 3NK9A 1NR2A 5C4JB 1H9KA 1ICWA 3VYUA 3V2TA 3SK6A 2UXDQ 2OQ0A 1YIJA 1H9SA 4GOPB 4IUVA 2L4NA 4DV6Q 4EQOA 2XWJB 3HOVH 5M5XH 2F0MA 2QDBA 1TWAH 2XTIA 3I8ZA 3BG3A 3EQLC 1HFNA 1EY6A 4GN3B 2GN5A 2AWNA 5IP9G 2A69C 4DR7L 5EBCA 2DGYA 4PMCA 1EYGA 2RCNA 1K9MC 1EQRA 3VA5A 2OF1A 1JWMD 3UDIA 5JPMC 4LFBQ 2VB2X 1JWSD 1SBBB 5M3MH 1FNVA 3PSIA 5KNDA 3GTJB 4LFAL 5DM63 4V0BA 2ZTDA 3I4MB 4DUZQ 5LL6X 3MWYW 4A3BH 2ID0A 4UAIA 3KK7A 1Y1WB 1O78A 2K52A 1PZJD 1SYFA 1ASZA 1KXLA 3I7FA 2XRQD 2B8GA 1EFWA 1FGBD 4ZUJA 3RZDH 1DYQA 2PI2E 4QL5A 2KCNA 3SK5A 3J80c 3OMGA 1E7ZA 4ZCKA 4A3CG 3S1RB 4IN3A 2NVYH 2K50A 4Z9CB 3BVGA 1PRTB 1EFID 2N8NA 3DHQA 2E75C 4IFDJ 4BBSB 1AFPA 3DUZA 1X3EA 4OWTB 2ZM6Q 1Y69U 4AH6A 1TWFH 4P2CB 3U50C 1CA6A 1BR9A 1K83B 3HOYG 4L5SA 1Q81C 1LUZA 4AIMA 5C3EG 3DM1A 3H94A 1FJGL 5G3LD 3PF5A 3HOWG 2ICEC 1UE5A 1SFOB 4LF9L 5IYDH 2HQEA 1BCPF 1LTBD 4X3UA 3MXNB 2UUCQ 2CKZB 1K28A 2I5LX 4IUUA 4DPGA 2EJGC 4L63B 2IX3A 2F3VA 4KKSA 2WFWA 1EQTA 2R3ZA 3S15H 2MQHA 4JI0Q 3CCJA 1QVFA 5KIXA 1Y8PB 1TT2A 4DV4L 1CA5A 2ZXOA 4JV5L 2YYZA 2Q2TA 1Z47A 2K4KA 3H09A 4CJ2C 2EY6A 5C0XH 1F9QA 4K5XA 1P16A 1JE5A 3SHLA 3X3MA 2MP1A 3SVMA 2OWOA 3K6OA 2I46A 1HH2P 3BZKA 4YHHQ 4OWXB 5TSSA 1PFBA 3GTOH 2AUKA 4EVOA 2SDFA 4X62Q 2B29A 5KGUA 1W3SA 1CI3M 1J6QA 3QJYA 3TP7A 2N49A 2JA7G 4P74A 1HZAA 1WJJA 3NWSA 1PLFA 2EVBA 1FNUA 2DNCA 2M2LA 1TWCB 2VS1A 2PYKA 1JJ2A 3STBC 3LWEA 1DONA 3SEBA 4DR3L 2HT1A 2PZTA 3RN5A 4LF7L 1XMQQ 3PGZA 4A3EG 2RSOA 5CORA 5FO7B 1M8AA 1PRTF 1QZHA 1IW7C 1SE4A 1STGA 4RGTA 5BN4A 3K8AA 1OXVA 3I55A 5HY6A 1EEID 2B2YA 2IT1A 4OELB 4NW2A 3OTOL 4KHZA 1PFMA 2OCEA 5LMNQ 5IT9c 3GV6A 3D6WA 3T1HL 4CDFC 2V4DA 1X6OA 1EY7A 2O2LD 3KLWA 1LT3D 1EIHA 2XSCA 5G3LF 1QZGA 3PO2B 3ITPA 4FNFA 1ET6A 2FMMA 3S14H 4H02A 2JA5G 1NR4A 2JA9A 3FMCA 4LMQD 5C3WA 2XGTA 1Y1VH 1EUJA 4XQQA 5F2DA 4DNTB 4A3JH 1NY4A 2B2TC 3A5ZB 4GNXC 4LF5Q 1ML0D 5I6WA 2A68C 1LTRD 4KN4C 1YVCA 2AMCB 1Q7YC 3FRPB 1DCZA 4BY1G 4DR4L 1I4QA 2KEEA 4CKBA 1UEAB 4KD3A 4ZLTF 3S1MH 4K6DA 2IX0A 1SROA 1Q1BA 1HR0L 4KHPQ 1FR3A 1E24A 2ES2A 4DGZA 4R8IA 2Y0SE 4XYQA 4JC0A 2F0TA 4KK7A 4BA1I 3CF5A 2FHTA 2LFNA 4X64L 4QJFA 1AEXA 2RHQB 1TWGB 4XDXA 2Y0SB 4Y7NB 1QJOA 1JOOA 1JE4A 2AWOA 4C2MB 4X65Q 5JJLA 1T5XD 2B2YC 1QCBD 5EKIA 5LL6S 3J81L 3PCOB 2RA4A 3RLFA 4HIMA 1CT1D 2NVXB 2L11A 1IW7D 4HCSA 3KJPA 2OXPA 3GTQB 4H13C 1KDCA 3HOXB 3N6RA 4X6AH 1MBYA 4BBRG 4ZRZA 3JAME 5IE8A 2AKWB 2LKVA 1I4RA 3NXWA 1VQ7A 5LMNW 2KJXA 2F0NA 2GVAA 5C4JH 1TXYA 2HDMA 4OX9Q 3W2DA 5M5YB 1O7ZA 2UUAL 2EQSA 5BR8L 5ELBA 1IHZA 1E0BA 4B3TQ 4LF4L 3FKIB 2ICIA 1LM0A 3S17B 4ZKCB 5IYBH 4F8MA 2HHHL 2BOSA 3Q23A 2E2JB 2Z8LA 2TSSA 5A35A 2DJGC 2Q2UA 4BY7G 3K57A 3I4NB 3S2HB 3LX0A 1QNUA 1U5KA 1VQGA 4GNXB 2K14A 4V190 4A3DG 5D14A 4HAEA 3CXCA 1EWHA 3R2IA 3VA7A 2A1AA 2A68D 4C3JG 1YBYA 1IBLL 1SAPA 3U4VA 1EY4A 2WACA 3GTJH 3RD4A 3I4MH 3H91A 4POGA 4DV7L 2KA7A 1EY0A 1NSNS 4RGOS 3EIVA 1SXTA 4LUOA 1AZQA 3CMEA 1SMXA 4Q5VA 2PQAB 1SYEA 4NKLA 5KNBA 2Z0SA 2TMPA 3M4YA 3S1RH 1KLGD 5HURA 2J0TD 1YZ6A 1JMCA 1R4QB 4YCVA 3T1YL 1KIXA 3M9BA 1V1OA 4DNRB 4BBSH 1JJCB 3M85A 3AYHB 4B3RL 3U58A 2JSOA 4L5QA 3NENA 4JI8L 5IGEA 4JBMA 5COYA 4A3FH 2DN8A 5C44B 3D4WA 1A3UA 2DY8A 2BE5C 1I4XA 5IIFA 3I91A 3CAMA 2AUJD 4GKKL 1LT5D 1KAAA 1K83H 1X3QA 5IODA 1WTXA 3X3NA 3P75A 5C0XI 2R92G 3NQTA 3KFUA 1EU4A 3Q22A 1XX8A 1RD9D 2NZHA 3MAQA 1CKNB 2F0KA 2DNEA 1SFOH 5FKAC 1KHIA 1IBML 3TEHB 4OONA 3K5LA 5FLMG 2UUBL 1B4OA 4A3IG 1XPRA 5JJZA 2R61A 1MJEA 4RAUC 3ND9A 4IPCA 2O4XA 5KNCA 1YJNA 1ZYRC 2K7VA 4J15A 1GUWA 1B70B 1TS5A 5M3MB 2WP8J 2NYZD 5CMDA 1YNND 4CGYB 2RSNA 2B3GA 4OO1G 5JVG3 3H6MA 3DXJC 2LXKA 4KN7C 3MC0B 4C3IB 2A6EC 2L55A 4QQBX 3HS0C 4DR6Q 3VR2A 3RZDB 2WKCA 3RN2A 5ISRA 5AJ3L 1EL0A 1M1KC 1VQ9A 1LLRD 2NVYB 3B6YA 1GUSA 1WFQA 2NWGA 5CV7A 2J4XA 4F88A 2VQEL 2JA8G 1PH5A 1LT6D 3C1FA 4MIUA 1PZID 1C48A 2K5NA 2UXCL 3GD7A 4DV1Q 3CQZH 3E5SA 1TWCH 4LK1C 2F0VA 4CHTB 4DKAC 1KNAA 4Q0FA 1BBWA 4MN3A 3KF8B 3T56B 2QILA 3NTIA 3F2DA 2E2DC 3PQIA 3VYSA 2XNAC 2PPBC 3MFYA 1X3GA 1WTRA 2JE6I 2NTSA 2MHVA 4QUFA 4X3SA 1HNZL 4IOAA 3KF6B 1F2YA 2RBMA 3FPPA 5LMUQ 2BH8A 2F0UA 3J81j 4PMBA 3F1ZA 4K2KA 1VQKA 3I72A 4A3MB 2B63H 3PO2H 1CFMA 4WJWA 1QNKA 4GOPA 1SYGA 2EPBA 1TIID 3PUXA 4PV1C 3J7A5 2RDFA 2LS01 2F0GA 2PZWA 3I70A 5A2QL 1XNQQ 1BUVT 1HZ9A 2VW9A 3PIOA 4B9XA 3A0JA 3L2PA 3L0OA 3M4OB 4IQZA 1CK1A 1I4GA 4DR2L 1SNCA 4XT1B 4JI4Q 2SNMA 1Y14B 2R6GA 2F3WA 1D6EC 2JYOA 1H9JA 1SYBA 2F0JA 4XT3B 2Q2HA 1I3QB 2KEDA 4BS9A 2IHEA 3W5OA 3HRZC 1VQLA 1N36Q 4QB4A 2EZVA 4A93B 1VQCA 3UE1A 2WAQG 4RA8A 1B53A 4DNIA 4JI7L 4A76A 1STBA 5C5MA 4HIOA 4DAMA 4DV5L 1DJRD 1KRTA 3ERQA 2XN9C 2PI2A 3RLOA 3QOLA 4KD4A 1EIGA 2NVXH 1HTPA 2NTTA 1EYAA 5FLXc 1AZPA 1HTLD 4JI6L 2HCIA 1B9NA 2MJ8A 5ELFA 1NUCA 3GTQH 4WJ3M 2GA4B 2JXMB 1U4PA 1PTOD 3OW2A 1UNSA 4P71A 1GKHA 1E2ZA 4GOPC 1WCMH 2RQXA 3GP7A 1YI2A 4GKJQ 1CQFA 3AQQA 1DGSA 4QUCA 3S17H 1KDBA 4H7BA 2OTLA 2JA5B 2E2JH 2K04A 1G2TA 4DK1A 1D5MC 3J81E 1XMOQ 1N33L 2RCFA 4JI3Q 2F4VL 3I4NH 3S2HH 4A3GB 2OTJA 4APVA 1F2LA 3ONAB 1M4VA
chains in the Genus database with same CATH topology
1W6JA 2DY7A 3VR5A 1CHPD 1B1ZA 4UDUC 1MSGA 3TSSA 5D3IB 3BYYB 2CVRA 5FO8B 4K14A 2KHSA 2H4OA 3QG1A 1EEFD 3DWPA 3HOUB 4H44C 1ESRA 3MXGA 5K36G 3CRKC 1L0YB 4FF3A 4I65A 4KI0A 3Q0AA 4KY7A 1DZ1A 2RKSA 3D3RA 4C3HB 1RDPD 4HMJA 1XWEA 1D5ZC 4RHRA 2F0OA 4X3TA 4OL7A 4BBRB 1PZKD 4TKOB 4ZK9B 3PV0A 3OIQA 3IAYA 3NQIA 2IX1A 3MTSA 5JVH3 3K58A 3KBGA 5I4DA 1XXGA 1VDZA 2F0LA 3D8GA 2EYHA 3DEPA 1CZGA 2Z4IA 3NBHA 2E2HB 3J7YW 4OGQC 2K03A 3U9OA 2RDHA 3SR1A 2ZXRA 3ZYYX 1GUGA 2BA0A 3KBXA 4IURA 2F0HA 1FYCA 1WVLA 3L3OC 5AFWA 5DAUA 2XIWA 1DM0B 4OIJA 5CR3A 2K6AA 2IWHA 2VNUD 5CYUA 1I4HA 1EQVA 1EY5A 3A55A 3GTKB 4A3FB 3VR3A 2EYPA 5ELEA 1VMCA 1HXYD 1E2VA 1RKNA 4IFDI 1QOHA 4HCEA 4PQXA 1SNDA 1JORA 3NSWA 1IYUA 4DN4M 1BOSA 1H9RA 1BO0A 1F77A 1HQRD 3NTKA 1SNPA 1E2WA 1LTGD 1W6KA 2K33A 1OXXK 2E2IB 5BN3A 1NAPA 2PW5A 3I4LA 3DWQA 4OIKA 3H0GB 3EVQA 1G6ZA 4O42A 3WDNA 4HSPA 4WFN3 4KY5A 1VMPA 5DM73 1LTAD 1JR0D 5I6YA 4DXFA 3J80L 4OHJA 2F0DA 3I90A 2BDNA 3PMFA 2B2TA 5I2YA 5EPLA 3OPOA 3EA6A 5I9OA 5ELCA 1SEBD 1JICA 1PFNA 3CQZB 4J8QA 1PYWD 3VR6A 5KRUA 1OXSC 1JOQA 5A2QE 1EY9A 1DOLA 3D6CA 2I07B 3R8BA 1EZ8A 2K5DA 5C5LA 1SSOA 4ODGA 5IOCA 2IL8A 2WINB 1PTOH 4LJZC 5E1FA 5M3FB 3F2UA 4JBWA 2B63B 4EQNA 3A8IE 3CU7A 3A7AB 2K1BA 2VUMB 1F9SA 1TY2A 4TQUS 2EYLA 2KCCA 1BBXC 4ID6A 1LV9A 1RJTA 1SE3A 4CKEA 2CW0D 3S9WA 2SNSA 1II3A 2PO4A 1K8MA 2F0QA 2D5DA 3K0YA 3K5MA 3BDOA 5T1IA 1JOKA 4G4KA 5KEEA 4DFAA 4DK0A 2B2WC 3I73A 5IT9L 5EBDA 4L8JA 2A5HA 4HTHA 1R4PB 2A6HD 4YIJA 3KF8A 4ZYSA 1WTPA 1EYCA 1WCMB 1U4RA 1K8OA 2KOLA 4H0LC 1HPCA 1G291 1ONLA 5K5PA 3V05A 2KUMA 4ILWA 1QE6A 1DXMA 2L1BA 2VB3X 3OWEB 5M9OA 5I2XA 1GHKA 1YNNC 4EQPA 1HRJA 2WV6D 3MVVA 5T1GA 3OHXC 3NTHA 1Z7TA 1DOKA 4IZ8A 4EGVA 4RKLA 1I50B 3NBIA 4U673 4R8NA 1UUPA 3L7ZC 5CV5A 2E74C 2R7ZB 4CKCA 2F0SA 1IL8A 2L0CA 1GUNA 2HDLA 4BWGB 3C46A 1BNZA 1STEA 5KYIA 5CV8A 3PIO3 1RHPA 1ESFA 3MEHA 4K2LA 3T51B 1DD2A 3HKZB 5CGKA 2K5QA 2D9UA 1ET9A 5C0XJ 4FP5D 4G7ZC 3C1EA 2JEAI 2Q8TA 2PCFB 2PMZB 4KTAA 1RCVD 2PZUA 4XQNA 1MGSA 3UI2A 3L9AX 1XTCD 1EYDA 4RCOA 1STYA 4J6HA 4OO1H 4FF4A 4JK1C 3DWAA 3T4AC 4NDXA 4RKBA 1MD2D 3QB3A 3TZUA 4ME5A 2KVMA 4ZQ3A 1LABA 3EJIA 2EYMA 4RCNA 2ZXPA 4FO2A 3MXPA 2Z1CA 1TKWB 1ILPA 4QMGA 4HR7B 2NB0A 1CZWA 2F4IA 3Q24A 1F2MA 2PQEA 3HOYB 1D1IA 5C6AA 5C3EB 1D2BA 1PTOC 1LO5D 2NVQB 2L12A 2FMCA 2X69A 1I6VC 1QB5D 3HOWB 3TN2A 3NE5B 3J7AV 4PMWA 2LMCB 4RWSC 1WTWA 4CJ1B 2EXZA 1TS4A 3K7AB 1CTMA 5M5WB 1TVXA 3T16A 5IGCA 4IALA 1J9OA 2OEOA 1U9RA 4IFDH 1SNOA 4KJOA 1KLUD 1SMYD 1TWHB 1LT4D 3A8JE 3BDLA 3D4DA 3HGBA 4J1MA 2NBFA 2HUGA 5CBEE 3R2TA 2JA7B 2QF7A 1CHQD 1HQMC 4FXKC 3GTPB 3T53B 2EY1A 3NPPA 2ENBA 4PNYA 5E3FA 4I7ZC 3OWFA 4A3EB 3U9SA 2EDGA 4CBVA 4QCLA 4U68A 1SJED 4DAYA 4NP5A 2F03A 1PTOB 1L0XB 1A3TA 3TZDA 1YNJD 3BVMA 2F0FA 4XXEA 1A15A 1KNEA 3D31A 1UAPA 5CV6A 1KTKA 3TP6A 1GXDC 5JEAG 1EU3A 1WTVA 2RVLA 4BA2I 4K8IA 3MZ5A 5IT9E 3AU7A 3S1NB 3KLSA 4ZAIA 4ZUIA 1FD7D 5JAVA 3NP8A 1Q12A 3SDZA 3I3CA 4BY1B 4RGMA 1AN8A 2YU9B 3HEJA 4KKTA 1OO9B 3GTGB 2O5JC 4DU9A 1A6XA 5FLXL 2NN6H 3JAML 3EROA 3FDTA 3E0JA 2L9HA 4KV6A 2F0EA 2MGSA 4B9WA 4OO1I 4ABNA 2WIIB 3HG9A 4M1UB 1LTTD 4LAAA 1BCPB 1PTOF 4HEDA 2X6GA 2F0IA 1V1PB 1BCPD 5EQ0A 3C3LA 5HGTA 3WOFA 4BY7B 4IUTA 3IL8A 1AW7A 5EKKA 1JCKB 1ZXTA 1MI2A 3K5OA 1PMRA 4A3DB 1X32A 2IJ0A 3SE0A 3GQBA 4C3JB 3GTMB 5EPKA 3O13A 3VYTA 2Q8RE 1HHVA 2G9HD 2IW3A 1O7LA 1F2ZA 1QILA 5EKLA 1V43A 2CHBD 3FVQA 4DA2A 4C3IG 4FF2A 1KABA 5CBAE 2J7ZA 1OXTA 5CC4A 3R3OA 3R93A 4K5WA 3RMHA 2X6LA 3SK8A 1JC7A 4GZYC 4R9WA 4S3SA 2IPKD 2K28A 2FFKB 5C3XA 1PRTD 4KJNA 1Q3LA 3NUCA 2R92B 4RGNA 1HFGA 1WD1A 4IUQA 1I6HB 5C4ZA 2BCOA 1HA6A 1LACA 4O1NA 5IGFA 2D62A 3EFXD 1B3AA 4A3IB 3SXHA 1IYVA 4ULLA 1B44D 2EJMA 4RFBA 4G7HC 3IFTA 1ENCA 4WRDA 2BA1A 3OMCA 1SYDA 1V8QA 4QF4A 3K59A 1ENFA 1SNMA 2C9OA 1X3PA 2A69D 1SJHD 2QKIC 2CW0C 1C8CA 2K01A 4XQJA 3RZOB 5C0XG 1Q90A 3Q6SA 1RODA 5CV4A 5JEAJ 4G57A 1G8ZD 3OW7A 5C4HA 2A74C 2JA8B 4HSVA 3S16B 4IUNA 4F87A 3N52A 2K32A 2H1EA 2JEBI 4M8AA 3BS1A 3M7GA 3D4RA 2XVSA 1JQYD 4CJ0B 2A6HC 2B2WA 1VCIA 4L6TB 5J22A 3M7NA 4XIGS 4C1NI 3PIP3 3K5NA 1SE2A 2EYJA 1H9SB 2KECA 4RH6A 3QIAA 4XYOA 3GTLB 1STAA 1RTOA 1S5CD 4K8JA 1KDAA 1DOMA 1PXUA 3OOCA 4N9PA 1U4LA 2NN6I 1WD0A 5EPJA 1G2SA 5JPNC 1B50A 1LTID 4IUPA 1TR5A 2E76C 1Q8IA 3NWTA 1F9RA 2NVTB 1S5DD 4NMZA 1B2TA 2B2VA 2C5CA 1AP0A 4KKUA 2WAQB 2K5WA 2G9DA 1BXTA 1RTNA 1HCZA 1STNA 1B9MA 1F9PA 1PDQA 2L5TA 5J1ZA 3W3AA 1VF5C 1BDOA 4K5VA 5E4XA 1Y8OB 4TSSA 4C3HG 1TS3A 1VF7A 2PW7A 2B39A 1A3VA 5D65A 2EY2A 1R9TB 2MPMA 5FLXE 4FF1A 5E4WC 3A8KE 3G7LA 3GV3A 5DNFA 2MUYA 1Y8NB 1WTQA 4XTCS 1A2TA 2JA6B 1U4MA 3LNNA 1G91A 1TU2B 5IGDA 2B2VC 3BVZA 3S2DB 2B8FA 2PNRC 2EOTA 3A54A 2B2UA 3HOZB 3IKJA 4RHSA 1C4QA 2F1MA 3VYRA 1LTSD 1HUMA 1SDFA 5J39A 5D3DA 3T13A 3J7AF 1EZ6A 3QOJA 4HN7A 1MSHA 3CRLC 3MXUA 2LY7A 1BQQT 3HP3A 1ENAA 3P1HA 4A3KB 1ILQA 1GOZA 2EE1A 2VXWA 4N9TA 1S5BD 2EYFA 2AQ1B 4X3KA 4TRDA 5FK9C 1GHJA 1GUOA 2ZT9C 1H9MA 1S5FD 3HOVB 5M5XB 1TWAB 1SMYC 2QCPX 4FYDA 3S1QB 2F0WA 3H3VC 1CQVA 3AB9A 4HMIA 2M00A 4DXGA 1D1KA 2B2UC 5ELDA 3MA2B 4A3BB 1ZKOA 2AQ3B 1QWYA 1SNQA 3KLSX 2Q8IB 3SK4A 5FOBB 4F7XA 3FPUB 1IKLA 3P7JA 4K6LA 3VR4A 1CM9A 2KQ3A 3CHBD 1O80A 1ZEQX 3J80E 2K05A 3G6JB 1I4PA 5IGGA 1YNJC 2FINB 3DMUA 2NZ1D 2HCCA 1D5XC 1TWFB 1QG7A 3A56A 2N55A 3TBIB 3E6ZX 5JOBA 3TP8A 2XWBB 2BE5D 3V96A 3PUZA 3QWNA 1O7YA 4FXGC 1EY8A 5IGBA 2F0PA 1V1PA 3QO2A 4WORA 2Z4HA 3S15B 3GO5A 4B08A 2N88A 1IKMA 4C1NK 4FVMA 4IFDG 3M3YB 1RF2D 1S5ED 1ZYRD 1GUTA 3IFDA 3BDCA 1A2UA 3BZDB 2AQ2B 4KMUC 1TQOA 4MHEA 4ZKBB 4DF7A 2A6ED 4G7OC 3CKIB 3ND8A 3WOEA 3GTOB 1BF4A 3HZXA 1Z6HA 3OIPA 3TDQA 1Q1EA 1JB3A 2A73B 3PUWA 5KYLA 2R93B 2EYOA 4DAVA 2WKDA 4DAPA 2SEBD 2EY5A 3KLRA 3PUYA 1NCVA 5NUCA 2RDGA 5LHY1 3LWUA 5DEHA 3NHHA 4KY6A 1BCPC 2D2CC 2QEJC 1HA5A 5FO9B 5JEAH 1S4ZA 2O5IC 5BN5A 2SOBA 4QIWB 1STHA 2BDOA 3MFGA 3C2PA 1TS2A 1WTOA 3MHBA 1TY0A 3S14B 3A7LA 3TP5A 2CQAA 1J8IA 1Y1VB 2M9VA 3MXNA 5EJWA 4A3JB 4FXDA 4E6IA 3AMUA 3OSOA 3PUVA 2JP1A 3FEWX 3KUPA 1EWCA 3S1MB 3TMEA 1OXUA 2EJFC 5K36H 1SYCA 2WB1B 1T5EA 5CV9A 2NUCA 1GJXA 3P20A 4AYBB 2OT2A 1XYIA 2FJ2A 2XRSD 2NN6G 3RUZA 3PO3B 1EOTA 5I9PA 1PRTC 3BYTB 1JWUD 5C4XB 1FNWA 4KHVA 4C56C 3DEOA 1HUNA 5EGTA 3URYA 3NK9A 1NR2A 5C4JB 1H9KA 1ICWA 3VYUA 3V2TA 3SK6A 1H9SA 4IUVA 2L4NA 4EQOA 2XWJB 2F0MA 2QDBA 3I8ZA 3BG3A 3EQLC 1HFNA 1EY6A 2AWNA 2A69C 5EBCA 4PMCA 3VA5A 2OF1A 1JWMD 5JPMC 2VB2X 1JWSD 1SBBB 1FNVA 5KNDA 3GTJB 5DM63 4V0BA 3I4MB 5LL6X 3MWYW 2ID0A 4UAIA 3KK7A 1Y1WB 1O78A 1PZJD 1SYFA 2XRQD 2B8GA 1FGBD 4ZUJA 1DYQA 2KCNA 3SK5A 3OMGA 3S1RB 4IN3A 4Z9CB 3BVGA 1PRTB 1EFID 3DHQA 2E75C 4IFDJ 4BBSB 1AFPA 3DUZA 1Y69U 4P2CB 1CA6A 1BR9A 1K83B 3DM1A 3H94A 5G3LD 2ICEC 1SFOB 2HQEA 1BCPF 1LTBD 4X3UA 4IUUA 2EJGC 4L63B 2IX3A 2F3VA 4KKSA 1EQTA 2R3ZA 5KIXA 1Y8PB 1TT2A 1CA5A 2ZXOA 2YYZA 1Z47A 3H09A 4CJ2C 2EY6A 5C0XH 1F9QA 4K5XA 3SHLA 3X3MA 2MP1A 3SVMA 3K6OA 2I46A 5TSSA 1PFBA 2AUKA 4EVOA 2SDFA 5KGUA 1CI3M 3QJYA 3TP7A 3NWSA 1PLFA 2EVBA 1FNUA 2DNCA 2M2LA 1TWCB 2PYKA 3LWEA 1DONA 3SEBA 2PZTA 2RSOA 5CORA 5FO7B 1M8AA 1PRTF 1IW7C 1SE4A 1STGA 4RGTA 5BN4A 1OXVA 1EEID 2B2YA 2IT1A 4NW2A 4KHZA 1PFMA 3GV6A 3D6WA 2V4DA 1EY7A 2O2LD 1LT3D 1EIHA 2XSCA 5G3LF 3PO2B 3ITPA 4FNFA 1ET6A 2FMMA 1NR4A 3FMCA 4LMQD 5C3WA 4XQQA 5F2DA 4DNTB 2B2TC 1ML0D 5I6WA 2A68C 1LTRD 4KN4C 3FRPB 1DCZA 1I4QA 2KEEA 4CKBA 1UEAB 4KD3A 4ZLTF 4K6DA 2IX0A 1Q1BA 1FR3A 4DGZA 4R8IA 4XYQA 2F0TA 4KK7A 4BA1I 2FHTA 2LFNA 1AEXA 1TWGB 4XDXA 2Y0SB 4Y7NB 1QJOA 1JOOA 1JE4A 2AWOA 4C2MB 1T5XD 2B2YC 1QCBD 5EKIA 5LL6S 3J81L 2RA4A 3RLFA 1CT1D 2NVXB 2L11A 1IW7D 4HCSA 2OXPA 3GTQB 4H13C 1KDCA 3HOXB 3N6RA 1MBYA 4ZRZA 3JAME 2LKVA 1I4RA 3NXWA 2KJXA 2F0NA 2HDMA 3W2DA 5M5YB 1O7ZA 5ELBA 1IHZA 1E0BA 3FKIB 2ICIA 3S17B 4ZKCB 4F8MA 2E2JB 2BOSA 3Q23A 2Z8LA 2TSSA 5A35A 3K57A 3I4NB 3S2HB 3LX0A 1QNUA 4V190 5D14A 4HAEA 1EWHA 3R2IA 3VA7A 2A68D 4C3JG 1SAPA 1EY4A 2WACA 3RD4A 3H91A 2KA7A 1EY0A 1NSNS 4RGOS 1SXTA 1AZQA 4Q5VA 1SYEA 4NKLA 5KNBA 2TMPA 3M4YA 1KLGD 5HURA 2J0TD 1R4QB 1V1OA 4DNRB 3M85A 2JSOA 5IGEA 5COYA 2DN8A 5C44B 3D4WA 1A3UA 2DY8A 2BE5C 1I4XA 5IIFA 3I91A 2AUJD 1LT5D 1KAAA 1X3QA 5IODA 1WTXA 3X3NA 3P75A 5C0XI 3NQTA 1EU4A 3Q22A 1XX8A 1RD9D 3MAQA 2F0KA 2DNEA 5FKAC 3K5LA 1B4OA 5JJZA 2R61A 4RAUC 3ND9A 2O4XA 5KNCA 1ZYRC 2K7VA 1GUWA 1TS5A 5M3MB 2WP8J 2NYZD 5CMDA 1YNND 4CGYB 2RSNA 4OO1G 5JVG3 3H6MA 3DXJC 4KN7C 3MC0B 4C3IB 2A6EC 2L55A 3HS0C 3VR2A 3RZDB 2WKCA 5ISRA 1EL0A 1LLRD 2NVYB 1GUSA 2NWGA 5CV7A 2J4XA 4F88A 1LT6D 3C1FA 4MIUA 1PZID 1C48A 3GD7A 3E5SA 4LK1C 2F0VA 4CHTB 1KNAA 4Q0FA 4MN3A 3T56B 2QILA 3NTIA 2E2DC 3VYSA 2XNAC 2PPBC 3MFYA 1WTRA 2JE6I 2NTSA 2MHVA 4QUFA 4X3SA 1F2YA 2RBMA 3FPPA 2F0UA 4PMBA 4K2KA 3I72A 4A3MB 1CFMA 4WJWA 1QNKA 1SYGA 2EPBA 1TIID 3PUXA 4PV1C 2RDFA 2LS01 2F0GA 2PZWA 3I70A 5A2QL 1BUVT 4B9XA 3M4OB 4IQZA 1CK1A 1I4GA 1SNCA 4XT1B 2SNMA 2R6GA 2F3WA 1D6EC 2JYOA 1H9JA 1SYBA 2F0JA 4XT3B 1I3QB 2KEDA 4BS9A 3HRZC 4QB4A 2EZVA 4A93B 4RA8A 1B53A 1STBA 5C5MA 1DJRD 3ERQA 2XN9C 3QOLA 4KD4A 1EIGA 1HTPA 2NTTA 1EYAA 1AZPA 1HTLD 2HCIA 1B9NA 2MJ8A 5ELFA 1NUCA 2GA4B 2JXMB 1U4PA 1PTOD 1UNSA 1E2ZA 2RQXA 3GP7A 1CQFA 4QUCA 1KDBA 4H7BA 2JA5B 2K04A 1G2TA 4DK1A 1D5MC 3J81E 4A3GB 1F2LA 3ONAB 1M4VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KEE A;  4ZKB B;  4HSV A;  1A15 A;  1KNE A;  2DY7 A;  5E4X A;  1DOK A;  4ZLT F;  3F2U A;  1EQT A;  5EPK A;  2R3Z A;  2Q8R E;  1HHV A;  1BF4 A;  1VMC A;  3N52 A;  5COY A;  2H1E A;  3DEO A;  5D65 A;  1ILP A;  1QNK A;  1MSG A;  2K1B A;  1HUN A;  2MPM A;  2EPB A;  2DY8 A;  4R8I A;  1WTV A;  3I91 A;  2CVR A;  5E4W C;  4CJ0 B;  1CA5 A;  1X3Q A;  1WTX A;  1F9S A;  3G7L A;  2FHT A;  2RVL A;  2B2U C;  1NR2 A;  2B2W A;  4CJ2 C;  1ICW A;  1XX8 A;  3GV3 A;  1IL8 A;  1ESR A;  2L12 A;  2X69 A;  4DN4 M;  5CBA E;  2J7Z A;  4ZAI A;  4XDX A;  2HDL A;  3TN2 A;  1BO0 A;  4IUV A;  1NCV A;  2L4N A;  5DNF A;  1JE4 A;  1BBX C;  3FPU B;  1IKL A;  1F9Q A;  4RWS C;  1BNZ A;  1WTW A;  2B2Y C;  3I3C A;  5EKI A;  1LV9 A;  3P7J A;  1B4O A;  3I8Z A;  2MP1 A;  3R93 A;  4CJ1 B;  5JJZ A;  3SVM A;  2RA4 A;  4XT1 B;  1WTQ A;  1HFN A;  1NAP A;  1RJT A;  1U4M A;  2X6L A;  1PFB A;  1DZ1 A;  4OIK A;  2L11 A;  1CM9 A;  1G91 A;  2SDF A;  4RAU C;  2JYO A;  1RHP A;  2KEC A;  4HCS A;  1G6Z A;  1O80 A;  4XT3 B;  4O42 A;  4R9W A;  2B2V C;  2KED A;  1TVX A;  1GUW A;  1RTO A;  2K05 A;  1S4Z A;  1VMP A;  1DOM A;  1J9O A;  2NYZ D;  4X3T A;  5CMD A;  2RSN A;  2K28 A;  1U4L A;  1PLF A;  2EOT A;  2FFK B;  5EPJ A;  2D9U A;  2FIN B;  1G2S A;  2M2L A;  1WD0 A;  1B50 A;  1Q3L A;  4IUP A;  2HDM A;  4ZK9 B;  3LWE A;  1WTO A;  1O7Z A;  1HFG A;  3MWY W;  4IUQ A;  1WD1 A;  2NZ1 D;  1DON A;  1E0B A;  2HCC A;  4RA8 A;  4UAI A;  3I90 A;  2BDN A;  5T1I A;  1B53 A;  2B2U A;  2B2T A;  2RSO A;  5COR A;  1QG7 A;  4ZKC B;  1J8I A;  2N55 A;  1HUM A;  1M8A A;  2B2W C;  3MTS A;  2Q8T A;  1HA6 A;  1SDF A;  5EJW A;  3FDT A;  1F9R A;  1B3A A;  5EPL A;  1EL0 A;  1EIG A;  1AZP A;  2B2Y A;  2L9H A;  3DEP A;  1MGS A;  2HCI A;  2MJ8 A;  4NW2 A;  1MSH A;  2JP1 A;  2NWG A;  3UI2 A;  1PFM A;  5D14 A;  4HAE A;  1O7Y A;  3GV6 A;  3D6W A;  1WTP A;  2MGS A;  2HUG A;  3HP3 A;  3KUP A;  1JIC A;  1U4P A;  2K03 A;  5CBE E;  1B2T A;  1PFN A;  3QO2 A;  2B2V A;  1U4R A;  1SAP A;  1EIH A;  1ILQ A;  2EE1 A;  2KOL A;  2VXW A;  1AP0 A;  3H91 A;  1KNA A;  3KBX A;  2N88 A;  2KUM A;  4MN3 A;  2FMM A;  4IUR A;  4X3K A;  1NR4 A;  1DOL A;  1IKM A;  4QUC A;  4HED A;  4LMQ D;  2X6G A;  1X3P A;  4IUU A;  1QE6 A;  1CA6 A;  1WVL A;  1WTR A;  1C8C A;  5EQ0 A;  1AZQ A;  2K04 A;  1G2T A;  1RTN A;  5AFW A;  2K01 A;  4QUF A;  2L1B A;  3DM1 A;  1SSO A;  2XIW A;  3IFD A;  4U68 A;  2KVM A;  2FJ2 A;  4IUT A;  2B2T C;  3IL8 A;  1ROD A;  3Q6S A;  4OIJ A;  4X3S A;  1F9P A;  1ML0 D;  1PDQ A;  1XYI A;  2IL8 A;  1EOT A;  3TZD A;  1F2L A;  1ZXT A;  1MI2 A;  3ONA B;  4X3U A;  1HRJ A;  4MHE A;  5T1G A;  1X32 A; 
#chains in the Genus database with same CATH topology
 1W6J A;  1V1Q A;  2DY7 A;  3MEF A;  3VR5 A;  1I94 Q;  1HZC A;  1CHP D;  1B1Z A;  1FVI A;  4UDU C;  1GVP A;  3BZC A;  3AFQ A;  1MSG A;  3TSS A;  2YV5 A;  5D3I B;  1PA6 A;  3BYY B;  1I50 H;  2CVR A;  5FO8 B;  1S40 A;  4K14 A;  2KHS A;  2H4O A;  1WOC A;  3QG1 A;  1EEF D;  3DWP A;  3HOU B;  1VQN A;  4H44 C;  1ESR A;  4MNO A;  3MXG A;  3HOZ G;  3CRK C;  5K36 G;  1L0Y B;  4FF3 A;  1WYD A;  4I65 A;  4DV6 L;  4KI0 A;  4A4I A;  3Q0A A;  2UXB Q;  4KY7 A;  4R1J A;  1DZ1 A;  2RKS A;  3HKZ G;  3D3R A;  1Q86 C;  4C3H B;  1RDP D;  4HMJ A;  1XWE A;  1D5Z C;  4DV0 L;  5C44 H;  1IBK Q;  2D0P A;  4RHR A;  2F0O A;  2ZJQ A;  3K80 C;  1C0A A;  4X3T A;  4OL7 A;  4BBR B;  4JI5 Q;  1PZK D;  4TKO B;  4ZK9 B;  3CC2 A;  4LFB L;  4IOC A;  3PV0 A;  3OIQ A;  3IAY A;  3NQI A;  4LW1 A;  4DUZ L;  5DLQ E;  2IX1 A;  3RR5 A;  3MTS A;  5JVH 3;  3KJO A;  3K58 A;  3KBG A;  5I4D A;  1XXG A;  1VDZ A;  2F0L A;  3D8G A;  2EYH A;  3DEP A;  1CZG A;  2Z4I A;  4B3S Q;  3NBH A;  3HOV G;  2E2H B;  3J7Y W;  4OGQ C;  2K03 A;  3U9O A;  2RDH A;  2VL6 A;  3SR1 A;  2ZXR A;  3ZYY X;  1LTL A;  1GUG A;  4DR5 Q;  4C3I H;  2BA0 A;  3KBX A;  4IUR A;  2F0H A;  4UP8 A;  4QGU A;  1I5F A;  1FYC A;  1WVL A;  3L3O C;  1CSQ A;  5AFW A;  4O2D A;  5GRO A;  4A3B G;  5DAU A;  2XIW A;  1KC8 C;  1DM0 B;  4OIJ A;  5CR3 A;  4DUY L;  3BU2 A;  2K6A A;  2IWH A;  2VNU D;  5CYU A;  1KRS A;  3QR8 A;  1CKM A;  1NMG A;  2UUC L;  1I4H A;  1EQV A;  1EY5 A;  3A55 A;  4YCU A;  3GTK B;  5IYC G;  4A3F B;  3VR3 A;  2EYP A;  5ELE A;  1VMC A;  1HXY D;  1E2V A;  4HJA A;  1RKN A;  1J5E L;  4JI0 L;  4IFD I;  1QOH A;  4HCE A;  4IPG A;  4POF A;  4FDB A;  4CDC C;  4PQX A;  1SND A;  1JOR A;  3NSW A;  1IYU A;  4DN4 M;  5C3E H;  1BOS A;  1H9R A;  2NVQ H;  1BO0 A;  1F77 A;  1HQR D;  3NTK A;  1SNP A;  1E2W A;  1LTG D;  1W6K A;  1XJV A;  1KD1 C;  2K33 A;  1OXX K;  3E9I A;  4B3M L;  2E2I B;  5BN3 A;  1NAP A;  4JW0 A;  2PW5 A;  3I4L A;  3DWQ A;  4OIK A;  1A63 A;  3FHW A;  3K7A H;  3H0G B;  3EVQ A;  4YHH L;  4A3M H;  1G6Z A;  4O42 A;  4DK3 C;  3WDN A;  4HSP A;  4X62 L;  5M5W H;  4WFN 3;  4KY5 A;  1VMP A;  1U0L A;  5DM7 3;  1LTA D;  2KHJ A;  1GO3 E;  1JR0 D;  4R4Q A;  5I6Y A;  4DXF A;  1N32 L;  3J80 L;  4OHJ A;  2F0D A;  3I90 A;  2BDN A;  3PMF A;  4JI1 Q;  2B2T A;  5I2Y A;  4GNX A;  1A0I A;  1XMQ L;  3M4O H;  3E9H A;  5EPL A;  1QVG A;  4EX5 A;  3OPO A;  3EA6 A;  5I9O A;  1I3Q H;  2CCZ A;  5ELC A;  1SEB D;  3BJU A;  1Z9F A;  1JIC A;  1WTH A;  1PFN A;  3CQZ B;  1LYL A;  4MTN A;  4A93 H;  4J8Q A;  1PYW D;  3VR6 A;  5KRU A;  1OXS C;  2PQA A;  1JOQ A;  2JQO A;  5A2Q E;  1EY9 A;  3RLN A;  2GVB A;  1DOL A;  3D6C A;  3GTP H;  2I07 B;  3R8B A;  1EZ8 A;  2K5D A;  2Z9H A;  4R4O A;  5C5L A;  3SGI A;  1SSO A;  4ODG A;  2R93 G;  5IOC A;  1M90 C;  2IL8 A;  4MZ9 A;  2WIN B;  5IP7 H;  1PTO H;  1E3P A;  4LJZ C;  1D8L A;  5E1F A;  3KDF A;  4K0K Q;  5M3F B;  2ZJR A;  3F2U A;  4JBW A;  2B63 B;  3NBH B;  4EQN A;  3FP9 A;  1YHA A;  1XTD A;  1PYB A;  3A8I E;  1CKN A;  3CU7 A;  1O7I A;  2ALY B;  2K1B A;  3A7A B;  3F2B A;  4KHP L;  2I0Q A;  3GDE A;  2JA5 H;  2VUM B;  2RHS B;  1F9S A;  1TY2 A;  4TQU S;  4DR3 Q;  2EYL A;  4HIK A;  3JAM i;  4A3G H;  1K3R A;  3S1N H;  4LUZ A;  2KCC A;  1Y1V G;  2MNA A;  1BBX C;  2E8G A;  3TS0 A;  4ID6 A;  1LV9 A;  1RJT A;  1SE3 A;  4JI2 Q;  4CKE A;  4P73 A;  3OTO Q;  2CW0 D;  3S9W A;  2SNS A;  1II3 A;  2PO4 A;  1K8M A;  1SRU A;  2WAQ E;  4CDD C;  2F0Q A;  3LGJ A;  1K0S A;  2D5D A;  4JBJ A;  3HOU H;  3K0Y A;  4OX9 L;  3K5M A;  3M4P A;  2WB1 G;  3BDO A;  5T1I A;  1JOK A;  4G4K A;  4B3T L;  5KEE A;  4YWL A;  4DFA A;  4DK0 A;  2B2W C;  3I73 A;  5IT9 L;  5EBD A;  4LF8 Q;  4AYB G;  4L8J A;  4X66 Q;  1OTC A;  2A5H A;  2DUD A;  3PO3 G;  4HTH A;  4C3H H;  2IY5 B;  1R4P B;  4JG2 A;  2A6H D;  4YIJ A;  3KF8 A;  4UY8 C;  4ZYS A;  1WTP A;  5C4X G;  2H5X A;  1EYC A;  3H15 A;  1WCM B;  3TRZ A;  1U4R A;  4BBR H;  1K8O A;  2KOL A;  4H0L C;  1HPC A;  1G29 1;  2VZA A;  2CWA A;  1A62 A;  1ONL A;  3I2Z A;  1HR0 Q;  5K5P A;  3V05 A;  2KUM A;  2F52 A;  3KF6 A;  4ILW A;  1QE6 A;  3WWV A;  1DXM A;  4HID A;  2L1B A;  3ICE A;  2VB3 X;  3OWE B;  5M9O A;  5I2X A;  1GHK A;  4NXN L;  4YY3 L;  1YNN C;  4EQP A;  1VQ6 A;  1YJW A;  1N34 Q;  2E2H H;  1HRJ A;  3CCS A;  2WV6 D;  3E0E A;  3MVV A;  5T1G A;  2N3S A;  3OHX C;  3NTH A;  3IRB A;  1Z7T A;  1DOK A;  1PH2 A;  4BXX G;  4IZ8 A;  3GTM H;  5IWA Q;  1JT8 A;  4EGV A;  1VQD A;  4RKL A;  3F2C A;  1H95 A;  1I50 B;  3NBI A;  4DR1 L;  3DM3 A;  4U67 3;  4R8N A;  1UUP A;  3L7Z C;  3PIP A;  5CV5 A;  2E74 C;  3I4M G;  2R7Z B;  4CKC A;  2UUA Q;  2F0S A;  1IL8 A;  1Y1W G;  2L0C A;  4Y52 H;  4OWW B;  1GUN A;  2HDL A;  4JYA Q;  4BWG B;  4IO9 A;  3C46 A;  4R4I A;  1BNZ A;  2HHH Q;  3HKZ E;  5L37 A;  1SN8 A;  3CCE A;  1STE A;  3Q8D A;  5KYI A;  4DV3 Q;  3GTK H;  5CV8 A;  3PIO 3;  1RHP A;  2CWP A;  1ESF A;  4GS3 A;  3KDF B;  3MEH A;  4K2L A;  1MJC A;  3T51 B;  3HKZ B;  1DD2 A;  2CQO A;  5CGK A;  4BBS G;  2ASB A;  1D7Q A;  1IBL Q;  1MKH A;  2K5Q A;  2D9U A;  2PMZ E;  1X3F A;  5GAG C;  1ET9 A;  5C0X J;  4FP5 D;  4G7Z C;  1PH9 A;  3C1E A;  1HR0 W;  1I6H H;  2JEA I;  2Q8T A;  2PCF B;  2PMZ B;  2KBN A;  4DR6 L;  4KTA A;  1RCV D;  2PZU A;  2E2I H;  1B3Q A;  2JK8 A;  4XQN A;  1MGS A;  3H0G H;  1GM5 A;  3UI2 A;  1L2F A;  3ULL A;  3T1Y Q;  3L9A X;  1XTC D;  1EYD A;  2LSS A;  4RCO A;  2HIX A;  1STY A;  4J6H A;  4OO1 H;  4DV1 L;  4FF4 A;  4JK1 C;  3DWA A;  3W1G A;  3T4A C;  1WI5 A;  4NDX A;  4GKK Q;  1YIT A;  4RKB A;  1S3O A;  1MD2 D;  1PHJ A;  3QB3 A;  3TZU A;  4ME5 A;  2KVM A;  3RZO H;  1VQB A;  4ZQ3 A;  1LAB A;  3EJI A;  5H1S E;  1JB7 A;  2EYM A;  2NZO A;  4RCN A;  2ZXP A;  3U4Z A;  2JA8 H;  4FO2 A;  3S16 H;  3MXP A;  2Z1C A;  3TRE A;  3CW2 C;  1TKW B;  1ILP A;  4QMG A;  4HR7 B;  2NB0 A;  1CZW A;  2F4I A;  3Q24 A;  2E5L L;  1F2M A;  2PQE A;  3HOY B;  1D1I A;  5C6A A;  5C3E B;  1D2B A;  1PTO C;  1LO5 D;  4HJ5 A;  2L12 A;  2NVQ B;  2FMC A;  2X69 A;  1I6V C;  2PNH A;  1QB5 D;  3HOW B;  3TN2 A;  3NE5 B;  3J7A V;  4PMW A;  2LMC B;  4RWS C;  1WTW A;  4CJ1 B;  5M3F H;  4GN4 B;  2EXZ A;  1TS4 A;  5AJ3 Q;  3K7A B;  1CTM A;  4JI4 L;  2IHF A;  5M5W B;  4EQ5 A;  2UU9 L;  2VQE Q;  1TVX A;  3T16 A;  5IGC A;  4IAL A;  1J9O A;  2OEO A;  4AQY L;  2VUM H;  5JJK A;  1U9R A;  4IFD H;  1SNO A;  4KJO A;  3PO2 G;  1KLU D;  3KYH C;  4NXM Q;  1EQQ A;  1SMY D;  1TWH B;  4DV2 Q;  1LT4 D;  3A8J E;  3BDL A;  3NEL A;  3D4D A;  3HGB A;  4J1M A;  2QDL A;  2NBF A;  4PG3 A;  1XPU A;  1X54 A;  2HUG A;  2HIV A;  3J81 i;  5CBE E;  3R2T A;  3UDG A;  2JA7 B;  3CC4 A;  2QF7 A;  2EXD A;  1CHQ D;  1HQM C;  4FXK C;  1XNR L;  3GTP B;  4L5R C;  3KOJ A;  3T53 B;  2EY1 A;  3NPP A;  2ENB A;  4PNY A;  5E3F A;  4I7Z C;  3OWF A;  4WJ4 A;  2KHI A;  4A3E B;  3U9S A;  2EDG A;  4R4C A;  4CBV A;  1ASY A;  1NE3 A;  4UPA A;  4QCL A;  3JAM c;  4U68 A;  1SJE D;  4DAY A;  4NP5 A;  2Y0S G;  1VQO A;  3CD6 A;  2F03 A;  1PTO B;  1L0X B;  1A3T A;  3TZD A;  1YNJ D;  3BVM A;  2F0F A;  1YNX A;  2VQF L;  1PH7 A;  4XXE A;  4UP7 A;  1FGU A;  2QA4 A;  1A15 A;  1KNE A;  3D31 A;  1UAP A;  4P72 A;  5CV6 A;  1G6P A;  1KTK A;  3TP6 A;  1GXD C;  5JEA G;  1I94 L;  3HOX G;  3I4O A;  2A19 A;  5GAD C;  4A3L G;  1EU3 A;  1WTV A;  1GD7 A;  2RVL A;  4BA2 I;  4K8I A;  3MZ5 A;  1SR3 A;  5IT9 E;  3FKI G;  3AU7 A;  3S1N B;  1AE2 A;  3KLS A;  1PH8 A;  1QUQ B;  4ZAI A;  4ZUI A;  2ZTC A;  1FD7 D;  5JAV A;  2LXJ A;  1HJP A;  3NP8 A;  1Q12 A;  3SDZ A;  2JA6 G;  4LF6 Q;  3I3C A;  3DLL A;  4RGM A;  4BY1 B;  1AN8 A;  3I4N G;  1A8V A;  2YU9 B;  3HEJ A;  3EBE A;  1CSP A;  4NPS A;  4KKT A;  1K3B C;  1PVO A;  1EOV A;  1OO9 B;  3ULJ A;  3GTG B;  2O5J C;  2WB1 E;  1MHW C;  4DU9 A;  1HNW L;  2R7Z H;  4JI5 L;  1C7Y A;  1A6X A;  2UXD L;  5FLX L;  4PZ6 A;  2NN6 H;  4AYB E;  3JAM L;  5FJ8 G;  1IL2 A;  5E7N A;  3ERO A;  3HOZ H;  2QEX A;  3FDT A;  1PH6 A;  3VDY A;  3E0J A;  1N33 Q;  1V9P A;  2L9H A;  3AFP A;  4GLV B;  3UE0 A;  4KV6 A;  1UE1 A;  2F0E A;  4A3K G;  2MGS A;  3ER0 A;  4B9W A;  1HNX Q;  4B3S L;  4OO1 I;  4ABN A;  2WII B;  2Z6B A;  3HG9 A;  4M1U B;  1LTT D;  5C44 G;  4LAA A;  1AE3 A;  4DR5 L;  1BCP B;  1NJI C;  1PTO F;  4HED A;  2X6G A;  2F0I A;  1V1P B;  1BCP D;  5EQ0 A;  2Z6K C;  3C3L A;  5HGT A;  3NEM A;  3WOF A;  4BY7 B;  4IUT A;  3IL8 A;  5IP9 H;  1AW7 A;  2HQL A;  5EKK A;  1JCK B;  1ZXT A;  1MI2 A;  3K5O A;  1PMR A;  4A3D B;  1L1O A;  1X32 A;  2IJ0 A;  3SE0 A;  3GQB A;  4C3J B;  3GTM B;  5EPK A;  3O13 A;  3VYT A;  2Q8R E;  1HHV A;  1KL9 A;  3S1Q H;  4LFC Q;  2G9H D;  4DV0 Q;  4HJ8 A;  2ZM6 L;  2IW3 A;  5ELO A;  1O7L A;  1F2Z A;  5M3M G;  1QIL A;  5EKL A;  1V43 A;  2CHB D;  3FVQ A;  4L5T A;  4DA2 A;  4C3I G;  2N78 A;  3CCQ A;  4FF2 A;  1KAB A;  5ELN A;  5CBA E;  4A3C H;  2J7Z A;  1OXT A;  1BKB A;  1P8L A;  5CC4 A;  3R3O A;  3R93 A;  4DAY B;  4DR7 Q;  4K5W A;  1L0W A;  3RMH A;  2X6L A;  3SK8 A;  4JVZ A;  4GLX A;  1YHQ A;  1JC7 A;  4GZY C;  4JBK A;  4R9W A;  5IYC H;  4S3S A;  2IPK D;  4LFA Q;  2K28 A;  2FFK B;  5C3X A;  1PRT D;  3CCR A;  3HOY H;  4KJN A;  1Q3L A;  3NUC A;  4MTK A;  4HJ7 A;  4RGN A;  1HFG A;  1EWI A;  4IUQ A;  1WD1 A;  2R92 B;  1I6H B;  3HOW H;  2K5V A;  5C4Z A;  4JI1 L;  2BCO A;  1HA6 A;  1AH9 A;  2QW7 A;  1LAC A;  4O1N A;  5IGF A;  2D62 A;  2AHO B;  3EFX D;  1B3A A;  4A3I B;  3SXH A;  5IYD G;  4DUY Q;  1L1O C;  1IYV A;  4ULL A;  1XPO A;  1B44 D;  2EJM A;  4RFB A;  4G7H C;  3IFT A;  1ENC A;  4WRD A;  2BA1 A;  1T9H A;  3OMC A;  2YTV A;  2JJQ A;  3CP0 A;  1SYD A;  2MO1 A;  4P75 A;  4A3M G;  1VQ5 A;  1V8Q A;  4QF4 A;  3K59 A;  1ENF A;  1TWH H;  1J5E Q;  1S72 A;  1SNM A;  1N8R C;  3H3V H;  3CCL A;  2C9O A;  1X3P A;  2A69 D;  1SJH D;  2QKI C;  2CW0 C;  1Q82 C;  1C8C A;  1FJG Q;  1ICF B;  2K01 A;  4XQJ A;  3M3Y H;  3RZO B;  2I5M X;  4LF9 Q;  5C0X G;  1Q90 A;  1UWV A;  3G6E A;  3Q6S A;  1ROD A;  5CV4 A;  5JEA J;  1HZB A;  4G57 A;  1G8Z D;  3OW7 A;  5LMN L;  3JC6 6;  2D0O A;  5C4H A;  2A74 C;  2JA8 B;  4HSV A;  4B3M Q;  1K8G A;  2JA7 H;  3S16 B;  4IUN A;  4F87 A;  4K0K L;  3N52 A;  2K32 A;  2H1E A;  2JEB I;  4DV4 Q;  4M8A A;  3BS1 A;  3M7G A;  3D4R A;  4JV5 Q;  4A3E H;  2XVS A;  1JQY D;  4CJ0 B;  4A93 G;  3K81 C;  2A6H C;  2MO0 A;  4IPH A;  2KEN A;  1K0R A;  2B2W A;  1VCI A;  1N32 Q;  3HFZ B;  4L6T B;  5J22 A;  1VQE A;  3ZJY C;  4LF5 L;  1RIP A;  3M7N A;  2R93 H;  4XIG S;  1N9W A;  3CMA A;  4C1N I;  3PIP 3;  3K5N A;  3G48 A;  1SE2 A;  2EYJ A;  1H9S B;  2KEC A;  4JI2 L;  3AEV A;  4RH6 A;  3QIA A;  5IP7 G;  1L1O B;  4XYO A;  5GAE C;  3GTL B;  1STA A;  3J81 c;  1RTO A;  1NNX A;  1S5C D;  1RL2 A;  1KDA A;  4K8J A;  1DOM A;  1PXU A;  3UDF A;  2YTX A;  3OOC A;  4N9P A;  1U4L A;  2NN6 I;  4I7A A;  1WD0 A;  1IZ6 A;  5EPJ A;  1G2S A;  5JPN C;  1B50 A;  1LTI D;  3ERS X;  4IUP A;  4LF7 Q;  4NB3 A;  1TR5 A;  2E76 C;  2CFM A;  4OXP A;  1Q8I A;  3NWT A;  3A5U A;  1UE6 A;  4X65 L;  4A3J G;  1PH4 A;  4BY1 H;  1SLJ A;  1F9R A;  4A3G G;  4LF8 L;  2YU9 H;  2NVT B;  4X66 L;  1S5D D;  4NMZ A;  3T1H Q;  4KLK A;  2G5D A;  2ZJP A;  1VQF A;  1B2T A;  1IXR A;  3GTG H;  2B2V A;  1VS0 A;  2C5C A;  1AP0 A;  4KKU A;  3D0F A;  2WAQ B;  2K5W A;  1BVS A;  2L15 A;  2G9D A;  4LWC A;  2OQK A;  1BXT A;  1RTN A;  1HCZ A;  1STN A;  3HOU G;  1B9M A;  1F9P A;  1PDQ A;  2L5T A;  4RMF A;  4DR4 Q;  2I5H A;  5J1Z A;  3PO3 H;  3W3A A;  1N34 L;  1VF5 C;  1BDO A;  4GN5 A;  4K5V A;  3STB D;  3M4Q A;  5E4X A;  5EAY A;  3TS2 A;  5C4X H;  1Y8O B;  2P5Z X;  4TSS A;  4C3H G;  1TS3 A;  1VF7 A;  2PW7 A;  2B39 A;  2VY3 A;  1A3V A;  1B7Y B;  5D65 A;  2EY2 A;  5IWA L;  1R9T B;  2MPM A;  5FLX E;  4FF1 A;  5E4W C;  3A8K E;  4X64 Q;  3G7L A;  4YWK A;  3GV3 A;  4BY7 H;  1VQM A;  5IYB G;  5HGQ A;  5DNF A;  2MUY A;  4CDE C;  4JYA L;  4A3D H;  1Y8N B;  1WTQ A;  4XTC S;  1A2T A;  1G51 A;  2JA6 B;  4C3J H;  1U4M A;  3LNN A;  2KCM A;  1G91 A;  4BXX H;  4DV3 L;  1YEZ A;  2V1C C;  1TU2 B;  2K5H A;  5IGD A;  2B2V C;  3BVZ A;  3G4S A;  1E1T A;  3S2D B;  2B8F A;  2PNR C;  4YCW A;  2EOT A;  2FXQ A;  3A54 A;  5BR8 Q;  4LF4 Q;  4UP9 A;  1CKO A;  2MFI A;  2B2U A;  3HOZ B;  3IKJ A;  4RHS A;  1Y1W H;  1C4Q A;  2F1M A;  3VYR A;  1LTS D;  1HUM A;  1KAW A;  1SDF A;  5J39 A;  4NXN Q;  4ALP A;  5D3D A;  3T13 A;  3J7A F;  1EZ6 A;  2R7D A;  4YY3 Q;  3QOJ A;  4HN7 A;  3A74 A;  5J3B A;  1MSH A;  1VQP A;  3CRL C;  3MXU A;  2LY7 A;  1BQQ T;  3HP3 A;  1ENA A;  3P1H A;  4JOI A;  4A3K B;  4A3F G;  1ILQ A;  1GOZ A;  2EE1 A;  2VXW A;  4N9T A;  4DK6 C;  3H3V I;  4DV7 Q;  2R92 H;  3CCM A;  1S5B D;  2EYF A;  2AQ1 B;  4X3K A;  4DR1 Q;  4TRD A;  5FK9 C;  1GHJ A;  1GUO A;  1W2B A;  2BH2 A;  1E22 A;  5FLM H;  4A3I H;  1MIU A;  2ZT9 C;  3J80 i;  2DJF C;  1H9M A;  3CPF A;  1S5F D;  1VQJ A;  2ZTE A;  3EN2 A;  2K75 A;  2F3I A;  3HOV B;  5M5X B;  1TWA B;  5IY0 A;  4B3R Q;  4JI8 Q;  1SMY C;  3F8T A;  2QCP X;  4FYD A;  3H0G G;  3S1Q B;  2JN4 A;  2F0W A;  3H3V C;  1CQV A;  1NTG A;  1PH3 A;  3AB9 A;  1QUQ A;  1QVC A;  1Q8K A;  4HMI A;  2M00 A;  4DXG A;  1D1K A;  2B2U C;  5ELD A;  3MA2 B;  4A3B B;  1ZKO A;  2AQ3 B;  1QWY A;  1SNQ A;  3KLS X;  1IBM Q;  4LNQ A;  2Q8I B;  3SK4 A;  5FOB B;  4F7X A;  2UUB Q;  3FPU B;  1IKL A;  5JJI A;  1CUK A;  5LMU L;  4A75 A;  3P7J A;  4ME3 A;  4K6L A;  3VR4 A;  1PV4 A;  1CM9 A;  4JPB W;  2KQ3 A;  3CHB D;  1O80 A;  1ZEQ X;  4JOI C;  3J80 E;  2K05 A;  3G6J B;  1I4P A;  5IGG A;  1YNJ C;  1NBW A;  2FIN B;  3DMU A;  5GQO A;  4N8X 1;  3S24 A;  1XNQ L;  1YHB A;  2NZ1 D;  2HCC A;  1D5X C;  2ATW A;  3RNU A;  4NXM L;  1K73 C;  1TWF B;  1QG7 A;  3A56 A;  2N55 A;  5GAH C;  4PZ8 A;  4DV2 L;  2R7F A;  3HKS A;  3G71 A;  1VQI A;  1PYS B;  3TBI B;  3E6Z X;  5JOB A;  3TP8 A;  3J7Z C;  1X65 A;  2XWB B;  1IYJ B;  2BE5 D;  3V96 A;  3PUZ A;  3QWN A;  3GTL H;  1O7Y A;  1NMF A;  5M3F G;  4FXG C;  3PF4 A;  1EY8 A;  4JCV E;  5IGB A;  2F0P A;  1V1P A;  2UXC Q;  3QO2 A;  1N36 L;  2B63 G;  4WOR A;  2QGQ A;  2Z4H A;  3S15 B;  3GO5 A;  3CCV A;  4B08 A;  2N88 A;  1IKM A;  3W1B A;  4RG1 A;  4N8F A;  4C1N K;  4FVM A;  2VUM G;  1FL0 A;  4IFD G;  3M3Y B;  2E5L Q;  1RF2 D;  1HNZ Q;  4IJH A;  1S5E D;  1ZYR D;  1BBU A;  1GUT A;  3IFD A;  3BDC A;  2NVT H;  1A2U A;  3BZD B;  2AQ2 B;  1VQH A;  4KMU C;  1TQO A;  4MHE A;  4ZKB B;  4DF7 A;  2A6E D;  3ULP A;  4G7O C;  3CKI B;  3ND8 A;  1VQ4 A;  3WOE A;  3GTO B;  1BF4 A;  3HZX A;  1K8A C;  1Z6H A;  3CC7 A;  4GKJ L;  4QY7 A;  2UU9 Q;  1VQA A;  3OIP A;  3OYY A;  3CCU A;  3TDQ A;  4AQY Q;  3TQY A;  1Q1E A;  1JB3 A;  2A73 B;  3PUW A;  5KYL A;  2R93 B;  1E1O A;  2EYO A;  3UDX A;  2WKD A;  4DAV A;  4JI3 L;  3I56 A;  4DAP A;  2SEB D;  1XMO L;  2EY5 A;  3KLR A;  1TWG H;  3PUY A;  1NCV A;  4O0A A;  5NUC A;  3E3X A;  1UE7 A;  4DR2 Q;  4Y7N H;  4C2M H;  2RDG A;  5LHY 1;  3LWU A;  4LF6 L;  5DEH A;  3NHH A;  4KY6 A;  4QIW E;  1BCP C;  1PH1 A;  2D2C C;  1X55 A;  2QEJ C;  1HA5 A;  5FO9 B;  2EIF A;  1R9T H;  5JEA H;  1Q46 A;  4IJL A;  3HOX H;  1S4Z A;  1X9N A;  1WCM G;  2O5I C;  1KQS A;  5BN5 A;  4A3L H;  4UHV A;  2SOB A;  4QIW B;  1STH A;  2BDO A;  3MFG A;  1JJG A;  3C2P A;  1TS2 A;  2Z6K A;  4OEM B;  1WTO A;  4JI7 Q;  3MHB A;  1XNR Q;  1TY0 A;  5M5Y H;  3S14 B;  3A7L A;  4DV5 Q;  1EIF A;  3FKI H;  3TP5 A;  1UEB A;  2CQA A;  1J8I A;  2Q2I A;  1VQ8 A;  1Y1V B;  1EIY B;  2M9V A;  4HJ9 A;  4JI6 Q;  2CH4 W;  1SE8 A;  3MXN A;  5EJW A;  2KCT A;  4LUV A;  2JA6 H;  2UXB L;  4A3J B;  4FXD A;  4E6I A;  3AMU A;  3OSO A;  3PUV A;  2JP1 A;  2VQF Q;  1IBK L;  3S2D H;  2HD3 A;  3FEW X;  3KUP A;  1EWC A;  1PFS A;  4PZ7 A;  1HNX L;  3S1M B;  2CH4 A;  4TVA B;  3TME A;  1B8A A;  1OXU A;  2EJF C;  2RF4 A;  5K36 H;  1SYC A;  2WB1 B;  1T5E A;  5CV9 A;  5FJ8 H;  2NUC A;  2R7Z G;  2A8V A;  1GJX A;  2F4V Q;  3P20 A;  4YWM A;  4AYB B;  2OT2 A;  1XYI A;  1C9O A;  1X56 A;  2FJ2 A;  2XRS D;  2NN6 G;  3RUZ A;  3PO3 B;  1EOT A;  3K0X A;  4IPD A;  5I9P A;  3CPW A;  1PRT C;  3BYT B;  1JWU D;  5C4X B;  2C35 B;  4GLA C;  4A3K H;  1FNW A;  1YJ9 A;  3K7U C;  4KHV A;  4C56 C;  2YTY A;  3DEO A;  4LFC L;  1HUN A;  4R4T A;  5EGT A;  3URY A;  1HNW Q;  3NK9 A;  1NR2 A;  5C4J B;  1H9K A;  1ICW A;  3VYU A;  3V2T A;  3SK6 A;  2UXD Q;  2OQ0 A;  1YIJ A;  1H9S A;  4GOP B;  4IUV A;  2L4N A;  4DV6 Q;  4EQO A;  2XWJ B;  3HOV H;  5M5X H;  2F0M A;  2QDB A;  1TWA H;  2XTI A;  3I8Z A;  3BG3 A;  3EQL C;  1HFN A;  1EY6 A;  4GN3 B;  2GN5 A;  2AWN A;  5IP9 G;  2A69 C;  4DR7 L;  5EBC A;  2DGY A;  4PMC A;  1EYG A;  2RCN A;  1K9M C;  1EQR A;  3VA5 A;  2OF1 A;  1JWM D;  3UDI A;  5JPM C;  4LFB Q;  2VB2 X;  1JWS D;  1SBB B;  5M3M H;  1FNV A;  3PSI A;  5KND A;  3GTJ B;  4LFA L;  5DM6 3;  4V0B A;  2ZTD A;  3I4M B;  4DUZ Q;  5LL6 X;  3MWY W;  4A3B H;  2ID0 A;  4UAI A;  3KK7 A;  1Y1W B;  1O78 A;  2K52 A;  1PZJ D;  1SYF A;  1ASZ A;  1KXL A;  3I7F A;  2XRQ D;  2B8G A;  1EFW A;  1FGB D;  4ZUJ A;  3RZD H;  1DYQ A;  2PI2 E;  4QL5 A;  2KCN A;  3SK5 A;  3J80 c;  3OMG A;  1E7Z A;  4ZCK A;  4A3C G;  3S1R B;  4IN3 A;  2NVY H;  2K50 A;  4Z9C B;  3BVG A;  1PRT B;  1EFI D;  2N8N A;  3DHQ A;  2E75 C;  4IFD J;  4BBS B;  1AFP A;  3DUZ A;  1X3E A;  4OWT B;  2ZM6 Q;  1Y69 U;  4AH6 A;  1TWF H;  4P2C B;  3U50 C;  1CA6 A;  1BR9 A;  1K83 B;  3HOY G;  4L5S A;  1Q81 C;  1LUZ A;  4AIM A;  5C3E G;  3DM1 A;  3H94 A;  1FJG L;  5G3L D;  3PF5 A;  3HOW G;  2ICE C;  1UE5 A;  1SFO B;  4LF9 L;  5IYD H;  2HQE A;  1BCP F;  1LTB D;  4X3U A;  3MXN B;  2UUC Q;  2CKZ B;  1K28 A;  2I5L X;  4IUU A;  4DPG A;  2EJG C;  4L63 B;  2IX3 A;  2F3V A;  4KKS A;  2WFW A;  1EQT A;  2R3Z A;  3S15 H;  2MQH A;  4JI0 Q;  3CCJ A;  1QVF A;  5KIX A;  1Y8P B;  1TT2 A;  4DV4 L;  1CA5 A;  2ZXO A;  4JV5 L;  2YYZ A;  2Q2T A;  1Z47 A;  2K4K A;  3H09 A;  4CJ2 C;  2EY6 A;  5C0X H;  1F9Q A;  4K5X A;  1P16 A;  1JE5 A;  3SHL A;  3X3M A;  2MP1 A;  3SVM A;  2OWO A;  3K6O A;  2I46 A;  1HH2 P;  3BZK A;  4YHH Q;  4OWX B;  5TSS A;  1PFB A;  3GTO H;  2AUK A;  4EVO A;  2SDF A;  4X62 Q;  2B29 A;  5KGU A;  1W3S A;  1CI3 M;  1J6Q A;  3QJY A;  3TP7 A;  2N49 A;  2JA7 G;  4P74 A;  1HZA A;  1WJJ A;  3NWS A;  1PLF A;  2EVB A;  1FNU A;  2DNC A;  2M2L A;  1TWC B;  2VS1 A;  2PYK A;  1JJ2 A;  3STB C;  3LWE A;  1DON A;  3SEB A;  4DR3 L;  2HT1 A;  2PZT A;  3RN5 A;  4LF7 L;  1XMQ Q;  3PGZ A;  4A3E G;  2RSO A;  5COR A;  5FO7 B;  1M8A A;  1PRT F;  1QZH A;  1IW7 C;  1SE4 A;  1STG A;  4RGT A;  5BN4 A;  3K8A A;  1OXV A;  3I55 A;  5HY6 A;  1EEI D;  2B2Y A;  2IT1 A;  4OEL B;  4NW2 A;  3OTO L;  4KHZ A;  1PFM A;  2OCE A;  5LMN Q;  5IT9 c;  3GV6 A;  3D6W A;  3T1H L;  4CDF C;  2V4D A;  1X6O A;  1EY7 A;  2O2L D;  3KLW A;  1LT3 D;  1EIH A;  2XSC A;  5G3L F;  1QZG A;  3PO2 B;  3ITP A;  4FNF A;  1ET6 A;  2FMM A;  3S14 H;  4H02 A;  2JA5 G;  1NR4 A;  2JA9 A;  3FMC A;  4LMQ D;  5C3W A;  2XGT A;  1Y1V H;  1EUJ A;  4XQQ A;  5F2D A;  4DNT B;  4A3J H;  1NY4 A;  2B2T C;  3A5Z B;  4GNX C;  4LF5 Q;  1ML0 D;  5I6W A;  2A68 C;  1LTR D;  4KN4 C;  1YVC A;  2AMC B;  1Q7Y C;  3FRP B;  1DCZ A;  4BY1 G;  4DR4 L;  1I4Q A;  2KEE A;  4CKB A;  1UEA B;  4KD3 A;  4ZLT F;  3S1M H;  4K6D A;  2IX0 A;  1SRO A;  1Q1B A;  1HR0 L;  4KHP Q;  1FR3 A;  1E24 A;  2ES2 A;  4DGZ A;  4R8I A;  2Y0S E;  4XYQ A;  4JC0 A;  2F0T A;  4KK7 A;  4BA1 I;  3CF5 A;  2FHT A;  2LFN A;  4X64 L;  4QJF A;  1AEX A;  2RHQ B;  1TWG B;  4XDX A;  2Y0S B;  4Y7N B;  1QJO A;  1JOO A;  1JE4 A;  2AWO A;  4C2M B;  4X65 Q;  5JJL A;  1T5X D;  2B2Y C;  1QCB D;  5EKI A;  5LL6 S;  3J81 L;  3PCO B;  2RA4 A;  3RLF A;  4HIM A;  1CT1 D;  2NVX B;  2L11 A;  1IW7 D;  4HCS A;  3KJP A;  2OXP A;  3GTQ B;  4H13 C;  1KDC A;  3HOX B;  3N6R A;  4X6A H;  1MBY A;  4BBR G;  4ZRZ A;  3JAM E;  5IE8 A;  2AKW B;  2LKV A;  1I4R A;  3NXW A;  1VQ7 A;  5LMN W;  2KJX A;  2F0N A;  2GVA A;  5C4J H;  1TXY A;  2HDM A;  4OX9 Q;  3W2D A;  5M5Y B;  1O7Z A;  2UUA L;  2EQS A;  5BR8 L;  5ELB A;  1IHZ A;  1E0B A;  4B3T Q;  4LF4 L;  3FKI B;  2ICI A;  1LM0 A;  3S17 B;  4ZKC B;  5IYB H;  4F8M A;  2HHH L;  2BOS A;  3Q23 A;  2E2J B;  2Z8L A;  2TSS A;  5A35 A;  2DJG C;  2Q2U A;  4BY7 G;  3K57 A;  3I4N B;  3S2H B;  3LX0 A;  1QNU A;  1U5K A;  1VQG A;  4GNX B;  2K14 A;  4V19 0;  4A3D G;  5D14 A;  4HAE A;  3CXC A;  1EWH A;  3R2I A;  3VA7 A;  2A1A A;  2A68 D;  4C3J G;  1YBY A;  1IBL L;  1SAP A;  3U4V A;  1EY4 A;  2WAC A;  3GTJ H;  3RD4 A;  3I4M H;  3H91 A;  4POG A;  4DV7 L;  2KA7 A;  1EY0 A;  1NSN S;  4RGO S;  3EIV A;  1SXT A;  4LUO A;  1AZQ A;  3CME A;  1SMX A;  4Q5V A;  2PQA B;  1SYE A;  4NKL A;  5KNB A;  2Z0S A;  2TMP A;  3M4Y A;  3S1R H;  1KLG D;  5HUR A;  2J0T D;  1YZ6 A;  1JMC A;  1R4Q B;  4YCV A;  3T1Y L;  1KIX A;  3M9B A;  1V1O A;  4DNR B;  4BBS H;  1JJC B;  3M85 A;  3AYH B;  4B3R L;  3U58 A;  2JSO A;  4L5Q A;  3NEN A;  4JI8 L;  5IGE A;  4JBM A;  5COY A;  4A3F H;  2DN8 A;  5C44 B;  3D4W A;  1A3U A;  2DY8 A;  2BE5 C;  1I4X A;  5IIF A;  3I91 A;  3CAM A;  2AUJ D;  4GKK L;  1LT5 D;  1KAA A;  1K83 H;  1X3Q A;  5IOD A;  1WTX A;  3X3N A;  3P75 A;  5C0X I;  2R92 G;  3NQT A;  3KFU A;  1EU4 A;  3Q22 A;  1XX8 A;  1RD9 D;  2NZH A;  3MAQ A;  1CKN B;  2F0K A;  2DNE A;  1SFO H;  5FKA C;  1KHI A;  1IBM L;  3TEH B;  4OON A;  3K5L A;  5FLM G;  2UUB L;  1B4O A;  4A3I G;  1XPR A;  5JJZ A;  2R61 A;  1MJE A;  4RAU C;  3ND9 A;  4IPC A;  2O4X A;  5KNC A;  1YJN A;  1ZYR C;  2K7V A;  4J15 A;  1GUW A;  1B70 B;  1TS5 A;  5M3M B;  2WP8 J;  2NYZ D;  5CMD A;  1YNN D;  4CGY B;  2RSN A;  2B3G A;  4OO1 G;  5JVG 3;  3H6M A;  3DXJ C;  2LXK A;  4KN7 C;  3MC0 B;  4C3I B;  2A6E C;  2L55 A;  4QQB X;  3HS0 C;  4DR6 Q;  3VR2 A;  3RZD B;  2WKC A;  3RN2 A;  5ISR A;  5AJ3 L;  1EL0 A;  1M1K C;  1VQ9 A;  1LLR D;  2NVY B;  3B6Y A;  1GUS A;  1WFQ A;  2NWG A;  5CV7 A;  2J4X A;  4F88 A;  2VQE L;  2JA8 G;  1PH5 A;  1LT6 D;  3C1F A;  4MIU A;  1PZI D;  1C48 A;  2K5N A;  2UXC L;  3GD7 A;  4DV1 Q;  3CQZ H;  3E5S A;  1TWC H;  4LK1 C;  2F0V A;  4CHT B;  4DKA C;  1KNA A;  4Q0F A;  1BBW A;  4MN3 A;  3KF8 B;  3T56 B;  2QIL A;  3NTI A;  3F2D A;  2E2D C;  3PQI A;  3VYS A;  2XNA C;  2PPB C;  3MFY A;  1X3G A;  1WTR A;  2JE6 I;  2NTS A;  2MHV A;  4QUF A;  4X3S A;  1HNZ L;  4IOA A;  3KF6 B;  1F2Y A;  2RBM A;  3FPP A;  5LMU Q;  2BH8 A;  2F0U A;  3J81 j;  4PMB A;  3F1Z A;  4K2K A;  1VQK A;  3I72 A;  4A3M B;  2B63 H;  3PO2 H;  1CFM A;  4WJW A;  1QNK A;  4GOP A;  1SYG A;  2EPB A;  1TII D;  3PUX A;  4PV1 C;  3J7A 5;  2RDF A;  2LS0 1;  2F0G A;  2PZW A;  3I70 A;  5A2Q L;  1XNQ Q;  1BUV T;  1HZ9 A;  2VW9 A;  3PIO A;  4B9X A;  3A0J A;  3L2P A;  3L0O A;  3M4O B;  4IQZ A;  1CK1 A;  1I4G A;  4DR2 L;  1SNC A;  4XT1 B;  4JI4 Q;  2SNM A;  1Y14 B;  2R6G A;  2F3W A;  1D6E C;  2JYO A;  1H9J A;  1SYB A;  2F0J A;  4XT3 B;  2Q2H A;  1I3Q B;  2KED A;  4BS9 A;  2IHE A;  3W5O A;  3HRZ C;  1VQL A;  1N36 Q;  4QB4 A;  2EZV A;  4A93 B;  1VQC A;  3UE1 A;  2WAQ G;  4RA8 A;  1B53 A;  4DNI A;  4JI7 L;  4A76 A;  1STB A;  5C5M A;  4HIO A;  4DAM A;  4DV5 L;  1DJR D;  1KRT A;  3ERQ A;  2XN9 C;  2PI2 A;  3RLO A;  3QOL A;  4KD4 A;  1EIG A;  2NVX H;  1HTP A;  2NTT A;  1EYA A;  5FLX c;  1AZP A;  1HTL D;  4JI6 L;  2HCI A;  1B9N A;  2MJ8 A;  5ELF A;  1NUC A;  3GTQ H;  4WJ3 M;  2GA4 B;  2JXM B;  1U4P A;  1PTO D;  3OW2 A;  1UNS A;  4P71 A;  1GKH A;  1E2Z A;  4GOP C;  1WCM H;  2RQX A;  3GP7 A;  1YI2 A;  4GKJ Q;  1CQF A;  3AQQ A;  1DGS A;  4QUC A;  3S17 H;  1KDB A;  4H7B A;  2OTL A;  2JA5 B;  2E2J H;  2K04 A;  1G2T A;  4DK1 A;  1D5M C;  3J81 E;  1XMO Q;  1N33 L;  2RCF A;  4JI3 Q;  2F4V L;  3I4N H;  3S2H H;  4A3G B;  2OTJ A;  4APV A;  1F2L A;  3ONA B;  1M4V A; 
#chains in the Genus database with same CATH homology
 1W6J A;  2DY7 A;  3VR5 A;  1CHP D;  1B1Z A;  4UDU C;  1MSG A;  3TSS A;  5D3I B;  3BYY B;  2CVR A;  5FO8 B;  4K14 A;  2KHS A;  2H4O A;  3QG1 A;  1EEF D;  3DWP A;  3HOU B;  4H44 C;  1ESR A;  3MXG A;  5K36 G;  3CRK C;  1L0Y B;  4FF3 A;  4I65 A;  4KI0 A;  3Q0A A;  4KY7 A;  1DZ1 A;  2RKS A;  3D3R A;  4C3H B;  1RDP D;  4HMJ A;  1XWE A;  1D5Z C;  4RHR A;  2F0O A;  4X3T A;  4OL7 A;  4BBR B;  1PZK D;  4TKO B;  4ZK9 B;  3PV0 A;  3OIQ A;  3IAY A;  3NQI A;  2IX1 A;  3MTS A;  5JVH 3;  3K58 A;  3KBG A;  5I4D A;  1XXG A;  1VDZ A;  2F0L A;  3D8G A;  2EYH A;  3DEP A;  1CZG A;  2Z4I A;  3NBH A;  2E2H B;  3J7Y W;  4OGQ C;  2K03 A;  3U9O A;  2RDH A;  3SR1 A;  2ZXR A;  3ZYY X;  1GUG A;  2BA0 A;  3KBX A;  4IUR A;  2F0H A;  1FYC A;  1WVL A;  3L3O C;  5AFW A;  5DAU A;  2XIW A;  1DM0 B;  4OIJ A;  5CR3 A;  2K6A A;  2IWH A;  2VNU D;  5CYU A;  1I4H A;  1EQV A;  1EY5 A;  3A55 A;  3GTK B;  4A3F B;  3VR3 A;  2EYP A;  5ELE A;  1VMC A;  1HXY D;  1E2V A;  1RKN A;  4IFD I;  1QOH A;  4HCE A;  4PQX A;  1SND A;  1JOR A;  3NSW A;  1IYU A;  4DN4 M;  1BOS A;  1H9R A;  1BO0 A;  1F77 A;  1HQR D;  3NTK A;  1SNP A;  1E2W A;  1LTG D;  1W6K A;  2K33 A;  1OXX K;  2E2I B;  5BN3 A;  1NAP A;  2PW5 A;  3I4L A;  3DWQ A;  4OIK A;  3H0G B;  3EVQ A;  1G6Z A;  4O42 A;  3WDN A;  4HSP A;  4WFN 3;  4KY5 A;  1VMP A;  5DM7 3;  1LTA D;  1JR0 D;  5I6Y A;  4DXF A;  3J80 L;  4OHJ A;  2F0D A;  3I90 A;  2BDN A;  3PMF A;  2B2T A;  5I2Y A;  5EPL A;  3OPO A;  3EA6 A;  5I9O A;  5ELC A;  1SEB D;  1JIC A;  1PFN A;  3CQZ B;  4J8Q A;  1PYW D;  3VR6 A;  5KRU A;  1OXS C;  1JOQ A;  5A2Q E;  1EY9 A;  1DOL A;  3D6C A;  2I07 B;  3R8B A;  1EZ8 A;  2K5D A;  5C5L A;  1SSO A;  4ODG A;  5IOC A;  2IL8 A;  2WIN B;  1PTO H;  4LJZ C;  5E1F A;  5M3F B;  3F2U A;  4JBW A;  2B63 B;  4EQN A;  3A8I E;  3CU7 A;  3A7A B;  2K1B A;  2VUM B;  1F9S A;  1TY2 A;  4TQU S;  2EYL A;  2KCC A;  1BBX C;  4ID6 A;  1LV9 A;  1RJT A;  1SE3 A;  4CKE A;  2CW0 D;  3S9W A;  2SNS A;  1II3 A;  2PO4 A;  1K8M A;  2F0Q A;  2D5D A;  3K0Y A;  3K5M A;  3BDO A;  5T1I A;  1JOK A;  4G4K A;  5KEE A;  4DFA A;  4DK0 A;  2B2W C;  3I73 A;  5IT9 L;  5EBD A;  4L8J A;  2A5H A;  4HTH A;  1R4P B;  2A6H D;  4YIJ A;  3KF8 A;  4ZYS A;  1WTP A;  1EYC A;  1WCM B;  1U4R A;  1K8O A;  2KOL A;  4H0L C;  1HPC A;  1G29 1;  1ONL A;  5K5P A;  3V05 A;  2KUM A;  4ILW A;  1QE6 A;  1DXM A;  2L1B A;  2VB3 X;  3OWE B;  5M9O A;  5I2X A;  1GHK A;  1YNN C;  4EQP A;  1HRJ A;  2WV6 D;  3MVV A;  5T1G A;  3OHX C;  3NTH A;  1Z7T A;  1DOK A;  4IZ8 A;  4EGV A;  4RKL A;  1I50 B;  3NBI A;  4U67 3;  4R8N A;  1UUP A;  3L7Z C;  5CV5 A;  2E74 C;  2R7Z B;  4CKC A;  2F0S A;  1IL8 A;  2L0C A;  1GUN A;  2HDL A;  4BWG B;  3C46 A;  1BNZ A;  1STE A;  5KYI A;  5CV8 A;  3PIO 3;  1RHP A;  1ESF A;  3MEH A;  4K2L A;  3T51 B;  1DD2 A;  3HKZ B;  5CGK A;  2K5Q A;  2D9U A;  1ET9 A;  5C0X J;  4FP5 D;  4G7Z C;  3C1E A;  2JEA I;  2Q8T A;  2PCF B;  2PMZ B;  4KTA A;  1RCV D;  2PZU A;  4XQN A;  1MGS A;  3UI2 A;  3L9A X;  1XTC D;  1EYD A;  4RCO A;  1STY A;  4J6H A;  4OO1 H;  4FF4 A;  4JK1 C;  3DWA A;  3T4A C;  4NDX A;  4RKB A;  1MD2 D;  3QB3 A;  3TZU A;  4ME5 A;  2KVM A;  4ZQ3 A;  1LAB A;  3EJI A;  2EYM A;  4RCN A;  2ZXP A;  4FO2 A;  3MXP A;  2Z1C A;  1TKW B;  1ILP A;  4QMG A;  4HR7 B;  2NB0 A;  1CZW A;  2F4I A;  3Q24 A;  1F2M A;  2PQE A;  3HOY B;  1D1I A;  5C6A A;  5C3E B;  1D2B A;  1PTO C;  1LO5 D;  2NVQ B;  2L12 A;  2FMC A;  2X69 A;  1I6V C;  1QB5 D;  3HOW B;  3TN2 A;  3NE5 B;  3J7A V;  4PMW A;  2LMC B;  4RWS C;  1WTW A;  4CJ1 B;  2EXZ A;  1TS4 A;  3K7A B;  1CTM A;  5M5W B;  1TVX A;  3T16 A;  5IGC A;  4IAL A;  1J9O A;  2OEO A;  1U9R A;  4IFD H;  1SNO A;  4KJO A;  1KLU D;  1SMY D;  1TWH B;  1LT4 D;  3A8J E;  3BDL A;  3D4D A;  3HGB A;  4J1M A;  2NBF A;  2HUG A;  5CBE E;  3R2T A;  2JA7 B;  2QF7 A;  1CHQ D;  1HQM C;  4FXK C;  3GTP B;  3T53 B;  2EY1 A;  3NPP A;  2ENB A;  4PNY A;  5E3F A;  4I7Z C;  3OWF A;  4A3E B;  3U9S A;  2EDG A;  4CBV A;  4QCL A;  4U68 A;  1SJE D;  4DAY A;  4NP5 A;  2F03 A;  1PTO B;  1L0X B;  1A3T A;  3TZD A;  1YNJ D;  3BVM A;  2F0F A;  4XXE A;  1A15 A;  1KNE A;  3D31 A;  1UAP A;  5CV6 A;  1KTK A;  3TP6 A;  1GXD C;  5JEA G;  1EU3 A;  1WTV A;  2RVL A;  4BA2 I;  4K8I A;  3MZ5 A;  5IT9 E;  3AU7 A;  3S1N B;  3KLS A;  4ZAI A;  4ZUI A;  1FD7 D;  5JAV A;  3NP8 A;  1Q12 A;  3SDZ A;  3I3C A;  4BY1 B;  4RGM A;  1AN8 A;  2YU9 B;  3HEJ A;  4KKT A;  1OO9 B;  3GTG B;  2O5J C;  4DU9 A;  1A6X A;  5FLX L;  2NN6 H;  3JAM L;  3ERO A;  3FDT A;  3E0J A;  2L9H A;  4KV6 A;  2F0E A;  2MGS A;  4B9W A;  4OO1 I;  4ABN A;  2WII B;  3HG9 A;  4M1U B;  1LTT D;  4LAA A;  1BCP B;  1PTO F;  4HED A;  2X6G A;  2F0I A;  1V1P B;  1BCP D;  5EQ0 A;  3C3L A;  5HGT A;  3WOF A;  4BY7 B;  4IUT A;  3IL8 A;  1AW7 A;  5EKK A;  1JCK B;  1ZXT A;  1MI2 A;  3K5O A;  1PMR A;  4A3D B;  1X32 A;  2IJ0 A;  3SE0 A;  3GQB A;  4C3J B;  3GTM B;  5EPK A;  3O13 A;  3VYT A;  2Q8R E;  1HHV A;  2G9H D;  2IW3 A;  1O7L A;  1F2Z A;  1QIL A;  5EKL A;  1V43 A;  2CHB D;  3FVQ A;  4DA2 A;  4C3I G;  4FF2 A;  1KAB A;  5CBA E;  2J7Z A;  1OXT A;  5CC4 A;  3R3O A;  3R93 A;  4K5W A;  3RMH A;  2X6L A;  3SK8 A;  1JC7 A;  4GZY C;  4R9W A;  4S3S A;  2IPK D;  2K28 A;  2FFK B;  5C3X A;  1PRT D;  4KJN A;  1Q3L A;  3NUC A;  2R92 B;  4RGN A;  1HFG A;  1WD1 A;  4IUQ A;  1I6H B;  5C4Z A;  2BCO A;  1HA6 A;  1LAC A;  4O1N A;  5IGF A;  2D62 A;  3EFX D;  1B3A A;  4A3I B;  3SXH A;  1IYV A;  4ULL A;  1B44 D;  2EJM A;  4RFB A;  4G7H C;  3IFT A;  1ENC A;  4WRD A;  2BA1 A;  3OMC A;  1SYD A;  1V8Q A;  4QF4 A;  3K59 A;  1ENF A;  1SNM A;  2C9O A;  1X3P A;  2A69 D;  1SJH D;  2QKI C;  2CW0 C;  1C8C A;  2K01 A;  4XQJ A;  3RZO B;  5C0X G;  1Q90 A;  3Q6S A;  1ROD A;  5CV4 A;  5JEA J;  4G57 A;  1G8Z D;  3OW7 A;  5C4H A;  2A74 C;  2JA8 B;  4HSV A;  3S16 B;  4IUN A;  4F87 A;  3N52 A;  2K32 A;  2H1E A;  2JEB I;  4M8A A;  3BS1 A;  3M7G A;  3D4R A;  2XVS A;  1JQY D;  4CJ0 B;  2A6H C;  2B2W A;  1VCI A;  4L6T B;  5J22 A;  3M7N A;  4XIG S;  4C1N I;  3PIP 3;  3K5N A;  1SE2 A;  2EYJ A;  1H9S B;  2KEC A;  4RH6 A;  3QIA A;  4XYO A;  3GTL B;  1STA A;  1RTO A;  1S5C D;  4K8J A;  1KDA A;  1DOM A;  1PXU A;  3OOC A;  4N9P A;  1U4L A;  2NN6 I;  1WD0 A;  5EPJ A;  1G2S A;  5JPN C;  1B50 A;  1LTI D;  4IUP A;  1TR5 A;  2E76 C;  1Q8I A;  3NWT A;  1F9R A;  2NVT B;  1S5D D;  4NMZ A;  1B2T A;  2B2V A;  2C5C A;  1AP0 A;  4KKU A;  2WAQ B;  2K5W A;  2G9D A;  1BXT A;  1RTN A;  1HCZ A;  1STN A;  1B9M A;  1F9P A;  1PDQ A;  2L5T A;  5J1Z A;  3W3A A;  1VF5 C;  1BDO A;  4K5V A;  5E4X A;  1Y8O B;  4TSS A;  4C3H G;  1TS3 A;  1VF7 A;  2PW7 A;  2B39 A;  1A3V A;  5D65 A;  2EY2 A;  1R9T B;  2MPM A;  5FLX E;  4FF1 A;  5E4W C;  3A8K E;  3G7L A;  3GV3 A;  5DNF A;  2MUY A;  1Y8N B;  1WTQ A;  4XTC S;  1A2T A;  2JA6 B;  1U4M A;  3LNN A;  1G91 A;  1TU2 B;  5IGD A;  2B2V C;  3BVZ A;  3S2D B;  2B8F A;  2PNR C;  2EOT A;  3A54 A;  2B2U A;  3HOZ B;  3IKJ A;  4RHS A;  1C4Q A;  2F1M A;  3VYR A;  1LTS D;  1HUM A;  1SDF A;  5J39 A;  5D3D A;  3T13 A;  3J7A F;  1EZ6 A;  3QOJ A;  4HN7 A;  1MSH A;  3CRL C;  3MXU A;  2LY7 A;  1BQQ T;  3HP3 A;  1ENA A;  3P1H A;  4A3K B;  1ILQ A;  1GOZ A;  2EE1 A;  2VXW A;  4N9T A;  1S5B D;  2EYF A;  2AQ1 B;  4X3K A;  4TRD A;  5FK9 C;  1GHJ A;  1GUO A;  2ZT9 C;  1H9M A;  1S5F D;  3HOV B;  5M5X B;  1TWA B;  1SMY C;  2QCP X;  4FYD A;  3S1Q B;  2F0W A;  3H3V C;  1CQV A;  3AB9 A;  4HMI A;  2M00 A;  4DXG A;  1D1K A;  2B2U C;  5ELD A;  3MA2 B;  4A3B B;  1ZKO A;  2AQ3 B;  1QWY A;  1SNQ A;  3KLS X;  2Q8I B;  3SK4 A;  5FOB B;  4F7X A;  3FPU B;  1IKL A;  3P7J A;  4K6L A;  3VR4 A;  1CM9 A;  2KQ3 A;  3CHB D;  1O80 A;  1ZEQ X;  3J80 E;  2K05 A;  3G6J B;  1I4P A;  5IGG A;  1YNJ C;  2FIN B;  3DMU A;  2NZ1 D;  2HCC A;  1D5X C;  1TWF B;  1QG7 A;  3A56 A;  2N55 A;  3TBI B;  3E6Z X;  5JOB A;  3TP8 A;  2XWB B;  2BE5 D;  3V96 A;  3PUZ A;  3QWN A;  1O7Y A;  4FXG C;  1EY8 A;  5IGB A;  2F0P A;  1V1P A;  3QO2 A;  4WOR A;  2Z4H A;  3S15 B;  3GO5 A;  4B08 A;  2N88 A;  1IKM A;  4C1N K;  4FVM A;  4IFD G;  3M3Y B;  1RF2 D;  1S5E D;  1ZYR D;  1GUT A;  3IFD A;  3BDC A;  1A2U A;  3BZD B;  2AQ2 B;  4KMU C;  1TQO A;  4MHE A;  4ZKB B;  4DF7 A;  2A6E D;  4G7O C;  3CKI B;  3ND8 A;  3WOE A;  3GTO B;  1BF4 A;  3HZX A;  1Z6H A;  3OIP A;  3TDQ A;  1Q1E A;  1JB3 A;  2A73 B;  3PUW A;  5KYL A;  2R93 B;  2EYO A;  4DAV A;  2WKD A;  4DAP A;  2SEB D;  2EY5 A;  3KLR A;  3PUY A;  1NCV A;  5NUC A;  2RDG A;  5LHY 1;  3LWU A;  5DEH A;  3NHH A;  4KY6 A;  1BCP C;  2D2C C;  2QEJ C;  1HA5 A;  5FO9 B;  5JEA H;  1S4Z A;  2O5I C;  5BN5 A;  2SOB A;  4QIW B;  1STH A;  2BDO A;  3MFG A;  3C2P A;  1TS2 A;  1WTO A;  3MHB A;  1TY0 A;  3S14 B;  3A7L A;  3TP5 A;  2CQA A;  1J8I A;  1Y1V B;  2M9V A;  3MXN A;  5EJW A;  4A3J B;  4FXD A;  4E6I A;  3AMU A;  3OSO A;  3PUV A;  2JP1 A;  3FEW X;  3KUP A;  1EWC A;  3S1M B;  3TME A;  1OXU A;  2EJF C;  5K36 H;  1SYC A;  2WB1 B;  1T5E A;  5CV9 A;  2NUC A;  1GJX A;  3P20 A;  4AYB B;  2OT2 A;  1XYI A;  2FJ2 A;  2XRS D;  2NN6 G;  3RUZ A;  3PO3 B;  1EOT A;  5I9P A;  1PRT C;  3BYT B;  1JWU D;  5C4X B;  1FNW A;  4KHV A;  4C56 C;  3DEO A;  1HUN A;  5EGT A;  3URY A;  3NK9 A;  1NR2 A;  5C4J B;  1H9K A;  1ICW A;  3VYU A;  3V2T A;  3SK6 A;  1H9S A;  4IUV A;  2L4N A;  4EQO A;  2XWJ B;  2F0M A;  2QDB A;  3I8Z A;  3BG3 A;  3EQL C;  1HFN A;  1EY6 A;  2AWN A;  2A69 C;  5EBC A;  4PMC A;  3VA5 A;  2OF1 A;  1JWM D;  5JPM C;  2VB2 X;  1JWS D;  1SBB B;  1FNV A;  5KND A;  3GTJ B;  5DM6 3;  4V0B A;  3I4M B;  5LL6 X;  3MWY W;  2ID0 A;  4UAI A;  3KK7 A;  1Y1W B;  1O78 A;  1PZJ D;  1SYF A;  2XRQ D;  2B8G A;  1FGB D;  4ZUJ A;  1DYQ A;  2KCN A;  3SK5 A;  3OMG A;  3S1R B;  4IN3 A;  4Z9C B;  3BVG A;  1PRT B;  1EFI D;  3DHQ A;  2E75 C;  4IFD J;  4BBS B;  1AFP A;  3DUZ A;  1Y69 U;  4P2C B;  1CA6 A;  1BR9 A;  1K83 B;  3DM1 A;  3H94 A;  5G3L D;  2ICE C;  1SFO B;  2HQE A;  1BCP F;  1LTB D;  4X3U A;  4IUU A;  2EJG C;  4L63 B;  2IX3 A;  2F3V A;  4KKS A;  1EQT A;  2R3Z A;  5KIX A;  1Y8P B;  1TT2 A;  1CA5 A;  2ZXO A;  2YYZ A;  1Z47 A;  3H09 A;  4CJ2 C;  2EY6 A;  5C0X H;  1F9Q A;  4K5X A;  3SHL A;  3X3M A;  2MP1 A;  3SVM A;  3K6O A;  2I46 A;  5TSS A;  1PFB A;  2AUK A;  4EVO A;  2SDF A;  5KGU A;  1CI3 M;  3QJY A;  3TP7 A;  3NWS A;  1PLF A;  2EVB A;  1FNU A;  2DNC A;  2M2L A;  1TWC B;  2PYK A;  3LWE A;  1DON A;  3SEB A;  2PZT A;  2RSO A;  5COR A;  5FO7 B;  1M8A A;  1PRT F;  1IW7 C;  1SE4 A;  1STG A;  4RGT A;  5BN4 A;  1OXV A;  1EEI D;  2B2Y A;  2IT1 A;  4NW2 A;  4KHZ A;  1PFM A;  3GV6 A;  3D6W A;  2V4D A;  1EY7 A;  2O2L D;  1LT3 D;  1EIH A;  2XSC A;  5G3L F;  3PO2 B;  3ITP A;  4FNF A;  1ET6 A;  2FMM A;  1NR4 A;  3FMC A;  4LMQ D;  5C3W A;  4XQQ A;  5F2D A;  4DNT B;  2B2T C;  1ML0 D;  5I6W A;  2A68 C;  1LTR D;  4KN4 C;  3FRP B;  1DCZ A;  1I4Q A;  2KEE A;  4CKB A;  1UEA B;  4KD3 A;  4ZLT F;  4K6D A;  2IX0 A;  1Q1B A;  1FR3 A;  4DGZ A;  4R8I A;  4XYQ A;  2F0T A;  4KK7 A;  4BA1 I;  2FHT A;  2LFN A;  1AEX A;  1TWG B;  4XDX A;  2Y0S B;  4Y7N B;  1QJO A;  1JOO A;  1JE4 A;  2AWO A;  4C2M B;  1T5X D;  2B2Y C;  1QCB D;  5EKI A;  5LL6 S;  3J81 L;  2RA4 A;  3RLF A;  1CT1 D;  2NVX B;  2L11 A;  1IW7 D;  4HCS A;  2OXP A;  3GTQ B;  4H13 C;  1KDC A;  3HOX B;  3N6R A;  1MBY A;  4ZRZ A;  3JAM E;  2LKV A;  1I4R A;  3NXW A;  2KJX A;  2F0N A;  2HDM A;  3W2D A;  5M5Y B;  1O7Z A;  5ELB A;  1IHZ A;  1E0B A;  3FKI B;  2ICI A;  3S17 B;  4ZKC B;  4F8M A;  2E2J B;  2BOS A;  3Q23 A;  2Z8L A;  2TSS A;  5A35 A;  3K57 A;  3I4N B;  3S2H B;  3LX0 A;  1QNU A;  4V19 0;  5D14 A;  4HAE A;  1EWH A;  3R2I A;  3VA7 A;  2A68 D;  4C3J G;  1SAP A;  1EY4 A;  2WAC A;  3RD4 A;  3H91 A;  2KA7 A;  1EY0 A;  1NSN S;  4RGO S;  1SXT A;  1AZQ A;  4Q5V A;  1SYE A;  4NKL A;  5KNB A;  2TMP A;  3M4Y A;  1KLG D;  5HUR A;  2J0T D;  1R4Q B;  1V1O A;  4DNR B;  3M85 A;  2JSO A;  5IGE A;  5COY A;  2DN8 A;  5C44 B;  3D4W A;  1A3U A;  2DY8 A;  2BE5 C;  1I4X A;  5IIF A;  3I91 A;  2AUJ D;  1LT5 D;  1KAA A;  1X3Q A;  5IOD A;  1WTX A;  3X3N A;  3P75 A;  5C0X I;  3NQT A;  1EU4 A;  3Q22 A;  1XX8 A;  1RD9 D;  3MAQ A;  2F0K A;  2DNE A;  5FKA C;  3K5L A;  1B4O A;  5JJZ A;  2R61 A;  4RAU C;  3ND9 A;  2O4X A;  5KNC A;  1ZYR C;  2K7V A;  1GUW A;  1TS5 A;  5M3M B;  2WP8 J;  2NYZ D;  5CMD A;  1YNN D;  4CGY B;  2RSN A;  4OO1 G;  5JVG 3;  3H6M A;  3DXJ C;  4KN7 C;  3MC0 B;  4C3I B;  2A6E C;  2L55 A;  3HS0 C;  3VR2 A;  3RZD B;  2WKC A;  5ISR A;  1EL0 A;  1LLR D;  2NVY B;  1GUS A;  2NWG A;  5CV7 A;  2J4X A;  4F88 A;  1LT6 D;  3C1F A;  4MIU A;  1PZI D;  1C48 A;  3GD7 A;  3E5S A;  4LK1 C;  2F0V A;  4CHT B;  1KNA A;  4Q0F A;  4MN3 A;  3T56 B;  2QIL A;  3NTI A;  2E2D C;  3VYS A;  2XNA C;  2PPB C;  3MFY A;  1WTR A;  2JE6 I;  2NTS A;  2MHV A;  4QUF A;  4X3S A;  1F2Y A;  2RBM A;  3FPP A;  2F0U A;  4PMB A;  4K2K A;  3I72 A;  4A3M B;  1CFM A;  4WJW A;  1QNK A;  1SYG A;  2EPB A;  1TII D;  3PUX A;  4PV1 C;  2RDF A;  2LS0 1;  2F0G A;  2PZW A;  3I70 A;  5A2Q L;  1BUV T;  4B9X A;  3M4O B;  4IQZ A;  1CK1 A;  1I4G A;  1SNC A;  4XT1 B;  2SNM A;  2R6G A;  2F3W A;  1D6E C;  2JYO A;  1H9J A;  1SYB A;  2F0J A;  4XT3 B;  1I3Q B;  2KED A;  4BS9 A;  3HRZ C;  4QB4 A;  2EZV A;  4A93 B;  4RA8 A;  1B53 A;  1STB A;  5C5M A;  1DJR D;  3ERQ A;  2XN9 C;  3QOL A;  4KD4 A;  1EIG A;  1HTP A;  2NTT A;  1EYA A;  1AZP A;  1HTL D;  2HCI A;  1B9N A;  2MJ8 A;  5ELF A;  1NUC A;  2GA4 B;  2JXM B;  1U4P A;  1PTO D;  1UNS A;  1E2Z A;  2RQX A;  3GP7 A;  1CQF A;  4QUC A;  1KDB A;  4H7B A;  2JA5 B;  2K04 A;  1G2T A;  4DK1 A;  1D5M C;  3J81 E;  4A3G B;  1F2L A;  3ONA B;  1M4V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...