2B2YC

Tandem chromodomains of human chd1
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
86
structure length
86
Chain Sequence
EEFETIERFMDCRIGRKGATGATTTIYAVEADGDPNAGFEKNKEPGEIQYLIKWKGWSHIHNTWETEETLKQQNVRGMKKLDNYKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Peptide binding protein
molecule keywords Chromodomain-helicase-DNA-binding protein 1
publication title Double chromodomains cooperate to recognize the methylated histone H3 tail.
pubmed doi rcsb
source organism Homo sapiens
total genus 22
structure length 86
sequence length 86
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2005-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2b2yC00
2NWGA 4X3TA 2M2LA 2K28A 1WD1A 1SDFA 1DZ1A 1NR4A 2B2VA 2H1EA 3MWYW 1XX8A 1AZQA 1G6ZA 3TN2A 1VMPA 2K1BA 2L9HA 3QO2A 4NW2A 1HUNA 1CA5A 2B2YC 1HFGA 2FJ2A 5EKIA 1O7YA 5JJZA 2K01A 1J9OA 1HHVA 1EOTA 1KNEA 2J7ZA 5COYA 2B2TC 1B2TA 1SSOA 2HCIA 2HDLA 5CBAE 3N52A 1NAPA 2L12A 2FINB 1F2LA 2KVMA 2SDFA 1BO0A 1WD0A 1B50A 2EPBA 4R9WA 2B2WC 1RTNA 1B53A 2HUGA 2IL8A 2MGSA 5D14A 1HFNA 4IUUA 1RJTA 1KNAA 1O80A 1QNKA 3HP3A 3I91A 3KBXA 4ZLTF 1WTVA 1BF4A 3H91A 3I90A 3KUPA 2Q8RE 3UI2A 3FPUB 4O42A 3MTSA 5EPJA 3DEOA 2KOLA 1WTQA 1MI2A 1G2SA 4IUVA 4RAUC 1MSGA 2L4NA 1LV9A 1AP0A 1DONA 1SAPA 1DOMA 2JP1A 1EIHA 5CORA 5T1GA 1JE4A 1ICWA 2KEDA 4HCSA 5EQ0A 1EQTA 1GUWA 2KEEA 3G7LA 1IKMA 3P7JA 1TVXA 3Q6SA 2B2VC 3I8ZA 5T1IA 4R8IA 1BNZA 1J8IA 4IUTA 4RA8A 4IURA 2EOTA 1Q3LA 4HEDA 1IL8A 1DOLA 2FMMA 2RA4A 2B2UA 3R93A 1IKLA 2DY8A 4MHEA 4X3KA 1XYIA 1HA6A 1WVLA 1RODA 1RHPA 1WTXA 4IUPA 2B2TA 4QUFA 5E4XA 4HAEA 2N55A 1VMCA 1F9SA 5EJWA 1ESRA 1ML0D 4X3SA 2L1BA 1QG7A 1X3QA 2B2WA 4XDXA 4ZKBB 1QE6A 1WTOA 2RSOA 3F2UA 1X3PA 2X6GA 4MN3A 1NCVA 1ILPA 1S4ZA 2RSNA 3I3CA 1F9RA 3IFDA 3LWEA 4ZKCB 1HRJA 1PFNA 2FHTA 4CJ1B 5AFWA 2K04A 2R3ZA 1C8CA 2X6LA 3ONAB 5CMDA 1EL0A 5DNFA 1DOKA 2K03A 2NZ1D 3TZDA 2MPMA 1RTOA 1F9PA 1AZPA 2Q8TA 3GV3A 1HUMA 4CJ2C 1E0BA 2HCCA 3D6WA 4XT1B 2NYZD 2MJ8A 3GV6A 1B3AA 2K05A 2B2YA 1MSHA 2XIWA 2CVRA 1BBXC 4X3UA 1PDQA 1CM9A 5EPKA 1MGSA 1PFMA 2D9UA 1M8AA 3DEPA 2KECA 4DN4M 3FDTA 4HSVA 4CJ0B 1G2TA 4IUQA 4LMQD 2JYOA 1U4MA 1U4LA 1WTWA 5CBEE 4QUCA 4ZK9B 2L11A 1EIGA 1CA6A 2B2UC 1ILQA 1U4PA 1X32A 2HDMA 3IL8A 1U4RA 2BDNA 1PLFA 2MP1A 3DM1A 4U68A 1NR2A 1WTRA 2KUMA 2DY7A 2N88A 2X69A 1F9QA 1G91A 4ZAIA 2EE1A 4UAIA 4XT3B 1A15A 1ZXTA 4OIKA 5D65A 2FFKB 2RVLA 4OIJA 4RWSC 1B4OA 1WTPA 1PFBA 2VXWA 1O7ZA 5E4WC 1JICA 5EPLA 3SVMA
chains in the Genus database with same CATH superfamily
2Z4HA 4R4CA 2Y0SB 1PH8A 3I4NG 3PO2G 2K52A 3DM3A 3MWYW 2GVAA 3D4WA 1PZID 2VUMG 1X9NA 1F77A 1EU4A 4C3IB 1Q1EA 1K8MA 2WFWA 2B2TC 2UXDL 1K3RA 1SYCA 4H7BA 2SDFA 3ZJYC 2PI2E 4JVZA 2VQEL 1B53A 1CFMA 4POGA 1O80A 2F0IA 4RCOA 2NVYH 1BXTA 1UUPA 4ZCKA 4OX9Q 4U673 5EPJA 1F2YA 2MQHA 4PZ6A 4KJOA 5I2YA 1JWMD 2F0PA 1V1PA 5T1GA 4EQPA 4LFAQ 1GUWA 3P7JA 3KF6B 5K36G 3C1EA 5LL6S 4CKEA 4R8IA 2SNMA 3PIP3 1J8IA 3QOJA 4JI8L 1TR5A 4C3JG 1WYDA 1Q3LA 3CCMA 2FMMA 2B2UA 3IRBA 1GD7A 1KDBA 4YHHQ 4CDFC 4LFCL 3KLWA 1Z6HA 1HNZL 1EY8A 5EJWA 2ICIA 1VQPA 2B8FA 3G6JB 1VQMA 1ILPA 4IFDJ 2JA5G 2R93B 4DV7L 4K2KA 4JYAQ 4ID6A 4TSSA 3TP8A 4PZ8A 1HUMA 2WAQG 2AQ2B 1WTHA 3D6CA 3LNNA 2DJGC 2EYHA 5IYCG 2NZOA 1SE2A 4DV5L 3HGBA 1I4XA 3PQIA 2JA9A 3WOEA 1UWVA 3PIOA 4LF9L 4ZRZA 3I4LA 4G57A 4NKLA 4AQYQ 4HSPA 2ATWA 3UDXA 1KLUD 3KLSA 1VQAA 4BS9A 1B7YB 2E2JB 1I3QB 1YNJC 2F0QA 1PH2A 4OWXB 4FXGC 2VNUD 1TWFH 2X69A 3KYHC 4DFAA 1RCVD 5IGFA 3A56A 3TQYA 2FFKB 5DLQE 2E5LL 2RCNA 1EY4A 3G48A 4A3FH 1I4GA 2WV6D 5IGCA 1XX8A 3HKZB 4V0BA 2ICEC 5ELCA 2YU9B 1G6ZA 1D5XC 1A8VA 2Z9HA 2J7ZA 1V9PA 4ILWA 3S17H 1QB5D 4CDEC 1MHWC 1ZYRD 1QNUA 3CXCA 1T5EA 3J7YW 1EYDA 4LF7L 5C4ZA 5KRUA 3AFQA 3MC0B 3TBIB 3K8AA 2NUCA 3DEOA 1PTOH 5JJKA 3F2DA 1MSGA 1UE1A 1KRSA 5IYDH 5CV8A 1TY0A 3VYTA 4IFDI 2LY7A 4IPGA 3S2HH 3A8KE 4IZ8A 3CCSA 1IKMA 2UUAL 1W6KA 3HOYH 1I4HA 3K6OA 3I4MH 1LO5D 3FHWA 1OTCA 1SFOH 3OMGA 3HOWG 1D6EC 4BY1H 1IBKL 5CC4A 2A73B 2A68D 5AJ3L 1MD2D 4ZUIA 3HOUB 1JJ2A 2HT1A 4JCVE 1N34L 3UE1A 5KYLA 2IY5B 1YZ6A 4IJHA 2BA0A 1A3VA 2P5ZX 1C0AA 3GQBA 2SEBD 1K83H 2PCFB 1LT3D 4KMUC 1NCVA 2FXQA 5D3IB 1IBLQ 3PIO3 2A6HD 2EDGA 2R3ZA 1SMYC 2KCMA 1B9MA 2XNAC 2DGYA 5GAGC 1GO3E 4A3IB 2MJ8A 1A63A 2K05A 2PQEA 1MSHA 3CKIB 1G8ZD 1A62A 1Y1VG 1SNPA 4DUZQ 4PV1C 1O78A 1I6HH 2IJ0A 3SXHA 3TEHB 4JI3Q 3ZYYX 3HG9A 1STGA 1SN8A 2A6EC 2OEOA 1D2BA 3FKIG 4HCEA 4BBRG 2KUMA 4IUNA 5IGEA 5KNCA 1Q81C 2N3SA 3J81E 4OX9L 3GP7A 3KK7A 2NVTB 3TS2A 1V1PB 4ZYSA 2RVLA 1X3FA 1EY5A 5J3BA 2CW0C 2NWGA 4QIWB 3CPWA 2F0FA 2H1EA 4ME3A 3PO2H 5JPMC 4HIDA 2K75A 2L9HA 3TDQA 1CA5A 3S2DH 1HFGA 5HURA 1J5EQ 4A3EG 5JJZA 2VUMH 3KF8A 4UP8A 4HJ8A 3VYRA 1BUVT 2EYFA 4EQOA 3S1RB 1KRTA 3QIAA 4JI0Q 2HDLA 3BVMA 4DK1A 4FP5D 4RKLA 5E3FA 2YV5A 1SYGA 2HUGA 3QB3A 2Z8LA 3H91A 3NK9A 1LT4D 4JYAL 3DXJC 4CGYB 5IYBG 4JG2A 3EBEA 1EIHA 2EY1A 4KHPQ 1XNQQ 1VF7A 4LUZA 1L0XB 4EVOA 4HR7B 5K36H 1YIJA 5E4WC 4AQYL 3H3VC 4Y7NH 2EOTA 1RKNA 3FRPB 3SE0A 3R93A 2OT2A 5I6YA 1WTXA 1KTKA 4LF4Q 1ESRA 5C4XG 2KBNA 1SXTA 4KTAA 3JAME 1YNND 2XN9C 1OXSC 3HOVG 3J7AV 3RZDB 4BY7H 2UXBQ 2RHQB 5FLXc 4LF8Q 5KEEA 3M4OB 5M5WH 2KJXA 3SGIA 2RCFA 5IYCH 4CKBA 2YYZA 3FP9A 1EU3A 1M8AA 3UDFA 1Q86C 2BOSA 3FDTA 4OXPA 2EYOA 5FO8B 4IPCA 2RDGA 4DF7A 5CBEE 5H1SE 3BS1A 4RGNA 4KY6A 4A3KG 1SNOA 2F0KA 1CZGA 2K50A 1HTPA 1VQ4A 2MP1A 2CFMA 2VL6A 3DM1A 1L0WA 1P16A 3J7AF 1VQOA 3K7AH 3GTLB 4PZ7A 2F4IA 1ZXTA 2ZTDA 1TWCH 4RWSC 3TS0A 5IP9G 4ULLA 1X55A 1KDCA 3NEMA 3NP8A 3RNUA 5F2DA 4XQNA 1YI2A 2EY6A 3UDIA 3J80c 3GTGB 1JB7A 2A69D 3GDEA 3H0GB 1LTRD 2KCCA 4QQBX 4QL5A 1HHVA 1KNEA 3AB9A 3TSSA 2IPKD 4P2CB 1B2TA 2HCIA 2JA6B 3VR5A 2PQAA 2ES2A 2EPBA 4PMCA 2B2WC 3TP6A 4BXXH 3P75A 1XJVA 1IBLL 4KHZA 3I90A 3VYUA 3J81L 3A5UA 2UUCQ 4GLXA 4LF5Q 1HTLD 1HZCA 2JJQA 2K32A 4HIKA 3AYHB 3E9HA 2ZJQA 5D3DA 1PH3A 3NSWA 4UY8C 1SEBD 1NNXA 4H02A 3G7LA 4DUZL 3DWQA 4IUTA 4RA8A 1HNWQ 4YWKA 4ZQ3A 4JI3L 2WB1B 1HR0W 3DHQA 3HOWH 2EYJA 4R1JA 1HXYD 2RKSA 3ND8A 4Z9CB 3J81j 1S40A 1H9JA 5DM63 3W3AA 1YJ9A 1Y8NB 3CCQA 4GOPC 2RSNA 2MO0A 2K5WA 4C3HG 4FF3A 2CWPA 4X6AH 2TMPA 1FD7D 4DAPA 1QILA 4GNXA 2K03A 1GHJA 5DEHA 1JWUD 1IXRA 2Q8TA 3J7ZC 3KF8B 2HCCA 1J5EL 2QGQA 4QB4A 1GUGA 4GS3A 4JI0L 5CV7A 3I7FA 3STBD 3PMFA 2R92G 1CK1A 4OWTB 4DPGA 2L11A 4UDUC 2B2UC 1ILQA 1BOSA 3PSIA 2ZTCA 1WFQA 3S1MH 3T4AC 4C2MH 2F52A 1NR2A 2L15A 2F0HA 3FKIH 4A3FB 4RHSA 1E2VA 3Q8DA 1QWYA 5JJLA 4ZAIA 4DR7Q 2N78A 3EVQA 1D1IA 2BE5D 4DV4Q 2F0LA 4ODGA 3JAML 2QDLA 1GUOA 4A3GH 1E24A 4KHPL 3NBHA 1STYA 3S1NH 1AH9A 1JWSD 3M3YB 2NVXH 1K0SA 4JI4Q 1NR4A 2B2VA 5J1ZA 1B1ZA 1AZQA 1VQDA 3PV0A 1T9HA 2WAQE 2E2HH 5EKIA 1FNUA 2AUKA 4A3EH 1MJEA 5JAVA 4A93G 1I5FA 5CBAE 4LF4L 5EAYA 1HQMC 1PTOB 1C9OA 4P71A 4WJWA 5BR8Q 5JEAG 3ND9A 4IUUA 4R4QA 1DGSA 1SE4A 1U0LA 1IBMQ 4H13C 5M3FH 4H44C 3BDCA 3HOYB 2UXBL 3I4MB 1TS4A 3CQZH 4K2LA 5IYBH 4LF8L 1SAPA 2EY5A 2VB3X 1KL9A 1VF5C 4NMZA 1NJIC 1XTDA 3QR8A 2AWNA 4AYBB 3HS0C 1QUQA 1GKHA 4HEDA 3NQTA 1K83B 2A5HA 5FO7B 1ZKOA 4QUFA 4DAVA 5CYUA 4MNOA 1X6OA 2WP8J 1VMCA 4K8JA 1S72A 2K5QA 1Q82C 3E0EA 5C4XH 4F7XA 2MUYA 5IGBA 3OHXC 1ZYRC 2RDFA 2O5JC 1TS5A 2ALYB 2H5XA 3K5LA 2K6AA 1DD2A 4A75A 1TWHH 3GTKH 2B3GA 4BY1G 1N8RC 4NB3A 5HGQA 3PO3H 2PQAB 3L0OA 4LMQD 4GN3B 4GKJQ 4X66L 1TWGH 3E0JA 5KYIA 1LT6D 2L0CA 3CRKC 4ZK9B 2GN5A 1CA6A 4K5XA 4A3KH 1U4RA 2F0JA 4XQQA 1VQNA 3BJUA 1E1OA 4LF5L 4XTCS 1Y14B 1ASZA 3A7AB 3BVZA 3C46A 1ENAA 3RD4A 3PO2B 3I4NB 4N8FA 5D65A 2KQ3A 2VZAA 3GO5A 5IT9E 3L3OC 2A68C 5EPLA 4YY3Q 1C4QA 2K28A 1SDFA 1HNWL 2JE6I 3MFGA 4H0LC 3TN2A 1VQ6A 1PYSB 3QO2A 1IW7D 1S5FD 3A8JE 2A6HC 3CAMA 1QZHA 3RZOB 1NSNS 3PGZA 5CR3A 3HOZG 3EA6A 4K8IA 4LW1A 3N52A 1STBA 2R6GA 4JI1Q 4IPDA 1H9KA 4R9WA 2ZJPA 2VW9A 3BG3A 3U9SA 4GNXB 1V8QA 3UI2A 3GTQH 4KD3A 4JOIA 3MXUA 1LV9A 2F0EA 3S24A 1AP0A 5M9OA 3T53B 4Y7NB 3QWNA 4C3JB 1D7QA 3EROA 2PI2A 1GUTA 2E2IH 4YWMA 1GXDC 4O2DA 5T1IA 1L1OA 2B29A 3OYYA 1PRTD 3HKSA 4JBMA 2QKIC 1B70B 1YNXA 4NXNL 5BN3A 1GJXA 5IIFA 3GTPH 2LKVA 2QW7A 1C7YA 4IPHA 2JA5B 5M5XH 4DR7L 1FR3A 1ML0D 3R2IA 2CCZA 2HHHQ 4DV4L 1X56A 2F0TA 4XDXA 1XMOQ 1I94Q 1LYLA 1PFSA 3NBHB 1FGUA 1SE3A 1S4ZA 3LWEA 1PFNA 4C3HH 4DAMA 5ELNA 2EJGC 3VR3A 2ID0A 4KK7A 1F9PA 1W6JA 1XNRQ 4CJ2C 2BA1A 3A74A 3EIVA 1BBXC 1PDQA 1MGSA 1HPCA 1JQYD 3U4ZA 3A54A 1VQ8A 2A19A 1YHQA 2JYOA 5JJIA 1W2BA 2N49A 3SEBA 5FLMG 3K7AB 2R92H 5BR8L 1L0YB 4KJNA 4K5VA 4LK1C 4DK6C 5IY0A 5FJ8G 4QF4A 3TZUA 1IBML 2F3VA 2N88A 1VQJA 4XQJA 1A3TA 4BY7G 2G5DA 1PTOC 3OW7A 3BZKA 4RMFA 3CRLC 2QCPX 1NMGA 4IJLA 4OIJA 1TKWB 3I72A 1RF2D 4FF2A 3K5OA 4LUOA 3AMUA 2Z4IA 4KV6A 5C44B 5IP7H 1QUQB 4RKBA 1VQGA 1X3GA 1H9MA 3OSOA 3V2TA 1YNNC 4HIOA 1UEBA 1G6PA 2R7ZG 1S5CD 1E7ZA 3MXNA 4MIUA 1HCZA 1STHA 2A74C 1PMRA 4A93H 3R8BA 1NAPA 2L12A 3O13A 1PYBA 1RTNA 1JOKA 5JEAH 1BF4A 1D1KA 4CHTB 5HGTA 1PH5A 2RF4A 1G2SA 4KHVA 4QJFA 2QDBA 1EUJA 4GLAC 5IT9L 2JP1A 2AQ3B 4AH6A 3HOWB 1BVSA 2C35B 2IT1A 3C3LA 4R4OA 5E1FA 2OWOA 4R8NA 1VQ7A 1JB3A 4BXXG 2R93G 3SK5A 1IKLA 3GTOB 2EZVA 1RODA 2K4KA 3A55A 4IUPA 1FYCA 2RBMA 5JVH3 4DV1Q 1GM5A 4LJZC 1VQ9A 4JPBW 3WOFA 2A69C 3L9AX 2UUBL 3MVVA 4NP5A 3PUWA 1EY6A 1Y8PB 2HQLA 4YY3L 3K7UC 4X62Q 4Y52H 2X6LA 1Y1VB 3ITPA 3OIPA 4DV6L 3Q23A 1EOVA 4C56C 5C6AA 4WJ4A 5CGKA 4DR4Q 1Y69U 2CVRA 4B3TQ 3E6ZX 2A8VA 1PFMA 3RR5A 3DEPA 3K0YA 2XGTA 2ZM6Q 2ZTEA 4BBRB 4L5QA 5A2QL 1LT5D 4JI1L 5ELEA 4UP9A 1LUZA 1WTWA 3PUVA 1TT2A 3HFZB 1H95A 1A2UA 1UE5A 4LWCA 2B63H 1EYCA 3B6YA 4DR6Q 2OQ0A 2NVXB 3H6MA 3V96A 1HZ9A 2TSSA 2WINB 4P73A 4JI5Q 2VXWA 2UU9Q 2E2HB 4A3EB 5GADC 4GNXC 1L1OB 2VB2X 3P1HA 3S16H 1BDOA 3HEJA 1EEFD 5M5YH 4JI7Q 2MO1A 4ABNA 3KJPA 1CKMA 3CCEA 1EOTA 1FJGQ 1PRTB 3HOZH 4HJ7A 2ZXOA 3KLRA 2KVMA 1X65A 2HHHL 4JC0A 1I94L 3NE5B 1TQOA 3CQZB 4UHVA 1F2ZA 2IL8A 1HFNA 4ZLTF 4A3GG 3QOLA 1SNDA 3K81C 3T13A 3K5MA 4BBSG 3PUYA 3STBC 1NUCA 4LFAL 2Q2TA 5FK9C 5GQOA 1MKHA 1XNRL 4MZ9A 5KIXA 3S14H 3NPPA 3HOXH 1K8AC 5C4JH 1LTGD 5CORA 1E22A 2KEDA 3KOJA 4YHHL 4A3LH 3K5NA 2B2VC 1Q7YC 2AWOA 2BE5C 5C5MA 3D4DA 2XTIA 5C4XB 3CMEA 4X65Q 1HA6A 2R7FA 5M3FG 2B2TA 5I9OA 2XWBB 1F9SA 1SROA 1FNVA 1MBYA 3HOVB 1JORA 1EEID 1PTOF 1X3QA 2M9VA 2NN6G 5J22A 4RHRA 1KXLA 3DWPA 4MN3A 2LXKA 1D5MC 1KIXA 3I3CA 1QOHA 1F9RA 4XYQA 2EIFA 2BH2A 1M4VA 4FO2A 2JA8G 1NTGA 1QJOA 4PG3A 1DOKA 1RTOA 4A3JH 1L2FA 4OWWB 3MXNB 2B2YA 1PTOD 1CM9A 3ULJA 2HQEA 3GTJH 4DV2Q 1EYAA 1R9TH 4I65A 1J6QA 4M8AA 2LSSA 1B44D 2HIXA 5FLMH 3GTMH 3NHHA 3MXGA 3D31A 2AKWB 2NVQH 1KQSA 5FJ8H 4C1NI 4HN7A 4F88A 4IN3A 2OF1A 3H15A 5C3WA 4YCVA 1IL2A 1JE5A 4A3DB 4RGOS 2EE1A 3EJIA 2CQAA 3M4YA 4C3IH 3NELA 1V1QA 3IAYA 3UE0A 2WACA 3PO3G 1SYDA 3G4SA 1DZ1A 5I6WA 3X3MA 2JQOA 3W1GA 2JN4A 4WFN3 4DV3Q 2IX1A 5CV4A 2PMZE 4NXMQ 1RIPA 4HJAA 2R7ZH 1EQQA 1X54A 1K28A 4DV1L 1SE8A 1CSQA 2F0MA 3U50C 4OGQC 1LTBD 4F87A 1F2LA 1B50A 4K14A 3PCOB 3CCUA 2EXZA 4J6HA 2K7VA 2VY3A 2E76C 5GAHC 4DR5Q 4WRDA 2EYPA 1HA5A 3AU7A 3S1QH 4X62L 3FPUB 3AFPA 1K9MC 1EWHA 3ERQA 5LMNQ 1NBWA 3IKJA 2NN6I 5DM73 3D3RA 4DR4L 4B3TL 1JE4A 3OMCA 5TSSA 3GTPB 2NVYB 2ZM6L 4K5WA 2ENBA 1BCPF 3VA7A 5IOCA 3J7A5 3FVQA 4DR3Q 5M5XB 3J80i 2I0QA 5ELOA 1AW7A 1DOLA 4KN7C 2UXCQ 2DNCA 3OIQA 1QCBD 5EBCA 1N36Q 4X3KA 2R93H 1WVLA 1N9WA 1STNA 1EIFA 5E4XA 4QCLA 4C3HB 3H3VH 1SYEA 1IW7C 3R3OA 1BCPD 1Q12A 1V1OA 4O0AA 1YBYA 2OQKA 5JPNC 3NENA 2O2LD 1ET9A 2RSOA 3F8TA 3VYSA 1BR9A 2UU9L 4ZKCB 1CHPD 2ASBA 3ONAB 4FF4A 1TS3A 1M90C 3TZDA 2F0NA 2MPMA 1AZPA 1I3QH 2ZXRA 3PUZA 2R92B 4JI7L 4K0KQ 2MFIA 3PF4A 1FJGL 4P75A 1G2TA 1U5KA 1U4MA 2K14A 4B08A 4IO9A 3BYTB 3A0JA 3QG1A 3G6EA 4WJ3M 1GOZA 1PRTC 2H4OA 3NTIA 4E6IA 1S5BD 2YU9H 1JMCA 2IHFA 1BBUA 1A15A 2QILA 4RGTA 4EQ5A 1TWAH 2BDOA 3C2PA 3BVGA 1DJRD 2EQSA 2RHSB 1CUKA 4JBKA 1EZ6A 1ENFA 5ELBA 1PVOA 1JT8A 2XRSD 1WD1A 4MTNA 4L5RC 1TWFB 3CCLA 4A93B 3FEWX 4N9TA 3W2DA 1E2ZA 4X65L 4L5SA 2HD3A 2Q2HA 1PYWD 4KY5A 1OXVA 2RDHA 3DLLA 4TVAB 3D4RA 4A3MG 4ZUJA 1HNXQ 2MGSA 1EY9A 2EY2A 2YTYA 2PW5A 4BBSH 3MXPA 2Y0SE 4LF6Q 1LTSD 1XNQL 4O1NA 4O42A 5KGUA 5IP7G 3S17B 2WB1G 2DJFC 4TRDA 1Z7TA 4PMBA 4YCUA 1FGBD 1SRUA 1H9RA 5JOBA 1SBBB 5EQ0A 4DV0Q 2E74C 4DV2L 1BNZA 4FXKC 1B9NA 1I4QA 2CH4W 4JV5Q 1PH7A 1B8AA 1XYIA 4LNQA 4Q5VA 1KDAA 4G7HC 1EFWA 1VQCA 1HJPA 2JA7G 5JEAJ 2JK8A 1D8LA 3S2HB 3CU7A 3FPPA 4A3IH 1K8OA 1VQEA 1KAAA 1QG7A 4X64Q 4ZKBB 1QE6A 1WTOA 2NN6H 1SFOB 1U9RA 4BY1B 2PMZB 5AFWA 5ELDA 3VA5A 1O7LA 1CQVA 2NZ1D 1PH1A 2JA8H 4FXDA 1K0RA 4XT1B 5M3MG 3GV6A 3OWFA 1DCZA 1I6VC 4NXML 1RD9D 1VCIA 2D9UA 3NWTA 4P74A 3BU2A 4JI2Q 4XXEA 4DV7Q 4V190 4EX5A 5C0XH 2C5CA 1Q1BA 4TKOB 3Q24A 4K6DA 3CC7A 2OTLA 4QY7A 3IL8A 4B9WA 1XXGA 4DR5L 3A5ZB 4JI6Q 3RLOA 4G7ZC 2AMCB 4K6LA 1YITA 1QVCA 1FL0A 1X3EA 5LMNL 4M1UB 2PNHA 1I6HB 1E2WA 1WTPA 1XMQQ 2JSOA 4BWGB 4OHJA 3NWSA 1VQBA 5IE8A 3RMHA 2Z0SA 4OELB 4X3TA 3HOZB 4CBVA 4DR3L 2MHVA 3PF5A 2UXCL 3OPOA 1N36L 2B63G 1GVPA 5FLXL 1CHQD 2BCOA 2KA7A 3U4VA 3SK4A 5C3EG 2UUCL 1SLJA 2E75C 2KCNA 3GD7A 1I4RA 3S14B 5D14A 3K58A 1RJTA 3S2DB 1JOQA 4XYOA 2VUMB 1YJWA 1BCPB 2I46A 3KFUA 1AE2A 2VS1A 3HKZE 3W5OA 4RAUC 1XPOA 2L4NA 3S15H 1DOMA 4K0KL 2F0DA 1HZBA 2F0SA 5C5LA 4DK0A 1QZGA 1LACA 1N32Q 3WWVA 3ULLA 3MEFA 5LMUQ 4KY7A 4B3MQ 2BH8A 2EXDA 1YHBA 4QGUA 4R4IA 4L6TB 1IL8A 3J80L 2AUJD 4A4IA 1TY2A 4B3SQ 3CP0A 2NTSA 2UUAQ 2N55A 1PRTF 4LAAA 4Q0FA 3S9WA 2SOBA 1UEAB 1I50H 2B2WA 3AEVA 3HOXG 3M7GA 1XPUA 4WORA 1VDZA 1IBKQ 1TU2B 3CPFA 2XSCA 5AJ3Q 1WCMG 2EYMA 2XRQD 4DUYQ 4A3LG 3GTJB 4DA2A 5A2QE 1R9TB 3BZDB 1E0BA 1IYJB 1H9SA 2NVQB 1SNCA 3CHBD 3CCVA 4DR2Q 4AIMA 1EFID 3GTLH 1ENCA 4N9PA 2R61A 1M1KC 3CD6A 3T1HQ 1HNXL 4BA1I 4BY7B 1A0IA 2QEXA 2KENA 1KABA 2NZHA 1AN8A 5M5WB 4GN5A 2WAQB 1LLRD 3RLNA 4GKKQ 4LF6L 3GTGH 4HJ5A 4UAIA 1Y1WG 4JI4L 2E2DC 4IOAA 3H0GH 4A3JG 4GN4B 4DXGA 1N33Q 2YTXA 1UE7A 5I4DA 4GOPA 1QVGA 2O4XA 1O7ZA 1C48A 1JICA 2K5HA 4DV0L 4A3BG 3SVMA 1PV4A 2JA6H 2IX3A 2R7ZB 1KD1C 1YVCA 5I2XA 4CDDC 2PNRC 1VMPA 2B2YC 1EQVA 4JV5L 4QMGA 2V4DA 4R4TA 2IWHA 5A35A 1TWCB 4NPSA 4L8JA 5COYA 2Y0SG 3NXWA 3S1QB 1WOCA 5KNBA 2D5DA 4YIJA 5KNDA 3NTKA 4X64L 3CCJA 1R4PB 4C3IG 4A3MH 5IWAQ 1CZWA 3MA2B 1LTTD 2E8GA 2Q8RE 4QIWE 1RDPD 4KN4C 3DMUA 1DONA 4IFDG 4LFBQ 4N8X1 4G4KA 2QA4A 5ELFA 4JI2L 3I8ZA 3LGJA 2OXPA 1JOOA 1K3BC 1AE3A 1MJCA 2DY8A 4MHEA 2YTVA 4JI6L 4JBJA 1KAWA 5C3XA 1NE3A 2JA7H 2G9DA 3ULPA 4KD4A 2PZWA 3BDOA 2AQ1B 2D0PA 2PZTA 3TP5A 2PYKA 2X6GA 1JJCB 1XMQL 3EQLC 3LWUA 1FVIA 4HMIA 5CMDA 4GKJL 2I5LX 3NTHA 4KLKA 1BKBA 4HMJA 3DWAA 3K0XA 1B3AA 1DYQA 5M3MH 4B3RQ 3M85A 2C9OA 2K5VA 4HTHA 1DXMA 4J15A 1IHZA 1WJJA 4S3SA 3N6RA 5IODA 1ZEQX 2PZUA 3PUXA 3J81c 5ISRA 1TWAB 5C44G 3M3YH 2F0WA 4PQXA 3RUZA 1F9QA 4DXFA 4MTKA 4A3CH 3T1YQ 3J81i 1T5XD 4BA2I 1PH4A 1S3OA 1N32L 4DNIA 5LMUL 1AEXA 1HZAA 2CWAA 1YJNA 3S1MB 4B3ML 4L5TA 3URYA 4C2MB 1BCPC 4IOCA 3FKIB 3KDFA 1HR0Q 2DN8A 2A1AA 1LTLA 4B3SL 1EYGA 1STAA 4A3GB 3A7LA 4BBSB 4RCNA 3S1NB 3HKZG 1EQRA 5G3LF 5C3EH 3U58A 4J8QA 3OTOQ 4RFBA 1K73C 4DR1Q 3EN2A 3HP3A 4EQNA 2I5MX 1LTID 4RGMA 4DUYL 3L7ZC 2LFNA 1PHJA 4IUVA 2I5HA 4KI0A 4UP7A 5G3LD 2PPBC 3OOCA 4GZYC 1H9SB 3CC4A 2OTJA 4DU9A 4PMWA 4DR2L 3VR4A 5JVG3 5FO9B 5M3FB 1A3UA 3D8GA 3K57A 1BQQT 4YCWA 3T1HL 4XIGS 1A2TA 2K33A 5EKLA 1KHIA 3ICEA 1TXYA 1XMOL 3F2CA 2B39A 3SDZA 1VS0A 4GKKL 5IGGA 4HAEA 1QVFA 3H3VI 2J0TD 1EY0A 4F8MA 3JAMc 2JA8B 4GOPB 2Z6KA 3G71A 1GUSA 1N33L 3E9IA 3I56A 3HOUG 3SHLA 1HRJA 4FVMA 1ET6A 1C8CA 1WCMH 1PZKD 3JAMi 5C4HA 5DNFA 2F4VQ 1WI5A 2WB1E 3I73A 1EWCA 2Z6BA 2XWJB 1ONLA 2Q2IA 4GLVB 1TIID 1O7IA 1XWEA 2KECA 2CH4A 4IUQA 1ASYA 3HRZC 3I4NH 2F3IA 4A3IG 1MIUA 1G51A 4QUCA 2D62A 1XTCD 1YHAA 1Y8OB 1U4PA 1TWHB 3GTKB 1CQFA 1ICFB 2BDNA 5IWAL 4U68A 3T56B 2DY7A 1G91A 3PO3B 1S5ED 3I2ZA 1Y1WH 4LFBL 4OIKA 1TWGB 4OO1G 3RZOH 4A3KB 4A3BH 5C0XG 2HIVA 5J39A 3VDYA 5CV9A 5C0XJ 2DNEA 4NW2A 2K1BA 2SNSA 1E1TA 1J9OA 4KKSA 4DNTB 2GA4B 2K5NA 2VQFQ 3NUCA 4YWLA 1S5DD 3MEHA 3A8IE 2LMCB 4C3JH 1Q8IA 3I4OA 1EZ8A 3S15B 3MHBA 1WTVA 1KNAA 3KBXA 1QNKA 2RQXA 1SYFA 1OO9B 2I07B 3MFYA 5BN5A 4IFDH 4CDCC 3CMAA 2WIIB 4B3RL 2R7DA 1KC8C 1II3A 1EQTA 2ZJRA 2JA5H 2KEEA 1YNJD 2ZT9C 3U9OA 2PO4A 1W3SA 3CCRA 4IURA 3GTQB 1CKOA 4IALA 1I50B 3TMEA 1SYBA 1RL2A 1RHPA 5GROA 3SK8A 3L2PA 2E2IB 2CQOA 4IQZA 3T1YL 2L1BA 4C1NK 1JR0D 2OCEA 3Q0AA 4DGZA 5EGTA 4OONA 2F03A 3M7NA 3IFTA 4FYDA 1EY7A 1Z9FA 3DUZA 4J1MA 2FHTA 3JC66 3F2BA 3T51B 5DAUA 1SNQA 1GHKA 4AYBE 3KDFB 4HIMA 1BBWA 1V43A 2EVBA 3C1FA 1HR0L 1SMXA 4P72A 1OXXK 4OO1I 1HQRD 2CHBD 4X3UA 5EPKA 4A3DG 1E3PA 2EJMA 4DN4M 3X3NA 1SJHD 4HSVA 4DR6L 5C0XI 1PXUA 3OTOL 3H09A 3LX0A 1EIGA 4DR1L 1X32A 4JW0A 2HDMA 4NDXA 4JI5L 2JEBI 5C44H 3UDGA 2CKZB 4X66Q 4JOIC 4DK3C 4XT3B 3SK6A 3OW2A 2E2JH 4A76A 4POFA 2F0UA 3HZXA 2Z1CA 4PNYA 2KCTA 1G291 3I55A 2KHIA 3V05A 2M2LA 5FLXE 1K8GA 1B3QA 1PH9A 1TS2A 1L1OC 4OL7A 5IGDA 2FJ2A 4A3MB 1O7YA 2K01A 5LL6X 2L5TA 1HH2P 3AQQA 5EKKA 5CV6A 2FINB 3NBIA 3H0GG 2EJFC 1XPRA 1SMYD 1R4QB 1CKNA 3T16A 1JCKB 3I91A 3OWEB 1CTMA 3CF5A 2JA6G 2F0VA 3KUPA 2NB0A 5LHY1 1WTQA 2F4VL 3GTOH 1IYVA 4DAYA 1ICWA 2FMCA 4HCSA 4DKAC 2A6ED 3J80E 1GUNA 2LXJA 3M9BA 3Q6SA 1Q90A 4KKUA 4LUVA 2JA7B 2LS01 2EYLA 1JC7A 2XVSA 2IW3A 1Y1VH 2CW0D 2UXDQ 1ESFA 1UE6A 4X3SA 1EWIA 1Q46A 2IHEA 4NXNQ 4FF1A 3ER0A 2VQEQ 3F2UA 3H94A 4BBRH 3IFDA 1OXTA 5M3MB 3HOUH 1VQ5A 2K04A 1UNSA 5E7NA 2K5DA 3GV3A 2D0OA 1VQKA 2M00A 3D6WA 2NYZD 3TP7A 2XIWA 2IX0A 2VQFL 4JK1C 2F0OA 4CJ0B 4L63B 4ALPA 2Q2UA 5CV5A 5FKAC 3KF6A 3RN2A 4JI8Q 2KHJA 2O5IC 3W1BA 1P8LA 3KJOA 1PLFA 4I7ZC 1WTRA 1PZJD 4LFCQ 4FDBA 4DNRB 1HNZQ 5IT9c 3TRZA 3TREA 1NY4A 2PW7A 5L37A 1B4OA 4OO1H 4DV3L 3CW2C 5BN4A 4A3FG 1I4PA 4I7AA 2B63B 1LM0A 1CI3M 3RLFA 5C3EB 2NVTH 1YEZA 3MAQA 2NBFA 1HUNA 2J4XA 3K59A 2L55A 3WDNA 4DV5Q 2JEAI 1OXUA 3EFXD 1SSOA 3RN5A 4LF9Q 1IZ6A 2WKCA 4A3CG 3K80C 3S16B 1BO0A 1WD0A 2F3WA 3E5SA 5HY6A 1Q8KA 5M5YB 3S1RH 3BZCA 4ME5A 3MZ5A 1VQFA 4RH6A 3MTSA 2KOLA 4OEMB 3F1ZA 1MI2A 2V1CC 5EBDA 5IYDG 1F2MA 3M4PA 3NQIA 3SR1A 1AFPA 2E5LQ 1JJGA 3I70A 3HOYG 3I4MG 5I9PA 3HOVH 1TVXA 2QF7A 3VR6A 3P20A 5NUCA 3VR2A 1STEA 3Q22A 2RA4A 3HOXB 3ERSX 5C4JB 1KLGD 3E3XA 1IYUA 1CSPA 1EIYB 4AYBG 1WCMB 4G7OC 3KLSX 1VQHA 1LABA 3PIPA 4LF7Q 1X3PA 2F0GA 1SJED 4B9XA 4TQUS 2G9HD 1D5ZC 2N8NA 4CJ1B 3KBGA 1SNMA 1EL0A 3R2TA 3D0FA 1NMFA 2UUBQ 1CT1D 1PA6A 2DUDA 1FNWA 1LTAD 4EGVA 5LMNW 3CC2A 2JXMB 2Q8IB 5IP9H 3QJYA 2MNAA 4A3DH 4UPAA 1VQIA 3RZDH 4DV6Q 1U4LA 5FOBB 2F1MA 3M4OH 1CKNB 2KHSA 4CKCA 4KKTA 5GAEC 1Y1WB 2AHOB 3M4QA 4A3JB 2QEJC 2B8GA 4RG1A 4JBWA 1VQLA 1UAPA 1A6XA 4HJ9A 4A3BB 3FMCA 1N34Q 2WKDA 4FNFA 1Z47A 2GVBA 2NTTA 2Z6KC 3BDLA 1PH6A 3BYYB 2ZXPA 4APVA 4DAYB 3GTMB 5K5PA 1PFBA 1SR3A 2D2CC 1DM0B
chains in the Genus database with same CATH topology
2Z4HA 2Y0SB 3MWYW 3D4WA 1PZID 1F77A 1EU4A 4C3IB 1Q1EA 1K8MA 2B2TC 1SYCA 4H7BA 2SDFA 1B53A 1CFMA 1O80A 2F0IA 4RCOA 1BXTA 1UUPA 4U673 5EPJA 1F2YA 4KJOA 5I2YA 1JWMD 2F0PA 1V1PA 5T1GA 4EQPA 1GUWA 3P7JA 5K36G 3C1EA 5LL6S 4CKEA 4R8IA 2SNMA 3PIP3 1J8IA 3QOJA 1TR5A 4C3JG 1Q3LA 2FMMA 2B2UA 1KDBA 1Z6HA 1EY8A 5EJWA 2ICIA 2B8FA 3G6JB 1ILPA 4IFDJ 2R93B 4K2KA 4ID6A 4TSSA 3TP8A 1HUMA 2AQ2B 3D6CA 3LNNA 2EYHA 1SE2A 3HGBA 1I4XA 3WOEA 4ZRZA 3I4LA 4G57A 4NKLA 4HSPA 1KLUD 3KLSA 4BS9A 2E2JB 1I3QB 1YNJC 2F0QA 4FXGC 2VNUD 2X69A 4DFAA 1RCVD 5IGFA 3A56A 2FFKB 1EY4A 1I4GA 2WV6D 5IGCA 1XX8A 3HKZB 4V0BA 2ICEC 5ELCA 2YU9B 1G6ZA 1D5XC 2J7ZA 4ILWA 1QB5D 1ZYRD 1QNUA 1T5EA 3J7YW 1EYDA 5C4ZA 5KRUA 3MC0B 3TBIB 2NUCA 3DEOA 1PTOH 1MSGA 5CV8A 1TY0A 3VYTA 4IFDI 2LY7A 3A8KE 4IZ8A 1IKMA 1W6KA 1I4HA 3K6OA 1LO5D 3OMGA 1D6EC 5CC4A 2A73B 2A68D 1MD2D 4ZUIA 3HOUB 5KYLA 2BA0A 1A3VA 3GQBA 2SEBD 2PCFB 1LT3D 4KMUC 1NCVA 5D3IB 3PIO3 2A6HD 2EDGA 2R3ZA 1SMYC 1B9MA 2XNAC 4A3IB 2MJ8A 2K05A 2PQEA 1MSHA 3CKIB 1G8ZD 1SNPA 4PV1C 1O78A 2IJ0A 3SXHA 3ZYYX 3HG9A 1STGA 2A6EC 2OEOA 1D2BA 4HCEA 2KUMA 4IUNA 5IGEA 5KNCA 3J81E 3GP7A 3KK7A 2NVTB 1V1PB 4ZYSA 2RVLA 1EY5A 2CW0C 2NWGA 4QIWB 2F0FA 2H1EA 5JPMC 2L9HA 3TDQA 1CA5A 1HFGA 5HURA 5JJZA 3KF8A 3VYRA 1BUVT 2EYFA 4EQOA 3S1RB 3QIAA 2HDLA 3BVMA 4DK1A 4FP5D 4RKLA 5E3FA 1SYGA 2HUGA 3QB3A 2Z8LA 3H91A 3NK9A 1LT4D 3DXJC 4CGYB 1EIHA 2EY1A 1VF7A 1L0XB 4EVOA 4HR7B 5K36H 3H3VC 2EOTA 1RKNA 3FRPB 3SE0A 3R93A 2OT2A 5I6YA 1WTXA 1KTKA 1ESRA 1SXTA 4KTAA 3JAME 1YNND 2XN9C 1OXSC 3J7AV 3RZDB 3M4OB 5KEEA 2KJXA 4CKBA 2YYZA 1EU3A 1M8AA 2BOSA 3FDTA 2EYOA 5FO8B 2RDGA 4DF7A 5CBEE 3BS1A 4RGNA 4KY6A 1SNOA 2F0KA 1CZGA 1HTPA 2MP1A 3DM1A 3J7AF 3GTLB 2F4IA 1ZXTA 4RWSC 4ULLA 1KDCA 3NP8A 5F2DA 4XQNA 2EY6A 3GTGB 2A69D 3H0GB 1LTRD 2KCCA 1HHVA 1KNEA 3AB9A 3TSSA 2IPKD 4P2CB 1B2TA 2HCIA 2JA6B 3VR5A 2EPBA 4PMCA 2B2WC 3TP6A 3P75A 4KHZA 3I90A 3VYUA 3J81L 1HTLD 2K32A 5D3DA 3NSWA 1SEBD 3G7LA 3DWQA 4IUTA 4RA8A 4ZQ3A 2WB1B 3DHQA 2EYJA 1HXYD 2RKSA 3ND8A 4Z9CB 1H9JA 5DM63 3W3AA 1Y8NB 2K5WA 4C3HG 2RSNA 4FF3A 2TMPA 1FD7D 4DAPA 1QILA 2K03A 1GHJA 5DEHA 1JWUD 2Q8TA 2HCCA 4QB4A 1GUGA 5CV7A 3PMFA 1CK1A 2L11A 4UDUC 2B2UC 1ILQA 1BOSA 3T4AC 1NR2A 2F0HA 4A3FB 4RHSA 1E2VA 1QWYA 4ZAIA 3EVQA 1D1IA 2BE5D 2F0LA 4ODGA 3JAML 1GUOA 3NBHA 1STYA 1JWSD 3M3YB 1NR4A 2B2VA 5J1ZA 1B1ZA 1AZQA 3PV0A 5EKIA 1FNUA 2AUKA 5JAVA 5CBAE 1HQMC 1PTOB 4WJWA 5JEAG 3ND9A 4IUUA 1SE4A 4H13C 4H44C 3BDCA 3HOYB 3I4MB 1TS4A 4K2LA 1SAPA 2EY5A 2VB3X 1VF5C 4NMZA 2AWNA 4AYBB 3HS0C 4HEDA 3NQTA 1K83B 2A5HA 5FO7B 1ZKOA 4QUFA 4DAVA 5CYUA 2WP8J 1VMCA 4K8JA 2K5QA 4F7XA 2MUYA 5IGBA 3OHXC 1ZYRC 2RDFA 2O5JC 1TS5A 3K5LA 2K6AA 1DD2A 4LMQD 3E0JA 5KYIA 1LT6D 2L0CA 3CRKC 4ZK9B 1CA6A 4K5XA 1U4RA 2F0JA 4XQQA 4XTCS 3A7AB 3BVZA 3C46A 1ENAA 3RD4A 3PO2B 3I4NB 5D65A 2KQ3A 3GO5A 5IT9E 3L3OC 2A68C 5EPLA 1C4QA 2K28A 1SDFA 2JE6I 3MFGA 4H0LC 3TN2A 3QO2A 1IW7D 1S5FD 3A8JE 2A6HC 3RZOB 1NSNS 5CR3A 3EA6A 4K8IA 3N52A 1STBA 2R6GA 1H9KA 4R9WA 3BG3A 3U9SA 1V8QA 3UI2A 4KD3A 3MXUA 1LV9A 2F0EA 1AP0A 5M9OA 3T53B 4Y7NB 3QWNA 4C3JB 3EROA 1GUTA 1GXDC 5T1IA 1PRTD 2QKIC 5BN3A 1GJXA 5IIFA 2LKVA 2JA5B 1FR3A 1ML0D 3R2IA 2F0TA 4XDXA 1SE3A 1S4ZA 3LWEA 1PFNA 2EJGC 3VR3A 2ID0A 4KK7A 1F9PA 1W6JA 4CJ2C 2BA1A 1BBXC 1PDQA 1MGSA 1HPCA 1JQYD 3A54A 2JYOA 3SEBA 3K7AB 1L0YB 4KJNA 4K5VA 4LK1C 4QF4A 3TZUA 2F3VA 2N88A 4XQJA 1A3TA 1PTOC 3OW7A 3CRLC 2QCPX 4OIJA 1TKWB 3I72A 1RF2D 4FF2A 3K5OA 3AMUA 2Z4IA 4KV6A 5C44B 4RKBA 1H9MA 3OSOA 3V2TA 1YNNC 1S5CD 3MXNA 4MIUA 1HCZA 1STHA 2A74C 1PMRA 3R8BA 1NAPA 2L12A 3O13A 1RTNA 1JOKA 5JEAH 1BF4A 1D1KA 4CHTB 5HGTA 1G2SA 4KHVA 2QDBA 5IT9L 2JP1A 2AQ3B 3HOWB 2IT1A 3C3LA 5E1FA 4R8NA 1JB3A 3SK5A 1IKLA 3GTOB 2EZVA 1RODA 3A55A 4IUPA 1FYCA 2RBMA 5JVH3 4LJZC 3WOFA 2A69C 3L9AX 3MVVA 4NP5A 3PUWA 1EY6A 1Y8PB 2X6LA 1Y1VB 3ITPA 3OIPA 3Q23A 4C56C 5C6AA 5CGKA 1Y69U 2CVRA 3E6ZX 1PFMA 3DEPA 3K0YA 4BBRB 5A2QL 1LT5D 5ELEA 1WTWA 3PUVA 1TT2A 1A2UA 1EYCA 2NVXB 3H6MA 3V96A 2TSSA 2WINB 2VXWA 2E2HB 4A3EB 2VB2X 3P1HA 1BDOA 3HEJA 1EEFD 4ABNA 1EOTA 1PRTB 2ZXOA 3KLRA 2KVMA 3NE5B 1TQOA 3CQZB 1F2ZA 2IL8A 1HFNA 4ZLTF 3QOLA 1SNDA 3T13A 3K5MA 3PUYA 1NUCA 5FK9C 5KIXA 3NPPA 1LTGD 5CORA 2KEDA 3K5NA 2B2VC 2AWOA 2BE5C 5C5MA 3D4DA 5C4XB 1HA6A 2B2TA 5I9OA 2XWBB 1F9SA 1FNVA 1MBYA 3HOVB 1JORA 1EEID 1PTOF 1X3QA 2M9VA 2NN6G 5J22A 4RHRA 3DWPA 4MN3A 1D5MC 3I3CA 4XYQA 1QOHA 1F9RA 1M4VA 4FO2A 1QJOA 1DOKA 1RTOA 2B2YA 1PTOD 1CM9A 2HQEA 1EYAA 4I65A 4M8AA 1B44D 3NHHA 3MXGA 3D31A 4C1NI 4HN7A 4F88A 4IN3A 2OF1A 5C3WA 4A3DB 4RGOS 2EE1A 3EJIA 2CQAA 3M4YA 3IAYA 2WACA 1SYDA 1DZ1A 5I6WA 3X3MA 4WFN3 2IX1A 5CV4A 2F0MA 4OGQC 1LTBD 4F87A 1F2LA 1B50A 4K14A 2EXZA 4J6HA 2K7VA 2E76C 4WRDA 2EYPA 1HA5A 3AU7A 3FPUB 1EWHA 3ERQA 3IKJA 2NN6I 5DM73 3D3RA 1JE4A 3OMCA 5TSSA 3GTPB 2NVYB 4K5WA 2ENBA 1BCPF 3VA7A 5IOCA 3FVQA 5M5XB 1AW7A 1DOLA 4KN7C 2DNCA 3OIQA 1QCBD 5EBCA 4X3KA 1WVLA 1STNA 5E4XA 4QCLA 4C3HB 1SYEA 1IW7C 3R3OA 1BCPD 1Q12A 1V1OA 5JPNC 2O2LD 1ET9A 2RSOA 3VYSA 1BR9A 4ZKCB 1CHPD 3ONAB 4FF4A 1TS3A 3TZDA 2F0NA 2MPMA 1AZPA 2ZXRA 3PUZA 2R92B 1G2TA 1U4MA 4B08A 3BYTB 3QG1A 1GOZA 1PRTC 2H4OA 3NTIA 4E6IA 1S5BD 1A15A 2QILA 4RGTA 2BDOA 3C2PA 3BVGA 1DJRD 1EZ6A 1ENFA 5ELBA 2XRSD 1WD1A 1TWFB 4A93B 3FEWX 4N9TA 3W2DA 1E2ZA 1PYWD 4KY5A 1OXVA 2RDHA 3D4RA 4ZUJA 2MGSA 1EY9A 2EY2A 2PW5A 3MXPA 1LTSD 4O1NA 4O42A 5KGUA 3S17B 4TRDA 1Z7TA 4PMBA 1FGBD 1H9RA 5JOBA 1SBBB 5EQ0A 2E74C 1BNZA 4FXKC 1B9NA 1I4QA 1XYIA 4Q5VA 1KDAA 4G7HC 5JEAJ 3S2HB 3CU7A 3FPPA 1K8OA 1KAAA 1QG7A 4ZKBB 1QE6A 1WTOA 2NN6H 1SFOB 1U9RA 4BY1B 2PMZB 5AFWA 5ELDA 3VA5A 1O7LA 1CQVA 2NZ1D 4FXDA 4XT1B 3GV6A 3OWFA 1DCZA 1I6VC 1RD9D 1VCIA 2D9UA 3NWTA 4XXEA 4V190 5C0XH 2C5CA 1Q1BA 4TKOB 3Q24A 4K6DA 4B9WA 3IL8A 1XXGA 4G7ZC 4K6LA 4M1UB 1I6HB 1E2WA 1WTPA 2JSOA 4BWGB 4OHJA 3NWSA 3RMHA 4X3TA 3HOZB 4CBVA 2MHVA 3OPOA 5FLXL 1CHQD 2BCOA 2KA7A 3SK4A 2E75C 2KCNA 3GD7A 1I4RA 3S14B 5D14A 3K58A 1RJTA 3S2DB 1JOQA 4XYOA 2VUMB 1BCPB 2I46A 4RAUC 2L4NA 1DOMA 2F0DA 2F0SA 4DK0A 5C5LA 1LACA 4KY7A 4L6TB 1IL8A 3J80L 2AUJD 1TY2A 2NTSA 2N55A 1PRTF 4LAAA 4Q0FA 3S9WA 2SOBA 1UEAB 2B2WA 3M7GA 4WORA 1VDZA 1TU2B 2XSCA 2EYMA 2XRQD 3GTJB 4DA2A 5A2QE 1R9TB 3BZDB 1E0BA 1H9SA 2NVQB 1SNCA 3CHBD 1EFID 1ENCA 4N9PA 2R61A 4BA1I 4BY7B 1KABA 1AN8A 5M5WB 2WAQB 1LLRD 4UAIA 2E2DC 4DXGA 5I4DA 2O4XA 1O7ZA 1C48A 1JICA 3SVMA 2IX3A 2R7ZB 5I2XA 2PNRC 1VMPA 2B2YC 1EQVA 4QMGA 2V4DA 2IWHA 5A35A 1TWCB 4L8JA 5COYA 3NXWA 3S1QB 5KNBA 2D5DA 4YIJA 5KNDA 3NTKA 1R4PB 4C3IG 1CZWA 3MA2B 1LTTD 2Q8RE 1RDPD 4KN4C 3DMUA 1DONA 4IFDG 4G4KA 5ELFA 3I8ZA 2OXPA 1JOOA 2DY8A 4MHEA 5C3XA 2G9DA 4KD4A 2PZWA 3BDOA 2AQ1B 2PZTA 3TP5A 2PYKA 2X6GA 3EQLC 3LWUA 4HMIA 5CMDA 3NTHA 4HMJA 3DWAA 1B3AA 1DYQA 3M85A 2C9OA 4HTHA 1DXMA 1IHZA 4S3SA 3N6RA 5IODA 1ZEQX 2PZUA 3PUXA 5ISRA 1TWAB 2F0WA 4PQXA 3RUZA 1F9QA 4DXFA 1T5XD 4BA2I 1AEXA 3S1MB 4C2MB 3URYA 1BCPC 3FKIB 2DN8A 1STAA 4A3GB 3A7LA 4BBSB 4RCNA 3S1NB 5G3LF 4J8QA 4RFBA 3HP3A 4EQNA 1LTID 4RGMA 3L7ZC 2LFNA 4IUVA 4KI0A 5G3LD 2PPBC 3OOCA 4GZYC 1H9SB 4DU9A 4PMWA 3VR4A 5JVG3 5FO9B 5M3FB 1A3UA 3D8GA 3K57A 1BQQT 4XIGS 1A2TA 2K33A 5EKLA 2B39A 3SDZA 5IGGA 4HAEA 2J0TD 1EY0A 4F8MA 2JA8B 1GUSA 3SHLA 1HRJA 4FVMA 1ET6A 1C8CA 1PZKD 5C4HA 5DNFA 3I73A 1EWCA 2XWJB 1ONLA 1TIID 1XWEA 2KECA 4IUQA 3HRZC 4QUCA 2D62A 1XTCD 1Y8OB 1U4PA 1TWHB 3GTKB 1CQFA 2BDNA 4U68A 3T56B 2DY7A 1G91A 3PO3B 1S5ED 4OIKA 1TWGB 4OO1G 4A3KB 5C0XG 5J39A 5CV9A 5C0XJ 2DNEA 4NW2A 2K1BA 2SNSA 1J9OA 4KKSA 4DNTB 2GA4B 3NUCA 1S5DD 3MEHA 3A8IE 2LMCB 1Q8IA 1EZ8A 3S15B 3MHBA 1WTVA 1KNAA 3KBXA 1QNKA 2RQXA 1SYFA 1OO9B 2I07B 3MFYA 5BN5A 4IFDH 2WIIB 1II3A 1EQTA 2KEEA 1YNJD 2ZT9C 3U9OA 2PO4A 4IURA 3GTQB 4IALA 1I50B 3TMEA 1SYBA 1RHPA 3SK8A 2E2IB 4IQZA 2L1BA 4C1NK 1JR0D 3Q0AA 4DGZA 5EGTA 2F03A 3M7NA 3IFTA 4FYDA 1EY7A 3DUZA 4J1MA 2FHTA 3T51B 5DAUA 1SNQA 1GHKA 1V43A 2EVBA 3C1FA 1OXXK 4OO1I 1HQRD 2CHBD 4X3UA 5EPKA 2EJMA 4DN4M 3X3NA 1SJHD 4HSVA 5C0XI 1PXUA 3H09A 3LX0A 1EIGA 1X32A 2HDMA 4NDXA 2JEBI 4XT3B 3SK6A 2F0UA 3HZXA 2Z1CA 4PNYA 1G291 3V05A 2M2LA 5FLXE 1TS2A 4OL7A 5IGDA 2FJ2A 4A3MB 1O7YA 2K01A 5LL6X 2L5TA 5EKKA 5CV6A 2FINB 3NBIA 2EJFC 1SMYD 1R4QB 3T16A 1JCKB 3I91A 3OWEB 1CTMA 2F0VA 3KUPA 2NB0A 5LHY1 1WTQA 1IYVA 4DAYA 1ICWA 2FMCA 4HCSA 2A6ED 3J80E 1GUNA 3Q6SA 1Q90A 4KKUA 2JA7B 2LS01 2EYLA 1JC7A 2XVSA 2IW3A 2CW0D 1ESFA 4X3SA 4FF1A 3F2UA 3H94A 3IFDA 1OXTA 5M3MB 2K04A 1UNSA 2K5DA 3GV3A 2M00A 3D6WA 2NYZD 3TP7A 2XIWA 2IX0A 4JK1C 2F0OA 4CJ0B 4L63B 5CV5A 5FKAC 2O5IC 1PLFA 4I7ZC 1WTRA 1PZJD 4DNRB 2PW7A 1B4OA 4OO1H 5BN4A 1I4PA 2B63B 1CI3M 3RLFA 5C3EB 3MAQA 2NBFA 1HUNA 2J4XA 3K59A 2L55A 3WDNA 2JEAI 1OXUA 3EFXD 1SSOA 2WKCA 3S16B 1BO0A 1WD0A 2F3WA 3E5SA 5M5YB 4ME5A 3MZ5A 4RH6A 3MTSA 2KOLA 1MI2A 5EBDA 1F2MA 3NQIA 3SR1A 1AFPA 3I70A 5I9PA 1TVXA 2QF7A 3VR6A 3P20A 5NUCA 3VR2A 1STEA 3Q22A 2RA4A 3HOXB 5C4JB 1KLGD 1IYUA 1WCMB 4G7OC 3KLSX 1LABA 1X3PA 2F0GA 1SJED 4B9XA 4TQUS 2G9HD 1D5ZC 4CJ1B 3KBGA 1SNMA 1EL0A 3R2TA 1CT1D 1FNWA 1LTAD 4EGVA 2JXMB 2Q8IB 3QJYA 1U4LA 5FOBB 2F1MA 2KHSA 4CKCA 4KKTA 1Y1WB 4A3JB 2QEJC 2B8GA 4JBWA 1UAPA 1A6XA 4A3BB 3FMCA 2WKDA 1Z47A 4FNFA 2NTTA 3BDLA 3BYYB 2ZXPA 3GTMB 5K5PA 1PFBA 5E4WC 2D2CC 1DM0B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NWG A;  4X3T A;  2M2L A;  2K28 A;  1WD1 A;  1SDF A;  1DZ1 A;  1NR4 A;  2B2V A;  2H1E A;  3MWY W;  1XX8 A;  1AZQ A;  1G6Z A;  3TN2 A;  1VMP A;  2K1B A;  2L9H A;  3QO2 A;  4NW2 A;  1HUN A;  1CA5 A;  2B2Y C;  1HFG A;  2FJ2 A;  5EKI A;  1O7Y A;  5JJZ A;  2K01 A;  1J9O A;  1HHV A;  1EOT A;  1KNE A;  2J7Z A;  5COY A;  2B2T C;  1B2T A;  1SSO A;  2HCI A;  2HDL A;  5CBA E;  3N52 A;  1NAP A;  2L12 A;  2FIN B;  1F2L A;  2KVM A;  2SDF A;  1BO0 A;  1WD0 A;  1B50 A;  2EPB A;  4R9W A;  2B2W C;  1RTN A;  1B53 A;  2HUG A;  2IL8 A;  2MGS A;  5D14 A;  1HFN A;  4IUU A;  1RJT A;  1KNA A;  1O80 A;  1QNK A;  3HP3 A;  3I91 A;  3KBX A;  4ZLT F;  1WTV A;  1BF4 A;  3H91 A;  3I90 A;  3KUP A;  2Q8R E;  3UI2 A;  3FPU B;  4O42 A;  3MTS A;  5EPJ A;  3DEO A;  2KOL A;  1WTQ A;  1MI2 A;  1G2S A;  4IUV A;  4RAU C;  1MSG A;  2L4N A;  1LV9 A;  1AP0 A;  1DON A;  1SAP A;  1DOM A;  2JP1 A;  1EIH A;  5COR A;  5T1G A;  1JE4 A;  1ICW A;  2KED A;  4HCS A;  5EQ0 A;  1EQT A;  1GUW A;  2KEE A;  3G7L A;  1IKM A;  3P7J A;  1TVX A;  3Q6S A;  2B2V C;  3I8Z A;  5T1I A;  4R8I A;  1BNZ A;  1J8I A;  4IUT A;  4RA8 A;  4IUR A;  2EOT A;  1Q3L A;  4HED A;  1IL8 A;  1DOL A;  2FMM A;  2RA4 A;  2B2U A;  3R93 A;  1IKL A;  2DY8 A;  4MHE A;  4X3K A;  1XYI A;  1HA6 A;  1WVL A;  1ROD A;  1RHP A;  1WTX A;  4IUP A;  2B2T A;  4QUF A;  5E4X A;  4HAE A;  2N55 A;  1VMC A;  1F9S A;  5EJW A;  1ESR A;  1ML0 D;  4X3S A;  2L1B A;  1QG7 A;  1X3Q A;  2B2W A;  4XDX A;  4ZKB B;  1QE6 A;  1WTO A;  2RSO A;  3F2U A;  1X3P A;  2X6G A;  4MN3 A;  1NCV A;  1ILP A;  1S4Z A;  2RSN A;  3I3C A;  1F9R A;  3IFD A;  3LWE A;  4ZKC B;  1HRJ A;  1PFN A;  2FHT A;  4CJ1 B;  5AFW A;  2K04 A;  2R3Z A;  1C8C A;  2X6L A;  3ONA B;  5CMD A;  1EL0 A;  5DNF A;  1DOK A;  2K03 A;  2NZ1 D;  3TZD A;  2MPM A;  1RTO A;  1F9P A;  1AZP A;  2Q8T A;  3GV3 A;  1HUM A;  4CJ2 C;  1E0B A;  2HCC A;  3D6W A;  4XT1 B;  2NYZ D;  2MJ8 A;  3GV6 A;  1B3A A;  2K05 A;  2B2Y A;  1MSH A;  2XIW A;  2CVR A;  1BBX C;  4X3U A;  1PDQ A;  1CM9 A;  5EPK A;  1MGS A;  1PFM A;  2D9U A;  1M8A A;  3DEP A;  2KEC A;  4DN4 M;  3FDT A;  4HSV A;  4CJ0 B;  1G2T A;  4IUQ A;  4LMQ D;  2JYO A;  1U4M A;  1U4L A;  1WTW A;  5CBE E;  4QUC A;  4ZK9 B;  2L11 A;  1EIG A;  1CA6 A;  2B2U C;  1ILQ A;  1U4P A;  1X32 A;  2HDM A;  3IL8 A;  1U4R A;  2BDN A;  1PLF A;  2MP1 A;  3DM1 A;  4U68 A;  1NR2 A;  1WTR A;  2KUM A;  2DY7 A;  2N88 A;  2X69 A;  1F9Q A;  1G91 A;  4ZAI A;  2EE1 A;  4UAI A;  4XT3 B;  1A15 A;  1ZXT A;  4OIK A;  5D65 A;  2FFK B;  2RVL A;  4OIJ A;  4RWS C;  1B4O A;  1WTP A;  1PFB A;  2VXW A;  1O7Z A;  5E4W C;  1JIC A;  5EPL A;  3SVM A; 
#chains in the Genus database with same CATH topology
 2Z4H A;  4R4C A;  2Y0S B;  1PH8 A;  3I4N G;  3PO2 G;  2K52 A;  3DM3 A;  3MWY W;  2GVA A;  3D4W A;  1PZI D;  2VUM G;  1X9N A;  1F77 A;  1EU4 A;  4C3I B;  1Q1E A;  1K8M A;  2WFW A;  2B2T C;  2UXD L;  1K3R A;  1SYC A;  4H7B A;  2SDF A;  3ZJY C;  2PI2 E;  4JVZ A;  2VQE L;  1B53 A;  1CFM A;  4POG A;  1O80 A;  2F0I A;  4RCO A;  2NVY H;  1BXT A;  1UUP A;  4ZCK A;  4OX9 Q;  4U67 3;  5EPJ A;  1F2Y A;  2MQH A;  4PZ6 A;  4KJO A;  5I2Y A;  1JWM D;  2F0P A;  1V1P A;  5T1G A;  4EQP A;  4LFA Q;  1GUW A;  3P7J A;  3KF6 B;  5K36 G;  3C1E A;  5LL6 S;  4CKE A;  4R8I A;  2SNM A;  3PIP 3;  1J8I A;  3QOJ A;  4JI8 L;  1TR5 A;  4C3J G;  1WYD A;  1Q3L A;  3CCM A;  2FMM A;  2B2U A;  3IRB A;  1GD7 A;  1KDB A;  4YHH Q;  4CDF C;  4LFC L;  3KLW A;  1Z6H A;  1HNZ L;  1EY8 A;  5EJW A;  2ICI A;  1VQP A;  2B8F A;  3G6J B;  1VQM A;  1ILP A;  4IFD J;  2JA5 G;  2R93 B;  4DV7 L;  4K2K A;  4JYA Q;  4ID6 A;  4TSS A;  3TP8 A;  4PZ8 A;  1HUM A;  2WAQ G;  2AQ2 B;  1WTH A;  3D6C A;  3LNN A;  2DJG C;  2EYH A;  5IYC G;  2NZO A;  1SE2 A;  4DV5 L;  3HGB A;  1I4X A;  3PQI A;  2JA9 A;  3WOE A;  1UWV A;  3PIO A;  4LF9 L;  4ZRZ A;  3I4L A;  4G57 A;  4NKL A;  4AQY Q;  4HSP A;  2ATW A;  3UDX A;  1KLU D;  3KLS A;  1VQA A;  4BS9 A;  1B7Y B;  2E2J B;  1I3Q B;  1YNJ C;  2F0Q A;  1PH2 A;  4OWX B;  4FXG C;  2VNU D;  1TWF H;  2X69 A;  3KYH C;  4DFA A;  1RCV D;  5IGF A;  3A56 A;  3TQY A;  2FFK B;  5DLQ E;  2E5L L;  2RCN A;  1EY4 A;  3G48 A;  4A3F H;  1I4G A;  2WV6 D;  5IGC A;  1XX8 A;  3HKZ B;  4V0B A;  2ICE C;  5ELC A;  2YU9 B;  1G6Z A;  1D5X C;  1A8V A;  2Z9H A;  2J7Z A;  1V9P A;  4ILW A;  3S17 H;  1QB5 D;  4CDE C;  1MHW C;  1ZYR D;  1QNU A;  3CXC A;  1T5E A;  3J7Y W;  1EYD A;  4LF7 L;  5C4Z A;  5KRU A;  3AFQ A;  3MC0 B;  3TBI B;  3K8A A;  2NUC A;  3DEO A;  1PTO H;  5JJK A;  3F2D A;  1MSG A;  1UE1 A;  1KRS A;  5IYD H;  5CV8 A;  1TY0 A;  3VYT A;  4IFD I;  2LY7 A;  4IPG A;  3S2H H;  3A8K E;  4IZ8 A;  3CCS A;  1IKM A;  2UUA L;  1W6K A;  3HOY H;  1I4H A;  3K6O A;  3I4M H;  1LO5 D;  3FHW A;  1OTC A;  1SFO H;  3OMG A;  3HOW G;  1D6E C;  4BY1 H;  1IBK L;  5CC4 A;  2A73 B;  2A68 D;  5AJ3 L;  1MD2 D;  4ZUI A;  3HOU B;  1JJ2 A;  2HT1 A;  4JCV E;  1N34 L;  3UE1 A;  5KYL A;  2IY5 B;  1YZ6 A;  4IJH A;  2BA0 A;  1A3V A;  2P5Z X;  1C0A A;  3GQB A;  2SEB D;  1K83 H;  2PCF B;  1LT3 D;  4KMU C;  1NCV A;  2FXQ A;  5D3I B;  1IBL Q;  3PIO 3;  2A6H D;  2EDG A;  2R3Z A;  1SMY C;  2KCM A;  1B9M A;  2XNA C;  2DGY A;  5GAG C;  1GO3 E;  4A3I B;  2MJ8 A;  1A63 A;  2K05 A;  2PQE A;  1MSH A;  3CKI B;  1G8Z D;  1A62 A;  1Y1V G;  1SNP A;  4DUZ Q;  4PV1 C;  1O78 A;  1I6H H;  2IJ0 A;  3SXH A;  3TEH B;  4JI3 Q;  3ZYY X;  3HG9 A;  1STG A;  1SN8 A;  2A6E C;  2OEO A;  1D2B A;  3FKI G;  4HCE A;  4BBR G;  2KUM A;  4IUN A;  5IGE A;  5KNC A;  1Q81 C;  2N3S A;  3J81 E;  4OX9 L;  3GP7 A;  3KK7 A;  2NVT B;  3TS2 A;  1V1P B;  4ZYS A;  2RVL A;  1X3F A;  1EY5 A;  5J3B A;  2CW0 C;  2NWG A;  4QIW B;  3CPW A;  2F0F A;  2H1E A;  4ME3 A;  3PO2 H;  5JPM C;  4HID A;  2K75 A;  2L9H A;  3TDQ A;  1CA5 A;  3S2D H;  1HFG A;  5HUR A;  1J5E Q;  4A3E G;  5JJZ A;  2VUM H;  3KF8 A;  4UP8 A;  4HJ8 A;  3VYR A;  1BUV T;  2EYF A;  4EQO A;  3S1R B;  1KRT A;  3QIA A;  4JI0 Q;  2HDL A;  3BVM A;  4DK1 A;  4FP5 D;  4RKL A;  5E3F A;  2YV5 A;  1SYG A;  2HUG A;  3QB3 A;  2Z8L A;  3H91 A;  3NK9 A;  1LT4 D;  4JYA L;  3DXJ C;  4CGY B;  5IYB G;  4JG2 A;  3EBE A;  1EIH A;  2EY1 A;  4KHP Q;  1XNQ Q;  1VF7 A;  4LUZ A;  1L0X B;  4EVO A;  4HR7 B;  5K36 H;  1YIJ A;  5E4W C;  4AQY L;  3H3V C;  4Y7N H;  2EOT A;  1RKN A;  3FRP B;  3SE0 A;  3R93 A;  2OT2 A;  5I6Y A;  1WTX A;  1KTK A;  4LF4 Q;  1ESR A;  5C4X G;  2KBN A;  1SXT A;  4KTA A;  3JAM E;  1YNN D;  2XN9 C;  1OXS C;  3HOV G;  3J7A V;  3RZD B;  4BY7 H;  2UXB Q;  2RHQ B;  5FLX c;  4LF8 Q;  5KEE A;  3M4O B;  5M5W H;  2KJX A;  3SGI A;  2RCF A;  5IYC H;  4CKB A;  2YYZ A;  3FP9 A;  1EU3 A;  1M8A A;  3UDF A;  1Q86 C;  2BOS A;  3FDT A;  4OXP A;  2EYO A;  5FO8 B;  4IPC A;  2RDG A;  4DF7 A;  5CBE E;  5H1S E;  3BS1 A;  4RGN A;  4KY6 A;  4A3K G;  1SNO A;  2F0K A;  1CZG A;  2K50 A;  1HTP A;  1VQ4 A;  2MP1 A;  2CFM A;  2VL6 A;  3DM1 A;  1L0W A;  1P16 A;  3J7A F;  1VQO A;  3K7A H;  3GTL B;  4PZ7 A;  2F4I A;  1ZXT A;  2ZTD A;  1TWC H;  4RWS C;  3TS0 A;  5IP9 G;  4ULL A;  1X55 A;  1KDC A;  3NEM A;  3NP8 A;  3RNU A;  5F2D A;  4XQN A;  1YI2 A;  2EY6 A;  3UDI A;  3J80 c;  3GTG B;  1JB7 A;  2A69 D;  3GDE A;  3H0G B;  1LTR D;  2KCC A;  4QQB X;  4QL5 A;  1HHV A;  1KNE A;  3AB9 A;  3TSS A;  2IPK D;  4P2C B;  1B2T A;  2HCI A;  2JA6 B;  3VR5 A;  2PQA A;  2ES2 A;  2EPB A;  4PMC A;  2B2W C;  3TP6 A;  4BXX H;  3P75 A;  1XJV A;  1IBL L;  4KHZ A;  3I90 A;  3VYU A;  3J81 L;  3A5U A;  2UUC Q;  4GLX A;  4LF5 Q;  1HTL D;  1HZC A;  2JJQ A;  2K32 A;  4HIK A;  3AYH B;  3E9H A;  2ZJQ A;  5D3D A;  1PH3 A;  3NSW A;  4UY8 C;  1SEB D;  1NNX A;  4H02 A;  3G7L A;  4DUZ L;  3DWQ A;  4IUT A;  4RA8 A;  1HNW Q;  4YWK A;  4ZQ3 A;  4JI3 L;  2WB1 B;  1HR0 W;  3DHQ A;  3HOW H;  2EYJ A;  4R1J A;  1HXY D;  2RKS A;  3ND8 A;  4Z9C B;  3J81 j;  1S40 A;  1H9J A;  5DM6 3;  3W3A A;  1YJ9 A;  1Y8N B;  3CCQ A;  4GOP C;  2RSN A;  2MO0 A;  2K5W A;  4C3H G;  4FF3 A;  2CWP A;  4X6A H;  2TMP A;  1FD7 D;  4DAP A;  1QIL A;  4GNX A;  2K03 A;  1GHJ A;  5DEH A;  1JWU D;  1IXR A;  2Q8T A;  3J7Z C;  3KF8 B;  2HCC A;  1J5E L;  2QGQ A;  4QB4 A;  1GUG A;  4GS3 A;  4JI0 L;  5CV7 A;  3I7F A;  3STB D;  3PMF A;  2R92 G;  1CK1 A;  4OWT B;  4DPG A;  2L11 A;  4UDU C;  2B2U C;  1ILQ A;  1BOS A;  3PSI A;  2ZTC A;  1WFQ A;  3S1M H;  3T4A C;  4C2M H;  2F52 A;  1NR2 A;  2L15 A;  2F0H A;  3FKI H;  4A3F B;  4RHS A;  1E2V A;  3Q8D A;  1QWY A;  5JJL A;  4ZAI A;  4DR7 Q;  2N78 A;  3EVQ A;  1D1I A;  2BE5 D;  4DV4 Q;  2F0L A;  4ODG A;  3JAM L;  2QDL A;  1GUO A;  4A3G H;  1E24 A;  4KHP L;  3NBH A;  1STY A;  3S1N H;  1AH9 A;  1JWS D;  3M3Y B;  2NVX H;  1K0S A;  4JI4 Q;  1NR4 A;  2B2V A;  5J1Z A;  1B1Z A;  1AZQ A;  1VQD A;  3PV0 A;  1T9H A;  2WAQ E;  2E2H H;  5EKI A;  1FNU A;  2AUK A;  4A3E H;  1MJE A;  5JAV A;  4A93 G;  1I5F A;  5CBA E;  4LF4 L;  5EAY A;  1HQM C;  1PTO B;  1C9O A;  4P71 A;  4WJW A;  5BR8 Q;  5JEA G;  3ND9 A;  4IUU A;  4R4Q A;  1DGS A;  1SE4 A;  1U0L A;  1IBM Q;  4H13 C;  5M3F H;  4H44 C;  3BDC A;  3HOY B;  2UXB L;  3I4M B;  1TS4 A;  3CQZ H;  4K2L A;  5IYB H;  4LF8 L;  1SAP A;  2EY5 A;  2VB3 X;  1KL9 A;  1VF5 C;  4NMZ A;  1NJI C;  1XTD A;  3QR8 A;  2AWN A;  4AYB B;  3HS0 C;  1QUQ A;  1GKH A;  4HED A;  3NQT A;  1K83 B;  2A5H A;  5FO7 B;  1ZKO A;  4QUF A;  4DAV A;  5CYU A;  4MNO A;  1X6O A;  2WP8 J;  1VMC A;  4K8J A;  1S72 A;  2K5Q A;  1Q82 C;  3E0E A;  5C4X H;  4F7X A;  2MUY A;  5IGB A;  3OHX C;  1ZYR C;  2RDF A;  2O5J C;  1TS5 A;  2ALY B;  2H5X A;  3K5L A;  2K6A A;  1DD2 A;  4A75 A;  1TWH H;  3GTK H;  2B3G A;  4BY1 G;  1N8R C;  4NB3 A;  5HGQ A;  3PO3 H;  2PQA B;  3L0O A;  4LMQ D;  4GN3 B;  4GKJ Q;  4X66 L;  1TWG H;  3E0J A;  5KYI A;  1LT6 D;  2L0C A;  3CRK C;  4ZK9 B;  2GN5 A;  1CA6 A;  4K5X A;  4A3K H;  1U4R A;  2F0J A;  4XQQ A;  1VQN A;  3BJU A;  1E1O A;  4LF5 L;  4XTC S;  1Y14 B;  1ASZ A;  3A7A B;  3BVZ A;  3C46 A;  1ENA A;  3RD4 A;  3PO2 B;  3I4N B;  4N8F A;  5D65 A;  2KQ3 A;  2VZA A;  3GO5 A;  5IT9 E;  3L3O C;  2A68 C;  5EPL A;  4YY3 Q;  1C4Q A;  2K28 A;  1SDF A;  1HNW L;  2JE6 I;  3MFG A;  4H0L C;  3TN2 A;  1VQ6 A;  1PYS B;  3QO2 A;  1IW7 D;  1S5F D;  3A8J E;  2A6H C;  3CAM A;  1QZH A;  3RZO B;  1NSN S;  3PGZ A;  5CR3 A;  3HOZ G;  3EA6 A;  4K8I A;  4LW1 A;  3N52 A;  1STB A;  2R6G A;  4JI1 Q;  4IPD A;  1H9K A;  4R9W A;  2ZJP A;  2VW9 A;  3BG3 A;  3U9S A;  4GNX B;  1V8Q A;  3UI2 A;  3GTQ H;  4KD3 A;  4JOI A;  3MXU A;  1LV9 A;  2F0E A;  3S24 A;  1AP0 A;  5M9O A;  3T53 B;  4Y7N B;  3QWN A;  4C3J B;  1D7Q A;  3ERO A;  2PI2 A;  1GUT A;  2E2I H;  4YWM A;  1GXD C;  4O2D A;  5T1I A;  1L1O A;  2B29 A;  3OYY A;  1PRT D;  3HKS A;  4JBM A;  2QKI C;  1B70 B;  1YNX A;  4NXN L;  5BN3 A;  1GJX A;  5IIF A;  3GTP H;  2LKV A;  2QW7 A;  1C7Y A;  4IPH A;  2JA5 B;  5M5X H;  4DR7 L;  1FR3 A;  1ML0 D;  3R2I A;  2CCZ A;  2HHH Q;  4DV4 L;  1X56 A;  2F0T A;  4XDX A;  1XMO Q;  1I94 Q;  1LYL A;  1PFS A;  3NBH B;  1FGU A;  1SE3 A;  1S4Z A;  3LWE A;  1PFN A;  4C3H H;  4DAM A;  5ELN A;  2EJG C;  3VR3 A;  2ID0 A;  4KK7 A;  1F9P A;  1W6J A;  1XNR Q;  4CJ2 C;  2BA1 A;  3A74 A;  3EIV A;  1BBX C;  1PDQ A;  1MGS A;  1HPC A;  1JQY D;  3U4Z A;  3A54 A;  1VQ8 A;  2A19 A;  1YHQ A;  2JYO A;  5JJI A;  1W2B A;  2N49 A;  3SEB A;  5FLM G;  3K7A B;  2R92 H;  5BR8 L;  1L0Y B;  4KJN A;  4K5V A;  4LK1 C;  4DK6 C;  5IY0 A;  5FJ8 G;  4QF4 A;  3TZU A;  1IBM L;  2F3V A;  2N88 A;  1VQJ A;  4XQJ A;  1A3T A;  4BY7 G;  2G5D A;  1PTO C;  3OW7 A;  3BZK A;  4RMF A;  3CRL C;  2QCP X;  1NMG A;  4IJL A;  4OIJ A;  1TKW B;  3I72 A;  1RF2 D;  4FF2 A;  3K5O A;  4LUO A;  3AMU A;  2Z4I A;  4KV6 A;  5C44 B;  5IP7 H;  1QUQ B;  4RKB A;  1VQG A;  1X3G A;  1H9M A;  3OSO A;  3V2T A;  1YNN C;  4HIO A;  1UEB A;  1G6P A;  2R7Z G;  1S5C D;  1E7Z A;  3MXN A;  4MIU A;  1HCZ A;  1STH A;  2A74 C;  1PMR A;  4A93 H;  3R8B A;  1NAP A;  2L12 A;  3O13 A;  1PYB A;  1RTN A;  1JOK A;  5JEA H;  1BF4 A;  1D1K A;  4CHT B;  5HGT A;  1PH5 A;  2RF4 A;  1G2S A;  4KHV A;  4QJF A;  2QDB A;  1EUJ A;  4GLA C;  5IT9 L;  2JP1 A;  2AQ3 B;  4AH6 A;  3HOW B;  1BVS A;  2C35 B;  2IT1 A;  3C3L A;  4R4O A;  5E1F A;  2OWO A;  4R8N A;  1VQ7 A;  1JB3 A;  4BXX G;  2R93 G;  3SK5 A;  1IKL A;  3GTO B;  2EZV A;  1ROD A;  2K4K A;  3A55 A;  4IUP A;  1FYC A;  2RBM A;  5JVH 3;  4DV1 Q;  1GM5 A;  4LJZ C;  1VQ9 A;  4JPB W;  3WOF A;  2A69 C;  3L9A X;  2UUB L;  3MVV A;  4NP5 A;  3PUW A;  1EY6 A;  1Y8P B;  2HQL A;  4YY3 L;  3K7U C;  4X62 Q;  4Y52 H;  2X6L A;  1Y1V B;  3ITP A;  3OIP A;  4DV6 L;  3Q23 A;  1EOV A;  4C56 C;  5C6A A;  4WJ4 A;  5CGK A;  4DR4 Q;  1Y69 U;  2CVR A;  4B3T Q;  3E6Z X;  2A8V A;  1PFM A;  3RR5 A;  3DEP A;  3K0Y A;  2XGT A;  2ZM6 Q;  2ZTE A;  4BBR B;  4L5Q A;  5A2Q L;  1LT5 D;  4JI1 L;  5ELE A;  4UP9 A;  1LUZ A;  1WTW A;  3PUV A;  1TT2 A;  3HFZ B;  1H95 A;  1A2U A;  1UE5 A;  4LWC A;  2B63 H;  1EYC A;  3B6Y A;  4DR6 Q;  2OQ0 A;  2NVX B;  3H6M A;  3V96 A;  1HZ9 A;  2TSS A;  2WIN B;  4P73 A;  4JI5 Q;  2VXW A;  2UU9 Q;  2E2H B;  4A3E B;  5GAD C;  4GNX C;  1L1O B;  2VB2 X;  3P1H A;  3S16 H;  1BDO A;  3HEJ A;  1EEF D;  5M5Y H;  4JI7 Q;  2MO1 A;  4ABN A;  3KJP A;  1CKM A;  3CCE A;  1EOT A;  1FJG Q;  1PRT B;  3HOZ H;  4HJ7 A;  2ZXO A;  3KLR A;  2KVM A;  1X65 A;  2HHH L;  4JC0 A;  1I94 L;  3NE5 B;  1TQO A;  3CQZ B;  4UHV A;  1F2Z A;  2IL8 A;  1HFN A;  4ZLT F;  4A3G G;  3QOL A;  1SND A;  3K81 C;  3T13 A;  3K5M A;  4BBS G;  3PUY A;  3STB C;  1NUC A;  4LFA L;  2Q2T A;  5FK9 C;  5GQO A;  1MKH A;  1XNR L;  4MZ9 A;  5KIX A;  3S14 H;  3NPP A;  3HOX H;  1K8A C;  5C4J H;  1LTG D;  5COR A;  1E22 A;  2KED A;  3KOJ A;  4YHH L;  4A3L H;  3K5N A;  2B2V C;  1Q7Y C;  2AWO A;  2BE5 C;  5C5M A;  3D4D A;  2XTI A;  5C4X B;  3CME A;  4X65 Q;  1HA6 A;  2R7F A;  5M3F G;  2B2T A;  5I9O A;  2XWB B;  1F9S A;  1SRO A;  1FNV A;  1MBY A;  3HOV B;  1JOR A;  1EEI D;  1PTO F;  1X3Q A;  2M9V A;  2NN6 G;  5J22 A;  4RHR A;  1KXL A;  3DWP A;  4MN3 A;  2LXK A;  1D5M C;  1KIX A;  3I3C A;  1QOH A;  1F9R A;  4XYQ A;  2EIF A;  2BH2 A;  1M4V A;  4FO2 A;  2JA8 G;  1NTG A;  1QJO A;  4PG3 A;  1DOK A;  1RTO A;  4A3J H;  1L2F A;  4OWW B;  3MXN B;  2B2Y A;  1PTO D;  1CM9 A;  3ULJ A;  2HQE A;  3GTJ H;  4DV2 Q;  1EYA A;  1R9T H;  4I65 A;  1J6Q A;  4M8A A;  2LSS A;  1B44 D;  2HIX A;  5FLM H;  3GTM H;  3NHH A;  3MXG A;  3D31 A;  2AKW B;  2NVQ H;  1KQS A;  5FJ8 H;  4C1N I;  4HN7 A;  4F88 A;  4IN3 A;  2OF1 A;  3H15 A;  5C3W A;  4YCV A;  1IL2 A;  1JE5 A;  4A3D B;  4RGO S;  2EE1 A;  3EJI A;  2CQA A;  3M4Y A;  4C3I H;  3NEL A;  1V1Q A;  3IAY A;  3UE0 A;  2WAC A;  3PO3 G;  1SYD A;  3G4S A;  1DZ1 A;  5I6W A;  3X3M A;  2JQO A;  3W1G A;  2JN4 A;  4WFN 3;  4DV3 Q;  2IX1 A;  5CV4 A;  2PMZ E;  4NXM Q;  1RIP A;  4HJA A;  2R7Z H;  1EQQ A;  1X54 A;  1K28 A;  4DV1 L;  1SE8 A;  1CSQ A;  2F0M A;  3U50 C;  4OGQ C;  1LTB D;  4F87 A;  1F2L A;  1B50 A;  4K14 A;  3PCO B;  3CCU A;  2EXZ A;  4J6H A;  2K7V A;  2VY3 A;  2E76 C;  5GAH C;  4DR5 Q;  4WRD A;  2EYP A;  1HA5 A;  3AU7 A;  3S1Q H;  4X62 L;  3FPU B;  3AFP A;  1K9M C;  1EWH A;  3ERQ A;  5LMN Q;  1NBW A;  3IKJ A;  2NN6 I;  5DM7 3;  3D3R A;  4DR4 L;  4B3T L;  1JE4 A;  3OMC A;  5TSS A;  3GTP B;  2NVY B;  2ZM6 L;  4K5W A;  2ENB A;  1BCP F;  3VA7 A;  5IOC A;  3J7A 5;  3FVQ A;  4DR3 Q;  5M5X B;  3J80 i;  2I0Q A;  5ELO A;  1AW7 A;  1DOL A;  4KN7 C;  2UXC Q;  2DNC A;  3OIQ A;  1QCB D;  5EBC A;  1N36 Q;  4X3K A;  2R93 H;  1WVL A;  1N9W A;  1STN A;  1EIF A;  5E4X A;  4QCL A;  4C3H B;  3H3V H;  1SYE A;  1IW7 C;  3R3O A;  1BCP D;  1Q12 A;  1V1O A;  4O0A A;  1YBY A;  2OQK A;  5JPN C;  3NEN A;  2O2L D;  1ET9 A;  2RSO A;  3F8T A;  3VYS A;  1BR9 A;  2UU9 L;  4ZKC B;  1CHP D;  2ASB A;  3ONA B;  4FF4 A;  1TS3 A;  1M90 C;  3TZD A;  2F0N A;  2MPM A;  1AZP A;  1I3Q H;  2ZXR A;  3PUZ A;  2R92 B;  4JI7 L;  4K0K Q;  2MFI A;  3PF4 A;  1FJG L;  4P75 A;  1G2T A;  1U5K A;  1U4M A;  2K14 A;  4B08 A;  4IO9 A;  3BYT B;  3A0J A;  3QG1 A;  3G6E A;  4WJ3 M;  1GOZ A;  1PRT C;  2H4O A;  3NTI A;  4E6I A;  1S5B D;  2YU9 H;  1JMC A;  2IHF A;  1BBU A;  1A15 A;  2QIL A;  4RGT A;  4EQ5 A;  1TWA H;  2BDO A;  3C2P A;  3BVG A;  1DJR D;  2EQS A;  2RHS B;  1CUK A;  4JBK A;  1EZ6 A;  1ENF A;  5ELB A;  1PVO A;  1JT8 A;  2XRS D;  1WD1 A;  4MTN A;  4L5R C;  1TWF B;  3CCL A;  4A93 B;  3FEW X;  4N9T A;  3W2D A;  1E2Z A;  4X65 L;  4L5S A;  2HD3 A;  2Q2H A;  1PYW D;  4KY5 A;  1OXV A;  2RDH A;  3DLL A;  4TVA B;  3D4R A;  4A3M G;  4ZUJ A;  1HNX Q;  2MGS A;  1EY9 A;  2EY2 A;  2YTY A;  2PW5 A;  4BBS H;  3MXP A;  2Y0S E;  4LF6 Q;  1LTS D;  1XNQ L;  4O1N A;  4O42 A;  5KGU A;  5IP7 G;  3S17 B;  2WB1 G;  2DJF C;  4TRD A;  1Z7T A;  4PMB A;  4YCU A;  1FGB D;  1SRU A;  1H9R A;  5JOB A;  1SBB B;  5EQ0 A;  4DV0 Q;  2E74 C;  4DV2 L;  1BNZ A;  4FXK C;  1B9N A;  1I4Q A;  2CH4 W;  4JV5 Q;  1PH7 A;  1B8A A;  1XYI A;  4LNQ A;  4Q5V A;  1KDA A;  4G7H C;  1EFW A;  1VQC A;  1HJP A;  2JA7 G;  5JEA J;  2JK8 A;  1D8L A;  3S2H B;  3CU7 A;  3FPP A;  4A3I H;  1K8O A;  1VQE A;  1KAA A;  1QG7 A;  4X64 Q;  4ZKB B;  1QE6 A;  1WTO A;  2NN6 H;  1SFO B;  1U9R A;  4BY1 B;  2PMZ B;  5AFW A;  5ELD A;  3VA5 A;  1O7L A;  1CQV A;  2NZ1 D;  1PH1 A;  2JA8 H;  4FXD A;  1K0R A;  4XT1 B;  5M3M G;  3GV6 A;  3OWF A;  1DCZ A;  1I6V C;  4NXM L;  1RD9 D;  1VCI A;  2D9U A;  3NWT A;  4P74 A;  3BU2 A;  4JI2 Q;  4XXE A;  4DV7 Q;  4V19 0;  4EX5 A;  5C0X H;  2C5C A;  1Q1B A;  4TKO B;  3Q24 A;  4K6D A;  3CC7 A;  2OTL A;  4QY7 A;  3IL8 A;  4B9W A;  1XXG A;  4DR5 L;  3A5Z B;  4JI6 Q;  3RLO A;  4G7Z C;  2AMC B;  4K6L A;  1YIT A;  1QVC A;  1FL0 A;  1X3E A;  5LMN L;  4M1U B;  2PNH A;  1I6H B;  1E2W A;  1WTP A;  1XMQ Q;  2JSO A;  4BWG B;  4OHJ A;  3NWS A;  1VQB A;  5IE8 A;  3RMH A;  2Z0S A;  4OEL B;  4X3T A;  3HOZ B;  4CBV A;  4DR3 L;  2MHV A;  3PF5 A;  2UXC L;  3OPO A;  1N36 L;  2B63 G;  1GVP A;  5FLX L;  1CHQ D;  2BCO A;  2KA7 A;  3U4V A;  3SK4 A;  5C3E G;  2UUC L;  1SLJ A;  2E75 C;  2KCN A;  3GD7 A;  1I4R A;  3S14 B;  5D14 A;  3K58 A;  1RJT A;  3S2D B;  1JOQ A;  4XYO A;  2VUM B;  1YJW A;  1BCP B;  2I46 A;  3KFU A;  1AE2 A;  2VS1 A;  3HKZ E;  3W5O A;  4RAU C;  1XPO A;  2L4N A;  3S15 H;  1DOM A;  4K0K L;  2F0D A;  1HZB A;  2F0S A;  5C5L A;  4DK0 A;  1QZG A;  1LAC A;  1N32 Q;  3WWV A;  3ULL A;  3MEF A;  5LMU Q;  4KY7 A;  4B3M Q;  2BH8 A;  2EXD A;  1YHB A;  4QGU A;  4R4I A;  4L6T B;  1IL8 A;  3J80 L;  2AUJ D;  4A4I A;  1TY2 A;  4B3S Q;  3CP0 A;  2NTS A;  2UUA Q;  2N55 A;  1PRT F;  4LAA A;  4Q0F A;  3S9W A;  2SOB A;  1UEA B;  1I50 H;  2B2W A;  3AEV A;  3HOX G;  3M7G A;  1XPU A;  4WOR A;  1VDZ A;  1IBK Q;  1TU2 B;  3CPF A;  2XSC A;  5AJ3 Q;  1WCM G;  2EYM A;  2XRQ D;  4DUY Q;  4A3L G;  3GTJ B;  4DA2 A;  5A2Q E;  1R9T B;  3BZD B;  1E0B A;  1IYJ B;  1H9S A;  2NVQ B;  1SNC A;  3CHB D;  3CCV A;  4DR2 Q;  4AIM A;  1EFI D;  3GTL H;  1ENC A;  4N9P A;  2R61 A;  1M1K C;  3CD6 A;  3T1H Q;  1HNX L;  4BA1 I;  4BY7 B;  1A0I A;  2QEX A;  2KEN A;  1KAB A;  2NZH A;  1AN8 A;  5M5W B;  4GN5 A;  2WAQ B;  1LLR D;  3RLN A;  4GKK Q;  4LF6 L;  3GTG H;  4HJ5 A;  4UAI A;  1Y1W G;  4JI4 L;  2E2D C;  4IOA A;  3H0G H;  4A3J G;  4GN4 B;  4DXG A;  1N33 Q;  2YTX A;  1UE7 A;  5I4D A;  4GOP A;  1QVG A;  2O4X A;  1O7Z A;  1C48 A;  1JIC A;  2K5H A;  4DV0 L;  4A3B G;  3SVM A;  1PV4 A;  2JA6 H;  2IX3 A;  2R7Z B;  1KD1 C;  1YVC A;  5I2X A;  4CDD C;  2PNR C;  1VMP A;  2B2Y C;  1EQV A;  4JV5 L;  4QMG A;  2V4D A;  4R4T A;  2IWH A;  5A35 A;  1TWC B;  4NPS A;  4L8J A;  5COY A;  2Y0S G;  3NXW A;  3S1Q B;  1WOC A;  5KNB A;  2D5D A;  4YIJ A;  5KND A;  3NTK A;  4X64 L;  3CCJ A;  1R4P B;  4C3I G;  4A3M H;  5IWA Q;  1CZW A;  3MA2 B;  1LTT D;  2E8G A;  2Q8R E;  4QIW E;  1RDP D;  4KN4 C;  3DMU A;  1DON A;  4IFD G;  4LFB Q;  4N8X 1;  4G4K A;  2QA4 A;  5ELF A;  4JI2 L;  3I8Z A;  3LGJ A;  2OXP A;  1JOO A;  1K3B C;  1AE3 A;  1MJC A;  2DY8 A;  4MHE A;  2YTV A;  4JI6 L;  4JBJ A;  1KAW A;  5C3X A;  1NE3 A;  2JA7 H;  2G9D A;  3ULP A;  4KD4 A;  2PZW A;  3BDO A;  2AQ1 B;  2D0P A;  2PZT A;  3TP5 A;  2PYK A;  2X6G A;  1JJC B;  1XMQ L;  3EQL C;  3LWU A;  1FVI A;  4HMI A;  5CMD A;  4GKJ L;  2I5L X;  3NTH A;  4KLK A;  1BKB A;  4HMJ A;  3DWA A;  3K0X A;  1B3A A;  1DYQ A;  5M3M H;  4B3R Q;  3M85 A;  2C9O A;  2K5V A;  4HTH A;  1DXM A;  4J15 A;  1IHZ A;  1WJJ A;  4S3S A;  3N6R A;  5IOD A;  1ZEQ X;  2PZU A;  3PUX A;  3J81 c;  5ISR A;  1TWA B;  5C44 G;  3M3Y H;  2F0W A;  4PQX A;  3RUZ A;  1F9Q A;  4DXF A;  4MTK A;  4A3C H;  3T1Y Q;  3J81 i;  1T5X D;  4BA2 I;  1PH4 A;  1S3O A;  1N32 L;  4DNI A;  5LMU L;  1AEX A;  1HZA A;  2CWA A;  1YJN A;  3S1M B;  4B3M L;  4L5T A;  3URY A;  4C2M B;  1BCP C;  4IOC A;  3FKI B;  3KDF A;  1HR0 Q;  2DN8 A;  2A1A A;  1LTL A;  4B3S L;  1EYG A;  1STA A;  4A3G B;  3A7L A;  4BBS B;  4RCN A;  3S1N B;  3HKZ G;  1EQR A;  5G3L F;  5C3E H;  3U58 A;  4J8Q A;  3OTO Q;  4RFB A;  1K73 C;  4DR1 Q;  3EN2 A;  3HP3 A;  4EQN A;  2I5M X;  1LTI D;  4RGM A;  4DUY L;  3L7Z C;  2LFN A;  1PHJ A;  4IUV A;  2I5H A;  4KI0 A;  4UP7 A;  5G3L D;  2PPB C;  3OOC A;  4GZY C;  1H9S B;  3CC4 A;  2OTJ A;  4DU9 A;  4PMW A;  4DR2 L;  3VR4 A;  5JVG 3;  5FO9 B;  5M3F B;  1A3U A;  3D8G A;  3K57 A;  1BQQ T;  4YCW A;  3T1H L;  4XIG S;  1A2T A;  2K33 A;  5EKL A;  1KHI A;  3ICE A;  1TXY A;  1XMO L;  3F2C A;  2B39 A;  3SDZ A;  1VS0 A;  4GKK L;  5IGG A;  4HAE A;  1QVF A;  3H3V I;  2J0T D;  1EY0 A;  4F8M A;  3JAM c;  2JA8 B;  4GOP B;  2Z6K A;  3G71 A;  1GUS A;  1N33 L;  3E9I A;  3I56 A;  3HOU G;  3SHL A;  1HRJ A;  4FVM A;  1ET6 A;  1C8C A;  1WCM H;  1PZK D;  3JAM i;  5C4H A;  5DNF A;  2F4V Q;  1WI5 A;  2WB1 E;  3I73 A;  1EWC A;  2Z6B A;  2XWJ B;  1ONL A;  2Q2I A;  4GLV B;  1TII D;  1O7I A;  1XWE A;  2KEC A;  2CH4 A;  4IUQ A;  1ASY A;  3HRZ C;  3I4N H;  2F3I A;  4A3I G;  1MIU A;  1G51 A;  4QUC A;  2D62 A;  1XTC D;  1YHA A;  1Y8O B;  1U4P A;  1TWH B;  3GTK B;  1CQF A;  1ICF B;  2BDN A;  5IWA L;  4U68 A;  3T56 B;  2DY7 A;  1G91 A;  3PO3 B;  1S5E D;  3I2Z A;  1Y1W H;  4LFB L;  4OIK A;  1TWG B;  4OO1 G;  3RZO H;  4A3K B;  4A3B H;  5C0X G;  2HIV A;  5J39 A;  3VDY A;  5CV9 A;  5C0X J;  2DNE A;  4NW2 A;  2K1B A;  2SNS A;  1E1T A;  1J9O A;  4KKS A;  4DNT B;  2GA4 B;  2K5N A;  2VQF Q;  3NUC A;  4YWL A;  1S5D D;  3MEH A;  3A8I E;  2LMC B;  4C3J H;  1Q8I A;  3I4O A;  1EZ8 A;  3S15 B;  3MHB A;  1WTV A;  1KNA A;  3KBX A;  1QNK A;  2RQX A;  1SYF A;  1OO9 B;  2I07 B;  3MFY A;  5BN5 A;  4IFD H;  4CDC C;  3CMA A;  2WII B;  4B3R L;  2R7D A;  1KC8 C;  1II3 A;  1EQT A;  2ZJR A;  2JA5 H;  2KEE A;  1YNJ D;  2ZT9 C;  3U9O A;  2PO4 A;  1W3S A;  3CCR A;  4IUR A;  3GTQ B;  1CKO A;  4IAL A;  1I50 B;  3TME A;  1SYB A;  1RL2 A;  1RHP A;  5GRO A;  3SK8 A;  3L2P A;  2E2I B;  2CQO A;  4IQZ A;  3T1Y L;  2L1B A;  4C1N K;  1JR0 D;  2OCE A;  3Q0A A;  4DGZ A;  5EGT A;  4OON A;  2F03 A;  3M7N A;  3IFT A;  4FYD A;  1EY7 A;  1Z9F A;  3DUZ A;  4J1M A;  2FHT A;  3JC6 6;  3F2B A;  3T51 B;  5DAU A;  1SNQ A;  1GHK A;  4AYB E;  3KDF B;  4HIM A;  1BBW A;  1V43 A;  2EVB A;  3C1F A;  1HR0 L;  1SMX A;  4P72 A;  1OXX K;  4OO1 I;  1HQR D;  2CHB D;  4X3U A;  5EPK A;  4A3D G;  1E3P A;  2EJM A;  4DN4 M;  3X3N A;  1SJH D;  4HSV A;  4DR6 L;  5C0X I;  1PXU A;  3OTO L;  3H09 A;  3LX0 A;  1EIG A;  4DR1 L;  1X32 A;  4JW0 A;  2HDM A;  4NDX A;  4JI5 L;  2JEB I;  5C44 H;  3UDG A;  2CKZ B;  4X66 Q;  4JOI C;  4DK3 C;  4XT3 B;  3SK6 A;  3OW2 A;  2E2J H;  4A76 A;  4POF A;  2F0U A;  3HZX A;  2Z1C A;  4PNY A;  2KCT A;  1G29 1;  3I55 A;  2KHI A;  3V05 A;  2M2L A;  5FLX E;  1K8G A;  1B3Q A;  1PH9 A;  1TS2 A;  1L1O C;  4OL7 A;  5IGD A;  2FJ2 A;  4A3M B;  1O7Y A;  2K01 A;  5LL6 X;  2L5T A;  1HH2 P;  3AQQ A;  5EKK A;  5CV6 A;  2FIN B;  3NBI A;  3H0G G;  2EJF C;  1XPR A;  1SMY D;  1R4Q B;  1CKN A;  3T16 A;  1JCK B;  3I91 A;  3OWE B;  1CTM A;  3CF5 A;  2JA6 G;  2F0V A;  3KUP A;  2NB0 A;  5LHY 1;  1WTQ A;  2F4V L;  3GTO H;  1IYV A;  4DAY A;  1ICW A;  2FMC A;  4HCS A;  4DKA C;  2A6E D;  3J80 E;  1GUN A;  2LXJ A;  3M9B A;  3Q6S A;  1Q90 A;  4KKU A;  4LUV A;  2JA7 B;  2LS0 1;  2EYL A;  1JC7 A;  2XVS A;  2IW3 A;  1Y1V H;  2CW0 D;  2UXD Q;  1ESF A;  1UE6 A;  4X3S A;  1EWI A;  1Q46 A;  2IHE A;  4NXN Q;  4FF1 A;  3ER0 A;  2VQE Q;  3F2U A;  3H94 A;  4BBR H;  3IFD A;  1OXT A;  5M3M B;  3HOU H;  1VQ5 A;  2K04 A;  1UNS A;  5E7N A;  2K5D A;  3GV3 A;  2D0O A;  1VQK A;  2M00 A;  3D6W A;  2NYZ D;  3TP7 A;  2XIW A;  2IX0 A;  2VQF L;  4JK1 C;  2F0O A;  4CJ0 B;  4L63 B;  4ALP A;  2Q2U A;  5CV5 A;  5FKA C;  3KF6 A;  3RN2 A;  4JI8 Q;  2KHJ A;  2O5I C;  3W1B A;  1P8L A;  3KJO A;  1PLF A;  4I7Z C;  1WTR A;  1PZJ D;  4LFC Q;  4FDB A;  4DNR B;  1HNZ Q;  5IT9 c;  3TRZ A;  3TRE A;  1NY4 A;  2PW7 A;  5L37 A;  1B4O A;  4OO1 H;  4DV3 L;  3CW2 C;  5BN4 A;  4A3F G;  1I4P A;  4I7A A;  2B63 B;  1LM0 A;  1CI3 M;  3RLF A;  5C3E B;  2NVT H;  1YEZ A;  3MAQ A;  2NBF A;  1HUN A;  2J4X A;  3K59 A;  2L55 A;  3WDN A;  4DV5 Q;  2JEA I;  1OXU A;  3EFX D;  1SSO A;  3RN5 A;  4LF9 Q;  1IZ6 A;  2WKC A;  4A3C G;  3K80 C;  3S16 B;  1BO0 A;  1WD0 A;  2F3W A;  3E5S A;  5HY6 A;  1Q8K A;  5M5Y B;  3S1R H;  3BZC A;  4ME5 A;  3MZ5 A;  1VQF A;  4RH6 A;  3MTS A;  2KOL A;  4OEM B;  3F1Z A;  1MI2 A;  2V1C C;  5EBD A;  5IYD G;  1F2M A;  3M4P A;  3NQI A;  3SR1 A;  1AFP A;  2E5L Q;  1JJG A;  3I70 A;  3HOY G;  3I4M G;  5I9P A;  3HOV H;  1TVX A;  2QF7 A;  3VR6 A;  3P20 A;  5NUC A;  3VR2 A;  1STE A;  3Q22 A;  2RA4 A;  3HOX B;  3ERS X;  5C4J B;  1KLG D;  3E3X A;  1IYU A;  1CSP A;  1EIY B;  4AYB G;  1WCM B;  4G7O C;  3KLS X;  1VQH A;  1LAB A;  3PIP A;  4LF7 Q;  1X3P A;  2F0G A;  1SJE D;  4B9X A;  4TQU S;  2G9H D;  1D5Z C;  2N8N A;  4CJ1 B;  3KBG A;  1SNM A;  1EL0 A;  3R2T A;  3D0F A;  1NMF A;  2UUB Q;  1CT1 D;  1PA6 A;  2DUD A;  1FNW A;  1LTA D;  4EGV A;  5LMN W;  3CC2 A;  2JXM B;  2Q8I B;  5IP9 H;  3QJY A;  2MNA A;  4A3D H;  4UPA A;  1VQI A;  3RZD H;  4DV6 Q;  1U4L A;  5FOB B;  2F1M A;  3M4O H;  1CKN B;  2KHS A;  4CKC A;  4KKT A;  5GAE C;  1Y1W B;  2AHO B;  3M4Q A;  4A3J B;  2QEJ C;  2B8G A;  4RG1 A;  4JBW A;  1VQL A;  1UAP A;  1A6X A;  4HJ9 A;  4A3B B;  3FMC A;  1N34 Q;  2WKD A;  4FNF A;  1Z47 A;  2GVB A;  2NTT A;  2Z6K C;  3BDL A;  1PH6 A;  3BYY B;  2ZXP A;  4APV A;  4DAY B;  3GTM B;  5K5P A;  1PFB A;  1SR3 A;  2D2C C;  1DM0 B; 
#chains in the Genus database with same CATH homology
 2Z4H A;  2Y0S B;  3MWY W;  3D4W A;  1PZI D;  1F77 A;  1EU4 A;  4C3I B;  1Q1E A;  1K8M A;  2B2T C;  1SYC A;  4H7B A;  2SDF A;  1B53 A;  1CFM A;  1O80 A;  2F0I A;  4RCO A;  1BXT A;  1UUP A;  4U67 3;  5EPJ A;  1F2Y A;  4KJO A;  5I2Y A;  1JWM D;  2F0P A;  1V1P A;  5T1G A;  4EQP A;  1GUW A;  3P7J A;  5K36 G;  3C1E A;  5LL6 S;  4CKE A;  4R8I A;  2SNM A;  3PIP 3;  1J8I A;  3QOJ A;  1TR5 A;  4C3J G;  1Q3L A;  2FMM A;  2B2U A;  1KDB A;  1Z6H A;  1EY8 A;  5EJW A;  2ICI A;  2B8F A;  3G6J B;  1ILP A;  4IFD J;  2R93 B;  4K2K A;  4ID6 A;  4TSS A;  3TP8 A;  1HUM A;  2AQ2 B;  3D6C A;  3LNN A;  2EYH A;  1SE2 A;  3HGB A;  1I4X A;  3WOE A;  4ZRZ A;  3I4L A;  4G57 A;  4NKL A;  4HSP A;  1KLU D;  3KLS A;  4BS9 A;  2E2J B;  1I3Q B;  1YNJ C;  2F0Q A;  4FXG C;  2VNU D;  2X69 A;  4DFA A;  1RCV D;  5IGF A;  3A56 A;  2FFK B;  1EY4 A;  1I4G A;  2WV6 D;  5IGC A;  1XX8 A;  3HKZ B;  4V0B A;  2ICE C;  5ELC A;  2YU9 B;  1G6Z A;  1D5X C;  2J7Z A;  4ILW A;  1QB5 D;  1ZYR D;  1QNU A;  1T5E A;  3J7Y W;  1EYD A;  5C4Z A;  5KRU A;  3MC0 B;  3TBI B;  2NUC A;  3DEO A;  1PTO H;  1MSG A;  5CV8 A;  1TY0 A;  3VYT A;  4IFD I;  2LY7 A;  3A8K E;  4IZ8 A;  1IKM A;  1W6K A;  1I4H A;  3K6O A;  1LO5 D;  3OMG A;  1D6E C;  5CC4 A;  2A73 B;  2A68 D;  1MD2 D;  4ZUI A;  3HOU B;  5KYL A;  2BA0 A;  1A3V A;  3GQB A;  2SEB D;  2PCF B;  1LT3 D;  4KMU C;  1NCV A;  5D3I B;  3PIO 3;  2A6H D;  2EDG A;  2R3Z A;  1SMY C;  1B9M A;  2XNA C;  4A3I B;  2MJ8 A;  2K05 A;  2PQE A;  1MSH A;  3CKI B;  1G8Z D;  1SNP A;  4PV1 C;  1O78 A;  2IJ0 A;  3SXH A;  3ZYY X;  3HG9 A;  1STG A;  2A6E C;  2OEO A;  1D2B A;  4HCE A;  2KUM A;  4IUN A;  5IGE A;  5KNC A;  3J81 E;  3GP7 A;  3KK7 A;  2NVT B;  1V1P B;  4ZYS A;  2RVL A;  1EY5 A;  2CW0 C;  2NWG A;  4QIW B;  2F0F A;  2H1E A;  5JPM C;  2L9H A;  3TDQ A;  1CA5 A;  1HFG A;  5HUR A;  5JJZ A;  3KF8 A;  3VYR A;  1BUV T;  2EYF A;  4EQO A;  3S1R B;  3QIA A;  2HDL A;  3BVM A;  4DK1 A;  4FP5 D;  4RKL A;  5E3F A;  1SYG A;  2HUG A;  3QB3 A;  2Z8L A;  3H91 A;  3NK9 A;  1LT4 D;  3DXJ C;  4CGY B;  1EIH A;  2EY1 A;  1VF7 A;  1L0X B;  4EVO A;  4HR7 B;  5K36 H;  3H3V C;  2EOT A;  1RKN A;  3FRP B;  3SE0 A;  3R93 A;  2OT2 A;  5I6Y A;  1WTX A;  1KTK A;  1ESR A;  1SXT A;  4KTA A;  3JAM E;  1YNN D;  2XN9 C;  1OXS C;  3J7A V;  3RZD B;  3M4O B;  5KEE A;  2KJX A;  4CKB A;  2YYZ A;  1EU3 A;  1M8A A;  2BOS A;  3FDT A;  2EYO A;  5FO8 B;  2RDG A;  4DF7 A;  5CBE E;  3BS1 A;  4RGN A;  4KY6 A;  1SNO A;  2F0K A;  1CZG A;  1HTP A;  2MP1 A;  3DM1 A;  3J7A F;  3GTL B;  2F4I A;  1ZXT A;  4RWS C;  4ULL A;  1KDC A;  3NP8 A;  5F2D A;  4XQN A;  2EY6 A;  3GTG B;  2A69 D;  3H0G B;  1LTR D;  2KCC A;  1HHV A;  1KNE A;  3AB9 A;  3TSS A;  2IPK D;  4P2C B;  1B2T A;  2HCI A;  2JA6 B;  3VR5 A;  2EPB A;  4PMC A;  2B2W C;  3TP6 A;  3P75 A;  4KHZ A;  3I90 A;  3VYU A;  3J81 L;  1HTL D;  2K32 A;  5D3D A;  3NSW A;  1SEB D;  3G7L A;  3DWQ A;  4IUT A;  4RA8 A;  4ZQ3 A;  2WB1 B;  3DHQ A;  2EYJ A;  1HXY D;  2RKS A;  3ND8 A;  4Z9C B;  1H9J A;  5DM6 3;  3W3A A;  1Y8N B;  2K5W A;  4C3H G;  2RSN A;  4FF3 A;  2TMP A;  1FD7 D;  4DAP A;  1QIL A;  2K03 A;  1GHJ A;  5DEH A;  1JWU D;  2Q8T A;  2HCC A;  4QB4 A;  1GUG A;  5CV7 A;  3PMF A;  1CK1 A;  2L11 A;  4UDU C;  2B2U C;  1ILQ A;  1BOS A;  3T4A C;  1NR2 A;  2F0H A;  4A3F B;  4RHS A;  1E2V A;  1QWY A;  4ZAI A;  3EVQ A;  1D1I A;  2BE5 D;  2F0L A;  4ODG A;  3JAM L;  1GUO A;  3NBH A;  1STY A;  1JWS D;  3M3Y B;  1NR4 A;  2B2V A;  5J1Z A;  1B1Z A;  1AZQ A;  3PV0 A;  5EKI A;  1FNU A;  2AUK A;  5JAV A;  5CBA E;  1HQM C;  1PTO B;  4WJW A;  5JEA G;  3ND9 A;  4IUU A;  1SE4 A;  4H13 C;  4H44 C;  3BDC A;  3HOY B;  3I4M B;  1TS4 A;  4K2L A;  1SAP A;  2EY5 A;  2VB3 X;  1VF5 C;  4NMZ A;  2AWN A;  4AYB B;  3HS0 C;  4HED A;  3NQT A;  1K83 B;  2A5H A;  5FO7 B;  1ZKO A;  4QUF A;  4DAV A;  5CYU A;  2WP8 J;  1VMC A;  4K8J A;  2K5Q A;  4F7X A;  2MUY A;  5IGB A;  3OHX C;  1ZYR C;  2RDF A;  2O5J C;  1TS5 A;  3K5L A;  2K6A A;  1DD2 A;  4LMQ D;  3E0J A;  5KYI A;  1LT6 D;  2L0C A;  3CRK C;  4ZK9 B;  1CA6 A;  4K5X A;  1U4R A;  2F0J A;  4XQQ A;  4XTC S;  3A7A B;  3BVZ A;  3C46 A;  1ENA A;  3RD4 A;  3PO2 B;  3I4N B;  5D65 A;  2KQ3 A;  3GO5 A;  5IT9 E;  3L3O C;  2A68 C;  5EPL A;  1C4Q A;  2K28 A;  1SDF A;  2JE6 I;  3MFG A;  4H0L C;  3TN2 A;  3QO2 A;  1IW7 D;  1S5F D;  3A8J E;  2A6H C;  3RZO B;  1NSN S;  5CR3 A;  3EA6 A;  4K8I A;  3N52 A;  1STB A;  2R6G A;  1H9K A;  4R9W A;  3BG3 A;  3U9S A;  1V8Q A;  3UI2 A;  4KD3 A;  3MXU A;  1LV9 A;  2F0E A;  1AP0 A;  5M9O A;  3T53 B;  4Y7N B;  3QWN A;  4C3J B;  3ERO A;  1GUT A;  1GXD C;  5T1I A;  1PRT D;  2QKI C;  5BN3 A;  1GJX A;  5IIF A;  2LKV A;  2JA5 B;  1FR3 A;  1ML0 D;  3R2I A;  2F0T A;  4XDX A;  1SE3 A;  1S4Z A;  3LWE A;  1PFN A;  2EJG C;  3VR3 A;  2ID0 A;  4KK7 A;  1F9P A;  1W6J A;  4CJ2 C;  2BA1 A;  1BBX C;  1PDQ A;  1MGS A;  1HPC A;  1JQY D;  3A54 A;  2JYO A;  3SEB A;  3K7A B;  1L0Y B;  4KJN A;  4K5V A;  4LK1 C;  4QF4 A;  3TZU A;  2F3V A;  2N88 A;  4XQJ A;  1A3T A;  1PTO C;  3OW7 A;  3CRL C;  2QCP X;  4OIJ A;  1TKW B;  3I72 A;  1RF2 D;  4FF2 A;  3K5O A;  3AMU A;  2Z4I A;  4KV6 A;  5C44 B;  4RKB A;  1H9M A;  3OSO A;  3V2T A;  1YNN C;  1S5C D;  3MXN A;  4MIU A;  1HCZ A;  1STH A;  2A74 C;  1PMR A;  3R8B A;  1NAP A;  2L12 A;  3O13 A;  1RTN A;  1JOK A;  5JEA H;  1BF4 A;  1D1K A;  4CHT B;  5HGT A;  1G2S A;  4KHV A;  2QDB A;  5IT9 L;  2JP1 A;  2AQ3 B;  3HOW B;  2IT1 A;  3C3L A;  5E1F A;  4R8N A;  1JB3 A;  3SK5 A;  1IKL A;  3GTO B;  2EZV A;  1ROD A;  3A55 A;  4IUP A;  1FYC A;  2RBM A;  5JVH 3;  4LJZ C;  3WOF A;  2A69 C;  3L9A X;  3MVV A;  4NP5 A;  3PUW A;  1EY6 A;  1Y8P B;  2X6L A;  1Y1V B;  3ITP A;  3OIP A;  3Q23 A;  4C56 C;  5C6A A;  5CGK A;  1Y69 U;  2CVR A;  3E6Z X;  1PFM A;  3DEP A;  3K0Y A;  4BBR B;  5A2Q L;  1LT5 D;  5ELE A;  1WTW A;  3PUV A;  1TT2 A;  1A2U A;  1EYC A;  2NVX B;  3H6M A;  3V96 A;  2TSS A;  2WIN B;  2VXW A;  2E2H B;  4A3E B;  2VB2 X;  3P1H A;  1BDO A;  3HEJ A;  1EEF D;  4ABN A;  1EOT A;  1PRT B;  2ZXO A;  3KLR A;  2KVM A;  3NE5 B;  1TQO A;  3CQZ B;  1F2Z A;  2IL8 A;  1HFN A;  4ZLT F;  3QOL A;  1SND A;  3T13 A;  3K5M A;  3PUY A;  1NUC A;  5FK9 C;  5KIX A;  3NPP A;  1LTG D;  5COR A;  2KED A;  3K5N A;  2B2V C;  2AWO A;  2BE5 C;  5C5M A;  3D4D A;  5C4X B;  1HA6 A;  2B2T A;  5I9O A;  2XWB B;  1F9S A;  1FNV A;  1MBY A;  3HOV B;  1JOR A;  1EEI D;  1PTO F;  1X3Q A;  2M9V A;  2NN6 G;  5J22 A;  4RHR A;  3DWP A;  4MN3 A;  1D5M C;  3I3C A;  4XYQ A;  1QOH A;  1F9R A;  1M4V A;  4FO2 A;  1QJO A;  1DOK A;  1RTO A;  2B2Y A;  1PTO D;  1CM9 A;  2HQE A;  1EYA A;  4I65 A;  4M8A A;  1B44 D;  3NHH A;  3MXG A;  3D31 A;  4C1N I;  4HN7 A;  4F88 A;  4IN3 A;  2OF1 A;  5C3W A;  4A3D B;  4RGO S;  2EE1 A;  3EJI A;  2CQA A;  3M4Y A;  3IAY A;  2WAC A;  1SYD A;  1DZ1 A;  5I6W A;  3X3M A;  4WFN 3;  2IX1 A;  5CV4 A;  2F0M A;  4OGQ C;  1LTB D;  4F87 A;  1F2L A;  1B50 A;  4K14 A;  2EXZ A;  4J6H A;  2K7V A;  2E76 C;  4WRD A;  2EYP A;  1HA5 A;  3AU7 A;  3FPU B;  1EWH A;  3ERQ A;  3IKJ A;  2NN6 I;  5DM7 3;  3D3R A;  1JE4 A;  3OMC A;  5TSS A;  3GTP B;  2NVY B;  4K5W A;  2ENB A;  1BCP F;  3VA7 A;  5IOC A;  3FVQ A;  5M5X B;  1AW7 A;  1DOL A;  4KN7 C;  2DNC A;  3OIQ A;  1QCB D;  5EBC A;  4X3K A;  1WVL A;  1STN A;  5E4X A;  4QCL A;  4C3H B;  1SYE A;  1IW7 C;  3R3O A;  1BCP D;  1Q12 A;  1V1O A;  5JPN C;  2O2L D;  1ET9 A;  2RSO A;  3VYS A;  1BR9 A;  4ZKC B;  1CHP D;  3ONA B;  4FF4 A;  1TS3 A;  3TZD A;  2F0N A;  2MPM A;  1AZP A;  2ZXR A;  3PUZ A;  2R92 B;  1G2T A;  1U4M A;  4B08 A;  3BYT B;  3QG1 A;  1GOZ A;  1PRT C;  2H4O A;  3NTI A;  4E6I A;  1S5B D;  1A15 A;  2QIL A;  4RGT A;  2BDO A;  3C2P A;  3BVG A;  1DJR D;  1EZ6 A;  1ENF A;  5ELB A;  2XRS D;  1WD1 A;  1TWF B;  4A93 B;  3FEW X;  4N9T A;  3W2D A;  1E2Z A;  1PYW D;  4KY5 A;  1OXV A;  2RDH A;  3D4R A;  4ZUJ A;  2MGS A;  1EY9 A;  2EY2 A;  2PW5 A;  3MXP A;  1LTS D;  4O1N A;  4O42 A;  5KGU A;  3S17 B;  4TRD A;  1Z7T A;  4PMB A;  1FGB D;  1H9R A;  5JOB A;  1SBB B;  5EQ0 A;  2E74 C;  1BNZ A;  4FXK C;  1B9N A;  1I4Q A;  1XYI A;  4Q5V A;  1KDA A;  4G7H C;  5JEA J;  3S2H B;  3CU7 A;  3FPP A;  1K8O A;  1KAA A;  1QG7 A;  4ZKB B;  1QE6 A;  1WTO A;  2NN6 H;  1SFO B;  1U9R A;  4BY1 B;  2PMZ B;  5AFW A;  5ELD A;  3VA5 A;  1O7L A;  1CQV A;  2NZ1 D;  4FXD A;  4XT1 B;  3GV6 A;  3OWF A;  1DCZ A;  1I6V C;  1RD9 D;  1VCI A;  2D9U A;  3NWT A;  4XXE A;  4V19 0;  5C0X H;  2C5C A;  1Q1B A;  4TKO B;  3Q24 A;  4K6D A;  4B9W A;  3IL8 A;  1XXG A;  4G7Z C;  4K6L A;  4M1U B;  1I6H B;  1E2W A;  1WTP A;  2JSO A;  4BWG B;  4OHJ A;  3NWS A;  3RMH A;  4X3T A;  3HOZ B;  4CBV A;  2MHV A;  3OPO A;  5FLX L;  1CHQ D;  2BCO A;  2KA7 A;  3SK4 A;  2E75 C;  2KCN A;  3GD7 A;  1I4R A;  3S14 B;  5D14 A;  3K58 A;  1RJT A;  3S2D B;  1JOQ A;  4XYO A;  2VUM B;  1BCP B;  2I46 A;  4RAU C;  2L4N A;  1DOM A;  2F0D A;  2F0S A;  4DK0 A;  5C5L A;  1LAC A;  4KY7 A;  4L6T B;  1IL8 A;  3J80 L;  2AUJ D;  1TY2 A;  2NTS A;  2N55 A;  1PRT F;  4LAA A;  4Q0F A;  3S9W A;  2SOB A;  1UEA B;  2B2W A;  3M7G A;  4WOR A;  1VDZ A;  1TU2 B;  2XSC A;  2EYM A;  2XRQ D;  3GTJ B;  4DA2 A;  5A2Q E;  1R9T B;  3BZD B;  1E0B A;  1H9S A;  2NVQ B;  1SNC A;  3CHB D;  1EFI D;  1ENC A;  4N9P A;  2R61 A;  4BA1 I;  4BY7 B;  1KAB A;  1AN8 A;  5M5W B;  2WAQ B;  1LLR D;  4UAI A;  2E2D C;  4DXG A;  5I4D A;  2O4X A;  1O7Z A;  1C48 A;  1JIC A;  3SVM A;  2IX3 A;  2R7Z B;  5I2X A;  2PNR C;  1VMP A;  2B2Y C;  1EQV A;  4QMG A;  2V4D A;  2IWH A;  5A35 A;  1TWC B;  4L8J A;  5COY A;  3NXW A;  3S1Q B;  5KNB A;  2D5D A;  4YIJ A;  5KND A;  3NTK A;  1R4P B;  4C3I G;  1CZW A;  3MA2 B;  1LTT D;  2Q8R E;  1RDP D;  4KN4 C;  3DMU A;  1DON A;  4IFD G;  4G4K A;  5ELF A;  3I8Z A;  2OXP A;  1JOO A;  2DY8 A;  4MHE A;  5C3X A;  2G9D A;  4KD4 A;  2PZW A;  3BDO A;  2AQ1 B;  2PZT A;  3TP5 A;  2PYK A;  2X6G A;  3EQL C;  3LWU A;  4HMI A;  5CMD A;  3NTH A;  4HMJ A;  3DWA A;  1B3A A;  1DYQ A;  3M85 A;  2C9O A;  4HTH A;  1DXM A;  1IHZ A;  4S3S A;  3N6R A;  5IOD A;  1ZEQ X;  2PZU A;  3PUX A;  5ISR A;  1TWA B;  2F0W A;  4PQX A;  3RUZ A;  1F9Q A;  4DXF A;  1T5X D;  4BA2 I;  1AEX A;  3S1M B;  4C2M B;  3URY A;  1BCP C;  3FKI B;  2DN8 A;  1STA A;  4A3G B;  3A7L A;  4BBS B;  4RCN A;  3S1N B;  5G3L F;  4J8Q A;  4RFB A;  3HP3 A;  4EQN A;  1LTI D;  4RGM A;  3L7Z C;  2LFN A;  4IUV A;  4KI0 A;  5G3L D;  2PPB C;  3OOC A;  4GZY C;  1H9S B;  4DU9 A;  4PMW A;  3VR4 A;  5JVG 3;  5FO9 B;  5M3F B;  1A3U A;  3D8G A;  3K57 A;  1BQQ T;  4XIG S;  1A2T A;  2K33 A;  5EKL A;  2B39 A;  3SDZ A;  5IGG A;  4HAE A;  2J0T D;  1EY0 A;  4F8M A;  2JA8 B;  1GUS A;  3SHL A;  1HRJ A;  4FVM A;  1ET6 A;  1C8C A;  1PZK D;  5C4H A;  5DNF A;  3I73 A;  1EWC A;  2XWJ B;  1ONL A;  1TII D;  1XWE A;  2KEC A;  4IUQ A;  3HRZ C;  4QUC A;  2D62 A;  1XTC D;  1Y8O B;  1U4P A;  1TWH B;  3GTK B;  1CQF A;  2BDN A;  4U68 A;  3T56 B;  2DY7 A;  1G91 A;  3PO3 B;  1S5E D;  4OIK A;  1TWG B;  4OO1 G;  4A3K B;  5C0X G;  5J39 A;  5CV9 A;  5C0X J;  2DNE A;  4NW2 A;  2K1B A;  2SNS A;  1J9O A;  4KKS A;  4DNT B;  2GA4 B;  3NUC A;  1S5D D;  3MEH A;  3A8I E;  2LMC B;  1Q8I A;  1EZ8 A;  3S15 B;  3MHB A;  1WTV A;  1KNA A;  3KBX A;  1QNK A;  2RQX A;  1SYF A;  1OO9 B;  2I07 B;  3MFY A;  5BN5 A;  4IFD H;  2WII B;  1II3 A;  1EQT A;  2KEE A;  1YNJ D;  2ZT9 C;  3U9O A;  2PO4 A;  4IUR A;  3GTQ B;  4IAL A;  1I50 B;  3TME A;  1SYB A;  1RHP A;  3SK8 A;  2E2I B;  4IQZ A;  2L1B A;  4C1N K;  1JR0 D;  3Q0A A;  4DGZ A;  5EGT A;  2F03 A;  3M7N A;  3IFT A;  4FYD A;  1EY7 A;  3DUZ A;  4J1M A;  2FHT A;  3T51 B;  5DAU A;  1SNQ A;  1GHK A;  1V43 A;  2EVB A;  3C1F A;  1OXX K;  4OO1 I;  1HQR D;  2CHB D;  4X3U A;  5EPK A;  2EJM A;  4DN4 M;  3X3N A;  1SJH D;  4HSV A;  5C0X I;  1PXU A;  3H09 A;  3LX0 A;  1EIG A;  1X32 A;  2HDM A;  4NDX A;  2JEB I;  4XT3 B;  3SK6 A;  2F0U A;  3HZX A;  2Z1C A;  4PNY A;  1G29 1;  3V05 A;  2M2L A;  5FLX E;  1TS2 A;  4OL7 A;  5IGD A;  2FJ2 A;  4A3M B;  1O7Y A;  2K01 A;  5LL6 X;  2L5T A;  5EKK A;  5CV6 A;  2FIN B;  3NBI A;  2EJF C;  1SMY D;  1R4Q B;  3T16 A;  1JCK B;  3I91 A;  3OWE B;  1CTM A;  2F0V A;  3KUP A;  2NB0 A;  5LHY 1;  1WTQ A;  1IYV A;  4DAY A;  1ICW A;  2FMC A;  4HCS A;  2A6E D;  3J80 E;  1GUN A;  3Q6S A;  1Q90 A;  4KKU A;  2JA7 B;  2LS0 1;  2EYL A;  1JC7 A;  2XVS A;  2IW3 A;  2CW0 D;  1ESF A;  4X3S A;  4FF1 A;  3F2U A;  3H94 A;  3IFD A;  1OXT A;  5M3M B;  2K04 A;  1UNS A;  2K5D A;  3GV3 A;  2M00 A;  3D6W A;  2NYZ D;  3TP7 A;  2XIW A;  2IX0 A;  4JK1 C;  2F0O A;  4CJ0 B;  4L63 B;  5CV5 A;  5FKA C;  2O5I C;  1PLF A;  4I7Z C;  1WTR A;  1PZJ D;  4DNR B;  2PW7 A;  1B4O A;  4OO1 H;  5BN4 A;  1I4P A;  2B63 B;  1CI3 M;  3RLF A;  5C3E B;  3MAQ A;  2NBF A;  1HUN A;  2J4X A;  3K59 A;  2L55 A;  3WDN A;  2JEA I;  1OXU A;  3EFX D;  1SSO A;  2WKC A;  3S16 B;  1BO0 A;  1WD0 A;  2F3W A;  3E5S A;  5M5Y B;  4ME5 A;  3MZ5 A;  4RH6 A;  3MTS A;  2KOL A;  1MI2 A;  5EBD A;  1F2M A;  3NQI A;  3SR1 A;  1AFP A;  3I70 A;  5I9P A;  1TVX A;  2QF7 A;  3VR6 A;  3P20 A;  5NUC A;  3VR2 A;  1STE A;  3Q22 A;  2RA4 A;  3HOX B;  5C4J B;  1KLG D;  1IYU A;  1WCM B;  4G7O C;  3KLS X;  1LAB A;  1X3P A;  2F0G A;  1SJE D;  4B9X A;  4TQU S;  2G9H D;  1D5Z C;  4CJ1 B;  3KBG A;  1SNM A;  1EL0 A;  3R2T A;  1CT1 D;  1FNW A;  1LTA D;  4EGV A;  2JXM B;  2Q8I B;  3QJY A;  1U4L A;  5FOB B;  2F1M A;  2KHS A;  4CKC A;  4KKT A;  1Y1W B;  4A3J B;  2QEJ C;  2B8G A;  4JBW A;  1UAP A;  1A6X A;  4A3B B;  3FMC A;  2WKD A;  1Z47 A;  4FNF A;  2NTT A;  3BDL A;  3BYY B;  2ZXP A;  3GTM B;  5K5P A;  1PFB A;  5E4W C;  2D2C C;  1DM0 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...