4ID6A

Crystal structure of staphylococcal nuclease mutant v23i/i72l
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
136
structure length
136
Chain Sequence
KLHKEPATLIKAIDGDTIKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKLEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Thermonuclease
publication title Crystal Structure of Staphylococcal nuclease mutant V23I/I72L
rcsb
source organism Staphylococcus aureus
total genus 39
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2012-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4id6A00
2SOBA 3S9WA 2EYHA 5C5LA 4KD3A 1NSNS 5ISRA 2PQEA 3OWFA 2ENBA 3P1HA 3BDCA 1A2UA 4PMBA 5EKLA 3EVQA 2F0HA 4WORA 3SK6A 4E6IA 5IODA 5KIXA 4RKBA 4K14A 2F0JA 5DAUA 1SNOA 4IZ8A 3V2TA 3SHLA 4KY6A 2F0KA 5CV8A 5DEHA 4RKLA 1STAA 4DFAA 1A2TA 4EVOA 5I9OA 5HGTA 5C3WA 4KTAA 2RKSA 2F0TA 5EKKA 2EYPA 1EY8A 5CC4A 5C6AA 1ENCA 4K2KA 4J1MA 1SNDA 5IGGA 5KEEA 1KABA 1JORA 5IGFA 3SXHA 1EZ8A 1STYA 1STNA 1TT2A 5KYLA 5CGKA 3NXWA 3ITPA 2EYOA 2F0DA 2OF1A 3EROA 3P75A 5CV6A 2HQEA 2M00A 3TMEA 1STHA 1A3UA 1STBA 2F0WA 1F2YA 4EQNA 4F7XA 5IGBA 5IOCA 2QDBA 1KDAA 4DGZA 4K5WA 1EYAA 3C1FA 3OSOA 5EGTA 5F2DA 3VA5A 1EYCA 4HTHA 4OL7A 5NUCA 2EYFA 3D6CA 1A3TA 2PZUA 5KYIA 4WRDA 4ID6A 5J39A 1II3A 4NP5A 2F0IA 4I65A 4NMZA 2EYLA 5J22A 5C4ZA 2RDFA 4NDXA 4B9WA 3NHHA 2F0SA 3SK4A 1JOQA 2EYJA 4ZUJA 4KJNA 2KQ3A 5K5PA 2O4XA 4R8NA 3BDLA 3SR1A 1SNPA 4N9TA 4K2LA 2EY5A 1F2ZA 1EZ6A 3QOLA 3TP7A 1TR5A 2WACA 2F0LA 4K5VA 2PW5A 1SYEA 1ENAA 1EYDA 1A3VA 4K5XA 4NKLA 2EY6A 5IIFA 3DMUA 4KY7A 3QB3A 3NQTA 3MVVA 3R3OA 3C1EA 5CV7A 3RUZA 4KY5A 2EXZA 1F2MA 2F3WA 1EQVA 4K6DA 2EY1A 3D4WA 3T13A 3TP5A 5JAVA 4K8JA 5C4HA 5KGUA 4KJOA 1TQOA 3D4DA 3TP8A 1JOOA 5I6WA 5IGDA 2OEOA 2F0GA 4PNYA 1EY6A 4N9PA 1NUCA 4ZQ3A 3U9OA 1SYBA 3QOJA 5E3FA 2EY2A 4ODGA 4S3SA 3MHBA 3SK5A 5IGEA 4H7BA 4LAAA 3ERQA 3NP8A 1U9RA 4KD4A 4F8MA 2PYKA 1JOKA 3LX0A 1SYCA 3H6MA 5JOBA 4IUNA 1SNQA 3DHQA 2LKVA 3PMFA 4KV6A 4TRDA 5CV4A 4YIJA 4EQOA 1EY5A 3E5SA 1EY0A 5C3XA 2F0FA 2SNMA 3OMGA 3OMCA 1KDBA 5CV9A 3EJIA 3MEHA 1EY4A 4DF7A 2NUCA 4HMIA 4IALA 1AEXA 2PW7A 4HMJA 4K8IA 1SYGA 5IGCA 3MXPA 4KHVA 1IHZA 5KRUA 3HZXA 4MIUA 5CR3A 1EY9A 2F0MA 5M9OA 1KDCA 1SYFA 1SNMA 2F0EA 2F0NA 3MZ5A 4QMGA 2OXPA 3D8GA 5E1FA 4DU9A 5C5MA 2EYMA 2F0PA 4B9XA 4ME5A 2F0QA 2F0VA 1EY7A 3SK8A 5CV5A 4EQPA 5HURA 2RBMA 5I6YA 4PMCA 1SNCA 2KHSA 2SNSA 3NK9A 5J1ZA 3TP6A 2F0UA 2F3VA 2F0OA 4QB4A 1SYDA 4QF4A 3NUCA 4J6HA 1RKNA 4ZUIA 4G57A 2PZWA 5I9PA 2PZTA 3T16A 1KAAA 3HEJA 1STGA
chains in the Genus database with same CATH superfamily
1O7ZA 3K7UC 5CORA 2E76C 2IT1A 4RAUC 5FLXE 4A3KG 2AMCB 3SHLA 5BR8L 2F0KA 4HJAA 2BE5D 4XXEA 4BY7B 4RHSA 2EYPA 2E75C 4G7ZC 4DR4L 1K83B 2GVAA 4CJ2C 3SXHA 4OWTB 4MZ9A 1BQQT 3L7ZC 2H5XA 4MTKA 4LF6Q 1VQFA 1Y14B 2EYOA 1GD7A 2K52A 1UE6A 1QE6A 4JG2A 1YNXA 2NZOA 2Q8RE 2C9OA 2XN9C 4DUZQ 1HA6A 1KDAA 2NVYH 4HJ7A 3VA5A 1WCMG 4JI4Q 1RF2D 5NUCA 4YWKA 1U0LA 1N36L 1XNQQ 2KQ3A 2N78A 4R8NA 1PLFA 4K2LA 3RLNA 2EY5A 2A8VA 4JV5Q 4FXGC 4YY3L 2M2LA 5IYBG 3D3RA 3K8AA 3A74A 2A19A 2NVQB 1GHKA 1ENFA 3IAYA 1F77A 3KDFA 1T5XD 2CQOA 2EY1A 2ICIA 4LW1A 4V190 4X62Q 1HHVA 2A74C 1RJTA 2A6ED 2YU9H 1XMQL 4LFBQ 2VB3X 5AJ3Q 2FMMA 4AYBE 4CKCA 1VQ4A 1K8AC 1MHWC 2E2IB 3HG9A 1I94L 3KLSA 2UXDQ 1CFMA 2O5IC 3E5SA 1EY0A 3J80i 3GTKB 5CYUA 2VQEQ 3TZDA 4DAYA 3A7AB 1AEXA 3NBHB 3M4OB 1PFNA 1RHPA 2BH8A 4C3JB 2JA5H 1A62A 4GKJL 3SVMA 2B2VC 4QMGA 4HJ8A 4A3IG 3S17H 4A3KB 2F0PA 2K1BA 4R9WA 1PDQA 1B7YB 4DV2Q 3HFZB 1YIJA 3NK9A 2DY7A 1ML0D 4BWGB 5I9PA 3DWAA 3AEVA 4P75A 5JEAH 1CUKA 1SJED 1X3EA 3GTMH 2PQEA 3RMHA 3L0OA 1SFOB 1CKNB 1NY4A 5BN4A 3A8KE 5DAUA 4IZ8A 3CF5A 2L5TA 1U4PA 5JEAJ 1BCPF 3FKIH 3BZKA 4JYAQ 1T9HA 5K36G 4F88A 3QG1A 3K80C 4LF6L 3QJYA 4K6LA 2B63B 3EBEA 2SDFA 1PTOD 4M1UB 4DUZL 2EQSA 5ELDA 1L1OB 3HGBA 1I50B 4OO1G 2LXJA 4C3HH 5EAYA 1BCPB 4R4CA 2KCNA 3NHHA 2AHOB 3GTLH 1S72A 4JV5L 4IUUA 1I4RA 4TVAB 2B2TC 3J81j 5M3MG 1AFPA 1Q46A 1ENAA 5T1GA 3A5UA 1EQRA 2MJ8A 1CQVA 3IKJA 1X32A 3C1EA 3FRPB 1LT3D 3Q23A 2EXZA 1F2MA 2MFIA 4K8JA 4X62L 1D5ZC 2BE5C 3A8IE 1NUCA 4QIWE 2CH4A 1M1KC 4DAPA 1D8LA 1QNKA 4IPGA 4LFBL 3RD4A 4JI1L 4RG1A 5E4WC 2PYKA 2QF7A 2HDMA 3E3XA 4A3IB 1A63A 1PFMA 2KHJA 3ICEA 1PH4A 2SNMA 1HNZQ 2VQEL 3G4SA 1WTOA 4H02A 3ERSX 3J80E 1UEBA 1VMPA 3UE0A 2PMZE 2N3SA 4A3FG 1GUSA 3R2IA 1EIHA 3GTQH 2K75A 1I4QA 1GOZA 2RQXA 4ME5A 2ATWA 4DV2L 3OIQA 1I6HB 3TBIB 3F2BA 1QNUA 4R8IA 1VF7A 4IUVA 2VUMG 2QA4A 4DUYL 4IFDH 1ILPA 1NSNS 1A6XA 3HP3A 1YNNC 4DNIA 1CQFA 1STAA 4AQYL 1JWSD 2M9VA 5D3IB 5EQ0A 1EQQA 3HKZE 5FJ8H 3DEOA 3HOUG 2R93H 4JYAL 4J1MA 5LMUQ 3M4PA 2K28A 1I4GA 2VXWA 1S5CD 4C1NK 2AQ1B 1STYA 2WV6D 4JOIA 3FPPA 3UE1A 2OF1A 3MEFA 2M00A 3J7YW 2EJFC 2F3IA 2HCCA 4CDCC 1H9SB 1MSHA 1LM0A 4C1NI 4HR7B 1FGUA 5KNBA 2NB0A 4OL7A 3D6CA 3RN2A 4L5SA 2ZJRA 1II3A 4A3GH 4NP5A 4NMZA 4JBMA 2EYLA 3FMCA 4L63B 4LF5L 2RSOA 3M4QA 4H44C 4AYBG 1VQPA 4KJNA 5K5PA 1MGSA 2AWOA 3IFTA 4X64Q 2RHQB 2N55A 1U4LA 1TR5A 2XGTA 2DUDA 3JC66 3PUZA 3VR3A 4X65L 2FFKB 3CPWA 1R4QB 1N32L 1RL2A 3GO5A 1HFGA 4XIGS 4KJOA 1JJGA 1PTOF 1IZ6A 1SE3A 3U4ZA 2KOLA 4XYQA 1WOCA 5E3FA 4KMUC 4JI0L 4A3FB 1JMCA 4H7BA 2B2UA 3TRZA 3G48A 5LMNQ 5JOBA 4OGQC 4KV6A 2A6HD 2DGYA 1RCVD 5BN5A 1V8QA 4R4OA 5GQOA 5EKIA 3F2DA 1HNZL 4HMJA 1YZ6A 2L4NA 1QB5D 2ZM6Q 2VUMB 3CQZH 5GAHC 1GXDC 2PQAB 2WINB 2JP1A 3KOJA 5KRUA 4A3BH 1QJOA 1SEBD 1PTOB 3LNNA 2EYMA 4IQZA 1E24A 1DGSA 1NMFA 2F0VA 2F0QA 4EQPA 4OIKA 3K57A 3TP6A 2AQ2B 3QWNA 3ZJYC 4POFA 1YJWA 1PHJA 3HOUB 4DXGA 2K5DA 3G6EA 1RTNA 4KD3A 3AU7A 2A69C 4OEMB 2K5WA 3S1NH 2JA6H 1G291 4WORA 3I73A 4RKBA 1RTOA 2JA9A 2KCCA 3IFDA 4IUQA 1X65A 1VQBA 1L0YB 2KCTA 2RKSA 3VR4A 2HIVA 4DV6L 1K28A 2QILA 4NXNL 2KUMA 1PH9A 4JI2L 1HZ9A 4A3JB 4LF8Q 1IBKQ 3LWEA 3UDGA 3PO2B 4DA2A 2MO1A 3P20A 4AYBB 3K59A 5C4JB 3M4YA 2HQEA 4JI7Q 4DK6C 5FKAC 2Z8LA 4XT1B 3CC4A 1TS5A 5M5YH 2KJXA 2PO4A 4EQ5A 1W6JA 4WRDA 3T1YQ 5JEAG 2SEBD 3S16H 5GROA 2F4IA 1JOQA 4BY1G 3T1HL 4OIJA 3FDTA 4FF1A 4X64L 3PIOA 2CCZA 1FYCA 2X6GA 3MXNB 3M3YB 3TSSA 5IIFA 1OTCA 2QKIC 2UUAQ 4IOAA 2Z1CA 1S4ZA 2BH2A 3C2PA 4ZK9B 4GN5A 5LL6S 1CI3M 1JQYD 4EGVA 4LUOA 3DUZA 4LF4L 2B2WA 3IL8A 1JB3A 1JJCB 4X3SA 5IGEA 2ES2A 1QZGA 2E2DC 3CW2C 2A73B 1JOKA 3OIPA 2EJMA 2LKVA 1UEAB 2HDLA 1Z7TA 4HJ5A 3CU7A 4C3HG 1FVIA 1S5DD 3MEHA 1FNUA 1X3FA 5A2QE 3VYSA 3KJOA 4DNTB 3RNUA 1D1KA 1TWHB 2D0OA 3C46A 3HZXA 1TWFB 3Q8DA 3H15A 2YU9B 5EBDA 4OWWB 5FO8B 1AZQA 5ELNA 1HNXL 2ZJPA 3ZYYX 3KBXA 3PIPA 5G3LD 1M90C 2K01A 3D0FA 1VQ5A 2DNCA 2E2HH 2DJFC 3CCVA 1RKNA 1KLGD 1KAAA 1HTPA 4JI6Q 3S9WA 1TWAH 5M3FH 4YHHQ 4MTNA 4CJ1B 4QCLA 2JN4A 1D7QA 4DN4M 1XTDA 1Y1VG 2K14A 3S17B 4P74A 1Q1BA 2VY3A 4ZKCB 2NVXH 4DK3C 1J5EQ 5EKKA 1MI2A 1N33L 1KNEA 1EY8A 1WTXA 3LWUA 1LACA 4LUVA 2ZXRA 5D65A 3OOCA 4N8X1 1O7LA 1WI5A 2E74C 1FNVA 2YTXA 2NN6I 2D5DA 2JXMB 5H1SE 1FJGL 3GTMB 4B3SQ 2R7FA 4BY1B 1PV4A 5CV6A 1PYWD 1O80A 4GLXA 4JI7L 4IJLA 1P8LA 1STBA 3DWQA 4LF9L 5IOCA 1QILA 1H9KA 2IHFA 3UDIA 4H13C 2MP1A 3KBGA 1WVLA 4DV1L 1BF4A 3HOYH 1HPCA 3WDNA 1L2FA 2PMZB 4B3MQ 4G7HC 1XPRA 3G7LA 4DR7Q 1DOLA 1QUQA 3OWEB 4PZ6A 1I5FA 1SNPA 3U9SA 2AQ3B 4GNXA 1D6EC 4K5VA 2KBNA 4CBVA 4WJ3M 4DR6Q 3PO3H 5ELCA 3QB3A 2UUAL 3I72A 4ZRZA 4Q5VA 4C3HB 3MAQA 3VDYA 4YWLA 4OELB 1STEA 1B2TA 2HT1A 2OEOA 1F9PA 2PCFB 4JC0A 1SMYC 1V1PB 1DCZA 3S1MH 1KRSA 4F8MA 2V1CC 3NQIA 1XPOA 3HKZB 4UY8C 4IPHA 1VQKA 4UDUC 1E1TA 3GP7A 4A3GG 5BN3A 1EWCA 5EPJA 2TMPA 2MNAA 4DV5Q 3J81L 4OX9L 2A68C 2OCEA 3MXPA 3ER0A 3BJUA 1ILQA 2Q2IA 2PI2A 2F0MA 5M9OA 1SLJA 5C3EB 4DR2L 1Y1VB 3RLFA 5HURA 4A3DH 2Z0SA 1L0WA 4IJHA 2SNSA 1B44D 1WTHA 2LSSA 4N8FA 2LFNA 3F2UA 2CHBD 4GOPB 2EPBA 4RGNA 2Z6KA 4QL5A 4JI6L 2SOBA 5C5LA 2GN5A 2KEEA 1K73C 3G71A 5M5XH 3UDXA 2I5LX 3BDCA 3S15H 3D4RA 3AMUA 2B39A 3GTQB 1G6PA 1V43A 1ICWA 3I8ZA 3EIVA 4YCVA 4ZCKA 2F0JA 3GQBA 4R4IA 2WAQE 4XDXA 1Y1WG 5HGTA 4A3LH 5C3WA 1J5EL 2JEAI 1WTQA 1NJIC 1PYSB 1EOVA 1IW7D 2JQOA 3DLLA 3GTOB 4A3BG 2WKCA 5G3LF 1TT2A 1M4VA 4HIOA 3VYTA 4B3SL 2XIWA 1VQCA 2VW9A 4C3IH 3URYA 2IWHA 1IL2A 1XJVA 2KHIA 5F2DA 5JVG3 4RCNA 1JB7A 1YITA 5DM73 4B3ML 5J22A 3CHBD 1AW7A 3EFXD 1F9RA 4FF2A 1BBWA 2JA6G 2JA8B 1O7YA 1EZ6A 1NCVA 2I5HA 3CCMA 1EEID 2HD3A 2WFWA 1YNJC 5JVH3 2K4KA 3MVVA 4A3CH 1NBWA 3CPFA 4ILWA 2F3WA 4A3GB 3L2PA 1R4PB 1EY6A 1CTMA 2R92H 3PCOB 3ERQA 2K33A 3A56A 1G8ZD 1SNQA 3DHQA 2CVRA 3CC2A 1SXTA 5CV4A 5KNCA 1TWCB 1M8AA 1IYUA 3EJIA 1IBMQ 2EIFA 4IOCA 4DV5L 4K8IA 4TKOB 2QEXA 1OXVA 5FO9B 2UXCQ 1KC8C 3HOZH 1BOSA 3STBD 1WTWA 4DAYB 3A55A 3CMAA 1WD0A 1PMRA 3E0JA 4I7ZC 3S14H 2XNAC 3QIAA 2AKWB 4UPAA 1WFQA 1KAWA 1HR0Q 1V9PA 1SN8A 3F8TA 1SNCA 2IX0A 1YVCA 1Y1WB 2F3VA 4K0KQ 4QB4A 3OYYA 3V96A 4XQNA 3JAML 4FXKC 2WB1E 2Z4IA 2Z9HA 3CQZB 2C5CA 3MXUA 1VQHA 5ISRA 4BA2I 3M7GA 1AE2A 2AUJD 3PQIA 3KLWA 4A3BB 3EVQA 5C44H 1LUZA 1HQRD 2F03A 1HFNA 5LL6X 4RCOA 3PF5A 2RDHA 3DM3A 4B3RQ 1SNDA 4KKUA 2ZXOA 4JI5Q 1CHQD 1GM5A 1Q3LA 3P75A 3EROA 2JA6B 2OQKA 4DV4Q 3CC7A 3GDEA 2ASBA 1HZAA 3RN5A 4OHJA 4HTHA 2VL6A 3WOEA 1SE8A 4ID6A 3S1QH 2KECA 3WOFA 5C0XI 4B9WA 1HCZA 2D9UA 2I0QA 2EYJA 1WCMB 3KF6B 1JCKB 4CDDC 1MSGA 1PFSA 1Q82C 2ZTCA 3NBHA 2MHVA 2WACA 1L1OC 2I5MX 2HIXA 2IX1A 3K7AH 1EYDA 4K5XA 3NQTA 1PRTD 1H9MA 2B8FA 1BCPC 1EQTA 4ULLA 3S16B 4JI4L 2JA7G 2B2VA 1SYBA 4FNFA 5FO7B 3RZOB 1XNQL 3NP8A 2RCNA 3G6JB 4GN3B 3SGIA 4KLKA 3J81c 2YV5A 4EQOA 1PH7A 1ZYRD 3HOYG 4YCUA 3J7AF 1V1QA 4DK0A 3S1RB 3AYHB 2F4VQ 4IALA 2OTLA 4KHVA 3BG3A 1L0XB 1X3QA 2WAQG 4JVZA 1X3GA 5E1FA 3CP0A 3OTOQ 4JK1C 1OXTA 4OO1I 1HA5A 1R9TB 5AJ3L 3KFUA 2F0UA 2D2CC 4K0KL 3A8JE 2UUCQ 1K0SA 1ONLA 1CZGA 2UXDL 3S2DH 1NR4A 2FHTA 2CFMA 1PA6A 1HUMA 2NN6H 2EYHA 1BBUA 1SAPA 2ZTEA 3CCEA 3H3VC 3MA2B 1QVFA 3NWSA 3V2TA 4JW0A 3NE5B 1A2TA 2MPMA 4TSSA 5CC4A 2K04A 4K2KA 4G4KA 4CJ0B 4JI5L 1DXMA 4DV3Q 1TWAB 5IT9L 2QEJC 3M9BA 3N52A 3CCSA 3Q0AA 3FVQA 2JSOA 1STHA 4EQNA 1IKLA 2B2TA 1EFID 4A3DG 4BS9A 3J7A5 4RGOS 4GZYC 3CCLA 3I4LA 2PI2E 2A6EC 2F0IA 4NDXA 4DR1Q 2K05A 3SK4A 2WKDA 4IFDJ 2JA7B 1XYIA 2K32A 1C0AA 2LXKA 2XSCA 4JBKA 3GTPB 3J7ZC 4A3LG 1KD1C 3BZCA 4L5TA 4NKLA 2UU9Q 1WD1A 3BU2A 1DZ1A 1MJCA 1TWGH 3BDOA 3AFQA 1UE7A 3VR5A 3HOYB 2EE1A 3NENA 4POGA 1YBYA 3K5NA 5C4HA 5M3MB 2CH4W 3TP8A 5I6WA 1ZKOA 1FGBD 2F0GA 2EVBA 4ZQ3A 2R7DA 2K7VA 1SJHD 1HTLD 5IYDH 1YI2A 1TS4A 2WAQB 3MHBA 4DR3Q 1VQDA 1U9RA 4AH6A 2GA4B 3H6MA 3Q6SA 1LT5D 1GJXA 2WB1G 4MHEA 3CCRA 4A3EH 2UUBQ 3EN2A 5E7NA 1C48A 2NUCA 4HMIA 4NXMQ 1H9JA 2PW7A 2JYOA 1CSPA 3HS0C 5EBCA 2VQFQ 1K8GA 1ASYA 1G2SA 1EY9A 3MFGA 5DLQE 1PRTF 3CCUA 3HOWH 1XMOQ 3S1MB 3OTOL 3JAMc 3KF8B 1EY7A 4A3CG 2ZTDA 4YCWA 3NUCA 2UUCL 3CRLC 1X3PA 1H9SA 1MD2D 4NB3A 3T16A 3I3CA 4A76A 3EA6A 3W3AA 2R92G 1Q8IA 2CQAA 1PTOC 3NPPA 1RDPD 2L11A 3P1HA 2F0HA 2B29A 2NVQH 1XXGA 4K14A 2BDNA 1YHAA 5DEHA 2PPBC 1PRTB 4A3DB 3E6ZX 4PZ7A 4ALPA 3HOXH 1SMXA 2CWPA 5C6AA 2HCIA 1JORA 1KABA 1HZCA 4CKEA 1NR2A 4RGMA 4DV3L 1EZ8A 4GLAC 2YTYA 4DV0Q 3H0GH 3TMEA 1KTKA 1N34Q 4LK1C 3GTKH 4K5WA 2J0TD 1S5FD 4DR5Q 1GUWA 4BBRH 2XTIA 4HIMA 4C3JH 3D31A 2G9HD 3GD7A 4P73A 3TREA 4FO2A 2FXQA 4I65A 3OPOA 3AFPA 5GAEC 3I55A 2RDFA 4GS3A 3I4MH 4DR1L 3M85A 3T56B 1W6KA 5C44G 1MIUA 2JA5G 5LMUL 1PFBA 3PUXA 1N8RC 3CRKC 1BXTA 1D1IA 1CHPD 1U4RA 5L37A 4KY7A 4XQJA 4L5RC 4JBWA 2KVMA 4KY5A 2WB1B 3J81i 4P71A 1CT1D 1DD2A 5JAVA 4O42A 5EPLA 3IRBA 1X56A 3BVGA 3KK7A 5CBAE 4OXPA 4DR3L 4NPSA 5C4XH 4LFAQ 1SYCA 1SDFA 1EU3A 4L5QA 2UUBL 3QO2A 1KDBA 1JICA 2NVYB 4HJ9A 2CKZB 4B08A 1UE1A 4FF4A 2B63H 2BA1A 3U50C 3FKIG 2ICEC 3BYTB 5FOBB 3CCQA 4G7OC 3W5OA 2R92B 1Q81C 1KIXA 5IYBH 1I50H 2ALYB 1VQMA 1XMOL 1IL8A 3FPUB 3MFYA 3O13A 5JJZA 4PMCA 4LNQA 1HUNA 5J1ZA 1KQSA 5LMNL 3T53B 1G2TA 3HEJA 1Y8OB 2VZAA 3E9HA 3A7LA 1B1ZA 3KLRA 1MKHA 1Z9FA 5IODA 5JPNC 1VQJA 2I07B 2ZM6L 5GAGC 1JR0D 3EQLC 3VA7A 4DFAA 1GVPA 3H91A 1LTLA 3SE0A 3MXNA 5IT9c 3T51B 1QCBD 1HZBA 2R6GA 4RMFA 5C0XH 1KNAA 1C9OA 4R1JA 5DM63 1Q12A 5ELOA 3Q24A 3ITPA 4A3IH 1S40A 3CD6A 2Q2UA 4DV0L 5C44B 5IE8A 2JA5B 1N34L 4DGZA 1JJ2A 1VCIA 3C1FA 5C0XJ 3KUPA 1TIID 4DV7Q 4ZAIA 1BVSA 2IW3A 1IBLQ 1I4HA 3GTGH 5C4ZA 2F0SA 2O2LD 1CSQA 4ZUJA 4M8AA 1RODA 1C8CA 2O4XA 5ELFA 3VYUA 4LF8L 2E8GA 1IBKL 1KL9A 2A6HC 1HXYD 1QUQB 1Q8KA 2F0LA 2PW5A 1SYEA 4FYDA 4GKKQ 5E4XA 2D62A 1RD9D 4HIKA 3RUZA 5T1IA 1EQVA 5K36H 4KN7C 1E22A 2J7ZA 3I91A 1GUTA 1C7YA 3J81E 3PUVA 3T1YL 1PXUA 3FKIB 4PQXA 2R61A 4UP9A 4IFDG 3S24A 3L9AX 1PH5A 2ZJQA 5M5WH 3K7AB 4IUNA 5HGQA 4OO1H 4X3UA 2ID0A 3R2TA 4V0BA 3TEHB 2PNHA 2F0FA 3KYHC 3JAMi 4QGUA 1ICFB 4BXXH 4F87A 4UP8A 2F52A 5FJ8G 3CAMA 3Q22A 4HIDA 1LT4D 2R93G 5BR8Q 1PH6A 1XWEA 2YTVA 3K6OA 4DU9A 3BZDB 4FXDA 3C3LA 3GTLB 2DNEA 4OONA 2XRQD 1I4XA 4G57A 3S2HH 1WJJA 1A8VA 2IX3A 2L1BA 1TVXA 2AWNA 3GTJH 1FD7D 1UE5A 3OHXC 1DONA 5IYDG 2RF4A 3I7FA 4RWSC 5KIXA 5EKLA 2E2JH 1CKOA 2LMCB 4KY6A 1EFWA 5JJIA 5FLMH 2K50A 2K5VA 2XWBB 4QY7A 4A3EG 1LTGD 1J9OA 2F0TA 4GOPC 1N36Q 2E5LQ 4Y7NH 3NBIA 4A3FH 1Y8NB 3RZDH 4YY3Q 5KYLA 3HOWG 5CGKA 1B3QA 4B3TQ 1ESFA 1QWYA 1CM9A 1F9SA 4RGTA 1UWVA 1EYAA 4YHHL 3OSOA 1TXYA 1LO5D 2B3GA 5EGTA 4DV7L 4CGYB 1EOTA 5KNDA 4HCEA 1B50A 1XMQQ 4LFCQ 1TY2A 3BDLA 1I3QH 3K5OA 3AQQA 2A1AA 1QZHA 1WYDA 1LTTD 2B2YC 1NE3A 1PZKD 2N49A 2BOSA 1PVOA 1FR3A 2EY6A 3HOXG 5J3BA 4LWCA 1LYLA 3DEPA 1S5BD 3HOUH 3KLSX 5CV7A 1IKMA 3OW7A 3H0GG 2R93B 1W3SA 4GOPA 1EWHA 4DR7L 2BCOA 4HN7A 4BBRG 4A3JH 4YIJA 5D14A 1ZEQX 5C3XA 1J6QA 1TWGB 3PO2H 3V05A 4RH6A 3I4MG 4DR6L 2HUGA 5C4JH 1NNXA 5JJLA 1SYGA 4UP7A 3W1GA 1LTSD 3JAME 4TQUS 1Z6HA 3PGZA 2NTSA 3ND9A 3NELA 3FHWA 3KDFB 2OXPA 3PUYA 3NTIA 1U5KA 1XX8A 1E2WA 2KHSA 2RA4A 4A3EB 4ZUIA 2L15A 1X55A 2PZTA 1LV9A 2B2YA 3K0XA 1E7ZA 5D3DA 3M3YH 3ULJA 2ENBA 4R4TA 4DK1A 1EIYB 3HOWB 5C4XG 5I9OA 1TS2A 2QGQA 3I4OA 4KKSA 4KTAA 2Q2HA 2E5LL 1IYVA 2HQLA 3SEBA 3HOVH 2RSNA 3H94A 1VQ6A 3M7NA 2B63G 2VB2X 4FDBA 3GV3A 2MUYA 5FLXL 3A0JA 1LTRD 4B3TL 1QVCA 5IGBA 4U68A 2KCMA 1HRJA 4IUTA 4APVA 1B9NA 3ND8A 1YNND 1TWHH 2N8NA 3HOXB 5J39A 2PZUA 3B6YA 1TWFH 5KYIA 4WJWA 4LFCL 4JI1Q 4IO9A 3I2ZA 1Y69U 1K3RA 1Z47A 1PYBA 1AN8A 2EDGA 3CKIB 4PG3A 3H0GB 1F2ZA 3R93A 4QQBX 5A35A 4LUZA 2NVTH 1BDOA 3S1NB 4KHZA 4BBRB 3CMEA 3R3OA 2VS1A 3DM1A 5C0XG 4K6DA 3P7JA 2BDOA 5ELEA 3I4NH 5TSSA 4NW2A 3I4MB 4U673 4PNYA 3BS1A 1EU4A 2MO0A 4I7AA 4OWXB 4RA8A 5M3FG 3K58A 3F2CA 1ET6A 3NEMA 1SROA 3LX0A 4RFBA 2Z6BA 4DUYQ 4J15A 5CV9A 4BY1H 5M5YB 4BA1I 4Y52H 4QUCA 2WIIB 2CW0D 1K8OA 1Q7YC 4AQYQ 1OXUA 3MZ5A 4HEDA 3H3VI 2Y0SE 5C4XB 4JPBW 1YHBA 4IUPA 1DOKA 1HJPA 5CV5A 2RBMA 3PUWA 1IW7C 2F0OA 4P72A 1LABA 1KXLA 4ZKBB 3N6RA 1AE3A 1LTAD 1CKNA 3TS0A 5LMNW 1VQ7A 3PIO3 1IBML 1A2UA 5IT9E 3A54A 1XNRQ 4J8QA 2UXCL 1SNOA 2NWGA 1OXXK 1BBXC 2QW7A 3KF6A 4LF5Q 1I4PA 5AFWA 3PO3G 4BXXG 4A75A 3HRZC 3GV6A 3RR5A 4UAIA 3K5MA 1KHIA 1HR0L 5I2XA 1VQ9A 5EJWA 5IGFA 3A5ZB 1VQOA 4A3MH 4HSPA 5IP9H 1K3BC 2IHEA 4A93H 4X65Q 5GADC 4MNOA 4C2MH 2F0WA 1L1OA 1F2YA 2FINB 1N32Q 2A69D 3QR8A 3J7AV 4MN3A 4JBJA 1QG7A 1GO3E 4JI0Q 2JEBI 2E2HB 5C3EH 3FEWX 1EIGA 4JOIC 1Y1VH 4B3RL 3PIP3 2R7ZH 2LS01 3TP7A 1C4QA 2L55A 5FLMG 5M3FB 1A3VA 2LY7A 1D5MC 2X69A 3BYYB 4DV4L 4JI8Q 1U4MA 2RCFA 3STBC 4IPDA 1PH3A 1RIPA 2NVXB 1UNSA 3T13A 2FJ2A 1SR3A 2L12A 3GTGB 1PH2A 1JOOA 3KJPA 2NTTA 2KEDA 3U9OA 1AH9A 4PV1C 3FP9A 4BBSH 4ZYSA 1XPUA 1W2BA 1EY5A 3GTOH 1CKMA 1T5EA 1UUPA 3OMGA 1BUVT 1X9NA 1BNZA 3CCJA 5LHY1 1NMGA 2JE6I 5IGCA 1VQEA 4L8JA 1IHZA 3TDQA 2JK8A 2ZT9C 1SSOA 1MJEA 3HKSA 2A5HA 2G9DA 5CR3A 1YEZA 1SYFA 1GKHA 3TS2A 4DV6Q 2B2UC 4C3IG 2XVSA 4NXNQ 5M5WB 4JI2Q 5I2YA 4BY7H 3ULLA 1K83H 2KA7A 2WP8J 2JA8H 3PO3B 3J80L 5ELBA 1LLRD 2UXBQ 4FVMA 3H09A 3DWPA 1JE4A 2JJQA 1JWMD 4XYOA 3TZUA 2F4VL 1B53A 1XNRL 1A15A 5IYCH 1HQMC 4EVOA 4KN4C 4A3JG 3MXGA 4JI3Q 1OXSC 3ULPA 3PO2G 2IY5B 3X3NA 5EPKA 4RHRA 3NTHA 3SDZA 4A4IA 2OQ0A 2F1MA 5FLXc 4X66Q 3T1HQ 3S2HB 1PH1A 1SRUA 2EXDA 1YJ9A 1GHJA 3GTJB 1GUOA 1TKWB 1K0RA 3NXWA 2E2JB 4P2CB 1TS3A 4DPGA 5IWAQ 1A3UA 1PRTC 1TWCH 1EUJA 2CW0C 4ME3A 4Z9CB 1LTBD 1NAPA 1EL0A 1D2BA 2QDLA 1LT6D 3U4VA 3VR6A 4FP5D 2OWOA 3L3OC 3RLOA 4PZ8A 4LF4Q 1JE5A 2DN8A 1FL0A 2IJ0A 4Y7NB 4IN3A 5FK9C 4DAVA 1WTVA 2XWJB 3RZDB 4XQQA 1Q90A 3VR2A 2IL8A 3HOZG 3PSIA 2Q8IB 3QOLA 1GUGA 1ZYRC 2NBFA 1Y1WH 4X6AH 2E2IH 5M5XB 5IP7H 1K8MA 3S15B 2TSSA 1B9MA 1TU2B 2EJGC 1VQNA 3HOVG 4HCSA 4JI8L 3D6WA 5KGUA 3AB9A 3KF8A 4QJFA 1HNXQ 3M4OH 2Y0SG 1ESRA 2H1EA 1I3QB 4S3SA 1AZPA 4A3KH 2PNRC 1CZWA 1LTID 4C3IB 4WJ4A 1VQ8A 1O7IA 3OMCA 1EY4A 2PQAA 3NTKA 2Z4HA 2UU9L 2G5DA 2B2WC 1SFOH 3UI2A 2MGSA 2Q2TA 1PZJD 1WTPA 1N33Q 1SNMA 1IYJB 3D8GA 2L0CA 1QVGA 1ZXTA 3K81C 1SMYD 1GUNA 2RVLA 1WCMH 1FJGQ 4J6HA 4X3KA 3I4NG 1VF5C 1VS0A 2IPKD 2L9HA 2UXBL 1STGA 5I6YA 4LF7Q 4LF9Q 1EWIA 4HSVA 3ONAB 3OWFA 4NXML 3SK6A 4PMBA 1B8AA 1SE4A 2A68D 4E6IA 4ABNA 1VDZA 1JT8A 5JJKA 2VQFL 1E2ZA 4DV1Q 3MC0B 4IPCA 4RKLA 4KHPQ 4JI3L 1WTRA 2GVBA 4UHVA 1JWUD 1H95A 2I46A 1TY0A 1O78A 1VMCA 1G6ZA 1H9RA 4IURA 4X66L 5KEEA 3RZOH 2EZVA 1E1OA 2FMCA 3OW2A 2HHHQ 1STNA 4O1NA 2K5QA 4CHTB 4CDEC 5IWAL 3W2DA 4F7XA 1CA6A 2B8GA 3S1RH 3HOZB 4GN4B 2NZ1D 1FNWA 3S14B 3NWTA 4HAEA 4JCVE 1EYCA 1UAPA 2RDGA 2EYFA 1A3TA 3HOVB 3X3MA 3E9IA 2ZXPA 4YWMA 2NYZD 2Y0SB 1YHQA 1Q1EA 1N9WA 1R9TH 1ASZA 1B70B 2OTJA 3BVMA 4OX9Q 2QCPX 3NSWA 3UDFA 1EEFD 2XRSD 5HY6A 3K0YA 3TP5A 4DR5L 4A3MG 1PH8A 3D4DA 5IP9G 1P16A 3HKZG 4A93G 2DY8A 4DR2Q 1VQLA 2NN6G 4O0AA 4ODGA 3SK5A 4LAAA 4GNXC 3H3VH 4Q0FA 2NVTB 2EOTA 4TRDA 3PMFA 1I6HH 2YYZA 4XT3B 1V1OA 4DF7A 1YNJD 2H4OA 4GNXB 4DXFA 1BR9A 1XTCD 3I4NB 3LGJA 5C3EG 3VYRA 1SBBB 1E0BA 2K6AA 2MQHA 1S3OA 2R7ZG 5I4DA 2J4XA 3T4AC 1DYQA 4C56C 3S1QB 3TQYA 1HNWQ 2F0EA 4CDFC 1K9MC 1EYGA 4LMQD 3J80c 3CXCA 4QUFA 5CMDA 4QIWB 2V4DA 4R4QA 5A2QL 2X6LA 1NTGA 1SYDA 3W1BA 5JPMC 4L6TB 4AIMA 4LFAL 2JA7H 4LF7L 2O5JC 3GTPH 4DNRB 3R8BA 1BO0A 4BBSG 1DOMA 5CV8A 3K5LA 2N88A 4KHPL 3BVZA 1DM0B 5M3MH 1G51A 1E3PA 4DR4Q 2R3ZA 1ENCA 5IGGA 1MBYA 2Z6KC 1VQIA 2HHHL 2C35B 1HR0W 4IFDI 1F2LA 2F0DA 1I6VC 2Q8TA 1Q86C 1VQGA 2QDBA 3WWVA 4BY7G 2KENA 1KRTA 2JA8G 1B3AA 4GLVB 1KLUD 5CBEE 2BA0A 1HH2P 4A3MB 3I90A 1VQAA 3SR1A 1X6OA 4A93B 3S2DB 4N9TA 3PV0A 4C2MB 5IYCG 4O2DA 1BKBA 4DAMA 3I56A 3DMUA 2OT2A 4KI0A 1X54A 2DJGC 4LJZC 3DXJC 3D4WA 1TQOA 3MWYW 1V1PA 4DKAC 2VUMH 4N9PA 1QOHA 1IBLL 3QOJA 4X3TA 1A0IA 1D5XC 1E2VA 1PTOH 2EY2A 1IXRA 3TN2A 5IY0A 2R7ZB 1AP0A 4KK7A 2P5ZX 3U58A 2K5NA 3F1ZA 4KD4A 1G91A 1PZID 1I94Q 5COYA 5DNFA 1DJRD 5IGDA 1J8IA 2CWAA 4PMWA 1OO9B 1Y8PB 4GKKL 4EX5A 1S5ED 2AUKA 2D0PA 3PF4A 4WFN3 1BCPD 2VNUD 4FF3A 1F9QA 4GKJQ 1YJNA 1SE2A 2K03A 4MIUA 3E0EA 1KDCA 1CK1A 1HNWL 2F0NA 3I70A 5IP7G 2NZHA 3MTSA 4ZLTF 5C5MA 1ET9A 2RHSB 1JC7A 1CA5A 4BBSB 4B9XA 3SK8A 1B4OA 4H0LC 4QF4A 4XTCS 2PZWA 1EIFA 4KKTA 4C3JG 2K5HA 4CKBA
chains in the Genus database with same CATH topology
1O7ZA 5CORA 2E76C 2IT1A 4RAUC 5FLXE 3SHLA 2F0KA 2BE5D 4XXEA 4BY7B 4RHSA 2EYPA 2E75C 4G7ZC 1K83B 4CJ2C 3SXHA 1BQQT 3L7ZC 2EYOA 1QE6A 2Q8RE 1HA6A 2C9OA 2XN9C 1KDAA 3VA5A 1RF2D 5NUCA 2KQ3A 4R8NA 1PLFA 4K2LA 2EY5A 4FXGC 2M2LA 3D3RA 2NVQB 1GHKA 1ENFA 3IAYA 1F77A 1T5XD 2EY1A 2ICIA 4V190 1HHVA 2A74C 1RJTA 2A6ED 2VB3X 2FMMA 4CKCA 2E2IB 3HG9A 3KLSA 1CFMA 2O5IC 3E5SA 1EY0A 3GTKB 5CYUA 3TZDA 4DAYA 3A7AB 1AEXA 3M4OB 1PFNA 1RHPA 4C3JB 3SVMA 2B2VC 4QMGA 4A3KB 2F0PA 2K1BA 4R9WA 1PDQA 3NK9A 2DY7A 1ML0D 4BWGB 5I9PA 3DWAA 5JEAH 1SJED 2PQEA 3RMHA 1SFOB 5BN4A 3A8KE 5DAUA 4IZ8A 2L5TA 1U4PA 5JEAJ 1BCPF 5K36G 4F88A 3QG1A 3QJYA 4K6LA 2B63B 2SDFA 1PTOD 4M1UB 5ELDA 3HGBA 1I50B 4OO1G 1BCPB 2KCNA 3NHHA 4IUUA 1I4RA 2B2TC 1AFPA 5T1GA 1ENAA 2MJ8A 1CQVA 3IKJA 1X32A 3C1EA 3FRPB 1LT3D 3Q23A 2EXZA 1F2MA 4K8JA 1D5ZC 2BE5C 3A8IE 1NUCA 4DAPA 1QNKA 3RD4A 5E4WC 2PYKA 2QF7A 2HDMA 4A3IB 1PFMA 2SNMA 1WTOA 3J80E 1VMPA 1GUSA 3R2IA 1EIHA 1I4QA 1GOZA 2RQXA 4ME5A 3OIQA 1I6HB 3TBIB 1QNUA 4R8IA 1VF7A 4IUVA 4IFDH 1ILPA 1NSNS 1A6XA 3HP3A 1YNNC 1CQFA 1STAA 1JWSD 2M9VA 5D3IB 5EQ0A 3DEOA 4J1MA 2K28A 1I4GA 2VXWA 1S5CD 4C1NK 2AQ1B 1STYA 2WV6D 3FPPA 2OF1A 2M00A 3J7YW 2EJFC 2HCCA 1H9SB 1MSHA 4C1NI 4HR7B 5KNBA 2NB0A 4OL7A 3D6CA 1II3A 4NP5A 4NMZA 2EYLA 3FMCA 4L63B 2RSOA 4H44C 4KJNA 5K5PA 1MGSA 2AWOA 3IFTA 2N55A 1U4LA 1TR5A 3VR3A 3PUZA 2FFKB 1R4QB 3GO5A 1HFGA 4XIGS 4KJOA 1PTOF 1SE3A 2KOLA 4XYQA 5E3FA 4KMUC 4A3FB 4H7BA 2B2UA 5JOBA 4OGQC 4KV6A 2A6HD 1RCVD 5BN5A 1V8QA 5EKIA 4HMJA 2L4NA 1QB5D 2VUMB 5KRUA 1GXDC 2JP1A 2WINB 1QJOA 1SEBD 1PTOB 3LNNA 2EYMA 4IQZA 2F0QA 2F0VA 4EQPA 4OIKA 3K57A 3TP6A 2AQ2B 3QWNA 3HOUB 4DXGA 2K5DA 1RTNA 4KD3A 3AU7A 2A69C 2K5WA 1G291 4WORA 3I73A 4RKBA 1RTOA 2KCCA 3IFDA 4IUQA 1L0YB 2RKSA 3VR4A 2QILA 2KUMA 4A3JB 3LWEA 3PO2B 4DA2A 3P20A 4AYBB 3K59A 5C4JB 3M4YA 2HQEA 5FKAC 2Z8LA 4XT1B 1TS5A 2KJXA 2PO4A 1W6JA 4WRDA 5JEAG 2SEBD 2F4IA 1JOQA 4OIJA 3FDTA 4FF1A 1FYCA 2X6GA 3M3YB 3TSSA 5IIFA 2QKIC 2Z1CA 1S4ZA 3C2PA 4ZK9B 5LL6S 1CI3M 1JQYD 4EGVA 3DUZA 2B2WA 3IL8A 1JB3A 4X3SA 5IGEA 2E2DC 2A73B 1JOKA 3OIPA 2EJMA 2LKVA 1UEAB 2HDLA 1Z7TA 3CU7A 4C3HG 1S5DD 3MEHA 1FNUA 5A2QE 3VYSA 4DNTB 1D1KA 1TWHB 3C46A 3HZXA 1TWFB 2YU9B 5EBDA 5FO8B 1AZQA 3ZYYX 3KBXA 5G3LD 2K01A 2DNCA 1RKNA 1KLGD 1KAAA 1HTPA 3S9WA 4CJ1B 4QCLA 4DN4M 3S17B 1Q1BA 4ZKCB 5EKKA 1MI2A 1KNEA 1EY8A 1WTXA 3LWUA 1LACA 2ZXRA 5D65A 3OOCA 1O7LA 2E74C 1FNVA 2NN6I 2D5DA 2JXMB 3GTMB 4BY1B 5CV6A 1PYWD 1O80A 1STBA 3DWQA 5IOCA 1QILA 1H9KA 4H13C 2MP1A 3KBGA 1WVLA 1BF4A 1HPCA 3WDNA 2PMZB 4G7HC 3G7LA 1DOLA 3OWEB 1SNPA 3U9SA 2AQ3B 1D6EC 4K5VA 4CBVA 5ELCA 3QB3A 3I72A 4ZRZA 4Q5VA 4C3HB 3MAQA 1STEA 1B2TA 2OEOA 1F9PA 2PCFB 1SMYC 1V1PB 1DCZA 4F8MA 3NQIA 3HKZB 4UDUC 3GP7A 5BN3A 1EWCA 5EPJA 2TMPA 3J81L 2A68C 3MXPA 1ILQA 2F0MA 5M9OA 5C3EB 1Y1VB 3RLFA 5HURA 2SNSA 1B44D 2LFNA 3F2UA 2CHBD 2EPBA 4RGNA 2SOBA 5C5LA 2KEEA 3BDCA 3D4RA 3AMUA 2B39A 3GTQB 1V43A 1ICWA 3I8ZA 2F0JA 3GQBA 4XDXA 5HGTA 5C3WA 2JEAI 1WTQA 1IW7D 3GTOB 2WKCA 5G3LF 1TT2A 1M4VA 3VYTA 2XIWA 3URYA 2IWHA 5F2DA 5JVG3 4RCNA 5DM73 5J22A 3CHBD 1AW7A 3EFXD 1F9RA 4FF2A 2JA8B 1O7YA 1EZ6A 1NCVA 1EEID 1YNJC 5JVH3 3MVVA 4ILWA 2F3WA 4A3GB 1R4PB 1EY6A 1CTMA 3ERQA 2K33A 3A56A 1G8ZD 1SNQA 3DHQA 2CVRA 1SXTA 5CV4A 5KNCA 1TWCB 1M8AA 1IYUA 3EJIA 4K8IA 4TKOB 1OXVA 5FO9B 1BOSA 1WTWA 3A55A 1WD0A 1PMRA 3E0JA 4I7ZC 2XNAC 3QIAA 1SNCA 2IX0A 1Y1WB 2F3VA 4QB4A 3V96A 4XQNA 3JAML 4FXKC 2Z4IA 3CQZB 2C5CA 3MXUA 5ISRA 4BA2I 4A3BB 3M7GA 2AUJD 3EVQA 1HQRD 2F03A 1HFNA 5LL6X 4RCOA 2RDHA 1SNDA 4KKUA 2ZXOA 1CHQD 1Q3LA 3P75A 3EROA 2JA6B 4OHJA 4HTHA 3WOEA 4ID6A 2KECA 3WOFA 5C0XI 4B9WA 1HCZA 2D9UA 2EYJA 1WCMB 1JCKB 1MSGA 3NBHA 2MHVA 2WACA 2IX1A 1EYDA 4K5XA 3NQTA 1PRTD 1H9MA 2B8FA 1BCPC 1EQTA 4ULLA 3S16B 2B2VA 1SYBA 4FNFA 5FO7B 3RZOB 3NP8A 3G6JB 4EQOA 1ZYRD 3J7AF 4DK0A 3S1RB 4IALA 4KHVA 3BG3A 1L0XB 1X3QA 5E1FA 4JK1C 1OXTA 4OO1I 1HA5A 1R9TB 2F0UA 2D2CC 3A8JE 1ONLA 1CZGA 1NR4A 2FHTA 1HUMA 2NN6H 2EYHA 1SAPA 3H3VC 3MA2B 3NWSA 3V2TA 3NE5B 1A2TA 2MPMA 4TSSA 5CC4A 2K04A 4K2KA 4G4KA 4CJ0B 1DXMA 1TWAB 5IT9L 2QEJC 3N52A 3Q0AA 3FVQA 2JSOA 1STHA 4EQNA 1IKLA 2B2TA 1EFID 4BS9A 4RGOS 4GZYC 3I4LA 2A6EC 2F0IA 4NDXA 2K05A 3SK4A 2WKDA 4IFDJ 2JA7B 1XYIA 2K32A 2XSCA 3GTPB 4NKLA 1WD1A 1DZ1A 3BDOA 3VR5A 3HOYB 2EE1A 3K5NA 5C4HA 5M3MB 3TP8A 5I6WA 1ZKOA 1FGBD 2F0GA 2EVBA 4ZQ3A 2K7VA 1SJHD 1HTLD 1TS4A 2WAQB 3MHBA 1U9RA 2GA4B 3H6MA 3Q6SA 1LT5D 1GJXA 4MHEA 1C48A 2NUCA 4HMIA 1H9JA 2PW7A 2JYOA 3HS0C 5EBCA 1G2SA 1EY9A 3MFGA 1PRTF 3S1MB 1EY7A 3NUCA 3CRLC 1X3PA 1H9SA 1MD2D 3T16A 3I3CA 3EA6A 3W3AA 1Q8IA 2CQAA 1PTOC 3NPPA 1RDPD 2L11A 3P1HA 2F0HA 1XXGA 4K14A 2BDNA 5DEHA 2PPBC 1PRTB 4A3DB 3E6ZX 5C6AA 2HCIA 1JORA 1KABA 4CKEA 1NR2A 4RGMA 1EZ8A 3TMEA 1KTKA 4LK1C 4K5WA 2J0TD 1S5FD 1GUWA 3D31A 2G9HD 3GD7A 4FO2A 4I65A 3OPOA 2RDFA 3M85A 3T56B 1W6KA 1PFBA 3PUXA 3CRKC 1BXTA 1D1IA 1CHPD 1U4RA 4KY7A 4XQJA 4JBWA 2KVMA 4KY5A 2WB1B 1CT1D 1DD2A 5JAVA 4O42A 5EPLA 3BVGA 3KK7A 5CBAE 1SYCA 1SDFA 1EU3A 3QO2A 1KDBA 1JICA 2NVYB 4B08A 4FF4A 2BA1A 2ICEC 3BYTB 5FOBB 4G7OC 2R92B 1IL8A 3FPUB 3MFYA 3O13A 5JJZA 4PMCA 1HUNA 5J1ZA 3T53B 1G2TA 3HEJA 1Y8OB 3A7LA 1B1ZA 3KLRA 5IODA 5JPNC 2I07B 1JR0D 3EQLC 3VA7A 4DFAA 3H91A 3SE0A 3MXNA 3T51B 1QCBD 2R6GA 5C0XH 1KNAA 5DM63 1Q12A 3Q24A 3ITPA 5C44B 2JA5B 4DGZA 1VCIA 3C1FA 5C0XJ 3KUPA 1TIID 4ZAIA 2IW3A 1I4HA 5C4ZA 2F0SA 2O2LD 4ZUJA 4M8AA 1RODA 1C8CA 2O4XA 5ELFA 3VYUA 2A6HC 1HXYD 2F0LA 2PW5A 1SYEA 4FYDA 5E4XA 2D62A 1RD9D 3RUZA 5T1IA 1EQVA 5K36H 4KN7C 2J7ZA 3I91A 1GUTA 3J81E 3PUVA 1PXUA 3FKIB 4PQXA 2R61A 4IFDG 3L9AX 3K7AB 4IUNA 4OO1H 4X3UA 2ID0A 3R2TA 4V0BA 2F0FA 4F87A 3Q22A 1LT4D 1XWEA 3K6OA 4DU9A 3BZDB 4FXDA 3C3LA 3GTLB 2DNEA 2XRQD 1I4XA 4G57A 2IX3A 2L1BA 1TVXA 2AWNA 1FD7D 3OHXC 1DONA 4RWSC 5KIXA 5EKLA 2LMCB 4KY6A 2XWBB 1LTGD 1J9OA 2F0TA 3NBIA 1Y8NB 5KYLA 5CGKA 1ESFA 1QWYA 1CM9A 1F9SA 4RGTA 1EYAA 3OSOA 5EGTA 1LO5D 4CGYB 1EOTA 5KNDA 4HCEA 1B50A 1TY2A 3BDLA 3K5OA 1LTTD 2B2YC 1PZKD 2BOSA 1FR3A 2EY6A 3DEPA 1S5BD 3KLSX 5CV7A 1IKMA 3OW7A 2R93B 1EWHA 2BCOA 4HN7A 4YIJA 5D14A 1ZEQX 5C3XA 1TWGB 3V05A 4RH6A 2HUGA 1SYGA 1LTSD 3JAME 4TQUS 1Z6HA 2NTSA 3ND9A 2OXPA 3PUYA 3NTIA 1XX8A 1E2WA 2KHSA 2RA4A 4A3EB 4ZUIA 2PZTA 1LV9A 2B2YA 5D3DA 2ENBA 4DK1A 3HOWB 5I9OA 1TS2A 4KKSA 4KTAA 1IYVA 3SEBA 2RSNA 3H94A 3M7NA 2VB2X 3GV3A 2MUYA 5FLXL 1LTRD 5IGBA 4U68A 1HRJA 4IUTA 1B9NA 3ND8A 1YNND 3HOXB 5J39A 2PZUA 5KYIA 4WJWA 1Y69U 1Z47A 1AN8A 2EDGA 3CKIB 3H0GB 1F2ZA 3R93A 5A35A 1BDOA 3S1NB 4KHZA 4BBRB 3R3OA 3DM1A 5C0XG 4K6DA 3P7JA 2BDOA 5ELEA 5TSSA 4NW2A 3I4MB 4U673 4PNYA 3BS1A 1EU4A 4RA8A 3K58A 1ET6A 3LX0A 4RFBA 5CV9A 5M5YB 4BA1I 4QUCA 2WIIB 2CW0D 1K8OA 1OXUA 3MZ5A 4HEDA 5C4XB 4IUPA 1DOKA 5CV5A 2RBMA 3PUWA 1IW7C 2F0OA 1LABA 4ZKBB 3N6RA 1LTAD 3PIO3 1A2UA 5IT9E 3A54A 4J8QA 1SNOA 2NWGA 1OXXK 1BBXC 1I4PA 5AFWA 3HRZC 3GV6A 4UAIA 3K5MA 5I2XA 5EJWA 5IGFA 4HSPA 2F0WA 1F2YA 2FINB 2A69D 3J7AV 4MN3A 1QG7A 2JEBI 2E2HB 3FEWX 1EIGA 3PIP3 2LS01 3TP7A 1C4QA 2L55A 5M3FB 1A3VA 2LY7A 1D5MC 2X69A 3BYYB 1U4MA 2NVXB 1UNSA 3T13A 2FJ2A 3GTGB 2L12A 1JOOA 2NTTA 2KEDA 3U9OA 4PV1C 4ZYSA 1EY5A 1T5EA 1UUPA 3OMGA 1BUVT 1BNZA 5LHY1 2JE6I 5IGCA 4L8JA 1IHZA 3TDQA 2ZT9C 1SSOA 5CR3A 2A5HA 2G9DA 1SYFA 2B2UC 4C3IG 2XVSA 5M5WB 5I2YA 2KA7A 2WP8J 3PO3B 3J80L 5ELBA 1LLRD 4FVMA 3H09A 3DWPA 1JE4A 4XYOA 1JWMD 3TZUA 1B53A 1A15A 1HQMC 4EVOA 4KN4C 3MXGA 1OXSC 3X3NA 5EPKA 4RHRA 3NTHA 3SDZA 2F1MA 3S2HB 1GHJA 3GTJB 1GUOA 1TKWB 3NXWA 2E2JB 4P2CB 1TS3A 1A3UA 1PRTC 2CW0C 4Z9CB 1EL0A 1LTBD 1NAPA 1D2BA 1LT6D 3VR6A 4FP5D 3L3OC 2DN8A 2IJ0A 4Y7NB 4IN3A 5FK9C 4DAVA 1WTVA 2XWJB 3RZDB 4XQQA 1Q90A 3VR2A 2IL8A 2Q8IB 3QOLA 1GUGA 1ZYRC 2NBFA 5M5XB 1K8MA 3S15B 2TSSA 1B9MA 1TU2B 2EJGC 4HCSA 3D6WA 5KGUA 3AB9A 3KF8A 1ESRA 2H1EA 1I3QB 4S3SA 1AZPA 2PNRC 1CZWA 1LTID 4C3IB 3OMCA 1EY4A 3NTKA 2Z4HA 2B2WC 3UI2A 2MGSA 1PZJD 1WTPA 1SNMA 3D8GA 2L0CA 1ZXTA 1SMYD 1GUNA 2RVLA 4J6HA 4X3KA 1VF5C 2IPKD 2L9HA 1STGA 5I6YA 4HSVA 3ONAB 3OWFA 3SK6A 4PMBA 2A68D 1SE4A 4E6IA 4ABNA 1VDZA 1E2ZA 3MC0B 4RKLA 1WTRA 1JWUD 2I46A 1TY0A 1O78A 1VMCA 1G6ZA 1H9RA 4IURA 5KEEA 2EZVA 2FMCA 1STNA 4O1NA 2K5QA 4CHTB 3W2DA 4F7XA 1CA6A 2B8GA 3HOZB 2NZ1D 1FNWA 3S14B 3NWTA 4HAEA 1EYCA 1UAPA 2RDGA 2EYFA 1A3TA 3HOVB 3X3MA 2ZXPA 2NYZD 2Y0SB 1Q1EA 3BVMA 2QCPX 3NSWA 1EEFD 2XRSD 3K0YA 3TP5A 3D4DA 2DY8A 2NN6G 4ODGA 3SK5A 4LAAA 4Q0FA 2NVTB 2EOTA 4TRDA 3PMFA 2YYZA 4XT3B 1V1OA 4DF7A 1YNJD 2H4OA 4DXFA 1BR9A 1XTCD 3I4NB 3VYRA 1SBBB 1E0BA 2K6AA 5I4DA 2J4XA 3T4AC 1DYQA 4C56C 3S1QB 2F0EA 4LMQD 4QUFA 5CMDA 4QIWB 2V4DA 5A2QL 2X6LA 1SYDA 5JPMC 4L6TB 2O5JC 4DNRB 3R8BA 1BO0A 1DOMA 5CV8A 3K5LA 2N88A 3BVZA 1DM0B 2R3ZA 1ENCA 5IGGA 1MBYA 4IFDI 1F2LA 2F0DA 1I6VC 2Q8TA 2QDBA 1B3AA 1KLUD 5CBEE 2BA0A 4A3MB 3I90A 3SR1A 4A93B 3S2DB 4N9TA 3PV0A 4C2MB 3DMUA 2OT2A 4KI0A 4LJZC 3DXJC 3D4WA 1TQOA 3MWYW 1V1PA 4N9PA 1QOHA 3QOJA 4X3TA 1D5XC 1E2VA 1PTOH 2EY2A 3TN2A 2R7ZB 1AP0A 4KK7A 1G91A 4KD4A 1PZID 5COYA 5DNFA 1DJRD 5IGDA 1J8IA 4PMWA 1OO9B 1Y8PB 1S5ED 2AUKA 4WFN3 1BCPD 2VNUD 4FF3A 1F9QA 1SE2A 2K03A 4MIUA 1KDCA 1CK1A 2F0NA 3I70A 4ZLTF 3MTSA 5C5MA 1ET9A 1CA5A 1JC7A 4BBSB 4B9XA 3SK8A 1B4OA 4H0LC 4QF4A 4XTCS 2PZWA 4KKTA 4C3JG 4CKBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2SOB A;  3S9W A;  2EYH A;  5C5L A;  4KD3 A;  1NSN S;  5ISR A;  2PQE A;  3OWF A;  2ENB A;  3P1H A;  3BDC A;  1A2U A;  4PMB A;  5EKL A;  3EVQ A;  2F0H A;  4WOR A;  3SK6 A;  4E6I A;  5IOD A;  5KIX A;  4RKB A;  4K14 A;  2F0J A;  5DAU A;  1SNO A;  4IZ8 A;  3V2T A;  3SHL A;  4KY6 A;  2F0K A;  5CV8 A;  5DEH A;  4RKL A;  1STA A;  4DFA A;  1A2T A;  4EVO A;  5I9O A;  5HGT A;  5C3W A;  4KTA A;  2RKS A;  2F0T A;  5EKK A;  2EYP A;  1EY8 A;  5CC4 A;  5C6A A;  1ENC A;  4K2K A;  4J1M A;  1SND A;  5IGG A;  5KEE A;  1KAB A;  1JOR A;  5IGF A;  3SXH A;  1EZ8 A;  1STY A;  1STN A;  1TT2 A;  5KYL A;  5CGK A;  3NXW A;  3ITP A;  2EYO A;  2F0D A;  2OF1 A;  3ERO A;  3P75 A;  5CV6 A;  2HQE A;  2M00 A;  3TME A;  1STH A;  1A3U A;  1STB A;  2F0W A;  1F2Y A;  4EQN A;  4F7X A;  5IGB A;  5IOC A;  2QDB A;  1KDA A;  4DGZ A;  4K5W A;  1EYA A;  3C1F A;  3OSO A;  5EGT A;  5F2D A;  3VA5 A;  1EYC A;  4HTH A;  4OL7 A;  5NUC A;  2EYF A;  3D6C A;  1A3T A;  2PZU A;  5KYI A;  4WRD A;  4ID6 A;  5J39 A;  1II3 A;  4NP5 A;  2F0I A;  4I65 A;  4NMZ A;  2EYL A;  5J22 A;  5C4Z A;  2RDF A;  4NDX A;  4B9W A;  3NHH A;  2F0S A;  3SK4 A;  1JOQ A;  2EYJ A;  4ZUJ A;  4KJN A;  2KQ3 A;  5K5P A;  2O4X A;  4R8N A;  3BDL A;  3SR1 A;  1SNP A;  4N9T A;  4K2L A;  2EY5 A;  1F2Z A;  1EZ6 A;  3QOL A;  3TP7 A;  1TR5 A;  2WAC A;  2F0L A;  4K5V A;  2PW5 A;  1SYE A;  1ENA A;  1EYD A;  1A3V A;  4K5X A;  4NKL A;  2EY6 A;  5IIF A;  3DMU A;  4KY7 A;  3QB3 A;  3NQT A;  3MVV A;  3R3O A;  3C1E A;  5CV7 A;  3RUZ A;  4KY5 A;  2EXZ A;  1F2M A;  2F3W A;  1EQV A;  4K6D A;  2EY1 A;  3D4W A;  3T13 A;  3TP5 A;  5JAV A;  4K8J A;  5C4H A;  5KGU A;  4KJO A;  1TQO A;  3D4D A;  3TP8 A;  1JOO A;  5I6W A;  5IGD A;  2OEO A;  2F0G A;  4PNY A;  1EY6 A;  4N9P A;  1NUC A;  4ZQ3 A;  3U9O A;  1SYB A;  3QOJ A;  5E3F A;  2EY2 A;  4ODG A;  4S3S A;  3MHB A;  3SK5 A;  5IGE A;  4H7B A;  4LAA A;  3ERQ A;  3NP8 A;  1U9R A;  4KD4 A;  4F8M A;  2PYK A;  1JOK A;  3LX0 A;  1SYC A;  3H6M A;  5JOB A;  4IUN A;  1SNQ A;  3DHQ A;  2LKV A;  3PMF A;  4KV6 A;  4TRD A;  5CV4 A;  4YIJ A;  4EQO A;  1EY5 A;  3E5S A;  1EY0 A;  5C3X A;  2F0F A;  2SNM A;  3OMG A;  3OMC A;  1KDB A;  5CV9 A;  3EJI A;  3MEH A;  1EY4 A;  4DF7 A;  2NUC A;  4HMI A;  4IAL A;  1AEX A;  2PW7 A;  4HMJ A;  4K8I A;  1SYG A;  5IGC A;  3MXP A;  4KHV A;  1IHZ A;  5KRU A;  3HZX A;  4MIU A;  5CR3 A;  1EY9 A;  2F0M A;  5M9O A;  1KDC A;  1SYF A;  1SNM A;  2F0E A;  2F0N A;  3MZ5 A;  4QMG A;  2OXP A;  3D8G A;  5E1F A;  4DU9 A;  5C5M A;  2EYM A;  2F0P A;  4B9X A;  4ME5 A;  2F0Q A;  2F0V A;  1EY7 A;  3SK8 A;  5CV5 A;  4EQP A;  5HUR A;  2RBM A;  5I6Y A;  4PMC A;  1SNC A;  2KHS A;  2SNS A;  3NK9 A;  5J1Z A;  3TP6 A;  2F0U A;  2F3V A;  2F0O A;  4QB4 A;  1SYD A;  4QF4 A;  3NUC A;  4J6H A;  1RKN A;  4ZUI A;  4G57 A;  2PZW A;  5I9P A;  2PZT A;  3T16 A;  1KAA A;  3HEJ A;  1STG A; 
#chains in the Genus database with same CATH topology
 1O7Z A;  3K7U C;  5COR A;  2E76 C;  2IT1 A;  4RAU C;  5FLX E;  4A3K G;  2AMC B;  3SHL A;  5BR8 L;  2F0K A;  4HJA A;  2BE5 D;  4XXE A;  4BY7 B;  4RHS A;  2EYP A;  2E75 C;  4G7Z C;  4DR4 L;  1K83 B;  2GVA A;  4CJ2 C;  3SXH A;  4OWT B;  4MZ9 A;  1BQQ T;  3L7Z C;  2H5X A;  4MTK A;  4LF6 Q;  1VQF A;  1Y14 B;  2EYO A;  1GD7 A;  2K52 A;  1UE6 A;  1QE6 A;  4JG2 A;  1YNX A;  2NZO A;  2Q8R E;  2C9O A;  2XN9 C;  4DUZ Q;  1HA6 A;  1KDA A;  2NVY H;  4HJ7 A;  3VA5 A;  1WCM G;  4JI4 Q;  1RF2 D;  5NUC A;  4YWK A;  1U0L A;  1N36 L;  1XNQ Q;  2KQ3 A;  2N78 A;  4R8N A;  1PLF A;  4K2L A;  3RLN A;  2EY5 A;  2A8V A;  4JV5 Q;  4FXG C;  4YY3 L;  2M2L A;  5IYB G;  3D3R A;  3K8A A;  3A74 A;  2A19 A;  2NVQ B;  1GHK A;  1ENF A;  3IAY A;  1F77 A;  3KDF A;  1T5X D;  2CQO A;  2EY1 A;  2ICI A;  4LW1 A;  4V19 0;  4X62 Q;  1HHV A;  2A74 C;  1RJT A;  2A6E D;  2YU9 H;  1XMQ L;  4LFB Q;  2VB3 X;  5AJ3 Q;  2FMM A;  4AYB E;  4CKC A;  1VQ4 A;  1K8A C;  1MHW C;  2E2I B;  3HG9 A;  1I94 L;  3KLS A;  2UXD Q;  1CFM A;  2O5I C;  3E5S A;  1EY0 A;  3J80 i;  3GTK B;  5CYU A;  2VQE Q;  3TZD A;  4DAY A;  3A7A B;  1AEX A;  3NBH B;  3M4O B;  1PFN A;  1RHP A;  2BH8 A;  4C3J B;  2JA5 H;  1A62 A;  4GKJ L;  3SVM A;  2B2V C;  4QMG A;  4HJ8 A;  4A3I G;  3S17 H;  4A3K B;  2F0P A;  2K1B A;  4R9W A;  1PDQ A;  1B7Y B;  4DV2 Q;  3HFZ B;  1YIJ A;  3NK9 A;  2DY7 A;  1ML0 D;  4BWG B;  5I9P A;  3DWA A;  3AEV A;  4P75 A;  5JEA H;  1CUK A;  1SJE D;  1X3E A;  3GTM H;  2PQE A;  3RMH A;  3L0O A;  1SFO B;  1CKN B;  1NY4 A;  5BN4 A;  3A8K E;  5DAU A;  4IZ8 A;  3CF5 A;  2L5T A;  1U4P A;  5JEA J;  1BCP F;  3FKI H;  3BZK A;  4JYA Q;  1T9H A;  5K36 G;  4F88 A;  3QG1 A;  3K80 C;  4LF6 L;  3QJY A;  4K6L A;  2B63 B;  3EBE A;  2SDF A;  1PTO D;  4M1U B;  4DUZ L;  2EQS A;  5ELD A;  1L1O B;  3HGB A;  1I50 B;  4OO1 G;  2LXJ A;  4C3H H;  5EAY A;  1BCP B;  4R4C A;  2KCN A;  3NHH A;  2AHO B;  3GTL H;  1S72 A;  4JV5 L;  4IUU A;  1I4R A;  4TVA B;  2B2T C;  3J81 j;  5M3M G;  1AFP A;  1Q46 A;  1ENA A;  5T1G A;  3A5U A;  1EQR A;  2MJ8 A;  1CQV A;  3IKJ A;  1X32 A;  3C1E A;  3FRP B;  1LT3 D;  3Q23 A;  2EXZ A;  1F2M A;  2MFI A;  4K8J A;  4X62 L;  1D5Z C;  2BE5 C;  3A8I E;  1NUC A;  4QIW E;  2CH4 A;  1M1K C;  4DAP A;  1D8L A;  1QNK A;  4IPG A;  4LFB L;  3RD4 A;  4JI1 L;  4RG1 A;  5E4W C;  2PYK A;  2QF7 A;  2HDM A;  3E3X A;  4A3I B;  1A63 A;  1PFM A;  2KHJ A;  3ICE A;  1PH4 A;  2SNM A;  1HNZ Q;  2VQE L;  3G4S A;  1WTO A;  4H02 A;  3ERS X;  3J80 E;  1UEB A;  1VMP A;  3UE0 A;  2PMZ E;  2N3S A;  4A3F G;  1GUS A;  3R2I A;  1EIH A;  3GTQ H;  2K75 A;  1I4Q A;  1GOZ A;  2RQX A;  4ME5 A;  2ATW A;  4DV2 L;  3OIQ A;  1I6H B;  3TBI B;  3F2B A;  1QNU A;  4R8I A;  1VF7 A;  4IUV A;  2VUM G;  2QA4 A;  4DUY L;  4IFD H;  1ILP A;  1NSN S;  1A6X A;  3HP3 A;  1YNN C;  4DNI A;  1CQF A;  1STA A;  4AQY L;  1JWS D;  2M9V A;  5D3I B;  5EQ0 A;  1EQQ A;  3HKZ E;  5FJ8 H;  3DEO A;  3HOU G;  2R93 H;  4JYA L;  4J1M A;  5LMU Q;  3M4P A;  2K28 A;  1I4G A;  2VXW A;  1S5C D;  4C1N K;  2AQ1 B;  1STY A;  2WV6 D;  4JOI A;  3FPP A;  3UE1 A;  2OF1 A;  3MEF A;  2M00 A;  3J7Y W;  2EJF C;  2F3I A;  2HCC A;  4CDC C;  1H9S B;  1MSH A;  1LM0 A;  4C1N I;  4HR7 B;  1FGU A;  5KNB A;  2NB0 A;  4OL7 A;  3D6C A;  3RN2 A;  4L5S A;  2ZJR A;  1II3 A;  4A3G H;  4NP5 A;  4NMZ A;  4JBM A;  2EYL A;  3FMC A;  4L63 B;  4LF5 L;  2RSO A;  3M4Q A;  4H44 C;  4AYB G;  1VQP A;  4KJN A;  5K5P A;  1MGS A;  2AWO A;  3IFT A;  4X64 Q;  2RHQ B;  2N55 A;  1U4L A;  1TR5 A;  2XGT A;  2DUD A;  3JC6 6;  3PUZ A;  3VR3 A;  4X65 L;  2FFK B;  3CPW A;  1R4Q B;  1N32 L;  1RL2 A;  3GO5 A;  1HFG A;  4XIG S;  4KJO A;  1JJG A;  1PTO F;  1IZ6 A;  1SE3 A;  3U4Z A;  2KOL A;  4XYQ A;  1WOC A;  5E3F A;  4KMU C;  4JI0 L;  4A3F B;  1JMC A;  4H7B A;  2B2U A;  3TRZ A;  3G48 A;  5LMN Q;  5JOB A;  4OGQ C;  4KV6 A;  2A6H D;  2DGY A;  1RCV D;  5BN5 A;  1V8Q A;  4R4O A;  5GQO A;  5EKI A;  3F2D A;  1HNZ L;  4HMJ A;  1YZ6 A;  2L4N A;  1QB5 D;  2ZM6 Q;  2VUM B;  3CQZ H;  5GAH C;  1GXD C;  2PQA B;  2WIN B;  2JP1 A;  3KOJ A;  5KRU A;  4A3B H;  1QJO A;  1SEB D;  1PTO B;  3LNN A;  2EYM A;  4IQZ A;  1E24 A;  1DGS A;  1NMF A;  2F0V A;  2F0Q A;  4EQP A;  4OIK A;  3K57 A;  3TP6 A;  2AQ2 B;  3QWN A;  3ZJY C;  4POF A;  1YJW A;  1PHJ A;  3HOU B;  4DXG A;  2K5D A;  3G6E A;  1RTN A;  4KD3 A;  3AU7 A;  2A69 C;  4OEM B;  2K5W A;  3S1N H;  2JA6 H;  1G29 1;  4WOR A;  3I73 A;  4RKB A;  1RTO A;  2JA9 A;  2KCC A;  3IFD A;  4IUQ A;  1X65 A;  1VQB A;  1L0Y B;  2KCT A;  2RKS A;  3VR4 A;  2HIV A;  4DV6 L;  1K28 A;  2QIL A;  4NXN L;  2KUM A;  1PH9 A;  4JI2 L;  1HZ9 A;  4A3J B;  4LF8 Q;  1IBK Q;  3LWE A;  3UDG A;  3PO2 B;  4DA2 A;  2MO1 A;  3P20 A;  4AYB B;  3K59 A;  5C4J B;  3M4Y A;  2HQE A;  4JI7 Q;  4DK6 C;  5FKA C;  2Z8L A;  4XT1 B;  3CC4 A;  1TS5 A;  5M5Y H;  2KJX A;  2PO4 A;  4EQ5 A;  1W6J A;  4WRD A;  3T1Y Q;  5JEA G;  2SEB D;  3S16 H;  5GRO A;  2F4I A;  1JOQ A;  4BY1 G;  3T1H L;  4OIJ A;  3FDT A;  4FF1 A;  4X64 L;  3PIO A;  2CCZ A;  1FYC A;  2X6G A;  3MXN B;  3M3Y B;  3TSS A;  5IIF A;  1OTC A;  2QKI C;  2UUA Q;  4IOA A;  2Z1C A;  1S4Z A;  2BH2 A;  3C2P A;  4ZK9 B;  4GN5 A;  5LL6 S;  1CI3 M;  1JQY D;  4EGV A;  4LUO A;  3DUZ A;  4LF4 L;  2B2W A;  3IL8 A;  1JB3 A;  1JJC B;  4X3S A;  5IGE A;  2ES2 A;  1QZG A;  2E2D C;  3CW2 C;  2A73 B;  1JOK A;  3OIP A;  2EJM A;  2LKV A;  1UEA B;  2HDL A;  1Z7T A;  4HJ5 A;  3CU7 A;  4C3H G;  1FVI A;  1S5D D;  3MEH A;  1FNU A;  1X3F A;  5A2Q E;  3VYS A;  3KJO A;  4DNT B;  3RNU A;  1D1K A;  1TWH B;  2D0O A;  3C46 A;  3HZX A;  1TWF B;  3Q8D A;  3H15 A;  2YU9 B;  5EBD A;  4OWW B;  5FO8 B;  1AZQ A;  5ELN A;  1HNX L;  2ZJP A;  3ZYY X;  3KBX A;  3PIP A;  5G3L D;  1M90 C;  2K01 A;  3D0F A;  1VQ5 A;  2DNC A;  2E2H H;  2DJF C;  3CCV A;  1RKN A;  1KLG D;  1KAA A;  1HTP A;  4JI6 Q;  3S9W A;  1TWA H;  5M3F H;  4YHH Q;  4MTN A;  4CJ1 B;  4QCL A;  2JN4 A;  1D7Q A;  4DN4 M;  1XTD A;  1Y1V G;  2K14 A;  3S17 B;  4P74 A;  1Q1B A;  2VY3 A;  4ZKC B;  2NVX H;  4DK3 C;  1J5E Q;  5EKK A;  1MI2 A;  1N33 L;  1KNE A;  1EY8 A;  1WTX A;  3LWU A;  1LAC A;  4LUV A;  2ZXR A;  5D65 A;  3OOC A;  4N8X 1;  1O7L A;  1WI5 A;  2E74 C;  1FNV A;  2YTX A;  2NN6 I;  2D5D A;  2JXM B;  5H1S E;  1FJG L;  3GTM B;  4B3S Q;  2R7F A;  4BY1 B;  1PV4 A;  5CV6 A;  1PYW D;  1O80 A;  4GLX A;  4JI7 L;  4IJL A;  1P8L A;  1STB A;  3DWQ A;  4LF9 L;  5IOC A;  1QIL A;  1H9K A;  2IHF A;  3UDI A;  4H13 C;  2MP1 A;  3KBG A;  1WVL A;  4DV1 L;  1BF4 A;  3HOY H;  1HPC A;  3WDN A;  1L2F A;  2PMZ B;  4B3M Q;  4G7H C;  1XPR A;  3G7L A;  4DR7 Q;  1DOL A;  1QUQ A;  3OWE B;  4PZ6 A;  1I5F A;  1SNP A;  3U9S A;  2AQ3 B;  4GNX A;  1D6E C;  4K5V A;  2KBN A;  4CBV A;  4WJ3 M;  4DR6 Q;  3PO3 H;  5ELC A;  3QB3 A;  2UUA L;  3I72 A;  4ZRZ A;  4Q5V A;  4C3H B;  3MAQ A;  3VDY A;  4YWL A;  4OEL B;  1STE A;  1B2T A;  2HT1 A;  2OEO A;  1F9P A;  2PCF B;  4JC0 A;  1SMY C;  1V1P B;  1DCZ A;  3S1M H;  1KRS A;  4F8M A;  2V1C C;  3NQI A;  1XPO A;  3HKZ B;  4UY8 C;  4IPH A;  1VQK A;  4UDU C;  1E1T A;  3GP7 A;  4A3G G;  5BN3 A;  1EWC A;  5EPJ A;  2TMP A;  2MNA A;  4DV5 Q;  3J81 L;  4OX9 L;  2A68 C;  2OCE A;  3MXP A;  3ER0 A;  3BJU A;  1ILQ A;  2Q2I A;  2PI2 A;  2F0M A;  5M9O A;  1SLJ A;  5C3E B;  4DR2 L;  1Y1V B;  3RLF A;  5HUR A;  4A3D H;  2Z0S A;  1L0W A;  4IJH A;  2SNS A;  1B44 D;  1WTH A;  2LSS A;  4N8F A;  2LFN A;  3F2U A;  2CHB D;  4GOP B;  2EPB A;  4RGN A;  2Z6K A;  4QL5 A;  4JI6 L;  2SOB A;  5C5L A;  2GN5 A;  2KEE A;  1K73 C;  3G71 A;  5M5X H;  3UDX A;  2I5L X;  3BDC A;  3S15 H;  3D4R A;  3AMU A;  2B39 A;  3GTQ B;  1G6P A;  1V43 A;  1ICW A;  3I8Z A;  3EIV A;  4YCV A;  4ZCK A;  2F0J A;  3GQB A;  4R4I A;  2WAQ E;  4XDX A;  1Y1W G;  5HGT A;  4A3L H;  5C3W A;  1J5E L;  2JEA I;  1WTQ A;  1NJI C;  1PYS B;  1EOV A;  1IW7 D;  2JQO A;  3DLL A;  3GTO B;  4A3B G;  2WKC A;  5G3L F;  1TT2 A;  1M4V A;  4HIO A;  3VYT A;  4B3S L;  2XIW A;  1VQC A;  2VW9 A;  4C3I H;  3URY A;  2IWH A;  1IL2 A;  1XJV A;  2KHI A;  5F2D A;  5JVG 3;  4RCN A;  1JB7 A;  1YIT A;  5DM7 3;  4B3M L;  5J22 A;  3CHB D;  1AW7 A;  3EFX D;  1F9R A;  4FF2 A;  1BBW A;  2JA6 G;  2JA8 B;  1O7Y A;  1EZ6 A;  1NCV A;  2I5H A;  3CCM A;  1EEI D;  2HD3 A;  2WFW A;  1YNJ C;  5JVH 3;  2K4K A;  3MVV A;  4A3C H;  1NBW A;  3CPF A;  4ILW A;  2F3W A;  4A3G B;  3L2P A;  1R4P B;  1EY6 A;  1CTM A;  2R92 H;  3PCO B;  3ERQ A;  2K33 A;  3A56 A;  1G8Z D;  1SNQ A;  3DHQ A;  2CVR A;  3CC2 A;  1SXT A;  5CV4 A;  5KNC A;  1TWC B;  1M8A A;  1IYU A;  3EJI A;  1IBM Q;  2EIF A;  4IOC A;  4DV5 L;  4K8I A;  4TKO B;  2QEX A;  1OXV A;  5FO9 B;  2UXC Q;  1KC8 C;  3HOZ H;  1BOS A;  3STB D;  1WTW A;  4DAY B;  3A55 A;  3CMA A;  1WD0 A;  1PMR A;  3E0J A;  4I7Z C;  3S14 H;  2XNA C;  3QIA A;  2AKW B;  4UPA A;  1WFQ A;  1KAW A;  1HR0 Q;  1V9P A;  1SN8 A;  3F8T A;  1SNC A;  2IX0 A;  1YVC A;  1Y1W B;  2F3V A;  4K0K Q;  4QB4 A;  3OYY A;  3V96 A;  4XQN A;  3JAM L;  4FXK C;  2WB1 E;  2Z4I A;  2Z9H A;  3CQZ B;  2C5C A;  3MXU A;  1VQH A;  5ISR A;  4BA2 I;  3M7G A;  1AE2 A;  2AUJ D;  3PQI A;  3KLW A;  4A3B B;  3EVQ A;  5C44 H;  1LUZ A;  1HQR D;  2F03 A;  1HFN A;  5LL6 X;  4RCO A;  3PF5 A;  2RDH A;  3DM3 A;  4B3R Q;  1SND A;  4KKU A;  2ZXO A;  4JI5 Q;  1CHQ D;  1GM5 A;  1Q3L A;  3P75 A;  3ERO A;  2JA6 B;  2OQK A;  4DV4 Q;  3CC7 A;  3GDE A;  2ASB A;  1HZA A;  3RN5 A;  4OHJ A;  4HTH A;  2VL6 A;  3WOE A;  1SE8 A;  4ID6 A;  3S1Q H;  2KEC A;  3WOF A;  5C0X I;  4B9W A;  1HCZ A;  2D9U A;  2I0Q A;  2EYJ A;  1WCM B;  3KF6 B;  1JCK B;  4CDD C;  1MSG A;  1PFS A;  1Q82 C;  2ZTC A;  3NBH A;  2MHV A;  2WAC A;  1L1O C;  2I5M X;  2HIX A;  2IX1 A;  3K7A H;  1EYD A;  4K5X A;  3NQT A;  1PRT D;  1H9M A;  2B8F A;  1BCP C;  1EQT A;  4ULL A;  3S16 B;  4JI4 L;  2JA7 G;  2B2V A;  1SYB A;  4FNF A;  5FO7 B;  3RZO B;  1XNQ L;  3NP8 A;  2RCN A;  3G6J B;  4GN3 B;  3SGI A;  4KLK A;  3J81 c;  2YV5 A;  4EQO A;  1PH7 A;  1ZYR D;  3HOY G;  4YCU A;  3J7A F;  1V1Q A;  4DK0 A;  3S1R B;  3AYH B;  2F4V Q;  4IAL A;  2OTL A;  4KHV A;  3BG3 A;  1L0X B;  1X3Q A;  2WAQ G;  4JVZ A;  1X3G A;  5E1F A;  3CP0 A;  3OTO Q;  4JK1 C;  1OXT A;  4OO1 I;  1HA5 A;  1R9T B;  5AJ3 L;  3KFU A;  2F0U A;  2D2C C;  4K0K L;  3A8J E;  2UUC Q;  1K0S A;  1ONL A;  1CZG A;  2UXD L;  3S2D H;  1NR4 A;  2FHT A;  2CFM A;  1PA6 A;  1HUM A;  2NN6 H;  2EYH A;  1BBU A;  1SAP A;  2ZTE A;  3CCE A;  3H3V C;  3MA2 B;  1QVF A;  3NWS A;  3V2T A;  4JW0 A;  3NE5 B;  1A2T A;  2MPM A;  4TSS A;  5CC4 A;  2K04 A;  4K2K A;  4G4K A;  4CJ0 B;  4JI5 L;  1DXM A;  4DV3 Q;  1TWA B;  5IT9 L;  2QEJ C;  3M9B A;  3N52 A;  3CCS A;  3Q0A A;  3FVQ A;  2JSO A;  1STH A;  4EQN A;  1IKL A;  2B2T A;  1EFI D;  4A3D G;  4BS9 A;  3J7A 5;  4RGO S;  4GZY C;  3CCL A;  3I4L A;  2PI2 E;  2A6E C;  2F0I A;  4NDX A;  4DR1 Q;  2K05 A;  3SK4 A;  2WKD A;  4IFD J;  2JA7 B;  1XYI A;  2K32 A;  1C0A A;  2LXK A;  2XSC A;  4JBK A;  3GTP B;  3J7Z C;  4A3L G;  1KD1 C;  3BZC A;  4L5T A;  4NKL A;  2UU9 Q;  1WD1 A;  3BU2 A;  1DZ1 A;  1MJC A;  1TWG H;  3BDO A;  3AFQ A;  1UE7 A;  3VR5 A;  3HOY B;  2EE1 A;  3NEN A;  4POG A;  1YBY A;  3K5N A;  5C4H A;  5M3M B;  2CH4 W;  3TP8 A;  5I6W A;  1ZKO A;  1FGB D;  2F0G A;  2EVB A;  4ZQ3 A;  2R7D A;  2K7V A;  1SJH D;  1HTL D;  5IYD H;  1YI2 A;  1TS4 A;  2WAQ B;  3MHB A;  4DR3 Q;  1VQD A;  1U9R A;  4AH6 A;  2GA4 B;  3H6M A;  3Q6S A;  1LT5 D;  1GJX A;  2WB1 G;  4MHE A;  3CCR A;  4A3E H;  2UUB Q;  3EN2 A;  5E7N A;  1C48 A;  2NUC A;  4HMI A;  4NXM Q;  1H9J A;  2PW7 A;  2JYO A;  1CSP A;  3HS0 C;  5EBC A;  2VQF Q;  1K8G A;  1ASY A;  1G2S A;  1EY9 A;  3MFG A;  5DLQ E;  1PRT F;  3CCU A;  3HOW H;  1XMO Q;  3S1M B;  3OTO L;  3JAM c;  3KF8 B;  1EY7 A;  4A3C G;  2ZTD A;  4YCW A;  3NUC A;  2UUC L;  3CRL C;  1X3P A;  1H9S A;  1MD2 D;  4NB3 A;  3T16 A;  3I3C A;  4A76 A;  3EA6 A;  3W3A A;  2R92 G;  1Q8I A;  2CQA A;  1PTO C;  3NPP A;  1RDP D;  2L11 A;  3P1H A;  2F0H A;  2B29 A;  2NVQ H;  1XXG A;  4K14 A;  2BDN A;  1YHA A;  5DEH A;  2PPB C;  1PRT B;  4A3D B;  3E6Z X;  4PZ7 A;  4ALP A;  3HOX H;  1SMX A;  2CWP A;  5C6A A;  2HCI A;  1JOR A;  1KAB A;  1HZC A;  4CKE A;  1NR2 A;  4RGM A;  4DV3 L;  1EZ8 A;  4GLA C;  2YTY A;  4DV0 Q;  3H0G H;  3TME A;  1KTK A;  1N34 Q;  4LK1 C;  3GTK H;  4K5W A;  2J0T D;  1S5F D;  4DR5 Q;  1GUW A;  4BBR H;  2XTI A;  4HIM A;  4C3J H;  3D31 A;  2G9H D;  3GD7 A;  4P73 A;  3TRE A;  4FO2 A;  2FXQ A;  4I65 A;  3OPO A;  3AFP A;  5GAE C;  3I55 A;  2RDF A;  4GS3 A;  3I4M H;  4DR1 L;  3M85 A;  3T56 B;  1W6K A;  5C44 G;  1MIU A;  2JA5 G;  5LMU L;  1PFB A;  3PUX A;  1N8R C;  3CRK C;  1BXT A;  1D1I A;  1CHP D;  1U4R A;  5L37 A;  4KY7 A;  4XQJ A;  4L5R C;  4JBW A;  2KVM A;  4KY5 A;  2WB1 B;  3J81 i;  4P71 A;  1CT1 D;  1DD2 A;  5JAV A;  4O42 A;  5EPL A;  3IRB A;  1X56 A;  3BVG A;  3KK7 A;  5CBA E;  4OXP A;  4DR3 L;  4NPS A;  5C4X H;  4LFA Q;  1SYC A;  1SDF A;  1EU3 A;  4L5Q A;  2UUB L;  3QO2 A;  1KDB A;  1JIC A;  2NVY B;  4HJ9 A;  2CKZ B;  4B08 A;  1UE1 A;  4FF4 A;  2B63 H;  2BA1 A;  3U50 C;  3FKI G;  2ICE C;  3BYT B;  5FOB B;  3CCQ A;  4G7O C;  3W5O A;  2R92 B;  1Q81 C;  1KIX A;  5IYB H;  1I50 H;  2ALY B;  1VQM A;  1XMO L;  1IL8 A;  3FPU B;  3MFY A;  3O13 A;  5JJZ A;  4PMC A;  4LNQ A;  1HUN A;  5J1Z A;  1KQS A;  5LMN L;  3T53 B;  1G2T A;  3HEJ A;  1Y8O B;  2VZA A;  3E9H A;  3A7L A;  1B1Z A;  3KLR A;  1MKH A;  1Z9F A;  5IOD A;  5JPN C;  1VQJ A;  2I07 B;  2ZM6 L;  5GAG C;  1JR0 D;  3EQL C;  3VA7 A;  4DFA A;  1GVP A;  3H91 A;  1LTL A;  3SE0 A;  3MXN A;  5IT9 c;  3T51 B;  1QCB D;  1HZB A;  2R6G A;  4RMF A;  5C0X H;  1KNA A;  1C9O A;  4R1J A;  5DM6 3;  1Q12 A;  5ELO A;  3Q24 A;  3ITP A;  4A3I H;  1S40 A;  3CD6 A;  2Q2U A;  4DV0 L;  5C44 B;  5IE8 A;  2JA5 B;  1N34 L;  4DGZ A;  1JJ2 A;  1VCI A;  3C1F A;  5C0X J;  3KUP A;  1TII D;  4DV7 Q;  4ZAI A;  1BVS A;  2IW3 A;  1IBL Q;  1I4H A;  3GTG H;  5C4Z A;  2F0S A;  2O2L D;  1CSQ A;  4ZUJ A;  4M8A A;  1ROD A;  1C8C A;  2O4X A;  5ELF A;  3VYU A;  4LF8 L;  2E8G A;  1IBK L;  1KL9 A;  2A6H C;  1HXY D;  1QUQ B;  1Q8K A;  2F0L A;  2PW5 A;  1SYE A;  4FYD A;  4GKK Q;  5E4X A;  2D62 A;  1RD9 D;  4HIK A;  3RUZ A;  5T1I A;  1EQV A;  5K36 H;  4KN7 C;  1E22 A;  2J7Z A;  3I91 A;  1GUT A;  1C7Y A;  3J81 E;  3PUV A;  3T1Y L;  1PXU A;  3FKI B;  4PQX A;  2R61 A;  4UP9 A;  4IFD G;  3S24 A;  3L9A X;  1PH5 A;  2ZJQ A;  5M5W H;  3K7A B;  4IUN A;  5HGQ A;  4OO1 H;  4X3U A;  2ID0 A;  3R2T A;  4V0B A;  3TEH B;  2PNH A;  2F0F A;  3KYH C;  3JAM i;  4QGU A;  1ICF B;  4BXX H;  4F87 A;  4UP8 A;  2F52 A;  5FJ8 G;  3CAM A;  3Q22 A;  4HID A;  1LT4 D;  2R93 G;  5BR8 Q;  1PH6 A;  1XWE A;  2YTV A;  3K6O A;  4DU9 A;  3BZD B;  4FXD A;  3C3L A;  3GTL B;  2DNE A;  4OON A;  2XRQ D;  1I4X A;  4G57 A;  3S2H H;  1WJJ A;  1A8V A;  2IX3 A;  2L1B A;  1TVX A;  2AWN A;  3GTJ H;  1FD7 D;  1UE5 A;  3OHX C;  1DON A;  5IYD G;  2RF4 A;  3I7F A;  4RWS C;  5KIX A;  5EKL A;  2E2J H;  1CKO A;  2LMC B;  4KY6 A;  1EFW A;  5JJI A;  5FLM H;  2K50 A;  2K5V A;  2XWB B;  4QY7 A;  4A3E G;  1LTG D;  1J9O A;  2F0T A;  4GOP C;  1N36 Q;  2E5L Q;  4Y7N H;  3NBI A;  4A3F H;  1Y8N B;  3RZD H;  4YY3 Q;  5KYL A;  3HOW G;  5CGK A;  1B3Q A;  4B3T Q;  1ESF A;  1QWY A;  1CM9 A;  1F9S A;  4RGT A;  1UWV A;  1EYA A;  4YHH L;  3OSO A;  1TXY A;  1LO5 D;  2B3G A;  5EGT A;  4DV7 L;  4CGY B;  1EOT A;  5KND A;  4HCE A;  1B50 A;  1XMQ Q;  4LFC Q;  1TY2 A;  3BDL A;  1I3Q H;  3K5O A;  3AQQ A;  2A1A A;  1QZH A;  1WYD A;  1LTT D;  2B2Y C;  1NE3 A;  1PZK D;  2N49 A;  2BOS A;  1PVO A;  1FR3 A;  2EY6 A;  3HOX G;  5J3B A;  4LWC A;  1LYL A;  3DEP A;  1S5B D;  3HOU H;  3KLS X;  5CV7 A;  1IKM A;  3OW7 A;  3H0G G;  2R93 B;  1W3S A;  4GOP A;  1EWH A;  4DR7 L;  2BCO A;  4HN7 A;  4BBR G;  4A3J H;  4YIJ A;  5D14 A;  1ZEQ X;  5C3X A;  1J6Q A;  1TWG B;  3PO2 H;  3V05 A;  4RH6 A;  3I4M G;  4DR6 L;  2HUG A;  5C4J H;  1NNX A;  5JJL A;  1SYG A;  4UP7 A;  3W1G A;  1LTS D;  3JAM E;  4TQU S;  1Z6H A;  3PGZ A;  2NTS A;  3ND9 A;  3NEL A;  3FHW A;  3KDF B;  2OXP A;  3PUY A;  3NTI A;  1U5K A;  1XX8 A;  1E2W A;  2KHS A;  2RA4 A;  4A3E B;  4ZUI A;  2L15 A;  1X55 A;  2PZT A;  1LV9 A;  2B2Y A;  3K0X A;  1E7Z A;  5D3D A;  3M3Y H;  3ULJ A;  2ENB A;  4R4T A;  4DK1 A;  1EIY B;  3HOW B;  5C4X G;  5I9O A;  1TS2 A;  2QGQ A;  3I4O A;  4KKS A;  4KTA A;  2Q2H A;  2E5L L;  1IYV A;  2HQL A;  3SEB A;  3HOV H;  2RSN A;  3H94 A;  1VQ6 A;  3M7N A;  2B63 G;  2VB2 X;  4FDB A;  3GV3 A;  2MUY A;  5FLX L;  3A0J A;  1LTR D;  4B3T L;  1QVC A;  5IGB A;  4U68 A;  2KCM A;  1HRJ A;  4IUT A;  4APV A;  1B9N A;  3ND8 A;  1YNN D;  1TWH H;  2N8N A;  3HOX B;  5J39 A;  2PZU A;  3B6Y A;  1TWF H;  5KYI A;  4WJW A;  4LFC L;  4JI1 Q;  4IO9 A;  3I2Z A;  1Y69 U;  1K3R A;  1Z47 A;  1PYB A;  1AN8 A;  2EDG A;  3CKI B;  4PG3 A;  3H0G B;  1F2Z A;  3R93 A;  4QQB X;  5A35 A;  4LUZ A;  2NVT H;  1BDO A;  3S1N B;  4KHZ A;  4BBR B;  3CME A;  3R3O A;  2VS1 A;  3DM1 A;  5C0X G;  4K6D A;  3P7J A;  2BDO A;  5ELE A;  3I4N H;  5TSS A;  4NW2 A;  3I4M B;  4U67 3;  4PNY A;  3BS1 A;  1EU4 A;  2MO0 A;  4I7A A;  4OWX B;  4RA8 A;  5M3F G;  3K58 A;  3F2C A;  1ET6 A;  3NEM A;  1SRO A;  3LX0 A;  4RFB A;  2Z6B A;  4DUY Q;  4J15 A;  5CV9 A;  4BY1 H;  5M5Y B;  4BA1 I;  4Y52 H;  4QUC A;  2WII B;  2CW0 D;  1K8O A;  1Q7Y C;  4AQY Q;  1OXU A;  3MZ5 A;  4HED A;  3H3V I;  2Y0S E;  5C4X B;  4JPB W;  1YHB A;  4IUP A;  1DOK A;  1HJP A;  5CV5 A;  2RBM A;  3PUW A;  1IW7 C;  2F0O A;  4P72 A;  1LAB A;  1KXL A;  4ZKB B;  3N6R A;  1AE3 A;  1LTA D;  1CKN A;  3TS0 A;  5LMN W;  1VQ7 A;  3PIO 3;  1IBM L;  1A2U A;  5IT9 E;  3A54 A;  1XNR Q;  4J8Q A;  2UXC L;  1SNO A;  2NWG A;  1OXX K;  1BBX C;  2QW7 A;  3KF6 A;  4LF5 Q;  1I4P A;  5AFW A;  3PO3 G;  4BXX G;  4A75 A;  3HRZ C;  3GV6 A;  3RR5 A;  4UAI A;  3K5M A;  1KHI A;  1HR0 L;  5I2X A;  1VQ9 A;  5EJW A;  5IGF A;  3A5Z B;  1VQO A;  4A3M H;  4HSP A;  5IP9 H;  1K3B C;  2IHE A;  4A93 H;  4X65 Q;  5GAD C;  4MNO A;  4C2M H;  2F0W A;  1L1O A;  1F2Y A;  2FIN B;  1N32 Q;  2A69 D;  3QR8 A;  3J7A V;  4MN3 A;  4JBJ A;  1QG7 A;  1GO3 E;  4JI0 Q;  2JEB I;  2E2H B;  5C3E H;  3FEW X;  1EIG A;  4JOI C;  1Y1V H;  4B3R L;  3PIP 3;  2R7Z H;  2LS0 1;  3TP7 A;  1C4Q A;  2L55 A;  5FLM G;  5M3F B;  1A3V A;  2LY7 A;  1D5M C;  2X69 A;  3BYY B;  4DV4 L;  4JI8 Q;  1U4M A;  2RCF A;  3STB C;  4IPD A;  1PH3 A;  1RIP A;  2NVX B;  1UNS A;  3T13 A;  2FJ2 A;  1SR3 A;  2L12 A;  3GTG B;  1PH2 A;  1JOO A;  3KJP A;  2NTT A;  2KED A;  3U9O A;  1AH9 A;  4PV1 C;  3FP9 A;  4BBS H;  4ZYS A;  1XPU A;  1W2B A;  1EY5 A;  3GTO H;  1CKM A;  1T5E A;  1UUP A;  3OMG A;  1BUV T;  1X9N A;  1BNZ A;  3CCJ A;  5LHY 1;  1NMG A;  2JE6 I;  5IGC A;  1VQE A;  4L8J A;  1IHZ A;  3TDQ A;  2JK8 A;  2ZT9 C;  1SSO A;  1MJE A;  3HKS A;  2A5H A;  2G9D A;  5CR3 A;  1YEZ A;  1SYF A;  1GKH A;  3TS2 A;  4DV6 Q;  2B2U C;  4C3I G;  2XVS A;  4NXN Q;  5M5W B;  4JI2 Q;  5I2Y A;  4BY7 H;  3ULL A;  1K83 H;  2KA7 A;  2WP8 J;  2JA8 H;  3PO3 B;  3J80 L;  5ELB A;  1LLR D;  2UXB Q;  4FVM A;  3H09 A;  3DWP A;  1JE4 A;  2JJQ A;  1JWM D;  4XYO A;  3TZU A;  2F4V L;  1B53 A;  1XNR L;  1A15 A;  5IYC H;  1HQM C;  4EVO A;  4KN4 C;  4A3J G;  3MXG A;  4JI3 Q;  1OXS C;  3ULP A;  3PO2 G;  2IY5 B;  3X3N A;  5EPK A;  4RHR A;  3NTH A;  3SDZ A;  4A4I A;  2OQ0 A;  2F1M A;  5FLX c;  4X66 Q;  3T1H Q;  3S2H B;  1PH1 A;  1SRU A;  2EXD A;  1YJ9 A;  1GHJ A;  3GTJ B;  1GUO A;  1TKW B;  1K0R A;  3NXW A;  2E2J B;  4P2C B;  1TS3 A;  4DPG A;  5IWA Q;  1A3U A;  1PRT C;  1TWC H;  1EUJ A;  2CW0 C;  4ME3 A;  4Z9C B;  1LTB D;  1NAP A;  1EL0 A;  1D2B A;  2QDL A;  1LT6 D;  3U4V A;  3VR6 A;  4FP5 D;  2OWO A;  3L3O C;  3RLO A;  4PZ8 A;  4LF4 Q;  1JE5 A;  2DN8 A;  1FL0 A;  2IJ0 A;  4Y7N B;  4IN3 A;  5FK9 C;  4DAV A;  1WTV A;  2XWJ B;  3RZD B;  4XQQ A;  1Q90 A;  3VR2 A;  2IL8 A;  3HOZ G;  3PSI A;  2Q8I B;  3QOL A;  1GUG A;  1ZYR C;  2NBF A;  1Y1W H;  4X6A H;  2E2I H;  5M5X B;  5IP7 H;  1K8M A;  3S15 B;  2TSS A;  1B9M A;  1TU2 B;  2EJG C;  1VQN A;  3HOV G;  4HCS A;  4JI8 L;  3D6W A;  5KGU A;  3AB9 A;  3KF8 A;  4QJF A;  1HNX Q;  3M4O H;  2Y0S G;  1ESR A;  2H1E A;  1I3Q B;  4S3S A;  1AZP A;  4A3K H;  2PNR C;  1CZW A;  1LTI D;  4C3I B;  4WJ4 A;  1VQ8 A;  1O7I A;  3OMC A;  1EY4 A;  2PQA A;  3NTK A;  2Z4H A;  2UU9 L;  2G5D A;  2B2W C;  1SFO H;  3UI2 A;  2MGS A;  2Q2T A;  1PZJ D;  1WTP A;  1N33 Q;  1SNM A;  1IYJ B;  3D8G A;  2L0C A;  1QVG A;  1ZXT A;  3K81 C;  1SMY D;  1GUN A;  2RVL A;  1WCM H;  1FJG Q;  4J6H A;  4X3K A;  3I4N G;  1VF5 C;  1VS0 A;  2IPK D;  2L9H A;  2UXB L;  1STG A;  5I6Y A;  4LF7 Q;  4LF9 Q;  1EWI A;  4HSV A;  3ONA B;  3OWF A;  4NXM L;  3SK6 A;  4PMB A;  1B8A A;  1SE4 A;  2A68 D;  4E6I A;  4ABN A;  1VDZ A;  1JT8 A;  5JJK A;  2VQF L;  1E2Z A;  4DV1 Q;  3MC0 B;  4IPC A;  4RKL A;  4KHP Q;  4JI3 L;  1WTR A;  2GVB A;  4UHV A;  1JWU D;  1H95 A;  2I46 A;  1TY0 A;  1O78 A;  1VMC A;  1G6Z A;  1H9R A;  4IUR A;  4X66 L;  5KEE A;  3RZO H;  2EZV A;  1E1O A;  2FMC A;  3OW2 A;  2HHH Q;  1STN A;  4O1N A;  2K5Q A;  4CHT B;  4CDE C;  5IWA L;  3W2D A;  4F7X A;  1CA6 A;  2B8G A;  3S1R H;  3HOZ B;  4GN4 B;  2NZ1 D;  1FNW A;  3S14 B;  3NWT A;  4HAE A;  4JCV E;  1EYC A;  1UAP A;  2RDG A;  2EYF A;  1A3T A;  3HOV B;  3X3M A;  3E9I A;  2ZXP A;  4YWM A;  2NYZ D;  2Y0S B;  1YHQ A;  1Q1E A;  1N9W A;  1R9T H;  1ASZ A;  1B70 B;  2OTJ A;  3BVM A;  4OX9 Q;  2QCP X;  3NSW A;  3UDF A;  1EEF D;  2XRS D;  5HY6 A;  3K0Y A;  3TP5 A;  4DR5 L;  4A3M G;  1PH8 A;  3D4D A;  5IP9 G;  1P16 A;  3HKZ G;  4A93 G;  2DY8 A;  4DR2 Q;  1VQL A;  2NN6 G;  4O0A A;  4ODG A;  3SK5 A;  4LAA A;  4GNX C;  3H3V H;  4Q0F A;  2NVT B;  2EOT A;  4TRD A;  3PMF A;  1I6H H;  2YYZ A;  4XT3 B;  1V1O A;  4DF7 A;  1YNJ D;  2H4O A;  4GNX B;  4DXF A;  1BR9 A;  1XTC D;  3I4N B;  3LGJ A;  5C3E G;  3VYR A;  1SBB B;  1E0B A;  2K6A A;  2MQH A;  1S3O A;  2R7Z G;  5I4D A;  2J4X A;  3T4A C;  1DYQ A;  4C56 C;  3S1Q B;  3TQY A;  1HNW Q;  2F0E A;  4CDF C;  1K9M C;  1EYG A;  4LMQ D;  3J80 c;  3CXC A;  4QUF A;  5CMD A;  4QIW B;  2V4D A;  4R4Q A;  5A2Q L;  2X6L A;  1NTG A;  1SYD A;  3W1B A;  5JPM C;  4L6T B;  4AIM A;  4LFA L;  2JA7 H;  4LF7 L;  2O5J C;  3GTP H;  4DNR B;  3R8B A;  1BO0 A;  4BBS G;  1DOM A;  5CV8 A;  3K5L A;  2N88 A;  4KHP L;  3BVZ A;  1DM0 B;  5M3M H;  1G51 A;  1E3P A;  4DR4 Q;  2R3Z A;  1ENC A;  5IGG A;  1MBY A;  2Z6K C;  1VQI A;  2HHH L;  2C35 B;  1HR0 W;  4IFD I;  1F2L A;  2F0D A;  1I6V C;  2Q8T A;  1Q86 C;  1VQG A;  2QDB A;  3WWV A;  4BY7 G;  2KEN A;  1KRT A;  2JA8 G;  1B3A A;  4GLV B;  1KLU D;  5CBE E;  2BA0 A;  1HH2 P;  4A3M B;  3I90 A;  1VQA A;  3SR1 A;  1X6O A;  4A93 B;  3S2D B;  4N9T A;  3PV0 A;  4C2M B;  5IYC G;  4O2D A;  1BKB A;  4DAM A;  3I56 A;  3DMU A;  2OT2 A;  4KI0 A;  1X54 A;  2DJG C;  4LJZ C;  3DXJ C;  3D4W A;  1TQO A;  3MWY W;  1V1P A;  4DKA C;  2VUM H;  4N9P A;  1QOH A;  1IBL L;  3QOJ A;  4X3T A;  1A0I A;  1D5X C;  1E2V A;  1PTO H;  2EY2 A;  1IXR A;  3TN2 A;  5IY0 A;  2R7Z B;  1AP0 A;  4KK7 A;  2P5Z X;  3U58 A;  2K5N A;  3F1Z A;  4KD4 A;  1G91 A;  1PZI D;  1I94 Q;  5COY A;  5DNF A;  1DJR D;  5IGD A;  1J8I A;  2CWA A;  4PMW A;  1OO9 B;  1Y8P B;  4GKK L;  4EX5 A;  1S5E D;  2AUK A;  2D0P A;  3PF4 A;  4WFN 3;  1BCP D;  2VNU D;  4FF3 A;  1F9Q A;  4GKJ Q;  1YJN A;  1SE2 A;  2K03 A;  4MIU A;  3E0E A;  1KDC A;  1CK1 A;  1HNW L;  2F0N A;  3I70 A;  5IP7 G;  2NZH A;  3MTS A;  4ZLT F;  5C5M A;  1ET9 A;  2RHS B;  1JC7 A;  1CA5 A;  4BBS B;  4B9X A;  3SK8 A;  1B4O A;  4H0L C;  4QF4 A;  4XTC S;  2PZW A;  1EIF A;  4KKT A;  4C3J G;  2K5H A;  4CKB A; 
#chains in the Genus database with same CATH homology
 1O7Z A;  5COR A;  2E76 C;  2IT1 A;  4RAU C;  5FLX E;  3SHL A;  2F0K A;  2BE5 D;  4XXE A;  4BY7 B;  4RHS A;  2EYP A;  2E75 C;  4G7Z C;  1K83 B;  4CJ2 C;  3SXH A;  1BQQ T;  3L7Z C;  2EYO A;  1QE6 A;  2Q8R E;  1HA6 A;  2C9O A;  2XN9 C;  1KDA A;  3VA5 A;  1RF2 D;  5NUC A;  2KQ3 A;  4R8N A;  1PLF A;  4K2L A;  2EY5 A;  4FXG C;  2M2L A;  3D3R A;  2NVQ B;  1GHK A;  1ENF A;  3IAY A;  1F77 A;  1T5X D;  2EY1 A;  2ICI A;  4V19 0;  1HHV A;  2A74 C;  1RJT A;  2A6E D;  2VB3 X;  2FMM A;  4CKC A;  2E2I B;  3HG9 A;  3KLS A;  1CFM A;  2O5I C;  3E5S A;  1EY0 A;  3GTK B;  5CYU A;  3TZD A;  4DAY A;  3A7A B;  1AEX A;  3M4O B;  1PFN A;  1RHP A;  4C3J B;  3SVM A;  2B2V C;  4QMG A;  4A3K B;  2F0P A;  2K1B A;  4R9W A;  1PDQ A;  3NK9 A;  2DY7 A;  1ML0 D;  4BWG B;  5I9P A;  3DWA A;  5JEA H;  1SJE D;  2PQE A;  3RMH A;  1SFO B;  5BN4 A;  3A8K E;  5DAU A;  4IZ8 A;  2L5T A;  1U4P A;  5JEA J;  1BCP F;  5K36 G;  4F88 A;  3QG1 A;  3QJY A;  4K6L A;  2B63 B;  2SDF A;  1PTO D;  4M1U B;  5ELD A;  3HGB A;  1I50 B;  4OO1 G;  1BCP B;  2KCN A;  3NHH A;  4IUU A;  1I4R A;  2B2T C;  1AFP A;  5T1G A;  1ENA A;  2MJ8 A;  1CQV A;  3IKJ A;  1X32 A;  3C1E A;  3FRP B;  1LT3 D;  3Q23 A;  2EXZ A;  1F2M A;  4K8J A;  1D5Z C;  2BE5 C;  3A8I E;  1NUC A;  4DAP A;  1QNK A;  3RD4 A;  5E4W C;  2PYK A;  2QF7 A;  2HDM A;  4A3I B;  1PFM A;  2SNM A;  1WTO A;  3J80 E;  1VMP A;  1GUS A;  3R2I A;  1EIH A;  1I4Q A;  1GOZ A;  2RQX A;  4ME5 A;  3OIQ A;  1I6H B;  3TBI B;  1QNU A;  4R8I A;  1VF7 A;  4IUV A;  4IFD H;  1ILP A;  1NSN S;  1A6X A;  3HP3 A;  1YNN C;  1CQF A;  1STA A;  1JWS D;  2M9V A;  5D3I B;  5EQ0 A;  3DEO A;  4J1M A;  2K28 A;  1I4G A;  2VXW A;  1S5C D;  4C1N K;  2AQ1 B;  1STY A;  2WV6 D;  3FPP A;  2OF1 A;  2M00 A;  3J7Y W;  2EJF C;  2HCC A;  1H9S B;  1MSH A;  4C1N I;  4HR7 B;  5KNB A;  2NB0 A;  4OL7 A;  3D6C A;  1II3 A;  4NP5 A;  4NMZ A;  2EYL A;  3FMC A;  4L63 B;  2RSO A;  4H44 C;  4KJN A;  5K5P A;  1MGS A;  2AWO A;  3IFT A;  2N55 A;  1U4L A;  1TR5 A;  3VR3 A;  3PUZ A;  2FFK B;  1R4Q B;  3GO5 A;  1HFG A;  4XIG S;  4KJO A;  1PTO F;  1SE3 A;  2KOL A;  4XYQ A;  5E3F A;  4KMU C;  4A3F B;  4H7B A;  2B2U A;  5JOB A;  4OGQ C;  4KV6 A;  2A6H D;  1RCV D;  5BN5 A;  1V8Q A;  5EKI A;  4HMJ A;  2L4N A;  1QB5 D;  2VUM B;  5KRU A;  1GXD C;  2JP1 A;  2WIN B;  1QJO A;  1SEB D;  1PTO B;  3LNN A;  2EYM A;  4IQZ A;  2F0Q A;  2F0V A;  4EQP A;  4OIK A;  3K57 A;  3TP6 A;  2AQ2 B;  3QWN A;  3HOU B;  4DXG A;  2K5D A;  1RTN A;  4KD3 A;  3AU7 A;  2A69 C;  2K5W A;  1G29 1;  4WOR A;  3I73 A;  4RKB A;  1RTO A;  2KCC A;  3IFD A;  4IUQ A;  1L0Y B;  2RKS A;  3VR4 A;  2QIL A;  2KUM A;  4A3J B;  3LWE A;  3PO2 B;  4DA2 A;  3P20 A;  4AYB B;  3K59 A;  5C4J B;  3M4Y A;  2HQE A;  5FKA C;  2Z8L A;  4XT1 B;  1TS5 A;  2KJX A;  2PO4 A;  1W6J A;  4WRD A;  5JEA G;  2SEB D;  2F4I A;  1JOQ A;  4OIJ A;  3FDT A;  4FF1 A;  1FYC A;  2X6G A;  3M3Y B;  3TSS A;  5IIF A;  2QKI C;  2Z1C A;  1S4Z A;  3C2P A;  4ZK9 B;  5LL6 S;  1CI3 M;  1JQY D;  4EGV A;  3DUZ A;  2B2W A;  3IL8 A;  1JB3 A;  4X3S A;  5IGE A;  2E2D C;  2A73 B;  1JOK A;  3OIP A;  2EJM A;  2LKV A;  1UEA B;  2HDL A;  1Z7T A;  3CU7 A;  4C3H G;  1S5D D;  3MEH A;  1FNU A;  5A2Q E;  3VYS A;  4DNT B;  1D1K A;  1TWH B;  3C46 A;  3HZX A;  1TWF B;  2YU9 B;  5EBD A;  5FO8 B;  1AZQ A;  3ZYY X;  3KBX A;  5G3L D;  2K01 A;  2DNC A;  1RKN A;  1KLG D;  1KAA A;  1HTP A;  3S9W A;  4CJ1 B;  4QCL A;  4DN4 M;  3S17 B;  1Q1B A;  4ZKC B;  5EKK A;  1MI2 A;  1KNE A;  1EY8 A;  1WTX A;  3LWU A;  1LAC A;  2ZXR A;  5D65 A;  3OOC A;  1O7L A;  2E74 C;  1FNV A;  2NN6 I;  2D5D A;  2JXM B;  3GTM B;  4BY1 B;  5CV6 A;  1PYW D;  1O80 A;  1STB A;  3DWQ A;  5IOC A;  1QIL A;  1H9K A;  4H13 C;  2MP1 A;  3KBG A;  1WVL A;  1BF4 A;  1HPC A;  3WDN A;  2PMZ B;  4G7H C;  3G7L A;  1DOL A;  3OWE B;  1SNP A;  3U9S A;  2AQ3 B;  1D6E C;  4K5V A;  4CBV A;  5ELC A;  3QB3 A;  3I72 A;  4ZRZ A;  4Q5V A;  4C3H B;  3MAQ A;  1STE A;  1B2T A;  2OEO A;  1F9P A;  2PCF B;  1SMY C;  1V1P B;  1DCZ A;  4F8M A;  3NQI A;  3HKZ B;  4UDU C;  3GP7 A;  5BN3 A;  1EWC A;  5EPJ A;  2TMP A;  3J81 L;  2A68 C;  3MXP A;  1ILQ A;  2F0M A;  5M9O A;  5C3E B;  1Y1V B;  3RLF A;  5HUR A;  2SNS A;  1B44 D;  2LFN A;  3F2U A;  2CHB D;  2EPB A;  4RGN A;  2SOB A;  5C5L A;  2KEE A;  3BDC A;  3D4R A;  3AMU A;  2B39 A;  3GTQ B;  1V43 A;  1ICW A;  3I8Z A;  2F0J A;  3GQB A;  4XDX A;  5HGT A;  5C3W A;  2JEA I;  1WTQ A;  1IW7 D;  3GTO B;  2WKC A;  5G3L F;  1TT2 A;  1M4V A;  3VYT A;  2XIW A;  3URY A;  2IWH A;  5F2D A;  5JVG 3;  4RCN A;  5DM7 3;  5J22 A;  3CHB D;  1AW7 A;  3EFX D;  1F9R A;  4FF2 A;  2JA8 B;  1O7Y A;  1EZ6 A;  1NCV A;  1EEI D;  1YNJ C;  5JVH 3;  3MVV A;  4ILW A;  2F3W A;  4A3G B;  1R4P B;  1EY6 A;  1CTM A;  3ERQ A;  2K33 A;  3A56 A;  1G8Z D;  1SNQ A;  3DHQ A;  2CVR A;  1SXT A;  5CV4 A;  5KNC A;  1TWC B;  1M8A A;  1IYU A;  3EJI A;  4K8I A;  4TKO B;  1OXV A;  5FO9 B;  1BOS A;  1WTW A;  3A55 A;  1WD0 A;  1PMR A;  3E0J A;  4I7Z C;  2XNA C;  3QIA A;  1SNC A;  2IX0 A;  1Y1W B;  2F3V A;  4QB4 A;  3V96 A;  4XQN A;  3JAM L;  4FXK C;  2Z4I A;  3CQZ B;  2C5C A;  3MXU A;  5ISR A;  4BA2 I;  4A3B B;  3M7G A;  2AUJ D;  3EVQ A;  1HQR D;  2F03 A;  1HFN A;  5LL6 X;  4RCO A;  2RDH A;  1SND A;  4KKU A;  2ZXO A;  1CHQ D;  1Q3L A;  3P75 A;  3ERO A;  2JA6 B;  4OHJ A;  4HTH A;  3WOE A;  4ID6 A;  2KEC A;  3WOF A;  5C0X I;  4B9W A;  1HCZ A;  2D9U A;  2EYJ A;  1WCM B;  1JCK B;  1MSG A;  3NBH A;  2MHV A;  2WAC A;  2IX1 A;  1EYD A;  4K5X A;  3NQT A;  1PRT D;  1H9M A;  2B8F A;  1BCP C;  1EQT A;  4ULL A;  3S16 B;  2B2V A;  1SYB A;  4FNF A;  5FO7 B;  3RZO B;  3NP8 A;  3G6J B;  4EQO A;  1ZYR D;  3J7A F;  4DK0 A;  3S1R B;  4IAL A;  4KHV A;  3BG3 A;  1L0X B;  1X3Q A;  5E1F A;  4JK1 C;  1OXT A;  4OO1 I;  1HA5 A;  1R9T B;  2F0U A;  2D2C C;  3A8J E;  1ONL A;  1CZG A;  1NR4 A;  2FHT A;  1HUM A;  2NN6 H;  2EYH A;  1SAP A;  3H3V C;  3MA2 B;  3NWS A;  3V2T A;  3NE5 B;  1A2T A;  2MPM A;  4TSS A;  5CC4 A;  2K04 A;  4K2K A;  4G4K A;  4CJ0 B;  1DXM A;  1TWA B;  5IT9 L;  2QEJ C;  3N52 A;  3Q0A A;  3FVQ A;  2JSO A;  1STH A;  4EQN A;  1IKL A;  2B2T A;  1EFI D;  4BS9 A;  4RGO S;  4GZY C;  3I4L A;  2A6E C;  2F0I A;  4NDX A;  2K05 A;  3SK4 A;  2WKD A;  4IFD J;  2JA7 B;  1XYI A;  2K32 A;  2XSC A;  3GTP B;  4NKL A;  1WD1 A;  1DZ1 A;  3BDO A;  3VR5 A;  3HOY B;  2EE1 A;  3K5N A;  5C4H A;  5M3M B;  3TP8 A;  5I6W A;  1ZKO A;  1FGB D;  2F0G A;  2EVB A;  4ZQ3 A;  2K7V A;  1SJH D;  1HTL D;  1TS4 A;  2WAQ B;  3MHB A;  1U9R A;  2GA4 B;  3H6M A;  3Q6S A;  1LT5 D;  1GJX A;  4MHE A;  1C48 A;  2NUC A;  4HMI A;  1H9J A;  2PW7 A;  2JYO A;  3HS0 C;  5EBC A;  1G2S A;  1EY9 A;  3MFG A;  1PRT F;  3S1M B;  1EY7 A;  3NUC A;  3CRL C;  1X3P A;  1H9S A;  1MD2 D;  3T16 A;  3I3C A;  3EA6 A;  3W3A A;  1Q8I A;  2CQA A;  1PTO C;  3NPP A;  1RDP D;  2L11 A;  3P1H A;  2F0H A;  1XXG A;  4K14 A;  2BDN A;  5DEH A;  2PPB C;  1PRT B;  4A3D B;  3E6Z X;  5C6A A;  2HCI A;  1JOR A;  1KAB A;  4CKE A;  1NR2 A;  4RGM A;  1EZ8 A;  3TME A;  1KTK A;  4LK1 C;  4K5W A;  2J0T D;  1S5F D;  1GUW A;  3D31 A;  2G9H D;  3GD7 A;  4FO2 A;  4I65 A;  3OPO A;  2RDF A;  3M85 A;  3T56 B;  1W6K A;  1PFB A;  3PUX A;  3CRK C;  1BXT A;  1D1I A;  1CHP D;  1U4R A;  4KY7 A;  4XQJ A;  4JBW A;  2KVM A;  4KY5 A;  2WB1 B;  1CT1 D;  1DD2 A;  5JAV A;  4O42 A;  5EPL A;  3BVG A;  3KK7 A;  5CBA E;  1SYC A;  1SDF A;  1EU3 A;  3QO2 A;  1KDB A;  1JIC A;  2NVY B;  4B08 A;  4FF4 A;  2BA1 A;  2ICE C;  3BYT B;  5FOB B;  4G7O C;  2R92 B;  1IL8 A;  3FPU B;  3MFY A;  3O13 A;  5JJZ A;  4PMC A;  1HUN A;  5J1Z A;  3T53 B;  1G2T A;  3HEJ A;  1Y8O B;  3A7L A;  1B1Z A;  3KLR A;  5IOD A;  5JPN C;  2I07 B;  1JR0 D;  3EQL C;  3VA7 A;  4DFA A;  3H91 A;  3SE0 A;  3MXN A;  3T51 B;  1QCB D;  2R6G A;  5C0X H;  1KNA A;  5DM6 3;  1Q12 A;  3Q24 A;  3ITP A;  5C44 B;  2JA5 B;  4DGZ A;  1VCI A;  3C1F A;  5C0X J;  3KUP A;  1TII D;  4ZAI A;  2IW3 A;  1I4H A;  5C4Z A;  2F0S A;  2O2L D;  4ZUJ A;  4M8A A;  1ROD A;  1C8C A;  2O4X A;  5ELF A;  3VYU A;  2A6H C;  1HXY D;  2F0L A;  2PW5 A;  1SYE A;  4FYD A;  5E4X A;  2D62 A;  1RD9 D;  3RUZ A;  5T1I A;  1EQV A;  5K36 H;  4KN7 C;  2J7Z A;  3I91 A;  1GUT A;  3J81 E;  3PUV A;  1PXU A;  3FKI B;  4PQX A;  2R61 A;  4IFD G;  3L9A X;  3K7A B;  4IUN A;  4OO1 H;  4X3U A;  2ID0 A;  3R2T A;  4V0B A;  2F0F A;  4F87 A;  3Q22 A;  1LT4 D;  1XWE A;  3K6O A;  4DU9 A;  3BZD B;  4FXD A;  3C3L A;  3GTL B;  2DNE A;  2XRQ D;  1I4X A;  4G57 A;  2IX3 A;  2L1B A;  1TVX A;  2AWN A;  1FD7 D;  3OHX C;  1DON A;  4RWS C;  5KIX A;  5EKL A;  2LMC B;  4KY6 A;  2XWB B;  1LTG D;  1J9O A;  2F0T A;  3NBI A;  1Y8N B;  5KYL A;  5CGK A;  1ESF A;  1QWY A;  1CM9 A;  1F9S A;  4RGT A;  1EYA A;  3OSO A;  5EGT A;  1LO5 D;  4CGY B;  1EOT A;  5KND A;  4HCE A;  1B50 A;  1TY2 A;  3BDL A;  3K5O A;  1LTT D;  2B2Y C;  1PZK D;  2BOS A;  1FR3 A;  2EY6 A;  3DEP A;  1S5B D;  3KLS X;  5CV7 A;  1IKM A;  3OW7 A;  2R93 B;  1EWH A;  2BCO A;  4HN7 A;  4YIJ A;  5D14 A;  1ZEQ X;  5C3X A;  1TWG B;  3V05 A;  4RH6 A;  2HUG A;  1SYG A;  1LTS D;  3JAM E;  4TQU S;  1Z6H A;  2NTS A;  3ND9 A;  2OXP A;  3PUY A;  3NTI A;  1XX8 A;  1E2W A;  2KHS A;  2RA4 A;  4A3E B;  4ZUI A;  2PZT A;  1LV9 A;  2B2Y A;  5D3D A;  2ENB A;  4DK1 A;  3HOW B;  5I9O A;  1TS2 A;  4KKS A;  4KTA A;  1IYV A;  3SEB A;  2RSN A;  3H94 A;  3M7N A;  2VB2 X;  3GV3 A;  2MUY A;  5FLX L;  1LTR D;  5IGB A;  4U68 A;  1HRJ A;  4IUT A;  1B9N A;  3ND8 A;  1YNN D;  3HOX B;  5J39 A;  2PZU A;  5KYI A;  4WJW A;  1Y69 U;  1Z47 A;  1AN8 A;  2EDG A;  3CKI B;  3H0G B;  1F2Z A;  3R93 A;  5A35 A;  1BDO A;  3S1N B;  4KHZ A;  4BBR B;  3R3O A;  3DM1 A;  5C0X G;  4K6D A;  3P7J A;  2BDO A;  5ELE A;  5TSS A;  4NW2 A;  3I4M B;  4U67 3;  4PNY A;  3BS1 A;  1EU4 A;  4RA8 A;  3K58 A;  1ET6 A;  3LX0 A;  4RFB A;  5CV9 A;  5M5Y B;  4BA1 I;  4QUC A;  2WII B;  2CW0 D;  1K8O A;  1OXU A;  3MZ5 A;  4HED A;  5C4X B;  4IUP A;  1DOK A;  5CV5 A;  2RBM A;  3PUW A;  1IW7 C;  2F0O A;  1LAB A;  4ZKB B;  3N6R A;  1LTA D;  3PIO 3;  1A2U A;  5IT9 E;  3A54 A;  4J8Q A;  1SNO A;  2NWG A;  1OXX K;  1BBX C;  1I4P A;  5AFW A;  3HRZ C;  3GV6 A;  4UAI A;  3K5M A;  5I2X A;  5EJW A;  5IGF A;  4HSP A;  2F0W A;  1F2Y A;  2FIN B;  2A69 D;  3J7A V;  4MN3 A;  1QG7 A;  2JEB I;  2E2H B;  3FEW X;  1EIG A;  3PIP 3;  2LS0 1;  3TP7 A;  1C4Q A;  2L55 A;  5M3F B;  1A3V A;  2LY7 A;  1D5M C;  2X69 A;  3BYY B;  1U4M A;  2NVX B;  1UNS A;  3T13 A;  2FJ2 A;  3GTG B;  2L12 A;  1JOO A;  2NTT A;  2KED A;  3U9O A;  4PV1 C;  4ZYS A;  1EY5 A;  1T5E A;  1UUP A;  3OMG A;  1BUV T;  1BNZ A;  5LHY 1;  2JE6 I;  5IGC A;  4L8J A;  1IHZ A;  3TDQ A;  2ZT9 C;  1SSO A;  5CR3 A;  2A5H A;  2G9D A;  1SYF A;  2B2U C;  4C3I G;  2XVS A;  5M5W B;  5I2Y A;  2KA7 A;  2WP8 J;  3PO3 B;  3J80 L;  5ELB A;  1LLR D;  4FVM A;  3H09 A;  3DWP A;  1JE4 A;  4XYO A;  1JWM D;  3TZU A;  1B53 A;  1A15 A;  1HQM C;  4EVO A;  4KN4 C;  3MXG A;  1OXS C;  3X3N A;  5EPK A;  4RHR A;  3NTH A;  3SDZ A;  2F1M A;  3S2H B;  1GHJ A;  3GTJ B;  1GUO A;  1TKW B;  3NXW A;  2E2J B;  4P2C B;  1TS3 A;  1A3U A;  1PRT C;  2CW0 C;  4Z9C B;  1EL0 A;  1LTB D;  1NAP A;  1D2B A;  1LT6 D;  3VR6 A;  4FP5 D;  3L3O C;  2DN8 A;  2IJ0 A;  4Y7N B;  4IN3 A;  5FK9 C;  4DAV A;  1WTV A;  2XWJ B;  3RZD B;  4XQQ A;  1Q90 A;  3VR2 A;  2IL8 A;  2Q8I B;  3QOL A;  1GUG A;  1ZYR C;  2NBF A;  5M5X B;  1K8M A;  3S15 B;  2TSS A;  1B9M A;  1TU2 B;  2EJG C;  4HCS A;  3D6W A;  5KGU A;  3AB9 A;  3KF8 A;  1ESR A;  2H1E A;  1I3Q B;  4S3S A;  1AZP A;  2PNR C;  1CZW A;  1LTI D;  4C3I B;  3OMC A;  1EY4 A;  3NTK A;  2Z4H A;  2B2W C;  3UI2 A;  2MGS A;  1PZJ D;  1WTP A;  1SNM A;  3D8G A;  2L0C A;  1ZXT A;  1SMY D;  1GUN A;  2RVL A;  4J6H A;  4X3K A;  1VF5 C;  2IPK D;  2L9H A;  1STG A;  5I6Y A;  4HSV A;  3ONA B;  3OWF A;  3SK6 A;  4PMB A;  2A68 D;  1SE4 A;  4E6I A;  4ABN A;  1VDZ A;  1E2Z A;  3MC0 B;  4RKL A;  1WTR A;  1JWU D;  2I46 A;  1TY0 A;  1O78 A;  1VMC A;  1G6Z A;  1H9R A;  4IUR A;  5KEE A;  2EZV A;  2FMC A;  1STN A;  4O1N A;  2K5Q A;  4CHT B;  3W2D A;  4F7X A;  1CA6 A;  2B8G A;  3HOZ B;  2NZ1 D;  1FNW A;  3S14 B;  3NWT A;  4HAE A;  1EYC A;  1UAP A;  2RDG A;  2EYF A;  1A3T A;  3HOV B;  3X3M A;  2ZXP A;  2NYZ D;  2Y0S B;  1Q1E A;  3BVM A;  2QCP X;  3NSW A;  1EEF D;  2XRS D;  3K0Y A;  3TP5 A;  3D4D A;  2DY8 A;  2NN6 G;  4ODG A;  3SK5 A;  4LAA A;  4Q0F A;  2NVT B;  2EOT A;  4TRD A;  3PMF A;  2YYZ A;  4XT3 B;  1V1O A;  4DF7 A;  1YNJ D;  2H4O A;  4DXF A;  1BR9 A;  1XTC D;  3I4N B;  3VYR A;  1SBB B;  1E0B A;  2K6A A;  5I4D A;  2J4X A;  3T4A C;  1DYQ A;  4C56 C;  3S1Q B;  2F0E A;  4LMQ D;  4QUF A;  5CMD A;  4QIW B;  2V4D A;  5A2Q L;  2X6L A;  1SYD A;  5JPM C;  4L6T B;  2O5J C;  4DNR B;  3R8B A;  1BO0 A;  1DOM A;  5CV8 A;  3K5L A;  2N88 A;  3BVZ A;  1DM0 B;  2R3Z A;  1ENC A;  5IGG A;  1MBY A;  4IFD I;  1F2L A;  2F0D A;  1I6V C;  2Q8T A;  2QDB A;  1B3A A;  1KLU D;  5CBE E;  2BA0 A;  4A3M B;  3I90 A;  3SR1 A;  4A93 B;  3S2D B;  4N9T A;  3PV0 A;  4C2M B;  3DMU A;  2OT2 A;  4KI0 A;  4LJZ C;  3DXJ C;  3D4W A;  1TQO A;  3MWY W;  1V1P A;  4N9P A;  1QOH A;  3QOJ A;  4X3T A;  1D5X C;  1E2V A;  1PTO H;  2EY2 A;  3TN2 A;  2R7Z B;  1AP0 A;  4KK7 A;  1G91 A;  4KD4 A;  1PZI D;  5COY A;  5DNF A;  1DJR D;  5IGD A;  1J8I A;  4PMW A;  1OO9 B;  1Y8P B;  1S5E D;  2AUK A;  4WFN 3;  1BCP D;  2VNU D;  4FF3 A;  1F9Q A;  1SE2 A;  2K03 A;  4MIU A;  1KDC A;  1CK1 A;  2F0N A;  3I70 A;  4ZLT F;  3MTS A;  5C5M A;  1ET9 A;  1CA5 A;  1JC7 A;  4BBS B;  4B9X A;  3SK8 A;  1B4O A;  4H0L C;  4QF4 A;  4XTC S;  2PZW A;  4KKT A;  4C3J G;  4CKB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...