2B2YC

Tandem chromodomains of human chd1
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
86
structure length
86
Chain Sequence
EEFETIERFMDCRIGRKGATGATTTIYAVEADGDPNAGFEKNKEPGEIQYLIKWKGWSHIHNTWETEETLKQQNVRGMKKLDNYKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Double chromodomains cooperate to recognize the methylated histone H3 tail.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Peptide binding protein
molecule keywords Chromodomain-helicase-DNA-binding protein 1
total genus 22
structure length 86
sequence length 86
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2005-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2b2yC00
1XX8A 2MP1A 1NR2A 4IUVA 5E4XA 4IUPA 1CA5A 1VMPA 1ZXTA 2MPMA 4XT3B 1E0BA 2K04A 1WTXA 4IUQA 2HCIA 1B53A 3Q6SA 2RVLA 1GUWA 2K1BA 1PFBA 4X3KA 2JP1A 2R3ZA 2DY7A 2HDLA 2RSNA 2B2VA 1WTRA 2K05A 2L4NA 2Q8RE 4RWSC 4HCSA 1EL0A 2SDFA 1B4OA 1HRJA 4CJ1B 5AFWA 2EOTA 1SDFA 2M2LA 1RODA 2B2VC 2D9UA 5DNFA 2B2UC 1QNKA 1IL8A 1EIGA 1U4LA 2X6GA 3MWYW 1G91A 1ML0D 2CVRA 2JYOA 1BNZA 1U4PA 1MSGA 1B3AA 4LMQD 4ZKBB 5CBAE 2J7ZA 2KOLA 1XYIA 2KEDA 1WVLA 1QE6A 1WTQA 1ESRA 1MI2A 1J8IA 1X32A 3R93A 4X3UA 5D65A 2L12A 3FPUB 2L9HA 4DN4M 1IKLA 2N88A 5T1IA 2K03A 5EPJA 4R8IA 1AZPA 3TN2A 3N52A 4CJ0B 4QUCA 2RSOA 1MGSA 1C8CA 2L11A 2K28A 4QUFA 3GV6A 1O80A 2MJ8A 3DEOA 1TVXA 1EIHA 1CM9A 1PLFA 2B2WA 1NR4A 1O7ZA 3IL8A 1WTOA 4HAEA 1QG7A 3SVMA 3IFDA 2NYZD 4IURA 2KECA 2RA4A 3D6WA 4X3SA 4O42A 1HHVA 1NCVA 2HUGA 4CJ2C 2H1EA 4U68A 2NWGA 2X6LA 3P7JA 2IL8A 2KUMA 3ONAB 1B50A 2MGSA 1WTPA 3QO2A 1VMCA 3KBXA 1O7YA 1HFGA 4HEDA 2N55A 1F9RA 1PDQA 1J9OA 2B2TC 4NW2A 2DY8A 2EE1A 3DM1A 1AP0A 1BF4A 1RJTA 2FMMA 4MN3A 2B2UA 3GV3A 3I90A 3MTSA 2B2YA 4XDXA 5EQ0A 4ZKCB 4MHEA 1HFNA 1SSOA 4ZLTF 1LV9A 1ICWA 2FINB 4OIKA 5JJZA 1G2TA 1HA6A 2Q8TA 1B2TA 1SAPA 1KNEA 1U4MA 2B2YC 1Q3LA 1JE4A 2NZ1D 3G7LA 5EJWA 5EKIA 5CBEE 1IKMA 1DZ1A 1G2SA 1NAPA 1PFNA 3FDTA 4RA8A 5COYA 4ZAIA 3I91A 1WTVA 1ILQA 5EPLA 1JICA 2FFKB 5CORA 3H91A 1M8AA 3KUPA 3LWEA 2FJ2A 1F2LA 4IUTA 1RHPA 2K01A 1DONA 1DOKA 1RTNA 1RTOA 2EPBA 2XIWA 2BDNA 1X3QA 1KNAA 2HCCA 4X3TA 4ZK9B 5T1GA 1MSHA 1CA6A 2VXWA 4RAUC 1F9PA 1G6ZA 1BO0A 3I8ZA 1A15A 1F9QA 4OIJA 1PFMA 1WD1A 1BBXC 1HUNA 1DOLA 2L1BA 2FHTA 1HUMA 2KEEA 1X3PA 4UAIA 5E4WC 3HP3A 1ILPA 1EOTA 2X69A 4IUUA 4R9WA 5EPKA 5CMDA 2B2WC 1F9SA 3F2UA 1WTWA 1DOMA 1U4RA 3UI2A 2HDMA 1AZQA 2KVMA 3DEPA 3I3CA 4HSVA 4XT1B 1EQTA 1S4ZA 3TZDA 2B2TA 5D14A 1WD0A
chains in the Genus database with same CATH superfamily
2MP1A 2VW9A 1ZXTA 4Y52H 2F0MA 2HCIA 2WINB 4DR4Q 1CZGA 2Q2IA 1WTRA 2JA7H 2K05A 5LHY1 4QQBX 5C4JH 1PA6A 4HCEA 4L5SA 2IJ0A 1W2BA 4LAAA 3J81L 4DV3Q 1BNZA 1EY6A 1U4PA 1EUJA 5IGGA 1VQCA 2UUCQ 5IGBA 1X32A 3TDQA 1CSPA 1E22A 4KTAA 2UXCQ 5EKKA 2NN6H 3KDFA 1BCPB 2K28A 2WIIB 1SYGA 3W3AA 2B2WA 4LK1C 1I6VC 3CCSA 3A8JE 1XMQL 3PF4A 4IURA 2Q2HA 4HIOA 1BR9A 2NN6G 3VR4A 3CKIB 3KF8A 1PH5A 2R92H 3CCVA 2F0GA 4X64Q 3CQZB 1L0WA 3HKSA 4PZ7A 3R2IA 1QJOA 4HTHA 1AP0A 4AYBB 4C3IG 2WB1G 1XNQQ 4K5VA 1G291 1CI3M 2MFIA 4LF4L 4A3GB 4NDXA 1DGSA 2B2YA 4PG3A 4BA1I 2B3GA 3GTKB 1SR3A 5FLMH 3SGIA 4C3IH 1V1OA 1O78A 4A3KB 1K0SA 4A76A 3C2PA 1QVCA 1K3RA 1FYCA 1UE7A 3JAMi 1TY2A 1PH4A 3TS2A 2JA7B 1SNPA 1DOKA 3MVVA 1N36Q 2UUBL 1QZHA 1K3BC 3IRBA 2XTIA 4LF8L 1NTGA 4XQJA 1MBYA 3I56A 2F0VA 1PRTC 4DAMA 4JPBW 4LF9L 1CKOA 5C3WA 3J81i 2P5ZX 4DV5L 1U5KA 3NWSA 4MZ9A 3GTJH 3NTKA 5A2QE 3CCQA 2RF4A 1AZQA 2Z4IA 1HCZA 5FJ8H 1DD2A 5M5XH 2F0WA 4DR1Q 1H9JA 2K5QA 2K1BA 1V8QA 4RWSC 2AQ2B 3M4OB 1SDFA 2HIXA 2EYLA 2PZTA 4B3SQ 1V9PA 3K58A 2MHVA 3SE0A 1NJIC 2X6GA 2LS01 5HY6A 3TP7A 3A5ZB 4LMQD 4C3HG 1PMRA 4KHVA 3AB9A 4QMGA 4UP7A 2OTLA 2F0EA 2XRQD 2BCOA 1FNVA 4DV2L 4BY1G 1XMOL 2E5LL 1HNWQ 4XIGS 4C1NI 2Z6KA 4LFAQ 4DNRB 1NBWA 1PH2A 1LT5D 3P75A 3GTKH 1TVXA 3FRPB 3DXJC 3MC0B 1WTOA 3PO2G 1SLJA 1LTGD 3E3XA 3PIPA 5ISRA 1TR5A 2NUCA 3S1MH 4POFA 3EBEA 3L9AX 3HOXB 1HR0Q 4BXXG 5CR3A 1VQLA 5CV6A 4JI0Q 2H5XA 1S72A 1FGBD 2WAQB 4DUZQ 3PO2H 3KOJA 1ONLA 5GAEC 4A3EG 4WJ4A 2N78A 4EX5A 3VR6A 2JEAI 4BXXH 4HJ5A 4ZKCB 5CV7A 3PIO3 2YV5A 3I4MG 2Q2UA 4R4TA 1HA6A 3A8KE 1PTOD 1SAPA 4E6IA 5IT9L 4YY3Q 1PFNA 1EZ6A 3M3YB 2CH4W 3QB3A 4CKEA 3AQQA 3FMCA 3D4RA 4JI4L 1B9MA 1EY7A 3NUCA 4LUOA 1G51A 1NNXA 1KNAA 3QG1A 1K9MC 2OWOA 4GKKL 1SMXA 1Y1VH 3MFYA 4A4IA 1DCZA 2I0QA 1AH9A 5C6AA 5CV5A 3RR5A 5E4WC 4DR7L 4DV5Q 3ICEA 2A69D 3UDXA 4RHSA 5DLQE 1F9SA 5IP7H 1DYQA 4NKLA 3RUZA 2PW5A 2GVBA 2HHHL 5C44B 4LF7Q 3MA2B 1CHPD 4IALA 2MPMA 5FK9C 1TWCH 4IN3A 1PFBA 4IFDI 3VR2A 3G48A 2B2VA 1WCMH 4DAVA 3R8BA 1IBMQ 1XTDA 4TSSA 4PMWA 1HRJA 3KBGA 4DGZA 5AFWA 3RLNA 1ESFA 1XTCD 3C3LA 3MWYW 2CVRA 2RHQB 4R1JA 1MKHA 4LUZA 3VYRA 5KYIA 1J8IA 1SNOA 1KLGD 5JVH3 2L9HA 4CDEC 4JBKA 4NPSA 1IKLA 2N88A 2PZWA 3M4PA 1AE2A 1UWVA 3TZUA 4R8IA 1YBYA 4ZUJA 5IOCA 5GQOA 1LTTD 2V4DA 3HOYH 2WKCA 2D62A 4UPAA 4Q0FA 3HZXA 1Q1EA 3IFDA 2EY5A 2PI2E 2VQEQ 5KIXA 4BBSG 3HOYG 3MXPA 3OWEB 2JA6G 2QF7A 2VY3A 3HS0C 4JYAL 2F3IA 1PTOF 4DR4L 3KJPA 4K6DA 4DU9A 1VQHA 3RLFA 1TS3A 1A8VA 2F3WA 3BZDB 1W3SA 1NY4A 4QGUA 5GAGC 4V190 2XRSD 2EVBA 4BWGB 1R9TB 4DK3C 4HJ8A 4RH6A 2BH8A 1HNZQ 4Y7NH 2M9VA 1ILQA 1GHJA 2K5VA 1XNRL 1EY8A 3HOXH 2RBMA 1W6KA 2EJGC 3LWEA 3NBIA 4AYBG 5C0XG 3HOVG 1T9HA 3PUYA 4C3JB 1LTLA 5K36H 2EYOA 4L5RC 5M3FB 4P73A 2R93B 2AQ3B 2XVSA 1RL2A 1HUMA 4WJWA 3TS0A 3HOWH 2B63G 2XSCA 5C0XH 2AUKA 2X69A 5IYDH 1S5CD 1ZKOA 4A3BG 5J39A 1ASYA 3GTGB 4XT3B 4CHTB 3SK6A 4IUQA 1ENCA 2K5WA 4LF5L 5IGEA 5M5YH 5IYDG 2AHOB 2UU9Q 5BN5A 2HDLA 2ES2A 4JBWA 1FD7D 3G71A 1UNSA 2DJGC 5LL6X 4U673 3K7AB 3ITPA 2EYHA 3QJYA 4JOIA 1BOSA 1EIGA 3T1HL 3J80c 4JYAQ 4A3MG 1JORA 4DV6Q 1E2ZA 2L5TA 3EFXD 4HR7B 1TXYA 2OXPA 4R4QA 3TBIB 4GOPA 4DV2Q 3T4AC 1C9OA 5I2XA 2GA4B 1TWGB 3PMFA 5T1IA 4DR3L 5BR8L 3G4SA 1EYAA 3KLSA 1EIHA 3HGBA 1KDAA 2XN9C 5M9OA 5JJIA 5JVG3 2F0JA 4X65Q 2D5DA 1JJGA 1JCKB 4JI8Q 2IL8A 4KK7A 1Y8NB 5IGCA 1JOQA 3GTMH 2N55A 1J5EQ 3D6CA 1D2BA 3TP5A 2AUJD 5IWAQ 2ID0A 2LSSA 1HQMC 3I90A 1SYCA 2R92G 2JSOA 3EROA 1M90C 2FINB 1SNDA 2Z0SA 2IX0A 1Q3LA 4BY1B 1PRTB 3FDTA 1II3A 4RA8A 3GTOH 1AN8A 1TWCB 2NTSA 4JI7Q 2UUAL 2K14A 1EFWA 3VA5A 3KUPA 3T13A 1RHPA 4DUYQ 4A3FG 1DONA 5CV8A 1PYBA 3KK7A 3E0JA 1KQSA 4DUYL 4JBJA 4DKAC 1CKNB 1Y1WB 4LWCA 2L0CA 3H15A 3CHBD 1D7QA 1HUNA 1PH8A 4JI7L 1YHBA 1HQRD 3FPPA 1KAWA 4O0AA 1AW7A 2WAQG 4BBRH 3CRKC 2JA6B 2F1MA 4FF2A 2BE5C 2EDGA 2HDMA 2K32A 4OWWB 4A93G 1VQ4A 1EYDA 4HSPA 3EVQA 1TWGH 1XX8A 2IWHA 1RCVD 1SN8A 2F0FA 3FKIH 4A3JG 5NUCA 1O7LA 1IHZA 3BYTB 2BOSA 4BBRG 1U9RA 2R3ZA 2PNHA 1BCPF 1ZYRD 2DY7A 4WFN3 3J7ZC 2L4NA 1KTKA 3F1ZA 4HCSA 1BKBA 1EY4A 4ABNA 4A3IB 4JW0A 4H13C 4CJ1B 4FF1A 1QUQA 4JI0L 5DNFA 1IW7C 1N34L 1EZ8A 2ICIA 3OPOA 3SDZA 5A35A 3QOJA 1L1OC 4GNXB 2GN5A 3JAME 4DR6Q 4EQPA 3GTMB 1RD9D 4ZKBB 1N9WA 2NVTH 2PYKA 5IYCG 5JJLA 1CFMA 1MI2A 5DEHA 1YIJA 2PZUA 2EYPA 3A5UA 4GZYC 3M7GA 2VS1A 2VUMB 4DR3Q 4CJ0B 2R61A 4DV6L 4DV3L 1H9SB 4BY7G 5FLXE 1EY0A 4BY1H 4WJ3M 5LMUQ 3FP9A 2K5NA 3P20A 1VQMA 3VA7A 3TEHB 2N49A 4FO2A 1G8ZD 2Y0SE 4KKSA 2KUMA 3K5LA 4LFAL 2JXMB 2G9HD 5CV9A 3MEHA 4C56C 5I9PA 3NQIA 5IYBG 3VR5A 3KF6A 4PV1C 4OO1I 2JJQA 3D31A 1NE3A 4KI0A 4A3KH 2FXQA 2F0IA 3CXCA 3BU2A 3RMHA 4B08A 1C48A 5L37A 1LO5D 4P72A 1ICWA 4K8IA 4A3EH 4A3KG 3TMEA 1DZ1A 4PMBA 2NZHA 4X62L 1Q82C 1ZYRC 3O13A 1WTVA 1IZ6A 3MZ5A 5FLXL 1WI5A 4A3DG 4OHJA 2BH2A 3BJUA 5JEAH 1MHWC 4PZ8A 2F03A 3P1HA 5C4ZA 4LF8Q 3I4NG 4DR5L 3CCJA 1QZGA 1LM0A 4GLVB 2K75A 2EY2A 1B3QA 3S1QH 1PFMA 2K50A 3K57A 3CF5A 4DA2A 3D3RA 3I4NH 2F0NA 2HQEA 3S16H 5I2YA 1RDPD 4CDDC 3M85A 3DEPA 5BN4A 3J81c 4DK0A 1Z6HA 5E4XA 5J1ZA 1K83H 4DFAA 1SEBD 4POGA 1SE3A 3OTOL 3WWVA 4UHVA 4ILWA 4HJ7A 4ALPA 1GO3E 2A8VA 1I50B 2DJFC 1N32Q 3GO5A 3JAMc 3NHHA 2K4KA 1GXDC 2LY7A 4RGTA 5IODA 1I4GA 1KRSA 1S5DD 2F0HA 2NZOA 1K8GA 1A63A 3CC2A 5TSSA 1VF7A 1S5ED 5IY0A 1WCMG 1QNUA 2RCNA 2A5HA 3CCUA 3CPFA 2KEDA 2EY1A 1I4RA 2NTTA 1WTQA 2R93G 1Y1WG 3GDEA 3TREA 2L12A 4X64L 2OQKA 3CRLC 3BG3A 3HKZB 1HR0W 5EAYA 4MTNA 1AZPA 4NXML 2RSOA 2VB2X 1MGSA 2G5DA 4ME3A 1O80A 3T53B 4DAYA 1HJPA 4HAEA 3PIP3 1UUPA 1HHVA 1YNXA 3NSWA 3SK4A 1VQEA 2ASBA 1PV4A 2MGSA 1WTPA 1OO9B 1YJ9A 3J7AV 1EQQA 1VMCA 2Q2TA 3ND8A 1VS0A 3J80L 1F9RA 1E1OA 1J9OA 1JC7A 1Q90A 4MNOA 5LMNW 3M3YH 3T16A 3I2ZA 2A68C 4KY5A 1N8RC 2ZM6Q 2ENBA 3NPPA 3QIAA 3TQYA 2IX1A 4MHEA 2JA6H 4B3TL 4F87A 4ZLTF 4FDBA 4KHPL 1V43A 2A6HC 3KF6B 2YTYA 5EJWA 4IQZA 2R7DA 4DXGA 1VQ5A 3DWAA 1K73C 5EBDA 3I91A 3JC66 1EY9A 2FFKB 4H7BA 4RG1A 1L0YB 3URYA 3MXNA 3ERQA 4DR5Q 3GTPH 2BDNA 2HCCA 3S14B 1TS2A 2YYZA 4YY3L 1Q7YC 3E5SA 1TKWB 4Q5VA 4Z9CB 2HT1A 1QILA 2KEEA 3STBC 5CYUA 4L63B 4S3SA 4ULLA 3A54A 1I50H 1XXGA 3K0XA 2NVXH 3C1FA 1I6HB 3V05A 2JEBI 4NP5A 2A1AA 4XT1B 1X3EA 3PO3H 1SNMA 3L0OA 3HOWG 1CK1A 3I72A 1VF5C 1SFOB 2F0DA 1FR3A 3GTOB 1XNRQ 3ERSX 3TSSA 1Q8KA 2B39A 4DPGA 2E2JB 2E2IH 1PTOH 3NELA 4JVZA 2B2UC 2DN8A 3B6YA 3HFZB 4KHPQ 2IW3A 4YHHQ 2Y0SG 1GUOA 4A3FB 2E8GA 3I4NB 1PRTD 2RHSB 3EN2A 5C3EB 4A3JB 1XYIA 2Z9HA 4XTCS 2JA8G 4NB3A 2LFNA 2K52A 1D5ZC 2F0PA 2V1CC 1SRUA 2VQFL 1WOCA 2KCTA 4KN7C 5JOBA 2PMZB 1VQIA 1FL0A 2PQAA 1V1PA 3FKIB 3H94A 3UE1A 1ET9A 4GOPB 2JA8H 4A93B 5JPNC 2DNCA 3S17B 3SEBA 4APVA 3CQZH 2NWGA 2DNEA 1KIXA 1IYVA 4LUVA 4JCVE 1SROA 4EQ5A 4DV0Q 3H0GB 4A3IG 4CBVA 3G6EA 1LYLA 1H9KA 2DGYA 3STBD 4OX9Q 3GD7A 1EYGA 1UEAB 2KBNA 3S1NB 4J15A 5JPMC 4MN3A 1X6OA 4F88A 3RD4A 1SSOA 1YZ6A 4B3RQ 2LXKA 4K0KQ 3MHBA 4DNTB 1L2FA 2WFWA 3DMUA 1YJNA 2QGQA 1B9NA 5EPLA 3SR1A 1V1QA 3TRZA 1EQRA 2EIFA 4JG2A 3RZOB 4JI6Q 2Z6KC 3Q23A 3S1MB 1HTPA 1E7ZA 4HMIA 3AEVA 2EPBA 3KYHC 5AJ3Q 5T1GA 1VCIA 2EYJA 1SE4A 2NBFA 2KENA 5CMDA 1STNA 4K6LA 1UE1A 1SYFA 2I07B 4GKKQ 2K33A 3TZDA 4IO9A 1HNXQ 2EXZA 3GP7A 1VMPA 3K5OA 1WTXA 3F2DA 3J7AF 2NVYB 1UAPA 5KNBA 1YNNC 3KDFB 3W1GA 4IPGA 2A73B 4X65L 3DLLA 2VQEL 3BS1A 4RKBA 2M2LA 3OW2A 1XPOA 2CCZA 1Q1BA 3E9IA 4AYBE 1EIYB 3SK5A 5HURA 4B3RL 4I65A 2D0PA 1H9RA 1PTOC 3S2HB 1R4QB 5CBAE 3H3VC 2DUDA 2YU9H 5EGTA 1EIFA 2C9OA 4IPCA 1MJCA 4DUZL 2BA0A 3T1YL 5C44H 4DV0L 1XPUA 1NUCA 1IYJB 1C8CA 3S2DB 3K6OA 1TY0A 3R3OA 1FJGL 2MJ8A 1S5FD 1CM9A 2Q8IB 1VQ6A 1HZCA 2UXCL 4LFCL 1HNWL 2RA4A 2VQFQ 1LTAD 2VNUD 1B8AA 3BVZA 4U68A 2IX3A 5ELCA 3HOUH 1UEBA 2JK8A 2Z4HA 1K8OA 1GUNA 1MD2D 1XMOQ 1PH6A 2E5LQ 3JAML 2LKVA 3DM1A 1N32L 2J0TD 3L2PA 4A3EB 2FMMA 1TU2B 4PZ6A 4RGOS 4DF7A 1I4PA 2B2UA 3MTSA 2F0TA 4YHHL 1TWFB 1OXVA 2F4VL 3FEWX 4QY7A 1HH2P 2Q8TA 2NZ1D 4JC0A 2CFMA 5EKIA 4NMZA 3HKZE 1Y8PB 1K0RA 1S3OA 3TP8A 2LXJA 2XNAC 5I6WA 1XWEA 3PUVA 1U0LA 2PPBC 5E3FA 1A3TA 2C5CA 3KLWA 4LF5Q 1PYWD 4X62Q 3RNUA 4ZK9B 3Q22A 1EEID 4MIUA 1SNCA 1I4XA 2L1BA 2RCFA 5FLXc 3E9HA 3PGZA 3LWUA 4P75A 2UUBQ 2E2HH 4G4KA 1YNND 3NTIA 1WTWA 4JI5Q 1TQOA 1JE5A 1Y1VG 1PH9A 1D8LA 4HSVA 3PV0A 1WD0A 2JQOA 3U4ZA 5FKAC 2CWAA 5CGKA 2ZTCA 1I94Q 3OMGA 2RVLA 3DUZA 1SMYC 3M4YA 4X3KA 5IP7G 2RSNA 3UE0A 2JA9A 3S2HH 1PHJA 2SDFA 1YNJD 4LF6Q 2CWPA 1YHQA 2CQAA 1JWSD 2B2VC 2RDHA 5FO7B 4DK1A 2D0OA 1JR0D 3OIPA 2VUMH 2ICEC 1R9TH 3V2TA 4C3IB 2JYOA 3K0YA 4PQXA 2J4XA 4R4IA 2UXDL 4LFBL 3QOLA 2QILA 3HOZB 3ULPA 5D65A 4LW1A 2VUMG 4DN4M 2KQ3A 4HJ9A 1C4QA 4NXMQ 3T1YQ 5IIFA 3N52A 2F0SA 3GTGH 1FNWA 4QUCA 4RGNA 4C2MH 1FJGQ 3RZDB 2I5HA 1WJJA 4DV4L 2R7ZB 4QB4A 1D6EC 1WYDA 3MXNB 3X3MA 2E2JH 2EYMA 4X3SA 2YTXA 4FXKC 3K81C 1TS4A 1EEFD 1SYEA 1EWHA 3KBXA 4YCVA 1B70B 1HFGA 2R6GA 4X66L 3L7ZC 4CGYB 2MNAA 2O5JC 1OTCA 4L8JA 4LF6L 2AWOA 2ZTDA 1L1OB 1EOVA 4GNXC 5J3BA 4OIKA 3G7LA 1U4MA 4PMCA 5CBEE 3KJOA 1OXXK 1SNQA 1NAPA 3A8IE 3E6ZX 3S17H 3H0GG 5J22A 5IP9G 3AFQA 3S1QB 4ZAIA 2NVYH 3NBHA 1VQ9A 1RF2D 2E75C 4K8JA 1A62A 1LACA 3OTOQ 4DR7Q 3H0GH 2KHJA 1F9PA 4ZCKA 3I8ZA 1SYDA 4CKCA 1WD1A 4OELB 4UDUC 3NBHB 1Q12A 1DOLA 1GJXA 3HOXG 2VL6A 3PO3B 2RDFA 3UDFA 3LX0A 4KHZA 4QIWB 1VQNA 4IUUA 1A2UA 3K80C 1ASZA 1SFOH 1VQKA 4A3CG 2A69C 3CCLA 2YU9B 4IOCA 4ZYSA 1Y14B 5D14A 2UXBL 4X66Q 4B3ML 3PO2B 2ZJQA 1SXTA 2IHFA 3Q8DA 1O7IA 4OGQC 1Y69U 1GUWA 3I4MB 4JI4Q 4A3CH 4JI8L 4A3BH 4IPHA 2L55A 2N3SA 5G3LF 2B8FA 1UE6A 1DM0B 2WB1B 3CC7A 4GOPC 2F0UA 2JA7G 2QEXA 3H3VH 1JWMD 5C4JB 4JI2L 3J81E 1RIPA 3W1BA 4X3UA 1T5EA 2QKIC 4A3MH 5C5MA 4QIWE 4QJFA 1K8MA 3VR3A 2K6AA 1JB7A 3A7LA 3AFPA 5M3MB 4LFCQ 1QG7A 1FGUA 3VYUA 4B3SL 5I9OA 1VDZA 1TWHH 4CJ2C 2KA7A 4O1NA 5M5WH 5IT9c 1SJHD 2HIVA 1B50A 1CZWA 2VB3X 3S1NH 4J8QA 4F7XA 1A0IA 4N9PA 1A2TA 1E24A 1CQVA 3I73A 3VYTA 2ZXPA 1KRTA 4LNQA 2O2LD 3S2DH 1K8AC 1I5FA 5JJZA 4HIKA 1JB3A 2WACA 1IW7D 4KD4A 2PO4A 1D1KA 1QUQB 2RDGA 1D5XC 1D1IA 1M8AA 1F2LA 4DR1L 2NVXB 3OMCA 4GLAC 5I6YA 1NSNS 4JK1C 4X3TA 1SYBA 1F77A 2KHIA 4L6TB 1HZ9A 4KY6A 4KD3A 1EU3A 1EOTA 1TWFH 3S1RH 1P16A 1U4RA 3I70A 3I4OA 4IPDA 2E2IB 2UUAQ 1EQTA 1PFSA 4RFBA 2HQLA 4KN4C 2AWNA 3K7AH 2IHEA 4KV6A 2K04A 5C3XA 3VYSA 2KHSA 4IJHA 1BXTA 1N33L 4JI6L 2JP1A 5FJ8G 3ZJYC 4QF4A 2MQHA 1E2VA 1QVFA 2EOTA 2A6HD 3FKIG 2PI2A 4B9WA 4A3JH 5IWAL 1QNKA 5M5WB 1C0AA 2F0KA 1K28A 3C46A 1G91A 1ET6A 4YCWA 4TKOB 3WDNA 4G7ZC 1LTBD 2K5HA 3IKJA 1YI2A 4ZQ3A 1TWAH 3CAMA 3HRZC 2QDBA 5M3MH 3FHWA 3DWQA 3RLOA 5M3FG 1IYUA 1Q86C 2SEBD 2K5DA 1M4VA 1EQVA 2UXDQ 5IYCH 4DV4Q 1S5BD 1X55A 2L11A 3BZCA 4KKUA 1JOOA 2R7FA 1STAA 5ELEA 4A3LG 4RHRA 3BDLA 2GVAA 5BR8Q 1GHKA 2UUCL 3D6WA 5KNDA 2ZJPA 5ELFA 1NCVA 3W2DA 1H9SA 3QO2A 3J80i 2B63B 4G7OC 2QEJC 4DV7Q 1O7YA 2EJMA 2EXDA 1I94L 1IBML 5M5YB 2B2TC 4JI1L 1GUSA 4A3GG 4TQUS 3T51B 3KLRA 4JV5L 3NENA 4XDXA 4C2MB 2IY5B 5ELOA 1H9MA 4EQOA 3CMEA 1B2TA 4A3FH 4A3GH 3PUXA 5ELDA 1LUZA 2B8GA 4ZRZA 1PRTF 4KJNA 2UU9L 1EWIA 4GKJL 3UDGA 2F52A 3X3NA 1QWYA 1Z7TA 4O2DA 3CPWA 1BO0A 1E2WA 1YJWA 3HEJA 4CDCC 4BBSB 2FHTA 4RGMA 1NMGA 2OCEA 3GTLB 4QCLA 3MAQA 4OWXB 4V0BA 5ELBA 1T5XD 2FMCA 3I4LA 5EPKA 4DV1L 1I4HA 2B2WC 1Q8IA 2PQAB 1J6QA 4IFDJ 1GD7A 2IPKD 4RCNA 3AU7A 1NR2A 4IUVA 5C0XJ 1VQGA 4IOAA 3E0EA 3AMUA 1SMYD 1X9NA 3NQTA 5K5PA 3OWFA 2M00A 1YNJC 4GN5A 1TWAB 1VQDA 5A2QL 1HNZL 4HIMA 4DAPA 1RODA 5BN3A 5LMUL 3A74A 4ZUIA 5D3DA 1JJCB 4UP8A 1JMCA 3SK8A 1RKNA 2OEOA 4XQNA 4C3HB 4ME5A 2A6ED 2XGTA 2G9DA 3F2CA 1ESRA 2PMZE 3KFUA 5G3LD 4JI3L 5F2DA 5JJKA 3Q24A 2CW0C 3HKZG 4OXPA 4NXNQ 4G57A 4WORA 1KLUD 1KXLA 2R93H 5FO8B 1PLFA 3HOVB 1NR4A 3IL8A 1L0XB 2KECA 4L5QA 1TT2A 1EYCA 2OF1A 2ATWA 5LL6S 3GQBA 2H4OA 2D2CC 5C4XH 1N34Q 1CUKA 2PQEA 1GOZA 1CTMA 2Z1CA 5M5XB 1OXSC 3U9OA 4FYDA 5C0XI 1PDQA 1C7YA 2EE1A 3H3VI 1LT6D 1EWCA 4OO1G 3GTJB 2VZAA 4BS9A 1VQJA 3PQIA 3EQLC 1VQ7A 2NVQH 3K5NA 1LV9A 5H1SE 4HIDA 3LNNA 1KL9A 1VQBA 4L5TA 1CSQA 3S15H 4OO1H 3ULJA 1N36L 4YCUA 2HHHQ 3S14H 1JICA 3NP8A 4LF9Q 5CORA 3ULLA 3H91A 2L15A 3M4OH 1AE3A 2NB0A 2K01A 1XPRA 1RTOA 4YWLA 1E1TA 2CH4A 3NWTA 1X3QA 2OTJA 1OXUA 4IUNA 1I3QH 4FNFA 3U4VA 4RAUC 1QB5D 1V1PB 1A15A 4KJOA 1KHIA 2A6EC 3KF8B 4B3TQ 3PCOB 1BCPC 4LJZC 4R9WA 2AKWB 5EBCA 1Y1VB 4AQYL 5GAHC 4ODGA 4K0KL 1CHQD 1DOMA 2WV6D 2KVMA 3I3CA 1JT8A 1HPCA 1ENFA 1JOKA 2B2TA 3H6MA 1YHAA 5AJ3L 3CP0A 4P2CB 4JBMA 2R92B 1E0BA 4EQNA 5I4DA 4BA2I 4R8NA 3J80E 3CD6A 4EVOA 2AMCB 5KYLA 3J81j 1LT3D 4ID6A 3HOZH 4HJAA 1GVPA 1XMQQ 2JA5G 2OQ0A 3A55A 4A3DB 1BQQT 5C4XB 1IL8A 2CW0D 1GUTA 4OX9L 1ML0D 2O4XA 1CKNA 1NMFA 1R4PB 2QA4A 2A74C 3HOZG 4CKBA 4DAYB 3QR8A 1QE6A 1PH7A 3RN5A 5D3IB 3CC4A 4LFBQ 4IZ8A 4M1UB 1HR0L 2E74C 1YEZA 1LTSD 3BZKA 1O7ZA 4QL5A 4JI3Q 2EYFA 2XWJB 4BBRB 4KMUC 3T1HQ 3HOYB 1LABA 5E7NA 3ONAB 1EY5A 1UE5A 3K5MA 3AYHB 4HEDA 3D8GA 4M8AA 4J6HA 4NW2A 4N8FA 1CT1D 2OT2A 2KCNA 1B44D 1VQPA 4IFDG 2XWBB 1A6XA 2KJXA 3Q0AA 1QCBD 3PIOA 5KRUA 3CCEA 1X54A 4B3MQ 4AIMA 1L1OA 1G2TA 1KNEA 3D4DA 1IKMA 2IT1A 3HOVH 3CW2C 2C35B 4IFDH 3GTPB 5K36G 3NEMA 4BY7B 3BVGA 2MO0A 1CQFA 2FJ2A 4MTKA 2F0OA 2B63H 4I7ZC 1WTHA 3MXUA 1RTNA 2XIWA 4K14A 4TVAB 4GKJQ 3BDCA 1G6ZA 1EFID 1F9QA 1I6HH 3PO3G 4HMJA 2R7ZH 1B1ZA 3UDIA 5IGFA 1YVCA 1FVIA 1ILPA 2BDOA 3MEFA 4YIJA 4FXDA 4A3BB 3F2UA 2MO1A 3M9BA 5FOBB 3VDYA 1SE8A 3CMAA 5EKLA 4K2KA 1DJRD 4OONA 3Q6SA 3J7A5 5JAVA 3T56B 3D0FA 2Q8RE 4GNXA 3IFTA 4JOIC 1KABA 1QOHA 1B4OA 4DV7L 4LF4Q 3J7YW 4DXFA 1XJVA 4G7HC 1VQOA 3FVQA 5DM63 1VQAA 4KKTA 4JI1Q 1U4LA 1BVSA 5C4HA 3OW7A 1LTRD 1MSGA 1B3AA 3GTQH 2ZM6L 5CV4A 3OYYA 2KOLA 4X6AH 4N8X1 3R93A 3IAYA 1J5EL 4GN3B 2F4IA 2HD3A 1FNUA 4OWTB 5M3MG 4B9XA 1PZID 3BVMA 4DNIA 5M3FH 2RQXA 3DHQA 3EJIA 2X6LA 1HXYD 4BY7H 3TP6A 4A3LH 1K83B 4LF7L 1S40A 1HTLD 2DY8A 1JJ2A 5FLMG 3HOUG 1M1KC 3GV3A 4RCOA 4FF3A 2Z8LA 3K8AA 1PTOB 1HNXL 3NXWA 1DXMA 1MJEA 1ZEQX 2B2YC 1N33Q 1BDOA 1JE4A 5C5LA 4JI5L 3BYYB 1A3UA 2SNSA 5IT9E 1JWUD 3WOEA 2Y0SB 4R4CA 4IUTA 3M7NA 3S1RB 1LT4D 3V96A 2CQOA 4DK6C 1CA6A 4H44C 2QW7A 3MFGA 4OL7A 1VQFA 4OIJA 1KD1C 2JA8B 4A93H 5HGTA 4A3DH 1Z9FA 1SBBB 3F2BA 4K5XA 1D5MC 2WAQE 3F8TA 1Q81C 3M4QA 3U9SA 1X3FA 1AFPA 2NVQB 4FF4A 5LMNQ 4IUPA 3EIVA 1B53A 3S16B 4XYQA 4N9TA 1VQ8A 4OEMB 3I55A 4WRDA 5CC4A 1B7YB 3NK9A 4C3HH 1SJED 1STYA 3W5OA 2QDLA 2I5LX 3NTHA 2ZXOA 1H95A 5C44G 4JV5Q 1I4QA 1X65A 1ENAA 1PZKD 4PNYA 2J7ZA 5IE8A 5GADC 5GROA 3OOCA 4FP5D 4UY8C 1SE2A 3U50C 3R2TA 2F0LA 3SXHA 2K03A 4JI2Q 5KGUA 3K7UC 2KCCA 2YTVA 3OHXC 2Z6BA 1IBLL 1BBUA 4QUFA 3GV6A 4XXEA 3S24A 1Y1WH 3PUZA 5IYBH 1PH3A 2JE6I 4FXGC 3ER0A 2E2DC 1HZAA 4O42A 2H1EA 4KLKA 2K7VA 4UP9A 2TSSA 1KAAA 3OIQA 3GTQB 3I4MH 2JA5B 1STHA 3PF5A 2E76C 5C4XG 3ND9A 1BF4A 1KDCA 1RJTA 1IBKL 2NN6I 2TMPA 1GKHA 1STBA 4DV1Q 4DR6L 1F2ZA 2BE5D 1PVOA 5C3EG 4GLXA 1IL2A 3PUWA 5JEAG 4AH6A 2O5IC 1CKMA 2LMCB 2ZXRA 3EA6A 1MIUA 1G2SA 5E1FA 4XQQA 5KEEA 4YWMA 3A56A 5COYA 2A68D 4H02A 2UXBQ 1LTID 3GTLH 5C3EH 2NVTB 4K2LA 4XYOA 1GUGA 5HGQA 1TWHB 4A75A 3MXGA 4K5WA 3A7AB 1EU4A 1LLRD 1KC8C 1MSHA 4C3JG 1BBXC 1BCPD 1X3PA 1X3GA 4UAIA 3HP3A 2PNRC 5ELNA 4C1NK 2ALYB 3DM3A 3UI2A 4C3JH 2A19A 3G6JB 2N8NA 1QVGA 1HA5A 3HOUB 2EY6A 1PXUA 1CA5A 1TIID 1ICFB 4KY7A 1STEA 1KDBA 3QWNA 2QCPX 3L3OC 1EL0A 3U58A 2WP8J 1TS5A 1XNQL 2D9UA 5JEAJ 4FVMA 4CDFC 1PZJD 1Q46A 1WCMB 4J1MA 2EQSA 2CKZB 2EJFC 2WB1E 1JQYD 1P8LA 4A3MB 1BUVT 1OXTA 1IBKQ 3BDOA 3CCMA 1WVLA 2JA5H 3RZDH 3PSIA 3RZOH 3FPUB 4F8MA 3S9WA 4NXNL 5FO9B 1F2YA 3ZYYX 5EPJA 3TN2A 2MUYA 4BBSH 3DEOA 1IBLQ 1F2MA 1X56A 3SVMA 2I5MX 2E2HB 2NYZD 1G6PA 4R4OA 2HUGA 1IXRA 3P7JA 4GS3A 4IJLA 2F0QA 2JN4A 1Z47A 4P74A 1STGA 2RKSA 4P71A 3A0JA 3SHLA 3I7FA 3N6RA 4RKLA 4HN7A 3S15B 5IP9H 3CCRA 1BBWA 2PW7A 5EQ0A 4A3IH 1GM5A 5LMNL 1HFNA 2ZT9C 1PYSB 3LGJA 2AQ1B 3HG9A 3WOFA 4DR2L 2SOBA 4RMFA 1I3QB 4I7AA 2F3VA 3C1EA 2ZJRA 4YWKA 3D4WA 2EZVA 3H09A 2WKDA 3KLSX 2ZTEA 2B29A 1HZBA 5DAUA 1A3VA 4Y7NB 1YITA 3CU7A 3K59A 1PH1A 4DR2Q 2VXWA 5DM73 5KNCA 3NE5B 1WFQA 2I46A 5IGDA 1AEXA 2SNMA 3RN2A 2F4VQ 4AQYQ 3DWPA 3OSOA 4TRDA 2CHBD 1Y8OB 2KCMA 4GN4B 2BA1A 2PCFB 1W6JA 1E3PA 4H0LC 4EGVA 3HOWB 1S4ZA 2R7ZG
chains in the Genus database with same CATH topology
2MP1A 1ZXTA 2F0MA 2HCIA 2WINB 1CZGA 1WTRA 2K05A 5LHY1 4HCEA 2IJ0A 1BNZA 4LAAA 3J81L 1EY6A 1U4PA 5IGGA 5IGBA 1X32A 3TDQA 4KTAA 5EKKA 2NN6H 1BCPB 2K28A 2WIIB 1SYGA 3W3AA 2B2WA 4LK1C 1I6VC 3A8JE 4IURA 1BR9A 2NN6G 3VR4A 3CKIB 3KF8A 2F0GA 3CQZB 3R2IA 1QJOA 4HTHA 1AP0A 4AYBB 4C3IG 4K5VA 1G291 1CI3M 4A3GB 4NDXA 2B2YA 4BA1I 3GTKB 1V1OA 1O78A 4A3KB 3C2PA 1FYCA 1TY2A 2JA7B 1SNPA 1DOKA 3MVVA 4XQJA 1MBYA 2F0VA 1PRTC 5C3WA 3NWSA 3NTKA 5A2QE 1AZQA 2Z4IA 1HCZA 1DD2A 2F0WA 1H9JA 2K5QA 2K1BA 1V8QA 4RWSC 2AQ2B 3M4OB 1SDFA 2PZTA 2EYLA 3K58A 2MHVA 3SE0A 2X6GA 2LS01 3TP7A 4LMQD 4C3HG 1PMRA 4KHVA 3AB9A 4QMGA 2F0EA 2XRQD 2BCOA 1FNVA 4XIGS 4C1NI 4DNRB 1LT5D 3P75A 1TVXA 3FRPB 3DXJC 3MC0B 1WTOA 1LTGD 5ISRA 1TR5A 2NUCA 3L9AX 3HOXB 5CR3A 5CV6A 1FGBD 2WAQB 1ONLA 3VR6A 2JEAI 4ZKCB 5CV7A 3PIO3 1HA6A 3A8KE 1PTOD 1SAPA 4E6IA 5IT9L 1PFNA 1EZ6A 3M3YB 3QB3A 4CKEA 3FMCA 3D4RA 1B9MA 1EY7A 3NUCA 1KNAA 3QG1A 3MFYA 1DCZA 5C6AA 5CV5A 5E4WC 2A69D 4RHSA 1F9SA 1DYQA 4NKLA 3RUZA 2PW5A 5C44B 3MA2B 1CHPD 4IALA 2MPMA 5FK9C 4IN3A 1PFBA 4IFDI 3VR2A 2B2VA 4DAVA 3R8BA 4TSSA 4PMWA 1HRJA 3KBGA 4DGZA 5AFWA 1ESFA 1XTCD 3C3LA 3MWYW 2CVRA 3VYRA 5KYIA 1J8IA 1SNOA 1KLGD 5JVH3 2L9HA 1IKLA 2N88A 2PZWA 3TZUA 4R8IA 4ZUJA 5IOCA 1LTTD 2V4DA 2WKCA 2D62A 4Q0FA 3HZXA 1Q1EA 3IFDA 2EY5A 5KIXA 3MXPA 3OWEB 2QF7A 3HS0C 1PTOF 4K6DA 4DU9A 3RLFA 1TS3A 2F3WA 3BZDB 4V190 2XRSD 2EVBA 4BWGB 1R9TB 4RH6A 2M9VA 1ILQA 1GHJA 1EY8A 2RBMA 1W6KA 2EJGC 3LWEA 3NBIA 5C0XG 3PUYA 4C3JB 5K36H 2EYOA 5M3FB 2R93B 2AQ3B 2XVSA 1HUMA 4WJWA 2XSCA 5C0XH 2AUKA 2X69A 1S5CD 1ZKOA 5J39A 3GTGB 4XT3B 4CHTB 3SK6A 4IUQA 1ENCA 2K5WA 5IGEA 5BN5A 2HDLA 4JBWA 1FD7D 1UNSA 5LL6X 4U673 3K7AB 3ITPA 2EYHA 3QJYA 1BOSA 1EIGA 1JORA 1E2ZA 2L5TA 3EFXD 4HR7B 2OXPA 3TBIB 3T4AC 5I2XA 2GA4B 1TWGB 3PMFA 5T1IA 1EYAA 3KLSA 1EIHA 3HGBA 1KDAA 2XN9C 5M9OA 5JVG3 2F0JA 2D5DA 1JCKB 2IL8A 4KK7A 1Y8NB 5IGCA 1JOQA 2N55A 3D6CA 1D2BA 3TP5A 2AUJD 2ID0A 1HQMC 3I90A 1SYCA 2JSOA 3EROA 2FINB 1SNDA 2IX0A 1Q3LA 4BY1B 1PRTB 3FDTA 1II3A 4RA8A 1AN8A 1TWCB 2NTSA 3VA5A 3KUPA 3T13A 1RHPA 1DONA 5CV8A 3KK7A 3E0JA 1Y1WB 2L0CA 3CHBD 1HUNA 1HQRD 3FPPA 1AW7A 3CRKC 2JA6B 2F1MA 4FF2A 2BE5C 2EDGA 2HDMA 2K32A 1EYDA 4HSPA 3EVQA 1XX8A 2IWHA 1RCVD 2F0FA 5NUCA 1O7LA 1IHZA 3BYTB 2BOSA 1U9RA 2R3ZA 1BCPF 1ZYRD 2DY7A 4WFN3 2L4NA 1KTKA 4HCSA 1EY4A 4ABNA 4A3IB 4H13C 4CJ1B 4FF1A 5DNFA 1IW7C 1EZ8A 2ICIA 3OPOA 3SDZA 5A35A 3QOJA 3JAME 4EQPA 3GTMB 1RD9D 4ZKBB 2PYKA 1CFMA 1MI2A 5DEHA 2PZUA 2EYPA 4GZYC 3M7GA 2VUMB 4CJ0B 2R61A 1H9SB 5FLXE 1EY0A 3P20A 3VA7A 4FO2A 1G8ZD 4KKSA 2KUMA 3K5LA 2JXMB 2G9HD 5CV9A 3MEHA 4C56C 5I9PA 3NQIA 3VR5A 4PV1C 4OO1I 3D31A 4KI0A 2F0IA 3RMHA 4B08A 1C48A 1LO5D 1ICWA 4K8IA 3TMEA 1DZ1A 4PMBA 1ZYRC 3O13A 1WTVA 3MZ5A 5FLXL 4OHJA 5JEAH 2F03A 3P1HA 5C4ZA 2EY2A 1PFMA 3K57A 4DA2A 3D3RA 2F0NA 2HQEA 5I2YA 1RDPD 3M85A 3DEPA 5BN4A 4DK0A 1Z6HA 5E4XA 5J1ZA 4DFAA 1SEBD 1SE3A 4ILWA 1I50B 3GO5A 3NHHA 1GXDC 2LY7A 4RGTA 5IODA 1I4GA 2F0HA 1S5DD 5TSSA 1VF7A 1S5ED 1QNUA 2A5HA 2KEDA 2EY1A 1I4RA 2NTTA 1WTQA 2L12A 3CRLC 3BG3A 3HKZB 1AZPA 2RSOA 2VB2X 1MGSA 1O80A 3T53B 4DAYA 4HAEA 3PIP3 1UUPA 1HHVA 3NSWA 3SK4A 2MGSA 1WTPA 1OO9B 3J7AV 1VMCA 3ND8A 3J80L 1F9RA 1J9OA 1JC7A 1Q90A 3T16A 2A68C 4KY5A 2ENBA 3NPPA 3QIAA 2IX1A 4MHEA 4F87A 4ZLTF 1V43A 2A6HC 5EJWA 4IQZA 4DXGA 3DWAA 5EBDA 3I91A 1EY9A 2FFKB 4H7BA 1L0YB 3URYA 3MXNA 3ERQA 2BDNA 2HCCA 3S14B 1TS2A 2YYZA 3E5SA 1TKWB 4Q5VA 4Z9CB 1QILA 2KEEA 5CYUA 4L63B 4S3SA 4ULLA 3A54A 1XXGA 3C1FA 1I6HB 3V05A 2JEBI 4NP5A 4XT1B 1SNMA 1CK1A 3I72A 1VF5C 1SFOB 2F0DA 1FR3A 3GTOB 3TSSA 2B39A 2E2JB 1PTOH 2B2UC 2DN8A 2IW3A 1GUOA 4A3FB 3I4NB 1PRTD 5C3EB 4A3JB 1XYIA 4XTCS 2LFNA 1D5ZC 2F0PA 4KN7C 5JOBA 2PMZB 1V1PA 3FKIB 3H94A 1ET9A 4A93B 5JPNC 2DNCA 3S17B 3SEBA 2NWGA 2DNEA 1IYVA 3H0GB 4CBVA 1H9KA 3GD7A 1UEAB 3S1NB 5JPMC 4MN3A 4F88A 3RD4A 1SSOA 3MHBA 4DNTB 3DMUA 1B9NA 5EPLA 3SR1A 3RZOB 3Q23A 3S1MB 1HTPA 4HMIA 2EPBA 5T1GA 1VCIA 2EYJA 1SE4A 2NBFA 5CMDA 1STNA 4K6LA 1SYFA 2I07B 2K33A 3TZDA 2EXZA 3GP7A 1VMPA 3K5OA 1WTXA 3J7AF 2NVYB 1UAPA 5KNBA 1YNNC 2A73B 3BS1A 4RKBA 2M2LA 1Q1BA 3SK5A 5HURA 4I65A 1H9RA 1PTOC 3S2HB 1R4QB 5CBAE 3H3VC 5EGTA 2C9OA 2BA0A 1NUCA 1C8CA 3S2DB 3K6OA 1TY0A 3R3OA 2MJ8A 1S5FD 1CM9A 2Q8IB 2RA4A 1LTAD 2VNUD 3BVZA 4U68A 2IX3A 5ELCA 2Z4HA 1K8OA 1GUNA 1MD2D 3JAML 2LKVA 3DM1A 2J0TD 4A3EB 2FMMA 1TU2B 4RGOS 4DF7A 1I4PA 2B2UA 3MTSA 2F0TA 1TWFB 1OXVA 3FEWX 2Q8TA 2NZ1D 5EKIA 4NMZA 1Y8PB 3TP8A 2XNAC 5I6WA 1XWEA 3PUVA 2PPBC 5E3FA 1A3TA 2C5CA 1PYWD 4ZK9B 3Q22A 1EEID 4MIUA 1SNCA 1I4XA 2L1BA 3LWUA 4G4KA 1YNND 3NTIA 1WTWA 1TQOA 4HSVA 3PV0A 1WD0A 5FKAC 5CGKA 3OMGA 2RVLA 3DUZA 1SMYC 3M4YA 4X3KA 2RSNA 2SDFA 1YNJD 2CQAA 1JWSD 2B2VC 2RDHA 5FO7B 4DK1A 1JR0D 3OIPA 2ICEC 3V2TA 4C3IB 2JYOA 3K0YA 4PQXA 2J4XA 3QOLA 2QILA 3HOZB 5D65A 4DN4M 2KQ3A 1C4QA 5IIFA 3N52A 2F0SA 1FNWA 4QUCA 4RGNA 3RZDB 2R7ZB 4QB4A 1D6EC 3X3MA 2EYMA 4X3SA 4FXKC 1TS4A 1EEFD 1SYEA 1EWHA 3KBXA 1HFGA 2R6GA 3L7ZC 4CGYB 2O5JC 4L8JA 2AWOA 4OIKA 3G7LA 1U4MA 4PMCA 5CBEE 1OXXK 1SNQA 1NAPA 3A8IE 3E6ZX 5J22A 3S1QB 4ZAIA 3NBHA 1RF2D 2E75C 4K8JA 1LACA 1F9PA 3I8ZA 1SYDA 4CKCA 1WD1A 4UDUC 1Q12A 1DOLA 1GJXA 3PO3B 2RDFA 3LX0A 4KHZA 4QIWB 4IUUA 1A2UA 2A69C 2YU9B 4ZYSA 5D14A 3PO2B 1SXTA 4OGQC 1Y69U 1GUWA 3I4MB 2L55A 5G3LF 2B8FA 1DM0B 2WB1B 2F0UA 1JWMD 5C4JB 3J81E 4X3UA 1T5EA 2QKIC 5C5MA 1K8MA 3VR3A 2K6AA 3A7LA 5M3MB 1QG7A 3VYUA 5I9OA 1VDZA 4CJ2C 2KA7A 4O1NA 1SJHD 1B50A 1CZWA 2VB3X 4J8QA 4F7XA 4N9PA 1A2TA 1CQVA 3I73A 3VYTA 2ZXPA 2O2LD 5JJZA 1JB3A 2WACA 1IW7D 4KD4A 2PO4A 1D1KA 2RDGA 1D5XC 1D1IA 1M8AA 1F2LA 2NVXB 3OMCA 5I6YA 1NSNS 4JK1C 4X3TA 1SYBA 1F77A 4L6TB 4KY6A 4KD3A 1EU3A 1EOTA 1U4RA 3I70A 2E2IB 1EQTA 4RFBA 4KN4C 2AWNA 4KV6A 2K04A 5C3XA 3VYSA 2KHSA 1BXTA 2JP1A 4QF4A 1E2VA 2EOTA 2A6HD 4B9WA 1QNKA 5M5WB 2F0KA 3C46A 1G91A 1ET6A 4TKOB 3WDNA 4G7ZC 1LTBD 3IKJA 4ZQ3A 3HRZC 2QDBA 3DWQA 1IYUA 2SEBD 2K5DA 1M4VA 1EQVA 1S5BD 2L11A 4KKUA 1JOOA 1STAA 5ELEA 4RHRA 3BDLA 1GHKA 3D6WA 5KNDA 5ELFA 1NCVA 3W2DA 1H9SA 3QO2A 2B63B 4G7OC 2QEJC 1O7YA 2EJMA 5M5YB 2B2TC 1GUSA 4TQUS 3T51B 3KLRA 4XDXA 4C2MB 1H9MA 4EQOA 1B2TA 3PUXA 5ELDA 2B8GA 4ZRZA 1PRTF 4KJNA 3X3NA 1QWYA 1Z7TA 1BO0A 1E2WA 3HEJA 4BBSB 2FHTA 4RGMA 3GTLB 4QCLA 3MAQA 4V0BA 5ELBA 1T5XD 2FMCA 3I4LA 5EPKA 1I4HA 2B2WC 1Q8IA 4IFDJ 2IPKD 4RCNA 5C0XJ 3AU7A 1NR2A 4IUVA 3AMUA 1SMYD 3NQTA 5K5PA 3OWFA 2M00A 1YNJC 1TWAB 5A2QL 4DAPA 1RODA 5BN3A 4ZUIA 5D3DA 3SK8A 1RKNA 2OEOA 4XQNA 4C3HB 4ME5A 2A6ED 2G9DA 1ESRA 5G3LD 5F2DA 3Q24A 2CW0C 4G57A 4WORA 1KLUD 5FO8B 1PLFA 3HOVB 1NR4A 3IL8A 1L0XB 2KECA 1TT2A 1EYCA 2OF1A 5LL6S 3GQBA 2H4OA 2D2CC 2PQEA 1GOZA 1CTMA 2Z1CA 5M5XB 1OXSC 3U9OA 4FYDA 5C0XI 1PDQA 2EE1A 1LT6D 1EWCA 4OO1G 3GTJB 4BS9A 3EQLC 3K5NA 1LV9A 3LNNA 4OO1H 1JICA 3NP8A 5CORA 3H91A 2NB0A 2K01A 1RTOA 3NWTA 1X3QA 1OXUA 4IUNA 4FNFA 4RAUC 1QB5D 1V1PB 1A15A 4KJOA 2A6EC 1BCPC 4LJZC 4R9WA 5EBCA 1Y1VB 4ODGA 1CHQD 1DOMA 2WV6D 2KVMA 3I3CA 1HPCA 1ENFA 1JOKA 2B2TA 3H6MA 4P2CB 2R92B 1E0BA 4EQNA 5I4DA 4BA2I 4R8NA 3J80E 4EVOA 5KYLA 1LT3D 4ID6A 3A55A 4A3DB 1BQQT 5C4XB 1IL8A 2CW0D 1GUTA 1ML0D 2O4XA 1R4PB 2A74C 4CKBA 1QE6A 5D3IB 4IZ8A 4M1UB 2E74C 1LTSD 1O7ZA 2EYFA 2XWJB 4BBRB 4KMUC 3HOYB 1LABA 3ONAB 1EY5A 3K5MA 4HEDA 3D8GA 4M8AA 4J6HA 4NW2A 1CT1D 2OT2A 2KCNA 1B44D 4IFDG 2XWBB 1A6XA 2KJXA 3Q0AA 1QCBD 5KRUA 1G2TA 1KNEA 3D4DA 1IKMA 2IT1A 4IFDH 3GTPB 5K36G 4BY7B 3BVGA 1CQFA 2FJ2A 2F0OA 4I7ZC 3MXUA 1RTNA 2XIWA 4K14A 3BDCA 1G6ZA 1EFID 1F9QA 4HMJA 1B1ZA 5IGFA 1ILPA 2BDOA 4YIJA 4FXDA 4A3BB 3F2UA 5FOBB 5EKLA 4K2KA 1DJRD 3Q6SA 5JAVA 3T56B 2Q8RE 3IFTA 1KABA 1QOHA 1B4OA 3J7YW 4DXFA 4G7HC 3FVQA 5DM63 4KKTA 1U4LA 5C4HA 3OW7A 1LTRD 1MSGA 1B3AA 5CV4A 2KOLA 3R93A 3IAYA 2F4IA 1FNUA 4B9XA 1PZID 3BVMA 2RQXA 3DHQA 3EJIA 2X6LA 1HXYD 3TP6A 1K83B 1HTLD 2DY8A 3GV3A 4RCOA 4FF3A 2Z8LA 1PTOB 3NXWA 1DXMA 1ZEQX 2B2YC 1BDOA 1JE4A 5C5LA 3BYYB 1A3UA 2SNSA 5IT9E 1JWUD 3WOEA 2Y0SB 4IUTA 3M7NA 3S1RB 1LT4D 3V96A 1CA6A 4H44C 3MFGA 4OL7A 2JA8B 4OIJA 5HGTA 1SBBB 4K5XA 1D5MC 3U9SA 1AFPA 2NVQB 4FF4A 4IUPA 1B53A 3S16B 4XYQA 4N9TA 4WRDA 5CC4A 3NK9A 1SJED 1STYA 3NTHA 2ZXOA 1I4QA 1ENAA 1PZKD 4PNYA 2J7ZA 3OOCA 4FP5D 1SE2A 3R2TA 2F0LA 3SXHA 2K03A 5KGUA 2KCCA 3OHXC 4QUFA 3GV6A 4XXEA 3PUZA 2JE6I 4FXGC 2E2DC 4O42A 2H1EA 2K7VA 2TSSA 1KAAA 3OIQA 3GTQB 2JA5B 1STHA 2E76C 3ND9A 1BF4A 1KDCA 1RJTA 2NN6I 2TMPA 1STBA 1F2ZA 2BE5D 3PUWA 5JEAG 2O5IC 2LMCB 2ZXRA 3EA6A 1G2SA 5E1FA 4XQQA 5KEEA 3A56A 5COYA 2A68D 1LTID 2NVTB 4K2LA 4XYOA 1GUGA 1TWHB 3MXGA 4K5WA 3A7AB 1EU4A 1LLRD 1MSHA 4C3JG 1BBXC 1BCPD 1X3PA 4UAIA 3HP3A 2PNRC 4C1NK 3UI2A 3G6JB 1HA5A 3HOUB 2EY6A 1PXUA 1CA5A 1TIID 4KY7A 1STEA 1KDBA 3L3OC 2QCPX 3QWNA 1EL0A 2WP8J 1TS5A 2D9UA 5JEAJ 4FVMA 1PZJD 1WCMB 4J1MA 2EJFC 4A3MB 1JQYD 1BUVT 1OXTA 3BDOA 1WVLA 3FPUB 4F8MA 3S9WA 5FO9B 1F2YA 3ZYYX 5EPJA 3TN2A 2MUYA 3DEOA 1F2MA 3SVMA 2E2HB 2NYZD 2HUGA 3P7JA 2F0QA 1Z47A 1STGA 2RKSA 3SHLA 3N6RA 4RKLA 4HN7A 3S15B 2PW7A 5EQ0A 1HFNA 2ZT9C 2AQ1B 3HG9A 3WOFA 2SOBA 1I3QB 2F3VA 3C1EA 3D4WA 2EZVA 3H09A 2WKDA 3KLSX 5DAUA 1A3VA 4Y7NB 3CU7A 3K59A 2VXWA 5KNCA 5DM73 3NE5B 2I46A 5IGDA 1AEXA 2SNMA 3DWPA 3OSOA 4TRDA 2CHBD 1Y8OB 2BA1A 2PCFB 1W6JA 4H0LC 4EGVA 3HOWB 1S4ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XX8 A;  2MP1 A;  1NR2 A;  4IUV A;  5E4X A;  4IUP A;  1CA5 A;  1VMP A;  1ZXT A;  2MPM A;  4XT3 B;  1E0B A;  2K04 A;  1WTX A;  4IUQ A;  2HCI A;  1B53 A;  3Q6S A;  2RVL A;  1GUW A;  2K1B A;  1PFB A;  4X3K A;  2JP1 A;  2R3Z A;  2DY7 A;  2HDL A;  2RSN A;  2B2V A;  1WTR A;  2K05 A;  2L4N A;  2Q8R E;  4RWS C;  4HCS A;  1EL0 A;  2SDF A;  1B4O A;  1HRJ A;  4CJ1 B;  5AFW A;  2EOT A;  1SDF A;  2M2L A;  1ROD A;  2B2V C;  2D9U A;  5DNF A;  2B2U C;  1QNK A;  1IL8 A;  1EIG A;  1U4L A;  2X6G A;  3MWY W;  1G91 A;  1ML0 D;  2CVR A;  2JYO A;  1BNZ A;  1U4P A;  1MSG A;  1B3A A;  4LMQ D;  4ZKB B;  5CBA E;  2J7Z A;  2KOL A;  1XYI A;  2KED A;  1WVL A;  1QE6 A;  1WTQ A;  1ESR A;  1MI2 A;  1J8I A;  1X32 A;  3R93 A;  4X3U A;  5D65 A;  2L12 A;  3FPU B;  2L9H A;  4DN4 M;  1IKL A;  2N88 A;  5T1I A;  2K03 A;  5EPJ A;  4R8I A;  1AZP A;  3TN2 A;  3N52 A;  4CJ0 B;  4QUC A;  2RSO A;  1MGS A;  1C8C A;  2L11 A;  2K28 A;  4QUF A;  3GV6 A;  1O80 A;  2MJ8 A;  3DEO A;  1TVX A;  1EIH A;  1CM9 A;  1PLF A;  2B2W A;  1NR4 A;  1O7Z A;  3IL8 A;  1WTO A;  4HAE A;  1QG7 A;  3SVM A;  3IFD A;  2NYZ D;  4IUR A;  2KEC A;  2RA4 A;  3D6W A;  4X3S A;  4O42 A;  1HHV A;  1NCV A;  2HUG A;  4CJ2 C;  2H1E A;  4U68 A;  2NWG A;  2X6L A;  3P7J A;  2IL8 A;  2KUM A;  3ONA B;  1B50 A;  2MGS A;  1WTP A;  3QO2 A;  1VMC A;  3KBX A;  1O7Y A;  1HFG A;  4HED A;  2N55 A;  1F9R A;  1PDQ A;  1J9O A;  2B2T C;  4NW2 A;  2DY8 A;  2EE1 A;  3DM1 A;  1AP0 A;  1BF4 A;  1RJT A;  2FMM A;  4MN3 A;  2B2U A;  3GV3 A;  3I90 A;  3MTS A;  2B2Y A;  4XDX A;  5EQ0 A;  4ZKC B;  4MHE A;  1HFN A;  1SSO A;  4ZLT F;  1LV9 A;  1ICW A;  2FIN B;  4OIK A;  5JJZ A;  1G2T A;  1HA6 A;  2Q8T A;  1B2T A;  1SAP A;  1KNE A;  1U4M A;  2B2Y C;  1Q3L A;  1JE4 A;  2NZ1 D;  3G7L A;  5EJW A;  5EKI A;  5CBE E;  1IKM A;  1DZ1 A;  1G2S A;  1NAP A;  1PFN A;  3FDT A;  4RA8 A;  5COY A;  4ZAI A;  3I91 A;  1WTV A;  1ILQ A;  5EPL A;  1JIC A;  2FFK B;  5COR A;  3H91 A;  1M8A A;  3KUP A;  3LWE A;  2FJ2 A;  1F2L A;  4IUT A;  1RHP A;  2K01 A;  1DON A;  1DOK A;  1RTN A;  1RTO A;  2EPB A;  2XIW A;  2BDN A;  1X3Q A;  1KNA A;  2HCC A;  4X3T A;  4ZK9 B;  5T1G A;  1MSH A;  1CA6 A;  2VXW A;  4RAU C;  1F9P A;  1G6Z A;  1BO0 A;  3I8Z A;  1A15 A;  1F9Q A;  4OIJ A;  1PFM A;  1WD1 A;  1BBX C;  1HUN A;  1DOL A;  2L1B A;  2FHT A;  1HUM A;  2KEE A;  1X3P A;  4UAI A;  5E4W C;  3HP3 A;  1ILP A;  1EOT A;  2X69 A;  4IUU A;  4R9W A;  5EPK A;  5CMD A;  2B2W C;  1F9S A;  3F2U A;  1WTW A;  1DOM A;  1U4R A;  3UI2 A;  2HDM A;  1AZQ A;  2KVM A;  3DEP A;  3I3C A;  4HSV A;  4XT1 B;  1EQT A;  1S4Z A;  3TZD A;  2B2T A;  5D14 A;  1WD0 A; 
#chains in the Genus database with same CATH topology
 2MP1 A;  2VW9 A;  1ZXT A;  4Y52 H;  2F0M A;  2HCI A;  2WIN B;  4DR4 Q;  1CZG A;  2Q2I A;  1WTR A;  2JA7 H;  2K05 A;  5LHY 1;  4QQB X;  5C4J H;  1PA6 A;  4HCE A;  4L5S A;  2IJ0 A;  1W2B A;  4LAA A;  3J81 L;  4DV3 Q;  1BNZ A;  1EY6 A;  1U4P A;  1EUJ A;  5IGG A;  1VQC A;  2UUC Q;  5IGB A;  1X32 A;  3TDQ A;  1CSP A;  1E22 A;  4KTA A;  2UXC Q;  5EKK A;  2NN6 H;  3KDF A;  1BCP B;  2K28 A;  2WII B;  1SYG A;  3W3A A;  2B2W A;  4LK1 C;  1I6V C;  3CCS A;  3A8J E;  1XMQ L;  3PF4 A;  4IUR A;  2Q2H A;  4HIO A;  1BR9 A;  2NN6 G;  3VR4 A;  3CKI B;  3KF8 A;  1PH5 A;  2R92 H;  3CCV A;  2F0G A;  4X64 Q;  3CQZ B;  1L0W A;  3HKS A;  4PZ7 A;  3R2I A;  1QJO A;  4HTH A;  1AP0 A;  4AYB B;  4C3I G;  2WB1 G;  1XNQ Q;  4K5V A;  1G29 1;  1CI3 M;  2MFI A;  4LF4 L;  4A3G B;  4NDX A;  1DGS A;  2B2Y A;  4PG3 A;  4BA1 I;  2B3G A;  3GTK B;  1SR3 A;  5FLM H;  3SGI A;  4C3I H;  1V1O A;  1O78 A;  4A3K B;  1K0S A;  4A76 A;  3C2P A;  1QVC A;  1K3R A;  1FYC A;  1UE7 A;  3JAM i;  1TY2 A;  1PH4 A;  3TS2 A;  2JA7 B;  1SNP A;  1DOK A;  3MVV A;  1N36 Q;  2UUB L;  1QZH A;  1K3B C;  3IRB A;  2XTI A;  4LF8 L;  1NTG A;  4XQJ A;  1MBY A;  3I56 A;  2F0V A;  1PRT C;  4DAM A;  4JPB W;  4LF9 L;  1CKO A;  5C3W A;  3J81 i;  2P5Z X;  4DV5 L;  1U5K A;  3NWS A;  4MZ9 A;  3GTJ H;  3NTK A;  5A2Q E;  3CCQ A;  2RF4 A;  1AZQ A;  2Z4I A;  1HCZ A;  5FJ8 H;  1DD2 A;  5M5X H;  2F0W A;  4DR1 Q;  1H9J A;  2K5Q A;  2K1B A;  1V8Q A;  4RWS C;  2AQ2 B;  3M4O B;  1SDF A;  2HIX A;  2EYL A;  2PZT A;  4B3S Q;  1V9P A;  3K58 A;  2MHV A;  3SE0 A;  1NJI C;  2X6G A;  2LS0 1;  5HY6 A;  3TP7 A;  3A5Z B;  4LMQ D;  4C3H G;  1PMR A;  4KHV A;  3AB9 A;  4QMG A;  4UP7 A;  2OTL A;  2F0E A;  2XRQ D;  2BCO A;  1FNV A;  4DV2 L;  4BY1 G;  1XMO L;  2E5L L;  1HNW Q;  4XIG S;  4C1N I;  2Z6K A;  4LFA Q;  4DNR B;  1NBW A;  1PH2 A;  1LT5 D;  3P75 A;  3GTK H;  1TVX A;  3FRP B;  3DXJ C;  3MC0 B;  1WTO A;  3PO2 G;  1SLJ A;  1LTG D;  3E3X A;  3PIP A;  5ISR A;  1TR5 A;  2NUC A;  3S1M H;  4POF A;  3EBE A;  3L9A X;  3HOX B;  1HR0 Q;  4BXX G;  5CR3 A;  1VQL A;  5CV6 A;  4JI0 Q;  2H5X A;  1S72 A;  1FGB D;  2WAQ B;  4DUZ Q;  3PO2 H;  3KOJ A;  1ONL A;  5GAE C;  4A3E G;  4WJ4 A;  2N78 A;  4EX5 A;  3VR6 A;  2JEA I;  4BXX H;  4HJ5 A;  4ZKC B;  5CV7 A;  3PIO 3;  2YV5 A;  3I4M G;  2Q2U A;  4R4T A;  1HA6 A;  3A8K E;  1PTO D;  1SAP A;  4E6I A;  5IT9 L;  4YY3 Q;  1PFN A;  1EZ6 A;  3M3Y B;  2CH4 W;  3QB3 A;  4CKE A;  3AQQ A;  3FMC A;  3D4R A;  4JI4 L;  1B9M A;  1EY7 A;  3NUC A;  4LUO A;  1G51 A;  1NNX A;  1KNA A;  3QG1 A;  1K9M C;  2OWO A;  4GKK L;  1SMX A;  1Y1V H;  3MFY A;  4A4I A;  1DCZ A;  2I0Q A;  1AH9 A;  5C6A A;  5CV5 A;  3RR5 A;  5E4W C;  4DR7 L;  4DV5 Q;  3ICE A;  2A69 D;  3UDX A;  4RHS A;  5DLQ E;  1F9S A;  5IP7 H;  1DYQ A;  4NKL A;  3RUZ A;  2PW5 A;  2GVB A;  2HHH L;  5C44 B;  4LF7 Q;  3MA2 B;  1CHP D;  4IAL A;  2MPM A;  5FK9 C;  1TWC H;  4IN3 A;  1PFB A;  4IFD I;  3VR2 A;  3G48 A;  2B2V A;  1WCM H;  4DAV A;  3R8B A;  1IBM Q;  1XTD A;  4TSS A;  4PMW A;  1HRJ A;  3KBG A;  4DGZ A;  5AFW A;  3RLN A;  1ESF A;  1XTC D;  3C3L A;  3MWY W;  2CVR A;  2RHQ B;  4R1J A;  1MKH A;  4LUZ A;  3VYR A;  5KYI A;  1J8I A;  1SNO A;  1KLG D;  5JVH 3;  2L9H A;  4CDE C;  4JBK A;  4NPS A;  1IKL A;  2N88 A;  2PZW A;  3M4P A;  1AE2 A;  1UWV A;  3TZU A;  4R8I A;  1YBY A;  4ZUJ A;  5IOC A;  5GQO A;  1LTT D;  2V4D A;  3HOY H;  2WKC A;  2D62 A;  4UPA A;  4Q0F A;  3HZX A;  1Q1E A;  3IFD A;  2EY5 A;  2PI2 E;  2VQE Q;  5KIX A;  4BBS G;  3HOY G;  3MXP A;  3OWE B;  2JA6 G;  2QF7 A;  2VY3 A;  3HS0 C;  4JYA L;  2F3I A;  1PTO F;  4DR4 L;  3KJP A;  4K6D A;  4DU9 A;  1VQH A;  3RLF A;  1TS3 A;  1A8V A;  2F3W A;  3BZD B;  1W3S A;  1NY4 A;  4QGU A;  5GAG C;  4V19 0;  2XRS D;  2EVB A;  4BWG B;  1R9T B;  4DK3 C;  4HJ8 A;  4RH6 A;  2BH8 A;  1HNZ Q;  4Y7N H;  2M9V A;  1ILQ A;  1GHJ A;  2K5V A;  1XNR L;  1EY8 A;  3HOX H;  2RBM A;  1W6K A;  2EJG C;  3LWE A;  3NBI A;  4AYB G;  5C0X G;  3HOV G;  1T9H A;  3PUY A;  4C3J B;  1LTL A;  5K36 H;  2EYO A;  4L5R C;  5M3F B;  4P73 A;  2R93 B;  2AQ3 B;  2XVS A;  1RL2 A;  1HUM A;  4WJW A;  3TS0 A;  3HOW H;  2B63 G;  2XSC A;  5C0X H;  2AUK A;  2X69 A;  5IYD H;  1S5C D;  1ZKO A;  4A3B G;  5J39 A;  1ASY A;  3GTG B;  4XT3 B;  4CHT B;  3SK6 A;  4IUQ A;  1ENC A;  2K5W A;  4LF5 L;  5IGE A;  5M5Y H;  5IYD G;  2AHO B;  2UU9 Q;  5BN5 A;  2HDL A;  2ES2 A;  4JBW A;  1FD7 D;  3G71 A;  1UNS A;  2DJG C;  5LL6 X;  4U67 3;  3K7A B;  3ITP A;  2EYH A;  3QJY A;  4JOI A;  1BOS A;  1EIG A;  3T1H L;  3J80 c;  4JYA Q;  4A3M G;  1JOR A;  4DV6 Q;  1E2Z A;  2L5T A;  3EFX D;  4HR7 B;  1TXY A;  2OXP A;  4R4Q A;  3TBI B;  4GOP A;  4DV2 Q;  3T4A C;  1C9O A;  5I2X A;  2GA4 B;  1TWG B;  3PMF A;  5T1I A;  4DR3 L;  5BR8 L;  3G4S A;  1EYA A;  3KLS A;  1EIH A;  3HGB A;  1KDA A;  2XN9 C;  5M9O A;  5JJI A;  5JVG 3;  2F0J A;  4X65 Q;  2D5D A;  1JJG A;  1JCK B;  4JI8 Q;  2IL8 A;  4KK7 A;  1Y8N B;  5IGC A;  1JOQ A;  3GTM H;  2N55 A;  1J5E Q;  3D6C A;  1D2B A;  3TP5 A;  2AUJ D;  5IWA Q;  2ID0 A;  2LSS A;  1HQM C;  3I90 A;  1SYC A;  2R92 G;  2JSO A;  3ERO A;  1M90 C;  2FIN B;  1SND A;  2Z0S A;  2IX0 A;  1Q3L A;  4BY1 B;  1PRT B;  3FDT A;  1II3 A;  4RA8 A;  3GTO H;  1AN8 A;  1TWC B;  2NTS A;  4JI7 Q;  2UUA L;  2K14 A;  1EFW A;  3VA5 A;  3KUP A;  3T13 A;  1RHP A;  4DUY Q;  4A3F G;  1DON A;  5CV8 A;  1PYB A;  3KK7 A;  3E0J A;  1KQS A;  4DUY L;  4JBJ A;  4DKA C;  1CKN B;  1Y1W B;  4LWC A;  2L0C A;  3H15 A;  3CHB D;  1D7Q A;  1HUN A;  1PH8 A;  4JI7 L;  1YHB A;  1HQR D;  3FPP A;  1KAW A;  4O0A A;  1AW7 A;  2WAQ G;  4BBR H;  3CRK C;  2JA6 B;  2F1M A;  4FF2 A;  2BE5 C;  2EDG A;  2HDM A;  2K32 A;  4OWW B;  4A93 G;  1VQ4 A;  1EYD A;  4HSP A;  3EVQ A;  1TWG H;  1XX8 A;  2IWH A;  1RCV D;  1SN8 A;  2F0F A;  3FKI H;  4A3J G;  5NUC A;  1O7L A;  1IHZ A;  3BYT B;  2BOS A;  4BBR G;  1U9R A;  2R3Z A;  2PNH A;  1BCP F;  1ZYR D;  2DY7 A;  4WFN 3;  3J7Z C;  2L4N A;  1KTK A;  3F1Z A;  4HCS A;  1BKB A;  1EY4 A;  4ABN A;  4A3I B;  4JW0 A;  4H13 C;  4CJ1 B;  4FF1 A;  1QUQ A;  4JI0 L;  5DNF A;  1IW7 C;  1N34 L;  1EZ8 A;  2ICI A;  3OPO A;  3SDZ A;  5A35 A;  3QOJ A;  1L1O C;  4GNX B;  2GN5 A;  3JAM E;  4DR6 Q;  4EQP A;  3GTM B;  1RD9 D;  4ZKB B;  1N9W A;  2NVT H;  2PYK A;  5IYC G;  5JJL A;  1CFM A;  1MI2 A;  5DEH A;  1YIJ A;  2PZU A;  2EYP A;  3A5U A;  4GZY C;  3M7G A;  2VS1 A;  2VUM B;  4DR3 Q;  4CJ0 B;  2R61 A;  4DV6 L;  4DV3 L;  1H9S B;  4BY7 G;  5FLX E;  1EY0 A;  4BY1 H;  4WJ3 M;  5LMU Q;  3FP9 A;  2K5N A;  3P20 A;  1VQM A;  3VA7 A;  3TEH B;  2N49 A;  4FO2 A;  1G8Z D;  2Y0S E;  4KKS A;  2KUM A;  3K5L A;  4LFA L;  2JXM B;  2G9H D;  5CV9 A;  3MEH A;  4C56 C;  5I9P A;  3NQI A;  5IYB G;  3VR5 A;  3KF6 A;  4PV1 C;  4OO1 I;  2JJQ A;  3D31 A;  1NE3 A;  4KI0 A;  4A3K H;  2FXQ A;  2F0I A;  3CXC A;  3BU2 A;  3RMH A;  4B08 A;  1C48 A;  5L37 A;  1LO5 D;  4P72 A;  1ICW A;  4K8I A;  4A3E H;  4A3K G;  3TME A;  1DZ1 A;  4PMB A;  2NZH A;  4X62 L;  1Q82 C;  1ZYR C;  3O13 A;  1WTV A;  1IZ6 A;  3MZ5 A;  5FLX L;  1WI5 A;  4A3D G;  4OHJ A;  2BH2 A;  3BJU A;  5JEA H;  1MHW C;  4PZ8 A;  2F03 A;  3P1H A;  5C4Z A;  4LF8 Q;  3I4N G;  4DR5 L;  3CCJ A;  1QZG A;  1LM0 A;  4GLV B;  2K75 A;  2EY2 A;  1B3Q A;  3S1Q H;  1PFM A;  2K50 A;  3K57 A;  3CF5 A;  4DA2 A;  3D3R A;  3I4N H;  2F0N A;  2HQE A;  3S16 H;  5I2Y A;  1RDP D;  4CDD C;  3M85 A;  3DEP A;  5BN4 A;  3J81 c;  4DK0 A;  1Z6H A;  5E4X A;  5J1Z A;  1K83 H;  4DFA A;  1SEB D;  4POG A;  1SE3 A;  3OTO L;  3WWV A;  4UHV A;  4ILW A;  4HJ7 A;  4ALP A;  1GO3 E;  2A8V A;  1I50 B;  2DJF C;  1N32 Q;  3GO5 A;  3JAM c;  3NHH A;  2K4K A;  1GXD C;  2LY7 A;  4RGT A;  5IOD A;  1I4G A;  1KRS A;  1S5D D;  2F0H A;  2NZO A;  1K8G A;  1A63 A;  3CC2 A;  5TSS A;  1VF7 A;  1S5E D;  5IY0 A;  1WCM G;  1QNU A;  2RCN A;  2A5H A;  3CCU A;  3CPF A;  2KED A;  2EY1 A;  1I4R A;  2NTT A;  1WTQ A;  2R93 G;  1Y1W G;  3GDE A;  3TRE A;  2L12 A;  4X64 L;  2OQK A;  3CRL C;  3BG3 A;  3HKZ B;  1HR0 W;  5EAY A;  4MTN A;  1AZP A;  4NXM L;  2RSO A;  2VB2 X;  1MGS A;  2G5D A;  4ME3 A;  1O80 A;  3T53 B;  4DAY A;  1HJP A;  4HAE A;  3PIP 3;  1UUP A;  1HHV A;  1YNX A;  3NSW A;  3SK4 A;  1VQE A;  2ASB A;  1PV4 A;  2MGS A;  1WTP A;  1OO9 B;  1YJ9 A;  3J7A V;  1EQQ A;  1VMC A;  2Q2T A;  3ND8 A;  1VS0 A;  3J80 L;  1F9R A;  1E1O A;  1J9O A;  1JC7 A;  1Q90 A;  4MNO A;  5LMN W;  3M3Y H;  3T16 A;  3I2Z A;  2A68 C;  4KY5 A;  1N8R C;  2ZM6 Q;  2ENB A;  3NPP A;  3QIA A;  3TQY A;  2IX1 A;  4MHE A;  2JA6 H;  4B3T L;  4F87 A;  4ZLT F;  4FDB A;  4KHP L;  1V43 A;  2A6H C;  3KF6 B;  2YTY A;  5EJW A;  4IQZ A;  2R7D A;  4DXG A;  1VQ5 A;  3DWA A;  1K73 C;  5EBD A;  3I91 A;  3JC6 6;  1EY9 A;  2FFK B;  4H7B A;  4RG1 A;  1L0Y B;  3URY A;  3MXN A;  3ERQ A;  4DR5 Q;  3GTP H;  2BDN A;  2HCC A;  3S14 B;  1TS2 A;  2YYZ A;  4YY3 L;  1Q7Y C;  3E5S A;  1TKW B;  4Q5V A;  4Z9C B;  2HT1 A;  1QIL A;  2KEE A;  3STB C;  5CYU A;  4L63 B;  4S3S A;  4ULL A;  3A54 A;  1I50 H;  1XXG A;  3K0X A;  2NVX H;  3C1F A;  1I6H B;  3V05 A;  2JEB I;  4NP5 A;  2A1A A;  4XT1 B;  1X3E A;  3PO3 H;  1SNM A;  3L0O A;  3HOW G;  1CK1 A;  3I72 A;  1VF5 C;  1SFO B;  2F0D A;  1FR3 A;  3GTO B;  1XNR Q;  3ERS X;  3TSS A;  1Q8K A;  2B39 A;  4DPG A;  2E2J B;  2E2I H;  1PTO H;  3NEL A;  4JVZ A;  2B2U C;  2DN8 A;  3B6Y A;  3HFZ B;  4KHP Q;  2IW3 A;  4YHH Q;  2Y0S G;  1GUO A;  4A3F B;  2E8G A;  3I4N B;  1PRT D;  2RHS B;  3EN2 A;  5C3E B;  4A3J B;  1XYI A;  2Z9H A;  4XTC S;  2JA8 G;  4NB3 A;  2LFN A;  2K52 A;  1D5Z C;  2F0P A;  2V1C C;  1SRU A;  2VQF L;  1WOC A;  2KCT A;  4KN7 C;  5JOB A;  2PMZ B;  1VQI A;  1FL0 A;  2PQA A;  1V1P A;  3FKI B;  3H94 A;  3UE1 A;  1ET9 A;  4GOP B;  2JA8 H;  4A93 B;  5JPN C;  2DNC A;  3S17 B;  3SEB A;  4APV A;  3CQZ H;  2NWG A;  2DNE A;  1KIX A;  1IYV A;  4LUV A;  4JCV E;  1SRO A;  4EQ5 A;  4DV0 Q;  3H0G B;  4A3I G;  4CBV A;  3G6E A;  1LYL A;  1H9K A;  2DGY A;  3STB D;  4OX9 Q;  3GD7 A;  1EYG A;  1UEA B;  2KBN A;  3S1N B;  4J15 A;  5JPM C;  4MN3 A;  1X6O A;  4F88 A;  3RD4 A;  1SSO A;  1YZ6 A;  4B3R Q;  2LXK A;  4K0K Q;  3MHB A;  4DNT B;  1L2F A;  2WFW A;  3DMU A;  1YJN A;  2QGQ A;  1B9N A;  5EPL A;  3SR1 A;  1V1Q A;  3TRZ A;  1EQR A;  2EIF A;  4JG2 A;  3RZO B;  4JI6 Q;  2Z6K C;  3Q23 A;  3S1M B;  1HTP A;  1E7Z A;  4HMI A;  3AEV A;  2EPB A;  3KYH C;  5AJ3 Q;  5T1G A;  1VCI A;  2EYJ A;  1SE4 A;  2NBF A;  2KEN A;  5CMD A;  1STN A;  4K6L A;  1UE1 A;  1SYF A;  2I07 B;  4GKK Q;  2K33 A;  3TZD A;  4IO9 A;  1HNX Q;  2EXZ A;  3GP7 A;  1VMP A;  3K5O A;  1WTX A;  3F2D A;  3J7A F;  2NVY B;  1UAP A;  5KNB A;  1YNN C;  3KDF B;  3W1G A;  4IPG A;  2A73 B;  4X65 L;  3DLL A;  2VQE L;  3BS1 A;  4RKB A;  2M2L A;  3OW2 A;  1XPO A;  2CCZ A;  1Q1B A;  3E9I A;  4AYB E;  1EIY B;  3SK5 A;  5HUR A;  4B3R L;  4I65 A;  2D0P A;  1H9R A;  1PTO C;  3S2H B;  1R4Q B;  5CBA E;  3H3V C;  2DUD A;  2YU9 H;  5EGT A;  1EIF A;  2C9O A;  4IPC A;  1MJC A;  4DUZ L;  2BA0 A;  3T1Y L;  5C44 H;  4DV0 L;  1XPU A;  1NUC A;  1IYJ B;  1C8C A;  3S2D B;  3K6O A;  1TY0 A;  3R3O A;  1FJG L;  2MJ8 A;  1S5F D;  1CM9 A;  2Q8I B;  1VQ6 A;  1HZC A;  2UXC L;  4LFC L;  1HNW L;  2RA4 A;  2VQF Q;  1LTA D;  2VNU D;  1B8A A;  3BVZ A;  4U68 A;  2IX3 A;  5ELC A;  3HOU H;  1UEB A;  2JK8 A;  2Z4H A;  1K8O A;  1GUN A;  1MD2 D;  1XMO Q;  1PH6 A;  2E5L Q;  3JAM L;  2LKV A;  3DM1 A;  1N32 L;  2J0T D;  3L2P A;  4A3E B;  2FMM A;  1TU2 B;  4PZ6 A;  4RGO S;  4DF7 A;  1I4P A;  2B2U A;  3MTS A;  2F0T A;  4YHH L;  1TWF B;  1OXV A;  2F4V L;  3FEW X;  4QY7 A;  1HH2 P;  2Q8T A;  2NZ1 D;  4JC0 A;  2CFM A;  5EKI A;  4NMZ A;  3HKZ E;  1Y8P B;  1K0R A;  1S3O A;  3TP8 A;  2LXJ A;  2XNA C;  5I6W A;  1XWE A;  3PUV A;  1U0L A;  2PPB C;  5E3F A;  1A3T A;  2C5C A;  3KLW A;  4LF5 Q;  1PYW D;  4X62 Q;  3RNU A;  4ZK9 B;  3Q22 A;  1EEI D;  4MIU A;  1SNC A;  1I4X A;  2L1B A;  2RCF A;  5FLX c;  3E9H A;  3PGZ A;  3LWU A;  4P75 A;  2UUB Q;  2E2H H;  4G4K A;  1YNN D;  3NTI A;  1WTW A;  4JI5 Q;  1TQO A;  1JE5 A;  1Y1V G;  1PH9 A;  1D8L A;  4HSV A;  3PV0 A;  1WD0 A;  2JQO A;  3U4Z A;  5FKA C;  2CWA A;  5CGK A;  2ZTC A;  1I94 Q;  3OMG A;  2RVL A;  3DUZ A;  1SMY C;  3M4Y A;  4X3K A;  5IP7 G;  2RSN A;  3UE0 A;  2JA9 A;  3S2H H;  1PHJ A;  2SDF A;  1YNJ D;  4LF6 Q;  2CWP A;  1YHQ A;  2CQA A;  1JWS D;  2B2V C;  2RDH A;  5FO7 B;  4DK1 A;  2D0O A;  1JR0 D;  3OIP A;  2VUM H;  2ICE C;  1R9T H;  3V2T A;  4C3I B;  2JYO A;  3K0Y A;  4PQX A;  2J4X A;  4R4I A;  2UXD L;  4LFB L;  3QOL A;  2QIL A;  3HOZ B;  3ULP A;  5D65 A;  4LW1 A;  2VUM G;  4DN4 M;  2KQ3 A;  4HJ9 A;  1C4Q A;  4NXM Q;  3T1Y Q;  5IIF A;  3N52 A;  2F0S A;  3GTG H;  1FNW A;  4QUC A;  4RGN A;  4C2M H;  1FJG Q;  3RZD B;  2I5H A;  1WJJ A;  4DV4 L;  2R7Z B;  4QB4 A;  1D6E C;  1WYD A;  3MXN B;  3X3M A;  2E2J H;  2EYM A;  4X3S A;  2YTX A;  4FXK C;  3K81 C;  1TS4 A;  1EEF D;  1SYE A;  1EWH A;  3KBX A;  4YCV A;  1B70 B;  1HFG A;  2R6G A;  4X66 L;  3L7Z C;  4CGY B;  2MNA A;  2O5J C;  1OTC A;  4L8J A;  4LF6 L;  2AWO A;  2ZTD A;  1L1O B;  1EOV A;  4GNX C;  5J3B A;  4OIK A;  3G7L A;  1U4M A;  4PMC A;  5CBE E;  3KJO A;  1OXX K;  1SNQ A;  1NAP A;  3A8I E;  3E6Z X;  3S17 H;  3H0G G;  5J22 A;  5IP9 G;  3AFQ A;  3S1Q B;  4ZAI A;  2NVY H;  3NBH A;  1VQ9 A;  1RF2 D;  2E75 C;  4K8J A;  1A62 A;  1LAC A;  3OTO Q;  4DR7 Q;  3H0G H;  2KHJ A;  1F9P A;  4ZCK A;  3I8Z A;  1SYD A;  4CKC A;  1WD1 A;  4OEL B;  4UDU C;  3NBH B;  1Q12 A;  1DOL A;  1GJX A;  3HOX G;  2VL6 A;  3PO3 B;  2RDF A;  3UDF A;  3LX0 A;  4KHZ A;  4QIW B;  1VQN A;  4IUU A;  1A2U A;  3K80 C;  1ASZ A;  1SFO H;  1VQK A;  4A3C G;  2A69 C;  3CCL A;  2YU9 B;  4IOC A;  4ZYS A;  1Y14 B;  5D14 A;  2UXB L;  4X66 Q;  4B3M L;  3PO2 B;  2ZJQ A;  1SXT A;  2IHF A;  3Q8D A;  1O7I A;  4OGQ C;  1Y69 U;  1GUW A;  3I4M B;  4JI4 Q;  4A3C H;  4JI8 L;  4A3B H;  4IPH A;  2L55 A;  2N3S A;  5G3L F;  2B8F A;  1UE6 A;  1DM0 B;  2WB1 B;  3CC7 A;  4GOP C;  2F0U A;  2JA7 G;  2QEX A;  3H3V H;  1JWM D;  5C4J B;  4JI2 L;  3J81 E;  1RIP A;  3W1B A;  4X3U A;  1T5E A;  2QKI C;  4A3M H;  5C5M A;  4QIW E;  4QJF A;  1K8M A;  3VR3 A;  2K6A A;  1JB7 A;  3A7L A;  3AFP A;  5M3M B;  4LFC Q;  1QG7 A;  1FGU A;  3VYU A;  4B3S L;  5I9O A;  1VDZ A;  1TWH H;  4CJ2 C;  2KA7 A;  4O1N A;  5M5W H;  5IT9 c;  1SJH D;  2HIV A;  1B50 A;  1CZW A;  2VB3 X;  3S1N H;  4J8Q A;  4F7X A;  1A0I A;  4N9P A;  1A2T A;  1E24 A;  1CQV A;  3I73 A;  3VYT A;  2ZXP A;  1KRT A;  4LNQ A;  2O2L D;  3S2D H;  1K8A C;  1I5F A;  5JJZ A;  4HIK A;  1JB3 A;  2WAC A;  1IW7 D;  4KD4 A;  2PO4 A;  1D1K A;  1QUQ B;  2RDG A;  1D5X C;  1D1I A;  1M8A A;  1F2L A;  4DR1 L;  2NVX B;  3OMC A;  4GLA C;  5I6Y A;  1NSN S;  4JK1 C;  4X3T A;  1SYB A;  1F77 A;  2KHI A;  4L6T B;  1HZ9 A;  4KY6 A;  4KD3 A;  1EU3 A;  1EOT A;  1TWF H;  3S1R H;  1P16 A;  1U4R A;  3I70 A;  3I4O A;  4IPD A;  2E2I B;  2UUA Q;  1EQT A;  1PFS A;  4RFB A;  2HQL A;  4KN4 C;  2AWN A;  3K7A H;  2IHE A;  4KV6 A;  2K04 A;  5C3X A;  3VYS A;  2KHS A;  4IJH A;  1BXT A;  1N33 L;  4JI6 L;  2JP1 A;  5FJ8 G;  3ZJY C;  4QF4 A;  2MQH A;  1E2V A;  1QVF A;  2EOT A;  2A6H D;  3FKI G;  2PI2 A;  4B9W A;  4A3J H;  5IWA L;  1QNK A;  5M5W B;  1C0A A;  2F0K A;  1K28 A;  3C46 A;  1G91 A;  1ET6 A;  4YCW A;  4TKO B;  3WDN A;  4G7Z C;  1LTB D;  2K5H A;  3IKJ A;  1YI2 A;  4ZQ3 A;  1TWA H;  3CAM A;  3HRZ C;  2QDB A;  5M3M H;  3FHW A;  3DWQ A;  3RLO A;  5M3F G;  1IYU A;  1Q86 C;  2SEB D;  2K5D A;  1M4V A;  1EQV A;  2UXD Q;  5IYC H;  4DV4 Q;  1S5B D;  1X55 A;  2L11 A;  3BZC A;  4KKU A;  1JOO A;  2R7F A;  1STA A;  5ELE A;  4A3L G;  4RHR A;  3BDL A;  2GVA A;  5BR8 Q;  1GHK A;  2UUC L;  3D6W A;  5KND A;  2ZJP A;  5ELF A;  1NCV A;  3W2D A;  1H9S A;  3QO2 A;  3J80 i;  2B63 B;  4G7O C;  2QEJ C;  4DV7 Q;  1O7Y A;  2EJM A;  2EXD A;  1I94 L;  1IBM L;  5M5Y B;  2B2T C;  4JI1 L;  1GUS A;  4A3G G;  4TQU S;  3T51 B;  3KLR A;  4JV5 L;  3NEN A;  4XDX A;  4C2M B;  2IY5 B;  5ELO A;  1H9M A;  4EQO A;  3CME A;  1B2T A;  4A3F H;  4A3G H;  3PUX A;  5ELD A;  1LUZ A;  2B8G A;  4ZRZ A;  1PRT F;  4KJN A;  2UU9 L;  1EWI A;  4GKJ L;  3UDG A;  2F52 A;  3X3N A;  1QWY A;  1Z7T A;  4O2D A;  3CPW A;  1BO0 A;  1E2W A;  1YJW A;  3HEJ A;  4CDC C;  4BBS B;  2FHT A;  4RGM A;  1NMG A;  2OCE A;  3GTL B;  4QCL A;  3MAQ A;  4OWX B;  4V0B A;  5ELB A;  1T5X D;  2FMC A;  3I4L A;  5EPK A;  4DV1 L;  1I4H A;  2B2W C;  1Q8I A;  2PQA B;  1J6Q A;  4IFD J;  1GD7 A;  2IPK D;  4RCN A;  3AU7 A;  1NR2 A;  4IUV A;  5C0X J;  1VQG A;  4IOA A;  3E0E A;  3AMU A;  1SMY D;  1X9N A;  3NQT A;  5K5P A;  3OWF A;  2M00 A;  1YNJ C;  4GN5 A;  1TWA B;  1VQD A;  5A2Q L;  1HNZ L;  4HIM A;  4DAP A;  1ROD A;  5BN3 A;  5LMU L;  3A74 A;  4ZUI A;  5D3D A;  1JJC B;  4UP8 A;  1JMC A;  3SK8 A;  1RKN A;  2OEO A;  4XQN A;  4C3H B;  4ME5 A;  2A6E D;  2XGT A;  2G9D A;  3F2C A;  1ESR A;  2PMZ E;  3KFU A;  5G3L D;  4JI3 L;  5F2D A;  5JJK A;  3Q24 A;  2CW0 C;  3HKZ G;  4OXP A;  4NXN Q;  4G57 A;  4WOR A;  1KLU D;  1KXL A;  2R93 H;  5FO8 B;  1PLF A;  3HOV B;  1NR4 A;  3IL8 A;  1L0X B;  2KEC A;  4L5Q A;  1TT2 A;  1EYC A;  2OF1 A;  2ATW A;  5LL6 S;  3GQB A;  2H4O A;  2D2C C;  5C4X H;  1N34 Q;  1CUK A;  2PQE A;  1GOZ A;  1CTM A;  2Z1C A;  5M5X B;  1OXS C;  3U9O A;  4FYD A;  5C0X I;  1PDQ A;  1C7Y A;  2EE1 A;  3H3V I;  1LT6 D;  1EWC A;  4OO1 G;  3GTJ B;  2VZA A;  4BS9 A;  1VQJ A;  3PQI A;  3EQL C;  1VQ7 A;  2NVQ H;  3K5N A;  1LV9 A;  5H1S E;  4HID A;  3LNN A;  1KL9 A;  1VQB A;  4L5T A;  1CSQ A;  3S15 H;  4OO1 H;  3ULJ A;  1N36 L;  4YCU A;  2HHH Q;  3S14 H;  1JIC A;  3NP8 A;  4LF9 Q;  5COR A;  3ULL A;  3H91 A;  2L15 A;  3M4O H;  1AE3 A;  2NB0 A;  2K01 A;  1XPR A;  1RTO A;  4YWL A;  1E1T A;  2CH4 A;  3NWT A;  1X3Q A;  2OTJ A;  1OXU A;  4IUN A;  1I3Q H;  4FNF A;  3U4V A;  4RAU C;  1QB5 D;  1V1P B;  1A15 A;  4KJO A;  1KHI A;  2A6E C;  3KF8 B;  4B3T Q;  3PCO B;  1BCP C;  4LJZ C;  4R9W A;  2AKW B;  5EBC A;  1Y1V B;  4AQY L;  5GAH C;  4ODG A;  4K0K L;  1CHQ D;  1DOM A;  2WV6 D;  2KVM A;  3I3C A;  1JT8 A;  1HPC A;  1ENF A;  1JOK A;  2B2T A;  3H6M A;  1YHA A;  5AJ3 L;  3CP0 A;  4P2C B;  4JBM A;  2R92 B;  1E0B A;  4EQN A;  5I4D A;  4BA2 I;  4R8N A;  3J80 E;  3CD6 A;  4EVO A;  2AMC B;  5KYL A;  3J81 j;  1LT3 D;  4ID6 A;  3HOZ H;  4HJA A;  1GVP A;  1XMQ Q;  2JA5 G;  2OQ0 A;  3A55 A;  4A3D B;  1BQQ T;  5C4X B;  1IL8 A;  2CW0 D;  1GUT A;  4OX9 L;  1ML0 D;  2O4X A;  1CKN A;  1NMF A;  1R4P B;  2QA4 A;  2A74 C;  3HOZ G;  4CKB A;  4DAY B;  3QR8 A;  1QE6 A;  1PH7 A;  3RN5 A;  5D3I B;  3CC4 A;  4LFB Q;  4IZ8 A;  4M1U B;  1HR0 L;  2E74 C;  1YEZ A;  1LTS D;  3BZK A;  1O7Z A;  4QL5 A;  4JI3 Q;  2EYF A;  2XWJ B;  4BBR B;  4KMU C;  3T1H Q;  3HOY B;  1LAB A;  5E7N A;  3ONA B;  1EY5 A;  1UE5 A;  3K5M A;  3AYH B;  4HED A;  3D8G A;  4M8A A;  4J6H A;  4NW2 A;  4N8F A;  1CT1 D;  2OT2 A;  2KCN A;  1B44 D;  1VQP A;  4IFD G;  2XWB B;  1A6X A;  2KJX A;  3Q0A A;  1QCB D;  3PIO A;  5KRU A;  3CCE A;  1X54 A;  4B3M Q;  4AIM A;  1L1O A;  1G2T A;  1KNE A;  3D4D A;  1IKM A;  2IT1 A;  3HOV H;  3CW2 C;  2C35 B;  4IFD H;  3GTP B;  5K36 G;  3NEM A;  4BY7 B;  3BVG A;  2MO0 A;  1CQF A;  2FJ2 A;  4MTK A;  2F0O A;  2B63 H;  4I7Z C;  1WTH A;  3MXU A;  1RTN A;  2XIW A;  4K14 A;  4TVA B;  4GKJ Q;  3BDC A;  1G6Z A;  1EFI D;  1F9Q A;  1I6H H;  3PO3 G;  4HMJ A;  2R7Z H;  1B1Z A;  3UDI A;  5IGF A;  1YVC A;  1FVI A;  1ILP A;  2BDO A;  3MEF A;  4YIJ A;  4FXD A;  4A3B B;  3F2U A;  2MO1 A;  3M9B A;  5FOB B;  3VDY A;  1SE8 A;  3CMA A;  5EKL A;  4K2K A;  1DJR D;  4OON A;  3Q6S A;  3J7A 5;  5JAV A;  3T56 B;  3D0F A;  2Q8R E;  4GNX A;  3IFT A;  4JOI C;  1KAB A;  1QOH A;  1B4O A;  4DV7 L;  4LF4 Q;  3J7Y W;  4DXF A;  1XJV A;  4G7H C;  1VQO A;  3FVQ A;  5DM6 3;  1VQA A;  4KKT A;  4JI1 Q;  1U4L A;  1BVS A;  5C4H A;  3OW7 A;  1LTR D;  1MSG A;  1B3A A;  3GTQ H;  2ZM6 L;  5CV4 A;  3OYY A;  2KOL A;  4X6A H;  4N8X 1;  3R93 A;  3IAY A;  1J5E L;  4GN3 B;  2F4I A;  2HD3 A;  1FNU A;  4OWT B;  5M3M G;  4B9X A;  1PZI D;  3BVM A;  4DNI A;  5M3F H;  2RQX A;  3DHQ A;  3EJI A;  2X6L A;  1HXY D;  4BY7 H;  3TP6 A;  4A3L H;  1K83 B;  4LF7 L;  1S40 A;  1HTL D;  2DY8 A;  1JJ2 A;  5FLM G;  3HOU G;  1M1K C;  3GV3 A;  4RCO A;  4FF3 A;  2Z8L A;  3K8A A;  1PTO B;  1HNX L;  3NXW A;  1DXM A;  1MJE A;  1ZEQ X;  2B2Y C;  1N33 Q;  1BDO A;  1JE4 A;  5C5L A;  4JI5 L;  3BYY B;  1A3U A;  2SNS A;  5IT9 E;  1JWU D;  3WOE A;  2Y0S B;  4R4C A;  4IUT A;  3M7N A;  3S1R B;  1LT4 D;  3V96 A;  2CQO A;  4DK6 C;  1CA6 A;  4H44 C;  2QW7 A;  3MFG A;  4OL7 A;  1VQF A;  4OIJ A;  1KD1 C;  2JA8 B;  4A93 H;  5HGT A;  4A3D H;  1Z9F A;  1SBB B;  3F2B A;  4K5X A;  1D5M C;  2WAQ E;  3F8T A;  1Q81 C;  3M4Q A;  3U9S A;  1X3F A;  1AFP A;  2NVQ B;  4FF4 A;  5LMN Q;  4IUP A;  3EIV A;  1B53 A;  3S16 B;  4XYQ A;  4N9T A;  1VQ8 A;  4OEM B;  3I55 A;  4WRD A;  5CC4 A;  1B7Y B;  3NK9 A;  4C3H H;  1SJE D;  1STY A;  3W5O A;  2QDL A;  2I5L X;  3NTH A;  2ZXO A;  1H95 A;  5C44 G;  4JV5 Q;  1I4Q A;  1X65 A;  1ENA A;  1PZK D;  4PNY A;  2J7Z A;  5IE8 A;  5GAD C;  5GRO A;  3OOC A;  4FP5 D;  4UY8 C;  1SE2 A;  3U50 C;  3R2T A;  2F0L A;  3SXH A;  2K03 A;  4JI2 Q;  5KGU A;  3K7U C;  2KCC A;  2YTV A;  3OHX C;  2Z6B A;  1IBL L;  1BBU A;  4QUF A;  3GV6 A;  4XXE A;  3S24 A;  1Y1W H;  3PUZ A;  5IYB H;  1PH3 A;  2JE6 I;  4FXG C;  3ER0 A;  2E2D C;  1HZA A;  4O42 A;  2H1E A;  4KLK A;  2K7V A;  4UP9 A;  2TSS A;  1KAA A;  3OIQ A;  3GTQ B;  3I4M H;  2JA5 B;  1STH A;  3PF5 A;  2E76 C;  5C4X G;  3ND9 A;  1BF4 A;  1KDC A;  1RJT A;  1IBK L;  2NN6 I;  2TMP A;  1GKH A;  1STB A;  4DV1 Q;  4DR6 L;  1F2Z A;  2BE5 D;  1PVO A;  5C3E G;  4GLX A;  1IL2 A;  3PUW A;  5JEA G;  4AH6 A;  2O5I C;  1CKM A;  2LMC B;  2ZXR A;  3EA6 A;  1MIU A;  1G2S A;  5E1F A;  4XQQ A;  5KEE A;  4YWM A;  3A56 A;  5COY A;  2A68 D;  4H02 A;  2UXB Q;  1LTI D;  3GTL H;  5C3E H;  2NVT B;  4K2L A;  4XYO A;  1GUG A;  5HGQ A;  1TWH B;  4A75 A;  3MXG A;  4K5W A;  3A7A B;  1EU4 A;  1LLR D;  1KC8 C;  1MSH A;  4C3J G;  1BBX C;  1BCP D;  1X3P A;  1X3G A;  4UAI A;  3HP3 A;  2PNR C;  5ELN A;  4C1N K;  2ALY B;  3DM3 A;  3UI2 A;  4C3J H;  2A19 A;  3G6J B;  2N8N A;  1QVG A;  1HA5 A;  3HOU B;  2EY6 A;  1PXU A;  1CA5 A;  1TII D;  1ICF B;  4KY7 A;  1STE A;  1KDB A;  3QWN A;  2QCP X;  3L3O C;  1EL0 A;  3U58 A;  2WP8 J;  1TS5 A;  1XNQ L;  2D9U A;  5JEA J;  4FVM A;  4CDF C;  1PZJ D;  1Q46 A;  1WCM B;  4J1M A;  2EQS A;  2CKZ B;  2EJF C;  2WB1 E;  1JQY D;  1P8L A;  4A3M B;  1BUV T;  1OXT A;  1IBK Q;  3BDO A;  3CCM A;  1WVL A;  2JA5 H;  3RZD H;  3PSI A;  3RZO H;  3FPU B;  4F8M A;  3S9W A;  4NXN L;  5FO9 B;  1F2Y A;  3ZYY X;  5EPJ A;  3TN2 A;  2MUY A;  4BBS H;  3DEO A;  1IBL Q;  1F2M A;  1X56 A;  3SVM A;  2I5M X;  2E2H B;  2NYZ D;  1G6P A;  4R4O A;  2HUG A;  1IXR A;  3P7J A;  4GS3 A;  4IJL A;  2F0Q A;  2JN4 A;  1Z47 A;  4P74 A;  1STG A;  2RKS A;  4P71 A;  3A0J A;  3SHL A;  3I7F A;  3N6R A;  4RKL A;  4HN7 A;  3S15 B;  5IP9 H;  3CCR A;  1BBW A;  2PW7 A;  5EQ0 A;  4A3I H;  1GM5 A;  5LMN L;  1HFN A;  2ZT9 C;  1PYS B;  3LGJ A;  2AQ1 B;  3HG9 A;  3WOF A;  4DR2 L;  2SOB A;  4RMF A;  1I3Q B;  4I7A A;  2F3V A;  3C1E A;  2ZJR A;  4YWK A;  3D4W A;  2EZV A;  3H09 A;  2WKD A;  3KLS X;  2ZTE A;  2B29 A;  1HZB A;  5DAU A;  1A3V A;  4Y7N B;  1YIT A;  3CU7 A;  3K59 A;  1PH1 A;  4DR2 Q;  2VXW A;  5DM7 3;  5KNC A;  3NE5 B;  1WFQ A;  2I46 A;  5IGD A;  1AEX A;  2SNM A;  3RN2 A;  2F4V Q;  4AQY Q;  3DWP A;  3OSO A;  4TRD A;  2CHB D;  1Y8O B;  2KCM A;  4GN4 B;  2BA1 A;  2PCF B;  1W6J A;  1E3P A;  4H0L C;  4EGV A;  3HOW B;  1S4Z A;  2R7Z G; 
#chains in the Genus database with same CATH homology
 2MP1 A;  1ZXT A;  2F0M A;  2HCI A;  2WIN B;  1CZG A;  1WTR A;  2K05 A;  5LHY 1;  4HCE A;  2IJ0 A;  1BNZ A;  4LAA A;  3J81 L;  1EY6 A;  1U4P A;  5IGG A;  5IGB A;  1X32 A;  3TDQ A;  4KTA A;  5EKK A;  2NN6 H;  1BCP B;  2K28 A;  2WII B;  1SYG A;  3W3A A;  2B2W A;  4LK1 C;  1I6V C;  3A8J E;  4IUR A;  1BR9 A;  2NN6 G;  3VR4 A;  3CKI B;  3KF8 A;  2F0G A;  3CQZ B;  3R2I A;  1QJO A;  4HTH A;  1AP0 A;  4AYB B;  4C3I G;  4K5V A;  1G29 1;  1CI3 M;  4A3G B;  4NDX A;  2B2Y A;  4BA1 I;  3GTK B;  1V1O A;  1O78 A;  4A3K B;  3C2P A;  1FYC A;  1TY2 A;  2JA7 B;  1SNP A;  1DOK A;  3MVV A;  4XQJ A;  1MBY A;  2F0V A;  1PRT C;  5C3W A;  3NWS A;  3NTK A;  5A2Q E;  1AZQ A;  2Z4I A;  1HCZ A;  1DD2 A;  2F0W A;  1H9J A;  2K5Q A;  2K1B A;  1V8Q A;  4RWS C;  2AQ2 B;  3M4O B;  1SDF A;  2PZT A;  2EYL A;  3K58 A;  2MHV A;  3SE0 A;  2X6G A;  2LS0 1;  3TP7 A;  4LMQ D;  4C3H G;  1PMR A;  4KHV A;  3AB9 A;  4QMG A;  2F0E A;  2XRQ D;  2BCO A;  1FNV A;  4XIG S;  4C1N I;  4DNR B;  1LT5 D;  3P75 A;  1TVX A;  3FRP B;  3DXJ C;  3MC0 B;  1WTO A;  1LTG D;  5ISR A;  1TR5 A;  2NUC A;  3L9A X;  3HOX B;  5CR3 A;  5CV6 A;  1FGB D;  2WAQ B;  1ONL A;  3VR6 A;  2JEA I;  4ZKC B;  5CV7 A;  3PIO 3;  1HA6 A;  3A8K E;  1PTO D;  1SAP A;  4E6I A;  5IT9 L;  1PFN A;  1EZ6 A;  3M3Y B;  3QB3 A;  4CKE A;  3FMC A;  3D4R A;  1B9M A;  1EY7 A;  3NUC A;  1KNA A;  3QG1 A;  3MFY A;  1DCZ A;  5C6A A;  5CV5 A;  5E4W C;  2A69 D;  4RHS A;  1F9S A;  1DYQ A;  4NKL A;  3RUZ A;  2PW5 A;  5C44 B;  3MA2 B;  1CHP D;  4IAL A;  2MPM A;  5FK9 C;  4IN3 A;  1PFB A;  4IFD I;  3VR2 A;  2B2V A;  4DAV A;  3R8B A;  4TSS A;  4PMW A;  1HRJ A;  3KBG A;  4DGZ A;  5AFW A;  1ESF A;  1XTC D;  3C3L A;  3MWY W;  2CVR A;  3VYR A;  5KYI A;  1J8I A;  1SNO A;  1KLG D;  5JVH 3;  2L9H A;  1IKL A;  2N88 A;  2PZW A;  3TZU A;  4R8I A;  4ZUJ A;  5IOC A;  1LTT D;  2V4D A;  2WKC A;  2D62 A;  4Q0F A;  3HZX A;  1Q1E A;  3IFD A;  2EY5 A;  5KIX A;  3MXP A;  3OWE B;  2QF7 A;  3HS0 C;  1PTO F;  4K6D A;  4DU9 A;  3RLF A;  1TS3 A;  2F3W A;  3BZD B;  4V19 0;  2XRS D;  2EVB A;  4BWG B;  1R9T B;  4RH6 A;  2M9V A;  1ILQ A;  1GHJ A;  1EY8 A;  2RBM A;  1W6K A;  2EJG C;  3LWE A;  3NBI A;  5C0X G;  3PUY A;  4C3J B;  5K36 H;  2EYO A;  5M3F B;  2R93 B;  2AQ3 B;  2XVS A;  1HUM A;  4WJW A;  2XSC A;  5C0X H;  2AUK A;  2X69 A;  1S5C D;  1ZKO A;  5J39 A;  3GTG B;  4XT3 B;  4CHT B;  3SK6 A;  4IUQ A;  1ENC A;  2K5W A;  5IGE A;  5BN5 A;  2HDL A;  4JBW A;  1FD7 D;  1UNS A;  5LL6 X;  4U67 3;  3K7A B;  3ITP A;  2EYH A;  3QJY A;  1BOS A;  1EIG A;  1JOR A;  1E2Z A;  2L5T A;  3EFX D;  4HR7 B;  2OXP A;  3TBI B;  3T4A C;  5I2X A;  2GA4 B;  1TWG B;  3PMF A;  5T1I A;  1EYA A;  3KLS A;  1EIH A;  3HGB A;  1KDA A;  2XN9 C;  5M9O A;  5JVG 3;  2F0J A;  2D5D A;  1JCK B;  2IL8 A;  4KK7 A;  1Y8N B;  5IGC A;  1JOQ A;  2N55 A;  3D6C A;  1D2B A;  3TP5 A;  2AUJ D;  2ID0 A;  1HQM C;  3I90 A;  1SYC A;  2JSO A;  3ERO A;  2FIN B;  1SND A;  2IX0 A;  1Q3L A;  4BY1 B;  1PRT B;  3FDT A;  1II3 A;  4RA8 A;  1AN8 A;  1TWC B;  2NTS A;  3VA5 A;  3KUP A;  3T13 A;  1RHP A;  1DON A;  5CV8 A;  3KK7 A;  3E0J A;  1Y1W B;  2L0C A;  3CHB D;  1HUN A;  1HQR D;  3FPP A;  1AW7 A;  3CRK C;  2JA6 B;  2F1M A;  4FF2 A;  2BE5 C;  2EDG A;  2HDM A;  2K32 A;  1EYD A;  4HSP A;  3EVQ A;  1XX8 A;  2IWH A;  1RCV D;  2F0F A;  5NUC A;  1O7L A;  1IHZ A;  3BYT B;  2BOS A;  1U9R A;  2R3Z A;  1BCP F;  1ZYR D;  2DY7 A;  4WFN 3;  2L4N A;  1KTK A;  4HCS A;  1EY4 A;  4ABN A;  4A3I B;  4H13 C;  4CJ1 B;  4FF1 A;  5DNF A;  1IW7 C;  1EZ8 A;  2ICI A;  3OPO A;  3SDZ A;  5A35 A;  3QOJ A;  3JAM E;  4EQP A;  3GTM B;  1RD9 D;  4ZKB B;  2PYK A;  1CFM A;  1MI2 A;  5DEH A;  2PZU A;  2EYP A;  4GZY C;  3M7G A;  2VUM B;  4CJ0 B;  2R61 A;  1H9S B;  5FLX E;  1EY0 A;  3P20 A;  3VA7 A;  4FO2 A;  1G8Z D;  4KKS A;  2KUM A;  3K5L A;  2JXM B;  2G9H D;  5CV9 A;  3MEH A;  4C56 C;  5I9P A;  3NQI A;  3VR5 A;  4PV1 C;  4OO1 I;  3D31 A;  4KI0 A;  2F0I A;  3RMH A;  4B08 A;  1C48 A;  1LO5 D;  1ICW A;  4K8I A;  3TME A;  1DZ1 A;  4PMB A;  1ZYR C;  3O13 A;  1WTV A;  3MZ5 A;  5FLX L;  4OHJ A;  5JEA H;  2F03 A;  3P1H A;  5C4Z A;  2EY2 A;  1PFM A;  3K57 A;  4DA2 A;  3D3R A;  2F0N A;  2HQE A;  5I2Y A;  1RDP D;  3M85 A;  3DEP A;  5BN4 A;  4DK0 A;  1Z6H A;  5E4X A;  5J1Z A;  4DFA A;  1SEB D;  1SE3 A;  4ILW A;  1I50 B;  3GO5 A;  3NHH A;  1GXD C;  2LY7 A;  4RGT A;  5IOD A;  1I4G A;  2F0H A;  1S5D D;  5TSS A;  1VF7 A;  1S5E D;  1QNU A;  2A5H A;  2KED A;  2EY1 A;  1I4R A;  2NTT A;  1WTQ A;  2L12 A;  3CRL C;  3BG3 A;  3HKZ B;  1AZP A;  2RSO A;  2VB2 X;  1MGS A;  1O80 A;  3T53 B;  4DAY A;  4HAE A;  3PIP 3;  1UUP A;  1HHV A;  3NSW A;  3SK4 A;  2MGS A;  1WTP A;  1OO9 B;  3J7A V;  1VMC A;  3ND8 A;  3J80 L;  1F9R A;  1J9O A;  1JC7 A;  1Q90 A;  3T16 A;  2A68 C;  4KY5 A;  2ENB A;  3NPP A;  3QIA A;  2IX1 A;  4MHE A;  4F87 A;  4ZLT F;  1V43 A;  2A6H C;  5EJW A;  4IQZ A;  4DXG A;  3DWA A;  5EBD A;  3I91 A;  1EY9 A;  2FFK B;  4H7B A;  1L0Y B;  3URY A;  3MXN A;  3ERQ A;  2BDN A;  2HCC A;  3S14 B;  1TS2 A;  2YYZ A;  3E5S A;  1TKW B;  4Q5V A;  4Z9C B;  1QIL A;  2KEE A;  5CYU A;  4L63 B;  4S3S A;  4ULL A;  3A54 A;  1XXG A;  3C1F A;  1I6H B;  3V05 A;  2JEB I;  4NP5 A;  4XT1 B;  1SNM A;  1CK1 A;  3I72 A;  1VF5 C;  1SFO B;  2F0D A;  1FR3 A;  3GTO B;  3TSS A;  2B39 A;  2E2J B;  1PTO H;  2B2U C;  2DN8 A;  2IW3 A;  1GUO A;  4A3F B;  3I4N B;  1PRT D;  5C3E B;  4A3J B;  1XYI A;  4XTC S;  2LFN A;  1D5Z C;  2F0P A;  4KN7 C;  5JOB A;  2PMZ B;  1V1P A;  3FKI B;  3H94 A;  1ET9 A;  4A93 B;  5JPN C;  2DNC A;  3S17 B;  3SEB A;  2NWG A;  2DNE A;  1IYV A;  3H0G B;  4CBV A;  1H9K A;  3GD7 A;  1UEA B;  3S1N B;  5JPM C;  4MN3 A;  4F88 A;  3RD4 A;  1SSO A;  3MHB A;  4DNT B;  3DMU A;  1B9N A;  5EPL A;  3SR1 A;  3RZO B;  3Q23 A;  3S1M B;  1HTP A;  4HMI A;  2EPB A;  5T1G A;  1VCI A;  2EYJ A;  1SE4 A;  2NBF A;  5CMD A;  1STN A;  4K6L A;  1SYF A;  2I07 B;  2K33 A;  3TZD A;  2EXZ A;  3GP7 A;  1VMP A;  3K5O A;  1WTX A;  3J7A F;  2NVY B;  1UAP A;  5KNB A;  1YNN C;  2A73 B;  3BS1 A;  4RKB A;  2M2L A;  1Q1B A;  3SK5 A;  5HUR A;  4I65 A;  1H9R A;  1PTO C;  3S2H B;  1R4Q B;  5CBA E;  3H3V C;  5EGT A;  2C9O A;  2BA0 A;  1NUC A;  1C8C A;  3S2D B;  3K6O A;  1TY0 A;  3R3O A;  2MJ8 A;  1S5F D;  1CM9 A;  2Q8I B;  2RA4 A;  1LTA D;  2VNU D;  3BVZ A;  4U68 A;  2IX3 A;  5ELC A;  2Z4H A;  1K8O A;  1GUN A;  1MD2 D;  3JAM L;  2LKV A;  3DM1 A;  2J0T D;  4A3E B;  2FMM A;  1TU2 B;  4RGO S;  4DF7 A;  1I4P A;  2B2U A;  3MTS A;  2F0T A;  1TWF B;  1OXV A;  3FEW X;  2Q8T A;  2NZ1 D;  5EKI A;  4NMZ A;  1Y8P B;  3TP8 A;  2XNA C;  5I6W A;  1XWE A;  3PUV A;  2PPB C;  5E3F A;  1A3T A;  2C5C A;  1PYW D;  4ZK9 B;  3Q22 A;  1EEI D;  4MIU A;  1SNC A;  1I4X A;  2L1B A;  3LWU A;  4G4K A;  1YNN D;  3NTI A;  1WTW A;  1TQO A;  4HSV A;  3PV0 A;  1WD0 A;  5FKA C;  5CGK A;  3OMG A;  2RVL A;  3DUZ A;  1SMY C;  3M4Y A;  4X3K A;  2RSN A;  2SDF A;  1YNJ D;  2CQA A;  1JWS D;  2B2V C;  2RDH A;  5FO7 B;  4DK1 A;  1JR0 D;  3OIP A;  2ICE C;  3V2T A;  4C3I B;  2JYO A;  3K0Y A;  4PQX A;  2J4X A;  3QOL A;  2QIL A;  3HOZ B;  5D65 A;  4DN4 M;  2KQ3 A;  1C4Q A;  5IIF A;  3N52 A;  2F0S A;  1FNW A;  4QUC A;  4RGN A;  3RZD B;  2R7Z B;  4QB4 A;  1D6E C;  3X3M A;  2EYM A;  4X3S A;  4FXK C;  1TS4 A;  1EEF D;  1SYE A;  1EWH A;  3KBX A;  1HFG A;  2R6G A;  3L7Z C;  4CGY B;  2O5J C;  4L8J A;  2AWO A;  4OIK A;  3G7L A;  1U4M A;  4PMC A;  5CBE E;  1OXX K;  1SNQ A;  1NAP A;  3A8I E;  3E6Z X;  5J22 A;  3S1Q B;  4ZAI A;  3NBH A;  1RF2 D;  2E75 C;  4K8J A;  1LAC A;  1F9P A;  3I8Z A;  1SYD A;  4CKC A;  1WD1 A;  4UDU C;  1Q12 A;  1DOL A;  1GJX A;  3PO3 B;  2RDF A;  3LX0 A;  4KHZ A;  4QIW B;  4IUU A;  1A2U A;  2A69 C;  2YU9 B;  4ZYS A;  5D14 A;  3PO2 B;  1SXT A;  4OGQ C;  1Y69 U;  1GUW A;  3I4M B;  2L55 A;  5G3L F;  2B8F A;  1DM0 B;  2WB1 B;  2F0U A;  1JWM D;  5C4J B;  3J81 E;  4X3U A;  1T5E A;  2QKI C;  5C5M A;  1K8M A;  3VR3 A;  2K6A A;  3A7L A;  5M3M B;  1QG7 A;  3VYU A;  5I9O A;  1VDZ A;  4CJ2 C;  2KA7 A;  4O1N A;  1SJH D;  1B50 A;  1CZW A;  2VB3 X;  4J8Q A;  4F7X A;  4N9P A;  1A2T A;  1CQV A;  3I73 A;  3VYT A;  2ZXP A;  2O2L D;  5JJZ A;  1JB3 A;  2WAC A;  1IW7 D;  4KD4 A;  2PO4 A;  1D1K A;  2RDG A;  1D5X C;  1D1I A;  1M8A A;  1F2L A;  2NVX B;  3OMC A;  5I6Y A;  1NSN S;  4JK1 C;  4X3T A;  1SYB A;  1F77 A;  4L6T B;  4KY6 A;  4KD3 A;  1EU3 A;  1EOT A;  1U4R A;  3I70 A;  2E2I B;  1EQT A;  4RFB A;  4KN4 C;  2AWN A;  4KV6 A;  2K04 A;  5C3X A;  3VYS A;  2KHS A;  1BXT A;  2JP1 A;  4QF4 A;  1E2V A;  2EOT A;  2A6H D;  4B9W A;  1QNK A;  5M5W B;  2F0K A;  3C46 A;  1G91 A;  1ET6 A;  4TKO B;  3WDN A;  4G7Z C;  1LTB D;  3IKJ A;  4ZQ3 A;  3HRZ C;  2QDB A;  3DWQ A;  1IYU A;  2SEB D;  2K5D A;  1M4V A;  1EQV A;  1S5B D;  2L11 A;  4KKU A;  1JOO A;  1STA A;  5ELE A;  4RHR A;  3BDL A;  1GHK A;  3D6W A;  5KND A;  5ELF A;  1NCV A;  3W2D A;  1H9S A;  3QO2 A;  2B63 B;  4G7O C;  2QEJ C;  1O7Y A;  2EJM A;  5M5Y B;  2B2T C;  1GUS A;  4TQU S;  3T51 B;  3KLR A;  4XDX A;  4C2M B;  1H9M A;  4EQO A;  1B2T A;  3PUX A;  5ELD A;  2B8G A;  4ZRZ A;  1PRT F;  4KJN A;  3X3N A;  1QWY A;  1Z7T A;  1BO0 A;  1E2W A;  3HEJ A;  4BBS B;  2FHT A;  4RGM A;  3GTL B;  4QCL A;  3MAQ A;  4V0B A;  5ELB A;  1T5X D;  2FMC A;  3I4L A;  5EPK A;  1I4H A;  2B2W C;  1Q8I A;  4IFD J;  2IPK D;  4RCN A;  5C0X J;  3AU7 A;  1NR2 A;  4IUV A;  3AMU A;  1SMY D;  3NQT A;  5K5P A;  3OWF A;  2M00 A;  1YNJ C;  1TWA B;  5A2Q L;  4DAP A;  1ROD A;  5BN3 A;  4ZUI A;  5D3D A;  3SK8 A;  1RKN A;  2OEO A;  4XQN A;  4C3H B;  4ME5 A;  2A6E D;  2G9D A;  1ESR A;  5G3L D;  5F2D A;  3Q24 A;  2CW0 C;  4G57 A;  4WOR A;  1KLU D;  5FO8 B;  1PLF A;  3HOV B;  1NR4 A;  3IL8 A;  1L0X B;  2KEC A;  1TT2 A;  1EYC A;  2OF1 A;  5LL6 S;  3GQB A;  2H4O A;  2D2C C;  2PQE A;  1GOZ A;  1CTM A;  2Z1C A;  5M5X B;  1OXS C;  3U9O A;  4FYD A;  5C0X I;  1PDQ A;  2EE1 A;  1LT6 D;  1EWC A;  4OO1 G;  3GTJ B;  4BS9 A;  3EQL C;  3K5N A;  1LV9 A;  3LNN A;  4OO1 H;  1JIC A;  3NP8 A;  5COR A;  3H91 A;  2NB0 A;  2K01 A;  1RTO A;  3NWT A;  1X3Q A;  1OXU A;  4IUN A;  4FNF A;  4RAU C;  1QB5 D;  1V1P B;  1A15 A;  4KJO A;  2A6E C;  1BCP C;  4LJZ C;  4R9W A;  5EBC A;  1Y1V B;  4ODG A;  1CHQ D;  1DOM A;  2WV6 D;  2KVM A;  3I3C A;  1HPC A;  1ENF A;  1JOK A;  2B2T A;  3H6M A;  4P2C B;  2R92 B;  1E0B A;  4EQN A;  5I4D A;  4BA2 I;  4R8N A;  3J80 E;  4EVO A;  5KYL A;  1LT3 D;  4ID6 A;  3A55 A;  4A3D B;  1BQQ T;  5C4X B;  1IL8 A;  2CW0 D;  1GUT A;  1ML0 D;  2O4X A;  1R4P B;  2A74 C;  4CKB A;  1QE6 A;  5D3I B;  4IZ8 A;  4M1U B;  2E74 C;  1LTS D;  1O7Z A;  2EYF A;  2XWJ B;  4BBR B;  4KMU C;  3HOY B;  1LAB A;  3ONA B;  1EY5 A;  3K5M A;  4HED A;  3D8G A;  4M8A A;  4J6H A;  4NW2 A;  1CT1 D;  2OT2 A;  2KCN A;  1B44 D;  4IFD G;  2XWB B;  1A6X A;  2KJX A;  3Q0A A;  1QCB D;  5KRU A;  1G2T A;  1KNE A;  3D4D A;  1IKM A;  2IT1 A;  4IFD H;  3GTP B;  5K36 G;  4BY7 B;  3BVG A;  1CQF A;  2FJ2 A;  2F0O A;  4I7Z C;  3MXU A;  1RTN A;  2XIW A;  4K14 A;  3BDC A;  1G6Z A;  1EFI D;  1F9Q A;  4HMJ A;  1B1Z A;  5IGF A;  1ILP A;  2BDO A;  4YIJ A;  4FXD A;  4A3B B;  3F2U A;  5FOB B;  5EKL A;  4K2K A;  1DJR D;  3Q6S A;  5JAV A;  3T56 B;  2Q8R E;  3IFT A;  1KAB A;  1QOH A;  1B4O A;  3J7Y W;  4DXF A;  4G7H C;  3FVQ A;  5DM6 3;  4KKT A;  1U4L A;  5C4H A;  3OW7 A;  1LTR D;  1MSG A;  1B3A A;  5CV4 A;  2KOL A;  3R93 A;  3IAY A;  2F4I A;  1FNU A;  4B9X A;  1PZI D;  3BVM A;  2RQX A;  3DHQ A;  3EJI A;  2X6L A;  1HXY D;  3TP6 A;  1K83 B;  1HTL D;  2DY8 A;  3GV3 A;  4RCO A;  4FF3 A;  2Z8L A;  1PTO B;  3NXW A;  1DXM A;  1ZEQ X;  2B2Y C;  1BDO A;  1JE4 A;  5C5L A;  3BYY B;  1A3U A;  2SNS A;  5IT9 E;  1JWU D;  3WOE A;  2Y0S B;  4IUT A;  3M7N A;  3S1R B;  1LT4 D;  3V96 A;  1CA6 A;  4H44 C;  3MFG A;  4OL7 A;  2JA8 B;  4OIJ A;  5HGT A;  1SBB B;  4K5X A;  1D5M C;  3U9S A;  1AFP A;  2NVQ B;  4FF4 A;  4IUP A;  1B53 A;  3S16 B;  4XYQ A;  4N9T A;  4WRD A;  5CC4 A;  3NK9 A;  1SJE D;  1STY A;  3NTH A;  2ZXO A;  1I4Q A;  1ENA A;  1PZK D;  4PNY A;  2J7Z A;  3OOC A;  4FP5 D;  1SE2 A;  3R2T A;  2F0L A;  3SXH A;  2K03 A;  5KGU A;  2KCC A;  3OHX C;  4QUF A;  3GV6 A;  4XXE A;  3PUZ A;  2JE6 I;  4FXG C;  2E2D C;  4O42 A;  2H1E A;  2K7V A;  2TSS A;  1KAA A;  3OIQ A;  3GTQ B;  2JA5 B;  1STH A;  2E76 C;  3ND9 A;  1BF4 A;  1KDC A;  1RJT A;  2NN6 I;  2TMP A;  1STB A;  1F2Z A;  2BE5 D;  3PUW A;  5JEA G;  2O5I C;  2LMC B;  2ZXR A;  3EA6 A;  1G2S A;  5E1F A;  4XQQ A;  5KEE A;  3A56 A;  5COY A;  2A68 D;  1LTI D;  2NVT B;  4K2L A;  4XYO A;  1GUG A;  1TWH B;  3MXG A;  4K5W A;  3A7A B;  1EU4 A;  1LLR D;  1MSH A;  4C3J G;  1BBX C;  1BCP D;  1X3P A;  4UAI A;  3HP3 A;  2PNR C;  4C1N K;  3UI2 A;  3G6J B;  1HA5 A;  3HOU B;  2EY6 A;  1PXU A;  1CA5 A;  1TII D;  4KY7 A;  1STE A;  1KDB A;  3L3O C;  2QCP X;  3QWN A;  1EL0 A;  2WP8 J;  1TS5 A;  2D9U A;  5JEA J;  4FVM A;  1PZJ D;  1WCM B;  4J1M A;  2EJF C;  4A3M B;  1JQY D;  1BUV T;  1OXT A;  3BDO A;  1WVL A;  3FPU B;  4F8M A;  3S9W A;  5FO9 B;  1F2Y A;  3ZYY X;  5EPJ A;  3TN2 A;  2MUY A;  3DEO A;  1F2M A;  3SVM A;  2E2H B;  2NYZ D;  2HUG A;  3P7J A;  2F0Q A;  1Z47 A;  1STG A;  2RKS A;  3SHL A;  3N6R A;  4RKL A;  4HN7 A;  3S15 B;  2PW7 A;  5EQ0 A;  1HFN A;  2ZT9 C;  2AQ1 B;  3HG9 A;  3WOF A;  2SOB A;  1I3Q B;  2F3V A;  3C1E A;  3D4W A;  2EZV A;  3H09 A;  2WKD A;  3KLS X;  5DAU A;  1A3V A;  4Y7N B;  3CU7 A;  3K59 A;  2VXW A;  5KNC A;  5DM7 3;  3NE5 B;  2I46 A;  5IGD A;  1AEX A;  2SNM A;  3DWP A;  3OSO A;  4TRD A;  2CHB D;  1Y8O B;  2BA1 A;  2PCF B;  1W6J A;  4H0L C;  4EGV A;  3HOW B;  1S4Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...