2B2YC

Tandem chromodomains of human chd1
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
86
structure length
86
Chain Sequence
b'EEFETIERFMDCRIGRKGATGATTTIYAVEADGDPNAGFEKNKEPGEIQYLIKWKGWSHIHNTWETEETLKQQNVRGMKKLDNYKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chromodomain-helicase-DNA-binding protein 1
publication title Double chromodomains cooperate to recognize the methylated histone H3 tail.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Peptide binding protein
total genus 22
structure length 86
sequence length 86
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 2005-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00385 Chromo Chromo (CHRromatin Organisation MOdifier) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2b2yC00
5EKIA 1G91A 1JICA 1EL0A 2KEDA 2DY7A 3QO2A 1RTNA 1E0BA 4HCSA 4OIJA 4CJ0B 1BBXC 4IUTA 3IFDA 4NW2A 4R9WA 3I90A 5EJWA 2B2WC 4DN4M 5EPJA 2RSNA 4QUCA 1EIGA 3P7JA 1B3AA 3ONAB 3N52A 3UI2A 1G6ZA 1ESRA 1HFGA 2FFKB 4XDXA 1SDFA 3MTSA 2R3ZA 3FDTA 3H91A 1F9RA 4XT3B 3R93A 1JE4A 1O80A 3SVMA 1ILQA 1RHPA 2RA4A 3DM1A 1AZPA 1ILPA 1Q3LA 2B2UC 2HUGA 3Q6SA 4ZLTF 2KOLA 1G2TA 1DOLA 1S4ZA 2L4NA 1PFNA 1X3PA 1SSOA 2CVRA 1MGSA 2HDLA 4CJ1B 1QNKA 4X3UA 2RVLA 1NAPA 5D65A 1KNEA 2B2UA 1BO0A 4IUQA 5E4WC 4QUFA 1WTRA 1HHVA 1WTOA 2EOTA 3FPUB 1WD0A 4HAEA 1RODA 2KEEA 2HCCA 1PFMA 5DNFA 1DONA 2Q8TA 1C8CA 1IKLA 1U4MA 2BDNA 5AFWA 1ZXTA 5COYA 5CBAE 2FINB 2IL8A 1VMPA 1NCVA 2MJ8A 1WTXA 3F2UA 2B2VA 2SDFA 3D6WA 1TVXA 2M2LA 1RTOA 1EQTA 2X6LA 2JP1A 3MWYW 4MHEA 3TN2A 2EPBA 1PDQA 5T1GA 2KUMA 1M8AA 3G7LA 4ZKCB 1DZ1A 1HUNA 2X6GA 4R8IA 1SAPA 1U4RA 1U4PA 2D9UA 2KECA 1ICWA 4RAUC 4RA8A 3HP3A 1NR4A 2XIWA 3GV3A 1HUMA 2K28A 5E4XA 1G2SA 1A15A 1QE6A 4U68A 1WVLA 3TZDA 1MI2A 4ZK9B 3GV6A 2FHTA 1IL8A 4MN3A 4X3SA 2B2VC 2DY8A 1HRJA 4HSVA 1U4LA 5CBEE 2N55A 4RWSC 4HEDA 1WTPA 1WTWA 1O7YA 2B2YA 3I3CA 2K03A 3I8ZA 5EPLA 3KUPA 3LWEA 1XYIA 1WD1A 2NZ1D 1DOMA 1CA6A 2HDMA 1IKMA 1PFBA 1X32A 1F9SA 2B2TA 1F2LA 5T1IA 4XT1B 1AZQA 2NWGA 2HCIA 4X3TA 1B2TA 1J8IA 2L12A 4LMQD 1AP0A 1MSHA 2RSOA 3DEOA 4UAIA 4X3KA 2Q8RE 1F9QA 1WTVA 1ML0D 1B50A 4IUVA 4OIKA 1EOTA 2L9HA 1F9PA 1XX8A 2VXWA 1VMCA 2X69A 2J7ZA 3IL8A 2B2YC 2L1BA 1NR2A 2H1EA 2K01A 2NYZD 1BNZA 1CA5A 2FJ2A 1EIHA 1QG7A 1X3QA 2MP1A 1O7ZA 1J9OA 2B2TC 5JJZA 4ZAIA 2B2WA 4O42A 4CJ2C 2MGSA 2MPMA 1CM9A 1B4OA 2JYOA 2K1BA 4IURA 1HFNA 1DOKA 2K05A 3KBXA 2K04A 1BF4A 1GUWA 4ZKBB 1MSGA 2KVMA 1B53A 3DEPA 2N88A 2FMMA 5D14A 5EPKA 3I91A 1LV9A 4IUPA 5CMDA 1HA6A 5CORA 2L11A 5EQ0A 2EE1A 1KNAA 4IUUA 1WTQA 1RJTA 1PLFA
chains in the Genus database with same CATH superfamily
5EKIA 3MVVA 1IYUA 3QO2A 1VF5C 2DY7A 4OIJA 2UXDL 2WACA 4FO2A 4PG3A 1PH2A 4ZQ3A 1PTOD 4JC0A 3PO2H 2RDFA 3HOXG 1HFGA 3HOXH 1V1OA 1LT4D 1A2TA 3SVMA 4CBVA 1TWFH 1GJXA 5JJLA 4CGYB 3SEBA 3TS2A 3TP7A 1VF7A 2QA4A 2LXJA 2HUGA 3GD7A 4YWLA 1U5KA 4B9WA 3GTLB 5IGDA 4QY7A 4Y7NH 4RCOA 5H1SE 3EJIA 5ELOA 1NTGA 5GAGC 5D65A 1K8MA 1Y8OB 3A55A 1S5DD 1TS5A 4AYBB 1WD0A 3UE0A 3NTIA 1GUOA 1K3BC 3X3NA 1CI3M 4FF4A 2FINB 4ZCKA 4BXXG 4OO1H 2R92G 1LT3D 5F2DA 3PO3G 1PRTD 5JAVA 1AH9A 1GVPA 5FO8B 3JC66 4GOPC 1JOOA 4NKLA 1I4RA 3ULPA 4K0KQ 1TWGH 1HZAA 4KTAA 4DK3C 1UE6A 4OX9L 1VS0A 3KLRA 2VUMH 4G57A 2FHTA 3BYYB 1LTLA 4LFBL 3S2DH 5KYIA 4KHPL 4OL7A 2N55A 1WTPA 1WTWA 2UUAQ 4IJLA 4O0AA 3TP8A 3S1NB 1VQLA 2A5HA 2JJQA 1FYCA 2B2TA 3T1HL 2PYKA 2A69D 3U9SA 3MA2B 1K8GA 3CC4A 4LFBQ 5ELFA 2E75C 5IYCG 1HNXQ 5L37A 5IYCH 2PZTA 1VQ5A 3PUVA 5C0XH 3EBEA 3SHLA 3DWQA 4JBKA 2H1EA 1FR3A 2BA0A 2NYZD 4A3CG 4PMWA 3I4NB 3W5OA 1CSQA 1Z7TA 5IP9G 4AH6A 1LTSD 5IP9H 2OWOA 5IT9c 5JJKA 1QUQB 5C44H 3DXJC 3J81L 5CMDA 3E9HA 1UE7A 1OXXK 1XPUA 1RF2D 4LF6Q 1NBWA 3A54A 4KD3A 3CPFA 1RTNA 4DR6L 4DR2L 2V4DA 2YYZA 4DKAC 4IPGA 1JR0D 4UHVA 4DV6L 1EIGA 2DN8A 1EY5A 5KYLA 3J7ZC 2SEBD 4C3JB 2R93B 4XDXA 1IBLL 1NMFA 3NHHA 3O13A 5GROA 4DK0A 3D31A 2EY5A 1IXRA 4QMGA 3CC7A 2E2HB 5IWAL 2A6EC 4X66Q 1LACA 1EWIA 4DR6Q 4DR2Q 3S15H 3KDFA 4LF4Q 1KLUD 4DV6Q 2K75A 4DV4Q 2UUBL 1K28A 4DK6C 1YHAA 3VYRA 3NK9A 2EJFC 1V1QA 2C9OA 4QB4A 1O7LA 3W3AA 5AFWA 5COYA 4IOCA 5KIXA 2IL8A 1UEBA 4LFAL 3PGZA 1HQMC 3S14H 3L0OA 2JA8G 3NBHA 4GNXB 1TIID 5C3EB 4BWGB 2D9UA 4JVZA 3PO2B 3NTHA 2ES2A 2XIWA 5M5YB 4LFAQ 3U58A 1TWFB 4DFAA 3OPOA 3LX0A 1HA5A 1VQNA 3GV6A 4JBJA 1M4VA 2F0JA 1U4LA 3RD4A 4A3KG 1RCVD 2PQAA 4A3KH 1IZ6A 4HSPA 1LTTD 5EPLA 3HKSA 1XYIA 2NZ1D 2PMZE 3TBIB 1JWUD 1AW7A 5CV9A 4A93G 4BBRB 2YU9H 1TWAH 3HOYG 1EU3A 2L12A 2E5LQ 3LGJA 4JI6L 2F3VA 3HOZH 5M5WH 1PH9A 2F4VL 4OWXB 1EWHA 3NQIA 2LXKA 4L6TB 2J7ZA 3K5NA 3R3OA 3BJUA 1NR2A 3MFYA 3MEFA 4I7ZC 4XXEA 4OWTB 4JI6Q 1TWGB 2F4VQ 2OQ0A 1DOKA 3IKJA 2Y0SG 5GAHC 4BY1B 1G6PA 2VUMB 2AQ2B 1Z6HA 3SK8A 5EQ0A 2EE1A 1VQ4A 3CCLA 1H9JA 5IYBG 2A73B 5IYBH 5C3WA 1TY0A 1ASYA 1SFOH 4LF5L 2NN6G 5JJIA 4R4TA 2NN6H 1BR9A 2DGYA 5ELCA 4ID6A 1F9RA 3RN5A 2RA4A 3DM1A 4A3BG 5IIFA 4GNXC 5TSSA 4B3RL 4DAYA 1WYDA 2QKIC 3R2TA 3MHBA 1NAPA 4IUQA 3NEMA 1CFMA 1R4PB 2DJFC 1HR0W 3NP8A 3CCUA 1KDAA 2AWOA 5C44B 2V1CC 1Z47A 1IKLA 5IOCA 1JB7A 4FNFA 5IE8A 1VMPA 3VR2A 2MJ8A 3KDFB 1Q46A 1ESFA 3T51B 3D6WA 4RGNA 1AE2A 1V1PB 2X6LA 3JAME 1EQQA 1M8AA 4ZKCB 1HUNA 5C4XB 4R8IA 1FNWA 2JA7G 1U4PA 2RBMA 5FLXc 1CKNA 1EQRA 2KECA 4WRDA 1A3TA 2EIFA 1HUMA 2JEAI 1EFWA 2XRQD 3RLOA 3KF6A 3W2DA 4DR5Q 3M4PA 3NWSA 2JA5B 5M3FB 3NBHB 3S15B 3KYHC 3HFZB 4KY7A 1MHWC 3CHBD 1X3GA 3I3CA 1SROA 4YCVA 5M5XB 1QWYA 3W1GA 2Z1CA 1D5XC 3I73A 3ND9A 1N34L 4DR7L 1FVIA 3T16A 4C2MH 4XT1B 3H94A 5M3MG 4HJ7A 1FGBD 1JJ2A 2GVBA 4LMQD 5M3MH 1AP0A 1MSHA 1HTLD 4B3TL 3TS0A 1YVCA 5ELBA 5FKAC 4XIGS 1F9PA 1CKMA 3WOFA 1OTCA 1Q8KA 4AQYL 1VQPA 4K6DA 4DR7Q 5KGUA 1VQCA 2ENBA 2Q2HA 3NSWA 4HMIA 1QG7A 2XTIA 1O7ZA 3VYSA 5JJZA 5IYDG 2Z4HA 2ZJRA 1NE3A 4B3TQ 5IYDH 4F88A 1E24A 3I91A 4J8QA 4AQYQ 1HA6A 3C3LA 3ICEA 1WTHA 1KNAA 1SEBD 1VQ6A 4OELB 1EL0A 1D1KA 3BZCA 3H0GG 5EBCA 1YBYA 1E2WA 1TY2A 3I90A 1G8ZD 2QEXA 2C35B 3GTKB 3HOZB 5M5WB 1XWEA 4KV6A 1H9MA 4A3MG 3S16B 1ILQA 2ICEC 3H15A 4A3MH 3NE5B 1ONLA 1CZWA 1YJ9A 1S4ZA 5LL6S 1PFNA 2HDLA 4PZ6A 4TKOB 4GLAC 3VR5A 1UNSA 1KQSA 4DPGA 3PF4A 1RODA 1B9NA 4A3IG 1ENFA 4XYOA 2Q8IB 4JI0L 3QOJA 3RMHA 1LTRD 5CBAE 1BBWA 2N8NA 1ET6A 3MXPA 4H44C 4KN4C 4DAYB 2ALYB 3E0JA 4DV1L 2IWHA 3Q23A 3G7LA 4DUYL 1C0AA 1YNNC 2K7VA 4ALPA 2XSCA 1A0IA 2HIXA 4IFDI 2Q2TA 3D3RA 2N3SA 1I50H 2EYHA 1KDCA 1WI5A 4JOIC 4PQXA 1VQHA 4DV1Q 2SOBA 3B6YA 4JYAL 1EZ8A 1PH3A 4M1UB 1SXTA 1QZGA 3I72A 2LFNA 3U4VA 3E0EA 5FK9C 4K5XA 4DU9A 1VQKA 1PZID 1J8IA 3E3XA 2OEOA 1S72A 2KCMA 2A68C 3KJOA 4IPDA 1E22A 2O5IC 2OXPA 4OGQC 1ENCA 1KHIA 3K5OA 2X69A 3OIPA 3H3VI 3RZDB 3NPPA 1SE4A 5IT9L 1I6HH 1L1OA 1J5EQ 3BDLA 2B2WA 4O42A 1HXYD 3NUCA 1RKNA 3J80E 1X3FA 3DEPA 3I2ZA 1YNJC 5BR8L 4KKUA 4WJ4A 4QL5A 2BH8A 1R4QB 2L11A 2K4KA 2AKWB 1QNUA 2Z0SA 1G91A 1JICA 4POFA 3QG1A 4ME3A 1KRSA 4C2MB 4NW2A 2RSNA 5J39A 3UI2A 2EYMA 3M9BA 1G6ZA 1LTGD 1GHKA 2BH2A 1HH2P 2R3ZA 1Q86C 4BBSH 2LKVA 5BN3A 3MXGA 4AYBG 2K32A 3OWEB 4KHVA 4OONA 1Q1EA 4QF4A 3X3MA 4EQ5A 4DAVA 1EIYB 2WKDA 2KOLA 3K7UC 1VQBA 4CJ1B 1MGSA 2IHEA 3KLSA 4JI7Q 4DXFA 4LF8L 2M00A 3K81C 2KCTA 2EY2A 4LJZC 3G71A 1DONA 1TKWB 2XNAC 1TR5A 3L2PA 1BVSA 2I5HA 5LL6X 3M7NA 1TWCB 3A8IE 3I7FA 1N33L 2CH4W 3HKZB 3VYUA 2HT1A 1NR4A 1QVCA 3A0JA 1XJVA 4P73A 1QE6A 1STAA 1WVLA 1M1KC 5LMNW 2OT2A 1NNXA 4H02A 5I4DA 5CBEE 4HJ9A 1GUTA 2F0OA 1O7YA 1OO9B 5BN4A 4JI1L 2Z6KA 4KK7A 3ZJYC 1AE3A 1U0LA 4P74A 5GAEC 3EIVA 3BG3A 4DUZQ 2JN4A 3T13A 5HY6A 5IP7G 4JV5L 4X64L 3I4NG 3OTOL 5IP7H 1CTMA 4OIKA 3STBC 4LUZA 1VMCA 3V96A 4H7BA 4JI1Q 4RKLA 1PRTF 3A5ZB 5J3BA 1XNQQ 2K01A 5FO7B 2FJ2A 1BUVT 1UE5A 1QJOA 4XTCS 4CJ2C 1HNWQ 1I50B 2K1BA 1D8LA 4YCUA 2K05A 1HCZA 1FJGL 4LNQA 3KFUA 4C3JG 2R93G 5M9OA 4C3JH 2OF1A 4DR3Q 4LFCQ 2R93H 1WTQA 1H9SA 4FXKC 3T4AC 1L1OB 5DEHA 3IFDA 5E7NA 3I4MG 3J7AV 3P7JA 1B3AA 3AFPA 2AUJD 4X62L 3SK6A 1TU2B 1YNXA 4DXGA 3CPWA 4XT3B 5ELEA 5JEAG 2JA6H 3Q8DA 3WDNA 2B8FA 4R4QA 1Q90A 1MBYA 3A5UA 1SYEA 2BE5C 2L5TA 2WAQB 3DMUA 4R1JA 3CCVA 3KOJA 3AU7A 2QDBA 4F87A 4ME5A 4G7HC 4X6AH 4JI5Q 1SE8A 4JI8Q 3ZYYX 2Q8TA 4ZRZA 5C3EH 3PO2G 2A6HC 2F0KA 2I0QA 5JEAJ 4C1NI 1OXTA 3KLSX 5M5YH 3OMGA 2B2VA 2SDFA 3TQYA 5FLXL 1I4QA 1TVXA 4MHEA 3A8KE 2FXQA 3GO5A 4LWCA 4NP5A 4BY7B 4F7XA 1JOQA 5A2QL 1Y8PB 4B08A 4FVMA 4RAUC 1SJED 3QOLA 2K5WA 1JC7A 4BBSB 1EOVA 1A15A 4BBRG 4PNYA 4BBRH 4MN3A 4CDEC 2AHOB 1PHJA 1PV4A 2KHSA 4K0KL 4UPAA 1OXSC 2F52A 2HHHQ 4OO1G 3V05A 1Q82C 1QB5D 1K0RA 5FJ8H 1P16A 2AUKA 3I70A 1EYCA 1ZYRC 1E2VA 5HGQA 3E9IA 4KLKA 2NVXH 2Q8RE 3TSSA 1MJEA 2UUAL 4EGVA 2F4IA 2IPKD 2UU9Q 2MUYA 1L1OC 2F0LA 2VUMG 2RDHA 4BY1H 2B2YC 1TQOA 3HOWB 2O2LD 1UWVA 5IODA 3CCQA 1HNXL 1JWSD 1CM9A 2JYOA 1Y8NB 3F2DA 4Q5VA 5KNDA 1KAAA 3WWVA 2RQXA 3W1BA 2F0TA 3IFTA 3NBIA 2D0PA 1SYDA 4DR4Q 1D5MC 4A76A 2MFIA 4RHRA 4TVAB 1PA6A 1M90C 2I5LX 3I4OA 1YEZA 3GTPB 5C0XG 3K5LA 4LUOA 5D3DA 5KNCA 1SBBB 5LMUL 3JAMc 3H3VC 1PVOA 4LF6L 4B3ML 3A8JE 4K5VA 4KKTA 4HIDA 2XVSA 4C3IB 3M4OH 1ZKOA 5G3LF 3CCMA 5C44G 4M8AA 3CMEA 1IW7C 2GVAA 1QCBD 3PV0A 1X3PA 2SNSA 5LMUQ 1D6EC 1PTOB 4EQPA 3Q24A 4UP9A 5C0XJ 4B3MQ 3U4ZA 3EVQA 1NUCA 3PIPA 4HAEA 5C4XG 4X66L 1GO3E 2HCCA 2WB1B 5C4XH 2OTJA 1U4MA 4LF4L 1ZXTA 3Q22A 4DV4L 1T5XD 1VDZA 2ZT9C 4AYBE 3MWYW 4J15A 1STHA 3PUXA 4KI0A 4DGZA 4FF3A 2JA5H 5M3FH 1WCMH 3RLNA 1SYBA 1Y14B 4DA2A 1DM0B 5M5XH 2KENA 3ITPA 4KKSA 2JA6B 2PQEA 1EY4A 1LTBD 1SMYC 4J1MA 1MI2A 3CCRA 2F3WA 1PRTB 4HSVA 4BA2I 4HEDA 3C2PA 4LF7Q 1IKMA 3P1HA 2R7ZH 5KEEA 2ATWA 4X3TA 1VQDA 5IGFA 1JORA 1JOKA 4U673 2F0PA 1WTVA 5DAUA 3F2BA 3Q0AA 4IALA 2R7FA 3HRZC 3UDFA 4TRDA 2L0CA 4L5QA 4FF1A 2E5LL 1C48A 1EFID 1EIHA 2ZXRA 2F0MA 1SE3A 5FLMH 5IGGA 5JPMC 1I4PA 1HFNA 1QVGA 1TWHH 4FXDA 1KIXA 2PZUA 1LLRD 2JA9A 1SN8A 1STBA 2QF7A 4JI4Q 3AMUA 1EY6A 4TQUS 4HIOA 3HOZG 3GTKH 2K6AA 2I46A 3L9AX 4G4KA 3S9WA 2VB3X 1PTOC 1AN8A 3S16H 1LT5D 3CAMA 4CJ0B 5EJWA 2A8VA 3RR5A 1KDBA 1PH4A 1I6VC 2NVXB 4Z9CB 1VQOA 1GXDC 1K83B 3MTSA 3FDTA 3E5SA 3BVGA 1E7ZA 2A1AA 5CV4A 2IX0A 1Q3LA 1XXGA 1U9RA 1GUGA 3QIAA 2CVRA 2HQEA 2EJGC 2R92B 1WTRA 2NZOA 4A3DH 3K6OA 1PFMA 2PNHA 3OSOA 3OYYA 1II3A 1ET9A 1XPRA 1A3VA 1PRTC 2VZAA 5EAYA 1L0YB 4DNRB 2VNUD 1SRUA 2HQLA 4KY5A 4RFBA 4PMBA 2I07B 2JP1A 4CKBA 2EY6A 1PH5A 1DJRD 4GKJQ 1CQVA 4MTKA 4IZ8A 4N9PA 3AQQA 1YJNA 1G2SA 2G9DA 4FP5D 3M4OB 4H13C 5I9PA 2RDGA 3J80c 3SR1A 1SNQA 3UDXA 1D2BA 2A69C 2UUCQ 2MO1A 2PW7A 4DR5L 1AZQA 3OW7A 2VY3A 3PQIA 2B3GA 3DEOA 4UAIA 3RZDH 1S5CD 1E1OA 4IUVA 3OW2A 3SK4A 1YHBA 1STYA 2PI2A 1AEXA 2K5QA 4N9TA 5C3XA 1WCMB 2B8GA 2VQEQ 5HURA 4IJHA 3SK5A 2B2TC 1LABA 2TMPA 1GUWA 3KBXA 3D6CA 4L5TA 3A56A 2CKZB 3GQBA 4ILWA 4P72A 4QQBX 3G6JB 5CORA 2E2IH 1I4XA 5JOBA 4APVA 1QILA 2F0WA 1PLFA 2Z6BA 1B70B 3K7AH 3JAMi 4OXPA 2PQAB 1YITA 2R7ZB 3DM3A 2GN5A 4G7ZC 4DNIA 1I4GA 1BCPD 4L63B 1S3OA 2UXCQ 1MJCA 1L2FA 2VQFL 1YHQA 1Q7YC 2NUCA 2B63B 1DXMA 4K5WA 4B9XA 2L4NA 5CV6A 3D0FA 1Y1WH 1KLGD 4UDUC 4DV7Q 1F2MA 4KD4A 1N9WA 1JQYD 1TWCH 3G6EA 3HKZG 4CHTB 1TWHB 1PYBA 4PZ7A 2GA4B 3RLFA 3AEVA 1PYWD 2VQFQ 3GTOB 3K59A 2NZHA 1FGUA 1DGSA 4H0LC 4KN7C 3FRPB 5FOBB 2ZXOA 1EYGA 4N8X1 3BZDB 3EROA 1SAPA 4X65Q 1KD1C 1G291 5CC4A 3KBGA 4GLXA 2UXBQ 2BCOA 2CW0D 4TSSA 2LSSA 2ZM6Q 4A93B 3TZDA 5CR3A 2OTLA 3STBD 4A3LG 3ULLA 3HOYB 1B3QA 4A3LH 3AB9A 2NVYB 5CYUA 2E76C 2RKSA 2YV5A 1YZ6A 3R8BA 1EU4A 1PFBA 1SYCA 2EDGA 4N8FA 5I2YA 4A3DB 2OQKA 2K50A 4RGMA 1Y1VB 4MTNA 3OWFA 2KCCA 2Y0SB 3S1MB 1XPOA 1FD7D 1K0SA 4UP8A 3HOVB 2EXZA 1J9OA 2L15A 4NDXA 4IFDH 1ENAA 1CKNB 5IGCA 2IY5B 2E2DC 2HIVA 1EEID 1EYAA 4A75A 4O2DA 5C5MA 2F0EA 3KF6B 4EX5A 3T1YQ 1J5EL 4DNTB 5I6WA 1JWMD 3JAML 3C1FA 4DK1A 2LMCB 2MO0A 1RIPA 5DM73 3CXCA 1NY4A 3NELA 3DLLA 2WAQG 3PIP3 4ZUJA 4R4CA 2K5NA 2QCPX 3ONAB 1IYVA 3G4SA 4LF9Q 1D1IA 4DV3Q 1HNZL 2M9VA 1O80A 1F77A 3MXNA 2MNAA 2Q2UA 1N32Q 3CU7A 4R4IA 2K5DA 1GHJA 3CMAA 3U50C 3H3VH 3ND8A 1CT1D 4UP7A 1PH8A 4YWMA 4QIWB 4GOPA 1FNVA 4PV1C 1HHVA 1SYFA 3S1QB 1HNZQ 3GTGH 1PXUA 4BY7H 3UDIA 1XMOQ 2KJXA 4E6IA 1C8CA 4YHHL 1TT2A 2CWAA 2WKCA 4MIUA 3UE1A 2BDOA 2E2IB 1K3RA 2O4XA 4JI7L 1NCVA 2O5JC 4A3GB 5ELDA 4BBSG 4PZ8A 1GUSA 1N8RC 3K7AB 2M2LA 1EQTA 3HGBA 2H4OA 1VQGA 4G7OC 3TZUA 1SNDA 1ICWA 2VB2X 4L5SA 4YHHQ 1RD9D 2K28A 2HD3A 3VA7A 4XQJA 1BXTA 1H9KA 3J80i 4DV2L 5D3IB 3RNUA 2F0QA 2N78A 4A3FB 2DY8A 2CQAA 3MAQA 4RWSC 2F0FA 2D62A 2YTVA 1Y1WB 5GADC 3M4YA 2WINB 3DWAA 2HDMA 3DWPA 4NXML 4DV2Q 3KK7A 1S5FD 1VCIA 3HOWG 2D5DA 4KJOA 3HOWH 2K33A 2F3IA 4CDCC 4K14A 1ICFB 3FPPA 1XNRQ 1B50A 1IHZA 1PTOF 3IAYA 3CRKC 2Z4IA 1XMQQ 2IHFA 3SXHA 4RGOS 2VL6A 4ODGA 4NXMQ 5CV7A 4DUZL 1VQEA 3PUWA 3HOUH 2RCNA 1HJPA 2MPMA 4WFN3 4FDBA 3GTPH 2EYJA 2Q2IA 1B53A 1LT6D 2N88A 2E2JB 1BDOA 1T9HA 4P75A 4C3HH 1XNQL 1R9TB 3PMFA 2LS01 3K57A 1JMCA 1HNWL 2KCNA 3V2TA 1X9NA 2R7DA 4DV0Q 3NTKA 1QVFA 3RZOB 1VQAA 4C3IH 4R9WA 4F8MA 2D2CC 5EPJA 3J7AF 4LFCL 3N52A 4DR3L 1JT8A 2WIIB 1E3PA 2ZTEA 1SDFA 3F8TA 3J81j 1PTOH 3P75A 4HN7A 3TRZA 1RHPA 4YY3L 2WB1G 3RUZA 1PZKD 4K2KA 3TMEA 4FXGC 4RCNA 3GTQH 1TXYA 3NWTA 2VS1A 3I4LA 2A6ED 1IBML 5K36H 1JE5A 2EZVA 4MNOA 4C56C 1W6JA 2EQSA 4YIJA 4YY3Q 1YI2A 2XGTA 3J81E 4LW1A 2CHBD 1D7QA 5C4ZA 3OHXC 4HJAA 2JA6G 4AIMA 1RTOA 4JI5L 3M3YB 4HTHA 1IBMQ 5T1GA 1L0WA 4JI8L 1DZ1A 4YCWA 1BOSA 1U4RA 1XTDA 3FVQA 2QEJC 4NB3A 1SNPA 2J0TD 3FKIH 1EQVA 2E74C 3J80L 1UE1A 3HKZE 4IUNA 4U68A 4BA1I 4L5RC 2F0UA 1IL8A 2NBFA 3BU2A 5C3EG 1HRJA 3CW2C 1HR0Q 5IGEA 3D4RA 1H9RA 3S17B 4ULLA 3I8ZA 3KUPA 4Y52H 1CA6A 2PNRC 1S40A 3GTGB 2LY7A 2NWGA 2HCIA 4A3JH 4LAAA 1K73C 2AWNA 2HHHL 1X54A 1ML0D 2JEBI 1DYQA 1GM5A 1EOTA 1XX8A 2VXWA 3OMCA 2NTSA 1A62A 2JK8A 2CWPA 3ERSX 4BS9A 2G5DA 2ZJPA 2UU9L 1I3QB 1A6XA 5FO9B 4A3EB 2EYPA 4GN4B 3K8AA 5FJ8G 1MSGA 1ZEQX 2KVMA 4JBMA 4HCEA 2UXDQ 2OCEA 4OO1I 3SGIA 3MFGA 1H95A 1K83H 4GNXA 2KEDA 2F0IA 3EQLC 4BY1G 2B2WC 3VA5A 3ERQA 4K2LA 4HR7B 3WOEA 4DR4L 3UDGA 4DAMA 2FFKB 4BXXH 2PCFB 1E2ZA 1Q1BA 2ASBA 2R61A 2R92H 2CFMA 3PO3H 1AZPA 3CP0A 5C4HA 2ZXPA 4ZLTF 3PSIA 4NXNL 4XQNA 1X56A 2KQ3A 1MIUA 3HOUB 1KNEA 4QUFA 1JJCB 4JG2A 5JPNC 2NVQB 2WAQE 3L7ZC 4HIKA 4KHZA 4C3HB 1GD7A 3K5MA 1KRTA 4RHSA 3D8GA 2BOSA 4NXNQ 1Q8IA 4O1NA 3QJYA 4GN5A 3F2UA 1PMRA 5GQOA 3S24A 4IPHA 3C1EA 5C0XI 3TN2A 4A4IA 1H9SB 1TS2A 4OX9Q 2KUMA 4HJ8A 5I2XA 1T5EA 3BDCA 4B3SL 3KLWA 3H09A 4KHPQ 1YIJA 2F0GA 5LHY1 5E4XA 4DR1L 2JXMB 2QDLA 2FMCA 3M85A 2VW9A 2PMZB 1VQ7A 3T1HQ 1G51A 3GTJB 3GTQB 3CQZH 4A3CH 3GTMB 1EEFD 1Z9FA 4B3SQ 2K14A 3VDYA 5K5PA 4DR1Q 3HEJA 1F2LA 2ID0A 1B2TA 4UY8C 4EQNA 2JA5G 5M3FG 1WCMG 2K52A 3ULJA 4KMUC 2NVTB 1UEAB 2XWJB 3I56A 3F1ZA 4LF7L 1STEA 1RL2A 1CZGA 1W3SA 4V190 1NSNS 1O7IA 3N6RA 1CHQD 3URYA 2Z6KC 5NUCA 5C4JB 3FKIB 1SJHD 1I94L 2IW3A 4ZAIA 2EY1A 5EKLA 2QGQA 5CV8A 3G48A 1F2YA 2WV6D 1BF4A 2K04A 2R7ZG 4ZKBB 3I4MB 2RCFA 3ER0A 5D14A 4QGUA 4IUPA 4XQQA 1V1PA 2BDNA 1I94Q 1IBLQ 1K8AC 1D5ZC 3S1RB 4JI4L 2B63G 4R8NA 1B1ZA 4A3JB 5IWAQ 2MQHA 2B63H 1BQQT 1S5ED 1ESRA 1LTID 1BBUA 5FLMG 2XWBB 2KA7A 2UUBQ 4QJFA 1C7YA 1PFSA 1N36L 2JA8H 3CCSA 1A3UA 5EKKA 3GTOH 3QB3A 4RKBA 3BYTB 3AFQA 3HOXB 1L0XB 3VR3A 1BO0A 2B2UA 3K0XA 3CD6A 3MEHA 2F03A 3K58A 4MZ9A 2KEEA 4NMZA 1SNOA 1N36Q 4Y7NB 4JOIA 1F2ZA 4V0BA 1WJJA 1RDPD 2B39A 5DM63 4JI3L 2WB1E 1C4QA 2AQ1B 3A7AB 4A93H 2KBNA 2X6GA 2KHJA 3HOYH 1I4HA 1B44D 3BVZA 2NVYH 1YJWA 4DAPA 3HP3A 3FMCA 5G3LD 1YNND 2EYOA 1KTKA 1BCPF 4A3DG 3PO3B 4EVOA 4JI3Q 4S3SA 4X3SA 3GDEA 2B2VC 4GKJL 1JB3A 1PH7A 3PIOA 1Y1VG 2L55A 1Y1VH 3I55A 3LWEA 4K8IA 4FYDA 1F9SA 3CKIB 1X3EA 3S1MH 2Z9HA 3S2DB 4IQZA 2NN6I 3AYHB 4X3KA 3HOVG 5EBDA 5LMNL 3HOVH 1WFQA 3CRLC 2UUCL 1VQ9A 2L9HA 2WP8J 2A68D 3IL8A 1STNA 4CDDC 1I5FA 1STGA 2J4XA 1CA5A 1UAPA 2MP1A 2IX1A 2RF4A 1B4OA 5LMNQ 4IN3A 4I7AA 3TEHB 2XRSD 4A3BH 5EPKA 2VQEL 3CQZB 4GLVB 4LF5Q 4IUUA 3T56B 1X6OA 1YNJD 2C5CA 1HTPA 3PCOB 2JSOA 2DUDA 1Y69U 5BN5A 1VQMA 1E0BA 1PZJD 2F0VA 1BBXC 4DN4M 2K5HA 5CGKA 4QUCA 1SMXA 1ASZA 4B3RQ 1LYLA 1V9PA 2QILA 3NENA 1HZCA 1LTAD 3IRBA 3P20A 3R93A 1JE4A 5ISRA 4OWWB 3S1QH 1LUZA 1V8QA 3F2CA 1G2TA 1FNUA 1TS4A 2JA7H 2KHIA 1EY0A 4A3GG 1Q12A 4X3UA 1S5BD 2P5ZX 3MXUA 2UXCL 1KABA 3M4QA 4C1NK 3HG9A 5IT9E 4A3GH 4L8JA 1C9OA 1E1TA 2EOTA 2IJ0A 2G9HD 1JCKB 3GP7A 2YTYA 3FEWX 1X65A 2F0SA 5C5LA 4DV7L 4IOAA 5C6AA 2XN9C 3SDZA 1BKBA 1PDQA 1SLJA 1KXLA 1WOCA 4A3FG 2B29A 4A3FH 4DF7A 1P8LA 3LWUA 2MHVA 1Y1WG 4RA8A 4WORA 3S14B 1SE2A 1N34Q 2JA8B 3MC0B 4X65L 3K80C 2UXBL 4K8JA 2WFWA 2PZWA 1WD1A 2ZM6L 1KAWA 5T1IA 5JVG3 1SR3A 2NB0A 3QWNA 1W6KA 3A74A 1F9QA 4A3KB 1VQ8A 2NTTA 4R4OA 4DV5L 1B9MA 3BZKA 3D4WA 4LUVA 3PF5A 3K0YA 2JE6I 2RHSB 3H0GH 2YU9B 1A2UA 1TWAB 2L1BA 2E2JH 2PW5A 1R9TH 1GKHA 3PUZA 4HIMA 2EYFA 2MGSA 4IURA 5AJ3L 4DV5Q 2JQOA 1GOZA 3RZOH 1QOHA 5J22A 2N49A 3S2HH 2D0OA 4GS3A 4KJNA 4CKEA 4OEMB 3J81c 4NPSA 4HCSA 1JJGA 5AJ3Q 1B8AA 1J6QA 1CQFA 3U9OA 4ZUIA 4A3IH 1B7YB 1FL0A 5KNBA 4GKKL 1VQJA 3T1YL 4YWKA 1IBKL 4IFDG 4IPCA 3H91A 3C46A 1LM0A 4OHJA 1V43A 2B2UC 3Q6SA 3BS1A 5DLQE 1SFOB 5HGTA 4JI0Q 4LF9L 1SSOA 3CCJA 1QNKA 4GKKQ 3J7YW 4DV3L 1EYDA 5E4WC 4CDFC 1IBKQ 2BE5D 1N32L 2I5MX 1BCPB 4Q0FA 3M3YH 4A3BB 2DNCA 4DUYQ 1TS3A 3VYTA 4IFDJ 1EIFA 3TDQA 1A8VA 1CK1A 3H6MA 4LK1C 2A6HD 2EJMA 1SNCA 3OIQA 1XMOL 2PPBC 2CCZA 3M7GA 4JYAQ 3DHQA 4QCLA 3S17H 5I9OA 3GV3A 3HS0C 5A35A 4J6HA 5E3FA 2YTXA 3LNNA 3NQTA 4JK1C 2K5VA 2TSSA 4BY7G 4ZK9B 5EGTA 4ABNA 2JA7B 3FHWA 1A63A 4I65A 3FP9A 2B2YA 1GUNA 2SNMA 3KF8A 4EQOA 1X32A 1SNMA 1EY7A 2DJGC 1CUKA 2E8GA 2RSOA 4WJWA 1OXUA 1K9MC 2EXDA 4RG1A 2ICIA 2CH4A 3R2IA 4A3EG 1I3QH 1VQIA 1ZYRD 3QR8A 4A3EH 4GZYC 5FLXE 1CSPA 2AQ3B 1KC8C 1OXVA 3MZ5A 3GTLH 5M3MB 5JVH3 4POGA 5BR8Q 4HMJA 1X3QA 1XNRL 5A2QE 1NMGA 1EY8A 2Y0SE 3CF5A 2A19A 1UUPA 1XMQL 4PMCA 5E1FA 4RH6A 1NJIC 2IX3A 3J7A5 2FMMA 1LV9A 3NXWA 3TREA 4JW0A 4KY6A 4IO9A 4FF2A 1RJTA 3OOCA 4CKCA 2QW7A 4IUTA 1BCPC 2R6GA 2Z8LA 1EY9A 2PI2E 4RGTA 1EZ6A 1MD2D 2BA1A 3TP5A 3HOUG 4DV0L 1K8OA 4RMFA 1PYSB 4LF8Q 1ILPA 3KJPA 3H0GB 3PUYA 2NVQH 4C3HG 1DOLA 1IL2A 2RHQB 1HZ9A 2RVLA 4K6LA 4WJ3M 3S1NH 1O78A 1IW7D 1MKHA 2CQOA 1WTOA 3FPUB 4C3IG 4A3MB 1N33Q 5DNFA 4HJ5A 1SYGA 2EYLA 2A74C 4QIWE 1CKOA 1XTCD 3S2HB 3VR4A 2F0HA 4ZYSA 1DD2A 4GN3B 2PO4A 1PH1A 1WTXA 1Q81C 3PIO3 1AFPA 3BDOA 2EPBA 1QZHA 1EUJA 1X55A 3DUZA 4P71A 5ELNA 2CW0C 3A7LA 1HPCA 4A3IB 3GTJH 1KL9A 3CCEA 3GTMH 3I4NH 2IT1A 5K36G 3EA6A 5IGBA 3TP6A 5J1ZA 1CHPD 4P2CB 3MXNB 3CC2A 1SMYD 2NVTH 5KRUA 4JV5Q 4X64Q 2K03A 3OTOQ 1DOMA 4JCVE 3VR6A 3RN2A 4JPBW 4GOPB 5CV5A 1HR0L 3SE0A 3EN2A 3FKIG 4XYQA 5C4JH 5IY0A 1DCZA 2F1MA 2ZTCA 3T53B 1QUQA 4JBWA 2E2HH 1FJGQ 3KF8B 1LO5D 3I4MH 3EFXD 1HQRD 2H5XA 3HZXA 4JI2L 1BNZA 3D4DA 1PH6A 3L3OC 1W2BA 1HZBA 2F0DA 3BVMA 5JEAH 1EWCA 2F0NA 2ZTDA 2DNEA 3S1RH 4A3JG 5I6YA 1VQFA 2EVBA 3E6ZX 3J81i 1IYJB 1I6HB 2AMCB 4JI2Q 4X62Q 2ZJQA
chains in the Genus database with same CATH topology
5EKIA 3MVVA 1IYUA 3QO2A 1VF5C 2DY7A 4OIJA 2WACA 4FO2A 4ZQ3A 1PTOD 2RDFA 1HFGA 1V1OA 1LT4D 1A2TA 3SVMA 4CBVA 1GJXA 4CGYB 3SEBA 3TP7A 1VF7A 2HUGA 3GD7A 4B9WA 3GTLB 5IGDA 4RCOA 3EJIA 5D65A 1K8MA 1Y8OB 3A55A 1S5DD 1TS5A 4AYBB 1WD0A 3NTIA 1GUOA 3X3NA 1CI3M 4FF4A 2FINB 4OO1H 1LT3D 5F2DA 1PRTD 5JAVA 5FO8B 1JOOA 4NKLA 1I4RA 4KTAA 3KLRA 4G57A 2FHTA 3BYYB 5KYIA 4OL7A 2N55A 1WTPA 1WTWA 3TP8A 3S1NB 2A5HA 1FYCA 2B2TA 2PYKA 2A69D 3U9SA 3MA2B 5ELFA 2E75C 2PZTA 3PUVA 5C0XH 3SHLA 3DWQA 2H1EA 1FR3A 2BA0A 2NYZD 4PMWA 3I4NB 1Z7TA 1LTSD 3DXJC 3J81L 5CMDA 1OXXK 1RF2D 3A54A 4KD3A 1RTNA 2V4DA 2YYZA 1JR0D 1EIGA 2DN8A 1EY5A 5KYLA 2SEBD 4C3JB 2R93B 4XDXA 3NHHA 3O13A 4DK0A 3D31A 2EY5A 4QMGA 2E2HB 2A6EC 1LACA 1KLUD 3VYRA 3NK9A 2EJFC 2C9OA 4QB4A 5AFWA 1O7LA 5COYA 3W3AA 5KIXA 2IL8A 1HQMC 3NBHA 1TIID 5C3EB 4BWGB 2D9UA 3PO2B 3NTHA 2XIWA 5M5YB 1TWFB 4DFAA 3OPOA 3LX0A 1HA5A 3GV6A 1M4VA 2F0JA 1U4LA 3RD4A 1RCVD 4HSPA 1LTTD 5EPLA 1XYIA 2NZ1D 3TBIB 1JWUD 1AW7A 5CV9A 4BBRB 1EU3A 2L12A 2F3VA 1EWHA 3NQIA 4L6TB 2J7ZA 3K5NA 3R3OA 1NR2A 3MFYA 4XXEA 4I7ZC 1TWGB 1DOKA 3IKJA 4BY1B 2VUMB 2AQ2B 1Z6HA 3SK8A 5EQ0A 2EE1A 1H9JA 2A73B 5C3WA 1TY0A 2NN6G 2NN6H 1BR9A 5ELCA 4ID6A 1F9RA 2RA4A 3DM1A 5IIFA 5TSSA 4DAYA 2QKIC 3R2TA 3MHBA 1NAPA 4IUQA 1CFMA 1R4PB 3NP8A 1KDAA 2AWOA 5C44B 1Z47A 1IKLA 5IOCA 4FNFA 1VMPA 3VR2A 2MJ8A 1ESFA 3T51B 3D6WA 4RGNA 1V1PB 2X6LA 3JAME 1M8AA 4ZKCB 1HUNA 5C4XB 4R8IA 1FNWA 1U4PA 2RBMA 2KECA 4WRDA 1A3TA 1HUMA 2JEAI 2XRQD 3W2DA 3NWSA 2JA5B 5M3FB 3S15B 4KY7A 3CHBD 3I3CA 5M5XB 1QWYA 2Z1CA 1D5XC 3I73A 3ND9A 3T16A 4XT1B 3H94A 1FGBD 1AP0A 4LMQD 1MSHA 1HTLD 5ELBA 5FKAC 4XIGS 1F9PA 3WOFA 4K6DA 5KGUA 2ENBA 3NSWA 4HMIA 1QG7A 1O7ZA 3VYSA 5JJZA 2Z4HA 4F88A 3I91A 4J8QA 1HA6A 3C3LA 1KNAA 1SEBD 1EL0A 1D1KA 5EBCA 3I90A 1E2WA 1TY2A 1G8ZD 3GTKB 3HOZB 5M5WB 1XWEA 4KV6A 1H9MA 3S16B 1ILQA 2ICEC 3NE5B 1ONLA 1CZWA 1S4ZA 5LL6S 1PFNA 2HDLA 4TKOB 3VR5A 1UNSA 1RODA 1B9NA 1ENFA 4XYOA 2Q8IB 3QOJA 3RMHA 1LTRD 5CBAE 1ET6A 3MXPA 4H44C 4KN4C 3E0JA 2IWHA 3Q23A 3G7LA 1YNNC 2K7VA 2XSCA 4IFDI 3D3RA 2EYHA 1KDCA 4PQXA 2SOBA 1EZ8A 4M1UB 1SXTA 3I72A 2LFNA 5FK9C 4K5XA 4DU9A 1PZID 1J8IA 2OEOA 2A68C 2O5IC 2OXPA 4OGQC 1ENCA 3K5OA 2X69A 3OIPA 3RZDB 1SE4A 3NPPA 5IT9L 3BDLA 2B2WA 4O42A 1HXYD 3NUCA 1RKNA 3J80E 3DEPA 1YNJC 4KKUA 2L11A 1R4QB 1QNUA 1G91A 1JICA 3QG1A 4C2MB 4NW2A 2RSNA 5J39A 3UI2A 2EYMA 1GHKA 1G6ZA 1LTGD 2R3ZA 2LKVA 5BN3A 3MXGA 2K32A 3OWEB 4KHVA 1Q1EA 4QF4A 3X3MA 4DAVA 2WKDA 2KOLA 4CJ1B 1MGSA 3KLSA 4DXFA 2M00A 2EY2A 4LJZC 1DONA 1TKWB 2XNAC 1TR5A 5LL6X 3M7NA 1TWCB 3A8IE 3HKZB 3VYUA 1NR4A 1QE6A 1STAA 1WVLA 2OT2A 5I4DA 5CBEE 1GUTA 2F0OA 1O7YA 1OO9B 5BN4A 4KK7A 3BG3A 3T13A 1CTMA 4OIKA 1VMCA 3V96A 4H7BA 4RKLA 1PRTF 2K01A 5FO7B 2FJ2A 1BUVT 1QJOA 4XTCS 4CJ2C 1I50B 2K1BA 2K05A 1HCZA 4C3JG 5M9OA 2OF1A 1WTQA 1H9SA 4FXKC 3T4AC 5DEHA 3IFDA 3J7AV 3P7JA 1B3AA 2AUJD 3SK6A 1TU2B 4DXGA 4XT3B 5ELEA 5JEAG 3WDNA 2B8FA 1Q90A 1MBYA 1SYEA 2BE5C 2L5TA 2WAQB 3DMUA 3AU7A 2QDBA 4F87A 4ME5A 4G7HC 3ZYYX 2Q8TA 4ZRZA 2A6HC 2F0KA 5JEAJ 4C1NI 1OXTA 3KLSX 5FLXL 3OMGA 2B2VA 2SDFA 1I4QA 1TVXA 4MHEA 3A8KE 4NP5A 3GO5A 4BY7B 4F7XA 1JOQA 5A2QL 1Y8PB 4B08A 4FVMA 4RAUC 1SJED 3QOLA 2K5WA 1JC7A 4BBSB 1A15A 4PNYA 4MN3A 2KHSA 1OXSC 4OO1G 3V05A 1QB5D 2AUKA 3I70A 1EYCA 1ZYRC 1E2VA 2Q8RE 3TSSA 4EGVA 2F4IA 2IPKD 2MUYA 2F0LA 2RDHA 2B2YC 1TQOA 3HOWB 2O2LD 5IODA 1JWSD 1CM9A 2JYOA 1Y8NB 4Q5VA 5KNDA 1KAAA 2RQXA 2F0TA 3IFTA 3NBIA 1SYDA 1D5MC 4RHRA 3GTPB 5C0XG 3K5LA 5D3DA 5KNCA 1SBBB 3H3VC 3A8JE 4K5VA 4KKTA 2XVSA 4C3IB 1ZKOA 5G3LF 4M8AA 1IW7C 3PV0A 1QCBD 1X3PA 2SNSA 1D6EC 1PTOB 4EQPA 3Q24A 5C0XJ 3EVQA 1NUCA 4HAEA 2HCCA 2WB1B 1U4MA 1ZXTA 3Q22A 1T5XD 1VDZA 2ZT9C 3MWYW 1STHA 3PUXA 4KI0A 4DGZA 4FF3A 1SYBA 4DA2A 1DM0B 3ITPA 4KKSA 2JA6B 2PQEA 1EY4A 1LTBD 1SMYC 4J1MA 1MI2A 2F3WA 1PRTB 4HSVA 4BA2I 4HEDA 3C2PA 1IKMA 3P1HA 5KEEA 4X3TA 5IGFA 1JORA 1JOKA 4U673 2F0PA 1WTVA 5DAUA 3Q0AA 4IALA 3HRZC 4TRDA 2L0CA 4FF1A 1C48A 1EFID 1EIHA 2ZXRA 2F0MA 1SE3A 5IGGA 5JPMC 1I4PA 1HFNA 4FXDA 2PZUA 1LLRD 1STBA 3AMUA 2QF7A 1EY6A 4TQUS 2K6AA 2I46A 3L9AX 4G4KA 3S9WA 2VB3X 1PTOC 1AN8A 1LT5D 4CJ0B 5EJWA 1KDBA 1I6VC 2NVXB 4Z9CB 1GXDC 1K83B 3MTSA 3FDTA 3E5SA 3BVGA 5CV4A 2IX0A 1Q3LA 1XXGA 1U9RA 1GUGA 3QIAA 2CVRA 2HQEA 2EJGC 2R92B 1WTRA 3K6OA 1PFMA 3OSOA 1II3A 1ET9A 1A3VA 1PRTC 1L0YB 4DNRB 2VNUD 4KY5A 4RFBA 4PMBA 2I07B 2JP1A 4CKBA 2EY6A 1DJRD 1CQVA 4IZ8A 4N9PA 1G2SA 2G9DA 4FP5D 3M4OB 4H13C 5I9PA 2RDGA 3SR1A 1SNQA 1D2BA 2A69C 2PW7A 1AZQA 3OW7A 3DEOA 4UAIA 1S5CD 4IUVA 3SK4A 1STYA 5C3XA 1AEXA 2K5QA 4N9TA 1WCMB 2B8GA 5HURA 3SK5A 2B2TC 1LABA 2TMPA 1GUWA 3KBXA 3D6CA 3A56A 3GQBA 4ILWA 3G6JB 5CORA 1I4XA 5JOBA 1QILA 2F0WA 1PLFA 2R7ZB 4G7ZC 1I4GA 1BCPD 4L63B 2NUCA 2B63B 1DXMA 4K5WA 4B9XA 2L4NA 5CV6A 1KLGD 4UDUC 1F2MA 4KD4A 1JQYD 4CHTB 1TWHB 3RLFA 2GA4B 1PYWD 3GTOB 3K59A 4H0LC 4KN7C 3FRPB 5FOBB 2ZXOA 3BZDB 3EROA 1SAPA 1G291 5CC4A 3KBGA 2BCOA 2CW0D 4TSSA 4A93B 3TZDA 5CR3A 3HOYB 3AB9A 2NVYB 5CYUA 2E76C 2RKSA 3R8BA 1EU4A 1PFBA 1SYCA 2EDGA 5I2YA 4A3DB 4RGMA 1Y1VB 3OWFA 2KCCA 2Y0SB 3S1MB 1FD7D 3HOVB 2EXZA 1J9OA 4NDXA 4IFDH 1ENAA 5IGCA 2E2DC 1EEID 1EYAA 5C5MA 2F0EA 4DNTB 5I6WA 1JWMD 3JAML 3C1FA 4DK1A 2LMCB 5DM73 3PIP3 4ZUJA 2QCPX 3ONAB 1IYVA 1D1IA 2M9VA 1O80A 1F77A 3MXNA 3CU7A 2K5DA 1GHJA 3ND8A 1CT1D 4QIWB 1FNVA 4PV1C 1HHVA 1SYFA 3S1QB 1PXUA 2KJXA 4E6IA 1C8CA 1TT2A 2WKCA 4MIUA 2BDOA 2E2IB 2O4XA 2O5JC 1NCVA 4A3GB 5ELDA 1GUSA 3K7AB 2M2LA 1EQTA 3HGBA 2H4OA 4G7OC 3TZUA 1SNDA 1ICWA 2VB2X 1RD9D 2K28A 4XQJA 3VA7A 1BXTA 1H9KA 5D3IB 2F0QA 4A3FB 2DY8A 2CQAA 3MAQA 4RWSC 2F0FA 2D62A 1Y1WB 3M4YA 2WINB 3DWAA 2HDMA 3DWPA 3KK7A 1S5FD 1VCIA 2D5DA 4KJOA 2K33A 4K14A 3FPPA 1B50A 1IHZA 1PTOF 3IAYA 3CRKC 2Z4IA 3SXHA 4RGOS 4ODGA 5CV7A 3PUWA 2MPMA 4WFN3 2EYJA 1B53A 1LT6D 2N88A 2E2JB 1BDOA 1R9TB 3PMFA 2LS01 3K57A 2KCNA 3V2TA 3NTKA 3RZOB 4R9WA 4F8MA 2D2CC 5EPJA 3J7AF 3N52A 2WIIB 1SDFA 1PTOH 3P75A 4HN7A 1RHPA 3RUZA 1PZKD 4K2KA 3TMEA 4FXGC 4RCNA 3NWTA 3I4LA 2A6ED 5K36H 2EZVA 4C56C 1W6JA 4YIJA 3J81E 2CHBD 5C4ZA 3OHXC 1RTOA 3M3YB 4HTHA 5T1GA 1DZ1A 1BOSA 1U4RA 2QEJC 3FVQA 1SNPA 2J0TD 1EQVA 2E74C 3J80L 4BA1I 4IUNA 4U68A 2F0UA 1IL8A 2NBFA 1HRJA 5IGEA 3D4RA 1H9RA 3S17B 4ULLA 3I8ZA 3KUPA 1CA6A 2PNRC 3GTGB 2LY7A 2NWGA 2HCIA 4LAAA 2AWNA 1ML0D 2JEBI 1DYQA 1EOTA 1XX8A 2VXWA 3OMCA 2NTSA 4BS9A 1I3QB 1A6XA 5FO9B 4A3EB 2EYPA 1MSGA 1ZEQX 2KVMA 4HCEA 4OO1I 3MFGA 2KEDA 2F0IA 3EQLC 2B2WC 3VA5A 3ERQA 4K2LA 4HR7B 3WOEA 2FFKB 2PCFB 1E2ZA 1Q1BA 2R61A 1AZPA 5C4HA 2ZXPA 4ZLTF 4XQNA 2KQ3A 3HOUB 1KNEA 4QUFA 5JPNC 2NVQB 3L7ZC 4KHZA 4C3HB 3K5MA 4RHSA 3D8GA 2BOSA 1Q8IA 4O1NA 3QJYA 3F2UA 1PMRA 3C1EA 5C0XI 3TN2A 1H9SB 1TS2A 2KUMA 5I2XA 1T5EA 3BDCA 3H09A 2F0GA 5LHY1 5E4XA 2JXMB 2FMCA 3M85A 2PMZB 3GTJB 3GTQB 3GTMB 1EEFD 5K5PA 3HEJA 1F2LA 2ID0A 1B2TA 4EQNA 4KMUC 2NVTB 1UEAB 2XWJB 1STEA 1CZGA 4V190 1NSNS 3N6RA 1CHQD 3URYA 5NUCA 5C4JB 3FKIB 1SJHD 2IW3A 4ZAIA 2EY1A 5EKLA 5CV8A 1F2YA 2WV6D 1BF4A 2K04A 4ZKBB 3I4MB 5D14A 4IUPA 4XQQA 1V1PA 2BDNA 1D5ZC 3S1RB 4R8NA 1B1ZA 4A3JB 1BQQT 1S5ED 1ESRA 1LTID 2XWBB 2KA7A 1A3UA 5EKKA 3QB3A 4RKBA 3BYTB 3HOXB 1L0XB 3VR3A 1BO0A 2B2UA 3MEHA 2F03A 3K58A 2KEEA 4NMZA 1SNOA 4Y7NB 1F2ZA 4V0BA 1RDPD 2B39A 5DM63 1C4QA 2AQ1B 3A7AB 2X6GA 1I4HA 1B44D 3BVZA 4DAPA 3HP3A 3FMCA 5G3LD 1YNND 2EYOA 1KTKA 1BCPF 3PO3B 4EVOA 4S3SA 4X3SA 2B2VC 1JB3A 2L55A 3LWEA 4K8IA 4FYDA 1F9SA 3CKIB 3S2DB 4IQZA 2NN6I 4X3KA 5EBDA 3CRLC 2L9HA 2WP8J 2A68D 3IL8A 1STNA 1STGA 2J4XA 1CA5A 1UAPA 2MP1A 2IX1A 1B4OA 4IN3A 2XRSD 5EPKA 3CQZB 4IUUA 3T56B 1YNJD 2C5CA 1HTPA 2JSOA 1Y69U 5BN5A 1E0BA 1PZJD 2F0VA 1BBXC 4DN4M 5CGKA 4QUCA 2QILA 1LTAD 3P20A 3R93A 1JE4A 5ISRA 1V8QA 1G2TA 1FNUA 1TS4A 1EY0A 1Q12A 4X3UA 1S5BD 3MXUA 1KABA 5IT9E 4C1NK 3HG9A 4L8JA 2EOTA 2IJ0A 2G9HD 1JCKB 3GP7A 3FEWX 2F0SA 5C5LA 5C6AA 2XN9C 3SDZA 1PDQA 4DF7A 3LWUA 2MHVA 4RA8A 4WORA 3S14B 1SE2A 2JA8B 3MC0B 4K8JA 2PZWA 1WD1A 5T1IA 5JVG3 2NB0A 3QWNA 1W6KA 1F9QA 4A3KB 2NTTA 1B9MA 3D4WA 3K0YA 2JE6I 2YU9B 1A2UA 1TWAB 2L1BA 2PW5A 3PUZA 2EYFA 2MGSA 4IURA 1GOZA 1QOHA 5J22A 4KJNA 4CKEA 4HCSA 3U9OA 1CQFA 4ZUIA 5KNBA 4IFDG 3H91A 3C46A 4OHJA 1V43A 2B2UC 3Q6SA 3BS1A 1SFOB 5HGTA 1SSOA 1QNKA 3J7YW 1EYDA 5E4WC 2BE5D 1BCPB 4Q0FA 4A3BB 2DNCA 1TS3A 3VYTA 4IFDJ 3TDQA 1CK1A 3H6MA 4LK1C 2A6HD 2EJMA 1SNCA 3OIQA 2PPBC 3M7GA 3DHQA 4QCLA 5I9OA 3GV3A 3HS0C 5A35A 4J6HA 5E3FA 3LNNA 3NQTA 4JK1C 2TSSA 4ZK9B 5EGTA 4ABNA 2JA7B 4I65A 2B2YA 1GUNA 2SNMA 3KF8A 4EQOA 1X32A 1SNMA 1EY7A 2RSOA 4WJWA 1OXUA 2ICIA 3R2IA 1ZYRD 4GZYC 5FLXE 2AQ3B 1OXVA 3MZ5A 5M3MB 5JVH3 4HMJA 1X3QA 5A2QE 1EY8A 1UUPA 4PMCA 5E1FA 4RH6A 2IX3A 2FMMA 1LV9A 3NXWA 4KY6A 4FF2A 1RJTA 3OOCA 4CKCA 4IUTA 1BCPC 2R6GA 2Z8LA 1EY9A 4RGTA 1EZ6A 1MD2D 2BA1A 3TP5A 1K8OA 1ILPA 3H0GB 3PUYA 4C3HG 1DOLA 2RVLA 4K6LA 1O78A 1IW7D 1WTOA 3FPUB 4C3IG 4A3MB 5DNFA 1SYGA 2EYLA 2A74C 3S2HB 1DD2A 1XTCD 3VR4A 2F0HA 4ZYSA 2PO4A 1WTXA 3PIO3 1AFPA 3BDOA 2EPBA 3DUZA 2CW0C 3A7LA 1HPCA 4A3IB 2IT1A 5K36G 3EA6A 5IGBA 3TP6A 5J1ZA 1CHPD 4P2CB 1SMYD 5KRUA 2K03A 1DOMA 3VR6A 5CV5A 3SE0A 4XYQA 1DCZA 2F1MA 3T53B 4JBWA 1LO5D 3EFXD 1HQRD 3HZXA 1BNZA 3D4DA 3L3OC 2F0DA 3BVMA 5JEAH 1EWCA 2F0NA 2DNEA 5I6YA 2EVBA 3E6ZX 1I6HB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EKI A;  1G91 A;  1JIC A;  1EL0 A;  2KED A;  2DY7 A;  3QO2 A;  1RTN A;  1E0B A;  4HCS A;  4OIJ A;  4CJ0 B;  1BBX C;  4IUT A;  3IFD A;  4NW2 A;  4R9W A;  3I90 A;  5EJW A;  2B2W C;  4DN4 M;  5EPJ A;  2RSN A;  4QUC A;  1EIG A;  3P7J A;  1B3A A;  3ONA B;  3N52 A;  3UI2 A;  1G6Z A;  1ESR A;  1HFG A;  2FFK B;  4XDX A;  1SDF A;  3MTS A;  2R3Z A;  3FDT A;  3H91 A;  1F9R A;  4XT3 B;  3R93 A;  1JE4 A;  1O80 A;  3SVM A;  1ILQ A;  1RHP A;  2RA4 A;  3DM1 A;  1AZP A;  1ILP A;  1Q3L A;  2B2U C;  2HUG A;  3Q6S A;  4ZLT F;  2KOL A;  1G2T A;  1DOL A;  1S4Z A;  2L4N A;  1PFN A;  1X3P A;  1SSO A;  2CVR A;  1MGS A;  2HDL A;  4CJ1 B;  1QNK A;  4X3U A;  2RVL A;  1NAP A;  5D65 A;  1KNE A;  2B2U A;  1BO0 A;  4IUQ A;  5E4W C;  4QUF A;  1WTR A;  1HHV A;  1WTO A;  2EOT A;  3FPU B;  1WD0 A;  4HAE A;  1ROD A;  2KEE A;  2HCC A;  1PFM A;  5DNF A;  1DON A;  2Q8T A;  1C8C A;  1IKL A;  1U4M A;  2BDN A;  5AFW A;  1ZXT A;  5COY A;  5CBA E;  2FIN B;  2IL8 A;  1VMP A;  1NCV A;  2MJ8 A;  1WTX A;  3F2U A;  2B2V A;  2SDF A;  3D6W A;  1TVX A;  2M2L A;  1RTO A;  1EQT A;  2X6L A;  2JP1 A;  3MWY W;  4MHE A;  3TN2 A;  2EPB A;  1PDQ A;  5T1G A;  2KUM A;  1M8A A;  3G7L A;  4ZKC B;  1DZ1 A;  1HUN A;  2X6G A;  4R8I A;  1SAP A;  1U4R A;  1U4P A;  2D9U A;  2KEC A;  1ICW A;  4RAU C;  4RA8 A;  3HP3 A;  1NR4 A;  2XIW A;  3GV3 A;  1HUM A;  2K28 A;  5E4X A;  1G2S A;  1A15 A;  1QE6 A;  4U68 A;  1WVL A;  3TZD A;  1MI2 A;  4ZK9 B;  3GV6 A;  2FHT A;  1IL8 A;  4MN3 A;  4X3S A;  2B2V C;  2DY8 A;  1HRJ A;  4HSV A;  1U4L A;  5CBE E;  2N55 A;  4RWS C;  4HED A;  1WTP A;  1WTW A;  1O7Y A;  2B2Y A;  3I3C A;  2K03 A;  3I8Z A;  5EPL A;  3KUP A;  3LWE A;  1XYI A;  1WD1 A;  2NZ1 D;  1DOM A;  1CA6 A;  2HDM A;  1IKM A;  1PFB A;  1X32 A;  1F9S A;  2B2T A;  1F2L A;  5T1I A;  4XT1 B;  1AZQ A;  2NWG A;  2HCI A;  4X3T A;  1B2T A;  1J8I A;  2L12 A;  4LMQ D;  1AP0 A;  1MSH A;  2RSO A;  3DEO A;  4UAI A;  4X3K A;  2Q8R E;  1F9Q A;  1WTV A;  1ML0 D;  1B50 A;  4IUV A;  4OIK A;  1EOT A;  2L9H A;  1F9P A;  1XX8 A;  2VXW A;  1VMC A;  2X69 A;  2J7Z A;  3IL8 A;  2B2Y C;  2L1B A;  1NR2 A;  2H1E A;  2K01 A;  2NYZ D;  1BNZ A;  1CA5 A;  2FJ2 A;  1EIH A;  1QG7 A;  1X3Q A;  2MP1 A;  1O7Z A;  1J9O A;  2B2T C;  5JJZ A;  4ZAI A;  2B2W A;  4O42 A;  4CJ2 C;  2MGS A;  2MPM A;  1CM9 A;  1B4O A;  2JYO A;  2K1B A;  4IUR A;  1HFN A;  1DOK A;  2K05 A;  3KBX A;  2K04 A;  1BF4 A;  1GUW A;  4ZKB B;  1MSG A;  2KVM A;  1B53 A;  3DEP A;  2N88 A;  2FMM A;  5D14 A;  5EPK A;  3I91 A;  1LV9 A;  4IUP A;  5CMD A;  1HA6 A;  5COR A;  2L11 A;  5EQ0 A;  2EE1 A;  1KNA A;  4IUU A;  1WTQ A;  1RJT A;  1PLF A; 
#chains in the Genus database with same CATH topology
 5EKI A;  3MVV A;  1IYU A;  3QO2 A;  1VF5 C;  2DY7 A;  4OIJ A;  2UXD L;  2WAC A;  4FO2 A;  4PG3 A;  1PH2 A;  4ZQ3 A;  1PTO D;  4JC0 A;  3PO2 H;  2RDF A;  3HOX G;  1HFG A;  3HOX H;  1V1O A;  1LT4 D;  1A2T A;  3SVM A;  4CBV A;  1TWF H;  1GJX A;  5JJL A;  4CGY B;  3SEB A;  3TS2 A;  3TP7 A;  1VF7 A;  2QA4 A;  2LXJ A;  2HUG A;  3GD7 A;  4YWL A;  1U5K A;  4B9W A;  3GTL B;  5IGD A;  4QY7 A;  4Y7N H;  4RCO A;  5H1S E;  3EJI A;  5ELO A;  1NTG A;  5GAG C;  5D65 A;  1K8M A;  1Y8O B;  3A55 A;  1S5D D;  1TS5 A;  4AYB B;  1WD0 A;  3UE0 A;  3NTI A;  1GUO A;  1K3B C;  3X3N A;  1CI3 M;  4FF4 A;  2FIN B;  4ZCK A;  4BXX G;  4OO1 H;  2R92 G;  1LT3 D;  5F2D A;  3PO3 G;  1PRT D;  5JAV A;  1AH9 A;  1GVP A;  5FO8 B;  3JC6 6;  4GOP C;  1JOO A;  4NKL A;  1I4R A;  3ULP A;  4K0K Q;  1TWG H;  1HZA A;  4KTA A;  4DK3 C;  1UE6 A;  4OX9 L;  1VS0 A;  3KLR A;  2VUM H;  4G57 A;  2FHT A;  3BYY B;  1LTL A;  4LFB L;  3S2D H;  5KYI A;  4KHP L;  4OL7 A;  2N55 A;  1WTP A;  1WTW A;  2UUA Q;  4IJL A;  4O0A A;  3TP8 A;  3S1N B;  1VQL A;  2A5H A;  2JJQ A;  1FYC A;  2B2T A;  3T1H L;  2PYK A;  2A69 D;  3U9S A;  3MA2 B;  1K8G A;  3CC4 A;  4LFB Q;  5ELF A;  2E75 C;  5IYC G;  1HNX Q;  5L37 A;  5IYC H;  2PZT A;  1VQ5 A;  3PUV A;  5C0X H;  3EBE A;  3SHL A;  3DWQ A;  4JBK A;  2H1E A;  1FR3 A;  2BA0 A;  2NYZ D;  4A3C G;  4PMW A;  3I4N B;  3W5O A;  1CSQ A;  1Z7T A;  5IP9 G;  4AH6 A;  1LTS D;  5IP9 H;  2OWO A;  5IT9 c;  5JJK A;  1QUQ B;  5C44 H;  3DXJ C;  3J81 L;  5CMD A;  3E9H A;  1UE7 A;  1OXX K;  1XPU A;  1RF2 D;  4LF6 Q;  1NBW A;  3A54 A;  4KD3 A;  3CPF A;  1RTN A;  4DR6 L;  4DR2 L;  2V4D A;  2YYZ A;  4DKA C;  4IPG A;  1JR0 D;  4UHV A;  4DV6 L;  1EIG A;  2DN8 A;  1EY5 A;  5KYL A;  3J7Z C;  2SEB D;  4C3J B;  2R93 B;  4XDX A;  1IBL L;  1NMF A;  3NHH A;  3O13 A;  5GRO A;  4DK0 A;  3D31 A;  2EY5 A;  1IXR A;  4QMG A;  3CC7 A;  2E2H B;  5IWA L;  2A6E C;  4X66 Q;  1LAC A;  1EWI A;  4DR6 Q;  4DR2 Q;  3S15 H;  3KDF A;  4LF4 Q;  1KLU D;  4DV6 Q;  2K75 A;  4DV4 Q;  2UUB L;  1K28 A;  4DK6 C;  1YHA A;  3VYR A;  3NK9 A;  2EJF C;  1V1Q A;  2C9O A;  4QB4 A;  1O7L A;  3W3A A;  5AFW A;  5COY A;  4IOC A;  5KIX A;  2IL8 A;  1UEB A;  4LFA L;  3PGZ A;  1HQM C;  3S14 H;  3L0O A;  2JA8 G;  3NBH A;  4GNX B;  1TII D;  5C3E B;  4BWG B;  2D9U A;  4JVZ A;  3PO2 B;  3NTH A;  2ES2 A;  2XIW A;  5M5Y B;  4LFA Q;  3U58 A;  1TWF B;  4DFA A;  3OPO A;  3LX0 A;  1HA5 A;  1VQN A;  3GV6 A;  4JBJ A;  1M4V A;  2F0J A;  1U4L A;  3RD4 A;  4A3K G;  1RCV D;  2PQA A;  4A3K H;  1IZ6 A;  4HSP A;  1LTT D;  5EPL A;  3HKS A;  1XYI A;  2NZ1 D;  2PMZ E;  3TBI B;  1JWU D;  1AW7 A;  5CV9 A;  4A93 G;  4BBR B;  2YU9 H;  1TWA H;  3HOY G;  1EU3 A;  2L12 A;  2E5L Q;  3LGJ A;  4JI6 L;  2F3V A;  3HOZ H;  5M5W H;  1PH9 A;  2F4V L;  4OWX B;  1EWH A;  3NQI A;  2LXK A;  4L6T B;  2J7Z A;  3K5N A;  3R3O A;  3BJU A;  1NR2 A;  3MFY A;  3MEF A;  4I7Z C;  4XXE A;  4OWT B;  4JI6 Q;  1TWG B;  2F4V Q;  2OQ0 A;  1DOK A;  3IKJ A;  2Y0S G;  5GAH C;  4BY1 B;  1G6P A;  2VUM B;  2AQ2 B;  1Z6H A;  3SK8 A;  5EQ0 A;  2EE1 A;  1VQ4 A;  3CCL A;  1H9J A;  5IYB G;  2A73 B;  5IYB H;  5C3W A;  1TY0 A;  1ASY A;  1SFO H;  4LF5 L;  2NN6 G;  5JJI A;  4R4T A;  2NN6 H;  1BR9 A;  2DGY A;  5ELC A;  4ID6 A;  1F9R A;  3RN5 A;  2RA4 A;  3DM1 A;  4A3B G;  5IIF A;  4GNX C;  5TSS A;  4B3R L;  4DAY A;  1WYD A;  2QKI C;  3R2T A;  3MHB A;  1NAP A;  4IUQ A;  3NEM A;  1CFM A;  1R4P B;  2DJF C;  1HR0 W;  3NP8 A;  3CCU A;  1KDA A;  2AWO A;  5C44 B;  2V1C C;  1Z47 A;  1IKL A;  5IOC A;  1JB7 A;  4FNF A;  5IE8 A;  1VMP A;  3VR2 A;  2MJ8 A;  3KDF B;  1Q46 A;  1ESF A;  3T51 B;  3D6W A;  4RGN A;  1AE2 A;  1V1P B;  2X6L A;  3JAM E;  1EQQ A;  1M8A A;  4ZKC B;  1HUN A;  5C4X B;  4R8I A;  1FNW A;  2JA7 G;  1U4P A;  2RBM A;  5FLX c;  1CKN A;  1EQR A;  2KEC A;  4WRD A;  1A3T A;  2EIF A;  1HUM A;  2JEA I;  1EFW A;  2XRQ D;  3RLO A;  3KF6 A;  3W2D A;  4DR5 Q;  3M4P A;  3NWS A;  2JA5 B;  5M3F B;  3NBH B;  3S15 B;  3KYH C;  3HFZ B;  4KY7 A;  1MHW C;  3CHB D;  1X3G A;  3I3C A;  1SRO A;  4YCV A;  5M5X B;  1QWY A;  3W1G A;  2Z1C A;  1D5X C;  3I73 A;  3ND9 A;  1N34 L;  4DR7 L;  1FVI A;  3T16 A;  4C2M H;  4XT1 B;  3H94 A;  5M3M G;  4HJ7 A;  1FGB D;  1JJ2 A;  2GVB A;  4LMQ D;  5M3M H;  1AP0 A;  1MSH A;  1HTL D;  4B3T L;  3TS0 A;  1YVC A;  5ELB A;  5FKA C;  4XIG S;  1F9P A;  1CKM A;  3WOF A;  1OTC A;  1Q8K A;  4AQY L;  1VQP A;  4K6D A;  4DR7 Q;  5KGU A;  1VQC A;  2ENB A;  2Q2H A;  3NSW A;  4HMI A;  1QG7 A;  2XTI A;  1O7Z A;  3VYS A;  5JJZ A;  5IYD G;  2Z4H A;  2ZJR A;  1NE3 A;  4B3T Q;  5IYD H;  4F88 A;  1E24 A;  3I91 A;  4J8Q A;  4AQY Q;  1HA6 A;  3C3L A;  3ICE A;  1WTH A;  1KNA A;  1SEB D;  1VQ6 A;  4OEL B;  1EL0 A;  1D1K A;  3BZC A;  3H0G G;  5EBC A;  1YBY A;  1E2W A;  1TY2 A;  3I90 A;  1G8Z D;  2QEX A;  2C35 B;  3GTK B;  3HOZ B;  5M5W B;  1XWE A;  4KV6 A;  1H9M A;  4A3M G;  3S16 B;  1ILQ A;  2ICE C;  3H15 A;  4A3M H;  3NE5 B;  1ONL A;  1CZW A;  1YJ9 A;  1S4Z A;  5LL6 S;  1PFN A;  2HDL A;  4PZ6 A;  4TKO B;  4GLA C;  3VR5 A;  1UNS A;  1KQS A;  4DPG A;  3PF4 A;  1ROD A;  1B9N A;  4A3I G;  1ENF A;  4XYO A;  2Q8I B;  4JI0 L;  3QOJ A;  3RMH A;  1LTR D;  5CBA E;  1BBW A;  2N8N A;  1ET6 A;  3MXP A;  4H44 C;  4KN4 C;  4DAY B;  2ALY B;  3E0J A;  4DV1 L;  2IWH A;  3Q23 A;  3G7L A;  4DUY L;  1C0A A;  1YNN C;  2K7V A;  4ALP A;  2XSC A;  1A0I A;  2HIX A;  4IFD I;  2Q2T A;  3D3R A;  2N3S A;  1I50 H;  2EYH A;  1KDC A;  1WI5 A;  4JOI C;  4PQX A;  1VQH A;  4DV1 Q;  2SOB A;  3B6Y A;  4JYA L;  1EZ8 A;  1PH3 A;  4M1U B;  1SXT A;  1QZG A;  3I72 A;  2LFN A;  3U4V A;  3E0E A;  5FK9 C;  4K5X A;  4DU9 A;  1VQK A;  1PZI D;  1J8I A;  3E3X A;  2OEO A;  1S72 A;  2KCM A;  2A68 C;  3KJO A;  4IPD A;  1E22 A;  2O5I C;  2OXP A;  4OGQ C;  1ENC A;  1KHI A;  3K5O A;  2X69 A;  3OIP A;  3H3V I;  3RZD B;  3NPP A;  1SE4 A;  5IT9 L;  1I6H H;  1L1O A;  1J5E Q;  3BDL A;  2B2W A;  4O42 A;  1HXY D;  3NUC A;  1RKN A;  3J80 E;  1X3F A;  3DEP A;  3I2Z A;  1YNJ C;  5BR8 L;  4KKU A;  4WJ4 A;  4QL5 A;  2BH8 A;  1R4Q B;  2L11 A;  2K4K A;  2AKW B;  1QNU A;  2Z0S A;  1G91 A;  1JIC A;  4POF A;  3QG1 A;  4ME3 A;  1KRS A;  4C2M B;  4NW2 A;  2RSN A;  5J39 A;  3UI2 A;  2EYM A;  3M9B A;  1G6Z A;  1LTG D;  1GHK A;  2BH2 A;  1HH2 P;  2R3Z A;  1Q86 C;  4BBS H;  2LKV A;  5BN3 A;  3MXG A;  4AYB G;  2K32 A;  3OWE B;  4KHV A;  4OON A;  1Q1E A;  4QF4 A;  3X3M A;  4EQ5 A;  4DAV A;  1EIY B;  2WKD A;  2KOL A;  3K7U C;  1VQB A;  4CJ1 B;  1MGS A;  2IHE A;  3KLS A;  4JI7 Q;  4DXF A;  4LF8 L;  2M00 A;  3K81 C;  2KCT A;  2EY2 A;  4LJZ C;  3G71 A;  1DON A;  1TKW B;  2XNA C;  1TR5 A;  3L2P A;  1BVS A;  2I5H A;  5LL6 X;  3M7N A;  1TWC B;  3A8I E;  3I7F A;  1N33 L;  2CH4 W;  3HKZ B;  3VYU A;  2HT1 A;  1NR4 A;  1QVC A;  3A0J A;  1XJV A;  4P73 A;  1QE6 A;  1STA A;  1WVL A;  1M1K C;  5LMN W;  2OT2 A;  1NNX A;  4H02 A;  5I4D A;  5CBE E;  4HJ9 A;  1GUT A;  2F0O A;  1O7Y A;  1OO9 B;  5BN4 A;  4JI1 L;  2Z6K A;  4KK7 A;  3ZJY C;  1AE3 A;  1U0L A;  4P74 A;  5GAE C;  3EIV A;  3BG3 A;  4DUZ Q;  2JN4 A;  3T13 A;  5HY6 A;  5IP7 G;  4JV5 L;  4X64 L;  3I4N G;  3OTO L;  5IP7 H;  1CTM A;  4OIK A;  3STB C;  4LUZ A;  1VMC A;  3V96 A;  4H7B A;  4JI1 Q;  4RKL A;  1PRT F;  3A5Z B;  5J3B A;  1XNQ Q;  2K01 A;  5FO7 B;  2FJ2 A;  1BUV T;  1UE5 A;  1QJO A;  4XTC S;  4CJ2 C;  1HNW Q;  1I50 B;  2K1B A;  1D8L A;  4YCU A;  2K05 A;  1HCZ A;  1FJG L;  4LNQ A;  3KFU A;  4C3J G;  2R93 G;  5M9O A;  4C3J H;  2OF1 A;  4DR3 Q;  4LFC Q;  2R93 H;  1WTQ A;  1H9S A;  4FXK C;  3T4A C;  1L1O B;  5DEH A;  3IFD A;  5E7N A;  3I4M G;  3J7A V;  3P7J A;  1B3A A;  3AFP A;  2AUJ D;  4X62 L;  3SK6 A;  1TU2 B;  1YNX A;  4DXG A;  3CPW A;  4XT3 B;  5ELE A;  5JEA G;  2JA6 H;  3Q8D A;  3WDN A;  2B8F A;  4R4Q A;  1Q90 A;  1MBY A;  3A5U A;  1SYE A;  2BE5 C;  2L5T A;  2WAQ B;  3DMU A;  4R1J A;  3CCV A;  3KOJ A;  3AU7 A;  2QDB A;  4F87 A;  4ME5 A;  4G7H C;  4X6A H;  4JI5 Q;  1SE8 A;  4JI8 Q;  3ZYY X;  2Q8T A;  4ZRZ A;  5C3E H;  3PO2 G;  2A6H C;  2F0K A;  2I0Q A;  5JEA J;  4C1N I;  1OXT A;  3KLS X;  5M5Y H;  3OMG A;  2B2V A;  2SDF A;  3TQY A;  5FLX L;  1I4Q A;  1TVX A;  4MHE A;  3A8K E;  2FXQ A;  3GO5 A;  4LWC A;  4NP5 A;  4BY7 B;  4F7X A;  1JOQ A;  5A2Q L;  1Y8P B;  4B08 A;  4FVM A;  4RAU C;  1SJE D;  3QOL A;  2K5W A;  1JC7 A;  4BBS B;  1EOV A;  1A15 A;  4BBR G;  4PNY A;  4BBR H;  4MN3 A;  4CDE C;  2AHO B;  1PHJ A;  1PV4 A;  2KHS A;  4K0K L;  4UPA A;  1OXS C;  2F52 A;  2HHH Q;  4OO1 G;  3V05 A;  1Q82 C;  1QB5 D;  1K0R A;  5FJ8 H;  1P16 A;  2AUK A;  3I70 A;  1EYC A;  1ZYR C;  1E2V A;  5HGQ A;  3E9I A;  4KLK A;  2NVX H;  2Q8R E;  3TSS A;  1MJE A;  2UUA L;  4EGV A;  2F4I A;  2IPK D;  2UU9 Q;  2MUY A;  1L1O C;  2F0L A;  2VUM G;  2RDH A;  4BY1 H;  2B2Y C;  1TQO A;  3HOW B;  2O2L D;  1UWV A;  5IOD A;  3CCQ A;  1HNX L;  1JWS D;  1CM9 A;  2JYO A;  1Y8N B;  3F2D A;  4Q5V A;  5KND A;  1KAA A;  3WWV A;  2RQX A;  3W1B A;  2F0T A;  3IFT A;  3NBI A;  2D0P A;  1SYD A;  4DR4 Q;  1D5M C;  4A76 A;  2MFI A;  4RHR A;  4TVA B;  1PA6 A;  1M90 C;  2I5L X;  3I4O A;  1YEZ A;  3GTP B;  5C0X G;  3K5L A;  4LUO A;  5D3D A;  5KNC A;  1SBB B;  5LMU L;  3JAM c;  3H3V C;  1PVO A;  4LF6 L;  4B3M L;  3A8J E;  4K5V A;  4KKT A;  4HID A;  2XVS A;  4C3I B;  3M4O H;  1ZKO A;  5G3L F;  3CCM A;  5C44 G;  4M8A A;  3CME A;  1IW7 C;  2GVA A;  1QCB D;  3PV0 A;  1X3P A;  2SNS A;  5LMU Q;  1D6E C;  1PTO B;  4EQP A;  3Q24 A;  4UP9 A;  5C0X J;  4B3M Q;  3U4Z A;  3EVQ A;  1NUC A;  3PIP A;  4HAE A;  5C4X G;  4X66 L;  1GO3 E;  2HCC A;  2WB1 B;  5C4X H;  2OTJ A;  1U4M A;  4LF4 L;  1ZXT A;  3Q22 A;  4DV4 L;  1T5X D;  1VDZ A;  2ZT9 C;  4AYB E;  3MWY W;  4J15 A;  1STH A;  3PUX A;  4KI0 A;  4DGZ A;  4FF3 A;  2JA5 H;  5M3F H;  1WCM H;  3RLN A;  1SYB A;  1Y14 B;  4DA2 A;  1DM0 B;  5M5X H;  2KEN A;  3ITP A;  4KKS A;  2JA6 B;  2PQE A;  1EY4 A;  1LTB D;  1SMY C;  4J1M A;  1MI2 A;  3CCR A;  2F3W A;  1PRT B;  4HSV A;  4BA2 I;  4HED A;  3C2P A;  4LF7 Q;  1IKM A;  3P1H A;  2R7Z H;  5KEE A;  2ATW A;  4X3T A;  1VQD A;  5IGF A;  1JOR A;  1JOK A;  4U67 3;  2F0P A;  1WTV A;  5DAU A;  3F2B A;  3Q0A A;  4IAL A;  2R7F A;  3HRZ C;  3UDF A;  4TRD A;  2L0C A;  4L5Q A;  4FF1 A;  2E5L L;  1C48 A;  1EFI D;  1EIH A;  2ZXR A;  2F0M A;  1SE3 A;  5FLM H;  5IGG A;  5JPM C;  1I4P A;  1HFN A;  1QVG A;  1TWH H;  4FXD A;  1KIX A;  2PZU A;  1LLR D;  2JA9 A;  1SN8 A;  1STB A;  2QF7 A;  4JI4 Q;  3AMU A;  1EY6 A;  4TQU S;  4HIO A;  3HOZ G;  3GTK H;  2K6A A;  2I46 A;  3L9A X;  4G4K A;  3S9W A;  2VB3 X;  1PTO C;  1AN8 A;  3S16 H;  1LT5 D;  3CAM A;  4CJ0 B;  5EJW A;  2A8V A;  3RR5 A;  1KDB A;  1PH4 A;  1I6V C;  2NVX B;  4Z9C B;  1VQO A;  1GXD C;  1K83 B;  3MTS A;  3FDT A;  3E5S A;  3BVG A;  1E7Z A;  2A1A A;  5CV4 A;  2IX0 A;  1Q3L A;  1XXG A;  1U9R A;  1GUG A;  3QIA A;  2CVR A;  2HQE A;  2EJG C;  2R92 B;  1WTR A;  2NZO A;  4A3D H;  3K6O A;  1PFM A;  2PNH A;  3OSO A;  3OYY A;  1II3 A;  1ET9 A;  1XPR A;  1A3V A;  1PRT C;  2VZA A;  5EAY A;  1L0Y B;  4DNR B;  2VNU D;  1SRU A;  2HQL A;  4KY5 A;  4RFB A;  4PMB A;  2I07 B;  2JP1 A;  4CKB A;  2EY6 A;  1PH5 A;  1DJR D;  4GKJ Q;  1CQV A;  4MTK A;  4IZ8 A;  4N9P A;  3AQQ A;  1YJN A;  1G2S A;  2G9D A;  4FP5 D;  3M4O B;  4H13 C;  5I9P A;  2RDG A;  3J80 c;  3SR1 A;  1SNQ A;  3UDX A;  1D2B A;  2A69 C;  2UUC Q;  2MO1 A;  2PW7 A;  4DR5 L;  1AZQ A;  3OW7 A;  2VY3 A;  3PQI A;  2B3G A;  3DEO A;  4UAI A;  3RZD H;  1S5C D;  1E1O A;  4IUV A;  3OW2 A;  3SK4 A;  1YHB A;  1STY A;  2PI2 A;  1AEX A;  2K5Q A;  4N9T A;  5C3X A;  1WCM B;  2B8G A;  2VQE Q;  5HUR A;  4IJH A;  3SK5 A;  2B2T C;  1LAB A;  2TMP A;  1GUW A;  3KBX A;  3D6C A;  4L5T A;  3A56 A;  2CKZ B;  3GQB A;  4ILW A;  4P72 A;  4QQB X;  3G6J B;  5COR A;  2E2I H;  1I4X A;  5JOB A;  4APV A;  1QIL A;  2F0W A;  1PLF A;  2Z6B A;  1B70 B;  3K7A H;  3JAM i;  4OXP A;  2PQA B;  1YIT A;  2R7Z B;  3DM3 A;  2GN5 A;  4G7Z C;  4DNI A;  1I4G A;  1BCP D;  4L63 B;  1S3O A;  2UXC Q;  1MJC A;  1L2F A;  2VQF L;  1YHQ A;  1Q7Y C;  2NUC A;  2B63 B;  1DXM A;  4K5W A;  4B9X A;  2L4N A;  5CV6 A;  3D0F A;  1Y1W H;  1KLG D;  4UDU C;  4DV7 Q;  1F2M A;  4KD4 A;  1N9W A;  1JQY D;  1TWC H;  3G6E A;  3HKZ G;  4CHT B;  1TWH B;  1PYB A;  4PZ7 A;  2GA4 B;  3RLF A;  3AEV A;  1PYW D;  2VQF Q;  3GTO B;  3K59 A;  2NZH A;  1FGU A;  1DGS A;  4H0L C;  4KN7 C;  3FRP B;  5FOB B;  2ZXO A;  1EYG A;  4N8X 1;  3BZD B;  3ERO A;  1SAP A;  4X65 Q;  1KD1 C;  1G29 1;  5CC4 A;  3KBG A;  4GLX A;  2UXB Q;  2BCO A;  2CW0 D;  4TSS A;  2LSS A;  2ZM6 Q;  4A93 B;  3TZD A;  5CR3 A;  2OTL A;  3STB D;  4A3L G;  3ULL A;  3HOY B;  1B3Q A;  4A3L H;  3AB9 A;  2NVY B;  5CYU A;  2E76 C;  2RKS A;  2YV5 A;  1YZ6 A;  3R8B A;  1EU4 A;  1PFB A;  1SYC A;  2EDG A;  4N8F A;  5I2Y A;  4A3D B;  2OQK A;  2K50 A;  4RGM A;  1Y1V B;  4MTN A;  3OWF A;  2KCC A;  2Y0S B;  3S1M B;  1XPO A;  1FD7 D;  1K0S A;  4UP8 A;  3HOV B;  2EXZ A;  1J9O A;  2L15 A;  4NDX A;  4IFD H;  1ENA A;  1CKN B;  5IGC A;  2IY5 B;  2E2D C;  2HIV A;  1EEI D;  1EYA A;  4A75 A;  4O2D A;  5C5M A;  2F0E A;  3KF6 B;  4EX5 A;  3T1Y Q;  1J5E L;  4DNT B;  5I6W A;  1JWM D;  3JAM L;  3C1F A;  4DK1 A;  2LMC B;  2MO0 A;  1RIP A;  5DM7 3;  3CXC A;  1NY4 A;  3NEL A;  3DLL A;  2WAQ G;  3PIP 3;  4ZUJ A;  4R4C A;  2K5N A;  2QCP X;  3ONA B;  1IYV A;  3G4S A;  4LF9 Q;  1D1I A;  4DV3 Q;  1HNZ L;  2M9V A;  1O80 A;  1F77 A;  3MXN A;  2MNA A;  2Q2U A;  1N32 Q;  3CU7 A;  4R4I A;  2K5D A;  1GHJ A;  3CMA A;  3U50 C;  3H3V H;  3ND8 A;  1CT1 D;  4UP7 A;  1PH8 A;  4YWM A;  4QIW B;  4GOP A;  1FNV A;  4PV1 C;  1HHV A;  1SYF A;  3S1Q B;  1HNZ Q;  3GTG H;  1PXU A;  4BY7 H;  3UDI A;  1XMO Q;  2KJX A;  4E6I A;  1C8C A;  4YHH L;  1TT2 A;  2CWA A;  2WKC A;  4MIU A;  3UE1 A;  2BDO A;  2E2I B;  1K3R A;  2O4X A;  4JI7 L;  1NCV A;  2O5J C;  4A3G B;  5ELD A;  4BBS G;  4PZ8 A;  1GUS A;  1N8R C;  3K7A B;  2M2L A;  1EQT A;  3HGB A;  2H4O A;  1VQG A;  4G7O C;  3TZU A;  1SND A;  1ICW A;  2VB2 X;  4L5S A;  4YHH Q;  1RD9 D;  2K28 A;  2HD3 A;  3VA7 A;  4XQJ A;  1BXT A;  1H9K A;  3J80 i;  4DV2 L;  5D3I B;  3RNU A;  2F0Q A;  2N78 A;  4A3F B;  2DY8 A;  2CQA A;  3MAQ A;  4RWS C;  2F0F A;  2D62 A;  2YTV A;  1Y1W B;  5GAD C;  3M4Y A;  2WIN B;  3DWA A;  2HDM A;  3DWP A;  4NXM L;  4DV2 Q;  3KK7 A;  1S5F D;  1VCI A;  3HOW G;  2D5D A;  4KJO A;  3HOW H;  2K33 A;  2F3I A;  4CDC C;  4K14 A;  1ICF B;  3FPP A;  1XNR Q;  1B50 A;  1IHZ A;  1PTO F;  3IAY A;  3CRK C;  2Z4I A;  1XMQ Q;  2IHF A;  3SXH A;  4RGO S;  2VL6 A;  4ODG A;  4NXM Q;  5CV7 A;  4DUZ L;  1VQE A;  3PUW A;  3HOU H;  2RCN A;  1HJP A;  2MPM A;  4WFN 3;  4FDB A;  3GTP H;  2EYJ A;  2Q2I A;  1B53 A;  1LT6 D;  2N88 A;  2E2J B;  1BDO A;  1T9H A;  4P75 A;  4C3H H;  1XNQ L;  1R9T B;  3PMF A;  2LS0 1;  3K57 A;  1JMC A;  1HNW L;  2KCN A;  3V2T A;  1X9N A;  2R7D A;  4DV0 Q;  3NTK A;  1QVF A;  3RZO B;  1VQA A;  4C3I H;  4R9W A;  4F8M A;  2D2C C;  5EPJ A;  3J7A F;  4LFC L;  3N52 A;  4DR3 L;  1JT8 A;  2WII B;  1E3P A;  2ZTE A;  1SDF A;  3F8T A;  3J81 j;  1PTO H;  3P75 A;  4HN7 A;  3TRZ A;  1RHP A;  4YY3 L;  2WB1 G;  3RUZ A;  1PZK D;  4K2K A;  3TME A;  4FXG C;  4RCN A;  3GTQ H;  1TXY A;  3NWT A;  2VS1 A;  3I4L A;  2A6E D;  1IBM L;  5K36 H;  1JE5 A;  2EZV A;  4MNO A;  4C56 C;  1W6J A;  2EQS A;  4YIJ A;  4YY3 Q;  1YI2 A;  2XGT A;  3J81 E;  4LW1 A;  2CHB D;  1D7Q A;  5C4Z A;  3OHX C;  4HJA A;  2JA6 G;  4AIM A;  1RTO A;  4JI5 L;  3M3Y B;  4HTH A;  1IBM Q;  5T1G A;  1L0W A;  4JI8 L;  1DZ1 A;  4YCW A;  1BOS A;  1U4R A;  1XTD A;  3FVQ A;  2QEJ C;  4NB3 A;  1SNP A;  2J0T D;  3FKI H;  1EQV A;  2E74 C;  3J80 L;  1UE1 A;  3HKZ E;  4IUN A;  4U68 A;  4BA1 I;  4L5R C;  2F0U A;  1IL8 A;  2NBF A;  3BU2 A;  5C3E G;  1HRJ A;  3CW2 C;  1HR0 Q;  5IGE A;  3D4R A;  1H9R A;  3S17 B;  4ULL A;  3I8Z A;  3KUP A;  4Y52 H;  1CA6 A;  2PNR C;  1S40 A;  3GTG B;  2LY7 A;  2NWG A;  2HCI A;  4A3J H;  4LAA A;  1K73 C;  2AWN A;  2HHH L;  1X54 A;  1ML0 D;  2JEB I;  1DYQ A;  1GM5 A;  1EOT A;  1XX8 A;  2VXW A;  3OMC A;  2NTS A;  1A62 A;  2JK8 A;  2CWP A;  3ERS X;  4BS9 A;  2G5D A;  2ZJP A;  2UU9 L;  1I3Q B;  1A6X A;  5FO9 B;  4A3E B;  2EYP A;  4GN4 B;  3K8A A;  5FJ8 G;  1MSG A;  1ZEQ X;  2KVM A;  4JBM A;  4HCE A;  2UXD Q;  2OCE A;  4OO1 I;  3SGI A;  3MFG A;  1H95 A;  1K83 H;  4GNX A;  2KED A;  2F0I A;  3EQL C;  4BY1 G;  2B2W C;  3VA5 A;  3ERQ A;  4K2L A;  4HR7 B;  3WOE A;  4DR4 L;  3UDG A;  4DAM A;  2FFK B;  4BXX H;  2PCF B;  1E2Z A;  1Q1B A;  2ASB A;  2R61 A;  2R92 H;  2CFM A;  3PO3 H;  1AZP A;  3CP0 A;  5C4H A;  2ZXP A;  4ZLT F;  3PSI A;  4NXN L;  4XQN A;  1X56 A;  2KQ3 A;  1MIU A;  3HOU B;  1KNE A;  4QUF A;  1JJC B;  4JG2 A;  5JPN C;  2NVQ B;  2WAQ E;  3L7Z C;  4HIK A;  4KHZ A;  4C3H B;  1GD7 A;  3K5M A;  1KRT A;  4RHS A;  3D8G A;  2BOS A;  4NXN Q;  1Q8I A;  4O1N A;  3QJY A;  4GN5 A;  3F2U A;  1PMR A;  5GQO A;  3S24 A;  4IPH A;  3C1E A;  5C0X I;  3TN2 A;  4A4I A;  1H9S B;  1TS2 A;  4OX9 Q;  2KUM A;  4HJ8 A;  5I2X A;  1T5E A;  3BDC A;  4B3S L;  3KLW A;  3H09 A;  4KHP Q;  1YIJ A;  2F0G A;  5LHY 1;  5E4X A;  4DR1 L;  2JXM B;  2QDL A;  2FMC A;  3M85 A;  2VW9 A;  2PMZ B;  1VQ7 A;  3T1H Q;  1G51 A;  3GTJ B;  3GTQ B;  3CQZ H;  4A3C H;  3GTM B;  1EEF D;  1Z9F A;  4B3S Q;  2K14 A;  3VDY A;  5K5P A;  4DR1 Q;  3HEJ A;  1F2L A;  2ID0 A;  1B2T A;  4UY8 C;  4EQN A;  2JA5 G;  5M3F G;  1WCM G;  2K52 A;  3ULJ A;  4KMU C;  2NVT B;  1UEA B;  2XWJ B;  3I56 A;  3F1Z A;  4LF7 L;  1STE A;  1RL2 A;  1CZG A;  1W3S A;  4V19 0;  1NSN S;  1O7I A;  3N6R A;  1CHQ D;  3URY A;  2Z6K C;  5NUC A;  5C4J B;  3FKI B;  1SJH D;  1I94 L;  2IW3 A;  4ZAI A;  2EY1 A;  5EKL A;  2QGQ A;  5CV8 A;  3G48 A;  1F2Y A;  2WV6 D;  1BF4 A;  2K04 A;  2R7Z G;  4ZKB B;  3I4M B;  2RCF A;  3ER0 A;  5D14 A;  4QGU A;  4IUP A;  4XQQ A;  1V1P A;  2BDN A;  1I94 Q;  1IBL Q;  1K8A C;  1D5Z C;  3S1R B;  4JI4 L;  2B63 G;  4R8N A;  1B1Z A;  4A3J B;  5IWA Q;  2MQH A;  2B63 H;  1BQQ T;  1S5E D;  1ESR A;  1LTI D;  1BBU A;  5FLM G;  2XWB B;  2KA7 A;  2UUB Q;  4QJF A;  1C7Y A;  1PFS A;  1N36 L;  2JA8 H;  3CCS A;  1A3U A;  5EKK A;  3GTO H;  3QB3 A;  4RKB A;  3BYT B;  3AFQ A;  3HOX B;  1L0X B;  3VR3 A;  1BO0 A;  2B2U A;  3K0X A;  3CD6 A;  3MEH A;  2F03 A;  3K58 A;  4MZ9 A;  2KEE A;  4NMZ A;  1SNO A;  1N36 Q;  4Y7N B;  4JOI A;  1F2Z A;  4V0B A;  1WJJ A;  1RDP D;  2B39 A;  5DM6 3;  4JI3 L;  2WB1 E;  1C4Q A;  2AQ1 B;  3A7A B;  4A93 H;  2KBN A;  2X6G A;  2KHJ A;  3HOY H;  1I4H A;  1B44 D;  3BVZ A;  2NVY H;  1YJW A;  4DAP A;  3HP3 A;  3FMC A;  5G3L D;  1YNN D;  2EYO A;  1KTK A;  1BCP F;  4A3D G;  3PO3 B;  4EVO A;  4JI3 Q;  4S3S A;  4X3S A;  3GDE A;  2B2V C;  4GKJ L;  1JB3 A;  1PH7 A;  3PIO A;  1Y1V G;  2L55 A;  1Y1V H;  3I55 A;  3LWE A;  4K8I A;  4FYD A;  1F9S A;  3CKI B;  1X3E A;  3S1M H;  2Z9H A;  3S2D B;  4IQZ A;  2NN6 I;  3AYH B;  4X3K A;  3HOV G;  5EBD A;  5LMN L;  3HOV H;  1WFQ A;  3CRL C;  2UUC L;  1VQ9 A;  2L9H A;  2WP8 J;  2A68 D;  3IL8 A;  1STN A;  4CDD C;  1I5F A;  1STG A;  2J4X A;  1CA5 A;  1UAP A;  2MP1 A;  2IX1 A;  2RF4 A;  1B4O A;  5LMN Q;  4IN3 A;  4I7A A;  3TEH B;  2XRS D;  4A3B H;  5EPK A;  2VQE L;  3CQZ B;  4GLV B;  4LF5 Q;  4IUU A;  3T56 B;  1X6O A;  1YNJ D;  2C5C A;  1HTP A;  3PCO B;  2JSO A;  2DUD A;  1Y69 U;  5BN5 A;  1VQM A;  1E0B A;  1PZJ D;  2F0V A;  1BBX C;  4DN4 M;  2K5H A;  5CGK A;  4QUC A;  1SMX A;  1ASZ A;  4B3R Q;  1LYL A;  1V9P A;  2QIL A;  3NEN A;  1HZC A;  1LTA D;  3IRB A;  3P20 A;  3R93 A;  1JE4 A;  5ISR A;  4OWW B;  3S1Q H;  1LUZ A;  1V8Q A;  3F2C A;  1G2T A;  1FNU A;  1TS4 A;  2JA7 H;  2KHI A;  1EY0 A;  4A3G G;  1Q12 A;  4X3U A;  1S5B D;  2P5Z X;  3MXU A;  2UXC L;  1KAB A;  3M4Q A;  4C1N K;  3HG9 A;  5IT9 E;  4A3G H;  4L8J A;  1C9O A;  1E1T A;  2EOT A;  2IJ0 A;  2G9H D;  1JCK B;  3GP7 A;  2YTY A;  3FEW X;  1X65 A;  2F0S A;  5C5L A;  4DV7 L;  4IOA A;  5C6A A;  2XN9 C;  3SDZ A;  1BKB A;  1PDQ A;  1SLJ A;  1KXL A;  1WOC A;  4A3F G;  2B29 A;  4A3F H;  4DF7 A;  1P8L A;  3LWU A;  2MHV A;  1Y1W G;  4RA8 A;  4WOR A;  3S14 B;  1SE2 A;  1N34 Q;  2JA8 B;  3MC0 B;  4X65 L;  3K80 C;  2UXB L;  4K8J A;  2WFW A;  2PZW A;  1WD1 A;  2ZM6 L;  1KAW A;  5T1I A;  5JVG 3;  1SR3 A;  2NB0 A;  3QWN A;  1W6K A;  3A74 A;  1F9Q A;  4A3K B;  1VQ8 A;  2NTT A;  4R4O A;  4DV5 L;  1B9M A;  3BZK A;  3D4W A;  4LUV A;  3PF5 A;  3K0Y A;  2JE6 I;  2RHS B;  3H0G H;  2YU9 B;  1A2U A;  1TWA B;  2L1B A;  2E2J H;  2PW5 A;  1R9T H;  1GKH A;  3PUZ A;  4HIM A;  2EYF A;  2MGS A;  4IUR A;  5AJ3 L;  4DV5 Q;  2JQO A;  1GOZ A;  3RZO H;  1QOH A;  5J22 A;  2N49 A;  3S2H H;  2D0O A;  4GS3 A;  4KJN A;  4CKE A;  4OEM B;  3J81 c;  4NPS A;  4HCS A;  1JJG A;  5AJ3 Q;  1B8A A;  1J6Q A;  1CQF A;  3U9O A;  4ZUI A;  4A3I H;  1B7Y B;  1FL0 A;  5KNB A;  4GKK L;  1VQJ A;  3T1Y L;  4YWK A;  1IBK L;  4IFD G;  4IPC A;  3H91 A;  3C46 A;  1LM0 A;  4OHJ A;  1V43 A;  2B2U C;  3Q6S A;  3BS1 A;  5DLQ E;  1SFO B;  5HGT A;  4JI0 Q;  4LF9 L;  1SSO A;  3CCJ A;  1QNK A;  4GKK Q;  3J7Y W;  4DV3 L;  1EYD A;  5E4W C;  4CDF C;  1IBK Q;  2BE5 D;  1N32 L;  2I5M X;  1BCP B;  4Q0F A;  3M3Y H;  4A3B B;  2DNC A;  4DUY Q;  1TS3 A;  3VYT A;  4IFD J;  1EIF A;  3TDQ A;  1A8V A;  1CK1 A;  3H6M A;  4LK1 C;  2A6H D;  2EJM A;  1SNC A;  3OIQ A;  1XMO L;  2PPB C;  2CCZ A;  3M7G A;  4JYA Q;  3DHQ A;  4QCL A;  3S17 H;  5I9O A;  3GV3 A;  3HS0 C;  5A35 A;  4J6H A;  5E3F A;  2YTX A;  3LNN A;  3NQT A;  4JK1 C;  2K5V A;  2TSS A;  4BY7 G;  4ZK9 B;  5EGT A;  4ABN A;  2JA7 B;  3FHW A;  1A63 A;  4I65 A;  3FP9 A;  2B2Y A;  1GUN A;  2SNM A;  3KF8 A;  4EQO A;  1X32 A;  1SNM A;  1EY7 A;  2DJG C;  1CUK A;  2E8G A;  2RSO A;  4WJW A;  1OXU A;  1K9M C;  2EXD A;  4RG1 A;  2ICI A;  2CH4 A;  3R2I A;  4A3E G;  1I3Q H;  1VQI A;  1ZYR D;  3QR8 A;  4A3E H;  4GZY C;  5FLX E;  1CSP A;  2AQ3 B;  1KC8 C;  1OXV A;  3MZ5 A;  3GTL H;  5M3M B;  5JVH 3;  4POG A;  5BR8 Q;  4HMJ A;  1X3Q A;  1XNR L;  5A2Q E;  1NMG A;  1EY8 A;  2Y0S E;  3CF5 A;  2A19 A;  1UUP A;  1XMQ L;  4PMC A;  5E1F A;  4RH6 A;  1NJI C;  2IX3 A;  3J7A 5;  2FMM A;  1LV9 A;  3NXW A;  3TRE A;  4JW0 A;  4KY6 A;  4IO9 A;  4FF2 A;  1RJT A;  3OOC A;  4CKC A;  2QW7 A;  4IUT A;  1BCP C;  2R6G A;  2Z8L A;  1EY9 A;  2PI2 E;  4RGT A;  1EZ6 A;  1MD2 D;  2BA1 A;  3TP5 A;  3HOU G;  4DV0 L;  1K8O A;  4RMF A;  1PYS B;  4LF8 Q;  1ILP A;  3KJP A;  3H0G B;  3PUY A;  2NVQ H;  4C3H G;  1DOL A;  1IL2 A;  2RHQ B;  1HZ9 A;  2RVL A;  4K6L A;  4WJ3 M;  3S1N H;  1O78 A;  1IW7 D;  1MKH A;  2CQO A;  1WTO A;  3FPU B;  4C3I G;  4A3M B;  1N33 Q;  5DNF A;  4HJ5 A;  1SYG A;  2EYL A;  2A74 C;  4QIW E;  1CKO A;  1XTC D;  3S2H B;  3VR4 A;  2F0H A;  4ZYS A;  1DD2 A;  4GN3 B;  2PO4 A;  1PH1 A;  1WTX A;  1Q81 C;  3PIO 3;  1AFP A;  3BDO A;  2EPB A;  1QZH A;  1EUJ A;  1X55 A;  3DUZ A;  4P71 A;  5ELN A;  2CW0 C;  3A7L A;  1HPC A;  4A3I B;  3GTJ H;  1KL9 A;  3CCE A;  3GTM H;  3I4N H;  2IT1 A;  5K36 G;  3EA6 A;  5IGB A;  3TP6 A;  5J1Z A;  1CHP D;  4P2C B;  3MXN B;  3CC2 A;  1SMY D;  2NVT H;  5KRU A;  4JV5 Q;  4X64 Q;  2K03 A;  3OTO Q;  1DOM A;  4JCV E;  3VR6 A;  3RN2 A;  4JPB W;  4GOP B;  5CV5 A;  1HR0 L;  3SE0 A;  3EN2 A;  3FKI G;  4XYQ A;  5C4J H;  5IY0 A;  1DCZ A;  2F1M A;  2ZTC A;  3T53 B;  1QUQ A;  4JBW A;  2E2H H;  1FJG Q;  3KF8 B;  1LO5 D;  3I4M H;  3EFX D;  1HQR D;  2H5X A;  3HZX A;  4JI2 L;  1BNZ A;  3D4D A;  1PH6 A;  3L3O C;  1W2B A;  1HZB A;  2F0D A;  3BVM A;  5JEA H;  1EWC A;  2F0N A;  2ZTD A;  2DNE A;  3S1R H;  4A3J G;  5I6Y A;  1VQF A;  2EVB A;  3E6Z X;  3J81 i;  1IYJ B;  1I6H B;  2AMC B;  4JI2 Q;  4X62 Q;  2ZJQ A; 
#chains in the Genus database with same CATH homology
 5EKI A;  3MVV A;  1IYU A;  3QO2 A;  1VF5 C;  2DY7 A;  4OIJ A;  2WAC A;  4FO2 A;  4ZQ3 A;  1PTO D;  2RDF A;  1HFG A;  1V1O A;  1LT4 D;  1A2T A;  3SVM A;  4CBV A;  1GJX A;  4CGY B;  3SEB A;  3TP7 A;  1VF7 A;  2HUG A;  3GD7 A;  4B9W A;  3GTL B;  5IGD A;  4RCO A;  3EJI A;  5D65 A;  1K8M A;  1Y8O B;  3A55 A;  1S5D D;  1TS5 A;  4AYB B;  1WD0 A;  3NTI A;  1GUO A;  3X3N A;  1CI3 M;  4FF4 A;  2FIN B;  4OO1 H;  1LT3 D;  5F2D A;  1PRT D;  5JAV A;  5FO8 B;  1JOO A;  4NKL A;  1I4R A;  4KTA A;  3KLR A;  4G57 A;  2FHT A;  3BYY B;  5KYI A;  4OL7 A;  2N55 A;  1WTP A;  1WTW A;  3TP8 A;  3S1N B;  2A5H A;  1FYC A;  2B2T A;  2PYK A;  2A69 D;  3U9S A;  3MA2 B;  5ELF A;  2E75 C;  2PZT A;  3PUV A;  5C0X H;  3SHL A;  3DWQ A;  2H1E A;  1FR3 A;  2BA0 A;  2NYZ D;  4PMW A;  3I4N B;  1Z7T A;  1LTS D;  3DXJ C;  3J81 L;  5CMD A;  1OXX K;  1RF2 D;  3A54 A;  4KD3 A;  1RTN A;  2V4D A;  2YYZ A;  1JR0 D;  1EIG A;  2DN8 A;  1EY5 A;  5KYL A;  2SEB D;  4C3J B;  2R93 B;  4XDX A;  3NHH A;  3O13 A;  4DK0 A;  3D31 A;  2EY5 A;  4QMG A;  2E2H B;  2A6E C;  1LAC A;  1KLU D;  3VYR A;  3NK9 A;  2EJF C;  2C9O A;  4QB4 A;  5AFW A;  1O7L A;  5COY A;  3W3A A;  5KIX A;  2IL8 A;  1HQM C;  3NBH A;  1TII D;  5C3E B;  4BWG B;  2D9U A;  3PO2 B;  3NTH A;  2XIW A;  5M5Y B;  1TWF B;  4DFA A;  3OPO A;  3LX0 A;  1HA5 A;  3GV6 A;  1M4V A;  2F0J A;  1U4L A;  3RD4 A;  1RCV D;  4HSP A;  1LTT D;  5EPL A;  1XYI A;  2NZ1 D;  3TBI B;  1JWU D;  1AW7 A;  5CV9 A;  4BBR B;  1EU3 A;  2L12 A;  2F3V A;  1EWH A;  3NQI A;  4L6T B;  2J7Z A;  3K5N A;  3R3O A;  1NR2 A;  3MFY A;  4XXE A;  4I7Z C;  1TWG B;  1DOK A;  3IKJ A;  4BY1 B;  2VUM B;  2AQ2 B;  1Z6H A;  3SK8 A;  5EQ0 A;  2EE1 A;  1H9J A;  2A73 B;  5C3W A;  1TY0 A;  2NN6 G;  2NN6 H;  1BR9 A;  5ELC A;  4ID6 A;  1F9R A;  2RA4 A;  3DM1 A;  5IIF A;  5TSS A;  4DAY A;  2QKI C;  3R2T A;  3MHB A;  1NAP A;  4IUQ A;  1CFM A;  1R4P B;  3NP8 A;  1KDA A;  2AWO A;  5C44 B;  1Z47 A;  1IKL A;  5IOC A;  4FNF A;  1VMP A;  3VR2 A;  2MJ8 A;  1ESF A;  3T51 B;  3D6W A;  4RGN A;  1V1P B;  2X6L A;  3JAM E;  1M8A A;  4ZKC B;  1HUN A;  5C4X B;  4R8I A;  1FNW A;  1U4P A;  2RBM A;  2KEC A;  4WRD A;  1A3T A;  1HUM A;  2JEA I;  2XRQ D;  3W2D A;  3NWS A;  2JA5 B;  5M3F B;  3S15 B;  4KY7 A;  3CHB D;  3I3C A;  5M5X B;  1QWY A;  2Z1C A;  1D5X C;  3I73 A;  3ND9 A;  3T16 A;  4XT1 B;  3H94 A;  1FGB D;  1AP0 A;  4LMQ D;  1MSH A;  1HTL D;  5ELB A;  5FKA C;  4XIG S;  1F9P A;  3WOF A;  4K6D A;  5KGU A;  2ENB A;  3NSW A;  4HMI A;  1QG7 A;  1O7Z A;  3VYS A;  5JJZ A;  2Z4H A;  4F88 A;  3I91 A;  4J8Q A;  1HA6 A;  3C3L A;  1KNA A;  1SEB D;  1EL0 A;  1D1K A;  5EBC A;  3I90 A;  1E2W A;  1TY2 A;  1G8Z D;  3GTK B;  3HOZ B;  5M5W B;  1XWE A;  4KV6 A;  1H9M A;  3S16 B;  1ILQ A;  2ICE C;  3NE5 B;  1ONL A;  1CZW A;  1S4Z A;  5LL6 S;  1PFN A;  2HDL A;  4TKO B;  3VR5 A;  1UNS A;  1ROD A;  1B9N A;  1ENF A;  4XYO A;  2Q8I B;  3QOJ A;  3RMH A;  1LTR D;  5CBA E;  1ET6 A;  3MXP A;  4H44 C;  4KN4 C;  3E0J A;  2IWH A;  3Q23 A;  3G7L A;  1YNN C;  2K7V A;  2XSC A;  4IFD I;  3D3R A;  2EYH A;  1KDC A;  4PQX A;  2SOB A;  1EZ8 A;  4M1U B;  1SXT A;  3I72 A;  2LFN A;  5FK9 C;  4K5X A;  4DU9 A;  1PZI D;  1J8I A;  2OEO A;  2A68 C;  2O5I C;  2OXP A;  4OGQ C;  1ENC A;  3K5O A;  2X69 A;  3OIP A;  3RZD B;  1SE4 A;  3NPP A;  5IT9 L;  3BDL A;  2B2W A;  4O42 A;  1HXY D;  3NUC A;  1RKN A;  3J80 E;  3DEP A;  1YNJ C;  4KKU A;  2L11 A;  1R4Q B;  1QNU A;  1G91 A;  1JIC A;  3QG1 A;  4C2M B;  4NW2 A;  2RSN A;  5J39 A;  3UI2 A;  2EYM A;  1GHK A;  1G6Z A;  1LTG D;  2R3Z A;  2LKV A;  5BN3 A;  3MXG A;  2K32 A;  3OWE B;  4KHV A;  1Q1E A;  4QF4 A;  3X3M A;  4DAV A;  2WKD A;  2KOL A;  4CJ1 B;  1MGS A;  3KLS A;  4DXF A;  2M00 A;  2EY2 A;  4LJZ C;  1DON A;  1TKW B;  2XNA C;  1TR5 A;  5LL6 X;  3M7N A;  1TWC B;  3A8I E;  3HKZ B;  3VYU A;  1NR4 A;  1QE6 A;  1STA A;  1WVL A;  2OT2 A;  5I4D A;  5CBE E;  1GUT A;  2F0O A;  1O7Y A;  1OO9 B;  5BN4 A;  4KK7 A;  3BG3 A;  3T13 A;  1CTM A;  4OIK A;  1VMC A;  3V96 A;  4H7B A;  4RKL A;  1PRT F;  2K01 A;  5FO7 B;  2FJ2 A;  1BUV T;  1QJO A;  4XTC S;  4CJ2 C;  1I50 B;  2K1B A;  2K05 A;  1HCZ A;  4C3J G;  5M9O A;  2OF1 A;  1WTQ A;  1H9S A;  4FXK C;  3T4A C;  5DEH A;  3IFD A;  3J7A V;  3P7J A;  1B3A A;  2AUJ D;  3SK6 A;  1TU2 B;  4DXG A;  4XT3 B;  5ELE A;  5JEA G;  3WDN A;  2B8F A;  1Q90 A;  1MBY A;  1SYE A;  2BE5 C;  2L5T A;  2WAQ B;  3DMU A;  3AU7 A;  2QDB A;  4F87 A;  4ME5 A;  4G7H C;  3ZYY X;  2Q8T A;  4ZRZ A;  2A6H C;  2F0K A;  5JEA J;  4C1N I;  1OXT A;  3KLS X;  5FLX L;  3OMG A;  2B2V A;  2SDF A;  1I4Q A;  1TVX A;  4MHE A;  3A8K E;  4NP5 A;  3GO5 A;  4BY7 B;  4F7X A;  1JOQ A;  5A2Q L;  1Y8P B;  4B08 A;  4FVM A;  4RAU C;  1SJE D;  3QOL A;  2K5W A;  1JC7 A;  4BBS B;  1A15 A;  4PNY A;  4MN3 A;  2KHS A;  1OXS C;  4OO1 G;  3V05 A;  1QB5 D;  2AUK A;  3I70 A;  1EYC A;  1ZYR C;  1E2V A;  2Q8R E;  3TSS A;  4EGV A;  2F4I A;  2IPK D;  2MUY A;  2F0L A;  2RDH A;  2B2Y C;  1TQO A;  3HOW B;  2O2L D;  5IOD A;  1JWS D;  1CM9 A;  2JYO A;  1Y8N B;  4Q5V A;  5KND A;  1KAA A;  2RQX A;  2F0T A;  3IFT A;  3NBI A;  1SYD A;  1D5M C;  4RHR A;  3GTP B;  5C0X G;  3K5L A;  5D3D A;  5KNC A;  1SBB B;  3H3V C;  3A8J E;  4K5V A;  4KKT A;  2XVS A;  4C3I B;  1ZKO A;  5G3L F;  4M8A A;  1IW7 C;  3PV0 A;  1QCB D;  1X3P A;  2SNS A;  1D6E C;  1PTO B;  4EQP A;  3Q24 A;  5C0X J;  3EVQ A;  1NUC A;  4HAE A;  2HCC A;  2WB1 B;  1U4M A;  1ZXT A;  3Q22 A;  1T5X D;  1VDZ A;  2ZT9 C;  3MWY W;  1STH A;  3PUX A;  4KI0 A;  4DGZ A;  4FF3 A;  1SYB A;  4DA2 A;  1DM0 B;  3ITP A;  4KKS A;  2JA6 B;  2PQE A;  1EY4 A;  1LTB D;  1SMY C;  4J1M A;  1MI2 A;  2F3W A;  1PRT B;  4HSV A;  4BA2 I;  4HED A;  3C2P A;  1IKM A;  3P1H A;  5KEE A;  4X3T A;  5IGF A;  1JOR A;  1JOK A;  4U67 3;  2F0P A;  1WTV A;  5DAU A;  3Q0A A;  4IAL A;  3HRZ C;  4TRD A;  2L0C A;  4FF1 A;  1C48 A;  1EFI D;  1EIH A;  2ZXR A;  2F0M A;  1SE3 A;  5IGG A;  5JPM C;  1I4P A;  1HFN A;  4FXD A;  2PZU A;  1LLR D;  1STB A;  3AMU A;  2QF7 A;  1EY6 A;  4TQU S;  2K6A A;  2I46 A;  3L9A X;  4G4K A;  3S9W A;  2VB3 X;  1PTO C;  1AN8 A;  1LT5 D;  4CJ0 B;  5EJW A;  1KDB A;  1I6V C;  2NVX B;  4Z9C B;  1GXD C;  1K83 B;  3MTS A;  3FDT A;  3E5S A;  3BVG A;  5CV4 A;  2IX0 A;  1Q3L A;  1XXG A;  1U9R A;  1GUG A;  3QIA A;  2CVR A;  2HQE A;  2EJG C;  2R92 B;  1WTR A;  3K6O A;  1PFM A;  3OSO A;  1II3 A;  1ET9 A;  1A3V A;  1PRT C;  1L0Y B;  4DNR B;  2VNU D;  4KY5 A;  4RFB A;  4PMB A;  2I07 B;  2JP1 A;  4CKB A;  2EY6 A;  1DJR D;  1CQV A;  4IZ8 A;  4N9P A;  1G2S A;  2G9D A;  4FP5 D;  3M4O B;  4H13 C;  5I9P A;  2RDG A;  3SR1 A;  1SNQ A;  1D2B A;  2A69 C;  2PW7 A;  1AZQ A;  3OW7 A;  3DEO A;  4UAI A;  1S5C D;  4IUV A;  3SK4 A;  1STY A;  5C3X A;  1AEX A;  2K5Q A;  4N9T A;  1WCM B;  2B8G A;  5HUR A;  3SK5 A;  2B2T C;  1LAB A;  2TMP A;  1GUW A;  3KBX A;  3D6C A;  3A56 A;  3GQB A;  4ILW A;  3G6J B;  5COR A;  1I4X A;  5JOB A;  1QIL A;  2F0W A;  1PLF A;  2R7Z B;  4G7Z C;  1I4G A;  1BCP D;  4L63 B;  2NUC A;  2B63 B;  1DXM A;  4K5W A;  4B9X A;  2L4N A;  5CV6 A;  1KLG D;  4UDU C;  1F2M A;  4KD4 A;  1JQY D;  4CHT B;  1TWH B;  3RLF A;  2GA4 B;  1PYW D;  3GTO B;  3K59 A;  4H0L C;  4KN7 C;  3FRP B;  5FOB B;  2ZXO A;  3BZD B;  3ERO A;  1SAP A;  1G29 1;  5CC4 A;  3KBG A;  2BCO A;  2CW0 D;  4TSS A;  4A93 B;  3TZD A;  5CR3 A;  3HOY B;  3AB9 A;  2NVY B;  5CYU A;  2E76 C;  2RKS A;  3R8B A;  1EU4 A;  1PFB A;  1SYC A;  2EDG A;  5I2Y A;  4A3D B;  4RGM A;  1Y1V B;  3OWF A;  2KCC A;  2Y0S B;  3S1M B;  1FD7 D;  3HOV B;  2EXZ A;  1J9O A;  4NDX A;  4IFD H;  1ENA A;  5IGC A;  2E2D C;  1EEI D;  1EYA A;  5C5M A;  2F0E A;  4DNT B;  5I6W A;  1JWM D;  3JAM L;  3C1F A;  4DK1 A;  2LMC B;  5DM7 3;  3PIP 3;  4ZUJ A;  2QCP X;  3ONA B;  1IYV A;  1D1I A;  2M9V A;  1O80 A;  1F77 A;  3MXN A;  3CU7 A;  2K5D A;  1GHJ A;  3ND8 A;  1CT1 D;  4QIW B;  1FNV A;  4PV1 C;  1HHV A;  1SYF A;  3S1Q B;  1PXU A;  2KJX A;  4E6I A;  1C8C A;  1TT2 A;  2WKC A;  4MIU A;  2BDO A;  2E2I B;  2O4X A;  2O5J C;  1NCV A;  4A3G B;  5ELD A;  1GUS A;  3K7A B;  2M2L A;  1EQT A;  3HGB A;  2H4O A;  4G7O C;  3TZU A;  1SND A;  1ICW A;  2VB2 X;  1RD9 D;  2K28 A;  4XQJ A;  3VA7 A;  1BXT A;  1H9K A;  5D3I B;  2F0Q A;  4A3F B;  2DY8 A;  2CQA A;  3MAQ A;  4RWS C;  2F0F A;  2D62 A;  1Y1W B;  3M4Y A;  2WIN B;  3DWA A;  2HDM A;  3DWP A;  3KK7 A;  1S5F D;  1VCI A;  2D5D A;  4KJO A;  2K33 A;  4K14 A;  3FPP A;  1B50 A;  1IHZ A;  1PTO F;  3IAY A;  3CRK C;  2Z4I A;  3SXH A;  4RGO S;  4ODG A;  5CV7 A;  3PUW A;  2MPM A;  4WFN 3;  2EYJ A;  1B53 A;  1LT6 D;  2N88 A;  2E2J B;  1BDO A;  1R9T B;  3PMF A;  2LS0 1;  3K57 A;  2KCN A;  3V2T A;  3NTK A;  3RZO B;  4R9W A;  4F8M A;  2D2C C;  5EPJ A;  3J7A F;  3N52 A;  2WII B;  1SDF A;  1PTO H;  3P75 A;  4HN7 A;  1RHP A;  3RUZ A;  1PZK D;  4K2K A;  3TME A;  4FXG C;  4RCN A;  3NWT A;  3I4L A;  2A6E D;  5K36 H;  2EZV A;  4C56 C;  1W6J A;  4YIJ A;  3J81 E;  2CHB D;  5C4Z A;  3OHX C;  1RTO A;  3M3Y B;  4HTH A;  5T1G A;  1DZ1 A;  1BOS A;  1U4R A;  2QEJ C;  3FVQ A;  1SNP A;  2J0T D;  1EQV A;  2E74 C;  3J80 L;  4BA1 I;  4IUN A;  4U68 A;  2F0U A;  1IL8 A;  2NBF A;  1HRJ A;  5IGE A;  3D4R A;  1H9R A;  3S17 B;  4ULL A;  3I8Z A;  3KUP A;  1CA6 A;  2PNR C;  3GTG B;  2LY7 A;  2NWG A;  2HCI A;  4LAA A;  2AWN A;  1ML0 D;  2JEB I;  1DYQ A;  1EOT A;  1XX8 A;  2VXW A;  3OMC A;  2NTS A;  4BS9 A;  1I3Q B;  1A6X A;  5FO9 B;  4A3E B;  2EYP A;  1MSG A;  1ZEQ X;  2KVM A;  4HCE A;  4OO1 I;  3MFG A;  2KED A;  2F0I A;  3EQL C;  2B2W C;  3VA5 A;  3ERQ A;  4K2L A;  4HR7 B;  3WOE A;  2FFK B;  2PCF B;  1E2Z A;  1Q1B A;  2R61 A;  1AZP A;  5C4H A;  2ZXP A;  4ZLT F;  4XQN A;  2KQ3 A;  3HOU B;  1KNE A;  4QUF A;  5JPN C;  2NVQ B;  3L7Z C;  4KHZ A;  4C3H B;  3K5M A;  4RHS A;  3D8G A;  2BOS A;  1Q8I A;  4O1N A;  3QJY A;  3F2U A;  1PMR A;  3C1E A;  5C0X I;  3TN2 A;  1H9S B;  1TS2 A;  2KUM A;  5I2X A;  1T5E A;  3BDC A;  3H09 A;  2F0G A;  5LHY 1;  5E4X A;  2JXM B;  2FMC A;  3M85 A;  2PMZ B;  3GTJ B;  3GTQ B;  3GTM B;  1EEF D;  5K5P A;  3HEJ A;  1F2L A;  2ID0 A;  1B2T A;  4EQN A;  4KMU C;  2NVT B;  1UEA B;  2XWJ B;  1STE A;  1CZG A;  4V19 0;  1NSN S;  3N6R A;  1CHQ D;  3URY A;  5NUC A;  5C4J B;  3FKI B;  1SJH D;  2IW3 A;  4ZAI A;  2EY1 A;  5EKL A;  5CV8 A;  1F2Y A;  2WV6 D;  1BF4 A;  2K04 A;  4ZKB B;  3I4M B;  5D14 A;  4IUP A;  4XQQ A;  1V1P A;  2BDN A;  1D5Z C;  3S1R B;  4R8N A;  1B1Z A;  4A3J B;  1BQQ T;  1S5E D;  1ESR A;  1LTI D;  2XWB B;  2KA7 A;  1A3U A;  5EKK A;  3QB3 A;  4RKB A;  3BYT B;  3HOX B;  1L0X B;  3VR3 A;  1BO0 A;  2B2U A;  3MEH A;  2F03 A;  3K58 A;  2KEE A;  4NMZ A;  1SNO A;  4Y7N B;  1F2Z A;  4V0B A;  1RDP D;  2B39 A;  5DM6 3;  1C4Q A;  2AQ1 B;  3A7A B;  2X6G A;  1I4H A;  1B44 D;  3BVZ A;  4DAP A;  3HP3 A;  3FMC A;  5G3L D;  1YNN D;  2EYO A;  1KTK A;  1BCP F;  3PO3 B;  4EVO A;  4S3S A;  4X3S A;  2B2V C;  1JB3 A;  2L55 A;  3LWE A;  4K8I A;  4FYD A;  1F9S A;  3CKI B;  3S2D B;  4IQZ A;  2NN6 I;  4X3K A;  5EBD A;  3CRL C;  2L9H A;  2WP8 J;  2A68 D;  3IL8 A;  1STN A;  1STG A;  2J4X A;  1CA5 A;  1UAP A;  2MP1 A;  2IX1 A;  1B4O A;  4IN3 A;  2XRS D;  5EPK A;  3CQZ B;  4IUU A;  3T56 B;  1YNJ D;  2C5C A;  1HTP A;  2JSO A;  1Y69 U;  5BN5 A;  1E0B A;  1PZJ D;  2F0V A;  1BBX C;  4DN4 M;  5CGK A;  4QUC A;  2QIL A;  1LTA D;  3P20 A;  3R93 A;  1JE4 A;  5ISR A;  1V8Q A;  1G2T A;  1FNU A;  1TS4 A;  1EY0 A;  1Q12 A;  4X3U A;  1S5B D;  3MXU A;  1KAB A;  5IT9 E;  4C1N K;  3HG9 A;  4L8J A;  2EOT A;  2IJ0 A;  2G9H D;  1JCK B;  3GP7 A;  3FEW X;  2F0S A;  5C5L A;  5C6A A;  2XN9 C;  3SDZ A;  1PDQ A;  4DF7 A;  3LWU A;  2MHV A;  4RA8 A;  4WOR A;  3S14 B;  1SE2 A;  2JA8 B;  3MC0 B;  4K8J A;  2PZW A;  1WD1 A;  5T1I A;  5JVG 3;  2NB0 A;  3QWN A;  1W6K A;  1F9Q A;  4A3K B;  2NTT A;  1B9M A;  3D4W A;  3K0Y A;  2JE6 I;  2YU9 B;  1A2U A;  1TWA B;  2L1B A;  2PW5 A;  3PUZ A;  2EYF A;  2MGS A;  4IUR A;  1GOZ A;  1QOH A;  5J22 A;  4KJN A;  4CKE A;  4HCS A;  3U9O A;  1CQF A;  4ZUI A;  5KNB A;  4IFD G;  3H91 A;  3C46 A;  4OHJ A;  1V43 A;  2B2U C;  3Q6S A;  3BS1 A;  1SFO B;  5HGT A;  1SSO A;  1QNK A;  3J7Y W;  1EYD A;  5E4W C;  2BE5 D;  1BCP B;  4Q0F A;  4A3B B;  2DNC A;  1TS3 A;  3VYT A;  4IFD J;  3TDQ A;  1CK1 A;  3H6M A;  4LK1 C;  2A6H D;  2EJM A;  1SNC A;  3OIQ A;  2PPB C;  3M7G A;  3DHQ A;  4QCL A;  5I9O A;  3GV3 A;  3HS0 C;  5A35 A;  4J6H A;  5E3F A;  3LNN A;  3NQT A;  4JK1 C;  2TSS A;  4ZK9 B;  5EGT A;  4ABN A;  2JA7 B;  4I65 A;  2B2Y A;  1GUN A;  2SNM A;  3KF8 A;  4EQO A;  1X32 A;  1SNM A;  1EY7 A;  2RSO A;  4WJW A;  1OXU A;  2ICI A;  3R2I A;  1ZYR D;  4GZY C;  5FLX E;  2AQ3 B;  1OXV A;  3MZ5 A;  5M3M B;  5JVH 3;  4HMJ A;  1X3Q A;  5A2Q E;  1EY8 A;  1UUP A;  4PMC A;  5E1F A;  4RH6 A;  2IX3 A;  2FMM A;  1LV9 A;  3NXW A;  4KY6 A;  4FF2 A;  1RJT A;  3OOC A;  4CKC A;  4IUT A;  1BCP C;  2R6G A;  2Z8L A;  1EY9 A;  4RGT A;  1EZ6 A;  1MD2 D;  2BA1 A;  3TP5 A;  1K8O A;  1ILP A;  3H0G B;  3PUY A;  4C3H G;  1DOL A;  2RVL A;  4K6L A;  1O78 A;  1IW7 D;  1WTO A;  3FPU B;  4C3I G;  4A3M B;  5DNF A;  1SYG A;  2EYL A;  2A74 C;  3S2H B;  1DD2 A;  1XTC D;  3VR4 A;  2F0H A;  4ZYS A;  2PO4 A;  1WTX A;  3PIO 3;  1AFP A;  3BDO A;  2EPB A;  3DUZ A;  2CW0 C;  3A7L A;  1HPC A;  4A3I B;  2IT1 A;  5K36 G;  3EA6 A;  5IGB A;  3TP6 A;  5J1Z A;  1CHP D;  4P2C B;  1SMY D;  5KRU A;  2K03 A;  1DOM A;  3VR6 A;  5CV5 A;  3SE0 A;  4XYQ A;  1DCZ A;  2F1M A;  3T53 B;  4JBW A;  1LO5 D;  3EFX D;  1HQR D;  3HZX A;  1BNZ A;  3D4D A;  3L3O C;  2F0D A;  3BVM A;  5JEA H;  1EWC A;  2F0N A;  2DNE A;  5I6Y A;  2EVB A;  3E6Z X;  1I6H B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...