4ID6A

Crystal structure of staphylococcal nuclease mutant v23i/i72l
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
136
structure length
136
Chain Sequence
KLHKEPATLIKAIDGDTIKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKLEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Staphylococcal nuclease mutant V23I/I72L
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Thermonuclease
total genus 39
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2012-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4id6A00
1STNA 5IGBA 3MZ5A 2PZTA 4K5WA 5CC4A 1EQVA 2F0MA 2QDBA 4KY7A 1STAA 2RBMA 3HEJA 1EY8A 3SR1A 2PW7A 5J22A 2NUCA 4QMGA 4QF4A 3OWFA 5C5LA 1STGA 3D4DA 1KDAA 1SNDA 5I6YA 5IGEA 5C6AA 1A2TA 4K8IA 4IUNA 5CV9A 5KYIA 2M00A 3HZXA 2EYOA 3DHQA 1JOKA 1JORA 2F0FA 4K8JA 3D8GA 5C4HA 4F8MA 3R3OA 5CV8A 3SHLA 5NUCA 1NUCA 5KRUA 2F3VA 3ERQA 3QOLA 2RDFA 2EY2A 2F0EA 3BDCA 4KHVA 3T13A 3ITPA 4EQNA 3NUCA 2EYPA 5I9OA 5IIFA 5IGGA 2F0TA 5IODA 5ISRA 1STHA 4HMJA 3EJIA 5C3XA 3QB3A 1F2ZA 1A3UA 2KQ3A 2RKSA 3C1FA 3MHBA 4QB4A 5J1ZA 3VA5A 4MIUA 3EVQA 3MVVA 2EYHA 2EYJA 3NHHA 1SYCA 4KJOA 3TP5A 3V2TA 5M9OA 5CV4A 1SNPA 5DAUA 1A3TA 1JOQA 4HMIA 3S9WA 1SNQA 4N9PA 4KD4A 4B9XA 1II3A 1SYFA 3H6MA 2O4XA 4DGZA 1EY0A 4HTHA 4NDXA 1SNMA 4PMBA 5CV7A 5E3FA 4KD3A 4F7XA 2F3WA 3SK6A 3SK8A 5KIXA 5CGKA 4ZQ3A 3MXPA 5IGDA 2F0WA 3C1EA 2F0SA 4K2LA 1SNCA 2F0HA 3MEHA 2EYFA 1F2YA 3LX0A 3U9OA 3NP8A 4R8NA 5CV5A 5EKLA 2F0OA 4KJNA 4I65A 4IZ8A 3NXWA 1EZ6A 1EY7A 2PW5A 4PMCA 4S3SA 3P75A 2LKVA 4WRDA 1RKNA 1EYCA 1EY6A 2EY6A 3QOJA 1EY9A 2F0QA 4PNYA 2EY1A 1A3VA 4NP5A 2F0KA 2PQEA 4K5XA 3P1HA 4K2KA 4WORA 5F2DA 4ZUJA 1SYBA 1EYAA 4K6DA 4E6IA 3SK5A 1KAAA 4KV6A 1KDBA 4EQPA 1U9RA 3PMFA 5C3WA 5DEHA 5EGTA 3RUZA 2F0JA 2EYMA 1SYEA 2PYKA 4J6HA 5C5MA 5K5PA 1ENCA 2F0UA 2SNSA 4NKLA 3T16A 3TP7A 2F0VA 2PZUA 5I9PA 2WACA 4KTAA 5CR3A 1NSNS 2F0LA 4B9WA 4YIJA 3BDLA 5KGUA 1KABA 3TP6A 3NK9A 2SOBA 1JOOA 1SYGA 4IALA 1STBA 1EY5A 4NMZA 2OF1A 1SNOA 2OEOA 4ODGA 4KY6A 2F0PA 1ENAA 4DF7A 1TQOA 3NQTA 2F0IA 1EY4A 3SXHA 5KEEA 3D6CA 3E5SA 1TT2A 4K14A 5KYLA 3OMCA 2EYLA 3EROA 4K5VA 4ID6A 5E1FA 5HURA 4ME5A 4H7BA 2F0NA 4KY5A 4RKBA 4ZUIA 5J39A 1EYDA 1STYA 2KHSA 3TMEA 4TRDA 1IHZA 4EQOA 5IOCA 2PZWA 5JOBA 2EY5A 4LAAA 1KDCA 3SK4A 2OXPA 1AEXA 3DMUA 4RKLA 5C4ZA 5IGFA 5JAVA 1EZ8A 5CV6A 3OSOA 4OL7A 5I6WA 3D4WA 2HQEA 4DFAA 4J1MA 1TR5A 3TP8A 3OMGA 2ENBA 2F0DA 4G57A 4N9TA 2F0GA 4DU9A 2EXZA 4EVOA 2SNMA 5HGTA 1F2MA 1A2UA 5EKKA 1SYDA 5IGCA
chains in the Genus database with same CATH superfamily
4DV3L 2PZTA 2QDBA 1B70B 5GADC 4DV7Q 2NWGA 5D14A 5G3LD 5JJIA 2YU9H 4LF4L 3N6RA 3PUWA 3ULJA 1BR9A 1ICWA 1BCPD 1N8RC 2B2TA 4GKJQ 2UUAQ 2EPBA 2Z6KC 4JBJA 1ASYA 4HCSA 1DM0B 2DUDA 4ULLA 1FD7D 2B2TC 1LT5D 1IZ6A 4XYQA 4TQUS 3CF5A 4GNXC 1WTPA 2A6ED 2Y0SB 3CP0A 4IUPA 2E5LQ 3V2TA 5CV4A 3A0JA 1E3PA 3X3MA 1ASZA 4JV5Q 1GUWA 4FF1A 4PMBA 1G2SA 1J6QA 4ABNA 1I4QA 1BCPB 4A3IG 1W2BA 1F2YA 1PH5A 2IWHA 1H9SA 1N33L 2NVTB 4OO1G 2E2JB 1EZ6A 4BWGB 1X54A 1PH2A 2ID0A 1UAPA 1BUVT 4X62Q 5IYCG 5JEAH 4HEDA 4H02A 4IPGA 1HH2P 2UXBQ 5KNDA 4GLVB 2ZXOA 1W6JA 2EIFA 4H13C 1S5DD 5ELCA 2Q2TA 4BY7B 1GHJA 4OWTB 2F0JA 2YU9B 1KRTA 3Q0AA 3OIPA 3F1ZA 2F0UA 4NKLA 2K32A 1CT1D 1I4PA 4APVA 2BH8A 3BJUA 4KKTA 4MNOA 4BBRH 1VQ9A 4IALA 1DGSA 1VQOA 3BVMA 4R8IA 1Y1WH 1BKBA 4JC0A 3VR5A 2JYOA 2R93H 1HTPA 3EBEA 3TQYA 2VL6A 4NXNQ 3M4QA 1RTOA 3I55A 2E75C 2PNRC 4KY5A 2ICIA 1CFMA 3MAQA 3NENA 3I4NB 1P16A 3S14B 4C3HB 3GP7A 2ES2A 3CCJA 1O7LA 3HFZB 1LV9A 1F2MA 2K04A 5EBDA 1PTOD 4EQ5A 2IY5B 5LL6S 1EQVA 1VQ8A 2KCMA 1EY8A 1SXTA 3D31A 4C3JH 3CC4A 1PV4A 2CCZA 2HQLA 4DA2A 3HOZG 2F0FA 3I2ZA 3UDFA 5CV8A 3SHLA 4IOCA 5KRUA 1CSQA 4YCWA 3CCUA 1BCPC 3HOUH 2HCCA 3PQIA 1N32L 2F0TA 4OX9L 3NBHA 2JQOA 3EJIA 5T1GA 4QB4A 5J1ZA 2KUMA 4OEMB 3TP5A 1PH3A 4XT3B 2B29A 3FKIB 1CTMA 2B2YC 4XT1B 5DAUA 4U673 1V1OA 4FP5D 2HHHL 2D5DA 2NVYH 4JBMA 1HHVA 4JI4L 4OXPA 3I4LA 1Q46A 5JVH3 4DV6L 2MP1A 2JEBI 3MEHA 3R8BA 5CV5A 1JE5A 1UE5A 3J81c 4I65A 4IZ8A 5EKIA 3S2HH 3S24A 4PMCA 3P75A 1VQMA 1RKNA 1EYCA 1WCMH 2K5VA 3VYSA 3L7ZC 3M7GA 3K58A 1G8ZD 1Y1WG 2KCCA 3PIO3 3CCEA 3G4SA 1DOKA 3P7JA 3K0YA 4CJ2C 4B3TL 3AYHB 4LMQD 4A3JB 1WTOA 2JA6H 1BXTA 2QEJC 4A3GG 3VYRA 1S5CD 4JI2Q 3NPPA 2KCNA 2M2LA 3S1QB 1F2LA 4A3CH 1SJED 5JJLA 1I94L 1EOVA 3SEBA 1B4OA 4Q0FA 4RAUC 3S1RH 5GAHC 1F9PA 3TMEA 1AH9A 4RHSA 1PVOA 3KFUA 2NYZD 2HDMA 3MXNB 3MA2B 4OIJA 4DV4L 2K5QA 2WFWA 1Q3LA 4EVOA 2CQAA 2EVBA 1HA6A 3GTPB 1HZBA 3KLWA 3KYHC 1QNUA 3I4OA 4JI7Q 3BZCA 3KBXA 3PO3H 1X3QA 1OXVA 1W6KA 4QMGA 4HR7B 1VQHA 3GTQB 3I7FA 1Z47A 4GN4B 1LTBD 5M5WH 3PIPA 1TS4A 4DR5Q 2KHIA 4JG2A 3PV0A 1B8AA 1C9OA 4G4KA 3QR8A 2Q8IB 4JI5Q 3G71A 3DM3A 4YHHL 3MHBA 1N34Q 4A3MH 1KXLA 2QF7A 4XDXA 4ZYSA 3CCMA 3MVVA 1Y1VG 5LMUQ 3DWQA 3HS0C 1XMQL 5E7NA 4FXDA 4HJAA 4JVZA 4A3JG 5M3MH 1FJGL 2XGTA 1PFMA 4B9XA 4A93H 4A93B 4DGZA 2V4DA 1BCPF 1X3GA 2FJ2A 2QDLA 2G9HD 1AE3A 2L4NA 4DV1L 1TS5A 3MWYW 1GUNA 1B7YB 4KJNA 1YJ9A 3KLRA 3M85A 5IP9H 3EFXD 4DR7Q 2EJFC 4X3SA 1KAAA 1K28A 3F2UA 4JI2L 1JWUD 1Z9FA 1Z7TA 3T1YQ 3MC0B 3Q22A 2M9VA 3I72A 2B2UC 5EPLA 4DV5L 2WIIB 1XXGA 2JA7H 2PZUA 3B6YA 3STBD 2WV6D 2BH2A 2F0LA 5GAGC 5A35A 4P74A 1KABA 5TSSA 1E0BA 1JQYD 1WTWA 3PO3G 4BBRB 4A3LH 4L5SA 4P73A 3OPOA 1TY2A 1UEAB 2BA0A 5IYBH 1X32A 3GTGB 5E1FA 4DUYQ 4JYAL 1KLGD 3NBHB 4RMFA 2NTTA 5FJ8G 3VR3A 1NJIC 4C2MB 4ZUIA 3J7AF 1J5EL 1QZHA 1B1ZA 4K6LA 4EQOA 5IOCA 1KDCA 4C3IB 2IT1A 4Q5VA 5JAVA 3ULLA 3KBGA 3R2IA 5LMNQ 1YNXA 4X66Q 3P20A 2SNMA 4DR3L 1JB3A 5IE8A 2R7ZG 1V43A 5IGCA 4V190 1C48A 1STNA 3JC66 4RGTA 4YWKA 3GO5A 3J80E 4JI1Q 3RNUA 4A3GH 1U4RA 2EOTA 2FINB 1HNXL 2EQSA 1VQIA 1MJEA 2VQFL 1C0AA 1G6ZA 3ERQA 4CKBA 1XX8A 3OW2A 2F0EA 3LGJA 4KHVA 2IPKD 3T13A 3NEMA 1EIGA 1ET6A 2DJGC 1X55A 5K36G 1HNZQ 4DK3C 4UHVA 4MIUA 4A3FH 4PZ8A 4XQQA 2YTVA 3AFPA 1E1OA 1EIYB 3GTJH 2X69A 1NE3A 1KNEA 3MFYA 2DNEA 1VQCA 3H6MA 2ZM6Q 4NDXA 4BY1G 3OWEB 3RZOB 3ND9A 5C4XH 3C3LA 4R1JA 4JI8Q 4X3TA 3JAMc 4HIKA 2E5LL 4ILWA 1B9NA 3U9OA 4YY3L 1YJNA 2NVTH 1ESFA 4DV0L 2XVSA 4DR2L 4RFBA 3CW2C 4DAMA 1YNJD 2DJFC 1EY6A 3S1NB 2EY1A 3P1HA 2QEXA 3KDFA 1BDOA 5H1SE 3HOXG 1N34L 1PH6A 5C3WA 3A7AB 3LNNA 1CQFA 4C3JB 4DV2Q 2AWNA 1PH1A 4Y7NB 4A3KH 3PUZA 2JJQA 1JOOA 1SJHD 1SYGA 4DV4Q 1L2FA 1IBLL 1JJGA 1GUGA 1SEBD 5IWAL 1MD2D 2F03A 4ODGA 3ER0A 2F0PA 4KY6A 2VNUD 2X6LA 4JI6Q 1ML0D 4C3IH 3HOYG 1PFBA 3VYUA 3A56A 4ZK9B 3UE1A 4ZKCB 3J81j 4H44C 3I4NG 4IPCA 3H0GB 2I5MX 4KI0A 3PUVA 4IQZA 3TS2A 1U5KA 1S5ED 1YIJA 4DU9A 1UE6A 2R92H 1PRTC 4IUUA 1Y8OB 4QIWE 1HZCA 5IGBA 1RL2A 1IYUA 3D4RA 4ALPA 1E1TA 4IOAA 1MI2A 1RJTA 2KVMA 2BE5C 3HP3A 3OWFA 1K83B 3J80i 3J7A5 5A2QL 5FJ8H 3UDIA 2PQAA 3J7AV 3D8GA 2WAQG 4CJ1B 4C1NI 1DJRD 1KLUD 4AQYQ 4R4OA 4BBSG 3H91A 2K03A 4OIKA 4OWXB 2E2JH 5IGGA 2A73B 1I6HH 1ILPA 1STHA 2L5TA 2H4OA 1I3QH 3GTLB 2N88A 3C46A 1XMOQ 4FO2A 3STBC 1PH4A 2EDGA 2E74C 3DWAA 1A6XA 2WKDA 1R4PB 3IL8A 5FLXE 3RZDH 1I6VC 1KRSA 1GHKA 3GV3A 3UDXA 1EY0A 1VMPA 1VQLA 4LNQA 4C1NK 5IP7H 5KNBA 1J5EQ 3D3RA 2K01A 1XTDA 2IW3A 4UAIA 3LX0A 2XWBB 3NP8A 1DONA 4X64Q 1K0SA 3G48A 2OCEA 1TWHH 4LF8L 4KKSA 1SSOA 1PTOH 3DLLA 1XNQL 2Q8TA 3F8TA 3KDFB 4O42A 3I4NH 2EE1A 3I56A 5C4XB 4IO9A 2B2VA 1LACA 3GDEA 2NZOA 1B53A 1L0XB 1DOMA 1PYSB 4YWLA 4J6HA 2WACA 2DY8A 3TBIB 2LXJA 3BDLA 3GTKH 2JA5B 1M4VA 3M4YA 1EY5A 2MPMA 1AZPA 4A3KG 4G7HC 2OTJA 3EA6A 3RLNA 4L8JA 2A6HD 1HXYD 4CKCA 3M3YB 3IRBA 5JVG3 2JA7B 1XNRQ 4K0KL 1YBYA 3F2DA 2X6GA 1Q81C 4RKBA 1PZJD 4GKKL 4GLXA 3J7ZC 4FF4A 4YCUA 1YNND 1EU3A 2CWPA 1TKWB 4DAVA 3CAMA 4UPAA 3O13A 4CDEC 3D4WA 2HQEA 1S5FD 1TR5A 1JCKB 5ELOA 1HR0W 4NPSA 3CHBD 4O2DA 1ZEQX 4JI0L 4TKOB 5C4JB 1JB7A 2Z4IA 3S15H 2F0MA 2RBMA 1LLRD 3H15A 1PRTF 1Y14B 1S5BD 3CRLC 5BN3A 2Q2IA 4IUNA 5CV9A 1KQSA 2PI2A 4DR5L 3PO2B 5K36H 4UP8A 1X65A 1SMYC 1CUKA 2F3IA 3Q23A 2VQFQ 5IT9E 4L5TA 1ZYRC 2XWJB 3NUCA 4R4IA 1AFPA 1YJWA 1U4MA 1A3UA 1NTGA 3C1FA 1VQKA 3RLOA 4HSPA 2EYHA 5M5XB 4A3EH 3NHHA 4X3UA 1E2ZA 1GVPA 3KUPA 2WB1B 1K8AC 4JV5L 1SNMA 1OXXK 2B2WA 5CV7A 4KD3A 3W2DA 3SK8A 1J8IA 5M5XH 1K3RA 2QILA 2E2IH 5D65A 2R92G 2Q2HA 1SNCA 2Z6BA 2E8GA 1TWHB 2R61A 3HKZB 2WB1G 4A75A 4RGNA 3GTMH 1JT8A 2VUMG 1YHQA 1SN8A 5C0XH 2B3GA 1LYLA 2CKZB 3I70A 2UUAL 2KOLA 1X3FA 3HKZG 2VS1A 2QW7A 3WWVA 1V8QA 3SK5A 4GOPC 4KV6A 4EQPA 3HOVH 5JJKA 2PMZE 5DEHA 5EBCA 1NMGA 2I0QA 1EYGA 3W5OA 3A5UA 2LFNA 3D6WA 4A3MB 4B9WA 4YIJA 3W3AA 4JI3Q 4TSSA 2ASBA 3DXJC 1HA5A 2AMCB 4NW2A 3E0JA 2MO0A 1HTLD 5FOBB 2SEBD 5JPMC 5KYLA 2QCPX 4LUVA 4QUFA 4MN3A 4RG1A 5HURA 2UUCQ 3MXUA 4B3ML 1V1PA 4GOPA 1SR3A 3CPFA 1Y8PB 2UUCL 1LM0A 1STYA 3G6EA 4B3RQ 2Q8RE 1QWYA 3NE5B 1EQQA 2JA8B 3OSOA 4OL7A 4A3DH 3U4VA 2K5WA 4J15A 1ILQA 1BF4A 3X3NA 1HR0L 2L11A 4B3RL 1HQMC 4ZRZA 3K5LA 4A3DG 2ATWA 2K5DA 5M3FB 2BA1A 1HPCA 5I2YA 4P75A 2RA4A 5KYIA 1GD7A 1JICA 1JOKA 1QILA 1JORA 2C9OA 4BA2I 3CCQA 2CQOA 1XPUA 2R93G 1RIPA 5AFWA 2PI2E 5I9OA 1STEA 1SMYD 3CPWA 5DM63 1TXYA 4HMJA 2RQXA 4A3KB 4DFAA 3HOZB 1PRTB 2GVAA 4KJOA 5M9OA 4JI8L 5A2QE 4OO1I 3MEFA 4GNXA 1LTAD 2HUGA 2L1BA 5M3MB 1G291 1U0LA 3RZDB 4LJZC 4PZ6A 1C8CA 4BBSH 2XNAC 1LTGD 1WFQA 2BCOA 3ZYYX 2UUBQ 5IYCH 5GROA 4NXNL 3BVZA 2IX1A 1WD1A 2D9UA 4CDDC 2A6HC 2A68D 4JI6L 2K7VA 2Z1CA 1HRJA 1A62A 2K1BA 1A3VA 3A55A 4ZUJA 4A3CG 1KDBA 1K9MC 1R4QB 4RGMA 4X64L 3J81E 4POFA 1PTOC 1VDZA 2E2DC 2WAQB 2B2VC 3M4PA 5FO9B 3V96A 5ELEA 2NB0A 1NAPA 2FXQA 1K8MA 4NMZA 3TRZA 3WOEA 4QQBX 1VMCA 3M7NA 1H95A 5KNCA 1PDQA 4DR1L 1KD1C 2L15A 2GN5A 4NXML 4DAPA 1O80A 3TN2A 3C2PA 5C44G 1SBBB 1KIXA 1HFNA 2IJ0A 2UXCQ 4XQJA 3TEHB 2AUKA 1N32Q 2L9HA 3S1MH 2C5CA 5C44B 4N9TA 2VXWA 4JCVE 2MQHA 1A2UA 2VZAA 3T16A 3K59A 3DM1A 4DK6C 1PHJA 4X6AH 1UE7A 1HCZA 2K14A 1HFGA 3I73A 4HN7A 2PW7A 2XRSD 5EJWA 1JR0D 4LFBL 1FR3A 2M00A 2N3SA 2IX3A 1L0WA 3R2TA 1W3SA 1LTRD 4G7OC 2MHVA 1QG7A 4DAYA 1CKNA 5ELDA 4DR4L 1MSHA 1D5MC 2RHSB 1D5XC 1IBML 3S2DB 5FLMH 1IKLA 3HOUG 1L1OB 3VR2A 3I8ZA 4N8FA 3VA5A 5HY6A 1GUOA 5FK9C 4IFDG 1T5EA 1PXUA 2B2UA 1WTXA 3RMHA 4WFN3 1EOTA 4DAYB 4ZKBB 2Y0SG 4KD4A 4C3JG 1KHIA 4HTHA 4R4QA 1FJGQ 1HZ9A 1NR4A 1XMOL 1XMQQ 1TWAB 2AWOA 2YYZA 2I07B 3MXPA 3T51B 5M5YH 2A6EC 3K7AH 3EQLC 4R8NA 3W1GA 3D0FA 3IFDA 4S3SA 2N49A 3KF6A 1VQJA 1P8LA 3IKJA 4F87A 1K3BC 1VQ5A 1S40A 4A3GB 1UUPA 1PYWD 2JP1A 2NZHA 3FMCA 2RF4A 2JXMB 2VY3A 1ENCA 2CW0C 4BBRG 3H3VI 1JWSD 1I3QB 5KGUA 1PZID 1GM5A 4ZAIA 2QGQA 3TP6A 3T1YL 1FVIA 3J7YW 1GUSA 2JA6G 4A3EG 2JA6B 2I46A 1LUZA 3VR6A 1EY4A 3N52A 5IYDH 5ELNA 1QOHA 3FP9A 4K5VA 3T56B 1XWEA 4ME5A 2K28A 2J4XA 3PUYA 1E24A 3M3YH 4J8QA 3S1NH 2A68C 2OXPA 4TVAB 5C4ZA 2PQAB 2FMMA 2XTIA 1O7ZA 1B3AA 5FLXc 5IYBG 5EAYA 4UDUC 3DWPA 5C3EB 3IAYA 3BU2A 5J22A 1ZKOA 2HIXA 3H09A 2KEDA 3PIP3 4CHTB 2RDHA 4K8IA 2A69C 1GOZA 4R9WA 2CVRA 1N9WA 4AYBE 1LTID 1D1KA 3FKIH 1CKOA 4K8JA 1HR0Q 5C4HA 1XYIA 3CC2A 2GVBA 1RHPA 2TSSA 2HD3A 4HIMA 1A15A 4A3FB 1X9NA 3ITPA 1JE4A 3U58A 3TS0A 2NBFA 4A93G 4Y7NH 1YZ6A 1DXMA 1D1IA 2KQ3A 3HOUB 4LFCQ 1TWGH 4BBSB 2F1MA 5EPKA 1NY4A 1I50H 2N78A 3M9BA 4IUVA 5J3BA 2UU9L 3CQZB 4GKKQ 4OWWB 1TWGB 1MKHA 1DYQA 5DNFA 4BA1I 1V9PA 4K2LA 1SAPA 2B2WC 3ERSX 3RD4A 5EKLA 2EJMA 3I90A 3NELA 1T5XD 2N8NA 4RA8A 2EJGC 2Z6KA 2ZM6L 3CC7A 2L12A 2O5IC 1L0YB 4BS9A 1EY9A 1SLJA 4M1UB 2E2IB 1LT6D 4HJ5A 5BR8L 2F4VQ 1Y69U 1WTVA 3KF8A 4K5XA 3L9AX 3KLSA 1YHAA 1YNJC 1K83H 1LT4D 3PIOA 3BZDB 5K5PA 2FMCA 2R7DA 1UEBA 4RH6A 3GTGH 4B3TQ 5C3EH 1PFSA 3A54A 1PFNA 1SFOH 4X66L 1C4QA 3NBIA 4FF2A 1OXSC 2TMPA 1CA5A 3E6ZX 5LMUL 2R6GA 2JA8H 3E9IA 4LWCA 4K14A 3J81L 2YTXA 3EROA 5JPNC 1IL2A 1IKMA 2F0NA 4JI5L 1WTRA 2R7FA 1RDPD 1Q8KA 3U9SA 3J80L 2C35B 1OXTA 4P71A 3UI2A 2EY5A 3SK4A 4RCOA 3GD7A 2PPBC 3OMGA 4G57A 4XQNA 1O7YA 5DLQE 2ZJRA 4MTKA 2D2CC 4R4CA 4K5WA 2NVXH 4PZ7A 1FYCA 4AQYL 2O2LD 3ULPA 1STGA 2Q2UA 1SNDA 2FFKB 1HUMA 5C6AA 3FPPA 4EGVA 3WOFA 4DK0A 3MXNA 1LTSD 3QOLA 4C3IG 1TIID 3OTOL 3HOWB 1NCVA 1WCMB 1X56A 1CKNB 4A3LG 5IODA 4CGYB 3S2HB 2IX0A 4WJ3M 5CBAE 4F88A 4B3SQ 1WCMG 1N36L 2UUBL 1K73C 4IFDH 1T9HA 4K0KQ 1FNUA 3QJYA 1F77A 1WJJA 3HRZC 3R93A 3S9WA 3ND8A 2A5HA 1QVGA 1BBWA 2UU9Q 4N9PA 1AN8A 2O4XA 1TU2B 3KJOA 1LTLA 3GTJB 1A0IA 3HGBA 1QVFA 1TY0A 3FEWX 2LS01 4DV2L 5IP9G 1CKMA 4L6TB 3A7LA 4KN4C 1EY7A 4WRDA 1SROA 5GQOA 2EY6A 2AHOB 4PNYA 4NB3A 4NP5A 2RDGA 3E3XA 1QZGA 1SYBA 4E6IA 4LFAL 1E22A 4KK7A 4HSVA 4X65L 3RUZA 5EPJA 4FXKC 4LF8Q 2JN4A 4A3BG 5I9PA 2NVXB 2JEAI 3DUZA 3HOZH 1PRTD 2XRQD 2EXDA 4LW1A 3BDOA 5I4DA 2A1AA 3S1QH 1CSPA 1PYBA 5C44H 3S17H 2OF1A 3T1HL 3BZKA 3MTSA 4Y52H 3CCLA 5M5WB 3HOVG 4YY3Q 1L1OA 1EWIA 2H5XA 4IPDA 4H7BA 4C3HG 4AH6A 4QGUA 4DNIA 2MNAA 3NSWA 2CH4A 2PZWA 4LAAA 2P5ZX 1OTCA 1AEXA 4IPHA 3QIAA 2JK8A 1M90C 4FDBA 1EZ8A 4CDCC 1EL0A 1KTKA 3FDTA 1Q1BA 1XTCD 1SFOB 4JBWA 2AKWB 3GTKB 1ZYRD 2GA4B 3L3OC 1Y1VB 1IW7C 3NTIA 2R7ZH 1B50A 1STAA 4UY8C 1GO3E 4AIMA 3EN2A 1A2TA 3HZXA 4OO1H 4IJHA 1HNXQ 3JAMi 4JPBW 5CYUA 1NUCA 3HOYB 3BDCA 2ZTDA 3QG1A 4L5QA 5T1IA 2K52A 5ISRA 3J80c 1G51A 4DR6Q 1F2ZA 1HNZL 4DR3Q 1K0RA 3K7UC 4QIWB 1XPOA 3CXCA 2OQKA 1JOQA 4HMIA 1AP0A 1SYFA 4LUZA 4LK1C 5E3FA 2BE5D 3PO2G 2F3WA 5IWAQ 5KIXA 4C56C 4ZQ3A 3I4MB 4DUZQ 4EX5A 4HIOA 3VDYA 3AQQA 3L0OA 3KLSX 5AJ3L 1UWVA 1LT3D 2AQ1B 3K7AB 1SE8A 3OYYA 4LF6Q 1TWAH 3QOJA 4P72A 3OTOQ 2WP8J 1RD9D 3CRKC 2F0KA 2N55A 3G7LA 2MGSA 1RODA 1Q12A 4LFBQ 2DGYA 1CM9A 2RSNA 3GTQH 1LABA 1M8AA 1SYEA 5M3MG 5BN4A 1CI3M 4LF9Q 1MJCA 4YCVA 1NSNS 1Q90A 1Y1VH 4OELB 4AYBG 2PNHA 4DR4Q 2SOBA 1H9RA 5DM73 3NWTA 2QA4A 3PF4A 2RSOA 4LF5L 1IBKQ 1EQTA 1EFWA 3NTHA 4KKUA 4GN3B 1Q7YC 4XIGS 3K5MA 2HDLA 3PGZA 1G91A 3F2BA 1HUNA 1V1PB 4GOPB 4L63B 1FNVA 1Q1EA 1N36Q 4JOIA 1RCVD 1EQRA 4UP7A 1SE3A 1EYDA 1M1KC 1GXDC 4OHJA 3JAME 3GTOH 4RKLA 1E7ZA 3PF5A 2A19A 4IN3A 5M3FG 3KF8B 3RR5A 2ZT9C 1IBKL 2XIWA 4LF4Q 1HNWQ 4L5RC 4Z9CB 2OTLA 3WDNA 2UXCL 2ZJPA 5LMNW 3CCSA 4KLKA 2Z4HA 4GN5A 3TSSA 3I4MH 3SR1A 4BY1H 1EEFD 2MJ8A 4RHRA 4QF4A 1H9MA 1R9TB 1Z6HA 1QB5D 1J9OA 1YEZA 3FVQA 5FLMG 3A8JE 1AE2A 1EEID 3MXGA 1IW7D 3L2PA 3A8KE 2F4VL 1KL9A 2RDFA 2JA5G 1MHWC 2NN6I 1EWHA 1N33Q 4RCNA 4FXGC 3GTMB 3AEVA 1JMCA 4R4TA 1YITA 1D2BA 2RKSA 1H9JA 2E2HH 5IT9c 1WYDA 5I6YA 2JE6I 2I5LX 1BQQT 4ZCKA 4RGOS 4F7XA 1VQGA 1QVCA 2E2HB 2O5JC 3QWNA 3OOCA 2F0HA 4A4IA 2B8GA 2EYFA 2Y0SE 3CCVA 1EUJA 2MFIA 4BY7G 2PW5A 1KNAA 3S2DH 2F52A 2PCFB 4DNTB 4O0AA 4GNXB 5D3DA 4XTCS 4WORA 4JI3L 4K6DA 1IYJB 3K57A 3GV6A 3U50C 3PO2H 2KBNA 5EGTA 2PYKA 2EYMA 5C5MA 4FYDA 4DV7L 1LTTD 2SNSA 3TP7A 1B2TA 4DV3Q 4M8AA 2Z8LA 4CKEA 1I6HB 1B9MA 1E2WA 1AZQA 1I4GA 1STBA 3BVGA 1EWCA 4HJ8A 4YWMA 4QY7A 1SNOA 1JWMD 1ENAA 4DF7A 2JA7G 1UNSA 2JA9A 5KEEA 1QJOA 1VQFA 1D8LA 1CK1A 3HOXH 3ICEA 4B3MQ 2MO1A 4OGQC 4X3KA 5J39A 4LFCL 1ONLA 1TS2A 1SE2A 4PMWA 2PMZB 2NN6G 3RN2A 3PCOB 5I6WA 1VF5C 2F0DA 2F0GA 1IBLQ 5HGTA 1ZXTA 1H9KA 5EKKA 4BXXH 3K8AA 3SGIA 5CC4A 3NTKA 2RCNA 1PH9A 1CHPD 5C4XG 3BYYB 5M5YB 1EU4A 4DK1A 3CMEA 3I3CA 2NUCA 4ME3A 3D4DA 2HCIA 5IGEA 1XJVA 2CFMA 1YHBA 3MFGA 1JC7A 2LSSA 2WINB 1S4ZA 4QL5A 2VW9A 3KJPA 4JI4Q 2F4IA 3R3OA 4F8MA 2F3VA 2ZXPA 5LL6X 1WI5A 5C0XI 1VS0A 4DV0Q 3I91A 1TS3A 3NQIA 2K05A 2OT2A 1K8GA 1MIUA 4IFDI 1FGUA 5C0XJ 1H9SB 1TWCB 2L0CA 3PSIA 1ICFB 1A3TA 1QUQB 2B63H 2B63B 4LF5Q 1SNQA 2Z0SA 4U68A 1I50B 2LY7A 1WD0A 1QNKA 5BN5A 3SK6A 3FRPB 4HIDA 2BOSA 1CA6A 1CHQD 5IGDA 3CKIB 3AFQA 3M4OB 4DR1Q 2QKIC 5FKAC 2LXKA 1DCZA 3NXWA 4B08A 5JEAG 1VQDA 1TWFH 2NN6H 2V1CC 4LUOA 2VQEQ 1HQRD 4IJLA 1XNQQ 3RZOH 1NNXA 4MZ9A 1VQ4A 1D5ZC 5G3LF 3FPUB 4JI1L 1YI2A 2KENA 3EIVA 4MHEA 4DUZL 4A3EB 1BVSA 3FKIG 5LHY1 4NXMQ 2B39A 1U4LA 5LMNL 4DXGA 4LF7L 4LF6L 4JOIC 3VR4A 2BDOA 2OQ0A 3K81C 1DOLA 3A74A 2NTSA 1G6PA 1I4RA 3QO2A 5CORA 2K50A 4JBKA 1B3QA 1IHZA 3CCRA 2NVQB 3OIQA 5D3IB 3DMUA 4AYBB 1SDFA 2ALYB 5ELFA 1VQPA 5CV6A 4GLAC 2ZJQA 1FGBD 3T53B 1GUTA 3UDGA 2K5HA 2XSCA 1IXRA 3GTOB 1I4XA 1BO0A 1O78A 2FHTA 3HEJA 1I4HA 3JAML 5C5LA 4OX9Q 4FNFA 1WTHA 3PUXA 2EYOA 3DHQA 4JI0Q 4DV1Q 2WB1E 4O1NA 5NUCA 5BR8Q 1TWCH 4QUCA 2EY2A 1PH7A 1X3PA 3V05A 3BYTB 2JA5H 3HKZE 4IURA 1A63A 3Q24A 1S3OA 4A3FG 1SNPA 4H0LC 1XNRL 2CW0D 2NVYB 2AQ2B 1GJXA 4FVMA 3DEOA 2LMCB 1HJPA 3I4MG 2A8VA 5M3FH 2F0WA 1PA6A 3C1EA 2F0SA 3HG9A 1FL0A 4X65Q 2R92B 1X6OA 4HAEA 1KC8C 1TVXA 1C7YA 5GAEC 3E0EA 1SE4A 5C0XG 1QUQA 3RN5A 2PQEA 5F2DA 2KEEA 1D6EC 3J81i 2IHEA 4CBVA 4BY1B 4DR6L 4KHPL 2HIVA 1R9TH 5ELBA 2F0VA 2RHQB 3S15B 2K5NA 1A8VA 4DKAC 3NK9A 2G5DA 3TZDA 4CJ0B 2UXBL 2OEOA 4KN7C 3S1MB 1L1OC 2YTYA 3W1BA 4DR2Q 1PMRA 2DN8A 2F0IA 3NQTA 3OHXC 4X62L 2VB2X 4B3SL 2NVQH 3OW7A 3F2CA 2EYLA 4ID6A 2K75A 4HJ9A 2AQ3B 4I7AA 4C2MH 5AJ3Q 1U4PA 2K6AA 1K8OA 3KF6B 3S16B 2KHSA 1VQ7A 1VQ6A 4P2CB 3UE0A 1PTOF 1Y1WB 1I94Q 3H3VH 3CMAA 2XN9C 4A3DB 2EXZA 1JJCB 4A3IH 3MZ5A 4PQXA 4KY7A 3RLFA 3H0GH 1Q8IA 2VB3X 2OWOA 1BBUA 1KDAA 1BOSA 4MTNA 4CDFC 3K5NA 1I5FA 3Q8DA 4A3BB 1D7QA 4EQNA 4UP9A 1EIFA 2EYPA 2D0OA 4PV1C 2NZ1D 3HOWG 3KOJA 1MSGA 5C3XA 2D0PA 3QB3A 2R3ZA 4A3JH 2JSOA 1VQEA 3AB9A 1RF2D 2ZXRA 4DV6Q 1SYCA 2A74C 4RWSC 1AW7A 3ZJYC 4A3MG 2A69D 3CD6A 1SRUA 1II3A 1NMFA 2KHJA 3IFTA 4QCLA 4KMUC 1DZ1A 2CHBD 5CGKA 3GTLH 2PO4A 4I7ZC 3KK7A 4KHZA 2WAQE 3K5OA 2F0OA 2B63G 1S72A 1EIHA 1PH8A 2J7ZA 4GZYC 1IBMQ 1JJ2A 4C3HH 3S14H 1O7IA 5FLXL 1WOCA 1FNWA 2H1EA 2YV5A 3URYA 2VQEL 3HOYH 5EQ0A 2KCTA 1EYAA 1QCBD 1VCIA 1U9RA 4HJ7A 3K80C 4DNRB 3PO3B 5IP7G 1X3EA 4A3IB 4POGA 1V1QA 4JW0A 4WJWA 4DR7L 1OXUA 2B8FA 2L55A 2J0TD 5I2XA 1NR2A 3HKSA 3K6OA 2I5HA 2KECA 4LFAQ 4GS3A 2DY7A 3HOWH 5COYA 4DPGA 3G6JB 1TQOA 1VQAA 3VYTA 3SXHA 1WVLA 4BXXG 5IY0A 2G9DA 3S16H 1VF7A 3S1RB 2K4KA 1G2TA 4TRDA 3HOXB 5JOBA 2KJXA 4HCEA 4XYOA 5IGFA 3T4AC 3DEPA 1HZAA 5FO8B 1B44D 3BG3A 1YVCA 1PTOB 2HT1A 4LF7Q 1TWFB 5JJZA 1F9RA 3CU7A 3TP8A 3S17B 3SDZA 3SVMA 2SDFA 4ZLTF 4JK1C 3A5ZB 1PZKD 3H0GG 1EFID 4QJFA 2Z9HA 1F9QA 3LWEA 5FO7B 3ONAB 4LF9L 5JEAJ 2CH4W 3U4ZA 4DXFA 3HOVB 3CQZH 1QE6A 4PG3A 1YNNC 2ZTEA 3GQBA 3TDQA 1ESRA 5IYDG 1ET9A 1Y8NB 2AUJD 5L37A 1IYVA 2B2YA 4DV5Q 2ZTCA 3AMUA 3EVQA 5HGQA 2EYJA 3H3VC 4IUQA 4DUYL 4JYAQ 4BY7H 1HNWL 1NBWA 4OONA 1BNZA 2VUMH 2VUMB 4V0BA 5IT9L 5IIFA 4GKJL 1UE1A 2IL8A 4N8X1 1Q86C 1CZGA 1GKHA 1E2VA 4XXEA 1VQNA 1CQVA 1VQBA 3VA7A 1MBYA 1BBXC 4FF3A 2K33A 2RCFA 5E4WC 3A8IE 2CWAA 3BS1A 2LKVA 3M4OH 1SMXA 2KA7A 3TZUA 2F0QA 2WKCA 4IFDJ 4A76A 4K2KA 2JA8G 1LO5D 3K0XA 3NWSA 5E4XA 1PLFA 3PMFA 2BDNA 1Q82C 4DN4M 1DD2A 2UXDL 2ICEC 3AU7A 4KTAA 5CR3A 1WTQA 4WJ4A 5C4JH 1RTNA 2RVLA 1ENFA 2IHFA 1F9SA 3FHWA 3LWUA 3T1HQ 1KAWA 5C3EG 1CZWA 1MGSA 4A3BH 5CMDA 3D6CA 3E5SA 1TT2A 4G7ZC 3OMCA 3E9HA 4JI7L 3Q6SA 1OO9B 2MUYA 5CBEE 2EZVA 3SE0A 4YHHQ 2UXDQ 2HHHQ 2R7ZB 2D62A 4KHPQ 3GTPH 1XPRA 2R93B 2DNCA 4J1MA 3TREA 2ENBA 2E76C 1IL8A 4IUTA 1SYDA 3H94A
chains in the Genus database with same CATH topology
2PZTA 2QDBA 2NWGA 5D14A 5G3LD 3N6RA 3PUWA 1BR9A 1ICWA 1BCPD 2B2TA 2EPBA 4HCSA 1DM0B 4ULLA 1FD7D 2B2TC 1LT5D 4XYQA 4TQUS 1WTPA 2A6ED 2Y0SB 4IUPA 3V2TA 5CV4A 3X3MA 1GUWA 4FF1A 4PMBA 1G2SA 4ABNA 1I4QA 1BCPB 1F2YA 2IWHA 1H9SA 2NVTB 4OO1G 2E2JB 1EZ6A 4BWGB 2ID0A 1UAPA 1BUVT 5JEAH 4HEDA 5KNDA 2ZXOA 1W6JA 4H13C 1S5DD 5ELCA 4BY7B 1GHJA 2F0JA 2YU9B 3Q0AA 3OIPA 2F0UA 4NKLA 2K32A 1CT1D 1I4PA 4KKTA 4IALA 3BVMA 4R8IA 3VR5A 2JYOA 1HTPA 1RTOA 2E75C 2PNRC 4KY5A 2ICIA 1CFMA 3MAQA 3I4NB 3S14B 4C3HB 3GP7A 1O7LA 1LV9A 1F2MA 2K04A 5EBDA 1PTOD 5LL6S 1EQVA 1EY8A 1SXTA 3D31A 4DA2A 2F0FA 5CV8A 3SHLA 5KRUA 1BCPC 2HCCA 2F0TA 3NBHA 3EJIA 5T1GA 4QB4A 5J1ZA 2KUMA 3TP5A 4XT3B 3FKIB 5DAUA 1CTMA 2B2YC 4XT1B 4U673 1V1OA 4FP5D 2D5DA 1HHVA 3I4LA 5JVH3 2MP1A 2JEBI 3MEHA 3R8BA 5CV5A 4I65A 4IZ8A 5EKIA 4PMCA 3P75A 1RKNA 1EYCA 3VYSA 3L7ZC 3M7GA 3K58A 1G8ZD 2KCCA 3PIO3 1DOKA 3P7JA 3K0YA 4CJ2C 4LMQD 4A3JB 1WTOA 1BXTA 2QEJC 3VYRA 1S5CD 3NPPA 2KCNA 2M2LA 3S1QB 1F2LA 1SJED 3SEBA 1B4OA 4Q0FA 4RAUC 1F9PA 3TMEA 4RHSA 2NYZD 2HDMA 3MA2B 4OIJA 2K5QA 1Q3LA 4EVOA 2CQAA 2EVBA 1HA6A 3GTPB 1QNUA 3KBXA 1X3QA 1OXVA 1W6KA 4QMGA 4HR7B 3GTQB 1Z47A 1LTBD 1TS4A 3PV0A 4G4KA 2Q8IB 3MHBA 2QF7A 4XDXA 4ZYSA 3MVVA 3DWQA 3HS0C 4FXDA 4A93B 1PFMA 4B9XA 4DGZA 2V4DA 1BCPF 2FJ2A 2G9HD 2L4NA 1TS5A 3MWYW 1GUNA 4KJNA 3KLRA 3M85A 3EFXD 2EJFC 4X3SA 1KAAA 3F2UA 1JWUD 1Z7TA 3MC0B 3Q22A 2M9VA 3I72A 2B2UC 5EPLA 2WIIB 1XXGA 2PZUA 2WV6D 2F0LA 5A35A 1KABA 5TSSA 1E0BA 1JQYD 1WTWA 4BBRB 3OPOA 1TY2A 1UEAB 2BA0A 1X32A 3GTGB 5E1FA 1KLGD 2NTTA 3VR3A 4C2MB 4ZUIA 3J7AF 1B1ZA 4K6LA 4EQOA 5IOCA 1KDCA 4C3IB 2IT1A 4Q5VA 5JAVA 3KBGA 3R2IA 3P20A 2SNMA 1JB3A 1V43A 5IGCA 4V190 1C48A 1STNA 4RGTA 3GO5A 3J80E 1U4RA 2EOTA 2FINB 1G6ZA 3ERQA 4CKBA 1XX8A 2F0EA 4KHVA 3T13A 2IPKD 1EIGA 1ET6A 5K36G 4MIUA 4XQQA 2X69A 1KNEA 3MFYA 2DNEA 3H6MA 4NDXA 3OWEB 3RZOB 3ND9A 3C3LA 4X3TA 4ILWA 1B9NA 3U9OA 1ESFA 2XVSA 4RFBA 1YNJD 1EY6A 3S1NB 2EY1A 3P1HA 1BDOA 5C3WA 3A7AB 3LNNA 1CQFA 4C3JB 2AWNA 4Y7NB 3PUZA 1SJHD 1SYGA 1JOOA 1GUGA 1SEBD 1MD2D 2F03A 4ODGA 4KY6A 2F0PA 2VNUD 2X6LA 1ML0D 1PFBA 3VYUA 3A56A 4ZK9B 4ZKCB 4H44C 3H0GB 4KI0A 3PUVA 4IQZA 1S5ED 4DU9A 1PRTC 4IUUA 1Y8OB 5IGBA 1IYUA 3D4RA 1MI2A 1RJTA 2KVMA 2BE5C 3HP3A 3OWFA 1K83B 5A2QL 3J7AV 3D8GA 4CJ1B 4C1NI 1DJRD 1KLUD 3H91A 2K03A 4OIKA 5IGGA 2A73B 1ILPA 1STHA 2L5TA 2H4OA 3GTLB 2N88A 3C46A 4FO2A 2EDGA 2E74C 3DWAA 1A6XA 2WKDA 1R4PB 3IL8A 5FLXE 1I6VC 1GHKA 3GV3A 1EY0A 1VMPA 4C1NK 5KNBA 3D3RA 2K01A 2IW3A 4UAIA 3LX0A 2XWBB 3NP8A 1DONA 4KKSA 1SSOA 1PTOH 2Q8TA 4O42A 2EE1A 5C4XB 2B2VA 1LACA 1B53A 1L0XB 1DOMA 4J6HA 2WACA 2DY8A 3TBIB 3BDLA 2JA5B 1M4VA 3M4YA 1EY5A 2MPMA 1AZPA 4G7HC 3EA6A 4L8JA 2A6HD 1HXYD 4CKCA 3M3YB 5JVG3 2JA7B 2X6GA 4RKBA 1PZJD 4FF4A 1YNND 1EU3A 1TKWB 4DAVA 3O13A 3D4WA 2HQEA 1S5FD 1TR5A 1JCKB 3CHBD 1ZEQX 4TKOB 5C4JB 2Z4IA 2F0MA 2RBMA 1LLRD 1PRTF 1S5BD 3CRLC 5BN3A 4IUNA 5CV9A 3PO2B 5K36H 1SMYC 3Q23A 5IT9E 1ZYRC 2XWJB 3NUCA 1AFPA 1U4MA 1A3UA 3C1FA 4HSPA 2EYHA 5M5XB 3NHHA 4X3UA 1E2ZA 3KUPA 2WB1B 1SNMA 1OXXK 2B2WA 5CV7A 4KD3A 3W2DA 3SK8A 1J8IA 2QILA 5D65A 1SNCA 1TWHB 2R61A 3HKZB 4RGNA 5C0XH 3I70A 2KOLA 1V8QA 3SK5A 4KV6A 4EQPA 5DEHA 5EBCA 2LFNA 3D6WA 4A3MB 4B9WA 4YIJA 3W3AA 4TSSA 3DXJC 1HA5A 4NW2A 3E0JA 1HTLD 5FOBB 2SEBD 5JPMC 5KYLA 2QCPX 4QUFA 4MN3A 5HURA 3MXUA 1V1PA 1Y8PB 1STYA 2Q8RE 1QWYA 3NE5B 2JA8B 3OSOA 4OL7A 2K5WA 1ILQA 1BF4A 3X3NA 2L11A 1HQMC 4ZRZA 3K5LA 2K5DA 5M3FB 2BA1A 1HPCA 5I2YA 2RA4A 5KYIA 1JOKA 1JICA 1QILA 1JORA 2C9OA 4BA2I 5AFWA 5I9OA 1STEA 1SMYD 5DM63 4HMJA 2RQXA 4A3KB 4DFAA 3HOZB 1PRTB 4KJOA 5M9OA 5A2QE 4OO1I 1LTAD 2HUGA 2L1BA 5M3MB 1G291 3RZDB 4LJZC 1C8CA 2XNAC 1LTGD 2BCOA 3ZYYX 3BVZA 2IX1A 1WD1A 2D9UA 2A6HC 2A68D 2K7VA 2Z1CA 1HRJA 2K1BA 1A3VA 3A55A 4ZUJA 1KDBA 1R4QB 4RGMA 3J81E 1PTOC 1VDZA 2E2DC 2WAQB 2B2VC 5FO9B 3V96A 5ELEA 2NB0A 1NAPA 1K8MA 4NMZA 3WOEA 1VMCA 3M7NA 5KNCA 1PDQA 4DAPA 1O80A 3TN2A 3C2PA 1SBBB 1HFNA 2IJ0A 4XQJA 2AUKA 2L9HA 2C5CA 5C44B 4N9TA 2VXWA 1A2UA 3T16A 3K59A 3DM1A 1HCZA 1HFGA 3I73A 4HN7A 2PW7A 2XRSD 5EJWA 1JR0D 1FR3A 2M00A 2IX3A 3R2TA 1LTRD 4G7OC 2MHVA 1QG7A 4DAYA 5ELDA 1MSHA 1D5MC 3S2DB 1D5XC 1IKLA 3VR2A 3I8ZA 3VA5A 1GUOA 5FK9C 4IFDG 1T5EA 1PXUA 2B2UA 1WTXA 3RMHA 4WFN3 1EOTA 4ZKBB 4KD4A 4C3JG 4HTHA 1NR4A 1TWAB 2AWOA 2YYZA 2I07B 3MXPA 3T51B 2A6EC 3EQLC 4R8NA 3IFDA 4S3SA 3IKJA 4F87A 4A3GB 1UUPA 1PYWD 2JP1A 3FMCA 2JXMB 1ENCA 2CW0C 1JWSD 1I3QB 5KGUA 1PZID 4ZAIA 3TP6A 3J7YW 1GUSA 2JA6B 2I46A 3VR6A 1EY4A 3N52A 1QOHA 4K5VA 3T56B 1XWEA 4ME5A 2K28A 2J4XA 3PUYA 4J8QA 2A68C 2OXPA 5C4ZA 2FMMA 1O7ZA 1B3AA 4UDUC 3DWPA 5C3EB 3IAYA 5J22A 1ZKOA 3H09A 2KEDA 3PIP3 4CHTB 2RDHA 4K8IA 2A69C 1GOZA 4R9WA 2CVRA 1LTID 1D1KA 4K8JA 5C4HA 1XYIA 1RHPA 2TSSA 4A3FB 1A15A 3ITPA 1JE4A 2NBFA 1DXMA 1D1IA 2KQ3A 3HOUB 4BBSB 2F1MA 5EPKA 4IUVA 3CQZB 1TWGB 1DYQA 5DNFA 4BA1I 4K2LA 1SAPA 2B2WC 3RD4A 5EKLA 2EJMA 3I90A 1T5XD 4RA8A 2EJGC 2L12A 2O5IC 1L0YB 4BS9A 1EY9A 4M1UB 2E2IB 1LT6D 1Y69U 1WTVA 3KF8A 4K5XA 3L9AX 3KLSA 1YNJC 1LT4D 3BZDB 5K5PA 2FMCA 4RH6A 3A54A 1PFNA 1C4QA 3NBIA 4FF2A 1OXSC 2TMPA 1CA5A 3E6ZX 2R6GA 4K14A 3J81L 3EROA 5JPNC 1IKMA 2F0NA 1WTRA 1RDPD 3U9SA 3J80L 1OXTA 3UI2A 2EY5A 3SK4A 4RCOA 3GD7A 2PPBC 3OMGA 4G57A 4XQNA 1O7YA 2D2CC 4K5WA 1FYCA 2O2LD 1STGA 1SNDA 2FFKB 1HUMA 5C6AA 3FPPA 4EGVA 3WOFA 4DK0A 3MXNA 1LTSD 3QOLA 4C3IG 1TIID 3HOWB 1NCVA 1WCMB 5IODA 4CGYB 3S2HB 2IX0A 5CBAE 4F88A 4IFDH 1FNUA 3QJYA 1F77A 3HRZC 3R93A 3S9WA 3ND8A 2A5HA 4N9PA 1AN8A 2O4XA 1TU2B 3GTJB 3HGBA 1TY0A 3FEWX 2LS01 4L6TB 3A7LA 4KN4C 1EY7A 4WRDA 2EY6A 4PNYA 4NP5A 2RDGA 1SYBA 4E6IA 4KK7A 4HSVA 3RUZA 5EPJA 4FXKC 5I9PA 2NVXB 2JEAI 3DUZA 1PRTD 2XRQD 3BDOA 5I4DA 2OF1A 3MTSA 5M5WB 4H7BA 4C3HG 3NSWA 2PZWA 4LAAA 1AEXA 3QIAA 1EZ8A 1EL0A 1KTKA 3FDTA 1Q1BA 1XTCD 1SFOB 4JBWA 3GTKB 1ZYRD 2GA4B 3L3OC 1Y1VB 1IW7C 3NTIA 1B50A 1STAA 1A2TA 3HZXA 4OO1H 5CYUA 1NUCA 3HOYB 3BDCA 3QG1A 5T1IA 5ISRA 1F2ZA 4QIWB 1JOQA 4HMIA 1AP0A 1SYFA 4LK1C 5E3FA 2BE5D 2F3WA 5KIXA 4C56C 4ZQ3A 3I4MB 3KLSX 1LT3D 2AQ1B 3K7AB 3QOJA 2WP8J 1RD9D 3CRKC 2F0KA 2N55A 3G7LA 2MGSA 1RODA 1Q12A 1CM9A 2RSNA 1LABA 1M8AA 1SYEA 5BN4A 1CI3M 1NSNS 1Q90A 1H9RA 2SOBA 5DM73 3NWTA 2RSOA 1EQTA 3NTHA 4KKUA 4XIGS 3K5MA 2HDLA 1G91A 1HUNA 1V1PB 4L63B 1FNVA 1Q1EA 1RCVD 1SE3A 1EYDA 1GXDC 4OHJA 3JAME 4RKLA 4IN3A 2ZT9C 2XIWA 4Z9CB 3WDNA 2Z4HA 3TSSA 3SR1A 1R9TB 1EEFD 2MJ8A 4QF4A 1H9MA 4RHRA 1Z6HA 1QB5D 1J9OA 3FVQA 3A8JE 1EEID 3MXGA 1IW7D 3A8KE 2RDFA 2NN6I 1EWHA 4RCNA 4FXGC 3GTMB 1D2BA 2RKSA 1H9JA 5I6YA 2JE6I 1BQQT 4RGOS 4F7XA 2E2HB 2O5JC 3QWNA 3OOCA 2F0HA 2B8GA 2EYFA 2PW5A 1KNAA 2PCFB 4DNTB 5D3DA 4XTCS 4WORA 4K6DA 3K57A 3GV6A 5EGTA 2PYKA 2EYMA 5C5MA 4FYDA 1LTTD 2SNSA 3TP7A 1B2TA 4M8AA 2Z8LA 4CKEA 1I6HB 1B9MA 1E2WA 1AZQA 1STBA 1I4GA 3BVGA 1EWCA 1SNOA 1JWMD 1ENAA 4DF7A 1UNSA 5KEEA 1QJOA 1CK1A 4OGQC 4X3KA 5J39A 1ONLA 1TS2A 1SE2A 4PMWA 2PMZB 2NN6G 5I6WA 1VF5C 2F0DA 2F0GA 5HGTA 5EKKA 1ZXTA 1H9KA 5CC4A 3NTKA 1CHPD 5M5YB 3BYYB 1EU4A 4DK1A 3I3CA 2NUCA 3D4DA 2HCIA 5IGEA 3MFGA 1JC7A 2WINB 1S4ZA 2F4IA 3R3OA 4F8MA 2F3VA 2ZXPA 5LL6X 5C0XI 3I91A 1TS3A 3NQIA 2K05A 2OT2A 4IFDI 5C0XJ 1H9SB 1TWCB 2L0CA 1A3TA 2B63B 1SNQA 4U68A 1I50B 2LY7A 1WD0A 1QNKA 5BN5A 3SK6A 3FRPB 2BOSA 1CA6A 1CHQD 5IGDA 3CKIB 3M4OB 2QKIC 5FKAC 1DCZA 3NXWA 4B08A 5JEAG 2NN6H 1HQRD 1D5ZC 5G3LF 3FPUB 4MHEA 4A3EB 5LHY1 2B39A 1U4LA 4DXGA 3VR4A 2BDOA 1DOLA 2NTSA 1I4RA 3QO2A 5CORA 1IHZA 2NVQB 3OIQA 5D3IB 3DMUA 4AYBB 1SDFA 5ELFA 5CV6A 1FGBD 3T53B 1GUTA 2XSCA 3GTOB 1I4XA 1BO0A 1O78A 2FHTA 3HEJA 1I4HA 3JAML 5C5LA 4FNFA 3PUXA 2EYOA 3DHQA 4O1NA 5NUCA 4QUCA 2EY2A 1X3PA 3V05A 3BYTB 4IURA 3Q24A 1SNPA 4H0LC 2CW0D 2NVYB 2AQ2B 1GJXA 4FVMA 3DEOA 2LMCB 2F0WA 3C1EA 2F0SA 3HG9A 2R92B 4HAEA 1TVXA 1SE4A 5C0XG 2PQEA 5F2DA 2KEEA 1D6EC 4CBVA 4BY1B 5ELBA 2F0VA 3S15B 3NK9A 3TZDA 4CJ0B 2OEOA 4KN7C 3S1MB 1PMRA 2DN8A 2F0IA 3NQTA 3OHXC 2VB2X 3OW7A 2EYLA 4ID6A 2AQ3B 1U4PA 2K6AA 1K8OA 3S16B 2KHSA 4P2CB 1PTOF 1Y1WB 2XN9C 4A3DB 2EXZA 3MZ5A 4PQXA 4KY7A 3RLFA 1Q8IA 2VB3X 1KDAA 1BOSA 3K5NA 4A3BB 4EQNA 2EYPA 4PV1C 2NZ1D 1MSGA 5C3XA 3QB3A 2R3ZA 2JSOA 3AB9A 1RF2D 2ZXRA 1SYCA 2A74C 4RWSC 1AW7A 2A69D 1II3A 3IFTA 4QCLA 4KMUC 1DZ1A 2CHBD 5CGKA 2PO4A 4I7ZC 3KK7A 4KHZA 3K5OA 2F0OA 1EIHA 2J7ZA 4GZYC 5FLXL 1FNWA 2H1EA 3URYA 5EQ0A 1EYAA 1QCBD 1VCIA 1U9RA 4DNRB 3PO3B 4A3IB 4WJWA 1OXUA 2B8FA 2L55A 5I2XA 2J0TD 1NR2A 3K6OA 2KECA 2DY7A 5COYA 3G6JB 1TQOA 3VYTA 3SXHA 1WVLA 2G9DA 1VF7A 3S1RB 1G2TA 4TRDA 3HOXB 5JOBA 2KJXA 4HCEA 4XYOA 5IGFA 3T4AC 3DEPA 5FO8B 1B44D 3BG3A 1PTOB 1TWFB 5JJZA 1F9RA 3CU7A 3TP8A 3S17B 3SDZA 3SVMA 4ZLTF 2SDFA 4JK1C 1PZKD 1EFID 1F9QA 3LWEA 5FO7B 3ONAB 5JEAJ 4DXFA 3HOVB 1QE6A 1YNNC 3GQBA 3TDQA 1ESRA 1ET9A 1Y8NB 2AUJD 1IYVA 2B2YA 3AMUA 3EVQA 2EYJA 3H3VC 4IUQA 1BNZA 2VUMB 4V0BA 5IT9L 5IIFA 2IL8A 1CZGA 1E2VA 4XXEA 1CQVA 3VA7A 1MBYA 1BBXC 4FF3A 2K33A 5E4WC 3A8IE 3BS1A 2LKVA 2KA7A 3TZUA 2F0QA 2WKCA 4IFDJ 4K2KA 1LO5D 3NWSA 5E4XA 1PLFA 3PMFA 2BDNA 4DN4M 1DD2A 2ICEC 3AU7A 4KTAA 5CR3A 1WTQA 1RTNA 2RVLA 1ENFA 1F9SA 3LWUA 1CZWA 1MGSA 5CMDA 3D6CA 3E5SA 1TT2A 4G7ZC 3OMCA 3Q6SA 1OO9B 2MUYA 5CBEE 2EZVA 3SE0A 2R7ZB 2D62A 2R93B 2DNCA 4J1MA 2ENBA 2E76C 1IL8A 4IUTA 1SYDA 3H94A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1STN A;  5IGB A;  3MZ5 A;  2PZT A;  4K5W A;  5CC4 A;  1EQV A;  2F0M A;  2QDB A;  4KY7 A;  1STA A;  2RBM A;  3HEJ A;  1EY8 A;  3SR1 A;  2PW7 A;  5J22 A;  2NUC A;  4QMG A;  4QF4 A;  3OWF A;  5C5L A;  1STG A;  3D4D A;  1KDA A;  1SND A;  5I6Y A;  5IGE A;  5C6A A;  1A2T A;  4K8I A;  4IUN A;  5CV9 A;  5KYI A;  2M00 A;  3HZX A;  2EYO A;  3DHQ A;  1JOK A;  1JOR A;  2F0F A;  4K8J A;  3D8G A;  5C4H A;  4F8M A;  3R3O A;  5CV8 A;  3SHL A;  5NUC A;  1NUC A;  5KRU A;  2F3V A;  3ERQ A;  3QOL A;  2RDF A;  2EY2 A;  2F0E A;  3BDC A;  4KHV A;  3T13 A;  3ITP A;  4EQN A;  3NUC A;  2EYP A;  5I9O A;  5IIF A;  5IGG A;  2F0T A;  5IOD A;  5ISR A;  1STH A;  4HMJ A;  3EJI A;  5C3X A;  3QB3 A;  1F2Z A;  1A3U A;  2KQ3 A;  2RKS A;  3C1F A;  3MHB A;  4QB4 A;  5J1Z A;  3VA5 A;  4MIU A;  3EVQ A;  3MVV A;  2EYH A;  2EYJ A;  3NHH A;  1SYC A;  4KJO A;  3TP5 A;  3V2T A;  5M9O A;  5CV4 A;  1SNP A;  5DAU A;  1A3T A;  1JOQ A;  4HMI A;  3S9W A;  1SNQ A;  4N9P A;  4KD4 A;  4B9X A;  1II3 A;  1SYF A;  3H6M A;  2O4X A;  4DGZ A;  1EY0 A;  4HTH A;  4NDX A;  1SNM A;  4PMB A;  5CV7 A;  5E3F A;  4KD3 A;  4F7X A;  2F3W A;  3SK6 A;  3SK8 A;  5KIX A;  5CGK A;  4ZQ3 A;  3MXP A;  5IGD A;  2F0W A;  3C1E A;  2F0S A;  4K2L A;  1SNC A;  2F0H A;  3MEH A;  2EYF A;  1F2Y A;  3LX0 A;  3U9O A;  3NP8 A;  4R8N A;  5CV5 A;  5EKL A;  2F0O A;  4KJN A;  4I65 A;  4IZ8 A;  3NXW A;  1EZ6 A;  1EY7 A;  2PW5 A;  4PMC A;  4S3S A;  3P75 A;  2LKV A;  4WRD A;  1RKN A;  1EYC A;  1EY6 A;  2EY6 A;  3QOJ A;  1EY9 A;  2F0Q A;  4PNY A;  2EY1 A;  1A3V A;  4NP5 A;  2F0K A;  2PQE A;  4K5X A;  3P1H A;  4K2K A;  4WOR A;  5F2D A;  4ZUJ A;  1SYB A;  1EYA A;  4K6D A;  4E6I A;  3SK5 A;  1KAA A;  4KV6 A;  1KDB A;  4EQP A;  1U9R A;  3PMF A;  5C3W A;  5DEH A;  5EGT A;  3RUZ A;  2F0J A;  2EYM A;  1SYE A;  2PYK A;  4J6H A;  5C5M A;  5K5P A;  1ENC A;  2F0U A;  2SNS A;  4NKL A;  3T16 A;  3TP7 A;  2F0V A;  2PZU A;  5I9P A;  2WAC A;  4KTA A;  5CR3 A;  1NSN S;  2F0L A;  4B9W A;  4YIJ A;  3BDL A;  5KGU A;  1KAB A;  3TP6 A;  3NK9 A;  2SOB A;  1JOO A;  1SYG A;  4IAL A;  1STB A;  1EY5 A;  4NMZ A;  2OF1 A;  1SNO A;  2OEO A;  4ODG A;  4KY6 A;  2F0P A;  1ENA A;  4DF7 A;  1TQO A;  3NQT A;  2F0I A;  1EY4 A;  3SXH A;  5KEE A;  3D6C A;  3E5S A;  1TT2 A;  4K14 A;  5KYL A;  3OMC A;  2EYL A;  3ERO A;  4K5V A;  4ID6 A;  5E1F A;  5HUR A;  4ME5 A;  4H7B A;  2F0N A;  4KY5 A;  4RKB A;  4ZUI A;  5J39 A;  1EYD A;  1STY A;  2KHS A;  3TME A;  4TRD A;  1IHZ A;  4EQO A;  5IOC A;  2PZW A;  5JOB A;  2EY5 A;  4LAA A;  1KDC A;  3SK4 A;  2OXP A;  1AEX A;  3DMU A;  4RKL A;  5C4Z A;  5IGF A;  5JAV A;  1EZ8 A;  5CV6 A;  3OSO A;  4OL7 A;  5I6W A;  3D4W A;  2HQE A;  4DFA A;  4J1M A;  1TR5 A;  3TP8 A;  3OMG A;  2ENB A;  2F0D A;  4G57 A;  4N9T A;  2F0G A;  4DU9 A;  2EXZ A;  4EVO A;  2SNM A;  5HGT A;  1F2M A;  1A2U A;  5EKK A;  1SYD A;  5IGC A; 
#chains in the Genus database with same CATH topology
 4DV3 L;  2PZT A;  2QDB A;  1B70 B;  5GAD C;  4DV7 Q;  2NWG A;  5D14 A;  5G3L D;  5JJI A;  2YU9 H;  4LF4 L;  3N6R A;  3PUW A;  3ULJ A;  1BR9 A;  1ICW A;  1BCP D;  1N8R C;  2B2T A;  4GKJ Q;  2UUA Q;  2EPB A;  2Z6K C;  4JBJ A;  1ASY A;  4HCS A;  1DM0 B;  2DUD A;  4ULL A;  1FD7 D;  2B2T C;  1LT5 D;  1IZ6 A;  4XYQ A;  4TQU S;  3CF5 A;  4GNX C;  1WTP A;  2A6E D;  2Y0S B;  3CP0 A;  4IUP A;  2E5L Q;  3V2T A;  5CV4 A;  3A0J A;  1E3P A;  3X3M A;  1ASZ A;  4JV5 Q;  1GUW A;  4FF1 A;  4PMB A;  1G2S A;  1J6Q A;  4ABN A;  1I4Q A;  1BCP B;  4A3I G;  1W2B A;  1F2Y A;  1PH5 A;  2IWH A;  1H9S A;  1N33 L;  2NVT B;  4OO1 G;  2E2J B;  1EZ6 A;  4BWG B;  1X54 A;  1PH2 A;  2ID0 A;  1UAP A;  1BUV T;  4X62 Q;  5IYC G;  5JEA H;  4HED A;  4H02 A;  4IPG A;  1HH2 P;  2UXB Q;  5KND A;  4GLV B;  2ZXO A;  1W6J A;  2EIF A;  4H13 C;  1S5D D;  5ELC A;  2Q2T A;  4BY7 B;  1GHJ A;  4OWT B;  2F0J A;  2YU9 B;  1KRT A;  3Q0A A;  3OIP A;  3F1Z A;  2F0U A;  4NKL A;  2K32 A;  1CT1 D;  1I4P A;  4APV A;  2BH8 A;  3BJU A;  4KKT A;  4MNO A;  4BBR H;  1VQ9 A;  4IAL A;  1DGS A;  1VQO A;  3BVM A;  4R8I A;  1Y1W H;  1BKB A;  4JC0 A;  3VR5 A;  2JYO A;  2R93 H;  1HTP A;  3EBE A;  3TQY A;  2VL6 A;  4NXN Q;  3M4Q A;  1RTO A;  3I55 A;  2E75 C;  2PNR C;  4KY5 A;  2ICI A;  1CFM A;  3MAQ A;  3NEN A;  3I4N B;  1P16 A;  3S14 B;  4C3H B;  3GP7 A;  2ES2 A;  3CCJ A;  1O7L A;  3HFZ B;  1LV9 A;  1F2M A;  2K04 A;  5EBD A;  1PTO D;  4EQ5 A;  2IY5 B;  5LL6 S;  1EQV A;  1VQ8 A;  2KCM A;  1EY8 A;  1SXT A;  3D31 A;  4C3J H;  3CC4 A;  1PV4 A;  2CCZ A;  2HQL A;  4DA2 A;  3HOZ G;  2F0F A;  3I2Z A;  3UDF A;  5CV8 A;  3SHL A;  4IOC A;  5KRU A;  1CSQ A;  4YCW A;  3CCU A;  1BCP C;  3HOU H;  2HCC A;  3PQI A;  1N32 L;  2F0T A;  4OX9 L;  3NBH A;  2JQO A;  3EJI A;  5T1G A;  4QB4 A;  5J1Z A;  2KUM A;  4OEM B;  3TP5 A;  1PH3 A;  4XT3 B;  2B29 A;  3FKI B;  1CTM A;  2B2Y C;  4XT1 B;  5DAU A;  4U67 3;  1V1O A;  4FP5 D;  2HHH L;  2D5D A;  2NVY H;  4JBM A;  1HHV A;  4JI4 L;  4OXP A;  3I4L A;  1Q46 A;  5JVH 3;  4DV6 L;  2MP1 A;  2JEB I;  3MEH A;  3R8B A;  5CV5 A;  1JE5 A;  1UE5 A;  3J81 c;  4I65 A;  4IZ8 A;  5EKI A;  3S2H H;  3S24 A;  4PMC A;  3P75 A;  1VQM A;  1RKN A;  1EYC A;  1WCM H;  2K5V A;  3VYS A;  3L7Z C;  3M7G A;  3K58 A;  1G8Z D;  1Y1W G;  2KCC A;  3PIO 3;  3CCE A;  3G4S A;  1DOK A;  3P7J A;  3K0Y A;  4CJ2 C;  4B3T L;  3AYH B;  4LMQ D;  4A3J B;  1WTO A;  2JA6 H;  1BXT A;  2QEJ C;  4A3G G;  3VYR A;  1S5C D;  4JI2 Q;  3NPP A;  2KCN A;  2M2L A;  3S1Q B;  1F2L A;  4A3C H;  1SJE D;  5JJL A;  1I94 L;  1EOV A;  3SEB A;  1B4O A;  4Q0F A;  4RAU C;  3S1R H;  5GAH C;  1F9P A;  3TME A;  1AH9 A;  4RHS A;  1PVO A;  3KFU A;  2NYZ D;  2HDM A;  3MXN B;  3MA2 B;  4OIJ A;  4DV4 L;  2K5Q A;  2WFW A;  1Q3L A;  4EVO A;  2CQA A;  2EVB A;  1HA6 A;  3GTP B;  1HZB A;  3KLW A;  3KYH C;  1QNU A;  3I4O A;  4JI7 Q;  3BZC A;  3KBX A;  3PO3 H;  1X3Q A;  1OXV A;  1W6K A;  4QMG A;  4HR7 B;  1VQH A;  3GTQ B;  3I7F A;  1Z47 A;  4GN4 B;  1LTB D;  5M5W H;  3PIP A;  1TS4 A;  4DR5 Q;  2KHI A;  4JG2 A;  3PV0 A;  1B8A A;  1C9O A;  4G4K A;  3QR8 A;  2Q8I B;  4JI5 Q;  3G71 A;  3DM3 A;  4YHH L;  3MHB A;  1N34 Q;  4A3M H;  1KXL A;  2QF7 A;  4XDX A;  4ZYS A;  3CCM A;  3MVV A;  1Y1V G;  5LMU Q;  3DWQ A;  3HS0 C;  1XMQ L;  5E7N A;  4FXD A;  4HJA A;  4JVZ A;  4A3J G;  5M3M H;  1FJG L;  2XGT A;  1PFM A;  4B9X A;  4A93 H;  4A93 B;  4DGZ A;  2V4D A;  1BCP F;  1X3G A;  2FJ2 A;  2QDL A;  2G9H D;  1AE3 A;  2L4N A;  4DV1 L;  1TS5 A;  3MWY W;  1GUN A;  1B7Y B;  4KJN A;  1YJ9 A;  3KLR A;  3M85 A;  5IP9 H;  3EFX D;  4DR7 Q;  2EJF C;  4X3S A;  1KAA A;  1K28 A;  3F2U A;  4JI2 L;  1JWU D;  1Z9F A;  1Z7T A;  3T1Y Q;  3MC0 B;  3Q22 A;  2M9V A;  3I72 A;  2B2U C;  5EPL A;  4DV5 L;  2WII B;  1XXG A;  2JA7 H;  2PZU A;  3B6Y A;  3STB D;  2WV6 D;  2BH2 A;  2F0L A;  5GAG C;  5A35 A;  4P74 A;  1KAB A;  5TSS A;  1E0B A;  1JQY D;  1WTW A;  3PO3 G;  4BBR B;  4A3L H;  4L5S A;  4P73 A;  3OPO A;  1TY2 A;  1UEA B;  2BA0 A;  5IYB H;  1X32 A;  3GTG B;  5E1F A;  4DUY Q;  4JYA L;  1KLG D;  3NBH B;  4RMF A;  2NTT A;  5FJ8 G;  3VR3 A;  1NJI C;  4C2M B;  4ZUI A;  3J7A F;  1J5E L;  1QZH A;  1B1Z A;  4K6L A;  4EQO A;  5IOC A;  1KDC A;  4C3I B;  2IT1 A;  4Q5V A;  5JAV A;  3ULL A;  3KBG A;  3R2I A;  5LMN Q;  1YNX A;  4X66 Q;  3P20 A;  2SNM A;  4DR3 L;  1JB3 A;  5IE8 A;  2R7Z G;  1V43 A;  5IGC A;  4V19 0;  1C48 A;  1STN A;  3JC6 6;  4RGT A;  4YWK A;  3GO5 A;  3J80 E;  4JI1 Q;  3RNU A;  4A3G H;  1U4R A;  2EOT A;  2FIN B;  1HNX L;  2EQS A;  1VQI A;  1MJE A;  2VQF L;  1C0A A;  1G6Z A;  3ERQ A;  4CKB A;  1XX8 A;  3OW2 A;  2F0E A;  3LGJ A;  4KHV A;  2IPK D;  3T13 A;  3NEM A;  1EIG A;  1ET6 A;  2DJG C;  1X55 A;  5K36 G;  1HNZ Q;  4DK3 C;  4UHV A;  4MIU A;  4A3F H;  4PZ8 A;  4XQQ A;  2YTV A;  3AFP A;  1E1O A;  1EIY B;  3GTJ H;  2X69 A;  1NE3 A;  1KNE A;  3MFY A;  2DNE A;  1VQC A;  3H6M A;  2ZM6 Q;  4NDX A;  4BY1 G;  3OWE B;  3RZO B;  3ND9 A;  5C4X H;  3C3L A;  4R1J A;  4JI8 Q;  4X3T A;  3JAM c;  4HIK A;  2E5L L;  4ILW A;  1B9N A;  3U9O A;  4YY3 L;  1YJN A;  2NVT H;  1ESF A;  4DV0 L;  2XVS A;  4DR2 L;  4RFB A;  3CW2 C;  4DAM A;  1YNJ D;  2DJF C;  1EY6 A;  3S1N B;  2EY1 A;  3P1H A;  2QEX A;  3KDF A;  1BDO A;  5H1S E;  3HOX G;  1N34 L;  1PH6 A;  5C3W A;  3A7A B;  3LNN A;  1CQF A;  4C3J B;  4DV2 Q;  2AWN A;  1PH1 A;  4Y7N B;  4A3K H;  3PUZ A;  2JJQ A;  1JOO A;  1SJH D;  1SYG A;  4DV4 Q;  1L2F A;  1IBL L;  1JJG A;  1GUG A;  1SEB D;  5IWA L;  1MD2 D;  2F03 A;  4ODG A;  3ER0 A;  2F0P A;  4KY6 A;  2VNU D;  2X6L A;  4JI6 Q;  1ML0 D;  4C3I H;  3HOY G;  1PFB A;  3VYU A;  3A56 A;  4ZK9 B;  3UE1 A;  4ZKC B;  3J81 j;  4H44 C;  3I4N G;  4IPC A;  3H0G B;  2I5M X;  4KI0 A;  3PUV A;  4IQZ A;  3TS2 A;  1U5K A;  1S5E D;  1YIJ A;  4DU9 A;  1UE6 A;  2R92 H;  1PRT C;  4IUU A;  1Y8O B;  4QIW E;  1HZC A;  5IGB A;  1RL2 A;  1IYU A;  3D4R A;  4ALP A;  1E1T A;  4IOA A;  1MI2 A;  1RJT A;  2KVM A;  2BE5 C;  3HP3 A;  3OWF A;  1K83 B;  3J80 i;  3J7A 5;  5A2Q L;  5FJ8 H;  3UDI A;  2PQA A;  3J7A V;  3D8G A;  2WAQ G;  4CJ1 B;  4C1N I;  1DJR D;  1KLU D;  4AQY Q;  4R4O A;  4BBS G;  3H91 A;  2K03 A;  4OIK A;  4OWX B;  2E2J H;  5IGG A;  2A73 B;  1I6H H;  1ILP A;  1STH A;  2L5T A;  2H4O A;  1I3Q H;  3GTL B;  2N88 A;  3C46 A;  1XMO Q;  4FO2 A;  3STB C;  1PH4 A;  2EDG A;  2E74 C;  3DWA A;  1A6X A;  2WKD A;  1R4P B;  3IL8 A;  5FLX E;  3RZD H;  1I6V C;  1KRS A;  1GHK A;  3GV3 A;  3UDX A;  1EY0 A;  1VMP A;  1VQL A;  4LNQ A;  4C1N K;  5IP7 H;  5KNB A;  1J5E Q;  3D3R A;  2K01 A;  1XTD A;  2IW3 A;  4UAI A;  3LX0 A;  2XWB B;  3NP8 A;  1DON A;  4X64 Q;  1K0S A;  3G48 A;  2OCE A;  1TWH H;  4LF8 L;  4KKS A;  1SSO A;  1PTO H;  3DLL A;  1XNQ L;  2Q8T A;  3F8T A;  3KDF B;  4O42 A;  3I4N H;  2EE1 A;  3I56 A;  5C4X B;  4IO9 A;  2B2V A;  1LAC A;  3GDE A;  2NZO A;  1B53 A;  1L0X B;  1DOM A;  1PYS B;  4YWL A;  4J6H A;  2WAC A;  2DY8 A;  3TBI B;  2LXJ A;  3BDL A;  3GTK H;  2JA5 B;  1M4V A;  3M4Y A;  1EY5 A;  2MPM A;  1AZP A;  4A3K G;  4G7H C;  2OTJ A;  3EA6 A;  3RLN A;  4L8J A;  2A6H D;  1HXY D;  4CKC A;  3M3Y B;  3IRB A;  5JVG 3;  2JA7 B;  1XNR Q;  4K0K L;  1YBY A;  3F2D A;  2X6G A;  1Q81 C;  4RKB A;  1PZJ D;  4GKK L;  4GLX A;  3J7Z C;  4FF4 A;  4YCU A;  1YNN D;  1EU3 A;  2CWP A;  1TKW B;  4DAV A;  3CAM A;  4UPA A;  3O13 A;  4CDE C;  3D4W A;  2HQE A;  1S5F D;  1TR5 A;  1JCK B;  5ELO A;  1HR0 W;  4NPS A;  3CHB D;  4O2D A;  1ZEQ X;  4JI0 L;  4TKO B;  5C4J B;  1JB7 A;  2Z4I A;  3S15 H;  2F0M A;  2RBM A;  1LLR D;  3H15 A;  1PRT F;  1Y14 B;  1S5B D;  3CRL C;  5BN3 A;  2Q2I A;  4IUN A;  5CV9 A;  1KQS A;  2PI2 A;  4DR5 L;  3PO2 B;  5K36 H;  4UP8 A;  1X65 A;  1SMY C;  1CUK A;  2F3I A;  3Q23 A;  2VQF Q;  5IT9 E;  4L5T A;  1ZYR C;  2XWJ B;  3NUC A;  4R4I A;  1AFP A;  1YJW A;  1U4M A;  1A3U A;  1NTG A;  3C1F A;  1VQK A;  3RLO A;  4HSP A;  2EYH A;  5M5X B;  4A3E H;  3NHH A;  4X3U A;  1E2Z A;  1GVP A;  3KUP A;  2WB1 B;  1K8A C;  4JV5 L;  1SNM A;  1OXX K;  2B2W A;  5CV7 A;  4KD3 A;  3W2D A;  3SK8 A;  1J8I A;  5M5X H;  1K3R A;  2QIL A;  2E2I H;  5D65 A;  2R92 G;  2Q2H A;  1SNC A;  2Z6B A;  2E8G A;  1TWH B;  2R61 A;  3HKZ B;  2WB1 G;  4A75 A;  4RGN A;  3GTM H;  1JT8 A;  2VUM G;  1YHQ A;  1SN8 A;  5C0X H;  2B3G A;  1LYL A;  2CKZ B;  3I70 A;  2UUA L;  2KOL A;  1X3F A;  3HKZ G;  2VS1 A;  2QW7 A;  3WWV A;  1V8Q A;  3SK5 A;  4GOP C;  4KV6 A;  4EQP A;  3HOV H;  5JJK A;  2PMZ E;  5DEH A;  5EBC A;  1NMG A;  2I0Q A;  1EYG A;  3W5O A;  3A5U A;  2LFN A;  3D6W A;  4A3M B;  4B9W A;  4YIJ A;  3W3A A;  4JI3 Q;  4TSS A;  2ASB A;  3DXJ C;  1HA5 A;  2AMC B;  4NW2 A;  3E0J A;  2MO0 A;  1HTL D;  5FOB B;  2SEB D;  5JPM C;  5KYL A;  2QCP X;  4LUV A;  4QUF A;  4MN3 A;  4RG1 A;  5HUR A;  2UUC Q;  3MXU A;  4B3M L;  1V1P A;  4GOP A;  1SR3 A;  3CPF A;  1Y8P B;  2UUC L;  1LM0 A;  1STY A;  3G6E A;  4B3R Q;  2Q8R E;  1QWY A;  3NE5 B;  1EQQ A;  2JA8 B;  3OSO A;  4OL7 A;  4A3D H;  3U4V A;  2K5W A;  4J15 A;  1ILQ A;  1BF4 A;  3X3N A;  1HR0 L;  2L11 A;  4B3R L;  1HQM C;  4ZRZ A;  3K5L A;  4A3D G;  2ATW A;  2K5D A;  5M3F B;  2BA1 A;  1HPC A;  5I2Y A;  4P75 A;  2RA4 A;  5KYI A;  1GD7 A;  1JIC A;  1JOK A;  1QIL A;  1JOR A;  2C9O A;  4BA2 I;  3CCQ A;  2CQO A;  1XPU A;  2R93 G;  1RIP A;  5AFW A;  2PI2 E;  5I9O A;  1STE A;  1SMY D;  3CPW A;  5DM6 3;  1TXY A;  4HMJ A;  2RQX A;  4A3K B;  4DFA A;  3HOZ B;  1PRT B;  2GVA A;  4KJO A;  5M9O A;  4JI8 L;  5A2Q E;  4OO1 I;  3MEF A;  4GNX A;  1LTA D;  2HUG A;  2L1B A;  5M3M B;  1G29 1;  1U0L A;  3RZD B;  4LJZ C;  4PZ6 A;  1C8C A;  4BBS H;  2XNA C;  1LTG D;  1WFQ A;  2BCO A;  3ZYY X;  2UUB Q;  5IYC H;  5GRO A;  4NXN L;  3BVZ A;  2IX1 A;  1WD1 A;  2D9U A;  4CDD C;  2A6H C;  2A68 D;  4JI6 L;  2K7V A;  2Z1C A;  1HRJ A;  1A62 A;  2K1B A;  1A3V A;  3A55 A;  4ZUJ A;  4A3C G;  1KDB A;  1K9M C;  1R4Q B;  4RGM A;  4X64 L;  3J81 E;  4POF A;  1PTO C;  1VDZ A;  2E2D C;  2WAQ B;  2B2V C;  3M4P A;  5FO9 B;  3V96 A;  5ELE A;  2NB0 A;  1NAP A;  2FXQ A;  1K8M A;  4NMZ A;  3TRZ A;  3WOE A;  4QQB X;  1VMC A;  3M7N A;  1H95 A;  5KNC A;  1PDQ A;  4DR1 L;  1KD1 C;  2L15 A;  2GN5 A;  4NXM L;  4DAP A;  1O80 A;  3TN2 A;  3C2P A;  5C44 G;  1SBB B;  1KIX A;  1HFN A;  2IJ0 A;  2UXC Q;  4XQJ A;  3TEH B;  2AUK A;  1N32 Q;  2L9H A;  3S1M H;  2C5C A;  5C44 B;  4N9T A;  2VXW A;  4JCV E;  2MQH A;  1A2U A;  2VZA A;  3T16 A;  3K59 A;  3DM1 A;  4DK6 C;  1PHJ A;  4X6A H;  1UE7 A;  1HCZ A;  2K14 A;  1HFG A;  3I73 A;  4HN7 A;  2PW7 A;  2XRS D;  5EJW A;  1JR0 D;  4LFB L;  1FR3 A;  2M00 A;  2N3S A;  2IX3 A;  1L0W A;  3R2T A;  1W3S A;  1LTR D;  4G7O C;  2MHV A;  1QG7 A;  4DAY A;  1CKN A;  5ELD A;  4DR4 L;  1MSH A;  1D5M C;  2RHS B;  1D5X C;  1IBM L;  3S2D B;  5FLM H;  1IKL A;  3HOU G;  1L1O B;  3VR2 A;  3I8Z A;  4N8F A;  3VA5 A;  5HY6 A;  1GUO A;  5FK9 C;  4IFD G;  1T5E A;  1PXU A;  2B2U A;  1WTX A;  3RMH A;  4WFN 3;  1EOT A;  4DAY B;  4ZKB B;  2Y0S G;  4KD4 A;  4C3J G;  1KHI A;  4HTH A;  4R4Q A;  1FJG Q;  1HZ9 A;  1NR4 A;  1XMO L;  1XMQ Q;  1TWA B;  2AWO A;  2YYZ A;  2I07 B;  3MXP A;  3T51 B;  5M5Y H;  2A6E C;  3K7A H;  3EQL C;  4R8N A;  3W1G A;  3D0F A;  3IFD A;  4S3S A;  2N49 A;  3KF6 A;  1VQJ A;  1P8L A;  3IKJ A;  4F87 A;  1K3B C;  1VQ5 A;  1S40 A;  4A3G B;  1UUP A;  1PYW D;  2JP1 A;  2NZH A;  3FMC A;  2RF4 A;  2JXM B;  2VY3 A;  1ENC A;  2CW0 C;  4BBR G;  3H3V I;  1JWS D;  1I3Q B;  5KGU A;  1PZI D;  1GM5 A;  4ZAI A;  2QGQ A;  3TP6 A;  3T1Y L;  1FVI A;  3J7Y W;  1GUS A;  2JA6 G;  4A3E G;  2JA6 B;  2I46 A;  1LUZ A;  3VR6 A;  1EY4 A;  3N52 A;  5IYD H;  5ELN A;  1QOH A;  3FP9 A;  4K5V A;  3T56 B;  1XWE A;  4ME5 A;  2K28 A;  2J4X A;  3PUY A;  1E24 A;  3M3Y H;  4J8Q A;  3S1N H;  2A68 C;  2OXP A;  4TVA B;  5C4Z A;  2PQA B;  2FMM A;  2XTI A;  1O7Z A;  1B3A A;  5FLX c;  5IYB G;  5EAY A;  4UDU C;  3DWP A;  5C3E B;  3IAY A;  3BU2 A;  5J22 A;  1ZKO A;  2HIX A;  3H09 A;  2KED A;  3PIP 3;  4CHT B;  2RDH A;  4K8I A;  2A69 C;  1GOZ A;  4R9W A;  2CVR A;  1N9W A;  4AYB E;  1LTI D;  1D1K A;  3FKI H;  1CKO A;  4K8J A;  1HR0 Q;  5C4H A;  1XYI A;  3CC2 A;  2GVB A;  1RHP A;  2TSS A;  2HD3 A;  4HIM A;  1A15 A;  4A3F B;  1X9N A;  3ITP A;  1JE4 A;  3U58 A;  3TS0 A;  2NBF A;  4A93 G;  4Y7N H;  1YZ6 A;  1DXM A;  1D1I A;  2KQ3 A;  3HOU B;  4LFC Q;  1TWG H;  4BBS B;  2F1M A;  5EPK A;  1NY4 A;  1I50 H;  2N78 A;  3M9B A;  4IUV A;  5J3B A;  2UU9 L;  3CQZ B;  4GKK Q;  4OWW B;  1TWG B;  1MKH A;  1DYQ A;  5DNF A;  4BA1 I;  1V9P A;  4K2L A;  1SAP A;  2B2W C;  3ERS X;  3RD4 A;  5EKL A;  2EJM A;  3I90 A;  3NEL A;  1T5X D;  2N8N A;  4RA8 A;  2EJG C;  2Z6K A;  2ZM6 L;  3CC7 A;  2L12 A;  2O5I C;  1L0Y B;  4BS9 A;  1EY9 A;  1SLJ A;  4M1U B;  2E2I B;  1LT6 D;  4HJ5 A;  5BR8 L;  2F4V Q;  1Y69 U;  1WTV A;  3KF8 A;  4K5X A;  3L9A X;  3KLS A;  1YHA A;  1YNJ C;  1K83 H;  1LT4 D;  3PIO A;  3BZD B;  5K5P A;  2FMC A;  2R7D A;  1UEB A;  4RH6 A;  3GTG H;  4B3T Q;  5C3E H;  1PFS A;  3A54 A;  1PFN A;  1SFO H;  4X66 L;  1C4Q A;  3NBI A;  4FF2 A;  1OXS C;  2TMP A;  1CA5 A;  3E6Z X;  5LMU L;  2R6G A;  2JA8 H;  3E9I A;  4LWC A;  4K14 A;  3J81 L;  2YTX A;  3ERO A;  5JPN C;  1IL2 A;  1IKM A;  2F0N A;  4JI5 L;  1WTR A;  2R7F A;  1RDP D;  1Q8K A;  3U9S A;  3J80 L;  2C35 B;  1OXT A;  4P71 A;  3UI2 A;  2EY5 A;  3SK4 A;  4RCO A;  3GD7 A;  2PPB C;  3OMG A;  4G57 A;  4XQN A;  1O7Y A;  5DLQ E;  2ZJR A;  4MTK A;  2D2C C;  4R4C A;  4K5W A;  2NVX H;  4PZ7 A;  1FYC A;  4AQY L;  2O2L D;  3ULP A;  1STG A;  2Q2U A;  1SND A;  2FFK B;  1HUM A;  5C6A A;  3FPP A;  4EGV A;  3WOF A;  4DK0 A;  3MXN A;  1LTS D;  3QOL A;  4C3I G;  1TII D;  3OTO L;  3HOW B;  1NCV A;  1WCM B;  1X56 A;  1CKN B;  4A3L G;  5IOD A;  4CGY B;  3S2H B;  2IX0 A;  4WJ3 M;  5CBA E;  4F88 A;  4B3S Q;  1WCM G;  1N36 L;  2UUB L;  1K73 C;  4IFD H;  1T9H A;  4K0K Q;  1FNU A;  3QJY A;  1F77 A;  1WJJ A;  3HRZ C;  3R93 A;  3S9W A;  3ND8 A;  2A5H A;  1QVG A;  1BBW A;  2UU9 Q;  4N9P A;  1AN8 A;  2O4X A;  1TU2 B;  3KJO A;  1LTL A;  3GTJ B;  1A0I A;  3HGB A;  1QVF A;  1TY0 A;  3FEW X;  2LS0 1;  4DV2 L;  5IP9 G;  1CKM A;  4L6T B;  3A7L A;  4KN4 C;  1EY7 A;  4WRD A;  1SRO A;  5GQO A;  2EY6 A;  2AHO B;  4PNY A;  4NB3 A;  4NP5 A;  2RDG A;  3E3X A;  1QZG A;  1SYB A;  4E6I A;  4LFA L;  1E22 A;  4KK7 A;  4HSV A;  4X65 L;  3RUZ A;  5EPJ A;  4FXK C;  4LF8 Q;  2JN4 A;  4A3B G;  5I9P A;  2NVX B;  2JEA I;  3DUZ A;  3HOZ H;  1PRT D;  2XRQ D;  2EXD A;  4LW1 A;  3BDO A;  5I4D A;  2A1A A;  3S1Q H;  1CSP A;  1PYB A;  5C44 H;  3S17 H;  2OF1 A;  3T1H L;  3BZK A;  3MTS A;  4Y52 H;  3CCL A;  5M5W B;  3HOV G;  4YY3 Q;  1L1O A;  1EWI A;  2H5X A;  4IPD A;  4H7B A;  4C3H G;  4AH6 A;  4QGU A;  4DNI A;  2MNA A;  3NSW A;  2CH4 A;  2PZW A;  4LAA A;  2P5Z X;  1OTC A;  1AEX A;  4IPH A;  3QIA A;  2JK8 A;  1M90 C;  4FDB A;  1EZ8 A;  4CDC C;  1EL0 A;  1KTK A;  3FDT A;  1Q1B A;  1XTC D;  1SFO B;  4JBW A;  2AKW B;  3GTK B;  1ZYR D;  2GA4 B;  3L3O C;  1Y1V B;  1IW7 C;  3NTI A;  2R7Z H;  1B50 A;  1STA A;  4UY8 C;  1GO3 E;  4AIM A;  3EN2 A;  1A2T A;  3HZX A;  4OO1 H;  4IJH A;  1HNX Q;  3JAM i;  4JPB W;  5CYU A;  1NUC A;  3HOY B;  3BDC A;  2ZTD A;  3QG1 A;  4L5Q A;  5T1I A;  2K52 A;  5ISR A;  3J80 c;  1G51 A;  4DR6 Q;  1F2Z A;  1HNZ L;  4DR3 Q;  1K0R A;  3K7U C;  4QIW B;  1XPO A;  3CXC A;  2OQK A;  1JOQ A;  4HMI A;  1AP0 A;  1SYF A;  4LUZ A;  4LK1 C;  5E3F A;  2BE5 D;  3PO2 G;  2F3W A;  5IWA Q;  5KIX A;  4C56 C;  4ZQ3 A;  3I4M B;  4DUZ Q;  4EX5 A;  4HIO A;  3VDY A;  3AQQ A;  3L0O A;  3KLS X;  5AJ3 L;  1UWV A;  1LT3 D;  2AQ1 B;  3K7A B;  1SE8 A;  3OYY A;  4LF6 Q;  1TWA H;  3QOJ A;  4P72 A;  3OTO Q;  2WP8 J;  1RD9 D;  3CRK C;  2F0K A;  2N55 A;  3G7L A;  2MGS A;  1ROD A;  1Q12 A;  4LFB Q;  2DGY A;  1CM9 A;  2RSN A;  3GTQ H;  1LAB A;  1M8A A;  1SYE A;  5M3M G;  5BN4 A;  1CI3 M;  4LF9 Q;  1MJC A;  4YCV A;  1NSN S;  1Q90 A;  1Y1V H;  4OEL B;  4AYB G;  2PNH A;  4DR4 Q;  2SOB A;  1H9R A;  5DM7 3;  3NWT A;  2QA4 A;  3PF4 A;  2RSO A;  4LF5 L;  1IBK Q;  1EQT A;  1EFW A;  3NTH A;  4KKU A;  4GN3 B;  1Q7Y C;  4XIG S;  3K5M A;  2HDL A;  3PGZ A;  1G91 A;  3F2B A;  1HUN A;  1V1P B;  4GOP B;  4L63 B;  1FNV A;  1Q1E A;  1N36 Q;  4JOI A;  1RCV D;  1EQR A;  4UP7 A;  1SE3 A;  1EYD A;  1M1K C;  1GXD C;  4OHJ A;  3JAM E;  3GTO H;  4RKL A;  1E7Z A;  3PF5 A;  2A19 A;  4IN3 A;  5M3F G;  3KF8 B;  3RR5 A;  2ZT9 C;  1IBK L;  2XIW A;  4LF4 Q;  1HNW Q;  4L5R C;  4Z9C B;  2OTL A;  3WDN A;  2UXC L;  2ZJP A;  5LMN W;  3CCS A;  4KLK A;  2Z4H A;  4GN5 A;  3TSS A;  3I4M H;  3SR1 A;  4BY1 H;  1EEF D;  2MJ8 A;  4RHR A;  4QF4 A;  1H9M A;  1R9T B;  1Z6H A;  1QB5 D;  1J9O A;  1YEZ A;  3FVQ A;  5FLM G;  3A8J E;  1AE2 A;  1EEI D;  3MXG A;  1IW7 D;  3L2P A;  3A8K E;  2F4V L;  1KL9 A;  2RDF A;  2JA5 G;  1MHW C;  2NN6 I;  1EWH A;  1N33 Q;  4RCN A;  4FXG C;  3GTM B;  3AEV A;  1JMC A;  4R4T A;  1YIT A;  1D2B A;  2RKS A;  1H9J A;  2E2H H;  5IT9 c;  1WYD A;  5I6Y A;  2JE6 I;  2I5L X;  1BQQ T;  4ZCK A;  4RGO S;  4F7X A;  1VQG A;  1QVC A;  2E2H B;  2O5J C;  3QWN A;  3OOC A;  2F0H A;  4A4I A;  2B8G A;  2EYF A;  2Y0S E;  3CCV A;  1EUJ A;  2MFI A;  4BY7 G;  2PW5 A;  1KNA A;  3S2D H;  2F52 A;  2PCF B;  4DNT B;  4O0A A;  4GNX B;  5D3D A;  4XTC S;  4WOR A;  4JI3 L;  4K6D A;  1IYJ B;  3K57 A;  3GV6 A;  3U50 C;  3PO2 H;  2KBN A;  5EGT A;  2PYK A;  2EYM A;  5C5M A;  4FYD A;  4DV7 L;  1LTT D;  2SNS A;  3TP7 A;  1B2T A;  4DV3 Q;  4M8A A;  2Z8L A;  4CKE A;  1I6H B;  1B9M A;  1E2W A;  1AZQ A;  1I4G A;  1STB A;  3BVG A;  1EWC A;  4HJ8 A;  4YWM A;  4QY7 A;  1SNO A;  1JWM D;  1ENA A;  4DF7 A;  2JA7 G;  1UNS A;  2JA9 A;  5KEE A;  1QJO A;  1VQF A;  1D8L A;  1CK1 A;  3HOX H;  3ICE A;  4B3M Q;  2MO1 A;  4OGQ C;  4X3K A;  5J39 A;  4LFC L;  1ONL A;  1TS2 A;  1SE2 A;  4PMW A;  2PMZ B;  2NN6 G;  3RN2 A;  3PCO B;  5I6W A;  1VF5 C;  2F0D A;  2F0G A;  1IBL Q;  5HGT A;  1ZXT A;  1H9K A;  5EKK A;  4BXX H;  3K8A A;  3SGI A;  5CC4 A;  3NTK A;  2RCN A;  1PH9 A;  1CHP D;  5C4X G;  3BYY B;  5M5Y B;  1EU4 A;  4DK1 A;  3CME A;  3I3C A;  2NUC A;  4ME3 A;  3D4D A;  2HCI A;  5IGE A;  1XJV A;  2CFM A;  1YHB A;  3MFG A;  1JC7 A;  2LSS A;  2WIN B;  1S4Z A;  4QL5 A;  2VW9 A;  3KJP A;  4JI4 Q;  2F4I A;  3R3O A;  4F8M A;  2F3V A;  2ZXP A;  5LL6 X;  1WI5 A;  5C0X I;  1VS0 A;  4DV0 Q;  3I91 A;  1TS3 A;  3NQI A;  2K05 A;  2OT2 A;  1K8G A;  1MIU A;  4IFD I;  1FGU A;  5C0X J;  1H9S B;  1TWC B;  2L0C A;  3PSI A;  1ICF B;  1A3T A;  1QUQ B;  2B63 H;  2B63 B;  4LF5 Q;  1SNQ A;  2Z0S A;  4U68 A;  1I50 B;  2LY7 A;  1WD0 A;  1QNK A;  5BN5 A;  3SK6 A;  3FRP B;  4HID A;  2BOS A;  1CA6 A;  1CHQ D;  5IGD A;  3CKI B;  3AFQ A;  3M4O B;  4DR1 Q;  2QKI C;  5FKA C;  2LXK A;  1DCZ A;  3NXW A;  4B08 A;  5JEA G;  1VQD A;  1TWF H;  2NN6 H;  2V1C C;  4LUO A;  2VQE Q;  1HQR D;  4IJL A;  1XNQ Q;  3RZO H;  1NNX A;  4MZ9 A;  1VQ4 A;  1D5Z C;  5G3L F;  3FPU B;  4JI1 L;  1YI2 A;  2KEN A;  3EIV A;  4MHE A;  4DUZ L;  4A3E B;  1BVS A;  3FKI G;  5LHY 1;  4NXM Q;  2B39 A;  1U4L A;  5LMN L;  4DXG A;  4LF7 L;  4LF6 L;  4JOI C;  3VR4 A;  2BDO A;  2OQ0 A;  3K81 C;  1DOL A;  3A74 A;  2NTS A;  1G6P A;  1I4R A;  3QO2 A;  5COR A;  2K50 A;  4JBK A;  1B3Q A;  1IHZ A;  3CCR A;  2NVQ B;  3OIQ A;  5D3I B;  3DMU A;  4AYB B;  1SDF A;  2ALY B;  5ELF A;  1VQP A;  5CV6 A;  4GLA C;  2ZJQ A;  1FGB D;  3T53 B;  1GUT A;  3UDG A;  2K5H A;  2XSC A;  1IXR A;  3GTO B;  1I4X A;  1BO0 A;  1O78 A;  2FHT A;  3HEJ A;  1I4H A;  3JAM L;  5C5L A;  4OX9 Q;  4FNF A;  1WTH A;  3PUX A;  2EYO A;  3DHQ A;  4JI0 Q;  4DV1 Q;  2WB1 E;  4O1N A;  5NUC A;  5BR8 Q;  1TWC H;  4QUC A;  2EY2 A;  1PH7 A;  1X3P A;  3V05 A;  3BYT B;  2JA5 H;  3HKZ E;  4IUR A;  1A63 A;  3Q24 A;  1S3O A;  4A3F G;  1SNP A;  4H0L C;  1XNR L;  2CW0 D;  2NVY B;  2AQ2 B;  1GJX A;  4FVM A;  3DEO A;  2LMC B;  1HJP A;  3I4M G;  2A8V A;  5M3F H;  2F0W A;  1PA6 A;  3C1E A;  2F0S A;  3HG9 A;  1FL0 A;  4X65 Q;  2R92 B;  1X6O A;  4HAE A;  1KC8 C;  1TVX A;  1C7Y A;  5GAE C;  3E0E A;  1SE4 A;  5C0X G;  1QUQ A;  3RN5 A;  2PQE A;  5F2D A;  2KEE A;  1D6E C;  3J81 i;  2IHE A;  4CBV A;  4BY1 B;  4DR6 L;  4KHP L;  2HIV A;  1R9T H;  5ELB A;  2F0V A;  2RHQ B;  3S15 B;  2K5N A;  1A8V A;  4DKA C;  3NK9 A;  2G5D A;  3TZD A;  4CJ0 B;  2UXB L;  2OEO A;  4KN7 C;  3S1M B;  1L1O C;  2YTY A;  3W1B A;  4DR2 Q;  1PMR A;  2DN8 A;  2F0I A;  3NQT A;  3OHX C;  4X62 L;  2VB2 X;  4B3S L;  2NVQ H;  3OW7 A;  3F2C A;  2EYL A;  4ID6 A;  2K75 A;  4HJ9 A;  2AQ3 B;  4I7A A;  4C2M H;  5AJ3 Q;  1U4P A;  2K6A A;  1K8O A;  3KF6 B;  3S16 B;  2KHS A;  1VQ7 A;  1VQ6 A;  4P2C B;  3UE0 A;  1PTO F;  1Y1W B;  1I94 Q;  3H3V H;  3CMA A;  2XN9 C;  4A3D B;  2EXZ A;  1JJC B;  4A3I H;  3MZ5 A;  4PQX A;  4KY7 A;  3RLF A;  3H0G H;  1Q8I A;  2VB3 X;  2OWO A;  1BBU A;  1KDA A;  1BOS A;  4MTN A;  4CDF C;  3K5N A;  1I5F A;  3Q8D A;  4A3B B;  1D7Q A;  4EQN A;  4UP9 A;  1EIF A;  2EYP A;  2D0O A;  4PV1 C;  2NZ1 D;  3HOW G;  3KOJ A;  1MSG A;  5C3X A;  2D0P A;  3QB3 A;  2R3Z A;  4A3J H;  2JSO A;  1VQE A;  3AB9 A;  1RF2 D;  2ZXR A;  4DV6 Q;  1SYC A;  2A74 C;  4RWS C;  1AW7 A;  3ZJY C;  4A3M G;  2A69 D;  3CD6 A;  1SRU A;  1II3 A;  1NMF A;  2KHJ A;  3IFT A;  4QCL A;  4KMU C;  1DZ1 A;  2CHB D;  5CGK A;  3GTL H;  2PO4 A;  4I7Z C;  3KK7 A;  4KHZ A;  2WAQ E;  3K5O A;  2F0O A;  2B63 G;  1S72 A;  1EIH A;  1PH8 A;  2J7Z A;  4GZY C;  1IBM Q;  1JJ2 A;  4C3H H;  3S14 H;  1O7I A;  5FLX L;  1WOC A;  1FNW A;  2H1E A;  2YV5 A;  3URY A;  2VQE L;  3HOY H;  5EQ0 A;  2KCT A;  1EYA A;  1QCB D;  1VCI A;  1U9R A;  4HJ7 A;  3K80 C;  4DNR B;  3PO3 B;  5IP7 G;  1X3E A;  4A3I B;  4POG A;  1V1Q A;  4JW0 A;  4WJW A;  4DR7 L;  1OXU A;  2B8F A;  2L55 A;  2J0T D;  5I2X A;  1NR2 A;  3HKS A;  3K6O A;  2I5H A;  2KEC A;  4LFA Q;  4GS3 A;  2DY7 A;  3HOW H;  5COY A;  4DPG A;  3G6J B;  1TQO A;  1VQA A;  3VYT A;  3SXH A;  1WVL A;  4BXX G;  5IY0 A;  2G9D A;  3S16 H;  1VF7 A;  3S1R B;  2K4K A;  1G2T A;  4TRD A;  3HOX B;  5JOB A;  2KJX A;  4HCE A;  4XYO A;  5IGF A;  3T4A C;  3DEP A;  1HZA A;  5FO8 B;  1B44 D;  3BG3 A;  1YVC A;  1PTO B;  2HT1 A;  4LF7 Q;  1TWF B;  5JJZ A;  1F9R A;  3CU7 A;  3TP8 A;  3S17 B;  3SDZ A;  3SVM A;  2SDF A;  4ZLT F;  4JK1 C;  3A5Z B;  1PZK D;  3H0G G;  1EFI D;  4QJF A;  2Z9H A;  1F9Q A;  3LWE A;  5FO7 B;  3ONA B;  4LF9 L;  5JEA J;  2CH4 W;  3U4Z A;  4DXF A;  3HOV B;  3CQZ H;  1QE6 A;  4PG3 A;  1YNN C;  2ZTE A;  3GQB A;  3TDQ A;  1ESR A;  5IYD G;  1ET9 A;  1Y8N B;  2AUJ D;  5L37 A;  1IYV A;  2B2Y A;  4DV5 Q;  2ZTC A;  3AMU A;  3EVQ A;  5HGQ A;  2EYJ A;  3H3V C;  4IUQ A;  4DUY L;  4JYA Q;  4BY7 H;  1HNW L;  1NBW A;  4OON A;  1BNZ A;  2VUM H;  2VUM B;  4V0B A;  5IT9 L;  5IIF A;  4GKJ L;  1UE1 A;  2IL8 A;  4N8X 1;  1Q86 C;  1CZG A;  1GKH A;  1E2V A;  4XXE A;  1VQN A;  1CQV A;  1VQB A;  3VA7 A;  1MBY A;  1BBX C;  4FF3 A;  2K33 A;  2RCF A;  5E4W C;  3A8I E;  2CWA A;  3BS1 A;  2LKV A;  3M4O H;  1SMX A;  2KA7 A;  3TZU A;  2F0Q A;  2WKC A;  4IFD J;  4A76 A;  4K2K A;  2JA8 G;  1LO5 D;  3K0X A;  3NWS A;  5E4X A;  1PLF A;  3PMF A;  2BDN A;  1Q82 C;  4DN4 M;  1DD2 A;  2UXD L;  2ICE C;  3AU7 A;  4KTA A;  5CR3 A;  1WTQ A;  4WJ4 A;  5C4J H;  1RTN A;  2RVL A;  1ENF A;  2IHF A;  1F9S A;  3FHW A;  3LWU A;  3T1H Q;  1KAW A;  5C3E G;  1CZW A;  1MGS A;  4A3B H;  5CMD A;  3D6C A;  3E5S A;  1TT2 A;  4G7Z C;  3OMC A;  3E9H A;  4JI7 L;  3Q6S A;  1OO9 B;  2MUY A;  5CBE E;  2EZV A;  3SE0 A;  4YHH Q;  2UXD Q;  2HHH Q;  2R7Z B;  2D62 A;  4KHP Q;  3GTP H;  1XPR A;  2R93 B;  2DNC A;  4J1M A;  3TRE A;  2ENB A;  2E76 C;  1IL8 A;  4IUT A;  1SYD A;  3H94 A; 
#chains in the Genus database with same CATH homology
 2PZT A;  2QDB A;  2NWG A;  5D14 A;  5G3L D;  3N6R A;  3PUW A;  1BR9 A;  1ICW A;  1BCP D;  2B2T A;  2EPB A;  4HCS A;  1DM0 B;  4ULL A;  1FD7 D;  2B2T C;  1LT5 D;  4XYQ A;  4TQU S;  1WTP A;  2A6E D;  2Y0S B;  4IUP A;  3V2T A;  5CV4 A;  3X3M A;  1GUW A;  4FF1 A;  4PMB A;  1G2S A;  4ABN A;  1I4Q A;  1BCP B;  1F2Y A;  2IWH A;  1H9S A;  2NVT B;  4OO1 G;  2E2J B;  1EZ6 A;  4BWG B;  2ID0 A;  1UAP A;  1BUV T;  5JEA H;  4HED A;  5KND A;  2ZXO A;  1W6J A;  4H13 C;  1S5D D;  5ELC A;  4BY7 B;  1GHJ A;  2F0J A;  2YU9 B;  3Q0A A;  3OIP A;  2F0U A;  4NKL A;  2K32 A;  1CT1 D;  1I4P A;  4KKT A;  4IAL A;  3BVM A;  4R8I A;  3VR5 A;  2JYO A;  1HTP A;  1RTO A;  2E75 C;  2PNR C;  4KY5 A;  2ICI A;  1CFM A;  3MAQ A;  3I4N B;  3S14 B;  4C3H B;  3GP7 A;  1O7L A;  1LV9 A;  1F2M A;  2K04 A;  5EBD A;  1PTO D;  5LL6 S;  1EQV A;  1EY8 A;  1SXT A;  3D31 A;  4DA2 A;  2F0F A;  5CV8 A;  3SHL A;  5KRU A;  1BCP C;  2HCC A;  2F0T A;  3NBH A;  3EJI A;  5T1G A;  4QB4 A;  5J1Z A;  2KUM A;  3TP5 A;  4XT3 B;  3FKI B;  5DAU A;  1CTM A;  2B2Y C;  4XT1 B;  4U67 3;  1V1O A;  4FP5 D;  2D5D A;  1HHV A;  3I4L A;  5JVH 3;  2MP1 A;  2JEB I;  3MEH A;  3R8B A;  5CV5 A;  4I65 A;  4IZ8 A;  5EKI A;  4PMC A;  3P75 A;  1RKN A;  1EYC A;  3VYS A;  3L7Z C;  3M7G A;  3K58 A;  1G8Z D;  2KCC A;  3PIO 3;  1DOK A;  3P7J A;  3K0Y A;  4CJ2 C;  4LMQ D;  4A3J B;  1WTO A;  1BXT A;  2QEJ C;  3VYR A;  1S5C D;  3NPP A;  2KCN A;  2M2L A;  3S1Q B;  1F2L A;  1SJE D;  3SEB A;  1B4O A;  4Q0F A;  4RAU C;  1F9P A;  3TME A;  4RHS A;  2NYZ D;  2HDM A;  3MA2 B;  4OIJ A;  2K5Q A;  1Q3L A;  4EVO A;  2CQA A;  2EVB A;  1HA6 A;  3GTP B;  1QNU A;  3KBX A;  1X3Q A;  1OXV A;  1W6K A;  4QMG A;  4HR7 B;  3GTQ B;  1Z47 A;  1LTB D;  1TS4 A;  3PV0 A;  4G4K A;  2Q8I B;  3MHB A;  2QF7 A;  4XDX A;  4ZYS A;  3MVV A;  3DWQ A;  3HS0 C;  4FXD A;  4A93 B;  1PFM A;  4B9X A;  4DGZ A;  2V4D A;  1BCP F;  2FJ2 A;  2G9H D;  2L4N A;  1TS5 A;  3MWY W;  1GUN A;  4KJN A;  3KLR A;  3M85 A;  3EFX D;  2EJF C;  4X3S A;  1KAA A;  3F2U A;  1JWU D;  1Z7T A;  3MC0 B;  3Q22 A;  2M9V A;  3I72 A;  2B2U C;  5EPL A;  2WII B;  1XXG A;  2PZU A;  2WV6 D;  2F0L A;  5A35 A;  1KAB A;  5TSS A;  1E0B A;  1JQY D;  1WTW A;  4BBR B;  3OPO A;  1TY2 A;  1UEA B;  2BA0 A;  1X32 A;  3GTG B;  5E1F A;  1KLG D;  2NTT A;  3VR3 A;  4C2M B;  4ZUI A;  3J7A F;  1B1Z A;  4K6L A;  4EQO A;  5IOC A;  1KDC A;  4C3I B;  2IT1 A;  4Q5V A;  5JAV A;  3KBG A;  3R2I A;  3P20 A;  2SNM A;  1JB3 A;  1V43 A;  5IGC A;  4V19 0;  1C48 A;  1STN A;  4RGT A;  3GO5 A;  3J80 E;  1U4R A;  2EOT A;  2FIN B;  1G6Z A;  3ERQ A;  4CKB A;  1XX8 A;  2F0E A;  4KHV A;  3T13 A;  2IPK D;  1EIG A;  1ET6 A;  5K36 G;  4MIU A;  4XQQ A;  2X69 A;  1KNE A;  3MFY A;  2DNE A;  3H6M A;  4NDX A;  3OWE B;  3RZO B;  3ND9 A;  3C3L A;  4X3T A;  4ILW A;  1B9N A;  3U9O A;  1ESF A;  2XVS A;  4RFB A;  1YNJ D;  1EY6 A;  3S1N B;  2EY1 A;  3P1H A;  1BDO A;  5C3W A;  3A7A B;  3LNN A;  1CQF A;  4C3J B;  2AWN A;  4Y7N B;  3PUZ A;  1SJH D;  1SYG A;  1JOO A;  1GUG A;  1SEB D;  1MD2 D;  2F03 A;  4ODG A;  4KY6 A;  2F0P A;  2VNU D;  2X6L A;  1ML0 D;  1PFB A;  3VYU A;  3A56 A;  4ZK9 B;  4ZKC B;  4H44 C;  3H0G B;  4KI0 A;  3PUV A;  4IQZ A;  1S5E D;  4DU9 A;  1PRT C;  4IUU A;  1Y8O B;  5IGB A;  1IYU A;  3D4R A;  1MI2 A;  1RJT A;  2KVM A;  2BE5 C;  3HP3 A;  3OWF A;  1K83 B;  5A2Q L;  3J7A V;  3D8G A;  4CJ1 B;  4C1N I;  1DJR D;  1KLU D;  3H91 A;  2K03 A;  4OIK A;  5IGG A;  2A73 B;  1ILP A;  1STH A;  2L5T A;  2H4O A;  3GTL B;  2N88 A;  3C46 A;  4FO2 A;  2EDG A;  2E74 C;  3DWA A;  1A6X A;  2WKD A;  1R4P B;  3IL8 A;  5FLX E;  1I6V C;  1GHK A;  3GV3 A;  1EY0 A;  1VMP A;  4C1N K;  5KNB A;  3D3R A;  2K01 A;  2IW3 A;  4UAI A;  3LX0 A;  2XWB B;  3NP8 A;  1DON A;  4KKS A;  1SSO A;  1PTO H;  2Q8T A;  4O42 A;  2EE1 A;  5C4X B;  2B2V A;  1LAC A;  1B53 A;  1L0X B;  1DOM A;  4J6H A;  2WAC A;  2DY8 A;  3TBI B;  3BDL A;  2JA5 B;  1M4V A;  3M4Y A;  1EY5 A;  2MPM A;  1AZP A;  4G7H C;  3EA6 A;  4L8J A;  2A6H D;  1HXY D;  4CKC A;  3M3Y B;  5JVG 3;  2JA7 B;  2X6G A;  4RKB A;  1PZJ D;  4FF4 A;  1YNN D;  1EU3 A;  1TKW B;  4DAV A;  3O13 A;  3D4W A;  2HQE A;  1S5F D;  1TR5 A;  1JCK B;  3CHB D;  1ZEQ X;  4TKO B;  5C4J B;  2Z4I A;  2F0M A;  2RBM A;  1LLR D;  1PRT F;  1S5B D;  3CRL C;  5BN3 A;  4IUN A;  5CV9 A;  3PO2 B;  5K36 H;  1SMY C;  3Q23 A;  5IT9 E;  1ZYR C;  2XWJ B;  3NUC A;  1AFP A;  1U4M A;  1A3U A;  3C1F A;  4HSP A;  2EYH A;  5M5X B;  3NHH A;  4X3U A;  1E2Z A;  3KUP A;  2WB1 B;  1SNM A;  1OXX K;  2B2W A;  5CV7 A;  4KD3 A;  3W2D A;  3SK8 A;  1J8I A;  2QIL A;  5D65 A;  1SNC A;  1TWH B;  2R61 A;  3HKZ B;  4RGN A;  5C0X H;  3I70 A;  2KOL A;  1V8Q A;  3SK5 A;  4KV6 A;  4EQP A;  5DEH A;  5EBC A;  2LFN A;  3D6W A;  4A3M B;  4B9W A;  4YIJ A;  3W3A A;  4TSS A;  3DXJ C;  1HA5 A;  4NW2 A;  3E0J A;  1HTL D;  5FOB B;  2SEB D;  5JPM C;  5KYL A;  2QCP X;  4QUF A;  4MN3 A;  5HUR A;  3MXU A;  1V1P A;  1Y8P B;  1STY A;  2Q8R E;  1QWY A;  3NE5 B;  2JA8 B;  3OSO A;  4OL7 A;  2K5W A;  1ILQ A;  1BF4 A;  3X3N A;  2L11 A;  1HQM C;  4ZRZ A;  3K5L A;  2K5D A;  5M3F B;  2BA1 A;  1HPC A;  5I2Y A;  2RA4 A;  5KYI A;  1JOK A;  1JIC A;  1QIL A;  1JOR A;  2C9O A;  4BA2 I;  5AFW A;  5I9O A;  1STE A;  1SMY D;  5DM6 3;  4HMJ A;  2RQX A;  4A3K B;  4DFA A;  3HOZ B;  1PRT B;  4KJO A;  5M9O A;  5A2Q E;  4OO1 I;  1LTA D;  2HUG A;  2L1B A;  5M3M B;  1G29 1;  3RZD B;  4LJZ C;  1C8C A;  2XNA C;  1LTG D;  2BCO A;  3ZYY X;  3BVZ A;  2IX1 A;  1WD1 A;  2D9U A;  2A6H C;  2A68 D;  2K7V A;  2Z1C A;  1HRJ A;  2K1B A;  1A3V A;  3A55 A;  4ZUJ A;  1KDB A;  1R4Q B;  4RGM A;  3J81 E;  1PTO C;  1VDZ A;  2E2D C;  2WAQ B;  2B2V C;  5FO9 B;  3V96 A;  5ELE A;  2NB0 A;  1NAP A;  1K8M A;  4NMZ A;  3WOE A;  1VMC A;  3M7N A;  5KNC A;  1PDQ A;  4DAP A;  1O80 A;  3TN2 A;  3C2P A;  1SBB B;  1HFN A;  2IJ0 A;  4XQJ A;  2AUK A;  2L9H A;  2C5C A;  5C44 B;  4N9T A;  2VXW A;  1A2U A;  3T16 A;  3K59 A;  3DM1 A;  1HCZ A;  1HFG A;  3I73 A;  4HN7 A;  2PW7 A;  2XRS D;  5EJW A;  1JR0 D;  1FR3 A;  2M00 A;  2IX3 A;  3R2T A;  1LTR D;  4G7O C;  2MHV A;  1QG7 A;  4DAY A;  5ELD A;  1MSH A;  1D5M C;  3S2D B;  1D5X C;  1IKL A;  3VR2 A;  3I8Z A;  3VA5 A;  1GUO A;  5FK9 C;  4IFD G;  1T5E A;  1PXU A;  2B2U A;  1WTX A;  3RMH A;  4WFN 3;  1EOT A;  4ZKB B;  4KD4 A;  4C3J G;  4HTH A;  1NR4 A;  1TWA B;  2AWO A;  2YYZ A;  2I07 B;  3MXP A;  3T51 B;  2A6E C;  3EQL C;  4R8N A;  3IFD A;  4S3S A;  3IKJ A;  4F87 A;  4A3G B;  1UUP A;  1PYW D;  2JP1 A;  3FMC A;  2JXM B;  1ENC A;  2CW0 C;  1JWS D;  1I3Q B;  5KGU A;  1PZI D;  4ZAI A;  3TP6 A;  3J7Y W;  1GUS A;  2JA6 B;  2I46 A;  3VR6 A;  1EY4 A;  3N52 A;  1QOH A;  4K5V A;  3T56 B;  1XWE A;  4ME5 A;  2K28 A;  2J4X A;  3PUY A;  4J8Q A;  2A68 C;  2OXP A;  5C4Z A;  2FMM A;  1O7Z A;  1B3A A;  4UDU C;  3DWP A;  5C3E B;  3IAY A;  5J22 A;  1ZKO A;  3H09 A;  2KED A;  3PIP 3;  4CHT B;  2RDH A;  4K8I A;  2A69 C;  1GOZ A;  4R9W A;  2CVR A;  1LTI D;  1D1K A;  4K8J A;  5C4H A;  1XYI A;  1RHP A;  2TSS A;  4A3F B;  1A15 A;  3ITP A;  1JE4 A;  2NBF A;  1DXM A;  1D1I A;  2KQ3 A;  3HOU B;  4BBS B;  2F1M A;  5EPK A;  4IUV A;  3CQZ B;  1TWG B;  1DYQ A;  5DNF A;  4BA1 I;  4K2L A;  1SAP A;  2B2W C;  3RD4 A;  5EKL A;  2EJM A;  3I90 A;  1T5X D;  4RA8 A;  2EJG C;  2L12 A;  2O5I C;  1L0Y B;  4BS9 A;  1EY9 A;  4M1U B;  2E2I B;  1LT6 D;  1Y69 U;  1WTV A;  3KF8 A;  4K5X A;  3L9A X;  3KLS A;  1YNJ C;  1LT4 D;  3BZD B;  5K5P A;  2FMC A;  4RH6 A;  3A54 A;  1PFN A;  1C4Q A;  3NBI A;  4FF2 A;  1OXS C;  2TMP A;  1CA5 A;  3E6Z X;  2R6G A;  4K14 A;  3J81 L;  3ERO A;  5JPN C;  1IKM A;  2F0N A;  1WTR A;  1RDP D;  3U9S A;  3J80 L;  1OXT A;  3UI2 A;  2EY5 A;  3SK4 A;  4RCO A;  3GD7 A;  2PPB C;  3OMG A;  4G57 A;  4XQN A;  1O7Y A;  2D2C C;  4K5W A;  1FYC A;  2O2L D;  1STG A;  1SND A;  2FFK B;  1HUM A;  5C6A A;  3FPP A;  4EGV A;  3WOF A;  4DK0 A;  3MXN A;  1LTS D;  3QOL A;  4C3I G;  1TII D;  3HOW B;  1NCV A;  1WCM B;  5IOD A;  4CGY B;  3S2H B;  2IX0 A;  5CBA E;  4F88 A;  4IFD H;  1FNU A;  3QJY A;  1F77 A;  3HRZ C;  3R93 A;  3S9W A;  3ND8 A;  2A5H A;  4N9P A;  1AN8 A;  2O4X A;  1TU2 B;  3GTJ B;  3HGB A;  1TY0 A;  3FEW X;  2LS0 1;  4L6T B;  3A7L A;  4KN4 C;  1EY7 A;  4WRD A;  2EY6 A;  4PNY A;  4NP5 A;  2RDG A;  1SYB A;  4E6I A;  4KK7 A;  4HSV A;  3RUZ A;  5EPJ A;  4FXK C;  5I9P A;  2NVX B;  2JEA I;  3DUZ A;  1PRT D;  2XRQ D;  3BDO A;  5I4D A;  2OF1 A;  3MTS A;  5M5W B;  4H7B A;  4C3H G;  3NSW A;  2PZW A;  4LAA A;  1AEX A;  3QIA A;  1EZ8 A;  1EL0 A;  1KTK A;  3FDT A;  1Q1B A;  1XTC D;  1SFO B;  4JBW A;  3GTK B;  1ZYR D;  2GA4 B;  3L3O C;  1Y1V B;  1IW7 C;  3NTI A;  1B50 A;  1STA A;  1A2T A;  3HZX A;  4OO1 H;  5CYU A;  1NUC A;  3HOY B;  3BDC A;  3QG1 A;  5T1I A;  5ISR A;  1F2Z A;  4QIW B;  1JOQ A;  4HMI A;  1AP0 A;  1SYF A;  4LK1 C;  5E3F A;  2BE5 D;  2F3W A;  5KIX A;  4C56 C;  4ZQ3 A;  3I4M B;  3KLS X;  1LT3 D;  2AQ1 B;  3K7A B;  3QOJ A;  2WP8 J;  1RD9 D;  3CRK C;  2F0K A;  2N55 A;  3G7L A;  2MGS A;  1ROD A;  1Q12 A;  1CM9 A;  2RSN A;  1LAB A;  1M8A A;  1SYE A;  5BN4 A;  1CI3 M;  1NSN S;  1Q90 A;  1H9R A;  2SOB A;  5DM7 3;  3NWT A;  2RSO A;  1EQT A;  3NTH A;  4KKU A;  4XIG S;  3K5M A;  2HDL A;  1G91 A;  1HUN A;  1V1P B;  4L63 B;  1FNV A;  1Q1E A;  1RCV D;  1SE3 A;  1EYD A;  1GXD C;  4OHJ A;  3JAM E;  4RKL A;  4IN3 A;  2ZT9 C;  2XIW A;  4Z9C B;  3WDN A;  2Z4H A;  3TSS A;  3SR1 A;  1R9T B;  1EEF D;  2MJ8 A;  4QF4 A;  1H9M A;  4RHR A;  1Z6H A;  1QB5 D;  1J9O A;  3FVQ A;  3A8J E;  1EEI D;  3MXG A;  1IW7 D;  3A8K E;  2RDF A;  2NN6 I;  1EWH A;  4RCN A;  4FXG C;  3GTM B;  1D2B A;  2RKS A;  1H9J A;  5I6Y A;  2JE6 I;  1BQQ T;  4RGO S;  4F7X A;  2E2H B;  2O5J C;  3QWN A;  3OOC A;  2F0H A;  2B8G A;  2EYF A;  2PW5 A;  1KNA A;  2PCF B;  4DNT B;  5D3D A;  4XTC S;  4WOR A;  4K6D A;  3K57 A;  3GV6 A;  5EGT A;  2PYK A;  2EYM A;  5C5M A;  4FYD A;  1LTT D;  2SNS A;  3TP7 A;  1B2T A;  4M8A A;  2Z8L A;  4CKE A;  1I6H B;  1B9M A;  1E2W A;  1AZQ A;  1STB A;  1I4G A;  3BVG A;  1EWC A;  1SNO A;  1JWM D;  1ENA A;  4DF7 A;  1UNS A;  5KEE A;  1QJO A;  1CK1 A;  4OGQ C;  4X3K A;  5J39 A;  1ONL A;  1TS2 A;  1SE2 A;  4PMW A;  2PMZ B;  2NN6 G;  5I6W A;  1VF5 C;  2F0D A;  2F0G A;  5HGT A;  5EKK A;  1ZXT A;  1H9K A;  5CC4 A;  3NTK A;  1CHP D;  5M5Y B;  3BYY B;  1EU4 A;  4DK1 A;  3I3C A;  2NUC A;  3D4D A;  2HCI A;  5IGE A;  3MFG A;  1JC7 A;  2WIN B;  1S4Z A;  2F4I A;  3R3O A;  4F8M A;  2F3V A;  2ZXP A;  5LL6 X;  5C0X I;  3I91 A;  1TS3 A;  3NQI A;  2K05 A;  2OT2 A;  4IFD I;  5C0X J;  1H9S B;  1TWC B;  2L0C A;  1A3T A;  2B63 B;  1SNQ A;  4U68 A;  1I50 B;  2LY7 A;  1WD0 A;  1QNK A;  5BN5 A;  3SK6 A;  3FRP B;  2BOS A;  1CA6 A;  1CHQ D;  5IGD A;  3CKI B;  3M4O B;  2QKI C;  5FKA C;  1DCZ A;  3NXW A;  4B08 A;  5JEA G;  2NN6 H;  1HQR D;  1D5Z C;  5G3L F;  3FPU B;  4MHE A;  4A3E B;  5LHY 1;  2B39 A;  1U4L A;  4DXG A;  3VR4 A;  2BDO A;  1DOL A;  2NTS A;  1I4R A;  3QO2 A;  5COR A;  1IHZ A;  2NVQ B;  3OIQ A;  5D3I B;  3DMU A;  4AYB B;  1SDF A;  5ELF A;  5CV6 A;  1FGB D;  3T53 B;  1GUT A;  2XSC A;  3GTO B;  1I4X A;  1BO0 A;  1O78 A;  2FHT A;  3HEJ A;  1I4H A;  3JAM L;  5C5L A;  4FNF A;  3PUX A;  2EYO A;  3DHQ A;  4O1N A;  5NUC A;  4QUC A;  2EY2 A;  1X3P A;  3V05 A;  3BYT B;  4IUR A;  3Q24 A;  1SNP A;  4H0L C;  2CW0 D;  2NVY B;  2AQ2 B;  1GJX A;  4FVM A;  3DEO A;  2LMC B;  2F0W A;  3C1E A;  2F0S A;  3HG9 A;  2R92 B;  4HAE A;  1TVX A;  1SE4 A;  5C0X G;  2PQE A;  5F2D A;  2KEE A;  1D6E C;  4CBV A;  4BY1 B;  5ELB A;  2F0V A;  3S15 B;  3NK9 A;  3TZD A;  4CJ0 B;  2OEO A;  4KN7 C;  3S1M B;  1PMR A;  2DN8 A;  2F0I A;  3NQT A;  3OHX C;  2VB2 X;  3OW7 A;  2EYL A;  4ID6 A;  2AQ3 B;  1U4P A;  2K6A A;  1K8O A;  3S16 B;  2KHS A;  4P2C B;  1PTO F;  1Y1W B;  2XN9 C;  4A3D B;  2EXZ A;  3MZ5 A;  4PQX A;  4KY7 A;  3RLF A;  1Q8I A;  2VB3 X;  1KDA A;  1BOS A;  3K5N A;  4A3B B;  4EQN A;  2EYP A;  4PV1 C;  2NZ1 D;  1MSG A;  5C3X A;  3QB3 A;  2R3Z A;  2JSO A;  3AB9 A;  1RF2 D;  2ZXR A;  1SYC A;  2A74 C;  4RWS C;  1AW7 A;  2A69 D;  1II3 A;  3IFT A;  4QCL A;  4KMU C;  1DZ1 A;  2CHB D;  5CGK A;  2PO4 A;  4I7Z C;  3KK7 A;  4KHZ A;  3K5O A;  2F0O A;  1EIH A;  2J7Z A;  4GZY C;  5FLX L;  1FNW A;  2H1E A;  3URY A;  5EQ0 A;  1EYA A;  1QCB D;  1VCI A;  1U9R A;  4DNR B;  3PO3 B;  4A3I B;  4WJW A;  1OXU A;  2B8F A;  2L55 A;  5I2X A;  2J0T D;  1NR2 A;  3K6O A;  2KEC A;  2DY7 A;  5COY A;  3G6J B;  1TQO A;  3VYT A;  3SXH A;  1WVL A;  2G9D A;  1VF7 A;  3S1R B;  1G2T A;  4TRD A;  3HOX B;  5JOB A;  2KJX A;  4HCE A;  4XYO A;  5IGF A;  3T4A C;  3DEP A;  5FO8 B;  1B44 D;  3BG3 A;  1PTO B;  1TWF B;  5JJZ A;  1F9R A;  3CU7 A;  3TP8 A;  3S17 B;  3SDZ A;  3SVM A;  4ZLT F;  2SDF A;  4JK1 C;  1PZK D;  1EFI D;  1F9Q A;  3LWE A;  5FO7 B;  3ONA B;  5JEA J;  4DXF A;  3HOV B;  1QE6 A;  1YNN C;  3GQB A;  3TDQ A;  1ESR A;  1ET9 A;  1Y8N B;  2AUJ D;  1IYV A;  2B2Y A;  3AMU A;  3EVQ A;  2EYJ A;  3H3V C;  4IUQ A;  1BNZ A;  2VUM B;  4V0B A;  5IT9 L;  5IIF A;  2IL8 A;  1CZG A;  1E2V A;  4XXE A;  1CQV A;  3VA7 A;  1MBY A;  1BBX C;  4FF3 A;  2K33 A;  5E4W C;  3A8I E;  3BS1 A;  2LKV A;  2KA7 A;  3TZU A;  2F0Q A;  2WKC A;  4IFD J;  4K2K A;  1LO5 D;  3NWS A;  5E4X A;  1PLF A;  3PMF A;  2BDN A;  4DN4 M;  1DD2 A;  2ICE C;  3AU7 A;  4KTA A;  5CR3 A;  1WTQ A;  1RTN A;  2RVL A;  1ENF A;  1F9S A;  3LWU A;  1CZW A;  1MGS A;  5CMD A;  3D6C A;  3E5S A;  1TT2 A;  4G7Z C;  3OMC A;  3Q6S A;  1OO9 B;  2MUY A;  5CBE E;  2EZV A;  3SE0 A;  2R7Z B;  2D62 A;  2R93 B;  2DNC A;  4J1M A;  2ENB A;  2E76 C;  1IL8 A;  4IUT A;  1SYD A;  3H94 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...