2B2YC

Tandem chromodomains of human chd1
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
86
structure length
86
Chain Sequence
EEFETIERFMDCRIGRKGATGATTTIYAVEADGDPNAGFEKNKEPGEIQYLIKWKGWSHIHNTWETEETLKQQNVRGMKKLDNYKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chromodomain-helicase-DNA-binding protein 1
publication title Double chromodomains cooperate to recognize the methylated histone H3 tail.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Peptide binding protein
total genus 22
structure length 86
sequence length 86
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2005-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2b2yC00
1IKMA 1DOKA 1VMCA 1GUWA 1LV9A 2EOTA 3D6WA 2J7ZA 5COYA 2KVMA 2X69A 4R8IA 2MPMA 2N88A 4ZLTF 3HP3A 1X3PA 2SDFA 2HUGA 2RSOA 1O7YA 4IURA 2NZ1D 3MWYW 1BBXC 1HFNA 1WTQA 4CJ0B 2B2WC 1ZXTA 2FINB 2EE1A 2DY8A 3N52A 1SSOA 2BDNA 4X3UA 1MI2A 4MHEA 4U68A 2K28A 4OIJA 1KNAA 1MSGA 2Q8RE 1VMPA 1J9OA 2FHTA 1U4PA 3P7JA 3DEPA 5E4XA 1WTRA 2B2VA 5EJWA 2MP1A 4ZKCB 5EPJA 2B2UC 5T1GA 1ESRA 1WVLA 4UAIA 1SAPA 2K1BA 1HUNA 2K04A 3GV6A 3G7LA 1WD0A 2L9HA 1BO0A 2H1EA 2HDLA 3F2UA 2R3ZA 4NW2A 4ZK9B 4X3TA 5EPLA 2B2TC 1G91A 1EOTA 1RTNA 2KOLA 3KUPA 2B2YA 1B50A 1B2TA 1X3QA 1O7ZA 4X3KA 1EIHA 1MGSA 1ICWA 3DEOA 2KEEA 3SVMA 1G2TA 4IUTA 1O80A 1HRJA 2RA4A 2X6GA 3QO2A 1PFMA 1U4LA 2L12A 3DM1A 1AZQA 2FJ2A 2EPBA 1U4RA 2RSNA 3UI2A 3H91A 5CBEE 1DZ1A 4IUPA 1SDFA 3I90A 4XT3B 1E0BA 3R93A 5DNFA 1HHVA 3ONAB 4RA8A 1J8IA 5AFWA 2KECA 5CORA 1HFGA 3GV3A 1B53A 4XT1B 3IFDA 4MN3A 5E4WC 2X6LA 1HA6A 4DN4M 2KEDA 4OIKA 4QUFA 1EL0A 4CJ2C 1QG7A 1IKLA 2IL8A 1PFNA 5D14A 3LWEA 2HDMA 1MSHA 1RODA 4LMQD 2B2VC 4IUUA 4RWSC 1TVXA 1PDQA 1A15A 2M2LA 1F9QA 5EKIA 1QE6A 1S4ZA 1G6ZA 2L4NA 1XYIA 2JYOA 2K03A 4ZKBB 3I91A 4IUVA 1JE4A 2D9UA 1BF4A 1CM9A 2B2YC 2FFKB 5JJZA 4HEDA 5EQ0A 1B4OA 1DOLA 3IL8A 1RTOA 1M8AA 4R9WA 1QNKA 1X32A 5CMDA 2VXWA 1DONA 1KNEA 2MGSA 3FPUB 2JP1A 2N55A 3Q6SA 1IL8A 3FDTA 2NWGA 2K01A 3MTSA 4QUCA 1NR2A 2Q8TA 1CA5A 1AP0A 4HCSA 3I3CA 2CVRA 1RHPA 1PLFA 2L11A 1EIGA 1JICA 1WTOA 2XIWA 1B3AA 1ML0D 5EPKA 2RVLA 4X3SA 2K05A 4ZAIA 3KBXA 1NCVA 1Q3LA 2MJ8A 1PFBA 1C8CA 4RAUC 2B2UA 1F9SA 4CJ1B 1G2SA 1WD1A 1CA6A 1WTXA 5D65A 3TN2A 1EQTA 2FMMA 1WTPA 2NYZD 2KUMA 1F2LA 2B2TA 4HAEA 2HCCA 5T1IA 1WTWA 1HUMA 2DY7A 1DOMA 1NR4A 1AZPA 1BNZA 5CBAE 1RJTA 1ILQA 1U4MA 3TZDA 1XX8A 2HCIA 1F9RA 1ILPA 1WTVA 2L1BA 4XDXA 1F9PA 4IUQA 4HSVA 3I8ZA 4O42A 2B2WA 1NAPA
chains in the Genus database with same CATH superfamily
3E6ZX 2F0FA 4Q0FA 3TP8A 1LT3D 2KVMA 4A3JB 3TSSA 3PIOA 2IY5B 3NSWA 4ILWA 1W6JA 2N88A 5M5XB 3OWEB 3M4PA 1ET6A 3R8BA 2JA7B 4HIOA 1WTQA 1K83H 5FJ8H 4K2LA 5IODA 2DY8A 1MHWC 1K3BC 3IRBA 3HOYH 2EYFA 4P74A 1HQRD 5FLXE 1PRTF 1O78A 4RGTA 4YHHQ 4Z9CB 1PFSA 1PH2A 3I4MB 1GXDC 2E2IB 3AB9A 3J81L 3PO3G 2K4KA 1Y8OB 2R3ZA 4ZK9B 4BBRG 4FF3A 3BZCA 3JAMi 1X3QA 4B3RL 4K5XA 4JK1C 3A7LA 4KHVA 4GKKL 4K0KQ 1HRJA 5IT9E 2ES2A 3A5UA 3KOJA 3OMGA 1A2TA 3Q22A 3M9BA 1KDBA 3J7AV 3ERSX 4A3GB 1X3EA 3U9SA 3NTHA 2VNUD 4K5WA 4OX9L 4PMCA 3SHLA 4JI3L 2NTSA 4DN4M 1H9RA 1AE2A 4JBJA 1JWSD 3J80L 5LL6S 5KIXA 4HMIA 3PUVA 3NPPA 3H6MA 1OTCA 1JE4A 3ULLA 2F0HA 1IYUA 5EBDA 1NMGA 4BY7H 3B6YA 3S16B 3LGJA 2AWNA 1BKBA 2N55A 3Q6SA 4DV2Q 1D1IA 1XTCD 1FJGQ 4JI2L 1WTOA 4JOIC 4S3SA 1EU3A 1XTDA 2BE5D 1D5XC 1VDZA 4X62L 2UU9Q 5CV4A 1PA6A 3PF4A 1X56A 4A93G 1CQFA 2EYOA 5GAGC 1N36L 1A3UA 5JEAJ 4YY3L 3M4OH 1W6KA 1EIFA 1R4QB 5FO9B 4JYAQ 3QR8A 2H4OA 5C0XH 4LFCQ 4XDXA 3NBHA 4DAVA 1Y1VB 5C4XG 2IX1A 2EOTA 4OWWB 4RKLA 2NVTH 1E24A 1HR0W 4B3SL 3DWQA 1VCIA 1R4PB 4A3KG 3GTKB 2F4VL 2Z4HA 2RSOA 4IURA 1NY4A 4DV3Q 4HTHA 2DN8A 4I7ZC 1HFNA 2B8FA 1D5ZC 4LWCA 1R9TB 2BDNA 1FD7D 2E2HB 4JI7Q 4ALPA 1I6VC 2FHTA 1L1OB 4KI0A 3DEPA 4DAYA 1EZ6A 2NBFA 3HOXH 1IL2A 3GTMB 4KN4C 3UE1A 3KK7A 4BXXG 1HUNA 3H3VH 2WV6D 2Z4IA 2QKIC 3MEHA 4R4IA 3EFXD 3HOWB 4LF8L 1U5KA 1EFID 3RLNA 4DUZL 3KBGA 2MNAA 4QCLA 2ALYB 4GKJL 1XNQL 1G291 5LMNQ 3A55A 1E1TA 3CCLA 4H0LC 4N8FA 1GM5A 1KC8C 1HPCA 1HR0L 1QUQA 3GTQH 3K5LA 4TRDA 4KY5A 1QZGA 1VQ4A 1FNVA 1I4GA 5C44G 4FP5D 4QUFA 4GNXA 1XPOA 2R93G 2NZOA 3NWTA 2EDGA 5KNDA 3H15A 5IP9H 2NVXH 1MSHA 3OW7A 3AMUA 4NDXA 4IFDI 3RZDH 1HJPA 1PZID 3T13A 3WOEA 1EWHA 2L55A 3G4SA 4A93B 1TWHB 4C2MB 4L63B 1KNEA 1WI5A 2KENA 2JK8A 3NBHB 4K6LA 1IL8A 4HCSA 1SR3A 2C9OA 2R61A 1J6QA 2RVLA 2Z9HA 4X66L 1I4QA 1CSPA 1IYVA 1KXLA 2XSCA 1FR3A 4IO9A 3TN2A 3FKIG 4A3KB 4DV7L 3PO2G 2B39A 1SE4A 3EROA 3K5MA 1PYWD 4DAYB 3ICEA 2BOSA 2LXJA 3PV0A 2A74C 2HCIA 4DR2L 3E0EA 1EUJA 3WOFA 3S1QH 3HOVG 1IYJB 1D6EC 3RNUA 4P2CB 4UP9A 1STNA 2VQFQ 3TBIB 5COYA 3PF5A 2RCNA 1XMOQ 4OHJA 1BBXC 2ZTCA 3WWVA 1ENFA 1HQMC 1HXYD 5C4ZA 4CGYB 4OIJA 3I55A 1QUQB 1S3OA 4A3FH 1STHA 1J9OA 2MO0A 1U4PA 4JG2A 4WRDA 3URYA 1LM0A 4DR4L 1HNXL 4GNXB 3T53B 5IYBH 2R7FA 5C44B 2IHFA 3KDFA 1W2BA 2A73B 1K28A 2B63B 5M5YB 5BN4A 3DEOA 1G2TA 2R93B 2V1CC 4IUTA 3VR2A 5C3EB 2RA4A 1OXTA 3BVMA 3VDYA 4XYOA 1DZ1A 2ID0A 3CHBD 2HHHQ 2VQEQ 3K8AA 2OQKA 4QL5A 2D5DA 5FJ8G 2PNHA 4MN3A 5E4WC 3HOYG 3HOUH 3S2DB 1D8LA 2A19A 2OTLA 1VQBA 4KHZA 1LYLA 1KDCA 5IGCA 1RODA 3T1YQ 3H0GH 4GLXA 2I5HA 4PZ8A 4H44C 4DV5L 1FGUA 3M4QA 3T4AC 3S1RB 1LUZA 4FF4A 3EQLC 4IUVA 1EYDA 2F0TA 5J3BA 2DJFC 3FKIB 4KK7A 3PO2B 1ZYRC 3I72A 1CT1D 3JC66 1DM0B 1KDAA 2NWGA 1BBUA 1ESFA 2MHVA 1YI2A 3HOVB 3F1ZA 3GP7A 5GAHC 3GTLB 3S15H 2CH4A 2EY6A 4EQNA 5C4JH 2HQLA 4EQPA 4RAUC 1CA6A 1CKMA 5ELDA 1ET9A 3S17B 3J81E 1K8OA 2LY7A 2UXCQ 2LKVA 1NSNS 3NE5B 4HIDA 1XX8A 5I9PA 4IUQA 4BY7G 3I8ZA 3KDFB 1DOKA 2KCCA 4DAPA 2Z0SA 1TWCB 1UE6A 1PTOB 5GAEC 3E5SA 5LHY1 1I3QH 2E76C 2NZ1D 1SN8A 2UUCQ 4MTKA 1WCMH 3A8KE 4JBWA 4U68A 1SFOB 4A76A 2E5LL 5DAUA 4GN5A 4ULLA 2B2VA 2MP1A 2YU9H 4QIWE 3J80E 3CRKC 3W1GA 1K83B 3T16A 1HZAA 4OWXB 2Q8IB 4RGNA 3AFPA 1RTNA 3KUPA 3HOYB 1JORA 5C0XG 1A63A 1ICWA 2EQSA 2ZM6L 1XMQL 3CPFA 1AZQA 4XYQA 3MZ5A 3PUWA 1HNWL 2AHOB 4BBSH 2AWOA 3K57A 1K73C 2QCPX 3SXHA 2LS01 1T5EA 3FVQA 2N49A 3SK6A 1JC7A 2K32A 3NTIA 4L8JA 3HOXG 1KLUD 2ENBA 1V1PB 3L7ZC 4O1NA 4KKTA 2XNAC 4F8MA 3CMEA 4G7ZC 1N33L 1Q1BA 2UUAQ 4KV6A 5C3XA 1VQKA 1QE6A 1KHIA 1TY0A 4LF4L 1VQNA 4LFAL 3W2DA 2RDHA 4DV6Q 1VQ6A 3CCSA 1B4OA 2K5QA 1N34Q 1RTOA 1TWGH 2DJGC 2VXWA 3CCRA 4IFDH 4A3EH 1NJIC 1D2BA 5CV9A 4QIWB 4DUYQ 4POGA 3QB3A 3SK8A 1SMYC 4X3SA 3OHXC 4ZAIA 2RHSB 4A3IH 1E2ZA 5IE8A 1ENCA 5KEEA 4DU9A 5BN5A 2E2JB 5IP9G 2IT1A 2VS1A 2PQAA 2JA8H 3LNNA 2EY1A 4X64Q 4QB4A 4KJOA 1T5XD 1ILPA 1ZYRD 3A74A 4LMQD 5KRUA 1PH1A 3CC4A 3V05A 3M4OB 3OW2A 1PTOF 1YZ6A 3CP0A 4FF2A 1YJNA 1MJCA 3I4LA 3N52A 2F0DA 3CQZH 2UXBQ 3VYTA 1CZWA 1YITA 3P7JA 4KJNA 2BH2A 4JBKA 1C48A 3EN2A 3BJUA 5JPMC 4CDCC 3AEVA 5IY0A 1G91A 5EPLA 3T1HQ 1VQAA 3U50C 4K14A 1J5EL 5AJ3Q 2ZJQA 3SVMA 3MXUA 1A2UA 4FXKC 2C35B 4BS9A 2JA6H 4DR5Q 5K36H 3MXGA 1EY4A 4NXNQ 1E0BA 1UEAB 1Y1WB 5M9OA 5TSSA 1DD2A 1FNWA 4X65Q 2NVQH 1GD7A 1TQOA 3GV3A 1B53A 3IFDA 4R4QA 4RCOA 2M00A 3MAQA 4FNFA 1PHJA 4F87A 3BDOA 4A3FG 3TS2A 4A4IA 4PG3A 3LWEA 3F2DA 4FO2A 1YHAA 3T56B 4L5SA 5IYBG 2KJXA 4UPAA 3SK4A 1A15A 1VQPA 1S72A 3S1NB 1F9QA 1YNJC 1LTGD 1S4ZA 2L4NA 2PQAB 2D9UA 3KLSA 4JI4Q 5JJZA 2EIFA 2NVXB 5JJLA 2RQXA 3O13A 1M8AA 3ITPA 1PMRA 2JQOA 4RH6A 3I73A 4R8NA 3OTOL 3FP9A 4JI1L 1MJEA 1SRUA 3HOUG 3DXJC 3KBXA 5G3LF 1TT2A 1A6XA 3NENA 1WTXA 5IGFA 2VB3X 3H0GG 3EBEA 1CKNA 3PIO3 5ELBA 2K5VA 2HCCA 1P8LA 5EAYA 3KF6A 1L0WA 4RG1A 4B3RQ 1SYGA 4GKKQ 2B2WA 2ZJPA 4DV1L 1YJ9A 2EYMA 3GTOB 3HKZG 3SE0A 3KJOA 5GQOA 4DAMA 4QQBX 2F3VA 3GTPH 1SMYD 4FVMA 1ZXTA 3ZJYC 1V9PA 2FINB 4QGUA 1VQOA 4OX9Q 1LTLA 4UY8C 3G6EA 1EFWA 2JA5H 2IPKD 4JI3Q 2KHJA 4TQUS 4A3LH 2CQAA 1WTRA 1EY6A 1EQRA 4V0BA 3NP8A 3RLOA 4PZ6A 1Q8IA 3SK5A 2QA4A 5FO8B 1PZJD 2ZXOA 5T1GA 2CH4W 1SAPA 3G7LA 5IIFA 2WINB 1WD0A 3I4NH 3BG3A 3EJIA 3HKZE 2ICEC 3F2CA 2F0KA 3BU2A 4A3MH 1SYCA 3BVGA 1MKHA 2OEOA 4P73A 2D2CC 1S5DD 4UP7A 3NELA 1PYSB 4OONA 4JVZA 2BA1A 3P20A 2CKZB 1WCMG 3RN2A 4JI2Q 1PYBA 1A3TA 4HIMA 1ICFB 3JAMc 2XWBB 4CJ2C 5EKLA 1C7YA 1I4RA 5ELEA 4X62Q 3DWPA 3BS1A 3TP6A 1N36Q 4IUUA 4LF9Q 3TREA 4YY3Q 4GNXC 4K6DA 2QW7A 3HOUB 1JJGA 2AUJD 1CKNB 4OEMB 2XGTA 2JE6I 5EGTA 3KF6B 5EQ0A 2I5MX 4K8JA 4ME3A 2XRQD 3KJPA 1QNKA 4HSPA 1L1OA 4B3SQ 1EY0A 2AQ2B 4BBSG 1EYAA 2Q8TA 4QUCA 4KHPL 2F4VQ 4LF6L 2HQEA 3D4WA 1TWFH 5KYLA 1GUSA 5F2DA 5EPKA 4CBVA 2IHEA 4QF4A 1P16A 1Q3LA 1PFBA 3CCMA 1Z9FA 4DA2A 2SNSA 3R2TA 3HKZB 4RGOS 2B2TA 2XTIA 1YNJD 3TP7A 3KLWA 3RMHA 3S15B 2DY7A 3GDEA 1H95A 4DNIA 2KCTA 2E8GA 2IW3A 2Z8LA 4DUZQ 1CSQA 1GO3E 4QY7A 4GKJQ 1XNQQ 4CJ0B 5I6YA 1TS4A 3D6WA 3A7AB 4IFDG 4A3EG 3TZUA 2C5CA 2XVSA 5I9OA 3I2ZA 4A3BH 3HP3A 1HR0Q 1WFQA 3ND8A 3KF8A 3J7A5 2YTYA 4IQZA 1V1QA 2EE1A 4X3UA 1HA5A 1K8MA 4A3IG 1TWAB 3H94A 4MHEA 1HZ9A 1SROA 4LF7Q 2WACA 2R6GA 2K52A 4DXGA 4ZKCB 1I3QB 4ZRZA 2JA8G 2XRSD 1BVSA 3A0JA 4RKBA 1B50A 3PO3B 5LMUL 4G7OC 1EQVA 4RCNA 2RDFA 4IOCA 1K3RA 1YBYA 3ULJA 2WB1G 4BBRB 2FJ2A 5CV6A 2SNMA 3TEHB 4XT3B 2F0GA 4I65A 5CC4A 3UE0A 4DR6L 4JI6Q 1J8IA 5H1SE 3AFQA 3PMFA 2F3IA 1HTLD 4ZCKA 4LF5L 1KAWA 2ZTDA 4LJZC 4X66Q 5IGEA 2K50A 1LTSD 1CFMA 1I50H 2O5JC 4DV7Q 1K8AC 2EY2A 3L0OA 3EIVA 4C3HH 2JYOA 1CKOA 2G5DA 4DR2Q 2GA4B 1AN8A 2L0CA 2JA6G 5K36G 5C6AA 4DGZA 4GOPC 4BA2I 4DK0A 4XQNA 4DV0L 1G8ZD 3FPPA 1L2FA 4OWTB 3CU7A 4PNYA 1JICA 1F2YA 1B3AA 3W5OA 2DNEA 3M85A 3GTGH 3KF8B 2F0QA 3MXPA 2QEXA 4DR4Q 2O2LD 4C1NK 4BY1H 1HNXQ 1BDOA 1YNXA 2UU9L 2K5NA 3X3NA 3S1MH 1GJXA 4A3IB 4NMZA 5M5WH 1VF5C 4DNTB 3K7AH 1F9PA 1KRSA 4HSVA 1NAPA 2J7ZA 1S40A 2MUYA 1BOSA 4R8IA 3G48A 5C4XB 2AMCB 3DUZA 1PVOA 1CZGA 4AQYQ 1B1ZA 1TY2A 2Q2HA 3J7AF 1EU4A 3MXNA 1GUNA 1Q81C 2JXMB 4DK6C 2EJFC 2OT2A 1A62A 4UAIA 2K1BA 3HFZB 3S2HH 3GV6A 3CQZB 1SNQA 4APVA 4NPSA 4DV5Q 1TU2B 1EOTA 4X3KA 3AQQA 1Y69U 2JSOA 4G7HC 5I6WA 1S5BD 1Q7YC 2L12A 1U4LA 3AU7A 1DGSA 2SEBD 3UDXA 1N8RC 3I90A 2XWJB 4L5QA 4P71A 1JB3A 4ZYSA 5FO7B 3PCOB 1LLRD 2F0PA 4JOIA 1VQDA 2K5DA 5IWAL 2JN4A 2JA5G 4A3LG 2KEDA 3KLSX 3V2TA 1IKLA 2J0TD 3M3YB 3HEJA 1SYEA 5A2QL 3HG9A 1LT5D 1TKWB 1SMXA 2LXKA 3SGIA 3I4NG 5KGUA 3I70A 2UUBQ 1OXXK 4YCWA 4HMJA 1AH9A 1G6PA 2FFKB 2B2YC 2F0VA 4A3JH 4OO1I 4A3MG 1TXYA 5CMDA 5M5XH 1DONA 4JI8L 4J1MA 3GTJB 1E1OA 3FDTA 3GO5A 5EKKA 5I4DA 5KNBA 4RFBA 1I6HB 4RGMA 3VR4A 2ASBA 1FL0A 1H9MA 4LFBL 2F3WA 1QOHA 2E5LQ 1PRTC 1TR5A 2CWPA 1HTPA 2AQ1B 2FMMA 5ELOA 1SE2A 3J7ZC 3U4VA 2CCZA 3MXNB 1AW7A 1EQQA 1JOOA 1V1OA 1NR4A 4ABNA 1AZPA 5FLMH 5JVH3 2RHQB 1WTVA 4CKCA 4NXML 1BQQT 1RD9D 2ZM6Q 2KBNA 1FYCA 4IN3A 4A3GH 2X69A 2I0QA 2MPMA 1HNWQ 1V1PA 4ID6A 1O7YA 5FLXc 4DF7A 2BA0A 3PIP3 4R4TA 3S24A 2NVYH 2F52A 1PV4A 3FRPB 1ENAA 1YNNC 4IPHA 2I46A 4NKLA 2B2UC 1ESRA 1FVIA 1YVCA 2K7VA 4GN3B 4KLKA 2MFIA 2VUMH 3K80C 5IT9c 2H1EA 1N33Q 2JA5B 1H9KA 4NW2A 4X3TA 1X9NA 1QZHA 4LF4Q 4LFAQ 2SOBA 1UE1A 4KD4A 1PFMA 1L0YB 2R92H 2Z6KA 2EPBA 2RSNA 4A3BG 3UDIA 3RZOH 3I4NB 4AIMA 3K6OA 1X6OA 4XTCS 1NE3A 5CV7A 4A3MB 1PH9A 3HOZH 5J22A 5K5PA 1EL0A 1HZCA 4DKAC 1PFNA 3QOJA 3C1FA 2OF1A 2NN6I 1B9MA 5JVG3 2WAQG 1Q90A 1YHBA 1H9JA 3BZKA 1PXUA 2RBMA 4MNOA 4HJ8A 1Y1VH 2K03A 2LMCB 1BF4A 2YTXA 4B3ML 4IPCA 5ELNA 2TMPA 5FOBB 2YTVA 2EY5A 1STEA 1F2MA 4N9PA 3IFTA 2IJ0A 3FEWX 1RIPA 2WKCA 3TDQA 1I4HA 4ME5A 3GTMH 5JEAH 3MFYA 1SNCA 3OOCA 1X65A 1C8CA 1GUTA 1F9SA 2A69C 4C3JH 4DR3L 3HOWH 4ZUJA 4DR7L 3F2BA 2K33A 1TWFB 1KABA 5T1IA 1T9HA 3HGBA 4C3HG 1BNZA 4Y7NH 3KFUA 1J5EQ 2JEBI 3GD7A 1F9RA 2EYPA 2UXCL 1VQGA 3R2IA 1UUPA 1IKMA 4YIJA 2N8NA 1DXMA 3VYUA 5IP7H 4ZQ3A 2Q2TA 3Q24A 2PW5A 4RHSA 1EZ8A 3DM3A 2CW0C 3RR5A 4BY7B 1SNOA 2HUGA 1JJCB 1KIXA 3ZYYX 2B2WC 2OCEA 3CC7A 1PRTD 2K28A 2BH8A 3CC2A 5E4XA 2PI2E 2EYHA 3NQIA 5EPJA 1IBKL 4BY1G 3I4OA 2L9HA 2HDLA 3QJYA 2ZXRA 2DUDA 1TWHH 3WDNA 1BUVT 1CTMA 4WJ4A 1EIHA 2CQOA 3V96A 1EIYB 1O80A 3TS0A 3QO2A 4H13C 3Q0AA 2QF7A 1OXVA 1NNXA 1Q12A 4UHVA 1IBLL 1M4VA 3EVQA 4LK1C 1HHVA 5M3FH 2OQ0A 3OWFA 5I2XA 2NVTB 1DCZA 1VQCA 5CORA 2F0MA 4JI1Q 3CCUA 1BXTA 2UXDL 4A3KH 4AYBG 3PUYA 1YNND 1LTRD 1UWVA 5C3WA 3K58A 4OXPA 2K75A 2K5HA 3HOXB 1EWIA 1NTGA 4KKUA 4WJWA 1WTHA 4RHRA 1N9WA 1CM9A 2EZVA 1SBBB 1MBYA 2MGSA 3K7UC 3OMCA 1YEZA 4MIUA 3SEBA 4AYBE 4C3HB 3MEFA 2VZAA 2I07B 5C5LA 4F88A 1LTTD 1IBML 2QDLA 4DR1L 1RHPA 4FDBA 3OSOA 4OO1H 1C0AA 5DM63 2KCMA 1L1OC 4OL7A 3C2PA 3GTQB 1OXUA 4EVOA 1Z6HA 1VQHA 2R7DA 1EY5A 4CJ1B 3H3VI 3QIAA 1JB7A 1VF7A 3R3OA 2B63H 5M5YH 1G51A 5M3MH 2F0NA 1DOMA 5C3EH 1U4MA 2NZHA 3RZDB 2R7ZH 5IOCA 2L1BA 4PV1C 4A3JG 3M7GA 2G9DA 4BY1B 3NTKA 3DHQA 3S1MB 1VQFA 4TKOB 3LX0A 1N32L 4LUZA 2E75C 3MWYW 5CR3A 4C3IH 1AEXA 3S2DH 1SSOA 4K5VA 4KY7A 5KYIA 3ULPA 2Q8RE 5GROA 2A69D 2G9HD 2PZTA 1RF2D 1K8GA 5A2QE 2VY3A 2UXBL 3NQTA 3NBIA 3RN5A 5DM73 1XXGA 5FLMG 2CFMA 2JEAI 3PUZA 1Z47A 1IHZA 4AYBB 1B7YB 4HJ9A 2WFWA 4FYDA 2V4DA 1U4RA 1E22A 1HCZA 5CBEE 3S1QB 2CW0D 4DFAA 4A3GG 2F0SA 4O2DA 1LACA 3ONAB 1SE8A 3DLLA 4LF6Q 1SLJA 3NWSA 1VQLA 3A54A 3PGZA 4QMGA 1K0SA 4JBMA 2DNCA 1HA6A 5GADC 1H9SB 4L6TB 4A3DH 4GLAC 1LTID 4POFA 4OGQC 5E1FA 3AYHB 4JI5L 4A3FB 2Q2UA 4JW0A 2VUMG 2HIVA 5D3IB 4UDUC 4YWMA 4IUNA 1KAAA 1HNZL 5IYCH 4H02A 4ZUIA 2R92G 2NN6H 1LTBD 5CV5A 4CHTB 1TWCH 1LT4D 4I7AA 4DV4L 1JCKB 5BR8L 1HZBA 3K81C 2NB0A 3MTSA 1I4XA 1Q8KA 4XQQA 4C1NI 1SFOH 4DK3C 1PH7A 1EIGA 2Z6BA 4K8IA 3HOZG 3J81c 1MIUA 4R1JA 5JAVA 2MJ8A 3FHWA 4TVAB 2A1AA 3Q23A 1E7ZA 3A56A 2HIXA 1CUKA 3J81i 2NYZD 3G71A 2KUMA 2NTTA 3JAML 1XNRL 1BCPB 4KMUC 1QCBD 1SYFA 1Y1VG 3U4ZA 3H0GB 4HJ5A 1ILQA 1QVCA 5LMUQ 4B3TL 2Q2IA 4DXFA 2CHBD 1GUWA 1LV9A 5BN3A 2PNRC 4N8X1 4DR6Q 1I94L 2P5ZX 3KLRA 2A8VA 3J80c 3CF5A 5JEAG 1UE7A 3HRZC 4LF5Q 4YCVA 3NHHA 4JV5L 3J80i 4C3JG 1SNDA 3HOWG 4LF8Q 5C4JB 4IZ8A 2F0LA 4GN4B 3IAYA 3BDCA 1RCVD 2NVYB 3D3RA 1GHJA 5EBCA 1C4QA 2Y0SG 3VR3A 4JI0L 4X6AH 3M4YA 3RLFA 3D6CA 3CD6A 5IP7G 1NBWA 1QVGA 4UP8A 2VUMB 2F0UA 3OPOA 1QJOA 2QILA 1UE5A 4WORA 5IYDH 4DV0Q 1MD2D 1JWMD 4WFN3 4NB3A 4XT1B 2R92B 1CQVA 2ZT9C 4IJLA 5J1ZA 2E2JH 2D62A 3CXCA 2IL8A 1WCMB 2EXZA 5D14A 3S9WA 1YJWA 4M8AA 1XJVA 2N3SA 2ZTEA 2A6HC 2WKDA 3A5ZB 3RZOB 2Y0SE 4YHHL 3G6JB 2ATWA 2DGYA 2PZWA 2YU9B 3HOZB 3C1EA 2E2DC 4ZKBB 4LF9L 3MFGA 4K0KL 3UDGA 3CAMA 1KD1C 1DOLA 3Q8DA 5I2YA 4U673 1PTOC 3FPUB 5M3FG 1ASYA 5L37A 5CGKA 4IJHA 2QEJC 4BBSB 3TP5A 4IFDJ 1S5FD 4EQ5A 1PH5A 2WB1E 1VQ7A 1VS0A 1STYA 3NUCA 1BCPF 1EYCA 4HAEA 3K5NA 3CCQA 4KY6A 1E2WA 4AH6A 5CBAE 1SYBA 4K2KA 1KRTA 3RUZA 4C3JB 2F0JA 4JCVE 4MTNA 5CYUA 1A0IA 1WD1A 2VL6A 1WYDA 3HS0C 4F7XA 1Y1WH 4JPBW 1B70B 1FGBD 4PMBA 2K6AA 3BZDB 4DV2L 4Y7NB 1TWGB 2SDFA 1F2ZA 3K59A 2Y0SB 4A3EB 1FJGL 4OO1G 2B8GA 1E3PA 5IWAQ 2B29A 1V8QA 2F0WA 1ASZA 4GZYC 3C3LA 1VMPA 2RDGA 5KNCA 2M9VA 2EXDA 1YIJA 4R4CA 3S1NH 1FNUA 3CPWA 4CDDC 1WVLA 4LF7L 3A8IE 2B63G 4IOAA 5M3MG 3MVVA 5C3EG 4OELB 4JYAL 3NK9A 5LMNW 2JA8B 2R7ZG 4LFCL 4B08A 2KEEA 1II3A 1B44D 2X6GA 1XPUA 1D5MC 4EX5A 3CW2C 3H91A 4G57A 5DLQE 4JI8Q 1SDFA 2WB1B 1BBWA 1O7IA 4RA8A 1M90C 3ER0A 4DV3L 5AFWA 4C3IG 4CKEA 1HFGA 4KKSA 2Z6KC 3NEMA 3VR5A 4JI6L 2A6EC 4JI7L 4LFBQ 2EYLA 1SXTA 2VW9A 1VQEA 5M3FB 5JPNC 3CMAA 5NUCA 3P1HA 1L0XB 3CKIB 4QJFA 1JMCA 2B2VC 4HJ7A 1AFPA 4J15A 5FKAC 4KN7C 2F0EA 3CCEA 1B8AA 1PZKD 3I91A 3LWUA 3S14H 1Q46A 5LMNL 2NUCA 4NXMQ 4R9WA 3TMEA 3GTOH 2RCFA 3K5OA 1ONLA 2JA6B 2D0OA 2D0PA 2YV5A 4GLVB 4XQJA 1CA5A 3UDFA 4IALA 1I4PA 1PLFA 3W1BA 2PMZE 4E6IA 1ML0D 2NVQB 2A68C 2K05A 4A3DG 1NCVA 2ZXPA 3E9IA 2A6HD 3E0JA 3L3OC 1G2SA 2IX0A 2PCFB 3E3XA 3CCVA 2K5WA 1WOCA 1JOQA 2GVBA 1V43A 1CHQD 1WTWA 2AUKA 4FXDA 3DMUA 3VA5A 1EY9A 3MHBA 1QNUA 4YWLA 5IYCG 4WJ3M 3M7NA 2JA7H 4RMFA 2NN6G 3H3VC 4A3CH 1PTOD 3L2PA 1EEFD 5M3MB 4ZLTF 1Y8NB 2PO4A 2OTJA 4CDEC 2R7ZB 2E2IH 2PW7A 3I4MH 3N6RA 2TSSA 1RL2A 2F0IA 3K0XA 2OWOA 1XPRA 3PUXA 2FXQA 1KNAA 1LABA 1JJ2A 4AQYL 5HGTA 4C3IB 2J4XA 2FMCA 2K04A 3F2UA 4HR7B 3OIPA 1XMQQ 2L5TA 3D4RA 3BYTB 5JOBA 5HURA 3BDLA 4GOPA 2LSSA 1GUGA 2VQFL 2PMZB 4B3MQ 1EY8A 3R93A 5DNFA 1XMOL 2KECA 1QWYA 1CHPD 4HCEA 3ND9A 1STBA 3F8TA 4B9XA 4OIKA 3GTPB 1QG7A 5HGQA 5FLXL 1D1KA 1IZ6A 1C9OA 2O4XA 3I56A 1B3QA 3CCJA 4DR3Q 4DR7Q 2BCOA 4H7BA 3S16H 2PZUA 3JAME 2ICIA 1HH2P 4G4KA 1SYDA 5EKIA 1XYIA 2MQHA 4A3DB 3D8GA 1XWEA 3P75A 3KYHC 4DNRB 1BR9A 4HN7A 2EJMA 4HEDA 5IT9L 1OXSC 3IL8A 1SNPA 2UUBL 1X32A 2PYKA 3VYSA 5CV8A 5IYDG 2CWAA 2GVAA 2HHHL 2VQEL 1TWAH 1D7QA 5G3LD 2VB2X 1AE3A 2EYJA 2A6ED 2EJGC 1PH4A 1GHKA 1Q86C 2F4IA 5C4HA 2KHSA 1O7LA 1JOKA 5D65A 2WIIB 3T1YL 1IBKQ 4C56C 3SDZA 4N9TA 1X54A 4DPGA 1VQJA 3PO3H 1KLGD 1HUMA 2I5LX 4J8QA 3QG1A 2IX3A 4BBRH 3D31A 3GTKH 4LNQA 1TIID 4MZ9A 1EYGA 4Y52H 5IGGA 3VYRA 3BYYB 4A75A 3PIPA 4LW1A 1R9TH 4PZ7A 1VMCA 1Y14B 3I7FA 3D0FA 2E2HH 3NXWA 1IBLQ 4GOPB 2WAQE 1A3VA 1STGA 1LT6D 4YWKA 2A68D 3E9HA 2F03A 1UNSA 2UXDQ 1MSGA 1M1KC 1SNMA 2QGQA 2GN5A 1LO5D 2WP8J 3IKJA 1IXRA 1TS3A 4CKBA 4BWGB 1JT8A 2IWHA 2Z1CA 1QILA 2PI2A 3J7YW 4XXEA 1BCPC 2KOLA 5E3FA 2B2YA 1KTKA 2OXPA 3U58A 1B2TA 1MGSA 4P72A 4HJAA 3PQIA 4KTAA 5C0XJ 1Y1WG 1K9MC 4KD3A 3UI2A 5E7NA 1Q1EA 2B3GA 2F0OA 2LFNA 1A8VA 1KL9A 5HY6A 5D3DA 2PQEA 1IBMQ 5IGBA 2PPBC 4A3BB 2UUCL 4DR1Q 4O0AA 3OYYA 1EEID 2F1MA 2MO1A 1VQIA 1JR0D 4A93H 3RD4A 2L15A 4C2MH 1ZKOA 1IW7C 4DK1A 1Q82C 1TVXA 1PDQA 2KA7A 5IGDA 5ISRA 1JWUD 3HZXA 1GOZA 2WAQB 2KCNA 3SR1A 1NMFA 4R4OA 3H09A 1NUCA 3STBC 1EOVA 1Y8PB 1YHQA 5C4XH 2H5XA 1VQ8A 3OTOQ 2JA9A 2JP1A 3ERQA 2BDOA 4CDFC 4LAAA 1NR2A 2N78A 1N32Q 3MC0B 1WJJA 3DWAA 1LTAD 4L5TA 1PH6A 1EWCA 2YYZA 1SJHD 4EQOA 2K14A 2B2UA 2AKWB 3EA6A 5C0XI 4PMWA 1TS5A 3CRLC 4FXGC 1WTPA 3QWNA 1F2LA 5JJIA 5LL6X 4BXXH 2UUAL 1I50B 1S5ED 4V190 5ELFA 3W3AA 1F77A 4DV6L 1RJTA 4M1UB 3TZDA 4DV1Q 3L9AX 1N34L 1I5FA 1H9SA 2X6LA 4P75A 4Q5VA 1GKHA 5DEHA 5JJKA 4JC0A 1X3PA 1VQ5A 1X55A 4DUYL 3T51B 3TRZA 1SEBD 3M3YH 2RKSA 2ZJRA 5C44H 4IPDA 1MI2A 1E2VA 3D4DA 4J6HA 1GUOA 4PQXA 1SJED 1X3FA 4HIKA 5EJWA 1B9NA 1KQSA 2R93H 3J81j 1PRTB 3FMCA 4JI5Q 1UEBA 3GTGB 3BVZA 2KHIA 1EY7A 3X3MA 1OO9B 1BO0A 4X64L 1VQMA 1Z7TA 2B2TC 2XN9C 2RF4A 1K0RA 1O7ZA 4EGVA 3PSIA 2JA7G 1HNZQ 5M5WB 2E74C 4YCUA 5ELCA 4LUOA 3GTJH 4A3CG 3DM1A 1VQ9A 2AQ3B 3K7AB 1ZEQX 4DV4Q 1U9RA 3C46A 3QOLA 4IUPA 5BR8Q 1I6HH 4L5RC 4BA1I 2KQ3A 4NP5A 3I4MG 3VR6A 3K0YA 5J39A 3A8JE 1X3GA 3S1RH 3HKSA 1W3SA 2BE5C 3TQYA 2HDMA 3FKIH 1TS2A 3PO2H 1UAPA 1XNRQ 4RWSC 2M2LA 1QVFA 1BCPD 1JQYD 3T1HL 4FF1A 1DJRD 1G6ZA 4TSSA 5FK9C 3S2HB 5AJ3L 5C5MA 1STAA 4B3TQ 2HT1A 4DR5L 3HOVH 4IPGA 4KHPQ 3GTLH 4ODGA 2A5HA 3OIQA 2EVBA 4NXNL 2HD3A 2JJQA 1U0LA 3VA7A 2K01A 4X65L 3S14B 3U9OA 1I94Q 3S17H 1AP0A 3I3CA 2CVRA 2L11A 5A35A 2XIWA 4LUVA 4B9WA 3MA2B 2O5IC 1JE5A 1DYQA 2QDBA 1PH8A 3GQBA 4JV5Q 1EQTA 1CK1A 4XIGS 1IW7D 1QB5D 1RKNA 1GVPA 4GS3A 1SE3A 1S5CD 1PH3A 1PTOH 1RDPD 4JI0Q 4JI4L 3STBD 1CI3M 4O42A
chains in the Genus database with same CATH topology
3E6ZX 2F0FA 4Q0FA 3TP8A 1LT3D 2KVMA 4A3JB 3TSSA 3NSWA 4ILWA 1W6JA 2N88A 5M5XB 3OWEB 1ET6A 3R8BA 2JA7B 1WTQA 4K2LA 5IODA 2DY8A 2EYFA 1HQRD 5FLXE 1PRTF 1O78A 4RGTA 4Z9CB 2E2IB 3I4MB 1GXDC 3AB9A 3J81L 1Y8OB 2R3ZA 4ZK9B 4FF3A 1X3QA 4K5XA 4JK1C 3A7LA 4KHVA 1HRJA 5IT9E 3OMGA 1A2TA 3Q22A 1KDBA 3J7AV 4A3GB 3U9SA 3NTHA 2VNUD 4K5WA 4PMCA 3SHLA 2NTSA 4DN4M 1H9RA 1JWSD 3J80L 5LL6S 5KIXA 4HMIA 3PUVA 3NPPA 3H6MA 1JE4A 2F0HA 1IYUA 5EBDA 3S16B 2AWNA 2N55A 3Q6SA 1D1IA 1XTCD 1WTOA 4S3SA 1EU3A 2BE5D 1D5XC 1VDZA 5CV4A 1CQFA 2EYOA 1A3UA 5JEAJ 1W6KA 1R4QB 5FO9B 2H4OA 5C0XH 4XDXA 3NBHA 4DAVA 1Y1VB 2IX1A 2EOTA 4RKLA 3DWQA 1VCIA 1R4PB 3GTKB 2Z4HA 2RSOA 4IURA 4HTHA 2DN8A 4I7ZC 1HFNA 2B8FA 1D5ZC 1R9TB 2BDNA 1FD7D 2E2HB 1I6VC 2FHTA 4KI0A 3DEPA 4DAYA 1EZ6A 2NBFA 3GTMB 4KN4C 3KK7A 1HUNA 2WV6D 2Z4IA 2QKIC 3MEHA 3HOWB 3EFXD 1EFID 3KBGA 4QCLA 1G291 3A55A 4H0LC 1HPCA 3K5LA 4TRDA 4KY5A 1FNVA 1I4GA 4FP5D 4QUFA 3NWTA 2EDGA 5KNDA 1MSHA 3OW7A 3AMUA 4NDXA 4IFDI 1PZID 3T13A 3WOEA 1EWHA 2L55A 4A93B 1TWHB 4C2MB 4L63B 1KNEA 4K6LA 1IL8A 4HCSA 2C9OA 2R61A 2RVLA 1I4QA 1IYVA 2XSCA 1FR3A 3TN2A 4A3KB 2B39A 1SE4A 3EROA 3K5MA 1PYWD 2BOSA 3PV0A 2A74C 2HCIA 3WOFA 1D6EC 4P2CB 1STNA 3TBIB 5COYA 4OHJA 1BBXC 1ENFA 1HQMC 1HXYD 5C4ZA 4CGYB 4OIJA 1STHA 1J9OA 4WRDA 1U4PA 3URYA 3T53B 5C44B 2A73B 2B63B 5M5YB 5BN4A 3DEOA 1G2TA 2R93B 4IUTA 3VR2A 5C3EB 2RA4A 1OXTA 3BVMA 4XYOA 1DZ1A 2ID0A 3CHBD 2D5DA 4MN3A 5E4WC 3S2DB 4KHZA 1KDCA 5IGCA 1RODA 4H44C 3T4AC 3S1RB 4FF4A 3EQLC 4IUVA 1EYDA 2F0TA 3FKIB 4KK7A 3PO2B 1ZYRC 3I72A 1CT1D 1DM0B 1KDAA 2NWGA 1ESFA 2MHVA 3HOVB 3GP7A 3GTLB 2EY6A 4EQNA 4EQPA 1CA6A 4RAUC 5ELDA 1ET9A 3S17B 3J81E 1K8OA 2LY7A 2LKVA 1NSNS 3NE5B 1XX8A 5I9PA 4IUQA 3I8ZA 1DOKA 2KCCA 4DAPA 1TWCB 1PTOB 3E5SA 5LHY1 2E76C 2NZ1D 3A8KE 4JBWA 4U68A 1SFOB 5DAUA 4ULLA 2B2VA 2MP1A 3J80E 3CRKC 1K83B 3T16A 2Q8IB 4RGNA 1RTNA 3KUPA 3HOYB 1JORA 5C0XG 1ICWA 1AZQA 4XYQA 3MZ5A 3PUWA 2AWOA 3K57A 2QCPX 3SXHA 2LS01 1T5EA 3FVQA 3SK6A 1JC7A 2K32A 3NTIA 4L8JA 1KLUD 2ENBA 1V1PB 3L7ZC 4O1NA 4KKTA 2XNAC 4F8MA 4G7ZC 1Q1BA 4KV6A 5C3XA 1QE6A 1TY0A 3W2DA 2RDHA 1B4OA 2K5QA 1RTOA 2VXWA 4IFDH 1D2BA 5CV9A 4QIWB 3QB3A 3SK8A 1SMYC 4X3SA 3OHXC 4ZAIA 1E2ZA 1ENCA 5KEEA 4DU9A 5BN5A 2E2JB 2IT1A 3LNNA 2EY1A 4QB4A 4KJOA 1T5XD 1ILPA 1ZYRD 4LMQD 5KRUA 3V05A 3M4OB 1PTOF 4FF2A 3I4LA 3N52A 2F0DA 3VYTA 1CZWA 3P7JA 4KJNA 1C48A 5JPMC 1G91A 5EPLA 4K14A 3SVMA 3MXUA 1A2UA 4FXKC 4BS9A 5K36H 3MXGA 1EY4A 1E0BA 1UEAB 1Y1WB 5M9OA 5TSSA 1DD2A 1FNWA 1TQOA 3GV3A 1B53A 3IFDA 4RCOA 2M00A 3MAQA 4FNFA 4F87A 3BDOA 3LWEA 4FO2A 3T56B 2KJXA 3SK4A 1A15A 3S1NB 1F9QA 1YNJC 1LTGD 1S4ZA 2L4NA 2D9UA 3KLSA 5JJZA 2NVXB 2RQXA 3O13A 1M8AA 3ITPA 1PMRA 4RH6A 3I73A 4R8NA 3DXJC 3KBXA 5G3LF 1TT2A 1A6XA 1WTXA 5IGFA 2VB3X 3PIO3 5ELBA 2HCCA 1SYGA 2B2WA 2EYMA 3GTOB 3SE0A 2F3VA 1SMYD 4FVMA 1ZXTA 2FINB 2IPKD 4TQUS 2CQAA 1WTRA 1EY6A 4V0BA 3NP8A 3SK5A 1Q8IA 5FO8B 1PZJD 2ZXOA 5T1GA 1SAPA 3G7LA 5IIFA 2WINB 1WD0A 3BG3A 3EJIA 2ICEC 2F0KA 1SYCA 3BVGA 2OEOA 2D2CC 1S5DD 2BA1A 3P20A 1A3TA 2XWBB 4CJ2C 5EKLA 1I4RA 5ELEA 3DWPA 3BS1A 3TP6A 4IUUA 4K6DA 3HOUB 2AUJD 2JE6I 5EGTA 5EQ0A 4K8JA 2XRQD 1QNKA 4HSPA 1EY0A 2AQ2B 1EYAA 2Q8TA 4QUCA 2HQEA 3D4WA 5KYLA 1GUSA 5F2DA 5EPKA 4CBVA 4QF4A 1Q3LA 1PFBA 4DA2A 2SNSA 3R2TA 3HKZB 4RGOS 2B2TA 1YNJD 3TP7A 3RMHA 3S15B 2DY7A 2IW3A 2Z8LA 4CJ0B 5I6YA 1TS4A 3D6WA 3A7AB 4IFDG 3TZUA 2C5CA 2XVSA 5I9OA 3HP3A 3ND8A 3KF8A 4IQZA 2EE1A 4X3UA 1HA5A 1K8MA 1TWAB 3H94A 4MHEA 2WACA 2R6GA 4DXGA 4ZKCB 1I3QB 4ZRZA 2XRSD 4RKBA 1B50A 3PO3B 4G7OC 1EQVA 4RCNA 2RDFA 4BBRB 2FJ2A 5CV6A 2SNMA 4XT3B 2F0GA 4I65A 5CC4A 1J8IA 3PMFA 1HTLD 4LJZC 5IGEA 1LTSD 1CFMA 2O5JC 2EY2A 2JYOA 2GA4B 1AN8A 2L0CA 5K36G 5C6AA 4DGZA 4BA2I 4DK0A 4XQNA 1G8ZD 3FPPA 3CU7A 4PNYA 1JICA 1F2YA 1B3AA 2DNEA 3M85A 2F0QA 3MXPA 2O2LD 4C1NK 1BDOA 3X3NA 1GJXA 4A3IB 4NMZA 1VF5C 4DNTB 1F9PA 4HSVA 1NAPA 2J7ZA 2MUYA 1BOSA 4R8IA 5C4XB 3DUZA 1CZGA 1B1ZA 1TY2A 3J7AF 1EU4A 3MXNA 1GUNA 2JXMB 2EJFC 2OT2A 4UAIA 2K1BA 3GV6A 3CQZB 1SNQA 1TU2B 1EOTA 4X3KA 1Y69U 2JSOA 4G7HC 5I6WA 1S5BD 2L12A 1U4LA 3AU7A 2SEBD 3I90A 2XWJB 1JB3A 4ZYSA 5FO7B 1LLRD 2F0PA 2K5DA 2KEDA 3V2TA 3KLSX 1IKLA 2J0TD 3M3YB 3HEJA 1SYEA 5A2QL 3HG9A 1LT5D 1TKWB 5KGUA 3I70A 1OXXK 4HMJA 2FFKB 2B2YC 2F0VA 4OO1I 5CMDA 1DONA 4J1MA 3GTJB 3FDTA 3GO5A 5EKKA 5I4DA 5KNBA 4RFBA 1I6HB 4RGMA 3VR4A 1H9MA 2F3WA 1QOHA 1PRTC 1TR5A 1HTPA 2AQ1B 2FMMA 1SE2A 1AW7A 1JOOA 1V1OA 1NR4A 4ABNA 1AZPA 5JVH3 1WTVA 4CKCA 1BQQT 1RD9D 1FYCA 4IN3A 2X69A 2MPMA 1V1PA 4ID6A 1O7YA 4DF7A 2BA0A 3PIP3 3FRPB 1ENAA 1YNNC 4NKLA 2I46A 2B2UC 1ESRA 2K7VA 2H1EA 2JA5B 1H9KA 4NW2A 4X3TA 2SOBA 4KD4A 1PFMA 1L0YB 2EPBA 2RSNA 3I4NB 3K6OA 4XTCS 5CV7A 4A3MB 5J22A 5K5PA 1EL0A 1PFNA 3QOJA 3C1FA 2OF1A 2NN6I 1B9MA 5JVG3 1Q90A 1H9JA 1PXUA 2RBMA 2K03A 2LMCB 1BF4A 2TMPA 5FOBB 4N9PA 2EY5A 1STEA 1F2MA 3IFTA 2IJ0A 3FEWX 2WKCA 3TDQA 1I4HA 4ME5A 5JEAH 3MFYA 1SNCA 3OOCA 1C8CA 1GUTA 1F9SA 2A69C 4ZUJA 2K33A 1TWFB 1KABA 5T1IA 3HGBA 4C3HG 1BNZA 2JEBI 3GD7A 1F9RA 2EYPA 3R2IA 1UUPA 1IKMA 4YIJA 1DXMA 3VYUA 4ZQ3A 3Q24A 2PW5A 4RHSA 1EZ8A 2CW0C 4BY7B 1SNOA 2HUGA 3ZYYX 2B2WC 1PRTD 2K28A 5E4XA 2EYHA 3NQIA 5EPJA 2L9HA 2HDLA 3QJYA 2ZXRA 3WDNA 1BUVT 1CTMA 1EIHA 3V96A 1O80A 3QO2A 4H13C 3Q0AA 2QF7A 1OXVA 1Q12A 1M4VA 3EVQA 4LK1C 1HHVA 3OWFA 5I2XA 2NVTB 1DCZA 5CORA 2F0MA 1BXTA 3PUYA 1YNND 1LTRD 5C3WA 3K58A 3HOXB 4KKUA 4WJWA 4RHRA 1CM9A 2EZVA 1SBBB 1MBYA 2MGSA 3OMCA 4MIUA 3SEBA 4C3HB 2I07B 5C5LA 4F88A 1LTTD 1RHPA 3OSOA 4OO1H 5DM63 4OL7A 3C2PA 3GTQB 1OXUA 4EVOA 1Z6HA 1EY5A 4CJ1B 3QIAA 1VF7A 3R3OA 2F0NA 1DOMA 1U4MA 3RZDB 5IOCA 2L1BA 4PV1C 3M7GA 2G9DA 4BY1B 3NTKA 3DHQA 3S1MB 4TKOB 3LX0A 2E75C 3MWYW 5CR3A 1AEXA 1SSOA 4K5VA 4KY7A 5KYIA 2Q8RE 2A69D 2G9HD 2PZTA 1RF2D 5A2QE 3NQTA 3NBIA 5DM73 1XXGA 2JEAI 3PUZA 1Z47A 1IHZA 4AYBB 4FYDA 2V4DA 1U4RA 1HCZA 5CBEE 3S1QB 2CW0D 4DFAA 2F0SA 1LACA 3ONAB 3NWSA 3A54A 4QMGA 2DNCA 1HA6A 1H9SB 4L6TB 1LTID 4OGQC 5E1FA 4A3FB 5D3IB 4UDUC 4IUNA 1KAAA 4ZUIA 2NN6H 1LTBD 5CV5A 4CHTB 1LT4D 1JCKB 2NB0A 3MTSA 1I4XA 4XQQA 4C1NI 1EIGA 4K8IA 5JAVA 2MJ8A 3Q23A 3A56A 2NYZD 2KUMA 2NTTA 3JAML 1BCPB 4KMUC 1QCBD 1SYFA 3H0GB 1ILQA 4DXFA 2CHBD 1GUWA 1LV9A 5BN3A 2PNRC 3KLRA 5JEAG 3HRZC 3NHHA 4C3JG 1SNDA 5C4JB 4IZ8A 2F0LA 3IAYA 3BDCA 1RCVD 2NVYB 3D3RA 1GHJA 5EBCA 1C4QA 3VR3A 3M4YA 3RLFA 3D6CA 2VUMB 2F0UA 3OPOA 1QJOA 2QILA 4WORA 1MD2D 1JWMD 4WFN3 4XT1B 2R92B 1CQVA 2ZT9C 5J1ZA 2D62A 2IL8A 1WCMB 2EXZA 5D14A 3S9WA 4M8AA 2A6HC 2WKDA 3RZOB 3G6JB 2PZWA 2YU9B 3HOZB 3C1EA 2E2DC 4ZKBB 3MFGA 1DOLA 5I2YA 4U673 1PTOC 3FPUB 5CGKA 2QEJC 4BBSB 3TP5A 4IFDJ 1S5FD 1STYA 3NUCA 1BCPF 1EYCA 4HAEA 3K5NA 4KY6A 1E2WA 5CBAE 1SYBA 4K2KA 3RUZA 4C3JB 2F0JA 5CYUA 1WD1A 3HS0C 4F7XA 1FGBD 4PMBA 2K6AA 3BZDB 4Y7NB 1TWGB 2SDFA 1F2ZA 3K59A 2Y0SB 4A3EB 4OO1G 2B8GA 1V8QA 2F0WA 4GZYC 3C3LA 1VMPA 2RDGA 5KNCA 2M9VA 1FNUA 1WVLA 3A8IE 3MVVA 3NK9A 2JA8B 4B08A 2KEEA 1II3A 1B44D 2X6GA 1D5MC 3H91A 4G57A 1SDFA 2WB1B 4RA8A 5AFWA 4C3IG 4CKEA 1HFGA 4KKSA 3VR5A 2A6EC 2EYLA 1SXTA 5M3FB 5JPNC 5NUCA 3P1HA 1L0XB 3CKIB 2B2VC 1AFPA 5FKAC 4KN7C 2F0EA 1PZKD 3I91A 3LWUA 2NUCA 4R9WA 3TMEA 3K5OA 1ONLA 2JA6B 4XQJA 1CA5A 4IALA 1I4PA 1PLFA 4E6IA 1ML0D 2NVQB 2A68C 2K05A 1NCVA 2ZXPA 2A6HD 3E0JA 3L3OC 1G2SA 2IX0A 2PCFB 2K5WA 1JOQA 1V43A 1CHQD 1WTWA 2AUKA 4FXDA 3DMUA 3VA5A 1EY9A 3MHBA 1QNUA 3M7NA 2NN6G 3H3VC 1PTOD 1EEFD 5M3MB 4ZLTF 1Y8NB 2PO4A 2R7ZB 2PW7A 3N6RA 2TSSA 2F0IA 3PUXA 1KNAA 1LABA 5HGTA 4C3IB 2J4XA 2FMCA 2K04A 3F2UA 4HR7B 3OIPA 2L5TA 3D4RA 3BYTB 5JOBA 5HURA 3BDLA 1GUGA 2PMZB 1EY8A 3R93A 5DNFA 2KECA 1QWYA 1CHPD 4HCEA 3ND9A 1STBA 4B9XA 4OIKA 3GTPB 1QG7A 5FLXL 1D1KA 2O4XA 2BCOA 4H7BA 2PZUA 3JAME 2ICIA 4G4KA 1SYDA 5EKIA 1XYIA 4A3DB 3D8GA 1XWEA 3P75A 4DNRB 1BR9A 4HN7A 2EJMA 4HEDA 5IT9L 1OXSC 3IL8A 1SNPA 1X32A 2PYKA 3VYSA 5CV8A 5G3LD 2VB2X 2EYJA 2A6ED 2EJGC 1GHKA 2F4IA 5C4HA 2KHSA 1O7LA 1JOKA 5D65A 2WIIB 4C56C 3SDZA 4N9TA 1KLGD 1HUMA 4J8QA 3QG1A 2IX3A 3D31A 1TIID 5IGGA 3VYRA 3BYYB 1VMCA 3NXWA 1A3VA 1STGA 1LT6D 2A68D 2F03A 1UNSA 1MSGA 1SNMA 1LO5D 2WP8J 3IKJA 1TS3A 4CKBA 4BWGB 2IWHA 2Z1CA 1QILA 3J7YW 4XXEA 1BCPC 2KOLA 5E3FA 2B2YA 1KTKA 2OXPA 1B2TA 1MGSA 4KTAA 5C0XJ 4KD3A 3UI2A 1Q1EA 2F0OA 2LFNA 5D3DA 2PQEA 2PPBC 5IGBA 4A3BB 1EEID 2F1MA 1JR0D 3RD4A 4DK1A 1ZKOA 1IW7C 1TVXA 1PDQA 2KA7A 5IGDA 5ISRA 1JWUD 3HZXA 1GOZA 2WAQB 2KCNA 3SR1A 3H09A 1NUCA 1Y8PB 2JP1A 3ERQA 2BDOA 4LAAA 1NR2A 3MC0B 3DWAA 1LTAD 1EWCA 2YYZA 1SJHD 4EQOA 2B2UA 5C0XI 3EA6A 4PMWA 1TS5A 3CRLC 4FXGC 1WTPA 3QWNA 1F2LA 5LL6X 1I50B 1S5ED 4V190 5ELFA 3W3AA 1F77A 1RJTA 4M1UB 3TZDA 3L9AX 1H9SA 2X6LA 4Q5VA 5DEHA 1X3PA 3T51B 1SEBD 2RKSA 1MI2A 1E2VA 3D4DA 4J6HA 1GUOA 4PQXA 1SJED 5EJWA 1B9NA 1PRTB 3FMCA 3GTGB 3BVZA 1EY7A 3X3MA 1OO9B 1BO0A 1Z7TA 2B2TC 2XN9C 1O7ZA 4EGVA 5M5WB 2E74C 5ELCA 3DM1A 2AQ3B 3K7AB 1ZEQX 1U9RA 3C46A 3QOLA 4IUPA 4BA1I 2KQ3A 4NP5A 3VR6A 3K0YA 5J39A 3A8JE 2BE5C 2HDMA 1TS2A 1UAPA 4RWSC 2M2LA 1BCPD 1JQYD 4FF1A 1DJRD 1G6ZA 4TSSA 5FK9C 3S2HB 5C5MA 1STAA 4ODGA 2A5HA 3OIQA 2EVBA 3VA7A 2K01A 3S14B 3U9OA 1AP0A 3I3CA 2CVRA 2L11A 5A35A 2XIWA 4B9WA 3MA2B 2O5IC 1DYQA 2QDBA 3GQBA 1EQTA 1CK1A 4XIGS 1IW7D 1QB5D 1RKNA 1SE3A 1S5CD 1PTOH 1RDPD 1CI3M 4O42A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IKM A;  1DOK A;  1VMC A;  1GUW A;  1LV9 A;  2EOT A;  3D6W A;  2J7Z A;  5COY A;  2KVM A;  2X69 A;  4R8I A;  2MPM A;  2N88 A;  4ZLT F;  3HP3 A;  1X3P A;  2SDF A;  2HUG A;  2RSO A;  1O7Y A;  4IUR A;  2NZ1 D;  3MWY W;  1BBX C;  1HFN A;  1WTQ A;  4CJ0 B;  2B2W C;  1ZXT A;  2FIN B;  2EE1 A;  2DY8 A;  3N52 A;  1SSO A;  2BDN A;  4X3U A;  1MI2 A;  4MHE A;  4U68 A;  2K28 A;  4OIJ A;  1KNA A;  1MSG A;  2Q8R E;  1VMP A;  1J9O A;  2FHT A;  1U4P A;  3P7J A;  3DEP A;  5E4X A;  1WTR A;  2B2V A;  5EJW A;  2MP1 A;  4ZKC B;  5EPJ A;  2B2U C;  5T1G A;  1ESR A;  1WVL A;  4UAI A;  1SAP A;  2K1B A;  1HUN A;  2K04 A;  3GV6 A;  3G7L A;  1WD0 A;  2L9H A;  1BO0 A;  2H1E A;  2HDL A;  3F2U A;  2R3Z A;  4NW2 A;  4ZK9 B;  4X3T A;  5EPL A;  2B2T C;  1G91 A;  1EOT A;  1RTN A;  2KOL A;  3KUP A;  2B2Y A;  1B50 A;  1B2T A;  1X3Q A;  1O7Z A;  4X3K A;  1EIH A;  1MGS A;  1ICW A;  3DEO A;  2KEE A;  3SVM A;  1G2T A;  4IUT A;  1O80 A;  1HRJ A;  2RA4 A;  2X6G A;  3QO2 A;  1PFM A;  1U4L A;  2L12 A;  3DM1 A;  1AZQ A;  2FJ2 A;  2EPB A;  1U4R A;  2RSN A;  3UI2 A;  3H91 A;  5CBE E;  1DZ1 A;  4IUP A;  1SDF A;  3I90 A;  4XT3 B;  1E0B A;  3R93 A;  5DNF A;  1HHV A;  3ONA B;  4RA8 A;  1J8I A;  5AFW A;  2KEC A;  5COR A;  1HFG A;  3GV3 A;  1B53 A;  4XT1 B;  3IFD A;  4MN3 A;  5E4W C;  2X6L A;  1HA6 A;  4DN4 M;  2KED A;  4OIK A;  4QUF A;  1EL0 A;  4CJ2 C;  1QG7 A;  1IKL A;  2IL8 A;  1PFN A;  5D14 A;  3LWE A;  2HDM A;  1MSH A;  1ROD A;  4LMQ D;  2B2V C;  4IUU A;  4RWS C;  1TVX A;  1PDQ A;  1A15 A;  2M2L A;  1F9Q A;  5EKI A;  1QE6 A;  1S4Z A;  1G6Z A;  2L4N A;  1XYI A;  2JYO A;  2K03 A;  4ZKB B;  3I91 A;  4IUV A;  1JE4 A;  2D9U A;  1BF4 A;  1CM9 A;  2B2Y C;  2FFK B;  5JJZ A;  4HED A;  5EQ0 A;  1B4O A;  1DOL A;  3IL8 A;  1RTO A;  1M8A A;  4R9W A;  1QNK A;  1X32 A;  5CMD A;  2VXW A;  1DON A;  1KNE A;  2MGS A;  3FPU B;  2JP1 A;  2N55 A;  3Q6S A;  1IL8 A;  3FDT A;  2NWG A;  2K01 A;  3MTS A;  4QUC A;  1NR2 A;  2Q8T A;  1CA5 A;  1AP0 A;  4HCS A;  3I3C A;  2CVR A;  1RHP A;  1PLF A;  2L11 A;  1EIG A;  1JIC A;  1WTO A;  2XIW A;  1B3A A;  1ML0 D;  5EPK A;  2RVL A;  4X3S A;  2K05 A;  4ZAI A;  3KBX A;  1NCV A;  1Q3L A;  2MJ8 A;  1PFB A;  1C8C A;  4RAU C;  2B2U A;  1F9S A;  4CJ1 B;  1G2S A;  1WD1 A;  1CA6 A;  1WTX A;  5D65 A;  3TN2 A;  1EQT A;  2FMM A;  1WTP A;  2NYZ D;  2KUM A;  1F2L A;  2B2T A;  4HAE A;  2HCC A;  5T1I A;  1WTW A;  1HUM A;  2DY7 A;  1DOM A;  1NR4 A;  1AZP A;  1BNZ A;  5CBA E;  1RJT A;  1ILQ A;  1U4M A;  3TZD A;  1XX8 A;  2HCI A;  1F9R A;  1ILP A;  1WTV A;  2L1B A;  4XDX A;  1F9P A;  4IUQ A;  4HSV A;  3I8Z A;  4O42 A;  2B2W A;  1NAP A; 
#chains in the Genus database with same CATH topology
 3E6Z X;  2F0F A;  4Q0F A;  3TP8 A;  1LT3 D;  2KVM A;  4A3J B;  3TSS A;  3PIO A;  2IY5 B;  3NSW A;  4ILW A;  1W6J A;  2N88 A;  5M5X B;  3OWE B;  3M4P A;  1ET6 A;  3R8B A;  2JA7 B;  4HIO A;  1WTQ A;  1K83 H;  5FJ8 H;  4K2L A;  5IOD A;  2DY8 A;  1MHW C;  1K3B C;  3IRB A;  3HOY H;  2EYF A;  4P74 A;  1HQR D;  5FLX E;  1PRT F;  1O78 A;  4RGT A;  4YHH Q;  4Z9C B;  1PFS A;  1PH2 A;  3I4M B;  1GXD C;  2E2I B;  3AB9 A;  3J81 L;  3PO3 G;  2K4K A;  1Y8O B;  2R3Z A;  4ZK9 B;  4BBR G;  4FF3 A;  3BZC A;  3JAM i;  1X3Q A;  4B3R L;  4K5X A;  4JK1 C;  3A7L A;  4KHV A;  4GKK L;  4K0K Q;  1HRJ A;  5IT9 E;  2ES2 A;  3A5U A;  3KOJ A;  3OMG A;  1A2T A;  3Q22 A;  3M9B A;  1KDB A;  3J7A V;  3ERS X;  4A3G B;  1X3E A;  3U9S A;  3NTH A;  2VNU D;  4K5W A;  4OX9 L;  4PMC A;  3SHL A;  4JI3 L;  2NTS A;  4DN4 M;  1H9R A;  1AE2 A;  4JBJ A;  1JWS D;  3J80 L;  5LL6 S;  5KIX A;  4HMI A;  3PUV A;  3NPP A;  3H6M A;  1OTC A;  1JE4 A;  3ULL A;  2F0H A;  1IYU A;  5EBD A;  1NMG A;  4BY7 H;  3B6Y A;  3S16 B;  3LGJ A;  2AWN A;  1BKB A;  2N55 A;  3Q6S A;  4DV2 Q;  1D1I A;  1XTC D;  1FJG Q;  4JI2 L;  1WTO A;  4JOI C;  4S3S A;  1EU3 A;  1XTD A;  2BE5 D;  1D5X C;  1VDZ A;  4X62 L;  2UU9 Q;  5CV4 A;  1PA6 A;  3PF4 A;  1X56 A;  4A93 G;  1CQF A;  2EYO A;  5GAG C;  1N36 L;  1A3U A;  5JEA J;  4YY3 L;  3M4O H;  1W6K A;  1EIF A;  1R4Q B;  5FO9 B;  4JYA Q;  3QR8 A;  2H4O A;  5C0X H;  4LFC Q;  4XDX A;  3NBH A;  4DAV A;  1Y1V B;  5C4X G;  2IX1 A;  2EOT A;  4OWW B;  4RKL A;  2NVT H;  1E24 A;  1HR0 W;  4B3S L;  3DWQ A;  1VCI A;  1R4P B;  4A3K G;  3GTK B;  2F4V L;  2Z4H A;  2RSO A;  4IUR A;  1NY4 A;  4DV3 Q;  4HTH A;  2DN8 A;  4I7Z C;  1HFN A;  2B8F A;  1D5Z C;  4LWC A;  1R9T B;  2BDN A;  1FD7 D;  2E2H B;  4JI7 Q;  4ALP A;  1I6V C;  2FHT A;  1L1O B;  4KI0 A;  3DEP A;  4DAY A;  1EZ6 A;  2NBF A;  3HOX H;  1IL2 A;  3GTM B;  4KN4 C;  3UE1 A;  3KK7 A;  4BXX G;  1HUN A;  3H3V H;  2WV6 D;  2Z4I A;  2QKI C;  3MEH A;  4R4I A;  3EFX D;  3HOW B;  4LF8 L;  1U5K A;  1EFI D;  3RLN A;  4DUZ L;  3KBG A;  2MNA A;  4QCL A;  2ALY B;  4GKJ L;  1XNQ L;  1G29 1;  5LMN Q;  3A55 A;  1E1T A;  3CCL A;  4H0L C;  4N8F A;  1GM5 A;  1KC8 C;  1HPC A;  1HR0 L;  1QUQ A;  3GTQ H;  3K5L A;  4TRD A;  4KY5 A;  1QZG A;  1VQ4 A;  1FNV A;  1I4G A;  5C44 G;  4FP5 D;  4QUF A;  4GNX A;  1XPO A;  2R93 G;  2NZO A;  3NWT A;  2EDG A;  5KND A;  3H15 A;  5IP9 H;  2NVX H;  1MSH A;  3OW7 A;  3AMU A;  4NDX A;  4IFD I;  3RZD H;  1HJP A;  1PZI D;  3T13 A;  3WOE A;  1EWH A;  2L55 A;  3G4S A;  4A93 B;  1TWH B;  4C2M B;  4L63 B;  1KNE A;  1WI5 A;  2KEN A;  2JK8 A;  3NBH B;  4K6L A;  1IL8 A;  4HCS A;  1SR3 A;  2C9O A;  2R61 A;  1J6Q A;  2RVL A;  2Z9H A;  4X66 L;  1I4Q A;  1CSP A;  1IYV A;  1KXL A;  2XSC A;  1FR3 A;  4IO9 A;  3TN2 A;  3FKI G;  4A3K B;  4DV7 L;  3PO2 G;  2B39 A;  1SE4 A;  3ERO A;  3K5M A;  1PYW D;  4DAY B;  3ICE A;  2BOS A;  2LXJ A;  3PV0 A;  2A74 C;  2HCI A;  4DR2 L;  3E0E A;  1EUJ A;  3WOF A;  3S1Q H;  3HOV G;  1IYJ B;  1D6E C;  3RNU A;  4P2C B;  4UP9 A;  1STN A;  2VQF Q;  3TBI B;  5COY A;  3PF5 A;  2RCN A;  1XMO Q;  4OHJ A;  1BBX C;  2ZTC A;  3WWV A;  1ENF A;  1HQM C;  1HXY D;  5C4Z A;  4CGY B;  4OIJ A;  3I55 A;  1QUQ B;  1S3O A;  4A3F H;  1STH A;  1J9O A;  2MO0 A;  1U4P A;  4JG2 A;  4WRD A;  3URY A;  1LM0 A;  4DR4 L;  1HNX L;  4GNX B;  3T53 B;  5IYB H;  2R7F A;  5C44 B;  2IHF A;  3KDF A;  1W2B A;  2A73 B;  1K28 A;  2B63 B;  5M5Y B;  5BN4 A;  3DEO A;  1G2T A;  2R93 B;  2V1C C;  4IUT A;  3VR2 A;  5C3E B;  2RA4 A;  1OXT A;  3BVM A;  3VDY A;  4XYO A;  1DZ1 A;  2ID0 A;  3CHB D;  2HHH Q;  2VQE Q;  3K8A A;  2OQK A;  4QL5 A;  2D5D A;  5FJ8 G;  2PNH A;  4MN3 A;  5E4W C;  3HOY G;  3HOU H;  3S2D B;  1D8L A;  2A19 A;  2OTL A;  1VQB A;  4KHZ A;  1LYL A;  1KDC A;  5IGC A;  1ROD A;  3T1Y Q;  3H0G H;  4GLX A;  2I5H A;  4PZ8 A;  4H44 C;  4DV5 L;  1FGU A;  3M4Q A;  3T4A C;  3S1R B;  1LUZ A;  4FF4 A;  3EQL C;  4IUV A;  1EYD A;  2F0T A;  5J3B A;  2DJF C;  3FKI B;  4KK7 A;  3PO2 B;  1ZYR C;  3I72 A;  1CT1 D;  3JC6 6;  1DM0 B;  1KDA A;  2NWG A;  1BBU A;  1ESF A;  2MHV A;  1YI2 A;  3HOV B;  3F1Z A;  3GP7 A;  5GAH C;  3GTL B;  3S15 H;  2CH4 A;  2EY6 A;  4EQN A;  5C4J H;  2HQL A;  4EQP A;  4RAU C;  1CA6 A;  1CKM A;  5ELD A;  1ET9 A;  3S17 B;  3J81 E;  1K8O A;  2LY7 A;  2UXC Q;  2LKV A;  1NSN S;  3NE5 B;  4HID A;  1XX8 A;  5I9P A;  4IUQ A;  4BY7 G;  3I8Z A;  3KDF B;  1DOK A;  2KCC A;  4DAP A;  2Z0S A;  1TWC B;  1UE6 A;  1PTO B;  5GAE C;  3E5S A;  5LHY 1;  1I3Q H;  2E76 C;  2NZ1 D;  1SN8 A;  2UUC Q;  4MTK A;  1WCM H;  3A8K E;  4JBW A;  4U68 A;  1SFO B;  4A76 A;  2E5L L;  5DAU A;  4GN5 A;  4ULL A;  2B2V A;  2MP1 A;  2YU9 H;  4QIW E;  3J80 E;  3CRK C;  3W1G A;  1K83 B;  3T16 A;  1HZA A;  4OWX B;  2Q8I B;  4RGN A;  3AFP A;  1RTN A;  3KUP A;  3HOY B;  1JOR A;  5C0X G;  1A63 A;  1ICW A;  2EQS A;  2ZM6 L;  1XMQ L;  3CPF A;  1AZQ A;  4XYQ A;  3MZ5 A;  3PUW A;  1HNW L;  2AHO B;  4BBS H;  2AWO A;  3K57 A;  1K73 C;  2QCP X;  3SXH A;  2LS0 1;  1T5E A;  3FVQ A;  2N49 A;  3SK6 A;  1JC7 A;  2K32 A;  3NTI A;  4L8J A;  3HOX G;  1KLU D;  2ENB A;  1V1P B;  3L7Z C;  4O1N A;  4KKT A;  2XNA C;  4F8M A;  3CME A;  4G7Z C;  1N33 L;  1Q1B A;  2UUA Q;  4KV6 A;  5C3X A;  1VQK A;  1QE6 A;  1KHI A;  1TY0 A;  4LF4 L;  1VQN A;  4LFA L;  3W2D A;  2RDH A;  4DV6 Q;  1VQ6 A;  3CCS A;  1B4O A;  2K5Q A;  1N34 Q;  1RTO A;  1TWG H;  2DJG C;  2VXW A;  3CCR A;  4IFD H;  4A3E H;  1NJI C;  1D2B A;  5CV9 A;  4QIW B;  4DUY Q;  4POG A;  3QB3 A;  3SK8 A;  1SMY C;  4X3S A;  3OHX C;  4ZAI A;  2RHS B;  4A3I H;  1E2Z A;  5IE8 A;  1ENC A;  5KEE A;  4DU9 A;  5BN5 A;  2E2J B;  5IP9 G;  2IT1 A;  2VS1 A;  2PQA A;  2JA8 H;  3LNN A;  2EY1 A;  4X64 Q;  4QB4 A;  4KJO A;  1T5X D;  1ILP A;  1ZYR D;  3A74 A;  4LMQ D;  5KRU A;  1PH1 A;  3CC4 A;  3V05 A;  3M4O B;  3OW2 A;  1PTO F;  1YZ6 A;  3CP0 A;  4FF2 A;  1YJN A;  1MJC A;  3I4L A;  3N52 A;  2F0D A;  3CQZ H;  2UXB Q;  3VYT A;  1CZW A;  1YIT A;  3P7J A;  4KJN A;  2BH2 A;  4JBK A;  1C48 A;  3EN2 A;  3BJU A;  5JPM C;  4CDC C;  3AEV A;  5IY0 A;  1G91 A;  5EPL A;  3T1H Q;  1VQA A;  3U50 C;  4K14 A;  1J5E L;  5AJ3 Q;  2ZJQ A;  3SVM A;  3MXU A;  1A2U A;  4FXK C;  2C35 B;  4BS9 A;  2JA6 H;  4DR5 Q;  5K36 H;  3MXG A;  1EY4 A;  4NXN Q;  1E0B A;  1UEA B;  1Y1W B;  5M9O A;  5TSS A;  1DD2 A;  1FNW A;  4X65 Q;  2NVQ H;  1GD7 A;  1TQO A;  3GV3 A;  1B53 A;  3IFD A;  4R4Q A;  4RCO A;  2M00 A;  3MAQ A;  4FNF A;  1PHJ A;  4F87 A;  3BDO A;  4A3F G;  3TS2 A;  4A4I A;  4PG3 A;  3LWE A;  3F2D A;  4FO2 A;  1YHA A;  3T56 B;  4L5S A;  5IYB G;  2KJX A;  4UPA A;  3SK4 A;  1A15 A;  1VQP A;  1S72 A;  3S1N B;  1F9Q A;  1YNJ C;  1LTG D;  1S4Z A;  2L4N A;  2PQA B;  2D9U A;  3KLS A;  4JI4 Q;  5JJZ A;  2EIF A;  2NVX B;  5JJL A;  2RQX A;  3O13 A;  1M8A A;  3ITP A;  1PMR A;  2JQO A;  4RH6 A;  3I73 A;  4R8N A;  3OTO L;  3FP9 A;  4JI1 L;  1MJE A;  1SRU A;  3HOU G;  3DXJ C;  3KBX A;  5G3L F;  1TT2 A;  1A6X A;  3NEN A;  1WTX A;  5IGF A;  2VB3 X;  3H0G G;  3EBE A;  1CKN A;  3PIO 3;  5ELB A;  2K5V A;  2HCC A;  1P8L A;  5EAY A;  3KF6 A;  1L0W A;  4RG1 A;  4B3R Q;  1SYG A;  4GKK Q;  2B2W A;  2ZJP A;  4DV1 L;  1YJ9 A;  2EYM A;  3GTO B;  3HKZ G;  3SE0 A;  3KJO A;  5GQO A;  4DAM A;  4QQB X;  2F3V A;  3GTP H;  1SMY D;  4FVM A;  1ZXT A;  3ZJY C;  1V9P A;  2FIN B;  4QGU A;  1VQO A;  4OX9 Q;  1LTL A;  4UY8 C;  3G6E A;  1EFW A;  2JA5 H;  2IPK D;  4JI3 Q;  2KHJ A;  4TQU S;  4A3L H;  2CQA A;  1WTR A;  1EY6 A;  1EQR A;  4V0B A;  3NP8 A;  3RLO A;  4PZ6 A;  1Q8I A;  3SK5 A;  2QA4 A;  5FO8 B;  1PZJ D;  2ZXO A;  5T1G A;  2CH4 W;  1SAP A;  3G7L A;  5IIF A;  2WIN B;  1WD0 A;  3I4N H;  3BG3 A;  3EJI A;  3HKZ E;  2ICE C;  3F2C A;  2F0K A;  3BU2 A;  4A3M H;  1SYC A;  3BVG A;  1MKH A;  2OEO A;  4P73 A;  2D2C C;  1S5D D;  4UP7 A;  3NEL A;  1PYS B;  4OON A;  4JVZ A;  2BA1 A;  3P20 A;  2CKZ B;  1WCM G;  3RN2 A;  4JI2 Q;  1PYB A;  1A3T A;  4HIM A;  1ICF B;  3JAM c;  2XWB B;  4CJ2 C;  5EKL A;  1C7Y A;  1I4R A;  5ELE A;  4X62 Q;  3DWP A;  3BS1 A;  3TP6 A;  1N36 Q;  4IUU A;  4LF9 Q;  3TRE A;  4YY3 Q;  4GNX C;  4K6D A;  2QW7 A;  3HOU B;  1JJG A;  2AUJ D;  1CKN B;  4OEM B;  2XGT A;  2JE6 I;  5EGT A;  3KF6 B;  5EQ0 A;  2I5M X;  4K8J A;  4ME3 A;  2XRQ D;  3KJP A;  1QNK A;  4HSP A;  1L1O A;  4B3S Q;  1EY0 A;  2AQ2 B;  4BBS G;  1EYA A;  2Q8T A;  4QUC A;  4KHP L;  2F4V Q;  4LF6 L;  2HQE A;  3D4W A;  1TWF H;  5KYL A;  1GUS A;  5F2D A;  5EPK A;  4CBV A;  2IHE A;  4QF4 A;  1P16 A;  1Q3L A;  1PFB A;  3CCM A;  1Z9F A;  4DA2 A;  2SNS A;  3R2T A;  3HKZ B;  4RGO S;  2B2T A;  2XTI A;  1YNJ D;  3TP7 A;  3KLW A;  3RMH A;  3S15 B;  2DY7 A;  3GDE A;  1H95 A;  4DNI A;  2KCT A;  2E8G A;  2IW3 A;  2Z8L A;  4DUZ Q;  1CSQ A;  1GO3 E;  4QY7 A;  4GKJ Q;  1XNQ Q;  4CJ0 B;  5I6Y A;  1TS4 A;  3D6W A;  3A7A B;  4IFD G;  4A3E G;  3TZU A;  2C5C A;  2XVS A;  5I9O A;  3I2Z A;  4A3B H;  3HP3 A;  1HR0 Q;  1WFQ A;  3ND8 A;  3KF8 A;  3J7A 5;  2YTY A;  4IQZ A;  1V1Q A;  2EE1 A;  4X3U A;  1HA5 A;  1K8M A;  4A3I G;  1TWA B;  3H94 A;  4MHE A;  1HZ9 A;  1SRO A;  4LF7 Q;  2WAC A;  2R6G A;  2K52 A;  4DXG A;  4ZKC B;  1I3Q B;  4ZRZ A;  2JA8 G;  2XRS D;  1BVS A;  3A0J A;  4RKB A;  1B50 A;  3PO3 B;  5LMU L;  4G7O C;  1EQV A;  4RCN A;  2RDF A;  4IOC A;  1K3R A;  1YBY A;  3ULJ A;  2WB1 G;  4BBR B;  2FJ2 A;  5CV6 A;  2SNM A;  3TEH B;  4XT3 B;  2F0G A;  4I65 A;  5CC4 A;  3UE0 A;  4DR6 L;  4JI6 Q;  1J8I A;  5H1S E;  3AFQ A;  3PMF A;  2F3I A;  1HTL D;  4ZCK A;  4LF5 L;  1KAW A;  2ZTD A;  4LJZ C;  4X66 Q;  5IGE A;  2K50 A;  1LTS D;  1CFM A;  1I50 H;  2O5J C;  4DV7 Q;  1K8A C;  2EY2 A;  3L0O A;  3EIV A;  4C3H H;  2JYO A;  1CKO A;  2G5D A;  4DR2 Q;  2GA4 B;  1AN8 A;  2L0C A;  2JA6 G;  5K36 G;  5C6A A;  4DGZ A;  4GOP C;  4BA2 I;  4DK0 A;  4XQN A;  4DV0 L;  1G8Z D;  3FPP A;  1L2F A;  4OWT B;  3CU7 A;  4PNY A;  1JIC A;  1F2Y A;  1B3A A;  3W5O A;  2DNE A;  3M85 A;  3GTG H;  3KF8 B;  2F0Q A;  3MXP A;  2QEX A;  4DR4 Q;  2O2L D;  4C1N K;  4BY1 H;  1HNX Q;  1BDO A;  1YNX A;  2UU9 L;  2K5N A;  3X3N A;  3S1M H;  1GJX A;  4A3I B;  4NMZ A;  5M5W H;  1VF5 C;  4DNT B;  3K7A H;  1F9P A;  1KRS A;  4HSV A;  1NAP A;  2J7Z A;  1S40 A;  2MUY A;  1BOS A;  4R8I A;  3G48 A;  5C4X B;  2AMC B;  3DUZ A;  1PVO A;  1CZG A;  4AQY Q;  1B1Z A;  1TY2 A;  2Q2H A;  3J7A F;  1EU4 A;  3MXN A;  1GUN A;  1Q81 C;  2JXM B;  4DK6 C;  2EJF C;  2OT2 A;  1A62 A;  4UAI A;  2K1B A;  3HFZ B;  3S2H H;  3GV6 A;  3CQZ B;  1SNQ A;  4APV A;  4NPS A;  4DV5 Q;  1TU2 B;  1EOT A;  4X3K A;  3AQQ A;  1Y69 U;  2JSO A;  4G7H C;  5I6W A;  1S5B D;  1Q7Y C;  2L12 A;  1U4L A;  3AU7 A;  1DGS A;  2SEB D;  3UDX A;  1N8R C;  3I90 A;  2XWJ B;  4L5Q A;  4P71 A;  1JB3 A;  4ZYS A;  5FO7 B;  3PCO B;  1LLR D;  2F0P A;  4JOI A;  1VQD A;  2K5D A;  5IWA L;  2JN4 A;  2JA5 G;  4A3L G;  2KED A;  3KLS X;  3V2T A;  1IKL A;  2J0T D;  3M3Y B;  3HEJ A;  1SYE A;  5A2Q L;  3HG9 A;  1LT5 D;  1TKW B;  1SMX A;  2LXK A;  3SGI A;  3I4N G;  5KGU A;  3I70 A;  2UUB Q;  1OXX K;  4YCW A;  4HMJ A;  1AH9 A;  1G6P A;  2FFK B;  2B2Y C;  2F0V A;  4A3J H;  4OO1 I;  4A3M G;  1TXY A;  5CMD A;  5M5X H;  1DON A;  4JI8 L;  4J1M A;  3GTJ B;  1E1O A;  3FDT A;  3GO5 A;  5EKK A;  5I4D A;  5KNB A;  4RFB A;  1I6H B;  4RGM A;  3VR4 A;  2ASB A;  1FL0 A;  1H9M A;  4LFB L;  2F3W A;  1QOH A;  2E5L Q;  1PRT C;  1TR5 A;  2CWP A;  1HTP A;  2AQ1 B;  2FMM A;  5ELO A;  1SE2 A;  3J7Z C;  3U4V A;  2CCZ A;  3MXN B;  1AW7 A;  1EQQ A;  1JOO A;  1V1O A;  1NR4 A;  4ABN A;  1AZP A;  5FLM H;  5JVH 3;  2RHQ B;  1WTV A;  4CKC A;  4NXM L;  1BQQ T;  1RD9 D;  2ZM6 Q;  2KBN A;  1FYC A;  4IN3 A;  4A3G H;  2X69 A;  2I0Q A;  2MPM A;  1HNW Q;  1V1P A;  4ID6 A;  1O7Y A;  5FLX c;  4DF7 A;  2BA0 A;  3PIP 3;  4R4T A;  3S24 A;  2NVY H;  2F52 A;  1PV4 A;  3FRP B;  1ENA A;  1YNN C;  4IPH A;  2I46 A;  4NKL A;  2B2U C;  1ESR A;  1FVI A;  1YVC A;  2K7V A;  4GN3 B;  4KLK A;  2MFI A;  2VUM H;  3K80 C;  5IT9 c;  2H1E A;  1N33 Q;  2JA5 B;  1H9K A;  4NW2 A;  4X3T A;  1X9N A;  1QZH A;  4LF4 Q;  4LFA Q;  2SOB A;  1UE1 A;  4KD4 A;  1PFM A;  1L0Y B;  2R92 H;  2Z6K A;  2EPB A;  2RSN A;  4A3B G;  3UDI A;  3RZO H;  3I4N B;  4AIM A;  3K6O A;  1X6O A;  4XTC S;  1NE3 A;  5CV7 A;  4A3M B;  1PH9 A;  3HOZ H;  5J22 A;  5K5P A;  1EL0 A;  1HZC A;  4DKA C;  1PFN A;  3QOJ A;  3C1F A;  2OF1 A;  2NN6 I;  1B9M A;  5JVG 3;  2WAQ G;  1Q90 A;  1YHB A;  1H9J A;  3BZK A;  1PXU A;  2RBM A;  4MNO A;  4HJ8 A;  1Y1V H;  2K03 A;  2LMC B;  1BF4 A;  2YTX A;  4B3M L;  4IPC A;  5ELN A;  2TMP A;  5FOB B;  2YTV A;  2EY5 A;  1STE A;  1F2M A;  4N9P A;  3IFT A;  2IJ0 A;  3FEW X;  1RIP A;  2WKC A;  3TDQ A;  1I4H A;  4ME5 A;  3GTM H;  5JEA H;  3MFY A;  1SNC A;  3OOC A;  1X65 A;  1C8C A;  1GUT A;  1F9S A;  2A69 C;  4C3J H;  4DR3 L;  3HOW H;  4ZUJ A;  4DR7 L;  3F2B A;  2K33 A;  1TWF B;  1KAB A;  5T1I A;  1T9H A;  3HGB A;  4C3H G;  1BNZ A;  4Y7N H;  3KFU A;  1J5E Q;  2JEB I;  3GD7 A;  1F9R A;  2EYP A;  2UXC L;  1VQG A;  3R2I A;  1UUP A;  1IKM A;  4YIJ A;  2N8N A;  1DXM A;  3VYU A;  5IP7 H;  4ZQ3 A;  2Q2T A;  3Q24 A;  2PW5 A;  4RHS A;  1EZ8 A;  3DM3 A;  2CW0 C;  3RR5 A;  4BY7 B;  1SNO A;  2HUG A;  1JJC B;  1KIX A;  3ZYY X;  2B2W C;  2OCE A;  3CC7 A;  1PRT D;  2K28 A;  2BH8 A;  3CC2 A;  5E4X A;  2PI2 E;  2EYH A;  3NQI A;  5EPJ A;  1IBK L;  4BY1 G;  3I4O A;  2L9H A;  2HDL A;  3QJY A;  2ZXR A;  2DUD A;  1TWH H;  3WDN A;  1BUV T;  1CTM A;  4WJ4 A;  1EIH A;  2CQO A;  3V96 A;  1EIY B;  1O80 A;  3TS0 A;  3QO2 A;  4H13 C;  3Q0A A;  2QF7 A;  1OXV A;  1NNX A;  1Q12 A;  4UHV A;  1IBL L;  1M4V A;  3EVQ A;  4LK1 C;  1HHV A;  5M3F H;  2OQ0 A;  3OWF A;  5I2X A;  2NVT B;  1DCZ A;  1VQC A;  5COR A;  2F0M A;  4JI1 Q;  3CCU A;  1BXT A;  2UXD L;  4A3K H;  4AYB G;  3PUY A;  1YNN D;  1LTR D;  1UWV A;  5C3W A;  3K58 A;  4OXP A;  2K75 A;  2K5H A;  3HOX B;  1EWI A;  1NTG A;  4KKU A;  4WJW A;  1WTH A;  4RHR A;  1N9W A;  1CM9 A;  2EZV A;  1SBB B;  1MBY A;  2MGS A;  3K7U C;  3OMC A;  1YEZ A;  4MIU A;  3SEB A;  4AYB E;  4C3H B;  3MEF A;  2VZA A;  2I07 B;  5C5L A;  4F88 A;  1LTT D;  1IBM L;  2QDL A;  4DR1 L;  1RHP A;  4FDB A;  3OSO A;  4OO1 H;  1C0A A;  5DM6 3;  2KCM A;  1L1O C;  4OL7 A;  3C2P A;  3GTQ B;  1OXU A;  4EVO A;  1Z6H A;  1VQH A;  2R7D A;  1EY5 A;  4CJ1 B;  3H3V I;  3QIA A;  1JB7 A;  1VF7 A;  3R3O A;  2B63 H;  5M5Y H;  1G51 A;  5M3M H;  2F0N A;  1DOM A;  5C3E H;  1U4M A;  2NZH A;  3RZD B;  2R7Z H;  5IOC A;  2L1B A;  4PV1 C;  4A3J G;  3M7G A;  2G9D A;  4BY1 B;  3NTK A;  3DHQ A;  3S1M B;  1VQF A;  4TKO B;  3LX0 A;  1N32 L;  4LUZ A;  2E75 C;  3MWY W;  5CR3 A;  4C3I H;  1AEX A;  3S2D H;  1SSO A;  4K5V A;  4KY7 A;  5KYI A;  3ULP A;  2Q8R E;  5GRO A;  2A69 D;  2G9H D;  2PZT A;  1RF2 D;  1K8G A;  5A2Q E;  2VY3 A;  2UXB L;  3NQT A;  3NBI A;  3RN5 A;  5DM7 3;  1XXG A;  5FLM G;  2CFM A;  2JEA I;  3PUZ A;  1Z47 A;  1IHZ A;  4AYB B;  1B7Y B;  4HJ9 A;  2WFW A;  4FYD A;  2V4D A;  1U4R A;  1E22 A;  1HCZ A;  5CBE E;  3S1Q B;  2CW0 D;  4DFA A;  4A3G G;  2F0S A;  4O2D A;  1LAC A;  3ONA B;  1SE8 A;  3DLL A;  4LF6 Q;  1SLJ A;  3NWS A;  1VQL A;  3A54 A;  3PGZ A;  4QMG A;  1K0S A;  4JBM A;  2DNC A;  1HA6 A;  5GAD C;  1H9S B;  4L6T B;  4A3D H;  4GLA C;  1LTI D;  4POF A;  4OGQ C;  5E1F A;  3AYH B;  4JI5 L;  4A3F B;  2Q2U A;  4JW0 A;  2VUM G;  2HIV A;  5D3I B;  4UDU C;  4YWM A;  4IUN A;  1KAA A;  1HNZ L;  5IYC H;  4H02 A;  4ZUI A;  2R92 G;  2NN6 H;  1LTB D;  5CV5 A;  4CHT B;  1TWC H;  1LT4 D;  4I7A A;  4DV4 L;  1JCK B;  5BR8 L;  1HZB A;  3K81 C;  2NB0 A;  3MTS A;  1I4X A;  1Q8K A;  4XQQ A;  4C1N I;  1SFO H;  4DK3 C;  1PH7 A;  1EIG A;  2Z6B A;  4K8I A;  3HOZ G;  3J81 c;  1MIU A;  4R1J A;  5JAV A;  2MJ8 A;  3FHW A;  4TVA B;  2A1A A;  3Q23 A;  1E7Z A;  3A56 A;  2HIX A;  1CUK A;  3J81 i;  2NYZ D;  3G71 A;  2KUM A;  2NTT A;  3JAM L;  1XNR L;  1BCP B;  4KMU C;  1QCB D;  1SYF A;  1Y1V G;  3U4Z A;  3H0G B;  4HJ5 A;  1ILQ A;  1QVC A;  5LMU Q;  4B3T L;  2Q2I A;  4DXF A;  2CHB D;  1GUW A;  1LV9 A;  5BN3 A;  2PNR C;  4N8X 1;  4DR6 Q;  1I94 L;  2P5Z X;  3KLR A;  2A8V A;  3J80 c;  3CF5 A;  5JEA G;  1UE7 A;  3HRZ C;  4LF5 Q;  4YCV A;  3NHH A;  4JV5 L;  3J80 i;  4C3J G;  1SND A;  3HOW G;  4LF8 Q;  5C4J B;  4IZ8 A;  2F0L A;  4GN4 B;  3IAY A;  3BDC A;  1RCV D;  2NVY B;  3D3R A;  1GHJ A;  5EBC A;  1C4Q A;  2Y0S G;  3VR3 A;  4JI0 L;  4X6A H;  3M4Y A;  3RLF A;  3D6C A;  3CD6 A;  5IP7 G;  1NBW A;  1QVG A;  4UP8 A;  2VUM B;  2F0U A;  3OPO A;  1QJO A;  2QIL A;  1UE5 A;  4WOR A;  5IYD H;  4DV0 Q;  1MD2 D;  1JWM D;  4WFN 3;  4NB3 A;  4XT1 B;  2R92 B;  1CQV A;  2ZT9 C;  4IJL A;  5J1Z A;  2E2J H;  2D62 A;  3CXC A;  2IL8 A;  1WCM B;  2EXZ A;  5D14 A;  3S9W A;  1YJW A;  4M8A A;  1XJV A;  2N3S A;  2ZTE A;  2A6H C;  2WKD A;  3A5Z B;  3RZO B;  2Y0S E;  4YHH L;  3G6J B;  2ATW A;  2DGY A;  2PZW A;  2YU9 B;  3HOZ B;  3C1E A;  2E2D C;  4ZKB B;  4LF9 L;  3MFG A;  4K0K L;  3UDG A;  3CAM A;  1KD1 C;  1DOL A;  3Q8D A;  5I2Y A;  4U67 3;  1PTO C;  3FPU B;  5M3F G;  1ASY A;  5L37 A;  5CGK A;  4IJH A;  2QEJ C;  4BBS B;  3TP5 A;  4IFD J;  1S5F D;  4EQ5 A;  1PH5 A;  2WB1 E;  1VQ7 A;  1VS0 A;  1STY A;  3NUC A;  1BCP F;  1EYC A;  4HAE A;  3K5N A;  3CCQ A;  4KY6 A;  1E2W A;  4AH6 A;  5CBA E;  1SYB A;  4K2K A;  1KRT A;  3RUZ A;  4C3J B;  2F0J A;  4JCV E;  4MTN A;  5CYU A;  1A0I A;  1WD1 A;  2VL6 A;  1WYD A;  3HS0 C;  4F7X A;  1Y1W H;  4JPB W;  1B70 B;  1FGB D;  4PMB A;  2K6A A;  3BZD B;  4DV2 L;  4Y7N B;  1TWG B;  2SDF A;  1F2Z A;  3K59 A;  2Y0S B;  4A3E B;  1FJG L;  4OO1 G;  2B8G A;  1E3P A;  5IWA Q;  2B29 A;  1V8Q A;  2F0W A;  1ASZ A;  4GZY C;  3C3L A;  1VMP A;  2RDG A;  5KNC A;  2M9V A;  2EXD A;  1YIJ A;  4R4C A;  3S1N H;  1FNU A;  3CPW A;  4CDD C;  1WVL A;  4LF7 L;  3A8I E;  2B63 G;  4IOA A;  5M3M G;  3MVV A;  5C3E G;  4OEL B;  4JYA L;  3NK9 A;  5LMN W;  2JA8 B;  2R7Z G;  4LFC L;  4B08 A;  2KEE A;  1II3 A;  1B44 D;  2X6G A;  1XPU A;  1D5M C;  4EX5 A;  3CW2 C;  3H91 A;  4G57 A;  5DLQ E;  4JI8 Q;  1SDF A;  2WB1 B;  1BBW A;  1O7I A;  4RA8 A;  1M90 C;  3ER0 A;  4DV3 L;  5AFW A;  4C3I G;  4CKE A;  1HFG A;  4KKS A;  2Z6K C;  3NEM A;  3VR5 A;  4JI6 L;  2A6E C;  4JI7 L;  4LFB Q;  2EYL A;  1SXT A;  2VW9 A;  1VQE A;  5M3F B;  5JPN C;  3CMA A;  5NUC A;  3P1H A;  1L0X B;  3CKI B;  4QJF A;  1JMC A;  2B2V C;  4HJ7 A;  1AFP A;  4J15 A;  5FKA C;  4KN7 C;  2F0E A;  3CCE A;  1B8A A;  1PZK D;  3I91 A;  3LWU A;  3S14 H;  1Q46 A;  5LMN L;  2NUC A;  4NXM Q;  4R9W A;  3TME A;  3GTO H;  2RCF A;  3K5O A;  1ONL A;  2JA6 B;  2D0O A;  2D0P A;  2YV5 A;  4GLV B;  4XQJ A;  1CA5 A;  3UDF A;  4IAL A;  1I4P A;  1PLF A;  3W1B A;  2PMZ E;  4E6I A;  1ML0 D;  2NVQ B;  2A68 C;  2K05 A;  4A3D G;  1NCV A;  2ZXP A;  3E9I A;  2A6H D;  3E0J A;  3L3O C;  1G2S A;  2IX0 A;  2PCF B;  3E3X A;  3CCV A;  2K5W A;  1WOC A;  1JOQ A;  2GVB A;  1V43 A;  1CHQ D;  1WTW A;  2AUK A;  4FXD A;  3DMU A;  3VA5 A;  1EY9 A;  3MHB A;  1QNU A;  4YWL A;  5IYC G;  4WJ3 M;  3M7N A;  2JA7 H;  4RMF A;  2NN6 G;  3H3V C;  4A3C H;  1PTO D;  3L2P A;  1EEF D;  5M3M B;  4ZLT F;  1Y8N B;  2PO4 A;  2OTJ A;  4CDE C;  2R7Z B;  2E2I H;  2PW7 A;  3I4M H;  3N6R A;  2TSS A;  1RL2 A;  2F0I A;  3K0X A;  2OWO A;  1XPR A;  3PUX A;  2FXQ A;  1KNA A;  1LAB A;  1JJ2 A;  4AQY L;  5HGT A;  4C3I B;  2J4X A;  2FMC A;  2K04 A;  3F2U A;  4HR7 B;  3OIP A;  1XMQ Q;  2L5T A;  3D4R A;  3BYT B;  5JOB A;  5HUR A;  3BDL A;  4GOP A;  2LSS A;  1GUG A;  2VQF L;  2PMZ B;  4B3M Q;  1EY8 A;  3R93 A;  5DNF A;  1XMO L;  2KEC A;  1QWY A;  1CHP D;  4HCE A;  3ND9 A;  1STB A;  3F8T A;  4B9X A;  4OIK A;  3GTP B;  1QG7 A;  5HGQ A;  5FLX L;  1D1K A;  1IZ6 A;  1C9O A;  2O4X A;  3I56 A;  1B3Q A;  3CCJ A;  4DR3 Q;  4DR7 Q;  2BCO A;  4H7B A;  3S16 H;  2PZU A;  3JAM E;  2ICI A;  1HH2 P;  4G4K A;  1SYD A;  5EKI A;  1XYI A;  2MQH A;  4A3D B;  3D8G A;  1XWE A;  3P75 A;  3KYH C;  4DNR B;  1BR9 A;  4HN7 A;  2EJM A;  4HED A;  5IT9 L;  1OXS C;  3IL8 A;  1SNP A;  2UUB L;  1X32 A;  2PYK A;  3VYS A;  5CV8 A;  5IYD G;  2CWA A;  2GVA A;  2HHH L;  2VQE L;  1TWA H;  1D7Q A;  5G3L D;  2VB2 X;  1AE3 A;  2EYJ A;  2A6E D;  2EJG C;  1PH4 A;  1GHK A;  1Q86 C;  2F4I A;  5C4H A;  2KHS A;  1O7L A;  1JOK A;  5D65 A;  2WII B;  3T1Y L;  1IBK Q;  4C56 C;  3SDZ A;  4N9T A;  1X54 A;  4DPG A;  1VQJ A;  3PO3 H;  1KLG D;  1HUM A;  2I5L X;  4J8Q A;  3QG1 A;  2IX3 A;  4BBR H;  3D31 A;  3GTK H;  4LNQ A;  1TII D;  4MZ9 A;  1EYG A;  4Y52 H;  5IGG A;  3VYR A;  3BYY B;  4A75 A;  3PIP A;  4LW1 A;  1R9T H;  4PZ7 A;  1VMC A;  1Y14 B;  3I7F A;  3D0F A;  2E2H H;  3NXW A;  1IBL Q;  4GOP B;  2WAQ E;  1A3V A;  1STG A;  1LT6 D;  4YWK A;  2A68 D;  3E9H A;  2F03 A;  1UNS A;  2UXD Q;  1MSG A;  1M1K C;  1SNM A;  2QGQ A;  2GN5 A;  1LO5 D;  2WP8 J;  3IKJ A;  1IXR A;  1TS3 A;  4CKB A;  4BWG B;  1JT8 A;  2IWH A;  2Z1C A;  1QIL A;  2PI2 A;  3J7Y W;  4XXE A;  1BCP C;  2KOL A;  5E3F A;  2B2Y A;  1KTK A;  2OXP A;  3U58 A;  1B2T A;  1MGS A;  4P72 A;  4HJA A;  3PQI A;  4KTA A;  5C0X J;  1Y1W G;  1K9M C;  4KD3 A;  3UI2 A;  5E7N A;  1Q1E A;  2B3G A;  2F0O A;  2LFN A;  1A8V A;  1KL9 A;  5HY6 A;  5D3D A;  2PQE A;  1IBM Q;  5IGB A;  2PPB C;  4A3B B;  2UUC L;  4DR1 Q;  4O0A A;  3OYY A;  1EEI D;  2F1M A;  2MO1 A;  1VQI A;  1JR0 D;  4A93 H;  3RD4 A;  2L15 A;  4C2M H;  1ZKO A;  1IW7 C;  4DK1 A;  1Q82 C;  1TVX A;  1PDQ A;  2KA7 A;  5IGD A;  5ISR A;  1JWU D;  3HZX A;  1GOZ A;  2WAQ B;  2KCN A;  3SR1 A;  1NMF A;  4R4O A;  3H09 A;  1NUC A;  3STB C;  1EOV A;  1Y8P B;  1YHQ A;  5C4X H;  2H5X A;  1VQ8 A;  3OTO Q;  2JA9 A;  2JP1 A;  3ERQ A;  2BDO A;  4CDF C;  4LAA A;  1NR2 A;  2N78 A;  1N32 Q;  3MC0 B;  1WJJ A;  3DWA A;  1LTA D;  4L5T A;  1PH6 A;  1EWC A;  2YYZ A;  1SJH D;  4EQO A;  2K14 A;  2B2U A;  2AKW B;  3EA6 A;  5C0X I;  4PMW A;  1TS5 A;  3CRL C;  4FXG C;  1WTP A;  3QWN A;  1F2L A;  5JJI A;  5LL6 X;  4BXX H;  2UUA L;  1I50 B;  1S5E D;  4V19 0;  5ELF A;  3W3A A;  1F77 A;  4DV6 L;  1RJT A;  4M1U B;  3TZD A;  4DV1 Q;  3L9A X;  1N34 L;  1I5F A;  1H9S A;  2X6L A;  4P75 A;  4Q5V A;  1GKH A;  5DEH A;  5JJK A;  4JC0 A;  1X3P A;  1VQ5 A;  1X55 A;  4DUY L;  3T51 B;  3TRZ A;  1SEB D;  3M3Y H;  2RKS A;  2ZJR A;  5C44 H;  4IPD A;  1MI2 A;  1E2V A;  3D4D A;  4J6H A;  1GUO A;  4PQX A;  1SJE D;  1X3F A;  4HIK A;  5EJW A;  1B9N A;  1KQS A;  2R93 H;  3J81 j;  1PRT B;  3FMC A;  4JI5 Q;  1UEB A;  3GTG B;  3BVZ A;  2KHI A;  1EY7 A;  3X3M A;  1OO9 B;  1BO0 A;  4X64 L;  1VQM A;  1Z7T A;  2B2T C;  2XN9 C;  2RF4 A;  1K0R A;  1O7Z A;  4EGV A;  3PSI A;  2JA7 G;  1HNZ Q;  5M5W B;  2E74 C;  4YCU A;  5ELC A;  4LUO A;  3GTJ H;  4A3C G;  3DM1 A;  1VQ9 A;  2AQ3 B;  3K7A B;  1ZEQ X;  4DV4 Q;  1U9R A;  3C46 A;  3QOL A;  4IUP A;  5BR8 Q;  1I6H H;  4L5R C;  4BA1 I;  2KQ3 A;  4NP5 A;  3I4M G;  3VR6 A;  3K0Y A;  5J39 A;  3A8J E;  1X3G A;  3S1R H;  3HKS A;  1W3S A;  2BE5 C;  3TQY A;  2HDM A;  3FKI H;  1TS2 A;  3PO2 H;  1UAP A;  1XNR Q;  4RWS C;  2M2L A;  1QVF A;  1BCP D;  1JQY D;  3T1H L;  4FF1 A;  1DJR D;  1G6Z A;  4TSS A;  5FK9 C;  3S2H B;  5AJ3 L;  5C5M A;  1STA A;  4B3T Q;  2HT1 A;  4DR5 L;  3HOV H;  4IPG A;  4KHP Q;  3GTL H;  4ODG A;  2A5H A;  3OIQ A;  2EVB A;  4NXN L;  2HD3 A;  2JJQ A;  1U0L A;  3VA7 A;  2K01 A;  4X65 L;  3S14 B;  3U9O A;  1I94 Q;  3S17 H;  1AP0 A;  3I3C A;  2CVR A;  2L11 A;  5A35 A;  2XIW A;  4LUV A;  4B9W A;  3MA2 B;  2O5I C;  1JE5 A;  1DYQ A;  2QDB A;  1PH8 A;  3GQB A;  4JV5 Q;  1EQT A;  1CK1 A;  4XIG S;  1IW7 D;  1QB5 D;  1RKN A;  1GVP A;  4GS3 A;  1SE3 A;  1S5C D;  1PH3 A;  1PTO H;  1RDP D;  4JI0 Q;  4JI4 L;  3STB D;  1CI3 M;  4O42 A; 
#chains in the Genus database with same CATH homology
 3E6Z X;  2F0F A;  4Q0F A;  3TP8 A;  1LT3 D;  2KVM A;  4A3J B;  3TSS A;  3NSW A;  4ILW A;  1W6J A;  2N88 A;  5M5X B;  3OWE B;  1ET6 A;  3R8B A;  2JA7 B;  1WTQ A;  4K2L A;  5IOD A;  2DY8 A;  2EYF A;  1HQR D;  5FLX E;  1PRT F;  1O78 A;  4RGT A;  4Z9C B;  2E2I B;  3I4M B;  1GXD C;  3AB9 A;  3J81 L;  1Y8O B;  2R3Z A;  4ZK9 B;  4FF3 A;  1X3Q A;  4K5X A;  4JK1 C;  3A7L A;  4KHV A;  1HRJ A;  5IT9 E;  3OMG A;  1A2T A;  3Q22 A;  1KDB A;  3J7A V;  4A3G B;  3U9S A;  3NTH A;  2VNU D;  4K5W A;  4PMC A;  3SHL A;  2NTS A;  4DN4 M;  1H9R A;  1JWS D;  3J80 L;  5LL6 S;  5KIX A;  4HMI A;  3PUV A;  3NPP A;  3H6M A;  1JE4 A;  2F0H A;  1IYU A;  5EBD A;  3S16 B;  2AWN A;  2N55 A;  3Q6S A;  1D1I A;  1XTC D;  1WTO A;  4S3S A;  1EU3 A;  2BE5 D;  1D5X C;  1VDZ A;  5CV4 A;  1CQF A;  2EYO A;  1A3U A;  5JEA J;  1W6K A;  1R4Q B;  5FO9 B;  2H4O A;  5C0X H;  4XDX A;  3NBH A;  4DAV A;  1Y1V B;  2IX1 A;  2EOT A;  4RKL A;  3DWQ A;  1VCI A;  1R4P B;  3GTK B;  2Z4H A;  2RSO A;  4IUR A;  4HTH A;  2DN8 A;  4I7Z C;  1HFN A;  2B8F A;  1D5Z C;  1R9T B;  2BDN A;  1FD7 D;  2E2H B;  1I6V C;  2FHT A;  4KI0 A;  3DEP A;  4DAY A;  1EZ6 A;  2NBF A;  3GTM B;  4KN4 C;  3KK7 A;  1HUN A;  2WV6 D;  2Z4I A;  2QKI C;  3MEH A;  3HOW B;  3EFX D;  1EFI D;  3KBG A;  4QCL A;  1G29 1;  3A55 A;  4H0L C;  1HPC A;  3K5L A;  4TRD A;  4KY5 A;  1FNV A;  1I4G A;  4FP5 D;  4QUF A;  3NWT A;  2EDG A;  5KND A;  1MSH A;  3OW7 A;  3AMU A;  4NDX A;  4IFD I;  1PZI D;  3T13 A;  3WOE A;  1EWH A;  2L55 A;  4A93 B;  1TWH B;  4C2M B;  4L63 B;  1KNE A;  4K6L A;  1IL8 A;  4HCS A;  2C9O A;  2R61 A;  2RVL A;  1I4Q A;  1IYV A;  2XSC A;  1FR3 A;  3TN2 A;  4A3K B;  2B39 A;  1SE4 A;  3ERO A;  3K5M A;  1PYW D;  2BOS A;  3PV0 A;  2A74 C;  2HCI A;  3WOF A;  1D6E C;  4P2C B;  1STN A;  3TBI B;  5COY A;  4OHJ A;  1BBX C;  1ENF A;  1HQM C;  1HXY D;  5C4Z A;  4CGY B;  4OIJ A;  1STH A;  1J9O A;  4WRD A;  1U4P A;  3URY A;  3T53 B;  5C44 B;  2A73 B;  2B63 B;  5M5Y B;  5BN4 A;  3DEO A;  1G2T A;  2R93 B;  4IUT A;  3VR2 A;  5C3E B;  2RA4 A;  1OXT A;  3BVM A;  4XYO A;  1DZ1 A;  2ID0 A;  3CHB D;  2D5D A;  4MN3 A;  5E4W C;  3S2D B;  4KHZ A;  1KDC A;  5IGC A;  1ROD A;  4H44 C;  3T4A C;  3S1R B;  4FF4 A;  3EQL C;  4IUV A;  1EYD A;  2F0T A;  3FKI B;  4KK7 A;  3PO2 B;  1ZYR C;  3I72 A;  1CT1 D;  1DM0 B;  1KDA A;  2NWG A;  1ESF A;  2MHV A;  3HOV B;  3GP7 A;  3GTL B;  2EY6 A;  4EQN A;  4EQP A;  1CA6 A;  4RAU C;  5ELD A;  1ET9 A;  3S17 B;  3J81 E;  1K8O A;  2LY7 A;  2LKV A;  1NSN S;  3NE5 B;  1XX8 A;  5I9P A;  4IUQ A;  3I8Z A;  1DOK A;  2KCC A;  4DAP A;  1TWC B;  1PTO B;  3E5S A;  5LHY 1;  2E76 C;  2NZ1 D;  3A8K E;  4JBW A;  4U68 A;  1SFO B;  5DAU A;  4ULL A;  2B2V A;  2MP1 A;  3J80 E;  3CRK C;  1K83 B;  3T16 A;  2Q8I B;  4RGN A;  1RTN A;  3KUP A;  3HOY B;  1JOR A;  5C0X G;  1ICW A;  1AZQ A;  4XYQ A;  3MZ5 A;  3PUW A;  2AWO A;  3K57 A;  2QCP X;  3SXH A;  2LS0 1;  1T5E A;  3FVQ A;  3SK6 A;  1JC7 A;  2K32 A;  3NTI A;  4L8J A;  1KLU D;  2ENB A;  1V1P B;  3L7Z C;  4O1N A;  4KKT A;  2XNA C;  4F8M A;  4G7Z C;  1Q1B A;  4KV6 A;  5C3X A;  1QE6 A;  1TY0 A;  3W2D A;  2RDH A;  1B4O A;  2K5Q A;  1RTO A;  2VXW A;  4IFD H;  1D2B A;  5CV9 A;  4QIW B;  3QB3 A;  3SK8 A;  1SMY C;  4X3S A;  3OHX C;  4ZAI A;  1E2Z A;  1ENC A;  5KEE A;  4DU9 A;  5BN5 A;  2E2J B;  2IT1 A;  3LNN A;  2EY1 A;  4QB4 A;  4KJO A;  1T5X D;  1ILP A;  1ZYR D;  4LMQ D;  5KRU A;  3V05 A;  3M4O B;  1PTO F;  4FF2 A;  3I4L A;  3N52 A;  2F0D A;  3VYT A;  1CZW A;  3P7J A;  4KJN A;  1C48 A;  5JPM C;  1G91 A;  5EPL A;  4K14 A;  3SVM A;  3MXU A;  1A2U A;  4FXK C;  4BS9 A;  5K36 H;  3MXG A;  1EY4 A;  1E0B A;  1UEA B;  1Y1W B;  5M9O A;  5TSS A;  1DD2 A;  1FNW A;  1TQO A;  3GV3 A;  1B53 A;  3IFD A;  4RCO A;  2M00 A;  3MAQ A;  4FNF A;  4F87 A;  3BDO A;  3LWE A;  4FO2 A;  3T56 B;  2KJX A;  3SK4 A;  1A15 A;  3S1N B;  1F9Q A;  1YNJ C;  1LTG D;  1S4Z A;  2L4N A;  2D9U A;  3KLS A;  5JJZ A;  2NVX B;  2RQX A;  3O13 A;  1M8A A;  3ITP A;  1PMR A;  4RH6 A;  3I73 A;  4R8N A;  3DXJ C;  3KBX A;  5G3L F;  1TT2 A;  1A6X A;  1WTX A;  5IGF A;  2VB3 X;  3PIO 3;  5ELB A;  2HCC A;  1SYG A;  2B2W A;  2EYM A;  3GTO B;  3SE0 A;  2F3V A;  1SMY D;  4FVM A;  1ZXT A;  2FIN B;  2IPK D;  4TQU S;  2CQA A;  1WTR A;  1EY6 A;  4V0B A;  3NP8 A;  3SK5 A;  1Q8I A;  5FO8 B;  1PZJ D;  2ZXO A;  5T1G A;  1SAP A;  3G7L A;  5IIF A;  2WIN B;  1WD0 A;  3BG3 A;  3EJI A;  2ICE C;  2F0K A;  1SYC A;  3BVG A;  2OEO A;  2D2C C;  1S5D D;  2BA1 A;  3P20 A;  1A3T A;  2XWB B;  4CJ2 C;  5EKL A;  1I4R A;  5ELE A;  3DWP A;  3BS1 A;  3TP6 A;  4IUU A;  4K6D A;  3HOU B;  2AUJ D;  2JE6 I;  5EGT A;  5EQ0 A;  4K8J A;  2XRQ D;  1QNK A;  4HSP A;  1EY0 A;  2AQ2 B;  1EYA A;  2Q8T A;  4QUC A;  2HQE A;  3D4W A;  5KYL A;  1GUS A;  5F2D A;  5EPK A;  4CBV A;  4QF4 A;  1Q3L A;  1PFB A;  4DA2 A;  2SNS A;  3R2T A;  3HKZ B;  4RGO S;  2B2T A;  1YNJ D;  3TP7 A;  3RMH A;  3S15 B;  2DY7 A;  2IW3 A;  2Z8L A;  4CJ0 B;  5I6Y A;  1TS4 A;  3D6W A;  3A7A B;  4IFD G;  3TZU A;  2C5C A;  2XVS A;  5I9O A;  3HP3 A;  3ND8 A;  3KF8 A;  4IQZ A;  2EE1 A;  4X3U A;  1HA5 A;  1K8M A;  1TWA B;  3H94 A;  4MHE A;  2WAC A;  2R6G A;  4DXG A;  4ZKC B;  1I3Q B;  4ZRZ A;  2XRS D;  4RKB A;  1B50 A;  3PO3 B;  4G7O C;  1EQV A;  4RCN A;  2RDF A;  4BBR B;  2FJ2 A;  5CV6 A;  2SNM A;  4XT3 B;  2F0G A;  4I65 A;  5CC4 A;  1J8I A;  3PMF A;  1HTL D;  4LJZ C;  5IGE A;  1LTS D;  1CFM A;  2O5J C;  2EY2 A;  2JYO A;  2GA4 B;  1AN8 A;  2L0C A;  5K36 G;  5C6A A;  4DGZ A;  4BA2 I;  4DK0 A;  4XQN A;  1G8Z D;  3FPP A;  3CU7 A;  4PNY A;  1JIC A;  1F2Y A;  1B3A A;  2DNE A;  3M85 A;  2F0Q A;  3MXP A;  2O2L D;  4C1N K;  1BDO A;  3X3N A;  1GJX A;  4A3I B;  4NMZ A;  1VF5 C;  4DNT B;  1F9P A;  4HSV A;  1NAP A;  2J7Z A;  2MUY A;  1BOS A;  4R8I A;  5C4X B;  3DUZ A;  1CZG A;  1B1Z A;  1TY2 A;  3J7A F;  1EU4 A;  3MXN A;  1GUN A;  2JXM B;  2EJF C;  2OT2 A;  4UAI A;  2K1B A;  3GV6 A;  3CQZ B;  1SNQ A;  1TU2 B;  1EOT A;  4X3K A;  1Y69 U;  2JSO A;  4G7H C;  5I6W A;  1S5B D;  2L12 A;  1U4L A;  3AU7 A;  2SEB D;  3I90 A;  2XWJ B;  1JB3 A;  4ZYS A;  5FO7 B;  1LLR D;  2F0P A;  2K5D A;  2KED A;  3V2T A;  3KLS X;  1IKL A;  2J0T D;  3M3Y B;  3HEJ A;  1SYE A;  5A2Q L;  3HG9 A;  1LT5 D;  1TKW B;  5KGU A;  3I70 A;  1OXX K;  4HMJ A;  2FFK B;  2B2Y C;  2F0V A;  4OO1 I;  5CMD A;  1DON A;  4J1M A;  3GTJ B;  3FDT A;  3GO5 A;  5EKK A;  5I4D A;  5KNB A;  4RFB A;  1I6H B;  4RGM A;  3VR4 A;  1H9M A;  2F3W A;  1QOH A;  1PRT C;  1TR5 A;  1HTP A;  2AQ1 B;  2FMM A;  1SE2 A;  1AW7 A;  1JOO A;  1V1O A;  1NR4 A;  4ABN A;  1AZP A;  5JVH 3;  1WTV A;  4CKC A;  1BQQ T;  1RD9 D;  1FYC A;  4IN3 A;  2X69 A;  2MPM A;  1V1P A;  4ID6 A;  1O7Y A;  4DF7 A;  2BA0 A;  3PIP 3;  3FRP B;  1ENA A;  1YNN C;  4NKL A;  2I46 A;  2B2U C;  1ESR A;  2K7V A;  2H1E A;  2JA5 B;  1H9K A;  4NW2 A;  4X3T A;  2SOB A;  4KD4 A;  1PFM A;  1L0Y B;  2EPB A;  2RSN A;  3I4N B;  3K6O A;  4XTC S;  5CV7 A;  4A3M B;  5J22 A;  5K5P A;  1EL0 A;  1PFN A;  3QOJ A;  3C1F A;  2OF1 A;  2NN6 I;  1B9M A;  5JVG 3;  1Q90 A;  1H9J A;  1PXU A;  2RBM A;  2K03 A;  2LMC B;  1BF4 A;  2TMP A;  5FOB B;  4N9P A;  2EY5 A;  1STE A;  1F2M A;  3IFT A;  2IJ0 A;  3FEW X;  2WKC A;  3TDQ A;  1I4H A;  4ME5 A;  5JEA H;  3MFY A;  1SNC A;  3OOC A;  1C8C A;  1GUT A;  1F9S A;  2A69 C;  4ZUJ A;  2K33 A;  1TWF B;  1KAB A;  5T1I A;  3HGB A;  4C3H G;  1BNZ A;  2JEB I;  3GD7 A;  1F9R A;  2EYP A;  3R2I A;  1UUP A;  1IKM A;  4YIJ A;  1DXM A;  3VYU A;  4ZQ3 A;  3Q24 A;  2PW5 A;  4RHS A;  1EZ8 A;  2CW0 C;  4BY7 B;  1SNO A;  2HUG A;  3ZYY X;  2B2W C;  1PRT D;  2K28 A;  5E4X A;  2EYH A;  3NQI A;  5EPJ A;  2L9H A;  2HDL A;  3QJY A;  2ZXR A;  3WDN A;  1BUV T;  1CTM A;  1EIH A;  3V96 A;  1O80 A;  3QO2 A;  4H13 C;  3Q0A A;  2QF7 A;  1OXV A;  1Q12 A;  1M4V A;  3EVQ A;  4LK1 C;  1HHV A;  3OWF A;  5I2X A;  2NVT B;  1DCZ A;  5COR A;  2F0M A;  1BXT A;  3PUY A;  1YNN D;  1LTR D;  5C3W A;  3K58 A;  3HOX B;  4KKU A;  4WJW A;  4RHR A;  1CM9 A;  2EZV A;  1SBB B;  1MBY A;  2MGS A;  3OMC A;  4MIU A;  3SEB A;  4C3H B;  2I07 B;  5C5L A;  4F88 A;  1LTT D;  1RHP A;  3OSO A;  4OO1 H;  5DM6 3;  4OL7 A;  3C2P A;  3GTQ B;  1OXU A;  4EVO A;  1Z6H A;  1EY5 A;  4CJ1 B;  3QIA A;  1VF7 A;  3R3O A;  2F0N A;  1DOM A;  1U4M A;  3RZD B;  5IOC A;  2L1B A;  4PV1 C;  3M7G A;  2G9D A;  4BY1 B;  3NTK A;  3DHQ A;  3S1M B;  4TKO B;  3LX0 A;  2E75 C;  3MWY W;  5CR3 A;  1AEX A;  1SSO A;  4K5V A;  4KY7 A;  5KYI A;  2Q8R E;  2A69 D;  2G9H D;  2PZT A;  1RF2 D;  5A2Q E;  3NQT A;  3NBI A;  5DM7 3;  1XXG A;  2JEA I;  3PUZ A;  1Z47 A;  1IHZ A;  4AYB B;  4FYD A;  2V4D A;  1U4R A;  1HCZ A;  5CBE E;  3S1Q B;  2CW0 D;  4DFA A;  2F0S A;  1LAC A;  3ONA B;  3NWS A;  3A54 A;  4QMG A;  2DNC A;  1HA6 A;  1H9S B;  4L6T B;  1LTI D;  4OGQ C;  5E1F A;  4A3F B;  5D3I B;  4UDU C;  4IUN A;  1KAA A;  4ZUI A;  2NN6 H;  1LTB D;  5CV5 A;  4CHT B;  1LT4 D;  1JCK B;  2NB0 A;  3MTS A;  1I4X A;  4XQQ A;  4C1N I;  1EIG A;  4K8I A;  5JAV A;  2MJ8 A;  3Q23 A;  3A56 A;  2NYZ D;  2KUM A;  2NTT A;  3JAM L;  1BCP B;  4KMU C;  1QCB D;  1SYF A;  3H0G B;  1ILQ A;  4DXF A;  2CHB D;  1GUW A;  1LV9 A;  5BN3 A;  2PNR C;  3KLR A;  5JEA G;  3HRZ C;  3NHH A;  4C3J G;  1SND A;  5C4J B;  4IZ8 A;  2F0L A;  3IAY A;  3BDC A;  1RCV D;  2NVY B;  3D3R A;  1GHJ A;  5EBC A;  1C4Q A;  3VR3 A;  3M4Y A;  3RLF A;  3D6C A;  2VUM B;  2F0U A;  3OPO A;  1QJO A;  2QIL A;  4WOR A;  1MD2 D;  1JWM D;  4WFN 3;  4XT1 B;  2R92 B;  1CQV A;  2ZT9 C;  5J1Z A;  2D62 A;  2IL8 A;  1WCM B;  2EXZ A;  5D14 A;  3S9W A;  4M8A A;  2A6H C;  2WKD A;  3RZO B;  3G6J B;  2PZW A;  2YU9 B;  3HOZ B;  3C1E A;  2E2D C;  4ZKB B;  3MFG A;  1DOL A;  5I2Y A;  4U67 3;  1PTO C;  3FPU B;  5CGK A;  2QEJ C;  4BBS B;  3TP5 A;  4IFD J;  1S5F D;  1STY A;  3NUC A;  1BCP F;  1EYC A;  4HAE A;  3K5N A;  4KY6 A;  1E2W A;  5CBA E;  1SYB A;  4K2K A;  3RUZ A;  4C3J B;  2F0J A;  5CYU A;  1WD1 A;  3HS0 C;  4F7X A;  1FGB D;  4PMB A;  2K6A A;  3BZD B;  4Y7N B;  1TWG B;  2SDF A;  1F2Z A;  3K59 A;  2Y0S B;  4A3E B;  4OO1 G;  2B8G A;  1V8Q A;  2F0W A;  4GZY C;  3C3L A;  1VMP A;  2RDG A;  5KNC A;  2M9V A;  1FNU A;  1WVL A;  3A8I E;  3MVV A;  3NK9 A;  2JA8 B;  4B08 A;  2KEE A;  1II3 A;  1B44 D;  2X6G A;  1D5M C;  3H91 A;  4G57 A;  1SDF A;  2WB1 B;  4RA8 A;  5AFW A;  4C3I G;  4CKE A;  1HFG A;  4KKS A;  3VR5 A;  2A6E C;  2EYL A;  1SXT A;  5M3F B;  5JPN C;  5NUC A;  3P1H A;  1L0X B;  3CKI B;  2B2V C;  1AFP A;  5FKA C;  4KN7 C;  2F0E A;  1PZK D;  3I91 A;  3LWU A;  2NUC A;  4R9W A;  3TME A;  3K5O A;  1ONL A;  2JA6 B;  4XQJ A;  1CA5 A;  4IAL A;  1I4P A;  1PLF A;  4E6I A;  1ML0 D;  2NVQ B;  2A68 C;  2K05 A;  1NCV A;  2ZXP A;  2A6H D;  3E0J A;  3L3O C;  1G2S A;  2IX0 A;  2PCF B;  2K5W A;  1JOQ A;  1V43 A;  1CHQ D;  1WTW A;  2AUK A;  4FXD A;  3DMU A;  3VA5 A;  1EY9 A;  3MHB A;  1QNU A;  3M7N A;  2NN6 G;  3H3V C;  1PTO D;  1EEF D;  5M3M B;  4ZLT F;  1Y8N B;  2PO4 A;  2R7Z B;  2PW7 A;  3N6R A;  2TSS A;  2F0I A;  3PUX A;  1KNA A;  1LAB A;  5HGT A;  4C3I B;  2J4X A;  2FMC A;  2K04 A;  3F2U A;  4HR7 B;  3OIP A;  2L5T A;  3D4R A;  3BYT B;  5JOB A;  5HUR A;  3BDL A;  1GUG A;  2PMZ B;  1EY8 A;  3R93 A;  5DNF A;  2KEC A;  1QWY A;  1CHP D;  4HCE A;  3ND9 A;  1STB A;  4B9X A;  4OIK A;  3GTP B;  1QG7 A;  5FLX L;  1D1K A;  2O4X A;  2BCO A;  4H7B A;  2PZU A;  3JAM E;  2ICI A;  4G4K A;  1SYD A;  5EKI A;  1XYI A;  4A3D B;  3D8G A;  1XWE A;  3P75 A;  4DNR B;  1BR9 A;  4HN7 A;  2EJM A;  4HED A;  5IT9 L;  1OXS C;  3IL8 A;  1SNP A;  1X32 A;  2PYK A;  3VYS A;  5CV8 A;  5G3L D;  2VB2 X;  2EYJ A;  2A6E D;  2EJG C;  1GHK A;  2F4I A;  5C4H A;  2KHS A;  1O7L A;  1JOK A;  5D65 A;  2WII B;  4C56 C;  3SDZ A;  4N9T A;  1KLG D;  1HUM A;  4J8Q A;  3QG1 A;  2IX3 A;  3D31 A;  1TII D;  5IGG A;  3VYR A;  3BYY B;  1VMC A;  3NXW A;  1A3V A;  1STG A;  1LT6 D;  2A68 D;  2F03 A;  1UNS A;  1MSG A;  1SNM A;  1LO5 D;  2WP8 J;  3IKJ A;  1TS3 A;  4CKB A;  4BWG B;  2IWH A;  2Z1C A;  1QIL A;  3J7Y W;  4XXE A;  1BCP C;  2KOL A;  5E3F A;  2B2Y A;  1KTK A;  2OXP A;  1B2T A;  1MGS A;  4KTA A;  5C0X J;  4KD3 A;  3UI2 A;  1Q1E A;  2F0O A;  2LFN A;  5D3D A;  2PQE A;  2PPB C;  5IGB A;  4A3B B;  1EEI D;  2F1M A;  1JR0 D;  3RD4 A;  4DK1 A;  1ZKO A;  1IW7 C;  1TVX A;  1PDQ A;  2KA7 A;  5IGD A;  5ISR A;  1JWU D;  3HZX A;  1GOZ A;  2WAQ B;  2KCN A;  3SR1 A;  3H09 A;  1NUC A;  1Y8P B;  2JP1 A;  3ERQ A;  2BDO A;  4LAA A;  1NR2 A;  3MC0 B;  3DWA A;  1LTA D;  1EWC A;  2YYZ A;  1SJH D;  4EQO A;  2B2U A;  5C0X I;  3EA6 A;  4PMW A;  1TS5 A;  3CRL C;  4FXG C;  1WTP A;  3QWN A;  1F2L A;  5LL6 X;  1I50 B;  1S5E D;  4V19 0;  5ELF A;  3W3A A;  1F77 A;  1RJT A;  4M1U B;  3TZD A;  3L9A X;  1H9S A;  2X6L A;  4Q5V A;  5DEH A;  1X3P A;  3T51 B;  1SEB D;  2RKS A;  1MI2 A;  1E2V A;  3D4D A;  4J6H A;  1GUO A;  4PQX A;  1SJE D;  5EJW A;  1B9N A;  1PRT B;  3FMC A;  3GTG B;  3BVZ A;  1EY7 A;  3X3M A;  1OO9 B;  1BO0 A;  1Z7T A;  2B2T C;  2XN9 C;  1O7Z A;  4EGV A;  5M5W B;  2E74 C;  5ELC A;  3DM1 A;  2AQ3 B;  3K7A B;  1ZEQ X;  1U9R A;  3C46 A;  3QOL A;  4IUP A;  4BA1 I;  2KQ3 A;  4NP5 A;  3VR6 A;  3K0Y A;  5J39 A;  3A8J E;  2BE5 C;  2HDM A;  1TS2 A;  1UAP A;  4RWS C;  2M2L A;  1BCP D;  1JQY D;  4FF1 A;  1DJR D;  1G6Z A;  4TSS A;  5FK9 C;  3S2H B;  5C5M A;  1STA A;  4ODG A;  2A5H A;  3OIQ A;  2EVB A;  3VA7 A;  2K01 A;  3S14 B;  3U9O A;  1AP0 A;  3I3C A;  2CVR A;  2L11 A;  5A35 A;  2XIW A;  4B9W A;  3MA2 B;  2O5I C;  1DYQ A;  2QDB A;  3GQB A;  1EQT A;  1CK1 A;  4XIG S;  1IW7 D;  1QB5 D;  1RKN A;  1SE3 A;  1S5C D;  1PTO H;  1RDP D;  1CI3 M;  4O42 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...