4ID6A

Crystal structure of staphylococcal nuclease mutant v23i/i72l
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
136
structure length
136
Chain Sequence
KLHKEPATLIKAIDGDTIKLMYKGQPMTFRLLLVDTPETKHPKKGVEKYGPEASAFTKKMVENAKKLEVEFDKGQRTDKYGRGLAYIYADGKMVNEALVRQGLAKVAYVYKPNNTHEQHLRKSEAQAKKEKLNIWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Staphylococcal nuclease mutant V23I/I72L
rcsb
source organism Staphylococcus aureus
molecule tags Hydrolase
molecule keywords Thermonuclease
total genus 39
structure length 136
sequence length 136
ec nomenclature ec 3.1.31.1: Micrococcal nuclease.
pdb deposition date 2012-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00565 SNase Staphylococcal nuclease homologue
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.90 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 4id6A00
1SNQA 1STHA 2PZTA 5CV9A 3D4DA 1ENCA 3QB3A 1EZ8A 4IUNA 4J6HA 3MEHA 1KABA 2PQEA 4R8NA 4ODGA 2OXPA 5C3XA 1SNMA 2F0SA 4QF4A 2F0IA 3OMCA 2RBMA 3OWFA 1F2MA 3P75A 1NUCA 4K2KA 1STNA 1SYFA 3EVQA 4TRDA 5I9PA 1ENAA 4RKLA 4NP5A 4K8JA 1EYDA 3R3OA 3TP7A 5I9OA 5J22A 1EY8A 2EY1A 4B9WA 2O4XA 5KEEA 3TMEA 1KDBA 2EYOA 4ZUJA 3NUCA 1EZ6A 1SYEA 5C5MA 4G57A 3QOLA 3T13A 2F0FA 3DMUA 3NK9A 5C3WA 4EQNA 2RDFA 4K14A 3ERQA 2F0KA 1JOKA 1A3UA 2F0NA 3MVVA 4K5XA 5J39A 3SK8A 2PW7A 5IGEA 2EXZA 5KGUA 1A2UA 4KY6A 2NUCA 2RKSA 2EYLA 5E1FA 5HGTA 1EYCA 3D8GA 4OL7A 1SNDA 4B9XA 2F0QA 3S9WA 4KY5A 2M00A 3MHBA 4N9PA 2PW5A 4ZQ3A 1SYBA 5NUCA 1A3TA 2F0TA 1TQOA 2QDBA 5ISRA 4F7XA 5C6AA 2F0DA 4QB4A 3U9OA 1EY7A 3C1EA 3D4WA 4K6DA 4KJOA 4PMBA 4YIJA 5CC4A 1KAAA 2F0GA 2F0UA 4KD3A 1SNPA 2PYKA 1STBA 5IGFA 2F3VA 5C5LA 3EROA 1EQVA 3P1HA 2SOBA 4KD4A 4DFAA 5EGTA 3DHQA 5CR3A 5EKKA 4F8MA 3PMFA 4KJNA 1SYGA 4HMIA 5CV4A 1SYCA 2F0HA 5KRUA 2F0OA 2F0EA 2F0WA 2F0LA 2F3WA 3H6MA 3LX0A 1A3VA 3OMGA 1AEXA 3BDLA 3HZXA 4IALA 4S3SA 5DAUA 4DGZA 5I6WA 2PZUA 4KTAA 5CV6A 4I65A 5CV7A 4WRDA 2EY5A 2SNSA 5F2DA 5EKLA 3SR1A 3MXPA 3HEJA 4WORA 4H7BA 4E6IA 1A2TA 3C1FA 1JOQA 3T16A 4EVOA 1EY6A 2EYMA 3OSOA 3NXWA 4NMZA 5CV8A 3ITPA 4RKBA 1II3A 1F2YA 4EQOA 5IODA 5C4HA 2EY2A 1KDAA 5JOBA 1TT2A 2F0JA 2F0MA 4NDXA 5J1ZA 4KHVA 4HTHA 4NKLA 3SK5A 3TP6A 5CV5A 2ENBA 3NP8A 3NQTA 1NSNS 1TR5A 5HURA 4PNYA 2PZWA 5IGCA 4ID6A 1STAA 3EJIA 4LAAA 1STYA 3RUZA 3SK4A 3SK6A 1JORA 1EYAA 1IHZA 2EY6A 5DEHA 4DF7A 2KQ3A 3TP5A 3SHLA 3E5SA 5K5PA 4MIUA 1SYDA 3V2TA 3SXHA 2F0VA 5IGBA 3VA5A 1EY4A 2HQEA 2OEOA 5M9OA 1EY9A 4N9TA 4K2LA 1U9RA 5IIFA 1KDCA 2WACA 3D6CA 1EY0A 5KIXA 4J1MA 1JOOA 4PMCA 2EYJA 4HMJA 1RKNA 2LKVA 4K8IA 4DU9A 4EQPA 5CGKA 5IGGA 4K5VA 5JAVA 2F0PA 3BDCA 1SNCA 4IZ8A 4KY7A 2EYPA 1STGA 1EY5A 1F2ZA 5IOCA 5KYLA 5E3FA 2OF1A 3QOJA 4ZUIA 4K5WA 5I6YA 2EYHA 2EYFA 5C4ZA 3NHHA 3MZ5A 1SNOA 4QMGA 2KHSA 5KYIA 2SNMA 4KV6A 4ME5A 3TP8A 5IGDA
chains in the Genus database with same CATH superfamily
3ND8A 2KCCA 2E75C 4KKTA 4A3GG 5M5YH 2NVXB 3S15H 1SSOA 4JI8Q 3NPPA 1SMYC 3S15B 2L11A 2B2TA 2I07B 1OXUA 3CQZB 4RCOA 5ELNA 1VQMA 5J22A 2R92B 3W3AA 5EBCA 3M4OB 4QIWE 1XMQL 3S1NB 2HUGA 5C5MA 5BN3A 5C3WA 2D9UA 2RDFA 3IRBA 4HCEA 4K14A 2F0KA 4HIOA 4FDBA 2PW7A 3L0OA 3FKIG 3CHBD 3K59A 4B3SL 5ELOA 1WYDA 4CKEA 1SNDA 3I4NH 4AYBE 4A75A 1Q7YC 4MHEA 4HJ9A 2EVBA 2B29A 4RWSC 1R9TB 2XTIA 5LL6X 1HZ9A 3C1EA 4YIJA 1HUMA 1CA5A 1DD2A 1HXYD 2PYKA 1GD7A 4DV2L 4A3MG 1H95A 3DLLA 2MGSA 4IPHA 1EQVA 4RGMA 4X3TA 3H0GH 4JI6L 4HMIA 1YNND 4OX9Q 3BDLA 2BDOA 1SLJA 5CV7A 4KKSA 3SR1A 1MKHA 3MXGA 3KDFB 4JPBW 4JBMA 3AU7A 3PO3G 3T16A 3VR2A 4EVOA 1N34Q 4IPDA 3VDYA 2BCOA 2RSNA 4LF9Q 3HG9A 3DM1A 4LUVA 4GNXA 4FP5D 5CMDA 1SE3A 3PUYA 1WTOA 1JORA 1BVSA 3SK6A 1K83B 5FLXE 4HIKA 1IHZA 1N36L 2F03A 2ID0A 1I94Q 3NE5B 1S5BD 1Y1VG 3T1HQ 1EOTA 1B53A 4YHHQ 1J9OA 4C3JH 2E5LQ 2EPBA 1G91A 1Z7TA 2KHIA 3FRPB 2I5LX 3UDXA 4A3FB 3GTMB 1SNCA 1VQNA 3I55A 1VQLA 1AH9A 1PH8A 2A6ED 2HQLA 4FO2A 2AHOB 1PTOD 4QJFA 2I46A 4HJ5A 4DAYB 3UDIA 1XTDA 5M3FG 1I4QA 3D4DA 3MC0B 1JC7A 2VQEL 2MPMA 1UE5A 4LF4Q 2F4IA 1STNA 1SYFA 4IFDI 1JQYD 2UXBQ 4R4OA 2I0QA 5JVH3 5JPNC 1YVCA 2WB1B 1PH2A 4LUOA 2EYOA 1BDOA 5KIXA 1R4PB 4A3JB 4L5TA 1XPUA 3RMHA 5FO7B 3I72A 2XRQD 2A68C 3NWTA 1ZEQX 5A2QE 1Q86C 4YCVA 1A62A 1KLGD 4OL7A 2B2WA 4ZQ3A 1EQTA 5NUCA 1XJVA 5FLMH 1S40A 1SMYD 1UE1A 4DAYA 3A5ZB 4K6DA 3S16B 4KJOA 1TY0A 4OELB 1ICWA 1EYGA 2VQFL 3CMEA 4DV4L 1NE3A 1BBWA 2SOBA 4A3CG 3E3XA 5IP7G 1IBKL 5D3IB 2F0HA 2JE6I 2F0LA 3TS0A 1G291 4DGZA 5I6WA 3KF8A 4DV6L 3J80c 2EY5A 2SNSA 4ZYSA 1HQMC 1PMRA 2CKZB 3U9SA 3BYYB 1JOQA 1BCPD 4I7ZC 5T1IA 5CV8A 4A3KG 1I4PA 4RKBA 1H9JA 4DK1A 1Y1VB 2K5HA 2ASBA 5IODA 1ML0D 5C4HA 1KDAA 2KOLA 3CAMA 2HCCA 5IT9E 3T1YQ 4KHVA 5C0XI 4QIWB 4OO1G 2ENBA 1K8AC 1O7ZA 3RLNA 4PNYA 1TWAH 1SEBD 2C5CA 3EJIA 4HR7B 4LF9L 3F2UA 5C0XJ 3KLSA 3SEBA 1AE2A 4OO1I 1MI2A 3IFDA 3R2IA 2EY6A 1XPRA 1LV9A 4Y7NB 1QUQB 4GOPB 2F0VA 3M85A 1KXLA 1I50B 1PFNA 2Q2IA 4JBWA 3OYYA 2Z4HA 2H1EA 4C3JB 1AE3A 2VL6A 2R61A 3K57A 3A54A 3OOCA 2QCPX 1AN8A 3I4NB 4DV0Q 2YTXA 1QWYA 3KLWA 4QY7A 3MZ5A 2E2IB 5A2QL 3S17H 1B7YB 1PDQA 1X3PA 2PI2A 3E6ZX 2J4XA 2JJQA 3FHWA 2NZ1D 3ND9A 4OWXB 1LTTD 1PRTD 4A3MB 2F0IA 1DOLA 2Q8RE 4HN7A 3HOVG 4ZCKA 2VUMH 2R7ZG 5C44H 3I4OA 1BOSA 3I7FA 5EBDA 2VUMB 3GTPB 3TEHB 1EYDA 3NTIA 2F1MA 1C48A 1N36Q 2XRSD 1K3RA 4QUFA 4F87A 3PV0A 1PH4A 1JOKA 1A3UA 5D3DA 5JVG3 4MTKA 4ZAIA 1CZGA 1B4OA 2JA7B 2E76C 3VR5A 3K5MA 1CSPA 2HHHL 1WD1A 2E2JH 2QEJC 1QCBD 4BA1I 3D4RA 1TQOA 3Q23A 1YIJA 2XIWA 3D4WA 3G6JB 3OTOL 3S16H 1YEZA 4EQ5A 2X6LA 5M5WB 1CTMA 4KHPL 3RNUA 2BOSA 2RHQB 4Y52H 3M4QA 2JA8B 2CW0C 1UNSA 4L8JA 1V9PA 1VQIA 3V05A 4JK1C 2RVLA 4WJ4A 1PTOF 4WORA 4BS9A 1KRSA 2EDGA 3CC4A 1KL9A 4NB3A 5LMNQ 2ZTEA 3NXWA 3K5OA 4QUCA 1HHVA 3SVMA 3J81L 1DOKA 3CCRA 1VS0A 2B8GA 2XSCA 4DNRB 4HTHA 4UP8A 4XDXA 4JI4L 3J7AF 1TR5A 1OO9B 3FPPA 2L1BA 3C46A 1ONLA 5DEHA 5C4XG 4DF7A 4DK0A 2AQ1B 3RLOA 3W2DA 4WJ3M 2R7ZB 1EUJA 3F8TA 1AZPA 3ZYYX 4K2LA 2R7ZH 1KDCA 1BCPC 4J1MA 1JOOA 5CGKA 3BVGA 4J8QA 2RCFA 3S14B 3TZUA 3IKJA 4APVA 5AJ3L 3LNNA 4A3BH 3MFGA 4K5WA 5I6YA 4KK7A 1SJED 2PMZB 4QMGA 1F9QA 5I4DA 5M3MH 2UU9Q 1PTOB 2B63B 2PZTA 3MEHA 3BZDB 1SNMA 2CWAA 1G6ZA 4FNFA 1SDFA 1QJOA 3GO5A 5C44B 1RF2D 4GKJQ 5GROA 2N88A 1YHQA 2AQ3B 4PV1C 2QA4A 4R1JA 1KDBA 2HIVA 1ILPA 4A93G 2KVMA 4QQBX 1JICA 1F9SA 1X3GA 2D5DA 1I6VC 3CRKC 4POGA 3M4YA 2VB2X 1VQ9A 4A3KB 1QVFA 3PO2H 1RIPA 1Q82C 1RDPD 1EQRA 2E2JB 1IKLA 1Z47A 2QEXA 1M8AA 4H44C 2CCZA 2A74C 3CU7A 4PMBA 3T53B 3HOZH 1PFSA 1SNPA 1B3AA 3QIAA 1X55A 1W2BA 1IYVA 4DK6C 4YY3L 1V1PB 1D1KA 1EOVA 3MAQA 3NWSA 1CSQA 1VQOA 2XN9C 1D2BA 5DM63 2K5NA 1W3SA 5EKLA 4MTNA 3H91A 1CKNB 4E6IA 1A2TA 5FLMG 4X3UA 3CCMA 1WD0A 1XNRL 3PIP3 1QVCA 1EU3A 4RCNA 2WAQG 2JK8A 1WTVA 1ILQA 3GTLH 4WJWA 4JI2L 2FFKB 2ZXPA 4A3MH 2IX3A 2JQOA 2L5TA 2QKIC 4F88A 1TWGB 2LFNA 1K28A 3TBIB 2Q2HA 4KI0A 5EAYA 1STAA 1YZ6A 3BZCA 2DNCA 1MD2D 3D3RA 1LTSD 2G9DA 3GTKH 4O42A 3G6EA 1LUZA 2WINB 3GDEA 3GTKB 3J81j 1SN8A 1EL0A 3Q22A 3RD4A 1LM0A 4FF2A 2NVTH 3N6RA 3FDTA 1EY5A 2FHTA 3HOXG 1WTWA 3GV3A 2JA5H 2JA6G 1HQRD 5IGDA 4JI0Q 1SNQA 1I3QH 1YNJC 3TRZA 3S2DH 3MXNA 1KABA 4CDFC 3OMCA 4B3ML 1Q8IA 2JSOA 3KF8B 3K7AH 4BXXG 3MEFA 5TSSA 1N33L 2R7FA 3R3OA 4JV5Q 2EY1A 4GOPA 1D6EC 3PCOB 3QWNA 2Y0SB 4BBRB 1B3QA 2ZJRA 1PYSB 1WI5A 2ZXOA 1C7YA 2NVXH 3SK8A 4A3DB 3W1GA 3T1YL 5KNDA 3C3LA 4C3IG 4GKKL 4DPGA 3AYHB 1PYWD 1GUTA 3EBEA 2KCNA 3OIQA 1OTCA 3L2PA 3CCEA 2F3VA 1S5ED 3EROA 3AMUA 3S2HB 2E2HH 3P1HA 4DV6Q 4FYDA 1G8ZD 5EKKA 1I6HH 5C4XB 4LFCQ 3H0GG 1ZYRC 4K6LA 2BDNA 2F0OA 3A8IE 3I4MH 1LO5D 3TQYA 3CCUA 1KD1C 2OT2A 2Z0SA 2E5LL 1E1OA 2I5HA 4GN3B 4H7BA 4YHHL 4YWMA 2EJGC 3C1FA 4DK3C 2D2CC 2H5XA 3TREA 4NMZA 1LACA 1RD9D 3TP6A 3K58A 1K9MC 1G2TA 4V190 3CMAA 2NVQH 5CBEE 1L1OA 3M9BA 1GO3E 1XPOA 4UPAA 2OWOA 2Z1CA 4G7OC 1WFQA 1XNRQ 4DR2L 5K36G 4JW0A 3VYRA 2BA0A 4CDEC 1GUGA 3I56A 2HD3A 1Q81C 3H3VH 1L1OB 2WACA 5A35A 5IGGA 4A3KH 3PO2B 1CT1D 3EIVA 1LABA 4FF4A 2JYOA 2F0PA 4JOIA 2EYPA 1F2LA 1F2ZA 3HOYG 2UUBQ 3QOJA 2B2YA 4JC0A 4IO9A 3GTJB 1GUNA 2KHSA 1IBLL 1BBUA 2JA7G 2PMZE 1IBMQ 4KMUC 3DUZA 3KDFA 3QB3A 1J5EQ 1P8LA 2Y0SG 2NVYH 4BBRG 3H3VI 3U58A 1LTID 1Y8NB 5ELDA 1LT6D 4FF3A 5IE8A 4JI1Q 1I5FA 3URYA 4DR7Q 1K8MA 1WTRA 3TP7A 3T1HL 2BA1A 3BYTB 1H9SB 2NZOA 1YITA 1LLRD 4RGTA 2F0NA 5LL6S 2JA6B 5IGEA 2XWJB 1VQPA 1XMQQ 3AB9A 4GLXA 4O2DA 2F3IA 2QDLA 4B9XA 3HKZE 1Q3LA 3AFQA 5IT9L 1JE5A 2LMCB 3NEMA 4PQXA 4EGVA 1HNXL 4OWTB 4JI8L 3CCLA 1N34L 1IKMA 4C3JG 4A3IG 3AEVA 1LTLA 2UXCQ 3HOZB 4IPCA 1K83H 4LNQA 2DY7A 1I4RA 4JVZA 1BCPB 2A6EC 1Y1WB 3RZOB 1XMOL 1STEA 3DXJC 1SYCA 4OX9L 5C3EH 4JI6Q 4IUVA 3HZXA 1HJPA 4GZYC 4I65A 5EQ0A 2K04A 3LWUA 4DV2Q 3GTOH 2Q8IB 1WCMB 4OHJA 5T1GA 4P71A 4B3TL 2RDHA 2EYMA 2QILA 1WCMH 3S2DB 5D65A 2L4NA 1QB5D 2EY2A 4A3EG 5JOBA 2L12A 2MP1A 5M5YB 4CJ0B 4NDXA 3SK5A 4J15A 1SE8A 1WTXA 5HURA 5IYCG 4X6AH 4UHVA 4LAAA 3SK4A 1VQBA 5M3FB 1VQ7A 4PZ8A 4LFBQ 3I8ZA 1SJHD 1A6XA 5BR8L 4BY1H 2DJFC 4MIUA 4NXNQ 3GQBA 2ZTDA 4KHZA 1K8GA 2G9HD 1U9RA 4IUTA 2EJFC 3DEOA 3K0YA 4K5VA 2IPKD 3NBHA 1STGA 2CH4W 2EYFA 2MO1A 4KHPQ 3ICEA 5EPJA 1N32L 3FKIH 2SNMA 1VF5C 3PF4A 1DM0B 4R8IA 2A5HA 3HOWB 1PZJD 4A93B 2EE1A 3OIPA 4A3LG 2Z9HA 4N8FA 4G4KA 2M2LA 4HEDA 3HOUG 5LMUL 4K2KA 3CRLC 2DN8A 2WB1G 1PVOA 1E2ZA 2RA4A 3V96A 4IOCA 4K0KL 1V1PA 4ZUJA 4DUZQ 5FLXc 4NXML 3K0XA 2F0FA 4EQNA 3W5OA 3JAME 4BY7H 2JA5G 3PUVA 2K03A 4AQYQ 1CKOA 2QF7A 4GLAC 3JAMi 2ZM6Q 2WV6D 1N8RC 2Q2TA 3MHBA 2PW5A 4B3RL 1OXVA 2F0TA 2PNRC 1UE6A 1Q1EA 2YYZA 1FJGL 2Z8LA 1EY7A 3WWVA 1Q8KA 1NR2A 2F0UA 4DR5Q 4LWCA 1U4RA 5H1SE 2VZAA 2Z4IA 3VR4A 3TN2A 5EGTA 2PQAB 3EQLC 3EFXD 3ULLA 3MTSA 4U68A 1HTLD 1S5DD 2DY8A 5COYA 5CV6A 4X64Q 3H15A 5JEAG 5IYDH 1U4PA 1AZQA 1HNZQ 4DR1L 3E0JA 1ZXTA 4DR5L 1E22A 1FNWA 2M9VA 1EWIA 5C44G 3WDNA 3OSOA 3CF5A 2MUYA 1F2YA 3K7AB 4AQYL 3G48A 2K52A 1Y1WG 2WKDA 2JA8G 1FGUA 3DWQA 3H94A 1HZBA 3K7UC 3BVZA 5E4XA 1PRTC 3IL8A 3STBC 1TWFH 5K5PA 4FXKC 2E2DC 3UDGA 1VQ5A 1DGSA 1EY9A 4N9TA 1CKMA 1EY0A 2BH8A 1TVXA 4R4IA 4R4TA 3KFUA 2B2VA 1V1OA 2IL8A 4ZKBB 1AP0A 5IYCH 2E8GA 4KLKA 4Q0FA 1X32A 2CWPA 1BUVT 1ET6A 2V1CC 4TRDA 1FR3A 2K50A 2R92G 5M5XB 3VA7A 2IHFA 1IYJB 4K8JA 4RH6A 5BN4A 1CHPD 4O0AA 4IPGA 3TMEA 4G57A 1HR0W 3H0GB 1YJ9A 2A68D 1PH6A 1PFBA 2CW0D 4CGYB 3TDQA 1A2UA 3JAML 5JJKA 2RKSA 1TWHB 2EYLA 4JI3L 5HGTA 1X3QA 1ESRA 3NQIA 1MSGA 4JI7Q 2K5VA 4DV3Q 3C2PA 1KLUD 3NBHB 1VCIA 1FVIA 3CD6A 4BXXH 4IFDJ 2C35B 2YTVA 4OEMB 1KHIA 4LFAL 4POFA 2WB1E 4B3TQ 2A6HC 2XGTA 2F0GA 1LTBD 3T56B 2KA7A 1B70B 4A3DG 4IOAA 4KD4A 4Y7NH 5CR3A 2IJ0A 4JI5Q 2F0WA 4JYAL 4PMWA 1P16A 1AEXA 4S3SA 1GUSA 1LTAD 2KUMA 2C9OA 1RHPA 1E3PA 1IL2A 2D0PA 5GQOA 1YJWA 2UXCL 1ASZA 5KNBA 1EIGA 2OCEA 1Z6HA 3FP9A 3K81C 4L5RC 4C1NI 2X69A 3ULJA 1GJXA 2B2UC 4HJ8A 2AWOA 5HY6A 2G5DA 2K5DA 1CQFA 4Z9CB 3KK7A 1LYLA 3LWEA 4BBSB 1VQ8A 2D0OA 3BVMA 1X6OA 2Y0SE 2AMCB 3KJOA 3PUZA 1PXUA 2KEEA 3SXHA 1UE7A 2HQEA 4M1UB 3QR8A 3U4VA 2MFIA 3M4PA 4L5SA 3CC2A 4PMCA 1ZKOA 1B2TA 1GM5A 2FMMA 5IOCA 2MO0A 1VQ6A 4JI5L 2PNHA 4HIMA 3NHHA 1PH7A 1PH1A 1CUKA 3J80E 3WOEA 5KNCA 4J6HA 2B2YC 4A3JG 1M1KC 3GTQH 1HTPA 1K0SA 1GHJA 1DONA 1K3BC 1SR3A 4XT3B 3OWFA 1TIID 1NUCA 3CW2C 3S1MH 1O7LA 2ZTCA 4YCUA 3PGZA 3HGBA 1E7ZA 2AUJD 5M5XH 1GKHA 4P75A 2N55A 2OTLA 2B63H 3CCJA 3J81i 4A3BG 3NK9A 2BE5D 4P74A 1NBWA 3S17B 1F9PA 4A4IA 4ME3A 1NMFA 3NTHA 4ULLA 5JJIA 4A76A 1PRTF 3NELA 4RMFA 2ZT9C 4QCLA 4DAPA 3E9HA 3DWPA 3NENA 1A3TA 2KENA 1O80A 4OIKA 2VS1A 1IXRA 2VW9A 1SXTA 5IP9H 4G7HC 2B2WC 1HA6A 1T9HA 1DCZA 2VY3A 5C5LA 2B2TC 4X66L 2UUAL 4I7AA 3RR5A 1S72A 1O7YA 1RL2A 4HAEA 3LX0A 1Y8PB 5C3EG 2KBNA 1FNUA 1UUPA 4GNXB 5EKIA 1LTGD 1NMGA 2FMCA 3D31A 4H0LC 5F2DA 3TS2A 4CBVA 1I4XA 1B50A 2ZJPA 1CKNA 1D5MC 4LF8Q 1N9WA 1F77A 4DV5Q 4LF5L 1Q90A 5ELBA 4A3IH 1UEAB 2NVYB 3ITPA 1MSHA 1XXGA 4ZKCB 5IYBG 4P72A 4ZRZA 5J1ZA 3I90A 3BU2A 1B8AA 3RZDB 1ICFB 1E2VA 1WVLA 1BQQT 3E5SA 3HKZG 1X9NA 2KECA 3GV6A 4DR1Q 1GOZA 3KF6B 2IW3A 2O5IC 2WFWA 2Z6KA 4YWKA 2R6GA 4A3DH 4KY7A 1AW7A 5KYLA 5E3FA 4RHSA 2CHBD 3F2BA 4A3EB 2NB0A 2HDMA 2K5WA 2DUDA 2JA7H 4RG1A 4GNXC 3SE0A 4FF1A 4UAIA 2N49A 5ELFA 4IUNA 4RGNA 4C3HB 1SFOB 5K36H 3N52A 1K73C 1F2MA 1PHJA 2DGYA 2BH2A 3S1RH 4AYBB 1FL0A 3S1MB 1PFMA 3Q0AA 3PIPA 2A69C 2B63G 5KEEA 4LF6L 4IFDG 1CHQD 2HCIA 3DM3A 2IWHA 3MXNB 2Z6KC 3CKIB 1X65A 3ERQA 3KLSX 4R4QA 2UXDL 4OONA 3CCSA 1TS5A 1WOCA 5E7NA 5C4JH 1S4ZA 1E0BA 3FMCA 3B6YA 5LMUQ 4F7XA 2WIIB 2CFMA 4BBSH 2R93B 5CC4A 1HPCA 4DNTB 5DM73 4H13C 1GHKA 2VB3X 1EIYB 4Q5VA 1CM9A 4X62L 1KAWA 5EPLA 4DR3L 3I4MG 4IUUA 1VQFA 1YNJD 2V4DA 3BDOA 1C8CA 3GTGB 2UUCQ 4C3IH 3FEWX 1KNEA 5JJZA 1VMPA 4OGQC 1SE4A 3SGIA 2ZM6L 1LT3D 1V8QA 4A3CH 3A5UA 3I70A 1JJCB 1YJNA 3NQTA 2JA8H 4OO1H 5M3MB 2PZWA 4N8X1 5FLXL 1YI2A 1SE2A 1HCZA 1NY4A 2XNAC 4AYBG 4LF8L 1V1QA 3VA5A 3H3VC 4K0KQ 2VNUD 1T5EA 4XYQA 3MA2B 2EYJA 5JAVA 2JP1A 4C3HG 1VF7A 5EPKA 1TU2B 2EQSA 1QVGA 1TWAB 3S1NH 2O2LD 1D1IA 1DXMA 1VQCA 3RN2A 3Q6SA 3HOWG 3TP8A 5CV9A 4IJHA 4LMQD 3CC7A 3STBD 4LF7L 2CQAA 1L2FA 5AJ3Q 2F0SA 3VR3A 3HOXB 1HNXQ 2KEDA 1XYIA 4GLVB 2O4XA 1YHBA 1SYEA 4DV7Q 1HRJA 2F4VL 5C0XG 4HSVA 1PTOH 4CDCC 1CI3M 5J39A 2JA5B 1K0RA 1S5FD 3PUWA 4JI4Q 3I73A 4R4CA 2GVBA 4DR6L 3S1QB 2RHSB 1IZ6A 3HOVH 3CCQA 3R93A 1QG7A 2QDBA 2Z6BA 5LMNL 2YU9B 4TQUS 1U4LA 2R93H 4DA2A 5D14A 3I2ZA 5GAHC 2A69D 2OTJA 3KUPA 4X3KA 1IBLQ 2AUKA 4F8MA 3PMFA 4GN5A 5FJ8H 2NWGA 5KRUA 2EIFA 3H6MA 3NBIA 1SBBB 1A3VA 4CKBA 4XQNA 1GUWA 1VQGA 4WRDA 2K28A 5L37A 2PO4A 1EIFA 4IUPA 3A56A 1J8IA 4X65Q 3HOZG 2A6HD 1FD7D 3NTKA 1TKWB 2B2VC 4A3IB 1II3A 2K7VA 5LMNW 4JCVE 2KJXA 3TSSA 1A15A 3EN2A 5CV5A 2SEBD 4ALPA 1JMCA 1E2WA 3MXUA 1I3QB 2R3ZA 4RHRA 1RTOA 1TWCH 2RCNA 1NJIC 2E2IH 5IYDG 4MN3A 3GP7A 3TP5A 4HCSA 3G4SA 2N78A 2OEOA 3M3YH 1AFPA 1TWHH 1CA6A 4JI1L 2GN5A 2QW7A 1PLFA 4DKAC 1BKBA 3G7LA 4UY8C 4IZ8A 4JYAQ 3RN5A 2MQHA 1J5EL 4LFCL 4ZUIA 2NVQB 2JEBI 4B08A 2EYHA 4IN3A 4KV6A 4MNOA 3QO2A 2XWBB 1U5KA 4ODGA 1NTGA 2JN4A 1SFOH 3HOYB 2OQKA 4IQZA 2HDLA 3AFPA 4DV1Q 2L9HA 1BCPF 3S1RB 4RKLA 4JI7L 2WAQE 4QL5A 5CYUA 5I9OA 4DR6Q 4JI3Q 4B9WA 4CDDC 3P20A 1X3EA 2TSSA 1I4HA 3DMUA 1M90C 3H09A 1JWMD 5GAGC 3GTOB 3I91A 4MZ9A 1KTKA 3MFYA 1BR9A 4K5XA 2VXWA 2XVSA 5M5WH 5IP7H 1V43A 2EXZA 4A3FG 4NW2A 4A3FH 4NPSA 3GTMH 2DJGC 3K80C 2RF4A 2NTTA 2F0QA 2K33A 3S9WA 1N33Q 2K6AA 4N9PA 1SYBA 1QNUA 4IURA 2Q2UA 1TY2A 2B2UA 4LF7Q 3UI2A 5EJWA 4XTCS 4KD3A 2X6GA 2L0CA 5IP9G 5IGFA 3ONAB 2BE5C 3QG1A 4BY1B 2HIXA 1TWFB 3F2DA 5ELCA 2F0EA 2IHEA 5E1FA 3U4ZA 2NZHA 2ALYB 3OMGA 1IW7C 4TVAB 4C56C 1HZAA 4HSPA 4UP9A 1C0AA 4YCWA 3CQZH 4XQJA 3MXPA 4A3LH 3LGJA 1BNZA 3CPFA 2DNEA 4OXPA 3J7A5 4LFAQ 4ZLTF 4EQOA 4GKKQ 1I6HB 4A93H 1TT2A 3KBXA 3GTJH 4FXGC 3CP0A 2RQXA 4ID6A 1LTRD 2FINB 3PUXA 1R9TH 4BY1G 3PF5A 1RJTA 3V2TA 5IGBA 3J7YW 4GOPC 2UUCL 1HNZL 5FK9C 1W6KA 2CQOA 4EQPA 2K05A 2OQ0A 4B3MQ 2PQAA 4X64L 1WTPA 4OWWB 4LF4L 4IFDH 1S5CD 4KN7C 1HFGA 3HOVB 1MHWC 4JI0L 4HIDA 3PSIA 4X62Q 3KBGA 1JWSD 4YY3Q 1JB3A 5ELEA 4BWGB 2D62A 3A8JE 4A3JH 1FJGQ 3O13A 4QF4A 3J80i 3P75A 5BN5A 1RODA 4C2MB 2K14A 4B3RQ 2JXMB 2IX0A 3VYUA 3Q24A 4C2MH 1EWCA 4DUYL 1I94L 3T13A 3QOLA 1HZCA 3JC66 3GTQB 1MGSA 3HOWH 1A8VA 4XIGS 4L5QA 4BY7G 1LT4D 4DUYQ 4KKUA 1G6PA 4GKJL 2F52A 4KY5A 1EEFD 2MJ8A 4TSSA 1VQHA 3ER0A 4HJAA 2K4KA 3U9OA 2YU9H 5IYBH 1TS3A 1O78A 1L0WA 1DYQA 1IL8A 1L1OC 4DFAA 1N32Q 1C4QA 3W1BA 1WTHA 2B8FA 5CV4A 1PTOC 4DR3Q 4DXGA 2CVRA 3F1ZA 2F3WA 1JJ2A 4JBKA 1PZID 2YTYA 1UEBA 2PZUA 3KLRA 1KC8C 2LXJA 2SDFA 4CJ1B 3PQIA 1MBYA 3M7GA 2J7ZA 1GXDC 3ZJYC 3HKZB 2Q8TA 4H02A 1VQJA 3T51B 5BR8Q 3DEPA 4FXDA 4C3HH 3A55A 4LFBL 5JJLA 1OXTA 5CORA 3NSWA 1BXTA 3PIOA 5G3LD 2FXQA 2CH4A 4PG3A 4RGOS 4DXFA 1NR4A 3BS1A 2F0MA 2NYZD 1PH3A 3HOYH 1KNAA 4B3SQ 5CBAE 3NP8A 4A3BB 4JG2A 1EFWA 5IGCA 3HS0C 1ET9A 4LK1C 1PYBA 1STYA 2K75A 3OW2A 1MJEA 2GVAA 5FO9B 1EYAA 1IW7D 4NXMQ 4IJLA 4DUZL 2JA9A 1H9SA 4LF6Q 1Z9FA 1SYDA 1EIHA 1D8LA 3T4AC 1EU4A 4AH6A 1QZHA 3HOUH 1TS4A 2A1AA 1WCMG 3K5LA 4OIJA 4DN4M 5C4JB 1RKNA 1E24A 1SAPA 3UE1A 2PCFB 2NN6I 1JCKB 2A8VA 3Q8DA 1Q12A 2NBFA 1SNOA 4BY7B 4ME5A 5M3FH 3KJPA 2UUAQ 2L55A 4PZ6A 1ENCA 3UDFA 2IY5B 1XNQL 4G7ZC 4R8NA 4C1NK 2KHJA 5DNFA 4O1NA 1W6JA 2ES2A 1GUOA 2HHHQ 3X3NA 1HA5A 2LSSA 4IUQA 5C0XH 2WP8J 3ERSX 1JJGA 1YNNC 4WFN3 5KGUA 2NUCA 3S14H 1KIXA 1EYCA 1MIUA 3J81E 4DR7L 3JAMc 1PRTB 2EZVA 2M00A 4DV1L 3D6WA 1TXYA 4P73A 4KN4C 1TS2A 2A19A 1TWCB 4QB4A 3A7LA 5FOBB 1BF4A 1STBA 2R93G 1VMCA 5IY0A 1DZ1A 4XYOA 1IBML 1HNWQ 1Q46A 3FVQA 4UP7A 1LT5D 2E74C 1SYGA 1TWGH 3BJUA 4L63B 1FYCA 1RTNA 2TMPA 5C6AA 1SROA 4IALA 3J7AV 1H9MA 2EXDA 5JEAH 1QE6A 3HP3A 4A3GH 1FGBD 1NCVA 3OTOQ 3E9IA 2WKCA 1QUQA 3IFTA 4DR2Q 4DAVA 1X56A 2A73B 5GAEC 1S3OA 1C9OA 1PZKD 3HOXH 1B44D 1NSNS 3GTGH 2PI2E 3RUZA 3I4MB 5DLQE 1BBXC 3FKIB 2RDGA 3VYSA 2KQ3A 3SHLA 4X65L 1YHAA 5IWAQ 1XX8A 4JOIC 1O7IA 1YNXA 3A7AB 1WTQA 3R8BA 3S1QH 4HMJA 2LKVA 4JBJA 1KRTA 3DWAA 4RFBA 4LJZC 2K1BA 4DR4L 3RLFA 3EA6A 2R7DA 4U673 2K32A 3ULPA 2OF1A 1IBKQ 3AQQA 4V0BA 1CQVA 4X3SA 1MJCA 4QGUA 3P7JA 4DV4Q 4GS3A 3BZKA 1STHA 1X54A 2UUBL 3HRZC 3PO2G 4DV0L 1L0XB 2YV5A 3CXCA 5C3XA 1Y1VH 3VR6A 4CJ2C 1DJRD 2RBMA 1HR0Q 5JEAJ 5I9PA 4LUZA 1ENAA 2ZXRA 5E4WC 4DV3L 1M4VA 3A74A 3G71A 4C3IB 3KF6A 2H4OA 3MWYW 4GN4B 1J6QA 1EZ6A 1Y8OB 3S2HH 2NTSA 4HJ7A 1FNVA 3MVVA 1Y1WH 2F4VQ 4DV7L 1B9NA 1T5XD 3OPOA 1I50H 5C3EB 1D5XC 3E0EA 4ILWA 1JE4A 3FPUB 4YWLA 2EOTA 1XTCD 2VUMG 1SMXA 2F0DA 2HT1A 1EEID 4ZK9B 1CZWA 1KAAA 3M7NA 2VQEQ 3RZDH 1D5ZC 1A0IA 3I3CA 3U50C 3M3YB 1EFID 1UWVA 4AIMA 2KCMA 3DHQA 2AWNA 3KYHC 1H9KA 3X3MA 1IYUA 2JA6H 2K01A 1A63A 1CFMA 3TZDA 3L7ZC 3L3OC 3GTPH 3J81c 3HFZB 1EWHA 4L6TB 2IX1A 3M4OH 1JT8A 3HEJA 2VQFQ 3I4NG 2NN6H 4A3GB 3GD7A 1JB7A 1G51A 4UDUC 1EY6A 1NNXA 1PV4A 4P2CB 1HFNA 1JWUD 2LS01 1VQKA 1D7QA 2O5JC 3QJYA 1SRUA 3S24A 3CPWA 4PZ7A 2F0JA 4NKLA 1I4GA 1F9RA 5JPMC 1B9MA 2B3GA 1QOHA 4ABNA 1ENFA 1Q1BA 2LY7A 1RCVD 2KCTA 3D0FA 3K8AA 4JV5L 1UAPA 1EY4A 4CHTB 3HOUB 2UXBL 5AFWA 3D6CA 2JEAI 4DU9A 1HR0L 3CCVA 2PPBC 5C4ZA 5J3BA 4EX5A 4XQQA 5FKAC 1U4MA 2LXKA 2MHVA 1KQSA 5G3LF 1PA6A 1QILA 4BBRH 1EZ8A 1NAPA 3J80L 5FO8B 2PQEA 2OXPA 4DR4Q 2EJMA 3A8KE 3GTLB 3EVQA 3OWEB 1QZGA 4R9WA 2R92H 4NP5A 1L0YB 1PH5A 4RAUC 1U0LA 5IWAL 3J7ZC 1EY8A 2B39A 3HKSA 2ICEC 5I2XA 2P5ZX 2UXDQ 3NUCA 2QGQA 3RZOH 1R4QB 2NVTB 1DOMA 1H9RA 3WOFA 5IT9c 4KY6A 4RA8A 1X3FA 4BA2I 4DNIA 3D8GA 3OW7A 2WAQB 2NN6G 3VYTA 4JI2Q 4DAMA 3BG3A 1WJJA 5ISRA 3F2CA 1VQAA 3L9AX 3PIO3 4TKOB 2UU9L 3K6OA 4KJNA 2MNAA 4XXEA 2AKWB 2N3SA 3A0JA 4LW1A 1CK1A 5FJ8G 2RSOA 5M3MG 3OHXC 5DAUA 1YBYA 1HNWL 4KTAA 2ICIA 3I4LA 1VQ4A 1EQQA 1VDZA 2N8NA 3SDZA 4NXNL 1K8OA 4BBSG 1G2SA 5HGQA 2J0TD 1ESFA 2I5MX 3K5NA 3KOJA 1E1TA 4A3EH 3IAYA 2AQ2B 4CKCA 1PH9A 1HUNA 1OXXK 4M8AA 1BO0A 5GADC 4XT1B 1QNKA 5LHY1 2E2HB 1VQDA 1HH2P 1Y14B 5C4XH 1B1ZA 4DV5L 4LF5Q 3R2TA 1JR0D 2ZJQA 2K5QA 4FVMA 3PO3H 5M9OA 3UE0A 1Y69U 5IIFA 2L15A 1VQEA 3PO3B 2IT1A 4K8IA 1GVPA 2ATWA 3BDCA 1XNQQ 2FJ2A 1XMOQ 2GA4B 1OXSC 5I2YA 5KYIA 1ZYRD 1XWEA 4X66Q 1ASYA
chains in the Genus database with same CATH topology
3ND8A 2KCCA 2E75C 4KKTA 2NVXB 1SSOA 3NPPA 1SMYC 3S15B 2L11A 2B2TA 2I07B 1OXUA 3CQZB 4RCOA 5J22A 2R92B 3W3AA 5EBCA 3M4OB 3S1NB 2HUGA 5C5MA 5BN3A 5C3WA 2D9UA 2RDFA 4HCEA 4K14A 2F0KA 2PW7A 3CHBD 3K59A 4CKEA 1SNDA 4MHEA 2EVBA 4RWSC 1R9TB 5LL6X 3C1EA 4YIJA 1HUMA 1CA5A 1DD2A 1HXYD 2PYKA 2MGSA 1EQVA 4RGMA 4X3TA 4HMIA 1YNND 3BDLA 2BDOA 5CV7A 4KKSA 3SR1A 3MXGA 3AU7A 3T16A 3VR2A 4EVOA 2BCOA 2RSNA 3HG9A 3DM1A 4FP5D 5CMDA 1SE3A 3PUYA 1WTOA 1JORA 3SK6A 1K83B 5FLXE 1IHZA 2F03A 2ID0A 3NE5B 1S5BD 1EOTA 1B53A 1J9OA 2EPBA 1G91A 1Z7TA 3FRPB 4A3FB 3GTMB 1SNCA 2A6ED 4FO2A 1PTOD 2I46A 1I4QA 3D4DA 3MC0B 1JC7A 2MPMA 2F4IA 1STNA 1SYFA 4IFDI 1JQYD 5JVH3 5JPNC 2WB1B 2EYOA 1BDOA 5KIXA 1R4PB 4A3JB 3RMHA 5FO7B 3I72A 2XRQD 2A68C 3NWTA 1ZEQX 5A2QE 1KLGD 4OL7A 2B2WA 4ZQ3A 1EQTA 5NUCA 1SMYD 4DAYA 3S16B 4K6DA 4KJOA 1TY0A 1ICWA 2SOBA 5D3IB 2F0HA 2JE6I 2F0LA 1G291 4DGZA 5I6WA 3KF8A 2EY5A 2SNSA 4ZYSA 1HQMC 1PMRA 3U9SA 3BYYB 1JOQA 1BCPD 4I7ZC 5T1IA 5CV8A 1I4PA 4RKBA 1H9JA 4DK1A 1Y1VB 5IODA 1ML0D 5C4HA 1KDAA 2KOLA 2HCCA 5IT9E 4KHVA 5C0XI 4QIWB 4OO1G 2ENBA 1O7ZA 4PNYA 1SEBD 2C5CA 3EJIA 4HR7B 3F2UA 5C0XJ 3KLSA 3SEBA 4OO1I 1MI2A 3IFDA 3R2IA 2EY6A 1LV9A 4Y7NB 2F0VA 3M85A 1I50B 1PFNA 4JBWA 2Z4HA 2H1EA 4C3JB 2R61A 3K57A 3A54A 3I4NB 2QCPX 1AN8A 3OOCA 1QWYA 3MZ5A 2E2IB 5A2QL 1PDQA 1X3PA 3E6ZX 2J4XA 2NZ1D 3ND9A 1LTTD 1PRTD 4A3MB 2F0IA 1DOLA 2Q8RE 4HN7A 1BOSA 5EBDA 2VUMB 3GTPB 1EYDA 3NTIA 2F1MA 1C48A 2XRSD 4QUFA 4F87A 3PV0A 1JOKA 1A3UA 5D3DA 5JVG3 4ZAIA 1CZGA 1B4OA 2JA7B 2E76C 3VR5A 3K5MA 1WD1A 2QEJC 1QCBD 4BA1I 3D4RA 1TQOA 3Q23A 2XIWA 3D4WA 3G6JB 2X6LA 5M5WB 1CTMA 2BOSA 2JA8B 2CW0C 1UNSA 4L8JA 3V05A 4JK1C 2RVLA 1PTOF 4WORA 4BS9A 2EDGA 3NXWA 3K5OA 4QUCA 1HHVA 3SVMA 3J81L 1DOKA 2B8GA 2XSCA 4DNRB 4HTHA 4XDXA 3J7AF 1TR5A 1OO9B 3FPPA 2L1BA 3C46A 1ONLA 5DEHA 4DF7A 4DK0A 2AQ1B 3W2DA 2R7ZB 1AZPA 3ZYYX 4K2LA 1KDCA 1BCPC 4J1MA 1JOOA 5CGKA 3BVGA 4J8QA 3S14B 3TZUA 3IKJA 3LNNA 5I6YA 3MFGA 4K5WA 4KK7A 1SJED 2PMZB 4QMGA 1F9QA 5I4DA 1PTOB 2B63B 2PZTA 3MEHA 3BZDB 1SNMA 1G6ZA 4FNFA 1SDFA 5C44B 1QJOA 3GO5A 1RF2D 2N88A 2AQ3B 4PV1C 1KDBA 1ILPA 2KVMA 1JICA 1F9SA 2D5DA 1I6VC 3CRKC 3M4YA 2VB2X 4A3KB 1RDPD 2E2JB 1IKLA 1Z47A 1M8AA 4H44C 2A74C 3CU7A 4PMBA 3T53B 1SNPA 1B3AA 3QIAA 1IYVA 1V1PB 1D1KA 3MAQA 3NWSA 2XN9C 1D2BA 5DM63 5EKLA 3H91A 4E6IA 1A2TA 4X3UA 1WD0A 3PIP3 4RCNA 1EU3A 1WTVA 1ILQA 4WJWA 2FFKB 2ZXPA 2IX3A 2L5TA 2QKIC 4F88A 1TWGB 2LFNA 3TBIB 4KI0A 1STAA 2DNCA 1MD2D 3D3RA 1LTSD 2G9DA 4O42A 2WINB 3GTKB 1EL0A 3Q22A 3RD4A 4FF2A 3N6RA 3FDTA 1EY5A 2FHTA 1WTWA 3GV3A 5IGDA 1HQRD 1SNQA 1YNJC 3MXNA 1KABA 3OMCA 1Q8IA 2JSOA 5TSSA 3R3OA 2EY1A 1D6EC 3QWNA 2Y0SB 4BBRB 2ZXOA 3SK8A 4A3DB 5KNDA 3C3LA 4C3IG 1PYWD 1GUTA 3OIQA 2KCNA 2F3VA 1S5ED 3EROA 3AMUA 3S2HB 3P1HA 4FYDA 1G8ZD 5EKKA 5C4XB 4K6LA 1ZYRC 2BDNA 2F0OA 3A8IE 1LO5D 2OT2A 4H7BA 2EJGC 3C1FA 2D2CC 4NMZA 1LACA 1RD9D 3TP6A 3K58A 1G2TA 4V190 5CBEE 2Z1CA 4G7OC 5K36G 3VYRA 2BA0A 1GUGA 2WACA 5A35A 5IGGA 3PO2B 1CT1D 4FF4A 1LABA 2JYOA 2F0PA 2EYPA 1F2LA 1F2ZA 3QOJA 2B2YA 3GTJB 1GUNA 2KHSA 4KMUC 3DUZA 3QB3A 1LTID 1Y8NB 5ELDA 1LT6D 4FF3A 3URYA 1K8MA 1WTRA 3TP7A 2BA1A 3BYTB 1H9SB 1LLRD 4RGTA 2F0NA 5LL6S 2JA6B 5IGEA 2XWJB 3AB9A 4B9XA 1Q3LA 5IT9L 2LMCB 4PQXA 4EGVA 1IKMA 4C3JG 3HOZB 2DY7A 1I4RA 1BCPB 2A6EC 1Y1WB 3RZOB 1STEA 3DXJC 1SYCA 4IUVA 3HZXA 4GZYC 4I65A 5EQ0A 2K04A 3LWUA 2Q8IB 1WCMB 4OHJA 5T1GA 2RDHA 2EYMA 2QILA 3S2DB 5D65A 2L4NA 1QB5D 2EY2A 5JOBA 2L12A 2MP1A 5M5YB 4CJ0B 4NDXA 3SK5A 1WTXA 5HURA 4LAAA 3SK4A 5M3FB 3I8ZA 1SJHD 1A6XA 4MIUA 3GQBA 4KHZA 2G9HD 1U9RA 4IUTA 2EJFC 3DEOA 3K0YA 2IPKD 4K5VA 3NBHA 1STGA 2EYFA 5EPJA 2SNMA 1VF5C 1DM0B 4R8IA 2A5HA 3HOWB 1PZJD 4A93B 2EE1A 3OIPA 4G4KA 2M2LA 4HEDA 4K2KA 3CRLC 2DN8A 1E2ZA 2RA4A 3V96A 1V1PA 4ZUJA 2F0FA 4EQNA 3JAME 3PUVA 2K03A 2QF7A 2WV6D 3MHBA 2PW5A 1OXVA 2F0TA 2PNRC 1Q1EA 2YYZA 2Z8LA 1EY7A 1NR2A 2F0UA 1U4RA 2Z4IA 3VR4A 3TN2A 5EGTA 3EQLC 3EFXD 3MTSA 4U68A 1HTLD 1S5DD 2DY8A 5COYA 5CV6A 5JEAG 1U4PA 1AZQA 3E0JA 1ZXTA 1FNWA 2M9VA 3WDNA 3OSOA 2MUYA 1F2YA 3K7AB 2WKDA 3DWQA 3H94A 3BVZA 5E4XA 1PRTC 3IL8A 5K5PA 4FXKC 2E2DC 1EY9A 4N9TA 1EY0A 1TVXA 2B2VA 1V1OA 2IL8A 4ZKBB 1AP0A 4Q0FA 1X32A 1BUVT 1ET6A 4TRDA 1FR3A 5M5XB 3VA7A 4K8JA 4RH6A 5BN4A 1CHPD 3TMEA 4G57A 3H0GB 2A68D 1PFBA 2CW0D 4CGYB 3TDQA 3JAML 1A2UA 2RKSA 1TWHB 2EYLA 5HGTA 1X3QA 1ESRA 3NQIA 1MSGA 3C2PA 1KLUD 1VCIA 4IFDJ 2A6HC 2F0GA 1LTBD 3T56B 2KA7A 4KD4A 5CR3A 2IJ0A 2F0WA 4PMWA 4S3SA 1AEXA 1GUSA 1LTAD 2KUMA 2C9OA 1RHPA 5KNBA 1EIGA 1Z6HA 4C1NI 2X69A 1GJXA 2B2UC 2AWOA 2K5DA 1CQFA 4Z9CB 3KK7A 3LWEA 4BBSB 3BVMA 3PUZA 1PXUA 2KEEA 3SXHA 2HQEA 4M1UB 4PMCA 1ZKOA 1B2TA 2FMMA 5IOCA 3NHHA 3J80E 3WOEA 5KNCA 4J6HA 2B2YC 1HTPA 1GHJA 1DONA 4XT3B 3OWFA 1TIID 1NUCA 1O7LA 3HGBA 2AUJD 2N55A 3NK9A 2BE5D 3S17B 1F9PA 3NTHA 4ULLA 1PRTF 2ZT9C 4QCLA 4DAPA 3DWPA 1A3TA 1O80A 4OIKA 1SXTA 4G7HC 2B2WC 1HA6A 1DCZA 5C5LA 2B2TC 1O7YA 4HAEA 3LX0A 1Y8PB 1FNUA 1UUPA 5EKIA 1LTGD 2FMCA 3D31A 4H0LC 5F2DA 4CBVA 1I4XA 1B50A 1D5MC 1F77A 1Q90A 5ELBA 1UEAB 2NVYB 3ITPA 1MSHA 1XXGA 4ZKCB 4ZRZA 5J1ZA 3I90A 3RZDB 1E2VA 1WVLA 1BQQT 3E5SA 2KECA 3GV6A 1GOZA 2IW3A 2O5IC 2R6GA 4KY7A 1AW7A 5KYLA 5E3FA 4RHSA 2CHBD 4A3EB 2NB0A 2HDMA 2K5WA 3SE0A 4FF1A 4UAIA 5ELFA 4IUNA 4RGNA 4C3HB 1SFOB 5K36H 3N52A 1F2MA 4AYBB 3S1MB 1PFMA 3Q0AA 2A69C 5KEEA 4IFDG 1CHQD 2HCIA 2IWHA 3CKIB 3ERQA 3KLSX 1TS5A 1S4ZA 1E0BA 3FMCA 4F7XA 2WIIB 2R93B 5CC4A 1HPCA 4DNTB 5DM73 4H13C 1GHKA 2VB3X 4Q5VA 1CM9A 5EPLA 4IUUA 1YNJD 2V4DA 3BDOA 1C8CA 3GTGB 3FEWX 1KNEA 5JJZA 1VMPA 4OGQC 1SE4A 1LT3D 1V8QA 3I70A 3NQTA 4OO1H 5M3MB 2PZWA 5FLXL 1SE2A 1HCZA 2XNAC 3VA5A 3H3VC 2VNUD 1T5EA 4XYQA 3MA2B 2EYJA 5JAVA 2JP1A 4C3HG 1VF7A 5EPKA 1TU2B 1TWAB 2O2LD 1D1IA 1DXMA 3Q6SA 3TP8A 5CV9A 4LMQD 2CQAA 2F0SA 3VR3A 3HOXB 2KEDA 1XYIA 2O4XA 1SYEA 1HRJA 5C0XG 4HSVA 1PTOH 2JA5B 1CI3M 5J39A 1S5FD 3PUWA 3I73A 3S1QB 3R93A 1QG7A 2QDBA 2YU9B 4TQUS 1U4LA 4DA2A 5D14A 2A69D 3KUPA 4X3KA 2AUKA 4F8MA 3PMFA 2NWGA 5KRUA 3NBIA 3H6MA 1SBBB 1A3VA 4XQNA 4CKBA 1GUWA 4WRDA 2K28A 2PO4A 4IUPA 3A56A 1J8IA 2A6HD 1FD7D 3NTKA 1TKWB 2B2VC 4A3IB 1II3A 2K7VA 2KJXA 3TSSA 1A15A 5CV5A 2SEBD 1E2WA 3MXUA 1I3QB 2R3ZA 4RHRA 1RTOA 4MN3A 3GP7A 3TP5A 4HCSA 2OEOA 1AFPA 1CA6A 1PLFA 3G7LA 4IZ8A 4ZUIA 2NVQB 2JEBI 4B08A 2EYHA 4IN3A 4KV6A 3QO2A 2XWBB 4ODGA 3HOYB 4IQZA 2HDLA 2L9HA 1BCPF 3S1RB 4RKLA 5CYUA 5I9OA 4B9WA 3P20A 2TSSA 1I4HA 3DMUA 3H09A 1JWMD 3GTOB 3I91A 1KTKA 3MFYA 1BR9A 4K5XA 2VXWA 2XVSA 1V43A 2EXZA 4NW2A 2NTTA 2F0QA 2K33A 3S9WA 2K6AA 4N9PA 1SYBA 1QNUA 4IURA 1TY2A 2B2UA 3UI2A 5EJWA 4XTCS 4KD3A 2X6GA 2L0CA 5IGFA 3ONAB 2BE5C 3QG1A 4BY1B 1TWFB 5ELCA 2F0EA 5E1FA 3OMGA 1IW7C 4C56C 4HSPA 4XQJA 3MXPA 1BNZA 2DNEA 4ZLTF 4EQOA 1I6HB 1TT2A 3KBXA 4FXGC 2RQXA 4ID6A 1LTRD 2FINB 3PUXA 1RJTA 3V2TA 5IGBA 3J7YW 5FK9C 1W6KA 4EQPA 2K05A 1WTPA 4IFDH 1S5CD 4KN7C 1HFGA 3HOVB 3KBGA 1JWSD 1JB3A 5ELEA 4BWGB 2D62A 3A8JE 3O13A 4QF4A 3P75A 5BN5A 1RODA 4C2MB 2JXMB 2IX0A 3VYUA 3Q24A 1EWCA 3T13A 3QOLA 3GTQB 1MGSA 4XIGS 1LT4D 4KKUA 4KY5A 1EEFD 2MJ8A 4TSSA 3U9OA 1TS3A 1O78A 1DYQA 1IL8A 4DFAA 1C4QA 2B8FA 5CV4A 1PTOC 4DXGA 2CVRA 2F3WA 1PZID 2PZUA 3KLRA 2SDFA 4CJ1B 1MBYA 3M7GA 2J7ZA 1GXDC 3HKZB 2Q8TA 3T51B 3DEPA 4FXDA 3A55A 1OXTA 5CORA 3NSWA 1BXTA 5G3LD 4DXFA 4RGOS 1NR4A 3BS1A 2F0MA 2NYZD 1KNAA 5CBAE 3NP8A 4A3BB 5IGCA 3HS0C 1ET9A 4LK1C 1STYA 5FO9B 1EYAA 1IW7D 1H9SA 1SYDA 1EIHA 3T4AC 1EU4A 1TS4A 3K5LA 4OIJA 4DN4M 5C4JB 1RKNA 1SAPA 2PCFB 2NN6I 1JCKB 1Q12A 2NBFA 1SNOA 4BY7B 4ME5A 2L55A 1ENCA 4G7ZC 4R8NA 4C1NK 5DNFA 4O1NA 1W6JA 1GUOA 3X3NA 1HA5A 4IUQA 5C0XH 2WP8J 1YNNC 4WFN3 5KGUA 2NUCA 1EYCA 3J81E 1PRTB 2EZVA 2M00A 3D6WA 4KN4C 1TS2A 1TWCB 4QB4A 3A7LA 5FOBB 1BF4A 1STBA 1VMCA 1DZ1A 4XYOA 3FVQA 1LT5D 2E74C 1SYGA 4L63B 1FYCA 1RTNA 2TMPA 5C6AA 4IALA 3J7AV 1H9MA 5JEAH 1QE6A 3HP3A 1FGBD 1NCVA 2WKCA 3IFTA 4DAVA 2A73B 1PZKD 1B44D 1NSNS 3RUZA 3I4MB 1BBXC 3FKIB 3VYSA 2RDGA 2KQ3A 3SHLA 1XX8A 3A7AB 1WTQA 3R8BA 4HMJA 2LKVA 3DWAA 4RFBA 4LJZC 2K1BA 3RLFA 3EA6A 4U673 2K32A 2OF1A 4V0BA 1CQVA 4X3SA 3P7JA 1STHA 3HRZC 1L0XB 5C3XA 3VR6A 4CJ2C 1DJRD 2RBMA 5JEAJ 5I9PA 1ENAA 2ZXRA 5E4WC 1M4VA 4C3IB 2H4OA 3MWYW 1EZ6A 1Y8OB 2NTSA 1FNVA 3MVVA 1B9NA 1T5XD 3OPOA 5C3EB 1D5XC 4ILWA 1JE4A 3FPUB 2EOTA 1XTCD 2F0DA 1EEID 4ZK9B 1CZWA 1KAAA 3M7NA 1D5ZC 3I3CA 3M3YB 1EFID 3DHQA 2AWNA 1H9KA 3X3MA 1IYUA 2K01A 1CFMA 3TZDA 3L7ZC 3L3OC 2IX1A 4L6TB 1EWHA 3HEJA 2NN6H 4A3GB 3GD7A 4UDUC 1EY6A 1HFNA 4P2CB 1JWUD 2LS01 2O5JC 3QJYA 2F0JA 4NKLA 1I4GA 1F9RA 5JPMC 1B9MA 1QOHA 4ABNA 1ENFA 1Q1BA 2LY7A 1RCVD 1UAPA 1EY4A 4CHTB 3HOUB 5AFWA 3D6CA 2JEAI 4DU9A 2PPBC 5C4ZA 4XQQA 5FKAC 1U4MA 2MHVA 5G3LF 1QILA 1EZ8A 1NAPA 3J80L 5FO8B 2PQEA 2OXPA 2EJMA 3A8KE 3GTLB 3EVQA 3OWEB 4R9WA 4NP5A 1L0YB 4RAUC 1EY8A 2B39A 2ICEC 5I2XA 3NUCA 1R4QB 2NVTB 1DOMA 1H9RA 3WOFA 4KY6A 4RA8A 4BA2I 3D8GA 3OW7A 2WAQB 2NN6G 3VYTA 3BG3A 5ISRA 3L9AX 3PIO3 4TKOB 3K6OA 4KJNA 4XXEA 1CK1A 2RSOA 3OHXC 5DAUA 4KTAA 2ICIA 3I4LA 1VDZA 3SDZA 1K8OA 1G2SA 2J0TD 1ESFA 3K5NA 3IAYA 2AQ2B 4CKCA 1HUNA 1OXXK 4M8AA 1BO0A 4XT1B 1QNKA 5LHY1 2E2HB 1B1ZA 3R2TA 1JR0D 2K5QA 4FVMA 5M9OA 1Y69U 5IIFA 3PO3B 2IT1A 4K8IA 3BDCA 2FJ2A 2GA4B 1OXSC 5I2YA 5KYIA 1ZYRD 1XWEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SNQ A;  1STH A;  2PZT A;  5CV9 A;  3D4D A;  1ENC A;  3QB3 A;  1EZ8 A;  4IUN A;  4J6H A;  3MEH A;  1KAB A;  2PQE A;  4R8N A;  4ODG A;  2OXP A;  5C3X A;  1SNM A;  2F0S A;  4QF4 A;  2F0I A;  3OMC A;  2RBM A;  3OWF A;  1F2M A;  3P75 A;  1NUC A;  4K2K A;  1STN A;  1SYF A;  3EVQ A;  4TRD A;  5I9P A;  1ENA A;  4RKL A;  4NP5 A;  4K8J A;  1EYD A;  3R3O A;  3TP7 A;  5I9O A;  5J22 A;  1EY8 A;  2EY1 A;  4B9W A;  2O4X A;  5KEE A;  3TME A;  1KDB A;  2EYO A;  4ZUJ A;  3NUC A;  1EZ6 A;  1SYE A;  5C5M A;  4G57 A;  3QOL A;  3T13 A;  2F0F A;  3DMU A;  3NK9 A;  5C3W A;  4EQN A;  2RDF A;  4K14 A;  3ERQ A;  2F0K A;  1JOK A;  1A3U A;  2F0N A;  3MVV A;  4K5X A;  5J39 A;  3SK8 A;  2PW7 A;  5IGE A;  2EXZ A;  5KGU A;  1A2U A;  4KY6 A;  2NUC A;  2RKS A;  2EYL A;  5E1F A;  5HGT A;  1EYC A;  3D8G A;  4OL7 A;  1SND A;  4B9X A;  2F0Q A;  3S9W A;  4KY5 A;  2M00 A;  3MHB A;  4N9P A;  2PW5 A;  4ZQ3 A;  1SYB A;  5NUC A;  1A3T A;  2F0T A;  1TQO A;  2QDB A;  5ISR A;  4F7X A;  5C6A A;  2F0D A;  4QB4 A;  3U9O A;  1EY7 A;  3C1E A;  3D4W A;  4K6D A;  4KJO A;  4PMB A;  4YIJ A;  5CC4 A;  1KAA A;  2F0G A;  2F0U A;  4KD3 A;  1SNP A;  2PYK A;  1STB A;  5IGF A;  2F3V A;  5C5L A;  3ERO A;  1EQV A;  3P1H A;  2SOB A;  4KD4 A;  4DFA A;  5EGT A;  3DHQ A;  5CR3 A;  5EKK A;  4F8M A;  3PMF A;  4KJN A;  1SYG A;  4HMI A;  5CV4 A;  1SYC A;  2F0H A;  5KRU A;  2F0O A;  2F0E A;  2F0W A;  2F0L A;  2F3W A;  3H6M A;  3LX0 A;  1A3V A;  3OMG A;  1AEX A;  3BDL A;  3HZX A;  4IAL A;  4S3S A;  5DAU A;  4DGZ A;  5I6W A;  2PZU A;  4KTA A;  5CV6 A;  4I65 A;  5CV7 A;  4WRD A;  2EY5 A;  2SNS A;  5F2D A;  5EKL A;  3SR1 A;  3MXP A;  3HEJ A;  4WOR A;  4H7B A;  4E6I A;  1A2T A;  3C1F A;  1JOQ A;  3T16 A;  4EVO A;  1EY6 A;  2EYM A;  3OSO A;  3NXW A;  4NMZ A;  5CV8 A;  3ITP A;  4RKB A;  1II3 A;  1F2Y A;  4EQO A;  5IOD A;  5C4H A;  2EY2 A;  1KDA A;  5JOB A;  1TT2 A;  2F0J A;  2F0M A;  4NDX A;  5J1Z A;  4KHV A;  4HTH A;  4NKL A;  3SK5 A;  3TP6 A;  5CV5 A;  2ENB A;  3NP8 A;  3NQT A;  1NSN S;  1TR5 A;  5HUR A;  4PNY A;  2PZW A;  5IGC A;  4ID6 A;  1STA A;  3EJI A;  4LAA A;  1STY A;  3RUZ A;  3SK4 A;  3SK6 A;  1JOR A;  1EYA A;  1IHZ A;  2EY6 A;  5DEH A;  4DF7 A;  2KQ3 A;  3TP5 A;  3SHL A;  3E5S A;  5K5P A;  4MIU A;  1SYD A;  3V2T A;  3SXH A;  2F0V A;  5IGB A;  3VA5 A;  1EY4 A;  2HQE A;  2OEO A;  5M9O A;  1EY9 A;  4N9T A;  4K2L A;  1U9R A;  5IIF A;  1KDC A;  2WAC A;  3D6C A;  1EY0 A;  5KIX A;  4J1M A;  1JOO A;  4PMC A;  2EYJ A;  4HMJ A;  1RKN A;  2LKV A;  4K8I A;  4DU9 A;  4EQP A;  5CGK A;  5IGG A;  4K5V A;  5JAV A;  2F0P A;  3BDC A;  1SNC A;  4IZ8 A;  4KY7 A;  2EYP A;  1STG A;  1EY5 A;  1F2Z A;  5IOC A;  5KYL A;  5E3F A;  2OF1 A;  3QOJ A;  4ZUI A;  4K5W A;  5I6Y A;  2EYH A;  2EYF A;  5C4Z A;  3NHH A;  3MZ5 A;  1SNO A;  4QMG A;  2KHS A;  5KYI A;  2SNM A;  4KV6 A;  4ME5 A;  3TP8 A;  5IGD A; 
#chains in the Genus database with same CATH topology
 3ND8 A;  2KCC A;  2E75 C;  4KKT A;  4A3G G;  5M5Y H;  2NVX B;  3S15 H;  1SSO A;  4JI8 Q;  3NPP A;  1SMY C;  3S15 B;  2L11 A;  2B2T A;  2I07 B;  1OXU A;  3CQZ B;  4RCO A;  5ELN A;  1VQM A;  5J22 A;  2R92 B;  3W3A A;  5EBC A;  3M4O B;  4QIW E;  1XMQ L;  3S1N B;  2HUG A;  5C5M A;  5BN3 A;  5C3W A;  2D9U A;  2RDF A;  3IRB A;  4HCE A;  4K14 A;  2F0K A;  4HIO A;  4FDB A;  2PW7 A;  3L0O A;  3FKI G;  3CHB D;  3K59 A;  4B3S L;  5ELO A;  1WYD A;  4CKE A;  1SND A;  3I4N H;  4AYB E;  4A75 A;  1Q7Y C;  4MHE A;  4HJ9 A;  2EVB A;  2B29 A;  4RWS C;  1R9T B;  2XTI A;  5LL6 X;  1HZ9 A;  3C1E A;  4YIJ A;  1HUM A;  1CA5 A;  1DD2 A;  1HXY D;  2PYK A;  1GD7 A;  4DV2 L;  4A3M G;  1H95 A;  3DLL A;  2MGS A;  4IPH A;  1EQV A;  4RGM A;  4X3T A;  3H0G H;  4JI6 L;  4HMI A;  1YNN D;  4OX9 Q;  3BDL A;  2BDO A;  1SLJ A;  5CV7 A;  4KKS A;  3SR1 A;  1MKH A;  3MXG A;  3KDF B;  4JPB W;  4JBM A;  3AU7 A;  3PO3 G;  3T16 A;  3VR2 A;  4EVO A;  1N34 Q;  4IPD A;  3VDY A;  2BCO A;  2RSN A;  4LF9 Q;  3HG9 A;  3DM1 A;  4LUV A;  4GNX A;  4FP5 D;  5CMD A;  1SE3 A;  3PUY A;  1WTO A;  1JOR A;  1BVS A;  3SK6 A;  1K83 B;  5FLX E;  4HIK A;  1IHZ A;  1N36 L;  2F03 A;  2ID0 A;  1I94 Q;  3NE5 B;  1S5B D;  1Y1V G;  3T1H Q;  1EOT A;  1B53 A;  4YHH Q;  1J9O A;  4C3J H;  2E5L Q;  2EPB A;  1G91 A;  1Z7T A;  2KHI A;  3FRP B;  2I5L X;  3UDX A;  4A3F B;  3GTM B;  1SNC A;  1VQN A;  3I55 A;  1VQL A;  1AH9 A;  1PH8 A;  2A6E D;  2HQL A;  4FO2 A;  2AHO B;  1PTO D;  4QJF A;  2I46 A;  4HJ5 A;  4DAY B;  3UDI A;  1XTD A;  5M3F G;  1I4Q A;  3D4D A;  3MC0 B;  1JC7 A;  2VQE L;  2MPM A;  1UE5 A;  4LF4 Q;  2F4I A;  1STN A;  1SYF A;  4IFD I;  1JQY D;  2UXB Q;  4R4O A;  2I0Q A;  5JVH 3;  5JPN C;  1YVC A;  2WB1 B;  1PH2 A;  4LUO A;  2EYO A;  1BDO A;  5KIX A;  1R4P B;  4A3J B;  4L5T A;  1XPU A;  3RMH A;  5FO7 B;  3I72 A;  2XRQ D;  2A68 C;  3NWT A;  1ZEQ X;  5A2Q E;  1Q86 C;  4YCV A;  1A62 A;  1KLG D;  4OL7 A;  2B2W A;  4ZQ3 A;  1EQT A;  5NUC A;  1XJV A;  5FLM H;  1S40 A;  1SMY D;  1UE1 A;  4DAY A;  3A5Z B;  4K6D A;  3S16 B;  4KJO A;  1TY0 A;  4OEL B;  1ICW A;  1EYG A;  2VQF L;  3CME A;  4DV4 L;  1NE3 A;  1BBW A;  2SOB A;  4A3C G;  3E3X A;  5IP7 G;  1IBK L;  5D3I B;  2F0H A;  2JE6 I;  2F0L A;  3TS0 A;  1G29 1;  4DGZ A;  5I6W A;  3KF8 A;  4DV6 L;  3J80 c;  2EY5 A;  2SNS A;  4ZYS A;  1HQM C;  1PMR A;  2CKZ B;  3U9S A;  3BYY B;  1JOQ A;  1BCP D;  4I7Z C;  5T1I A;  5CV8 A;  4A3K G;  1I4P A;  4RKB A;  1H9J A;  4DK1 A;  1Y1V B;  2K5H A;  2ASB A;  5IOD A;  1ML0 D;  5C4H A;  1KDA A;  2KOL A;  3CAM A;  2HCC A;  5IT9 E;  3T1Y Q;  4KHV A;  5C0X I;  4QIW B;  4OO1 G;  2ENB A;  1K8A C;  1O7Z A;  3RLN A;  4PNY A;  1TWA H;  1SEB D;  2C5C A;  3EJI A;  4HR7 B;  4LF9 L;  3F2U A;  5C0X J;  3KLS A;  3SEB A;  1AE2 A;  4OO1 I;  1MI2 A;  3IFD A;  3R2I A;  2EY6 A;  1XPR A;  1LV9 A;  4Y7N B;  1QUQ B;  4GOP B;  2F0V A;  3M85 A;  1KXL A;  1I50 B;  1PFN A;  2Q2I A;  4JBW A;  3OYY A;  2Z4H A;  2H1E A;  4C3J B;  1AE3 A;  2VL6 A;  2R61 A;  3K57 A;  3A54 A;  3OOC A;  2QCP X;  1AN8 A;  3I4N B;  4DV0 Q;  2YTX A;  1QWY A;  3KLW A;  4QY7 A;  3MZ5 A;  2E2I B;  5A2Q L;  3S17 H;  1B7Y B;  1PDQ A;  1X3P A;  2PI2 A;  3E6Z X;  2J4X A;  2JJQ A;  3FHW A;  2NZ1 D;  3ND9 A;  4OWX B;  1LTT D;  1PRT D;  4A3M B;  2F0I A;  1DOL A;  2Q8R E;  4HN7 A;  3HOV G;  4ZCK A;  2VUM H;  2R7Z G;  5C44 H;  3I4O A;  1BOS A;  3I7F A;  5EBD A;  2VUM B;  3GTP B;  3TEH B;  1EYD A;  3NTI A;  2F1M A;  1C48 A;  1N36 Q;  2XRS D;  1K3R A;  4QUF A;  4F87 A;  3PV0 A;  1PH4 A;  1JOK A;  1A3U A;  5D3D A;  5JVG 3;  4MTK A;  4ZAI A;  1CZG A;  1B4O A;  2JA7 B;  2E76 C;  3VR5 A;  3K5M A;  1CSP A;  2HHH L;  1WD1 A;  2E2J H;  2QEJ C;  1QCB D;  4BA1 I;  3D4R A;  1TQO A;  3Q23 A;  1YIJ A;  2XIW A;  3D4W A;  3G6J B;  3OTO L;  3S16 H;  1YEZ A;  4EQ5 A;  2X6L A;  5M5W B;  1CTM A;  4KHP L;  3RNU A;  2BOS A;  2RHQ B;  4Y52 H;  3M4Q A;  2JA8 B;  2CW0 C;  1UNS A;  4L8J A;  1V9P A;  1VQI A;  3V05 A;  4JK1 C;  2RVL A;  4WJ4 A;  1PTO F;  4WOR A;  4BS9 A;  1KRS A;  2EDG A;  3CC4 A;  1KL9 A;  4NB3 A;  5LMN Q;  2ZTE A;  3NXW A;  3K5O A;  4QUC A;  1HHV A;  3SVM A;  3J81 L;  1DOK A;  3CCR A;  1VS0 A;  2B8G A;  2XSC A;  4DNR B;  4HTH A;  4UP8 A;  4XDX A;  4JI4 L;  3J7A F;  1TR5 A;  1OO9 B;  3FPP A;  2L1B A;  3C46 A;  1ONL A;  5DEH A;  5C4X G;  4DF7 A;  4DK0 A;  2AQ1 B;  3RLO A;  3W2D A;  4WJ3 M;  2R7Z B;  1EUJ A;  3F8T A;  1AZP A;  3ZYY X;  4K2L A;  2R7Z H;  1KDC A;  1BCP C;  4J1M A;  1JOO A;  5CGK A;  3BVG A;  4J8Q A;  2RCF A;  3S14 B;  3TZU A;  3IKJ A;  4APV A;  5AJ3 L;  3LNN A;  4A3B H;  3MFG A;  4K5W A;  5I6Y A;  4KK7 A;  1SJE D;  2PMZ B;  4QMG A;  1F9Q A;  5I4D A;  5M3M H;  2UU9 Q;  1PTO B;  2B63 B;  2PZT A;  3MEH A;  3BZD B;  1SNM A;  2CWA A;  1G6Z A;  4FNF A;  1SDF A;  1QJO A;  3GO5 A;  5C44 B;  1RF2 D;  4GKJ Q;  5GRO A;  2N88 A;  1YHQ A;  2AQ3 B;  4PV1 C;  2QA4 A;  4R1J A;  1KDB A;  2HIV A;  1ILP A;  4A93 G;  2KVM A;  4QQB X;  1JIC A;  1F9S A;  1X3G A;  2D5D A;  1I6V C;  3CRK C;  4POG A;  3M4Y A;  2VB2 X;  1VQ9 A;  4A3K B;  1QVF A;  3PO2 H;  1RIP A;  1Q82 C;  1RDP D;  1EQR A;  2E2J B;  1IKL A;  1Z47 A;  2QEX A;  1M8A A;  4H44 C;  2CCZ A;  2A74 C;  3CU7 A;  4PMB A;  3T53 B;  3HOZ H;  1PFS A;  1SNP A;  1B3A A;  3QIA A;  1X55 A;  1W2B A;  1IYV A;  4DK6 C;  4YY3 L;  1V1P B;  1D1K A;  1EOV A;  3MAQ A;  3NWS A;  1CSQ A;  1VQO A;  2XN9 C;  1D2B A;  5DM6 3;  2K5N A;  1W3S A;  5EKL A;  4MTN A;  3H91 A;  1CKN B;  4E6I A;  1A2T A;  5FLM G;  4X3U A;  3CCM A;  1WD0 A;  1XNR L;  3PIP 3;  1QVC A;  1EU3 A;  4RCN A;  2WAQ G;  2JK8 A;  1WTV A;  1ILQ A;  3GTL H;  4WJW A;  4JI2 L;  2FFK B;  2ZXP A;  4A3M H;  2IX3 A;  2JQO A;  2L5T A;  2QKI C;  4F88 A;  1TWG B;  2LFN A;  1K28 A;  3TBI B;  2Q2H A;  4KI0 A;  5EAY A;  1STA A;  1YZ6 A;  3BZC A;  2DNC A;  1MD2 D;  3D3R A;  1LTS D;  2G9D A;  3GTK H;  4O42 A;  3G6E A;  1LUZ A;  2WIN B;  3GDE A;  3GTK B;  3J81 j;  1SN8 A;  1EL0 A;  3Q22 A;  3RD4 A;  1LM0 A;  4FF2 A;  2NVT H;  3N6R A;  3FDT A;  1EY5 A;  2FHT A;  3HOX G;  1WTW A;  3GV3 A;  2JA5 H;  2JA6 G;  1HQR D;  5IGD A;  4JI0 Q;  1SNQ A;  1I3Q H;  1YNJ C;  3TRZ A;  3S2D H;  3MXN A;  1KAB A;  4CDF C;  3OMC A;  4B3M L;  1Q8I A;  2JSO A;  3KF8 B;  3K7A H;  4BXX G;  3MEF A;  5TSS A;  1N33 L;  2R7F A;  3R3O A;  4JV5 Q;  2EY1 A;  4GOP A;  1D6E C;  3PCO B;  3QWN A;  2Y0S B;  4BBR B;  1B3Q A;  2ZJR A;  1PYS B;  1WI5 A;  2ZXO A;  1C7Y A;  2NVX H;  3SK8 A;  4A3D B;  3W1G A;  3T1Y L;  5KND A;  3C3L A;  4C3I G;  4GKK L;  4DPG A;  3AYH B;  1PYW D;  1GUT A;  3EBE A;  2KCN A;  3OIQ A;  1OTC A;  3L2P A;  3CCE A;  2F3V A;  1S5E D;  3ERO A;  3AMU A;  3S2H B;  2E2H H;  3P1H A;  4DV6 Q;  4FYD A;  1G8Z D;  5EKK A;  1I6H H;  5C4X B;  4LFC Q;  3H0G G;  1ZYR C;  4K6L A;  2BDN A;  2F0O A;  3A8I E;  3I4M H;  1LO5 D;  3TQY A;  3CCU A;  1KD1 C;  2OT2 A;  2Z0S A;  2E5L L;  1E1O A;  2I5H A;  4GN3 B;  4H7B A;  4YHH L;  4YWM A;  2EJG C;  3C1F A;  4DK3 C;  2D2C C;  2H5X A;  3TRE A;  4NMZ A;  1LAC A;  1RD9 D;  3TP6 A;  3K58 A;  1K9M C;  1G2T A;  4V19 0;  3CMA A;  2NVQ H;  5CBE E;  1L1O A;  3M9B A;  1GO3 E;  1XPO A;  4UPA A;  2OWO A;  2Z1C A;  4G7O C;  1WFQ A;  1XNR Q;  4DR2 L;  5K36 G;  4JW0 A;  3VYR A;  2BA0 A;  4CDE C;  1GUG A;  3I56 A;  2HD3 A;  1Q81 C;  3H3V H;  1L1O B;  2WAC A;  5A35 A;  5IGG A;  4A3K H;  3PO2 B;  1CT1 D;  3EIV A;  1LAB A;  4FF4 A;  2JYO A;  2F0P A;  4JOI A;  2EYP A;  1F2L A;  1F2Z A;  3HOY G;  2UUB Q;  3QOJ A;  2B2Y A;  4JC0 A;  4IO9 A;  3GTJ B;  1GUN A;  2KHS A;  1IBL L;  1BBU A;  2JA7 G;  2PMZ E;  1IBM Q;  4KMU C;  3DUZ A;  3KDF A;  3QB3 A;  1J5E Q;  1P8L A;  2Y0S G;  2NVY H;  4BBR G;  3H3V I;  3U58 A;  1LTI D;  1Y8N B;  5ELD A;  1LT6 D;  4FF3 A;  5IE8 A;  4JI1 Q;  1I5F A;  3URY A;  4DR7 Q;  1K8M A;  1WTR A;  3TP7 A;  3T1H L;  2BA1 A;  3BYT B;  1H9S B;  2NZO A;  1YIT A;  1LLR D;  4RGT A;  2F0N A;  5LL6 S;  2JA6 B;  5IGE A;  2XWJ B;  1VQP A;  1XMQ Q;  3AB9 A;  4GLX A;  4O2D A;  2F3I A;  2QDL A;  4B9X A;  3HKZ E;  1Q3L A;  3AFQ A;  5IT9 L;  1JE5 A;  2LMC B;  3NEM A;  4PQX A;  4EGV A;  1HNX L;  4OWT B;  4JI8 L;  3CCL A;  1N34 L;  1IKM A;  4C3J G;  4A3I G;  3AEV A;  1LTL A;  2UXC Q;  3HOZ B;  4IPC A;  1K83 H;  4LNQ A;  2DY7 A;  1I4R A;  4JVZ A;  1BCP B;  2A6E C;  1Y1W B;  3RZO B;  1XMO L;  1STE A;  3DXJ C;  1SYC A;  4OX9 L;  5C3E H;  4JI6 Q;  4IUV A;  3HZX A;  1HJP A;  4GZY C;  4I65 A;  5EQ0 A;  2K04 A;  3LWU A;  4DV2 Q;  3GTO H;  2Q8I B;  1WCM B;  4OHJ A;  5T1G A;  4P71 A;  4B3T L;  2RDH A;  2EYM A;  2QIL A;  1WCM H;  3S2D B;  5D65 A;  2L4N A;  1QB5 D;  2EY2 A;  4A3E G;  5JOB A;  2L12 A;  2MP1 A;  5M5Y B;  4CJ0 B;  4NDX A;  3SK5 A;  4J15 A;  1SE8 A;  1WTX A;  5HUR A;  5IYC G;  4X6A H;  4UHV A;  4LAA A;  3SK4 A;  1VQB A;  5M3F B;  1VQ7 A;  4PZ8 A;  4LFB Q;  3I8Z A;  1SJH D;  1A6X A;  5BR8 L;  4BY1 H;  2DJF C;  4MIU A;  4NXN Q;  3GQB A;  2ZTD A;  4KHZ A;  1K8G A;  2G9H D;  1U9R A;  4IUT A;  2EJF C;  3DEO A;  3K0Y A;  4K5V A;  2IPK D;  3NBH A;  1STG A;  2CH4 W;  2EYF A;  2MO1 A;  4KHP Q;  3ICE A;  5EPJ A;  1N32 L;  3FKI H;  2SNM A;  1VF5 C;  3PF4 A;  1DM0 B;  4R8I A;  2A5H A;  3HOW B;  1PZJ D;  4A93 B;  2EE1 A;  3OIP A;  4A3L G;  2Z9H A;  4N8F A;  4G4K A;  2M2L A;  4HED A;  3HOU G;  5LMU L;  4K2K A;  3CRL C;  2DN8 A;  2WB1 G;  1PVO A;  1E2Z A;  2RA4 A;  3V96 A;  4IOC A;  4K0K L;  1V1P A;  4ZUJ A;  4DUZ Q;  5FLX c;  4NXM L;  3K0X A;  2F0F A;  4EQN A;  3W5O A;  3JAM E;  4BY7 H;  2JA5 G;  3PUV A;  2K03 A;  4AQY Q;  1CKO A;  2QF7 A;  4GLA C;  3JAM i;  2ZM6 Q;  2WV6 D;  1N8R C;  2Q2T A;  3MHB A;  2PW5 A;  4B3R L;  1OXV A;  2F0T A;  2PNR C;  1UE6 A;  1Q1E A;  2YYZ A;  1FJG L;  2Z8L A;  1EY7 A;  3WWV A;  1Q8K A;  1NR2 A;  2F0U A;  4DR5 Q;  4LWC A;  1U4R A;  5H1S E;  2VZA A;  2Z4I A;  3VR4 A;  3TN2 A;  5EGT A;  2PQA B;  3EQL C;  3EFX D;  3ULL A;  3MTS A;  4U68 A;  1HTL D;  1S5D D;  2DY8 A;  5COY A;  5CV6 A;  4X64 Q;  3H15 A;  5JEA G;  5IYD H;  1U4P A;  1AZQ A;  1HNZ Q;  4DR1 L;  3E0J A;  1ZXT A;  4DR5 L;  1E22 A;  1FNW A;  2M9V A;  1EWI A;  5C44 G;  3WDN A;  3OSO A;  3CF5 A;  2MUY A;  1F2Y A;  3K7A B;  4AQY L;  3G48 A;  2K52 A;  1Y1W G;  2WKD A;  2JA8 G;  1FGU A;  3DWQ A;  3H94 A;  1HZB A;  3K7U C;  3BVZ A;  5E4X A;  1PRT C;  3IL8 A;  3STB C;  1TWF H;  5K5P A;  4FXK C;  2E2D C;  3UDG A;  1VQ5 A;  1DGS A;  1EY9 A;  4N9T A;  1CKM A;  1EY0 A;  2BH8 A;  1TVX A;  4R4I A;  4R4T A;  3KFU A;  2B2V A;  1V1O A;  2IL8 A;  4ZKB B;  1AP0 A;  5IYC H;  2E8G A;  4KLK A;  4Q0F A;  1X32 A;  2CWP A;  1BUV T;  1ET6 A;  2V1C C;  4TRD A;  1FR3 A;  2K50 A;  2R92 G;  5M5X B;  3VA7 A;  2IHF A;  1IYJ B;  4K8J A;  4RH6 A;  5BN4 A;  1CHP D;  4O0A A;  4IPG A;  3TME A;  4G57 A;  1HR0 W;  3H0G B;  1YJ9 A;  2A68 D;  1PH6 A;  1PFB A;  2CW0 D;  4CGY B;  3TDQ A;  1A2U A;  3JAM L;  5JJK A;  2RKS A;  1TWH B;  2EYL A;  4JI3 L;  5HGT A;  1X3Q A;  1ESR A;  3NQI A;  1MSG A;  4JI7 Q;  2K5V A;  4DV3 Q;  3C2P A;  1KLU D;  3NBH B;  1VCI A;  1FVI A;  3CD6 A;  4BXX H;  4IFD J;  2C35 B;  2YTV A;  4OEM B;  1KHI A;  4LFA L;  4POF A;  2WB1 E;  4B3T Q;  2A6H C;  2XGT A;  2F0G A;  1LTB D;  3T56 B;  2KA7 A;  1B70 B;  4A3D G;  4IOA A;  4KD4 A;  4Y7N H;  5CR3 A;  2IJ0 A;  4JI5 Q;  2F0W A;  4JYA L;  4PMW A;  1P16 A;  1AEX A;  4S3S A;  1GUS A;  1LTA D;  2KUM A;  2C9O A;  1RHP A;  1E3P A;  1IL2 A;  2D0P A;  5GQO A;  1YJW A;  2UXC L;  1ASZ A;  5KNB A;  1EIG A;  2OCE A;  1Z6H A;  3FP9 A;  3K81 C;  4L5R C;  4C1N I;  2X69 A;  3ULJ A;  1GJX A;  2B2U C;  4HJ8 A;  2AWO A;  5HY6 A;  2G5D A;  2K5D A;  1CQF A;  4Z9C B;  3KK7 A;  1LYL A;  3LWE A;  4BBS B;  1VQ8 A;  2D0O A;  3BVM A;  1X6O A;  2Y0S E;  2AMC B;  3KJO A;  3PUZ A;  1PXU A;  2KEE A;  3SXH A;  1UE7 A;  2HQE A;  4M1U B;  3QR8 A;  3U4V A;  2MFI A;  3M4P A;  4L5S A;  3CC2 A;  4PMC A;  1ZKO A;  1B2T A;  1GM5 A;  2FMM A;  5IOC A;  2MO0 A;  1VQ6 A;  4JI5 L;  2PNH A;  4HIM A;  3NHH A;  1PH7 A;  1PH1 A;  1CUK A;  3J80 E;  3WOE A;  5KNC A;  4J6H A;  2B2Y C;  4A3J G;  1M1K C;  3GTQ H;  1HTP A;  1K0S A;  1GHJ A;  1DON A;  1K3B C;  1SR3 A;  4XT3 B;  3OWF A;  1TII D;  1NUC A;  3CW2 C;  3S1M H;  1O7L A;  2ZTC A;  4YCU A;  3PGZ A;  3HGB A;  1E7Z A;  2AUJ D;  5M5X H;  1GKH A;  4P75 A;  2N55 A;  2OTL A;  2B63 H;  3CCJ A;  3J81 i;  4A3B G;  3NK9 A;  2BE5 D;  4P74 A;  1NBW A;  3S17 B;  1F9P A;  4A4I A;  4ME3 A;  1NMF A;  3NTH A;  4ULL A;  5JJI A;  4A76 A;  1PRT F;  3NEL A;  4RMF A;  2ZT9 C;  4QCL A;  4DAP A;  3E9H A;  3DWP A;  3NEN A;  1A3T A;  2KEN A;  1O80 A;  4OIK A;  2VS1 A;  1IXR A;  2VW9 A;  1SXT A;  5IP9 H;  4G7H C;  2B2W C;  1HA6 A;  1T9H A;  1DCZ A;  2VY3 A;  5C5L A;  2B2T C;  4X66 L;  2UUA L;  4I7A A;  3RR5 A;  1S72 A;  1O7Y A;  1RL2 A;  4HAE A;  3LX0 A;  1Y8P B;  5C3E G;  2KBN A;  1FNU A;  1UUP A;  4GNX B;  5EKI A;  1LTG D;  1NMG A;  2FMC A;  3D31 A;  4H0L C;  5F2D A;  3TS2 A;  4CBV A;  1I4X A;  1B50 A;  2ZJP A;  1CKN A;  1D5M C;  4LF8 Q;  1N9W A;  1F77 A;  4DV5 Q;  4LF5 L;  1Q90 A;  5ELB A;  4A3I H;  1UEA B;  2NVY B;  3ITP A;  1MSH A;  1XXG A;  4ZKC B;  5IYB G;  4P72 A;  4ZRZ A;  5J1Z A;  3I90 A;  3BU2 A;  1B8A A;  3RZD B;  1ICF B;  1E2V A;  1WVL A;  1BQQ T;  3E5S A;  3HKZ G;  1X9N A;  2KEC A;  3GV6 A;  4DR1 Q;  1GOZ A;  3KF6 B;  2IW3 A;  2O5I C;  2WFW A;  2Z6K A;  4YWK A;  2R6G A;  4A3D H;  4KY7 A;  1AW7 A;  5KYL A;  5E3F A;  4RHS A;  2CHB D;  3F2B A;  4A3E B;  2NB0 A;  2HDM A;  2K5W A;  2DUD A;  2JA7 H;  4RG1 A;  4GNX C;  3SE0 A;  4FF1 A;  4UAI A;  2N49 A;  5ELF A;  4IUN A;  4RGN A;  4C3H B;  1SFO B;  5K36 H;  3N52 A;  1K73 C;  1F2M A;  1PHJ A;  2DGY A;  2BH2 A;  3S1R H;  4AYB B;  1FL0 A;  3S1M B;  1PFM A;  3Q0A A;  3PIP A;  2A69 C;  2B63 G;  5KEE A;  4LF6 L;  4IFD G;  1CHQ D;  2HCI A;  3DM3 A;  2IWH A;  3MXN B;  2Z6K C;  3CKI B;  1X65 A;  3ERQ A;  3KLS X;  4R4Q A;  2UXD L;  4OON A;  3CCS A;  1TS5 A;  1WOC A;  5E7N A;  5C4J H;  1S4Z A;  1E0B A;  3FMC A;  3B6Y A;  5LMU Q;  4F7X A;  2WII B;  2CFM A;  4BBS H;  2R93 B;  5CC4 A;  1HPC A;  4DNT B;  5DM7 3;  4H13 C;  1GHK A;  2VB3 X;  1EIY B;  4Q5V A;  1CM9 A;  4X62 L;  1KAW A;  5EPL A;  4DR3 L;  3I4M G;  4IUU A;  1VQF A;  1YNJ D;  2V4D A;  3BDO A;  1C8C A;  3GTG B;  2UUC Q;  4C3I H;  3FEW X;  1KNE A;  5JJZ A;  1VMP A;  4OGQ C;  1SE4 A;  3SGI A;  2ZM6 L;  1LT3 D;  1V8Q A;  4A3C H;  3A5U A;  3I70 A;  1JJC B;  1YJN A;  3NQT A;  2JA8 H;  4OO1 H;  5M3M B;  2PZW A;  4N8X 1;  5FLX L;  1YI2 A;  1SE2 A;  1HCZ A;  1NY4 A;  2XNA C;  4AYB G;  4LF8 L;  1V1Q A;  3VA5 A;  3H3V C;  4K0K Q;  2VNU D;  1T5E A;  4XYQ A;  3MA2 B;  2EYJ A;  5JAV A;  2JP1 A;  4C3H G;  1VF7 A;  5EPK A;  1TU2 B;  2EQS A;  1QVG A;  1TWA B;  3S1N H;  2O2L D;  1D1I A;  1DXM A;  1VQC A;  3RN2 A;  3Q6S A;  3HOW G;  3TP8 A;  5CV9 A;  4IJH A;  4LMQ D;  3CC7 A;  3STB D;  4LF7 L;  2CQA A;  1L2F A;  5AJ3 Q;  2F0S A;  3VR3 A;  3HOX B;  1HNX Q;  2KED A;  1XYI A;  4GLV B;  2O4X A;  1YHB A;  1SYE A;  4DV7 Q;  1HRJ A;  2F4V L;  5C0X G;  4HSV A;  1PTO H;  4CDC C;  1CI3 M;  5J39 A;  2JA5 B;  1K0R A;  1S5F D;  3PUW A;  4JI4 Q;  3I73 A;  4R4C A;  2GVB A;  4DR6 L;  3S1Q B;  2RHS B;  1IZ6 A;  3HOV H;  3CCQ A;  3R93 A;  1QG7 A;  2QDB A;  2Z6B A;  5LMN L;  2YU9 B;  4TQU S;  1U4L A;  2R93 H;  4DA2 A;  5D14 A;  3I2Z A;  5GAH C;  2A69 D;  2OTJ A;  3KUP A;  4X3K A;  1IBL Q;  2AUK A;  4F8M A;  3PMF A;  4GN5 A;  5FJ8 H;  2NWG A;  5KRU A;  2EIF A;  3H6M A;  3NBI A;  1SBB B;  1A3V A;  4CKB A;  4XQN A;  1GUW A;  1VQG A;  4WRD A;  2K28 A;  5L37 A;  2PO4 A;  1EIF A;  4IUP A;  3A56 A;  1J8I A;  4X65 Q;  3HOZ G;  2A6H D;  1FD7 D;  3NTK A;  1TKW B;  2B2V C;  4A3I B;  1II3 A;  2K7V A;  5LMN W;  4JCV E;  2KJX A;  3TSS A;  1A15 A;  3EN2 A;  5CV5 A;  2SEB D;  4ALP A;  1JMC A;  1E2W A;  3MXU A;  1I3Q B;  2R3Z A;  4RHR A;  1RTO A;  1TWC H;  2RCN A;  1NJI C;  2E2I H;  5IYD G;  4MN3 A;  3GP7 A;  3TP5 A;  4HCS A;  3G4S A;  2N78 A;  2OEO A;  3M3Y H;  1AFP A;  1TWH H;  1CA6 A;  4JI1 L;  2GN5 A;  2QW7 A;  1PLF A;  4DKA C;  1BKB A;  3G7L A;  4UY8 C;  4IZ8 A;  4JYA Q;  3RN5 A;  2MQH A;  1J5E L;  4LFC L;  4ZUI A;  2NVQ B;  2JEB I;  4B08 A;  2EYH A;  4IN3 A;  4KV6 A;  4MNO A;  3QO2 A;  2XWB B;  1U5K A;  4ODG A;  1NTG A;  2JN4 A;  1SFO H;  3HOY B;  2OQK A;  4IQZ A;  2HDL A;  3AFP A;  4DV1 Q;  2L9H A;  1BCP F;  3S1R B;  4RKL A;  4JI7 L;  2WAQ E;  4QL5 A;  5CYU A;  5I9O A;  4DR6 Q;  4JI3 Q;  4B9W A;  4CDD C;  3P20 A;  1X3E A;  2TSS A;  1I4H A;  3DMU A;  1M90 C;  3H09 A;  1JWM D;  5GAG C;  3GTO B;  3I91 A;  4MZ9 A;  1KTK A;  3MFY A;  1BR9 A;  4K5X A;  2VXW A;  2XVS A;  5M5W H;  5IP7 H;  1V43 A;  2EXZ A;  4A3F G;  4NW2 A;  4A3F H;  4NPS A;  3GTM H;  2DJG C;  3K80 C;  2RF4 A;  2NTT A;  2F0Q A;  2K33 A;  3S9W A;  1N33 Q;  2K6A A;  4N9P A;  1SYB A;  1QNU A;  4IUR A;  2Q2U A;  1TY2 A;  2B2U A;  4LF7 Q;  3UI2 A;  5EJW A;  4XTC S;  4KD3 A;  2X6G A;  2L0C A;  5IP9 G;  5IGF A;  3ONA B;  2BE5 C;  3QG1 A;  4BY1 B;  2HIX A;  1TWF B;  3F2D A;  5ELC A;  2F0E A;  2IHE A;  5E1F A;  3U4Z A;  2NZH A;  2ALY B;  3OMG A;  1IW7 C;  4TVA B;  4C56 C;  1HZA A;  4HSP A;  4UP9 A;  1C0A A;  4YCW A;  3CQZ H;  4XQJ A;  3MXP A;  4A3L H;  3LGJ A;  1BNZ A;  3CPF A;  2DNE A;  4OXP A;  3J7A 5;  4LFA Q;  4ZLT F;  4EQO A;  4GKK Q;  1I6H B;  4A93 H;  1TT2 A;  3KBX A;  3GTJ H;  4FXG C;  3CP0 A;  2RQX A;  4ID6 A;  1LTR D;  2FIN B;  3PUX A;  1R9T H;  4BY1 G;  3PF5 A;  1RJT A;  3V2T A;  5IGB A;  3J7Y W;  4GOP C;  2UUC L;  1HNZ L;  5FK9 C;  1W6K A;  2CQO A;  4EQP A;  2K05 A;  2OQ0 A;  4B3M Q;  2PQA A;  4X64 L;  1WTP A;  4OWW B;  4LF4 L;  4IFD H;  1S5C D;  4KN7 C;  1HFG A;  3HOV B;  1MHW C;  4JI0 L;  4HID A;  3PSI A;  4X62 Q;  3KBG A;  1JWS D;  4YY3 Q;  1JB3 A;  5ELE A;  4BWG B;  2D62 A;  3A8J E;  4A3J H;  1FJG Q;  3O13 A;  4QF4 A;  3J80 i;  3P75 A;  5BN5 A;  1ROD A;  4C2M B;  2K14 A;  4B3R Q;  2JXM B;  2IX0 A;  3VYU A;  3Q24 A;  4C2M H;  1EWC A;  4DUY L;  1I94 L;  3T13 A;  3QOL A;  1HZC A;  3JC6 6;  3GTQ B;  1MGS A;  3HOW H;  1A8V A;  4XIG S;  4L5Q A;  4BY7 G;  1LT4 D;  4DUY Q;  4KKU A;  1G6P A;  4GKJ L;  2F52 A;  4KY5 A;  1EEF D;  2MJ8 A;  4TSS A;  1VQH A;  3ER0 A;  4HJA A;  2K4K A;  3U9O A;  2YU9 H;  5IYB H;  1TS3 A;  1O78 A;  1L0W A;  1DYQ A;  1IL8 A;  1L1O C;  4DFA A;  1N32 Q;  1C4Q A;  3W1B A;  1WTH A;  2B8F A;  5CV4 A;  1PTO C;  4DR3 Q;  4DXG A;  2CVR A;  3F1Z A;  2F3W A;  1JJ2 A;  4JBK A;  1PZI D;  2YTY A;  1UEB A;  2PZU A;  3KLR A;  1KC8 C;  2LXJ A;  2SDF A;  4CJ1 B;  3PQI A;  1MBY A;  3M7G A;  2J7Z A;  1GXD C;  3ZJY C;  3HKZ B;  2Q8T A;  4H02 A;  1VQJ A;  3T51 B;  5BR8 Q;  3DEP A;  4FXD A;  4C3H H;  3A55 A;  4LFB L;  5JJL A;  1OXT A;  5COR A;  3NSW A;  1BXT A;  3PIO A;  5G3L D;  2FXQ A;  2CH4 A;  4PG3 A;  4RGO S;  4DXF A;  1NR4 A;  3BS1 A;  2F0M A;  2NYZ D;  1PH3 A;  3HOY H;  1KNA A;  4B3S Q;  5CBA E;  3NP8 A;  4A3B B;  4JG2 A;  1EFW A;  5IGC A;  3HS0 C;  1ET9 A;  4LK1 C;  1PYB A;  1STY A;  2K75 A;  3OW2 A;  1MJE A;  2GVA A;  5FO9 B;  1EYA A;  1IW7 D;  4NXM Q;  4IJL A;  4DUZ L;  2JA9 A;  1H9S A;  4LF6 Q;  1Z9F A;  1SYD A;  1EIH A;  1D8L A;  3T4A C;  1EU4 A;  4AH6 A;  1QZH A;  3HOU H;  1TS4 A;  2A1A A;  1WCM G;  3K5L A;  4OIJ A;  4DN4 M;  5C4J B;  1RKN A;  1E24 A;  1SAP A;  3UE1 A;  2PCF B;  2NN6 I;  1JCK B;  2A8V A;  3Q8D A;  1Q12 A;  2NBF A;  1SNO A;  4BY7 B;  4ME5 A;  5M3F H;  3KJP A;  2UUA Q;  2L55 A;  4PZ6 A;  1ENC A;  3UDF A;  2IY5 B;  1XNQ L;  4G7Z C;  4R8N A;  4C1N K;  2KHJ A;  5DNF A;  4O1N A;  1W6J A;  2ES2 A;  1GUO A;  2HHH Q;  3X3N A;  1HA5 A;  2LSS A;  4IUQ A;  5C0X H;  2WP8 J;  3ERS X;  1JJG A;  1YNN C;  4WFN 3;  5KGU A;  2NUC A;  3S14 H;  1KIX A;  1EYC A;  1MIU A;  3J81 E;  4DR7 L;  3JAM c;  1PRT B;  2EZV A;  2M00 A;  4DV1 L;  3D6W A;  1TXY A;  4P73 A;  4KN4 C;  1TS2 A;  2A19 A;  1TWC B;  4QB4 A;  3A7L A;  5FOB B;  1BF4 A;  1STB A;  2R93 G;  1VMC A;  5IY0 A;  1DZ1 A;  4XYO A;  1IBM L;  1HNW Q;  1Q46 A;  3FVQ A;  4UP7 A;  1LT5 D;  2E74 C;  1SYG A;  1TWG H;  3BJU A;  4L63 B;  1FYC A;  1RTN A;  2TMP A;  5C6A A;  1SRO A;  4IAL A;  3J7A V;  1H9M A;  2EXD A;  5JEA H;  1QE6 A;  3HP3 A;  4A3G H;  1FGB D;  1NCV A;  3OTO Q;  3E9I A;  2WKC A;  1QUQ A;  3IFT A;  4DR2 Q;  4DAV A;  1X56 A;  2A73 B;  5GAE C;  1S3O A;  1C9O A;  1PZK D;  3HOX H;  1B44 D;  1NSN S;  3GTG H;  2PI2 E;  3RUZ A;  3I4M B;  5DLQ E;  1BBX C;  3FKI B;  2RDG A;  3VYS A;  2KQ3 A;  3SHL A;  4X65 L;  1YHA A;  5IWA Q;  1XX8 A;  4JOI C;  1O7I A;  1YNX A;  3A7A B;  1WTQ A;  3R8B A;  3S1Q H;  4HMJ A;  2LKV A;  4JBJ A;  1KRT A;  3DWA A;  4RFB A;  4LJZ C;  2K1B A;  4DR4 L;  3RLF A;  3EA6 A;  2R7D A;  4U67 3;  2K32 A;  3ULP A;  2OF1 A;  1IBK Q;  3AQQ A;  4V0B A;  1CQV A;  4X3S A;  1MJC A;  4QGU A;  3P7J A;  4DV4 Q;  4GS3 A;  3BZK A;  1STH A;  1X54 A;  2UUB L;  3HRZ C;  3PO2 G;  4DV0 L;  1L0X B;  2YV5 A;  3CXC A;  5C3X A;  1Y1V H;  3VR6 A;  4CJ2 C;  1DJR D;  2RBM A;  1HR0 Q;  5JEA J;  5I9P A;  4LUZ A;  1ENA A;  2ZXR A;  5E4W C;  4DV3 L;  1M4V A;  3A74 A;  3G71 A;  4C3I B;  3KF6 A;  2H4O A;  3MWY W;  4GN4 B;  1J6Q A;  1EZ6 A;  1Y8O B;  3S2H H;  2NTS A;  4HJ7 A;  1FNV A;  3MVV A;  1Y1W H;  2F4V Q;  4DV7 L;  1B9N A;  1T5X D;  3OPO A;  1I50 H;  5C3E B;  1D5X C;  3E0E A;  4ILW A;  1JE4 A;  3FPU B;  4YWL A;  2EOT A;  1XTC D;  2VUM G;  1SMX A;  2F0D A;  2HT1 A;  1EEI D;  4ZK9 B;  1CZW A;  1KAA A;  3M7N A;  2VQE Q;  3RZD H;  1D5Z C;  1A0I A;  3I3C A;  3U50 C;  3M3Y B;  1EFI D;  1UWV A;  4AIM A;  2KCM A;  3DHQ A;  2AWN A;  3KYH C;  1H9K A;  3X3M A;  1IYU A;  2JA6 H;  2K01 A;  1A63 A;  1CFM A;  3TZD A;  3L7Z C;  3L3O C;  3GTP H;  3J81 c;  3HFZ B;  1EWH A;  4L6T B;  2IX1 A;  3M4O H;  1JT8 A;  3HEJ A;  2VQF Q;  3I4N G;  2NN6 H;  4A3G B;  3GD7 A;  1JB7 A;  1G51 A;  4UDU C;  1EY6 A;  1NNX A;  1PV4 A;  4P2C B;  1HFN A;  1JWU D;  2LS0 1;  1VQK A;  1D7Q A;  2O5J C;  3QJY A;  1SRU A;  3S24 A;  3CPW A;  4PZ7 A;  2F0J A;  4NKL A;  1I4G A;  1F9R A;  5JPM C;  1B9M A;  2B3G A;  1QOH A;  4ABN A;  1ENF A;  1Q1B A;  2LY7 A;  1RCV D;  2KCT A;  3D0F A;  3K8A A;  4JV5 L;  1UAP A;  1EY4 A;  4CHT B;  3HOU B;  2UXB L;  5AFW A;  3D6C A;  2JEA I;  4DU9 A;  1HR0 L;  3CCV A;  2PPB C;  5C4Z A;  5J3B A;  4EX5 A;  4XQQ A;  5FKA C;  1U4M A;  2LXK A;  2MHV A;  1KQS A;  5G3L F;  1PA6 A;  1QIL A;  4BBR H;  1EZ8 A;  1NAP A;  3J80 L;  5FO8 B;  2PQE A;  2OXP A;  4DR4 Q;  2EJM A;  3A8K E;  3GTL B;  3EVQ A;  3OWE B;  1QZG A;  4R9W A;  2R92 H;  4NP5 A;  1L0Y B;  1PH5 A;  4RAU C;  1U0L A;  5IWA L;  3J7Z C;  1EY8 A;  2B39 A;  3HKS A;  2ICE C;  5I2X A;  2P5Z X;  2UXD Q;  3NUC A;  2QGQ A;  3RZO H;  1R4Q B;  2NVT B;  1DOM A;  1H9R A;  3WOF A;  5IT9 c;  4KY6 A;  4RA8 A;  1X3F A;  4BA2 I;  4DNI A;  3D8G A;  3OW7 A;  2WAQ B;  2NN6 G;  3VYT A;  4JI2 Q;  4DAM A;  3BG3 A;  1WJJ A;  5ISR A;  3F2C A;  1VQA A;  3L9A X;  3PIO 3;  4TKO B;  2UU9 L;  3K6O A;  4KJN A;  2MNA A;  4XXE A;  2AKW B;  2N3S A;  3A0J A;  4LW1 A;  1CK1 A;  5FJ8 G;  2RSO A;  5M3M G;  3OHX C;  5DAU A;  1YBY A;  1HNW L;  4KTA A;  2ICI A;  3I4L A;  1VQ4 A;  1EQQ A;  1VDZ A;  2N8N A;  3SDZ A;  4NXN L;  1K8O A;  4BBS G;  1G2S A;  5HGQ A;  2J0T D;  1ESF A;  2I5M X;  3K5N A;  3KOJ A;  1E1T A;  4A3E H;  3IAY A;  2AQ2 B;  4CKC A;  1PH9 A;  1HUN A;  1OXX K;  4M8A A;  1BO0 A;  5GAD C;  4XT1 B;  1QNK A;  5LHY 1;  2E2H B;  1VQD A;  1HH2 P;  1Y14 B;  5C4X H;  1B1Z A;  4DV5 L;  4LF5 Q;  3R2T A;  1JR0 D;  2ZJQ A;  2K5Q A;  4FVM A;  3PO3 H;  5M9O A;  3UE0 A;  1Y69 U;  5IIF A;  2L15 A;  1VQE A;  3PO3 B;  2IT1 A;  4K8I A;  1GVP A;  2ATW A;  3BDC A;  1XNQ Q;  2FJ2 A;  1XMO Q;  2GA4 B;  1OXS C;  5I2Y A;  5KYI A;  1ZYR D;  1XWE A;  4X66 Q;  1ASY A; 
#chains in the Genus database with same CATH homology
 3ND8 A;  2KCC A;  2E75 C;  4KKT A;  2NVX B;  1SSO A;  3NPP A;  1SMY C;  3S15 B;  2L11 A;  2B2T A;  2I07 B;  1OXU A;  3CQZ B;  4RCO A;  5J22 A;  2R92 B;  3W3A A;  5EBC A;  3M4O B;  3S1N B;  2HUG A;  5C5M A;  5BN3 A;  5C3W A;  2D9U A;  2RDF A;  4HCE A;  4K14 A;  2F0K A;  2PW7 A;  3CHB D;  3K59 A;  4CKE A;  1SND A;  4MHE A;  2EVB A;  4RWS C;  1R9T B;  5LL6 X;  3C1E A;  4YIJ A;  1HUM A;  1CA5 A;  1DD2 A;  1HXY D;  2PYK A;  2MGS A;  1EQV A;  4RGM A;  4X3T A;  4HMI A;  1YNN D;  3BDL A;  2BDO A;  5CV7 A;  4KKS A;  3SR1 A;  3MXG A;  3AU7 A;  3T16 A;  3VR2 A;  4EVO A;  2BCO A;  2RSN A;  3HG9 A;  3DM1 A;  4FP5 D;  5CMD A;  1SE3 A;  3PUY A;  1WTO A;  1JOR A;  3SK6 A;  1K83 B;  5FLX E;  1IHZ A;  2F03 A;  2ID0 A;  3NE5 B;  1S5B D;  1EOT A;  1B53 A;  1J9O A;  2EPB A;  1G91 A;  1Z7T A;  3FRP B;  4A3F B;  3GTM B;  1SNC A;  2A6E D;  4FO2 A;  1PTO D;  2I46 A;  1I4Q A;  3D4D A;  3MC0 B;  1JC7 A;  2MPM A;  2F4I A;  1STN A;  1SYF A;  4IFD I;  1JQY D;  5JVH 3;  5JPN C;  2WB1 B;  2EYO A;  1BDO A;  5KIX A;  1R4P B;  4A3J B;  3RMH A;  5FO7 B;  3I72 A;  2XRQ D;  2A68 C;  3NWT A;  1ZEQ X;  5A2Q E;  1KLG D;  4OL7 A;  2B2W A;  4ZQ3 A;  1EQT A;  5NUC A;  1SMY D;  4DAY A;  3S16 B;  4K6D A;  4KJO A;  1TY0 A;  1ICW A;  2SOB A;  5D3I B;  2F0H A;  2JE6 I;  2F0L A;  1G29 1;  4DGZ A;  5I6W A;  3KF8 A;  2EY5 A;  2SNS A;  4ZYS A;  1HQM C;  1PMR A;  3U9S A;  3BYY B;  1JOQ A;  1BCP D;  4I7Z C;  5T1I A;  5CV8 A;  1I4P A;  4RKB A;  1H9J A;  4DK1 A;  1Y1V B;  5IOD A;  1ML0 D;  5C4H A;  1KDA A;  2KOL A;  2HCC A;  5IT9 E;  4KHV A;  5C0X I;  4QIW B;  4OO1 G;  2ENB A;  1O7Z A;  4PNY A;  1SEB D;  2C5C A;  3EJI A;  4HR7 B;  3F2U A;  5C0X J;  3KLS A;  3SEB A;  4OO1 I;  1MI2 A;  3IFD A;  3R2I A;  2EY6 A;  1LV9 A;  4Y7N B;  2F0V A;  3M85 A;  1I50 B;  1PFN A;  4JBW A;  2Z4H A;  2H1E A;  4C3J B;  2R61 A;  3K57 A;  3A54 A;  3I4N B;  2QCP X;  1AN8 A;  3OOC A;  1QWY A;  3MZ5 A;  2E2I B;  5A2Q L;  1PDQ A;  1X3P A;  3E6Z X;  2J4X A;  2NZ1 D;  3ND9 A;  1LTT D;  1PRT D;  4A3M B;  2F0I A;  1DOL A;  2Q8R E;  4HN7 A;  1BOS A;  5EBD A;  2VUM B;  3GTP B;  1EYD A;  3NTI A;  2F1M A;  1C48 A;  2XRS D;  4QUF A;  4F87 A;  3PV0 A;  1JOK A;  1A3U A;  5D3D A;  5JVG 3;  4ZAI A;  1CZG A;  1B4O A;  2JA7 B;  2E76 C;  3VR5 A;  3K5M A;  1WD1 A;  2QEJ C;  1QCB D;  4BA1 I;  3D4R A;  1TQO A;  3Q23 A;  2XIW A;  3D4W A;  3G6J B;  2X6L A;  5M5W B;  1CTM A;  2BOS A;  2JA8 B;  2CW0 C;  1UNS A;  4L8J A;  3V05 A;  4JK1 C;  2RVL A;  1PTO F;  4WOR A;  4BS9 A;  2EDG A;  3NXW A;  3K5O A;  4QUC A;  1HHV A;  3SVM A;  3J81 L;  1DOK A;  2B8G A;  2XSC A;  4DNR B;  4HTH A;  4XDX A;  3J7A F;  1TR5 A;  1OO9 B;  3FPP A;  2L1B A;  3C46 A;  1ONL A;  5DEH A;  4DF7 A;  4DK0 A;  2AQ1 B;  3W2D A;  2R7Z B;  1AZP A;  3ZYY X;  4K2L A;  1KDC A;  1BCP C;  4J1M A;  1JOO A;  5CGK A;  3BVG A;  4J8Q A;  3S14 B;  3TZU A;  3IKJ A;  3LNN A;  5I6Y A;  3MFG A;  4K5W A;  4KK7 A;  1SJE D;  2PMZ B;  4QMG A;  1F9Q A;  5I4D A;  1PTO B;  2B63 B;  2PZT A;  3MEH A;  3BZD B;  1SNM A;  1G6Z A;  4FNF A;  1SDF A;  5C44 B;  1QJO A;  3GO5 A;  1RF2 D;  2N88 A;  2AQ3 B;  4PV1 C;  1KDB A;  1ILP A;  2KVM A;  1JIC A;  1F9S A;  2D5D A;  1I6V C;  3CRK C;  3M4Y A;  2VB2 X;  4A3K B;  1RDP D;  2E2J B;  1IKL A;  1Z47 A;  1M8A A;  4H44 C;  2A74 C;  3CU7 A;  4PMB A;  3T53 B;  1SNP A;  1B3A A;  3QIA A;  1IYV A;  1V1P B;  1D1K A;  3MAQ A;  3NWS A;  2XN9 C;  1D2B A;  5DM6 3;  5EKL A;  3H91 A;  4E6I A;  1A2T A;  4X3U A;  1WD0 A;  3PIP 3;  4RCN A;  1EU3 A;  1WTV A;  1ILQ A;  4WJW A;  2FFK B;  2ZXP A;  2IX3 A;  2L5T A;  2QKI C;  4F88 A;  1TWG B;  2LFN A;  3TBI B;  4KI0 A;  1STA A;  2DNC A;  1MD2 D;  3D3R A;  1LTS D;  2G9D A;  4O42 A;  2WIN B;  3GTK B;  1EL0 A;  3Q22 A;  3RD4 A;  4FF2 A;  3N6R A;  3FDT A;  1EY5 A;  2FHT A;  1WTW A;  3GV3 A;  5IGD A;  1HQR D;  1SNQ A;  1YNJ C;  3MXN A;  1KAB A;  3OMC A;  1Q8I A;  2JSO A;  5TSS A;  3R3O A;  2EY1 A;  1D6E C;  3QWN A;  2Y0S B;  4BBR B;  2ZXO A;  3SK8 A;  4A3D B;  5KND A;  3C3L A;  4C3I G;  1PYW D;  1GUT A;  3OIQ A;  2KCN A;  2F3V A;  1S5E D;  3ERO A;  3AMU A;  3S2H B;  3P1H A;  4FYD A;  1G8Z D;  5EKK A;  5C4X B;  4K6L A;  1ZYR C;  2BDN A;  2F0O A;  3A8I E;  1LO5 D;  2OT2 A;  4H7B A;  2EJG C;  3C1F A;  2D2C C;  4NMZ A;  1LAC A;  1RD9 D;  3TP6 A;  3K58 A;  1G2T A;  4V19 0;  5CBE E;  2Z1C A;  4G7O C;  5K36 G;  3VYR A;  2BA0 A;  1GUG A;  2WAC A;  5A35 A;  5IGG A;  3PO2 B;  1CT1 D;  4FF4 A;  1LAB A;  2JYO A;  2F0P A;  2EYP A;  1F2L A;  1F2Z A;  3QOJ A;  2B2Y A;  3GTJ B;  1GUN A;  2KHS A;  4KMU C;  3DUZ A;  3QB3 A;  1LTI D;  1Y8N B;  5ELD A;  1LT6 D;  4FF3 A;  3URY A;  1K8M A;  1WTR A;  3TP7 A;  2BA1 A;  3BYT B;  1H9S B;  1LLR D;  4RGT A;  2F0N A;  5LL6 S;  2JA6 B;  5IGE A;  2XWJ B;  3AB9 A;  4B9X A;  1Q3L A;  5IT9 L;  2LMC B;  4PQX A;  4EGV A;  1IKM A;  4C3J G;  3HOZ B;  2DY7 A;  1I4R A;  1BCP B;  2A6E C;  1Y1W B;  3RZO B;  1STE A;  3DXJ C;  1SYC A;  4IUV A;  3HZX A;  4GZY C;  4I65 A;  5EQ0 A;  2K04 A;  3LWU A;  2Q8I B;  1WCM B;  4OHJ A;  5T1G A;  2RDH A;  2EYM A;  2QIL A;  3S2D B;  5D65 A;  2L4N A;  1QB5 D;  2EY2 A;  5JOB A;  2L12 A;  2MP1 A;  5M5Y B;  4CJ0 B;  4NDX A;  3SK5 A;  1WTX A;  5HUR A;  4LAA A;  3SK4 A;  5M3F B;  3I8Z A;  1SJH D;  1A6X A;  4MIU A;  3GQB A;  4KHZ A;  2G9H D;  1U9R A;  4IUT A;  2EJF C;  3DEO A;  3K0Y A;  2IPK D;  4K5V A;  3NBH A;  1STG A;  2EYF A;  5EPJ A;  2SNM A;  1VF5 C;  1DM0 B;  4R8I A;  2A5H A;  3HOW B;  1PZJ D;  4A93 B;  2EE1 A;  3OIP A;  4G4K A;  2M2L A;  4HED A;  4K2K A;  3CRL C;  2DN8 A;  1E2Z A;  2RA4 A;  3V96 A;  1V1P A;  4ZUJ A;  2F0F A;  4EQN A;  3JAM E;  3PUV A;  2K03 A;  2QF7 A;  2WV6 D;  3MHB A;  2PW5 A;  1OXV A;  2F0T A;  2PNR C;  1Q1E A;  2YYZ A;  2Z8L A;  1EY7 A;  1NR2 A;  2F0U A;  1U4R A;  2Z4I A;  3VR4 A;  3TN2 A;  5EGT A;  3EQL C;  3EFX D;  3MTS A;  4U68 A;  1HTL D;  1S5D D;  2DY8 A;  5COY A;  5CV6 A;  5JEA G;  1U4P A;  1AZQ A;  3E0J A;  1ZXT A;  1FNW A;  2M9V A;  3WDN A;  3OSO A;  2MUY A;  1F2Y A;  3K7A B;  2WKD A;  3DWQ A;  3H94 A;  3BVZ A;  5E4X A;  1PRT C;  3IL8 A;  5K5P A;  4FXK C;  2E2D C;  1EY9 A;  4N9T A;  1EY0 A;  1TVX A;  2B2V A;  1V1O A;  2IL8 A;  4ZKB B;  1AP0 A;  4Q0F A;  1X32 A;  1BUV T;  1ET6 A;  4TRD A;  1FR3 A;  5M5X B;  3VA7 A;  4K8J A;  4RH6 A;  5BN4 A;  1CHP D;  3TME A;  4G57 A;  3H0G B;  2A68 D;  1PFB A;  2CW0 D;  4CGY B;  3TDQ A;  3JAM L;  1A2U A;  2RKS A;  1TWH B;  2EYL A;  5HGT A;  1X3Q A;  1ESR A;  3NQI A;  1MSG A;  3C2P A;  1KLU D;  1VCI A;  4IFD J;  2A6H C;  2F0G A;  1LTB D;  3T56 B;  2KA7 A;  4KD4 A;  5CR3 A;  2IJ0 A;  2F0W A;  4PMW A;  4S3S A;  1AEX A;  1GUS A;  1LTA D;  2KUM A;  2C9O A;  1RHP A;  5KNB A;  1EIG A;  1Z6H A;  4C1N I;  2X69 A;  1GJX A;  2B2U C;  2AWO A;  2K5D A;  1CQF A;  4Z9C B;  3KK7 A;  3LWE A;  4BBS B;  3BVM A;  3PUZ A;  1PXU A;  2KEE A;  3SXH A;  2HQE A;  4M1U B;  4PMC A;  1ZKO A;  1B2T A;  2FMM A;  5IOC A;  3NHH A;  3J80 E;  3WOE A;  5KNC A;  4J6H A;  2B2Y C;  1HTP A;  1GHJ A;  1DON A;  4XT3 B;  3OWF A;  1TII D;  1NUC A;  1O7L A;  3HGB A;  2AUJ D;  2N55 A;  3NK9 A;  2BE5 D;  3S17 B;  1F9P A;  3NTH A;  4ULL A;  1PRT F;  2ZT9 C;  4QCL A;  4DAP A;  3DWP A;  1A3T A;  1O80 A;  4OIK A;  1SXT A;  4G7H C;  2B2W C;  1HA6 A;  1DCZ A;  5C5L A;  2B2T C;  1O7Y A;  4HAE A;  3LX0 A;  1Y8P B;  1FNU A;  1UUP A;  5EKI A;  1LTG D;  2FMC A;  3D31 A;  4H0L C;  5F2D A;  4CBV A;  1I4X A;  1B50 A;  1D5M C;  1F77 A;  1Q90 A;  5ELB A;  1UEA B;  2NVY B;  3ITP A;  1MSH A;  1XXG A;  4ZKC B;  4ZRZ A;  5J1Z A;  3I90 A;  3RZD B;  1E2V A;  1WVL A;  1BQQ T;  3E5S A;  2KEC A;  3GV6 A;  1GOZ A;  2IW3 A;  2O5I C;  2R6G A;  4KY7 A;  1AW7 A;  5KYL A;  5E3F A;  4RHS A;  2CHB D;  4A3E B;  2NB0 A;  2HDM A;  2K5W A;  3SE0 A;  4FF1 A;  4UAI A;  5ELF A;  4IUN A;  4RGN A;  4C3H B;  1SFO B;  5K36 H;  3N52 A;  1F2M A;  4AYB B;  3S1M B;  1PFM A;  3Q0A A;  2A69 C;  5KEE A;  4IFD G;  1CHQ D;  2HCI A;  2IWH A;  3CKI B;  3ERQ A;  3KLS X;  1TS5 A;  1S4Z A;  1E0B A;  3FMC A;  4F7X A;  2WII B;  2R93 B;  5CC4 A;  1HPC A;  4DNT B;  5DM7 3;  4H13 C;  1GHK A;  2VB3 X;  4Q5V A;  1CM9 A;  5EPL A;  4IUU A;  1YNJ D;  2V4D A;  3BDO A;  1C8C A;  3GTG B;  3FEW X;  1KNE A;  5JJZ A;  1VMP A;  4OGQ C;  1SE4 A;  1LT3 D;  1V8Q A;  3I70 A;  3NQT A;  4OO1 H;  5M3M B;  2PZW A;  5FLX L;  1SE2 A;  1HCZ A;  2XNA C;  3VA5 A;  3H3V C;  2VNU D;  1T5E A;  4XYQ A;  3MA2 B;  2EYJ A;  5JAV A;  2JP1 A;  4C3H G;  1VF7 A;  5EPK A;  1TU2 B;  1TWA B;  2O2L D;  1D1I A;  1DXM A;  3Q6S A;  3TP8 A;  5CV9 A;  4LMQ D;  2CQA A;  2F0S A;  3VR3 A;  3HOX B;  2KED A;  1XYI A;  2O4X A;  1SYE A;  1HRJ A;  5C0X G;  4HSV A;  1PTO H;  2JA5 B;  1CI3 M;  5J39 A;  1S5F D;  3PUW A;  3I73 A;  3S1Q B;  3R93 A;  1QG7 A;  2QDB A;  2YU9 B;  4TQU S;  1U4L A;  4DA2 A;  5D14 A;  2A69 D;  3KUP A;  4X3K A;  2AUK A;  4F8M A;  3PMF A;  2NWG A;  5KRU A;  3NBI A;  3H6M A;  1SBB B;  1A3V A;  4XQN A;  4CKB A;  1GUW A;  4WRD A;  2K28 A;  2PO4 A;  4IUP A;  3A56 A;  1J8I A;  2A6H D;  1FD7 D;  3NTK A;  1TKW B;  2B2V C;  4A3I B;  1II3 A;  2K7V A;  2KJX A;  3TSS A;  1A15 A;  5CV5 A;  2SEB D;  1E2W A;  3MXU A;  1I3Q B;  2R3Z A;  4RHR A;  1RTO A;  4MN3 A;  3GP7 A;  3TP5 A;  4HCS A;  2OEO A;  1AFP A;  1CA6 A;  1PLF A;  3G7L A;  4IZ8 A;  4ZUI A;  2NVQ B;  2JEB I;  4B08 A;  2EYH A;  4IN3 A;  4KV6 A;  3QO2 A;  2XWB B;  4ODG A;  3HOY B;  4IQZ A;  2HDL A;  2L9H A;  1BCP F;  3S1R B;  4RKL A;  5CYU A;  5I9O A;  4B9W A;  3P20 A;  2TSS A;  1I4H A;  3DMU A;  3H09 A;  1JWM D;  3GTO B;  3I91 A;  1KTK A;  3MFY A;  1BR9 A;  4K5X A;  2VXW A;  2XVS A;  1V43 A;  2EXZ A;  4NW2 A;  2NTT A;  2F0Q A;  2K33 A;  3S9W A;  2K6A A;  4N9P A;  1SYB A;  1QNU A;  4IUR A;  1TY2 A;  2B2U A;  3UI2 A;  5EJW A;  4XTC S;  4KD3 A;  2X6G A;  2L0C A;  5IGF A;  3ONA B;  2BE5 C;  3QG1 A;  4BY1 B;  1TWF B;  5ELC A;  2F0E A;  5E1F A;  3OMG A;  1IW7 C;  4C56 C;  4HSP A;  4XQJ A;  3MXP A;  1BNZ A;  2DNE A;  4ZLT F;  4EQO A;  1I6H B;  1TT2 A;  3KBX A;  4FXG C;  2RQX A;  4ID6 A;  1LTR D;  2FIN B;  3PUX A;  1RJT A;  3V2T A;  5IGB A;  3J7Y W;  5FK9 C;  1W6K A;  4EQP A;  2K05 A;  1WTP A;  4IFD H;  1S5C D;  4KN7 C;  1HFG A;  3HOV B;  3KBG A;  1JWS D;  1JB3 A;  5ELE A;  4BWG B;  2D62 A;  3A8J E;  3O13 A;  4QF4 A;  3P75 A;  5BN5 A;  1ROD A;  4C2M B;  2JXM B;  2IX0 A;  3VYU A;  3Q24 A;  1EWC A;  3T13 A;  3QOL A;  3GTQ B;  1MGS A;  4XIG S;  1LT4 D;  4KKU A;  4KY5 A;  1EEF D;  2MJ8 A;  4TSS A;  3U9O A;  1TS3 A;  1O78 A;  1DYQ A;  1IL8 A;  4DFA A;  1C4Q A;  2B8F A;  5CV4 A;  1PTO C;  4DXG A;  2CVR A;  2F3W A;  1PZI D;  2PZU A;  3KLR A;  2SDF A;  4CJ1 B;  1MBY A;  3M7G A;  2J7Z A;  1GXD C;  3HKZ B;  2Q8T A;  3T51 B;  3DEP A;  4FXD A;  3A55 A;  1OXT A;  5COR A;  3NSW A;  1BXT A;  5G3L D;  4DXF A;  4RGO S;  1NR4 A;  3BS1 A;  2F0M A;  2NYZ D;  1KNA A;  5CBA E;  3NP8 A;  4A3B B;  5IGC A;  3HS0 C;  1ET9 A;  4LK1 C;  1STY A;  5FO9 B;  1EYA A;  1IW7 D;  1H9S A;  1SYD A;  1EIH A;  3T4A C;  1EU4 A;  1TS4 A;  3K5L A;  4OIJ A;  4DN4 M;  5C4J B;  1RKN A;  1SAP A;  2PCF B;  2NN6 I;  1JCK B;  1Q12 A;  2NBF A;  1SNO A;  4BY7 B;  4ME5 A;  2L55 A;  1ENC A;  4G7Z C;  4R8N A;  4C1N K;  5DNF A;  4O1N A;  1W6J A;  1GUO A;  3X3N A;  1HA5 A;  4IUQ A;  5C0X H;  2WP8 J;  1YNN C;  4WFN 3;  5KGU A;  2NUC A;  1EYC A;  3J81 E;  1PRT B;  2EZV A;  2M00 A;  3D6W A;  4KN4 C;  1TS2 A;  1TWC B;  4QB4 A;  3A7L A;  5FOB B;  1BF4 A;  1STB A;  1VMC A;  1DZ1 A;  4XYO A;  3FVQ A;  1LT5 D;  2E74 C;  1SYG A;  4L63 B;  1FYC A;  1RTN A;  2TMP A;  5C6A A;  4IAL A;  3J7A V;  1H9M A;  5JEA H;  1QE6 A;  3HP3 A;  1FGB D;  1NCV A;  2WKC A;  3IFT A;  4DAV A;  2A73 B;  1PZK D;  1B44 D;  1NSN S;  3RUZ A;  3I4M B;  1BBX C;  3FKI B;  3VYS A;  2RDG A;  2KQ3 A;  3SHL A;  1XX8 A;  3A7A B;  1WTQ A;  3R8B A;  4HMJ A;  2LKV A;  3DWA A;  4RFB A;  4LJZ C;  2K1B A;  3RLF A;  3EA6 A;  4U67 3;  2K32 A;  2OF1 A;  4V0B A;  1CQV A;  4X3S A;  3P7J A;  1STH A;  3HRZ C;  1L0X B;  5C3X A;  3VR6 A;  4CJ2 C;  1DJR D;  2RBM A;  5JEA J;  5I9P A;  1ENA A;  2ZXR A;  5E4W C;  1M4V A;  4C3I B;  2H4O A;  3MWY W;  1EZ6 A;  1Y8O B;  2NTS A;  1FNV A;  3MVV A;  1B9N A;  1T5X D;  3OPO A;  5C3E B;  1D5X C;  4ILW A;  1JE4 A;  3FPU B;  2EOT A;  1XTC D;  2F0D A;  1EEI D;  4ZK9 B;  1CZW A;  1KAA A;  3M7N A;  1D5Z C;  3I3C A;  3M3Y B;  1EFI D;  3DHQ A;  2AWN A;  1H9K A;  3X3M A;  1IYU A;  2K01 A;  1CFM A;  3TZD A;  3L7Z C;  3L3O C;  2IX1 A;  4L6T B;  1EWH A;  3HEJ A;  2NN6 H;  4A3G B;  3GD7 A;  4UDU C;  1EY6 A;  1HFN A;  4P2C B;  1JWU D;  2LS0 1;  2O5J C;  3QJY A;  2F0J A;  4NKL A;  1I4G A;  1F9R A;  5JPM C;  1B9M A;  1QOH A;  4ABN A;  1ENF A;  1Q1B A;  2LY7 A;  1RCV D;  1UAP A;  1EY4 A;  4CHT B;  3HOU B;  5AFW A;  3D6C A;  2JEA I;  4DU9 A;  2PPB C;  5C4Z A;  4XQQ A;  5FKA C;  1U4M A;  2MHV A;  5G3L F;  1QIL A;  1EZ8 A;  1NAP A;  3J80 L;  5FO8 B;  2PQE A;  2OXP A;  2EJM A;  3A8K E;  3GTL B;  3EVQ A;  3OWE B;  4R9W A;  4NP5 A;  1L0Y B;  4RAU C;  1EY8 A;  2B39 A;  2ICE C;  5I2X A;  3NUC A;  1R4Q B;  2NVT B;  1DOM A;  1H9R A;  3WOF A;  4KY6 A;  4RA8 A;  4BA2 I;  3D8G A;  3OW7 A;  2WAQ B;  2NN6 G;  3VYT A;  3BG3 A;  5ISR A;  3L9A X;  3PIO 3;  4TKO B;  3K6O A;  4KJN A;  4XXE A;  1CK1 A;  2RSO A;  3OHX C;  5DAU A;  4KTA A;  2ICI A;  3I4L A;  1VDZ A;  3SDZ A;  1K8O A;  1G2S A;  2J0T D;  1ESF A;  3K5N A;  3IAY A;  2AQ2 B;  4CKC A;  1HUN A;  1OXX K;  4M8A A;  1BO0 A;  4XT1 B;  1QNK A;  5LHY 1;  2E2H B;  1B1Z A;  3R2T A;  1JR0 D;  2K5Q A;  4FVM A;  5M9O A;  1Y69 U;  5IIF A;  3PO3 B;  2IT1 A;  4K8I A;  3BDC A;  2FJ2 A;  2GA4 B;  1OXS C;  5I2Y A;  5KYI A;  1ZYR D;  1XWE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...